2RA2A

X-ray structure of the q7cpv8 protein from salmonella typhimurium at the resolution 1.9 a. northeast structural genomics consortium target str88a
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
PNYVMHTNDGRSIVTDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMVALENLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipoprotein
publication title X-Ray structure of the Q7CPV8 protein from Salmonella typhimurium at the resolution 1.9 A.
rcsb
source organism Salmonella typhimurium lt2
molecule tags Lipoprotein
total genus 8
structure length 55
sequence length 55
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ra2A00
4PJOC 1KQ1A 4M75A 4M7AB 3RUXA 3HFNA 1I5LA 4HT8A 3HFOA 4XQ3A 4M78A 3V8JA 5GAMg 3RERA 4M78F 1KQ2A 5LJ3j 3BW1A 2DTOA 3JCMW 2I2LA 4M77D 2EWNA 2RA2A 4M78C 1N9SA 2K57A 4QVDA 1Y96B 5GAN2 4J5YA 4F7UB 4C8QD 2E1HA 4XU2A 4M77A 4HT9A 3JCMh 3RKYA 5GANh 2EJFA 2VXEA 2DTHA 2DVEA 4C8QA 3QSUA 3FB9A 4C92B 4M75B 3L1AA 3FIFA 4M77C 1D3BB 5DY9A 5LJ3f 5GAN5 4M7AA 4M7DD 5GAN8 1I81A 5LJ5h 4M7AF 4C8QC 4XU3A 2FB7A 1JRIA 4J6XA 2EAYA 3BY7A 4M7AC 4MMLA 1YCYA 3JCMf 4M78E 1M8VA 1Y96A 1WPYA 3RIRA 4Y91A 4F7UA 5GAOr 4F7UF 4M77B 1X01A 1MGQA 3JB9D 5GMKl 5GAMj 1I4K1 3JCMX 4C92A 5GAMh 2YLBA 1D3BA 4M75F 4A54A 4EMKB 4PJOD 3EFSA 4RCCA 1HXDA 3PGGA 3JB9J 3L2ZA 4C92C 4M75C 2ZGWA 3INZA 4M7DB 4PJOA 4M7AE 5LJ3h 2E10A 5CAIA 4A53A 4JRKA 1HK9A 5GAN7 4M78G 2DTIA 2CGHA 1I8FA 4XTVA 3V8LA 5GAMf 5GAN3 4M77F 2DEQA 5GAOq 2VXFA 4C8QF 4F7UE 4QVCA 2YLCA 4EMKA 3JCMJ 4V2SA 1M5Q1 3M4GA 1JBMA 1WQWA 4EMGA 4M7DA 4M75E 1H641 1LOJA 4C8QG 4EMKC 5GMKe 4PJOB 2E65A 2DXTA 2DXUA 4M7AG 4J6YA 4HA8A 4M7DC 2RM4A 5GMKi 2YHTA 3JB9H 4NOYA 4XTWA 3SB2A 4NL3A 5GAOm 2E41A 4XU1A 4C92F 2E64A 4M77E 4F7UG 4X9DA 3BFMA 3JCMP 4C8QE 4J6WA 1B34B 5GANd 4OP0A 4DQ2A 4PJOF 4MMKA 4C92G 2HNIA 4M75G 4NL2A 5GANg 1WNLA 5LJ5d 3HSBA 1U1TA 5GANe 5GAOp 5LJ5g 4XTXA 3RKXA 2DZ9A 2DZCA 3JCMb 3AHUA 3EFRA 4RCBA 4XTZA 5LJ5e 2JN0A 1LJOA 3QUIA 4EMHA 1WQ7A 4M77G 3QO3A 1B34A 4C92E 4M7DF 5I21A 2EJGA 4JRIA 4M78D 3V7RA 1BIBA 4JLIA 3RESA 4XU0A 3JCMV 2EJ9A 2QTXA 4PJOE 2RB6A 4M7DG 4N0AA 2DJZA 5LJ3d 3SWNB 5GAMe 4X9CA 2RD1A 2VC8A 3FJPA 3V7CA 3JB9F 5LJ3g 1TH7A 4N0AC 5GANj 3JCMd 3JB9I 3VU3C 3QHSA 5LJ3e 4M7AD 1U1SA 4JUVA 3GIBA 3JCMg 3JB9G 4WF2A 5GAOl 5LJ5j 4XTYA 3BDUA 3JCMe 4M7DE 4M78B 2DKGA 1LNXA 1BIAA 4PJOG 2Y90A 3JCMc 5GMKm 3SWNA 5GAN6 5GMKj 5GAOn 5GANf 4PNOA 5GMKh 5GAN4 3SWNC 1N9RA 4XTUA 3JCMQ 3V7SA 4M75D 2FYKA 3V8KA 4C92D 5LJ5f 4C8QB 3RKWA 5GAMd
chains in the Genus database with same CATH superfamily
4LUEA 4HT8A 2DIQA 1BK2A 2I0NA 2HL5C 2OAWA 4FL6A 4M77D 1KQSA 2FRWA 4M77A 2PTKA 3CMAQ 4ME7A 1XTDA 1UGSB 4ZN1A 2BE7D 3M58A 3SEMA 5GAN8 1QVGA 3RMQA 2DPPB 1VQKA 4MZPA 1H92A 1OZ3A 2V8JA 2HQHA 4F7UA 1RAGB 2JTFA 5CIUA 1M2OA 3QXEB 1GFDA 1QKWA 3CD6T 1AZGB 1RAIB 2AKKA 4C5GA 1K9MU 4XTVA 5A0DA 1WXBA 3GPLA 4LD6A 2DYBA 5I2MA 2DK3A 2CP5A 1VQ6A 2WSFE 4HVWA 3M4GA 4MZTA 1WQWA 4M7DA 2R5MA 1K0SA 3QZ9B 4J6YA 3JSCA 2F5TX 1FYNA 1X2KA 3M0TA 1IB8A 2H3EB 4Z02A 2RJDA 2DL7A 3CMAA 3M0SA 2GTOA 1KHIA 3OQ5A 4PJOF 2DM1A 1BI3A 3META 2QQ9A 2OJ2A 2MCNA 2QA4T 2W0ZA 2GTJA 1Y71A 2DZ9A 2JN0A 3EGDA 1T0JA 3R6NA 2GQIA 3QO3A 1GCQA 2ZPFB 2X4JA 4PLIA 3HRTA 2P0QA 3LYIA 2K3YA 2ZPHB 5A0GA 7AT1B 3I56T 8ATCB 3FDRA 4ZGDB 3VU3C 3CCUQ 2L0AA 4F17A 5ECAA 3A8HB 4ZGJB 1KHCA 5GMKj 2HDAA 2KXCA 4J9DA 3CPWP 2P4RA 3OBWA 4J9GA 2LQNA 2JMAA 1KQ1A 1VQ9Q 2WSCE 1RAFB 2BUDA 2J7IA 2KNBB 2V8KA 4FW2A 2ZPEB 3OS1A 4HT9A 3VS1A 2O9SA 3THKA 4FYYB 1V1CA 4OMLA 2XD0A 2YSQA 1AD5A 2RO0A 1M8VA 4Y91A 2YRDA 1UHCA 1D0ZA 4D8DA 3R6OA 3M4YA 3H0HA 3CCUA 4N4GA 4DBRA 1W2BS 4PJOD 1YJWT 1HXDA 2A08A 3P8HA 4Y92A 4OMFB 4PJOA 2JT4A 2QI2A 2EVRA 1UJ0A 4LDUA 2DEQA 3J80E 2F2XA 4C8QF 2A3LA 1SEMA 2COZA 3CCJA 1VQ9A 1QMCA 3PVQA 2R58A 2ZPIB 4EMKC 2AK5A 4LD9K 5GJVB 2DXUA 1VQOT 2KDSA 2P0PA 2RM4A 1D1CA 4Z89A 4AG2C 4YTLA 4KUDK 2E64A 1W70A 4F7UG 2V26A 4XK8E 3UA7A 4J6WA 2W10A 2AZVA 3I55T 1ZBXA 3SFMA 3OW2A 1Y7XA 3PIPA 1U1TA 1KQSS 2Y4YA 3CXCA 3E2UA 3QJYA 2LNHB 2PZ1A 2RJEA 2CS7A 1LJOA 4EMHA 5J39A 1VQ7T 1QVGS 3VUBA 1VQ5T 2L5QA 1MNEA 2RQWA 4KRTA 3RESA 2YWWA 4BY6C 4M7DG 4OMQA 2VC8A 1TUGB 3V7CA 5LJ3g 3OMCA 2EYWA 3JB9I 5IT9E 1V29B 3OB9A 4PJLA 1ZSZC 2HMAA 3OA6A 5GAOl 1EZZB 3VRZA 4A4HA 3CEYA 5IHKA 1SF9A 1Z9ZA 4JS5A 1T0HA 4RG8A 3TSWA 1JXMA 2EQJA 1KC8R 2KAFA 3RKWA 1WLPB 4E2FB 4M78A 4LDYA 3RERA 3BW1A 2LQKA 2DBMA 3EH2A 3G1JA 1VQ4Q 5GAN2 1Q86C 1K8AR 4C8QD 3JCMh 1IHVA 4C8QA 3QPHA 3NGPA 3O8VA 4PK4A 3D7SB 3LW5E 4EIKA 3F70A 2DAQA 1FMVA 4D8KA 3H9NA 5L23A 2HCKA 1WJQA 4DEYA 4HCCA 4EMKB 2E4HA 4J7IA 2G6FX 4BE1A 5KYXB 1QWFA 3VS3A 3I35A 1PNJA 4XAXB 1NPPA 2EYYA 1UGQB 3OMGA 3MP8A 4JRPA 4E7LA 3L2WA 3CC4Q 1ZUYA 2GCXA 5D6YA 2LNVA 1VQ4A 4IIOA 5D7UA 1MMDA 3P8DA 3L2RA 2GFUA 1UJYA 2CUDA 3OYMA 4BY6B 1S72Q 5KYUB 4DOWA 1G8XA 2CZ7B 5LJ5d 5GANe 3I9QA 1PD0A 1W2BP 2EIFA 2CT3A 3G71A 1ZSZB 2MF2A 2FZKB 2CKKA 4PFPA 3EFOB 5C6SA 2DL8A 1BCOA 2YRCA 1SSFA 2VWFA 1M2VB 3CCLT 1YIJQ 4E7SA 2RD1A 2XMFA 3JCMd 3ULRB 3RDVA 1ZA1B 1QCOA 5LJ5j 3CC4A 3PFSA 2XICA 1K73R 1LNXA 2QEXQ 5CVIA 1M90R 2HEQA 3SWNA 3TREA 5GAN6 3ER0A 2CUBA 3CBPA 1KQSP 2HBPA 1NEBA 1S72A 3EG9B 5GAMg 1G3WA 4QQ6A 5IHNA 2OTLA 3JCMW 1QVGP 2RK1A 2A7YA 1E6GA 1IRXA 3FB9A 3H0IA 1PHTA 1D3BB 3OW2S 3CXCS 4J6XA 1KD1R 1YIJA 2QK0A 3RNJA 5IH2A 2EQUA 2OAUA 1M1GA 2RN8A 3OS0A 3TU4K 4OF1A 2LQWA 1G3SA 2KYBA 3URGA 3OYNA 2QEXA 1WJRA 2EYZA 5CAIA 1AT1B 1SHFA 4JRKA 2SEMA 4Y28E 4M78G 1G2BA 2NUTB 2DTIA 3CC7Q 4BDYA 2MWPA 4RKUE 1JB0E 1ZA2B 2YLCA 2EBPA 2KGTA 1M5Q1 3PVLA 4C8QG 1MV3A 1YITQ 5GAOm 4RTVA 3CCQT 3MHXA 2JOYA 1ZSGA 3CD6Q 2FZGB 1WHLA 3M9QA 1XOVA 1ZUKA 4ESRA 3VS5A 1VQLA 2V1QA 2ED1A 1W4SA 4BUGA 3V7RA 1SSHA 4JZ3A 2EJ9A 1M8MA 2XDPA 2EKHA 5GAMe 2FZCB 3CC7A 3CQTA 2LRQA 3H41A 3MEVA 3A8LB 1VQ8T 2LCLA 1UB4A 2QDLA 2YUQA 1YNZA 2CP3A 3VRYA 2K3BA 3MEAA 2P0KA 2KT1A 1YITA 2CZ1B 4CI0C 5GANf 1Q81U 1N9RA 2FPEA 1QP3A 4LN2A 1E7OA 1M3AA 2EPDA 2R57A 1GCPA 2E6ZA 1N27A 1TS9A 2PUKB 5IN1A 2HZYA 3X28B 2KRNA 4QKUA 4PFOA 4IUPA 2RHUA 2K2VA 3CCRQ 4XU2A 1K1ZA 2PQWA 1NLPC 5GANh 4BACA 2CREA 3CCSA 1X6GA 3CCMT 1Q7YU 3QSUA 1MMGA 1EIFA 2X9HA 5DY9A 4M7AA 3QDFA 1YCSB 1JRIA 1PD1A 3I56Q 2X4YA 2ZPGB 1M1KU 1QLYA 4WTOB 2L3SA 2PVOB 2CP7A 1LCKA 9ATCB 1D1AA 1EFNA 1H3HA 1X75C 2JS2A 2AIRB 2DMOA 1WA7A 3CCVT 1JXOA 1HK9A 4C0FA 2H3JA 4GLKA 1BI0A 4C5HA 2M0YA 1RLQC 1RI0A 4HA8A 3O5ZA 2K2MA 3G6ET 3CCRA 3OW2P 3MEUA 4JJDA 3CXCP 3OY9A 4C92F 3JCMP 2KROA 3G4ST 2RQRA 3LGLA 3DLMA 4A4FA 1ABOA 4C0DC 1JO8A 4E6RA 3I56A 1K9MC 1YJWQ 2D0NA 3AHUA 5FU6C 1N8RU 1UEBA 3MCAB 1WIEA 1WQ7A 2LDMA 2RI2A 3DKMA 5AT1B 1VQMA 5I21A 1PCXA 2B8AA 1XJWB 2F1LA 3JAME 3PT9A 4E7JA 5DLQE 5LJ3d 3A8MB 1JU5C 3QHSA 1VQOQ 2VYTA 1M3CA 2DKGA 3X20B 2DJQA 4F04B 2XI9A 1AZEA 4AFUC 3I55Q 2CP6A 2DRKA 