2XG8D

Structural basis of gene regulation by protein pii: the crystal complex of pii and pipx from synechococcus elongatus pcc 7942
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
SENYLNHPTFGLLYQICSFGDSKELFATLYAQRLFFLVAFDARGTRFEPIGRNEARMLVDNRLRQLRRDASLQEYNQLQQVFKQTFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITROGEN REGULATORY PROTEIN P-II
publication title Structural Basis for the Regulation of Ntca-Dependent Transcription by Proteins Pipx and Pii.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Transcription
total genus 20
structure length 87
sequence length 87
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2010-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF12058 DUF3539 Protein of unknown function (DUF3539)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.660 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xg8D01
2XKOC 3N5BB 2XG8D
chains in the Genus database with same CATH superfamily
4AFZC 1VQ5Q 1QW1A 3CCEA 3CBPA 2ZZDA 3H8ZA 3LWHA 2QGGA 2FYKA 4EMGA 3EHQA 3QJ6A 2KXCA 2PUKB 2LT4A 4J9BA 4HVVA 2A3LA 4OGEA 2BTTA 4ZTJA 4ATOA 2OAUA 1YI2Q 4F7UG 1NYFA 3CMAQ 2QQSA 2P0PA 1MGQA 1G3WA 2QTVA 2EWNA 1YJWT 3QUIA 3DKMA 1QKXA 5GANf 5GAN3 4XU3A 3G7ZA 1VQMQ 1ZSZB 3SWNA 1AT1B 1KD1U 2K7AA 3PIOA 4M7AA 1M1KC 2J7IA 3UWNA 2QASA 7AT1B 1C6VX 2RB6A 1UHCA 2RHXA 5LJ5j 2WSFE 3EGXB 1YJNT 3CCVA 2CKKA 2HZYA 4KUDK 3C0CA 4M78E 5LL6S 1Y57A 2XI9A 3EGDB 4O6JA 4ZNXA 4PJOE 3JCMP 1WX6A 1VQOT 4M7DA 2KDSA 4OGCA 4LUDA 2HBWA 1NLPC 4PJNA 1VQLA 1WFWA 2CZ7B 1KQSP 1KIKA 1M3CA 3OYFA 3EG1A 1Q86C 1MHNA 1TOVA 4M77E 2FG0A 2IIMA 1MMGA 4JLGA 1T3LA 2RHYA 1KQSS 3OMCA 3UA7A 3GP8A 4BI8B 5FRMA 2QYZA 5L23A 1VOMA 5A0DA 3H0IA 3I56Q 1Q81R 1NLOC 4Y91A 1QCNA 2BKDN 2DXTA 1VQKA 2DXCA 1YWOA 3OS2A 1FMWA 3OBYA 1GFCA 4E7ZA 2OTJA 2CP3A 1UGPB 4KH1B 5IHNA 2DTHA 2R58A 1NE8A 1C0MA 3CC4T 4LD6A 3H0FA 4B9XA 2ECZA 2F2XA 3HFNA 4M7DB 2DNUA 4GLMA 5GANe 3HL8A 1ZUYA 1HXDA 2ZAEA 3JAME 1PRLC 3PMIA 2DXUA 2RHUA 3C12A 2V26A 3EG2A 4XQ3A 1NEGA 3QSUA 1LPLA 2E3HA 1M3BA 5KYUA 3OQ5A 1M8VA 4XTZA 4XTUA 3CCLA 2LMJA 1AWJA 1MV0B 2ESWA 3EFOA 3V8KA 4IUUA 2NUTA 2X4YA 3MJXA 2XICA 2HD0A 2C0TA 1BCMA 3HRTA 5DLOA 2VVKA 1OZ2A 2XHCA 4J9CA 1QWFA 3FLGA 2XK0A 3QBYA 4QQDA 1GCPA 4KT0E 1SEMA 1X6BA 2KRMA 3PIPA 3AHUA 2ZPHB 4M7DG 2QG9B 1W1FA 1WIEA 3OYNA 1UTIA 1K73R 4LNPA 2LJ3A 4CRIA 1I5LA 1U5SA 1N6AA 2JJ9A 2DMOA 2OTLA 2IG0A 3EHRA 3ER0A 2LTOA 3CPWP 4IIOA 1K8AC 1RLQC 2CT3A 1YIJA 1UGSB 1YFNA 1CKBA 1UEBA 5KYUB 2V8IA 4BDZA 1ZQ1A 1YN8A 1GBRA 4ZGEB 3JB9F 3JCMg 3CC2T 1D0XA 3M4YA 3CPWS 1Y96A 3TU4K 3UATA 2NUTB 5FU7C 1VQNT 2XIDA 3CPFA 5A2QE 2RH2A 5A0GA 1GBQA 2DFUA 3M53A 2RHZA 1TXQA 2EQJA 4A4EA 2L2PA 3EH1A 2DE0X 4X9CA 4E7KA 5GAN2 1QVFP 1H641 1M4ZA 1HSQA 2KR3A 4ORZA 3L2QA 3CCMT 3CCSQ 4B6MA 3QYGB 1SKUB 3M54A 4MDWA 4E47A 4M7AD 3CCRQ 2B8AA 2MIOA 1JU5C 4XK8E 4QQGA 1QVFS 3WVEB 1U8RA 2K9GA 4NL2A 5LJ3j 3SB2A 3NFCA 3PMTA 5GMKj 2LX7A 3CCQA 4CC7A 2F1LA 2YLCA 1UFFA 2COZA 3G4SA 5GAN7 1Q82U 1BI2A 5IAYA 2HBPA 4M75E 1EX4A 2EYQA 4BY6C 5GAN8 5GAN4 4M7DD 2DF6A 2ATCB 5GAMf 2L5QA 4Z88A 1RAHB 1Y96B 2XU8A 1RAAB 1RADB 1M2VA 3UA6A 4NS5A 2Z0WA 2VKNA 2DD4A 4IUVA 1K0SA 2DVEA 3G6EQ 3H41A 4QW2A 1HK9A 2KE9A 1BI0A 3BE3A 4M78C 2DEUA 2E64A 2JNGA 3KUFA 4PJOC 1YITT 4JRKA 1MMNA 1N8RR 2QA4T 1Q7YC 1N27A 1D1AA 4C8QE 4RCBA 4GBQA 3PVLA 2PVOB 5KYXB 3GBQA 2Y4YA 5FU6C 5KYWA 2DIQA 4JJDA 1TTHB 4M77C 1IO6A 1KQ1A 3MPUB 4R0KA 4EMHA 1WQ7A 3INZA 3A8MB 3MEAA 5M9OA 9ATCB 1RAGB 1TH7A 1M2VB 2A08A 3I55A 2MWOA 5LJ5d 4N4GA 1QVFA 3L2WA 4C8QF 2HAXA 2EPDA 3NHNA 3LYIA 2DBKA 4KGXB 1BI3A 4FYVB 1M90C 2DEQA 2DJZA 1WHMA 4PK4A 2DXBA 1M3AA 2L3RA 2CREA 5I2SA 3Q1JA 4JJNK 1VQPA 1M5Q1 1ABQA 5LJ3f 5GAMe 4C5IA 1QCFA 5J3BA 2GGRA 3CCEQ 3JB9J 1VQ5T 2BZYA 4OMMA 1YHQA 5HK0A 2NYSA 1UECA 5CKEA 4X1VA 2XDBA 1YJ9Q 3REAB 2ROTA 5DM7R 3LWIA 2NLUA 1F1BB 3FEOA 2O2OA 2C0OA 1D0YA 2O31A 2K57A 3RUXA 2ZPBB 1VQ6T 2LNHB 5LJ5h 4MDXA 1VQ8T 1SSFA 1B07A 2OJ2A 1BYMA 1C1AA 2GFUA 3E9FA 3X28B 2PVDB 1M1KU 3CD6A 3VU3C 4HT8A 4C92E 4YTLA 2MYSA 2FO0A 2YUOA 3ZL7C 2FB7A 3CCVQ 5FU7B 1G8XA 2EKHA 2RQTA 4OMPA 1UGQB 1WA7A 2RI2A 2LQWA 5CKHA 2WACA 2LJ1A 5HCKA 2RO0A 2RNAA 4LXCA 3M0RA 5C6SA 3FJ5A 4E7IA 2J05A 2JTMA 1WYXA 3CQTA 1RI9A 4LN2A 4M78A 1YJWA 1VQLQ 1IREB 5A0LA 4PJOA 1ACMB 2L89A 4C92F 1Q86U 2CZ0B 3CC7T 5I22A 1FX7A 4DEYA 4XTXA 3M59A 4KGZB 4M77A 4PFZA 3OYEA 4JRPA 1WJRA 2YUPA 3EG3A 1N9RA 1SRMA 3PE0A 4BY6B 3OYDA 1YJNA 1W2BP 4E6RA 3OMGA 3R6NA 2CP0A 5FRNA 3QZ5B 2P0QA 3MO8A 1MV3A 2FHDA 2OTJQ 1HJDA 3A1PA 3MEWA 4QQ6A 5CCAA 4FT4A 1JBMA 4JPBW 1W2BS 4OF1A 4J8OA 4J9HA 2GTJA 1VQOA 4OB0B 2LCLA 4BE1A 1X43A 4M75C 2L3QA 1VQ4Q 3HTRA 1QCOA 4M78B 3U23A 8AT1B 3GIBA 3OYLA 2CZ6B 4PJOB 3GNFB 1VA7A 1BCOA 4Z02A 2ZPEB 1B34B 3L2ZA 4PLLA 3OY9A 1DJ7B 4IUPA 4X9DA 1VQ7T 5FU6B 4HCBA 4IUQA 3LX7A 4N4IA 4M77B 1T3SA 1I1JA 4ZTFA 2CSQA 2M0OA 3CXCP 2O01E 2CDTA 5LJ3d 5GMKm 3R6OA 1JXMA 3HFOA 4C8QC 3MP6A 1WHGA 3A8LB 2HKQB 2DLPA 2O88A 3CC4A 3GF5A 2EJ9A 3NTKA 2DVJA 2DM1A 3CBOA 2XD0A 3CXCS 4A4HA 2ZCFB 2BE9B 2FPEA 2RN8A 5KE2A 3JCMQ 2E12A 3FB9A 4M78G 3LH5A 4QVZA 3VUZA 4PJOG 2CUBA 4FYYB 3BW1A 2OTLQ 1I0CA 3JB9H 1PKSA 3L2VA 1YIJQ 2DETA 2NUZA 2AHJB 4NL3A 4KULA 3MKDA 2BZ8A 1ZLMA 5EC7A 1WHLA 2LT1A 2DYBA 3TQ7P 2NWMA 2VXFA 1D1BA 4EPCA 1W2BA 4IKFA 1RUWA 3A8HB 3I5RA 4JJCA 4PNOA 2GBQA 1M1GA 2DL7A 4II1A 4ELZC 4PKCC 4A4KA 2DZCA 3VS7A 3A5ZB 2BE7D 2QAZA 1IGUA 1WJQA 3NPFA 4EMKC 1MMAA 5LJ3h 1BU1A 1Y0MA 2VWFA 1UE9A 2K79A 1WLPB 5GMKh 2COWA 2LCCA 1KSWA 2X35A 3CCRT 3FDRA 2X51A 3T9NA 3G1JA 2RJCA 4FCYA 3RKXA 1OEBA 3THKA 4L6V5 2HL5C 2G6FX 4BI3A 3CCQQ 4J7IA 2JW4A 5FWBA 4Y28E 3G4SQ 3CC2A 2AZVA 4HCZA 3RIRA 1J3TA 3QDFA 1EZZB 1VQNA 3NGPA 3L2RA 1ZA2B 3SFMA 1M27C 2GTOA 4M78D 5D6YA 3RBBB 2HCKA 4PJOD 3CXCA 3L42A 1U1TA 1VIEA 4RTVA 5I21A 4M75A 2V1RA 4C92C 3G6ET 1FYNA 4J9DA 3OYKA 4HCCA 4M77D 3VKIA 1R0BG 1WXUA 2M0YA 3NMZC 2PUOB 4C5EA 3SWNB 4LDYA 5CR2A 2EJGA 4M7AB 4J6XA 3PNWC 3GLXA 1KQ2A 3RERA 2HDAA 1Q7YU 2MK5A 3V7SA 2XDDA 4FW2A 4M4ZA 4LDWA 1K9MR 3M0SA 1TG0A 1TUDA 2MPXC 1QVGA 1BKBA 1IRXA 3S3OA 3VRYA 1QP3A 4C8QA 1A0NB 3X20B 2RA2A 2EVRA 3MEUA 4LDVA 4WF2A 4O5VA 4OMNA 4HVWA 3VS2A 2X4XA 4RKUE 3RESA 5GAN5 2EYWA 1Q82R 2RJFA 3I55Q 5HK3A 1BBZA 2EFIA 4M75B 