2JXBA

Structure of cd3epsilon-nck2 first sh3 domain complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
86
structure length
86
Chain Sequence
HMKERPPPVPNPDYNSLKKGSLVKNLHMTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein complex
molecule keywords T-cell surface glycoprotein CD3 epsilon chain, Cytoplasmic p
publication title Structural and functional evidence that Nck interaction with CD3epsilon regulates T-cell receptor activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jxbA00
1AOJA 2RQTA 4KRTA 2VKNA 4AG2C 1AWWA 3VS7A 1OOTA 3RNJA 2SRCA 2E5KA 1CKAA 4J9EA 1AEYA 1Z9QA 2RQVA 2YSQA 3TSZA 5FW9A 2EGEA 1VYVA 1YN8A 2YUQA 1HSQA 3JV3A 1B3QA 1ABQA 4HXJA 3GBQA 2LJ1A 2DVJA 3O5ZA 1JEGA 1UJ0A 1W70A 3REBB 2ABLA 3VS2A 1U3OA 2GTOA 1WXBA 1VYUA 3IQLA 2CT3A 1UHFA 4E6RA 2LJ3A 4JPBW 1QKWA 1JQQA 1UDLA 1YWPA 2JTEA 2NWMA 1KFZA 1JU5C 1Y57A 3CQTA 2EW3A 1JXMA 2KYBA 2LX7A 4JZ3A 1M3AA 2LP5A 1YNZA 2PTKA 1IO6A 2J06A 2M51A 2VVKA 2ROLA 2DNUA 4F14A 2YUOA 1OV3A 3LH5A 3PVLA 2A28A 2DRKA 1QWFA 2F2WA 2JS2A 2KXDA 2D8HA 1NM7A 1SPKA 2P4RA 1B07A 2G6FX 4M4ZA 1UFFA 2L3SA 4J9HA 5IXFA 2K6DA 2HEQA 2JXBA 1T3LA 1PNJA 4RTTA 1QWEA 1K0XA 2DF6A 1AWXA 2DE0X 1NLOC 3UATA 4LNPA 2L3PA 1T0HA 3EG2A 2CREA 1M30A 1K4US 2CUDA 2DL3A 4K11A 2CSQA 4OMQA 2L3QA 5IHNA 4ORZA 2HDAA 2YUNA 2DBKA 1E6GA 1NEGA 2MOXA 2YDLA 4AG1C 2KE9A 4ZNXA 3U23A 1GFCA 2DM1A 1WFWA 1EFNA 2D1XA 2JM8A 1YCSB 2DL4A 2IIMA 3QWXX 1MV3A 2KXCA 1W1FA 2X3XD 1TUDA 1X43A 4CC7A 1PWTA 1UECA 3H0IA 4ESRA 1Z9ZA 1SEMA 2BZXA 2ED1A 2EYWA 1GBRA 2DX1A 1ARKA 4EIKA 4DEYA 4GBQA 1RLQC 1WDXA 2RPNA 2NUZA 1ZUYA 3VS6A 4J9GA 1AWJA 1CSKA 3M0TA 2KEAA 1H3HA 2L0AA 4LUEA 5EC7A 1TUCA 2CUBA 1BB9A 5GJWB 4J9CA 4LUDA 2RN8A 1FMKA 2EYYA 1UGVA 2KT1A 1U06A 2AKKA 1NEBA 2FRWA 2KROA 1PKTA 1A0NB 4A63B 2JM9A 1WX6A 2EGCA 2AZVA 4Z89A 2AKLA 2K2MA 2PNIA 1M27C 1ZX6A 4IIMA 2W0ZA 3EG3A 1GCQA 2OAWA 1KSWA 1W6XA 2EKHA 2K7AA 2A36A 3M0RA 4RTWA 1SHFA 1BBZA 1GL5A 3I5RA 4D8DA 2K3BA 1GBQA 1ZUUA 2CSIA 4J9IA 4RUGA 1RLPC 2KT8A 3M0QA 1WI7A 2RQRA 1CKBA 1AWOA 1E6HA 4DEXA 4D8KA 1UG1A 3I35A 2DL8A 1HD3A 1AZGB 4LE9A 4R0KA 1OPLA 2YT6A 4GLMA 2B86A 3M0UA 3A98A 5I11A 1UJYA 2GGRA 2RQWA 2DL5A 2GTJA 3ULRB 2J7IA 2GNCA 4HVUA 3UA7A 2LZ6B 1WA7A 4RTUA 3EHQA 3H0HA 4CC4B 2KR3A 3TVTA 5FWBA 2VWFA 1G2BA 2JMCA 2M0YA 2RNAA 2CH4A 2V1QA 1H8KA 2CH4W 4LN2A 1ZUKA 2JW4A 1X2QA 2YUPA 1NYFA 1RUWA 1E7OA 2JMAA 5IHIA 3FJ5A 2ED0A 4X1VA 3H41A 1MV0B 3M0SA 3VRZA 1TG0A 3H0FA 2DYBA 1QLYA 2ECZA 4AFSC 2BTTA 2PZ1A 4RTZA 1X6BA 2BZ8A 2K9GA 3I9QA 3UA6A 2KRNA 3VS1A 4RTVA 5IH2A 4JJDA 4OMNA 1PKSA 1QCFA 4JJBA 1KJWA 4HVWA 2KRSA 1FYNA 1WYXA 1WXTA 3NGPA 2O31A 2K79A 1M3BA 2ESWA 2RMOA 1JXOA 2F2VA 1UHCA 2EYZA 2HBWA 1OPKA 4WCIA 1GCPA 1MUZA 1X2KA 2KNBB 1BK2A 2XMFA 3UF4A 2DBMA 2HSPA 2I0NA 3SEMA 2H8HA 4CC3A 1SRMA 4OMLA 1YWOA 2FPEA 1PRMC 2KRMA 1X6GA 3R6NA 3NHNA 3NMZC 4HVVA 4JZ4A 2LMJA 2GBQA 3C0CA 1VYTA 2HCKA 1AD5A 3PE0A 4F16A 4F17A 2DRMA 1XOVA 4OMPA 2DL7A 2JS0A 5IHKA 1BU1A 2C0IA 1GFDA 3KFVA 1M3CA 4JJCA 2JT4A 3EG0A 2CDTA 4J9DA 1ZBJA 2D0NA 2O9VA 1JO8A 1G83A 2FEIA 2AK5A 1I1JA 2FPDA 2W10A 4OMOA 3ZL7C 2J6FA 3VS5A 2DA9A 1K76A 2OI3A 1WXUA 2MIOA 2BZYA 2L2PA 4RTYA 1PHTA 4AFUC 5IXBA 1LCKA 4OMMA 2MCNA 2KYMA 1NG2A 1X69A 1KIKA 2J6OA 1HJDA 1ABOA 3REAB 5FWCA 5GJVB 4CC2A 2CT4A 2O9SA 1SRLA 1VA7A 2FO0A 3I5SA 2DILA 1M8MA 4J9FA 1SHGA 2F2XA 1S1NA 2FG0A 4FSSA 3VRYA 1I0CA 2J6KA 1AZEA 3EG1A 5ECAA 1U5SA 1H92A 2O88A 1GRIA 5L23A 2V1RA 1N5ZA 2RF0A 4J9BA 5HCKA 1AVZC 3NPFA 2FPFA 1ZSGA 2LJ0A 4RTXA 1NLPC 3PVQA 2AZSA 2EYXA 1OEBA 1PRLC 2ENMA 1YP5A 3M0PA 2FRYA 2A37A 1V1CA 3QWYA 2LCSA 2DMOA 2EBPA 1WLPB 4Y92A 2QDLA 4IIOA 2LQNA 1GCQC 1Y0MA 2A08A 1UE9A 4Z8AA 1WIEA 1QKXA 2DJQA 3VS0A 1ZLMA 2SEMA 2O2OA 3VS3A 5I22A 2KGTA 1X27A 4Z88A 2OJ2A 3SHWA 1SSHA 1UTIA 2ROTA 3THKA 1UUEA 4QT7A 2EGAA 3EGUA 4AFQC 2C0TA 2J05A 1T3SA 3VS4A 1K0SA 3TSWA 1I07A 2GQIA 2D8JA 4AFZC 2EVRA 1RI9A 2LNHB 4HCKA 2C0OA 2X3WD 3EHRA 2RQUA 2EPDA 3RBBB 2EQIA 1K9AA 1NYGA 1T0JA 2DLPA 2KBTA 1K1ZA 2LQWA 1J3TA
chains in the Genus database with same CATH superfamily
2QYZA 2RQTA 1QP2A 2VKNA 1QVFS 3GF5A 2HL3A 4JJNK 3I56A 3NTHA 1AWWA 3HKSA 4M75G 2E5KA 1YFNA 1Z9QA 2RQVA 3TSZA 3MPUB 5J26A 1VQPA 3JCMP 1ZSZC 1ABQA 4BE0A 3ME9A 2LJ1A 2DETA 5CR2A 3O5ZA 3I55A 4E7LA 3REBB 5KYUB 1TOVA 2QDYB 2CP2A 4FYXB 1D1CA 3KBGA 4FT4A 2PU9B 4FM4B 1KFZA 2HD0A 5FU6C 2EW3A 3BY7A 4C92G 1Y7XA 4JZ3A 3OYGA 1M3AA 3CMET 3G71Q 2LP5A 1YNZA 2D9TA 3EG9B 4EMKA 2H3EB 4V2SA 2VVKA 4XAXB 2ROLA 1Q7YU 1VQKA 4C8QC 3EH2A 4QKUA 1GXIE 4M78C 5GAN3 1D09B 4EMHA 3CEYA 2M0OA 1NM7A 1I8FA 2G6FX 1YBYA 4PJJA 3CCUT 4J9HA 1SSFA 4KH0B 2JXBA 1VQ8A 1PNJA 2BE9B 1K0XA 2DF6A 5CQXA 2LX9A 3UATA 4LNPA 3QDRB 4Y91A 2WSFE 3UWNA 2CREA 1K4US 1QVGP 3LWHA 2DL3A 1VQ9T 2EQKA 2NYSA 4A4KA 4GY5A 2A3LA 1D0XA 1NEGA 3VU3C 1VQLA 4B9XA 3A8MB 2RI2A 5C0MA 3LWIA 2KE9A 2L3RA 2X9HA 3U23A 1GFCA 1PSFA 3A8OB 2EWNA 3CBPA 2VGNA 3MKDA 4XTXA 3V8LA 4B9WA 3QWXX 5KYNA 1MV3A 5DY9A 1YHQQ 1NJIR 3OW2S 4LDVA 4J5YA 2QA4Q 2EYWA 2RK2A 4EIKA 3HRUA 2E5QA 2HKQB 3PIPA 4A54A 1KQSP 4M7AG 1ZBXA 3MO8A 1IREB 3RDVA 3M0TA 4N0AA 1H3HA 1Y96A 4MMLA 4OF1A 4BACA 3DB3A 5GJWB 2MPXC 4LUDA 1EIFA 5FU7C 5LJ5j 2KT1A 2AKKA 2K5LA 1W2BA 1PKTA 1A0NB 5CKEA 1KHIA 1VQOA 3MP8A 1WX6A 2JM9A 2AZVA 2R58A 4M75D 2MAMA 1JJ2A 1ZX6A 3HFNA 2W0ZA 2V8JA 5C6SA 2QK0A 2QEXT 1GCQA 1TUGB 3CCQQ 3QUIA 2COWA 8ATCB 5HKCA 2A36A 1YI2A 1GL5A 4IUPA 1TS9A 1KD1R 4J9IA 1Q86R 1VQ4Q 2KT8A 1XTDA 1CKBA 3OS2A 4ME7A 4FYWB 5KYYA 3OYEA 3OYLA 2WSEE 1UG1A 2HAXA 3G4SA 1IGQA 3JCMV 4GLMA 5CO7A 4DBRA 1B34A 3A8LB 1B34B 3ER0A 4F7UF 2GGRA 3CD6A 2L89A 1IXDA 3I56T 2DL5A 2HQXA 2O4XB 4KGZB 3SDZA 3ULRB 1QMCA 2YLCA 3UA7A 1WA7A 1VQPT 3EHQA 4JLGA 5LJ3g 2VWFA 4KUIA 2M0YA 3RIRA 3L42A 3CCEA 4J6YA 1ZA2B 2EQMA 4XU3A 5GAOl 1E7OA 1ZSZA 3X20B 3DKMA 5CK9A 5M9OA 2QTXA 5IHIA 2LT1A 3L2ZA 1YJ9T 3A5ZB 3FC3A 3VRZA 1TG0A 4NL3A 4L59A 2RO0A 4AFSC 5GANg 1X6BA 3UA6A 1SF9A 4JJDA 1S72T 2KK4A 1MHNA 4JJBA 4HVWA 3G71A 5KCHA 1MMNA 3JB9H 3UDCA 2YRVA 3NGPA 3LGLA 4RG8A 2O31A 1YJNT 4TVRA 2F2VA 2DZCA 3CCLQ 4DOVA 3EGDB 1PD0A 2XMFA 2DBMA 5AYFA 4C8QA 2DYIA 2HSPA 5GAMd 4CC3A 4M78A 4OMLA 4BDYA 4C5EA 1WQ7A 2PVOB 2OTJQ 4MMKA 3G1JA 