2RA2A

X-ray structure of the q7cpv8 protein from salmonella typhimurium at the resolution 1.9 a. northeast structural genomics consortium target str88a
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
55
structure length
55
Chain Sequence
PNYVMHTNDGRSIVTDGKPQTDNDTGMISYKDANGNKQQINRTDVKEMVALENLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipoprotein
molecule keywords Putative lipoprotein
publication title X-Ray structure of the Q7CPV8 protein from Salmonella typhimurium at the resolution 1.9 A.
rcsb
source organism Salmonella typhimurium lt2
total genus 8
structure length 55
sequence length 55
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ra2A00
2Y90A 5LJ3h 5LJ5j 4XTWA 5GAOp 4M7DE 3JB9D 3RERA 4C92B 1I4K1 4M7DF 1I5LA 5DY9A 4PJOG 3SB2A 3RIRA 1LOJA 5LJ3d 3HSBA 3JCMg 4M77B 2DZCA 2I2LA 3JCMQ 1WPYA 4JRKA 4M75B 3FJPA 1MGQA 4M78E 3RKWA 5GAN4 4M78F 2DEQA 3RESA 4M7DD 4M7AE 4M7DG 4C92A 5GMKl 3JCMf 5GANh 1TH7A 1Y96B 1D3BA 5GAMe 2EAYA 1H641 4WF2A 3HFOA 3L1AA 5CAIA 4N0AC 4XU1A 4C8QG 2E41A 5GMKe 3AHUA 2RD1A 4J6YA 3M4GA 4M78D 4M7AC 4M78G 5GANd 5GAMj 4HT8A 5GAN8 3JB9F 3V7SA 5GAOn 4OP0A 5LJ5e 3JCMX 3JCMJ 4M7AD 2E65A 4DQ2A 3FB9A 1I81A 1BIAA 5GAMg 4J6WA 4F7UA 4EMKB 3V7RA 2EJ9A 4C8QB 4C92E 5GMKm 3JB9H 3JB9G 2DJZA 1WQ7A 3JCMc 5LJ5g 3JCMP 5GAMf 1HK9A 4MMKA 5LJ3j 4HA8A 4C92C 2DXTA 3BDUA 4QVCA 3V8JA 1B34B 2DTIA 5LJ5f 2HNIA 1U1SA 4X9CA 4XU3A 4C92D 5GMKi 4M77C 2EJGA 3QSUA 4M7AF 4M75C 4XTZA 5GAOr 4PJOB 1X01A 2JN0A 4M77A 4F7UE 4RCBA 3QUIA 3PGGA 4M75A 4NOYA 3VU3C 2CGHA 4X9DA 5GANj 1KQ2A 3V7CA 2VXFA 3L2ZA 4EMGA 5GAN7 2EWNA 2FYKA 4V2SA 4M7AG 4M7DB 1Y96A 2K57A 3SWNB 4PJOA 3BW1A 1U1TA 3EFRA 4RCCA 2E10A 4HT9A 1I8FA 5GAN6 1M5Q1 5LJ3e 3RKYA 1JBMA 2E1HA 4C92F 3GIBA 2RB6A 4M78B 2DXUA 5GAOq 4M77E 4NL3A 1LJOA 3RKXA 1WNLA 3QHSA 4M75E 4M7AB 4M77F 4C8QC 5GMKh 3HFNA 4M75F 2DZ9A 1N9SA 4EMKA 5LJ3g 1M8VA 4C8QA 3BFMA 4C92G 2DVEA 1BIBA 4Y91A 5I21A 2DKGA 5LJ5h 4PJOE 4JUVA 2VXEA 3JCMh 4M77D 5GANe 3JCMV 3JCMb 4M75D 4JRIA 5LJ3f 4M75G 4F7UF 1N9RA 5LJ5d 1B34A 2DTOA 1JRIA 4PJOC 3JCMd 3JB9I 4EMHA 5GAN5 4J6XA 3RUXA 3EFSA 5GANg 5GAOl 1D3BB 2YHTA 4A54A 4PJOD 4C8QE 4J5YA 4F7UG 3BY7A 4C8QF 4M7DC 4XQ3A 3V8LA 3SWNC 5GANf 4XTXA 3QO3A 4M7DA 5GAN2 4EMKC 3SWNA 5GAMh 1YCYA 4QVDA 2DTHA 2RA2A 4PNOA 4XU0A 3JCMW 4M78C 4XTYA 4C8QD 2RM4A 1HXDA 2QTXA 2VC8A 3INZA 4MMLA 3FIFA 4XTVA 4XTUA 2FB7A 4F7UB 4JLIA 5GAN3 1WQWA 4M78A 5GAMd 2E64A 5GAOm 2YLBA 4N0AA 5GMKj 4NL2A 1LNXA 4PJOF 4M77G 1KQ1A 2EJFA 3V8KA 4XU2A 4A53A 2YLCA 3JCMe 4M7AA 3JB9J 2ZGWA
chains in the Genus database with same CATH superfamily
2JVVA 2RPNA 3EG9B 1VQLT 4PFZA 3O8VA 3OMGA 3CEYA 1PG5B 3QG1A 4C0ZA 4GLMA 1R0CB 2DEQA 2E3IA 1WXUA 3CCUA 4QW2A 2RI3A 3HRUA 5CAIA 5GMKe 3HFOA 4PK4A 1M1KC 3JCMX 4DQ2A 5GAMg 3G1JA 1M3BA 4DA4A 1RADB 3CC2T 2ROTA 5GMKm 1O75A 1WXTA 4C92C 3CCJQ 2DTIA 2MF2A 1CSKA 2CP5A 4M75C 2A7YA 2RI2A 3VU3C 2GQVA 2JS2A 1ACMB 4M7AG 1HYOA 3PVLA 3MKDA 2KI7A 1YJWQ 3GF5A 1I1JA 1VQPT 4J83A 1VQMT 3CCST 3GIBA 1YNZA 5GAOq 3ZEHA 4E47A 2IVWA 3OYFA 3CCVT 3VS1A 4KH0B 4HCBA 3CBPA 1M2OA 2E5QA 3CCMT 3IQLA 4OGCA 5LJ5h 2A3LA 2HL5C 2ZPHB 3L42A 2JXBA 4P5NA 2KYBA 2DTOA 2H8HA 1M1KU 4EMHA 2M1HA 1BI0A 1QWFA 1RACB 1YCSB 2EGAA 1D0ZA 2CKKA 4E7SA 3PIPA 2HEQA 2JMCA 1UECA 1HXDA 2RM4A 4LD6A 3OYGA 2RH2A 1T3LA 2EYWA 4D8KA 2YLCA 3VS4A 3RDVA 2ZPIB 5LJ3h 3CCQQ 1HD3A 3UWNA 1D1BA 1RABB 3M54A 2E5KA 2CREA 2HBPA 1WJQA 1KJWA 2CZ7B 2FVUA 5FU6B 2B86A 4LDXA 2O4XB 3M5AA 2OTJA 1M1FA 2YWWA 1M30A 4ZNXA 3RR6A 2MI6A 1X69A 1VQ7A 1OQKA 3UA6A 1N8RC 4OP0A 2IG0A 7AT1B 1NLPC 1I81A 2NWMA 2JTEA 3E9FA 2Z0WA 3TEEA 1D1AA 2FZKB 4ELZC 3I55A 3CPWP 1OU8A 2DXTA 3EG3A 3E19A 5GJVB 1M9SA 2J06A 3EG9A 2C0IA 2EW3A 3I56Q 3QSUA 2KRNA 4RKUE 1K8AC 4FT2A 1Q7YU 2PNIA 2WSCE 4PFPA 4JRQA 2RHZA 1CKAA 4OMMA 2CYZB 3SWNB 1U3OA 3VYHB 4QT7A 3EHRA 3CCJA 2K4YA 1BI1A 3A8MB 3J81E 4DBFA 5J26A 3O5ZA 4LE9A 1MMAA 1NEBA 2QA4Q 1M8VA 4BY6C 2DYIA 2JMAA 2LMJA 4HVUA 4J9DA 5KYWB 1PRLC 1D1CA 1Y07A 1YHQQ 3H0HA 1YITT 1YJWA 1VQ8Q 4HVVA 3EHQA 3OYHA 3JB9I 4J6XA 4PJOD 2HSPA 3DLMA 1D3BB 2YUOA 1UEBA 4M7DC 2F5KA 1YIJT 2COWA 3ASKA 2HQXA 3QYHB 1C0MA 2IIMA 5FU7C 2HMAA 4LDUA 4J7IA 2EGEA 1IHVA 4C5IA 5GAN3 2D6FA 4PJOF 4BI8B 3V8KA 4ZGEB 3NTIA 3C95A 1ZUYA 4R56A 1VA7A 1QVFS 4DBRA 5I2SA 2O9VA 1NEGA 1QP3A 5DY9A 2CS7A 3LX7A 1XJWB 2D9TA 4JRKA 3FJPA 2W0ZA 3GNFB 3RKWA 3PVQA 1N27A 1PD1A 3LWIA 3NMZC 4GY5A 4J9HA 1UHFA 2HL3A 2DIQA 3CCQA 1I0CA 1M2VB 4AFQC 2ATCB 2VYTA 3PTAA 3CPWS 3F70A 2PUKB 3D7SB 2M02A 1GCQA 1UGSB 3QDFA 3OSVA 1P92A 1VQ5Q 4QVCA 2W10A 4KULA 2JS0A 3G6EA 1UTIA 2EJGA 4HKEA 2ED1A 4RCBA 1QKWA 3CPFA 2DL7A 4EIKA 2AT1B 5IXBA 1FWZA 5KH6A 2VXFA 1KC8U 2O4XA 3CMEQ 2ESWA 4C5GA 2LX9A 2GCXA 3I56A 1RAHB 3RKXA 5DM7R 1VQ6Q 1YJNT 3M0TA 5HCKA 4LUEA 4L5GA 3HHTB 4PJOE 1KD1U 5IHKA 2LJ3A 4J9CA 4JRIA 2CP0A 5KCHA 3REBB 4PJMA 3G4SQ 2GBQA 3RUXA 2EYXA 2HQHA 4Z02A 5ECAA 1J3TA 1YWOA 2X51A 5M9OA 2QA4A 2F69A 2XICA 3WVEB 1NJIU 1SG5A 3SWNA 5KE3A 2RJEA 1VQ9T 2FL7A 2K5LA 4XTVA 4JLIA 1VQKT 2RHXA 2PZ1A 1JB0E 1TUCA 3JV3A 2P0QA 3HPWA 1AWXA 1NPRA 2HDAA 4GBQA 5KYWA 1OU9A 4ZTJA 3CPWA 1LOJA 1NE8A 4J9EA 3HTRA 2EFIA 1E6HA 2VUBA 8AT1B 2YXYA 1OZ3A 1N5ZA 1ZSZB 1D3BA 2YSQA 1RLQC 2ZZDA 4ELYC 2RD1A 3QKJA 4B6MA 1WX6A 3OS2A 5CR2A 1JJ2P 4AG1C 2KGTA 4E7JA 1H8KA 3VS5A 4J6WA 3TCJA 2MWOA 2A28A 2QK0A 2CSQA 1YJ9Q 1VQ4T 3BE3A 1ZA1B 4PJNA 3OYYA 4J8OA 1U1SA 4QQDA 4C92D 3EGXB 2DRMA 2RO0A 4RTWA 1KFZA 4OMOA 3P8BB 2LQWA 4E2FB 1UHCA 1S72Q 1W4SA 2LVMA 2YUNA 3QWYA 2HZYA 4BDYA 1VQ5A 2OTLA 4C92F 4ESRA 3MPUB 1SSHA 1WNLA 4XK8E 5GMKh 5KE2A 4M75F 2M0YA 3SEMA 1N9SA 1PKTA 3ZFJA 2R57A 2DE0X 2BKDN 1IREB 5GANe 4ZN1A 1VQOT 4M77D 1NLOC 4F04B 3CBMA 1TWBA 3CMEA 2KE9A 3CC7Q 2DMOA 4OB2B 1IO6A 1K73U 2MMPA 3X25B 3VUZA 2WSEE 3QO3A 2YUQA 4QVDA 4FSXA 2RA2A 4M78C 1VIFA 3OYJA 1PRMC 2C0TA 2RN8A 2KROA 3LGFA 5CCAA 4OF1A 1FMVA 2L0AA 4IUPA 1WHJA 3VRZA 2J7IA 3QBYA 3PMIA 3JCMe 3CC4T 3QPHA 4E6RA 4C5HA 4DEXA 2M51A 4IIMA 5CKDA 1WHMA 2RK1A 2DYBA 1D0YA 2ENMA 1N8RR 1U06A 1G8XA 1ZBXA 4KUDK 4Y28E 3J7AF 4Z8AA 2DFUA 3CCUQ 3M0RA 5GANd 2K6DA 5CKFA 2E65A 2A08A 5CQXA 2P0PA 1W2BP 2GTJA 4C92E 3CCET 5HY6A 1YI2A 1B7TA 2D8HA 1VOMA 1BU1A 1K8AR 4O6JA 3G71A 2KYMA 5IHNA 4XU3A 2ZPEB 2MIOA 5GAOr 2QG9B 2D0QB 3OW2P 2JOYA 2A37A 1PKSA 3NGPA 3L2ZA 4EMGA 3RNJA 4V2SA 1ZSZA 1YJ9A 2CZ6B 4PJOA 3BW1A 3MHXA 4CC4B 4HT9A 4BI3A 3EGDA 1EZZB 1QCFA 1Y71A 4M77E 1LJOA 3QHSA 1T0HA 4C0DC 5C0MA 2FEIA 2K9GA 2PVDB 2GF7A 4Y91A 1OZ2A 2MOXA 1E7OA 3G7ZA 1SHFA 1MV3A 4OVAA 1RAFB 1MUZA 1WHKA 4UC4A 3EGXA 5FLXE 2QDYB 3CQTA 3EGUA 3RMQA 2LJ0A 2C0OA 2F2WA 2D8JA 4PJJA 4C8QD 3QZ5B 4ZN3A 3X28B 1WQWA 3QJYA 4A4FA 2CP2A 1GFCA 2ZPGB 1LNXA 1KQ1A 3S3MA 1K0XA 1O9SA 4FT4A 1RI0A 2DK3A 4AFZC 2G6FX 4PJLA 4M7DF 3SB2A 2FPFA 3GLXA 4PJOG 1OPLA 2RQTA 2CP7A 