2XG8D

Structural basis of gene regulation by protein pii: the crystal complex of pii and pipx from synechococcus elongatus pcc 7942
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
SENYLNHPTFGLLYQICSFGDSKELFATLYAQRLFFLVAFDARGTRFEPIGRNEARMLVDNRLRQLRRDASLQEYNQLQQVFKQTFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords NITROGEN REGULATORY PROTEIN P-II
publication title Structural Basis for the Regulation of Ntca-Dependent Transcription by Proteins Pipx and Pii.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 20
structure length 87
sequence length 87
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2010-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF12058 DUF3539 Protein of unknown function (DUF3539)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.660 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xg8D01
3N5BB 2XG8D 2XKOC
chains in the Genus database with same CATH superfamily
3Q1JA 2L3SA 3V7CA 2DX1A 1KC8C 3CPWS 2KDSA 3JB9I 1MMAA 4M77F 5GAN4 3C4SA 4J9CA 4V2SA 4M77G 1G5VA 3EGXA 2VUBA 1WA7A 1WGSA 3TREA 1Q95G 3N5BB 2OTJA 1YJNT 2EYXA 1X6GA 2MPXC 5FU7C 4DQ2A 5FWCA 3CMEA 3QWYA 2KBTA 3VS3A 2QG9B 1YI2Q 2HCKA 2VXEA 3OW2A 3CCUA 2IIMA 1XTDA 2YRVA 3CBOA 1G3WA 1PM3A 3NGPA 3SWNA 1OX8A 1UB4A 1MUZA 1M1KU 3WVDB 3TEEA 2O2OA 5KE2A 4AFQC 1UJ0A 1JJ2A 1EFNA 1U1SA 1K73C 1YHQT 2NWMA 3G4SQ 1Q82U 5D7UA 2JXBA 3MEAA 3ZFJA 5KYXB 4ZN3A 3JCMd 1RACB 2LX7A 2RI5A 1QWFA 2LQKA 4KH1B 2OX7A 5LJ5d 1K73R 2J06A 3DKMA 1WDXA 1OOTA 2MOXA 1UTIA 4Q5WA 3MEUA 1GFCA 3OBYA 3I55A 2G6FX 5KYNA 2D8JA 2I0NA 1B34A 2IPOB 3E19A 1YJ9A 4J9EA 5GMKi 5LJ3j 1SHGA 4WCIA 2RK2A 1S72T 1OEBA 5LJ3h 1VQPQ 1YBYA 3NMZC 1D0XA 2HQXA 1XJWB 3NTHA 4GBQA 5L8RE 1MV3A 2X4WA 3G6EQ 3QJ6A 2D0QB 3M55A 2RQRA 1M30A 1WNLA 1YITQ 2JS2A 1VQKT 4FYXB 2EKHA 4RTTA 2DA9A 1WIEA 4BD3A 4E6RA 3MPUB 3EG9B 5J3BA 1OU9A 1R77A 2BUDA 4PJNA 1Q86C 2CYZB 1WHHA 1VYUA 2OJ2A 1OYXA 2FB7A 5CKBA 1UGPB 2RO0A 5IXBA 1QVGS 3VJPA 1ZLMA 4J7IA 4MZMA 3V8JA 4OB0B 4C0DB 1X43A 1Q86R 2DYBA 1FXXA 3QKJA 3JCMV 1OPLA 4DA4A 2DVEA 2M51A 4IIMA 4C8QC 2DZCA 1Y96B 3QJYA 1E6HA 4E47A 1UJYA 1FYNA 2QTXA 2HL5C 2YUNA 2ED1A 5KYYA 2QDLA 2CH4A 1PKTA 3PMTA 1LCKA 4F7UB 2EGCA 2CZ6B 4XU2A 2RJDA 3QBYA 2HAXA 1QP2A 3OYLA 4DBHA 1YJWA 2GNCA 1WHLA 3OSVA 4KUIA 4PJLA 4E2FB 1YCSB 2RD1A 2KYMA 2L5QA 3C0CA 1C0MA 3WVEB 4XK8E 1QLYA 2R5AA 3VUBA 4QKUA 1M3BA 3HHTB 1VQ5Q 3E1SA 5GAOn 1VQOT 1WQ7A 4M7AB 1RAIB 5I2MA 2QDYB 1JO8A 3QIIA 1YWPA 1G8XA 1NZ9A 2HKNA 3TSWA 2PU9B 3TSZA 5I2SA 3H6ZA 4FSXA 4M7AA 1QKWA 4M75D 3VS0A 3OBWA 1PNJA 3CC7A 2GTJA 4KGXB 2MI6A 2D0NA 3T9NA 3OW2S 1M1KC 4N0AA 3CCMQ 2QEXA 4Z89A 3EG1A 4J7FA 3S3OA 5CKEA 4AT1B 2E12A 3ME9A 4RTZA 5I22A 1LOJA 1Q82C 3RERA 3JCMW 5DY9A 1JJ2S 2MIOA 3CC2T 1F1BB 4M7AF 1WI7A 3HL8A 3GIBA 4M7AG 2KK4A 2J7IA 2PTKA 3A5ZB 5FRNA 3X26B 1M3CA 3TQ7P 4CC7A 1UGSB 2PQWA 2V8JA 5FW9A 1Q82R 2EFIA 1QVFA 2M9UA 1K1ZA 1PD0A 4XU0A 5KCOA 1AHJB 2F69A 4LD9K 5GANf 3NPFA 3EFOB 1XNIA 3JCMP 2PNIA 2ATCB 2X3XD 2K79A 3H8ZA 4LNPA 3CMAQ 1VQ6Q 1VQ8Q 1I07A 1IRXA 2PUOB 2EQKA 1PHTA 2O9VA 2DEQA 2DZ9A 3E9FA 1NBEB 3ULRB 2FPDA 1VQLQ 3CCEQ 2ZPHB 1VQMA 2L8DA 4PJOD 2DTIA 4FT2A 2V8KA 4RUGA 1M1FA 1OZ2A 1FMVA 1PRMC 3EHRA 1YIJA 1YI2T 1T0JA 4PFOA 5KYWB 3BFMA 1M2OA 1I81A 3GLXA 3HPWA 4F16A 4D6WA 1M90U 1RI0A 2LT1A 2EWNA 5KYWA 1V1CA 4FU6A 3PIOA 1UGVA 2KY9A 2PUKB 4FSSA 2DIQA 1OULA 4BE0A 3S3NA 2JM8A 3MP8A 1QMCA 4C92C 2L0AA 3MP6A 3REBB 3CCQA 2ZCFB 1UE9A 2LT4A 5GAN2 2QXFA 3JCMb 5HK0A 1VQ7T 1UGQB 1OPKA 4NOYA 2K2MA 4C5EA 5GAOm 1D1CA 2X4JA 3RUXA 4PK4A 1OQKA 1NM7A 4ANJA 3HKSA 3V7RA 3OYGA 2LVMA 2ROTA 2YT6A 1MMGA 3G71Q 2ABLA 4OMMA 4FYVB 3VRZA 1VIFA 2H8HA 2AZVA 4FL6A 2CZ7B 1PG5B 1DJ7B 4XU3A 1UECA 3G1JA 4IIOA 4X1VA 3O5ZA 2VGNA 1VQPT 3M57A 2LMJA 2QQBA 3QDFA 2QGFB 2R5MA 3PIPA 4CC4B 1A0NB 2EQJA 2RQTA 1W4SA 2A36A 4D8DA 3G6ET 3CCRQ 2COWA 5FROA 2JW4A 1YITT 4HVWA 3OYIA 1ZA2B 1KC8U 5LJ3d 2F1LA 1NPRA 3VS6A 7AT1B 2EW3A 4LDXA 3UPUA 5IHKA 1W1FA 2RA2A 2QQRA 1I5LA 1BK2A 2A3LA 3AT1B 2RB6A 3QHSA 3CCSQ 1E7OA 4JPBW 2GFUA 3UA7A 5IHIA 2QQSA 1T3LA 1WYXA 2DXCA 2XK0A 2YRCA 2LX9A 4R0KA 4R56A 4EMKA 2F2WA 4TVRA 2E5KA 3D7SB 1Y0MA 4PJJA 2V1QA 1OI1A 2EAYA 1BI0A 2O9SA 3FLGA 2KRNA 2JVVA 2XDPA 1G83A 3OYAA 3L1AA 1VOMA 1N9SA 2FG0A 3M0UA 4B9WA 3S3MA 5GAOl 4M77E 3KUFA 1FMKA 1VQ9Q 1YHQA 1BIAA 1TH7A 4PJMA 2RQVA 5IN1A 1C6VX 1KQSA 2NUTA 1W6XA 1LVKA 3I56A 1X2QA 2QI2A 1I4K1 1QVFS 5FU6B 4A4HA 1VQNQ 5GAOp 1PSFA 1U1TA 3PFSA 4JZ4A 4FCYA 4KUDK 2FPFA 4JS4A 4JRPA 1WX6A 5EG2A 2FEIA 5IHNA 1VQ5T 4OMLA 1RLQC 1T0HA 4JJNK 2YHTA 1CKBA 5ECAA 1K9MU 3EFSA 3EFRA 4EMKC 2YUOA 4OMPA 2M02A 3JV3A 2KQWA 1RUWA 2K5LA 1M90C 5GANj 2EJ9A 2PVDB 4RCBA 2FVUA 3KXTA 4OB2B 1YNZA 5CQXA 5GANh 3CCMT 2QYZA 2KT1A 1D09B 1M1GA 2JN0A 2YDLA 3OMCA 4E7IA 4HCCA 2RQUA 4P5NA 3M0SA 4A4GA 4RCCA 2K3BA 2OTJQ 1RL2A 4HA8A 1BB9A 2A7YA 4JJBA 3I9QA 2GFAA 1TTHB 3CMEQ 4M7DA 3HFOA 5GAN7 2CP5A 2BTTA 4M78A 2VV5A 3JAME 5FU7B 3CXCA 3CCUQ 2DKGA 3P8DA 2KI7A 2P0KA 3OYYA 2RHXA 1WHJA 3M4GA 4PKCC 3V7SA 1GL5A 2CUDA 2CZ1B 2C0TA 2DM1A 2EGAA 4OGEA 3CMAT 1VQ8T 1RAGB 4HCZA 4M7DG 4OMFB 2A08A 3A98A 5KCHA 2ZAEA 4GLMA 4M78G 1KD1U 1VQLT 3CCET 3JRZA 4ZTJA 2FYKA 4LE9A 2WSFE 3RIRA 1KK7A 3RKXA 2DLPA 2QAZA 3DLMA 1WHKA 4KGZB 5A0GA 3I55Q 3JCMe 3M4YA 1HSQA 1EIFA 2XKOC 1YN8A 4QVZA 5LJ5e 1K8AC 1YJ9Q 1KC8R 1NYFA 3JCMJ 1VQOA 1X2KA 4M7DC 2HMAA 3NTIA 3META 4AFZC 4BY6B 2OTLA 2D8HA 2M1HA 4M78C 3VRYA 3CC4A 4AMCA 4QQ6A 2DXUA 1Q81U 4ORZA 1ZUYA 4Y92A 1MNEA 2H3JA 2RK1A 4M75B 1ZBJA 3URGA 1WQWA 3GF5A 2XD0A 3UATA 4M77C 2DE0X 2F2VA 2O01E 4J6YA 2PZ1A 4QVDA 2KNBB 4OMOA 3PVLA 2DL8A 3E2UA 4JRIA 3JB9H 2DFUA 1Y71A 2HSEB 2JNGA 3G71T 2PVGB 3R6OA 1V29B 2JUFA 2L3RA 4KH0B 1M27C 1Z9QA 2DL7A 5I11A 2MF2A 3QPHA 2LZ6B 4BE1A 2QGGA 1KQSS 1ZHIA 2DTOA 2FZKB 5KYXA 4JRKA 3MJXA 4JZ3A 3SD4A 3DLLA 2NUPB 4IUTA 4M75F 2DXBA 3CCRT 1D0YA 2RJFA 1ZBXA 2SRCA 2KGTA 1UHCA 4AG2C 5IXFA 3L2RA 3M0RA 2AHJB 4LDVA 1WHGA 3GNFB 1J3TA 1Y7XA 2CGHA 2NUPA 5KH6A 2RJCA 2LQWA 2CUBA 4J9HA 1GCQA 3M58A 2MK5A 1K9MC 3INZA 1K0SA 2LQ8A 1C1AA 2NYSA 3SDZA 3CCST 2RHIA 4BUGA 1TUDA 3H0HA 1SF9A 2BIVA 1YJWQ 3ER0A 2C06A 4M7AE 4PJOB 1JRIA 3SWNC 3FB9A 5GAMh 1UGRB 3ZL7C 1EX4A 2DPPB 4ZGJB 1D0ZA 1OV3A 1SSHA 1I5OB 2O88A 3QZ9B 1YI2A 