1BCMA 1X6GA 4ZN1A 2LMJA 1Q95G 2QG9B 4M7DG 4A53A 2C0IA 4M7AD 3E2UA 1M3CA 4JJCA 3BDUA 1JO8A 1VQLT 4NL2A 2VC8A 2FPDA 2LDMA 5CCAA 1RI0A 1D3BB 3L2VA 2W10A 4PJNA 2DA9A 2BE7D 1WXUA 2LCLA 2X51A 2BZYA 2L2PA 4RTYA 1PHTA 4M77D 2DAQA 2K3XA 4ANJA 1LCKA 2P0QA 2MCNA 1VQMQ 2KYMA 1U8RA 1N27A 1X69A 1YITA 4E7IA 1KIKA 1M2VB 5FROA 3OYYA 3REAB 3V7CA 2VXFA 2O9SA 2QA4A 1LJOA 1WJRA 3M57A 1OI1A 3N5BB 3FB9A 2ZPEB 3VYGA 3OYFA 3TQ7P 3CMAQ 1D0YA 2V1RA 1OYXA 4Q5WA 1ACMB 3S3OA 4DBHA 3JCMW 2RF0A 2QXFA 5FLXE 1IRXA 3C94A 3NPFA 4PJOD 4JRQA 1JB0E 4RTXA 3PVQA 4E7HA 1YP5A 1VQOT 3HSBA 5GANj 1N9RA 5CIUA 3I55Q 4EPCA 3EAEA 4C92C 4PL6A 1V1CA 5FU7B 1X75C 2DMOA 4PLLA 2DXTA 3JCMg 3JRZA 1V76A 4NOYA 5DLOA 3QYHB 2LQNA 2ZAEA 2A08A 1OULA 2E64A 3VUBA 5HK0A 1JJ2P 1WIEA 4EMGA 2RM4A 3VS0A 2K5IA 4E7SA 1ZLMA 2DTOA 3CCQA 2SEMA 4C0ZA 3VS3A 1M5Q1 5KYWA 5KYWB 4VUBA 1OX8A 4M77F 2DIQA 2P0KA 2OJ2A 4PKCC 1UGSB 1C0MA 1VQKQ 2HMAA 3LYIA 1T3SA 3VS4A 2E65A 2Y4XA 3TSWA 1BI2A 2BKDN 1UB4A 4AFZC 2EVRA 5GMKm 1LVKA 2C0OA 2Y4YA 4LXCA 2LQ8A 3E9FA 3PNWC 1T0JA 1VQ8Q 2CP0A 2KBTA 4KUDK 2PUOB 4AG2C 4DQ2A 5EG2A 3E1SA 4PJMA 2CKKA 4MZMA 4PJOF 2YSQA 1QVGA 3AHUA 2L8DA 2JVVA 1O75A 4C5GA 4KGVB 3E9GA 1UEBA 5GAOp 2ABLA 2R5AA 4PLIA 3VS2A 1WXBA 1VYUA 4X9DA 3OYKA 3IQLA 1QP3A 1UHFA 3P8HA 4E6RA 1JQQA 4L5GA 2JTEA 3G71T 1P92A 3BDLA 1Y57A 3CQTA 1JXMA 1NBEB 2FZGB 4C8QD 4AMCA 1Q82R 4FYYB 2PTKA 3QDFA 4M78D 2J06A 2R57A 3CCSQ 3CCLA 2DNUA 1W2BS 5J3BA 2D6FA 5LJ3e 3LH5A 3P8DA 2A28A 3CC7Q 2JS2A 2EAYA 2ZPBB 4XTUA 2P4RA 1M1KC 2RHYA 5D6XA 3RMQA 1MNEA 2KAFA 4OB1B 4XU0A 2CP6A 1QCOA 1KQ1A 2VUBA 2K6DA 4E7KA 4RTTA 2KQWA 3OSVA 1AWXA 4FW1A 3OA6A 1NLOC 3CXCS 1FX7A 2M16A 2L3PA 3EG2A 4QVCA 3JAME 1QW1A 3V7SA 2QAZA 2XICA 1C1AA 4JRPA 3G6EA 2FZCB 3EFOA 1YJWQ 1YI2Q 1VQ5Q 4F7UG 2PVGB 4ZNXA 4A4GA 1VQMA 2DJZA 3GOXA 1YHQT 4FSXA 1EFNA 2D1XA 1DJ7B 4IURA 4C8QF 2QA4T 4HCCA 2DL4A 2GFAA 2FVUA 3G4SQ 1N8RC 4M78F 1BI1A 2KXCA 1BIBA 2X3XD 1TUDA 4CC7A 1PWTA 1UECA 2QTVA 4XK8E 3H0IA 5GAOr 1C6VX 2HQEA 1Z9ZA 1SEMA 2ED1A 4M75B 2VGMA 3CD6Q 2PVDB 1M90R 1ARKA 1KC8C 1RLQC 3OY9A 3CMAA 2P84A 2ZZDA 2KEAA 2EQUA 1TH7A 4FIBA 4LUEA 3CCEQ 3LLRA 4MZTA 2CZ1B 1BB9A 2KVQG 1UGRB 2RN8A 2EYYA 2L5QA 5FRNA 4M75E 5KYUA 1M9SA 1K9MU 4A4FA 3J80E 2RI3A 4A63B 2EGCA 4C92A 1IHWA 2RHXA 4C92B 2AKLA 1R0CB 2PNIA 2CZ0B 5LJ5g 1M27C 3OW2P 2X35A 1K9MR 4PFZA 1VQ4T 1U1TA 3C95A 3JSCA 2K7AA 3EG9A 3QPHA 4PJLA 4RTWA 1G8XA 1KG1A 3I5RA 5GMKe 2ATCB 5CKBA 4KH1B 2KY9A 2JTMA 4RUGA 1YIJA 1NPPA 3NTKA 4C92E 5IT9E 5I2SA 4DEXA 4M7DC 2DL8A 1AZGB 2V26A 3C4SA 2GF7A 4LE9A 2RK1A 1OPLA 1WPYA 3FIFA 3GNGA 1LOJA 1UJYA 2MMPA 2RQWA 1Q7YR 2GTJA 4LDYA 4QVZA 2QQSA 4HVUA 3JCMe 2VB6A 5GAMf 3V8KA 2RNAA 2V1QA 1H8KA 1ZUKA 3V8JA 4GLKA 3M4GA 2XG8D 1LNXA 3L2WA 1RAIB 2PUKB 3QHSA 4E7ZA 1MMDA 3H41A 1PSEA 1QLYA 2AIRB 5CKFA 2H3JA 3M59A 3M54A 2DEQA 2PZ1A 2BZ8A 2K9GA 3I9QA 2KRNA 1M1KU 3M4YA 5LJ3f 3VS1A 3TU4K 2Y90A 4KBMB 1YITQ 3C12A 1PKSA 4XTVA 3CCLT 2FB7A 4LDWA 4E2FB 1FYNA 2FZKB 2LT4A 1WXTA 4M7AB 4MDXA 3CCSA 1JXOA 1IGUA 2XK0A 1OPKA 1GCPA 3JCMc 3CC7A 1BK2A 2DFUA 5D6WA 2OTJT 3BE3A 2WACA 2E10A 1HYOA 3JCMQ 1R8OB 3S3NA 2CP3A 3NHNA 3A1PA 3S6WA 4HVVA 4JZ4A 4M7AE 1FWZA 1VYTA 3PE0A 1AD5A 2HBPA 3V7RA 4F17A 2COYA 4M77G 3OSSC 2C06A 2DL7A 3RESA 2RHZA 5GAMh 4KT0E 1FXXA 1GFDA 1QQJA 3EG0A 2CDTA 1B7TA 2CP7A 2D0NA 3VJPA 1N8RU 2ZPGB 5GAOq 5LL6S 3VS5A 3CCRA 5AT1B 1YJWA 1K76A 1VQ5A 3X24B 5A2QE 1RL2A 3RKWA 3CPFA 2RJDA 4OMMA 1N8RR 2E6NA 3M53A 5LJ3h 1BYMA 2LTOA 4OB3B 4QW2A 2QGFB 5A0GA 1QVGS 2LC4A 1WHKA 4PJOG 5KH6A 3QIIA 5GJVB 3CCMA 1SRLA 4RCCA 2DILA 3CC4A 3CMAT 2ZPIB 1I5LA 2O4XA 2XDDA 3OYIA 1R77A 2FG0A 3VRYA 4BD3A 3HTRA 2V8KA 1AZEA 3WXMB 1H92A 1GRIA 5L23A 3QJYA 2V8IA 3RKYA 2Z0WA 3I55T 4J9BA 4ZGJB 1U1SA 4E47A 3PMIA 1AVZC 2QQRA 3EGXA 3EGXB 1M1GA 2AZSA 4C5IA 1OEBA 1PRLC 3M0PA 1Y07A 3P8BB 3PMTA 2FYKA 3DLMA 5CVIA 4FYVB 2LCSA 3OS5A 1WLPB 1BIAA 4ZGEB 3SWNC 1KQSS 1UE9A 4Z8AA 2VASA 4IUTA 3QZ5B 3CBMA 1VQKT 2CGHA 3QYGB 1X27A 3VYHB 1QVFA 4ZN3A 2DO3A 3OYMA 2LVMA 1SSHA 1UTIA 2ROTA 3EGDA 4QT7A 2HL5C 2QGGA 3FLGA 2EGAA 3JCMf 4AFQC 2JUFA 2IVWA 1K8AC 5IN1A 3QZ9B 1VQ8T 4M7DA 4M7DB 5GAN4 2RQUA 1TWBA 3RBBB 2RHUA 1D1AA 1NYGA 4FW2A 2QASA 2DLPA 1J3TA 1AOJA 1XJWB 2CZ6B 2RB6A 4KRTA 3SB2A 2OTLA 2K2VA 3VS7A 3RNJA 3H8ZA 1CKAA 4J9EA 5LJ5e 1AEYA 2DKGA 3QKJA 3L1AA 5FW9A 2EGEA 3CCJA 1HSQA 3JV3A 3HPWA 3M58A 5LJ3d 4HXJA 3GBQA 4M7DE 2HSEB 4C8QG 2DVJA 5GAOm 1JEGA 1D3BA 3JB9I 4M78G 4E7JA 2E4HA 3G6EQ 2X4JA 1U3OA 3OB9A 1W4SA 2CT3A 5GMKh 1QKWA 4WTOB 5GAN5 4MZPA 2F5KA 2NWMA 1WGSA 3DLLA 1JU5C 4CRIA 1M2VA 5CKDA 1RAFB 3CCST 4M75C 3MEAA 4HT8A 1IO6A 3CC7T 1MGQA 4ZGDB 4F14A 4XU2A 2YUOA 1OV3A 3PVLA 2DRKA 3HRTA 1QWFA 3JCMh 2D8HA 1MNDA 1SPKA 3S3MA 3TREA 2NUTA 4M4ZA 2NUTB 5FRMA 2L3SA 3L2QA 5IXFA 2RA2A 5KCOA 4R56A 3HFOA 1T3LA 4C5HA 2ZPFB 2EIFA 7AT1B 3JB9F 1M30A 2JZ2A 2IG0A 2CUDA 3OYBA 3OW2A 4K11A 2CSQA 2L3QA 1WQWA 2VXEA 3A8GB 1VQ5T 1YJWT 1YI2T 4ORZA 1RAHB 1TU0B 2DBKA 2CYZB 2MK5A 2YDLA 3X25B 4D6WA 4AG1C 3MEVA 3G4ST 1WJSA 2RJEA 1QCNA 3M5AA 3CCVQ 1YIJQ 3GPLA 2DM1A 1WFWA 2DVEA 4BI8B 4RMOA 1VQ7Q 4FT2A 2DXUA 3CD6T 2MF2A 2IIMA 3LH0A 2YHTA 1NZ9A 3M55A 3CXCP 4HT9A 2AHJB 3CMEA 2E3IA 3PT9A 1WDXA 3CPWP 2RPNA 1NPRA 3CCET 1WHGA 1ZUYA 1AWJA 1CSKA 3X28B 4PFPA 5HY6A 3E19A 4OVAA 5EC7A 1HK9A 5I2MA 1TUCA 1FMKA 3D7SB 1UGVA 4JRIA 1U06A 1NEBA 3CCUA 2FRWA 5CQYA 1Y71A 1ZA1B 2M02A 2P4TA 1VOMA 2RJCA 4Z89A 4ELYC 2K2MA 5GMKi 3A8HB 1OX9A 3JCMd 1K8AU 2F1LA 1PCXA 3EG3A 1KK7A 3SWNA 3SWNB 4M7AC 2OAWA 3QXEB 4PFOA 3HP9A 1VQ9A 1JBMA 4LDXA 3M0RA 1BBZA 2E3HA 1QVFP 2K3BA 1GBQA 1ZUUA 2CSIA 1K8AR 2RQRA 1AWOA 1E6HA 3CC2Q 1HD3A 4M77C 4R0KA 5LJ5f 3ASKA 2YT6A 4C0GA 1JJ2S 2B86A 3FRNA 3OMCA 3RR6A 5I11A 1TTHB 1NJIC 4XQ3A 4IKFA 3OMGA 3JCMJ 4RTUA 3H0HA 3TVTA 1BCOA 3QG1A 5FWBA 5GANe 2WSCE 3OS1A 3FDRA 1G2BA 2JMCA 5GAN6 1G3YA 3J81E 1X2QA 2HZYA 4C0FA 4F7UB 1NYFA 4IUQA 2QQAA 3Q1JA 2E6ZA 2AT1B 4PJOC 4X1VA 3CCRQ 1MV0B 1D0ZA 1YITT 4JS5A 2BTTA 2RD1A 4RTZA 4NS5A 3X26B 4RTVA 2JN0A 4OMNA 4MDWA 1X01A 4F7UE 4X9CA 2KRSA 1VQNQ 1WYXA 3CCMQ 2JTFA 4M75A 1FMVA 2K79A 3CC4Q 4BE2A 1M3BA 2RMOA 2LCCA 1UHCA 4X34A 2HBWA 4WCIA 3GNFB 4ZTJA 2ZGWA 1MUZA 2XHCA 2EJ9A 1KD1C 1Q86C 2I0NA 3SEMA 