1K73R

Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
molecule tags Ribosome
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2001-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1k73R00
1N8RR 1NJIR 3CPWP 1K9MR 1VQ6Q 3CCEQ 3I56Q 2QEXQ 3CCLQ 3CD6Q 1VQ8Q 1K73R 3CMEQ 1S72Q 3CCQQ 1KD1R 2QA4Q 1VQ9Q 1VQKQ 1KC8R 3OW2P 3CCUQ 3CXCP 1YJNQ 3CCVQ 1Q82R 1VQLQ 1YITQ 1Q7YR 1VQOQ 1KQSP 3CMAQ 1M1KR 1M90R 1VQMQ 1VQ7Q 3G4SQ 1YHQQ 1VQNQ 1Q86R 1YI2Q 1VQPQ 3CC7Q 3I55Q 1QVFP 1YJ9Q 2OTJQ 1K8AR 1W2BP 1Q81R 3CCMQ 2OTLQ 1VQ4Q 3G6EQ 3CCJQ 1QVGP 1VQ5Q 1JJ2P 1YIJQ 3CCRQ 3CC2Q 3CC4Q 3CCSQ 3G71Q 1YJWQ
chains in the Genus database with same CATH superfamily
1TUCA 5KYNA 2RNAA 1M4ZA 2FPFA 4C92F 4XU2A 5GMKi 2ED1A 1B7TA 4J8OA 2ROLA 2WACA 4DBHA 2QEXT 1GCQA 3REBB 4LNPA 3L2VA 4C8QA 5A0DA 6AT1B 4HT9A 4J9HA 2LTOA 4J6YA 1NJIU 3SHWA 1IHVA 2L3SA 2VUBA 4OGCA 2FB7A 4E7ZA 1U1SA 4DQ2A 4QT7A 3QWYA 2CT3A 1YJWT 2GFAA 2M1HA 3TCJA 1I81A 4LXCA 5EG2A 1V29B 2BZYA 3EH1A 2KT1A 3UF4A 2HQHA 4M75B 1M2VB 3WXMB 3FEOA 1G3TA 2P0KA 4BY6C 2B86A 2EYQA 1YWOA 5LJ5j 1WA7A 3ZFJA 2MWPA 3X24B 1G83A 2F5TX 3VS2A 1RAFB 3OY9A 3E19A 1RUWA 3DLMA 1QKXA 2OAWA 4PFZA 4BD3A 4J9FA 4PKCC 2BKDN 1WYXA 2MWOA 1YJ9Q 3L2QA 1K8AR 1W2BS 5GAMj 1PD1A 2DMOA 3HRUA 4FW2A 4LUDA 2EYYA 2E4HA 1OEBA 3EFRA 1D09B 2ZPFB 2CYZB 4C8QC 3F70A 4PFOA 2OTJT 3C0CA 3RKXA 1Y96A 5DLOA 4A4FA 4J7IA 1LJOA 1G3SA 1AHJB 4Z88A 3FLGA 3X26B 4QQGA 5LJ3f 4KUDK 1WXUA 2DAQA 1FMWA 5LJ3h 2ZZDA 4EIKA 5FWBA 4Y91A 3CPWS 3A8HB 1M27C 4F04B 2P0QA 3CCST 1ZA2B 5A2QE 3JSCA 3CMAT 4DEYA 1Q81C 2V8JA 1IHWA 2R5AA 2DEQA 2F5KA 4M75F 3OB9A 4OGEA 4XTYA 1TTHB 2LZ6B 2E70A 3QZ9B 2RHIA 3FIFA 1WJSA 3I55T 2K7AA 5IAYA 5KYWA 1YHQA 3A8GB 1RI9A 2DL7A 3S3MA 2YWWA 4OMFB 4C0DB 1BYMA 2DE0X 2FRWA 2YUQA 1WDXA 3MP6A 3G71A 1QVFA 4M7DF 2HMAA 2KYBA 1M3BA 2NYSA 3GNGA 2RN8A 5FW9A 3RDVA 1VQPA 1VIEA 1W2BP 2AZSA 2DJZA 4DBQA 4ZN1A 4O5VA 5GJWB 4NL3A 1R0BG 2HBPA 5GAMh 1ZSZA 4OMMA 5KYYA 3LYIA 5HY6A 4KULA 4D8DA 5FRNA 4JJBA 2ZPEB 3OQ5A 3UWNA 4D8KA 1YITQ 1VQ7Q 4ORZA 2CREA 1YHQQ 1M90C 5LJ5h 2JTMA 2HNIA 4C92C 5GANd 4JRQA 2AT1B 1OULA 2X4YA 1VQ8A 1U3OA 3JCMe 4IIMA 1PRLC 3CCEQ 3CBOA 4JJCA 1LVKA 2C0IA 2CGHA 3MP8A 2C0OA 1SEMA 2R5MA 1LNXA 2LNVA 4FT4A 3FRNA 1N6AA 5KE2A 4B6MA 1K76A 1VQMQ 3TREA 3AT1B 2BE7D 3JCMc 2GNCA 2EYXA 2DZ9A 5IHKA 5GMKl 2L8DA 1AEYA 1RAAB 2MI6A 2DVJA 1UECA 1KD1R 3R6OA 3RMQA 4A4GA 4E7KA 2A3LA 1JRIA 2X35A 3QYHB 1MMGA 4RTZA 3I56T 2LJ0A 1FYNA 1S72A 1UHFA 2RI5A 3RR6A 1K0SA 3VU3C 4NL2A 2CZ1B 3H8ZA 5LJ3j 2LRQA 2QI2A 2NLUA 4FW1A 4M7AG 1T3LA 1TUDA 1QP2A 4F7UF 3CCRA 2BZXA 3X25B 5GMKj 3D7SB 2LQ8A 3QUIA 1M1FA 2NWMA 4BE0A 1I4K1 4QKUA 4HCZA 1VQ6A 2XDBA 4KUIA 4GBQA 3OS5A 1K1ZA 3VS0A 2YLCA 2XICA 2FPDA 2MAMA 2SRCA 3VRZA 4IUPA 4XTVA 4C92E 2CP7A 1UHCA 2AK5A 3A8LB 2K4YA 3I5SA 4N4IA 2LMJA 2RM4A 3M0SA 1RL2A 2FZKB 3JCMg 4E7SA 2RQWA 1VQOQ 3CC4T 5IXFA 1LPLA 4PJOG 4ZGDB 3V8LA 2D1XA 1GRIA 3I55Q 2EWNA 1GFCA 4DEXA 4BI4A 2L2PA 1TSFA 4RTWA 5HK0A 2FRYA 3UATA 3CCVT 1Q86C 1WXBA 3M4GA 1QCOA 2ROTA 5GANf 2EGEA 3M4YA 1M90R 5KYXB 4LN2A 2DBMA 3NTHA 1NZ9A 5GAOl 1AT1B 3OYBA 2O4XA 4FSSA 1K9MU 1VQ5Q 1ABQA 1QLYA 1VQ6Q 1WPYA 2X4WA 2CH4W 4KH0B 3A1PA 5FWCA 3HTRA 2A37A 2K5FA 1KC8C 1FWZA 4C92B 3JB9D 2RA2A 4K11A 5J3BA 1MUZA 3MJXA 3HRTA 2DNUA 1D1BA 3L2RA 2EAYA 4J9BA 2F2WA 2JXBA 1BIAA 3FDRA 1PRMC 2O2OA 2RK1A 1UJ0A 5CKHA 5GMKh 2K3XA 1YITA 4IKFA 3TSWA 2E6ZA 1UGRB 3CC7T 4M78C 2RQRA 2LQKA 4L59A 4OB1B 4QW2A 4OMQA 2X4JA 5GMKm 1KFZA 2Y4YA 4B9XA 2XDPA 2FZGB 2HD0A 3SFMA 5FU7C 4HXJA 2CUBA 2EJFA 2HL3A 3MKDA 1JU5C 4E2FB 2A7YA 2FG0A 3VJPA 1QW1A 4E7HA 2HCKA 3NMZC 2KQWA 3RKWA 4RCCA 2LP5A 2YUNA 2D0NA 2X51A 1YJNT 4XTXA 2E64A 1KK7A 2M51A 2K57A 1V1CA 2I0NA 4DOWA 2DD5A 1VQOA 3NTIA 3L2UA 2K5LA 2GGRA 5GAMd 2PTKA 5D6YA 4E7LA 3PIOA 4XTWA 4M75D 3Q1JA 4F7UB 1KSWA 1JJ2S 5GAN7 3JB9J 1G5VA 3BY7A 3OYHA 1M30A 2DL3A 1TH7A 4KH1B 3P8DA 4IUUA 2CSIA 3EHRA 2CUDA 2DTOA 2EFIA 5GJVB 2BIVA 3CEYA 1B34B 1KC8R 4R56A 1VQPT 1RACB 3X28B 2D0QB 3HFNA 2VWFA 2LX9A 3IQLA 4XU0A 3J80E 3SWNC 1QVFP 2P84A 4N0AC 3CCQA 4LDVA 5CAIA 4HCKA 4N0AA 5KYYB 3RIRA 2A36A 5GANh 3FB9A 2RHZA 1C6VX 3FJ5A 1KQSA 3WVDB 3V7CA 3O5ZA 3JB9F 2RHXA 1K73C 2KDSA 2M0YA 1UGSB 4ZGJB 1SF9A 