2E3HA

Crystal structure of the clip-170 cap-gly domain 2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
81
Chain Sequence
ELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTVRRVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Restin
publication title Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 81
sequence length 90
ec nomenclature
pdb deposition date 2006-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2e3hA00
2HL3A 1TXQA 1WHLA 2CP6A 2MPXC 1WHKA 2HKNA 2HQHA 2M02A 1WHGA 2Z0WA 2HL5C 2CP3A 1WHJA 3RDVA 3TQ7P 1IXDA 2CP2A 4B6MA 2QK0A 1LPLA 2E3IA 3E2UA 1TOVA 2CP0A 2E3HA 1WHHA 2HKQB 1WHMA 2COWA 2COYA 2E4HA 2COZA 2CP5A 2CP7A
chains in the Genus database with same CATH superfamily
5LJ3g 1WI7A 3DB3A 2LCCA 2RJEA 1VQ6T 4CI0C 2FPDA 4J9CA 1G5VA 4R56A 5LJ3d 1SRMA 4CC2A 1ZBXA 1ZUKA 3PE0A 3VS1A 1V1CA 1QCFA 1VQ6Q 3LWIA 2QQRA 1RLPC 3A8LB 4OMLA 3M59A 2V8KA 2OTJQ 4L5GA 1D09B 3OYYA 2ZPIB 4NOYA 1I5LA 1WA7A 2O4XA 2M1HA 3M0RA 3ZBDA 3KUFA 4BI8B 2MK5A 5A0LA 2PVGB 2P4RA 2KRSA 4C8QD 1ZUUA 3JCMV 1UECA 5CKHA 5FU6B 3QYGB 2DBMA 4C5EA 2RJFA 3L2ZA 2QASA 1FMWA 2KNBB 2DFUA 3E2UA 1WHHA 1BCOA 2IG0A 3X24B 1WXBA 4N0AA 1PNJA 2LP5A 1K73C 4AFSC 2MAMA 1VQ8Q 2E1HA 3EGDB 2E5KA 2LQWA 2WSEE 1OOTA 4ZN1A 1JJ2P 5LJ5j 4R0KA 1ABOA 1N9SA 1AWJA 3SEMA 1IGQA 3MEWA 2DVJA 3WVEB 2EVRA 2RH2A 1VQKT 2LT4A 1MGQA 4LDUA 4FYYB 1VQNA 1XOVA 2CP7A 3OYCA 1M2VA 4PJOF 1OU9A 3VUBA 3MHXA 3MO8A 1NE8A 3OYLA 2BUDA 4M78C 2L89A 4HKEA 2DLPA 1VQKQ 3KBGA 2F1LA 1UG1A 1M8VA 3VJPA 1YITQ 1KQSP 1T3SA 4KGXB 3CCEA 4M7DA 2DXCA 1MV3A 4E7ZA 3UATA 2PZ1A 1VQ4T 2EQJA 3CC7A 1JJ2S 1WX6A 3CCSQ 3I56A 1X2KA 3FLGA 3RKYA 2OX7A 2CUDA 2RI5A 1ZSZA 5IHKA 4C0ZA 2HEQA 1VQ4Q 2V1RA 3OS1A 1KJWA 2ED1A 5C6SA 1OU8A 2D0QB 4CRIA 1Q95G 5HY6A 4BB7A 4GLKA 4PLIA 2A7YA 4DBQA 2DXTA 3A8MB 2DILA 4M75F 4IUQA 1QVGP 3C12A 1VQPA 4RMOA 4J6XA 2X3XD 5FWCA 4FT4A 1QKXA 3SD4A 2DBKA 1KQSS 4C0FA 1Y57A 3C4SA 5GAN7 2M0YA 3G4SA 2M16A 4IIOA 4RUGA 2L3PA 4M7DD 4RG2A 1LCKA 2DKGA 1RAFB 4OGEA 5D6WA 2F2XA 3RMQA 2OJ2A 2O88A 1Q82R 2ZAEA 5KYYA 3QJYA 2X35A 2NUPA 1EX4A 3R6OA 2OAUA 2K2VA 8ATCB 2QK0A 2PVDB 2X9HA 4M77A 2FZGB 2ROLA 4D6WA 2E3HA 3VYHB 4JJNK 2E5QA 1QVGS 3META 1AWXA 1ZHIA 2GNCA 3CXCP 2DL7A 2A3LA 2LX7A 1ZA2B 1V29B 1VQ5Q 4J9DA 4RCCA 2YUOA 3TVTA 1D0XA 3DLMA 3GOXA 1YCYA 4GLMA 2JM8A 3CMET 5AT1B 2JVVA 5GMKm 1OZ3A 1OX8A 1YI2T 2XK0A 1QWFA 2VASA 4XU1A 2EQKA 1VQOA 3NHNA 1KHIA 3G6EQ 4N4GA 4XU0A 5KYWA 1ZSZB 4XQ3A 4PJJA 1YP5A 2VGNA 1KQ1A 1QLYA 1PKTA 4M4ZA 1G3TA 2EYZA 3SHWA 2JT4A 4MZTA 1SPKA 3M57A 4M77D 2DF6A 3O8VA 3CXCS 3X25B 1X6BA 4J5YA 2D9TA 2XU8A 4M7AA 3HTRA 1YJNT 1UDLA 2K2MA 3CCRT 4HCCA 2RI3A 3S6WA 1VIFA 3RKXA 4KUIA 5FLXE 2VXEA 2FO0A 3PNWC 2O9SA 3SDZA 1CKBA 5KH6A 5EG2A 1YIJA 5GAOn 2JS0A 1SHGA 1YJNQ 2GFUA 1W1FA 4MZPA 1TWBA 3JB9I 4FYVB 2IIMA 3RIRA 4C0DB 3VU3C 5LJ3j 2NUPB 3CMAQ 5GAMg 2FZKB 2HL5C 4ME7A 4QKUA 1I8FA 1M8MA 2KEAA 4JRQA 3NMZC 3V8KA 4LXCA 5GAMd 4HCKA 4HVUA 3OB9A 4EDUA 2KXDA 4X34A 4M7AD 2CP6A 2VUBA 3JB9H 4F7UG 1XNIA 1FWZA 3PMIA 1X2QA 3CCJQ 3LH0A 3OYGA 1NJIU 4PKCC 9ATCB 4ZNXA 2VKNA 5CCAA 1D1AA 3SFMA 1TSFA 2E6NA 1OPKA 4MMKA 4RKUE 2AIRB 6AT1B 5KYWB 3CPFA 1HD3A 1RAGB 2ENMA 4JS4A 2V8IA 2ROTA 2DEQA 3OQ5A 2JS2A 4P5NA 1PRMC 2J6OA 1FX7A 1K1ZA 4B9XA 3OYDA 5IHIA 1YJ9A 2AK5A 3OS2A 2LJ3A 2M9UA 3M0SA 3VS3A 3HRTA 4GY5A 1IB8A 1BBZA 4F7UA 3D7SB 3HRUA 1QWEA 3P8HA 4E6RA 2D8HA 5IH2A 4N4IA 3HFOA 4JDSA 1Q82C 2K5IA 3S3OA 1LVKA 2X3WD 2VGMA 5CKBA 2JW4A 3CBOA 2AZSA 4AFQC 1X69A 2RN8A 4FW2A 1VQNQ 4KT0E 1WQ7A 4PJOC 1WGSA 1HSQA 3JB9D 3CCET 1WJRA 2YDLA 2EW3A 2EWNA 2JTMA 4MZMA 2YRCA 2H3EB 4LN2A 1QVPA 2FPEA 3I56T 2ZCFB 3GBQA 5C0MA 2J06A 4F7UE 3FJPA 1UFFA 3GIBA 4C5HA 3CC7Q 4C5IA 1KQ2A 3I56Q 2KYMA 2EKHA 4C92C 2M02A 4Y92A 2HDAA 1VQPT 4BY6C 1B3QA 8AT1B 1RAHB 4DQ2A 3VS6A 1PD0A 1M1FA 1ZUYA 4BY6B 1Q7YU 5GANh 1KG1A 3M53A 1HXDA 1BI1A 3QXEB 3RUXA 1VQPQ 2WACA 3GNGA 3G4ST 3GF5A 1D3BB 1AWOA 3A8GB 4Z8AA 3TU4K 1R0CB 4F7UB 3G4SQ 3CPWA 2YUPA 2FRWA 5GMKh 3PVLA 2NWMA 2YRDA 1IO6A 4OB3B 5CQYA 2QXFA 4X9CA 5CQXA 2K5FA 1GBRA 1Q86R 2LQKA 1VUBA 2DL8A 4BDYA 5GANg 4ZTJA 2A08A 3NTIA 4RCBA 