1BKBA

Initiation factor 5a from archebacterium pyrobaculum aerophilum
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
136
structure length
136
Chain Sequence
b'KWVMSTKYVEAGELKEGSYVVIDGEPCRVVEIEKSKTGKHGSAKARIVAVGVFDGGKRTLSLPVDAQVEVPIIEKFTAQILSVSGDVIQLMDMRDYKTIEVPMKYVEEEAKGRLAPGAEVEVWQILDRYKIIRVKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSLATION INITIATION FACTOR 5A
publication title Structure of translation initiation factor 5A from Pyrobaculum aerophilum at 1.75 A resolution.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Translation
total genus 26
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 1998-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1bkbA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1bkbA02
1NY4A 2K5NA 1HZ9A 3UDIA 3H3VI 4NXML 2RHSB 4BA1I 2Z6KA 4KHPQ 4YWLA 4J15A 1YJNT 3CC2T 4GS3A 4P71A 3KBGA 4UP7A 5ELNA 2MFIA 4JI1Q 4DR7L 4JI0L 1K73U 1IBLL 4A3EG 1BBUA 5EAYA 2B3GA 2WFWA 2YTYA 3F8TA 1E24A 4NPSA 4XIGS 3PF4A 1YEZA 1W2BA 3FKIH 4DK3C 1NTGA 4PG3A 3JAME 1VQ7T 3U50C 3OTOL 4JOIA 2NN6I 4GNXA 2Y0SE 4KHZA 5M5WH 2R7ZG 4BXXG 1PH6A 4HJ9A 5FJ8G 3KDFB 2KCMA 2JEAI 2A1AA 4B3RQ 5LL6S 2G3RA 4LF8Q 1XPOA 1X3FA 5IYBH 2GN5A 1P16A 5ELOA 4POGA 3HOUH 2HHHL 1M1KU 3S15H 1TWGH 4JI5Q 1J5EL 3RZOH 1OXXK 2KENA 4DV5L 1M90C 3HOVG 1Q1BA 3CCST 5LMNW 3J7A5 1GM5A 3STBD 4Y7NH 2F52A 5C0XJ 4X34A 1N8RU 4FDBA 1N36Q 1N33Q 1WCMG 4LFBQ 4NXNL 3VDYA 1YIJA 1Y1VG 3G71T 2JA7G 3S1MH 1XTDA 1PA6A 5M5XH 4DV3L 2E2HH 1Y14B 5IP9H 4AQYL 5IE8A 2JUFA 5M3MG 2LXKA 1HNZL 5FLMH 4JCVE 3HOXG 3KYHC 1VQAA 3CCRT 3ZJYC 4QGUA 1KXLA 1EUJA 1IBKL 2K5HA 2YYZA 1XNRL 2R93H 1VQEA 4IPDA 2E5LL 3FHWA 1XNQQ 4A3GG 4LFCL 3CCQA 3CCUA 3S1NH 3J80E 4A3MH 1VQOA 1SROA 1KHIA 2KBNA 5C0XG 2AWOA 4DV2Q 1B7YB 1CKMA 2YV5A 2ZJRA 1MJCA 3WWVA 3F1ZA 1K9MU 3TREA 1PH1A 3UE1A 2NVTH 1K3RA 3E9IA 1FJGQ 4P72A 1YHBA 3GTKH 2UU9L 2VQFL 4BY1H 4BY7G 4DR6L 1JJCB 3M9BA 4BBRH 5JJKA 2IT1A 1NBWA 3K7UC 3PUWA 4A4IA 4DR3Q 4LF6Q 2KHJA 4A76A 4DUZQ 1VQNT 5IYCH 1Q8KA 3MEFA 3CCMA 1QVCA 3F2CA 5JJLA 3J81E 1KQSS 4GNXC 1B8AA 5C44H 3CMET 1YITA 1JJGA 2EXDA 2NZHA 1GKHA 4A3DG 1U5KA 4IPCA 3KF6B 4GKJL 5M3FH 2AWNA 3S1RH 3KDFA 1TWCH 1AE3A 4JBKA 2D0PA 4HJAA 5IT9c 4POFA 2WAQG 2UXBQ 1B70B 2QA4A 4L5RC 1YHQA 4LFAL 2MI6A 2Q2UA 4DR4Q 3CPWS 1BBWA 3CMAA 2OCEA 2OQKA 4HIMA 3AFPA 1YZ6A 2ZM6Q 2JA6G 1VQOT 4DR5Q 3L7ZC 1PHJA 1DGSA 2PI2A 5C3EG 3KJPA 4LF7L 2JA8G 2KHIA 3AFQA 1JB7A 3I2ZA 4APVA 1X65A 2VQEQ 4DV1Q 4QIWE 2N8NA 4X65Q 1IBML 2DO3A 4LF9L 4A3KG 1K83H 2UUBQ 4GN3B 3RR5A 4JI4L 1SMXA 2VS1A 3CCMT 1IYJB 4DR7Q 1YJNA 3CC2A 5GROA 2R7ZH 1VQLA 1XMOL 4BXXH 1PH9A 1V9PA 4DKAC 3GTPH 5FJ8H 5JEAG 5HGQA 4ZN3A 1YI2A 1E1TA 1VQ8A 3ULJA 3BZKA 2EIFA 1GD7A 2AHOB 2E8GA 2IHFA 4DV4Q 3UDGA 1PVOA 2VNUD 2JA9A 5A2QE 4IJLA 1NJIC 4EQ5A 3HOVH 4H02A 3CPFA 4IFDG 1VQHA 1Q1EA 2JA5G 4JI3Q 3H0GG 4DUYL 2B63G 5FLXE 3CMAT 1KRSA 1SFOH 1E7ZA 3PUXA 1WCMH 2XTIA 2ID0A 5LMUQ 1PH3A 1N34Q 4YWKA 1AH9A 3RZDH 5IYDH 2UUCL 1X54A 2UXDQ 1KC8U 4A75A 3GDEA 4GKKQ 5M3MH 1M90U 5C0XI 4YY3L 3CCSA 3KF6A 3HOXH 4P73A 4MNOA 1TWAH 2ALYB 4IOCA 4X66Q 1G291 2UUAQ 3PUZA 2IX0A 4DV0Q 1JJ2A 3EN2A 1PYSB 1S40A 4QQDA 4A3GH 3G71A 1M1GA 1X3GA 4B3ML 2F4VL 1HJPA 2HQLA 4AIMA 4JV5L 1FL0A 2CQOA 1VQLT 2MNAA 1HR0Q 1K8GA 3KF8B 1C0AA 3CCRA 2KDSA 1HNWL 2D0OA 1S72A 1YI2T 3HOYG 1QVGA 1Q82U 1VQ8T 4DAMA 4BY7H 2E70A 4LUOA 3HKZG 4OX9Q 3GTGH 1WFQA 3TS2A 1NMGA 3TS0A 2A8VA 3BJUA 3CCVT 3GD7A 1OXSC 4B3SQ 3NENA 3G6ET 1CSPA 2KCTA 2MWPA 1N32Q 1I5FA 4ME3A 4JI8L 3T1HL 4JYAL 4YCUA 1XMQL 4YHHL 3I4MG 1H95A 4QL5A 1V43A 1VQNA 4A93G 1ASZA 2HIXA 1PH7A 1PH5A 5GQOA 2YTXA 2JJQA 1J6QA 4GN4B 5GADC 2IHEA 2K75A 3L2PA 1I94L 2CKZB 4EX5A 1A0IA 3CMEA 2AMCB 3OW2A 2HT1A 4RG2A 3CCET 3CXCA 2XGTA 3D31A 2ES2A 2JA6H 4OWTB 2YTVA 5C3EH 4DV6L 4A3CG 1RL2A 1UWVA 1X56A 5BR8L 2JOYA 5AJ3L 4DR1L 1S72T 1EFWA 4TQUS 4HIOA 1HNXL 5IY0A 4A3FG 4GKJQ 3T1YL 2ASBA 1SE8A 3PIPA 1OXUA 1UE6A 4LWCA 3M3YH 4DPGA 2WAQE 1GO3E 4KHPL 2R7FA 4A3LH 1YBYA 3I4NH 1R9TH 3ULPA 1PH4A 2Z6KC 4UP9A 2R6GA 4JI1L 3E9HA 3JAMi 4HIDA 1Q81C 2WB1G 1VCIA 4O2DA 4BBSG 1VQ5T 1PH8A 3K7AH 1VQ9A 4X64Q 1BVSA 4AYBG 4LF4Q 3PO3G 4IFDI 4K0KQ 2VY3A 2DUDA 4OO1G 4Y52H 1G51A 3S17H 1W2BS 1VQCA 2L15A 1K73C 4R4TA 3GTJH 3E0EA 1SSFA 1XNIA 2E6ZA 2Q2HA 5LMNQ 4JOIC 5C4XG 4A3BG 3AYHB 4JI7Q 4JI6Q 3DB4A 4OWWB 3TRZA 3NBHB 2JA5H 1QZHA 4OWXB 4DR2Q 3H0GH 4LF8L 2MQHA 4B3RL 4DV7Q 2Q2IA 4L5TA 2B63H 4QQBX 4ZN1A 1VQIA 2IX1A 3CCLT 3KOJA 3CF5A 1X9NA 3ICEA 1KD1C 4JI5L 1VQ6T 2K50A 2CWPA 2QGQA 3PV0A 1YJWT 4LF5Q 1WJJA 3MXNB 2K14A 1NJIU 1Q12A 2PI2E 4IJHA 3S24A 2PQAB 3CW2C 5C4XH 3PO2G 2UXCQ 3K80C 1N36L 1N33L 2ZTCA 2CCZA 2BH2A 3JC66 4LFBL 2R7DA 1PFSA 4PZ7A 3EBEA 5JEAJ 3M4OH 3U4VA 5IWAQ 5K36G 4GOPB 1G6PA 3PUVA 4LUZA 3CXCS 4UP8A 1XPUA 2ZTDA 1N8RC 3RLFA 2E2JH 1VQPT 3HOZG 2RF4A 1YVCA 3J80i 4WJ3M 1VQ9T 1VQKA 1SRUA 1HZAA 2L3RA 4A3EH 1PV4A 5DLQE 3U58A 2NN6G 4B3TL 4JBMA 1XNQL 3LGLA 1Q86U 3HOYH 2FXQA 2ZJQA 5IAYA 3GTLH 4IFDJ 1IXRA 1Z9FA 5H1SE 2AKWB 3GTOH 2K5VA 3J81j 3PCOB 4JI2Q 3UDXA 4DV2L 4UPAA 4BA2I 4JC0A 3A74A 4OONA 2Z0SA 4HJ7A 4B3TQ 1EOVA 1FJGL 2VL6A 1WYDA 3DB3A 1KAWA 3J81i 1N9WA 1MJEA 