4PJOA 1RAAB 2HDAA 3DB4A 3PE0A 3EG9A 3CD6Q 1RAFB 3OYDA 2EYZA 3OY9A 1PSEA 3VUZA 3BDLA 4RTWA 2RQWA 1VQ9T 2QA4A 1WHMA 3CC7Q 1YFNA 2KR3A 2OAUA 4C92E 1S1NA 2KROA 1H3ZA 3KBGA 5GAOq 3CXCS 4PJOF 3BW1A 3SB2A 4IUQA 2QEXQ 4PJOG 2BE7D 1VQNT 5HK3A 1RAEB 1XQHA 4M77D 1B3QA 1VQ7A 1M8VA 2JTEA 2X35A 1M4ZA 2GCXA 2P0PA 1D3BB 1KJWA 2CZ0B 5GAMg 2CDTA 2DJQA 4PLLA 4EMHA 1KD1C 4ELZC 1Y96A 3LGFA 1I1JA 1ZA1B 2YWWA 3RKYA 2FPEA 2H3EB 1JEGA 1QWEA 4DEXA 2E6ZA 3L2UA 4LDYA 1QCNA 4AG1C 4F7UA 1R0CB 2FRWA 1TUCA 2JTFA 2VB6A 3CCJT 3AHUA 1K9AA 2P84A 1WXBA 1KD1R 1SRMA 5DM7R 1UG1A 1FWZA 1M3AA 3MEVA 3VS2A 2MAMA 4FT4A 4J6XA 1SPKA 3CQTA 4R55A 2YXYA 5L23A 4LXCA 4F7UF 2E65A 2YRDA 1Q81C 4XTUA 2DBKA 4F7UG 2OTJT 1VQMQ 2HSPA 2K9GA 5GANd 3L42A 4J9GA 2E64A 3CPFA 5GMKj 4BB7A 3CMET 4QVCA 2FO0A 2BKDN 5GMKh 1YIJQ 2KT8A 4XTVA 4C0DC 3EH2A 1GXIE 3A8HB 2K5IA 3HP9A 3CCUT 3LWIA 4EIKA 2WACA 1BIBA 2CP6A 1I0CA 2ZGWA 2YUPA 3THKA 4L6V5 4NL2A 2KMTA 1M1KR 4EDUA 2Y90A 4PL6A 1HK9A 3UDCA 2VYTA 8AT1B 3SHWA 3CCQQ 4GLKA 1PCXA 1PWTA 2RJEA 3PT9A 1BI3A 2ZPEB 2EQIA 2GTOA 2FZGB 4F17A 4DBRA 3KFVA 3M54A 1N8RU 4MMLA 5HY6A 1JU5C 2JMCA 4C8QD 3L2QA 3I55T 4XU1A 4FYWB 3M0QA 3EFOA 1AWXA 2DMOA 1BKBA 2CT3A 2VVKA 4M7AC 5LL6S 1H92A 2FL7A 2W0ZA 2X9HA 1HXDA 1YJ9T 2ZPFB 1NEBA 1R8OB 3CCVA 1W2BP 3VS5A 2DNUA 2W10A 2DEUA 2EYYA 2COZA 3EAEA 3F70A 4N0AC 1B7TA 3OYJA 1M5Q1 3SEMA 2DD4A 1U5SA 3OYEA 2LTOA 1BI1A 4RTXA 3EH1A 2P4TA 3I5SA 4HT8A 1SG5A 3OYMA 2JTMA 4OGCA 3G4ST 2X51A 3V8LA 3LWHA 4JJCA 4BDYA 4FIBA 2CKKA 5LJ3e 1MNDA 2CSQA 1PD1A 2DRKA 3PMIA 3MO8A 3CPWP 2SEMA 2MWOA 2HZYA 1BCMA 2JM9A 2EKOA 3GP8A 1SSFA 4N4GA 1D1BA 1HJDA 2DVJA 3G7ZA 3QUIA 1AWWA 2PVOB 2GQVA 4C5IA 4A54A 4IUUA 1LNXA 1YHQQ 2LC4A 1X01A 2ED0A 3REAB 3FJPA 3LW5E 1VQ4A 1O75A 1QP3A 3I56Q 3MEWA 3VS4A 5GAN5 1YJWT 2DF6A 1OX9A 5CR2A 3C94A 2C0IA 4QW2A 3ASKA 1CSKA 3EGUA 5IT9E 5CO7A 5IH2A 2LCCA 2CT4A 4HVVA 4F14A 1M8MA 2AK5A 4J83A 2XHCA 1AT1B 3CD6T 4FYYB 1K8AU 1YCYA 1TS9A 5GAMd 4MDWA 3PNWC 1YJNA 2COYA 5DLQE 3CEYA 1OZ3A 1EZZB 1KSWA 3CCLQ 1IREB 3J7AF 3VV0A 4M7DE 4X9DA 2EJGA 3CC7T 2EPDA 3RR6A 3GBQA 4M78E 4L5GA 5LJ5g 2DK3A 1VIEA 5FRMA 2QEXT 1H641 3HTRA 2RNAA 5A0DA 1Z9ZA 1QW1A 4E7SA 4C92D 4YTLA 3QWXX 4L59A 1B07A 1I8FA 2KE9A 3NTKA 4FW2A 4CC2A 2QTVA 1TUGB 1N8RC 4A4EA 5GAMf 1RLPC 1WFWA 2DL4A 1KQ1A 3HRSA 1WXTA 4BACA 3JB9D 4PFZA 2K4YA 1TU0B 5CVIA 2HBWA 2RPNA 3LH0A 1N8RR 2RMOA 1QVGP 3HRTA 3J81E 1K76A 1CKAA 3VS1A 4OF1A 2DIGA 4JRQA 1S72A 1ZSZB 1TOVA 2ECZA 1VQMT 4BI8B 2M0YA 3PTAA 3HRUA 3GNGA 4MZTA 2A0FB 4B9XA 2HBPA 4K11A 2QK0A 2EJFA 1RAHB 1YIJT 5CAIA 2LNVA 1ZX6A 2E4HA 3FEOA 1VQKA 3VYGA 2E70A 3X24B 4J9BA 1M90R 2HEQA 2AT1B 2KRMA 3BY7A 3H0FA 4MMKA 2HQHA 2LDMA 2EQUA 3CBPA 2CS7A 3QO3A 4PNOA 4AFSC 2OTLQ 2L89A 1GCPA 3CC4Q 4J9DA 4ZGEB 3CCQT 2J6FA 2QQ9A 2K7AA 3A8OB 4MZPA 5FU6C 4LUEA 2FZCB 3TCJA 4C0FA 2RHUA 3FRNA 3OYKA 4LDUA 3QG1A 1G3TA 1SEMA 3C95A 3EHQA 1WJRA 1VQ6T 4M77B 2BZYA 5HKCA 3OSSC 1QKXA 1K0XA 3SFMA 3A1PA 4JS5A 2NUZA 2JOYA 3VS7A 4J5YA 3GPLA 4J9IA 3X25B 4PFPA 1AVZC 3RMSA 3OW2P 2ENMA 3VYHB 3WXMB 1R0BG 4XTXA 1IGQA 3CCJA 1KIKA 1ABOA 1GFDA 2CP7A 5CKFA 1JJ2P 1MHNA 4Z88A 3MKDA 4RTVA 4J6WA 1N27A 2X4YA 3EGXB 4PJOE 2WSEE 3NHNA 5CCAA 2I2LA 1IHWA 5CIUA 2AKLA 5HCKA 1UEBA 3A8MB 1AD5A 2D6FA 4LUDA 2CP0A 2E5QA 2F2XA 3UF4A 2YLCA 1K8AR 1WXUA 2Y4YA 3P8BB 2YUQA 1NPPA 4ZN1A 3MP1A 4M75A 2P4RA 4OB3B 3SWNB 4ATOA 3C12A 4A63B 4LD6A 3PGGA 2OI3A 4AFUC 3P8HA 2JS0A 4NL3A 1U3OA 5GAN3 2AKKA 3CC2A 1O9SA 2BZ8A 2JZ2A 1VYVA 2LCLA 5C0MA 4IUPA 2VC8A 2RI2A 5C6SA 3IQLA 5J26A 3JSCA 2QA4Q 3GOXA 4F7UE 2EGEA 4F04B 3I56T 4M75G 2V26A 2XDBA 5I21A 1ZQ1A 1UDLA 1VQ7Q 1IO6A 3MHXA 1XOVA 2LJ0A 1B34B 3VKIA 2E10A 3RESA 4DBFA 4XTYA 1BBZA 3UWNA 2GBQA 4C8QB 2CH4W 2E3IA 3UT1A 3JCMX 5GJWB 3RKWA 3E9GA 1NG2A 1X27A 4JLIA 1P92A 4BY6C 4C8QA 4D8KA 1QVPA 5GAMj 1UUEA 3LX7A 1PC0A 1W70A 3PVQA 1K9MR 2MMPA 5CQYA 3OYFA 3CCLT 3QYHB 2ROLA 4M75C 1KFZA 2O4XB 2KRSA 4OB1B 3OB9A 1WJSA 2ZPBB 2LP5A 3JCMf 4A4KA 5KYUB 2RF0A 2O4XA 4M7DD 4C8QF 5LJ5f 4OMNA 4C8QG 4M78D 2KYBA 2V1RA 5KYUA 3G4SA 3OMGA 5J39A 1N9RA 1QQJA 3HSBA 1N6AA 1NYGA 2E1HA 4EMGA 1X6OA 5KE3A 2DRMA 1Y57A 5GAOr 2XG8D 4LDWA 3JCMc 2KEAA 4QT7A 1GCQC 5GANe 4M4ZA 4E7LA 2VASA 3UA6A 2Y4XA 2J05A 4B6MA 2DERA 3CBMA 2X4XA 4N4HA 5LJ3g 2GGRA 4O5VA 1D3BA 1OU8A 5KYYB 4Z8AA 2KVQG 2C0OA 3U23A 1IGUA 2IVWA 2E3HA 3VU3C 1VQPA 1YWOA 2KXCA 3L2ZA 2DAQA 4PJOC 3EG2A 5CK9A 1BYMA 3G6EA 3S6WA 1YITA 5M9OA 1HD3A 3OS1A 1SKUB 4FM4B 4JUVA 2HD0A 2LRQA 2M0OA 4KRTA 4DOVA 4BE2A 4NS5A 4FW1A 3CCVQ 2OAWA 5D6YA 2JJ9A 3EGDB 3DB3A 3CD6A 3FIFA 1VUBA 2OTLT 1IB8A 1QVFP 3CC4T 1FX7A 2F5TX 4ESRA 3EGDA 1Q81R 1UFFA 2HNIA 5CKDA 3O8VA 1WJQA 1Y07A 3X20B 3LH5A 3EG3A 1AWJA 4KBMB 1JQQA 2LJ3A 2XMFA 3FC3A 2XDDA 1E6GA 3QYGB 2RHYA 2FHDA 3JCMQ 2X3WD 4Y28E 3RMQA 2EVRA 4E7ZA 1V76A 4C92B 3A8LB 2GF7A 4QQDA 3FDRA 1MV0B 3L2VA 1LJOA 2B86A 2RI3A 5GAN8 2MYSA 4C92A 4HT9A 1MGQA 1BCOA 3OS0A 5D6XA 2WSCE 1QCFA 3MCAB 1IHVA 3RBBB 3FJ5A 2DL5A 1VQ5A 2KAFA 1WPYA 4ZNXA 2R57A 4VUBA 3I5RA 2DILA 4XAXB 3QZ5B 1AZGB 3I35A 1RI9A 4DBQA 3ZBDA 1VQ4Q 3QDRB 4RTUA 4C92F 4C92G 9ATCB 2LQNA 3M59A 2VXFA 2XI9A 1ZSGA 4XTZA 3QXEB 4IUVA 3OA6A 2LNHB 2L2PA 2R58A 1KHCA 1JXMA 3CCMA 1ABQA 1ZUKA 3NFCA 4ELYC 5AT1B 2VWFA 2E41A 3R6NA 3JB9F 2KSSA 1H8KA 3JB9G 1LPLA 1AWOA 2L3PA 2K2VA 1YJNQ 4HVUA 1M2VB 1NJIU 3V8KA 2EYQA 4PLIA 5IAYA 2A37A 1W2BA 2V8IA 4II1A 3LYIA 2YLBA 3RNJA 3OS2A 2QA4T 2GQIA 1MMDA 2A28A 1M2VA 3M0PA 3LGLA 1JBMA 1BI2A 5GAMe 2CP2A 2RN8A 2O31A 5GMKm 1K4US 3QSUA 4LN2A 1ACMB 2DO3A 2DETA 4ZGDB 1G2BA 4XQ3A 1GBQA 3JCMh 2DXTA 5LJ5j 3L2WA 4DEYA 2CP3A 2D9TA 1M9SA 5LJ5h 3CMAA 1VQ6A 4RG2A 1VQ8A 1KG1A 2ZPGB 4ZTFA 1Q7YU 2DTHA 2M16A 3TU4K 2EIFA 1VQLA 2LCSA 3CCEA 2Z0WA 2NLUA 6AT1B 2L3QA 2HKQB 4KGVB 1AEYA 2IG0A 4KULA 2F5KA 8ATCB 1BU1A 2DBMA 2ZZDA 4A4FA 4X34A 1GBRA 2K3YA 3CPWA 3OS5A 4O6JA 4RMOA 1TWBA 2HL3A 1RABB 4M7AD 4C0GA 2RM4A 2JMAA 3RDVA 4OP0A 1JB0E 2DL3A 2CREA 4A53A 1U8RA 4HKEA 4XTWA 1S72Q 2EBPA 2G3RA 3JCMg 1KQSP 4WF2A 1X6BA 1ZUUA 2CSIA 2E6NA 2XU8A 2BZXA 1X75C 4EMKB 1WLPB 2ESWA 3H41A 5GJVB 4C5GA 2J6KA 1VQKQ 4HCBA 4JJDA 1FMWA 3H9NA 4J9FA 5GAN6 2MCNA 1SHFA 4N4IA 4CC3A 2JT4A 5FWBA 3G71A 4KT0E 1PKSA 1X69A 1H3HA 1PRLC 2K3XA 4MDXA 3X28B 1SRLA 1AZEA 4X9CA 5A0LA 5GMKl 1IXDA 