1BKBA

Initiation factor 5a from archebacterium pyrobaculum aerophilum
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
136
structure length
136
Chain Sequence
KWVMSTKYVEAGELKEGSYVVIDGEPCRVVEIEKSKTGKHGSAKARIVAVGVFDGGKRTLSLPVDAQVEVPIIEKFTAQILSVSGDVIQLMDMRDYKTIEVPMKYVEEEAKGRLAPGAEVEVWQILDRYKIIRVKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSLATION INITIATION FACTOR 5A
publication title Structure of translation initiation factor 5A from Pyrobaculum aerophilum at 1.75 A resolution.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Translation
total genus 26
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 1998-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1bkbA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1bkbA02
3NEMA 2JQOA 1UEBA 2OTJA 4QIWE 3CMET 2KHIA 4JV5L 3CC7T 4LF7Q 1KRTA 5J3BA 3F2DA 3BZKA 1NBWA 1VQ8A 4DAMA 1NPPA 5C4XG 1Y1WH 1L1OB 1VQAA 4RMFA 3RLOA 1FGUA 1VQCA 4L5QA 3PCOB 5IT9c 3PSIA 5C3EH 2V1CC 1E7ZA 1NMFA 3I56A 4A3GG 4DR2Q 2EXDA 2KENA 3PUZA 3K8AA 2H5XA 1Q46A 1G291 3KYHC 4ME3A 3HOXH 4DV0L 4R4IA 2VZAA 1PV4A 1M1GA 1Q1EA 1G51A 5EAYA 4JOIC 3W1GA 4HIDA 4NXMQ 4GKJL 4JBKA 3M4QA 5M3FH 1C9OA 1S72T 1YHBA 4GN3B 1HZ9A 4LF7L 5DLQE 1KD1C 2GN5A 1BBUA 2JA6H 2KCMA 3CCUA 3RNUA 4QJFA 3KF6A 4YWKA 4A3CG 3PGZA 1A63A 1LM0A 3CD6A 1A8VA 4J15A 2E2IH 2UUBQ 1KQSA 5GROA 4DR2L 2JNGA 1SMXA 1X56A 4YHHQ 1Y1WG 3PF4A 2PI2E 3ULPA 3S2HH 4K0KQ 1NY4A 1Q86U 2Z6KA 3HFZB 3WWVA 4LUZA 1W2BA 1KHIA 2PMZE 5C3EG 4BA2I 4X64Q 2UXCQ 2F52A 3DB3A 2OCEA 1LTLA 4NXML 1WYDA 3J7A5 3HOXG 3CCLT 3KF6B 4B3RQ 1VCIA 1YITA 1V43A 1YNXA 3L0OA 1SN8A 4JYAQ 4DV2Q 3OW2A 3S1RH 1N9WA 3TREA 5IY0A 3J80c 1YHQA 5IWAQ 1CKOA 2JA7G 2JA6G 2XGTA 4A3FH 1A0IA 5GQOA 1EQQA 2UUBL 4BY7G 3CC4T 1I3QH 4C3HH 1KQSS 4YHHL 1VQDA 1QVFA 1U0LA 3I55T 4R4CA 3CXCS 2PNHA 1JB7A 4K0KL 4JBJA 2EQSA 5JEAJ 1E3PA 2UXCL 1W2BS 4X64L 2CWAA 4R4TA 4POFA 1EWIA 3M4OH 4PZ6A 5IP9H 4DAYB 1PH5A 1YBYA 1OXVA 3PO2H 2ZTCA 4B3RL 4DV4Q 1YJWA 1N34Q 2IY5B 2N3SA 2NVXH 2LVMA 4A3LG 4R4QA 1EOVA 4DV2L 3OW2S 1OXSC 2IT1A 1Z47A 2VL6A 4PMWA 3GTLH 4UP8A 3IRBA 1KAWA 5IWAL 1M1KC 4YTLA 1L2FA 5BR8Q 3OTOQ 4IPDA 1OXUA 4A3EH 1K3RA 3UDXA 3CPWS 4KHPQ 2EIFA 1OXTA 3F8TA 1S40A 3G71A 1YJNA 5A2QE 1HR0W 1QVFS 5LL6S 1Q1BA 1XNRQ 4LWCA 4A3FG 1I50H 4UY8C 2MI6A 4LF6Q 1LYLA 4DR7Q 4DR6Q 2ZJQA 3NENA 1MIUA 4JI1Q 3S1NH 1K8AC 5FJ8H 4PG3A 5C0XI 4X62Q 2FXQA 3GO5A 1Q8KA 4AQYQ 4B3SQ 4UPAA 1Q82U 5GAGC 4DV4L 1N34L 1HZCA 2R7DA 3LGFA 1D8LA 2IHFA 2QEXA 4BY1G 3TEHB 3PO2G 4IFDJ 1O7IA 4AYBE 1KC8C 2KBNA 1VQ6A 5BR8L 4GOPB 3PIPA 2CKZB 3OTOL 2E8GA 1WOCA 1JMCA 4KHPL 3J80i 1Q7YU 3HOWH 2K52A 2KVQG 1PFSA 3CPFA 2LSSA 4Y52H 1G6PA 1XNRL 4A3EG 1VQ9A 2XTIA 2ZTDA 3CCMA 3CP0A 3LGJA 5C44H 2HHHQ 5LMUQ 2Y0SG 4JI8Q 4LF6L 3FKIH 3I4MH 3HOZH 2BH2A 4JI1L 4C3JH 5C0XJ 1LUZA 1YEZA 2E2HH 3Q8DA 4DR6L 4X62L 4AQYL 2IX0A 4B3SL 1IBMQ 4GOPC 1SFOH 4ALPA 4X65Q 1B7YB 1K73C 5FJ8G 4LF9Q 2VUMH 1GM5A 2R7ZG 4A3KH 1IBLQ 1VQMA 4DUZQ 4IPGA 4RG1A 4LW1A 1BVSA 3H0GG 4HJ9A 4DK3C 3CCEA 2A1AA 2G3RA 5JJLA 1CKMA 1VQPT 1WI5A 4JOIA 5IYCG 2LXJA 5ELOA 1XMQQ 1HNZQ 3CMEA 3I2ZA 4L5TA 3G4ST 3CC7A 4X34A 3M85A 1UE1A 3S1MH 4GKKQ 2DGYA 3SGIA 4HJ8A 2HHHL 1XPUA 4L5RC 4JYAL 1PA6A 5LMUL 3DB4A 4KI0A 4P72A 3E9IA 4JI8L 3HOWG 1IBKQ 3I4NH 1P8LA 3A0JA 1AE2A 4A3IH 5C44G 2DUDA 2VQFQ 3A74A 1IBML 3HOZG 4X66Q 1NJIU 4KHZA 3FKIG 4YCVA 1VQ7A 1X3FA 4X65L 3I4MG 1KL9A 4LF9L 3TS2A 2UXDQ 2JUFA 1IBLL 2NVYH 2RF4A 3K7AH 4DUZL 1TWCH 3HKZG 3MXNB 3S24A 1V1QA 5LMNW 5JEAG 3CCJT 2D62A 1E24A 4QY7A 3KJPA 1FVIA 1HH2P 3L7ZC 2E2JH 2VUMG 3TRZA 2LQ8A 4A3KG 5K36G 2WB1G 3UDGA 2BA1A 4A3CH 4DUYQ 1XMQL 1S72A 1HNZL 2JA5H 2IG0A 4MZ9A 4JI6Q 1SSFA 2ID0A 4DR1Q 4GKKL 5M5XH 4LFCQ 3AEVA 3RZDH 1YJ9T 1WFQA 2R6GA 2YTYA 1IBKL 4HJ7A 2AWOA 3GTOH 4L5SA 2VQFL 1CKNB 4X66L 2UXDL 3F2BA 3KJOA 3RLNA 2JA7H 3I4NG 1ASZA 4IOAA 2OWOA 4A3IG 3PUYA 4DV7Q 4BY7H 1TWFH 3S2DH 1Q12A 1X9NA 3HOVH 2JJQA 1VQOA 5C4JH 2I0QA 1FJGQ 2OTJT 1GO3E 2K5VA 2JK8A 1PVOA 2ALYB 3CCLA 3JAMc 4DUYL 1C7YA 1IL2A 3J7ZC 4A3JH 4JI6L 4DR1L 1VQBA 1VQ8T 1NZ9A 4LFCL 2L3RA 1J5EQ 1M90U 4OONA 2JA5G 4IFDG 4A3LH 2N78A 3S1QH 1KIXA 3W5OA 1VQKA 3EBEA 1J6QA 3I56T 3S15H 3CMAT 3CF5A 2R93H 3CC4A 3ULJA 1SE8A 2AHOB 3W1BA 1Q86C 1U5KA 4DV7L 2HIVA 3CCRT 4GN4B 3CC2T 2CKKA 4C3IH 4JCVE 3STBD 2HIXA 2YTVA 1FJGL 3OYYA 5C0XG 3HOYH 1VQ5T 4A3BH 1VQGA 3S14H 4A76A 4PZ7A 1BKBA 1ASYA 3HOVG 3AQQA 4YWMA 3PO3G 3CCUT 4YWLA 1EIFA 3MEFA 1XJVA 5M5YH 2RHSB 2IX1A 2B3GA 3FP9A 2OTLT 3K0XA 3PV0A 4DR5Q 4A3JG 3LGLA 2AKWB 1PH8A 4DV6Q 2A19A 4BY1H 1HR0Q 3G6EA 2D0OA 1CSQA 3GTPH 2K14A 1HNXQ 3KFUA 4AIMA 1QZGA 2CFMA 4NB3A 1JJGA 4BA1I 4IFDI 5IAYA 2R93G 2AMCB 4OX9Q 3CCVT 5ELNA 5GADC 4JI0Q 4JBWA 4DV5Q 3ZJYC 1YIJT 3LH0A 1YITT 2Z0SA 4GOPA 4BBRH 2CQOA 4QL5A 4CRIA 1Q81U 2E5LQ 4GS3A 1YI2T 1QVCA 3HOYG 1YHQT 4GN5A 3JAMi 1MJCA 3F2CA 4A3BG 4HJ5A 4BXXH 4WJ3M 4DR5L 2R7ZH 4DV6L 1HR0L 3GTMH 4A75A 3H0GH 2R92H 3U58A 1IYJB 1N36Q 1HNXL 2RHQB 4HJAA 2XHCA 2K75A 2MO0A 1CUKA 1PH1A 1RIPA 5IYCH 1EUJA 2WFWA 4KLKA 3M4PA 4OX9L 3ICEA 4JI0L 4DV5L 1Q82C 1JJCB 4A93G 2QA4T 2WAQE 3KOJA 2E5LL 4JC0A 3M9BA 3EN2A 2CWPA 4GNXB 1S3OA 2VNUD 4JI7Q 4TQUS 