1BKBA

Initiation factor 5a from archebacterium pyrobaculum aerophilum
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
136
structure length
136
Chain Sequence
KWVMSTKYVEAGELKEGSYVVIDGEPCRVVEIEKSKTGKHGSAKARIVAVGVFDGGKRTLSLPVDAQVEVPIIEKFTAQILSVSGDVIQLMDMRDYKTIEVPMKYVEEEAKGRLAPGAEVEVWQILDRYKIIRVKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords TRANSLATION INITIATION FACTOR 5A
publication title Structure of translation initiation factor 5A from Pyrobaculum aerophilum at 1.75 A resolution.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
total genus 26
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 1998-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1bkbA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1bkbA02
5DM7R 1AE3A 2JA7H 3S17H 4O2DA 1IZ6A 4L5RC 1XPUA 4A3BG 3S16H 2LSSA 4X6AH 4A3KH 4UY8C 4IFDG 5FLMH 1I50H 3CCJT 2HHHL 4YCUA 5J3BA 1VQPA 2JJQA 3RLFA 1X3GA 2YU9H 4GKKL 3M7NA 2NVQH 1YJ9A 5IWAL 3BZKA 1X9NA 3CCQT 3K81C 2ASBA 1OXXK 3DLLA 3F1ZA 3WWVA 1OXSC 3GTPH 3AYHB 1NJIC 1QZGA 2R93G 4GLXA 2OCEA 4JI0L 2IY5B 3T1HQ 4JOIC 1CKNA 4OWXB 3G6EA 2Z6KC 4QIWE 2JE6I 4DUZL 1HR0W 3DB3A 1QUQA 4R4CA 2UUAL 4LUOA 4BY1H 3KOJA 4OWTB 4NXNL 3CXCA 3CC7T 4JI1Q 4HJAA 4AYBG 4IJHA 2K52A 1Y14B 2BA1A 3PF5A 1XNQQ 3KYHC 3HOWH 4J15A 4BY7G 4DAMA 2E70A 1K8AC 4HIDA 4YCVA 3HKZE 3LH0A 4B3MQ 4LF9Q 4NPSA 3IRBA 1MIUA 1BVSA 4JI2L 4LFAL 2E8GA 2NZOA 1G6PA 4JI5L 1CSPA 2RF4A 1IXRA 2I5LX 3I55A 5M3MG 1IBLL 3PO2G 4A3EH 3I7FA 4QY7A 3CCRT 3S2DH 1JB7A 1JE5A 3CCVA 3CPWS 1GM5A 2R7FA 1X55A 3S1QH 4DR7L 1HJPA 2F52A 3K0XA 1NMFA 1TWFH 4P75A 1MJEA 4L5SA 5JJLA 4A75A 3G6ET 1B7YB 4UPAA 1HNWQ 3CMAA 1N34Q 1RIPA 1K9MU 2YTVA 2MO0A 3CAMA 1M1KU 4IFDJ 1KAWA 3CCLA 2UUCL 4UP8A 1PVOA 1Q8KA 1SRUA 3E9IA 1SE8A 3L0OA 3LGFA 4HJ5A 4C3IH 4GKKQ 3STBD 4POFA 1ASYA 5IWAQ 4KLKA 1MKHA 5JJIA 2BH2A 2NVTH 1PH9A 1SFOH 4P74A 2LQ8A 4C2MH 1KQSS 3I55T 4DR5L 4BBRH 4JI7L 1PV4A 1VQLA 1A8VA 2PI2A 1VQOA 3S2HH 1HZBA 5LL6S 1KC8U 3JAMi 2R92H 4DV7L 3GTJH 4DR1L 2MQHA 3HOZH 3HFZB 2ES2A 4Y52H 2AWNA 2VL6A 1L0WA 2VQEQ 3RZOH 5GROA 3BJUA 4X64L 5C3EH 1M90C 2AMCB 4NXNQ 2WB1E 1FJGL 2DO3A 1E3PA 4P71A 1VQIA 2ZTEA 2JA7G 3CCLT 1UE5A 4P72A 3RLNA 5JEAG 1HNXQ 5M5WH 4JBWA 3EBEA 2ALYB 5IT9c 4MZ9A 5FLMG 1CUKA 4A3KG 2KENA 1N36L 1K8GA 4OX9L 1LYLA 1UE6A 1J5EL 1VQ6A 1X3EA 4X65Q 3I2ZA 4DV6L 4JI5Q 1JJCB 4QQBX 1IBLQ 4L5TA 1XTDA 4C3JH 2ZM6L 1YBYA 1XNRL 2KCTA 3RLOA 4B3RL 2ZTCA 4GOPA 1OXUA 2IG0A 3J81i 1VQLT 3ULPA 3DB4A 1VQOT 1IBML 4DR7Q 3JC66 1EOVA 4LWCA 1NJIU 2OTJA 1CKOA 2NZHA 3HOYH 5IYCH 3GDEA 3KDFB 2B63H 1SR3A 1VQ4T 3OTOQ 1PH5A 4DK6C 2N78A 4R4TA 3K80C 1N32L 1YEZA 4BY1G 3CCUA 3K8AA 4JBMA 1W3SA 1XJVA 2UUCQ 5GQOA 2OTLT 3KF8B 1YIJT 2CQOA 4IOCA 2UU9L 3HOWG 3M4OH 1H95A 3CW2C 2LXKA 3CC4A 1TWAH 2VQFL 1BKBA 3A0JA 1VQ6T 4DV1L 1PH1A 1KXLA 2JNGA 3W1BA 2KHIA 2Y0SE 1HNZL 2EQSA 2GVAA 1I6HH 4JI4L 2F4VL 2PI2E 4JI7Q 4L5QA 2JVVA 4A3IH 4PG3A 1GO3E 1K83H 2Q2HA 3ULLA 1VQNA 5FLXc 3UDGA 4GNXC 2JUFA 4A3EG 3CCEA 2KBNA 4DR1Q 4LF7L 3KLWA 2OTJT 3PUYA 3KBGA 1S72T 4GLAC 4YCWA 3M4PA 4X64Q 1Q12A 1FJGQ 1WI5A 5BR8L 4IFDI 3U4ZA 1YZ6A 1NMGA 3RN5A 2Q2IA 5JEAJ 1VQHA 3CQZH 2VW9A 1HR0Q 3PUZA 3ICEA 1FVIA 3TEHB 1EIFA 3A5UA 3I56A 3GTGH 4LUVA 1AE2A 3CC4T 4DV6Q 4UP7A 4LF8L 4LUZA 5IT9E 1HZCA 4PZ8A 1EFWA 3UE0A 2ZM6Q 1XNRQ 4BA1I 4LF9L 4A3MH 1VQMA 1VQJA 1PH3A 3M3YH 4KHPL 3KDFA 2G3RA 1IBMQ 1VQNT 1VQ9A 2PNHA 4BBRG 3CCET 1L1OC 1PH8A 1C7YA 3LGJA 2YTXA 4X62L 1J6QA 2E5LL 2LXJA 2YV5A 1PH4A 3HOZG 3PO3H 4A3GH 3KJOA 1VQ5A 2WAQG 2C35B 2PQAB 3NELA 4IPGA 1N32Q 3EIVA 4X66Q 3PCOB 5C3EG 1M90U 4AQYL 1X3FA 1YITT 4K0KL 2UU9Q 3CMEA 1SSFA 4MTNA 2OWOA 1GKHA 3I56T 2CCZA 4DV0L 3RN2A 4C3HH 2VQFQ 2CFMA 1YVCA 2CWPA 4LFBL 4DV1Q 2R6GA 2VZAA 3G4SA 4ZN1A 1I94L 1HNZQ 3U50C 1QVFA 1E7ZA 2MNAA 4JI4Q 1VQPT 3CXCS 1A62A 2MFIA 1VQMT 4LNQA 2F4VQ 4DR4L 4LF7Q 1YJ9T 4A3LH 2DGYA 3UDIA 4YHHL 3K7AH 2E2JH 1VQ9T 3H3VH 2A8VA 2N3SA 5FLXE 3GTKH 1RL2A 1CKMA 5GAEC 1JT8A 5E7NA 3UE1A 1W2BA 2A1AA 1KRTA 5BR8Q 3S1MH 3HOYG 5IYCG 4DNIA 5AJ3L 2E2HH 1VQ5T 2B63G 2UUBL 1VCIA 4O0AA 4AH6A 4AYBE 3RNUA 1S3OA 3HKSA 2K4KA 4HIMA 4GOPB 4JC0A 1EIYB 3BZCA 1P16A 2F3IA 3GTLH 3JAMc 3CMET 2I5HA 4B3SL 1OXVA 4LF8Q 3CCMA 4DR6L 4YWLA 2GVBA 4TVRA 3U58A 2CKKA 1R9TH 3G4ST 2VY3A 4MNOA 4GN5A 4EX5A 4Y7NH 2VNUD 3TREA 1HH2P 5IP9H 2K5HA 2VUMH 3E0EA 2PQAA 2IX1A 2MI6A 1XMQL 4AIMA 5GAHC 1YHBA 4DPGA 2RHSB 2E5LQ 3CCVT 2OQKA 5HY6A 1VQGA 5C4JH 1PH2A 1PHJA 2UXCL 3GTQH 4DUZQ 2UUAQ 1NBWA 4A76A 2ZTDA 1NPPA 4AQYQ 3A5ZB 1JJ2A 4DK3C 3J81c 4K0KQ 3CMAT 4JI6L 4JV5L 3PGZA 4R4IA 1FGUA 3TS0A 1OXTA 2MO1A 4R4OA 4DUYL 1IYJB 4JI8L 1VQ8A 3J80i 4DV0Q 3I4MH 3S14H 2WB1G 4A3CH 4WJ4A 4A3DG 1Q1BA 5HGQA 3UDFA 4YY3L 4DR4Q 4LFAQ 4JI2Q 3T1YL 3KFUA 5IE8A 1YJNA 1BBUA 4A3MG 2IX0A 4NXML 1HZAA 1D8LA 4JI3L 2D0PA 3H0GH 3MEFA 4IO9A 4A3DH 3P8BB 2KCMA 4LF4L 2JA9A 4H02A 1D7QA 3S24A 1VQCA 1IL2A 4A3GG 1YJWA 3J7ZC 2MWOA 1EQRA 1N33L 2IHFA 3SGIA 5GADC 1S40A 2HHHQ 1SN8A 1VQAA 2UUBQ 1VS0A 2ID0A 2JEBI 3W5OA 4A4IA 2IT1A 4GKJL 5DLQE 1IBKL 4DR3L 3GTMH 5K36G 4XIGS 2XHCA 3K7UC 1K3RA 1WCMH 3KF6B 2JA5H 5IYDH 3HOXH 3JAME 4XTCS 1WJJA 2B3GA 4RG1A 1Y1WH 1TWHH 