2XG8D

Structural basis of gene regulation by protein pii: the crystal complex of pii and pipx from synechococcus elongatus pcc 7942
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
b'SENYLNHPTFGLLYQICSFGDSKELFATLYAQRLFFLVAFDARGTRFEPIGRNEARMLVDNRLRQLRRDASLQEYNQLQQVFKQTFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITROGEN REGULATORY PROTEIN P-II
molecule tags Transcription
source organism Synechococcus elongatus
publication title Structural Basis for the Regulation of Ntca-Dependent Transcription by Proteins Pipx and Pii.
pubmed doi rcsb
total genus 20
structure length 87
sequence length 87
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2010-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF12058 DUF3539 Protein of unknown function (DUF3539)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.660 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xg8D01
2XKOC 2XG8D 3N5BB
chains in the Genus database with same CATH superfamily
2CH4A 2YUOA 4F7UF 1H3ZA 3UATA 3CMAT 2VWFA 1EX4A 1IHVA 4J7IA 4RUGA 5I11A 5GANg 2JM9A 1Q7YU 1HD3A 2VYTA 1K0SA 4M7DB 3VKIA 2DILA 1V29B 3LGLA 2QYZA 3OS2A 2LJ0A 3E1SA 1T3LA 3HKSA 1X75C 3CCUA 3WXMB 2HKNA 2O9VA 1N5ZA 1UJ0A 1K76A 2V1QA 4PFOA 2OTJT 5LJ5j 4D8KA 2X51A 4MDXA 1D3BB 2YSQA 2EPDA 2P0KA 2DLPA 1MNEA 5KYWA 5D6YA 2KXCA 4J9HA 3CMEA 5I22A 4RTWA 4BD3A 2V26A 5HK0A 4A63B 5EC7A 3QJYA 1ABOA 3CCJQ 3CMEQ 1M27C 2L5QA 5LJ3g 3JCMf 4C0FA 2J05A 3CCEQ 2BUDA 2RHZA 3CCST 2LVMA 2A08A 1X6OA 3L2RA 2ZCFB 2EYYA 4F7UE 3VYGA 4DEYA 1RABB 1VYUA 1QVPA 2DO3A 3OYHA 3PFSA 2M0OA 2DD5A 4PL6A 1TXQA 3QDRB 1M2VA 1JJ2A 1QW1A 4OP0A 1H92A 2M1HA 2K9GA 5IHNA 4HT8A 3S3NA 4HCCA 3CCJA 4X1VA 4PJMA 2A3LA 1RAFB 2QASA 1MMAA 2RA2A 1YITQ 2LMJA 1VQ6T 1AWWA 1D1CA 3M56A 1VQ5Q 3A8HB 2MCNA 1UJYA 2ZGWA 1O75A 3JCMg 5HK3A 4Z8AA 3BY7A 3L42A 3JCMP 2KK4A 1BU1A 3CBOA 1KFZA 1KG1A 4PFPA 5KE2A 1X27A 3OYJA 2C0OA 4KH1B 2KYBA 5CCAA 2QQSA 1FMWA 2XD0A 2FEIA 3UA7A 3G6EQ 1EFNA 4LDYA 4HCBA 4AG2C 2ZPIB 1ZQ1A 2EJ9A 4IUTA 1KQ2A 4BE1A 2VB6A 1WYXA 4OMMA 1GRIA 4M7AG 2EIFA 4CC4B 4IKFA 2QEXT 1VQMA 3CCUQ 2E70A 4FW2A 4HVWA 2P4RA 3M9QA 1N8RR 3TSWA 3NPFA 1K73U 4QT7A 4RTZA 2YRDA 1MHNA 2EBPA 4RKUE 1YJ9Q 2A37A 2F1LA 5GAMj 1WXUA 4FT2A 1XOVA 1W70A 2DRKA 1YNZA 2DX1A 3CCMA 4LE9A 4F7UB 2JVVA 2KNBB 3MEAA 3ASKA 3A1PA 2E3IA 1NPPA 1Q82C 3BE3A 2RQVA 4RCCA 5KYNA 1KIKA 2JTMA 2WSFE 3REBB 4ZN1A 3SDZA 1Q82U 2GQVA 2JS0A 1IZ6A 4J9IA 2JUFA 4OMNA 1K8AU 4JUVA 2LCLA 4J6WA 2O88A 3O8VA 1E6GA 2DBMA 5KH6A 1WPYA 4E7IA 1WJQA 2E5QA 4PFZA 2JW4A 1RAAB 4M7AC 2XDBA 3RERA 1G3SA 3VS6A 2AT1B 3VU3C 1W2BP 2GFAA 1B34B 3VS7A 1M90C 2YUQA 2GTOA 3OBYA 2L89A 2GBQA 2LC4A 1OEBA 3CD6T 4A4KA 4XQ3A 2O9SA 1PG5B 5FLXE 1M1KC 2F2WA 4ZNXA 1JB0E 1S72T 3WVDB 4M75G 1OZ2A 1SRLA 1GCQA 4XU0A 1BKBA 1KD1C 1OZ3A 1QVGS 3BDUA 4M77B 4RG2A 3V7CA 3TQ7P 2CT3A 5IXFA 1UHFA 4Z88A 3U23A 3CMAQ 3SWNC 1KQSA 2QA4Q 2W10A 1OQKA 1WI7A 3J81E 1AD5A 2SRCA 3I9QA 4EMHA 1BB9A 3JRZA 2M51A 2CS7A 3NTKA 1VQKQ 3R6OA 3M0SA 2CP3A 4QQ6A 2M02A 5IH2A 4A4HA 1YJWT 2DL8A 2DEQA 2K5FA 3SHWA 1N9RA 2LTOA 3E9GA 1QVGP 5FROA 3PNWC 1Q95G 4CC7A 1JRIA 1D0XA 1TWBA 3RMQA 3I56A 1IRXA 1XTDA 2WACA 2OX7A 3A8OB 3LWIA 2ENMA 5GAMe 2LJ1A 3OSSC 1WHLA 1TU0B 1BI3A 2EWNA 2DIQA 5A0DA 3H9NA 1C1AA 1UTIA 3PT9A 3ZBDA 2E10A 1RADB 2DL7A 2JOYA 2MIOA 1YWOA 4JJNK 2EQMA 2XG8D 3OS1A 5CR2A 4JLIA 5CK9A 2CYZB 1X01A 2D8JA 2ED1A 3RKWA 3CC4Q 3OYEA 2K5LA 4C8QD 1OPKA 3DKMA 1RI9A 2JM8A 1NLPC 3JCMh 4ZN3A 2FPEA 3CC4A 3CCMQ 4QQGA 4ZGEB 3OYFA 2LNHB 4KRTA 1YHQA 2BE7D 3NTHA 2X4YA 4BB7A 3OBWA 1B7TA 3MEVA 1VQ6Q 1Y57A 2E5KA 1X6GA 3CXCA 3WVEB 4IIMA 2F5TX 3H0IA 1QMCA 2A0FB 5M9OA 1M3AA 2EGCA 1ZSZA 1ZX6A 1KC8U 1O9SA 1VIFA 1QVFS 2WSCE 4J83A 3R6NA 4OGCA 4JJCA 3C4SA 1ZUUA 2RQTA 2ZPFB 7AT1B 2OTJQ 2J06A 1SSHA 4DOVA 5GAN4 3G1JA 5IAYA 2B8AA 4KUIA 1H8KA 2OTJA 3CBMA 2XICA 3EG2A 1LJOA 2DAQA 1G5VA 3PE0A 4ELZC 3I55A 4NL3A 2Y90A 3RNJA 1OV3A 4P5NA 3CPWA 2RI5A 1YCYA 5FWCA 1WXTA 3CCUT 1BIAA 2QGGA 3OS0A 3M59A 1UG1A 3HTRA 3JCMe 5LJ5d 1PRLC 2RJEA 3DLLA 2MMPA 3QJ6A 3HFNA 2EYWA 4OB2B 2HQHA 4F04B 4JJDA 1H3HA 4MDWA 2FPFA 2D1XA 3LYIA 5GJWB 2CP7A 1GL5A 4EMKC 2DJZA 3UPUA 2PVDB 5FU6B 2PUKB 4BE2A 1ZSZB 3I5SA 3OB9A 3ER0A 4C92A 2LJ3A 3HRTA 1I8FA 1S72A 1KSWA 2HBPA 3VS2A 1AWOA 1UGRB 1OU8A 1NG2A 1D1BA 3LGFA 2EKHA 3H6ZA 5GAMh 3CMAA 4D6WA 3CC2Q 5LJ3h 5KE3A 1FX7A 3QG1A 2QI2A 1N8RU 4M75D 2EQKA 2DMOA 3MJXA 1VA7A 2AZVA 5HCKA 4C0DC 1M2OA 5KYXA 4KGXB 2FHDA 1UUEA 1Q81R 5GMKm 2DETA 3CCMT 2HL3A 3V7RA 3GNGA 3I56Q 3I35A 2DF6A 2HAXA 4M7AE 3QPHA 1KHIA 1X2QA 4JRIA 4DQ2A 2KT8A 1IHWA 4D8DA 4R0KA 3LX7A 1OOTA 4M78C 5FWBA 4C5IA 3PIPA 3VYHB 2K4YA 2DJQA 3QIIA 2W0ZA 1OYXA 1DJ7B 4RTYA 3CCSA 1G3WA 3EH2A 3C95A 2JJ9A 4OMPA 3URGA 2L3RA 5CO7A 3QWYA 2RHUA 4AFQC 3OYDA 4JRKA 2DVEA 2KSSA 2XIDA 3SEMA 4HVUA 2QTVA 5DLQE 4XU2A 1BCOA 4JDSA 2DYIA 5LJ3f 4LDWA 4C0GA 1BBZA 3CC7Q 1YI2Q 2LDMA 1NJIR 1WX6A 4PK4A 4B6MA 1AHJB 1HSQA 1PNJA 1VOMA 3MEWA 1BCMA 3JCMQ 2D0NA 3MP1A 2A7YA 1FXXA 3MEUA 1YIJQ 2CP0A 1UGSB 2HKQB 2RK2A 3DB3A 1UE9A 2RO0A 4PJOD 3CC2A 3GBQA 2ECZA 2V8IA 2MOXA 1M1KU 3DLMA 4Z02A 2DNUA 1OPLA 1NJIU 4M78B 5LJ3d 2QAZA 2CKKA 4F17A 3A8LB 2BZXA 2QQ9A 2G3RA 1GFDA 5GAOr 3INZA 5LL6S 2EYXA 2H3JA 1VQNA 2YUPA 2SEMA 3JCMc 4C0ZA 2KDSA 3JB9J 3SFMA 2AKLA 3S6WA 2E6ZA 2MWOA 1TTHB 1M5Q1 4JRQA 3RR6A 2CZ6B 1KQSS 3CCRT 3F70A 3JCMW 1K8AC 1YJWA 1VQ6A 4M7AD 1NPRA 1R0BG 4EDUA 1M8VA 1VQ4T 4E47A 5CQYA 3QZ5B 4CC3A 3M53A 2LT1A 2VC8A 3KBGA 2DA9A 1M90R 1NZ9A 3A5ZB 3X25B 1Z9QA 2ZPBB 3GIBA 1KK7A 5GMKi 4M7DG 2QGFB 4M7DC 1KC8C 2LZ6B 1JJ2P 3CC7T 1MMGA 4J9GA 3EG3A 4KH0B 1Q82R 2FRWA 1V76A 2CUBA 1I5LA 3L2UA 5GAMd 4M7DE 1JU5C 3E19A 2HDAA 4A53A 1K8AR 2QXFA 1CSKA 5CKBA 3VS3A 3H0FA 1ZBXA 1ZHIA 2K2MA 4X9CA 5GAOn 1B07A 1M2VB 2ESWA 4LDXA 1IGUA 3CCVT 2E1HA 2XK0A 2E65A 1PWTA 4M75E 1PC0A 5D6WA 3CCEA 4R55A 3EGUA 5GMKl 4KT0E 4M7DA 2Y4YA 3J80E 3RUXA 4JZ3A 5J26A 2X4WA 3EHRA 3P8DA 4M78D 4PJJA 1B3QA 3PIOA 2L0AA 1GBQA 4NS5A 4DA4A 1YP5A 2CZ1B 1LNXA 1JEGA 1Y07A 1GFCA 3CEYA 1WA7A 4QQDA 5KYUB 2KEAA 1J3TA 5DLOA 3SD4A 3I5RA 1SHGA 3MP8A 1M4ZA 1VYTA 4C5EA 3EAEA 5D6XA 4M7DF 4E7KA 3JCMd 2I2LA 3OYBA 4EIKA 3NHNA 2FYKA 4C8QE 3QXEB 1C6VX 3OW2P 1D0ZA 4KGZB 4X34A 4AMCA 3OYAA 2M9UA 3JB9G 1NEGA 2NLUA 