2E3HA

Crystal structure of the clip-170 cap-gly domain 2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
81
Chain Sequence
b'ELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTVRRVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Restin
publication title Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 18
structure length 81
sequence length 90
ec nomenclature
pdb deposition date 2006-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2e3hA00
2M02A 2CP5A 2COZA 2QK0A 1TOVA 1WHLA 2CP3A 2CP2A 2HL3A 2HL5C 2HQHA 2Z0WA 2E3IA 4B6MA 1WHMA 1WHKA 1LPLA 1TXQA 2COWA 1WHJA 2CP6A 2CP7A 1WHGA 2COYA 1WHHA 2MPXC 1IXDA 2E3HA 2E4HA 3TQ7P 2CP0A 2HKQB 3RDVA 3E2UA 2HKNA
chains in the Genus database with same CATH superfamily
2K6DA 4M78G 1UE9A 3X25B 2HBWA 3M0TA 1R0CB 2FZKB 2D6FA 4LD6A 2YUPA 3EG1A 3EH2A 2DPPB 2V8JA 4X34A 3ASKA 1ZX6A 2J7IA 2ATCB 5IHNA 1B7TA 4E7ZA 5EC7A 4BY6B 1E6HA 3RDVA 1K8AC 3LGLA 2WSCE 3PVLA 4J7IA 4HKEA 4OMQA 5M9OA 2BZYA 4M7AG 1YJ9T 4BY6C 3NTIA 1Q81C 4QVDA 3KXTA 2YUNA 1N27A 3MP1A 1K0SA 1WHGA 2ECZA 1M90C 3X28B 1IGQA 2EKHA 2KNBB 3ER0A 3BW1A 1YCSB 4RTVA 3OMCA 2QK0A 3CCUQ 1TUDA 2E1HA 1RI9A 3QUIA 2FHDA 4ZNXA 4HVUA 5GMKe 3CXCP 2AKLA 4OMFB 3P8DA 1RI0A 3VS5A 5GAOn 4C5IA 2CZ1B 1MNDA 3CCSQ 3GBQA 2E41A 2CGHA 3C94A 3L2WA 3HRSA 2V1RA 3M0SA 2LC4A 2CH4W 1QVGP 1NJIU 4PJNA 3BY7A 2ZPHB 4F7UF 1VQ5T 1RL2A 3MP6A 1RAAB 1IHVA 4J6XA 1VQ7A 3FEOA 4DQ2A 3FJPA 1ZSGA 3OYLA 1FX7A 2AIRB 1K76A 2X4XA 4C8QE 3H0FA 4M75F 4ZGJB 4RMOA 1RLQC 1UGRB 3A8MB 2D8JA 3CCET 1V1CA 4BI3A 4V2SA 2CP2A 3O8VA 1S72T 1TUCA 3CPWP 2BZXA 2A7YA 5A0DA 1LJOA 1PRMC 1LVKA 2KSSA 1Q7YR 1VIEA 2EBPA 2DTIA 4J6YA 2COYA 3OBYA 1P92A 4XTUA 1HJDA 3ULRB 1JJ2P 5GANh 2EJGA 4LE9A 4M78F 2DZ9A 2EWNA 3VRZA 3OYMA 2CYZB 3M59A 2QI2A 2WSEE 4JZ3A 3VUBA 3JB9G 3A98A 1IHWA 1WHMA 2MWOA 5L8RE 3ZFJA 5HCKA 4M77C 3E19A 3S6WA 1FYNA 1MMNA 2PVGB 4FYWB 1D0ZA 3CD6Q 3C12A 2RD1A 2LCLA 3LX7A 5CCAA 2MIOA 3CC7Q 3PT9A 3OS0A 1OZ2A 3M53A 4M7AF 1ZHIA 1FMWA 3JRZA 4XK8E 3CCRA 1D1AA 4KT0E 3ZEHA 1X2QA 2JNGA 5HK3A 5I2MA 4KGXB 2L3QA 2COWA 1I0CA 1QVFA 1ZBXA 3P8HA 1M3CA 4LDXA 2JW4A 3PMIA 4AT1B 2E10A 3LGFA 3TEEA 4AMCA 1KJWA 2H8HA 2EGEA 2HL5C 2W0ZA 2Z0WA 5D6WA 1NYFA 2MMPA 2PQWA 4C8QD 1YCYA 3V7SA 1RAEB 4D8DA 2NWMA 5IT9E 2CT4A 3J7AF 2J6FA 3P8BB 2P0KA 2RHYA 3CC4Q 1WHLA 1QWEA 2RHZA 3HTRA 2DNUA 2JT4A 2O2OA 4BDZA 4N0AA 2DE0X 2DM1A 4X1VA 4FM4B 4F16A 2LQWA 2M16A 4C0GA 4FL6A 4IIOA 5A0LA 1NBEB 5DLQE 2QQRA 3OW2S 2KXCA 3QPHA 2RF0A 2EQMA 2BKDN 2GTJA 1E7OA 5D6YA 4M77E 1M1KR 2K7AA 1G83A 4IUUA 4MZMA 5GANf 1UECA 2EYWA 4FW1A 2QGFB 2QA4A 2EJ9A 4AFQC 1NLPC 2J06A 2RA2A 5GANj 1RLPC 2LT1A 2YDLA 2D0NA 2FRYA 3QHSA 3M0PA 4A63B 1KSWA 2RMOA 2YUQA 3CCLQ 3HFNA 2DVJA 3I55A 2K57A 1YJNA 1VQ4A 2DF6A 4IIMA 1KD1U 3MCAB 1CKAA 1I8FA 1WIEA 2KT8A 2QXFA 2KYMA 1SPKA 2VVKA 2EYYA 5FLXE 2M0OA 4BE0A 2R5AA 4ORZA 2O9VA 1AWJA 3VS0A 2RH2A 1ZSZC 1YHQT 1NE8A 1OV3A 1UUEA 1QP2A 1JRIA 1CKBA 2R58A 3MHXA 4RCCA 2ED1A 1WPYA 2EW3A 4A53A 3GPLA 1YJ9A 2ED0A 2RHUA 1Q86U 2COZA 4JJBA 1KK7A 3CQTA 2LQNA 5KYWA 1LNXA 4Q5WA 5KYWB 4PFOA 4C8QG 1AHJB 2EPDA 2DKGA 3RKWA 3JAME 2RQUA 1VQMT 1MMAA 3HRTA 3QSUA 1UHFA 4CI0C 2SRCA 2O88A 2FRWA 4J9DA 3OYJA 3M56A 3G4SQ 3M0QA 1IRXA 3V8JA 2CUDA 4PK4A 1EZZB 1RACB 2FG0A 2EQUA 2ZPBB 1WHHA 1M3AA 4B9WA 1K9MU 4LDYA 1RAFB 3EH1A 2GFAA 1VQ5A 1VQOT 1YWPA 4BB7A 1O75A 4DBQA 1QW1A 4IUPA 1SSHA 3LW5E 1QCFA 5IHIA 1VQNT 2KDSA 4RTYA 2DRMA 1MUZA 3HPWA 1YN8A 3A8LB 1UGPB 1X43A 3EG0A 3RIRA 2AHJB 1JB0E 3I35A 3CCEA 1BIAA 2PTKA 2KBTA 4LDWA 2F2WA 3MEVA 2WSFE 3MEUA 1GCQC 1Z9QA 1Q86C 1A0NB 1M4ZA 1OU8A 1QKXA 1K73R 3SDZA 1E6GA 3PNWC 4PKCC 1PRLC 2DX1A 2LX7A 4C0DC 1TSFA 1ZUYA 1XOVA 1AVZC 4PNOA 1Z9ZA 4ZGEB 2VWFA 5I22A 1WZOA 4PLIA 2OAWA 3L2VA 2RJDA 1Q82U 2L8DA 4RTWA 2RNAA 2HQHA 3PMTA 5GAMe 4AG2C 2E6NA 3C4SA 1YP5A 3X20B 9ATCB 4L5GA 1QVFP 3PFSA 1WXBA 1O9SA 4OVAA 5C6SA 2JM9A 2RI3A 2LMJA 2OTJQ 1I5LA 1VQ8Q 2KI7A 2DRKA 1AZGB 1PNJA 5HKCA 3JCMP 2OJ2A 2DJZA 3LYIA 3QIIA 5CIUA 4C8QF 5L23A 1VYTA 3URGA 4J7FA 5IAYA 2YLBA 4PJJA 3L2ZA 1IXDA 1YITA 3MJXA 2ROLA 2ZPGB 4MZPA 3DB4A 3ZBDA 1VQLQ 1FMKA 1OEBA 1M8VA 