2RA2A

X-ray structure of the q7cpv8 protein from salmonella typhimurium at the resolution 1.9 a. northeast structural genomics consortium target str88a
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
PNYVMHTNDGRSIVTDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMVALENLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
publication title X-Ray structure of the Q7CPV8 protein from Salmonella typhimurium at the resolution 1.9 A.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Lipoprotein
total genus 8
structure length 55
sequence length 55
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ra2A00
3SWNA 2DKGA 1LJOA 5GANj 4M75E 4PJOA 3RESA 4JUVA 4M75F 3JB9D 1I81A 4QVCA 2DTIA 4C92A 3L1AA 5GAMj 4M7DE 2YLCA 3HFOA 1M5Q1 5GAMe 3JCMW 3JCMd 2QTXA 5GAOr 4M7DF 3JB9G 3V8JA 1Y96B 2DZ9A 5GANh 4X9DA 3SWNB 3JCMg 4M77E 5GAN6 5GAN2 4QVDA 3RUXA 4M7AA 2EWNA 2DJZA 4PJOB 2E10A 4M77F 5LJ5d 3FJPA 2DTHA 4EMKA 1I8FA 1BIBA 1N9SA 3QUIA 1JBMA 4M78D 3JB9J 4F7UE 5LJ3h 5LJ5f 4M78E 3SB2A 3SWNC 4M75A 4Y91A 4F7UF 4F7UG 5GMKh 4XTVA 5GAOl 1WPYA 4M78F 4M7AB 4M78G 3JCMJ 4PJOC 5GMKl 4V2SA 3BY7A 4NL3A 3FIFA 4M7DA 3VU3C 4J6XA 4XTWA 1D3BB 3M4GA 5LJ5j 4N0AA 4C8QA 3JCMP 5LJ5e 4NOYA 4JLIA 3RKXA 2E65A 3JB9F 4EMHA 4M77A 4M75B 2RM4A 2YLBA 5GANg 4M7AC 1TH7A 2RA2A 5GAN3 5GAOm 3QSUA 5GMKm 5GAMg 4EMKC 3JCMf 2VXFA 5GAMh 3JCMX 3BDUA 5LJ3d 4C92B 4C8QB 3JCMc 3V7CA 2RD1A 3L2ZA 3HFNA 4HA8A 5CAIA 4XU3A 5GAOp 5LJ3g 2CGHA 4HT8A 4EMGA 4M75C 4X9CA 4PJOD 2VC8A 1U1TA 4J6YA 4RCBA 5LJ3f 5GAOq 3JCMe 4PJOE 2DVEA 4XQ3A 1KQ2A 2E1HA 4M78C 1JRIA 3AHUA 4PJOF 4XU0A 1LNXA 4PJOG 3JB9I 4C92C 4EMKB 4N0AC 2FB7A 4MMKA 4C8QC 5GAN4 2DEQA 4C92G 5GANd 5I21A 2JN0A 2E64A 3RKWA 4MMLA 4WF2A 5DY9A 3HSBA 4M7AD 1I4K1 2YHTA 1LOJA 2VXEA 3INZA 3RKYA 2FYKA 1MGQA 5GAMd 1N9RA 2EJFA 1X01A 1I5LA 2EJ9A 4M7AE 4DQ2A 2DZCA 4XTUA 5GANf 4OP0A 4M7AG 2RB6A 4M7AF 3V7SA 4M7DB 5LJ5h 3V8LA 3QHSA 1YCYA 1WNLA 1BIAA 4A54A 5GAMf 5GMKi 1B34A 4F7UA 4M75D 4M78A 5GAN8 2DXUA 5GAN5 4XTYA 4M77B 3V8KA 3RERA 2HNIA 4NL2A 4M7DD 2ZGWA 5GANe 3GIBA 4M75G 4JRIA 3JCMV 4C92D 1HXDA 4M7DC 1M8VA 3V7RA 4C8QD 2DTOA 2DXTA 3EFSA 4C92E 5GAN7 4M7DG 3RIRA 3BFMA 4RCCA 4C8QE 1B34B 4M77D 4C92F 4F7UB 2K57A 3JB9H 4XTZA 1WQ7A 2EAYA 4M78B 4C8QG 4C8QF 5LJ3j 3EFRA 4M77C 3JCMh 5GAOn 1WQWA 5LJ3e 1HK9A 5GMKj 3JCMb 4XTXA 2E41A 4M77G 3FB9A 3PGGA 4XU1A 4JRKA 5GMKe 1D3BA 1U1SA 1H641 5LJ5g 3JCMQ 4J6WA 1KQ1A 3QO3A 4PNOA 4A53A 2I2LA 3BW1A 1Y96A 2EJGA 4J5YA 4XU2A 2Y90A 4HT9A
chains in the Genus database with same CATH superfamily
3N5BB 3FC3A 3G4SQ 2JMCA 4II1A 1GFCA 4E7JA 4QQDA 3L1AA 3KXTA 1SHGA 1P92A 2QTXA 2DX1A 1RAEB 1VQ9T 2O4XB 4M7AA 3CC7T 3CCMT 2X51A 3X25B 4B9XA 2KMTA 2OAUA 4DBFA 4CC7A 2DO3A 1C1AA 5LJ3h 3REAB 3SB2A 2KXCA 2HQXA 2IPOB 2NUPA 1Q82C 1KD1C 4M7DA 1D3BB 5I2MA 4C5GA 3GP8A 4PFZA 3I55T 1JJ2P 1K73U 2FZCB 1BI3A 3URGA 2RHZA 2H8HA 3CCEQ 2YLBA 4M4ZA 3ZBDA 8AT1B 1VQ8Q 1RI9A 1ZA1B 1UHCA 2HSPA 4C0DB 2Z0WA 4E7ZA 1BI1A 1YP5A 5GJWB 3G6ET 2O9VA 3G71Q 3VS2A 2DEQA 1KC8R 3M59A 3CPFA 3OYIA 3EG0A 1C0MA 4F14A 4BI8B 1AWWA 1BIAA 2QI2A 1WIEA 3PT9A 3VKIA 2PUOB 3OYDA 1UJYA 2O4XA 1GCPA 3OS1A 3S3NA 3VS4A 4ESRA 1X2QA 2LJ1A 2RQTA 5I22A 1LVKA 1TTHB 2MI6A 2CP2A 1TUCA 1R0BG 3FDRA 4M78B 1G3YA 1ARKA 1D3BA 1E6HA 2XDPA 2C0OA 4IUPA 1X69A 4N4HA 5FRNA 4HCCA 4Z89A 4RUGA 3A8GB 1RABB 3HFOA 1M5Q1 3LYIA 1QP3A 1Y96B 1KQSP 2IIMA 1PM3A 2VB6A 4JZ3A 5GAN6 4ZGDB 1C6VX 5FROA 1VYUA 4A4EA 1WDXA 2DRMA 4M78D 5CK9A 2CT4A 1M1KC 4PJOC 4BY6C 2KRSA 3L2UA 2HD0A 2RHYA 1Y07A 3I35A 4RTTA 3EGUA 4IURA 3RBBB 1Y7XA 4J9DA 2DYIA 1MV3A 2LNVA 4ZNXA 1W2BP 3REBB 2FG0A 1M90C 3JCMc 3WXMB 1QVGS 4M75C 1QWEA 4J83A 4PKCC 2R58A 3CD6A 2YUNA 3CMEA 3MP8A 2J6KA 1KSWA 3LX7A 2EJFA 1S72Q 2DXCA 4K11A 2JOYA 5CQYA 2XKOC 5AT1B 3CMAQ 3QKJA 4KGZB 1Q7YC 1QKXA 2AZVA 1OV3A 2EVRA 1Q81R 3GNGA 1M3BA 1G8XA 3E1SA 1N6AA 3M55A 3LWHA 3BDLA 5LJ3e 5FU7C 1K8AC 1VQ9A 3JCMQ 1T3LA 2XIDA 3H0IA 2QAZA 2LQWA 3CC7A 1NJIU 4A4GA 5KCOA 3GOXA 2LTOA 2NYSA 2Y4XA 4TVRA 4B9WA 4FCYA 4FSXA 1NZ9A 2ZPIB 2HBWA 4FW1A 3P8HA 1OZ2A 2QEXQ 1RAAB 4J9HA 1VQ4T 2HKNA 1WXTA 3I55A 4OMFB 4R55A 2H3JA 3DKMA 3OYBA 2VASA 4V2SA 1OPKA 1BYMA 4ZTJA 2DEUA 4A4FA 2CP6A 1RACB 2KI7A 1N8RC 2QGFB 1R0CB 3PNWC 4DBQA 1NBEB 2MWPA 3EGDA 1FMVA 1YN8A 1PSEA 5GAN3 1AZEA 4B6MA 1NLPC 3CCUT 3QSUA 2IG0A 1WYXA 2J05A 2KAFA 5CAIA 4HT8A 5AYFA 3HKSA 2DD4A 3M57A 3NFCA 1IGUA 5HY6A 4LN2A 4MMLA 5DY9A 3NTIA 2ZAEA 3RKYA 2F2WA 2FYKA 4C0FA 4DQ2A 3CCSQ 4F16A 2LMJA 4PL6A 3UWNA 2AHJB 4A54A 4F7UA 4FYXB 4CRIA 1VQOT 3TQ7P 3MPUB 2J6FA 3S3OA 3H9NA 1QW1A 4M7DC 2A7YA 3V7RA 3OYEA 3G4ST 2K57A 2EAYA 4C8QG 1GRIA 1WX6A 2M0OA 4XTXA 4XU1A 4LD9K 4JDSA 1K8AU 2JVVA 2JNGA 1VA7A 3M0RA 2RO0A 3HL8A 2JJ9A 1UDLA 2FB7A 1K9MU 3EG9B 4PLIA 5A0GA 4HCKA 3L2VA 2ZPHB 5IHIA 3CPWP 2KE9A 3E19A 7AT1B 3MP1A 1I81A 2YLCA 3NHNA 3HHTB 1X6BA 3V8JA 1I07A 1TXQA 4PJMA 3Q1JA 1WZOA 1T0HA 3OYJA 4DEXA 3M0QA 3OQ5A 2LRQA 1YWOA 3M54A 1VQ8T 2KT8A 1UHFA 2FZKB 2YDLA 5CR2A 2ABLA 5FWBA 5A0LA 2QTVA 3OW2S 1N8RU 2GQIA 5CKFA 2VGNA 5KYYA 5IH2A 2A36A 3NMZC 2EQJA 3JCMf 5GAMh 3SEMA 3ASKA 2D8HA 1G3TA 5D6WA 1SRLA 4BI4A 3OYMA 5IT9E 2DM1A 2WSCE 2KK4A 2O01E 1LNXA 2NUTB 2ZZDA 3M58A 4Z88A 4ZGJB 4D8DA 3EG9A 4A4HA 1WJQA 2BZYA 3TVTA 2JM9A 1X01A 4M7AE 2O88A 3M0TA 1H3ZA 3QJYA 2YXYA 2FVUA 2MK5A 3VS0A 3FEOA 1XNIA 2G3RA 1SF9A 3SDZA 3OMGA 2KBTA 1RAHB 2V26A 4M77B 3RERA 2VUBA 1S1NA 2LT1A 2JTEA 1ZBXA 3VRZA 3O8VA 2HZYA 4J9EA 3CC4A 1UTIA 4XAXB 2RQUA 5CIUA 5LJ3j 1TS9A 2M16A 2CP3A 3FB9A 1QVGA 1JXMA 2J06A 1WA7A 1ZSZB 1QCNA 3E9FA 1VQ4A 4M78C 2OTLA 3H41A 4PJOA 1PRMC 1MMGA 5LL6S 3SWNB 2KRNA 1K73R 2HDAA 3LGFA 5LJ5d 4IUTA 2FZGB 2COZA 1N9SA 2NUTA 1VQMA 2FPDA 5CVIA 2OAWA 4C5HA 4M75A 1ABQA 3BY7A 2DMOA 2JS2A 4AT1B 2QK0A 1Q95G 3S6WA 3X28B 4M77A 3UDCA 1TH7A 4E6RA 2P0KA 4LDUA 2BTTA 5J39A 2FL7A 4C92B 1Y0MA 4C8QB 3QWYA 4JJNK 2V1QA 4KH1B 1S72T 1YJNQ 1D1BA 3CMAT 4XU0A 2QDYB 1VQOA 2OTLQ 2HMAA 2YWWA 1KHCA 2ZCFB 4Y92A 1YNZA 2YHTA 2DLPA 2EQMA 1X6OA 4RTUA 5CQXA 2DZCA 2PNIA 3G4SA 4J9FA 1RL2A 3M56A 4LDVA 1UB4A 3GF5A 1FXXA 4CC2A 3V8KA 5EC7A 4PJLA 4C92D 1VQMQ 4C8QD 2H3EB 2HBPA 3BFMA 3PFSA 4RCCA 2GNCA 2RH2A 3JCMh 4N4GA 4LD6A 3EGXB 2A3LA 3PGGA 4JRKA 2EQIA 3P8BB 1SPKA 3M0SA 2MOXA 2QEXT 2L3SA 4E7SA 1WHHA 4J5YA 2CUBA 3CMET 1DJ7B 3CCEA 4ZTFA 3QYGB 4ELZC 4QVCA 1YFNA 2DTIA 4C92A 5GAMe 1Q82R 3TCJA 1KD1R 1VQ8A 3JB9G 3DLMA 1X2KA 2RI3A 2K4YA 4OMQA 1J3TA 1UGQB 4HKEA 2HEQA 4KGXB 3VS5A 1H92A 2PVGB 1KFZA 3RR6A 1X43A 2KROA 4PLLA 3G71A 2XU8A 2PQWA 2RJEA 2KDSA 4OGCA 5HCKA 2D1XA 1FMKA 3M4GA 2NLUA 4GY5A 1MV0B 5CKDA 2F5KA 4OMMA 2RI5A 3FRNA 2DXBA 3QYHB 4IUQA 5KYNA 1PG5B 2DETA 4R0KA 2ZPGB 1JQQA 1I0CA 1M1FA 4ORZA 3CCST 3EGXA 5L8RE 3AHUA 4OB1B 3JB9I 9ATCB 5CKHA 3VUBA 1I4K1 3INZA 1QP2A 1I5LA 3O5ZA 2ZPBB 3CBOA 4M7AF 