2DL5A

Solution structure of the first sh3 domain of human kiaa0769 protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
78
structure length
78
Chain Sequence
b'GSSGSSGTLRNYPLTCKVVYSYKASQPDELTIEEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0769 protein
publication title Solution structure of the first SH3 domain of human KIAA0769 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 4
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl5A00
2KRNA 1GRIA 3M0QA 3NHNA 1MUZA 2ESWA 1K4US 1X27A 2DYBA 2CDTA 3VRZA 4Z88A 1WXBA 2DA9A 2JTEA 1NYGA 1VA7A 4AG1C 3EG1A 3I5SA 2KXDA 2RPNA 2HEQA 3H0IA 2W0ZA 1J3TA 1SPKA 2NWMA 1LCKA 1YP5A 1GCQC 1BU1A 1QKXA 1PNJA 1GCQA 1JU5C 2EVRA 1UGVA 2DF6A 3R6NA 1SHGA 2FO0A 1B07A 2CSIA 3TSZA 4D8KA 1QKWA 2D0NA 2K3BA 2DL5A 1X2KA 4JJCA 1HSQA 2AZSA 2J6OA 3PE0A 1A0NB 1PHTA 1ZSGA 2EYWA 1PRLC 2LJ0A 1SRMA 5IHNA 2LJ3A 1NG2A 2CSQA 2HDAA 2DILA 1FYNA 2DE0X 1U3OA 1AWJA 2JM8A 2DL4A 4RTZA 4WCIA 2CT4A 2O9SA 3EG0A 1QWEA 2BZYA 2JXBA 4J9EA 1UECA 1I0CA 2YUNA 2JMAA 4M4ZA 3I5RA 1I1JA 2JS2A 1KFZA 1WX6A 3FJ5A 4OMLA 5EC7A 2KRMA 2LJ1A 4J9GA 1H8KA 1Z9ZA 2FPFA 4RTWA 1GFDA 2EGEA 2YUQA 4QT7A 2E5KA 2JM9A 1E7OA 2FRWA 1SSHA 2RQVA 2DM1A 3SEMA 2A37A 2GNCA 1B3QA 3IQLA 4OMOA 2C0OA 4CC4B 4LN2A 1RUWA 3ULRB 2FRYA 2KEAA 2ROTA 2B86A 2C0IA 4X1VA 5IHIA 2KRSA 2IIMA 1W70A 2DL7A 5GJVB 1AOJA 3A98A 2X3WD 1X69A 4LE9A 3VS3A 2KYMA 3SHWA 2EPDA 1WXTA 4HXJA 4J9FA 1WIEA 2L0AA 1NEBA 2ENMA 3EG2A 2JS0A 1UJ0A 4IIOA 3UA7A 1AD5A 2KNBB 1H92A 3CQTA 2D8JA 1VYUA 1MV3A 4RUGA 1X43A 2H8HA 3NGPA 1S1NA 2YUOA 1UHCA 1E6HA 2ED0A 1T3SA 1XOVA 2LNHB 2K6DA 1AWWA 1I07A 2PNIA 4AFQC 2DLPA 1TUCA 2P4RA 4A63B 1JO8A 1IO6A 1GL5A 3EHQA 3QWXX 1M3AA 3I35A 4OMQA 1PRMC 2VWFA 1AZGB 2K79A 2CUBA 1K76A 4RTXA 2F2XA 2KGTA 2CH4W 4K11A 2DL3A 1ZUYA 1PWTA 2XMFA 2LQWA 1QWFA 1NEGA 1PKTA 1T0HA 2DRMA 4JJDA 2HSPA 1ZLMA 2DL8A 2YDLA 2SRCA 1AWXA 5I11A 4HCKA 1KSWA 2GQIA 4HVVA 1OEBA 1V1CA 2L3SA 1M30A 2ROLA 2J05A 2YT6A 1AEYA 1YWOA 2I0NA 3M0UA 2KR3A 2D1XA 1ZUKA 2QDLA 2OJ2A 2O2OA 4E6RA 2FG0A 2MOXA 3VS2A 2C0TA 4AFUC 2OI3A 1K0SA 1BB9A 4GBQA 4AFZC 4Z8AA 4RTTA 2LMJA 3RNJA 3RBBB 2EKHA 2W10A 1SHFA 2GTJA 1CKAA 3M0PA 2AK5A 1RLPC 2AKLA 2L2PA 1AZEA 1YNZA 2RQTA 3UATA 1U5SA 2ED1A 2K2MA 1X6BA 1VYTA 3H0FA 4CC2A 1TG0A 1OPKA 2KE9A 1GFCA 2KROA 1UUEA 2EYYA 2DJQA 1UG1A 2X3XD 5I22A 2L3PA 2LCSA 2BZ8A 3PVQA 2EGCA 2VKNA 1Y57A 1ZUUA 3VS4A 4ZNXA 2HCKA 4JZ3A 1BBZA 2A28A 4Y92A 3TVTA 4RTVA 4FSSA 4F14A 4JPBW 2RMOA 1QCFA 1SEMA 1Y0MA 3EG3A 2YSQA 2OAWA 3M0SA 5L23A 1G83A 2PTKA 1M27C 4HVWA 1M3CA 5FW9A 5ECAA 3EGUA 1U06A 1WA7A 2O9VA 4LUDA 1FMKA 2LZ6B 4OMMA 1SRLA 3GBQA 1VYVA 1ZBJA 2DVJA 2D8HA 3VS0A 4LUEA 3ZL7C 1OV3A 4AG2C 1AWOA 1Z9QA 2RQWA 2F2WA 1ABOA 2KT8A 1WLPB 1UJYA 2SEMA 3KFVA 5HCKA 2EGAA 2V1RA 4LNPA 1W6XA 1GCPA 2KBTA 1WI7A 1UTIA 2EBPA 2GTOA 2MCNA 2A08A 2O88A 3THKA 1N5ZA 1PKSA 3JV3A 1ABQA 2FPDA 1ARKA 1CKBA 2EW3A 1WYXA 2EYXA 1M3BA 2RNAA 2J7IA 3M0RA 1TUDA 4CC3A 2DMOA 2O31A 4R0KA 3M0TA 4Z89A 4RTUA 1NM7A 2FEIA 3I9QA 2BTTA 1JQQA 1WXUA 1K9AA 4RTYA 1JEGA 3O5ZA 1K0XA 1QLYA 2PZ1A 3VS1A 3NPFA 2RF0A 2DX1A 1BK2A 2GBQA 1EFNA 4AFSC 4F16A 1JXOA 5IH2A 1GBQA 2YUPA 3EHRA 3PVLA 2DBMA 1HD3A 2A36A 1ZX6A 4IIMA 1RI9A 2ECZA 2J6KA 4OMNA 1M8MA 1JXMA 1W1FA 2M51A 3C0CA 2RN8A 1OOTA 2AKKA 2CT3A 2GGRA 2AZVA 4ORZA 2K7AA 2EYZA 4JZ4A 2EQIA 1RLQC 2CUDA 3REAB 1WDXA 3U23A 2JT4A 1CSKA 1X6GA 5FWCA 1KIKA 4J9DA 2KXCA 2J06A 3QWYA 2F2VA 1T3LA 2K9GA 4ESRA 1UE9A 2LX7A 2FPEA 3TSWA 5IHKA 3NMZC 2MIOA 2ABLA 2M0YA 5IXFA 1K1ZA 1GBRA 4GLMA 1KJWA 1T0JA 1E6GA 1YWPA 2J6FA 4OMPA 2JMCA 5FWBA 4EIKA 2G6FX 3VRYA 1UDLA 1YCSB 1NLOC 3VS5A 2RQUA 4DEYA 2DBKA 2RQRA 1X2QA 2HBWA 2NUZA 4J9BA 2LQNA 1NYFA 1UHFA 3VS7A 3REBB 2VVKA 5GJWB 1HJDA 4J9IA 1NLPC 3UA6A 2JW4A 3LH5A 4D8DA 1OPLA 2KYBA 1G2BA 2LP5A 4KRTA 3H41A 4F17A 2CREA 2DNUA 1YN8A 2DRKA 1H3HA 2L3QA 4HVUA 2KT1A 2CH4A 2V1QA 1MV0B 4JJBA 4CC7A 4DEXA 4J9CA 3VS6A 1AVZC 2BZXA 1UFFA 4J9HA 5IXBA 3UF4A 1WFWA 3H0HA
chains in the Genus database with same CATH superfamily
2H3JA 1M1FA 1MUZA 2MWPA 3KXTA 2DYBA 3VRZA 1D0ZA 4A4HA 1WXBA 2JTFA 4EMGA 3A8HB 2DXTA 1M90C 3SWNA 1VA7A 1BCOA 2QDYB 2RPNA 2X35A 1JJ2P 1LCKA 1FX7A 1BU1A 5FLXE 4M78A 2EVRA 1R8OB 4XU3A 4BI8B 5KH6A 2FO0A 4C92B 1KQSA 1X2KA 2AZSA 3JB9I 4C8QC 3PIPA 1PHTA 2JOYA 1ZQ1A 4OB3B 1PRLC 3CD6Q 5LJ3h 3RIRA 1OX9A 2CSQA 2HDAA 4ANJA 2JTMA 1XQHA 5GANh 2M1HA 4M7DG 5DM7R 4QQ6A 4F7UB 2JM8A 5KYWB 2DL4A 3MEVA 1YJWT 3CCRA 3EG0A 1QWEA 2XI9A 3MEUA 1Y07A 4J9EA 3QKJA 2DO3A 1KC8R 2YUNA 2MPXC 4C92A 2DPPB 3I5RA 4QQGA 1RAAB 2QI2A 3OYGA 2JNGA 4OMLA 3OW2P 4M75F 1WNLA 2JZ2A 1R0BG 3RMSA 3C12A 4KULA 1Z9ZA 1GFDA 2E5QA 2EGEA 3RESA 3JB9F 1E7OA 1WHJA 1WHGA 1KC8C 4F7UA 4PFOA 3X24B 3JB9H 4FW1A 2C0OA 2QEXQ 4M78D 1D1BA 4PFPA 3VU3C 3ULRB 1IHWA 3V8LA 4EPCA 5GMKm 4X1VA 1VQ4A 2DIGA 2DL7A 1AOJA 4M7DE 3INZA 3HP9A 2EJFA 5FU7C 3JCMX 4N4IA 4ME7A 2KYMA 3V7CA 4OF1A 2M16A 1U1TA 1OZ2A 2ATCB 1HK9A 2IG0A 2XICA 1NEBA 2ENMA 4N4GA 4XU0A 5GANd 2QG9B 1VQNT 3GOXA 2KNBB 3OA6A 3CQTA 4QQDA 3M56A 1X43A 3CXCA 2H8HA 1S1NA 2CP5A 1E6HA 2M9UA 1AWWA 2E41A 2RJCA 3JCMQ 4M75B 5KYXA 3CCSQ 4C92D 4PKCC 1PD0A 2D0QB 1IO6A 1XNIA 4OMQA 3PMTA 1AZGB 1Q95G 2XU8A 3M4YA 3M9QA 3F70A 1K76A 1PM3A 4FT4A 2CH4W 1D0YA 1WJRA 2VASA 4A4KA 3JCMP 2XMFA 2LQWA 4LDWA 5IN1A 1MHNA 1MMAA 1AWXA 4HCKA 2OTJA 1KSWA 3EGXB 2MYSA 1OEBA 1M30A 2I0NA 4M75A 2KR3A 2QDLA 3MEWA 1RAFB 2O2OA 5LJ3f 2MOXA 1RL2A 3VS2A 2C0TA 1N9RA 2OI3A 4C92G 1K0SA 5GANf 1KQSP 1BB9A 1UB4A 2VGMA 1VOMA 3GP8A 3CCRQ 3RNJA 1VQLA 2EKHA 4J5YA 2FHDA 2GTJA 1Q82U 1RLPC 2AKLA 2IPOB 1S72T 1VQ5T 1AZEA 4XU1A 1W2BP 3CC2A 2K2MA 1UGQB 2X4WA 1X6BA 1VYTA 3H0FA 2KE9A 2M0OA 3EGXA 4F7UG 3GNGA 3FJPA 2DJQA 1N8RR 1OYXA 5GAMe 2CP3A 2GFAA 2VKNA 5GAOq 1QW1A 1KD1U 1M8VA 3CCET 4M7DC 4Y92A 3CCQT 4RTVA 4IUVA 1BI2A 4F14A 4JPBW 4BY6C 3L2QA 1VQ4Q 1N8RC 4X34A 1M1KU 2F5TX 4JRIA 4C92E 4KGXB 2RJEA 2LT1A 2JN0A 5KYYB 3HRSA 2DYIA 1VQOT 4BD3A 1WA7A 2BUDA 4FSXA 1FMKA 2LZ6B 3HTRA 1SRLA 1ZBJA 4A4GA 2L8DA 2D8HA 1KG1A 3JCMf 2V8KA 3OS1A 3ZL7C 4M75D 1UEBA 3X25B 4CRIA 2NLUA 1AWOA 2BE7D 2K5LA 2KT8A 4ELYC 5A2QE 4F7UE 1VQ9T 3KFVA 3CPWP 1QVGP 5HCKA 1ZBXA 1NPPA 2EGAA 3SD4A 3JB9D 