2H8HA 4BE1A 1SRMA 4B6MA 4J6WA 5LJ5h 1VIFA 2VYTA 1MMAA 4J7IA 2XIDA 2HNIA 3C0CA 1N9SA 3UT1A 4F16A 2EFIA 2K5FA 2PQWA 3MCAB 5DM7R 1XOVA 4OMPA 2JS0A 5IHKA 2FL7A 1BU1A 2QI2A 4A4HA 2D0QB 4J83A 3CCQT 1M2OA 1G83A 3HRSA 3ZBDA 2FEIA 2AK5A 2DXCA 1K73C 4O5VA 4PK4A 3NFCA 3URGA 2HKNA 4RG2A 1Q81C 2BIVA 5IXBA 3CCVA 1YJ9A 3EFSA 2F5TX 4XU1A 1VQ7A 1ZHIA 2M9UA 2GFUA 4FL6A 2X4XA 2J6OA 5KYXA 5KYXB 2JOYA 5FWCA 4CC2A 2DERA 2CT4A 2YWWA 4OMFB 3NTIA 3I5SA 1S72A 4EMKB 4J9FA 3OYDA 1SHGA 1S1NA 4FSSA 1I0CA 4KGXB 3KUFA 1PD1A 3OYAA 1YJNA 2OTLQ 1U5SA 4KULA 4YTLA 2O88A 4IUUA 2F69A 2EQJA 1N5ZA 3CCJQ 3MHXA 5HCKA 2FPFA 1NLPC 1VQ6Q 3MP1A 2ENMA 2A37A 2MWPA 3L2UA 2EBPA 2KDSA 2QDLA 1BKBA 4IIOA 4JLIA 3VV0A 1IB8A 1Y0MA 1QKXA 2DJQA 1H3ZA 4Y28E 3M9QA 3FEOA 1KHCA 5LJ5d 5I22A 4XTYA 2ZPHB 2KGTA 1NJIU 4M7AA 1WHLA 2KMTA 4Z88A 2E41A 5KE3A 1I5OB 2A7YA 3THKA 1UUEA 1M1KR 1G5VA 1I4K1 1WHHA 3CC2A 2J05A 1R0BG 8AT1B 1K0SA 4N4HA 2A0FB 2GQIA 5GANf 2D8JA 1RI9A 3JB9G 4HCKA 2X3WD 3MJXA 3EHRA 4O6JA 3RKXA 4II1A 4M77A 4M77B 2DD5A 2EQIA 3HL8A 3OYNA 1K1ZA 3OS0A 3LGFA 4WF2A 1FMWA 3ZFJA 4CI0C 1OOTA 4J7FA 1UGPB 2SRCA 1F1BB 1VYVA 1YN8A 1Y96B 2YUQA 1B3QA 3G6ET 2FHDA 3AT1B 9ATCB 2DIGA 4M77E 1UJ0A 1W70A 2EJFA 2GTOA 1VQMT 1KC8U 1D1BA 1N6AA 2LJ3A 3R6OA 4JPBW 4PJOA 4PJOB 1VUBA 5CKHA 1UDLA 1YWPA 1KD1U 4HCBA 1Q86U 3QSUA 2VV5A 1G3TA 5J39A 2YRDA 3VUZA 1TXQA 4OGEA 2XDPA 2YXYA 1OU8A 3UPUA 3CBOA 2KYBA 2LX7A 1VQNA 4BY6B 3MEWA 1KC8R 3CXCA 2M51A 1JRIA 4LD9K 1OQKA 4AT1B 3CPWA 3CMEQ 5GAMg 1PM3A 3H6ZA 3LX7A 2K57A 4PJOE 4DOWA 2F2WA 4QQ6A 5KYYB 2KXDA 4UC4A 1RADB 1B07A 5GANh 1YCYA 1UFFA 1K73U 4C92D 2DZ9A 2GCXA 4P5NA 5A0LA 4BB7A 2HEQA 4OGCA 3SFMA 4ATOA 1QWEA 2E1HA 3CCUQ 4C0DC 2DE0X 1Q81U 3PGGA 5GAN7 1T0HA 1K73R 2X4YA 1XQHA 2DTIA 4OMQA 5IHNA 4J6XA 4JS4A 2HDAA 2YLBA 1ZSZB 1WHMA 1BI3A 2YUNA 1WJQA 3M56A 3GIBA 1Q81R 1ZQ1A 5IAYA 1VQ9Q 1E6GA 3CCVT 1YIJT 2MOXA 3JB9J 4M75F 1VQ7T 1M8VA 4QQGA 3LW5E 4N4GA 2KI7A 1H641 2JM8A 1YCSB 2DK3A 2XD0A 4L6V5 1TSFA 1LPLA 1W1FA 4A4EA 1X43A 2LQKA 5FU6B 4ESRA 2BZXA 4R55A 4HKEA 1GBRA 2DX1A 1Q82C 4DEYA 2YRCA 4GBQA 5A0DA 2NUZA 3O8VA 1M1FA 4DBQA 4C8QB 2XDBA 1UGQB 4J9GA 3VS6A 1WZOA 4C92F 1WNLA 4M78B 2L0AA 2DTHA 2CUBA 1VQ6A 3JB9D 4J9CA 3OBWA 1VIEA 2XKOC 4DA4A 2XU8A 4XTWA 2KROA 2I2LA 4FCYA 3OYCA 5I21A 4OP0A 4IUVA 1EX4A 4BUGA 2RHIA 2K3YA 4C8QE 3PIOA 3OQ5A 4M78E 4IIMA 2MI6A 5GAMj 3J7AF 5GANd 3WVEB 3QO3A 6AT1B 1KSWA 2QQBA 1W6XA 4DBFA 2EKHA 2RH2A 1SHFA 3H9NA 4D8DA 1WHJA 2DD4A 3L2RA 5GAN2 2QEXQ 3CC2T 3BW1A 1RLPC 3M0QA 4HA8A 1WI7A 4D8KA 3HHTB 3I35A 4Z02A 1NE8A 3JCMb 4QVDA 3VKIA 1YHQA 5GMKl 3TCJA 3M0UA 3A98A 5LJ3j 3OYJA 1X6OA 2EKOA 2J7IA 2GNCA 4LD6A 2LZ6B 1PC0A 4CC4B 3I56Q 1M90C 2KR3A 1SG5A 1AT1B 1QVPA 1XNIA 3BFMA 4F04B 2ZCFB 2CH4A 2CH4W 1VQPQ 4LN2A 3TEEA 2JW4A 2YUPA 3CCRT 1IZ6A 2HQHA 4EDUA 1RUWA 2JMAA 3META 5GAOn 3FJ5A 2ED0A 1W2BP 1RABB 4M7AF 3M0SA 3H0FA 2DYBA 2ECZA 4PNOA 4ELZC 3JCMX 1KQ2A 1YJ9Q 3MP6A 2JJ9A 1VQNT 2MYSA 3CCMT 1M4ZA 3RMSA 5IH2A 4ZTFA 3CC4T 2LRQA 4EMKC 1I81A 1QCFA 1KJWA 3PFSA 1K9MC 1S72Q 3T9NA 5D6YA 2ESWA 1OZ2A 2EYZA 1VQ4A 2P0PA 1HXDA 3MEUA 1X2KA 2KNBB 3INZA 1YJNQ 3UF4A 2E12A 4BI4A 4HCZA 4LDUA 3WVDB 1YWOA 2FPEA 3OYHA 5L8RE 1PRMC 2G3RA 2KRMA 3R6NA 2K4YA 3NMZC 2GBQA 2HCKA 2BUDA 1Q7YC 4J8OA 2DRMA 3KXTA 3OBYA 4BI3A 2OAUA 4C0DB 4JRKA 3KFVA 3G7ZA 2JT4A 4J9DA 1ZBJA 2O9VA 2NLUA 2R5MA 1IHVA 3F70A 5HK3A 1I1JA 3PTAA 4OMOA 3ZL7C 2J6FA 2NUPA 1Q82U 2OI3A 2EYQA 2NUPB 2MIOA 5GAMe 1VQLQ 1O9SA 4M7DD 3ZEHA 4AFUC 2KSSA 2DPPB 2JNGA 3SD4A 1NG2A 1G3WA 4JUVA 5DLQE 5GMKj 1HJDA 2O01E 1ABOA 1RAAB 1PG5B 1RAEB 1VA7A 2FO0A 4RCBA 2OTLT 2MWOA 1V29B 2CZ7B 1M8MA 2F2XA 5GAN8 2RJFA 2J6KA 1AHJB 4XTZA 1KQSA 3EG1A 3CCJT 5ECAA 1OU9A 4N0AC 1VQ6T 2M1HA 1RAGB 2LNVA 2OTJA 1ZSGA 2LJ0A 4OB2B 2B8AA 4F7UA 2DXBA 2EYXA 1RACB 5KE2A 2FRYA 1SKUB 3EH1A 2RI5A 3QBYA 3EFRA 1G3SA 3QWYA 1BI0A 1VQOQ 5D7UA 2DEUA 4Y92A 3CPWS 4QQDA 2X4WA 1GCQC 4RKUE 2E70A 4BY6C 3DB4A 4N4IA 1EZZB 2EJGA 4M7DF 2O2OA 4BDZA 2OX7A 3EFOB 3SHWA 4JDSA 2QEXA 3GLXA 3GP8A 1M90U 3RERA 2IPOB 3EGUA 2QQ9A 3FJPA 1OZ3A 2C0TA 2COZA 4FU6A 2CP5A 3QJ6A 1I07A 4OB0B 2GQVA 2LNHB 2CS7A 2EPDA 5CAIA 3RUXA 1K9AA 2XI9A 1MMGA 2LQWA
chains in the Genus database with same CATH topology
1AOJA 2RQTA 4KRTA 2VKNA 4AG2C 1AWWA 3VS7A 1OOTA 3RNJA 2SRCA 2E5KA 1CKAA 4J9EA 1AEYA 1Z9QA 2RQVA 2YSQA 3TSZA 5FW9A 2EGEA 1VYVA 1YN8A 2YUQA 1HSQA 3JV3A 1B3QA 1ABQA 4HXJA 3GBQA 2LJ1A 2DVJA 3O5ZA 1JEGA 1UJ0A 1W70A 3REBB 2ABLA 3VS2A 1U3OA 2GTOA 1WXBA 1VYUA 3IQLA 2CT3A 1UHFA 4E6RA 2LJ3A 4JPBW 1QKWA 1JQQA 1UDLA 1YWPA 2JTEA 2NWMA 1KFZA 1JU5C 1Y57A 3CQTA 2EW3A 1JXMA 2KYBA 2LX7A 4JZ3A 1M3AA 2LP5A 1YNZA 2PTKA 1IO6A 2J06A 2M51A 2VVKA 2ROLA 2DNUA 4F14A 2YUOA 1OV3A 3LH5A 3PVLA 2A28A 2DRKA 1QWFA 2F2WA 2JS2A 2KXDA 2D8HA 1NM7A 1SPKA 2P4RA 1B07A 2G6FX 4M4ZA 1UFFA 2L3SA 4J9HA 5IXFA 2K6DA 2HEQA 2JXBA 1T3LA 1PNJA 4RTTA 1QWEA 1K0XA 2DF6A 1AWXA 2DE0X 1NLOC 3UATA 4LNPA 2L3PA 1T0HA 3EG2A 2CREA 1M30A 1K4US 2CUDA 2DL3A 4K11A 2CSQA 4OMQA 2L3QA 5IHNA 4ORZA 2HDAA 2YUNA 2DBKA 1E6GA 1NEGA 2MOXA 2YDLA 4AG1C 2KE9A 4ZNXA 3U23A 1GFCA 2DM1A 1WFWA 1EFNA 2D1XA 2JM8A 1YCSB 2DL4A 2IIMA 3QWXX 1MV3A 2KXCA 1W1FA 2X3XD 1TUDA 1X43A 4CC7A 1PWTA 1UECA 3H0IA 4ESRA 1Z9ZA 1SEMA 2BZXA 2ED1A 2EYWA 1GBRA 2DX1A 1ARKA 4EIKA 4DEYA 4GBQA 1RLQC 1WDXA 2RPNA 2NUZA 1ZUYA 3VS6A 4J9GA 1AWJA 1CSKA 3M0TA 2KEAA 1H3HA 2L0AA 4LUEA 5EC7A 1TUCA 2CUBA 1BB9A 5GJWB 4J9CA 4LUDA 2RN8A 1FMKA 2EYYA 1UGVA 2KT1A 1U06A 2AKKA 1NEBA 2FRWA 2KROA 1PKTA 1A0NB 4A63B 2JM9A 1WX6A 2EGCA 2AZVA 4Z89A 2AKLA 2K2MA 2PNIA 1M27C 1ZX6A 4IIMA 2W0ZA 3EG3A 1GCQA 2OAWA 1KSWA 1W6XA 2EKHA 2K7AA 2A36A 3M0RA 4RTWA 1SHFA 1BBZA 1GL5A 3I5RA 4D8DA 2K3BA 1GBQA 1ZUUA 2CSIA 4J9IA 4RUGA 1RLPC 2KT8A 3M0QA 1WI7A 2RQRA 1CKBA 1AWOA 1E6HA 4DEXA 4D8KA 1UG1A 3I35A 2DL8A 1HD3A 1AZGB 4LE9A 4R0KA 1OPLA 2YT6A 4GLMA 2B86A 3M0UA 3A98A 5I11A 1UJYA 2GGRA 2RQWA 2DL5A 2GTJA 3ULRB 2J7IA 2GNCA 4HVUA 3UA7A 2LZ6B 1WA7A 4RTUA 3EHQA 3H0HA 4CC4B 2KR3A 3TVTA 5FWBA 2VWFA 1G2BA 2JMCA 2M0YA 2RNAA 2CH4A 2V1QA 1H8KA 2CH4W 4LN2A 1ZUKA 2JW4A 1X2QA 2YUPA 1NYFA 1RUWA 1E7OA 2JMAA 5IHIA 3FJ5A 2ED0A 4X1VA 3H41A 1MV0B 3M0SA 3VRZA 1TG0A 3H0FA 2DYBA 1QLYA 