2CP2A 5IXBA 1YFNA 2RI2A 2E65A 4XTYA 1Y96A 2YUQA 3UPUA 4JJDA 2RJDA 1RAEB 1JO8A 1ZX6A 5GANd 2M51A 5L8RE 2VYTA 3G1JA 3QPHA 4KH0B 5GAN2 2MPXC 4IIMA 4KUDK 4J9GA 1VOMA 1U5SA 2O2OA 2EGAA 5A0GA 1VQOT 4Z89A 1IXDA 1Q7YR 3KXTA 2DRKA 1R77A 4JZ3A 3CMEA 1M4ZA 4M7DF 4FW1A 4JRIA 1R8OB 2A28A 1YI2A 2QQSA 4PLLA 2CP0A 2Y90A 2MMPA 4JRKA 5I2MA 4OF1A 2DRMA 1WNLA 1VQOQ 3NTKA 1U1TA 1TXQA 3HSBA 2M0OA 1BIAA 1UHFA 2BIVA 2R58A 3BW1A 4M78G 1JB0E 2EJ9A 2F69A 2FG0A 2GTOA 1YIJT 4QVZA 3JSCA 2PUKB 2QQ9A 3CCRA 3BFMA 2O9VA 5GJVB 1RL2A 1PSFA 2RMOA 3C95A 1P92A 1YIJQ 1RACB 2CSQA 2DTOA 4N4HA 3NFCA 3CBPA 3OMCA 4HVWA 2JOYA 4ANJA 4XTXA 4J6WA 2DXUA 3THKA 5GAMf 1M30A 2CT4A 2BTTA 1TTHB 5CK9A 3UT1A 4M78A 3CCLA 1Y0MA 4FIBA 4PL6A 1TUDA 1SF9A 2CZ6B 3LH5A 3OS0A 1H641 4M77F 1Y96B 5HK0A 3QIIA 1H3HA 3JAME 2KMTA 2C06A 1X75C 1JU5C 2OTLA 1W4SA 1R0BG 5GAN6 1IREB 2YUNA 3L2UA 4J9HA 1UEBA 5GAOl 2FEIA 1W70A 2PUOB 3OBYA 3CBMA 3CCMA 5GAOr 1UGVA 3EG1A 3EG2A 3F70A 3EGUA 2MCNA 1DJ7B 4OB2B 1WJSA 3VRYA 1YJ9T 2LNVA 2QI2A 3QHSA 3T9NA 2FB7A 1EIFA 4M78E 2HL3A 3H8ZA 3P8DA 1T0HA 2DJQA 5KCHA 2L2PA 4IURA 4AFUC 2K3YA 1YJ9Q 2DE0X 2P4TA 2XHCA 2FHDA 2KRMA 3UWNA 1WXUA 1TU0B 2RHZA 4M7AF 4OB0B 2HKQB 4OMNA 2KI7A 5FWBA 2COWA 2K4YA 5M9OA 1O75A 1G3YA 4WF2A 4WTOB 1M2OA 1Q86C 1U3OA 4D8KA 4C8QC 3V8JA 3JCMQ 5HCKA 3QYHB 3MKDA 1NLPC 5CAIA 1MNEA 2P0KA 1S72A 4LDVA 4M78B 2DZCA 1QCOA 3OA6A 1Q81U 2E6ZA 3EH1A 1M27C 2CSIA 3HRSA 5IHNA 1AD5A 3MPUB 5IT9E 2HAXA 2FRYA 4DEYA 4HT8A 2YWWA 1JQQA 5CKEA 1K9MC 4CC4B 1CSKA 1ZBJA 3MP6A 3OSSC 2RQRA 2C0TA 3FRNA 3RDVA 1Q7YC 4IKFA 2LNHB 1VQ9T 3M56A 2A0FB 3M0UA 1NEGA 3QSUA 4WCIA 1PWTA 1C6VX 4HT9A 2HCKA 1RI9A 3HPWA 2ECZA 1M5Q1 1T0JA 3FB9A 5J3BA 1K0SA 2DEUA 1VQMA 2K79A 2BZXA 1WHGA 2XICA 3GLXA 1X01A 3CC4T 1I5OB 2EQUA 2KQWA 1MMNA 1UB4A 4PJMA 4OGCA 4AFZC 2FL7A 3JB9F 1AEYA 1U1SA 1G3WA 1PC0A 4ZGJB 1I07A 5CR2A 4JJBA 2X51A 2DD5A 1B7TA 3J80E 2HQHA 1TG0A 2RM4A 2BZYA 2YSQA 4IUTA 4PFOA 1Q81R 3M4GA 1PCXA 2MIOA 2XI9A 4B6MA 4F7UF 1GCQC 2KSSA 2LX9A 4RTZA 3V7RA 2XIDA 1GFDA 3OYIA 1K8AU 5IXFA 5GANf 3CD6A 1OZ2A 3ER0A 2EQMA 3S3MA 4X1VA 2RNAA 1RADB 4LD6A 2GF7A 2HZYA 1V76A 2CZ0B 4V2SA 5GANj 5GAN5 1D1BA 1NG2A 4DOVA 1SSHA 4AG2C 1TUCA 4PFPA 2QEXA 5J26A 1RI0A 3MEVA 4BI3A 3QJ6A 5HK3A 2KBTA 3EAEA 3SWNC 2COYA 2L3SA 1MMAA 2CP5A 5LJ5e 4OVAA 1M90U 2QGFB 1AZGB 5GMKj 1WHKA 1JBMA 1M9SA 5CVIA 2DPPB 4M7DC 3CMEQ 3PVQA 3CPWP 1YI2Q 1VQLA 3VS4A 2DAQA 2LDMA 3H0IA 4PJOG 4KGZB 5GAMh 1NM7A 3VV0A 4RTUA 3U23A 1K0XA 1PG5B 1WHLA 2DVEA 2XDBA 3O5ZA 2JMAA 2YXYA 1X43A 1BKBA 1WHJA 3JCMb 2FVUA 2AT1B 3GPLA 2L8DA 2EGCA 2HSEB 3CCRQ 2MI6A 2DL5A 3JRZA 1YBYA 1VQ7T 1OQKA 2ZPEB 2RQWA 7AT1B 3L2WA 3X26B 3TSWA 4C92G 4LDYA 1X6OA 3CPWS 2F2WA 3CCLT 4BACA 1OYXA 1RAIB 4Z88A 1WPYA 3OYKA 4LE9A 2MWPA 1AWWA 1IZ6A 3HKSA 3EH2A 4EMKC 4M75G 1WLPB 2HQXA 1B07A 4NS5A 3CCLQ 1KD1U 1KK7A 3EGXA 1MHNA 2JUFA 2E12A 2LQ8A 2OTLT 1UE9A 2RQTA 2X4JA 4J83A 3RESA 4KULA 3M4YA 2DIGA 3GNFB 2HMAA 3CCMT 1JJ2A 1RLQC 3PTAA 4C92A 4JS5A 5KE3A 4F14A 1NZ9A 3AHUA 2VXFA 4DBHA 4O6JA 3CCMQ 1RUWA 3FEOA 2JMCA 4PJOE 2ED0A 1D3BA 4J6YA 3G71T 1E6GA 1LPLA 1G8XA 2ZPHB 3DKMA 4OMOA 3CCUA 1KQSA 4KGVB 1IRXA 2L3QA 3CEYA 3CCQT 3EG0A 4L59A 5DLQE 2DNUA 4BUGA 2K9GA 4KRTA 1M3CA 3JCMe 4JJCA 2KXCA 1PM3A 3ZEHA 2CS7A 2PNIA 4FT2A 5FU7C 1PKSA 2AKLA 4ZGDB 1KD1R 4EIKA 5FU7B 3E9FA 5GMKe 3ZL7C 1Q81C 2PTKA 4DOWA 2V1QA 4C92E 2KR3A 4QT7A 4MDXA 1S72T 3UA6A 2LZ6B 1M3AA 5GAN4 1YHQA 4BE0A 4PNOA 2IPOB 4PJOB 1NJIR 1K73U 4M75E 1U06A 2NUTB 4OP0A 5KCOA 4X9DA 2B86A 1S72Q 4BE1A 1RABB 2QTXA 1QMCA 3EGXB 3CCEQ 2CT3A 3OMGA 4M78F 2C0IA 3M58A 2LMJA 4C5GA 1YITA 2I0NA 3OW2A 4LDXA 4JLGA 3RERA 2DTHA 4O5VA 5I11A 4PJLA 3WVDB 4ZGEB 1VQ9A 1VIEA 5GAN3 1VQMT 4E7LA 4C92B 2XKOC 4JZ4A 5LJ3e 3GP8A 2ZZDA 4JLIA 4M75C 2EFIA 1VQMQ 1YJWA 1W2BA 1MMGA 3M0PA 4M75B 3MCAB 5KE2A 4QVCA 3CC4A 1N27A 2EPDA 2HKNA 2JNGA 4XU2A 4E7JA 3H6ZA 2B8AA 2C0OA 1NLOC 2MF2A 1SRLA 2QQBA 1UJYA 2R5AA 5DM7R 1K73R 2CH4A 4JUVA 2EIFA 4Y91A 4LD9K 3CD6T 2RHYA 2CZ1B 5D6YA 2KE9A 1QP3A 5DY9A 4XTVA 2QYZA 2GFAA 2RHXA 3TQ7P 2A36A 2QAZA 4DBFA 1FYNA 3VUZA 4A4HA 3A8HB 1K9AA 2OAWA 2E10A 1HK9A 2J6FA 2QDYB 