1K73R

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2001-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1k73R00
3CD6Q 2QEXQ 1VQ8Q 3OW2P 3CCUQ 3CCMQ 3CMEQ 1N8RR 1YI2Q 1S72Q 3CXCP 3CCQQ 3CC4Q 1JJ2P 2OTLQ 1Q7YR 2QA4Q 3CC2Q 3G6EQ 3I56Q 1YITQ 3CPWP 1VQ7Q 1QVFP 1VQ4Q 1M90R 1VQMQ 1K8AR 1VQ5Q 3G4SQ 1VQNQ 3CCRQ 2OTJQ 1K9MR 3CCVQ 1Q82R 1VQOQ 1YIJQ 1KD1R 1M1KR 1Q86R 1VQPQ 1KC8R 1W2BP 1VQ9Q 3CC7Q 3CCSQ 3CCJQ 1Q81R 1YJWQ 3CCEQ 1VQ6Q 1YHQQ 3CCLQ 1QVGP 1VQLQ 3I55Q 1KQSP 3CMAQ 1VQKQ 1K73R 1YJNQ 3G71Q 1NJIR 1YJ9Q
chains in the Genus database with same CATH superfamily
3CD6A 2W0ZA 2V8KA 3CCUT 5IHKA 4PL6A 2GGRA 4PJNA 1M9SA 1RAFB 4DQ2A 1WNLA 1VQPT 3CCEA 4BE0A 1Q81C 3I55A 1GCQC 3A8HB 2EKHA 4M7DE 3UA6A 2COWA 1BI2A 3G71A 2ZGWA 3M4YA 3EH2A 3M55A 1YJ9A 2DTIA 3NHNA 3CCMA 2PUOB 5GANf 1WHJA 2RO0A 2HZYA 2QA4Q 1VIFA 1UEBA 2DXBA 7AT1B 2RJFA 2M02A 4FCYA 1VQNT 2LCCA 1MNEA 5IH2A 1MNDA 3JAME 2CP0A 5GAOr 1YJWT 3CBPA 1KQSP 4BB7A 2DA9A 4ZTFA 1SF9A 5FRNA 5CQYA 1AZGB 1WI7A 1UG1A 4M77D 4DOWA 4M7AD 4K11A 1KK7A 2PNIA 4OMNA 2CH4A 1LCKA 1X6GA 1QVGS 3RBBB 2O2OA 2DRKA 1FWZA 3EFOB 1Q86R 1UGRB 4D6WA 2BZXA 1VQ9Q 3CCSA 4FSXA 2MAMA 4QQ6A 3FEOA 5GAN2 1WJQA 1QVFS 1I5LA 3RESA 1G3TA 4FYXB 1MMDA 1OULA 2CH4W 1XNIA 2GNCA 3PTAA 2J05A 1JJ2P 1OEBA 3UF4A 5GAMf 1M30A 1EX4A 2RQUA 1E6GA 2EQUA 4B6MA 4V2SA 3M54A 3JB9F 1FXXA 1WLPB 4IUVA 1K9MU 5CKFA 4C8QD 4A54A 2RNAA 4O5VA 1TUCA 5HCKA 4A4EA 2KXDA 3OBWA 2FZGB 3ER0A 2V1QA 5GAMj 3G6EQ 1YITQ 4BDYA 2J6FA 3ULRB 5GAMg 1AHJB 1RUWA 1ZA1B 3CC7A 1WXBA 1PHTA 1QKWA 2E6ZA 4B9WA 2RK2A 1ABQA 1KQSA 3MEVA 3CBOA 1X01A 1PKTA 3L2ZA 1BKBA 2KYBA 1GBRA 1IO6A 3EGDA 4KH1B 2QYZA 2QA4T 3L2VA 2E12A 2AT1B 2HBPA 5IXFA 1K8AC 2P0QA 5GANd 1HXDA 3A98A 2DM1A 1NLOC 1UJYA 2HL5C 3JCMQ 1BCOA 3PVQA 4KGZB 2M1HA 4C0DB 2MWPA 1XTDA 3J81E 4J6WA 1M27C 3V7CA 1PRMC 2COYA 4NL2A 2BE9B 2W10A 1WHHA 1GCQA 2V26A 3H0FA 5FLXE 1JJ2A 3U23A 5A2QE 2K79A 3SHWA 3L2QA 1KC8R 2ED0A 3FB9A 1VQ9T 2K2MA 2V1RA 1ZLMA 5GAOn 3TVTA 3EGXB 4AFZC 4E6RA 3C12A 1G3SA 2IVWA 5D7UA 5KYWA 2O9VA 1M1GA 4OB3B 4CC3A 2JTMA 2DYIA 3PMTA 4M78C 3MP1A 1AOJA 4JJDA 1N8RC 3PE0A 4B9XA 1ZA2B 1J3TA 3QIIA 3JB9G 2VXEA 4M75D 3URGA 2EGEA 1KD1C 3OYJA 3O5ZA 4BACA 1UHCA 4MDWA 3RIRA 3VRZA 2MPXC 3OYFA 3OYHA 2V8JA 1ZBXA 2A08A 1T0HA 3V8LA 3OQ5A 2ZZDA 3RKYA 2LQKA 3AT1B 3TU4K 4D8KA 1SEMA 1QCFA 1QMCA 1K73U 2CZ7B 3KUFA 1D09B 2XMFA 4JRKA 2KE9A 2XU8A 3G6ET 1KQSS 1YITT 1B7TA 1WQ7A 3EG3A 3QDRB 2YUOA 2B86A 4OMOA 5KE3A 2DL4A 1YWPA 2DJZA 1WPYA 4HVVA 3PIOA 3DLLA 2LP5A 4IIMA 1WX6A 3SB2A 2ZPBB 2DILA 5I22A 3JCMf 2NYSA 3OMCA 3M9QA 2RN8A 2KR3A 5KYYB 4PNOA 4Z8AA 1FMWA 1JXMA 5ECAA 5CR2A 2GQVA 2J7IA 1ZQ1A 1K73C 1W4SA 1GFCA 2ED1A 3HFNA 3LH5A 4J9DA 3QWXX 1D0YA 3EG2A 2FRYA 3HTRA 3A1PA 4M77F 4M7AF 3CC4Q 2QDLA 1MV0B 1UE9A 2L3SA 5IHIA 3GPLA 4OGCA 3JCMg 4R0KA 2EAYA 2VKNA 1LJOA 2YRDA 3BY7A 3ASKA 1EZZB 4E7LA 4XU0A 2DTHA 2DXTA 3P8HA 5CCAA 1YJNQ 1QKXA 2DL3A 4DBQA 1AVZC 2E5KA 2KI7A 2CP6A 3OYGA 1G2BA 3CPWP 3GOXA 2F2WA 2QASA 1KHIA 2AHJB 3H6ZA 2E70A 2FZKB 3VS7A 4C8QF 3C4SA 1D3BB 1H641 2DKGA 2FHDA 4PLIA 5J3BA 2K3YA 4JRQA 4CI0C 4ZN3A 3VU3C 4PJOC 2YUNA 5GAOp 2FG0A 3O8VA 1B34A 1UGQB 1EIFA 3TSWA 1VQ7Q 2KRNA 3OA6A 1QCNA 4XTZA 1TXQA 3JCMc 2FEIA 4M78A 4ELZC 1IZ6A 2P4RA 4Y28E 1KSWA 2G6FX 1MMGA 1AWJA 1I5OB 2C0TA 1OI1A 4OB1B 1NBEB 4Y91A 4FT4A 3UATA 3I5RA 3KBGA 4L5GA 2QGFB 5IN1A 2OTLA 4PJMA 1BK2A 3VV0A 3FDRA 4LDWA 4RTTA 5GMKe 4J8OA 5CQXA 3X26B 2CT3A 4QT7A 3QG1A 5GAN8 3HL8A 4C0DC 4RTWA 3OS0A 5EC7A 4M7DC 3CMAA 2DIQA 2D6FA 2BE7D 3EG9B 4M77G 2DZCA 4M7AG 2AZVA 3VS1A 1PD0A 4HVUA 3THKA 4ZGJB 3QKJA 2EJ9A 4E7SA 3CC4T 2KQWA 3HHTB 1GFDA 3CPWA 1LVKA 3A8OB 2XI9A 3CBMA 4RTYA 2O88A 1D1CA 1VQ6A 3JB9H 1WHGA 4WCIA 4EDUA 3UT1A 4LNPA 3NTHA 4GLKA 2J6OA 2ENMA 1TWBA 1YJNT 3HPWA 5GAN5 1D1BA 2DF6A 2JMCA 4AG1C 1M3AA 2PQWA 4CRIA 3LGFA 4DBHA 4EMKB 4XTUA 1VQOA 4EPCA 2XDBA 4JJBA 2O01E 3VS4A 4C8QG 4RCBA 1Q81R 3M53A 2A0FB 3EFOA 1UFFA 4C92E 2XD0A 1ZSZB 2RB6A 2EJGA 3OB9A 2CP3A 2EPDA 1VYVA 1QW1A 5CIUA 3RNJA 2YLBA 4JJCA 3I9QA 4F7UF 1VQ7T 4RKUE 4AMCA 5M9OA 1N5ZA 2JZ2A 4MMKA 3L2UA 1RACB 4HCKA 1SKUB 3SWNC 3OW2S 3CCLQ 2NUPB 1AZEA 3VS0A 3ZL7C 1VQKQ 2VYTA 5KYUA 1TH7A 1WHMA 2WSEE 4E2FB 2F2VA 