2E3HA

Crystal structure of the clip-170 cap-gly domain 2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
81
Chain Sequence
ELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTVRRVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Restin
total genus 18
structure length 81
sequence length 90
ec nomenclature
pdb deposition date 2006-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2e3hA00
2MPXC 2COZA 2CP6A 2CP0A 2CP5A 2E3HA 2CP7A 1TOVA 1LPLA 2M02A 4B6MA 2E4HA 2HL3A 1WHHA 2CP2A 1TXQA 1WHKA 2COWA 2QK0A 2CP3A 2COYA 1WHLA 3RDVA 3E2UA 2HQHA 1IXDA 2E3IA 2HL5C 1WHJA 1WHGA 2HKQB 2Z0WA 3TQ7P 1WHMA 2HKNA
chains in the Genus database with same CATH superfamily
1K9AA 2DYIA 2R5AA 2CP0A 4BE1A 4PFPA 3M4YA 1SRLA 1VQOT 2RJDA 3OYMA 3NMZC 4XU2A 3QO3A 4X34A 2J6KA 4HVVA 4JJDA 4PJNA 4DOWA 1FX7A 1O9SA 1ARKA 2RA2A 3O8VA 2KYBA 2WSFE 3LGLA 1XNIA 1RLPC 4EPCA 2DXCA 3M4GA 3A5ZB 2E1HA 4AG1C 1PKTA 1OPKA 1QVPA 4QVDA 3OA6A 4QQGA 3VS2A 2OTJT 4Q5WA 4PJOB 5FU7B 3H9NA 1KSWA 3CC7T 1VQ5A 1QWEA 4J9DA 4JLIA 4J9EA 1Q81C 4J6XA 4M77C 1VQOA 1PM3A 2K3YA 1PSEA 2D8HA 2HKQB 3EAEA 1Y57A 3G6EQ 4OMFB 3G71A 4J6YA 5CR2A 2DL8A 4HVUA 3CCSQ 1GCQA 5KE2A 2KRNA 3TEEA 1Y96A 4JRQA 1VA7A 2DL4A 2YHTA 4JJNK 4C8QA 4OMLA 4ORZA 1ZBXA 2RN8A 1JB0E 1Q7YC 2MK5A 4E2FB 3J81E 5GMKm 1RAIB 2VV5A 2YWWA 3OYEA 3E9FA 2NWMA 1KQSA 2LT1A 4MZTA 4QVZA 2KR3A 1GBRA 2P84A 4F7UG 1WDXA 2KXDA 2QA4T 3C95A 4M75D 3VYHB 1D3BA 2RK1A 1OU8A 3MP6A 1VQNT 2EJFA 5J3BA 2X3WD 1QCFA 4M78G 2QQBA 4OB1B 1VQ4Q 2LP5A 1XOVA 2EYYA 2HSPA 2KMTA 3RBBB 4EMKB 2RB6A 1M30A 4X1VA 4C8QE 2EKHA 4A4HA 1G83A 4E7IA 3PIPA 4J7IA 3OYCA 3FJ5A 4BACA 2AT1B 2CKKA 2PVOB 3I5RA 2WSEE 1NLOC 1RACB 1YJWQ 4L5GA 3G6ET 4C92A 2QQ9A 2FRWA 4HCCA 1G3YA 2CH4A 1PWTA 3OQ5A 2LNVA 2QGGA 3FEOA 3VS6A 3UWNA 1IREB 2DXTA 2RI5A 2FPEA 2IPOB 3G6EA 2QQAA 1MMNA 2DAQA 2QA4Q 5LJ3e 1Q7YU 2DEUA 1WHGA 4N4GA 3RERA 2M9UA 3A8LB 3URGA 5GAOn 4MMKA 5FU7C 4LUDA 3RMSA 2DD4A 1VQNA 2W0ZA 1BU1A 2J06A 1Q82C 3CCLQ 1GFCA 1YI2T 4AFZC 7AT1B 3EFOB 1VQ5Q 1G3SA 2ZPIB 1N6AA 3SWNC 5GAN7 3UF4A 2DK3A 3X24B 4MZPA 2HL5C 1IO6A 2CSIA 3S3NA 3ZBDA 2DFUA 3I9QA 3CCST 3SWNB 4C0DB 3VS1A 1VQKT 2DM1A 4M7DC 1WYXA 3I55T 3EGUA 5J26A 3JB9G 1WFWA 3META 2LNHB 3M54A 1YN8A 3CQTA 1Q82R 2HDAA 2P4TA 1KK7A 2XHCA 5ECAA 3DLMA 1WHLA 1KC8U 1VQ6T 4LNPA 5GAMj 2K5IA 1KQ1A 3CCLA 1B07A 1WHJA 3F70A 5HY6A 4A54A 2NUTA 2D1XA 3V7SA 2E12A 2QTXA 1Y07A 4FT2A 3A8GB 2FRYA 3A98A 3TREA 3VUBA 1P92A 5A2QE 3CCEQ 5A0GA 5KYWB 2KAFA 4X9DA 2D6FA 3G7ZA 4DEYA 2MOXA 1VQ4T 5KYYA 3U23A 3L2QA 4M7AD 1GCQC 4D8DA 2XD0A 1QVFA 4PJOG 3PT9A 3M0SA 4JRIA 4M7AA 2ESWA 2FEIA 2RJFA 1RLQC 5GANe 2P0PA 4OF1A 1Y7XA 4RUGA 1MGQA 2LX7A 3UDCA 3EFRA 2GQIA 2Y90A 2EJ9A 2PVDB 3RDVA 4OMMA 4Z02A 4Y91A 2RI2A 3JV3A 3PVLA 2O9SA 3CMET 2FO0A 2EW3A 4ZGJB 3V8JA 8AT1B 1QVFS 4E6RA 3JB9F 4C92E 1NJIU 1WA7A 3CBMA 1ZLMA 1QMCA 2DILA 2K6DA 4PFOA 1OZ2A 1Q81R 1QP2A 1UGPB 5FW9A 4IUVA 3CEYA 2DVEA 2ATCB 4FW2A 4M7AC 5LL6S 2KEAA 2RQUA 4IUTA 2FYKA 3VUZA 3UA7A 3MCAB 1H92A 5D7UA 5GAOm 2DEQA 1VQLT 4KGVB 5GAN4 3QG1A 4FIBA 1K1ZA 2GFUA 2WSCE 3L2WA 1C1AA 1TSFA 4M7DB 3CCEA 1LCKA 2PUOB 2K9GA 2C06A 2DA9A 1AWXA 4M7AF 4YTLA 5LJ3g 3L2RA 2E64A 1AWOA 1M2VB 2MPXC 2YXYA 1IGUA 3CCUA 1WLPB 2ZPFB 4ZN1A 3VKIA 3PNWC 4JLGA 4Z8AA 1KG1A 3VS5A 1VQOQ 2BIVA 3WXMB 1MNEA 1NLPC 3OW2P 1K9MC 3MEWA 3OYYA 3L2UA 5KYYB 3QIIA 3QDRB 2BZYA 3CCRA 3LGFA 2RMOA 2Z0WA 1K76A 4D8KA 2QEXT 1QKWA 2JMCA 2X4WA 2DTIA 3OYKA 2CP7A 1N5ZA 4XU3A 2P0KA 4N4HA 1R8OB 2DMOA 2VB6A 3HFOA 2YUOA 3SEMA 2L3PA 2X4JA 1H8KA 3FRNA 3CCVT 2COZA 2FZGB 1TWBA 1UGQB 5AYFA 1YHQA 1XTDA 2MIOA 5GANh 2H8HA 3JB9I 2J6OA 4XTZA 1VYTA 3MJXA 1AOJA 3I5SA 4C92B 1W2BP 3S3MA 2DLPA 2JM8A 2FB7A 1VQ9Q 4DQ2A 2VC8A 4RTVA 1MMAA 2EPDA 1JJ2S 3CC2T 5GANg 1TXQA 3HSBA 1OI1A 3RKYA 1KD1C 2C0TA 2NUZA 3GIBA 3QBYA 4IURA 2JZ2A 2RK2A 3A8MB 2NUTB 4J9BA 4LDUA 3CC4Q 2JTFA 2L89A 2O4XA 1OULA 4RTYA 1I07A 2QYZA 4VUBA 2R58A 3VRYA 1EZZB 1LJOA 3V7RA 4HCBA 1VUBA 5A0LA 1ZX6A 2QEXA 2PTKA 2ROLA 4E7JA 1R0BG 3GNGA 4RG2A 5I22A 4J6WA 2CZ7B 4M4ZA 4ELZC 1SSFA 2QTVA 3QYGB 1WJQA 1TU0B 3CMAQ 4M7DE 3BE3A 3M9QA 2ZCFB 3OW2S 