2JXBA

Structure of cd3epsilon-nck2 first sh3 domain complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
86
structure length
86
Chain Sequence
b'HMKERPPPVPNPDYNSLKKGSLVKNLHMTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD3 epsilon chain, Cytoplasmic p
molecule tags Signaling protein complex
source organism Homo sapiens
publication title Structural and functional evidence that Nck interaction with CD3epsilon regulates T-cell receptor activity.
pubmed doi rcsb
total genus 8
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jxbA00
1T3SA 1UFFA 2DRMA 2ECZA 2RQUA 1T3LA 1WXBA 2LJ1A 2DE0X 2EW3A 2L0AA 1IO6A 3VRYA 1PHTA 4Y92A 2GTOA 2KYMA 3RBBB 3H0HA 1WFWA 1NYGA 2JS0A 2KR3A 2GNCA 1RLPC 1H8KA 4A63B 4GBQA 2FG0A 2LZ6B 1K9AA 3SHWA 1U06A 2P4RA 5IXBA 1ABQA 2DNUA 1UECA 1H92A 2DL5A 2DLPA 4D8KA 1QWEA 2KRMA 1NYFA 3LH5A 1JQQA 4E6RA 2C0IA 2DILA 1SRMA 2J6FA 1S1NA 1E6GA 1U5SA 1K76A 4GLMA 2RF0A 3EHRA 1NEGA 2O9VA 1I0CA 1VYVA 1X69A 4HVVA 4J9IA 1MV0B 1BK2A 2CT4A 1ZX6A 3M0UA 3EGUA 2DA9A 1KJWA 2EBPA 2HSPA 2O31A 5IHIA 1BBZA 2D1XA 3M0SA 1AWJA 1U3OA 2YUQA 4RTZA 5IH2A 1YN8A 1HJDA 4OMNA 4JJDA 1UHFA 4LUEA 4JZ4A 1WXTA 4AFZC 4AFSC 1JU5C 1FYNA 2DYBA 3PVQA 2BZ8A 1WIEA 2AKLA 1AZGB 2ABLA 4ORZA 3PVLA 2ESWA 3M0TA 2RPNA 2B86A 2JM8A 2GGRA 1WA7A 3NPFA 2ENMA 4Z88A 1GCQC 1NLPC 3FJ5A 2LQWA 2A28A 2FEIA 4OMLA 3UF4A 1KSWA 5IHNA 3M0PA 1X43A 2DBMA 1SSHA 4LUDA 2KXCA 4CC2A 1PNJA 1E6HA 3TSZA 1OPLA 2DL3A 4LNPA 2D8JA 3GBQA 1AWOA 2K2MA 3PE0A 2AZSA 2LX7A 2V1QA 4ESRA 2SEMA 2RQVA 1UTIA 4HVWA 4OMQA 3JV3A 1OEBA 5ECAA 1Y57A 2KBTA 2EYXA 2J6OA 1N5ZA 2AKKA 4WCIA 1UUEA 2JT4A 2KROA 2FO0A 1RLQC 1CSKA 3A98A 3EG3A 5GJVB 2YSQA 2BZYA 3VS6A 2ED1A 2GTJA 4D8DA 2F2VA 2O9SA 1X6BA 1YWPA 3CQTA 1WDXA 3REBB 2LMJA 2KE9A 1UDLA 2L3SA 1JXMA 4RTTA 2PZ1A 1NG2A 2MIOA 1UG1A 3VS4A 1WI7A 1Z9ZA 3H0FA 4AFUC 1HSQA 1QCFA 3VS7A 1SHFA 2W10A 2KRNA 1VYTA 1TUDA 4HXJA 5FWCA 5HCKA 4IIMA 2RQTA 1AVZC 2X3XD 2CREA 3H41A 4RTXA 2LP5A 2DX1A 1AWWA 4EIKA 2EYYA 1AOJA 1MUZA 2YUPA 1ZSGA 4RTYA 2FPFA 3SEMA 1MV3A 4F17A 2DRKA 2D8HA 3I5SA 1AD5A 1RI9A 1M3CA 1A0NB 1UHCA 3VS2A 4J9GA 2J05A 2EYZA 2F2XA 5FW9A 1SHGA 4OMMA 3TSWA 2AZVA 5IXFA 3VS1A 5FWBA 2KEAA 4AG2C 4JZ3A 2PNIA 2KT8A 2K6DA 2YDLA 1K4US 2CSIA 1X2QA 2C0TA 2DF6A 1GFCA 4HVUA 2O2OA 2HCKA 1NEBA 1SRLA 1WYXA 2NWMA 3O5ZA 1PRLC 4RUGA 4RTUA 2BZXA 3EG1A 3M0QA 2LNHB 2C0OA 4CC3A 2A36A 1UGVA 1CKAA 1SPKA 1YCSB 2LQNA 1YNZA 1GBRA 4JPBW 2J7IA 1UJYA 1G83A 4F14A 1W6XA 1QKXA 4LN2A 2CT3A 1WLPB 1ABOA 1X2KA 3VS5A 5IHKA 2V1RA 4IIOA 2CSQA 2RN8A 3NHNA 1M27C 3H0IA 1AZEA 1K0SA 1SEMA 2EGEA 1OOTA 2D0NA 3QWXX 2LCSA 1GRIA 2VKNA 1RUWA 2EVRA 2DMOA 4DEXA 4KRTA 3NGPA 2EGAA 4OMOA 3VS0A 2ROLA 3U23A 2EYWA 1WXUA 2DJQA 2JS2A 1ZUKA 2ED0A 1B3QA 1W70A 2HBWA 3C0CA 5L23A 2LJ0A 2CH4A 3VS3A 5I22A 2GBQA 2G6FX 4HCKA 2KGTA 2J06A 2DL8A 2I0NA 2L3QA 4J9FA 3UA6A 2EPDA 1NLOC 1T0JA 2M0YA 2OAWA 4RTVA 3ULRB 1LCKA 1PRMC 1QLYA 2SRCA 2X3WD 4J9HA 2FRYA 2YUOA 1T0HA 3ZL7C 3THKA 2A37A 4DEYA 2K9GA 3VRZA 1ZBJA 1UJ0A 2F2WA 1M3BA 3UATA 1GL5A 1UE9A 3EHQA 2EKHA 4CC7A 2DL4A 5EC7A 4Z89A 4LE9A 3TVTA 1GFDA 1K0XA 2JM9A 1H3HA 3IQLA 2L2PA 1JO8A 1FMKA 2FPDA 1B07A 1KIKA 2FPEA 1GCPA 1VYUA 2DM1A 1I07A 2MCNA 2RMOA 1ARKA 1AEYA 3KFVA 3EG0A 2YT6A 2J6KA 1PWTA 1I1JA 1X27A 1M3AA 2CUDA 1WX6A 2CH4W 5I11A 4AG1C 1Z9QA 1VA7A 4QT7A 2FRWA 2W0ZA 2JMAA 2CDTA 1EFNA 2VVKA 2PTKA 1J3TA 4JJBA 1G2BA 1Y0MA 2IIMA 1PKSA 2OI3A 2NUZA 1ZUYA 2RNAA 2KNBB 1PKTA 1W1FA 2HEQA 4RTWA 3EG2A 1M8MA 1AWXA 1GCQA 2KT1A 1M30A 4J9DA 5GJWB 3I35A 1BB9A 1K1ZA 2QDLA 4J9CA 2DBKA 2XMFA 4R0KA 2CUBA 3UA7A 1KFZA 2LJ3A 2O88A 3I9QA 1CKBA 2K79A 3NMZC 2JTEA 4Z8AA 2ROTA 4AFQC 1YWOA 2E5KA 2KYBA 2JW4A 2H8HA 2DL7A 4K11A 4FSSA 4M4ZA 4ZNXA 2EQIA 4J9EA 1ZLMA 2DVJA 1X6GA 2OJ2A 2RQRA 2AK5A 2HDAA 1TUCA 2RQWA 2YUNA 2L3PA 1GBQA 2A08A 2GQIA 2VWFA 4F16A 1NM7A 2M51A 1OPKA 1E7OA 3I5RA 3R6NA 1ZUUA 1JXOA 2K7AA 4J9BA 1QKWA 3QWYA 4OMPA 1HD3A 2JMCA 2JXBA 1BU1A 1OV3A 1QWFA 1TG0A 3M0RA 2BTTA 2K3BA 1XOVA 3REAB 2MOXA 1YP5A 3RNJA 1JEGA 1V1CA 4CC4B 4JJCA 2EGCA 2KRSA 4X1VA 2KXDA
chains in the Genus database with same CATH superfamily
2DRMA 2ECZA 3CCVA 1G8XA 5KCHA 1WXBA 4XQ3A 4EMHA 1PHTA 3CC2T 2ZGWA 2DIQA 2GTOA 3C12A 4BI3A 4C92A 2CGHA 4C5HA 3SWNB 3BDLA 3LH0A 2YRCA 3H0HA 1BI0A 1NYGA 2JS0A 2DEUA 1OX9A 2WACA 1WJQA 4O6JA 1RLPC 5CKDA 1H8KA 4A63B 1YJ9T 1K9AA 5IXBA 2QAZA 3CCUT 2DNUA 2DL5A 1VQNA 1JQQA 1HYOA 2C0IA 1RABB 3BFMA 3RKWA 4LDXA 1E6GA 4BUGA 3PMIA 4BI4A 1BKBA 1O75A 1QVFP 4ZN1A 1NEGA 3M55A 3EH1A 3NTHA 1X69A 4XTWA 4ELYC 3OYDA 4C8QE 2CT4A 2DA9A 3M54A 1YITT 2HQEA 2HSPA 4KBMB 1W2BS 2M16A 4J83A 1BBZA 2D1XA 1BI3A 3CCSQ 1HJDA 3JCMb 4MZPA 2P0PA 1KG1A 1WXTA 4AFSC 1JU5C 3FEOA 2JZ2A 1UEBA 4A54A 3P8DA 4DBHA 1K9MC 4ORZA 4LDYA 1UGRB 5CKHA 2XI9A 2MYSA 5D6WA 2P0QA 2GGRA 1WA7A 5FROA 2QA4A 1O9SA 4C92G 1Q82C 4Z88A 1YITQ 2A0FB 4PJOC 2A28A 4OMLA 2OTLA 2VYTA 3VU3C 2OX7A 1AT1B 1M2VB 4FCYA 3CMAQ 4B9XA 3CD6T 1SSHA 2H3EB 5KYYB 2B8AA 3JRZA 4LNPA 4QQ6A 4M77D 4C0DC 3PE0A 4ESRA 2V1QA 4HVWA 5A0LA 2KVQG 3OYGA 2O4XB 2KBTA 3OY9A 4C5IA 2P84A 4BDZA 4M78G 1QW1A 2JT4A 2FO0A 2YRDA 1LOJA 5IN1A 3QO3A 1CSKA 1W4SA 3A98A 3CC4Q 2QQSA 3CCLQ 1N8RC 3CMAT 2F2VA 1X6BA 3CQTA 5J3BA 1WDXA 5CAIA 3JCMW 1YJWT 4AT1B 3RDVA 4EMGA 3C4SA 2RI2A 2QG9B 3EFOB 1SHFA 2L89A 1VQ8T 1VYTA 1TUDA 4HXJA 2ZPEB 3H41A 2VUBA 5KYYA 3G6ET 4RTXA 4Z02A 5A0DA 3NFCA 1VQOQ 2NUPB 2DKGA 2EYYA 1AOJA 4BE1A 3A5ZB 5CQYA 4XU0A 2F1LA 1M2OA 3EFOA 1RI9A 2QDYB 5CKBA 1A0NB 3MCAB 5LJ3j 3VS2A 2AIRB 1RI0A 2EYZA 1SHGA 3TSWA 2C06A 3VS1A 4M7AD 5FWBA 2KEAA 3ZEHA 4F7UG 5GAMe 5FLXE 2JUFA 3EGXB 3QDFA 4PFPA 1AHJB 2K4YA 4NOYA 2RA2A 3OQ5A 1EIFA 2O2OA 4YTLA 2HMAA 1NEBA 1WYXA 3L2VA 2NWMA 2HL3A 1VQ4A 2DETA 3LLRA 4A4FA 2BZXA 3EG1A 4ZTJA 3CC7A 5LJ5j 4OB3B 3V8KA 1UJYA 4F14A 1W6XA 1QKXA 3JCMe 2FYKA 1X2KA 1QCOA 3VS5A 5IHKA 3CCRA 2V1RA 3JB9H 3NHNA 3EGDB 5GANe 4PFOA 3M56A 3H0IA 1K0SA 3L2UA 4M77G 5GMKl 1K9MR 3QWXX 4DBQA 3MO8A 1RUWA 2EVRA 2O4XA 3URGA 3OW2P 2DMOA 3NGPA 2JVVA 3KUFA 2LQKA 5FU6B 4MMKA 2EYWA 2JS2A 4QVCA 2ED0A 4P5NA 4L59A 2QI2A 1IXDA 5J26A 3X25B 3X28B 2YLCA 5AYFA 3VS3A 1KD1R 2GBQA 2G6FX 1M9SA 2K3XA 4PJOB 4J8OA 1WQWA 2KGTA 3META 1MNDA 2OTLQ 