2MMPA 2MWOA 3I5SA 2NUTB 2R5MA 1HYOA 2AKKA 2CSIA 1RABB 4DEYA 1YIJQ 4PJOA 3MP6A 4KUIA 2DMOA 2EYQA 2D1XA 2K5IA 2RPNA 4OMPA 4KRTA 2HD0A 1GL5A 1TOVA 4DEXA 2LT4A 1MUZA 1OV3A 2K5LA 5LJ5h 4IUTA 4LE9A 1WHLA 2KRSA 2E3HA 4BE1A 2LC4A 1Y96A 2ZCFB 1WFWA 4M77B 4M7AB 1C0MA 2FZCB 2DBKA 2DX1A 4M75E 3A8MB 2GFAA 2K6DA 2CGHA 5CVIA 1YN8A 3BW1A 1VUBA 2DD5A 1KQ1A 2JW4A 4LDVA 1V29B 2LTOA 5LJ5e 4R56A 4OVAA 3VUZA 4BI4A 1YI2A 1R0BG 2HQEA 4M7DA 2EQMA 2EWNA 5AYFA 4M75G 2MOXA 5FWCA 2I0NA 3G4SA 2DTOA 1Q82R 2RJEA 3GIBA 4QQDA 4XTXA 1Q95G 2RQRA 1M90U 1TTHB 1YHQQ 3FJ5A 4KGXB 2EKOA 3E19A 3JSCA 3P8BB 2RM4A 4C8QB 4WTOB 3UPUA 5HY6A 4N0AC 1YWOA 4F7UG 1ARKA 2C0IA 2E10A 3JCMX 2QA4A 3E1SA 1NJIU 4RTXA 5GJVB 2EFIA 1K8AR 1S1NA 1JXOA 2CZ0B 1BBZA 1BCMA 1K76A 4ZGEB 1FMVA 2EW3A 1OYXA 3CCLT 5FRMA 2MF2A 2FVUA 1RAGB 1OU8A 2HSEB 2KXCA 5GMKi 5LL6S 1VQKT 1WDXA 4C0GA 3OYAA 3OYEA 5GAOq 5KH6A 2NWMA 3QDFA 1QVPA 1X2QA 4HCBA 3M59A 1UTIA 3PMIA 1UDLA 4JZ3A 5D6XA 2KT8A 1OPLA 2PVOB 1YIJT 1Q7YU 2HBWA 3MEUA 6AT1B 2JNGA 1SRLA 4J9GA 2DE0X 4OMMA 4PJJA 4GLMA 4AFQC 3GP8A 2KVQG 2EBPA 2D0QB 1NJIC 2P0KA 3SWNA 3KXTA 2HL3A 2VC8A 1N8RR 2CS7A 1BI0A 4CC2A 2CZ1B 3HRSA 2VASA 1KFZA 2Y4YA 4X34A 1KD1R 2L3RA 5KYYA 1I81A 2R58A 5DLQE 1TUDA 1N9SA 5GANj 3VKIA 4EMKC 1S72Q 3CCQQ 3G6EA 2K4YA 2LJ1A 5GANg 1ZUKA 4XTVA 3ZEHA 2CDTA 2R5AA 4M75B 2MYSA 3L42A 1YHQT 1M1KU 2XKOC 1PSEA 4J83A 1PWTA 2E65A 2XDPA 3OY9A 2RI3A 4NL3A 3CD6Q 1PC0A 3CMEA 1GXIE 1V76A 3V7RA 2PZ1A 2MI6A 2DAQA 2RH2A 3A8LB 1VQ5A 5KYXB 3CCRA 1NLPC 4FSSA 3JCMb 3QZ5B 4F7UB 3OS2A 2C06A 4BI3A 2M0OA 2RF0A 2QQSA 3VJPA 4QVCA 1QLYA 3I55Q 3OYNA 3G71Q 1OPKA 4CC4B 1YJ9Q 1KIKA 1D3BA 2R57A 1EFNA 4RTVA 3CCMQ 1MMAA 3CXCP 3I35A 4J9HA 4VUBA 2LVMA 5GMKj 2AIRB 3JCMW 1G5VA 2CKKA 3UWNA 1T3LA 1KHCA 1M1KC 4ORZA 4N0AA 3RMQA 1M8VA 1B07A 3H0IA 4J9BA 2DK3A 3QJ6A 5LJ3h 3JCMJ 4HT9A 2QTXA 2RHIA 2F2XA 2HCKA 2XDDA 4M78D 4M7AC 3I56A 2H3EB 3ME9A 3MKDA 3JB9J 2EYZA 1X6OA 4LDUA 1K9MC 2D9TA 1GCPA 1ABOA 2CSQA 2X4WA 3M0RA 3CCSQ 3MEAA 1JO8A 1SG5A 2OX7A 2RJCA 3OS5A 1R8OB 2HQHA 5LJ3e 2LQNA 4EMGA 4FT2A 1QP3A 3RERA 3JCMV 4XK8E 2QGGA 3QO3A 2K9GA 1KJWA 1S72T 3CCQT 2YWWA 1VQMQ 3J80E 1B3QA 2D8HA 2VXFA 4J6XA 2LZ6B 3CCJA 2FB7A 2ZPFB 3M5AA 3MEWA 3L1AA 4L59A 2JXBA 2DEQA 2AKLA 1CKAA 2KGTA 4RG2A 1QCOA 2WACA 5GAOm 1Y57A 3CD6T 1RL2A 4XAXB 1ZHIA 1T0JA 2EVRA 2GFUA 3CXCA 2ESWA 5FWBA 4Y92A 3TREA 2VGNA 2O4XB 3CC7Q 4PFOA 1YBYA 3NGPA 4EMKA 2MIOA 4FYWB 3SEMA 4C92C 2E1HA 1VQLQ 1OX8A 1OX9A 1Q86U 4BY6B 3G71T 1WIEA 1ZX6A 1XOVA 3NTKA 5CK9A 1M2VB 1YJ9T 1ZSZA 2KROA 2QG9B 2FRWA 3M0TA 2EQKA 3CCMT 1WQWA 2OAUA 2E6NA 3ZFJA 4AT1B 3LX7A 1AWWA 1QP2A 1WJRA 1X43A 2BZYA 2WSCE 2M0YA 2OJ2A 3X25B 2XICA 2NUPA 4JPBW 2K5FA 1M4ZA 5GAN7 4ZGDB 3OYKA 1WXUA 2YRCA 4FM4B 5A0GA 2NUTA 1Q86C 4QKUA 4A4HA 3CQTA 3GLXA 3CCST 4A53A 1JJ2S 2VVKA 4IKFA 5CO7A 5I2SA 4PJOD 1FX7A 5KCOA 1T3SA 2KMTA 2HEQA 1D1AA 2HKQB 3DLMA 1VQMT 4M75C 1F1BB 1RLPC 4M7AA 2CYZB 3G1JA 1N9RA 3PGGA 1IB8A 1V1CA 1LNXA 3BFMA 2FYKA 2YDLA 1RAHB 4AFSC 1FMKA 5GANh 1JRIA 4FU6A 3HP9A 2DL8A 1G8XA 3VYGA 1WXTA 1BIBA 2SEMA 1TS9A 2K3XA 2VB6A 5AT1B 3IQLA 2DYBA 3T9NA 2JUFA 1YCSB 1VYUA 3CC7T 4M7DD 1VQLT 1SSFA 1PRLC 5D6YA 4AFUC 3RR6A 1KC8U 4C5GA 5HK3A 4OB2B 1QWEA 2O9SA 3V7SA 2QEXQ 2X35A 1ZSGA 4FYVB 4JS5A 1ZBJA 4RG8A 1BU1A 4Z88A 2OTJA 1NYGA 1RAIB 2NUZA 3P8DA 4L6V5 1H3ZA 2X3WD 1W6XA 1OQKA 2DXUA 1RI9A 5IHNA 1WYXA 4ME7A 2HAXA 2KSSA 5FU7B 1O75A 3KFVA 3TEEA 4M78F 5GAMh 4C92A 4Q5WA 4M77E 4M7AE 4KH0B 2K7AA 2FL7A 1VQ4A 1UB4A 2RMOA 4HXJA 2F5TX 3OMGA 4XU2A 5LJ5d 2HMAA 5D6WA 1Y71A 1K4US 1UGVA 1K1ZA 2X9HA 2RQVA 1RAAB 5GAN3 2YUPA 4TVRA 3S6WA 1IHVA 1E7OA 3FC3A 2RQWA 1Y0MA 5GAMe 2SRCA 3SFMA 2MCNA 4ATOA 2CP7A 4XQ3A 3LH0A 4E7JA 3LWIA 5J39A 2JMAA 3M0QA 4HCZA 2XG8D 2RHYA 4C8QE 5GAOl 4QVZA 3LYIA 3RUXA 2KY9A 3PNWC 4OMLA 3CCUA 3NFCA 1RI0A 4O6JA 4X9CA 5CAIA 1NM7A 1XQHA 4YTLA 1UHFA 3CCVQ 3DKMA 5J26A 3MHXA 4R55A 1VQPA 3OYYA 5KYWB 3OYDA 2QDYB 2XHCA 2DO3A 4JUVA 3X20B 2DVEA 4IURA 5IXBA 3REBB 2WSFE 4M75A 2D8JA 3PT9A 1NPRA 2A28A 2HDAA 2CP2A 2DJQA 1MV3A 2X4JA 1VQ8Q 2QEXT 1IXDA 3GF5A 2QQ9A 1I1JA 2OTLQ 4GY5A 4HCCA 2KEAA 5CKEA 1VQNA 2BZ8A 2KBTA 4F04B 3M0SA 5KYXA 2XIDA 1YJWA 4ZNXA 2E5QA 4JRPA 4OMQA 3CMAQ 