2X4YA 1ZA1B 4KULA 3OYIA 1XTDA 1UGVA 1QVPA 3M55A 2XDDA 1PSFA 1U8RA 1HXDA 3D7SB 2HMAA 1SG5A 2CT3A 5KYUA 4J9HA 2EQJA 2FZGB 3CCMA 3ZL7C 5KYUB 3RMQA 1Y71A 1AWWA 2O31A 5FU7B 3WXMB 2X35A 4XTWA 4C5EA 1Y07A 2OTLA 1M2OA 1Q82C 4PFZA 1FWZA 1YI2Q 1NM7A 1U5SA 1M2VA 1W1FA 1M2VB 3VKIA 1IB8A 4AFUC 1I5OB 4XU1A 3CMEQ 3H6ZA 5LL6S 4BDYA 3H0HA 2NUTA 2DL3A 3G71Q 1W2BS 1ABOA 1SEMA 2NUZA 2NUTB 3CCJQ 2RO0A 2LX9A 1JJ2S 4WF2A 3M5AA 3OY9A 1G2BA 1R77A 5LJ5d 3V7CA 1YJNT 3HSBA 4AG1C 2AT1B 1HYOA 4PJOB 1X27A 1SHFA 2VXEA 2DJQA 2PUOB 5GAOr 3GNFB 2RQWA 1YIJQ 1T0HA 4D6WA 2E3IA 4LN2A 3JB9D 1N8RC 4PJOC 3GLXA 4RTXA 1OULA 2K79A 1UGQB 3I9QA 4Y92A 3N5BB 3CEYA 2KK4A 5DLOA 1WLPB 4DBRA 2CS7A 3UA7A 2QYZA 1C1AA 2VUBA 3QJ6A 2ZPIB 2DL5A 3OYFA 4PJLA 3MEAA 1KFZA 1B3QA 4KGVB 1AD5A 3RNJA 1WQWA 1YHQA 2LQKA 1QCOA 4EIKA 2JMCA 4M7DC 2HCKA 4C0ZA 1AWOA 3CC2T 4A4EA 1KC8U 2M0YA 2DAQA 1X69A 1I07A 2DILA 3EG2A 3X24B 2JXBA 2PVOB 5GANg 1VQKT 5GAOp 1PKTA 3OYNA 3TSWA 2PZ1A 3NPFA 4BI4A 4EPCA 2ZPFB 2RHIA 2VXFA 3EG9A 2LJ3A 3WVEB 1VQMA 4BI8B 3EG9B 2AZSA 1XQHA 1VYVA 4R55A 2NUPA 1NPRA 4ANJA 2GTOA 1OQKA 2DBMA 4AFZC 2NUPB 5KCHA 4OMOA 4B6MA 4DOWA 1D09B 4E7SA 2RHXA 2D9TA 2AZVA 3G6EQ 3H8ZA 2B8AA 2PNIA 1VQOA 2K9GA 4DBFA 2HNIA 3BDUA 4RKUE 1K8AR 4UC4A 2EYZA 4J9EA 2MAMA 2ROTA 1RUWA 4PJOE 4C92C 1VQNA 3CBOA 1VQ7Q 2C0OA 1Q81R 2XI9A 1DJ7B 5CKHA 1X6OA 4QVCA 1G3WA 4D8KA 3JCMd 4OGEA 4N4IA 4FT4A 1M90R 4JZ4A 4C5GA 1KC8C 3I56T 2KROA 1BCMA 3CMAT 3GP8A 2W10A 4M77A 4E7JA 2P0PA 4O6JA 3G1JA 4CC2A 2M9UA 4ZGDB 4F17A 4M77B 1M3BA 3OW2A 4M7DE 2DEQA 4FYVB 4J83A 1QMCA 5CKDA 2GQIA 1WA7A 4XTXA 1G5VA 4HVWA 4NS5A 1VUBA 4FT2A 2RQTA 5KYXA 2L89A 3V7RA 3OB9A 3MO8A 2ABLA 5KYXB 2EIFA 5CO7A 4XU2A 2GCXA 2DZCA 3OBWA 3JV3A 2Y90A 3KUFA 1NJIC 2LP5A 2JMAA 3WVDB 3KBGA 2PU9B 4FIBA 2X3WD 2X3XD 3OA6A 1JQQA 3VS3A 3VS1A 4A54A 2JZ2A 3TREA 2DO3A 2DD5A 3EGXA 1R0BG 5GAN2 5LJ5h 1VQ9A 2FPEA 3CCRQ 3EGXB 4KGZB 1JXMA 3QWXX 2MCNA 1YITT 2DYIA 1U1TA 4OB3B 2O9SA 5GANe 4JRIA 3JB9H 1KG1A 3S3OA 1M1GA 3UT1A 1R8OB 4A4HA 2CP7A 1WXUA 5FU6C 1K9AA 5GAMd 2LCCA 1EFNA 1MV3A 2L2PA 5GMKl 3TU4K 4EDUA 3HKSA 4M75B 3JCMQ 2CZ7B 5C0MA 3CCMT 1BU1A 2CZ6B 1PC0A 2OX7A 2HL3A 4IUVA 3CBPA 1KQ1A 3PE0A 3OYHA 4IUQA 1ZUUA 2BE9B 2KGTA 4M75C 3QDFA 3UWNA 2OTLT 4N4GA 3QYGB 2QEXT 2DFUA 2LRQA 5CQXA 3TCJA 1VQPQ 3Q1JA 4XTZA 2DTHA 4GBQA 5A2QE 2E3HA 4JPBW 4MZTA 3QO3A 4KUIA 4E6RA 5GAN4 3CCQT 4RTTA 4E7IA 3E9GA 4MMKA 1LPLA 4QKUA 1NPPA 2J05A 4FU6A 4M78C 1X2KA 2DTOA 2OAUA 2DK3A 4NL3A 1PHTA 3F70A 3OSSC 4ELYC 3A8OB 1TTHB 3JB9F 2D8HA 2BZ8A 2RI2A 4J9GA 1K73U 5HK0A 1YJWT 4J8OA 1S1NA 1MMDA 2G3RA 7AT1B 2QA4Q 3VU3C 1EIFA 1PD0A 3LH0A 2GFUA 5CVIA 4M7AC 1AEYA 2VGNA 1TS9A 2RJFA 2DL4A 1GFCA 1ZSZA 3RKXA 3H9NA 1GBQA 1UHCA 3I55Q 5LJ3d 1ZSZB 2LJ0A 2F2XA 4KH1B 1YJNQ 5KH6A 1VQ4Q 1M30A 1WGSA 1WI7A 8AT1B 3MPUB 5LJ5f 3CCVA 4FW2A 4F7UE 3JCMX 3FRNA 1TG0A 2DXCA 3JCMh 3OQ5A 3VS6A 1QCNA 1NZ9A 5LJ5j 4LDVA 2CKKA 3RUXA 1KIKA 1JO8A 2MOXA 4M75E 3REBB 3LWIA 2LTOA 3CC2A 2HZYA 3OYGA 1OU9A 2JUFA 2VASA 5FROA 1WHJA 3CCUT 2LDMA 3A8GB 1D1CA 1YJ9Q 2RJCA 3C95A 4KUDK 4PJOG 3OYBA 2KAFA 1VQKA 2HKQB 2JTMA 1I4K1 1PWTA 3S3NA 3FJ5A 4M77D 2P4RA 4JS4A 3CCST 5IH2A 3OS5A 2FZCB 4HCBA 4M78E 1OI1A 1GXIE 3VRYA 1X01A 2A3LA 2KVQG 3M57A 1KQSS 2KRSA 2MI6A 1UG1A 2H3JA 3LH5A 4ZTFA 2DL7A 1JBMA 2RN8A 4L59A 1KD1C 1BI2A 1SKUB 4M7DG 2WACA 1M27C 1NG2A 3EFRA 2KRNA 3JCMW 4JUVA 5J3BA 5A0GA 4M7AE 4OP0A 2PVDB 4EMKC 1GCQA 1PSEA 4QQGA 3RMSA 5GMKm 1VQ5Q 4O5VA 1ABQA 4EMGA 2ZGWA 2E12A 2XDBA 2XG8D 1JXOA 2J6OA 3DLMA 1B07A 3GF5A 2HQEA 1RADB 1TWBA 4C0DB 3OW2P 3SD4A 1K0XA 3VYGA 4DEXA 2XD0A 3I56A 1M1FA 5GJVB 4A4FA 2FB7A 3CMAA 3CCEQ 1AT1B 1BBZA 3VS2A 1UTIA 1S72Q 4NOYA 3TSZA 3JSCA 4J9IA 2DIQA 3VJPA 4C5HA 2FYKA 2HQXA 4ZN3A 3RBBB 1IZ6A 4FSSA 4LD9K 3A1PA 1PKSA 3M0RA 3JCMf 1W6XA 3VUZA 3CC7T 4DA4A 2RI5A 1W2BA 1PD1A 1Y96A 3MKDA 4Y91A 2X4WA 3H41A 1Y96B 5D7UA 1K9MC 3OYEA 1VQ9T 2DEUA 2OI3A 1HSQA 4FSXA 3V8LA 1VQ6A 2ENMA 1UEBA 4MDXA 4XQ3A 1OPLA 4R56A 5KYYA 2CSQA 2D1XA 2HD0A 4M77G 2DXTA 2L3SA 4JJCA 4HXJA 5KYYB 3V8KA 2CH4A 2A37A 3CXCS 1IREB 1Q86R 1YNZA 2FVUA 1OOTA 1FMVA 4RCBA 5LJ3h 1WQ7A 2DA9A 3L42A 