3OYHA 2J6OA 1VA7A 3M53A 1K73U 5LJ3f 4E7HA 2NUTB 4IKFA 2EYWA 5EC7A 5GMKe 1G3SA 4Z02A 2VGMA 1QCOA 4DOWA 2AIRB 3CCRA 2D1XA 2QASA 4J8OA 5CKHA 3BE3A 1D1AA 2K6DA 5A2QE 1N5ZA 2MWPA 2QQAA 2BE9B 3J80E 1JXOA 1T3SA 3CCVT 2VKNA 4IURA 2K57A 1TSFA 4HXJA 2FRYA 4C0ZA 4RKUE 4WTOB 4BDZA 3CCSA 3HFNA 3M5AA 4EPCA 3EG0A 1KHIA 3OYBA 3CXCP 1ZSZA 1UHFA 1RADB 4C5HA 2RH2A 4RTYA 3CCJQ 3CCLA 1TXQA 1KQ2A 4M75E 2XICA 2KXDA 5AYFA 1VQOQ 1ARKA 1NJIC 1GRIA 2EQMA 5DLOA 4OVAA 1QVGA 4M7DB 1Q86U 1VYTA 1MMNA 4M78B 1VQ9A 2LJ1A 1W2BS 2DYIA 2RHZA 4OMQA 4E7KA 1G3YA 3OYNA 2YSQA 4CRIA 1NJIR 1NLOC 1AOJA 1VQNA 2P0QA 2DJZA 4QQGA 1HYOA 4CI0C 3OYCA 1IZ6A 1WZOA 5FLXE 4BI3A 4GY5A 3OQ5A 4JDSA 4UC4A 1Q7YC 3H0IA 2K5FA 3JB9J 5D6WA 3CC2Q 1U06A 1NE8A 1NLPC 4JLGA 4M77A 2B8AA 3TVTA 1TG0A 4Y91A 2HQEA 4ME7A 4BI4A 1ZSZC 2AZSA 3LLRA 2ZPIB 5GANg 4M7DF 4E7JA 3BDUA 2DD5A 4RG8A 3M9QA 1NEGA 4C8QE 1VQ4T 4M78F 3M0TA 1Q7YR 3ZEHA 3A8GB 4HCKA 3M56A 2XIDA 1YP5A
chains in the Genus database with same CATH topology
1HXDA 2JVVA 2XDPA 2ZPFB 1YJ9T 1N6AA 1R8OB 3L1AA 3OYAA 3Q1JA 2E1HA 3CCVA 4EMGA 3V7CA 1N9SA 1X6OA 1KC8C 5KE3A 3CPWS 2KDSA 3EAEA 5GAOr 3JB9I 4M77F 2XG8D 5GAN4 3F70A 3C4SA 4N0AC 4LDWA 4M77G 4V2SA 3JCMc 4B9WA 3OYJA 3S3MA 5GAOl 1M5Q1 4M77E 2DD4A 3KUFA 5GANe 4E7LA 1G5VA 3OYEA 2LTOA 2Y4XA 1YHQA 2VUBA 3CBMA 2X4XA 1BIAA 1TH7A 4N4HA 5LJ3g 1BI1A 5IN1A 4O5VA 1KQSA 1WGSA 3TREA 3N5BB 2P4TA 2OTJA 3I56A 1YJNT 1D3BA 4HT8A 2QI2A 5FU7C 1I4K1 2KVQG 1QVFS 4DQ2A 5FU6B 4A4HA 3CMEA 5GAOp 3OYMA 1PSFA 1U1TA 3PFSA 5J39A 2JTMA 4OGCA 3G4ST 4KUDK 4JS4A 2IVWA 4JRPA 5EG2A 3VU3C 1VQPA 2VXEA 3OW2A 3CCUA 3L2ZA 3V8LA 3LWHA 1XTDA 4BDYA 4FIBA 2CKKA 2DAQA 4PJOC 1VQ5T 2YRVA 5LJ3e 5CK9A 1BYMA 3CBOA 1G3WA 3SWNA 3G6EA 1UB4A 1M1KU 3S6WA 3WVDB 3TEEA 5KE2A 3PMIA 1YITA 5M9OA 1JJ2A 3MO8A 4JJNK 2YHTA 1U1SA 1K73C 3OS1A 2MWOA 1K9MU 4FM4B 3EFSA 2EKOA 3EFRA 4JUVA 4EMKC 2HD0A 2LRQA 1YHQT 3GP8A 1Q82U 2M0OA 2KQWA 3MEAA 1SSFA 4DOVA 4N4GA 4BE2A 2K5LA 4NS5A 3ZFJA 1M90C 5GANj 2EJ9A 2PVDB 5D6YA 3G7ZA 3QUIA 4RCBA 2FVUA 4ZN3A 3JCMd 3KXTA 4OB2B 2PVOB 2RI5A 5CQXA 3DB3A 5GANh 2LQKA 3CCMT 3CD6A 3FIFA 2GQVA 1VUBA 2OTLT 1M1GA 2JN0A 4C5IA 5LJ5d 4A54A 3CC4T 1FX7A 3OMCA 3DKMA 2F5TX 4IUUA 4E7IA 1LNXA 4HCCA 4P5NA 4Q5WA 2HNIA 1X01A 2LC4A 3MEUA 5CKDA 3OBYA 3O8VA 4A4GA 3I55A 1WJQA 1Y07A 3X20B 3FJPA 4RCCA 3LW5E 1VQ4A 1O75A 1QP3A 3MEWA 1B34A 1RL2A 4HA8A 5GAN5 1YJWT 2A7YA 3E19A 5CR2A 2GFAA 4KBMB 3C94A 4M7DA 3FC3A 1YJ9A 2XDDA 5GMKi 3HFOA 4QW2A 3QYGB 5GAN7 5LJ3j 3ASKA 4M78A 2RK2A 5IT9E 5CO7A 1S72T 2VV5A 2RHYA 3JAME 5FU7B 5LJ3h 2LCCA 2FHDA 3CXCA 1YBYA 3JCMQ 2DKGA 3P8DA 2HQXA 2P0KA 4Y28E 3RMQA 3OYYA 3NTHA 5L8RE 2X4WA 4J83A 4C92B 2XHCA 3A8LB 2RHXA 2GF7A 3CD6T 3QJ6A 2D0QB 3M55A 3M4GA 1WNLA 4PKCC 1YCYA 1K8AU 3V7SA 5GAMd 4QQDA 4MDWA 3FDRA 2CZ1B 3L2VA 1VQKT 3PNWC 1YJNA 1LJOA 2RI3A 5DLQE 4BD3A 4OGEA 5GAN8 3CEYA 3CMAT 4C92A 4HT9A 1MGQA 1OZ3A 1VQ8T 4HCZA 3OS0A 5J3BA 5D6XA 2BUDA 4OMFB 4M7DG 1IREB 3J7AF 3VV0A 4M7DE 4X9DA 2EJGA 2WSCE 5KCHA 2CYZB 1Q86C 3CC7T 4M78G 1KD1U 1VQLT 4M78E 4L5GA 5LJ5g 3MCAB 1OYXA 2DK3A 2FB7A 1VIEA 3JRZA 5CKBA 4ZTJA 3CCET 1UGPB 2FYKA 5FRMA 2RO0A 2QEXT 1VQ5A 2WSFE 1H641 1WPYA 2KAFA 3VJPA 1QVGS 3RIRA 2R57A 4J7IA 5A0DA 3RKXA 1QW1A 4VUBA 4MZMA 3DLMA 3V8JA 4OB0B 4XAXB 3QZ5B 4C0DB 5A0GA 4C92D 3ZBDA 3JCMe 3QDRB 3M4YA 4C92F 1FXXA 4YTLA 4C92G 3M59A 1EIFA 2XKOC 4L59A 3QKJA 4QVZA 1I8FA 2VXFA 2XI9A 3JCMV 5LJ5e 1K8AC 3NTKA 4XTZA 4DA4A 3QXEB 4IUVA 3OA6A 2DVEA 3JCMJ 1VQOA 1N8RC 2R58A 1KHCA 4A4EA 5GAMf 4C8QC 4M7DC 3CCMA 2DZCA 1Y96B 3QJYA 4BY6B 3NTIA 3META 4E47A 1KQ1A 3HRSA 3NFCA 2QTXA 2OTLA 2M1HA 4M78C 4ELYC 4BACA 3CC4A 4QQ6A 3JB9D 2DXUA 1Q81U 2E41A 2K4YA 3JB9F 2KSSA 3PMTA 5CVIA 3JB9G 4F7UB 2CZ6B 2H3JA 2RK1A 4XU2A 4M75B 1VQNT 2RJDA 3QBYA 3URGA 3LH0A 1WQWA 1QP2A 2K2VA 3GF5A 3OYLA 2HAXA 2XD0A 1YJWA 4M77C 1NJIU 2O01E 3OSVA 4KUIA 3V8KA 2EYQA 4J6YA 4PLIA 5IAYA 2RD1A 1W2BA 3HRTA 2V8IA 3J81E 2L5QA 4II1A 3LYIA 4OF1A 2YLBA 2DIGA 4QVDA 3OS2A 2QA4T 4JRQA 3WVEB 4XK8E 1S72A 3JB9H 4JRIA 1Y71A 2JNGA 3LGLA 1JBMA 2PVGB 2R5AA 3G71T 1VQMT 4BI8B 1BI2A 5GAMe 3R6OA 3PTAA 3HRUA 3GNGA 1V29B 2JUFA 2L3RA 4MZTA 3VUBA 3HHTB 5GMKm 4B9XA 3E1SA 2HBPA 3QSUA 5GAOn 1VQOT 2DO3A 2EJFA 1WQ7A 4M7AB 4ZGDB 1YIJT 4XQ3A 5CAIA 2MF2A 2LNVA 5I2MA 2QDYB 3JCMh 2DXTA 3QIIA 3QPHA 3FEOA 5LJ5j 4BE1A 1VQKA 3L2WA 3VYGA 2D9TA 1NZ9A 1KQSS 1ZHIA 2DTOA 2PU9B 2E70A 1M9SA 4JRKA 5LJ5h 5I2SA 3CMAA 3H6ZA 4FSXA 3SD4A 1VQ6A 4M7AA 4RG2A 1VQ8A 4M75D 3X24B 3DLLA 1KG1A 4IUTA 2ZPGB 4ZTFA 4M75F 1Q7YU 2DTHA 2DXBA 3CCRT 3OBWA 2RJFA 1ZBXA 3BY7A 3CC7A 2MI6A 4MMKA 2M16A 3TU4K 2EIFA 3L2RA 2LDMA 1VQLA 2EQUA 3T9NA 2AHJB 3CBPA 3GNFB 4LDVA 3CCEA 1Y7XA 2CS7A 2NLUA 3QO3A 4N0AA 2CGHA 3OW2S 4PNOA 2RJCA 5KH6A 2QEXA 1M1KC 2IG0A 2L89A 4J7FA 4KULA 3S3OA 3M58A 5CKEA 2F5KA 1K9MC 2E12A 3INZA 3ME9A 2ZZDA 3CCQT 4ZGEB 1LOJA 4A4FA 2LQ8A 2QQ9A 4X34A 1Q82C 3SDZA 2K3YA 3CPWA 3RERA 3JCMW 3OS5A 3CCST 3A8OB 4O6JA 4MZPA 5DY9A 4RMOA 1JJ2S 3CC2T 2RHIA 4C0GA 4M7AD 4BUGA 5FU6C 4M7AF 3HL8A 2BIVA 3TCJA 4C0FA 3GIBA 2RHUA 2RM4A 3ER0A 2KK4A 4M7AG 4OP0A 3FRNA 2C06A 3OYKA 4M7AE 1JB0E 4LDUA 3A5ZB 4PJOB 3QG1A 1JRIA 3SWNC 1G3TA 5FRNA 3C95A 4A53A 3X26B 3FB9A 1U8RA 5GAMh 4HKEA 1UGRB 4XTWA 1WJRA 1VQ6T 2DPPB 4M77B 4ZGJB 2G3RA 3JCMg 1UGSB 2PQWA 2V8JA 4WF2A 2EFIA 3QZ9B 5HKCA 1YI2A 3OSSC 1QVFA 4PJOA 2M9UA 2E6NA 3SFMA 2XU8A 1X75C 4EMKB 4XU0A 4JS5A 5KCOA 1AHJB 2F69A 3DB4A 4LD9K 2JOYA 5GANf 4C5GA 3OYDA 4J5YA 3GPLA 3X25B 3RMSA 3OY9A 4HCBA 1XNIA 3JCMP 1PSEA 3H8ZA 3VUZA 3BDLA 3VYHB 3WXMB 2PUOB 1VQ9T 2EQKA 5GAN6 4XTXA 2QA4A 3CCJA 2DEQA 2DZ9A 3E9FA 4N4IA 2OAUA 3G71A 4KT0E 4C92E 2ZPHB 1VQMA 2L8DA 5CKFA 2DTIA 4PJOD 3KBGA 1MHNA 4FT2A 4PJOF 3BW1A 3SB2A 5GAOq 3CXCS 2V8KA 4IUQA 2K3XA 4PJOG 4MDXA 3X28B 4J6WA 1N27A 2X4YA 1Q7YC 1M1FA 1OZ2A 4X9CA 2WSEE 1XQHA 4M77D 5A0LA 5CCAA 5HK3A 5GMKl 2I2LA 3OYHA 1VQ7A 1M8VA 1YIJA 3M53A 1K73U 2X35A 5LJ3f 4E7HA 1YI2T 1M4ZA 5CIUA 4IKFA 2GCXA 2P0PA 1D3BB 2CZ0B 1UEBA 5GMKe 3A8MB 1G3SA 4Z02A 3BFMA 2VGMA 5GAMg 1I81A 3GLXA 3HPWA 4PLLA 4DOWA 2D6FA 4EMHA 1KD1C 4D6WA 2E5QA 4ELZC 1M90U 1Y96A 3LGFA 1RI0A 2YLCA 2Y4YA 2LT1A 3P8BB 3CCRA 3RKYA 1NPPA 4J8OA 2EWNA 5CKHA 4ZN1A 4FU6A 3PIOA 2E6ZA 3L2UA 4LDYA 2KY9A 3MP1A 4F7UA 2PUKB 