3V7SA 2VYTA 3V8LA 2GQVA 3TSWA 1B34A 3OW2A 5GAN8 1VQPA 2EKOA 2E5KA 2VGMA 4NL2A 5KYWB 1MNDA 4ZGEB 2CZ6B 4E7HA 2DAQA 4IUVA 1YITQ 3JCMb 1H8KA 3LWIA 1BI0A 2M51A 1H641 1VUBA 1ZA2B 3META 4JJBA 2ROTA 1VQ7Q 2RHUA 2L5QA 3NTKA 1PSFA 1MMNA 1BU1A 3EG1A 3H8ZA 1M1KR 3OYHA 3A98A 3VV0A 2PZ1A 1IB8A 2VWFA 5A2QE 4X9DA 1UGVA 1ZUYA 5HK0A 2LC4A 2VKNA 1NYFA 2QASA 2GFUA 1AHJB 1PNJA 4RMOA 1YBYA 1V76A 4F7UE 1AEYA 1NJIC 5LJ5f 1M90R 2OTJQ 1VYVA 2QQRA 3CCLQ 3L2WA 4IIOA 5GMKl 1M27C 1RAFB 1X6GA 4OB2B 3RMSA 5FU6B 3EH2A 4HXJA 1S72A 1VQPQ 1U06A 3C95A 3ULRB 3RKXA 2E65A 2QYZA 2P0QA 1VIFA 5GANg 3CMAA 1GL5A 4FYVB 3F70A 2LQ8A 2EGCA 5GAMg 1ZUUA 4EIKA 4EMGA 3J81E 2EYZA 4AFSC 5GAOq 4O5VA 3JCMe 1Q7YR 3JV3A 1VQNQ 1Q86U 1NE8A 4MMKA 1K0SA 1AWXA 2E70A 2KY9A 2COYA 2PVOB 3P8DA 4ATOA 3U23A 1KHIA 4BE0A 1ZX6A 1K8AR 2GFAA 1G3SA 4PFOA 4M78A 4L59A 2QEXA 2LJ0A 1QVFS 4DOWA 3A1PA 4IIMA 1PWTA 2CSIA 2FPEA 4C5IA 5J3BA 2W0ZA 3CC2Q 3D7SB 2O2OA 2K5IA 4M77C 4RG8A 3KUFA 4J8OA 1WJRA 1OU8A 2CP0A 1Y96A 3UF4A 2FO0A 4HT9A 2LCLA 2DKGA 2YUOA 5GANj 1NEBA 5KE2A 2DBMA 3JB9D 1MNEA 1UUEA 2AKKA 3X24B 1WHJA 3MO8A 5GAMj 1ZSZC 1QLYA 1M2VB 2DL3A 1FWZA 2ZPFB 1N8RR 1TG0A 3MEWA 1B7TA 3FJPA 2QA4Q 3BE3A 1QQJA 2BZ8A 3GNFB 3SWNC 4N4IA 1K9MC 4D6WA 3CC4T 5KYXB 2RHIA 4RTVA 2L2PA 3CCSA 3VYGA 1N5ZA 3LH5A 3JB9F 2MF2A 2LX7A 1AOJA 4C5EA 2CDTA 1V1CA 2F1LA 2JW4A 2VXFA 3HRUA 2OTLT 5LJ3d 3OY9A 4AG1C 4XU3A 3PVLA 3CBMA 1U1TA 1UG1A 1WXUA 2EYWA 5D6XA 4PJOE 1SSHA 2DVEA 2SEMA 2HQHA 4XQ3A 1KC8U 1NPRA 3S3MA 4C92C 4C8QC 2RMOA 3RKWA 4PK4A 2RJFA 1VQKQ 4KUIA 1VQMT 2HKQB 3L2RA 5CKBA 2DPPB 4MZPA 5LJ5h 1VQLQ 3ER0A 2CUDA 3SD4A 1IGQA 3QPHA 1UFFA 2ZGWA 5IXFA 2MAMA 4JRIA 1M8VA 2RQWA 4D8KA 2DL5A 5GAN7 4JJCA 2SRCA 2OX7A 2EYYA 1R77A 2RPNA 2I0NA 2CH4A 1B3QA 2DL7A 3I9QA 1LJOA 4HVWA 1PCXA 3A5ZB 3EHQA 5IHKA 2XK0A 1H3HA 3MP6A 4EDUA 2RN8A 3LH0A 4LDXA 1MMAA 3NGPA 4OB3B 1PD1A 4Z8AA 2DTHA 5IXBA 1ABOA 1YWPA 1U8RA 2EPDA 4QKUA 2AK5A 4F7UF 1QMCA 1SSFA 3JCMJ 2LQNA 4JRQA 3HRTA 2CT3A 2R57A 3H0HA 1JO8A 4E7LA 2JT4A 3A8HB 3MCAB 1U3OA 5I2SA 2FEIA 8ATCB 2A0FB 1WJSA 4DOVA 3L2ZA 3CCET 1OZ3A 2GBQA 5LJ3g 5C0MA 3C12A 4BACA 1HJDA 2DBKA 1OEBA 1I5OB 2GCXA 4J9IA 2D6FA 4Z02A 1VYTA 4FM4B 2LQKA 2QDLA 2VXEA 1QVGP 1QVPA 3OSSC 4IUUA 1XQHA 4M7AG 3G71T 5IN1A 2E4HA 3QHSA 1D0ZA 1Q81U 1XOVA 1NM7A 2CREA 4OGEA 3UPUA 3GIBA 1IHVA 1FMWA 3OBWA 1EFNA 4M7DG 1VQ7T 3OMCA 1ZHIA 3JB9H 3UA6A 1NYGA 1YJWQ 4DBRA 3E2UA 4LXCA 1W4SA 2DJQA 1VQ6A 3M9QA 1IXDA 3VS7A 2E6ZA 3MEUA 4FU6A 2NUZA 2HL3A 4PNOA 2I2LA 2HCKA 2G6FX 2JXBA 1IZ6A 5D6YA 3HP9A 4QQ6A 3SFMA 4FT4A 4M7DE 4CC4B 3MHXA 5GAOr 2OTJT 2KQWA 3TU4K 3CCLT 4KRTA 1AWJA 4FW2A 2O31A 2DF6A 1VQPT 4QW2A 1JJ2S 4BDYA 1EZZB 1QVFA 4J9CA 1YJNA 2BUDA 1KJWA 4GLMA 2E3IA 3SHWA 4WCIA 5GAOl 5HK3A 5GMKh 1TWBA 3AT1B 4HVVA 3FJ5A 1RAIB 2X9HA 1M3CA 2CZ1B 2KR3A 5LJ5e 4EMHA 1TU0B 2HQEA 1LCKA 1VQNT 1VOMA 4RKUE 4EMKC 4PJNA 5FU6C 2V8KA 4HCBA 1GCQA 3X26B 3L42A 1OI1A 2PU9B 3ZFJA 3PMIA 3QZ5B 1VQ6Q 4J6YA 5LJ3f 2AKLA 1YCSB 2K5LA 4PJOF 1WHGA 5IHNA 1UGPB 5I11A 2EIFA 1GFDA 3NTHA 5I21A 1ZSGA 1IO6A 3CXCA 1TOVA 3PMTA 3RMQA 2DK3A 1W6XA 1YJ9Q 3QZ9B 2RB6A 3WVDB 4Q5WA 1YCYA 3CC2T 1VQ5Q 4WTOB 4RTYA 1SHFA 2X3XD 1CSKA 1HXDA 2QGGA 4BD3A 1ZSZA 2QQAA 2E6NA 5GAOn 2ESWA 2MMPA 2ROLA 1IREB 2O9SA 1AWOA 1PC0A 4MDWA 1JEGA 3DB3A 1SRMA 1VIEA 1KQSS 1UEBA 2PUKB 3OS0A 2QG9B 5J26A 3R6OA 3SWNA 2F2VA 4ANJA 3J7AF 2QA4T 2XICA 2YRDA 3EFOB 2FRYA 1YIJQ 2A08A 1TUDA 2KRMA 1BIBA 2K79A 2B8AA 5A0DA 1JXOA 3WVEB 4M78E 4Y91A 4RG2A 4ELYC 4M7AB 3H6ZA 3RNJA 1W2BS 1ACMB 3CCUQ 3C0CA 1N27A 4C8QA 3ZL7C 2YRVA 2KXDA 2BE7D 2K3YA 1YI2Q 2NUPB 5GMKm 2K7AA 1KIKA 2YUQA 3HPWA 3OW2P 2COWA 3V7CA 1VQKT 2CYZB 2JZ2A 4BE1A 5DLQE 2X4JA 1VQLT 1ZLMA 1YITA 2X4YA 2PTKA 5GANd 4M7AD 5GAMd 3VRYA 1D1AA 2JTMA 1XJWB 2EJ9A 2L8DA 2GGRA 3EFOA 4XTUA 1VQ7A 1WHKA 5FWCA 3CCVQ 1LPLA 3M53A 3CCQA 4M7DD 2L0AA 1AT1B 4L6V5 3JCMV 1AVZC 1Q86C 2JTFA 2P0PA 2DXTA 3RIRA 3R6NA 3DB4A 3G1JA 4XTZA 1WQWA 5D7UA 1ZQ1A 5GMKe 1I1JA 2OTJA 1IHWA 1RUWA 2KGTA 4QQGA 3CCLA 3OB9A 1KQ1A 1K9AA 2K5FA 2CZ0B 5CKEA 1FX7A 3UT1A 3QDRB 3JSCA 4BE2A 4J9GA 2D0NA 1NJIR 1W70A 4JJDA 4M7DF 3I56Q 4XK8E 2DILA 2IVWA 4MDXA 3RUXA 3J80E 1FYNA 5C6SA 4DBHA 4P5NA 3UATA 2GTOA 1YHQQ 2KEAA 1VQNA 4E7IA 4Y28E 1BI2A 4F7UG 4RTXA 4XTWA 5FW9A 2L3QA 5LJ5j 3M4YA 4OMNA 3JCMP 2CS7A 3CCQQ 3LW5E 2YRCA 2XDBA 1WHMA 4DEYA 3GPLA 1BKBA 2OI3A 2RF0A 4ZN3A 5EG2A 2LNHB 2QQSA 2PVDB 1PKTA 2F2XA 5GAOp 4JS4A 2CGHA 1M8MA 4RCBA 5CCAA 3CC2A 1EIFA 2DIQA 3OYNA 1ZUKA 1KQ2A 4EMKB 4N0AC 2CSQA 4E7KA 2FRWA 2JN0A 2EW3A 1JJ2A 2RJCA 2F69A 1SEMA 2FPFA 1D0YA 5KYWA 2X35A 5M9OA 2JM8A 2KSSA 5DLOA 2JMAA 3ME9A 3OYLA 1YJWT 2CZ7B 1OX8A 2M1HA 1CKBA 2DL4A 1D09B 2ECZA 4XTYA 4A63B 2DFUA 1KC8C 1D0XA 1PKSA 1OULA 3MEAA 3QWXX 2QA4A 2YSQA 1U5SA 1Z9ZA 3EFRA 3CPWS 1HK9A 4BI3A 5FRMA 1U1SA 1Z9QA 4J6WA 4AFQC 2W10A 2DA9A 1PRLC 1GCQC 2WSEE 4OF1A 1Q82U 1KD1U 2RJDA 4ME7A 2XI9A 4LDWA 1K9MR 2LT4A 2KNBB 1ZBJA 2EKHA 2JUFA 3JCMd 1M3AA 2DZ9A 2P4TA 4LUDA 4EMKA 1I8FA 2CP5A 5KE3A 4KBMB 1JBMA 1OQKA 3C4SA 2E3HA 2RQVA 4XTVA 2EQUA 1WFWA 4M78F 3OA6A 2C0IA 4E2FB 4NL3A 3FIFA 1E6GA 4JPBW 3VYHB 1VQKA 4NOYA 4JLIA 2BE9B 1VQ6T 1WGSA 1VQLA 2RM4A 1KQSA 2M02A 2RI2A 2EQKA 3MJXA 3EH1A 2VVKA 1UECA 1UGSB 3T9NA 4FYWB 3CXCS 1RADB 2QQ9A 3CCRA 1D1CA 5ECAA 3CCJA 3VJPA 3EGDB 1YJ9T 1BK2A 1F1BB 1NG2A 2E1HA 1VQ5T 2EGAA 5CO7A 4PJOG 3THKA 2HSEB 2C0TA 2EGEA 3HSBA 1YJNT 1UGRB 4A4KA 4X1VA 3PIPA 2J6OA 5GANf 4JRPA 2X3WD 4PJJA 1WNLA 3FLGA 5GAMf 3CCMA 1W2BA 2DXUA 2HNIA 3CBPA 4M75G 1BBZA 3RDVA 2KYMA 2X4WA 2RHXA 4OVAA 1BCMA 3G7ZA 1MMDA 4F7UB 2LZ6B 1WQ7A 2LCSA 3M0UA 5GMKj 3CD6Q 4M77G 3CMEQ 1M30A 3L2QA 3CEYA 1K1ZA 2BKDN 1YIJT 3EHRA 4MZMA 1Q81C 3PE0A 1M2VA 4A53A 3OS5A 2DD5A 1M1KU 1T0JA 4M75E 4LE9A 3PVQA 4JUVA 3QDFA 4F17A 1QKWA 1OU9A 3CCRQ 3CCJQ 3JCMW 2QXFA 4VUBA 3G6EA 1HYOA 3JCMg 4M77E 5GAN2 2DJZA 5KYXA 2E5QA 2R5AA 1QCOA 4BB7A 1M90U 1M4ZA 3QUIA 1SKUB 4LUEA 2DYBA 4GLKA 1YI2T 1UE9A 1OOTA 3X20B 1VQ9Q 3JAME 4AFUC 3CC7Q 3CCMQ 4OMPA 1JU5C 2P84A 2WSFE 3PTAA 2AZSA 4L5GA 4M7AC 1PHTA 5GAOm 2BIVA 2ATCB 3GBQA 1V29B 4LDYA 1M2OA 3QG1A 3BDUA 1Q7YU 2MYSA 3I55Q 1WHLA 5KYYB 2C06A 4RTZA 1JRIA 1YJWA 2MPXC 1RLQC 3CCVT 4KGVB 2Y4YA 5GAN4 1OPLA 4C92G 4OMOA 2E64A 3H0FA 1TSFA 2L3RA 1N9RA 3OYYA 4OP0A 3TEEA 2LP5A 3QIIA 3G6EQ 2ED0A 1WXBA 2CKKA 4DA4A 1G2BA 2E12A 2DL8A 3VS1A 1NEGA 2XHCA 4PFPA 4ZN1A 4FYYB 4C0ZA 3OS2A 4C92E 4C8QE 3UA7A 1JB0E 2RK1A 2MWOA 4EPCA 1QVFP 3I56T 2EYQA 2YUPA 5FLXE 3HRSA 1YITT 2AT1B 2Y90A 1YHQT 2ENMA 4QVZA 5KYUB 1NLOC 1AZGB 4HVUA 5L23A 1RI0A 1QCFA 2DVJA 2RK2A 2DIGA 2L3PA 5GANh 4PJOB 2E10A 1GXIE 2K6DA 4BY6B 3M0PA 2GTJA 1O9SA 3CCQT 1PD0A 2WACA 2KYBA 3JB9J 1K0XA 1CKAA 2KVQG 1WPYA 1EX4A 1RAGB 3CPWA 1B07A 1RLPC 2BZXA 4J7FA 5GJVB 3TREA 4C0DC 4N0AA 3CXCP 5HKCA 1YJ9A 3C94A 2MCNA 4M75B 4BUGA 