2RPNA 1W70A 3CC4T 2MYSA 4OF1A 3JB9J 1WJQA 2EAYA 1QVGS 1PG5B 3OMGA 2RJEA 1GFDA 1TU0B 2VYTA 4TVRA 2E6ZA 3FDRA 3UATA 4PJMA 2QTXA 3SWNC 5CKFA 2XKOC 4HVVA 5I21A 2QQSA 2QEXA 2IVWA 2QDLA 2P84A 2LNVA 3A8HB 5GAMf 3OSVA 3CCMQ 2QG9B 2FL7A 1QP3A 3G7ZA 3VS7A 3MEWA 4Z88A 3CCQA 3IQLA 3OYYA 5GAMj 5D6XA 3RERA 2LNHB 3CPWS 5GAN7 3A5ZB 2FO0A 4R0KA 4BE2A 4LUEA 4EMHA 2DMOA 2E5QA 4GLMA 1X6BA 4HT9A 1Q7YU 4N4HA 1YWOA 1M90U 4OB1B 1WJRA 3M54A 1WX6A 4OB0B 2A36A 2CSIA 1BIBA 3CCLT 4OMPA 2YRCA 4PJOA 4M75G 2DXBA 5CKBA 2HKNA 1YJWA 2QQBA 3QZ5B 1MNEA 2VB6A 3NHNA 4M4ZA 4CC4B 2IPOB 3EAEA 3DLLA 2P4TA 2KYBA 2J6KA 1KHIA 3HFOA 3CCVT 3QG1A 1LCKA 5GMKh 1ZLMA 3UA6A 4C8QC 4M7DA 3U23A 4GLKA 5FWCA 1UJYA 3C0CA 2CP3A 2CREA 4M7DB 2MWPA 2EVRA 1Q82R 2Y4XA 5CR2A 3VS4A 3OS1A 3OS2A 4F04B 4FCYA 1XNIA 2P0QA 2MPXC 1K4US 4C0FA 2QGGA 3SFMA 4M77F 2G6FX 4WCIA 2FPDA 4P5NA 5LJ3f 5GAN3 3JB9I 3KFVA 1RAHB 1YHQQ 2X51A 2O01E 2HEQA 3M0UA 2KEAA 5LJ3j 3CCUA 2GNCA 3BE3A 4KRTA 2DLPA 1U3OA 3LLRA 3M4GA 1Q7YC 1AOJA 3G4ST 1PM3A 4MDWA 1MGQA 4E7KA 3CCSA 2M02A 1Y0MA 3GNGA 5FRNA 2F2VA 1VIFA 2JTEA 2QQAA 2YXYA 3E9FA 1AZEA 4DEYA 2KE9A 1NEBA 1VQMQ 3EG3A 1N8RR 2I2LA 3FIFA 4J6WA 4QQDA 1Q95G 1J3TA 4C92A 5KE3A 2DYBA 2QTVA 1BYMA 4ATOA 4C92B 1T3LA 2VKNA 5GAOq 3G6EA 3SEMA 3HP9A 3E2UA 4X9DA 2HDAA 1N9SA 4OB2B 2CUBA 2MF2A 3OYAA 2CP5A 5LJ5g 5I11A 3PIOA 1M1KU 1IGUA 4ME7A 4HCCA 2DL8A 3MP8A 4BUGA 1C6VX 1ZBJA 2JTFA 5CQYA 1VQOQ 4Z89A 1SHGA 2ZPEB 1SSFA 1UB4A 4PLLA 1VQNQ 5KYNA 2EFIA 2YRDA 4IURA 1H3ZA 1T0JA 1WJSA 2K5IA 1VA7A 4HCKA 2Y4YA 1SRMA 1X6GA 2IIMA 2XU8A 4Z8AA 1W2BP 6AT1B 2D0QB 1BK2A 1VOMA 3BFMA 2NLUA 1RABB 3L1AA 5GMKj 3CD6A 3X26B 1AWXA 1RAIB 4BE1A 2C0TA 1K1ZA 4LXCA 1OPKA 1TUGB 2ZCFB 1MMGA 3ME9A 3QKJA 4J9CA 8ATCB 3CC7A 4JS5A 1V76A 1UDLA 4QQ6A 3O5ZA 2EQKA 3NMZC 5KE2A 2BTTA 2OTJT 5IXFA 2QQ9A 1TXQA 2ZAEA 2BIVA 3NGPA 3JCMV 1VQ8T 1TH7A 1VQ6T 3I5RA 2ESWA 1NLOC 3L2RA 1MHNA 3FC3A 3UDCA 1WXTA 5KCOA 3M4YA 2F69A 4JRKA 3EHRA 4HCZA 4A4GA 4XU3A 3J80E 1TOVA 1M1KC 1QKWA 4F7UA 2L5QA 2V8IA 5FU6B 2K3YA 1H641 5GAN5 3QJYA 4F7UB 1OX8A 1VQLT 1B34A 2XICA 1G3YA 1VQ9Q 3QZ9B 1HD3A 2K2MA 4E47A 4WTOB 1KC8R 5CK9A 1V29B 1B34B 4C92E 3TQ7P 2AKKA 4M75A 1VYUA 2JM8A 3H0IA 4PJOD 3JCMb 2DBKA 4A4KA 2YUOA 2PUKB 2YHTA 1PCXA 1M9SA 4FYYB 3OYDA 1M8MA 2KR3A 4LDUA 3REAB 5GAN6 1BCOA 3CC4A 2DD4A 1WDXA 1WHKA 3PIPA 2JOYA 2V1QA 3PTAA 2K3XA 4F14A 4LUDA 4DBHA 1VQPA 1YI2T 3JCMg 1QQJA 4XTYA 3DB3A 4M78A 2CDTA 4M7DD 5DY9A 1T3SA 2VGMA 5LJ5e 1NJIR 2HAXA 3GOXA 4M78B 1N6AA 3CMET 5EG2A 5GAOl 3AHUA 2B86A 2EKOA 2L3RA 2C0IA 1GL5A 1MV0B 3G71T 1KQSA 2E65A 2K3BA 3RKYA 3CCJT 4QT7A 3HRUA 1U1SA 4N0AC 3RR6A 2DIGA 2K5FA 1OX9A 1SF9A 2XHCA 5HY6A 4M7AA 3OYCA 4L6V5 2L3PA 4M7AB 4ESRA 2CZ0B 4JLIA 2A08A 4CC3A 3CCLA 4BD3A 2K4YA 2XIDA 1YIJT 3UF4A 3TVTA 1ZQ1A 5FW9A 2HSEB 1WNLA 5J26A 3QXEB 1I1JA 2RQVA 2KRMA 1QVFS 1F1BB 2LZ6B 4X9CA 4C92D 2LVMA 2K2VA 2XDPA 1W4SA 2AK5A 2E64A 5CAIA 2EGCA 1BI3A 2LJ1A 2YT6A 3I5SA 4Z02A 2GQVA 3QBYA 2RK1A 1YBYA 5GAMg 4IKFA 2DETA 4CRIA 2R5MA 2F5TX 3CCVQ 2JN0A 4KBMB 3SB2A 1ZUKA 3CBMA 4FYXB 5FWBA 2KXDA 2X4JA 1UFFA 3UPUA 4CC7A 3JCMJ 2CP0A 4JDSA 3THKA 4ZN1A 2DVEA 3CC2Q 2V26A 4OMLA 5DM7R 5J39A 1K73C 2YWWA 5CKEA 2F5KA 1G3TA 4RG8A 3L2UA 5GMKi 4JJNK 3G4SA 2JJ9A 4J9FA 5AT1B 4JJDA 4II1A 1VQKQ 1G3SA 1GBRA 1NYGA 4JLGA 3NFCA 1HK9A 3EFOA 4KH0B 1GCPA 4EMKA 4JRQA 3EFOB 4VUBA 1N5ZA 3GIBA 3JCMe 3G6ET 2JS2A 4EMKB 1LOJA 2RK2A 1ZA2B 5GJWB 1UGSB 3CXCA 1H92A 5AYFA 1WYXA 2EGAA 3META 2RM4A 1ARKA 3INZA 2QAZA 2DXUA 1VQ7T 4YTLA 2QDYB 2FEIA 2GF7A 2RB6A 2E4HA 3HHTB 3CPFA 5GAMh 3R6OA 4BACA 2LQ8A 3M58A 2X9HA 1QVGA 3QWYA 5FRMA 2O4XA 1C0MA 2XK0A 1UJ0A 2O4XB 5LJ3g 3M9QA 1ACMB 1BB9A 2H3EB 1BKBA 4RG2A 2E70A 2A0FB 2F1LA 2ZZDA 4QVZA 2KY9A 4NL2A 1S72A 4M75D 5IHKA 5GAOm 1WFWA 3I56Q 3CD6T 3BDLA 2BE7D 3CPWA 3CMAQ 1OYXA 1QWFA 1D1BA 2BUDA 4OMNA 1XJWB 2JS0A 3DKMA 2L0AA 4C92G 2YLCA 3QDRB 3EFSA 4HT8A 3RESA 4RTUA 2R57A 4JRPA 1G8XA 1D3BA 1KD1R 1JJ2A 1JEGA 3VV0A 2DERA 1D3BB 3NTHA 2HSPA 2EJFA 2A28A 1SRLA 5IXBA 2OTJA 1QLYA 4M78D 4E7LA 4ZTJA 1BI1A 2YSQA 3QYHB 1VQ8A 4B9XA 3NTKA 3CCRT 3EGDA 2E5KA 4IUTA 4E2FB 2IG0A 1KHCA 1U06A 3EGUA 