3VYGA 4GLMA 1OU9A 4FT4A 2BUDA 1QW1A 2O01E 4M77G 4C92F 1NPRA 4PNOA 5CKDA 4KUIA 3C0CA 2J6FA 2JT4A 3JCMb 3EH1A 5GMKl 2XK0A 1VIFA 1ZUUA 2FHDA 1X69A 5IHNA 1E6GA 1IGQA 1PCXA 1VQ5T 2DJZA 4M75G 4RTUA 2A28A 1KIKA 1WXUA 3EG9B 3P8DA 2EQJA 4FL6A 2JXBA 2X9HA 3DB3A 5EC7A 1BBZA 1ZA1B 3UA6A 4OGEA 1K0SA 2KDSA 4M7DG 1WXTA 3JAME 4II1A 4F04B 1PNJA 2RNAA 5GAMh 4ZGEB 2EJGA 5GMKe 4XTWA 2CZ0B 3HRUA 4PLLA 1S72A 1AT1B 1X75C 1NPPA 1M2VA 4F7UA 3RMQA 2DIGA 1Y96B 1VQPT 4HA8A 1S1NA 1EX4A 1Z9ZA 4R0KA 2OTLQ 2RO0A 2MI6A 1U3OA 2IVWA 3G1JA 1F1BB 1V1CA 1BIAA 1G3TA 3LH5A 4J9HA 3CCMQ 3EG2A 1PD0A 2LCCA 3O5ZA 3CCJT 1UEBA 2VWFA 5IAYA 2HNIA 1M90C 2GTOA 4F17A 2F2XA 1ACMB 3I55Q 3G4SA 1BB9A 2M0YA 2HQXA 1UTIA 2FG0A 2KQWA 1JJ2A 2RHZA 1ZSZA 3OYHA 1K0XA 4NL3A 4PJLA 1UJYA 2V8JA 3FB9A 1O75A 1Q95G 1YJNQ 5HK0A 4MZMA 3M0TA 4AFSC 2JTMA 3CCRT 2HL3A 1I0CA 3PVQA 4DOVA 4C92G 3MEVA 4L59A 2LCSA 1YJNT 4J9GA 2VKNA 3I56A 5D6YA 4LUEA 3DB4A 3MEUA 4OGCA 4LDYA 2K7AA 3X25B 1UGSB 3BFMA 1JJ2P 2CDTA 1YJ9Q 4J7FA 3NPFA 4F7UF 4FYYB 1YFNA 5CVIA 4M78B 4QQ6A 5HCKA 1VQMT 1LOJA 2RQVA 5CIUA 2A3LA 4Y28E 2YUQA 2ECZA 2LZ6B 1X43A 3DLLA 5KE3A 2J7IA 1KQSP 4IUUA 5CKHA 2EVRA 3J7AF 2K5LA 1VQKQ 2IIMA 2K4YA 1WZOA 5GAN6 3ZFJA 2O88A 2RM4A 2X51A 3RESA 4XU1A 1W70A 2LQ8A 1M90R 1M27C 1QWFA 1YWPA 2F2WA 1TUDA 3ER0A 3OYNA 3CC4A 2KVQG 4PFZA 2EYXA 4RCBA 1N8RC 3OYGA 5GMKh 5CO7A 3E9GA 4A4EA 3CCJA 3EHQA 2JW4A 3H8ZA 3VS3A 1ZHIA 2KROA 3MKDA 5LJ5j 1WJRA 1QKXA 4Z88A 1CKAA 1QP3A 4PLIA 3M57A 4M77B 1JXOA 2A36A 2XG8D 1VQ9A 2KBTA 2CUDA 2O9VA 4C5EA 2XICA 3MHXA 3CC2Q 3LX7A 3QHSA 1M3CA 1YIJT 4E7ZA 4ANJA 5IH2A 1NM7A 3CCJQ 1RABB 4LD9K 4M75B 2DJQA 3VJPA 1Y71A 4PJJA 1WI7A 4JJBA 2QQSA 2DE0X 1BI0A 3EFOA 3HHTB 1I4K1 2MYSA 4B9XA 4PJOD 2KT1A 2CP3A 4A4FA 5KYWA 1Q82U 4BY6B 1CSKA 1NBEB 1D0YA 1M3AA 3FDRA 1MHNA 4A4GA 1UJ0A 2M1HA 3PTAA 2GNCA 2E3HA 5FWBA 1K8AC 2E65A 4TVRA 1AEYA 1RL2A 1BI2A 3NTHA 4C5IA 3MPUB 4M77F 4JRKA 4C92D 2ZZDA 1MMGA 2DXUA 1N8RU 4OB3B 2GFAA 1YJ9A 3M0UA 2ABLA 4OP0A 4XTVA 2QEXQ 4A4KA 5J39A 2DD5A 2K3XA 3EGXA 4CI0C 2HQEA 2VXEA 2E41A 2HMAA 4HVWA 2C0OA 2MF2A 3AHUA 3TVTA 3EG9A 4PJOE 1YIJQ 3GF5A 3H6ZA 3BDUA 2D0QB 2XDPA 4IIOA 1R77A 1RAEB 1N9SA 3G71T 4ZN3A 3HPWA 4Z89A 2LDMA 2OX7A 4WCIA 4FSSA 2DPPB 3P8BB 3JCMV 5FROA 5GAN2 3I55A 1VQ9T 2NUPA 2RQTA 3SB2A 2QQRA 2HQHA 2GGRA 1JRIA 2QG9B 1EIFA 4BE2A 4A63B 2K5FA 1YJWA 2EQKA 4O5VA 4OMNA 1LNXA 4M77E 2CP6A 3MP8A 1IRXA 1NYFA 5C6SA 3GLXA 3VU3C 5IT9E 1R0CB 1OX9A 2LMJA 1YHQT 4C8QB 2ZPEB 1WPYA 4J8OA 2C0IA 4E7LA 3JSCA 3ZL7C 1Q7YR 2HSEB 4M75E 3QWXX 2EQIA 5GMKj 3CD6A 4M75C 1GBQA 4KGXB 4M78E 1ZA2B 4LXCA 2L3RA 3OMCA 1W2BA 1U1SA 2V26A 3CC4T 1FXXA 3KUFA 1VQMQ 3CMEQ 2ZPBB 3JCMf 3JCMP 4C8QD 1VQ7T 2RJEA 2KXCA 3L1AA 2GCXA 1IXDA 5I11A 3LWIA 1A0NB 3KBGA 4CRIA 4ZTJA 1JU5C 4GLKA 1KQ2A 1Q86C 2KT8A 2CZ1B 1YITQ 1M2OA 3HRSA 3REAB 3CCRQ 4M77D 3CCSA 3FJPA 3TSWA 1M1KU 1HJDA 3JCMd 1OZ3A 1W4SA 1I5OB 1M1KC 1YWOA 2I2LA 1D1CA 5GMKi 4BI8B 4BI3A 4F16A 3OY9A 1TOVA 5I2MA 3DKMA 3SWNA 1VQLQ 1PD1A 3JB9H 3OW2A 2G6FX 1TH7A 3VS4A 4XAXB 1YI2A 3EH2A 1QQJA 4DBHA 1GFDA 4M78A 1BYMA 4N0AA 1PHTA 2P0QA 1Q81U 2A37A 4C0DC 2E70A 4BD3A 1I1JA 4DA4A 2DL3A 2BTTA 5CKBA 2A7YA 1E7OA 4JJCA 2YUNA 3JCMc 1YJWT 1C0MA 3PGGA 2MWPA 1ZBJA 2LC4A 4KRTA 2LTOA 4IUQA 2KYMA 6AT1B 1X6GA 3L2ZA 4F7UE 5FRNA 3SFMA 2QAZA 1SG5A 1QVGA 1RAHB 4RKUE 2QDLA 3OYDA 1K73C 3M58A 3V8KA 1M4ZA 2Y4XA 3CD6Q 2B86A 2LJ3A 1PRLC 3ME9A 3UT1A 1M1FA 2DL5A 1OYXA 2HD0A 4CC3A 5IXFA 2LT4A 1YP5A 2CZ6B 4J9FA 2DL7A 2KY9A 2YRVA 1Q86R 4EIKA 2M0OA 1PRMC 2XU8A 2HAXA 4J9CA 2DTOA 3FLGA 3EGDB 4PJOA 1RUWA 3HFNA 2XMFA 1JBMA 1T3LA 3L2VA 1JQQA 2EIFA 3CPWA 3M0QA 1WGSA 2NLUA 1V29B 2VXFA 2JUFA 3OYBA 5LJ5g 1VIEA 3QYHB 3MEAA 3KFVA 4HCZA 4LDXA 4LE9A 4M78F 2LJ1A 2EYZA 1ABOA 4EMHA 2LVMA 2DZCA 4M75F 3VV0A 4F14A 1UFFA 3PMTA 4RTXA 4FSXA 5CKFA 4QKUA 1M3BA 3LH0A 3M59A 4LN2A 3EG0A 5GAN3 2ZPHB 1IZ6A 1VQ6A 2RHIA 1NJIC 1RAFB 1WJSA 4KULA 3A8OB 2WACA 3THKA 2QGFB 4LDVA 2CT3A 4XTXA 3H41A 1KD1R 4KH1B 1YJ9T 1PKSA 2RPNA 1G2BA 1B3QA 1BKBA 1UE9A 2MAMA 4E7SA 4WF2A 4C8QG 1WHMA 4R55A 2O31A 3CXCA 2RD1A 1LPLA 2AKLA 4D6WA 3CCLT 2XIDA 1N9RA 2CH4W 