2DL5A

Solution structure of the first sh3 domain of human kiaa0769 protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
78
structure length
78
Chain Sequence
GSSGSSGTLRNYPLTCKVVYSYKASQPDELTIEEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the first SH3 domain of human KIAA0769 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords KIAA0769 protein
total genus 4
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl5A00
1NM7A 4RTYA 2J06A 1AWOA 2HDAA 1BB9A 1UDLA 4Z8AA 2JM8A 1U3OA 2KRMA 1WI7A 2L3QA 2M0YA 4J9EA 1X2KA 1YNZA 2JT4A 2DE0X 1RLQC 1AEYA 2L0AA 4F16A 4JJCA 1B3QA 4A63B 1GCPA 4LUEA 2AZVA 1VA7A 4K11A 2LNHB 1NYFA 1JXOA 1GRIA 1SSHA 4CC3A 2RQRA 1WIEA 1YWOA 1OV3A 3VS5A 2JW4A 3LH5A 2ROLA 2BTTA 1K76A 2AK5A 2K3BA 2DYBA 1U5SA 1QWFA 3QWXX 4AFSC 2L3SA 2LZ6B 1AD5A 1AOJA 3H41A 1HD3A 2FPDA 4Y92A 2YUQA 1CSKA 4GLMA 1NG2A 4HCKA 2EGCA 1NYGA 3EG2A 4J9DA 4OMQA 2HEQA 2DRKA 1XOVA 1SRLA 1ZBJA 2AZSA 2DBMA 2LCSA 1E6GA 4QT7A 4KRTA 2KBTA 2KR3A 1AZGB 2CUBA 2QDLA 3EG3A 4WCIA 2ECZA 4JZ4A 2JM9A 1GL5A 4X1VA 2CT4A 1ZUYA 1PNJA 2A28A 2CSQA 2DILA 3PVLA 2RN8A 4J9HA 3REBB 2G6FX 1ZUUA 2YUNA 3VS6A 2RQUA 2CH4A 2EBPA 1YWPA 2DBKA 2OAWA 2MOXA 2H8HA 4GBQA 5GJWB 2J7IA 2RQWA 2PNIA 4AFZC 1HJDA 5L23A 2NWMA 2BZXA 3H0IA 1AWXA 2FRYA 1T3LA 2DL4A 2E5KA 2IIMA 4JJDA 4HVVA 3VS0A 2EGEA 3IQLA 1WDXA 2KXCA 3TSZA 2P4RA 3SEMA 1NLPC 1ZLMA 2LMJA 1KFZA 2JMCA 1PWTA 2DL8A 4Z89A 2B86A 2GTOA 4JJBA 2J05A 1MV3A 1OPKA 3NMZC 3EHRA 1X27A 2RF0A 1QWEA 1KIKA 1UHFA 3TSWA 2KEAA 4IIOA 1E6HA 1X2QA 1PKSA 2GQIA 1Z9QA 2FRWA 2C0TA 3EG1A 2EYXA 2JXBA 3ULRB 1ZUKA 4DEYA 4OMMA 1CKAA 2A36A 4JZ3A 4F14A 5IXBA 1H3HA 3M0PA 1MV0B 3R6NA 2KNBB 1JU5C 2VVKA 1GCQA 3I5RA 2HCKA 3VRZA 3ZL7C 5IXFA 2LJ0A 2W0ZA 3M0RA 1JO8A 2W10A 2KRSA 4LE9A 3RBBB 1WA7A 4IIMA 4ZNXA 1WX6A 1H92A 2D0NA 2C0IA 3NPFA 5FW9A 4ORZA 2D1XA 1SHFA 1I1JA 2J6OA 1AVZC 2YUPA 1AWWA 1G2BA 5IH2A 1W1FA 2XMFA 4J9BA 1GBRA 2NUZA 3RNJA 4AG2C 1X69A 2LX7A 2FO0A 1WXTA 1M30A 1UUEA 2EKHA 2LQWA 2LQNA 3U23A 1WLPB 4JPBW 2DJQA 5EC7A 1KJWA 1UECA 3THKA 2YT6A 2PTKA 2DF6A 1UJYA 1UGVA 5FWCA 1I07A 1OEBA 2A08A 1K9AA 1NEGA 2EYWA 2FPEA 2O88A 1UJ0A 1YN8A 2KXDA 4RTXA 2FG0A 2FEIA 1ABOA 3GBQA 2X3WD 1I0CA 1IO6A 2KT1A 4F17A 2DLPA 1PRMC 2ROTA 2VKNA 2D8JA 1AWJA 2DL3A 3VS1A 1WXBA 4EIKA 2OJ2A 2EYYA 2OI3A 2EPDA 2DMOA 2KYMA 4E6RA 1M3AA 2CUDA 5I22A 1RLPC 1VYTA 4J9FA 1JEGA 3EG0A 1W70A 3NHNA 2DRMA 1PHTA 2EW3A 4RUGA 2RNAA 1G83A 3I5SA 1Y0MA 1N5ZA 2YDLA 3VS3A 1GFDA 3VS4A 3M0QA 4CC4B 2F2WA 1EFNA 2V1QA 4OMOA 3FJ5A 2YSQA 2HSPA 1LCKA 2JTEA 2BZ8A 1GBQA 1JQQA 2CREA 5GJVB 1WYXA 4J9GA 2J6FA 2SRCA 3NGPA 3O5ZA 4M4ZA 2M51A 3REAB 1W6XA 1RI9A 4AFQC 4HVWA 4RTTA 2KRNA 3M0UA 1X43A 2C0OA 1U06A 2CT3A 2KYBA 2L3PA 4CC7A 1T0JA 3UF4A 1QLYA 1GCQC 4OMNA 2L2PA 1ABQA 2BZYA 4LN2A 3UA7A 2RQTA 4OMPA 2V1RA 1V1CA 2CDTA 1J3TA 2O31A 2ED1A 3EGUA 2K2MA 1WXUA 4RTWA 2J6KA 1H8KA 1VYUA 2SEMA 2ABLA 1X6BA 1BBZA 4J9CA 4CC2A 2O9VA 4AFUC 1RUWA 1E7OA 4D8KA 1KSWA 1TG0A 3H0FA 4R0KA 2HBWA 4HVUA 1CKBA 1JXMA 1ZX6A 2AKLA 2CH4W 3SHWA 1YCSB 4D8DA 1BU1A 1WFWA 2K6DA 5I11A 4HXJA 2O2OA 3PE0A 2KT8A 1K1ZA 1UFFA 2O9SA 4RTUA 4DEXA 3JV3A 1NLOC 2LJ1A 3QWYA 1TUCA 3M0SA 1S1NA 1SRMA 1UTIA 4RTZA 2DX1A 5ECAA 3EHQA 2KE9A 2GBQA 3VS7A 4FSSA 2KROA 1M3CA 2EGAA 4RTVA 3KFVA 1FMKA 1Y57A 2X3XD 2LP5A 5FWBA 2AKKA 2A37A 2RMOA 2MCNA 2ENMA 1YP5A 2KGTA 2PZ1A 1K0XA 1QKXA 3UA6A 3PVQA 1NEBA 1SEMA 2VWFA 2ED0A 1FYNA 1B07A 2LJ3A 3CQTA 1ZSGA 4OMLA 1T0HA 1UG1A 1QKWA 2ESWA 1QCFA 2GTJA 2EQIA 1X6GA 2DVJA 3VRYA 2D8HA 1M8MA 1UE9A 4AG1C 5IHIA 2EVRA 1A0NB 1OOTA 1M3BA 1SPKA 4ESRA 2JS0A 3C0CA 4LUDA 1OPLA 3I9QA 4LNPA 4J9IA 1VYVA 2I0NA 1BK2A 2RQVA 2K9GA 1PKTA 1TUDA 5IHNA 1Z9ZA 5HCKA 1GFCA 2DM1A 1M27C 3A98A 2F2VA 2CSIA 1K4US 1AZEA 2K79A 2DA9A 3I35A 2EYZA 2MIOA 2DL5A 5IHKA 1SHGA 1UHCA 2FPFA 1ARKA 4Z88A 3UATA 2F2XA 3TVTA 2JS2A 3H0HA 1K0SA 2K7AA 2RPNA 3M0TA 1HSQA 3VS2A 2DL7A 2YUOA 2GGRA 2JMAA 1T3SA 2GNCA 1PRLC 1MUZA 2DNUA
chains in the Genus database with same CATH superfamily
1Y07A 2YRVA 3X26B 3I56A 1NM7A 3FIFA 3CXCP 1P92A 1AWOA 2HDAA 4C0DB 2IG0A 5KYNA 1BB9A 1KC8R 4Z8AA 1VQPT 2L3QA 4J9EA 3UDCA 1YNZA 3CCQQ 1RLQC 4M7DE 1U1TA 2AZVA 1VA7A 1VQKQ 1N6AA 1YITQ 4PK4A 2WSEE 1GRIA 1SSHA 2X4JA 2KQWA 3HSBA 2O4XB 4BI8B 1YHQQ 2JW4A 3GPLA 3VV0A 2ROLA 1BYMA 3HP9A 2DYBA 1EX4A 1U5SA 3E9FA 3QWXX 4O6JA 1JJ2S 3BY7A 2KI7A 1ZBXA 3S6WA 1AD5A 1I5OB 1AOJA 1VQ4A 4PLLA 2YUQA 4AT1B 1QVFP 1VQNQ 4ZTJA 2XHCA 4PNOA 1CSKA 1O9SA 4GLMA 4M78B 4QKUA 2BKDN 3LW5E 2VXEA 4XTYA 1VQLA 1ZBJA 2DBMA 3CCUT 4X9CA 4QT7A 2KBTA 2JTMA 3FB9A 4BACA 5D6YA 1M2OA 1GL5A 4A54A 4FYXB 1X01A 4QQGA 4ATOA 2WSCE 3CCMQ 3VYHB 4M75D 3CCQA 4NOYA 1VUBA 1G8XA 2JVVA 4FW2A 3CCMA 1ZUUA 3M54A 3UT1A 3OYYA 2EBPA 1YWPA 4OF1A 2DBKA 5GAOm 3OS0A 1M8VA 1M2VB 2H8HA 4GBQA 2J7IA 1NZ9A 1QCOA 4HKEA 2PNIA 3OYIA 3ZEHA 2PQWA 3EAEA 3J81E 1S72T 3X28B 5L23A 1PD0A 2RHZA 4P5NA 4OB3B 1PG5B 2IIMA 3MP8A 3OW2S 5CCAA 3CMAQ 6AT1B 2KXCA 2DD4A 1VQ7T 1OULA 1ZLMA 3WVDB 3SDZA 1PWTA 4KT0E 2B86A 5KCHA 3P8DA 4M75B 1OPKA 3EHRA 3TU4K 2RHUA 3CEYA 1X27A 2RF0A 4RCCA 3OW2A 1UHFA 4IIOA 1E6HA 1D3BA 1QQJA 1X2QA 8AT1B 4LDUA 1Z9QA 1VQMQ 1KD1R 2JXBA 3Q1JA 3ULRB 2XDPA 1CKAA 1M5Q1 1TXQA 4M75F 5IXBA 1H3ZA 4KBMB 4M77F 1MV0B 2KNBB 1ACMB 4LDXA 4IUVA 1K9MR 2CZ1B 4C8QA 4KGZB 2LQ8A 2DJZA 4M7AE 4MDWA 1UB4A 1VQ7A 1TH7A 2LJ0A 2W0ZA 4JDSA 4A4KA 2RI2A 5CO7A 4ZN3A 3CMAT 1U1SA 1AHJB 3OMGA 4F7UB 3META 2C0IA 3M4GA 1G2BA 5IH2A 4PFOA 1W1FA 4OGEA 3OSSC 4RKUE 3PT9A 3RNJA 3LWHA 2LX7A 5CQYA 2LT4A 1RAFB 2QEXQ 3CPFA 1VQNA 2V8KA 1PSEA 2LQWA 2LQNA 2EAYA 1WLPB 3U23A 2MF2A 3JB9F 4J6YA 1OEBA 2EYWA 3CCQT 1YN8A 3G1JA 4X9DA 1VQ4T 1LPLA 2X3WD 2EWNA 1IO6A 2DIQA 4EMGA 2ROTA 4M77D 4QVZA 3CCUA 2KYMA 2LRQA 4PJOC 2DPPB 2DIGA 2H3JA 1VQLT 1RLPC 5CR2A 3DLLA 2H3EB 2FZKB 3ZBDA 1MMGA 4J5YA 3INZA 1W70A 2JOYA 2RNAA 3OMCA 2RHXA 1G83A 1OYXA 1W2BA 2RH2A 1Y0MA 3VS3A 3CCLT 4M7DF 1GFDA 4M75E 4CC4B 2XDBA 4FIBA 3R6OA 2DK3A 1FXXA 2ZPIB 4CI0C 4FT2A 3CC4Q 4IUQA 1NJIU 2JTEA 3QSUA 2BZ8A 4C8QD 1JJ2A 1GBQA 1Q81U 1X6OA 2D9TA 2CREA 2Y90A 2DD5A 1VQPA 4BUGA 2SRCA 3CCST 3LWIA 2QTXA 1IGUA 3VUZA 4RTTA 2DYIA 3M55A 7AT1B 2XDDA 1T0JA 1VQ8A 4FYVB 1QLYA 3M5AA 