1BKBA

Initiation factor 5a from archebacterium pyrobaculum aerophilum
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
136
structure length
136
Chain Sequence
KWVMSTKYVEAGELKEGSYVVIDGEPCRVVEIEKSKTGKHGSAKARIVAVGVFDGGKRTLSLPVDAQVEVPIIEKFTAQILSVSGDVIQLMDMRDYKTIEVPMKYVEEEAKGRLAPGAEVEVWQILDRYKIIRVKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of translation initiation factor 5A from Pyrobaculum aerophilum at 1.75 A resolution.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Translation
molecule keywords TRANSLATION INITIATION FACTOR 5A
total genus 26
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 1998-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1bkbA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1bkbA02
2LSSA 2VUMH 1EYGA 1CKMA 4OWTB 1VQLT 1KC8C 4NXML 4GNXA 2UU9Q 1Q86U 1TWGH 2WAQE 1E1TA 4LUOA 2LVMA 3CC7A 2K14A 2WP8J 4AH6A 2VZAA 4A3BH 1L1OB 1KD1U 1IXRA 2Q2HA 1IBLQ 1N9WA 2IX0A 3S24A 1Q7YC 1Y1VH 1PYBA 3CPFA 1K73C 2NZOA 3JC66 5J3BA 4P75A 4P71A 4LFCQ 2HT1A 1PH5A 4DV3L 3P8BB 2WB1E 4GKJL 4BY1G 3KFUA 3ULJA 4UPAA 4FDBA 1XNQL 1S3OA 1HR0Q 4L5TA 2CFMA 1VQMT 2ZTDA 2IHFA 3I4MH 2LXKA 4HJAA 4YTLA 2OTJA 3CXCS 4A3BG 1D7QA 4UP9A 5FLXE 3LH0A 4JI4L 2Q2UA 4PZ6A 1VQLA 1YJ9T 1E1OA 4RG2A 2R93H 1PH8A 3NENA 4R4IA 2C35B 5HGQA 4DV0L 4A3MH 3HOXG 2UUBQ 3HKSA 4A76A 2BA1A 5AJ3Q 2JA8H 2E5LL 4OWXB 4A3IG 4POFA 2JQOA 4DPGA 4O2DA 2DO3A 3JAME 1VQMA 3U50C 1V9PA 4X34A 3CMEA 2KCMA 4QGUA 5IY0A 5C44H 1VQNA 2MFIA 1TXYA 4LWCA 5JJLA 3ER0A 2Q2IA 2UUCQ 3FHWA 3L2PA 1P8LA 2JA9A 2QEXT 1RL2A 3GD7A 3ERSX 2KENA 3J81c 2ZM6L 3HOYH 3CMAT 1KRSA 3PUWA 5IYDH 2F3IA 1Q82C 4B3TQ 5C0XI 4YWMA 1T9HA 3GTQH 2UXCQ 3B6YA 1GO3E 2OQ0A 2OWOA 5FLMG 3S1QH 4JI2Q 1I50H 3CCLA 3OYYA 2HIXA 2ZTCA 2VS1A 3J80c 3NEMA 4LF5Q 1Y1WG 1SRUA 1VQ4T 1HZAA 4DAYB 1M1KC 1HZ9A 3AYHB 3UE1A 4BA2I 2GN5A 3W1GA 2I5MX 4LUZA 3S2DH 1PFSA 4BXXG 4QY7A 4ALPA 3LGFA 3I2ZA 1HNXQ 1VQ6T 4OO1I 1K0RA 2V1CC 4YWKA 1N8RC 4LF4L 1VQNT 1EIFA 2N78A 3A5UA 3J80E 5C4XH 3G6EA 3J80i 1VQPT 1M1GA 1PH9A 1EFWA 4GKKQ 5C0XJ 4JI8Q 4BBSH 2LQ8A 3K80C 1KAWA 1OXTA 2B63G 4DK6C 1L0WA 4L5SA 1WYDA 4IPGA 1A63A 4DV1L 3NELA 3HOVH 4IPHA 4DV2Q 4LF8Q 3KDFB 3U4ZA 3I56A 5K36G 1SLJA 4DR7L 1YBYA 4PZ7A 4AYBG 2R93G 2CQOA 4B3ML 4J15A 3CCQT 3S15H 1L1OC 1HNWQ 3M85A 2K5NA 2R6GA 4B3SL 1SROA 5IP7G 2A1AA 3F8TA 2RHSB 1UWVA 3KDFA 2OTLA 4BY1H 3CD6T 1JE5A 2AMCB 1L1OA 4LFAL 1ASYA 5IP9G 1VQ5T 1TWHH 2JJQA 1XMQQ 4DV4Q 4LFBL 3J81E 2KCTA 1BKBA 2R7DA 3M9BA 1LYLA 4NXNL 1EUJA 2YYZA 5IP9H 4JI4Q 2E70A 1JT8A 1QVGA 1X3GA 1JMCA 5GAEC 2YU9H 4DR1L 2IG0A 3RN2A 5AJ3L 2I5LX 3M7NA 1VS0A 3CD6A 2YTYA 1U0LA 3CCUT 3TS2A 1W3SA 2DGYA 2K50A 5GAHC 2R92G 4JI1Q 1FL0A 1PH1A 4JI3Q 3TQYA 2L3RA 3CCMT 1QVFS 1VQBA 3RLOA 1A8VA 3U4VA 3J81j 4JYAQ 1QZGA 3PO3G 3T1YL 2JA5G 4BY7H 3S2HH 5FJ8G 1N36L 3A0JA 2B63H 1YI2T 3OTOL 2I0QA 1Q1EA 4A3FG 5M3FG 2NVTH 2EIFA 4IPCA 1NE3A 3HOZH 2CWAA 4LF9Q 4YY3Q 2K52A 5C3EH 4JBMA 4GN4B 4A3GH 5C44G 1PH3A 4NPSA 5M5WH 2QGQA 3KJPA 1PV4A 5IWAQ 4DR3L 4A3KG 2JA5H 4BY7G 3EIVA 2VNUD 2I5HA 3K7AH 4IFDG 3CCUA 1FGUA 4JI0L 1SE8A 1HNXL 2YTVA 5H1SE 4OXPA 1FJGL 4ME3A 2BH8A 3AFQA 4JBWA 4LF4Q 3PUXA 2XHCA 4JI6L 3G71T 3NBHB 3PCOB 3F2DA 2E6ZA 3I4MG 2AWOA 2NN6I 4DV5Q 1VQKA 5IYCG 1M90C 1KHIA 3PUZA 3ICEA 2Z0SA 2YV5A 1TWAH 3A74A 4JI5Q 4A3EG 4P73A 3I7FA 3EBEA 3RLNA 3CC2A 4JBKA 2B29A 1X55A 3S1MH 1HJPA 1Y14B 2VY3A 4IFDI 4QJFA 1Q82U 3FKIH 3W1BA 3PV0A 4X62Q 4QQBX 1N32Q 5GAGC 3STBC 4DR5L 1GM5A 1VQ8T 3CPWS 3RNUA 4C3JH 4LNQA 2ASBA 1A62A 2NVYH 3K8AA 2VQEL 1IBMQ 2PI2E 1M90U 1HR0L 2NZHA 2WB1G 3CCVT 2PMZE 1VQDA 5BR8Q 4K0KQ 1ASZA 3HOXH 4B3SQ 2QA4T 1KL9A 1E3PA 3LGLA 3CC2T 3D0FA 4HJ7A 2MO1A 1W2BA 4WJ3M 3I4OA 5M5XH 5IYBH 2EQSA 1XPRA 3F2BA 4C3HH 4IOCA 2F4VL 1DGSA 4P74A 1UE1A 4LFAQ 3T1HL 3HOVG 3GTLH 1Q12A 1EQRA 4JI7Q 4DV4L 4LFBQ 3FKIG 1IL2A 3H3VH 1EWIA 2JK8A 4XTCS 1VQFA 3GTJH 4LUVA 3I55A 3MXNB 4X64L 2WAQG 2IX1A 1CKNB 3GTMH 1I94Q 4L5QA 2QEXA 4BA1I 5LMNQ 4JI7L 1KQSS 5GROA 1IBKQ 4DK3C 4DNIA 4GOPB 2UUCL 5C4XG 1WOCA 4AQYL 1NZ9A 3DB4A 3PUYA 3PSIA 1I3QH 1QZHA 1VQJA 1H95A 3G4SA 1P16A 3HOWH 1PVOA 4JI3L 3CCJA 1KXLA 3CC4T 5HY6A 1Q46A 3L0OA 3GTOH 1VQ4A 1WJJA 3H3VI 1V1QA 3K81C 3ZJYC 5DLQE 4TQUS 4GOPA 3HOUG 4BXXH 3E0EA 1N36Q 3DM3A 1PA6A 1L2FA 4LF5L 2JA7G 1Q86C 3CC7T 1IYJB 2PQAA 3OTOQ 4A3KH 4UY8C 4HIMA 1J5EQ 2KDSA 1NBWA 1CSPA 3CW2C 3TRZA 5LL6S 3KYHC 4R4QA 1QUQB 4TVAB 1K8GA 1WCMH 1A0IA 2PI2A 1HNZQ 2RHQB 4JV5Q 3BZKA 4GLAC 1VQ7T 3PIPA 3STBD 1N34L 3UDIA 4A3FH 4LF6L 5GADC 1KC8U 2E2HH 1FVIA 2MQHA 4XIGS 3EN2A 3U58A 1WCMG 2A8VA 4A75A 3BJUA 3KF6A 4JI0Q 5LMNW 4PG3A 1X3FA 2Z6KA 1YHQT 1YJWT 2NVXH 4GKKL 1YZ6A 3LGJA 1J6QA 3BU2A 4JI8L 2VQFL 1PH4A 2JUFA 1N33Q 2R7FA 2R92H 2JA7H 4B3RQ 1VQOT 2VL6A 1QVFA 2E8GA 4A3MG 4DV5L 1SMXA 2E2IH 1SN8A 3CXCA 2F52A 1G51A 2Y0SE 3CCQA 4JG2A 1X54A 4NB3A 3W5OA 2NVQH 2WFWA 2MWPA 2UXBL 4CRIA 4R4TA 4PMWA 3RR5A 5A2QE 3AEVA 5E7NA 3CCLT 3GTGH 4DR6Q 1EIYB 3S1RH 4X62L 1B7YB 2YTXA 1VQ9T 3H0GG 1YHAA 3CPWA 1XNRQ 3GO5A 4GLXA 2KHIA 1Q81U 3J7AF 1VQ6A 1BVSA 1E22A 4QIWE 3I4NG 1JJ2A 4NXNQ 2D62A 1VQIA 4RMFA 5C0XG 3PF5A 2UXDQ 1Q8KA 1VQOA 1OXXK 1VQ7A 1X9NA 3MEFA 