3HRTA 4LNPA 4N4HA 2EBPA 2GTOA 4LDUA 1Y96A 4HCBA 1N5ZA 4NS5A 5KYYA 1PKSA 5DLQE 2E3IA 1ABQA 2FPDA 3RKYA 3UT1A 4E2FB 1YJ9A 4OGEA 3CXCP 4M7AB 1M3BA 3CMEA 1TUDA 1X01A 2LC4A 4R0KA 3BFMA 3E1SA 2FEIA 3I9QA 4BE2A 3FC3A 1YITA 4M75G 3SWNC 1WXUA 1O9SA 1JEGA 2LQKA 1QLYA 2OTJQ 1LJOA 1OZ3A 4PLIA 4Z02A 4XTXA 4QVCA 2LT4A 3V7SA 2MAMA 2HQXA 2G3RA 2DFUA 3JB9G 1EFNA 3MHXA 4J7FA 1QVFS 1JXOA 2QQRA 1FXXA 3MEAA 3TU4K 2RK1A 2P84A 1VQLQ 5I21A 1W1FA 4UC4A 3JCMW 3KUFA 2QK0A 3GPLA 2GGRA 4Y28E 2LDMA 3CC2Q 3V7RA 3VUZA 1WGSA 4PJOF 1X6GA 4J9DA 5A0DA 3VYHB 3G4SA 2RHYA 2FPEA 3G71Q 2LNVA 2HAXA 2MIOA 1QVFA 4XU2A 2M0YA 4M75E 2FVUA 3I55T 3OMGA 2EQKA 1GBRA 2DIQA 2DXCA 2B8AA 4C92C 5GMKl 2BIVA 2QQSA 1E6GA 2OX7A 3NTIA 5KYNA 2FZCB 2JMCA 5FWBA 4FU6A 5KCOA 2COZA 2DZ9A 5GMKj 2G6FX 1JB0E 2EFIA 3RDVA 4XAXB 4OB0B 3VS5A 3EG9B 2VXFA 2L5QA 2DBKA 4J6WA 1WQWA 4C5EA 2COYA 3QJYA 1I5OB 1YI2Q 1UHFA 3LGLA 1MNEA 2PVGB 2VVKA 1HJDA 1Q86R 1HXDA 2JW4A 2X9HA 4D8DA 3UDCA 1G2BA 4NL2A 2HSEB 4A54A 3AHUA 2EKOA 3OS5A 3URGA 2CH4A 3OYAA 3HHTB 4JJNK 4DEXA 1RAEB 2FYKA 1JBMA 3EG9A 4IKFA 2HD0A 4YTLA 1WQ7A 1YJ9Q 3HFNA 2P0PA 3UF4A 3CMEQ 4M77F 3QJ6A 3QIIA 2ESWA 2YXYA 1K4US 1X27A 3OSSC 1XTDA 1VIEA 2XKOC 3NFCA 1YITQ 2XDPA 5IAYA 4LDVA 3E9FA 5M9OA 4B9XA 3I5SA 4M7AG 2P4TA 4PJOA 1SPKA 1M2VB 1QKXA 1PNJA 1GCQA 4A4EA 2PUKB 3TQ7P 1B07A 1GXIE 2NUTA 1G5VA 3SB2A 3JCMJ 3ZEHA 2K3BA 2DL5A 4ZTJA 4JJCA 2RA2A 3LWHA 3PE0A 1A0NB 5GANg 3CMAT 1VQMA 4AT1B 4LD9K 4M75C 2LJ0A 5GAMh 3CD6A 1K73C 3UWNA 1AWJA 1VQPT 1M2VA 1WHMA 1VQ8A 4WCIA 4XTUA 2LX9A 2WSEE 2BZYA 2JXBA 3CPFA 2GFUA 1U1SA 2LTOA 2JMAA 4M4ZA 4M7AE 2JS2A 1KFZA 1WX6A 3QZ5B 1BYMA 5EC7A 4J9GA 1H8KA 2FPFA 1OU9A 1MMNA 3QUIA 2AT1B 3TEEA 2O4XB 1Q7YU 1VQ6T 1WPYA 4N0AA 2E5KA 2JM9A 3CBOA 2K3YA 2NUPB 2RQVA 3G1JA 1OQKA 3VV0A 4JDSA 4PJOD 3SEMA 3SFMA 2QEXA 2FRYA 3H8ZA 2KEAA 2C0IA 2KRSA 2IIMA 3S3OA 1W70A 2HNIA 5HK0A 5LJ5e 1X69A 1YJNA 2PVDB 3LX7A 2EPDA 1IREB 5GAMd 4M78B 3V8JA 1TXQA 5LJ3j 1ACMB 2O4XA 2DJZA 5CKDA 3EG2A 3QDRB 3L2UA 4IIOA 3UA7A 5GANj 2NUPA 1H92A 2QA4A 1MV3A 3NGPA 2A7YA 2YUOA 1UHCA 2YLBA 2ED0A 3G6ET 1LVKA 4PJOG 1YIJQ 2DLPA 1JO8A 3CCSA 3EH2A 3QWXX 3I35A 2K79A 1R0CB 2HL3A 3A8GB 2OTLT 2DL3A 1PWTA 5CO7A 3G4ST 1T0HA 1PKTA 4JJDA 3EFRA 2GF7A 1BKBA 4J7IA 3VKIA 1WZOA 2DETA 2DL8A 1W2BS 4ZN3A 2RHUA 2GQIA 2KY9A 1V1CA 1VQMQ 2L3SA 3GNFB 2YT6A 1KHIA 1QQJA 2KAFA 1D09B 1HYOA 1AEYA 1YWOA 2D1XA 1I5LA 5GAMf 4DA4A 1O75A 4E6RA 2E12A 1KHCA 3C95A 5L8RE 1K8AU 4M7AC 2K5FA 4AFZC 3CC7T 1VQ8Q 4PJOE 4RTTA 2LMJA 3C4SA 3OYEA 1CKAA 2KVQG 3M0PA 3CCVA 2HQEA 4CC2A 3CC4T 1OPKA 1GFCA 2KROA 2EYYA 4DBRA 2ZPIB 4KUDK 2YHTA 3JCMc 1UG1A 1Q82R 4GY5A 2L3PA 2QQAA 2BZ8A 3P8HA 1U8RA 1WHHA 3CCJA 1Y57A 1ZUUA 1VQ7Q 4ZNXA 4JZ3A 1BBZA 2A28A 3BW1A 1KQ1A 4DBFA 3CPWS 1QVGS 3C94A 5KE2A 1G3TA 2CZ6B 2CYZB 1QCFA 1Y0MA 1Q82C 2QTXA 2OAWA 5L23A 2AIRB 1H3ZA 5KYXB 2C06A 1YJNQ 2VXEA 4RG8A 3EGDA 4RG2A 1VQKT 3O8VA 3OBWA 2EQUA 3VS0A 4LUEA 1M90U 3CBPA 2RQWA 3BE3A 4OP0A 4KGVB 2F2WA 1ABOA 2QA4Q 1UJYA 2MK5A 1N9SA 1YHQA 3CCUA 4J6YA 4PFZA 5GAN5 3M4GA 2V8JA 1D1AA 3QZ9B 2V1RA 1PD1A 4WTOB 5GAN4 2XDDA 1WI7A 4M78G 2A08A 1NZ9A 2O88A 5CKEA 1NE8A 1PC0A 3JV3A 3I56A 1ARKA 2EW3A 2M02A 1UGPB 2FZGB 3OYFA 3M0TA 5CQXA 4Z89A 3OYCA 2ZPEB 1PSFA 4ZTFA 4MMLA 3OYDA 1TS9A 5KYUB 4KBMB 1WHLA 4RTYA 1LPLA 2RJDA 1PSEA 4PJJA 4NOYA 2ZZDA 3E2UA 2E10A 5GAOm 3NPFA 4OMFB 2GBQA 4JRPA 3J80E 4LXCA 4AFSC 4P5NA 2RH2A 4XQ3A 2HMAA 4L5GA 5DY9A 4IIMA 2MI6A 4OMNA 4F04B 2E4HA 2M51A 4E7HA 3V8KA 2VUBA 4KH1B 4M78E 4LDXA 4ORZA 5LL6S 2K7AA 3PMIA 2CUDA 3LH0A 5KYUA 3X20B 3REAB 1WDXA 3CCVQ 1PG5B 3U23A 2JT4A 1KIKA 2Y4XA 1EZZB 3QWYA 1QP3A 4FYVB 1UGSB 4ESRA 1UE9A 2LX7A 5IHKA 2QEXT 1SF9A 2ABLA 3G71A 2VGNA 3CCJQ 5KCHA 2KDSA 3JAME 1MNDA 5A0LA 4HCCA 4GLMA 3OYJA 3L42A 3FEOA 2QQBA 1KJWA 3VJPA 4C8QF 2MMPA 3OYHA 5J39A 4J83A 2JVVA 4FW2A 4ATOA 3VRYA 4E7ZA 1UDLA 3LLRA 5LJ5h 1YCSB 1NLOC 1Y96B 2WSCE 3A8LB 3CCLA 2E3HA 3VYGA 5KE3A 4ZGEB 2NUZA 3PFSA 3VS7A 2CS7A 1YI2A 1BI0A 3TREA 2E6ZA 1OPLA 2LP5A 2E6NA 4AMCA 3I55Q 1M4ZA 3H41A 1YHQQ 3CCUQ 2DRKA 5J26A 3EH1A 2HBPA 3JCMb 2QGFB 2QASA 3OYNA 4CC7A 2YRDA 2LCCA 2EJ9A 1N6AA 1VUBA 3L2WA 4J9CA 4MZTA 3I56Q 3OYLA 1V76A 1VIFA 3OMCA 1FMVA 1RAHB 4J9HA 3H0HA 2IVWA 2KRNA 3M0QA 2DEQA 3NHNA 2K2VA 3OBYA 3JRZA 2F1LA 1DJ7B 4FIBA 4BDYA 4O5VA 3OYIA 2JTEA 1NYGA 5CCAA 1TTHB 2KXDA 4QW2A 2E65A 3H0IA 5LJ5d 2W0ZA 3CCRT 2NWMA 2VV5A 1YP5A 4BACA 3QXEB 4M78C 2YWWA 1JU5C 2ZPGB 1UGVA 4XK8E 4C5HA 2QTVA 2DXUA 3R6NA 1SHGA 2COWA 4L59A 3RKXA 4RKUE 4D8KA 1YBYA 2D0NA 2P0QA 2AHJB 1OX8A 5GAMg 2PU9B 3CCMQ 4C8QA 5GAOn 2H3EB 2CZ0B 4R56A 1C1AA 4XTZA 1SRMA 5IHNA 1NG2A 4LDYA 2DILA 2DE0X 1U3OA 2CP0A 3PNWC 1C0MA 2RJFA 1QCNA 5IT9E 3DB3A 1NJIU 1TU0B 2CT4A 1K9MU 5AYFA 1VQ4T 2K3XA 1N8RU 7AT1B 2QYZA 4MZMA 1BIBA 3OQ5A 1I1JA 3LGFA 4Y91A 3FJ5A 5CAIA 4ZGDB 1TSFA 2LJ1A 1RADB 3CCLQ 1M2OA 3CMAQ 2PQWA 3Q1JA 4HCZA 4BI3A 2QGGA 4OVAA 3HFOA 1BCMA 2E70A 1MMGA 2A37A 1G3YA 4OMOA 4RMOA 2R5AA 4E7LA 1RUWA 1Q7YR 2KK4A 1N27A 1YJWA 2ROTA 1YFNA 2B86A 3M59A 1JRIA 4OB2B 1RACB 4E7KA 5GAN6 1LOJA 4LE9A 3AT1B 4XTWA 2DD5A 1BIAA 3RR6A 3VS3A 1IB8A 3SHWA 4PJOB 1SG5A 1WXTA 4HXJA 4C8QD 1JJ2S 1Q86C 1WIEA 5GAMj 4M7DF 2L0AA 2XG8D 3DLMA 1G8XA 3NTHA 2EQMA 3VUBA 3WVDB 3GF5A 1OULA 2JS0A 1UJ0A 1Q7YC 4KH0B 3M58A 3T9NA 2OTJT 2NUTB 4HKEA 4C0GA 3OYYA 4IUPA 5GAOl 1YCYA 4XTVA 1T3SA 2LNHB 2K6DA 4FYYB 3X26B 1TUGB 2DVEA 1TOVA 5GMKi 4E7JA 2PNIA 2P4RA 1YIJA 4A63B 1VQLT 1GL5A 3JCMe 1PRMC 2ZAEA 4EDUA 3A1PA 2CUBA 1RI0A 1AHJB 3CC2T 2R5MA 2F2XA 4C8QG 1D3BB 2KGTA 2L89A 2O01E 4K11A 1ZUYA 2DRMA 2DTOA 2HSPA 2R58A 4C5IA 5GAN2 2LQ8A 1VQNA 5I11A 3FLGA 4PL6A 5J3BA 4IUTA 3OW2S 4GLKA 2XD0A 3M0UA 3N5BB 3J81E 1ZUKA 2FL7A 2FG0A 4AFUC 4DOWA 2MF2A 2BE9B 4II1A 3S3MA 1D1CA 2DTIA 2RHXA 4L6V5 4EMKB 2HL5C 3E9GA 1D3BA 3LW5E 2PUOB 4M77B 3HPWA 2AK5A 1Q81U 1I4K1 1YNZA 2RQTA 1U5SA 1Y71A 1IZ6A 1TG0A 1YI2T 4FL6A 1QVFP 2X3XD 5I22A 1WHKA 3M55A 2F5KA 3PVQA 2EGCA 5HKCA 3GLXA 1W4SA 2WACA 3VS4A 1P92A 3MPUB 1VQ7A 5GAN8 3MP1A 2I2LA 3TVTA 5CIUA 4EMHA 2RHIA 4EMKA 2V8IA 4CI0C 1OI1A 4PJLA 4FSSA 1YJWQ 3QPHA 4M77A 1KK7A 1SEMA 4RCBA 1YJ9T 2EAYA 2LVMA 1EIFA 3M0SA 1G83A 1M27C 1VQ5A 5FW9A 4OB1B 5ECAA 3CMET 