1YJNQ 2EPDA 5LJ3d 1NLOC 1IRXA 2M0YA 2D0QB 1PSEA 3JCMQ 3HHTB 3MPUB 1D3BA 2E12A 4E7ZA 4QVDA 3PIPA 1T0HA 3ZL7C 2PUKB 2K5LA 4JLIA 2F2WA 4C8QA 1W2BP 1VOMA 3UATA 2EJ9A 5CO7A 3G4ST 2F5TX 2DL4A 1IGQA 4IUQA 1TS9A 2BUDA 1NBEB 5LJ3e 5KE3A 3GLXA 1GCPA 2DXUA 3RERA 1MMDA 3CCLA 3MEVA 1EX4A 2ZPGB 1OX8A 5D6XA 3CPFA 3CMET 2PQWA 1I1JA 2RJDA 1VQ9A 2CUDA 4RG2A 4HCBA 2QQRA 1RAGB 2E70A 3QUIA 1Z9QA 2FRWA 3HKSA 3N5BB 2YLBA 1VQKT 2HNIA 3JCMV 4E47A 2I2LA 4KULA 3CCVT 3OS1A 3QJYA 2XU8A 1G2BA 1Y0MA 4C0FA 1ZUYA 3CCMT 2KNBB 2IVWA 3CCET 2MK5A 2HEQA 1M8MA 3OSSC 1VQPT 4X9DA 3QXEB 5GAN2 3OW2A 1K1ZA 2MWPA 1WPYA 3OYBA 4FT2A 4F7UB 1VQNT 1XNIA 2RHZA 1M90R 2LJ3A 1JJ2S 1TSFA 3L2QA 3RUXA 3NMZC 2EKOA 4BY6C 3X26B 2KYBA 5KYUB 2JW4A 2FL7A 4FSSA 3OYIA 2E3IA 2EQKA 3DLMA 2YWWA 4XTXA 3OMCA 2EQIA 3LX7A 2DVJA 1YIJT 1M4ZA 1X6GA 2HDAA 2XD0A 1PSFA 1OZ2A 1BCOA 2LTOA 2A08A 3H8ZA 3CCUQ 1K73R 1N9RA 4WTOB 4M7DC 4UC4A 1NM7A 1BYMA 4M7DF 1Y96A 2NUTB 3A1PA 5FRMA 3I56Q 4J9BA 2K7AA 1N8RR 2LX9A 2VGNA 2FZGB 1QWFA 1OV3A 2MOXA 1YP5A 2RJFA 1JEGA 2VXEA 2AHJB 1ZA1B 4M78B 1NJIR 4ZNXA 1MMGA 1UFFA 4M7DE 2BIVA 2QEXA 1VQ9T 2RQUA 1T3LA 3CMEA 2LJ1A 2EW3A 3VRYA 2YRVA 1VQ8A 1N6AA 1ZBXA 1SF9A 4Y28E 1Q86U 3RBBB 1G5VA 1WFWA 2KSSA 4GBQA 2FG0A 2LZ6B 3D7SB 1Q7YC 2DD4A 1ABQA 1YHQA 1UECA 4GY5A 4D8KA 4DQ2A 1I4K1 1QWEA 1WHMA 4KH1B 1NYFA 2JJ9A 1PCXA 2J6FA 5GAMg 1S1NA 5A0GA 1YHQQ 2E1HA 4GLMA 2ZPHB 3EHRA 2PU9B 2MMPA 4X34A 4PL6A 3MEUA 3OYYA 2O9VA 5GMKh 3MHXA 4M75E 4HVVA 2HQXA 4J9IA 2RK1A 1ZX6A 4LXCA 1KJWA 2EBPA 3M57A 1YCYA 3M53A 1VQKQ 4QKUA 1VQ6A 5IH2A 3CCRQ 3CCJQ 1D0YA 1YN8A 1VQKA 2BE9B 3DKMA 5FU7B 1D0XA 3G6EA 2DXBA 1VQ7A 4LUEA 4OGEA 4JS5A 4XTZA 3CCQT 4JZ4A 2DYBA 4IUVA 3I56A 3SFMA 4ME7A 4C8QG 5LJ5d 3QG1A 3PVLA 1TH7A 4FM4B 3CD6A 4PJOF 3JCMJ 3OS5A 1SKUB 2CP0A 2CP2A 2ENMA 3TCJA 4M78A 3GP8A 2IPOB 4XK8E 3QIIA 3UF4A 2R57A 2V26A 3M0PA 1X43A 3EH2A 4JRQA 1B34B 4VUBA 3OBYA 3CXCA 1VQNQ 3E19A 3RR6A 1AWOA 2MWOA 2AZSA 2DAQA 2RH2A 2RQVA 3JV3A 3FDRA 1WHHA 1IHWA 2J6OA 4WCIA 3CC7T 4E7JA 4ATOA 1RLQC 4C5EA 4FT4A 4J6YA 3EG3A 2DXTA 1QCNA 5CQXA 2ED1A 2GTJA 3LW5E 2O9SA 2EFIA 3M9QA 3REBB 2RHXA 2KE9A 3CCJA 1UDLA 2KAFA 4IUPA 1QMCA 4RTTA 1QP2A 4L5GA 3UWNA 3PIOA 2COWA 1NG2A 2CZ7B 4LDUA 3VS4A 4IURA 3UPUA 1Q81U 1OU9A 1PC0A 4A4HA 5GANf 1AVZC 2X3XD 5IAYA 3VKIA 1D1CA 2LP5A 2F5KA 4M75F 2E6ZA 3EGDA 4PLLA 4EIKA 3CCLT 5LJ3g 2V8IA 1MUZA 4FYVB 2FPFA 4LD9K 3I5SA 2GF7A 1NJIU 4FL6A 4O5VA 5KYNA 4RCCA 5FW9A 3OW2S 1NJIC 2IG0A 1ACMB 1VQPA 3M4GA 4BD3A 2YDLA 4M7DB 1K4US 1Q86R 1X2QA 2DF6A 4GLKA 1YI2Q 4F7UE 1SRLA 3CCEA 3CCVQ 1PRLC 4RUGA 5GAN7 3M0QA 4LDWA 1QP3A 4CC3A 1YCSB 1VQ7T 1YNZA 4ZGEB 4KUDK 1GBRA 2J7IA 1ZA2B 2V8KA 4LN2A 1TU0B 3RKYA 4E7SA 6AT1B 4IIOA 3UT1A 5KH6A 1AZEA 4PJOE 2EGEA 1VQLT 4M7DA 1OOTA 2D0NA 2LDMA 3CCQQ 3ZFJA 2E6NA 2VKNA 3PNWC 3PFSA 5HK3A 3MKDA 4E7LA 5GMKi 1QVGS 2M9UA 4JUVA 3U23A 1WXUA 1YHQT 2HBWA 1D1AA 3CBOA 1NE8A 2E4HA 4QVZA 2RM4A 2OAUA 2EYQA 4C5GA 2J06A 4HCZA 1G3SA 5DLQE 5GMKj 1WHJA 1Q7YR 4FYXB 3UA6A 4PLIA 1T0JA 2OAWA 4A4KA 4M7AC 2MF2A 4M75C 2QQ9A 1KQSA 1VQOT 3OYCA 2VV5A 2CP6A 2MI6A 2YUOA 1PG5B 2K3YA 2A37A 2K9GA 1KHIA 1SG5A 3G71Q 1VQMA 3CMEQ 3G7ZA 2CKKA 3OMGA 4M75A 3PT9A 3L1AA 1C6VX 4B6MA 1JBMA 1YJ9Q 3JB9G 2DTOA 5M9OA 1Q7YU 2GCXA 3DLLA 2L2PA 1JO8A 4C92F 2CZ0B 1FMKA 2FPDA 4CI0C 4F7UF 3J80E 3CC7Q 2MCNA 1N9SA 2KK4A 3OSVA 1BCMA 1ARKA 2KDSA 3KFVA 3GF5A 2DTIA 2J6KA 4M77F 4M7AB 3CCRT 5DLOA 1X27A 2CH4W 3EFSA 3JCMd 1Y07A 3V8LA 4RMOA 4NS5A 4FYWB 2VVKA 2DEQA 5A2QE 2IIMA 1ZSZC 1G3WA 2CP3A 2OI3A 2XDPA 3CC2A 2NUTA 1Q81R 2YXYA 3RMSA 2GQVA 2CP5A 1WJRA 2K2VA 4RTWA 3EG2A 1RAIB 1Q86C 2KT1A 1BB9A 3DB3A 4XAXB 4J9CA 2DBKA 1YJNA 1KQ2A 2XDBA 3LWIA 4JDSA 2O88A 1KFZA 3WVEB 4BE0A 1CKBA 3OS2A 3HP9A 5GAN6 2ROTA 1KC8R 4AFQC 5D6YA 2QYZA 1YI2A 9ATCB 4OGCA 2DL7A 3SWNC 1R0BG 2NUPA 1KHCA 1XJWB 3CPWS 4KH0B 3FIFA 4M7AF 1RAHB 2KQWA 2OJ2A 4PKCC 1M1FA 2AK5A 1B34A 1TUCA 1HK9A 2DJZA 4DBFA 1M2VA 2Z0WA 5LJ3f 2QQAA 3BW1A 1G3YA 1KC8U 1KQSP 1RL2A 2M51A 1E7OA 2COZA 1FXXA 2CS7A 1ZUUA 1JXOA 1QKWA 3QWYA 4OMPA 1WHKA 1VQ4Q 2JMCA 1TG0A 2CYZB 1TOVA 5GAOl 4JRPA 2K3BA 3REAB 4OB1B 3OYMA 5GAOr 5KCOA 4BACA 1T3SA 1M8VA 3HFNA 2L0AA 1IO6A 4BI8B 3CD6Q 2PUOB 2HAXA 4MMLA 4M7AG 5LL6S 1ZSZA 4Y92A 1XTDA 2KYMA 3TQ7P 3JCMg 2KR3A 1D0ZA 2GNCA 3QZ5B 3CCSA 4BY6B 3SHWA 1U06A 2P4RA 3MJXA 4EMKA 2DLPA 5J39A 2KRMA 2FZKB 5GAN5 5L8RE 1IB8A 2DILA 1SRMA 4N4IA 3A8MB 5GAMd 1K76A 2RF0A 5GANj 4QW2A 1RAFB 2QASA 4ZN3A 3JCMc 3R6OA 5GAOq 1B7TA 1I0CA 3E9GA 5GAN8 1MV0B 1QVPA 3M0UA 2Y90A 3C95A 4KT0E 1YIJA 2YUQA 1K9MU 3VV0A 4MDXA 1ZHIA 4PJNA 1UHFA 2X9HA 3FRNA 3EFRA 4AFZC 1VQMQ 1FYNA 5GANd 2QXFA 4M77B 2R58A 3PVQA 3VUBA 4M78F 4XU3A 2BZ8A 2X4WA 1WIEA 2EWNA 1AZGB 3F70A 3JCMP 3OYKA 3E1SA 4F7UA 2E41A 4J7IA 1U1TA 1M1GA 1OI1A 3M0TA 2RPNA 3LGLA 2B86A 3PMTA 4A4GA 4M7AE 3PTAA 3FJ5A 2QTVA 2XK0A 3VYGA 2LCLA 1Q95G 2LCCA 2FZCB 1FWZA 2K5IA 1KSWA 5IHNA 4PFZA 2LRQA 4PJJA 1PNJA 2HD0A 1E6HA 3TSZA 1WHGA 4XTVA 2D8JA 3GBQA 2K2MA 2LX7A 2E64A 2QTXA 2SEMA 3HTRA 1UTIA 4OMQA 2A3LA 1X01A 1OEBA 4EMKC 4M75G 1V29B 1UUEA 1ZSZB 3JB9D 5GJVB 2BZYA 4D6WA 2LC4A 4OF1A 2PVOB 3VS6A 1VQLA 4MZMA 5DY9A 4XU1A 2CZ6B 2XIDA 5CR2A 1V76A 1QQJA 1YWPA 3OS0A 1KK7A 4BE2A 2MPXC 3JSCA 1IHVA 2K5FA 2ZCFB 5GANg 1UG1A 1QVGA 3M59A 2FHDA 5DM7R 3H0FA 5GAOm 2ZPBB 2W10A 1UGPB 1XQHA 5FWCA 1TUGB 4M77E 2RQTA 1M1KC 3SB2A 4KGVB 1NPRA 1TWBA 1AWWA 2QGFB 3A8HB 1YJNT 3HFOA 3RESA 5C0MA 1BIAA 4RTYA 1MV3A 4FSXA 4F17A 1VQ6Q 2DRKA 4R56A 1M90U 1OU8A 2D8HA 2X4JA 4F04B 4N0AC 1M3CA 1QVGP 4JRIA 4OMMA 2AZVA 1VQ7Q 3ASKA 2E65A 4AG2C 5KYUA 3GPLA 2PNIA 4HKEA 2KT8A 2K6DA 3ER0A 3CCMQ 3OYHA 3RMQA 2RO0A 2CSIA 5HY6A 1GFCA 2HCKA 5HKCA 1VQPQ 3MEAA 3O5ZA 4NL3A 4RTUA 2RI5A 4JS4A 2LNHB 1K73U 1MMNA 1UGVA 1U1SA 2LQNA 3X24B 3CBMA 3QPHA 4RCBA 1KQ1A 4JPBW 1H3ZA 1G83A 2R5AA 4L6V5 2CZ1B 2CT3A 1ABOA 2XKOC 3P8BB 2QK0A 1EZZB 4PK4A 1LPLA 4N0AA 1M27C 5IT9E 2EAYA 4HT9A 4C8QB 2LCSA 2RHIA 4V2SA 1GRIA 3L2RA 1VQMT 4QQGA 4FIBA 5FRNA 2R5MA 4KRTA 4KUIA 4BB7A 3J81E 4OMOA 4N4GA 4R55A 2ROLA 2DJQA 4A4EA 1ZUKA 1W2BA 1FX7A 1B3QA 1W70A 3C0CA 3H9NA 3CC2Q 5I22A 4HCKA 1Q82U 3G6EQ 2F69A 1TXQA 3CC4A 2DZ9A 1MMAA 1Q81C 2L3QA 3EAEA 4J9FA 3ME9A 2WSEE 4RTVA 4TVRA 