3PGGA 4MZMA 1GXIE 1WPYA 2RJCA 2EQMA 1I4K1 4ZGEB 3EH1A 4B6MA 5GAOp 4L5GA 4XQ3A 3T9NA 3QJYA 1RL2A 3L2ZA 2V1RA 3OYKA 2V26A 4JRKA 1SSFA 3G6EA 3RERA 3QO3A 5KCOA 1ZA1B 2DTOA 1H8KA 1VYUA 2ABLA 4RCBA 1X6BA 1BBZA 3I56T 3PFSA 3OB9A 4OGCA 3G4SQ 4AFUC 1C0MA 3CBOA 4A4GA 4D8KA 1YJWA 1TSFA 3H0FA 1OQKA 2HBWA 3JB9H 1CKBA 2O01E 1VQKT 2E1HA 4D8DA 5GAOq 4PJOD 2GFUA 2EYQA 1UFFA 5CKEA 3MHXA 2Z0WA 1TUCA 3E19A 2QQBA 1S1NA 1V29B 4RTZA 1IGQA 2CP0A 2RO0A 2RHYA 3G4ST 4MMKA 4C92G 2KROA 3CCJA 1M3CA 1FMKA 2X3XD 3OYCA 4BDYA 2QA4T 3C94A 2ENMA 1YP5A 2HQEA 2KGTA 4R56A 2ZZDA 2RA2A 4ME7A 1K0XA 2QGGA 2XKOC 3PVQA 1SEMA 1NEBA 2LVMA 1KK7A 1B07A 3KBGA 2COYA 2LJ3A 3P8HA 3CQTA 4JRQA 1ZSGA 4OMLA 3HPWA 5A0LA 3F70A 2ESWA 1QCFA 2GTJA 3FJPA 2EQIA 3VRYA 1D0YA 2LX9A 1IZ6A 2JZ2A 4KULA 3V8LA 5IHIA 1A0NB 4C0ZA 1M3BA 1SPKA 5HK3A 1VQ9Q 1D1AA 4NS5A 1YI2Q 3I9QA 1WHHA 4EMKC 4J9IA 1VYVA 2YLBA 1PKTA 5IHNA 1RAAB 5DM7R 4GY5A 1M27C 1RADB 3CCVQ 2F2VA 3OSVA 4PJOB 1K4US 5GMKh 4V2SA 2E10A 1ZA2B 1UHCA 3LLRA 3DKMA 1ARKA 3UATA 1M2VA 4PL6A 3RKXA 1NPPA 1QMCA 3QJ6A 3OS5A 2P84A 3NTKA 1W2BP 5C6SA 4PLIA 2GNCA 1VQ4Q 4M78D 2DNUA 1SF9A 3I55Q 3V7SA 1YJ9T 4RG2A 3FRNA 4E7JA 5CKHA 3EGXB 2KRMA 1WI7A 4Z02A 2X35A 3DB3A 1C1AA 2JT4A 3FEOA 2DE0X 1AEYA 3RIRA 4M7DA 2HMAA 2L0AA 4JJCA 4F16A 1GCPA 1BKBA 1WNLA 4K11A 1JXOA 2QYZA 2MMPA 2DFUA 3CCEA 1UGRB 3VS5A 1VQ5A 5FRNA 3SWNC 1M9SA 3BE3A 1D0ZA 2I2LA 4FM4B 1QWFA 3E1SA 4AFSC 1WHMA 1G3SA 2LT1A 4Y92A 4BY6C 4N4GA 3MEAA 4B9XA 4HCKA 2EGCA 1VQMT 2QEXT 2DZCA 2P0QA 4F7UF 3EG2A 3MCAB 4J9DA 2HEQA 2DRKA 3TEEA 1SRLA 3CBMA 3RMSA 2QK0A 3G6ET 1K9MC 2EJ9A 4J7IA 2KR3A 1VQLQ 1AZGB 5D6WA 5D7UA 4R55A 5GANe 2VXFA 1KG1A 2CGHA 2ECZA 4JZ4A 2DKGA 1PC0A 4X1VA 2CT4A 5CIUA 1PNJA 2CSQA 2DILA 1TOVA 1K73R 3CCSQ 3QYGB 4HCZA 1Q95G 4C0DC 3EFSA 3OY9A 3CCSA 1M1GA 3CD6T 2OAWA 5GJWB 1S72Q 3TQ7P 3BW1A 4AFZC 2NWMA 2BZXA 3H0IA 1KQSS 4Q5WA 1W2BS 1T3LA 4A4EA 1WHLA 2KMTA 4HVVA 4DBHA 2EGEA 4M75G 3IQLA 1WDXA 2ZPBB 3JAME 3SEMA 2LC4A 3MEVA 4Z89A 2GTOA 3NTIA 1MV3A 1R0CB 3NMZC 3MEWA 1QWEA 1UEBA 3TSWA 2KEAA 1VQ6Q 4KUDK 3JSCA 4HCCA 3JCMg 1PKSA 4BB7A 1PM3A 1G3YA 4OMMA 3E9GA 4JZ3A 2E5QA 4M78E 5DY9A 4M78A 2G3RA 3R6NA 3CD6Q 2K5IA 2F1LA 2CS7A 4PJMA 1Y96B 3I5RA 3ZFJA 2HKQB 1VQNT 2QXFA 5IXFA 1JJ2P 2GQVA 1JO8A 4MZPA 4LE9A 3OYFA 3RBBB 2EIFA 3ASKA 1YITT 4ZNXA 1WX6A 4A4HA 1H92A 3EGXA 1EZZB 5FW9A 3NPFA 3QZ9B 4ORZA 3CC4T 1SHFA 1AVZC 3CMAA 4E2FB 2NUZA 3KXTA 1X69A 1Q7YU 2F5KA 5LJ5h 1M30A 3AT1B 3CCJQ 2AIRB 5A2QE 2HSEB 2YLCA 4RG8A 5EC7A 3JCMX 5AYFA 1UGVA 5FWCA 2RM4A 1I07A 2A08A 2FPEA 4M7AG 1SG5A 3BFMA 3S3OA 3RUXA 3MPUB 2KXDA 2KDSA 2QA4Q 2FG0A 2FEIA 1ABOA 3SWNB 3HL8A 1I0CA 2MWOA 2DLPA 1PRMC 2VKNA 1MGQA 2DL3A 3VS1A 4EIKA 1R8OB 1RAEB 2OJ2A 4FCYA 2MPXC 4EPCA 4M75A 2BE9B 3L2RA 3M59A 4J7FA 2ZPGB 2EW3A 3WXMB 1YIJA 1C6VX 2YDLA 4ZGJB 1W4SA 3M0QA 5CKFA 2F2WA 4J6XA 3BDUA 3URGA 1S72A 2MWPA 1WYXA 4J9GA 3I55T 2DETA 3NGPA 2OTLQ 3O5ZA 3GP8A 1QW1A 4M4ZA 4M77G 5AT1B 3REAB 1K8AC 5GANh 3H9NA 2COZA 3OYDA 3CCMT 4DOVA 1NJIC 3M0UA 1X43A 2C0OA 1U06A 2CT3A 2KYBA 4CC7A 1GCQC 4OMNA 3A8GB 3CMEA 4IUTA 1V76A 5KYXA 2L2PA 3HTRA 1N8RC 4QVDA 3UA7A 2RQTA 4DBFA 4OMPA 4NL3A 2O31A 2QQAA 2OTJA 1WXUA 4RTWA 2L5QA 1OZ3A 2SEMA 1YJWQ 4J9CA 4C5GA 3OYAA 4FT4A 4JS5A 4E7HA 3FC3A 4MDXA 3QKJA 2DXUA 1Q82U 4R0KA 1ZX6A 3M56A 2CH4W 3JB9G 1ZHIA 4QQ6A 1WQ7A 4ELYC 4PJOF 2E3HA 5I11A 4HXJA 2O2OA 2KT8A 3CC2Q 3QZ5B 2A0FB 1WQWA 4RTUA 4DEXA 3JV3A 2M1HA 4DBRA 1SRMA 3HRUA 2PVGB 3OYLA 3CCVT 1HXDA 2GBQA 2LQKA 1Y96A 4N0AA 5GAN8 5D6XA 2EGAA 4RTVA 3KFVA 3QIIA 5LJ3h 4KUIA 1QVGS 4C5HA 2VYTA 5LJ5e 1Q86C 2KSSA 2K4YA 2RK2A 3CMET 1K9MU 4M7DG 5A0DA 5FU6B 4F04B 2ED0A 3RESA 1FYNA 2XI9A 1KQSA 1IHVA 1QKWA 2L89A 4J8OA 1M90U 1X6GA 4JRPA 3I55A 3S3MA 3V7RA 5LJ3f 1D1BA 1PSFA 3CC7A 1BI1A 1VQOT 1OOTA 1VOMA 2JS0A 4LUDA 1KQSP 1IHWA 2QAZA 3A8MB 4C8QF 1KQ2A 2CP2A 2QASA 3QPHA 2EQJA 1FWZA 3DLMA 2COWA 4II1A 3JCMQ 2QI2A 2ZCFB 4N4HA 4M7DD 2XICA 1YCYA 3MP6A 2DM1A 1JBMA 3OYHA 1YHQT 2Y4YA 3M9QA 2E4HA 2CSIA 4EDUA 2DA9A 3V8JA 3I35A 1MMNA 5IHKA 1YI2T 1X75C 2KK4A 1SHGA 1OU9A 3CCRA 2F2XA 3TVTA 1K8AR 1NBEB 3M0TA 1HSQA 5KYYB 1MNEA 4GLKA 1T3SA 2A3LA 3FLGA 4AMCA 5GAMe 4N4IA 3EH2A 3C95A 2J06A 1VQ6A 1K73C 4F7UA 1UDLA 5A0GA 2JM8A 1U3OA 3RKWA 1X2KA 4WTOB 5FLXE 2C06A 5GAOn 3CCLQ 2FZCB 4BE1A 4DBQA 4BD3A 1YITA 5GANf 1OZ2A 1UGSB 2OX7A 4C92E 3JCMJ 2QTVA 1RABB 1PCXA 5KYXB 2LNHB 1NYFA 1Q82C 4JUVA 1YJNQ 1WIEA 4OB0B 1BCMA 1YWOA 4M78G 2IPOB 5CAIA 2DEQA 5GAMj 3LH5A 5GANg 1K76A 2AK5A 2K3BA 3GOXA 4F7UG 1G3TA 4BI3A 2HAXA 2ZAEA 2L3RA 5CQXA 3BDLA 4YTLA 2KY9A 4BE0A 3H41A 2FPDA 2MI6A 4OB2B 2FYKA 2VUBA 2X4YA 2PVOB 3H8ZA 1D1CA 4C92B 1PD1A 2KAFA 2PVDB 3QBYA 3M4YA 5LJ3e 1JRIA 2HL5C 2LNVA 1E6GA 5LJ5j 3OS1A 5I2SA 3UWNA 1QP3A 2QDLA 1Q81C 3MO8A 5KE2A 2EQKA 3TCJA 2E12A 5GAOr 3G71T 3N5BB 1ZUYA 2A28A 4ELZC 4XU1A 3PVLA 1D0XA 4J9HA 1M1KC 4HA8A 3REBB 3NTHA 4PJOA 2OTLT 1QVPA 2K2VA 2YUNA 5GAOl 4PJLA 2JN0A 4M7AF 4QQDA 2QDYB 1Q7YR 4XU2A 1XQHA 2PUKB 4XTZA 2R5AA 2RJDA 2RQWA 4A53A 1B34B 1VQ5Q 4M7AA 3QDRB 3JCMd 1HJDA 3LX7A 4E7SA 3LGFA 4RMOA 2QQRA 1R0BG 5IT9E 4J83A 2KVQG 1AWXA 3QYHB 2DL4A 4E7KA 3JCMV 3OA6A 3G71Q 4BE2A 1KHIA 1IREB 3VS0A 2BE7D 1WHJA 3JCMc 2RK1A 2JJ9A 3SB2A 1NLPC 2LMJA 2DL8A 2VB6A 4M77B 2QEXA 3LGLA 3I56Q 3HRTA 4C5IA 4N0AC 1KIKA 4PJNA 4M7AD 2FRWA 4KGVB 2EYXA 3EGDB 4M78F 1ZUKA 4DEYA 2JNGA 4C92F 3HRSA 2QG9B 2A36A 2GF7A 5KE3A 3RDVA 1H3HA 2GCXA 1JU5C 4PKCC 1OX9A 4KH1B 4E7IA 4C8QC 2VGNA 1M1FA 2BUDA 1N8RU 2CZ6B 2GFAA 1H641 4FSXA 3V7CA 4Y28E 3GLXA 4IUPA 3SWNA 5LL6S 3M0RA 4KH0B 2X4WA 2IVWA 4IIMA 4C5EA 3G71A 5DLOA 2DVEA 3PIOA 2D1XA 1AWWA 2J6OA 1TTHB 2YUPA 2YRCA 3QDFA 2XMFA 1KD1C 2HKNA 2LTOA 5FU7B 2FO0A 1WXTA 3OYNA 5FU6C 2DXTA 1N8RR 2EKHA 1YJ9A 1WGSA 4JPBW 3QG1A 2DJQA 3JCMe 4XAXB 1EIFA 2OTLA 1UECA 2YT6A 2DF6A 1UJYA 4MZTA 4VUBA 3JRZA 1K9AA 1UJ0A 2E41A 1F1BB 4LD9K 1MMAA 2HZYA 2KT1A 2K57A 5GAMf 2AT1B 1AWJA 2R5MA 2F5TX 1G3WA 1VQ7Q 1M4ZA 3EFOB 1Q81R 4E6RA 1WJRA 2LCLA 5I22A 1VYTA 2RJEA 4J9FA 4F7UE 3CCUQ 1YIJQ 3LH0A 1WHKA 3KUFA 4E47A 2P0PA 5HK0A 2DRMA 1PHTA 1QVGP 3QUIA 1LJOA 1EFNA 4O5VA 4OMOA 3FJ5A 3JB9D 2HSPA 3OYEA 5HY6A 3EG9A 3HFNA 4QVCA 2XD0A 1W6XA 3HHTB 1RI9A 3VKIA 