1K73R

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2001-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1k73R00
1M1KR 1VQ5Q 1VQ9Q 1K8AR 1VQMQ 1Q86R 1VQ8Q 1YITQ 1VQ4Q 1VQKQ 3CCLQ 3CCJQ 1Q82R 1VQLQ 3CC2Q 3CPWP 1Q81R 1YHQQ 1Q7YR 1YI2Q 1KD1R 1YJNQ 3CCQQ 1YJWQ 1M90R 1VQ7Q 3CXCP 3CMEQ 3CCMQ 1NJIR 3CCEQ 3CC7Q 1N8RR 3CMAQ 1W2BP 1YJ9Q 1JJ2P 3G71Q 3I55Q 3CC4Q 1KC8R 1K9MR 1KQSP 3I56Q 1VQOQ 3CCUQ 1QVFP 1VQ6Q 1K73R 2OTJQ 3CCSQ 3CCVQ 3OW2P 2OTLQ 3CD6Q 3G6EQ 2QA4Q 1S72Q 1VQPQ 3G4SQ 2QEXQ 1YIJQ 1QVGP 3CCRQ 1VQNQ
chains in the Genus database with same CATH superfamily
5LJ5f 3VU3C 2J6OA 4M77E 1YNZA 3E1SA 3J81E 4ZTFA 2DBKA 4R0KA 1K73U 4J83A 3UA7A 3PVLA 2EKHA 2QASA 2E3HA 3R6OA 1RADB 2JT4A 2JUFA 1VQ5T 3A8GB 1QCOA 3LLRA 5GAOq 3I5RA 2XHCA 4M7DE 1M1KR 1VQ5Q 2MWOA 3V8JA 1J3TA 4C0GA 1VQKQ 1H641 3TQ7P 2D6FA 2QXFA 4PFZA 1HXDA 2DFUA 3CMEQ 3KXTA 1LVKA 3TVTA 4BI4A 3OYAA 3I55Q 4QVZA 1OYXA 2L8DA 3DB4A 4E7HA 3SDZA 1H8KA 3C95A 5GAN6 5I2MA 4PFPA 4F14A 3L42A 2LJ1A 1HJDA 1N5ZA 3JSCA 4PJNA 1N9RA 1U1SA 2EJFA 3LH5A 1RACB 2KR3A 1U3OA 4OB0B 2VV5A 4IIOA 3G6EA 3EG1A 1PSEA 4C0DB 1M27C 2ECZA 3DB3A 2KYMA 4L59A 1BI1A 3HRSA 4HCKA 3HTRA 3EFSA 1HK9A 2X4XA 4GY5A 2VVKA 2RK2A 1Y7XA 1Z9ZA 1PRLC 3I56T 5J26A 2LZ6B 1UE9A 4OF1A 3QXEB 4C8QF 2OTJQ 3QG1A 2DL8A 4EMHA 3UPUA 4F04B 1JRIA 4BI3A 4HT8A 2EWNA 3C0CA 1VQNQ 1EFNA 3CBMA 1SPKA 1PKTA 1M5Q1 1M3BA 2PVDB 3O5ZA 4IURA 2JOYA 1M3AA 2C0IA 2LJ0A 3JCMc 4BDYA 4J7IA 1R0BG 2AKKA 3V8KA 1ARKA 5CAIA 2K4YA 2CREA 2CZ0B 2KDSA 3H0FA 3CD6Q 4TVRA 4J7FA 4QW2A 4ZNXA 4D8KA 1IO6A 1Q81C 1WHGA 2GGRA 2EGAA 1P92A 3QPHA 1VQ7T 4BACA 1I1JA 3AT1B 4OVAA 3J7AF 4M7AA 2RHXA 3OS1A 1D3BA 4N0AA 4A4HA 2WSEE 2XU8A 1NZ9A 1WFWA 4X1VA 3PIPA 1OZ3A 1IZ6A 2RH2A 1R77A 2NUTA 2Y4YA 2YRCA 1QKXA 4RG2A 2XDDA 3JB9D 1PD1A 4ZN3A 1YFNA 3MEWA 5IHIA 3CCMT 2KT8A 4OMQA 3EFOB 4JZ4A 3G71T 2P4RA 2XIDA 2CZ1B 2EYZA 1WGSA 3G71Q 5IAYA 2DL3A 1KHCA 2EYWA 3CC4Q 1JEGA 1I5OB 3REAB 3CCRT 5KE3A 1CSKA 2JTFA 3CCRQ 3DLMA 2L89A 2X3XD 1YJWT 1TWBA 1CKAA 2KAFA 3CCLA 1RAGB 3I5SA 2ZPHB 1YJWQ 1O9SA 2F2VA 2QQBA 1QMCA 2NLUA 2IG0A 3GLXA 1QW1A 3ZEHA 2LJ3A 2R57A 3CCUQ 1ZUUA 3A8LB 3UT1A 4WF2A 1K8AC 2J06A 2X51A 3QWYA 2ZPIB 4B9XA 3ULRB 2DYBA 3CXCS 4Z02A 2RI2A 1MMDA 2KBTA 1Q7YC 2DTOA 4B9WA 4XU1A 4QT7A 4C8QA 3UF4A 1VQ8A 2AZSA 2GFUA 1SHGA 2KEAA 4FCYA 1YHQA 1K73C 1NJIR 4A4EA 3SWNC 4D6WA 2A37A 3TSWA 2EQMA 5A0GA 1NBEB 1MMGA 5CKDA 1VQ9T 1UB4A 3FRNA 1JBMA 5GANf 1AT1B 3A98A 1VQ9Q 2CKKA 2QQRA 2GCXA 1NLOC 5ECAA 2XMFA 3CCJQ 1Y07A 4QQGA 1SRMA 3OYDA 5CVIA 5KH6A 3M9QA 1YJ9T 1H3ZA 2O2OA 3JB9G 3VUBA 1G8XA 3JB9J 4C92B 4DBHA 4HVUA 4ZGEB 5CKFA 1OQKA 1T3LA 5I11A 4M78F 4RTTA 4M7AE 2GFAA 3I35A 4MZMA 2HKQB 2JTEA 1YJNQ 1WYXA 2DKGA 3CC7A 3HPWA 4PK4A 4AFQC 3OMGA 1Y71A 5FRMA 1UHCA 3RERA 3HRTA 3EHQA 5AYFA 1I4K1 3H8ZA 1SG5A 1T0JA 5LJ3f 4KULA 2LQKA 5GAN8 3M0QA 2KI7A 3S3MA 3JCMg 3CC2Q 4XTYA 2EYQA 2E10A 2DA9A 3LX7A 1X43A 4PJLA 1WX6A 4DOWA 3OYGA 1FWZA 1M2VB 4OGEA 4E6RA 2C0OA 5CKEA 2A7YA 2FPDA 4L5GA 4ZGDB 4PJOA 2KSSA 3CXCA 3JCMe 1M90U 1BIBA 5GAOn 2FHDA 1UHFA 1IHVA 2VKNA 2NUPA 1VQLQ 2PVOB 1D1CA 1SRLA 2DK3A 1Y96B 2COYA 1WIEA 1WXBA 3QUIA 3L2RA 2RK1A 3EH2A 3A1PA 1W70A 4KH0B 1RI0A 4C8QE 5IN1A 4NOYA 5LJ5g 2GTOA 1PKSA 4DEXA 5FRNA 2XKOC 4MZPA 3JCMX 4PJJA 2VXFA 2CDTA 1WA7A 4FT2A 2L3PA 4C92D 3M0PA 3PGGA 5LJ5e 3TREA 1N6AA 1R8OB 3X26B 1HYOA 3UWNA 2EGCA 3QKJA 2EQIA 4M78A 1D1AA 2DL7A 3CMAA 2OI3A 2CP0A 2RNAA 3X20B 3FB9A 2XDPA 2FL7A 2YDLA 5KCOA 1Y57A 2LNHB 4FW2A 1I8FA 4PLIA 1TUGB 1SKUB 5A0LA 2E41A 1AOJA 2LQWA 2A08A 4CC7A 3RNJA 1UGPB 2GF7A 3H6ZA 2L3QA 4RG8A 2DX1A 3OS5A 2R58A 1ZBJA 4XTZA 1YIJT 2BZYA 2EIFA 3EGDA 5FU6B 2QA4A 2V26A 1U5SA 1M8VA 2HZYA 2DTHA 1GBQA 5M9OA 3G7ZA 2HNIA 4HA8A 4LDXA 4CI0C 3H0IA 4XAXB 2E4HA 4BE2A 2K3BA 2RQTA 3OYMA 2ATCB 1PCXA 1SSHA 3EG3A 3X28B 2KXCA 2C0TA 2DMOA 4PJOE 2JNGA 2KNBB 1QP2A 3TCJA 3X25B 1UJ0A 4RKUE 1OU9A 2A36A 1NYGA 4XU0A 2CZ7B 2WSFE 2KROA 3CXCP 4C92G 4LDVA 1UECA 2GQIA 5KYWA 4OMFB 1NG2A 5GMKl 1SF9A 3BDLA 3QDFA 3A8MB 2CS7A 4MDWA 1Q81U 3QSUA 1AVZC 4XTWA 1K9MC 3L2ZA 2DXCA 3M55A 4HCZA 1UG1A 1UUEA 1VIFA 1N8RR 3FIFA 4KRTA 4J6YA 3HKSA 3QIIA 2LC4A 2JZ2A 1VQOQ 3M0RA 4JRIA 2DXUA 9ATCB 4V2SA 4C0ZA 2DVJA 1B34B 