1ZUYA 2QGFB 5KCHA 4M77D 1AWJA 2VXEA 2SEMA 1YWPA 1VQ4T 1Q7YU 4C0DC 4AFSC 1KC8U 4ELYC 4JZ4A 3VS6A 1BBZA 1N5ZA 5HCKA 3ULRB 2KVQG 4J5YA 5FU7B 1G3YA 5IH2A 2DA9A 2XG8D 2KRMA 2JS2A 1M1KU 3PNWC 4YTLA 3THKA 4BE2A 3QO3A 2E10A 2OJ2A 4JPBW 4ESRA 1Y7XA 4BACA 1R0CB 3G4SA 3OYKA 2CZ6B 5I21A 1E6GA 1RLPC 1BU1A 5GANg 3OYIA 3CC7Q 5KYUB 4C8QF 5GAN4 5FRMA 5FU6B 1E6HA 5AYFA 1TOVA 2HQEA 5GAMf 1WFWA 2BE9B 4C92G 4C92A 1NPRA 1YBYA 1WNLA 1HJDA 2KYMA 3QDRB 1IO6A 1QKWA 1X43A 3NTKA 1T0JA 1Y0MA 4FYVB 3VS7A 2ESWA 4CC2A 1N27A 1YJWA 3SD4A 5DLQE 1VIFA 2EVRA 4J83A 3PVQA 3OSVA 2XU8A 1HXDA 5A0LA 1BKBA 4J9GA 4RTUA 2KRSA 1BB9A 4ME7A 2RK2A 4PL6A 3UDCA 1MGQA 1AD5A 2MPXC 5D6WA 1VUBA 1FXXA 5CCAA 1NG2A 4M7AE 2QA4T 1QVPA 1QVGP 4Q5WA 4MDWA 3R6NA 3VS5A 1TS9A 2RI2A 4RCBA 1D1CA 3RNJA 1XTDA 1PCXA 2KNBB 4LD9K 4JS5A 2DLPA 3ME9A 2VGMA 2C0TA 3O8VA 5CKEA 3H6ZA 4TVRA 2CT4A 1J3TA 2QTVA 4MMLA 3BE3A 3SB2A 1QWEA 2DL4A 3MHXA 2E5QA 2LCCA 3CCVA 2DERA 2OAUA 2ENMA 1QWFA 5I11A 1I07A 2KRNA 2MIOA 2VKNA 2DXCA 1VQKA 2COZA 3G7ZA 3H0IA 1RI0A 1FMVA 3MO8A 5LL6S 5GAN3 3CC4A 1VQPQ 4N4HA 1Y71A 2JN0A 4RG2A 3JV3A 3VYHB 2EQJA 3G6EA 2HKQB 2V8IA 5FROA 1VYTA 2DD4A 3G71Q 1W6XA 1JXOA 3NPFA 2CZ0B 2Z0WA 3J7AF 1TG0A 1F1BB 2E65A 3CCMT 1M2OA 4A54A 1Q7YC 4PLIA 4E7IA 1M3AA 3PFSA 1PNJA 2EQMA 4J6XA 1KG1A 5CO7A 4E7JA 2EW3A 4M75G 1Z9QA 3PTAA 3INZA 3OYDA 4JZ3A 1WHJA 2GBQA 3MEAA 1IREB 3KBGA 5I2MA 2EGCA 4PJOD 2PVGB 1QP3A 1ZHIA 4J7FA 2LT1A 3CCRT 1AVZC 2OTLA 2X3WD 2DETA 4M77E 2DX1A 1ZBJA 2ATCB 1M1KR 2PUKB 4L6V5 4A4KA 3OYLA 3GOXA 3V8JA 2OTJQ 4JJDA 1S72T 2HBWA 1JBMA 3G6EQ 1QVGA 3I56A 2PQWA 3LX7A 5GAOq 4M77A 1Q86U 3CCLQ 5GAOp 2F2VA 1VOMA 4KT0E 4OB2B 4GLKA 4RUGA 1UGPB 2IIMA 2WSCE 2HEQA 1I5LA 1VQKQ 1EZZB 2DRMA 4JLGA 1U06A 3RKYA 2MCNA 2PVOB 1QCNA 4FM4B 2YLBA 3SDZA 4WTOB 2KXDA 1Q86R 4RTTA 3CCMA 3KFVA 2JUFA 1RADB 1JJ2A 1MHNA 5D7UA 2JW4A 1UJYA 2LVMA 1Q95G 4RKUE 1VQ8T 5IN1A 2AHJB 1VQ9A 2XD0A 4Z89A 1YNZA 2L0AA 2MMPA 3LLRA 1X6GA 2O01E 2NUTB 3HHTB 2JTFA 4M78F 4LDXA 4M75A 3NFCA 2DVEA 2P4RA 2BZ8A 1VQ5A 3M0RA 3L2ZA 1D1AA 2QQSA 3H0FA 2YXYA 2KE9A 2A0FB 2GTJA 4E6RA 2D6FA 2E3HA 2CP6A 4QVZA 4X34A 1N8RC 2JT4A 4VUBA 5L8RE 1VQLT 4M7AF 2VVKA 1JJ2P 3RESA 1N8RR 4HVUA 4EMHA 1UGQB 1G3WA 1VYUA 1WHLA 4Y28E 1KQ2A 2AKKA 3I55A 1ZBXA 3CBMA 1PSEA 1IB8A 2QA4A 4HVWA 4M78A 2HAXA 1KHIA 4QVCA 1YP5A 1BCOA 2QQAA 4J9IA 3QZ5B 2DEUA 2H3JA 2MF2A 3CMAA 2RHUA 1VQNQ 1W70A 4P5NA 5LJ5g 1RAEB 2BUDA 5DY9A 3SEMA 3CD6Q 4AG1C 3QSUA 5LJ3g 3CPWA 5FU6C 3HRSA 2XDDA 2CH4A 3A5ZB 3M5AA 4R55A 5GAMg 2LT4A 2RD1A 2D8JA 1M8VA 4MZTA 2RH2A 3LGLA 5EC7A 1PHTA 2OTLQ 4RMOA 3MEWA 3CPWP 2LJ3A 1D3BA 2VASA 1I5OB 2KXCA 2EQIA 4Z02A 4M77F 4C5IA 1HSQA 2EIFA 1YIJA 4DBFA 3OYAA 3DKMA 5GAOr 1YIJT 4MDXA 1ZX6A 3OYGA 1KD1U 4II1A 3META 4Y92A 1H8KA 2CP5A 1WZOA 3CMET 1SRMA 3UT1A 2COYA 1MNDA 1UUEA 5CVIA 3EG0A 2KK4A 2M16A 1WJQA 1K0XA 1O75A 2O31A 1NYGA 1GXIE 3CCJA 2E3IA 3KUFA 3EG1A 4C0ZA 1O9SA 2DXUA 1YI2Q 2FL7A 4PJOE 4C5GA 4M7DD 1E7OA 1JXMA 2R58A 5I2SA 2XMFA 2DM1A 2E5KA 4J9EA 5A0GA 1VQ4A 3C4SA 4WCIA 2RMOA 4AFQC 4C8QD 3JB9I 1Y07A 4RG8A 3GLXA 3I9QA 1YI2T 1MV3A 1QCFA 2QQBA 3EGUA 1AWWA 4OP0A 1XNIA 2O9VA 4O6JA 3NHNA 4M7AD 4OF1A 2ZPHB 2LQNA 3C95A 5IT9E 1S1NA 4QQ6A 1UB4A 3N5BB 1SG5A 1NM7A 2RJFA 2L89A 3M55A 1VQLA 4KRTA 2YT6A 1WHGA 2HL5C 1LCKA 2AZVA 2WSFE 2F2XA 4EMKA 3EG9B 1OYXA 2WSEE 4M78E 2VV5A 4BDYA 2KBTA 5KE3A 5CKBA 4EMGA 2M9UA 3EGXB 4C5HA 4B9WA 1CSKA 1SPKA 1OZ3A 3QPHA 2FHDA 3DB4A 3L1AA 4F14A 1X2KA 1WHKA 2MYSA 4HT8A 4A53A 5GAOm 3LH0A 1A0NB 1WJRA 5GANe 1VQOT 2PNIA 4ZGEB 4M77C 2RF0A 1X75C 3MP1A 4M7AA 1KIKA 5GAN2 1VQNT 4PJOC 4JUVA 1UG1A 1YJNA 3RBBB 4F7UA 3UPUA 1RABB 3JCMV 1DJ7B 2XK0A 2RJDA 5ECAA 3VKIA 2DZCA 2LNHB 2CZ7B 3ZBDA 5L23A 2RQTA 2YRCA 4RTVA 3JCMJ 4OB0B 3EH2A 3CCJQ 4M4ZA 4IUVA 2JMCA 3OYFA 1B07A 3T9NA 4C92D 2EBPA 5HK3A 1X69A 4LDYA 3PGGA 4PFPA 2DKGA 1UGVA 1Q82U 3URGA 3JB9G 3H9NA 3H0HA 3OYCA 1R77A 3DB3A 3CPFA 1U5SA 4JRPA 1EFNA 4NS5A 1V76A 1VQMT 1BIBA 1SSFA 4F17A 5GAN5 2CP0A 2NUPB 3VUZA 3OW2S 1C0MA 1AWOA 3I56Q 5CK9A 2EKOA 1VQ9Q 2QXFA 4X1VA 1M3CA 1N8RU 2NUTA 1TUGB 1M5Q1 2COWA 2K6DA 1MV0B 2GTOA 2J7IA 3BDUA 4HKEA 3P8HA 1ZLMA 2JTEA 4AMCA 2EJ9A 4JJNK 2QTXA 3QJYA 1R8OB 2FVUA 5GMKe 2DK3A 1IGQA 2EYZA 2ABLA 