2QEXT 1WFWA 1ARKA 4IUVA 5A0DA 5FRMA 2HQEA 3OYJA 1S1NA 2LJ1A 4LDWA 2QA4A 2RHUA 2DYBA 2EYYA 5I21A 2RQVA 3I55A 1GXIE 2QEXQ 3TEEA 3RNJA 3HL8A 4E7IA 2MWOA 1H3ZA 1UGRB 1VQLT 1WQWA 1IHVA 3EFRA 3JB9J 5CIUA 3M54A 2KGTA 4C8QG 4OB1B 3FC3A 4OMMA 1VQLQ 2A37A 2HNIA 4XU3A 2DK3A 4LUEA 2VC8A 3RBBB 1YWOA 3AT1B 3EFOA 3OYFA 1VYUA 4OMFB 3KFVA 2L3RA 1VA7A 2MOXA 4QQGA 1KSWA 2GQIA 4J7IA 3A8OB 5FROA 3C94A 3I9QA 3CC2A 1XJWB 3JCMJ 1SHFA 3L1AA 1T3LA 2WSFE 1KD1C 3QUIA 1VQ7A 1SG5A 1K76A 5CKFA 4C8QA 3BDLA 3FIFA 1VYVA 4C0GA 2CYZB 2Y4YA 1FMKA 2KT8A 3ASKA 1BCMA 4FYWB 1XTDA 4XTZA 2CREA 4EMGA 4TVRA 2H8HA 2JTEA 3INZA 5GMKi 5GAMj 1NJIC 2ABLA 3CMAA 2DM1A 3G7ZA 3A98A 2RPNA 5GAOq 1D0YA 3L2RA 1C0MA 2OTJT 1KC8U 4RTYA 2WSCE 4DBRA 3DLLA 2XD0A 1W6XA 3UA7A 5GMKl 1H8KA 1KFZA 2SEMA 3EFSA 3OY9A 2DMOA 2CP3A 2DYIA 4E7HA 1G83A 3CCJA 1AT1B 2HBWA 3E9GA 2KAFA 3LGFA 2LT1A 4C8QE 1WHMA 5FU6C 5IN1A 3CCUT 3PT9A 1M1KU 3WXMB 2ZPFB 2CDTA 4M78D 2RK1A 3H0FA 2VWFA 2DO3A 3G71A 4AMCA 3EFOB 2LCLA 4PJNA 1ZQ1A 2ZGWA 3CCUQ 1QCNA 5FRNA 1VQ8T 3FDRA 3BE3A 1QVFA 4FSXA 2RO0A 3CCQA 3OYNA 3M9QA 1I0CA 2E64A 1Y71A 5LJ5f 3LLRA 4M7DG 1GCQA 3MJXA 2HD0A 2NUZA 4XAXB 1YHQT 4BDZA 2O01E 3ULRB 5CKDA 1KC8R 2JXBA 4ZTFA 1U8RA 1BI3A 1NYGA 3L42A 4C8QB 4E7SA 2J05A 1BYMA 3CQTA 3MP8A 4FSSA 3REAB 1G2BA 2EJFA 2D8JA 2QQAA 3VS2A 1YHQQ 1FXXA 2KT1A 2XG8D 2DX1A 3OS5A 1UGPB 4E47A 3J81E 1LJOA 1YITT 5GAOp 4GBQA 4F04B 4JRPA 2YT6A 2DZ9A 3X20B 1WYXA 1Q82U 3SWNA 2DA9A 2DL3A 4DEXA 3PGGA 2R57A 2IVWA 1ZA1B 2XDPA 2GQVA 1M1KR 3CCST 1WDXA 4FYXB 4LNPA 3VS5A 3JCMX 2K5LA 1Y7XA 1VQ9Q 1YJWT 1D1CA 2X4YA 3M55A 1XQHA 3JCMc 2O4XB 3OYEA 1EFNA 3JCMP 3H9NA 4C92F 1BK2A 3QDFA 5AYFA 3PIPA 4DA4A 5GAMe 3CCVA 1YJWQ 2K6DA 3QWXX 4PK4A 3CC4Q 2BKDN 4M77G 1GBQA 2ESWA 3LX7A 1BIBA 3M0QA 4N0AC 4RG8A 2AZVA 2EGEA 1LNXA 1I1JA 4FU6A 1BU1A 3OW2P 2GTJA 4M7DE 1C1AA 3V7SA 4FL6A 3OSVA 2P84A 3QBYA 2BE7D 2I2LA 1MV0B 1OV3A 1ZLMA 1BI0A 2FPFA 1PD1A 4EMKA 4IUUA 3E19A 2G6FX 2VVKA 3I35A 2QA4T 2DJZA 4BD3A 1X6GA 3I55T 1NYFA 2XMFA 4L6V5 4HXJA 3R6NA 1VQ5T 1E6HA 2J7IA 2MYSA 1AZEA 1IGUA 1W2BP 1YNZA 1KIKA 1M2VB 2BZ8A 2YLCA 2X4WA 3QZ5B 4KH1B 4OMPA 2COZA 3N5BB 3BY7A 2QA4Q 3H41A 2GBQA 2YRVA 2AKKA 3I55Q 3SWNB 2G3RA 5KYXA 4FM4B 3JCMf 4RTWA 4A4EA 3MP1A 3VS0A 4M7AG 4OMQA 5DLOA 4HCZA 3EG3A 1BB9A 1D0ZA 1M1GA 3RMSA 1N8RU 3OW2S 4M7DB 2CKKA 2QDLA 4Z02A 3G6ET 1UGQB 4QQ6A 1LOJA 1TOVA 1H92A 2EBPA 3M5AA 2OI3A 1QW1A 2EQIA 3DB4A 5GAOm 4B9WA 1ZSZC 5I2SA 1MUZA 1QP2A 2QGGA 3UDCA 2KY9A 3TCJA 1UHCA 3J7AF 1SKUB 1NPPA 1PSEA 2LC4A 4XK8E 3VRZA 4J9IA 2HSPA 1K8AR 1W2BS 4M77E 2V8JA 3PFSA 2JZ2A 1MNDA 3CC2T 1OI1A 1ACMB 2K3XA 5KYNA 3LWHA 4E2FB 4ZN3A 4A53A 1EZZB 3PIOA 4VUBA 4ESRA 1AOJA 3CC2Q 2KROA 1VQ7Q 4II1A 3VYGA 3L2QA 1KC8C 4PJOA 5D7UA 2E41A 3LGLA 3CMAT 3Q1JA 5LJ3f 4C0DC 2NUTA 4J9FA 2CGHA 3I5RA 5ECAA 1M90R 1PHTA 1M3BA 2E4HA 5KYYB 4EMKB 2D6FA 3QG1A 3JCMW 5IAYA 4LUDA 1GRIA 2YHTA 3EG9A 1VQ6A 4QVDA 2LVMA 4M77C 2DTIA 4MMLA 1WIEA 1N8RR 2GGRA 3JB9G 1WZOA 5GJWB 2LCSA 4M77B 2OTJA 2EKOA 4KBMB 2OTLQ 1E7OA 3IQLA 2LRQA 3NGPA 5I22A 4BE2A 2E3IA 1M1KC 2FZCB 3CCJT 2FYKA 1VYTA 5KYXB 1ABQA 3TSZA 4AG1C 4M7AE 3NTHA 3QWYA 1UTIA 4J7FA 3OYAA 5LL6S 5LJ5h 2DERA 2EYXA 3TREA 1F1BB 4M75A 1B34A 2Y4XA 3HFNA 3P8BB 1YWPA 4PJOD 3QDRB 2H3JA 2ZPBB 2W10A 1IHWA 2DIQA 1NEBA 1RAAB 2X4XA 1WXTA 5GANe 1NPRA 2KK4A 2QTVA 3L2VA 1SSFA 5A2QE 4J9EA 5L23A 3URGA 4MDWA 3G71Q 1GFCA 1GCPA 1TS9A 2DD4A 2DETA 1VQ8A 1O9SA 4M7AC 2F5TX 3S3NA 3FJ5A 3CCQQ 1AVZC 3JV3A 5LJ5g 1BI2A 3SB2A 1GL5A 2BE9B 4M7AB 4F17A 3ZFJA 4YTLA 1J3TA 1JEGA 2YLBA 4C92D 2KVQG 5J39A 5GAN8 4E7KA 3E1SA 1CKAA 2J6KA 5FW9A 5LJ5d 2LJ0A 1VQNT 2Z0WA 2CH4W 3V8LA 4NL3A 2D0NA 4J9BA 1QVGA 3QKJA 2K3BA 4M75D 3HHTB 1UGSB 2NYSA 4AT1B 3OYMA 3EHQA 2CZ7B 4C8QF 4RTXA 1OEBA 2KDSA 2R5MA 1VQKA 4R55A 3EG9B 2F2VA 2EYQA 3UF4A 2LTOA 3H0HA 1Y07A 2O31A 2KYBA 3A5ZB 1FMVA 3A1PA 1I4K1 2RF0A 2EJGA 1Q86U 2ATCB 2L0AA 4QW2A 4A63B 3CC7T 4Q5WA 3QZ9B 1QVFP 1YN8A 2ZPGB 1OX9A 3CCSA 3REBB 2P0PA 1QKWA 4BI4A 4K11A 1UJ0A 3C0CA 2DL4A 4A54A 2RK2A 4IUPA 1VQ4A 3CCVT 2VB6A 5KYUA 2K57A 1B34B 1Z9ZA 2LQNA 4Y28E 4F16A 3CXCA 4ATOA 4ELZC 4HCBA 4UC4A 1N6AA 