4C0ZA 4E47A 5CK9A 2GTJA 1M9SA 4C92C 2VYTA 2L2PA 2JVVA 1NEGA 3WVEB 1WIEA 2CYZB 2EGAA 1OOTA 2IG0A 4O6JA 5DM7R 4HT9A 1SHGA 5CQYA 1I8FA 5FWCA 1QCNA 4E7HA 2VVKA 1VQKA 2X35A 2DERA 3G4ST 3HTRA 5LJ3j 4RCCA 3CPWS 4RTTA 4XU0A 3QWYA 3C94A 3X28B 2KGTA 1VOMA 5FU6C 1AWWA 2O4XB 3NFCA 2DRKA 1V76A 5LJ5f 5I21A 2O2OA 4IKFA 4DBRA 1C6VX 1M8VA 3BY7A 4OVAA 2RQRA 2PQWA 1CKBA 4ZTFA 2L8DA 2PUKB 3H0IA 1Q86U 4M7DF 5GANd 1AZGB 4PK4A 3CMEA 3EHRA 1MNDA 2D8JA 5LJ3h 1X27A 3C4SA 3LLRA 3JB9J 3BDLA 4BY6C 2L3SA 4LD6A 3GP8A 3NHNA 4ATOA 3INZA 1VQMA 5CQXA 3TU4K 4BI4A 2FVUA 3C12A 1BCMA 4MMLA 3V8LA 5DLOA 4MDXA 4HXJA 1IHVA 1VQ7Q 2DZ9A 3HL8A 1K73R 5D6WA 1XJWB 1HD3A 1J3TA 2YLCA 2HKNA 1UB4A 4HCKA 4P5NA 4FYWB 3EG3A 5GAOl 1SRMA 1VQ7A 1BCOA 1K73U 5LJ5e 2B8AA 2EQMA 3A1PA 1YHQQ 5HKCA 4N4IA 3JB9D 3OS1A 2DO3A 3S3OA 1HK9A 5FU6B 3R6OA 3AT1B 3NGPA 2RH2A 2I0NA 4NOYA 3P8HA 3FC3A 2RQWA 1B34B 2MWOA 1QVGP 1YJNA 2NYSA 2V8KA 2DF6A 3CCQT 5FRMA 4RMOA 1FMVA 1PC0A 3JRZA 1UDLA 3GBQA 4Y92A 2FPDA 4DBQA 3BW1A 4OB0B 2KNBB 3VS0A 2OI3A 4B9WA 4EMKA 2QK0A 1SSHA 3OS0A 2F5TX 4M7DD 4DBFA 4JZ4A 2AZSA 2YLBA 3OYIA 2X4XA 3V7CA 3M0RA 1VQLA 2EAYA 2XI9A 3OS2A 1ZUYA 2CREA 3QKJA 2V8IA 3GPLA 4FYVB 1KC8C 1AWJA 1N27A 2M51A 4CC7A 3CC7Q 2HBPA 4AG2C 2CSQA 5IN1A 3LYIA 1VQ8Q 2BE9B 4M7AE 1QLYA 4BDZA 3CMAA 3OYFA 2DX1A 5D6XA 2D9TA 1UECA 1RAAB 5IHKA 2ED1A 1I5LA 5KCHA 3RR6A 2K2MA 1GCPA 3CBOA 1SKUB 3R6NA 2QASA 3OMGA 3RKXA 2VASA 1X2QA 4BB7A 5GJVB 2AZVA 2COWA 2F1LA 2EBPA 1W2BS 2V1RA 2LX9A 1H3HA 5A0DA 4V2SA 4AT1B 3PIOA 3Q1JA 2FL7A 3CPWP 4PJMA 1UGVA 1VQ8A 2YT6A 2VGMA 1SF9A 1BIBA 4UC4A 1GRIA 2MMPA 1FYNA 3NTIA 5KYXA 5GANf 3HP9A 4J83A 4F7UB 4HKEA 4JS5A 3PE0A 4J5YA 2CT4A 1TUCA 5LJ5h 3S6WA 1TG0A 1W6XA 9ATCB 3D7SB 3VS7A 2JMAA 4IIMA 1EFNA 1KC8R 2MCNA 4M75A 1WHKA 1QVGS 4MDWA 1I81A 1NG2A 2DIQA 5GJWB 1Y0MA 2K79A 1KHCA 1K9MR 3E2UA 2E6ZA 1ZQ1A 3CCQQ 1WQWA 3M0PA 4XTYA 2K57A 1JEGA 2YSQA 5CAIA 1NEBA 4R56A 5CCAA 3CXCP 2L5QA 4JDSA 2R57A 2E4HA 2EWNA 4GBQA 1VQ6Q 1M5Q1 2DBMA 1WQ7A 3VRZA 2CS7A 5IXBA 2E6NA 3M55A 4PL6A 1G3WA 1IB8A 3MP1A 4KGZB 3JCMX 2AK5A 2DRMA 2ENMA 1KHIA 3CCVA 1U1TA 3MO8A 3OS5A 2Y4YA 1K8AU 2G3RA 3SDZA 3A8HB 1VQPQ 4FW1A 1FWZA 3UATA 4B6MA 5FLXE 1JO8A 2L0AA 2LCLA 2JS2A 3EGXB 1S72T 2RI3A 5M9OA 2EGCA 1YI2Q 5KCOA 4IUPA 1M8MA 5AT1B 3SHWA 3CCUQ 1RI9A 2H3EB 5KYUA 2FZCB 2K2VA 2LQNA 1D3BB 1ZUKA 3QUIA 2OTLA 3QJYA 1M1GA 2CP5A 1JXMA 2KRSA 3OB9A 2QA4A 4JZ3A 2EKOA 3M5AA 3CCMA 3JCMh 4N0AC 2JM9A 1UGRB 2LJ0A 2COYA 1RADB 2DXBA 2RHXA 3ASKA 1M1KR 4HT8A 1BI3A 1LVKA 1OX8A 1KFZA 1YITA 4C0FA 1T0HA 4QVCA 3I35A 2HEQA 2JTEA 2EQUA 2DBKA 2M02A 2DETA 4ELYC 4C8QC 3CCMT 2E5KA 1VYVA 3UPUA 1UHCA 1U5SA 4JPBW 5KYUB 2OTLT 1TS9A 1NZ9A 3L42A 2BZXA 2AHJB 1BI1A 1UUEA 2V1QA 2ZGWA 4C0GA 1MMDA 2XKOC 4M7AB 2DYBA 5GAN8 3LWHA 1G8XA 3H0FA 1D1BA 2P4RA 2PNIA 4M7DA 2OTJA 2GQVA 1OQKA 4C8QF 1VQNQ 2XDBA 1AD5A 4OB2B 3H0HA 3PMIA 3TCJA 1YNZA 2GBQA 5LJ3f 1GXIE 2YRCA 2HBWA 2X3XD 1X6OA 4BE0A 1RI0A 2FZKB 4NL2A 3OYJA 2BE7D 2RJCA 3JCMQ 3QJ6A 2QI2A 1X01A 1NE8A 4FU6A 5GAMe 3JCMW 1KD1U 4RTWA 3QZ9B 4XQ3A 2ED0A 3CBPA 3WVDB 2D0NA 2LRQA 5DY9A 1D0ZA 4J9IA 2LQWA 2QDYB 4EMGA 2KK4A 5GAMd 4EMKC 4K11A 2JJ9A 3CPFA 3M56A 3QDFA 1MV0B 2KSSA 2KE9A 4M77A 3REBB 5GAOp 1AHJB 1RAGB 5CKEA 1E6HA 4NS5A 1IHWA 1DJ7B 1D09B 1D0XA 2CGHA 1WXBA 3OBYA 4M78D 5C0MA 2FPFA 2R5MA 2F2VA 5KYNA 2OTJQ 4L6V5 5KYXB 3RUXA 2NUPB 2M16A 4A53A 3T9NA 3TQ7P 5GAN5 3CXCS 3CCQA 1B7TA 2A08A 3G4SQ 1SEMA 2RF0A 2QXFA 1KQSS 2DVJA 4ME7A 1T3SA 1WHHA 2CUBA 3RNJA 4RG8A 1MUZA 2EYQA 4ZNXA 2OAWA 4KUDK 4FYXB 2JOYA 2YRDA 4QW2A 3JCMe 2JS0A 1Z9QA 3OYAA 1B34A 3EG1A 1YITT 4FCYA 2OJ2A 5KH6A 2AKKA 1X6BA 1QVFP 3JCMg 1UHFA 2ROTA 2BZ8A 2K3BA 2PVGB 3FIFA 3X26B 3I56T 4PJOC 5GAMf 1BK2A 8ATCB 1U8RA 1U06A 3QXEB 1K8AR 1OEBA 1G5VA 1K9MU 4PKCC 2X4YA 5GAOq 2ZAEA 1K4US 1AZEA 5L8RE 1UG1A 1YBYA 2ZPGB 3X20B 3CCUT 1TTHB 1YIJA 4OMPA 2JNGA 3LW5E 1S72Q 2YUPA 3OSSC 2DTHA 2L3QA 5I2SA 3CC2A 3QPHA 4C5HA 4EDUA 3E19A 4KH0B 1VQPA 2RHYA 4ESRA 2KRMA 5GAOr 3CCVQ 1PG5B 3CC7A 2EFIA 3GNFB 3CMAT 3TSZA 3KXTA 4JRPA 1HYOA 1ABQA 1HSQA 4LDWA 1D1AA 1X2KA 5IHIA 4M78C 5EG2A 3ULRB 1OV3A 2A0FB 1WNLA 