2E3HA

Crystal structure of the clip-170 cap-gly domain 2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
81
Chain Sequence
ELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTVRRVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Restin
publication title Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 18
structure length 81
sequence length 90
ec nomenclature
pdb deposition date 2006-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2e3hA00
2M02A 2E4HA 1LPLA 3RDVA 1TXQA 4B6MA 1WHLA 2COWA 2HL3A 2CP2A 2HQHA 2QK0A 1WHKA 2CP5A 1WHJA 2HKNA 2CP7A 2COZA 3E2UA 1IXDA 2CP6A 2HL5C 2MPXC 3TQ7P 2CP3A 2E3IA 2HKQB 2E3HA 1WHGA 1TOVA 1WHHA 2COYA 1WHMA 2Z0WA 2CP0A
chains in the Genus database with same CATH superfamily
1VIFA 5LJ3g 3HRSA 4EMKC 4HKEA 5LJ3d 1R8OB 1YJNA 2JTEA 4XTZA 1QKWA 5D6XA 1VQ4T 2BZ8A 2KQWA 4PL6A 4KGXB 1IHWA 1VQLA 2KY9A 3QSUA 2DXTA 5DY9A 2DO3A 1PNJA 2EWNA 1KHCA 3HPWA 1WLPB 3JCMg 4BI4A 3E1SA 1ZUYA 3JCMd 2HCKA 4AFQC 1OU8A 3G6ET 2KXCA 1GFCA 2NLUA 2AKLA 2KROA 2ZPFB 5IHKA 4BY6B 4M7DA 4C0DC 4D8DA 5KYXA 4DBRA 2VASA 3EG0A 4PJOB 2CT3A 1G5VA 4KGZB 1QCOA 2HD0A 3QXEB 2F2VA 1QVPA 3A8OB 4E7SA 5GJVB 2FL7A 2KGTA 5I2SA 3CPWS 2PU9B 2RHYA 5HCKA 3A8HB 2L3QA 1D0ZA 2LDMA 4LXCA 2KEAA 2DZCA 4FIBA 5D6WA 4E7LA 2EGAA 5J39A 4YTLA 5GMKj 4Z8AA 3OW2A 4C92B 4KH0B 4A4FA 3E19A 2L89A 4KRTA 3M55A 4IIOA 2QI2A 1UJYA 1ZUKA 2CP0A 3PMTA 3QDFA 1IB8A 2FZGB 2ED1A 4ATOA 2FG0A 1M8VA 1OX9A 1ABOA 3OYGA 3CCUT 3GF5A 2RJCA 2J6KA 3QJ6A 3QWXX 3OYAA 2M0YA 1ZA2B 5GJWB 4AT1B 4HXJA 2LTOA 1H8KA 1JU5C 2J6OA 1VQPQ 2WACA 5A2QE 2L3SA 4ZTFA 3VS0A 1MV0B 2GFAA 4XK8E 4M7DB 3SD4A 4A53A 1YHQA 3QBYA 5KYWA 1S72Q 3UT1A 4XU0A 5CQXA 2HBPA 1H3HA 1FWZA 2LRQA 1VQ4A 2HBWA 2LJ0A 1V1CA 2E3IA 4ESRA 2XDDA 1UGVA 1VQ7A 2DXUA 4C5GA 3LH0A 2YHTA 2CSQA 4IIMA 4M77A 3THKA 2EJGA 1AWJA 1QWEA 4MMLA 4JZ3A 5EC7A 2LP5A 2KRSA 3I9QA 3G6EA 2D6FA 4RUGA 4C0ZA 3CC4T 2K5FA 1VA7A 1KQ1A 1OPLA 4ANJA 1CKBA 1B7TA 1NPRA 1M1FA 4BY6C 1Y57A 1M27C 4CRIA 2X51A 3GNGA 1MMGA 4PJOC 3M58A 3P8BB 3I56Q 1VQNQ 5GAOm 3EFOA 2H3EB 2AZSA 5IHNA 2IPOB 2QA4T 2QXFA 3JB9I 4M7DE 2MPXC 3TQ7P 1WJRA 4M77F 4J7IA 2YSQA 1K8AR 4HVWA 5LJ3f 1U5SA 2RM4A 2DFUA 4JZ4A 4N0AC 3I55T 4C92C 2VYTA 4RCCA 4EMHA 1M4ZA 1VQ9T 2MYSA 1BI3A 4ZGEB 4L6V5 1Q82U 4BUGA 1M8MA 4PJOD 4FW2A 2VKNA 4OMLA 4EMGA 3JCMf 1VIEA 1QQJA 1C1AA 1QP3A 3LWIA 2A7YA 2DTIA 4WCIA 1TS9A 2MCNA 2RN8A 2QAZA 3CC7A 1WHHA 2ECZA 5GAOq 4LD9K 1K0XA 1GXIE 1VQ6Q 1HK9A 3L2RA 5GANd 3CCST 3CCQQ 1BI2A 3EGUA 2BKDN 2VGMA 2RPNA 4C92D 1N9RA 4FYWB 5CKFA 3G4ST 1K73R 4M7DC 5AYFA 5J26A 3JCMV 4GBQA 3CBOA 1E7OA 2DL5A 3JB9J 4JJBA 2M0OA 2ZPIB 1SF9A 2DD5A 2CDTA 2RB6A 2R57A 2KRNA 4A54A 1W2BA 1OZ3A 4C8QA 5GMKm 3NPFA 4NL2A 2EQJA 2LNHB 5FU7B 2DL4A 4O5VA 4Z88A 1X6OA 1KQSS 2LCLA 1N6AA 2YLBA 1YITQ 1GFDA 4M7DD 3FRNA 1RAIB 3VS3A 2OX7A 1PKSA 3SHWA 4M77E 4MZPA 4B9XA 3HFOA 5M9OA 4OF1A 1LCKA 4QQGA 2LCCA 4B9WA 2XKOC 3CCEQ 2E64A 3P8DA 2RHZA 1SHFA 3EFRA 1M1GA 2QA4A 3VUZA 2QTXA 2CH4W 2Z0WA 3CCVQ 2DIQA 1HJDA 3ZEHA 2JM8A 3QHSA 3VS5A 2DLPA 2DBMA 4C8QF 4PLLA 1OU9A 1ZSZA 2DIGA 2PVOB 2LQWA 2LT1A 3CCLA 3OW2P 2EQUA 3I55A 1QVGS 1FYNA 2NYSA 4FT2A 4OB2B 3MCAB 2DPPB 3VS7A 3V8KA 4JRQA 2JW4A 4F7UA 4EIKA 1SHGA 3TCJA 1GRIA 3REBB 3X28B 1YJ9T 2WSEE 3UPUA 5KYYB 4Q5WA 1VQMQ 2MAMA 4TVRA 3L42A 2XD0A 1XQHA 2K6DA 3S3MA 2KT8A 1Q82C 3CEYA 2C0TA 2GNCA 3CCSA 2EQIA 3JCMe 1M90R 1H92A 1RADB 5CKEA 4A63B 4JDSA 2P0QA 1TSFA 3JV3A 2NUTA 3JSCA 2DE0X 2SEMA 1WXBA 4OGEA 3X25B 2K4YA 5FROA 3GIBA 4F7UF 1N8RU 2RNAA 3OSVA 4ZN1A 3L2UA 2ROTA 3E9GA 1VQ5Q 1BIAA 4CC7A 4HT9A 1OI1A 4LD6A 4IURA 3EH2A 3J7AF 3Q1JA 2IIMA 1GCQC 1NZ9A 1UGPB 3C0CA 4HVVA 3CBPA 5FU7C 5D7UA 2XG8D 2Y90A 4RTWA 4M75B 2DEQA 4E7KA 1YI2T 1JBMA 4RTUA 1D1AA 2JTMA 4GLMA 2EVRA 1P92A 1X75C 5GAMj 3PVLA 4C8QE 2L8DA 3TREA 3BY7A 4RTTA 4LUEA 1MMDA 3CC2T 3RUXA 2DJZA 4N4IA 2BE9B 5HK3A 4C0GA 1TUDA 3ER0A 4AG1C 3LWHA 1VQKT 1U1SA 1BCMA 1PSEA 2NUTB 2GQVA 1VUBA 3OBWA 4OGCA 2DKGA 1I5OB 4M7AB 2O9VA 1WDXA 2P4RA 1YJ9A 4BDZA 4ORZA 4BI3A 2A08A 2ROLA 3UA7A 4XTXA 1X01A 2EQKA 3E2UA 3CQTA 4ZN3A 2M1HA 4R0KA 4OVAA 4F7UE 2F5KA 3OB9A 4N4HA 