3T1HQ 1OXUA 2JE6I 4X66L 2CCZA 4DV6L 1N32L 4DR2Q 4YWLA 2ALYB 1PH7A 1S40A 5DM7R 2KBNA 2CKZB 2UUAQ 3CP0A 4X64Q 3CF5A 2LXJA 1LM0A 3RZDH 4JI1L 5JEAG 1XTDA 1M1KU 1CSQA 2B3GA 1QUQA 2OTJT 2ZJPA 1R9TH 3M4PA 1IBKL 2K5VA 1YI2A 4DV7L 4AQYQ 2PQAB 4KLKA 4HJ9A 3HOZG 1NPPA 4KHPL 1VQPA 2R7ZH 3S16H 1I5FA 4A3JG 1AH9A 2XGTA 1Z47A 3KF6B 4A3EH 4POGA 5FJ8H 1EQQA 3WWVA 2IY5B 2IT1A 2RF4A 5IYCH 4X65Q 4LF9L 3CMET 3E9IA 3RLFA 1VCIA 1PH6A 4GOPC 1KIXA 1YJ9A 1WFQA 3TEHB 2HHHQ 4DR4L 1VQ5A 1GKHA 1X56A 2GVBA 3HOUH 2HQLA 3KJOA 4QL5A 1Y1WH 3M4OH 1OTCA 2D0PA 3VDYA 2AHOB 4GN3B 2ZJQA 5J26A 4YCVA 1FJGQ 1B8AA 3HOWG 4JOIA 4PZ8A 1N34Q 3CAMA 2PNHA 3AQQA 1OXSC 1KQSA 3PGZA 2OTLT 1SR3A 3M4QA 4HJ5A 5IYDG 1XPUA 1X3EA 2ZTEA 4HIOA 1XMOL 3CMAA 4ZN1A 3K7UC 4KI0A 4LF7L 3OW2S 1UEBA 4H02A 4OX9L 4R4OA 3TS0A 1HZCA 4JI5L 3PIOA 4DUZL 1N33L 5IP7H 1YJNT 3HKZE 1LTLA 3RZOH 1K73U 2JOYA 1YJWA 1YHQA 1S72A 3PUVA 1BBWA 1OXVA 1VQGA 4GLVB 4MZ9A 5M3MG 1Q7YU 2AWNA 1TWFH 3K0XA 4O0AA 5JJKA 5IYBG 4HIKA 1MJEA 2CKKA 2N3SA 5GQOA 3H15A 2N49A 2JVVA 4DR5Q 1AE2A 5ELOA 3DLLA 2VQEQ 4MNOA 4YCUA 1IBML 2AKWB 1JB7A 2ZJRA 5BR8L 3PO2G 4K0KL 4UP8A 3S1NH 1K3RA 2D0OA 2VW9A 4BBSG 2K5HA 1X65A 1XNRL 1K83H 1U5KA 3CCSA 3E9HA 3Q8DA 4UP7A 4BBRG 2F4VQ 5FLXc 4DUYQ 3G6ET 3I56T 1WI5A 1AE3A 5C4JH 5EAYA 4AYBE 3SGIA 1JJGA 3IRBA 4A3DH 2JA6G 3J81i 5ELNA 4GNXB 3GTKH 3JAMc 4BBRH 2EXDA 1I94L 1QVCA 4A93G 5LMNL 4JOIC 3BZCA 3HKZG 4DV0Q 1VQKT 2UUBL 1C0AA 4DR2L 3CCST 3CC4A 1XJVA 5M5YH 1XNIA 2VUMG 3F1ZA 4TVRA 1C9OA 1XPOA 3GTPH 5M3MH 1YJNA 4DV7Q 2BH2A 1YITA 4C2MH 1VQHA 2K4KA 2ZM6Q 1S72T 3KOJA 4DKAC 3L7ZC 1RIPA 1PYSB 2JEBI 3UE0A 4DAMA 5IE8A 1JJ2S 4A3JH 4B3TL 1QVGS 4R4CA 3AFPA 1J5EL 2E2JH 2IHEA 1VQAA 2NN6G 4R1JA 4L5RC 4A3CG 1CUKA 4EX5A 3G71A 4MTNA 1C7YA 1HNZL 1NJIC 4JV5L 3TREA 4RG1A 4DR4Q 3HFZB 3OW2A 3KLWA 4IJLA 1X6OA 4LF6Q 3M3YH 1I6HH 2L15A 4QQDA 2K75A 3KBGA 1GVPA 1GD7A 1IZ6A 2KVQG 5IT9c 5LMUL 1VQEA 4HJ8A 4A4IA 3FP9A 5JEAJ 3DB3A 1B70B 4YHHQ 1NTGA 1YNXA 3CCRT 2VQFQ 1UE5A 3CQZH 1K8AU 4OWWB 1KD1C 1HH2P 4B3RL 5JJIA 2BA0A 3I4NH 1NMFA 4JC0A 1VQ8A 1CKNA 1XMOQ 4NXMQ 2HIVA 3ULLA 3G4ST 1E7ZA 4A93H 4IOAA 4OX9Q 1E24A 2UXBQ 4DUZQ 2JA6H 1IBLL 1YIJA 2GVAA 1HR0W 1Y1VG 1YHBA 2MI6A 4DV1Q 3CCMA 1HZBA 3S14H 4DV2L 4LF8L 4DR6L 4LFCL 1YITT 4A3LG 4IO9A 1YVCA 4DR7Q 1TWCH 1NY4A 4JBJA 4DV3Q 1PH2A 4GKJQ 4B3MQ 1HNWL 1NMGA 3PO2H 1XNQQ 1K9MU 2JA8G 2DUDA 2MWOA 3CCRA 1K8AC 1BBUA 1O7IA 4ZN3A 2MNAA 4HIDA 2UXDL 2RCNA 1Q1BA 4DUYL 5IAYA 1JJCB 1UE7A 4KHPQ 4X66Q 3UDXA 4DV6Q 3G48A 1XMQL 2ES2A 1YEZA 1G291 4Y7NH 4A3LH 3CCJT 2E5LQ 2JNGA 4Y52H 2UUAL 4APVA 2Y0SG 3A5ZB 4OO1G 4GS3A 2H5XA 2UU9L 3S17H 3H0GH 4JCVE 2OCEA 3RN5A 1NJIU 4DR1Q 3UDGA 3CCET 4IJHA 2ATWA 4C3IH 1SFOH 4IFDJ 2CWPA 2Z6KC 1V43A 1MJCA 3D31A 1W2BS 5IT9E 3GDEA 2Q2TA 2UXCL 4JYAL 3F2CA 1EOVA 1Q81C 1YIJT 4GNXC 2QA4A 3T1YQ 4X65L 3J7ZC 1PHJA 4JI2L 1VQ9A 3J7A5 2A19A 1VQCA 2HHHL 1D8LA 3CCEA 1N8RU 3ULPA 2MO0A 4YCWA 4WJ4A 3UDFA 4OONA 4EQ5A 4A3GG 1LUZA 4AIMA 5FLMH 4YY3L 1CKOA 5C3EG 1SSFA 4A3CH 4X6AH 2JEAI 3CCVA 4P72A 2R7ZG 1NPRA 1UE6A 5M3FH 5IWAL 1MKHA 4IPDA 2KHJA 4KHZA 2OQKA 4DR3Q 3HOYG 3PF4A 2N8NA 1G6PA 1MIUA 1KRTA 1Z9FA 5LMUQ 2FXQA 2ID0A 2XTIA 3KF8B 2G3RA 4GN5A 4LW1A 3JAMi 4LF7Q 4YHHL 3PO3H 4A3DG 1K9MC 2LCLA 3I55T 4JI6Q 4A3IH
chains in the Genus database with same CATH superfamily
4OGQC 4LXCA 5FRNA 3D8GA 4F88A 2VUMH 1QCNA 1VQLT 3CRLC 1KC8C 1RCVD 4NXML 1QCOA 2WAQE 4LUOA 4G7HC 1M8AA 2K28A 4DK1A 3N52A 2CH4W 4FNFA 4OIJA 2WAQB 3LH5A 4A3IB 1MHWC 3JB9I 1OZ2A 3V8JA 2IX0A 1Q7YC 2LRQA 2X6LA 1B9NA 1A3VA 2OF1A 4LFCQ 3CRKC 3TU4K 5DNFA 1B34B 1PH5A 1AZPA 1X75C 3VYHB 3CCQQ 2OTJQ 1TG0A 5I9OA 3KFUA 3ULJA 3FDRA 1XXGA 4UPAA 3ND8A 3E19A 1HR0Q 4L5TA 1G2BA 1VQMT 4ZUJA 3OYJA 1NJIR 1U06A 1Q86R 1NR4A 3LH0A 2L0CA 1D5XC 2Q2UA 1VQ6Q 5C44B 2ZPFB 1E1OA 2YLBA 4KHPL 4DV0L 5HGQA 3FKIB 1EX4A 3M54A 3MHBA 3ERQA 2E5LL 3QB3A 5ELDA 4AT1B 2DO3A 1VQMA 5C44H 1UHCA 1B7TA 2ZPBB 1CM9A 2KCMA 2ICIA 2EYHA 3MA2B 2MFIA 4A4FA 4LWCA 2X3XD 2KYBA 1ILPA 2R5MA 2JA9A 1OEBA 2D0QB 4E7HA 2RM4A 1WTHA 2ZM6L 4J8OA 1PD1A 3CMAT 2RDHA 1EIHA 2F3IA 2XMFA 2EXZA 3C0CA 3BG3A 3GTQH 2UXCQ 4MZTA 4IZ8A 4I7ZC 3AMUA 2P4TA 4BD3A 1KQSP 4X3UA 3E6ZX 4FF1A 2WSEE 1PSFA 2FMCA 2XRSD 1M3BA 3EGUA 2KYMA 1JE4A 2EVBA 3A55A 3EQLC 3NEMA 3E2UA 1Y1WG 2GTJA 1CZGA 2GN5A 1RAEB 3M59A 3QDFA 4LN2A 1O7ZA 2DY7A 2X4JA 2IL8A 4HCKA 4IFDH 3JCMg 5IGCA 1Z9ZA 4M78B 3G6JB 3QOLA 4TKOB 3OW2P 4R55A 1VQNT 3TP7A 4XU3A 1EIFA 2B86A 4CKCA 4QUCA 3A5UA 5FU7B 1MHNA 5C4XH 3G6EA 1JWUD 3H8ZA 2DL8A 1KG1A 3OB9A 2K03A 4MN3A 4ZKCB 1G3YA 4Q5VA 4U68A 2WACA 5CV8A 3I56Q 3CU7A 3HEJA 5FW9A 1F9QA 4DK6C 5T1IA 1ICWA 2QQAA 2KJXA 2RHZA 3V96A 5J22A 1IW7C 4DV2Q 2DNEA 2D5DA 2Y4XA 4PZ7A 2B8FA 5D7UA 4J15A 1VF5C 3CCQT 2RK1A 3JSCA 2D8JA 5KYUB 3CBMA 2R6GA 4B3SL 2NUTB 4LDUA 4XQ3A 1L0XB 4RTWA 1S5CD 1SE4A 3R8BA 4BY1H 2AMCB 1L1OA 1YJNQ 5IP9G 2F0LA 1TWHH 3Q0AA 2GNCA 2JJQA 4LFBL 2KCTA 4M78C 1YNZA 5IP9H 5AYFA 1M90R 2KEAA 2O5JC 5M3MB 5GAEC 4DR1L 4EMKC 5GAOl 2IG0A 3M55A 3RN2A 4E6RA 1U0LA 4QUFA 3TS2A 1M3AA 2YSQA 1W3SA 5GAHC 4LDVA 4JI1Q 3NP8A 1LTAD 3JB9G 1TU2B 2PTKA 4KJOA 3RD4A 4JYAQ 4M77A 2VV5A 5GANf 1VQBA 3G6EQ 1WTVA 1LNXA 