3S3NA 2DIQA 5A2QE 4BE0A 4M75A 2MWPA 2QQAA 4OB3B 2JTFA 3MP8A 3CCJT 3SWNB 3AHUA 4ATOA 3C12A 3J80E 4C92C 4LD6A 3PGGA 3MP6A 3CCQA 2ZCFB 3P8HA 3CCVT 2LT4A 4IURA 2K57A 5DM7R 4C0ZA 4RKUE 5GAN2 2QXFA 4NL3A 3CCSA 4BDZA 1FWZA 3JCMb 3HFNA 3M5AA 5GAN3 3CC2A 4EPCA 3MEVA 1KHIA 1O9SA 2JZ2A 2MAMA 5HK0A 1UGQB 3OYBA 1VQ7T 4NOYA 5GAOm 2LCLA 4C5EA 5C0MA 4FT4A 4J6XA 4IUPA 4C5HA 2X4JA 3RUXA 2VC8A 2RI2A 5C6SA 4R55A 5J26A 2RH2A 3JSCA 3HKSA 4PJOE 3V7RA 4F7UF 2E65A 3OYGA 1Q81C 2LVMA 3CCLA 4XTUA 4F7UG 2OTJT 3GOXA 4F7UE 3I56T 1KQ2A 4M75G 5GANd 2XDBA 3L42A 1VIFA 2E64A 3CPFA 2XICA 4M75E 1ZQ1A 5I21A 5GMKj 4BB7A 5AYFA 4FL6A 3CMET 4QVCA 2CZ7B 2BKDN 5GMKh 1DJ7B 4XTVA 1H3ZA 4XU3A 4C0DC 1NJIC 3MHXA 1GXIE 1XOVA 2EQMA 3A8HB 2K5IA 3HP9A 1B34B 2VGNA 2E10A 3RESA 3VKIA 5DLOA 3CCUT 1VQPT 3M57A 4XTYA 3LWIA 4OVAA 2QQBA 3UWNA 1QVGA 2WACA 4C8QB 2R5MA 3PIPA 1Q86U 3UT1A 4M7DB 1BIBA 2EQJA 3JCMX 1W4SA 4M78B 2ZGWA 3RKWA 1VQ9A 3G6ET 1W2BS 3E9GA 5FROA 4L6V5 4JLIA 2RHZA 4NL2A 4E7KA 1YITT 1P92A 1G3YA 2KMTA 4BY6C 4C8QA 3OYNA 3OYIA 1KC8U 1QVPA 4EDUA 4CRIA 2Y90A 5GAMj 5LJ3d 4PL6A 1NPRA 1HK9A 3LX7A 3UDCA 2P0QA 3UPUA 4LDXA 1VQNA 2VYTA 2MMPA 2DJZA 2RA2A 4QQGA 5CQYA 3OYFA 4CI0C 2QQRA 3CCLT 3OYCA 1IZ6A 3QYHB 5FLXE 1I5LA 4GLKA 4M75C 4BI3A 4GY5A 3OQ5A 2A3LA 2RB6A 2RJEA 3PT9A 3QHSA 2K5FA 4JDSA 1BI3A 2ZPEB 4UC4A 5D6WA 3JB9J 2GFUA 2O4XB 4OB1B 2QQSA 1NE8A 3OB9A 4JLGA 4M77A 2B8AA 1WJSA 2ZPBB 2DXCA 4Y91A 2XK0A 3M54A 4A4KA 2LX9A 3JCMf 1N8RU 4MMLA 2HQEA 3HSBA 4R56A 5HY6A 4ME7A 4BI4A 4EMKA 4C8QD 2O4XA 3LLRA 2ZPIB 4TVRA 5GANg 4M7DD 4C8QF 4M7DF 5LJ5f 3L2QA 3BDUA 2DD5A 3I55T 4E7JA 4XU1A 4RG8A 4C8QG 4M78D 3M9QA 1OI1A 2EAYA 4C8QE 1VQ4T 4M78F 1BI0A 3G4SA 1BKBA 3ZEHA 4M7AC 3A8GB 3OMGA 5LL6S 3FLGA 3M56A 2XIDA 1N9RA 2FL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N5B B;  2XG8 D;  2XKO C; 
#chains in the Genus database with same CATH topology
 3Q1J A;  2L3S A;  3V7C A;  2DX1 A;  1KC8 C;  3CPW S;  2KDS A;  3JB9 I;  1MMA A;  4M77 F;  5GAN 4;  3C4S A;  4J9C A;  4V2S A;  4M77 G;  1G5V A;  3EGX A;  2VUB A;  1WA7 A;  1WGS A;  3TRE A;  1Q95 G;  3N5B B;  2OTJ A;  1YJN T;  2EYX A;  1X6G A;  2MPX C;  5FU7 C;  4DQ2 A;  5FWC A;  3CME A;  3QWY A;  2KBT A;  3VS3 A;  2QG9 B;  1YI2 Q;  2HCK A;  2VXE A;  3OW2 A;  3CCU A;  2IIM A;  1XTD A;  2YRV A;  3CBO A;  1G3W A;  1PM3 A;  3NGP A;  3SWN A;  1OX8 A;  1UB4 A;  1MUZ A;  1M1K U;  3WVD B;  3TEE A;  2O2O A;  5KE2 A;  4AFQ C;  1UJ0 A;  1JJ2 A;  1EFN A;  1U1S A;  1K73 C;  1YHQ T;  2NWM A;  3G4S Q;  1Q82 U;  5D7U A;  2JXB A;  3MEA A;  3ZFJ A;  5KYX B;  4ZN3 A;  3JCM d;  1RAC B;  2LX7 A;  2RI5 A;  1QWF A;  2LQK A;  4KH1 B;  2OX7 A;  5LJ5 d;  1K73 R;  2J06 A;  3DKM A;  1WDX A;  1OOT A;  2MOX A;  1UTI A;  4Q5W A;  3MEU A;  1GFC A;  3OBY A;  3I55 A;  2G6F X;  5KYN A;  2D8J A;  2I0N A;  1B34 A;  2IPO B;  3E19 A;  1YJ9 A;  4J9E A;  5GMK i;  5LJ3 j;  1SHG A;  4WCI A;  2RK2 A;  1S72 T;  1OEB A;  5LJ3 h;  1VQP Q;  1YBY A;  3NMZ C;  1D0X A;  2HQX A;  1XJW B;  3NTH A;  4GBQ A;  5L8R E;  1MV3 A;  2X4W A;  3G6E Q;  3QJ6 A;  2D0Q B;  3M55 A;  2RQR A;  1M30 A;  1WNL A;  1YIT Q;  2JS2 A;  1VQK T;  4FYX B;  2EKH A;  4RTT A;  2DA9 A;  1WIE A;  4BD3 A;  4E6R A;  3MPU B;  3EG9 B;  5J3B A;  1OU9 A;  1R77 A;  2BUD A;  4PJN A;  1Q86 C;  2CYZ B;  1WHH A;  1VYU A;  2OJ2 A;  1OYX A;  2FB7 A;  5CKB A;  1UGP B;  2RO0 A;  5IXB A;  1QVG S;  3VJP A;  1ZLM A;  4J7I A;  4MZM A;  3V8J A;  4OB0 B;  4C0D B;  1X43 A;  1Q86 R;  2DYB A;  1FXX A;  3QKJ A;  3JCM V;  1OPL A;  4DA4 A;  2DVE A;  2M51 A;  4IIM A;  4C8Q C;  2DZC A;  1Y96 B;  3QJY A;  1E6H A;  4E47 A;  1UJY A;  1FYN A;  2QTX A;  2HL5 C;  2YUN A;  2ED1 A;  5KYY A;  2QDL A;  2CH4 A;  1PKT A;  3PMT A;  1LCK A;  4F7U B;  2EGC A;  2CZ6 B;  4XU2 A;  2RJD A;  3QBY A;  2HAX A;  1QP2 A;  3OYL A;  4DBH A;  1YJW A;  2GNC A;  1WHL A;  3OSV A;  4KUI A;  4PJL A;  4E2F B;  1YCS B;  2RD1 A;  2KYM A;  2L5Q A;  3C0C A;  1C0M A;  3WVE B;  4XK8 E;  1QLY A;  2R5A A;  3VUB A;  4QKU A;  1M3B A;  3HHT B;  1VQ5 Q;  3E1S A;  5GAO n;  1VQO T;  1WQ7 A;  4M7A B;  1RAI B;  5I2M A;  2QDY B;  1JO8 A;  3QII A;  1YWP A;  1G8X A;  1NZ9 A;  2HKN A;  3TSW A;  2PU9 B;  3TSZ A;  5I2S A;  3H6Z A;  4FSX A;  4M7A A;  1QKW A;  4M75 D;  3VS0 A;  3OBW A;  1PNJ A;  3CC7 A;  2GTJ A;  4KGX B;  2MI6 A;  2D0N A;  3T9N A;  3OW2 S;  1M1K C;  4N0A A;  3CCM Q;  2QEX A;  4Z89 A;  3EG1 A;  4J7F A;  3S3O A;  5CKE A;  4AT1 B;  2E12 A;  3ME9 A;  4RTZ A;  5I22 A;  1LOJ A;  1Q82 C;  3RER A;  3JCM W;  5DY9 A;  1JJ2 S;  2MIO A;  3CC2 T;  1F1B B;  4M7A F;  1WI7 A;  3HL8 A;  3GIB A;  4M7A G;  2KK4 A;  2J7I A;  2PTK A;  3A5Z B;  5FRN A;  3X26 B;  1M3C A;  3TQ7 P;  4CC7 A;  1UGS B;  2PQW A;  2V8J A;  5FW9 A;  1Q82 R;  2EFI A;  1QVF A;  2M9U A;  1K1Z A;  1PD0 A;  4XU0 A;  5KCO A;  1AHJ B;  2F69 A;  4LD9 K;  5GAN f;  3NPF A;  3EFO B;  1XNI A;  3JCM P;  2PNI A;  2ATC B;  2X3X D;  2K79 A;  3H8Z A;  4LNP A;  3CMA Q;  1VQ6 Q;  1VQ8 Q;  1I07 A;  1IRX A;  2PUO B;  2EQK A;  1PHT A;  2O9V A;  2DEQ A;  2DZ9 A;  3E9F A;  1NBE B;  3ULR B;  2FPD A;  1VQL Q;  3CCE Q;  2ZPH B;  1VQM A;  2L8D A;  4PJO D;  2DTI A;  4FT2 A;  2V8K A;  4RUG A;  1M1F A;  1OZ2 A;  1FMV A;  1PRM C;  3EHR A;  1YIJ A;  1YI2 T;  1T0J A;  4PFO A;  5KYW B;  3BFM A;  1M2O A;  1I81 A;  3GLX A;  3HPW A;  4F16 A;  4D6W A;  1M90 U;  1RI0 A;  2LT1 A;  2EWN A;  5KYW A;  1V1C A;  4FU6 A;  3PIO A;  1UGV A;  2KY9 A;  2PUK B;  4FSS A;  2DIQ A;  1OUL A;  4BE0 A;  3S3N A;  2JM8 A;  3MP8 A;  1QMC A;  4C92 C;  2L0A A;  3MP6 A;  3REB B;  3CCQ A;  2ZCF B;  1UE9 A;  2LT4 A;  5GAN 2;  2QXF A;  3JCM b;  5HK0 A;  1VQ7 T;  1UGQ B;  1OPK A;  4NOY A;  2K2M A;  4C5E A;  5GAO m;  1D1C A;  2X4J A;  3RUX A;  4PK4 A;  1OQK A;  1NM7 A;  4ANJ A;  3HKS A;  3V7R A;  3OYG A;  2LVM A;  2ROT A;  2YT6 A;  1MMG A;  3G71 Q;  2ABL A;  4OMM A;  4FYV B;  3VRZ A;  1VIF A;  2H8H A;  2AZV A;  4FL6 A;  2CZ7 B;  1PG5 B;  1DJ7 B;  4XU3 A;  1UEC A;  3G1J A;  4IIO A;  4X1V A;  3O5Z A;  2VGN A;  1VQP T;  3M57 A;  2LMJ A;  2QQB A;  3QDF A;  2QGF B;  2R5M A;  3PIP A;  4CC4 B;  1A0N B;  2EQJ A;  2RQT A;  1W4S A;  2A36 A;  4D8D A;  3G6E T;  3CCR Q;  2COW