2AHJB 1G3SA 3CCVQ 1K9MU 2JN0A 3OYBA 1JXMA 1K8AC 2SRCA 2DXBA 2PU9B 1KHCA 3I5SA 1SEMA 2NLUA 1K4US 1TH7A 1MMDA 2K7AA 4J8OA 2RB6A 2CUBA 4RTVA 1YCSB 3JCMh 4A4FA 3BDUA 2JM9A 3QO3A 1JRIA 4A4KA 1QVFS 1OULA 1I81A 5HKCA 3NPFA 1OPLA 4ELYC 2QG9B 3ME9A 2JTFA 3CD6Q 1M90C 5EC7A 2JJ9A 4QQDA 4D8DA 2W0ZA 2PQWA 1N8RC 2RJCA 4EPCA 1HYOA 3M0TA 1TUGB 1VQ5A 1ZSGA 2E70A 1JXOA 3JCMg 1N5ZA 3HP9A 3V7CA 4A4GA 2D1XA 3EHRA 3VKIA 3MEUA 4XTWA 1WJQA 2RA2A 1N9RA 1QQJA 4CC7A 1K9MR 2KRNA 4CC3A 3JCMd 5CO7A 1NBEB 1PRLC 2HBPA 2F5KA 3G6EA 2L5QA 4FCYA 2RHIA 4EMHA 1AHJB 5LJ3h 1HJDA 4RTTA 4HVVA 5KYUB 2EYWA 4ORZA 3PMTA 5D6XA 2VV5A 3LW5E 3MEAA 3OYHA 3OBWA 3RKWA 1Z9QA 2P0QA 4NL2A 3RR6A 3EGDA 4HA8A 2V26A 3LYIA 2EAYA 2RD1A 2PVOB 1YJNA 4XTUA 1UUEA 1A0NB 2GCXA 4PFZA 1X27A 3VS7A 3X28B 2XDDA 2RQUA 4JPBW
chains in the Genus database with same CATH topology
2HL3A 1TXQA 1WHLA 2CP6A 2MPXC 1WHKA 2HKNA 2HQHA 2M02A 1WHGA 2Z0WA 2HL5C 2CP3A 1WHJA 3RDVA 3TQ7P 1IXDA 2CP2A 4B6MA 2QK0A 1LPLA 2E3IA 3E2UA 1TOVA 2CP0A 2E3HA 1WHHA 2HKQB 1WHMA 2COWA 2COYA 2E4HA 2COZA 2CP5A 2CP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HL3 A;  1TXQ A;  1WHL A;  2CP6 A;  2MPX C;  1WHK A;  2HKN A;  2HQH A;  2M02 A;  1WHG A;  2Z0W A;  2HL5 C;  2CP3 A;  1WHJ A;  3RDV A;  3TQ7 P;  1IXD A;  2CP2 A;  4B6M A;  2QK0 A;  1LPL A;  2E3I A;  3E2U A;  1TOV A;  2CP0 A;  2E3H A;  1WHH A;  2HKQ B;  1WHM A;  2COW A;  2COY A;  2E4H A;  2COZ A;  2CP5 A;  2CP7 A; 
#chains in the Genus database with same CATH topology
 5LJ3 g;  1WI7 A;  3DB3 A;  2LCC A;  2RJE A;  1VQ6 T;  4CI0 C;  2FPD A;  4J9C A;  1G5V A;  4R56 A;  5LJ3 d;  1SRM A;  4CC2 A;  1ZBX A;  1ZUK A;  3PE0 A;  3VS1 A;  1V1C A;  1QCF A;  1VQ6 Q;  3LWI A;  2QQR A;  1RLP C;  3A8L B;  4OML A;  3M59 A;  2V8K A;  2OTJ Q;  4L5G A;  1D09 B;  3OYY A;  2ZPI B;  4NOY A;  1I5L A;  1WA7 A;  2O4X A;  2M1H A;  3M0R A;  3ZBD A;  3KUF A;  4BI8 B;  2MK5 A;  5A0L A;  2PVG B;  2P4R A;  2KRS A;  4C8Q D;  1ZUU A;  3JCM V;  1UEC A;  5CKH A;  5FU6 B;  3QYG B;  2DBM A;  4C5E A;  2RJF A;  3L2Z A;  2QAS A;  1FMW A;  2KNB B;  2DFU A;  3E2U A;  1WHH A;  1BCO A;  2IG0 A;  3X24 B;  1WXB A;  4N0A A;  1PNJ A;  2LP5 A;  1K73 C;  4AFS C;  2MAM A;  1VQ8 Q;  2E1H A;  3EGD B;  2E5K A;  2LQW A;  2WSE E;  1OOT A;  4ZN1 A;  1JJ2 P;  5LJ5 j;  4R0K A;  1ABO A;  1N9S A;  1AWJ A;  3SEM A;  1IGQ A;  3MEW A;  2DVJ A;  3WVE B;  2EVR A;  2RH2 A;  1VQK T;  2LT4 A;  1MGQ A;  4LDU A;  4FYY B;  1VQN A;  1XOV A;  2CP7 A;  3OYC A;  1M2V A;  4PJO F;  1OU9 A;  3VUB A;  3MHX A;  3MO8 A;  1NE8 A;  3OYL A;  2BUD A;  4M78 C;  2L89 A;  4HKE A;  2DLP A;  1VQK Q;  3KBG A;  2F1L A;  1UG1 A;  1M8V A;  3VJP A;  1YIT Q;  1KQS P;  1T3S A;  4KGX B;  3CCE A;  4M7D A;  2DXC A;  1MV3 A;  4E7Z A;  3UAT A;  2PZ1 A;  1VQ4 T;  2EQJ A;  3CC7 A;  1JJ2 S;  1WX6 A;  3CCS Q;  3I56 A;  1X2K A;  3FLG A;  3RKY A;  2OX7 A;  2CUD A;  2RI5 A;  1ZSZ A;  5IHK A;  4C0Z A;  2HEQ A;  1VQ4 Q;  2V1R A;  3OS1 A;  1KJW A;  2ED1 A;  5C6S A;  1OU8 A;  2D0Q B;  4CRI A;  1Q95 G;  5HY6 A;  4BB7 A;  4GLK A;  4PLI A;  2A7Y A;  4DBQ A;  2DXT A;  3A8M B;  2DIL A;  4M75 F;  4IUQ A;  1QVG P;  3C12 A;  1VQP A;  4RMO A;  4J6X A;  2X3X D;  5FWC A;  4FT4 A;  1QKX A;  3SD4 A;  2DBK A;  1KQS S;  4C0F A;  1Y57 A;  3C4S A;  5GAN 7;  2M0Y A;  3G4S A;  2M16 A;  4IIO A;  4RUG A;  2L3P A;  4M7D D;  4RG2 A;  1LCK A;  2DKG A;  1RAF B;  4OGE A;  5D6W A;  2F2X A;  3RMQ A;  2OJ2 A;  2O88 A;  1Q82 R;  2ZAE A;  5KYY A;  3QJY A;  2X35 A;  2NUP A;  1EX4 A;  3R6O A;  2OAU A;  2K2V A;  8ATC B;  2QK0 A;  2PVD B;  2X9H A;  4M77 A;  2FZG B;  2ROL A;  4D6W A;  2E3H A;  3VYH B;  4JJN K;  2E5Q A;  1QVG S;  3MET A;  1AWX A;  1ZHI A;  2GNC A;  3CXC P;  2DL7 A;  2A3L A;  2LX7 A;  1ZA2 B;  1V29 B;  1VQ5 Q;  4J9D A;  4RCC A;  2YUO A;  3TVT A;  1D0X A;  3DLM A;  3GOX A;  1YCY A;  4GLM A;  2JM8 A;  3CME T;  5AT1 B;  2JVV A;  5GMK m;  1OZ3 A;  1OX8 A;  1YI2 T;  2XK0 A;  1QWF A;  2VAS A;  4XU1 A;  2EQK A;  1VQO A;  3NHN A;  1KHI A;  3G6E Q;  4N4G A;  4XU0 A;  5KYW A;  1ZSZ B;  4XQ3 A;  4PJJ A;  1YP5 