4AFUC 2GFUA 1WNLA 1JO8A 1TUGB 1WJRA 2Y4XA 3G71A 5IN1A 3VRYA 5LJ3j 2QQBA 2FZGB 4AFSC 1SHFA 2E6NA 3KFVA 1NEBA 3QBYA 4OMQA 3KUFA 4LNPA 2LX9A 2OJ2A 1IB8A 1VQ9Q 4JPBW 3S3OA 3OMGA 4FL6A 2R5AA 3L1AA 3NFCA 1ACMB 2HCKA 3L2VA 4XTXA 1R77A 3OYMA 2DYBA 4Y28E 3G71T 3CXCS 2KVQG 3VRZA 4E7JA 1YJNT 1VQ4Q 2OTLQ 1W1FA 2EQJA 1EIFA 4PLIA 3REAB 2ZZDA 3TSZA 4HCKA 2MYSA 1KQ1A 3V8LA 3G4ST 3MO8A 4FYWB 2GGRA 3M4GA 1U1TA 5LJ5e 1QVFA 4J7FA 1Q86R 5LJ5h 2D9TA 5GAOl 2E41A 2J7IA 8AT1B 2COYA 4IIOA 2FZKB 2PUOB 2HSPA 2RHXA 4IUVA 5DM7R 5HKCA 1VQ9A 5A0LA 1C0MA 3RMSA 1VIEA 4WCIA 1QWEA 2YHTA 4BI3A 1U5SA 1JQQA 5CQXA 1PSFA 4FT4A 3V8JA 3G6ET 1MV3A 4BI4A 2YRVA 3EFOA 2QQAA 2DTOA 1QP3A 2QEXQ 3M0QA 8ATCB 3TREA 1AZGB 3SWNB 5GAMg 3J7AF 2NWMA 2K57A 3VS5A 4MZPA 2DEUA 3RESA 1WDXA 3QO3A 2K3XA 1BI1A 2ROTA 2CUDA 2EKOA 4FYYB 4RG8A 3VS1A 4XTVA 3A98A 3CCQA 3M54A 3OYKA 1G83A 1RAHB 2PQWA 3QZ9B 4VUBA 2HZYA 4DBRA 1LPLA 4N0AA 4E7ZA 4J9DA 4L6V5 3KXTA 4JRPA 5GMKj 2X3WD 2P0QA 1YJ9A 3CCQT 1YFNA 1TOVA 3JB9H 2DVJA 4KUDK 1VQKT 3EFRA 4A4FA 1QVGA 1VQOT 1H641 5GAOm 4JS4A 2F69A 4RTXA 3EG9B 5A2QE 3PTAA 2ABLA 1KD1U 2DTIA 5GJVB 1YHQQ 1SG5A 3JAME 4QW2A 3LH5A 2EW3A 2LT4A 3VUBA 1ZSGA 2ZPEB 2MK5A 4M7AF 5J3BA 2HQEA 1FMVA 1HJDA 1R0CB 1KQSP 2PNIA 1IXDA 1WFWA 4C92F 1AT1B 1RI0A 4UC4A 2NYSA 1I5OB 3QDFA 4E7SA 4KULA 1YN8A 2X4XA 5ECAA 5EG2A 1Q7YR 3G71Q 3EGXA 2IPOB 5AYFA 2L8DA 5CIUA 2EGEA 4ZGJB 3GF5A 3QKJA 4M78G 3G4SQ 2L3PA 1PKTA 3RKYA 1SSFA 2YLBA 4J9EA 3PMIA 2RN8A 3I55Q 1YJNQ 2OTLT 1M90U 2KGTA 3M57A 9ATCB 1YJNA 1Q81U 1Q86C 1ZBJA 4ZGDB 4FM4B 1K73C 3CCLT 2K6DA 5AT1B 4MMKA 1YCSB 1YJWQ 2EGAA 3OYGA 4E7HA 3ULRB 2KXDA 3HP9A 4RMOA 4PJOC 2DD4A 3CCQQ 3JV3A 2F5KA 4DBHA 3JCMb 3UA6A 4XAXB 2F2VA 4XK8E 3EG9A 4XU1A 5CKHA 1S1NA 2P4TA 2IIMA 4C92E 4OB1B 2MAMA 3HHTB 4PJOE 1RAIB 4M7DD 2AIRB 2KR3A 1D09B 1M3BA 1PSEA 5C0MA 3CD6Q 3P8HA 2O01E 2QEXA 1NYFA 1QVFP 1M8MA 2YRCA 1YIJA 1ZA2B 4QVZA 1JXOA 1N9SA 2YXYA 2JTEA 3EGXB 4EMGA 1VQOA 3OS5A 4V2SA 2FZCB 4Z89A 1WGSA 3A8MB 1TS9A 3CPFA 1UECA 5KCOA 3L2ZA 4L59A 5GAOp 2R5MA 5IT9E 1UGPB 2DERA 5IHKA 2DZ9A 1TG0A 1VQMT 4OGEA 4FIBA 1M3CA 2DL4A 1VQKA 6AT1B 3CCLQ 2ZPGB 3P8BB 4Q5WA 2NUZA 2KT1A 2VXEA 1I0CA 2EQIA 1G2BA 3FRNA 2CREA 4DEXA 2CZ7B 4DBFA 1OX9A 3FIFA 1E6HA 3C94A 2D0QB 2EJFA 2RQRA 3VUZA 4TVRA 3CCRA 2RB6A 2CZ0B 3X28B 1K9MR 2BIVA 2LQNA 2DXBA 3MP6A 2K2VA 3H0HA 1YHQT 3OMCA 3JCMX 2HBWA 1F1BB 5CVIA 3QHSA 1QQJA 4M77D 3UDCA 3LW5E 3DB4A 4C0DB 1T0HA 1X69A 3JB9F 1VQOQ 1VQPQ 4N4GA 1QWFA 3CCSQ 1GCPA 1B34A 4PJOB 3M5AA 1PD1A 4FYXB 1BI0A 1MMNA 5FU7B 2XDPA 5CKDA 1VQ7T 3UT1A 4J9FA 1QCFA 2LQKA 2XHCA 5GANj 1CKAA 4C92D 2LRQA 3QSUA 2AKKA 3EFSA 5I2SA 3MCAB 2D8HA 3G7ZA 4PKCC 5CKEA 5KYWB 3CQTA 3EG0A 2RI3A 4PJOF 2GQIA 1I81A 2LCSA 2C0TA 2DL5A 2EAYA 1RACB 1ZUKA 3QYHB 1G8XA 2CGHA 3UF4A 2QG9B 5GANh 2L2PA 4MZMA 1ARKA 4M78E 2HQXA 2QQRA 2O4XB 2FPDA 3HFOA 3FC3A 2E4HA 2QDYB 2LQWA 4A54A 2PZ1A 3OW2S 2FB7A 3EG1A 4GLKA 2YLCA 2ROLA 1WIEA 1YIJT 1W2BA 1YI2T 3LLRA 3NTIA 1QCOA 1SKUB 1RL2A 1VQ4A 4BY6C 4YTLA 3FJ5A 1D3BA 2RH2A 1MMDA 5KCHA 3TEEA 5GMKh 1MUZA 3QYGB 3LWHA 1ZSZC 2V1RA 1BIBA 4KBMB 5I2MA 3PVQA 2RJCA 1WHMA 3FEOA 2RF0A 4OMOA 1RAGB 2MWPA 1BK2A 2HL5C 1AWXA 5C6SA 1G3YA 1OU9A 2K7AA 3CCET 1K0XA 1A0NB 4M75A 1Y7XA 4LD9K 4E2FB 2EFIA 1QCNA 2MF2A 4WF2A 1VQMQ 1U1SA 2Z0WA 1ABQA 1Q7YC 4X9DA 2YDLA 4RCBA 5L8RE 1VQ5T 4C5HA 2YUNA 4EMKA 4IUQA 1OX8A 5FRMA 2V8JA 3T9NA 3OYCA 3CCVA 2J6OA 4R56A 4F7UG 5GAN3 2KRSA 3I55T 4F14A 3PGGA 3GPLA 2VV5A 3RDVA 3META 1AWJA 2EQUA 3HRSA 2DFUA 2GF7A 2BZ8A 3PVLA 5KYUA 3Q1JA 3V8KA 4A4EA 4C8QC 5LJ5f 2RK1A 2RQWA 2IG0A 1VQPT 2OAUA 2MI6A 1KJWA 2KY9A 4M7AA 4M7AB 1Y71A 4BY6B 1T3SA 3FB9A 2O2OA 2H3EB 1D1AA 3CCVQ 4MMLA 1NM7A 2KQWA 1W6XA 3GNFB 4M77F 3MHXA 2NUTA 2NUTB 1Q86U 3OY9A 4O6JA 4N4HA 2FRYA 5CAIA 3G4SA 1UFFA 1TH7A 2D6FA 2KRNA 2GNCA 1FWZA 1VQNT 4FU6A 4PNOA 2DXCA 2DIGA 1YI2A 2FL7A 1U8RA 4J5YA 2DBKA 2RI2A 4C8QB 1UB4A 4C8QF 1WHKA 2KROA 2VASA 3EHQA 5GMKe 3SWNA 1VQLA 2ATCB 1YJ9T 1EZZB 1HXDA 5IHIA 2JMCA 2JNGA 3ME9A 1V1CA 1R8OB 4FYVB 2VXFA 2HEQA 4HKEA 1UGVA 2RHYA 4OF1A 2FO0A 1SRMA 4M75C 4PJNA 2X3XD 1RAEB 4IURA 4FSXA 4JZ4A 3FDRA 2H8HA 4NL2A 5A0GA 4WTOB 2L3SA 1BYMA 4GLMA 3OSVA 2CH4W 1QKXA 4PJLA 1PHTA 1VUBA 2K79A 2RM4A 3A8GB 1VQ8A 4M77G 1PKSA 1ZLMA 4LDVA 1K9AA 1IGQA 4RTUA 1JBMA 2M16A 3MKDA 1VQ8T 3UWNA 1WHHA 4N4IA 2LCCA 1VQ9T 3JB9D 2ZAEA 4BI8B 2BKDN 3AHUA 4AG1C 2M0YA 4XTZA 3THKA 2JN0A 3MPUB 4MZTA 1QKWA 5I21A 1WJSA 3IQLA 1UEBA 1M1FA 2KAFA 5FW9A 3PMTA 2NUPB 4PJOG 2I0NA 1WHGA 4C92G 4ZTJA 4DBQA 3OA6A 3LH0A 2J6FA 3ZL7C 2RJDA 4M77A 1NBEB 1KC8R 2QA4T 2X35A 5GAMf 1UDLA 4L5GA 3NMZC 1NLOC 1GXIE 2BE9B 5GAN8 3GP8A 5GANf 1AEYA 3FJPA 3M0PA 4F7UA 1VQLQ 1PM3A 1LCKA 3X24B 1SPKA 5CKFA 5GAN6 4ZTFA 2EYZA 4HCZA 4CC2A 2BZYA 3H8ZA 1K73R 4M77E 4J6XA 4BE0A 3BDLA 2VVKA 4O5VA 2K3BA 4FCYA 3RIRA 1Y96B 4BACA 4J9BA 1UGQB 3OYIA 4BDZA 2X4JA 4M77C 3JB9I 4EPCA 1FMKA 2JMAA 1Q81C 2CP2A 2AK5A 3E9FA 2VGNA 2DXTA 1QP2A 3CCLA 1NYGA 1S72Q 2JXBA 4LUEA 2LNVA 3CD6A 2G6FX 2RNAA 5GANe 4AFZC 1ZUYA 1NJIC 4B9WA 1RLPC 3HSBA 4M78F 4XU3A 4M75F 4ME7A 1IO6A 4OMFB 2DM1A 4CI0C 4XTUA 4HVVA 3L2WA 4GBQA 1TSFA 2F2XA 2A36A 4CRIA 1AZEA 2XDDA 2AZSA 4AT1B 2NUPA 4BDYA 5KYXB 5FRNA 5GANd 2HMAA 4KGVB 3CXCP 1M9SA 1P92A 1K4US 4ESRA 2CP6A 2XU8A 1UHCA 1CKBA 2CT4A 1X2KA 1XQHA 4C5GA 1IREB 1PCXA 1MNDA 1Y96A 1TUCA 1Z9ZA 1K9MC 3HL8A 5HY6A 4C8QA 1FYNA 2VUBA 4A4GA 5FU7C 3QUIA 2DPPB 4XTWA 2MPXC 2RQUA 4JLGA 2K3YA 3M0RA 1E7OA 1RUWA 2DZCA 2R57A 2PVOB 3OYYA 3M55A 2CSIA 1M1KR 3VS0A 2OAWA 1YBYA 3X20B 2X9HA 1JXMA 3JCMV 1JJ2S 4ORZA 3CCJT 3AT1B 4OMLA 5L23A 5IXBA 4QVCA 1HK9A 2JT4A 4QKUA 2DRMA 4K11A 5LJ5g 2BTTA 3NGPA 4HXJA 4LDUA 2RD1A 3EGDA 2JS2A 4J9CA 4ELYC 3RKXA 3OYLA 3CPWP 2COWA 3GOXA 2LQ8A 5GAN2 2HD0A 3HPWA 1W4SA 1WXBA 3OYNA 1WQ7A 4LUDA 2AHJB 3M58A 3GLXA 5FU6C 1GCQC 4BUGA 2XI9A 1YWPA 1I1JA 4PLLA 3X26B 4II1A 1VQNQ 1G3TA 2ZPHB 4GY5A 3V7SA 4DOWA 5DY9A 3N5BB 2RHIA 3CBPA 4F16A 4IUUA 2CSQA 1Y0MA 2CDTA 4E7LA 4OB3B 1NE8A 3RBBB 1LVKA 3SB2A 1T0JA 2KI7A 1K1ZA 1RLQC 1TUDA 4Y92A 3TVTA 3QWXX 1BI2A 1OULA 2O31A 3I56T 4J6YA 1VQ7A 1KHCA 3HRUA 3CPWS 3OQ5A 4FW1A 2L3QA 3CMET 2KMTA 1I07A 1WHJA 2O4XA 1K9MU 4ATOA 2OI3A 4M4ZA 1WZOA 2E64A 1M1GA 2RMOA 3CC2T 2HSEB 4RTTA 2FG0A 3O5ZA 1N6AA 2KRMA 2VKNA 