3CF5A 1TWCH 4YTLA 2JEAI 1K73C 4DV4L 1N8RC 1N9WA 3CPFA 3ZJYC 4OXPA 1TWGH 2BA0A 3CD6A 2HT1A 3OYYA 1NY4A 3AQQA 3B6YA 1YJNT 4DR5Q 4FDBA 4BBSH 3LGLA 1XMQQ 4A3LG 4JOIA 5C44H 1Q1EA 4PZ7A 2Z6KA 1Z47A 2K5VA 1PA6A 3I4OA 4JBJA 4LF6L 1QVCA 1Q81C 2YTYA 2R7ZH 4DV7Q 1X54A 2Q2TA 1YHAA 4DR2L 3HOUG 1SLJA 4DKAC 1JJGA 5IP7H 3TS2A 3NENA 4JI6Q 1P8LA 4JV5Q 3E9HA 3T1HL 1UWVA 4A3JH 2HQLA 2A19A 1GVPA 1V1QA 1I5FA 3J81E 2L3RA 2MWPA 1HZ9A 1EYGA 2FXQA 3CCUT 2NN6I 4X34A 2R7DA 3PUWA 1XNQL 4YY3Q 3NBHB 1N36Q 1QZHA 4OX9Q 4IOAA 3T1YQ 2GN5A 1J5EQ 4ZN3A 2JA8H 3FP9A 4RMFA 3OW2A 5IAYA 4HIKA 1PH7A 2Q2UA 2PMZE 2ZJRA 5IP9G 4DV3L 2NN6G 4JI3Q 4NXMQ 1T9HA 2JQOA 3MXNB 4LF4Q 2VUMG 4B3RQ 2N8NA 2IHEA 1KHIA 1A63A 1O7IA 4IPDA 5H1SE 1N33Q 2E2IH 3PIOA 2BH8A 3KF6A 4GLVB 4DAYB 1OTCA 1WYDA 4GKJQ 3ULJA 3PUVA 2XTIA 3G71A 4DR3Q 3A74A 2YYZA 1HNWL 3CP0A 1XPOA 4DV5L 1UE7A 3GO5A 5ELOA 1JMCA 1AH9A 1FL0A 3HOUH 2AHOB 2K50A 4DV2L 3U4VA 4OWWB 3I4MG 1NZ9A 1SMXA 4A3CG 2ATWA 4BXXH 1PYBA 4KHZA 4DV4Q 2EIFA 2UXDL 1KL9A 3KJPA 3J81j 3M85A 2HIVA 4NB3A 2WP8J 1E24A 5LMNW 1WFQA 4WJ3M 3PIPA 4LF6Q 1YI2A 1KIXA 3HKZG 1X56A 1Q82U 5C4XH 2I5MX 3H0GG 4QQDA 3CCRA 1Q7YC 1DGSA 2AWOA 3RR5A 5M5YH 4GNXB 4DR2Q 3CC2A 2WAQE 2JA6H 3I4NH 1BBWA 1Y1VH 1QVFS 3M4QA 2R92G 1U5KA 2DUDA 3G71T 2N49A 2VQEL 1LTLA 1B8AA 1XNIA 1LUZA 1PYSB 3D31A 1NE3A 3FKIH 3FHWA 4HIOA 3HOVH 1E1TA 1E22A 1WCMG 5IYDG 1XMOL 2JA5G 4LF5L 3HOXG 3S15H 4KI0A 1W2BS 2VS1A 1Y1WG 1A0IA 1GD7A 3GD7A 4JCVE 4A3FH 1HNXL 4B3TL 3L7ZC 3J7AF 2KHJA 4OONA 3RZDH 3S1RH 1K73U 1V43A 1VQBA 3CPWA 1N8RU 4DV3Q 5FJ8H 1Q86C 2K5NA 5JJKA 4X65L 3J80c 4KHPQ 1L2FA 3CCSA 1MJCA 2JK8A 2L15A 1YI2T 1U0LA 2QA4A 4BBSG 4LW1A 1E1OA 5C44G 3AFQA 4A3IG 3AEVA 4YWKA 3CC2T 4IPCA 1L1OB 3F2BA 1Q81U 4X62Q 4JBKA 2CKZB 2R7ZG 5IYBH 3PO3G 4ALPA 3TRZA 4HJ8A 4A93H 5IP7G 4DV5Q 1KD1U 2NVXH 4HJ7A 4A3JG 3OTOL 3TQYA 4DV2Q 2QEXA 1TXYA 3F2CA 5LMUL 2LVMA 1EWIA 1UEBA 3STBC 5EAYA 1YHQA 5M3FH 2UXDQ 1KQSA 3Q8DA 4A3BH 4LFBQ 1UE1A 3CCMT 1VQDA 1WOCA 2K75A 2V1CC 2I0QA 1JJ2S 4EQ5A 4PZ6A 4GNXA 1I94Q 4LFCL 1QVGA 2JA8G 2QGQA 2H5XA 4P73A 1PH6A 1VQKA 3F2DA 4GS3A 2KVQG 3CCST 5ELNA 4TVAB 4QGUA 2QA4T 2D0OA 4YHHQ 2JOYA 3NEMA 2NVYH 1Q82C 4TQUS 5A2QE 4JYAL 4YWMA 5J26A 1Q46A 1QVGS 1NTGA 3PSIA 4GN3B 5LMNL 3AFPA 1LM0A 2R93H 3J7A5 5C0XI 5IY0A 5AJ3Q 1V9PA 1I3QH 1VQ4A 1VQ7A 1EQQA 2ZJQA 4JG2A 3GTOH 4RG2A 1C0AA 2D62A 2UXBL 1XMOQ 2QEXT 3G48A 3W1GA 4LF5Q 2AKWB 2OQ0A 4GN4B 4B3SQ 2OTLA 1YHQT 1YIJA 1VQFA 2HIXA 2WFWA 1HR0L 4B3TQ 1VQ8T 1B70B 1G51A 4BXXG 4DR6Q 5C0XG 4BY7H 3H3VI 1PFSA 4BA2I 3PUXA 3ERSX 3VDYA 4APVA 4ME3A 4POGA 1L1OA 1SROA 1VQEA 3ER0A 1Z9FA 1VQKT 4OO1I 2RHQB 3J80E 4IPHA 3M9BA 5M3MH 3PO2H 1ASZA 2EXDA 5C4XG 1CSQA 1Q7YU 2Y0SG 2JA6G 1EUJA 3EN2A 3I4NG 3PF4A 2UXCQ 1KRSA 1S72A 1C9OA 1Y1VG 1YJWT 2K14A 1M1GA 3H15A 4OO1G 1VQ7T 1XPRA 2B29A 1KD1C 1K9MC 5LMUQ 4IJLA 1NPRA 3HOVG 4X66L 1M1KC 4UP9A 3FKIG 4DUYQ 4JI8Q 4HJ9A 4QL5A 5GAGC 4CRIA 2KDSA 5M5XH 4PMWA 3F8TA 2XGTA 4JI1L 1CKNB 2ZJPA 4A3FG 1K8AU 4QJFA 4LFCQ 1K0RA 1QUQB 2Z0SA 3CCJA 1G291 3UDXA 5FJ8G 3S1NH 1Q86U 4R4QA 2LCLA 3CD6T 3DM3A 2E6ZA 2RCNA 3PV0A 4B3ML 4JYAQ 3CCQA 5LMNQ 1X6OA 2CWAA 1X65A 1KC8C 3OW2S 1YNXA 5IYBG 4A93G 4R1JA 3L2PA 2UXBQ 1IBKQ 4GOPC 4JI0Q 1YITA 1N34L 5C0XJ 3D0FA 3BU2A 3CC7A 5M3FG
chains in the Genus database with same CATH superfamily
1AE3A 3S17H 4O2DA 5EBCA 2GA4B 4A3BG 1GUTA 2B8AA 3VS6A 5HK0A 5FLMH 1KDBA 4K5WA 3CCJT 3BFMA 2QEXQ 1IW7C 3SXHA 5IOCA 5J3BA 5GMKl 2LFNA 4GKKL 3M7NA 2NVQH 2EQMA 1YJ9A 5IWAL 1M2VA 3BZKA 1OZ2A 3CCQT 1G5VA 4F17A 4M7AG 1JICA 1OXXK 1HD3A 1X75C 4C8QD 1PTOH 1ENFA 1OXSC 3FVQA 2VV5A 3WWVA 1NJIC 4F7UA 4MZMA 4GLXA 2K7VA 4KRTA 3KF8B 4ULLA 1WTWA 1H92A 4OWXB 4AMCA 3G6EA 4QIWE 4DUZL 2UUAL 2ZXOA 3JCMW 1QUQA 1HR0W 4HVVA 3MAQA 3HP3A 3BW1A 4OWTB 3URYA 5KYYB 1D0YA 2FPEA 3OYNA 4AYBG 2YRDA 3HOWH 2HEQA 1Y14B 1XNQQ 4BY1B 4DA2A 2ED0A 2L3QA 4DAMA 5I9PA 4HIDA 2FPDA 5L8RE 3H0FA 1XXGA 4ELZC 3OBYA 3IRBA 4JI2L 1G6PA 1HRJA 3X28B 1TSFA 1BO0A 4MN3A 4ZNXA 1RAEB 1CSPA 1IBLL 3JCMc 2CDTA 4M78C 3I55A 1I4HA 4PFOA 1JOOA 3BZDB 5J22A 3R6OA 2QTXA 5D6WA 3CCRT 3OS2A 1JE5A 1Q81R 1IO6A 4OMMA 3QO3A 2R7FA 1LT4D 1M9SA 1UGSB 4M7DC 2F52A 1I8FA 4L5SA 1MJEA 2OXPA 1W4SA 2DL8A 2MMPA 4DQ2A 3G6ET 3NHHA 3NMZC 4CDEC 1N34Q 2YTVA 4PFPA 1SSOA 2MO0A 4IFDJ 1E7OA 1YCSB 2AKKA 3L1AA 5FWBA 1E2VA 4KN4C 5C4HA 1KLUD 3RN2A 1SRUA 4C0FA 1TS4A 4MTKA 2KJXA 1D09B 4HJ5A 2DAQA 1JR0D 3MPUB 1MKHA 3N5BB 2K4YA 4WTOB 2CP5A 2DZ9A 4C5IA 2BH2A 1SFOH 1KQSS 2RK1A 3I55T 3DWPA 5CKEA 1PV4A 2QCPX 4BD3A 1ENAA 3OPOA 2NVTB 1HZBA 4KH0B 5LL6S 4LDXA 4Z88A 2RDFA 3GTJH 1SNOA 4KBMB 1PG5B 2ES2A 2D8HA 1HJDA 3R2TA 3VA7A 2VQEQ 2VL6A 3EHRA 4J8OA 3AU7A 1FJGL 4FP5D 5E3FA 4NXNQ 2R93B 4NXMQ 3CEYA 3OSOA 3RKYA 3M0UA 3CBOA 2WAQB 2F0UA 3H6ZA 4AG2C 2ZTEA 4KD4A 2DD4A 3F70A 5HCKA 2IW3A 3HRZC 1WTOA 4JBWA 4CDCC 4LK1C 1CUKA 4PQXA 2HBPA 1WHGA 1K8GA 2LJ3A 3RUXA 1VQ6A 1TS3A 1X3EA 2F0PA 1JJCB 3I2ZA 1SE2A 2BIVA 4N8X1 4L5TA 3OYGA 1CT1D 3DHQA 4BY7B 2K2VA 3ERQA 5EKLA 5GJVB 2ZM6L 3RLOA 5M9OA 4M75F 2E74C 4ZUIA 2LQNA 1PRTD 4WJWA 4N0AC 2K5DA 2LMJA 4PL6A 2VUBA 1EOVA 4LWCA 1JXOA 1CKOA 1EL0A 2X4XA 3SWNA 2NZHA 3OBWA 3WDNA 2OI3A 