A;  2VGN A;  1KQ1 A;  1QLY A;  1PKT A;  4M4Z A;  1G3T A;  2EYZ A;  3SHW A;  2JT4 A;  4MZT A;  1SPK A;  3M57 A;  4M77 D;  2DF6 A;  3O8V A;  3CXC S;  3X25 B;  1X6B A;  4J5Y A;  2D9T A;  2XU8 A;  4M7A A;  3HTR A;  1YJN T;  1UDL A;  2K2M A;  3CCR T;  4HCC A;  2RI3 A;  3S6W A;  1VIF A;  3RKX A;  4KUI A;  5FLX E;  2VXE A;  2FO0 A;  3PNW C;  2O9S A;  3SDZ A;  1CKB A;  5KH6 A;  5EG2 A;  1YIJ A;  5GAO n;  2JS0 A;  1SHG A;  1YJN Q;  2GFU A;  1W1F A;  4MZP A;  1TWB A;  3JB9 I;  4FYV B;  2IIM A;  3RIR A;  4C0D B;  3VU3 C;  5LJ3 j;  2NUP B;  3CMA Q;  5GAM g;  2FZK B;  2HL5 C;  4ME7 A;  4QKU A;  1I8F A;  1M8M A;  2KEA A;  4JRQ A;  3NMZ C;  3V8K A;  4LXC A;  5GAM d;  4HCK A;  4HVU A;  3OB9 A;  4EDU A;  2KXD A;  4X34 A;  4M7A D;  2CP6 A;  2VUB A;  3JB9 H;  4F7U G;  1XNI A;  1FWZ A;  3PMI A;  1X2Q A;  3CCJ Q;  3LH0 A;  3OYG A;  1NJI U;  4PKC C;  9ATC B;  4ZNX A;  2VKN A;  5CCA A;  1D1A A;  3SFM A;  1TSF A;  2E6N A;  1OPK A;  4MMK A;  4RKU E;  2AIR B;  6AT1 B;  5KYW B;  3CPF A;  1HD3 A;  1RAG B;  2ENM A;  4JS4 A;  2V8I A;  2ROT A;  2DEQ A;  3OQ5 A;  2JS2 A;  4P5N A;  1PRM C;  2J6O A;  1FX7 A;  1K1Z A;  4B9X A;  3OYD A;  5IHI A;  1YJ9 A;  2AK5 A;  3OS2 A;  2LJ3 A;  2M9U A;  3M0S A;  3VS3 A;  3HRT A;  4GY5 A;  1IB8 A;  1BBZ A;  4F7U A;  3D7S B;  3HRU A;  1QWE A;  3P8H A;  4E6R A;  2D8H A;  5IH2 A;  4N4I A;  3HFO A;  4JDS A;  1Q82 C;  2K5I A;  3S3O A;  1LVK A;  2X3W D;  2VGM A;  5CKB A;  2JW4 A;  3CBO A;  2AZS A;  4AFQ C;  1X69 A;  2RN8 A;  4FW2 A;  1VQN Q;  4KT0 E;  1WQ7 A;  4PJO C;  1WGS A;  1HSQ A;  3JB9 D;  3CCE T;  1WJR A;  2YDL A;  2EW3 A;  2EWN A;  2JTM A;  4MZM A;  2YRC A;  2H3E B;  4LN2 A;  1QVP A;  2FPE A;  3I56 T;  2ZCF B;  3GBQ A;  5C0M A;  2J06 A;  4F7U E;  3FJP A;  1UFF A;  3GIB A;  4C5H A;  3CC7 Q;  4C5I A;  1KQ2 A;  3I56 Q;  2KYM A;  2EKH A;  4C92 C;  2M02 A;  4Y92 A;  2HDA A;  1VQP T;  4BY6 C;  1B3Q A;  8AT1 B;  1RAH B;  4DQ2 A;  3VS6 A;  1PD0 A;  1M1F A;  1ZUY A;  4BY6 B;  1Q7Y U;  5GAN h;  1KG1 A;  3M53 A;  1HXD A;  1BI1 A;  3QXE B;  3RUX A;  1VQP Q;  2WAC A;  3GNG A;  3G4S T;  3GF5 A;  1D3B B;  1AWO A;  3A8G B;  4Z8A A;  3TU4 K;  1R0C B;  4F7U B;  3G4S Q;  3CPW A;  2YUP A;  2FRW A;  5GMK h;  3PVL A;  2NWM A;  2YRD A;  1IO6 A;  4OB3 B;  5CQY A;  2QXF A;  4X9C A;  5CQX A;  2K5F A;  1GBR A;  1Q86 R;  2LQK A;  1VUB A;  2DL8 A;  4BDY A;  5GAN g;  4ZTJ A;  2A08 A;  3NTI A;  4RCB A;  2CP2 A;  5IXB A;  1YFN A;  2RI2 A;  2E65 A;  4XTY A;  1Y96 A;  2YUQ A;  3UPU A;  4JJD A;  2RJD A;  1RAE B;  1JO8 A;  1ZX6 A;  5GAN d;  2M51 A;  5L8R E;  2VYT A;  3G1J A;  3QPH A;  4KH0 B;  5GAN 2;  2MPX C;  4IIM A;  4KUD K;  4J9G A;  1VOM A;  1U5S A;  2O2O A;  2EGA A;  5A0G A;  1VQO T;  4Z89 A;  1IXD A;  1Q7Y R;  3KXT A;  2DRK A;  1R77 A;  4JZ3 A;  3CME A;  1M4Z A;  4M7D F;  4FW1 A;  4JRI A;  1R8O B;  2A28 A;  1YI2 A;  2QQS A;  4PLL A;  2CP0 A;  2Y90 A;  2MMP A;  4JRK A;  5I2M A;  4OF1 A;  2DRM A;  1WNL A;  1VQO Q;  3NTK A;  1U1T A;  1TXQ A;  3HSB A;  2M0O A;  1BIA A;  1UHF A;  2BIV A;  2R58 A;  3BW1 A;  4M78 G;  1JB0 E;  2EJ9 A;  2F69 A;  2FG0 A;  2GTO A;  1YIJ T;  4QVZ A;  3JSC A;  2PUK B;  2QQ9 A;  3CCR A;  3BFM A;  2O9V A;  5GJV B;  1RL2 A;  1PSF A;  2RMO A;  3C95 A;  1P92 A;  1YIJ Q;  1RAC B;  2CSQ A;  2DTO A;  4N4H A;  3NFC A;  3CBP A;  3OMC A;  4HVW A;  2JOY A;  4ANJ A;  4XTX A;  4J6W A;  2DXU A;  3THK A;  5GAM f;  1M30 A;  2CT4 A;  2BTT A;  1TTH B;  5CK9 A;  3UT1 A;  4M78 A;  3CCL A;  1Y0M A;  4FIB A;  4PL6 A;  1TUD A;  1SF9 A;  2CZ6 B;  3LH5 A;  3OS0 A;  1H64 1;  4M77 F;  1Y96 B;  5HK0 A;  3QII A;  1H3H A;  3JAM E;  2KMT A;  2C06 A;  1X75 C;  1JU5 C;  2OTL A;  1W4S A;  1R0B G;  5GAN 6;  1IRE B;  2YUN A;  3L2U A;  4J9H A;  1UEB A;  5GAO l;  2FEI A;  1W70 A;  2PUO B;  3OBY A;  3CBM A;  3CCM A;  5GAO r;  1UGV A;  3EG1 A;  3EG2 A;  3F70 A;  3EGU A;  2MCN A;  1DJ7 B;  4OB2 B;  1WJS A;  3VRY A;  1YJ9 T;  2LNV A;  2QI2 A;  3QHS A;  3T9N A;  2FB7 A;  1EIF A;  4M78 E;  2HL3 A;  3H8Z A;  3P8D A;  1T0H A;  2DJQ A;  5KCH A;  2L2P A;  4IUR A;  