1MNDA 2VGMA 4XTXA 4EMHA 2L3PA 3CCRQ 5J26A 3UF4A 4JLIA 1ABQA 5LJ3d 1XTDA 2XU8A 2RJFA 2CKKA 4QW2A 1V1CA 2CDTA 2X4XA 2ZPFB 1J3TA 2ZPHB 4HCBA 2RB6A 2XG8D 4LDYA 3G4SA 4FYYB 1VQ6T 2FZGB 2CZ7B 5CKBA 5KYYA 2VASA 3G7ZA 4CC2A 1LVKA 2DXBA 1VQ9A 3DB4A 1RACB 1TU0B 3CBPA 3RR6A 1B7TA 3GNGA 1JXMA 5HKCA 2M16A 2AKLA 2CP5A 3SHWA 3OBWA 4LXCA 1BU1A 2K6DA 4OP0A 1JB0E 3PE0A 2A7YA 1YI2A 1MMDA 1VQOA 2O9SA 3CC7T 4OVAA 3X25B 1NLOC 3CXCS 3QWYA 4M75C 3M0SA 1I8FA 4EMKA 2D6FA 1UTIA 3JCMW 2DX1A 5ECAA 3EHQA 3L2WA 4C8QB 5EG2A 1AT1B 3VS7A 2NUPB 4HT8A 1KD1U 1WHGA 5FWBA 3C12A 3OYJA 2AKKA 2MCNA 3QXEB 2QQ9A 2PZ1A 1QKXA 3UA6A 1NJIR 2K3XA 2P0KA 3M58A 4E7ZA 1BI0A 4C8QG 1KHCA 1N9RA 4BI4A 1UG1A 3CC7Q 2DVJA 1UE9A 2O4XA 1M1KU 4PFZA 3OS2A 1FX7A 4AG1C 2EVRA 4FU6A 4ESRA 2RHIA 1I81A 3GNFB 4PJOE 1OPLA 4MMLA 3AHUA 4JLGA 4LNPA 5GAN4 2YHTA 1M90C 1BK2A 3CCLA 3D7SB 2RQVA 4DQ2A 2NUTB 3A5ZB 2JUFA 1HK9A 2K9GA 5DLQE 3CCVA 1UGQB 5HCKA 1GFCA 5FRMA 5LJ5d 3A98A 1G5VA 2RD1A 2K79A 2OTJT 2E6ZA 2EYZA 2MIOA 4M7AC 2NLUA 3L2VA 4PJJA 2FPFA 4Z88A 2E6NA 3CPWS 3H0HA 2AHJB 3VS2A 2DL7A 2GGRA 2WSFE 5KYUB 4PJOG 1MUZA 1HYOA 4RTYA 2EKOA 3EG9B 2B8AA 1OI1A 2QGFB 4J6WA 2M0YA 2XIDA 4DA4A 4M77E 3PMTA 4B9WA 4C8QE 3MP1A 2CZ0B 3QHSA 2MAMA 2OAUA 3L42A 2EJFA 4LD6A 2FB7A 4C92A 1B3QA 1D09B 4A63B 3EGDA 4LUEA 2CP7A 2FVUA 1YIJT 3CCEQ 5LJ3g 2M9UA 3RMQA 4CC3A 2RQRA 3J7AF 1OV3A 5FU7C 2X51A 3M53A 1OU8A 2BTTA 4ZN1A 4XK8E 5GMKi 1WJQA 3SD4A 5GMKe 3VU3C 2L3SA 2LZ6B 1D3BB 4PFPA 3CPWP 1WZOA 4D6WA 3PIPA 4L6V5 1HD3A 1UGPB 2EQUA 5KYWB 3HFOA 1QP2A 1VQ9T 1Y71A 1NG2A 3JCMf 1NYGA 4OMQA 1XOVA 1RI0A 1B34A 2AZSA 2HQHA 2LCSA 1NE8A 2HQXA 2LCCA 5LJ5g 2BIVA 2WACA 4KRTA 8ATCB 1TUGB 2Y4XA 3UPUA 3OYBA 2CUBA 1QVFA 3SFMA 3EG3A 2L8DA 4WCIA 2E70A 2JM9A 1O75A 1BI2A 4FYWB 4XTUA 2DTHA 1ZSZA 3MEUA 2ZPEB 2RN8A 1KC8C 2G6FX 2QQSA 5GAN2 4M77A 1YFNA 3VS6A 2VC8A 2RQUA 2CH4A 3EFRA 4C0GA 1WJSA 2HBPA 2MOXA 4X34A 5C0MA 3CC4A 9ATCB 4OMFB 2RI5A 1K73U 2D0QB 2FRYA 1QVFS 3JB9J 2E5KA 4JJDA 3PMIA 3TSZA 2CP6A 2P4RA 1KFZA 3O8VA 2JMCA 3X20B 4JJBA 2LDMA 2J05A 3L2QA 2HNIA 1KC8U 1RAHB 4L59A 1BIBA 2GQIA 5M9OA 2C0TA 3EG1A 2FL7A 4BDZA 5GAMh 4M7AB 4LDWA 1QVGA 4F14A 4M7DC 1ZSZC 2F69A 3M0PA 2PUOB 1XJWB 3GF5A 2VVKA 1IXDA 1GCQA 1VIFA 2K5FA 3CD6A 2HCKA 3MKDA 3VRZA 3ZL7C 3OYMA 3PNWC 4IUUA 2HL3A 4A4FA 2NYSA 1I5LA 2ZGWA 2P4TA 5GAN3 2M02A 2W10A 2KRSA 4Y91A 3P8BB 1U8RA 1WA7A 2D0NA 1MHNA 1I1JA 3EFOA 4J9BA 1GBRA 1RAGB 2JTFA 2V8IA 4AG2C 5LJ3j 3PTAA 2CYZB 1R77A 3A8LB 3VYGA 1UUEA 3A1PA 4FW1A 1IB8A 2V8JA 1VQMA 1KJWA 3THKA 2EFIA 1RAIB 2PTKA 4IKFA 1NEGA 2DTIA 2K5LA 2O88A 3A8HB 2DERA 4RTXA 4ANJA 1Q7YC 3GBQA 3JCMh 1VQ8Q 4F17A 2X9HA 2XK0A 2D8JA 1WXBA 5I21A 3VJPA 2EYYA 4FL6A 2OI3A 2EPDA 2DMOA 1FMVA 4M77C 2E64A 5GMKm 5I2MA 1M3AA 3JCMP 1VQ5T 2CUDA 4C92D 3E2UA 4C0FA 3A8OB 3CCET 3G6EQ 1JEGA 2DXCA 1DJ7B 2OTJQ 4JRIA 4M78C 3EG0A 3M57A 4TVRA 5CKDA 1LNXA 3NHNA 1VIEA 4RUGA 2CP3A 2YXYA 3I5SA 1N5ZA 5KH6A 3VS4A 2MK5A 2V1QA 2YSQA 3HKSA 3WVEB 1LCKA 3MJXA 1VQPQ 3CXCA 5GAMd 4XTWA 4DOWA 5IAYA 1YJ9Q 1JQQA 5GJVB 2J6FA 2DZ9A 2RI3A 2ATCB 3CC2A 2M51A 4AFQC 4HVWA 5GANd 2KRNA 5GAMg 5GANj 4KGXB 3GIBA 3JCMb 4ZTFA 1M90R 5GAN7 3FDRA 3OBYA 3OYGA 2BZYA 1K8AU 4XU0A 3X24B 4LDVA 1N9SA 4LN2A 3CMEQ 1N27A 4EMKB 3OQ5A 2ED1A 4JS4A 3EGUA 4ZGDB 2K2MA 2J6KA 1YBYA 3CPWA 3H6ZA 2R57A 3S3NA 2NUPA 3L2UA 4C92C 2R58A 2O9VA 1RUWA 1TS9A 1TWBA 1E7OA 4OB1B 1KSWA 1TG0A 1QCNA 4E7LA 1FMWA 1YJNT 1Q82R 4HVUA 1VQOQ 4HT9A 1YCSB 1WFWA 2FHDA 5GMKj 1K1ZA 4XU3A 1YJNA 4WF2A 3NFCA 5LJ5f 5GAN6 2LJ1A 1ZQ1A 4UC4A 4M7DB 4CRIA 4IURA 1Q86U 5KYUA 2M0OA 1XNIA 2KE9A 5GMKl 4FSSA 4XTVA 3J80E 1Y57A 5CVIA 2LP5A 2DO3A 2RMOA 2A37A 3JB9I 2DEUA 2QA4A 2K3YA 2YWWA 2DAQA 4NL2A 1BCOA 3RKYA 2VWFA 5IN1A 3C4SA 2MYSA 3L1AA 2E3IA 3CCJT 2E65A 1OX8A 3V8KA 2PU9B 1T0HA 3CC2T 2D8HA 1M8MA 4JJNK 1M1KR 1BI3A 2YRDA 2EJGA 3ME9A 1Y7XA 3C0CA 3TREA 1BIAA 1LOJA 3CCRT 5J39A 1VQKA 5J3BA 5L8RE 1IRXA 2I0NA 5CK9A 2VV5A 1KQ1A 1YJWT 3ER0A 4BY6B 1TUDA 1Q86R 1YHQA 1SKUB 1Z9ZA 5KYWA 5GAN5 1AZEA 2DL5A 5FROA 3VUBA 2HD0A 2JS2A 1K0SA 2K7AA 2RPNA 2YUOA 1VQ8T 2JMAA 1NPRA 3LYIA 1ZSZB 1PRLC 2NUTA 3OW2P
chains in the Genus database with same CATH topology
1NM7A 4RTYA 2J06A 1AWOA 2HDAA 1BB9A 1UDLA 4Z8AA 2JM8A 1U3OA 2KRMA 1WI7A 2L3QA 2M0YA 4J9EA 1X2KA 1YNZA 2JT4A 2DE0X 1RLQC 1AEYA 2L0AA 4F16A 4JJCA 1B3QA 4A63B 1GCPA 4LUEA 2AZVA 1VA7A 4K11A 2LNHB 1NYFA 1JXOA 1GRIA 1SSHA 4CC3A 2RQRA 1WIEA 1YWOA 1OV3A 3VS5A 2JW4A 3LH5A 2ROLA 2BTTA 1K76A 2AK5A 2K3BA 2DYBA 1U5SA 1QWFA 3QWXX 4AFSC 2L3SA 2LZ6B 1AD5A 1AOJA 3H41A 1HD3A 2FPDA 4Y92A 2YUQA 1CSKA 4GLMA 1NG2A 4HCKA 2EGCA 1NYGA 3EG2A 4J9DA 4OMQA 2HEQA 2DRKA 1XOVA 1SRLA 1ZBJA 2AZSA 2DBMA 2LCSA 1E6GA 4QT7A 4KRTA 2KBTA 2KR3A 1AZGB 2CUBA 2QDLA 3EG3A 4WCIA 2ECZA 4JZ4A 2JM9A 1GL5A 4X1VA 2CT4A 1ZUYA 1PNJA 2A28A 2CSQA 2DILA 3PVLA 2RN8A 4J9HA 3REBB 2G6FX 1ZUUA 2YUNA 3VS6A 2RQUA 2CH4A 2EBPA 1YWPA 2DBKA 2OAWA 2MOXA 2H8HA 4GBQA 5GJWB 2J7IA 2RQWA 2PNIA 4AFZC 1HJDA 5L23A 2NWMA 2BZXA 3H0IA 1AWXA 2FRYA 1T3LA 2DL4A 2E5KA 2IIMA 4JJDA 4HVVA 3VS0A 2EGEA 3IQLA 1WDXA 2KXCA 3TSZA 2P4RA 3SEMA 1NLPC 1ZLMA 2LMJA 1KFZA 2JMCA 1PWTA 2DL8A 4Z89A 2B86A 2GTOA 4JJBA 2J05A 1MV3A 1OPKA 3NMZC 3EHRA 1X27A 2RF0A 1QWEA 1KIKA 1UHFA 3TSWA 2KEAA 4IIOA 1E6HA 1X2QA 1PKSA 2GQIA 1Z9QA 2FRWA 2C0TA 3EG1A 2EYXA 2JXBA 3ULRB 1ZUKA 4DEYA 4OMMA 1CKAA 2A36A 4JZ3A 4F14A 5IXBA 1H3HA 3M0PA 1MV0B 3R6NA 2KNBB 1JU5C 2VVKA 1GCQA 3I5RA 2HCKA 3VRZA 3ZL7C 5IXFA 2LJ0A 2W0ZA 3M0RA 1JO8A 2W10A 2KRSA 4LE9A 3RBBB 1WA7A 4IIMA 4ZNXA 1WX6A 1H92A 2D0NA 2C0IA 3NPFA 5FW9A 4ORZA 2D1XA 1SHFA 1I1JA 2J6OA 1AVZC 2YUPA 1AWWA 1G2BA 5IH2A 1W1FA 2XMFA 4J9BA 1GBRA 2NUZA 3RNJA 4AG2C 1X69A 2LX7A 2FO0A 1WXTA 1M30A 1UUEA 2EKHA 2LQWA 2LQNA 3U23A 1WLPB 4JPBW 2DJQA 5EC7A 1KJWA 1UECA 3THKA 2YT6A 2PTKA 2DF6A 1UJYA 1UGVA 5FWCA 1I07A 1OEBA 2A08A 1K9AA 1NEGA 2EYWA 2FPEA 2O88A 1UJ0A 1YN8A 2KXDA 4RTXA 2FG0A 2FEIA 1ABOA 3GBQA 2X3WD 1I0CA 1IO6A 2KT1A 4F17A 2DLPA 1PRMC 2ROTA 2VKNA 2D8JA 1AWJA 2DL3A 3VS1A 1WXBA 4EIKA 2OJ2A 2EYYA 2OI3A 2EPDA 2DMOA 2KYMA 4E6RA 1M3AA 2CUDA 5I22A 1RLPC 1VYTA 4J9FA 1JEGA 3EG0A 1W70A 3NHNA 2DRMA 1PHTA 2EW3A 4RUGA 2RNAA 1G83A 3I5SA 1Y0MA 