2ECZA 4AFSC 2BTTA 2PZ1A 4RTZA 1X6BA 2BZ8A 2K9GA 3I9QA 3UA6A 2KRNA 3VS1A 4RTVA 5IH2A 4JJDA 4OMNA 1PKSA 1QCFA 4JJBA 1KJWA 4HVWA 2KRSA 1FYNA 1WYXA 1WXTA 3NGPA 2O31A 2K79A 1M3BA 2ESWA 2RMOA 1JXOA 2F2VA 1UHCA 2EYZA 2HBWA 1OPKA 4WCIA 1GCPA 1MUZA 1X2KA 2KNBB 1BK2A 2XMFA 3UF4A 2DBMA 2HSPA 2I0NA 3SEMA 2H8HA 4CC3A 1SRMA 4OMLA 1YWOA 2FPEA 1PRMC 2KRMA 1X6GA 3R6NA 3NHNA 3NMZC 4HVVA 4JZ4A 2LMJA 2GBQA 3C0CA 1VYTA 2HCKA 1AD5A 3PE0A 4F16A 4F17A 2DRMA 1XOVA 4OMPA 2DL7A 2JS0A 5IHKA 1BU1A 2C0IA 1GFDA 3KFVA 1M3CA 4JJCA 2JT4A 3EG0A 2CDTA 4J9DA 1ZBJA 2D0NA 2O9VA 1JO8A 1G83A 2FEIA 2AK5A 1I1JA 2FPDA 2W10A 4OMOA 3ZL7C 2J6FA 3VS5A 2DA9A 1K76A 2OI3A 1WXUA 2MIOA 2BZYA 2L2PA 4RTYA 1PHTA 4AFUC 5IXBA 1LCKA 4OMMA 2MCNA 2KYMA 1NG2A 1X69A 1KIKA 2J6OA 1HJDA 1ABOA 3REAB 5FWCA 5GJVB 4CC2A 2CT4A 2O9SA 1SRLA 1VA7A 2FO0A 3I5SA 2DILA 1M8MA 4J9FA 1SHGA 2F2XA 1S1NA 2FG0A 4FSSA 3VRYA 1I0CA 2J6KA 1AZEA 3EG1A 5ECAA 1U5SA 1H92A 2O88A 1GRIA 5L23A 2V1RA 1N5ZA 2RF0A 4J9BA 5HCKA 1AVZC 3NPFA 2FPFA 1ZSGA 2LJ0A 4RTXA 1NLPC 3PVQA 2AZSA 2EYXA 1OEBA 1PRLC 2ENMA 1YP5A 3M0PA 2FRYA 2A37A 1V1CA 3QWYA 2LCSA 2DMOA 2EBPA 1WLPB 4Y92A 2QDLA 4IIOA 2LQNA 1GCQC 1Y0MA 2A08A 1UE9A 4Z8AA 1WIEA 1QKXA 2DJQA 3VS0A 1ZLMA 2SEMA 2O2OA 3VS3A 5I22A 2KGTA 1X27A 4Z88A 2OJ2A 3SHWA 1SSHA 1UTIA 2ROTA 3THKA 1UUEA 4QT7A 2EGAA 3EGUA 4AFQC 2C0TA 2J05A 1T3SA 3VS4A 1K0SA 3TSWA 1I07A 2GQIA 2D8JA 4AFZC 2EVRA 1RI9A 2LNHB 4HCKA 2C0OA 2X3WD 3EHRA 2RQUA 2EPDA 3RBBB 2EQIA 1K9AA 1NYGA 1T0JA 2DLPA 2KBTA 1K1ZA 2LQWA 1J3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AOJ A;  2RQT A;  4KRT A;  2VKN A;  4AG2 C;  1AWW A;  3VS7 A;  1OOT A;  3RNJ A;  2SRC A;  2E5K A;  1CKA A;  4J9E A;  1AEY A;  1Z9Q A;  2RQV A;  2YSQ A;  3TSZ A;  5FW9 A;  2EGE A;  1VYV A;  1YN8 A;  2YUQ A;  1HSQ A;  3JV3 A;  1B3Q A;  1ABQ A;  4HXJ A;  3GBQ A;  2LJ1 A;  2DVJ A;  3O5Z A;  1JEG A;  1UJ0 A;  1W70 A;  3REB B;  2ABL A;  3VS2 A;  1U3O A;  2GTO A;  1WXB A;  1VYU A;  3IQL A;  2CT3 A;  1UHF A;  4E6R A;  2LJ3 A;  4JPB W;  1QKW A;  1JQQ A;  1UDL A;  1YWP A;  2JTE A;  2NWM A;  1KFZ A;  1JU5 C;  1Y57 A;  3CQT A;  2EW3 A;  1JXM A;  2KYB A;  2LX7 A;  4JZ3 A;  1M3A A;  2LP5 A;  1YNZ A;  2PTK A;  1IO6 A;  2J06 A;  2M51 A;  2VVK A;  2ROL A;  2DNU A;  4F14 A;  2YUO A;  1OV3 A;  3LH5 A;  3PVL A;  2A28 A;  2DRK A;  1QWF A;  2F2W A;  2JS2 A;  2KXD A;  2D8H A;  1NM7 A;  1SPK A;  2P4R A;  1B07 A;  2G6F X;  4M4Z A;  1UFF A;  2L3S A;  4J9H A;  5IXF A;  2K6D A;  2HEQ A;  2JXB A;  1T3L A;  1PNJ A;  4RTT A;  1QWE A;  1K0X A;  2DF6 A;  1AWX A;  2DE0 X;  1NLO C;  3UAT A;  4LNP A;  2L3P A;  1T0H A;  3EG2 A;  2CRE A;  1M30 A;  1K4U S;  2CUD A;  2DL3 A;  4K11 A;  2CSQ A;  4OMQ A;  2L3Q A;  5IHN A;  4ORZ A;  2HDA A;  2YUN A;  2DBK A;  1E6G A;  1NEG A;  2MOX A;  2YDL A;  4AG1 C;  2KE9 A;  4ZNX A;  3U23 A;  1GFC A;  2DM1 A;  1WFW A;  1EFN A;  2D1X A;  2JM8 A;  1YCS B;  2DL4 A;  2IIM A;  3QWX X;  1MV3 A;  2KXC A;  1W1F A;  2X3X D;  1TUD A;  1X43 A;  4CC7 A;  1PWT A;  1UEC A;  3H0I A;  4ESR A;  1Z9Z A;  1SEM A;  2BZX A;  2ED1 A;  2EYW A;  1GBR A;  2DX1 A;  1ARK A;  4EIK A;  4DEY A;  4GBQ A;  1RLQ C;  1WDX A;  2RPN A;  2NUZ A;  1ZUY A;  3VS6 A;  4J9G A;  1AWJ A;  1CSK A;  3M0T A;  2KEA A;  1H3H A;  2L0A A;  4LUE A;  5EC7 A;  1TUC A;  2CUB A;  1BB9 A;  5GJW B;  4J9C A;  4LUD A;  2RN8 A;  1FMK A;  2EYY A;  1UGV A;  2KT1 A;  1U06 A;  2AKK A;  1NEB A;  2FRW A;  2KRO A;  1PKT A;  1A0N B;  4A63 B;  2JM9 A;  1WX6 A;  2EGC A;  2AZV A;  4Z89 A;  2AKL A;  2K2M A;  2PNI A;  1M27 C;  1ZX6 A;  4IIM A;  2W0Z A;  3EG3 A;  1GCQ A;  2OAW A;  1KSW A;  1W6X A;  2EKH A;  2K7A A;  2A36 A;  3M0R A;  4RTW A;  1SHF A;  1BBZ A;  1GL5 A;  3I5R A;  4D8D A;  2K3B A;  1GBQ A;  1ZUU A;  2CSI A;  4J9I A;  4RUG A;  1RLP C;  2KT8 A;  3M0Q A;  1WI7 A;  2RQR A;  1CKB A;  1AWO A;  1E6H A;  4DEX A;  4D8K A;  1UG1 A;  3I35 A;  2DL8 A;  1HD3 A;  1AZG B;  4LE9 A;  4R0K A;  1OPL A;  2YT6 A;  4GLM A;  2B86 A;  3M0U A;  3A98 A;  5I11 A;  1UJY A;  2GGR A;  2RQW A;  2DL5 A;  2GTJ A;  3ULR B;  2J7I A;  2GNC A;  4HVU A;  3UA7 A;  2LZ6 B;  1WA7 A;  4RTU A;  3EHQ A;  3H0H A;  4CC4 B;  2KR3 A;  3TVT A;  5FWB A;  2VWF A;  1G2B A;  2JMC A;  2M0Y A;  2RNA A;  2CH4 A;  2V1Q A;  1H8K A;  2CH4 W;  4LN2 A;  1ZUK A;  2JW4 A;  1X2Q A;  2YUP A;  1NYF A;  1RUW A;  1E7O A;  2JMA A;  5IHI A;  3FJ5 A;  2ED0 A;  4X1V A;  3H41 A;  1MV0 B;  3M0S A;  3VRZ A;  1TG0 A;  3H0F A;  2DYB A;  1QLY A;  2ECZ A;  4AFS C;  2BTT A;  2PZ1 A;  4RTZ A;  1X6B A;  2BZ8 A;  2K9G A;  3I9Q A;  3UA6 A;  2KRN A;  3VS1 A;  4RTV A;  5IH2 A;  4JJD A;  4OMN A;  1PKS A;  1QCF A;  4JJB A;  1KJW A;  4HVW A;  2KRS A;  1FYN A;  1WYX A;  1WXT A;  3NGP A;  2O31 A;  2K79 A;  1M3B A;  2ESW A;  2RMO A;  1JXO A;  2F2V A;  1UHC A;  2EYZ A;  2HBW A;  1OPK A;  4WCI A;  1GCP A;  1MUZ A;  1X2K A;  2KNB B;  1BK2 A;  2XMF A;  3UF4 A;  2DBM A;  2HSP A;  2I0N A;  3SEM A;  2H8H A;  4CC3 A;  1SRM A;  4OML A;  1YWO A;  2FPE A;  1PRM C;  2KRM A;  1X6G A;  3R6N A;  3NHN A;  3NMZ C;  4HVV A;  4JZ4 A;  2LMJ A;  2GBQ A;  3C0C A;  1VYT A;  2HCK A;  1AD5 A;  3PE0 A;  4F16 A;  4F17 A;  2DRM A;  1XOV A;  4OMP A;  2DL7 A;  2JS0 A;  5IHK A;  1BU1 A;  2C0I A;  1GFD A;  3KFV A;  1M3C A;  4JJC A;  2JT4 A;  3EG0 A;  2CDT A;  4J9D A;  1ZBJ A;  2D0N A;  2O9V A;  1JO8 A;  1G83 A;  2FEI A;  2AK5 A;  1I1J A;  2FPD A;  2W10 A;  4OMO A;  3ZL7 C;  2J6F A;  3VS5 A;  2DA9 A;  1K76 A;  2OI3 A;  1WXU A;  2MIO A;  2BZY A;  2L2P A;  4RTY A;  1PHT A;  4AFU C;  5IXB A;  1LCK A;  4OMM A;  2MCN A;  2KYM A;  1NG2 A;  1X69 A;  1KIK A;  2J6O A;  1HJD A;  1ABO A;  3REA B;  5FWC A;  5GJV B;  4CC2 A;  2CT4 A;  2O9S A;  1SRL A;  1VA7 A;  2FO0 A;  3I5S A;  2DIL A;  1M8M A;  4J9F A;  1SHG A;  2F2X A;  1S1N A;  2FG0 A;  4FSS A;  3VRY A;  1I0C A;  2J6K A;  1AZE A;  3EG1 A;  5ECA A;  1U5S A;  1H92 A;  2O88 A;  1GRI A;  5L23 A;  2V1R A;  1N5Z A;  2RF0 A;  4J9B A;  5HCK A;  1AVZ C;  3NPF A;  2FPF A;  1ZSG A;  2LJ0 A;  4RTX A;  1NLP C;  3PVQ A;  2AZS A;  2EYX A;  1OEB A;  1PRL C;  2ENM A;  1YP5 A;  3M0P A;  2FRY A;  2A37 A;  1V1C A;  3QWY A;  2LCS A;  2DMO A;  2EBP A;  1WLP B;  4Y92 A;  2QDL A;  4IIO A;  2LQN A;  1GCQ C;  1Y0M A;  2A08 A;  1UE9 A;  4Z8A A;  1WIE A;  1QKX A;  2DJQ A;  3VS0 A;  1ZLM A;  2SEM A;  2O2O A;  3VS3 A;  5I22 A;  2KGT A;  1X27 A;  4Z88 A;  2OJ2 A;  3SHW A;  1SSH A;  1UTI A;  2ROT A;  3THK A;  1UUE A;  4QT7 A;  2EGA A;  3EGU A;  4AFQ C;  2C0T A;  2J05 A;  1T3S A;  3VS4 A;  1K0S A;  3TSW A;  1I07 A;  2GQI A;  2D8J A;  4AFZ C;  2EVR A;  1RI9 A;  2LNH B;  4HCK A;  2C0O A;  2X3W D;  3EHR A;  2RQU A;  2EPD A;  3RBB B;  2EQI A;  1K9A A;  1NYG A;  1T0J A;  2DLP A;  2KBT A;  1K1Z A;  2LQW A;  1J3T A; 