1K73R 3CMEQ 2DXTA 3M59A 3CCQQ 4IURA 2QDLA 3S6WA 2JM8A 3G6ET 4OB3B 4X9CA 1TWBA 2X9HA 1Q7YR 4C0FA 1OI1A 2J6FA 1NE8A 3M54A 4ELZC 3CXCS 4C8QG 5J39A 1VQKT 2PVDB 1MMDA 4JDSA 2J06A 1ARKA 9ATCB 2IPOB 5GAOn 1YCSB 4BI3A 2KSSA 5GAN6 1D0YA 3GP8A 1QVGS 3M57A 3MPUB 2YSQA 1ZUKA 3QDFA 1NBEB 3OYJA 1OX9A 2FEIA 3RMSA 3OS0A 3CBPA 2D8HA 1EX4A 4KGXB 2QAZA 4RTXA 4XK8E 3EG3A 3M53A 2E6NA 2PUOB 3OS1A 3KXTA 2A28A 3OMGA 1QMCA 3I5RA 3VS4A 2QQ9A 1N9RA 3SWNB 1SHGA 4PJOA 1XJWB 3JCMQ 3G1JA 4OMPA 2JS0A 4C8QB 1NJIR 1M8MA 2DPPB 5KH6A 1G8XA 3BFMA 2YDLA 3QYGB 1WXTA 3JCMh 3M0TA 1GCQC 3EFOA 4EDUA 4MMKA 4L5GA 2ZPIB 2J6KA 4CC3A 1YJ9A 2FYKA 2DF6A 1OV3A 1NEBA 3FJPA 3H41A 3DLLA 1X6BA 1GBQA 2RHYA 1K9MR 4LE9A 2KR3A 1PKSA 2DILA 3QG1A 3CXCA 3JCMX 1YJ9T 2I2LA 3X20B 1NJIC 3VV0A 4Z8AA 4OMOA 3E1SA 1JEGA 3CCUT 3G4ST 3EFSA 2W10A 1SKUB 2M02A 1T0HA 1X01A 1PM3A 2XKOC 2AIRB 1AWXA 1M9SA 2K9GA 1X27A 2JOYA 3HPWA 3E2UA 4C0GA 3QKJA 1AOJA 4IUQA 2ECZA 3EG9A 2H8HA 4JLIA 3LWHA 4QVDA 2X3XD 1KHCA 2F69A 3BW1A 2KEAA 1YJWQ 2F1LA 4PK4A 4XU3A 3OYYA 5LJ5d 4HVVA 3PIPA 2QASA 4C8QE 1OPLA 1NYFA 3REAB 1M2VA 2FZCB 4ZTJA 1QQJA 5AT1B 1JB0E 1RAHB 1FMKA 4M7AC 5FLXE 2DO3A 1QVFS 1BI1A 1LOJA 3G71T 4FU6A 2GQIA 2VGNA 8AT1B 1GL5A 4DBRA 1G2BA 2D9TA 4PJLA 2DTIA 1WI7A 1CKBA 4PNOA 3QJ6A 2QGGA 3OYNA 3CCVQ 3MEVA 5C6SA 2H3EB 3CCQT 2CP3A 4M77B 1RLQC 2RO0A 3M0QA 4ZNXA 2RJCA 4V2SA 2P0PA 4FSXA 2J05A 3QBYA 1PWTA 3CCMQ 1VQ4Q 1Y57A 3TQ7P 4EMKC 3EGDA 3CCRQ 5KCOA 2P4TA 3A98A 7AT1B 2XI9A 1W4SA 5GAN8 2HKNA 5CR2A 1HK9A 2YUOA 1C1AA 4PJMA 4FYWB 3M58A 3V7RA 4EPCA 3M9QA 1HYOA 4FIBA 1SRLA 3FC3A 4D6WA 4BE1A 1OU8A 4M78G 4ZN3A 3LH5A 3P8BB 1Y96B 5CKFA 4KGZB 1OOTA 2OTJA 2RJEA 5M9OA 4BUGA 4BY6B 2KY9A 2KMTA 2FPEA 1VQMA 1WQWA 3JCMP 2YRDA 1K9MC 1ABOA 3ZL7C 4A63B 3GPLA 2RQVA 4HCBA 2FO0A 2VB6A 1H3HA 5KYUA 1WQ7A 2W0ZA 1XOVA 3EGXA 4A4HA 5DM7R 1TXQA 3HKSA 3OBWA 4IUTA 1UE9A 1PKTA 3GBQA 2VC8A 1NLOC 2KROA 4M7DG 2V8KA 1X6OA 3OBYA 3CC7A 1D0XA 4E47A 2O4XB 4FL6A 5CQXA 4MZPA 3L2WA 2EGAA 3JCMf 1VQNA 4M78B 1YITT 2DL8A 4M7AB 1JO8A 4AT1B 3PVLA 2LDMA 3EFOB 4PJOB 3TSZA 3PMIA 4XTZA 1NLPC 3QXEB 4F7UE 4CC7A 2DYBA 1WLPB 1OPKA 3VS3A 4XAXB 4AFZC 4FCYA 1KJWA 3ZEHA 1B3QA 1WX6A 2ZAEA 2QEXQ 3E9GA 3LGFA 3JB9H 1S72Q 1BI2A 4OMLA 2RB6A 3M0PA 4M77G 4XU1A 2JZ2A 1WHHA 2XIDA 3QWXX 3V8KA 5LJ3e 3UA6A 3MCAB 2KT8A 3HL8A 5GAMe 4FYXB 3CC4Q 2LJ1A 2DRKA 1PG5B 1OU9A 5C0MA 2CS7A 2ZGWA 2DXBA 4ZTFA 2QG9B 4CI0C 1K4US 1VQ7T 4LDWA 3L42A 3LWIA 2J6OA 3PT9A 5IHIA 3CCEA 1K8AU 3C12A 2AKLA 1I0CA 5J26A 1KQ1A 1YI2A 3S3OA 3CQTA 1H3ZA 1YN8A 4F7UG 4LD6A 2Y90A 2R57A 3VUBA 4JS4A 3HSBA 1N9SA 3C94A 2EJGA 1NPPA 1WGSA 1D0ZA 2K3BA 2EYWA 2DYIA 4MZMA 1H641 4BI8B 1IRXA 3CCJT 3UA7A 3GNFB 2G6FX 1VQ6T 1GBRA 2JJ9A 2LCLA 3E9FA 5IXBA 2K2VA 1YIJQ 1YFNA 1UEBA 1UFFA 2ZPBB 4UC4A 1EIFA 3J81E 3CMEA 2QA4Q 2DBKA 2DTHA 1FX7A 2GQVA 2RI3A 3CCUA 1W1FA 4PJOF 2HQXA 3EGDB 4J9CA 2CDTA 1M1GA 2E12A 2G3RA 3ER0A 1OZ2A 2IVWA 1VYVA 2K3YA 3TEEA 2ED0A 2QK0A 5LJ3d 1SSHA 2DIGA 4KGVB 2RPNA 2XHCA 2KAFA 2V1QA 3V7SA 4DOVA 1VQLQ 1ZA1B 3CMAQ 3CD6T 4R0KA 4FT2A 1YCYA 2EPDA 1X2QA 2DIQA 1AZGB 1I1JA 1NEGA 3GIBA 4FYYB 4F16A 5GANj 2V1RA 5CKDA 2A08A 4BB7A 2EQKA 1ZSZB 2DFUA 1Q81U 2ZCFB 4OMNA 1UTIA 2HSPA 1W2BA 2JM9A 2OX7A 3OW2P 5D6XA 2YRVA 3U23A 3RERA 1KQSP 2HSEB 4A4EA 2X4XA 5CIUA 1WHMA 5LJ5f 3VYGA 1UDLA 3RUXA 3JCMW 4QQDA 2IG0A 1ZUUA 3CC2A 1OX8A 4AG2C 3CC2Q 4N4GA 1JQQA 1VQ8Q 2K2MA 2LQWA 4ATOA 4M7DB 1HD3A 4EMKB 3QIIA 1PSFA 1RAIB 2B8AA 2LC4A 2L5QA 1PC0A 2NUPA 3EAEA 4RTYA 3VS1A 1BK2A 1BCMA 1KQSS 4HA8A 2L3QA 1BI3A 2EQUA 3NGPA 2CSQA 1VQ5T 2PZ1A 4BDZA 1Q82C 2L3RA 2GFUA 1YHQT 2YUPA 3CC2T 1IZ6A 1GCPA 2OI3A 4ANJA 2VXFA 1AZEA 3HFOA 1RAGB 4PLLA 2K79A 3S3NA 1VQ9T 2JNGA 4LDUA 4JRIA 2GCXA 2V26A 4M75C 4J9DA 4HCCA 1M90U 2L3PA 3EHQA 2RQUA 3CCSA 1TU0B 4CC4B 4DA4A 1KD1C 2C06A 5I22A 2NUZA 1K9AA 3CCUQ 3CXCP 4M7DA 3JCMb 3I35A 2M0OA 1CKAA 1ZSGA 3CD6A 1Z9ZA 2YHTA 1B34A 1MNEA 3OMCA 4XQ3A 2QDYB 4M7DE 1T3SA 4JRKA 4AFUC 2VYTA 1PD0A 1WIEA 4PJNA 3BDLA 3OW2A 3A8MB 1MMAA 3GF5A 4OVAA 2K5IA 5IHNA 2KI7A 3TVTA 1K73U 2DJQA 3VRYA 3G4SQ 3AHUA 3MEUA 3PMTA 1U8RA 4GLMA 1ACMB 3WVEB 2QQRA 2JMAA 2MOXA 3QHSA 1GFDA 3CCSQ 1SHFA 2OTLT 1K8AC 2HZYA 1XQHA 2E41A 3OS2A 2ZPGB 5KYWB 2LCSA 2PU9B 1M1KC 3SWNA 3EG2A 3ASKA 2O9SA 4WF2A 5LJ5e 3JCMd 5HKCA 5KYXA 8ATCB 1IXDA 1ZSZC 2CKKA 2EKHA 2DL5A 3JAME 4LUEA 2E1HA 1OQKA 4M78D 4XTUA 1I8FA 1Q82R 2MK5A 3OSSC 3JRZA 3M0UA 3M56A 1D3BB 1ZQ1A 4M75E 3CCET 1IGUA 2QEXA 1MMNA 2JVVA 1H92A 1P92A 1Q81R 2O88A 2KGTA 1VQ7A 4X9DA 4M7DC 2Y4XA 4C5EA 4PJJA 1VA7A 2CP2A 2GF7A 2HDAA 3OA6A 4CRIA 1U1TA 3OYMA 3PE0A 4J6WA 1YJNQ 3HP9A 3CCLT 2QYZA 4IIOA 1BI0A 3CCLA 4KBMB 5CQYA 3OYEA 2BTTA 3A8OB 2LX7A 4NOYA 3LW5E 4GY5A 3TU4K
chains in the Genus database with same CATH topology
1N8RR 1NJIR 3CPWP 1K9MR 1VQ6Q 3CCEQ 3I56Q 2QEXQ 3CCLQ 3CD6Q 1VQ8Q 1K73R 3CMEQ 1S72Q 3CCQQ 1KD1R 2QA4Q 1VQ9Q 1VQKQ 1KC8R 3OW2P 3CCUQ 3CXCP 1YJNQ 3CCVQ 1Q82R 1VQLQ 1YITQ 1Q7YR 1VQOQ 1KQSP 3CMAQ 1M1KR 1M90R 1VQMQ 1VQ7Q 3G4SQ 1YHQQ 1VQNQ 1Q86R 1YI2Q 1VQPQ 3CC7Q 3I55Q 1QVFP 1YJ9Q 2OTJQ 1K8AR 1W2BP 1Q81R 3CCMQ 2OTLQ 1VQ4Q 3G6EQ 3CCJQ 1QVGP 1VQ5Q 1JJ2P 1YIJQ 3CCRQ 3CC2Q 3CC4Q 3CCSQ 3G71Q 1YJWQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R R;  1NJI R;  3CPW P;  1K9M R;  1VQ6 Q;  3CCE Q;  3I56 Q;  2QEX Q;  3CCL Q;  3CD6 Q;  1VQ8 Q;  1K73 R;  3CME Q;  1S72 Q;  3CCQ Q;  1KD1 R;  2QA4 Q;  1VQ9 Q;  1VQK Q;  1KC8 R;  3OW2 P;  3CCU Q;  3CXC P;  1YJN Q;  3CCV Q;  1Q82 R;  1VQL Q;  1YIT Q;  1Q7Y R;  1VQO Q;  1KQS P;  3CMA Q;  1M1K R;  1M90 R;  1VQM Q;  1VQ7 Q;  3G4S Q;  1YHQ Q;  1VQN Q;  1Q86 R;  1YI2 Q;  1VQP Q;  3CC7 Q;  3I55 Q;  1QVF P;  1YJ9 Q;  2OTJ Q;  1K8A R;  1W2B P;  1Q81 R;  3CCM Q;  2OTL Q;  1VQ4 Q;  3G6E Q;  3CCJ Q;  1QVG P;  1VQ5 Q;  1JJ2 P;  1YIJ Q;  3CCR Q;  3CC2 Q;  3CC4 Q;  3CCS Q;  3G71 Q;  1YJW Q; 
#chains in the Genus database with same CATH topology
 1TUC A;  5KYN A;  2RNA A;  1M4Z A;  2FPF A;  4C92 F;  4XU2 A;  5GMK i;  2ED1 A;  1B7T A;  4J8O A;  2ROL A;  2WAC A;  4DBH A;  2QEX T;  1GCQ A;  3REB B;  4LNP A;  3L2V A;  4C8Q A;  5A0D A;  6AT1 B;  4HT9 A;  4J9H A;  2LTO A;  4J6Y A;  1NJI U;  3SHW A;  1IHV A;  2L3S A;  2VUB A;  4OGC A;  2FB7 A;  4E7Z A;  1U1S A;  4DQ2 A;  4QT7 A;  3QWY A;  2CT3 A;  1YJW T;  2GFA A;  2M1H A;  3TCJ A;  1I81 A;  4LXC A;  5EG2 A;  1V29 B;  2BZY A;  3EH1 A;  2KT1 A;  3UF4 A;  2HQH A;  4M75 B;  1M2V B;  3WXM B;  3FEO A;  1G3T A;  2P0K A;  4BY6 C;  2B86 A;  2EYQ A;  1YWO A;  5LJ5 j;  1WA7 A;  3ZFJ A;  2MWP A;  3X24 B;  1G83 A;  2F5T X;  3VS2 A;  1RAF B;  3OY9 A;  3E19 A;  1RUW A;  3DLM A;  1QKX A;  2OAW A;  4PFZ A;  4BD3 A;  4J9F A;  4PKC C;  2BKD N;  1WYX A;  2MWO A;  1YJ9 Q;  3L2Q A;  1K8A R;  1W2B S;  5GAM j;  1PD1 A;  2DMO A;  3HRU A;  4FW2 A;  4LUD A;  2EYY A;  2E4H A;  1OEB A;  3EFR A;  1D09 B;  2ZPF B;  2CYZ B;  4C8Q C;  3F70 A;  4PFO A;  2OTJ T;  3C0C A;  3RKX A;  1Y96 A;  5DLO A;  4A4F A;  4J7I A;  1LJO A;  1G3S A;  1AHJ B;  4Z88 A;  3FLG A;  3X26 B;  4QQG A;  5LJ3 f;  4KUD K;  1WXU A;  2DAQ A;  1FMW A;  5LJ3 h;  2ZZD A;  4EIK A;  5FWB A;  4Y91 A;  3CPW S;  3A8H B;  1M27 C;  4F04 B;  2P0Q A;  3CCS T;  1ZA2 B;  5A2Q E;  3JSC A;  3CMA T;  4DEY A;  1Q81 C;  2V8J A;  1IHW A;  2R5A A;  2DEQ A;  2F5K A;  4M75 F;  3OB9 A;  4OGE A;  4XTY A;  1TTH B;  2LZ6 B;  2E70 A;  3QZ9 B;  2RHI A;  3FIF A;  1WJS A;  3I55 T;  2K7A A;  5IAY A;  5KYW A;  1YHQ A;  3A8G B;  1RI9 A;  2DL7 A;  3S3M A;  2YWW A;  4OMF B;  4C0D B;  1BYM A;  2DE0 X;  2FRW A;  2YUQ A;  1WDX A;  3MP6 A;  3G71 A;  1QVF A;  4M7D F;  2HMA A;  2KYB A;  1M3B A;  2NYS A;  3GNG A;  2RN8 A;  5FW9 A;  3RDV A;  1VQP A;  1VIE A;  1W2B P;  2AZS A;  2DJZ A;  4DBQ A;  4ZN1 A;  4O5V A;  5GJW B;  4NL3 A;  1R0B G;  2HBP A;  5GAM h;  1ZSZ A;  4OMM A;  5KYY A;  3LYI A;  5HY6 A;  4KUL A;  4D8D A;  5FRN A;  4JJB A;  2ZPE B;  3OQ5 A;  3UWN A;  4D8K A;  1YIT Q;  1VQ7 Q;  4ORZ A;  2CRE A;  1YHQ Q;  1M90 C;  5LJ5 h;  2JTM A;  2HNI A;  4C92 C;  5GAN d;  4JRQ A;  2AT1 B;  1OUL A;  2X4Y A;  1VQ8 A;  1U3O A;  3JCM e;  4IIM A;  1PRL C;  3CCE Q;  3CBO A;  4JJC A;  1LVK A;  2C0I A;  2CGH A;  3MP8 A;  2C0O A;  1SEM A;  2R5M A;  1LNX A;  2LNV A;  4FT4 A;  3FRN A;  1N6A A;  5KE2 A;  4B6M A;  1K76 A;  1VQM Q;  3TRE A;  3AT1 B;  2BE7 D;  3JCM c;  2GNC A;  2EYX A;  2DZ9 A;  5IHK A;  5GMK l;  2L8D A;  1AEY A;  1RAA B;  2MI6 A;  2DVJ A;  1UEC