4FSSA 1H9JA 1QZGA 3JB9F 5C3EB 5FJ8G 1WJQA 3ZEHA 2DXTA 1FYNA 1TS9A 5IHIA 4C0DB 5M3FG 1PMRA 1WHMA 1BF4A 3VV0A 3OIPA 1VIEA 2CWAA 3HOZH 4YY3Q 4JBMA 4GN4B 4OGEA 1TXQA 3TSWA 1IW7D 3HPWA 2M9UA 3K6OA 1ZUUA 3A7LA 1PV4A 3CQTA 5KCOA 1PZID 2JA5H 1HA6A 4M77C 4RGTA 4IFDG 4JK1C 4DXGA 3CCUA 3K59A 4JI0L 3MEHA 2EJGC 3FEOA 2Z9HA 4JBWA 3PUXA 1IYUA 2DKGA 2RH2A 5IGGA 2K7AA 3T53B 5JPMC 4CJ2C 2VXFA 1TS5A 4OMMA 1VQKA 1F9RA 4EQOA 1M90C 2PW5A 3PUZA 4KKTA 4PQXA 3ICEA 1I8FA 4P73A 3P1HA 4PNOA 4OMNA 1LT4D 2F0IA 4EMHA 1UGQB 2RA2A 1MMAA 3S1MH 4H13C 4X62Q 5G3LD 2SEBD 2LFNA 4CDEC 4XYOA 2LJ1A 3DWQA 3STBC 4QQ6A 3CPWS 1VQ8T 4C3JH 3LWEA 3LWIA 1A62A 1H9KA 2CQAA 2RQWA 2NVYH 4NW2A 2KR3A 2PQEA 3CCVT 1VMCA 1VQDA 1XWEA 1Y96A 1QB5D 1MNDA 4RGNA 4XDXA 2A73B 4JW0A 4OP0A 2ZXRA 1W2BA 2EYWA 3F2BA 1HFGA 3HOVG 4AG2C 1Q12A 1EQRA 2K04A 4DV4L 3FKIG 1PSEA 4NP5A 1AW7A 4JJDA 4XTCS 3H3VH 2QTXA 1VQFA 3O13A 2IX1A 1VYUA 1KDBA 2DL5A 2JMAA 1EYDA 2EY2A 1YWOA 1IBKQ 4DF7A 4B6MA 4CKEA 2UUCL 1R9TB 2L12A 2RDGA 3DB4A 3BVZA 1TIID 2K5DA 3KUPA 4FVMA 4JJCA 1T0HA 1IL8A 1SYGA 3CCJA 4L63B 3THKA 1V1QA 2XIDA 4J8QA 4BXXH 1X3QA 2PNIA 3E0EA 4RTTA 3R2TA 1N36Q 2JA7G 1I4RA 3D4WA 1PA6A 2PQAA 3OTOQ 3UATA 4OMQA 4A3KH 2COYA 4QT7A 3OS2A 3CCVQ 2QI2A 2KDSA 2L2PA 4PFPA 3CW2C 1S4ZA 5LL6S 5LJ3h 2KHSA 4JRPA 5CKBA 2HKNA 2DLPA 1WCMH 4DGZA 3HOVB 4C0GA 5D6XA 2J7ZA 4GLAC 1VQ7T 2PCFB 2Z6BA 1N34L 3STBD 1WJSA 1SAPA 4A3FH 1PRMC 2MF2A 2YRDA 1KC8U 3IFDA 5A0LA 3ONAB 3HRSA 3EN2A 4J6WA 4GZYC 1BO0A 1OX9A 2AZSA 2KQWA 5LMNW 4N8X1 2BE7D 1ZA2B 4M7AB 4NKLA 3MXUA 1YHQT 1YJWT 1X69A 3VUZA 1YZ6A 3LGJA 1Q82R 1Q81R 1Q3LA 2VQFL 2KK4A 4LD9K 5GMKh 5A35A 1YI2Q 3CXCA 2F52A 1G51A 1WHKA 1CK1A 4MZMA 3RMHA 4OB1B 4C3JG 7AT1B 1OU8A 1VYVA 3D7SB 5KRUA 1SYBA 2EYFA 3RR5A 2JA7B 1WGSA 5GAMd 3HHTB 4XTVA 1KAAA 1SEMA 3C1EA 1EIYB 3S1RH 4M77G 3GF5A 2YTXA 4OF1A 3H0GG 3U9SA 3EA6A 4OGCA 3V2TA 1TTHB 2O5IC 1Q7YR 1U3OA 5KE2A 1HFNA 1UGRB 3M0TA 1Y7XA 3E9FA 3PNWC 4NOYA 3GTGH 1LACA 4NXNQ 1UGSB 3VR6A 1SNQA 2C9OA 2B63B 3E0JA 4RGOS 3T1HQ 2LY7A 1SNOA 2C0IA 2QILA 4X66L 1N32L 1PH7A 2A28A 4YWLA 2DN8A 2KBNA 3LYIA 2DTIA 2BOSA 3CP0A 1W70A 2B2YA 3R93A 1HK9A 3RZDH 1BIBA 2B3GA 1CSQA 2OTJT 1G2SA 4RKBA 1R4QB 2J7IA 1YCSB 3L9AX 3HOZG 2VYTA 3RZDB 4A3JG 2WKDA 2XGTA 4IUTA 1Z47A 3FPPA 1AH9A 5FJ8H 4CJ0B 2HBWA 3PE0A 1EQQA 5CK9A 4OL7A 4O5VA 4LF9L 4KT0E 2A6HC 2EQUA 4IUPA 4FYYB 4EVOA 1SKUB 4DAYA 3E9IA 1VCIA 1PC0A 5KYYA 1H9MA 1WFQA 2A6ED 3MFGA 4E47A 4XXEA 1T3SA 2V26A 4DR4L 1GKHA 4K6DA 2F5TX 3R6NA 4QL5A 2DFUA 1Z6HA 1OTCA 1BCPC 1LTID 4AFSC 2BIVA 4HSVA 2EZVA 4GN3B 2GTOA 4M75E 2AUJD 3WXMB 1B8AA 3HOWG 4JOIA 3HL8A 3CAMA 2PNHA 2F0WA 1OXSC 3AQQA 3PGZA 5KNCA 3HOUB 1UGVA 4XTXA 4M7AF 1XPUA 1VQ4Q 2E5QA 1SPKA 1UG1A 4ZN1A 1RAHB 3K7UC 2J06A 4KH1B 2PVGB 4M7DD 4OX9L 1AZQA 1F2MA 1YJNT 2NTSA 1TUCA 1LTLA 3RZOH 1K73U 4ZGJB 2JOYA 5EG2A 3PUVA 4GLVB 4A4GA 1BBWA 4AFUC 2FHTA 5JJKA 5DY9A 5IYBG 4FF3A 2YUOA 1RAGB 5GQOA 1UFFA 2N49A 3TMEA 5ELOA 1K83B 4MDXA 2JJ9A 3E5SA 3QJYA 2AKWB 5GAN6 1WXTA 2EVRA 3PO2G 5FWBA 1K3RA 2D0OA 2GFUA 1D1AA 4G7ZC 2QYZA 4PJOA 3SK5A 3E9HA 2W10A 1I07A 4DUYQ 3M5AA 2R58A 2RB6A 2RN8A 3I56T 1AE3A 1JWSD 2KEDA 1ZUYA 2AT1B 1NE8A 2DXCA 3SGIA 4XQQA 4AYBE 1ML0D 3WOEA 1UDLA 3J81i 3M0PA 1NNXA 1G8ZD 1RF2D 3GTKH 4BBRH 2H3EB 1I94L 1GFCA 5D6YA 2F0HA 4JOIC 3BZCA 2M1HA 3HKZG 4DV0Q 1VQKT 2I2LA 5KYLA 1WQ7A 3EH2A 2WINB 1JR0D 3EVQA 4IURA 1GXDC 1DONA 1U1TA 1XNIA 2FPEA 3Q24A 4CJ1B 2GF7A 3I5SA 3META 4ZTFA 1S5ED 1YITA 1HUMA 2BH2A 4QCLA 2ZM6Q 1VQHA 2LDMA 4X9DA 4H0LC 1S72T 5KYXA 3KOJA 1YCYA 3MCAB 3UE0A 5IE8A 2KI7A 1YITQ 1SYEA 1WHHA 2IHEA 1FNVA 4UDUC 2JTFA 1WJRA 2FZKB 1QMCA 1C7YA 5J1ZA 3OHXC 5JEAH 1Y1WB 5CV4A 4IJLA 3M3YH 1BCPF 4QQDA 4ELYC 2L8DA 2K75A 1NG2A 2HKQB 2L15A 3CQZB 5C6AA 5IT9c 4J9HA 1M2VA 1PWTA 1VQEA 3F2UA 1LO5D 3U23A 1I5OB 1TWAB 3FVQA 4A4IA 5IGFA 3FP9A 1K73R 2CSQA 3DB3A 4YHHQ 5CV7A 4XU2A 1YNXA 3CQZH 1FWZA 1K8AU 1KD1C 3TP5A 5I4DA 4OWWB 2RBMA 3S1MB 1L0YB 1N6AA 1RLPC 1WYXA 4KGXB 1XMOQ 4PJOB 3K7AB 4OMLA 2NZ1D 2PW7A 4A93H 1N5ZA 3PFSA 2QGFB 1DOLA 2F0PA 3JCMQ 1S5FD 5C3WA 2BE5C 2UXBQ 5ELCA 4DUZQ 1IBLL 5GANg 2K5LA 5LJ5j 2M51A 1J9OA 1D2BA 3MXPA 4ME5A 1Y69U 1G91A 3S14H 4DV2L 5EPJA 4L6V5 2FPDA 1OX8A 2HL3A 2KSSA 1TWCH 2SRCA 4DV3Q 3M57A 1IB8A 4OB2B 2EJ9A 2JSOA 3GNFB 2HBPA 4C8QD 2DIGA 2Q8RE 1II3A 3K58A 2PYKA 2MHVA 4U673 2FVUA 4L6TB 3S3NA 1K8AC 2DEUA 4LD6A 3TQ7P 2RKSA 2FINB 3MEVA 2ROTA 2RCNA 2UXDL 2DF6A 3HTRA 4J9IA 5IAYA 1JJCB 4XT3B 3OW7A 3ASKA 4A3LH 2O31A 1GBQA 2HMAA 2P4RA 2VC8A 3MPUB 4JRQA 1W6KA 2DJFC 3GTKB 1N8RR 4JPBW 2Y0SG 1DXMA 2G9HD 5FKAC 3J7AV 5I2MA 3X20B 1TT2A 4GS3A 1HHVA 4JCVE 3Q23A 4LDWA 1SE2A 4DR1Q 5LJ5f 4FO2A 3GP8A 4C3IH 2VGMA 4OB0B 1KNEA 1V43A 2KQ3A 3ZYYX 4AMCA 3D31A 3RMSA 4M7DG 2Q2TA 4JYAL 3F2CA 2CGHA 3S6WA 1YIJT 2KRNA 4X65L 1A15A 1PHJA 3EGXB 1LT5D 4M7DF 4F14A 2F0DA 1W4SA 3TEEA 1N8RU 4PMCA 4WJ4A 4WTOB 5IXBA 5FU7C 1X6BA 4HCBA 1O78A 5CCAA 2GA4B 4YY3L 1CKOA 3RZOB 4X6AH 4HT9A 4E7JA 3SVMA 1O9SA 1WLPB 1GUNA 5M3FH 2KHJA 2C0TA 2L0AA 2Z4HA 4K8IA 4C8QC 1G6PA 2QEJC 3PMIA 2E64A 4WFN3 5LMUQ 1GRIA 4CKBA 1V1PB 2XTIA 3SR1A 4LF7Q 4LW1A 5EC7A 4A3DG 3L2VA 1AOJA 3S1NB 1K9MC 1EQVA 4A54A 