2DBMA 4M77B 3A98A 2EQIA 5FWBA 1Q81U 2RK2A 3LGLA 2EYZA 3C4SA 1VQNT 3P8HA 2WSFE 4WF2A 5KCOA 1S1NA 2J6OA 2E41A 2DXCA 3CCRT 1W2BS 1PSFA 2OTJQ 1VQ7Q 1Q86U 2JM9A 3V7RA 5J39A 1RAEB 2XDPA 1JO8A 1AD5A 1K9MR 4Y92A 1YITQ 2L89A 1VQPA 3LH5A 1V76A 4X9CA 1VQMA 3CCSA 3I55Q 1TUGB 2BTTA 3M9QA 4LD9K 4FSSA 5AYFA 3CCVA 2M16A 5EG2A 3CCMA 2JJ9A 4X9DA 5LL6S 3MEAA 5FRNA 1ZUUA 3A8LB 2HSEB 4OMNA 4E7IA 1Q82R 1EX4A 4IUQA 3RKYA 3EG2A 3GOXA 2KNBB 2H3EB 4JS5A 4ORZA 2OAUA 2KRMA 2DBKA 2MYSA 3L2UA 2DVEA 1KHIA 1RUWA 2DLPA 2VXEA 2KDSA 2NUTB 4BUGA 1JRIA 1QVGP 1G2BA 4KRTA 2MK5A 4KGVB 1FMKA 4C8QE 2FPEA 4J9GA 1M1GA 4XQ3A 4FYXB 4E7HA 5GANf 2Y4YA 2KQWA 3CCLT 1MV0B 1MNDA 3KXTA 1JXOA 2A0FB 2P84A 4MMLA 1HJDA 2YDLA 1KQSP 4NL2A 2ROLA 3OYAA 5I22A 2L5QA 4XU2A 3J80E 1W2BA 1XOVA 2DO3A 1ZSGA 3JB9D 3H0IA 4RTVA 1VUBA 3RMSA 2EVRA 4C92A 3OW2A 2Y4XA 3JCMf 1Y96B 3I5RA 1H641 2PQWA 2RI5A 3OMCA 2QAZA 4K11A 5GAMj 3JB9F 3QXEB 1YJNQ 3H0FA 3M0PA 2O88A 3I35A 2GNCA 5FU7B 4C8QB 3RBBB 5LJ5g 2E6NA 2O9SA 4J9FA 1UJYA 1Z9ZA 4XTZA 4M77A 2G3RA 2EBPA 2HKNA 4AFSC 3G6EQ 4ZGJB 3V7CA 2P4TA 4J9IA 3M58A 5C6SA 1ARKA 5IH2A 1YITA 1WJRA 1C1AA 1GCPA 3KBGA 2PVOB 1UDLA 1SRMA 4FU6A 2GQIA 2GFAA 2LQKA 4J7FA 5HK3A 5LJ3g 1IRXA 3ME9A 4C92G 1YIJA 4HCCA 1UFFA 4M75G 3A8HB 1KK7A 4CC2A 1JU5C 1PM3A 2CZ0B 4A4GA 3HP9A 4RTZA 3H9NA 3V8LA 3QJ6A 2SRCA 2EQJA 2NYSA 3X24B 2KAFA 3L2QA 2LQ8A 1QQJA 2QTXA 3R6NA 3MJXA 5CQYA 2XDDA 5FWCA 1SEMA 4A53A 4M77G 2EJFA 3SDZA 1R77A 5KYUB 1NG2A 4FM4B 5LJ5j 2X9HA 2DVJA 3JRZA 5GAOp 1N8RU 4JRPA 1I4K1 4PFOA 2YUPA 2COZA 2L3PA 2NUTA 5I2MA 4FIBA 1BYMA 1WPYA 2QGFB 2CT3A 4LUDA 5GAN4 4M78F 1Y7XA 1RLPC 5GANh 2CUBA 1WXBA 2O31A 4OMPA 5GAMe 3OYDA 3QWXX 2OJ2A 3L1AA 4N4HA 2PTKA 1X2KA 4QQGA 3PIOA 4KGXB 5CVIA 4A4HA 1K8AU 4ZGDB 1YP5A 2EJ9A 1WQ7A 3VKIA 2DIGA 4MMKA 1VQOQ 4AT1B 5LJ3j 1Z9QA 2KMTA 3BDUA 3H41A 1B34B 2KVQG 4OMFB 4CC3A 1G5VA 3MO8A 2JW4A 1YJNA 1QVGA 2L8DA 3CCJT 2FRWA 3VUBA 5FW9A 1Y96A 2F2XA 2ABLA 4RCCA 4F16A 1GRIA 4JJDA 2NLUA 1OPKA 3M55A 3CC4Q 4KBMB 2OTLQ 2LCSA 3TVTA 4C8QA 1KQSA 2QQRA 3OS5A 2KXDA 1R8OB 5D6XA 1A0NB 3OQ5A 4A4KA 1RAIB 5KYXA 1K9MC 2DX1A 1VQ9A 2CUDA 4IURA 2D0NA 2FZCB 1VQKA 4C0FA 4OB1B 1YBYA 4FYYB 1QP2A 4D6WA 5FROA 2OX7A 1X43A 4CRIA 1JQQA 4AFUC 3SWNC 4XTXA 3URGA 4EMKC 2J6FA 4A63B 4HCKA 2MAMA 2ZPFB 2QQBA 3CXCP 3INZA 1Q82C 1WHLA 1X2QA 2BZYA 2FPDA 1X6BA 1RL2A 4JDSA 1E6GA 2L3QA 4XTWA 4FYVB 1IGUA 3CMAT 5EC7A 2EYYA 1ABOA 1I5LA 3OYEA 4C5EA 3RIRA 1K76A 1SHGA 2KT1A 2P4RA 3HSBA 4JJNK 3M59A 4F14A 3CCQT 4CC7A 4M7DG 1M90R 2L3RA 1G3YA 4OB3B 1VQ4A 2CP6A 4N0AC 4C8QG 3FJ5A 2D1XA 2B8AA 5GAN8 3NPFA 2F2VA 4LN2A 1BIAA 3VS3A 1AWOA 1WFWA 2CZ1B 3UDCA 2RHUA 1SRLA 3MP1A 2M9UA 4ANJA 3OYBA 5HK0A 2ECZA 5KYUA 2DJQA 1TG0A 1YI2Q 1X27A 1PCXA 5D7UA 4PJOB 5IXFA 5HKCA 3G71Q 1Q82U 3EGDB 4MZPA 1OX8A 1YWPA 3HRTA 1VQOA 5KYNA 1U1TA 1EFNA 2X4XA 5KYYB 3SD4A 1QCNA 2K3YA 1MNEA 2AIRB 3PNWC 1SPKA 2WACA 1WJSA 1GL5A 1UGVA 4JUVA 5DLOA 2DXBA 4M75D 2DL8A 1VYVA 1WYXA 1B34A 2EQMA 2QA4T 2DL5A 3M56A 1VQNQ 1DJ7B 3CC4A 1YHQT 1VQ8T 3HL8A 3CXCS 2KRSA 1C6VX 2IPOB 1VQLQ 5CKEA 2YLBA 3VS7A 1K0SA 1LVKA 3FLGA 3L2VA 3JCMb 2ZGWA 1M3AA 4M4ZA 3TSWA 1TXQA 1U5SA 2J6KA 3E9GA 2X3WD 1MGQA 2BUDA 2LJ1A 2EIFA 2LCCA 3WVDB 3CC2Q 4J6YA 3I9QA 4HT8A 5GAOn 3VRYA 1BCOA 2E3HA 1NPPA 3JB9G 3JCMc 4KGZB 3JCMP 5GAMf 4BI4A 4NS5A 3M0UA 4HXJA 1CKBA 4XAXB 2COYA 2X4WA 3A8OB 1VYTA 5J3BA 2LNVA 3SHWA 4Z89A 1UUEA 1WIEA 5GJWB 1AZEA 4JZ3A 2HQEA 3QUIA 1VQPQ 1JJ2S 4JPBW 1VQMQ 3CCSQ 4QQ6A 2DNUA 2FYKA 3S3NA 4JJCA 3CCVQ 2DEUA 3CCLQ 4OGEA 3X26B 3OYMA 3X20B 3EFRA 3CCMQ 1OV3A 4BE2A 3THKA 4A4EA 3VS2A 4M75E 3CXCA 3S6WA 2BE7D 2DZ9A 2JTFA 1AOJA 2R58A 3UATA 3BFMA 2XHCA 2DKGA 5CK9A 1FXXA 1VQ6T 5D6WA 1UB4A 2XDBA 4RG8A 1TU0B 3JCMd 2LT1A 4CI0C 5GAOl 4AMCA 4A54A 2YHTA 4RG2A 4ME7A 4O5VA 1KSWA 4FW2A 1H3ZA 2V26A 2YT6A 1T0JA 1WI7A 1NBEB 3G4ST 2DTHA 4PNOA 4XTYA 4E7LA 5KYYA 1TUDA 5GMKj 2K2MA 1VQNA 4IUTA 2HD0A 4RTUA 3PE0A 4QVZA 5CKHA 4C92B 1GBRA 3CCRA 1ZLMA 2NUZA 2H3JA 1BK2A 4M75B 3RESA 2O2OA 3MP8A 4M7DD 1VQLA 3PFSA 3VS0A 1NYGA 4M7AC 1G3TA 1M4ZA 2CDTA 4M78G 3OYKA 4C0GA 1JJ2A 2RJCA 3DB3A 3FC3A 2ZPBB 2RHYA 4N4GA 2LNHB 3SFMA 1HK9A 1KC8R 1ZUKA 4HA8A 1B07A 1WHGA 3CC2A 2RF0A 2HNIA 1R0BG 4DBQA 5L8RE 3PGGA 1WGSA 1M90C 2RHIA 1KD1R 1N6AA 4LDWA 2EKHA 2QQ9A 4PLIA 4PKCC 2QEXT 1S72T 1G3SA 1K1ZA 2FHDA 3OW2S 4JZ4A 4LDVA 1NJIR 4II1A 3CCLA 3JCMV 4F7UF 2LC4A 1QKXA 4RTXA 1YIJQ 2DETA 1AHJB 2E70A 2KXCA 4LXCA 5IAYA 4MZTA 4R0KA 8ATCB 3EG1A 3CC7T 3CD6T 1G83A 2E4HA 4OMQA 4PL6A 3REAB 1UGPB 5IHIA 1KHCA 1AWJA 2EPDA 2FG0A 5AT1B 2EYQA 2LT4A 3OS1A 3M0SA 1Y0MA 1VYUA 5L23A 4M7DE 1KG1A 4KH1B 2DF6A 4LDYA 1ZA2B 1M90U 3U23A 1WDXA 1H92A 3M53A 3VYGA 1AT1B 2V1QA 1MMNA 4QKUA 2EGCA 1X75C 4KUIA 3LLRA 2DM1A 2EAYA 1QW1A 1X6GA 2DAQA 3GBQA 2PUOB 3QZ9B 3CCUT 3TU4K 2JT4A 2PU9B 4BY6B 1UG1A 4RTTA 2LZ6B 2AK5A 2JZ2A 2QGGA 3FRNA 2X4JA 2QQSA 4M77C 4FL6A 2DL4A 1F1BB 2JTMA 4N4IA 4F7UE 4M75A 2DERA 1W70A 3LH0A 2EWNA 2JNGA 5IN1A 3DLLA 4M7DB 2LTOA 3L2WA 2CP3A 3GNGA 4IIOA 1I8FA 1JXMA 1M5Q1 2HAXA 2E1HA 2RB6A 3JSCA 5KYXB 2X4YA 2LDMA 1K73R 3MEVA 2KBTA 1Q7YC 3CMAQ 1QLYA 2VB6A 2EQUA 4B9XA 1IXDA 2ZAEA 1N9RA 2RQWA 1NZ9A 4HCZA 2XG8D 3OYNA 2BE9B 4X34A 1VQ9Q 1QVFP 1NM7A 2XI9A 2E12A 4E7KA 4RTYA 1ZHIA 2M0OA 2OAWA 1VQKQ 2FRYA 1UJ0A 2KR3A 1YCYA 2FZGB 3A5ZB 2VC8A 4F7UB 5GAOm 2X3XD 2LCLA 4X1VA 1QVGS 3JB9J 2KK4A 2Y90A 4BD3A 3HRSA 1OYXA 3RERA 3MCAB 2VASA 3OYIA 3GP8A 2ZCFB 1IB8A 1I5OB 4RUGA 3N5BB 2P0KA 5A0LA 1T3SA 2KSSA 2EQKA 1TTHB 2QDLA 3UA7A 1KQSS 1YFNA 2XKOC 1K9AA 3QDRB 4M78D 4MDWA 2O01E 1QVPA 2XMFA 1VQ4Q 1WZOA 3FB9A 3EFOB 4EMKB 3JB9H 1GBQA 4WTOB 5D6YA 2KY9A 3PT9A 2OTJT 1VQ7T 4HVWA 3EG0A 3V8JA 3LW5E 2QI2A 5GMKi 4TVRA 3VV0A 3LYIA 1XTDA 1TOVA 2XU8A 4MZMA 1OULA 3M0QA 4BE0A 2CGHA 2SEMA 4JJBA 3I55T 2LX7A 2QASA 3OB9A 1VIEA 3FDRA 1GCQC 2V8JA 4C8QC 2VKNA 3HFNA 1SKUB 2CH4W 1H3HA 1UE9A 4IKFA 4BB7A 3JCMh 1KC8C 4DBHA 2AZVA 2DA9A 1EIFA 5FU6C 4FCYA 2XD0A 2BIVA 2K2VA 3KUFA 3DB4A 1X6OA 3EFSA 5GANg 5A2QE 4PLLA 1KIKA 3A8GB 3BY7A 1GXIE 1BCMA 1W6XA 1I07A 1V1CA 2K3BA 3CMAA 4M7DA 4GLKA 1KD1C 3C0CA 2GFUA 1YJWT 1G3WA 3PMTA 1Q81R 5GAMd 2E64A 4B9WA 4ZTFA 2PVGB 4FW1A 3E1SA 2CH4A 1XNIA 2KT8A 3L2RA 3OBWA 1NJIC 5I11A 2BZ8A 4ATOA 3JCMg 2I2LA 2CSIA 4M78E 2C06A 1Q86R 1M27C 4YTLA 3OBYA 1WLPB 1LPLA 3CCEQ 3M4GA 3JAME 5LJ5e 4M7AD 3TSZA 1LCKA 1FX7A 1PC0A 2K7AA 4F7UA 2X35A 5FRMA 2VGMA 4DOWA 3P8DA 3Q1JA 4E7ZA 1FMWA 1JEGA 3QYGB 4M7AF 2JN0A 2MPXC 3I5SA 5GANj 4KT0E 1QVFA 2AKKA 2NUPB 1K9MU 4VUBA 3UF4A 3M4YA 2K3XA 2K5FA 2E10A 2XK0A 2L2PA 2QTVA 1BB9A 5A0DA 5A0GA 5LJ3e 3G6ET 2MWPA 1SSFA 4M78B 2DXUA 4NL3A 3ULRB 3EAEA 3EFOA 4EMKA 1YHQA 1PWTA 1VQ8A 1WA7A 5I21A 1NYFA 3GPLA 1M3CA 5LJ5d 2AZSA 5IT9E 3I56T 1IGQA 1YN8A 1IZ6A 4L6V5 4F7UG 1B3QA 1M1KR 1FYNA 2F5TX 1BKBA 2HKQB 3BDLA 2LRQA 3OYLA 2DD4A 4Z88A 