1W2BS 3JCMJ 2EYQA 1QLYA 2HNIA 3EGDB 2YWWA 2VGMA 4E6RA 3FLGA 1HYOA 4J8OA 3BW1A 2QK0A 3E2UA 3C0CA 2RPNA 1N8RC 4JS5A 1U3OA 2EJGA 4C92B 1OI1A 1VQ8Q 3H41A 2E3HA 4C8QG 2GCXA 3CCRQ 2QTXA 2XMFA 4QVDA 3TCJA 2JZ2A 2YT6A 1D0YA 2E12A 2K5IA 1SEMA 3M4YA 2C0IA 2LP5A 1AOJA 2KYMA 4N0AC 4M75B 1MGQA 2WSEE 1MV0B 1LOJA 1SF9A 3ZEHA 4LD6A 4HA8A 1WLPB 4LXCA 2RJFA 4C92C 2PVGB 5LJ3e 2OTLA 2PU9B 1VQPA 4EMKB 1PD0A 2COZA 2P84A 3CC7A 2A28A 2P0PA 2C06A 1U06A 4NOYA 2DKGA 3M0UA 2QDLA 1WQWA 1XJWB 1X6BA 1VQLT 2R58A 3ZFJA 4PJOA 2KE9A 1ZA1B 2PTKA 4OVAA 5KYYB 5J39A 2B86A 4FSSA 4M78A 1YITT 2KBTA 5D7UA 3TU4K 2DE0X 2V8KA 2J6KA 2DL3A 1VYVA 4OB0B 4XTYA 1AVZC 5GAN7 4IUPA 3C12A 3G6EA 2CP5A 3CC4T 1GBRA 2QA4A 3VV0A 3L2QA 3S3MA 1I4K1 1X43A 3M0TA 1VQ7Q 2DXUA 2GTJA 4JJBA 2LX7A 1KD1R 4Y91A 4RTVA 3EFOB 2DTHA 4HT9A 2JTFA 2DK3A 2ED0A 2XKOC 1M30A 2FVUA 3D7SB 3EH1A 4B9XA 1YITA 2EVRA 1PRMC 4LN2A 3BFMA 3VS4A 3VJPA 3JSCA 1VQ5A 1XNIA 5GAOq 5GAN5 2IVWA 5KYYA 3OW2A 1N27A 4ANJA
chains in the Genus database with same CATH topology
4F7UF 1H3ZA 4L6V5 2DJZA 2JNGA 3KXTA 3UPUA 3CMAT 3ME9A 2PVDB 5FU6B 2PUKB 1R8OB 4JRPA 4J7IA 4BE2A 2VXFA 5GMKj 3OB9A 5GANg 1Q7YU 2P0QA 2VYTA 3ER0A 4C92A 4HKEA 1YJ9A 2RHYA 4OF1A 3HRTA 1I8FA 4M75C 3VKIA 2HBPA 3CCQT 1V29B 3LGLA 1S72A 3JB9H 4M7DB 3OS2A 3E1SA 4IURA 1UGRB 4FSXA 4KUDK 1VQKT 3EFRA 3LGFA 4A4FA 3HKSA 3H6ZA 5GAMh 3CMAA 1X75C 3FDRA 5LJ3h 4D6WA 3CCUA 1QVGA 5KE3A 1FX7A 4NL2A 3QG1A 2QI2A 3WXMB 5A0GA 1VQOT 1H641 5GAOm 4JS4A 2F69A 1N8RU 1BYMA 4M75D 2EQKA 2OTJT 5A2QE 5LJ5j 3PTAA 3OSVA 4MDXA 1KD1U 1D3BB 4C0DC 2DTIA 1VUBA 3JAME 2P0KA 2RM4A 4QW2A 3A8GB 1VQ8A 2FHDA 4M77G 5D6YA 2LT4A 4LDVA 5GMKm 3VUBA 1JBMA 3CCMT 2M16A 3CMEA 2ZPEB 3V7RA 3GNGA 4M7AF 5J3BA 4BD3A 1VQ8T 2HQEA 3UWNA 5HK0A 4N4IA 2LCCA 1VQ9T 3QJYA 2HAXA 4M7AE 3JB9D 4C92F 3QPHA 4BI8B 1KHIA 2BKDN 1RI0A 4UC4A 4JRIA 4DQ2A 3AHUA 4KULA 2L5QA 2X4XA 5LJ3g 5EG2A 4XTZA 3JCMf 4C0FA 2JN0A 4MZTA 5AYFA 2L8DA 3LX7A 5CIUA 5I21A 2BUDA 2RHZA 4M78C 4ZGJB 1WJSA 2LVMA 3GF5A 3QKJA 1UEBA 4C5IA 1M1FA 2KAFA 4M78G 3PIPA 3PMTA 1X6OA 3VYHB 3L2RA 2K4YA 2ZCFB 4F7UE 4PJOG 3VYGA 4C92G 2DO3A 1QVPA 3RKYA 4ZTJA 3OYHA 3PFSA 1SSFA 2YLBA 2M0OA 3OA6A 2DD5A 3PMIA 3QIIA 2OTLT 4PL6A 3LH0A 3M57A 1YJNA 1Q81U 1M90U 1OYXA 4ZGDB 1Q86C 3QDRB 4FM4B 1DJ7B 2RJDA 4M77A 3CCSA 1K73C 3CCLT 1G3WA 3C95A 2QA4T 1JJ2A 2X35A 5GAMf 4MMKA 3URGA 2L3RA 4L5GA 5CO7A 1QW1A 4OP0A 1GXIE 2M1HA 5GAN8 3OYGA 4E7HA 3S3NA 3GP8A 4HT8A 3JCMP 4HCCA 5GANf 2RHUA 3HP9A 3CCJA 3FJPA 4RMOA 4F7UA 3OYDA 4PJOC 2A3LA 4JRKA 2DD4A 3X24B 2DVEA 2KSSA 2RA2A 2XIDA 5CKFA 5GAN6 2F5KA 4ZTFA 3JCMb 1VQ6T 4HCZA 3H8ZA 3M56A 4XAXB 4M77E 3A8HB 5DLQE 4XU2A 4J6XA 4BE0A 3BDLA 2ZGWA 1O75A 4XK8E 3JCMg 5HK3A 4O5VA 4XU1A 3BY7A 3L42A 2P4TA 4JDSA 5CKHA 2KK4A 5LJ3f 3CBOA 4OB1B 4LDWA 3RIRA 2MAMA 3HHTB 4C92E 1Y96B 4BACA 4PJOE 4M7DD 1KG1A 4C0GA 5KE2A 1UGQB 3OYJA 2LDMA 5CCAA 2QQSA 3OYIA 4BDZA 2XD0A 1AHJB 2X4JA 3MEWA 4M77C 3JB9I 4EPCA 1PSEA 5C0MA 4LDYA 4HCBA 1Q81C 3JCMQ 2ZPIB 3P8HA 2O01E 3E9FA 3MP1A 2QEXA 1ZQ1A 2A7YA 2EJ9A 4IUTA 3CCST 1KQ2A 2VGNA 1FXXA 2DXTA 3MEUA 4BE1A 1QP2A 1UGSB 3CCLA 1YIJA 4M7AG 2RK2A 2EIFA 3DB3A 2LNVA 4QVZA 4IKFA 3CD6A 2RO0A 2QEXT 1VQMA 1N9SA 3CC2A 2E70A 4PJOD 2V8IA 5GANe 3M9QA 1NJIC 4B9WA 1K73U 1M1KU 3DLMA 4Z02A 4EMGA 1VQOA 3HSBA 3OS5A 1MHNA 4RKUE 4M78F 1NJIU 4XU3A 4M75F 4V2SA 4M78B 4ME7A 1WGSA 3A8MB 5LJ3d 4OMFB 3CPFA 5GAMj 2CKKA 4FT2A 3A8LB 5KCOA 2QQ9A 1XOVA 3L2ZA 4CI0C 2G3RA 5GAOr 3INZA 4L59A 4XTUA 2R5MA 5LL6S 5GAOp 3L2WA 1UGPB 5IT9E 3CCMA 2H3JA 1VQNA 2DZ9A 2JVVA 4F7UB 3MEAA 3JCMc 4C0ZA 2KDSA 3JB9J 1VQMT 3ASKA 4OGEA 3SFMA 4FIBA 4CRIA 1NPPA 2XDDA 1Q82C 4BDYA 3S6WA 5FRNA 2E6ZA 2MWOA 1VQKA 4RCCA 1M5Q1 5GANd 4JRQA 2ZPGB 1M9SA 1P92A 2CZ6B 2JTMA 2WSFE 3P8BB 4Q5WA 1KQSS 4ZN1A 3CCRT 2VXEA 3F70A 3SDZA 3JCMW 1Q82U 2XU8A 1K8AC 1YJWA 2GQVA 3FRNA 1IZ6A 1XQHA 4C5GA 1IREB 2CZ7B 1VQ6A 1Y96A 2JUFA 4M7AD 1NPRA 4EDUA 3FIFA 1K9MC 3HL8A 5HY6A 4C8QA 1VQ4T 2VUBA 4E47A 3C94A 2D0QB 2EJFA 2LCLA 2DPPB 3QUIA 4J6WA 4JUVA 4XTWA 5FU7C 3VUZA 4TVRA 5CQYA 3O8VA 3QZ5B 4JLGA 3CCRA 2K3YA 5KH6A 3M53A 2DZCA 2RB6A 2VC8A 2R57A 2PVOB 1WPYA 2LT1A 1WJQA 2E5QA 3KBGA 3OYYA 4E7IA 2CZ0B 3M55A 3X28B 2BIVA 3A5ZB 1NZ9A 2DXBA 3MP6A 3X25B 2K2VA 1YBYA 3X20B 2ZPBB 4M7AC 3GIBA 4M7DG 5GMKi 2XDBA 3RERA 4M7DC 1G3SA 1KC8C 3JCMV 1YHQT 1JJ2S 3OMCA 3JCMX 3CC7T 3VU3C 3CCJT 2GFAA 5CVIA 1B34B 3QHSA 4M77D 3UDCA 1M90C 3LW5E 4QVCA 3DB4A 1HK9A 3OBYA 4C0DB 2L89A 2LC4A 3CD6T 4A4KA 5LJ5g 1I5LA 3JB9F 4XQ3A 5FLXE 5GAMd 3L2UA 1M1KC 4LDUA 4M7DE 4N4GA 2RD1A 3E19A 1JB0E 4ELYC 1S72T 4A53A 1B34A 3RKXA 2QXFA 5CKBA 3WVDB 4PJOB 4M75G 3OYLA 1ZBXA 1ZHIA 3GOXA 3M5AA 1OZ2A 4X9CA 4XU0A 1BKBA 2LQ8A 1KD1C 5GAOn 1OZ3A 1QVGS 3BDUA 4M77B 5GAN2 4RG2A 3V7CA 1BI0A 4LDXA 2HD0A 3HPWA 2XDPA 5FU7B 5CKDA 2E1HA 3CCVT 3UT1A 1VQ7T 1W4SA 2XK0A 2E65A 2LQKA 2XHCA 4M75E 5GANj 3SWNC 3OYNA 1KQSA 3J81E 1WQ7A 5D6WA 2AHJB 1K8AU 3CCEA 3M58A 3GLXA 4R55A 5FU6C 5GMKl 4BUGA 4EMHA 4KT0E 4M7DA 2XI9A 2LRQA 2Y4YA 4C92D 4PLLA 3J80E 3RUXA 5J26A 2X4WA 3X26B 3QSUA 3P8DA 3JRZA 4M78D 1M8VA 4II1A 3EFSA 1G3TA 2CS7A 2ZPHB 3NTKA 5I2SA 3MCAB 3R6OA 4QQ6A 3PIOA 3G7ZA 4PKCC 4GY5A 4NS5A 5CKEA 2CZ1B 3V7SA 4A4HA 4DA4A 2DEQA 2RI3A 2K5FA 1YJWT 4PJOF 5DY9A 3N5BB 4DOWA 1I81A 2RHIA 1N9RA 2LTOA 2EAYA 3CBPA 3E9GA 4IUUA 5FROA 3PNWC 1LNXA 1JRIA 1Y07A 4E7LA 3QYHB 4OB3B 2CGHA 3RMQA 1NE8A 3I56A 1XTDA 3CEYA 2WACA 3SB2A 5GANh 4QQDA 4MZMA 5DLOA 3SD4A 3A8OB 3LWIA 3MP8A 1M4ZA 4M78E 2HQXA 5GAMe 2QQRA 3OSSC 2O4XB 3HFOA 4C5EA 3EAEA 3FC3A 2QDYB 5D6XA 4A54A 1BI2A 4M7DF 1BI3A 3I56T 4E7KA 2EWNA 4J6YA 3OW2S 3JCMd 2I2LA 1KHCA 2FB7A 2DIQA 3HRUA 3OQ5A 4GLKA 3OYBA 3CPWS 2YLCA 1YIJT 1W2BA 1YI2T 5A0DA 2FYKA 3CMET 2KMTA 3LLRA 4C8QE 2O4XA 1K9MU 3NTIA 4ATOA 3QXEB 2E64A 1M1GA 3PT9A 3CC2T 1RL2A 3ZBDA 1VQ4A 2E10A 4YTLA 4BY6C 1D3BA 2RH2A 1N6AA 2JOYA 5KCHA 3TEEA 4X34A 5GMKh 4JJNK 3JCMJ 2EYQA 3QYGB 1W2BS 2HNIA 3LWHA 2EQMA 2XG8D 2M9UA 3OS1A 3OYAA 3JB9G 2VGMA 2NLUA 5CR2A 2GFUA 4JLIA 5CK9A 2CYZB 1BIBA 1X01A 4KBMB 5I2MA 1WNLA 3RKWA 3FLGA 2RJCA 1WJRA 2Y4XA 3G71A 4J8OA 5IN1A 3BW1A 3OYEA 2K5LA 4C8QD 3FEOA 3DKMA 5LJ3j 2QQBA 3JCMh 4ZN3A 3CC4A 2MWPA 2E6NA 1N8RC 4QQGA 4JS5A 5C6SA 4ZGEB 2EJGA 4C92B 3OYFA 1G3YA 1OI1A 3QBYA 3CCET 