1V29B 3KDFB 5LJ5d 4LN2A 2NTSA 3OTOQ 2B63H 4FNFA 4ZKCB 2DL7A 3S6WA 4BY1G 2F0DA 1PMRA 1O7YA 2UUCQ 4DGZA 2RHIA 2KVMA 5GANf 3TN2A 2MPMA 1QNKA 3EG9A 1RD9D 3CW2C 2LXKA 2TSSA 5I11A 3EFXD 2AQ1B 1VQ6T 5I2YA 3SHLA 4DV1L 1BNZA 1KXLA 1Q86R 3UPUA 4J9FA 2Y0SE 2ESWA 1RDPD 3J81L 4JI4L 2F4VL 3ULLA 1GO3E 1Y8NB 1HYOA 3D4RA 4LF7L 3UDGA 4FF3A 2XU8A 2KBNA 4DR1Q 5CCAA 2GTJA 5FRNA 2K01A 1ZYRC 1I6HB 2QQAA 2B86A 1IYVA 4EMKC 2KBTA 1D1CA 1SYEA 4X64Q 2QTVA 4XU0A 3NWSA 4GLAC 1Q12A 3GNGA 1K4US 2GTOA 2PW7A 3QKJA 1IYUA 5JEAJ 1YCYA 5CIUA 2RKSA 4MZTA 3SB2A 1VQHA 1GUWA 2VW9A 1FVIA 3KLSX 1EIFA 1U4LA 3A5UA 1M3BA 4PJJA 2F0LA 4HTHA 2KR3A 4QQ6A 1AE2A 4EQOA 4X1VA 1EFWA 2F5TX 1ABQA 1U1SA 3LW5E 3UE0A 5KRUA 4IIMA 4BA1I 4A3MH 1VQMA 4RA8A 2CP7A 1UFFA 3M55A 5EKIA 1VQ9A 3MHBA 4J6WA 1L1OC 2J6FA 2BDOA 2L9HA 1C7YA 4WFN3 2NVQB 4FF2A 4A3GH 2E5LL 2V8JA 2YV5A 3OWFA 2K5FA 3KF8A 2XN9C 2WAQG 3NQIA 4KTAA 3NELA 4RWSC 4DNTB 3PCOB 4AQYL 4DEYA 4OIJA 1X69A 1A3VA 4K0KL 1L0XB 2F0OA 3PTAA 1SSFA 4MTNA 1I4PA 5LL6X 2KECA 1BDOA 4IUNA 2EY6A 4C3HH 2VQFQ 4DV0L 1YVCA 5GMKe 1Y07A 3VR5A 3G4SA 2I07B 3M58A 1A6XA 2VKNA 1QVFA 4DR4L 1VQMT 3MEUA 2K3YA 2P0QA 1LTTD 3PQIA 1VQ9T 1TTHB 2N3SA 1BIAA 2EXZA 1BF4A 4LDWA 1NR4A 4M77G 3UF4A 2A1AA 1LT6D 5BR8Q 3Q23A 3MEWA 4XAXB 4AH6A 2HHHL 1JOQA 3BZCA 2F3IA 4C92C 2PVOB 4E7JA 2DVJA 2I5HA 1JO8A 1T0JA 2K5WA 2EGAA 2V26A 3JB9F 2VB2X 4LJZC 2MCNA 2X3XD 3EGDB 4TVRA 1JWMD 2CKKA 3G4ST 1XX8A 4Y7NH 2NN6H 2XMFA 4V0BA 5KNBA 1UE9A 3L3OC 1O75A 2IX1A 2MI6A 4K5VA 1XMQL 1EY4A 3VS7A 2NZ1D 2RHSB 1WTQA 3ZL7C 2FYKA 2F0TA 2KY9A 5HY6A 2O01E 1VQGA 1MV0B 3INZA 2OQKA 2VUMB 4A76A 1R0CB 1VQNQ 3J81c 4GY5A 4JI6L 3PGZA 3OYAA 2KAFA 3GTQB 1C4QA 1EZ6A 2A68C 1BB9A 3NWTA 3IQLA 1VQ8A 4JI8L 5BN5A 3I4MH 2DK3A 1N32L 2NYSA 3BG3A 4FM4B 2WKDA 5HGQA 4PLIA 4LDUA 5DAUA 1OULA 2JS0A 1M5Q1 5A0LA 4L6TB 2HNIA 1PNJA 1HZAA 1ZUKA 1IREB 3H0GH 4M78B 5GANe 1H9SB 2JXMB 2H3JA 1D7QA 3S24A 3LH5A 1STHA 2NB0A 4M7DB 2UUBQ 5JJLA 5FO9B 1SMYD 1SPKA 3TQ7P 2JEBI 3M0PA 3W5OA 3IL8A 1KQ1A 1K0XA 2XHCA 2F0IA 2PNRC 2J06A 2B3GA 1Y71A 3CRLC 4QF4A 1Y1WH 2B63B 4CKBA 5TSSA 1VQ5Q 3CF5A 5C3XA 2HSPA 4DV4L 5GAOp 1K8AR 3M7GA 3V8LA 1CM9A 3K5NA 4OXPA 1SYBA 1TWGH 3OYYA 2L5QA 3AQQA 5COYA 5KEEA 4DR5Q 4JUVA 3QSUA 3GBQA 4JOIA 1FMKA 2EQIA 3RNJA 1A2TA 4B9XA 2K5VA 2Z6KA 4JBJA 1PA6A 1CA5A 1Q81C 4A54A 2R7ZH 3DXJC 3WVDB 2Q2TA 2KSSA 1YHAA 4EVOA 1K1ZA 5E4WC 2DRKA 3TSWA 4XTWA 3JB9H 2F2VA 1P8LA 2EY5A 3C1FA 3T1HL 2A19A 4FF4A 2LDMA 1V1QA 4ZGDB 1EYGA 2FXQA 2NN6I 1ZLMA 4X34A 4K5XA 4A3JB 3PUWA 5G3LD 2CZ0B 3NBHB 4OX9Q 2DYIA 3T1YQ 2GN5A 2F0GA 2JA8H 3FP9A 3G1JA 4PJOF 3D8GA 2ROTA 4JI3Q 4A4KA 3O13A 1T9HA 1A15A 2VUMG 2RM4A 3NK9A 1BQQT 1FYCA 1KHIA 1ESFA 3PIOA 3KF6A 4A3MB 1OTCA 5E4XA 3VS3A 2B8GA 1ZBJA 2NBFA 3PUVA 5IGCA 5GAOm 4DR3Q 2ED1A 3OSVA 4M7AF 3A74A 4DFAA 1XPOA 1JB0E 2GFUA 3HRSA 4C8QE 5ELOA 4DV5L 3V7RA 3H91A 1RLPC 3HOUH 2AHOB 2QW7A 5GAMg 3U4VA 2LC4A 1SMXA 4BXXH 4XQNA 2AUJD 4MMLA 1ZUUA 1TS2A 1WTVA 4JS4A 4A4GA 3KJPA 5DNFA 5L37A 4M78G 1JBMA 2HIVA 4NB3A 1ZQ1A 5IN1A 1VA7A 1QCBD 2K2MA 4C3HB 4LF6Q 1X56A 1Q82U 4M7DG 3EVQA 3CC2A 2J4XA 1X2QA 1TG0A 1BBWA 1K3BC 3M4QA 5C4XB 2M0OA 4EMKB 1U5KA 5I6WA 4OO1H 3HHTB 2DUDA 1FMVA 2LNHB 4HCBA 3ND9A 1TS9A 2FZCB 1QG7A 1X3QA 2K3BA 4X3TA 1YNZA 3FKIH 3T13A 3MFGA 4XQQA 1Q3LA 8AT1B 2RCFA 1E22A 3I70A 4HIOA 4DA4A 1RTNA 3URGA 4UHVA 2DBMA 2FL7A 1W2BS 1SNQA 2VS1A 4KI0A 2RQWA 3LWHA 1U4RA 2FEIA 3MXNA 3P8DA 3S1RH 3L2ZA 1K73U 3GF5A 3M4GA 1N8RU 1Q86C 1SYDA 4A3FB 4DAYA 3ITPA 4CKEA 3BYYB 3RZDB 3JB9I 2R5AA 4J9BA 4FW1A 4BBSG 2VXWA 3DLMA 3AFQA 2PZWA 2MYSA 4ZGJB 3CC2T 1L1OB 1RHPA 3EA6A 2CKZB 4E47A 2C0OA 2EVRA 2F0JA 2LKVA 2ZXRA 2EZVA 4HJ7A 4A3JG 1PC0A 1YWOA 2F0QA 3A7AB 2KA7A 1AZQA 5EG2A 2PZTA 2FRWA 5M3FH 1SRMA 2UXDQ 1BCPC 1WJQA 1KQSA 2DTOA 2P4TA 4YIJA 1UHCA 4A3BH 5I21A 2V1CC 5I22A 2CT3A 1JJ2S 4HCCA 4EQ5A 4PZ6A 4CJ0B 3A8OB 2I46A 4LFCL 4GNXA 1I94Q 1V1PA 2EQKA 2VGMA 1ACMB 4R0KA 1VQKA 2A37A 4GS3A 2JP1A 1F9RA 4BDZA 1ENCA 5A0GA 5A2QE 1Y96A 4KUDK 2DYBA 2JYOA 1Q46A 2AKLA 3E9FA 1M8AA 4GN3B 3AFPA 1OX8A 4XYQA 5AJ3Q 3PIO3 2JMCA 4PMCA 5KE2A 2L8DA 3W1GA 1DCZA 4GN4B 4C92B 1I3QB 4B3SQ 4B3TQ 2HIXA 1MV3A 5CR2A 2HDMA 3KUPA 2DN8A 3EFOA 4BACA 1JCKB 2WSEE 2AUKA 2RN8A 4QVDA 1SAPA 2JXBA 2LJ1A 2EPBA 4RG8A 1EU4A 4O5VA 1Z9FA 1VQKT 4OO1I 1V1CA 5CKBA 1QOHA 3VS1A 2NWMA 2WKCA 2EXDA 5C4XG 2Z0WA 1AEXA 1Q7YU 4DXFA 5M3MB 3PO2B 2VXFA 1Y1VG 1CFMA 2D0NA 2K14A 2MGSA 1M2VB 5DM73 1EFNA 1XPRA 2HQHA 2HZYA 4J83A 2IL8A 2R7ZB 4B9WA 4X66L 4L5GA 4UP9A 4HJ9A 3I3CA 2DY7A 3KBXA 4QL5A 1PTOD 4VUBA 4DK1A 5M5XH 4S3SA 3F8TA 4JI1L 3C46A 4A3FG 4QJFA 4J7FA 1QUQB 1VMPA 4ID6A 3E3XA 5D3DA 5KYWA 1VIFA 2OJ2A 5FJ8G 3S3MA 4RTZA 2PZUA 1DONA 1RF2D 5FKAC 4B3ML 3PV0A 4XT1B 4JYAQ 3SFMA 5LMNQ 4X9DA 4DAVA 2DEQA 2JTFA 4L6V5 4MIUA 1G8ZD 1D2BA 3X24B 4XTXA 2A08A 3UA6A 1D3BA 3OW2S 1YNXA 3T4AC 2CUBA 4DBRA 2QA4Q 2UXBQ 1GHKA 3MTSA 3E1SA 5LJ5h 3MHXA 5EC7A 1TVXA 1WXBA 2CP6A 3D0FA 2RQTA 5C0XJ 1C8CA 3BU2A 3CC7A 4A3DH 2EVBA 1R4PB 4X6AH 5FW9A 2E75C 3A8JE 4UY8C 4IFDG 3GIBA 1AFPA 3HOUB 1T3LA 1WHJA 3HPWA 1WXTA 1Q90A 3U23A 1TY0A 1D5XC 3S16B 1X9NA 3K81C 3FPUB 1Q82R 3DLLA 4X3UA 1T0HA 1JC7A 1ZXTA 1QZGA 