1U06A 2O9VA 4LUDA 3DKMA 2DEUA 1VYVA 2DVJA 2NYSA 4C92F 1YITT 3MP8A 1OV3A 4AG2C 1Z9QA 2D9TA 2CGHA 5GAN7 3D7SB 3CCQA 1W6XA 1GCPA 3J7AF 1UTIA 1Y7XA 2MCNA 5D6XA 3THKA 5HK3A 1CKBA 1G3SA 1WYXA 2EYXA 2RNAA 5GAOr 2RD1A 1VQOA 3S3NA 3WVEB 2O31A 1X75C 1KQSS 4RTUA 1VQKQ 1NM7A 2DZCA 5CKFA 2CZ7B 1K9AA 3S6WA 2L3RA 1VQNQ 3O5ZA 1K73U 2K4YA 4M7DD 3VS1A 4IUUA 1VQ9A 2DX1A 2RO0A 3M53A 4M77D 4KGZB 4DBQA 5IH2A 1GBQA 2YUPA 3EHRA 1XJWB 2CP2A 2A36A 3QHSA 1RI9A 2YRCA 2ECZA 2HKQB 1JXMA 1TH7A 4VUBA 4Q5WA 1ZHIA 2EYZA 2EQIA 5FWCA 1W2BA 4C0DB 3KBGA 2XK0A 2K9GA 3EGDB 3R6OA 3QYHB 3TSWA 3JB9J 2KI7A 4M77G 3MJXA 2KQWA 2VB6A 3ME9A 5LJ5g 2OAUA 1T0JA 1YWPA 2P0KA 4OMPA 2K57A 5FU6B 3PGGA 3L2VA 4EIKA 1KD1R 1VQ5Q 1S72Q 1MMDA 2X4XA 2RQRA 2HBWA 4J9BA 3REBB 1WJQA 2XIDA 5KYWA 5GJWB 3P8BB 3CXCS 4E7IA 1IXDA 3NTKA 2RM4A 2DKGA 2FZKB 1M1KR 1QMCA 4C0FA 2Y90A 3M54A 1YIJT 2D6FA 4BUGA 2CREA 3I55A 1KD1C 4JRKA 2DERA 2YRVA 3CCEQ 1H3HA 2L3QA 2PVOB 4HVUA 1PCXA 4MDXA 3CCQQ 2KT1A 3H6ZA 3CPWA 1QVGA 2V1QA 1MV0B 4JJBA 4M77E 1RABB 5LJ3d 2GQVA 3JCMh 4DBHA 3G7ZA 1M1KC 3VS6A 2BZXA 3L1AA 4E7SA 4R55A 1WFWA 1VQOQ 1GRIA 2EYQA 4PJNA 2CP7A 3DLLA 1VQMT 4DQ2A 2CDTA 1M9SA 2ZGWA 4Z88A 2X4YA 4LD6A 2DA9A 3UPUA 3CD6T 4HT8A 5CKHA 3QG1A 4D6WA 4AG1C 3EG1A 3EFOB 1VQ9Q 3ZBDA 1VQ8T 2HEQA 3OS0A 4PJOC 4PNOA 1J3TA 4FYWB 4FT2A 5LJ5j 1GCQC 3FB9A 2DF6A 2V26A 2XHCA 1BI3A 2CSIA 5C6SA 3TSZA 2EQJA 1QKWA 5GMKe 3EAEA 3RKWA 4MMKA 1HSQA 1F1BB 2J6OA 4BI4A 3CCMA 1ZSGA 2EYWA 5D7UA 5FRNA 1VQ7T 4PLLA 4JUVA 2LJ3A 3EFOA 1KC8U 1FYNA 4O6JA 2DK3A 3JCMd 4RTZA 4A53A 2O9SA 2ZPBB 5CVIA 1MGQA 5I2MA 1UECA 5HY6A 4MDWA 1I0CA 2RHZA 3HSBA 3QBYA 1M1GA 1YJNT 3META 2RK2A 1NJIR 3OS2A 3FRNA 2KRMA 1K9MR 2KMTA 4ZN1A 2RB6A 4RTWA 4M7AF 3CMAA 2YUQA 4QT7A 4N0AC 2QA4T 2FRWA 1SSHA 1ZSZB 3A8MB 2DM1A 4EMKC 2GNCA 1B3QA 3IQLA 4CC4B 1VQPA 2QAZA 1NJIC 2BKDN 4M77C 4LN2A 1K9MC 5IHIA 3ER0A 3CCST 3CBMA 1WJSA 5GJVB 5CR2A 3OYKA 3A98A 3FIFA 2X3WD 3MCAB 5GAN3 2DTHA 4J9FA 3HL8A 3FDRA 4NL3A 4B6MA 5FROA 3LWIA 2VYTA 1AD5A 1ZSZA 4WF2A 1B7TA 3GIBA 3TCJA 2D8JA 1VYUA 1VQ6A 4RUGA 1ZA1B 2MWOA 2LRQA 1XOVA 2X51A 4BDZA 3MKDA 1G3WA 4C8QB 2E1HA 1I07A 4TVRA 4AFQC 4IUQA 2QQ9A 4BE1A 1TUCA 3EFSA 3M57A 4V2SA 3HKSA 3EHQA 1OU8A 1M3AA 4FYXB 2VWFA 2DXBA 2Y4YA 4ELZC 1IRXA 4RTXA 3ASKA 4KT0E 3CCVT 4BE0A 3BY7A 1QWFA 1NEGA 3PT9A 8AT1B 1ZA2B 3X28B 2DAQA 4KUIA 1ZLMA 2YDLA 3QSUA 2SRCA 4B9WA 1LNXA 4HVVA 4X9CA 1KQ2A 2ROLA 2J05A 3CCJT 2CZ1B 3BDUA 3G6EA 2OJ2A 4HA8A 4M7AA 4GBQA 2ZPHB 4Z8AA 4JLGA 4JRQA 3RBBB 2W10A 1SHFA 3JSCA 4X9DA 4A4FA 2L2PA 3UATA 2ED1A 2OTLA 1IGQA 2RI2A 2X4JA 5FU7B 3MP6A 1UUEA 4IURA 5LJ3e 2ZPFB 5LJ5f 1Q81R 2LCSA 4XTYA 1I8FA 2LCLA 3QO3A 5GANe 1YHQT 3CCUT 1RAIB 4JS5A 2EWNA 2HCKA 3HRUA 2DD4A 4FM4B 1SKUB 1VQPQ 1TWBA 3CC7A 3OSVA 3DB4A 2RMOA 4RCCA 3EG3A 2YSQA 3I56T 4JS4A 1Q81C 3QDFA 1M5Q1 5AT1B 4C0DC 2PTKA 4HVWA 1M3CA 3LYIA 5EG2A 3EGUA 1UGRB 2EJGA 5CKBA 4OMMA 3PIOA 3CC4A 3GBQA 3A8OB 3OY9A 2RI5A 1IHVA 3QYGB 2ZCFB 1VQ6Q 1WLPB 2CKKA 2SEMA 4M7AD 6AT1B 4OGCA 5FU6C 4DOVA 2HQHA 4C0ZA 1QVPA 2KBTA 4QVZA 1C6VX 4PK4A 2A3LA 2J7IA 3M0RA 1QP2A 5GAOp 2KSSA 4CC3A 3CCMT 2DMOA 1JJ2A 1H641 1VQKA 2YLCA 4C5GA 2VC8A 1RAGB 5GMKh 2BTTA 2A0FB 1JQQA 3RMQA 2GCXA 2HZYA 4JLIA 1K0XA 5FRMA 2QXFA 2PZ1A 1BI1A 3G71T 2F69A 2RF0A 1IGUA 1R77A 3G6EQ 1BK2A 4F16A 4HT9A 3PVLA 4QVDA 2DBMA 1HD3A 1K73R 1ZX6A 3OYMA 3L2RA 2J6KA 3RUXA 1M8MA 4M7DB 2Z0WA 5CQYA 3C0CA 2RN8A 1OOTA 2AKKA 2CT3A 5LJ3g 2AZVA 3RERA 2JUFA 9ATCB 3CCLT 3H9NA 4JZ4A 4BY6B 1B34B 1RLQC 2OTLQ 3BDLA 3A5ZB 1K8AR 1CSKA 2KXCA 2J06A 3G4SQ 1NBEB 4E47A 4M78F 2F2VA 1T3LA 4BB7A 2K5IA 1D0XA 3OW2A 2FB7A 4C8QE 2HKNA 5CK9A 3NMZC 3CEYA 3L2ZA 4FCYA 1V29B 3M5AA 1FWZA 5IXFA 4ZGJB 1K1ZA 3WXMB 2XDBA 2CP6A 3ZFJA 4M7DA 1K8AC 5D6YA 2J6FA 3CC7Q 1X6OA 2JJ9A 2RI3A 3E19A 5D6WA 1B34A 1Q86U 3JCMV 1NPRA 2RQUA 4DEYA 1EX4A 8ATCB 1S72A 1X2QA 5A0GA 2LQNA 1NYFA 3CC4Q 4J9IA 2R57A 1NLPC 3UA6A 3LH5A 2WSFE 3PTAA 2KYBA 4KRTA 4J8OA 4F17A 2DNUA 4PJMA 1YN8A 3SWNB 1FMWA 4MZPA 5DLOA 1QCOA 3JCMg 3SDZA 3CCEA 3OB9A 2EIFA 4J6XA 5C0MA 5I2SA 1AT1B 1M90R 1I81A 1SSFA 3OYBA 4F7UF 3P8DA 4QKUA 1AVZC 1ZSZC 1UFFA 5IXBA 2E64A 3MO8A
chains in the Genus database with same CATH topology
2KRNA 1GRIA 3M0QA 3NHNA 1MUZA 2ESWA 1K4US 1X27A 2DYBA 2CDTA 3VRZA 4Z88A 1WXBA 2DA9A 2JTEA 1NYGA 1VA7A 4AG1C 3EG1A 3I5SA 2KXDA 2RPNA 2HEQA 3H0IA 2W0ZA 1J3TA 1SPKA 2NWMA 1LCKA 1YP5A 1GCQC 1BU1A 1QKXA 1PNJA 1GCQA 1JU5C 2EVRA 1UGVA 2DF6A 3R6NA 1SHGA 2FO0A 1B07A 2CSIA 3TSZA 4D8KA 1QKWA 2D0NA 2K3BA 2DL5A 1X2KA 4JJCA 1HSQA 2AZSA 2J6OA 3PE0A 1A0NB 1PHTA 1ZSGA 2EYWA 1PRLC 2LJ0A 1SRMA 5IHNA 2LJ3A 1NG2A 2CSQA 2HDAA 2DILA 1FYNA 2DE0X 1U3OA 1AWJA 2JM8A 2DL4A 4RTZA 4WCIA 2CT4A 2O9SA 3EG0A 1QWEA 2BZYA 2JXBA 4J9EA 1UECA 1I0CA 2YUNA 2JMAA 4M4ZA 3I5RA 1I1JA 2JS2A 1KFZA 1WX6A 3FJ5A 4OMLA 5EC7A 2KRMA 2LJ1A 4J9GA 1H8KA 1Z9ZA 2FPFA 4RTWA 1GFDA 2EGEA 2YUQA 4QT7A 2E5KA 2JM9A 1E7OA 2FRWA 1SSHA 2RQVA 2DM1A 3SEMA 2A37A 2GNCA 1B3QA 3IQLA 4OMOA 2C0OA 4CC4B 4LN2A 1RUWA 3ULRB 2FRYA 2KEAA 2ROTA 2B86A 2C0IA 4X1VA 5IHIA 2KRSA 2IIMA 1W70A 2DL7A 5GJVB 1AOJA 3A98A 2X3WD 1X69A 4LE9A 3VS3A 2KYMA 3SHWA 2EPDA 1WXTA 4HXJA 4J9FA 1WIEA 2L0AA 1NEBA 2ENMA 3EG2A 2JS0A 1UJ0A 4IIOA 3UA7A 1AD5A 2KNBB 1H92A 3CQTA 2D8JA 1VYUA 1MV3A 4RUGA 1X43A 2H8HA 3NGPA 1S1NA 2YUOA 1UHCA 1E6HA 2ED0A 1T3SA 1XOVA 2LNHB 2K6DA 1AWWA 1I07A 2PNIA 4AFQC 2DLPA 1TUCA 2P4RA 4A63B 1JO8A 1IO6A 1GL5A 3EHQA 3QWXX 1M3AA 3I35A 4OMQA 1PRMC 2VWFA 1AZGB 2K79A 2CUBA 1K76A 4RTXA 2F2XA 2KGTA 2CH4W 4K11A 2DL3A 1ZUYA 1PWTA 2XMFA 2LQWA 1QWFA 1NEGA 1PKTA 1T0HA 2DRMA 4JJDA 2HSPA 1ZLMA 2DL8A 2YDLA 2SRCA 1AWXA 5I11A 4HCKA 1KSWA 2GQIA 4HVVA 1OEBA 1V1CA 2L3SA 1M30A 2ROLA 2J05A 2YT6A 1AEYA 1YWOA 2I0NA 3M0UA 2KR3A 2D1XA 1ZUKA 2QDLA 2OJ2A 2O2OA 4E6RA 2FG0A 2MOXA 3VS2A 2C0TA 4AFUC 2OI3A 1K0SA 1BB9A 4GBQA 4AFZC 4Z8AA 4RTTA 2LMJA 3RNJA 3RBBB 2EKHA 2W10A 1SHFA 2GTJA 1CKAA 3M0PA 2AK5A 1RLPC 2AKLA 2L2PA 1AZEA 1YNZA 2RQTA 3UATA 1U5SA 2ED1A 2K2MA 1X6BA 1VYTA 3H0FA 4CC2A 1TG0A 1OPKA 2KE9A 1GFCA 2KROA 1UUEA 2EYYA 2DJQA 1UG1A 2X3XD 5I22A 2L3PA 2LCSA 2BZ8A 3PVQA 2EGCA 2VKNA 1Y57A 1ZUUA 3VS4A 4ZNXA 2HCKA 4JZ3A 1BBZA 2A28A 4Y92A 3TVTA 4RTVA 