2DL5A

Solution structure of the first sh3 domain of human kiaa0769 protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
78
structure length
78
Chain Sequence
GSSGSSGTLRNYPLTCKVVYSYKASQPDELTIEEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords KIAA0769 protein
publication title Solution structure of the first SH3 domain of human KIAA0769 protein
rcsb
source organism Homo sapiens
total genus 4
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl5A00
1X6BA 2LQWA 3RBBB 1UFFA 4K11A 1NEBA 1H3HA 1MV0B 3R6NA 1QLYA 3I9QA 1SHGA 5IHNA 3EG2A 1QWFA 4E6RA 5IHKA 2JMCA 4AG2C 2O9SA 2HSPA 2JS0A 1ZX6A 1PRMC 4AFUC 1E7OA 1UECA 2PTKA 4HXJA 1G83A 2RPNA 2CH4A 2DRMA 2DNUA 1SHFA 3VS4A 4AFSC 3IQLA 4R0KA 2GTOA 1GBRA 4LUEA 2ROLA 2GGRA 2J7IA 3LH5A 2OAWA 1OPLA 1CKBA 2DJQA 2L3SA 1CKAA 4J9BA 5IXBA 1M3AA 1NYGA 3M0QA 2ESWA 1Z9ZA 1ZUUA 1U5SA 2JT4A 4LN2A 2BZYA 1W70A 2FRWA 1AWWA 1E6GA 1NYFA 4J9HA 1X43A 1MUZA 4QT7A 4JJCA 1I0CA 3THKA 2CSQA 3VS7A 4RTXA 2M0YA 2OI3A 3VS0A 2YSQA 2EGAA 1VYUA 1K4US 1WA7A 2EKHA 4D8DA 1VYVA 5FWBA 1IO6A 2DMOA 2FPDA 2FPFA 1YN8A 3I5RA 4J9EA 2KRNA 4LUDA 2A28A 2VKNA 4F16A 1UE9A 2PNIA 1WDXA 1PNJA 2W10A 3QWYA 1WXTA 1GBQA 1M3CA 4LNPA 2EBPA 2KE9A 4OMQA 2A08A 2GNCA 1M30A 1UTIA 1PKSA 4CC4B 5IH2A 1YWPA 4OMPA 2JXBA 2AZSA 4RTYA 1JU5C 1W6XA 2BZXA 2GQIA 2K3BA 2EYXA 3GBQA 3REAB 1KJWA 5GJWB 1QKWA 2GBQA 3ZL7C 1AZGB 2ABLA 2YDLA 4OMLA 2CREA 3H41A 2L2PA 1JXMA 2CUDA 2EYZA 2KRMA 1I1JA 1BBZA 1AWXA 4RTWA 4JZ4A 2H8HA 4CC2A 2KNBB 2A37A 1W1FA 3TSZA 1JQQA 4HVUA 2EQIA 2YUNA 2O9VA 2LCSA 2CDTA 3C0CA 1GRIA 2IIMA 2YUOA 3UA6A 4X1VA 1H92A 1OOTA 2GTJA 2B86A 2LNHB 1ABQA 2C0IA 2O31A 5ECAA 2FRYA 5HCKA 4DEYA 5I11A 3NPFA 1WIEA 1GCQA 2DE0X 2G6FX 1SEMA 4Z89A 3NGPA 1V1CA 4ZNXA 2SRCA 1ZSGA 3REBB 2EVRA 2QDLA 4ESRA 2KYBA 2DBKA 2EGCA 1TUDA 1AWOA 2X3WD 2K9GA 2NUZA 2LZ6B 1NM7A 3QWXX 2LMJA 2DVJA 2RQTA 4J9DA 2KBTA 2MIOA 1GCPA 1A0NB 2DF6A 1M3BA 1OEBA 1WI7A 4FSSA 4Y92A 1CSKA 3VRZA 2AKKA 4J9GA 1ARKA 4OMNA 1TUCA 1SRLA 2O2OA 3H0HA 2D8HA 1KFZA 2NWMA 1WXBA 1PKTA 2ECZA 3I35A 1NLPC 1Y57A 4IIMA 2KXDA 1JO8A 1UHFA 3UATA 3VRYA 1I07A 2I0NA 1ZLMA 4RTZA 2W0ZA 1H8KA 3PVQA 4RTVA 2KROA 2DILA 3VS2A 2F2WA 2AZVA 1WFWA 2DRKA 4OMOA 1K0SA 2DYBA 5GJVB 1K0XA 1OV3A 2LP5A 2JTEA 1PHTA 2EGEA 1UDLA 1OPKA 4F14A 4Z8AA 4AFZC 3CQTA 2FPEA 2KT1A 3EHQA 2SEMA 2JM9A 2L3QA 3JV3A 1HD3A 1N5ZA 3EG0A 3O5ZA 4J9FA 2L0AA 2LJ1A 1UG1A 2FEIA 3KFVA 1WX6A 5EC7A 4OMMA 4HVWA 4LE9A 1FYNA 1GFDA 4CC3A 4J9IA 2ENMA 1WLPB 2ED0A 1X2KA 3PVLA 4KRTA 2DM1A 3VS5A 1T0JA 2RMOA 2BTTA 4RUGA 1U3OA 1ZUYA 1ZUKA 1VA7A 1KSWA 1AOJA 3TSWA 4WCIA 2EPDA 4GBQA 1HJDA 2A36A 4JJDA 1GL5A 1QWEA 4Z88A 1RLPC 1GFCA 2DBMA 4JJBA 3TVTA 4A63B 2BZ8A 2F2VA 1X27A 3UF4A 1AVZC 1T0HA 4HCKA 2CT3A 2J05A 1S1NA 2HDAA 3SHWA 4EIKA 2DX1A 1UJ0A 1UUEA 4AG1C 2ROTA 2M51A 2KEAA 2L3PA 2EW3A 2CH4W 1E6HA 1RI9A 3RNJA 2J6FA 2CUBA 2RN8A 2DL8A 2X3XD 2K7AA 1EFNA 2KR3A 1B07A 1VYTA 3EG1A 2MCNA 2RQRA 4JPBW 2RQWA 2YUQA 3M0PA 2JM8A 2KYMA 1BB9A 2LQNA 2LX7A 1X6GA 2LJ3A 1G2BA 4IIOA 4D8KA 2DL4A 5IXFA 1QCFA 3NMZC 2RQUA 2RF0A 2VVKA 2FG0A 2HEQA 1UJYA 2KGTA 2DLPA 2YT6A 1LCKA 1UGVA 5I22A 4CC7A 4AFQC 1T3LA 4F17A 1AZEA 1SSHA 2V1RA 5IHIA 1UHCA 1M27C 3VS3A 2CT4A 3FJ5A 3VS1A 1K76A 2AK5A 1KIKA 1GCQC 2V1QA 5FWCA 3M0RA 1U06A 2DA9A 3NHNA 5L23A 1FMKA 3ULRB 2PZ1A 3UA7A 2J6OA 3VS6A 2O88A 1Z9QA 2DL5A 2MOXA 2D0NA 1X2QA 1HSQA 2YUPA 4J9CA 1AWJA 1NEGA 1AEYA 1JXOA 1WXUA 1MV3A 1XOVA 1RLQC 1T3SA 1AD5A 1SRMA 2J6KA 2D1XA 2AKLA 2FO0A 2RQVA 2DL3A 2LJ0A 1ZBJA 3PE0A 1YP5A 3EGUA 1BU1A 2KXCA 2K2MA 4GLMA 1ABOA 1QKXA 2C0OA 2KRSA 2RNAA 3EG3A 2D8JA 3EHRA 3A98A 2KT8A 3SEMA 1PWTA 2HBWA 3H0IA 1RUWA 2F2XA 2EYYA 2OJ2A 2P4RA 2XMFA 3M0UA 2JW4A 4RTTA 1TG0A 1J3TA 1BK2A 4JZ3A 4ORZA 2K79A 4M4ZA 1NG2A 1M8MA 1SPKA 4HVVA 2HCKA 3I5SA 1PRLC 1K1ZA 1JEGA 2JMAA 3M0SA 5FW9A 2E5KA 2DL7A 2ED1A 1K9AA 1YNZA 2JS2A 3M0TA 1Y0MA 2K6DA 2CSIA 4DEXA 4RTUA 1NLOC 1YWOA 2C0TA 1YCSB 2J06A 3U23A 3H0FA 2EYWA 1X69A 1WYXA 1B3QA 2VWFA
chains in the Genus database with same CATH superfamily
5LL6S 4K11A 4OB1B 1MV0B 5GAOn 2R5AA 3GP8A 1QVFP 3OSSC 2FZGB 3ER0A 2YRCA 5GANh 2ZPHB 2EAYA 4E6RA 2FZKB 2JMCA 4LDUA 3RR6A 4EMGA 4MZTA 1G3WA 1UECA 4M75C 5DY9A 2DRMA 3A8LB 5CKBA 4M7AC 1HK9A 4BI4A 3GNFB 2KK4A 2JTMA 1MMAA 5A2QE 1GBRA 4LUEA 2OAWA 4M75E 4M7DD 2DJQA 1CKAA 5IXBA 3OQ5A 1NYGA 2YLCA 3BE3A 1Z9ZA 4M7AE 4IUUA 1U5SA 2KI7A 3CC4A 1W70A 1M2OA 3S3NA 1E6GA 3LGFA 1R0BG 1N8RC 4M77A 5GANg 4L5GA 2LTOA 2RD1A 1IXDA 4JJCA 4M7DF 2DD5A 3J81E 2OI3A 3MHXA 1Q7YC 4M77G 1K4US 2EKHA 1XJWB 2AHJB 1X01A 4PJNA 2DMOA 2XG8D 1X75C 4PFOA 3LLRA 1UE9A 1WDXA 3WVEB 2RHYA 5HK3A 4E7ZA 1WJSA 4LNPA 5KYUB 3ZBDA 3GLXA 2A08A 2JVVA 1VIFA 2COYA 2GCXA 4KGVB 1YWPA 1YJ9A 1KD1C 1KG1A 4OP0A 3M59A 1M2VA 3CEYA 3M55A 1W6XA 2M9UA 3A1PA 1QMCA 3REAB 3L2RA 2E1HA 1YI2T 1VQKT 2V8IA 2JN0A 2VV5A 2ABLA 2YDLA 2CREA 3H41A 2L2PA 5CO7A 2JNGA 1TOVA 2BE9B 1ZSZA 2CZ0B 5GAN6 1TTHB 4JZ4A 2FZCB 4XTWA 5KCHA 1OYXA 4HVUA 1YBYA 3X28B 1D0YA 2EQIA 2CDTA 3CCMT 1WHHA 4ZGJB 5I21A 4FW2A 4X1VA 3JCMc 4AMCA 1OOTA 3QPHA 1UEBA 1M90R 3RIRA 1VQNA 5ECAA 1TWBA 1WHGA 1WIEA 1SEMA 4DOWA 2M16A 1UGQB 2MMPA 1V1CA 1FMWA 3BDLA 2HQEA 4PLIA 1ZSGA 1D3BB 3HFOA 3CCUQ 2QDLA 4ESRA 4RG8A 1UGRB 2QAZA 1I81A 4C92B 1OU8A 2EGCA 4BY6C 1NJIC 2X3WD 1FMVA 3JSCA 4J83A 1OU9A 1PD0A 2KBTA 1BIAA 1GCPA 2XI9A 3JCMX 3E2UA 2RJFA 1WI7A 1VQ5A 4EMHA 2E3HA 5A0LA 4KT0E 3GOXA 1K9MC 1MHNA 2AKKA 1QVPA 5GAN2 3VYHB 1SRLA 1VQOA 3H0HA 1KFZA 2DO3A 4N0AC 3CMET 2ECZA 3CCLA 4ZN1A 3CMAA 1Y57A 1JO8A 2YRVA 1I07A 2W0ZA 5FU6C 1H8KA 3PVQA 3QIIA 5KH6A 1FX7A 4F7UE 5GAOm 2DYBA 4FT2A 3HRSA 3JCMQ 4BY6B 1PHTA 4QW2A 2G3RA 2KQWA 2XU8A 3G4ST 3QUIA 1F1BB 4C0ZA 4ZTJA 3CCSA 3EHQA 5CKEA 3OS1A 1YIJT 1IZ6A 3JV3A 1HD3A 5GAOl 3O5ZA 1WX6A 4OMMA 1K73C 1GFDA 2ENMA 2VUBA 2COZA 1N9RA 2PUKB 4KRTA 5KYUA 2PU9B 2BTTA 4PKCC 1N8RU 1U3OA 1ZUYA 4HCCA 1VA7A 4FYXB 3OYGA 3M53A 5FU6B 1YHQT 4KBMB 3DLLA 1AOJA 3EFOB 3TSWA 3JCMh 4GBQA 3CCRQ 2F69A 3VKIA 2PUOB 1QWEA 2DXCA 1GFCA 2QXFA 2DBMA 4GLKA 4JJBA 4A63B 2JOYA 2ZPFB 3CCJT 3PFSA 9ATCB 3DLMA 1DJ7B 1V29B 1X27A 3UF4A 5GAN3 1S1NA 2HDAA 5LJ5j 4EIKA 4BI8B 2WSCE 3CD6A 3OYIA 4NS5A 3V8LA 3JCMd 4J6XA 5FU7C 