2PZ1A 1HXDA 4E7KA 3CD6T 3N5BB 1GL5A 4JS4A 3HRTA 1YCYA 4M7AG 5GAMg 2XDDA 2OAUA 3OBWA 3IQLA 2E3IA 1NYGA 5HK3A 3OYLA 2PU9B 4XTUA 1MV3A 2GF7A 4RTZA 3GOXA 4X9CA 3RKWA 1AVZC 4OMQA 2J05A 4BDYA 4KT0E 4AFQC 2F69A 2VGNA 1T0JA 3QSUA 3E1SA 2VUBA 1SHFA 2E10A 3I56Q 4AMCA 1WX6A 1VQ4A 2DNUA 3J80E 1FMKA 1KJWA 5DLQE 4XK8E 4WTOB 4QT7A 4DEXA 2SEMA 1QCOA 4C5GA 5LJ5d 3CCET 1FMWA 1VYUA 5GANj 4ZGDB 2HZYA 3NTKA 4BUGA 1OPLA 1W1FA 1YCSB 4CC2A 5L23A 1TUGB 1ZSGA 2EYWA 1PSFA 2LQKA 3ZEHA 2HCKA 2KI7A 2EGEA 2DKGA 2JN0A 1VQ8T 1NJIR 2YDLA 1N8RR 4KBMB 2F5KA 1XQHA 4GY5A 5LJ3d 1ZSZC 4AFUC 3EFSA 3HKSA 2CP2A 4OMOA 4PJOF 3OSVA 3PFSA 2BKDN 2W10A 3JCMJ 1ZSZB 3G71Q 2RHUA 3EGDA 4FM4B 4JUVA 2H3JA 2E5QA 1M90U 2SRCA 1H3ZA 3QZ5B 1SPKA 2AIRB 3M53A 3SD4A 4QQDA 4CC4B 1H641 3RIRA
chains in the Genus database with same CATH topology
2MPXC 2COZA 2CP6A 2CP0A 2CP5A 2E3HA 2CP7A 1TOVA 1LPLA 2M02A 4B6MA 2E4HA 2HL3A 1WHHA 2CP2A 1TXQA 1WHKA 2COWA 2QK0A 2CP3A 2COYA 1WHLA 3RDVA 3E2UA 2HQHA 1IXDA 2E3IA 2HL5C 1WHJA 1WHGA 2HKQB 2Z0WA 3TQ7P 1WHMA 2HKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MPX C;  2COZ A;  2CP6 A;  2CP0 A;  2CP5 A;  2E3H A;  2CP7 A;  1TOV A;  1LPL A;  2M02 A;  4B6M A;  2E4H A;  2HL3 A;  1WHH A;  2CP2 A;  1TXQ A;  1WHK A;  2COW A;  2QK0 A;  2CP3 A;  2COY A;  1WHL A;  3RDV A;  3E2U A;  2HQH A;  1IXD A;  2E3I A;  2HL5 C;  1WHJ A;  1WHG A;  2HKQ B;  2Z0W A;  3TQ7 P;  1WHM A;  2HKN A; 
#chains in the Genus database with same CATH topology
 1K9A A;  2DYI A;  2R5A A;  2CP0 A;  4BE1 A;  4PFP A;  3M4Y A;  1SRL A;  1VQO T;  2RJD A;  3OYM A;  3NMZ C;  4XU2 A;  3QO3 A;  4X34 A;  2J6K A;  4HVV A;  4JJD A;  4PJN A;  4DOW A;  1FX7 A;  1O9S A;  1ARK A;  2RA2 A;  3O8V A;  2KYB A;  2WSF E;  3LGL A;  1XNI A;  1RLP C;  4EPC A;  2DXC A;  3M4G A;  3A5Z B;  2E1H A;  4AG1 C;  1PKT A;  1OPK A;  1QVP A;  4QVD A;  3OA6 A;  4QQG A;  3VS2 A;  2OTJ T;  4Q5W A;  4PJO B;  5FU7 B;  3H9N A;  1KSW A;  3CC7 T;  1VQ5 A;  1QWE A;  4J9D A;  4JLI A;  4J9E A;  1Q81 C;  4J6X A;  4M77 C;  1VQO A;  1PM3 A;  2K3Y A;  1PSE A;  2D8H A;  2HKQ B;  3EAE A;  1Y57 A;  3G6E Q;  4OMF B;  3G71 A;  4J6Y A;  5CR2 A;  2DL8 A;  4HVU A;  3CCS Q;  1GCQ A;  5KE2 A;  2KRN A;  3TEE A;  1Y96 A;  4JRQ A;  1VA7 A;  2DL4 A;  2YHT A;  4JJN K;  4C8Q A;  4OML A;  4ORZ A;  1ZBX A;  2RN8 A;  1JB0 E;  1Q7Y C;  2MK5 A;  4E2F B;  3J81 E;  5GMK m;  1RAI B;  2VV5 A;  2YWW A;  3OYE A;  3E9F A;  2NWM A;  1KQS A;  2LT1 A;  4MZT A;  4QVZ A;  2KR3 A;  1GBR A;  2P84 A;  4F7U G;  1WDX A;  2KXD A;  2QA4 T;  3C95 A;  4M75 D;  3VYH B;  1D3B A;  2RK1 A;  1OU8 A;  3MP6 A;  1VQN T;  2EJF A;  5J3B A;  2X3W D;  1QCF A;  4M78 G;  2QQB A;  4OB1 B;  1VQ4 Q;  2LP5 A;  1XOV A;  2EYY A;  2HSP A;  2KMT A;  3RBB B;  4EMK B;  2RB6 A;  1M30 A;  4X1V A;  4C8Q E;  2EKH A;  4A4H A;  1G83 A;  4E7I A;  3PIP A;  4J7I A;  3OYC A;  3FJ5 A;  4BAC A;  2AT1 B;  2CKK A;  2PVO B;  3I5R A;  2WSE E;  1NLO C;  1RAC B;  1YJW Q;  4L5G A;  3G6E T;  4C92 A;  2QQ9 A;  2FRW A;  4HCC A;  1G3Y A;  2CH4 A;  1PWT A;  3OQ5 A;  2LNV A;  2QGG A;  3FEO A;  3VS6 A;  3UWN A;  1IRE B;  2DXT A;  2RI5 A;  2FPE A;  2IPO B;  3G6E A;  2QQA A;  1MMN A;  2DAQ A;  2QA4 Q;  5LJ3 e;  1Q7Y U;  2DEU A;  1WHG A;  4N4G A;  3RER A;  2M9U A;  3A8L B;  3URG A;  5GAO n;  4MMK A;  5FU7 C;  4LUD A;  3RMS A;  2DD4 A;  1VQN A;  2W0Z A;  1BU1 A;  2J06 A;  1Q82 C;  3CCL Q;  1GFC A;  1YI2 T;  4AFZ C;  7AT1 B;  3EFO B;  1VQ5 Q;  1G3S A;  2ZPI B;  1N6A A;  3SWN C;  5GAN 7;  3UF4 A;  2DK3 A;  3X24 B;  4MZP A;  2HL5 C;  1IO6 A;  2CSI A;  3S3N A;  3ZBD A;  2DFU A;  3I9Q A;  3CCS T;  3SWN B;  4C0D B;  3VS1 A;  1VQK T;  2DM1 A;  4M7D C;  1WYX A;  3I55 T;  3EGU A;  5J26 A;  3JB9 G;  1WFW A;  3MET A;  2LNH B;  3M54 A;  1YN8 A;  3CQT A;  1Q82 R;  2HDA A;  2P4T A;  1KK7 A;  2XHC A;  5ECA A;  3DLM A;  1WHL A;  1KC8 U;  1VQ6 T;  4LNP A;  5GAM j;  2K5I A;  1KQ1 A;  3CCL A;  1B07 A;  1WHJ A;  3F70 A;  5HY6 A;  4A54 A;  2NUT A;  2D1X A;  3V7S A;  2E12 A;  2QTX A;  1Y07 A;  4FT2 A;  3A8G B;  2FRY A;  3A98 A;  3TRE A;  3VUB