5IH2A 3CCRA 4E7JA 4E7HA 2IG0A 4QQDA 4PFZA 4MDXA 2PVDB 1M3CA 3CPWA 2RI3A 4M77G 1BCOA 4JJCA 1VQ8T 1X6GA 2GTOA 3VS1A 4FW1A 1R0BG 3QWYA 3EGDA 1IXDA 9ATCB 2C0OA 2DM1A 2CP3A 3QPHA 2QQBA 3CPFA 1NE8A 4OB0B 2GGRA 2F5TX 2EBPA 4WF2A 2MIOA 4BE2A 1W2BP 2DMOA 1V29B 3UDCA 1N8RC 2K5IA 1IGUA 4AMCA 3OYHA 2QK0A 2XU8A 5GAN3 3AT1B 2COZA 3CMET 1WJQA 3M0SA 3EFSA 3VS4A 1KFZA 1WX6A 2D1XA 1YI2A 4OMPA 4RG2A 4MMKA 1YJWQ 1OPKA 4LN2A 3RKYA 3SB2A 4M75C 1TU0B 1PCXA 2YDLA 3NMZC 3CC2A 5GAMf 2GCXA 3DB4A 1KIKA 4PJLA 3X26B 4IUUA 4J8OA 5CKHA 3X24B 2CZ7B 2FZKB 2AKKA 1VQKA 2GBQA 3ULRB 5GANe 4PJOA 2NUPB 3H0FA 4J6XA 3NHNA 5LJ5j 2HSEB 3EGDB 4M75D 4DOWA 3KUFA 4XTYA 3JRZA 1T0HA 1QWFA 4A4EA 4M7AC 1VQOQ 4LUDA 1XNIA 2XDPA 4FYXB 2QQRA 3FEOA 4NS5A 1M5Q1 1Y96A 1W4SA 3VRYA 4BDYA 5CAIA 1WHGA 2LQ8A 4N0AA 3PIOA 5A0LA 1YHQT 1UFFA 3EH1A 1AT1B 2QQAA 1PKTA 2LQKA 4AFUC 3GNFB 1ACMB 1H3ZA 3HFNA 5IXFA 1VQ7T 3LGLA 3QYGB 4PJOF 1VQ8A 4J6WA 4J9GA 3JCMh 1I8FA 4M7AD 4C8QG 2E5KA 1GBQA 2O9SA 1QVFA 2LNVA 4EDUA 2X3WD 4OMMA 1QP2A 5C0MA 4XQ3A 3LX7A 2DEUA 2FEIA 1VYTA 3LH5A 4UC4A 3A98A 5FWBA 3SEMA 3PMIA 2DL3A 4BI8B 1UGSB 2P0KA 4ELZC 4D6WA 2DYBA 1JEGA 4KGVB 4E47A 3RESA 3J81E 1OOTA 2CSIA 4C92F 3R6NA 4C0FA 1G3WA 3CMEA 4BE0A 1WZOA 3CCMQ 1I07A 1OX8A 2M02A 1MNEA 1JJ2A 5FLXE 1X27A 4HCKA 3H8ZA 4BD3A 3DLMA 1Y96B 1YIJQ 5GAOr 3M9QA 1JXOA 2MMPA 2CZ6B 2E3HA 4LDXA 4FCYA 3HTRA 4XU2A 2VUBA 4F7UG 2DRKA 2CZ1B 2QG9B 2CREA 3J80E 2E4HA 4M7DF 5C6SA 2I0NA 3VKIA 2ZAEA 1AWWA 3CCJQ 2HL3A 2X4WA 4DEXA 3CCUQ 2ENMA 3KXTA 4Z89A 2JN0A 3CC7T 4PLIA 3V7SA 1J3TA 1BBZA 3OYYA 1AVZC 3PNWC 3OS2A 1SSHA 2K3BA 4JJNK 3PIPA 4PJOE 1BYMA 2X9HA 2QEXQ 1SG5A 1PC0A 2RI5A 4M78B 2XDBA 1PSFA 2EYQA 5GAN2 3OYCA 4E2FB 2O01E 3I35A 1XTDA 1VQPT 3ASKA 4AFSC 2HEQA 4E6RA 3CPWP 1U1TA 4FL6A 2EPDA 3M4YA 4C92E 2CUBA 1M2OA 4HCCA 5KE3A 2VXFA 1YWOA 1S72T 3ZL7C 3C4SA 2OTLQ 4M4ZA 2XICA 3OYDA 1QVGA 2HDAA 1ZBJA 4N4GA 3HSBA 3CMAQ 3CC4Q 2P4TA 3L2ZA 1E6HA 4RTXA 1AWOA 2AK5A 1R77A 4A4GA 5KE2A 3BFMA 2RJFA 2ZPBB 1UHFA 2DL8A 3QYHB 2ZZDA 1HD3A 4JRIA 3OBYA 5GAN4 3JB9D 3RERA 2JT4A 1YN8A 3M0RA 1GCQA 5I2MA 5CKDA 3OYJA 2IVWA 2J7IA 1ABQA 1Z9QA 4J9IA 3CCLT 2JUFA 3RR6A 4QQ6A 3I56T 1VQNT 2QASA 1VQ9Q 1Q82R 4FU6A 3PFSA 2LJ1A 4LE9A 1U8RA 1QLYA 3TVTA 1PRLC 5CVIA 2FRWA 1NYGA 1OEBA 5GANh 2W0ZA 2M51A 2FPEA 5KCOA 3M53A 2EKOA 2EYXA 2JMAA 4XTWA 5CK9A 2HQXA 1Q7YR 3UATA 1G8XA 3JCMb 1Q7YU 3RMSA 3BE3A 1FXXA 4J7FA 2YT6A 2KYMA 2DVJA 3A8LB 2J05A 4M78C 2JXBA 3CXCA 1VQ6T 1VQPA 1NLPC 1UECA 2GF7A 3EGXB 5KYYA 3CCQT 3FLGA 3HRTA 3OW2S 2XMFA 2ESWA 2EJ9A 3QDRB 3EG9B 1S72A 2VXEA 1QVFP 2MI6A 1NEGA 3AHUA 2JZ2A 4IUTA 2RQRA 1G2BA 5GMKi 3URGA 3MEAA 1FMWA 3V8LA 3HRUA 2F2XA 1B3QA 2MK5A 1K76A 4M78D 3GLXA 2A28A 2DETA 2CP2A 2EGEA 1GBRA 1FX7A 2YUNA 5FRNA 2I2LA 3RIRA 3VV0A 2E1HA 1JJ2P 1RI0A 4FSSA 4ME7A 4OB1B 4C5IA 1Y71A 5GAN6 1T3SA 3V7CA 2KMTA 4DBFA 3OYFA 1UEBA 3EHRA 4XTUA 4PJOG 2CKKA 1ZSGA 1K4US 1AEYA 3OMGA 4IUQA 2BUDA 2HKNA 3I56A 2OJ2A 2KXDA 1VQNA 2GTJA 1NYFA 3QZ5B 2DX1A 4KT0E 4M75A 3VYGA 2RQWA 1WYXA 1I5LA 5LJ3e 2EGCA 3CCVT 1G3SA 3HKSA 2MWOA 1KHIA 4C92G 5GMKe 5IHIA 1PWTA 3JAME 5GAOn 2BE7D 2JM9A 5AT1B 3OSSC 1AZEA 1QCNA 5GAMg 5GAN7 3QO3A 5GAMd 3CCRT 3O8VA 1M3AA 1OYXA 1VYVA 3NFCA 2GQIA 1IHVA 4X9CA 1SKUB 3PT9A 1UUEA 3QG1A 2LJ3A 2OTJQ 1HSQA 2F2WA 4M7AA 2MOXA 4ELYC 1HXDA 1N8RR 3MP6A 1VQ6A 3CD6Q 4M75F 2DXCA 1Q7YC 2P0PA 3CCQA 5I22A 2RQUA 4QT7A 2EYYA 2KBTA 3N5BB 4M7DG 3O5ZA 6AT1B 2KAFA 1AWXA 2M16A 2PUKB 1IRXA 3BW1A 4JLIA 3M5AA 3RKWA 2L2PA 2RK2A 1D3BB 4GLKA 4DBHA 1BK2A 1M9SA 4ZGJB 3RMQA 1QVGP 1UHCA 3FJPA 4JLGA 3JCMW 1IO6A 1WHKA 1U06A 3EG1A 1KK7A 3FIFA 5IXBA 2VGNA 2YUOA 1PD1A 3G71Q 2ZPGB 1LOJA 2KDSA 4M7AF 2COYA 4DBQA 1OV3A 4FM4B 4AG2C 1Y0MA 2A3LA 1KC8R 1YITA 2LVMA 3UF4A 3OA6A 1UJ0A 1NJIC 1V76A 1KC8U 3T9NA 4KULA 2J06A 4J6YA 4OB3B 2C06A 3OYBA 2GFUA 2VC8A 3UA6A 3CCEA 3I5SA 1EX4A 3JCMJ 1TOVA 5KYNA 4RMOA 2KNBB 3FC3A 2K2MA 2A37A 3OYNA 3M0PA 3GPLA 2DILA 4J9HA 1W2BS 1YCSB 1NG2A 5IT9E 2E41A 3CCVA 5KYUA 2JS2A 2RF0A 1I1JA 1BU1A 4RTZA 5IN1A 2V8KA 1Y07A 1NLOC 3H9NA 3TSZA 1X2QA 2KK4A 3OYKA 4M75E 1SSFA 4QVZA 1YJNQ 1UG1A 4JRPA 1YFNA 2PUOB 1MV3A 2O4XB 