1KD1U 1S72T 4M75D 2HAXA 2DL8A 2MWPA 2EFIA 2X3XD 3C95A 3OBYA 5FRMA 4M7AD 1SF9A 3EG1A 2MCNA 3CCVQ 3MP8A 4JPBW 2KYMA 3MEWA 4KUIA 1BB9A 3CCET 3JCMV 1VQ8T 2DL4A 3FJPA 2RQUA 3G71T 2VVKA 4M75F 4IUPA 3NFCA 2VASA 1PCXA 4M7AF 3MP6A 4CC7A 1YJNT 3V7SA 3OYMA 4C5HA 3VYGA 5D6YA 1NPRA 3OYKA 3QBYA 4E7SA 1QCNA 4XTUA 5GAMj 1K76A 1GCQC 2V1QA 4DBQA 3M0RA 4C92G 1OX8A 3UA7A 5GAN5 4FYWB 3ZFJA 4FM4B 2D0NA 1NEGA 1AEYA 1JXOA 2QQRA 1XOVA 1VQLQ 1WHKA 1T3SA 1VQMQ 3CBMA 3I55T 3LWHA 1SRMA 2QQSA 1Q86C 2L5QA 2FO0A 4DQ2A 3M5AA 1VQ7Q 1VQ6Q 3RDVA 3FIFA 3VUZA 4QKUA 1YP5A 1BU1A 2KXCA 3OYCA 2K2MA 2RNAA 2X4WA 3CC7T 3EHRA 4M77C 5D7UA 1PWTA 4FU6A 2DK3A 3DB3A 3H0IA 2WSFE 2OJ2A 2P4RA 4CRIA 2LRQA 4C5GA 2L8DA 1W4SA 4M77E 1OQKA 6AT1B 1YI2A 3HKSA 2K79A 1VQKA 4WF2A 2HCKA 1YITT 1PRLC 3M4GA 1RI0A 1G3SA 4BD3A 2DL7A 1X6OA 3JB9G 1K9AA 4BDYA 2JS2A 3M0TA 3EFRA 1EZZB 2EQMA 3C12A 4X34A 4RTUA 1N8RR 4N0AA 4XTZA 1BCOA 5A0DA 1K8AC 3NTKA 1WYXA 1B3QA 2VWFA 3CCMA 2X4XA 2M02A 1W2BS 2QQBA 4XTVA 1H3HA 2QA4T 4FYYB 2QEXQ 2LT4A 3R6NA 3EFOA 3UDCA 2KMTA 3I9QA 2E3IA 3JAME 4ATOA 4KGZB 3CCQQ 2EWNA 2KSSA 2HSPA 2JS0A 1PRMC 1ZSZC 3OYYA 5C6SA 2GFAA 2P0PA 4MMLA 5CKHA 4QQ6A 1BIBA 5LJ5h 2CH4A 2DNUA 2VGMA 3OYJA 4R0KA 5J26A 3MEUA 1KD1R 1BI3A 5CAIA 2FYKA 3HPWA 2BIVA 2JT4A 1M5Q1 5IAYA 2E6NA 3JCMJ 1C0MA 4NL3A 1NYFA 5GAOp 2E4HA 4MZMA 3JB9I 4BE2A 2EYQA 2QGGA 1X43A 1MUZA 3CC4Q 1D1AA 5LJ5d 2LX9A 1R8OB 3THKA 2CSQA 3CMEA 3VS7A 4RTXA 4JRIA 4QQGA 5LJ3f 4XAXB 3G1JA 2R57A 4F7UF 2CP5A 5FWBA 2FPFA 3S6WA 2ZAEA 4LUDA 1C1AA 2PNIA 3L2UA 2COWA 2H3EB 5GAMh 2EBPA 1IRXA 2K3YA 2K4YA 2KE9A 1AT1B 1PKSA 3G4SA 4CC4B 5IH2A 4RCBA 2DD4A 4XK8E 4Y28E 3QDRB 1SSFA 4RTYA 1D1CA 1YIJA 2GQIA 2BZXA 4AT1B 1YJ9Q 1WJRA 1AZGB 3C94A 5GMKe 3CBOA 1D09B 4ELZC 1KQ1A 5GAMg 4JRQA 2A37A 2CYZB 3ZEHA 3TSZA 1H641 4A4HA 3EGDB 2LCSA 3C0CA 1GRIA 3X24B 2DIQA 2IIMA 1YHQA 4MDXA 2BKDN 1H92A 2YLBA 4XU0A 2GTJA 2LNHB 2C0IA 5I11A 3NPFA 1GCQA 1I5LA 3NGPA 1Q95G 1GXIE 3CCJA 1VQ4T 1VQNQ 2EVRA 1IHWA 2CGHA 2CZ7B 1N27A 2DKGA 2QQ9A 2K9GA 4XU2A 2LZ6B 3QWXX 2LMJA 5D6XA 2NUTB 1S72A 3G6EQ 3VJPA 1OEBA 4IUVA 4NL2A 5CCAA 4Y92A 3VRZA 5GANd 1BCMA 4J9GA 3CCEA 3D7SB 3URGA 1Q81U 2BE7D 2DZCA 1VQ8A 1M9SA 1MMGA 1VQ5Q 3G71A 2CP2A 2ATCB 1G8XA 2NWMA 3VUBA 3PTAA 4EDUA 4BE1A 2CP6A 2E41A 2LQKA 3TCJA 4PJLA 1KQ2A 2KXDA 2EKOA 1YJNA 1UHFA 2XHCA 1VQOQ 3QYGB 2I0NA 1K8AU 3M57A 3QDFA 2KROA 2DILA 3CMAQ 3VS2A 2F2WA 2K5LA 2AZVA 1WFWA 4O5VA 2JZ2A 1K0SA 2B8AA 4ELYC 2LP5A 4DBFA 4F14A 4OVAA 4FW1A 4Z8AA 4AFZC 2DTOA 2E70A 2KT1A 1VQPQ 2LDMA 1UGPB 3I55A 2ZZDA 2P84A 4C92C 5KE3A 4M77D 2IG0A 3CCSQ 4J9FA 1W2BA 2LJ1A 4B9WA 3KFVA 1M1GA 2OTLA 1XTDA 1WGSA 4B6MA 1FWZA 4HVWA 4LE9A 1VQ9Q 3PMTA 4OMFB 2M1HA 2VC8A 4C92E 4J9IA 1KC8C 3GNGA 5CQXA 3CC7A 1X2KA 3H6ZA 4M77F 4RUGA 1G3YA 3SDZA 4Y91A 3QHSA 1KSWA 2XDDA 1HJDA 4MMKA 1YITA 1OX9A 2DXTA 1GL5A 4Z88A 1QP2A 2ZCFB 2LNVA 3PGGA 3S3MA 5DM7R 1B7TA 3LWIA 1QW1A 2F2VA 4C0FA 3V8KA 4Q5WA 3SHWA 1O75A 2DAQA 3QYHB 4PK4A 1RAFB 4PJOB 2X4YA 4AG1C 4TVRA 4BDZA 3HTRA 3EGDA 2E64A 1RI9A 2QA4A 3MO8A 3CD6Q 2EJ9A 2QG9B 2KR3A 1M1KC 3TREA 2DJZA 3UPUA 2YUQA 4MZPA 2LX7A 1KHIA 3OYLA 5KE2A 1G2BA 5IXFA 3NTIA 1HXDA 2X35A 2HEQA 4KUDK 3AHUA 1LCKA 2ZGWA 3X20B 4AFQC 1T3LA 2JTFA 3EG9B 1W2BP 5IHIA 1UHCA 2NUTA 2CT4A 2C06A 2AK5A 1KIKA 2LCLA 1BYMA 2DA9A 3NHNA 4EMKB 1VQMT 4NOYA 1Q81R 2GFUA 3X25B 3HRTA 3SWNC 2DL5A 2MOXA 1AWJA 4J5YA 3CPWS 3QG1A 1RLQC 1Q82C 3OS5A 4E7HA 5C0MA 2A3LA 3M56A 1LVKA 2EIFA 1KQSS 1K8AR 3QJ6A 3UWNA 3JCMf 1ZBJA 3PE0A 4O6JA 4GLMA 3MP1A 2OTJQ 2KRSA 3OYHA 3EG3A 1XNIA 3QSUA 2X9HA 3G7ZA 2D8JA 2DEQA 3V8JA 4E2FB 2YXYA 2F2XA 3H8ZA 1PSEA 2RM4A 3M0UA 4QQDA 4RTTA 1ZQ1A 2XIDA 1TG0A 1ZHIA 1J3TA 1WJQA 3META 5GAOq 4LD9K 2A7YA 1NG2A 4HVVA 2PVDB 2RI2A 1TUGB 4YTLA 2PVOB 2E12A 5FW9A 2F5KA 2ED1A 3SWNB 1Q7YU 4PL6A 3C4SA 3CXCS 1YI2Q 1YNZA 1VQKQ 3SB2A 4QVDA 2QI2A 3P8BB 3V7RA 2CSIA 2QEXT 4II1A 2C0TA 4JLIA 1YCSB 2J06A 3U23A 2L89A 1X69A 1X6BA 2H3JA 3CCQT 1UFFA 3QKJA 1QVGS 3PT9A 2EQJA 4EPCA 1QP3A 1ZBXA 3CCMQ 1M4ZA 3J7AF 1LOJA 1SHGA 5IHNA 3EG2A 1QWFA 3L42A 4ZGEB 3M4YA 3HHTB 2AT1B 1VQ4A 3TQ7P 2O4XB 1FXXA 4IURA 1E7OA 4LDVA 2DPPB 2MK5A 1D3BA 1KC8U 3BDUA 7AT1B 1G83A 2RPNA 4AFSC 5DLOA 5LJ3e 4PJOA 3FRNA 4C92A 2GTOA 3HRUA 2CZ6B 5KCOA 2GGRA 1OPLA 1CKBA 2L3SA 4J9BA 2WSEE 2F5TX 2ESWA 5AYFA 1ZUUA 4M78B 4LN2A 2BZYA 2FRWA 2L3RA 4PJOG 5EG2A 4QT7A 3PIOA 1RAGB 1M90C 4E7LA 1IHVA 5AT1B 2QDYB 1WHLA 2M0OA 5KYXB 1VYUA 1N9SA 1WA7A 2FL7A 4XQ3A 4D8DA 4C8QC 1YJWT 1MMDA 4B9XA 1XQHA 1B34B 3CMEQ 4J9EA 1NJIU 2VKNA 3EG9A 3R6OA 1GBQA 2HQHA 3EH2A 1M3CA 4OF1A 5GANe 4C92D 5I2MA 4EMKA 1M1KU 4OMQA 3RESA 2GNCA 1YJ9T 1UTIA 1LJOA 1IREB 1P92A 1OZ2A 4OMPA 4N4HA 2HD0A 1U1TA 1K9MU 3ASKA 2K3BA 3GBQA 5GJWB 4C92F 4RG2A 3I56T 3E1SA 2GBQA 3ZL7C 3HFNA 4M7DB 2ZPIB 1RAAB 3CC2T 3A8MB 2KRMA 4KH0B 1BBZA 1AWXA 3OYDA 2DTHA 3NTHA 2KNBB 2EQKA 1WQ7A 2YUNA 2O9VA 4N4GA 4C8QB 1WHJA 2YUOA 5IT9E 2QTVA 3RKYA 5LJ5f 2RI3A 3RKXA 2YRDA 4ANJA 1ABQA 2O31A 4DEYA 2FRYA 5HCKA 1Q82U 2DE0X 2G6FX 4Z89A 2RHIA 1YHQQ 5KYYB 1Q7YR 2DERA 4ZNXA 2AIRB 3FEOA 3JB9D 1HYOA 4BI3A 3REBB 3SWNA 1RADB 3SD4A 2V8KA 3G6ET 3MEVA 3OSVA 2JUFA 1K73U 1AWOA 2E6ZA 2HZYA 4FT4A 2NUZA 4PJMA 1NM7A 3CPWA 3JB9F 2DVJA 5HY6A 4J9DA 5CIUA 2MIOA 1EX4A 1A0NB 3FLGA 2RO0A 4L6V5 1M3BA 1KQSA 2VB6A 3P8HA 3X26B 2HKQB 3L2QA 4FYVB 4J6YA 1S72Q 1ARKA 2O2OA 4DOVA 2O4XA 2CP3A 4ZGDB 1KC8R 2MI6A 2CKKA 1WXBA 1PKTA 3CCEQ 1UGSB 3I35A 1VQ8Q 3L2WA 3UATA 3G71Q 3VRYA 2NUPB 3E19A 5GMKi 1TS9A 1YJNQ 3OW2S 4M78A 2RHXA 3HL8A 1VQPT 2DRKA 4OMOA 3TU4K 1VQMA 4HKEA 1I8FA 1OI1A 1OV3A 2JTEA 3DB4A 3CXCA 4N4IA 1WNLA 2P0KA 1PG5B 4R56A 3CQTA 4OB0B 1VQ9T 1NPPA 3EH1A 3RMSA 4F04B 2JM9A 1BI0A 2K5FA 4M78G 3JB9J 4JS5A 5KYXA 2O01E 1WZOA 2D9TA 3EG0A 1NJIR 4RCCA 2L0AA 5GAN8 1UG1A 2FEIA 1QVGA 2HSEB 4A54A 4FIBA 1FYNA 2RB6A 3VV0A 1RL2A 2ED0A 5GAMd 3OYEA 4DBRA 4JRPA 4KULA 1M1KR 3PVLA 2OTLQ 2DM1A 5GANf 3OBWA 8ATCB 1K9MR 3CC7Q 3RKWA 4OGCA 3CPWP 4WCIA 2EPDA 3OS2A 3CCUT 4JJDA 5HK0A 4FL6A 1TH7A 1RLPC 1TSFA 1U8RA 2HKNA 1KQSP 2DEUA 3TVTA 3QZ5B 5KYWB 2A0FB 4J6WA 2BZ8A 2RI5A 1Q86U 4XTYA 3OY9A 1AVZC 4HCKA 2CT3A 2J05A 2QEXA 5GAN7 2DX1A 5LJ3g 2E5QA 2FB7A 1UJ0A 1UUEA 2ROTA 2M51A 4A4EA 