1N5ZA 2YDLA 3VS3A 1GFDA 3VS4A 3M0QA 4CC4B 2F2WA 1EFNA 2V1QA 4OMOA 3FJ5A 2YSQA 2HSPA 1LCKA 2JTEA 2BZ8A 1GBQA 1JQQA 2CREA 5GJVB 1WYXA 4J9GA 2J6FA 2SRCA 3NGPA 3O5ZA 4M4ZA 2M51A 3REAB 1W6XA 1RI9A 4AFQC 4HVWA 4RTTA 2KRNA 3M0UA 1X43A 2C0OA 1U06A 2CT3A 2KYBA 2L3PA 4CC7A 1T0JA 3UF4A 1QLYA 1GCQC 4OMNA 2L2PA 1ABQA 2BZYA 4LN2A 3UA7A 2RQTA 4OMPA 2V1RA 1V1CA 2CDTA 1J3TA 2O31A 2ED1A 3EGUA 2K2MA 1WXUA 4RTWA 2J6KA 1H8KA 1VYUA 2SEMA 2ABLA 1X6BA 1BBZA 4J9CA 4CC2A 2O9VA 4AFUC 1RUWA 1E7OA 4D8KA 1KSWA 1TG0A 3H0FA 4R0KA 2HBWA 4HVUA 1CKBA 1JXMA 1ZX6A 2AKLA 2CH4W 3SHWA 1YCSB 4D8DA 1BU1A 1WFWA 2K6DA 5I11A 4HXJA 2O2OA 3PE0A 2KT8A 1K1ZA 1UFFA 2O9SA 4RTUA 4DEXA 3JV3A 1NLOC 2LJ1A 3QWYA 1TUCA 3M0SA 1S1NA 1SRMA 1UTIA 4RTZA 2DX1A 5ECAA 3EHQA 2KE9A 2GBQA 3VS7A 4FSSA 2KROA 1M3CA 2EGAA 4RTVA 3KFVA 1FMKA 1Y57A 2X3XD 2LP5A 5FWBA 2AKKA 2A37A 2RMOA 2MCNA 2ENMA 1YP5A 2KGTA 2PZ1A 1K0XA 1QKXA 3UA6A 3PVQA 1NEBA 1SEMA 2VWFA 2ED0A 1FYNA 1B07A 2LJ3A 3CQTA 1ZSGA 4OMLA 1T0HA 1UG1A 1QKWA 2ESWA 1QCFA 2GTJA 2EQIA 1X6GA 2DVJA 3VRYA 2D8HA 1M8MA 1UE9A 4AG1C 5IHIA 2EVRA 1A0NB 1OOTA 1M3BA 1SPKA 4ESRA 2JS0A 3C0CA 4LUDA 1OPLA 3I9QA 4LNPA 4J9IA 1VYVA 2I0NA 1BK2A 2RQVA 2K9GA 1PKTA 1TUDA 5IHNA 1Z9ZA 5HCKA 1GFCA 2DM1A 1M27C 3A98A 2F2VA 2CSIA 1K4US 1AZEA 2K79A 2DA9A 3I35A 2EYZA 2MIOA 2DL5A 5IHKA 1SHGA 1UHCA 2FPFA 1ARKA 4Z88A 3UATA 2F2XA 3TVTA 2JS2A 3H0HA 1K0SA 2K7AA 2RPNA 3M0TA 1HSQA 3VS2A 2DL7A 2YUOA 2GGRA 2JMAA 1T3SA 2GNCA 1PRLC 1MUZA 2DNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NM7 A;  4RTY A;  2J06 A;  1AWO A;  2HDA A;  1BB9 A;  1UDL A;  4Z8A A;  2JM8 A;  1U3O A;  2KRM A;  1WI7 A;  2L3Q A;  2M0Y A;  4J9E A;  1X2K A;  1YNZ A;  2JT4 A;  2DE0 X;  1RLQ C;  1AEY A;  2L0A A;  4F16 A;  4JJC A;  1B3Q A;  4A63 B;  1GCP A;  4LUE A;  2AZV A;  1VA7 A;  4K11 A;  2LNH B;  1NYF A;  1JXO A;  1GRI A;  1SSH A;  4CC3 A;  2RQR A;  1WIE A;  1YWO A;  1OV3 A;  3VS5 A;  2JW4 A;  3LH5 A;  2ROL A;  2BTT A;  1K76 A;  2AK5 A;  2K3B A;  2DYB A;  1U5S A;  1QWF A;  3QWX X;  4AFS C;  2L3S A;  2LZ6 B;  1AD5 A;  1AOJ A;  3H41 A;  1HD3 A;  2FPD A;  4Y92 A;  2YUQ A;  1CSK A;  4GLM A;  1NG2 A;  4HCK A;  2EGC A;  1NYG A;  3EG2 A;  4J9D A;  4OMQ A;  2HEQ A;  2DRK A;  1XOV A;  1SRL A;  1ZBJ A;  2AZS A;  2DBM A;  2LCS A;  1E6G A;  4QT7 A;  4KRT A;  2KBT A;  2KR3 A;  1AZG B;  2CUB A;  2QDL A;  3EG3 A;  4WCI A;  2ECZ A;  4JZ4 A;  2JM9 A;  1GL5 A;  4X1V A;  2CT4 A;  1ZUY A;  1PNJ A;  2A28 A;  2CSQ A;  2DIL A;  3PVL A;  2RN8 A;  4J9H A;  3REB B;  2G6F X;  1ZUU A;  2YUN A;  3VS6 A;  2RQU A;  2CH4 A;  2EBP A;  1YWP A;  2DBK A;  2OAW A;  2MOX A;  2H8H A;  4GBQ A;  5GJW B;  2J7I A;  2RQW A;  2PNI A;  4AFZ C;  1HJD A;  5L23 A;  2NWM A;  2BZX A;  3H0I A;  1AWX A;  2FRY A;  1T3L A;  2DL4 A;  2E5K A;  2IIM A;  4JJD A;  4HVV A;  3VS0 A;  2EGE A;  3IQL A;  1WDX A;  2KXC A;  3TSZ A;  2P4R A;  3SEM A;  1NLP C;  1ZLM A;  2LMJ A;  1KFZ A;  2JMC A;  1PWT A;  2DL8 A;  4Z89 A;  2B86 A;  2GTO A;  4JJB A;  2J05 A;  1MV3 A;  1OPK A;  3NMZ C;  3EHR A;  1X27 A;  2RF0 A;  1QWE A;  1KIK A;  1UHF A;  3TSW A;  2KEA A;  4IIO A;  1E6H A;  1X2Q A;  1PKS A;  2GQI A;  1Z9Q A;  2FRW A;  2C0T A;  3EG1 A;  2EYX A;  2JXB A;  3ULR B;  1ZUK A;  4DEY A;  4OMM A;  1CKA A;  2A36 A;  4JZ3 A;  4F14 A;  5IXB A;  1H3H A;  3M0P A;  1MV0 B;  3R6N A;  2KNB B;  1JU5 C;  2VVK A;  1GCQ A;  3I5R A;  2HCK A;  3VRZ A;  3ZL7 C;  5IXF A;  2LJ0 A;  2W0Z A;  3M0R A;  1JO8 A;  2W10 A;  2KRS A;  4LE9 A;  3RBB B;  1WA7 A;  4IIM A;  4ZNX A;  1WX6 A;  1H92 A;  2D0N A;  2C0I A;  3NPF A;  5FW9 A;  4ORZ A;  2D1X A;  1SHF A;  1I1J A;  2J6O A;  1AVZ C;  2YUP A;  1AWW A;  1G2B A;  5IH2 A;  1W1F A;  2XMF A;  4J9B A;  1GBR A;  2NUZ A;  3RNJ A;  4AG2 C;  1X69 A;  2LX7 A;  2FO0 A;  1WXT A;  1M30 A;  1UUE A;  2EKH A;  2LQW A;  2LQN A;  3U23 A;  1WLP B;  4JPB W;  2DJQ A;  5EC7 A;  1KJW A;  1UEC A;  3THK A;  2YT6 A;  2PTK A;  2DF6 A;  1UJY A;  1UGV A;  5FWC A;  1I07 A;  1OEB A;  2A08 A;  1K9A A;  1NEG A;  2EYW A;  2FPE A;  2O88 A;  1UJ0 A;  1YN8 A;  2KXD A;  4RTX A;  2FG0 A;  2FEI A;  1ABO A;  3GBQ A;  2X3W D;  1I0C A;  1IO6 A;  2KT1 A;  4F17 A;  2DLP A;  1PRM C;  2ROT A;  2VKN A;  2D8J A;  1AWJ A;  2DL3 A;  3VS1 A;  1WXB A;  4EIK A;  2OJ2 A;  2EYY A;  2OI3 A;  2EPD A;  2DMO A;  2KYM A;  4E6R A;  1M3A A;  2CUD A;  5I22 A;  1RLP C;  1VYT A;  4J9F A;  1JEG A;  3EG0 A;  1W70 A;  3NHN A;  2DRM A;  1PHT A;  2EW3 A;  4RUG A;  2RNA A;  1G83 A;  3I5S A;  1Y0M A;  1N5Z A;  2YDL A;  3VS3 A;  1GFD A;  3VS4 A;  3M0Q A;  4CC4 B;  2F2W A;  1EFN A;  2V1Q A;  4OMO A;  3FJ5 A;  2YSQ A;  2HSP A;  1LCK A;  2JTE A;  2BZ8 A;  1GBQ A;  1JQQ A;  2CRE A;  5GJV B;  1WYX A;  4J9G A;  2J6F A;  2SRC A;  3NGP A;  3O5Z A;  4M4Z A;  2M51 A;  3REA B;  1W6X A;  1RI9 A;  4AFQ C;  4HVW A;  4RTT A;  2KRN A;  3M0U A;  1X43 A;  2C0O A;  1U06 A;  2CT3 A;  2KYB A;  2L3P A;  4CC7 A;  1T0J A;  3UF4 A;  1QLY A;  1GCQ C;  4OMN A;  2L2P A;  1ABQ A;  2BZY A;  4LN2 A;  3UA7 A;  2RQT A;  4OMP A;  2V1R A;  1V1C A;  2CDT A;  1J3T A;  2O31 A;  2ED1 A;  3EGU A;  2K2M A;  1WXU A;  4RTW A;  2J6K A;  1H8K A;  1VYU A;  2SEM A;  2ABL A;  1X6B A;  1BBZ A;  4J9C A;  4CC2 A;  2O9V A;  4AFU C;  1RUW A;  1E7O A;  4D8K A;  1KSW A;  1TG0 A;  3H0F A;  4R0K A;  2HBW A;  4HVU A;  1CKB A;  1JXM A;  1ZX6 A;  2AKL A;  2CH4 W;  3SHW A;  1YCS B;  4D8D A;  1BU1 A;  1WFW A;  2K6D A;  5I11 A;  4HXJ A;  2O2O A;  3PE0 A;  2KT8 A;  1K1Z A;  1UFF A;  2O9S A;  4RTU A;  4DEX A;  3JV3 A;  1NLO C;  2LJ1 A;  3QWY A;  1TUC A;  3M0S A;  1S1N A;  1SRM A;  1UTI A;  4RTZ A;  2DX1 A;  5ECA A;  3EHQ A;  2KE9 A;  2GBQ A;  3VS7 A;  4FSS A;  2KRO A;  1M3C A;  2EGA A;  4RTV A;  3KFV A;  1FMK A;  1Y57 A;  2X3X D;  2LP5 A;  5FWB A;  2AKK A;  2A37 A;  2RMO A;  2MCN A;  2ENM A;  1YP5 A;  2KGT A;  2PZ1 A;  1K0X A;  1QKX A;  3UA6 A;  3PVQ A;  1NEB A;  1SEM A;  2VWF A;  2ED0 A;  1FYN A;  1B07 A;  2LJ3 A;  3CQT A;  1ZSG A;  4OML A;  1T0H A;  1UG1 A;  1QKW A;  2ESW A;  1QCF A;  2GTJ A;  2EQI A;  1X6G A;  2DVJ A;  3VRY A;  2D8H A;  1M8M A;  1UE9 A;  4AG1 C;  5IHI A;  2EVR A;  1A0N B;  1OOT A;  1M3B A;  1SPK A;  4ESR A;  2JS0 A;  3C0C A;  4LUD A;  1OPL A;  3I9Q A;  4LNP A;  4J9I A;  1VYV A;  2I0N A;  1BK2 A;  2RQV A;  2K9G A;  1PKT A;  1TUD A;  5IHN A;  1Z9Z A;  5HCK A;  1GFC A;  2DM1 A;  1M27 C;  3A98 A;  2F2V A;  2CSI A;  1K4U S;  1AZE A;  2K79 A;  2DA9 A;  3I35 A;  2EYZ A;  2MIO A;  2DL5 A;  5IHK A;  1SHG A;  1UHC A;  2FPF A;  1ARK A;  4Z88 A;  3UAT A;  2F2X A;  3TVT A;  2JS2 A;  3H0H A;  1K0S A;  2K7A A;  2RPN A;  3M0T A;  1HSQ A;  3VS2 A;  2DL7 A;  2YUO A;  2GGR A;  2JMA A;  1T3S A;  2GNC A;  1PRL C;  1MUZ A;  2DNU A; 