3EGDB 3PVQA 4PJOF 3EHQA 2YRVA 2V8KA 1JU5C 1I81A 4XAXB 4OMMA 3L2QA 1VQ6Q 2GGRA 1GRIA 1VQLA 4RUGA 4DOVA 2GBQA 4M7AD 1IO6A 2EYXA 2M1HA 4HA8A 4J5YA 1YITQ 2KQWA 2KT1A 2NYSA 5IN1A 3SWNA 4LNPA 1FXXA 2VV5A 3SHWA 4M7DF 2RQRA 3SWNB 1X75C 4PFPA 2EQIA 3VYHB 1VQPT 1N8RU 3OYKA 4Y28E 3S3MA 3FB9A 1H3HA 2CP6A 1N9RA 4AFSC 4OGCA 1YI2A 1KQSP 5GANd 1H8KA 1NEGA 1KQ2A 1K8AU 1Y7XA 4E7HA 1K9MR 3JCMc 2OTLQ 3FLGA 2C06A 2QEXQ 3CMEA 4GY5A 2VC8A 1D0XA 1Q81U 2LCSA 5GAN8 5FU7C 4F7UG 3AT1B 2EYQA 2I0NA 3PGGA 1Y57A 3G71A 2LT4A 4J9BA 3R6NA 3CCJA 3CCQQ 1RAGB 5LJ3e 4XU0A 1BI0A 4PL6A 4RTZA 3T9NA 2QA4T 1YFNA 5ECAA 3LWHA 2MK5A 1D0YA 2HBPA 4K11A 4MMLA 1OZ3A 2K5LA 4QW2A 3J81E 2KMTA 4ELZC 2QASA 4C92F 1EX4A 4C8QA 1YIJA 2XMFA 2M51A 3I55T 4C8QB 2JVVA 1YJWQ 1CSKA 3HL8A 3E1SA 2FPFA 1VQ4T 1M5Q1 2SEMA 5I2SA 4XTVA
chains in the Genus database with same CATH topology
2M02A 2CP5A 2COZA 2QK0A 1TOVA 1WHLA 2CP3A 2CP2A 2HL3A 2HL5C 2HQHA 2Z0WA 2E3IA 4B6MA 1WHMA 1WHKA 1LPLA 1TXQA 2COWA 1WHJA 2CP6A 2CP7A 1WHGA 2COYA 1WHHA 2MPXC 1IXDA 2E3HA 2E4HA 3TQ7P 2CP0A 2HKQB 3RDVA 3E2UA 2HKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M02 A;  2CP5 A;  2COZ A;  2QK0 A;  1TOV A;  1WHL A;  2CP3 A;  2CP2 A;  2HL3 A;  2HL5 C;  2HQH A;  2Z0W A;  2E3I A;  4B6M A;  1WHM A;  1WHK A;  1LPL A;  1TXQ A;  2COW A;  1WHJ A;  2CP6 A;  2CP7 A;  1WHG A;  2COY A;  1WHH A;  2MPX C;  1IXD A;  2E3H A;  2E4H A;  3TQ7 P;  2CP0 A;  2HKQ B;  3RDV A;  3E2U A;  2HKN A; 
#chains in the Genus database with same CATH topology
 2K6D A;  4M78 G;  1UE9 A;  3X25 B;  2HBW A;  3M0T A;  1R0C B;  2FZK B;  2D6F A;  4LD6 A;  2YUP A;  3EG1 A;  3EH2 A;  2DPP B;  2V8J A;  4X34 A;  3ASK A;  1ZX6 A;  2J7I A;  2ATC B;  5IHN A;  1B7T A;  4E7Z A;  5EC7 A;  4BY6 B;  1E6H A;  3RDV A;  1K8A C;  3LGL A;  2WSC E;  3PVL A;  4J7I A;  4HKE A;  4OMQ A;  5M9O A;  2BZY A;  4M7A G;  1YJ9 T;  4BY6 C;  3NTI A;  1Q81 C;  4QVD A;  3KXT A;  2YUN A;  1N27 A;  3MP1 A;  1K0S A;  1WHG A;  2ECZ A;  1M90 C;  3X28 B;  1IGQ A;  2EKH A;  2KNB B;  3ER0 A;  3BW1 A;  1YCS B;  4RTV A;  3OMC A;  2QK0 A;  3CCU Q;  1TUD A;  2E1H A;  1RI9 A;  3QUI A;  2FHD A;  4ZNX A;  4HVU A;  5GMK e;  3CXC P;  2AKL A;  4OMF B;  3P8D A;  1RI0 A;  3VS5 A;  5GAO n;  4C5I A;  2CZ1 B;  1MND A;  3CCS Q;  3GBQ A;  2E41 A;  2CGH A;  3C94 A;  3L2W A;  3HRS A;  2V1R A;  3M0S A;  2LC4 A;  2CH4 W;  1QVG P;  1NJI U;  4PJN A;  3BY7 A;  2ZPH B;  4F7U F;  1VQ5 T;  1RL2 A;  3MP6 A;  1RAA B;  1IHV A;  4J6X A;  1VQ7 A;  3FEO A;  4DQ2 A;  3FJP A;  1ZSG A;  3OYL A;  1FX7 A;  2AIR B;  1K76 A;  2X4X A;  4C8Q E;  3H0F A;  4M75 F;  4ZGJ B;  4RMO A;  1RLQ C;  1UGR B;  3A8M B;  2D8J A;  3CCE T;  1V1C A;  4BI3 A;  4V2S A;  2CP2 A;  3O8V A;  1S72 T;  1TUC A;  3CPW P;  2BZX A;  2A7Y A;  5A0D A;  1LJO A;  1PRM C;  1LVK A;  2KSS A;  1Q7Y R;  1VIE A;  2EBP A;  2DTI A;  4J6Y A;  2COY A;  3OBY A;  1P92 A;  4XTU A;  1HJD A;  3ULR B;  1JJ2 P;  5GAN h;  2EJG A;  4LE9 A;  4M78 F;  2DZ9 A;  2EWN A;  3VRZ A;  3OYM A;  2CYZ B;  3M59 A;  2QI2 A;  2WSE E;  4JZ3 A;  3VUB A;  3JB9 G;  3A98 A;  1IHW A;  1WHM A;  2MWO A;  5L8R E;  3ZFJ A;  5HCK A;  4M77 C;  3E19 A;  3S6W A;  1FYN A;  1MMN A;  2PVG B;  4FYW B;  1D0Z A;  3CD6 Q;  3C12 A;  2RD1 A;  2LCL A;  3LX7 A;  5CCA A;  2MIO A;  3CC7 Q;  3PT9 A;  3OS0 A;  1OZ2 A;  3M53 A;  4M7A F;  1ZHI A;  1FMW A;  3JRZ A;  4XK8 E;  3CCR A;  1D1A A;  4KT0 E;  3ZEH A;  1X2Q A;  2JNG A;  5HK3 A;  5I2M A;  4KGX B;  2L3Q A;  2COW A;  1I0C A;  1QVF A;  1ZBX A;  3P8H A;  1M3C A;  4LDX A;  2JW4 A;  3PMI A;  4AT1 B;  2E10 A;  3LGF A;  3TEE A;  4AMC A;  1KJW A;  2H8H A;  2EGE A;  2HL5 C;  2W0Z A;  2Z0W A;  5D6W A;  1NYF A;  2MMP A;  2PQW A;  4C8Q D;  1YCY A;  3V7S A;  1RAE B;  4D8D A;  2NWM A;  5IT9 E;  2CT4 A;  3J7A F;  2J6F A;  3P8B B;  2P0K A;  2RHY A;  3CC4 Q;  1WHL A;  1QWE A;  2RHZ A;  3HTR A;  2DNU A;  2JT4 A;  2O2O A;  4BDZ A;  4N0A A;  2DE0 X;  2DM1 A;  4X1V A;  4FM4 B;  4F16 A;  2LQW A;  2M16 A;  4C0G A;  4FL6 A;  4IIO A;  5A0L A;  1NBE B;  5DLQ E;  2QQR A;  3OW2 S;  2KXC A;  3QPH A;  