3CCQA 4C8QA 2EW3A 2CH4W 1E6HA 4M7DG 1EIFA 3MPUB 3KUFA 3RNJA 5GMKj 1WPYA 2J6FA 2D0QB 2CUBA 2RN8A 1Q82R 4ZN3A 1ACMB 2K7AA 1EFNA 3OA6A 4JUVA 2RQRA 1NBEB 2HL3A 3M0PA 2NYSA 2QA4Q 3UT1A 5KYYA 3INZA 4JS4A 4C8QG 1X6GA 4D8KA 2KAFA 3VU3C 3CXCP 3NMZC 4QVCA 3JRZA 3EFSA 1K73R 1UJYA 2KY9A 3OMCA 3E9GA 4DA4A 2RK2A 1UGVA 2DXBA 5I22A 3OYFA 4F17A 2DXUA 1M8VA 1AZEA 2K5IA 2V1RA 3H9NA 3JCMe 1QVGP 4QVZA 2RJEA 3VS3A 1Y96B 3VS1A 2XKOC 5GAN4 5FWCA 1U06A 3CCLQ 3T9NA 5L23A 1FMKA 3FDRA 2PZ1A 4C8QD 3VS6A 1MMNA 1Z9QA 2MF2A 3JB9H 1X2QA 2YUPA 4J9CA 4OGEA 1KHCA 4V2SA 1MV3A 1JJ2S 1AD5A 4PNOA 2OTJT 2XD0A 1YJWA 1D0ZA 4PJOC 3WXMB 4C8QF 2RQVA 3KBGA 2LJ0A 2NUPA 2VXEA 2DVEA 3GF5A 4DBHA 4M75B 3QO3A 1ABOA 1QKXA 2C0OA 4PJOE 4M7AB 5I2SA 4BE0A 2KT8A 2BUDA 2HBWA 3CCRT 1RUWA 4XU1A 1G3TA 4BUGA 5KYNA 4KGXB 1BK2A 4JZ3A 4ORZA 1IGUA 4M4ZA 3I56A 2EQUA 2HBPA 2XDPA 2JMAA 3A8OB 3L2VA 2QASA 4HT8A 3CC2A 2E5KA 2R58A 4HCZA 4PLLA 3SFMA 2EJGA 1LNXA 1R77A 4D6WA 1N6AA 3OB9A 3M9QA 1IGQA 2K6DA 2I2LA 2RHUA 5CVIA 1YWOA 3HP9A 4EMKC 1BKBA 3H0FA 4Z02A 2DYIA 2LQWA 3RBBB 1ZA1B 3CCVT 1NEBA 1YFNA 1WQWA 2KDSA 1QLYA 5CKDA 3O8VA 1SKUB 5IHKA 2RH2A 4LXCA 5GAOr 4AG2C 2PVGB 1YCYA 1Q86R 2O9SA 5KYWA 3OW2A 1ZX6A 4AFUC 3G6EA 2DZ9A 2PTKA 1AHJB 4HXJA 2ZPBB 3VS4A 1VQ4Q 1SHFA 3IQLA 2XICA 3A8GB 1BI1A 2ROLA 2J7IA 3LH5A 3E9FA 2PQWA 4J7IA 5CK9A 2MPXC 2X51A 1M3AA 3M0QA 3A5ZB 3P8DA 5GMKh 2XK0A 2JJ9A 5FLXE 3EGXB 4C5IA 4C5EA 1AWWA 4J9HA 1VQLT 2LQ8A 2FVUA 4A4FA 1I0CA 1VQ7T 2HQXA 1LPLA 1VQ6T 2OAUA 3J80E 2CZ1B 1KK7A 2M0YA 3VS0A 2YSQA 2EGAA 4PFPA 2MWOA 4VUBA 2Y90A 4L59A 1VYVA 4A53A 4WTOB 1IO6A 4HT9A 4PJJA 2FPDA 1YN8A 3I5RA 2X4JA 2KRNA 2A28A 4F16A 2MAMA 1PNJA 2W10A 3QWYA 1WXTA 1VQPA 1Y96A 4E7JA 5FROA 2XDBA 3GIBA 1RAEB 3QJYA 1M30A 3V7CA 2JXBA 2AZSA 3LGLA 2F1LA 1VQ9A 5LJ5e 2DIGA 2OX7A 4HCBA 1JU5C 1QVFS 2EYXA 1KJWA 1QKWA 3OYAA 2RJDA 4OMLA 1O9SA 1JXMA 2CUDA 2EYZA 1I1JA 4R55A 4E7IA 4RTWA 4M75A 2H8HA 4OB2B 4CC2A 1Y71A 2RHZA 4M78C 3OW2P 3GPLA 5L8RE 4M7AA 1W1FA 3DKMA 1JQQA 3QXEB 3LW5E 4F7UB 1WHMA 3QZ9B 4HA8A 3N5BB 3UA6A 3AT1B 4IUTA 4M78E 2B86A 1RAIB 4M75G 1SG5A 1D1BA 3CCUA 2K57A 2CS7A 4GY5A 4M7AG 4ZTFA 2SRCA 2P0QA 2HNIA 5GAMe 2KYBA 1JBMA 4BB7A 2RJCA 2DBKA 2V26A 1TUDA 3Q1JA 2ZPGB 3L1AA 2GQVA 2RK1A 2K3XA 3JCMg 2RQTA 2GF7A 1JJ2A 1ZA2B 2DF6A 3CC4T 2LCCA 2NLUA 3MCAB 4FSSA 1CSKA 1C6VX 3OYBA 2CP7A 3HSBA 1OULA 4OMNA 1TUCA 4M7DC 4XTXA 5D6WA 2IVWA 2D8HA 1PSFA 1PC0A 1NLPC 4IIMA 4M7DE 2D6FA 1ZLMA 2Y4XA 4RKUE 4RTZA 2P4TA 4UC4A 2ZPEB 3LX7A 3LYIA 4RTVA 2DFUA 1OZ3A 3A8HB 3ME9A 4JLGA 3EGXA 1NZ9A 2VXFA 2EJFA 2RA2A 5GJVB 3M58A 4C8QE 1K0XA 4PJOD 3MJXA 4E47A 5LJ3j 2EGEA 1VUBA 1H3ZA 1UDLA 1OPKA 1G5VA 2K2VA 5FU7B 3WVDB 2FPEA 2VYTA 4RMOA 2SEMA 1Y07A 1QCOA 1RAHB 1VIEA 2QYZA 2L3QA 5IN1A 2OTJA 1N5ZA 2IPOB 4PJOF 2OTLT 2DTIA 5J39A 3G4SQ 1I5OB 3RUXA 5EC7A 5M9OA 3CBPA 5DLQE 4CC3A 1YIJQ 3KXTA 1WLPB 3CPFA 2E10A 1IB8A 3L2ZA 4J7FA 2Z0WA 3VS5A 1T0JA 2RMOA 3CCRA 2LT1A 1ZUKA 2YHTA 5GMKm 3PIPA 4KH1B 4CI0C 1VQNT 1Q81C 1JJ2P 2A36A 5HKCA 4JJNK 5GANj 3PNWC 4P5NA 1V76A 2R5MA 3OS0A 4BACA 1T0HA 4LDXA 5GMKl 3F70A 4X9DA 4IUQA 2CP0A 2LVMA 4F7UA 3CCJQ 2KEAA 3TEEA 2L3PA 3CCVA 3JCMP 1UB4A 3RMQA 4JDSA 4PFZA 1B07A 1VYTA 4M77B 1VQ5T 1NE8A 1R0CB 2RQWA 4IKFA 3OMGA 2JM8A 4F7UG 2QGFB 2QQAA 1QQJA 2LQNA 2LJ3A 4IIOA 3BFMA 1QCFA 3S3OA 2RF0A 1VQOT 1PD1A 2FG0A 5GAMf 3M54A 2QTXA 2KGTA 1I4K1 1Y7XA 2DLPA 4XU3A 4ME7A 3CCLT 3JCMb 2WACA 2YT6A 1U1SA 3CMAT 1RACB 2YWWA 4C0GA 5CR2A 4FCYA 1SSHA 3OYNA 2Y4YA 3JCMW 1QVFA 1M27C 4FSXA 3FJ5A 1BI2A 4E7KA 3BY7A 2V8JA 2DETA 3ULRB 1VQLA 2J6OA 2O88A 3BW1A 1JRIA 1HSQA 1M2VB 5FRNA 5A0GA 4JRKA 5LJ5g 3CCST 1VQ7A 4MDWA 5CKFA 1WXUA 1VQ6A 4C0DC 2J6KA 2D1XA 2AKLA 4X9CA 1TU0B 2DL3A 1ZSZB 3LH0A 8AT1B 3EGUA 5J3BA 1B34A 3MKDA 1YJWQ 1MGQA 3I55Q 4J8OA 2HMAA 5CQYA 1PM3A 3A98A 3SEMA 2KVQG 5LJ3h 4LD6A 1MNEA 3MEAA 2EYYA 2XMFA 2VGNA 2JW4A 2MYSA 4M78D 1M90U 2QK0A 1SPKA 1M8MA 2FHDA 2HL5C 1MNDA 1JB0E 3I5SA 3EAEA 2LC4A 1K1ZA 1VOMA 1JEGA 3M0SA 1D0XA 1RABB 4LDYA 2E65A 1TXQA 4OB3B 3I56Q 3PMIA 3FC3A 1Y0MA 3RERA 4M7DA 4DEXA 4M78F 1NLOC 4C0DB 1YITQ 4A4GA 1M1FA 3FB9A 4A4KA 5LJ3d 3CC2Q 4LDWA 2EYWA 3CD6T
chains in the Genus database with same CATH topology
1X6BA 2LQWA 3RBBB 1UFFA 4K11A 1NEBA 1H3HA 1MV0B 3R6NA 1QLYA 3I9QA 1SHGA 5IHNA 3EG2A 1QWFA 4E6RA 5IHKA 2JMCA 4AG2C 2O9SA 2HSPA 2JS0A 1ZX6A 1PRMC 4AFUC 1E7OA 1UECA 2PTKA 4HXJA 1G83A 2RPNA 2CH4A 2DRMA 2DNUA 1SHFA 3VS4A 4AFSC 3IQLA 4R0KA 2GTOA 1GBRA 4LUEA 2ROLA 2GGRA 2J7IA 3LH5A 2OAWA 1OPLA 1CKBA 2DJQA 2L3SA 1CKAA 4J9BA 5IXBA 1M3AA 1NYGA 3M0QA 2ESWA 1Z9ZA 1ZUUA 1U5SA 2JT4A 4LN2A 2BZYA 1W70A 2FRWA 1AWWA 1E6GA 1NYFA 4J9HA 1X43A 1MUZA 4QT7A 4JJCA 1I0CA 3THKA 2CSQA 3VS7A 4RTXA 2M0YA 2OI3A 3VS0A 2YSQA 2EGAA 1VYUA 1K4US 1WA7A 2EKHA 4D8DA 1VYVA 5FWBA 1IO6A 2DMOA 2FPDA 2FPFA 1YN8A 3I5RA 4J9EA 2KRNA 4LUDA 2A28A 2VKNA 4F16A 1UE9A 2PNIA 1WDXA 1PNJA 2W10A 3QWYA 1WXTA 1GBQA 1M3CA 4LNPA 2EBPA 2KE9A 4OMQA 2A08A 2GNCA 1M30A 1UTIA 1PKSA 4CC4B 5IH2A 1YWPA 4OMPA 2JXBA 2AZSA 4RTYA 1JU5C 1W6XA 2BZXA 2GQIA 2K3BA 2EYXA 3GBQA 3REAB 1KJWA 5GJWB 1QKWA 2GBQA 3ZL7C 1AZGB 2ABLA 2YDLA 4OMLA 2CREA 3H41A 2L2PA 1JXMA 2CUDA 2EYZA 2KRMA 1I1JA 1BBZA 1AWXA 4RTWA 4JZ4A 2H8HA 4CC2A 2KNBB 2A37A 1W1FA 3TSZA 1JQQA 4HVUA 2EQIA 2YUNA 2O9VA 2LCSA 2CDTA 3C0CA 1GRIA 2IIMA 2YUOA 3UA6A 4X1VA 1H92A 1OOTA 2GTJA 2B86A 2LNHB 1ABQA 2C0IA 2O31A 5ECAA 2FRYA 5HCKA 4DEYA 5I11A 3NPFA 1WIEA 1GCQA 2DE0X 2G6FX 1SEMA 4Z89A 3NGPA 1V1CA 4ZNXA 2SRCA 1ZSGA 3REBB 2EVRA 2QDLA 4ESRA 2KYBA 2DBKA 2EGCA 1TUDA 1AWOA 2X3WD 2K9GA 2NUZA 2LZ6B 1NM7A 3QWXX 2LMJA 2DVJA 2RQTA 4J9DA 2KBTA 2MIOA 1GCPA 1A0NB 2DF6A 1M3BA 1OEBA 1WI7A 4FSSA 4Y92A 1CSKA 3VRZA 2AKKA 4J9GA 1ARKA 4OMNA 1TUCA 1SRLA 2O2OA 3H0HA 2D8HA 1KFZA 2NWMA 1WXBA 1PKTA 2ECZA 3I35A 1NLPC 1Y57A 4IIMA 2KXDA 1JO8A 1UHFA 3UATA 3VRYA 1I07A 2I0NA 1ZLMA 4RTZA 2W0ZA 1H8KA 3PVQA 4RTVA 2KROA 2DILA 3VS2A 2F2WA 2AZVA 1WFWA 2DRKA 4OMOA 1K0SA 2DYBA 5GJVB 1K0XA 1OV3A 2LP5A 2JTEA 1PHTA 2EGEA 1UDLA 1OPKA 4F14A 4Z8AA 4AFZC 3CQTA 2FPEA 2KT1A 3EHQA 2SEMA 2JM9A 2L3QA 3JV3A 1HD3A 1N5ZA 3EG0A 3O5ZA 4J9FA 2L0AA 2LJ1A 1UG1A 2FEIA 3KFVA 1WX6A 5EC7A 4OMMA 4HVWA 4LE9A 1FYNA 1GFDA 