4BBRG 2JE6I 3AFPA 1EFWA 2YYZA 2YTXA 1XNQQ 2B63H 3RZOH 1Q7YC 2MWPA 2NZOA 4BBSG 3U4ZA 1NTGA 2Q2IA 4JI3Q 4POGA 1BBWA 3G4SA 1SRUA 2VY3A 4BXXG 3DLLA 5IYDH 3GTQH 4JBMA 2BH8A 1VQLT 3BZCA 2R92G 4DV3Q 4C2MH 1PH4A 2GVAA 4A3MH 1MJEA 4GNXC 3D0FA 3TS0A 1MKHA 1H95A 4TVAB 3A5UA 4B3MQ 3CCST 3H3VI 4P73A 1X6OA 2OQKA 5IP7H 1UE5A 5LMNQ 1FL0A 1SLJA 4O0AA 1VQ6T 2C35B 4JI7L 2JA9A 3CCJA 5DM7R 2I5LX 3GTJH 1B8AA 3I7FA 1XNQL 4QQDA 3FHWA 2K4KA 5IYBH 4DK6C 3H15A 4JI3L 3PUVA 4YCWA 5GAHC 1HNWQ 4YCUA 4MTNA 4AYBG 2E70A 5AJ3Q 1XMOQ 2B63G 1CKNA 2NZHA 2NVQH 4B3TQ 3K7UC 1YJ9A 4JG2A 4DV3L 2NVTH 3J81E 3M3YH 4GLXA 1N33Q 4GKJQ 5IYDG 1VQ4T 4DR7L 1NJIC 4B3ML 2WAQG 4A3MG 5LMNL 1QVGA 2BA0A 4LUVA 4A4IA 2LCLA 2RCNA 4LNQA 3G48A 1VS0A 4EX5A 5M3MH 3AYHB 3KDFB 3S16H 1X54A 4Y7NH 2ZJPA 1UE6A 2MFIA 5FLXE 3CCQT 1VQFA 3P8BB 4IJLA 5IP7G 4IJHA 1VQNT 1JJ2A 2E6ZA 4JI4Q 3S17H 4QQBX 3J81j 1B70B 1Z9FA 2DO3A 3J7AF 1NE3A 2HQLA 2GVBA 2NN6I 3BJUA 3JC66 4APVA 3UE0A 5IYBG 5AJ3L 1XMOL 3K80C 1WCMH 4B3TL 1GD7A 5H1SE 3PO3H 2WP8J 2Q2HA 1HJPA 1N33L 4HIMA 4LF8Q 3HKSA 4XIGS 1SR3A 1I5FA 2F4VQ 3CMAA 1VQ7T 1X55A 2PQAB 1KD1U 1E1TA 4JI5Q 2QGQA 2B29A 1QVGS 3T1YQ 2YU9H 4OWTB 3CCRA 3I4OA 2UUCQ 4R1JA 2JOYA 3CC2A 1NPRA 3KF8B 2KDSA 3GDEA 3ERSX 1L1OC 1YVCA 1VQ5A 4DR4Q 3DM3A 3PUXA 1JJ2S 5M3MG 4JI4L 2UXBQ 3GTKH 3I55A 4IPHA 2Q2TA 4LF5Q 1I6HH 1PH3A 1L0WA 1UE7A 4IOCA 1WJJA 1M90C 3E9HA 4XTCS 2OTLA 1EYGA 1TWHH 5M5WH 3RN2A 4LF8L 3U4VA 4LFBQ 5FLMH 1GKHA 4UP9A 4DV1Q 2F4VL 1WCMG 3ER0A 3CXCA 2AWNA 4QGUA 5J26A 4JI5L 4ZN3A 3RLFA 1IXRA 3T1YL 1CSPA 1J5EL 2UUCL 3CD6T 2K50A 4GLVB 4X6AH 1VQOT 3CCVA 2K5NA 3E0EA 4PZ8A 3NELA 3UE1A 2UU9Q 2ZJRA 3F1ZA 2UUAQ 3H3VH 4HIKA 5JJKA 4DR4L 3U50C 1YIJA 1W3SA 4A3DH 4OWXB 2Q2UA 2UXBL 4LF4Q 4LF5L 4ZN1A 4LF4L 1YZ6A 1QZHA 5M3FG 1YI2A 1PHJA 4FDBA 2I5HA 1PH9A 2MWOA 4A93H 1V9PA 1XPRA 3T1HQ 3CPWA 1VQKT 1KRSA 1GVPA 2JVVA 1T9HA 1Y14B 2MO1A 4H02A 4DV1L 3VDYA 4LFBL 3UDIA 5GAEC 4OWWB 1OTCA 1X3EA 1JT8A 1PH6A 1HZAA 5FLMG 1PYSB 3J81c 2JA8H 3STBC 4BBSH 1M1KU 1PH2A 2Y0SE 3K81C 3PF5A 2UU9L 5IT9E 4AH6A 5HGQA 4GNXA 2UUAL 4NXNQ 1VQEA 3CW2C 2K5HA 1RL2A 2I5MX 2ZTEA 4UP7A 2VQEQ 4HIOA 2Z6KC 1JE5A 4TVRA 1QUQA 4DR3Q 2QA4A 1Q81C 1VQIA 3PUWA 1R9TH 2IHEA 4P71A 4NPSA 4EQ5A 4WJ4A 3TQYA 1K83H 5FLXc 4A3DG 1K8AU 1X3GA 2JEBI 4DNIA 3T1HL 1HNWL 5IE8A 1SROA 3G6ET 2LXKA 1Y1VH 1YJWT 4DKAC 1E22A 1NMGA 1I94Q 1TWAH 1XNIA 1EQRA 5HY6A 1HZBA 2L15A 3GD7A 2MNAA 2D0PA 1C0AA 2MQHA 1KC8U 1VQLA 2ES2A 3NBHB 1VQJA 4RG2A 1QUQB 4LUOA 1VQPA 3ULLA 3G71T 1YJNT 4NXNL 2KHJA 1N36L 1DGSA 3JAME 2VQEL 3CCSA 4YY3Q 4DR3L 1PH7A 3KBGA 1YHAA 5IP9G 1EIYB 4OO1G 1N32Q 2N8NA 4LFAQ 3RR5A 3CQZH 2F3IA 3HOUH 3HKZE 1PYBA 4JI2Q 1K8GA 2WB1E 1I94L 1K9MU 1K73U 4P75A 3GTGH 2HT1A 2QEXT 1AE3A 3AFQA 1N8RU 1K0RA 1P16A 1Y1VG 2ZM6Q 2CCZA 1KXLA 2NN6G 2YV5A 1A62A 3J80E 5E7NA 3CAMA 3B6YA 4O2DA 2VW9A 3D31A 3J81i 4DPGA 1VQ4A 5C4XH 1IZ6A 4JV5Q 3KDFA 1TWGH 1K9MC 2VS1A 2A8VA 3PIOA 3UDFA 4YY3L 1E1OA 1TXYA 1VQ9T 1N8RC 3CCMT 1X65A 1N32L 3A5ZB 1XTDA 4LFAL 4A3GH 3KLWA 2PI2A 2R7FA 3BU2A 2JA8G 2ASBA 4OXPA 3EIVA 3CCQA 3RN5A 1OXXK 1D7QA 2OQ0A 3M7NA 1VQNA 2KCTA 1VQHA 4JI2L 1L1OA 3HOUG 2JEAI 4MNOA 4OO1I 2ATWA 2N49A 1VQMT 3L2PA 1XPOA 4IPCA 1AH9A 4P74A 2ZM6L 4DV0Q 1UWVA 2PQAA 3CCET 4GLAC 5JJIA 4R4OA 4IO9A
chains in the Genus database with same CATH superfamily
1V8QA 2JQOA 2JN4A 1SMYC 5IODA 2KK4A 3CMET 4LF7Q 2K4YA 4M78G 1SSOA 5J3BA 1EZ8A 3F2DA 4UC4A 1OPLA 4HCZA 3JCMh 1D09B 3OYEA 2LQWA 3RLOA 3NQTA 2ZXRA 5C3EH 4N4HA 1E7ZA 4RGNA 2L89A 3RNJA 3I56A 4A3GG 1VQPQ 4HCCA 2EXDA 3S3NA 2Q8RE 3A8KE 4OB0B 2H5XA 3M4OB 1G291 1KDCA 1QCNA 4ME3A 4OHJA 4DV0L 1QKXA 4MMLA 4PNOA 1PV4A 2LRQA 1SYBA 4WORA 4HIDA 3W1GA 4MMKA 2RMOA 2V26A 3RBBB 2O01E 3BFMA 1YHBA 2JM9A 1JWMD 4ZGDB 4M7AC 1GL5A 2CP0A 3MJXA 5DLQE 2GN5A 1X2KA 4R56A 1VF5C 2FMCA 5IGCA 5CBEE 4C0FA 1RI0A 3FPPA 4IQZA 1PD1A 3FRNA 2LJ0A 1J3TA 4EIKA 1HJDA 2Y0SB 3CD6A 4C92C 4E7ZA 2RK1A 4ZKCB 1A3VA 1X56A 2LDMA 2JSOA 3S1NB 2E3IA 2MMPA 3WVDB 3WWVA 2DERA 2PMZE 1KHIA 1WXBA 1TUGB 1X27A 2OCEA 3M7GA 4KTAA 4J8QA 4NXML 3M53A 3CCLT 3KF6B 3CCQQ 1M4ZA 1JR0D 2D1XA 1VQNQ 4C5IA 4DXFA 3SVMA 3OA6A 2PW7A 5IY0A 2TSSA 1CKOA 1EY0A 5LJ3g 1I3QH 3RMQA 4C3HH 1KQSS 3HOZB 4MDXA 2EKOA 3I55T 3EFSA 5CORA 2PNHA 1JB7A 3FPUB 4K0KL 4JBJA 5JEAJ 3TZUA 2XG8D 3MP6A 2JM8A 3BDCA 4FU6A 4UDUC 4R4TA 1EWIA 3QBYA 5K5PA 1PH5A 3QIIA 4RCCA 1OXVA 2F0VA 4HVUA 3JSCA 2R3ZA 2WB1B 4DV4Q 4HMJA 2NVXH 3I56Q 3R2TA 4C2MB 4DNTB 1ZA1B 1B7TA 3C0CA 5CO7A 4PMWA 3L2UA 5IWAL 5BR8Q 4YTLA 1TTHB 4ZAIA 1NLPC 2A69D 1OXUA 4DK1A 1OXTA 1W6JA 4M75D 1HR0W 2L3PA 1Q1BA 3VR3A 1I50H 4UY8C 3R93A 3RUXA 2K33A 1MHWC 2GFAA 2OX7A 2KECA 2W10A 1S5CD 4X62Q 3KFVA 3CD6Q 1Q8KA 1RDPD 2TMPA 3I9QA 3K59A 4UPAA 5GAGC 1DD2A 1EIGA 1N34L 2QI2A 1HZCA 3LGFA 1D8LA 4V0BA 2IHFA 2ZXOA 1HUMA 5FO7B 1O7IA 3M0PA 1NYGA 4II1A 2KBNA 4QW2A 1O7YA 5IT9L 1VQ6A 4AYBE 4GOPB 4O6JA 2RBMA 3HL8A 4AFZC 1HXYD 2E8GA 4NW2A 2EJ9A 1Q7YU 2HDMA 3T9NA 1PTOC 2KY9A 5DLOA 1PFSA 4Y52H 1WXUA 3LGJA 2XTIA 3CP0A 1Y7XA 1A3UA 2QK0A 2IIMA 1E6HA 3ONAB 2Y0SG 5LMUQ 4DR7L 4C56C 2BH2A 4C3JH 3BG3A 1JQYD 3Q8DA 1UAPA 1EL0A 3OW2P 1UJYA 4A3KH 1IBLQ 5CQYA 2NUTA 1NEBA 1VQMA 