5JJZA 2LNVA 2LSSA 1CKMA 1W1FA 3FJPA 1RKNA 2ZXPA 1TWGH 1HSQA 5LJ5d 3CC7A 2WP8J 4B9WA 2B2UA 1ET6A 3MHXA 3IKJA 1UUEA 4ZUIA 4J9CA 4NDXA 2DBKA 3S14B 3S24A 2KY9A 3H9NA 4C8QA 1CFMA 2R92B 4AFQC 1PYBA 3REAB 3CPFA 1K73C 2NZOA 2NVQB 3VR2A 1YJWQ 1YHQQ 2WB1E 4BY1G 3EG3A 2QASA 2O01E 2X9HA 1EEID 3CC4Q 2RJDA 3TVTA 2IHFA 2ZTDA 4N4GA 4HJAA 5KYWB 4A3BG 5FLXE 4JI4L 2RJEA 2B2UC 2K5IA 2F4IA 1EQTA 2O2LD 1VOMA 1YJ9T 3QYGB 3HP9A 2L89A 1PH8A 3NENA 1TWBA 4R4IA 3MWYW 4A3MH 2JA8H 3S3MA 1JOQA 2BA1A 4X3KA 3G7LA 4OWXB 2L3PA 2YT6A 1FD7D 2JQOA 1RJTA 1I5LA 5I9PA 3U50C 2VXWA 3T4AC 4QGUA 3CMEA 1VQNA 1CSKA 1TXYA 3ER0A 2UUCQ 2JA8B 3LNNA 4J7FA 4R9WA 2QEXT 2HAXA 3J81c 2JM8A 1B53A 1KRSA 5IYDH 1CI3M 2CH4A 4K5XA 4B3TQ 1T9HA 3GV3A 2EYZA 2VASA 3DWPA 4JI2Q 5FLMG 3CCLA 3J80c 5KYYB 3J7YW 4E7KA 3QO3A 3URGA 1VQ4T 1M1KC 1HZAA 1HZ9A 2JN0A 2KROA 3UI2A 4BA2I 4A93B 3S2DH 4HCCA 5M5WB 2NUZA 1E2ZA 4QY7A 3QIAA 4ALPA 3LGFA 3I2ZA 1HNXQ 1STAA 1MGSA 5M3FB 1K0RA 3TP6A 3QZ5B 2RPNA 1QVGP 4LF4L 1G3SA 4FP5D 1VQ9Q 3S2DB 4S3SA 4JZ4A 1SSOA 2N78A 1LVKA 3HFNA 3J80E 2O4XB 1BYMA 1NSNS 1QNKA 1K28A 2F0GA 2NBFA 3J80i 3H6ZA 3RBBB 3NUCA 5C0XJ 1H9RA 2LQ8A 2F0MA 1KAWA 1HJDA 1UEAB 1V1OA 4L5SA 1DM0B 4A4EA 1BB9A 2HL5C 2A08A 4DV1L 1GL5A 1LPLA 5K36G 5LJ3e 4C0FA 4C1NK 4C92G 4DR7L 1YBYA 4AYBG 1BDOA 1J8IA 4RTZA 4B3ML 5DLOA 5C4JB 3S15H 2K6DA 1VUBA 1L1OC 1GCPA 2F0OA 3BY7A 3FDTA 2I0NA 5CC4A 2CP7A 1SROA 4HMIA 1RACB 2A1AA 2E2JB 3EFRA 1UWVA 4M78F 2DZCA 2OTLA 4O1NA 3TP8A 3QR8A 3R6OA 4LUDA 1QCFA 1F1BB 1CKAA 2YRVA 3J81E 4FXDA 1JOKA 4NXNL 5KYWA 2YYZA 3I9QA 1BCOA 4EQNA 2E70A 1VDZA 1QVGA 1QP2A 3BW1A 1JMCA 2VB3X 4RCOA 5AJ3L 2HDMA 3M7NA 2YTYA 3CCUT 3DXJC 1VYTA 1K9AA 2HQEA 1UB4A 2EWNA 5T1GA 3ME9A 3RESA 2CREA 1CTMA 1MBYA 4FXGC 1FL0A 3VYRA 2R92G 2XU8A 2B8AA 2YUPA 1QVFS 3PTAA 5IOCA 4N9TA 4BY7H 1O75A 3OYEA 5ELEA 3S2HH 4M75G 2DM1A 4M75B 1BUVT 3A0JA 1YI2T 5LJ3f 2I0QA 3KLSX 2DA9A 4ZGEB 1AEYA 1LJOA 2EIFA 3O5ZA 1NE3A 2RO0A 4LF9Q 1WPYA 3PO3B 3H94A 4M77F 2X4XA 4DBHA 3C1FA 3EGDB 5M5WH 1WNLA 1J3TA 1RTOA 1RAFB 5IWAQ 4BY7G 1DJ7B 2V8IA 3NTIA 3VS0A 4F16A 2XD0A 3K7AH 5IT9L 5IGDA 2VNUD 2ED0A 4M75D 2YTVA 1WTXA 1JU5C 4OXPA 4ZAIA 1ZKOA 1WTQA 1QCBD 3AFQA 1F77A 2PPBC 2XHCA 4JI6L 3INZA 3G71T 1QILA 3PCOB 3F2DA 1SHGA 2BE5D 3QYHB 4DV5Q 3GPLA 3PMFA 1SSHA 1QE6A 2Z0SA 5KGUA 3M53A 5DAUA 2CUDA 2LCSA 2OXPA 3OIQA 1QWYA 3AB9A 4IFDI 3V8KA 4QJFA 1Q82U 2OAWA 1FNWA 1S5BD 1LCKA 3I70A 2EYQA 4JS5A 1GM5A 2TMPA 4ID6A 1ENFA 3RNUA 4LNQA 4L8JA 2XKOC 3N5BB 4KUDK 3K8AA 4CDFC 2ASBA 1PD0A 4KY7A 1PFMA 1SNCA 2RSOA 1AWXA 2BDOA 5JPNC 2QA4T 1KL9A 4WJ3M 2XN9C 1OI1A 2DJQA 2LX7A 3CBOA 2LCCA 3CBPA 4HJ7A 2HSPA 5M5XH 5GANh 2X4YA 4C3HH 1XX8A 1CKBA 4IOCA 1GCQA 2OX7A 4LFAQ 4BACA 4G4KA 4JJBA 3UPUA 5L37A 1IL2A 5KYIA 1EWIA 2JK8A 4FCYA 3GTJH 3MXNB 2EKHA 1I94Q 4L5QA 4RHSA 1JICA 2QDLA 2FZGB 2QQ9A 4DK3C 1DYQA 1NR2A 5E4XA 4GOPB 4M7AG 3DEOA 1NZ9A 3S3OA 2M00A 3PUYA 3VRZA 2LMJA 1K0SA 1UECA 1LABA 1STBA 1PTOF 1VQJA 5I22A 3D4DA 4PLLA 4M8AA 3NK9A 2PUKB 4JI3L 1PVOA 1WQWA 1B50A 3FRNA 3A98A 1Q46A 4BWGB 5DM63 1B34A 1KQ1A 1WHGA 4A3EB 1N27A 2VGNA 3HOUG 2J6FA 2EJFC 3BDLA 3I5RA 2QGGA 4LF5L 2EAYA 1IHZA 3NHHA 1IYJB 4UY8C 2D9TA 2M16A 2JN4A 3LX7A 3MEAA 4BE2A 4BY6B 2QAZA 4ANJA 1NCVA 2F0UA 4R4QA 1QUQB 3A8GB 4R56A 3P75A 4RWSC 3BZKA 5D3IB 4M7DB 4DN4M 2A6HD 1BI3A 1FVIA 4LUEA 1HXYD 3U58A 4ORZA 5GAN4 2P0QA 4M7DE 1TWGB 2O2OA 2DNCA 3BJUA 4HN7A 4A75A 4IN3A 4RCNA 4M78D 4K2LA 3VS6A 2IPKD 2NVXH 1TKWB 1J6QA 4M7AE 1B44D 2R92H 2VL6A 1RABB 2E8GA 1EIGA 4A3MG 2NVQH 2Y0SE 5ELFA 3CCQA 5EKIA 1EZ8A 2MWPA 2UXBL 1KTKA 1GUTA 2CP0A 4CC2A 1B4OA 3PQIA 4K14A 5JOBA 4IIMA 3AU7A 3AEVA 3CCLT 1KC8R 1IGUA 3FB9A 1B9MA 4RCCA 1S1NA 3V7SA 2F0NA 2RQXA 2WSFE 4BDYA 4KKUA 4KUIA 1E6GA 3H09A 4C92A 1AVZC 3E9GA 1GUGA 1VQ9T 2MPXC 2MPMA 2YU9B 1PCXA 2IIMA 3CPWA 3GO5A 4OO1H 4BY6C 4JJNK 2KHIA 2ABLA 4E7ZA 3VR3A 1YNNC 4XQNA 2X69A 1FYCA 1V29B 3QHSA 5CQYA 3KLSA 2D62A 3NMZC 3H41A 5IXFA 1ZXTA 5D14A 3PF5A 2UXDQ 1Q8KA 1BI0A 1EFNA 1VQOA 3VUBA 2GFAA 3X28B 1TS2A 1OXUA 1X9NA 2JE6I 3QO2A 2W0ZA 2HD0A 1BI2A 4M77D 2F69A 4DBRA 3HSBA 1PRTC 4DR2Q 1TUDA 3OYAA 1DD2A 2BCOA 4ZK9B 4X64Q 2A69C 1LM0A 4C0DC 2YWWA 5JEAG 1XTDA 4FYWB 2G6FX 2ZJPA 4BB7A 4A3DH 5M5YB 3M4PA 4J9FA 1I3QB 4DV7L 4AQYQ 2WSCE 2QTVA 3FIFA 4H44C 3CC7Q 2HEQA 1VQPA 3S16H 1UUPA 1I5FA 3CCLQ 4A3DB 4J6YA 1D1IA 2XWJB 1NM7A 3FJ5A 1LTTD 1RTNA 4X65Q 4DFAA 2EJMA 4ZYSA 2XRQD 1XQHA 4DA2A 3D3RA 1KIXA 1O7LA 1ESRA 1QW1A 2EJGA 2GVBA 4G7OC 4RUGA 2DVEA 2F0JA 2LKVA 3VDYA 2I07B 2A68C 2ZJQA 1RODA 1FJGQ 4J5YA 1V1CA 1AHJB 5D3DA 3O8VA 5LJ3d 1KQSA 1SR3A 3JCMe 5IYDG 4DBQA 3EG0A 2ZTEA 3CMAA 1B3QA 1K8OA 4LF7L 3OW2S 2CZ7B 2DRMA 3EHRA 3RDVA 2LS01 1HZCA 4A63B 4H02A 2XIWA 4R4OA 2K01A 4JI5L 5M5XB 1N33L 3S15B 2PZUA 3HKZE 5C4HA 4B08A 1FGBD 1NUCA 2WIIB 4C8QB 1YJWA 1YHQA 3HGBA 4M7AD 2MUYA 1EY5A 2NUTA 1LTRD 3X3MA 3K5LA 5HKCA 2JVVA 1D3BA 3DLLA 1Y8OB 4MNOA 2VQEQ 1IBML 1JB7A 3AT1B 2MAMA 2QDYB 2E65A 4KTAA 1M30A 4FSXA 3MO8A 1XNRL 3EHQA 4K5VA 1F2LA 3HOWB 3G6ET 1E0BA 1MGQA 1BBZA 1TS3A 1WI5A 2N55A 2CZ1B 2KECA 2TSSA 3V05A 3IRBA 1ZSGA 4GNXB 3JAMc 2NWGA 2EXDA 1K9MR 4BI3A 3D6CA 5LMNL 5FO8B 4A93G 1EZZB 2G9DA 