1ZUKA

Yeast bbc1 sh3 domain complexed with a peptide from las17
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
EPEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFVAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords Myosin tail region-interacting protein MTI1
total genus 14
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zukA00
2FO0A 2EGEA 1M27C 1UGVA 2DL7A 1WA7A 1AWWA 4ZNXA 4Z89A 2RQWA 2DMOA 4WCIA 1QCFA 2JM9A 2DYBA 2ECZA 1OPKA 4QT7A 2K7AA 3SHWA 1WLPB 3NGPA 2JT4A 1U5SA 4LN2A 1SHGA 4JJBA 1WXTA 3EGUA 3VS7A 4F16A 1NEBA 1SEMA 4JJDA 2RMOA 1UTIA 1JU5C 3LH5A 1Z9ZA 2DF6A 4J9BA 3TVTA 3H0IA 1AD5A 1I1JA 1TUCA 1JXOA 2EYZA 1CKAA 5I11A 1W1FA 2CSIA 1IO6A 1V1CA 2K6DA 2JTEA 2KR3A 3C0CA 1UHCA 1ZUKA 3H41A 2PTKA 1AWJA 2KEAA 3NHNA 4ESRA 3M0RA 5IXFA 4IIMA 1PRMC 2KRMA 1UFFA 3VS1A 2KT1A 2DILA 2DL3A 1PKTA 2CH4A 2O31A 2VKNA 4CC3A 4AFSC 2H8HA 4Y92A 2JW4A 1X6GA 4CC2A 1S1NA 2J05A 2F2XA 2X3XD 2J6FA 1XOVA 1CSKA 4J9IA 1BK2A 1YP5A 4RTWA 1Y0MA 2YUPA 2IIMA 2PZ1A 2FEIA 4F14A 2KT8A 3H0FA 1UG1A 4AFQC 2EW3A 2D8JA 1X2KA 1K76A 2LMJA 4HVVA 1AOJA 1SPKA 3R6NA 1FYNA 1YWOA 3CQTA 2SRCA 4D8DA 2GTJA 1JQQA 2F2VA 4RTUA 2EPDA 1VA7A 4LNPA 1K0XA 2LZ6B 2DE0X 2DA9A 1M3AA 4HXJA 2OAWA 1OOTA 2CDTA 2I0NA 2YT6A 3EHRA 4AG2C 1U06A 4LUDA 3NMZC 2BTTA 1G83A 2C0IA 2E5KA 2EQIA 1ZSGA 4RTVA 1PHTA 2ED0A 3VRYA 3A98A 3EG2A 4J9FA 2DBKA 3M0PA 2A28A 1YN8A 1ZLMA 1H92A 2BZXA 5GJWB 1GCQA 4OMPA 1NLPC 2F2WA 1GFDA 1AVZC 2YUNA 4A63B 1E6HA 2RN8A 1WXBA 2DRMA 4RTZA 2DBMA 3EG1A 4X1VA 4AG1C 1UJ0A 1H8KA 1UJYA 3VS3A 4DEXA 1YCSB 4LUEA 1GL5A 1QKXA 1VYUA 1BBZA 2LNHB 2EBPA 2J7IA 2RPNA 1M3CA 2EYYA 4JJCA 2OI3A 1ZUYA 1UDLA 3EG0A 2DL4A 2C0TA 3VS4A 2JMCA 1TG0A 2K3BA 1KIKA 1GCQC 1JEGA 1GCPA 2D0NA 3REAB 2KRNA 1AWXA 1K1ZA 5I22A 1UE9A 1KJWA 2DRKA 3PVQA 4J9CA 3GBQA 4IIOA 4J9GA 2O9VA 1NLOC 2AZVA 2K9GA 2J6OA 4OMQA 4J9EA 