2HKNA 2LRQA 1D1CA 2MOXA 2VXEA 4JZ3A 1JJ2A 3OS0A 1M1FA 1OV3A 1YITA 1ZUKA 3QWYA 5C0MA 4M7AG 2QA4A 1M90U 4F7UF 3MP1A 2K3BA 4PJMA 1SF9A 2EQKA 2LZ6B 4FYWB 5GAOp 1E7OA 2JMCA 2QQ9A 3VV0A 3HPWA 1VQPQ 4BDYA 4IURA 2GF7A 3E2UA 3JCMd 2DA9A 3V7RA 5LJ5f 4JRIA 4HCKA 5CAIA 2EW3A 3VYHB 5GAOl 4CI0C 3CCET 1YHQQ 2BUDA 3D7SB 4EMKA 2YRDA 1ZSGA 2D6FA 4DEXA 2F2WA 1Z9QA 1YJ9T 2A0FB 3HRUA 2DL5A 2WSEE 3A8GB 4HA8A 2O9SA 3SHWA 4OB2B 1TUGB 2MCNA 1E6HA 5KE3A 3OS5A 1OX9A 2PVGB 4F04B 1FWZA 3EFOB 4B9WA 2DX1A 3FJPA 3CMET 2E3IA 4FSSA 4F16A 3CD6Q 1M8MA 4C5GA 4XU0A 5GAN6 3S3NA 1AHJB 2LC4A 2H3JA 4PJJA 1AWOA 3LGFA 2EQMA 2J6OA 3CCJT 1PKTA 1H8KA 1S1NA 3E19A 1S72T 1W70A 4MZMA 1H3ZA 4C92A 2MI6A 4FU6A 2GQVA 1G5VA 1WQWA 1KG1A 2Y4XA 3UDCA 2HQHA 2CGHA 3I9QA 4KH0B 1YJWQ 1RLPC 5DY9A 1VQ6A 4CC2A 2QXFA 4OVAA 5KYYA 1PRMC 1NPPA 3DB3A 1VQ8A 2IVWA 3OB9A 2JVVA 2HNIA 2DPPB 2EGAA 1I4K1 2B86A 5GANg 1O75A 2X9HA 2HSPA 1UB4A 1UGVA 4ESRA 3PT9A 3EG0A 4E2FB 4DOVA 5LJ5e 2JZ2A 4M75D 5GJVB 1VQ9T 2R5MA 3VS5A 4BE2A 1YJNQ 3OSVA 2DRKA 2SRCA 1SPKA 1X2KA 2FVUA 1KC8U 3JCMV 1NZ9A 6AT1B 4M7AF 2CP5A 5IXBA 3SDZA 2P4RA 1RAEB 1VQOQ 1GL5A 3S3MA 3P8BB 2DZ9A 3RKWA 2JT4A 1D3BA 3M0UA 3I5SA 4ELYC 1QP2A 4C0GA 1X01A 1VQ4T 4XAXB 3CCUT 3JCMb 3EAEA 3EFSA 2JTEA 3G71T 2XKOC 3URGA 2P84A 1QWEA 3CC7A 3OYHA 4JLIA 2YUNA 1YP5A 4M7DF 4C8QD 1PNJA 2K6DA 1K4US 2M9UA 1U3OA 2PU9B 4AFUC 3QDRB 1LJOA 5IHIA 2JOYA 1NJIR 4Z89A 2RMOA 2MAMA 2A28A 4JJBA 5KCOA 2QEXT 1D0ZA 1BIAA 3HP9A 2R5AA 2RJDA 3LH0A 1OYXA 1VIFA 2EAYA 3CC4Q 4A53A 4LD9K 2K4YA 1AWWA 1RABB 1WHKA 1IXDA 4OMOA 3E1SA 1QVPA 5IN1A 4C0DC 1WHJA 2KT8A 1JO8A 1AEYA 1WJSA 1TU0B 3A98A 2VC8A 2OTLT 4RG8A 1YNZA 3VJPA 3RMQA 5KYWB 1VQ7A 3V8LA 3C4SA 5AT1B 2FRWA 2YDLA 4LUEA 3M56A 3QHSA 5FW9A 1D09B 4RTTA 4XTYA 3HHTB 2KBTA 4AT1B 1Z9ZA 3M55A 1PCXA 1XOVA 3OYAA 1TWBA 1ABOA 1K1ZA 3FRNA 1YI2T 1WPYA 1VUBA 3CMAT 3VYGA 2DILA 2M1HA 2RK1A 2KI7A 1NYGA 1M30A 2FZGB 3P8HA 8ATCB 2KXDA 3M5AA 3J80E 4J5YA 1VQMT 5GMKl 3M0PA 4XTVA 3QKJA 2A7YA 2YRCA 2I0NA 1ZSZC 5CKBA 1GRIA 2ZPIB 2C06A 2EYYA 2KRNA 2YLBA 4EDUA 1RI0A 3CC2Q 4C92D 3G4ST 1KHIA 4QT7A 3BDUA 3EFRA 2VYTA 3HRSA 4BI4A 2MWPA 4Y92A 4OB3B 2RQUA 1YWPA 1YCSB 1Q81C 4P5NA 2HQEA 3ZBDA 2RI5A 2MMPA 1UGRB 4HVUA 1B7TA 4BE0A 1X6GA 2CP7A 1K9MC 4AMCA 3OYCA 2EJFA 4J6YA 3M0QA 2NUPA 3CCRA 1YCYA 2K2MA 1T0HA 2L3PA 3EH2A 4AG1C 4DBRA 5CKDA 1WI7A 1PSFA 5LJ3e 4ME7A 2RD1A 3I56T 4OMQA 1TSFA 1KK7A 3S6WA 1VQKQ 5GMKe 1V1CA 2XG8D 2EGEA 3GNGA 1Q82C 1UJ0A 2EQIA 1KD1R 3RR6A 2JS2A 1I8FA 5CQXA 5DLQE 1KJWA 4PL6A 5GAMg 4JDSA 2JN0A 5GANj 5CK9A 4F7UA 3G6EA 5HKCA 2QK0A 4ANJA 4C0FA 3BDLA 4QVDA 3ME9A 2CP2A 3WVDB 4BUGA 3QG1A 3DLLA 2E6NA 2YXYA 2NUPB 4KGVB 3JCMX 3CCLQ 2QA4Q 4EIKA 1R8OB 1AZEA 4PFOA 1K73C 2QQRA 1I07A 1XTDA 3OYBA 2KEAA 4FT2A 1OX8A 2HQXA 2PTKA 2E10A 1LCKA 1V76A 2X3XD 3META 2E1HA 1IB8A 1BB9A 1QMCA 4J9FA 3BFMA 5CO7A 4X34A 3L1AA 1Y71A 2RQWA 2X4WA 1YHQT 4E7JA 2K3XA 4HXJA 3UF4A 1PHTA 4TVRA 4J7FA 1FMKA 2CH4W 4C0DB 4RMOA 3EG9A 2ED1A 2ZPGB 1UDLA 2EQUA 1H3HA 2EBPA 3DB4A 2QQAA 1IHWA 1R77A 1QVGP 1ZSZA 2J6KA 2CP6A 1K8AU 3JCMf 3RKYA 1UHFA 3RNJA 2K5FA 4M77G 4JUVA 4JZ4A 1PM3A 2MF2A 2E4HA 1AZGB 1ARKA 3N5BB 1WZOA 1QVGS 1BI1A 3EGXA 3LLRA 3JCMJ 1MUZA 2M51A 1X6OA 1M2OA 3QZ9B 4PJLA 5D7UA 4XU2A 3OSSC 3EGDA 1NM7A 1PD1A 5LJ3g 2DERA 5AYFA 1M90R 1GFDA 3MCAB 2YUQA 3NTIA 3CCST 3OW2A 3UPUA 1JJ2P 1JRIA 4MMKA 1YJ9A 2YT6A 4DBFA 2RJEA 3QJYA 2QDLA 3OYYA 3VS0A 2DL3A 2V8KA 1SRLA 2D9TA 1JJ2S 1WXBA 1BK2A 3LGLA 1VQ6Q 3EG9B 3X25B 1VQ8Q 2KROA 2CT4A 1OI1A 1VYTA 2JM8A 3ZFJA 2W10A 4QVCA 3JB9I 4BD3A 2RPNA 2V8JA 3QO3A 3CMEA 1AOJA 2VGNA 3VS3A 2GCXA 2O9VA 4LE9A 2DRMA 4L5GA 1QLYA 4N4HA 1N8RC 1W6XA 2C0IA 2LX9A 4MMLA 2W0ZA 3CCJA 2HMAA 5D6WA 3CCMA 1RAFB 2E65A 3MHXA 3WXMB 1S72A 4E7LA 4GY5A 3VRZA 2OI3A 3H6ZA 1RL2A 1ZBJA 2YWWA 3EGUA 2ROLA 4R56A 3JB9G 1IZ6A 5J39A 2FPDA 5KCHA 1NJIC 3JCMe 3H9NA 2LQKA 2QGFB 4ZGDB 3KBGA 4RTUA 3CC7Q 2CS7A 2X4JA 3VS1A 1OULA 2XDPA 3FIFA 4OB1B 2XMFA 4M78F 2X3WD 4F7UE 1P92A 3LW5E 4PJOF 1K9AA 1CSKA 1VQ9A 5FROA 2FRYA 2SEMA 1WHHA 2HSEB 2RHIA 2A36A 4A4GA 1OPKA 2EKOA 2PZ1A 4XTWA 4F14A 5J26A 3OYGA 3QPHA 1MMDA 3C94A 4M77F 2LJ0A 5ECAA 2L8DA 4KBMB 3REBB 1XNIA 2LVMA 2GFAA 1VQ4A 1MNEA 2R57A 3OYIA 3CCUA 5HY6A 1RAIB 3G71A 1WNLA 4E7HA 1KC8R 4RTWA 3PFSA 4OP0A 2VGMA 3M57A 1FMVA 1OQKA 5GAMj 5FLXE 4J9GA 1VQ7Q 1XQHA 3ASKA 4RCCA 4C8QB 2KT1A 1G83A 2QEXA 1X27A 1PSEA 3JB9D 1G3SA 2V1QA 4M75G 2KY9A 5CIUA 4KRTA 1SSHA 5GJWB 2QDYB 2JM9A 3V7CA 1TUCA 4AFQC 1E6GA 2DTIA 2M16A 3VS6A 4A54A 4JRQA 2E41A 2CYZB 3OA6A 3HSBA 1BIBA 2D1XA 1KQSA 1PWTA 3JV3A 1N9SA 3JCMW 2DKGA 5GANd 2KYBA 4OMFB 4VUBA 3KXTA 1EIFA 1X69A 2CZ1B 1VQ5A 2G3RA 2GQIA 3J7AF 4DQ2A 4ZN1A 4C8QG 4QKUA 2DIGA 3CCVT 4BB7A 3PGGA 3JCMh 3ZEHA 4EMKB 1YI2A 2JMAA 3CMAA 1EFNA 1Q81U 2E70A 1SG5A 3TSWA 4PLIA 1VQLT 4M7AE 4A63B 3GPLA 2CUDA 4FM4B 2YRVA 2CSIA 1K9MU 2DD5A 5EG2A 1VQMA 1AD5A 1T0JA 1KD1C 3OS1A 4GLKA 2IPOB 1CKAA 2JS0A 2F5TX 2FEIA 2QTXA 1IGQA 1OU8A 2DL8A 1ZHIA 2DJQA 2DAQA 3E9GA 2M02A 4J6WA 1OZ3A 1OOTA 4UC4A 2ZPFB 3O8VA 5KYXA 2A37A 2E5KA 1VQKT 2PQWA 1YBYA 4M7DE 1GCQC 2H3EB 2PNIA 4DA4A 4L59A 2L0AA 3L2UA 2OTJT 4FL6A 3MEVA 3PVQA 1LOJA 5GANh 1M1KR 2YHTA 3QIIA 2LQ8A 3CBMA 4IIMA 4C92B 2DTOA 1G3YA 2HL3A 1U1SA 2ABLA 1B3QA 1X2QA 2LCSA 3TCJA 3J81E 2K5LA 3O5ZA 4J9EA 5I11A 2OX7A 2F2VA 2F5KA 1K76A 5KYYB 2F69A 2VB6A 4NOYA 2LP5A 3I56A 4M75F 1UG1A 4ZGJB 2O4XA 2COYA 3A8OB 5GAOm 3CCLT 2K2VA 3JRZA 2ENMA 4N0AC 5D6XA 2VUBA 5CVIA 3CPWA 1Q86R 2Y90A 1MNDA 1M9SA 1VYUA 2VV5A 1K73U 3M0TA 2RM4A 5GAOn 2E6ZA 3IQLA 4A4FA 4LDUA 4XU1A 2JXBA 3TSZA 5KYNA 1JB0E 1OPLA 2AKKA 4C92G 3NTHA 4J9IA 1ZBXA 1X75C 4D8KA 3VUBA 1R0CB 2I2LA 2KGTA 1Y7XA 1D3BB 3AT1B 3I35A 2P4TA 1U06A 4KUIA 1GXIE 2J06A 1XJWB 2ZGWA 2EYZA 2EIFA 3QYHB 1YIJT 2KSSA 4MZTA 2AT1B 2J6FA 1AWXA 1G2BA 2AK5A 2O4XB 1NPRA 2DK3A 1ZA1B 1QQJA 1ZX6A 2FZCB 2D0NA 4V2SA 2LNVA 3P8DA 5FWCA 4E7SA 2YSQA 3X26B 1JQQA 5LJ5g 4FYXB 3FC3A 4DOWA 1W4SA 4D6WA 2EYXA 2AIRB 2KVQG 4RG2A 1UJYA 3TEEA 2K3YA 3QWXX 2EGCA 1ZUUA 3F70A 4WCIA 4WTOB 4AG2C 5IXFA 1SHGA 1G3TA 2HEQA 5IH2A 2DO3A 2KYMA 3GOXA 4FIBA 3CCQT 5KH6A 3V8JA 4RTYA 4Z8AA 1HD3A 5GAOq 3JCMc 1QKWA 4CC3A 5IHKA 1GCQA 2DYIA 1VQNQ 3CMEQ 5GAOr 4ZN3A 4RTXA 4C5HA 2D8HA 4CC4B 2OAWA 1K8AR 3HKSA 2ED0A 1N8RU 