3R6OA 4N0AA 3UPUA 1AVZC 3HKSA 1OX9A 2F1LA 1K73C 2AKLA 4AG2C 3NHNA 1IHWA 3S3OA 2KEAA 1XQHA 5LJ3d 2DILA 2ED0A 2QXFA 1UGRB 1M8MA 2VV5A 3CCRQ 3FEOA 4M7AE 4LNPA 5GMKl 4Q5WA 4FYWB 1GFDA 5CKBA 4EDUA 1PD0A 2EKOA 3AHUA 4JS4A 3C12A 2VGNA 3NTHA 2OI3A 2A36A 3V7SA 4OB0B 1BBZA 4IUUA 2RMOA 3JCMJ 2QEXQ 1AEYA 1MMDA 9ATCB 4IUVA 3MEWA 4DEYA 1TSFA 4C0DB 4JLGA 3WXMB 3QIIA 2DRKA 1M2VA 3ZL7C 3UT1A 2QQAA 2VWFA 3E2UA 2GGRA 3H8ZA 3CCEA 1UGQB 2LP5A 1RI9A 2HCKA 1QWEA 1X01A 2RQRA 4NOYA 4DOVA 2RQUA 1KQ2A 2RJDA 2JUFA 2MCNA 3CD6Q 2K57A 1VQ6A 3META 2VVKA 1JBMA 3TQ7P 1Q7YR 2XIDA 6AT1B 1BI2A 4M77F 4M7AB 3NFCA 1PSEA 2JM8A 2AHJB 3G4SA 1RAAB 1V29B 1ZSZC 2E6ZA 4EPCA 1VQ5T 1Q95G 2OTLT 4PJOC 1OOTA 4WCIA 4J5YA 4RMOA 2R5MA 2I0NA 2R5AA 3CBOA 2GTOA 2NUPA 5GAN2 3LWHA 3T9NA 3NTKA 2V1RA 2K79A 4XU0A 2DPPB 1D0XA 3CMET 4XTUA 2FB7A 4M78A 3OSSC 3EH2A 3M57A 1OEBA 5CO7A 1PHTA 3C94A 1AZGB 2RQVA 3KFVA 2DZCA 3JCMQ 3OA6A 1AWWA 1WHHA 1SF9A 2K5IA 3AT1B 1TH7A 4MDXA 2DD5A 4XU1A 2V8IA 2FO0A 4OMLA 1U8RA 3EH1A 2HBWA 2LQNA 3OY9A 1Q81C 4BDZA 2DJZA 3A1PA 2BZXA 3OYCA 3MP6A 2YRVA 2RNAA 1K4US 5LJ5f 2QEXA 1S72A 1RAGB 1ABQA 1Q86C 2CT4A 1Y57A 1YI2T 5GAN7 3MEUA 3VS6A 1OI1A 2J05A 1MHNA 2V8KA 5GAN6 3ER0A 3G71T 1PNJA 4BACA 4F17A 1D09B 1TS9A 1HSQA 3H6ZA 4J9BA 1BIBA 1W1FA 2YRCA 3CC7A 1YJ9T 3CD6A 4D8DA 5LJ3f 2L3SA 2QYZA 2RJFA 5GAN5 1ZQ1A 5CIUA 1BI3A 3DKMA 4C8QF 1QCOA 2YRDA 5GAMh 4L59A 3TREA 1MMGA 2DL3A 3JCMW 3OS0A 4BE1A 3FIFA 3VJPA 4R55A 1QMCA 5DLQE 4M7AA 3ZBDA 1ZX6A 1ZBJA
chains in the Genus database with same CATH topology
2JVVA 2Y90A 3QPHA 4BD3A 3HRSA 4XTWA 1OYXA 3RERA 3MCAB 3CMAT 1VQLT 4C5HA 1I5LA 3OYEA 3OYIA 3O8VA 4C5EA 3RIRA 3GP8A 2ZCFB 3HSBA 3OMGA 3CEYA 5CKDA 3N5BB 2RK1A 3QG1A 4C0ZA 4JJNK 2P0KA 3M59A 5A0LA 2DEQA 3CCQT 3CCUA 4M7DG 1ZBXA 2KSSA 4QW2A 2RI3A 2EQKA 4KUDK 2L3RA 1G3YA 3HRUA 4OB3B 4Y28E 1VQ4A 1KQSS 5CAIA 5GMKe 2XKOC 3HFOA 4N0AC 3J7AF 4C8QG 3QDRB 4M78D 2B8AA 4MDWA 5GANd 2O01E 5GAN8 1M1KC 1QVPA 3JCMX 5CKFA 2E65A 4DQ2A 3FB9A 5CQXA 5GAMg 1BIAA 4DA4A 2P0PA 4EMKB 3CC2T 4C92E 5GMKm 2CZ1B 3UDCA 3CCET 3JB9H 2RHUA 5HY6A 3MP1A 2M9UA 5D6YA 1O75A 3JB9J 2KY9A 1YI2A 3PT9A 3OYBA 5HK0A 2OTJT 4C92C 1VQ7T 4O6JA 3V8JA 2DTIA 2MF2A 3LW5E 2QI2A 3G71A 5GMKi 4XU3A 4TVRA 4M75C 2ZPEB 5GAOr 2A7YA 2RI2A 1XTDA 3LYIA 3VV0A 4PJOB 2XU8A 2D0QB 5HKCA 2JOYA 4MZMA 1Q82U 3VU3C 2GQVA 4MZPA 2CGHA 4BE0A 3L2ZA 4EMGA 4V2SA 3HRTA 4M7AG 3I55T 1YJ9A 2CZ6B 1VQOA 4PJOA 3BW1A 3MHXA 3GF5A 1U1TA 4HT9A 4BI3A 3OB9A 2X4XA 1VQPT 1VIEA 4J83A 1VQMT 3FDRA 3CCST 3GIBA 5GAOq 2V8JA 1Y71A 3SD4A 3ZEHA 4M77E 2IVWA 1LJOA 4E47A 3QHSA 3OYFA 3CCVT 4C8QC 2K3YA 4C0DC 5C0MA 3HFNA 3CBPA 3PNWC 4HCBA 2E5QA 2WACA 1WJSA 3CCMT 2PVDB 4OGCA 2GF7A 4Y91A 1OZ2A 5LJ5h 2A3LA 4IKFA 4JUVA 4BB7A 3JCMh 1KC8C 5DLOA 2ZPHB 2DXBA 3G7ZA 3L42A 4M75D 1EIFA 4OVAA 4P5NA 5FU6C 1B34A 2DTOA 2EQMA 2QA4T 2XD0A 2BIVA 2K2VA 3KUFA 3M56A 4UC4A 1M1KU 4EMHA 3DB4A 1X6OA 3EFSA 2M1HA 5GANg 1DJ7B 1BI0A 5FLXE 5A2QE 4PLLA 2QDYB 3CC4A 3A8GB 1YHQT 3BY7A 1GXIE 1VQ8T 3RMQA 3HL8A 2CKKA 3CXCS 3CMAA 4M7DA 3PIPA 4GLKA 1KD1C 2GFUA 1YJWT 4C8QD 2RM4A 1HXDA 3QZ5B 4ZN3A 1G3WA 3PMTA 4LD6A 3X28B 3OYGA 2RH2A 1WQWA 3QJYA 4A4FA 2E64A 5CKEA 2YLBA 5GAMd 2ZPGB 1LNXA 1KQ1A 3FLGA 4B9WA 3L2VA 3S3MA 2PVGB 2YLCA 1O9SA 4FT4A 3JCMb 4ZTFA 2ZPIB 2ZGWA 3E1SA 5LJ3h 1RI0A 2DK3A 1XNIA 3L2RA 4M7DF 3UWNA 3OBWA 3SB2A 3GLXA 4PJOG 3JCMe 3M54A 1NJIC 4ATOA 3E9GA 3JCMg 4M77B 2I2LA 4M78E 1MGQA 2C06A 1Q81U 2BUDA 2RK2A 2HBPA 3LGLA 1WJQA 2EIFA 2CZ7B 2LCCA 3WVDB 2FVUA 4YTLA 3C4SA 5FU6B 2O4XB 3OBYA 3M5AA 2WSFE 3P8HA 4LDXA 1VQNT 4WF2A 5KCOA 2OTJA 1M1FA 2E41A 1VQ7A 2MI6A 4J6YA 3M4GA 3JAME 4HT8A 2DXCA 5GAOn 4OP0A 5LJ5e 3CCRT 1W2BS 2IG0A 1N8RC 4M7AD 1PSFA 1I81A 1Q86U 3E9FA 1FX7A 3V7RA 4F7UA 1NPPA 5J39A 3JB9G 2XDPA 2X35A 3TEEA 3JCMc 3JCMP 5GAMf 4BI4A 4NS5A 4ELZC 3I55A 5FRMA 2L89A 2DXTA 2VGMA 4XAXB 4DOWA 2X4WA 3A8OB 3P8DA 3E19A 3Q1JA 5J3BA 1M9SA 4X9CA 1VQPA 3CCSA 2LNVA 1VQMA 3QSUA 3QYGB 4M7AF 3M9QA 4LD9K 5AYFA 2JN0A 3CCVA 2HQEA 3QUIA 4RKUE 2M16A 1K8AC 1JJ2S 4FT2A 1Q7YU 5EG2A 2WSCE 4QQ6A 4X9DA 4KT0E 5LL6S 3CCMA 4JRQA 5GANj 1QVFA 2RHZA 2FYKA 3MEAA 3S3NA 1K9MU 2CYZB 4OGEA 4VUBA 3SWNB 3X26B 3A8LB 3VYHB 3OYMA 3X20B 5FRNA 2K3XA 2K5FA 2E10A 2XK0A 3EFRA 3M4YA 5A0DA 5A0GA 3RKYA 4IUQA 5LJ3e 3CCJA 2K4YA 4E7IA 3G6ET 1BI1A 3A8MB 2MWPA 1SSFA 4M78B 2DXUA 3GOXA 4BE2A 3J81E 4NL3A 4A4EA 4M75E 3CXCA 5J26A 3S6WA 4JS5A 3EAEA 2DZ9A 2OAUA 2JTFA 2R58A 4EMKA 4BY6C 1YHQA 1M8VA 3BFMA 2XHCA 1VQ8A 3L2UA 2DVEA 5I21A 1KHIA 2DKGA 5CK9A 1Y07A 2VXEA 2KDSA 3GPLA 1FXXA 1VQ6T 1YITT 1YJWA 5D6WA 1UB4A 4BUGA 5LJ5d 2XDBA 1JRIA 4RG8A 3OYHA 5IT9E 3JCMd 3JB9I 2LT1A 4CI0C 3I56T 4J6XA 5GAOl 4PJOD 3DLMA 1D3BB 2YHTA 4RG2A 4A54A 1IZ6A 4ME7A 4L6V5 4C8QE 4F7UG 4O5VA 1UEBA 1M1GA 1H3ZA 4M7DC 4XQ3A 2F5KA 4E7HA 1YIJT 3ASKA 5GANf 2Y4YA 2HQXA 3QYHB 2KQWA 5FU7C 3CCLT 2F5TX 3G4ST 1BKBA 2DTHA 4PNOA 3KXTA 4LDUA 4XTYA 3BDLA 4MMLA 4J7IA 2LRQA 4C5IA 5GAN3 3OYLA 2DD4A 4E7LA 3UPUA 3R6OA 4N0AA 5GMKj 4NL2A 2D6FA 3OYAA 3HKSA 4PJOF 3V8KA 4BI8B 4ZGEB 2L5QA 4XU2A 3NTIA 3J80E 1W2BA 1VQNA 1K73C 4IUTA 3C95A 1XOVA 4R56A 2HD0A 2DO3A 1QVFS 4QVZA 5CKHA 3S3OA 3JB9D 4C92B 5I2SA 3CCRA 1QP3A 5DY9A 1XQHA 2CS7A 2H3JA 5LJ3d 2QXFA 3LX7A 1VUBA 2D9TA 3RMSA 4JRKA 4M75B 3FJPA 1UGRB 2VV5A 3GNFB 3RKWA 3RESA 3MP8A 4M7DD 3FEOA 1VQLA 4M7AE 4C92A 1N27A 5GMKl 3PFSA 2Y4XA 4Q5WA 1Y96B 3JCMf 3OW2A 3LWIA 5CKBA 1H641 2PQWA 4EDUA 4GY5A 2EKOA 3AHUA 2RI5A 3OMCA 4JS4A 3C12A 2DIQA 2VGNA 4M7AC 3NTHA 1G3TA 1M4ZA 4M78G 5GAMj 3OYKA 4C0GA 3V7SA 4OB0B 3CCQA 1JJ2A 3JCMJ 4IUUA 3JB9F 3QXEB 2RJCA 3DB3A 4IUVA 2VYTA 3FC3A 3MEWA 2ZPBB 5FU7B 4C8QB 2RHYA 4C0DB 3PTAA 3CPWS 4N4GA 4JLGA 3WXMB 5LJ5g 3SFMA 2E6NA 3QIIA 1HK9A 3F70A 2PUKB 4HA8A 3UT1A 2QQAA 1UGSB 3OSVA 1P92A 3H8ZA 4QVCA 3CC2A 2HNIA 4KULA 3CCEA 1UGQB 3G6EA 2EJGA 5L8RE 4XTZA 4HKEA 1X01A 4M77A 2G3RA 3CPFA 4RCBA 3PGGA 4NOYA 4DOVA 1WGSA 1FWZA 5KH6A 4ZGJB 1KQ2A 3V7CA 2VXFA 2P4TA 2RJDA 2JUFA 1KC8U 3M58A 2O4XA 2K57A 2RHIA 5C6SA 1M90C 1N6AA 1VQ6A 4LDWA 1YITA 2QQ9A 3META 1WJRA 1JBMA 4C5GA 4PLIA 2LX9A 2XIDA 4PKCC 3KBGA 2GCXA 2PVOB 3I56A 2QEXT 5DM7R 3RKXA 1S72T 4FU6A 1BI2A 1G3SA 4M77F 4M7AB 3CC4T 1YJNT 2GFAA 2LQKA 3NFCA 4J7FA 5HK3A 5LJ3g 1PSEA 2FHDA 3ME9A 3OW2S 4C92G 1YIJA 4L5GA 4LDVA 3HHTB 4PJOE 1KD1U 4II1A 3CCLA 2AHJB 3JCMV 3G4SA 4HCCA 4JRIA 4M75G 4F7UF 1V29B 3A8HB 2LC4A 2E6ZA 5KCHA 4EPCA 1VQ5T 2OTLT 4PJOC 1AHJB 2CZ0B 2E70A 3RUXA 4A4GA 3HP9A 4Z02A 4J5YA 5IAYA 4MZTA 4RMOA 2R5MA 5M9OA 3V8LA 2QA4A 2F69A 2R5AA 2XICA 3WVEB 3QJ6A 1NJIU 3CC7T 3CBOA 3LWHA 2EQJA 5GAN2 3X24B 3T9NA 3SWNA 3CD6T 5KE3A 2KAFA 3NTKA 2RJEA 4PL6A 4XU0A 3L2QA 2FL7A 1VQ9T 1UGPB 2DPPB 2LQ8A 1KHCA 2K5LA 2QTXA 3CMET 4XTVA 4XTUA 5CQYA 2FB7A 2XDDA 4JLIA 1VQKT 4M78A 2RHXA 3OSSC 4A53A 1JB0E 4M77G 2EJFA 2EYQA 3SDZA 