2AZSA 2CSQA 3ULRB 5GJVB 3M0TA 2LCSA 4RUGA 1KSWA 3I9QA 3RNJA 1SRMA 1Z9QA 4J9HA 2JXBA 3NPFA 2PNIA 2K2MA 3O5ZA 2VVKA 1ZX6A 3M0QA 1T0HA 2KGTA 1X2QA 3VS2A 2B86A 2JS2A 2EYWA 2YUOA 2KXDA 2W0ZA 3UA7A 2EKHA 2LQWA 4HVWA 1OPLA 2C0OA 1E7OA 4JZ3A 2JS0A 1UECA 2CH4W 2EYXA 1GBRA 3IQLA 4JZ4A 2O9SA 1SRLA 2ENMA 3QWXX 3VS6A 1QWEA 3UA6A 1WIEA 2FRWA 1QWFA 1ABOA 1VYVA 2V1RA 4GBQA 4FSSA 3U23A 3FJ5A 2J06A 2L3QA 2KROA 3I5RA 2J6KA 2G6FX 2NUZA 2LJ3A 1YNZA 2FPEA 2GNCA 1Y57A 2YDLA 1ZBJA 1TUDA 1M30A 1SSHA 2FPDA 1SHFA 1QLYA 2L3SA 2VWFA 2L2PA 1ABQA 5ECAA 2O88A 2KXCA 2FG0A 1I07A 2ESWA 4JPBW 2XMFA 2KBTA 1K4US 2O2OA 1M3BA 1RUWA 1M8MA 1PKSA 2HEQA 1H3HA 1B3QA 2V1QA 4K11A 1AEYA 2LP5A 1GBQA 2RF0A 4ORZA 1PRLC 1RLQC 2KE9A 2BZ8A 1J3TA 1X69A 2GQIA 2RQUA 3EHQA 4HCKA 2LJ0A 4OMNA 1W70A 3ZL7C 2HDAA 1MV3A 1AZGB 2M0YA 2RQRA 4RTXA 1K0SA 1GFCA 2ROTA 2MIOA 4CC7A 1NYGA 1MV0B 5IHNA 2JM8A 2DX1A 1NYFA 2L0AA 3REBB 2BZYA 2JMAA 2D1XA 3THKA 1WYXA 2HSPA 4CC4B 4GLMA 4RTTA 2NWMA 3SEMA 2GGRA 1JO8A 1BU1A 2ABLA 4OMMA 5IHIA 1AWOA 2P4RA 2RQVA 1U3OA 1NG2A 3JV3A 4KRTA 2EGAA 1T3LA 2MOXA 3VRZA 4AFUC 1QKWA 1ZUUA 2HCKA 3VS5A 2AK5A 2CUBA 2DVJA 3PE0A 2DM1A 2GTOA 1AZEA 4Z88A 3VS0A 2ED1A 3M0UA 3TSWA 2FPFA 2A08A 2KYBA 1HD3A 1PWTA 1GRIA 2EVRA 2FRYA 3RBBB 2GBQA 2M51A 2LQNA 1OEBA 3I5SA 4OMLA 4DEYA 5IXBA 1YWPA 4M4ZA 5HCKA 1OV3A 2L3PA 4RTYA 2AKKA 1NEGA 2LX7A 4OMOA 1FMKA 1UUEA 5L23A 4E6RA 1WX6A 1A0NB 1HSQA 2K79A 1EFNA 1W6XA 2QDLA 4D8KA 1E6GA 1WXUA 1KFZA 2DLPA 1JXMA 2DJQA 4LE9A 5FWCA 2RNAA 2DL8A 3UF4A 1ARKA 1X43A 1WDXA 4AFZC 1T0JA 4HVUA 2A37A 2YUQA 1N5ZA 2MCNA 2KYMA 1RLPC 1X27A 1B07A 4Z8AA 2A36A 1K9AA 2ROLA 2CUDA 2DNUA 1LCKA 3I35A 5EC7A 1BB9A 2YSQA 2LJ1A 1VYTA 1WI7A 2W10A 3M0SA 5IH2A 3TSZA 1I0CA 1PNJA 2AKLA 1NM7A 2KRSA 3PVLA 1G2BA 2D8HA 5IHKA 1MUZA 2CREA 5FWBA 1T3SA 2OJ2A 1X6BA 5FW9A 3H0HA 1RI9A 4R0KA 2RQTA 2EGCA 2DL5A 4F17A 1WFWA 3EG3A 2CT4A 2X3WD 2HBWA 2SEMA 1UHFA 3KFVA 3UATA 3QWYA 2KNBB 4EIKA 1CKBA 4J9DA 2CT3A 1HJDA