1VQMA 1PM3A 1B34A 2C0IA 5EG2A 2NUPA 3G1JA 1VQLQ 3M57A 1ZUUA 3EHQA 1K0SA 8ATCB 2NWMA 2XHCA 2PZ1A 3S3NA 4DOVA 4NL3A 1X69A 4K11A 3CXCP 3GP8A 1JRIA 4X1VA 3G7ZA 5LJ5g 1RL2A 2B8AA 5LJ5d 1IGQA 2FVUA 1CKAA 5I21A 3WXMB 1G83A 2DL7A 4M7AE 1NPPA 2QQSA 1WQWA 1E6GA 5GAN5 4CC3A 3M56A 4JS5A 1MGQA 1WQ7A 2VVKA 1VQ5A 1I4K1 4QKUA 2DAQA 2DVEA 5KYUB 2JJ9A 1K9MR 3IQLA 2YRDA 1K9MU 1BKBA 2K2VA 2LX7A 5CIUA 2CP5A 2AIRB 2CP7A 3LGFA 1U3OA 2K3YA 1N9SA 1YJWT 2AZVA 2L0AA 4WTOB 2RHUA 1B34B 4LDWA 2X4YA 5DM7R 4XTVA 4FYVB 5KH6A 1KC8C 1Q81U 2KT1A 4V2SA 4PJJA 1PRMC 1M3BA 3MKDA 5GAN8 5HKCA 1OULA 2LX9A 3JCMQ 4ZNXA 3JB9F 3A1PA 2E6ZA 2O2OA 3U23A 2RMOA 5LJ3h 1YHQQ 2D9TA 1YBYA 4Z02A 2DTOA 3NTHA 4ZTJA 1M2VA 1X43A 5CQYA 1VQ4Q 2V1QA 1ZX6A 5GMKh 3H0HA 1O9SA 1AOJA 3M0UA 1VQOT 1M30A 3OYMA 2DK3A 2K9GA 1YCYA 5CCAA 3OS1A 1KG1A 1RAGB 1N5ZA 2WSFE 3GOXA 3INZA 4JJDA 1LVKA 2X4JA 2E6NA 3DB3A 1ARKA 1WXUA 2K5LA 3G6EQ 2JNGA 1KJWA 5GAOp 2ATCB 4QVDA 2CH4A 2YRCA 3C94A 4BE1A 2R58A 3ME9A 4F16A 4PJNA 4L59A 2K79A 1RAAB 2D8HA 1KD1C 1ZLMA 2WSCE 1MUZA 1YP5A 2PTKA 1A0NB 4M78A 1EZZB 1RLQC 2YUPA 2JS0A 4XAXB 1ZHIA 3JB9H 1JO8A 3WVEB 5D6YA 2RJEA 1EFNA 4B6MA 1OZ2A 4OMNA 3MP8A 2FO0A 3EG3A 1T0JA 2EJFA 2EFIA 3S3OA 5LL6S 3C12A 2VV5A 4J9EA 2JTFA 4PJMA 1M2VB 1WNLA 3CCMT 2FB7A 4M75G 3GBQA 1YJWA 1K9MC 5LJ3j 1LPLA 3M59A 1WPYA 1AHJB 5GAMe 4EPCA 3LYIA 2FZCB 1YIJT 2FPFA 4M78F 2KI7A 3LW5E 2D0NA 3CC7Q 4OP0A 3H0IA 3VS2A 2G3RA 1YNZA 2RA2A 2ZCFB 2YWWA 1JQQA 2A0FB 5LJ5f 3D7SB 3OYLA 1KQSA 1Q81C 1B07A 1WA7A 2KYBA 1K9AA 1NEBA 4RTVA 4QW2A 3MEUA 1Z9ZA 1O75A 2KR3A 1M1KC 2RHIA 3CCJT 2L3PA 5HK0A 2RQVA 4M7AG 2MF2A 3LLRA 5HY6A 4F17A 2YRVA 3MHXA 3DKMA 1VQOA 4MZMA 3MP1A 4JS4A 3EG2A 4L5GA 3V8JA 4FSXA 4Y92A 1Q86R 2E70A 3NGPA 2JMCA 3A5ZB 3OQ5A 4RTYA 2RHXA 2V1RA 4X34A 1Q86U 5KYXB 3WVDB 2BZYA 1LNXA 1T3LA 2QEXT 2CGHA 4JPBW 4J83A 4KBMB 2CUDA 1TG0A 3MEWA 2KRMA 2LT4A 4PFPA 3QKJA 2PVGB 2R5AA 2X35A 4CI0C 3VYHB 3L1AA 3OYEA 3VUBA 2PQWA 2EYZA 1RAHB 1AD5A 3CBMA 3M0TA 4DA4A 4JRKA 5L8RE 2J6FA 2F69A 2W10A 2OTLT 4DQ2A 2BZXA 3M0QA 2QGGA 3EGXA 2QA4Q 1WFWA 1UTIA 3CMAT 3V7RA 3MO8A 4LDUA 5IAYA 3EG9A 4M78E 2JVVA 1PG5B 3QJYA 1R0CB 3CCLQ 2OAWA 3I55Q 3CCMA 2L5QA 3M4GA 1S1NA 4X9DA 5DLOA 3QUIA 1WHJA 1C0MA 2HQEA 2HL5C 2RH2A 1QVFS 2X4XA 1YIJA 1D0YA 5J3BA 2EAYA 4HA8A 2Y4XA 1N27A 1WXTA 1XOVA 1K8AU 5KYWB 2YXYA 3MPUB 4JUVA 2K3XA 4XU3A 5DLQE 4A4KA 3CCSQ 2R5MA 2VWFA 1QCFA 1TUGB 3CCJA 3E9FA 4M77B 1VOMA 2G6FX 1BIBA 3G4SQ 4PFOA 3CCUA 1TWBA 3OS5A 1JJ2S 5LJ5e 1UB4A 1MMNA 5GANg 3OS0A 3PVQA 4E7IA 2ZGWA 4J9FA 1PHTA 4D8KA 1W70A 3REAB 2LC4A 1Y7XA 2QEXA 2LZ6B 1I0CA 4R56A 2HKQB 1JB0E 1VYUA 1DJ7B 1K73U 3TSWA 1Q86C 5A0DA 2AT1B 3EFOB 1WGSA 3JB9G 2KSSA 3FB9A 3JCMc 1TTHB 4KUIA 1NJIR 1G3TA 1RABB 1QW1A 3SDZA 5KCHA 2O88A 2H3JA 1YWPA 1NJIU 2CZ0B 2RK1A 2E65A 1C6VX 4FYYB 2OTLA 3L2VA 2HMAA 3P8HA 2YUQA 4J9BA 4Y28E 3F70A 3S6WA 4MZTA 1YITT 3CMAA 3CC4A 1BI0A 1G3YA 5FW9A 5GANj 4VUBA 3META 3RNJA 1GL5A 4RKUE 1X6BA 4DEYA 2AHJB 3H6ZA 3FJ5A 3CCET 1D3BA 2HAXA 2XK0A 3RBBB 2QDLA 5CR2A 1YJ9Q 2ED0A 1MMAA 2D8JA 1NBEB 2Y4YA 4II1A 4A4HA 3OYIA 3BDUA 4IUPA 5GAMh 2DD4A 3JCMX 1VQ9A 1TH7A 3A8MB 1KQSP 4LDVA 3CCRQ 1K8AC 3L2QA 4HT8A 1GCPA 1OQKA 3KFVA 5I11A 1F1BB 2QDYB 1VQMT 2OAUA 2FRYA 3SWNA 4C8QB 3L2WA 3VS6A 1IREB 4M77C 3OY9A 1ZBXA 2E5QA 1WHLA 1FMVA 2HQHA 3JCMP 1AZGB 2D0QB 2P84A 4F14A 2O31A 2CP6A 2DXBA 4FT4A 5GAOl 1SRMA 3HP9A 2EQMA 1M90U 1QKXA 5L23A 3C95A 1CSKA 3NTIA 2XI9A 1HYOA 3G4SA 4AFZC 3SFMA 1D0XA 4M78G 2A36A 3PGGA 2OTJT 2HZYA 5FU6B 3CD6T 1YI2Q 2O4XA 4M77D 1QMCA 3KBGA 1VQ5T 3BDLA 1K73C 1H641 4CC4B 4PKCC 2LQNA 4EMKA 2K57A 3QIIA 2K7AA 1ZSZB 1W1FA 2DJQA 2EYWA 1K1ZA 4RG8A 1Q95G 3CC2Q 4KUDK 3FDRA 3MEVA 1EIFA 2RJDA 4F7UB 2ABLA 2LCSA 1UDLA 2FHDA 1VQKQ 4J5YA 4ZGDB 4CC2A 2L3RA 2KVQG 2LMJA 2XIDA 3G71T 5GANf 3TEEA 1RUWA 3SWNB 3CXCS 2DRMA 1FMKA 2H8HA 4LDYA 4PNOA 1LJOA 1BI1A 4GY5A 4F04B 7AT1B 3QZ9B 5A0GA 2DBKA 4BB7A 1WJSA 2V26A 3NTKA 4HCZA 2EKHA 3ZBDA 2M9UA 2CS7A 4LNPA 5GMKl 5FWCA 3MJXA 2CYZB 4KH1B 1D09B 2F1LA 1MHNA 1UE9A 1ZA1B 2JOYA 5ECAA 1VQ8Q 1KSWA 3HHTB 3VRZA 4QVCA 3I5RA 2SRCA 4EMKB 4E7ZA 4XU1A 1KD1R 2BIVA 4C8QC 