1KDBA 1RTNA 4IPGA 4D8KA 4LW1A 1BVSA 5I4DA 4DUZQ 4OELB 2L0AA 1GUWA 2K7VA 4HN7A 2DNEA 3RKXA 4CI0C 1CKMA 1EY4A 2X51A 3V05A 3TZDA 5CMDA 5FWCA 3K0YA 3FEOA 1XMQQ 3D3RA 3CMEA 1HNZQ 3NTHA 3VRZA 1UE1A 2QDLA 3MEVA 2DGYA 4H0LC 1M2VA 3SGIA 2HHHL 3S1QB 4JYAL 1J8IA 1VIEA 3E9IA 1IBKQ 6AT1B 2JTMA 1TT2A 2VQFQ 5GAMg 3JB9H 3HOZG 4HTHA 2QGGA 4YCVA 3NMZC 1VQ7A 2KCNA 2C0IA 3J80L 2O4XB 1OZ2A 4C3IB 1I5OB 3GLXA 3I72A 3K7AH 5HURA 4Q5WA 1D5ZC 2RHYA 3S24A 4QY7A 1EEID 3S14B 4J6WA 3L7ZC 2G9HD 2WB1G 5LHY1 2RHZA 2RH2A 4ODGA 4CKEA 2AHJB 1SSFA 3A1PA 1FMKA 1ZEQX 4A63B 5M5XH 4LFCQ 3AEVA 1NJIR 1YJ9T 1PXUA 1WFQA 2R6GA 2YTYA 4HJ7A 3C94A 4Z89A 3GTOH 3EHRA 3MPUB 1VQ6Q 2K32A 2P5ZX 4KY5A 1BCMA 1QWFA 1LTAD 1ZYRC 4X3KA 5CBAE 1CKNB 2M51A 4X66L 2KYMA 4OL7A 4JPBW 3F2BA 4AMCA 4IOAA 1HD3A 2G6FX 4DV7Q 1N9SA 2A68C 1TWFH 3S2DH 2EY5A 2EYYA 4JDSA 4I7AA 4RWSC 3I3CA 1C0MA 5LJ5d 2JJQA 5JOBA 1FJGQ 1F1BB 1VYTA 4ZGEB 2OTJT 1GO3E 2KCCA 2ALYB 3CCLA 3ND8A 3JAMc 4DUYL 3J7ZC 4M77C 1B34B 4JJNK 2DY7A 1VQMQ 1M90U 1F9QA 3GTMB 4XU1A 4IFDG 3JCMd 2O5IC 4E2FB 1B9MA 1KIXA 2EJFA 1HQMC 3W5OA 1J6QA 3Q23A 3S15H 1RHPA 2C9OA 4QCLA 3CF5A 1WTVA 2A08A 2OI3A 4DOWA 1SE8A 3CMEQ 2HIVA 3K5OA 3OYIA 1KD1R 2P84A 3A8LB 3STBD 1MNDA 2HIXA 2RQTA 5KYIA 2CT4A 1VQGA 1ET6A 3H0FA 2O9SA 2SRCA 1X32A 3V96A 4YWMA 2EZVA 1VQ7Q 2ROTA 3M54A 3MEFA 2K6AA 2A6HC 3ZBDA 5IH2A 3K0XA 5F2DA 1FMWA 1XOVA 2ZPEB 4ME7A 4M78D 2EFIA 2DBMA 2Y90A 2L11A 1WX6A 1S4ZA 2K14A 2N55A 1HNXQ 2CFMA 2F1MA 4M78F 2WAQB 3RDVA 1NAPA 4BA1I 4BS9A 5JJZA 4MDWA 7AT1B 4IALA 5ELNA 5CV7A 2EYQA 1JOQA 1Y71A 4JBWA 5GAOl 1YIJT 2F69A 1YITT 3V2TA 4BBRH 4C3IG 5HGTA 2E5LQ 1Q81U 2B2TA 1QVCA 1CKBA 2KJXA 4GN5A 1MJCA 3F2CA 3MEHA 2EGEA 1WHHA 2CP7A 4BXXH 4LMQD 1PTOB 3MZ5A 3K5MA 4RTXA 3LWIA 4A75A 2R92H 2PVGB 1JWUD 4C8QA 1PH1A 3Q6SA 4IUQA 4F7UF 3M4PA 2RSOA 1T5XD 3ICEA 2BE7D 4JI0L 3NHNA 4DV5L 5LJ5j 5CKDA 1MMNA 5CKFA 4EPCA 5EC7A 2RKSA 2VXWA 3M57A 5ELDA 4M75C 2YYZA 3TP7A 2DXBA 1QVPA 1M2OA 2VY3A 1SRUA 1TUCA 1V1OA 4M78E 1CKAA 3DLMA 3DLLA 5IYDH 2CW0C 1MGQA 1SJED 3V7RA 4CC3A 4FXGC 4C2MH 3NP8A 5EGTA 4PJOA 4XQJA 1SRMA 4QQ6A 3QO2A 2DYIA 4L6V5 4A3MH 3D0FA 3TS0A 4HVWA 1H95A 1RABB 4TVAB 2GF7A 3VYGA 4XTWA 1G6ZA 2LY7A 2A0FB 2OQKA 2MGSA 1CQFA 5LMNQ 1FL0A 3U23A 2MK5A 3SK5A 3MAQA 4C0DC 4XAXB 3L3OC 1CQVA 2VWFA 5DM7R 3HPWA 3DWPA 1DONA 3GTKB 4RTZA 3I7FA 1SNMA 3QYGB 1EZ6A 4E7JA 3QUIA 5E4XA 3R8BA 3DM1A 2CP5A 3ND9A 4RH6A 1HNWQ 2VB3X 5AJ3Q 2YUOA 3L1AA 5M5WB 1XMOQ 1U1TA 1YJ9A 2E2IB 2WACA 4F7UE 4LDVA 3M3YH 2K3XA 1H9MA 2L3QA 1VQ4T 3EFXD 1NJIC 4B3ML 2WAQG 4IFDH 3VU3C 1TS9A 1HYOA 1GOZA 3EH1A 3TU4K 3T13A 5DEHA 1UGSB 2CGHA 3RKYA 1WHKA 2CS7A 2XDDA 4CBVA 4EX5A 3AYHB 4C5EA 3KDFB 1D2BA 5I21A 1PM3A 5FLXE 4IJLA 2QQ9A 4IJHA 4XTVA 3P75A 4JZ4A 1AWJA 4M77B 3R6NA 1B70B 2JXBA 2LNHB 2K03A 2C0TA 2HQLA 5LJ3h 5I11A 2NN6I 3E0JA 5KYXA 3UE0A 4APVA 1B9NA 3K80C 3VR5A 2AIRB 2NB0A 1RLQC 3BE3A 1Q3LA 2Q2HA 1HJPA 4MHEA 2DRKA 1BF4A 3SWNA 4XIGS 2F4VQ 4M4ZA 3O13A 1HFGA 4ESRA 2PQAB 2QGQA 3M58A 1BCPC 3HP9A 2YU9H 5GAMf 3KF8B 2KDSA 2QQBA 1ZSGA 2GTJA 3DM3A 3GTLB 1JJ2S 4FSXA 4DNRB 1LCKA 2AUKA 1EY7A 2F0HA 4EDUA 3M4GA 1KLGD 1OOTA 1L0WA 1WJJA 3QXEB 4OIKA 4XTCS 1EYGA 5CYUA 1RACB 4PL6A 1DJRD 1TWHH 4LFBQ 3CBMA 3M9QA 3O5ZA 4UP9A 4DV1Q 2LCCA 1B53A 2AWNA 4QGUA 4KV6A 4JI5L 3T1YL 1TUDA 4A4KA 4N8FA 3LNNA 1N6AA 4K6DA 1VQOT 1YJ9Q 1SXTA 2O2LD 1Y8OB 3UE1A 3H3VH 1TS5A 2KA7A 2MPXC 1YIJA 1W3SA 4OWXB 2UXBL 3CQZB 2EBPA 4LF5L 4ZN1A 1Q90A 4OMNA 3THKA 4X9DA 2F4IA 2RA2A 3LWHA 1SNCA 1V9PA 1VQKT 4H02A 2MO1A 1T9HA 3VDYA 2DZ9A 2E2DC 1PRTC 1JQQA 5GAEC 2PU9B 2FG0A 2FPFA 1OTCA 1HXDA 1AFPA 1SYCA 1OI1A 2X4JA 3QZ9B 3LWEA 2O31A 5FLMG 2K57A 3WVEB 3STBC 1T3SA 1M1KU 1TWGB 2Y0SE 1XYIA 1Y96A 5KNBA 2UU9L 2A3LA 2E6NA 1JE4A 2K5HA 2I5MX 4QT7A 2J4XA 1R9TH 2HCCA 4LF4L 1VQIA 4NPSA 4EQ5A 5I2MA 1D0XA 2QQSA 3A8OB 5FLXc 4DU9A 1U4LA 1X3GA 3OYAA 3T1HL 5IE8A 1SROA 3G6ET 2A6ED 4M77G 2HDAA 3QB3A 1NMGA 4PFZA 1I94Q 3U9SA 3JB9J 2MNAA 4K5XA 3PVQA 1KC8U 3FVQA 5GAMh 2ES2A 4A4EA 2QGFB 4ABNA 1VQJA 2XKOC 2COWA 2J6OA 4GLMA 1QUQB 4K5WA 4Q5VA 1MMDA 1BU1A 3G71T 1ONLA 1TWCB 2Q2UA 3VV0A 4C0DB 1EY5A 3L2VA 2EYWA 2HBPA 1DXMA 4LDUA 1UHCA 1D1KA 2EDGA 1Q8IA 1N32Q 1U06A 5C3EB 3RR5A 4XYQA 2XWJB 2DL5A 1PZID 1LLRD 5I2XA 1B1ZA 5L8RE 2EQKA 2PYKA 1ABQA 2WB1E 1K9MU 1K73U 3FRPB 1AE3A 1YIJQ 4ID6A 5ELBA 5GAOp 5I9OA 1KXLA 3M0RA 2NN6G 2P0QA 5T1IA 4JRPA 3H6ZA 3CAMA 1MSHA 3B6YA 2HAXA 1E2ZA 3D31A 4O2DA 2JA7B 3AB9A 2F0OA 4LN2A 2Q8IB 2KGTA 4DPGA 1VQ4A 5C4XH 3X3MA 3A8IE 1JB3A 1I4GA 3MEUA 2JTEA 4ELYC 4HKEA 1VQ9T 1WD1A 4F7XA 3CCMT 2I07B 2D5DA 1D5MC 3HRTA 3CPWP 3KLWA 1FYNA 2R7FA 1HRJA 2FPEA 2CH4W 3RN5A 1ZSZA 2X4XA 4JI2L 3PFSA 3QG1A 5GANd 1CSKA 2LJ1A 1L1OA 4GZYC 3GP7A 4M7AA 3T4AC 1AH9A 5KCHA 2IL8A 4HMIA 3VR4A 2DFUA 1AOJA 2ZM6L 2GNCA 5D6YA 4Y91A 3CCET 4GLAC 2E12A 3HFOA 3KLSA 4M7AF 2NUTB 1GUNA 2E4HA 4XU3A 3V7SA 1BCPB 4JV5L 2FHTA 3CC7T 4X9CA 1KIKA 4OGEA 2K5FA 4C92F 1VQ8A 5D65A 2YSQA 1WTWA 4DAMA 3W3AA 2KI7A 1Y1WH 1VQAA 1I3QB 2CZ6B 4C3HB 1FGUA 3BW1A 1RAAB 1BDOA 3M55A 4IUNA 3VS5A 3PMFA 4DR2Q 4KH1B 2OT2A 3J81L 3A8JE 3JCMc 4HSPA 2EVRA 4OMLA 1RAIB 3FLGA 4AG1C 2DXUA 2DNCA 2LCSA 2G5DA 4R4IA 2F2VA 