2LT4A 3OS1A 3M57A 2P0QA 3HPWA 4FM4B 5LJ5j 1NPRA 3JRZA 4M7DE 5GAOp 1KG1A 1N8RU 4JRPA 5CO7A 3C94A 1I4K1 4LDYA 4ZTJA 3CPWA 1M90U 1LOJA 1NE8A 5I2MA 4FIBA 1BYMA 2DZCA 2EFIA 3JCMQ 1WPYA 3OA6A 2VUBA 3M53A 3VYGA 1OZ3A 5GAN4 4M78F 1Y7XA 2K5IA 1X75C 4KUIA 5GANh 1TH7A 3LLRA 1D3BA 2DD5A 4MDXA 3OYDA 5GAMe 2EAYA 1QW1A 2ZZDA 3L1AA 4N4HA 4ELYC 4XU1A 2RD1A 2V8IA 3QKJA 3OS2A 2DAQA 4QQGA 5CR2A 3PIOA 1U8RA 2PUOB 5CVIA 4E7JA 4A4HA 1K8AU 4ZGDB 3QZ9B 4J6WA 2EJ9A 3TCJA 3OY9A 2MWOA 1Q81C 4BDZA 2DJZA 3CCUT 1WQ7A 3TU4K 3VKIA 2DIGA 4BY6B 2PU9B 4MMKA 3OYCA 1VQ4T 5LJ3j 2JZ2A 3MP6A 2KMTA 2X4JA 2YRVA 3BDUA 3FRNA 3OYYA 4J8OA 1B34B 5LJ5f 1U1SA 2QQSA 2KVQG 4QQDA 4C92D 4M77C 4OMFB 4FL6A 1G5VA 3MO8A 2QEXA 2JTMA 4N4IA 4F7UE 1S72A 2RO0A 1YJNA 1QVGA 4M75A 2L8DA 3P8BB 1Q86C 3CCJT 3LH0A 3VUBA 1YI2T 5GAN7 2EWNA 2JNGA 5IN1A 3DLLA 3MEUA 1Y96A 4M7DB 2LTOA 1OI1A 1W4SA 2LVMA 3L2WA 1MHNA 2V8KA 3GNGA 4RCCA 4BDYA 1I8FA 5GAN6 1M5Q1 3ER0A 3G71T 1VQ5A 2HAXA 2OTLA 2E1HA 4C92F 4BACA 2RB6A 3JSCA 2X4YA 1WNLA 2NLUA 2LDMA 4XK8E 3M55A 5GMKh 5KE2A 3MEVA 4M75F 4KBMB 1N9SA 3ZFJA 2R57A 4C8QA 3H6ZA 1KQSA 2QQRA 3OS5A 2BKDN 1R8OB 5D6XA 1Q7YC 1BIBA 1IREB 3CC7A 1YJ9T 5GANe 4ZN1A 3OQ5A 4M77D 4A4KA 1VQOT 1K9MC 2EQUA 4B9XA 3CD6A 5LJ3f 1VQ9A 3CBMA 1N9RA 4IURA 3CMEA 1NZ9A 2RJFA 1VQKA 4HCZA 4C0FA 4OB1B 1YBYA 5GAN5 2XG8D 3OYNA 4OB2B 1QP2A 4X34A 1ZQ1A 5CIUA 5FROA 4D6WA 1K73U 1BI3A 2MMPA 2XI9A 3DKMA 2E12A 3X25B 4E7KA 1ZHIA 2M0OA 4C8QF 3VUZA 4CRIA 3SWNC 4XTXA 2WSEE 3QO3A 3URGA 4EMKC 5GAMh 4L59A 1YCYA 4FSXA 3TREA 2MAMA 2RA2A 2ZPFB 2QQBA 4QVDA 3JCMW 4M78C 1VIFA 3A5ZB 3OS0A 2VC8A 4F7UB 3INZA 4BE1A 3FIFA 3VJPA 3OYJA 1Q82C 5GAOm 3LGFA 5CCAA 2LCLA 4OF1A 4R55A 1RL2A 1QVGS 4IUPA 5DLQE 4M7AA 3ZBDA 4JDSA 3QBYA 3PMIA 2KK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y90 A;  5LJ3 h;  5LJ5 j;  4XTW A;  5GAO p;  4M7D E;  3JB9 D;  3RER A;  4C92 B;  1I4K 1;  4M7D F;  1I5L A;  5DY9 A;  4PJO G;  3SB2 A;  3RIR A;  1LOJ A;  5LJ3 d;  3HSB A;  3JCM g;  4M77 B;  2DZC A;  2I2L A;  3JCM Q;  1WPY A;  4JRK A;  4M75 B;  3FJP A;  1MGQ A;  4M78 E;  3RKW A;  5GAN 4;  4M78 F;  2DEQ A;  3RES A;  4M7D D;  4M7A E;  4M7D G;  4C92 A;  5GMK l;  3JCM f;  5GAN h;  1TH7 A;  1Y96 B;  1D3B A;  5GAM e;  2EAY A;  1H64 1;  4WF2 A;  3HFO A;  3L1A A;  5CAI A;  4N0A C;  4XU1 A;  4C8Q G;  2E41 A;  5GMK e;  3AHU A;  2RD1 A;  4J6Y A;  3M4G A;  4M78 D;  4M7A C;  4M78 G;  5GAN d;  5GAM j;  4HT8 A;  5GAN 8;  3JB9 F;  3V7S A;  5GAO n;  4OP0 A;  5LJ5 e;  3JCM X;  3JCM J;  4M7A D;  2E65 A;  4DQ2 A;  3FB9 A;  1I81 A;  1BIA A;  5GAM g;  4J6W A;  4F7U A;  4EMK B;  3V7R A;  2EJ9 A;  4C8Q B;  4C92 E;  5GMK m;  3JB9 H;  3JB9 G;  2DJZ A;  1WQ7 A;  3JCM c;  5LJ5 g;  3JCM P;  5GAM f;  1HK9 A;  4MMK A;  5LJ3 j;  4HA8 A;  4C92 C;  2DXT A;  3BDU A;  4QVC A;  3V8J A;  1B34 B;  2DTI A;  5LJ5 f;  2HNI A;  1U1S A;  4X9C A;  4XU3 A;  4C92 D;  5GMK i;  4M77 C;  2EJG A;  3QSU A;  4M7A F;  4M75 C;  4XTZ A;  5GAO r;  4PJO B;  1X01 A;  2JN0 A;  4M77 A;  4F7U E;  4RCB A;  3QUI A;  3PGG A;  4M75 A;  4NOY A;  3VU3 C;  2CGH A;  4X9D A;  5GAN j;  1KQ2 A;  3V7C A;  2VXF A;  3L2Z A;  4EMG A;  5GAN 7;  2EWN A;  2FYK A;  4V2S A;  4M7A G;  4M7D B;  1Y96 A;  2K57 A;  3SWN B;  4PJO A;  3BW1 A;  1U1T A;  3EFR A;  4RCC A;  2E10 A;  4HT9 A;  1I8F A;  5GAN 6;  1M5Q 1;  5LJ3 e;  3RKY A;  1JBM A;  2E1H A;  4C92 F;  3GIB A;  2RB6 A;  4M78 B;  2DXU A;  5GAO q;  4M77 E;  4NL3 A;  1LJO A;  3RKX A;  1WNL A;  3QHS A;  4M75 E;  4M7A B;  4M77 F;  4C8Q C;  5GMK h;  3HFN A;  4M75 F;  2DZ9 A;  1N9S A;  4EMK A;  5LJ3 g;  1M8V A;  4C8Q A;  3BFM A;  4C92 G;  2DVE A;  1BIB A;  4Y91 A;  5I21 A;  2DKG A;  5LJ5 h;  4PJO E;  4JUV A;  2VXE A;  3JCM h;  4M77 D;  5GAN e;  3JCM V;  3JCM b;  4M75 D;  4JRI A;  5LJ3 f;  4M75 G;  4F7U F;  1N9R A;  5LJ5 d;  1B34 A;  2DTO A;  1JRI A;  4PJO C;  3JCM d;  3JB9 I;  4EMH A;  5GAN 5;  4J6X A;  3RUX A;  3EFS A;  5GAN g;  5GAO l;  1D3B B;  2YHT A;  4A54 A;  4PJO D;  4C8Q E;  4J5Y A;  4F7U G;  3BY7 A;  4C8Q F;  4M7D C;  4XQ3 A;  3V8L A;  3SWN C;  5GAN f;  4XTX A;  3QO3 A;  4M7D A;  5GAN 2;  4EMK C;  3SWN A;  5GAM h;  1YCY A;  4QVD A;  2DTH A;  2RA2 A;  4PNO A;  4XU0 A;  3JCM W;  4M78 C;  4XTY A;  4C8Q D;  2RM4 A;  1HXD A;  2QTX A;  2VC8 A;  3INZ A;  4MML A;  3FIF A;  4XTV A;  4XTU A;  2FB7 A;  4F7U B;  4JLI A;  5GAN 3;  1WQW A;  4M78 A;  5GAM d;  2E64 A;  5GAO m;  2YLB A;  4N0A A;  5GMK j;  4NL2 A;  1LNX A;  4PJO F;  4M77 G;  1KQ1 A;  2EJF A;  3V8K A;  4XU2 A;  4A53 A;  2YLC A;  3JCM e;  4M7A A;  3JB9 J;  2ZGW A; 
#chains in the Genus database with same CATH topology
 2JVV A;  2RPN A;  3EG9 B;  1VQL T;  4PFZ A;  3O8V A;  3OMG A;  3CEY A;  1PG5 B;  3QG1 A;  4C0Z A;  4GLM A;  1R0C B;  2DEQ A;  2E3I A;  1WXU A;  3CCU A;  4QW2 A;  2RI3 A;  3HRU A;  5CAI A;  5GMK e;  3HFO A;  4PK4 A;  1M1K C;  3JCM X;  4DQ2 A;  5GAM g;  3G1J A;  1M3B A;  4DA4 A;  1RAD B;  3CC2 T;  2ROT A;  5GMK m;  1O75 A;  1WXT A;  4C92 C;  3CCJ Q;  2DTI A;  2MF2 A;  1CSK A;  2CP5 A;  4M75 C;  2A7Y A;  2RI2 A;  3VU3 C;  2GQV A;  2JS2 A;  1ACM B;  4M7A G;  1HYO A;  3PVL A;  3MKD A;  2KI7 A;  1YJW Q;  3GF5 A;  1I1J A;  1VQP T;  4J83 A;  1VQM T;  3CCS T;  3GIB A;  1YNZ A;  5GAO q;  3ZEH A;  4E47 A;  2IVW A;  3OYF A;  3CCV T;  3VS1 A;  4KH0 B;  4HCB A;  3CBP A;  1M2O A;  2E5Q A;  3CCM T;  3IQL A;  4OGC A;  5LJ5 h;  2A3L A;  2HL5 C;  2ZPH B;  3L42 A;  2JXB A;  4P5N A;  2KYB A;  2DTO A;  2H8H A;  1M1K U;  4EMH A;  2M1H A;  1BI0 A;  1QWF A;  1RAC B;  1YCS B;  2EGA A;  1D0Z A;  2CKK A;  4E7S A;  3PIP A;  2HEQ A;  2JMC A;  1UEC A;  1HXD A;  2RM4 A;  4LD6 A;  3OYG A;  2RH2 A;  1T3L A;  2EYW A;  4D8K A;  2YLC A;  3VS4 A;  3RDV A;  2ZPI B;  5LJ3 h;  3CCQ Q;  1HD3 A;  3UWN A;  1D1B A;  1RAB B;  3M54 A;  2E5K A;  2CRE A;  2HBP A;  1WJQ A;  1KJW A;  2CZ7 B;  2FVU A;  5FU6 B;  2B86 A;  4LDX A;  2O4X B;  3M5A A;  2OTJ A;  1M1F A;  2YWW A;  1M30 A;  4ZNX A;  3RR6 A;  2MI6 A;  1X69 A;  1VQ7 A;  1OQK A;  3UA6 A;  1N8R C;  4OP0 A;  2IG0 A;  7AT1 B;  1NLP C;  1I81 A;  2NWM A;  2JTE A;  3E9F A;  2Z0W A;  3TEE A;  1D1A A;  2FZK B;  4ELZ C;  3I55 A;  3CPW P;  1OU8 A;  2DXT A;  3EG3 A;  3E19 A;  5GJV B;  1M9S A;  2J06 A;  3EG9 A;  2C0I A;  2EW3 A;  3I56 Q;  3QSU A;  2KRN A;  4RKU E;  1K8A C;  4FT2 A;  1Q7Y U;  2PNI A;  2WSC E;  4PFP A;  4JRQ A;  2RHZ A;  1CKA A;  4OMM A;  2CYZ B;  3SWN B;  1U3O A;  3VYH B;  4QT7 A;  3EHR A;  3CCJ A;  2K4Y A;  1BI1 A;  3A8M B;  3J81 E;  4DBF A;  5J26 A;  3O5Z A;  4LE9 A;  1MMA A;  1NEB A;  2QA4 Q;  1M8V A;  4BY6 C;  2DYI A;  2JMA A;  2LMJ A;  4HVU A;  4J9D A;  5KYW B;  1PRL C;  1D1C A;  1Y07 A;  1YHQ Q;  3H0H A;  1YIT T;  1YJW A;  1VQ8 Q;  4HVV A;  3EHQ A;  3OYH A;  3JB9 I;  4J6X A;  4PJO D;  2HSP A;  3DLM A;  1D3B B;  2YUO A;  1UEB A;  4M7D C;  2F5K A;  1YIJ T;  2COW A;  3ASK A;  2HQX A;  3QYH B;  1C0M A;  2IIM A;  5FU7 C;  2HMA A;  4LDU A;  4J7I A;  2EGE A;  1IHV A;  4C5I A;  5GAN 3;  2D6F A;  4PJO F;  4BI8 B;  3V8K A;  4ZGE B;  3NTI A;  3C95 A;  1ZUY A;  4R56 A;  1VA7 A;  1QVF S;  4DBR A;  5I2S A;  2O9V A;  1NEG A;  1QP3 A;  5DY9 A;  2CS7 A;  3LX7 A;  1XJW B;  2D9T A;  4JRK A;  3FJP A;  2W0Z A;  3GNF B;  3RKW A;  3PVQ A;  1N27 A;  1PD1 A;  3LWI A;  3NMZ C;  4GY5 A;  4J9H A;  1UHF A;  2HL3 A;  2DIQ A;  3CCQ A;  1I0C A;  1M2V B;  4AFQ C;  2ATC B;  2VYT A;  3PTA A;  3CPW S;  3F70 A;  2PUK B;  3D7S B;  2M02 A;  1GCQ A;  1UGS B;  3QDF A;  3OSV A;  1P92 A;  1VQ5 Q;  4QVC A;  2W10 A;  4KUL A;  2JS0 A;  3G6E A;  1UTI A;  2EJG A;  4HKE A;  2ED1 A;  4RCB A;  1QKW A;  3CPF A;  2DL7 A;  4EIK A;  2AT1 B;  5IXB A;  1FWZ A;  5KH6 A;  2VXF A;  1KC8 U;  2O4X A;  3CME Q;  2ESW A;  4C5G A;  2LX9 A;  2GCX A;  3I56 A;  1RAH B;  3RKX A;  5DM7 R;  1VQ6 Q;  1YJN T;  3M0T A;  5HCK A;  4LUE A;  4L5G A;  3HHT B;  4PJO E;  1KD1 U;  5IHK A;  2LJ3 A;  4J9C A;  4JRI A;  2CP0 A;  5KCH A;  3REB B;  4PJM A;  3G4S Q;  2GBQ A;  3RUX A;  2EYX A;  2HQH A;  4Z02 A;  5ECA A;  1J3T A;  1YWO A;  2X51 A;  5M9O A;  2QA4 A;  2F69 A;  2XIC A;  3WVE B;  1NJI U;  1SG5 A;  3SWN A;  5KE3 A;  2RJE A;  1VQ9 T;  2FL7 A;  2K5L A;  4XTV A;  4JLI A;  1VQK T;  2RHX A;  2PZ1 A;  1JB0 E;  1TUC A;  3JV3 A;  2P0Q A;  3HPW A;  1AWX A;  1NPR A;  2HDA A;  4GBQ A;  5KYW A;  1OU9 A;  4ZTJ A;  3CPW A;  1LOJ A;  1NE8 A;  4J9E A;  3HTR A;  2EFI A;  1E6H A;  2VUB A;  8AT1 B;  2YXY A;  1OZ3 A;  1N5Z A;  1ZSZ B;  1D3B A;  2YSQ A;  1RLQ C;  2ZZD A;  4ELY C;  2RD1 A;  3QKJ A;  4B6M A;  1WX6 A;  3OS2 A;  5CR2 A;  1JJ2 P;  4AG1 C;  2KGT A;  4E7J A;  1H8K A;  3VS5 A;  4J6W A;  3TCJ A;  2MWO A;  2A28 A;  2QK0 A;  2CSQ A;  1YJ9 Q;  1VQ4 T;  3BE3 A;  1ZA1 B;  4PJN A;  3OYY A;  4J8O A;  1U1S A;  4QQD A;  4C92 D;  3EGX B;  2DRM A;  2RO0 A;  4RTW A;  1KFZ A;  4OMO A;  3P8B B;  2LQW A;  4E2F B;  1UHC A;  1S72 Q;  1W4S A;  2LVM A;  2YUN A;  3QWY A;  2HZY A;  4BDY A;  1VQ5 A;  2OTL A;  4C92 F;  4ESR A;  3MPU B;  1SSH A;  1WNL A;  4XK8 E;  5GMK h;  5KE2 A;  4M75 F;  2M0Y A;  3SEM A;  1N9S A;  1PKT A;  3ZFJ A;  2R57 A;  2DE0 X;  2BKD N;  1IRE B;  5GAN e;  4ZN1 A;  1VQO T;  4M77 D;  1NLO C;  4F04 B;  3CBM A;  1TWB A;  3CME A;  2KE9 A;  3CC7 Q;  2DMO A;  4OB2 B;  1IO6 A;  1K73 U;  2MMP A;  3X25 B;  3VUZ A;  2WSE E;  3QO3 A;  2YUQ A;  4QVD A;  4FSX A;  2RA2 A;  4M78 C;  1VIF A;  3OYJ A;  1PRM C;  2C0T A;  2RN8 A;  2KRO A;  3LGF A;  5CCA A;  4OF1 A;  1FMV A;  2L0A A;  4IUP A;  1WHJ A;  3VRZ A;  2J7I A;  3QBY A;  3PMI A;  3JCM e;  3CC4 T;  3QPH A;  4E6R A;  4C5H A;  4DEX A;  2M51 A;  4IIM A;  5CKD A;  1WHM A;  2RK1 A;  2DYB A;  1D0Y A;  2ENM A;  1N8R R;  1U06 A;  1G8X A;  1ZBX A;  4KUD K;  4Y28 E;  3J7A F;  4Z8A A;  2DFU A;  3CCU Q;  3M0R A;  5GAN d;  2K6D A;  5CKF A;  2E65 A;  2A08 A;  5CQX A;  2P0P A;  1W2B P;  2GTJ A;  4C92 E;  3CCE T;  5HY6 A;  1YI2 A;  1B7T A;  2D8H A;  1VOM A;  1BU1 A;  1K8A R;  4O6J A;  3G71 A;  2KYM A;  5IHN A;  4XU3 A;  2ZPE B;  2MIO A;  5GAO r;  2QG9 B;  2D0Q B;  3OW2 P;  2JOY A;  2A37 A;  1PKS A;  3NGP A;  3L2Z A;  4EMG A;  3RNJ A;  4V2S A;  1ZSZ A;  1YJ9 A;  2CZ6 B;  4PJO A;  3BW1 A;  3MHX A;  4CC4 B;  4HT9 A;  4BI3 A;  3EGD A;  1EZZ B;  1QCF A;  1Y71 A;  4M77 E;  1LJO A;  3QHS A;  1T0H A;  4C0D C;  5C0M A;  2FEI A;  2K9G A;  2PVD B;  2GF7 A;  4Y91 A;  1OZ2 A;  2MOX A;  1E7O A;  3G7Z A;  1SHF A;  1MV3 A;  4OVA A;  1RAF B;  1MUZ A;  1WHK A;  4UC4 A;  3EGX A;  5FLX E;  2QDY B;  3CQT A;  3EGU A;  3RMQ A;  2LJ0 A;  2C0O A;  2F2W A;  2D8J A;  4PJJ A;  4C8Q D;  3QZ5 B;  4ZN3 A;  3X28 B;  1WQW A;  3QJY A;  4A4F A;  2CP2 A;  1GFC A;  2ZPG B;  1LNX A;  1KQ1 A;  3S3M A;  1K0X A;  1O9S A;  4FT4 A;  1RI0 A;  2DK3 A;  4AFZ C;  2G6F X;  4PJL A;  4M7D F;  3SB2 A;  2FPF A;  3GLX A;  4PJO G;  1OPL A;  2RQT A;  2CP7 A;  2DBM A;  4M77 B;  3A98 A;  2EQI A;  5FWB A;  1Q81 U;  2RK2 A;  3LGL A;  2EYZ A;  3C4S A;  1VQN T;  3P8H A;  2WSF E;  4WF2 A;  5KCO A;  1S1N A;  2J6O A;  2E41 A;  2DXC A;  3CCR T;  1W2B S;  1PSF A;  2OTJ Q;  1VQ7 Q;  1Q86 U;  2JM9 A;  3V7R A;  5J39 A;  1RAE B;  2XDP A;  1JO8 A;  1AD5 A;  1K9M R;  4Y92 A;  1YIT Q;  2L89 A;  1VQP A;  3LH5 A;  1V76 A;  4X9C A;  1VQM A;  3CCS A;  3I55 Q;  1TUG B;  2BTT A;  3M9Q A;  4LD9 K;  4FSS A;  5AYF A;  3CCV A;  2M16 A;  5EG2 A;  3CCM A;  2JJ9 A;  4X9D A;  5LL6 S;  3MEA A;  5FRN A;  1ZUU A;  3A8L B;  2HSE B;  4OMN A;  4E7I A;  1Q82 R;  1EX4 A;  4IUQ A;  3RKY A;  3EG2 A;  3GOX A;  2KNB B;  2H3E B;  4JS5 A;  4ORZ A;  2OAU A;  2KRM A;  2DBK A;  2MYS A;  3L2U A;  2DVE A;  1KHI A;  1RUW A;  2DLP A;  2VXE A;  2KDS A;  2NUT B;  4BUG A;  1JRI A;  1QVG P;  1G2B A;  4KRT A;  2MK5 A;  4KGV B;  1FMK A;  4C8Q E;  2FPE A;  4J9G A;  1M1G A;  4XQ3 A;  4FYX B;  4E7H A;  5GAN f;  2Y4Y A;  2KQW A;  3CCL T;  1MV0 B;  1MND A;  3KXT A;  1JXO A;  2A0F B;  2P84 A;  4MML A;  1HJD A;  2YDL A;  1KQS P;  4NL2 A;  2ROL A;  3OYA A;  5I22 A;  2L5Q A;  4XU2 A;  3J80 E;  1W2B A;  1XOV A;  2DO3 A;  1ZSG A;  3JB9 D;  3H0I A;  4RTV A;  1VUB A;  3RMS A;  2EVR A;  4C92 A;  3OW2 A;  2Y4X A;  3JCM f;  1Y96 B;  3I5R A;  1H64 1;  2PQW A;  2RI5 A;  3OMC A;  2QAZ A;  4K11 A;  5GAM j;  3JB9 F;  3QXE B;  1YJN Q;  3H0F A;  3M0P A;  2O88 A;  3I35 A;  2GNC A;  5FU7 B;  4C8Q B;  3RBB B;  5LJ5 g;  2E6N A;  2O9S A;  4J9F A;  1UJY A;  1Z9Z A;  4XTZ A;  4M77 A;  2G3R A;  2EBP A;  2HKN A;  4AFS C;  3G6E Q;  4ZGJ B;  3V7C A;  2P4T A;  4J9I A;  3M58 A;  5C6S A;  1ARK A;  5IH2 A;  1YIT A;  1WJR A;  1C1A A;  1GCP A;  3KBG A;  2PVO B;  1UDL A;  1SRM A;  4FU6 A;  2GQI A;  2GFA A;  2LQK A;  4J7F A;  5HK3 A;  5LJ3 g;  1IRX A;  3ME9 A;  4C92 G;  1YIJ A;  4HCC A;  1UFF A;  4M75 G;  3A8H B;  1KK7 A;  4CC2 A;  1JU5 C;  1PM3 A;  2CZ0 B;  4A4G A;  3HP9 A;  4RTZ A;  3H9N A;  3V8L A;  3QJ6 A;  2SRC A;  2EQJ A;  2NYS A;  3X24 B;  2KAF A;  3L2Q A;  2LQ8 A;  1QQJ A;  2QTX A;  3R6N A;  3MJX A;  5CQY A;  2XDD A;  5FWC A;  1SEM A;  4A53 A;  4M77 G;  2EJF A;  3SDZ A;  1R77 A;  5KYU B;  1NG2 A;  4FM4 B;  5LJ5 j;  2X9H A;  2DVJ A;  3JRZ A;  5GAO p;  1N8R U;  4JRP A;  1I4K 1;  4PFO A;  2YUP A;  2COZ A;  2L3P A;  2NUT A;  5I2M A;  4FIB A;  1BYM A;  1WPY A;  2QGF B;  2CT3 A;  4LUD A;  5GAN 4;  4M78 F;  1Y7X A;  1RLP C;  5GAN h;  2CUB A;  1WXB A;  2O31 A;  4OMP A;  5GAM e;  3OYD A;  3QWX X;  2OJ2 A;  3L1A A;  4N4H A;  2PTK A;  1X2K A;  4QQG A;  3PIO A;  4KGX B;  5CVI A;  4A4H A;  1K8A U;  4ZGD B;  1YP5 A;  2EJ9 A;  1WQ7 A;  3VKI