A;  1KD1 R;  3R6O A;  3RMQ A;  4A4G A;  4E7K A;  2A3L A;  1JRI A;  2X35 A;  3QYH B;  1MMG A;  4RTZ A;  3I56 T;  2LJ0 A;  1FYN A;  1S72 A;  1UHF A;  2RI5 A;  3RR6 A;  1K0S A;  3VU3 C;  4NL2 A;  2CZ1 B;  3H8Z A;  5LJ3 j;  2LRQ A;  2QI2 A;  2NLU A;  4FW1 A;  4M7A G;  1T3L A;  1TUD A;  1QP2 A;  4F7U F;  3CCR A;  2BZX A;  3X25 B;  5GMK j;  3D7S B;  2LQ8 A;  3QUI A;  1M1F A;  2NWM A;  4BE0 A;  1I4K 1;  4QKU A;  4HCZ A;  1VQ6 A;  2XDB A;  4KUI A;  4GBQ A;  3OS5 A;  1K1Z A;  3VS0 A;  2YLC A;  2XIC A;  2FPD A;  2MAM A;  2SRC A;  3VRZ A;  4IUP A;  4XTV A;  4C92 E;  2CP7 A;  1UHC A;  2AK5 A;  3A8L B;  2K4Y A;  3I5S A;  4N4I A;  2LMJ A;  2RM4 A;  3M0S A;  1RL2 A;  2FZK B;  3JCM g;  4E7S A;  2RQW A;  1VQO Q;  3CC4 T;  5IXF A;  1LPL A;  4PJO G;  4ZGD B;  3V8L A;  2D1X A;  1GRI A;  3I55 Q;  2EWN A;  1GFC A;  4DEX A;  4BI4 A;  2L2P A;  1TSF A;  4RTW A;  5HK0 A;  2FRY A;  3UAT A;  3CCV T;  1Q86 C;  1WXB A;  3M4G A;  1QCO A;  2ROT A;  5GAN f;  2EGE A;  3M4Y A;  1M90 R;  5KYX B;  4LN2 A;  2DBM A;  3NTH A;  1NZ9 A;  5GAO l;  1AT1 B;  3OYB A;  2O4X A;  4FSS A;  1K9M U;  1VQ5 Q;  1ABQ A;  1QLY A;  1VQ6 Q;  1WPY A;  2X4W A;  2CH4 W;  4KH0 B;  3A1P A;  5FWC A;  3HTR A;  2A37 A;  2K5F A;  1KC8 C;  1FWZ A;  4C92 B;  3JB9 D;  2RA2 A;  4K11 A;  5J3B A;  1MUZ A;  3MJX A;  3HRT A;  2DNU A;  1D1B A;  3L2R A;  2EAY A;  4J9B A;  2F2W A;  2JXB A;  1BIA A;  3FDR A;  1PRM C;  2O2O A;  2RK1 A;  1UJ0 A;  5CKH A;  5GMK h;  2K3X A;  1YIT A;  4IKF A;  3TSW A;  2E6Z A;  1UGR B;  3CC7 T;  4M78 C;  2RQR A;  2LQK A;  4L59 A;  4OB1 B;  4QW2 A;  4OMQ A;  2X4J A;  5GMK m;  1KFZ A;  2Y4Y A;  4B9X A;  2XDP A;  2FZG B;  2HD0 A;  3SFM A;  5FU7 C;  4HXJ A;  2CUB A;  2EJF A;  2HL3 A;  3MKD A;  1JU5 C;  4E2F B;  2A7Y A;  2FG0 A;  3VJP A;  1QW1 A;  4E7H A;  2HCK A;  3NMZ C;  2KQW A;  3RKW A;  4RCC A;  2LP5 A;  2YUN A;  2D0N A;  2X51 A;  1YJN T;  4XTX A;  2E64 A;  1KK7 A;  2M51 A;  2K57 A;  1V1C A;  2I0N A;  4DOW A;  2DD5 A;  1VQO A;  3NTI A;  3L2U A;  2K5L A;  2GGR A;  5GAM d;  2PTK A;  5D6Y A;  4E7L A;  3PIO A;  4XTW A;  4M75 D;  3Q1J A;  4F7U B;  1KSW A;  1JJ2 S;  5GAN 7;  3JB9 J;  1G5V A;  3BY7 A;  3OYH A;  1M30 A;  2DL3 A;  1TH7 A;  4KH1 B;  3P8D A;  4IUU A;  2CSI A;  3EHR A;  2CUD A;  2DTO A;  2EFI A;  5GJV B;  2BIV A;  3CEY A;  1B34 B;  1KC8 R;  4R56 A;  1VQP T;  1RAC B;  3X28 B;  2D0Q B;  3HFN A;  2VWF A;  2LX9 A;  3IQL A;  4XU0 A;  3J80 E;  3SWN C;  1QVF P;  2P84 A;  4N0A C;  3CCQ A;  4LDV A;  5CAI A;  4HCK A;  4N0A A;  5KYY B;  3RIR A;  2A36 A;  5GAN h;  3FB9 A;  2RHZ A;  1C6V X;  3FJ5 A;  1KQS A;  3WVD B;  3V7C A;  3O5Z A;  3JB9 F;  2RHX A;  1K73 C;  2KDS A;  2M0Y A;  1UGS B;  4ZGJ B;  1SF9 A;  1ZUY A;  2QGF B;  5KCH A;  4M77 D;  1AWJ A;  2VXE A;  2SEM A;  1YWP A;  1VQ4 T;  1Q7Y U;  4C0D C;  4AFS C;  1KC8 U;  4ELY C;  4JZ4 A;  3VS6 A;  1BBZ A;  1N5Z A;  5HCK A;  3ULR B;  2KVQ G;  4J5Y A;  5FU7 B;  1G3Y A;  5IH2 A;  2DA9 A;  2XG8 D;  2KRM A;  2JS2 A;  1M1K U;  3PNW C;  4YTL A;  3THK A;  4BE2 A;  3QO3 A;  2E10 A;  2OJ2 A;  4JPB W;  4ESR A;  1Y7X A;  4BAC A;  1R0C B;  3G4S A;  3OYK A;  2CZ6 B;  5I21 A;  1E6G A;  1RLP C;  1BU1 A;  5GAN g;  3OYI A;  3CC7 Q;  5KYU B;  4C8Q F;  5GAN 4;  5FRM A;  5FU6 B;  1E6H A;  5AYF A;  1TOV A;  2HQE A;  5GAM f;  1WFW A;  2BE9 B;  4C92 G;  4C92 A;  1NPR A;  1YBY A;  1WNL A;  1HJD A;  2KYM A;  3QDR B;  1IO6 A;  1QKW A;  1X43 A;  3NTK A;  1T0J A;  1Y0M A;  4FYV B;  3VS7 A;  2ESW A;  4CC2 A;  1N27 A;  1YJW A;  3SD4 A;  5DLQ E;  1VIF A;  2EVR A;  4J83 A;  3PVQ A;  3OSV A;  2XU8 A;  1HXD A;  5A0L A;  1BKB A;  4J9G A;  4RTU A;  2KRS A;  1BB9 A;  4ME7 A;  2RK2 A;  4PL6 A;  3UDC A;  1MGQ A;  1AD5 A;  2MPX C;  5D6W A;  1VUB A;  1FXX A;  5CCA A;  1NG2 A;  4M7A E;  2QA4 T;  1QVP A;  1QVG P;  4Q5W A;  4MDW A;  3R6N A;  3VS5 A;  1TS9 A;  2RI2 A;  4RCB A;  1D1C A;  3RNJ A;  1XTD A;  1PCX A;  2KNB B;  4LD9 K;  4JS5 A;  2DLP A;  3ME9 A;  2VGM A;  2C0T A;  3O8V A;  5CKE A;  3H6Z A;  4TVR A;  2CT4 A;  1J3T A;  2QTV A;  4MML A;  3BE3 A;  3SB2 A;  1QWE A;  2DL4 A;  3MHX A;  2E5Q A;  2LCC A;  3CCV A;  2DER A;  2OAU A;  2ENM A;  1QWF