#chains in the Genus database with same CATH topology
 2QYZ A;  2RQT A;  1QP2 A;  2VKN A;  1QVF S;  3GF5 A;  2HL3 A;  4JJN K;  3I56 A;  3NTH A;  1AWW A;  3HKS A;  4M75 G;  2E5K A;  1YFN A;  1Z9Q A;  2RQV A;  3TSZ A;  3MPU B;  5J26 A;  1VQP A;  3JCM P;  1ZSZ C;  1ABQ A;  4BE0 A;  3ME9 A;  2LJ1 A;  2DET A;  5CR2 A;  3O5Z A;  3I55 A;  4E7L A;  3REB B;  5KYU B;  1TOV A;  2QDY B;  2CP2 A;  4FYX B;  1D1C A;  3KBG A;  4FT4 A;  2PU9 B;  4FM4 B;  1KFZ A;  2HD0 A;  5FU6 C;  2EW3 A;  3BY7 A;  4C92 G;  1Y7X A;  4JZ3 A;  3OYG A;  1M3A A;  3CME T;  3G71 Q;  2LP5 A;  1YNZ A;  2D9T A;  3EG9 B;  4EMK A;  2H3E B;  4V2S A;  2VVK A;  4XAX B;  2ROL A;  1Q7Y U;  1VQK A;  4C8Q C;  3EH2 A;  4QKU A;  1GXI E;  4M78 C;  5GAN 3;  1D09 B;  4EMH A;  3CEY A;  2M0O A;  1NM7 A;  1I8F A;  2G6F X;  1YBY A;  4PJJ A;  3CCU T;  4J9H A;  1SSF A;  4KH0 B;  2JXB A;  1VQ8 A;  1PNJ A;  2BE9 B;  1K0X A;  2DF6 A;  5CQX A;  2LX9 A;  3UAT A;  4LNP A;  3QDR B;  4Y91 A;  2WSF E;  3UWN A;  2CRE A;  1K4U S;  1QVG P;  3LWH A;  2DL3 A;  1VQ9 T;  2EQK A;  2NYS A;  4A4K A;  4GY5 A;  2A3L A;  1D0X A;  1NEG A;  3VU3 C;  1VQL A;  4B9X A;  3A8M B;  2RI2 A;  5C0M A;  3LWI A;  2KE9 A;  2L3R A;  2X9H A;  3U23 A;  1GFC A;  1PSF A;  3A8O B;  2EWN A;  3CBP A;  2VGN A;  3MKD A;  4XTX A;  3V8L A;  4B9W A;  3QWX X;  5KYN A;  1MV3 A;  5DY9 A;  1YHQ Q;  1NJI R;  3OW2 S;  4LDV A;  4J5Y A;  2QA4 Q;  2EYW A;  2RK2 A;  4EIK A;  3HRU A;  2E5Q A;  2HKQ B;  3PIP A;  4A54 A;  1KQS P;  4M7A G;  1ZBX A;  3MO8 A;  1IRE B;  3RDV A;  3M0T A;  4N0A A;  1H3H A;  1Y96 A;  4MML A;  4OF1 A;  4BAC A;  3DB3 A;  5GJW B;  2MPX C;  4LUD A;  1EIF A;  5FU7 C;  5LJ5 j;  2KT1 A;  2AKK A;  2K5L A;  1W2B A;  1PKT A;  1A0N B;  5CKE A;  1KHI A;  1VQO A;  3MP8 A;  1WX6 A;  2JM9 A;  2AZV A;  2R58 A;  4M75 D;  2MAM A;  1JJ2 A;  1ZX6 A;  3HFN A;  2W0Z A;  2V8J A;  5C6S A;  2QK0 A;  2QEX T;  1GCQ A;  1TUG B;  3CCQ Q;  3QUI A;  2COW A;  8ATC B;  5HKC A;  2A36 A;  1YI2 A;  1GL5 A;  4IUP A;  1TS9 A;  1KD1 R;  4J9I A;  1Q86 R;  1VQ4 Q;  2KT8 A;  1XTD A;  1CKB A;  3OS2 A;  4ME7 A;  4FYW B;  5KYY A;  3OYE A;  3OYL A;  2WSE E;  1UG1 A;  2HAX A;  3G4S A;  1IGQ A;  3JCM V;  4GLM A;  5CO7 A;  4DBR A;  1B34 A;  3A8L B;  1B34 B;  3ER0 A;  4F7U F;  2GGR A;  3CD6 A;  2L89 A;  1IXD A;  3I56 T;  2DL5 A;  2HQX A;  2O4X B;  4KGZ B;  3SDZ A;  3ULR B;  1QMC A;  2YLC A;  3UA7 A;  1WA7 A;  1VQP T;  3EHQ A;  4JLG A;  5LJ3 g;  2VWF A;  4KUI A;  2M0Y A;  3RIR A;  3L42 A;  3CCE A;  4J6Y A;  1ZA2 B;  2EQM A;  4XU3 A;  5GAO l;  1E7O A;  1ZSZ A;  3X20 B;  3DKM A;  5CK9 A;  5M9O A;  2QTX A;  5IHI A;  2LT1 A;  3L2Z A;  1YJ9 T;  3A5Z B;  3FC3 A;  3VRZ A;  1TG0 A;  4NL3 A;  4L59 A;  2RO0 A;  4AFS C;  5GAN g;  1X6B A;  3UA6 A;  1SF9 A;  4JJD A;  1S72 T;  2KK4 A;  1MHN A;  4JJB A;  4HVW A;  3G71 A;  5KCH A;  1MMN A;  3JB9 H;  3UDC A;  2YRV A;  3NGP A;  3LGL A;  4RG8 A;  2O31 A;  1YJN T;  4TVR A;  2F2V A;  2DZC A;  3CCL Q;  4DOV A;  3EGD B;  1PD0 A;  2XMF A;  2DBM A;  5AYF A;  4C8Q A;  2DYI A;  2HSP A;  5GAM d;  4CC3 A;  4M78 A;  4OML A;  4BDY A;  4C5E A;  1WQ7 A;  2PVO B;  2OTJ Q;  4MMK A;  3G1J A;  1BCM A;  1X6G A;  4ZN1 A;  2LMJ A;  1Q95 G;  2QG9 B;  4M7D G;  4A53 A;  2C0I A;  4M7A D;  3E2U A;  1M3C A;  4JJC A;  3BDU A;  1JO8 A;  1VQL T;  4NL2 A;  2VC8 A;  2FPD A;  2LDM A;  5CCA A;  1RI0 A;  1D3B B;  3L2V A;  2W10 A;  4PJN A;  2DA9 A;  2BE7 D;  1WXU A;  2LCL A;  2X51 A;  2BZY A;  2L2P A;  4RTY A;  1PHT A;  4M77 D;  2DAQ A;  2K3X A;  4ANJ A;  1LCK A;  2P0Q A;  2MCN A;  1VQM Q;  2KYM A;  1U8R A;  1N27 A;  1X69 A;  1YIT A;  4E7I A;  1KIK A;  1M2V B;  5FRO A;  3OYY A;  3REA B;  3V7C A;  2VXF A;  2O9S A;  2QA4 A;  1LJO A;  1WJR A;  3M57 A;  1OI1 A;  3N5B B;  3FB9 A;  2ZPE B;  3VYG A;  3OYF A;  3TQ7 P;  3CMA Q;  1D0Y A;  2V1R A;  1OYX A;  4Q5W A;  1ACM B;  3S3O A;  4DBH A;  3JCM W;  2RF0 A;  2QXF A;  5FLX E;  1IRX A;  3C94 A;  3NPF A;  4PJO D;  4JRQ A;  1JB0 E;  4RTX A;  3PVQ A;  4E7H A;  1YP5 A;  1VQO T;  3HSB A;  5GAN j;  1N9R A;  5CIU A;  3I55 Q;  4EPC A;  3EAE A;  4C92 C;  4PL6 A;  1V1C A;  5FU7 B;  1X75 C;  2DMO A;  4PLL A;  2DXT A;  3JCM g;  3JRZ A;  1V76 A;  4NOY A;  5DLO A;  3QYH B;  2LQN A;  2ZAE A;  2A08 A;  1OUL A;  2E64 A;  3VUB A;  5HK0 A;  1JJ2 P;  1WIE A;  4EMG A;  2RM4 A;  3VS0 A;  2K5I A;  4E7S A;  1ZLM A;  2DTO A;  3CCQ A;  2SEM A;  4C0Z A;  3VS3 A;  1M5Q 1;  5KYW A;  5KYW B;  4VUB A;  1OX8 A;  4M77 F;  2DIQ A;  2P0K A;  2OJ2 A;  4PKC C;  1UGS B;  1C0M A;  1VQK Q;  2HMA A;  3LYI A;  1T3S A;  3VS4 A;  2E65 A;  2Y4X A;  3TSW A;  1BI2 A;  2BKD N;  1UB4 A;  4AFZ C;  2EVR A;  5GMK m;  1LVK A;  2C0O A;  2Y4Y A;  4LXC A;  2LQ8 A;  3E9F A;  3PNW C;  1T0J A;  1VQ8 Q;  2CP0 A;  2KBT A;  4KUD K;  2PUO B;  4AG2 C;  4DQ2 A;  5EG2 A;  3E1S A;  4PJM A;  2CKK A;  4MZM A;  4PJO F;  2YSQ A;  1QVG A;  3AHU A;  2L8D A;  2JVV A;  1O75 A;  4C5G A;  4KGV B;  3E9G A;  1UEB A;  5GAO p;  2ABL A;  2R5A A;  4PLI A;  3VS2 A;  1WXB A;  1VYU A;  4X9D A;  3OYK A;  3IQL A;  1QP3 A;  1UHF A;  3P8H A;  4E6R A;  1JQQ A;  4L5G A;  2JTE A;  3G71 T;  1P92 A;  3BDL A;  1Y57 A;  3CQT A;  1JXM A;  1NBE B;  2FZG B;  4C8Q D;  4AMC A;  1Q82 R;  4FYY B;  2PTK A;  3QDF A;  4M78 D;  2J06 A;  2R57 A;  3CCS Q;  3CCL A;  2DNU A;  1W2B S;  5J3B A;  2D6F A;  5LJ3 e;  3LH5 A;  3P8D A;  2A28 A;  3CC7 Q;  2JS2 A;  2EAY A;  2ZPB B;  4XTU A;  2P4R A;  1M1K C;  2RHY A;  5D6X A;  3RMQ A;  1MNE