A;  5FRO A;  2JW4 A;  1YIT T;  4HVW A;  3OYI A;  1ZA2 B;  1KC8 U;  5LJ3 d;  2F1L A;  1NPR A;  3VS6 A;  7AT1 B;  2EW3 A;  4LDX A;  3UPU A;  5IHK A;  1W1F A;  2RA2 A;  2QQR A;  1I5L A;  1BK2 A;  2A3L A;  3AT1 B;  2RB6 A;  3QHS A;  3CCS Q;  1E7O A;  4JPB W;  2GFU A;  3UA7 A;  5IHI A;  2QQS A;  1T3L A;  1WYX A;  2DXC A;  2XK0 A;  2YRC A;  2LX9 A;  4R0K A;  4R56 A;  4EMK A;  2F2W A;  4TVR A;  2E5K A;  3D7S B;  1Y0M A;  4PJJ A;  2V1Q A;  1OI1 A;  2EAY A;  1BI0 A;  2O9S A;  3FLG A;  2KRN A;  2JVV A;  2XDP A;  1G83 A;  3OYA A;  3L1A A;  1VOM A;  1N9S A;  2FG0 A;  3M0U A;  4B9W A;  3S3M A;  5GAO l;  4M77 E;  3KUF A;  1FMK A;  1VQ9 Q;  1YHQ A;  1BIA A;  1TH7 A;  4PJM A;  2RQV A;  5IN1 A;  1C6V X;  1KQS A;  2NUT A;  1W6X A;  1LVK A;  3I56 A;  1X2Q A;  2QI2 A;  1I4K 1;  1QVF S;  5FU6 B;  4A4H A;  1VQN Q;  5GAO p;  1PSF A;  1U1T A;  3PFS A;  4JZ4 A;  4FCY A;  4KUD K;  2FPF A;  4JS4 A;  4JRP A;  1WX6 A;  5EG2 A;  2FEI A;  5IHN A;  1VQ5 T;  4OML A;  1RLQ C;  1T0H A;  4JJN K;  2YHT A;  1CKB A;  5ECA A;  1K9M U;  3EFS A;  3EFR A;  4EMK C;  2YUO A;  4OMP A;  2M02 A;  3JV3 A;  2KQW A;  1RUW A;  2K5L A;  1M90 C;  5GAN j;  2EJ9 A;  2PVD B;  4RCB A;  2FVU A;  3KXT A;  4OB2 B;  1YNZ A;  5CQX A;  5GAN h;  3CCM T;  2QYZ A;  2KT1 A;  1D09 B;  1M1G A;  2JN0 A;  2YDL A;  3OMC A;  4E7I A;  4HCC A;  2RQU A;  4P5N A;  3M0S A;  4A4G A;  4RCC A;  2K3B A;  2OTJ Q;  1RL2 A;  4HA8 A;  1BB9 A;  2A7Y A;  4JJB A;  3I9Q A;  2GFA A;  1TTH B;  3CME Q;  4M7D A;  3HFO A;  5GAN 7;  2CP5 A;  2BTT A;  4M78 A;  2VV5 A;  3JAM E;  5FU7 B;  3CXC A;  3CCU Q;  2DKG A;  3P8D A;  2KI7 A;  2P0K A;  3OYY A;  2RHX A;  1WHJ A;  3M4G A;  4PKC C;  3V7S A;  1GL5 A;  2CUD A;  2CZ1 B;  2C0T A;  2DM1 A;  2EGA A;  4OGE A;  3CMA T;  1VQ8 T;  1RAG B;  4HCZ A;  4M7D G;  4OMF B;  2A08 A;  3A98 A;  5KCH A;  2ZAE A;  4GLM A;  4M78 G;  1KD1 U;  1VQL T;  3CCE T;  3JRZ A;  4ZTJ A;  2FYK A;  4LE9 A;  2WSF E;  3RIR A;  1KK7 A;  3RKX A;  2DLP A;  2QAZ A;  3DLM A;  1WHK A;  4KGZ B;  5A0G A;  3I55 Q;  3JCM e;  3M4Y A;  1HSQ A;  1EIF A;  2XKO C;  1YN8 A;  4QVZ A;  5LJ5 e;  1K8A C;  1YJ9 Q;  1KC8 R;  1NYF A;  3JCM J;  1VQO A;  1X2K A;  4M7D C;  2HMA A;  3NTI A;  3MET A;  4AFZ C;  4BY6 B;  2OTL A;  2D8H A;  2M1H A;  4M78 C;  3VRY A;  3CC4 A;  4AMC A;  4QQ6 A;  2DXU A;  1Q81 U;  4ORZ A;  1ZUY A;  4Y92 A;  1MNE A;  2H3J A;  2RK1 A;  4M75 B;  1ZBJ A;  3URG A;  1WQW A;  3GF5 A;  2XD0 A;  3UAT A;  4M77 C;  2DE0 X;  2F2V A;  2O01 E;  4J6Y A;  2PZ1 A;  4QVD A;  2KNB B;  4OMO A;  3PVL A;  2DL8 A;  3E2U A;  4JRI A;  3JB9 H;  2DFU A;  1Y71 A;  2HSE B;  2JNG A;  3G71 T;  2PVG B;  3R6O A;  1V29 B;  2JUF A;  2L3R A;  4KH0 B;  1M27 C;  1Z9Q A;  2DL7 A;  5I11 A;  2MF2 A;  3QPH A;  2LZ6 B;  4BE1 A;  2QGG A;  1KQS S;  1ZHI A;  2DTO A;  2FZK B;  5KYX A;  4JRK A;  3MJX A;  4JZ3 A;  3SD4 A;  3DLL A;  2NUP B;  4IUT A;  4M75 F;  2DXB A;  3CCR T;  1D0Y A;  2RJF A;  1ZBX A;  2SRC A;  2KGT A;  1UHC A;  4AG2 C;  5IXF A;  3L2R A;  3M0R A;  2AHJ B;  4LDV A;  1WHG A;  3GNF B;  1J3T A;  1Y7X A;  2CGH A;  2NUP A;  5KH6 A;  2RJC A;  2LQW A;  2CUB A;  4J9H A;  1GCQ A;  3M58 A;  2MK5 A;  1K9M C;  3INZ A;  1K0S A;  2LQ8 A;  1C1A A;  2NYS A;  3SDZ A;  3CCS T;  2RHI A;  4BUG A;  1TUD A;  3H0H A;  1SF9 A;  2BIV A;  1YJW Q;  3ER0 A;  2C06 A;  4M7A E;  4PJO B;  1JRI A;  3SWN C;  3FB9 A;  5GAM h;  1UGR B;  3ZL7 C;  1EX4 A;  2DPP B;  4ZGJ B;  1D0Z A;  1OV3 A;  1SSH A;  1I5O B;  2O88 A;  3QZ9 B;  1YI2 A;  4PJO A;  1RAA B;  2HDA A;  3DB4 A;  3PE0 A;  3EG9 A;  3CD6 Q;  1RAF B;  3OYD A;  2EYZ A;  3OY9 A;  1PSE A;  3VUZ A;  3BDL A;  4RTW A;  2RQW A;  1VQ9 T;  2QA4 A;  1WHM A;  3CC7 Q;  1YFN A;  2KR3 A;  2OAU A;  4C92 E;  1S1N A;  2KRO A;  1H3Z A;  3KBG A;  5GAO q;  3CXC S;  4PJO F;  3BW1 A;  3SB2 A;  4IUQ A;  2QEX Q;  4PJO G;  2BE7 D;  1VQN T;  5HK3 A;  1RAE B;  1XQH A;  4M77 D;  1B3Q A;  1VQ7 A;  1M8V A;  2JTE A;  2X35 A;  1M4Z A;  2GCX A;  2P0P A;  1D3B B;  1KJW A;  2CZ0 B;  5GAM g;  2CDT A;  2DJQ A;  4PLL A;  4EMH A;  1KD1 C;  4ELZ C;  1Y96 A;  3LGF A;  1I1J A;  1ZA1 B;  2YWW A;  3RKY A;  2FPE A;  2H3E B;  1JEG A;  1QWE A;  4DEX A;  2E6Z A;  3L2U A;  4LDY A;  1QCN A;  4AG1 C;  4F7U A;  1R0C B;  2FRW A;  1TUC A;  2JTF A;  2VB6 A;  3CCJ T;  3AHU A;  1K9A A;  2P84 A;  1WXB A;  1KD1 R;  1SRM A;  5DM7 R;  1UG1 A;  1FWZ A;  1M3A A;  3MEV A;  3VS2 A;  2MAM A;  4FT4 A;  4J6X A;  1SPK A;  3CQT A;  4R55 A;  2YXY A;  5L23 A;  4LXC A;  4F7U F;  2E65 A;  2YRD A;  1Q81 C;  4XTU A;  2DBK A;  4F7U G;  2OTJ T;  1VQM Q;  2HSP A;  2K9G A;  5GAN d;  3L42 A;  4J9G A;  2E64 A;  3CPF A;  5GMK j;  4BB7 A;  3CME T;  4QVC A;  2FO0 A;  2BKD N;  5GMK h;  1YIJ Q;  2KT8 A;  4XTV A;  4C0D C;  3EH2 A;  1GXI E;  3A8H B;  2K5I A;  3HP9 A;  3CCU T;  3LWI A;  4EIK A;  2WAC A;  1BIB A;  2CP6 A;  1I0C A;  2ZGW A;  2YUP A;  3THK A;  4L6V 5;  4NL2 A;  2KMT A;  1M1K R;  4EDU A;  2Y90 A;  4PL6 A;  1HK9 A;  3UDC A;  2VYT A;  8AT1 B;  3SHW A;  3CCQ Q;  4GLK A;  1PCX A;  1PWT A;  2RJE A;  3PT9 A;  1BI3 A;  2ZPE B;  2EQI A;  2GTO A;  2FZG B;  4F17 A;  4DBR A;  3KFV A;  3M54 A;  1N8R U;  4MML A;  5HY6 A;  1JU5 C;  2JMC A;  4C8Q D;  3L2Q A;  3I55 T;  4XU1 A;  4FYW B;  3M0Q A;  3EFO A;  1AWX A;  2DMO A;  1BKB A;  2CT3 A;  2VVK A;  4M7A C;  5LL6 S;  1H92 A;  2FL7 A;  2W0Z A;  2X9H A;  1HXD A;  1YJ9 T;  2ZPF B;  1NEB A;  1R8O B;  3CCV A;  1W2B P;  3VS5 A;  2DNU A;  2W10 A;  2DEU A;  2EYY A;  2COZ A;  3EAE A;  3F70 A;  4N0A C;  1B7T A;  3OYJ A;  1M5Q 1;  3SEM A;  2DD4 A;  1U5S A;  3OYE A;  2LTO A;  1BI1 A;  4RTX A;  3EH1 A;  2P4T A;  3I5S A;  4HT8 A;  1SG5 A;  3OYM A;  2JTM A;  4OGC A;  3G4S T;  2X51 A;  3V8L A;  3LWH A;  4JJC A;  4BDY A;  4FIB A;  2CKK A;  5LJ3 e;  1MND A;  2CSQ A;  1PD1 A;  2DRK A;  3PMI A;  3MO8 A;  3CPW P;  2SEM A;  2MWO A;  2HZY A;  1BCM A;  2JM9 A;  2EKO A;  3GP8 A;  1SSF A;  4N4G A;  1D1B A;  1HJD A;  2DVJ A;  3G7Z A;  3QUI A;  1AWW A;  2PVO B;  2GQV A;  4C5I A;  4A54 A;  4IUU A;  1LNX A;  1YHQ Q;  2LC4 A;  1X01 A;  2ED0 A;  3REA B;  3FJP A;  3LW5 E;  1VQ4 A;  1O75 A;  1QP3 A;  3I56 Q;  3MEW A;  3VS4 A;  5GAN 