4FSSA 4F14A 4JPBW 2RMOA 1QCFA 1SEMA 1Y0MA 3EG3A 2YSQA 2OAWA 3M0SA 5L23A 1G83A 2PTKA 1M27C 4HVWA 1M3CA 5FW9A 5ECAA 3EGUA 1U06A 1WA7A 2O9VA 4LUDA 1FMKA 2LZ6B 4OMMA 1SRLA 3GBQA 1VYVA 1ZBJA 2DVJA 2D8HA 3VS0A 4LUEA 3ZL7C 1OV3A 4AG2C 1AWOA 1Z9QA 2RQWA 2F2WA 1ABOA 2KT8A 1WLPB 1UJYA 2SEMA 3KFVA 5HCKA 2EGAA 2V1RA 4LNPA 1W6XA 1GCPA 2KBTA 1WI7A 1UTIA 2EBPA 2GTOA 2MCNA 2A08A 2O88A 3THKA 1N5ZA 1PKSA 3JV3A 1ABQA 2FPDA 1ARKA 1CKBA 2EW3A 1WYXA 2EYXA 1M3BA 2RNAA 2J7IA 3M0RA 1TUDA 4CC3A 2DMOA 2O31A 4R0KA 3M0TA 4Z89A 4RTUA 1NM7A 2FEIA 3I9QA 2BTTA 1JQQA 1WXUA 1K9AA 4RTYA 1JEGA 3O5ZA 1K0XA 1QLYA 2PZ1A 3VS1A 3NPFA 2RF0A 2DX1A 1BK2A 2GBQA 1EFNA 4AFSC 4F16A 1JXOA 5IH2A 1GBQA 2YUPA 3EHRA 3PVLA 2DBMA 1HD3A 2A36A 1ZX6A 4IIMA 1RI9A 2ECZA 2J6KA 4OMNA 1M8MA 1JXMA 1W1FA 2M51A 3C0CA 2RN8A 1OOTA 2AKKA 2CT3A 2GGRA 2AZVA 4ORZA 2K7AA 2EYZA 4JZ4A 2EQIA 1RLQC 2CUDA 3REAB 1WDXA 3U23A 2JT4A 1CSKA 1X6GA 5FWCA 1KIKA 4J9DA 2KXCA 2J06A 3QWYA 2F2VA 1T3LA 2K9GA 4ESRA 1UE9A 2LX7A 2FPEA 3TSWA 5IHKA 3NMZC 2MIOA 2ABLA 2M0YA 5IXFA 1K1ZA 1GBRA 4GLMA 1KJWA 1T0JA 1E6GA 1YWPA 2J6FA 4OMPA 2JMCA 5FWBA 4EIKA 2G6FX 3VRYA 1UDLA 1YCSB 1NLOC 3VS5A 2RQUA 4DEYA 2DBKA 2RQRA 1X2QA 2HBWA 2NUZA 4J9BA 2LQNA 1NYFA 1UHFA 3VS7A 3REBB 2VVKA 5GJWB 1HJDA 4J9IA 1NLPC 3UA6A 2JW4A 3LH5A 4D8DA 1OPLA 2KYBA 1G2BA 2LP5A 4KRTA 3H41A 4F17A 2CREA 2DNUA 1YN8A 2DRKA 1H3HA 2L3QA 4HVUA 2KT1A 2CH4A 2V1QA 1MV0B 4JJBA 4CC7A 4DEXA 4J9CA 3VS6A 1AVZC 2BZXA 1UFFA 4J9HA 5IXBA 3UF4A 1WFWA 3H0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRN A;  1GRI A;  3M0Q A;  3NHN A;  1MUZ A;  2ESW A;  1K4U S;  1X27 A;  2DYB A;  2CDT A;  3VRZ A;  4Z88 A;  1WXB A;  2DA9 A;  2JTE A;  1NYG A;  1VA7 A;  4AG1 C;  3EG1 A;  3I5S A;  2KXD A;  2RPN A;  2HEQ A;  3H0I A;  2W0Z A;  1J3T A;  1SPK A;  2NWM A;  1LCK A;  1YP5 A;  1GCQ C;  1BU1 A;  1QKX A;  1PNJ A;  1GCQ A;  1JU5 C;  2EVR A;  1UGV A;  2DF6 A;  3R6N A;  1SHG A;  2FO0 A;  1B07 A;  2CSI A;  3TSZ A;  4D8K A;  1QKW A;  2D0N A;  2K3B A;  2DL5 A;  1X2K A;  4JJC A;  1HSQ A;  2AZS A;  2J6O A;  3PE0 A;  1A0N B;  1PHT A;  1ZSG A;  2EYW A;  1PRL C;  2LJ0 A;  1SRM A;  5IHN A;  2LJ3 A;  1NG2 A;  2CSQ A;  2HDA A;  2DIL A;  1FYN A;  2DE0 X;  1U3O A;  1AWJ A;  2JM8 A;  2DL4 A;  4RTZ A;  4WCI A;  2CT4 A;  2O9S A;  3EG0 A;  1QWE A;  2BZY A;  2JXB A;  4J9E A;  1UEC A;  1I0C A;  2YUN A;  2JMA A;  4M4Z A;  3I5R A;  1I1J A;  2JS2 A;  1KFZ A;  1WX6 A;  3FJ5 A;  4OML A;  5EC7 A;  2KRM A;  2LJ1 A;  4J9G A;  1H8K A;  1Z9Z A;  2FPF A;  4RTW A;  1GFD A;  2EGE A;  2YUQ A;  4QT7 A;  2E5K A;  2JM9 A;  1E7O A;  2FRW A;  1SSH A;  2RQV A;  2DM1 A;  3SEM A;  2A37 A;  2GNC A;  1B3Q A;  3IQL A;  4OMO A;  2C0O A;  4CC4 B;  4LN2 A;  1RUW A;  3ULR B;  2FRY A;  2KEA A;  2ROT A;  2B86 A;  2C0I A;  4X1V A;  5IHI A;  2KRS A;  2IIM A;  1W70 A;  2DL7 A;  5GJV B;  1AOJ A;  3A98 A;  2X3W D;  1X69 A;  4LE9 A;  3VS3 A;  2KYM A;  3SHW A;  2EPD A;  1WXT A;  4HXJ A;  4J9F A;  1WIE A;  2L0A A;  1NEB A;  2ENM A;  3EG2 A;  2JS0 A;  1UJ0 A;  4IIO A;  3UA7 A;  1AD5 A;  2KNB B;  1H92 A;  3CQT A;  2D8J A;  1VYU A;  1MV3 A;  4RUG A;  1X43 A;  2H8H A;  3NGP A;  1S1N A;  2YUO A;  1UHC A;  1E6H A;  2ED0 A;  1T3S A;  1XOV A;  2LNH B;  2K6D A;  1AWW A;  1I07 A;  2PNI A;  4AFQ C;  2DLP A;  1TUC A;  2P4R A;  4A63 B;  1JO8 A;  1IO6 A;  1GL5 A;  3EHQ A;  3QWX X;  1M3A A;  3I35 A;  4OMQ A;  1PRM C;  2VWF A;  1AZG B;  2K79 A;  2CUB A;  1K76 A;  4RTX A;  2F2X A;  2KGT A;  2CH4 W;  4K11 A;  2DL3 A;  1ZUY A;  1PWT A;  2XMF A;  2LQW A;  1QWF A;  1NEG A;  1PKT A;  1T0H A;  2DRM A;  4JJD A;  2HSP A;  1ZLM A;  2DL8 A;  2YDL A;  2SRC A;  1AWX A;  5I11 A;  4HCK A;  1KSW A;  2GQI A;  4HVV A;  1OEB A;  1V1C A;  2L3S A;  1M30 A;  2ROL A;  2J05 A;  2YT6 A;  1AEY A;  1YWO A;  2I0N A;  3M0U A;  2KR3 A;  2D1X A;  1ZUK A;  2QDL A;  2OJ2 A;  2O2O A;  4E6R A;  2FG0 A;  2MOX A;  3VS2 A;  2C0T A;  4AFU C;  2OI3 A;  1K0S A;  1BB9 A;  4GBQ A;  4AFZ C;  4Z8A A;  4RTT A;  2LMJ A;  3RNJ A;  3RBB B;  2EKH A;  2W10 A;  1SHF A;  2GTJ A;  1CKA A;  3M0P A;  2AK5 A;  1RLP C;  2AKL A;  2L2P A;  1AZE A;  1YNZ A;  2RQT A;  3UAT A;  1U5S A;  2ED1 A;  2K2M A;  1X6B A;  1VYT A;  3H0F A;  4CC2 A;  1TG0 A;  1OPK A;  2KE9 A;  1GFC A;  2KRO A;  1UUE A;  2EYY A;  2DJQ A;  1UG1 A;  2X3X D;  5I22 A;  2L3P A;  2LCS A;  2BZ8 A;  3PVQ A;  2EGC A;  2VKN A;  1Y57 A;  1ZUU A;  3VS4 A;  4ZNX A;  2HCK A;  4JZ3 A;  1BBZ A;  2A28 A;  4Y92 A;  3TVT A;  4RTV A;  4FSS A;  4F14 A;  4JPB W;  2RMO A;  1QCF A;  1SEM A;  1Y0M A;  3EG3 A;  2YSQ A;  2OAW A;  3M0S A;  5L23 A;  1G83 A;  2PTK A;  1M27 C;  4HVW A;  1M3C A;  5FW9 A;  5ECA A;  3EGU A;  1U06 A;  1WA7 A;  2O9V A;  4LUD A;  1FMK A;  2LZ6 B;  4OMM A;  1SRL A;  3GBQ A;  1VYV A;  1ZBJ A;  2DVJ A;  2D8H A;  3VS0 A;  4LUE A;  3ZL7 C;  1OV3 A;  4AG2 C;  1AWO A;  1Z9Q A;  2RQW A;  2F2W A;  1ABO A;  2KT8 A;  1WLP B;  1UJY A;  2SEM A;  3KFV A;  5HCK A;  2EGA A;  2V1R A;  4LNP A;  1W6X A;  1GCP A;  2KBT A;  1WI7 A;  1UTI A;  2EBP A;  2GTO A;  2MCN A;  2A08 A;  2O88 A;  3THK A;  1N5Z A;  1PKS A;  3JV3 A;  1ABQ A;  2FPD A;  1ARK A;  1CKB A;  2EW3 A;  1WYX A;  2EYX A;  1M3B A;  2RNA A;  2J7I A;  3M0R A;  1TUD A;  4CC3 A;  2DMO A;  2O31 A;  4R0K A;  3M0T A;  4Z89 A;  4RTU A;  1NM7 A;  2FEI A;  3I9Q A;  2BTT A;  1JQQ A;  1WXU A;  1K9A A;  4RTY A;  1JEG A;  3O5Z A;  1K0X A;  1QLY A;  2PZ1 A;  3VS1 A;  3NPF A;  2RF0 A;  2DX1 A;  1BK2 A;  2GBQ A;  1EFN A;  4AFS C;  4F16 A;  1JXO A;  5IH2 A;  1GBQ A;  2YUP A;  3EHR A;  3PVL A;  2DBM A;  1HD3 A;  2A36 A;  1ZX6 A;  4IIM A;  1RI9 A;  2ECZ A;  2J6K A;  4OMN A;  1M8M A;  1JXM A;  1W1F A;  2M51 A;  3C0C A;  2RN8 A;  1OOT A;  2AKK A;  2CT3 A;  2GGR A;  2AZV A;  4ORZ A;  2K7A A;  2EYZ A;  4JZ4 A;  2EQI A;  1RLQ C;  2CUD A;  3REA B;  1WDX A;  3U23 A;  2JT4 A;  1CSK A;  1X6G A;  5FWC A;  1KIK A;  4J9D A;  2KXC A;  2J06 A;  3QWY A;  2F2V A;  1T3L A;  2K9G A;  4ESR A;  1UE9 A;  2LX7 A;  2FPE A;  3TSW A;  5IHK A;  3NMZ C;  2MIO A;  2ABL A;  2M0Y A;  5IXF A;  1K1Z A;  1GBR A;  4GLM A;  1KJW A;  1T0J A;  1E6G A;  1YWP A;  2J6F A;  4OMP A;  2JMC A;  5FWB A;  4EIK A;  2G6F X;  3VRY A;  1UDL A;  1YCS B;  1NLO C;  3VS5 A;  2RQU A;  4DEY A;  2DBK A;  2RQR A;  1X2Q A;  2HBW A;  2NUZ A;  4J9B A;  2LQN A;  1NYF A;  1UHF A;  3VS7 A;  3REB B;  2VVK A;  5GJW B;  1HJD A;  4J9I A;  1NLP C;  3UA6 A;  2JW4 A;  3LH5 A;  4D8D A;  1OPL A;  2KYB A;  1G2B A;  2LP5 A;  4KRT A;  3H41 A;  4F17 A;  2CRE A;  2DNU A;  1YN8 A;  2DRK A;  1H3H A;  2L3Q A;  4HVU A;  2KT1 A;  2CH4 A;  2V1Q A;  1MV0 B;  4JJB A;  4CC7 A;  4DEX A;  4J9C A;  3VS6 A;  1AVZ C;  2BZX A;  1UFF A;  4J9H A;  5IXB A;  3UF4 A;  1WFW A;  3H0H A; 