3S3NA 5GANh 1PG5B 5D6YA 3NPFA 4JJNK 4C5GA 1YITQ 4D8DA 3CCQT 1D0YA 1YI2T 3U23A 2D8HA 4M78E 1VQ4A 1G3TA 1I07A 2A0FB 5D6WA 3CCQQ 5DM7R 2CYZB 1WI7A 4OB3B 4M77B 3I56A 1VQPT 1ABQA 2IIMA 1Q82C 2VWFA 2YRDA 3L2WA 1PHTA 4B6MA 2DEQA 1AWJA 2K9GA 4GLMA 1KD1C 2J6FA 1TTHB 1KQSS 1M9SA 2VC8A 3VRYA 5LJ5j 1BBZA 4F7UF 2OX7A 2J7IA 4BI8B 4M7DB 3EGXA 4QVDA 5I21A 5CCAA 3MP6A 2QDYB 4JUVA 6AT1B 1K8AU 4Z89A 2YRVA 2QEXQ 1GBRA 2MYSA 1Q86R 1Q7YU 4IUQA 1G83A 2KK4A 3H0HA 5AT1B 3LWHA 3CPWP 3M0SA 1F1BB 5C6SA 5GAMh 1LPLA 2L3SA 4OMLA 4ESRA 1VQ7A 1WNLA 2FPEA 1PSFA 4J9HA 4R56A 2HEQA 4O5VA 1W2BA 2KXDA 2HBWA 1C0MA 3SWNB 1T3SA 1GCPA 4M7AF 2ZCFB 3A5ZB 4EIKA 1VQKT 4JLIA 3VRZA 5CKHA 3PIOA 4XTUA 2X9HA 3CMET 2IVWA 2XD0A 2CUBA 3I55T 2BZ8A 1YP5A 1WJSA 3CBPA 2BTTA 3CCEA 3CCMA 4FSXA 2E5KA 4AT1B 4XU2A 1S72Q 1G3SA 1XOVA 4L6V5 2W10A 4FSSA 3EG0A 2VB6A 2ESWA 4RTXA 1IB8A 2RJDA 2QGFB 1KSWA 2BIVA 1GXIE 2WSCE 2JJ9A 5FU6C 4E47A 3NGPA 1FYNA 1AZGB 4FYYB 4Y91A 2EBPA 4LXCA 1VQMT 2BKDN 4M77D 4AMCA 1VQMQ 3RUXA 1PWTA 5KYYB 4WTOB 5KYNA 1XQHA 1KQSA 2G3RA 4J9BA 2MIOA 2B86A 2RHYA 2OTJT 1RAIB 3VS2A 1KC8R 4XTVA 3CCVQ 4E7SA 2P0KA 4J8OA 1VQNT 2KGTA 3MKDA 4M7DD 1QKWA 2FYKA 1CKBA 4F7UA 2JXBA 4RTYA 2LRQA 2DL5A 3ZBDA 3EG9A 1UGSB 4FYXB 2HCKA 4LDWA 1GFDA 1QP3A 3RR6A 3OYEA 2KE9A 2DPPB 1AWOA 2M9UA 2DD4A 4A4KA 4JJDA 4M75F 3CD6T 2RQVA 1YJ9A 2PTKA 1M1KC 2K5FA 3VS3A 2OJ2A 2ROLA 5GMKh 4XU3A 2X35A 3CEYA 4RUGA 3OMCA 2FB7A 5J3BA 1WJQA 3DKMA 1W4SA 1U1TA 8AT1B 1QWFA 3D7SB 1BU1A 3L2VA 2RQWA 4O6JA 1K73R 5GAOl 4KH1B 1NEBA 4IUUA 1W2BP 2HBPA 3EG2A 1ZHIA 2FG0A 3VKIA 1GL5A 2FRYA 4E2FB 4KGXB 4M77C 4YTLA 4QKUA 3CC4T 2R5AA 4M77G 4HKEA 3X24B 2ZAEA 3QBYA 3INZA 2DE0X 3QWXX 4E7ZA 4LN2A 2LP5A 4J6WA 2BZXA 3AHUA 4JZ3A 4EMKA 3QZ9B 3RMSA 1B07A 4M7DC 4AG2C 3VS0A 4M7DG 1I0CA 5GAN2 2RMOA 1TUCA 3CCUT 5CK9A 4PJOF 5GAOr 2DXTA 1AD5A 2RB6A 3M59A 2OAUA 3M0UA 3OY9A 4J9EA 2K57A 1PD0A 3LYIA 1N9SA 3HP9A 3RIRA 2K3YA 2K79A 2LT4A 5KYXA 1IHWA 3A8HB 1IRXA 1ZSGA 1BI0A 1T0HA 3GF5A 4HCBA 1KQSP 4X9DA 3BFMA 2EJ9A 2HAXA 2QQAA 4F7UE 3G6EQ 2DEUA 1D3BB 3FLGA 4HVVA 4FM4B 3CCJT 3HSBA 1UGRB 3NMZC 3MO8A 2RA2A 4M75A 5FU7B 3OYIA 3OBWA 2RQUA 2NUTB 4LDUA 2RHUA 3RKWA 2DJZA 1A0NB 1V76A 1BK2A 2K6DA 2EAYA 5GMKi 4OB1B 3UATA 3VS1A 2O01E 1NM7A 1X27A 2O9VA 4JJCA 1YJNT 4LDYA 2KYBA 3NHNA 5FWCA 1K9MU 2VGMA 5LJ3j 1QVGS 1UTIA 3TSZA 3FDRA 5IXFA 2OTLA 1IGQA 2EW3A 2DTIA 3CCSA 1ZSZA 4C5HA 4C0FA 4IUVA 3C12A 1YIJA 1JJ2S 1KQ1A 4DEYA 3CC2T 2HL5C 2L3RA 5I22A 2J05A 1E6GA 5KYUB 2Y4XA 3QJ6A 2XG8D 5GAMf 3HHTB 4C8QB 4ZTJA 2KMTA 4ORZA 5FWBA 4J9FA 1FMKA 1PRMC 1UFFA 4JDSA 3M5AA 3OS2A 1Q82U 4QVCA 2L5QA 1VQLT 1WXUA 4C92E 1NJIC 1KD1U 4DQ2A 1QVFS 5GJWB 4RCCA 4N4IA 1D0ZA 2M51A 3QJYA 3EHRA 1V1CA 3L2UA 1ZQ1A 1WDXA 2DILA 2DERA 1X01A 2X4YA 3P8BB 3MHXA 2RQRA 2V1QA 1JU5C 4M7AD 3CCLT 2MOXA 4OMMA 2JM9A 3QYGB 3CCLQ 1ZA1B 2HQXA 3CPFA 1G2BA 2I2LA 1X6GA 3V7CA 4EDUA 3KUFA 2FO0A 2V8IA 2GTJA 2VXEA 1D09B 4M75E 1RLQC 2QI2A 2DYIA 3BY7A 2D1XA 3L2QA 1OV3A 2K2VA 1QQJA 1VQ8Q 1N8RU 2DBMA 4A53A 2CT3A 1YHQQ 2OAWA 4DBQA 1YI2A 4EPCA 3PE0A 1QVGA 1K0XA 1X6OA 2KT1A 2VGNA 4JRKA 3A8OB 2ZZDA 1VQPA 2ED0A 3LGFA 1DJ7B 1OU8A 1X6BA 2LCSA 3NTHA 4A54A 3RESA 3LWIA 5HK3A 3JRZA 2H3JA 4MMKA 2QK0A 1UEBA 2NUPB 1VYUA 5D7UA 2CP3A 1VQ6A 1PC0A 4C8QD 1XTDA 2MAMA 2VUBA 4PNOA 3LH0A 3JB9F 2COWA 3VS7A 3S6WA 2FEIA 2CZ6B 4AG1C 1M8MA 5FROA 3SEMA 3VS4A 5GAN7 4J9IA 1QVFA 4M7AC 4M4ZA 1FXXA 3CC7Q 4M7AG 2MF2A 4KGVB 4ANJA 5D6XA 4N0AC 5I2SA 1VYVA 3EH1A 2W0ZA 4J6XA 1WJRA 1ACMB 5FU7C 3RBBB 2DD5A 3SD4A 1WLPB 1JXMA 1QVPA 1X75C 2PNIA 2RO0A 1VQ5A 1BB9A 2K7AA 2RHZA 1VQKA 5IT9E 2YUPA 1JB0E 1WHJA 4OMOA 1M90R 3V8LA 3CMEA 2RPNA 1MMAA 2ZPEB 3I55A 3GIBA 1M1KU 3N5BB 4M78B 2ENMA 4JPBW 1IREB 4QQ6A 2YWWA 4BD3A 4MZTA 4RTUA 4J9CA 4II1A 3GP8A 2RJFA 3GNFB 1VQOT 2CP5A 1RAAB 3ASKA 4E7LA 2K5IA 3OYYA 1W1FA 2QTVA 4X9CA 4BUGA 3M4GA 1YITT 4MMLA 2JS2A 4HCCA 3SHWA 4OB2B 4OMNA 4ELYC 1VQMA 4C8QC 4J9DA 3ZFJA 1KIKA 4DA4A 1NE8A 4C8QG 4JRQA 1GFCA 1PM3A 2L2PA 5EC7A 2A28A 1Z9QA 1I81A 3SWNA 1VOMA 1TG0A 2ZPBB 4PJOD 3PT9A 2F2WA 2OTJA 1X2QA 2X4JA 1UGVA 1QVGP 2DIGA 3EGUA 4R55A 1FMWA 1VQNA 3JCMW 2DF6A 3VYGA 2XI9A 5IHKA 3META 1BCMA 1WHMA 3OW2S 4F17A 2LCCA 1BYMA 1KK7A 