A;  5I11 A;  1I07 A;  2KRN A;  2MIO A;  2VKN A;  2DXC A;  1VQK A;  2COZ A;  3G7Z A;  3H0I A;  1RI0 A;  1FMV A;  3MO8 A;  5LL6 S;  5GAN 3;  3CC4 A;  1VQP Q;  4N4H A;  1Y71 A;  2JN0 A;  4RG2 A;  3JV3 A;  3VYH B;  2EQJ A;  3G6E A;  2HKQ B;  2V8I A;  5FRO A;  1VYT A;  2DD4 A;  3G71 Q;  1W6X A;  1JXO A;  3NPF A;  2CZ0 B;  2Z0W A;  3J7A F;  1TG0 A;  1F1B B;  2E65 A;  3CCM T;  1M2O A;  4A54 A;  1Q7Y C;  4PLI A;  4E7I A;  1M3A A;  3PFS A;  1PNJ A;  2EQM A;  4J6X A;  1KG1 A;  5CO7 A;  4E7J A;  2EW3 A;  4M75 G;  1Z9Q A;  3PTA A;  3INZ A;  3OYD A;  4JZ3 A;  1WHJ A;  2GBQ A;  3MEA A;  1IRE B;  3KBG A;  5I2M A;  2EGC A;  4PJO D;  2PVG B;  1QP3 A;  1ZHI A;  4J7F A;  2LT1 A;  3CCR T;  1AVZ C;  2OTL A;  2X3W D;  2DET A;  4M77 E;  2DX1 A;  1ZBJ A;  2ATC B;  1M1K R;  2PUK B;  4L6V 5;  4A4K A;  3OYL A;  3GOX A;  3V8J A;  2OTJ Q;  4JJD A;  1S72 T;  2HBW A;  1JBM A;  3G6E Q;  1QVG A;  3I56 A;  2PQW A;  3LX7 A;  5GAO q;  4M77 A;  1Q86 U;  3CCL Q;  5GAO p;  2F2V A;  1VOM A;  4KT0 E;  4OB2 B;  4GLK A;  4RUG A;  1UGP B;  2IIM A;  2WSC E;  2HEQ A;  1I5L A;  1VQK Q;  1EZZ B;  2DRM A;  4JLG A;  1U06 A;  3RKY A;  2MCN A;  2PVO B;  1QCN A;  4FM4 B;  2YLB A;  3SDZ A;  4WTO B;  2KXD A;  1Q86 R;  4RTT A;  3CCM A;  3KFV A;  2JUF A;  1RAD B;  1JJ2 A;  1MHN A;  5D7U A;  2JW4 A;  1UJY A;  2LVM A;  1Q95 G;  4RKU E;  1VQ8 T;  5IN1 A;  2AHJ B;  1VQ9 A;  2XD0 A;  4Z89 A;  1YNZ A;  2L0A A;  2MMP A;  3LLR A;  1X6G A;  2O01 E;  2NUT B;  3HHT B;  2JTF A;  4M78 F;  4LDX A;  4M75 A;  3NFC A;  2DVE A;  2P4R A;  2BZ8 A;  1VQ5 A;  3M0R A;  3L2Z A;  1D1A A;  2QQS A;  3H0F A;  2YXY A;  2KE9 A;  2A0F B;  2GTJ A;  4E6R A;  2D6F A;  2E3H A;  2CP6 A;  4QVZ A;  4X34 A;  1N8R C;  2JT4 A;  4VUB A;  5L8R E;  1VQL T;  4M7A F;  2VVK A;  1JJ2 P;  3RES A;  1N8R R;  4HVU A;  4EMH A;  1UGQ B;  1G3W A;  1VYU A;  1WHL A;  4Y28 E;  1KQ2 A;  2AKK A;  3I55 A;  1ZBX A;  3CBM A;  1PSE A;  1IB8 A;  2QA4 A;  4HVW A;  4M78 A;  2HAX A;  1KHI A;  4QVC A;  1YP5 A;  1BCO A;  2QQA A;  4J9I A;  3QZ5 B;  2DEU A;  2H3J A;  2MF2 A;  3CMA A;  2RHU A;  1VQN Q;  1W70 A;  4P5N A;  5LJ5 g;  1RAE B;  2BUD A;  5DY9 A;  3SEM A;  3CD6 Q;  4AG1 C;  3QSU A;  5LJ3 g;  3CPW A;  5FU6 C;  3HRS A;  2XDD A;  2CH4 A;  3A5Z B;  3M5A A;  4R55 A;  5GAM g;  2LT4 A;  2RD1 A;  2D8J A;  1M8V A;  4MZT A;  2RH2 A;  3LGL A;  5EC7 A;  1PHT A;  2OTL Q;  4RMO A;  3MEW A;  3CPW P;  2LJ3 A;  1D3B A;  2VAS A;  1I5O B;  2KXC A;  2EQI A;  4Z02 A;  4M77 F;  4C5I A;  1HSQ A;  2EIF A;  1YIJ A;  4DBF A;  3OYA A;  3DKM A;  5GAO r;  1YIJ T;  4MDX A;  1ZX6 A;  3OYG A;  1KD1 U;  4II1 A;  3MET A;  4Y92 A;  1H8K A;  2CP5 A;  1WZO A;  3CME T;  1SRM A;  3UT1 A;  2COY A;  1MND A;  1UUE A;  5CVI A;  3EG0 A;  2KK4 A;  2M16 A;  1WJQ A;  1K0X A;  1O75 A;  2O31 A;  1NYG A;  1GXI E;  3CCJ A;  2E3I A;  3KUF A;  3EG1 A;  4C0Z A;  1O9S A;  2DXU A;  1YI2 Q;  2FL7 A;  4PJO E;  4C5G A;  4M7D D;  1E7O A;  1JXM A;  2R58 A;  5I2S A;  2XMF A;  2DM1 A;  2E5K A;  4J9E A;  5A0G A;  1VQ4 A;  3C4S A;  4WCI A;  2RMO A;  4AFQ C;  4C8Q D;  3JB9 I;  1Y07 A;  4RG8 A;  3GLX A;  3I9Q A;  1YI2 T;  1MV3 A;  1QCF A;  2QQB A;  3EGU A;  1AWW A;  4OP0 A;  1XNI A;  2O9V A;  4O6J A;  3NHN A;  4M7A D;  4OF1 A;  2ZPH B;  2LQN A;  3C95 A;  5IT9 E;  1S1N A;  4QQ6 A;  1UB4 A;  3N5B B;  1SG5 A;  1NM7 A;  2RJF A;  2L89 A;  3M55 A;  1VQL A;  4KRT A;  2YT6 A;  1WHG A;  2HL5 C;  1LCK A;  2AZV A;  2WSF E;  2F2X A;  4EMK A;  3EG9 B;  1OYX A;  2WSE E;  4M78 E;  2VV5 A;  4BDY A;  2KBT A;  5KE3 A;  5CKB A;  4EMG A;  2M9U A;  3EGX B;  4C5H A;  4B9W A;  1CSK A;  1SPK A;  1OZ3 A;  3QPH A;  2FHD A;  3DB4 A;  3L1A A;  4F14 A;  1X2K A;  1WHK A;  2MYS A;  4HT8 A;  4A53 A;  5GAO m;  3LH0 A;  1A0N B;  1WJR A;  5GAN e;  1VQO T;  2PNI A;  4ZGE B;  4M77 C;  2RF0 A;  1X75 C;  3MP1 A;  4M7A A;  1KIK A;  5GAN 2;  1VQN T;  4PJO C;  4JUV A;  1UG1 A;  1YJN A;  3RBB B;  4F7U A;  3UPU A;  1RAB B;  3JCM V;  1DJ7 B;  2XK0 A;  2RJD A;  5ECA A;  3VKI A;  2DZC A;  2LNH B;  2CZ7 B;  3ZBD A;  5L23 A;  2RQT A;  2YRC A;  4RTV A;  3JCM J;  4OB0 B;  3EH2 A;  3CCJ Q;  4M4Z A;  4IUV A;  2JMC A;  3OYF A;  1B07 