1RIPA 4DR3L 4LF6L 1QZGA 4NXMQ 3I4MH 1L2FA 1WOCA 1U0LA 3JAMc 1LM0A 4DUZL 1Y1WG 4IO9A 4GLVB 3W5OA 4JI0Q 4AH6A 4A93H 1IBLQ 1Z47A 3CCVA 2R93G 4UY8C 2R92G 3G6EA 4OXPA 1WI5A 3NEMA 3PUYA 3RNUA 4CRIA 4PZ8A 3HKZE 4RMFA 1BKBA 3OTOQ 1IZ6A 3HFZB 3M4QA 2CKKA 1Y1VH 2JA7H 2GVBA 3G4ST 1VQBA 1L1OB 3RLNA 2LCLA 1GVPA 2B29A 2ATWA 2I5LX 4A3CH 2UXBL 2GVAA 4LNQA 4BY1G 4X62L 4BBRG 1LYLA 1VQKT 3BU2A 2WP8J 5M5YH 4DR4L 2IY5B 1KL9A 1T9HA 1VQ4T 2XHCA 1D8LA 2OQ0A 5IT9E 1ASYA 2HHHQ 2I5MX 4A3FH 1J5EQ 4C3HH 2ZM6L 4DV5Q 2PQAA 3CCEA 4DR5L 2IG0A 3OYYA 3P8BB 1VS0A 3A0JA 2JA8H 1CUKA 4DV1L 2VQEL 4ALPA 2MO1A 4NXNQ 1C9OA 1PYBA 3PSIA 4GOPA 4X65L 4R4QA 2ZJPA 3PO3H 4DV3Q 4AQYQ 4JG2A 2DGYA 2PMZE 3UE0A 3W1BA 2H5XA 1EYGA 1HNZQ 2UUBL 2MWOA 3A5UA 2OTLT 1IBKQ 1S3OA 1XNRQ 2N3SA 1V1QA 3ULLA 3M85A 2E5LQ 1K8AC 4A3BH 1VQ5A 4HIKA 4LFCQ 4HJ8A 2I0QA 5E7NA 1VQJA 4A3DH 1EQRA 3KJOA 3S16H 2EQSA 4DV4L 1XPRA 3UDFA 3GO5A 1HZBA 1W3SA 2WB1E 3I56T 1VQGA 1SLJA 3CP0A 1HH2P 3STBC 2UU9Q 1EWIA 3CC7A 4AYBE 2JEBI 3J81c 3I4OA 2VQFQ 4JI3L 3FP9A 4DR6Q 2N49A 3H3VH 3PO2H 5JJIA 2KVQG 1X6OA 2JNGA 2QEXA 1A62A 1EIFA 1E3PA 3LGJA 1KQSA 3CCLA 2ZTEA 4O0AA 5LMUL 4C3IH 1N34L 2NVXH 3HOWG 1D7QA 1VQ6A 1KD1U 4DK6C 2UXDL 1Q7YC 1YJWA 5GAHC 4GKKL 3CC4T 3S1QH 4PZ6A 1XJVA 1I6HH 3TQYA 4GLXA 3Q8DA 4A3IG 3W1GA 3HOZH 4X66L 1L1OA 4DNIA 2UUAL 1FVIA 3CAMA 3CQZH 3G48A 4DV0L 1E1OA 2LQ8A 1KC8C 1QVFA 3DM3A 1YJ9A 4QY7A 4A3KH 2OTJT 1JJ2S 3I55T 2HIVA 2N78A 3I7FA 3RN5A 1HZCA 4LFAQ 3EIVA 3CPWA 2K52A 1HR0L 2VZAA 2JK8A 3CCJT 1VQPA 4LW1A 3GTQH 1NPPA 1EQQA 3PIOA 1QUQB 3K0XA 2NVYH 1QVGS 1LTLA 5IYDG 3RN2A 4LF7Q 3ER0A 4GOPC 4R4OA 2Q2TA 3NELA 4OX9L 2LVMA 4P75A 1Y1WH 4R1JA 2VUMG 5IP7G 2BH8A 2Y0SG 3IRBA 4A3JG 1CKNB 1CSQA 1Q82C 3ERSX 1KRTA 3CC7T 4B3SL 2RCNA 1VQFA 1N32L 1IBMQ 4LF9Q 2R92H 3F2BA 2NVQH 4JBWA 2QEXT 4JI4Q 1X3EA 4KI0A 3CD6A 1FGUA 5GAGC 4L5SA 2NZOA 3LH0A 1Q46A 1XMOQ 3LGFA 1K0RA 3M4PA 3PGZA 1EIYB 3KFUA 3FKIG 1NMFA 1OTCA 2RHQB 4YCVA 3HKSA 1L0WA 3AQQA 1M1KC 3L0OA 1VQMA 1JE5A 2I5HA 3K81C 1MIUA 4MZ9A 5FLXc 1YJ9T 1VQDA 2CWAA 1I3QH 3J7ZC 3OW2S 3G4SA 2E2IH 1PH2A 2JQOA 1CKOA 3K8AA 4DUYQ 5IYBG 4IPGA 4HJ5A 4QJFA 1YIJT 4YWMA 4C3JH 1TWFH 2A19A 4PMWA 4DAYB 1VQ4A 3HOUG 3RLOA 2MO0A 1L1OC 5C4JH 2UUCQ 4WJ4A 1OXTA 2JVVA 1QVFS 1JT8A 1YNXA 1TXYA 4YY3Q 4X62Q 5J3BA 4LUVA 1UEBA 4IOAA 1UE5A 3U4ZA 1OXVA 4YTLA 3J7AF 4KLKA 3CCQT 4X64L 3CCUT 2VW9A 4LF4L 4K0KL 5IP9G 1SN8A 4L5QA 4TVRA 2C35B 3CD6T 4JBJA 4B3MQ 3A5ZB 5FLMG 1K9MC 2F4VQ 2BA0A 4IPHA 4JV5Q 4MTNA 1KIXA 4X6AH 4YCWA 1QUQA 4GN5A 2OTLA 1YHAA 1NZ9A 1HNWQ 5LMNL 3SGIA 4GNXB 4JI7L 1SR3A 3KLWA 4JI6L 3S14H 1TWHH 1I50H 5J26A 1VQMT 1K8AU 4DR2L 4A3MG 3S2DH 3D0FA 3H15A 5HY6A 2F3IA 4DV7L 2V1CC 1CKNA 4A3LG 3I4NG 2LSSA 1UE7A 3B6YA 3F2DA 3BZCA 3AEVA 1A63A 1JMCA 1P8LA 1HR0W 3HOWH 4TVAB 1NPRA 4LF5L 3DLLA 3I56A 4XTCS 1YITT 1X55A 4JI8Q 3T1HQ 3M7NA 5GAEC 1XMQQ 4YHHQ 1AE2A 4JYAQ 1O7IA 4A3IH 2UXCL 3S2HH 2K4KA 1VQ7A 2LXJA 5IYCG 3TEHB 1A8VA 1MKHA 4OO1I 4RG1A 2BA1A 1E22A 1NE3A 4GLAC 4R4CA 2QA4T 5DM7R 1YHQT 5IWAL 5C44G 3GTMH 4P74A 1Q7YU 1I94Q 1C7YA 3CC4A 2D62A 3PF5A 4BBSH 5M3FG 2JE6I 4NB3A 2YU9H 4C2MH 4R4IA 2OWOA 4DV6Q 2OTJA 2PNHA 3I55A 2CFMA 3J80c 5BR8Q 5AJ3Q 4DR1Q 4JI2L 1IL2A 5IP7H 1HNXQ 2VUMH 4A3JH 1LUZA 3CCJA 1Q86C 1UE1A 1Q81U 3T1YQ
chains in the Genus database with same CATH superfamily
5KYXB 2K5NA 2ABLA 3UDIA 3ITPA 4BA1I 1WJRA 1T0JA 2L3SA 1SDFA 1VQ7Q 2WAQB 4D8KA 3CC2T 2Z6KA 3ONAB 2RI2A 4GS3A 4J15A 3EG0A 3QUIA 1G8XA 5EC7A 1K73U 2LQKA 4C5IA 2EBPA 5EAYA 5A35A 4NPSA 3DHQA 1WJQA 1BK2A 4M75G 1UTIA 4B08A 2SRCA 2OT2A 4OL7A 2TMPA 4KHZA 2R57A 1AZGB 1AZQA 4FCYA 2FPDA 2DTOA 4BXXG 1YCYA 1I1JA 5CVIA 3KDFB 2NUTB 2JEAI 1FR3A 2C0OA 3M0RA 3TSSA 5BN3A 4B3RQ 4M7DB 9ATCB 2DEUA 5IYBH 2HMAA 2QTVA 3H94A 1SSHA 4POGA 2HHHL 1M1KU 3HOYB 1KQ2A 1TWGH 5C4ZA 3INZA 3RZOH 2FZCB 1IB8A 1SNCA 1Z6HA 4HA8A 1VF7A 2EYJA 2HL5C 2J0TD 4Y7NH 2J7IA 4HTHA 3H09A 2F52A 1H8KA 3CCRQ 1N36Q 1PFMA 2IL8A 3R8BA 1WCMG 1Y96A 3ZYYX 1RDPD 3CQTA 3A8JE 3RKXA 3SK4A 5IXBA 3K5LA 2QDYB 2E2HH 4AQYL 3GP7A 2Q8IB 5IE8A 4QUCA 3AB9A 4G4KA 1EY5A 1N27A 1VOMA 2YYZA 1BDOA 1XNRL 3WXMB 1S5FD 1VQEA 1XNQQ 4A3GG 2BUDA 5JJZA 3CCUA 4L63B 1UE9A 1QWYA 1SROA 4XAXB 1B7YB 1JXMA 2W0ZA 2OF1A 3GNFB 2NVTH 3GTKH 4AG1C 4DR6L 3M9BA 4EIKA 3D6CA 4DR3Q 1EY7A 4OMNA 2KHJA 4FW1A 2Z4IA 2GTOA 3SDZA 3CCMA 3VR5A 2QXFA 5LJ3g 1RJTA 4RTYA 4GNXC 4O6JA 3I73A 5J22A 5I2MA 3SK5A 1YITA 2EXDA 3QIAA 4PJNA 4A3DG 3VYHB 3KF6B 3SHLA 4JBKA 5GANg 1WPYA 4PFZA 4E2FB 1ZKOA 3GP8A 3CKIB 5EPJA 3CBMA 2HBWA 3A56A 5CYUA 1B70B 2QA4A 4LJZC 1T0HA 4A4HA 3QG1A 1KDAA 2AHJB 1TR5A 4HIMA 3CEYA 2F0NA 4QVCA 3L7ZC 1PHJA 5C3EG 4DN4M 1U3OA 4LAAA 5GAN2 2P4RA 1SYEA 5LJ3d 3QB3A 1SYBA 2WIIB 1D1CA 1D6EC 1WCMB 2RHXA 4X65Q 2CP5A 4A3KG 4F7UF 4GN3B 1AFPA 4DFAA 2EJGA 5GANd 4JRKA 5GAOq 1TS9A 3CCMT 1RI0A 2KJXA 4FVMA 4RTVA 4X1VA 4F7UE 4XT3B 4DK1A 4JPBW 5FJ8H 5JEAG 3C0CA 4ZN3A 1YI2A 4NL2A 2EJMA 3X20B 2DRKA 1OV3A 5EKLA 1ESRA 1CI3M 1JOKA 2VNUD 2FPEA 1CZWA 3W3AA 4IJLA 1IKMA 3SK6A 2F5TX 3CPFA 1OULA 1Q1EA 2JA5G 3H0GG 4DUYL 1GUSA 5DLOA 1PMRA 1KRSA 4FNFA 4QW2A 4KJNA 5AFWA 1WQ7A 2ID0A 2LDMA 2L12A 2EY1A 1X32A 3I90A 2CT3A 5IYDH 1X54A 