4CC3A 4J9IA 2ENMA 1WLPB 2ED0A 1X2KA 3PVLA 4KRTA 2DM1A 3VS5A 1T0JA 2RMOA 2BTTA 4RUGA 1U3OA 1ZUYA 1ZUKA 1VA7A 1KSWA 1AOJA 3TSWA 4WCIA 2EPDA 4GBQA 1HJDA 2A36A 4JJDA 1GL5A 1QWEA 4Z88A 1RLPC 1GFCA 2DBMA 4JJBA 3TVTA 4A63B 2BZ8A 2F2VA 1X27A 3UF4A 1AVZC 1T0HA 4HCKA 2CT3A 2J05A 1S1NA 2HDAA 3SHWA 4EIKA 2DX1A 1UJ0A 1UUEA 4AG1C 2ROTA 2M51A 2KEAA 2L3PA 2EW3A 2CH4W 1E6HA 1RI9A 3RNJA 2J6FA 2CUBA 2RN8A 2DL8A 2X3XD 2K7AA 1EFNA 2KR3A 1B07A 1VYTA 3EG1A 2MCNA 2RQRA 4JPBW 2RQWA 2YUQA 3M0PA 2JM8A 2KYMA 1BB9A 2LQNA 2LX7A 1X6GA 2LJ3A 1G2BA 4IIOA 4D8KA 2DL4A 5IXFA 1QCFA 3NMZC 2RQUA 2RF0A 2VVKA 2FG0A 2HEQA 1UJYA 2KGTA 2DLPA 2YT6A 1LCKA 1UGVA 5I22A 4CC7A 4AFQC 1T3LA 4F17A 1AZEA 1SSHA 2V1RA 5IHIA 1UHCA 1M27C 3VS3A 2CT4A 3FJ5A 3VS1A 1K76A 2AK5A 1KIKA 1GCQC 2V1QA 5FWCA 3M0RA 1U06A 2DA9A 3NHNA 5L23A 1FMKA 3ULRB 2PZ1A 3UA7A 2J6OA 3VS6A 2O88A 1Z9QA 2DL5A 2MOXA 2D0NA 1X2QA 1HSQA 2YUPA 4J9CA 1AWJA 1NEGA 1AEYA 1JXOA 1WXUA 1MV3A 1XOVA 1RLQC 1T3SA 1AD5A 1SRMA 2J6KA 2D1XA 2AKLA 2FO0A 2RQVA 2DL3A 2LJ0A 1ZBJA 3PE0A 1YP5A 3EGUA 1BU1A 2KXCA 2K2MA 4GLMA 1ABOA 1QKXA 2C0OA 2KRSA 2RNAA 3EG3A 2D8JA 3EHRA 3A98A 2KT8A 3SEMA 1PWTA 2HBWA 3H0IA 1RUWA 2F2XA 2EYYA 2OJ2A 2P4RA 2XMFA 3M0UA 2JW4A 4RTTA 1TG0A 1J3TA 1BK2A 4JZ3A 4ORZA 2K79A 4M4ZA 1NG2A 1M8MA 1SPKA 4HVVA 2HCKA 3I5SA 1PRLC 1K1ZA 1JEGA 2JMAA 3M0SA 5FW9A 2E5KA 2DL7A 2ED1A 1K9AA 1YNZA 2JS2A 3M0TA 1Y0MA 2K6DA 2CSIA 4DEXA 4RTUA 1NLOC 1YWOA 2C0TA 1YCSB 2J06A 3U23A 3H0FA 2EYWA 1X69A 1WYXA 1B3QA 2VWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6B A;  2LQW A;  3RBB B;  1UFF A;  4K11 A;  1NEB A;  1H3H A;  1MV0 B;  3R6N A;  1QLY A;  3I9Q A;  1SHG A;  5IHN A;  3EG2 A;  1QWF A;  4E6R A;  5IHK A;  2JMC A;  4AG2 C;  2O9S A;  2HSP A;  2JS0 A;  1ZX6 A;  1PRM C;  4AFU C;  1E7O A;  1UEC A;  2PTK A;  4HXJ A;  1G83 A;  2RPN A;  2CH4 A;  2DRM A;  2DNU A;  1SHF A;  3VS4 A;  4AFS C;  3IQL A;  4R0K A;  2GTO A;  1GBR A;  4LUE A;  2ROL A;  2GGR A;  2J7I A;  3LH5 A;  2OAW A;  1OPL A;  1CKB A;  2DJQ A;  2L3S A;  1CKA A;  4J9B A;  5IXB A;  1M3A A;  1NYG A;  3M0Q A;  2ESW A;  1Z9Z A;  1ZUU A;  1U5S A;  2JT4 A;  4LN2 A;  2BZY A;  1W70 A;  2FRW A;  1AWW A;  1E6G A;  1NYF A;  4J9H A;  1X43 A;  1MUZ A;  4QT7 A;  4JJC A;  1I0C A;  3THK A;  2CSQ A;  3VS7 A;  4RTX A;  2M0Y A;  2OI3 A;  3VS0 A;  2YSQ A;  2EGA A;  1VYU A;  1K4U S;  1WA7 A;  2EKH A;  4D8D A;  1VYV A;  5FWB A;  1IO6 A;  2DMO A;  2FPD A;  2FPF A;  1YN8 A;  3I5R A;  4J9E A;  2KRN A;  4LUD A;  2A28 A;  2VKN A;  4F16 A;  1UE9 A;  2PNI A;  1WDX A;  1PNJ A;  2W10 A;  3QWY A;  1WXT A;  1GBQ A;  1M3C A;  4LNP A;  2EBP A;  2KE9 A;  4OMQ A;  2A08 A;  2GNC A;  1M30 A;  1UTI A;  1PKS A;  4CC4 B;  5IH2 A;  1YWP A;  4OMP A;  2JXB A;  2AZS A;  4RTY A;  1JU5 C;  1W6X A;  2BZX A;  2GQI A;  2K3B A;  2EYX A;  3GBQ A;  3REA B;  1KJW A;  5GJW B;  1QKW A;  2GBQ A;  3ZL7 C;  1AZG B;  2ABL A;  2YDL A;  4OML A;  2CRE A;  3H41 A;  2L2P A;  1JXM A;  2CUD A;  2EYZ A;  2KRM A;  1I1J A;  1BBZ A;  1AWX A;  4RTW A;  4JZ4 A;  2H8H A;  4CC2 A;  2KNB B;  2A37 A;  1W1F A;  3TSZ A;  1JQQ A;  4HVU A;  2EQI A;  2YUN A;  2O9V A;  2LCS A;  2CDT A;  3C0C A;  1GRI A;  2IIM A;  2YUO A;  3UA6 A;  4X1V A;  1H92 A;  1OOT A;  2GTJ A;  2B86 A;  2LNH B;  1ABQ A;  2C0I A;  2O31 A;  5ECA A;  2FRY A;  5HCK A;  4DEY A;  5I11 A;  3NPF A;  1WIE A;  1GCQ A;  2DE0 X;  2G6F X;  1SEM A;  4Z89 A;  3NGP A;  1V1C A;  4ZNX A;  2SRC A;  1ZSG A;  3REB B;  2EVR A;  2QDL A;  4ESR A;  2KYB A;  2DBK A;  2EGC A;  1TUD A;  1AWO A;  2X3W D;  2K9G A;  2NUZ A;  2LZ6 B;  1NM7 A;  3QWX X;  2LMJ A;  2DVJ A;  2RQT A;  4J9D A;  2KBT A;  2MIO A;  1GCP A;  1A0N B;  2DF6 A;  1M3B A;  1OEB A;  1WI7 A;  4FSS A;  4Y92 A;  1CSK A;  3VRZ A;  2AKK A;  4J9G A;  1ARK A;  4OMN A;  1TUC A;  1SRL A;  2O2O A;  3H0H A;  2D8H A;  1KFZ A;  2NWM A;  1WXB A;  1PKT A;  2ECZ A;  3I35 A;  1NLP C;  1Y57 A;  4IIM A;  2KXD A;  1JO8 A;  1UHF A;  3UAT A;  3VRY A;  1I07 A;  2I0N A;  1ZLM A;  4RTZ A;  2W0Z A;  1H8K A;  3PVQ A;  4RTV A;  2KRO A;  2DIL A;  3VS2 A;  2F2W A;  2AZV A;  1WFW A;  2DRK A;  4OMO A;  1K0S A;  2DYB A;  5GJV B;  1K0X A;  1OV3 A;  2LP5 A;  2JTE A;  1PHT A;  2EGE A;  1UDL A;  1OPK A;  4F14 A;  4Z8A A;  4AFZ C;  3CQT A;  2FPE A;  2KT1 A;  3EHQ A;  2SEM A;  2JM9 A;  2L3Q A;  3JV3 A;  1HD3 A;  1N5Z A;  3EG0 A;  3O5Z A;  4J9F A;  2L0A A;  2LJ1 A;  1UG1 A;  2FEI A;  3KFV A;  1WX6 A;  5EC7 A;  4OMM A;  4HVW A;  4LE9 A;  1FYN A;  1GFD A;  4CC3 A;  4J9I A;  2ENM A;  1WLP B;  2ED0 A;  1X2K A;  3PVL A;  4KRT A;  2DM1 A;  3VS5 A;  1T0J A;  2RMO A;  2BTT A;  4RUG A;  1U3O A;  1ZUY A;  1ZUK A;  1VA7 A;  1KSW A;  1AOJ A;  3TSW A;  4WCI A;  2EPD A;  4GBQ A;  1HJD A;  2A36 A;  4JJD A;  1GL5 A;  1QWE A;  4Z88 A;  1RLP C;  1GFC A;  2DBM A;  4JJB A;  3TVT A;  4A63 B;  2BZ8 A;  2F2V A;  1X27 A;  3UF4 A;  1AVZ C;  1T0H A;  4HCK A;  2CT3 A;  2J05 A;  1S1N A;  2HDA A;  3SHW A;  4EIK A;  2DX1 A;  1UJ0 A;  1UUE A;  4AG1 C;  2ROT A;  2M51 A;  2KEA A;  2L3P A;  2EW3 A;  2CH4 W;  1E6H A;  1RI9 A;  3RNJ A;  2J6F A;  2CUB A;  2RN8 A;  2DL8 A;  2X3X D;  2K7A A;  1EFN A;  2KR3 A;  1B07 A;  1VYT A;  3EG1 A;  2MCN A;  2RQR A;  4JPB W;  2RQW A;  2YUQ A;  3M0P A;  2JM8 A;  2KYM A;  1BB9 A;  2LQN A;  2LX7 A;  1X6G A;  2LJ3 A;  1G2B A;  4IIO A;  4D8K A;  2DL4 A;  5IXF A;  1QCF A;  3NMZ C;  2RQU A;  2RF0 A;  2VVK A;  2FG0 A;  2HEQ A;  1UJY A;  2KGT A;  2DLP A;  2YT6 A;  1LCK A;  1UGV A;  5I22 A;  4CC7 A;  4AFQ C;  1T3L A;  4F17 A;  1AZE A;  1SSH A;  2V1R A;  5IHI A;  1UHC A;  1M27 C;  3VS3 A;  2CT4 A;  3FJ5 A;  3VS1 A;  1K76 A;  2AK5 A;  1KIK A;  1GCQ C;  2V1Q A;  5FWC A;  3M0R A;  1U06 A;  2DA9 A;  3NHN A;  5L23 A;  1FMK A;  3ULR B;  2PZ1 A;  3UA7 A;  2J6O A;  3VS6 A;  2O88 A;  1Z9Q A;  2DL5 A;  2MOX A;  2D0N A;  1X2Q A;  1HSQ A;  2YUP A;  4J9C A;  1AWJ A;  1NEG A;  1AEY A;  1JXO A;  1WXU A;  1MV3 A;  1XOV A;  1RLQ C;  1T3S A;  1AD5 A;  1SRM A;  2J6K A;  2D1X A;  2AKL A;  2FO0 A;  2RQV A;  2DL3 A;  2LJ0 A;  1ZBJ A;  3PE0 A;  1YP5 A;  3EGU A;  1BU1 A;  2KXC A;  2K2M A;  4GLM A;  1ABO A;  1QKX A;  2C0O A;  2KRS A;  2RNA A;  3EG3 A;  2D8J A;  3EHR A;  3A98 A;  2KT8 A;  3SEM A;  1PWT A;  2HBW A;  3H0I A;  1RUW A;  2F2X A;  2EYY A;  2OJ2 A;  2P4R A;  2XMF A;  3M0U A;  2JW4 A;  4RTT A;  1TG0 A;  1J3T A;  1BK2 A;  4JZ3 A;  4ORZ A;  2K79 A;  4M4Z A;  1NG2 A;  1M8M A;  1SPK A;  4HVV A;  2HCK A;  3I5S A;  1PRL C;  1K1Z A;  1JEG A;  2JMA A;  3M0S A;  5FW9 A;  2E5K A;  2DL7 A;  2ED1 A;  1K9A A;  1YNZ A;  2JS2 A;  3M0T A;  1Y0M A;  2K6D A;  2CSI A;  4DEX A;  4RTU A;  1NLO C;  1YWO A;  2C0T A;  1YCS B;  2J06 A;  3U23 A;  3H0F A;  2EYW A;  1X69 A;  1WYX A;  1B3Q A;  2VWF A; 