2RI2A 1WXBA 1HTPA 2PZTA 4WORA 1C0AA 1PKTA 2K9GA 1KIKA 2CS7A 2VWFA 4PJOF 1WDXA 2SEMA 1RADB 4DBFA 3R2IA 4KN7C 1I81A 1IKMA 4A3JB 1U9RA 3BS1A 1C9OA 2K57A 1JOOA 5M3MH 2ATCB 1JEGA 3DM1A 2BZYA 4M75A 3EAEA 2Z0WA 2RK2A 2M2LA 4DAMA 2HHHQ 1PYSB 4B3TL 4A3JH 1QKWA 1F9PA 3U9OA 1OO9B 2RI5A 2J4XA 1J5EL 3GTPB 4F7UG 1YN8A 3KFVA 1HYOA 5IHNA 1VQAA 1ET9A 2NYZD 4L5RC 5C4ZA 5KYNA 3EGDA 3EROA 1NJIC 1HNZL 4JV5L 4IIOA 3HFZB 2AHJB 2CW0C 1M1FA 3KLWA 4LF6Q 5IH2A 1EY8A 1I6HH 4BUGA 1HPCA 2FZCB 1EFID 3MZ5A 1R0CB 2F0VA 1IZ6A 3URYA 1K8MA 2D2CC 2KT8A 2K2MA 3BVMA 4HJ8A 2LJ3A 4WCIA 3Q22A 4MZPA 2HSEB 1OPKA 3OYBA 4LAAA 4PFZA 3IFTA 4B3RL 1WFWA 2BA0A 3TDQA 1NMFA 4JC0A 2E3IA 5CO7A 2ZPEB 4EMKA 2KOLA 3ULLA 2Z4IA 4NXMQ 2ZXOA 4IOAA 2FYKA 1C4QA 5FROA 1VQLQ 1W6JA 3KBXA 4Z02A 1HR0W 2KAFA 4EIKA 1TQOA 1Y1VG 2NUPA 4DV1Q 1HZBA 3HP3A 4IUVA 2OJ2A 1VQ7Q 2ICEC 4LFCL 4DR6L 4A3LG 4IO9A 1OYXA 3QXEB 2MP1A 1QVPA 4KJNA 4DR7Q 2VB2X 2JA6B 3JCMP 5L8RE 4V2SA 5GAOq 2B2TC 4EGVA 4B3MQ 1K1ZA 2FG0A 3PO2H 3T51B 1QVFP 5GAMf 3MAQA 3I91A 2JA8G 2OTLQ 3C4SA 4ZQ3A 4HIDA 4BBSB 4ZN3A 1JB0E 1XOVA 4QF4A 2EY6A 3S17B 4E6IA 1D3BB 1UE7A 3KLRA 2F0EA 4KHPQ 1C6VX 1V8QA 1HQMC 1DZ1A 1G291 1AWOA 2RQRA 1VQKQ 3OSOA 5CBAE 2E5LQ 2UUAL 3A5ZB 1X3PA 4P2CB 3S17H 3F70A 2OCEA 3RN5A 3UDGA 1TY0A 2P84A 5CBEE 2ATWA 2E3HA 4IFDJ 3M4OB 1B3AA 4J9DA 2NYSA 1CZWA 1PG5B 2E12A 1MJCA 2DBMA 3VYTA 3OYKA 3G1JA 5KH6A 5IT9E 4YIJA 1DOKA 1OPLA 2UXCL 3ZBDA 1Q81C 3S1QB 2EYOA 2M9VA 3EH1A 2XK0A 2E5KA 3L2WA 2VB6A 1VQ9A 3J7A5 1VQCA 1CQVA 2F3VA 3ULPA 5GAMg 1I0CA 2DTOA 2OAUA 3JAML 3UDFA 2DAQA 1T3LA 4KD4A 4EQ5A 4AIMA 2DL3A 3DKMA 5EBDA 4JDSA 5GAMe 4J9EA 5CV5A 5C5MA 4P72A 5C3XA 1PXUA 3QOJA 5IWAL 3HOYG 2ROLA 3HS0C 1M8VA 1ICFB 2HDLA 3SHWA 5I2XA 1MIUA 5GANe 2JM9A 1D5MC 2ID0A 1CA5A 3DEPA 4JRKA 3G4SQ 2LCLA 4FYDA 3I55T 1G3TA 4JI6Q 1PFBA 3GOXA 3QUIA 3BYYB 4A3IH 4ZRZA 3HOZB 4OWTB 1EU3A 5EPKA 4GNXA 2YU9H 1Q86U 2RQUA 3VRYA 3V8LA 4AH6A 2K14A 2CYZB 2IVWA 5CKHA 2HCKA 2H3JA 3SEMA 4FL6A 1HA5A 2VZAA 3TZUA 1L1OB 1KD1U 5L23A 4JVZA 4BS9A 2F0SA 3TS0A 3QKJA 2BZ8A 1VMPA 4QMGA 4P75A 3QWXX 2RVLA 3M56A 4D8KA 1X2QA 5GAN8 2CP2A 4P71A 4EDUA 1YP5A 3BDOA 3VS5A 2Q8TA 4GKJL 1X6GA 1PFNA 2F2WA 5IGEA 1XNQL 1CHQD 2CFMA 2LXKA 4JLIA 4RHRA 5CYUA 3CXCS 4UP9A 3FC3A 2XICA 1HTLD 2FJ2A 3A7AB 1N9SA 1C8CA 3UT1A 5JVG3 4RG2A 2R93H 3WVDB 1KD1R 3LWUA 4ESRA 5LJ5e 2C35B 1Y71A 2DIQA 2L5TA 3HOXG 3OYIA 4A76A 2UUBQ 3OBYA 4A3IG 9ATCB 2JP1A 4DV6Q 3JAME 4X34A 5IY0A 1I6HB 5JJLA 1T5EA 3FHWA 1P8LA 3GD7A 3HOYH 3ERSX 2KENA 4OHJA 3PUWA 3NQTA 4N0AC 4RH6A 4Y28E 1MSHA 1Q82C 3TSZA 5C0XI 2FRYA 4OB3B 1DJRD 4TRDA 3MVVA 3P8DA 4ZCKA 2KT1A 3OYYA 4DEXA 1KLUD 2ZTCA 2VS1A 3HOYB 2D9UA 2AUKA 1GHKA 5CKFA 4LF5Q 2HNIA 1XTCD 4DAYB 3AYHB 2QK0A 2H4OA 4KD3A 3E3XA 3UE1A 3OS0A 2O4XA 5FLXL 4LUZA 3I73A 1PFSA 3BVGA 3R3OA 4HEDA 4BXXG 3JRZA 1WTWA 1VQ6T 4OO1I 2V1CC 1JWMD 4YWKA 1N8RC 4C1NI 1AD5A 1KDCA 4J9GA 1TR5A 3GTOB 2KRMA 3JCMX 2M02A 2KVMA 5NUCA 3W2DA 1Q90A 1PRTB 1PH9A 1E2WA 1EFWA 2IJ0A 4A3KB 1AT1B 4MMKA 4M7AC 1EY4A 4BBSH 2JTEA 2B63G 5BN4A 4N8FA 2CZ6B 1SJHD 1L0WA 4IPGA 4LMQD 4KMUC 3NELA 3HOVH 2EKOA 2OEOA 4IPHA 3ULRB 3KXTA 2CHBD 3KDFB 3U4ZA 4PNYA 3OQ5A 4F7XA 1SLJA 4BY1B 2CQOA 5I2SA 4KH0B 2L1BA 4IALA 1HNWQ 1GBRA 4CDDC 2J6KA 5KYXB 1BOSA 4DQ2A 2K5NA 1SRLA 3DUZA 5CR3A 3SEBA 2C5CA 3F8TA 2LX9A 5EQ0A 2RHSB 5IP7G 2EY1A 5AFWA 3OYFA 4M7AA 4DNTB 1RLQC 1QQJA 1JE5A 4PJJA 4HMJA 3RKWA 3NPFA 1VQ5T 1ILQA 5I2YA 5I6YA 5GAN2 2XNAC 4DV4Q 1XMQQ 1C0MA 1S72Q 1BKBA 3BDUA 2R7DA 3M9BA 1EUJA 1JT8A 2IPOB 2CP5A 3QIIA 1FNUA 1I4QA 4Z9CB 2BZXA 4KULA 5FWCA 2FRWA 1SNPA 2EQIA 1VF7A 1WZOA 4PLIA 3OMGA 2BUDA 2DGYA 2K50A 1BIAA 3EFXD 1PZKD 3NWTA 5F2DA 1I6VC 1I4HA 3RLOA 1A8VA 3J81j 4NL3A 1QG7A 2JXBA 1T0JA 4JUVA 3PO3G 2JA5G 2KNBB 2QQRA 1N36L 4ABNA 4PJMA 4IUQA 2B63H 3OTOL 2F1LA 5FRMA 1EY7A 4A3FG 2NVTH 2F0FA 2MMPA 3CCJQ 1AP0A 1TS4A 1PYWD 1MMNA 2MJ8A 2LT1A 1IYVA 5C3EH 4A3GH 4K2KA 4N4HA 5C44G 1PH3A 1TVXA 3JB9D 1SMYC 2QXFA 4NPSA 4FF4A 1M3CA 4A3KG 1LV9A 1H9SA 4CDCC 2AQ3B 3EIVA 1D0ZA 1ZSZB 2D6FA 1FGUA 4C8QE 3G7ZA 2COWA 5JVH3 5H1SE 2QKIC 4EQPA 1FJGL 4ME3A 1DCZA 2IWHA 1D1BA 3E1SA 3NBHB 1RDPD 4RGMA 2E6ZA 2A3LA 1WI7A 2DILA 2EBPA 1A2TA 1TY2A 2NN6I 3I4LA 1HXDA 5C5LA 1KHIA 4FW2A 3A74A 1TWAH 4JI5Q 3RMQA 1H641 1QLYA 4C3JB 3GNGA 3SWNC 5KYUA 3EBEA 3MJXA 3CC2A 3RLNA 3QDRB 4RKLA 1G2TA 1HJPA 3LWHA 1N9RA 3OS1A 3FKIH 2J6OA 3PV0A 5D65A 2DPPB 1A3TA 5GAGC 4BE1A 4HVUA 1IHWA 2PMZB 1GCQC 2VQEL 1IBMQ 2K33A 2PI2E 1KHCA 3UA6A 4C5GA 4LE9A 1KFZA 1ASZA 3HOXH 4IQZA 4IKFA 5KNDA 4B3SQ 3LGLA 3CC2T 3REBB 3NBIA 3JCMJ 2MO1A 1X43A 3C12A 5C0MA 3H0GB 1XPRA 1ZYRC 3HG9A 1BI1A 2LP5A 3K5NA 1DGSA 1UE1A 3T1HL 4HKEA 3ND9A 4LJZC 3GTLH 4N4IA 2LZ6B 4LFBQ 3HOXB 3OOCA 1RUWA 3VA7A 2CZ0B 3I55A 2K3YA 1CKNB 2QEXA 1EWHA 5LMNQ 1KQSS 4JI7L 1YNJD 2LQNA 3GTLB 4IUNA 4RTXA 1M4ZA 5C4XG 3NPPA 1WOCA 4M7DA 2CVRA 3NQIA 3HZXA 1PKSA 4C92F 5HK3A 3G4SA 4P5NA 1BCPB 1UE9A 1P16A 2I46A 3PIP3 3A8HB 2R7ZB 3CC4T 3L0OA 3H3VI 3GTOH 1VQ4A 2L55A 3K81C 3ZJYC 5DLQE 3NTHA 4TQUS 5FU6B 2Q8IB 4GOPA 1ZBXA 2RHXA 1ABQA 5A0DA 4Z89A 1L2FA 3A1PA 3MP6A 4M78G 1PTOD 2B2VA 4A3FB 1J5EQ 1CSPA 3OYMA 3KYHC 5CORA 5IN1A 2K5QA 3OSVA 