2GBQA 1N5ZA 2Q8RE 1RAGB 4JJBA 4JOIC 2Z6KC 4EMHA 4BY6C 4R4CA 3NPFA 2JM9A 1M27C 4BY1H 1VIEA 4EQNA 3FEOA 4CI0C 3CC7T 4HJAA 1WTPA 2PUOB 5IHKA 2BA1A 2RA4A 4RCOA 2JTMA 4J15A 1RLQC 2HUGA 3FKIB 1K8AC 2Q8TA 1K73R 2KE9A 3LYIA 3HKZE 1JQQA 1N8RR 4YCVA 4OB3B 4NPSA 1YIJQ 1BVSA 1MIUA 4DNRB 2NZOA 2GF7A 4XU3A 1PD0A 2BZ8A 1IXRA 1LNXA 2X51A 5M3MG 3PO2G 1AD5A 4G7HC 1QCFA 3I7FA 2L2PA 4DAPA 7AT1B 3QIAA 2ICIA 4FF1A 3CPWS 5CO7A 3NFCA 1X55A 3K0XA 3KFVA 2CP2A 4P75A 5ELEA 3MP6A 4F7UG 2L1BA 2PMZB 4D6WA 3CMAA 2A74C 1EY0A 4M77C 5D65A 1MD2D 1GL5A 3QIIA 1HUNA 3JCMh 5JAVA 3SWNB 1PFNA 1I6VC 4KD3A 3CCLA 5CV7A 1Q8KA 3QYGB 1SE8A 1GFDA 3W3AA 3QOLA 4J6YA 3BVMA 5EPLA 4GKKQ 2E76C 2C5CA 5M3FB 4QUCA 5IWAQ 2VYTA 5ELDA 2NVTH 5JJIA 5D6XA 2EJ9A 2LQ8A 3EG9B 1SNDA 4K6DA 3WXMB 3E0JA 1VQLA 1KQ2A 3CCJQ 2DIGA 4M8AA 1CQFA 4HMIA 5CV6A 2H4OA 1HUMA 4DV7L 4XYOA 3MFYA 5LJ5j 1MI2A 1Y8PB 3CCQQ 5GROA 2ZGWA 4ZAIA 1X32A 2WB1E 3TP7A 3L42A 4CDFC 4XQJA 1E3PA 1KNEA 5CYUA 4LNPA 4JJDA 3CCLT 2LT1A 1UE5A 3BVGA 2DE0X 4FXGC 4P72A 5JEAG 1HNXQ 3QHSA 4HVUA 4A3KG 1N36L 3V8KA 3HSBA 1D1BA 3RUZA 4DV6L 4HXJA 5M5WB 1IBLQ 1YNNC 2B2TA 2E6NA 2DXBA 3ASKA 2WSCE 4B3RL 2XIWA 4KY7A 4GOPA 1OXUA 1Q7YR 1VQLT 3DB4A 3JC66 3UA7A 3MO8A 4KJNA 1Y69U 5EJWA 1B34A 2G5DA 3A8KE 3NPPA 4Y28E 2F2WA 1YJ9Q 2O5IC 5CV9A 2E3IA 2DERA 3FLGA 1DXMA 1PH5A 1QWYA 2FZGB 3K80C 4HEDA 1YEZA 3HOYB 1UTIA 1EWCA 2EJFA 4PK4A 4C8QA 1W3SA 1IGQA 5GQOA 2ZPEB 2X9HA 1YIJT 1EYDA 1WA7A 2D1XA 1L0YB 1Z9QA 1BCPB 2CQOA 2CW0D 1WHKA 3G6EQ 4LMQD 5LJ3d 3ZEHA 2SDFA 2EE1A 3CC4A 3LWIA 3QB3A 1BKBA 2OX7A 4RGMA 5CKFA 3A0JA 1RODA 4K8IA 1IHVA 2JNGA 2EQUA 3W1BA 2KHIA 1B50A 1HNZL 2J7ZA 1TWAB 1I6HH 2PI2E 5KNCA 4L5QA 2JVVA 1FGBD 4A3IH 5K36G 3A8IE 2CH4A 2O2OA 4A3EG 1S1NA 4GNXC 1M1FA 2J6KA 2SOBA 2X6LA 3KLWA 1X27A 4M75D 3RKXA 3PUYA 4CGYB 2NTTA 3KBGA 5GANg 3SK5A 3BS1A 1PZJD 3EG3A 1WD1A 1FJGQ 3I55Q 3H3VC 1DZ1A 4L59A 1EZ8A 2A3LA 1UJYA 1MBYA 2Q2IA 1K8MA 1AWXA 3HEJA 4RHRA 4DN4M 2DJQA 3C2PA 2QQBA 4WRDA 2GFAA 3V8JA 3TEHB 3MEVA 1FWZA 1EEFD 3U9OA 4ESRA 5GAN4 3CC4T 1H3HA 3PVQA 2BKDN 4LUZA 1HZCA 2CZ7B 4A3DB 5CVIA 2ZM6Q 2VC8A 4JLIA 5EPJA 3D7SB 2A69C 2F4IA 4IUTA 2DX1A 4KGZB 1MMGA 2G3RA 4KKSA 1NLOC 1X43A 4BBRG 1QW1A 4OMQA 5FU6C 2DJGC 2A7YA 4M78F 3M3YB 2X4JA 4X62L 1J6QA 4Q0FA 2LXJA 4JRPA 1NLPC 2PTKA 2JN0A 2C35B 4M7DF 3NBIA 3A8GB 4GBQA 5GAN5 1JXMA 2LX7A 1GKHA 2CCZA 1RABB 4DV1Q 2RDGA 2R6GA 2EGCA 1CTMA 3OYCA 5KNDA 3U50C 4JI4Q 2F4VQ 2M51A 3CXCS 2MFIA 4V190 1MNEA 4LF7Q 1YJ9T 1EY7A 2PUKB 2EYOA 4E7HA 2A8VA 3H3VH 4DOWA 1VQ6Q 1RL2A 2QQ9A 5I2MA 5E7NA 1EYCA 2XWBB 1W2BA 2KOLA 2E2JB 1YN8A 2H3EB 3HOYG 2LTOA 5IYCG 1J8IA 1Z6HA 2FZKB 3I73A 1TKWB 1R77A 1KD1R 3S1MB 4G7OC 1P16A 2PW5A 3GTLH 2LJ0A 5GAN3 1ZX6A 2E2HB 1WFWA 2EPDA 1KG1A 3X26B 1U4MA 1BIBA 4IZ8A 3CCMA 4R8IA 2FO0A 1M8MA 5GMKi 3OW7A 4DR6L 1NE8A 1H641 2DXCA 3T51B 3M9QA 1VYVA 2YHTA 4MNOA 4EX5A 1HH2P 2G9DA 2K5HA 3SK6A 2VUMH 4LUDA 1QCOA 3X3MA 4D8DA 1YHBA 4QW2A 3LNNA 2E5LQ 4OELB 3A1PA 4E7KA 3JSCA 5C4JH 1PHJA 4DOVA 2XSCA 3OQ5A 5DY9A 2RI2A 1OU8A 3GTQH 2UXCL 2KK4A 2ZTDA 1NPPA 5FOBB 4AQYQ 1JJ2A 3EG0A 4K0KQ 3GLXA 4BY6B 3L2VA 1M8VA 4R4IA 4JV5L 3TS0A 1O7ZA 4R4OA 3RMHA 1IYJB 4DV0Q 5A2QL 4XTUA 2WB1G 4A4HA 1B9NA 4A3DG 3CBMA 2XRQD 3PE0A 3UDFA 1G6ZA 4DXGA 4YY3L 4DR4Q 3JB9D 4LFAQ 4LAAA 3EH2A 1ZSZA 4WCIA 2F03A 3K5OA 4KMUC 1M2OA 2IX0A 1FXXA 5JVG3 2KRSA 4NXML 1D8LA 2DXUA 4QB4A 2D0PA 1FX7A 3MEFA 4IO9A 2CVRA 1C48A 1FNWA 1OO9B 1WXUA 1VQCA 1YJWA 2BE5D 1W6KA 2IPOB 3PGGA 1VQMQ 2BE7D 2IHFA 2CH4W 2HHHQ 1VS0A 2IT1A 3UATA 1KDAA 1VQ9Q 5DLQE 1X01A 3P1HA 1XYIA 4M77B 1PD1A 5CBAE 3KF6B 1B07A 2J7IA 2XKOC 2ZCFB 3EGXA 3SK4A 2HD0A 1S5DD 4RG1A 5JVH3 3GTMB 2YUQA 1TWHH 1TWCH 4YTLA 1ZBXA 1WQ7A 1K73C 2KEDA 3J7AV 1N8RC 1N9WA 3CPFA 1N9RA 4HN7A 3EROA 2K5IA 3B6YA 1QVFP 4N9TA 3FC3A 4FDBA 4J6XA 3LGLA 1XMQQ 2QDBA 4BBSH 4DEXA 1K28A 3I4LA 3I4OA 4RTTA 4R56A 3JB9J 4ORZA 3G4SQ 1BXTA 1O78A 3O8VA 1YNJC 1AZPA 1XJWB 4A3IB 1AWJA 1D0XA 4JI6Q 1E2WA 4A3JH 1GVPA 1U1TA 4IQZA 3MP8A 3ZFJA 2L3RA 1I5FA 3EG1A 4J1MA 5KYUB 1D6EC 5IXFA 1SRLA 2R7DA 3HRUA 1XNQL 2CSQA 1SG5A 1QZHA 2AT1B 1J5EQ 4ZN3A 3I5RA 3OW2A 1GCQA 2RJDA 3DKMA 5IAYA 2D5DA 4FSXA 3OYEA 3MXNB 1UJ0A 2K33A 2N8NA 2IHEA 2V1QA 4J9HA 1DJRD 2EYXA 2RJCA 1EEID 4IPDA 4LXCA 1ZEQX 4GLVB 4DAYB 1WYDA 2F1MA 2B2TC 4I7AA 2IIMA 3G71A 2YRVA 4GLKA 1FNVA 2YYZA 3BDCA 1AH9A 1U8RA 5I4DA 4J5YA 2W0ZA 2K50A 1B4OA 3JCMd 4A3CG 1M3CA 4C92F 1PYBA 4KHZA 4DV4Q 2EIFA 3MCAB 2RDHA 1MNDA 1G3YA 2TMPA 4C8QC 2EJFC 3J81j 3M85A 2K7AA 2O9VA 1VQ8Q 3GQBA 1WFQA 2RH2A 5D7UA 4PJOD 3EQLC 1YI2A 1UGQB 1R4QB 5C4XH 3CRKC 4R8NA 4OF1A 1Q7YC 3RR5A 3OSSC 4GNXB 1I07A 1V1PB 1Y1VH 3M57A 3EFSA 2R92G 5M5YB 2EKOA 2EY2A 3G71T 2Y0SB 2DZCA 4Z89A 3G7LA 2VQEL 5KGUA 1LTLA 4K6LA 2HBWA 3EAEA 5L23A 1LUZA 3E2UA 3D31A 4BI4A 5IGBA 1WCMG 5IYDG 4JJNK 1CA6A 2UUAQ 3K5MA 4LF5L 4H13C 3HOVB 1A0IA 5CV4A 4A3FH 4LDYA 1OV3A 3RDVA 1G2SA 2KHJA 3L7ZC 2R57A 4EQPA 3RZDH 3GTLB 1V43A 1IHWA 1MUZA 3CPWA 4IUQA 1VQBA 1GUOA 3E5SA 2YLCA 5FJ8H 1UUEA 4KHPQ 3CCSA 3EFOB 1YI2T 1U0LA 4JJCA 3C95A 4MDWA 4LW1A 2NUPA 1E1OA 5C5MA 4AT1B 4A3IG 2X4WA 3ZYYX 4IPCA 3OYHA 1EZZB 5FU6B 5GAN7 1RJTA 3TRZA 4QT7A 2DNCA 3C1EA 