2GQVA 3JCMP 1E6HA 1LNXA 3CMAQ 2DETA 1MGQA 1X2KA 5A0DA 2DM1A 2JMCA 4KGZB 2QYZA 4KT0E 2QEXT 4DOVA 5KCHA 3KFVA 3CD6A 4E7IA 5KYWB 2RN8A 3JCMQ 3C94A 5IH2A 3V7RA 3OA6A 4J9GA 3E2UA 4Z8AA 1B3QA 1FMVA 1SEMA 2P0QA 2YLCA 3MJXA 1YWPA 3DLLA 4N4HA 3VUZA 2I0NA 3OYFA 3VS6A 1XNIA 4BY6B 1AEYA 1QVFP 1K9AA 2F5KA 2FPFA 2J6KA 2HDAA 2QA4Q 1VYTA 3WVDB 1TH7A 1AWXA 3R6NA 1H92A 2O4XB 2YUOA 4M78D 1N8RC 4Z88A 5GANg 5IHNA 2JW4A 4DBFA 2ZPGB 5CIUA 8ATCB 2Y90A 1RI9A 2D9TA 5GAN5 1OPKA 2YHTA 3G71A 3CC4A 1S72T 1HSQA 1M1FA 1JXOA 2CH4A 3CCRA 4PJOC 5C0MA 2K2MA 5GANe 1TOVA 3M58A 4PJOG 4IIMA 2P4TA 4FYWB 1R0CB 3M56A 1Q81R 1B7TA 1YJWA 5GMKm 2V8JA 1KJWA 3MPUB 2DJQA 2RM4A 3OQ5A 2RJCA 3CCUA 2NUZA 1OI1A 2LQ8A 4C92F 3EGXB 2COZA 2RJEA 4LUEA 3M54A 4IUTA 4AFSC 5LJ3g 1QCNA 3OW2A 1LOJA 2XK0A 4FT4A 2FZCB 3CCVT 1OPLA 5GAMg 1WQWA 1NPPA 3H41A 5GAN4 1Q86C 3GOXA 1BIAA 5GAN3 3E9FA 2ZPFB 2E70A 2M0YA 3MEUA 1VQ4T 3EFOA 5DY9A 5LJ3e 4RTVA 2E3IA 1VQ9A 2FZGB 1VQ4Q 1NJIU 3CCJA 2LCLA 1NLPC 2F5TX 1GCQA 1ZX6A 1OZ2A 5A2QE 2DRMA 4K11A 3E19A 5GAMe 4M78C 2JTMA 2RI3A 3PFSA 4M78G 3I56Q 4PJMA 1NEGA 1RL2A 2E1HA 2F69A 1QLYA 2O88A 1D0XA 3PMTA 2KRSA 2GNCA 1K8AR 2VASA 3P8DA 4A4GA 1QWEA 3OYNA 3JCMJ 2ED1A 1FX7A 4AFZC 1Q7YR 5CQYA 1YJNA 5EG2A 1BCOA 4F16A 2KVQG 3G4ST 1C1AA 2E64A 3PTAA 1TS9A 4P5NA 2QQ9A 2AIRB 3G4SQ 4Y28E 2F1LA 1D1BA 1KG1A 2LNVA 4ZGJB 2M02A 4BB7A 2FZKB 2YSQA 3JCMd 3RKYA 4C5EA 3CC2A 1VQ7Q 3HFOA 1ZUKA 2EFIA 2LVMA 2LTOA 2EKOA 1U8RA 3OYBA 1UJYA 1EIFA 1RLPC 5HK0A 2CH4W 3SB2A 4OGCA 1TUDA 3CCET 2ROTA 1KC8C 1VA7A 1UDLA 1VQLA 2QAZA 4F7UB 5CO7A 4KBMB 2LX9A 4C92A 3CCMQ 2KRNA 4NL3A 3CCEQ 2O9SA 2CSQA 7AT1B 1E7OA 1WHKA 2HD0A 3EG9B 3M57A 2D0NA 3EFRA 2XICA 3BDUA 1LCKA 3PVQA 3VJPA 3CQTA 4IUPA 4HXJA 3OS0A 4FIBA 3V7SA 1XJWB 2KY9A 3FEOA 3FJPA 2E12A 5LJ5d 3RDVA 3T9NA 2V8KA 4BY6C 3L1AA 3REBB 1EZZB 4JS4A 2DL4A 2JMAA 3QDRB 5GANj 5L23A 2QTXA 1ZA2B 4NS5A 3G6ET 4M7AB 1IXDA 4PFOA 2B8AA 3OW2P 2MWPA 2E6NA 3JCMh 5HCKA 5KYUA 5GMKe 2X4WA 2HKNA 3HL8A 5CKBA 1OEBA 1SSFA 1K0SA 3OYKA 3OYJA 4XQ3A 1MV0B 1M2VA 2HSPA 2JM8A 1M30A 4ELZC 4NL2A 2EQJA 3ME9A 2K3XA 2PUOB 3JB9I 1YCSB 3WXMB 3PNWC 1TXQA 3QO3A 2WACA 1JO8A 2PU9B 5IXBA 1YWOA 4VUBA 1Y0MA 2C06A 1Y96A 1LJOA 2DVEA 2LX7A 2DZ9A 2EYYA 2DNUA 4OMPA 2QDLA 4EMKB 2DAQA 2P0PA 3H9NA 5CQXA 1WPYA 1YJ9Q 4AFUC 3M53A 2LDMA 2DXBA 3M4YA 1OULA 2JVVA 2EJGA 2G6FX 5LJ5h 1MNDA 5GAMj 3QYHB 2XDBA 1UGQB 2LMJA 2CP7A 1WXTA 4HVWA 3CBOA 3JV3A 2M1HA 2GBQA 3F70A 1IGUA 2QQSA 3JAME 5GAOm 1MV3A 2JN0A 2NYSA 4LE9A 5HY6A 5DLOA 2QGGA 4C0DC 2FVUA 5KYXB 4BE1A 2DLPA 2YT6A 2E65A 4E7JA 3RKXA 3MP8A 1M3CA 1VIEA 2MK5A 2LQNA 4CRIA 3HRUA 2AT1B 3MP1A 1WZOA 4CC3A 5FW9A 4JLGA 2EGEA 2PZ1A 1K4US 1OX9A 2RD1A 4CC2A 3URGA 1KQ2A 2YXYA 3NFCA 5GAOp 1ZBXA 2L0AA 4M75B 3UDCA 1MUZA 1SHFA 2AZVA 1MNEA 3GBQA 1BI2A 4C5IA 3CPWS 4BDZA 3NTKA 1G5VA 4M77F 3BW1A 4ATOA 2SRCA 4RTZA 2YUQA 2D8JA 2VYTA 1JQQA 1X69A 2H3EB 1OX8A 5KE2A 3MEVA 1S1NA 4BE0A 3NTIA 3SFMA 3OSVA 4CC4B 3VYHB 1RAHB 1VQOA 3OB9A 1M4ZA 4M7DF 1TU0B 3OSSC 3JCMb 3I9QA 1OOTA 1VQ8T 2CSIA 4JRPA 3HFNA 3VS5A 1YHQT 2CP6A 1ZSZB 2HQHA 1YITA 2E6ZA 2CT4A 4HT9A 4PLLA 3CCQA 4KUDK 1RABB 3ZL7C 3OYHA 3GNGA 1M1GA 1ZLMA 2P84A 2D0QB 2HQEA 2CP2A 2AKLA 2BE9B 1BKBA 3FJ5A 3JB9H 1W6XA 2MPXC 3KBGA 4PL6A 2MCNA 4F7UG 1EX4A 4LD6A 2BE7D 1N27A 1G3WA 1JJ2A 1WHLA 2PUKB 1WQ7A 1GCQC 2HMAA 4A63B 2YLBA 4PJOB 2M16A 5GMKj 3THKA 1V29B 4XTXA 2RHIA 1K9MR 4N4GA 2HL3A 2EPDA 2QEXA 3P8HA 4RMOA 2H8HA 2FRWA 2O31A 3TU4K 3CC7T 1C6VX 2OTLT 2YUNA 3UA6A 1ABOA 1B34A 4RTWA 3CCST 5HKCA 2ZGWA 2OTLQ 1PNJA 3G1JA 4M75D 3CCSQ 1HD3A 1Q86U 3CPWA 1YIJQ 3BE3A 1AHJB 3MEAA 5GJVB 4EMGA 3QZ5B 2A3LA 2QG9B 1ZUYA 2SEMA 4FW1A 2KRMA 5GANd 2Z0WA 1Q82R 1KFZA 1MMNA 4FYVB 1H3HA 2BUDA 4M77A 1KD1R 2DZCA 4IKFA 3S3OA 1TSFA 4MDXA 3QHSA 3GPLA 1VUBA 3TEEA 1QCFA 3LGLA 2CUDA 1K76A 1WHHA 3FC3A 4WCIA 3EAEA 2RF0A 1RUWA 4PKCC 4JJBA 2V1RA 1S72A 2E5QA 4RCBA 2CGHA 3WVEB 4EMKC 4LUDA 3LW5E 4GLKA 3VV0A 2HSEB 4ZN1A 2F2XA 4M7DA 5DLQE 2AK5A 4C92C 1KHIA 1W2BS 2MI6A 5LL6S 3OYCA 1YN8A 2NWMA 4Q5WA 1Q95G 2PQWA 4LNPA 2EYXA 1I5LA 3PMIA 4QQDA 5J39A 2DRKA 1AWWA 5L8RE 3MCAB 1NYFA 4JS5A 2PVGB 5LJ3d 3EGDB 2M0OA 2DIQA 1O75A 5GAMd 3OYLA 1NPRA 2EQKA 5FLXE 2O4XA 4LD9K 4ME7A 4FL6A 3OBYA 3CCVA 3E9GA 3O8VA 2IPOB 2LT1A 1RAFB 3J80E 1K1ZA 4GBQA 2X3WD 3JCMf 4XK8E 4M75C 4FU6A 1YCYA 4M75G 3IQLA 1KC8U 3CMAT 1YI2Q 3C4SA 4DBRA 2KQWA 4Y92A 2MMPA 1JJ2P 3RMQA 4UC4A 1AZEA 2K5LA 3Q1JA 1RAEB 4J5YA 4X34A 5CR2A 3ER0A 1VQPQ 1G3YA 4E7KA 1M90C 2DO3A 2AHJB 4KUIA 3JCMV 4A4FA 1U06A 1MHNA 1VQ6T 1GRIA 3M0TA 2R5MA 4OP0A 1BI3A 2JS0A 1VQ6Q 2QA4T 1M2OA 1YBYA 2ABLA 2EVRA 5KYYA 5LJ3h 1ZSZC 2EQUA 2RI5A 3G4SA