3VJPA 5I2SA 3UWNA 2VGMA 4HVUA 5DLOA 1VQPT 1I5LA 3OYKA 5LJ3j 3L2UA 4KH0B 2CZ0B 4LDVA 1VQ7Q 1M3BA 2KY9A 3X24B 2K57A 1YJ9A 3C4SA 4CRIA 2BIVA 3PMTA 1YWOA 1YJNA 1I1JA 3FIFA 4M77C 3OYJA 3C94A 1I81A 4XU3A 2KMTA 3EG1A 4RMOA 1YCYA 4OMMA 1Y96A 3HP9A 4JDSA 2DE0X 4C92A 5GAMh 1BBZA 1SPKA 1VQNQ 3JB9J 2DYIA 2SRCA 2KI7A 1Q82R 2JJ9A 1HYOA 1OULA 2CGHA 3FLGA 3I55A 2JTEA 3VV0A 4F7UE 2MAMA 2XIDA 2R5AA 3LGFA 2MPXC 3VKIA 4WCIA 4C0DB 2ABLA 4FM4B 3VS7A 4M7AG 2K7AA 4M7DC 2ECZA 5FU6B 5L8RE 4XTWA 2OTJT 1MHNA 2A28A 1K73U 1C1AA 5KCHA 1IHWA 5KYYA 4M75G 1WNLA 3RKXA 1HD3A 2M51A 5LJ5e 2DILA 1UECA 2K5FA 5KYWB 1PSEA 1VQNA 1GCQC 2RB6A 1HSQA 2KEAA 3N5BB 1X27A 1Q86R 2FL7A 1R8OB 2G3RA 3OYLA 1IXDA 3JCMe 4FW1A 4J9HA 4J9EA 2Y90A 3QZ5B 3NHNA 3X25B 1NJIR 4ORZA 3KUFA 4CC3A 1YI2T 2F2VA 2FYKA 1FMKA 5GAMd 5GJWB 2DD4A 4J83A 3MP1A 3CBOA 3Q1JA 4F7UB 4J8OA 2FRYA 1ZHIA 1DJ7B 3L2QA 2EJFA 2VXEA 3CCLQ 1UFFA 3OYDA 1N6AA 3CMET 3QJ6A 4IUTA 3A1PA 4TVRA 1ARKA 5HCKA 1MNDA 3OYIA 4BE0A 3EGXA 4L5GA 5GAMj 1I4K1 2JM9A 1O75A 2RQTA 5CK9A 1OQKA 1TUDA 2MI6A 1BKBA 4RCCA 4M7DB 4RTXA 1JQQA 1M1FA 4PJOC 2IVWA 1C6VX 4E7ZA 1RI9A 3WVDB 2PVDB 2O01E 2BE9B 2C0IA 3NTHA 4ZTFA 4J7FA 2XKOC 1LPLA 5FW9A 4OMOA 4P5NA 1YHQQ 5HK3A 3EGDB 2LC4A 3QKJA 4F14A 4C92G 4E47A 3J81E 2JUFA 2AKLA 3TSZA 5GAOp 1G5VA 3PMIA 1YBYA 4M77G 4HCBA 3OSSC 2X35A 2EJGA 1ACMB 1QKXA 4R55A 2HBWA 2YRVA 2ENMA 2JTMA 2HSEB 2KQWA 2XU8A 3AT1B 4R56A 4N4HA 1M27C 1BU1A 5D6XA 3M55A 2AHJB 2CH4A 2KRMA 5EG2A 4JUVA 5HKCA 4QQDA 1NEGA 1PRMC 1FWZA 1OEBA 3OYYA 2J06A 2WSEE 3MP6A 1YHQA 3IQLA 3QYGB 4FIBA 5LJ5f 4A4GA 1RL2A 3CC2Q 2DL3A 4ELYC 3S6WA 2VKNA 1GBQA 2JW4A 4M78C 3UA6A 4B9WA 3TCJA 2XHCA 3OYFA 4AFZC 3I5SA 3FC3A 3TQ7P 1VQKT 3FJ5A 2LX9A 3L1AA 2EFIA 4OMPA 5LJ5h 4C8QC 1B07A 1W1FA 2EKOA 3JCMf 4M78E 3WXMB 1VQ8Q 2JZ2A 3JB9D 1U8RA 4IURA 3RBBB 3VS0A 1FX7A 2XDBA 1CSKA 3SDZA 1X6BA 1VYTA 2IG0A 3OBYA 1VQ6T 4A4EA 5A2QE 3GNGA 1TWBA 3CC2A 1LOJA 1I07A 5KYUA 3CCMQ 2L89A 2QTVA 1IGUA 4M4ZA 4AFQC 4JLGA 3FRNA 4OP0A 4MMKA 1AWWA 1M9SA 2L3RA 2J6KA 1R0CB 2A36A 3CCVQ 2RHYA 2C06A 3S3NA 3VYHB 3CPFA 2RHXA 3M54A 2MIOA 2OI3A 2EGEA 2QQBA 5LJ3e 2KK4A 3G6EQ 2RQVA 4M78B 5LL6S 4PJOG 3JCMc 4PNOA 3PE0A 3M57A 5GAN4 2VUBA 4XTUA 1MMAA 3SWNC 1GFCA 2K79A 2JMCA 5CQYA 3P8BB 4C8QB 1NE8A 2D9TA 2M1HA 1Q82U 1KQ2A 3HRUA 2K5IA 3MO8A 2CP0A 3NTIA 2F2WA 2HQEA 2MOXA 4IUQA 3UATA 4RG2A 4PFZA 1VIEA 3KFVA 4J9FA 3UPUA 1TG0A 3ASKA 2CYZB 1UDLA 1F1BB 4J9CA 3HPWA 4E7KA 2NUTA 4AG1C 3S3OA 2CH4W 1Q81C 3EG0A 5GMKl 1GXIE 1XNIA 2DFUA 2RMOA 4A54A 4Z88A 3L2ZA 2E10A 1IZ6A 4JJNK 1I8FA 3CCJT 2JM8A 5GAOq 1VQ9T 1K9MR 3CCET 1Q7YC 3GF5A 4LDXA 2E65A 2C0TA 2FO0A 5C0MA 3WVEB 2LCSA 1M1KC 4VUBA 2V1RA 4NL3A 4FT4A 2F69A 4XU1A 4BI4A 1TTHB 2O4XA 1WHJA 2LJ0A 4AMCA 5FWBA 4FSSA 1I5OB 1NJIU 1M4ZA 4FYVB 1XQHA 2J6OA 2YDLA 2E5KA 2HKQB 2PUOB 1AHJB 2QDYB 1B34A 4JJBA 2LJ1A 3EAEA 2CSIA 1KSWA 1NZ9A 1PG5B 1SHGA 3X26B 4N0AA 1AVZC 3SWNB 5CKBA 4WF2A 1OPKA 3VS6A 5CQXA 1OV3A 2LQ8A 3RR6A 1WHGA 3NFCA 1ZUUA 4K11A 3V7SA 1N8RC 5CR2A 4UC4A 5CKEA 8AT1B 4PL6A 2DTOA 5EC7A 2E1HA 2DBKA 1M30A 3BE3A 2AZSA 2LX7A 2LMJA 5LJ3f 2DL5A 4PKCC 3NPFA 4O6JA 2EAYA 4M7AC 1Y07A 3H0FA 4OGEA 3C0CA 1NM7A 4Q5WA 1CKAA 4CC4B 3PIOA 1UE9A 2QA4Q 3E19A 4FCYA 4M75C 3UT1A 3CD6A 4M7AE 5LJ3h 3VS2A 1YI2Q 2KYMA 2HKNA 1RAHB 4MDXA 5D6WA 1X69A 1JJ2A 4QVCA 2D1XA 1W6XA 3QIIA 4IUVA 2E70A 1NPRA 4L59A 1RLPC 4V2SA 2XK0A 4M75E 1BCMA 3M56A 1PSFA 4FYXB 2YHTA 3CMEQ 3GBQA 3KXTA 4MDWA 3H8ZA 1BYMA 2O2OA 2BKDN 1ABQA 3G71T 1WXUA 1KFZA 4E7HA 4RCBA 3GNFB 2QQRA 2H8HA 1EX4A 2QA4A 4RTTA 4KH1B 3CBMA 1BIBA 5IXBA 1UG1A 2KR3A 2BZ8A 2LP5A 1PC0A 3BDLA 2KXDA 3ZEHA 1K73C 1SRMA 3E9GA 1X43A 4XTYA 4R0KA 5GMKm 1KC8U 3M0PA 3UDCA 2GBQA 3HL8A 2NUPA 4MZMA 4GLMA 4LE9A 3EHRA 2OTLT 1NYGA 4M7AB 3T9NA 3V8JA 2ZPBB 1K8AU 2GNCA 2NYSA 2QGFB 4QVDA 1TSFA 1JEGA 4J5YA 2E3HA 5IAYA 2DVJA 2COWA 2DVEA 5GAN5 4M75B 2X3XD 1OI1A 4KUIA 5AYFA 3RIRA 2MYSA 1A0NB 2QQSA 4F7UF 3OS2A 1MGQA 6AT1B 4ANJA 2DO3A 2QEXT 2E12A 2K9GA 5KYNA 3RMSA 4C92C 1G3TA 1WX6A 1VQ5Q 1YJWA 2XG8D 5GAN7 3V8LA 4C5EA 3HKSA 5GAMf 5GAN3 3OYHA 2NWMA 4ELZC 3JCMJ 5HY6A 4BD3A 4X34A 1G83A 1VQKQ 2MK5A 3SB2A 4AT1B 1VQOA 2P4TA 4M77E 2WACA 5FROA 1CKBA 1QCNA 1UUEA 2A37A 1UHFA 4GY5A 3HSBA 4F16A 5KE3A 2KBTA 3EG2A 1UGRB 1VQLT 3SHWA 2JXBA 3C95A 1WDXA 1OX9A 2KRSA 4Z8AA 1ZBJA 3J7AF 1K9AA 4JRIA 4JLIA 1VIFA 1VQ7A 3CC7T 4O5VA 2FHDA 4XU0A 2KE9A 2YUNA 1VQ5A 2CZ6B 4X9CA 4RUGA 2VB6A 4DA4A 1B3QA 2CT4A 4ATOA 4HXJA 1YITT 1M90U 4M7DE 1TU0B 1D0XA 1U3OA 3SD4A 1JJ2S 3DB3A 4C0GA 2YXYA 2CSQA 1ZX6A 2QASA 4JZ4A 5HK0A 3V8KA 2D8JA 5KH6A 1KG1A 1D1BA 2E6NA 2EGCA 4HKEA 5CKDA 3EH1A 2A0FB 3HFNA 1ZQ1A 4XQ3A 5FRMA 2FG0A 3L42A 5FLXE 2C0OA 3ZL7C 1WI7A 4KGXB 3CCST 1Y96B 2LZ6B 3C12A 2DETA 1BB9A 1SKUB 4OGCA 3QWYA 4C92B 3A98A 1KD1U 4M7DD 2RPNA 5CKHA 1VOMA 4M77B 1WXTA 3E9FA 1R0BG 2MMPA 2B86A 4OMNA 3EG3A 5I11A 2X4WA 4N4IA 2DEUA 1NBEB 4A4KA 4ZNXA 3VUZA 2CDTA 1PKSA 4RTZA 2KT8A 3JV3A 4EPCA 1VYVA 2YT6A 2GF7A 3CCRT 1X2QA 5KYYB 4PJJA 1BI2A 2EYQA 4LNPA 2BZXA 4KGVB 1KIKA 2LTOA 3LH5A 2EW3A 4JJCA 4JPBW 1VQMT 5CO7A 3A8OB 1K0XA 2DLPA 1FXXA 3QBYA 1GBRA 2HSPA 3HTRA 3CCJQ 1QVFA 4FYWB 1Y0MA 2PVGB 4PJOE 3CCEQ 1UGPB 1Y57A 2LCCA 3JB9F 1AWOA 3CCLA 2M9UA 3I5RA 3GIBA 2F5KA 3REAB 3REBB 2L2PA 4D6WA 2O31A 1O9SA 2M02A 2D6FA 3JCMQ 1OYXA 2ZZDA 1Q81R 1T3LA 4IIMA 1RADB 3RUXA 5IXFA 3U23A 4M78F 1YJ9T 2RA2A 1N9SA 2AT1B 1YJNT 1OPLA 2HD0A 3QDRB 2EQIA 2DXCA 3EGXB 3GLXA 4C0ZA 2DTHA 2NUZA 1YFNA 1TXQA 1LVKA 1Q7YR 3OYEA 1RUWA 3CCEA 3CCQQ 1IGQA 4B9XA 4IKFA 5KE2A 1X01A 3L2VA 1B7TA 1M1KR 3JCMX 2MWOA 1MMNA 1SG5A 4BB7A 1JJ2P 4PJNA 1OU9A 1UGVA 4ZN3A 1Q82C 1E6HA 4DBQA 4A53A 3FEOA 5FU7C 1NYFA 4JRQA 2FVUA 4EMKA 1JBMA 2QAZA 2DL4A 4EMGA 5KYXA 4PJOB 4BE2A 4LDWA 1NLOC 2M16A 2D8HA 3G7ZA 2K5LA 4C8QE 4ZGEB 3A5ZB 5GANg 4OB1B 2CP2A 3CCQA 3S3MA 1PWTA 4XTXA 2DZCA 3MJXA 1VQNT 2M0OA 3QUIA 1G3YA 4M78D 1N8RR 4II1A 2ROTA 4KGZB 3CMAT 2QTXA 4KT0E 2KSSA 4JS4A 2J6FA 2DJZA 3LWHA 2JVVA 3OSVA 1ZSZA 1H3ZA 3DB4A 1RAAB 3EFOA 5A0LA 1U1SA 3OYCA 2VGNA 1M2VA 2QGGA 3HRSA 2XDDA 4DOVA 1VQ8A 3LH0A 1NJIC 3VYGA 2K6DA 3G71Q 1UTIA 1YWPA 4KULA 4FSXA 1H8KA 3HFOA 2EQMA 2LT4A 1TUCA 2VVKA 4BDZA 2I2LA 1YN8A 2ED0A 4KBMB 2D0QB 3RKYA 2RQUA 4FU6A 3EG9A 4AFSC 3EHQA 1OX8A 5FU7B 3CCMA 2ROLA 3KBGA 3G4SQ 3ZFJA 1WPYA 1K76A 2X51A 1YP5A 1S1NA 2FPFA 2IPOB 1QVFS 1D3BA 2RNAA 3PGGA 2DERA 4J9BA 1RAEB 2Z0WA 1D09B 1I0CA 4OB3B 4PLLA 2RJFA 2HL3A 2OTLQ 3LLRA 3CCVA 2BZYA 4LXCA 3M0RA 1QP2A 2V8IA 3CCUT 2RF0A 2GFAA 3PTAA 1HJDA 3JB9H 2E41A 3M53A 4X9DA 1KJWA 3G6EA 3OS5A 2JNGA 4QT7A 4NL2A 5CKFA 1VYUA 3A8GB 1QCFA 2PNIA 1SRLA 3G4SA 2QG9B 2O88A 1VQPQ 2DXBA 4RTUA 2NLUA 2EQKA 4HCZA 3QWXX 1U06A 3JCMV 2ESWA 2DX1A 2QQAA 3GP8A 2BTTA 4BI8B 1Q86U 3FJPA 4N0AC 1Q95G 5M9OA 3JB9G 4EDUA 5J26A 1YHQT 2HQXA 3NMZC 4NS5A 2GQVA 1VQLQ 