1PRMC 3O8VA 1QLYA 5C6SA 3L2WA 1KD1C 2EJGA 3M4YA 3BY7A 3THKA 2WSFE 1M3BA 4ZGDB 4DBRA 1UE9A 1ZQ1A 1YJWQ 3EHQA 5I2MA 2EKHA 1KD1U 3A8GB 4C8QD 3G71A 4Z89A 5EC7A 1GFDA 4LE9A 2EIFA 5CKEA 1K0XA 1YJWA 4XTUA 2JM9A 1QVFS 3IQLA 4RG8A 1B07A 2FPEA 3I56T 1RAAB 1VYUA 1I07A 4J5YA 1HXDA 2RMOA 3OYJA 1AEYA 3CEYA 4FW2A 3OYLA 3EG0A 1C0MA 3KXTA 4BDYA 3MEWA 3KBGA 2RD1A 3CCST 1WJSA 2BKDN 4FYYB 5LJ5f 3GNFB 4ELZC 2W0ZA 5AT1B 4ZTFA 2CDTA 2QEXT 4HCCA 4PJMA 3JCMX 2JTMA 2X51A 3HPWA 3LWHA 2DO3A 1PKSA 4N4HA 5LJ5h 1RADB 1YIJQ 4DA4A 3BDUA 3DB4A 3RKXA 2DK3A 1UB4A 2QA4T 2L5QA 2OTJQ 3LGFA 2DD5A 3P8HA 1M30A 4J9DA 3CPWA 4M77A 1K8AR 4M78E 5GAOn 4C8QF 3V7CA 1U8RA 3S3MA 1YFNA 2QDLA 4R0KA 2CUBA 4OB2B 4C92C 5GAN3 3I9QA 2HZYA 4HA8A 4Z8AA 3QHSA 3S6WA 2H8HA 4LD6A 2XICA 4K11A 2X4YA 1F1BB 1N8RU 2ZPIB 2ZAEA 2LT4A 2DERA 2LQ8A 3QYGB 4C92E 3MP8A 2RQWA 2KMTA 2YUNA 2QA4Q 3I55T 3OA6A 1FMWA 1GBQA 3QZ9B 4IUTA 2RB6A 2V8JA 5LJ5e 2EJFA 1WZOA 4F16A 3G1JA 1OPKA 3HRSA 4HT8A 4E7IA 2LT1A 3CBPA 1VQ5Q 1OZ3A 3JAME 2KI7A 2VXFA 2JXBA 1BU1A 2QQBA 3M0RA 1XOVA 2WSCE 2JOYA 3RNJA 3QBYA 1V1CA 1M90C 1YJ9A 4JJCA 3I55A 2EGCA 2KXDA 5GAMj 2DE0X 3Q1JA 3OYEA 2RJCA 2XDDA 3A8OB 1I8FA 3LYIA 4E7KA 2DPPB 3A8LB 1R0CB 1H641 3GOXA 1NPPA 2DXCA 1IGUA 4M77C 2E10A 1S72A 1H92A 3QJ6A 1BIBA 4XU2A 3LH5A 5D7UA 4E6RA 1Q82R 4J6XA 1S72Q 3SWNA 1U5SA 3OBWA 5FU6C 1TTHB 3G4SA 4J6WA 1JJ2A 2NYSA 1VYVA 1N27A 4JLGA 1C1AA 1BK2A 4Q5WA 3FJPA 3EGUA 2COYA 4PJOG 3CC4T 3QKJA 5KYXA 1D1BA 2O31A 3FB9A 5IHIA 3M0SA 1YI2T 1AWJA 1U3OA 4RTZA 3CCMA 2AT1B 2HL5C 4OMNA 2X35A 4JJDA 5I2SA 2FVUA 1R77A 1M1KR 3SD4A 3OYAA 3CCEQ 2CP7A 3INZA 3H6ZA 2OTLT 2AKLA 2ABLA 2XG8D 3JB9J 4OMFB 5GAN4 2ZZDA 7AT1B 2ESWA 4FU6A 2Y4XA 4C0GA 2DFUA 2JM8A 1JB0E 3NPFA 3UDCA 5HK0A 2OTJA 1GCQC 1NLPC 2MAMA 1UGQB 2LQWA 2EQJA 2FEIA 3M5AA 3CMAA 3HSBA 1Y7XA 1D09B 2DBMA 1VIEA 4OB0B 4LUDA 3NTKA 4JJNK 2KXCA 4M75B 4CC2A 4EPCA 1OPLA 2DL3A 3HL8A 1K8AU 2JN0A 4C8QC 2VC8A 3CCJT 1SSFA 4J7FA 5ECAA 1Y57A 2EYXA 1N5ZA 2AKKA 3G4SQ 1VQ8Q 4PNOA 2KROA 2M02A 3L2ZA 5CVIA 2DZCA 3GNGA 2YSQA 4KGZB 4M7AA 3V7RA 4II1A 1LVKA 4D8DA 4DOWA 3HRTA 3CXCP 2LMJA 2L3SA 1JXMA 2ZPFB 2PZ1A 4M7DD 5GMKe 2MIOA 2H3JA 3JCMf 4X9CA 1P92A 1WI7A 1Z9ZA 1G3TA 4AFUC 5CK9A 1HSQA 2VGMA 1QCFA 2DYIA 3VS7A 2RHYA 2A7YA 3PGGA 2HKQB 2KRNA 2D9TA 5HCKA 4IIMA 2BE7D 1UGSB 2CREA 4C0DB 2DX1A 3JCMh 3CPWP 1X75C 2O01E 4WF2A 3S3NA 1VIFA 8AT1B 2YUPA 1ZSGA 3SEMA 1BI2A 1AD5A 2RJEA 1Y96B 3EG9A 1PM3A 1UHCA 3AHUA 4J9GA 2JNGA 2YHTA 1VUBA 2J05A 2F2XA 3V8JA 1MGQA 5IXFA 3OYFA 2OTJT 5KYXB 2NLUA 3QDRB 4JZ3A 1K73C 2DTHA 4ANJA 2G3RA 5GMKm 3JB9F 5GAOp 3JB9I 4AMCA 3MP6A 3OYNA 3CXCS 2C0TA 4HVUA 1VQ5T 4ZGJB 2C0OA 2A36A 5EG2A 1CKAA 1MHNA 1SPKA 5CCAA 2VASA 3HRUA 1RAEB 5FU7C 5CIUA 1WLPB 4RKUE 3GIBA 3BE3A 4DOVA 2CSQA 2GFAA 2PVDB 4C92B 2RN8A 1VQ5A 4PJOD 2HSEB 2D6FA 5KYWB 2PVGB 1SEMA 3M58A 3FC3A 2QGGA 4MZTA 4DEXA 1M1KU 4PJLA 2KY9A 2EGAA 3G71T 3VS0A 5I21A 2DVEA 1S72T 3E9FA 2P0KA 1K8AC 3FLGA 4Y91A 3X20B 5L23A 2LJ0A 4A53A 2M1HA 2CH4A 4EMKB 2E5QA 1WQ7A 5LJ5g 3QSUA 2DL8A 1DJ7B 2I0NA 3C94A 2L8DA 1I5LA 4C0ZA 2LNVA 4OVAA 3ULRB 1LCKA 1PD0A 3WXMB 4M78C 5KYWA 2SRCA 2X3WD 4J9HA 2FRYA 3I55Q 5GAMf 1IREB 4DEYA 3VRZA 1ZBJA 1UJ0A 4IUUA 4E2FB 1GL5A 1R8OB 4M78D 3E2UA 2HKNA 1I5OB 4CC7A 3TVTA 1H3HA 5GAMh 3TU4K 1KQSS 1JRIA 1KIKA 4MDWA 1M5Q1 2DM1A 1VQOA 3RIRA 5CKFA 1I81A 4C92D 2YT6A 1VQ9Q 1PWTA 4EDUA 3EG9B 2EQUA 3CCQA 1M3AA 3J7AF 1WX6A 3ZBDA 5I11A 1X6OA 2RHUA 4AG1C 2Y4YA 1VA7A 5KE2A 3VJPA 4QT7A 2EQMA 4B9WA 3QYHB 2JMAA 1BI1A 4XTYA 1WGSA 2VB6A 1EFNA 3NTIA 2PTKA 1J3TA 4JJBA 3VUZA 1PD1A 5GANh 2GFUA 3EGXA 2NUZA 1VQLQ 3T9NA 2RNAA 4JRKA 3V7SA 1PKTA 1W1FA 4E7HA 3AT1B 1IZ6A 1YITA 1AWXA 2DIGA 4NL2A 4PJOA 1YBYA 1GCQA 4M7DG 5GJWB 3I35A 2HBPA 3CCUA 3S3OA 3TREA 4OP0A 2XHCA 4CRIA 2K57A 2L3RA 1NZ9A 2XMFA 1RACB 1OYXA 3UA7A 3L42A 3MP1A 8ATCB 1D3BB 2ATCB 2K79A 1WNLA 2JTEA 4M75D 3TEEA 2RK2A 1YWOA 2E5KA 2X4XA 4QQDA 1VQ6T 2P4TA 1QVFA 4M4ZA 3VYHB 1MNEA 1GXIE 2JTFA 1LNXA 2QEXQ 4J9EA 1OQKA 4LDVA 1ZLMA 2FB7A 1KC8C 2RQRA 1LJOA 2L3PA 3SDZA 1VQ4T 3OB9A 2GQIA 2VWFA 2RI3A 1JJ2P 2E3HA 1OULA 2M0OA 4KGXB 3I5RA 2HQHA 3R6NA 2LVMA 1Y71A 1FMVA 1HD3A 5LJ3h 3WVDB 4FW1A 4IKFA 2BTTA 4CC4B 1WHLA 2KRSA 4X1VA
chains in the Genus database with same CATH topology
1T3SA 1UFFA 2DRMA 2ECZA 2RQUA 1T3LA 1WXBA 2LJ1A 2DE0X 2EW3A 2L0AA 1IO6A 3VRYA 1PHTA 4Y92A 2GTOA 2KYMA 3RBBB 3H0HA 1WFWA 1NYGA 2JS0A 2KR3A 2GNCA 1RLPC 1H8KA 4A63B 4GBQA 2FG0A 2LZ6B 1K9AA 3SHWA 1U06A 2P4RA 5IXBA 1ABQA 2DNUA 1UECA 1H92A 2DL5A 2DLPA 4D8KA 1QWEA 2KRMA 1NYFA 3LH5A 1JQQA 4E6RA 2C0IA 2DILA 1SRMA 2J6FA 1S1NA 1E6GA 1U5SA 1K76A 4GLMA 2RF0A 3EHRA 1NEGA 2O9VA 1I0CA 1VYVA 1X69A 4HVVA 4J9IA 1MV0B 1BK2A 2CT4A 1ZX6A 3M0UA 3EGUA 2DA9A 1KJWA 2EBPA 2HSPA 2O31A 5IHIA 1BBZA 2D1XA 3M0SA 1AWJA 1U3OA 2YUQA 4RTZA 5IH2A 1YN8A 1HJDA 4OMNA 4JJDA 1UHFA 4LUEA 4JZ4A 1WXTA 4AFZC 4AFSC 1JU5C 1FYNA 2DYBA 3PVQA 2BZ8A 1WIEA 2AKLA 1AZGB 2ABLA 4ORZA 3PVLA 2ESWA 3M0TA 2RPNA 2B86A 2JM8A 2GGRA 1WA7A 3NPFA 2ENMA 4Z88A 1GCQC 1NLPC 3FJ5A 2LQWA 2A28A 2FEIA 4OMLA 3UF4A 1KSWA 5IHNA 3M0PA 1X43A 2DBMA 1SSHA 4LUDA 2KXCA 4CC2A 1PNJA 1E6HA 3TSZA 1OPLA 2DL3A 4LNPA 2D8JA 3GBQA 1AWOA 2K2MA 3PE0A 2AZSA 2LX7A 2V1QA 4ESRA 2SEMA 2RQVA 1UTIA 4HVWA 4OMQA 3JV3A 1OEBA 5ECAA 1Y57A 2KBTA 2EYXA 2J6OA 1N5ZA 2AKKA 4WCIA 1UUEA 2JT4A 2KROA 2FO0A 1RLQC 1CSKA 3A98A 3EG3A 5GJVB 2YSQA 2BZYA 3VS6A 2ED1A 2GTJA 4D8DA 2F2VA 2O9SA 1X6BA 1YWPA 3CQTA 1WDXA 3REBB 2LMJA 2KE9A 1UDLA 2L3SA 1JXMA 4RTTA 2PZ1A 1NG2A 2MIOA 1UG1A 3VS4A 1WI7A 1Z9ZA 3H0FA 4AFUC 1HSQA 1QCFA 3VS7A 1SHFA 2W10A 2KRNA 1VYTA 1TUDA 4HXJA 5FWCA 5HCKA 4IIMA 2RQTA 1AVZC 2X3XD 2CREA 3H41A 4RTXA 2LP5A 2DX1A 1AWWA 4EIKA 2EYYA 1AOJA 1MUZA 2YUPA 1ZSGA 4RTYA 2FPFA 3SEMA 1MV3A 4F17A 2DRKA 2D8HA 3I5SA 1AD5A 1RI9A 1M3CA 1A0NB 1UHCA 3VS2A 4J9GA 2J05A 2EYZA 2F2XA 5FW9A 1SHGA 4OMMA 3TSWA 2AZVA 5IXFA 3VS1A 5FWBA 2KEAA 4AG2C 4JZ3A 2PNIA 2KT8A 2K6DA 2YDLA 1K4US 2CSIA 1X2QA 2C0TA 2DF6A 1GFCA 4HVUA 2O2OA 2HCKA 1NEBA 1SRLA 1WYXA 2NWMA 3O5ZA 1PRLC 4RUGA 4RTUA 2BZXA 3EG1A 3M0QA 2LNHB 2C0OA 4CC3A 2A36A 1UGVA 1CKAA 1SPKA 1YCSB 2LQNA 1YNZA 1GBRA 4JPBW 2J7IA 1UJYA 1G83A 4F14A 1W6XA 1QKXA 4LN2A 2CT3A 