chains in the Genus database with same CATH topology
1M1KR 1VQ5Q 1VQ9Q 1K8AR 1VQMQ 1Q86R 1VQ8Q 1YITQ 1VQ4Q 1VQKQ 3CCLQ 3CCJQ 1Q82R 1VQLQ 3CC2Q 3CPWP 1Q81R 1YHQQ 1Q7YR 1YI2Q 1KD1R 1YJNQ 3CCQQ 1YJWQ 1M90R 1VQ7Q 3CXCP 3CMEQ 3CCMQ 1NJIR 3CCEQ 3CC7Q 1N8RR 3CMAQ 1W2BP 1YJ9Q 1JJ2P 3G71Q 3I55Q 3CC4Q 1KC8R 1K9MR 1KQSP 3I56Q 1VQOQ 3CCUQ 1QVFP 1VQ6Q 1K73R 2OTJQ 3CCSQ 3CCVQ 3OW2P 2OTLQ 3CD6Q 3G6EQ 2QA4Q 1S72Q 1VQPQ 3G4SQ 2QEXQ 1YIJQ 1QVGP 3CCRQ 1VQNQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K R;  1VQ5 Q;  1VQ9 Q;  1K8A R;  1VQM Q;  1Q86 R;  1VQ8 Q;  1YIT Q;  1VQ4 Q;  1VQK Q;  3CCL Q;  3CCJ Q;  1Q82 R;  1VQL Q;  3CC2 Q;  3CPW P;  1Q81 R;  1YHQ Q;  1Q7Y R;  1YI2 Q;  1KD1 R;  1YJN Q;  3CCQ Q;  1YJW Q;  1M90 R;  1VQ7 Q;  3CXC P;  3CME Q;  3CCM Q;  1NJI R;  3CCE Q;  3CC7 Q;  1N8R R;  3CMA Q;  1W2B P;  1YJ9 Q;  1JJ2 P;  3G71 Q;  3I55 Q;  3CC4 Q;  1KC8 R;  1K9M R;  1KQS P;  3I56 Q;  1VQO Q;  3CCU Q;  1QVF P;  1VQ6 Q;  1K73 R;  2OTJ Q;  3CCS Q;  3CCV Q;  3OW2 P;  2OTL Q;  3CD6 Q;  3G6E Q;  2QA4 Q;  1S72 Q;  1VQP Q;  3G4S Q;  2QEX Q;  1YIJ Q;  1QVG P;  3CCR Q;  1VQN Q; 
#chains in the Genus database with same CATH topology
 5LJ5 f;  3VU3 C;  2J6O A;  4M77 E;  1YNZ A;  3E1S A;  3J81 E;  4ZTF A;  2DBK A;  4R0K A;  1K73 U;  4J83 A;  3UA7 A;  3PVL A;  2EKH A;  2QAS A;  2E3H A;  3R6O A;  1RAD B;  2JT4 A;  2JUF A;  1VQ5 T;  3A8G B;  1QCO A;  3LLR A;  5GAO q;  3I5R A;  2XHC A;  4M7D E;  1M1K R;  1VQ5 Q;  2MWO A;  3V8J A;  1J3T A;  4C0G A;  1VQK Q;  1H64 1;  3TQ7 P;  2D6F A;  2QXF A;  4PFZ A;  1HXD A;  2DFU A;  3CME Q;  3KXT A;  1LVK A;  3TVT A;  4BI4 A;  3OYA A;  3I55 Q;  4QVZ A;  1OYX A;  2L8D A;  3DB4 A;  4E7H A;  3SDZ A;  1H8K A;  3C95 A;  5GAN 6;  5I2M A;  4PFP A;  4F14 A;  3L42 A;  2LJ1 A;  1HJD A;  1N5Z A;  3JSC A;  4PJN A;  1N9R A;  1U1S A;  2EJF A;  3LH5 A;  1RAC B;  2KR3 A;  1U3O A;  4OB0 B;  2VV5 A;  4IIO A;  3G6E A;  3EG1 A;  1PSE A;  4C0D B;  1M27 C;  2ECZ A;  3DB3 A;  2KYM A;  4L59 A;  1BI1 A;  3HRS A;  4HCK A;  3HTR A;  3EFS A;  1HK9 A;  2X4X A;  4GY5 A;  2VVK A;  2RK2 A;  1Y7X A;  1Z9Z A;  1PRL C;  3I56 T;  5J26 A;  2LZ6 B;  1UE9 A;  4OF1 A;  3QXE B;  4C8Q F;  2OTJ Q;  3QG1 A;  2DL8 A;  4EMH A;  3UPU A;  4F04 B;  1JRI A;  4BI3 A;  4HT8 A;  2EWN A;  3C0C A;  1VQN Q;  1EFN A;  3CBM A;  1SPK A;  1PKT A;  1M5Q 1;  1M3B A;  2PVD B;  3O5Z A;  4IUR A;  2JOY A;  1M3A A;  2C0I A;  2LJ0 A;  3JCM c;  4BDY A;  4J7I A;  1R0B G;  2AKK A;  3V8K A;  1ARK A;  5CAI A;  2K4Y A;  2CRE A;  2CZ0 B;  2KDS A;  3H0F A;  3CD6 Q;  4TVR A;  4J7F A;  4QW2 A;  4ZNX A;  4D8K A;  1IO6 A;  1Q81 C;  1WHG A;  2GGR A;  2EGA A;  1P92 A;  3QPH A;  1VQ7 T;  4BAC A;  1I1J A;  3AT1 B;  4OVA A;  3J7A F;  4M7A A;  2RHX A;  3OS1 A;  1D3B A;  4N0A A;  4A4H A;  2WSE E;  2XU8 A;  1NZ9 A;  1WFW A;  4X1V A;  3PIP A;  1OZ3 A;  1IZ6 A;  2RH2 A;  1R77 A;  2NUT A;  2Y4Y A;  2YRC A;  1QKX A;  4RG2 A;  2XDD A;  3JB9 D;  1PD1 A;  4ZN3 A;  1YFN A;  3MEW A;  5IHI A;  3CCM T;  2KT8 A;  4OMQ A;  3EFO B;  4JZ4 A;  3G71 T;  2P4R A;  2XID A;  2CZ1 B;  2EYZ A;  1WGS A;  3G71 Q;  5IAY A;  2DL3 A;  1KHC A;  2EYW A;  3CC4 Q;  1JEG A;  1I5O B;  3REA B;  3CCR T;  5KE3 A;  1CSK A;  2JTF A;  3CCR Q;  3DLM A;  2L89 A;  2X3X D;  1YJW T;  1TWB A;  1CKA A;  2KAF A;  3CCL A;  1RAG B;  3I5S A;  2ZPH B;  1YJW Q;  1O9S A;  2F2V A;  2QQB A;  1QMC A;  2NLU A;  2IG0 A;  3GLX A;  1QW1 A;  3ZEH A;  2LJ3 A;  2R57 A;  3CCU Q;  1ZUU A;  3A8L B;  3UT1 A;  4WF2 A;  1K8A C;  2J06 A;  2X51 A;  3QWY A;  2ZPI B;  4B9X A;  3ULR B;  2DYB A;  3CXC S;  4Z02 A;  2RI2 A;  1MMD A;  2KBT A;  1Q7Y C;  2DTO A;  4B9W A;  4XU1 A;  4QT7 A;  4C8Q A;  3UF4 A;  1VQ8 A;  2AZS A;  2GFU A;  1SHG A;  