2XG8D 1VQ5A 3A8LB 1A0NB 2RA2A 5IAYA 3A8OB 4IKFA 1W1FA 2CH4W 4E47A 1XTDA 3JCMX 2VV5A 4NS5A 2RD1A 2K3BA 3HFNA 2OJ2A 3OSVA 4AFZC 2D0QB 3M5AA 3HTRA 4X9CA 1OYXA 2VC8A 4PJOD 2CP7A 2M9UA 1K76A 4KUDK 1WI7A 4C0GA 1G83A 2QQBA 1UJ0A 4OMLA 1BCOA 4BDZA 4QT7A 4WF2A 1E7OA 1LOJA 2M0YA 1MGQA 4GBQA 2EFIA 4FL6A 1O75A 2JS0A 4HCZA 5KYUA 3E9GA 2FHDA 2V1RA 3A8MB 1K4US 3VS6A 3EAEA 3LLRA 1HSQA 4OB0B 3OBYA 4M75D 1Y71A 2YT6A 5GAN5 1MHNA 2RNAA 1YIJA 4J7IA 2V8IA 1G5VA 5FU7B 2A37A 2R5MA 2DTOA 2LX9A 4M77D 2ED1A 3KFVA 3OYCA 3VUZA 2E41A 2DERA 2K2MA 3GLXA 1X27A 3OYAA 6AT1B 2HAXA 3QXEB 1HD3A 2K3XA 2HL5C 1M1GA 3BW1A 3CCUA 2EJGA 4XU2A 2P4RA 2K9GA 3RESA 4M75F 3OYFA 1YI2A 4R56A 1SG5A 3IQLA 3CQTA 1KK7A 4QVDA 1R8OB 2DRKA 2EWNA 3MEVA 4UC4A 3CC4Q 4M77F 1OX9A 2K2VA 1Y57A 2D9TA 4MZTA 2LDMA 4M78G 3LGLA 4F04B 1M9SA 3KBGA 4X34A 4J6XA 3VU3C 1VQ4Q 4YTLA 4FIBA 3MKDA 1K73C 3ZEHA 3EG3A 1MUZA 1BB9A 3CCVA 5KH6A 4KT0E 3QBYA 3TSZA 1KG1A 3NPFA 2V8JA 3QJ6A 3I5SA 4AMCA 2D8JA 3VS3A 5DM7R 2KT1A 3PIOA 3OYKA 4HA8A 1GBRA 2RQRA 3EG2A 1NPPA 2L89A 2F5TX 4FT2A 2XDDA 2EBPA 2LJ3A 2XD0A 2J7IA 2AIRB 1GBQA 1IRXA 4CI0C 1G3WA 1WLPB 1Q86R 4JS5A 2ZPEB 1X75C 2GF7A 4JLGA 4O6JA 2XMFA 4M7DB 2EYXA 1AD5A 3OYGA 3DLLA 4CC3A 5GMKi 2LCCA 3CD6T 3JRZA 2B86A 2A28A 3I56A 2NWMA 2X4XA 5GANe 4AG2C 4FSSA 1QWFA 2MIOA 3EFSA 1B34B 5KCHA 4C92F 1TUGB 4C8QF 1YHQA 4KULA 2LVMA 4J9BA 1VQOQ 3CCRT 4KH0B 4RTWA 3CCJT 1T3SA 2DE0X 4LNPA 5LJ5g 3QO3A 4JZ4A 2DNUA 3I5RA
chains in the Genus database with same CATH topology
2OTLA 2WSEE 3N5BB 3FC3A 1LJOA 4OF1A 3A5ZB 4II1A 1Q82U 1KD1U 2RJDA 4PJOA 4ME7A 2XI9A 4E7JA 4LDWA 2XK0A 4QQDA 2LT4A 3L1AA 3MP6A 3KXTA 4EDUA 1P92A 3LH0A 2JUFA 4LDXA 3JCMd 2QTXA 5LL6S 1VQ9T 2DZ9A 4OB3B 3SWNB 2P4TA 2O4XB 4M7AA 3CC7T 3CCMT 3LGFA 5LJ5d 4IUTA 3X25B 2DTHA 2KMTA 4B9XA 4EMKA 1I8FA 2OAUA 1N9SA 5KE3A 4KBMB 1JBMA 1VQMA 1U8RA 3C4SA 2DO3A 5CVIA 5LJ3h 4C5HA 3SB2A 4M75A 4F7UF 4XTVA 1SSFA 2EQUA 2HQXA 4M78F 3OA6A 3JCMJ 3BY7A 4NL3A 1Q82C 3FIFA 1KD1C 4M7DA 3VYHB 1VQKA 4JRQA 1D3BB 3HRTA 5I2MA 4C5GA 3GP8A 3S6WA 2R57A 3I55T 1K73U 1BI3A 4NOYA 3A8HB 4JLIA 3URGA 3X28B 4E7LA 1VQ6T 2RHZA 4M77A 1WGSA 3UDCA 2RM4A 2YLBA 3MCAB 5I2SA 1KQSA 1VQLA 2RI2A 1TH7A 2EQKA 3ZBDA 2P0KA 4LDUA 1UGSB 5J39A 1WJSA 2FL7A 3T9NA 4C92B 3CXCS 4C0DB 4C8QB 4DOVA 3L2ZA 3CCET 2QQ9A 1OZ3A 3CCRA 4JJNK 5LJ3g 3CCJA 3VJPA 1BI1A 5C0MA 3C12A 1S72T 1YJ9T 4BACA 3G6ET 2E1HA 3CMAT 1VQ5T 5CO7A 4XU0A 4PJOG 2GCXA 2QDYB 1VQOA 2D6FA 4Z02A 2DEQA 4FM4B 1KHCA 2LQKA 2ZCFB 3HSBA 3M59A 2YHTA 2VXEA 2EQMA 1YJNT 1UGRB 4A4KA 1X6OA 3CPFA 1QVPA 5CQXA 3OYIA 2DZCA 3PIPA 5GANf 4JRPA 3OSSC 4IUUA 1XQHA 3G4SA 4M7AG 3G71T 4BI8B 1RL2A 3M56A 5IN1A 3QHSA 1WNLA 1BIAA 2QI2A 3FLGA 3PT9A 4LDVA 5GAMf 1UB4A 1XOVA 3CCMA 1W2BA 1Q81U 3VKIA 3GF5A 2PUOB 1FXXA 3OYDA 2DXUA 2O4XA 3V8KA 3OS1A 2HNIA 3S3NA 4OGEA 3UPUA 3CBPA 3GIBA 4M75G 3OBWA 4C92D 4C8QD 2X4WA 4M7DG 2RHXA 4OVAA 2MI6A 2HBPA 3BFMA 3PFSA 4RCCA 3G7ZA 3OMCA 4F7UB 1ZHIA 1VQ7T 3FDRA 3JB9H 1WQ7A 4M78B 2RH2A 3JCMh 4N4GA 5GMKj 4M77G 4LD6A 1G3YA 2A3LA 3PGGA 4JRKA 1W4SA 3L2QA 1D3BA 3CEYA 3P8BB 3M9QA 1VQ6A 2BKDN 1YIJT 2QEXT 2XDPA 2E6ZA 3MEUA 4FU6A 4MZMA 4PNOA 1Q81C 4A53A 2I2LA 3OS5A 4IUPA 2DD5A 4J5YA 1M1KU 4N4HA 3CMET 1DJ7B 4M75E 1IZ6A 5D6YA 5FRNA 3HP9A 4HCCA 4QQ6A 4JUVA 3SFMA 3CCEA 3A8GB 3QYGB 4ELZC 4QVCA 2DTIA 4FT4A 4C92A 4M7DE 3HFOA 1M5Q1 3LYIA 3MHXA 3TCJA 5GAMe 3JCMW 2QXFA 2KQWA 5GAOr 4VUBA 1VQ8A 3JB9G 2OTJT 1QP3A 1Y96B 3G6EA 3CCLT 3TU4K 3DLMA 2RI3A 4M77E 3JCMg 5GAN6 5GAN2 2DJZA 2K4YA 2E5QA 2R5AA 4ZGDB 1VQPT 1UGQB 4QW2A 4HKEA 5FROA 4BB7A 1M90U 4BDYA 1M4ZA 1JJ2S 1QVFA 3QUIA 1YJNA 4A4EA 2BUDA 4M78D 4GLKA 5CK9A 1YI2T 2PVGB 3X20B 4PLLA 5GAOl 3G71A 1M1KC 5HK3A 2XU8A 5GMKh 2PQWA 2RJEA 2KDSA 4PJOC 4OGCA 3JAME 4BY6C 3L2UA 2HD0A 2RHYA 1Y07A 3M4GA 2NLUA 4GY5A 2CZ1B 5CKDA 5LJ5e 2WSFE 4EMHA 3PTAA 2HQEA 4IURA 1VQNT 2F5KA 1Y7XA 4L5GA 4M7AC 5GAOm 4RKUE 2BIVA 2RI5A 3FRNA 1V29B 4LDYA 4EMKC 2LNVA 2DXBA 3QYHB 4IUQA 5FU6C 3QG1A 3BDUA 1M90C 3JCMc 2V8KA 4HCBA 2ZPGB 1Q7YU 3WXMB 1M1FA 3X26B 3L42A 1OI1A 4M75C 1QVGS 2PU9B 3CCST 3ZFJA 3PMIA 3QZ5B 2C06A 4J6YA 5LJ3f 4J83A 5L8RE 2K5LA 3AHUA 1JRIA 4OB1B 1YJWA 4PKCC 4PJOF 3JB9I 3CCVT 2R58A 3CD6A 2Y4YA 1UGPB 5GAN4 2EIFA 3MP8A 3CMEA 4C92G 3NTHA 5I21A 5CKHA 2E64A 3CXCA 3PMTA 3VUBA 1I4K1 3RMQA 3INZA 1QP2A 2DK3A 3LX7A 2L3RA 1N9RA 2EJFA 2ZPBB 3OYYA 1I5LA 2DXCA 3CBOA 3QZ9B 4OP0A 2RB6A 4M7AF 3V7SA 3WVDB 2JOYA 2VYTA 4Q5WA 5CQYA 3TEEA 1YCYA 2XKOC 3QIIA 3V8LA 3CC2T 2GQVA 3QKJA 1B34A 2CKKA 1Q7YC 4DA4A 2E12A 3OW2A 5GAN8 1VQPA 2EKOA 2VGMA 4NL2A 3GNGA 1HXDA 2XHCA 4ZGEB 4ZN1A 2CZ6B 4E7HA 4C0ZA 4BD3A 3OS2A 4C92E 3E1SA 4C8QE 1N6AA 2DAQA 2QQAA 3M55A 2E6NA 3LWHA 1JB0E 5GAOn 4ZTFA 2RK1A 3BDLA 5LJ3e 4IUVA 2MMPA 2MWOA 3JCMb 4PJOE 1IREB 4EPCA 4MDWA 5FU7C 1K8AC 3LWIA 3I56T 1BI0A 1VQ9A 1H641 3DB3A 2EYQA 3JCMQ 1VUBA 2XIDA 1VIEA 3HRSA 5FLXE 1KQSS 3META 3CC7A 1NJIU 1UEBA 2PUKB 4A4GA 3OS0A 5J26A 1YITT 3R6OA 2Y90A 2RHUA 3SWNA 5KCOA 2L5QA 3GOXA 2LTOA 3J7AF 3NTKA 2Y4XA 2QA4T 1PSFA 2XICA 4TVRA 1YHQT 4QVZA 4B9WA 3H8ZA 3OYHA 3VV0A 1RI0A 4FSXA 1NZ9A 2ZPIB 3P8HA 1OZ2A 2RK2A 2DIGA 5GANh 5A2QE 4X9DA 5HK0A 2LC4A 1VQ4T 4PJOB 2E10A 3I55A 1GXIE 4OMFB 4BY6B 4R55A 2GFUA 1AHJB 1BIBA 4RMOA 1O9SA 3CCQT 1YBYA 2H3JA 2B8AA 2WACA 4HT9A 5A0DA 3DKMA 3JB9J 3WVEB 4F7UE 3OYBA 1NJIC 5LJ5f 4M78E 4Y91A 2QQRA 4RG2A 2KVQG 1WPYA 4M7AB 4ELYC 3L2WA 4V2SA 1BYMA 5GMKl 3H6ZA 4ZTJA 4A4FA 1W2BS 3CPWA 4OB2B 3RMSA 5FU6B 4C0DC 4J7FA 3TREA 1N8RC 4N0AA 5HKCA 1N27A 4C8QA 3PNWC 1YJ9A 1S72A 3C95A 2YRVA 2MWPA 2E65A 3RKXA 2K3YA 3C94A 2P0QA 4M75B 1VIFA 4BUGA 2XG8D 5GANg 1PSEA 3A8LB 3CMAA 5GAN3 2RA2A 5IAYA 1VQ5A 3A8OB 4IKFA 3F70A 2LQ8A 3CCUT 3QSUA 5GMKm 5GAMg 2IG0A 4E47A 1XTDA 3JCMX 2VV5A 4NS5A 3HPWA 3V7CA 2RD1A 1VQKT 2KAFA 3HFNA 5CAIA 2CYZB 3OSVA 4HT8A 2D0QB 2JZ2A 5AYFA 3M5AA 4EMGA 4X9CA 3J81E 1OYXA 2VC8A 4PJOD 3HKSA 2M9UA 5GAOq 2DD4A 4O5VA 3M57A 3JCMe 4BE1A 5DLQE 4C0GA 2X4JA 4KUDK 1VQLT 3NFCA 1Q86U 1YITA 2QQBA 1NE8A 5HY6A 4BDZA 2X4YA 4MMKA 5GANd 2E70A 2KY9A 4MMLA 4WF2A 5DY9A 3NTIA 4M7AD 2PVOB 3P8DA 1LOJA 3RKYA 2FYKA 1MGQA 5GAMd 2JTMA 2EFIA 2EJ9A 1O75A 2L8DA 4FL6A 4HCZA 4C0FA 4DQ2A 4ATOA 4XTUA 3E9GA 1VQ7A 2FHDA 3A8MB 4PL6A 3UWNA 1KHIA 3EAEA 2AHJB 4BE0A 3LLRA 4A54A 2GFAA 4OB0B 3OBYA 4M75D 1G3SA 1Y71A 4F7UA 4M78A 4CRIA 1VQOT 5GAN5 1MHNA 4L59A 1YIJA 3M53A 4J7IA 2QEXA 2V8IA 3CCQA 3S3OA 1QVFS 4M7DD 4DOWA 1G5VA 1QW1A 4L6V5 5FU7B 2R5MA 3JCMV 4M7DC 2A7YA 3V7RA 3OYEA 1Q86C 2DTOA 2JTFA 2DXTA 2P0PA 3RIRA 4C5IA 2LX9A 4M77D 3DB4A 3G4ST 2K57A 4XTZA 5J3BA 2EAYA 4C8QG 2K5IA 4M77C 2M0OA 1WQWA 3OYCA 4RG8A 4XTXA 3VUZA 2E41A 1ZQ1A 3GLXA 3KUFA 4XU1A 5GMKe 4LD9K 2OTJA 4JDSA 4J8OA 1K8AU 2JVVA 2JNGA 4QQGA 2RO0A 3OYAA 1WJRA 3CCLA 3HL8A 1KQ1A 3OB9A 2HAXA 2K5FA 3QXEB 2CZ0B 2K3XA 1M1GA 