1WLPB 1ABOA 1X2KA 3VS5A 5IHKA 2V1RA 4IIOA 2CSQA 2RN8A 3NHNA 1M27C 3H0IA 1AZEA 1K0SA 1SEMA 2EGEA 1OOTA 2D0NA 3QWXX 2LCSA 1GRIA 2VKNA 1RUWA 2EVRA 2DMOA 4DEXA 4KRTA 3NGPA 2EGAA 4OMOA 3VS0A 2ROLA 3U23A 2EYWA 1WXUA 2DJQA 2JS2A 1ZUKA 2ED0A 1B3QA 1W70A 2HBWA 3C0CA 5L23A 2LJ0A 2CH4A 3VS3A 5I22A 2GBQA 2G6FX 4HCKA 2KGTA 2J06A 2DL8A 2I0NA 2L3QA 4J9FA 3UA6A 2EPDA 1NLOC 1T0JA 2M0YA 2OAWA 4RTVA 3ULRB 1LCKA 1PRMC 1QLYA 2SRCA 2X3WD 4J9HA 2FRYA 2YUOA 1T0HA 3ZL7C 3THKA 2A37A 4DEYA 2K9GA 3VRZA 1ZBJA 1UJ0A 2F2WA 1M3BA 3UATA 1GL5A 1UE9A 3EHQA 2EKHA 4CC7A 2DL4A 5EC7A 4Z89A 4LE9A 3TVTA 1GFDA 1K0XA 2JM9A 1H3HA 3IQLA 2L2PA 1JO8A 1FMKA 2FPDA 1B07A 1KIKA 2FPEA 1GCPA 1VYUA 2DM1A 1I07A 2MCNA 2RMOA 1ARKA 1AEYA 3KFVA 3EG0A 2YT6A 2J6KA 1PWTA 1I1JA 1X27A 1M3AA 2CUDA 1WX6A 2CH4W 5I11A 4AG1C 1Z9QA 1VA7A 4QT7A 2FRWA 2W0ZA 2JMAA 2CDTA 1EFNA 2VVKA 2PTKA 1J3TA 4JJBA 1G2BA 1Y0MA 2IIMA 1PKSA 2OI3A 2NUZA 1ZUYA 2RNAA 2KNBB 1PKTA 1W1FA 2HEQA 4RTWA 3EG2A 1M8MA 1AWXA 1GCQA 2KT1A 1M30A 4J9DA 5GJWB 3I35A 1BB9A 1K1ZA 2QDLA 4J9CA 2DBKA 2XMFA 4R0KA 2CUBA 3UA7A 1KFZA 2LJ3A 2O88A 3I9QA 1CKBA 2K79A 3NMZC 2JTEA 4Z8AA 2ROTA 4AFQC 1YWOA 2E5KA 2KYBA 2JW4A 2H8HA 2DL7A 4K11A 4FSSA 4M4ZA 4ZNXA 2EQIA 4J9EA 1ZLMA 2DVJA 1X6GA 2OJ2A 2RQRA 2AK5A 2HDAA 1TUCA 2RQWA 2YUNA 2L3PA 1GBQA 2A08A 2GQIA 2VWFA 4F16A 1NM7A 2M51A 1OPKA 1E7OA 3I5RA 3R6NA 1ZUUA 1JXOA 2K7AA 4J9BA 1QKWA 3QWYA 4OMPA 1HD3A 2JMCA 2JXBA 1BU1A 1OV3A 1QWFA 1TG0A 3M0RA 2BTTA 2K3BA 1XOVA 3REAB 2MOXA 1YP5A 3RNJA 1JEGA 1V1CA 4CC4B 4JJCA 2EGCA 2KRSA 4X1VA 2KXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3S A;  1UFF A;  2DRM A;  2ECZ A;  2RQU A;  1T3L A;  1WXB A;  2LJ1 A;  2DE0 X;  2EW3 A;  2L0A A;  1IO6 A;  3VRY A;  1PHT A;  4Y92 A;  2GTO A;  2KYM A;  3RBB B;  3H0H A;  1WFW A;  1NYG A;  2JS0 A;  2KR3 A;  2GNC A;  1RLP C;  1H8K A;  4A63 B;  4GBQ A;  2FG0 A;  2LZ6 B;  1K9A A;  3SHW A;  1U06 A;  2P4R A;  5IXB A;  1ABQ A;  2DNU A;  1UEC A;  1H92 A;  2DL5 A;  2DLP A;  4D8K A;  1QWE A;  2KRM A;  1NYF A;  3LH5 A;  1JQQ A;  4E6R A;  2C0I A;  2DIL A;  1SRM A;  2J6F A;  1S1N A;  1E6G A;  1U5S A;  1K76 A;  4GLM A;  2RF0 A;  3EHR A;  1NEG A;  2O9V A;  1I0C A;  1VYV A;  1X69 A;  4HVV A;  4J9I A;  1MV0 B;  1BK2 A;  2CT4 A;  1ZX6 A;  3M0U A;  3EGU A;  2DA9 A;  1KJW A;  2EBP A;  2HSP A;  2O31 A;  5IHI A;  1BBZ A;  2D1X A;  3M0S A;  1AWJ A;  1U3O A;  2YUQ A;  4RTZ A;  5IH2 A;  1YN8 A;  1HJD A;  4OMN A;  4JJD A;  1UHF A;  4LUE A;  4JZ4 A;  1WXT A;  4AFZ C;  4AFS C;  1JU5 C;  1FYN A;  2DYB A;  3PVQ A;  2BZ8 A;  1WIE A;  2AKL A;  1AZG B;  2ABL A;  4ORZ A;  3PVL A;  2ESW A;  3M0T A;  2RPN A;  2B86 A;  2JM8 A;  2GGR A;  1WA7 A;  3NPF A;  2ENM A;  4Z88 A;  1GCQ C;  1NLP C;  3FJ5 A;  2LQW A;  2A28 A;  2FEI A;  4OML A;  3UF4 A;  1KSW A;  5IHN A;  3M0P A;  1X43 A;  2DBM A;  1SSH A;  4LUD A;  2KXC A;  4CC2 A;  1PNJ A;  1E6H A;  3TSZ A;  1OPL A;  2DL3 A;  4LNP A;  2D8J A;  3GBQ A;  1AWO A;  2K2M A;  3PE0 A;  2AZS A;  2LX7 A;  2V1Q A;  4ESR A;  2SEM A;  2RQV A;  1UTI A;  4HVW A;  4OMQ A;  3JV3 A;  1OEB A;  5ECA A;  1Y57 A;  2KBT A;  2EYX A;  2J6O A;  1N5Z A;  2AKK A;  4WCI A;  1UUE A;  2JT4 A;  2KRO A;  2FO0 A;  1RLQ C;  1CSK A;  3A98 A;  3EG3 A;  5GJV B;  2YSQ A;  2BZY A;  3VS6 A;  2ED1 A;  2GTJ A;  4D8D A;  2F2V A;  2O9S A;  1X6B A;  1YWP A;  3CQT A;  1WDX A;  3REB B;  2LMJ A;  2KE9 A;  1UDL A;  2L3S A;  1JXM A;  4RTT A;  2PZ1 A;  1NG2 A;  2MIO A;  1UG1 A;  3VS4 A;  1WI7 A;  1Z9Z A;  3H0F A;  4AFU C;  1HSQ A;  1QCF A;  3VS7 A;  1SHF A;  2W10 A;  2KRN A;  1VYT A;  1TUD A;  4HXJ A;  5FWC A;  5HCK A;  4IIM A;  2RQT A;  1AVZ C;  2X3X D;  2CRE A;  3H41 A;  4RTX A;  2LP5 A;  2DX1 A;  1AWW A;  4EIK A;  2EYY A;  1AOJ A;  1MUZ A;  2YUP A;  1ZSG A;  4RTY A;  2FPF A;  3SEM A;  1MV3 A;  4F17 A;  2DRK A;  2D8H A;  3I5S A;  1AD5 A;  1RI9 A;  1M3C A;  1A0N B;  1UHC A;  3VS2 A;  4J9G A;  2J05 A;  2EYZ A;  2F2X A;  5FW9 A;  1SHG A;  4OMM A;  3TSW A;  2AZV A;  5IXF A;  3VS1 A;  5FWB A;  2KEA A;  4AG2 C;  4JZ3 A;  2PNI A;  2KT8 A;  2K6D A;  2YDL A;  1K4U S;  2CSI A;  1X2Q A;  2C0T A;  2DF6 A;  1GFC A;  4HVU A;  2O2O A;  2HCK A;  1NEB A;  1SRL A;  1WYX A;  2NWM A;  3O5Z A;  1PRL C;  4RUG A;  4RTU A;  2BZX A;  3EG1 A;  3M0Q A;  2LNH B;  2C0O A;  4CC3 A;  2A36 A;  1UGV A;  1CKA A;  1SPK A;  1YCS B;  2LQN A;  1YNZ A;  1GBR A;  4JPB W;  2J7I A;  1UJY A;  1G83 A;  4F14 A;  1W6X A;  1QKX A;  4LN2 A;  2CT3 A;  1WLP B;  1ABO A;  1X2K A;  3VS5 A;  5IHK A;  2V1R A;  4IIO A;  2CSQ A;  2RN8 A;  3NHN A;  1M27 C;  3H0I A;  1AZE A;  1K0S A;  1SEM A;  2EGE A;  1OOT A;  2D0N A;  3QWX X;  2LCS A;  1GRI A;  2VKN A;  1RUW A;  2EVR A;  2DMO A;  4DEX A;  4KRT A;  3NGP A;  2EGA A;  4OMO A;  3VS0 A;  2ROL A;  3U23 A;  2EYW A;  1WXU A;  2DJQ A;  2JS2 A;  1ZUK A;  2ED0 A;  1B3Q A;  1W70 A;  2HBW A;  3C0C A;  5L23 A;  2LJ0 A;  2CH4 A;  3VS3 A;  5I22 A;  2GBQ A;  2G6F X;  4HCK A;  2KGT A;  2J06 A;  2DL8 A;  2I0N A;  2L3Q A;  4J9F A;  3UA6 A;  2EPD A;  1NLO C;  1T0J A;  2M0Y A;  2OAW A;  4RTV A;  3ULR B;  1LCK A;  1PRM C;  1QLY A;  2SRC A;  2X3W D;  4J9H A;  2FRY A;  2YUO A;  1T0H A;  3ZL7 C;  3THK A;  2A37 A;  4DEY A;  2K9G A;  3VRZ A;  1ZBJ A;  1UJ0 A;  2F2W A;  1M3B A;  3UAT A;  1GL5 A;  1UE9 A;  3EHQ A;  2EKH A;  4CC7 A;  2DL4 A;  5EC7 A;  4Z89 A;  4LE9 A;  3TVT A;  1GFD A;  1K0X A;  2JM9 A;  1H3H A;  3IQL A;  2L2P A;  1JO8 A;  1FMK A;  2FPD A;  1B07 A;  1KIK A;  2FPE A;  1GCP A;  1VYU A;  2DM1 A;  1I07 A;  2MCN A;  2RMO A;  1ARK A;  1AEY A;  3KFV A;  3EG0 A;  2YT6 A;  2J6K A;  1PWT A;  1I1J A;  1X27 A;  1M3A A;  2CUD A;  1WX6 A;  2CH4 W;  5I11 A;  4AG1 C;  1Z9Q A;  1VA7 A;  4QT7 A;  2FRW A;  2W0Z A;  2JMA A;  2CDT A;  1EFN A;  2VVK A;  2PTK A;  1J3T A;  4JJB A;  1G2B A;  1Y0M A;  2IIM A;  1PKS A;  2OI3 A;  2NUZ A;  1ZUY A;  2RNA A;  2KNB B;  1PKT A;  1W1F A;  2HEQ A;  4RTW A;  3EG2 A;  1M8M A;  1AWX A;  1GCQ A;  2KT1 A;  1M30 A;  4J9D A;  5GJW B;  3I35 A;  1BB9 A;  1K1Z A;  2QDL A;  4J9C A;  2DBK A;  2XMF A;  4R0K A;  2CUB A;  3UA7 A;  1KFZ A;  2LJ3 A;  2O88 A;  3I9Q A;  1CKB A;  2K79 A;  3NMZ C;  2JTE A;  4Z8A A;  2ROT A;  4AFQ C;  1YWO A;  2E5K A;  2KYB A;  2JW4 A;  2H8H A;  2DL7 A;  4K11 A;  4FSS A;  4M4Z A;  4ZNX A;  2EQI A;  4J9E A;  1ZLM A;  2DVJ A;  1X6G A;  2OJ2 A;  2RQR A;  2AK5 A;  2HDA A;  1TUC A;  2RQW A;  2YUN A;  2L3P A;  1GBQ A;  2A08 A;  2GQI A;  2VWF A;  4F16 A;  1NM7 A;  2M51 A;  1OPK A;  1E7O A;  3I5R A;  3R6N A;  1ZUU A;  1JXO A;  2K7A A;  4J9B A;  1QKW A;  3QWY A;  4OMP A;  1HD3 A;  2JMC A;  2JXB A;  1BU1 A;  1OV3 A;  1QWF A;  1TG0 A;  3M0R A;  2BTT A;  2K3B A;  1XOV A;  3REA B;  2MOX A;  1YP5 A;  3RNJ A;  1JEG A;  1V1C A;  4CC4 B;  4JJC A;  2EGC A;  2KRS A;  4X1V A;  2KXD A; 