3KUFA 2LX9A 4M75A 1Y7XA 4C8QG 1YHQA 4LD9K 2GCXA 3S3OA 3OMGA 2EFIA 2QTXA 3NTHA 4FL6A 2R5AA 3L1AA 3NFCA 4QVDA 2MF2A 2X4YA 4WF2A 3TCJA 1U1SA 4BB7A 4XTXA 3L2VA 3OYMA 2JZ2A 2E12A 3OBWA 2K5IA 1Q7YC 3M4YA 4X9DA 4Y28E 3MEVA 3CXCS 3G71T 4HT9A 2KVQG 4A4GA 4RCBA 4E7JA 1YJNT 5L8RE 1VQ5T 2EQJA 1EIFA 4N0AC 4M75B 4PLIA 2ZZDA 4C5HA 1MGQA 3CXCA 4EMKA 2WSEE 4IUQA 3WVEB 5FRMA 2V8JA 3T9NA 3OYCA 2F5TX 3CCVA 1LOJA 3ZEHA 1KQ1A 3V8LA 4LD6A 4R56A 3G4ST 3MO8A 4HA8A 5M9OA 3M4GA 1U1TA 4F7UG 5LJ5e 1QVFA 5GAN3 3I55T 2RJFA 4J7FA 1O9SA 1VIFA 3PGGA 2PVGB 4C92C 5LJ3e 1KC8U 5LJ5h 2VV5A 2D9TA 3GPLA 2PU9B 2OTLA 1QVFS 2WSCE 4EMKB 1VQPA 4J83A 3META 5GAOl 2E41A 2EQUA 3HRSA 4OGCA 3CC7A 2GF7A 2P0PA 3C4SA 2PUOB 2C06A 2RHXA 4IUVA 2ZPFB 3Q1JA 5DM7R 4NOYA 3V8KA 2DKGA 5HKCA 1VQ9A 4A4EA 5A0LA 4C8QC 1WQWA 5LJ5f 2RK1A 4DOVA 5GAN4 5IAYA 2IG0A 2R58A 3ZFJA 3RMSA 2B8AA 1VQPT 2OAUA 1VQLT 4OVAA 4PJOA 1VIEA 4KUIA 5J39A 2MI6A 2OTJA 2KY9A 4M78A 2YHTA 4M7AB 1Y71A 1YITT 4BY6B 4M7AA 3FB9A 3CBMA 4BI3A 3TU4K 2V8KA 2XICA 1LJOA 2DAQA 5CQXA 4OB0B 1PSFA 4XTYA 4FT4A 3V8JA 3G6ET 4BI4A 1G5VA 1VQ7A 4MMLA 4ELZC 2YRVA 5GAN7 2KQWA 4IUPA 3I55A 3GNFB 4M77F 3C12A 2Y90A 4NL3A 3MHXA 3G6EA 1Q86U 2QQAA 3OY9A 4O6JA 4P5NA 4N4HA 2RI5A 3CPWA 3CC4T 2DTOA 5CAIA 3G4SA 1YCYA 2QA4A 1QP3A 3VV0A 3L2QA 3S3MA 1I4K1 1TH7A 3CCUT 1BIAA 2D6FA 3OS0A 3M59A 2DXUA 3TREA 1FWZA 3JCMe 1VQNT 5LJ5d 2RJEA 3SWNB 5GAMg 4FU6A 2MMPA 3QJ6A 4PNOA 4Y91A 3DLLA 2DTHA 2DXCA 2K57A 2DIGA 3HFNA 4MZPA 1YI2A 2FL7A 1U8RA 3J7AF 2JTFA 4OB2B 3QO3A 2RI2A 2DK3A 2K3XA 4J5YA 3RESA 1BI1A 2XKOC 2EKOA 4RG8A 4C8QB 1UB4A 2FVUA 4C8QF 4XTVA 4B9XA 1YITA 4MDWA 3CCQA 3BFMA 3M54A 3OYKA 3LYIA 5GMKe 3SWNA 3VJPA 1VQLA 3JSCA 1VQ5A 1XNIA 1YJ9T 1HXDA 2PQWA 5GAOq 5GAN5 4EMKC 3QZ9B 2IVWA 4VUBA 3OW2A 1N27A 4N0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XKO C;  2XG8 D;  3N5B B; 
#chains in the Genus database with same CATH topology
 2CH4 A;  2YUO A;  4F7U F;  1H3Z A;  3UAT A;  3CMA T;  2VWF A;  1EX4 A;  1IHV A;  4J7I A;  4RUG A;  5I11 A;  5GAN g;  2JM9 A;  1Q7Y U;  1HD3 A;  2VYT A;  1K0S A;  4M7D B;  3VKI A;  2DIL A;  1V29 B;  3LGL A;  2QYZ A;  3OS2 A;  2LJ0 A;  3E1S A;  1T3L A;  3HKS A;  1X75 C;  3CCU A;  3WXM B;  2HKN A;  2O9V A;  1N5Z A;  1UJ0 A;  1K76 A;  2V1Q A;  4PFO A;  2OTJ T;  5LJ5 j;  4D8K A;  2X51 A;  4MDX A;  1D3B B;  2YSQ A;  2EPD A;  2P0K A;  2DLP A;  1MNE A;  5KYW A;  5D6Y A;  2KXC A;  4J9H A;  3CME A;  5I22 A;  4RTW A;  4BD3 A;  2V26 A;  5HK0 A;  4A63 B;  5EC7 A;  3QJY A;  1ABO A;  3CCJ Q;  3CME Q;  1M27 C;  2L5Q A;  5LJ3 g;  3JCM f;  4C0F A;  2J05 A;  3CCE Q;  2BUD A;  2RHZ A;  3CCS T;  2LVM A;  2A08 A;  1X6O A;  3L2R A;  2ZCF B;  2EYY A;  4F7U E;  3VYG A;  4DEY A;  1RAB B;  1VYU A;  1QVP A;  2DO3 A;  3OYH A;  3PFS A;  2M0O A;  2DD5 A;  4PL6 A;  1TXQ A;  3QDR B;  1M2V A;  1JJ2 A;  1QW1 A;  4OP0 A;  1H92 A;  2M1H A;  2K9G A;  5IHN A;  4HT8 A;  3S3N A;  4HCC A;  3CCJ A;  4X1V A;  4PJM A;  2A3L A;  1RAF B;  2QAS A;  1MMA A;  2RA2 A;  1YIT Q;  2LMJ A;  1VQ6 T;  1AWW A;  1D1C A;  3M56 A;  1VQ5 Q;  3A8H B;  2MCN A;  1UJY A;  2ZGW A;  1O75 A;  3JCM g;  5HK3 A;  4Z8A A;  3BY7 A;  3L42 A;  3JCM P;  2KK4 A;  1BU1 A;  3CBO A;  1KFZ A;  1KG1 A;  4PFP A;  5KE2 A;  1X27 A;  3OYJ A;  2C0O A;  4KH1 B;  2KYB A;  5CCA A;  2QQS A;  1FMW A;  2XD0 A;  2FEI A;  3UA7 A;  3G6E Q;  1EFN A;  4LDY A;  4HCB A;  4AG2 C;  2ZPI B;  1ZQ1 A;  2EJ9 A;  4IUT A;  1KQ2 A;  4BE1 A;  2VB6 A;  1WYX A;  4OMM A;  1GRI A;  4M7A G;  2EIF A;  4CC4 B;  4IKF A;  2QEX T;  1VQM A;  3CCU Q;  2E70 A;  4FW2 A;  4HVW A;  2P4R A;  3M9Q A;  1N8R R;  3TSW A;  3NPF A;  1K73 U;  4QT7 A;  4RTZ A;  2YRD A;  1MHN A;  2EBP A;  4RKU E;  1YJ9 Q;  2A37 A;  2F1L A;  5GAM j;  1WXU A;  4FT2 A;  1XOV A;  1W70 A;  2DRK A;  1YNZ A;  2DX1 A;  3CCM A;  4LE9 A;  4F7U B;  2JVV A;  2KNB B;  3MEA A;  3ASK A;  3A1P A;  2E3I A;  1NPP A;  1Q82 C;  3BE3 A;  2RQV A;  4RCC A;  5KYN A;  1KIK A;  2JTM A;  2WSF E;  3REB B;  4ZN1 A;  3SDZ A;  1Q82 U;  2GQV A;  2JS0 A;  1IZ6 A;  4J9I A;  2JUF A;  4OMN A;  1K8A U;  4JUV A;  2LCL A;  4J6W A;  2O88 A;  3O8V A;  1E6G A;  2DBM A;  5KH6 A;  1WPY A;  4E7I A;  1WJQ A;  2E5Q A;  4PFZ A;  2JW4 A;  1RAA B;  4M7A C;  2XDB A;  3RER A;  1G3S A;  3VS6 A;  2AT1 B;  3VU3 C;  1W2B P;  2GFA A;  1B34 B;  3VS7 A;  1M90 C;  2YUQ A;  2GTO A;  3OBY A;  2L89 A;  2GBQ A;  2LC4 A;  1OEB A;  3CD6 T;  4A4K A;  4XQ3 A;  2O9S A;  1PG5 B;  5FLX E;  1M1K C;  2F2W A;  4ZNX A;  1JB0 E;  1S72 T;  3WVD B;  4M75 G;  1OZ2 A;  1SRL A;  1GCQ A;  4XU0 A;  1BKB A;  1KD1 C;  1OZ3 A;  1QVG S;  3BDU A;  4M77 B;  4RG2 A;  3V7C A;  3TQ7 P;  2CT3 A;  5IXF A;  1UHF A;  4Z88 A;  3U23 A;  3CMA Q;  3SWN C;  1KQS A;  2QA4 Q;  2W10 A;  1OQK A;  1WI7 A;  3J81 E;  1AD5 A;  2SRC A;  3I9Q A;  4EMH A;  1BB9 A;  3JRZ A;  2M51 A;  2CS7 A;  3NTK A;  1VQK Q;  3R6O A;  3M0S A;  2CP3 A;  4QQ6 A;  2M02 A;  5IH2 A;  4A4H A;  1YJW T;  2DL8 A;  2DEQ A;  2K5F A;  3SHW A;  1N9R A;  2LTO A;  3E9G A;  1QVG P;  5FRO A;  3PNW C;  1Q95 G;  4CC7 A;  1JRI A;  1D0X A;  1TWB A;  3RMQ A;  3I56 A;  1IRX A;  1XTD A;  2WAC A;  2OX7 A;  3A8O B;  3LWI A;  2ENM A;  5GAM e;  2LJ1 A;  3OSS C;  1WHL A;  1TU0 B;  1BI3 A;  2EWN A;  2DIQ A;  5A0D A;  3H9N A;  1C1A A;  1UTI A;  3PT9 A;  3ZBD A;  2E10 A;  1RAD B;  2DL7 A;  2JOY A;  2MIO A;  1YWO A;  4JJN K;  2EQM A;  2XG8 D;  3OS1 A;  5CR2 A;  4JLI A;  5CK9 A;  2CYZ B;  1X01 A;  2D8J A;  2ED1 A;  3RKW A;  3CC4 Q;  3OYE A;  2K5L A;  4C8Q D;  1OPK A;  3DKM A;  1RI9 A;  2JM8 A;  1NLP C;  3JCM h;  4ZN3 A;  2FPE A;  3CC4 A;  3CCM Q;  4QQG A;  4ZGE B;  3OYF A;  2LNH B;  4KRT A;  1YHQ A;  2BE7 D;  3NTH A;  2X4Y A;  4BB7 A;  3OBW A;  1B7T A;  3MEV A;  1VQ6 Q;  1Y57 A;  2E5K A;  1X6G A;  3CXC A;  3WVE B;  4IIM A;  2F5T X;  3H0I A;  1QMC A;  2A0F B;  5M9O A;  1M3A A;  2EGC A;  1ZSZ A;  1ZX6 A;  1KC8 U;  1O9S A;  1VIF A;  1QVF S;  2WSC E;  4J83 A;  3R6N A;  4OGC A;  4JJC A;  3C4S A;  1ZUU A;  2RQT A;  2ZPF B;  7AT1 B;  2OTJ Q;  2J06 A;  1SSH A;  4DOV A;  5GAN 4;  3G1J A;  5IAY A;  2B8A A;  4KUI A;  1H8K A;  2OTJ A;  3CBM A;  2XIC A;  3EG2 A;  1LJO A;  2DAQ A;  1G5V A;  3PE0 A;  