2KEA A;  4FCY A;  1YHQ A;  1K73 C;  1NJI R;  4A4E A;  3SWN C;  4D6W A;  2A37 A;  3TSW A;  2EQM A;  5A0G A;  1NBE B;  1MMG A;  5CKD A;  1VQ9 T;  1UB4 A;  3FRN A;  1JBM A;  5GAN f;  1AT1 B;  3A98 A;  1VQ9 Q;  2CKK A;  2QQR A;  2GCX A;  1NLO C;  5ECA A;  2XMF A;  3CCJ Q;  1Y07 A;  4QQG A;  1SRM A;  3OYD A;  5CVI A;  5KH6 A;  3M9Q A;  1YJ9 T;  1H3Z A;  2O2O A;  3JB9 G;  3VUB A;  1G8X A;  3JB9 J;  4C92 B;  4DBH A;  4HVU A;  4ZGE B;  5CKF A;  1OQK A;  1T3L A;  5I11 A;  4M78 F;  4RTT A;  4M7A E;  2GFA A;  3I35 A;  4MZM A;  2HKQ B;  2JTE A;  1YJN Q;  1WYX A;  2DKG A;  3CC7 A;  3HPW A;  4PK4 A;  4AFQ C;  3OMG A;  1Y71 A;  5FRM A;  1UHC A;  3RER A;  3HRT A;  3EHQ A;  5AYF A;  1I4K 1;  3H8Z A;  1SG5 A;  1T0J A;  5LJ3 f;  4KUL A;  2LQK A;  5GAN 8;  3M0Q A;  2KI7 A;  3S3M A;  3JCM g;  3CC2 Q;  4XTY A;  2EYQ A;  2E10 A;  2DA9 A;  3LX7 A;  1X43 A;  4PJL A;  1WX6 A;  4DOW A;  3OYG A;  1FWZ A;  1M2V B;  4OGE A;  4E6R A;  2C0O A;  5CKE A;  2A7Y A;  2FPD A;  4L5G A;  4ZGD B;  4PJO A;  2KSS A;  3CXC A;  3JCM e;  1M90 U;  1BIB A;  5GAO n;  2FHD A;  1UHF A;  1IHV A;  2VKN A;  2NUP A;  1VQL Q;  2PVO B;  1D1C A;  1SRL A;  2DK3 A;  1Y96 B;  2COY A;  1WIE A;  1WXB A;  3QUI A;  3L2R A;  2RK1 A;  3EH2 A;  3A1P A;  1W70 A;  4KH0 B;  1RI0 A;  4C8Q E;  5IN1 A;  4NOY A;  5LJ5 g;  2GTO A;  1PKS A;  4DEX A;  5FRN A;  2XKO C;  4MZP A;  3JCM X;  4PJJ A;  2VXF A;  2CDT A;  1WA7 A;  4FT2 A;  2L3P A;  4C92 D;  3M0P A;  3PGG A;  5LJ5 e;  3TRE A;  1N6A A;  1R8O B;  3X26 B;  1HYO A;  3UWN A;  2EGC A;  3QKJ A;  2EQI A;  4M78 A;  1D1A A;  2DL7 A;  3CMA A;  2OI3 A;  2CP0 A;  2RNA A;  3X20 B;  3FB9 A;  2XDP A;  2FL7 A;  2YDL A;  5KCO A;  1Y57 A;  2LNH B;  4FW2 A;  1I8F A;  4PLI A;  1TUG B;  1SKU B;  5A0L A;  2E41 A;  1AOJ A;  2LQW A;  2A08 A;  4CC7 A;  3RNJ A;  1UGP B;  2GF7 A;  3H6Z A;  2L3Q A;  4RG8 A;  2DX1 A;  3OS5 A;  2R58 A;  1ZBJ A;  4XTZ A;  1YIJ T;  2BZY A;  2EIF A;  3EGD A;  5FU6 B;  2QA4 A;  2V26 A;  1U5S A;  1M8V A;  2HZY A;  2DTH A;  1GBQ A;  5M9O A;  3G7Z A;  2HNI A;  4HA8 A;  4LDX A;  4CI0 C;  3H0I A;  4XAX B;  2E4H A;  4BE2 A;  2K3B A;  2RQT A;  3OYM A;  2ATC B;  1PCX A;  1SSH A;  3EG3 A;  3X28 B;  2KXC A;  2C0T A;  2DMO A;  4PJO E;  2JNG A;  2KNB B;  1QP2 A;  3TCJ A;  3X25 B;  1UJ0 A;  4RKU E;  1OU9 A;  2A36 A;  1NYG A;  4XU0 A;  2CZ7 B;  2WSF E;  2KRO A;  3CXC P;  4C92 G;  4LDV A;  1UEC A;  2GQI A;  5KYW A;  4OMF B;  1NG2 A;  5GMK l;  1SF9 A;  3BDL A;  3QDF A;  3A8M B;  2CS7 A;  4MDW A;  1Q81 U;  3QSU A;  1AVZ C;  4XTW A;  1K9M C;  3L2Z A;  2DXC A;  3M55 A;  4HCZ A;  1UG1 A;  1UUE A;  1VIF A;  1N8R R;  3FIF A;  4KRT A;  4J6Y A;  3HKS A;  3QII A;  2LC4 A;  2JZ2 A;  1VQO Q;  3M0R A;  4JRI A;  2DXU A;  9ATC B;  4V2S A;  4C0Z A;  2DVJ A;  1B34 B;  3S3N A;  5GAN h;  1PG5 B;  5D6Y A;  3NPF A;  4JJN K;  4C5G A;  1YIT Q;  4D8D A;  3CCQ T;  1D0Y A;  1YI2 T;  3U23 A;  2D8H A;  4M78 E;  1VQ4 A;  1G3T A;  1I07 A;  2A0F B;  5D6W A;  3CCQ Q;  5DM7 R;  2CYZ B;  1WI7 A;  4OB3 B;  4M77 B;  3I56 A;  1VQP T;  1ABQ A;  2IIM A;  1Q82 C;  2VWF A;  2YRD A;  3L2W A;  1PHT A;  4B6M A;  2DEQ A;  1AWJ A;  2K9G A;  4GLM A;  1KD1 C;  2J6F A;  1TTH B;  1KQS S;  1M9S A;  2VC8 A;  3VRY A;  5LJ5 j;  1BBZ A;  4F7U F;  2OX7 A;  2J7I A;  4BI8 B;  4M7D B;  3EGX A;  4QVD A;  5I21 A;  5CCA A;  3MP6 A;  2QDY B;  4JUV A;  6AT1 B;  1K8A U;  4Z89 A;  2YRV A;  2QEX Q;  1GBR A;  2MYS A;  1Q86 R;  1Q7Y U;  4IUQ A;  1G83 A;  2KK4 A;  3H0H A;  5AT1 B;  3LWH A;  3CPW P;  3M0S A;  1F1B B;  5C6S A;  5GAM h;  1LPL A;  2L3S A;  4OML A;  4ESR A;  1VQ7 A;  1WNL A;  2FPE A;  1PSF A;  4J9H A;  4R56 A;  2HEQ A;  4O5V A;  1W2B A;  2KXD A;  2HBW A;  1C0M A;  3SWN B;  1T3S A;  1GCP A;  4M7A F;  2ZCF B;  3A5Z B;  4EIK A;  1VQK T;  4JLI A;  3VRZ A;  5CKH A;  3PIO A;  4XTU A;  2X9H A;  3CME T;  2IVW A;  2XD0 A;  2CUB A;  3I55 T;  2BZ8 A;  1YP5 A;  1WJS A;  3CBP A;  2BTT A;  3CCE A;  3CCM A;  4FSX A;  2E5K A;  4AT1 B;  4XU2 A;  1S72 Q;  1G3S A;  1XOV A;  4L6V 5;  2W10 A;  4FSS A;  3EG0 A;  2VB6 A;  2ESW A;  4RTX A;  1IB8 A;  2RJD A;  2QGF B;  1KSW A;  2BIV A;  1GXI E;  2WSC E;  