#chains in the Genus database with same CATH topology
 5LL6 S;  4K11 A;  4OB1 B;  1MV0 B;  5GAO n;  2R5A A;  3GP8 A;  1QVF P;  3OSS C;  2FZG B;  3ER0 A;  2YRC A;  5GAN h;  2ZPH B;  2EAY A;  4E6R A;  2FZK B;  2JMC A;  4LDU A;  3RR6 A;  4EMG A;  4MZT A;  1G3W A;  1UEC A;  4M75 C;  5DY9 A;  2DRM A;  3A8L B;  5CKB A;  4M7A C;  1HK9 A;  4BI4 A;  3GNF B;  2KK4 A;  2JTM A;  1MMA A;  5A2Q E;  1GBR A;  4LUE A;  2OAW A;  4M75 E;  4M7D D;  2DJQ A;  1CKA A;  5IXB A;  3OQ5 A;  1NYG A;  2YLC A;  3BE3 A;  1Z9Z A;  4M7A E;  4IUU A;  1U5S A;  2KI7 A;  3CC4 A;  1W70 A;  1M2O A;  3S3N A;  1E6G A;  3LGF A;  1R0B G;  1N8R C;  4M77 A;  5GAN g;  4L5G A;  2LTO A;  2RD1 A;  1IXD A;  4JJC A;  4M7D F;  2DD5 A;  3J81 E;  2OI3 A;  3MHX A;  1Q7Y C;  4M77 G;  1K4U S;  2EKH A;  1XJW B;  2AHJ B;  1X01 A;  4PJN A;  2DMO A;  2XG8 D;  1X75 C;  4PFO A;  3LLR A;  1UE9 A;  1WDX A;  3WVE B;  2RHY A;  5HK3 A;  4E7Z A;  1WJS A;  4LNP A;  5KYU B;  3ZBD A;  3GLX A;  2A08 A;  2JVV A;  1VIF A;  2COY A;  2GCX A;  4KGV B;  1YWP A;  1YJ9 A;  1KD1 C;  1KG1 A;  4OP0 A;  3M59 A;  1M2V A;  3CEY A;  3M55 A;  1W6X A;  2M9U A;  3A1P A;  1QMC A;  3REA B;  3L2R A;  2E1H A;  1YI2 T;  1VQK T;  2V8I A;  2JN0 A;  2VV5 A;  2ABL A;  2YDL A;  2CRE A;  3H41 A;  2L2P A;  5CO7 A;  2JNG A;  1TOV A;  2BE9 B;  1ZSZ A;  2CZ0 B;  5GAN 6;  1TTH B;  4JZ4 A;  2FZC B;  4XTW A;  5KCH A;  1OYX A;  4HVU A;  1YBY A;  3X28 B;  1D0Y A;  2EQI A;  2CDT A;  3CCM T;  1WHH A;  4ZGJ B;  5I21 A;  4FW2 A;  4X1V A;  3JCM c;  4AMC A;  1OOT A;  3QPH A;  1UEB A;  1M90 R;  3RIR A;  1VQN A;  5ECA A;  1TWB A;  1WHG A;  1WIE A;  1SEM A;  4DOW A;  2M16 A;  1UGQ B;  2MMP A;  1V1C A;  1FMW A;  3BDL A;  2HQE A;  4PLI A;  1ZSG A;  1D3B B;  3HFO A;  3CCU Q;  2QDL A;  4ESR A;  4RG8 A;  1UGR B;  2QAZ A;  1I81 A;  4C92 B;  1OU8 A;  2EGC A;  4BY6 C;  1NJI C;  2X3W D;  1FMV A;  3JSC A;  4J83 A;  1OU9 A;  1PD0 A;  2KBT A;  1BIA A;  1GCP A;  2XI9 A;  3JCM X;  3E2U A;  2RJF A;  1WI7 A;  1VQ5 A;  4EMH A;  2E3H A;  5A0L A;  4KT0 E;  3GOX A;  1K9M C;  1MHN A;  2AKK A;  1QVP A;  5GAN 2;  3VYH B;  1SRL A;  1VQO A;  3H0H A;  1KFZ A;  2DO3 A;  4N0A C;  3CME T;  2ECZ A;  3CCL A;  4ZN1 A;  3CMA A;  1Y57 A;  1JO8 A;  2YRV A;  1I07 A;  2W0Z A;  5FU6 C;  1H8K A;  3PVQ A;  3QII A;  5KH6 A;  1FX7 A;  4F7U E;  5GAO m;  2DYB A;  4FT2 A;  3HRS A;  3JCM Q;  4BY6 B;  1PHT A;  4QW2 A;  2G3R A;  2KQW A;  2XU8 A;  3G4S T;  3QUI A;  1F1B B;  4C0Z A;  4ZTJ A;  3CCS A;  3EHQ A;  5CKE A;  3OS1 A;  1YIJ T;  1IZ6 A;  3JV3 A;  1HD3 A;  5GAO l;  3O5Z A;  1WX6 A;  4OMM A;  1K73 C;  1GFD A;  2ENM A;  2VUB A;  2COZ A;  1N9R A;  2PUK B;  4KRT A;  5KYU A;  2PU9 B;  2BTT A;  4PKC C;  1N8R U;  1U3O A;  1ZUY A;  4HCC A;  1VA7 A;  4FYX B;  3OYG A;  3M53 A;  5FU6 B;  1YHQ T;  4KBM B;  3DLL A;  1AOJ A;  3EFO B;  3TSW A;  3JCM h;  4GBQ A;  3CCR Q;  2F69 A;  3VKI A;  2PUO B;  1QWE A;  2DXC A;  1GFC A;  2QXF A;  2DBM A;  4GLK A;  4JJB A;  4A63 B;  2JOY A;  2ZPF B;  3CCJ T;  3PFS A;  9ATC B;  3DLM A;  1DJ7 B;  1V29 B;  1X27 A;  3UF4 A;  5GAN 3;  1S1N A;  2HDA A;  5LJ5 j;  4EIK A;  4BI8 B;  2WSC E;  3CD6 A;  3OYI A;  4NS5 A;  3V8L A;  3JCM d;  4J6X A;  5FU7 C;  1KD1 U;  1S72 T;  4M75 D;  2HAX A;  2DL8 A;  2MWP A;  2EFI A;  2X3X D;  3C95 A;  3OBY A;  5FRM A;  4M7A D;  1SF9 A;  3EG1 A;  2MCN A;  3CCV Q;  3MP8 A;  4JPB W;  2KYM A;  3MEW A;  4KUI A;  1BB9 A;  3CCE T;  3JCM V;  1VQ8 T;  2DL4 A;  3FJP A;  2RQU A;  3G71 T;  2VVK A;  4M75 F;  4IUP A;  3NFC A;  2VAS A;  1PCX A;  4M7A F;  3MP6 A;  4CC7 A;  1YJN T;  3V7S A;  3OYM A;  4C5H A;  3VYG A;  5D6Y A;  1NPR A;  3OYK A;  3QBY A;  4E7S A;  1QCN A;  4XTU A;  5GAM j;  1K76 A;  1GCQ C;  2V1Q A;  4DBQ A;  3M0R A;  4C92 G;  1OX8 A;  3UA7 A;  5GAN 5;  4FYW B;  3ZFJ A;  4FM4 B;  2D0N A;  1NEG A;  1AEY A;  1JXO A;  2QQR A;  1XOV A;  1VQL Q;  1WHK A;  1T3S A;  1VQM Q;  3CBM A;  3I55 T;  3LWH A;  1SRM A;  2QQS A;  1Q86 C;  2L5Q A;  2FO0 A;  4DQ2 A;  3M5A A;  1VQ7 Q;  1VQ6 Q;  3RDV A;  3FIF A;  3VUZ A;  4QKU A;  1YP5 A;  1BU1 A;  2KXC A;  3OYC A;  2K2M A;  2RNA A;  2X4W A;  3CC7 T;  3EHR A;  4M77 C;  5D7U A;  1PWT A;  4FU6 A;  2DK3 A;  3DB3 A;  3H0I A;  2WSF E;  2OJ2 A;  2P4R A;  4CRI A;  2LRQ A;  4C5G A;  2L8D A;  1W4S A;  4M77 E;  1OQK A;  6AT1 B;  1YI2 A;  3HKS A;  2K79 A;  1VQK A;  4WF2 A;  2HCK A;  1YIT T;  1PRL C;  3M4G A;  1RI0 A;  1G3S A;  4BD3 A;  2DL7 A;  1X6O A;  3JB9 G;  1K9A A;  4BDY A;  2JS2 A;  3M0T A;  3EFR A;  1EZZ B;  2EQM A;  3C12 A;  4X34 A;  4RTU A;  1N8R R;  4N0A A;  4XTZ A;  1BCO A;  5A0D A;  1K8A C;  3NTK A;  1WYX A;  1B3Q A;  2VWF A;  3CCM A;  2X4X A;  2M02 A;  1W2B S;  2QQB A;  4XTV A;  1H3H A;  2QA4 T;  4FYY B;  2QEX Q;  2LT4 A;  3R6N A;  3EFO A;  3UDC A;  2KMT A;  3I9Q A;  2E3I A;  3JAM E;  4ATO A;  4KGZ B;  3CCQ Q;  2EWN A;  2KSS A;  2HSP A;  2JS0 A;  1PRM C;  1ZSZ C;  3OYY A;  5C6S A;  2GFA A;  2P0P A;  4MML A;  5CKH A;  4QQ6 A;  1BIB A;  5LJ5 h;  2CH4 A;  2DNU A;  2VGM A;  3OYJ A;  4R0K A;  5J26 A;  3MEU A;  1KD1 R;  1BI3 A;  5CAI A;  2FYK A;  3HPW A;  2BIV A;  2JT4 A;  1M5Q 1;  5IAY A;  2E6N A;  3JCM J;  1C0M A;  4NL3 A;  1NYF A;  5GAO p;  2E4H A;  4MZM A;  3JB9 I;  4BE2 A;  2EYQ A;  2QGG A;  1X43 A;  1MUZ A;  3CC4 Q;  1D1A A;  5LJ5 d;  2LX9 A;  1R8O B;  3THK A;  2CSQ A;  3CME A;  3VS7 A;  4RTX A;  4JRI A;  4QQG A;  5LJ3 f;  4XAX B;  3G1J A;  2R57 A;  4F7U F;  2CP5 A;  5FWB A;  2FPF A;  3S6W A;  2ZAE A;  4LUD A;  