4ELZ C;  3I55 A;  4NL3 A;  2Y90 A;  3RNJ A;  1OV3 A;  4P5N A;  3CPW A;  2RI5 A;  1YCY A;  5FWC A;  1WXT A;  3CCU T;  1BIA A;  2QGG A;  3OS0 A;  3M59 A;  1UG1 A;  3HTR A;  3JCM e;  5LJ5 d;  1PRL C;  2RJE A;  3DLL A;  2MMP A;  3QJ6 A;  3HFN A;  2EYW A;  4OB2 B;  2HQH A;  4F04 B;  4JJD A;  1H3H A;  4MDW A;  2FPF A;  2D1X A;  3LYI A;  5GJW B;  2CP7 A;  1GL5 A;  4EMK C;  2DJZ A;  3UPU A;  2PVD B;  5FU6 B;  2PUK B;  4BE2 A;  1ZSZ B;  3I5S A;  3OB9 A;  3ER0 A;  4C92 A;  2LJ3 A;  3HRT A;  1I8F A;  1S72 A;  1KSW A;  2HBP A;  3VS2 A;  1AWO A;  1UGR B;  1OU8 A;  1NG2 A;  1D1B A;  3LGF A;  2EKH A;  3H6Z A;  5GAM h;  3CMA A;  4D6W A;  3CC2 Q;  5LJ3 h;  5KE3 A;  1FX7 A;  3QG1 A;  2QI2 A;  1N8R U;  4M75 D;  2EQK A;  2DMO A;  3MJX A;  1VA7 A;  2AZV A;  5HCK A;  4C0D C;  1M2O A;  5KYX A;  4KGX B;  2FHD A;  1UUE A;  1Q81 R;  5GMK m;  2DET A;  3CCM T;  2HL3 A;  3V7R A;  3GNG A;  3I56 Q;  3I35 A;  2DF6 A;  2HAX A;  4M7A E;  3QPH A;  1KHI A;  1X2Q A;  4JRI A;  4DQ2 A;  2KT8 A;  1IHW A;  4D8D A;  4R0K A;  3LX7 A;  1OOT A;  4M78 C;  5FWB A;  4C5I A;  3PIP A;  3VYH B;  2K4Y A;  2DJQ A;  3QII A;  2W0Z A;  1OYX A;  1DJ7 B;  4RTY A;  3CCS A;  1G3W A;  3EH2 A;  3C95 A;  2JJ9 A;  4OMP A;  3URG A;  2L3R A;  5CO7 A;  3QWY A;  2RHU A;  4AFQ C;  3OYD A;  4JRK A;  2DVE A;  2KSS A;  2XID A;  3SEM A;  4HVU A;  2QTV A;  5DLQ E;  4XU2 A;  1BCO A;  4JDS A;  2DYI A;  5LJ3 f;  4LDW A;  4C0G A;  1BBZ A;  3CC7 Q;  1YI2 Q;  2LDM A;  1NJI R;  1WX6 A;  4PK4 A;  4B6M A;  1AHJ B;  1HSQ A;  1PNJ A;  1VOM A;  3MEW A;  1BCM A;  3JCM Q;  2D0N A;  3MP1 A;  2A7Y A;  1FXX A;  3MEU A;  1YIJ Q;  2CP0 A;  1UGS B;  2HKQ B;  2RK2 A;  3DB3 A;  1UE9 A;  2RO0 A;  4PJO D;  3CC2 A;  3GBQ A;  2ECZ A;  2V8I A;  2MOX A;  1M1K U;  3DLM A;  4Z02 A;  2DNU A;  1OPL A;  1NJI U;  4M78 B;  5LJ3 d;  2QAZ A;  2CKK A;  4F17 A;  3A8L B;  2BZX A;  2QQ9 A;  2G3R A;  1GFD A;  5GAO r;  3INZ A;  5LL6 S;  2EYX A;  2H3J A;  1VQN A;  2YUP A;  2SEM A;  3JCM c;  4C0Z A;  2KDS A;  3JB9 J;  3SFM A;  2AKL A;  3S6W A;  2E6Z A;  2MWO A;  1TTH B;  1M5Q 1;  4JRQ A;  3RR6 A;  2CZ6 B;  1KQS S;  3CCR T;  3F70 A;  3JCM W;  1K8A C;  1YJW A;  1VQ6 A;  4M7A D;  1NPR A;  1R0B G;  4EDU A;  1M8V A;  1VQ4 T;  4E47 A;  5CQY A;  3QZ5 B;  4CC3 A;  3M53 A;  2LT1 A;  2VC8 A;  3KBG A;  2DA9 A;  1M90 R;  1NZ9 A;  3A5Z B;  3X25 B;  1Z9Q A;  2ZPB B;  3GIB A;  1KK7 A;  5GMK i;  4M7D G;  2QGF B;  4M7D C;  1KC8 C;  2LZ6 B;  1JJ2 P;  3CC7 T;  1MMG A;  4J9G A;  3EG3 A;  4KH0 B;  1Q82 R;  2FRW A;  1V76 A;  2CUB A;  1I5L A;  3L2U A;  5GAM d;  4M7D E;  1JU5 C;  3E19 A;  2HDA A;  4A53 A;  1K8A R;  2QXF A;  1CSK A;  5CKB A;  3VS3 A;  3H0F A;  1ZBX A;  1ZHI A;  2K2M A;  4X9C A;  5GAO n;  1B07 A;  1M2V B;  2ESW A;  4LDX A;  1IGU A;  3CCV T;  2E1H A;  2XK0 A;  2E65 A;  1PWT A;  4M75 E;  1PC0 A;  5D6W A;  3CCE A;  4R55 A;  3EGU A;  5GMK l;  4KT0 E;  4M7D A;  2Y4Y A;  3J80 E;  3RUX A;  4JZ3 A;  5J26 A;  2X4W A;  3EHR A;  3P8D A;  4M78 D;  4PJJ A;  1B3Q A;  3PIO A;  2L0A A;  1GBQ A;  4NS5 A;  4DA4 A;  1YP5 A;  2CZ1 B;  1LNX A;  1JEG A;  1Y07 A;  1GFC A;  3CEY A;  1WA7 A;  4QQD A;  5KYU B;  2KEA A;  1J3T A;  5DLO A;  3SD4 A;  3I5R A;  1SHG A;  3MP8 A;  1M4Z A;  1VYT A;  4C5E A;  3EAE A;  5D6X A;  4M7D F;  4E7K A;  3JCM d;  2I2L A;  3OYB A;  4EIK A;  3NHN A;  2FYK A;  4C8Q E;  3QXE B;  1C6V X;  3OW2 P;  1D0Z A;  4KGZ B;  4X34 A;  4AMC A;  3OYA A;  2M9U A;  3JB9 G;  1NEG A;  2NLU A;  4AFU C;  2GFU A;  1WNL A;  1JO8 A;  1TUG B;  1WJR A;  2Y4X A;  3G71 A;  5IN1 A;  3VRY A;  5LJ3 j;  2QQB A;  2FZG B;  4AFS C;  1SHF A;  2E6N A;  3KFV A;  1NEB A;  3QBY A;  4OMQ A;  3KUF A;  4LNP A;  2LX9 A;  2OJ2 A;  1IB8 A;  1VQ9 Q;  4JPB W;  3S3O A;  3OMG A;  4FL6 A;  2R5A A;  3L1A A;  3NFC A;  1ACM B;  2HCK A;  3L2V A;  4XTX A;  1R77 A;  3OYM A;  2DYB A;  4Y28 E;  3G71 T;  3CXC S;  2KVQ G;  3VRZ A;  4E7J A;  1YJN T;  1VQ4 Q;  2OTL Q;  1W1F A;  2EQJ A;  1EIF A;  4PLI A;  3REA B;  2ZZD A;  3TSZ A;  4HCK A;  2MYS A;  1KQ1 A;  3V8L A;  3G4S T;  3MO8 A;  4FYW B;  2GGR A;  3M4G A;  1U1T A;  5LJ5 e;  1QVF A;  4J7F A;  1Q86 R;  5LJ5 h;  2D9T A;  5GAO l;  2E41 A;  2J7I A;  8AT1 B;  2COY A;  4IIO A;  2FZK B;  2PUO B;  2HSP A;  2RHX A;  4IUV A;  5DM7 R;  5HKC A;  1VQ9 A;  5A0L A;  1C0M A;  3RMS A;  1VIE A;  4WCI A;  1QWE A;  2YHT A;  4BI3 A;  1U5S A;  1JQQ A;  5CQX A;  1PSF A;  4FT4 A;  3V8J A;  3G6E T;  1MV3 A;  4BI4 A;  2YRV A;  3EFO A;  2QQA A;  2DTO A;  1QP3 A;  2QEX Q;  3M0Q A;  8ATC B;  3TRE A;  1AZG B;  3SWN B;  5GAM g;  3J7A F;  2NWM A;  2K57 A;  3VS5 A;  4MZP A;  2DEU A;  3RES A;  1WDX A;  3QO3 A;  2K3X A;  1BI1 A;  2ROT A;  2CUD A;  2EKO A;  4FYY B;  4RG8 A;  3VS1 A;  4XTV A;  3A98 A;  3CCQ A;  3M54 A;  3OYK A;  1G83 A;  1RAH B;  2PQW A;  3QZ9 B;  4VUB A;  2HZY A;  4DBR A;  1LPL A;  4N0A A;  4E7Z A;  4J9D A;  4L6V 5;  3KXT A;  4JRP A;  5GMK j;  2X3W D;  2P0Q A;  1YJ9 A;  3CCQ T;  1YFN A;  1TOV A;  3JB9 H;  2DVJ A;  4KUD K;  1VQK T;  3EFR A;  4A4F A;  1QVG A;  1VQO T;  1H64 1;  5GAO m;  4JS4 A;  2F69 A;  4RTX A;  3EG9 B;  5A2Q E;  3PTA A;  2ABL A;  1KD1 U;  2DTI A;  5GJV B;  1YHQ Q;  1SG5 A;  3JAM E;  4QW2 A;  3LH5 A;  2EW3 A;  2LT4 A;  3VUB A;  1ZSG A;  2ZPE B;  2MK5 A;  4M7A F;  5J3B A;  2HQE A;  1FMV A;  1HJD A;  1R0C B;  1KQS P;  2PNI A;  1IXD A;  1WFW A;  4C92 F;  1AT1 B;  1RI0 A;  4UC4 A;  2NYS A;  1I5O B;  3QDF A;  4E7S A;  4KUL A;  1YN8 A;  2X4X A;  5ECA A;  5EG2 A;  1Q7Y R;  3G71 Q;  3EGX A;  2IPO B;  5AYF A;  2L8D A;  5CIU A;  2EGE A;  4ZGJ B;  3GF5 A;  3QKJ A;  4M78 G;  3G4S Q;  2L3P A;  1PKT A;  3RKY A;  1SSF A;  2YLB A;  4J9E A;  3PMI A;  2RN8 A;  3I55 Q;  1YJN Q;  2OTL T;  1M90 U;  2KGT A;  3M57 A;  9ATC B;  1YJN A;  1Q81 U;  1Q86 C;  1ZBJ A;  4ZGD B;  4FM4 B;  1K73 C;  3CCL T;  2K6D A;  5AT1 B;  4MMK A;  1YCS B;  1YJW Q;  2EGA A;  3OYG A;  4E7H A;  3ULR B;  2KXD A;  3HP9 A;  4RMO A;  4PJO C;  2DD4 A;  3CCQ Q;  3JV3 A;  2F5K A;  4DBH A;  3JCM b;  3UA6 A;  4XAX B;  2F2V A;  4XK8 E;  3EG9 A;  4XU1 A;  5CKH A;  1S1N A;  2P4T A;  2IIM A;  4C92 E;  4OB1 B;  2MAM A;  3HHT B;  4PJO E;  1RAI B;  4M7D D;  2AIR B;  