2RF0 A;  2EQM A;  2BKD N;  2GTJ A;  1E7O A;  5D6Y A;  4M77 E;  1M1K R;  2K7A A;  1G83 A;  4IUU A;  4MZM A;  5GAN f;  1UEC A;  2EYW A;  4FW1 A;  2QGF B;  2QA4 A;  2EJ9 A;  4AFQ C;  1NLP C;  2J06 A;  2RA2 A;  5GAN j;  1RLP C;  2LT1 A;  2YDL A;  2D0N A;  2FRY A;  3QHS A;  3M0P A;  4A63 B;  1KSW A;  2RMO A;  2YUQ A;  3CCL Q;  3HFN A;  2DVJ A;  3I55 A;  2K57 A;  1YJN A;  1VQ4 A;  2DF6 A;  4IIM A;  1KD1 U;  3MCA B;  1CKA A;  1I8F A;  1WIE A;  2KT8 A;  2QXF A;  2KYM A;  1SPK A;  2VVK A;  2EYY A;  5FLX E;  2M0O A;  4BE0 A;  2R5A A;  4ORZ A;  2O9V A;  1AWJ A;  3VS0 A;  2RH2 A;  1ZSZ C;  1YHQ T;  1NE8 A;  1OV3 A;  1UUE A;  1QP2 A;  1JRI A;  1CKB A;  2R58 A;  3MHX A;  4RCC A;  2ED1 A;  1WPY A;  2EW3 A;  4A53 A;  3GPL A;  1YJ9 A;  2ED0 A;  2RHU A;  1Q86 U;  2COZ A;  4JJB A;  1KK7 A;  3CQT A;  2LQN A;  5KYW A;  1LNX A;  4Q5W A;  5KYW B;  4PFO A;  4C8Q G;  1AHJ B;  2EPD A;  2DKG A;  3RKW A;  3JAM E;  2RQU A;  1VQM T;  1MMA A;  3HRT A;  3QSU A;  1UHF A;  4CI0 C;  2SRC A;  2O88 A;  2FRW A;  4J9D A;  3OYJ A;  3M56 A;  3G4S Q;  3M0Q A;  1IRX A;  3V8J A;  2CUD A;  4PK4 A;  1EZZ B;  1RAC B;  2FG0 A;  2EQU A;  2ZPB B;  1WHH A;  1M3A A;  4B9W A;  1K9M U;  4LDY A;  1RAF B;  3EH1 A;  2GFA A;  1VQ5 A;  1VQO T;  1YWP A;  4BB7 A;  1O75 A;  4DBQ A;  1QW1 A;  4IUP A;  1SSH A;  3LW5 E;  1QCF A;  5IHI A;  1VQN T;  2KDS A;  4RTY A;  2DRM A;  1MUZ A;  3HPW A;  1YN8 A;  3A8L B;  1UGP B;  1X43 A;  3EG0 A;  3RIR A;  2AHJ B;  1JB0 E;  3I35 A;  3CCE A;  1BIA A;  2PTK A;  2KBT A;  4LDW A;  2F2W A;  3MEV A;  2WSF E;  3MEU A;  1GCQ C;  1Z9Q A;  1Q86 C;  1A0N B;  1M4Z A;  1OU8 A;  1QKX A;  1K73 R;  3SDZ A;  1E6G A;  3PNW C;  4PKC C;  1PRL C;  2DX1 A;  2LX7 A;  4C0D C;  1TSF A;  1ZUY A;  1XOV A;  1AVZ C;  4PNO A;  1Z9Z A;  4ZGE B;  2VWF A;  5I22 A;  1WZO A;  4PLI A;  2OAW A;  3L2V A;  2RJD A;  1Q82 U;  2L8D A;  4RTW A;  2RNA A;  2HQH A;  3PMT A;  5GAM e;  4AG2 C;  2E6N A;  3C4S A;  1YP5 A;  3X20 B;  9ATC B;  4L5G A;  1QVF P;  3PFS A;  1WXB A;  1O9S A;  4OVA A;  5C6S A;  2JM9 A;  2RI3 A;  2LMJ A;  2OTJ Q;  1I5L A;  1VQ8 Q;  2KI7 A;  2DRK A;  1AZG B;  1PNJ A;  5HKC A;  3JCM P;  2OJ2 A;  2DJZ A;  3LYI A;  3QII A;  5CIU A;  4C8Q F;  5L23 A;  1VYT A;  3URG A;  4J7F A;  5IAY A;  2YLB A;  4PJJ A;  3L2Z A;  1IXD A;  1YIT A;  3MJX A;  2ROL A;  2ZPG B;  4MZP A;  3DB4 A;  3ZBD A;  1VQL Q;  1FMK A;  1OEB A;  1M8V A;  2X4Y A;  1ZA1 B;  4KUL A;  3OYI A;  1XTD A;  1UGV A;  1QVP A;  3M55 A;  2XDD A;  1PSF A;  1U8R A;  1HXD A;  3D7S B;  2HMA A;  1SG5 A;  2CT3 A;  5KYU A;  4J9H A;  2EQJ A;  2FZG B;  3CCM A;  3ZL7 C;  5KYU B;  3RMQ A;  1Y71 A;  1AWW A;  2O31 A;  5FU7 B;  3WXM B;  2X35 A;  4XTW A;  4C5E A;  1Y07 A;  2OTL A;  1M2O A;  1Q82 C;  4PFZ A;  1FWZ A;  1YI2 Q;  1NM7 A;  1U5S A;  1M2V A;  1W1F A;  1M2V B;  3VKI A;  1IB8 A;  4AFU C;  1I5O B;  4XU1 A;  3CME Q;  3H6Z A;  5LL6 S;  4BDY A;  3H0H A;  2NUT A;  2DL3 A;  3G71 Q;  1W2B S;  1ABO A;  1SEM A;  2NUZ A;  2NUT B;  3CCJ Q;  2RO0 A;  2LX9 A;  1JJ2 S;  4WF2 A;  3M5A A;  3OY9 A;  1G2B A;  1R77 A;  5LJ5 d;  3V7C A;  1YJN T;  3HSB A;  4AG1 C;  2AT1 B;  1HYO A;  4PJO B;  1X27 A;  1SHF A;  2VXE A;  2DJQ A;  2PUO B;  5GAO r;  3GNF B;  2RQW A;  1YIJ Q;  1T0H A;  4D6W A;  2E3I A;  4LN2 A;  3JB9 D;  1N8R C;  4PJO C;  3GLX A;  4RTX A;  1OUL A;  2K79 A;  1UGQ B;  3I9Q A;  4Y92 A;  3N5B B;  3CEY A;  2KK4 A;  5DLO A;  1WLP B;  4DBR A;  2CS7 A;  3UA7 A;  2QYZ A;  1C1A A;  2VUB A;  3QJ6 A;  2ZPI B;  2DL5 A;  3OYF A;  4PJL A;  3MEA A;  1KFZ A;  1B3Q A;  4KGV B;  1AD5 A;  3RNJ A;  1WQW A;  1YHQ A;  2LQK A;  1QCO A;  4EIK A;  2JMC A;  4M7D C;  2HCK A;  4C0Z A;  1AWO A;  3CC2 T;  4A4E A;  1KC8 U;  2M0Y A;  2DAQ A;  1X69 A;  1I07 A;  2DIL A;  3EG2 A;  3X24 B;  2JXB A;  2PVO B;  5GAN g;  1VQK T;  5GAO p;  1PKT A;  3OYN A;  3TSW A;  2PZ1 A;  3NPF A;  4BI4 A;  4EPC A;  2ZPF B;  2RHI A;  2VXF A;  3EG9 A;  2LJ3 A;  3WVE B;  1VQM A;  4BI8 B;  3EG9 B;  2AZS A;  1XQH A;  1VYV A;  4R55 A;  2NUP A;  1NPR A;  4ANJ A;  2GTO A;  1OQK A;  2DBM A;  4AFZ C;  