3BW1A 3CCUA 1Y96A 2EJGA 4XU2A 2FB7A 5CKEA 4PLIA 1K9MU 1FX7A 2LCLA 2DKGA 3QDRB 3UT1A 5A0GA 3L2VA 5GANj 3JSCA 2ZPHB 4BE2A 3E19A 3RESA 5KE2A 4M75F 3MP1A 3OYFA 1I81A 3JB9D 1YI2A 3X24B 3MO8A 5GAMj 4R56A 2YLCA 4M7DF 4XK8E 3HHTB 3V8JA 1FWZA 2ZPFB 2IVWA 4MDXA 3MEWA 3Q1JA 1R8OB 4UC4A 2EWNA 3MEVA 3RUXA 4QVDA 3J80E 4M77F 5C6SA 3FJPA 4P5NA 3OYJA 2K2VA 1VQNA 3OQ5A 4E7IA 2LRQA 1BI2A 2D9TA 4MZTA 4Y28E 3GNFB 3SWNC 4N4IA 3M54A 4F7UG 2LDMA 4D6WA 3CC4T 1K9MC 1VQ8T 4M78G 3LGLA 1M9SA 5CR2A 3KBGA 4X34A 4J6XA 3VU3C 4XTWA 5A0LA 2RHIA 4YTLA 3OW2S 5LJ5j 3M4YA 4FIBA 1N8RU 3CCSA 3JCMP 1K73C 3ZEHA 3VYGA 2CS7A 5CKFA 2VGNA 3JB9F 2MF2A 3LW5E 2XDBA 3CCVA 5KH6A 3GPLA 1BKBA 4C5EA 4KT0E 3QBYA 4ZN3A 2EQJA 1KG1A 2V8JA 5EG2A 3QJ6A 2VXFA 3HRUA 3JCMf 5GAMh 2OTLT 5LJ3d 3ASKA 2QQSA 3OY9A 2PVDB 1G3TA 5D6WA 5DM7R 5GAOp 3PIOA 4HA8A 3OYKA 4BI4A 4XU3A 4JS4A 3OYMA 5IT9E 2CGHA 1NPPA 2L89A 2F5TX 3CBMA 1U1TA 4RCBA 5CCAA 4FT2A 5D6XA 2XDDA 2XD0A 3CC2A 1EIFA 2DVEA 4XQ3A 2WSCE 2DIQA 2KK4A 3OYNA 2O01E 1KC8U 1KQ2A 1NPRA 3S3MA 1LNXA 4CI0C 4C92C 4EMKB 4N0AC 2ZZDA 3M58A 4C8QC 4ZGJB 1G3WA 4E7KA 2JN0A 3RKWA 1JJ2A 4JS5A 4A4HA 2ZPEB 2RJFA 2RJCA 1WJQA 1X75C 2F69A 2GF7A 4KUIA 1VQMT 1X01A 4JLGA 4O6JA 4M7AE 2X35A 5M9OA 1H3ZA 3L2RA 3QJYA 5CKBA 4M7DB 2KSSA 2DPPB 2FVUA 4MZPA 5LJ5h 3OYGA 5DLOA 3FEOA 1XNIA 3DLLA 2G3RA 3ME9A 3SDZA 5GMKi 3OYLA 1YJWT 3ER0A 2LCCA 2CZ7B 3OMGA 3SD4A 3JRZA 2M1HA 3QPHA 3CD6T 4XTYA 4M77B 3RERA 3I56A 2VUBA 2X4XA 2ZGWA 5GANe 2LT1A 1ZBXA 2MAMA 4JRIA 3O8VA 1KC8C 1M8VA 3EFSA 5GAN7 3MEAA 3CC4A 1B34B 5KCHA 4C92F 4XAXB 2QA4A 5CIUA 4C8QF 5LJ3j 1YHQA 4KULA 3EFRA 3CPWS 1HK9A 2M16A 2LVMA 4BI3A 3FB9A 1QVGA 3CCRT 5FRMA 1U1SA 3CCJT 5LJ5g 4J6WA 3QO3A 3E9FA 1VQ4A 4M78C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWN A;  2DKG A;  1LJO A;  5GAN j;  4M75 E;  4PJO A;  3RES A;  4JUV A;  4M75 F;  3JB9 D;  1I81 A;  4QVC A;  2DTI A;  4C92 A;  3L1A A;  5GAM j;  4M7D E;  2YLC A;  3HFO A;  1M5Q 1;  5GAM e;  3JCM W;  3JCM d;  2QTX A;  5GAO r;  4M7D F;  3JB9 G;  3V8J A;  1Y96 B;  2DZ9 A;  5GAN h;  4X9D A;  3SWN B;  3JCM g;  4M77 E;  5GAN 6;  5GAN 2;  4QVD A;  3RUX A;  4M7A A;  2EWN A;  2DJZ A;  4PJO B;  2E10 A;  4M77 F;  5LJ5 d;  3FJP A;  2DTH A;  4EMK A;  1I8F A;  1BIB A;  1N9S A;  3QUI A;  1JBM A;  4M78 D;  3JB9 J;  4F7U E;  5LJ3 h;  5LJ5 f;  4M78 E;  3SB2 A;  3SWN C;  4M75 A;  4Y91 A;  4F7U F;  4F7U G;  5GMK h;  4XTV A;  5GAO l;  1WPY A;  4M78 F;  4M7A B;  4M78 G;  3JCM J;  4PJO C;  5GMK l;  4V2S A;  3BY7 A;  4NL3 A;  3FIF A;  4M7D A;  3VU3 C;  4J6X A;  4XTW A;  1D3B B;  3M4G A;  5LJ5 j;  4N0A A;  4C8Q A;  3JCM P;  5LJ5 e;  4NOY A;  4JLI A;  3RKX A;  2E65 A;  3JB9 F;  4EMH A;  4M77 A;  4M75 B;  2RM4 A;  2YLB A;  5GAN g;  4M7A C;  1TH7 A;  2RA2 A;  5GAN 3;  5GAO m;  3QSU A;  5GMK m;  5GAM g;  4EMK C;  3JCM f;  2VXF A;  5GAM h;  3JCM X;  3BDU A;  5LJ3 d;  4C92 B;  4C8Q B;  3JCM c;  3V7C A;  2RD1 A;  3L2Z A;  3HFN A;  4HA8 A;  5CAI A;  4XU3 A;  5GAO p;  5LJ3 g;  2CGH A;  4HT8 A;  4EMG A;  4M75 C;  4X9C A;  4PJO D;  2VC8 A;  1U1T A;  4J6Y A;  4RCB A;  5LJ3 f;  5GAO q;  3JCM e;  4PJO E;  2DVE A;  4XQ3 A;  1KQ2 A;  2E1H A;  4M78 C;  1JRI A;  3AHU A;  4PJO F;  4XU0 A;  1LNX A;  4PJO G;  3JB9 I;  4C92 C;  4EMK B;  4N0A C;  2FB7 A;  4MMK A;  4C8Q C;  5GAN 4;  2DEQ A;  4C92 G;  5GAN d;  5I21 A;  2JN0 A;  2E64 A;  3RKW A;  4MML A;  4WF2 A;  5DY9 A;  3HSB A;  4M7A D;  1I4K 1;  2YHT A;  1LOJ A;  2VXE A;  3INZ A;  3RKY A;  2FYK A;  1MGQ A;  5GAM d;  1N9R A;  2EJF A;  1X01 A;  1I5L A;  2EJ9 A;  4M7A E;  4DQ2 A;  2DZC A;  4XTU A;  5GAN f;  4OP0 A;  4M7A G;  2RB6 A;  4M7A F;  3V7S A;  4M7D B;  5LJ5 h;  3V8L A;  3QHS A;  1YCY A;  1WNL A;  1BIA A;  4A54 A;  5GAM f;  5GMK i;  1B34 A;  4F7U A;  4M75 D;  4M78 A;  5GAN 8;  2DXU A;  5GAN 5;  4XTY A;  4M77 B;  3V8K A;  3RER A;  2HNI A;  4NL2 A;  4M7D D;  2ZGW A;  5GAN e;  3GIB A;  4M75 G;  4JRI A;  3JCM V;  4C92 D;  1HXD A;  4M7D C;  1M8V A;  3V7R A;  4C8Q D;  2DTO A;  2DXT A;  3EFS A;  4C92 E;  5GAN 7;  4M7D G;  3RIR A;  3BFM A;  4RCC A;  4C8Q E;  1B34 B;  4M77 D;  4C92 F;  4F7U B;  2K57 A;  3JB9 H;  4XTZ A;  1WQ7 A;  2EAY A;  4M78 B;  4C8Q G;  4C8Q F;  5LJ3 j;  3EFR A;  4M77 C;  3JCM h;  5GAO n;  1WQW A;  5LJ3 e;  1HK9 A;  5GMK j;  3JCM b;  4XTX A;  2E41 A;  4M77 G;  3FB9 A;  3PGG A;  4XU1 A;  4JRK A;  5GMK e;  1D3B A;  1U1S A;  1H64 1;  5LJ5 g;  3JCM Q;  4J6W A;  1KQ1 A;  3QO3 A;  4PNO A;  4A53 A;  2I2L A;  3BW1 A;  1Y96 A;  2EJG A;  4J5Y A;  4XU2 A;  2Y90 A;  4HT9 A; 
#chains in the Genus database with same CATH topology
 3N5B B;  3FC3 A;  3G4S Q;  2JMC A;  4II1 A;  1GFC A;  4E7J A;  4QQD A;  3L1A A;  3KXT A;  1SHG A;  1P92 A;  2QTX A;  2DX1 A;  1RAE B;  1VQ9 T;  2O4X B;  4M7A A;  3CC7 T;  3CCM T;  2X51 A;  3X25 B;  4B9X A;  2KMT A;  2OAU A;  4DBF A;  4CC7 A;  2DO3 A;  1C1A A;  5LJ3 h;  3REA B;  3SB2 A;  2KXC A;  2HQX A;  2IPO B;  2NUP A;  1Q82 C;  1KD1 C;  4M7D A;  1D3B B;  5I2M A;  4C5G A;  3GP8 A;  4PFZ A;  3I55 T;  1JJ2 P;  1K73 U;  2FZC B;  1BI3 A;  3URG A;  2RHZ A;  2H8H A;  3CCE Q;  2YLB A;  4M4Z A;  3ZBD A;  8AT1 B;  1VQ8 Q;  1RI9 A;  1ZA1 B;  1UHC A;  2HSP A;  4C0D B;  2Z0W A;  4E7Z A;  1BI1 A;  1YP5 A;  5GJW B;  3G6E T;  2O9V A;  3G71 Q;  3VS2 A;  2DEQ A;  1KC8 R;  3M59 A;  3CPF A;  3OYI A;  3EG0 A;  1C0M A;  4F14 A;  4BI8 B;  1AWW A;  1BIA A;  2QI2 A;  1WIE A;  3PT9 A;  3VKI A;  2PUO B;  3OYD A;  1UJY A;  2O4X A;  1GCP A;  3OS1 A;  3S3N A;  3VS4 A;  4ESR A;  1X2Q A;  2LJ1 A;  2RQT A;  5I22 A;  1LVK A;  1TTH B;  2MI6 A;  2CP2 A;  1TUC A;  1R0B G;  3FDR A;  4M78 B;  1G3Y A;  1ARK A;  1D3B A;  1E6H A;  2XDP A;  2C0O A;  4IUP A;  1X69 A;  4N4H A;  5FRN A;  4HCC A;  4Z89 A;  4RUG A;  3A8G B;  1RAB B;  3HFO A;  1M5Q 1;  3LYI A;  1QP3 A;  1Y96 B;  1KQS P;  2IIM A;  1PM3 A;  2VB6 A;  4JZ3 A;  5GAN 6;  4ZGD B;  1C6V X;  5FRO A;  1VYU A;  4A4E A;  1WDX A;  2DRM A;  4M78 D;  5CK9 A;  2CT4 A;  1M1K C;  4PJO C;  4BY6 C;  2KRS A;  3L2U A;  2HD0 A;  2RHY A;  1Y07 A;  3I35 A;  4RTT A;  3EGU A;  4IUR A;  3RBB B;  1Y7X A;  4J9D A;  2DYI A;  1MV3 A;  2LNV A;  4ZNX A;  1W2B P;  3REB B;  2FG0 A;  1M90 C;  3JCM c;  3WXM B;  1QVG S;  4M75 C;  1QWE A;  4J83 A;  4PKC C;  2R58 A;  3CD6 A;  2YUN A;  3CME A;  3MP8 A;  2J6K A;  1KSW A;  3LX7 A;  2EJF A;  1S72 Q;  2DXC A;  4K11 A;  2JOY A;  5CQY A;  2XKO C;  5AT1 B;  3CMA Q;  3QKJ A;  4KGZ B;  1Q7Y C;  1QKX A;  2AZV A;  1OV3 A;  2EVR A;  1Q81 R;  3GNG A;  1M3B A;  1G8X A;  3E1S A;  1N6A A;  3M55 A;  3LWH A;  3BDL A;  5LJ3 e;  5FU7 C;  1K8A C;  1VQ9 A;  3JCM Q;  1T3L A;  2XID A;  3H0I A;  2QAZ A;  2LQW A;  3CC7 A;  1NJI U;  4A4G A;  5KCO A;  3GOX A;  2LTO A;  2NYS A;  