2COYA 5CCAA 3H6ZA 3MEWA 1IREB 3M5AA 1VQPA 3UF4A 3CPWA 1V76A 1OZ2A 4HVVA 4LUDA 4M7AF 3DLLA 2FB7A 2OTJQ 1RABB 3BY7A 2QYZA 1WFWA 4MMLA 5FWCA 1GL5A 1OOTA 2LJ3A 1KC8C 2ATCB 5GAOr 2RHIA 1T3SA 4X1VA 3ME9A 2YUOA 4M75F 3EFSA 1KK7A 5I22A 4OB0B 2ZGWA 3NTKA 1OU8A 1K8AC 4CC7A 3M0UA 1Z9QA 2YUPA 3LX7A 2DRMA 1QW1A 3CC2T 4HCKA 2VXFA 1X6OA 2FPDA 4C5IA 3CCSQ 2K3XA 2O4XB 4B6MA 5FRNA 1H641 1WHKA 5GMKe 2IIMA 1ZLMA 5GMKi 2L3QA 4NOYA 1K4US 2DA9A 4FT2A 2K4YA 1B34B 2DD5A 5IHIA 2O9VA 1U5SA 2HNIA 2J05A 2OTJA 1FMWA 3TEEA 2GGRA 4CC2A 1MUZA 3QG1A 1QVFP 3OYGA 3JCMb 3EFRA 1J3TA 1VQ4T 1WGSA 2DF6A 4A63B 2DNUA 4QW2A 2X3WD 3OYBA 2EYXA 4M7AD 1PM3A 3BDUA 1AWJA 1TOVA 1BIAA 1WZOA 4QQGA 2JS0A 2HAXA 2LVMA 4DBHA 4M75D 2E5QA 1D0YA 4M75A 3EGUA 1VQMQ 4DEXA 1YI2A 3LWIA 4PJMA 2EWNA 4QVZA 3CC4T 2RI5A 2L3PA 2OX7A 4OVAA 1PRLC 1WHHA 1M90C 2X4XA 4OB2B 3TVTA 3QYHB 3ZBDA 2RH2A 1WJSA 2Y4XA 3HHTB 3CMEA 1S72T 3MKDA 1WYXA 1MV0B 2VASA 4L6V5 3PNWC 2QXFA 2YLBA 1N5ZA 2EGAA 2PU9B 1C0MA 3INZA 4IUUA 4E7IA 4RTWA 2ZCFB 2KVQG 4M77F 1QVPA 2P84A 1YJ9Q 1YIJT 2DIGA 1YJNQ 1KD1C 3E1SA 2DXTA 1R77A 2VV5A 5J3BA 3M0QA 4BI3A 2RHZA 3BFMA 5GANd 3VS4A 2LT1A 2ZAEA 4DQ2A 5DM7R 3CPWS 2E3IA 5LJ5g 2RI3A 4XTZA 4RTYA 1VUBA 4C92E 3GOXA 4M7DF 1GRIA 1W2BA 1WHMA 2RK2A 1AWXA 2FEIA 1PKTA 1QWEA 3MPUB 1BI1A 3JRZA 1RACB 1IO6A 1AOJA 1TH7A 1VA7A 2L8DA 5GANj 5KYWA 2NUPB 3M59A 1AEYA 3JCMg 3OYAA 4J9IA 1NG2A 2RJCA 5GAOn 4DBFA 5GMKh 1QQJA 1P92A 5KCOA 4GBQA 4C92D 4ZTJA 1VQ6Q
chains in the Genus database with same CATH topology
1NE8A 4PJOC 2E6ZA 3RUXA 1N27A 2D9TA 2PUKB 4HT8A 2DIQA 5IN1A 2M1HA 4M78F 1Q82U 1KQ2A 3X28B 3HRUA 2K5IA 3MO8A 3NTIA 4FL6A 1YJ9T 2HQEA 2RA2A 4M77D 1N9SA 4IUQA 1YJNT 4IUPA 2RHUA 1KQSA 2K2VA 4RG2A 2HD0A 3QDRB 4XU2A 2PQWA 4M77A 2DXCA 1VIEA 5GANh 3GLXA 4C0ZA 3CCSA 2DTHA 3CCMT 4BACA 4ME7A 1Q7YU 1XTDA 3UPUA 3QSUA 1EIFA 1UGSB 3ASKA 5DY9A 4ZN1A 3M58A 4M7AA 5GAN8 1QVGA 2CYZB 3RMQA 2DPPB 3OYEA 4MZPA 1JRIA 1VQKA 2X4YA 3CCEA 1OZ3A 2V8JA 2ZPGB 3HPWA 4E7KA 1M1KU 4B9XA 4F7UA 4IKFA 5KE2A 3S3OA 1X01A 2JTFA 5CIUA 3L2VA 1Q81C 3QXEB 2PVOB 5GMKl 1GXIE 3JCMX 3CD6T 2MWOA 1XNIA 4A54A 4C5GA 4BB7A 1X75C 3L2ZA 4ZN3A 2E10A 1Q82C 1IZ6A 3CCVT 4A53A 1K9MU 1HK9A 3FEOA 5FU7C 4C0FA 4JJNK 2H3JA 1I8FA 4XTVA 5A0DA 3CCJT 4JRQA 5GAOq 4GLKA 3GPLA 1BI0A 1VQ9T 4LD6A 4C5HA 5I2MA 2DK3A 2FVUA 3CCET 4EMKA 1Q7YC 1VQ6A 2WSFE 4MZTA 3GF5A 3M4GA 1JBMA 1WQWA 4EMGA 4LDXA 4M7DA 4PJOB 1RI0A 2E65A 2R5MA 3QZ9B 4LDWA 4BE2A 4J6YA 4HA8A 5C0MA 3JSCA 3WVEB 2F5TX 2M16A 1M1KC 3G6ET 3CCRA 3G7ZA 3MEUA 4VUBA 4Z02A 4NL3A 2K5LA 4FT4A 2F69A 4XU1A 2RJDA 4C92F 3OY9A 3CMAA 3JCMP 4BI4A 4C8QE 4ZGEB 2O4XA 3G4ST 1KHIA 3OQ5A 4A4FA 3LGLA 3DLMA 4PJOF 3A5ZB 5GANg 4OB1B 1BI3A 4C0DC 3I56A 3META 2QQ9A 3CCQA 3S3MA 2QA4T 1M4ZA 1NJIU 1XQHA 1K9MC 4XTXA 1Y71A 2DZ9A 2DZCA 3AHUA 1VQNT 2M0OA 2JN0A 3QUIA 5FU6C 1N8RU 1UEBA 3MCAB 1WQ7A 1AHJB 2LDMA 2PUOB 2QDYB 1B34A 2RI2A 3DKMA 2ZPFB 3QO3A 1VQMA 5I21A 1G3YA 2B8AA 3EAEA 4M78D 2X4JA 4PLIA 4II1A 3HRTA 1NZ9A 2P0QA 3LYIA 3X26B 3CMAT 2K3YA 3JAME 2QTXA 4KT0E 2KSSA 4JS4A 3PT9A 4N0AA 2DJZA 5DLQE 2JVVA 3SWNB 3OSVA 5LJ3d 3LWHA 4E7JA 5CKBA 3A8MB 2ZPHB 5A0GA 1H3ZA 3I56T 3DB4A 3FDRA 4ZGDB 3VU3C 3QHSA 5A0LA 1U1SA 3OYCA 2VGNA 4WF2A 3A8HB 2VYTA 4ZGJB 5CQXA 2DKGA 3HRSA 2XDDA 3X20B 4DOVA 1KHCA 1VQ8A 2LQ8A 5GMKj 3LH0A 2XI9A 1NJIC 3VYGA 3NFCA 3V7SA 3VJPA 1N8RC 5I2SA 5CR2A 3UWNA 2VGMA 3OBWA 1KQ1A 5DLOA 4KULA 4FSXA 4UC4A 1VQPT 1I5LA 2WSCE 3HFOA 5CKEA 2BUDA 2EQMA 2LT4A 3OYKA 5LJ3j 3L2UA 4BDZA 2CZ0B 4LDVA 4PL6A 2DTOA 2I2LA 2KY9A 3X24B 2K57A 2V8KA 2E1HA 2ZPEB 3C4SA 4KBMB 4CRIA 3OS1A 2BIVA 2D0QB 3RKYA 1YJ9A 4HT9A 3PMTA 1YJNA 3FIFA 4FU6A 4M77C 5LJ3f 3OYJA 3C94A 1I81A 2XD0A 4PKCC 2KMTA 4XU3A 4O6JA 5FU7B 4RMOA 3CCMA 2EAYA 4M7AC 3KBGA 2RO0A 1YCYA 1Y07A 3ZFJA 1M8VA 1Y96A 1WPYA 4Y91A 4OGEA 3HP9A 4JDSA 4Q5WA 3R6OA 3M4YA 3PIOA 3CCUA 3E19A 4C92A 4N4GA 5GAMh 1D3BA 1W2BS 1QVFS 4PJOD 1YJWT 1HXDA 3PGGA 3JB9J 3P8HA 4M75C 4OMFB 3UT1A 3CD6A 4M7AE 4PJOA 2QI2A 5LJ3h 4OB3B 4PLLA 2CGHA 2RJFA 4MDXA 5D6WA 4LDUA 2DEQA 3J80E 3FLGA 3I55A 3LLRA 3CCVA 1JJ2A 3VV0A 4C8QF 4F7UE 2MAMA 2XIDA 4QVCA 2A3LA 3QIIA 4IUVA 2R5AA 3LGFA 3VKIA 3CCJA 2E70A 1VQ9A 1NPRA 4L59A 4C0DB 4V2SA 2XK0A 1QP2A 2R58A 2V8IA 2ZPIB 4M75E 4EMKC 4LD9K 4FM4B 4M7AG 2DXUA 3CCUT 1VQOT 2GFAA 2KDSA 3PTAA 4M7DC 2P0PA 2RM4A 3M56A 1PSFA 2YHTA 5FU6B 4YTLA 5L8RE 3JB9H 4XTWA 2E41A 3M53A 4KUDK 2E64A 4F7UG 2OTJT 4X9DA 4XK8E 3KXTA 1MHNA 3G6EA 3OS5A 4J6WA 4MDWA 2JNGA 1K73U 5KCHA 3I55T 1ZBXA 3H8ZA 4M75G 4NL2A 5CKFA 1WNLA 3SFMA 3A8GB 3OW2A 1Y7XA 3PIPA 1BYMA 2BKDN 3G4SA 1U1TA 3G71T 2Y4YA 3CXCA 1KQSS 3QJYA 2DXBA 2RJEA 2NLUA 2CS7A 3RKXA 4E7HA 4RCBA 3GNFB 2EQKA 2QQRA 5LJ5e 1LJOA 4EMHA 5J39A 1VQ7T 2QA4A 1QVGS 4HCZA 3VUBA 2K5FA 1VQ5T 1PSEA 1VQNA 2L5QA 3CBMA 1BIBA 3RESA 3JCMV 4BY6C 2QQAA 2RB6A 3GP8A 4M7DG 3N5BB 4BI8B 1Q86U 2VC8A 3FJPA 3V7CA 5LJ3g 3OMCA 4N0AC 3JB9I 5IT9E 1V29B 2FL7A 3OB9A 1R8OB 3BDLA 2G3RA 5M9OA 3OYLA 4EDUA 5GAOl 3OA6A 3ZEHA 3JB9G 1K73C 5J26A 3E9GA 4XTYA 3JCMe 4A4HA 1YHQT 2HQXA 5GMKm 2Y90A 3CEYA 3QZ5B 1KC8U 3UDCA 3X25B 4JS5A 4NS5A 3KUFA 4RG8A 1YI2T 2EQJA 3HL8A 2FYKA 2GQVA 2KAFA 4MZMA 3RKWA 5GAMd 2OTLT 4M7AB 2DD4A 4J83A 3T9NA 4M78A 2ZPBB 3H6ZA 4LDYA 3MP1A 3V8JA 5CCAA 1K8AU 3BW1A 2LQKA 3CBOA 3MEWA 3RERA 1IREB 3M5AA 3Q1JA 1VQPA 4QVDA 5GAN2 3CPWA 4J5YA 4F7UB 4C8QD 4J8OA 1Q86C 5IAYA 1OZ2A 1ZHIA 1DJ7B 3JCMh 3L2QA 2EJFA 2VXEA 2DVEA 3QPHA 4C8QA 5GAN5 4M75B 3O8VA 3OYDA 3DLLA 4M7AF 1N6AA 3LW5E 3CMET 2FB7A 3QJ6A 4IUTA 1OI1A 3F70A 3BY7A 4TVRA 4MMLA 4KUIA 1KC8C 2DAQA 5AYFA 3RIRA 5GAOr 2QQSA 2RHIA 4F7UF 3OS2A 3OYIA 1MGQA 4BE0A 5GAMj 4L5GA 1I4K1 1WJQA 3ME9A 1O75A 5CK9A 4HCCA 2DO3A 2QEXT 2E12A 4M75F 2MI6A 4EMKB 4J7IA 1BKBA 3EFSA 4RCCA 3RMSA 4BE1A 4OB0B 4C92C 2ZGWA 4M7DB 1G3TA 3NTKA 1K8AC 1YJWA 2XG8D 5GAN7 1M1FA 3LX7A 3V8LA 2IVWA 3HKSA 1QW1A 4C5EA 5GAMf 5GAN3 3CC2T 4XAXB 1NPPA 2VXFA 1X6OA 3OYHA 1UGQB 4ELZC 3OMGA 4C5IA 3JCMJ 5HY6A 4BD3A 3MP8A 4JRPA 3WVDB 2K3XA 2O4XB 2O01E 2PVDB 4X34A 4E7LA 3L2WA 1H641 5FRNA 2GCXA 5D6YA 5GMKe 2LNVA 1VQ4A 3NTHA 4ZTFA 4J7FA 3P8DA 2XKOC 5GMKi 3L2RA 4NOYA 3SB2A 4P5NA 1VQOA 5HK3A 2GFUA 2P4TA 4M77E 2LC4A 4FT2A 2K4YA 3QKJA 1B34B 2WACA 3OYMA 2DD5A 5FROA 4BY6B 4C92G 2HNIA 4E47A 4DOWA 2JUFA 4GY5A 3TEEA 3J81E 2OTJA 2CZ7B 5LJ5d 3HSBA 5GANe 5KE3A 3QG1A 1UGRB 3OYGA 1VQLT 2EIFA 5GAOp 1G5VA 3JCMb 3C95A 3EFRA 3G71A 3PMIA 1YBYA 2MF2A 1VQ4T 2CKKA 4M77G 4HCBA 3OSSC 3P8BB 3J7AF 1WGSA 5C6SA 2X35A 2EJGA 4JRIA 4JLIA 4R55A 1VIFA 1SSFA 2YRVA 1VQ7A 2JTMA 4O5VA 2FHDA 2KQWA 2XU8A 4XU0A 3CC7T 1VQ5A 3CCLT 4R56A 2CZ6B 4N4HA 4QW2A 4X9CA 2RD1A 5D6XA 3M55A 3OYBA 2AHJB 3JCMd 4DA4A 5EG2A 4M7AD 4JUVA 5HKCA 4ATOA 1M90U 1YITT 4QQDA 5LJ5j 3CC4A 3PFSA 2XICA 3BDUA 4M7DE 1LNXA 1BIAA 5CVIA 1FWZA 3OYYA 3SD4A 3SWNA 4QQGA 3TREA 5GAN6 1JJ2S 3DB3A 2WSEE 3ER0A 4C0GA 2HAXA 3MP6A 2LVMA 1YHQA 5HK0A 4M75D 3QYGB 3V8KA 3CBPA 5KH6A 1KG1A 4FIBA 2E5QA 5LJ5f 4A4GA 2E6NA 1RL2A 4HKEA 2HBPA 5CKDA 4M75A 1S72A 3HFNA 1YI2A 4ELYC 1ZQ1A 4XQ3A 3LWIA 5GAMg 5FRMA 1G3WA 3L42A 4QQ6A 5FLXE 2OTLA 3S6WA 3JCMW 2RK1A 4M78C 2EWNA 4B9WA 4QVZA 3TCJA 2XHCA 3OYFA 1Y96B 3CCST 3CC4T 3C12A 2RI5A 2A7YA 3FC3A 1VQKT 4OVAA 4OGCA 2LX9A 3FB9A 4C92B 3L1AA 1D3BB 3OW2S 1KD1U 4M7DD 2EFIA 5LJ5h 1M90C 4C8QC 2X4XA 4OB2B 3CXCS 4J6XA 2EKOA 3QYHB 3JCMf 2RH2A 3ZBDA 4M78E 5CKHA 1WJSA 2Y4XA 3HHTB 3WXMB 3CMEA 1YIJA 1S72T 2JZ2A 4M77B 3JB9D 1U8RA 2EQUA 4IURA 2OAUA 1M1GA 3E9FA 4L6V5 2MMPA 3PNWC 2QXFA 2YLBA 3OS0A 1FX7A 4OF1A 3TU4K 2XDBA 3SDZA 1G3SA 2X4WA 2PU9B 3URGA 3INZA 3OYNA 4N4IA 1WJRA 2QEXA 4IUUA 5CAIA 4E7IA 2IG0A 4JRKA 4Y28E 4M78G 2DTIA 2ZCFB 3OBYA 1VQ6T 4A4EA 2KVQG 4M77F 1QVPA 3VUZA 2MWPA 4A4KA 5A2QE 4BDYA 4RKUE 3GNGA 1JB0E 2YLCA 4EPCA 1YIJT 3CC2A 1M5Q1 2DIGA 1KD1C 2GF7A 4C8QG 1LOJA 3CCRT 3E1SA 2DXTA 1BI2A 2VV5A 5J3BA 2EYQA 4BI3A 2L89A 2RHZA 5GAOm 4JLGA 3BFMA 3FRNA 5GANd 3CCQT 2LT1A 4OP0A 4DQ2A 3MHXA 2JOYA 2LTOA 4MMKA 5DM7R 3CPWS 1M9SA 2L3RA 1VQMT 5LJ5g 3M9QA 1XOVA 5CO7A 2RI3A 3A8OB 4XTZA 1VQLA 1FXXA 1VUBA 2RHYA 3QBYA 4C92E 3GOXA 4M7DF 4BUGA 1W4SA 2C06A 3V7RA 1QVFA 1W2BA 3S3NA 2RK2A 3VYHB 3CPFA 2RHXA 2EJ9A 2PVGB 4PJOE 1UGPB 2XDPA 1BI1A 2LCCA 3JRZA 5GAMe 3CC7A 3M54A 3JB9F 3CCLA 1TH7A 2L8DA 2LRQA 2M9UA 3MEVA 5GANj 2QQBA 5LJ3e 3A8LB 3M59A 1VQ8T 3GIBA 2LCLA 1UB4A 2F5KA 3JCMg 3OYAA 2KK4A 3MEAA 2P0KA 4M78B 5LL6S 4PJOG 3JCMc 2RJCA 4D6WA 1YITA 5GAOn 2CZ1B 4CI0C 5GANf 1O9SA 1Q81U 4PNOA 5GMKh 1P92A 3M57A 5KCOA 5GAN4 2D6FA 2VUBA 1N9RA 4XTUA 1QP3A 3SWNC 4C92D 3JCMQ 4ZTJA 5CQYA 1OYXA 2ZZDA 4C8QB 2R57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJO C;  1KQ1 A;  4M75 A;  4M7A B;  3RUX A;  3HFN A;  1I5L A;  4HT8 A;  3HFO A;  4XQ3 A;  4M78 A;  3V8J A;  5GAM g;  3RER A;  4M78 F;  1KQ2 A;  5LJ3 j;  3BW1 A;  2DTO A;  3JCM W;  2I2L A;  4M77 D;  2EWN A;  2RA2 A;  4M78 C;  1N9S A;  2K57 A;  4QVD A;  1Y96 B;  5GAN 2;  4J5Y A;  4F7U B;  4C8Q D;  2E1H A;  4XU2 A;  4M77 A;  4HT9 A;  3JCM h;  3RKY A;  5GAN h;  2EJF A;  2VXE A;  2DTH A;  2DVE A;  4C8Q A;  3QSU A;  3FB9 A;  4C92 B;  4M75 B;  3L1A A;  3FIF A;  4M77 C;  1D3B B;  5DY9 A;  5LJ3 f;  5GAN 5;  4M7A A;  4M7D D;  5GAN 8;  1I81 A;  5LJ5 h;  4M7A F;  4C8Q C;  4XU3 A;  2FB7 A;  1JRI A;  4J6X A;  2EAY A;  3BY7 A;  4M7A C;  4MML A;  1YCY A;  3JCM f;  4M78 E;  1M8V A;  1Y96 A;  1WPY A;  3RIR A;  4Y91 A;  4F7U A;  5GAO r;  4F7U F;  4M77 B;  1X01 A;  1MGQ A;  3JB9 D;  5GMK l;  5GAM j;  1I4K 1;  3JCM X;  4C92 A;  5GAM h;  2YLB A;  1D3B A;  4M75 F;  4A54 A;  4EMK B;  4PJO D;  3EFS A;  4RCC A;  1HXD A;  3PGG A;  3JB9 J;  3L2Z A;  4C92 C;  4M75 C;  2ZGW A;  3INZ A;  4M7D B;  4PJO A;  4M7A E;  5LJ3 h;  2E10 A;  5CAI A;  4A53 A;  4JRK A;  1HK9 A;  5GAN 7;  4M78 G;  2DTI A;  2CGH A;  1I8F A;  4XTV A;  3V8L A;  5GAM f;  5GAN 3;  4M77 F;  2DEQ A;  5GAO q;  2VXF A;  4C8Q F;  4F7U E;  4QVC A;  2YLC A;  4EMK A;  3JCM J;  4V2S A;  1M5Q 1;  3M4G A;  1JBM A;  1WQW A;  4EMG A;  4M7D A;  4M75 E;  1H64 1;  1LOJ A;  4C8Q G;  4EMK C;  5GMK e;  4PJO B;  2E65 A;  2DXT A;  2DXU A;  4M7A G;  4J6Y A;  4HA8 A;  4M7D C;  2RM4 A;  5GMK i;  2YHT A;  3JB9 H;  4NOY A;  4XTW A;  3SB2 A;  4NL3 A;  5GAO m;  2E41 A;  4XU1 A;  4C92 F;  2E64 A;  4M77 E;  4F7U G;  4X9D A;  3BFM A;  3JCM P;  4C8Q E;  4J6W A;  1B34 B;  5GAN d;  4OP0 A;  4DQ2 A;  4PJO F;  4MMK A;  4C92 G;  2HNI A;  4M75 G;  4NL2 A;  5GAN g;  1WNL A;  5LJ5 d;  3HSB A;  1U1T A;  5GAN e;  5GAO p;  5LJ5 g;  4XTX A;  3RKX A;  2DZ9 A;  2DZC A;  3JCM b;  3AHU A;  3EFR A;  4RCB A;  4XTZ A;  5LJ5 e;  2JN0 A;  1LJO A;  3QUI A;  4EMH A;  1WQ7 A;  4M77 G;  3QO3 A;  1B34 A;  4C92 E;  4M7D F;  5I21 A;  2EJG A;  4JRI A;  4M78 D;  3V7R A;  1BIB A;  4JLI A;  3RES A;  4XU0 A;  3JCM V;  2EJ9 A;  2QTX A;  4PJO E;  2RB6 A;  4M7D G;  4N0A A;  2DJZ A;  5LJ3 d;  3SWN B;  5GAM e;  4X9C A;  2RD1 A;  2VC8 A;  3FJP A;  3V7C A;  3JB9 F;  5LJ3 g;  1TH7 A;  4N0A C;  5GAN j;  3JCM d;  3JB9 I;  3VU3 C;  3QHS A;  5LJ3 e;  4M7A D;  1U1S A;  4JUV A;  3GIB A;  3JCM g;  3JB9 G;  4WF2 A;  5GAO l;  5LJ5 j;  4XTY A;  3BDU A;  3JCM e;  4M7D E;  4M78 B;  2DKG A;  1LNX A;  1BIA A;  4PJO G;  2Y90 A;  3JCM c;  5GMK m;  3SWN A;  5GAN 6;  5GMK j;  5GAO n;  5GAN f;  4PNO A;  5GMK h;  5GAN 4;  3SWN C;  1N9R A;  4XTU A;  3JCM Q;  3V7S A;  4M75 D;  2FYK A;  3V8K A;  4C92 D;  5LJ5 f;  4C8Q B;  3RKW A;  5GAM d; 
#chains in the Genus database with same CATH topology
 4LUE A;  4HT8 A;  2DIQ A;  1BK2 A;  2I0N A;  2HL5 C;  2OAW A;  4FL6 A;  4M77 D;  1KQS A;  2FRW A;  4M77 A;  2PTK A;  3CMA Q;  4ME7 A;  1XTD A;  1UGS B;  4ZN1 A;  2BE7 D;  3M58 A;  3SEM A;  5GAN 8;  1QVG A;  3RMQ A;  2DPP B;  1VQK A;  4MZP A;  1H92 A;  1OZ3 A;  2V8J A;  2HQH A;  4F7U A;  1RAG B;  2JTF A;  5CIU A;  1M2O A;  3QXE B;  1GFD A;  1QKW A;  3CD6 T;  1AZG B;  1RAI B;  2AKK A;  4C5G A;  1K9M U;  4XTV A;  5A0D A;  1WXB A;  3GPL A;  4LD6 A;  2DYB A;  5I2M A;  2DK3 A;  2CP5 A;  1VQ6 A;  2WSF E;  4HVW A;  3M4G A;  4MZT A;  1WQW A;  4M7D A;  2R5M A;  1K0S A;  3QZ9 B;  4J6Y A;  3JSC A;  2F5T X;  1FYN A;  1X2K A;  3M0T A;  1IB8 A;  2H3E B;  4Z02 A;  2RJD A;  2DL7 A;  3CMA A;  3M0S A;  2GTO A;  1KHI A;  3OQ5 A;  4PJO F;  2DM1 A;  1BI3 A;  3MET A;  2QQ9 A;  2OJ2 A;  2MCN A;  2QA4 T;  2W0Z A;  2GTJ A;  1Y71 A;  2DZ9 A;  2JN0 A;  3EGD A;  1T0J A;  3R6N A;  2GQI A;  3QO3 A;  1GCQ A;  2ZPF B;  2X4J A;  4PLI A;  3HRT A;  2P0Q A;  3LYI A;  2K3Y A;  2ZPH B;  5A0G A;  7AT1 B;  3I56 T;  8ATC B;  3FDR A;  4ZGD B;  3VU3 C;  3CCU Q;  2L0A A;  4F17 A;  5ECA A;  3A8H B;  4ZGJ B;  1KHC A;  5GMK j;  2HDA A;  2KXC A;  4J9D A;  3CPW P;  2P4R A;  3OBW A;  4J9G A;  2LQN A;  2JMA A;  1KQ1 A;  1VQ9 Q;  2WSC E;  1RAF B;  2BUD A;  2J7I A;  2KNB B;  2V8K A;  4FW2 A;  2ZPE B;  3OS1 A;  4HT9 A;  3VS1 A;  2O9S A;  3THK A;  4FYY B;  1V1C A;  4OML A;  2XD0 A;  2YSQ A;  1AD5 A;  2RO0 A;  1M8V A;  4Y91 A;  2YRD A;  1UHC A;  1D0Z A;  4D8D A;  3R6O A;  3M4Y A;  3H0H A;  3CCU A;  4N4G A;  4DBR A;  1W2B S;  4PJO D;  1YJW T;  1HXD A;  2A08 A;  3P8H A;  4Y92 A;  4OMF B;  4PJO A;  2JT4 A;  2QI2 A;  2EVR A;  1UJ0 A;  4LDU A;  2DEQ A;  3J80 E;  2F2X A;  4C8Q F;  2A3L A;  1SEM A;  2COZ A;  3CCJ A;  1VQ9 A;  1QMC A;  3PVQ A;  2R58 A;  2ZPI B;  4EMK C;  2AK5 A;  4LD9 K;  5GJV B;  2DXU A;  1VQO T;  2KDS A;  2P0P A;  2RM4 A;  1D1C A;  4Z89 A;  4AG2 C;  4YTL A;  4KUD K;  2E64 A;  1W70 A;  4F7U G;  2V26 A;  4XK8 E;  3UA7 A;  4J6W A;  2W10 A;  2AZV A;  3I55 T;  1ZBX A;  3SFM A;  3OW2 A;  1Y7X A;  3PIP A;  1U1T A;  1KQS S;  