3CCJQ 3MP8A 3CCMQ 4MZPA 3CCSA 1S72Q 2E5QA 5GAMd 2L3SA 1NBEB 1OU9A 2D0QB 5IT9E 4J83A 1K0XA 1H92A 3M4GA 1O9SA 5CKFA 5GMKi 2WSCE 2RQVA 1NEBA 2DBMA 2AZSA 2RQRA 3CEYA 4PFPA 1NJIU 1NG2A 1B34A 3SWNC 2VASA 4N0AA 1RACB 2D8JA 3SEMA 4M7AC 1WDXA 3OBWA 3BY7A 4R55A 2AKLA 1VQ9Q 2GNCA 3OW2P 2LDMA 1PD0A 4JS5A 1KC8C 1KHCA 1WXTA 3I55T 2FL7A 3OW2S 4OMLA 3UT1A 1AVZC 1N5ZA 4D8DA 4M7DC 4F17A 2LQNA 3X24B 4DBQA 3KFVA 1Q95G 1YITQ 4RUGA 3TREA 4HT9A 2KMTA 3JSCA 3CCUQ 4BACA 2BZXA 3G71Q 5GAMh 1KFZA 3QXEB 2JUFA 3TVTA 3ULRB 2DL4A 1Y07A 3RMSA 1IHVA 2JTFA 4DBHA 3DLMA 1SHFA 4FW1A 1VQPT 4HKEA 3M58A 2QQBA 2CH4A 4K11A 1JEGA 1LVKA 2FPFA 1VYVA 3PTAA 2KRSA 2BIVA 1FXXA 1Q7YR 1JXOA 1PG5B 2QEXQ 1PC0A 5L8RE 4C0ZA 3OYMA 1LNXA 2P0KA 4LDXA 1I81A 2KNBB 1V29B 2KAFA 1I5OB 4F7UB 1UUEA 3VS4A 3M9QA 4IUTA 4Q5WA 3OYJA 5I2MA 2KQWA 4JS4A 3RDVA 2FZKB 3C95A 1WGSA 2RK2A 4AFSC 2K5IA 5CQYA 2RF0A 1HYOA 4FSXA 4RTZA 1TS9A 2RI3A 3SD4A 2QI2A 3CD6T 3H0HA 2KK4A 2H8HA
chains in the Genus database with same CATH topology
4ELYC 2RI2A 4OP0A 1QP2A 1QW1A 4C0GA 3CCEA 5CKHA 1X01A 3CBPA 2WACA 2ZZDA 3H8ZA 4XAXB 3LWHA 1VQ4T 2RO0A 2FYKA 3CCUT 4EMGA 2VGMA 3JCMb 3EAEA 5C6SA 3M57A 3EFSA 3G71T 4E7IA 5GAMj 2JTMA 2XKOC 5FLXE 4M78A 3URGA 3QJ6A 2PUKB 2LT4A 3CC7A 1YJWA 3OYHA 1IREB 4JLIA 2A3LA 4OGEA 5A0LA 4PJOA 4ZTJA 4M7DF 1XQHA 4C8QD 4ATOA 3ASKA 2OAUA 2M9UA 4F7UG 4RCCA 4C8QB 2L89A 2PU9B 2QQSA 4C92F 2QEXA 1Q86U 1PSEA 2CZ0B 3QDRB 1LJOA 1G3SA 1MGQA 2P0PA 3JB9D 1G3WA 4M75G 2EWNA 2KY9A 3CC7T 1FX7A 1YJWT 5CIUA 3QUIA 2JOYA 3DKMA 4XTXA 5GANf 5GAN3 2MAMA 2QDYB 3M59A 4XU3A 3G7ZA 3V7CA 5KCOA 4M77A 4JRPA 3OYEA 2QEXT 1WJRA 3SWNA 2DTIA 1BIAA 1KD1U 2M16A 4A54A 4JRQA 3PIOA 1N9RA 3HP9A 4BY6B 3OYDA 2E41A 2R5AA 2RJDA 1OYXA 3LH0A 1YJNA 1M1KC 4M7AA 1VIFA 2EAYA 2CYZB 3OMGA 3UWNA 3OA6A 4A53A 2RB6A 4LD9K 3HSBA 5FRNA 2K4YA 1BIBA 2P0QA 2RHXA 3MO8A 2FHDA 3QZ5B 5LJ5j 2WSFE 1KQSA 3E1SA 3MEWA 1QVPA 4QQ6A 5IN1A 4C0DC 5CCAA 4FT4A 1JBMA 1W2BS 1YJNT 4OF1A 1N9SA 4J8OA 3CCVA 1VQOA 2CKKA 4OB0B 2LCLA 4BE1A 3JCMW 4KUDK 4M78E 5LL6S 2DKGA 4M75C 2XI9A 5GANd 4O6JA 4OMFB 4VUBA 3KXTA 1EIFA 2CZ1B 1VQ5A 3J7AF 2G3RA 4PJOE 1WJSA 4DQ2A 4ZN1A 3JCMP 2VC8A 4C8QG 2DIGA 2OTLT 3CCVT 1VQOT 4M78B 4RG8A 2KDSA 4BB7A 3GIBA 3OYLA 4M7DA 4OGCA 2CZ6B 3VJPA 3RMQA 4PJOB 3PGGA 1VQ7A 3GNFB 3V8LA 1VQLA 3JCMh 2CZ7B 3C4SA 4Z02A 2ZPEB 3ZEHA 1B34B 3OYFA 4EMKB 3M56A 1YI2A 1Q86C 3QHSA 1MHNA 4M77E 3L2ZA 4PLLA 3OY9A 4XTYA 3CMAA 3HHTB 1Q81U 2E70A 1DJ7B 4IUPA 4JLGA 4X9DA 3M55A 1VQ7T 1XOVA 5FU6B 3OYAA 2RHYA 4PLIA 1KQSS 3OMCA 1VQLT 3GP8A 4IUQA 3LX7A 4N4IA 4BI8B 3GPLA 5FRMA 4M7AE 1VQ5T 4M77B 5A0DA 3FRNA 1YI2T 4ZTFA 4FM4B 2YRVA 1K9MU 2DD5A 1WPYA 5EG2A 2M0OA 1VUBA 1VQMA 1KD1C 3CMAT 4Y91A 2O01E 4GLKA 5LJ3d 3VYGA 3OS1A 2F5TX 5GMKm 2QTXA 2M1HA 3R6OA 2BKDN 1ZHIA 2DXTA 1VQKA 2RK1A 3HFOA 2DXCA 4C8QC 2DAQA 3MP6A 3P8HA 3OS2A 3A8LB 3E9GA 3M5AA 3CC4A 3GF5A 2EJ9A 3NTKA 3OBYA 4J6WA 1OZ3A 3CBOA 3J80E 4J5YA 4UC4A 1VQMT 5GMKl 2ZPFB 4A4HA 3CXCS 3O8VA 2XD0A 2OTJA 2ZCFB 1UGPB 5KE2A 3JCMQ 1VQKT 2E12A 2DTHA 4XTVA 3QKJA 2PQWA 2R58A 1YBYA 2A7YA 1NE8A 3FB9A 4M78G 4M7DE 3CC4T 4LD6A 4DA4A 4QVZA 3VUZA 4L59A 4PJOG 5CKBA 4B9XA 3L2UA 2OTJT 2ZPIB 4FL6A 2C06A 3MEVA 2YLBA 1LOJA 3BW1A 5GANh 4EDUA 1RI0A 3HFNA 4M7DB 5GANe 3JB9H 3HL8A 2YHTA 3QIIA 1KHIA 4C92D 1HXDA 2LQ8A 3CBMA 3JAME 3L2VA 3G4ST 4C92B 3PMIA 3BDUA 3EFRA 2VYTA 2AHJB 2DTOA 1G3YA 2DXUA 2RHUA 3C12A 4XQ3A 4NL3A 1U1SA 3HRSA 4KULA 4BI4A 2MWPA 3QSUA 4OB3B 3OQ5A 1M8VA 2LT1A 1Q81C 4P5NA 3TCJA 4XTZA 2HQEA 3J81E 3ZBDA 2K5LA 2VXFA 4XTUA 3CCLA 2RI5A 2F5KA 2MMPA 4EPCA 1UGRB 3V8KA 1W2BA 4BE0A 4IUUA 4IKFA 2F69A 4NOYA 1K9MC 3A8HB 3OYCA 2X4YA 2EJFA 4M75F 4PNOA 3I56A 4J6YA 4ZGJB 1M1GA 4ELZC 4II1A 2XICA 2O4XA 4PKCC 2HD0A 4A4KA 3A8OB 5GAOm 2DZCA 3CCLT 2K2VA 3A5ZB 3CCRA 3JRZA 1WJQA 1YCYA 3HRTA 4EMKC 5DLOA 1OZ2A 4N0AC 5D6XA 2VUBA 2XHCA 5CKDA 5LJ3h 5CVIA 1PSFA 3CPWA 5LJ3e 4ME7A 2RD1A 2Y90A 3I56T 3FLGA 1M9SA 1K73U 2VV5A 2XK0A 3QBYA 5GMKh 4QQDA 2RM4A 3S6WA 2E6ZA 2LCCA 4KT0E 5GAOn 2X35A 5GMKe 3PIPA 4A4FA 2XG8D 3FDRA 4LDUA 3CCRT 3T9NA 4XU1A 3AHUA 2ZPHB 4M7DG 3GNGA 1JB0E 2RJCA 1Q82C 3RKXA 3OYNA 4L6V5 4C92G 3NTHA 1ZBXA 1X75C 4CRIA 4BI3A 4J7IA 1I5LA 3VUBA 1I8FA 5CQXA 2I2LA 1N6AA 2OTLA 1Y7XA 2IG0A 4Y28E 3ER0A 1D3BB 3CC2A 2LTOA 5DLQE 1K8AC 2P4TA 4HCZA 4PL6A 1YIJA 1UGSB 3RIRA 5GAMg 1UEBA 1VQNA 4JDSA 2V8IA 4BDZA 3L2RA 1ZQ1A 3SFMA 2JN0A 4KUIA 4M78D 5D6YA 1GXIE 5GANj 4ZGEB 5CK9A 4F7UA 3JB9F 3G6EA 3JCMg 3CC2T 3CPWS 2ZGWA 3M4YA 3CXCA 1Y96A 2EIFA 5HKCA 3L42A 4PJOD 1U1TA 3QYHB 3TU4K 1YIJT 1VIEA 2KSSA 4C0FA 5I21A 3BDLA 4M75A 4QVDA 4MZTA 1VQNT 5FU7C 2XIDA 3ME9A 3CPFA 3WVDB 4BUGA 3QG1A 3DLLA 2E6NA 5A2QE 2RH2A 5A0GA 2O4XB 4C92C 3G6ET 3OYKA 3M53A 2RHZA 3JCMX 2EQJA 1NPRA 4A4EA 4HCCA 4X9CA 4E7KA 5GAN2 4M77D 1H641 1M4ZA 1R8OB 3VKIA 2DK3A 3L2QA 3CCMT 2PUOB 4C5EA 3SWNB 2QQRA 3QYGB 1K73C 1XTDA 3M54A 4LDYA 2LNVA 3P8DA 4MDWA 4E47A 5CR2A 4M7AD 2EJGA 3OYBA 3X26B 4M7AB 2B8AA 4FT2A 4J6XA 2HQXA 5LJ5g 3PNWC 3GLXA 2E10A 4XK8E 4QQGA 1KQ2A 3FC3A 1QVFS 4DOWA 1W4SA 4D6WA 1Q7YU 3WVEB 3V7SA 2XDDA 3META 1U8RA 4LDWA 4NL2A 5LJ3j 3SB2A 3NFCA 3PMTA 2KVQG 1QVGA 2E1HA 4RG2A 1BKBA 3TEEA 2K3YA 3BFMA 5CO7A 5GMKj 3CCQA 3S3OA 1QP3A 3L1AA 4X34A 1Y71A 2YLCA 2X4WA 1YHQT 4E7JA 4C8QA 2K3XA 5GAN7 3G4SA 3F70A 1Q82U 3X20B 2RA2A 1BI2A 5IAYA 4TVRA 2HBPA 4M75E 3MEUA 4J7FA 4LDVA 1G3TA 4BY6C 2EYQA 4WF2A 2DO3A 5GAN8 4O5VA 3GOXA 4FIBA 5GAN4 5KH6A 3CCQT 4M7DD 2X4XA 4C0DB 3V8JA 4RMOA 4RKUE 5GAMf 2L5QA 3RESA 5GAN5 1Y96B 5GAOq 2XU8A 2ZPGB 3JCMc 2RJFA 2EQUA 5HK3A 2EFIA 3DB4A 2QQAA 4M75B 2LRQA 4NS5A 1K8AU 3JCMf 3RKYA 2VXEA 5GAOr 4ZN3A 2DD4A 2K5FA 4M77G 4IUVA 4JUVA 4C5HA 2DVEA 2MF2A 1JJ2A 3OS0A 1M1FA 1YITA 3N5BB 1QVGS 4QW2A 1HK9A 5C0MA 4M7AG 2QA4A 1BI1A 3HKSA 3LLRA 3JCMJ 1M90U 4F7UF 1BI0A 3MP1A 1N8RU 3MP8A 1X6OA 3QZ9B 4M78C 2EQKA 4MZPA 5GAOp 2E64A 3CCSA 2JNGA 3KUFA 4PJOC 2E5QA 5GAMd 4XU2A 1YITT 3OSSC 2QQ9A 4JRKA 5LJ3g 3VV0A 2D0QB 5AYFA 3HPWA 2QA4T 4BDYA 1Q7YC 5IT9E 1N27A 4IURA 4J83A 2GF7A 3MCAB 3JCMd 4C8QE 3M4GA 3NTIA 4RCBA 3V7RA 5LJ5f 4JRIA 1O9SA 5CKFA 5GMKi 2PVOB 3CCST 3OW2A 5CAIA 2WSCE 3UPUA 3VYHB 2Y4YA 3CEYA 1JRIA 4MMKA 5FU6C 5GAOl 1YJ9A 4CI0C 3CCET 2RJEA 1NJIU 2DIQA 3QJYA 4M77C 2BUDA 3OYYA 1B34A 