3RD4A 2RB6A 4EDUA 5IP7G 2QILA 4DV5Q 2NVXH 4C56C 3OTOL 4J9IA 5C4JB 5LMUL 5CR3A 1YHQA 1I1JA 3Q8DA 3E19A 3C4SA 5C5LA 5GAOl 1UE1A 4LFBQ 4IFDH 4JPBW 1UB4A 1STYA 2LT4A 2CYZB 1SHFA 2QQSA 1QVGA 4CC2A 1EY8A 1PH6A 1T5EA 3F2DA 4HCKA 3VYTA 3CCST 4YHHQ 1NNXA 1VMCA 2K79A 5KYWB 1NTGA 3PSIA 1D1AA 1JU5C 2PYKA 1WD0A 1JWSD 2NVYB 3HTRA 2VXEA 1VQ4A 3CBPA 2VWFA 1VQ7A 1I3QH 1JOKA 4JG2A 1EQQA 1TQOA 4BDYA 3S3NA 3G48A 4K8JA 4XTYA 3AHUA 1D3BB 1YHQT 2OTLA 3VA5A 4JI0L 1VQ8T 1B70B 1G51A 2F0EA 1ILQA 1SEBD 2ROLA 4KGVB 5C0XG 1PFSA 4E7SA 3TEEA 5KYIA 1VDZA 2CT4A 1PRTC 4OGCA 2DJFC 2M1HA 3OB9A 2ICEC 3A98A 1D0ZA 2RHQB 1TWHB 1TWCB 3G7ZA 4FYXB 2KYBA 2HL5C 3M54A 3VS2A 2PU9B 5M3MH 2ATCB 2QYZA 2FHTA 4PMBA 1CSQA 1ASZA 3PO2H 2Y0SG 2M9UA 2XD0A 1S4ZA 1SSHA 1B3AA 2NYZD 2Y4XA 1EUJA 3U9SA 1IL8A 3PF4A 1KFZA 1S72A 1C9OA 1KRSA 2PO4A 2M0YA 4BBSB 3G6JB 3C3LA 1VQ7T 1KD1C 1RAIB 4LDVA 2L3PA 2KYMA 3HOVG 3CC2Q 4DUYQ 1EY5A 3OYDA 2OEOA 2JW4A 1WJRA 4M75E 4CRIA 2IVWA 2KDSA 5DLOA 1D5ZC 3SVMA 3R8BA 1EY6A 2ZJPA 4LFCQ 4D8KA 2RPNA 1GUNA 3UDXA 3T9NA 2QGGA 2K5LA 2F0SA 1LV9A 1X2KA 1TU0B 4OB0B 3MXPA 3SEBA 2O4XA 4EMGA 1MHWC 3K57A 3S1NB 2DJZA 5GAMh 3VS4A 3VR4A 4ME5A 4OO1G 2AK5A 1ZSZC 3GV6A 1DJ7B 3MZ5A 2FJ2A 3FJPA 5IYBG 4C5HA 2FFKB 3D6CA 1QMCA 1U06A 1IBKQ 4JZ3A 1YITA 2B2UA 2A6HD 2F0MA 3I91A 1PCXA 4NMZA 3I72A 2XDPA 5HK3A 1HQRD 3SWNC 5DM7R 5JEAH 1TT2A 4C1NI 1IZ6A 2BZYA 2A73B 4L5RC 1XPUA 3S16H 1KQSP 4A3KH 3A8HB 4RCBA 1VUBA 5LJ3h 2JA7B 4BE1A 3FDRA 1C6VX 5FO7B 1JE4A 2F5KA 1WHHA 3OMGA 1VQPA 1FNUA 2JJQA 3GP7A 1GBQA 1R8OB 5FU7C 3FDTA 5KE3A 3GOXA 4RTVA 1G8XA 5GJWB 4B6MA 2YU9B 3F1ZA 2C0TA 2JJ9A 2F0VA 1G2BA 4DBFA 2A0FB 1VQKQ 1IGUA 2OCEA 1QP2A 2IY5B 1A2UA 2V4DA 5IGGA 1CKNA 3BYTB 1I4RA 2G6FX 4KY5A 4LUOA 2ZT9C 1Y1VB 3KOJA 3IFDA 4ZGEB 3CXCA 4JI1Q 3A8MB 1A3TA 2EY1A 4PFZA 1QILA 3PF5A 3OYIA 1TWBA 4NP5A 2EYPA 1BCPF 1NM7A 4HA8A 1RUWA 3LH0A 3KLSA 4B3MQ 2CZ1B 2D9UA 4LF9Q 3VRZA 3HL8A 2E8GA 2YXYA 1MHNA 4JI5L 2SRCA 2RF4A 1ZSGA 4II1A 5K36H 2RQXA 4A3EH 4C92E 1PWTA 3S2DH 4XQ3A 3CCVA 1GCQC 1NCVA 2DY8A 2CP3A 2M2LA 3TP6A 4DR7L 2EYLA 2L0CA 1F1BB 2K57A 2WSFE 1TWFH 4F8MA 1RAFB 1B7YB 3DMUA 1HNWQ 5AYFA 3S1QB 2AQ3B 1WTRA 1RAAB 3CAMA 2HQEA 5ISRA 2F2XA 4OMOA 1OYXA 1PFMA 4QMGA 4J8QA 4CBVA 2NVXB 4UP8A 3QDRB 1XTCD 3L0OA 3LGFA 2L0AA 1EYAA 3QDFA 2EBPA 3K5LA 3X3NA 3OYKA 2DL5A 3STBD 1ASYA 4C8QB 4BB7A 3DEPA 4P74A 5GAMj 4C2MH 4C3IB 4DR5L 1OOTA 4ANJA 4BBRH 4JI7L 4BI3A 2E64A 1VQOA 5ELCA 1KC8U 4FXKC 3JAMi 3VRYA 1HPCA 2MQHA 3I8ZA 1LO5D 4Y52H 2ZPGB 3BJUA 2AMCB 3HOZB 3QJ6A 4I65A 2JA5B 2DO3A 4P71A 1NYFA 3DWAA 4OMLA 2JA7G 1HTPA 4FCYA 3HS0C 3OWEB 5LJ3j 4DK0A 5C3EB 5KCHA 5M5WH 1I5LA 2ALYB 1B9MA 3M0QA 1H9MA 2KENA 4OX9L 2EYHA 3NTHA 4X65Q 3IFTA 3CC7Q 4R55A 4TSSA 4OP0A 1XTDA 3RBBB 1YBYA 1XNRL 1SMYC 4WF2A 2L12A 2JZ2A 3O5ZA 2IG0A 3ULPA 1VQOT 1IBML 2IWHA 4C3JB 2OTJA 2LP5A 3ULRB 1GBRA 3VYUA 4ZYSA 1AT1B 3TP8A 5IYCH 2DLPA 3HOYH 3GDEA 2DL4A 5IH2A 1SR3A 4CC4B 4DK6C 4H7BA 3EFRA 2F3WA 4R4TA 1SYGA 2HDAA 1V76A 2F1LA 3CCUA 3K8AA 3JRZA 1JB3A 1OZ3A 4JBMA 4F7UB 2K28A 4RH6A 1SE4A 2B2VA 4J6HA 4IOCA 2UU9L 4LUEA 1S5CD 1TWAH 2BZXA 4NS5A 2E12A 4J9EA 2K32A 1PH1A 3HRTA 4K14A 3M4OB 1AZEA 3OOCA 2EQSA 1JRIA 3CQTA 2KI7A 3UI2A 4PG3A 3CCEA 2F69A 3L2RA 2OTJT 2L11A 2W10A 1K83B 1NEBA 3JCMP 3VS5A 2R3ZA 3M4PA 3U4ZA 1YZ6A 3RN5A 1CZGA 1QB5D 3OIPA 1T5XD 3JCMQ 3OYFA 1I5OB 1WX6A 2M9VA 1HR0Q 3I9QA 3ICEA 4C8QG 3I56A 4E7LA 1F2ZA 4LUVA 3CU7A 2ZPIB 4N4IA 3CMAQ 2DNEA 1HCZA 4UP7A 4DV6Q 1ZKOA 4LF8L 2V8IA 3ZBDA 3QUIA 5IT9E 4PZ8A 4C3IG 1PRTB 4HR7B 2C0IA 1EY9A 4XT3B 3CCLQ 4F87A 1VQJA 3VUZA 4RKLA 4A3KB 1JWUD 3QOJA 5I2XA 1PH3A 1SNPA 3M3YH 1BI3A 1IW7D 2DF6A 3CCET 2B39A 1PH8A 5KCOA 1AWOA 4BE0A 3MWYW 4O42A 3HOZG 1CSKA 2DBKA 4PJOE 1H9KA 4RCNA 4FT4A 1N32Q 4BE2A 3PMIA 5C3EG 1WLPB 1VQLQ 1M90U 1LTRD 4QUFA 4CDDC 3AMUA 1QE6A 2RJFA 1X3FA 3CMEA 2BTTA 4M77F 5FRMA 5GAOq 2XDBA 4R4QA 3I56T 2RHZA 1X6BA 2CWPA 4G7ZC 2EJGA 5LJ5g 3QWXX 2OAWA 4RTYA 4ZN1A 4M7AE 3LWUA 1I94L 1HNZQ 1E7ZA 2MNAA 1SNCA 1A62A 9ATCB 2KXDA 4JVZA 1J9OA 2CS7A 4RTUA 2QEJC 1HXYD 3KK7A 4C3JG 3THKA 3X20B 3IKJA 3V05A 1G3SA 4AFUC 4FSSA 3S9WA 2E2JH 5FLXE 4RUGA 1F77A 1GJXA 1QWFA 1JT8A 1M4ZA 3SDZA 1ZSZB 2E41A 3UE1A 3S1MH 5KYNA 2N55A 5IIFA 4M78D 3FEWX 5AJ3L 2IJ0A 4A3EB 2E2HH 3VV0A 1VCIA 2PCFB 4O0AA 4AYBE 1S3OA 3RNUA 2K4KA 3S2DB 2HKNA 2LQWA 5GMKh 2WINB 1PFBA 2KMTA 3CMET 2DILA 1TWFB 4B3SL 1OXVA 3SR1A 4KV6A 6AT1B 2KEEA 1PDQA 3CHBD 4XTZA 2B2UC 2F0NA 1R9TH 2DFUA 4X3SA 2VY3A 2DPPB 3EGXB 3KUFA 4IURA 4X9CA 4C0DC 2OF1A 3TREA 2XNAC 4ZKBB 4HKEA 5FU7B 5D14A 3E0EA 2PQAA 3CC4Q 3M0TA 5ECAA 1UHFA 4AIMA 5GAHC 3BE3A 2WV6D 1KC8R 3VKIA 1PH2A 2BE9B 4JW0A 3VR3A 4C2MB 5LHY1 2QXFA 1SJHD 3L2WA 1QVPA 2X3WD 1ESRA 2EYMA 5KYLA 4BBRB 4DUZQ 2LQKA 1BI1A 2L3SA 2NLUA 2OT2A 3A5ZB 4IUUA 2WIIB 3EG2A 3CMAT 4M1UB 5CAIA 1FGUA 1FMWA 2EYFA 1J3TA 3FB9A 3FRPB 3K0YA 3TDQA 2EJMA 4CC3A 4RHSA 3J80i 1TUGB 3META 4M75A 4A3CH 3AT1B 4RCCA 5C3WA 4OGEA 3WOFA 1WIEA 1AVZC 1O80A 4KKTA 4JI2Q 2DNUA 2MPXC 4EMKA 1BI0A 1C1AA 5IE8A 1YJNA 3QG1A 4FYYB 4FYVB 1M3AA 2RJEA 1UGPB 3GP8A 3R93A 2KCMA 3QR8A 5GAMd 4LF4L 4H02A 2EFIA 3HKZB 1BCMA 3HFNA 5CORA 2MWOA 1N33L 2R92H 1S40A 