1C1A A;  2PNI A;  3L2U A;  2COW A;  2H3E B;  5GAM h;  2EBP A;  1IRX A;  2K3Y A;  2K4Y A;  2KE9 A;  1AT1 B;  1PKS A;  3G4S A;  4CC4 B;  5IH2 A;  4RCB A;  2DD4 A;  4XK8 E;  4Y28 E;  3QDR B;  1SSF A;  4RTY A;  1D1C A;  1YIJ A;  2GQI A;  2BZX A;  4AT1 B;  1YJ9 Q;  1WJR A;  1AZG B;  3C94 A;  5GMK e;  3CBO A;  1D09 B;  4ELZ C;  1KQ1 A;  5GAM g;  4JRQ A;  2A37 A;  2CYZ B;  3ZEH A;  3TSZ A;  1H64 1;  4A4H A;  3EGD B;  2LCS A;  3C0C A;  1GRI A;  3X24 B;  2DIQ A;  2IIM A;  1YHQ A;  4MDX A;  2BKD N;  1H92 A;  2YLB A;  4XU0 A;  2GTJ A;  2LNH B;  2C0I A;  5I11 A;  3NPF A;  1GCQ A;  1I5L A;  3NGP A;  1Q95 G;  1GXI E;  3CCJ A;  1VQ4 T;  1VQN Q;  2EVR A;  1IHW A;  2CGH A;  2CZ7 B;  1N27 A;  2DKG A;  2QQ9 A;  2K9G A;  4XU2 A;  2LZ6 B;  3QWX X;  2LMJ A;  5D6X A;  2NUT B;  1S72 A;  3G6E Q;  3VJP A;  1OEB A;  4IUV A;  4NL2 A;  5CCA A;  4Y92 A;  3VRZ A;  5GAN d;  1BCM A;  4J9G A;  3CCE A;  3D7S B;  3URG A;  1Q81 U;  2BE7 D;  2DZC A;  1VQ8 A;  1M9S A;  1MMG A;  1VQ5 Q;  3G71 A;  2CP2 A;  2ATC B;  1G8X A;  2NWM A;  3VUB A;  3PTA A;  4EDU A;  4BE1 A;  2CP6 A;  2E41 A;  2LQK A;  3TCJ A;  4PJL A;  1KQ2 A;  2KXD A;  2EKO A;  1YJN A;  1UHF A;  2XHC A;  1VQO Q;  3QYG B;  2I0N A;  1K8A U;  3M57 A;  3QDF A;  2KRO A;  2DIL A;  3CMA Q;  3VS2 A;  2F2W A;  2K5L A;  2AZV A;  1WFW A;  4O5V A;  2JZ2 A;  1K0S A;  2B8A A;  4ELY C;  2LP5 A;  4DBF A;  4F14 A;  4OVA A;  4FW1 A;  4Z8A A;  4AFZ C;  2DTO A;  2E70 A;  2KT1 A;  1VQP Q;  2LDM A;  1UGP B;  3I55 A;  2ZZD A;  2P84 A;  4C92 C;  5KE3 A;  4M77 D;  2IG0 A;  3CCS Q;  4J9F A;  1W2B A;  2LJ1 A;  4B9W A;  3KFV A;  1M1G A;  2OTL A;  1XTD A;  1WGS A;  4B6M A;  1FWZ A;  4HVW A;  4LE9 A;  1VQ9 Q;  3PMT A;  4OMF B;  2M1H A;  2VC8 A;  4C92 E;  4J9I A;  1KC8 C;  3GNG A;  5CQX A;  3CC7 A;  1X2K A;  3H6Z A;  4M77 F;  4RUG A;  1G3Y A;  3SDZ A;  4Y91 A;  3QHS A;  1KSW A;  2XDD A;  1HJD A;  4MMK A;  1YIT A;  1OX9 A;  2DXT A;  1GL5 A;  4Z88 A;  1QP2 A;  2ZCF B;  2LNV A;  3PGG A;  3S3M A;  5DM7 R;  1B7T A;  3LWI A;  1QW1 A;  2F2V A;  4C0F A;  3V8K A;  4Q5W A;  3SHW A;  1O75 A;  2DAQ A;  3QYH B;  4PK4 A;  1RAF B;  4PJO B;  2X4Y A;  4AG1 C;  4TVR A;  4BDZ A;  3HTR A;  3EGD A;  2E64 A;  1RI9 A;  2QA4 A;  3MO8 A;  3CD6 Q;  2EJ9 A;  2QG9 B;  2KR3 A;  1M1K C;  3TRE A;  2DJZ A;  3UPU A;  2YUQ A;  4MZP A;  2LX7 A;  1KHI A;  3OYL A;  5KE2 A;  1G2B A;  5IXF A;  3NTI A;  1HXD A;  2X35 A;  2HEQ A;  4KUD K;  3AHU A;  1LCK A;  2ZGW A;  3X20 B;  4AFQ C;  1T3L A;  2JTF A;  3EG9 B;  1W2B P;  5IHI A;  1UHC A;  2NUT A;  2CT4 A;  2C06 A;  2AK5 A;  1KIK A;  2LCL A;  1BYM A;  2DA9 A;  3NHN A;  4EMK B;  1VQM T;  4NOY A;  1Q81 R;  2GFU A;  3X25 B;  3HRT A;  3SWN C;  2DL5 A;  2MOX A;  1AWJ A;  4J5Y A;  3CPW S;  3QG1 A;  1RLQ C;  1Q82 C;  3OS5 A;  4E7H A;  5C0M A;  2A3L A;  3M56 A;  1LVK A;  2EIF A;  1KQS S;  1K8A R;  3QJ6 A;  3UWN A;  3JCM f;  1ZBJ A;  3PE0 A;  4O6J A;  4GLM A;  3MP1 A;  2OTJ Q;  2KRS A;  3OYH A;  3EG3 A;  1XNI A;  3QSU A;  2X9H A;  3G7Z A;  2D8J A;  2DEQ A;  3V8J A;  4E2F B;  2YXY A;  2F2X A;  3H8Z A;  1PSE A;  2RM4 A;  3M0U A;  4QQD A;  4RTT A;  1ZQ1 A;  2XID A;  1TG0 A;  1ZHI A;  1J3T A;  1WJQ A;  3MET A;  5GAO q;  4LD9 K;  2A7Y A;  1NG2 A;  4HVV A;  2PVD B;  2RI2 A;  1TUG B;  4YTL A;  2PVO B;  2E12 A;  5FW9 A;  2F5K A;  2ED1 A;  3SWN B;  1Q7Y U;  4PL6 A;  3C4S A;  3CXC S;  1YI2 Q;  1YNZ A;  1VQK Q;  3SB2 A;  4QVD A;  2QI2 A;  3P8B B;  3V7R A;  2CSI A;  2QEX T;  4II1 A;  2C0T A;  4JLI A;  1YCS B;  2J06 A;  3U23 A;  2L89 A;  1X69 A;  1X6B A;  2H3J A;  3CCQ T;  1UFF A;  3QKJ A;  1QVG S;  3PT9 A;  2EQJ A;  4EPC A;  1QP3 A;  1ZBX A;  3CCM Q;  1M4Z A;  3J7A F;  1LOJ A;  1SHG A;  5IHN A;  3EG2 A;  1QWF A;  3L42 A;  4ZGE B;  3M4Y A;  3HHT B;  2AT1 B;  1VQ4 A;  3TQ7 P;  2O4X B;  1FXX A;  4IUR A;  1E7O A;  4LDV A;  2DPP B;  2MK5 A;  1D3B A;  1KC8 U;  3BDU A;  7AT1 B;  1G83 A;  2RPN A;  4AFS C;  5DLO A;  5LJ3 e;  4PJO A;  3FRN A;  4C92 A;  2GTO A;  3HRU A;  2CZ6 B;  5KCO A;  2GGR A;  1OPL A;  1CKB A;  2L3S A;  4J9B A;  2WSE E;  2F5T X;  2ESW A;  5AYF A;  1ZUU A;  4M78 B;  4LN2 A;  2BZY A;  2FRW A;  2L3R A;  4PJO G;  5EG2 A;  4QT7 A;  3PIO A;  1RAG B;  1M90 C;  4E7L A;  1IHV A;  5AT1 B;  2QDY B;  1WHL A;  2M0O A;  5KYX B;  1VYU A;  1N9S A;  1WA7 A;  2FL7 A;  4XQ3 A;  4D8D A;  4C8Q C;  1YJW T;  1MMD A;  4B9X A;  1XQH A;  1B34 B;  3CME Q;  4J9E A;  1NJI U;  2VKN A;  3EG9 A;  3R6O A;  1GBQ A;  2HQH A;  3EH2 A;  1M3C A;  4OF1 A;  5GAN e;  4C92 D;  5I2M A;  4EMK A;  1M1K U;  4OMQ A;  3RES A;  2GNC A;  1YJ9 T;  1UTI A;  1LJO A;  1IRE B;  1P92 A;  1OZ2 A;  4OMP A;  4N4H A;  2HD0 A;  1U1T A;  1K9M U;  3ASK A;  2K3B A;  3GBQ A;  5GJW B;  4C92 F;  4RG2 A;  3I56 T;  3E1S A;  2GBQ A;  3ZL7 C;  3HFN A;  4M7D B;  2ZPI B;  1RAA B;  3CC2 T;  3A8M B;  2KRM A;  4KH0 B;  1BBZ A;  1AWX A;  3OYD A;  2DTH A;  3NTH A;  2KNB B;  2EQK A;  1WQ7 A;  2YUN A;  2O9V A;  4N4G A;  4C8Q B;  1WHJ A;  2YUO A;  5IT9 E;  2QTV A;  3RKY A;  5LJ5 f;  2RI3 A;  3RKX A;  2YRD A;  4ANJ A;  1ABQ A;  2O31 A;  4DEY A;  2FRY A;  5HCK A;  1Q82 U;  2DE0 X;  2G6F X;  4Z89 A;  2RHI A;  1YHQ Q;  5KYY B;  1Q7Y R;  2DER A;  4ZNX A;  2AIR B;  3FEO A;  3JB9 D;  1HYO A;  4BI3 A;  3REB B;  3SWN A;  1RAD B;  3SD4 A;  2V8K A;  3G6E T;  3MEV A;  3OSV A;  2JUF A;  1K73 U;  1AWO A;  2E6Z A;  2HZY A;  4FT4 A;  2NUZ A;  4PJM A;  1NM7 A;  3CPW A;  3JB9 F;  2DVJ A;  5HY6 A;  4J9D A;  5CIU A;  2MIO A;  1EX4 A;  1A0N B;  3FLG A;  2RO0 A;  4L6V 5;  1M3B A;  1KQS A;  2VB6 A;  3P8H A;  3X26 B;  2HKQ B;  3L2Q A;  4FYV B;  4J6Y A;  1S72 Q;  1ARK A;  2O2O A;  4DOV A;  2O4X A;  2CP3 A;  4ZGD B;  1KC8 R;  2MI6 A;  2CKK A;  1WXB A;  1PKT A;  3CCE Q;  1UGS B;  3I35 A;  1VQ8 Q;  3L2W A;  3UAT A;  3G71 Q;  3VRY A;  2NUP B;  3E19 A;  5GMK i;  1TS9 A;  1YJN Q;  3OW2 S;  4M78 A;  2RHX A;  3HL8 A;  1VQP T;  2DRK A;  4OMO A;  3TU4 K;  1VQM A;  4HKE A;  1I8F A;  1OI1 A;  1OV3 A;  2JTE A;  3DB4 A;  3CXC A;  4N4I A;  1WNL A;  2P0K A;  1PG5 B;  4R56 A;  3CQT A;  4OB0 B;  1VQ9 T;  1NPP A;  3EH1 A;  3RMS A;  4F04 