1KD1U 1D1BA 2QYZA 5LJ5h 1YJNT 4J9DA 4HCBA 2DF6A 4BACA 4PK4A 3PTAA 1TXQA 1VQLT 2E12A 4OMQA 3OMCA 4IKFA 1W6XA 2KE9A 2OI3A 2OTJA 3CMEQ 4NOYA 8AT1B 1M90C 3CD6A 2QTVA 2QGFB 1JXMA 2V8JA 1UGQB 2QQ9A 4C0DB 5FU6C 3HL8A 3R6OA 4HVUA 2CT4A 2ZPEB 4C8QD 1NM7A 4J9CA 4RCBA 4MDWA 2HNIA 3A8GB 1ZSZC 1WIEA 3UWNA 1IZ6A 2FYKA 3TU4K 1SPKA 2NUZA 2RO0A 2ZPHB 4R55A 1RAEB 2V8IA 3RKXA 1SRLA 3G71A 1Q81R 1I81A 3H41A 4P5NA 4OMOA 2MWPA 1TUCA 3RDVA 1WI7A 4OMFB 4Y91A 4C5HA 1M1KR 1RAFB 3VJPA 2COWA 2RD1A 3SWNC 1M1KU 2DNUA 2E10A 1SEMA 3ZFJA 2DERA 1D1CA 4O6JA 2RI2A 3X20B 2DTHA 5CO7A 1RI9A 2YLCA 2EW3A 1PD0A 3PE0A 3DLLA 2DYIA 2X3XD 3M54A 5FRMA 5CKBA 1ZQ1A 2VB6A 4IUVA 2B86A 1KQ2A 1X2KA 2RQTA 4C5EA 1XJWB 2BTTA 1VQ7Q 1RACB 2FPDA 2DA9A 1UGRB 2DZ9A 2EIFA 3EAEA 3VU3C 2HSPA 1RLPC 1BB9A 4C92A 1WHMA 2PNIA 1MNDA
chains in the Genus database with same CATH topology
2M02A 2E4HA 1LPLA 3RDVA 1TXQA 4B6MA 1WHLA 2COWA 2HL3A 2CP2A 2HQHA 2QK0A 1WHKA 2CP5A 1WHJA 2HKNA 2CP7A 2COZA 3E2UA 1IXDA 2CP6A 2HL5C 2MPXC 3TQ7P 2CP3A 2E3IA 2HKQB 2E3HA 1WHGA 1TOVA 1WHHA 2COYA 1WHMA 2Z0WA 2CP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M02 A;  2E4H A;  1LPL A;  3RDV A;  1TXQ A;  4B6M A;  1WHL A;  2COW A;  2HL3 A;  2CP2 A;  2HQH A;  2QK0 A;  1WHK A;  2CP5 A;  1WHJ A;  2HKN A;  2CP7 A;  2COZ A;  3E2U A;  1IXD A;  2CP6 A;  2HL5 C;  2MPX C;  3TQ7 P;  2CP3 A;  2E3I A;  2HKQ B;  2E3H A;  1WHG A;  1TOV A;  1WHH A;  2COY A;  1WHM A;  2Z0W A;  2CP0 A; 
#chains in the Genus database with same CATH topology
 1VIF A;  5LJ3 g;  3HRS A;  4EMK C;  4HKE A;  5LJ3 d;  1R8O B;  1YJN A;  2JTE A;  4XTZ A;  1QKW A;  5D6X A;  1VQ4 T;  2BZ8 A;  2KQW A;  4PL6 A;  4KGX B;  1IHW A;  1VQL A;  2KY9 A;  3QSU A;  2DXT A;  5DY9 A;  2DO3 A;  1PNJ A;  2EWN A;  1KHC A;  3HPW A;  1WLP B;  3JCM g;  4BI4 A;  3E1S A;  1ZUY A;  3JCM d;  2HCK A;  4AFQ C;  1OU8 A;  3G6E T;  2KXC A;  1GFC A;  2NLU A;  2AKL A;  2KRO A;  2ZPF B;  5IHK A;  4BY6 B;  4M7D A;  4C0D C;  4D8D A;  5KYX A;  4DBR A;  2VAS A;  3EG0 A;  4PJO B;  2CT3 A;  1G5V A;  4KGZ B;  1QCO A;  2HD0 A;  3QXE B;  2F2V A;  1QVP A;  3A8O B;  4E7S A;  5GJV B;  2FL7 A;  2KGT A;  5I2S A;  3CPW S;  2PU9 B;  2RHY A;  5HCK A;  3A8H B;  2L3Q A;  1D0Z A;  2LDM A;  4LXC A;  2KEA A;  2DZC A;  4FIB A;  5D6W A;  4E7L A;  2EGA A;  5J39 A;  4YTL A;  5GMK j;  4Z8A A;  3OW2 A;  4C92 B;  4KH0 B;  4A4F A;  3E19 A;  2L89 A;  4KRT A;  3M55 A;  4IIO A;  2QI2 A;  1UJY A;  1ZUK A;  2CP0 A;  3PMT A;  3QDF A;  1IB8 A;  2FZG B;  2ED1 A;  4ATO A;  2FG0 A;  1M8V A;  1OX9 A;  1ABO A;  3OYG A;  3CCU T;  3GF5 A;  2RJC A;  2J6K A;  3QJ6 A;  3QWX X;  3OYA A;  2M0Y A;  1ZA2 B;  5GJW B;  4AT1 B;  4HXJ A;  2LTO A;  1H8K A;  1JU5 C;  2J6O A;  1VQP Q;  2WAC A;  5A2Q E;  2L3S A;  4ZTF A;  3VS0 A;  1MV0 B;  2GFA A;  4XK8 E;  4M7D B;  3SD4 A;  4A53 A;  1YHQ A;  3QBY A;  5KYW A;  1S72 Q;  3UT1 A;  4XU0 A;  5CQX A;  2HBP A;  1H3H A;  1FWZ A;  2LRQ A;  1VQ4 A;  2HBW A;  2LJ0 A;  1V1C A;  2E3I A;  4ESR A;  2XDD A;  1UGV A;  1VQ7 A;  2DXU A;  4C5G A;  3LH0 A;  2YHT A;  2CSQ A;  4IIM A;  4M77 A;  3THK A;  2EJG A;  1AWJ A;  1QWE A;  4MML A;  4JZ3 A;  5EC7 A;  2LP5 A;  2KRS A;  3I9Q A;  3G6E A;  2D6F A;  4RUG A;  4C0Z A;  3CC4 T;  2K5F A;  1VA7 A;  1KQ1 A;  1OPL A;  4ANJ A;  1CKB A;  1B7T A;  1NPR A;  1M1F A;  4BY6 C;  1Y57 A;  1M27 C;  4CRI A;  2X51 A;  3GNG A;  1MMG A;  4PJO C;  3M58 A;  3P8B B;  3I56 Q;  1VQN Q;  5GAO m;  3EFO A;  2H3E B;  2AZS A;  5IHN A;  2IPO B;  2QA4 T;  2QXF A;  3JB9 I;  4M7D E;  2MPX C;  3TQ7 P;  1WJR A;  4M77 F;  4J7I A;  2YSQ A;  1K8A R;  4HVW A;  5LJ3 f;  1U5S A;  2RM4 A;  2DFU A;  4JZ4 A;  4N0A C;  3I55 T;  4C92 C;  2VYT A;  4RCC A;  4EMH A;  1M4Z A;  1VQ9 T;  2MYS A;  1BI3 A;  4ZGE B;  4L6V 5;  1Q82 U;  4BUG A;  1M8M A;  4PJO D;  4FW2 A;  2VKN A;  4OML A;  4EMG A;  3JCM f;  1VIE A;  1QQJ A;  1C1A A;  1QP3 A;  3LWI A;  2A7Y A;  2DTI A;  4WCI A;  1TS9 A;  2MCN A;  2RN8 A;  2QAZ A;  3CC7 A;  1WHH A;  2ECZ A;  5GAO q;  4LD9 K;  1K0X A;  1GXI E;  1VQ6 Q;  1HK9 A;  3L2R A;  5GAN d;  3CCS T;  