2Y4X A;  4TVR A;  4B9W A;  4FCY A;  4FSX A;  1NZ9 A;  2ZPI B;  2HBW A;  4FW1 A;  3P8H A;  1OZ2 A;  2QEX Q;  1RAA B;  4J9H A;  1VQ4 T;  2HKN A;  1WXT A;  3I55 A;  4OMF B;  4R55 A;  2H3J A;  3DKM A;  3OYB A;  2VAS A;  4V2S A;  1OPK A;  1BYM A;  4ZTJ A;  2DEU A;  4A4F A;  2CP6 A;  1RAC B;  2KI7 A;  1N8R C;  2QGF B;  1R0C B;  3PNW C;  4DBQ A;  1NBE B;  2MWP A;  3EGD A;  1FMV A;  1YN8 A;  1PSE A;  5GAN 3;  1AZE A;  4B6M A;  1NLP C;  3CCU T;  3QSU A;  2IG0 A;  1WYX A;  2J05 A;  2KAF A;  5CAI A;  4HT8 A;  5AYF A;  3HKS A;  2DD4 A;  3M57 A;  3NFC A;  1IGU A;  5HY6 A;  4LN2 A;  4MML A;  5DY9 A;  3NTI A;  2ZAE A;  3RKY A;  2F2W A;  2FYK A;  4C0F A;  4DQ2 A;  3CCS Q;  4F16 A;  2LMJ A;  4PL6 A;  3UWN A;  2AHJ B;  4A54 A;  4F7U A;  4FYX B;  4CRI A;  1VQO T;  3TQ7 P;  3MPU B;  2J6F A;  3S3O A;  3H9N A;  1QW1 A;  4M7D C;  2A7Y A;  3V7R A;  3OYE A;  3G4S T;  2K57 A;  2EAY A;  4C8Q G;  1GRI A;  1WX6 A;  2M0O A;  4XTX A;  4XU1 A;  4LD9 K;  4JDS A;  1K8A U;  2JVV A;  2JNG A;  1VA7 A;  3M0R A;  2RO0 A;  3HL8 A;  2JJ9 A;  1UDL A;  2FB7 A;  1K9M U;  3EG9 B;  4PLI A;  5A0G A;  4HCK A;  3L2V A;  2ZPH B;  5IHI A;  3CPW P;  2KE9 A;  3E19 A;  7AT1 B;  3MP1 A;  1I81 A;  2YLC A;  3NHN A;  3HHT B;  1X6B A;  3V8J A;  1I07 A;  1TXQ A;  4PJM A;  3Q1J A;  1WZO A;  1T0H A;  3OYJ A;  4DEX A;  3M0Q A;  3OQ5 A;  2LRQ A;  1YWO A;  3M54 A;  1VQ8 T;  2KT8 A;  1UHF A;  2FZK B;  2YDL A;  5CR2 A;  2ABL A;  5FWB A;  5A0L A;  2QTV A;  3OW2 S;  1N8R U;  2GQI A;  5CKF A;  2VGN A;  5KYY A;  5IH2 A;  2A36 A;  3NMZ C;  2EQJ A;  3JCM f;  5GAM h;  3SEM A;  3ASK A;  2D8H A;  1G3T A;  5D6W A;  1SRL A;  4BI4 A;  3OYM A;  5IT9 E;  2DM1 A;  2WSC E;  2KK4 A;  2O01 E;  1LNX A;  2NUT B;  2ZZD A;  3M58 A;  4Z88 A;  4ZGJ B;  4D8D A;  3EG9 A;  4A4H A;  1WJQ A;  2BZY A;  3TVT A;  2JM9 A;  1X01 A;  4M7A E;  2O88 A;  3M0T A;  1H3Z A;  3QJY A;  2YXY A;  2FVU A;  2MK5 A;  3VS0 A;  3FEO A;  1XNI A;  2G3R A;  1SF9 A;  3SDZ A;  3OMG A;  2KBT A;  1RAH B;  2V26 A;  4M77 B;  3RER A;  2VUB A;  1S1N A;  2LT1 A;  2JTE A;  1ZBX A;  3VRZ A;  3O8V A;  2HZY A;  4J9E A;  3CC4 A;  1UTI A;  4XAX B;  2RQU A;  5CIU A;  5LJ3 j;  1TS9 A;  2M16 A;  2CP3 A;  3FB9 A;  1QVG A;  1JXM A;  2J06 A;  1WA7 A;  1ZSZ B;  1QCN A;  3E9F A;  1VQ4 A;  4M78 C;  2OTL A;  3H41 A;  4PJO A;  1PRM C;  1MMG A;  5LL6 S;  3SWN B;  2KRN A;  1K73 R;  2HDA A;  3LGF A;  5LJ5 d;  4IUT A;  2FZG B;  2COZ A;  1N9S A;  2NUT A;  1VQM A;  2FPD A;  5CVI A;  2OAW A;  4C5H A;  4M75 A;  1ABQ A;  3BY7 A;  2DMO A;  2JS2 A;  4AT1 B;  2QK0 A;  1Q95 G;  3S6W A;  3X28 B;  4M77 A;  3UDC A;  1TH7 A;  4E6R A;  2P0K A;  4LDU A;  2BTT A;  5J39 A;  2FL7 A;  4C92 B;  1Y0M A;  4C8Q B;  3QWY A;  4JJN K;  2V1Q A;  4KH1 B;  1S72 T;  1YJN Q;  1D1B A;  3CMA T;  4XU0 A;  2QDY B;  1VQO A;  2OTL Q;  2HMA A;  2YWW A;  1KHC A;  2ZCF B;  4Y92 A;  1YNZ A;  2YHT A;  2DLP A;  2EQM A;  1X6O A;  4RTU A;  5CQX A;  2DZC A;  2PNI A;  3G4S A;  4J9F A;  1RL2 A;  3M56 A;  4LDV A;  1UB4 A;  3GF5 A;  1FXX A;  4CC2 A;  3V8K A;  5EC7 A;  4PJL A;  4C92 D;  1VQM Q;  4C8Q D;  2H3E B;  2HBP A;  3BFM A;  3PFS A;  4RCC A;  2GNC A;  2RH2 A;  3JCM h;  4N4G A;  4LD6 A;  3EGX B;  2A3L A;  3PGG A;  4JRK A;  2EQI A;  3P8B B;  1SPK A;  3M0S A;  2MOX A;  2QEX T;  2L3S A;  4E7S A;  1WHH A;  4J5Y A;  2CUB A;  3CME T;  1DJ7 B;  3CCE A;  4ZTF A;  3QYG B;  4ELZ C;  4QVC A;  1YFN A;  2DTI A;  4C92 A;  5GAM e;  1Q82 R;  3TCJ A;  1KD1 R;  1VQ8 A;  3JB9 G;  3DLM A;  1X2K A;  2RI3 A;  2K4Y A;  4OMQ A;  1J3T A;  1UGQ B;  4HKE A;  2HEQ A;  4KGX B;  3VS5 A;  1H92 A;  2PVG B;  1KFZ A;  3RR6 A;  1X43 A;  2KRO A;  4PLL A;  3G71 A;  2XU8 A;  2PQW A;  2RJE A;  2KDS A;  4OGC A;  5HCK A;  2D1X A;  1FMK A;  3M4G A;  2NLU A;  4GY5 A;  1MV0 B;  5CKD A;  2F5K A;  4OMM A;  2RI5 A;  3FRN A;  2DXB A;  3QYH B;  4IUQ A;  5KYN A;  1PG5 B;  2DET A;  4R0K A;  2ZPG B;  1JQQ A;  1I0C A;  1M1F A;  4ORZ A;  3CCS T;  3EGX A;  5L8R E;  3AHU A;  4OB1 B;  3JB9 I;  9ATC B;  5CKH A;  3VUB A;  1I4K 1;  3INZ A;  1QP2 A;  1I5L A;  3O5Z A;  2ZPB B;  3CBO A;  4M7A F;  3V7S A;  2VYT A;  3V8L A;  2GQV A;  3TSW A;  1B34 A;  3OW2 A;  5GAN 8;  1VQP A;  2EKO A;  2E5K A;  2VGM A;  4NL2 A;  5KYW B;  1MND A;  4ZGE B;  2CZ6 B;  4E7H A;  2DAQ A;  4IUV A;  1YIT Q;  3JCM b;  1H8K A;  3LWI A;  1BI0 A;  2M51 A;  1H64 1;  1VUB A;  1ZA2 B;  3MET A;  4JJB A;  2ROT A;  1VQ7 Q;  2RHU A;  2L5Q A;  3NTK A;  1PSF A;  1MMN A;  1BU1 A;  3EG1 A;  3H8Z A;  1M1K R;  3OYH A;  3A98 A;  3VV0 A;  2PZ1 A;  1IB8 A;  2VWF A;  5A2Q E;  4X9D A;  1UGV A;  1ZUY A;  5HK0 A;  2LC4 A;  2VKN A;  1NYF A;  2QAS A;  2GFU A;  1AHJ B;  1PNJ A;  4RMO A;  1YBY A;  1V76 A;  4F7U E;  1AEY A;  1NJI C;  5LJ5 f;  1M90 R;  2OTJ Q;  1VYV A;  2QQR A;  3CCL Q;  3L2W A;  4IIO A;  5GMK l;  1M27 C;  1RAF B;  1X6G A;  4OB2 B;  3RMS A;  5FU6 B;  3EH2 A;  4HXJ A;  1S72 A;  1VQP Q;  1U06 A;  3C95 A;  3ULR B;  3RKX A;  2E65 A;  2QYZ A;  2P0Q A;  1VIF A;  5GAN g;  3CMA A;  1GL5 A;  4FYV B;  3F70 A;  2LQ8 A;  2EGC A;  5GAM g;  1ZUU A;  4EIK A;  4EMG A;  3J81 E;  2EYZ A;  4AFS C;  5GAO q;  4O5V A;  3JCM e;  1Q7Y R;  3JV3 A;  1VQN Q;  1Q86 U;  1NE8 A;  4MMK A;  1K0S A;  1AWX A;  2E70 A;  2KY9 A;  2COY A;  2PVO B;  3P8D A;  4ATO A;  3U23 A;  1KHI A;  4BE0 A;  1ZX6 A;  1K8A R;  2GFA A;  1G3S A;  4PFO A;  4M78 A;  4L59 A;  2QEX A;  2LJ0 A;  1QVF S;  4DOW A;  3A1P A;  4IIM A;  1PWT A;  2CSI A;  2FPE A;  4C5I A;  5J3B A;  2W0Z A;  3CC2 Q;  3D7S B;  2O2O A;  2K5I A;  4M77 C;  4RG8 A;  3KUF A;  4J8O A;  1WJR A;  1OU8 A;  2CP0 A;  1Y96 A;  3UF4 A;  2FO0 A;  4HT9 A;  2LCL A;  2DKG A;  2YUO A;  5GAN j;  1NEB A;  5KE2 A;  2DBM A;  3JB9 D;  1MNE A;  1UUE A;  2AKK A;  3X24 B;  1WHJ A;  3MO8 A;  5GAM j;  1ZSZ C;  1QLY A;  1M2V B;  2DL3 A;  1FWZ A;  2ZPF B;  1N8R R;  1TG0 A;  3MEW A;  1B7T A;  3FJP A;  2QA4 Q;  3BE3 A;  1QQJ A;  2BZ8 A;  3GNF B;  3SWN C;  4N4I A;  1K9M C;  4D6W A;  3CC4 T;  5KYX B;  2RHI A;  4RTV A;  2L2P A;  3CCS A;  3VYG A;  1N5Z A;  3LH5 A;  3JB9 F;  2MF2 A;  2LX7 A;  1AOJ A;  4C5E A;  2CDT A;  1V1C A;  2F1L A;  2JW4 A;  2VXF A;  3HRU A;  2OTL T;  5LJ3 d;  3OY9 A;  4AG1 C;  4XU3 A;  3PVL A;  3CBM A;  1U1T A;  1UG1 A;  1WXU A;  2EYW A;  5D6X A;  4PJO E;  1SSH A;  2DVE A;  2SEM A;  2HQH A;  4XQ3 A;  1KC8 U;  1NPR A;  3S3M A;  4C92 C;  4C8Q C;  2RMO A;  3RKW A;  4PK4 A;  2RJF A;  1VQK Q;  4KUI A;  1VQM T;  2HKQ B;  3L2R A;  5CKB A;  2DPP B;  4MZP A;  5LJ5 h;  1VQL Q;  3ER0 A;  2CUD A;  3SD4 A;  1IGQ A;  3QPH A;  1UFF A;  2ZGW A;  5IXF A;  2MAM A;  4JRI A;  1M8V A;  2RQW A;  4D8K A;  2DL5 A;  5GAN 7;  4JJC A;  2SRC A;  2OX7 A;  2EYY A;  1R77 A;  2RPN A;  2I0N