2JJ9 A;  5FU6 C;  4E47 A;  3NGP A;  1FYN A;  1AZG B;  4FYY B;  4Y91 A;  2EBP A;  4LXC A;  1VQM T;  2BKD N;  4M77 D;  4AMC A;  1VQM Q;  3RUX A;  1PWT A;  5KYY B;  4WTO B;  5KYN A;  1XQH A;  1KQS A;  2G3R A;  4J9B A;  2MIO A;  2B86 A;  2RHY A;  2OTJ T;  1RAI B;  3VS2 A;  1KC8 R;  4XTV A;  3CCV Q;  4E7S A;  2P0K A;  4J8O A;  1VQN T;  2KGT A;  3MKD A;  4M7D D;  1QKW A;  2FYK A;  1CKB A;  4F7U A;  2JXB A;  4RTY A;  2LRQ A;  2DL5 A;  3ZBD A;  3EG9 A;  1UGS B;  4FYX B;  2HCK A;  4LDW A;  1GFD A;  1QP3 A;  3RR6 A;  3OYE A;  2KE9 A;  2DPP B;  1AWO A;  2M9U A;  2DD4 A;  4A4K A;  4JJD A;  4M75 F;  3CD6 T;  2RQV A;  1YJ9 A;  2PTK A;  1M1K C;  2K5F A;  3VS3 A;  2OJ2 A;  2ROL A;  5GMK h;  4XU3 A;  2X35 A;  3CEY A;  4RUG A;  3OMC A;  2FB7 A;  5J3B A;  1WJQ A;  3DKM A;  1W4S A;  1U1T A;  8AT1 B;  1QWF A;  3D7S B;  1BU1 A;  3L2V A;  2RQW A;  4O6J A;  1K73 R;  5GAO l;  4KH1 B;  1NEB A;  4IUU A;  1W2B P;  2HBP A;  3EG2 A;  1ZHI A;  2FG0 A;  3VKI A;  1GL5 A;  2FRY A;  4E2F B;  4KGX B;  4M77 C;  4YTL A;  4QKU A;  3CC4 T;  2R5A A;  4M77 G;  4HKE A;  3X24 B;  2ZAE A;  3QBY A;  3INZ A;  2DE0 X;  3QWX X;  4E7Z A;  4LN2 A;  2LP5 A;  4J6W A;  2BZX A;  3AHU A;  4JZ3 A;  4EMK A;  3QZ9 B;  3RMS A;  1B07 A;  4M7D C;  4AG2 C;  3VS0 A;  4M7D G;  1I0C A;  5GAN 2;  2RMO A;  1TUC A;  3CCU T;  5CK9 A;  4PJO F;  5GAO r;  2DXT A;  1AD5 A;  2RB6 A;  3M59 A;  2OAU A;  3M0U A;  3OY9 A;  4J9E A;  2K57 A;  1PD0 A;  3LYI A;  1N9S A;  3HP9 A;  3RIR A;  2K3Y A;  2K79 A;  2LT4 A;  5KYX A;  1IHW A;  3A8H B;  1IRX A;  1ZSG A;  1BI0 A;  1T0H A;  3GF5 A;  4HCB A;  1KQS P;  4X9D A;  3BFM A;  2EJ9 A;  2HAX A;  2QQA A;  4F7U E;  3G6E Q;  2DEU A;  1D3B B;  3FLG A;  4HVV A;  4FM4 B;  3CCJ T;  3HSB A;  1UGR B;  3NMZ C;  3MO8 A;  2RA2 A;  4M75 A;  5FU7 B;  3OYI A;  3OBW A;  2RQU A;  2NUT B;  4LDU A;  2RHU A;  3RKW A;  2DJZ A;  1A0N B;  1V76 A;  1BK2 A;  2K6D A;  2EAY A;  5GMK i;  4OB1 B;  3UAT A;  3VS1 A;  2O01 E;  1NM7 A;  1X27 A;  2O9V A;  4JJC A;  1YJN T;  4LDY A;  2KYB A;  3NHN A;  5FWC A;  1K9M U;  2VGM A;  5LJ3 j;  1QVG S;  1UTI A;  3TSZ A;  3FDR A;  5IXF A;  2OTL A;  1IGQ A;  2EW3 A;  2DTI A;  3CCS A;  1ZSZ A;  4C5H A;  4C0F A;  4IUV A;  3C12 A;  1YIJ A;  1JJ2 S;  1KQ1 A;  4DEY A;  3CC2 T;  2HL5 C;  2L3R A;  5I22 A;  2J05 A;  1E6G A;  5KYU B;  2Y4X A;  3QJ6 A;  2XG8 D;  5GAM f;  3HHT B;  4C8Q B;  4ZTJ A;  2KMT A;  4ORZ A;  5FWB A;  4J9F A;  1FMK A;  1PRM C;  1UFF A;  4JDS A;  3M5A A;  3OS2 A;  1Q82 U;  4QVC A;  2L5Q A;  1VQL T;  1WXU A;  4C92 E;  1NJI C;  1KD1 U;  4DQ2 A;  1QVF S;  5GJW B;  4RCC A;  4N4I A;  1D0Z A;  2M51 A;  3QJY A;  3EHR A;  1V1C A;  3L2U A;  1ZQ1 A;  1WDX A;  2DIL A;  2DER A;  1X01 A;  2X4Y A;  3P8B B;  3MHX A;  2RQR A;  2V1Q A;  1JU5 C;  4M7A D;  3CCL T;  2MOX A;  4OMM A;  2JM9 A;  3QYG B;  3CCL Q;  1ZA1 B;  2HQX A;  3CPF A;  1G2B A;  2I2L A;  1X6G A;  3V7C A;  4EDU A;  3KUF A;  2FO0 A;  2V8I A;  2GTJ A;  2VXE A;  1D09 B;  4M75 E;  1RLQ C;  2QI2 A;  2DYI A;  3BY7 A;  2D1X A;  3L2Q A;  1OV3 A;  2K2V A;  1QQJ A;  1VQ8 Q;  1N8R U;  2DBM A;  4A53 A;  2CT3 A;  1YHQ Q;  2OAW A;  4DBQ A;  1YI2 A;  4EPC A;  3PE0 A;  1QVG A;  1K0X A;  1X6O A;  2KT1 A;  2VGN A;  4JRK A;  3A8O B;  2ZZD A;  1VQP A;  2ED0 A;  3LGF A;  1DJ7 B;  1OU8 A;  1X6B A;  2LCS A;  3NTH A;  4A54 A;  3RES A;  3LWI A;  5HK3 A;  3JRZ A;  2H3J A;  4MMK A;  2QK0 A;  1UEB A;  2NUP B;  1VYU A;  5D7U A;  2CP3 A;  1VQ6 A;  1PC0 A;  4C8Q D;  1XTD A;  2MAM A;  2VUB A;  4PNO A;  3LH0 A;  3JB9 F;  2COW A;  3VS7 A;  3S6W A;  2FEI A;  2CZ6 B;  4AG1 C;  1M8M A;  5FRO A;  3SEM A;  3VS4 A;  5GAN 7;  4J9I A;  1QVF A;  4M7A C;  4M4Z A;  1FXX A;  3CC7 Q;  4M7A G;  2MF2 A;  4KGV B;  4ANJ A;  5D6X A;  4N0A C;  5I2S A;  1VYV A;  3EH1 A;  2W0Z A;  4J6X A;  1WJR A;  1ACM B;  5FU7 C;  3RBB B;  2DD5 A;  3SD4 A;  1WLP B;  1JXM A;  1QVP A;  1X75 C;  2PNI A;  2RO0 A;  1VQ5 A;  1BB9 A;  2K7A A;  2RHZ A;  1VQK A;  5IT9 E;  2YUP A;  1JB0 E;  1WHJ A;  4OMO A;  1M90 R;  3V8L A;  3CME A;  2RPN A;  1MMA A;  2ZPE B;  3I55 A;  3GIB A;  1M1K U;  3N5B B;  4M78 B;  2ENM A;  4JPB W;  1IRE B;  4QQ6 A;  