5ELDA 1STGA 4A3BB 1AD5A 3CCSA 2ALYB 1SYFA 1VQLQ 1RCVD 2C5CA 1G291 2F0PA 4X66Q 4IOCA 1FMKA 3PUZA 4A3DB 2E6NA 3LLRA 1JJ2A 2HQXA 1IYUA 3J80L 1K8AR 2D8HA 4C56C 2KR3A 1FGBD 4AIMA 1FL0A 1HK9A 5C0XH 2V1RA 5CR3A 3PO2B 3MO8A 1ZYRC 3META 2KDSA 3A8IE 1YI2T 1QVGA 1AP0A 3A98A 5M9OA 5D65A 3TQ7P 5ISRA 1PZID 3E3XA 1QILA 1DOMA 3HKZG 5C3EB 1GXIE 3D4DA 4X3TA 4Q0FA 1UGPB 4C1NK 2QQSA 3Q1JA 5J39A 1CSPA 2L5TA 3BZDB 2O5JC 5ELFA 1PTOH 4A3KB 3I4MG 3FC3A 4QL5A 1V43A 4RGMA 2ZCFB 1R9TB 2L8DA 3CXCP 1D0ZA 1NSNS 4P5NA 2JMCA 1RLPC 3PGGA 1SF9A 3P8DA 2EGEA 2YTXA 3ND9A 2A37A 2JJQA 1J6QA 2DD5A 5GADC 2MCNA 2NUPA 2K75A 4ZUIA 1I94L 3M59A 1H9MA 1SBBB 4HVUA 3CMEA 3M0TA 3A7LA 3UT1A 1EIGA 2AMCB 2RD1A 1HUNA 3GTJB 2KT1A 2G5DA 3JCMP 4OWTB 4A3CG 2D0NA 3QO3A 1BQQT 2YUNA 3NQIA 2JA5B 2NVQB 2HSPA 4JLIA 3MPUB 3EFOB 5KEEA 3L2RA 4CKBA 4GKJQ 2F0UA 4DF7A 2YRVA 2DXCA 2G9HD 3T1YL 1OXUA 4FW2A 1UE6A 2A6HC 4NDXA 3TP7A 1QB5D 2RHYA 4DPGA 1GO3E 1D3BA 3JB9F 2FZGB 1WTVA 2EJFA 3E9HA 2QCPX 4BBSG 1VCIA 4O2DA 2B2YC 2EQIA 5HK3A 3K7AH 1PH8A 2DIGA 3OBWA 2DL5A 5HK0A 1I3QB 3S17H 1AOJA 1TXQA 1CQFA 4XDXA 5I2YA 1EY6A 2QEXQ 1SSFA 3CCLQ 2JYOA 4RCBA 1DYQA 4N4GA 3FDRA 2YLBA 2NZ1D 2SOBA 1VYTA 4B3RL 4F8MA 3BS1A 1B34B 2QQ9A 4L5TA 2B63H 1X2KA 4ZN1A 1VQIA 2M2LA 1OQKA 3HKZB 3ICEA 1NG2A 4OB0B 3VR6A 3GPLA 4M77C 1AHJB 1H9SA 1SAPA 1XWEA 2QGQA 3PV0A 4K5VA 4LF5Q 2KYMA 2RKSA 3EHRA 5LJ5j 4PLLA 4IJHA 1GXDC 3S24A 4J6WA 2UXCQ 1N36L 4F14A 3RIRA 2E5KA 4KGXB 1V1PA 4PZ7A 2M9UA 1W6XA 3I9QA 4FSSA 4JS5A 3U4VA 1C8CA 2R93B 3PUVA 5EKIA 3CXCS 4UP8A 1G6PA 3EJIA 3MEVA 1XPUA 3TEEA 2GQVA 1EWHA 2E2JH 1VQPT 1K9MR 2RF4A 1HFGA 1VQKA 1K8OA 2NN6G 1XNQL 1A3UA 2D2CC 5ELBA 1AWXA 4Y92A 4CI0C 2AKWB 3GTOH 4JS4A 3H8ZA 1BBZA 2DL7A 3UDXA 2M16A 4BA2I 4JC0A 4HJ7A 2O2OA 4E7JA 1G2TA 4V2SA 1K76A 1HXDA 2J4XA 1N9WA 4DR3L 1NYFA 2J06A 4AMCA 1LM0A 3N5BB 4IO9A 3W5OA 2A6ED 1QKXA 4A93H 4C5HA 3CCVA 3F70A 1H9RA 4BBSB 2DZ9A 1M3CA 3SWNC 2M02A 3G6EA 3NEMA 3H0IA 1BKBA 2K5QA 4M7AA 3M4QA 2EWNA 2B8GA 2JA7H 1JJ2P 2WV6D 4ABNA 3G4ST 1VQBA 2LCLA 2E3IA 2LQNA 3EGDA 1HQRD 2B29A 4LNQA 2EGCA 1LYLA 4A4GA 1VQKT 2A73B 2OAUA 2CP7A 2WP8J 3BU2A 2F1LA 4LDVA 1VQ4T 1ASYA 3HPWA 5IT9E 2KE9A 1QVGP 1E2ZA 3HG9A 3KLSA 4A3FH 3M4YA 2JW4A 1I4HA 2GQIA 2PQAA 3HZXA 3I8ZA 2SEMA 4NW2A 2B2TA 3A8MB 2IPKD 1ZUKA 1VS0A 4AFZC 1IL8A 3A0JA 2OTLQ 3K5MA 1CUKA 2JA8H 4ZGEB 3JCMf 3ZEHA 1PYBA 2EYFA 4NXNQ 4X65L 4XU1A 4OO1H 4JZ4A 2EQUA 4EQPA 5M5WB 5NUCA 1E2WA 1UJ0A 2DGYA 2PMZE 2J7ZA 4HAEA 4RKBA 5FU7C 2MWOA 3VUBA 2LT4A 3A5UA 3QJYA 1VMPA 4M78A 1S3OA 2K5WA 1IBKQ 5GJWB 3UF4A 1V1QA 3I56Q 3S15B 4KY6A 1U4RA 1VQ5A 1H9SB 4ULLA 2LCCA 5I11A 1BI1A 2M0OA 1GFCA 2F0OA 2XSCA 4K6DA 5E7NA 2QK0A 3KJOA 1STEA 4M8AA 3VS3A 3UDFA 2DBMA 4DAPA 4ZK9B 2YUPA 4XTVA 3JAMc 2G6FX 4OEMB 5CCAA 4DNTB 4IUTA 1W6JA 3MHBA 4RKUE 4DBFA 2NVYB 4DGZA 5M5XB 3CC4Q 4HVVA 3H3VH 2NBFA 1MBYA 3UI2A 3OS5A 1X6OA 1RD9D 3G7ZA 1QVFP 1D7QA 1JC7A 3DEPA 1VQ6A 1FMVA 4ZQ3A 3MCAB 3H0HA 4OMMA 5LJ3h 1Z7TA 1XJVA 4A3IG 1G2BA 4R0KA 4X66L 1L1OA 5IODA 2F3VA 2L0CA 2GCXA 2PZ1A 4PMBA 3X24B 3VR2A 1E1OA 2JTEA 2E3HA 1JJ2S 3I55T 1LPLA 5GANh 2OTJT 2HIVA 4JW0A 4LFAQ 2P84A 4RGNA 2LZ6B 2A3LA 5E1FA 2JK8A 3GTQH 5LJ3e 1QUQB 2RQVA 1XX8A 3ULRB 1FYCA 1QVGS 1QCBD 2KVMA 3RN2A 1ABQA 2KEEA 3LWIA 2Z9HA 1XXGA 2KAFA 2AQ3B 2QQRA 2KCNA 1J9OA 4R1JA 5GANe 2BH8A 2LQWA 1ZHIA 1S1NA 2FRYA 1CSQA 2LMCB 1A3TA 2KEDA 1GCQA 2RCNA 2XD0A 4EMKC 2R92H 3EGDB 4JBWA 2LY7A 5I6WA 4JI4Q 1G2SA 2JS2A 1WHKA 5IIFA 2NZOA 2M0YA 2Z1CA 2KSSA 1YJ9Q 3LGFA 1F2ZA 3PGZA 1EY8A 5K5PA 2JTFA 3KFUA 3FKIG 1NMFA 1OTCA 2RHQB 2K04A 3WVEB 2RMOA 2ROLA 2DYBA 1EOTA 1JE5A 3K81C 5I21A 4MZ9A 4PFPA 1YIJQ 2CWAA 1WLPB 4K11A 3V96A 3S14B 4FF3A 3LX7A 3FJPA 4HCCA 4ZLTF 4C8QA 1ZSZC 5IOCA 3D4WA 2L2PA 2MO0A 3SD4A 2XKOC 4RUGA 1OXTA 2JVVA 1QVFS 1TXYA 3ZL7C 4X62Q 2KROA 3I4LA 1UE5A 2XRQD 4A3IB 2VW9A 4ZTFA 1GUWA 1TIID 2DZCA 3JCMV 4TVRA 2C35B 3HOVB 3A5ZB 5CGKA 2PU9B 3MXPA 4L5GA 1GOZA 4WCIA 4C8QG 1YHAA 1HNWQ 3VS4A 4GNXB 1SR3A 1HPCA 1X6BA 2MJ8A 1TWHH 2DVJA 4KD3A 1JORA 3RZDB 3H15A 1QMCA 1CKNA 1UE7A 3B6YA 4JRIA 5IGGA 1G5VA 1IGQA 5KNBA 1HR0W 4LF5L 3V05A 1BCOA 4Z8AA 1BYMA 4O1NA 4DOVA 2OEOA 4XTCS 4JI8Q 4X9CA 3T1HQ 3QOLA 5GAEC 4YHHQ 1AE2A 2JTMA 2K32A 3M57A 2UXCL 3S2HH 1SJED 1VQ7A 1GUTA 5IYCG 3VS1A 1CHPD 4RG8A 1MKHA 4OO1I 4HSPA 1SHGA 3DWQA 2DL3A 3R2IA 2FPFA 2KI7A 2PQWA 5AYFA 5C44G 1PRTF 3R3OA 4KH1B 4RTZA 1NM7A 1C4QA 2YUQA 3FKIB 4HR7B 4J9CA 2L3QA 4WRDA 5C3WA 3JB9D 2FJ2A 3HRZC 1B3AA 3T13A 5M3FG 4BI3A 2YU9H 3E19A 3EGXB 1HCZA 1Y8OB 2OWOA 1PZKD 4DV6Q 2CFMA 3J80c 3RMHA 5BR8Q 1WA7A 1BU1A 3QWXX 5AJ3Q 2VUMH 4KRTA 1YJNQ 4A63B 1LUZA 2DNCA 3CCJA 5C4XH 4KK7A 4NMZA 1Q81U 4JJBA 4HXJA 1NY4A 4A53A 1RADB 1VQ8Q 3H3VI 2JMAA 2K7VA 2RHSB 2F2XA 5EKKA 4P71A 3KBGA 4UP7A 2Q8TA 3OPOA 1T3SA 2X4YA 1BBUA 4XXEA 1WI7A 4A3EG 2ZXRA 4XIGS 4L59A 4PG3A 1PHTA 2CDTA 3JAME 1VQ7T 2K1BA 2MOXA 2XDDA 2ZPHB 2DVEA 2XIWA 1WHHA 5FROA 2R7ZG 2CVRA 3J81L 1PH6A 2ZPGB 4HJ9A 4KBMB 4HCZA 5LL6S 2G3RA 2A68D 5KYYA 2WSFE 2L5QA 4LE9A 3TP5A 4CKCA 1XPOA 4A3BG 3M3YB 2XK0A 1JEGA 1LT3D 4BB7A 4DA4A 1OXXK 4WTOB 3G71Q 2KYBA 5JAVA 2DFUA 1U5SA 4OIJA 3PT9A 4C0FA 1VYUA 1SYGA 1Q95G 4JUVA 3BG3A 