5;  1YJW T;  2DF6 A;  1OX9 A;  5CR2 A;  3C94 A;  2C0I A;  4QW2 A;  3ASK A;  1CSK A;  3EGU A;  5IT9 E;  5CO7 A;  5IH2 A;  2LCC A;  2CT4 A;  4HVV A;  4F14 A;  1M8M A;  2AK5 A;  4J83 A;  2XHC A;  1AT1 B;  3CD6 T;  4FYY B;  1K8A U;  1YCY A;  1TS9 A;  5GAM d;  4MDW A;  3PNW C;  1YJN A;  2COY A;  5DLQ E;  3CEY A;  1OZ3 A;  1EZZ B;  1KSW A;  3CCL Q;  1IRE B;  3J7A F;  3VV0 A;  4M7D E;  4X9D A;  2EJG A;  3CC7 T;  2EPD A;  3RR6 A;  3GBQ A;  4M78 E;  4L5G A;  5LJ5 g;  2DK3 A;  1VIE A;  5FRM A;  2QEX T;  1H64 1;  3HTR A;  2RNA A;  5A0D A;  1Z9Z A;  1QW1 A;  4E7S A;  4C92 D;  4YTL A;  3QWX X;  4L59 A;  1B07 A;  1I8F A;  2KE9 A;  3NTK A;  4FW2 A;  4CC2 A;  2QTV A;  1TUG B;  1N8R C;  4A4E A;  5GAM f;  1RLP C;  1WFW A;  2DL4 A;  1KQ1 A;  3HRS A;  1WXT A;  4BAC A;  3JB9 D;  4PFZ A;  2K4Y A;  1TU0 B;  5CVI A;  2HBW A;  2RPN A;  3LH0 A;  1N8R R;  2RMO A;  1QVG P;  3HRT A;  3J81 E;  1K76 A;  1CKA A;  3VS1 A;  4OF1 A;  2DIG A;  4JRQ A;  1S72 A;  1ZSZ B;  1TOV A;  2ECZ A;  1VQM T;  4BI8 B;  2M0Y A;  3PTA A;  3HRU A;  3GNG A;  4MZT A;  2A0F B;  4B9X A;  2HBP A;  4K11 A;  2QK0 A;  2EJF A;  1RAH B;  1YIJ T;  5CAI A;  2LNV A;  1ZX6 A;  2E4H A;  3FEO A;  1VQK A;  3VYG A;  2E70 A;  3X24 B;  4J9B A;  1M90 R;  2HEQ A;  2AT1 B;  2KRM A;  3BY7 A;  3H0F A;  4MMK A;  2HQH A;  2LDM A;  2EQU A;  3CBP A;  2CS7 A;  3QO3 A;  4PNO A;  4AFS C;  2OTL Q;  2L89 A;  1GCP A;  3CC4 Q;  4J9D A;  4ZGE B;  3CCQ T;  2J6F A;  2QQ9 A;  2K7A A;  3A8O B;  4MZP A;  5FU6 C;  4LUE A;  2FZC B;  3TCJ A;  4C0F A;  2RHU A;  3FRN A;  3OYK A;  4LDU A;  3QG1 A;  1G3T A;  1SEM A;  3C95 A;  3EHQ A;  1WJR A;  1VQ6 T;  4M77 B;  2BZY A;  5HKC A;  3OSS C;  1QKX A;  1K0X A;  3SFM A;  3A1P A;  4JS5 A;  2NUZ A;  2JOY A;  3VS7 A;  4J5Y A;  3GPL A;  4J9I A;  3X25 B;  4PFP A;  1AVZ C;  3RMS A;  3OW2 P;  2ENM A;  3VYH B;  3WXM B;  1R0B G;  4XTX A;  1IGQ A;  3CCJ A;  1KIK A;  1ABO A;  1GFD A;  2CP7 A;  5CKF A;  1JJ2 P;  1MHN A;  4Z88 A;  3MKD A;  4RTV A;  4J6W A;  1N27 A;  2X4Y A;  3EGX B;  4PJO E;  2WSE E;  3NHN A;  5CCA A;  2I2L A;  1IHW A;  5CIU A;  2AKL A;  5HCK A;  1UEB A;  3A8M B;  1AD5 A;  2D6F A;  4LUD A;  2CP0 A;  2E5Q A;  2F2X A;  3UF4 A;  2YLC A;  1K8A R;  1WXU A;  2Y4Y A;  3P8B B;  2YUQ A;  1NPP A;  4ZN1 A;  3MP1 A;  4M75 A;  2P4R A;  4OB3 B;  3SWN B;  4ATO A;  3C12 A;  4A63 B;  4LD6 A;  3PGG A;  2OI3 A;  4AFU C;  3P8H A;  2JS0 A;  4NL3 A;  1U3O A;  5GAN 3;  2AKK A;  3CC2 A;  1O9S A;  2BZ8 A;  2JZ2 A;  1VYV A;  2LCL A;  5C0M A;  4IUP A;  2VC8 A;  2RI2 A;  5C6S A;  3IQL A;  5J26 A;  3JSC A;  2QA4 Q;  3GOX A;  4F7U E;  2EGE A;  4F04 B;  3I56 T;  4M75 G;  2V26 A;  2XDB A;  5I21 A;  1ZQ1 A;  1UDL A;  1VQ7 Q;  1IO6 A;  3MHX A;  1XOV A;  2LJ0 A;  1B34 B;  3VKI A;  2E10 A;  3RES A;  4DBF A;  4XTY A;  1BBZ A;  3UWN A;  2GBQ A;  4C8Q B;  2CH4 W;  2E3I A;  3UT1 A;  3JCM X;  5GJW B;  3RKW A;  3E9G A;  1NG2 A;  1X27 A;  4JLI A;  1P92 A;  4BY6 C;  4C8Q A;  4D8K A;  1QVP A;  5GAM j;  1UUE A;  3LX7 A;  1PC0 A;  1W70 A;  3PVQ A;  1K9M R;  2MMP A;  5CQY A;  3OYF A;  3CCL T;  3QYH B;  2ROL A;  4M75 C;  1KFZ A;  2O4X B;  2KRS A;  4OB1 B;  3OB9 A;  1WJS A;  2ZPB B;  2LP5 A;  3JCM f;  4A4K A;  5KYU B;  2RF0 A;  2O4X A;  4M7D D;  4C8Q F;  5LJ5 f;  4OMN A;  4C8Q G;  4M78 D;  2KYB A;  2V1R A;  5KYU A;  3G4S A;  3OMG A;  5J39 A;  1N9R A;  1QQJ A;  3HSB A;  1N6A A;  1NYG A;  2E1H A;  4EMG A;  1X6O A;  5KE3 A;  2DRM A;  1Y57 A;  5GAO r;  2XG8 D;  4LDW A;  3JCM c;  2KEA A;  4QT7 A;  1GCQ C;  5GAN e;  4M4Z A;  4E7L A;  2VAS A;  3UA6 A;  2Y4X A;  2J05 A;  4B6M A;  2DER A;  3CBM A;  2X4X A;  4N4H A;  5LJ3 g;  2GGR A;  4O5V A;  1D3B A;  1OU8 A;  5KYY B;  4Z8A A;  2KVQ G;  2C0O A;  3U23 A;  1IGU A;  2IVW A;  2E3H A;  3VU3 C;  1VQP A;  1YWO A;  2KXC A;  3L2Z A;  2DAQ A;  4PJO C;  3EG2 A;  5CK9 A;  1BYM A;  3G6E A;  3S6W A;  1YIT A;  5M9O A;  1HD3 A;  3OS1 A;  1SKU B;  4FM4 B;  4JUV A;  2HD0 A;  2LRQ A;  2M0O A;  4KRT A;  4DOV A;  4BE2 A;  4NS5 A;  4FW1 A;  3CCV Q;  2OAW A;  5D6Y A;  2JJ9 A;  3EGD B;  3DB3 A;  3CD6 A;  3FIF A;  1VUB A;  2OTL T;  1IB8 A;  1QVF P;  3CC4 T;  1FX7 A;  2F5T X;  4ESR A;  3EGD A;  1Q81 R;  1UFF A;  2HNI A;  5CKD A;  3O8V A;  1WJQ A;  1Y07 A;  3X20 B;  3LH5 A;  3EG3 A;  1AWJ A;  4KBM B;  1JQQ A;  2LJ3 A;  2XMF A;  3FC3 A;  2XDD A;  1E6G A;  3QYG B;  2RHY A;  2FHD A;  3JCM Q;  2X3W D;  4Y28 E;  3RMQ A;  2EVR A;  4E7Z A;  1V76 A;  4C92 B;  3A8L B;  2GF7 A;  4QQD A;  3FDR A;  1MV0 B;  3L2V A;  1LJO A;  2B86 A;  2RI3 A;  5GAN 8;  2MYS A;  4C92 A;  4HT9 A;  1MGQ A;  1BCO A;  3OS0 A;  5D6X A;  2WSC E;  1QCF A;  3MCA B;  1IHV A;  3RBB B;  3FJ5 A;  2DL5 A;  1VQ5 A;  2KAF A;  1WPY A;  4ZNX A;  2R57 A;  4VUB A;  3I5R A;  2DIL A;  4XAX B;  3QZ5 B;  1AZG B;  3I35 A;  1RI9 A;  4DBQ A;  3ZBD A;  1VQ4 Q;  3QDR B;  4RTU A;  4C92 F;  4C92 G;  9ATC B;  2LQN A;  3M59 A;  2VXF A;  2XI9 A;  1ZSG A;  4XTZ A;  3QXE B;  4IUV A;  3OA6 A;  2LNH B;  2L2P A;  2R58 A;  1KHC A;  1JXM A;  3CCM A;  1ABQ A;  1ZUK A;  3NFC A;  4ELY C;  5AT1 B;  2VWF A;  2E41 A;  3R6N A;  3JB9 F;  2KSS A;  1H8K A;  3JB9 G;  1LPL A;  1AWO A;  2L3P A;  2K2V A;  1YJN Q;  4HVU A;  1M2V B;  1NJI U;  3V8K A;  2EYQ A;  4PLI A;  5IAY A;  2A37 A;  1W2B A;  2V8I A;  4II1 A;  3LYI A;  2YLB A;  3RNJ A;  3OS2 A;  2QA4 T;  2GQI A;  1MMD A;  2A28 A;  1M2V A;  3M0P A;  3LGL A;  1JBM A;  1BI2 A;  5GAM e;  2CP2 A;  2RN8 A;  2O31 A;  5GMK m;  1K4U S;  3QSU A;  4LN2 A;  1ACM B;  2DO3 A;  2DET A;  4ZGD B;  1G2B A;  4XQ3 A;  1GBQ A;  3JCM h;  2DXT A;  5LJ5 j;  3L2W A;  4DEY A;  2CP3 A;  2D9T A;  1M9S A;  5LJ5 h;  3CMA A;  1VQ6 A;  4RG2 A;  1VQ8 A;  1KG1 A;  2ZPG B;  4ZTF A;  1Q7Y U;  2DTH A;  2M16 A;  3TU4 K;  2EIF A;  1VQL A;  2LCS A;  3CCE A;  2Z0W A;  2NLU A;  6AT1 B;  2L3Q A;  2HKQ B;  4KGV B;  1AEY A;  2IG0 A;  4KUL A;  2F5K A;  8ATC B;  1BU1 A;  2DBM A;  2ZZD A;  4A4F A;  4X34 A;  1GBR A;  2K3Y A;  3CPW A;  3OS5 A;  4O6J A;  4RMO A;  1TWB A;  2HL3 A;  1RAB B;  4M7A D;  4C0G A;  2RM4 A;  2JMA A;  3RDV A;  4OP0 A;  1JB0 E;  2DL3 A;  2CRE A;  4A53 A;  1U8R A;  4HKE A;  4XTW A;  1S72 Q;  2EBP A;  2G3R