2YWW A;  4BD3 A;  4MZT A;  4RTU A;  4J9C A;  4II1 A;  3GP8 A;  2RJF A;  3GNF B;  1VQO T;  2CP5 A;  1RAA B;  3ASK A;  4E7L A;  2K5I A;  3OYY A;  1W1F A;  2QTV A;  4X9C A;  4BUG A;  3M4G A;  1YIT T;  4MML A;  2JS2 A;  4HCC A;  3SHW A;  4OB2 B;  4OMN A;  4ELY C;  1VQM A;  4C8Q C;  4J9D A;  3ZFJ A;  1KIK A;  4DA4 A;  1NE8 A;  4C8Q G;  4JRQ A;  1GFC A;  1PM3 A;  2L2P A;  5EC7 A;  2A28 A;  1Z9Q A;  1I81 A;  3SWN A;  1VOM A;  1TG0 A;  2ZPB B;  4PJO D;  3PT9 A;  2F2W A;  2OTJ A;  1X2Q A;  2X4J A;  1UGV A;  1QVG P;  2DIG A;  3EGU A;  4R55 A;  1FMW A;  1VQN A;  3JCM W;  2DF6 A;  3VYG A;  2XI9 A;  5IHK A;  3MET A;  1BCM A;  1WHM A;  3OW2 S;  4F17 A;  2LCC A;  1BYM A;  1KK7 A;  2GQV A;  3JCM P;  1E6H A;  1LNX A;  3CMA Q;  2DET A;  1MGQ A;  1X2K A;  5A0D A;  2DM1 A;  2JMC A;  4KGZ B;  2QYZ A;  4KT0 E;  2QEX T;  4DOV A;  5KCH A;  3KFV A;  3CD6 A;  4E7I A;  5KYW B;  2RN8 A;  3JCM Q;  3C94 A;  5IH2 A;  3V7R A;  3OA6 A;  4J9G A;  3E2U A;  4Z8A A;  1B3Q A;  1FMV A;  1SEM A;  2P0Q A;  2YLC A;  3MJX A;  1YWP A;  3DLL A;  4N4H A;  3VUZ A;  2I0N A;  3OYF A;  3VS6 A;  1XNI A;  4BY6 B;  1AEY A;  1QVF P;  1K9A A;  2F5K A;  2FPF A;  2J6K A;  2HDA A;  2QA4 Q;  1VYT A;  3WVD B;  1TH7 A;  1AWX A;  3R6N A;  1H92 A;  2O4X B;  2YUO A;  4M78 D;  1N8R C;  4Z88 A;  5GAN g;  5IHN A;  2JW4 A;  4DBF A;  2ZPG B;  5CIU A;  8ATC B;  2Y90 A;  1RI9 A;  2D9T A;  5GAN 5;  1OPK A;  2YHT A;  3G71 A;  3CC4 A;  1S72 T;  1HSQ A;  1M1F A;  1JXO A;  2CH4 A;  3CCR A;  4PJO C;  5C0M A;  2K2M A;  5GAN e;  1TOV A;  3M58 A;  4PJO G;  4IIM A;  2P4T A;  4FYW B;  1R0C B;  3M56 A;  1Q81 R;  1B7T A;  1YJW A;  5GMK m;  2V8J A;  1KJW A;  3MPU B;  2DJQ A;  2RM4 A;  3OQ5 A;  2RJC A;  3CCU A;  2NUZ A;  1OI1 A;  2LQ8 A;  4C92 F;  3EGX B;  2COZ A;  2RJE A;  4LUE A;  3M54 A;  4IUT A;  4AFS C;  5LJ3 g;  1QCN A;  3OW2 A;  1LOJ A;  2XK0 A;  4FT4 A;  2FZC B;  3CCV T;  1OPL A;  5GAM g;  1WQW A;  1NPP A;  3H41 A;  5GAN 4;  1Q86 C;  3GOX A;  1BIA A;  5GAN 3;  3E9F A;  2ZPF B;  2E70 A;  2M0Y A;  3MEU A;  1VQ4 T;  3EFO A;  5DY9 A;  5LJ3 e;  4RTV A;  2E3I A;  1VQ9 A;  2FZG B;  1VQ4 Q;  1NJI U;  3CCJ A;  2LCL A;  1NLP C;  2F5T X;  1GCQ A;  1ZX6 A;  1OZ2 A;  5A2Q E;  2DRM A;  4K11 A;  3E19 A;  5GAM e;  4M78 C;  2JTM A;  2RI3 A;  3PFS A;  4M78 G;  3I56 Q;  4PJM A;  1NEG A;  1RL2 A;  2E1H A;  2F69 A;  1QLY A;  2O88 A;  1D0X A;  3PMT A;  2KRS A;  2GNC A;  1K8A R;  2VAS A;  3P8D A;  4A4G A;  1QWE A;  3OYN A;  3JCM J;  2ED1 A;  1FX7 A;  4AFZ C;  1Q7Y R;  5CQY A;  1YJN A;  5EG2 A;  1BCO A;  4F16 A;  2KVQ G;  3G4S T;  1C1A A;  2E64 A;  3PTA A;  1TS9 A;  4P5N A;  2QQ9 A;  2AIR B;  3G4S Q;  4Y28 E;  2F1L A;  1D1B A;  1KG1 A;  2LNV A;  4ZGJ B;  2M02 A;  4BB7 A;  2FZK B;  2YSQ A;  3JCM d;  3RKY A;  4C5E A;  3CC2 A;  1VQ7 Q;  3HFO A;  1ZUK A;  2EFI A;  2LVM A;  2LTO A;  2EKO A;  1U8R A;  3OYB A;  1UJY A;  1EIF A;  1RLP C;  5HK0 A;  2CH4 W;  3SB2 A;  4OGC A;  1TUD A;  3CCE T;  2ROT A;  1KC8 C;  1VA7 A;  1UDL A;  1VQL A;  2QAZ A;  4F7U B;  5CO7 A;  4KBM B;  2LX9 A;  4C92 A;  3CCM Q;  2KRN A;  4NL3 A;  3CCE Q;  2O9S A;  2CSQ A;  7AT1 B;  1E7O A;  1WHK A;  2HD0 A;  3EG9 B;  3M57 A;  2D0N A;  3EFR A;  2XIC A;  3BDU A;  1LCK A;  3PVQ A;  3VJP A;  3CQT A;  4IUP A;  4HXJ A;  3OS0 A;  4FIB A;  3V7S A;  1XJW B;  2KY9 A;  3FEO A;  3FJP A;  2E12 A;  5LJ5 d;  3RDV A;  3T9N A;  2V8K A;  4BY6 C;  3L1A A;  3REB B;  1EZZ B;  4JS4 A;  2DL4 A;  2JMA A;  3QDR B;  5GAN j;  5L23 A;  2QTX A;  1ZA2 B;  4NS5 A;  3G6E T;  4M7A B;  1IXD A;  4PFO A;  2B8A A;  3OW2 P;  2MWP A;  2E6N A;  3JCM h;  5HCK A;  5KYU A;  5GMK e;  2X4W A;  2HKN A;  3HL8 A;  5CKB A;  1OEB A;  1SSF A;  1K0S A;  3OYK A;  3OYJ A;  4XQ3 A;  1MV0 B;  1M2V A;  2HSP A;  2JM8 A;  1M30 A;  4ELZ C;  4NL2 A;  2EQJ A;  3ME9 A;  2K3X A;  2PUO B;  3JB9 I;  1YCS B;  3WXM B;  3PNW C;  1TXQ A;  3QO3 A;  2WAC A;  1JO8 A;  2PU9 B;  5IXB A;  1YWO A;  4VUB A;  1Y0M A;  2C06 A;  1Y96 A;  1LJO A;  2DVE A;  2LX7 A;  2DZ9 A;  2EYY A;  2DNU A;  4OMP A;  2QDL A;  4EMK B;  2DAQ A;  2P0P A;  3H9N A;  5CQX A;  1WPY A;  1YJ9 Q;  4AFU C;  3M53 A;  2LDM A;  2DXB A;  