A;  2DIG A;  4MMK A;  1VQO Q;  4AT1 B;  5LJ3 j;  1Z9Q A;  2KMT A;  3BDU A;  3H41 A;  1B34 B;  2KVQ G;  4OMF B;  4CC3 A;  1G5V A;  3MO8 A;  2JW4 A;  1YJN A;  1QVG A;  2L8D A;  3CCJ T;  2FRW A;  3VUB A;  5FW9 A;  1Y96 A;  2F2X A;  2ABL A;  4RCC A;  4F16 A;  1GRI A;  4JJD A;  2NLU A;  1OPK A;  3M55 A;  3CC4 Q;  4KBM B;  2OTL Q;  2LCS A;  3TVT A;  4C8Q A;  1KQS A;  2QQR A;  3OS5 A;  2KXD A;  1R8O B;  5D6X A;  1A0N B;  3OQ5 A;  4A4K A;  1RAI B;  5KYX A;  1K9M C;  2DX1 A;  1VQ9 A;  2CUD A;  4IUR A;  2D0N A;  2FZC B;  1VQK A;  4C0F A;  4OB1 B;  1YBY A;  4FYY B;  1QP2 A;  4D6W A;  5FRO A;  2OX7 A;  1X43 A;  4CRI A;  1JQQ A;  4AFU C;  3SWN C;  4XTX A;  3URG A;  4EMK C;  2J6F A;  4A63 B;  4HCK A;  2MAM A;  2ZPF B;  2QQB A;  3CXC P;  3INZ A;  1Q82 C;  1WHL A;  1X2Q A;  2BZY A;  2FPD A;  1X6B A;  1RL2 A;  4JDS A;  1E6G A;  2L3Q A;  4XTW A;  4FYV B;  1IGU A;  3CMA T;  5EC7 A;  2EYY A;  1ABO A;  1I5L A;  3OYE A;  4C5E A;  3RIR A;  1K76 A;  1SHG A;  2KT1 A;  2P4R A;  3HSB A;  4JJN K;  3M59 A;  4F14 A;  3CCQ T;  4CC7 A;  4M7D G;  1M90 R;  2L3R A;  1G3Y A;  4OB3 B;  1VQ4 A;  2CP6 A;  4N0A C;  4C8Q G;  3FJ5 A;  2D1X A;  2B8A A;  5GAN 8;  3NPF A;  2F2V A;  4LN2 A;  1BIA A;  3VS3 A;  1AWO A;  1WFW A;  2CZ1 B;  3UDC A;  2RHU A;  1SRL A;  3MP1 A;  2M9U A;  4ANJ A;  3OYB A;  5HK0 A;  2ECZ A;  5KYU A;  2DJQ A;  1TG0 A;  1YI2 Q;  1X27 A;  1PCX A;  5D7U A;  4PJO B;  5IXF A;  5HKC A;  3G71 Q;  1Q82 U;  3EGD B;  4MZP A;  1OX8 A;  1YWP A;  3HRT A;  1VQO A;  5KYN A;  1U1T A;  1EFN A;  2X4X A;  5KYY B;  3SD4 A;  1QCN A;  2K3Y A;  1MNE A;  2AIR B;  3PNW C;  1SPK A;  2WAC A;  1WJS A;  1GL5 A;  1UGV A;  4JUV A;  5DLO A;  2DXB A;  4M75 D;  2DL8 A;  1VYV A;  1WYX A;  1B34 A;  2EQM A;  2QA4 T;  2DL5 A;  3M56 A;  1VQN Q;  1DJ7 B;  3CC4 A;  1YHQ T;  1VQ8 T;  3HL8 A;  3CXC S;  2KRS A;  1C6V X;  2IPO B;  1VQL Q;  5CKE A;  2YLB A;  3VS7 A;  1K0S A;  1LVK A;  3FLG A;  3L2V A;  3JCM b;  2ZGW A;  1M3A A;  4M4Z A;  3TSW A;  1TXQ A;  1U5S A;  2J6K A;  3E9G A;  2X3W D;  1MGQ A;  2BUD A;  2LJ1 A;  2EIF A;  2LCC A;  3WVD B;  3CC2 Q;  4J6Y A;  3I9Q A;  4HT8 A;  5GAO n;  3VRY A;  1BCO A;  2E3H A;  1NPP A;  3JB9 G;  3JCM c;  4KGZ B;  3JCM P;  5GAM f;  4BI4 A;  4NS5 A;  3M0U A;  4HXJ A;  1CKB A;  4XAX B;  2COY A;  2X4W A;  3A8O B;  1VYT A;  5J3B A;  2LNV A;  3SHW A;  4Z89 A;  1UUE A;  1WIE A;  5GJW B;  1AZE A;  4JZ3 A;  2HQE A;  3QUI A;  1VQP Q;  1JJ2 S;  4JPB W;  1VQM Q;  3CCS Q;  4QQ6 A;  2DNU A;  2FYK A;  3S3N A;  4JJC A;  3CCV Q;  2DEU A;  3CCL Q;  4OGE A;  3X26 B;  3OYM A;  3X20 B;  3EFR A;  3CCM Q;  1OV3 A;  4BE2 A;  3THK A;  4A4E A;  3VS2 A;  4M75 E;  3CXC A;  3S6W A;  2BE7 D;  2DZ9 A;  2JTF A;  1AOJ A;  2R58 A;  3UAT A;  3BFM A;  2XHC A;  2DKG A;  5CK9 A;  1FXX A;  1VQ6 T;  5D6W A;  1UB4 A;  2XDB A;  4RG8 A;  1TU0 B;  3JCM d;  2LT1 A;  4CI0 C;  5GAO l;  4AMC A;  4A54 A;  2YHT A;  4RG2 A;  4ME7 A;  4O5V A;  1KSW A;  4FW2 A;  1H3Z A;  2V26 A;  2YT6 A;  1T0J A;  1WI7 A;  1NBE B;  3G4S T;  2DTH A;  4PNO A;  4XTY A;  4E7L A;  5KYY A;  1TUD A;  5GMK j;  2K2M A;  1VQN A;  4IUT A;  2HD0 A;  4RTU A;  3PE0 A;  4QVZ A;  5CKH A;  4C92 B;  1GBR A;  3CCR A;  1ZLM A;  2NUZ A;  2H3J A;  1BK2 A;  4M75 B;  3RES A;  2O2O A;  3MP8 A;  4M7D D;  1VQL A;  3PFS A;  3VS0 A;  1NYG A;  4M7A C;  1G3T A;  1M4Z A;  2CDT A;  4M78 G;  3OYK A;  4C0G A;  1JJ2 A;  2RJC A;  3DB3 A;  3FC3 A;  2ZPB B;  2RHY A;  4N4G A;  2LNH B;  3SFM A;  1HK9 A;  1KC8 R;  1ZUK A;  4HA8 A;  1B07 A;  1WHG A;  3CC2 A;  2RF0 A;  2HNI A;  1R0B G;  4DBQ A;  5L8R E;  3PGG A;  1WGS A;  1M90 C;  2RHI A;  1KD1 R;  1N6A A;  4LDW A;  2EKH A;  2QQ9 A;  4PLI A;  4PKC C;  2QEX T;  1S72 T;  1G3S A;  1K1Z A;  2FHD A;  3OW2 S;  4JZ4 A;  4LDV A;  1NJI R;  4II1 A;  3CCL A;  3JCM V;  4F7U F;  2LC4 A;  1QKX A;  4RTX A;  1YIJ Q;  2DET A;  1AHJ B;  2E70 A;  2KXC A;  4LXC A;  5IAY A;  4MZT A;  4R0K A;  8ATC B;  3EG1 A;  3CC7 T;  3CD6 T;  1G83 A;  2E4H A;  4OMQ A;  4PL6 A;  3REA B;  1UGP B;  5IHI A;  1KHC A;  1AWJ A;  2EPD A;  2FG0 A;  5AT1 B;  2EYQ A;  2LT4 A;  3OS1 A;  3M0S A;  1Y0M A;  1VYU A;  5L23 A;  4M7D E;  1KG1 A;  4KH1 B;  2DF6 A;  4LDY A;  1ZA2 B;  1M90 U;  3U23 A;  1WDX A;  1H92 A;  3M53 A;  3VYG A;  1AT1 B;  2V1Q A;  1MMN A;  4QKU A;  2EGC A;  1X75 C;  4KUI A;  3LLR A;  2DM1 A;  2EAY A;  1QW1 A;  1X6G A;  2DAQ A;  3GBQ A;  2PUO B;  3QZ9 B;  3CCU T;  3TU4 K;  2JT4 A;  2PU9 B;  4BY6 B;  1UG1 A;  4RTT A;  2LZ6 B;  2AK5 A;  2JZ2 A;  2QGG A;  3FRN A;  2X4J A;  2QQS A;  4M77 C;  4FL6 A;  2DL4 A;  1F1B B;  2JTM A;  4N4I A;  4F7U E;  4M75 A;  2DER A;  1W70 A;  3LH0 A;  2EWN A;  2JNG A;  5IN1 A;  3DLL A;  4M7D B;  2LTO A;  3L2W A;  2CP3 A;  3GNG A;  4IIO A;  1I8F A;  1JXM A;  1M5Q 1;  2HAX A;  2E1H A;  2RB6 A;  3JSC A;  5KYX B;  2X4Y A;  2LDM A;  1K73 R;  3MEV A;  2KBT A;  1Q7Y C;  3CMA Q;  1QLY A;  2VB6 A;  2EQU A;  4B9X A;  1IXD A;  2ZAE A;  1N9R A;  2RQW A;  1NZ9 A;  4HCZ A;  2XG8 D;  3OYN A;  2BE9 B;  4X34 A;  1VQ9 Q;  1QVF P;  1NM7 A;  2XI9 A;  2E12 A;  4E7K A;  4RTY A;  1ZHI A;  2M0O A;  2OAW A;  1VQK Q;  2FRY A;  1UJ0 A;  2KR3 A;  1YCY A;  2FZG B;  3A5Z B;  2VC8 A;  4F7U B;  5GAO m;  2X3X D;  2LCL A;  4X1V A;  1QVG S;  3JB9 J;  2KK4 A;  2Y90 A;  4BD3 A;  3HRS A;  1OYX A;  3RER A;  3MCA B;  2VAS A;  3OYI A;  3GP8 A;  2ZCF B;  1IB8 A;  1I5O B;  4RUG A;  3N5B B;  2P0K A;  5A0L A;  1T3S A;  2KSS A;  2EQK A;  1TTH B;  2QDL A;  3UA7 A;  1KQS S;  1YFN A;  2XKO C;  1K9A A;  3QDR B;  4M78 D;  4MDW A;  2O01 E;  1QVP A;  2XMF A;  1VQ4 Q;  1WZO A;  3FB9 A;  3EFO B;  4EMK B;  3JB9 H;  1GBQ A;  4WTO B;  5D6Y A;  2KY9 A;  3PT9 A;  2OTJ T;  1VQ7 T;  4HVW A;  3EG0 A;  3V8J A;  3LW5 E;  2QI2 A;  5GMK i;  4TVR A;  3VV0 A;  3LYI A;  1XTD A;  1TOV A;  2XU8 A;  4MZM A;  1OUL A;  3M0Q A;  4BE0 A;  2CGH A;  2SEM A;  4JJB A;  3I55 T;  2LX7 A;  2QAS A;  3OB9 A;  1VIE A;  3FDR A;  1GCQ C;  2V8J A;  4C8Q C;  2VKN A;  3HFN A;  1SKU B;  2CH4 W;  1H3H A;  1UE9 A;  4IKF A;  4BB7 A;  3JCM h;  1KC8 C;  4DBH A;  2AZV A;  2DA9 A;  1EIF A;  5FU6 C;  4FCY A;  2XD0 A;  2BIV A;  2K2V A;  3KUF A;  3DB4 A;  1X6O A;  3EFS A;  5GAN g;  5A2Q E;  4PLL A;  1KIK A;  3A8G B;  3BY7 A;  1GXI E;  1BCM A;  1W6X A;  1I07 A;  1V1C A;  2K3B A;  3CMA A;  4M7D A;  4GLK A;  1KD1 C;  3C0C A;  2GFU A;  1YJW T;  1G3W A;  3PMT A;  1Q81 R;  5GAM d;  2E64 A;  4B9W A;  4ZTF A;  2PVG B;  4FW1 A;  3E1S A;  2CH4 A;  1XNI A;  2KT8 A;  3L2R A;  3OBW A;  1NJI C;  5I11 A;  2BZ8 A;  4ATO A;  3JCM g;  2I2L A;  2CSI A;  4M78 E;  2C06 A;  1Q86 R;  1M27 C;  4YTL A;  3OBY A;  1WLP B;  1LPL A;  3CCE Q;  3M4G A;  3JAM E;  5LJ5 e;  4M7A D;  3TSZ A;  1LCK A;  