2Y4Y A;  3CXC A;  3E2U A;  3QJY A;  2LNH B;  2PZ1 A;  2RJE A;  2CS7 A;  1LJO A;  4EMH A;  5J39 A;  1VQ7 T;  1QVG S;  3VUB A;  1VQ5 T;  2L5Q A;  1MNE A;  2RQW A;  4KRT A;  3RES A;  2YWW A;  4BY6 C;  4M7D G;  4OMQ A;  2VC8 A;  1TUG B;  3V7C A;  5LJ3 g;  3OMC A;  2EYW A;  3JB9 I;  5IT9 E;  1V29 B;  3OB9 A;  4PJL A;  1ZSZ C;  2HMA A;  3OA6 A;  5GAO l;  1EZZ B;  3VRZ A;  4A4H A;  3CEY A;  5IHK A;  1SF9 A;  1Z9Z A;  4JS5 A;  1T0H A;  4RG8 A;  3TSW A;  1JXM A;  2EQJ A;  1KC8 R;  2KAF A;  3RKW A;  1WLP B;  4E2F B;  4M78 A;  4LDY A;  3RER A;  3BW1 A;  2LQK A;  2DBM A;  3EH2 A;  3G1J A;  1VQ4 Q;  5GAN 2;  1Q86 C;  1K8A R;  4C8Q D;  3JCM h;  1IHV A;  4C8Q A;  3QPH A;  3NGP A;  3O8V A;  4PK4 A;  3D7S B;  3LW5 E;  4EIK A;  3F70 A;  2DAQ A;  1FMV A;  4D8K A;  3H9N A;  5L23 A;  2HCK A;  1WJQ A;  4DEY A;  4HCC A;  4EMK B;  2E4H A;  4J7I A;  2G6F X;  4BE1 A;  5KYX B;  1QWF A;  3VS3 A;  3I35 A;  1PNJ A;  4XAX B;  1NPP A;  2EYY A;  1UGQ B;  3OMG A;  3MP8 A;  4JRP A;  4E7L A;  3L2W A;  3CC4 Q;  1ZUY A;  2GCX A;  5D6Y A;  2LNV A;  1VQ4 A;  4IIO A;  5D7U A;  1MMD A;  3P8D A;  3L2R A;  2GFU A;  1UJY A;  2CUD A;  3OYM A;  4BY6 B;  1S72 Q;  5KYU B;  4DOW A;  1G8X A;  2CZ7 B;  5LJ5 d;  5GAN e;  3I9Q A;  1PD0 A;  1W2B P;  2EIF A;  2CT3 A;  3G71 A;  1ZSZ B;  2MF2 A;  2FZK B;  2CKK A;  4PFP A;  3EFO B;  5C6S A;  2DL8 A;  1BCO A;  2YRC A;  1SSF A;  2VWF A;  1M2V B;  3CCL T;  1YIJ Q;  4E7S A;  2RD1 A;  2XMF A;  3JCM d;  3ULR B;  3RDV A;  1ZA1 B;  1QCO A;  5LJ5 j;  3CC4 A;  3PFS A;  2XIC A;  1K73 R;  1LNX A;  2QEX Q;  5CVI A;  1M90 R;  2HEQ A;  3SWN A;  3TRE A;  5GAN 6;  3ER0 A;  2CUB A;  3CBP A;  1KQS P;  2HBP A;  1NEB A;  1S72 A;  3EG9 B;  5GAM g;  1G3W A;  4QQ6 A;  5IHN A;  2OTL A;  3JCM W;  1QVG P;  2RK1 A;  2A7Y A;  1E6G A;  1IRX A;  3FB9 A;  3H0I A;  1PHT A;  1D3B B;  3OW2 S;  3CXC S;  4J6X A;  1KD1 R;  1YIJ A;  2QK0 A;  3RNJ A;  5IH2 A;  2EQU A;  2OAU A;  1M1G A;  2RN8 A;  3OS0 A;  3TU4 K;  4OF1 A;  2LQW A;  1G3S A;  2KYB A;  3URG A;  3OYN A;  2QEX A;  1WJR A;  2EYZ A;  5CAI A;  1AT1 B;  1SHF A;  4JRK A;  2SEM A;  4Y28 E;  4M78 G;  1G2B A;  2NUT B;  2DTI A;  3CC7 Q;  4BDY A;  2MWP A;  4RKU E;  1JB0 E;  1ZA2 B;  2YLC A;  2EBP A;  2KGT A;  1M5Q 1;  3PVL A;  4C8Q G;  1MV3 A;  1YIT Q;  5GAO m;  4RTV A;  3CCQ T;  3MHX A;  2JOY A;  1ZSG A;  3CD6 Q;  2FZG B;  1WHL A;  3M9Q A;  1XOV A;  1ZUK A;  4ESR A;  3VS5 A;  1VQL A;  2V1Q A;  2ED1 A;  1W4S A;  4BUG A;  3V7R A;  1SSH A;  4JZ3 A;  2EJ9 A;  1M8M A;  2XDP A;  2EKH A;  5GAM e;  2FZC B;  3CC7 A;  3CQT A;  2LRQ A;  3H41 A;  3MEV A;  3A8L B;  1VQ8 T;  2LCL A;  1UB4 A;  2QDL A;  2YUQ A;  1YNZ A;  2CP3 A;  3VRY A;  2K3B A;  3MEA A;  2P0K A;  2KT1 A;  1YIT A;  2CZ1 B;  4CI0 C;  5GAN f;  1Q81 U;  1N9R A;  2FPE A;  1QP3 A;  4LN2 A;  1E7O A;  1M3A A;  2EPD A;  2R57 A;  1GCP A;  2E6Z A;  1N27 A;  1TS9 A;  2PUK B;  5IN1 A;  2HZY A;  3X28 B;  2KRN A;  4QKU A;  4PFO A;  4IUP A;  2RHU A;  2K2V A;  3CCR Q;  4XU2 A;  1K1Z A;  2PQW A;  1NLP C;  5GAN h;  4BAC A;  2CRE A;  3CCS A;  1X6G A;  3CCM T;  1Q7Y U;  3QSU A;  1MMG A;  1EIF A;  2X9H A;  5DY9 A;  4M7A A;  3QDF A;  1YCS B;  1JRI A;  1PD1 A;  3I56 Q;  2X4Y A;  2ZPG B;  1M1K U;  1QLY A;  4WTO B;  2L3S A;  2PVO B;  2CP7 A;  1LCK A;  9ATC B;  1D1A A;  1EFN A;  1H3H A;  1X75 C;  2JS2 A;  2AIR B;  2DMO A;  1WA7 A;  3CCV T;  1JXO A;  1HK9 A;  4C0F A;  2H3J A;  4GLK A;  1BI0 A;  4C5H A;  2M0Y A;  1RLQ C;  1RI0 A;  4HA8 A;  3O5Z A;  2K2M A;  3G6E T;  3CCR A;  3OW2 P;  3MEU A;  4JJD A;  3CXC P;  3OY9 A;  4C92 F;  3JCM P;  2KRO A;  3G4S T;  2RQR A;  3LGL A;  3DLM A;  4A4F A;  1ABO A;  4C0D C;  1JO8 A;  4E6R A;  3I56 A;  1K9M C;  1YJW Q;  2D0N A;  3AHU A;  5FU6 C;  1N8R U;  1UEB A;  3MCA B;  1WIE A;  1WQ7 A;  2LDM A;  2RI2 A;  3DKM A;  5AT1 B;  1VQM A;  5I21 A;  1PCX A;  2B8A A;  1XJW B;  2F1L A;  3JAM E;  3PT9 A;  4E7J A;  5DLQ E;  5LJ3 d;  3A8M B;  1JU5 C;  3QHS A;  1VQO Q;  2VYT A;  1M3C A;  2DKG A;  3X20 B;  2DJQ A;  4F04 B;  2XI9 A;  1AZE A;  4AFU C;  3I55 Q;  2CP6 A;  2DRK A;  3VJP A;  5I2S A;  3UWN A;  2VGM A;  4HVU A;  5DLO A;  1VQP T;  1I5L A;  3OYK A;  5LJ3 j;  3L2U A;  4KH0 B;  2CZ0 B;  4LDV A;  1VQ7 Q;  1M3B A;  2KY9 A;  3X24 B;  2K57 A;  1YJ9 A;  3C4S A;  4CRI A;  2BIV A;  3PMT A;  1YWO A;  1YJN A;  1I1J A;  3FIF A;  4M77 C;  3OYJ A;  3C94 A;  1I81 A;  4XU3 A;  2KMT A;  3EG1 A;  4RMO A;  1YCY A;  4OMM A;  1Y96 A;  3HP9 A;  4JDS A;  2DE0 X;  4C92 A;  5GAM h;  1BBZ A;  1SPK A;  1VQN Q;  3JB9 J;  2DYI A;  2SRC A;  2KI7 A;  1Q82 R;  2JJ9 A;  1HYO A;  1OUL A;  2CGH A;  3FLG A;  3I55 A;  2JTE A;  3VV0 A;  4F7U E;  2MAM A;  2XID A;  2R5A A;  3LGF A;  2MPX C;  3VKI A;  4WCI A;  4C0D B;  2ABL A;  4FM4 B;  3VS7 A;  4M7A G;  2K7A A;  4M7D C;  2ECZ A;  5FU6 B;  5L8R E;  4XTW A;  2OTJ T;  1MHN A;  2A28 A;  1K73 U;  1C1A A;  5KCH A;  1IHW A;  5KYY A;  4M75 G;  1WNL A;  3RKX A;  1HD3 A;  2M51 A;  5LJ5 e;  2DIL A;  1UEC A;  2K5F A;  5KYW B;  1PSE A;  1VQN A;  1GCQ C;  2RB6 A;  1HSQ A;  2KEA A;  3N5B B;  1X27 A;  1Q86 R;  2FL7 A;  1R8O B;  2G3R A;  3OYL A;  1IXD A;  3JCM e;  4FW1 A;  4J9H A;  4J9E A;  2Y90 A;  3QZ5 B;  3NHN A;  3X25 B;  1NJI R;  4ORZ A;  3KUF A;  4CC3 A;  1YI2 T;  2F2V A;  2FYK A;  1FMK A;  5GAM d;  5GJW B;  2DD4 A;  4J83 A;  3MP1 A;  3CBO A;  3Q1J A;  4F7U B;  4J8O A;  2FRY A;  1ZHI A;  1DJ7 B;  3L2Q A;  2EJF A;  2VXE A;  3CCL Q;  1UFF A;  3OYD A;  1N6A A;  3CME T;  3QJ6 A;  4IUT A;  3A1P A;  4TVR A;  1ARK A;  5HCK A;  1MND A;  3OYI A;  4BE0 A;  3EGX A;  4L5G A;  5GAM j;  1I4K 1;  2JM9 A;  1O75 A;  2RQT A;  5CK9 A;  1OQK A;  1TUD A;  2MI6 A;  1BKB A;  4RCC A;  4M7D B;  4RTX A;  1JQQ A;  1M1F A;  4PJO C;  2IVW A;  1C6V X;  4E7Z A;  1RI9 A;  3WVD B;  2PVD B;  2O01 E;  2BE9 B;  2C0I A;  3NTH A;  4ZTF A;  4J7F A;  2XKO C;  1LPL A;  5FW9 A;  4OMO A;  4P5N A;  1YHQ Q;  5HK3 A;  3EGD B;  2LC4 A;  3QKJ A;  4F14 A;  4C92 G;  4E47 A;  3J81 E;  2JUF A;  2AKL A;  3TSZ A;  5GAO p;  1G5V A;  3PMI A;  1YBY A;  4M77 G;  4HCB A;  3OSS C;  2X35 A;  2EJG A;  1ACM B;  1QKX A;  4R55 A;  2HBW A;  2YRV A;  2ENM A;  2JTM A;  2HSE B;  2KQW A;  2XU8 A;  3AT1 B;  4R56 A;  4N4H A;  1M27 C;  1BU1 A;  5D6X A;  3M55 A;  2AHJ B;  2CH4 A;  2KRM A;  5EG2 A;  4JUV A;  5HKC A;  4QQD A;  1NEG A;  1PRM C;  1FWZ A;  1OEB A;  3OYY A;  2J06 A;  2WSE E;  3MP6 A;  1YHQ A;  3IQL A;  3QYG B;  4FIB A;  5LJ5 f;  4A4G A;  1RL2 A;  3CC2 Q;  2DL3 A;  4ELY C;  3S6W A;  2VKN A;  1GBQ A;  2JW4 A;  4M78 C;  3UA6 A;  4B9W A;  3TCJ A;  2XHC A;  3OYF A;  4AFZ C;  3I5S A;  3FC3 A;  3TQ7 P;  1VQK T;  3FJ5 A;  2LX9 A;  3L1A A;  2EFI A;  4OMP A;  5LJ5 h;  4C8Q C;  1B07 