#chains in the Genus database with same CATH topology
 1Y07 A;  2YRV A;  3X26 B;  3I56 A;  1NM7 A;  3FIF A;  3CXC P;  1P92 A;  1AWO A;  2HDA A;  4C0D B;  2IG0 A;  5KYN A;  1BB9 A;  1KC8 R;  4Z8A A;  1VQP T;  2L3Q A;  4J9E A;  3UDC A;  1YNZ A;  3CCQ Q;  1RLQ C;  4M7D E;  1U1T A;  2AZV A;  1VA7 A;  1VQK Q;  1N6A A;  1YIT Q;  4PK4 A;  2WSE E;  1GRI A;  1SSH A;  2X4J A;  2KQW A;  3HSB A;  2O4X B;  4BI8 B;  1YHQ Q;  2JW4 A;  3GPL A;  3VV0 A;  2ROL A;  1BYM A;  3HP9 A;  2DYB A;  1EX4 A;  1U5S A;  3E9F A;  3QWX X;  4O6J A;  1JJ2 S;  3BY7 A;  2KI7 A;  1ZBX A;  3S6W A;  1AD5 A;  1I5O B;  1AOJ A;  1VQ4 A;  4PLL A;  2YUQ A;  4AT1 B;  1QVF P;  1VQN Q;  4ZTJ A;  2XHC A;  4PNO A;  1CSK A;  1O9S A;  4GLM A;  4M78 B;  4QKU A;  2BKD N;  3LW5 E;  2VXE A;  4XTY A;  1VQL A;  1ZBJ A;  2DBM A;  3CCU T;  4X9C A;  4QT7 A;  2KBT A;  2JTM A;  3FB9 A;  4BAC A;  5D6Y A;  1M2O A;  1GL5 A;  4A54 A;  4FYX B;  1X01 A;  4QQG A;  4ATO A;  2WSC E;  3CCM Q;  3VYH B;  4M75 D;  3CCQ A;  4NOY A;  1VUB A;  1G8X A;  2JVV A;  4FW2 A;  3CCM A;  1ZUU A;  3M54 A;  3UT1 A;  3OYY A;  2EBP A;  1YWP A;  4OF1 A;  2DBK A;  5GAO m;  3OS0 A;  1M8V A;  1M2V B;  2H8H A;  4GBQ A;  2J7I A;  1NZ9 A;  1QCO A;  4HKE A;  2PNI A;  3OYI A;  3ZEH A;  2PQW A;  3EAE A;  3J81 E;  1S72 T;  3X28 B;  5L23 A;  1PD0 A;  2RHZ A;  4P5N A;  4OB3 B;  1PG5 B;  2IIM A;  3MP8 A;  3OW2 S;  5CCA A;  3CMA Q;  6AT1 B;  2KXC A;  2DD4 A;  1VQ7 T;  1OUL A;  1ZLM A;  3WVD B;  3SDZ A;  1PWT A;  4KT0 E;  2B86 A;  5KCH A;  3P8D A;  4M75 B;  1OPK A;  3EHR A;  3TU4 K;  2RHU A;  3CEY A;  1X27 A;  2RF0 A;  4RCC A;  3OW2 A;  1UHF A;  4IIO A;  1E6H A;  1D3B A;  1QQJ A;  1X2Q A;  8AT1 B;  4LDU A;  1Z9Q A;  1VQM Q;  1KD1 R;  2JXB A;  3Q1J A;  3ULR B;  2XDP A;  1CKA A;  1M5Q 1;  1TXQ A;  4M75 F;  5IXB A;  1H3Z A;  4KBM B;  4M77 F;  1MV0 B;  2KNB B;  1ACM B;  4LDX A;  4IUV A;  1K9M R;  2CZ1 B;  4C8Q A;  4KGZ B;  2LQ8 A;  2DJZ A;  4M7A E;  4MDW A;  1UB4 A;  1VQ7 A;  1TH7 A;  2LJ0 A;  2W0Z A;  4JDS A;  4A4K A;  2RI2 A;  5CO7 A;  4ZN3 A;  3CMA T;  1U1S A;  1AHJ B;  3OMG A;  4F7U B;  3MET A;  2C0I A;  3M4G A;  1G2B A;  5IH2 A;  4PFO A;  1W1F A;  4OGE A;  3OSS C;  4RKU E;  3PT9 A;  3RNJ A;  3LWH A;  2LX7 A;  5CQY A;  2LT4 A;  1RAF B;  2QEX Q;  3CPF A;  1VQN A;  2V8K A;  1PSE A;  2LQW A;  2LQN A;  2EAY A;  1WLP B;  3U23 A;  2MF2 A;  3JB9 F;  4J6Y A;  1OEB A;  2EYW A;  3CCQ T;  1YN8 A;  3G1J A;  4X9D A;  1VQ4 T;  1LPL A;  2X3W D;  2EWN A;  1IO6 A;  2DIQ A;  4EMG A;  2ROT A;  4M77 D;  4QVZ A;  3CCU A;  2KYM A;  2LRQ A;  4PJO C;  2DPP B;  2DIG A;  2H3J A;  1VQL T;  1RLP C;  5CR2 A;  3DLL A;  2H3E B;  2FZK B;  3ZBD A;  1MMG A;  4J5Y A;  3INZ A;  1W70 A;  2JOY A;  2RNA A;  3OMC A;  2RHX A;  1G83 A;  1OYX A;  1W2B A;  2RH2 A;  1Y0M A;  3VS3 A;  3CCL T;  4M7D F;  1GFD A;  4M75 E;  4CC4 B;  2XDB A;  4FIB A;  3R6O A;  2DK3 A;  1FXX A;  2ZPI B;  4CI0 C;  4FT2 A;  3CC4 Q;  4IUQ A;  1NJI U;  2JTE A;  3QSU A;  2BZ8 A;  4C8Q D;  1JJ2 A;  1GBQ A;  1Q81 U;  1X6O A;  2D9T A;  2CRE A;  2Y90 A;  2DD5 A;  1VQP A;  4BUG A;  2SRC A;  3CCS T;  3LWI A;  2QTX A;  1IGU A;  3VUZ A;  4RTT A;  2DYI A;  3M55 A;  7AT1 B;  2XDD A;  1T0J A;  1VQ8 A;  4FYV B;  1QLY A;  3M5A A;  3PGG A;  4MZM A;  1GXI E;  1WPY A;  2RJC A;  2EQM A;  1I4K 1;  4ZGE B;  3EH1 A;  4B6M A;  5GAO p;  4L5G A;  4XQ3 A;  3T9N A;  3QJY A;  1RL2 A;  3L2Z A;  2V1R A;  3OYK A;  2V26 A;  4JRK A;  1SSF A;  3G6E A;  3RER A;  3QO3 A;  5KCO A;  1ZA1 B;  2DTO A;  1H8K A;  1VYU A;  2ABL A;  4RCB A;  1X6B A;  1BBZ A;  3I56 T;  3PFS A;  3OB9 A;  4OGC A;  3G4S Q;  4AFU C;  1C0M A;  3CBO A;  4A4G A;  4D8K A;  1YJW A;  1TSF A;  3H0F A;  1OQK A;  2HBW A;  3JB9 H;  1CKB A;  2O01 E;  1VQK T;  2E1H A;  4D8D A;  5GAO q;  4PJO D;  2GFU A;  2EYQ A;  1UFF A;  5CKE A;  3MHX A;  2Z0W A;  1TUC A;  3E19 A;  2QQB A;  1S1N A;  1V29 B;  4RTZ A;  1IGQ A;  2CP0 A;  2RO0 A;  2RHY A;  3G4S T;  4MMK A;  4C92 G;  2KRO A;  3CCJ A;  1M3C A;  1FMK A;  2X3X D;  3OYC A;  4BDY A;  2QA4 T;  3C94 A;  2ENM A;  1YP5 A;  2HQE A;  2KGT A;  4R56 A;  2ZZD A;  2RA2 A;  4ME7 A;  1K0X A;  2QGG A;  2XKO C;  3PVQ A;  1SEM A;  1NEB A;  2LVM A;  1KK7 A;  1B07 A;  3KBG A;  2COY A;  2LJ3 A;  3P8H A;  3CQT A;  4JRQ A;  1ZSG A;  4OML A;  3HPW A;  5A0L A;  3F70 A;  2ESW A;  1QCF A;  2GTJ A;  3FJP A;  2EQI A;  3VRY A;  1D0Y A;  2LX9 A;  1IZ6 A;  2JZ2 A;  4KUL A;  3V8L A;  5IHI A;  1A0N B;  4C0Z A;  1M3B A;  1SPK A;  5HK3 A;  1VQ9 Q;  1D1A A;  4NS5 A;  1YI2 Q;  3I9Q A;  1WHH A;  4EMK C;  4J9I A;  1VYV A;  2YLB A;  1PKT A;  5IHN A;  1RAA B;  5DM7 R;  4GY5 A;  1M27 C;  1RAD B;  3CCV Q;  2F2V A;  3OSV A;  4PJO B;  1K4U S;  5GMK h;  4V2S A;  2E10 A;  1ZA2 B;  1UHC A;  3LLR A;  3DKM A;  1ARK A;  3UAT A;  1M2V A;  4PL6 A;  3RKX A;  1NPP A;  1QMC A;  3QJ6 A;  3OS5 A;  2P84 A;  3NTK A;  1W2B P;  5C6S A;  4PLI A;  2GNC A;  1VQ4 Q;  4M78 D;  2DNU A;  1SF9 A;  3I55 Q;  3V7S A;  1YJ9 T;  4RG2 A;  3FRN A;  4E7J A;  5CKH A;  3EGX B;  2KRM A;  1WI7 A;  4Z02 A;  2X35 A;  3DB3 A;  1C1A A;  2JT4 A;  3FEO A;  2DE0 X;  1AEY A;  3RIR A;  4M7D A;  2HMA A;  2L0A A;  4JJC A;  4F16 A;  1GCP A;  1BKB A;  1WNL A;  4K11 A;  1JXO A;  2QYZ A;  2MMP A;  2DFU A;  3CCE A;  1UGR B;  3VS5 A;  1VQ5 A;  5FRN A;  3SWN C;  1M9S A;  3BE3 A;  1D0Z A;  2I2L A;  4FM4 B;  1QWF A;  3E1S A;  4AFS C;  1WHM A;  1G3S A;  2LT1 A;  4Y92 A;  4BY6 C;  4N4G A;  3MEA A;  4B9X A;  4HCK A;  2EGC A;  1VQM T;  2QEX T;  2DZC