3SWNC 4EMKA 1KQ1A 2V8KA 2D6FA 4N0AA 2D9TA 1JJ2S 4M7AC 4EMHA 1WQ7A 1YJ9T 3LGLA 3INZA 3HRUA 3A8MB 3MEAA 3X25B 5M9OA 2WSEE 1TH7A 3A8GB 3OBWA 1OI1A 4HA8A 3BY7A 4R55A 3I55A 4OB2B 3ZFJA 4QVCA 2MWOA 2LDMA 5LJ5d 4N4GA 3JB9I 4BD3A 2V8JA 3QO3A 3L2WA 3CMEA 4C8QF 4JS5A 2HAXA 1QVFA 2VGNA 5KE3A 3LYIA 2GCXA 3OS5A 1KC8C 1KHCA 3I55T 2PVGB 1BI3A 2FL7A 4L5GA 3OW2S 4N4HA 1FWZA 4B9WA 1M90C 3UT1A 2DEQA 1N8RC 3FJPA 2LX9A 4MMLA 2DJZA 4M7DC 3CMET 3RERA 3CCJA 5D6WA 3X24B 2DXBA 3CCMA 4C5GA 2E65A 4HCBA 2L3RA 3MHXA 3TREA 3WXMB 1S72A 4HT9A 4XU0A 2KMTA 5GAN6 5I2SA 3Q1JA 1AHJB 3JSCA 4JJNK 4E7LA 3S3NA 2LC4A 4BACA 1VQPA 1M5Q1 2H3JA 4GY5A 3LGFA 3H6ZA 5GAMh 3QXEB 2EQMA 1RL2A 5LJ3f 3CCJT 5GAMe 4R56A 4C5IA 2JUFA 3JB9G 5J3BA 3E19A 1Y07A 3RMSA 1IZ6A 1S72T 4MZMA 2JTFA 1H3ZA 4C92A 3JB9J 2MI6A 4FU6A 5J39A 2GQVA 5KCHA 1WQWA 3DLMA 3JCMe 1NJIC 2Y4XA 1G5VA 1KG1A 1VQPT 4HKEA 2LQKA 3M58A 2QQBA 4ZGDB 3KBGA 1YHQA 3UDCA 5HK0A 2CGHA 5CKEA 2CS7A 2XDBA 2X4JA 5DM7R 3PTAA 5DY9A 3LWIA 1VQ6A 2BIVA 2NLUA 2XDPA 3FIFA 1FXXA 2QXFA 3FEOA 4OVAA 4OB1B 4M78F 1NPPA 3DB3A 1VQ8A 4F7UE 1P92A 3LW5E 2IVWA 2K57A 4PJOF 3OB9A 1VQ9A 2JVVA 2HNIA 2DPPB 5L8RE 5FROA 4C0ZA 3OYMA 1LNXA 1I4K1 5GANg 1O75A 3RUXA 1D3BA 1UB4A 2P0KA 1I81A 2ZPBB 3PT9A 4LDXA 1V29B 1VQ6T 2RHIA 2KAFA 4F7UB 4DOVA 4A4GA 5LJ5h 4MDXA 1VQ8T 2EKOA 5LJ5e 1SSFA 2JZ2A 4M75D 4XTWA 1VQ9T 2R5MA 5J26A 1BYMA 3M9QA 3OYGA 4V2SA 3QPHA 4IUTA 4BE2A 2GFUA 4Q5WA 3C94A 3OYJA 3E9FA 4M77F 5I2MA 3X28B 2KQWA 4JS4A 3OSVA 2PVDB 1M1KU 3C95A 3CD6A 2L8DA 1WGSA 4KBMB 2FVUA 2RK2A 3JCMV 3VU3C 1KC8U 1NZ9A 1XNIA 2K5IA 2LVMA 5CQYA 4M7AF 4HT8A 4C92E 4YTLA 3SDZA 2GFAA 1VQ4A 3OYIA 2R57A 3CCUA 2FB7A 4FSXA 5HY6A 5FU7B 3S3MA 3G71A 2RI3A 1WNLA 3P8BB 3SD4A 2QI2A 4E7HA 2DZ9A 3CD6T 3RKWA 2KK4A 1UGQB 3PFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XKO C;  3N5B B;  2XG8 D; 
#chains in the Genus database with same CATH topology
 4AFZ C;  1VQ5 Q;  1QW1 A;  3CCE A;  3CBP A;  2ZZD A;  3H8Z A;  3LWH A;  2QGG A;  2FYK A;  4EMG A;  3EHQ A;  3QJ6 A;  2KXC A;  2PUK B;  2LT4 A;  4J9B A;  4HVV A;  2A3L A;  4OGE A;  2BTT A;  4ZTJ A;  4ATO A;  2OAU A;  1YI2 Q;  4F7U G;  1NYF A;  3CMA Q;  2QQS A;  2P0P A;  1MGQ A;  1G3W A;  2QTV A;  2EWN A;  1YJW T;  3QUI A;  3DKM A;  1QKX A;  5GAN f;  5GAN 3;  4XU3 A;  3G7Z A;  1VQM Q;  1ZSZ B;  3SWN A;  1AT1 B;  1KD1 U;  2K7A A;  3PIO A;  4M7A A;  1M1K C;  2J7I A;  3UWN A;  2QAS A;  7AT1 B;  1C6V X;  2RB6 A;  1UHC A;  2RHX A;  5LJ5 j;  2WSF E;  3EGX B;  1YJN T;  3CCV A;  2CKK A;  2HZY A;  4KUD K;  3C0C A;  4M78 E;  5LL6 S;  1Y57 A;  2XI9 A;  3EGD B;  4O6J A;  4ZNX A;  4PJO E;  3JCM P;  1WX6 A;  1VQO T;  4M7D A;  2KDS A;  4OGC A;  4LUD A;  2HBW A;  1NLP C;  4PJN A;  1VQL A;  1WFW A;  2CZ7 B;  1KQS P;  1KIK A;  1M3C A;  3OYF A;  3EG1 A;  1Q86 C;  1MHN A;  1TOV A;  4M77 E;  2FG0 A;  2IIM A;  1MMG A;  4JLG A;  1T3L A;  2RHY A;  1KQS S;  3OMC A;  3UA7 A;  3GP8 A;  4BI8 B;  5FRM A;  2QYZ A;  5L23 A;  1VOM A;  5A0D A;  3H0I A;  3I56 Q;  1Q81 R;  1NLO C;  4Y91 A;  1QCN A;  2BKD N;  2DXT A;  1VQK A;  2DXC A;  1YWO A;  3OS2 A;  1FMW A;  3OBY A;  1GFC A;  4E7Z A;  2OTJ A;  2CP3 A;  1UGP B;  4KH1 B;  5IHN A;  2DTH A;  2R58 A;  1NE8 A;  1C0M A;  3CC4 T;  4LD6 A;  3H0F A;  4B9X A;  2ECZ A;  2F2X A;  3HFN A;  4M7D B;  2DNU A;  4GLM A;  5GAN e;  3HL8 A;  1ZUY A;  1HXD A;  2ZAE A;  3JAM E;  1PRL C;  3PMI A;  2DXU A;  2RHU A;  3C12 A;  2V26 A;  3EG2 A;  4XQ3 A;  1NEG A;  3QSU A;  1LPL A;  2E3H A;  1M3B A;  5KYU A;  3OQ5 A;  1M8V A;  4XTZ A;  4XTU A;  3CCL A;  2LMJ A;  1AWJ A;  1MV0 B;  2ESW A;  3EFO A;  3V8K A;  4IUU A;  2NUT A;  2X4Y A;  3MJX A;  2XIC A;  2HD0 A;  2C0T A;  1BCM A;  3HRT A;  5DLO A;  2VVK A;  1OZ2 A;  2XHC A;  4J9C A;  1QWF A;  3FLG A;  2XK0 A;  3QBY A;  4QQD A;  1GCP A;  4KT0 E;  1SEM A;  1X6B A;  2KRM A;  3PIP A;  3AHU A;  2ZPH B;  4M7D G;  2QG9 B;  1W1F A;  1WIE A;  3OYN A;  1UTI A;  1K73 R;  4LNP A;  2LJ3 A;  4CRI A;  1I5L A;  1U5S A;  1N6A A;  2JJ9 A;  2DMO A;  2OTL A;  2IG0 A;  3EHR A;  3ER0 A;  2LTO A;  3CPW P;  4IIO A;  1K8A C;  1RLQ C;  2CT3 A;  1YIJ A;  1UGS B;  1YFN A;  1CKB A;  1UEB A;  5KYU B;  2V8I A;  4BDZ A;  1ZQ1 A;  1YN8 A;  1GBR A;  4ZGE B;  3JB9 F;  3JCM g;  3CC2 T;  1D0X A;  3M4Y A;  3CPW S;  1Y96 A;  3TU4 K;  3UAT A;  2NUT B;  5FU7 C;  1VQN T;  2XID A;  3CPF A;  5A2Q E;  2RH2 A;  5A0G A;  1GBQ A;  2DFU A;  3M53 A;  2RHZ A;  1TXQ A;  2EQJ A;  4A4E A;  2L2P A;  3EH1 A;  2DE0 X;  4X9C A;  4E7K A;  5GAN 2;  1QVF P;  1H64 1;  1M4Z A;  1HSQ A;  2KR3 A;  4ORZ A;  3L2Q A;  3CCM T;  3CCS Q;  4B6M A;  3QYG B;  1SKU B;  3M54 A;  4MDW A;  4E47 A;  4M7A D;  3CCR Q;  2B8A A;  2MIO A;  1JU5 C;  4XK8 E;  4QQG A;  1QVF S;  3WVE B;  1U8R A;  2K9G A;  4NL2 A;  5LJ3 j;  3SB2 A;  3NFC A;  3PMT A;  5GMK j;  2LX7 A;  3CCQ A;  4CC7 A;  2F1L A;  2YLC A;  1UFF A;  2COZ A;  3G4S A;  5GAN 7;  1Q82 U;  1BI2 A;  5IAY A;  2HBP A;  4M75 E;  1EX4 A;  2EYQ A;  4BY6 C;  5GAN 8;  5GAN 4;  4M7D D;  2DF6 A;  2ATC B;  5GAM f;  2L5Q A;  4Z88 A;  1RAH B;  1Y96 B;  2XU8 A;  1RAA B;  1RAD B;  1M2V A;  3UA6 A;  4NS5 A;  2Z0W A;  2VKN A;  2DD4 A;  4IUV A;  1K0S A;  2DVE A;  3G6E Q;  3H41 A;  4QW2 A;  1HK9 A;  2KE9 A;  1BI0 A;  3BE3 A;  4M78 C;  2DEU A;  2E64 A;  2JNG A;  3KUF A;  4PJO C;  1YIT T;  4JRK A;  1MMN A;  1N8R R;  2QA4 T;  1Q7Y C;  1N27 A;  1D1A A;  4C8Q E;  4RCB A;  4GBQ A;  3PVL A;  2PVO B;  5KYX B;  3GBQ A;  2Y4Y A;  5FU6 C;  5KYW A;  2DIQ A;  4JJD A;  1TTH B;  4M77 C;  1IO6 A;  1KQ1 A;  3MPU B;  4R0K A;  4EMH A;  1WQ7 A;  3INZ A;  3A8M B;  3MEA A;  5M9O A;  9ATC B;  1RAG B;  1TH7 A;  1M2V B;  2A08 A;  3I55 A;  2MWO A;  5LJ5 d;  4N4G A;  1QVF A;  3L2W A;  4C8Q F;  2HAX A;  2EPD A;  3NHN A;  3LYI A;  2DBK A;  4KGX B;  1BI3 A;  4FYV B;  1M90 C;  2DEQ A;  2DJZ A;  1WHM A;  4PK4 A;  2DXB A;  1M3A A;  2L3R A;  2CRE A;  5I2S A;  3Q1J A;  4JJN K;  1VQP A;  1M5Q 1;  1ABQ A;  5LJ3 f;  5GAM e;  4C5I A;  1QCF A;  5J3B A;  2GGR A;  3CCE Q;  3JB9 J;  1VQ5 T;  2BZY A;  4OMM A;  1YHQ A;  5HK0 A;  2NYS A;  1UEC A;  5CKE A;  4X1V A;  2XDB A;  1YJ9 Q;  3REA B;  2ROT A;  5DM7 R;  3LWI A;  2NLU A;  1F1B B;  3FEO A;  