B;  2JM9 A;  1BI0 A;  2K5F A;  4M78 G;  3JB9 J;  4JS5 A;  5KYX A;  2O01 E;  1WZO A;  2D9T A;  3EG0 A;  1NJI R;  4RCC A;  2L0A A;  5GAN 8;  1UG1 A;  2FEI A;  1QVG A;  2HSE B;  4A54 A;  4FIB A;  1FYN A;  2RB6 A;  3VV0 A;  1RL2 A;  2ED0 A;  5GAM d;  3OYE A;  4DBR A;  4JRP A;  4KUL A;  1M1K R;  3PVL A;  2OTL Q;  2DM1 A;  5GAN f;  3OBW A;  8ATC B;  1K9M R;  3CC7 Q;  3RKW A;  4OGC A;  3CPW P;  4WCI A;  2EPD A;  3OS2 A;  3CCU T;  4JJD A;  5HK0 A;  4FL6 A;  1TH7 A;  1RLP C;  1TSF A;  1U8R A;  2HKN A;  1KQS P;  2DEU A;  3TVT A;  3QZ5 B;  5KYW B;  2A0F B;  4J6W A;  2BZ8 A;  2RI5 A;  1Q86 U;  4XTY A;  3OY9 A;  1AVZ C;  4HCK A;  2CT3 A;  2J05 A;  2QEX A;  5GAN 7;  2DX1 A;  5LJ3 g;  2E5Q A;  2FB7 A;  1UJ0 A;  1UUE A;  2ROT A;  2M51 A;  4A4E A;  3CCQ A;  4C8Q A;  2EW3 A;  2CH4 W;  1E6H A;  4M7D G;  1EIF A;  3MPU B;  3KUF A;  3RNJ A;  5GMK j;  1WPY A;  2J6F A;  2D0Q B;  2CUB A;  2RN8 A;  1Q82 R;  4ZN3 A;  1ACM B;  2K7A A;  1EFN A;  3OA6 A;  4JUV A;  2RQR A;  1NBE B;  2HL3 A;  3M0P A;  2NYS A;  2QA4 Q;  3UT1 A;  5KYY A;  3INZ A;  4JS4 A;  4C8Q G;  1X6G A;  4D8K A;  2KAF A;  3VU3 C;  3CXC P;  3NMZ C;  4QVC A;  3JRZ A;  3EFS A;  1K73 R;  1UJY A;  2KY9 A;  3OMC A;  3E9G A;  4DA4 A;  2RK2 A;  1UGV A;  2DXB A;  5I22 A;  3OYF A;  4F17 A;  2DXU A;  1M8V A;  1AZE A;  2K5I A;  2V1R A;  3H9N A;  3JCM e;  1QVG P;  4QVZ A;  2RJE A;  3VS3 A;  1Y96 B;  3VS1 A;  2XKO C;  5GAN 4;  5FWC A;  1U06 A;  3CCL Q;  3T9N A;  5L23 A;  1FMK A;  3FDR A;  2PZ1 A;  4C8Q D;  3VS6 A;  1MMN A;  1Z9Q A;  2MF2 A;  3JB9 H;  1X2Q A;  2YUP A;  4J9C A;  4OGE A;  1KHC A;  4V2S A;  1MV3 A;  1JJ2 S;  1AD5 A;  4PNO A;  2OTJ T;  2XD0 A;  1YJW A;  1D0Z A;  4PJO C;  3WXM B;  4C8Q F;  2RQV A;  3KBG A;  2LJ0 A;  2NUP A;  2VXE A;  2DVE A;  3GF5 A;  4DBH A;  4M75 B;  3QO3 A;  1ABO A;  1QKX A;  2C0O A;  4PJO E;  4M7A B;  5I2S A;  4BE0 A;  2KT8 A;  2BUD A;  2HBW A;  3CCR T;  1RUW A;  4XU1 A;  1G3T A;  4BUG A;  5KYN A;  4KGX B;  1BK2 A;  4JZ3 A;  4ORZ A;  1IGU A;  4M4Z A;  3I56 A;  2EQU A;  2HBP A;  2XDP A;  2JMA A;  3A8O B;  3L2V A;  2QAS A;  4HT8 A;  3CC2 A;  2E5K A;  2R58 A;  4HCZ A;  4PLL A;  3SFM A;  2EJG A;  1LNX A;  1R77 A;  4D6W A;  1N6A A;  3OB9 A;  3M9Q A;  1IGQ A;  2K6D A;  2I2L A;  2RHU A;  5CVI A;  1YWO A;  3HP9 A;  4EMK C;  1BKB A;  3H0F A;  4Z02 A;  2DYI A;  2LQW A;  3RBB B;  1ZA1 B;  3CCV T;  1NEB A;  1YFN A;  1WQW A;  2KDS A;  1QLY A;  5CKD A;  3O8V A;  1SKU B;  5IHK A;  2RH2 A;  4LXC A;  5GAO r;  4AG2 C;  2PVG B;  1YCY A;  1Q86 R;  2O9S A;  5KYW A;  3OW2 A;  1ZX6 A;  4AFU C;  3G6E A;  2DZ9 A;  2PTK A;  1AHJ B;  4HXJ A;  2ZPB B;  3VS4 A;  1VQ4 Q;  1SHF A;  3IQL A;  2XIC A;  3A8G B;  1BI1 A;  2ROL A;  2J7I A;  3LH5 A;  3E9F A;  2PQW A;  4J7I A;  5CK9 A;  2MPX C;  2X51 A;  1M3A A;  3M0Q A;  3A5Z B;  3P8D A;  5GMK h;  2XK0 A;  2JJ9 A;  5FLX E;  3EGX B;  4C5I A;  4C5E A;  1AWW A;  4J9H A;  1VQL T;  2LQ8 A;  2FVU A;  4A4F A;  1I0C A;  1VQ7 T;  2HQX A;  1LPL A;  1VQ6 T;  2OAU A;  3J80 E;  2CZ1 B;  1KK7 A;  2M0Y A;  3VS0 A;  2YSQ A;  2EGA A;  4PFP A;  2MWO A;  4VUB A;  2Y90 A;  4L59 A;  1VYV A;  4A53 A;  4WTO B;  1IO6 A;  4HT9 A;  4PJJ A;  2FPD A;  1YN8 A;  3I5R A;  2X4J A;  2KRN A;  2A28 A;  4F16 A;  2MAM A;  1PNJ A;  2W10 A;  3QWY A;  1WXT A;  1VQP A;  1Y96 A;  4E7J A;  5FRO A;  2XDB A;  3GIB A;  1RAE B;  3QJY A;  1M30 A;  3V7C A;  2JXB A;  2AZS A;  3LGL A;  2F1L A;  1VQ9 A;  5LJ5 e;  2DIG A;  2OX7 A;  4HCB A;  1JU5 C;  1QVF S;  2EYX A;  1KJW A;  1QKW A;  3OYA A;  2RJD A;  4OML A;  1O9S A;  1JXM A;  2CUD A;  2EYZ A;  1I1J A;  4R55 A;  4E7I A;  4RTW A;  4M75 A;  2H8H A;  4OB2 B;  4CC2 A;  1Y71 A;  2RHZ A;  4M78 C;  3OW2 P;  3GPL A;  5L8R E;  4M7A A;  1W1F A;  3DKM A;  1JQQ A;  3QXE B;  3LW5 E;  4F7U B;  1WHM A;  3QZ9 B;  4HA8 A;  3N5B B;  3UA6 A;  3AT1 B;  4IUT A;  4M78 E;  2B86 A;  1RAI B;  4M75 G;  1SG5 A;  1D1B A;  3CCU A;  2K57 A;  2CS7 A;  4GY5 A;  4M7A G;  4ZTF A;  2SRC A;  2P0Q A;  2HNI A;  5GAM e;  2KYB A;  1JBM A;  4BB7 A;  2RJC A;  2DBK A;  2V26 A;  1TUD A;  3Q1J A;  2ZPG B;  3L1A A;  2GQV A;  2RK1 A;  2K3X A;  3JCM g;  2RQT A;  2GF7 A;  1JJ2 A;  1ZA2 B;  2DF6 A;  3CC4 T;  2LCC A;  2NLU A;  3MCA B;  4FSS A;  1CSK A;  1C6V X;  3OYB A;  2CP7 A;  3HSB A;  1OUL A;  4OMN A;  1TUC A;  4M7D C;  4XTX A;  5D6W A;  2IVW A;  2D8H A;  1PSF A;  1PC0 A;  1NLP C;  4IIM A;  4M7D E;  2D6F A;  1ZLM A;  2Y4X A;  4RKU E;  4RTZ A;  2P4T A;  4UC4 A;  2ZPE B;  3LX7 A;  3LYI A;  4RTV A;  2DFU A;  1OZ3 A;  3A8H B;  3ME9 A;  4JLG A;  3EGX A;  1NZ9 A;  2VXF A;  2EJF A;  2RA2 A;  5GJV B;  3M58 A;  4C8Q E;  1K0X A;  4PJO D;  3MJX A;  4E47 A;  5LJ3 j;  2EGE A;  1VUB A;  1H3Z A;  1UDL A;  1OPK A;  1G5V A;  2K2V A;  5FU7 B;  3WVD B;  2FPE A;  2VYT A;  4RMO A;  2SEM A;  1Y07 A;  1QCO A;  1RAH B;  1VIE A;  2QYZ A;  2L3Q A;  5IN1 A;  2OTJ A;  1N5Z A;  2IPO B;  4PJO F;  2OTL T;  2DTI A;  5J39 A;  3G4S Q;  1I5O B;  3RUX A;  5EC7 A;  5M9O A;  3CBP A;  5DLQ E;  4CC3 A;  1YIJ Q;  3KXT A;  1WLP B;  3CPF A;  2E10 A;  1IB8 A;  3L2Z A;  4J7F A;  2Z0W A;  3VS5 A;  1T0J A;  2RMO A;  3CCR A;  2LT1 A;  1ZUK A;  2YHT A;  5GMK m;  3PIP A;  4KH1 B;  4CI0 C;  1VQN T;  1Q81 C;  1JJ2 P;  2A36 A;  5HKC A;  4JJN K;  5GAN j;  3PNW C;  4P5N A;  1V76 A;  2R5M A;  3OS0 A;  4BAC A;  1T0H A;  4LDX A;  5GMK l;  3F70 A;  4X9D A;  4IUQ A;  2CP0 A;  2LVM A;  4F7U A;  3CCJ Q;  2KEA A;  3TEE A;  2L3P A;  3CCV A;  3JCM P;  1UB4 A;  3RMQ A;  4JDS A;  4PFZ A;  1B07 A;  1VYT A;  4M77 B;  1VQ5 T;  1NE8 A;  1R0C B;  2RQW A;  4IKF A;  3OMG A;  2JM8 A;  4F7U G;  2QGF B;  2QQA A;  1QQJ A;  2LQN A;  2LJ3 A;  4IIO A;  3BFM A;  1QCF A;  3S3O A;  2RF0 A;  1VQO T;  1PD1 A;  2FG0 A;  5GAM f;  3M54 A;  2QTX A;  2KGT A;  1I4K 1;  1Y7X A;  2DLP A;  4XU3 A;  4ME7 A;  3CCL T;  3JCM b;  2WAC A;  2YT6 A;  1U1S A;  3CMA T;  1RAC B;  2YWW A;  4C0G A;  5CR2 A;  4FCY A;  1SSH A;  3OYN A;  2Y4Y A;  3JCM W;  1QVF A;  1M27 C;  4FSX A;  3FJ5 A;  1BI2 A;  4E7K A;  3BY7 A;  2V8J A;  2DET A;  3ULR B;  1VQL A;  2J6O A;  2O88 A;  3BW1 A;  1JRI A;  1HSQ A;  1M2V B;  5FRN A;  5A0G A;  4JRK A;  5LJ5 g;  3CCS T;  1VQ7 A;  4MDW A;  5CKF A;  1WXU A;  1VQ6 A;  4C0D C;  2J6K A;  2D1X A;  2AKL A;  4X9C A;  1TU0 B;  2DL3 A;  1ZSZ B;  3LH0 A;  8AT1 B;  3EGU A;  5J3B A;  1B34 A;  3MKD A;  1YJW Q;  1MGQ A;  3I55 Q;  4J8O A;  2HMA A;  5CQY A;  1PM3 A;  3A98 A;  3SEM A;  2KVQ G;  5LJ3 h;  4LD6 A;  1MNE A;  3MEA A;  2EYY A;  2XMF A;  2VGN A;  2JW4 A;  2MYS A;  4M78 D;  1M90 U;  2QK0 A;  1SPK A;  1M8M A;  2FHD A;  2HL5 C;  1MND A;  1JB0 E;  3I5S A;  3EAE A;  2LC4 A;  1K1Z A;  1VOM A;  1JEG A;  3M0S A;  1D0X A;  1RAB B;  4LDY A;  2E65 A;  1TXQ A;  4OB3 B;  3I56 Q;  3PMI A;  3FC3 A;  1Y0M A;  3RER A;  4M7D A;  4DEX A;  4M78 F;  1NLO C;  4C0D B;  1YIT Q;  4A4G A;  1M1F A;  3FB9 A;  4A4K A;  5LJ3 d;  3CC2 Q;  4LDW A;  2EYW A;  3CD6 T; 