5LMNW 1GM5A 3STBD 4X34A 1N8RU 1EEFD 3OBYA 1OU9A 4IUQA 1WDXA 2IJ0A 3BVZA 2EYLA 3FMCA 4FDBA 4OMOA 4NXNL 3VDYA 2KRNA 1XTDA 2XDBA 1TG0A 2DXTA 3R6OA 1Y14B 4HSVA 2JUFA 5M3MG 4BE1A 5C44B 5FLMH 4JCVE 2O9VA 2JJ9A 4QGUA 3CCRT 3HOXG 1KXLA 1PFBA 1EUJA 4M77G 1IBKL 2K5HA 3P1HA 5M3FB 1BBXC 5CC4A 3CCQA 3S1NH 4A3MH 1KHIA 2X35A 3A8OB 2A6HD 3VS5A 3WWVA 2ZJRA 3EG2A 1VQNQ 3O8VA 5KYXA 1KD1R 3LX0A 1D0XA 1I07A 3E9IA 4P72A 2EQJA 3MTSA 4BY1H 4BY7G 2HBPA 2P0KA 4BBRH 5JJKA 2IT1A 3K7UC 2VGMA 4LF6Q 2XI9A 2MPXC 2FG0A 3MP1A 2JZ2A 4DQ2A 1Q8KA 1NLOC 1QVCA 4EDUA 3MEFA 4CDEC 3J81E 4A3EB 1EQVA 3L1AA 2NWGA 3L2UA 2K28A 3O5ZA 3GTLB 4F7XA 2NZHA 3ERQA 1U5KA 4IPCA 2QG9B 3L9AX 4KHVA 2LT1A 2MK5A 3KDFA 2R5MA 2NUTA 1TWCH 3ASKA 5T1GA 5IT9c 2R7ZB 3FJ5A 1HA6A 4BI8B 2WAQG 4M77D 4LFAL 2PUKB 1YHQA 1CA6A 2MI6A 1RTOA 2Q2UA 3C46A 4DR4Q 4CJ1B 4A54A 2OCEA 2BDOA 1GBQA 2JA6G 5FKAC 4L6TB 1OOTA 3KFVA 1Y07A 3TVTA 2A6EC 1M9SA 2HD0A 1JB7A 3GQBA 1SFOB 3X3NA 2K57A 3BW1A 4N9PA 4OELB 4QIWE 1O7ZA 1CKBA 1WD0A 3VA7A 1I5LA 2UUBQ 1B7TA 1K4US 3RR5A 1EFNA 3HP3A 3BDUA 2PMZB 2VS1A 3CHBD 3E0JA 1B07A 4ZRZA 4JI4L 4KD4A 3CC2A 1VQLA 5M5YB 4BXXH 4M77B 1I4QA 1V9PA 3GTPH 2EDGA 2F2VA 4RHSA 1RAAB 2RA2A 3L2VA 2ZPIB 4JJDA 4AG2C 1E1TA 1WXBA 1EZ6A 4K8IA 5GAMf 2RDHA 4P2CB 3TMEA 1R77A 2EIFA 5IHIA 4XU2A 1TSFA 5HKCA 1VYVA 3CMAQ 2SDFA 5E3FA 1QP3A 1DCZA 1PVOA 5EPKA 3OS0A 3PMTA 5A2QE 1NJIC 4EQ5A 1U9RA 2RA4A 4IFDG 1VQHA 2Z8LA 4BDYA 3VYUA 2AZVA 3PO3B 4BY7B 3L3OC 2DJQA 1DONA 1WCMH 2HQEA 2XU8A 2XTIA 5CKFA 3TDQA 1AH9A 4RTUA 1KC8U 4NKLA 3GDEA 4A75A 3OSOA 3KF6A 2DPPB 2F0HA 1UAPA 3X3MA 4FYVB 2LJ3A 2FB7A 3M53A 4A3GH 1PYSB 1S40A 1M1GA 1I0CA 1AZEA 1NR4A 2EFIA 3NXWA 4N8X1 1WTRA 2MNAA 1VQLT 1N5ZA 1HR0Q 4BUGA 3LWEA 1SNOA 1EU3A 4L8JA 3HOYG 1HNWL 2ECZA 3SWNB 4DAMA 3OYFA 2JA6B 1AN8A 3GV6A 2COYA 5LJ5f 4LUOA 1AT1B 1JWSD 3GTGH 3TS0A 3BJUA 4U673 3S1QB 3GD7A 3HS0C 4UAIA 3HOZB 4OP0A 1OXSC 5D3DA 1K9AA 1WVLA 1I5FA 3RERA 5I6YA 4PFOA 4JI8L 3T1HL 1H95A 2RCFA 4YHHL 3QZ5B 4GLMA 5FWBA 4FYDA 1RAFB 5AT1B 3EA6A 3GNGA 4Q5WA 4BACA 1ASZA 2WACA 1LNXA 2EPDA 5GMKh 4JRPA 3CCEQ 3MA2B 5GQOA 1PKTA 3QYHB 1GUOA 3OWEB 2EY2A 2EYWA 3L2PA 4EX5A 1A0IA 2F0DA 1S72Q 1MUZA 1WFWA 1PTOF 1I81A 1BF4A 1W6KA 3BDOA 1ONLA 3CXCA 1SRLA 3PNWC 2L1BA 2F69A 4LXCA 4DV6L 5C3EH 5FU7B 1UWVA 2A36A 5GMKe 1X56A 5BR8L 5AJ3L 2PQEA 4IUPA 1EFWA 2LJ0A 4E7LA 5IY0A 4C3HG 2JSOA 4IIOA 1SE8A 4J9BA 3M5AA 3PIPA 2B2VA 3JCMJ 4LWCA 4XT1B 5EPLA 2B2WC 3VR4A 4QCLA 3A8HB 1EYDA 3I4NH 2VUBA 1R9TH 3ULPA 5KCOA 1PH4A 3JAMi 1PRMC 3OSSC 2R6GA 4UP9A 4CDDC 4HIDA 2WB1G 2E12A 2CT4A 2D0QB 5DAUA 5KE2A 1VQ9A 4IFDI 2FYKA 3CC7Q 4K0KQ 2VY3A 4XQ3A 2DUDA 4J9DA 1B9MA 2JN4A 4GBQA 4CDFC 3M4OB 1VQCA 2E2IB 1UGQB 4XTUA 1L0YB 2LFNA 3GTJH 3E0EA 1XNIA 1M1FA 2F5KA 5LMNQ 1ML0D 2AK5A 4IURA 1CT1D 4JOIC 4MN3A 4H0LC 4C3JB 1BCMA 3DB4A 1YJWQ 2AKKA 4JI6Q 2WINB 5KYWB 4OWXB 1QZHA 3H0GH 2JA5H 2MQHA 4MMLA 4XK8E 1H9KA 2D1XA 3H41A 1PRTD 1TKWB 2Q2IA 5C4JB 4DV7Q 4QQBX 2X4JA 3CCLT 3KOJA 4DEXA 1X9NA 2CUDA 1RABB 2QKIC 1NEBA 4R56A 1O7LA 2K14A 1HFNA 1NJIU 1Q12A 1BI3A 2PI2E 4J7FA 3H91A 3PO2G 1N6AA 3JC66 1G83A 2R7DA 1HTLD 1PFSA 4XYOA 1ZLMA 2B8AA 3EBEA 1UGVA 5JEAJ 2R93H 5K36G 2HL3A 4LUZA 2L3PA 2ZTDA 1GJXA 3M7GA 4KMUC 5LHY1 4HVWA 1M4VA 1MGSA 2DJGC 4BI4A 4WJ3M 2BE9B 1VQ9T 3Q6SA 2L3RA 5F2DA 1VDZA 3U58A 3LGLA 3HFNA 4EMKB 5HGTA 2QASA 2KXDA 2ZGWA 1KAAA 3HOWB 1Z9FA 3EFOA 2K2MA 3PCOB 4UPAA 2CREA 3A74A 4OONA 4B3TQ 1VMCA 1R8OB 2RI5A 2QILA 4R55A 4M7AF 4C3HB 2VL6A 1MGQA 3JV3A 1WYDA 5CQYA 3J81i 1K28A 4LF6L 3I4MH 1F9QA 2GGRA 2VASA 4ZTJA 1Q90A 1SNDA 3VS6A 1U0LA 3FPUB 3VR3A 2RQTA 3T53B 4M7AE 2K3YA 4AH6A 4JI0Q 1IBLQ 1Z47A 5HURA 3OS1A 1IHZA 2WB1B 2MIOA 3NQTA 4OXPA 1ZSGA 2FMCA 4J6YA 2SNMA 2EYXA 3T16A 1QCFA 2EYQA 5FOBB 2RM4A 3OTOQ 2XICA 4OGEA 1ZSZB 3E9FA 1MI2A 1Y1VH 1PNJA 2GVBA 4PLIA 4J1MA 3RLNA 1GVPA 1B34A 1Y0MA 2I5LX 3H6MA 4A3CH 5CORA 1AW7A 1JWMD 2IY5B 4DR4L 1Z9QA 3VYSA 1T9HA 5IGFA 2X4WA 2B86A 1QLYA 2CSIA 4M4ZA 4LD9K 2J6FA 3EFRA 3QPHA 2DXUA 4QF4A 4RMOA 1SNPA 4M78F 5KNCA 3VA5A 1II3A 2V1QA 3OYYA 3VYGA 3AMUA 5JPNC 1XYIA 2O88A 4X3SA 3I5SA 2ED1A 4M78E 4C5GA 4R4QA 5L37A 2NVXB 4DV3Q 1UJYA 5GMKi 3S3MA 2UUBL 1OZ2A 3UE0A 1TU0B 2H5XA 3BDCA 3NE5B 4CGYB 1RAHB 3OYKA 1PWTA 2OTLT 1I6HB 2GFAA 5KH6A 4DU9A 1STAA 4OIKA 1UEAB 2A68C 3M85A 2RF0A 3FPPA 1K8AC 1E6GA 1GUNA 1KTKA 2X4XA 3CQZB 2F2WA 2I0QA 1WTPA 1M27C 1EQRA 1XPRA 4BY6C 1ZBJA 4IKFA 3GO5A 4O5VA 4DBQA 3L42A 4Y7NB 4OMQA 3OB9A 4F88A 3EHQA 1I4RA 3NBIA 3I56T 3IQLA 4D8DA 2C9OA 1TH7A 1HH2P 3STBC 5C0MA 1M90R 4AYBE 2VQFQ 2GTJA 5D6XA 2JEBI 3I4OA 3J81c 3FP9A 2DIQA 2E2HB 5CK9A 1NLPC 1MMAA 2KVQG 1A62A 1E3PA 1Y1WB 1VUBA 1KQSA 2EVBA 4C3IH 3PMFA 5GAMj 1A3VA 2DRMA 4Z9CB 1FWZA 2E4HA 3CC4T 1AZPA 1I4K1 5FWCA 1OX9A 1JQYD 3OSVA 5CIUA 3S3OA 1YWOA 2LNVA 1Q82R 1AVZC 1FVIA 3CAMA 3T1YQ 1M8AA 1QVFA 4QY7A 2N55A 1LCKA 1YJ9A 3I7FA 2F0IA 1HZCA 3GTKB 3CPWA 2K52A 4JK1C 1HR0L 2GFUA 2VVKA 1VQPA 3AU7A 3NTIA 2B2UC 2VB6A 3EQLC 1WD1A 1EQQA 3PIOA 3VS7A 2NVYH 5IYDG 1LTLA 5I4DA 4GOPC 4R4OA 2R61A 2Q2TA 1AWWA 2LVMA 2IWHA 4P75A 1S4ZA 2XNAC 1OEBA 1Q82C 1PRLC 4I7AA 3IAYA 1TWFB 3QDFA 1BCPF 1IBMQ 4QIWB 4LF9Q 3Q22A 3JSCA 1RF2D 2JXMB 