3GTPB 1C4QA 2NVXB 4EMGA 4FSSA 3KUFA 2E10A 1S72T 3D4WA 4GN3B 4LF7L 4PFPA 1SNPA 2MP1A 1FNWA 2EW3A 2O2OA 2MJ8A 4WCIA 1L0YB 1LVKA 3OYGA 1PDQA 3DUZA 1CM9A 4XQNA 2E2IH 2UUBQ 1I50B 1XXGA 1UGRB 1SMXA 2KVMA 1VQ4Q 1II3A 5CC4A 1UG1A 1Q86U 4BA2I 3HFZB 5C3EG 2MOXA 2K2VA 1HCZA 1PD0A 2HL3A 3FC3A 4M7DA 4X64Q 2QQRA 3DB3A 1PRTB 1Y69U 2XDPA 2YUNA 5LJ3d 4M7AE 1LTLA 1RTOA 5JPNC 1LJOA 3J7A5 1Y07A 1M5Q1 5GJVB 2NWGA 4BDYA 4XQ3A 2C5CA 3L0OA 4JYAQ 4DV2Q 2AUJD 4DAYA 2EQJA 4JZ3A 1RKNA 2BIVA 4C92E 4KULA 1ESFA 2HNIA 3CHBD 4RA8A 2JA7G 2ED0A 4XDXA 3NGPA 2XGTA 2EWNA 3M0QA 2JYOA 2KUMA 1EQQA 5CV4A 4EMKB 1I6VC 2YWWA 5LJ5f 2BDOA 4C3JB 1I1JA 3JB9I 2EQSA 2MIOA 2R58A 2X3XD 1W2BS 1VQ8Q 3LH5A 2CWAA 4POFA 3HZXA 3WOFA 3V8KA 2CSIA 3MXPA 3PO2H 1YBYA 2CDTA 4A3KB 1O9SA 2MAMA 5KE3A 2IPKD 2N3SA 2LVMA 4A3LG 3JCMf 3MTSA 1PTOD 2RD1A 2JJ9A 4QMGA 3OW2S 4RHRA 3GTLH 3DEOA 4PFOA 1KAWA 4LJZC 1L2FA 1UGPB 3LWUA 2BE9B 4IPDA 3UDXA 4KHPQ 3MFYA 1S40A 2NN6H 4J6XA 3G71A 1SAPA 2PTKA 4J9EA 5ELCA 1SBBB 1QVFS 1XNRQ 4BB7A 2F2XA 2MI6A 4LF6Q 1WD0A 3NENA 4C3HG 2HD0A 2YUPA 4JI1Q 5FJ8H 3EG1A 5NUCA 2M16A 1DOKA 3I90A 4UAIA 2C0OA 4B3SQ 4RKBA 1Q82U 4DV4L 2KYBA 3QIAA 1C1AA 3X26B 2DEQA 2R7DA 3OIPA 3LLRA 4HCBA 3TEHB 4IFDJ 2FB7A 2HCIA 3BVMA 5BR8L 2CKZB 1Q81R 1E0BA 4QIWB 4BACA 1JMCA 5IXBA 3J80i 2L1BA 5M5XB 3HOWH 3CPFA 4FXKC 2LSSA 3J7AV 1G6PA 2FZKB 4LDYA 3L2WA 3LX7A 1VQ9A 3CCMA 2CREA 2EY1A 2RSNA 3RD4A 1D3BA 3GTOB 1STGA 4DBHA 5CV9A 2E2HH 1Z7TA 2DL7A 1D5XC 2RQXA 2IX0A 4MTKA 4O5VA 4X62L 4AQYL 1TVXA 4GOPC 2M00A 2SEMA 4X65Q 3KUPA 2Z0WA 1TWFB 4FO2A 1TY2A 4LF9Q 1CI3M 3P20A 1GM5A 1AZEA 2E76C 3PO3B 3VYTA 2BZYA 2GTOA 3X24B 2FZCB 4DK3C 3CCEA 3JAML 2A1AA 5JJLA 2BKDN 4IUPA 2DJZA 3UATA 1LABA 4JOIA 2VB2X 1ZYRD 4L5TA 3S1MH 2HQEA 3CC7A 2D8JA 1NCVA 2EJGC 3M85A 1ZUKA 1K8OA 2BZ8A 5LMUL 3DB4A 3L2ZA 3S15B 2GQIA 2A68D 4RAUC 2NYZD 4OP0A 2DUDA 3EG9B 5GMKm 5GANg 3A74A 1ZKOA 3S3MA 1GUTA 2UXDQ 2NLUA 1PSFA 1KNEA 1X3FA 1D6EC 3EA6A 4PJOB 4C3JG 3G71Q 1X69A 4XTXA 1IBLL 2RF4A 4RTYA 4DUZL 1TWCH 2AQ1B 4R8IA 1IGQA 3CCJT 4M77D 3VJPA 3X25B 1KFZA 1CK1A 1FVIA 2NBFA 3BZDB 3UWNA 4A3KG 4HA8A 3UDGA 1XMQL 1S72A 4M77F 3GIBA 1HNZL 4NKLA 2IG0A 2IWHA 3A7LA 4DR1Q 3CCSQ 3RZDH 2EYLA 4HCSA 3OS2A 1IBKL 2AWOA 1ZUYA 3D8GA 3OWEB 2VQFL 1RAFB 3RLNA 1ML0D 2JA7H 1NE8A 2OWOA 2LKVA 3T16A 4N9PA 2KXCA 5IHIA 1DYQA 1EWHA 3PUYA 2LP5A 3JB9G 2KQWA 1VQ9Q 3CCMQ 1Q12A 2KHSA 3HOVH 3A8MB 4MIUA 1I81A 1D0ZA 2PUOB 1FNUA 2A6HD 2HUGA 4BBRB 1WJSA 3H3VC 1LTTD 4L8JA 2OF1A 5EQ0A 1IL2A 2ENMA 4RCNA 1GCQA 4LFCL 1Z9ZA 3ZYYX 1J5EQ 2KNBB 4OONA 2J6FA 1OYXA 2DNUA 4A3LH 1F2MA 2R92B 1YFNA 3GBQA 1RAEB 3EBEA 4FW1A 3E3XA 5E1FA 3CMAT 5KYXB 3G1JA 3ULJA 2RI2A 3CC7Q 4DV7L 3CCRT 1TU0B 1CZWA 3A98A 3CC2T 1NR2A 2CKKA 2QYZA 3OYLA 4JCVE 5FKAC 2YTVA 1FJGL 3OYYA 3HOYH 4NS5A 3OYHA 5M9OA 1NLOC 4A76A 4PZ7A 4FF1A 4M77E 5GAMj 3PO3G 3CCUT 2EAYA 1EIFA 1HHVA 1ZBJA 2M1HA 2PZUA 4HR7B 1WHJA 5HKCA 1BI1A 1PH8A 1OU9A 4J5YA 2B2WA 1HR0Q 1CA6A 1S1NA 2FFKB 1CSQA 1H9SA 2PVOB 1LT6D 4IZ8A 3GTPH 2DA9A 4OGQC 1GJXA 4HXJA 1ABOA 4C0ZA 1S72Q 4A3MB 3G7LA 1C48A 5CKHA 4IFDI 3MXGA 5IAYA 1W4SA 3OYFA 3M0SA 4FL6A 3HG9A 1ICWA 3CCVT 4OX9Q 2HSPA 3OSOA 3ZJYC 3LH0A 4PJOG 2ICIA 2ZPHB 3C2PA 1YI2T 1TY0A 4M75F 1YHQT 5IGFA 1AZPA 1BNZA 2CW0D 4WJ3M 2Z8LA 4RGMA 4V190 1IYUA 3U58A 1IYJB 1N36Q 1HNXL 1N5ZA 2KT8A 4R0KA 4HJAA 2HD3A 2MO0A 1CUKA 1TS3A 3M3YB 4KBMB 1M1FA 1EUJA 1PFMA 5HK3A 3D6WA 3PQIA 2QASA 2VGMA 1M1KR 1VYVA 3HS0C 2F0NA 1NBEB 4A93G 5A0LA 4C1NK 1Y96B 1MNEA 3KOJA 2E5LL 2DJGC 1GBRA 5CV6A 1S3OA 1AN8A 2XIWA 3H9NA 4JI7Q 4TQUS 1E7OA 3MEWA 2JE6I 2QQAA 4QVDA 1SEMA 4BBRG 5A2QL 4ZLTF 1FYCA 2B63H 3RZOH 1YNJC 4OMFB 1EY8A 2ZXPA 3U4ZA 4POGA 4BXXG 3JRZA 1NSNS 1JO8A 1SNDA 1A15A 4WTOB 1VQLT 2R92G 3PT9A 2JP1A 1LPLA 2YLBA 3URYA 1MJEA 4PJMA 3EGXA 2FVUA 2K9GA 4OB3B 4LUEA 1A3TA 3MXUA 5TSSA 5I6YA 3A5UA 3TDQA 2YU9B 1Z6HA 2ECZA 5AT1B 3H3VI 5AYFA 1I8FA 2EVBA 5IP7H 3VRYA 3H0HA 4K8IA 1SLJA 1CT1D 4M75E 1SYFA 2B2UC 5M3FB 1SYEA 3CCJA 2F0FA 2I5LX 5EPLA 4TSSA 1B8AA 2I0NA 4QQDA 5IYBH 3H15A 4C5HA 4YCWA 3E1SA 4MTNA 1G3WA 2A7YA 1EWCA 1TWHB 4JJCA 1K9MR 3NE5B 2B2YA 1BCPD 2QXFA 1G8ZD 4DV3L 2JTFA 1TKWB 1ENCA 2LTOA 1N33Q 5IYDG 2QDBA 5KNDA 5C5LA 1IHWA 4A3MG 1RLPC 1F9PA 5LMNL 4N0AC 5FU6B 2DEUA 4A4IA 2LCLA 3G48A 3H91A 5IGGA 5M3MH 2DTIA 3H94A 4KJNA 4R55A 1VQFA 4OMMA 3P8BB 3I4LA 3H09A 4EQPA 1WQ7A 1STYA 3HSBA 3S17H 1PZJD 2N88A 1Z9FA 1D1BA 2DO3A 3BJUA 2GVBA 5AJ3L 1XMOL 1ZSZB 4FT2A 1WYXA 1XX8A 1GD7A 3PO3H 1YN8A 3SEMA 5LJ5e 1R4PB 5KE2A 1VUBA 3CMAA 2SDFA 3SK6A 4Y92A 2EKHA 5GMKj 4CJ1B 3ZL7C 2FL7A 1QVGS 2B29A 4OWTB 3CCRA 2UUCQ 5GANf 3N5BB 1EEFD 3CC2A 1AHJB 1NPRA 4N9TA 4ZKBB 2F1LA 1WXTA 4XU0A 3G6JB 1SKUB 1R9TB 2LZ6B 1YVCA 1PMRA 5CAIA 1RD9D 1N9RA 1WZOA 3MA2B 3AMUA 3I55A 1PRTD 3EROA 1IRXA 2B2VA 1PH3A 3T56B 1M9SA 4IOCA 3FMCA 2RHUA 1RI9A 2GQVA 2XMFA 1PRTF 1STAA 4RTVA 1TS2A 3GQBA 2F0KA 4I65A 3RN2A 1LTSD 1EQVA 4KMUC 3SXHA 2F4VL 3FIFA 2Y4YA 2HL5C 2DL8A 1IXRA 5E3FA 4KKTA 4PJNA 2K50A 4GLVB 4X6AH 4M78A 1IGUA 3CCVA 2K5NA 3NELA 4OF1A 2ZJRA 1H3ZA 1CHPD 4HIKA 3PMTA 3U50C 3RIRA 1QLYA 1NEGA 5M3FG 1YI2A 5KYWA 1Y57A 4PK4A 2MWOA 4G7HC 3MHXA 4A93H 1Q86R 4CDDC 1I07A 