#chains in the Genus database with same CATH topology
 2DRM A;  2ECZ A;  3CCV A;  1G8X A;  5KCH A;  1WXB A;  4XQ3 A;  4EMH A;  1PHT A;  3CC2 T;  2ZGW A;  2DIQ A;  2GTO A;  3C12 A;  4BI3 A;  4C92 A;  2CGH A;  4C5H A;  3SWN B;  3BDL A;  3LH0 A;  2YRC A;  3H0H A;  1BI0 A;  1NYG A;  2JS0 A;  2DEU A;  1OX9 A;  2WAC A;  1WJQ A;  4O6J A;  1RLP C;  5CKD A;  1H8K A;  4A63 B;  1YJ9 T;  1K9A A;  5IXB A;  2QAZ A;  3CCU T;  2DNU A;  2DL5 A;  1VQN A;  1JQQ A;  1HYO A;  2C0I A;  1RAB B;  3BFM A;  3RKW A;  4LDX A;  1E6G A;  4BUG A;  3PMI A;  4BI4 A;  1BKB A;  1O75 A;  1QVF P;  4ZN1 A;  1NEG A;  3M55 A;  3EH1 A;  3NTH A;  1X69 A;  4XTW A;  4ELY C;  3OYD A;  4C8Q E;  2CT4 A;  2DA9 A;  3M54 A;  1YIT T;  2HQE A;  2HSP A;  4KBM B;  1W2B S;  2M16 A;  4J83 A;  1BBZ A;  2D1X A;  1BI3 A;  3CCS Q;  1HJD A;  3JCM b;  4MZP A;  2P0P A;  1KG1 A;  1WXT A;  4AFS C;  1JU5 C;  3FEO A;  2JZ2 A;  1UEB A;  4A54 A;  3P8D A;  4DBH A;  1K9M C;  4ORZ A;  4LDY A;  1UGR B;  5CKH A;  2XI9 A;  2MYS A;  5D6W A;  2P0Q A;  2GGR A;  1WA7 A;  5FRO A;  2QA4 A;  1O9S A;  4C92 G;  1Q82 C;  4Z88 A;  1YIT Q;  2A0F B;  4PJO C;  2A28 A;  4OML A;  2OTL A;  2VYT A;  3VU3 C;  2OX7 A;  1AT1 B;  1M2V B;  4FCY A;  3CMA Q;  4B9X A;  3CD6 T;  1SSH A;  2H3E B;  5KYY B;  2B8A A;  3JRZ A;  4LNP A;  4QQ6 A;  4M77 D;  4C0D C;  3PE0 A;  4ESR A;  2V1Q A;  4HVW A;  5A0L A;  2KVQ G;  3OYG A;  2O4X B;  2KBT A;  3OY9 A;  4C5I A;  2P84 A;  4BDZ A;  4M78 G;  1QW1 A;  2JT4 A;  2FO0 A;  2YRD A;  1LOJ A;  5IN1 A;  3QO3 A;  1CSK A;  1W4S A;  3A98 A;  3CC4 Q;  2QQS A;  3CCL Q;  1N8R C;  3CMA T;  2F2V A;  1X6B A;  3CQT A;  5J3B A;  1WDX A;  5CAI A;  3JCM W;  1YJW T;  4AT1 B;  3RDV A;  4EMG A;  3C4S A;  2RI2 A;  2QG9 B;  3EFO B;  1SHF A;  2L89 A;  1VQ8 T;  1VYT A;  1TUD A;  4HXJ A;  2ZPE B;  3H41 A;  2VUB A;  5KYY A;  3G6E T;  4RTX A;  4Z02 A;  5A0D A;  3NFC A;  1VQO Q;  2NUP B;  2DKG A;  2EYY A;  1AOJ A;  4BE1 A;  3A5Z B;  5CQY A;  4XU0 A;  2F1L A;  1M2O A;  3EFO A;  1RI9 A;  2QDY B;  5CKB A;  1A0N B;  3MCA B;  5LJ3 j;  3VS2 A;  2AIR B;  1RI0 A;  2EYZ A;  1SHG A;  3TSW A;  2C06 A;  3VS1 A;  4M7A D;  5FWB A;  2KEA A;  3ZEH A;  4F7U G;  5GAM e;  5FLX E;  2JUF A;  3EGX B;  3QDF A;  4PFP A;  1AHJ B;  2K4Y A;  4NOY A;  2RA2 A;  3OQ5 A;  1EIF A;  2O2O A;  4YTL A;  2HMA A;  1NEB A;  1WYX A;  3L2V A;  2NWM A;  2HL3 A;  1VQ4 A;  2DET A;  3LLR A;  4A4F A;  2BZX A;  3EG1 A;  4ZTJ A;  3CC7 A;  5LJ5 j;  4OB3 B;  3V8K A;  1UJY A;  4F14 A;  1W6X A;  1QKX A;  3JCM e;  2FYK A;  1X2K A;  1QCO A;  3VS5 A;  5IHK A;  3CCR A;  2V1R A;  3JB9 H;  3NHN A;  3EGD B;  5GAN e;  4PFO A;  3M56 A;  3H0I A;  1K0S A;  3L2U A;  4M77 G;  5GMK l;  1K9M R;  3QWX X;  4DBQ A;  3MO8 A;  1RUW A;  2EVR A;  2O4X A;  3URG A;  3OW2 P;  2DMO A;  3NGP A;  2JVV A;  3KUF A;  2LQK A;  5FU6 B;  4MMK A;  2EYW A;  2JS2 A;  4QVC A;  2ED0 A;  4P5N A;  4L59 A;  2QI2 A;  1IXD A;  5J26 A;  3X25 B;  3X28 B;  2YLC A;  5AYF A;  3VS3 A;  1KD1 R;  2GBQ A;  2G6F X;  1M9S A;  2K3X A;  4PJO B;  4J8O A;  1WQW A;  2KGT A;  3MET A;  1MND A;  2OTL Q;  1YJN Q;  2EPD A;  5LJ3 d;  1NLO C;  1IRX A;  2M0Y A;  2D0Q B;  1PSE A;  3JCM Q;  3HHT B;  3MPU B;  1D3B A;  2E12 A;  4E7Z A;  4QVD A;  3PIP A;  1T0H A;  3ZL7 C;  2PUK B;  2K5L A;  4JLI A;  2F2W A;  4C8Q A;  1W2B P;  1VOM A;  3UAT A;  2EJ9 A;  5CO7 A;  3G4S T;  2F5T X;  2DL4 A;  1IGQ A;  4IUQ A;  1TS9 A;  2BUD A;  1NBE B;  5LJ3 e;  5KE3 A;  3GLX A;  1GCP A;  2DXU A;  3RER A;  1MMD A;  3CCL A;  3MEV A;  1EX4 A;  2ZPG B;  1OX8 A;  5D6X A;  3CPF A;  3CME T;  2PQW A;  1I1J A;  2RJD A;  1VQ9 A;  2CUD A;  4RG2 A;  4HCB A;  2QQR A;  1RAG B;  2E70 A;  3QUI A;  1Z9Q A;  2FRW A;  3HKS A;  3N5B B;  2YLB A;  1VQK T;  2HNI A;  3JCM V;  4E47 A;  2I2L A;  4KUL A;  3CCV T;  3OS1 A;  3QJY A;  2XU8 A;  1G2B A;  1Y0M A;  4C0F A;  1ZUY A;  3CCM T;  2KNB B;  2IVW A;  3CCE T;  2MK5 A;  2HEQ A;  1M8M A;  3OSS C;  1VQP T;  4X9D A;  3QXE B;  5GAN 2;  3OW2 A;  1K1Z A;  2MWP A;  1WPY A;  3OYB A;  4FT2 A;  4F7U B;  1VQN T;  1XNI A;  2RHZ A;  1M90 R;  2LJ3 A;  1JJ2 S;  1TSF A;  3L2Q A;  3RUX A;  3NMZ C;  2EKO A;  4BY6 C;  3X26 B;  2KYB A;  5KYU B;  2JW4 A;  2FL7 A;  4FSS A;  3OYI A;  2E3I A;  2EQK A;  3DLM A;  2YWW A;  4XTX A;  3OMC A;  2EQI A;  3LX7 A;  2DVJ A;  1YIJ T;  1M4Z A;  1X6G A;  2HDA A;  2XD0 A;  1PSF A;  1OZ2 A;  1BCO A;  2LTO A;  2A08 A;  3H8Z A;  3CCU Q;  1K73 R;  1N9R A;  4WTO B;  4M7D C;  4UC4 A;  1NM7 A;  1BYM A;  4M7D F;  1Y96 A;  2NUT B;  3A1P A;  5FRM A;  3I56 Q;  4J9B A;  2K7A A;  1N8R R;  2LX9 A;  2VGN A;  2FZG B;  1QWF A;  1OV3 A;  2MOX A;  1YP5 A;  2RJF A;  1JEG A;  2VXE A;  2AHJ B;  1ZA1 B;  4M78 B;  1NJI R;  4ZNX A;  1MMG A;  1UFF A;  4M7D E;  2BIV A;  2QEX A;  1VQ9 T;  2RQU A;  1T3L A;  3CME A;  2LJ1 A;  2EW3 A;  3VRY A;  2YRV A;  1VQ8 A;  1N6A A;  1ZBX A;  1SF9 A;  4Y28 E;  1Q86 U;  3RBB B;  1G5V A;  1WFW A;  2KSS A;  4GBQ A;  2FG0 A;  2LZ6 B;  3D7S B;  1Q7Y C;  2DD4 A;  1ABQ A;  1YHQ A;  1UEC A;  4GY5 A;  4D8K A;  4DQ2 A;  1I4K 1;  1QWE A;  1WHM A;  4KH1 B;  1NYF A;  2JJ9 A;  1PCX A;  2J6F A;  5GAM g;  1S1N A;  5A0G A;  1YHQ Q;  2E1H A;  4GLM A;  2ZPH B;  3EHR A;  2PU9 B;  2MMP A;  4X34 A;  4PL6 A;  3MEU A;  3OYY A;  2O9V A;  5GMK h;  3MHX A;  4M75 E;  4HVV A;  2HQX A;  4J9I A;  2RK1 A;  1ZX6 A;  4LXC A;  1KJW A;  2EBP A;  3M57 A;  1YCY A;  3M53 A;  1VQK Q;  4QKU A;  1VQ6 A;  5IH2 A;  3CCR Q;  3CCJ Q;  1D0Y A;  1YN8 A;  1VQK A;  2BE9 B;  3DKM A;  5FU7 B;  1D0X A;  3G6E A;  2DXB A;  1VQ7 A;  4LUE A;  4OGE A;  4JS5 A;  4XTZ A;  3CCQ T;  4JZ4 A;  2DYB A;  4IUV A;  3I56 A;  3SFM A;  4ME7 A;  4C8Q G;  5LJ5 d;  3QG1 A;  3PVL A;  1TH7 A;  4FM4 B;  3CD6 A;  4PJO F;  3JCM J;  3OS5 A;  1SKU B;  2CP0 A;  2CP2 A;  2ENM A;  3TCJ A;  4M78 A;  3GP8 A;  2IPO B;  4XK8 E;  3QII A;  3UF4 A;  2R57 A;  2V26 A;  3M0P A;  1X43 A;  3EH2 A;  4JRQ A;  1B34 B;  4VUB A;  3OBY A;  3CXC A;  1VQN Q;  3E19 A;  3RR6 A;  1AWO A;  2MWO A;  2AZS A;  2DAQ A;  2RH2 A;  2RQV A;  3JV3 A;  3FDR A;  1WHH A;  1IHW A;  2J6O A;  4WCI A;  3CC7 T;  4E7J A;  4ATO A;  1RLQ C;  4C5E A;  4FT4 A;  4J6Y A;  3EG3 A;  2DXT A;  1QCN A;  5CQX A;  2ED1 A;  2GTJ A;  3LW5 E;  2O9S A;  2EFI A;  3M9Q A;  3REB B;  2RHX A;  2KE9 A;  3CCJ A;  1UDL A;  2KAF A;  4IUP A;  1QMC A;  4RTT A;  1QP2 A;  4L5G A;  3UWN A;  3PIO A;  2COW A;  1NG2 A;  2CZ7 B;  4LDU A;  3VS4 A;  4IUR A;  3UPU A;  1Q81 U;  1OU9 A;  1PC0 A;  4A4H A;  5GAN f;  1AVZ C;  2X3X D;  5IAY A;  3VKI A;  1D1C A;  2LP5 A;  2F5K A;  4M75 F;  2E6Z A;  3EGD A;  4PLL A;  4EIK A;  3CCL T;  5LJ3 g;  2V8I A;  1MUZ A;  4FYV B;  2FPF A;  4LD9 K;  3I5S A;  2GF7 A;  1NJI U;  4FL6 A;  4O5V A;  5KYN A;  4RCC A;  5FW9 A;  3OW2 S;  1NJI C;  2IG0 A;  1ACM B;  1VQP A;  3M4G A;  4BD3 A;  2YDL A;  4M7D B;  1K4U S;  1Q86 R;  1X2Q A;  2DF6 A;  4GLK A;  1YI2 Q;  4F7U E;  1SRL A;  3CCE A;  3CCV Q;  1PRL C;  4RUG A;  5GAN 7;  3M0Q A;  4LDW A;  1QP3 A;  4CC3 A;  1YCS B;  1VQ7 T;  1YNZ A;  4ZGE B;  4KUD K;  1GBR A;  2J7I A;  1ZA2 B;  2V8K A;  4LN2 A;  1TU0 B;  3RKY A;  4E7S A;  6AT1 B;  4IIO A;  3UT1 A;  5KH6 A;  1AZE A;  4PJO E;  2EGE A;  1VQL T;  4M7D A;  1OOT A;  2D0N A;  2LDM A;  3CCQ Q;  3ZFJ A;  2E6N A;  2VKN A;  3PNW C;  3PFS A;  5HK3 A;  3MKD A;  4E7L A;  5GMK i;  1QVG S;  2M9U A;  4JUV A;  3U23 A;  1WXU A;  1YHQ T;  2HBW A;  1D1A A;  3CBO A;  1NE8 A;  2E4H A;  4QVZ A;  2RM4 A;  2OAU A;  2EYQ A;  4C5G A;  2J06 A;  4HCZ A;  1G3S A;  5DLQ E;  5GMK j;  1WHJ A;  1Q7Y R;  4FYX B;  3UA6 A;  4PLI A;  1T0J A;  2OAW A;  4A4K A;  4M7A C;  2MF2 A;  4M75 C;  2QQ9 A;  1KQS A;  1VQO T;  3OYC A;  2VV5 A;  2CP6 A;  2MI6 A;  2YUO A;  1PG5 B;  2K3Y A;  2A37 A;  2K9G A;  1KHI A;  1SG5 A;  3G71 Q;  1VQM A;  3CME Q;  3G7Z A;  2CKK A;  3OMG A;  4M75 A;  3PT9 A;  3L1A A;  1C6V X;  4B6M A;  1JBM A;  1YJ9 Q;  3JB9 G;  2DTO A;  5M9O A;  1Q7Y U;  2GCX A;  3DLL A;  2L2P A;  1JO8 A;  4C92 F;  2CZ0 B;  1FMK A;  2FPD A;  4CI0 C;  4F7U F;  3J80 E;  3CC7 Q;  2MCN A;  1N9S A;  2KK4 A;  3OSV A;  1BCM A;  1ARK A;  2KDS A;  3KFV A;  3GF5 A;  2DTI A;  2J6K A;  4M77 F;  4M7A B;  3CCR T;  5DLO A;  1X27 A;  2CH4 W;  3EFS A;  3JCM d;  1Y07 A;  3V8L A;  4RMO A;  4NS5 A;  4FYW B;  2VVK A;  2DEQ A;  5A2Q E;  2IIM A;  1ZSZ C;  1G3W A;  2CP3 A;  2OI3 A;  2XDP A;  3CC2 A;  2NUT A;  1Q81 R;  2YXY A;  3RMS A;  2GQV A;  2CP5 A;  1WJR A;  2K2V A;  4RTW A;  3EG2 A;  1RAI B;  1Q86 C;  2KT1 A;  1BB9 A;  3DB3 A;  4XAX B;  4J9C A;  2DBK A;  1YJN A;  1KQ2 A;  2XDB A;  3LWI A;  4JDS A;  2O88 A;  1KFZ A;  3WVE B;  4BE0 A;  1CKB A;  3OS2 A;  3HP9 A;  5GAN 6;  2ROT A;  1KC8 R;  4AFQ C;  5D6Y A;  2QYZ A;  1YI2 A;  9ATC B;  4OGC A;  2DL7 A;  3SWN C;  1R0B G;  2NUP A;  1KHC A;  1XJW B;  3CPW S;  4KH0 B;  3FIF A;  4M7A F;  1RAH B;  2KQW A;  2OJ2 A;  4PKC C;  1M1F A;  2AK5 A;  1B34 A;  1TUC A;  1HK9 A;  2DJZ A;  4DBF A;  1M2V A;  2Z0W A;  5LJ3 f;  2QQA A;  3BW1 A;  1G3Y A;  1KC8 U;  1KQS P;  1RL2 A;  2M51 A;  1E7O A;  2COZ A;  1FXX A;  2CS7 A;  1ZUU A;  1JXO A;  1QKW A;  3QWY A;  4OMP A;  1WHK A;  1VQ4 Q;  2JMC A;  1TG0 A;  2CYZ B;  1TOV A;  5GAO l;  4JRP A;  2K3B A;  3REA B;  4OB1 B;  3OYM A;  5GAO r;  5KCO A;  4BAC A;  1T3S A;  1M8V A;  3HFN A;  2L0A A;  1IO6 A;  4BI8 B;  3CD6 Q;  2PUO B;  2HAX A;  4MML A;  4M7A G;  5LL6 S;  1ZSZ A;  4Y92 A;  1XTD A;  2KYM A;  3TQ7 P;  3JCM g;  2KR3 A;  1D0Z A;  2GNC A;  3QZ5 B;  3CCS A;  4BY6 B;  3SHW A;  1U06 A;  2P4R A;  3MJX A;  4EMK A;  2DLP A;  5J39 A;  2KRM A;  2FZK B;  5GAN 5;  5L8R E;  1IB8 A;  2DIL A;  1SRM A;  4N4I A;  3A8M B;  5GAM d;  1K76 A;  2RF0 A;  5GAN j;  4QW2 A;  1RAF B;  2QAS A;  4ZN3 A;  3JCM c;  3R6O A;  5GAO q;  1B7T A;  1I0C A;  3E9G A;  5GAN 8;  1MV0 B;  1QVP A;  3M0U A;  2Y90 A;  3C95 A;  4KT0 E;  1YIJ A;  2YUQ A;  1K9M U;  3VV0 A;  4MDX A;  1ZHI A;  4PJN A;  1UHF A;  2X9H A;  3FRN A;  3EFR A;  4AFZ C;  1VQM Q;  1FYN A;  5GAN d;  2QXF A;  4M77 B;  2R58 A;  3PVQ A;  3VUB A;  4M78 F;  4XU3 A;  2BZ8 A;  2X4W A;  1WIE A;  2EWN A;  1AZG B;  3F70 A;  3JCM P;  3OYK A;  3E1S A;  4F7U A;  2E41 A;  4J7I A;  1U1T A;  1M1G A;  1OI1 A;  3M0T A;  2RPN A;  3LGL A;  2B86 A;  3PMT A;  4A4G A;  4M7A E;  3PTA A;  3FJ5 A;  2QTV A;  2XK0 A;  3VYG A;  2LCL A;  1Q95 G;  2LCC A;  2FZC B;  1FWZ A;  2K5I A;  1KSW A;  5IHN A;  4PFZ A;  2LRQ A;  4PJJ A;  1PNJ A;  2HD0 A;  1E6H A;  3TSZ A;  1WHG A;  4XTV A;  2D8J A;  3GBQ A;  2K2M A;  2LX7 A;  2E64 A;  2QTX A;  2SEM A;  3HTR A;  1UTI A;  4OMQ A;  2A3L A;  1X01 A;  1OEB A;  4EMK C;  4M75 G;  1V29 B;  1UUE A;  1ZSZ B;  3JB9 D;  5GJV B;  2BZY A;  4D6W A;  2LC4 A;  4OF1 A;  2PVO B;  3VS6 A;  1VQL A;  4MZM A;  5DY9 A;  4XU1 A;  2CZ6 B;  2XID A;  5CR2 A;  1V76 A;  1QQJ A;  1YWP A;  3OS0 A;  1KK7 A;  4BE2 A;  2MPX C;  3JSC A;  1IHV A;  2K5F A;  2ZCF B;  5GAN g;  1UG1 A;  1QVG A;  3M59 A;  2FHD A;  5DM7 R;  3H0F A;  5GAO m;  2ZPB B;  2W10 A;  1UGP B;  1XQH A;  5FWC A;  1TUG B;  4M77 E;  2RQT A;  1M1K C;  3SB2 A;  4KGV B;  1NPR A;  1TWB A;  1AWW A;  2QGF B;  3A8H B;  1YJN T;  3HFO A;  3RES A;  5C0M A;  1BIA A;  4RTY A;  1MV3 A;  4FSX A;  4F17 A;  1VQ6 Q;  2DRK A;  4R56 A;  1M90 U;  1OU8 A;  2D8H A;  2X4J A;  4F04 B;  4N0A C;  1M3C A;  1QVG P;  4JRI A;  4OMM A;  2AZV A;  1VQ7 Q;  3ASK A;  2E65 A;  4AG2 C;  5KYU A;  3GPL A;  2PNI A;  4HKE A;  2KT8 A;  2K6D A;  3ER0 A;  3CCM Q;  3OYH A;  3RMQ A;  2RO0 A;  2CSI A;  5HY6 A;  1GFC A;  2HCK A;  5HKC A;  1VQP Q;  3MEA A;  3O5Z A;  4NL3 A;  4RTU A;  2RI5 A;  4JS4 A;  2LNH B;  1K73 