A;  3T9N A;  4C92 D;  2EBP A;  5HK3 A;  1X69 A;  4LDY A;  3PGG A;  4PFP A;  2DKG A;  1UGV A;  1Q82 U;  3URG A;  3JB9 G;  3H9N A;  3H0H A;  3OYC A;  1R77 A;  3DB3 A;  3CPF A;  1U5S A;  4JRP A;  1EFN A;  4NS5 A;  1V76 A;  1VQM T;  1BIB A;  1SSF A;  4F17 A;  5GAN 5;  2CP0 A;  2NUP B;  3VUZ A;  3OW2 S;  1C0M A;  1AWO A;  3I56 Q;  5CK9 A;  2EKO A;  1VQ9 Q;  2QXF A;  4X1V A;  1M3C A;  1N8R U;  2NUT A;  1TUG B;  1M5Q 1;  2COW A;  2K6D A;  1MV0 B;  2GTO A;  2J7I A;  3BDU A;  4HKE A;  3P8H A;  1ZLM A;  2JTE A;  4AMC A;  2EJ9 A;  4JJN K;  2QTX A;  3QJY A;  1R8O B;  2FVU A;  5GMK e;  2DK3 A;  1IGQ A;  2EYZ A;  2ABL A;  1K73 R;  3CME Q;  2DXT A;  3M59 A;  3CCQ Q;  4IUR A;  2QDL A;  3S6W A;  2JM8 A;  3G6E T;  4OB3 B;  4X9C A;  1TWB A;  2X9H A;  1Q7Y R;  4C0F A;  1OI1 A;  2J6F A;  1NE8 A;  3M54 A;  4ELZ C;  3CXC S;  4C8Q G;  5J39 A;  1VQK T;  2PVD B;  1MMD A;  4JDS A;  2J06 A;  1ARK A;  9ATC B;  2IPO B;  5GAO n;  1YCS B;  4BI3 A;  2KSS A;  5GAN 6;  1D0Y A;  3GP8 A;  1QVG S;  3M57 A;  3MPU B;  2YSQ A;  1ZUK A;  3QDF A;  1NBE B;  3OYJ A;  1OX9 A;  2FEI A;  3RMS A;  3OS0 A;  3CBP A;  2D8H A;  1EX4 A;  4KGX B;  2QAZ A;  4RTX A;  4XK8 E;  3EG3 A;  3M53 A;  2E6N A;  2PUO B;  3OS1 A;  3KXT A;  2A28 A;  3OMG A;  1QMC A;  3I5R A;  3VS4 A;  2QQ9 A;  1N9R A;  3SWN B;  1SHG A;  4PJO A;  1XJW B;  3JCM Q;  3G1J A;  4OMP A;  2JS0 A;  4C8Q B;  1NJI R;  1M8M A;  2DPP B;  5KH6 A;  1G8X A;  3BFM A;  2YDL A;  3QYG B;  1WXT A;  3JCM h;  3M0T A;  1GCQ C;  3EFO A;  4EDU A;  4MMK A;  4L5G A;  2ZPI B;  2J6K A;  4CC3 A;  1YJ9 A;  2FYK A;  2DF6 A;  1OV3 A;  1NEB A;  3FJP A;  3H41 A;  3DLL A;  1X6B A;  1GBQ A;  2RHY A;  1K9M R;  4LE9 A;  2KR3 A;  1PKS A;  2DIL A;  3QG1 A;  3CXC A;  3JCM X;  1YJ9 T;  2I2L A;  3X20 B;  1NJI C;  3VV0 A;  4Z8A A;  4OMO A;  3E1S A;  1JEG A;  3CCU T;  3G4S T;  3EFS A;  2W10 A;  1SKU B;  2M02 A;  1T0H A;  1X01 A;  1PM3 A;  2XKO C;  2AIR B;  1AWX A;  1M9S A;  2K9G A;  1X27 A;  2JOY A;  3HPW A;  3E2U A;  4C0G A;  3QKJ A;  1AOJ A;  4IUQ A;  2ECZ A;  3EG9 A;  2H8H A;  4JLI A;  3LWH A;  4QVD A;  2X3X D;  1KHC A;  2F69 A;  3BW1 A;  2KEA A;  1YJW Q;  2F1L A;  4PK4 A;  4XU3 A;  3OYY A;  5LJ5 d;  4HVV A;  3PIP A;  2QAS A;  4C8Q E;  1OPL A;  1NYF A;  3REA B;  1M2V A;  2FZC B;  4ZTJ A;  1QQJ A;  5AT1 B;  1JB0 E;  1RAH B;  1FMK A;  4M7A C;  5FLX E;  2DO3 A;  1QVF S;  1BI1 A;  1LOJ A;  3G71 T;  4FU6 A;  2GQI A;  2VGN A;  8AT1 B;  1GL5 A;  4DBR A;  1G2B A;  2D9T A;  4PJL A;  2DTI A;  1WI7 A;  1CKB A;  4PNO A;  3QJ6 A;  2QGG A;  3OYN A;  3CCV Q;  3MEV A;  5C6S A;  2H3E B;  3CCQ T;  2CP3 A;  4M77 B;  1RLQ C;  2RO0 A;  3M0Q A;  4ZNX A;  2RJC A;  4V2S A;  2P0P A;  4FSX A;  2J05 A;  3QBY A;  1PWT A;  3CCM Q;  1VQ4 Q;  1Y57 A;  3TQ7 P;  4EMK C;  3EGD A;  3CCR Q;  5KCO A;  2P4T A;  3A98 A;  7AT1 B;  2XI9 A;  1W4S A;  5GAN 8;  2HKN A;  5CR2 A;  1HK9 A;  2YUO A;  1C1A A;  4PJM A;  4FYW B;  3M58 A;  3V7R A;  4EPC A;  3M9Q A;  1HYO A;  4FIB A;  1SRL A;  3FC3 A;  4D6W A;  4BE1 A;  1OU8 A;  4M78 G;  4ZN3 A;  3LH5 A;  3P8B B;  1Y96 B;  5CKF A;  4KGZ B;  1OOT A;  2OTJ A;  2RJE A;  5M9O A;  4BUG A;  4BY6 B;  2KY9 A;  2KMT A;  2FPE A;  1VQM A;  1WQW A;  3JCM P;  2YRD A;  1K9M C;  1ABO A;  3ZL7 C;  4A63 B;  3GPL A;  2RQV A;  4HCB A;  2FO0 A;  2VB6 A;  1H3H A;  5KYU A;  1WQ7 A;  2W0Z A;  1XOV A;  3EGX A;  4A4H A;  5DM7 R;  1TXQ A;  3HKS A;  3OBW A;  4IUT A;  1UE9 A;  1PKT A;  3GBQ A;  2VC8 A;  1NLO C;  2KRO A;  4M7D G;  2V8K A;  1X6O A;  3OBY A;  3CC7 A;  1D0X A;  4E47 A;  2O4X B;  4FL6 A;  5CQX A;  4MZP A;  3L2W A;  2EGA A;  3JCM f;  1VQN A;  4M78 B;  1YIT T;  2DL8 A;  4M7A B;  1JO8 A;  4AT1 B;  3PVL A;  2LDM A;  3EFO B;  4PJO B;  3TSZ A;  3PMI A;  4XTZ A;  1NLP C;  3QXE B;  4F7U E;  4CC7 A;  2DYB A;  1WLP B;  1OPK A;  3VS3 A;  4XAX B;  4AFZ C;  4FCY A;  1KJW A;  3ZEH A;  1B3Q A;  1WX6 A;  2ZAE A;  2QEX Q;  3E9G A;  3LGF A;  3JB9 H;  1S72 Q;  1BI2 A;  4OML A;  2RB6 A;  3M0P A;  4M77 G;  4XU1 A;  2JZ2 A;  1WHH A;  2XID A;  3QWX X;  3V8K A;  5LJ3 e;  3UA6 A;  3MCA B;  2KT8 A;  3HL8 A;  5GAM e;  4FYX B;  3CC4 Q;  2LJ1 A;  2DRK A;  1PG5 B;  1OU9 