3VS0A 1XPRA 1KRSA 3GV6A 4N8X1 5COYA 2I0QA 4LFBL 2WSCE 4DV1L 4CJ2C 3UDIA 3OS0A 5L37A 4M7DB 1GBQA 2F0TA 5C4ZA 3PIO3 4FIBA 2MHVA 4RTUA 1BYMA 3VS4A 1A2TA 4QUCA 1PYSB 1KK7A 2RI5A 2F2WA 1PH2A 1I5LA 5CK9A 1SFOB 3JCMb 5C4XB 2K5DA 2M2LA 3BVZA 1O75A 4UHVA 4FYDA 5IT9E 3CQTA 5HGQA 4GNXA 1BCOA 4NXNQ 4F7UA 5I22A 1X3PA 2ZTEA 1M27C 3JB9D 4NMZA 3CCLQ 3CMAQ 2VQEQ 2K2MA 1JE5A 5LJ3f 3PUWA 5CKEA 1OULA 1OEBA 2XIDA 3JB9F 4B9XA 2PZWA 3TQYA 3CCRQ 3SDZA 4DNIA 3CC2Q 1UFFA 3PGGA 1Y1VH 2Z4HA 1E22A 1XNIA 2LT1A 1EQRA 5HCKA 1HZBA 3K6OA 1U3OA 4FYXB 2D0PA 1AZQA 1C0AA 3REBB 2MQHA 3E9GA 3I55Q 1UNSA 1SJHD 4D6WA 3QDRB 3JCMP 1VQLA 4OMQA 5GANh 2KEAA 2V1QA 1VF7A 4LDXA 3ULLA 2NVYB 1YJNT 1WTOA 1K8AR 2KHJA 2JA8H 1PH7A 4YY3Q 5ISRA 1Y1WB 3KBGA 4OO1G 3GPLA 1X3QA 4CDFC 2N8NA 3V8JA 4LFAQ 2F3IA 1U4MA 3O8VA 1KQSP 2YT6A 3TCJA 2COZA 1KJWA 1I94L 5D3IB 5T1GA 2HT1A 3WXMB 3QO3A 4OEMB 1N8RU 1K0RA 4CDCC 1TH7A 1KLUD 2YV5A 4QB4A 3J80E 1YI2Q 2HSEB 2VW9A 2FHDA 1CHQD 4RFBA 2F0LA 3VR6A 3NHHA 1VMPA 3E19A 2D0NA 4H13C 4RGOS 3J81i 1K9MC 4HCKA 3PIOA 4Q0FA 2A8VA 5EJWA 2X4WA 1N32L 1XTDA 3X20B 1X43A 2PI2A 4JJDA 1DOMA 2QKIC 2YXYA 1QWEA 2K79A 4PJOD 3BVGA 4OXPA 2ASBA 1NNXA 1C6VX 1OXXK 5KYYB 1D3BB 1VQHA 2KR3A 2HZYA 4DOVA 1NYFA 3R2IA 2ATWA 3L2PA 4IPCA 1B2TA 3X3NA 2EYZA 4J7FA 3BYYB 1UWVA 3EFOB 1WI7A 1VDZA 4JVZA 1IB8A 2K01A 4LK1C 4IO9A 2L8DA 2DKGA 1UJ0A 5CKBA 5KYUB 2OTJA 4QIWE 4M7DG 2KHIA 1PCXA 5CV5A 1PKTA 3BZKA 1NBWA 4NP5A 1O7ZA 5C4XG 1NPPA 4JLIA 3OSSC 4RMFA 1VQLQ 1VQCA 1GUOA 1PRMC 5IT9c 1EY6A 3PSIA 4AG2C 1UHFA 1UUEA 1NMFA 4KKUA 1X01A 2KBTA 3V7CA 4ILWA 1PFNA 5FK9C 2KENA 1GUGA 4XYOA 3K8AA 1ZUUA 2ABLA 4VUBA 4RTTA 3U9OA 3HOXH 4BY1B 3PO2B 1W6KA 1QNUA 1U9RA 2VZAA 5FRNA 3KLRA 4QUFA 3CBOA 1QILA 2AK5A 1G51A 1MD2D 1AWXA 2PW5A 3D6CA 5GMKl 3NUCA 4HEDA 3M4QA 5EAYA 5M3FH 2XVSA 4JBKA 1EZZB 2H1EA 1CTMA 1HZ9A 2WV6D 5C6AA 1KD1C 2M02A 1BBUA 2JA6H 2KCMA 3RNUA 3QPHA 4QJFA 3KF6A 3VR2A 1LT5D 2A73B 2CP6A 2ROLA 1MBYA 2F5TX 1KQSA 4C0GA 1TS4A 2JNGA 1LTBD 3A8HB 3I91A 4BY6B 5GROA 2PI2E 4YHHQ 1Y1WG 4C5GA 2Z6KA 2R7ZB 4LUZA 2UXCQ 2F52A 3H0GB 1FX7A 5JAVA 1Y8NB 3PIP3 4NL3A 1JEGA 1WYDA 2DZCA 4B3RQ 4E47A 3QOLA 1YITA 2OAWA 3C95A 1DZ1A 2CH4A 5ELEA 3S1RH 2DXCA 1X6BA 3J80c 2QTVA 1XTCD 2B8FA 4FYYB 1KQ1A 3HOWB 4ZNXA 3RERA 1S5ED 4A3FH 2UUBL 2B8AA 1CZGA 4X3SA 2OTJQ 4R4CA 5GAN6 3CXCS 4KGVB 2E2HB 4KK7A 1K28A 1AT1B 2MPMA 4X64L 3M59A 3E5SA 2KROA 4PZ6A 2PO4A 4IIOA 2L55A 4OO1H 4MZPA 4FYWB 1UE9A 1BI0A 1STNA 2RN8A 2ZTCA 2EYOA 1K1ZA 1R77A 3A56A 4NDXA 3TP6A 2IY5B 2M9VA 5D7UA 4DV2L 3NTIA 2DBKA 2KMTA 1OO9B 2PVDB 1VMCA 2IT1A 1Z47A 3I70A 4EMKC 5FO9B 3IRBA 5CQXA 4ZK9B 3S1MB 2EJFC 3OTOQ 3GNGA 4A3EH 1F2ZA 1K3RA 3S9WA 2D9TA 2EIFA 3JCMQ 1YJNA 3OMGA 1OQKA 2VVKA 1BUVT 1LYLA 3OS1A 2ZJQA 4DR6Q 4ZYSA 1K8AC 2ZGWA 5C3XA 4RCOA 5C0XI 2FXQA 3GO5A 1R0BG 1QW1A 2VV5A 5A0GA 2V8JA 2MYSA 2QILA 4K6LA 1K3BC 4X3TA 2V4DA 2VC8A 3SHLA 4BY1G 2PPBC 3PO2G 3MC0B 4BI8B 2D9UA 1S5BD 5FOBB 3PMIA 3PIPA 2F0JA 3EHQA 2CT3A 4RUGA 1G3TA 1LO5D 1WOCA 2RHXA 3EJIA 5EKIA 4L5GA 5FO8B 4U673 4KHPL 4V2SA 3RZDB 2KVQG 4Z8AA 1FNVA 4F16A 1YITQ 1XNRL 2F0PA 5C44H 2FZGB 4LF6L 2BCOA 3DWAA 4JI8Q 2W0ZA 1VOMA 1G83A 3NTKA 3E6ZX 3FKIH 4ZUJA 4JI1L 3UI2A 3I4MH 1Y0MA 1GXDC 1IO6A 1T0HA 4B3SL 1IBMQ 3E9FA 1EIHA 1SFOH 2DILA 1OU8A 4JRIA 5FJ8G 2B2TC 3HOVB 2VUMH 2R7ZG 1YNND 1Q7YR 1HFNA 2SOBA 3H0GG 2PZ1A 2RQUA 1WTRA 4PKCC 1VQPT 1SE2A 1WI5A 3CRLC 2F3WA 1EYDA 2AQ2B 2LXJA 5ELOA 3GTGH 1D1CA 4C8QC 2EYXA 3Q1JA 3G4ST 2RJDA 4OB1B 4X34A 1IHZA 3FEWX 4LD9K 4GKKQ 4HJ8A 1XPUA 2LFNA 1PA6A 1K8MA 3M56A 1ESRA 1M3CA 4P72A 3HOWG 3I4NH 2K7AA 3A8GB 1P8LA 3A0JA 1AE2A 3H6MA 4A3IH 4C92A 4OMOA 1AW7A 1AD5A 1NJIU 4KHZA 4X65L 3ITPA 4LF9L 3TS2A 1YJNQ 2KEDA 2NVYH 1C8CA 3EGXB 1K0XA 2JMCA 2HMAA 2ZCFB 3HOYB 1V1QA 2B8GA 3KJPA 1E24A 1GRIA 2EQUA 3ZEHA 1HH2P 1KHCA 1BIAA 1M2VB 1PKSA 4IUTA 1SYDA 2QG9B 2BA1A 2K3BA 2JA5H 1ZX6A 3FJPA 4MZ9A 4JI6Q 2ID0A 5KYLA 2ENBA 2R5MA 1M8VA 1YWPA 3C1FA 3K57A 4PJOC 1AWOA 2VGNA 4E6RA 3TBIB 2Z4IA 2O88A 3VS1A 2UXDL 3M4YA 1ASZA 3E2UA 4Z9CB 3D4RA 5IOCA 4L59A 2FEIA 1QG7A 4JUVA 2NZ1D 2LX9A 4LDWA 4PMBA 1VQOA 2XRSD 5C4JH 2ESWA 2V8IA 2JK8A 3DHQA 2EGAA 4A3JH 2LJ3A 4BBSB 1TU2B 4DR1L 1VQBA 1NZ9A 3A55A 5G3LD 1LTID 2L3RA 5C6SA 1UTIA 1RODA 2E41A 2N78A 2XN9C 3BDOA 3CU7A 5G3LF 4B6MA 1VQKA 2R61A 3I56T 5J22A 2R93H 5I2YA 4WFN3 2M0OA 1R4QB 5FU7B 2IW3A 1JU5C 1PWTA 4E6IA 4KT0E 2PCFB 3MWYW 4D8DA 1TWAB 5E4WC 5C0XG 1M90R 5EBDA 4A3BH 2HQHA 5GAOm 1U4PA 3HOVG 4HVVA 3AQQA 2VXFA 1U4RA 5GANj 3KBXA 4K8JA 1X75C 2XK0A 1O7LA 2LC4A 1G91A 2B63B 2ED1A 2SEBD 2RHSB 2DF6A 2B3GA 3FP9A 2OTLT 5M5YH 2IX1A 4DR5Q 1GHKA 1UEAB 3SWNC 2X3WD 2AKWB 3EVQA 4DV6Q 4BY1H 2FO0A 3G6EA 2D0OA 3SHWA 4AIMA 3PNWC 1TIID 1ZA2B 2DTOA 4NB3A 5GAN3 1JJGA 2RNAA 3UPUA 4WF2A 3M0TA 3EQLC 3R6OA 3NPFA 4DEXA 4HT8A 4QVCA 2EPBA 2AMCB 1MV0B 1PTOF 3EH2A 2QEJC 3SEBA 3VYRA 2H3JA 4MZTA 3TVTA 3V8LA 2NUCA 2CHBD 3OYDA 2CQOA 4DA2A 4QL5A 1YNJD 2ZAEA 4GS3A 2KSSA 2KEEA 2KQ3A 3HOYG 1SHFA 2EYPA 4HJ5A 3G7ZA 1BI3A 4FXDA 3IL8A 3OW7A 3VYSA 2WINB 2R7ZH 1HR0L 1WLPB 1HPCA 1VQOQ 3NSWA 5KYWB 3H0GH 2PNRC 2P4RA 4JS5A 4J9HA 1W6XA 3VS6A 4HSVA 2R57A 1QJOA 2WFWA 4KLKA 2LQKA 2DXTA 