2RVLA 1X3EA 2K6DA 1FGUA 4PNOA 3LH0A 3MFGA 4LDWA 1XMOQ 4QVZA 1HJDA 1K0RA 3M4PA 2K3BA 3OMGA 4B9WA 2EY5A 4BS9A 3P20A 4IUUA 2EXZA 4YCVA 1L0WA 2BE5C 5FU6C 3A8KE 4UDUC 4J8OA 5IT9L 2LRQA 1UB4A 2I5HA 3IFTA 1OO9B 1PFNA 1BB9A 4HKEA 1YJ9T 4ZCKA 5JPMC 3G4SA 1IXDA 1CFMA 2JQOA 1QKWA 1CKOA 1MNEA 3K8AA 1I50B 1QP2A 3GLXA 4IPGA 1S5DD 3WOFA 3S2DB 3K57A 3WDNA 1EWCA 1YIJT 3HOUG 3L2QA 1X69A 3QBYA 1LV9A 1JXOA 1VQ4A 3RLOA 4DAYB 1IRXA 4WJ4A 3CCUQ 3JCMQ 2PZUA 4N0AA 3CD6Q 4ZGDB 5J3BA 1CSKA 1UEBA 1D5XC 3EG9B 2RBMA 4C92F 4LUVA 4IOAA 4NL3A 5G3LF 1OXVA 3U4ZA 4YTLA 4KLKA 4K0KL 5IP9G 3LNNA 3RUZA 3T51B 3BFMA 2RJEA 4C92E 2F4VQ 4JV5Q 1K9MC 1S5ED 3TN2A 4IPHA 3J7YW 2DA9A 4J6HA 1I8FA 2DYIA 1QUQA 4GN5A 3UATA 3CCMQ 1NZ9A 4A4KA 5LMNL 3EH2A 3SGIA 1SYCA 3KLWA 3URYA 4JI6L 3S14H 1TUGB 3K0YA 1G6ZA 1K8AU 1YITQ 4K2KA 1PD1A 3D0FA 1YFNA 2F3IA 4DV7L 2X3XD 2ICEC 5ECAA 3BZCA 4FT4A 3URGA 4TVAB 3MJXA 2XG8D 1PTOD 2PNRC 1SHFA 5GAOn 2QA4Q 1X55A 4JYAQ 3E6ZX 5GAOm 4F17A 3OYJA 4A3IH 4E6IA 4AFUC 2K4KA 2LX7A 1VIFA 1Q86R 1R0BG 1BI2A 2KRMA 3MVVA 4RG1A 1E22A 5C4HA 1NE3A 4GLAC 1SNQA 4R4CA 2SNSA 4TRDA 4ZKBB 4N9TA 4UC4A 1EU4A 1J3TA 2O9SA 1PZJD 2R3ZA 4DA2A 2F0FA 3U9SA 1EEID 2JE6I 1X27A 3RNJA 1V1OA 4C2MH 3JCMg 2F0GA 1PD0A 2YLCA 3F2UA 2OTJA 3PTAA 1TTHB 3I55A 3MFYA 1TWBA 1Q86C 1V76A 4B3TL 3HOUB 3X25B 1EZ8A 4KN7C 3QWYA 2BKDN 3MKDA 2DN8A 1YI2Q 4ZNXA 4E7KA 1HZ9A 1U1SA 2HQHA 4KY7A 4YWLA 1TUDA 3GBQA 1YJNT 1B9NA 5GANj 4K8JA 3WVDB 1KQSP 2MFIA 1IGUA 3LH5A 2BTTA 1SYDA 4JI1Q 3OYNA 3SK8A 1IBLL 5GAOp 2B3GA 2YTYA 2FINB 2DMOA 1LTSD 3F8TA 4KTAA 3PF4A 2FHTA 1W2BA 1QQJA 3FKIH 1NTGA 3S1MB 2KA7A 4H13C 8AT1B 3PIP3 1G3WA 3OTOL 3JCMd 4JOIA 1TS4A 2NN6I 4JJNK 2Y0SE 3WOEA 4GNXA 3A8LB 2CP0A 2O31A 3BYYB 4LD6A 2A1AA 3CPWP 2EYYA 3KUPA 3CCSQ 2QW7A 5J1ZA 3N52A 4KJOA 3EROA 2GN5A 1MD2D 4OMPA 3VS2A 1JQQA 2VC8A 4KKSA 1PLFA 4QMGA 1JR0D 1JE4A 2DJFC 4JI5Q 4XYQA 4XQJA 3HOVG 4A4FA 1M2OA 2L4NA 3V7RA 3K7AB 3S17B 1T5EA 2AQ1B 1R4QB 2P5ZX 5I9OA 1XOVA 2JA7G 2OAWA 3G71T 1BIAA 1U1TA 1TVXA 2RDGA 2RK2A 4DV3L 2E1HA 4PJOF 2C0TA 2LXKA 3C1EA 2PVDB 3KYHC 3T56B 3W2DA 1YN8A 2HSEB 4F04B 2J6KA 3EGXA 4PJOE 1GHJA 2F03A 2DLPA 2ICIA 1SE4A 4KGZB 1PRTC 2F0TA 3HSBA 3FHWA 4IPDA 3TSWA 4I7ZC 3S1RB 1X3QA 3T4AC 4E7SA 2KECA 1VQOA 1GBRA 1R4PB 5CBEE 2KBNA 2SEBD 4TSSA 1HRJA 1CKMA 3F1ZA 1K9MU 3TU4K 2QQAA 3TREA 4XTZA 1RUWA 1PH1A 3UE1A 3V7CA 4FYWB 1FJGQ 4F7UB 3FEWX 2VQFL 1SEBD 4MZPA 3FB9A 1AWOA 3PUWA 3OY9A 2F0MA 4A4IA 4J9HA 4KGVB 1SRMA 1Z9ZA 3C94A 3CMEQ 5FRNA 1VQNT 4M7DF 3NSWA 1B50A 4OMLA 5L23A 5IYCH 2E2JB 3UA7A 5JJLA 3D8GA 1KQSS 4MHEA 1B8AA 5C44H 2VXWA 1GHKA 4M7DE 1JOOA 2L11A 4QQGA 1P92A 2O2LD 4H44C 4XQQA 4DBHA 2EYZA 3GTOB 1WTWA 2AUJD 1WQWA 5M3FH 4GKJL 1AE3A 2D0PA 5A0LA 1T5XD 3FIFA 3OIQA 4POFA 4HJAA 5GAOl 3PFSA 2NUZA 3QIIA 2UXBQ 1WGSA 1FX7A 3CPWS 4HMIA 2MYSA 3DUZA 3CMAA 2A5HA 2DL4A 1YZ6A 3NWTA 3JB9G 3I3CA 1VQOT 4A93B 3E9GA 4DR5Q 4MZTA 4K5XA 1AEYA 3KJPA 1ZBXA 2VGNA 1RAIB 4A4EA 1EX4A 3AFQA 1S5CD 3TCJA 4EMGA 4K2LA 4APVA 3EFXD 4IZ8A 1RHPA 4DV1Q 5C3XA 5CAIA 4ZAIA 1HSQA 2N8NA 5T1IA 5KGUA 4LDUA 1IBML 3JAML 4LF9L 2JA7B 3Q24A 1K83H 4KN4C 3OIPA 3OYAA 2HUGA 3K59A 1K3BC 1SMXA 3G7LA 1IYJB 5KYLA 3GOXA 5GROA 1V8QA 1TWAB 2R7ZH 1XMOL 1PH9A 3A55A 2WSEE 5HGQA 2LNHB 3ULJA 3BZKA 2AHOB 2XN9C 3RKWA 2E8GA 2IHFA 4ELYC 5BN4A 4DV4Q 3Q0AA 4M75F 4AFQC 2AT1B 2C06A 1RKNA 2JA8B 1D1IA 4CC3A 3KXTA 2F1MA 4M75E 3MEAA 1Y71A 5FLXE 3CMAT 1K8MA 1SFOH 1E7ZA 1VQKQ 2XWJB 2ENMA 5CR2A 1QE6A 1PH3A 1PSFA 1LJOA 1N34Q 4YWKA 3MHXA 1K0SA 3GTMB 5ELCA 2UXDQ 1YNND 4GKKQ 5M3MH 2H3JA 4AT1B 1AEXA 3HOXH 4P73A 3NPPA 2UUAQ 3EAEA 4C0ZA 2IX0A 1NYGA 1W2BP 2X6LA 1TQOA 1UUPA 2Y4YA 1BCPD 1X3GA 2YDLA 4EMHA 2F4VL 1HJPA 4JV5L 1ZEQX 2F0LA 1HD3A 2B2YA 3I91A 1V1CA 4DK0A 3NK9A 3KF8B 4FSXA 4FYYB 3CCRA 5C4XG 2QGFB 3HP9A 1MNDA 3CCVQ 1S72A 2A69C 1NBEB 3OQ5A 4E7IA 4ANJA 2Y4XA 2DF6A 3G6EQ 4IUNA 4BY7H 1O78A 3M58A 1QCNA 1PG5B 4WF2A 5FW9A 4OX9Q 3TS2A 1EZZB 2CQAA 1JICA 3SR1A 1M3AA 4RKLA 1KDBA 4R9WA 1HXYD 1BR9A 4B3SQ 3NENA 1N32Q 2KCTA 2MWPA 1M5Q1 3A7AB 3PIO3 1NR2A 1Q7YR 1UGSB 1E7OA 4JYAL 4MTKA 1TS2A 3J7AV 4M77A 2L89A 4FF2A 2EQKA 1JBMA 2RPNA 5L8RE 4LDXA 3JB9I 4KUDK 1BCPB 2KBTA 3DWPA 3GTQB 1KC8R 1NUCA 2IHEA 5GAN4 2CKZB 1G3SA 2KEAA 1LABA 2D9UA 3RD4A 1LTBD 4HT8A 2PCFB 3HGBA 4RFBA 3QDRB 4RG2A 4C92D 3CCET 2ES2A 2JA6H 5G3LD 4FYXB 3BY7A 5IH2A 1RL2A 4PV1C 2R92B 2DETA 3VYRA 2JOYA 1LOJA 1K73R 1S72T 4IQZA 1TY2A 4HIOA 4LUEA 1IO6A 1EY9A 1YNJD 2NTTA 4DAVA 1VQ5Q 2K33A 2CH4W 3TZUA 1MV0B 3OYLA 1YBYA 4O42A 2V8JA 4BY6B 4A3LH 2K5IA 4JI1L 3CRKC 2VYTA 4WFN3 4E47A 1KIKA 4PJLA 3MEUA 3OYHA 5IGDA 2EYMA 1BVSA 3PO3G 4LF4Q 2CGHA 3K58A 4Y52H 3RBBB 3M0SA 1S5BD 1W1FA 1W2BS 1I4PA 1MHNA 2P0QA 2ZZDA 2OJ2A 2L15A 1WXTA 4C92B 2PVGB 1K73C 1M1KR 1F2LA 2F0EA 4K5WA 3SWNA 4R4TA 5A2QL 5JVG3 2E6ZA 1SXTA 5GAN5 1VQ6Q 1JCKB 1F2MA 3AYHB 4C0DC 4RWSC 5DM73 4JI7Q 5IN1A 3TP6A 3NBHB 3TRZA 4IFDH 2Z0WA 4DR2Q 3C95A 2MF2A 1WIEA 5EJWA 3D3RA 4B6MA 1UDLA 1QVPA 1KD1C 4OB3B 4JI5L 1LTTD 2K50A 2CWPA 3C4SA 1YJWT 2MPMA 2YRCA 2XDPA 3MXNB 4TKOB 4V0BA 2N88A 1D1KA 1MSGA 1B3QA 4QVDA 3CW2C 2PW5A 2EW3A 4J6XA 5I22A 3K80C 3QZ9B 2ZTCA 2CCZA 2V26A 2BE5D 3DM1A 4HCEA 