A;  2CH4 A;  1B3Q A;  2DL7 A;  3I9Q A;  1LJO A;  4HVW A;  1PCX A;  3A5Z B;  3EHQ A;  5IHK A;  2XK0 A;  1H3H A;  3MP6 A;  4EDU A;  2RN8 A;  3LH0 A;  4LDX A;  1MMA A;  3NGP A;  4OB3 B;  1PD1 A;  4Z8A A;  2DTH A;  5IXB A;  1ABO A;  1YWP A;  1U8R A;  2EPD A;  4QKU A;  2AK5 A;  4F7U F;  1QMC A;  1SSF A;  3JCM J;  2LQN A;  4JRQ A;  3HRT A;  2CT3 A;  2R57 A;  3H0H A;  1JO8 A;  4E7L A;  2JT4 A;  3A8H B;  3MCA B;  1U3O A;  5I2S A;  2FEI A;  8ATC B;  2A0F B;  1WJS A;  4DOV A;  3L2Z A;  3CCE T;  1OZ3 A;  2GBQ A;  5LJ3 g;  5C0M A;  3C12 A;  4BAC A;  1HJD A;  2DBK A;  1OEB A;  1I5O B;  2GCX A;  4J9I A;  2D6F A;  4Z02 A;  1VYT A;  4FM4 B;  2LQK A;  2QDL A;  2VXE A;  1QVG P;  1QVP A;  3OSS C;  4IUU A;  1XQH A;  4M7A G;  3G71 T;  5IN1 A;  2E4H A;  3QHS A;  1D0Z A;  1Q81 U;  1XOV A;  1NM7 A;  2CRE A;  4OGE A;  3UPU A;  3GIB A;  1IHV A;  1FMW A;  3OBW A;  1EFN A;  4M7D G;  1VQ7 T;  3OMC A;  1ZHI A;  3JB9 H;  3UA6 A;  1NYG A;  1YJW Q;  4DBR A;  3E2U A;  4LXC A;  1W4S A;  2DJQ A;  1VQ6 A;  3M9Q A;  1IXD A;  3VS7 A;  2E6Z A;  3MEU A;  4FU6 A;  2NUZ A;  2HL3 A;  4PNO A;  2I2L A;  2HCK A;  2G6F X;  2JXB A;  1IZ6 A;  5D6Y A;  3HP9 A;  4QQ6 A;  3SFM A;  4FT4 A;  4M7D E;  4CC4 B;  3MHX A;  5GAO r;  2OTJ T;  2KQW A;  3TU4 K;  3CCL T;  4KRT A;  1AWJ A;  4FW2 A;  2O31 A;  2DF6 A;  1VQP T;  4QW2 A;  1JJ2 S;  4BDY A;  1EZZ B;  1QVF A;  4J9C A;  1YJN A;  2BUD A;  1KJW A;  4GLM A;  2E3I A;  3SHW A;  4WCI A;  5GAO l;  5HK3 A;  5GMK h;  1TWB A;  3AT1 B;  4HVV A;  3FJ5 A;  1RAI B;  2X9H A;  1M3C A;  2CZ1 B;  2KR3 A;  5LJ5 e;  4EMH A;  1TU0 B;  2HQE A;  1LCK A;  1VQN T;  1VOM A;  4RKU E;  4EMK C;  4PJN A;  5FU6 C;  2V8K A;  4HCB A;  1GCQ A;  3X26 B;  3L42 A;  1OI1 A;  2PU9 B;  3ZFJ A;  3PMI A;  3QZ5 B;  1VQ6 Q;  4J6Y A;  5LJ3 f;  2AKL A;  1YCS B;  2K5L A;  4PJO F;  1WHG A;  5IHN A;  1UGP B;  5I11 A;  2EIF A;  1GFD A;  3NTH A;  5I21 A;  1ZSG A;  1IO6 A;  3CXC A;  1TOV A;  3PMT A;  3RMQ A;  2DK3 A;  1W6X A;  1YJ9 Q;  3QZ9 B;  2RB6 A;  3WVD B;  4Q5W A;  1YCY A;  3CC2 T;  1VQ5 Q;  4WTO B;  4RTY A;  1SHF A;  2X3X D;  1CSK A;  1HXD A;  2QGG A;  4BD3 A;  1ZSZ A;  2QQA A;  2E6N A;  5GAO n;  2ESW A;  2MMP A;  2ROL A;  1IRE B;  2O9S A;  1AWO A;  1PC0 A;  4MDW A;  1JEG A;  3DB3 A;  1SRM A;  1VIE A;  1KQS S;  1UEB A;  2PUK B;  3OS0 A;  2QG9 B;  5J26 A;  3R6O A;  3SWN A;  2F2V A;  4ANJ A;  3J7A F;  2QA4 T;  2XIC A;  2YRD A;  3EFO B;  2FRY A;  1YIJ Q;  2A08 A;  1TUD A;  2KRM A;  1BIB A;  2K79 A;  2B8A A;  5A0D A;  1JXO A;  3WVE B;  4M78 E;  4Y91 A;  4RG2 A;  4ELY C;  4M7A B;  3H6Z A;  3RNJ A;  1W2B S;  1ACM B;  3CCU Q;  3C0C A;  1N27 A;  4C8Q A;  3ZL7 C;  2YRV A;  2KXD A;  2BE7 D;  2K3Y A;  1YI2 Q;  2NUP B;  5GMK m;  2K7A A;  1KIK A;  2YUQ A;  3HPW A;  3OW2 P;  2COW A;  3V7C A;  1VQK T;  2CYZ B;  2JZ2 A;  4BE1 A;  5DLQ E;  2X4J A;  1VQL T;  1ZLM A;  1YIT A;  2X4Y A;  2PTK A;  5GAN d;  4M7A D;  5GAM d;  3VRY A;  1D1A A;  2JTM A;  1XJW B;  2EJ9 A;  2L8D A;  2GGR A;  3EFO A;  4XTU A;  1VQ7 A;  1WHK A;  5FWC A;  3CCV Q;  1LPL A;  3M53 A;  3CCQ A;  4M7D D;  2L0A A;  1AT1 B;  4L6V 5;  3JCM V;  1AVZ C;  1Q86 C;  2JTF A;  2P0P A;  2DXT A;  3RIR A;  3R6N A;  3DB4 A;  3G1J A;  4XTZ A;  1WQW A;  5D7U A;  1ZQ1 A;  5GMK e;  1I1J A;  2OTJ A;  1IHW A;  1RUW A;  2KGT A;  4QQG A;  3CCL A;  3OB9 A;  1KQ1 A;  1K9A A;  2K5F A;  2CZ0 B;  5CKE A;  1FX7 A;  3UT1 A;  3QDR B;  3JSC A;  4BE2 A;  4J9G A;  2D0N A;  1NJI R;  1W70 A;  4JJD A;  4M7D F;  3I56 Q;  4XK8 E;  2DIL A;  2IVW A;  4MDX A;  3RUX A;  3J80 E;  1FYN A;  5C6S A;  4DBH A;  4P5N A;  3UAT A;  2GTO A;  1YHQ Q;  2KEA A;  1VQN A;  4E7I A;  4Y28 E;  1BI2 A;  4F7U G;  4RTX A;  4XTW A;  5FW9 A;  2L3Q A;  5LJ5 j;  3M4Y A;  4OMN A;  3JCM P;  2CS7 A;  3CCQ Q;  3LW5 E;  2YRC A;  2XDB A;  1WHM A;  4DEY A;  3GPL A;  1BKB A;  2OI3 A;  2RF0 A;  4ZN3 A;  5EG2 A;  2LNH B;  2QQS A;  2PVD B;  1PKT A;  2F2X A;  5GAO p;  4JS4 A;  2CGH A;  1M8M A;  4RCB A;  5CCA A;  3CC2 A;  1EIF A;  2DIQ A;  3OYN A;  1ZUK A;  1KQ2 A;  4EMK B;  4N0A C;  2CSQ A;  4E7K A;  2FRW A;  2JN0 A;  2EW3 A;  1JJ2 A;  2RJC A;  2F69 A;  1SEM A;  2FPF A;  1D0Y A;  5KYW A;  2X35 A;  5M9O A;  2JM8 A;  2KSS A;  5DLO A;  2JMA A;  3ME9 A;  3OYL A;  1YJW T;  2CZ7 B;  1OX8 A;  2M1H A;  1CKB A;  2DL4 A;  1D09 B;  2ECZ A;  4XTY A;  4A63 B;  2DFU A;  1KC8 C;  1D0X A;  1PKS A;  1OUL A;  3MEA A;  3QWX X;  2QA4 A;  2YSQ A;  1U5S A;  1Z9Z A;  3EFR A;  3CPW S;  1HK9 A;  4BI3 A;  5FRM A;  1U1S A;  1Z9Q A;  4J6W A;  4AFQ C;  2W10 A;  2DA9 A;  1PRL C;  1GCQ C;  2WSE E;  4OF1 A;  1Q82 U;  1KD1 U;  2RJD A;  4ME7 A;  2XI9 A;  4LDW A;  1K9M R;  2LT4 A;  2KNB B;  1ZBJ A;  2EKH A;  2JUF A;  3JCM d;  1M3A A;  2DZ9 A;  2P4T A;  4LUD A;  4EMK A;  1I8F A;  2CP5 A;  5KE3 A;  4KBM B;  1JBM A;  1OQK A;  3C4S A;  2E3H A;  2RQV A;  4XTV A;  2EQU A;  1WFW A;  4M78 F;  3OA6 A;  2C0I A;  4E2F B;  4NL3 A;  3FIF A;  1E6G A;  4JPB W;  3VYH B;  1VQK A;  4NOY A;  4JLI A;  2BE9 B;  1VQ6 T;  1WGS A;  1VQL A;  2RM4 A;  1KQS A;  2M02 A;  2RI2 A;  2EQK A;  3MJX A;  3EH1 A;  2VVK A;  1UEC A;  1UGS B;  3T9N A;  4FYW B;  3CXC S;  1RAD B;  2QQ9 A;  3CCR A;  1D1C A;  5ECA A;  3CCJ A;  3VJP A;  3EGD B;  1YJ9 T;  1BK2 A;  1F1B B;  1NG2 A;  2E1H A;  1VQ5 T;  2EGA A;  5CO7 A;  4PJO G;  3THK A;  2HSE B;  2C0T A;  2EGE A;  3HSB A;  1YJN T;  1UGR B;  4A4K A;  4X1V A;  3PIP A;  2J6O A;  5GAN f;  4JRP A;  2X3W D;  4PJJ A;  1WNL A;  3FLG A;  5GAM f;  3CCM A;  1W2B A;  2DXU A;  2HNI A;  3CBP A;  4M75 G;  1BBZ A;  3RDV A;  2KYM A;  2X4W A;  2RHX A;  4OVA A;  1BCM A;  3G7Z A;  1MMD A;  4F7U B;  2LZ6 B;  1WQ7 A;  2LCS A;  3M0U A;  5GMK j;  3CD6 Q;  4M77 G;  3CME Q;  1M30 A;  3L2Q A;  3CEY A;  1K1Z A;  2BKD N;  1YIJ T;  3EHR A;  4MZM A;  1Q81 C;  3PE0 A;  1M2V A;  4A53 A;  3OS5 A;  2DD5 A;  1M1K U;  1T0J A;  4M75 E;  4LE9 A;  3PVQ A;  4JUV A;  3QDF A;  4F17 A;  1QKW A;  1OU9 A;  3CCR Q;  3CCJ Q;  3JCM W;  2QXF A;  4VUB A;  3G6E A;  1HYO A;  3JCM g;  4M77 E;  5GAN 2;  2DJZ A;  5KYX A;  2E5Q A;  2R5A A;  1QCO A;  4BB7 A;  1M90 U;  1M4Z A;  3QUI A;  1SKU B;  4LUE A;  2DYB A;  4GLK A;  1YI2 T;  1UE9 A;  1OOT A;  3X20 B;  1VQ9 Q;  3JAM E;  4AFU C;  3CC7 Q;  3CCM Q;  4OMP A;  1JU5 C;  2P84 A;  2WSF E;  3PTA A;  2AZS A;  4L5G A;  4M7A C;  1PHT A;  5GAO m;  2BIV A;  2ATC B;  3GBQ A;  1V29 B;  4LDY A;  1M2O A;  3QG1 A;  3BDU A;  1Q7Y U;  2MYS A;  3I55 Q;  1WHL A;  5KYY B;  2C06 A;  4RTZ A;  1JRI A;  1YJW A;  2MPX C;  1RLQ C;  3CCV T;  4KGV B;  2Y4Y A;  5GAN 4;  1OPL A;  4C92 G;  4OMO A;  2E64 A;  3H0F A;  1TSF A;  2L3R A;  1N9R A;  3OYY A;  4OP0 A;  3TEE A;  2LP5 A;  3QII A;  3G6E Q;  2ED0 A;  1WXB