A;  1P92 A;  5A2Q E;  3CCE Q;  5A0G A;  5KYW B;  2KAF A;  4X9D A;  2D6F A;  3G7Z A;  4DEY A;  2MOX A;  1VQ4 T;  5KYY A;  3U23 A;  3L2Q A;  4M7A D;  1GCQ C;  4D8D A;  2XD0 A;  1QVF A;  4PJO G;  3PT9 A;  3M0S A;  4JRI A;  4M7A A;  2ESW A;  2FEI A;  2RJF A;  1RLQ C;  5GAN e;  2P0P A;  4OF1 A;  1Y7X A;  4RUG A;  1MGQ A;  2LX7 A;  3UDC A;  3EFR A;  2GQI A;  2Y90 A;  2EJ9 A;  2PVD B;  3RDV A;  4OMM A;  4Z02 A;  4Y91 A;  2RI2 A;  3JV3 A;  3PVL A;  2O9S A;  3CME T;  2FO0 A;  2EW3 A;  4ZGJ B;  3V8J A;  8AT1 B;  1QVF S;  4E6R A;  3JB9 F;  4C92 E;  1NJI U;  1WA7 A;  3CBM A;  1ZLM A;  1QMC A;  2DIL A;  2K6D A;  4PFO A;  1OZ2 A;  1Q81 R;  1QP2 A;  1UGP B;  5FW9 A;  4IUV A;  3CEY A;  2DVE A;  2ATC B;  4FW2 A;  4M7A C;  5LL6 S;  2KEA A;  2RQU A;  4IUT A;  2FYK A;  3VUZ A;  3UA7 A;  3MCA B;  1H92 A;  5D7U A;  5GAO m;  2DEQ A;  1VQL T;  4KGV B;  5GAN 4;  3QG1 A;  4FIB A;  1K1Z A;  2GFU A;  2WSC E;  3L2W A;  1C1A A;  1TSF A;  4M7D B;  3CCE A;  1LCK A;  2PUO B;  2K9G A;  2C06 A;  2DA9 A;  1AWX A;  4M7A F;  4YTL A;  5LJ3 g;  3L2R A;  2E64 A;  1AWO A;  1M2V B;  2MPX C;  2YXY A;  1IGU A;  3CCU A;  1WLP B;  2ZPF B;  4ZN1 A;  3VKI A;  3PNW C;  4JLG A;  4Z8A A;  1KG1 A;  3VS5 A;  1VQO Q;  2BIV A;  3WXM B;  1MNE A;  1NLP C;  3OW2 P;  1K9M C;  3MEW A;  3OYY A;  3L2U A;  5KYY B;  3QII A;  3QDR B;  2BZY A;  3CCR A;  3LGF A;  2RMO A;  2Z0W A;  1K76 A;  4D8K A;  2QEX T;  1QKW A;  2JMC A;  2X4W A;  2DTI A;  3OYK A;  2CP7 A;  1N5Z A;  4XU3 A;  2P0K A;  4N4H A;  1R8O B;  2DMO A;  2VB6 A;  3HFO A;  2YUO A;  3SEM A;  2L3P A;  2X4J A;  1H8K A;  3FRN A;  3CCV T;  2COZ A;  2FZG B;  1TWB A;  1UGQ B;  5AYF A;  1YHQ A;  1XTD A;  2MIO A;  5GAN h;  2H8H A;  3JB9 I;  2J6O A;  4XTZ A;  1VYT A;  3MJX A;  1AOJ A;  3I5S A;  4C92 B;  1W2B P;  3S3M A;  2DLP A;  2JM8 A;  2FB7 A;  1VQ9 Q;  4DQ2 A;  2VC8 A;  4RTV A;  1MMA A;  2EPD A;  1JJ2 S;  3CC2 T;  5GAN g;  1TXQ A;  3HSB A;  1OI1 A;  3RKY A;  1KD1 C;  2C0T A;  2NUZ A;  3GIB A;  3QBY A;  4IUR A;  2JZ2 A;  2RK2 A;  3A8M B;  2NUT B;  4J9B A;  4LDU A;  3CC4 Q;  2JTF A;  2L89 A;  2O4X A;  1OUL A;  4RTY A;  1I07 A;  2QYZ A;  4VUB A;  2R58 A;  3VRY A;  1EZZ B;  1LJO A;  3V7R A;  4HCB A;  1VUB A;  5A0L A;  1ZX6 A;  2QEX A;  2PTK A;  2ROL A;  4E7J A;  1R0B G;  3GNG A;  4RG2 A;  5I22 A;  4J6W A;  2CZ7 B;  4M4Z A;  4ELZ C;  1SSF A;  2QTV A;  3QYG B;  1WJQ A;  1TU0 B;  3CMA Q;  4M7D E;  3BE3 A;  3M9Q A;  2ZCF B;  3OW2 S;  3VYG A;  4GLM A;  1OU9 A;  4FT4 A;  2BUD A;  1QW1 A;  2O01 E;  4M77 G;  4C92 F;  1NPR A;  4PNO A;  5CKD A;  4KUI A;  3C0C A;  2J6F A;  2JT4 A;  3JCM b;  3EH1 A;  5GMK l;  2XK0 A;  1VIF A;  1ZUU A;  2FHD A;  1X69 A;  5IHN A;  1E6G A;  1IGQ A;  1PCX A;  1VQ5 T;  2DJZ A;  4M75 G;  4RTU A;  2A28 A;  1KIK A;  1WXU A;  3EG9 B;  3P8D A;  2EQJ A;  4FL6 A;  2JXB A;  2X9H A;  3DB3 A;  5EC7 A;  1BBZ A;  1ZA1 B;  3UA6 A;  4OGE A;  1K0S A;  2KDS A;  4M7D G;  1WXT A;  3JAM E;  4II1 A;  4F04 B;  1PNJ A;  2RNA A;  5GAM h;  4ZGE B;  2EJG A;  5GMK e;  4XTW A;  2CZ0 B;  3HRU A;  4PLL A;  1S72 A;  1AT1 B;  1X75 C;  1NPP A;  1M2V A;  4F7U A;  3RMQ A;  2DIG A;  1Y96 B;  1VQP T;  4HA8 A;  1S1N A;  1EX4 A;  1Z9Z A;  4R0K A;  2OTL Q;  2RO0 A;  2MI6 A;  1U3O A;  2IVW A;  3G1J A;  1F1B B;  1V1C A;  1BIA A;  1G3T A;  3LH5 A;  4J9H A;  3CCM Q;  3EG2 A;  1PD0 A;  2LCC A;  3O5Z A;  3CCJ T;  1UEB A;  2VWF A;  5IAY A;  2HNI A;  1M90 C;  2GTO A;  4F17 A;  2F2X A;  1ACM B;  3I55 Q;  3G4S A;  1BB9 A;  2M0Y A;  2HQX A;  1UTI A;  2FG0 A;  2KQW A;  1JJ2 A;  2RHZ A;  1ZSZ A;  3OYH A;  1K0X A;  4NL3 A;  4PJL A;  1UJY A;  2V8J A;  3FB9 A;  1O75 A;  1Q95 G;  1YJN Q;  5HK0 A;  4MZM A;  3M0T A;  4AFS C;  2JTM A;  3CCR T;  2HL3 A;  1I0C A;  3PVQ A;  4DOV A;  4C92 G;  3MEV A;  4L59 A;  2LCS A;  1YJN T;  4J9G A;  2VKN A;  3I56 A;  5D6Y A;  4LUE A;  3DB4 A;  3MEU A;  4OGC A;  4LDY A;  2K7A A;  3X25 B;  1UGS B;  3BFM A;  1JJ2 P;  2CDT A;  1YJ9 Q;  4J7F A;  3NPF A;  4F7U F;  4FYY B;  1YFN A;  5CVI A;  4M78 B;  4QQ6 A;  5HCK A;  1VQM T;  1LOJ A;  2RQV A;  