2KR3 A;  1D09 B;  1M3B A;  1PSE A;  5C0M A;  3CD6 Q;  3P8H A;  2O01 E;  2QEX A;  1NYF A;  1QVF P;  1M8M A;  2YRC A;  1YIJ A;  1ZA2 B;  4QVZ A;  1JXO A;  1N9S A;  2YXY A;  2JTE A;  3EGX B;  4EMG A;  1VQO A;  3OS5 A;  4V2S A;  2FZC B;  4Z89 A;  1WGS A;  3A8M B;  1TS9 A;  3CPF A;  1UEC A;  5KCO A;  3L2Z A;  4L59 A;  5GAO p;  2R5M A;  5IT9 E;  1UGP B;  2DER A;  5IHK A;  2DZ9 A;  1TG0 A;  1VQM T;  4OGE A;  4FIB A;  1M3C A;  2DL4 A;  1VQK A;  6AT1 B;  3CCL Q;  2ZPG B;  3P8B B;  4Q5W A;  2NUZ A;  2KT1 A;  2VXE A;  1I0C A;  2EQI A;  1G2B A;  3FRN A;  2CRE A;  4DEX A;  2CZ7 B;  4DBF A;  1OX9 A;  3FIF A;  1E6H A;  3C94 A;  2D0Q B;  2EJF A;  2RQR A;  3VUZ A;  4TVR A;  3CCR A;  2RB6 A;  2CZ0 B;  3X28 B;  1K9M R;  2BIV A;  2LQN A;  2DXB A;  3MP6 A;  2K2V A;  3H0H A;  1YHQ T;  3OMC A;  3JCM X;  2HBW A;  1F1B B;  5CVI A;  3QHS A;  1QQJ A;  4M77 D;  3UDC A;  3LW5 E;  3DB4 A;  4C0D B;  1T0H A;  1X69 A;  3JB9 F;  1VQO Q;  1VQP Q;  4N4G A;  1QWF A;  3CCS Q;  1GCP A;  1B34 A;  4PJO B;  3M5A A;  1PD1 A;  4FYX B;  1BI0 A;  1MMN A;  5FU7 B;  2XDP A;  5CKD A;  1VQ7 T;  3UT1 A;  4J9F A;  1QCF A;  2LQK A;  2XHC A;  5GAN j;  1CKA A;  4C92 D;  2LRQ A;  3QSU A;  2AKK A;  3EFS A;  5I2S A;  3MCA B;  2D8H A;  3G7Z A;  4PKC C;  5CKE A;  5KYW B;  3CQT A;  3EG0 A;  2RI3 A;  4PJO F;  2GQI A;  1I81 A;  2LCS A;  2C0T A;  2DL5 A;  2EAY A;  1RAC B;  1ZUK A;  3QYH B;  1G8X A;  2CGH A;  3UF4 A;  2QG9 B;  5GAN h;  2L2P A;  4MZM A;  1ARK A;  4M78 E;  2HQX A;  2QQR A;  2O4X B;  2FPD A;  3HFO A;  3FC3 A;  2E4H A;  2QDY B;  2LQW A;  4A54 A;  2PZ1 A;  3OW2 S;  2FB7 A;  3EG1 A;  4GLK A;  2YLC A;  2ROL A;  1WIE A;  1YIJ T;  1W2B A;  1YI2 T;  3LLR A;  3NTI A;  1QCO A;  1SKU B;  1RL2 A;  1VQ4 A;  4BY6 C;  4YTL A;  3FJ5 A;  1D3B A;  2RH2 A;  1MMD A;  5KCH A;  3TEE A;  5GMK h;  1MUZ A;  3QYG B;  3LWH A;  1ZSZ C;  2V1R A;  1BIB A;  4KBM B;  5I2M A;  3PVQ A;  2RJC A;  1WHM A;  3FEO A;  2RF0 A;  4OMO A;  1RAG B;  2MWP A;  1BK2 A;  2HL5 C;  1AWX A;  5C6S A;  1G3Y A;  1OU9 A;  2K7A A;  3CCE T;  1K0X A;  1A0N B;  4M75 A;  1Y7X A;  4LD9 K;  4E2F B;  2EFI A;  1QCN A;  2MF2 A;  4WF2 A;  1VQM Q;  1U1S A;  2Z0W A;  1ABQ A;  1Q7Y C;  4X9D A;  2YDL A;  4RCB A;  5L8R E;  1VQ5 T;  4C5H A;  2YUN A;  4EMK A;  4IUQ A;  1OX8 A;  5FRM A;  2V8J A;  3T9N A;  3OYC A;  3CCV A;  2J6O A;  4R56 A;  4F7U G;  5GAN 3;  2KRS A;  3I55 T;  4F14 A;  3PGG A;  3GPL A;  2VV5 A;  3RDV A;  3MET A;  1AWJ A;  2EQU A;  3HRS A;  2DFU A;  2GF7 A;  2BZ8 A;  3PVL A;  5KYU A;  3Q1J A;  3V8K A;  4A4E A;  4C8Q C;  5LJ5 f;  2RK1 A;  2RQW A;  2IG0 A;  1VQP T;  2OAU A;  2MI6 A;  1KJW A;  2KY9 A;  4M7A A;  4M7A B;  1Y71 A;  4BY6 B;  1T3S A;  3FB9 A;  2O2O A;  2H3E B;  1D1A A;  3CCV Q;  4MML A;  1NM7 A;  2KQW A;  1W6X A;  3GNF B;  4M77 F;  3MHX A;  2NUT A;  2NUT B;  1Q86 U;  3OY9 A;  4O6J A;  4N4H A;  2FRY A;  5CAI A;  3G4S A;  1UFF A;  1TH7 A;  2D6F A;  2KRN A;  2GNC A;  1FWZ A;  1VQN T;  4FU6 A;  4PNO A;  2DXC A;  2DIG A;  1YI2 A;  2FL7 A;  1U8R A;  4J5Y A;  2DBK A;  2RI2 A;  4C8Q B;  1UB4 A;  4C8Q F;  1WHK A;  2KRO A;  2VAS A;  3EHQ A;  5GMK e;  3SWN A;  1VQL A;  2ATC B;  1YJ9 T;  1EZZ B;  1HXD A;  5IHI A;  2JMC A;  2JNG A;  3ME9 A;  1V1C A;  1R8O B;  4FYV B;  2VXF A;  2HEQ A;  4HKE A;  1UGV A;  2RHY A;  4OF1 A;  2FO0 A;  1SRM A;  4M75 C;  4PJN A;  2X3X D;  1RAE B;  4IUR A;  4FSX A;  4JZ4 A;  3FDR A;  2H8H A;  4NL2 A;  5A0G A;  4WTO B;  2L3S A;  1BYM A;  4GLM A;  3OSV A;  2CH4 W;  1QKX A;  4PJL A;  1PHT A;  1VUB A;  2K79 A;  2RM4 A;  3A8G B;  1VQ8 A;  4M77 G;  1PKS A;  1ZLM A;  4LDV A;  1K9A A;  1IGQ A;  4RTU A;  1JBM A;  2M16 A;  3MKD A;  1VQ8 T;  3UWN A;  1WHH A;  4N4I A;  2LCC A;  1VQ9 T;  3JB9 D;  2ZAE A;  4BI8 B;  2BKD N;  3AHU A;  4AG1 C;  2M0Y A;  4XTZ A;  3THK A;  2JN0 A;  3MPU B;  4MZT A;  1QKW A;  5I21 A;  1WJS A;  3IQL A;  1UEB A;  1M1F A;  2KAF A;  5FW9 A;  3PMT A;  2NUP B;  4PJO G;  2I0N A;  1WHG A;  4C92 G;  4ZTJ A;  4DBQ A;  3OA6 A;  3LH0 A;  2J6F A;  3ZL7 C;  2RJD A;  4M77 A;  1NBE B;  1KC8 R;  2QA4 T;  2X35 A;  5GAM f;  1UDL A;  4L5G A;  3NMZ C;  1NLO C;  1GXI E;  2BE9 B;  5GAN 8;  3GP8 A;  5GAN f;  1AEY A;  3FJP A;  3M0P A;  4F7U A;  1VQL Q;  1PM3 A;  1LCK A;  3X24 B;  1SPK A;  5CKF A;  5GAN 6;  4ZTF A;  2EYZ A;  4HCZ A;  4CC2 A;  2BZY A;  3H8Z A;  1K73 R;  4M77 E;  4J6X A;  4BE0 A;  3BDL A;  2VVK A;  4O5V A;  2K3B A;  4FCY A;  3RIR A;  1Y96 B;  4BAC A;  4J9B A;  1UGQ B;  3OYI A;  4BDZ A;  2X4J A;  4M77 C;  3JB9 I;  4EPC A;  1FMK A;  2JMA A;  1Q81 C;  2CP2 A;  2AK5 A;  3E9F A;  2VGN A;  2DXT A;  1QP2 A;  3CCL A;  1NYG A;  1S72 Q;  2JXB A;  4LUE A;  2LNV A;  3CD6 A;  2G6F X;  2RNA A;  5GAN e;  4AFZ C;  1ZUY A;  1NJI C;  4B9W A;  1RLP C;  3HSB A;  4M78 F;  4XU3 A;  4M75 F;  4ME7 A;  1IO6 A;  4OMF B;  2DM1 A;  4CI0 C;  4XTU A;  4HVV A;  3L2W A;  4GBQ A;  1TSF A;  2F2X A;  2A36 A;  4CRI A;  1AZE A;  2XDD A;  2AZS A;  4AT1 B;  2NUP A;  4BDY A;  5KYX B;  5FRN A;  5GAN d;  2HMA A;  4KGV B;  3CXC P;  1M9S A;  1P92 A;  1K4U S;  4ESR A;  2CP6 A;  2XU8 A;  1UHC A;  1CKB A;  2CT4 A;  1X2K A;  1XQH A;  4C5G A;  1IRE B;  1PCX A;  1MND A;  1Y96 A;  1TUC A;  1Z9Z A;  1K9M C;  3HL8 A;  5HY6 A;  4C8Q A;  1FYN A;  2VUB A;  4A4G A;  5FU7 C;  3QUI A;  2DPP B;  4XTW A;  2MPX C;  2RQU A;  4JLG A;  2K3Y A;  3M0R A;  1E7O A;  1RUW A;  2DZC A;  2R57 A;  2PVO B;  3OYY A;  3M55 A;  2CSI A;  1M1K R;  3VS0 A;  2OAW A;  1YBY A;  3X20 B;  2X9H A;  1JXM A;  3JCM V;  1JJ2 S;  4ORZ A;  3CCJ T;  3AT1 B;  4OML A;  5L23 A;  5IXB A;  4QVC A;  1HK9 A;  2JT4 A;  4QKU A;  2DRM A;  4K11 A;  5LJ5 g;  2BTT A;  3NGP A;  4HXJ A;  4LDU A;  2RD1 A;  3EGD A;  2JS2 A;  4J9C A;  4ELY C;  3RKX A;  3OYL A;  3CPW P;  2COW A;  3GOX A;  2LQ8 A;  5GAN 2;  2HD0 A;  3HPW A;  1W4S A;  1WXB A;  3OYN A;  1WQ7 A;  4LUD A;  2AHJ B;  3M58 A;  3GLX A;  5FU6 C;  1GCQ C;  4BUG A;  2XI9 A;  1YWP A;  1I1J A;  4PLL A;  3X26 B;  4II1 A;  1VQN Q;  1G3T A;  2ZPH B;  4GY5 A;  3V7S A;  4DOW A;  5DY9 A;  3N5B B;  2RHI A;  3CBP A;  4F16 A;  4IUU A;  2CSQ A;  1Y0M A;  2CDT A;  4E7L A;  4OB3 B;  1NE8 A;  3RBB B;  1LVK A;  3SB2 