A;  5C0M A;  2CS7 A;  2ZGW A;  2DXB A;  4ZTF A;  2QG9 B;  4CI0 C;  1K4U S;  1VQ7 T;  4LDW A;  3L42 A;  3LWI A;  2J6O A;  3PT9 A;  5IHI A;  3CCE A;  1K8A U;  3C12 A;  2AKL A;  1I0C A;  5J26 A;  1KQ1 A;  1YI2 A;  3S3O A;  3CQT A;  1H3Z A;  1YN8 A;  4F7U G;  4LD6 A;  2Y90 A;  2R57 A;  3VUB A;  4JS4 A;  3HSB A;  1N9S A;  3C94 A;  2EJG A;  1NPP A;  1WGS A;  1D0Z A;  2K3B A;  2EYW A;  2DYI A;  4MZM A;  1H64 1;  4BI8 B;  1IRX A;  3CCJ T;  3UA7 A;  3GNF B;  2G6F X;  1VQ6 T;  1GBR A;  2JJ9 A;  2LCL A;  3E9F A;  5IXB A;  2K2V A;  1YIJ Q;  1YFN A;  1UEB A;  1UFF A;  2ZPB B;  4UC4 A;  1EIF A;  3J81 E;  3CME A;  2QA4 Q;  2DBK A;  2DTH A;  1FX7 A;  2GQV A;  2RI3 A;  3CCU A;  1W1F A;  4PJO F;  2HQX A;  3EGD B;  4J9C A;  2CDT A;  1M1G A;  2E12 A;  2G3R A;  3ER0 A;  1OZ2 A;  2IVW A;  1VYV A;  2K3Y A;  3TEE A;  2ED0 A;  2QK0 A;  5LJ3 d;  1SSH A;  2DIG A;  4KGV B;  2RPN A;  2XHC A;  2KAF A;  2V1Q A;  3V7S A;  4DOV A;  1VQL Q;  1ZA1 B;  3CMA Q;  3CD6 T;  4R0K A;  4FT2 A;  1YCY A;  2EPD A;  1X2Q A;  2DIQ A;  1AZG B;  1I1J A;  1NEG A;  3GIB A;  4FYY B;  4F16 A;  5GAN j;  2V1R A;  5CKD A;  2A08 A;  4BB7 A;  2EQK A;  1ZSZ B;  2DFU A;  1Q81 U;  2ZCF B;  4OMN A;  1UTI A;  2HSP A;  1W2B A;  2JM9 A;  2OX7 A;  3OW2 P;  5D6X A;  2YRV A;  3U23 A;  3RER A;  1KQS P;  2HSE B;  4A4E A;  2X4X A;  5CIU A;  1WHM A;  5LJ5 f;  3VYG A;  1UDL A;  3RUX A;  3JCM W;  4QQD A;  2IG0 A;  1ZUU A;  3CC2 A;  1OX8 A;  4AG2 C;  3CC2 Q;  4N4G A;  1JQQ A;  1VQ8 Q;  2K2M A;  2LQW A;  4ATO A;  4M7D B;  1HD3 A;  4EMK B;  3QII A;  1PSF A;  1RAI B;  2B8A A;  2LC4 A;  2L5Q A;  1PC0 A;  2NUP A;  3EAE A;  4RTY A;  3VS1 A;  1BK2 A;  1BCM A;  1KQS S;  4HA8 A;  2L3Q A;  1BI3 A;  2EQU A;  3NGP A;  2CSQ A;  1VQ5 T;  2PZ1 A;  4BDZ A;  1Q82 C;  2L3R A;  2GFU A;  1YHQ T;  2YUP A;  3CC2 T;  1IZ6 A;  1GCP A;  2OI3 A;  4ANJ A;  2VXF A;  1AZE A;  3HFO A;  1RAG B;  4PLL A;  2K79 A;  3S3N A;  1VQ9 T;  2JNG A;  4LDU A;  4JRI A;  2GCX A;  2V26 A;  4M75 C;  4J9D A;  4HCC A;  1M90 U;  2L3P A;  3EHQ A;  2RQU A;  3CCS A;  1TU0 B;  4CC4 B;  4DA4 A;  1KD1 C;  2C06 A;  5I22 A;  2NUZ A;  1K9A A;  3CCU Q;  3CXC P;  4M7D A;  3JCM b;  3I35 A;  2M0O A;  1CKA A;  1ZSG A;  3CD6 A;  1Z9Z A;  2YHT A;  1B34 A;  1MNE A;  3OMC A;  4XQ3 A;  2QDY B;  4M7D E;  1T3S A;  4JRK A;  4AFU C;  2VYT A;  1PD0 A;  1WIE A;  4PJN A;  3BDL A;  3OW2 A;  3A8M B;  1MMA A;  3GF5 A;  4OVA A;  2K5I A;  5IHN A;  2KI7 A;  3TVT A;  1K73 U;  2DJQ A;  3VRY A;  3G4S Q;  3AHU A;  3MEU A;  3PMT A;  1U8R A;  4GLM A;  1ACM B;  3WVE B;  2QQR A;  2JMA A;  2MOX A;  3QHS A;  1GFD A;  3CCS Q;  1SHF A;  2OTL T;  1K8A C;  2HZY A;  1XQH A;  2E41 A;  3OS2 A;  2ZPG B;  5KYW B;  2LCS A;  2PU9 B;  1M1K C;  3SWN A;  3EG2 A;  3ASK A;  2O9S A;  4WF2 A;  5LJ5 e;  3JCM d;  5HKC A;  5KYX A;  8ATC B;  1IXD A;  1ZSZ C;  2CKK A;  2EKH A;  2DL5 A;  3JAM E;  4LUE A;  2E1H A;  1OQK A;  4M78 D;  4XTU A;  1I8F A;  1Q82 R;  2MK5 A;  3OSS C;  3JRZ A;  3M0U A;  3M56 A;  1D3B B;  1ZQ1 A;  4M75 E;  3CCE T;  1IGU A;  2QEX A;  1MMN A;  2JVV A;  1H92 A;  1P92 A;  1Q81 R;  2O88 A;  2KGT A;  1VQ7 A;  4X9D A;  4M7D C;  2Y4X A;  4C5E A;  4PJJ A;  1VA7 A;  2CP2 A;  2GF7 A;  2HDA A;  3OA6 A;  4CRI A;  1U1T A;  3OYM A;  3PE0 A;  4J6W A;  1YJN Q;  3HP9 A;  3CCL T;  2QYZ A;  4IIO A;  1BI0 A;  3CCL A;  4KBM B;  5CQY A;  3OYE A;  2BTT A;  3A8O B;  2LX7 A;  4NOY A;  3LW5 E;  4GY5 A;  3TU4 K; 
#chains in the Genus database with same CATH homology
 1N8R R;  1NJI R;  3CPW P;  1K9M R;  1VQ6 Q;  3CCE Q;  3I56 Q;  2QEX Q;  3CCL Q;  3CD6 Q;  1VQ8 Q;  1K73 R;  3CME Q;  1S72 Q;  3CCQ Q;  1KD1 R;  2QA4 Q;  1VQ9 Q;  1VQK Q;  1KC8 R;  3OW2 P;  3CCU Q;  3CXC P;  1YJN Q;  3CCV Q;  1Q82 R;  1VQL Q;  1YIT Q;  1Q7Y R;  1VQO Q;  1KQS P;  3CMA Q;  1M1K R;  1M90 R;  1VQM Q;  1VQ7 Q;  3G4S Q;  1YHQ Q;  1VQN Q;  1Q86 R;  1YI2 Q;  1VQP Q;  3CC7 Q;  3I55 Q;  1QVF P;  1YJ9 Q;  2OTJ Q;  1K8A R;  1W2B P;  1Q81 R;  3CCM Q;  2OTL Q;  1VQ4 Q;  3G6E Q;  3CCJ Q;  1QVG P;  1VQ5 Q;  1JJ2 P;  1YIJ Q;  3CCR Q;  3CC2 Q;  3CC4 Q;  3CCS Q;  3G71 Q;  1YJW Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...