A;  2CKK A;  4DA4 A;  1G2B A;  2E12 A;  2DL8 A;  3VS1 A;  1NEG A;  2XHC A;  4PFP A;  4ZN1 A;  4FYY B;  4C0Z A;  3OS2 A;  4C92 E;  4C8Q E;  3UA7 A;  1JB0 E;  2RK1 A;  2MWO A;  4EPC A;  1QVF P;  3I56 T;  2EYQ A;  2YUP A;  5FLX E;  3HRS A;  1YIT T;  2AT1 B;  2Y90 A;  1YHQ T;  2ENM A;  4QVZ A;  5KYU B;  1NLO C;  1AZG B;  4HVU A;  5L23 A;  1RI0 A;  1QCF A;  2DVJ A;  2RK2 A;  2DIG A;  2L3P A;  5GAN h;  4PJO B;  2E10 A;  1GXI E;  2K6D A;  4BY6 B;  3M0P A;  2GTJ A;  1O9S A;  3CCQ T;  1PD0 A;  2WAC A;  2KYB A;  3JB9 J;  1K0X A;  1CKA A;  2KVQ G;  1WPY A;  1EX4 A;  1RAG B;  3CPW A;  1B07 A;  1RLP C;  2BZX A;  4J7F A;  5GJV B;  3TRE A;  4C0D C;  4N0A A;  3CXC P;  5HKC A;  1YJ9 A;  3C94 A;  2MCN A;  4M75 B;  4BUG A;  2XG8 D;  1VQ5 A;  3A8L B;  1A0N B;  2RA2 A;  5IAY A;  3A8O B;  4IKF A;  1W1F A;  2CH4 W;  4E47 A;  1XTD A;  3JCM X;  2VV5 A;  4NS5 A;  2RD1 A;  2K3B A;  3HFN A;  2OJ2 A;  3OSV A;  4AFZ C;  2D0Q B;  3M5A A;  3HTR A;  4X9C A;  1OYX A;  2VC8 A;  4PJO D;  2CP7 A;  2M9U A;  1K76 A;  4KUD K;  1WI7 A;  4C0G A;  1G83 A;  2QQB A;  1UJ0 A;  4OML A;  1BCO A;  4BDZ A;  4QT7 A;  4WF2 A;  1E7O A;  1LOJ A;  2M0Y A;  1MGQ A;  4GBQ A;  2EFI A;  4FL6 A;  1O75 A;  2JS0 A;  4HCZ A;  5KYU A;  3E9G A;  2FHD A;  2V1R A;  3A8M B;  1K4U S;  3VS6 A;  3EAE A;  3LLR A;  1HSQ A;  4OB0 B;  3OBY A;  4M75 D;  1Y71 A;  2YT6 A;  5GAN 5;  1MHN A;  2RNA A;  1YIJ A;  4J7I A;  2V8I A;  1G5V A;  5FU7 B;  2A37 A;  2R5M A;  2DTO A;  2LX9 A;  4M77 D;  2ED1 A;  3KFV A;  3OYC A;  3VUZ A;  2E41 A;  2DER A;  2K2M A;  3GLX A;  1X27 A;  3OYA A;  6AT1 B;  2HAX A;  3QXE B;  1HD3 A;  2K3X A;  2HL5 C;  1M1G A;  3BW1 A;  3CCU A;  2EJG A;  4XU2 A;  2P4R A;  2K9G A;  3RES A;  4M75 F;  3OYF A;  1YI2 A;  4R56 A;  1SG5 A;  3IQL A;  3CQT A;  1KK7 A;  4QVD A;  1R8O B;  2DRK A;  2EWN A;  3MEV A;  4UC4 A;  3CC4 Q;  4M77 F;  1OX9 A;  2K2V A;  1Y57 A;  2D9T A;  4MZT A;  2LDM A;  4M78 G;  3LGL A;  4F04 B;  1M9S A;  3KBG A;  4X34 A;  4J6X A;  3VU3 C;  1VQ4 Q;  4YTL A;  4FIB A;  3MKD A;  1K73 C;  3ZEH A;  3EG3 A;  1MUZ A;  1BB9 A;  3CCV A;  5KH6 A;  4KT0 E;  3QBY A;  3TSZ A;  1KG1 A;  3NPF A;  2V8J A;  3QJ6 A;  3I5S A;  4AMC A;  2D8J A;  3VS3 A;  5DM7 R;  2KT1 A;  3PIO A;  3OYK A;  4HA8 A;  1GBR A;  2RQR A;  3EG2 A;  1NPP A;  2L89 A;  2F5T X;  4FT2 A;  2XDD A;  2EBP A;  2LJ3 A;  2XD0 A;  2J7I A;  2AIR B;  1GBQ A;  1IRX A;  4CI0 C;  1G3W A;  1WLP B;  1Q86 R;  4JS5 A;  2ZPE B;  1X75 C;  2GF7 A;  4JLG A;  4O6J A;  2XMF A;  4M7D B;  2EYX A;  1AD5 A;  3OYG A;  3DLL A;  4CC3 A;  5GMK i;  2LCC A;  3CD6 T;  3JRZ A;  2B86 A;  2A28 A;  3I56 A;  2NWM A;  2X4X A;  5GAN e;  4AG2 C;  4FSS A;  1QWF A;  2MIO A;  3EFS A;  1B34 B;  5KCH A;  4C92 F;  1TUG B;  4C8Q F;  1YHQ A;  4KUL A;  2LVM A;  4J9B A;  1VQO Q;  3CCR T;  4KH0 B;  4RTW A;  3CCJ T;  1T3S A;  2DE0 X;  4LNP A;  5LJ5 g;  3QO3 A;  4JZ4 A;  2DNU A;  3I5R A; 
#chains in the Genus database with same CATH homology
 2OTL A;  2WSE E;  3N5B B;  3FC3 A;  1LJO A;  4OF1 A;  3A5Z B;  4II1 A;  1Q82 U;  1KD1 U;  2RJD A;  4PJO A;  4ME7 A;  2XI9 A;  4E7J A;  4LDW A;  2XK0 A;  4QQD A;  2LT4 A;  3L1A A;  3MP6 A;  3KXT A;  4EDU A;  1P92 A;  3LH0 A;  2JUF A;  4LDX A;  3JCM d;  2QTX A;  5LL6 S;  1VQ9 T;  2DZ9 A;  4OB3 B;  3SWN B;  2P4T A;  2O4X B;  4M7A A;  3CC7 T;  3CCM T;  3LGF A;  5LJ5 d;  4IUT A;  3X25 B;  2DTH A;  2KMT A;  4B9X A;  4EMK A;  1I8F A;  2OAU A;  1N9S A;  5KE3 A;  4KBM B;  1JBM A;  1VQM A;  1U8R A;  3C4S A;  2DO3 A;  5CVI A;  5LJ3 h;  4C5H A;  3SB2 A;  4M75 A;  4F7U F;  4XTV A;  1SSF A;  2EQU A;  2HQX A;  4M78 F;  3OA6 A;  3JCM J;  3BY7 A;  4NL3 A;  1Q82 C;  3FIF A;  1KD1 C;  4M7D A;  3VYH B;  1VQK A;  4JRQ A;  1D3B B;  3HRT A;  5I2M A;  4C5G A;  3GP8 A;  3S6W A;  2R57 A;  3I55 T;  1K73 U;  1BI3 A;  4NOY A;  3A8H B;  4JLI A;  3URG A;  3X28 B;  4E7L A;  1VQ6 T;  2RHZ A;  4M77 A;  1WGS A;  3UDC A;  2RM4 A;  2YLB A;  3MCA B;  5I2S A;  1KQS A;  1VQL A;  2RI2 A;  1TH7 A;  2EQK A;  3ZBD A;  2P0K A;  4LDU A;  1UGS B;  5J39 A;  1WJS A;  2FL7 A;  3T9N A;  4C92 B;  3CXC S;  4C0D B;  4C8Q B;  4DOV A;  3L2Z A;  3CCE T;  2QQ9 A;  1OZ3 A;  3CCR A;  4JJN K;  5LJ3 g;  3CCJ A;  3VJP A;  1BI1 A;  5C0M A;  3C12 A;  1S72 T;  1YJ9 T;  4BAC A;  3G6E T;  2E1H A;  3CMA T;  1VQ5 T;  5CO7 A;  4XU0 A;  4PJO G;  2GCX A;  2QDY B;  1VQO A;  2D6F A;  4Z02 A;  2DEQ A;  4FM4 B;  1KHC A;  2LQK A;  2ZCF B;  3HSB A;  3M59 A;  2YHT A;  2VXE A;  2EQM A;  1YJN T;  1UGR B;  4A4K A;  1X6O A;  3CPF A;  1QVP A;  5CQX A;  3OYI A;  2DZC A;  3PIP A;  5GAN f;  4JRP A;  3OSS C;  4IUU A;  1XQH A;  3G4S A;  4M7A G;  3G71 T;  4BI8 B;  1RL2 A;  3M56 A;  5IN1 A;  3QHS A;  1WNL A;  1BIA A;  2QI2 A;  3FLG A;  3PT9 A;  4LDV A;  5GAM f;  1UB4 A;  1XOV A;  3CCM A;  1W2B A;  1Q81 U;  3VKI A;  3GF5 A;  2PUO B;  1FXX A;  3OYD A;  2DXU A;  2O4X A;  3V8K A;  3OS1 A;  2HNI A;  3S3N A;  4OGE A;  3UPU A;  3CBP A;  3GIB A;  4M75 G;  3OBW A;  4C92 D;  4C8Q D;  2X4W A;  4M7D G;  2RHX A;  4OVA A;  2MI6 A;  2HBP A;  3BFM A;  3PFS A;  4RCC A;  3G7Z A;  3OMC A;  4F7U B;  1ZHI A;  1VQ7 T;  3FDR A;  3JB9 H;  1WQ7 A;  4M78 B;  2RH2 A;  3JCM h;  4N4G A;  5GMK j;  4M77 G;  4LD6 A;  1G3Y A;  2A3L A;  3PGG A;  4JRK A;  1W4S A;  3L2Q A;  1D3B A;  3CEY A;  3P8B B;  3M9Q A;  1VQ6 A;  2BKD N;  1YIJ T;  2QEX T;  2XDP A;  2E6Z A;  3MEU A;  4FU6 A;  4MZM A;  4PNO A;  1Q81 C;  4A53 A;  2I2L A;  3OS5 A;  4IUP A;  2DD5 A;  4J5Y A;  1M1K U;  4N4H A;  3CME T;  1DJ7 B;  4M75 E;  1IZ6 A;  5D6Y A;  5FRN A;  3HP9 A;  4HCC A;  4QQ6 A;  4JUV A;  3SFM A;  3CCE A;  3A8G B;  3QYG B;  4ELZ C;  4QVC A;  2DTI A;  4FT4 A;  4C92 A;  4M7D E;  3HFO A;  1M5Q 1;  3LYI A;  3MHX A;  3TCJ A;  5GAM e;  3JCM W;  2QXF A;  2KQW A;  5GAO r;  4VUB A;  1VQ8 A;  3JB9 G;  2OTJ T;  1QP3 A;  1Y96 B;  3G6E A;  3CCL T;  3TU4 K;  3DLM A;  2RI3 A;  4M77 E;  3JCM g;  5GAN 6;  5GAN 2;  2DJZ A;  2K4Y A;  2E5Q A;  2R5A A;  4ZGD B;  1VQP T;  1UGQ B;  4QW2 A;  4HKE A;  5FRO A;  4BB7 A;  1M90 U;  4BDY A;  1M4Z A;  1JJ2 S;  1QVF A;  3QUI A;  1YJN A;  4A4E A;  2BUD A;  4M78 D;  4GLK A;  5CK9 A;  1YI2 T;  2PVG B;  3X20 B;  4PLL A;  5GAO l;  3G71 A;  1M1K C;  5HK3 A;  2XU8 A;  5GMK h;  2PQW A;  2RJE A;  2KDS A;  4PJO C;  4OGC A;  3JAM E;  4BY6 C;  3L2U A;  2HD0 A;  2RHY A;  1Y07 A;  3M4G A;  2NLU A;  4GY5 A;  2CZ1 B;  5CKD A;  5LJ5 e;  2WSF E;  4EMH A;  3PTA A;  2HQE A;  4IUR A;  1VQN T;  2F5K A;  1Y7X A;  4L5G A;  4M7A C;  5GAO m;  4RKU E;  2BIV A;  2RI5 A;  3FRN A;  1V29 B;  4LDY A;  4EMK C;  2LNV A;  2DXB A;  3QYH B;  4IUQ A;  5FU6 C;  3QG1 A;  3BDU A;  1M90 C;  3JCM c;  2V8K A;  4HCB A;  2ZPG B;  1Q7Y U;  3WXM B;  1M1F