2O2O A;  2C0O A;  1D0Y A;  2O31 A;  2K57 A;  3RUX A;  2ZPB B;  1VQ6 T;  2LNH B;  5LJ5 h;  4MDX A;  1VQ8 T;  1SSF A;  1B07 A;  2OJ2 A;  1BYM A;  1C1A A;  2GFU A;  3E9F A;  3X28 B;  2PVD B;  1M1K U;  3CD6 A;  3VU3 C;  4HT8 A;  4C92 E;  4YTL A;  2MYS A;  2FO0 A;  2YUO A;  3ZL7 C;  2FB7 A;  3CCV Q;  5FU7 B;  1G8X A;  2EKH A;  2RQT A;  4OMP A;  1UGQ B;  1WA7 A;  2RI2 A;  2LQW A;  5CKH A;  2WAC A;  2LJ1 A;  5HCK A;  2RO0 A;  2RNA A;  4LXC A;  3M0R A;  5C6S A;  3FJ5 A;  4E7I A;  2J05 A;  2JTM A;  1WYX A;  3CQT A;  1RI9 A;  4LN2 A;  4M78 A;  1YJW A;  1VQL Q;  1IRE B;  5A0L A;  4PJO A;  1ACM B;  2L89 A;  4C92 F;  1Q86 U;  2CZ0 B;  3CC7 T;  5I22 A;  1FX7 A;  4DEY A;  4XTX A;  3M59 A;  4KGZ B;  4M77 A;  4PFZ A;  3OYE A;  4JRP A;  1WJR A;  2YUP A;  3EG3 A;  1N9R A;  1SRM A;  3PE0 A;  4BY6 B;  3OYD A;  1YJN A;  1W2B P;  4E6R A;  3OMG A;  3R6N A;  2CP0 A;  5FRN A;  3QZ5 B;  2P0Q A;  3MO8 A;  1MV3 A;  2FHD A;  2OTJ Q;  1HJD A;  3A1P A;  3MEW A;  4QQ6 A;  5CCA A;  4FT4 A;  1JBM A;  4JPB W;  1W2B S;  4OF1 A;  4J8O A;  4J9H A;  2GTJ A;  1VQO A;  4OB0 B;  2LCL A;  4BE1 A;  1X43 A;  4M75 C;  2L3Q A;  1VQ4 Q;  3HTR A;  1QCO A;  4M78 B;  3U23 A;  8AT1 B;  3GIB A;  3OYL A;  2CZ6 B;  4PJO B;  3GNF B;  1VA7 A;  1BCO A;  4Z02 A;  2ZPE B;  1B34 B;  3L2Z A;  4PLL A;  3OY9 A;  1DJ7 B;  4IUP A;  4X9D A;  1VQ7 T;  5FU6 B;  4HCB A;  4IUQ A;  3LX7 A;  4N4I A;  4M77 B;  1T3S A;  1I1J A;  4ZTF A;  2CSQ A;  2M0O A;  3CXC P;  2O01 E;  2CDT A;  5LJ3 d;  5GMK m;  3R6O A;  1JXM A;  3HFO A;  4C8Q C;  3MP6 A;  1WHG A;  3A8L B;  2HKQ B;  2DLP A;  2O88 A;  3CC4 A;  3GF5 A;  2EJ9 A;  3NTK A;  2DVJ A;  2DM1 A;  3CBO A;  2XD0 A;  3CXC S;  4A4H A;  2ZCF B;  2BE9 B;  2FPE A;  2RN8 A;  5KE2 A;  3JCM Q;  2E12 A;  3FB9 A;  4M78 G;  3LH5 A;  4QVZ A;  3VUZ A;  4PJO G;  2CUB A;  4FYY B;  3BW1 A;  2OTL Q;  1I0C A;  3JB9 H;  1PKS A;  3L2V A;  1YIJ Q;  2DET A;  2NUZ A;  2AHJ B;  4NL3 A;  4KUL A;  3MKD A;  2BZ8 A;  1ZLM A;  5EC7 A;  1WHL A;  2LT1 A;  2DYB A;  3TQ7 P;  2NWM A;  2VXF A;  1D1B A;  4EPC A;  1W2B A;  4IKF A;  1RUW A;  3A8H B;  3I5R A;  4JJC A;  4PNO A;  2GBQ A;  1M1G A;  2DL7 A;  4II1 A;  4ELZ C;  4PKC C;  4A4K A;  2DZC A;  3VS7 A;  3A5Z B;  2BE7 D;  2QAZ A;  1IGU A;  1WJQ A;  3NPF A;  4EMK C;  1MMA A;  5LJ3 h;  1BU1 A;  1Y0M A;  2VWF A;  1UE9 A;  2K79 A;  1WLP B;  5GMK h;  2COW A;  2LCC A;  1KSW A;  2X35 A;  3CCR T;  3FDR A;  2X51 A;  3T9N A;  3G1J A;  2RJC A;  4FCY A;  3RKX A;  1OEB A;  3THK A;  4L6V 5;  2HL5 C;  2G6F X;  4BI3 A;  3CCQ Q;  4J7I A;  2JW4 A;  5FWB A;  4Y28 E;  3G4S Q;  3CC2 A;  2AZV A;  4HCZ A;  3RIR A;  1J3T A;  3QDF A;  1EZZ B;  1VQN A;  3NGP A;  3L2R A;  1ZA2 B;  3SFM A;  1M27 C;  2GTO A;  4M78 D;  5D6Y A;  3RBB B;  2HCK A;  4PJO D;  3CXC A;  3L42 A;  1U1T A;  1VIE A;  4RTV A;  5I21 A;  4M75 A;  2V1R A;  4C92 C;  3G6E T;  1FYN A;  4J9D A;  3OYK A;  4HCC A;  4M77 D;  3VKI A;  1R0B G;  1WXU A;  2M0Y A;  3NMZ C;  2PUO B;  4C5E A;  3SWN B;  4LDY A;  5CR2 A;  2EJG A;  4M7A B;  4J6X A;  3PNW C;  3GLX A;  1KQ2 A;  3RER A;  2HDA A;  1Q7Y U;  2MK5 A;  3V7S A;  2XDD A;  4FW2 A;  4M4Z A;  4LDW A;  1K9M R;  3M0S A;  1TG0 A;  1TUD A;  2MPX C;  1QVG A;  1BKB A;  1IRX A;  3S3O A;  3VRY A;  1QP3 A;  4C8Q A;  1A0N B;  3X20 B;  2RA2 A;  2EVR A;  3MEU A;  4LDV A;  4WF2 A;  4O5V A;  4OMN A;  4HVW A;  3VS2 A;  2X4X A;  4RKU E;  3RES A;  5GAN 5;  2EYW A;  1Q82 R;  2RJF A;  3I55 Q;  5HK3 A;  1BBZ A;  2EFI A;  4M75 B;  2HKN A;  2LRQ A;  1D1C A;  2MOX A;  2VXE A;  4JZ3 A;  1JJ2 A;  3OS0 A;  1M1F A;  1OV3 A;  1YIT A;  1ZUK A;  3QWY A;  5C0M A;  4M7A G;  2QA4 A;  1M90 U;  4F7U F;  3MP1 A;  2K3B A;  4PJM A;  1SF9 A;  2EQK A;  2LZ6 B;  4FYW B;  5GAO p;  1E7O A;  2JMC A;  2QQ9 A;  3VV0 A;  3HPW A;  1VQP Q;  4BDY A;  4IUR A;  2GF7 A;  3E2U A;  3JCM d;  2DA9 A;  3V7R A;  5LJ5 f;  4JRI A;  4HCK A;  5CAI A;  2EW3 A;  3VYH B;  5GAO l;  4CI0 C;  3CCE T;  1YHQ Q;  2BUD A;  3D7S B;  4EMK A;  2YRD A;  1ZSG A;  2D6F A;  4DEX A;  2F2W A;  1Z9Q A;  1YJ9 T;  2A0F B;  3HRU A;  2DL5 A;  2WSE E;  3A8G B;  4HA8 A;  2O9S A;  3SHW A;  4OB2 B;  1TUG B;  2MCN A;  1E6H A;  5KE3 A;  3OS5 A;  1OX9 A;  2PVG B;  4F04 B;  1FWZ A;  3EFO B;  4B9W A;  2DX1 A;  3FJP A;  3CME T;  2E3I A;  4FSS A;  4F16 A;  3CD6 Q;  1M8M A;  4C5G A;  4XU0 A;  5GAN 6;  3S3N A;  1AHJ B;  2LC4 A;  2H3J A;  4PJJ A;  1AWO A;  3LGF A;  2EQM A;  2J6O A;  3CCJ T;  1PKT A;  1H8K A;  1S1N A;  3E19 A;  1S72 T;  1W70 A;  4MZM A;  1H3Z A;  4C92 A;  2MI6 A;  4FU6 A;  2GQV A;  1G5V A;  1WQW A;  1KG1 A;  2Y4X A;  3UDC A;  2HQH A;  2CGH A;  3I9Q A;  4KH0 B;  1YJW Q;  1RLP C;  5DY9 A;  1VQ6 A;  4CC2 A;  2QXF A;  4OVA A;  5KYY A;  1PRM C;  1NPP A;  3DB3 A;  1VQ8 A;  2IVW A;  3OB9 A;  2JVV A;  2HNI A;  2DPP B;  2EGA A;  1I4K 1;  2B86 A;  5GAN g;  1O75 A;  2X9H A;  2HSP A;  1UB4 A;  1UGV A;  4ESR A;  3PT9 A;  3EG0 A;  4E2F B;  4DOV A;  5LJ5 e;  2JZ2 A;  4M75 D;  5GJV B;  1VQ9 T;  2R5M A;  3VS5 A;  4BE2 A;  1YJN Q;  3OSV A;  2DRK A;  2SRC A;  1SPK A;  1X2K A;  2FVU A;  1KC8 U;  3JCM V;  1NZ9 A;  6AT1 B;  4M7A F;  2CP5 A;  5IXB A;  3SDZ A;  2P4R A;  1RAE B;  1VQO Q;  1GL5 A;  3S3M A;  3P8B B;  2DZ9 A;  3RKW A;  2JT4 A;  1D3B A;  3M0U A;  3I5S A;  4ELY C;  1QP2 A;  4C0G A;  1X01 A;  1VQ4 T;  4XAX B;  3CCU T;  3JCM b;  3EAE A;  3EFS A;  2JTE A;  3G71 T;  2XKO C;  3URG A;  2P84 A;  1QWE A;  3CC7 A;  3OYH A;  4JLI A;  2YUN A;  1YP5 A;  4M7D F;  4C8Q D;  1PNJ A;  2K6D A;  1K4U S;  2M9U A;  1U3O A;  2PU9 B;  4AFU C;  3QDR B;  1LJO A;  5IHI A;  2JOY A;  1NJI R;  4Z89 A;  2RMO A;  2MAM A;  2A28 A;  4JJB A;  5KCO A;  2QEX T;  1D0Z A;  1BIA A;  3HP9 A;  2R5A A;  2RJD A;  3LH0 A;  1OYX A;  1VIF A;  2EAY A;  3CC4 Q;  4A53 A;  4LD9 K;  2K4Y A;  1AWW A;  1RAB B;  1WHK A;  1IXD A;  4OMO A;  3E1S A;  1QVP A;  5IN1 A;  4C0D C;  1WHJ A;  2KT8 A;  1JO8 A;  1AEY A;  1WJS A;  1TU0 B;  3A98 A;  2VC8 A;  2OTL T;  4RG8 A;  1YNZ A;  3VJP A;  3RMQ A;  5KYW B;  1VQ7 A;  3V8L A;  3C4S A;  5AT1 B;  2FRW A;  2YDL A;  4LUE A;  3M56 A;  3QHS A;  5FW9 A;  1D09 B;  4RTT A;  4XTY A;  3HHT B;  2KBT A;  4AT1 B;  1Z9Z A;  3M55 