U;  1MMN A;  1UGV A;  1U1S A;  2LQN A;  3X24 B;  3CBM A;  3QPH A;  4RCB A;  1KQ1 A;  4JPB W;  1H3Z A;  1G83 A;  2R5A A;  4L6V 5;  2CZ1 B;  2CT3 A;  1ABO A;  2XKO C;  3P8B B;  2QK0 A;  1EZZ B;  4PK4 A;  1LPL A;  4N0A A;  1M27 C;  5IT9 E;  2EAY A;  4HT9 A;  4C8Q B;  2LCS A;  2RHI A;  4V2S A;  1GRI A;  3L2R A;  1VQM T;  4QQG A;  4FIB A;  5FRN A;  2R5M A;  4KRT A;  4KUI A;  4BB7 A;  3J81 E;  4OMO A;  4N4G A;  4R55 A;  2ROL A;  2DJQ A;  4A4E A;  1ZUK A;  1W2B A;  1FX7 A;  1B3Q A;  1W70 A;  3C0C A;  3H9N A;  3CC2 Q;  5I22 A;  4HCK A;  1Q82 U;  3G6E Q;  2F69 A;  1TXQ A;  3CC4 A;  2DZ9 A;  1MMA A;  1Q81 C;  2L3Q A;  3EAE A;  4J9F A;  3ME9 A;  2WSE E;  4RTV A;  4TVR A;  1PRM C;  3O8V A;  1QLY A;  5C6S A;  3L2W A;  1KD1 C;  2EJG A;  3M4Y A;  3BY7 A;  3THK A;  2WSF E;  1M3B A;  4ZGD B;  4DBR A;  1UE9 A;  1ZQ1 A;  1YJW Q;  3EHQ A;  5I2M A;  2EKH A;  1KD1 U;  3A8G B;  4C8Q D;  3G71 A;  4Z89 A;  5EC7 A;  1GFD A;  4LE9 A;  2EIF A;  5CKE A;  1K0X A;  1YJW A;  4XTU A;  2JM9 A;  1QVF S;  3IQL A;  4RG8 A;  1B07 A;  2FPE A;  3I56 T;  1RAA B;  1VYU A;  1I07 A;  4J5Y A;  1HXD A;  2RMO A;  3OYJ A;  1AEY A;  3CEY A;  4FW2 A;  3OYL A;  3EG0 A;  1C0M A;  3KXT A;  4BDY A;  3MEW A;  3KBG A;  2RD1 A;  3CCS T;  1WJS A;  2BKD N;  4FYY B;  5LJ5 f;  3GNF B;  4ELZ C;  2W0Z A;  5AT1 B;  4ZTF A;  2CDT A;  2QEX T;  4HCC A;  4PJM A;  3JCM X;  2JTM A;  2X51 A;  3HPW A;  3LWH A;  2DO3 A;  1PKS A;  4N4H A;  5LJ5 h;  1RAD B;  1YIJ Q;  4DA4 A;  3BDU A;  3DB4 A;  3RKX A;  2DK3 A;  1UB4 A;  2QA4 T;  2L5Q A;  2OTJ Q;  3LGF A;  2DD5 A;  3P8H A;  1M30 A;  4J9D A;  3CPW A;  4M77 A;  1K8A R;  4M78 E;  5GAO n;  4C8Q F;  3V7C A;  1U8R A;  3S3M A;  1YFN A;  2QDL A;  4R0K A;  2CUB A;  4OB2 B;  4C92 C;  5GAN 3;  3I9Q A;  2HZY A;  4HA8 A;  4Z8A A;  3QHS A;  3S6W A;  2H8H A;  4LD6 A;  2XIC A;  4K11 A;  2X4Y A;  1F1B B;  1N8R U;  2ZPI B;  2ZAE A;  2LT4 A;  2DER A;  2LQ8 A;  3QYG B;  4C92 E;  3MP8 A;  2RQW A;  2KMT A;  2YUN A;  2QA4 Q;  3I55 T;  3OA6 A;  1FMW A;  1GBQ A;  3QZ9 B;  4IUT A;  2RB6 A;  2V8J A;  5LJ5 e;  2EJF A;  1WZO A;  4F16 A;  3G1J A;  1OPK A;  3HRS A;  4HT8 A;  4E7I A;  2LT1 A;  3CBP A;  1VQ5 Q;  1OZ3 A;  3JAM E;  2KI7 A;  2VXF A;  2JXB A;  1BU1 A;  2QQB A;  3M0R A;  1XOV A;  2WSC E;  2JOY A;  3RNJ A;  3QBY A;  1V1C A;  1M90 C;  1YJ9 A;  4JJC A;  3I55 A;  2EGC A;  2KXD A;  5GAM j;  2DE0 X;  3Q1J A;  3OYE A;  2RJC A;  2XDD A;  3A8O B;  1I8F A;  3LYI A;  4E7K A;  2DPP B;  3A8L B;  1R0C B;  1H64 1;  3GOX A;  1NPP A;  2DXC A;  1IGU A;  4M77 C;  2E10 A;  1S72 A;  1H92 A;  3QJ6 A;  1BIB A;  4XU2 A;  3LH5 A;  5D7U A;  4E6R A;  1Q82 R;  4J6X A;  1S72 Q;  3SWN A;  1U5S A;  3OBW A;  5FU6 C;  1TTH B;  3G4S A;  4J6W A;  1JJ2 A;  2NYS A;  1VYV A;  1N27 A;  4JLG A;  1C1A A;  1BK2 A;  4Q5W A;  3FJP A;  3EGU A;  2COY A;  4PJO G;  3CC4 T;  3QKJ A;  5KYX A;  1D1B A;  2O31 A;  3FB9 A;  5IHI A;  3M0S A;  1YI2 T;  1AWJ A;  1U3O A;  4RTZ A;  3CCM A;  2AT1 B;  2HL5 C;  4OMN A;  2X35 A;  4JJD A;  5I2S A;  2FVU A;  1R77 A;  1M1K R;  3SD4 A;  3OYA A;  3CCE Q;  2CP7 A;  3INZ A;  3H6Z A;  2OTL T;  2AKL A;  2ABL A;  2XG8 D;  3JB9 J;  4OMF B;  5GAN 4;  2ZZD A;  7AT1 B;  2ESW A;  4FU6 A;  2Y4X A;  4C0G A;  2DFU A;  2JM8 A;  1JB0 E;  3NPF A;  3UDC A;  5HK0 A;  2OTJ A;  1GCQ C;  1NLP C;  2MAM A;  1UGQ B;  2LQW A;  2EQJ A;  2FEI A;  3M5A A;  3CMA A;  3HSB A;  1Y7X A;  1D09 B;  2DBM A;  1VIE A;  4OB0 B;  4LUD A;  3NTK A;  4JJN K;  2KXC A;  4M75 B;  4CC2 A;  4EPC A;  1OPL A;  2DL3 A;  3HL8 A;  1K8A U;  2JN0 A;  4C8Q C;  2VC8 A;  3CCJ T;  1SSF A;  4J7F A;  5ECA A;  1Y57 A;  2EYX A;  1N5Z A;  2AKK A;  3G4S Q;  1VQ8 Q;  4PNO A;  2KRO A;  2M02 A;  3L2Z A;  5CVI A;  2DZC A;  3GNG A;  2YSQ A;  4KGZ B;  4M7A A;  3V7R A;  4II1 A;  1LVK A;  4D8D A;  4DOW A;  3HRT A;  3CXC P;  2LMJ A;  2L3S A;  1JXM A;  2ZPF B;  2PZ1 A;  4M7D D;  5GMK e;  2MIO A;  2H3J A;  3JCM f;  4X9C A;  1P92 A;  1WI7 A;  1Z9Z A;  1G3T A;  4AFU C;  5CK9 A;  1HSQ A;  2VGM A;  1QCF A;  2DYI A;  3VS7 A;  2RHY A;  2A7Y A;  3PGG A;  2HKQ B;  2KRN A;  2D9T A;  5HCK A;  4IIM A;  2BE7 D;  1UGS B;  2CRE A;  4C0D B;  2DX1 A;  3JCM h;  3CPW P;  1X75 C;  2O01 E;  4WF2 A;  3S3N A;  1VIF A;  8AT1 B;  2YUP A;  1ZSG A;  3SEM A;  1BI2 A;  1AD5 A;  2RJE A;  1Y96 B;  3EG9 A;  1PM3 A;  1UHC A;  3AHU A;  4J9G A;  2JNG A;  2YHT A;  1VUB A;  2J05 A;  2F2X A;  3V8J A;  1MGQ A;  5IXF A;  3OYF A;  2OTJ T;  5KYX B;  2NLU A;  3QDR B;  4JZ3 A;  1K73 C;  2DTH A;  4ANJ A;  2G3R A;  5GMK m;  3JB9 F;  5GAO p;  3JB9 I;  4AMC A;  3MP6 A;  3OYN A;  3CXC S;  2C0T A;  4HVU A;  1VQ5 T;  4ZGJ B;  2C0O A;  2A36 A;  5EG2 A;  1CKA A;  1MHN A;  1SPK A;  5CCA A;  2VAS A;  3HRU A;  1RAE B;  5FU7 C;  5CIU A;  1WLP B;  4RKU E;  3GIB A;  3BE3 A;  4DOV A;  2CSQ A;  2GFA A;  2PVD B;  4C92 B;  2RN8 A;  1VQ5 A;  4PJO D;  2HSE B;  2D6F A;  5KYW B;  2PVG B;  1SEM A;  3M58 A;  3FC3 A;  2QGG A;  4MZT A;  4DEX A;  1M1K U;  4PJL A;  2KY9 A;  2EGA A;  3G71 T;  3VS0 A;  5I21 A;  2DVE A;  1S72 T;  3E9F A;  2P0K A;  1K8A C;  3FLG A;  4Y91 A;  3X20 B;  5L23 A;  2LJ0 A;  4A53 A;  2M1H A;  2CH4 A;  4EMK B;  2E5Q A;  1WQ7 A;  5LJ5 g;  3QSU A;  2DL8 A;  1DJ7 B;  2I0N A;  3C94 A;  2L8D A;  1I5L A;  4C0Z A;  2LNV A;  4OVA A;  3ULR B;  1LCK A;  1PD0 A;  3WXM B;  4M78 C;  5KYW A;  2SRC A;  2X3W D;  4J9H A;  2FRY A;  3I55 Q;  5GAM f;  1IRE B;  4DEY A;  3VRZ A;  1ZBJ A;  1UJ0 A;  4IUU A;  4E2F B;  1GL5 A;  1R8O B;  4M78 D;  3E2U A;  2HKN A;  1I5O B;  4CC7 A;  3TVT A;  1H3H A;  5GAM h;  3TU4 K;  1KQS S;  1JRI A;  1KIK A;  4MDW A;  1M5Q 1;  2DM1 A;  1VQO A;  3RIR A;  5CKF A;  1I81 A;  4C92 D;  2YT6 A;  1VQ9 Q;  1PWT A;  4EDU A;  3EG9 B;  2EQU A;  3CCQ A;  1M3A A;  3J7A F;  1WX6 A;  3ZBD A;  5I11 A;  1X6O A;  2RHU A;  4AG1 C;  2Y4Y A;  1VA7 A;  5KE2 A;  3VJP A;  4QT7 A;  2EQM A;  4B9W A;  3QYH B;  2JMA A;  1BI1 A;  4XTY A;  1WGS A;  2VB6 A;  1EFN A;  3NTI A;  2PTK A;  1J3T A;  4JJB A;  3VUZ A;  1PD1 A;  5GAN h;  2GFU A;  3EGX A;  2NUZ A;  1VQL Q;  3T9N A;  2RNA A;  4JRK A;  3V7S A;  1PKT A;  1W1F A;  4E7H A;  3AT1 B;  1IZ6 A;  1YIT A;  1AWX A;  2DIG A;  4NL2 A;  4PJO A;  1YBY A;  1GCQ A;  4M7D G;  5GJW B;  3I35 A;  2HBP A;  3CCU A;  3S3O A;  3TRE A;  4OP0 A;  2XHC A;  4CRI A;  2K57 A;  2L3R A;  1NZ9 A;  2XMF A;  1RAC B;  1OYX A;  3UA7 A;  3L42 A;  3MP1 A;  8ATC B;  1D3B B;  2ATC B;  2K79 A;  1WNL A;  2JTE A;  4M75 D;  3TEE A;  2RK2 A;  1YWO A;  2E5K A;  2X4X A;  4QQD A;  1VQ6 T;  2P4T A;  1QVF A;  4M4Z A;  3VYH B;  1MNE A;  1GXI E;  2JTF A;  1LNX A;  2QEX Q;  4J9E A;  1OQK A;  4LDV A;  1ZLM A;  2FB7 A;  1KC8 C;  2RQR A;  1LJO A;  2L3P A;  3SDZ A;  1VQ4 T;  3OB9 A;  2GQI A;  2VWF A;  2RI3 A;  1JJ2 P;  2E3H A;  1OUL A;  2M0O A;  4KGX B;  3I5R A;  2HQH A;  3R6N A;  2LVM A;  1Y71 A;  1FMV A;  1HD3 A;  5LJ3 h;  3WVD B;  4FW1 A;  4IKF A;  2BTT A;  4CC4 B;  1WHL A;  2KRS A;  4X1V A; 