A;  2P0Q A;  4F7U F;  3EG2 A;  3MCA B;  4J9D A;  2HEQ A;  2DRK A;  3TEE A;  1SRL A;  3CBM A;  3RMS A;  2QK0 A;  3G6E T;  1K9M C;  2EJ9 A;  4J7I A;  2KR3 A;  1VQL Q;  1AZG B;  5D6W A;  5D7U A;  4R55 A;  5GAN e;  2VXF A;  1KG1 A;  2CGH A;  2ECZ A;  4JZ4 A;  2DKG A;  1PC0 A;  4X1V A;  2CT4 A;  5CIU A;  1PNJ A;  2CSQ A;  2DIL A;  1TOV A;  1K73 R;  3CCS Q;  3QYG B;  4HCZ A;  1Q95 G;  4C0D C;  3EFS A;  3OY9 A;  3CCS A;  1M1G A;  3CD6 T;  2OAW A;  5GJW B;  1S72 Q;  3TQ7 P;  3BW1 A;  4AFZ C;  2NWM A;  2BZX A;  3H0I A;  1KQS S;  4Q5W A;  1W2B S;  1T3L A;  4A4E A;  1WHL A;  2KMT A;  4HVV A;  4DBH A;  2EGE A;  4M75 G;  3IQL A;  1WDX A;  2ZPB B;  3JAM E;  3SEM A;  2LC4 A;  3MEV A;  4Z89 A;  2GTO A;  3NTI A;  1MV3 A;  1R0C B;  3NMZ C;  3MEW A;  1QWE A;  1UEB A;  3TSW A;  2KEA A;  1VQ6 Q;  4KUD K;  3JSC A;  4HCC A;  3JCM g;  1PKS A;  4BB7 A;  1PM3 A;  1G3Y A;  4OMM A;  3E9G A;  4JZ3 A;  2E5Q A;  4M78 E;  5DY9 A;  4M78 A;  2G3R A;  3R6N A;  3CD6 Q;  2K5I A;  2F1L A;  2CS7 A;  4PJM A;  1Y96 B;  3I5R A;  3ZFJ A;  2HKQ B;  1VQN T;  2QXF A;  5IXF A;  1JJ2 P;  2GQV A;  1JO8 A;  4MZP A;  4LE9 A;  3OYF A;  3RBB B;  2EIF A;  3ASK A;  1YIT T;  4ZNX A;  1WX6 A;  4A4H A;  1H92 A;  3EGX A;  1EZZ B;  5FW9 A;  3NPF A;  3QZ9 B;  4ORZ A;  3CC4 T;  1SHF A;  1AVZ C;  3CMA A;  4E2F B;  2NUZ A;  3KXT A;  1X69 A;  1Q7Y U;  2F5K A;  5LJ5 h;  1M30 A;  3AT1 B;  3CCJ Q;  2AIR B;  5A2Q E;  2HSE B;  2YLC A;  4RG8 A;  5EC7 A;  3JCM X;  5AYF A;  1UGV A;  5FWC A;  2RM4 A;  1I07 A;  2A08 A;  2FPE A;  4M7A G;  1SG5 A;  3BFM A;  3S3O A;  3RUX A;  3MPU B;  2KXD A;  2KDS A;  2QA4 Q;  2FG0 A;  2FEI A;  1ABO A;  3SWN B;  3HL8 A;  1I0C A;  2MWO A;  2DLP A;  1PRM C;  2VKN A;  1MGQ A;  2DL3 A;  3VS1 A;  4EIK A;  1R8O B;  1RAE B;  2OJ2 A;  4FCY A;  2MPX C;  4EPC A;  4M75 A;  2BE9 B;  3L2R A;  3M59 A;  4J7F A;  2ZPG B;  2EW3 A;  3WXM B;  1YIJ A;  1C6V X;  2YDL A;  4ZGJ B;  1W4S A;  3M0Q A;  5CKF A;  2F2W A;  4J6X A;  3BDU A;  3URG A;  1S72 A;  2MWP A;  1WYX A;  4J9G A;  3I55 T;  2DET A;  3NGP A;  2OTL Q;  3O5Z A;  3GP8 A;  1QW1 A;  4M4Z A;  4M77 G;  5AT1 B;  3REA B;  1K8A C;  5GAN h;  3H9N A;  2COZ A;  3OYD A;  3CCM T;  4DOV A;  1NJI C;  3M0U A;  1X43 A;  2C0O A;  1U06 A;  2CT3 A;  2KYB A;  4CC7 A;  1GCQ C;  4OMN A;  3A8G B;  3CME A;  4IUT A;  1V76 A;  5KYX A;  2L2P A;  3HTR A;  1N8R C;  4QVD A;  3UA7 A;  2RQT A;  4DBF A;  4OMP A;  4NL3 A;  2O31 A;  2QQA A;  2OTJ A;  1WXU A;  4RTW A;  2L5Q A;  1OZ3 A;  2SEM A;  1YJW Q;  4J9C A;  4C5G A;  3OYA A;  4FT4 A;  4JS5 A;  4E7H A;  3FC3 A;  4MDX A;  3QKJ A;  2DXU A;  1Q82 U;  4R0K A;  1ZX6 A;  3M56 A;  2CH4 W;  3JB9 G;  1ZHI A;  4QQ6 A;  1WQ7 A;  4ELY C;  4PJO F;  2E3H A;  5I11 A;  4HXJ A;  2O2O A;  2KT8 A;  3CC2 Q;  3QZ5 B;  2A0F B;  1WQW A;  4RTU A;  4DEX A;  3JV3 A;  2M1H A;  4DBR A;  1SRM A;  3HRU A;  2PVG B;  3OYL A;  3CCV T;  1HXD A;  2GBQ A;  2LQK A;  1Y96 A;  4N0A A;  5GAN 8;  5D6X A;  2EGA A;  4RTV A;  3KFV A;  3QII A;  5LJ3 h;  4KUI A;  1QVG S;  4C5H A;  2VYT A;  5LJ5 e;  1Q86 C;  2KSS A;  2K4Y A;  2RK2 A;  3CME T;  1K9M U;  4M7D G;  5A0D A;  5FU6 B;  4F04 B;  2ED0 A;  3RES A;  1FYN A;  2XI9 A;  1KQS A;  1IHV A;  1QKW A;  2L89 A;  4J8O A;  1M90 U;  1X6G A;  4JRP A;  3I55 A;  3S3M A;  3V7R A;  5LJ3 f;  1D1B A;  1PSF A;  3CC7 A;  1BI1 A;  1VQO T;  1OOT A;  1VOM A;  2JS0 A;  4LUD A;  1KQS P;  1IHW A;  2QAZ A;  3A8M B;  4C8Q F;  1KQ2 A;  2CP2 A;  2QAS A;  3QPH A;  2EQJ A;  1FWZ A;  3DLM A;  2COW A;  4II1 A;  3JCM Q;  2QI2 A;  2ZCF B;  4N4H A;  4M7D D;  2XIC A;  1YCY A;  3MP6 A;  2DM1 A;  1JBM A;  3OYH A;  1YHQ T;  2Y4Y A;  3M9Q A;  2E4H A;  2CSI A;  4EDU A;  2DA9 A;  3V8J A;  3I35 A;  1MMN A;  5IHK A;  1YI2 T;  1X75 C;  2KK4 A;  1SHG A;  1OU9 A;  3CCR A;  2F2X A;  3TVT A;  1K8A R;  1NBE B;  3M0T A;  1HSQ A;  5KYY B;  1MNE A;  4GLK A;  1T3S A;  2A3L A;  3FLG A;  4AMC A;  5GAM e;  4N4I A;  3EH2 A;  3C95 A;  2J06 A;  1VQ6 A;  1K73 C;  4F7U A;  1UDL A;  5A0G A;  2JM8 A;  1U3O A;  3RKW A;  1X2K A;  4WTO B;  5FLX E;  2C06 A;  5GAO n;  3CCL Q;  2FZC B;  4BE1 A;  4DBQ A;  4BD3 A;  1YIT A;  5GAN f;  1OZ2 A;  1UGS B;  2OX7 A;  4C92 E;  3JCM J;  2QTV A;  1RAB B;  1PCX A;  5KYX B;  2LNH B;  1NYF A;  1Q82 C;  4JUV A;  1YJN Q;  1WIE A;  4OB0 B;  1BCM A;  1YWO A;  4M78 G;  2IPO B;  5CAI A;  2DEQ A;  5GAM j;  3LH5 A;  5GAN g;  1K76 A;  2AK5 A;  2K3B A;  3GOX A;  4F7U G;  1G3T A;  4BI3 A;  2HAX A;  2ZAE A;  2L3R A;  5CQX A;  3BDL A;  4YTL A;  2KY9 A;  4BE0 A;  3H41 A;  2FPD A;  2MI6 A;  4OB2 B;  2FYK A;  2VUB A;  2X4Y A;  2PVO B;  3H8Z A;  1D1C A;  4C92 B;  1PD1 A;  2KAF A;  2PVD B;  3QBY A;  3M4Y A;  5LJ3 e;  1JRI A;  2HL5 C;  2LNV A;  1E6G A;  5LJ5 j;  3OS1 A;  5I2S A;  3UWN A;  1QP3 A;  2QDL A;  1Q81 C;  3MO8 A;  5KE2 A;  2EQK A;  3TCJ A;  2E12 A;  5GAO r;  3G71 T;  3N5B B;  1ZUY A;  2A28 A;  4ELZ C;  4XU1 A;  3PVL A;  1D0X A;  4J9H A;  1M1K C;  4HA8 A;  3REB B;  3NTH A;  4PJO A;  2OTL T;  1QVP A;  2K2V A;  2YUN A;  5GAO l;  4PJL A;  2JN0 A;  4M7A F;  4QQD A;  2QDY B;  1Q7Y R;  4XU2 A;  1XQH A;  2PUK B;  4XTZ A;  2R5A A;  2RJD A;  2RQW A;  4A53 A;  1B34 B;  1VQ5 Q;  4M7A A;  3QDR B;  3JCM d;  1HJD A;  3LX7 A;  4E7S A;  3LGF A;  4RMO A;  2QQR A;  1R0B G;  5IT9 E;  4J83 A;  2KVQ G;  1AWX A;  3QYH B;  2DL4 A;  4E7K A;  3JCM V;  3OA6 A;  3G71 Q;  4BE2 A;  1KHI A;  1IRE B;  3VS0 A;  2BE7 D;  1WHJ A;  3JCM c;  2RK1 A;  2JJ9 A;  3SB2 A;  1NLP C;  2LMJ A;  2DL8 A;  2VB6 A;  4M77 B;  2QEX A;  3LGL A;  3I56 Q;  3HRT A;  4C5I A;  4N0A C;  1KIK A;  4PJN A;  4M7A D;  2FRW A;  4KGV B;  2EYX A;  3EGD B;  4M78 F;  1ZUK A;  4DEY A;  2JNG A;  4C92 F;  3HRS A;  2QG9 B;  2A36 A;  2GF7 A;  5KE3 A;  3RDV A;  1H3H A;  2GCX A;  1JU5 C;  4PKC C;  1OX9 A;  4KH1 B;  4E7I A;  4C8Q C;  2VGN A;  1M1F A;  2BUD A;  1N8R U;  2CZ6 B;  2GFA A;  1H64 1;  4FSX A;  3V7C A;  4Y28 E;  3GLX A;  4IUP A;  3SWN A;  5LL6 S;  3M0R A;  4KH0 B;  2X4W A;  2IVW A;  4IIM A;  4C5E A;  3G71 A;  5DLO A;  2DVE A;  3PIO A;  2D1X A;  1AWW A;  2J6O A;  1TTH B;  2YUP A;  2YRC