3CCQ Q;  1BI2 A;  3EGU A;  2BKD N;  2VGM A;  2RPN A;  4C92 D;  1N9R A;  4FYW B;  5CKF A;  3G4S T;  1K73 R;  4M7D C;  5AYF A;  5J26 A;  3JCM V;  4GBQ A;  3CBO A;  1E7O A;  2DL5 A;  3JB9 J;  4JJB A;  2M0O A;  2ZPI B;  1SF9 A;  2DD5 A;  2CDT A;  2RB6 A;  2R57 A;  2KRN A;  4A54 A;  1W2B A;  1OZ3 A;  4C8Q A;  5GMK m;  3NPF A;  4NL2 A;  2EQJ A;  2LNH B;  5FU7 B;  2DL4 A;  4O5V A;  4Z88 A;  1X6O A;  1KQS S;  2LCL A;  1N6A A;  2YLB A;  1YIT Q;  1GFD A;  4M7D D;  3FRN A;  1RAI B;  3VS3 A;  2OX7 A;  1PKS A;  3SHW A;  4M77 E;  4MZP A;  4B9X A;  3HFO A;  5M9O A;  4OF1 A;  1LCK A;  4QQG A;  2LCC A;  4B9W A;  2XKO C;  3CCE Q;  2E64 A;  3P8D A;  2RHZ A;  1SHF A;  3EFR A;  1M1G A;  2QA4 A;  3VUZ A;  2QTX A;  2CH4 W;  2Z0W A;  3CCV Q;  2DIQ A;  1HJD A;  3ZEH A;  2JM8 A;  3QHS A;  3VS5 A;  2DLP A;  2DBM A;  4C8Q F;  4PLL A;  1OU9 A;  1ZSZ A;  2DIG A;  2PVO B;  2LQW A;  2LT1 A;  3CCL A;  3OW2 P;  2EQU A;  3I55 A;  1QVG S;  1FYN A;  2NYS A;  4FT2 A;  4OB2 B;  3MCA B;  2DPP B;  3VS7 A;  3V8K A;  4JRQ A;  2JW4 A;  4F7U A;  4EIK A;  1SHG A;  3TCJ A;  1GRI A;  3REB B;  3X28 B;  1YJ9 T;  2WSE E;  3UPU A;  5KYY B;  4Q5W A;  1VQM Q;  2MAM A;  4TVR A;  3L42 A;  2XD0 A;  1XQH A;  2K6D A;  3S3M A;  2KT8 A;  1Q82 C;  3CEY A;  2C0T A;  2GNC A;  3CCS A;  2EQI A;  3JCM e;  1M90 R;  1H92 A;  1RAD B;  5CKE A;  4A63 B;  4JDS A;  2P0Q A;  1TSF A;  3JV3 A;  2NUT A;  3JSC A;  2DE0 X;  2SEM A;  1WXB A;  4OGE A;  3X25 B;  2K4Y A;  5FRO A;  3GIB A;  4F7U F;  1N8R U;  2RNA A;  3OSV A;  4ZN1 A;  3L2U A;  2ROT A;  3E9G A;  1VQ5 Q;  1BIA A;  4CC7 A;  4HT9 A;  1OI1 A;  4LD6 A;  4IUR A;  3EH2 A;  3J7A F;  3Q1J A;  2IIM A;  1GCQ C;  1NZ9 A;  1UGP B;  3C0C A;  4HVV A;  3CBP A;  5FU7 C;  5D7U A;  2XG8 D;  2Y90 A;  4RTW A;  4M75 B;  2DEQ A;  4E7K A;  1YI2 T;  1JBM A;  4RTU A;  1D1A A;  2JTM A;  4GLM A;  2EVR A;  1P92 A;  1X75 C;  5GAM j;  3PVL A;  4C8Q E;  2L8D A;  3TRE A;  3BY7 A;  4RTT A;  4LUE A;  1MMD A;  3CC2 T;  3RUX A;  2DJZ A;  4N4I A;  2BE9 B;  5HK3 A;  4C0G A;  1TUD A;  3ER0 A;  4AG1 C;  3LWH A;  1VQK T;  1U1S A;  1BCM A;  1PSE A;  2NUT B;  2GQV A;  1VUB A;  3OBW A;  4OGC A;  2DKG A;  1I5O B;  4M7A B;  2O9V A;  1WDX A;  2P4R A;  1YJ9 A;  4BDZ A;  4ORZ A;  4BI3 A;  2A08 A;  2ROL A;  3UA7 A;  4XTX A;  1X01 A;  2EQK A;  3E2U A;  3CQT A;  4ZN3 A;  2M1H A;  4R0K A;  4OVA A;  4F7U E;  2F5K A;  3OB9 A;  4N4H A;  5IH2 A;  3CCR A;  4E7J A;  4E7H A;  2IG0 A;  4QQD A;  4PFZ A;  4MDX A;  2PVD B;  1M3C A;  3CPW A;  2RI3 A;  4M77 G;  1BCO A;  4JJC A;  1VQ8 T;  1X6G A;  2GTO A;  3VS1 A;  4FW1 A;  1R0B G;  3QWY A;  3EGD A;  1IXD A;  9ATC B;  2C0O A;  2DM1 A;  2CP3 A;  3QPH A;  2QQB A;  3CPF A;  1NE8 A;  4OB0 B;  2GGR A;  2F5T X;  2EBP A;  4WF2 A;  2MIO A;  4BE2 A;  1W2B P;  2DMO A;  1V29 B;  3UDC A;  1N8R C;  2K5I A;  1IGU A;  4AMC A;  3OYH A;  2QK0 A;  2XU8 A;  5GAN 3;  3AT1 B;  2COZ A;  3CME T;  1WJQ A;  3M0S A;  3EFS A;  3VS4 A;  1KFZ A;  1WX6 A;  2D1X A;  1YI2 A;  4OMP A;  4RG2 A;  4MMK A;  1YJW Q;  1OPK A;  4LN2 A;  3RKY A;  3SB2 A;  4M75 C;  1TU0 B;  1PCX A;  2YDL A;  3NMZ C;  3CC2 A;  5GAM f;  2GCX A;  3DB4 A;  1KIK A;  4PJL A;  3X26 B;  4IUU A;  4J8O A;  5CKH A;  3X24 B;  2CZ7 B;  2FZK B;  2AKK A;  1VQK A;  2GBQ A;  3ULR B;  5GAN e;  4PJO A;  2NUP B;  3H0F A;  4J6X A;  3NHN A;  5LJ5 j;  2HSE B;  3EGD B;  4M75 D;  4DOW A;  3KUF A;  4XTY A;  3JRZ A;  1T0H A;  1QWF A;  4A4E A;  4M7A C;  1VQO Q;  4LUD A;  1XNI A;  2XDP A;  4FYX B;  2QQR A;  3FEO A;  4NS5 A;  1M5Q 1;  1Y96 A;  1W4S A;  3VRY A;  4BDY A;  5CAI A;  1WHG A;  2LQ8 A;  4N0A A;  3PIO A;  5A0L A;  1YHQ T;  1UFF A;  3EH1 A;  1AT1 B;  2QQA A;  1PKT A;  2LQK A;  4AFU C;  3GNF B;  1ACM B;  1H3Z A;  3HFN A;  5IXF A;  1VQ7 T;  3LGL A;  3QYG B;  4PJO F;  1VQ8 A;  4J6W A;  4J9G A;  3JCM h;  1I8F A;  4M7A D;  4C8Q G;  2E5K A;  1GBQ A;  2O9S A;  1QVF A;  2LNV A;  4EDU A;  2X3W D;  4OMM A;  1QP2 A;  5C0M A;  4XQ3 A;  3LX7 A;  2DEU A;  2FEI A;  1VYT A;  3LH5 A;  4UC4 A;  3A98 A;  5FWB A;  3SEM A;  3PMI A;  2DL3 A;  4BI8 B;  1UGS