A;  1PCX A;  1XOV A;  3OYA A;  1TWB A;  1ABO A;  1K1Z A;  3FRN A;  1YI2 T;  1WPY A;  1VUB A;  3CMA T;  3VYG A;  2DIL A;  2M1H A;  2RK1 A;  2KI7 A;  1NYG A;  1M30 A;  2FZG B;  3P8H A;  8ATC B;  2KXD A;  3M5A A;  3J80 E;  4J5Y A;  1VQM T;  5GMK l;  3M0P A;  4XTV A;  3QKJ A;  2A7Y A;  2YRC A;  2I0N A;  1ZSZ C;  5CKB A;  1GRI A;  2ZPI B;  2C06 A;  2EYY A;  2KRN A;  2YLB A;  4EDU A;  1RI0 A;  3CC2 Q;  4C92 D;  3G4S T;  1KHI A;  4QT7 A;  3BDU A;  3EFR A;  2VYT A;  3HRS A;  4BI4 A;  2MWP A;  4Y92 A;  4OB3 B;  2RQU A;  1YWP A;  1YCS B;  1Q81 C;  4P5N A;  2HQE A;  3ZBD A;  2RI5 A;  2MMP A;  1UGR B;  4HVU A;  1B7T A;  4BE0 A;  1X6G A;  2CP7 A;  1K9M C;  4AMC A;  3OYC A;  2EJF A;  4J6Y A;  3M0Q A;  2NUP A;  3CCR A;  1YCY A;  2K2M A;  1T0H A;  2L3P A;  3EH2 A;  4AG1 C;  4DBR A;  5CKD A;  1WI7 A;  1PSF A;  5LJ3 e;  4ME7 A;  2RD1 A;  3I56 T;  4OMQ A;  1TSF A;  1KK7 A;  3S6W A;  1VQK Q;  5GMK e;  1V1C A;  2XG8 D;  2EGE A;  3GNG A;  1Q82 C;  1UJ0 A;  2EQI A;  1KD1 R;  3RR6 A;  2JS2 A;  1I8F A;  5CQX A;  5DLQ E;  1KJW A;  4PL6 A;  5GAM g;  4JDS A;  2JN0 A;  5GAN j;  5CK9 A;  4F7U A;  3G6E A;  5HKC A;  2QK0 A;  4ANJ A;  4C0F A;  3BDL A;  4QVD A;  3ME9 A;  2CP2 A;  3WVD B;  4BUG A;  3QG1 A;  3DLL A;  2E6N A;  2YXY A;  2NUP B;  4KGV B;  3JCM X;  3CCL Q;  2QA4 Q;  4EIK A;  1R8O B;  1AZE A;  4PFO A;  1K73 C;  2QQR A;  1I07 A;  1XTD A;  3OYB A;  2KEA A;  4FT2 A;  1OX8 A;  2HQX A;  2PTK A;  2E10 A;  1LCK A;  1V76 A;  2X3X D;  3MET A;  2E1H A;  1IB8 A;  1BB9 A;  1QMC A;  4J9F A;  3BFM A;  5CO7 A;  4X34 A;  3L1A A;  1Y71 A;  2RQW A;  2X4W A;  1YHQ T;  4E7J A;  2K3X A;  4HXJ A;  3UF4 A;  1PHT A;  4TVR A;  4J7F A;  1FMK A;  2CH4 W;  4C0D B;  4RMO A;  3EG9 A;  2ED1 A;  2ZPG B;  1UDL A;  2EQU A;  1H3H A;  2EBP A;  3DB4 A;  2QQA A;  1IHW A;  1R77 A;  1QVG P;  1ZSZ A;  2J6K A;  2CP6 A;  1K8A U;  3JCM f;  3RKY A;  1UHF A;  3RNJ A;  2K5F A;  4M77 G;  4JUV A;  4JZ4 A;  1PM3 A;  2MF2 A;  2E4H A;  1AZG B;  1ARK A;  3N5B B;  1WZO A;  1QVG S;  1BI1 A;  3EGX A;  3LLR A;  3JCM J;  1MUZ A;  2M51 A;  1X6O A;  1M2O A;  3QZ9 B;  4PJL A;  5D7U A;  4XU2 A;  3OSS C;  3EGD A;  1NM7 A;  1PD1 A;  5LJ3 g;  2DER A;  5AYF A;  1M90 R;  1GFD A;  3MCA B;  2YUQ A;  3NTI A;  3CCS T;  3OW2 A;  3UPU A;  1JJ2 P;  1JRI A;  4MMK A;  1YJ9 A;  2YT6 A;  4DBF A;  2RJE A;  3QJY A;  2QDL A;  3OYY A;  3VS0 A;  2DL3 A;  2V8K A;  1SRL A;  2D9T A;  1JJ2 S;  1WXB A;  1BK2 A;  3LGL A;  1VQ6 Q;  3EG9 B;  3X25 B;  1VQ8 Q;  2KRO A;  2CT4 A;  1OI1 A;  1VYT A;  2JM8 A;  3ZFJ A;  2W10 A;  4QVC A;  3JB9 I;  4BD3 A;  2RPN A;  2V8J A;  3QO3 A;  3CME A;  1AOJ A;  2VGN A;  3VS3 A;  2GCX A;  2O9V A;  4LE9 A;  2DRM A;  4L5G A;  1QLY A;  4N4H A;  1N8R C;  1W6X A;  2C0I A;  2LX9 A;  4MML A;  2W0Z A;  3CCJ A;  2HMA A;  5D6W A;  3CCM A;  1RAF B;  2E65 A;  3MHX A;  3WXM B;  1S72 A;  4E7L A;  4GY5 A;  3VRZ A;  2OI3 A;  3H6Z A;  1RL2 A;  1ZBJ A;  2YWW A;  3EGU A;  2ROL A;  4R56 A;  3JB9 G;  1IZ6 A;  5J39 A;  2FPD A;  5KCH A;  1NJI C;  3JCM e;  3H9N A;  2LQK A;  2QGF B;  4ZGD B;  3KBG A;  4RTU A;  3CC7 Q;  2CS7 A;  2X4J A;  3VS1 A;  1OUL A;  2XDP A;  3FIF A;  4OB1 B;  2XMF A;  4M78 F;  2X3W D;  4F7U E;  1P92 A;  3LW5 E;  4PJO F;  1K9A A;  1CSK A;  1VQ9 A;  5FRO A;  2FRY A;  2SEM A;  1WHH A;  2HSE B;  2RHI A;  2A36 A;  4A4G A;  1OPK A;  2EKO A;  2PZ1 A;  4XTW A;  4F14 A;  5J26 A;  3OYG A;  3QPH A;  1MMD A;  3C94 A;  4M77 F;  2LJ0 A;  5ECA A;  2L8D A;  4KBM B;  3REB B;  1XNI A;  2LVM A;  2GFA A;  1VQ4 A;  1MNE A;  2R57 A;  3OYI A;  3CCU A;  5HY6 A;  1RAI B;  3G71 A;  1WNL A;  4E7H A;  1KC8 R;  4RTW A;  3PFS A;  4OP0 A;  2VGM A;  3M57 A;  1FMV A;  1OQK A;  5GAM j;  5FLX E;  4J9G A;  1VQ7 Q;  1XQH A;  3ASK A;  4RCC A;  4C8Q B;  2KT1 A;  1G83 A;  2QEX A;  1X27 A;  1PSE A;  3JB9 D;  1G3S A;  2V1Q A;  4M75 G;  2KY9 A;  5CIU A;  4KRT A;  1SSH A;  5GJW B;  2QDY B;  2JM9 A;  3V7C A;  1TUC A;  4AFQ C;  1E6G A;  2DTI A;  2M16 A;  3VS6 A;  4A54 A;  4JRQ A;  2E41 A;  2CYZ B;  3OA6 A;  3HSB A;  1BIB A;  2D1X A;  1KQS A;  1PWT A;  3JV3 A;  1N9S A;  3JCM W;  2DKG A;  5GAN d;  2KYB A;  4OMF B;  4VUB A;  3KXT A;  1EIF A;  1X69 A;  2CZ1 B;  1VQ5 A;  2G3R A;  2GQI A;  3J7A F;  4DQ2 A;  4ZN1 A;  4C8Q G;  4QKU A;  2DIG A;  3CCV T;  4BB7 A;  3PGG A;  3JCM h;  3ZEH A;  4EMK B;  1YI2 A;  2JMA A;  3CMA A;  1EFN A;  1Q81 U;  2E70 A;  1SG5 A;  3TSW A;  4PLI A;  1VQL T;  4M7A E;  4A63 B;  3GPL A;  2CUD A;  4FM4 B;  2YRV A;  2CSI A;  1K9M U;  2DD5 A;  5EG2 A;  1VQM A;  1AD5 A;  1T0J A;  1KD1 C;  3OS1 A;  4GLK A;  2IPO B;  1CKA A;  2JS0 A;  2F5T X;  2FEI A;  2QTX A;  1IGQ A;  1OU8 A;  2DL8 A;  1ZHI A;  2DJQ A;  2DAQ A;  3E9G A;  2M02 A;  4J6W A;  1OZ3 A;  1OOT A;  4UC4 A;  2ZPF B;  3O8V A;  5KYX A;  2A37 A;  2E5K A;  1VQK T;  2PQW A;  1YBY A;  4M7D E;  1GCQ C;  2H3E B;  2PNI A;  4DA4 A;  4L59 A;  2L0A A;  3L2U A;  2OTJ T;  4FL6 A;  3MEV A;  3PVQ A;  1LOJ A;  5GAN h;  1M1K R;  2YHT A;  3QII A;  2LQ8 A;  3CBM A;  4IIM A;  4C92 B;  2DTO A;  1G3Y A;  2HL3 A;  1U1S A;  2ABL A;  1B3Q A;  1X2Q A;  2LCS A;  3TCJ A;  3J81 E;  2K5L A;  3O5Z A;  4J9E A;  5I11 A;  2OX7 A;  2F2V A;  2F5K A;  1K76 A;  5KYY B;  2F69 A;  2VB6 A;  4NOY A;  2LP5 A;  3I56 A;  4M75 F;  1UG1 A;  4ZGJ B;  2O4X A;  2COY A;  3A8O B;  5GAO m;  3CCL T;  2K2V A;  3JRZ A;  2ENM A;  4N0A C;  5D6X A;  2VUB A;  5CVI A;  3CPW A;  1Q86 R;  2Y90 A;  1MND A;  1M9S A;  1VYU A;  2VV5 A;  1K73 U;  3M0T A;  2RM4 A;  5GAO n;  2E6Z A;  3IQL A;  4A4F A;  4LDU A;  4XU1 A;  2JXB A;  3TSZ A;  5KYN A;  1JB0 E;  1OPL A;  2AKK A;  4C92 G;  3NTH A;  4J9I A;  1ZBX A;  1X75 C;  4D8K A;  3VUB A;  1R0C B;  2I2L A;  2KGT A;  1Y7X A;  1D3B B;  3AT1 B;  3I35 A;  2P4T A;  1U06 A;  4KUI A;  1GXI E;  2J06 A;  1XJW B;  2ZGW A;  2EYZ A;  2EIF A;  3QYH B;  1YIJ T;  2KSS A;  4MZT A;  2AT1 B;  2J6F A;  1AWX A;  1G2B A;  2AK5 A;  2O4X B;  1NPR A;  2DK3 A;  1ZA1 B;  1QQJ A;  1ZX6 A;  2FZC B;  2D0N A;  4V2S A;  2LNV A;  3P8D A;  5FWC A;  4E7S A;  2YSQ A;  3X26 B;  1JQQ A;  5LJ5 g;  4FYX B;  3FC3 A;  4DOW A;  1W4S A;  4D6W A;  2EYX A;  2AIR B;  2KVQ G;  4RG2 A;  1UJY A;  