3M4Y A;  1OUL A;  2JVV A;  2EJG A;  2G6F X;  5LJ5 h;  1MND A;  5GAM j;  3QYH B;  2XDB A;  1UGQ B;  2LMJ A;  2CP7 A;  1WXT A;  4HVW A;  3CBO A;  3JV3 A;  2M1H A;  2GBQ A;  3F70 A;  1IGU A;  2QQS A;  3JAM E;  5GAO m;  1MV3 A;  2JN0 A;  2NYS A;  4LE9 A;  5HY6 A;  5DLO A;  2QGG A;  4C0D C;  2FVU A;  5KYX B;  4BE1 A;  2DLP A;  2YT6 A;  2E65 A;  4E7J A;  3RKX A;  3MP8 A;  1M3C A;  1VIE A;  2MK5 A;  2LQN A;  4CRI A;  3HRU A;  2AT1 B;  3MP1 A;  1WZO A;  4CC3 A;  5FW9 A;  4JLG A;  2EGE A;  2PZ1 A;  1K4U S;  1OX9 A;  2RD1 A;  4CC2 A;  3URG A;  1KQ2 A;  2YXY A;  3NFC A;  5GAO p;  1ZBX A;  2L0A A;  4M75 B;  3UDC A;  1MUZ A;  1SHF A;  2AZV A;  1MNE A;  3GBQ A;  1BI2 A;  4C5I A;  3CPW S;  4BDZ A;  3NTK A;  1G5V A;  4M77 F;  3BW1 A;  4ATO A;  2SRC A;  4RTZ A;  2YUQ A;  2D8J A;  2VYT A;  1JQQ A;  1X69 A;  2H3E B;  1OX8 A;  5KE2 A;  3MEV A;  1S1N A;  4BE0 A;  3NTI A;  3SFM A;  3OSV A;  4CC4 B;  3VYH B;  1RAH B;  1VQO A;  3OB9 A;  1M4Z A;  4M7D F;  1TU0 B;  3OSS C;  3JCM b;  3I9Q A;  1OOT A;  1VQ8 T;  2CSI A;  4JRP A;  3HFN A;  3VS5 A;  1YHQ T;  2CP6 A;  1ZSZ B;  2HQH A;  1YIT A;  2E6Z A;  2CT4 A;  4HT9 A;  4PLL A;  3CCQ A;  4KUD K;  1RAB B;  3ZL7 C;  3OYH A;  3GNG A;  1M1G A;  1ZLM A;  2P84 A;  2D0Q B;  2HQE A;  2CP2 A;  2AKL A;  2BE9 B;  1BKB A;  3FJ5 A;  3JB9 H;  1W6X A;  2MPX C;  3KBG A;  4PL6 A;  2MCN A;  4F7U G;  1EX4 A;  4LD6 A;  2BE7 D;  1N27 A;  1G3W A;  1JJ2 A;  1WHL A;  2PUK B;  1WQ7 A;  1GCQ C;  2HMA A;  4A63 B;  2YLB A;  4PJO B;  2M16 A;  5GMK j;  3THK A;  1V29 B;  4XTX A;  2RHI A;  1K9M R;  4N4G A;  2HL3 A;  2EPD A;  2QEX A;  3P8H A;  4RMO A;  2H8H A;  2FRW A;  2O31 A;  3TU4 K;  3CC7 T;  1C6V X;  2OTL T;  2YUN A;  3UA6 A;  1ABO A;  1B34 A;  4RTW A;  3CCS T;  5HKC A;  2ZGW A;  2OTL Q;  1PNJ A;  3G1J A;  4M75 D;  3CCS Q;  1HD3 A;  1Q86 U;  3CPW A;  1YIJ Q;  3BE3 A;  1AHJ B;  3MEA A;  5GJV B;  4EMG A;  3QZ5 B;  2A3L A;  2QG9 B;  1ZUY A;  2SEM A;  4FW1 A;  2KRM A;  5GAN d;  2Z0W A;  1Q82 R;  1KFZ A;  1MMN A;  4FYV B;  1H3H A;  2BUD A;  4M77 A;  1KD1 R;  2DZC A;  4IKF A;  3S3O A;  1TSF A;  4MDX A;  3QHS A;  3GPL A;  1VUB A;  3TEE A;  1QCF A;  3LGL A;  2CUD A;  1K76 A;  1WHH A;  3FC3 A;  4WCI A;  3EAE A;  2RF0 A;  1RUW A;  4PKC C;  4JJB A;  2V1R A;  1S72 A;  2E5Q A;  4RCB A;  2CGH A;  3WVE B;  4EMK C;  4LUD A;  3LW5 E;  4GLK A;  3VV0 A;  2HSE B;  4ZN1 A;  2F2X A;  4M7D A;  5DLQ E;  2AK5 A;  4C92 C;  1KHI A;  1W2B S;  2MI6 A;  5LL6 S;  3OYC A;  1YN8 A;  2NWM A;  4Q5W A;  1Q95 G;  2PQW A;  4LNP A;  2EYX A;  1I5L A;  3PMI A;  4QQD A;  5J39 A;  2DRK A;  1AWW A;  5L8R E;  3MCA B;  1NYF A;  4JS5 A;  2PVG B;  5LJ3 d;  3EGD B;  2M0O A;  2DIQ A;  1O75 A;  5GAM d;  3OYL A;  1NPR A;  2EQK A;  5FLX E;  2O4X A;  4LD9 K;  4ME7 A;  4FL6 A;  3OBY A;  3CCV A;  3E9G A;  3O8V A;  2IPO B;  2LT1 A;  1RAF B;  3J80 E;  1K1Z A;  4GBQ A;  2X3W D;  3JCM f;  4XK8 E;  4M75 C;  4FU6 A;  1YCY A;  4M75 G;  3IQL A;  1KC8 U;  3CMA T;  1YI2 Q;  3C4S A;  4DBR A;  2KQW A;  4Y92 A;  2MMP A;  1JJ2 P;  3RMQ A;  4UC4 A;  1AZE A;  2K5L A;  3Q1J A;  1RAE B;  4J5Y A;  4X34 A;  5CR2 A;  3ER0 A;  1VQP Q;  1G3Y A;  4E7K A;  1M90 C;  2DO3 A;  2AHJ B;  4KUI A;  3JCM V;  4A4F A;  1U06 A;  1MHN A;  1VQ6 T;  1GRI A;  3M0T A;  2R5M A;  4OP0 A;  1BI3 A;  2JS0 A;  1VQ6 Q;  2QA4 T;  1M2O A;  1YBY A;  2ABL A;  2EVR A;  5KYY A;  5LJ3 h;  1ZSZ C;  2EQU A;  2RI5 A;  3G4S A; 
#chains in the Genus database with same CATH homology
 1M1K R;  1VQ5 Q;  1VQ9 Q;  1K8A R;  1VQM Q;  1Q86 R;  1VQ8 Q;  1YIT Q;  1VQ4 Q;  1VQK Q;  3CCL Q;  3CCJ Q;  1Q82 R;  1VQL Q;  3CC2 Q;  3CPW P;  1Q81 R;  1YHQ Q;  1Q7Y R;  1YI2 Q;  1KD1 R;  1YJN Q;  3CCQ Q;  1YJW Q;  1M90 R;  1VQ7 Q;  3CXC P;  3CME Q;  3CCM Q;  1NJI R;  3CCE Q;  3CC7 Q;  1N8R R;  3CMA Q;  1W2B P;  1YJ9 Q;  1JJ2 P;  3G71 Q;  3I55 Q;  3CC4 Q;  1KC8 R;  1K9M R;  1KQS P;  3I56 Q;  1VQO Q;  3CCU Q;  1QVF P;  1VQ6 Q;  1K73 R;  2OTJ Q;  3CCS Q;  3CCV Q;  3OW2 P;  2OTL Q;  3CD6 Q;  3G6E Q;  2QA4 Q;  1S72 Q;  1VQP Q;  3G4S Q;  2QEX Q;  1YIJ Q;  1QVG P;  3CCR Q;  1VQN Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...