2PI2A 1HNZQ 2DETA 2RHQB 4JV5Q 2ENBA 1P92A 3T56B 2JMCA 5CVIA 1ZHIA 1UTIA 4LF6L 1IGQA 2B2WC 3I90A 2MQHA 2XVSA 1DOMA 1F9SA 1R4PB 1WCMG 3EG9A 4JI0Q 2DXUA 3JCMh 4QW2A 4UAIA 2KXCA 4GKKL 3BU2A 4JI8L 3EFOA 1IO6A 4CGYB 2R7FA 2JA7H 3N6RA 1VQOT 4B3RQ 2P0PA 3A8MB 3SK6A 1BXTA 1X54A 4HXJA 4NB3A 2DERA 1U4MA 4K11A 4ME7A 4M77B 2JZ2A 4KGVB 2RD1A 4CRIA 5GAN3 2Y0SB 3DMUA 4R4TA 4PMWA 2RHYA 5E7NA 2DD4A 3TSSA 1F2ZA 2PVDB 4DR6Q 1GJXA 2OI3A 4D6WA 4KY6A 4X62L 3PMTA 1IKLA 1WD1A 1BQQT 1M1KR 1NAPA 1YHAA 4GLKA 8AT1B 4BI4A 1EY6A 3RKXA 1SYDA 2M0OA 2EGEA 1Z9QA 4II1A 4HT8A 3J7AF 1VQ6A 1BVSA 1NLOC 1E22A 4QIWE 4GY5A 2YRCA 3G71Q 4WF2A 1JJ2A 2PO4A 2J05A 2JS2A 3I4NG 1ENCA 4HSPA 3JCMd 1VQIA 4RMFA 4QIWB 1OXXK 4EMKB 1VQ7A 4BBRB 3MEFA 1C1AA 3SFMA 1R0BG 5DM7R 2CKZB 1BK2A 2CP6A 2YUQA 3CF5A 2UUAQ 3I4MB 2LXJA 4MDWA 3OA6A 2NUPB 1M1KU 4RG8A 2C0OA 1R9TH 1ABOA 1IBKL 1GUSA 2K5VA 1YI2A 2JA5B 1U4RA 1R8OB 2PQAB 4KLKA 4OEMB 2EOTA 2E75C 5EKKA 3I35A 1QNUA 2R7ZH 4C8QG 1CA6A 2DY8A 2QA4Q 4POGA 5KE3A 4HAEA 1RAAB 2JW4A 2IT1A 2RF4A 4WRDA 4M1UB 3CMET 1LT3D 2DJZA 3SK4A 2FHDA 4N0AA 3RLFA 4ZKBB 1YJ9A 1G3WA 1VQ5A 3QWYA 5C4XB 3C2PA 1X56A 3HOUH 4C3IB 3KJOA 1Y1WH 4MHEA 3SB2A 2DNUA 2D0PA 1Y07A 3BFMA 4F04B 2PU9B 2AHOB 2A6EC 4YCVA 3OYLA 4O42A 4DK0A 1N34Q 3JB9J 1WHLA 4QQGA 4M7DC 4HCEA 4PJOE 4XTWA 2RHIA 2NVYB 3M4QA 3OYDA 1EZ6A 4HIOA 1XMOL 1IREB 3CCRQ 1UEBA 2KXDA 2GQIA 4KBMB 3PIOA 4DUZL 5IP7H 5D6WA 4ZLTF 4PG3A 1S72A 4DEYA 3FPUB 3HKZB 5M3MG 1NYFA 1Q7YU 1TWFH 2AWNA 2VUBA 3K0XA 1MJEA 2N3SA 3OWEB 4DR5Q 5IODA 2F1MA 2V1RA 1AE2A 2MYSA 4OELB 1VQNQ 4YCUA 2E6NA 2F2XA 2AIRB 1YIJQ 2KMTA 2ZJRA 1RAIB 5LJ3g 5BR8L 1ZA1B 4K0KL 1RI9A 3S1NH 2VW9A 4BBSG 1U5SA 1EY0A 2ED1A 1EEFD 1QKXA 2K5HA 2QF7A 3FMCA 1K83H 4PK4A 3CCSA 3Q8DA 2EJFA 2DYBA 4UP7A 1WD0A 1JC7A 1Z7TA 4R8NA 2F4VQ 3A8OB 5C4JH 5HGTA 3AHUA 2JA6G 5EJWA 3CPWP 2A36A 2DD5A 2XI9A 1QVCA 2E1HA 4OMOA 4D8DA 2UUBL 3MC0B 2NWMA 3CCST 3X3NA 2K6AA 4JZ3A 4A53A 1K76A 2VUMG 3IL8A 4TVRA 5GMKe 2AKKA 1E2VA 1YJNA 4CC7A 4MMLA 2LNHB 3CCEQ 2K4KA 4C2MH 1D09B 1D5ZC 3L7ZC 1RIPA 4NL2A 2DJGC 3NSWA 1K8AR 2KRSA 1QVGS 3A56A 2E10A 1X01A 3M0UA 3CCUQ 2F2VA 3P20A 2C06A 4R1JA 2DZ9A 4V0BA 1V1PA 4C2MB 4A3CG 4EX5A 4MTNA 3TREA 4DR4Q 2YUNA 3OW2A 1RI0A 4C5IA 4J9BA 5GAOm 2RSNA 4J6HA 1GD7A 3L3OC 2H8HA 1PRTD 2KVQG 1B07A 1ZEQX 3I8ZA 2KGTA 1KLGD 3PVQA 3BDCA 3WDNA 4FU6A 4JLGA 1SF9A 5LMUL 1KDAA 5JEAJ 1B70B 4R0KA 3M4YA 1NTGA 2QCPX 1ENAA 4QB4A 2LT4A 1MI2A 2FFKB 1HH2P 3OWFA 1ZUKA 1VQ8A 2HIVA 1E7OA 3G4ST 1E7ZA 4DXFA 1MV3A 5GMKj 1D1KA 4OX9Q 3FRPB 1YIJA 2RDFA 1YHBA 3X24B 3CCMA 1H3ZA 4FXKC 5J39A 1SJED 1STGA 1YITT 4HA8A 3BE3A 3ITPA 2MGSA 3L2UA 2EYLA 2EFIA 4XQJA 1U8RA 1HQRD 1O80A 3L2QA 3RNJA 4LDYA 5EGTA 1HNWL 1NMGA 2ZT9C 4C0ZA 4F17A 1K9MU 4Y7NB 2K3BA 1OQKA 5DM73 4M77E 3CCRA 2L9HA 1W2BP 1O7IA 5LJ5h 1PNJA 3OYGA 1U4LA 5GANd 4DUYL 1HUNA 4ILWA 1AZGB 1ZSZC 3Q1JA 1B2TA 3VS7A 1Y0MA 2PQWA 3M0RA 3G48A 1YEZA 4PJLA 3D4RA 3RUZA 3CCJT 4Y7NH 1OU9A 4Y52H 4DOVA 1VQMQ 2A68D 3Q6SA 1SRMA 2ZGWA 3PIO3 4OO1G 2H5XA 2D1XA 1WHJA 3SWNA 1GUOA 4PJOC 3H91A 2P5ZX 4RCBA 4J83A 1ACMB 2K2VA 2BDNA 2RCFA 2Z6KC 3FEWX 2RNAA 1W2BS 4XT1B 2E74C 5IHKA 3PVLA 4XTYA 1VQPQ 4QVCA 2A5HA 1EOVA 2CDTA 1SNDA 1D0XA 2QA4A 1WCMB 1ZBJA 4TSSA 4JI2L 2MCNA 2A19A 2RHUA 1AZEA 4M75C 2MO0A 3EG1A 3NBHA 1TSFA 4ZGDB 3D6WA 4YCWA 4F87A 2F0TA 4XTUA 5AT1B 1XMQL 1LUZA 5FLMH 4A3GG 1TUGB 4M78E 5C3EG 1EL0A 1SSFA 1PM3A 2WV6D 2LC4A 3IQLA 2SDFA 1TWFB 3RERA 2RMOA 2QG9B 1MKHA 3DWAA 2OQKA 1X2KA 5I11A 4IPDA 4KHZA 4ODGA 3CEYA 4PMBA 1KRTA 1Z9FA 3CD6Q 1A0NB 1UNSA 4HCSA 3PO3H 3OYCA 4YHHL 3DM3A 4VUBA 3JCMb 2B2WA 1EYGA 3L42A 3S1RB 1Y1VB 2UU9Q 1E1TA 1IHVA 2LVMA 1EY9A 2G5DA 3I72A 1LTGD 2HCIA 2EW3A 3TCJA 4FW1A 4A3BH 2Q2HA 1IBLQ 1IXRA 2NVXB 2B2VC 3QJ6A 1N9WA 2F5KA 4QKUA 2JXMB 4M4ZA 4PJOD 1Y1VH 2HT1A 3JC66 5J3BA 1LLRD 4QVZA 1JXMA 5LJ3j 3LW5E 1PTOH 3OYHA 3P8BB 4DV3L 4A3BB 2SOBA 4FDBA 4ELZC 1A3UA 1S3OA 3C3LA 5GANj 1JCKB 5CGKA 3M4GA 3I4MH 2NLUA 4YTLA 2XDBA 1AWJA 2OTJA 3VYSA 1D7QA 1M8MA 2ZPIB 4CC3A 1UHFA 4RKUE 4C3HG 4DAPA 4PZ6A 1VQLA 1G6ZA 3KUFA 2CW0D 2BE9B 1IXDA 3VU3C 1LT6D 3HKSA 2CT4A 3CMEQ 5ELBA 5AJ3Q 4Y92A 2YXYA 3RKYA 4POFA 4DPGA 4O2DA 1I4PA 4JI7Q 1V9PA 1ESFA 1Q8IA 2DTHA 1PRTF 2EY5A 3M3YB 2Q2IA 4HTHA 3L2PA 1RL2A 1SXTA 3NFCA 1NBEB 4LNPA 1QJOA 5ISRA 4FYXB 4KV6A 3H3VC 4YWMA 4K8JA 3OS5A 3DHQA 3B6YA 1GO3E 2OQ0A 2OWOA 3GP7A 3CCMQ 3GTJB 1I50H 3H6MA 2FL7A 2HIXA 2DMOA 1STYA 2DX1A 1Q95G 4GLMA 1SRUA 4X1VA 5KCHA 2HQHA 2KEEA 2DEQA 3EFOB 3VJPA 3VR5A 2P0KA 3W1GA 4Z8AA 3OMCA 2I5MX 5KEEA 2ESWA 1O7YA 1GXIE 2YDLA 2XDPA 3EJIA 1LOJA 5GAMj 2B2TA 1A2UA 2E41A 3M9QA 4NS5A 3I55Q 1NEGA 2HCCA 4FF2A 2DXBA 1PZJD 1FR3A 2PNRC 1I1JA 2AK5A 1OOTA 4FT2A 1YNND 1CT1D 3OYNA 3SHLA 4J7IA 1VQPT 1M1GA 2HUGA 2NN6H 1Y8PB 1VA7A 2A37A 4O6JA 5I21A 4GKKQ 4AYBB 3SWNB 4JI8Q 4Q5WA 3K80C 1OXTA 1W6XA 2E76C 4OMFB 1WYDA 4AG1C 4DOWA 1A63A 1MV0B 3S9WA 4LF8Q 1QWEA 5KNBA 3I56A 4DU9A 2R93G 3HRUA 4ATOA 2A69D 2ZZDA 2K05A 2KE9A 1NEBA 3L2RA 3M85A 2PZ1A 2CSIA 5BN5A 3ZL7C 1OULA 2EQKA 2OT2A 4DNRB 2O88A 3KDFA 2A8VA 1G8XA 4UC4A 3CD6T 5EKLA 5CQXA 3IAYA 4LFAL 1JRIA 2WB1B 1SHFA 4ULLA 1ASYA 4N9PA 1I4K1 1LYLA 4JI4Q 5IIFA 