A;  1W1F A;  2EKO A;  3JCM f;  4M78 E;  3WXM B;  1VQ8 Q;  2JZ2 A;  3JB9 D;  1U8R A;  4IUR A;  3RBB B;  3VS0 A;  1FX7 A;  2XDB A;  1CSK A;  3SDZ A;  1X6B A;  1VYT A;  2IG0 A;  3OBY A;  1VQ6 T;  4A4E A;  5A2Q E;  3GNG A;  1TWB A;  3CC2 A;  1LOJ A;  1I07 A;  5KYU A;  3CCM Q;  2L89 A;  2QTV A;  1IGU A;  4M4Z A;  4AFQ C;  4JLG A;  3FRN A;  4OP0 A;  4MMK A;  1AWW A;  1M9S A;  2L3R A;  2J6K A;  1R0C B;  2A36 A;  3CCV Q;  2RHY A;  2C06 A;  3S3N A;  3VYH B;  3CPF A;  2RHX A;  3M54 A;  2MIO A;  2OI3 A;  2EGE A;  2QQB A;  5LJ3 e;  2KK4 A;  3G6E Q;  2RQV A;  4M78 B;  5LL6 S;  4PJO G;  3JCM c;  4PNO A;  3PE0 A;  3M57 A;  5GAN 4;  2VUB A;  4XTU A;  1MMA A;  3SWN C;  1GFC A;  2K79 A;  2JMC A;  5CQY A;  3P8B B;  4C8Q B;  1NE8 A;  2D9T A;  2M1H A;  1Q82 U;  1KQ2 A;  3HRU A;  2K5I A;  3MO8 A;  2CP0 A;  3NTI A;  2F2W A;  2HQE A;  2MOX A;  4IUQ A;  3UAT A;  4RG2 A;  4PFZ A;  1VIE A;  3KFV A;  4J9F A;  3UPU A;  1TG0 A;  3ASK A;  2CYZ B;  1UDL A;  1F1B B;  4J9C A;  3HPW A;  4E7K A;  2NUT A;  4AG1 C;  3S3O A;  2CH4 W;  1Q81 C;  3EG0 A;  5GMK l;  1GXI E;  1XNI A;  2DFU A;  2RMO A;  4A54 A;  4Z88 A;  3L2Z A;  2E10 A;  1IZ6 A;  4JJN K;  1I8F A;  3CCJ T;  2JM8 A;  5GAO q;  1VQ9 T;  1K9M R;  3CCE T;  1Q7Y C;  3GF5 A;  4LDX A;  2E65 A;  2C0T A;  2FO0 A;  5C0M A;  3WVE B;  2LCS A;  1M1K C;  4VUB A;  2V1R A;  4NL3 A;  4FT4 A;  2F69 A;  4XU1 A;  4BI4 A;  1TTH B;  2O4X A;  1WHJ A;  2LJ0 A;  4AMC A;  5FWB A;  4FSS A;  1I5O B;  1NJI U;  1M4Z A;  4FYV B;  1XQH A;  2J6O A;  2YDL A;  2E5K A;  2HKQ B;  2PUO B;  1AHJ B;  2QDY B;  1B34 A;  4JJB A;  2LJ1 A;  3EAE A;  2CSI A;  1KSW A;  1NZ9 A;  1PG5 B;  1SHG A;  3X26 B;  4N0A A;  1AVZ C;  3SWN B;  5CKB A;  4WF2 A;  1OPK A;  3VS6 A;  5CQX A;  1OV3 A;  2LQ8 A;  3RR6 A;  1WHG A;  3NFC A;  1ZUU A;  4K11 A;  3V7S A;  1N8R C;  5CR2 A;  4UC4 A;  5CKE A;  8AT1 B;  4PL6 A;  2DTO A;  5EC7 A;  2E1H A;  2DBK A;  1M30 A;  3BE3 A;  2AZS A;  2LX7 A;  2LMJ A;  5LJ3 f;  2DL5 A;  4PKC C;  3NPF A;  4O6J A;  2EAY A;  4M7A C;  1Y07 A;  3H0F A;  4OGE A;  3C0C A;  1NM7 A;  4Q5W A;  1CKA A;  4CC4 B;  3PIO A;  1UE9 A;  2QA4 Q;  3E19 A;  4FCY A;  4M75 C;  3UT1 A;  3CD6 A;  4M7A E;  5LJ3 h;  3VS2 A;  1YI2 Q;  2KYM A;  2HKN A;  1RAH B;  4MDX A;  5D6W A;  1X69 A;  1JJ2 A;  4QVC A;  2D1X A;  1W6X A;  3QII A;  4IUV A;  2E70 A;  1NPR A;  4L59 A;  1RLP C;  4V2S A;  2XK0 A;  4M75 E;  1BCM A;  3M56 A;  1PSF A;  4FYX B;  2YHT A;  3CME Q;  3GBQ A;  3KXT A;  4MDW A;  3H8Z A;  1BYM A;  2O2O A;  2BKD N;  1ABQ A;  3G71 T;  1WXU A;  1KFZ A;  4E7H A;  4RCB A;  3GNF B;  2QQR A;  2H8H A;  1EX4 A;  2QA4 A;  4RTT A;  4KH1 B;  3CBM A;  1BIB A;  5IXB A;  1UG1 A;  2KR3 A;  2BZ8 A;  2LP5 A;  1PC0 A;  3BDL A;  2KXD A;  3ZEH A;  1K73 C;  1SRM A;  3E9G A;  1X43 A;  4XTY A;  4R0K A;  5GMK m;  1KC8 U;  3M0P A;  3UDC A;  2GBQ A;  3HL8 A;  2NUP A;  4MZM A;  4GLM A;  4LE9 A;  3EHR A;  2OTL T;  1NYG A;  4M7A B;  3T9N A;  3V8J A;  2ZPB B;  1K8A U;  2GNC A;  2NYS A;  2QGF B;  4QVD A;  1TSF A;  1JEG A;  4J5Y A;  2E3H A;  5IAY A;  2DVJ A;  2COW A;  2DVE A;  5GAN 5;  4M75 B;  2X3X D;  1OI1 A;  4KUI A;  5AYF A;  3RIR A;  2MYS A;  1A0N B;  2QQS A;  4F7U F;  3OS2 A;  1MGQ A;  6AT1 B;  4ANJ A;  2DO3 A;  2QEX T;  2E12 A;  2K9G A;  5KYN A;  3RMS A;  4C92 C;  1G3T A;  1WX6 A;  1VQ5 Q;  1YJW A;  2XG8 D;  5GAN 7;  3V8L A;  4C5E A;  3HKS A;  5GAM f;  5GAN 3;  3OYH A;  2NWM A;  4ELZ C;  3JCM J;  5HY6 A;  4BD3 A;  4X34 A;  1G83 A;  1VQK Q;  2MK5 A;  3SB2 A;  4AT1 B;  1VQO A;  2P4T A;  4M77 E;  2WAC A;  5FRO A;  1CKB A;  1QCN A;  1UUE A;  2A37 A;  1UHF A;  4GY5 A;  3HSB A;  4F16 A;  5KE3 A;  2KBT A;  3EG2 A;  1UGR B;  1VQL T;  3SHW A;  2JXB A;  3C95 A;  1WDX A;  1OX9 A;  2KRS A;  4Z8A A;  1ZBJ A;  3J7A F;  1K9A A;  4JRI A;  4JLI A;  1VIF A;  1VQ7 A;  3CC7 T;  4O5V A;  2FHD A;  4XU0 A;  2KE9 A;  2YUN A;  1VQ5 A;  2CZ6 B;  4X9C A;  4RUG A;  2VB6 A;  4DA4 A;  1B3Q A;  2CT4 A;  4ATO A;  4HXJ A;  1YIT T;  1M90 U;  4M7D E;  1TU0 B;  1D0X A;  1U3O A;  3SD4 A;  1JJ2 S;  3DB3 A;  4C0G A;  2YXY A;  2CSQ A;  1ZX6 A;  2QAS A;  4JZ4 A;  5HK0 A;  3V8K A;  2D8J A;  5KH6 A;  1KG1 A;  1D1B A;  2E6N A;  2EGC A;  4HKE A;  5CKD A;  3EH1 A;  2A0F B;  3HFN A;  1ZQ1 A;  4XQ3 A;  5FRM A;  2FG0 A;  3L42 A;  5FLX E;  2C0O A;  3ZL7 C;  1WI7 A;  4KGX B;  3CCS T;  1Y96 B;  2LZ6 B;  3C12 A;  2DET A;  1BB9 A;  1SKU B;  4OGC A;  3QWY A;  4C92 B;  3A98 A;  1KD1 U;  4M7D D;  2RPN A;  5CKH A;  1VOM A;  4M77 B;  1WXT A;  3E9F A;  1R0B G;  2MMP A;  2B86 A;  4OMN A;  3EG3 A;  5I11 A;  2X4W A;  4N4I A;  2DEU A;  1NBE B;  4A4K A;  4ZNX A;  3VUZ A;  2CDT A;  1PKS A;  4RTZ A;  2KT8 A;  3JV3 A;  4EPC A;  1VYV A;  2YT6 A;  2GF7 A;  3CCR T;  1X2Q A;  5KYY B;  4PJJ A;  1BI2 A;  2EYQ A;  4LNP A;  2BZX A;  4KGV B;  1KIK A;  2LTO A;  3LH5 A;  2EW3 A;  4JJC A;  4JPB W;  1VQM T;  5CO7 A;  3A8O B;  1K0X A;  2DLP A;  1FXX A;  3QBY A;  1GBR A;  2HSP A;  3HTR A;  3CCJ Q;  1QVF A;  4FYW B;  1Y0M A;  2PVG B;  4PJO E;  3CCE Q;  1UGP B;  1Y57 A;  2LCC A;  3JB9 F;  1AWO A;  3CCL A;  2M9U A;  3I5R A;  3GIB A;  2F5K A;  3REA B;  3REB B;  2L2P A;  4D6W A;  2O31 A;  1O9S A;  2M02 A;  2D6F A;  3JCM Q;  1OYX A;  2ZZD A;  1Q81 R;  1T3L A;  4IIM A;  1RAD B;  3RUX A;  5IXF A;  3U23 A;  4M78 F;  1YJ9 T;  2RA2 A;  1N9S A;  2AT1 B;  1YJN T;  1OPL A;  2HD0 A;  3QDR B;  2EQI A;  2DXC A;  3EGX B;  3GLX A;  4C0Z A;  2DTH A;  2NUZ A;  1YFN A;  1TXQ A;  1LVK A;  1Q7Y R;  3OYE A;  1RUW A;  3CCE A;  3CCQ Q;  1IGQ A;  4B9X A;  4IKF A;  5KE2 A;  1X01 A;  3L2V A;  1B7T A;  1M1K R;  3JCM X;  2MWO A;  1MMN A;  1SG5 A;  4BB7 A;  1JJ2 P;  4PJN A;  1OU9 A;  1UGV A;  4ZN3 A;  1Q82 C;  1E6H A;  4DBQ A;  4A53 A;  3FEO A;  5FU7 C;  1NYF A;  4JRQ A;  2FVU A;  4EMK A;  1JBM A;  2QAZ A;  2DL4 A;  4EMG A;  5KYX A;  4PJO B;  4BE2 A;  4LDW A;  1NLO C;  2M16 A;  2D8H A;  3G7Z A;  2K5L A;  4C8Q E;  4ZGE B;  3A5Z B;  5GAN g;  4OB1 B;  2CP2 A;  3CCQ A;  3S3M A;  1PWT A;  4XTX A;  2DZC A;  3MJX A;  1VQN T;  2M0O A;  3QUI A;  1G3Y A;  4M78 D;  1N8R R;  4II1 A;  2ROT A;  4KGZ B;  3CMA T;  2QTX A;  4KT0 E;  2KSS A;  4JS4 A;  2J6F A;  2DJZ A;  3LWH A;  2JVV A;  3OSV A;  1ZSZ A;  1H3Z A;  3DB4 A;  1RAA B;  3EFO A;  5A0L A;  1U1S A;  3OYC A;  2VGN A;  1M2V A;  2QGG A;  3HRS A;  2XDD A;  4DOV A;  1VQ8 A;  3LH0 A;  1NJI C;  3VYG A;  2K6D A;  3G71 Q;  1UTI A;  1YWP A;  4KUL A;  4FSX A;  1H8K A;  3HFO A;  2EQM A;  2LT4 A;  1TUC A;  2VVK A;  4BDZ A;  2I2L A;  1YN8 A;  2ED0 A;  4KBM B;  2D0Q B;  3RKY A;  2RQU A;  4FU6 A;  3EG9 A;  4AFS C;  3EHQ A;  1OX8 A;  5FU7 B;  3CCM A;  2ROL A;  3KBG A;  3G4S Q;  3ZFJ A;  1WPY A;  1K76 A;  2X51 A;  1YP5 A;  