A;  1T0J A;  2KI7 A;  1K1Z A;  1RLQ C;  1TUD A;  4Y92 A;  3TVT A;  3QWX X;  1BI2 A;  1OUL A;  2O31 A;  3I56 T;  4J6Y A;  1VQ7 A;  1KHC A;  3HRU A;  3CPW S;  3OQ5 A;  4FW1 A;  2L3Q A;  3CME T;  2KMT A;  1I07 A;  1WHJ A;  2O4X A;  1K9M U;  4ATO A;  2OI3 A;  4M4Z A;  1WZO A;  2E64 A;  1M1G A;  2RMO A;  3CC2 T;  2HSE B;  4RTT A;  2FG0 A;  3O5Z A;  1N6A A;  2KRM A;  2VKN A;  1W2B S;  3JCM J;  2EYQ A;  1QLY A;  2HNI A;  3EGD B;  2YWW A;  2VGM A;  4E6R A;  3FLG A;  1HYO A;  4J8O A;  3BW1 A;  2QK0 A;  3E2U A;  3C0C A;  2RPN A;  1N8R C;  4JS5 A;  1U3O A;  2EJG A;  4C92 B;  1OI1 A;  1VQ8 Q;  3H41 A;  2E3H A;  4C8Q G;  2GCX A;  3CCR Q;  2QTX A;  2XMF A;  4QVD A;  3TCJ A;  2JZ2 A;  2YT6 A;  1D0Y A;  2E12 A;  2K5I A;  1SEM A;  3M4Y A;  2C0I A;  2LP5 A;  1AOJ A;  2KYM A;  4N0A C;  4M75 B;  1MGQ A;  2WSE E;  1MV0 B;  1LOJ A;  1SF9 A;  3ZEH A;  4LD6 A;  4HA8 A;  1WLP B;  4LXC A;  2RJF A;  4C92 C;  2PVG B;  5LJ3 e;  2OTL A;  2PU9 B;  1VQP A;  4EMK B;  1PD0 A;  2COZ A;  2P84 A;  3CC7 A;  2A28 A;  2P0P A;  2C06 A;  1U06 A;  4NOY A;  2DKG A;  3M0U A;  2QDL A;  1WQW A;  1XJW B;  1X6B A;  1VQL T;  2R58 A;  3ZFJ A;  4PJO A;  2KE9 A;  1ZA1 B;  2PTK A;  4OVA A;  5KYY B;  5J39 A;  2B86 A;  4FSS A;  4M78 A;  1YIT T;  2KBT A;  5D7U A;  3TU4 K;  2DE0 X;  2V8K A;  2J6K A;  2DL3 A;  1VYV A;  4OB0 B;  4XTY A;  1AVZ C;  5GAN 7;  4IUP A;  3C12 A;  3G6E A;  2CP5 A;  3CC4 T;  1GBR A;  2QA4 A;  3VV0 A;  3L2Q A;  3S3M A;  1I4K 1;  1X43 A;  3M0T A;  1VQ7 Q;  2DXU A;  2GTJ A;  4JJB A;  2LX7 A;  1KD1 R;  4Y91 A;  4RTV A;  3EFO B;  2DTH A;  4HT9 A;  2JTF A;  2DK3 A;  2ED0 A;  2XKO C;  1M30 A;  2FVU A;  3D7S B;  3EH1 A;  4B9X A;  1YIT A;  2EVR A;  1PRM C;  4LN2 A;  3BFM A;  3VS4 A;  3VJP A;  3JSC A;  1VQ5 A;  1XNI A;  5GAO q;  5GAN 5;  2IVW A;  5KYY A;  3OW2 A;  1N27 A;  4ANJ A; 
#chains in the Genus database with same CATH homology
 4F7U F;  1H3Z A;  4L6V 5;  2DJZ A;  2JNG A;  3KXT A;  3UPU A;  3CMA T;  3ME9 A;  2PVD B;  5FU6 B;  2PUK B;  1R8O B;  4JRP A;  4J7I A;  4BE2 A;  2VXF A;  5GMK j;  3OB9 A;  5GAN g;  1Q7Y U;  2P0Q A;  2VYT A;  3ER0 A;  4C92 A;  4HKE A;  1YJ9 A;  2RHY A;  4OF1 A;  3HRT A;  1I8F A;  4M75 C;  3VKI A;  2HBP A;  3CCQ T;  1V29 B;  3LGL A;  1S72 A;  3JB9 H;  4M7D B;  3OS2 A;  3E1S A;  4IUR A;  1UGR B;  4FSX A;  4KUD K;  1VQK T;  3EFR A;  3LGF A;  4A4F A;  3HKS A;  3H6Z A;  5GAM h;  3CMA A;  1X75 C;  3FDR A;  5LJ3 h;  4D6W A;  3CCU A;  1QVG A;  5KE3 A;  1FX7 A;  4NL2 A;  3QG1 A;  2QI2 A;  3WXM B;  5A0G A;  1VQO T;  1H64 1;  5GAO m;  4JS4 A;  2F69 A;  1N8R U;  1BYM A;  4M75 D;  2EQK A;  2OTJ T;  5A2Q E;  5LJ5 j;  3PTA A;  3OSV A;  4MDX A;  1KD1 U;  1D3B B;  4C0D C;  2DTI A;  1VUB A;  3JAM E;  2P0K A;  2RM4 A;  4QW2 A;  3A8G B;  1VQ8 A;  2FHD A;  4M77 G;  5D6Y A;  2LT4 A;  4LDV A;  5GMK m;  3VUB A;  1JBM A;  3CCM T;  2M16 A;  3CME A;  2ZPE B;  3V7R A;  3GNG A;  4M7A F;  5J3B A;  4BD3 A;  1VQ8 T;  2HQE A;  3UWN A;  5HK0 A;  4N4I A;  2LCC A;  1VQ9 T;  3QJY A;  2HAX A;  4M7A E;  3JB9 D;  4C92 F;  3QPH A;  4BI8 B;  1KHI A;  2BKD N;  1RI0 A;  4UC4 A;  4JRI A;  4DQ2 A;  3AHU A;  4KUL A;  2L5Q A;  2X4X A;  5LJ3 g;  5EG2 A;  4XTZ A;  3JCM f;  4C0F A;  2JN0 A;  4MZT A;  5AYF A;  2L8D A;  3LX7 A;  5CIU A;  5I21 A;  2BUD A;  2RHZ A;  4M78 C;  4ZGJ B;  1WJS A;  2LVM A;  3GF5 A;  3QKJ A;  1UEB A;  4C5I A;  1M1F A;  2KAF A;  4M78 G;  3PIP A;  3PMT A;  1X6O A;  3VYH B;  3L2R A;  2K4Y A;  2ZCF B;  4F7U E;  4PJO G;  3VYG A;  4C92 G;  2DO3 A;  1QVP A;  3RKY A;  4ZTJ A;  3OYH A;  3PFS A;  1SSF A;  2YLB A;  2M0O A;  3OA6 A;  2DD5 A;  3PMI A;  3QII A;  2OTL T;  4PL6 A;  3LH0 A;  3M57 A;  1YJN A;  1Q81 U;  1M90 U;  1OYX A;  4ZGD B;  1Q86 C;  3QDR B;  4FM4 B;  1DJ7 B;  2RJD A;  4M77 A;  3CCS A;  1K73 C;  3CCL T;  1G3W A;  3C95 A;  2QA4 T;  1JJ2 A;  2X35 A;  5GAM f;  4MMK A;  3URG A;  2L3R A;  4L5G A;  5CO7 A;  1QW1 A;  4OP0 A;  1GXI E;  2M1H A;  5GAN 8;  3OYG A;  4E7H A;  3S3N A;  3GP8 A;  4HT8 A;  3JCM P;  4HCC A;  5GAN f;  2RHU A;  3HP9 A;  3CCJ A;  3FJP A;  4RMO A;  4F7U A;  3OYD A;  4PJO C;  2A3L A;  4JRK A;  2DD4 A;  3X24 B;  2DVE A;  2KSS A;  2RA2 A;  2XID A;  5CKF A;  5GAN 6;  2F5K A;  4ZTF A;  3JCM b;  1VQ6 T;  4HCZ A;  3H8Z A;  3M56 A;  4XAX B;  4M77 E;  3A8H B;  5DLQ E;  4XU2 A;  4J6X A;  4BE0 A;  3BDL A;  2ZGW A;  1O75 A;  4XK8 E;  3JCM g;  5HK3 A;  4O5V A;  4XU1 A;  3BY7 A;  3L42 A;  2P4T A;  4JDS A;  5CKH A;  2KK4 A;  5LJ3 f;  3CBO A;  4OB1 B;  4LDW A;  3RIR A;  2MAM A;  3HHT B;  4C92 E;  1Y96 B;  4BAC A;  4PJO E;  4M7D D;  1KG1 A;  4C0G A;  5KE2 A;  1UGQ B;  3OYJ A;  2LDM A;  5CCA A;  2QQS A;  3OYI A;  4BDZ A;  2XD0 A;  1AHJ B;  2X4J A;  3MEW A;  4M77 C;  3JB9 I;  4EPC A;  1PSE A;  5C0M A;  4LDY A;  4HCB A;  1Q81 C;  3JCM Q;  2ZPI B;  3P8H A;  2O01 E;  3E9F A;  3MP1 A;  2QEX A;  1ZQ1 A;  2A7Y A;  2EJ9 A;  4IUT A;  3CCS T;  1KQ2 A;  2VGN A;  1FXX A;  2DXT A;  3MEU A;  4BE1 A;  1QP2 A;  1UGS B;  3CCL A;  1YIJ A;  4M7A G;  2RK2 A;  2EIF A;  3DB3 A;  2LNV A;  4QVZ A;  4IKF A;  3CD6 A;  2RO0 A;  2QEX T;  1VQM A;  1N9S A;  3CC2 A;  2E70 A;  4PJO D;  2V8I A;  5GAN e;  3M9Q A;  1NJI C;  4B9W A;  1K73 U;  1M1K U;  3DLM A;  4Z02 A;  4EMG A;  1VQO A;  3HSB A;  3OS5 A;  1MHN A;  4RKU E;  4M78 F;  1NJI U;  4XU3 A;  4M75 F;  4V2S A;  4M78 B;  4ME7 A;  1WGS A;  3A8M B;  5LJ3 d;  4OMF B;  3CPF A;  5GAM j;  2CKK A;  4FT2 A;  3A8L B;  5KCO A;  2QQ9 A;  1XOV A;  3L2Z A;  4CI0 C;  2G3R A;  5GAO r;  3INZ A;  4L59 A;  4XTU A;  2R5M A;  5LL6 S;  5GAO p;  3L2W A;  1UGP B;  5IT9 E;  3CCM A;  2H3J A;  1VQN A;  2DZ9 A;  2JVV A;  4F7U B;  3MEA A;  3JCM c;  4C0Z A;  2KDS A;  3JB9 J;  1VQM T;  3ASK A;  4OGE A;  3SFM A;  4FIB A;  4CRI A;  1NPP A;  2XDD A;  1Q82 C;  4BDY A;  3S6W A;  5FRN A;  2E6Z A;  2MWO A;  1VQK A;  4RCC A;  1M5Q 1;  5GAN d;  4JRQ A;  2ZPG B;  1M9S A;  1P92 A;  2CZ6 B;  2JTM A;  2WSF E;  3P8B B;  4Q5W A;  1KQS S;  4ZN1 A;  3CCR T;  2VXE A;  3F70 A;  3SDZ A;  3JCM W;  1Q82 U;  2XU8 A;  1K8A C;  1YJW A;  2GQV A;  3FRN A;  1IZ6 A;  1XQH A;  4C5G A;  1IRE B;  2CZ7 B;  1VQ6 A;  1Y96 A;  2JUF A;  4M7A D;  1NPR A;  