3TEE A;  2K3Y A;  3QWX X;  2EGC A;  1ZUU A;  3F70 A;  4WCI A;  4WTO B;  4AG2 C;  5IXF A;  1SHG A;  1G3T A;  2HEQ A;  5IH2 A;  2DO3 A;  2KYM A;  3GOX A;  4FIB A;  3CCQ T;  5KH6 A;  3V8J A;  4RTY A;  4Z8A A;  1HD3 A;  5GAO q;  3JCM c;  1QKW A;  4CC3 A;  5IHK A;  1GCQ A;  2DYI A;  1VQN Q;  3CME Q;  5GAO r;  4ZN3 A;  4RTX A;  4C5H A;  2D8H A;  4CC4 B;  2OAW A;  1K8A R;  3HKS A;  2ED0 A;  1N8R U;  3CCJ Q;  3MP8 A;  3CCM Q;  4MZP A;  3CCS A;  1S72 Q;  2E5Q A;  5GAM d;  2L3S A;  1NBE B;  1OU9 A;  2D0Q B;  5IT9 E;  4J83 A;  1K0X A;  1H92 A;  3M4G A;  1O9S A;  5CKF A;  5GMK i;  2WSC E;  2RQV A;  1NEB A;  2DBM A;  2AZS A;  2RQR A;  3CEY A;  4PFP A;  1NJI U;  1NG2 A;  1B34 A;  3SWN C;  2VAS A;  4N0A A;  1RAC B;  2D8J A;  3SEM A;  4M7A C;  1WDX A;  3OBW A;  3BY7 A;  4R55 A;  2AKL A;  1VQ9 Q;  2GNC A;  3OW2 P;  2LDM A;  1PD0 A;  4JS5 A;  1KC8 C;  1KHC A;  1WXT A;  3I55 T;  2FL7 A;  3OW2 S;  4OML A;  3UT1 A;  1AVZ C;  1N5Z A;  4D8D A;  4M7D C;  4F17 A;  2LQN A;  3X24 B;  4DBQ A;  3KFV A;  1Q95 G;  1YIT Q;  4RUG A;  3TRE A;  4HT9 A;  2KMT A;  3JSC A;  3CCU Q;  4BAC A;  2BZX A;  3G71 Q;  5GAM h;  1KFZ A;  3QXE B;  2JUF A;  3TVT A;  3ULR B;  2DL4 A;  1Y07 A;  3RMS A;  1IHV A;  2JTF A;  4DBH A;  3DLM A;  1SHF A;  4FW1 A;  1VQP T;  4HKE A;  3M58 A;  2QQB A;  2CH4 A;  4K11 A;  1JEG A;  1LVK A;  2FPF A;  1VYV A;  3PTA A;  2KRS A;  2BIV A;  1FXX A;  1Q7Y R;  1JXO A;  1PG5 B;  2QEX Q;  1PC0 A;  5L8R E;  4C0Z A;  3OYM A;  1LNX A;  2P0K A;  4LDX A;  1I81 A;  2KNB B;  1V29 B;  2KAF A;  1I5O B;  4F7U B;  1UUE A;  3VS4 A;  3M9Q A;  4IUT A;  4Q5W A;  3OYJ A;  5I2M A;  2KQW A;  4JS4 A;  3RDV A;  2FZK B;  3C95 A;  1WGS A;  2RK2 A;  4AFS C;  2K5I A;  5CQY A;  2RF0 A;  1HYO A;  4FSX A;  4RTZ A;  1TS9 A;  2RI3 A;  3SD4 A;  2QI2 A;  3CD6 T;  3H0H A;  2KK4 A;  2H8H A; 
#chains in the Genus database with same CATH homology
 4ELY C;  2RI2 A;  4OP0 A;  1QP2 A;  1QW1 A;  4C0G A;  3CCE A;  5CKH A;  1X01 A;  3CBP A;  2WAC A;  2ZZD A;  3H8Z A;  4XAX B;  3LWH A;  1VQ4 T;  2RO0 A;  2FYK A;  3CCU T;  4EMG A;  2VGM A;  3JCM b;  3EAE A;  5C6S A;  3M57 A;  3EFS A;  3G71 T;  4E7I A;  5GAM j;  2JTM A;  2XKO C;  5FLX E;  4M78 A;  3URG A;  3QJ6 A;  2PUK B;  2LT4 A;  3CC7 A;  1YJW A;  3OYH A;  1IRE B;  4JLI A;  2A3L A;  4OGE A;  5A0L A;  4PJO A;  4ZTJ A;  4M7D F;  1XQH A;  4C8Q D;  4ATO A;  3ASK A;  2OAU A;  2M9U A;  4F7U G;  4RCC A;  4C8Q B;  2L89 A;  2PU9 B;  2QQS A;  4C92 F;  2QEX A;  1Q86 U;  1PSE A;  2CZ0 B;  3QDR B;  1LJO A;  1G3S A;  1MGQ A;  2P0P A;  3JB9 D;  1G3W A;  4M75 G;  2EWN A;  2KY9 A;  3CC7 T;  1FX7 A;  1YJW T;  5CIU A;  3QUI A;  2JOY A;  3DKM A;  4XTX A;  5GAN f;  5GAN 3;  2MAM A;  2QDY B;  3M59 A;  4XU3 A;  3G7Z A;  3V7C A;  5KCO A;  4M77 A;  4JRP A;  3OYE A;  2QEX T;  1WJR A;  3SWN A;  2DTI A;  1BIA A;  1KD1 U;  2M16 A;  4A54 A;  4JRQ A;  3PIO A;  1N9R A;  3HP9 A;  4BY6 B;  3OYD A;  2E41 A;  2R5A A;  2RJD A;  1OYX A;  3LH0 A;  1YJN A;  1M1K C;  4M7A A;  1VIF A;  2EAY A;  2CYZ B;  3OMG A;  3UWN A;  3OA6 A;  4A53 A;  2RB6 A;  4LD9 K;  3HSB A;  5FRN A;  2K4Y A;  1BIB A;  2P0Q A;  2RHX A;  3MO8 A;  2FHD A;  3QZ5 B;  5LJ5 j;  2WSF E;  1KQS A;  3E1S A;  3MEW A;  1QVP A;  4QQ6 A;  5IN1 A;  4C0D C;  5CCA A;  4FT4 A;  1JBM A;  1W2B S;  1YJN T;  4OF1 A;  1N9S A;  4J8O A;  3CCV A;  1VQO A;  2CKK A;  4OB0 B;  2LCL A;  4BE1 A;  3JCM W;  4KUD K;  4M78 E;  5LL6 S;  2DKG A;  4M75 C;  2XI9 A;  5GAN d;  4O6J A;  4OMF B;  4VUB A;  3KXT A;  1EIF A;  2CZ1 B;  1VQ5 A;  3J7A F;  2G3R A;  4PJO E;  1WJS A;  4DQ2 A;  4ZN1 A;  3JCM P;  2VC8 A;  4C8Q G;  2DIG A;  2OTL T;  3CCV T;  1VQO T;  4M78 B;  4RG8 A;  2KDS A;  4BB7 A;  3GIB A;  3OYL A;  4M7D A;  4OGC A;  2CZ6 B;  3VJP A;  3RMQ A;  4PJO B;  3PGG A;  1VQ7 A;  3GNF B;  3V8L A;  1VQL A;  3JCM h;  2CZ7 B;  3C4S A;  4Z02 A;  2ZPE B;  3ZEH A;  1B34 B;  3OYF A;  4EMK B;  3M56 A;  1YI2 A;  1Q86 C;  3QHS A;  1MHN A;  4M77 E;  3L2Z A;  4PLL A;  3OY9 A;  4XTY A;  3CMA A;  3HHT B;  1Q81 U;  2E70 A;  1DJ7 B;  4IUP A;  4JLG A;  4X9D A;  3M55 A;  1VQ7 T;  1XOV A;  5FU6 B;  3OYA A;  2RHY A;  4PLI A;  1KQS S;  3OMC A;  1VQL T;  3GP8 A;  4IUQ A;  3LX7 A;  4N4I A;  4BI8 B;  3GPL A;  5FRM A;  4M7A E;  1VQ5 T;  4M77 B;  5A0D A;  3FRN A;  1YI2 T;  4ZTF A;  4FM4 B;  2YRV A;  1K9M U;  2DD5 A;  1WPY A;  5EG2 A;  2M0O A;  1VUB A;  1VQM A;  1KD1 C;  3CMA T;  4Y91 A;  2O01 E;  4GLK A;  5LJ3 d;  3VYG A;  3OS1 A;  2F5T X;  5GMK m;  2QTX A;  2M1H A;  3R6O A;  2BKD N;  1ZHI A;  2DXT A;  1VQK A;  2RK1 A;  3HFO A;  2DXC A;  4C8Q C;  2DAQ A;  3MP6 A;  3P8H A;  3OS2 A;  3A8L B;  3E9G A;  3M5A A;  3CC4 A;  3GF5 A;  2EJ9 A;  3NTK A;  3OBY A;  4J6W A;  1OZ3 A;  3CBO A;  3J80 E;  4J5Y A;  4UC4 A;  1VQM T;  5GMK l;  2ZPF B;  4A4H A;  3CXC S;  3O8V A;  2XD0 A;  2OTJ A;  2ZCF B;  1UGP B;  5KE2 A;  3JCM Q;  1VQK T;  2E12 A;  2DTH A;  4XTV A;  3QKJ A;  2PQW A;  2R58 A;  1YBY A;  2A7Y A;  1NE8 A;  3FB9 A;  4M78 G;  4M7D E;  3CC4 T;  4LD6 A;  4DA4 A;  4QVZ A;  3VUZ A;  4L59 A;  4PJO G;  5CKB A;  4B9X A;  3L2U A;  2OTJ T;  2ZPI B;  4FL6 A;  2C06 A;  3MEV A;  2YLB A;  1LOJ A;  3BW1 A;  5GAN h;  4EDU A;  1RI0 A;  3HFN A;  4M7D B;  5GAN e;  3JB9 H;  3HL8 A;  2YHT A;  3QII A;  1KHI A;  4C92 D;  1HXD A;  2LQ8 A;  3CBM A;  3JAM E;  3L2V A;  3G4S T;  4C92 B;  3PMI A;  3BDU A;  3EFR A;  2VYT A;  2AHJ B;  2DTO A;  1G3Y A;  2DXU A;  2RHU A;  3C12 A;  4XQ3 A;  4NL3 A;  1U1S A;  3HRS A;  4KUL A;  4BI4 A;  2MWP A;  3QSU A;  4OB3 B;  3OQ5 A;  1M8V A;  2LT1 A;  1Q81 C;  4P5N A;  3TCJ A;  4XTZ A;  2HQE A;  3J81 E;  3ZBD A;  2K5L A;  2VXF A;  4XTU A;  3CCL A;  2RI5 A;  2F5K A;  2MMP A;  4EPC A;  1UGR B;  3V8K A;  1W2B A;  4BE0 A;  4IUU A;  4IKF A;  2F69 A;  4NOY A;  1K9M C;  3A8H B;  3OYC A;  2X4Y A;  2EJF A;  4M75 F;  4PNO A;  3I56 A;  4J6Y A;  4ZGJ B;  1M1G A;  4ELZ C;  4II1 A;  2XIC A;  2O4X A;  4PKC C;  2HD0 A;  4A4K A;  3A8O B;  5GAO m;  2DZC A;  3CCL T;  2K2V A;  3A5Z B;  3CCR A;  3JRZ A;  1WJQ A;  1YCY A;  3HRT A;  4EMK C;  5DLO A;  1OZ2 A;  4N0A C;  5D6X A;  2VUB A;  2XHC A;  5CKD A;  5LJ3 h;  5CVI A;  1PSF A;  3CPW A;  