4OX9L 1RAGB 3GV3A 5BN4A 5CR3A 2DJQA 3QWXX 4EVOA 2F0IA 2L3SA 3TSZA 4KY6A 4ORZA 1VQKQ 2CP2A 2CZ7B 4A4FA 4ME5A 5M3MB 4KHVA 2QA4T 2WAQE 3M9BA 3MFGA 2CWPA 3Q24A 3K5LA 4GNXB 1KTKA 3NWSA 1HA6A 3QJYA 1FXXA 4F7UB 3EGDA 4AFSC 3JCMX 4DAPA 3MCAB 1XWEA 5IGBA 9ATCB 2CUBA 2MCNA 4C8QB 3S17B 2YTXA 1XNQQ 3L2RA 3MO8A 2J7IA 2MWPA 4KH0B 3UDCA 4E7SA 3MP1A 5LJ3j 1Q7YC 1DCZA 1V1PA 2DN8A 2Q2IA 3G4SA 4JI3Q 4BBSG 5C0MA 1B07A 2I2LA 3WDNA 4N0AA 2BH8A 1F2LA 1QMCA 2WSEE 2AZVA 4DBRA 3OHXC 4JBMA 2EE1A 5HK0A 4FVMA 3H0IA 4J9BA 1WIEA 1MKHA 1TWBA 3MXNA 4ATOA 5GAMe 3G6EQ 4IIMA 3CKIB 4J6HA 1JICA 1KNAA 2X6GA 4O0AA 1VQ6T 3NWTA 4JI7L 1CFMA 2JA9A 1I4XA 4RTWA 1ZXTA 2VKNA 3GTJH 2L9HA 2E74C 1GFDA 3PUVA 4YCUA 3L2QA 2B63G 2NVQH 4HT9A 4JW0A 4M77A 4WRDA 3K7UC 4JG2A 4B3TQ 1WJRA 3J81E 1N8RR 4GLXA 4GKJQ 1QP2A 2XICA 1BO0A 1BI2A 5DY9A 2F0SA 1YNNC 4ZQ3A 3VYHB 2DPPB 4LUVA 1VIFA 1GUSA 2COYA 2RCNA 3S16H 3IFDA 5BN3A 4Y7NH 2ZJPA 2MFIA 4M8AA 5IP7G 2X6LA 1JJ2A 2PUKB 2E6ZA 5KNCA 2HDLA 3OYNA 3KF8A 4JI4Q 3GF5A 1LT4D 4R8NA 5JPMC 4QQBX 3C1EA 3J7AF 1NE3A 5C0XH 4A93B 5K36G 3JC66 3M0UA 5IYBG 2RJFA 1WCMH 4QF4A 5FU6C 1LTRD 3HHTB 2CQAA 2WP8J 1N33L 2P4TA 4HIMA 4LF8Q 1SR3A 1I5FA 1VQ7T 1LNXA 1X55A 2EJMA 1X2QA 2X69A 2ATCB 2JT4A 4BE1A 1AEYA 1E1TA 5KIXA 1MGSA 3RUZA 4RCBA 3G4SQ 1SSHA 1V76A 1F9RA 4R1JA 1PC0A 3K5NA 1BK2A 1ZSZC 3CCEQ 2RVLA 5A35A 1ENAA 3C3LA 3ERSX 5I2SA 4ZTFA 1JCKB 1L1OC 4FF2A 4DR4Q 3PUXA 5M3MG 5GAOr 2CZ1B 1ICFB 4IPHA 1I6HH 3SWNB 4F7UG 3QDFA 1UE7A 1M90C 1Y1VB 5GJWB 4C8QG 2KRSA 2OTLA 2XWBB 3U4VA 5IN1A 1GKHA 4DAVA 3CXCA 3TP8A 2O9VA 1G8XA 5J26A 1QCBD 3MEAA 3RLFA 3DEPA 4F14A 1STEA 3NPPA 1CSPA 2J05A 3HGBA 4LAAA 4PV1C 2UUCL 5IXFA 2JA8B 4PZ8A 2EYMA 3TMEA 1WPYA 3UT1A 2UUAQ 5JJKA 1G2SA 3P1HA 4A3DH 1IKMA 1FWZA 1GXIE 2L5QA 1EOTA 3RESA 4K14A 4YIJA 4DBQA 4IUUA 1PFBA 2XI9A 1QZHA 1PHJA 2QCPX 4FDBA 2I5HA 2XSCA 3MVVA 1PH9A 2YDLA 4FF4A 4BDZA 5JVH3 2DIGA 2A28A 1B4OA 4JJBA 4M75A 1GVPA 1ET9A 5A0DA 3AHUA 2QW7A 3H8ZA 1PH6A 1M8MA 2NUZA 4ELZC 3FJ5A 2Q8TA 3J81c 4J6YA 2KT1A 2RQRA 3KLSX 1WDXA 1BR9A 4BBSH 1T3LA 3L42A 3SK8A 1ZLMA 3MKDA 1EYCA 1QNKA 4AH6A 4UP7A 4HIOA 1PH4A 4DR3Q 4KD4A 4DBFA 1QUQA 2QA4A 2HBWA 1Q81C 2CSQA 1ILQA 2IHEA 1YNZA 4M7DC 2D0QB 2WKCA 4ULLA 3S3OA 1K83H 1ILPA 2I46A 1YWOA 3D4DA 1HNWL 2LXKA 1YJWT 4DKAC 3X28B 4TKOB 5GMKe 3VS2A 1TWAH 4EGVA 5HY6A 4FT4A 5CR2A 4KRTA 1S5DD 1H9KA 2WKDA 5KH6A 1VA7A 2PZTA 2YHTA 3N6RA 2AKLA 3NQIA 4DV3Q 2OTLQ 2EY2A 1TR5A 1I4HA 3DMUA 1WHMA 1XQHA 4NXNL 3URGA 3JAME 1DGSA 2L5TA 2VQEL 1EIYB 1NUCA 5IP9G 2E2JB 1PHTA 2Z9HA 1QCFA 2YLCA 4FP5D 1STHA 4G57A 3HOUH 2M0YA 3ZFJA 5CGKA 4H44C 1KC8R 1PYBA 1K8GA 4CDEC 3HOXB 3SB2A 4P75A 1W2BP 2QEXT 3M5AA 3FB9A 1LOJA 4HAEA 3D7SB 1Y1VG 1X6GA 4RKLA 3VA5A 2XU8A 3DXJC 5E7NA 5KRUA 4G4KA 4A54A 2HKQB 2JA6B 5K36H 1IZ6A 4FM4B 4F17A 4P2CB 2A37A 4BY7B 1I0CA 1MSGA 3UDFA 4L63B 4YY3L 3OBYA 1N8RC 1X65A 4G7ZC 4LFAL 4A3GH 3TEEA 1K73R 2KE9A 3BU2A 2JA8G 2D2CC 2RJCA 2E65A 4E7KA 1PNJA 1QVFP 1D7QA 3OQ5A 5D6WA 4DXGA 3ULRB 4ZUIA 2KCTA 1BCPF 5LL6X 1WTQA 4OO1I 1RADB 2JXMB 1JXOA 1XPOA 2K05A 2E1HA 1SEBD 1HQRD 4P74A 4DV0Q 2QA4Q 2RF0A 2ZPFB 4A53A 2NTTA 1WHLA 4R4OA 1OZ3A 2MUYA 4FYVB 3NEMA 1WVLA 1JBMA 1UEBA 4JS4A 3S1RB 1VYUA 4N4GA 1OV3A 1KRTA 3IAYA 5C3WA 1ENFA 3PVLA 1H92A 4CHTB 1H641 4A3FB 1ARKA 1L1OB 4KJOA 1K9AA 4L5QA 2EPDA 2WIIB 3PCOB 4M7AB 5D3DA 1ZQ1A 2RCFA 1FGBD 1SPKA 2V1CC 4XXEA 1BIBA 4XTYA 3PUZA 3QR8A 1NG2A 1Q46A 4C92B 3KYHC 2F0DA 2DLPA 2PQWA 5DM73 3P8DA 3DKMA 2M9UA 1M1GA 1Q1EA 2ZPBB 3JCMe 1SYGA 4JOIC 4MN3A 4NXMQ 3OYJA 1C9OA 2DVJA 1PG5B 3GTQH 4CGYB 2RPNA 4KGZB 3VKIA 5GAN4 3KXTA 3CCUA 3P8HA 5FLXL 4KKSA 4YWKA 2P0PA 4A3EB 1V1CA 4ANJA 1F9SA 3PGZA 1A63A 1LM0A 1RF2D 3C4SA 4O1NA 1A8VA 5EBCA 2VYTA 2DMOA 8AT1B 3CCJQ 2DY8A 4J15A 3PF4A 3S2HH 4F8MA 4FW2A 3REAB 1IW7D 2EOTA 3ULPA 4K0KQ 1NY4A 1RCVD 2X9HA 4A3CG 1W2BA 2DIQA 1WQWA 4EMKA 3HRSA 4J9IA 1DJ7B 3NK9A 2CYZB 1D0YA 3HOXG 1I4K1 1H9RA 2HCKA 3LYIA 1VCIA 1V43A 1YNXA 2XDBA 1SN8A 4E7HA 3S6WA 1E6GA 2E64A 3QWYA 3OW2A 2QAZA 1N9WA 2AQ3B 8ATCB 3QOJA 3TREA 5IIFA 4BY6C 1YHQA 5IWAQ 1B50A 2JA6G 2DM1A 3RKWA 1A0IA 4RG8A 1H8KA 4Z88A 1SE3A 1FMVA 3CC4T 5GQOA 4CKBA 5IGDA 4YHHL 1DOLA 1QVFA 1FR3A 1L0XB 1U0LA 1UUPA 1VQDA 2J0TD 1R8OB 3FKIB 3I4MB 1A6XA 2GA4B 1E3PA 2BE5D 2UXCL 4DN4M 1B44D 3HP3A 3HKZB 3M4OH 1QP3A 1WA7A 3OIQA 5IP9H 3GNFB 5FROA 4DAYB 2VUMB 2VASA 2BDNA 1QB5D 3N52A 1YJWA 1N34Q 4B3RL 1GCQC 3RZOB 3NBHA 4FNFA 1EOVA 4R4QA 1OXSC 5FRMA 5DM63 2VL6A 3MHBA 4UP8A 1F77A 1D1AA 1M1KC 3GTGB 5IGEA 4E7LA 1YCSB 1W70A 2HQXA 2LT4A 3CPWS 2DYBA 2L12A 3F8TA 5KEEA 2RI3A 2NUPA 3F70A 5A2QE 2OAUA 3SE0A 3I4NB 5LL6S 1BOSA 1JOOA 3WOEA 4LWCA 4A3FG 2RHIA 4A3IB 1U5SA 3QKJA 5GAN8 3CCUQ 1IKLA 4KY7A 2MF2A 4DR7Q 1MIUA 3S1NH 1WTPA 4M7AG 1GHJA 4J9DA 2A5HA 4PG3A 1MMAA 2QF7A 2F0MA 1K0SA 2K5IA 2EYJA 2NVTB 4C92G 2QEXA 1G2BA 5L23A 4C8QD 4XK8E 5D14A 1KC8C 5GAN2 4LD6A 4BE2A 2JA5B 4PNYA 3AT1B 2B2WC 1KSWA 2C06A 2DRMA 4C8QF 3OTOL 1QKWA 4BI4A 4DEYA 1O80A 3CCVQ 1AVZC 1WGSA 2F5KA 1TOVA 3PE0A 3UA7A 1BBZA 3TSWA 2K52A 2DVEA 4A4HA 3OYKA 1A0NB 4A3EG 3BY7A 4NOYA 3JV3A 2E3HA 1Q82R 4XU2A 2ZTDA 3LX0A 2HHHQ 3HOZH 2A69C 4DR6L 3I73A 3OOCA 2J6KA 5C0XJ 