1S1N A;  2FPF A;  2IPO B;  1QVF S;  1D3B A;  2RNA A;  3PGG A;  2DER A;  4J9B A;  1RAE B;  2Z0W A;  1D09 B;  1I0C A;  4OB3 B;  4PLL A;  2RJF A;  2HL3 A;  2OTL Q;  3LLR A;  3CCV A;  2BZY A;  4LXC A;  3M0R A;  1QP2 A;  2V8I A;  3CCU T;  2RF0 A;  2GFA A;  3PTA A;  1HJD A;  3JB9 H;  2E41 A;  3M53 A;  4X9D A;  1KJW A;  3G6E A;  3OS5 A;  2JNG A;  4QT7 A;  4NL2 A;  5CKF A;  1VYU A;  3A8G B;  1QCF A;  2PNI A;  1SRL A;  3G4S A;  2QG9 B;  2O88 A;  1VQP Q;  2DXB A;  4RTU A;  2NLU A;  2EQK A;  4HCZ A;  3QWX X;  1U06 A;  3JCM V;  2ESW A;  2DX1 A;  2QQA A;  3GP8 A;  2BTT A;  4BI8 B;  1Q86 U;  3FJP A;  4N0A C;  1Q95 G;  5M9O A;  3JB9 G;  4EDU A;  5J26 A;  1YHQ T;  2HQX A;  3NMZ C;  4NS5 A;  2GQV A;  1VQL Q;  2COY A;  5CCA A;  3H6Z A;  3MEW A;  1IRE B;  3M5A A;  1VQP A;  3UF4 A;  3CPW A;  1V76 A;  1OZ2 A;  4HVV A;  4LUD A;  4M7A F;  3DLL A;  2FB7 A;  2OTJ Q;  1RAB B;  3BY7 A;  2QYZ A;  1WFW A;  4MML A;  5FWC A;  1GL5 A;  1OOT A;  2LJ3 A;  1KC8 C;  2ATC B;  5GAO r;  2RHI A;  1T3S A;  4X1V A;  3ME9 A;  2YUO A;  4M75 F;  3EFS A;  1KK7 A;  5I22 A;  4OB0 B;  2ZGW A;  3NTK A;  1OU8 A;  1K8A C;  4CC7 A;  3M0U A;  1Z9Q A;  2YUP A;  3LX7 A;  2DRM A;  1QW1 A;  3CC2 T;  4HCK A;  2VXF A;  1X6O A;  2FPD A;  4C5I A;  3CCS Q;  2K3X A;  2O4X B;  4B6M A;  5FRN A;  1H64 1;  1WHK A;  5GMK e;  2IIM A;  1ZLM A;  5GMK i;  2L3Q A;  4NOY A;  1K4U S;  2DA9 A;  4FT2 A;  2K4Y A;  1B34 B;  2DD5 A;  5IHI A;  2O9V A;  1U5S A;  2HNI A;  2J05 A;  2OTJ A;  1FMW A;  3TEE A;  2GGR A;  4CC2 A;  1MUZ A;  3QG1 A;  1QVF P;  3OYG A;  3JCM b;  3EFR A;  1J3T A;  1VQ4 T;  1WGS A;  2DF6 A;  4A63 B;  2DNU A;  4QW2 A;  2X3W D;  3OYB A;  2EYX A;  4M7A D;  1PM3 A;  3BDU A;  1AWJ A;  1TOV A;  1BIA A;  1WZO A;  4QQG A;  2JS0 A;  2HAX A;  2LVM A;  4DBH A;  4M75 D;  2E5Q A;  1D0Y A;  4M75 A;  3EGU A;  1VQM Q;  4DEX A;  1YI2 A;  3LWI A;  4PJM A;  2EWN A;  4QVZ A;  3CC4 T;  2RI5 A;  2L3P A;  2OX7 A;  4OVA A;  1PRL C;  1WHH A;  1M90 C;  2X4X A;  4OB2 B;  3TVT A;  3QYH B;  3ZBD A;  2RH2 A;  1WJS A;  2Y4X A;  3HHT B;  3CME A;  1S72 T;  3MKD A;  1WYX A;  1MV0 B;  2VAS A;  4L6V 5;  3PNW C;  2QXF A;  2YLB A;  1N5Z A;  2EGA A;  2PU9 B;  1C0M A;  3INZ A;  4IUU A;  4E7I A;  4RTW A;  2ZCF B;  2KVQ G;  4M77 F;  1QVP A;  2P84 A;  1YJ9 Q;  1YIJ T;  2DIG A;  1YJN Q;  1KD1 C;  3E1S A;  2DXT A;  1R77 A;  2VV5 A;  5J3B A;  3M0Q A;  4BI3 A;  2RHZ A;  3BFM A;  5GAN d;  3VS4 A;  2LT1 A;  2ZAE A;  4DQ2 A;  5DM7 R;  3CPW S;  2E3I A;  5LJ5 g;  2RI3 A;  4XTZ A;  4RTY A;  1VUB A;  4C92 E;  3GOX A;  4M7D F;  1GRI A;  1W2B A;  1WHM A;  2RK2 A;  1AWX A;  2FEI A;  1PKT A;  1QWE A;  3MPU B;  1BI1 A;  3JRZ A;  1RAC B;  1IO6 A;  1AOJ A;  1TH7 A;  1VA7 A;  2L8D A;  5GAN j;  5KYW A;  2NUP B;  3M59 A;  1AEY A;  3JCM g;  3OYA A;  4J9I A;  1NG2 A;  2RJC A;  5GAO n;  4DBF A;  5GMK h;  1QQJ A;  1P92 A;  5KCO A;  4GBQ A;  4C92 D;  4ZTJ A;  1VQ6 Q; 
#chains in the Genus database with same CATH homology
 1NE8 A;  4PJO C;  2E6Z A;  3RUX A;  1N27 A;  2D9T A;  2PUK B;  4HT8 A;  2DIQ A;  5IN1 A;  2M1H A;  4M78 F;  1Q82 U;  1KQ2 A;  3X28 B;  3HRU A;  2K5I A;  3MO8 A;  3NTI A;  4FL6 A;  1YJ9 T;  2HQE A;  2RA2 A;  4M77 D;  1N9S A;  4IUQ A;  1YJN T;  4IUP A;  2RHU A;  1KQS A;  2K2V A;  4RG2 A;  2HD0 A;  3QDR B;  4XU2 A;  2PQW A;  4M77 A;  2DXC A;  1VIE A;  5GAN h;  3GLX A;  4C0Z A;  3CCS A;  2DTH A;  3CCM T;  4BAC A;  4ME7 A;  1Q7Y U;  1XTD A;  3UPU A;  3QSU A;  1EIF A;  1UGS B;  3ASK A;  5DY9 A;  4ZN1 A;  3M58 A;  4M7A A;  5GAN 8;  1QVG A;  2CYZ B;  3RMQ A;  2DPP B;  3OYE A;  4MZP A;  1JRI A;  1VQK A;  2X4Y A;  3CCE A;  1OZ3 A;  2V8J A;  2ZPG B;  3HPW A;  4E7K A;  1M1K U;  4B9X A;  4F7U A;  4IKF A;  5KE2 A;  3S3O A;  1X01 A;  2JTF A;  5CIU A;  3L2V A;  1Q81 C;  3QXE B;  2PVO B;  5GMK l;  1GXI E;  3JCM X;  3CD6 T;  2MWO A;  1XNI A;  4A54 A;  4C5G A;  4BB7 A;  1X75 C;  3L2Z A;  4ZN3 A;  2E10 A;  1Q82 C;  1IZ6 A;  3CCV T;  4A53 A;  1K9M U;  1HK9 A;  3FEO A;  5FU7 C;  4C0F A;  4JJN K;  2H3J A;  1I8F A;  4XTV A;  5A0D A;  3CCJ T;  4JRQ A;  5GAO q;  4GLK A;  3GPL A;  1BI0 A;  1VQ9 T;  4LD6 A;  4C5H A;  5I2M A;  2DK3 A;  2FVU A;  3CCE T;  4EMK A;  1Q7Y C;  1VQ6 A;  2WSF E;  4MZT A;  3GF5 A;  3M4G A;  1JBM A;  1WQW A;  4EMG A;  4LDX A;  4M7D A;  4PJO B;  1RI0 A;  2E65 A;  2R5M A;  3QZ9 B;  4LDW A;  4BE2 A;  4J6Y A;  4HA8 A;  5C0M A;  3JSC A;  3WVE B;  2F5T X;  2M16 A;  1M1K C;  3G6E T;  3CCR A;  3G7Z A;  3MEU A;  4VUB A;  4Z02 A;  4NL3 A;  2K5L A;  4FT4 A;  2F69 A;  4XU1 A;  2RJD A;  4C92 F;  3OY9 A;  3CMA A;  3JCM P;  4BI4 A;  4C8Q E;  4ZGE B;  2O4X A;  3G4S T;  1KHI A;  3OQ5 A;  4A4F A;  3LGL A;  3DLM A;  4PJO F;  3A5Z B;  5GAN g;  4OB1 B;  1BI3 A;  4C0D C;  3I56 A;  3MET A;  2QQ9 A;  3CCQ A;  3S3M A;  2QA4 T;  1M4Z A;  1NJI U;  1XQH A;  1K9M C;  4XTX A;  1Y71 A;  2DZ9 A;  2DZC A;  3AHU A;  1VQN T;  2M0O A;  2JN0 A;  3QUI A;  5FU6 C;  1N8R U;  1UEB A;  3MCA B;  1WQ7 A;  1AHJ B;  2LDM A;  2PUO B;  2QDY B;  1B34 A;  2RI2 A;  3DKM A;  2ZPF B;  3QO3 A;  1VQM A;  5I21 A;  1G3Y A;  2B8A A;  3EAE A;  4M78 D;  2X4J A;  4PLI A;  4II1 A;  3HRT A;  1NZ9 A;  2P0Q A;  3LYI A;  3X26 B;  3CMA T;  2K3Y A;  3JAM E;  2QTX A;  4KT0 E;  2KSS A;  4JS4 A;  3PT9 A;  4N0A A;  2DJZ A;  5DLQ E;  2JVV A;  3SWN B;  3OSV A;  5LJ3 d;  3LWH A;  4E7J A;  5CKB A;  3A8M B;  2ZPH B;  5A0G A;  1H3Z A;  3I56 T;  3DB4 A;  3FDR A;  4ZGD B;  3VU3 C;  3QHS A;  5A0L A;  1U1S A;  3OYC A;  2VGN A;  4WF2 A;  3A8H B;  2VYT A;  4ZGJ B;  5CQX A;  2DKG A;  3HRS A;  2XDD A;  3X20 B;  4DOV A;  1KHC A;  1VQ8 A;  2LQ8 A;  5GMK j;  3LH0 A;  2XI9 A;  1NJI C;  3VYG A;  3NFC A;  3V7S A;  3VJP A;  1N8R C;  5I2S A;  5CR2 A;  3UWN A;  2VGM A;  3OBW A;  1KQ1 A;  5DLO A;  4KUL A;  4FSX A;  4UC4 A;  1VQP T;  1I5L A;  2WSC E;  3HFO A;  5CKE A;  2BUD A;  2EQM A;  2LT4 A;  3OYK A;  5LJ3 j;  3L2U A;  4BDZ A;  2CZ0 B;  4LDV A;  4PL6 A;  2DTO A;  2I2L A;  2KY9 A;  3X24 B;  2K57 A;  2V8K A;  2E1H A;  2ZPE B;  3C4S A;  4KBM B;  4CRI A;  3OS1 A;  2BIV A;  2D0Q B;  3RKY A;  1YJ9 A;  4HT9 A;  3PMT A;  1YJN A;  3FIF A;  4FU6 A;  4M77 C;  5LJ3 f;  3OYJ A;  3C94 A;  1I81 A;  2XD0 A;  4PKC C;  2KMT A;  4XU3 A;  4O6J A;  5FU7 B;  4RMO A;  3CCM A;  2EAY A;  4M7A C;  3KBG A;  2RO0 A;  1YCY A;  1Y07 A;  3ZFJ A;  1M8V A;  1Y96 A;  1WPY A;  4Y91 A;  4OGE A;  3HP9 A;  4JDS A;  4Q5W A;  3R6O A;  3M4Y A;  3PIO A;  3CCU A;  3E19 A;  4C92 A;  4N4G A;  5GAM h;  1D3B A;  1W2B S;  1QVF S;  4PJO D;  1YJW T;  1HXD A;  3PGG A;  3JB9 J;  3P8H A;  4M75 C;  4OMF B;  3UT1 A;  3CD6 A;  4M7A E;  4PJO A;  2QI2 A;  5LJ3 h;  4OB3 B;  4PLL A;  2CGH A;  2RJF A;  4MDX A;  5D6W A;  4LDU A;  