#chains in the Genus database with same CATH topology
 2H3J A;  1M1F A;  1MUZ A;  2MWP A;  3KXT A;  2DYB A;  3VRZ A;  1D0Z A;  4A4H A;  1WXB A;  2JTF A;  4EMG A;  3A8H B;  2DXT A;  1M90 C;  3SWN A;  1VA7 A;  1BCO A;  2QDY B;  2RPN A;  2X35 A;  1JJ2 P;  1LCK A;  1FX7 A;  1BU1 A;  5FLX E;  4M78 A;  2EVR A;  1R8O B;  4XU3 A;  4BI8 B;  5KH6 A;  2FO0 A;  4C92 B;  1KQS A;  1X2K A;  2AZS A;  3JB9 I;  4C8Q C;  3PIP A;  1PHT A;  2JOY A;  1ZQ1 A;  4OB3 B;  1PRL C;  3CD6 Q;  5LJ3 h;  3RIR A;  1OX9 A;  2CSQ A;  2HDA A;  4ANJ A;  2JTM A;  1XQH A;  5GAN h;  2M1H A;  4M7D G;  5DM7 R;  4QQ6 A;  4F7U B;  2JM8 A;  5KYW B;  2DL4 A;  3MEV A;  1YJW T;  3CCR A;  3EG0 A;  1QWE A;  2XI9 A;  3MEU A;  1Y07 A;  4J9E A;  3QKJ A;  2DO3 A;  1KC8 R;  2YUN A;  2MPX C;  4C92 A;  2DPP B;  3I5R A;  4QQG A;  1RAA B;  2QI2 A;  3OYG A;  2JNG A;  4OML A;  3OW2 P;  4M75 F;  1WNL A;  2JZ2 A;  1R0B G;  3RMS A;  3C12 A;  4KUL A;  1Z9Z A;  1GFD A;  2E5Q A;  2EGE A;  3RES A;  3JB9 F;  1E7O A;  1WHJ A;  1WHG A;  1KC8 C;  4F7U A;  4PFO A;  3X24 B;  3JB9 H;  4FW1 A;  2C0O A;  2QEX Q;  4M78 D;  1D1B A;  4PFP A;  3VU3 C;  3ULR B;  1IHW A;  3V8L A;  4EPC A;  5GMK m;  4X1V A;  1VQ4 A;  2DIG A;  2DL7 A;  1AOJ A;  4M7D E;  3INZ A;  3HP9 A;  2EJF A;  5FU7 C;  3JCM X;  4N4I A;  4ME7 A;  2KYM A;  3V7C A;  4OF1 A;  2M16 A;  1U1T A;  1OZ2 A;  2ATC B;  1HK9 A;  2IG0 A;  2XIC A;  1NEB A;  2ENM A;  4N4G A;  4XU0 A;  5GAN d;  2QG9 B;  1VQN T;  3GOX A;  2KNB B;  3OA6 A;  3CQT A;  4QQD A;  3M56 A;  1X43 A;  3CXC A;  2H8H A;  1S1N A;  2CP5 A;  1E6H A;  2M9U A;  1AWW A;  2E41 A;  2RJC A;  3JCM Q;  4M75 B;  5KYX A;  3CCS Q;  4C92 D;  4PKC C;  1PD0 A;  2D0Q B;  1IO6 A;  1XNI A;  4OMQ A;  3PMT A;  1AZG B;  1Q95 G;  2XU8 A;  3M4Y A;  3M9Q A;  3F70 A;  1K76 A;  1PM3 A;  4FT4 A;  2CH4 W;  1D0Y A;  1WJR A;  2VAS A;  4A4K A;  3JCM P;  2XMF A;  2LQW A;  4LDW A;  5IN1 A;  1MHN A;  1MMA A;  1AWX A;  4HCK A;  2OTJ A;  1KSW A;  3EGX B;  2MYS A;  1OEB A;  1M30 A;  2I0N A;  4M75 A;  2KR3 A;  2QDL A;  3MEW A;  1RAF B;  2O2O A;  5LJ3 f;  2MOX A;  1RL2 A;  3VS2 A;  2C0T A;  1N9R A;  2OI3 A;  4C92 G;  1K0S A;  5GAN f;  1KQS P;  1BB9 A;  1UB4 A;  2VGM A;  1VOM A;  3GP8 A;  3CCR Q;  3RNJ A;  1VQL A;  2EKH A;  4J5Y A;  2FHD A;  2GTJ A;  1Q82 U;  1RLP C;  2AKL A;  2IPO B;  1S72 T;  1VQ5 T;  1AZE A;  4XU1 A;  1W2B P;  3CC2 A;  2K2M A;  1UGQ B;  2X4W A;  1X6B A;  1VYT A;  3H0F A;  2KE9 A;  2M0O A;  3EGX A;  4F7U G;  3GNG A;  3FJP A;  2DJQ A;  1N8R R;  1OYX A;  5GAM e;  2CP3 A;  2GFA A;  2VKN A;  5GAO q;  1QW1 A;  1KD1 U;  1M8V A;  3CCE T;  4M7D C;  4Y92 A;  3CCQ T;  4RTV A;  4IUV A;  1BI2 A;  4F14 A;  4JPB W;  4BY6 C;  3L2Q A;  1VQ4 Q;  1N8R C;  4X34 A;  1M1K U;  2F5T X;  4JRI A;  4C92 E;  4KGX B;  2RJE A;  2LT1 A;  2JN0 A;  5KYY B;  3HRS A;  2DYI A;  1VQO T;  4BD3 A;  1WA7 A;  2BUD A;  4FSX A;  1FMK A;  2LZ6 B;  3HTR A;  1SRL A;  1ZBJ A;  4A4G A;  2L8D A;  2D8H A;  1KG1 A;  3JCM f;  2V8K A;  3OS1 A;  3ZL7 C;  4M75 D;  1UEB A;  3X25 B;  4CRI A;  2NLU A;  1AWO A;  2BE7 D;  2K5L A;  2KT8 A;  4ELY C;  5A2Q E;  4F7U E;  1VQ9 T;  3KFV A;  3CPW P;  1QVG P;  5HCK A;  1ZBX A;  1NPP A;  2EGA A;  3SD4 A;  3JB9 D;  3HRT A;  4LNP A;  4N4H A;  2EBP A;  2GTO A;  4LDU A;  1Y96 A;  4HCB A;  1N5Z A;  4NS5 A;  5KYY A;  1PKS A;  5DLQ E;  2E3I A;  1ABQ A;  2FPD A;  3RKY A;  3UT1 A;  4E2F B;  1YJ9 A;  4OGE A;  3CXC P;  4M7A B;  1M3B A;  3CME A;  1TUD A;  1X01 A;  2LC4 A;  4R0K A;  3BFM A;  3E1S A;  2FEI A;  3I9Q A;  4BE2 A;  3FC3 A;  1YIT A;  4M75 G;  3SWN C;  1WXU A;  1O9S A;  1JEG A;  2LQK A;  1QLY A;  2OTJ Q;  1LJO A;  1OZ3 A;  4PLI A;  4Z02 A;  4XTX A;  4QVC A;  2LT4 A;  3V7S A;  2MAM A;  2HQX A;  2G3R A;  2DFU A;  3JB9 G;  1EFN A;  3MHX A;  4J7F A;  1QVF S;  1JXO A;  2QQR A;  1FXX A;  3MEA A;  3TU4 K;  2RK1 A;  2P84 A;  1VQL Q;  5I21 A;  1W1F A;  4UC4 A;  3JCM W;  3KUF A;  2QK0 A;  3GPL A;  2GGR A;  4Y28 E;  2LDM A;  3CC2 Q;  3V7R A;  3VUZ A;  1WGS A;  4PJO F;  1X6G A;  4J9D A;  5A0D A;  3VYH B;  3G4S A;  2RHY A;  2FPE A;  3G71 Q;  2LNV A;  2HAX A;  2MIO A;  1QVF A;  4XU2 A;  2M0Y A;  4M75 E;  2FVU A;  3I55 T;  3OMG A;  2EQK A;  1GBR A;  2DIQ A;  2DXC A;  2B8A A;  4C92 C;  5GMK l;  2BIV A;  2QQS A;  1E6G A;  2OX7 A;  3NTI A;  5KYN A;  2FZC B;  2JMC A;  5FWB A;  4FU6 A;  5KCO A;  2COZ A;  2DZ9 A;  5GMK j;  2G6F X;  1JB0 E;  2EFI A;  3RDV A;  4XAX B;  4OB0 B;  3VS5 A;  3EG9 B;  2VXF A;  2L5Q A;  2DBK A;  4J6W A;  1WQW A;  4C5E A;  2COY A;  3QJY A;  1I5O B;  1YI2 Q;  1UHF A;  3LGL A;  1MNE A;  2PVG B;  2VVK A;  1HJD A;  1Q86 R;  1HXD A;  2JW4 A;  2X9H A;  4D8D A;  3UDC A;  1G2B A;  4NL2 A;  2HSE B;  4A54 A;  3AHU A;  2EKO A;  3OS5 A;  3URG A;  2CH4 A;  3OYA A;  3HHT B;  4JJN K;  4DEX A;  1RAE B;  2FYK A;  1JBM A;  3EG9 A;  4IKF A;  2HD0 A;  4YTL A;  1WQ7 A;  1YJ9 Q;  3HFN A;  2P0P A;  3UF4 A;  3CME Q;  4M77 F;  3QJ6 A;  3QII A;  2ESW A;  2YXY A;  1K4U S;  1X27 A;  3OSS C;  1XTD A;  1VIE A;  2XKO C;  3NFC A;  1YIT Q;  2XDP A;  5IAY A;  4LDV A;  3E9F A;  5M9O A;  4B9X A;  3I5S A;  4M7A G;  2P4T A;  4PJO A;  1SPK A;  1M2V B;  1QKX A;  1PNJ A;  1GCQ A;  4A4E A;  2PUK B;  3TQ7 P;  1B07 A;  1GXI E;  2NUT A;  1G5V A;  3SB2 A;  3JCM J;  3ZEH A;  2K3B A;  2DL5 A;  4ZTJ A;  4JJC A;  2RA2 A;  3LWH A;  3PE0 A;  1A0N B;  5GAN g;  3CMA T;  1VQM A;  4AT1 B;  4LD9 K;  4M75 C;  2LJ0 A;  5GAM h;  3CD6 A;  1K73 C;  3UWN A;  1AWJ A;  1VQP T;  1M2V A;  1WHM