A;  2KAF A;  4OB1 B;  4XU0 A;  2CP6 A;  1QCO A;  1KQ1 A;  2VUB A;  2K6D A;  4E7K A;  4RTT A;  2KQW A;  3OSV A;  1AWX A;  4FW1 A;  3OA6 A;  1NLO C;  3CXC S;  1FX7 A;  2M16 A;  2L3P A;  3EG2 A;  4QVC A;  3JAM E;  1QW1 A;  3V7S A;  2QAZ A;  2XIC A;  1C1A A;  4JRP A;  3G6E A;  2FZC B;  3EFO A;  1YJW Q;  1YI2 Q;  1VQ5 Q;  4F7U G;  2PVG B;  4ZNX A;  4A4G A;  1VQM A;  2DJZ A;  3GOX A;  1YHQ T;  4FSX A;  1EFN A;  2D1X A;  1DJ7 B;  4IUR A;  4C8Q F;  2QA4 T;  4HCC A;  2DL4 A;  2GFA A;  2FVU A;  3G4S Q;  1N8R C;  4M78 F;  1BI1 A;  2KXC A;  1BIB A;  2X3X D;  1TUD A;  4CC7 A;  1PWT A;  1UEC A;  2QTV A;  4XK8 E;  3H0I A;  5GAO r;  1C6V X;  2HQE A;  1Z9Z A;  1SEM A;  2ED1 A;  4M75 B;  2VGM A;  3CD6 Q;  2PVD B;  1M90 R;  1ARK A;  1KC8 C;  1RLQ C;  3OY9 A;  3CMA A;  2P84 A;  2ZZD A;  2KEA A;  2EQU A;  1TH7 A;  4FIB A;  4LUE A;  3CCE Q;  3LLR A;  4MZT A;  2CZ1 B;  1BB9 A;  2KVQ G;  1UGR B;  2RN8 A;  2EYY A;  2L5Q A;  5FRN A;  4M75 E;  5KYU A;  1M9S A;  1K9M U;  4A4F A;  3J80 E;  2RI3 A;  4A63 B;  2EGC A;  4C92 A;  1IHW A;  2RHX A;  4C92 B;  2AKL A;  1R0C B;  2PNI A;  2CZ0 B;  5LJ5 g;  1M27 C;  3OW2 P;  2X35 A;  1K9M R;  4PFZ A;  1VQ4 T;  1U1T A;  3C95 A;  3JSC A;  2K7A A;  3EG9 A;  3QPH A;  4PJL A;  4RTW A;  1G8X A;  1KG1 A;  3I5R A;  5GMK e;  2ATC B;  5CKB A;  4KH1 B;  2KY9 A;  2JTM A;  4RUG A;  1YIJ A;  1NPP A;  3NTK A;  4C92 E;  5IT9 E;  5I2S A;  4DEX A;  4M7D C;  2DL8 A;  1AZG B;  2V26 A;  3C4S A;  2GF7 A;  4LE9 A;  2RK1 A;  1OPL A;  1WPY A;  3FIF A;  3GNG A;  1LOJ A;  1UJY A;  2MMP A;  2RQW A;  1Q7Y R;  2GTJ A;  4LDY A;  4QVZ A;  2QQS A;  4HVU A;  3JCM e;  2VB6 A;  5GAM f;  3V8K A;  2RNA A;  2V1Q A;  1H8K A;  1ZUK A;  3V8J A;  4GLK A;  3M4G A;  2XG8 D;  1LNX A;  3L2W A;  1RAI B;  2PUK B;  3QHS A;  4E7Z A;  1MMD A;  3H41 A;  1PSE A;  1QLY A;  2AIR B;  5CKF A;  2H3J A;  3M59 A;  3M54 A;  2DEQ A;  2PZ1 A;  2BZ8 A;  2K9G A;  3I9Q A;  2KRN A;  1M1K U;  3M4Y A;  5LJ3 f;  3VS1 A;  3TU4 K;  2Y90 A;  4KBM B;  1YIT Q;  3C12 A;  1PKS A;  4XTV A;  3CCL T;  2FB7 A;  4LDW A;  4E2F B;  1FYN A;  2FZK B;  2LT4 A;  1WXT A;  4M7A B;  4MDX A;  3CCS A;  1JXO A;  1IGU A;  2XK0 A;  1OPK A;  1GCP A;  3JCM c;  3CC7 A;  1BK2 A;  2DFU A;  5D6W A;  2OTJ T;  3BE3 A;  2WAC A;  2E10 A;  1HYO A;  3JCM Q;  1R8O B;  3S3N A;  2CP3 A;  3NHN A;  3A1P A;  3S6W A;  4HVV A;  4JZ4 A;  4M7A E;  1FWZ A;  1VYT A;  3PE0 A;  1AD5 A;  2HBP A;  3V7R A;  4F17 A;  2COY A;  4M77 G;  3OSS C;  2C06 A;  2DL7 A;  3RES A;  2RHZ A;  5GAM h;  4KT0 E;  1FXX A;  1GFD A;  1QQJ A;  3EG0 A;  2CDT A;  1B7T A;  2CP7 A;  2D0N A;  3VJP A;  1N8R U;  2ZPG B;  5GAO q;  5LL6 S;  3VS5 A;  3CCR A;  5AT1 B;  1YJW A;  1K76 A;  1VQ5 A;  3X24 B;  5A2Q E;  1RL2 A;  3RKW A;  3CPF A;  2RJD A;  4OMM A;  1N8R R;  2E6N A;  3M53 A;  5LJ3 h;  1BYM A;  2LTO A;  4OB3 B;  4QW2 A;  2QGF B;  5A0G A;  1QVG S;  2LC4 A;  1WHK A;  4PJO G;  5KH6 A;  3QII A;  5GJV B;  3CCM A;  1SRL A;  4RCC A;  2DIL A;  3CC4 A;  3CMA T;  2ZPI B;  1I5L A;  2O4X A;  2XDD A;  3OYI A;  1R77 A;  2FG0 A;  3VRY A;  4BD3 A;  3HTR A;  2V8K A;  1AZE A;  3WXM B;  1H92 A;  1GRI A;  5L23 A;  3QJY A;  2V8I A;  3RKY A;  2Z0W A;  3I55 T;  4J9B A;  4ZGJ B;  1U1S A;  4E47 A;  3PMI A;  1AVZ C;  2QQR A;  3EGX A;  3EGX B;  1M1G A;  2AZS A;  4C5I A;  1OEB A;  1PRL C;  3M0P A;  1Y07 A;  3P8B B;  3PMT A;  2FYK A;  3DLM A;  5CVI A;  4FYV B;  2LCS A;  3OS5 A;  1WLP B;  1BIA A;  4ZGE B;  3SWN C;  1KQS S;  1UE9 A;  4Z8A A;  2VAS A;  4IUT A;  3QZ5 B;  3CBM A;  1VQK T;  2CGH A;  3QYG B;  1X27 A;  3VYH B;  1QVF A;  4ZN3 A;  2DO3 A;  3OYM A;  2LVM A;  1SSH A;  1UTI A;  2ROT A;  3EGD A;  4QT7 A;  2HL5 C;  2QGG A;  3FLG A;  2EGA A;  3JCM f;  4AFQ C;  2JUF A;  2IVW A;  1K8A C;  5IN1 A;  3QZ9 B;  1VQ8 T;  4M7D A;  4M7D B;  5GAN 4;  2RQU A;  1TWB A;  3RBB B;  2RHU A;  1D1A A;  1NYG A;  4FW2 A;  2QAS A;  2DLP A;  1J3T A;  1AOJ A;  1XJW B;  2CZ6 B;  2RB6 A;  4KRT A;  3SB2 A;  2OTL A;  2K2V A;  3VS7 A;  3RNJ A;  3H8Z A;  1CKA A;  4J9E A;  5LJ5 e;  1AEY A;  2DKG A;  3QKJ A;  3L1A A;  5FW9 A;  2EGE A;  3CCJ A;  1HSQ A;  3JV3 A;  3HPW A;  3M58 A;  5LJ3 d;  4HXJ A;  3GBQ A;  4M7D E;  2HSE B;  4C8Q G;  2DVJ A;  5GAO m;  1JEG A;  1D3B A;  3JB9 I;  4M78 G;  4E7J A;  2E4H A;  3G6E Q;  2X4J A;  1U3O A;  3OB9 A;  1W4S A;  2CT3 A;  5GMK h;  1QKW A;  4WTO B;  5GAN 5;  4MZP A;  2F5K A;  2NWM A;  1WGS A;  3DLL A;  1JU5 C;  4CRI A;  1M2V A;  5CKD A;  1RAF B;  3CCS T;  4M75 C;  3MEA A;  4HT8 A;  1IO6 A;  3CC7 T;  1MGQ A;  4ZGD B;  4F14 A;  4XU2 A;  2YUO A;  1OV3 A;  3PVL A;  2DRK A;  3HRT A;  1QWF A;  3JCM h;  2D8H A;  1MND A;  1SPK A;  3S3M A;  3TRE A;  2NUT A;  4M4Z A;  2NUT B;  5FRM A;  2L3S A;  3L2Q A;  5IXF A;  2RA2 A;  5KCO A;  4R56 A;  3HFO A;  1T3L A;  4C5H A;  2ZPF B;  2EIF A;  7AT1 B;  3JB9 F;  1M30 A;  2JZ2 A;  2IG0 A;  2CUD A;  3OYB A;  3OW2 A;  4K11 A;  2CSQ A;  2L3Q A;  1WQW A;  2VXE A;  3A8G B;  1VQ5 T;  1YJW T;  1YI2 T;  4ORZ A;  1RAH B;  1TU0 B;  2DBK A;  2CYZ B;  2MK5 A;  2YDL A;  3X25 B;  4D6W A;  4AG1 C;  3MEV A;  3G4S T;  1WJS A;  2RJE A;  1QCN A;  3M5A A;  3CCV Q;  1YIJ Q;  3GPL A;  2DM1 A;  1WFW A;  2DVE A;  4BI8 B;  4RMO A;  1VQ7 Q;  4FT2 A;  2DXU A;  3CD6 T;  2MF2 A;  2IIM A;  3LH0 A;  2YHT A;  1NZ9 A;  3M55 A;  3CXC P;  4HT9 A;  2AHJ B;  3CME A;  2E3I A;  3PT9 A;  1WDX A;  3CPW P;  2RPN A;  1NPR A;  3CCE T;  1WHG A;  1ZUY A;  1AWJ A;  1CSK A;  3X28 B;  4PFP A;  5HY6 A;  3E19 A;  4OVA A;  5EC7 A;  1HK9 A;  5I2M A;  1TUC A;  1FMK A;  3D7S B;  1UGV A;  4JRI A;  1U06 A;  1NEB A;  3CCU A;  2FRW A;  5CQY A;  1Y71 A;  1ZA1 B;  2M02 A;  2P4T A;  1VOM A;  2RJC A;  4Z89 A;  4ELY C;  2K2M A;  5GMK i;  3A8H B;  1OX9 A;  3JCM d;  1K8A U;  2F1L A;  1PCX A;  3EG3 A;  1KK7 A;  3SWN A;  3SWN B;  4M7A C;  2OAW A;  3QXE B;  4PFO A;  3HP9 A;  1VQ9 A;  1JBM A;  4LDX A;  3M0R A;  1BBZ A;  2E3H A;  1QVF P;  2K3B A;  1GBQ A;  1ZUU A;  2CSI A;  1K8A R;  2RQR A;  1AWO A;  1E6H A;  3CC2 Q;  1HD3 A;  4M77 C;  4R0K A;  5LJ5 f;  3ASK A;  2YT6 A;  4C0G A;  1JJ2 S;  2B86 A;  3FRN A;  3OMC