2DPPB 4M78G 5CKBA 1WHKA 1NE8A 3BDLA 4ANJA 2X4XA 2K57A 2Y4XA 4KT0E 1HJDA 3EFSA 1YHQA 3MO8A 1VQ6Q 1QVGP 2CREA 4FIBA 2V8IA 2LQWA 2YRVA 2EQJA 3EAEA 4A4FA 3CPWS 1UJ0A 4IUQA 2RQTA 4J7FA 4PJOF 2YSQA 4LUDA 1UECA 3J7AF 4GBQA 3S3NA 1M3CA 1N27A 1IGQA 1VQOQ 4HT8A 2DRMA 1NG2A 4OP0A 3VUBA 3OS1A 4MZPA 3MP8A 4C0FA 1M8MA 4OF1A 2E3IA 1M3BA 3JCMh 2D0NA 3CPFA 4EIKA 2JVVA 1C6VX 2X51A 4F7UE 4C5HA 5GMKm 2L8DA 3CCVT 3QWYA 2K2VA 1K9AA 3M58A 3LWHA 4C5IA 4M7DF 3L2RA 2RJDA 3EGXA 3N5BB 5GJWB 1RLQC 1VIEA 1VQ8T 1BYMA 1U3OA 5HK0A 4PKCC 3JCMe 2OTLT 2EYXA 4JS4A 4IIOA 4M4ZA 1K9MR 1OOTA 3MJXA 5FW9A 3OYCA 4A63B 2E41A 2CUDA 1QVGA 2PU9B 3CMAT 2DFUA 3EHQA 3HKSA 3QYHB 4HKEA 4RMOA 2ZPGB 1LPLA 5HKCA 4UC4A 3OYMA 4M78B 1M2VA 1ZUYA 1TU0B 5LJ3d 1M90C 3PIPA 2HQXA 5A0LA 2F1LA 3JCMP 2JJ9A 4C5EA 1VQ9A 1RADB 2J6KA 2COZA 5IT9E 1D0ZA 2IIMA 1VQ6T 3QXEB 3REAB 4KBMB 1JEGA 2YT6A 4PJOG 2KK4A 4E7KA 4NOYA 1YI2Q 1N6AA 5C6SA 2JS0A 2JS2A 1VOMA 1KQ2A 3G4SQ 3E2UA 1VQOT 3AHUA 3VS6A 2OI3A 3PVLA 1H3HA 1AWOA 3QSUA 3M0PA 1OZ2A 3GBQA 1PSFA 3QBYA 4ESRA 4JRIA 2CT4A 2JM9A 2LJ0A 4EMHA 4N4GA 1SRMA 4FW2A 5DLOA 5IAYA 3MCAB 1YNZA 3CC2Q 1YITA 1Q7YC 3OSSC 1U5SA 1RAEB 2RK1A 4M7DG 1ZSZC 3F70A 2LCSA 2DD4A 2QTVA 2DIGA 1TUGB 4DA4A 2L89A 3H8ZA 4J7IA 2DERA 3OYIA 4E7HA 5FU6B 3M57A 4E7IA 2QXFA 2MK5A 5I21A 1G83A 2ROTA 3CCEQ 2DVJA 1VA7A 1Q82U 2IPOB 2O31A 3MPUB 2G3RA 1K73R 2QQRA 1O9SA 1M2OA 1JQQA 2FPFA 2XK0A 5L23A 1SPKA 1VQMA 4LD9K 1QQJA 1X6BA 4LD6A 3TSZA 3QHSA 3TQ7P 4DBRA 3A5ZB 2L3PA 2L0AA 5KYUB 1K8AU 4DBFA 4CC7A 1X75C 4OMFB 1U8RA 4KGVB 4BD3A 2DLPA 2RHUA 5A0DA 2EJFA 4HA8A 4J9EA 4M77C 5CKHA 2RD1A 1YI2T 4PJOB 2LMJA 5FROA 1TG0A 3G4ST 1Q82C 3NMZC 2LX9A 1PCXA 1VQLA 2ZPHB 4C92D 2RI2A 3QPHA 2M16A 1SHFA 1Y96B 3FRNA 2LNHB 1UUEA 3CMEQ 4ZN1A 5GMKl 3C95A 3RDVA 3EG9A 4A4GA 2GBQA 2QAZA 4MZMA 1X2KA 3CC2T 1K0SA 2Z0WA 3OYLA 2RA2A 1VQ5Q 3CCRQ 1N8RU 4XTWA 4RUGA 4Z02A 2PVDB 2BIVA 1LOJA 4C0ZA 1KD1U 3DB3A 4C8QC 2LNVA 3HRUA 2ATCB 3LW5E 4M7DB 2DNUA 4JDSA 1E6HA 1X69A 4OB0B 3INZA 2DZ9A 4LDYA 4P5NA 3SDZA 2LRQA 3S3OA 4IUPA 2EYYA 3UDCA 3CCET 2DXCA 1YCYA 2QI2A 3SD4A 3JRZA 3I55T 4II1A 3NPFA 2QK0A 4D8DA 3L2WA 3RMSA 2VGMA 4LUEA 3R6OA 1MMNA 2RHZA 3ZBDA 3CC4A 2PVGB 5KYNA 2H3JA 3I56Q 5GAN6 4N4IA 4QQGA 2AK5A 2QQAA 2YLCA 2KDSA 5GAMd 3RKXA 3G7ZA 1YJNA 2BTTA 5KCHA 2ABLA 2YHTA 3M56A 2HSPA 1UGSB 4RTZA 2JM8A 2EQIA 4ELYC 5LJ5f 1XJWB 1IREB 3GNGA 2BUDA 1M1FA 4MMLA 3VS2A 3QYGB 2ZPEB 3CCJQ 1U1TA 2DL5A 2M51A 4X1VA 2YUQA 3E9GA 3SWNB 1H92A 3OYBA 3JV3A 1HD3A 1BI3A 2X3XD 2FO0A 2QEXA 4MZTA 5LJ5j 1K0XA 2JT4A 2LCLA 3CMET 3OSVA 2DL7A 5LJ5g 1VQ7A 3WXMB 1VQ5T 3CCRT 2PTKA 2FPEA 3JB9I 3CEYA 1JBMA 2LJ3A 4M77A 1NEBA 1W1FA 3Q1JA 4N4HA 3CXCS 1WGSA 1BIAA 2LDMA 4IUUA 3OW2P 2KNBB 2CP5A 3HFOA 5FU6C 3X28B 1PG5B 1U1SA 3EGUA 3EFRA 3UA7A 1AT1B 2KRMA 4AG2C 1W2BP 3R6NA 4ZTJA 2BKDN 3NTIA 1ZUUA 1TSFA 3V8KA 1D0XA 3TCJA 2IG0A 2YXYA 5GANe 4J6YA 1BI1A 1X27A 4WF2A 2GQIA 4C8QA 5I2MA 4RTUA 1Y7XA 3EG0A 4XU1A 3I56T 1NYFA 4OGEA 4JLIA 3FLGA 3FJPA 4BI8B 1WZOA 2LX7A 1IHWA 1Y07A 1WJSA 2A37A 1OU9A 1FYNA 4LN2A 5GMKh 2GTJA 2EYWA 1PNJA 2C0OA 3CCVA 3EHRA 1M5Q1 1W70A 1G3WA 4KULA 3C0CA 3E9FA 2JTEA 3BDUA 2AZSA 3EG1A 1KC8C 3CCJT 4C92F 1JB0E 1P92A 2LQ8A 2FPDA 1R77A 3EGDB 1VQ8A 1I0CA 1KG1A 3V8JA 3OW2A 1C1AA 1OZ3A 1IRXA 1YFNA 3FIFA 2ECZA 2RHXA 2JTFA 2X4YA 1DJ7B 3EH1A 3S3MA 1W2BA 4J9CA 3JCMd 4F17A 3CCLA 2VUBA 3DB4A 4XTYA 4QVDA 1VQKA 2GF7A 2H8HA 2EGAA 9ATCB 2B8AA 2A36A 4QW2A 2L2PA 2P0PA 4MDXA 1M90R 2ROLA 4RCCA 2OTJQ 1VYTA 2LT1A 1YIJA 2KT1A 4JZ4A 4XU3A 1A0NB 1MHNA 2ZAEA 1I07A 4BY6C 4BUGA 1JU5C 5GAN4 1G3YA 4J5YA 1NJIR 4PFPA 4M78E 2DETA 1PM3A 8ATCB 1AWXA 1VQ4Q 1Z9ZA 4M75F 4FL6A 3OBYA 4FYYB 1U06A 1NZ9A 2F5KA 2A3LA 4F7UA 1BB9A 3WVEB 2E4HA 1GBQA 2HNIA 4J9FA 1I4K1 4PJLA 5LJ3f 2J06A 4BE2A 1Q7YR 1WA7A 2GTOA 4F14A 4NS5A 3VYHB 1GRIA 1PD1A 1YP5A 4JJNK 4PLLA 4C92G 2P4TA 2E64A 3JB9D 4JLGA 3PFSA 1NEGA 2RI5A 3QUIA 4A4KA 2KYMA 5LJ3j 1W2BS 2DBMA 3CCUQ 5LJ3g 4KUDK 5DM7R 1QVFP 4Z89A 3M0UA 3A8GB 1NPPA 4E47A 1VQPQ 4LDXA 5DY9A 3H9NA 2P84A 2I2LA 2EIFA 2VV5A 3LGLA 1AEYA 4E7ZA 3QZ9B 3H0HA 2JOYA 2OAWA 3QJYA 4FW1A 1CSKA 4X9DA 1HK9A 3GNFB 1MGQA 3VS5A 1QWFA 1VQNQ 5I11A 3D7SB 2JN0A 2OTJT 3LLRA 1M1KR 4BDZA 1H8KA 1UGPB 2VWFA 5KE2A 1YJWQ 3VRYA 5C0MA 3WVDB 1R0CB 2L3QA 5EG2A 3VS3A 4PK4A 1I8FA 2CZ6B 5L8RE 5CKDA 3X24B 3C94A 1AD5A 2F69A 3H41A 3BE3A 2K3BA 2L5QA 3M4GA 1PKSA 1VQ4T 2KAFA 2A7YA 4HVWA 1HSQA 5FU7C 2O4XA 1Q81U 2EGCA 4LXCA 2QQBA 3HSBA 2GCXA 1B34B 4PFZA 3HRTA 4PJOE 1IGUA 1S72A 2HKNA 3CCQA 3CC2A 1Z9QA 2DEUA 2ZPIB 1QVFA 1CKBA 4J9IA 3META 4F16A 2Y90A 1SHGA 1SSHA 8AT1B 2CUBA 1ACMB 2M9UA 4C92B 4DOVA 3RKWA 2PUKB 2NLUA