#chains in the Genus database with same CATH homology
 1T3S A;  1UFF A;  2DRM A;  2ECZ A;  2RQU A;  1T3L A;  1WXB A;  2LJ1 A;  2DE0 X;  2EW3 A;  2L0A A;  1IO6 A;  3VRY A;  1PHT A;  4Y92 A;  2GTO A;  2KYM A;  3RBB B;  3H0H A;  1WFW A;  1NYG A;  2JS0 A;  2KR3 A;  2GNC A;  1RLP C;  1H8K A;  4A63 B;  4GBQ A;  2FG0 A;  2LZ6 B;  1K9A A;  3SHW A;  1U06 A;  2P4R A;  5IXB A;  1ABQ A;  2DNU A;  1UEC A;  1H92 A;  2DL5 A;  2DLP A;  4D8K A;  1QWE A;  2KRM A;  1NYF A;  3LH5 A;  1JQQ A;  4E6R A;  2C0I A;  2DIL A;  1SRM A;  2J6F A;  1S1N A;  1E6G A;  1U5S A;  1K76 A;  4GLM A;  2RF0 A;  3EHR A;  1NEG A;  2O9V A;  1I0C A;  1VYV A;  1X69 A;  4HVV A;  4J9I A;  1MV0 B;  1BK2 A;  2CT4 A;  1ZX6 A;  3M0U A;  3EGU A;  2DA9 A;  1KJW A;  2EBP A;  2HSP A;  2O31 A;  5IHI A;  1BBZ A;  2D1X A;  3M0S A;  1AWJ A;  1U3O A;  2YUQ A;  4RTZ A;  5IH2 A;  1YN8 A;  1HJD A;  4OMN A;  4JJD A;  1UHF A;  4LUE A;  4JZ4 A;  1WXT A;  4AFZ C;  4AFS C;  1JU5 C;  1FYN A;  2DYB A;  3PVQ A;  2BZ8 A;  1WIE A;  2AKL A;  1AZG B;  2ABL A;  4ORZ A;  3PVL A;  2ESW A;  3M0T A;  2RPN A;  2B86 A;  2JM8 A;  2GGR A;  1WA7 A;  3NPF A;  2ENM A;  4Z88 A;  1GCQ C;  1NLP C;  3FJ5 A;  2LQW A;  2A28 A;  2FEI A;  4OML A;  3UF4 A;  1KSW A;  5IHN A;  3M0P A;  1X43 A;  2DBM A;  1SSH A;  4LUD A;  2KXC A;  4CC2 A;  1PNJ A;  1E6H A;  3TSZ A;  1OPL A;  2DL3 A;  4LNP A;  2D8J A;  3GBQ A;  1AWO A;  2K2M A;  3PE0 A;  2AZS A;  2LX7 A;  2V1Q A;  4ESR A;  2SEM A;  2RQV A;  1UTI A;  4HVW A;  4OMQ A;  3JV3 A;  1OEB A;  5ECA A;  1Y57 A;  2KBT A;  2EYX A;  2J6O A;  1N5Z A;  2AKK A;  4WCI A;  1UUE A;  2JT4 A;  2KRO A;  2FO0 A;  1RLQ C;  1CSK A;  3A98 A;  3EG3 A;  5GJV B;  2YSQ A;  2BZY A;  3VS6 A;  2ED1 A;  2GTJ A;  4D8D A;  2F2V A;  2O9S A;  1X6B A;  1YWP A;  3CQT A;  1WDX A;  3REB B;  2LMJ A;  2KE9 A;  1UDL A;  2L3S A;  1JXM A;  4RTT A;  2PZ1 A;  1NG2 A;  2MIO A;  1UG1 A;  3VS4 A;  1WI7 A;  1Z9Z A;  3H0F A;  4AFU C;  1HSQ A;  1QCF A;  3VS7 A;  1SHF A;  2W10 A;  2KRN A;  1VYT A;  1TUD A;  4HXJ A;  5FWC A;  5HCK A;  4IIM A;  2RQT A;  1AVZ C;  2X3X D;  2CRE A;  3H41 A;  4RTX A;  2LP5 A;  2DX1 A;  1AWW A;  4EIK A;  2EYY A;  1AOJ A;  1MUZ A;  2YUP A;  1ZSG A;  4RTY A;  2FPF A;  3SEM A;  1MV3 A;  4F17 A;  2DRK A;  2D8H A;  3I5S A;  1AD5 A;  1RI9 A;  1M3C A;  1A0N B;  1UHC A;  3VS2 A;  4J9G A;  2J05 A;  2EYZ A;  2F2X A;  5FW9 A;  1SHG A;  4OMM A;  3TSW A;  2AZV A;  5IXF A;  3VS1 A;  5FWB A;  2KEA A;  4AG2 C;  4JZ3 A;  2PNI A;  2KT8 A;  2K6D A;  2YDL A;  1K4U S;  2CSI A;  1X2Q A;  2C0T A;  2DF6 A;  1GFC A;  4HVU A;  2O2O A;  2HCK A;  1NEB A;  1SRL A;  1WYX A;  2NWM A;  3O5Z A;  1PRL C;  4RUG A;  4RTU A;  2BZX A;  3EG1 A;  3M0Q A;  2LNH B;  2C0O A;  4CC3 A;  2A36 A;  1UGV A;  1CKA A;  1SPK A;  1YCS B;  2LQN A;  1YNZ A;  1GBR A;  4JPB W;  2J7I A;  1UJY A;  1G83 A;  4F14 A;  1W6X A;  1QKX A;  4LN2 A;  2CT3 A;  1WLP B;  1ABO A;  1X2K A;  3VS5 A;  5IHK A;  2V1R A;  4IIO A;  2CSQ A;  2RN8 A;  3NHN A;  1M27 C;  3H0I A;  1AZE A;  1K0S A;  1SEM A;  2EGE A;  1OOT A;  2D0N A;  3QWX X;  2LCS A;  1GRI A;  2VKN A;  1RUW A;  2EVR A;  2DMO A;  4DEX A;  4KRT A;  3NGP A;  2EGA A;  4OMO A;  3VS0 A;  2ROL A;  3U23 A;  2EYW A;  1WXU A;  2DJQ A;  2JS2 A;  1ZUK A;  2ED0 A;  1B3Q A;  1W70 A;  2HBW A;  3C0C A;  5L23 A;  2LJ0 A;  2CH4 A;  3VS3 A;  5I22 A;  2GBQ A;  2G6F X;  4HCK A;  2KGT A;  2J06 A;  2DL8 A;  2I0N A;  2L3Q A;  4J9F A;  3UA6 A;  2EPD A;  1NLO C;  1T0J A;  2M0Y A;  2OAW A;  4RTV A;  3ULR B;  1LCK A;  1PRM C;  1QLY A;  2SRC A;  2X3W D;  4J9H A;  2FRY A;  2YUO A;  1T0H A;  3ZL7 C;  3THK A;  2A37 A;  4DEY A;  2K9G A;  3VRZ A;  1ZBJ A;  1UJ0 A;  2F2W A;  1M3B A;  3UAT A;  1GL5 A;  1UE9 A;  3EHQ A;  2EKH A;  4CC7 A;  2DL4 A;  5EC7 A;  4Z89 A;  4LE9 A;  3TVT A;  1GFD A;  1K0X A;  2JM9 A;  1H3H A;  3IQL A;  2L2P A;  1JO8 A;  1FMK A;  2FPD A;  1B07 A;  1KIK A;  2FPE A;  1GCP A;  1VYU A;  2DM1 A;  1I07 A;  2MCN A;  2RMO A;  1ARK A;  1AEY A;  3KFV A;  3EG0 A;  2YT6 A;  2J6K A;  1PWT A;  1I1J A;  1X27 A;  1M3A A;  2CUD A;  1WX6 A;  2CH4 W;  5I11 A;  4AG1 C;  1Z9Q A;  1VA7 A;  4QT7 A;  2FRW A;  2W0Z A;  2JMA A;  2CDT A;  1EFN A;  2VVK A;  2PTK A;  1J3T A;  4JJB A;  1G2B A;  1Y0M A;  2IIM A;  1PKS A;  2OI3 A;  2NUZ A;  1ZUY A;  2RNA A;  2KNB B;  1PKT A;  1W1F A;  2HEQ A;  4RTW A;  3EG2 A;  1M8M A;  1AWX A;  1GCQ A;  2KT1 A;  1M30 A;  4J9D A;  5GJW B;  3I35 A;  1BB9 A;  1K1Z A;  2QDL A;  4J9C A;  2DBK A;  2XMF A;  4R0K A;  2CUB A;  3UA7 A;  1KFZ A;  2LJ3 A;  2O88 A;  3I9Q A;  1CKB A;  2K79 A;  3NMZ C;  2JTE A;  4Z8A A;  2ROT A;  4AFQ C;  1YWO A;  2E5K A;  2KYB A;  2JW4 A;  2H8H A;  2DL7 A;  4K11 A;  4FSS A;  4M4Z A;  4ZNX A;  2EQI A;  4J9E A;  1ZLM A;  2DVJ A;  1X6G A;  2OJ2 A;  2RQR A;  2AK5 A;  2HDA A;  1TUC A;  2RQW A;  2YUN A;  2L3P A;  1GBQ A;  2A08 A;  2GQI A;  2VWF A;  4F16 A;  1NM7 A;  2M51 A;  1OPK A;  1E7O A;  3I5R A;  3R6N A;  1ZUU A;  1JXO A;  2K7A A;  4J9B A;  1QKW A;  3QWY A;  4OMP A;  1HD3 A;  2JMC A;  2JXB A;  1BU1 A;  1OV3 A;  1QWF A;  1TG0 A;  3M0R A;  2BTT A;  2K3B A;  1XOV A;  3REA B;  2MOX A;  1YP5 A;  3RNJ A;  1JEG A;  1V1C A;  4CC4 B;  4JJC A;  2EGC A;  2KRS A;  4X1V A;  2KXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...