2NUP B;  5KCH A;  4OMO A;  4B6M A;  4DOW A;  1D09 B;  4E7S A;  2RHX A;  2D9T A;  2AZV A;  3G6E Q;  3H8Z A;  2B8A A;  2PNI A;  1VQO A;  2K9G A;  4DBF A;  2HNI A;  3BDU A;  4RKU E;  1K8A R;  4UC4 A;  2EYZ A;  4J9E A;  2MAM A;  2ROT A;  1RUW A;  4PJO E;  4C92 C;  1VQN A;  3CBO A;  1VQ7 Q;  2C0O A;  1Q81 R;  2XI9 A;  1DJ7 B;  5CKH A;  1X6O A;  4QVC A;  1G3W A;  4D8K A;  3JCM d;  4OGE A;  4N4I A;  4FT4 A;  1M90 R;  4JZ4 A;  4C5G A;  1KC8 C;  3I56 T;  2KRO A;  1BCM A;  3CMA T;  3GP8 A;  2W10 A;  4M77 A;  4E7J A;  2P0P A;  4O6J A;  3G1J A;  4CC2 A;  2M9U A;  4ZGD B;  4F17 A;  4M77 B;  1M3B A;  3OW2 A;  4M7D E;  2DEQ A;  4FYV B;  4J83 A;  1QMC A;  5CKD A;  2GQI A;  1WA7 A;  4XTX A;  1G5V A;  4HVW A;  4NS5 A;  1VUB A;  4FT2 A;  2RQT A;  5KYX A;  2L89 A;  3V7R A;  3OB9 A;  3MO8 A;  2ABL A;  5KYX B;  2EIF A;  5CO7 A;  4XU2 A;  2GCX A;  2DZC A;  3OBW A;  3JV3 A;  2Y90 A;  3KUF A;  1NJI C;  2LP5 A;  2JMA A;  3WVD B;  3KBG A;  2PU9 B;  4FIB A;  2X3W D;  2X3X D;  3OA6 A;  1JQQ A;  3VS3 A;  3VS1 A;  4A54 A;  2JZ2 A;  3TRE A;  2DO3 A;  2DD5 A;  3EGX A;  1R0B G;  5GAN 2;  5LJ5 h;  1VQ9 A;  2FPE A;  3CCR Q;  3EGX B;  4KGZ B;  1JXM A;  3QWX X;  2MCN A;  1YIT T;  2DYI A;  1U1T A;  4OB3 B;  2O9S A;  5GAN e;  4JRI A;  3JB9 H;  1KG1 A;  3S3O A;  1M1G A;  3UT1 A;  1R8O B;  4A4H A;  2CP7 A;  1WXU A;  5FU6 C;  1K9A A;  5GAM d;  2LCC A;  1EFN A;  1MV3 A;  2L2P A;  5GMK l;  3TU4 K;  4EDU A;  3HKS A;  4M75 B;  3JCM Q;  2CZ7 B;  5C0M A;  3CCM T;  1BU1 A;  2CZ6 B;  1PC0 A;  2OX7 A;  2HL3 A;  4IUV A;  3CBP A;  1KQ1 A;  3PE0 A;  3OYH A;  4IUQ A;  1ZUU A;  2BE9 B;  2KGT A;  4M75 C;  3QDF A;  3UWN A;  2OTL T;  4N4G A;  3QYG B;  2QEX T;  2DFU A;  2LRQ A;  5CQX A;  3TCJ A;  1VQP Q;  3Q1J A;  4XTZ A;  2DTH A;  4GBQ A;  5A2Q E;  2E3H A;  4JPB W;  4MZT A;  3QO3 A;  4KUI A;  4E6R A;  5GAN 4;  3CCQ T;  4RTT A;  4E7I A;  3E9G A;  4MMK A;  1LPL A;  4QKU A;  1NPP A;  2J05 A;  4FU6 A;  4M78 C;  1X2K A;  2DTO A;  2OAU A;  2DK3 A;  4NL3 A;  1PHT A;  3F70 A;  3OSS C;  4ELY C;  3A8O B;  1TTH B;  3JB9 F;  2D8H A;  2BZ8 A;  2RI2 A;  4J9G A;  1K73 U;  5HK0 A;  1YJW T;  4J8O A;  1S1N A;  1MMD A;  2G3R A;  7AT1 B;  2QA4 Q;  3VU3 C;  1EIF A;  1PD0 A;  3LH0 A;  2GFU A;  5CVI A;  4M7A C;  1AEY A;  2VGN A;  1TS9 A;  2RJF A;  2DL4 A;  1GFC A;  1ZSZ A;  3RKX A;  3H9N A;  1GBQ A;  1UHC A;  3I55 Q;  5LJ3 d;  1ZSZ B;  2LJ0 A;  2F2X A;  4KH1 B;  1YJN Q;  5KH6 A;  1VQ4 Q;  1M30 A;  1WGS A;  1WI7 A;  8AT1 B;  3MPU B;  5LJ5 f;  3CCV A;  4FW2 A;  4F7U E;  3JCM X;  3FRN A;  1TG0 A;  2DXC A;  3JCM h;  3OQ5 A;  3VS6 A;  1QCN A;  1NZ9 A;  5LJ5 j;  4LDV A;  2CKK A;  3RUX A;  1KIK A;  1JO8 A;  2MOX A;  4M75 E;  3REB B;  3LWI A;  2LTO A;  3CC2 A;  2HZY A;  3OYG A;  1OU9 A;  2JUF A;  2VAS A;  5FRO A;  1WHJ A;  3CCU T;  2LDM A;  3A8G B;  1D1C A;  1YJ9 Q;  2RJC A;  3C95 A;  4KUD K;  4PJO G;  3OYB A;  2KAF A;  1VQK A;  2HKQ B;  2JTM A;  1I4K 1;  1PWT A;  3S3N A;  3FJ5 A;  4M77 D;  2P4R A;  4JS4 A;  3CCS T;  5IH2 A;  3OS5 A;  2FZC B;  4HCB A;  4M78 E;  1OI1 A;  1GXI E;  3VRY A;  1X01 A;  2A3L A;  2KVQ G;  3M57 A;  1KQS S;  2KRS A;  2MI6 A;  1UG1 A;  2H3J A;  3LH5 A;  4ZTF A;  2DL7 A;  1JBM A;  2RN8 A;  4L59 A;  1KD1 C;  1BI2 A;  1SKU B;  4M7D G;  2WAC A;  1M27 C;  1NG2 A;  3EFR A;  2KRN A;  3JCM W;  4JUV A;  5J3B A;  5A0G A;  4M7A E;  4OP0 A;  2PVD B;  4EMK C;  1GCQ A;  1PSE A;  4QQG A;  3RMS A;  5GMK m;  1VQ5 Q;  4O5V A;  1ABQ A;  4EMG A;  2ZGW A;  2E12 A;  2XDB A;  2XG8 D;  1JXO A;  2J6O A;  3DLM A;  1B07 A;  3GF5 A;  2HQE A;  1RAD B;  1TWB A;  4C0D B;  3OW2 P;  3SD4 A;  1K0X A;  3VYG A;  4DEX A;  2XD0 A;  3I56 A;  1M1F A;  5GJV B;  4A4F A;  2FB7 A;  3CMA A;  3CCE Q;  1AT1 B;  1BBZ A;  3VS2 A;  1UTI A;  1S72 Q;  4NOY A;  3TSZ A;  3JSC A;  4J9I A;  2DIQ A;  3VJP A;  4C5H A;  2FYK A;  2HQX A;  4ZN3 A;  3RBB B;  1IZ6 A;  4FSS A;  4LD9 K;  3A1P A;  1PKS A;  3M0R A;  3JCM f;  1W6X A;  3VUZ A;  3CC7 T;  4DA4 A;  2RI5 A;  1W2B A;  1PD1 A;  1Y96 A;  3MKD A;  4Y91 A;  2X4W A;  3H41 A;  1Y96 B;  5D7U A;  1K9M