3M7GA 1X3GA 2EE1A 4K5WA 1MMGA 2WKCA 2A0FB 3GTMB 2DK3A 4HVWA 3TBIB 3H0HA 2EYMA 2I5LX 3CMAQ 1VS0A 3CD6A 4M78A 1MSGA 5EPLA 4CBVA 1D6EC 1PH1A 1QOHA 4JI3Q 3TQYA 2L3RA 3CCMT 5K36H 3U4VA 3A54A 2AZVA 1NLPC 5FU6C 3T1YL 1C48A 1B1ZA 1H3HA 2EDGA 1G5VA 3K57A 1D0YA 2LTOA 1Q1EA 3A8KE 2E2DC 2RQTA 1I50B 1JB3A 2AQ2B 4M75F 4IPCA 1PDQA 4A4HA 4KY5A 5EBCA 3S2HB 4CHTB 2K52A 4Z88A 2F3WA 2IX3A 4BY7B 2Z1CA 1K3BC 2K7VA 3QG1A 2RQVA 1I4XA 1STNA 2CUBA 2L11A 2ZPGB 2QGQA 3BZDB 3OPOA 3UDCA 3KJPA 4DR3L 2I5HA 3WVEB 1I4GA 2B2YC 3SXHA 1SE8A 1HNXL 2Y90A 3MP8A 3VS3A 1JQYD 2BH8A 4LF4Q 2X35A 1U4PA 1Y96B 3QZ9B 1STHA 4PL6A 3I4MG 2EPDA 3GQBA 5C6SA 3M58A 1EU4A 3NTKA 2AWOA 2FMMA 5G3LF 5IYCG 1TWCB 5CKEA 2YV5A 3VA5A 1VQOQ 2DL7A 4A3EG 3I7FA 1FMWA 2AKLA 3MEUA 1KK7A 1RHPA 3MFYA 3W3AA 2B29A 2HD3A 2MK5A 1X55A 4H7BA 4JBKA 2VY3A 1Y14B 4OIKA 4R8IA 4A3MB 4C92B 3W1BA 2EYYA 2PUOB 4QQBX 4HR7B 4DR5L 2A7YA 1KJWA 4KRTA 3JCMV 3JCMf 5GMKl 2Z8LA 1WXUA 1JO8A 1M90U 3HRZC 3VYGA 1SG5A 1HR0L 1X32A 2NZHA 2PMZE 2WB1G 5BR8Q 4K0KQ 1GFDA 1ZLMA 1E3PA 1S5DD 8ATCB 3D0FA 2JTMA 3CKIB 3I4OA 2HZYA 3QBYA 2EQSA 5IYBH 2F4VL 3VYUA 5C0XH 4P74A 1RD9D 1WX6A 5A2QL 1YWPA 2JT4A 1KNAA 2H1EA 4RA8A 5GAN7 4LUVA 4F8MA 4X64L 2WAQG 3GTMH 4BA1I 3TN2A 5GROA 2SNSA 3X25B 4DNIA 1M2OA 2RF0A 5E4WC 4AQYL 3PSIA 5TSSA 1I3QH 5I6WA 1QZHA 1H95A 2F03A 2NTTA 2K5FA 3HOWH 3GV6A 3S16B 1KXLA 5HY6A 3SDZA 4E7IA 1WJJA 3UA7A 3VS4A 3NGPA 4RTVA 1Q86C 3CC7T 3MXGA 2EYJA 1GOZA 4HIMA 5A0GA 4C92D 5BN3A 1NBWA 3TRZA 3RUXA 2LJ0A 1K0XA 1FX7A 2RA4A 1UAPA 1K8GA 1M2VB 4TVAB 4OMPA 1Y8NB 1A0IA 1WTRA 2NUCA 2L5QA 3VKIA 5HCKA 1PHTA 4C5HA 2MIOA 1UJYA 3PIPA 3UDIA 1XJWB 1JBMA 5GADC 2E2HH 4XIGS 3RR6A 3NHNA 2IW3A 4L59A 3SK8A 2O9VA 4FM4B 3KF6A 3MKDA 4UHVA 5IGBA 4OVAA 4X3TA 5FOBB 3PT9A 4EPCA 1X3FA 2Z6KA 5CV6A 4XU1A 5CMDA 1K4US 2FB7A 2R5AA 1PH4A 1N33Q 2FEIA 2JUFA 3K0YA 1BNZA 3GTGB 1QVFA 4DA4A 2E2IH 4DV5L 1SMXA 1SN8A 1PTOB 3W5OA 4JG2A 2EGCA 1VQ8Q 2WFWA 4X9CA 4XAXB 1SBBB 3WOFA 5A2QE 4IUUA 1G83A 1LTSD 1SYCA 2VUMB 3I3CA 5CIUA 2JYOA 2GCXA 2K5WA 1B7YB 4NMZA 4WJWA 1H92A 2A74C 1XNRQ 4E2FB 1MNEA 1GUWA 4GLXA 1X27A 1Q81U 4MTKA 1OV3A 2F0QA 2CP3A 2QQBA 1AEXA 1AN8A 1PLFA 1M5Q1 3EFSA 3A8IE 1JJ2P 2AQ1B 1BR9A 4E7LA 3P8HA 5C0XG 3RIRA 2D8HA 3A8JE 4DAVA 2ECZA 3JV3A 2CCZA 4DV6L 1E6HA 2DVJA 2FPFA 2ALYB 2L4NA 5CAIA 1S40A 1OZ3A 3K5OA 1F2YA 1EOTA 2J0TD 3SD4A 5LJ5g 2X6GA 3HRTA 4FIBA 2EQMA 4JI1L 1QUQA 5GAN5 1R77A 3J80L 4Y91A 1M27C 2R93B 3L1AA 4HJ9A 1NPPA 2XSCA 5GAMh 2N88A 3EG2A 4XK8E 4A3EH 4GBQA 3KF6B 2LQKA 3FLGA 2K32A 6AT1B 3WWVA 3MP1A 4ZTJA 2B8GA 2PZWA 5IYCH 2IY5B 1H8KA 3DLMA 3BYTB 1WVLA 3T16A 1PH6A 1CHPD 4GOPC 1UJ0A 3TEHB 4F7UE 5CR2A 3H0IA 3H0FA 2QW7A 2HQLA 4KK7A 5FO9B 5JAVA 4F7UB 3QSUA 3M4OH 2M0YA 5HK0A 5J26A 2KCNA 1WA7A 4PZ8A 1QP3A 1LTBD 3VR4A 2E4HA 5GMKm 2OTLT 4HJ5A 1X3EA 5E3FA 3UWNA 3J81L 4KI0A 1ONLA 2X4WA 5LHY1 4LK1C 3JCMW 2BKDN 4Q0FA 2EYXA 1D1CA 1MUZA 4C3HB 1KABA 4L5GA 1BCMA 5GAOp 1YNJC 3P7JA 5GAOn 5ECAA 3MXNA 1FXXA 1OXVA 1VQGA 4MZ9A 4C56C 2E2JH 2UU9L 4O0AA 4RAUC 2X51A 4BI8B 4HIKA 2CKKA 3H15A 3QPHA 4A4KA 1WTPA 3ZFJA 2EQJA 4RMOA 2QQSA 3UDXA 3PO2B 4UP8A 2GGRA 2HDAA 1X65A 1U5KA 1HRJA 3M0SA 4BBRG 5M9OA 1PTOC 1FMKA 5FLXc 1IRXA 1MD2D 2YHTA 5HURA 1MMDA 3HFOA 4ZNXA 5EAYA 4XU0A 1AFPA 4C92E 1JJGA 1U1SA 1M9SA 2O9SA 3GLXA 5ELNA 5GJWB 1ZSZA 2GBQA 4JRIA 4RTYA 1SEBD 4CC4B 1ARKA 1JXOA 4DR2L 3CC4A 3CHBD 1XJVA 5M5YH 2K1BA 2V4DA 1SFOB 2VVKA 3EG9B 4HVVA 4F7UA 3F1ZA 2K3XA 2BTTA 2XG8D 3CXCP 4PJOG 2SNMA 1XPOA 3GTPH 2Y4YA 5FK9C 2E2HB 5DEHA 4DV7Q 3VS1A 1SE3A 4XTZA 4LDXA 1ZX6A 4CI0C 4PV1C 3JAMi 4DKAC 2ENMA 3S1QH 2JEBI 1BCPD 1JJ2S 2KUMA 2MOXA 4E7SA 4R4CA 3KK7A 2QDBA 3AFPA 1M4VA 2V8KA 1H9SB 4I65A 2NN6G 2COZA 1CUKA 3JCMc 3G71A 2E2IB 4C5EA 3TZDA 4RG1A 4FT4A 3X26B 4F7UF 2DRKA 2KCCA 4B9XA 1X6OA 2RI3A 2F0KA 1NYGA 3KBGA 2CT3A 2RJFA 1GVPA 3K5MA 2NVTB 2EYPA 2L3SA 1WIEA 2FO0A 2HQXA 3GBQA 4KGZB 3JB9H 2XDDA 2NB0A 3NXWA 1SYFA 3T9NA 4A3GB 3LLRA 3CCRT 4RFBA 1UE5A 2VQFQ 2B39A 2PVOB 3OY9A 2YLCA 5LL6X 5JJIA 3I4NH 1CKNA 2ZPHB 1FMVA 3T13A 2EGAA 3OBWA 5E1FA 3SE0A 4KN4C 3NWSA 4C8QF 1E24A 1JQQA 3LX0A 1WTOA 2JA6H 1V76A 2LQWA 3QWNA 2GVAA 2MI6A 3PGGA 4LF8L 4BE0A 3M0QA 4RTUA 1HCZA 1T5XD 1YVCA 2K79A 1CQFA 3I4NB 5CKDA 1NY4A 4EMGA 4JBJA 1PH2A 1BBXC 4GKJQ 3KF8A 5KIXA 4FYVB 1XNQQ 1TU0B 1SDFA 1A6XA 3V7CA 5CV9A 3OSSC 2KBTA 2DYIA 5COYA 2DUDA 2MWOA 2RJCA 2MNAA 2GQVA 3C95A 3V7RA 1BBUA 2XWBB 1Q1BA 1KSWA 3CCSQ 4X66Q 2ES2A 1N32Q 3GIBA 1VIFA 2JNGA 2JS0A 1KQ2A 2KA7A 4APVA 1GHJA 3UF4A 3NE5B 2ZAEA 2R57A 1SMYD 3H0GH 1NJIU 4XYQA 4KHVA 3CCET 2DL4A 1EYAA 4IJHA 1SFOH 2CWPA 4AFZC 2R3ZA 1UGPB 5FO7B 1ZQ1A 3GDEA 4I7AA 1PRLC 4X3SA 2QEXQ 1TWHB 4PFOA 4GNXC 3GTQB 3C94A 3J7ZC 4C92C 3T1YQ 2L3QA 3MEWA 2ZCFB 2DE0X 1D8LA 2HHHL 3C46A 3CCEA 1STEA 3A8LB 4PJNA 5GAOr 3MTSA 4V190 1TOVA 1SNMA 2VKNA 1JORA 2EPBA 2K4YA 2VXEA 1EWCA 1EYCA 4OONA 2V8JA 2V1QA 4C3IG 1TH7A 4JS4A 2LMCB 4QVDA 4A3CH 1HD3A 4PKCC 2JEAI 3VS2A 2D0NA 3CCVA 4BDZA 1AWWA 4J6XA 2R7ZG 4J1MA 1NPRA 1BU1A 1UE6A 1QWFA 2X3WD 4K6LA 4G57A 4DR3Q 3PF4A 1YFNA 1VQ5Q 3L2ZA 2N8NA 1YJ9Q 2FXQA 5K5PA 3KF8B 2R61A 2G3RA 4GN5A 4HCZA 4KKSA 1XYIA 4MIUA 3EGXA 5GJVB 1Y57A 3CC2Q 5GMKi 1ZYRD