A;  1VQ8 A;  4WCI A;  4XTU A;  2LX9 A;  2WSE E;  2BZY A;  2JXB A;  3CPF A;  2GFU A;  1U1S A;  2LTO A;  2JMA A;  4M4Z A;  4M7A E;  2JS2 A;  1KFZ A;  1WX6 A;  3QZ5 B;  1BYM A;  5EC7 A;  4J9G A;  1H8K A;  2FPF A;  1OU9 A;  1MMN A;  3QUI A;  2AT1 B;  3TEE A;  2O4X B;  1Q7Y U;  1VQ6 T;  1WPY A;  4N0A A;  2E5K A;  2JM9 A;  3CBO A;  2K3Y A;  2NUP B;  2RQV A;  3G1J A;  1OQK A;  3VV0 A;  4JDS A;  4PJO D;  3SEM A;  3SFM A;  2QEX A;  2FRY A;  3H8Z A;  2KEA A;  2C0I A;  2KRS A;  2IIM A;  3S3O A;  1W70 A;  2HNI A;  5HK0 A;  5LJ5 e;  1X69 A;  1YJN A;  2PVD B;  3LX7 A;  2EPD A;  1IRE B;  5GAM d;  4M78 B;  3V8J A;  1TXQ A;  5LJ3 j;  1ACM B;  2O4X A;  2DJZ A;  5CKD A;  3EG2 A;  3QDR B;  3L2U A;  4IIO A;  3UA7 A;  5GAN j;  2NUP A;  1H92 A;  2QA4 A;  1MV3 A;  3NGP A;  2A7Y A;  2YUO A;  1UHC A;  2YLB A;  2ED0 A;  3G6E T;  1LVK A;  4PJO G;  1YIJ Q;  2DLP A;  1JO8 A;  3CCS A;  3EH2 A;  3QWX X;  3I35 A;  2K79 A;  1R0C B;  2HL3 A;  3A8G B;  2OTL T;  2DL3 A;  1PWT A;  5CO7 A;  3G4S T;  1T0H A;  1PKT A;  4JJD A;  3EFR A;  2GF7 A;  1BKB A;  4J7I A;  3VKI A;  1WZO A;  2DET A;  2DL8 A;  1W2B S;  4ZN3 A;  2RHU A;  2GQI A;  2KY9 A;  1V1C A;  1VQM Q;  2L3S A;  3GNF B;  2YT6 A;  1KHI A;  1QQJ A;  2KAF A;  1D09 B;  1HYO A;  1AEY A;  1YWO A;  2D1X A;  1I5L A;  5GAM f;  4DA4 A;  1O75 A;  4E6R A;  2E12 A;  1KHC A;  3C95 A;  5L8R E;  1K8A U;  4M7A C;  2K5F A;  4AFZ C;  3CC7 T;  1VQ8 Q;  4PJO E;  4RTT A;  2LMJ A;  3C4S A;  3OYE A;  1CKA A;  2KVQ G;  3M0P A;  3CCV A;  2HQE A;  4CC2 A;  3CC4 T;  1OPK A;  1GFC A;  2KRO A;  2EYY A;  4DBR A;  2ZPI B;  4KUD K;  2YHT A;  3JCM c;  1UG1 A;  1Q82 R;  4GY5 A;  2L3P A;  2QQA A;  2BZ8 A;  3P8H A;  1U8R A;  1WHH A;  3CCJ A;  1Y57 A;  1ZUU A;  1VQ7 Q;  4ZNX A;  4JZ3 A;  1BBZ A;  2A28 A;  3BW1 A;  1KQ1 A;  4DBF A;  3CPW S;  1QVG S;  3C94 A;  5KE2 A;  1G3T A;  2CZ6 B;  2CYZ B;  1QCF A;  1Y0M A;  1Q82 C;  2QTX A;  2OAW A;  5L23 A;  2AIR B;  1H3Z A;  5KYX B;  2C06 A;  1YJN Q;  2VXE A;  4RG8 A;  3EGD A;  4RG2 A;  1VQK T;  3O8V A;  3OBW A;  2EQU A;  3VS0 A;  4LUE A;  1M90 U;  3CBP A;  2RQW A;  3BE3 A;  4OP0 A;  4KGV B;  2F2W A;  1ABO A;  2QA4 Q;  1UJY A;  2MK5 A;  1N9S A;  1YHQ A;  3CCU A;  4J6Y A;  4PFZ A;  5GAN 5;  3M4G A;  2V8J A;  1D1A A;  3QZ9 B;  2V1R A;  1PD1 A;  4WTO B;  5GAN 4;  2XDD A;  1WI7 A;  4M78 G;  2A08 A;  1NZ9 A;  2O88 A;  5CKE A;  1NE8 A;  1PC0 A;  3JV3 A;  3I56 A;  1ARK A;  2EW3 A;  2M02 A;  1UGP B;  2FZG B;  3OYF A;  3M0T A;  5CQX A;  4Z89 A;  3OYC A;  2ZPE B;  1PSF A;  4ZTF A;  4MML A;  3OYD A;  1TS9 A;  5KYU B;  4KBM B;  1WHL A;  4RTY A;  1LPL A;  2RJD A;  1PSE A;  4PJJ A;  4NOY A;  2ZZD A;  3E2U A;  2E10 A;  5GAO m;  3NPF A;  4OMF B;  2GBQ A;  4JRP A;  3J80 E;  4LXC A;  4AFS C;  4P5N A;  2RH2 A;  4XQ3 A;  2HMA A;  4L5G A;  5DY9 A;  4IIM A;  2MI6 A;  4OMN A;  4F04 B;  2E4H A;  2M51 A;  4E7H A;  3V8K A;  2VUB A;  4KH1 B;  4M78 E;  4LDX A;  4ORZ A;  5LL6 S;  2K7A A;  3PMI A;  2CUD A;  3LH0 A;  5KYU A;  3X20 B;  3REA B;  1WDX A;  3CCV Q;  1PG5 B;  3U23 A;  2JT4 A;  1KIK A;  2Y4X A;  1EZZ B;  3QWY A;  1QP3 A;  4FYV B;  1UGS B;  4ESR A;  1UE9 A;  2LX7 A;  5IHK A;  2QEX T;  1SF9 A;  2ABL A;  3G71 A;  2VGN A;  3CCJ Q;  5KCH A;  2KDS A;  3JAM E;  1MND A;  5A0L A;  4HCC A;  4GLM A;  3OYJ A;  3L42 A;  3FEO A;  2QQB A;  1KJW A;  3VJP A;  4C8Q F;  2MMP A;  3OYH A;  5J39 A;  4J83 A;  2JVV A;  4FW2 A;  4ATO A;  3VRY A;  4E7Z A;  1UDL A;  3LLR A;  5LJ5 h;  1YCS B;  1NLO C;  1Y96 B;  2WSC E;  3A8L B;  3CCL A;  2E3H A;  3VYG A;  5KE3 A;  4ZGE B;  2NUZ A;  3PFS A;  3VS7 A;  2CS7 A;  1YI2 A;  1BI0 A;  3TRE A;  2E6Z A;  1OPL A;  2LP5 A;  2E6N A;  4AMC A;  3I55 Q;  1M4Z A;  3H41 A;  1YHQ Q;  3CCU Q;  2DRK A;  5J26 A;  3EH1 A;  2HBP A;  3JCM b;  2QGF B;  2QAS A;  3OYN A;  4CC7 A;  2YRD A;  2LCC A;  2EJ9 A;  1N6A A;  1VUB A;  3L2W A;  4J9C A;  4MZT A;  3I56 Q;  3OYL A;  1V76 A;  1VIF A;  3OMC A;  1FMV A;  1RAH B;  4J9H A;  3H0H A;  2IVW A;  2KRN A;  3M0Q A;  2DEQ A;  3NHN A;  2K2V A;  3OBY A;  3JRZ A;  2F1L A;  1DJ7 B;  4FIB A;  4BDY A;  4O5V A;  3OYI A;  2JTE A;  1NYG A;  5CCA A;  1TTH B;  2KXD A;  4QW2 A;  2E65 A;  3H0I A;  5LJ5 d;  2W0Z A;  3CCR T;  2NWM A;  2VV5 A;  1YP5 A;  4BAC A;  3QXE B;  4M78 C;  2YWW A;  1JU5 C;  2ZPG B;  1UGV A;  4XK8 E;  4C5H A;  2QTV A;  2DXU A;  3R6N A;  1SHG A;  2COW A;  4L59 A;  3RKX A;  4RKU E;  4D8K A;  1YBY A;  2D0N A;  2P0Q A;  2AHJ B;  1OX8 A;  5GAM g;  2PU9 B;  3CCM Q;  4C8Q A;  5GAO n;  2H3E B;  2CZ0 B;  4R56 A;  1C1A A;  4XTZ A;  1SRM A;  5IHN A;  1NG2 A;  4LDY A;  2DIL A;  2DE0 X;  1U3O A;  2CP0 A;  3PNW C;  1C0M A;  2RJF A;  1QCN A;  5IT9 E;  3DB3 A;  1NJI U;  1TU0 B;  2CT4 A;  1K9M U;  5AYF A;  1VQ4 T;  2K3X A;  1N8R U;  7AT1 B;  2QYZ A;  4MZM A;  1BIB A;  3OQ5 A;  1I1J A;  3LGF A;  4Y91 A;  3FJ5 A;  5CAI A;  4ZGD B;  1TSF A;  2LJ1 A;  1RAD B;  3CCL Q;  1M2O A;  3CMA Q;  2PQW A;  3Q1J A;  4HCZ A;  4BI3 A;  2QGG A;  4OVA A;  3HFO A;  1BCM A;  2E70 A;  1MMG A;  2A37 A;  1G3Y A;  4OMO A;  4RMO A;  2R5A A;  4E7L A;  1RUW A;  1Q7Y R;  2KK4 A;  1N27 A;  1YJW A;  2ROT A;  1YFN A;  2B86 A;  3M59 A;  1JRI A;  4OB2 B;  1RAC B;  4E7K A;  5GAN 6;  1LOJ A;  4LE9 A;  3AT1 B;  4XTW A;  2DD5 A;  1BIA A;  3RR6 A;  3VS3 A;  1IB8 A;  3SHW A;  4PJO B;  1SG5 A;  1WXT A;  4HXJ A;  4C8Q D;  1JJ2 S;  1Q86 C;  1WIE A;  5GAM j;  4M7D F;  2L0A A;  2XG8 D;  3DLM A;  1G8X A;  3NTH A;  2EQM A;  3VUB A;  3WVD B;  3GF5 A;  1OUL A;  2JS0 A;  1UJ0 A;  1Q7Y C;  4KH0 B;  3M58 A;  3T9N A;  2OTJ T;  2NUT B;  4HKE A;  4C0G A;  3OYY A;  4IUP A;  5GAO l;  1YCY A;  4XTV A;  1T3S A;  2LNH B;  2K6D A;  4FYY B;  3X26 B;  1TUG B;  2DVE A;  1TOV A;  5GMK i;  4E7J A;  2PNI A;  2P4R A;  1YIJ A;  4A63 B;  1VQL T;  1GL5 A;  3JCM e;  1PRM C;  2ZAE A;  4EDU A;  3A1P A;  2CUB A;  1RI0 A;  1AHJ B;  3CC2 T;  2R5M A;  2F2X A;  4C8Q G;  1D3B B;  2KGT A;  2L89 A;  2O01 E;  4K11 A;  1ZUY A;  2DRM A;  2DTO A;  2HSP A;  2R58 A;  4C5I A;  5GAN 2;  2LQ8 A;  1VQN A;  5I11 A;  3FLG A;  4PL6 A;  5J3B A;  4IUT A;  3OW2 S;  4GLK A;  