chains in the Genus database with same CATH topology
3CD6Q 2QEXQ 1VQ8Q 3OW2P 3CCUQ 3CCMQ 3CMEQ 1N8RR 1YI2Q 1S72Q 3CXCP 3CCQQ 3CC4Q 1JJ2P 2OTLQ 1Q7YR 2QA4Q 3CC2Q 3G6EQ 3I56Q 1YITQ 3CPWP 1VQ7Q 1QVFP 1VQ4Q 1M90R 1VQMQ 1K8AR 1VQ5Q 3G4SQ 1VQNQ 3CCRQ 2OTJQ 1K9MR 3CCVQ 1Q82R 1VQOQ 1YIJQ 1KD1R 1M1KR 1Q86R 1VQPQ 1KC8R 1W2BP 1VQ9Q 3CC7Q 3CCSQ 3CCJQ 1Q81R 1YJWQ 3CCEQ 1VQ6Q 1YHQQ 3CCLQ 1QVGP 1VQLQ 3I55Q 1KQSP 3CMAQ 1VQKQ 1K73R 1YJNQ 3G71Q 1NJIR 1YJ9Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 Q;  2QEX Q;  1VQ8 Q;  3OW2 P;  3CCU Q;  3CCM Q;  3CME Q;  1N8R R;  1YI2 Q;  1S72 Q;  3CXC P;  3CCQ Q;  3CC4 Q;  1JJ2 P;  2OTL Q;  1Q7Y R;  2QA4 Q;  3CC2 Q;  3G6E Q;  3I56 Q;  1YIT Q;  3CPW P;  1VQ7 Q;  1QVF P;  1VQ4 Q;  1M90 R;  1VQM Q;  1K8A R;  1VQ5 Q;  3G4S Q;  1VQN Q;  3CCR Q;  2OTJ Q;  1K9M R;  3CCV Q;  1Q82 R;  1VQO Q;  1YIJ Q;  1KD1 R;  1M1K R;  1Q86 R;  1VQP Q;  1KC8 R;  1W2B P;  1VQ9 Q;  3CC7 Q;  3CCS Q;  3CCJ Q;  1Q81 R;  1YJW Q;  3CCE Q;  1VQ6 Q;  1YHQ Q;  3CCL Q;  1QVG P;  1VQL Q;  3I55 Q;  1KQS P;  3CMA Q;  1VQK Q;  1K73 R;  1YJN Q;  3G71 Q;  1NJI R;  1YJ9 Q; 
#chains in the Genus database with same CATH topology
 3CD6 A;  2W0Z A;  2V8K A;  3CCU T;  5IHK A;  4PL6 A;  2GGR A;  4PJN A;  1M9S A;  1RAF B;  4DQ2 A;  1WNL A;  1VQP T;  3CCE A;  4BE0 A;  1Q81 C;  3I55 A;  1GCQ C;  3A8H B;  2EKH A;  4M7D E;  3UA6 A;  2COW A;  1BI2 A;  3G71 A;  2ZGW A;  3M4Y A;  3EH2 A;  3M55 A;  1YJ9 A;  2DTI A;  3NHN A;  3CCM A;  2PUO B;  5GAN f;  1WHJ A;  2RO0 A;  2HZY A;  2QA4 Q;  1VIF A;  1UEB A;  2DXB A;  7AT1 B;  2RJF A;  2M02 A;  4FCY A;  1VQN T;  2LCC A;  1MNE A;  5IH2 A;  1MND A;  3JAM E;  2CP0 A;  5GAO r;  1YJW T;  3CBP A;  1KQS P;  4BB7 A;  2DA9 A;  4ZTF A;  1SF9 A;  5FRN A;  5CQY A;  1AZG B;  1WI7 A;  1UG1 A;  4M77 D;  4DOW A;  4M7A D;  4K11 A;  1KK7 A;  2PNI A;  4OMN A;  2CH4 A;  1LCK A;  1X6G A;  1QVG S;  3RBB B;  2O2O A;  2DRK A;  1FWZ A;  3EFO B;  1Q86 R;  1UGR B;  4D6W A;  2BZX A;  1VQ9 Q;  3CCS A;  4FSX A;  2MAM A;  4QQ6 A;  3FEO A;  5GAN 2;  1WJQ A;  1QVF S;  1I5L A;  3RES A;  1G3T A;  4FYX B;  1MMD A;  1OUL A;  2CH4 W;  1XNI A;  2GNC A;  3PTA A;  2J05 A;  1JJ2 P;  1OEB A;  3UF4 A;  5GAM f;  1M30 A;  1EX4 A;  2RQU A;  1E6G A;  2EQU A;  4B6M A;  4V2S A;  3M54 A;  3JB9 F;  1FXX A;  1WLP B;  4IUV A;  1K9M U;  5CKF A;  4C8Q D;  4A54 A;  2RNA A;  4O5V A;  1TUC A;  5HCK A;  4A4E A;  2KXD A;  3OBW A;  2FZG B;  3ER0 A;  2V1Q A;  5GAM j;  3G6E Q;  1YIT Q;  4BDY A;  2J6F A;  3ULR B;  5GAM g;  1AHJ B;  1RUW A;  1ZA1 B;  3CC7 A;  1WXB A;  1PHT A;  1QKW A;  2E6Z A;  4B9W A;  2RK2 A;  1ABQ A;  1KQS A;  3MEV A;  3CBO A;  1X01 A;  1PKT A;  3L2Z A;  1BKB A;  2KYB A;  1GBR A;  1IO6 A;  3EGD A;  4KH1 B;  2QYZ A;  2QA4 T;  3L2V A;  2E12 A;  2AT1 B;  2HBP A;  5IXF A;  1K8A C;  2P0Q A;  5GAN d;  1HXD A;  3A98 A;  2DM1 A;  1NLO C;  1UJY A;  2HL5 C;  3JCM Q;  1BCO A;  3PVQ A;  4KGZ B;  2M1H A;  4C0D B;  2MWP A;  1XTD A;  3J81 E;  4J6W A;  1M27 C;  3V7C A;  1PRM C;  2COY A;  4NL2 A;  2BE9 B;  2W10 A;  1WHH A;  1GCQ A;  2V26 A;  3H0F A;  5FLX E;  1JJ2 A;  3U23 A;  5A2Q E;  2K79 A;  3SHW A;  3L2Q A;  1KC8 R;  2ED0 A;  3FB9 A;  1VQ9 T;  2K2M A;  2V1R A;  1ZLM A;  5GAO n;  3TVT A;  3EGX B;  4AFZ C;  4E6R A;  3C12 A;  1G3S A;  2IVW A;  5D7U A;  5KYW A;  2O9V A;  1M1G A;  4OB3 B;  4CC3 A;  2JTM A;  2DYI A;  3PMT A;  4M78 C;  3MP1 A;  1AOJ A;  4JJD A;  1N8R C;  3PE0 A;  4B9X A;  1ZA2 B;  1J3T A;  3QII A;  3JB9 G;  2VXE A;  4M75 D;  3URG A;  2EGE A;  1KD1 C;  3OYJ A;  3O5Z A;  4BAC A;  1UHC A;  4MDW A;  3RIR A;  3VRZ A;  2MPX C;  3OYF A;  3OYH A;  2V8J A;  1ZBX A;  2A08 A;  1T0H A;  3V8L A;  3OQ5 A;  2ZZD A;  3RKY A;  2LQK A;  