chains in the Genus database with same CATH topology
2VUMH 5FRNA 1VQLT 1KC8C 4NXML 2WAQE 4LUOA 3JB9I 1OZ2A 3V8JA 2IX0A 1Q7YC 2LRQA 4LFCQ 3TU4K 1B34B 1PH5A 1X75C 3VYHB 3KFUA 3ULJA 3FDRA 4UPAA 3E19A 1HR0Q 4L5TA 1VQMT 3OYJA 3LH0A 2Q2UA 2ZPFB 1E1OA 2YLBA 4KHPL 4DV0L 5HGQA 3M54A 2E5LL 2DO3A 1VQMA 5C44H 2ZPBB 2KCMA 2MFIA 4A4FA 4LWCA 2R5MA 2JA9A 2D0QB 4E7HA 2ZM6L 2RM4A 4J8OA 3CMAT 2F3IA 3GTQH 2UXCQ 4MZTA 2P4TA 4BD3A 2WSEE 1PSFA 3NEMA 1Y1WG 2GN5A 3M59A 2X4JA 3JCMg 4M78B 4R55A 1VQNT 4XU3A 1EIFA 3A5UA 5FU7B 1MHNA 5C4XH 3G6EA 3H8ZA 1KG1A 3OB9A 1G3YA 2WACA 4DK6C 2QQAA 2RHZA 4DV2Q 2Y4XA 4PZ7A 4J15A 3CCQT 2RK1A 3JSCA 3CBMA 2R6GA 4B3SL 4LDUA 4XQ3A 4BY1H 2AMCB 1L1OA 5IP9G 1TWHH 2JJQA 4LFBL 2KCTA 4M78C 5IP9H 5AYFA 5GAEC 4DR1L 4EMKC 5GAOl 2IG0A 3M55A 3RN2A 1U0LA 3TS2A 1W3SA 5GAHC 4LDVA 4JI1Q 3JB9G 4JYAQ 4M77A 2VV5A 5GANf 1VQBA 1LNXA 1QZGA 3JB9F 5FJ8G 1WJQA 3ZEHA 2DXTA 4C0DB 5M3FG 3VV0A 3HOZH 1VIEA 2CWAA 4YY3Q 4JBMA 4GN4B 4OGEA 3HPWA 2M9UA 1PV4A 5KCOA 2JA5H 4M77C 4IFDG 3CCUA 4JI0L 3FEOA 4JBWA 3PUXA 2DKGA 2RH2A 2VXFA 1VQKA 1M90C 3PUZA 3ICEA 1I8FA 4P73A 4PNOA 4EMHA 1UGQB 2RA2A 3S1MH 4X62Q 3STBC 4QQ6A 3CPWS 1VQ8T 4C3JH 3LWIA 1A62A 2NVYH 3CCVT 1VQDA 1Y96A 4OP0A 1W2BA 3F2BA 3HOVG 1Q12A 1EQRA 4DV4L 3FKIG 1PSEA 3H3VH 4XTCS 2QTXA 1VQFA 2IX1A 1IBKQ 2UUCL 3DB4A 3CCJA 1V1QA 2XIDA 4BXXH 3E0EA 1N36Q 2JA7G 1PA6A 2PQAA 3OTOQ 4A3KH 3OS2A 2QI2A 2KDSA 3CW2C 5LL6S 5LJ3h 4JRPA 5CKBA 1WCMH 4C0GA 5D6XA 4GLAC 1VQ7T 1N34L 3STBD 1WJSA 4A3FH 2MF2A 1KC8U 5A0LA 3HRSA 3EN2A 4J6WA 2KQWA 5LMNW 4M7AB 1YHQT 1YJWT 3VUZA 1YZ6A 3LGJA 2VQFL 2KK4A 4LD9K 5GMKh 3CXCA 2F52A 1G51A 4MZMA 4OB1B 3RR5A 1WGSA 5GAMd 3HHTB 4XTVA 1EIYB 3S1RH 4M77G 3GF5A 2YTXA 4OF1A 3H0GG 4OGCA 5KE2A 1UGRB 1Y7XA 3E9FA 3PNWC 4NOYA 4NXNQ 1UGSB 3T1HQ 4X66L 1N32L 1PH7A 4YWLA 2KBNA 3LYIA 2DTIA 3CP0A 1HK9A 3RZDH 1BIBA 2B3GA 1CSQA 2OTJT 3HOZG 2VYTA 4A3JG 1AH9A 2XGTA 4IUTA 1Z47A 5FJ8H 1EQQA 5CK9A 4O5VA 4LF9L 4KT0E 2EQUA 4IUPA 3E9IA 1VCIA 4DR4L 1WFQA 4E47A 1GKHA 2F5TX 4QL5A 1OTCA 2BIVA 4GN3B 4M75E 3WXMB 1B8AA 3HOWG 4JOIA 3HL8A 3CAMA 2PNHA 3AQQA 1OXSC 3PGZA 4M7AF 4XTXA 1XPUA 2E5QA 4ZN1A 3K7UC 2PVGB 4M7DD 4OX9L 1YJNT 1LTLA 3RZOH 1K73U 4ZGJB 2JOYA 5EG2A 3PUVA 4GLVB 4A4GA 1BBWA 5JJKA 5DY9A 5IYBG 5GQOA 2N49A 5ELOA 4MDXA 3QJYA 2AKWB 5GAN6 3PO2G 1K3RA 2D0OA 2GFUA 4PJOA 3E9HA 4DUYQ 2R58A 2RB6A 3M5AA 3I56T 1AE3A 2DXCA 4AYBE 1NE8A 3SGIA 3J81i 3GTKH 4BBRH 1I94L 5D6YA 4JOIC 3BZCA 2M1HA 3HKZG 4DV0Q 1VQKT 2I2LA 1WQ7A 4IURA 1U1TA 1XNIA 2GF7A 3META 2BH2A 4ZTFA 1YITA 2ZM6Q 1VQHA 2LDMA 4X9DA 1S72T 3KOJA 5IE8A 1YCYA 3MCAB 3UE0A 2IHEA 2JTFA 1WJRA 1C7YA 4IJLA 3M3YH 2L15A 4QQDA 4ELYC 2L8DA 2K75A 5IT9c 1VQEA 4A4IA 3FP9A 3DB3A 4YHHQ 4XU2A 1YNXA 3CQZH 1FWZA 1K8AU 1KD1C 4OWWB 1N6AA 1XMOQ 4PJOB 4A93H 3PFSA 3JCMQ 2UXBQ 4DUZQ 1IBLL 5GANg 2K5LA 5LJ5j 3S14H 4DV2L 4L6V5 2KSSA 1TWCH 4DV3Q 3M57A 4OB2B 2EJ9A 3GNFB 2HBPA 4C8QD 2DIGA 2FVUA 3S3NA 1K8AC 4LD6A 3MEVA 2UXDL 2RCNA 5IAYA 1JJCB 3ASKA 4A3LH 2VC8A 4JRQA 2Y0SG 5I2MA 3X20B 4GS3A 4JCVE 4LDWA 4DR1Q 5LJ5f 3GP8A 4C3IH 2VGMA 4OB0B 1V43A 3D31A 3RMSA 4M7DG 2Q2TA 4JYAL 3F2CA 2CGHA 3S6WA 1YIJT 4X65L 1PHJA 4M7DF 1W4SA 3TEEA 1N8RU 4WJ4A 5FU7C 4HCBA 5CCAA 4YY3L 1CKOA 4X6AH 4HT9A 4E7JA 1O9SA 5M3FH 2KHJA 4C8QC 1G6PA 3PMIA 2E64A 5LMUQ 2XTIA 4A3DG 4LF7Q 4LW1A 3L2VA 1K9MC 4A54A 2LNVA 2LSSA 1CKMA 3FJPA 1TWGH 5LJ5d 3CC7A 2WP8J 4B9WA 3MHXA 3S24A 2KY9A 4C8QA 1PYBA 3CPFA 1K73C 2NZOA 2WB1E 4BY1G 2O01E 2RJDA 2ZTDA 2IHFA 4N4GA 4HJAA 4A3BG 5FLXE 4JI4L 2RJEA 2K5IA 1YJ9T 3QYGB 3HP9A 2L89A 1PH8A 3NENA 4R4IA 4A3MH 2JA8H 3S3MA 2BA1A 4OWXB 2JQOA 1I5LA 3U50C 4QGUA 3CMEA 1VQNA 1TXYA 3ER0A 2UUCQ 4J7FA 2QEXT 2HAXA 3J81c 1KRSA 5IYDH 4B3TQ 1T9HA 5FLMG 4JI2Q 3CCLA 3J80c 4E7KA 3QO3A 3URGA 1VQ4T 1HZ9A 1M1KC 1HZAA 2JN0A 4BA2I 3S2DH 4HCCA 4QY7A 4ALPA 3LGFA 3I2ZA 1HNXQ 1K0RA 3QZ5B 4LF4L 1G3SA 2N78A 3HFNA 3J80E 2O4XB 1BYMA 3J80i 3H6ZA 5C0XJ 2LQ8A 1KAWA 4L5SA 4A4EA 4DV1L 5K36G 5LJ3e 4C0FA 4C92G 4DR7L 1YBYA 4AYBG 4B3ML 5DLOA 3S15H 1L1OC 1VUBA 3BY7A 1SROA 2A1AA 3EFRA 1UWVA 4M78F 2DZCA 2OTLA 3R6OA 2YRVA 3J81E 4NXNL 2YYZA 2E70A 1QVGA 1QP2A 3BW1A 1JMCA 5AJ3L 3M7NA 2YTYA 3CCUT 2HQEA 1UB4A 2EWNA 3ME9A 3RESA 2R92G 1FL0A 2XU8A 2B8AA 1QVFS 3PTAA 4BY7H 1O75A 3OYEA 3S2HH 4M75G 3A0JA 4M75B 1YI2T 5LJ3f 2I0QA 4ZGEB 1LJOA 2EIFA 1NE3A 2RO0A 4LF9Q 1WPYA 4M77F 2X4XA 5M5WH 1WNLA 5IWAQ 4BY7G 1DJ7B 2V8IA 3NTIA 2XD0A 3K7AH 2VNUD 4M75D 2YTVA 4OXPA 3AFQA 2XHCA 4JI6L 3INZA 3G71T 3PCOB 3F2DA 3QYHB 4DV5Q 3GPLA 2Z0SA 3M53A 4IFDI 3V8KA 4QJFA 1Q82U 2EYQA 4JS5A 1GM5A 3RNUA 4LNQA 2XKOC 3N5BB 4KUDK 3K8AA 2ASBA 2QA4T 1KL9A 4WJ3M 1OI1A 3CBOA 4HJ7A 2LCCA 3CBPA 5M5XH 5GANh 2X4YA 4C3HH 4IOCA 4LFAQ 4BACA 3UPUA 1IL2A 1EWIA 2JK8A 3GTJH 3MXNB 1I94Q 4L5QA 2QQ9A 4DK3C 4GOPB 4M7AG 1NZ9A 3S3OA 3PUYA 1VQJA 4PLLA 1PVOA 2PUKB 4JI3L 1WQWA 3FRNA 1Q46A 1B34A 1KQ1A 1N27A 2VGNA 3HOUG 3BDLA 4LF5L 2EAYA 1IYJB 4UY8C 2D9TA 2M16A 3LX7A 3MEAA 4BE2A 4BY6B 4R4QA 1QUQB 3A8GB 4R56A 3BZKA 4M7DB 1BI3A 1FVIA 3U58A 4M7DE 5GAN4 2P0QA 2A8VA 4A75A 3BJUA 4M78D 2NVXH 1J6QA 4M7AE 2R92H 2VL6A 2E8GA 4A3MG 2NVQH 2Y0SE 3CCQA 2MWPA 2UXBL 3AEVA