#chains in the Genus database with same CATH homology
 1X6B A;  2LQW A;  3RBB B;  1UFF A;  4K11 A;  1NEB A;  1H3H A;  1MV0 B;  3R6N A;  1QLY A;  3I9Q A;  1SHG A;  5IHN A;  3EG2 A;  1QWF A;  4E6R A;  5IHK A;  2JMC A;  4AG2 C;  2O9S A;  2HSP A;  2JS0 A;  1ZX6 A;  1PRM C;  4AFU C;  1E7O A;  1UEC A;  2PTK A;  4HXJ A;  1G83 A;  2RPN A;  2CH4 A;  2DRM A;  2DNU A;  1SHF A;  3VS4 A;  4AFS C;  3IQL A;  4R0K A;  2GTO A;  1GBR A;  4LUE A;  2ROL A;  2GGR A;  2J7I A;  3LH5 A;  2OAW A;  1OPL A;  1CKB A;  2DJQ A;  2L3S A;  1CKA A;  4J9B A;  5IXB A;  1M3A A;  1NYG A;  3M0Q A;  2ESW A;  1Z9Z A;  1ZUU A;  1U5S A;  2JT4 A;  4LN2 A;  2BZY A;  1W70 A;  2FRW A;  1AWW A;  1E6G A;  1NYF A;  4J9H A;  1X43 A;  1MUZ A;  4QT7 A;  4JJC A;  1I0C A;  3THK A;  2CSQ A;  3VS7 A;  4RTX A;  2M0Y A;  2OI3 A;  3VS0 A;  2YSQ A;  2EGA A;  1VYU A;  1K4U S;  1WA7 A;  2EKH A;  4D8D A;  1VYV A;  5FWB A;  1IO6 A;  2DMO A;  2FPD A;  2FPF A;  1YN8 A;  3I5R A;  4J9E A;  2KRN A;  4LUD A;  2A28 A;  2VKN A;  4F16 A;  1UE9 A;  2PNI A;  1WDX A;  1PNJ A;  2W10 A;  3QWY A;  1WXT A;  1GBQ A;  1M3C A;  4LNP A;  2EBP A;  2KE9 A;  4OMQ A;  2A08 A;  2GNC A;  1M30 A;  1UTI A;  1PKS A;  4CC4 B;  5IH2 A;  1YWP A;  4OMP A;  2JXB A;  2AZS A;  4RTY A;  1JU5 C;  1W6X A;  2BZX A;  2GQI A;  2K3B A;  2EYX A;  3GBQ A;  3REA B;  1KJW A;  5GJW B;  1QKW A;  2GBQ A;  3ZL7 C;  1AZG B;  2ABL A;  2YDL A;  4OML A;  2CRE A;  3H41 A;  2L2P A;  1JXM A;  2CUD A;  2EYZ A;  2KRM A;  1I1J A;  1BBZ A;  1AWX A;  4RTW A;  4JZ4 A;  2H8H A;  4CC2 A;  2KNB B;  2A37 A;  1W1F A;  3TSZ A;  1JQQ A;  4HVU A;  2EQI A;  2YUN A;  2O9V A;  2LCS A;  2CDT A;  3C0C A;  1GRI A;  2IIM A;  2YUO A;  3UA6 A;  4X1V A;  1H92 A;  1OOT A;  2GTJ A;  2B86 A;  2LNH B;  1ABQ A;  2C0I A;  2O31 A;  5ECA A;  2FRY A;  5HCK A;  4DEY A;  5I11 A;  3NPF A;  1WIE A;  1GCQ A;  2DE0 X;  2G6F X;  1SEM A;  4Z89 A;  3NGP A;  1V1C A;  4ZNX A;  2SRC A;  1ZSG A;  3REB B;  2EVR A;  2QDL A;  4ESR A;  2KYB A;  2DBK A;  2EGC A;  1TUD A;  1AWO A;  2X3W D;  2K9G A;  2NUZ A;  2LZ6 B;  1NM7 A;  3QWX X;  2LMJ A;  2DVJ A;  2RQT A;  4J9D A;  2KBT A;  2MIO A;  1GCP A;  1A0N B;  2DF6 A;  1M3B A;  1OEB A;  1WI7 A;  4FSS A;  4Y92 A;  1CSK A;  3VRZ A;  2AKK A;  4J9G A;  1ARK A;  4OMN A;  1TUC A;  1SRL A;  2O2O A;  3H0H A;  2D8H A;  1KFZ A;  2NWM A;  1WXB A;  1PKT A;  2ECZ A;  3I35 A;  1NLP C;  1Y57 A;  4IIM A;  2KXD A;  1JO8 A;  1UHF A;  3UAT A;  3VRY A;  1I07 A;  2I0N A;  1ZLM A;  4RTZ A;  2W0Z A;  1H8K A;  3PVQ A;  4RTV A;  2KRO A;  2DIL A;  3VS2 A;  2F2W A;  2AZV A;  1WFW A;  2DRK A;  4OMO A;  1K0S A;  2DYB A;  5GJV B;  1K0X A;  1OV3 A;  2LP5 A;  2JTE A;  1PHT A;  2EGE A;  1UDL A;  1OPK A;  4F14 A;  4Z8A A;  4AFZ C;  3CQT A;  2FPE A;  2KT1 A;  3EHQ A;  2SEM A;  2JM9 A;  2L3Q A;  3JV3 A;  1HD3 A;  1N5Z A;  3EG0 A;  3O5Z A;  4J9F A;  2L0A A;  2LJ1 A;  1UG1 A;  2FEI A;  3KFV A;  1WX6 A;  5EC7 A;  4OMM A;  4HVW A;  4LE9 A;  1FYN A;  1GFD A;  4CC3 A;  4J9I A;  2ENM A;  1WLP B;  2ED0 A;  1X2K A;  3PVL A;  4KRT A;  2DM1 A;  3VS5 A;  1T0J A;  2RMO A;  2BTT A;  4RUG A;  1U3O A;  1ZUY A;  1ZUK A;  1VA7 A;  1KSW A;  1AOJ A;  3TSW A;  4WCI A;  2EPD A;  4GBQ A;  1HJD A;  2A36 A;  4JJD A;  1GL5 A;  1QWE A;  4Z88 A;  1RLP C;  1GFC A;  2DBM A;  4JJB A;  3TVT A;  4A63 B;  2BZ8 A;  2F2V A;  1X27 A;  3UF4 A;  1AVZ C;  1T0H A;  4HCK A;  2CT3 A;  2J05 A;  1S1N A;  2HDA A;  3SHW A;  4EIK A;  2DX1 A;  1UJ0 A;  1UUE A;  4AG1 C;  2ROT A;  2M51 A;  2KEA A;  2L3P A;  2EW3 A;  2CH4 W;  1E6H A;  1RI9 A;  3RNJ A;  2J6F A;  2CUB A;  2RN8 A;  2DL8 A;  2X3X D;  2K7A A;  1EFN A;  2KR3 A;  1B07 A;  1VYT A;  3EG1 A;  2MCN A;  2RQR A;  4JPB W;  2RQW A;  2YUQ A;  3M0P A;  2JM8 A;  2KYM A;  1BB9 A;  2LQN A;  2LX7 A;  1X6G A;  2LJ3 A;  1G2B A;  4IIO A;  4D8K A;  2DL4 A;  5IXF A;  1QCF A;  3NMZ C;  2RQU A;  2RF0 A;  2VVK A;  2FG0 A;  2HEQ A;  1UJY A;  2KGT A;  2DLP A;  2YT6 A;  1LCK A;  1UGV A;  5I22 A;  4CC7 A;  4AFQ C;  1T3L A;  4F17 A;  1AZE A;  1SSH A;  2V1R A;  5IHI A;  1UHC A;  1M27 C;  3VS3 A;  2CT4 A;  3FJ5 A;  3VS1 A;  1K76 A;  2AK5 A;  1KIK A;  1GCQ C;  2V1Q A;  5FWC A;  3M0R A;  1U06 A;  2DA9 A;  3NHN A;  5L23 A;  1FMK A;  3ULR B;  2PZ1 A;  3UA7 A;  2J6O A;  3VS6 A;  2O88 A;  1Z9Q A;  2DL5 A;  2MOX A;  2D0N A;  1X2Q A;  1HSQ A;  2YUP A;  4J9C A;  1AWJ A;  1NEG A;  1AEY A;  1JXO A;  1WXU A;  1MV3 A;  1XOV A;  1RLQ C;  1T3S A;  1AD5 A;  1SRM A;  2J6K A;  2D1X A;  2AKL A;  2FO0 A;  2RQV A;  2DL3 A;  2LJ0 A;  1ZBJ A;  3PE0 A;  1YP5 A;  3EGU A;  1BU1 A;  2KXC A;  2K2M A;  4GLM A;  1ABO A;  1QKX A;  2C0O A;  2KRS A;  2RNA A;  3EG3 A;  2D8J A;  3EHR A;  3A98 A;  2KT8 A;  3SEM A;  1PWT A;  2HBW A;  3H0I A;  1RUW A;  2F2X A;  2EYY A;  2OJ2 A;  2P4R A;  2XMF A;  3M0U A;  2JW4 A;  4RTT A;  1TG0 A;  1J3T A;  1BK2 A;  4JZ3 A;  4ORZ A;  2K79 A;  4M4Z A;  1NG2 A;  1M8M A;  1SPK A;  4HVV A;  2HCK A;  3I5S A;  1PRL C;  1K1Z A;  1JEG A;  2JMA A;  3M0S A;  5FW9 A;  2E5K A;  2DL7 A;  2ED1 A;  1K9A A;  1YNZ A;  2JS2 A;  3M0T A;  1Y0M A;  2K6D A;  2CSI A;  4DEX A;  4RTU A;  1NLO C;  1YWO A;  2C0T A;  1YCS B;  2J06 A;  3U23 A;  3H0F A;  2EYW A;  1X69 A;  1WYX A;  1B3Q A;  2VWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...