4AFU C;  2K3Y A;  1YJ9 Q;  2DE0 X;  2P4T A;  2XHC A;  2FHD A;  2KRM A;  3UWN A;  1WXU A;  1TU0 B;  2RHZ A;  4M7A F;  4OB0 B;  2HKQ B;  4OMN A;  2KI7 A;  5FWB A;  2COW A;  2K4Y A;  5M9O A;  1O75 A;  1G3Y A;  4WF2 A;  4WTO B;  1M2O A;  1Q86 C;  1U3O A;  4D8K A;  4C8Q C;  3V8J A;  3JCM Q;  5HCK A;  3QYH B;  3MKD A;  1NLP C;  5CAI A;  1MNE A;  2P0K A;  1S72 A;  4LDV A;  4M78 B;  2DZC A;  1QCO A;  3OA6 A;  1Q81 U;  2E6Z A;  3EH1 A;  1M27 C;  2CSI A;  3HRS A;  5IHN A;  1AD5 A;  3MPU B;  5IT9 E;  2HAX A;  2FRY A;  4DEY A;  4HT8 A;  2YWW A;  1JQQ A;  5CKE A;  1K9M C;  4CC4 B;  1CSK A;  1ZBJ A;  3MP6 A;  3OSS C;  2RQR A;  2C0T A;  3FRN A;  3RDV A;  1Q7Y C;  4IKF A;  2LNH B;  1VQ9 T;  3M56 A;  2A0F B;  3M0U A;  1NEG A;  3QSU A;  4WCI A;  1PWT A;  1C6V X;  4HT9 A;  2HCK A;  1RI9 A;  3HPW A;  2ECZ A;  1M5Q 1;  1T0J A;  3FB9 A;  5J3B A;  1K0S A;  2DEU A;  1VQM A;  2K79 A;  2BZX A;  1WHG A;  2XIC A;  3GLX A;  1X01 A;  3CC4 T;  1I5O B;  2EQU A;  2KQW A;  1MMN A;  1UB4 A;  4PJM A;  4OGC A;  4AFZ C;  2FL7 A;  3JB9 F;  1AEY A;  1U1S A;  1G3W A;  1PC0 A;  4ZGJ B;  1I07 A;  5CR2 A;  4JJB A;  2X51 A;  2DD5 A;  1B7T A;  3J80 E;  2HQH A;  1TG0 A;  2RM4 A;  2BZY A;  2YSQ A;  4IUT A;  4PFO A;  1Q81 R;  3M4G A;  1PCX A;  2MIO A;  2XI9 A;  4B6M A;  4F7U F;  1GCQ C;  2KSS A;  2LX9 A;  4RTZ A;  3V7R A;  2XID A;  1GFD A;  3OYI A;  1K8A U;  5IXF A;  5GAN f;  3CD6 A;  1OZ2 A;  3ER0 A;  2EQM A;  3S3M A;  4X1V A;  2RNA A;  1RAD B;  4LD6 A;  2GF7 A;  2HZY A;  1V76 A;  2CZ0 B;  4V2S A;  5GAN j;  5GAN 5;  1D1B A;  1NG2 A;  4DOV A;  1SSH A;  4AG2 C;  1TUC A;  4PFP A;  2QEX A;  5J26 A;  1RI0 A;  3MEV A;  4BI3 A;  3QJ6 A;  5HK3 A;  2KBT A;  3EAE A;  3SWN C;  2COY A;  2L3S A;  1MMA A;  2CP5 A;  5LJ5 e;  4OVA A;  1M90 U;  2QGF B;  1AZG B;  5GMK j;  1WHK A;  1JBM A;  1M9S A;  5CVI A;  2DPP B;  4M7D C;  3CME Q;  3PVQ A;  3CPW P;  1YI2 Q;  1VQL A;  3VS4 A;  2DAQ A;  2LDM A;  3H0I A;  4PJO G;  4KGZ B;  5GAM h;  1NM7 A;  3VV0 A;  4RTU A;  3U23 A;  1K0X A;  1PG5 B;  1WHL A;  2DVE A;  2XDB A;  3O5Z A;  2JMA A;  2YXY A;  1X43 A;  1BKB A;  1WHJ A;  3JCM b;  2FVU A;  2AT1 B;  3GPL A;  2L8D A;  2EGC A;  2HSE B;  3CCR Q;  2MI6 A;  2DL5 A;  3JRZ A;  1YBY A;  1VQ7 T;  1OQK A;  2ZPE B;  2RQW A;  7AT1 B;  3L2W A;  3X26 B;  3TSW A;  4C92 G;  4LDY A;  1X6O A;  3CPW S;  2F2W A;  3CCL T;  4BAC A;  1OYX A;  1RAI B;  4Z88 A;  1WPY A;  3OYK A;  4LE9 A;  2MWP A;  1AWW A;  1IZ6 A;  3HKS A;  3EH2 A;  4EMK C;  4M75 G;  1WLP B;  2HQX A;  1B07 A;  4NS5 A;  3CCL Q;  1KD1 U;  1KK7 A;  3EGX A;  1MHN A;  2JUF A;  2E12 A;  2LQ8 A;  2OTL T;  1UE9 A;  2RQT A;  2X4J A;  4J83 A;  3RES A;  4KUL A;  3M4Y A;  2DIG A;  3GNF B;  2HMA A;  3CCM T;  1JJ2 A;  1RLQ C;  3PTA A;  4C92 A;  4JS5 A;  5KE3 A;  4F14 A;  1NZ9 A;  3AHU A;  2VXF A;  4DBH A;  4O6J A;  3CCM Q;  1RUW A;  3FEO A;  2JMC A;  4PJO E;  2ED0 A;  1D3B A;  4J6Y A;  3G71 T;  1E6G A;  1LPL A;  1G8X A;  2ZPH B;  3DKM A;  4OMO A;  3CCU A;  1KQS A;  4KGV B;  1IRX A;  2L3Q A;  3CEY A;  3CCQ T;  3EG0 A;  4L59 A;  5DLQ E;  2DNU A;  4BUG A;  2K9G A;  4KRT A;  1M3C A;  3JCM e;  4JJC A;  2KXC A;  1PM3 A;  3ZEH A;  2CS7 A;  2PNI A;  4FT2 A;  5FU7 C;  1PKS A;  2AKL A;  4ZGD B;  1KD1 R;  4EIK A;  5FU7 B;  3E9F A;  5GMK e;  3ZL7 C;  1Q81 C;  2PTK A;  4DOW A;  2V1Q A;  4C92 E;  2KR3 A;  4QT7 A;  4MDX A;  1S72 T;  3UA6 A;  2LZ6 B;  1M3A A;  5GAN 4;  1YHQ A;  4BE0 A;  4PNO A;  2IPO B;  4PJO B;  1NJI R;  1K73 U;  4M75 E;  1U06 A;  2NUT B;  4OP0 A;  5KCO A;  4X9D A;  2B86 A;  1S72 Q;  4BE1 A;  1RAB B;  2QTX A;  1QMC A;  3EGX B;  3CCE Q;  2CT3 A;  3OMG A;  4M78 F;  2C0I A;  3M58 A;  2LMJ A;  4C5G A;  1YIT A;  2I0N A;  3OW2 A;  4LDX A;  4JLG A;  3RER A;  2DTH A;  4O5V A;  5I11 A;  4PJL A;  3WVD B;  4ZGE B;  1VQ9 A;  1VIE A;  5GAN 3;  1VQM T;  4E7L A;  4C92 B;  2XKO C;  4JZ4 A;  5LJ3 e;  3GP8 A;  2ZZD A;  4JLI A;  4M75 C;  2EFI A;  1VQM Q;  1YJW A;  1W2B A;  1MMG A;  3M0P A;  4M75 B;  3MCA B;  5KE2 A;  4QVC A;  3CC4 A;  1N27 A;  2EPD A;  2HKN A;  2JNG A;  4XU2 A;  