3PO3G 3VS0A 1SN8A 1VQAA 1PKTA 4A4IA 1PZID 3HOZH 4GKJL 3GTMH 3MVVA 2EYZA 3K7UC 1WCMH 4TRDA 5IYDH 2SEBD 1HA6A 3JAME 1NBEB 1WJJA 1RAHB 3WVEB 1LT3D 3DM1A 5JPNC 2YUNA 3GNFB 5GANh 1KNAA 4MZPA 1E6HA 2HT1A 3CD6A 3TBIB 4RGTA 5IHIA 1YJNT 2DETA 1BU1A 1P92A 3C94A 3OS0A 4A3LG 3RIRA 1Q1EA 5ELBA 4PNOA 2IPKD 1QVCA 1MGSA 1U4PA 1SXTA 4DR2L 5C44B 4P2CB 1PTOC 2K04A 4DKAC 1JJGA 5IP7H 1W2BP 4RTWA 5D3IB 3V96A 3NENA 3TS2A 4JV5Q 1TXQA 2COWA 5GMKj 1UWVA 2HQLA 2PVGB 1ICFB 1ZYRD 3S14H 1HZ9A 1YFNA 4BUGA 2VB6A 1EX4A 1K9AA 1E0BA 1Y7XA 2E1HA 5KYXA 3JCMb 4H0LC 4CJ2C 1MSGA 4YY3Q 4PNYA 4IOAA 1N6AA 1I4QA 3VR2A 4RMFA 2WB1B 4HIKA 1GUSA 3SD4A 1LVKA 2ZJRA 5IP9G 4DV3L 1PH7A 2Q2UA 4LD9K 3CCMQ 3V7CA 1CHPD 5E1FA 3UT1A 4FIBA 3LWEA 4KK7A 2HL3A 1A63A 4C92A 5H1SE 5LJ5f 1LCKA 3MKDA 1IKLA 2E2IH 1PZKD 3Q1JA 1JQYD 4N8FA 2CP0A 1S5BD 1I81A 2NUPB 1QNUA 5EKKA 2PQWA 2E5KA 5HKCA 3CP0A 1M90R 1JJ2P 3GO5A 1JMCA 4DV2L 2R58A 1KTKA 4WORA 2KUMA 3L2QA 5C0XH 4JZ4A 3NP8A 1WNLA 4O6JA 1B1ZA 1BCOA 4Y91A 5C6SA 1KL9A 1SBBB 2WP8J 1E24A 2B2VC 5LMNW 4WJ3M 1GXIE 2Z6BA 3MEAA 3HKZG 1KIXA 1FD7D 4L63B 2PPBC 5M5YH 4QQDA 3CCRA 1DGSA 1I4XA 2AWOA 1WZOA 4K2LA 2WAQE 2DM1A 3QYHB 5CC4A 3NGPA 3F2UA 5I6YA 1TUCA 4JRQA 2JA6B 1XQHA 3I4NB 1G91A 1KIKA 1MGQA 1B8AA 1XNIA 1PYSB 3HOVH 1EQVA 1A3UA 2KQWA 5K5PA 1E1TA 2JA5G 1XMOL 3S15H 1YJWQ 3TSSA 3HOXG 1UECA 1GD7A 1NAPA 1HNXL 3EH1A 5GANj 3J7AF 4OONA 2EYQA 4IUVA 4C92D 1BBXC 2VVKA 3RR6A 1EIGA 4ZLTF 3V2TA 2H8HA 2DKGA 2K5NA 2KROA 2G9HD 5JOBA 2NUZA 4ZTJA 1MSHA 3OA6A 1L2FA 2DEUA 4OB2B 2A36A 2RD1A 4LD6A 4M77E 1V8QA 1R9TB 5C44G 3AEVA 4IN3A 1BOSA 1BYMA 4JBKA 1HA5A 3QWNA 5IYBH 2AHJB 1Y0MA 4ALPA 1B3QA 4HJ8A 4HSPA 4N9PA 1OEBA 3JCMf 2X35A 1U9RA 3R2IA 4KKUA 2QEXA 4A93B 2M00A 3L9AX 3F2CA 4PV1C 1UEBA 1ZHIA 5EAYA 3FIFA 1QKXA 2QKIC 3D4DA 1F2YA 2Z8LA 5IGDA 3CCMT 1IXDA 1LLRD 2HCIA 2K75A 4X3KA 5DEHA 1H9RA 2A68D 1WI7A 5J1ZA 4QIWB 3C0CA 3IAYA 3T16A 3SE0A 5A0DA 2H5XA 4P73A 2LCSA 4U673 3OW2P 3X25B 5ELNA 2KVQG 4TVAB 2D0OA 1Q95G 2EJGC 2NVYH 1Q82C 3NEMA 4TQUS 1WGSA 1XOVA 5J26A 4XDXA 3PVLA 1PKSA 1F2MA 2NUTA 4L8JA 2GGRA 2B8FA 1EIHA 4PJOG 5AFWA 2I2LA 1SDFA 5IY0A 2E65A 5C0XI 2R61A 2ZJQA 3NTKA 1M30A 4RTXA 2O4XB 1C0AA 4RG2A 2D62A 5AT1B 4MDXA 2QEXT 4LF5Q 2MJ8A 1CKAA 2AKWB 5GMKm 1PM3A 2OQ0A 2QDYB 4KH1B 2H1EA 2WFWA 3GTOB 2R92B 2Y4YA 3G71Q 1I0CA 2CREA 2EWNA 3H3VI 4DF7A 3PUXA 1WCMB 4ME3A 4ODGA 1SROA 3ER0A 3M53A 1II3A 2KEAA 5CQXA 4C0DB 3J80E 1QP3A 2YUPA 1JEGA 1GFCA 2Z9HA 3M9BA 4ZUJA 3TU4K 2RHUA 3D3RA 3Q6SA 1QCNA 1LTBD 1K8OA 2X69A 2JA6G 3EN2A 3I4NG 1AP0A 5D6YA 1YJWT 1M1GA 1YI2Q 1CK1A 2RSNA 4OGQC 2CW0C 4PJOA 2QASA 5LMUQ 1STEA 4F88A 4IJLA 1NPRA 3P75A 3C12A 4EIKA 1STNA 4HMJA 4JI8Q 1BR9A 3H9NA 3MEHA 3WOEA 2MIOA 2HCKA 5LJ5e 2XGTA 1CKNB 1LT5D 4ZK9B 4C0GA 3OYJA 1K8AU 3E6ZX 4OMNA 3P7JA 3JCMV 1HXDA 4KHVA 3R6NA 1G291 4HCZA 2N88A 3S1NH 3CPWP 1PHTA 4M75C 2LCLA 4F16A 4M7AA 2E6ZA 1KDCA 4C8QF 3DM3A 3NUCA 4FXDA 1OX9A 3H6MA 3VYRA 1X6OA 3K58A 4J9DA 1NSNS 2CWAA 1KABA 2YRCA 1KC8C 2BOSA 2M16A 3QO2A 4C5GA 3QWYA 3I90A 3S3OA 1GHJA 4CKCA 5EQ0A 3CCSQ 5IT9L 1QKWA 2O9SA 1TIID 2L5TA 2F0KA 3L2PA 4A93G 4NOYA 4OB1B 2KRNA 4NL2A 1SYCA 4GOPC 5F2DA 2E2IB 4JI0Q 1DD2A 2RQVA 1PSEA 1N34L 2JT4A 4NKLA 1OQKA 2VGNA 4O1NA 2JA7H 1ABOA 2F0HA 2LSSA 2CQAA 4FU6A 3LLRA 2RVLA 3NE5B 5CV5A 1I50H 1GOZA 1K0SA 3FJ5A 2M02A 3S17B 4N4HA 4JRIA 1UNSA 4YCUA 1YHQQ 1QVGP 1X3GA 3RLFA 2YU9H 2B2YA 4RAUC 2ASBA 3PNWC 4NL3A 3GTPH 3AYHB 4JRKA 1X6GA 3A8LB 1RCVD 5EGTA 2R93G 2RHXA 1MMNA 1ZUYA 4Z02A 1PTOB 2MP1A 3H0IA 3T1HQ 1SE3A 2KNBB 1HFGA 5J39A 2JE6I 1ZA2B 3DB3A 1LTGD 3TP5A 1Y96B 4ZTFA 1W6JA 4M7AD 2QF7A 4NXNL 1KK7A 1HHVA 3VU3C 5FLXL 5GAN6 4IJHA 2K52A 3QJYA 4QQGA 4RKUE 4M78E 1N9SA 4F7UF 1VQ4Q 1VQ7Q 3KYHC 4XXEA 4BY7G 2E70A 4KY6A 1HFNA 3Q0AA 2O5JC 3JCMe 3S15B 3HOWB 2KCCA 5FROA 2OTLQ 4M7DE 4LFAL 1Y8OB 1BK2A 4QKUA 2O88A 3OYBA 2I5LX 4K2KA 2IX3A 2Z4HA 4QY7A 4E6IA 1WVLA 1JB7A 1GM5A 3S1QH 2GQIA 4OMFB 1HJPA 1RTOA 1NMFA 2J0TD 2MF2A 2COYA 5T1GA 2HD3A 1TOVA 4A75A 4ZRZA 3UWNA 4UPAA 1RIPA 2SEMA 1K9MU 2FMMA 2XWJB 2JMAA 1M1KU 1UEAB 1KAWA 2GCXA 4OVAA 1S72Q 3HG9A 2UUCL 1PVOA 1TS5A 3E9IA 3TZUA 1STGA 2QGFB 1RACB 2RI5A 1PRMC 2MHVA 2MAMA 3RKWA 3DEOA 4C3IH 4POFA 2R5MA 5GANd 4V2SA 1ET6A 3D6WA 4KLKA 1BCPD 2P84A 1PRTF 1PH9A 2KCNA 4HCSA 2LRQA 1ILPA 4ATOA 1A8VA 2PI2A 2RNAA 4TKOB 3S2HH 1V1OA 1SFOB 4DR1L 5KYYA 1WHLA 2RI3A 1NYGA 3HFZB 4HSVA 1AZGB 2D2CC 5FK9C 4XU1A 5CMDA 2AWNA 1L0WA 3J7YW 3RZOH 4X64L 3OYLA 2QQRA 4XU2A 5C3EH 1M90C 3H41A 3GTJB 3VYSA 1VF5C 1MMAA 1F2LA 3UDCA 3VYHB 1VQIA 2A6ED 3RLNA 1RI0A 1ICWA 1HQMC 1D1KA 3EBEA 5IT9c 4MZ9A 5FLMG 2XG8D 2EW3A 1YITQ 1LYLA 1UE6A 2RBMA 1J5EL 4QQBX 4JI5Q 1KJWA 2JM8A 4P5NA 2FINB 2BE5C 3VJPA 1PYWD 4C3JH 2KCTA 4E7IA 1SYFA 4QVZA 2ZTCA 3JAML 2XVSA 5BN4A 3J81i 4DR7Q 2PZ1A 2MK5A 1NJIU 3OS5A 1VQPQ 2LX9A 1VYUA 3M59A 3NXWA 4HCEA 4ZQ3A 3M0SA 1VQ4T 1PLFA 2N78A 2RHYA 2P5ZX 3H8ZA 3Q22A 2JTEA 4JLGA 1XJVA 1H95A 2OTLT 4OEMB 3PMFA 3CXCP 3M4OH 2E3HA 3K6OA 2E10A 2BDNA 3HOWG 2EDGA 2LNVA 1W1FA 3L2UA 2CSIA 4KT0E 4FL6A 1SHGA 1F9QA 2VQFL 1ONLA 4MHEA 2O31A 2KXCA 1Y57A 2GVAA 5FWCA 1DOMA 2FVUA 4JI7Q 3FPPA 1K83H 3SK8A 2Q2HA 5FLXc 1VQNA 2P0PA 