A;  3QDF A;  2XMF A;  1KD1 C;  2HKN A;  2LTO A;  5FU7 B;  2FO0 A;  1WXT A;  3OYN A;  5FU6 C;  2DXT A;  1N8R R;  2EKH A;  1YJ9 A;  1WGS A;  4JPB W;  3QG1 A;  2DJQ A;  3JCM e;  4XAX B;  1EIF A;  2OTL A;  1UEC A;  2YT6 A;  2DF6 A;  1UJY A;  4MZT A;  4VUB A;  3JRZ A;  1K9A A;  1UJ0 A;  2E41 A;  1F1B B;  4LD9 K;  1MMA A;  2HZY A;  2KT1 A;  2K57 A;  5GAM f;  2AT1 B;  1AWJ A;  2R5M A;  2F5T X;  1G3W A;  1VQ7 Q;  1M4Z A;  3EFO B;  1Q81 R;  4E6R A;  1WJR A;  2LCL A;  5I22 A;  1VYT A;  2RJE A;  4J9F A;  4F7U E;  3CCU Q;  1YIJ Q;  3LH0 A;  1WHK A;  3KUF A;  4E47 A;  2P0P A;  5HK0 A;  2DRM A;  1PHT A;  1QVG P;  3QUI A;  1LJO A;  1EFN A;  4O5V A;  4OMO A;  3FJ5 A;  3JB9 D;  2HSP A;  3OYE A;  5HY6 A;  3EG9 A;  3HFN A;  4QVC A;  2XD0 A;  1W6X A;  3HHT B;  1RI9 A;  3VKI A;  1MND A;  2VGM A;  4XTX A;  4EMH A;  2L3P A;  3CCR Q;  5J26 A;  3UF4 A;  4JLI A;  1ABQ A;  5LJ3 d;  1XTD A;  2XU8 A;  2RJF A;  2CKK A;  4QW2 A;  1V1C A;  2CDT A;  2X4X A;  2ZPF B;  1J3T A;  2ZPH B;  4HCB A;  2RB6 A;  2XG8 D;  4LDY A;  3G4S A;  4FYY B;  1VQ6 T;  2FZG B;  2CZ7 B;  5CKB A;  5KYY A;  2VAS A;  3G7Z A;  4CC2 A;  1LVK A;  2DXB A;  1VQ9 A;  3DB4 A;  1RAC B;  1TU0 B;  3CBP A;  3RR6 A;  1B7T A;  3GNG A;  1JXM A;  5HKC A;  2M16 A;  2AKL A;  2CP5 A;  3SHW A;  3OBW A;  4LXC A;  1BU1 A;  2K6D A;  4OP0 A;  1JB0 E;  3PE0 A;  2A7Y A;  1YI2 A;  1MMD A;  1VQO A;  2O9S A;  3CC7 T;  4OVA A;  3X25 B;  1NLO C;  3CXC S;  3QWY A;  4M75 C;  3M0S A;  1I8F A;  4EMK A;  2D6F A;  1UTI A;  3JCM W;  2DX1 A;  5ECA A;  3EHQ A;  3L2W A;  4C8Q B;  5EG2 A;  1AT1 B;  3VS7 A;  2NUP B;  4HT8 A;  1KD1 U;  1WHG A;  5FWB A;  3C12 A;  3OYJ A;  2AKK A;  2MCN A;  3QXE B;  2QQ9 A;  2PZ1 A;  1QKX A;  3UA6 A;  1NJI R;  2K3X A;  2P0K A;  3M58 A;  4E7Z A;  1BI0 A;  4C8Q G;  1KHC A;  1N9R A;  4BI4 A;  1UG1 A;  3CC7 Q;  2DVJ A;  1UE9 A;  2O4X A;  1M1K U;  4PFZ A;  3OS2 A;  1FX7 A;  4AG1 C;  2EVR A;  4FU6 A;  4ESR A;  2RHI A;  1I81 A;  3GNF B;  4PJO E;  1OPL A;  4MML A;  3AHU A;  4JLG A;  4LNP A;  5GAN 4;  2YHT A;  1M90 C;  1BK2 A;  3CCL A;  3D7S B;  2RQV A;  4DQ2 A;  2NUT B;  3A5Z B;  2JUF A;  1HK9 A;  2K9G A;  5DLQ E;  3CCV A;  1UGQ B;  5HCK A;  1GFC A;  5FRM A;  5LJ5 d;  3A98 A;  1G5V A;  2RD1 A;  2K79 A;  2OTJ T;  2E6Z A;  2EYZ A;  2MIO A;  4M7A C;  2NLU A;  3L2V A;  4PJJ A;  2FPF A;  4Z88 A;  2E6N A;  3CPW S;  3H0H A;  2AHJ B;  3VS2 A;  2DL7 A;  2GGR A;  2WSF E;  5KYU B;  4PJO G;  1MUZ A;  1HYO A;  4RTY A;  2EKO A;  3EG9 B;  2B8A A;  1OI1 A;  2QGF B;  4J6W A;  2M0Y A;  2XID A;  4DA4 A;  4M77 E;  3PMT A;  4B9W A;  4C8Q E;  3MP1 A;  2CZ0 B;  3QHS A;  2MAM A;  2OAU A;  3L42 A;  2EJF A;  4LD6 A;  2FB7 A;  4C92 A;  1B3Q A;  1D09 B;  4A63 B;  3EGD A;  4LUE A;  2CP7 A;  2FVU A;  1YIJ T;  3CCE Q;  5LJ3 g;  2M9U A;  3RMQ A;  4CC3 A;  2RQR A;  3J7A F;  1OV3 A;  5FU7 C;  2X51 A;  3M53 A;  1OU8 A;  2BTT A;  4ZN1 A;  4XK8 E;  5GMK i;  1WJQ A;  3SD4 A;  5GMK e;  3VU3 C;  2L3S A;  2LZ6 B;  1D3B B;  4PFP A;  3CPW P;  1WZO A;  4D6W A;  3PIP A;  4L6V 5;  1HD3 A;  1UGP B;  2EQU A;  5KYW B;  3HFO A;  1QP2 A;  1VQ9 T;  1Y71 A;  1NG2 A;  3JCM f;  1NYG A;  4OMQ A;  1XOV A;  1RI0 A;  1B34 A;  2AZS A;  2HQH A;  2LCS A;  1NE8 A;  2HQX A;  2LCC A;  5LJ5 g;  2BIV A;  2WAC A;  4KRT A;  8ATC B;  1TUG B;  2Y4X A;  3UPU A;  3OYB A;  2CUB A;  1QVF A;  3SFM A;  3EG3 A;  2L8D A;  4WCI A;  2E70 A;  2JM9 A;  1O75 A;  1BI2 A;  4FYW B;  4XTU A;  2DTH A;  1ZSZ A;  3MEU A;  2ZPE B;  2RN8 A;  1KC8 C;  2G6F X;  2QQS A;  5GAN 2;  4M77 A;  1YFN A;  3VS6 A;  2VC8 A;  2RQU A;  2CH4 A;  3EFR A;  4C0G A;  1WJS A;  2HBP A;  2MOX A;  4X34 A;  5C0M A;  3CC4 A;  9ATC B;  4OMF B;  2RI5 A;  1K73 U;  2D0Q B;  2FRY A;  1QVF S;  3JB9 J;  2E5K A;  4JJD A;  3PMI A;  3TSZ A;  2CP6 A;  2P4R A;  1KFZ A;  3O8V A;  2JMC A;  3X20 B;  4JJB A;  2LDM A;  2J05 A;  3L2Q A;  2HNI A;  1KC8 U;  1RAH B;  4L59 A;  1BIB A;  2GQI A;  5M9O A;  2C0T A;  3EG1 A;  2FL7 A;  4BDZ A;  5GAM h;  4M7A B;  4LDW A;  1QVG A;  4F14 A;  4M7D C;  1ZSZ C;  2F69 A;  3M0P A;  2PUO B;  1XJW B;  3GF5 A;  2VVK A;  1IXD A;  1GCQ A;  1VIF A;  2K5F A;  3CD6 A;  2HCK A;  3MKD A;  3VRZ A;  3ZL7 C;  3OYM A;  3PNW C;  4IUU A;  2HL3 A;  4A4F A;  2NYS A;  1I5L A;  2ZGW A;  2P4T A;  5GAN 3;  2M02 A;  2W10 A;  2KRS A;  4Y91 A;  3P8B B;  1U8R A;  1WA7 A;  2D0N A;  1MHN A;  1I1J A;  3EFO A;  4J9B A;  1GBR A;  1RAG B;  2JTF A;  2V8I A;  4AG2 C;  5LJ3 j;  3PTA A;  2CYZ B;  1R77 A;  3A8L B;  3VYG A;  1UUE A;  3A1P A;  4FW1 A;  1IB8 A;  2V8J A;  1VQM A;  1KJW A;  3THK A;  2EFI A;  1RAI B;  2PTK A;  4IKF A;  1NEG A;  2DTI A;  2K5L A;  2O88 A;  3A8H B;  2DER A;  4RTX A;  4ANJ A;  1Q7Y C;  3GBQ A;  3JCM h;  1VQ8 Q;  4F17 A;  2X9H A;  2XK0 A;  2D8J A;  1WXB A;  5I21 A;  3VJP A;  2EYY A;  4FL6 A;  2OI3 A;  2EPD A;  2DMO A;  1FMV A;  4M77 C;  2E64 A;  5GMK m;  5I2M A;  1M3A A;  3JCM P;  1VQ5 T;  2CUD A;  4C92 D;  3E2U A;  4C0F A;  3A8O B;  3CCE T;  3G6E Q;  1JEG A;  2DXC A;  1DJ7 B;  2OTJ Q;  4JRI A;  4M78 C;  3EG0 A;  3M57 A;  4TVR A;  5CKD A;  1LNX A;  3NHN A;  1VIE A;  4RUG A;  2CP3 A;  2YXY A;  3I5S A;  1N5Z A;  5KH6 A;  3VS4 A;  2MK5 A;  2V1Q A;  2YSQ A;  3HKS A;  3WVE B;  1LCK A;  3MJX A;  1VQP Q;  3CXC A;  5GAM d;  4XTW A;  4DOW A;  5IAY A;  1YJ9 Q;  1JQQ A;  5GJV B;  2J6F A;  2DZ9 A;  2RI3 A;  2ATC B;  3CC2 A;  2M51 A;  4AFQ C;  4HVW A;  5GAN d;  2KRN A;  5GAM g;  5GAN j;  4KGX B;  3GIB A;  3JCM b;  4ZTF A;  1M90 R;  5GAN 7;  3FDR A;  3OBY A;  3OYG A;  2BZY A;  1K8A U;  4XU0 A;  3X24 B;  4LDV A;  1N9S A;  4LN2 A;  3CME Q;  1N27 A;  4EMK B;  3OQ5 A;  2ED1 A;  4JS4 A;  3EGU A;  4ZGD B;  2K2M A;  2J6K A;  1YBY A;  3CPW A;  3H6Z A;  2R57 A;  3S3N A;  2NUP A;  3L2U A;  4C92 C;  2R58 A;  2O9V A;  1RUW A;  1TS9 A;  1TWB A;  1E7O A;  4OB1 B;  1KSW A;  1TG0 A;  1QCN A;  4E7L A;  1FMW A;  1YJN T;  1Q82 R;  4HVU A;  1VQO Q;  4HT9 A;  1YCS B;  1WFW A;  2FHD A;  5GMK j;  1K1Z A;  4XU3 A;  1YJN A;  4WF2 A;  3NFC A;  5LJ5 f;  5GAN 6;  2LJ1 A;  1ZQ1 A;  4UC4 A;  4M7D B;  4CRI A;  4IUR A;  1Q86 U;  5KYU A;  2M0O A;  1XNI A;  2KE9 A;  5GMK l;  4FSS A;  4XTV A;  3J80 E;  1Y57 A;  5CVI A;  2LP5 A;  2DO3 A;  2RMO A;  2A37 A;  3JB9 I;  2DEU A;  2QA4 A;  2K3Y A;  2YWW A;  2DAQ A;  4NL2 A;  1BCO A;  3RKY A;  2VWF A;  5IN1 A;  3C4S A;  2MYS A;  3L1A A;  2E3I A;  3CCJ T;  2E65 A;  1OX8 A;  3V8K A;  2PU9 B;  1T0H A;  3CC2 T;  2D8H A;  1M8M A;  4JJN K;  1M1K R;  1BI3 A;  2YRD A;  2EJG A;  3ME9 A;  1Y7X A;  3C0C A;  3TRE A;  1BIA A;  1LOJ A;  3CCR T;  5J39 A;  1VQK A;  5J3B A;  5L8R E;  1IRX A;  2I0N A;  5CK9 A;  2VV5 A;  1KQ1 A;  1YJW T;  3ER0 A;  4BY6 B;  1TUD A;  1Q86 R;  1YHQ A;  1SKU B;  1Z9Z A;  5KYW A;  5GAN 5;  1AZE A;  2DL5 A;  5FRO A;  3VUB A;  2HD0 A;  2JS2 A;  1K0S A;  2K7A A;  2RPN A;  2YUO A;  1VQ8 T;  2JMA A;  1NPR A;  3LYI A;  1ZSZ B;  1PRL C;  2NUT A;  3OW2 P; 