C;  3OYE A;  1VQ9 T;  2DEU A;  2OI3 A;  1HSQ A;  4FSX A;  3V8L A;  1VQ6 A;  2ENM A;  1UEB A;  4MDX A;  4XQ3 A;  1OPL A;  4R56 A;  5KYY A;  2CSQ A;  2D1X A;  2HD0 A;  4M77 G;  2DXT A;  2L3S A;  4JJC A;  4HXJ A;  5KYY B;  3V8K A;  2CH4 A;  2A37 A;  3CXC S;  1IRE B;  1Q86 R;  1YNZ A;  2FVU A;  1OOT A;  1FMV A;  4RCB A;  5LJ3 h;  1WQ7 A;  2DA9 A;  3L42 A;  2RPN A;  1W70 A;  3CC4 T;  2MYS A;  4OF1 A;  3JB9 J;  1WJQ A;  2EAY A;  1QVG S;  1PG5 B;  3OMG A;  2RJE A;  1GFD A;  1TU0 B;  2VYT A;  4TVR A;  2E6Z A;  3FDR A;  3UAT A;  4PJM A;  2QTX A;  3SWN C;  5CKF A;  2XKO C;  4HVV A;  5I21 A;  2QQS A;  2QEX A;  2IVW A;  2QDL A;  2P84 A;  2LNV A;  3A8H B;  5GAM f;  3OSV A;  3CCM Q;  2QG9 B;  2FL7 A;  1QP3 A;  3G7Z A;  3VS7 A;  3MEW A;  4Z88 A;  3CCQ A;  3IQL A;  3OYY A;  5GAM j;  5D6X A;  3RER A;  2LNH B;  3CPW S;  5GAN 7;  3A5Z B;  2FO0 A;  4R0K A;  4BE2 A;  4LUE A;  4EMH A;  2DMO A;  2E5Q A;  4GLM A;  1X6B A;  4HT9 A;  1Q7Y U;  4N4H A;  1YWO A;  1M90 U;  4OB1 B;  1WJR A;  3M54 A;  1WX6 A;  4OB0 B;  2A36 A;  2CSI A;  1BIB A;  3CCL T;  4OMP A;  2YRC A;  4PJO A;  4M75 G;  2DXB A;  5CKB A;  2HKN A;  1YJW A;  2QQB A;  3QZ5 B;  1MNE A;  2VB6 A;  3NHN A;  4M4Z A;  4CC4 B;  2IPO B;  3EAE A;  3DLL A;  2P4T A;  2KYB A;  2J6K A;  1KHI A;  3HFO A;  3CCV T;  3QG1 A;  1LCK A;  5GMK h;  1ZLM A;  3UA6 A;  4C8Q C;  4M7D A;  3U23 A;  4GLK A;  5FWC A;  1UJY A;  3C0C A;  2CP3 A;  2CRE A;  4M7D B;  2MWP A;  2EVR A;  1Q82 R;  2Y4X A;  5CR2 A;  3VS4 A;  3OS1 A;  3OS2 A;  4F04 B;  4FCY A;  1XNI A;  2P0Q A;  2MPX C;  1K4U S;  4C0F A;  2QGG A;  3SFM A;  4M77 F;  2G6F X;  4WCI A;  2FPD A;  4P5N A;  5LJ3 f;  5GAN 3;  3JB9 I;  3KFV A;  1RAH B;  1YHQ Q;  2X51 A;  2O01 E;  2HEQ A;  3M0U A;  2KEA A;  5LJ3 j;  3CCU A;  2GNC A;  3BE3 A;  4KRT A;  2DLP A;  1U3O A;  3LLR A;  3M4G A;  1Q7Y C;  1AOJ A;  3G4S T;  1PM3 A;  4MDW A;  1MGQ A;  4E7K A;  3CCS A;  2M02 A;  1Y0M A;  3GNG A;  5FRN A;  2F2V A;  1VIF A;  2JTE A;  2QQA A;  2YXY A;  3E9F A;  1AZE A;  4DEY A;  2KE9 A;  1NEB A;  1VQM Q;  3EG3 A;  1N8R R;  2I2L A;  3FIF A;  4J6W A;  4QQD A;  1Q95 G;  1J3T A;  4C92 A;  5KE3 A;  2DYB A;  2QTV A;  1BYM A;  4ATO A;  4C92 B;  1T3L A;  2VKN A;  5GAO q;  3G6E A;  3SEM A;  3HP9 A;  3E2U A;  4X9D A;  2HDA A;  1N9S A;  4OB2 B;  2CUB A;  2MF2 A;  3OYA A;  2CP5 A;  5LJ5 g;  5I11 A;  3PIO A;  1M1K U;  1IGU A;  4ME7 A;  4HCC A;  2DL8 A;  3MP8 A;  4BUG A;  1C6V X;  1ZBJ A;  2JTF A;  5CQY A;  1VQO Q;  4Z89 A;  1SHG A;  2ZPE B;  1SSF A;  1UB4 A;  4PLL A;  1VQN Q;  5KYN A;  2EFI A;  2YRD A;  4IUR A;  1H3Z A;  1T0J A;  1WJS A;  2K5I A;  1VA7 A;  4HCK A;  2Y4Y A;  1SRM A;  1X6G A;  2IIM A;  2XU8 A;  4Z8A A;  1W2B P;  6AT1 B;  2D0Q B;  1BK2 A;  1VOM A;  3BFM A;  2NLU A;  1RAB B;  3L1A A;  5GMK j;  3CD6 A;  3X26 B;  1AWX A;  1RAI B;  4BE1 A;  2C0T A;  1K1Z A;  4LXC A;  1OPK A;  1TUG B;  2ZCF B;  1MMG A;  3ME9 A;  3QKJ A;  4J9C A;  8ATC B;  3CC7 A;  4JS5 A;  1V76 A;  1UDL A;  4QQ6 A;  3O5Z A;  2EQK A;  3NMZ C;  5KE2 A;  2BTT A;  2OTJ T;  5IXF A;  2QQ9 A;  1TXQ A;  2ZAE A;  2BIV A;  3NGP A;  3JCM V;  1VQ8 T;  1TH7 A;  1VQ6 T;  3I5R A;  2ESW A;  1NLO C;  3L2R A;  1MHN A;  3FC3 A;  3UDC A;  1WXT A;  5KCO A;  3M4Y A;  2F69 A;  4JRK A;  3EHR A;  4HCZ A;  4A4G A;  4XU3 A;  3J80 E;  1TOV A;  1M1K C;  1QKW A;  4F7U A;  2L5Q A;  2V8I A;  5FU6 B;  2K3Y A;  1H64 1;  5GAN 5;  3QJY A;  4F7U B;  1OX8 A;  1VQL T;  1B34 A;  2XIC A;  1G3Y A;  1VQ9 Q;  3QZ9 B;  1HD3 A;  2K2M A;  4E47 A;  4WTO B;  1KC8 R;  5CK9 A;  1V29 B;  1B34 B;  4C92 E;  3TQ7 P;  2AKK A;  4M75 A;  1VYU A;  2JM8 A;  3H0I A;  4PJO D;  3JCM b;  2DBK A;  4A4K A;  2YUO A;  2PUK B;  2YHT A;  1PCX A;  1M9S A;  4FYY B;  3OYD A;  1M8M A;  2KR3 A;  4LDU A;  3REA B;  5GAN 6;  1BCO A;  3CC4 A;  2DD4 A;  1WDX A;  1WHK A;  3PIP A;  2JOY A;  2V1Q A;  3PTA A;  2K3X A;  4F14 A;  4LUD A;  4DBH A;  1VQP A;  1YI2 T;  3JCM g;  1QQJ A;  4XTY A;  3DB3 A;  4M78 A;  2CDT A;  4M7D D;  5DY9 A;  1T3S A;  2VGM A;  5LJ5 e;  1NJI R;  2HAX A;  3GOX A;  4M78 B;  1N6A