5LJ3 e;  4ME7 A;  2RD1 A;  2Y90 A;  3I56 T;  3FLG A;  1M9S A;  1K73 U;  2VV5 A;  2XK0 A;  3QBY A;  5GMK h;  4QQD A;  2RM4 A;  3S6W A;  2E6Z A;  2LCC A;  4KT0 E;  5GAO n;  2X35 A;  5GMK e;  3PIP A;  4A4F A;  2XG8 D;  3FDR A;  4LDU A;  3CCR T;  3T9N A;  4XU1 A;  3AHU A;  2ZPH B;  4M7D G;  3GNG A;  1JB0 E;  2RJC A;  1Q82 C;  3RKX A;  3OYN A;  4L6V 5;  4C92 G;  3NTH A;  1ZBX A;  1X75 C;  4CRI A;  4BI3 A;  4J7I A;  1I5L A;  3VUB A;  1I8F A;  5CQX A;  2I2L A;  1N6A A;  2OTL A;  1Y7X A;  2IG0 A;  4Y28 E;  3ER0 A;  1D3B B;  3CC2 A;  2LTO A;  5DLQ E;  1K8A C;  2P4T A;  4HCZ A;  4PL6 A;  1YIJ A;  1UGS B;  3RIR A;  5GAM g;  1UEB A;  1VQN A;  4JDS A;  2V8I A;  4BDZ A;  3L2R A;  1ZQ1 A;  3SFM A;  2JN0 A;  4KUI A;  4M78 D;  5D6Y A;  1GXI E;  5GAN j;  4ZGE B;  5CK9 A;  4F7U A;  3JB9 F;  3G6E A;  3JCM g;  3CC2 T;  3CPW S;  2ZGW A;  3M4Y A;  3CXC A;  1Y96 A;  2EIF A;  5HKC A;  3L42 A;  4PJO D;  1U1T A;  3QYH B;  3TU4 K;  1YIJ T;  1VIE A;  2KSS A;  4C0F A;  5I21 A;  3BDL A;  4M75 A;  4QVD A;  4MZT A;  1VQN T;  5FU7 C;  2XID A;  3ME9 A;  3CPF A;  3WVD B;  4BUG A;  3QG1 A;  3DLL A;  2E6N A;  5A2Q E;  2RH2 A;  5A0G A;  2O4X B;  4C92 C;  3G6E T;  3OYK A;  3M53 A;  2RHZ A;  3JCM X;  2EQJ A;  1NPR A;  4A4E A;  4HCC A;  4X9C A;  4E7K A;  5GAN 2;  4M77 D;  1H64 1;  1M4Z A;  1R8O B;  3VKI A;  2DK3 A;  3L2Q A;  3CCM T;  2PUO B;  4C5E A;  3SWN B;  2QQR A;  3QYG B;  1K73 C;  1XTD A;  3M54 A;  4LDY A;  2LNV A;  3P8D A;  4MDW A;  4E47 A;  5CR2 A;  4M7A D;  2EJG A;  3OYB A;  3X26 B;  4M7A B;  2B8A A;  4FT2 A;  4J6X A;  2HQX A;  5LJ5 g;  3PNW C;  3GLX A;  2E10 A;  4XK8 E;  4QQG A;  1KQ2 A;  3FC3 A;  1QVF S;  4DOW A;  1W4S A;  4D6W A;  1Q7Y U;  3WVE B;  3V7S A;  2XDD A;  3MET A;  1U8R A;  4LDW A;  4NL2 A;  5LJ3 j;  3SB2 A;  3NFC A;  3PMT A;  2KVQ G;  1QVG A;  2E1H A;  4RG2 A;  1BKB A;  3TEE A;  2K3Y A;  3BFM A;  5CO7 A;  5GMK j;  3CCQ A;  3S3O A;  1QP3 A;  3L1A A;  4X34 A;  1Y71 A;  2YLC A;  2X4W A;  1YHQ T;  4E7J A;  4C8Q A;  2K3X A;  5GAN 7;  3G4S A;  3F70 A;  1Q82 U;  3X20 B;  2RA2 A;  1BI2 A;  5IAY A;  4TVR A;  2HBP A;  4M75 E;  3MEU A;  4J7F A;  4LDV A;  1G3T A;  4BY6 C;  2EYQ A;  4WF2 A;  2DO3 A;  5GAN 8;  4O5V A;  3GOX A;  4FIB A;  5GAN 4;  5KH6 A;  3CCQ T;  4M7D D;  2X4X A;  4C0D B;  3V8J A;  4RMO A;  4RKU E;  5GAM f;  2L5Q A;  3RES A;  5GAN 5;  1Y96 B;  5GAO q;  2XU8 A;  2ZPG B;  3JCM c;  2RJF A;  2EQU A;  5HK3 A;  2EFI A;  3DB4 A;  2QQA A;  4M75 B;  2LRQ A;  4NS5 A;  1K8A U;  3JCM f;  3RKY A;  2VXE A;  5GAO r;  4ZN3 A;  2DD4 A;  2K5F A;  4M77 G;  4IUV A;  4JUV A;  4C5H A;  2DVE A;  2MF2 A;  1JJ2 A;  3OS0 A;  1M1F A;  1YIT A;  3N5B B;  1QVG S;  4QW2 A;  1HK9 A;  5C0M A;  4M7A G;  2QA4 A;  1BI1 A;  3HKS A;  3LLR A;  3JCM J;  1M90 U;  4F7U F;  1BI0 A;  3MP1 A;  1N8R U;  3MP8 A;  1X6O A;  3QZ9 B;  4M78 C;  2EQK A;  4MZP A;  5GAO p;  2E64 A;  3CCS A;  2JNG A;  3KUF A;  4PJO C;  2E5Q A;  5GAM d;  4XU2 A;  1YIT T;  3OSS C;  2QQ9 A;  4JRK A;  5LJ3 g;  3VV0 A;  2D0Q B;  5AYF A;  3HPW A;  2QA4 T;  4BDY A;  1Q7Y C;  5IT9 E;  1N27 A;  4IUR A;  4J83 A;  2GF7 A;  3MCA B;  3JCM d;  4C8Q E;  3M4G A;  3NTI A;  4RCB A;  3V7R A;  5LJ5 f;  4JRI A;  1O9S A;  5CKF A;  5GMK i;  2PVO B;  3CCS T;  3OW2 A;  5CAI A;  2WSC E;  3UPU A;  3VYH B;  2Y4Y A;  3CEY A;  1JRI A;  4MMK A;  5FU6 C;  5GAO l;  1YJ9 A;  4CI0 C;  3CCE T;  2RJE A;  1NJI U;  2DIQ A;  3QJY A;  4M77 C;  2BUD A;  3OYY A;  1B34 A;  3SWN C;  4EMK A;  1KQ1 A;  2V8K A;  2D6F A;  4N0A A;  2D9T A;  1JJ2 S;  4M7A C;  4EMH A;  1WQ7 A;  1YJ9 T;  3LGL A;  3INZ A;  3HRU A;  3A8M B;  3MEA A;  3X25 B;  5M9O A;  2WSE E;  1TH7 A;  3A8G B;  3OBW A;  1OI1 A;  4HA8 A;  3BY7 A;  4R55 A;  3I55 A;  4OB2 B;  3ZFJ A;  4QVC A;  2MWO A;  2LDM A;  5LJ5 d;  4N4G A;  3JB9 I;  4BD3 A;  2V8J A;  3QO3 A;  3L2W A;  3CME A;  4C8Q F;  4JS5 A;  2HAX A;  1QVF A;  2VGN A;  5KE3 A;  3LYI A;  2GCX A;  3OS5 A;  1KC8 C;  1KHC A;  3I55 T;  2PVG B;  1BI3 A;  2FL7 A;  4L5G A;  3OW2 S;  4N4H A;  1FWZ A;  4B9W A;  1M90 C;  3UT1 A;  2DEQ A;  1N8R C;  3FJP A;  2LX9 A;  4MML A;  2DJZ A;  4M7D C;  3CME T;  3RER A;  3CCJ A;  5D6W A;  3X24 B;  2DXB A;  3CCM A;  4C5G A;  2E65 A;  4HCB A;  2L3R A;  3MHX A;  3TRE A;  3WXM B;  1S72 A;  4HT9 A;  4XU0 A;  2KMT A;  5GAN 6;  5I2S A;  3Q1J A;  1AHJ B;  3JSC A;  4JJN K;  4E7L A;  3S3N A;  2LC4 A;  4BAC A;  1VQP A;  1M5Q 1;  2H3J A;  4GY5 A;  3LGF A;  3H6Z A;  5GAM h;  3QXE B;  2EQM A;  1RL2 A;  5LJ3 f;  3CCJ T;  5GAM e;  4R56 A;  4C5I A;  2JUF A;  3JB9 G;  5J3B A;  3E19 A;  1Y07 A;  3RMS A;  1IZ6 A;  1S72 T;  4MZM A;  2JTF A;  1H3Z A;  4C92 A;  3JB9 J;  2MI6 A;  4FU6 A;  5J39 A;  2GQV A;  5KCH A;  1WQW A;  3DLM A;  3JCM e;  1NJI C;  2Y4X A;  1G5V A;  1KG1 A;  1VQP T;  4HKE A;  2LQK A;  3M58 A;  2QQB A;  4ZGD B;  3KBG A;  1YHQ A;  3UDC A;  5HK0 A;  2CGH A;  5CKE A;  2CS7 A;  2XDB A;  2X4J A;  5DM7 R;  3PTA A;  5DY9 A;  3LWI A;  1VQ6 A;  2BIV A;  2NLU A;  2XDP A;  3FIF A;  1FXX A;  2QXF A;  3FEO A;  4OVA A;  4OB1 B;  4M78 F;  1NPP A;  3DB3 A;  1VQ8 A;  4F7U E;  1P92 A;  3LW5 E;  2IVW A;  2K57 A;  4PJO F;  3OB9 A;  1VQ9 A;  2JVV A;  2HNI A;  2DPP B;  5L8R E;  5FRO A;  4C0Z A;  3OYM A;  1LNX A;  1I4K 1;  5GAN g;  1O75 A;  3RUX A;  1D3B A;  1UB4 A;  2P0K A;  1I81 A;  2ZPB B;  3PT9 A;  4LDX A;  1V29 B;  1VQ6 T;  2RHI A;  2KAF A;  4F7U B;  4DOV A;  4A4G A;  5LJ5 h;  4MDX A;  1VQ8 T;  2EKO A;  5LJ5 e;  1SSF A;  2JZ2 A;  4M75 D;  4XTW A;  1VQ9 T;  2R5M A;  5J26 A;  1BYM A;  3M9Q A;  3OYG A;  4V2S A;  3QPH A;  4IUT A;  4BE2 A;  2GFU A;  4Q5W A;  3C94 A;  3OYJ A;  3E9F A;  4M77 F;  5I2M A;  3X28 B;  2KQW A;  4JS4 A;  3OSV A;  2PVD B;  1M1K U;  3C95 A;  3CD6 A;  2L8D A;  1WGS A;  4KBM B;  2FVU A;  2RK2 A;  3JCM V;  3VU3 C;  1KC8 U;  1NZ9 A;  1XNI A;  2K5I A;  2LVM A;  5CQY A;  4M7A F;  4HT8 A;  4C92 E;  4YTL A;  3SDZ A;  2GFA A;  1VQ4 A;  3OYI A;  2R57 A;  3CCU A;  2FB7 A;  4FSX A;  5HY6 A;  5FU7 B;  3S3M A;  3G71 A;  2RI3 A;  1WNL A;  3P8B B;  3SD4 A;  2QI2 A;  4E7H A;  2DZ9 A;  3CD6 T;  3RKW A;  2KK4 A;  1UGQ B;  3PFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...