4KGXB 1YHQQ 1LUZA 2BTTA 1YEZA 2ZT9C 1HTLD 3J7YW 2RM4A 1TSFA 4Z02A 2RB6A 4P5NA 1B7YB 2OXPA 1K73C 4ALPA 1WTXA 3KK7A 4N4IA 1GCPA 3EG9A 2NWMA 3OBWA 4RG1A 1I4PA 1E2VA 3OYMA 3A7AB 1U1SA 4XTZA 5C4JB 4HJ9A 1MMGA 4F88A 5C44B 2G3RA 4A3JB 5EKLA 4PLLA 5IYCG 1SHGA 4KUDK 1B3AA 5I6WA 1BXTA 3EGDB 3F2UA 3JCMV 4PJOF 1YJWQ 3TP5A 4EQOA 1GFCA 3I8ZA 4L5RC 1H9JA 4KI0A 4JI8L 2AKKA 4L6TB 5KGUA 1V1PB 4ZRZA 2R93B 2F0EA 1KG1A 3I2ZA 4X1VA 5C44G 1IBML 3OYCA 4X66Q 3I4MG 3FKIG 3HTRA 1I4QA 1KL9A 2JUFA 4JLGA 1TXQA 2PMZB 3HKZG 3MXNB 5LMNW 5JEAG 4PLIA 1M30A 3VUZA 4JRQA 1FD7D 2D62A 2E2JH 4A3BB 2VUMG 3TRZA 2LQ8A 4Y28E 4C8QE 1J9OA 3NXWA 4A3CH 2FYKA 2ZPIB 4DUYQ 3ME9A 1RJTA 4HCEA 2EY6A 2GCXA 2SNMA 5M5YB 5GAOq 4KUIA 2BZXA 2L0CA 4GKKL 4BE0A 2K5LA 2QEXQ 4KD3A 3SK4A 4L5SA 4DR2L 4QQGA 3EG0A 1EY9A 1DM0B 1E2WA 3I4NG 5AFWA 3KJOA 2DD4A 1TG0A 2HKNA 2LQNA 5CCAA 4A3IG 4DQ2A 3OPOA 5C4HA 4BY7H 3PTAA 1X9NA 2JW4A 4CC2A 4J9FA 4RKUE 1BQQT 5CV8A 1JORA 4DF7A 3BDUA 2K5VA 1CA5A 1PVOA 1HK9A 4EQNA 4JI6L 2YUQA 4PJOE 2EYHA 1VQ8T 3RR6A 3ERQA 3EFRA 2B2YC 4RGTA 1UB4A 4B08A 2JA5G 1I4RA 4BY7G 5LJ5g 3S1QH 1JC7A 4AFQC 2XNAC 4J1MA 4PQXA 2AT1B 2P0KA 1PYWD 1V29B 3CC4A 2FJ2A 2AHOB 1IL8A 2EYFA 2KOLA 3W1BA 1Q86C 1U5KA 3META 2L2PA 2YRDA 2GGRA 4GN4B 1AZGB 3SR1A 3FDRA 1K76A 3JCMg 4IN3A 4C3IH 3H41A 4BUGA 1UDLA 2K3YA 2X35A 2F3VA 1VQ5T 4K11A 3S14H 2BUDA 2GBQA 1RAHB 1BKBA 3RMHA 1ASYA 3BDLA 3IQLA 2Z6BA 4YWLA 3OMCA 4QVZA 1YP5A 2VXEA 5FW9A 4AYBB 1XJVA 2F0GA 4PJJA 3AU7A 3SFMA 3PV0A 5FU7C 2F0WA 3L9AX 3LGLA 1R0CB 2G9DA 4A3JG 2JS2A 2A19A 3MP8A 3DWQA 1EFNA 3OS5A 4IUVA 1IW7C 3C46A 3GTQB 3I5RA 3KFUA 1M3BA 1QZGA 4K5VA 4M1UB 4F87A 3Q22A 4CJ0B 3LW5E 2FRWA 2Y4XA 3Q0AA 2R93G 3VYUA 2PNIA 4PMCA 2AZSA 5GADC 2LX7A 4JI0Q 2RDGA 3QYHB 1M8AA 4DV5Q 4OMPA 1QVGP 2RJEA 2V1RA 2Z0SA 4GOPA 1NM7A 4QKUA 2B2VC 4CRIA 2BOSA 3GTJB 3JAMi 1M3AA 1Z9QA 2K5WA 4A3BG 1SF9A 1H9SB 1HUNA 1UECA 4DR5L 1LT3D 4DV6L 1Y8PB 2ICEC 2LNVA 3GTMH 1D1IA 1S5FD 2NVQB 1EX4A 2JS0A 3IKJA 5BN5A 2BE5C 2A36A 2RHQB 2XHCA 4ZTJA 2K75A 2EJGA 1WFWA 4ZGJB 2RDFA 4ZCKA 4M75B 2DETA 4GLKA 1RIPA 4BWGB 2B86A 5IYCH 3HRUA 4M78C 1A2UA 5D6XA 1MI2A 2DE0X 2FINB 5IHNA 1Q82C 1G3YA 5EG2A 1JJCB 4J9CA 4MZMA 3S16B 3CC4Q 3TN2A 4Y7NB 4JC0A 1WJQA 3INZA 3EN2A 2L4NA 5JVG3 2VNUD 1Q95G 3HFNA 1N27A 3VUBA 1MHNA 3AFPA 1EFWA 2KXDA 3SD4A 1H3HA 2LMCB 1WHGA 1UGQB 3GOXA 3BYTB 4DK0A 3QZ5B 2NZOA 5JEAH 2IVWA 1NTGA 1IYVA 3JCMW 1BBWA 1WCMB 2LMJA 2K04A 2RQWA 4X3UA 5EPJA 1JXMA 2E5QA 3RMSA 1HTPA 2LS01 3BZCA 2GVAA 2DD5A 1KAAA 2O4XA 5DNFA 4GNXC 2IPOB 4XQQA 2OJ2A 4B3MQ 5GANe 3CCST 1QQJA 3I35A 1SMYD 4P73A 1X6OA 4PJLA 2DX1A 3I5SA 1UE5A 2J7ZA 2JMAA 1PRLC 1BB9A 1YCYA 1ACMB 2C35B 2Z1CA 2DL4A 1HSQA 4DFAA 1XNQL 3FHWA 1I6HB 2K4KA 3QHSA 3EG3A 4DK6C 2J06A 1PTOH 4JI3L 5GAHC 4AYBG 2E70A 2RDHA 2YRCA 3TSSA 1CKNA 2NZHA 2NVTH 2NTSA 1IHVA 5EKKA 2VUBA 1O78A 4IKFA 1KQ2A 4IURA 3GP8A 1QVGA 4M7AD 2BA0A 3R3OA 4LNQA 3T53B 1KABA 2K6DA 1VS0A 4OGCA 4H7BA 1X54A 1C7YA 4JK1C 1UE6A 3CEYA 2V8KA 3CCQT 2FRYA 4FCYA 4A3DB 2H8HA 1B34A 1AEXA 4C92D 1VQNT 1NR4A 5ECAA 1WNLA 2XRQD 1OX8A 2JZ2A 4AQYQ 3J81j 4RHSA 1TQOA 2K28A 1PSEA 1AWWA 2O5JC 4B3TL 5CVIA 1QCOA 5H1SE 4OVAA 1OPKA 4GKJL 2IX3A 3HKSA 2CZ0B 2ZPGB 1KD1U 4CC7A 3EG2A 3IFTA 4JI5Q 5GAN5 4M75G 5CIUA 3T1YQ 1QOHA 3I4OA 5KYNA 2RA4A 2JOYA 1ZHIA 4J9GA 2DK3A 1XJWB 3GDEA 2CUDA 5LJ3e 2E75C 2DTHA 1EYAA 1VQ5A 1SNQA 2OEOA 4JI4L 2YRVA 1U8RA 2UXBQ 1K83B 3GTKH 2Q2TA 4LF5Q 2CVRA 4XT1B 5IHKA 3E9HA 2JN0A 1G5VA 5M5WH 4LF8L 2F0QA 5FLMH 3JCMJ 1WCMG 3ER0A 3TQ7P 4ZN3A 2D6FA 2EGCA 1SDFA 3NBIA 3OB9A 1LACA 1J5EL 3CD6T 1M4VA 2IJ0A 4M7DD 2A74C 2B39A 3UF4A 1MUZA 1EFID 3E0EA 1G3SA 2UU9Q 3F1ZA 4NL2A 4DR4L 1K4US 4S3SA 4M7DF 3OWFA 4LF4Q 2RK2A 4DA4A 1BBXC 1YZ6A 3HOUB 4BI3A 4GY5A 1JRIA 3T1HQ 3CPWA 1Y14B 2KRMA 2PQEA 2JVVA 5GAOn 4C1NI 5ELFA 2RQVA 1LV9A 1PLFA 4OWWB 1X3EA 5C5MA 1JT8A 4GBQA 4M78B 3T51B 1RUWA 4JRKA 1SNOA 3QWNA 4AFUC 1HZAA 1QE6A 2K1BA 4KN4C 1AP0A 5GMKh 2H3EB 2KAFA 1EU4A 1JJ2P 2SNSA 3K81C 3PF5A 3OYBA 1QWYA 3NFCA 4CC4B 2E5KA 2UUAL 1MV3A 2WSFE 1T5EA 2K5QA 1VQEA 4E7IA 1JOKA 3CW2C 1RL2A 2GFUA 4K2KA 4K2LA 4A3GB 2Z6KC 4TVRA 4DGZA 4P71A 3OSVA 4WJ4A 2NYSA 2QTXA 1IXDA 4BD3A 2B2UA 1K8AU 4A3DG 1F2YA 1B3QA 1PZKD 1STBA 2JEBI 2QDYB 2DL3A 2VB6A 2DJFC 3HRZC 3EAEA 1OX9A 2H4OA 4LXCA 4U68A 2D8HA 5EPKA 2L15A 5FWBA 1VQ5Q 3GD7A 3HEJA 3BS1A 5J39A 5DAUA 2R5AA 4F04B 2FPDA 1LTGD 3A54A 2F03A 3NBHB 3K58A 1KDAA 1IREB 4RG2A 3CRKC 4O42A 4LUOA 1VQPA 1SE4A 3K7AB 1N36L 3CCSA 4M7DE 4DR3L 1YHAA 4RMOA 3VS7A 4EMHA 2EXZA 1SG5A 4AT1B 3CQZH 2F0UA 3QJ6A 1T0JA 4OB2B 3ASKA 1WTHA 2NUPB 3HKZE 4KN7C 3QSUA 3CXCP 1G2TA 4JI2Q 1SRLA 1HA5A 1P92A 4LNPA 3OY9A 3FDTA 2DAQA 4B9WA 3AFQA 4A4GA 4I7ZC 2RO0A 3C12A 1P16A 5KYYA 2ZM6Q 2CCZA 2CP3A 4XT3B 1A62A 5KCOA 2A6EC 4J7IA 3VS3A 5GAN7 4J8OA 3EGUA 1JB0E 1W1FA 2EQMA 3W2DA 3EFOA 4JV5Q 3KDFA 1TWGH 2VS1A 2ZZDA 4OIJA 3S2DB 1E1OA 1TXYA 5KYUA 3UA6A 3A5ZB 1UGVA 5I9PA 2KRNA 2X4YA 4FF3A 1JWSD 1EU3A 2EQIA 2FMMA 4TRDA 3S2HB 3EIVA 4CKCA 4J83A 3CCQA 4LUDA 2OQ0A 5GMKi 3VA7A 3M7NA 5GAMd 1VQNA 3P7JA 4R9WA 1EQTA 2JEAI 3HOUG 4MNOA 4WJWA 2N49A 5LJ5h 1VQMT 4XTUA 4G7OC 2HEQA 1ZBXA 5J1ZA 3CBPA 2PQAA 5JJIA 4LE9A 2XD0A