3AT1 B;  3TU4 K;  4D8K A;  1SEM A;  1QCF A;  1QMC A;  1K73 U;  2CZ7 B;  3KUF A;  1D09 B;  2XMF A;  4JRK A;  2KE9 A;  2XU8 A;  3G6E T;  1KQS S;  1YIT T;  1B7T A;  1WQ7 A;  3EG3 A;  3QDR B;  2YUO A;  2B86 A;  4OMO A;  5KE3 A;  2DL4 A;  1YWP A;  2DJZ A;  1WPY A;  4HVV A;  3PIO A;  3DLL A;  2LP5 A;  4IIM A;  1WX6 A;  3SB2 A;  2ZPB B;  2DIL A;  5I22 A;  3JCM f;  2NYS A;  3OMC A;  3M9Q A;  2RN8 A;  2KR3 A;  5KYY B;  4PNO A;  4Z8A A;  1FMW A;  1JXM A;  5ECA A;  5CR2 A;  2GQV A;  2J7I A;  1ZQ1 A;  1K73 C;  1W4S A;  1GFC A;  2ED1 A;  3HFN A;  3LH5 A;  4J9D A;  3QWX X;  1D0Y A;  3EG2 A;  2FRY A;  3HTR A;  3A1P A;  4M77 F;  4M7A F;  3CC4 Q;  2QDL A;  1MV0 B;  1UE9 A;  2L3S A;  5IHI A;  3GPL A;  4OGC A;  3JCM g;  4R0K A;  2EAY A;  2VKN A;  1LJO A;  2YRD A;  3BY7 A;  3ASK A;  1EZZ B;  4E7L A;  4XU0 A;  2DTH A;  2DXT A;  3P8H A;  5CCA A;  1YJN Q;  1QKX A;  2DL3 A;  4DBQ A;  1AVZ C;  2E5K A;  2KI7 A;  2CP6 A;  3OYG A;  1G2B A;  3CPW P;  3GOX A;  2F2W A;  2QAS A;  1KHI A;  2AHJ B;  3H6Z A;  2E70 A;  2FZK B;  3VS7 A;  4C8Q F;  3C4S A;  1D3B B;  1H64 1;  2DKG A;  2FHD A;  4PLI A;  5J3B A;  2K3Y A;  4JRQ A;  4CI0 C;  4ZN3 A;  3VU3 C;  4PJO C;  2YUN A;  5GAO p;  2FG0 A;  3O8V A;  1B34 A;  1UGQ B;  1EIF A;  3TSW A;  1VQ7 Q;  2KRN A;  3OA6 A;  1QCN A;  4XTZ A;  1TXQ A;  3JCM c;  2FEI A;  4M78 A;  4ELZ C;  1IZ6 A;  2P4R A;  4Y28 E;  1KSW A;  2G6F X;  1MMG A;  1AWJ A;  1I5O B;  2C0T A;  1OI1 A;  4OB1 B;  1NBE B;  4Y91 A;  4FT4 A;  3UAT A;  3I5R A;  3KBG A;  4L5G A;  2QGF B;  5IN1 A;  2OTL A;  4PJM A;  1BK2 A;  3VV0 A;  3FDR A;  4LDW A;  4RTT A;  5GMK e;  4J8O A;  5CQX A;  3X26 B;  2CT3 A;  4QT7 A;  3QG1 A;  5GAN 8;  3HL8 A;  4C0D C;  4RTW A;  3OS0 A;  5EC7 A;  4M7D C;  3CMA A;  2DIQ A;  2D6F A;  2BE7 D;  3EG9 B;  4M77 G;  2DZC A;  4M7A G;  2AZV A;  3VS1 A;  1PD0 A;  4HVU A;  3THK A;  4ZGJ B;  3QKJ A;  2EJ9 A;  4E7S A;  3CC4 T;  2KQW A;  3HHT B;  1GFD A;  3CPW A;  1LVK A;  3A8O B;  2XI9 A;  3CBM A;  4RTY A;  2O88 A;  1D1C A;  1VQ6 A;  3JB9 H;  1WHG A;  4WCI A;  4EDU A;  3UT1 A;  4LNP A;  3NTH A;  4GLK A;  2J6O A;  2ENM A;  1TWB A;  1YJN T;  3HPW A;  5GAN 5;  1D1B A;  2DF6 A;  2JMC A;  4AG1 C;  1M3A A;  2PQW A;  4CRI A;  3LGF A;  4DBH A;  4EMK B;  4XTU A;  1VQO A;  4EPC A;  2XDB A;  4JJB A;  2O01 E;  3VS4 A;  4C8Q G;  4RCB A;  1Q81 R;  3M53 A;  2A0F B;  3EFO A;  1UFF A;  4C92 E;  2XD0 A;  1ZSZ B;  2RB6 A;  2EJG A;  3OB9 A;  2CP3 A;  2EPD A;  1VYV A;  1QW1 A;  5CIU A;  3RNJ A;  2YLB A;  4JJC A;  3I9Q A;  4F7U F;  1VQ7 T;  4RKU E;  4AMC A;  5M9O A;  1N5Z A;  2JZ2 A;  4MMK A;  3L2U A;  1RAC B;  4HCK A;  1SKU B;  3SWN C;  3OW2 S;  3CCL Q;  2NUP B;  1AZE A;  3VS0 A;  3ZL7 C;  1VQK Q;  2VYT A;  5KYU A;  1TH7 A;  1WHM A;  2WSE E;  4E2F B;  2F2V A;  2MMP A;  2MWO A;  3I5S A;  2NUT B;  2R5M A;  1HYO A;  2AKK A;  2CSI A;  1RAB B;  4DEY A;  1YIJ Q;  4PJO A;  3MP6 A;  4KUI A;  2DMO A;  2EYQ A;  2D1X A;  2K5I A;  2RPN A;  4OMP A;  4KRT A;  2HD0 A;  1GL5 A;  1TOV A;  4DEX A;  2LT4 A;  1MUZ A;  1OV3 A;  2K5L A;  5LJ5 h;  4IUT A;  4LE9 A;  1WHL A;  2KRS A;  2E3H A;  4BE1 A;  2LC4 A;  1Y96 A;  2ZCF B;  1WFW A;  4M77 B;  4M7A B;  1C0M A;  2FZC B;  2DBK A;  2DX1 A;  4M75 E;  3A8M B;  2GFA A;  2K6D A;  2CGH A;  5CVI A;  1YN8 A;  3BW1 A;  1VUB A;  2DD5 A;  1KQ1 A;  2JW4 A;  4LDV A;  1V29 B;  2LTO A;  5LJ5 e;  4R56 A;  4OVA A;  3VUZ A;  4BI4 A;  1YI2 A;  1R0B G;  2HQE A;  4M7D A;  2EQM A;  2EWN A;  5AYF A;  4M75 G;  2MOX A;  5FWC A;  2I0N A;  3G4S A;  2DTO A;  1Q82 R;  2RJE A;  3GIB A;  4QQD A;  4XTX A;  1Q95 G;  2RQR A;  1M90 U;  1TTH B;  1YHQ Q;  3FJ5 A;  4KGX B;  2EKO A;  3E19 A;  3JSC A;  3P8B B;  2RM4 A;  4C8Q B;  4WTO B;  3UPU A;  5HY6 A;  4N0A C;  1YWO A;  4F7U G;  1ARK A;  2C0I A;  2E10 A;  3JCM X;  2QA4 A;  3E1S A;  1NJI U;  4RTX A;  5GJV B;  2EFI A;  1K8A R;  1S1N A;  1JXO A;  2CZ0 B;  1BBZ A;  1BCM A;  1K76 A;  4ZGE B;  1FMV A;  2EW3 A;  1OYX A;  3CCL T;  5FRM A;  2MF2 A;  2FVU A;  1RAG B;  1OU8 A;  2HSE B;  2KXC A;  5GMK i;  5LL6 S;  1VQK T;  1WDX A;  4C0G A;  3OYA A;  3OYE A;  5GAO q;  5KH6 A;  2NWM A;  3QDF A;  1QVP A;  