2JUFA 2ZPFB 1YWPA 4HT9A 8ATCB 3BVZA 4A4FA 2K9GA 3BY7A 3RESA 2EQJA 1S72T 2K03A 2EAYA 4YCWA 1LPLA 1K76A 1WI5A 5BR8L 4IFDI 1NMGA 1AW7A 1LJOA 3CCVQ 3CQZH 2K3XA 3PUZA 2X4YA 3Q24A 3I5SA 3REBB 2XRSD 3GTGH 2QI2A 3MJXA 1EFID 1Z9ZA 4M4ZA 5KIXA 1EOTA 4IKFA 3QZ5B 2D6FA 2LY7A 4DBQA 4ILWA 1I4GA 2YT6A 1TU2B 1XNRQ 4KHPL 3JCMX 2P4RA 2KQ3A 3KDFA 1I50B 2Z1CA 1IBMQ 1VQNT 1U3OA 4M77A 2HCCA 4DBHA 2PNHA 5CV8A 4KUIA 3RERA 3LGJA 2YTXA 4A4EA 2DIQA 1H3ZA 1UGVA 2DXTA 2QAZA 2J05A 3FRNA 4E7ZA 3KJOA 1PH4A 3PO3H 1FR3A 5IXBA 1VQ5A 1OU9A 3RMSA 3RMQA 2K5QA 2PQAB 3GTPB 1WPYA 3EIVA 4X66Q 4A3GB 4F14A 1VQOQ 4UAIA 5CBEE 5GAN2 1YITT 5IODA 2UU9Q 2X6GA 2OWOA 3FMCA 4FVMA 4BWGB 1IB8A 1H8KA 4PJOC 1GUGA 2CFMA 2F3VA 2SNMA 3QBYA 3MXUA 1HSQA 4I7ZC 4OIKA 5CGKA 3K59A 2VZAA 4LFBL 3KLRA 1B7TA 3PT9A 5C0MA 1VQPT 1LACA 4M75B 2AIRB 4LNQA 4A3LH 5I2SA 2DGYA 3UDIA 3OHXC 1G3TA 3K7AH 4YHHL 2JS2A 1UGRB 2C9OA 4FYDA 5LJ3g 1CKMA 5GAEC 2SNSA 5KYUA 5C6AA 4M7AC 5HGTA 3GTKH 4A53A 1LABA 1KRTA 4CC7A 2GQVA 4AFSC 2D9TA 2RA2A 4DNIA 1VQ5T 2B63G 3M4YA 4QVCA 2UUBL 3HKSA 1K9MR 1LTSD 4HIMA 4JC0A 4GOPB 1B53A 1EIYB 1M1KR 3JAMc 2OTJQ 5JPMC 1B44D 2RF0A 2L55A 2L89A 1B34B 3HP9A 4OMPA 4LF8Q 1PSFA 1UAPA 4N4GA 4M77D 2XK0A 2GVBA 5EPKA 4YWLA 3U58A 1KHCA 2FRYA 4UC4A 3V7SA 1NG2A 2AZSA 2DRMA 3CCUQ 2D0QB 4GN5A 4KGXB 1H9JA 1OI1A 2ENBA 2VNUD 5IP9H 3HGBA 3R3OA 1WHMA 1QLYA 1DM0B 2B2WA 4F7UE 4Y7NB 4DPGA 3CCVT 5CKDA 1TY2A 2B2YC 4BS9A 4MMKA 2A28A 4A63B 1WQWA 1NBWA 4PJLA 3S2HB 4DK3C 1QWEA 4PJMA 3CCEQ 1OXTA 2MO1A 4DUYL 5HURA 4WJ4A 1WYXA 3LX0A 4GLMA 4RFBA 3RZOB 1WDXA 2CUDA 4OHJA 4FW2A 1Q1BA 1PXUA 4G4KA 3S14B 1E6GA 3I4MB 4BI8B 3E9GA 1YP5A 4RGNA 3T1YL 3KFUA 1OPKA 4A3MG 1BBUA 5KYXB 3I56Q 2AZVA 3A54A 3OMCA 4JI3L 1M4VA 3W2DA 1AHJB 3P8BB 1UDLA 3HZXA 2JA9A 4F04B 2BCOA 1NJIR 1IL2A 2L4NA 1YNND 4E2FB 4A3GG 3J7ZC 1EQRA 2DMOA 2A6EC 3H0GB 3SGIA 1I4K1 5GADC 2XDDA 2ID0A 3P8HA 3TVTA 3EGDA 1IBKL 4DR3L 3SHWA 2QK0A 4XIGS 3J80L 5NUCA 2HQXA 1K3RA 2JA5H 5G3LF 3HOXH 4XTCS 2YSQA 4ME7A 1O7LA 2KGTA 1S5FD 4C3HG 2JEAI 4M75G 1E2ZA 3T53B 1ARKA 1X3PA 3ZJYC 1Y1WB 1VYTA 2JN4A 2RQUA 3HFOA 2ZPHB 1LOJA 4FYWB 2FHDA 3CMEQ 2BA0A 1FYNA 1ML0D 1NY4A 1WJSA 1KSWA 2EGEA 4Y92A 4C1NK 2F0WA 4PZ7A 1TWGB 5C44H 1T3SA 1Z47A 4LF6L 1JORA 3M0RA 2KT1A 2YTYA 4DV7Q 2KRMA 1X54A 5ELFA 3BDOA 2MUYA 3VYGA 1D1IA 2RK2A 1SLJA 2RMOA 3ONAB 1A0NB 3E9HA 4UDUC 5BN3A 5IGFA 2EYJA 3TSZA 4AFZC 2V8KA 3J81E 2MWPA 4AG1C 1S5ED 1G3WA 1LTAD 3CCUT 2DL3A 2XICA 3MP1A 4J7IA 1N36Q 2DVEA 2ZAEA 4M78A 2Y90A 1CI3M 3CQZB 1H9SA 3CKIB 5CQYA 3DWQA 3MC0B 4RGOS 3OYMA 1CKBA 5GAMf 1G83A 2EYWA 2FG0A 4LF9L 3GTGB 2PMZE 4M7DA 1AEYA 2NN6G 4NW2A 5C4ZA 2JQOA 4LF4Q 2JA8B 4B3RQ 2WACA 3LX7A 1STBA 1O7IA 2EKHA 1N33Q 2A6HC 1MMDA 2BH8A 2NWGA 2A69D 1STAA 2PNIA 4HVWA 3ULJA 2K6DA 2XTIA 3P20A 4GKJQ 1TR5A 1HNWL 2F0FA 1R0BG 4HAEA 1UE7A 4JS5A 1RKNA 4U68A 1FL0A 5LJ3f 3PO3B 3I4MG 4OWWB 1NZ9A 2ATWA 4CJ1B 3BDLA 3EGUA 2UXDL 2QDLA 1EWHA 5GAOn 2NUCA 4Z8AA 2YLBA 3ME9A 1D5MC 2ZZDA 3NTIA 3PFSA 1AN8A 3D4WA 3OS1A 2ABLA 3AB9A 5IGEA 3PIPA 1DOKA 4EGVA 2OAUA 2I5MX 1GXDC 3BDUA 3I35A 3H0GG 1SKUB 1OPLA 4DR2Q 2JA6H 4NDXA 3I4NH 1UG1A 2ECZA 1XWEA 1QVFS 4XK8E 4C92G 1YJNQ 3K7AB 2K6AA 2N49A 2Z4IA 4GZYC 1SF9A 5KH6A 3NBHA 3GTKB 1PRLC 1NE3A 3FHWA 4G57A 1IRXA 2NUTB 4M7DD 3H09A 1EU3A 1Y1WG 4B3TL 4JCVE 2KT8A 3M5AA 1NEGA 3GD7A 1TH7A 2PVDB 2V1RA 2DA9A 1LTID 2LZ6B 2PQEA 4N0AA 5EBDA 4DV3Q 5JJKA 1UUPA 2E5QA 4X65L 4RMOA 3J80c 1G2TA 1MJCA 2JK8A 2L15A 4IUPA 3OY9A 2QA4A 3S1RB 3TZDA 2EYYA 3A56A 3NHNA 2HKQB 4R9WA 4AFQC 2HSEB 4YWKA 3F2BA 2R7ZG 1Q81U 4X62Q 1CZWA 5T1IA 3CD6Q 4FT2A 1CQVA 3JV3A 4EPCA 4PKCC 4KJOA 5DM63 4A93H 2VB3X 3QXEB 2I0NA 2LCCA 1SJED 2DD5A 3JB9G 1RI9A 1KD1U 1NR2A 1SNMA 4H44C 4CHTB 4Q5WA 3TQYA 4DV2Q 1TXYA 3QZ9B 2LVMA 1U5SA 1EWIA 2Q8IB 3STBC 4F7XA 4ZCKA 1NUCA 2J6OA 4KULA 3N52A 1Q8IA 5FO8B 2GNCA 2YWWA 4C0ZA 4PJOB 1VQDA 1WOCA 3EJIA 2I0QA 4QCLA 2P0KA 2JA8G 2LMCB 2QGQA 4ABNA 3M56A 4A3BB 1QQJA 3A55A 4DU9A 5A35A 3N6RA 2MOXA 4QGUA 2QA4T 2DTHA 2XI9A 2CHBD 3SEMA 2JOYA 3JCMg 2K05A 4J9GA 4PLLA 4E6RA 4JYAL 4YWMA 1BI2A 1QVGS 5LMNL 1LM0A 2R93H 4M7AB 1DOLA 5CK9A 4RKBA 3J7A5 2FMCA 2C06A 1V9PA 4JK1C 1GCPA 1ZA1B 1O9SA 2CZ6B 3GTOH 4PJNA 1PTOF 2UXBL 1XMOQ 3MXGA 4K11A 4KN7C 4B08A 3EHQA 3HOUG 1YIJA 1VQFA 1CHQD 3H0HA 1HR0L 1N27A 3NQTA 4IIOA 4BXXG 4DR6Q 3REAB 4BY7H 2O2LD 3PMTA 4BA2I 1DYQA 3ERSX 2BUDA 3GV3A 2HAXA 4APVA 4AYBB 3VDYA 1L1OA 1C0MA 1W6XA 3HOXB 4POGA 1VQEA 5GAOr 2LS01 4IPHA 3A7LA 2A5HA 2JSOA 4Z9CB 3PIP3 1W70A 5GAN8 3KXTA 1SEMA 1F9PA 3VR6A 3H94A 2RSOA 1VF7A 5IHNA 3NSWA 2UXCQ 1Z7TA 4OL7A 2E2DC 1EQTA 3T56B 3H15A 1BBZA 2FPFA 2XIDA 2YDLA 4JDSA 4HT8A 3VUBA 5GAMe 2B29A 2KHSA 4Q5VA 3CCRQ 1K9MC 2B2WC 4IALA 5JJZA 1TUDA 2ENMA 2CGHA 1M1KC 1YNJD 3FKIG 4C5EA 5GAGC 4FO2A 3DUZA 2E4HA 3GPLA 1AOJA 3QPHA 1HTLD 2RQRA 1WTXA 1WTHA 2DTIA 4PMWA 4ELYC 2HMAA 3TCJA 1F9SA 2QG9B 1KAAA 1K0RA 1B2TA 5M5XB 2Z0SA 3CCJA 1RADB 3MA2B 4J9CA 1BUVT 1Q86U 2EOTA 3CD6T 1IHZA 2K1BA 2RCNA 2COZA 2ZPBB 5CKHA 4LE9A 3ND8A 5LJ3e 3CCQA 1AWWA 5I9OA 1IKMA 1HK9A 1ET9A 3TMEA 2AQ2B 3JCMJ 3OIQA 2D8JA 1VOMA 1X65A 2ZXPA 1KLGD 4R1JA 1GRIA 2FB7A 1QJOA 2HDLA 2VASA 2YUOA 4IPGA 2RO0A 4XTVA 5M3FG