chains in the Genus database with same CATH topology
2JQOA 2KK4A 3CMET 4LF7Q 2K4YA 4M78G 5J3BA 3F2DA 4UC4A 3JCMh 4HCZA 3OYEA 3RLOA 5C3EH 4N4HA 1E7ZA 2L89A 3I56A 4A3GG 4HCCA 2EXDA 3S3NA 4OB0B 2H5XA 1G291 4ME3A 4DV0L 4MMLA 4PNOA 1PV4A 2LRQA 4HIDA 3W1GA 4MMKA 2O01E 3BFMA 1YHBA 4ZGDB 4M7AC 5DLQE 2GN5A 4R56A 4C0FA 1RI0A 3FRNA 3CD6A 4C92C 2RK1A 1X56A 2LDMA 2MMPA 3WVDB 3WWVA 2PMZE 1KHIA 2OCEA 4NXML 3M53A 3CCLT 3KF6B 1M4ZA 4C5IA 3OA6A 5IY0A 1CKOA 5LJ3g 1I3QH 3RMQA 4C3HH 1KQSS 4MDXA 2EKOA 3I55T 3EFSA 2PNHA 1JB7A 4K0KL 4JBJA 5JEAJ 2XG8D 3MP6A 4FU6A 4R4TA 1EWIA 3QBYA 1PH5A 3QIIA 4RCCA 1OXVA 3JSCA 4DV4Q 2NVXH 5CO7A 4PMWA 3L2UA 5IWAL 5BR8Q 4YTLA 1OXUA 1OXTA 4M75D 1HR0W 1Q1BA 1I50H 4UY8C 3RUXA 2GFAA 4X62Q 4AQYQ 1Q8KA 4UPAA 5GAGC 1N34L 2QI2A 1HZCA 3LGFA 1D8LA 2IHFA 1O7IA 4II1A 2KBNA 4AYBE 4QW2A 1VQ6A 4GOPB 4O6JA 3HL8A 2E8GA 2EJ9A 1Q7YU 3T9NA 2KY9A 5DLOA 1PFSA 4Y52H 3LGJA 2XTIA 3CP0A 1Y7XA 4DR7L 5LMUQ 2Y0SG 2BH2A 4C3JH 3Q8DA 4A3KH 1IBLQ 5CQYA 1VQMA 4DUZQ 4IPGA 4LW1A 1BVSA 3RKXA 4CI0C 1CKMA 1XMQQ 3FEOA 1HNZQ 3CMEA 3NTHA 1UE1A 3MEVA 2DGYA 3SGIA 2HHHL 4JYAL 1VIEA 3E9IA 1IBKQ 2JTMA 2VQFQ 5GAMg 3JB9H 3HOZG 4YCVA 1VQ7A 2O4XB 1OZ2A 3GLXA 3K7AH 4Q5WA 2RHYA 3S24A 4QY7A 4J6WA 3L7ZC 2WB1G 2RHZA 2RH2A 2AHJB 1SSFA 5M5XH 4LFCQ 3AEVA 1YJ9T 1WFQA 2R6GA 2YTYA 4HJ7A 3C94A 3GTOH 1CKNB 4X66L 3F2BA 4IOAA 4DV7Q 1N9SA 1TWFH 3S2DH 4JDSA 5LJ5d 2JJQA 1FJGQ 4ZGEB 2OTJT 1GO3E 2ALYB 3CCLA 3JAMc 4DUYL 3J7ZC 4M77C 1B34B 4JJNK 1M90U 4IFDG 4XU1A 3JCMd 1KIXA 2EJFA 3W5OA 1J6QA 3S15H 3CF5A 4DOWA 1SE8A 2HIVA 3OYIA 3A8LB 3STBD 2HIXA 1VQGA 4YWMA 3M54A 3MEFA 3ZBDA 3K0XA 1XOVA 2ZPEB 4ME7A 4M78D 2EFIA 2Y90A 2K14A 1HNXQ 2CFMA 4M78F 4BA1I 4MDWA 5ELNA 2EYQA 1Y71A 4JBWA 5GAOl 1YIJT 2F69A 1YITT 4BBRH 2E5LQ 1Q81U 1QVCA 4GN5A 1MJCA 3F2CA 4BXXH 3LWIA 4A75A 2R92H 2PVGB 4C8QA 1PH1A 4IUQA 4F7UF 3M4PA 3ICEA 4JI0L 4DV5L 5LJ5j 5CKDA 5CKFA 4EPCA 3M57A 4M75C 2YYZA 2DXBA 1QVPA 2VY3A 1SRUA 4M78E 3DLMA 3DLLA 5IYDH 1MGQA 3V7RA 4DV3Q 4C2MH 4PJOA 4A3MH 4QQ6A 4L6V5 3D0FA 3TS0A 1H95A 4TVAB 2GF7A 3VYGA 4XTWA 2OQKA 5LMNQ 1FL0A 4C0DC 4XAXB 5DM7R 3HPWA 3I7FA 3QYGB 4E7JA 3QUIA 5AJ3Q 3L1AA 1XMOQ 1U1TA 1YJ9A 2WACA 4F7UE 4LDVA 3M3YH 2K3XA 1VQ4T 1NJIC 4B3ML 2WAQG 3VU3C 3TU4K 1UGSB 2CGHA 3RKYA 2CS7A 2XDDA 4EX5A 3AYHB 4C5EA 3KDFB 5I21A 5FLXE 4IJLA 2QQ9A 4IJHA 4XTVA 4M77B 1B70B 2HQLA 5LJ3h 2NN6I 4APVA 3UE0A 3K80C 2Q2HA 1HJPA 3SWNA 4XIGS 2F4VQ 2PQAB 2QGQA 3M58A 3HP9A 2YU9H 5GAMf 3KF8B 2KDSA 2QQBA 3DM3A 1JJ2S 4FSXA 4EDUA 3M4GA 1L0WA 1WJJA 3QXEB 4XTCS 1EYGA 4PL6A 1TWHH 4LFBQ 3CBMA 3M9QA 4DV1Q 4UP9A 2LCCA 2AWNA 4QGUA 4JI5L 3T1YL 4A4KA 1N6AA 1VQOT 3UE1A 3H3VH 1YIJA 1W3SA 4OWXB 2UXBL 4LF5L 4ZN1A 4X9DA 2RA2A 3LWHA 1V9PA 1VQKT 4H02A 2MO1A 1T9HA 3VDYA 2DZ9A 5GAEC 2PU9B 1OTCA 1HXDA 1OI1A 2X4JA 3QZ9B 5FLMG 2K57A 3WVEB 3STBC 1M1KU 2Y0SE 1Y96A 2UU9L 2A3LA 2E6NA 2K5HA 2I5MX 1R9TH 4LF4L 1VQIA 4NPSA 4EQ5A 5I2MA 2QQSA 3A8OB 5FLXc 1X3GA 3T1HL 3OYAA 5IE8A 1SROA 3G6ET 4M77G 1NMGA 1I94Q 3JB9J 2MNAA 1KC8U 2ES2A 5GAMh 4A4EA 1VQJA 2XKOC 1QUQB 3G71T 2Q2UA 3VV0A 4C0DB 3L2VA 2HBPA 4LDUA 1N32Q 3RR5A 5L8RE 2EQKA 2WB1E 1K9MU 1K73U 1AE3A 5GAOp 1KXLA 2NN6G 2P0QA 4JRPA 3H6ZA 3CAMA 3B6YA 2HAXA 4O2DA 3D31A 4DPGA 1VQ4A 5C4XH 3MEUA 4ELYC 4HKEA 1VQ9T 3CCMT 3HRTA 3KLWA 2R7FA 3RN5A 2X4XA 4JI2L 3PFSA 3QG1A 5GANd 1L1OA 4M7AA 1AH9A 5KCHA 2ZM6L 5D6YA 3CCET 4Y91A 4GLAC 2E12A 3HFOA 4M7AF 4XU3A 3V7SA 4JV5L 3CC7T 4X9CA 4OGEA 2K5FA 4C92F 1VQ8A 4DAMA 1Y1WH 1VQAA 2CZ6B 1FGUA 3BW1A 3M55A 4DR2Q 3JCMc 3FLGA 2DXUA 4R4IA 4EMGA 3KUFA 2E10A 1S72T 4GN3B 4LF7L 3OYGA 2E2IH 2UUBQ 1UGRB 1SMXA 1Q86U 4BA2I 3HFZB 5C3EG 2K2VA 3FC3A 4X64Q 4M7DA 2QQRA 3DB3A 2XDPA 5LJ3d 1LTLA 4M7AE 3J7A5 1LJOA 1Y07A 1M5Q1 4XQ3A 3L0OA 4DV2Q 2EQJA 2BIVA 4C92E 4KULA 2HNIA 2JA7G 2XGTA 2EWNA 1EQQA 4EMKB 5LJ5f 3JB9I 2EQSA 2R58A 1W2BS 2CWAA 4POFA 3V8KA 3PO2H 1YBYA 1O9SA 2MAMA 5KE3A 2N3SA 2LVMA 4A3LG 3JCMf 2RD1A 3OW2S 3GTLH 1KAWA 1L2FA 1UGPB 4IPDA 3UDXA 4KHPQ 1S40A 4J6XA 3G71A 1QVFS 1XNRQ 4BB7A 2MI6A 4LF6Q 3NENA 2HD0A 4JI1Q 5FJ8H 2M16A 4B3SQ 1Q82U 4DV4L 3X26B 2DEQA 2R7DA 3LLRA 4HCBA 3TEHB 4IFDJ 2FB7A 5BR8L 2CKZB 4BACA 1JMCA 3J80i 3HOWH 3CPFA 2LSSA 1G6PA 4LDYA 3L2WA 1VQ9A 3LX7A 3CCMA 1D3BA 2E2HH 4X62L 4AQYL 2IX0A 4O5VA 4GOPC 4X65Q 4LF9Q 1GM5A 3X24B 4DK3C 3CCEA 2A1AA 5JJLA 2BKDN 4IUPA 2DJZA 4JOIA 3S1MH 4L5TA 2HQEA 3CC7A 3M85A 5LMUL 3DB4A 3L2ZA 4OP0A 2DUDA 3A74A 5GMKm 5GANg 3S3MA 2UXDQ 2NLUA 1PSFA 1X3FA 4PJOB 4XTXA 1IBLL 2RF4A 4DUZL 1TWCH 3CCJT 4M77D 3VJPA 3X25B 1FVIA 3UWNA 4A3KG 4HA8A 3UDGA 1XMQL 1S72A 4M77F 3GIBA 1HNZL 2IG0A 4DR1Q 3RZDH 3OS2A 1IBKL 2AWOA 2VQFL 3RLNA 2JA7H 1NE8A 2OWOA 3PUYA 3JB9G 2KQWA 1Q12A 3HOVH 3A8MB 1I81A 2PUOB 1WJSA 1IL2A 4LFCL 1J5EQ 4OONA 1OYXA 4A3LH 3EBEA 3CMAT 3ULJA 2RI2A 4DV7L 3CCRT 3CC2T 2CKKA 3OYLA 4JCVE 2YTVA 1FJGL 3OYYA 3HOYH 4NS5A 3OYHA 5M9OA 4A76A 4PZ7A 4M77E 5GAMj 3PO3G 3CCUT 2EAYA 1EIFA 2M1HA 5HKCA 1BI1A 1PH8A 4J5YA 1HR0Q 1CSQA 3GTPH 2PVOB 4C0ZA 5CKHA 4IFDI 5IAYA 1W4SA 3OYFA 4FL6A 4OX9Q 3CCVT 3ZJYC 3LH0A 4PJOG 2ZPHB 1YI2T 4M75F 1YHQT 4WJ3M 3U58A 1IYJB 1N36Q 1HNXL 4HJAA 2MO0A 1CUKA 4KBMB 1M1FA 1EUJA