1X2Q A;  4HCB A;  3M59 A;  1UTI A;  3PMI A;  1UDL A;  4JZ3 A;  5D6X A;  2KT8 A;  1OPL A;  2PVO B;  1YIJ T;  1Q7Y U;  2HBW A;  3MEU A;  6AT1 B;  2JNG A;  1SRL A;  4J9G A;  2DE0 X;  4OMM A;  4PJJ A;  4GLM A;  4AFQ C;  3GP8 A;  2KVQ G;  2EBP A;  2D0Q B;  1NJI C;  2P0K A;  3SWN A;  3KXT A;  2HL3 A;  2VC8 A;  1N8R R;  2CS7 A;  1BI0 A;  4CC2 A;  2CZ1 B;  3HRS A;  2VAS A;  1KFZ A;  2Y4Y A;  4X34 A;  1KD1 R;  2L3R A;  5KYY A;  1I81 A;  2R58 A;  5DLQ E;  1TUD A;  1N9S A;  5GAN j;  3VKI A;  4EMK C;  1S72 Q;  3CCQ Q;  3G6E A;  2K4Y A;  2LJ1 A;  5GAN g;  1ZUK A;  4XTV A;  3ZEH A;  2CDT A;  2R5A A;  4M75 B;  2MYS A;  3L42 A;  1YHQ T;  1M1K U;  2XKO C;  1PSE A;  4J83 A;  1PWT A;  2E65 A;  2XDP A;  3OY9 A;  2RI3 A;  4NL3 A;  3CD6 Q;  1PC0 A;  3CME A;  1GXI E;  1V76 A;  3V7R A;  2PZ1 A;  2MI6 A;  2DAQ A;  2RH2 A;  3A8L B;  1VQ5 A;  5KYX B;  3CCR A;  1NLP C;  4FSS A;  3JCM b;  3QZ5 B;  4F7U B;  3OS2 A;  2C06 A;  4BI3 A;  2M0O A;  2RF0 A;  2QQS A;  3VJP A;  4QVC A;  1QLY A;  3I55 Q;  3OYN A;  3G71 Q;  1OPK A;  4CC4 B;  1YJ9 Q;  1KIK A;  1D3B A;  2R57 A;  1EFN A;  4RTV A;  3CCM Q;  1MMA A;  3CXC P;  3I35 A;  4J9H A;  4VUB A;  2LVM A;  5GMK j;  2AIR B;  3JCM W;  1G5V A;  2CKK A;  3UWN A;  1T3L A;  1KHC A;  1M1K C;  4ORZ A;  4N0A A;  3RMQ A;  1M8V A;  1B07 A;  3H0I A;  4J9B A;  2DK3 A;  3QJ6 A;  5LJ3 h;  3JCM J;  4HT9 A;  2QTX A;  2RHI A;  2F2X A;  2HCK A;  2XDD A;  4M78 D;  4M7A C;  3I56 A;  2H3E B;  3ME9 A;  3MKD A;  3JB9 J;  2EYZ A;  1X6O A;  4LDU A;  1K9M C;  2D9T A;  1GCP A;  1ABO A;  2CSQ A;  2X4W A;  3M0R A;  3CCS Q;  3MEA A;  1JO8 A;  1SG5 A;  2OX7 A;  2RJC A;  3OS5 A;  1R8O B;  2HQH A;  5LJ3 e;  2LQN A;  4EMG A;  4FT2 A;  1QP3 A;  3RER A;  3JCM V;  4XK8 E;  2QGG A;  3QO3 A;  2K9G A;  1KJW A;  1S72 T;  3CCQ T;  2YWW A;  1VQM Q;  3J80 E;  1B3Q A;  2D8H A;  2VXF A;  4J6X A;  2LZ6 B;  3CCJ A;  2FB7 A;  2ZPF B;  3M5A A;  3MEW A;  3L1A A;  4L59 A;  2JXB A;  2DEQ A;  2AKL A;  1CKA A;  2KGT A;  4RG2 A;  1QCO A;  2WAC A;  5GAO m;  1Y57 A;  3CD6 T;  1RL2 A;  4XAX B;  1ZHI A;  1T0J A;  2EVR A;  2GFU A;  3CXC A;  2ESW A;  5FWB A;  4Y92 A;  3TRE A;  2VGN A;  2O4X B;  3CC7 Q;  4PFO A;  1YBY A;  3NGP A;  4EMK A;  2MIO A;  4FYW B;  3SEM A;  4C92 C;  2E1H A;  1VQL Q;  1OX8 A;  1OX9 A;  1Q86 U;  4BY6 B;  3G71 T;  1WIE A;  1ZX6 A;  1XOV A;  3NTK A;  5CK9 A;  1M2V B;  1YJ9 T;  1ZSZ A;  2KRO A;  2QG9 B;  2FRW A;  3M0T A;  2EQK A;  3CCM T;  1WQW A;  2OAU A;  2E6N A;  3ZFJ A;  4AT1 B;  3LX7 A;  1AWW A;  1QP2 A;  1WJR A;  1X43 A;  2BZY A;  2WSC E;  2M0Y A;  2OJ2 A;  3X25 B;  2XIC A;  2NUP A;  4JPB W;  2K5F A;  1M4Z A;  5GAN 7;  4ZGD B;  3OYK A;  1WXU A;  2YRC A;  4FM4 B;  5A0G A;  2NUT A;  1Q86 C;  4QKU A;  4A4H A;  3CQT A;  3GLX A;  3CCS T;  4A53 A;  1JJ2 S;  2VVK A;  4IKF A;  5CO7 A;  5I2S A;  4PJO D;  1FX7 A;  5KCO A;  1T3S A;  2KMT A;  2HEQ A;  1D1A A;  2HKQ B;  3DLM A;  1VQM T;  4M75 C;  1F1B B;  1RLP C;  4M7A A;  2CYZ B;  3G1J A;  1N9R A;  3PGG A;  1IB8 A;  1V1C A;  1LNX A;  3BFM A;  2FYK A;  2YDL A;  1RAH B;  4AFS C;  1FMK A;  5GAN h;  1JRI A;  4FU6 A;  3HP9 A;  2DL8 A;  1G8X A;  3VYG A;  1WXT A;  1BIB A;  2SEM A;  1TS9 A;  2K3X A;  2VB6 A;  5AT1 B;  3IQL A;  2DYB A;  3T9N A;  2JUF A;  1YCS B;  1VYU A;  3CC7 T;  4M7D D;  1VQL T;  1SSF A;  1PRL C;  5D6Y A;  4AFU C;  3RR6 A;  1KC8 U;  4C5G A;  5HK3 A;  4OB2 B;  1QWE A;  2O9S A;  3V7S A;  2QEX Q;  2X35 A;  1ZSG A;  4FYV B;  4JS5 A;  1ZBJ A;  4RG8 A;  1BU1 A;  4Z88 A;  2OTJ A;  1NYG A;  1RAI B;  2NUZ A;  3P8D A;  4L6V 5;  1H3Z A;  2X3W D;  1W6X A;  1OQK A;  2DXU A;  1RI9 A;  5IHN A;  1WYX A;  4ME7 A;  2HAX A;  2KSS A;  5FU7 B;  1O75 A;  3KFV A;  3TEE A;  4M78 F;  5GAM h;  4C92 A;  4Q5W A;  4M77 E;  4M7A E;  4KH0 B;  2K7A A;  2FL7 A;  1VQ4 A;  1UB4 A;  2RMO A;  4HXJ A;  2F5T X;  3OMG A;  4XU2 A;  5LJ5 d;  2HMA A;  5D6W A;  1Y71 A;  1K4U S;  1UGV A;  1K1Z A;  2X9H A;  2RQV A;  1RAA B;  5GAN 3;  2YUP A;  4TVR A;  3S6W A;  1IHV A;  1E7O A;  3FC3 A;  2RQW A;  1Y0M A;  5GAM e;  2SRC A;  3SFM A;  2MCN A;  4ATO A;  2CP7 A;  4XQ3 A;  3LH0 A;  4E7J A;  3LWI A;  5J39 A;  2JMA A;  