4E7J A;  3H6Z A;  2B8A A;  2C0O A;  1NLO C;  2MF2 A;  1SRL A;  2QQB A;  1UJY A;  2R5A A;  5DM7 R;  1K73 R;  2CH4 A;  4JUV A;  2EIF A;  4Y91 A;  4LD9 K;  3CD6 T;  2RHY A;  2CZ1 B;  5D6Y A;  2KE9 A;  1QP3 A;  5DY9 A;  4XTV A;  2QYZ A;  2GFA A;  2RHX A;  3TQ7 P;  2A36 A;  2QAZ A;  4DBF A;  1FYN A;  3VUZ A;  4A4H A;  3A8H B;  1K9A A;  2OAW A;  2E10 A;  1HK9 A;  2J6F A;  2QDY B;  2QEX T;  1WFW A;  1ARK A;  4IUV A;  5A0D A;  5FRM A;  2HQE A;  3OYJ A;  1S1N A;  2LJ1 A;  4LDW A;  2QA4 A;  2RHU A;  2DYB A;  2EYY A;  5I21 A;  2RQV A;  3I55 A;  1GXI E;  2QEX Q;  3TEE A;  3RNJ A;  3HL8 A;  4E7I A;  2MWO A;  1H3Z A;  1UGR B;  1VQL T;  1WQW A;  1IHV A;  3EFR A;  3JB9 J;  5CIU A;  3M54 A;  2KGT A;  4C8Q G;  4OB1 B;  3FC3 A;  4OMM A;  1VQL Q;  2A37 A;  2HNI A;  4XU3 A;  2DK3 A;  4LUE A;  2VC8 A;  3RBB B;  1YWO A;  3AT1 B;  3EFO A;  3OYF A;  1VYU A;  4OMF B;  3KFV A;  2L3R A;  1VA7 A;  2MOX A;  4QQG A;  1KSW A;  2GQI A;  4J7I A;  3A8O B;  5FRO A;  3C94 A;  3I9Q A;  3CC2 A;  1XJW B;  3JCM J;  1SHF A;  3L1A A;  1T3L A;  2WSF E;  1KD1 C;  3QUI A;  1VQ7 A;  1SG5 A;  1K76 A;  5CKF A;  4C8Q A;  3BDL A;  3FIF A;  1VYV A;  4C0G A;  2CYZ B;  2Y4Y A;  1FMK A;  2KT8 A;  3ASK A;  1BCM A;  4FYW B;  1XTD A;  4XTZ A;  2CRE A;  4EMG A;  4TVR A;  2H8H A;  2JTE A;  3INZ A;  5GMK i;  5GAM j;  1NJI C;  2ABL A;  3CMA A;  2DM1 A;  3G7Z A;  3A98 A;  2RPN A;  5GAO q;  1D0Y A;  3L2R A;  1C0M A;  2OTJ T;  1KC8 U;  4RTY A;  2WSC E;  4DBR A;  3DLL A;  2XD0 A;  1W6X A;  3UA7 A;  5GMK l;  1H8K A;  1KFZ A;  2SEM A;  3EFS A;  3OY9 A;  2DMO A;  2CP3 A;  2DYI A;  4E7H A;  1G83 A;  3CCJ A;  1AT1 B;  2HBW A;  3E9G A;  2KAF A;  3LGF A;  2LT1 A;  4C8Q E;  1WHM A;  5FU6 C;  5IN1 A;  3CCU T;  3PT9 A;  1M1K U;  3WXM B;  2ZPF B;  2CDT A;  4M78 D;  2RK1 A;  3H0F A;  2VWF A;  2DO3 A;  3G71 A;  4AMC A;  3EFO B;  2LCL A;  4PJN A;  1ZQ1 A;  2ZGW A;  3CCU Q;  1QCN A;  5FRN A;  1VQ8 T;  3FDR A;  3BE3 A;  1QVF A;  4FSX A;  2RO0 A;  3CCQ A;  3OYN A;  3M9Q A;  1I0C A;  2E64 A;  1Y71 A;  5LJ5 f;  3LLR A;  4M7D G;  1GCQ A;  3MJX A;  2HD0 A;  2NUZ A;  4XAX B;  1YHQ T;  4BDZ A;  2O01 E;  3ULR B;  5CKD A;  1KC8 R;  2JXB A;  4ZTF A;  1U8R A;  1BI3 A;  1NYG A;  3L42 A;  4C8Q B;  4E7S A;  2J05 A;  1BYM A;  3CQT A;  3MP8 A;  4FSS A;  3REA B;  1G2B A;  2EJF A;  2D8J A;  2QQA A;  3VS2 A;  1YHQ Q;  1FXX A;  2KT1 A;  2XG8 D;  2DX1 A;  3OS5 A;  1UGP B;  4E47 A;  3J81 E;  1LJO A;  1YIT T;  5GAO p;  4GBQ A;  4F04 B;  4JRP A;  2YT6 A;  2DZ9 A;  3X20 B;  1WYX A;  1Q82 U;  3SWN A;  2DA9 A;  2DL3 A;  4DEX A;  3PGG A;  2R57 A;  2IVW A;  1ZA1 B;  2XDP A;  2GQV A;  1M1K R;  3CCS T;  1WDX A;  4FYX B;  4LNP A;  3VS5 A;  3JCM X;  2K5L A;  1Y7X A;  1VQ9 Q;  1YJW T;  1D1C A;  2X4Y A;  3M55 A;  1XQH A;  3JCM c;  2O4X B;  3OYE A;  1EFN A;  3JCM P;  3H9N A;  4C92 F;  1BK2 A;  3QDF A;  5AYF A;  3PIP A;  4DA4 A;  5GAM e;  3CCV A;  1YJW Q;  2K6D A;  3QWX X;  4PK4 A;  3CC4 Q;  2BKD N;  4M77 G;  1GBQ A;  2ESW A;  3LX7 A;  1BIB A;  3M0Q A;  4N0A C;  4RG8 A;  2AZV A;  2EGE A;  1LNX A;  1I1J A;  4FU6 A;  1BU1 A;  3OW2 P;  2GTJ A;  4M7D E;  1C1A A;  3V7S A;  4FL6 A;  3OSV A;  2P84 A;  3QBY A;  2BE7 D;  2I2L A;  1MV0 B;  1OV3 A;  1ZLM A;  1BI0 A;  2FPF A;  1PD1 A;  4EMK A;  4IUU A;  3E19 A;  2G6F X;  2VVK A;  3I35 A;  2QA4 T;  2DJZ A;  4BD3 A;  1X6G A;  3I55 T;  1NYF A;  2XMF A;  4L6V 5;  4HXJ A;  3R6N A;  1VQ5 T;  1E6H A;  2J7I A;  2MYS A;  1AZE A;  1IGU A;  1W2B P;  1YNZ A;  1KIK A;  1M2V B;  2BZ8 A;  2YLC A;  2X4W A;  3QZ5 B;  4KH1 B;  4OMP A;  2COZ A;  3N5B B;  3BY7 A;  2QA4 Q;  3H41 A;  2GBQ A;  2YRV A;  2AKK A;  3I55 Q;  3SWN B;  2G3R A;  5KYX A;  4FM4 B;  3JCM f;  4RTW A;  4A4E A;  3MP1 A;  3VS0 A;  4M7A G;  4OMQ A;  5DLO A;  4HCZ A;  3EG3 A;  1BB9 A;  1D0Z A;  1M1G A;  3RMS A;  1N8R U;  3OW2 S;  4M7D B;  2CKK A;  2QDL A;  4Z02 A;  3G6E T;  1UGQ B;  4QQ6 A;  1LOJ A;  1TOV A;  1H92 A;  2EBP A;  3M5A A;  2OI3 A;  1QW1 A;  2EQI A;  3DB4 A;  5GAO m;  4B9W A;  1ZSZ C;  5I2S A;  1MUZ A;  1QP2 A;  2QGG A;  3UDC A;  2KY9 A;  