4DEYA 5FK9C 1SEMA 4FF4A 4FXDA 3PE0A 8ATCB 3M4OH 2F0KA 4C5EA 1TY0A 4GOPB 5KNDA 1LTGD 1A15A 2IX3A 4IUVA 1OPLA 1TWHB 3KUFA 1YVCA 3MEHA 3HOZG 1SRUA 1HZAA 3HOYH 2CUBA 2HKNA 1UECA 5CV6A 3L2WA 4HEDA 1F1BB 4IFDJ 1Q8IA 4CC7A 1IXRA 5H1SE 4HCSA 4EVOA 4K14A 5D14A 1UHFA 3JCMh 2K5VA 3J81j 2EE1A 4JI2Q 1PTOC 2I46A 1E0BA 1L0XB 5HCKA 1WHLA 2Z0SA 2RJFA 1EOVA 2EJFC 1FJGL 4V190 3S2HB 5TSSA 4GZYC 1LT4D 3DB3A 1KAWA 5FU6B 1YWPA 4NXMQ 1RIPA 3OW7A 1QZGA 1GCPA 5GAMg 1L2FA 1WOCA 3CRLC 4DR7Q 1QWEA 5KYIA 2QF7A 3JCMe 2GF7A 2RDFA 1TOVA 2BE7D 1IKLA 1WZOA 4UY8C 2YU9B 1Q3LA 1WI5A 4KV6A 3RNUA 4PZ8A 1HHVA 5CKBA 3HKZE 4RMFA 2KK4A 2JS0A 2QGGA 3HFZB 1KQ1A 5DEHA 4FU6A 2VUMB 4PK4A 2FZKB 4FL6A 5KYWA 3JCMX 2ATWA 5C4XB 1U8RA 2UXBL 4BY1G 1BXTA 3V7SA 2RHUA 4BBRG 4PJOD 4X62L 1LT5D 6AT1B 1D8LA 2XHCA 2DAQA 2OQ0A 3S16B 1SE3A 1J5EQ 4C3HH 3OYEA 2VWFA 4DV5Q 2L9HA 2D6FA 1SMYD 5GAMd 1BOSA 4DR5L 2OX7A 2M51A 5GMKj 2FRWA 1G3YA 1QOHA 1EL0A 1C6VX 4MDXA 4C3JG 4R8IA 4DV1L 4ALPA 1H3HA 1C9OA 1BI0A 2E2DC 2HCIA 3K6OA 7AT1B 3ND8A 4J9EA 2V8KA 3C12A 1JO8A 1HNZQ 1JRIA 4CBVA 5LJ5g 1I4XA 4XQNA 2ZAEA 3LWHA 4EMKA 3OOCA 2LJ1A 4JLGA 2PTKA 2DBKA 4M7DD 2N3SA 1F77A 1ILPA 2AUKA 2E5LQ 4A3BH 2VXFA 4HIKA 2HZYA 3SEMA 4LFCQ 3NFCA 3RDVA 5IGBA 4A3DH 4OB1B 1B53A 5CO7A 2EQSA 4DV4L 3M0PA 2PO4A 2F0VA 1HZBA 3KK7A 2O5IC 4HCKA 1W3SA 2ZXOA 3CP0A 1VQGA 1SLJA 1LTRD 5KRUA 2UU9Q 1KDCA 2LX9A 3R2TA 1SE2A 2K7AA 5GMKm 3PO2H 2EAYA 1FNWA 4XU3A 2K79A 4HCBA 2D5DA 2QEJC 2QEXA 3LGJA 2NVXH 3M0QA 3CCLA 2ZTEA 4M7AC 3BVGA 1N34L 3HOWG 2ZPBB 1KD1U 2UXDL 5K36H 5LJ5d 1KLGD 5IGEA 4ORZA 5GJVB 4QKUA 5KYUB 4GKKL 2EOTA 1B1ZA 3K5NA 1I6HH 1ZSZA 3EG3A 3TQYA 1ABOA 2V8IA 1C48A 1KK7A 3W1GA 4A3MB 2UUAL 3S1NB 3CCJQ 3CQZH 1D0YA 3UDCA 1BIBA 2HDAA 4E6RA 4A3KH 1CM9A 1G3TA 1PYWD 2PNIA 3EIVA 3NTHA 5D6YA 4BY1B 4BBRB 3RR6A 2XWBB 4RCCA 2B2TC 1NPPA 1KFZA 4LW1A 3DKMA 1JB3A 4HT9A 5JEAH 3M0UA 3K0XA 2DJZA 4LF7Q 4WJWA 3SEBA 3D7SB 3JCMW 2LCSA 2V4DA 4OX9L 1Y1WH 2IIMA 5IP7G 4A3JG 2HDMA 1ZUYA 2ENBA 3HHTB 2JM8A 3DEOA 1WTXA 4M75D 1VQFA 4B3SL 2LP5A 1N32L 1A0NB 4M78C 1CZGA 2KCCA 3F2BA 1TWCB 2NVQH 1F9PA 2X6GA 2O4XB 4MZMA 2I0NA 3ZBDA 2RI3A 1ZA1B 2QEXT 1O80A 1LLRD 1KSWA 3CD6A 2F3WA 5GAGC 1F9RA 4L5SA 1EY0A 1M2VB 1ET9A 2F0JA 3H0FA 2E10A 3R93A 2KMTA 2BCOA 4Y28E 3VRZA 3AQQA 3L0OA 1XQHA 3SVMA 3H6ZA 1MIUA 3M56A 5LJ3f 5FLXc 2CW0C 2CZ1B 1I3QH 2HCCA 2CSQA 2KXCA 1PH2A 1ESFA 4BD3A 1OPKA 3GIBA 5IYBG 4M75B 2A7YA 1EYAA 2RQWA 5GANf 2VB3X 4PMCA 4HJ5A 2EYPA 4YWMA 1TWFH 4ELZC 2A19A 1JOQA 1PRTB 1X01A 1WXUA 2MP1A 1L1OC 2UUCQ 3CCQQ 2F0QA 5BN5A 2K5LA 2QTXA 3GTPB 2YT6A 4C1NI 1KLUD 1YNXA 2KGTA 4FT2A 2EYOA 4JVZA 4YY3Q 1TU2B 3OMCA 2YWWA 2F4IA 2EJ9A 3LW5E 2A0FB 2J05A 2D8JA 3CCUT 4WORA 2RNAA 1MHWC 4LF4L 3P8HA 1SN8A 3AEVA 4B3MQ 3MP8A 1VQMQ 3CD6T 4X6AH 4GY5A 3TSZA 2BA0A 1U06A 4DOWA 4B9XA 2JT4A 2B39A 4YCWA 3H3VC 2RSOA 2OTLA 1IYVA 2LS01 4JI7L 2RHIA 2RH2A 3MC0B 4FXGC 5GAN3 2ATCB 1GCQC 1MV3A 2EKHA 1I50H 4LMQD 4DR2L 3S2DH 5HY6A 3I4NG 3F2DA 2GNCA 1A63A 3OHXC 1JMCA 1YNNC 1P8LA 3TZDA 4A3JB 1NPRA 1D2BA 1NE8A 4Z88A 3I56A 3MAQA 3REBB 1ENCA 5FO9B 1YITT 1IHWA 1YHQQ 2WKDA 4X3KA 1XMQQ 3NMZC 4A3GB 1WX6A 2W10A 3AT1B 5CV4A 5I2XA 2LXJA 4ODGA 3TEHB 1A8VA 1GL5A 1BCPC 2YSQA 2PZTA 4NS5A 2KRSA 4Y91A 5GMKl 2KUMA 1Y96B 3FDTA 2QA4T 4GLKA 3DMUA 3QR8A 5EGTA 1KABA 4CJ2C 4P74A 1C7YA 3CC4A 2MMPA 3JCMc 1ICFB 2P0PA 2D62A 1VA7A 2H1EA 4Z02A 4ZKCB 4BBSH 3GTGB 3HL8A 2H4OA 2AQ2B 3QO2A 3A8GB 4R4IA 5C5LA 4C8QC 1SPKA 3M9QA 3N6RA 2DM1A 4ID6A 2PNHA 1V29B 4DAYA 4DR1Q 4JI2L 1IL2A 3CC2Q 1ZA2B 1HNXQ 5FO8B 1C0MA 4LK1C 1UE1A 4L6V5 1QNUA 1D09B 2F0SA 2RHZA 1LTID 1TWGB 3A54A 3THKA 3RZOB 3UA6A 4NXML 2DTIA 4KHPQ 1X2QA 3EG9A 3V8KA 2DNEA 5ELNA 4DR7L 1M4ZA 1G91A 1ENFA 4IALA 3FRNA 2DD4A 1PXUA 2WFWA 1E24A 3V8JA 1YEZA 2NWMA 4DK3C 2A69D 2RJDA 2LKVA 1DJRD 4OHJA 3G1JA 4H7BA 4ZUJA 2GBQA 1F2YA 3U50C 4C92C 3MXUA 5CV8A 3QKJA 2B8FA 1PC0A 3HEJA 1KHCA 5M5WH 3EH1A 4EGVA 2K2VA 2YUOA 2K05A 5FJ8G 1W70A 1A2TA 2KCMA 3MP6A 3MEWA 2ZPFB 1ZUUA 3CBOA 4PQXA 4LF8Q 1YNJC 1X3FA 1E6HA 5CV7A 5IXFA 2HD3A 1P16A 1RACB 4ME7A 5ELOA 3HOUH 3S15H 3I4NB 4YIJA 2NN6H 4BE2A 1J5EL 2KENA 2DX1A 4DV5L 1M90C 2NVTB 1Q1BA 5E4XA 2EQMA 3CCST 1STNA 4X3UA 3J7A5 4KT0E 3EG1A 1ZQ1A 3DWAA 5C0XJ 2AIRB 2NYZD 1BO0A 2FHDA 4HMJA 1N33Q 2JM9A 3SXHA 2DKGA 2ED0A 4LFBQ 1A6XA 1YIJA 1Y1VG 2OI3A 4DXFA 3S1MH 1PA6A 3CBPA 5M5XH 3UPUA 3SB2A 5IP9H 5GAN6 4OGQC 2NLUA 5JVH3 1HNZL 2PVOB 2K9GA 1VQAA 3C1FA 3ZJYC 4F87A 1KJWA 1RAEB 3RKYA 3H0GB 1JU5C 2ROTA 1QWFA 1D1AA 4II1A 3K5OA 2EGAA 5LL6X 1IW7D 2E5LL 5FO7B 5CKEA 4LFCL 4Q5VA 1STHA 4OB2B 3J80E 3X26B 3I5RA 1WTOA 5C0XG 1UHCA 2AWOA 4DV2Q 4XTXA 3KLSX 1Y7XA 2YV5A 1MJCA 2KNBB 3PMIA 2K4YA 1K3RA 4KULA 1YHBA 2UU9L 4C8QF 1JJCB 1NBWA 2CZ7B 3VS0A 3VRYA 2G9DA 4A76A 4DUZQ 3EFSA 2DTHA 2DEQA 1CA5A 1WHJA 5GAN7 4C8QE 1RLQC 2L55A 5GAMh 3VV0A 4ILWA 3F2CA 4C0GA 1N9RA 1GUGA 1IHVA 3CMET 4XU0A 1JJGA 1GKHA 5KIXA 1SG5A 1KNEA 2AWNA 3S1RH 5I2SA 3S3NA 1NCVA 4S3SA 2M1HA 2RSNA 5GAMe 4L5RC 3C2PA 1BBWA 3I4MB 1U4MA 3D4RA 2CZ6B 2OQKA 1VQ9Q 2VB2X 3AFPA 1YP5A 2ZM6Q 1RI9A 4C3IG 3NWSA 4LF7L 1DGSA 2PI2A 3TP8A 2KHIA 2K5FA 3I2ZA 3RESA 3U23A 1X65A 2NUCA 1OX8A 4J9GA 2VQEQ 