5CIU A;  2A3L A;  4Y28 E;  2YUQ A;  2ECZ A;  2LZ6 B;  1X43 A;  3DLL A;  5KE3 A;  2J7I A;  1KQS P;  4IUU A;  5CKH A;  2EVR A;  3J7A F;  2K5L A;  1VQK Q;  2IIM A;  2K4Y A;  1WZO A;  5GAN 6;  3ZFJ A;  2O88 A;  2RM4 A;  2X51 A;  3RES A;  4XU1 A;  1W70 A;  2LQ8 A;  1M90 R;  1M27 C;  1QWF A;  1YWP A;  2F2W A;  1TUD A;  3ER0 A;  3OYN A;  3CC4 A;  2KVQ G;  4PFZ A;  2EYX A;  4RCB A;  1N8R C;  3OYG A;  5GMK h;  5CO7 A;  3E9G A;  4A4E A;  3CCJ A;  3EHQ A;  2JW4 A;  3H8Z A;  3VS3 A;  1ZHI A;  2KRO A;  3MKD A;  5LJ5 j;  1WJR A;  1QKX A;  4Z88 A;  1CKA A;  1QP3 A;  4PLI A;  3M57 A;  4M77 B;  1JXO A;  2A36 A;  2XG8 D;  1VQ9 A;  2KBT A;  2CUD A;  2O9V A;  4C5E A;  2XIC A;  3MHX A;  3CC2 Q;  3LX7 A;  3QHS A;  1M3C A;  1YIJ T;  4E7Z A;  4ANJ A;  5IH2 A;  1NM7 A;  3CCJ Q;  1RAB B;  4LD9 K;  4M75 B;  2DJQ A;  3VJP A;  1Y71 A;  4PJJ A;  1WI7 A;  4JJB A;  2QQS A;  2DE0 X;  1BI0 A;  3EFO A;  3HHT B;  1I4K 1;  2MYS A;  4B9X A;  4PJO D;  2KT1 A;  2CP3 A;  4A4F A;  5KYW A;  1Q82 U;  4BY6 B;  1CSK A;  1NBE B;  1D0Y A;  1M3A A;  3FDR A;  1MHN A;  4A4G A;  1UJ0 A;  2M1H A;  3PTA A;  2GNC A;  2E3H A;  5FWB A;  1K8A C;  2E65 A;  4TVR A;  1AEY A;  1RL2 A;  1BI2 A;  3NTH A;  4C5I A;  3MPU B;  4M77 F;  4JRK A;  4C92 D;  2ZZD A;  1MMG A;  2DXU A;  1N8R U;  4OB3 B;  2GFA A;  1YJ9 A;  3M0U A;  2ABL A;  4OP0 A;  4XTV A;  2QEX Q;  4A4K A;  5J39 A;  2DD5 A;  2K3X A;  3EGX A;  4CI0 C;  2HQE A;  2VXE A;  2E41 A;  2HMA A;  4HVW A;  2C0O A;  2MF2 A;  3AHU A;  3TVT A;  3EG9 A;  4PJO E;  1YIJ Q;  3GF5 A;  3H6Z A;  3BDU A;  2D0Q B;  2XDP A;  4IIO A;  1R77 A;  1RAE B;  1N9S A;  3G71 T;  4ZN3 A;  3HPW A;  4Z89 A;  2LDM A;  2OX7 A;  4WCI A;  4FSS A;  2DPP B;  3P8B B;  3JCM V;  5FRO A;  5GAN 2;  3I55 A;  1VQ9 T;  2NUP A;  2RQT A;  3SB2 A;  2QQR A;  2HQH A;  2GGR A;  1JRI A;  2QG9 B;  1EIF A;  4BE2 A;  4A63 B;  2K5F A;  1YJW A;  2EQK A;  4O5V A;  4OMN A;  1LNX A;  4M77 E;  2CP6 A;  3MP8 A;  1IRX A;  1NYF A;  5C6S A;  3GLX A;  3VU3 C;  5IT9 E;  1R0C B;  1OX9 A;  2LMJ A;  1YHQ T;  4C8Q B;  2ZPE B;  1WPY A;  4J8O A;  2C0I A;  4E7L A;  3JSC A;  3ZL7 C;  1Q7Y R;  2HSE B;  4M75 E;  3QWX X;  2EQI A;  5GMK j;  3CD6 A;  4M75 C;  1GBQ A;  4KGX B;  4M78 E;  1ZA2 B;  4LXC A;  2L3R A;  3OMC A;  1W2B A;  1U1S A;  2V26 A;  3CC4 T;  1FXX A;  3KUF A;  1VQM Q;  3CME Q;  2ZPB B;  3JCM f;  3JCM P;  4C8Q D;  1VQ7 T;  2RJE A;  2KXC A;  3L1A A;  2GCX A;  1IXD A;  5I11 A;  3LWI A;  1A0N B;  3KBG A;  4CRI A;  4ZTJ A;  1JU5 C;  4GLK A;  1KQ2 A;  1Q86 C;  2KT8 A;  2CZ1 B;  1YIT Q;  1M2O A;  3HRS A;  3REA B;  3CCR Q;  4M77 D;  3CCS A;  3FJP A;  3TSW A;  1M1K U;  1HJD A;  3JCM d;  1OZ3 A;  1W4S A;  1I5O B;  1M1K C;  1YWO A;  2I2L A;  1D1C A;  5GMK i;  4BI8 B;  4BI3 A;  4F16 A;  3OY9 A;  1TOV A;  5I2M A;  3DKM A;  3SWN A;  1VQL Q;  1PD1 A;  3JB9 H;  3OW2 A;  2G6F X;  1TH7 A;  3VS4 A;  4XAX B;  1YI2 A;  3EH2 A;  1QQJ A;  4DBH A;  1GFD A;  4M78 A;  1BYM A;  4N0A A;  1PHT A;  2P0Q A;  1Q81 U;  2A37 A;  4C0D C;  2E70 A;  4BD3 A;  1I1J A;  4DA4 A;  2DL3 A;  2BTT A;  5CKB A;  2A7Y A;  1E7O A;  4JJC A;  2YUN A;  3JCM c;  1YJW T;  1C0M A;  3PGG A;  2MWP A;  1ZBJ A;  2LC4 A;  4KRT A;  2LTO A;  4IUQ A;  2KYM A;  6AT1 B;  1X6G A;  3L2Z A;  4F7U E;  5FRN A;  3SFM A;  2QAZ A;  1SG5 A;  1QVG A;  1RAH B;  4RKU E;  2QDL A;  3OYD A;  1K73 C;  3M58 A;  3V8K A;  1M4Z A;  2Y4X A;  3CD6 Q;  2B86 A;  2LJ3 A;  1PRL C;  3ME9 A;  3UT1 A;  1M1F A;  2DL5 A;  1OYX A;  2HD0 A;  4CC3 A;  5IXF A;  2LT4 A;  1YP5 A;  2CZ6 B;  4J9F A;  2DL7 A;  2KY9 A;  2YRV A;  1Q86 R;  4EIK A;  2M0O A;  1PRM C;  2XU8 A;  2HAX A;  4J9C A;  2DTO A;  3FLG A;  3EGD B;  4PJO A;  1RUW A;  3HFN A;  2XMF A;  1JBM A;  1T3L A;  3L2V A;  1JQQ A;  2EIF A;  3CPW A;  3M0Q A;  1WGS A;  2NLU A;  1V29 B;  2VXF A;  2JUF A;  3OYB A;  5LJ5 g;  1VIE A;  3QYH B;  3MEA A;  3KFV A;  4HCZ A;  4LDX A;  4LE9 A;  4M78 F;  2LJ1 A;  2EYZ A;  1ABO A;  4EMH A;  2LVM A;  2DZC A;  4M75 F;  3VV0 A;  4F14 A;  1UFF A;  3PMT A;  4RTX A;  4FSX A;  5CKF A;  4QKU A;  1M3B A;  