A;  3X26 B;  3L42 A;  1OI1 A;  4M75 C;  1QVG S;  2PU9 B;  3CCS T;  3ZFJ A;  3PMI A;  3QZ5 B;  2C06 A;  4J6Y A;  5LJ3 f;  4J83 A;  5L8R E;  2K5L A;  3AHU A;  1JRI A;  4OB1 B;  1YJW A;  4PKC C;  4PJO F;  3JB9 I;  3CCV T;  2R58 A;  3CD6 A;  2Y4Y A;  1UGP B;  5GAN 4;  2EIF A;  3MP8 A;  3CME A;  4C92 G;  3NTH A;  5I21 A;  5CKH A;  2E64 A;  3CXC A;  3PMT A;  3VUB A;  1I4K 1;  3RMQ A;  3INZ A;  1QP2 A;  2DK3 A;  3LX7 A;  2L3R A;  1N9R A;  2EJF A;  2ZPB B;  3OYY A;  1I5L A;  2DXC A;  3CBO A;  3QZ9 B;  4OP0 A;  2RB6 A;  4M7A F;  3V7S A;  3WVD B;  2JOY A;  2VYT A;  4Q5W A;  5CQY A;  3TEE A;  1YCY A;  2XKO C;  3QII A;  3V8L A;  3CC2 T;  2GQV A;  3QKJ A;  1B34 A;  2CKK A;  1Q7Y C;  4DA4 A;  2E12 A;  3OW2 A;  5GAN 8;  1VQP A;  2EKO A;  2VGM A;  4NL2 A;  3GNG A;  1HXD A;  2XHC A;  4ZGE B;  4ZN1 A;  2CZ6 B;  4E7H A;  4C0Z A;  4BD3 A;  3OS2 A;  4C92 E;  3E1S A;  4C8Q E;  1N6A A;  2DAQ A;  2QQA A;  3M55 A;  2E6N A;  3LWH A;  1JB0 E;  5GAO n;  4ZTF A;  2RK1 A;  3BDL A;  5LJ3 e;  4IUV A;  2MMP A;  2MWO A;  3JCM b;  4PJO E;  1IRE B;  4EPC A;  4MDW A;  5FU7 C;  1K8A C;  3LWI A;  3I56 T;  1BI0 A;  1VQ9 A;  1H64 1;  3DB3 A;  2EYQ A;  3JCM Q;  1VUB A;  2XID A;  1VIE A;  3HRS A;  5FLX E;  1KQS S;  3MET A;  3CC7 A;  1NJI U;  1UEB A;  2PUK B;  4A4G A;  3OS0 A;  5J26 A;  1YIT T;  3R6O A;  2Y90 A;  2RHU A;  3SWN A;  5KCO A;  2L5Q A;  3GOX A;  2LTO A;  3J7A F;  3NTK A;  2Y4X A;  2QA4 T;  1PSF A;  2XIC A;  4TVR A;  1YHQ T;  4QVZ A;  4B9W A;  3H8Z A;  3OYH A;  3VV0 A;  1RI0 A;  4FSX A;  1NZ9 A;  2ZPI B;  3P8H A;  1OZ2 A;  2RK2 A;  2DIG A;  5GAN h;  5A2Q E;  4X9D A;  5HK0 A;  2LC4 A;  1VQ4 T;  4PJO B;  2E10 A;  3I55 A;  1GXI E;  4OMF B;  4BY6 B;  4R55 A;  2GFU A;  1AHJ B;  1BIB A;  4RMO A;  1O9S A;  3CCQ T;  1YBY A;  2H3J A;  2B8A A;  2WAC A;  4HT9 A;  5A0D A;  3DKM A;  3JB9 J;  3WVE B;  4F7U E;  3OYB A;  1NJI C;  5LJ5 f;  4M78 E;  4Y91 A;  2QQR A;  4RG2 A;  2KVQ G;  1WPY A;  4M7A B;  4ELY C;  3L2W A;  4V2S A;  1BYM A;  5GMK l;  3H6Z A;  4ZTJ A;  4A4F A;  1W2B S;  3CPW A;  4OB2 B;  3RMS A;  5FU6 B;  4C0D C;  4J7F A;  3TRE A;  1N8R C;  4N0A A;  5HKC A;  1N27 A;  4C8Q A;  3PNW C;  1YJ9 A;  1S72 A;  3C95 A;  2YRV A;  2MWP A;  2E65 A;  3RKX A;  2K3Y A;  3C94 A;  2P0Q A;  4M75 B;  1VIF A;  4BUG A;  2XG8 D;  5GAN g;  1PSE A;  3A8L B;  3CMA A;  5GAN 3;  2RA2 A;  5IAY A;  1VQ5 A;  3A8O B;  4IKF A;  3F70 A;  2LQ8 A;  3CCU T;  3QSU A;  5GMK m;  5GAM g;  2IG0 A;  4E47 A;  1XTD A;  3JCM X;  2VV5 A;  4NS5 A;  3HPW A;  3V7C A;  2RD1 A;  1VQK T;  2KAF A;  3HFN A;  5CAI A;  2CYZ B;  3OSV A;  4HT8 A;  2D0Q B;  2JZ2 A;  5AYF A;  3M5A A;  4EMG A;  4X9C A;  3J81 E;  1OYX A;  2VC8 A;  4PJO D;  3HKS A;  2M9U A;  5GAO q;  2DD4 A;  4O5V A;  3M57 A;  3JCM e;  4BE1 A;  5DLQ E;  4C0G A;  2X4J A;  4KUD K;  1VQL T;  3NFC A;  1Q86 U;  1YIT A;  2QQB A;  1NE8 A;  5HY6 A;  4BDZ A;  2X4Y A;  4MMK A;  5GAN d;  2E70 A;  2KY9 A;  4MML A;  4WF2 A;  5DY9 A;  3NTI A;  4M7A D;  2PVO B;  3P8D A;  1LOJ A;  3RKY A;  2FYK A;  1MGQ A;  5GAM d;  2JTM A;  2EFI A;  2EJ9 A;  1O75 A;  2L8D A;  4FL6 A;  4HCZ A;  4C0F A;  4DQ2 A;  4ATO A;  4XTU A;  3E9G A;  1VQ7 A;  2FHD A;  3A8M B;  4PL6 A;  3UWN A;  1KHI A;  3EAE A;  2AHJ B;  4BE0 A;  3LLR A;  4A54 A;  2GFA A;  4OB0 B;  3OBY A;  4M75 D;  1G3S A;  1Y71 A;  4F7U A;  4M78 A;  4CRI A;  1VQO T;  5GAN 5;  1MHN A;  4L59 A;  1YIJ A;  3M53 A;  4J7I A;  2QEX A;  2V8I A;  3CCQ A;  3S3O A;  1QVF S;  4M7D D;  4DOW A;  1G5V A;  1QW1 A;  4L6V 5;  5FU7 B;  2R5M A;  3JCM V;  4M7D C;  2A7Y A;  3V7R A;  3OYE A;  1Q86 C;  2DTO A;  2JTF A;  2DXT A;  2P0P A;  3RIR A;  4C5I A;  2LX9 A;  4M77 D;  3DB4 A;  3G4S T;  2K57 A;  4XTZ A;  5J3B A;  2EAY A;  4C8Q G;  2K5I A;  4M77 C;  2M0O A;  1WQW A;  3OYC A;  4RG8 A;  4XTX A;  3VUZ A;  2E41 A;  1ZQ1 A;  3GLX A;  3KUF A;  4XU1 A;  5GMK e;  4LD9 K;  2OTJ A;  4JDS A;  4J8O A;  1K8A U;  2JVV A;  2JNG A;  4QQG A;  2RO0 A;  3OYA A;  1WJR A;  3CCL A;  3HL8 A;  1KQ1 A;  3OB9 A;  2HAX A;  2K5F A;  3QXE B;  2CZ0 B;  2K3X A;  1M1G A;  3BW1 A;  3CCU A;  1Y96 A;  2EJG A;  4XU2 A;  2FB7 A;  5CKE A;  4PLI A;  1K9M U;  1FX7 A;  2LCL A;  2DKG A;  3QDR B;  3UT1 A;  5A0G A;  3L2V A;  5GAN j;  3JSC A;  2ZPH B;  4BE2 A;  3E19 A;  3RES A;  5KE2 A;  4M75 F;  3MP1 A;  3OYF A;  1I81 A;  3JB9 D;  1YI2 A;  3X24 B;  3MO8 A;  5GAM j;  4R56 A;  2YLC A;  4M7D F;  4XK8 E;  3HHT B;  3V8J A;  1FWZ A;  2ZPF B;  2IVW A;  4MDX A;  3MEW A;  3Q1J A;  1R8O B;  4UC4 A;  2EWN A;  3MEV A;  3RUX A;  4QVD A;  3J80 E;  4M77 F;  5C6S A;  3FJP A;  4P5N A;  3OYJ A;  2K2V A;  1VQN A;  3OQ5 A;  4E7I A;  2LRQ A;  1BI2 A;  2D9T A;  4MZT A;  4Y28 E;  3GNF B;  3SWN C;  4N4I A;  3M54 A;  4F7U G;  2LDM A;  4D6W A;  3CC4 T;  1K9M C;  1VQ8 T;  4M78 G;  3LGL A;  1M9S A;  5CR2 A;  3KBG A;  4X34 A;  4J6X A;  3VU3 C;  4XTW A;  5A0L A;  2RHI A;  4YTL A;  3OW2 S;  5LJ5 j;  3M4Y A;  4FIB A;  1N8R U;  3CCS A;  3JCM P;  1K73 C;  3ZEH A;  3VYG A;  2CS7 A;  5CKF A;  2VGN A;  3JB9 F;  2MF2 A;  3LW5 E;  2XDB A;  3CCV A;  5KH6 A;  3GPL A;  1BKB A;  4C5E A;  4KT0 E;  3QBY A;  4ZN3 A;  2EQJ A;  1KG1 A;  2V8J A;  5EG2 A;  3QJ6 A;  2VXF A;  3HRU A;  3JCM f;  5GAM h;  2OTL T;  5LJ3 d;  3ASK A;  2QQS A;  3OY9 A;  2PVD B;  1G3T A;  5D6W A;  5DM7 R;  5GAO p;  3PIO A;  4HA8 A;  3OYK A;  4BI4 A;  4XU3 A;  4JS4 A;  3OYM A;  5IT9 E;  2CGH A;  1NPP A;  2L89 A;  2F5T X;  3CBM A;  1U1T A;  4RCB A;  5CCA A;  4FT2 A;  5D6X A;  2XDD A;  2XD0 A;  3CC2 A;  1EIF A;  2DVE A;  4XQ3 A;  2WSC E;  2DIQ A;  2KK4 A;  3OYN A;  2O01 E;  1KC8 U;  1KQ2 A;  1NPR A;  3S3M A;  1LNX A;  4CI0 C;  4C92 C;  4EMK B;  4N0A C;  2ZZD A;  3M58 A;  4C8Q C;  4ZGJ B;  1G3W A;  4E7K A;  2JN0 A;  3RKW A;  1JJ2 A;  4JS5 A;  4A4H A;  2ZPE B;  2RJF A;  2RJC A;  1WJQ A;  1X75 C;  2F69 A;  2GF7 A;  4KUI A;  1VQM T;  1X01 A;  4JLG A;  4O6J A;  4M7A E;  2X35 A;  5M9O A;  1H3Z A;  3L2R A;  3QJY A;  5CKB A;  4M7D B;  2KSS A;  2DPP B;  2FVU A;  4MZP A;  5LJ5 h;  3OYG A;  5DLO A;  3FEO A;  1XNI A;  3DLL A;  2G3R A;  3ME9 A;  3SDZ A;  5GMK i;  3OYL A;  1YJW T;  3ER0 A;  2LCC A;  2CZ7 B;  3OMG A;  3SD4 A;  3JRZ A;  2M1H A;  3QPH A;  3CD6 T;  4XTY A;  4M77 B;  3RER A;  3I56 A;  2VUB A;  2X4X A;  2ZGW A;  5GAN e;  2LT1 A;  1ZBX A;  2MAM A;  4JRI A;  3O8V A;  1KC8 C;  1M8V A;  3EFS A;  5GAN 7;  3MEA A;  3CC4 A;  1B34 B;  5KCH A;  4C92 F;  4XAX B;  2QA4 A;  5CIU A;  4C8Q F;  5LJ3 j;  1YHQ A;  4KUL A;  3EFR A;  3CPW S;  1HK9 A;  2M16 A;  2LVM A;  4BI3 A;  3FB9 A;  1QVG A;  3CCR T;  5FRM A;  1U1S A;  3CCJ T;  5LJ5 g;  4J6W A;  3QO3 A;  3E9F A;  1VQ4 A;  4M78 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...