#chains in the Genus database with same CATH homology
 1NM7 A;  4RTY A;  2J06 A;  1AWO A;  2HDA A;  1BB9 A;  1UDL A;  4Z8A A;  2JM8 A;  1U3O A;  2KRM A;  1WI7 A;  2L3Q A;  2M0Y A;  4J9E A;  1X2K A;  1YNZ A;  2JT4 A;  2DE0 X;  1RLQ C;  1AEY A;  2L0A A;  4F16 A;  4JJC A;  1B3Q A;  4A63 B;  1GCP A;  4LUE A;  2AZV A;  1VA7 A;  4K11 A;  2LNH B;  1NYF A;  1JXO A;  1GRI A;  1SSH A;  4CC3 A;  2RQR A;  1WIE A;  1YWO A;  1OV3 A;  3VS5 A;  2JW4 A;  3LH5 A;  2ROL A;  2BTT A;  1K76 A;  2AK5 A;  2K3B A;  2DYB A;  1U5S A;  1QWF A;  3QWX X;  4AFS C;  2L3S A;  2LZ6 B;  1AD5 A;  1AOJ A;  3H41 A;  1HD3 A;  2FPD A;  4Y92 A;  2YUQ A;  1CSK A;  4GLM A;  1NG2 A;  4HCK A;  2EGC A;  1NYG A;  3EG2 A;  4J9D A;  4OMQ A;  2HEQ A;  2DRK A;  1XOV A;  1SRL A;  1ZBJ A;  2AZS A;  2DBM A;  2LCS A;  1E6G A;  4QT7 A;  4KRT A;  2KBT A;  2KR3 A;  1AZG B;  2CUB A;  2QDL A;  3EG3 A;  4WCI A;  2ECZ A;  4JZ4 A;  2JM9 A;  1GL5 A;  4X1V A;  2CT4 A;  1ZUY A;  1PNJ A;  2A28 A;  2CSQ A;  2DIL A;  3PVL A;  2RN8 A;  4J9H A;  3REB B;  2G6F X;  1ZUU A;  2YUN A;  3VS6 A;  2RQU A;  2CH4 A;  2EBP A;  1YWP A;  2DBK A;  2OAW A;  2MOX A;  2H8H A;  4GBQ A;  5GJW B;  2J7I A;  2RQW A;  2PNI A;  4AFZ C;  1HJD A;  5L23 A;  2NWM A;  2BZX A;  3H0I A;  1AWX A;  2FRY A;  1T3L A;  2DL4 A;  2E5K A;  2IIM A;  4JJD A;  4HVV A;  3VS0 A;  2EGE A;  3IQL A;  1WDX A;  2KXC A;  3TSZ A;  2P4R A;  3SEM A;  1NLP C;  1ZLM A;  2LMJ A;  1KFZ A;  2JMC A;  1PWT A;  2DL8 A;  4Z89 A;  2B86 A;  2GTO A;  4JJB A;  2J05 A;  1MV3 A;  1OPK A;  3NMZ C;  3EHR A;  1X27 A;  2RF0 A;  1QWE A;  1KIK A;  1UHF A;  3TSW A;  2KEA A;  4IIO A;  1E6H A;  1X2Q A;  1PKS A;  2GQI A;  1Z9Q A;  2FRW A;  2C0T A;  3EG1 A;  2EYX A;  2JXB A;  3ULR B;  1ZUK A;  4DEY A;  4OMM A;  1CKA A;  2A36 A;  4JZ3 A;  4F14 A;  5IXB A;  1H3H A;  3M0P A;  1MV0 B;  3R6N A;  2KNB B;  1JU5 C;  2VVK A;  1GCQ A;  3I5R A;  2HCK A;  3VRZ A;  3ZL7 C;  5IXF A;  2LJ0 A;  2W0Z A;  3M0R A;  1JO8 A;  2W10 A;  2KRS A;  4LE9 A;  3RBB B;  1WA7 A;  4IIM A;  4ZNX A;  1WX6 A;  1H92 A;  2D0N A;  2C0I A;  3NPF A;  5FW9 A;  4ORZ A;  2D1X A;  1SHF A;  1I1J A;  2J6O A;  1AVZ C;  2YUP A;  1AWW A;  1G2B A;  5IH2 A;  1W1F A;  2XMF A;  4J9B A;  1GBR A;  2NUZ A;  3RNJ A;  4AG2 C;  1X69 A;  2LX7 A;  2FO0 A;  1WXT A;  1M30 A;  1UUE A;  2EKH A;  2LQW A;  2LQN A;  3U23 A;  1WLP B;  4JPB W;  2DJQ A;  5EC7 A;  1KJW A;  1UEC A;  3THK A;  2YT6 A;  2PTK A;  2DF6 A;  1UJY A;  1UGV A;  5FWC A;  1I07 A;  1OEB A;  2A08 A;  1K9A A;  1NEG A;  2EYW A;  2FPE A;  2O88 A;  1UJ0 A;  1YN8 A;  2KXD A;  4RTX A;  2FG0 A;  2FEI A;  1ABO A;  3GBQ A;  2X3W D;  1I0C A;  1IO6 A;  2KT1 A;  4F17 A;  2DLP A;  1PRM C;  2ROT A;  2VKN A;  2D8J A;  1AWJ A;  2DL3 A;  3VS1 A;  1WXB A;  4EIK A;  2OJ2 A;  2EYY A;  2OI3 A;  2EPD A;  2DMO A;  2KYM A;  4E6R A;  1M3A A;  2CUD A;  5I22 A;  1RLP C;  1VYT A;  4J9F A;  1JEG A;  3EG0 A;  1W70 A;  3NHN A;  2DRM A;  1PHT A;  2EW3 A;  4RUG A;  2RNA A;  1G83 A;  3I5S A;  1Y0M A;  1N5Z A;  2YDL A;  3VS3 A;  1GFD A;  3VS4 A;  3M0Q A;  4CC4 B;  2F2W A;  1EFN A;  2V1Q A;  4OMO A;  3FJ5 A;  2YSQ A;  2HSP A;  1LCK A;  2JTE A;  2BZ8 A;  1GBQ A;  1JQQ A;  2CRE A;  5GJV B;  1WYX A;  4J9G A;  2J6F A;  2SRC A;  3NGP A;  3O5Z A;  4M4Z A;  2M51 A;  3REA B;  1W6X A;  1RI9 A;  4AFQ C;  4HVW A;  4RTT A;  2KRN A;  3M0U A;  1X43 A;  2C0O A;  1U06 A;  2CT3 A;  2KYB A;  2L3P A;  4CC7 A;  1T0J A;  3UF4 A;  1QLY A;  1GCQ C;  4OMN A;  2L2P A;  1ABQ A;  2BZY A;  4LN2 A;  3UA7 A;  2RQT A;  4OMP A;  2V1R A;  1V1C A;  2CDT A;  1J3T A;  2O31 A;  2ED1 A;  3EGU A;  2K2M A;  1WXU A;  4RTW A;  2J6K A;  1H8K A;  1VYU A;  2SEM A;  2ABL A;  1X6B A;  1BBZ A;  4J9C A;  4CC2 A;  2O9V A;  4AFU C;  1RUW A;  1E7O A;  4D8K A;  1KSW A;  1TG0 A;  3H0F A;  4R0K A;  2HBW A;  4HVU A;  1CKB A;  1JXM A;  1ZX6 A;  2AKL A;  2CH4 W;  3SHW A;  1YCS B;  4D8D A;  1BU1 A;  1WFW A;  2K6D A;  5I11 A;  4HXJ A;  2O2O A;  3PE0 A;  2KT8 A;  1K1Z A;  1UFF A;  2O9S A;  4RTU A;  4DEX A;  3JV3 A;  1NLO C;  2LJ1 A;  3QWY A;  1TUC A;  3M0S A;  1S1N A;  1SRM A;  1UTI A;  4RTZ A;  2DX1 A;  5ECA A;  3EHQ A;  2KE9 A;  2GBQ A;  3VS7 A;  4FSS A;  2KRO A;  1M3C A;  2EGA A;  4RTV A;  3KFV A;  1FMK A;  1Y57 A;  2X3X D;  2LP5 A;  5FWB A;  2AKK A;  2A37 A;  2RMO A;  2MCN A;  2ENM A;  1YP5 A;  2KGT A;  2PZ1 A;  1K0X A;  1QKX A;  3UA6 A;  3PVQ A;  1NEB A;  1SEM A;  2VWF A;  2ED0 A;  1FYN A;  1B07 A;  2LJ3 A;  3CQT A;  1ZSG A;  4OML A;  1T0H A;  1UG1 A;  1QKW A;  2ESW A;  1QCF A;  2GTJ A;  2EQI A;  1X6G A;  2DVJ A;  3VRY A;  2D8H A;  1M8M A;  1UE9 A;  4AG1 C;  5IHI A;  2EVR A;  1A0N B;  1OOT A;  1M3B A;  1SPK A;  4ESR A;  2JS0 A;  3C0C A;  4LUD A;  1OPL A;  3I9Q A;  4LNP A;  4J9I A;  1VYV A;  2I0N A;  1BK2 A;  2RQV A;  2K9G A;  1PKT A;  1TUD A;  5IHN A;  1Z9Z A;  5HCK A;  1GFC A;  2DM1 A;  1M27 C;  3A98 A;  2F2V A;  2CSI A;  1K4U S;  1AZE A;  2K79 A;  2DA9 A;  3I35 A;  2EYZ A;  2MIO A;  2DL5 A;  5IHK A;  1SHG A;  1UHC A;  2FPF A;  1ARK A;  4Z88 A;  3UAT A;  2F2X A;  3TVT A;  2JS2 A;  3H0H A;  1K0S A;  2K7A A;  2RPN A;  3M0T A;  1HSQ A;  3VS2 A;  2DL7 A;  2YUO A;  2GGR A;  2JMA A;  1T3S A;  2GNC A;  1PRL C;  1MUZ A;  2DNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...