1W4SA 1DZ1A 4MIUA 4C0DB 2DO3A 4AFSC 1Y1VB 5IHNA 1H92A 2XVSA 1YJNA 1TS5A 2XIDA 2DL8A 2HNIA 4DKAC 5LJ5h 4PJOC 5JOBA 2MUYA 2E74C 1VQ8A 5DM63 1ET6A 1EIHA 4ZYSA 1PKSA 1GD7A 2NUPB 1SMYC 3UDGA 4F7UA 3VUZA 3DXJC 2JA9A 2KHSA 1LT6D 5CMDA 3HOVH 4H02A 1AWJA 1DJ7B 2XRSD 4JI3Q 5LJ5e 2FFKB 2HCKA 4BE0A 2B63G 2A28A 2D9TA 1X3PA 3PUXA 5LMUQ 1CKAA 4LN2A 3R6NA 3SHWA 3RZDH 3A1PA 2UUCL 4N4HA 3REAB 1B44D 1E2VA 3OA6A 3I72A 1B4OA 4J9FA 1M90U 4CJ0B 4RTXA 1QW1A 4M7DC 4YY3L 5C0XI 1PTOB 4MNOA 1TWAH 2QYZA 1D3BB 2RQRA 4OF1A 2ZPEB 4F7UG 5LJ3j 3G6JB 2CP3A 4DV0Q 2B2WA 3GV3A 3EN2A 5CKHA 1YCSB 4QQDA 3G71A 2A08A 1TT2A 1MMNA 4B3ML 2HQLA 2CQOA 1X75C 1K8GA 5EBCA 4M7AG 3IKJA 1C0AA 2DK3A 1SJHD 4XTWA 4LUDA 1F9SA 2X9HA 2D0OA 4FXKC 3PQIA 5IGCA 1Q82U 1VQ8T 1GFDA 1ZXTA 4RGTA 4M77F 2E70A 2RK1A 4FP5D 4C3IB 2PW7A 1WFQA 2CYZB 1NMGA 1U4LA 2E65A 3MXGA 5EQ0A 2QQBA 3CCVT 2DE0X 4M77E 3RMQA 4QUFA 3G6ET 2DY7A 2E5QA 2HDLA 4ME3A 1J8IA 3LYIA 4JJCA 4YCUA 3OYDA 1HA5A 1WHGA 1XMQL 4N8FA 3OYGA 1DM0B 2AZSA 4KUIA 4LDYA 1CHQD 1VQNA 4A93G 1PM3A 2M00A 4K6LA 3X28B 2HIXA 1PH7A 4KKTA 3CU7A 1PH5A 1V1PB 3I35A 2JXBA 4E7ZA 1ZX6A 1HTPA 4GN4B 3OYMA 2ZT9C 5CV9A 1DOLA 4DXGA 1G8ZD 1Q81R 2QAZA 4M78G 1VIEA 3OW2A 2HT1A 5DY9A 3D31A 3JB9H 2PYKA 2XGTA 2DY8A 4CKEA 2YTVA 4QB4A 4M7AD 4EQNA 5CBAE 3IL8A 1CQVA 2K6AA 4M75C 4DR1L 1HQMC 4NP5A 4TQUS 5DNFA 1HNXL 2FEIA 2X3WD 3VKIA 1WTQA 2B63B 1WTHA 4A3FG 1FD7D 2ASBA 3BVMA 3M3YH 3AHUA 2WAQE 4KHPL 2R7FA 1X43A 2JA8G 2Z6KC 1H3ZA 4R8NA 2RN8A 1Q81C 4G7HC 1VQ5T 1ILQA 4X64Q 4OO1G 4AYBG 2DERA 4XTYA 4OMFB 1G51A 4RGOS 3ME9A 3KF8A 4KH0B 4MMKA 4ME5A 1FXXA 4G7ZC 1WYXA 1TS3A 1STBA 4M7AB 2WKCA 2Q2HA 2E76C 1PSEA 5A0GA 3JB9J 2KQ3A 3HTRA 4OWWB 3M54A 2CP6A 4E7HA 2IVWA 2QI2A 2IW3A 5FLXL 4LF8L 1VF5C 1N8RR 4M78D 2PPBC 2IX1A 3CF5A 5I9PA 1RTNA 3OYIA 3T9NA 1VQ6T 1WJJA 3PVQA 4J83A 1FMWA 1I4GA 3NGPA 2LMJA 2R5AA 2PQAB 4QT7A 3OYBA 5D3IB 1VQPQ 2Q8RE 2Z6BA 1R0CB 1N33L 2BH2A 2ZXPA 4LFBL 3QJ6A 4JZ3A 1EQTA 3QWNA 2MAMA 5IWAQ 2CW0D 4KKUA 2K01A 1K1ZA 1JB0E 3S6WA 5CKDA 1D5ZC 4RH6A 5ELEA 1NNXA 1LACA 1N8RC 2K03A 2TSSA 3RLFA 2RO0A 1XJWB 4LNPA 3J80i 3FEOA 3FRPB 4A3EH 4RA8A 4J5YA 3GF5A 4OVAA 1PV4A 4JBMA 5DLQE 1O75A 1M30A 4JDSA 3EGUA 4M78B 1Q86U 2FXQA 4CC4B 5IAYA 2ZJQA 3GTLH 5D6WA 3KLRA 2F0WA 3S9WA 2HKQB 2RB6A 1ENAA 2B2VC 4DV2L 2FL7A 2EPBA 4X9DA 4MDWA 2AKLA 2J6OA 2L0AA 4QQ6A 4BWGB 2P4TA 4A3FB 2XMFA 1Y69U 1DXMA 1H641 1EFID 1QG7A 2CHBD 1MJEA 3FLGA 3LWUA 1T3LA 4DUZL 2CS7A 5D7UA 4G7OC 4GLVB 3FVQA 1X6GA 5GAN8 5EBDA 3G4SQ 1LO5D 2R93G 1PDQA 2R92G 3V8LA 3NPFA 4AYBB 5IHKA 5EG2A 4C92A 3PUYA 4C2MB 2E64A 4CRIA 3NHHA 4CDCC 1OU8A 1Y8PB 1C1AA 1IZ6A 4UHVA 2CP2A 2CKKA 2O01E 4VUBA 1VQ4Q 1L1OB 3NBHA 4ATOA 3P7JA 2RJCA 1IREB 4JRQA 3HRTA 1KNAA 1TUCA 4CHTB 2GVAA 4PNYA 3OYCA 5M5YH 1XTCD 1MSHA 1KL9A 2FO0A 2HHHQ 1QNKA 2DXBA 3MXNA 2E41A 2I5MX 3E5SA 3BDLA 2ZM6L 2VKNA 3HRUA 3CCEA 4FF1A 2IG0A 3BE3A 4C92G 2BOSA 4J7IA 1LTAD 2B2UA 3P8BB 4M1UB 2H8HA 2VQEL 2MO1A 2KQWA 3PSIA 1N9SA 4GOPA 1K0XA 1STYA 3PO3H 4RCNA 2ZJPA 1M8MA 2K3XA 4AQYQ 4JG2A 3O13A 3W1BA 3BYTB 1EYGA 1FNVA 1HUMA 1QJOA 4C8QD 1M3BA 1UGRB 3M4GA 2EJGC 3I70A 1Y8NB 3QXEB 3U9OA 2BDNA 1XNRQ 1UNSA 3TBIB 2MGSA 2QDLA 3ULLA 2I07B 2R58A 4HJ8A 1VQJA 3S16H 2MHVA 2BIVA 4RHRA 2OXPA 3OW2P 1O7YA 1OYXA 2WB1E 4RTTA 1D1BA 1UG1A 1EWIA 3CC7A 4N4IA 1ZYRD 4DR6Q 1Y57A 4JI3L 2N49A 4OGCA 2VV5A 2COWA 2HEQA 5JJIA 2RQUA 2JNGA 1DD2A 5CV5A 1EIFA 4O0AA 5LMUL 4IN3A 4KY5A 3E2UA 2RQXA 2LC4A 4C8QB 3IFDA 4DK6C 1Q7YC 1YJWA 2BZ8A 2DNUA 2OTJQ 3I55Q 1NEGA 1A2UA 3NUCA 4PZ6A 1SNMA 5C6AA 5GAHC 3S1QH 4FIBA 4GLXA 3HOZH 1IW7C 3Q8DA 4PJJA 4DNIA 1BNZA 1I5OB 4I65A 4PKCC 3G48A 4U68A 4DV0L 2LQ8A 1KC8C 1SSOA 2EY6A 2NYSA 3DM3A 4RCOA 3C3LA 3RN5A 3OWFA 2N78A 2GA4B 3L2ZA 1NAPA 4EQOA 2DILA 5KCHA 1KG1A 2EYHA 2VZAA 4FM4B 1SKUB 2BZYA 3CCJT 3SE0A 2VXEA 3JCMb 4JI0L 1UFFA 3VYTA 2CH4A 2FMMA 4D6WA 1FNUA 3ER0A 3NELA 4CC2A 1CK1A 1D5MC 1WJSA 2VUMG 2Y0SG 3IRBA 1CKNB 3ERSX 3QSUA 1KRTA 3CC7T 3JRZA 1RODA 4J8QA 4RTWA 1JWUD 5CQXA 5FRMA 3NHNA 3Q23A 1B2TA 1I6VC 3D6WA 2KOLA 4KI0A 1H9JA 3RMSA 4PJOA 1Q46A 1EYCA 5C5MA 1BUVT 1EIYB 1ICWA 4NOYA 2EZVA 3HKSA 1Y1WG 1OI1A 1M1KC 2QDBA 4IIMA 1YNZA 2EVRA 3H9NA 4J9IA 4Z89A 3QYGB 1VQMA 2ESWA 4HN7A 1VQDA 5COYA 1U4PA 3J7ZC 3M55A 4EPCA 3OW2S 3QOJA 3PVLA 2E2IH 3P75A 2CZ0B 3HFOA 4DUYQ 3ZFJA 1K83B 4QJFA 3HRSA 2H3EB 4PJOG 1MMGA 4F16A 4PMWA 4C3JH 2WSCE 2HAXA 5KYUA 2KT8A 5C4JH 2C0IA 4RAUC 2I2LA 1O9SA 4BDZA 4M7DA 1DOKA 1VQOQ 1JT8A 3UWNA 3VU3C 2NTSA 5GAOr 4PL6A 1PCXA 2PUOB 3J7AF 3CCQT 3MWYW 4X64L 1UUEA 4ESRA 1HYOA 3DLMA 1EY4A 4L5QA 4JBJA 5FLMG 1ACMB 2M9VA 1M8VA 4MTNA 1KIXA 1RAGB 2EKOA 4ZGJB 2K5DA 1NJIR 3NP8A 3NTKA 4M7DG 2X51A 5J26A 1VQMT 4G57A 4A3MG 3SFMA 4DNRB 2V1CC 4A3LG 5KYYB 3RUXA 2IPOB 2LSSA 2Z4HA 2YHTA 1OZ3A 5M3MB 3HOXB 1LVKA 2Y0SB 3HOWH 3V2TA 2A74C 2O4XA 5A0DA 1WHMA 3DLLA 1QCOA 2KY9A 3M7NA 1FYNA 1CTMA 1O7IA 3MZ5A 1M2VA 2FVUA 4PJMA 5KE3A 1MMDA 4FO2A 3QHSA 2BA1A 2E75C 3KBXA 2YXYA 5IWAL 5DM7R 1YHQT 2NB0A 3GTMH 3VJPA 3EVQA 1Q7YU 5KYNA 1I94Q 3PF5A 2X69A 4NB3A 1ARKA 2BZXA 1WNLA 4M75A 5E4WC 2JN0A 5C6SA 4DBRA 2PZWA 5IP7H 3E1SA 4N0AC 3OS2A 4A3JH 2LTOA 1GRIA 2YRDA 2A8VA 4PJOB 2JP1A 2COZA 2Y90A