3LH0 A;  3M59 A;  4LN2 A;  3EG0 A;  5GAN 3;  2ZPH B;  1IZ6 A;  1VQ6 A;  2RHI A;  1NJI C;  1RAF B;  1WJS A;  4KUL A;  3A8O B;  2WAC A;  3THK A;  2QGF B;  4LDV A;  2CT3 A;  4XTX A;  3H41 A;  1KD1 R;  4KH1 B;  1YJ9 T;  1PKS A;  2RPN A;  1G2B A;  1B3Q A;  1BKB A;  1UE9 A;  2MAM A;  4E7S A;  4WF2 A;  4C8Q G;  1WHM A;  4R55 A;  2O31 A;  3CXC A;  2RD1 A;  1LPL A;  2AKL A;  4D6W A;  3CCL T;  2XID A;  1N9R A;  2CH4 W;  4C0Z A;  4E47 A;  5CK9 A;  2GTJ A;  1M9S A;  4C92 C;  2VYT A;  2L2P A;  2JVV A;  1NEG A;  3WVE B;  1WIE A;  2CYZ B;  2EGA A;  1OOT A;  2IG0 A;  4O6J A;  5DM7 R;  4HT9 A;  1SHG A;  5CQY A;  1I8F A;  5FWC A;  1QCN A;  4E7H A;  2VVK A;  1VQK A;  2X35 A;  2DER A;  3G4S T;  3HTR A;  5LJ3 j;  4RCC A;  3CPW S;  4RTT A;  4XU0 A;  3QWY A;  3C94 A;  3X28 B;  2KGT A;  1VOM A;  5FU6 C;  1AWW A;  2O4X B;  3NFC A;  2DRK A;  1V76 A;  5LJ5 f;  5I21 A;  2O2O A;  4IKF A;  4DBR A;  1C6V X;  1M8V A;  3BY7 A;  4OVA A;  2RQR A;  2PQW A;  1CKB A;  4ZTF A;  2L8D A;  2PUK B;  3H0I A;  1Q86 U;  4M7D F;  5GAN d;  1AZG B;  4PK4 A;  3CME A;  3EHR A;  1MND A;  2D8J A;  5LJ3 h;  1X27 A;  3C4S A;  3LLR A;  3JB9 J;  3BDL A;  4BY6 C;  2L3S A;  4LD6 A;  3GP8 A;  3NHN A;  4ATO A;  3INZ A;  1VQM A;  5CQX A;  3TU4 K;  4BI4 A;  2FVU A;  3C12 A;  1BCM A;  4MML A;  3V8L A;  5DLO A;  4MDX A;  4HXJ A;  1IHV A;  1VQ7 Q;  2DZ9 A;  3HL8 A;  1K73 R;  5D6W A;  1XJW B;  1HD3 A;  1J3T A;  2YLC A;  2HKN A;  1UB4 A;  4HCK A;  4P5N A;  4FYW B;  3EG3 A;  5GAO l;  1SRM A;  1VQ7 A;  1BCO A;  1K73 U;  5LJ5 e;  2B8A A;  2EQM A;  3A1P A;  1YHQ Q;  5HKC A;  4N4I A;  3JB9 D;  3OS1 A;  2DO3 A;  3S3O A;  1HK9 A;  5FU6 B;  3R6O A;  3AT1 B;  3NGP A;  2RH2 A;  2I0N A;  4NOY A;  3P8H A;  3FC3 A;  2RQW A;  1B34 B;  2MWO A;  1QVG P;  1YJN A;  2NYS A;  2V8K A;  2DF6 A;  3CCQ T;  5FRM A;  4RMO A;  1FMV A;  1PC0 A;  3JRZ A;  1UDL A;  3GBQ A;  4Y92 A;  2FPD A;  4DBQ A;  3BW1 A;  4OB0 B;  2KNB B;  3VS0 A;  2OI3 A;  4B9W A;  4EMK A;  2QK0 A;  1SSH A;  3OS0 A;  2F5T X;  4M7D D;  4DBF A;  4JZ4 A;  2AZS A;  2YLB A;  3OYI A;  2X4X A;  3V7C A;  3M0R A;  1VQL A;  2EAY A;  2XI9 A;  3OS2 A;  1ZUY A;  2CRE A;  3QKJ A;  2V8I A;  3GPL A;  4FYV B;  1KC8 C;  1AWJ A;  1N27 A;  2M51 A;  4CC7 A;  3CC7 Q;  2HBP A;  4AG2 C;  2CSQ A;  5IN1 A;  3LYI A;  1VQ8 Q;  2BE9 B;  4M7A E;  1QLY A;  4BDZ A;  3CMA A;  3OYF A;  2DX1 A;  5D6X A;  2D9T A;  1UEC A;  1RAA B;  5IHK A;  2ED1 A;  1I5L A;  5KCH A;  3RR6 A;  2K2M A;  1GCP A;  3CBO A;  1SKU B;  3R6N A;  2QAS A;  3OMG A;  3RKX A;  2VAS A;  1X2Q A;  4BB7 A;  5GJV B;  2AZV A;  2COW A;  2F1L A;  2EBP A;  1W2B S;  2V1R A;  2LX9 A;  1H3H A;  5A0D A;  4V2S A;  4AT1 B;  3PIO A;  3Q1J A;  2FL7 A;  3CPW P;  4PJM A;  1UGV A;  1VQ8 A;  2YT6 A;  2VGM A;  1SF9 A;  1BIB A;  4UC4 A;  1GRI A;  2MMP A;  1FYN A;  3NTI A;  5KYX A;  5GAN f;  3HP9 A;  4J83 A;  4F7U B;  4HKE A;  4JS5 A;  3PE0 A;  4J5Y A;  2CT4 A;  1TUC A;  5LJ5 h;  3S6W A;  1TG0 A;  1W6X A;  9ATC B;  3D7S B;  3VS7 A;  2JMA A;  4IIM A;  1EFN A;  1KC8 R;  2MCN A;  4M75 A;  1WHK A;  1QVG S;  4MDW A;  1I81 A;  1NG2 A;  2DIQ A;  5GJW B;  1Y0M A;  2K79 A;  1KHC A;  1K9M R;  3E2U A;  2E6Z A;  1ZQ1 A;  3CCQ Q;  1WQW A;  3M0P A;  4XTY A;  2K57 A;  1JEG A;  2YSQ A;  5CAI A;  1NEB A;  4R56 A;  5CCA A;  3CXC P;  2L5Q A;  4JDS A;  2R57 A;  2E4H A;  2EWN A;  4GBQ A;  1VQ6 Q;  1M5Q 1;  2DBM A;  1WQ7 A;  3VRZ A;  2CS7 A;  5IXB A;  2E6N A;  3M55 A;  4PL6 A;  1G3W A;  1IB8 A;  3MP1 A;  4KGZ B;  3JCM X;  2AK5 A;  2DRM A;  2ENM A;  1KHI A;  3CCV A;  1U1T A;  3MO8 A;  3OS5 A;  2Y4Y A;  1K8A U;  2G3R A;  3SDZ A;  3A8H B;  1VQP Q;  4FW1 A;  1FWZ A;  3UAT A;  4B6M A;  5FLX E;  1JO8 A;  2L0A A;  2LCL A;  2JS2 A;  3EGX B;  1S72 T;  2RI3 A;  5M9O A;  2EGC A;  1YI2 Q;  5KCO A;  4IUP A;  1M8M A;  5AT1 B;  3SHW A;  3CCU Q;  1RI9 A;  2H3E B;  5KYU A;  2FZC B;  2K2V A;  2LQN A;  1D3B B;  1ZUK A;  3QUI A;  2OTL A;  3QJY A;  1M1G A;  2CP5 A;  1JXM A;  2KRS A;  3OB9 A;  2QA4 A;  4JZ3 A;  2EKO A;  3M5A A;  3CCM A;  3JCM h;  4N0A C;  2JM9 A;  1UGR