3M0Q A;  4HCZ A;  2XG8 D;  2RHY A;  4C8Q E;  5GAO l;  4QVZ A;  3LYI A;  3RUX A;  2KY9 A;  3PNW C;  4OML A;  3CCU A;  3NFC A;  1RI0 A;  4O6J A;  4X9C A;  5CAI A;  1NM7 A;  1XQH A;  4YTL A;  1UHF A;  3CCV Q;  3DKM A;  5J26 A;  3MHX A;  4R55 A;  1VQP A;  3OYY A;  5KYW B;  3OYD A;  2QDY B;  2XHC A;  2DO3 A;  4JUV A;  3X20 B;  2DVE A;  4IUR A;  5IXB A;  3REB B;  2WSF E;  4M75 A;  2D8J A;  3PT9 A;  1NPR A;  2A28 A;  2HDA A;  2CP2 A;  2DJQ A;  1MV3 A;  2X4J A;  1VQ8 Q;  2QEX T;  1IXD A;  3GF5 A;  2QQ9 A;  1I1J A;  2OTL Q;  4GY5 A;  4HCC A;  2KEA A;  5CKE A;  1VQN A;  2BZ8 A;  2KBT A;  4F04 B;  3M0S A;  5KYX A;  2XID A;  1YJW A;  4ZNX A;  2E5Q A;  4JRP A;  4OMQ A;  3CMA Q;  2DPP B;  4M78 G;  5CKB A;  1WHK A;  1NE8 A;  3BDL A;  4ANJ A;  2X4X A;  2K57 A;  2Y4X A;  4KT0 E;  1HJD A;  3EFS A;  1YHQ A;  3MO8 A;  1VQ6 Q;  1QVG P;  2CRE A;  4FIB A;  2V8I A;  2LQW A;  2YRV A;  2EQJ A;  3EAE A;  4A4F A;  3CPW S;  1UJ0 A;  4IUQ A;  2RQT A;  4J7F A;  4PJO F;  2YSQ A;  4LUD A;  1UEC A;  3J7A F;  4GBQ A;  3S3N A;  1M3C A;  1N27 A;  1IGQ A;  1VQO Q;  4HT8 A;  2DRM A;  1NG2 A;  4OP0 A;  3VUB A;  3OS1 A;  4MZP A;  3MP8 A;  4C0F A;  1M8M A;  4OF1 A;  2E3I A;  1M3B A;  3JCM h;  2D0N A;  3CPF A;  4EIK A;  2JVV A;  1C6V X;  2X51 A;  4F7U E;  4C5H A;  5GMK m;  2L8D A;  3CCV T;  3QWY A;  2K2V A;  1K9A A;  3M58 A;  3LWH A;  4C5I A;  4M7D F;  3L2R A;  2RJD A;  3EGX A;  3N5B B;  5GJW B;  1RLQ C;  1VIE A;  1VQ8 T;  1BYM A;  1U3O A;  5HK0 A;  4PKC C;  3JCM e;  2OTL T;  2EYX A;  4JS4 A;  4IIO A;  4M4Z A;  1K9M R;  1OOT A;  3MJX A;  5FW9 A;  3OYC A;  4A63 B;  2E41 A;  2CUD A;  1QVG A;  2PU9 B;  3CMA T;  2DFU A;  3EHQ A;  3HKS A;  3QYH B;  4HKE A;  4RMO A;  2ZPG B;  1LPL A;  5HKC A;  4UC4 A;  3OYM A;  4M78 B;  1M2V A;  1ZUY A;  1TU0 B;  5LJ3 d;  1M90 C;  3PIP A;  2HQX A;  5A0L A;  2F1L A;  3JCM P;  2JJ9 A;  4C5E A;  1VQ9 A;  1RAD B;  2J6K A;  2COZ A;  5IT9 E;  1D0Z A;  2IIM A;  1VQ6 T;  3QXE B;  3REA B;  4KBM B;  1JEG A;  2YT6 A;  4PJO G;  2KK4 A;  4E7K A;  4NOY A;  1YI2 Q;  1N6A A;  5C6S A;  2JS0 A;  2JS2 A;  1VOM A;  1KQ2 A;  3G4S Q;  3E2U A;  1VQO T;  3AHU A;  3VS6 A;  2OI3 A;  3PVL A;  1H3H A;  1AWO A;  3QSU A;  3M0P A;  1OZ2 A;  3GBQ A;  1PSF A;  3QBY A;  4ESR A;  4JRI A;  2CT4 A;  2JM9 A;  2LJ0 A;  4EMH A;  4N4G A;  1SRM A;  4FW2 A;  5DLO A;  5IAY A;  3MCA B;  1YNZ A;  3CC2 Q;  1YIT A;  1Q7Y C;  3OSS C;  1U5S A;  1RAE B;  2RK1 A;  4M7D G;  1ZSZ C;  3F70 A;  2LCS A;  2DD4 A;  2QTV A;  2DIG A;  1TUG B;  4DA4 A;  2L89 A;  3H8Z A;  4J7I A;  2DER A;  3OYI A;  4E7H A;  5FU6 B;  3M57 A;  4E7I A;  2QXF A;  2MK5 A;  5I21 A;  1G83 A;  2ROT A;  3CCE Q;  2DVJ A;  1VA7 A;  1Q82 U;  2IPO B;  2O31 A;  3MPU B;  2G3R A;  1K73 R;  2QQR A;  1O9S A;  1M2O A;  1JQQ A;  2FPF A;  2XK0 A;  5L23 A;  1SPK A;  1VQM A;  4LD9 K;  1QQJ A;  1X6B A;  4LD6 A;  3TSZ A;  3QHS A;  3TQ7 P;  4DBR A;  3A5Z B;  2L3P A;  2L0A A;  5KYU B;  1K8A U;  4DBF A;  4CC7 A;  1X75 C;  4OMF B;  1U8R A;  4KGV B;  4BD3 A;  2DLP A;  2RHU A;  5A0D A;  2EJF A;  4HA8 A;  4J9E A;  4M77 C;  5CKH A;  2RD1 A;  1YI2 T;  4PJO B;  2LMJ A;  5FRO A;  1TG0 A;  3G4S T;  1Q82 C;  3NMZ C;  2LX9 A;  1PCX A;  1VQL A;  2ZPH B;  4C92 D;  2RI2 A;  3QPH A;  2M16 A;  1SHF A;  1Y96 B;  3FRN A;  2LNH B;  1UUE A;  3CME Q;  4ZN1 A;  5GMK l;  3C95 A;  3RDV A;  3EG9 A;  4A4G A;  2GBQ A;  2QAZ A;  4MZM A;  1X2K A;  3CC2 T;  1K0S A;  2Z0W A;  3OYL A;  2RA2 A;  1VQ5 Q;  3CCR Q;  1N8R U;  4XTW A;  4RUG A;  4Z02 A;  2PVD B;  2BIV A;  1LOJ A;  4C0Z A;  1KD1 U;  3DB3 A;  4C8Q C;  2LNV A;  3HRU A;  2ATC B;  3LW5 E;  4M7D B;  2DNU A;  4JDS A;  1E6H A;  1X69 A;  4OB0 B;  3INZ A;  2DZ9 A;  4LDY A;  4P5N A;  3SDZ A;  2LRQ A;  3S3O A;  4IUP A;  2EYY A;  3UDC A;  3CCE T;  2DXC A;  1YCY A;  2QI2 A;  3SD4 A;  3JRZ A;  3I55 T;  4II1 A;  3NPF A;  2QK0 A;  4D8D A;  3L2W A;  3RMS A;  2VGM A;  4LUE A;  3R6O A;  1MMN A;  2RHZ A;  3ZBD A;  3CC4 A;  2PVG B;  5KYN A;  2H3J A;  3I56 Q;  5GAN 6;  4N4I A;  4QQG A;  2AK5 A;  2QQA A;  2YLC A;  2KDS A;  5GAM d;  3RKX A;  3G7Z A;  1YJN A;  2BTT A;  5KCH A;  2ABL A;  2YHT A;  3M56 A;  