chains in the Genus database with same CATH topology
2K5NA 3UDIA 4BA1I 1WJRA 2Z6KA 4J15A 3CC2T 4GS3A 2RI2A 3QUIA 1K73U 2LQKA 4C5IA 5EAYA 4NPSA 1WJQA 4M75G 4KHZA 2R57A 4BXXG 2DTOA 1YCYA 5CVIA 3KDFB 2JEAI 4B3RQ 4M7DB 5IYBH 4POGA 2HHHL 1M1KU 1KQ2A 1TWGH 3INZA 3RZOH 4HA8A 4Y7NH 2F52A 1N36Q 1WCMG 1Y96A 3RKXA 2QDYB 2E2HH 4AQYL 5IE8A 1N27A 2YYZA 1XNRL 3WXMB 1VQEA 1XNQQ 4A3GG 2BUDA 3CCUA 1SROA 4XAXB 1B7YB 3GNFB 2NVTH 3GTKH 4DR6L 3M9BA 4DR3Q 2KHJA 3SDZA 3CCMA 2QXFA 5LJ3g 4GNXC 4O6JA 5I2MA 1YITA 2EXDA 4A3DG 3VYHB 3KF6B 4JBKA 5GANg 1WPYA 3GP8A 3CBMA 1B70B 2QA4A 4A4HA 3QG1A 2AHJB 4HIMA 3CEYA 4QVCA 3L7ZC 1PHJA 5C3EG 5GAN2 5LJ3d 2RHXA 4X65Q 4A3KG 4F7UF 4GN3B 2EJGA 5GANd 4JRKA 5GAOq 3CCMT 1RI0A 4F7UE 5FJ8H 5JEAG 4ZN3A 1YI2A 4NL2A 3X20B 2VNUD 4IJLA 2F5TX 3CPFA 1Q1EA 2JA5G 3H0GG 4DUYL 5DLOA 1KRSA 4QW2A 1WQ7A 2ID0A 2LDMA 5IYDH 1X54A 3CCSA 2ALYB 4IOCA 4X66Q 1G291 3PUZA 2E6NA 3LLRA 1JJ2A 2HQXA 4AIMA 1FL0A 1HK9A 3MO8A 3META 2KDSA 1YI2T 1QVGA 5M9OA 3HKZG 1GXIE 1UGPB 2QQSA 3Q1JA 5J39A 1CSPA 3I4MG 3FC3A 4QL5A 1V43A 2ZCFB 2L8DA 4P5NA 3PGGA 3P8DA 2YTXA 2JJQA 1J6QA 2DD5A 5GADC 2K75A 1I94L 3M59A 3CMEA 3UT1A 2AMCB 2RD1A 3JCMP 4OWTB 4A3CG 3QO3A 4JLIA 3L2RA 4GKJQ 2YRVA 2DXCA 3T1YL 1OXUA 1UE6A 4DPGA 2RHYA 1GO3E 1D3BA 3JB9F 2EJFA 3E9HA 4BBSG 1VCIA 4O2DA 5HK3A 1PH8A 3K7AH 2DIGA 3OBWA 5HK0A 3S17H 1SSFA 4RCBA 4N4GA 3FDRA 2YLBA 4B3RL 1B34B 2QQ9A 4L5TA 2B63H 4ZN1A 1VQIA 3ICEA 4OB0B 3GPLA 4M77C 1AHJB 2QGQA 3PV0A 4LF5Q 5LJ5j 4PLLA 4IJHA 3S24A 4J6WA 2UXCQ 1N36L 3RIRA 4PZ7A 2M9UA 4JS5A 3U4VA 1G6PA 3PUVA 3CXCS 4UP8A 3MEVA 1XPUA 3TEEA 2GQVA 2E2JH 1VQPT 2RF4A 1VQKA 2NN6G 1XNQL 4CI0C 2AKWB 3GTOH 4JS4A 3H8ZA 3UDXA 2M16A 4BA2I 4JC0A 4HJ7A 4E7JA 4V2SA 1HXDA 1N9WA 4DR3L 1LM0A 3N5BB 4IO9A 3W5OA 4A93H 4C5HA 3CCVA 3F70A 2DZ9A 3SWNC 3G6EA 3NEMA 1BKBA 4M7AA 3M4QA 2EWNA 2JA7H 3G4ST 1VQBA 2LCLA 2B29A 4LNQA 1LYLA 4A4GA 1VQKT 2WP8J 2OAUA 3BU2A 4LDVA 1VQ4T 1ASYA 3HPWA 5IT9E 4A3FH 3M4YA 2PQAA 3A8MB 1VS0A 3A0JA 2JA8H 1CUKA 4ZGEB 3JCMf 3ZEHA 1PYBA 4NXNQ 4X65L 4XU1A 2EQUA 2DGYA 2PMZE 5FU7C 2MWOA 3VUBA 2LT4A 3A5UA 3QJYA 4M78A 1S3OA 1IBKQ 1V1QA 1VQ5A 2LCCA 1BI1A 2M0OA 5E7NA 3KJOA 3UDFA 4XTVA 5CCAA 4IUTA 4RKUE 3H3VH 3OS5A 1X6OA 3G7ZA 1D7QA 1VQ6A 3MCAB 5LJ3h 1XJVA 4A3IG 4X66L 1L1OA 2GCXA 3X24B 1E1OA 2OTJT 1JJ2S 3I55T 2HIVA 5GANh 4LFAQ 2A3LA 2JK8A 3GTQH 5LJ3e 1QUQB 1QVGS 3RN2A 3LWIA 2KAFA 2QQRA 4R1JA 5GANe 2BH8A 1ZHIA 1CSQA 2RCNA 2XD0A 4EMKC 2R92H 4JBWA 4JI4Q 2NZOA 2KSSA 3LGFA 3PGZA 3KFUA 2JTFA 3FKIG 1NMFA 1OTCA 2RHQB 3WVEB 1JE5A 3K81C 5I21A 4MZ9A 2CWAA 3LX7A 3FJPA 4HCCA 4C8QA 2MO0A 3SD4A 2XKOC 1OXTA 2JVVA 1QVFS 1TXYA 4X62Q 1UE5A 2VW9A 4ZTFA 2DZCA 3JCMV 4TVRA 2C35B 3A5ZB 2PU9B 4L5GA 4C8QG 1YHAA 1HNWQ 4GNXB 1SR3A 1TWHH 3H15A 1CKNA 1UE7A 3B6YA 4JRIA 1G5VA 1HR0W 4LF5L 1BYMA 4XTCS 4DOVA 4JI8Q 4X9CA 3T1HQ 5GAEC 4YHHQ 1AE2A 2JTMA 3M57A 2UXCL 3S2HH 1VQ7A 5IYCG 4RG8A 1MKHA 4OO1I 2PQWA 5AYFA 5C44G 3JB9D 5M3FG 4BI3A 2YU9H 3E19A 2OWOA 4DV6Q 2CFMA 3J80c 5BR8Q 5AJ3Q 2VUMH 1LUZA 3CCJA 5C4XH 1Q81U 1NY4A 4A53A 3H3VI 2RHSB 4P71A 3KBGA 4UP7A 2X4YA 4A3EG 1BBUA 4XIGS 4L59A 4PG3A 3JAME 1VQ7T 2XDDA 2ZPHB 2DVEA 5FROA 2R7ZG 1PH6A 2ZPGB 4HJ9A 4KBMB 4HCZA 5LL6S 2G3RA 1XPOA 2WSFE 2L5QA 2XK0A 4BB7A 4DA4A 1OXXK 3PT9A 4C0FA 5LMNW 4JUVA 1GM5A 3STBD 4X34A 1N8RU 4FDBA 3OBYA 4IUQA 4NXNL 3VDYA 1XTDA 2XDBA 2DXTA 3R6OA 1Y14B 2JUFA 5M3MG 4BE1A 5FLMH 4JCVE 3HOXG 1KXLA 4QGUA 3CCRT 1EUJA 4M77G 1IBKL 2K5HA 3CCQA 3S1NH 4A3MH 1KHIA 2X35A 3A8OB 2ZJRA 3WWVA 3O8VA 3E9IA 4P72A 2EQJA 4BY1H 4BY7G 2HBPA 2P0KA 4BBRH 5JJKA 2IT1A 3K7UC 2VGMA 4LF6Q 2XI9A 3MP1A 2JZ2A 4DQ2A 1Q8KA 3MEFA 1QVCA 4EDUA 3J81E 3L1AA 3L2UA 2NZHA 1U5KA 4IPCA 2LT1A 3KDFA 2R5MA 1TWCH 3ASKA 5IT9c 4BI8B 2WAQG 4M77D 4LFAL 2PUKB 1YHQA 2MI6A 2Q2UA 4DR4Q 4A54A 2OCEA 2JA6G 1Y07A 1M9SA 2HD0A 1JB7A 2K57A 3BW1A 4QIWE 1I5LA 2UUBQ 3RR5A 3BDUA 4JI4L 2VS1A 3CC2A 1VQLA 4BXXH 4M77B 1V9PA 3GTPH 3L2VA 2RA2A 2ZPIB 1E1TA 5GAMf 2EIFA 4XU2A 5HKCA 1PVOA 1QP3A 3OS0A 3PMTA 5A2QE 1NJIC 4EQ5A 4IFDG 1VQHA 4BDYA 1WCMH 2HQEA 2XU8A 2XTIA 5CKFA 1AH9A 1KC8U 4A75A 3GDEA 3KF6A 2DPPB 2FB7A 3M53A 4A3GH 1PYSB 1S40A 1M1GA 2EFIA 2MNAA 1VQLT 1HR0Q 4BUGA 1HNWL 3HOYG 3SWNB 4DAMA 3OYFA 5LJ5f 4LUOA 3GTGH 3TS0A 3BJUA 3GD7A 4OP0A 1OXSC 1I5FA 3RERA 4JI8L 3T1HL 1H95A 4YHHL 3QZ5B 3GNGA 4Q5WA 4BACA 1ASZA 2WACA 1LNXA 5GMKh 4JRPA 5GQOA 3QYHB 3L2PA 4EX5A 1A0IA 1I81A 3CXCA 3PNWC 2F69A 4DV6L 5C3EH 5FU7B 1UWVA 5GMKe 1X56A 5BR8L 5AJ3L 4IUPA 1EFWA 4E7LA 5IY0A 1SE8A 3PIPA 3M5AA 4LWCA 3JCMJ 3A8HB 3I4NH 2VUBA 1R9TH 3ULPA 5KCOA 1PH4A 3JAMi 3OSSC 2R6GA 4UP9A 4HIDA 2WB1G 2E12A 2D0QB 5KE2A 1VQ9A 4IFDI 2FYKA 4K0KQ 2VY3A 4XQ3A 2DUDA 1VQCA 1UGQB 4XTUA 3GTJH 3E0EA 1XNIA 1M1FA 2F5KA 5LMNQ 4JOIC 4IURA 4A3BG 4JI6Q 3DB4A 2JA5H 1QZHA 4OWXB 3H0GH 2MQHA 4MMLA 4XK8E 4DV7Q 2Q2IA 4QQBX 2X4JA 3CCLT 3KOJA 1X9NA 4R56A 2K14A 1NJIU 1Q12A 1BI3A 2PI2E 4J7FA 3PO2G 1N6AA 3JC66 2R7DA 1PFSA 2B8AA 3EBEA 5JEAJ 5K36G 4LUZA 2ZTDA 4BI4A 4WJ3M 1VQ9T 2L3RA 3U58A 3LGLA 3HFNA 4EMKB 2ZGWA 1Z9FA 3PCOB 4UPAA 3A74A 4OONA 4B3TQ 1R8OB 2RI5A 4R55A 4M7AF 2VL6A 1MGQA 1WYDA 5CQYA 3J81i 4LF6L 3I4MH 4ZTJA