1FX7 A;  1PC0 A;  2K7A A;  4F7U A;  2X35 A;  5FRM A;  2VGM A;  4DOW A;  3P8D A;  3Q1J A;  4E7Z A;  1FMW A;  1JEG A;  3QYG B;  4M7A F;  2JN0 A;  2MPX C;  3I5S A;  5GAN j;  4KT0 E;  1QVF A;  2AKK A;  2NUP B;  1K9M U;  4VUB A;  3UF4 A;  3M4Y A;  2K3X A;  2K5F A;  2E10 A;  2XK0 A;  2L2P A;  2QTV A;  1BB9 A;  5A0D A;  5A0G A;  5LJ3 e;  3G6E T;  2MWP A;  1SSF A;  4M78 B;  2DXU A;  4NL3 A;  3ULR B;  3EAE A;  3EFO A;  4EMK A;  1YHQ A;  1PWT A;  1VQ8 A;  1WA7 A;  5I21 A;  1NYF A;  3GPL A;  1M3C A;  5LJ5 d;  2AZS A;  5IT9 E;  3I56 T;  1IGQ A;  1YN8 A;  1IZ6 A;  4L6V 5;  4F7U G;  1B3Q A;  1M1K R;  1FYN A;  2F5T X;  1BKB A;  2HKQ B;  3BDL A;  2LRQ A;  3OYL A;  2DD4 A;  4Z88 A;  3R6O A;  4N0A A;  3UPU A;  1AVZ C;  3HKS A;  1OX9 A;  2F1L A;  1K73 C;  2AKL A;  4AG2 C;  3NHN A;  1IHW A;  3S3O A;  2KEA A;  1XQH A;  5LJ3 d;  2DIL A;  2ED0 A;  2QXF A;  1UGR B;  1M8M A;  2VV5 A;  3CCR Q;  3FEO A;  4M7A E;  4LNP A;  5GMK l;  4Q5W A;  4FYW B;  1GFD A;  5CKB A;  4EDU A;  1PD0 A;  2EKO A;  3AHU A;  4JS4 A;  3C12 A;  2VGN A;  3NTH A;  2OI3 A;  2A36 A;  3V7S A;  4OB0 B;  1BBZ A;  4IUU A;  2RMO A;  3JCM J;  2QEX Q;  1AEY A;  1MMD A;  9ATC B;  4IUV A;  3MEW A;  4DEY A;  1TSF A;  4C0D B;  4JLG A;  3WXM B;  3QII A;  2DRK A;  1M2V A;  3ZL7 C;  3UT1 A;  2QQA A;  2VWF A;  3E2U A;  2GGR A;  3H8Z A;  3CCE A;  1UGQ B;  2LP5 A;  1RI9 A;  2HCK A;  1QWE A;  1X01 A;  2RQR A;  4NOY A;  4DOV A;  2RQU A;  1KQ2 A;  2RJD A;  2JUF A;  2MCN A;  3CD6 Q;  2K57 A;  1VQ6 A;  3MET A;  2VVK A;  1JBM A;  3TQ7 P;  1Q7Y R;  2XID A;  6AT1 B;  1BI2 A;  4M77 F;  4M7A B;  3NFC A;  1PSE A;  2JM8 A;  2AHJ B;  3G4S A;  1RAA B;  1V29 B;  1ZSZ C;  2E6Z A;  4EPC A;  1VQ5 T;  1Q95 G;  2OTL T;  4PJO C;  1OOT A;  4WCI A;  4J5Y A;  4RMO A;  2R5M A;  2I0N A;  2R5A A;  3CBO A;  2GTO A;  2NUP A;  5GAN 2;  3LWH A;  3T9N A;  3NTK A;  2V1R A;  2K79 A;  4XU0 A;  2DPP B;  1D0X A;  3CME T;  4XTU A;  2FB7 A;  4M78 A;  3OSS C;  3EH2 A;  3M57 A;  1OEB A;  5CO7 A;  1PHT A;  3C94 A;  1AZG B;  2RQV A;  3KFV A;  2DZC A;  3JCM Q;  3OA6 A;  1AWW A;  1WHH A;  1SF9 A;  2K5I A;  3AT1 B;  1TH7 A;  4MDX A;  2DD5 A;  4XU1 A;  2V8I A;  2FO0 A;  4OML A;  1U8R A;  3EH1 A;  2HBW A;  2LQN A;  3OY9 A;  1Q81 C;  4BDZ A;  2DJZ A;  3A1P A;  2BZX A;  3OYC A;  3MP6 A;  2YRV A;  2RNA A;  1K4U S;  5LJ5 f;  2QEX A;  1S72 A;  1RAG B;  1ABQ A;  1Q86 C;  2CT4 A;  1Y57 A;  1YI2 T;  5GAN 7;  3MEU A;  3VS6 A;  1OI1 A;  2J05 A;  1MHN A;  2V8K A;  5GAN 6;  3ER0 A;  3G71 T;  1PNJ A;  4BAC A;  4F17 A;  1D09 B;  1TS9 A;  1HSQ A;  3H6Z A;  4J9B A;  1BIB A;  1W1F A;  2YRC A;  3CC7 A;  1YJ9 T;  3CD6 A;  4D8D A;  5LJ3 f;  2L3S A;  2QYZ A;  2RJF A;  5GAN 5;  1ZQ1 A;  5CIU A;  1BI3 A;  3DKM A;  4C8Q F;  1QCO A;  2YRD A;  5GAM h;  4L59 A;  3TRE A;  1MMG A;  2DL3 A;  3JCM W;  3OS0 A;  4BE1 A;  3FIF A;  3VJP A;  4R55 A;  1QMC A;  5DLQ E;  4M7A A;  3ZBD A;  1ZX6 A;  1ZBJ A; 
#chains in the Genus database with same CATH homology
 2JVV A;  2Y90 A;  3QPH A;  4BD3 A;  3HRS A;  4XTW A;  1OYX A;  3RER A;  3MCA B;  3CMA T;  1VQL T;  4C5H A;  1I5L A;  3OYE A;  3OYI A;  3O8V A;  4C5E A;  3RIR A;  3GP8 A;  2ZCF B;  3HSB A;  3OMG A;  3CEY A;  5CKD A;  3N5B B;  2RK1 A;  3QG1 A;  4C0Z A;  4JJN K;  2P0K A;  3M59 A;  5A0L A;  2DEQ A;  3CCQ T;  3CCU A;  4M7D G;  1ZBX A;  2KSS A;  4QW2 A;  2RI3 A;  2EQK A;  4KUD K;  2L3R A;  1G3Y A;  3HRU A;  4OB3 B;  4Y28 E;  1VQ4 A;  1KQS S;  5CAI A;  5GMK e;  2XKO C;  3HFO A;  4N0A C;  3J7A F;  4C8Q G;  3QDR B;  4M78 D;  2B8A A;  4MDW A;  5GAN d;  2O01 E;  5GAN 8;  1M1K C;  1QVP A;  3JCM X;  5CKF A;  2E65 A;  4DQ2 A;  3FB9 A;  5CQX A;  5GAM g;  1BIA A;  4DA4 A;  2P0P A;  4EMK B;  3CC2 T;  4C92 E;  5GMK m;  2CZ1 B;  3UDC A;  3CCE T;  3JB9 H;  2RHU A;  5HY6 A;  3MP1 A;  2M9U A;  5D6Y A;  1O75 A;  3JB9 J;  2KY9 A;  1YI2 A;  3PT9 A;  3OYB A;  5HK0 A;  2OTJ T;  4C92 C;  1VQ7 T;  4O6J A;  3V8J A;  2DTI A;  2MF2 A;  3LW5 E;  2QI2 A;  3G71 A;  5GMK i;  4XU3 A;  4TVR A;  4M75 C;  2ZPE B;  5GAO r;  2A7Y A;  2RI2 A;  1XTD A;  3LYI A;  3VV0 A;  4PJO B;  2XU8 A;  2D0Q B;  5HKC A;  2JOY A;  4MZM A;  1Q82 U;  3VU3 C;  2GQV A;  4MZP A;  2CGH A;  4BE0 A;  3L2Z A;  4EMG A;  4V2S A;  3HRT A;  4M7A G;  3I55 T;  1YJ9 A;  2CZ6 B;  1VQO A;  4PJO A;  3BW1 A;  3MHX A;  3GF5 A;  1U1T A;  4HT9 A;  4BI3 A;  3OB9 A;  2X4X A;  1VQP T;  1VIE A;  4J83 A;  1VQM T;  3FDR A;  3CCS T;  3GIB A;  5GAO q;  2V8J A;  1Y71 A;  3SD4 A;  3ZEH A;  4M77 E;  2IVW A;  1LJO A;  4E47 A;  3QHS A;  3OYF A;  3CCV T;  4C8Q C;  2K3Y A;  4C0D C;  5C0M A;  3HFN A;  3CBP A;  3PNW C;  4HCB A;  2E5Q A;  2WAC A;  1WJS A;  3CCM T;  2PVD B;  4OGC A;  2GF7 A;  4Y91 A;  1OZ2 A;  5LJ5 h;  2A3L A;  4IKF A;  4JUV A;  4BB7 A;  3JCM h;  1KC8 C;  5DLO A;  2ZPH B;  2DXB A;  3G7Z A;  3L42 A;  4M75 D;  1EIF A;  4OVA A;  4P5N A;  5FU6 C;  1B34 A;  2DTO A;  2EQM A;  2QA4 T;  2XD0 A;  2BIV A;  2K2V A;  3KUF A;  3M56 A;  4UC4 A;  1M1K U;  4EMH A;  3DB4 A;  1X6O A;  3EFS A;  2M1H A;  5GAN g;  1DJ7 B;  1BI0 A;  5FLX E;  5A2Q E;  4PLL A;  2QDY B;  3CC4 A;  3A8G B;  1YHQ T;  3BY7 A;  1GXI E;  1VQ8 T;  3RMQ A;  3HL8 A;  2CKK A;  3CXC S;  3CMA A;  4M7D A;  3PIP A;  4GLK A;  1KD1 C;  2GFU A;  1YJW T;  4C8Q D;  2RM4 A;  1HXD A;  3QZ5 B;  4ZN3 A;  1G3W A;  3PMT A;  4LD6 A;  3X28 B;  3OYG A;  2RH2 A;  1WQW A;  3QJY A;  4A4F A;  2E64 A;  5CKE A;  2YLB A;  5GAM d;  2ZPG B;  1LNX A;  1KQ1 A;  3FLG A;  4B9W A;  3L2V A;  3S3M A;  2PVG B;  2YLC A;  1O9S A;  4FT4 A;  3JCM b;  4ZTF A;  2ZPI B;  2ZGW A;  3E1S A;  5LJ3 h;  1RI0 A;  2DK3 A;  1XNI A;  3L2R A;  4M7D F;  3UWN A;  3OBW A;  3SB2 A;  3GLX A;  4PJO G;  3JCM e;  3M54 A;  1NJI C;  4ATO A;  3E9G A;  3JCM g;  4M77 B;  2I2L A;  4M78 E;  1MGQ A;  2C06 A;  1Q81 U;  2BUD A;  2RK2 A;  2HBP A;  3LGL A;  1WJQ A;  2EIF A;  2CZ7 B;  2LCC A;  3WVD B;  2FVU A;  4YTL A;  3C4S A;  5FU6 B;  2O4X B;  3OBY A;  3M5A A;  2WSF E;  3P8H A;  4LDX A;  1VQN T;  4WF2 A;  5KCO A;  2OTJ A;  1M1F A;  2E41 A;  1VQ7 A;  2MI6 A;  4J6Y A;  3M4G A;  3JAM E;  4HT8 A;  2DXC A;  5GAO n;  4OP0 A;  5LJ5 e;  3CCR T;  1W2B S;  2IG0 A;  1N8R C;  4M7A D;  1PSF A;  1I81 A;  1Q86 U;  3E9F A;  1FX7 A;  3V7R A;  4F7U A;  1NPP A;  5J39 A;  3JB9 G;  2XDP A;  2X35 A;  3TEE A;  3JCM c;  3JCM P;  5GAM f;  4BI4 A;  4NS5 A;  4ELZ C;  3I55 A;  5FRM A;  2L89 A;  2DXT A;  2VGM A;  4XAX B;  4DOW A;  2X4W A;  3A8O B;  3P8D A;  3E19 A;  3Q1J A;  5J3B A;  1M9S A;  4X9C A;  1VQP A;  3CCS A;  2LNV A;  1VQM A;  3QSU A;  3QYG B;  4M7A F;  3M9Q A;  4LD9 K;  5AYF A;  2JN0 A;  3CCV A;  2HQE A;  3QUI A;  4RKU E;  2M16 A;  1K8A C;  1JJ2 S;  4FT2 A;  1Q7Y U;  5EG2 A;  2WSC E;  4QQ6 