B;  2P0K A;  4ELZ C;  4D6W A;  2DYB A;  1JEG A;  4KGV B;  4E47 A;  3RES A;  3J81 E;  1OOT A;  2CSI A;  4C92 F;  3R6N A;  4C0F A;  1G3W A;  3CME A;  4BE0 A;  1WZO A;  3CCM Q;  1I07 A;  1OX8 A;  2M02 A;  1MNE A;  1JJ2 A;  5FLX E;  1X27 A;  4HCK A;  3H8Z A;  4BD3 A;  3DLM A;  1Y96 B;  1YIJ Q;  5GAO r;  3M9Q A;  1JXO A;  2MMP A;  2CZ6 B;  2E3H A;  4LDX A;  4FCY A;  3HTR A;  4XU2 A;  2VUB A;  4F7U G;  2DRK A;  2CZ1 B;  2QG9 B;  2CRE A;  3J80 E;  2E4H A;  4M7D F;  5C6S A;  2I0N A;  3VKI A;  2ZAE A;  1AWW A;  3CCJ Q;  2HL3 A;  2X4W A;  4DEX A;  3CCU Q;  2ENM A;  3KXT A;  4Z89 A;  2JN0 A;  3CC7 T;  4PLI A;  3V7S A;  1J3T A;  1BBZ A;  3OYY A;  1AVZ C;  3PNW C;  3OS2 A;  1SSH A;  2K3B A;  4JJN K;  3PIP A;  4PJO E;  1BYM A;  2X9H A;  2QEX Q;  1SG5 A;  1PC0 A;  2RI5 A;  4M78 B;  2XDB A;  1PSF A;  2EYQ A;  5GAN 2;  3OYC A;  4E2F B;  2O01 E;  3I35 A;  1XTD A;  1VQP T;  3ASK A;  4AFS C;  2HEQ A;  4E6R A;  3CPW P;  1U1T A;  4FL6 A;  2EPD A;  3M4Y A;  4C92 E;  2CUB A;  1M2O A;  4HCC A;  5KE3 A;  2VXF A;  1YWO A;  1S72 T;  3ZL7 C;  3C4S A;  2OTL Q;  4M4Z A;  2XIC A;  3OYD A;  1QVG A;  2HDA A;  1ZBJ A;  4N4G A;  3HSB A;  3CMA Q;  3CC4 Q;  2P4T A;  3L2Z A;  1E6H A;  4RTX A;  1AWO A;  2AK5 A;  1R77 A;  4A4G A;  5KE2 A;  3BFM A;  2RJF A;  2ZPB B;  1UHF A;  2DL8 A;  3QYH B;  2ZZD A;  1HD3 A;  4JRI A;  3OBY A;  5GAN 4;  3JB9 D;  3RER A;  2JT4 A;  1YN8 A;  3M0R A;  1GCQ A;  5I2M A;  5CKD A;  3OYJ A;  2IVW A;  2J7I A;  1ABQ A;  1Z9Q A;  4J9I A;  3CCL T;  2JUF A;  3RR6 A;  4QQ6 A;  3I56 T;  1VQN T;  2QAS A;  1VQ9 Q;  1Q82 R;  4FU6 A;  3PFS A;  2LJ1 A;  4LE9 A;  1U8R A;  1QLY A;  3TVT A;  1PRL C;  5CVI A;  2FRW A;  1NYG A;  1OEB A;  5GAN h;  2W0Z A;  2M51 A;  2FPE A;  5KCO A;  3M53 A;  2EKO A;  2EYX A;  2JMA A;  4XTW A;  5CK9 A;  2HQX A;  1Q7Y R;  3UAT A;  1G8X A;  3JCM b;  1Q7Y U;  3RMS A;  3BE3 A;  1FXX A;  4J7F A;  2YT6 A;  2KYM A;  2DVJ A;  3A8L B;  2J05 A;  4M78 C;  2JXB A;  3CXC A;  1VQ6 T;  1VQP A;  1NLP C;  1UEC A;  2GF7 A;  3EGX B;  5KYY A;  3CCQ T;  3FLG A;  3HRT A;  3OW2 S;  2XMF A;  2ESW A;  2EJ9 A;  3QDR B;  3EG9 B;  1S72 A;  2VXE A;  1QVF P;  2MI6 A;  1NEG A;  3AHU A;  2JZ2 A;  4IUT A;  2RQR A;  1G2B A;  5GMK i;  3URG A;  3MEA A;  1FMW A;  3V8L A;  3HRU A;  2F2X A;  1B3Q A;  2MK5 A;  1K76 A;  4M78 D;  3GLX A;  2A28 A;  2DET A;  2CP2 A;  2EGE A;  1GBR A;  1FX7 A;  2YUN A;  5FRN A;  2I2L A;  3RIR A;  3VV0 A;  2E1H A;  1JJ2 P;  1RI0 A;  4FSS A;  4ME7 A;  4OB1 B;  4C5I A;  1Y71 A;  5GAN 6;  1T3S A;  3V7C A;  2KMT A;  4DBF A;  3OYF A;  1UEB A;  3EHR A;  4XTU A;  4PJO G;  2CKK A;  1ZSG A;  1K4U S;  1AEY A;  3OMG A;  4IUQ A;  2BUD A;  2HKN A;  3I56 A;  2OJ2 A;  2KXD A;  1VQN A;  2GTJ A;  1NYF A;  3QZ5 B;  2DX1 A;  4KT0 E;  4M75 A;  3VYG A;  2RQW A;  1WYX A;  1I5L A;  5LJ3 e;  2EGC A;  3CCV T;  1G3S A;  3HKS A;  2MWO A;  1KHI A;  4C92 G;  5GMK e;  5IHI A;  1PWT A;  3JAM E;  5GAO n;  2BE7 D;  2JM9 A;  5AT1 B;  3OSS C;  1AZE A;  1QCN A;  5GAM g;  5GAN 7;  3QO3 A;  5GAM d;  3CCR T;  3O8V A;  1M3A A;  1OYX A;  1VYV A;  3NFC A;  2GQI A;  1IHV A;  4X9C A;  1SKU B;  3PT9 A;  1UUE A;  3QG1 A;  2LJ3 A;  2OTJ Q;  1HSQ A;  2F2W A;  4M7A A;  2MOX A;  4ELY C;  1HXD A;  1N8R R;  3MP6 A;  1VQ6 A;  3CD6 Q;  4M75 F;  2DXC A;  1Q7Y C;  2P0P A;  3CCQ A;  5I22 A;  2RQU A;  4QT7 A;  2EYY A;  2KBT A;  3N5B B;  4M7D G;  3O5Z A;  6AT1 B;  2KAF A;  1AWX A;  2M16 A;  2PUK B;  1IRX A;  3BW1 A;  4JLI A;  3M5A A;  3RKW A;  2L2P A;  2RK2 A;  1D3B B;  4GLK A;  4DBH A;  1BK2 A;  1M9S A;  4ZGJ B;  3RMQ A;  1QVG P;  1UHC A;  3FJP A;  4JLG A;  3JCM W;  1IO6 A;  1WHK A;  1U06 A;  3EG1 A;  1KK7 A;  3FIF A;  5IXB A;  2VGN A;  2YUO A;  1PD1 A;  3G71 Q;  2ZPG B;  1LOJ A;  2KDS A;  4M7A F;  2COY A;  4DBQ A;  1OV3 A;  4FM4 B;  4AG2 C;  1Y0M A;  2A3L A;  1KC8 R;  1YIT A;  2LVM A;  3UF4 A;  3OA6 A;  1UJ0 A;  1NJI C;  1V76 A;  1KC8 U;  3T9N A;  4KUL A;  2J06 A;  4J6Y A;  4OB3 B;  2C06 A;  3OYB A;  2GFU A;  2VC8 A;  3UA6 A;  3CCE A;  3I5S A;  1EX4 A;  3JCM J;  1TOV A;  5KYN A;  4RMO