A;  3JCM g;  1KQS P;  4WF2 A;  1X6B A;  1ZUU A;  2CSI A;  2E6N A;  2XU8 A;  2BZX A;  1X75 C;  4EMK B;  1WLP B;  2ESW A;  3H41 A;  5GJV B;  4C5G A;  2J6K A;  1VQK Q;  4HCB A;  4JJD A;  1FMW A;  3H9N A;  4J9F A;  5GAN 6;  2MCN A;  1SHF A;  4N4I A;  4CC3 A;  2JT4 A;  5FWB A;  3G71 A;  4KT0 E;  1PKS A;  1X69 A;  1H3H A;  1PRL C;  2K3X A;  4MDX A;  3X28 B;  1SRL A;  1AZE A;  4X9C A;  5A0L A;  5GMK l;  1IXD A;  3OYH A;  2J6O A;  1VA7 A;  3M53 A;  1K73 U;  5LJ3 f;  4E7H A;  2NUT B;  4IKF A;  2EYW A;  5EC7 A;  5GMK e;  1G3S A;  4Z02 A;  2VGM A;  1QCO A;  4DOW A;  2AIR B;  3CCR A;  2D1X A;  2QAS A;  4J8O A;  5CKH A;  3BE3 A;  1D1A A;  2K6D A;  5A2Q E;  1N5Z A;  2MWP A;  2QQA A;  2BE9 B;  3J80 E;  1JXO A;  1T3S A;  3CCV T;  2VKN A;  4IUR A;  2K57 A;  1TSF A;  4HXJ A;  2FRY A;  4C0Z A;  4RKU E;  4WTO B;  4BDZ A;  3CCS A;  3HFN A;  3M5A A;  4EPC A;  3EG0 A;  1KHI A;  3OYB A;  3CXC P;  1ZSZ A;  1UHF A;  1RAD B;  4C5H A;  2RH2 A;  4RTY A;  3CCJ Q;  3CCL A;  1TXQ A;  1KQ2 A;  4M75 E;  2XIC A;  2KXD A;  5AYF A;  1VQO Q;  1ARK A;  1NJI C;  1GRI A;  2EQM A;  5DLO A;  4OVA A;  1QVG A;  4M7D B;  1Q86 U;  1VYT A;  1MMN A;  4M78 B;  1VQ9 A;  2LJ1 A;  1W2B S;  2DYI A;  2RHZ A;  4OMQ A;  4E7K A;  1G3Y A;  3OYN A;  2YSQ A;  4CRI A;  1NJI R;  1NLO C;  1AOJ A;  1VQN A;  2P0Q A;  2DJZ A;  4QQG A;  1HYO A;  4CI0 C;  3OYC A;  1IZ6 A;  1WZO A;  5FLX E;  4BI3 A;  4GY5 A;  3OQ5 A;  4JDS A;  4UC4 A;  1Q7Y C;  3H0I A;  2K5F A;  3JB9 J;  5D6W A;  3CC2 Q;  1U06 A;  1NE8 A;  1NLP C;  4JLG A;  4M77 A;  2B8A A;  3TVT A;  1TG0 A;  4Y91 A;  2HQE A;  4ME7 A;  4BI4 A;  1ZSZ C;  2AZS A;  3LLR A;  2ZPI B;  5GAN g;  4M7D F;  4E7J A;  3BDU A;  2DD5 A;  4RG8 A;  3M9Q A;  1NEG A;  4C8Q E;  1VQ4 T;  4M78 F;  3M0T A;  1Q7Y R;  3ZEH A;  3A8G B;  4HCK A;  3M56 A;  2XID A;  1YP5 A; 
#chains in the Genus database with same CATH homology
 1HXD A;  2JVV A;  2XDP A;  2ZPF B;  1YJ9 T;  1N6A A;  1R8O B;  3L1A A;  3OYA A;  3Q1J A;  2E1H A;  3CCV A;  4EMG A;  3V7C A;  1N9S A;  1X6O A;  1KC8 C;  5KE3 A;  3CPW S;  2KDS A;  3EAE A;  5GAO r;  3JB9 I;  4M77 F;  2XG8 D;  5GAN 4;  3F70 A;  3C4S A;  4N0A C;  4LDW A;  4M77 G;  4V2S A;  3JCM c;  4B9W A;  3OYJ A;  3S3M A;  5GAO l;  1M5Q 1;  4M77 E;  2DD4 A;  3KUF A;  5GAN e;  4E7L A;  1G5V A;  3OYE A;  2LTO A;  2Y4X A;  1YHQ A;  2VUB A;  3CBM A;  2X4X A;  1BIA A;  1TH7 A;  4N4H A;  5LJ3 g;  1BI1 A;  5IN1 A;  4O5V A;  1KQS A;  1WGS A;  3TRE A;  3N5B B;  2P4T A;  2OTJ A;  3I56 A;  1YJN T;  1D3B A;  4HT8 A;  2QI2 A;  5FU7 C;  1I4K 1;  2KVQ G;  1QVF S;  4DQ2 A;  5FU6 B;  4A4H A;  3CME A;  5GAO p;  3OYM A;  1PSF A;  1U1T A;  3PFS A;  5J39 A;  2JTM A;  4OGC A;  3G4S T;  4KUD K;  4JS4 A;  2IVW A;  4JRP A;  5EG2 A;  3VU3 C;  1VQP A;  2VXE A;  3OW2 A;  3CCU A;  3L2Z A;  3V8L A;  3LWH A;  1XTD A;  4BDY A;  4FIB A;  2CKK A;  2DAQ A;  4PJO C;  1VQ5 T;  2YRV A;  5LJ3 e;  5CK9 A;  1BYM A;  3CBO A;  1G3W A;  3SWN A;  3G6E A;  1UB4 A;  1M1K U;  3S6W A;  3WVD B;  3TEE A;  5KE2 A;  3PMI A;  1YIT A;  5M9O A;  1JJ2 A;  3MO8 A;  4JJN K;  2YHT A;  1U1S A;  1K73 C;  3OS1 A;  2MWO A;  1K9M U;  4FM4 B;  3EFS A;  2EKO A;  3EFR A;  4JUV A;  4EMK C;  2HD0 A;  2LRQ A;  1YHQ T;  3GP8 A;  1Q82 U;  2M0O A;  2KQW A;  3MEA A;  1SSF A;  4DOV A;  4N4G A;  4BE2 A;  2K5L A;  4NS5 A;  3ZFJ A;  1M90 C;  5GAN j;  2EJ9 A;  2PVD B;  5D6Y A;  3G7Z A;  3QUI A;  4RCB A;  2FVU A;  4ZN3 A;  3JCM d;  3KXT A;  4OB2 B;  2PVO B;  2RI5 A;  5CQX A;  3DB3 A;  5GAN h;  2LQK A;  3CCM T;  3CD6 A;  3FIF A;  2GQV A;  1VUB A;  2OTL T;  1M1G A;  2JN0 A;  4C5I A;  5LJ5 d;  4A54 A;  3CC4 T;  1FX7 A;  3OMC A;  3DKM A;  2F5T X;  4IUU A;  4E7I A;  1LNX A;  4HCC A;  4P5N A;  4Q5W A;  2HNI A;  1X01 A;  2LC4 A;  3MEU A;  5CKD A;  3OBY A;  3O8V A;  4A4G A;  3I55 A;  1WJQ A;  1Y07 A;  3X20 B;  3FJP A;  4RCC A;  3LW5 E;  1VQ4 A;  1O75 A;  1QP3 A;  3MEW A;  1B34 A;  1RL2 A;  4HA8 A;  5GAN 5;  1YJW T;  2A7Y A;  3E19 A;  5CR2 A;  2GFA A;  4KBM B;  3C94 A;  4M7D A;  3FC3 A;  1YJ9 A;  2XDD A;  5GMK i;  3HFO A;  4QW2 A;  3QYG B;  5GAN 7;  5LJ3 j;  3ASK A;  4M78 A;  2RK2 A;  5IT9 E;  5CO7 A;  1S72 T;  2VV5 A;  2RHY A;  3JAM E;  5FU7 B;  5LJ3 h;  2LCC A;  2FHD A;  3CXC A;  1YBY A;  3JCM Q;  2DKG A;  3P8D A;  2HQX A;  2P0K A;  4Y28 E;  3RMQ A;  3OYY A;  3NTH A;  5L8R E;  2X4W A;  4J83 A;  4C92 B;  2XHC A;  3A8L B;  2RHX A;  2GF7 A;  3CD6 T;  3QJ6 A;  2D0Q B;  3M55 A;  3M4G A;  1WNL A;  4PKC C;  1YCY A;  1K8A U;  3V7S A;  5GAM d;  4QQD A;  4MDW A;  3FDR A;  2CZ1 B;  3L2V A;  1VQK T;  3PNW C;  1YJN A;  1LJO A;  2RI3 A;  5DLQ E;  4BD3 A;  4OGE A;  5GAN 8;  3CEY A;  3CMA T;  4C92 A;  4HT9 A;  1MGQ A;  1OZ3 A;  1VQ8 T;  4HCZ A;  3OS0 A;  5J3B A;  5D6X A;  2BUD A;  4OMF B;  4M7D G;  1IRE B;  3J7A F;  3VV0 A;  4M7D E;  4X9D A;  2EJG A;  2WSC E;  5KCH A;  2CYZ B;  1Q86 C;  3CC7 T;  4M78 G;  1KD1 U;  1VQL T;  4M78 E;  4L5G A;  5LJ5 g;  3MCA B;  1OYX A;  2DK3 A;  2FB7 A;  1VIE A;  3JRZ A;  5CKB A;  4ZTJ A;  3CCE T;  1UGP B;  2FYK A;  5FRM A;  2RO0 A;  2QEX T;  1VQ5 A;  2WSF E;  1H64 1;  1WPY A;  2KAF A;  3VJP A;  1QVG S;  3RIR A;  2R57 A;  4J7I A;  5A0D A;  3RKX A;  1QW1 A;  4VUB A;  4MZM A;  3DLM A;  3V8J A;  4OB0 B;  4XAX B;  3QZ5 B;  4C0D B;  5A0G A;  4C92 D;  3ZBD A;  3JCM e;  3QDR B;  3M4Y A;  4C92 F;  1FXX A;  4YTL A;  4C92 G;  3M59 A;  1EIF A;  2XKO C;  4L59 A;  3QKJ A;  4QVZ A;  1I8F A;  2VXF A;  2XI9 A;  3JCM V;  5LJ5 e;  1K8A C;  3NTK A;  4XTZ A;  4DA4 A;  3QXE B;  4IUV A;  3OA6 A;  2DVE A;  3JCM J;  1VQO A;  1N8R C;  2R58 A;  1KHC A;  4A4E A;  5GAM f;  4C8Q C;  4M7D C;  3CCM A;  2DZC A;  1Y96 B;  3QJY A;  4BY6 B;  3NTI A;  3MET A;  4E47 A;  1KQ1 A;  3HRS A;  3NFC A;  2QTX A;  2OTL A;  2M1H A;  4M78 C;  4ELY C;  4BAC A;  3CC4 A;  4QQ6 A;  3JB9 D;  2DXU A;  1Q81 U;  2E41 A;  2K4Y A;  3JB9 F;  2KSS A;  3PMT A;  5CVI A;  3JB9 G;  4F7U B;  2CZ6 B;  2H3J A;  2RK1 A;  4XU2 A;  4M75 B;  1VQN T;  2RJD A;  3QBY A;  3URG A;  3LH0 A;  1WQW A;  1QP2 A;  2K2V A;  3GF5 A;  3OYL A;  2HAX A;  2XD0 A;  1YJW A;  4M77 C;  1NJI U;  2O01 E;  3OSV A;  4KUI A;  3V8K A;  2EYQ A;  4J6Y