2XD0 A;  3M0U A;  3N5B B;  3J81 E;  1ZUK A;  2FL7 A;  2FG0 A;  4AFU C;  4DOW A;  2MF2 A;  2BE9 B;  4II1 A;  3S3M A;  1D1C A;  2DTI A;  2RHX A;  4L6V 5;  4EMK B;  2HL5 C;  3E9G A;  1D3B A;  3LW5 E;  2PUO B;  4M77 B;  3HPW A;  2AK5 A;  1Q81 U;  1I4K 1;  1YNZ A;  2RQT A;  1U5S A;  1Y71 A;  1IZ6 A;  1TG0 A;  1YI2 T;  4FL6 A;  1QVF P;  2X3X D;  5I22 A;  1WHK A;  3M55 A;  2F5K A;  3PVQ A;  2EGC A;  5HKC A;  3GLX A;  1W4S A;  2WAC A;  3VS4 A;  1P92 A;  3MPU B;  1VQ7 A;  5GAN 8;  3MP1 A;  2I2L A;  3TVT A;  5CIU A;  4EMH A;  2RHI A;  4EMK A;  2V8I A;  4CI0 C;  1OI1 A;  4PJL A;  4FSS A;  1YJW Q;  3QPH A;  4M77 A;  1KK7 A;  1SEM A;  4RCB A;  1YJ9 T;  2EAY A;  2LVM A;  1EIF A;  3M0S A;  1G83 A;  1M27 C;  1VQ5 A;  5FW9 A;  4OB1 B;  5ECA A;  3CME T;  1U06 A;  2O9V A;  4LUD A;  3DKM A;  2DEU A;  1VYV A;  2DVJ A;  2NYS A;  4C92 F;  1YIT T;  3MP8 A;  1OV3 A;  4AG2 C;  1Z9Q A;  2D9T A;  2CGH A;  5GAN 7;  3D7S B;  3CCQ A;  1W6X A;  1GCP A;  3J7A F;  1UTI A;  1Y7X A;  2MCN A;  5D6X A;  3THK A;  5HK3 A;  1CKB A;  1G3S A;  1WYX A;  2EYX A;  2RNA A;  5GAO r;  2RD1 A;  1VQO A;  3S3N A;  3WVE B;  2O31 A;  1X75 C;  1KQS S;  4RTU A;  1VQK Q;  1NM7 A;  2DZC A;  5CKF A;  2CZ7 B;  1K9A A;  3S6W A;  2L3R A;  1VQN Q;  3O5Z A;  1K73 U;  2K4Y A;  4M7D D;  3VS1 A;  4IUU A;  1VQ9 A;  2DX1 A;  2RO0 A;  3M53 A;  4M77 D;  4KGZ B;  4DBQ A;  5IH2 A;  1GBQ A;  2YUP A;  3EHR A;  1XJW B;  2CP2 A;  2A36 A;  3QHS A;  1RI9 A;  2YRC A;  2ECZ A;  2HKQ B;  1JXM A;  1TH7 A;  4VUB A;  4Q5W A;  1ZHI A;  2EYZ A;  2EQI A;  5FWC A;  1W2B A;  4C0D B;  3KBG A;  2XK0 A;  2K9G A;  3EGD B;  3R6O A;  3QYH B;  3TSW A;  3JB9 J;  2KI7 A;  4M77 G;  3MJX A;  2KQW A;  2VB6 A;  3ME9 A;  5LJ5 g;  2OAU A;  1T0J A;  1YWP A;  2P0K A;  4OMP A;  2K57 A;  5FU6 B;  3PGG A;  3L2V A;  4EIK A;  1KD1 R;  1VQ5 Q;  1S72 Q;  1MMD A;  2X4X A;  2RQR A;  2HBW A;  4J9B A;  3REB B;  1WJQ A;  2XID A;  5KYW A;  5GJW B;  3P8B B;  3CXC S;  4E7I A;  1IXD A;  3NTK A;  2RM4 A;  2DKG A;  2FZK B;  1M1K R;  1QMC A;  4C0F A;  2Y90 A;  3M54 A;  1YIJ T;  2D6F A;  4BUG A;  2CRE A;  3I55 A;  1KD1 C;  4JRK A;  2DER A;  2YRV A;  3CCE Q;  1H3H A;  2L3Q A;  2PVO B;  4HVU A;  1PCX A;  4MDX A;  3CCQ Q;  2KT1 A;  3H6Z A;  3CPW A;  1QVG A;  2V1Q A;  1MV0 B;  4JJB A;  4M77 E;  1RAB B;  5LJ3 d;  2GQV A;  3JCM h;  4DBH A;  3G7Z A;  1M1K C;  3VS6 A;  2BZX A;  3L1A A;  4E7S A;  4R55 A;  1WFW A;  1VQO Q;  1GRI A;  2EYQ A;  4PJN A;  2CP7 A;  3DLL A;  1VQM T;  4DQ2 A;  2CDT A;  1M9S A;  2ZGW A;  4Z88 A;  2X4Y A;  4LD6 A;  2DA9 A;  3UPU A;  3CD6 T;  4HT8 A;  5CKH A;  3QG1 A;  4D6W A;  4AG1 C;  3EG1 A;  3EFO B;  1VQ9 Q;  3ZBD A;  1VQ8 T;  2HEQ A;  3OS0 A;  4PJO C;  4PNO A;  1J3T A;  4FYW B;  4FT2 A;  5LJ5 j;  1GCQ C;  3FB9 A;  2DF6 A;  2V26 A;  2XHC A;  1BI3 A;  2CSI A;  5C6S A;  3TSZ A;  2EQJ A;  1QKW A;  5GMK e;  3EAE A;  3RKW A;  4MMK A;  1HSQ A;  1F1B B;  2J6O A;  4BI4 A;  3CCM A;  1ZSG A;  2EYW A;  5D7U A;  5FRN A;  1VQ7 T;  4PLL A;  4JUV A;  2LJ3 A;  3EFO A;  1KC8 U;  1FYN A;  4O6J A;  2DK3 A;  3JCM d;  4RTZ A;  4A53 A;  2O9S A;  2ZPB B;  5CVI A;  1MGQ A;  5I2M A;  1UEC A;  5HY6 A;  4MDW A;  1I0C A;  2RHZ A;  3HSB A;  3QBY A;  1M1G A;  1YJN T;  3MET A;  2RK2 A;  1NJI R;  3OS2 A;  3FRN A;  2KRM A;  1K9M R;  2KMT A;  4ZN1 A;  2RB6 A;  4RTW A;  4M7A F;  3CMA A;  2YUQ A;  4QT7 A;  4N0A C;  2QA4 T;  2FRW A;  1SSH A;  1ZSZ B;  3A8M B;  2DM1 A;  4EMK C;  2GNC A;  1B3Q A;  3IQL A;  4CC4 B;  1VQP A;  2QAZ A;  1NJI C;  2BKD N;  4M77 C;  4LN2 A;  1K9M C;  5IHI A;  3ER0 A;  3CCS T;  3CBM A;  1WJS A;  5GJV B;  5CR2 A;  3OYK A;  3A98 A;  3FIF A;  2X3W D;  3MCA B;  5GAN 3;  2DTH A;  4J9F A;  3HL8 A;  3FDR A;  4NL3 A;  4B6M A;  5FRO A;  3LWI A;  2VYT A;  1AD5 A;  1ZSZ A;  4WF2 A;  1B7T A;  3GIB A;  3TCJ A;  2D8J A;  1VYU A;  1VQ6 A;  4RUG A;  1ZA1 B;  2MWO A;  2LRQ A;  1XOV A;  2X51 A;  4BDZ A;  3MKD A;  1G3W A;  4C8Q B;  2E1H A;  1I07 A;  4TVR A;  4AFQ C;  4IUQ A;  2QQ9 A;  4BE1 A;  1TUC A;  3EFS A;  3M57 A;  4V2S A;  3HKS A;  3EHQ A;  1OU8 A;  1M3A A;  4FYX B;  2VWF A;  2DXB A;  2Y4Y A;  4ELZ C;  1IRX A;  4RTX A;  3ASK A;  4KT0 E;  3CCV T;  4BE0 A;  3BY7 A;  1QWF A;  1NEG A;  3PT9 A;  8AT1 B;  1ZA2 B;  3X28 B;  2DAQ A;  4KUI A;  1ZLM A;  2YDL A;  3QSU A;  2SRC A;  4B9W A;  1LNX A;  4HVV A;  4X9C A;  1KQ2 A;  2ROL A;  2J05 A;  3CCJ T;  2CZ1 B;  3BDU A;  3G6E A;  2OJ2 A;  4HA8 A;  4M7A A;  4GBQ A;  2ZPH B;  4Z8A A;  4JLG A;  4JRQ A;  3RBB B;  2W10 A;  1SHF A;  3JSC A;  4X9D A;  4A4F A;  2L2P A;  3UAT A;  2ED1 A;  2OTL A;  1IGQ A;  2RI2 A;  2X4J A;  5FU7 B;  3MP6 A;  1UUE A;  4IUR A;  5LJ3 e;  2ZPF B;  5LJ5 f;  1Q81 R;  2LCS A;  4XTY A;  1I8F A;  2LCL A;  3QO3 A;  5GAN e;  1YHQ T;  3CCU T;  1RAI B;  4JS5 A;  2EWN A;  2HCK A;  3HRU A;  2DD4 A;  4FM4 B;  1SKU B;  1VQP Q;  1TWB A;  3CC7 A;  3OSV A;  3DB4 A;  2RMO A;  4RCC A;  3EG3 A;  2YSQ A;  3I56 T;  4JS4 A;  1Q81 C;  3QDF A;  1M5Q 1;  5AT1 B;  4C0D C;  2PTK A;  4HVW A;  1M3C A;  3LYI A;  5EG2 A;  3EGU A;  1UGR B;  2EJG A;  5CKB A;  4OMM A;  3PIO A;  3CC4 A;  3GBQ A;  3A8O B;  3OY9 A;  2RI5 A;  1IHV A;  3QYG B;  2ZCF B;  1VQ6 Q;  1WLP B;  2CKK A;  2SEM A;  4M7A D;  6AT1 B;  4OGC A;  5FU6 C;  4DOV A;  2HQH A;  4C0Z A;  1QVP A;  2KBT A;  4QVZ A;  1C6V X;  4PK4 A;  2A3L A;  2J7I A;  3M0R A;  1QP2 A;  5GAO p;  2KSS A;  4CC3 A;  3CCM T;  2DMO A;  1JJ2 A;  1H64 1;  1VQK A;  2YLC A;  4C5G A;  2VC8 A;  1RAG B;  5GMK h;  2BTT A;  2A0F B;  1JQQ A;  3RMQ A;  2GCX A;  2HZY A;  4JLI A;  1K0X A;  5FRM A;  2QXF A;  2PZ1 A;  1BI1 A;  3G71 T;  2F69 A;  2RF0 A;  1IGU A;  1R77 A;  3G6E Q;  1BK2 A;  4F16 A;  4HT9 A;  3PVL A;  4QVD A;  2DBM A;  1HD3 A;  1K73 R;  1ZX6 A;  3OYM A;  3L2R A;  2J6K A;  3RUX A;  1M8M A;  4M7D B;  2Z0W A;  5CQY A;  3C0C A;  2RN8 A;  1OOT A;  2AKK A;  2CT3 A;  5LJ3 g;  2AZV A;  3RER A;  2JUF A;  9ATC B;  3CCL T;  3H9N A;  4JZ4 A;  4BY6 B;  1B34 B;  1RLQ C;  2OTL Q;  3BDL A;  3A5Z B;  1K8A R;  1CSK A;  2KXC A;  2J06 A;  3G4S Q;  1NBE B;  4E47 A;  4M78 F;  2F2V A;  1T3L A;  4BB7 A;  2K5I A;  1D0X A;  3OW2 A;  2FB7 A;  4C8Q E;  2HKN A;  5CK9 A;  3NMZ C;  3CEY A;  3L2Z A;  4FCY A;  1V29 B;  3M5A A;  1FWZ A;  5IXF A;  4ZGJ B;  1K1Z A;  3WXM B;  2XDB A;  2CP6 A;  3ZFJ A;  4M7D A;  1K8A C;  5D6Y A;  2J6F A;  3CC7 Q;  1X6O A;  2JJ9 A;  2RI3 A;  3E19 A;  5D6W A;  1B34 A;  1Q86 U;  3JCM V;  1NPR A;  2RQU A;  4DEY A;  1EX4 A;  8ATC B;  1S72 A;  1X2Q A;  5A0G A;  2LQN A;  1NYF A;  3CC4 Q;  4J9I A;  2R57 A;  1NLP C;  3UA6 A;  3LH5 A;  2WSF E;  3PTA A;  2KYB A;  4KRT A;  4J8O A;  4F17 A;  2DNU A;  4PJM A;  1YN8 A;  3SWN B;  1FMW A;  4MZP A;  5DLO A;  1QCO A;  3JCM g;  3SDZ A;  3CCE A;  3OB9 A;  2EIF A;  4J6X A;  5C0M A;  5I2S A;  1AT1 B;  1M90 R;  1I81 A;  1SSF A;  3OYB A;  4F7U F;  3P8D A;  4QKU A;  1AVZ C;  1ZSZ C;  1UFF A;  5IXB A;  2E64 A;  3MO8 A; 