2DEQ A;  3J80 E;  3FLG A;  3I55 A;  3LLR A;  3CCV A;  1JJ2 A;  3VV0 A;  4C8Q F;  4F7U E;  2MAM A;  2XID A;  4QVC A;  2A3L A;  3QII A;  4IUV A;  2R5A A;  3LGF A;  3VKI A;  3CCJ A;  2E70 A;  1VQ9 A;  1NPR A;  4L59 A;  4C0D B;  4V2S A;  2XK0 A;  1QP2 A;  2R58 A;  2V8I A;  2ZPI B;  4M75 E;  4EMK C;  4LD9 K;  4FM4 B;  4M7A G;  2DXU A;  3CCU T;  1VQO T;  2GFA A;  2KDS A;  3PTA A;  4M7D C;  2P0P A;  2RM4 A;  3M56 A;  1PSF A;  2YHT A;  5FU6 B;  4YTL A;  5L8R E;  3JB9 H;  4XTW A;  2E41 A;  3M53 A;  4KUD K;  2E64 A;  4F7U G;  2OTJ T;  4X9D A;  4XK8 E;  3KXT A;  1MHN A;  3G6E A;  3OS5 A;  4J6W A;  4MDW A;  2JNG A;  1K73 U;  5KCH A;  3I55 T;  1ZBX A;  3H8Z A;  4M75 G;  4NL2 A;  5CKF A;  1WNL A;  3SFM A;  3A8G B;  3OW2 A;  1Y7X A;  3PIP A;  1BYM A;  2BKD N;  3G4S A;  1U1T A;  3G71 T;  2Y4Y A;  3CXC A;  1KQS S;  3QJY A;  2DXB A;  2RJE A;  2NLU A;  2CS7 A;  3RKX A;  4E7H A;  4RCB A;  3GNF B;  2EQK A;  2QQR A;  5LJ5 e;  1LJO A;  4EMH A;  5J39 A;  1VQ7 T;  2QA4 A;  1QVG S;  4HCZ A;  3VUB A;  2K5F A;  1VQ5 T;  1PSE A;  1VQN A;  2L5Q A;  3CBM A;  1BIB A;  3RES A;  3JCM V;  4BY6 C;  2QQA A;  2RB6 A;  3GP8 A;  4M7D G;  3N5B B;  4BI8 B;  1Q86 U;  2VC8 A;  3FJP A;  3V7C A;  5LJ3 g;  3OMC A;  4N0A C;  3JB9 I;  5IT9 E;  1V29 B;  2FL7 A;  3OB9 A;  1R8O B;  3BDL A;  2G3R A;  5M9O A;  3OYL A;  4EDU A;  5GAO l;  3OA6 A;  3ZEH A;  3JB9 G;  1K73 C;  5J26 A;  3E9G A;  4XTY A;  3JCM e;  4A4H A;  1YHQ T;  2HQX A;  5GMK m;  2Y90 A;  3CEY A;  3QZ5 B;  1KC8 U;  3UDC A;  3X25 B;  4JS5 A;  4NS5 A;  3KUF A;  4RG8 A;  1YI2 T;  2EQJ A;  3HL8 A;  2FYK A;  2GQV A;  2KAF A;  4MZM A;  3RKW A;  5GAM d;  2OTL T;  4M7A B;  2DD4 A;  4J83 A;  3T9N A;  4M78 A;  2ZPB B;  3H6Z A;  4LDY A;  3MP1 A;  3V8J A;  5CCA A;  1K8A U;  3BW1 A;  2LQK A;  3CBO A;  3MEW A;  3RER A;  1IRE B;  3M5A A;  3Q1J A;  1VQP A;  4QVD A;  5GAN 2;  3CPW A;  4J5Y A;  4F7U B;  4C8Q D;  4J8O A;  1Q86 C;  5IAY A;  1OZ2 A;  1ZHI A;  1DJ7 B;  3JCM h;  3L2Q A;  2EJF A;  2VXE A;  2DVE A;  3QPH A;  4C8Q A;  5GAN 5;  4M75 B;  3O8V A;  3OYD A;  3DLL A;  4M7A F;  1N6A A;  3LW5 E;  3CME T;  2FB7 A;  3QJ6 A;  4IUT A;  1OI1 A;  3F70 A;  3BY7 A;  4TVR A;  4MML A;  4KUI A;  1KC8 C;  2DAQ A;  5AYF A;  3RIR A;  5GAO r;  2QQS A;  2RHI A;  4F7U F;  3OS2 A;  3OYI A;  1MGQ A;  4BE0 A;  5GAM j;  4L5G A;  1I4K 1;  1WJQ A;  3ME9 A;  1O75 A;  5CK9 A;  4HCC A;  2DO3 A;  2QEX T;  2E12 A;  4M75 F;  2MI6 A;  4EMK B;  4J7I A;  1BKB A;  3EFS A;  4RCC A;  3RMS A;  4BE1 A;  4OB0 B;  4C92 C;  2ZGW A;  4M7D B;  1G3T A;  3NTK A;  1K8A C;  1YJW A;  2XG8 D;  5GAN 7;  1M1F A;  3LX7 A;  3V8L A;  2IVW A;  3HKS A;  1QW1 A;  4C5E A;  5GAM f;  5GAN 3;  3CC2 T;  4XAX B;  1NPP A;  2VXF A;  1X6O A;  3OYH A;  1UGQ B;  4ELZ C;  3OMG A;  4C5I A;  3JCM J;  5HY6 A;  4BD3 A;  3MP8 A;  4JRP A;  3WVD B;  2K3X A;  2O4X B;  2O01 E;  2PVD B;  4X34 A;  4E7L A;  3L2W A;  1H64 1;  5FRN A;  2GCX A;  5D6Y A;  5GMK e;  2LNV A;  1VQ4 A;  3NTH A;  4ZTF A;  4J7F A;  3P8D A;  2XKO C;  5GMK i;  3L2R A;  4NOY A;  3SB2 A;  4P5N A;  1VQO A;  5HK3 A;  2GFU A;  2P4T A;  4M77 E;  2LC4 A;  4FT2 A;  2K4Y A;  3QKJ A;  1B34 B;  2WAC A;  3OYM A;  2DD5 A;  5FRO A;  4BY6 B;  4C92 G;  2HNI A;  4E47 A;  4DOW A;  2JUF A;  4GY5 A;  3TEE A;  3J81 E;  2OTJ A;  2CZ7 B;  5LJ5 d;  3HSB A;  5GAN e;  5KE3 A;  3QG1 A;  1UGR B;  3OYG A;  1VQL T;  2EIF A;  5GAO p;  1G5V A;  3JCM b;  3C95 A;  3EFR A;  3G71 A;  3PMI A;  1YBY A;  2MF2 A;  1VQ4 T;  2CKK A;  4M77 G;  4HCB A;  3OSS C;  3P8B B;  3J7A F;  1WGS A;  5C6S A;  2X35 A;  2EJG A;  4JRI A;  4JLI A;  4R55 A;  1VIF A;  1SSF A;  2YRV A;  1VQ7 A;  2JTM A;  4O5V A;  2FHD A;  2KQW A;  2XU8 A;  4XU0 A;  3CC7 T;  1VQ5 A;  3CCL T;  4R56 A;  2CZ6 B;  4N4H A;  4QW2 A;  4X9C A;  2RD1 A;  5D6X A;  3M55 A;  3OYB A;  2AHJ B;  3JCM d;  4DA4 A;  5EG2 A;  4M7A D;  4JUV A;  5HKC A;  4ATO A;  1M90 U;  1YIT T;  4QQD A;  5LJ5 j;  3CC4 A;  3PFS A;  2XIC A;  3BDU A;  4M7D E;  1LNX A;  1BIA A;  5CVI A;  1FWZ A;  3OYY A;  3SD4 A;  3SWN A;  4QQG A;  3TRE A;  5GAN 6;  1JJ2 S;  3DB3 A;  2WSE E;  3ER0 A;  4C0G A;  2HAX A;  3MP6 A;  2LVM A;  1YHQ A;  5HK0 A;  4M75 D;  3QYG B;  3V8K A;  3CBP A;  5KH6 A;  1KG1 A;  4FIB A;  2E5Q A;  5LJ5 f;  4A4G A;  2E6N A;  1RL2 A;  4HKE A;  2HBP A;  5CKD A;  4M75 A;  1S72 A;  3HFN A;  1YI2 A;  4ELY C;  1ZQ1 A;  4XQ3 A;  3LWI A;  5GAM g;  5FRM A;  1G3W A;  3L42 A;  4QQ6 A;  5FLX E;  2OTL A;  3S6W A;  3JCM W;  2RK1 A;  4M78 C;  2EWN A;  4B9W A;  4QVZ A;  3TCJ A;  2XHC A;  3OYF A;  1Y96 B;  3CCS T;  3CC4 T;  3C12 A;  2RI5 A;  2A7Y A;  3FC3 A;  1VQK T;  4OVA A;  4OGC A;  2LX9 A;  3FB9 A;  4C92 B;  3L1A A;  1D3B B;  3OW2 S;  1KD1 U;  4M7D D;  2EFI A;  5LJ5 h;  1M90 C;  4C8Q C;  2X4X A;  4OB2 B;  3CXC S;  4J6X A;  2EKO A;  3QYH B;  3JCM f;  2RH2 A;  3ZBD A;  4M78 E;  5CKH A;  1WJS A;  2Y4X A;  3HHT B;  3WXM B;  3CME A;  1YIJ A;  1S72 T;  2JZ2 A;  4M77 B;  3JB9 D;  1U8R A;  2EQU A;  4IUR A;  2OAU A;  1M1G A;  3E9F A;  4L6V 5;  2MMP A;  3PNW C;  2QXF A;  2YLB A;  3OS0 A;  1FX7 A;  4OF1 A;  3TU4 K;  2XDB A;  3SDZ A;  1G3S A;  2X4W A;  2PU9 B;  3URG A;  3INZ A;  3OYN A;  4N4I A;  1WJR A;  2QEX A;  4IUU A;  5CAI A;  4E7I A;  2IG0 A;  4JRK A;  4Y28 E;  4M78 G;  2DTI A;  2ZCF B;  3OBY A;  1VQ6 T;  4A4E A;  2KVQ G;  4M77 F;  1QVP A;  3VUZ A;  2MWP A;  4A4K A;  5A2Q E;  4BDY A;  4RKU E;  3GNG A;  1JB0 E;  2YLC A;  4EPC A;  1YIJ T;  3CC2 A;  1M5Q 1;  2DIG A;  1KD1 C;  2GF7 A;  4C8Q G;  1LOJ A;  3CCR T;  3E1S A;  2DXT A;  1BI2 A;  2VV5 A;  5J3B A;  2EYQ A;  4BI3 A;  2L89 A;  2RHZ A;  5GAO m;  4JLG A;  3BFM A;  3FRN A;  5GAN d;  3CCQ T;  2LT1 A;  4OP0 A;  4DQ2 A;  3MHX A;  2JOY A;  2LTO A;  4MMK A;  5DM7 R;  3CPW S;  1M9S A;  2L3R A;  1VQM T;  5LJ5 g;  3M9Q A;  1XOV A;  5CO7 A;  2RI3 A;  3A8O B;  4XTZ A;  1VQL A;  1FXX A;  1VUB A;  2RHY A;  3QBY A;  4C92 E;  3GOX A;  4M7D F;  4BUG A;  1W4S A;  2C06 A;  3V7R A;  1QVF A;  1W2B A;  3S3N A;  2RK2 A;  3VYH B;  3CPF A;  2RHX A;  2EJ9 A;  2PVG B;  4PJO E;  1UGP B;  2XDP A;  1BI1 A;  2LCC A;  3JRZ A;  5GAM e;  3CC7 A;  3M54 A;  3JB9 F;  3CCL A;  1TH7 A;  2L8D A;  2LRQ A;  2M9U A;  3MEV A;  5GAN j;  2QQB A;  5LJ3 e;  3A8L B;  3M59 A;  1VQ8 T;  3GIB A;  2LCL A;  1UB4 A;  2F5K A;  3JCM g;  3OYA A;  2KK4 A;  3MEA A;  2P0K A;  4M78 B;  5LL6 S;  4PJO G;  3JCM c;  2RJC A;  4D6W A;  1YIT A;  5GAO n;  2CZ1 B;  4CI0 C;  5GAN f;  1O9S A;  1Q81 U;  4PNO A;  5GMK h;  1P92 A;  3M57 A;  5KCO A;  5GAN 4;  2D6F A;  2VUB A;  1N9R A;  4XTU A;  1QP3 A;  3SWN C;  4C92 D;  3JCM Q;  4ZTJ A;  5CQY A;  1OYX A;  2ZZD A;  4C8Q B;  2R57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...