A;  3RR6 A;  5I11 A;  1TTH B;  1NJI C;  4XQ3 A;  4IKF A;  3OMG A;  3JCM J;  4RTU A;  3H0H A;  3TVT A;  1BCO A;  3QG1 A;  5FWB A;  5GAN e;  2WSC E;  3OS1 A;  3FDR A;  1G2B A;  2JMC A;  5GAN 6;  1G3Y A;  3J81 E;  1X2Q A;  2HZY A;  4C0F A;  4F7U B;  1NYF A;  4IUQ A;  2QQA A;  3Q1J A;  2E6Z A;  2AT1 B;  4PJO C;  4X1V A;  3CCR Q;  1MV0 B;  1D0Z A;  1YIT T;  4JS5 A;  2BTT A;  2RD1 A;  4RTZ A;  4NS5 A;  3X26 B;  4RTV A;  2JN0 A;  4OMN A;  4MDW A;  1X01 A;  4F7U E;  4X9C A;  2KRS A;  1VQN Q;  1WYX A;  3CCM Q;  2JTF A;  4M75 A;  1FMV A;  2K79 A;  3CC4 Q;  4BE2 A;  1M3B A;  2RMO A;  2LCC A;  1UHC A;  4X34 A;  2HBW A;  4WCI A;  3GNF B;  4ZTJ A;  2ZGW A;  1MUZ A;  2XHC A;  2EJ9 A;  1KD1 C;  1Q86 C;  2I0N A;  3SEM A;  2H8H A;  4BE1 A;  1SRM A;  4B6M A;  4J6W A;  5LJ5 h;  1VIF A;  2VYT A;  1MMA A;  4J7I A;  2XID A;  2HNI A;  3C0C A;  1N9S A;  3UT1 A;  4F16 A;  2EFI A;  2K5F A;  2PQW A;  3MCA B;  5DM7 R;  1XOV A;  4OMP A;  2JS0 A;  5IHK A;  2FL7 A;  1BU1 A;  2QI2 A;  4A4H A;  2D0Q B;  4J83 A;  3CCQ T;  1M2O A;  1G83 A;  3HRS A;  3ZBD A;  2FEI A;  2AK5 A;  2DXC A;  1K73 C;  4O5V A;  4PK4 A;  3NFC A;  3URG A;  2HKN A;  4RG2 A;  1Q81 C;  2BIV A;  5IXB A;  3CCV A;  1YJ9 A;  3EFS A;  2F5T X;  4XU1 A;  1VQ7 A;  1ZHI A;  2M9U A;  2GFU A;  4FL6 A;  2X4X A;  2J6O A;  5KYX A;  5KYX B;  2JOY A;  5FWC A;  4CC2 A;  2DER A;  2CT4 A;  2YWW A;  4OMF B;  3NTI A;  3I5S A;  1S72 A;  4EMK B;  4J9F A;  3OYD A;  1SHG A;  1S1N A;  4FSS A;  1I0C A;  4KGX B;  3KUF A;  1PD1 A;  3OYA A;  1YJN A;  2OTL Q;  1U5S A;  4KUL A;  4YTL A;  2O88 A;  4IUU A;  2F69 A;  2EQJ A;  1N5Z A;  3CCJ Q;  3MHX A;  5HCK A;  2FPF A;  1NLP C;  1VQ6 Q;  3MP1 A;  2ENM A;  2A37 A;  2MWP A;  3L2U A;  2EBP A;  2KDS A;  2QDL A;  1BKB A;  4IIO A;  4JLI A;  3VV0 A;  1IB8 A;  1Y0M A;  1QKX A;  2DJQ A;  1H3Z A;  4Y28 E;  3M9Q A;  3FEO A;  1KHC A;  5LJ5 d;  5I22 A;  4XTY A;  2ZPH B;  2KGT A;  1NJI U;  4M7A A;  1WHL A;  2KMT A;  4Z88 A;  2E41 A;  5KE3 A;  1I5O B;  2A7Y A;  3THK A;  1UUE A;  1M1K R;  1G5V A;  1I4K 1;  1WHH A;  3CC2 A;  2J05 A;  1R0B G;  8AT1 B;  1K0S A;  4N4H A;  2A0F B;  2GQI A;  5GAN f;  2D8J A;  1RI9 A;  3JB9 G;  4HCK A;  2X3W D;  3MJX A;  3EHR A;  4O6J A;  3RKX A;  4II1 A;  4M77 A;  4M77 B;  2DD5 A;  2EQI A;  3HL8 A;  3OYN A;  1K1Z A;  3OS0 A;  3LGF A;  4WF2 A;  1FMW A;  3ZFJ A;  4CI0 C;  1OOT A;  4J7F A;  1UGP B;  2SRC A;  1F1B B;  1VYV A;  1YN8 A;  1Y96 B;  2YUQ A;  1B3Q A;  3G6E T;  2FHD A;  3AT1 B;  9ATC B;  2DIG A;  4M77 E;  1UJ0 A;  1W70 A;  2EJF A;  2GTO A;  1VQM T;  1KC8 U;  1D1B A;  1N6A A;  2LJ3 A;  3R6O A;  4JPB W;  4PJO A;  4PJO B;  1VUB A;  5CKH A;  1UDL A;  1YWP A;  1KD1 U;  4HCB A;  1Q86 U;  3QSU A;  2VV5 A;  1G3T A;  5J39 A;  2YRD A;  3VUZ A;  1TXQ A;  4OGE A;  2XDP A;  2YXY A;  1OU8 A;  3UPU A;  3CBO A;  2KYB A;  2LX7 A;  1VQN A;  4BY6 B;  3MEW A;  1KC8 R;  3CXC A;  2M51 A;  1JRI A;  4LD9 K;  1OQK A;  4AT1 B;  3CPW A;  3CME Q;  5GAM g;  1PM3 A;  3H6Z A;  3LX7 A;  2K57 A;  4PJO E;  4DOW A;  2F2W A;  4QQ6 A;  5KYY B;  2KXD A;  4UC4 A;  1RAD B;  1B07 A;  5GAN h;  1YCY A;  1UFF A;  1K73 U;  4C92 D;  2DZ9 A;  2GCX A;  4P5N A;  5A0L A;  4BB7 A;  2HEQ A;  4OGC A;  3SFM A;  4ATO A;  1QWE A;  2E1H A;  3CCU Q;  4C0D C;  2DE0 X;  1Q81 U;  3PGG A;  5GAN 7;  1T0H A;  1K73 R;  2X4Y A;  1XQH A;  2DTI A;  4OMQ A;  5IHN A;  4J6X A;  4JS4 A;  2HDA A;  2YLB A;  1ZSZ B;  1WHM A;  1BI3 A;  2YUN A;  1WJQ A;  3M56 A;  3GIB A;  1Q81 R;  1ZQ1 A;  5IAY A;  1VQ9 Q;  1E6G A;  3CCV T;  1YIJ T;  2MOX A;  3JB9 J;  4M75 F;  1VQ7 T;  1M8V A;  4QQG A;  3LW5 E;  4N4G A;  2KI7 A;  1H64 1;  2JM8 A;  1YCS B;  2DK3 A;  2XD0 A;  4L6V 5;  1TSF A;  1LPL A;  1W1F A;  4A4E A;  1X43 A;  2LQK A;  5FU6 B;  4ESR A;  2BZX A;  4R55 A;  4HKE A;  1GBR A;  2DX1 A;  1Q82 C;  4DEY A;  2YRC A;  4GBQ A;  5A0D A;  2NUZ A;  3O8V A;  1M1F A;  4DBQ A;  4C8Q B;  2XDB A;  1UGQ B;  4J9G A;  3VS6 A;  1WZO A;  4C92 F;  1WNL A;  4M78 B;  2L0A A;  2DTH A;  2CUB A;  1VQ6 A;  3JB9 D;  4J9C A;  3OBW A;  1VIE A;  2XKO C;  4DA4 A;  2XU8 A;  4XTW A;  2KRO A;  2I2L A;  4FCY A;  3OYC A;  5I21 A;  4OP0 A;  4IUV A;  1EX4 A;  4BUG A;  2RHI A;  2K3Y A;  4C8Q E;  3PIO A;  3OQ5 A;  4M78 E;  4IIM A;  2MI6 A;  5GAM j;  3J7A F;  5GAN d;  3WVE B;  3QO3 A;  6AT1 B;  1KSW A;  2QQB A;  1W6X A;  4DBF A;  2EKH A;  2RH2 A;  1SHF A;  3H9N A;  4D8D A;  1WHJ A;  2DD4 A;  3L2R A;  5GAN 2;  2QEX Q;  3CC2 T;  3BW1 A;  1RLP C;  3M0Q A;  4HA8 A;  1WI7 A;  4D8K A;  3HHT B;  3I35 A;  4Z02 A;  1NE8 A;  3JCM b;  4QVD A;  3VKI A;  1YHQ A;  5GMK l;  3TCJ A;  3M0U A;  3A98 A;  5LJ3 j;  3OYJ A;  1X6O A;  2EKO A;  2J7I A;  2GNC A;  4LD6 A;  2LZ6 B;  1PC0 A;  4CC4 B;  3I56 Q;  1M90 C;  2KR3 A;  1SG5 A;  1AT1 B;  1QVP A;  1XNI A;  3BFM A;  4F04 B;  2ZCF B;  2CH4 A;  2CH4 W;  1VQP Q;  4LN2 A;  3TEE A;  2JW4 A;  2YUP A;  3CCR T;  1IZ6 A;  2HQH A;  4EDU A;  1RUW A;  2JMA A;  3MET A;  5GAO n;  3FJ5 A;  2ED0 A;  1W2B P;  1RAB B;  4M7A F;  3M0S A;  3H0F A;  2DYB A;  2ECZ A;  4PNO A;  4ELZ C;  3JCM X;  1KQ2 A;  1YJ9 Q;  3MP6 A;  2JJ9 A;  1VQN T;  2MYS A;  3CCM T;  1M4Z A;  3RMS A;  5IH2 A;  4ZTF A;  3CC4 T;  2LRQ A;  4EMK C;  1I81 A;  1QCF A;  1KJW A;  3PFS A;  1K9M C;  1S72 Q;  3T9N A;  5D6Y A;  2ESW A;  1OZ2 A;  2EYZ A;  1VQ4 A;  2P0P A;  1HXD A;  3MEU A;  1X2K A;  2KNB B;  3INZ A;  1YJN Q;  3UF4 A;  2E12 A;  4BI4 A;  4HCZ A;  4LDU A;  3WVD B;  1YWO A;  2FPE A;  3OYH A;  5L8R E;  1PRM C;  2G3R A;  2KRM A;  3R6N A;  2K4Y A;  3NMZ C;  2GBQ A;  2HCK A;  2BUD A;  1Q7Y C;  4J8O A;  2DRM A;  3KXT A;  3OBY A;  4BI3 A;  2OAU A;  4C0D B;  4JRK A;  3KFV A;  3G7Z A;  2JT4 A;  4J9D A;  1ZBJ A;  2O9V A;  2NLU A;  2R5M A;  1IHV A;  3F70 A;  5HK3 A;  1I1J A;  3PTA A;  4OMO A;  3ZL7 C;  2J6F A;  2NUP A;  1Q82 U;  2OI3 A;  2EYQ A;  2NUP B;  2MIO A;  5GAM e;  1VQL Q;  1O9S A;  4M7D D;  3ZEH A;  4AFU C;  2KSS A;  2DPP B;  2JNG A;  3SD4 A;  1NG2 A;  1G3W A;  4JUV A;  5DLQ E;  5GMK j;  1HJD A;  2O01 E;  1ABO A;  1RAA B;  1PG5 B;  1RAE B;  1VA7 A;  2FO0 A;  4RCB A;  2OTL T;  2MWO A;  1V29 B;  2CZ7 B;  1M8M A;  2F2X A;  5GAN 8;  2RJF A;  2J6K A;  1AHJ B;  4XTZ A;  1KQS A;  3EG1 A;  3CCJ T;  5ECA A;  1OU9 A;  4N0A C;  1VQ6 T;  2M1H A;  1RAG B;  2LNV A;  2OTJ A;  1ZSG A;  2LJ0 A;  4OB2 B;  2B8A A;  4F7U A;  2DXB A;  2EYX A;  1RAC B;  5KE2 A;  2FRY A;  1SKU B;  3EH1 A;  2RI5 A;  3QBY A;  3EFR A;  1G3S A;  3QWY A;  1BI0 A;  1VQO Q;  5D7U A;  2DEU A;  4Y92 A;  3CPW S;  4QQD A;  2X4W A;  1GCQ C;  4RKU E;  2E70 A;  4BY6 C;  3DB4 A;  4N4I A;  1EZZ B;  2EJG A;  4M7D F;  2O2O A;  4BDZ A;  2OX7 A;  3EFO B;  3SHW A;  4JDS A;  2QEX A;  3GLX A;  3GP8 A;  1M90 U;  3RER A;  2IPO B;  3EGU A;  2QQ9 A;  3FJP A;  1OZ3 A;  2C0T A;  2COZ A;  4FU6 A;  2CP5 A;  3QJ6 A;  1I07 A;  4OB0 B;  2GQV A;  2LNH B;  2CS7 A;  2EPD A;  5CAI A;  3RUX A;  1K9A A;  2XI9 A;  1MMG A;  2LQW A; 