#chains in the Genus database with same CATH homology
 2KRN A;  1GRI A;  3M0Q A;  3NHN A;  1MUZ A;  2ESW A;  1K4U S;  1X27 A;  2DYB A;  2CDT A;  3VRZ A;  4Z88 A;  1WXB A;  2DA9 A;  2JTE A;  1NYG A;  1VA7 A;  4AG1 C;  3EG1 A;  3I5S A;  2KXD A;  2RPN A;  2HEQ A;  3H0I A;  2W0Z A;  1J3T A;  1SPK A;  2NWM A;  1LCK A;  1YP5 A;  1GCQ C;  1BU1 A;  1QKX A;  1PNJ A;  1GCQ A;  1JU5 C;  2EVR A;  1UGV A;  2DF6 A;  3R6N A;  1SHG A;  2FO0 A;  1B07 A;  2CSI A;  3TSZ A;  4D8K A;  1QKW A;  2D0N A;  2K3B A;  2DL5 A;  1X2K A;  4JJC A;  1HSQ A;  2AZS A;  2J6O A;  3PE0 A;  1A0N B;  1PHT A;  1ZSG A;  2EYW A;  1PRL C;  2LJ0 A;  1SRM A;  5IHN A;  2LJ3 A;  1NG2 A;  2CSQ A;  2HDA A;  2DIL A;  1FYN A;  2DE0 X;  1U3O A;  1AWJ A;  2JM8 A;  2DL4 A;  4RTZ A;  4WCI A;  2CT4 A;  2O9S A;  3EG0 A;  1QWE A;  2BZY A;  2JXB A;  4J9E A;  1UEC A;  1I0C A;  2YUN A;  2JMA A;  4M4Z A;  3I5R A;  1I1J A;  2JS2 A;  1KFZ A;  1WX6 A;  3FJ5 A;  4OML A;  5EC7 A;  2KRM A;  2LJ1 A;  4J9G A;  1H8K A;  1Z9Z A;  2FPF A;  4RTW A;  1GFD A;  2EGE A;  2YUQ A;  4QT7 A;  2E5K A;  2JM9 A;  1E7O A;  2FRW A;  1SSH A;  2RQV A;  2DM1 A;  3SEM A;  2A37 A;  2GNC A;  1B3Q A;  3IQL A;  4OMO A;  2C0O A;  4CC4 B;  4LN2 A;  1RUW A;  3ULR B;  2FRY A;  2KEA A;  2ROT A;  2B86 A;  2C0I A;  4X1V A;  5IHI A;  2KRS A;  2IIM A;  1W70 A;  2DL7 A;  5GJV B;  1AOJ A;  3A98 A;  2X3W D;  1X69 A;  4LE9 A;  3VS3 A;  2KYM A;  3SHW A;  2EPD A;  1WXT A;  4HXJ A;  4J9F A;  1WIE A;  2L0A A;  1NEB A;  2ENM A;  3EG2 A;  2JS0 A;  1UJ0 A;  4IIO A;  3UA7 A;  1AD5 A;  2KNB B;  1H92 A;  3CQT A;  2D8J A;  1VYU A;  1MV3 A;  4RUG A;  1X43 A;  2H8H A;  3NGP A;  1S1N A;  2YUO A;  1UHC A;  1E6H A;  2ED0 A;  1T3S A;  1XOV A;  2LNH B;  2K6D A;  1AWW A;  1I07 A;  2PNI A;  4AFQ C;  2DLP A;  1TUC A;  2P4R A;  4A63 B;  1JO8 A;  1IO6 A;  1GL5 A;  3EHQ A;  3QWX X;  1M3A A;  3I35 A;  4OMQ A;  1PRM C;  2VWF A;  1AZG B;  2K79 A;  2CUB A;  1K76 A;  4RTX A;  2F2X A;  2KGT A;  2CH4 W;  4K11 A;  2DL3 A;  1ZUY A;  1PWT A;  2XMF A;  2LQW A;  1QWF A;  1NEG A;  1PKT A;  1T0H A;  2DRM A;  4JJD A;  2HSP A;  1ZLM A;  2DL8 A;  2YDL A;  2SRC A;  1AWX A;  5I11 A;  4HCK A;  1KSW A;  2GQI A;  4HVV A;  1OEB A;  1V1C A;  2L3S A;  1M30 A;  2ROL A;  2J05 A;  2YT6 A;  1AEY A;  1YWO A;  2I0N A;  3M0U A;  2KR3 A;  2D1X A;  1ZUK A;  2QDL A;  2OJ2 A;  2O2O A;  4E6R A;  2FG0 A;  2MOX A;  3VS2 A;  2C0T A;  4AFU C;  2OI3 A;  1K0S A;  1BB9 A;  4GBQ A;  4AFZ C;  4Z8A A;  4RTT A;  2LMJ A;  3RNJ A;  3RBB B;  2EKH A;  2W10 A;  1SHF A;  2GTJ A;  1CKA A;  3M0P A;  2AK5 A;  1RLP C;  2AKL A;  2L2P A;  1AZE A;  1YNZ A;  2RQT A;  3UAT A;  1U5S A;  2ED1 A;  2K2M A;  1X6B A;  1VYT A;  3H0F A;  4CC2 A;  1TG0 A;  1OPK A;  2KE9 A;  1GFC A;  2KRO A;  1UUE A;  2EYY A;  2DJQ A;  1UG1 A;  2X3X D;  5I22 A;  2L3P A;  2LCS A;  2BZ8 A;  3PVQ A;  2EGC A;  2VKN A;  1Y57 A;  1ZUU A;  3VS4 A;  4ZNX A;  2HCK A;  4JZ3 A;  1BBZ A;  2A28 A;  4Y92 A;  3TVT A;  4RTV A;  4FSS A;  4F14 A;  4JPB W;  2RMO A;  1QCF A;  1SEM A;  1Y0M A;  3EG3 A;  2YSQ A;  2OAW A;  3M0S A;  5L23 A;  1G83 A;  2PTK A;  1M27 C;  4HVW A;  1M3C A;  5FW9 A;  5ECA A;  3EGU A;  1U06 A;  1WA7 A;  2O9V A;  4LUD A;  1FMK A;  2LZ6 B;  4OMM A;  1SRL A;  3GBQ A;  1VYV A;  1ZBJ A;  2DVJ A;  2D8H A;  3VS0 A;  4LUE A;  3ZL7 C;  1OV3 A;  4AG2 C;  1AWO A;  1Z9Q A;  2RQW A;  2F2W A;  1ABO A;  2KT8 A;  1WLP B;  1UJY A;  2SEM A;  3KFV A;  5HCK A;  2EGA A;  2V1R A;  4LNP A;  1W6X A;  1GCP A;  2KBT A;  1WI7 A;  1UTI A;  2EBP A;  2GTO A;  2MCN A;  2A08 A;  2O88 A;  3THK A;  1N5Z A;  1PKS A;  3JV3 A;  1ABQ A;  2FPD A;  1ARK A;  1CKB A;  2EW3 A;  1WYX A;  2EYX A;  1M3B A;  2RNA A;  2J7I A;  3M0R A;  1TUD A;  4CC3 A;  2DMO A;  2O31 A;  4R0K A;  3M0T A;  4Z89 A;  4RTU A;  1NM7 A;  2FEI A;  3I9Q A;  2BTT A;  1JQQ A;  1WXU A;  1K9A A;  4RTY A;  1JEG A;  3O5Z A;  1K0X A;  1QLY A;  2PZ1 A;  3VS1 A;  3NPF A;  2RF0 A;  2DX1 A;  1BK2 A;  2GBQ A;  1EFN A;  4AFS C;  4F16 A;  1JXO A;  5IH2 A;  1GBQ A;  2YUP A;  3EHR A;  3PVL A;  2DBM A;  1HD3 A;  2A36 A;  1ZX6 A;  4IIM A;  1RI9 A;  2ECZ A;  2J6K A;  4OMN A;  1M8M A;  1JXM A;  1W1F A;  2M51 A;  3C0C A;  2RN8 A;  1OOT A;  2AKK A;  2CT3 A;  2GGR A;  2AZV A;  4ORZ A;  2K7A A;  2EYZ A;  4JZ4 A;  2EQI A;  1RLQ C;  2CUD A;  3REA B;  1WDX A;  3U23 A;  2JT4 A;  1CSK A;  1X6G A;  5FWC A;  1KIK A;  4J9D A;  2KXC A;  2J06 A;  3QWY A;  2F2V A;  1T3L A;  2K9G A;  4ESR A;  1UE9 A;  2LX7 A;  2FPE A;  3TSW A;  5IHK A;  3NMZ C;  2MIO A;  2ABL A;  2M0Y A;  5IXF A;  1K1Z A;  1GBR A;  4GLM A;  1KJW A;  1T0J A;  1E6G A;  1YWP A;  2J6F A;  4OMP A;  2JMC A;  5FWB A;  4EIK A;  2G6F X;  3VRY A;  1UDL A;  1YCS B;  1NLO C;  3VS5 A;  2RQU A;  4DEY A;  2DBK A;  2RQR A;  1X2Q A;  2HBW A;  2NUZ A;  4J9B A;  2LQN A;  1NYF A;  1UHF A;  3VS7 A;  3REB B;  2VVK A;  5GJW B;  1HJD A;  4J9I A;  1NLP C;  3UA6 A;  2JW4 A;  3LH5 A;  4D8D A;  1OPL A;  2KYB A;  1G2B A;  2LP5 A;  4KRT A;  3H41 A;  4F17 A;  2CRE A;  2DNU A;  1YN8 A;  2DRK A;  1H3H A;  2L3Q A;  4HVU A;  2KT1 A;  2CH4 A;  2V1Q A;  1MV0 B;  4JJB A;  4CC7 A;  4DEX A;  4J9C A;  3VS6 A;  1AVZ C;  2BZX A;  1UFF A;  4J9H A;  5IXB A;  3UF4 A;  1WFW A;  3H0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...