4EDU A;  3FIF A;  1K9M C;  3HL8 A;  5HY6 A;  4C8Q A;  1VQ4 T;  2VUB A;  4E47 A;  3C94 A;  2D0Q B;  2EJF A;  2LCL A;  2DPP B;  3QUI A;  4J6W A;  4JUV A;  4XTW A;  5FU7 C;  3VUZ A;  4TVR A;  5CQY A;  3O8V A;  3QZ5 B;  4JLG A;  3CCR A;  2K3Y A;  5KH6 A;  3M53 A;  2DZC A;  2RB6 A;  2VC8 A;  2R57 A;  2PVO B;  1WPY A;  2LT1 A;  1WJQ A;  2E5Q A;  3KBG A;  3OYY A;  4E7I A;  2CZ0 B;  3M55 A;  3X28 B;  2BIV A;  3A5Z B;  1NZ9 A;  2DXB A;  3MP6 A;  3X25 B;  2K2V A;  1YBY A;  3X20 B;  2ZPB B;  4M7A C;  3GIB A;  4M7D G;  5GMK i;  2XDB A;  3RER A;  4M7D C;  1G3S A;  1KC8 C;  3JCM V;  1YHQ T;  1JJ2 S;  3OMC A;  3JCM X;  3CC7 T;  3VU3 C;  3CCJ T;  2GFA A;  5CVI A;  1B34 B;  3QHS A;  4M77 D;  3UDC A;  1M90 C;  3LW5 E;  4QVC A;  3DB4 A;  1HK9 A;  3OBY A;  4C0D B;  2L89 A;  2LC4 A;  3CD6 T;  4A4K A;  5LJ5 g;  1I5L A;  3JB9 F;  4XQ3 A;  5FLX E;  5GAM d;  3L2U A;  1M1K C;  4LDU A;  4M7D E;  4N4G A;  2RD1 A;  3E19 A;  1JB0 E;  4ELY C;  1S72 T;  4A53 A;  1B34 A;  3RKX A;  2QXF A;  5CKB A;  3WVD B;  4PJO B;  4M75 G;  3OYL A;  1ZBX A;  1ZHI A;  3GOX A;  3M5A A;  1OZ2 A;  4X9C A;  4XU0 A;  1BKB A;  2LQ8 A;  1KD1 C;  5GAO n;  1OZ3 A;  1QVG S;  3BDU A;  4M77 B;  5GAN 2;  4RG2 A;  3V7C A;  1BI0 A;  4LDX A;  2HD0 A;  3HPW A;  2XDP A;  5FU7 B;  5CKD A;  2E1H A;  3CCV T;  3UT1 A;  1VQ7 T;  1W4S A;  2XK0 A;  2E65 A;  2LQK A;  2XHC A;  4M75 E;  5GAN j;  3SWN C;  3OYN A;  1KQS A;  3J81 E;  1WQ7 A;  5D6W A;  2AHJ B;  1K8A U;  3CCE A;  3M58 A;  3GLX A;  4R55 A;  5FU6 C;  5GMK l;  4BUG A;  4EMH A;  4KT0 E;  4M7D A;  2XI9 A;  2LRQ A;  2Y4Y A;  4C92 D;  4PLL A;  3J80 E;  3RUX A;  5J26 A;  2X4W A;  3X26 B;  3QSU A;  3P8D A;  3JRZ A;  4M78 D;  1M8V A;  4II1 A;  3EFS A;  1G3T A;  2CS7 A;  2ZPH B;  3NTK A;  5I2S A;  3MCA B;  3R6O A;  4QQ6 A;  3PIO A;  3G7Z A;  4PKC C;  4GY5 A;  4NS5 A;  5CKE A;  2CZ1 B;  3V7S A;  4A4H A;  4DA4 A;  2DEQ A;  2RI3 A;  2K5F A;  1YJW T;  4PJO F;  5DY9 A;  3N5B B;  4DOW A;  1I81 A;  2RHI A;  1N9R A;  2LTO A;  2EAY A;  3CBP A;  3E9G A;  4IUU A;  5FRO A;  3PNW C;  1LNX A;  1JRI A;  1Y07 A;  4E7L A;  3QYH B;  4OB3 B;  2CGH A;  3RMQ A;  1NE8 A;  3I56 A;  1XTD A;  3CEY A;  2WAC A;  3SB2 A;  5GAN h;  4QQD A;  4MZM A;  5DLO A;  3SD4 A;  3A8O B;  3LWI A;  3MP8 A;  1M4Z A;  4M78 E;  2HQX A;  5GAM e;  2QQR A;  3OSS C;  2O4X B;  3HFO A;  4C5E A;  3EAE A;  3FC3 A;  2QDY B;  5D6X A;  4A54 A;  1BI2 A;  4M7D F;  1BI3 A;  3I56 T;  4E7K A;  2EWN A;  4J6Y A;  3OW2 S;  3JCM d;  2I2L A;  1KHC A;  2FB7 A;  2DIQ A;  3HRU A;  3OQ5 A;  4GLK A;  3OYB A;  3CPW S;  2YLC A;  1YIJ T;  1W2B A;  1YI2 T;  5A0D A;  2FYK A;  3CME T;  2KMT A;  3LLR A;  4C8Q E;  2O4X A;  1K9M U;  3NTI A;  4ATO A;  3QXE B;  2E64 A;  1M1G A;  3PT9 A;  3CC2 T;  1RL2 A;  3ZBD A;  1VQ4 A;  2E10 A;  4YTL A;  4BY6 C;  1D3B A;  2RH2 A;  1N6A A;  2JOY A;  5KCH A;  3TEE A;  4X34 A;  5GMK h;  4JJN K;  3JCM J;  2EYQ A;  3QYG B;  1W2B S;  2HNI A;  3LWH A;  2EQM A;  2XG8 D;  2M9U A;  3OS1 A;  3OYA A;  3JB9 G;  2VGM A;  2NLU A;  5CR2 A;  2GFU A;  4JLI A;  5CK9 A;  2CYZ B;  1BIB A;  1X01 A;  4KBM B;  5I2M A;  1WNL A;  3RKW A;  3FLG A;  2RJC A;  1WJR A;  2Y4X A;  3G71 A;  4J8O A;  5IN1 A;  3BW1 A;  3OYE A;  2K5L A;  4C8Q D;  3FEO A;  3DKM A;  5LJ3 j;  2QQB A;  3JCM h;  4ZN3 A;  3CC4 A;  2MWP A;  2E6N A;  1N8R C;  4QQG A;  4JS5 A;  5C6S A;  4ZGE B;  2EJG A;  4C92 B;  3OYF A;  1G3Y A;  1OI1 A;  3QBY A;  3CCE T;  3KUF A;  2LX9 A;  4M75 A;  1Y7X A;  4C8Q G;  1YHQ A;  4LD9 K;  2GCX A;  3S3O A;  3OMG A;  2EFI A;  2QTX A;  3NTH A;  4FL6 A;  2R5A A;  3L1A A;  3NFC A;  4QVD A;  2MF2 A;  2X4Y A;  4WF2 A;  3TCJ A;  1U1S A;  4BB7 A;  4XTX A;  3L2V A;  3OYM A;  2JZ2 A;  2E12 A;  3OBW A;  2K5I A;  1Q7Y C;  3M4Y A;  4X9D A;  4Y28 E;  3MEV A;  3CXC S;  3G71 T;  4HT9 A;  2KVQ G;  4A4G A;  4RCB A;  4E7J A;  1YJN T;  5L8R E;  1VQ5 T;  2EQJ A;  1EIF A;  4N0A C;  4M75 B;  4PLI A;  2ZZD A;  4C5H A;  1MGQ A;  3CXC A;  4EMK A;  2WSE E;  4IUQ A;  3WVE B;  5FRM A;  2V8J A;  3T9N A;  3OYC A;  2F5T X;  3CCV A;  1LOJ A;  3ZEH A;  1KQ1 A;  3V8L A;  4LD6 A;  4R56 A;  3G4S T;  3MO8 A;  4HA8 A;  5M9O A;  3M4G A;  1U1T A;  4F7U G;  5LJ5 e;  1QVF A;  5GAN 3;  3I55 T;  2RJF A;  4J7F A;  1O9S A;  1VIF A;  3PGG A;  2PVG B;  4C92 C;  5LJ3 e;  1KC8 U;  5LJ5 h;  2VV5 A;  2D9T A;  3GPL A;  2PU9 B;  2OTL A;  1QVF S;  2WSC E;  4EMK B;  1VQP A;  4J83 A;  3MET A;  5GAO l;  2E41 A;  2EQU A;  3HRS A;  4OGC A;  3CC7 A;  2GF7 A;  2P0P A;  3C4S A;  2PUO B;  2C06 A;  2RHX A;  4IUV A;  2ZPF B;  3Q1J A;  5DM7 R;  4NOY A;  3V8K A;  2DKG A;  5HKC A;  1VQ9 A;  4A4E A;  5A0L A;  4C8Q C;  1WQW A;  5LJ5 f;  2RK1 A;  4DOV A;  5GAN 4;  5IAY A;  2IG0 A;  2R58 A;  3ZFJ A;  3RMS A;  2B8A A;  1VQP T;  2OAU A;  1VQL T;  4OVA A;  4PJO A;  1VIE A;  4KUI A;  5J39 A;  2MI6 A;  2OTJ A;  2KY9 A;  4M78 A;  2YHT A;  4M7A B;  1Y71 A;  1YIT T;  4BY6 B;  4M7A A;  3FB9 A;  3CBM A;  4BI3 A;  3TU4 K;  2V8K A;  2XIC A;  1LJO A;  2DAQ A;  5CQX A;  4OB0 B;  1PSF A;  4XTY A;  4FT4 A;  3V8J A;  3G6E T;  4BI4 A;  1G5V A;  1VQ7 A;  4MML A;  4ELZ C;  2YRV A;  5GAN 7;  2KQW A;  4IUP A;  3I55 A;  3GNF B;  4M77 F;  3C12 A;  2Y90 A;  4NL3 A;  3MHX A;  3G6E A;  1Q86 U;  2QQA A;  3OY9 A;  4O6J A;  4P5N A;  4N4H A;  2RI5 A;  3CPW A;  3CC4 T;  2DTO A;  5CAI A;  3G4S A;  1YCY A;  2QA4 A;  1QP3 A;  3VV0 A;  3L2Q A;  3S3M A;  1I4K 1;  1TH7 A;  3CCU T;  1BIA A;  2D6F A;  3OS0 A;  3M59 A;  2DXU A;  3TRE A;  1FWZ A;  3JCM e;  1VQN T;  5LJ5 d;  2RJE A;  3SWN B;  5GAM g;  4FU6 A;  2MMP A;  3QJ6 A;  4PNO A;  4Y91 A;  3DLL A;  2DTH A;  2DXC A;  2K57 A;  2DIG A;  3HFN A;  4MZP A;  1YI2 A;  2FL7 A;  1U8R A;  3J7A F;  2JTF A;  4OB2 B;  3QO3 A;  2RI2 A;  2DK3 A;  2K3X A;  4J5Y A;  3RES A;  1BI1 A;  2XKO C;  2EKO A;  4RG8 A;  4C8Q B;  1UB4 A;  2FVU A;  4C8Q F;  4XTV A;  4B9X A;  1YIT A;  4MDW A;  3CCQ A;  3BFM A;  3M54 A;  3OYK A;  3LYI A;  5GMK e;  3SWN A;  3VJP A;  1VQL A;  3JSC A;  1VQ5 A;  1XNI A;  1YJ9 T;  1HXD A;  2PQW A;  5GAO q;  5GAN 5;  4EMK C;  3QZ9 B;  2IVW A;  4VUB A;  3OW2 A;  1N27 A;  4N0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...