#chains in the Genus database with same CATH homology
 1AOJ A;  2RQT A;  4KRT A;  2VKN A;  4AG2 C;  1AWW A;  3VS7 A;  1OOT A;  3RNJ A;  2SRC A;  2E5K A;  1CKA A;  4J9E A;  1AEY A;  1Z9Q A;  2RQV A;  2YSQ A;  3TSZ A;  5FW9 A;  2EGE A;  1VYV A;  1YN8 A;  2YUQ A;  1HSQ A;  3JV3 A;  1B3Q A;  1ABQ A;  4HXJ A;  3GBQ A;  2LJ1 A;  2DVJ A;  3O5Z A;  1JEG A;  1UJ0 A;  1W70 A;  3REB B;  2ABL A;  3VS2 A;  1U3O A;  2GTO A;  1WXB A;  1VYU A;  3IQL A;  2CT3 A;  1UHF A;  4E6R A;  2LJ3 A;  4JPB W;  1QKW A;  1JQQ A;  1UDL A;  1YWP A;  2JTE A;  2NWM A;  1KFZ A;  1JU5 C;  1Y57 A;  3CQT A;  2EW3 A;  1JXM A;  2KYB A;  2LX7 A;  4JZ3 A;  1M3A A;  2LP5 A;  1YNZ A;  2PTK A;  1IO6 A;  2J06 A;  2M51 A;  2VVK A;  2ROL A;  2DNU A;  4F14 A;  2YUO A;  1OV3 A;  3LH5 A;  3PVL A;  2A28 A;  2DRK A;  1QWF A;  2F2W A;  2JS2 A;  2KXD A;  2D8H A;  1NM7 A;  1SPK A;  2P4R A;  1B07 A;  2G6F X;  4M4Z A;  1UFF A;  2L3S A;  4J9H A;  5IXF A;  2K6D A;  2HEQ A;  2JXB A;  1T3L A;  1PNJ A;  4RTT A;  1QWE A;  1K0X A;  2DF6 A;  1AWX A;  2DE0 X;  1NLO C;  3UAT A;  4LNP A;  2L3P A;  1T0H A;  3EG2 A;  2CRE A;  1M30 A;  1K4U S;  2CUD A;  2DL3 A;  4K11 A;  2CSQ A;  4OMQ A;  2L3Q A;  5IHN A;  4ORZ A;  2HDA A;  2YUN A;  2DBK A;  1E6G A;  1NEG A;  2MOX A;  2YDL A;  4AG1 C;  2KE9 A;  4ZNX A;  3U23 A;  1GFC A;  2DM1 A;  1WFW A;  1EFN A;  2D1X A;  2JM8 A;  1YCS B;  2DL4 A;  2IIM A;  3QWX X;  1MV3 A;  2KXC A;  1W1F A;  2X3X D;  1TUD A;  1X43 A;  4CC7 A;  1PWT A;  1UEC A;  3H0I A;  4ESR A;  1Z9Z A;  1SEM A;  2BZX A;  2ED1 A;  2EYW A;  1GBR A;  2DX1 A;  1ARK A;  4EIK A;  4DEY A;  4GBQ A;  1RLQ C;  1WDX A;  2RPN A;  2NUZ A;  1ZUY A;  3VS6 A;  4J9G A;  1AWJ A;  1CSK A;  3M0T A;  2KEA A;  1H3H A;  2L0A A;  4LUE A;  5EC7 A;  1TUC A;  2CUB A;  1BB9 A;  5GJW B;  4J9C A;  4LUD A;  2RN8 A;  1FMK A;  2EYY A;  1UGV A;  2KT1 A;  1U06 A;  2AKK A;  1NEB A;  2FRW A;  2KRO A;  1PKT A;  1A0N B;  4A63 B;  2JM9 A;  1WX6 A;  2EGC A;  2AZV A;  4Z89 A;  2AKL A;  2K2M A;  2PNI A;  1M27 C;  1ZX6 A;  4IIM A;  2W0Z A;  3EG3 A;  1GCQ A;  2OAW A;  1KSW A;  1W6X A;  2EKH A;  2K7A A;  2A36 A;  3M0R A;  4RTW A;  1SHF A;  1BBZ A;  1GL5 A;  3I5R A;  4D8D A;  2K3B A;  1GBQ A;  1ZUU A;  2CSI A;  4J9I A;  4RUG A;  1RLP C;  2KT8 A;  3M0Q A;  1WI7 A;  2RQR A;  1CKB A;  1AWO A;  1E6H A;  4DEX A;  4D8K A;  1UG1 A;  3I35 A;  2DL8 A;  1HD3 A;  1AZG B;  4LE9 A;  4R0K A;  1OPL A;  2YT6 A;  4GLM A;  2B86 A;  3M0U A;  3A98 A;  5I11 A;  1UJY A;  2GGR A;  2RQW A;  2DL5 A;  2GTJ A;  3ULR B;  2J7I A;  2GNC A;  4HVU A;  3UA7 A;  2LZ6 B;  1WA7 A;  4RTU A;  3EHQ A;  3H0H A;  4CC4 B;  2KR3 A;  3TVT A;  5FWB A;  2VWF A;  1G2B A;  2JMC A;  2M0Y A;  2RNA A;  2CH4 A;  2V1Q A;  1H8K A;  2CH4 W;  4LN2 A;  1ZUK A;  2JW4 A;  1X2Q A;  2YUP A;  1NYF A;  1RUW A;  1E7O A;  2JMA A;  5IHI A;  3FJ5 A;  2ED0 A;  4X1V A;  3H41 A;  1MV0 B;  3M0S A;  3VRZ A;  1TG0 A;  3H0F A;  2DYB A;  1QLY A;  2ECZ A;  4AFS C;  2BTT A;  2PZ1 A;  4RTZ A;  1X6B A;  2BZ8 A;  2K9G A;  3I9Q A;  3UA6 A;  2KRN A;  3VS1 A;  4RTV A;  5IH2 A;  4JJD A;  4OMN A;  1PKS A;  1QCF A;  4JJB A;  1KJW A;  4HVW A;  2KRS A;  1FYN A;  1WYX A;  1WXT A;  3NGP A;  2O31 A;  2K79 A;  1M3B A;  2ESW A;  2RMO A;  1JXO A;  2F2V A;  1UHC A;  2EYZ A;  2HBW A;  1OPK A;  4WCI A;  1GCP A;  1MUZ A;  1X2K A;  2KNB B;  1BK2 A;  2XMF A;  3UF4 A;  2DBM A;  2HSP A;  2I0N A;  3SEM A;  2H8H A;  4CC3 A;  1SRM A;  4OML A;  1YWO A;  2FPE A;  1PRM C;  2KRM A;  1X6G A;  3R6N A;  3NHN A;  3NMZ C;  4HVV A;  4JZ4 A;  2LMJ A;  2GBQ A;  3C0C A;  1VYT A;  2HCK A;  1AD5 A;  3PE0 A;  4F16 A;  4F17 A;  2DRM A;  1XOV A;  4OMP A;  2DL7 A;  2JS0 A;  5IHK A;  1BU1 A;  2C0I A;  1GFD A;  3KFV A;  1M3C A;  4JJC A;  2JT4 A;  3EG0 A;  2CDT A;  4J9D A;  1ZBJ A;  2D0N A;  2O9V A;  1JO8 A;  1G83 A;  2FEI A;  2AK5 A;  1I1J A;  2FPD A;  2W10 A;  4OMO A;  3ZL7 C;  2J6F A;  3VS5 A;  2DA9 A;  1K76 A;  2OI3 A;  1WXU A;  2MIO A;  2BZY A;  2L2P A;  4RTY A;  1PHT A;  4AFU C;  5IXB A;  1LCK A;  4OMM A;  2MCN A;  2KYM A;  1NG2 A;  1X69 A;  1KIK A;  2J6O A;  1HJD A;  1ABO A;  3REA B;  5FWC A;  5GJV B;  4CC2 A;  2CT4 A;  2O9S A;  1SRL A;  1VA7 A;  2FO0 A;  3I5S A;  2DIL A;  1M8M A;  4J9F A;  1SHG A;  2F2X A;  1S1N A;  2FG0 A;  4FSS A;  3VRY A;  1I0C A;  2J6K A;  1AZE A;  3EG1 A;  5ECA A;  1U5S A;  1H92 A;  2O88 A;  1GRI A;  5L23 A;  2V1R A;  1N5Z A;  2RF0 A;  4J9B A;  5HCK A;  1AVZ C;  3NPF A;  2FPF A;  1ZSG A;  2LJ0 A;  4RTX A;  1NLP C;  3PVQ A;  2AZS A;  2EYX A;  1OEB A;  1PRL C;  2ENM A;  1YP5 A;  3M0P A;  2FRY A;  2A37 A;  1V1C A;  3QWY A;  2LCS A;  2DMO A;  2EBP A;  1WLP B;  4Y92 A;  2QDL A;  4IIO A;  2LQN A;  1GCQ C;  1Y0M A;  2A08 A;  1UE9 A;  4Z8A A;  1WIE A;  1QKX A;  2DJQ A;  3VS0 A;  1ZLM A;  2SEM A;  2O2O A;  3VS3 A;  5I22 A;  2KGT A;  1X27 A;  4Z88 A;  2OJ2 A;  3SHW A;  1SSH A;  1UTI A;  2ROT A;  3THK A;  1UUE A;  4QT7 A;  2EGA A;  3EGU A;  4AFQ C;  2C0T A;  2J05 A;  1T3S A;  3VS4 A;  1K0S A;  3TSW A;  1I07 A;  2GQI A;  2D8J A;  4AFZ C;  2EVR A;  1RI9 A;  2LNH B;  4HCK A;  2C0O A;  2X3W D;  3EHR A;  2RQU A;  2EPD A;  3RBB B;  2EQI A;  1K9A A;  1NYG A;  1T0J A;  2DLP A;  2KBT A;  1K1Z A;  2LQW A;  1J3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...