A;  4X9D A;  4KT0 E;  5LL6 S;  3CCM A;  4JRQ A;  5GAN j;  1QVF A;  2RHZ A;  2FYK A;  3MEA A;  3S3N A;  1K9M U;  2CYZ B;  4OGE A;  4VUB A;  3SWN B;  3X26 B;  3A8L B;  3VYH B;  3OYM A;  3X20 B;  5FRN A;  2K3X A;  2K5F A;  2E10 A;  2XK0 A;  3EFR A;  3M4Y A;  5A0D A;  5A0G A;  3RKY A;  4IUQ A;  5LJ3 e;  3CCJ A;  2K4Y A;  4E7I A;  3G6E T;  1BI1 A;  3A8M B;  2MWP A;  1SSF A;  4M78 B;  2DXU A;  3GOX A;  4BE2 A;  3J81 E;  4NL3 A;  4A4E A;  4M75 E;  3CXC A;  5J26 A;  3S6W A;  4JS5 A;  3EAE A;  2DZ9 A;  2OAU A;  2JTF A;  2R58 A;  4EMK A;  4BY6 C;  1YHQ A;  1M8V A;  3BFM A;  2XHC A;  1VQ8 A;  3L2U A;  2DVE A;  5I21 A;  1KHI A;  2DKG A;  5CK9 A;  1Y07 A;  2VXE A;  2KDS A;  3GPL A;  1FXX A;  1VQ6 T;  1YIT T;  1YJW A;  5D6W A;  1UB4 A;  4BUG A;  5LJ5 d;  2XDB A;  1JRI A;  4RG8 A;  3OYH A;  5IT9 E;  3JCM d;  3JB9 I;  2LT1 A;  4CI0 C;  3I56 T;  4J6X A;  5GAO l;  4PJO D;  3DLM A;  1D3B B;  2YHT A;  4RG2 A;  4A54 A;  1IZ6 A;  4ME7 A;  4L6V 5;  4C8Q E;  4F7U G;  4O5V A;  1UEB A;  1M1G A;  1H3Z A;  4M7D C;  4XQ3 A;  2F5K A;  4E7H A;  1YIJ T;  3ASK A;  5GAN f;  2Y4Y A;  2HQX A;  3QYH B;  2KQW A;  5FU7 C;  3CCL T;  2F5T X;  3G4S T;  1BKB A;  2DTH A;  4PNO A;  3KXT A;  4LDU A;  4XTY A;  3BDL A;  4MML A;  4J7I A;  2LRQ A;  4C5I A;  5GAN 3;  3OYL A;  2DD4 A;  4E7L A;  3UPU A;  3R6O A;  4N0A A;  5GMK j;  4NL2 A;  2D6F A;  3OYA A;  3HKS A;  4PJO F;  3V8K A;  4BI8 B;  4ZGE B;  2L5Q A;  4XU2 A;  3NTI A;  3J80 E;  1W2B A;  1VQN A;  1K73 C;  4IUT A;  3C95 A;  1XOV A;  4R56 A;  2HD0 A;  2DO3 A;  1QVF S;  4QVZ A;  5CKH A;  3S3O A;  3JB9 D;  4C92 B;  5I2S A;  3CCR A;  1QP3 A;  5DY9 A;  1XQH A;  2CS7 A;  2H3J A;  5LJ3 d;  2QXF A;  3LX7 A;  1VUB A;  2D9T A;  3RMS A;  4JRK A;  4M75 B;  3FJP A;  1UGR B;  2VV5 A;  3GNF B;  3RKW A;  3RES A;  3MP8 A;  4M7D D;  3FEO A;  1VQL A;  4M7A E;  4C92 A;  1N27 A;  5GMK l;  3PFS A;  2Y4X A;  4Q5W A;  1Y96 B;  3JCM f;  3OW2 A;  3LWI A;  5CKB A;  1H64 1;  2PQW A;  4EDU A;  4GY5 A;  2EKO A;  3AHU A;  2RI5 A;  3OMC A;  4JS4 A;  3C12 A;  2DIQ A;  2VGN A;  4M7A C;  3NTH A;  1G3T A;  1M4Z A;  4M78 G;  5GAM j;  3OYK A;  4C0G A;  3V7S A;  4OB0 B;  3CCQ A;  1JJ2 A;  3JCM J;  4IUU A;  3JB9 F;  3QXE B;  2RJC A;  3DB3 A;  4IUV A;  2VYT A;  3FC3 A;  3MEW A;  2ZPB B;  5FU7 B;  4C8Q B;  2RHY A;  4C0D B;  3PTA A;  3CPW S;  4N4G A;  4JLG A;  3WXM B;  5LJ5 g;  3SFM A;  2E6N A;  3QII A;  1HK9 A;  3F70 A;  2PUK B;  4HA8 A;  3UT1 A;  2QQA A;  1UGS B;  3OSV A;  1P92 A;  3H8Z A;  4QVC A;  3CC2 A;  2HNI A;  4KUL A;  3CCE A;  1UGQ B;  3G6E A;  2EJG A;  5L8R E;  4XTZ A;  4HKE A;  1X01 A;  4M77 A;  2G3R A;  3CPF A;  4RCB A;  3PGG A;  4NOY A;  4DOV A;  1WGS A;  1FWZ A;  5KH6 A;  4ZGJ B;  1KQ2 A;  3V7C A;  2VXF A;  2P4T A;  2RJD A;  2JUF A;  1KC8 U;  3M58 A;  2O4X A;  2K57 A;  2RHI A;  5C6S A;  1M90 C;  1N6A A;  1VQ6 A;  4LDW A;  1YIT A;  2QQ9 A;  3MET A;  1WJR A;  1JBM A;  4C5G A;  4PLI A;  2LX9 A;  2XID A;  4PKC C;  3KBG A;  2GCX A;  2PVO B;  3I56 A;  2QEX T;  5DM7 R;  3RKX A;  1S72 T;  4FU6 A;  1BI2 A;  1G3S A;  4M77 F;  4M7A B;  3CC4 T;  1YJN T;  2GFA A;  2LQK A;  3NFC A;  4J7F A;  5HK3 A;  5LJ3 g;  1PSE A;  2FHD A;  3ME9 A;  3OW2 S;  4C92 G;  1YIJ A;  4L5G A;  4LDV A;  3HHT B;  4PJO E;  1KD1 U;  4II1 A;  3CCL A;  2AHJ B;  3JCM V;  3G4S A;  4HCC A;  4JRI A;  4M75 G;  4F7U F;  1V29 B;  3A8H B;  2LC4 A;  2E6Z A;  5KCH A;  4EPC A;  1VQ5 T;  2OTL T;  4PJO C;  1AHJ B;  2CZ0 B;  2E70 A;  3RUX A;  4A4G A;  3HP9 A;  4Z02 A;  4J5Y A;  5IAY A;  4MZT A;  4RMO A;  2R5M A;  5M9O A;  3V8L A;  2QA4 A;  2F69 A;  2R5A A;  2XIC A;  3WVE B;  3QJ6 A;  1NJI U;  3CC7 T;  3CBO A;  3LWH A;  2EQJ A;  5GAN 2;  3X24 B;  3T9N A;  3SWN A;  3CD6 T;  5KE3 A;  2KAF A;  3NTK A;  2RJE A;  4PL6 A;  4XU0 A;  3L2Q A;  2FL7 A;  1VQ9 T;  1UGP B;  2DPP B;  2LQ8 A;  1KHC A;  2K5L A;  2QTX A;  3CME T;  4XTV A;  4XTU A;  5CQY A;  2FB7 A;  2XDD A;  4JLI A;  1VQK T;  4M78 A;  2RHX A;  3OSS C;  4A53 A;  1JB0 E;  4M77 G;  2EJF A;  2EYQ A;  3SDZ A;  2LT4 A;  3OS1 A;  3M57 A;  2P0Q A;  3HPW A;  4FM4 B;  5LJ5 j;  1NPR A;  3JRZ A;  4M7D E;  5GAO p;  1KG1 A;  1N8R U;  4JRP A;  5CO7 A;  3C94 A;  1I4K 1;  4LDY A;  4ZTJ A;  3CPW A;  1M90 U;  1LOJ A;  1NE8 A;  5I2M A;  4FIB A;  1BYM A;  2DZC A;  2EFI A;  3JCM Q;  1WPY A;  3OA6 A;  2VUB A;  3M53 A;  3VYG A;  1OZ3 A;  5GAN 4;  4M78 F;  1Y7X A;  2K5I A;  1X75 C;  4KUI A;  5GAN h;  1TH7 A;  3LLR A;  1D3B A;  2DD5 A;  4MDX A;  3OYD A;  5GAM e;  2EAY A;  1QW1 A;  2ZZD A;  3L1A A;  4N4H A;  4ELY C;  4XU1 A;  2RD1 A;  2V8I A;  3QKJ A;  3OS2 A;  2DAQ A;  4QQG A;  5CR2 A;  3PIO A;  1U8R A;  2PUO B;  5CVI A;  4E7J A;  4A4H A;  1K8A U;  4ZGD B;  3QZ9 B;  4J6W A;  2EJ9 A;  3TCJ A;  3OY9 A;  2MWO A;  1Q81 C;  4BDZ A;  2DJZ A;  3CCU T;  1WQ7 A;  3TU4 K;  3VKI A;  2DIG A;  4BY6 B;  2PU9 B;  4MMK A;  3OYC A;  1VQ4 T;  5LJ3 j;  2JZ2 A;  3MP6 A;  2KMT A;  2X4J A;  2YRV A;  3BDU A;  3FRN A;  3OYY A;  4J8O A;  1B34 B;  5LJ5 f;  1U1S A;  2QQS A;  2KVQ G;  4QQD A;  4C92 D;  4M77 C;  4OMF B;  4FL6 A;  1G5V A;  3MO8 A;  2QEX A;  2JTM A;  4N4I A;  4F7U E;  1S72 A;  2RO0 A;  1YJN A;  1QVG A;  4M75 A;  2L8D A;  3P8B B;  1Q86 C;  3CCJ T;  3LH0 A;  3VUB A;  1YI2 T;  5GAN 7;  2EWN A;  2JNG A;  5IN1 A;  3DLL A;  3MEU A;  1Y96 A;  4M7D B;  2LTO A;  1OI1 A;  1W4S A;  2LVM A;  3L2W A;  1MHN A;  2V8K A;  3GNG A;  4RCC A;  4BDY A;  1I8F A;  5GAN 6;  1M5Q 1;  3ER0 A;  3G71 T;  1VQ5 A;  2HAX A;  2OTL A;  2E1H A;  4C92 F;  4BAC A;  2RB6 A;  3JSC A;  2X4Y A;  1WNL A;  2NLU A;  2LDM A;  4XK8 E;  3M55 A;  5GMK h;  5KE2 A;  3MEV A;  4M75 F;  4KBM B;  1N9S A;  3ZFJ A;  2R57 A;  4C8Q A;  3H6Z A;  1KQS A;  2QQR A;  3OS5 A;  2BKD N;  1R8O B;  5D6X A;  1Q7Y C;  1BIB A;  1IRE B;  3CC7 A;  1YJ9 T;  5GAN e;  4ZN1 A;  3OQ5 A;  4M77 D;  4A4K A;  1VQO T;  1K9M C;  2EQU A;  4B9X A;  3CD6 A;  5LJ3 f;  1VQ9 A;  3CBM A;  1N9R A;  4IUR A;  3CME A;  1NZ9 A;  2RJF A;  1VQK A;  4HCZ A;  4C0F A;  4OB1 B;  1YBY A;  5GAN 5;  2XG8 D;  3OYN A;  4OB2 B;  1QP2 A;  4X34 A;  1ZQ1 A;  5CIU A;  5FRO A;  4D6W A;  1K73 U;  1BI3 A;  2MMP A;  2XI9 A;  3DKM A;  2E12 A;  3X25 B;  4E7K A;  1ZHI A;  2M0O A;  4C8Q F;  3VUZ A;  4CRI A;  3SWN C;  4XTX A;  2WSE E;  3QO3 A;  3URG A;  4EMK C;  5GAM h;  4L59 A;  1YCY A;  4FSX A;  3TRE A;  2MAM A;  2RA2 A;  2ZPF B;  2QQB A;  4QVD A;  3JCM W;  4M78 C;  1VIF A;  3A5Z B;  3OS0 A;  2VC8 A;  4F7U B;  3INZ A;  4BE1 A;  3FIF A;  3VJP A;  3OYJ A;  1Q82 C;  5GAO m;  3LGF A;  5CCA A;  2LCL A;  4OF1 A;  4R55 A;  1RL2 A;  1QVG S;  4IUP A;  5DLQ E;  4M7A A;  3ZBD A;  4JDS A;  3QBY A;  3PMI A;  2KK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...