B;  2LJ0 A;  2COY A;  1RAD B;  2DXB A;  2RHX A;  3ASK A;  1M1K R;  4HT8 A;  1BI3 A;  1LVK A;  1OX8 A;  1KFZ A;  1YIT A;  4C0F A;  1T0H A;  4QVC A;  3I35 A;  2HEQ A;  2JTE A;  2EQU A;  2DBK A;  2M02 A;  2DET A;  4ELY C;  4C8Q C;  3CCM T;  2E5K A;  1VYV A;  3UPU A;  1UHC A;  1U5S A;  4JPB W;  5KYU B;  2OTL T;  1TS9 A;  1NZ9 A;  3L42 A;  2BZX A;  2AHJ B;  1BI1 A;  1UUE A;  2V1Q A;  2ZGW A;  4C0G A;  1MMD A;  2XKO C;  4M7A B;  2DYB A;  5GAN 8;  3LWH A;  1G8X A;  3H0F A;  1D1B A;  2P4R A;  2PNI A;  4M7D A;  2OTJ A;  2GQV A;  1OQK A;  4C8Q F;  1VQN Q;  2XDB A;  1AD5 A;  4OB2 B;  3H0H A;  3PMI A;  3TCJ A;  1YNZ A;  2GBQ A;  5LJ3 f;  1GXI E;  2YRC A;  2HBW A;  2X3X D;  1X6O A;  4BE0 A;  1RI0 A;  2FZK B;  4NL2 A;  3OYJ A;  2BE7 D;  2RJC A;  3JCM Q;  3QJ6 A;  2QI2 A;  1X01 A;  1NE8 A;  4FU6 A;  5GAM e;  3JCM W;  1KD1 U;  4RTW A;  3QZ9 B;  4XQ3 A;  2ED0 A;  3CBP A;  3WVD B;  2D0N A;  2LRQ A;  5DY9 A;  1D0Z A;  4J9I A;  2LQW A;  2QDY B;  4EMG A;  2KK4 A;  5GAM d;  4EMK C;  4K11 A;  2JJ9 A;  3CPF A;  3M56 A;  3QDF A;  1MV0 B;  2KSS A;  2KE9 A;  4M77 A;  3REB B;  5GAO p;  1AHJ B;  1RAG B;  5CKE A;  1E6H A;  4NS5 A;  1IHW A;  1DJ7 B;  1D09 B;  1D0X A;  2CGH A;  1WXB A;  3OBY A;  4M78 D;  5C0M A;  2FPF A;  2R5M A;  2F2V A;  5KYN A;  2OTJ Q;  4L6V 5;  5KYX B;  3RUX A;  2NUP B;  2M16 A;  4A53 A;  3T9N A;  3TQ7 P;  5GAN 5;  3CXC S;  3CCQ A;  1B7T A;  2A08 A;  3G4S Q;  1SEM A;  2RF0 A;  2QXF A;  1KQS S;  2DVJ A;  4ME7 A;  1T3S A;  1WHH A;  2CUB A;  3RNJ A;  4RG8 A;  1MUZ A;  2EYQ A;  4ZNX A;  2OAW A;  4KUD K;  4FYX B;  2JOY A;  2YRD A;  4QW2 A;  3JCM e;  2JS0 A;  1Z9Q A;  3OYA A;  1B34 A;  3EG1 A;  1YIT T;  4FCY A;  2OJ2 A;  5KH6 A;  2AKK A;  1X6B A;  1QVF P;  3JCM g;  1UHF A;  2ROT A;  2BZ8 A;  2K3B A;  2PVG B;  3FIF A;  3X26 B;  3I56 T;  4PJO C;  5GAM f;  1BK2 A;  8ATC B;  1U8R A;  1U06 A;  3QXE B;  1K8A R;  1OEB A;  1G5V A;  1K9M U;  4PKC C;  2X4Y A;  5GAO q;  2ZAE A;  1K4U S;  1AZE A;  5L8R E;  1UG1 A;  1YBY A;  2ZPG B;  3X20 B;  3CCU T;  1TTH B;  1YIJ A;  4OMP A;  2JNG A;  3LW5 E;  1S72 Q;  2YUP A;  3OSS C;  2DTH A;  2L3Q A;  5I2S A;  3CC2 A;  3QPH A;  4C5H A;  4EDU A;  3E19 A;  4KH0 B;  1VQP A;  2RHY A;  4ESR A;  2KRM A;  5GAO r;  3CCV Q;  1PG5 B;  3CC7 A;  2EFI A;  3GNF B;  3CMA T;  3TSZ A;  3KXT A;  4JRP A;  1HYO A;  1ABQ A;  1HSQ A;  4LDW A;  1D1A A;  1X2K A;  5IHI A;  4M78 C;  5EG2 A;  3ULR B;  1OV3 A;  2A0F B;  1WNL A;  2PZ1 A;  1HXD A;  4E7K A;  3CD6 T;  3N5B B;  1GL5 A;  4JS4 A;  3HRT A;  1YCY A;  4M7A G;  5GAM g;  2XDD A;  2OAU A;  3OBW A;  3IQL A;  2E3I A;  1NYG A;  5HK3 A;  3OYL A;  2PU9 B;  4XTU A;  1MV3 A;  2GF7 A;  4RTZ A;  3GOX A;  4X9C A;  3RKW A;  1AVZ C;  4OMQ A;  2J05 A;  4BDY A;  4KT0 E;  4AFQ C;  2F69 A;  2VGN A;  1T0J A;  3QSU A;  3E1S A;  2VUB A;  1SHF A;  2E10 A;  3I56 Q;  4AMC A;  1WX6 A;  1VQ4 A;  2DNU A;  3J80 E;  1FMK A;  1KJW A;  5DLQ E;  4XK8 E;  4WTO B;  4QT7 A;  4DEX A;  2SEM A;  1QCO A;  4C5G A;  5LJ5 d;  3CCE T;  1FMW A;  1VYU A;  5GAN j;  4ZGD B;  2HZY A;  3NTK A;  4BUG A;  1OPL A;  1W1F A;  1YCS B;  4CC2 A;  5L23 A;  1TUG B;  1ZSG A;  2EYW A;  1PSF A;  2LQK A;  3ZEH A;  2HCK A;  2KI7 A;  2EGE A;  2DKG A;  2JN0 A;  1VQ8 T;  1NJI R;  2YDL A;  1N8R R;  4KBM B;  2F5K A;  1XQH A;  4GY5 A;  5LJ3 d;  1ZSZ C;  4AFU C;  3EFS A;  3HKS A;  2CP2 A;  4OMO A;  4PJO F;  3OSV A;  3PFS A;  2BKD N;  2W10 A;  3JCM J;  1ZSZ B;  3G71 Q;  2RHU A;  3EGD A;  4FM4 B;  4JUV A;  2H3J A;  2E5Q A;  1M90 U;  2SRC A;  1H3Z A;  3QZ5 B;  1SPK A;  2AIR B;  3M53 A;  3SD4 A;  4QQD A;  4CC4 B;  1H64 1;  3RIR A; 
#chains in the Genus database with same CATH homology
 2MPX C;  2COZ A;  2CP6 A;  2CP0 A;  2CP5 A;  2E3H A;  2CP7 A;  1TOV A;  1LPL A;  2M02 A;  4B6M A;  2E4H A;  2HL3 A;  1WHH A;  2CP2 A;  1TXQ A;  1WHK A;  2COW A;  2QK0 A;  2CP3 A;  2COY A;  1WHL A;  3RDV A;  3E2U A;  2HQH A;  1IXD A;  2E3I A;  2HL5 C;  1WHJ A;  1WHG A;  2HKQ B;  2Z0W A;  3TQ7 P;  1WHM A;  2HKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...