A;  4PLI A;  5IAY A;  2RD1 A;  1W2B A;  3HRT A;  2V8I A;  3J81 E;  2L5Q A;  4II1 A;  3LYI A;  4OF1 A;  2YLB A;  2DIG A;  4QVD A;  3OS2 A;  2QA4 T;  4JRQ A;  3WVE B;  4XK8 E;  1S72 A;  3JB9 H;  4JRI A;  1Y71 A;  2JNG A;  3LGL A;  1JBM A;  2PVG B;  2R5A A;  3G71 T;  1VQM T;  4BI8 B;  1BI2 A;  5GAM e;  3R6O A;  3PTA A;  3HRU A;  3GNG A;  1V29 B;  2JUF A;  2L3R A;  4MZT A;  3VUB A;  3HHT B;  5GMK m;  4B9X A;  3E1S A;  2HBP A;  3QSU A;  5GAO n;  1VQO T;  2DO3 A;  2EJF A;  1WQ7 A;  4M7A B;  4ZGD B;  1YIJ T;  4XQ3 A;  5CAI A;  2MF2 A;  2LNV A;  5I2M A;  2QDY B;  3JCM h;  2DXT A;  3QII A;  3QPH A;  3FEO A;  5LJ5 j;  4BE1 A;  1VQK A;  3L2W A;  3VYG A;  2D9T A;  1NZ9 A;  1KQS S;  1ZHI A;  2DTO A;  2PU9 B;  2E70 A;  1M9S A;  4JRK A;  5LJ5 h;  5I2S A;  3CMA A;  3H6Z A;  4FSX A;  3SD4 A;  1VQ6 A;  4M7A A;  4RG2 A;  1VQ8 A;  4M75 D;  3X24 B;  3DLL A;  1KG1 A;  4IUT A;  2ZPG B;  4ZTF A;  4M75 F;  1Q7Y U;  2DTH A;  2DXB A;  3CCR T;  3OBW A;  2RJF A;  1ZBX A;  3BY7 A;  3CC7 A;  2MI6 A;  4MMK A;  2M16 A;  3TU4 K;  2EIF A;  3L2R A;  2LDM A;  1VQL A;  2EQU A;  3T9N A;  2AHJ B;  3CBP A;  3GNF B;  4LDV A;  3CCE A;  1Y7X A;  2CS7 A;  2NLU A;  3QO3 A;  4N0A A;  2CGH A;  3OW2 S;  4PNO A;  2RJC A;  5KH6 A;  2QEX A;  1M1K C;  2IG0 A;  2L89 A;  4J7F A;  4KUL A;  3S3O A;  3M58 A;  5CKE A;  2F5K A;  1K9M C;  2E12 A;  3INZ A;  3ME9 A;  2ZZD A;  3CCQ T;  4ZGE B;  1LOJ A;  4A4F A;  2LQ8 A;  2QQ9 A;  4X34 A;  1Q82 C;  3SDZ A;  2K3Y A;  3CPW A;  3RER A;  3JCM W;  3OS5 A;  3CCS T;  3A8O B;  4O6J A;  4MZP A;  5DY9 A;  4RMO A;  1JJ2 S;  3CC2 T;  2RHI A;  4C0G A;  4M7A D;  4BUG A;  5FU6 C;  4M7A F;  3HL8 A;  2BIV A;  3TCJ A;  4C0F A;  3GIB A;  2RHU A;  2RM4 A;  3ER0 A;  2KK4 A;  4M7A G;  4OP0 A;  3FRN A;  2C06 A;  3OYK A;  4M7A E;  1JB0 E;  4LDU A;  3A5Z B;  4PJO B;  3QG1 A;  1JRI A;  3SWN C;  1G3T A;  5FRN A;  3C95 A;  4A53 A;  3X26 B;  3FB9 A;  1U8R A;  5GAM h;  4HKE A;  1UGR B;  4XTW A;  1WJR A;  1VQ6 T;  2DPP B;  4M77 B;  4ZGJ B;  2G3R A;  3JCM g;  1UGS B;  2PQW A;  2V8J A;  4WF2 A;  2EFI A;  3QZ9 B;  5HKC A;  1YI2 A;  3OSS C;  1QVF A;  4PJO A;  2M9U A;  2E6N A;  3SFM A;  2XU8 A;  1X75 C;  4EMK B;  4XU0 A;  4JS5 A;  5KCO A;  1AHJ B;  2F69 A;  3DB4 A;  4LD9 K;  2JOY A;  5GAN f;  4C5G A;  3OYD A;  4J5Y A;  3GPL A;  3X25 B;  3RMS A;  3OY9 A;  4HCB A;  1XNI A;  3JCM P;  1PSE A;  3H8Z A;  3VUZ A;  3BDL A;  3VYH B;  3WXM B;  2PUO B;  1VQ9 T;  2EQK A;  5GAN 6;  4XTX A;  2QA4 A;  3CCJ A;  2DEQ A;  2DZ9 A;  3E9F A;  4N4I A;  2OAU A;  3G71 A;  4KT0 E;  4C92 E;  2ZPH B;  1VQM A;  2L8D A;  5CKF A;  2DTI A;  4PJO D;  3KBG A;  1MHN A;  4FT2 A;  4PJO F;  3BW1 A;  3SB2 A;  5GAO q;  3CXC S;  2V8K A;  4IUQ A;  2K3X A;  4PJO G;  4MDX A;  3X28 B;  4J6W A;  1N27 A;  2X4Y A;  1Q7Y C;  1M1F A;  1OZ2 A;  4X9C A;  2WSE E;  1XQH A;  4M77 D;  5A0L A;  5CCA A;  5HK3 A;  5GMK l;  2I2L A;  3OYH A;  1VQ7 A;  1M8V A;  1YIJ A;  3M53 A;  1K73 U;  2X35 A;  5LJ3 f;  4E7H A;  1YI2 T;  1M4Z A;  5CIU A;  4IKF A;  2GCX A;  2P0P A;  1D3B B;  2CZ0 B;  1UEB A;  5GMK e;  3A8M B;  1G3S A;  4Z02 A;  3BFM A;  2VGM A;  5GAM g;  1I81 A;  3GLX A;  3HPW A;  4PLL A;  4DOW A;  2D6F A;  4EMH A;  1KD1 C;  4D6W A;  2E5Q A;  4ELZ C;  1M90 U;  1Y96 A;  3LGF A;  1RI0 A;  2YLC A;  2Y4Y A;  2LT1 A;  3P8B B;  3CCR A;  3RKY A;  1NPP A;  4J8O A;  2EWN A;  5CKH A;  4ZN1 A;  4FU6 A;  3PIO A;  2E6Z A;  3L2U A;  4LDY A;  2KY9 A;  3MP1 A;  4F7U A;  2PUK B;  3S3N A;  2DIQ A;  5A2Q E;  4BE0 A;  4M75 A;  2MWP A;  2QQA A;  4OB3 B;  2JTF A;  3MP8 A;  3CCJ T;  3SWN B;  3AHU A;  4ATO A;  3C12 A;  3J80 E;  4C92 C;  4LD6 A;  3PGG A;  3MP6 A;  3CCQ A;  2ZCF B;  3P8H A;  3CCV T;  2LT4 A;  4IUR A;  2K57 A;  5DM7 R;  4C0Z A;  4RKU E;  5GAN 2;  2QXF A;  4NL3 A;  3CCS A;  4BDZ A;  1FWZ A;  3JCM b;  3HFN A;  3M5A A;  5GAN 3;  3CC2 A;  4EPC A;  3MEV A;  1KHI A;  1O9S A;  2JZ2 A;  2MAM A;  5HK0 A;  1UGQ B;  3OYB A;  1VQ7 T;  4NOY A;  5GAO m;  2LCL A;  4C5E A;  5C0M A;  4FT4 A;  4J6X A;  4IUP A;  4C5H A;  2X4J A;  3RUX A;  2VC8 A;  2RI2 A;  5C6S A;  4R55 A;  5J26 A;  2RH2 A;  3JSC A;  3HKS A;  4PJO E;  3V7R A;  4F7U F;  2E65 A;  3OYG A;  1Q81 C;  2LVM A;  3CCL A;  4XTU A;  4F7U G;  2OTJ T;  3GOX A;  4F7U E;  3I56 T;  1KQ2 A;  4M75 G;  5GAN d;  2XDB A;  3L42 A;  1VIF A;  2E64 A;  3CPF A;  2XIC A;  4M75 E;  1ZQ1 A;  5I21 A;  5GMK j;  4BB7 A;  5AYF A;  4FL6 A;  3CME T;  4QVC A;  2CZ7 B;  2BKD N;  5GMK h;  1DJ7 B;  4XTV A;  1H3Z A;  4XU3 A;  4C0D C;  1NJI C;  3MHX A;  1GXI E;  1XOV A;  2EQM A;  3A8H B;  2K5I A;  3HP9 A;  1B34 B;  2VGN A;  2E10 A;  3RES A;  3VKI A;  5DLO A;  3CCU T;  1VQP T;  3M57 A;  4XTY A;  3LWI A;  4OVA A;  2QQB A;  3UWN A;  1QVG A;  2WAC A;  4C8Q B;  2R5M A;  3PIP A;  1Q86 U;  3UT1 A;  4M7D B;  1BIB A;  2EQJ A;  3JCM X;  1W4S A;  4M78 B;  2ZGW A;  3RKW A;  1VQ9 A;  3G6E T;  1W2B S;  3E9G A;  5FRO A;  4L6V 5;  4JLI A;  2RHZ A;  4NL2 A;  4E7K A;  1YIT T;  1P92 A;  1G3Y A;  2KMT A;  4BY6 C;  4C8Q A;  3OYN A;  3OYI A;  1KC8 U;  1QVP A;  4EDU A;  4CRI A;  2Y90 A;  5GAM j;  5LJ3 d;  4PL6 A;  1NPR A;  1HK9 A;  3LX7 A;  3UDC A;  2P0Q A;  3UPU A;  4LDX A;  1VQN A;  2VYT A;  2MMP A;  2DJZ A;  2RA2 A;  4QQG A;  5CQY A;  3OYF A;  4CI0 C;  2QQR A;  3CCL T;  3OYC A;  1IZ6 A;  3QYH B;  5FLX E;  1I5L A;  4GLK A;  4M75 C;  4BI3 A;  4GY5 A;  3OQ5 A;  2A3L A;  2RB6 A;  2RJE A;  3PT9 A;  3QHS A;  2K5F A;  4JDS A;  1BI3 A;  2ZPE B;  4UC4 A;  5D6W A;  3JB9 J;  2GFU A;  2O4X B;  4OB1 B;  2QQS A;  1NE8 A;  3OB9 A;  4JLG A;  4M77 A;  2B8A A;  1WJS A;  2ZPB B;  2DXC A;  4Y91 A;  2XK0 A;  3M54 A;  4A4K A;  2LX9 A;  3JCM f;  1N8R U;  4MML A;  2HQE A;  3HSB A;  4R56 A;  5HY6 A;  4ME7 A;  4BI4 A;  4EMK A;  4C8Q D;  2O4X A;  3LLR A;  2ZPI B;  4TVR A;  5GAN g;  4M7D D;  4C8Q F;  4M7D F;  5LJ5 f;  3L2Q A;  3BDU A;  2DD5 A;  3I55 T;  4E7J A;  4XU1 A;  4RG8 A;  4C8Q G;  4M78 D;  3M9Q A;  1OI1 A;  2EAY A;  4C8Q E;  1VQ4 T;  4M78 F;  1BI0 A;  3G4S A;  1BKB A;  3ZEH A;  4M7A C;  3A8G B;  3OMG A;  5LL6 S;  3FLG A;  3M56 A;  2XID A;  1N9R A;  2FL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...