A;  2KNB B;  3FC3 A;  2K2M A;  2A37 A;  3OYN A;  3M0P A;  3GPL A;  2DIL A;  4J9H A;  1W2B S;  1YCS B;  1NG2 A;  5IT9 E;  2E41 A;  3CCV A;  5KYU A;  2JS2 A;  2RF0 A;  1I1J A;  1BU1 A;  4RTZ A;  5IN1 A;  2V8K A;  1Y07 A;  1NLO C;  3H9N A;  3TSZ A;  1X2Q A;  2KK4 A;  3OYK A;  4M75 E;  1SSF A;  4QVZ A;  1YJN Q;  1UG1 A;  4JRP A;  1YFN A;  2PUO B;  1MV3 A;  2O4X B;  1VQM A;  1PM3 A;  1B34 A;  2C0I A;  5EG2 A;  2NUP A;  3G1J A;  1VQL Q;  3M57 A;  1ZUU A;  3EHQ A;  1K0S A;  8ATC B;  2NWM A;  2XHC A;  2PZ1 A;  3S3N A;  4DOV A;  4NL3 A;  1X69 A;  4K11 A;  3CXC P;  3GP8 A;  1JRI A;  4X1V A;  3G7Z A;  5LJ5 g;  1RL2 A;  2B8A A;  5LJ5 d;  1IGQ A;  2FVU A;  1CKA A;  5I21 A;  3WXM B;  1G83 A;  2DL7 A;  4M7A E;  1NPP A;  2QQS A;  1WQW A;  1E6G A;  5GAN 5;  4CC3 A;  3M56 A;  4JS5 A;  1MGQ A;  1WQ7 A;  2VVK A;  1VQ5 A;  1I4K 1;  4QKU A;  2DAQ A;  2DVE A;  5KYU B;  2JJ9 A;  1K9M R;  3IQL A;  2YRD A;  1K9M U;  1BKB A;  2K2V A;  2LX7 A;  5CIU A;  2CP5 A;  2AIR B;  2CP7 A;  3LGF A;  1U3O A;  2K3Y A;  1N9S A;  1YJW T;  2AZV A;  2L0A A;  4WTO B;  2RHU A;  1B34 B;  4LDW A;  2X4Y A;  5DM7 R;  4XTV A;  4FYV B;  5KH6 A;  1KC8 C;  1Q81 U;  2KT1 A;  4V2S A;  4PJJ A;  1PRM C;  1M3B A;  3MKD A;  5GAN 8;  5HKC A;  1OUL A;  2LX9 A;  3JCM Q;  4ZNX A;  3JB9 F;  3A1P A;  2E6Z A;  2O2O A;  3U23 A;  2RMO A;  5LJ3 h;  1YHQ Q;  2D9T A;  1YBY A;  4Z02 A;  2DTO A;  3NTH A;  4ZTJ A;  1M2V A;  1X43 A;  5CQY A;  1VQ4 Q;  2V1Q A;  1ZX6 A;  5GMK h;  3H0H A;  1O9S A;  1AOJ A;  3M0U A;  1VQO T;  1M30 A;  3OYM A;  2DK3 A;  2K9G A;  1YCY A;  5CCA A;  3OS1 A;  1KG1 A;  1RAG B;  1N5Z A;  2WSF E;  3GOX A;  3INZ A;  4JJD A;  1LVK A;  2X4J A;  2E6N A;  3DB3 A;  1ARK A;  1WXU A;  2K5L A;  3G6E Q;  2JNG A;  1KJW A;  5GAO p;  2ATC B;  4QVD A;  2CH4 A;  2YRC A;  3C94 A;  4BE1 A;  2R58 A;  3ME9 A;  4F16 A;  4PJN A;  4L59 A;  2K79 A;  1RAA B;  2D8H A;  1KD1 C;  1ZLM A;  2WSC E;  1MUZ A;  1YP5 A;  2PTK A;  1A0N B;  4M78 A;  1EZZ B;  1RLQ C;  2YUP A;  2JS0 A;  4XAX B;  1ZHI A;  3JB9 H;  1JO8 A;  3WVE B;  5D6Y A;  2RJE A;  1EFN A;  4B6M A;  1OZ2 A;  4OMN A;  3MP8 A;  2FO0 A;  3EG3 A;  1T0J A;  2EJF A;  2EFI A;  3S3O A;  5LL6 S;  3C12 A;  2VV5 A;  4J9E A;  2JTF A;  4PJM A;  1M2V B;  1WNL A;  3CCM T;  2FB7 A;  4M75 G;  3GBQ A;  1YJW A;  1K9M C;  5LJ3 j;  1LPL A;  3M59 A;  1WPY A;  1AHJ B;  5GAM e;  4EPC A;  3LYI A;  2FZC B;  1YIJ T;  2FPF A;  4M78 F;  2KI7 A;  3LW5 E;  2D0N A;  3CC7 Q;  4OP0 A;  3H0I A;  3VS2 A;  2G3R A;  1YNZ A;  2RA2 A;  2ZCF B;  2YWW A;  1JQQ A;  2A0F B;  5LJ5 f;  3D7S B;  3OYL A;  1KQS A;  1Q81 C;  1B07 A;  1WA7 A;  2KYB A;  1K9A A;  1NEB A;  4RTV A;  4QW2 A;  3MEU A;  1Z9Z A;  1O75 A;  2KR3 A;  1M1K C;  2RHI A;  3CCJ T;  2L3P A;  5HK0 A;  2RQV A;  4M7A G;  2MF2 A;  3LLR A;  5HY6 A;  4F17 A;  2YRV A;  3MHX A;  3DKM A;  1VQO A;  4MZM A;  3MP1 A;  4JS4 A;  3EG2 A;  4L5G A;  3V8J A;  4FSX A;  4Y92 A;  1Q86 R;  2E70 A;  3NGP A;  2JMC A;  3A5Z B;  3OQ5 A;  4RTY A;  2RHX A;  2V1R A;  4X34 A;  1Q86 U;  5KYX B;  3WVD B;  2BZY A;  1LNX A;  1T3L A;  2QEX T;  2CGH A;  4JPB W;  4J83 A;  4KBM B;  2CUD A;  1TG0 A;  3MEW A;  2KRM A;  2LT4 A;  4PFP A;  3QKJ A;  2PVG B;  2R5A A;  2X35 A;  4CI0 C;  3VYH B;  3L1A A;  3OYE A;  3VUB A;  2PQW A;  2EYZ A;  1RAH B;  1AD5 A;  3CBM A;  3M0T A;  4DA4 A;  4JRK A;  5L8R E;  2J6F A;  2F69 A;  2W10 A;  2OTL T;  4DQ2 A;  2BZX A;  3M0Q A;  2QGG A;  3EGX A;  2QA4 Q;  1WFW A;  1UTI A;  3CMA T;  3V7R A;  3MO8 A;  4LDU A;  5IAY A;  3EG9 A;  4M78 E;  2JVV A;  1PG5 B;  3QJY A;  1R0C B;  3CCL Q;  2OAW A;  3I55 Q;  3CCM A;  2L5Q A;  3M4G A;  1S1N A;  4X9D A;  5DLO A;  3QUI A;  1WHJ A;  1C0M A;  2HQE A;  2HL5 C;  2RH2 A;  1QVF S;  2X4X A;  1YIJ A;  1D0Y A;  5J3B A;  2EAY A;  4HA8 A;  2Y4X A;  1N27 A;  1WXT A;  1XOV A;  1K8A U;  5KYW B;  2YXY A;  3MPU B;  4JUV A;  2K3X A;  4XU3 A;  5DLQ E;  4A4K A;  3CCS Q;  2R5M A;  2VWF A;  1QCF A;  1TUG B;  3CCJ A;  3E9F A;  4M77 B;  1VOM A;  2G6F X;  1BIB A;  3G4S Q;  4PFO A;  3CCU A;  1TWB A;  3OS5 A;  1JJ2 S;  5LJ5 