2HSP A;  1UGS B;  4RTZ A;  2JM8 A;  2EQI A;  4ELY C;  5LJ5 f;  1XJW B;  1IRE B;  3GNG A;  2BUD A;  1M1F A;  4MML A;  3VS2 A;  3QYG B;  2ZPE B;  3CCJ Q;  1U1T A;  2DL5 A;  2M51 A;  4X1V A;  2YUQ A;  3E9G A;  3SWN B;  1H92 A;  3OYB A;  3JV3 A;  1HD3 A;  1BI3 A;  2X3X D;  2FO0 A;  2QEX A;  4MZT A;  5LJ5 j;  1K0X A;  2JT4 A;  2LCL A;  3CME T;  3OSV A;  2DL7 A;  5LJ5 g;  1VQ7 A;  3WXM B;  1VQ5 T;  3CCR T;  2PTK A;  2FPE A;  3JB9 I;  3CEY A;  1JBM A;  2LJ3 A;  4M77 A;  1NEB A;  1W1F A;  3Q1J A;  4N4H A;  3CXC S;  1WGS A;  1BIA A;  2LDM A;  4IUU A;  3OW2 P;  2KNB B;  2CP5 A;  3HFO A;  5FU6 C;  3X28 B;  1PG5 B;  1U1S A;  3EGU A;  3EFR A;  3UA7 A;  1AT1 B;  2KRM A;  4AG2 C;  1W2B P;  3R6N A;  4ZTJ A;  2BKD N;  3NTI A;  1ZUU A;  1TSF A;  3V8K A;  1D0X A;  3TCJ A;  2IG0 A;  2YXY A;  5GAN e;  4J6Y A;  1BI1 A;  1X27 A;  4WF2 A;  2GQI A;  4C8Q A;  5I2M A;  4RTU A;  1Y7X A;  3EG0 A;  4XU1 A;  3I56 T;  1NYF A;  4OGE A;  4JLI A;  3FLG A;  3FJP A;  4BI8 B;  1WZO A;  2LX7 A;  1IHW A;  1Y07 A;  1WJS A;  2A37 A;  1OU9 A;  1FYN A;  4LN2 A;  5GMK h;  2GTJ A;  2EYW A;  1PNJ A;  2C0O A;  3CCV A;  3EHR A;  1M5Q 1;  1W70 A;  1G3W A;  4KUL A;  3C0C A;  3E9F A;  2JTE A;  3BDU A;  2AZS A;  3EG1 A;  1KC8 C;  3CCJ T;  4C92 F;  1JB0 E;  1P92 A;  2LQ8 A;  2FPD A;  1R77 A;  3EGD B;  1VQ8 A;  1I0C A;  1KG1 A;  3V8J A;  3OW2 A;  1C1A A;  1OZ3 A;  1IRX A;  1YFN A;  3FIF A;  2ECZ A;  2RHX A;  2JTF A;  2X4Y A;  1DJ7 B;  3EH1 A;  3S3M A;  1W2B A;  4J9C A;  3JCM d;  4F17 A;  3CCL A;  2VUB A;  3DB4 A;  4XTY A;  4QVD A;  1VQK A;  2GF7 A;  2H8H A;  2EGA A;  9ATC B;  2B8A A;  2A36 A;  4QW2 A;  2L2P A;  2P0P A;  4MDX A;  1M90 R;  2ROL A;  4RCC A;  2OTJ Q;  1VYT A;  2LT1 A;  1YIJ A;  2KT1 A;  4JZ4 A;  4XU3 A;  1A0N B;  1MHN A;  2ZAE A;  1I07 A;  4BY6 C;  4BUG A;  1JU5 C;  5GAN 4;  1G3Y A;  4J5Y A;  1NJI R;  4PFP A;  4M78 E;  2DET A;  1PM3 A;  8ATC B;  1AWX A;  1VQ4 Q;  1Z9Z A;  4M75 F;  4FL6 A;  3OBY A;  4FYY B;  1U06 A;  1NZ9 A;  2F5K A;  2A3L A;  4F7U A;  1BB9 A;  3WVE B;  2E4H A;  1GBQ A;  2HNI A;  4J9F A;  1I4K 1;  4PJL A;  5LJ3 f;  2J06 A;  4BE2 A;  1Q7Y R;  1WA7 A;  2GTO A;  4F14 A;  4NS5 A;  3VYH B;  1GRI A;  1PD1 A;  1YP5 A;  4JJN K;  4PLL A;  4C92 G;  2P4T A;  2E64 A;  3JB9 D;  4JLG A;  3PFS A;  1NEG A;  2RI5 A;  3QUI A;  4A4K A;  2KYM A;  5LJ3 j;  1W2B S;  2DBM A;  3CCU Q;  5LJ3 g;  4KUD K;  5DM7 R;  1QVF P;  4Z89 A;  3M0U A;  3A8G B;  1NPP A;  4E47 A;  1VQP Q;  4LDX A;  5DY9 A;  3H9N A;  2P84 A;  2I2L A;  2EIF A;  2VV5 A;  3LGL A;  1AEY A;  4E7Z A;  3QZ9 B;  3H0H A;  2JOY A;  2OAW A;  3QJY A;  4FW1 A;  1CSK A;  4X9D A;  1HK9 A;  3GNF B;  1MGQ A;  3VS5 A;  1QWF A;  1VQN Q;  5I11 A;  3D7S B;  2JN0 A;  2OTJ T;  3LLR A;  1M1K R;  4BDZ A;  1H8K A;  1UGP B;  2VWF A;  5KE2 A;  1YJW Q;  3VRY A;  5C0M A;  3WVD B;  1R0C B;  2L3Q A;  5EG2 A;  3VS3 A;  4PK4 A;  1I8F A;  2CZ6 B;  5L8R E;  5CKD A;  3X24 B;  3C94 A;  1AD5 A;  2F69 A;  3H41 A;  3BE3 A;  2K3B A;  2L5Q A;  3M4G A;  1PKS A;  1VQ4 T;  2KAF A;  2A7Y A;  4HVW A;  1HSQ A;  5FU7 C;  2O4X A;  1Q81 U;  2EGC A;  4LXC A;  2QQB A;  3HSB A;  2GCX A;  1B34 B;  4PFZ A;  3HRT A;  4PJO E;  1IGU A;  1S72 A;  2HKN A;  3CCQ A;  3CC2 A;  1Z9Q A;  2DEU A;  2ZPI B;  1QVF A;  1CKB A;  4J9I A;  3MET A;  4F16 A;  2Y90 A;  1SHG A;  1SSH A;  8AT1 B;  2CUB A;  1ACM B;  2M9U A;  4C92 B;  4DOV A;  3RKW A;  2PUK B;  2NLU A; 
#chains in the Genus database with same CATH homology
 3CD6 Q;  2QEX Q;  1VQ8 Q;  3OW2 P;  3CCU Q;  3CCM Q;  3CME Q;  1N8R R;  1YI2 Q;  1S72 Q;  3CXC P;  3CCQ Q;  3CC4 Q;  1JJ2 P;  2OTL Q;  1Q7Y R;  2QA4 Q;  3CC2 Q;  3G6E Q;  3I56 Q;  1YIT Q;  3CPW P;  1VQ7 Q;  1QVF P;  1VQ4 Q;  1M90 R;  1VQM Q;  1K8A R;  1VQ5 Q;  3G4S Q;  1VQN Q;  3CCR Q;  2OTJ Q;  1K9M R;  3CCV Q;  1Q82 R;  1VQO Q;  1YIJ Q;  1KD1 R;  1M1K R;  1Q86 R;  1VQP Q;  1KC8 R;  1W2B P;  1VQ9 Q;  3CC7 Q;  3CCS Q;  3CCJ Q;  1Q81 R;  1YJW Q;  3CCE Q;  1VQ6 Q;  1YHQ Q;  3CCL Q;  1QVG P;  1VQL Q;  3I55 Q;  1KQS P;  3CMA Q;  1VQK Q;  1K73 R;  1YJN Q;  3G71 Q;  1NJI R;  1YJ9 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...