chains in the Genus database with same CATH topology
1AE3A 3S17H 4O2DA 4A3BG 2B8AA 5HK0A 5FLMH 3CCJT 3BFMA 5J3BA 5GMKl 4GKKL 3M7NA 2NVQH 2EQMA 1YJ9A 5IWAL 3BZKA 1OZ2A 3CCQT 1G5VA 4M7AG 1OXXK 1X75C 4C8QD 3WWVA 1OXSC 2VV5A 1NJIC 4F7UA 4MZMA 4GLXA 4OWXB 3G6EA 4QIWE 4DUZL 2UUAL 3JCMW 1QUQA 1HR0W 3BW1A 4OWTB 3OYNA 4AYBG 3HOWH 1Y14B 1XNQQ 4DAMA 4HIDA 5L8RE 4ELZC 3OBYA 3IRBA 4JI2L 1G6PA 3X28B 1CSPA 1IBLL 3JCMc 3I55A 4M78C 3R6OA 2QTXA 5D6WA 3CCRT 3OS2A 1JE5A 2R7FA 3QO3A 1M9SA 1UGSB 4M7DC 2F52A 1I8FA 4L5SA 1MJEA 1W4SA 2MMPA 4DQ2A 3G6ET 1N34Q 2YTVA 2MO0A 4IFDJ 3L1AA 1SRUA 4C0FA 4HJ5A 2DAQA 1MKHA 3N5BB 2K4YA 2DZ9A 4C5IA 2BH2A 1SFOH 1KQSS 2RK1A 3I55T 5CKEA 1PV4A 4BD3A 1HZBA 5LL6S 4LDXA 3GTJH 4KBMB 2ES2A 2VQEQ 2VL6A 4J8OA 1FJGL 4NXNQ 3CEYA 3RKYA 3CBOA 3H6ZA 2ZTEA 2DD4A 3F70A 4JBWA 1CUKA 2HBPA 1K8GA 3RUXA 1VQ6A 1X3EA 3I2ZA 1JJCB 2BIVA 4L5TA 3OYGA 2K2VA 2ZM6L 3RLOA 5M9OA 4M75F 4N0AC 4PL6A 2VUBA 1EOVA 4LWCA 1CKOA 2X4XA 3SWNA 2NZHA 3OBWA 1V29B 3KDFB 5LJ5d 2B63H 3OTOQ 3S6WA 4BY1G 2UUCQ 2RHIA 5GANf 3CW2C 2LXKA 1VQ6T 4DV1L 1KXLA 3UPUA 2Y0SE 4JI4L 2F4VL 3ULLA 1GO3E 4LF7L 3UDGA 2XU8A 2KBNA 4DR1Q 5CCAA 5FRNA 2QQAA 4EMKC 4X64Q 4XU0A 4GLAC 1Q12A 3GNGA 3QKJA 5JEAJ 1YCYA 5CIUA 4MZTA 3SB2A 1VQHA 2VW9A 1FVIA 1EIFA 3A5UA 1AE2A 4QQ6A 1EFWA 2F5TX 1U1SA 3LW5E 3UE0A 4BA1I 4A3MH 1VQMA 3M55A 1VQ9A 4J6WA 1L1OC 1C7YA 4A3GH 2E5LL 2V8JA 2YV5A 2K5FA 2WAQG 3NELA 3PCOB 4AQYL 4K0KL 3PTAA 1SSFA 4MTNA 4DV0L 4C3HH 2VQFQ 1YVCA 5GMKe 1Y07A 3G4SA 3M58A 1QVFA 4DR4L 1VQMT 3MEUA 2K3YA 2P0QA 1VQ9T 2N3SA 1BIAA 4LDWA 4M77G 2A1AA 5BR8Q 3MEWA 4XAXB 4AH6A 2HHHL 3BZCA 2F3IA 4C92C 2PVOB 4E7JA 2I5HA 3JB9F 4TVRA 2CKKA 3G4ST 4Y7NH 1O75A 2IX1A 2MI6A 1XMQL 2RHSB 2FYKA 2OQKA 2KY9A 5HY6A 2O01E 1VQGA 3INZA 4A76A 3J81c 4GY5A 4JI6L 3PGZA 3OYAA 2KAFA 3S14H 4JI8L 1VQ8A 3I4MH 2DK3A 4FM4B 5HGQA 4PLIA 4LDUA 1M5Q1 5A0LA 2HNIA 1HZAA 1IREB 3H0GH 4M78B 5GANe 2H3JA 1D7QA 3S24A 4M7DB 2UUBQ 5JJLA 2JEBI 3W5OA 1KQ1A 2XHCA 2B3GA 1Y71A 1Y1WH 3CF5A 4DV4L 5GAOp 3V8LA 4OXPA 1TWGH 3OYYA 2L5QA 3AQQA 4DR5Q 4JUVA 3QSUA 4JOIA 2Z6KA 2K5VA 1PA6A 4B9XA 4JBJA 1Q81C 4A54A 2R7ZH 3WVDB 2Q2TA 2KSSA 1YHAA 1P8LA 4XTWA 3JB9H 3T1HL 2A19A 2LDMA 1V1QA 4ZGDB 1EYGA 2FXQA 2NN6I 4X34A 3PUWA 2CZ0B 3NBHB 4OX9Q 3T1YQ 2GN5A 2JA8H 3FP9A 4PJOF 4JI3Q 4A4KA 1T9HA 2VUMG 2RM4A 1KHIA 3PIOA 3KF6A 1OTCA 3PUVA 5GAOm 4DR3Q 3OSVA 4M7AF 3A74A 1XPOA 1JB0E 2GFUA 3HRSA 4C8QE 5ELOA 4DV5L 3V7RA 3HOUH 2AHOB 5GAMg 3U4VA 2LC4A 1SMXA 4BXXH 4MMLA 4JS4A 4A4GA 3KJPA 4M78G 1JBMA 2HIVA 4NB3A 1ZQ1A 5IN1A 4LF6Q 1X56A 1Q82U 4M7DG 3CC2A 1BBWA 3M4QA 2M0OA 4EMKB 1U5KA 3HHTB 2DUDA 4HCBA 3FKIH 4HIOA 1E22A 4DA4A 3URGA 4KI0A 2FL7A 1W2BS 2VS1A 3LWHA 3P8DA 3S1RH 3L2ZA 1K73U 3GF5A 3M4GA 1N8RU 1Q86C 3JB9I 2R5AA 4BBSG 3DLMA 3AFQA 4ZGJB 3CC2T 1L1OB 2CKZB 4E47A 4HJ7A 4A3JG 5EG2A 5M3FH 2UXDQ 1WJQA 1KQSA 2DTOA 2P4TA 4A3BH 5I21A 2V1CC 1JJ2S 4HCCA 4EQ5A 4PZ6A 4GNXA 3A8OB 1I94Q 4LFCL 2EQKA 2VGMA 1VQKA 4GS3A 4BDZA 5A0GA 5A2QE 1Y96A 4KUDK 1Q46A 4GN3B 3E9FA 3AFPA 5AJ3Q 5KE2A 2L8DA 3W1GA 4GN4B 4C92B 4B3SQ 4B3TQ 2HIXA 5CR2A 4BACA 2WSEE 4QVDA 4RG8A 1Z9FA 4O5VA 1VQKT 4OO1I 5CKBA 2EXDA 5C4XG 1Q7YU 2VXFA 1Y1VG 2K14A 1XPRA 4J83A 4B9WA 4X66L 4L5GA 4UP9A 4HJ9A 4QL5A 4VUBA 5M5XH 3F8TA 4JI1L 4A3FG 4QJFA 4J7FA 1QUQB 1VIFA 5FJ8G 3S3MA 4B3ML 3PV0A 4JYAQ 3SFMA 5LMNQ 4X9DA 2DEQA 2JTFA 4L6V5 3X24B 4XTXA 1D3BA 3OW2S 1YNXA 2UXBQ 3E1SA 5LJ5h 3MHXA 5C0XJ 3D0FA 3BU2A 3CC7A 4A3DH 4X6AH 4UY8C 4IFDG 3GIBA 3HPWA 1X9NA 3K81C 3DLLA 1QZGA 4JOIC 2Z6KC 4EMHA 4BY6C 4R4CA 4BY1H 1VIEA 3FEOA 4CI0C 3CC7T 4HJAA 2PUOB 2BA1A 2JTMA 4J15A 1K8AC 4YCVA 3LYIA 3HKZE 4OB3B 4NPSA 1MIUA 1BVSA 2NZOA 2GF7A 4XU3A 1IXRA 5M3MG 1LNXA 3PO2G 3I7FA 3CPWS 5CO7A 3NFCA 1X55A 3K0XA 4P75A 3MP6A 4F7UG 4D6WA 3CMAA 4M77C 3QIIA 3JCMh 3SWNB 3CCLA 1Q8KA 3QYGB 1SE8A 4J6YA 4GKKQ 5IWAQ 2VYTA 5JJIA 2NVTH 5D6XA 2EJ9A 2LQ8A 3WXMB 1VQLA 1KQ2A 2DIGA 4DV7L 5LJ5j 5GROA 2ZGWA 2WB1E 3L42A 1E3PA 3CCLT 1UE5A 2LT1A 4P72A 5JEAG 1HNXQ 3QHSA 4A3KG 1N36L 3V8KA 3HSBA 4DV6L 1IBLQ 2E6NA 2DXBA 3ASKA 2WSCE 4B3RL 4GOPA 1OXUA 1VQLT 3DB4A 3JC66 3MO8A 1B34A 4Y28E 3FLGA 1PH5A 3K80C 1N32L 1YEZA 2EJFA 4C8QA 1W3SA 5GQOA 2ZPEB 1YIJT 2CQOA 3KF8B 5LJ3d 3ZEHA 3CC4A 3LWIA 1BKBA 5CKFA 3A0JA 2JNGA 2EQUA 3W1BA 2KHIA 1HNZL 1I6HH 2PI2E 4L5QA 2JVVA 4A3IH 5K36G 4A3EG 4GNXC 1M1FA 3KLWA 4M75D 3RKXA 3PUYA 3KBGA 5GANg 1FJGQ 4L59A 2A3LA 2Q2IA 2QQBA 2GFAA 3V8JA 3TEHB 3MEVA 1FWZA 5GAN4 3CC4T 2BKDN 4LUZA 1HZCA 2CZ7B 5CVIA 2ZM6Q 2VC8A 4JLIA 4IUTA 2G3RA 4BBRG 1QW1A 5FU6C 2A7YA 4M78F 2X4JA 4X62L 1J6QA 2LXJA 4JRPA 2JN0A 2C35B 4M7DF 3A8GB 5GAN5 1GKHA 2CCZA 4DV1Q 2R6GA 3OYCA 3U50C 4JI4Q 2F4VQ 3CXCS 2MFIA 4LF7Q 1YJ9T 2PUKB 3H3VH 4E7HA 2A8VA 4DOWA 1RL2A 2QQ9A 5I2MA 5E7NA 1W2BA 3HOYG 2LTOA 5IYCG 1P16A 3GTLH 5GAN3 1KG1A 3X26B 1BIBA 3CCMA 5GMKi 4DR6L 1NE8A 1H641 2DXCA 3M9QA 4MNOA 2YHTA 4EX5A 1HH2P 2K5HA 2VUMH 1YHBA 4QW2A 2E5LQ 4E7KA 3JSCA 5C4JH 1PHJA 4DOVA 3OQ5A 5DY9A 2RI2A 3GTQH 2UXCL 2KK4A 2ZTDA 1NPPA 4AQYQ 1JJ2A 4K0KQ 3GLXA 4BY6B 3L2VA 1M8VA 4R4IA 4JV5L 3TS0A 4R4OA 1IYJB 4DV0Q 4XTUA 2WB1G 4A4HA 4A3DG 3CBMA 3UDFA 4YY3L 4DR4Q 3JB9D 4LFAQ