3TCJ A;  1UHC A;  3J7A F;  1SKU B;  1NPP A;  1PSE A;  2LC4 A;  4XK8 E;  3VRZ A;  4J9I A;  2HSP A;  1K8A R;  1W2B S;  4M77 E;  2V8J A;  3PFS A;  2JZ2 A;  1MND A;  3CC2 T;  1OI1 A;  1ACM B;  2K3X A;  5KYN A;  3LWH A;  4E2F B;  4ZN3 A;  4A53 A;  1EZZ B;  3PIO A;  4VUB A;  4ESR A;  1AOJ A;  3CC2 Q;  2KRO A;  1VQ7 Q;  4II1 A;  3VYG A;  3L2Q A;  1KC8 C;  4PJO A;  5D7U A;  2E41 A;  3LGL A;  3CMA T;  3Q1J A;  5LJ3 f;  4C0D C;  2NUT A;  4J9F A;  2CGH A;  3I5R A;  5ECA A;  1M90 R;  1PHT A;  1M3B A;  2E4H A;  5KYY B;  4EMK B;  2D6F A;  3QG1 A;  3JCM W;  5IAY A;  4LUD A;  1GRI A;  2YHT A;  3EG9 A;  1VQ6 A;  4QVD A;  2LVM A;  4M77 C;  2DTI A;  4MML A;  1WIE A;  1N8R R;  2GGR A;  3JB9 G;  1WZO A;  5GJW B;  2LCS A;  4M77 B;  2OTJ A;  2EKO A;  4KBM B;  2OTL Q;  1E7O A;  3IQL A;  2LRQ A;  3NGP A;  5I22 A;  4BE2 A;  2E3I A;  1M1K C;  2FZC B;  3CCJ T;  2FYK A;  1VYT A;  5KYX B;  1ABQ A;  3TSZ A;  4AG1 C;  4M7A E;  3NTH A;  3QWY A;  1UTI A;  4J7F A;  3OYA A;  5LL6 S;  5LJ5 h;  2DER A;  2EYX A;  3TRE A;  1F1B B;  4M75 A;  1B34 A;  2Y4X A;  3HFN A;  3P8B B;  1YWP A;  4PJO D;  3QDR B;  2H3J A;  2ZPB B;  2W10 A;  1IHW A;  2DIQ A;  1NEB A;  1RAA B;  2X4X A;  1WXT A;  5GAN e;  1NPR A;  2KK4 A;  2QTV A;  3L2V A;  1SSF A;  5A2Q E;  4J9E A;  5L23 A;  3URG A;  4MDW A;  3G71 Q;  1GFC A;  1GCP A;  1TS9 A;  2DD4 A;  2DET A;  1VQ8 A;  1O9S A;  4M7A C;  2F5T X;  3S3N A;  3FJ5 A;  3CCQ Q;  1AVZ C;  3JV3 A;  5LJ5 g;  1BI2 A;  3SB2 A;  1GL5 A;  2BE9 B;  4M7A B;  4F17 A;  3ZFJ A;  4YTL A;  1J3T A;  1JEG A;  2YLB A;  4C92 D;  2KVQ G;  5J39 A;  5GAN 8;  4E7K A;  3E1S A;  1CKA A;  2J6K A;  5FW9 A;  5LJ5 d;  2LJ0 A;  1VQN T;  2Z0W A;  2CH4 W;  3V8L A;  4NL3 A;  2D0N A;  4J9B A;  1QVG A;  3QKJ A;  2K3B A;  4M75 D;  3HHT B;  1UGS B;  2NYS A;  4AT1 B;  3OYM A;  3EHQ A;  2CZ7 B;  4C8Q F;  4RTX A;  1OEB A;  2KDS A;  2R5M A;  1VQK A;  4R55 A;  3EG9 B;  2F2V A;  2EYQ A;  3UF4 A;  2LTO A;  3H0H A;  1Y07 A;  2O31 A;  2KYB A;  3A5Z B;  1FMV A;  3A1P A;  1I4K 1;  2RF0 A;  2EJG A;  1Q86 U;  2ATC B;  2L0A A;  4QW2 A;  4A63 B;  3CC7 T;  4Q5W A;  3QZ9 B;  1QVF P;  1YN8 A;  2ZPG B;  1OX9 A;  3CCS A;  3REB B;  2P0P A;  1QKW A;  4BI4 A;  4K11 A;  1UJ0 A;  3C0C A;  2DL4 A;  4A54 A;  2RK2 A;  4IUP A;  1VQ4 A;  3CCV T;  2VB6 A;  5KYU A;  2K57 A;  1B34 B;  1Z9Z A;  2LQN A;  4Y28 E;  4F16 A;  3CXC A;  4ATO A;  4ELZ C;  4HCB A;  4UC4 A;  1N6A A;  2AHJ B;  1G3S A;  3CCV Q;  1K9M U;  2JN0 A;  3OYB A;  1JXM A;  1K8A C;  2SRC A;  2DXB A;  2PU9 B;  1KHC A;  3I5S A;  1SEM A;  2NLU A;  1K4U S;  1TH7 A;  1MMD A;  2K7A A;  4J8O A;  2RB6 A;  2CUB A;  4RTV A;  1YCS B;  3JCM h;  4A4F A;  3BDU A;  2JM9 A;  3QO3 A;  1JRI A;  4A4K A;  1QVF S;  1OUL A;  1I81 A;  5HKC A;  3NPF A;  1OPL A;  4ELY C;  2QG9 B;  3ME9 A;  2JTF A;  3CD6 Q;  1M90 C;  5EC7 A;  2JJ9 A;  4QQD A;  4D8D A;  2W0Z A;  2PQW A;  1N8R C;  2RJC A;  4EPC A;  1HYO A;  3M0T A;  1TUG B;  1VQ5 A;  1ZSG A;  2E70 A;  1JXO A;  3JCM g;  1N5Z A;  3HP9 A;  3V7C A;  4A4G A;  2D1X A;  3EHR A;  3VKI A;  3MEU A;  4XTW A;  1WJQ A;  2RA2 A;  1N9R A;  1QQJ A;  4CC7 A;  1K9M R;  2KRN A;  4CC3 A;  3JCM d;  5CO7 A;  1NBE B;  1PRL C;  2HBP A;  2F5K A;  3G6E A;  2L5Q A;  4FCY A;  2RHI A;  4EMH A;  1AHJ B;  5LJ3 h;  1HJD A;  4RTT A;  4HVV A;  5KYU B;  2EYW A;  4ORZ A;  3PMT A;  5D6X A;  2VV5 A;  3LW5 E;  3MEA A;  3OYH A;  3OBW A;  3RKW A;  1Z9Q A;  2P0Q A;  4NL2 A;  3RR6 A;  3EGD A;  4HA8 A;  2V26 A;  3LYI A;  2EAY A;  2RD1 A;  2PVO B;  1YJN A;  4XTU A;  1UUE A;  1A0N B;  2GCX A;  4PFZ A;  1X27 A;  3VS7 A;  3X28 B;  2XDD A;  2RQU A;  4JPB W; 
#chains in the Genus database with same CATH homology
 2HL3 A;  1TXQ A;  1WHL A;  2CP6 A;  2MPX C;  1WHK A;  2HKN A;  2HQH A;  2M02 A;  1WHG A;  2Z0W A;  2HL5 C;  2CP3 A;  1WHJ A;  3RDV A;  3TQ7 P;  1IXD A;  2CP2 A;  4B6M A;  2QK0 A;  1LPL A;  2E3I A;  3E2U A;  1TOV A;  2CP0 A;  2E3H A;  1WHH A;  2HKQ B;  1WHM A;  2COW A;  2COY A;  2E4H A;  2COZ A;  2CP5 A;  2CP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...