A;  3CME T;  5EG2 A;  5GAO l;  3AHU A;  2B86 A;  2EKO A;  2L3R A;  2C0I A;  1GL5 A;  1MV0 B;  3G71 T;  1KQS A;  2E65 A;  2K3B A;  3RKY A;  3CCJ T;  4QT7 A;  3HRU A;  1U1S A;  4N0A C;  3RR6 A;  2DIG A;  2K5F A;  1OX9 A;  1SF9 A;  2XHC A;  5HY6 A;  4M7A A;  3OYC A;  4L6V 5;  2L3P A;  4M7A B;  4ESR A;  2CZ0 B;  4JLI A;  2A08 A;  4CC3 A;  3CCL A;  4BD3 A;  2K4Y A;  2XID A;  1YIJ T;  3UF4 A;  3TVT A;  1ZQ1 A;  5FW9 A;  2HSE B;  1WNL A;  5J26 A;  3QXE B;  1I1J A;  2RQV A;  2KRM A;  1QVF S;  1F1B B;  2LZ6 B;  4X9C A;  4C92 D;  2LVM A;  2K2V A;  2XDP A;  1W4S A;  2AK5 A;  2E64 A;  5CAI A;  2EGC A;  1BI3 A;  2LJ1 A;  2YT6 A;  3I5S A;  4Z02 A;  2GQV A;  3QBY A;  2RK1 A;  1YBY A;  5GAM g;  4IKF A;  2DET A;  4CRI A;  2R5M A;  2F5T X;  3CCV Q;  2JN0 A;  4KBM B;  3SB2 A;  1ZUK A;  3CBM A;  4FYX B;  5FWB A;  2KXD A;  2X4J A;  1UFF A;  3UPU A;  4CC7 A;  3JCM J;  2CP0 A;  4JDS A;  3THK A;  4ZN1 A;  2DVE A;  3CC2 Q;  2V26 A;  4OML A;  5DM7 R;  5J39 A;  1K73 C;  2YWW A;  5CKE A;  2F5K A;  1G3T A;  4RG8 A;  3L2U A;  5GMK i;  4JJN K;  3G4S A;  2JJ9 A;  4J9F A;  5AT1 B;  4JJD A;  4II1 A;  1VQK Q;  1G3S A;  1GBR A;  1NYG A;  4JLG A;  3NFC A;  1HK9 A;  3EFO A;  4KH0 B;  1GCP A;  4EMK A;  4JRQ A;  3EFO B;  4VUB A;  1N5Z A;  3GIB A;  3JCM e;  3G6E T;  2JS2 A;  4EMK B;  1LOJ A;  2RK2 A;  1ZA2 B;  5GJW B;  1UGS B;  3CXC A;  1H92 A;  5AYF A;  1WYX A;  2EGA A;  3MET A;  2RM4 A;  1ARK A;  3INZ A;  2QAZ A;  2DXU A;  1VQ7 T;  4YTL A;  2QDY B;  2FEI A;  2GF7 A;  2RB6 A;  2E4H A;  3HHT B;  3CPF A;  5GAM h;  3R6O A;  4BAC A;  2LQ8 A;  3M58 A;  2X9H A;  1QVG A;  3QWY A;  5FRM A;  2O4X A;  1C0M A;  2XK0 A;  1UJ0 A;  2O4X B;  5LJ3 g;  3M9Q A;  1ACM B;  1BB9 A;  2H3E B;  1BKB A;  4RG2 A;  2E70 A;  2A0F B;  2F1L A;  2ZZD A;  4QVZ A;  2KY9 A;  4NL2 A;  1S72 A;  4M75 D;  5IHK A;  5GAO m;  1WFW A;  3I56 Q;  3CD6 T;  3BDL A;  2BE7 D;  3CPW A;  3CMA Q;  1OYX A;  1QWF A;  1D1B A;  2BUD A;  4OMN A;  1XJW B;  2JS0 A;  3DKM A;  2L0A A;  4C92 G;  2YLC A;  3QDR B;  3EFS A;  4HT8 A;  3RES A;  4RTU A;  2R57 A;  4JRP A;  1G8X A;  1D3B A;  1KD1 R;  1JJ2 A;  1JEG A;  3VV0 A;  2DER A;  1D3B B;  3NTH A;  2HSP A;  2EJF A;  2A28 A;  1SRL A;  5IXB A;  2OTJ A;  1QLY A;  4M78 D;  4E7L A;  4ZTJ A;  1BI1 A;  2YSQ A;  3QYH B;  1VQ8 A;  4B9X A;  3NTK A;  3CCR T;  3EGD A;  2E5K A;  4IUT A;  4E2F B;  2IG0 A;  1KHC A;  1U06 A;  3EGU A;  3EGD B;  3PVQ A;  4PJO F;  3EHQ A;  2YRV A;  2V8K A;  1JU5 C;  1I81 A;  4XAX B;  4OMM A;  3L2Q A;  1VQ6 Q;  2GGR A;  1GRI A;  1VQL A;  4RUG A;  4DOV A;  2GBQ A;  4M7A D;  1IO6 A;  2EYX A;  2M1H A;  4HA8 A;  4J5Y A;  1YIT Q;  2KQW A;  2KT1 A;  2NYS A;  5IN1 A;  3SWN A;  4LNP A;  1FXX A;  2VV5 A;  3SHW A;  4M7D F;  2RQR A;  3SWN B;  1X75 C;  4PFP A;  2EQI A;  3VYH B;  1VQP T;  1N8R U;  3OYK A;  4Y28 E;  3S3M A;  3FB9 A;  1H3H A;  2CP6 A;  1N9R A;  4AFS C;  4OGC A;  1YI2 A;  1KQS P;  5GAN d;  1H8K A;  1NEG A;  1KQ2 A;  1K8A U;  1Y7X A;  4E7H A;  1K9M R;  3JCM c;  2OTL Q;  3FLG A;  2C06 A;  2QEX Q;  3CME A;  4GY5 A;  2VC8 A;  1D0X A;  1Q81 U;  2LCS A;  5GAN 8;  5FU7 C;  4F7U G;  3AT1 B;  2EYQ A;  2I0N A;  3PGG A;  1Y57 A;  3G71 A;  2LT4 A;  4J9B A;  3R6N A;  3CCJ A;  3CCQ Q;  1RAG B;  5LJ3 e;  4XU0 A;  1BI0 A;  4PL6 A;  4RTZ A;  3T9N A;  2QA4 T;  1YFN A;  5ECA A;  3LWH A;  2MK5 A;  1D0Y A;  2HBP A;  4K11 A;  4MML A;  1OZ3 A;  2K5L A;  4QW2 A;  3J81 E;  2KMT A;  4ELZ C;  2QAS A;  4C92 F;  1EX4 A;  4C8Q A;  1YIJ A;  2XMF A;  2M51 A;  3I55 T;  4C8Q B;  2JVV A;  1YJW Q;  1CSK A;  3HL8 A;  3E1S A;  2FPF A;  1VQ4 T;  1M5Q 1;  2SEM A;  5I2S A;  4XTV A; 
#chains in the Genus database with same CATH homology
 2M02 A;  2CP5 A;  2COZ A;  2QK0 A;  1TOV A;  1WHL A;  2CP3 A;  2CP2 A;  2HL3 A;  2HL5 C;  2HQH A;  2Z0W A;  2E3I A;  4B6M A;  1WHM A;  1WHK A;  1LPL A;  1TXQ A;  2COW A;  1WHJ A;  2CP6 A;  2CP7 A;  1WHG A;  2COY A;  1WHH A;  2MPX C;  1IXD A;  2E3H A;  2E4H A;  3TQ7 P;  2CP0 A;  2HKQ B;  3RDV A;  3E2U A;  2HKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...