e;  1UB4 A;  1MMN A;  5GAN g;  3OS0 A;  3PVQ A;  4E7I A;  2ZGW A;  4J9F A;  1PHT A;  4D8K A;  1W70 A;  3REA B;  2LC4 A;  1Y7X A;  2QEX A;  2LZ6 B;  1I0C A;  4R56 A;  2HKQ B;  1JB0 E;  1VYU A;  1DJ7 B;  1K73 U;  3TSW A;  1Q86 C;  5A0D A;  2AT1 B;  3EFO B;  1WGS A;  3JB9 G;  2KSS A;  3FB9 A;  3JCM c;  1TTH B;  4KUI A;  1NJI R;  1G3T A;  1RAB B;  1QW1 A;  3SDZ A;  5KCH A;  2O88 A;  2H3J A;  1YWP A;  1NJI U;  2CZ0 B;  2RK1 A;  2E65 A;  1C6V X;  4FYY B;  2OTL A;  3L2V A;  2HMA A;  3P8H A;  2YUQ A;  4J9B A;  4Y28 E;  3F70 A;  3S6W A;  4MZT A;  1YIT T;  3CMA A;  3CC4 A;  1BI0 A;  1G3Y A;  5FW9 A;  5GAN j;  4VUB A;  3MET A;  3RNJ A;  1GL5 A;  4RKU E;  1X6B A;  4DEY A;  2AHJ B;  3H6Z A;  3FJ5 A;  3CCE T;  1D3B A;  2HAX A;  2XK0 A;  3RBB B;  2QDL A;  5CR2 A;  1YJ9 Q;  2ED0 A;  1MMA A;  2D8J A;  1NBE B;  2Y4Y A;  4II1 A;  4A4H A;  3OYI A;  3BDU A;  4IUP A;  5GAM h;  2DD4 A;  3JCM X;  1VQ9 A;  1TH7 A;  3A8M B;  1KQS P;  4LDV A;  3CCR Q;  1K8A C;  3L2Q A;  4HT8 A;  1GCP A;  1OQK A;  3KFV A;  5I11 A;  1F1B B;  2QDY B;  1VQM T;  2OAU A;  2FRY A;  3SWN A;  4C8Q B;  3L2W A;  3VS6 A;  1IRE B;  4M77 C;  3OY9 A;  1ZBX A;  2E5Q A;  1WHL A;  1FMV A;  2HQH A;  3JCM P;  1AZG B;  2D0Q B;  2P84 A;  4F14 A;  2O31 A;  2CP6 A;  2DXB A;  4FT4 A;  5GAO l;  1SRM A;  3HP9 A;  2EQM A;  1M90 U;  1QKX A;  5L23 A;  3C95 A;  1CSK A;  3NTI A;  2XI9 A;  1HYO A;  3G4S A;  4AFZ C;  3SFM A;  1D0X A;  4M78 G;  2A36 A;  3PGG A;  2OTJ T;  2HZY A;  5FU6 B;  3CD6 T;  1YI2 Q;  2O4X A;  4M77 D;  1QMC A;  3KBG A;  1VQ5 T;  3BDL A;  1K73 C;  1H64 1;  4CC4 B;  4PKC C;  2LQN A;  4EMK A;  2K57 A;  3QII A;  2K7A A;  1ZSZ B;  1W1F A;  2DJQ A;  2EYW A;  1K1Z A;  4RG8 A;  1Q95 G;  3CC2 Q;  4KUD K;  3FDR A;  3MEV A;  1EIF A;  2RJD A;  4F7U B;  2ABL A;  2LCS A;  1UDL A;  2FHD A;  1VQK Q;  4J5Y A;  4ZGD B;  4CC2 A;  2L3R A;  2KVQ G;  2LMJ A;  2XID A;  3G71 T;  5GAN f;  3TEE A;  1RUW A;  3SWN B;  3CXC S;  2DRM A;  1FMK A;  2H8H A;  4LDY A;  4PNO A;  1LJO A;  1BI1 A;  4GY5 A;  4F04 B;  7AT1 B;  3QZ9 B;  5A0G A;  2DBK A;  4BB7 A;  1WJS A;  2V26 A;  3NTK A;  4HCZ A;  2EKH A;  3ZBD A;  2M9U A;  2CS7 A;  4LNP A;  5GMK l;  5FWC A;  3MJX A;  2CYZ B;  4KH1 B;  1D09 B;  2F1L A;  1MHN A;  1UE9 A;  1ZA1 B;  2JOY A;  5ECA A;  1VQ8 Q;  1KSW A;  3HHT B;  3VRZ A;  4QVC A;  3I5R A;  2SRC A;  4EMK B;  4E7Z A;  4XU1 A;  1KD1 R;  2BIV A;  4C8Q C;  1KD1 U;  1D1B A;  2QYZ A;  5LJ5 h;  1YJN T;  4J9D A;  4HCB A;  2DF6 A;  4BAC A;  4PK4 A;  3PTA A;  1TXQ A;  1VQL T;  2E12 A;  4OMQ A;  3OMC A;  4IKF A;  1W6X A;  2KE9 A;  2OI3 A;  2OTJ A;  3CME Q;  4NOY A;  8AT1 B;  1M90 C;  3CD6 A;  2QTV A;  2QGF B;  1JXM A;  2V8J A;  1UGQ B;  2QQ9 A;  4C0D B;  5FU6 C;  3HL8 A;  3R6O A;  4HVU A;  2CT4 A;  2ZPE B;  4C8Q D;  1NM7 A;  4J9C A;  4RCB A;  4MDW A;  2HNI A;  3A8G B;  1ZSZ C;  1WIE A;  3UWN A;  1IZ6 A;  2FYK A;  3TU4 K;  1SPK A;  2NUZ A;  2RO0 A;  2ZPH B;  4R55 A;  1RAE B;  2V8I A;  3RKX A;  1SRL A;  3G71 A;  1Q81 R;  1I81 A;  3H41 A;  4P5N A;  4OMO A;  2MWP A;  1TUC A;  3RDV A;  1WI7 A;  4OMF B;  4Y91 A;  4C5H A;  1M1K R;  1RAF B;  3VJP A;  2COW A;  2RD1 A;  3SWN C;  1M1K U;  2DNU A;  2E10 A;  1SEM A;  3ZFJ A;  2DER A;  1D1C A;  4O6J A;  2RI2 A;  3X20 B;  2DTH A;  5CO7 A;  1RI9 A;  2YLC A;  2EW3 A;  1PD0 A;  3PE0 A;  3DLL A;  2DYI A;  2X3X D;  3M54 A;  5FRM A;  5CKB A;  1ZQ1 A;  2VB6 A;  4IUV A;  2B86 A;  1KQ2 A;  1X2K A;  2RQT A;  4C5E A;  1XJW B;  2BTT A;  1VQ7 Q;  1RAC B;  2FPD A;  2DA9 A;  1UGR B;  2DZ9 A;  2EIF A;  3EAE A;  3VU3 C;  2HSP A;  1RLP C;  1BB9 A;  4C92 A;  1WHM A;  2PNI A;  1MND A; 
#chains in the Genus database with same CATH homology
 2M02 A;  2E4H A;  1LPL A;  3RDV A;  1TXQ A;  4B6M A;  1WHL A;  2COW A;  2HL3 A;  2CP2 A;  2HQH A;  2QK0 A;  1WHK A;  2CP5 A;  1WHJ A;  2HKN A;  2CP7 A;  2COZ A;  3E2U A;  1IXD A;  2CP6 A;  2HL5 C;  2MPX C;  3TQ7 P;  2CP3 A;  2E3I A;  2HKQ B;  2E3H A;  1WHG A;  1TOV A;  1WHH A;  2COY A;  1WHM A;  2Z0W A;  2CP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...