chains in the Genus database with same CATH superfamily
5LJ5e 1UGVA 1AWWA 4Z89A 3OYJA 2DMOA 4HT9A 2DERA 2MWOA 4HCBA 4RG8A 5IT9E 2QEXA 4LN2A 4FL6A 4F16A 4XU2A 1NEBA 1QVPA 4JJDA 5HK0A 1PCXA 3LH5A 1Z9ZA 1RI0A 5GAMg 4B6MA 5GANj 2EYZA 1CKAA 4KGZB 4C5HA 4FT2A 2R5AA 1VQPT 4KUDK 5GAOn 4M75C 1I5OB 1MMNA 1VQ9T 1IB8A 5GANd 3ZEHA 2L89A 3QYHB 2VC8A 1ZSZC 5IXFA 3HRSA 1Q81U 1PRMC 2ZPBB 2KRMA 1UFFA 2DL3A 4NL2A 3BY7A 1YIJA 3OYLA 4CC2A 2J05A 2X3XD 4JUVA 2J6FA 1XOVA 5I2MA 4PJOE 2IVWA 5GMKi 1VQ7Q 1Y96A 1M9SA 1FWZA 1PD1A 3CXCA 2DTHA 5D6WA 1UG1A 3KBGA 4HVVA 3OB9A 1RACB 1AOJA 3EGDA 1SPKA 2FZGB 3F70A 1N8RR 4NOYA 2RH2A 4XU3A 3LLRA 2SRCA 4LDYA 2GTJA 1JQQA 5GMKm 3G71T 4RTUA 5GAOl 2QXFA 3OY9A 5KYWA 2EIFA 2LZ6B 1QW1A 3ER0A 4HXJA 1OOTA 2YT6A 4AG2C 2GQVA 2MAMA 2RHXA 1M2VA 5CKFA 1RL2A 3EG2A 2E3IA 3M0PA 3JB9J 2MF2A 1ZLMA 3G4SA 4M7DE 1GCQA 4OMPA 4DBQA 4JRPA 4PKCC 1VQLT 2KI7A 1I5LA 2JN0A 4EMGA 1GFDA 3OMGA 4A63B 1E6HA 2BUDA 1FMVA 1ZBXA 2XI9A 2QASA 2K5FA 4KBMB 1TWBA 4FW1A 1I4K1 4AG1C 1UJ0A 1BKBA 3VU3C 1VOMA 1VQ6Q 4N0AA 1U1SA 1WGSA 3OYDA 4LUEA 1QMCA 2MMPA 2BE7D 1GL5A 3A8LB 4CI0C 3CBMA 3L2VA 5FLXE 2CZ1B 2J7IA 4BY6B 4LD9K 2DJZA 2F69A 3RMSA 3CC7A 1QVFP 2OI3A 4CRIA 3A8HB 1ACMB 1UDLA 1YITT 2C0TA 2E1HA 3X20B 1M90U 1P92A 4ZTFA 2QQBA 2JTFA 3QJYA 4KH1B 5GAN3 2ZZDA 1YIJQ 3OA6A 1K1ZA 1YIJT 5LJ3f 4J9CA 3JCMQ 4IIOA 5GAN5 1KQ2A 1NLOC 2AZVA 2JJ9A 3J81E 3CD6Q 4JDSA 3CCLA 3CCSA 3OYHA 3HRUA 2JXBA 1OX9A 3O5ZA 2VVKA 5A0DA 4XTVA 5FRNA 4DBHA 2B86A 4M7DF 3LW5E 3GNFB 2W0ZA 2MYSA 2EKHA 2LQWA 3J80E 2R5MA 3M5AA 1OPLA 1UGQB 4HVWA 5LJ3j 2C0OA 2JS0A 1GBRA 3CCJA 2ENMA 4OB0B 3UA6A 4QQGA 5GANe 3QO3A 5KE2A 2OTJT 3HFOA 4FSSA 4GBQA 3FJ5A 2J06A 1N8RC 2L3QA 2V8IA 5LJ5d 2KROA 3CMAT 4MZTA 3E2UA 1XNIA 3I5RA 3SWNC 4PLIA 1D0ZA 2FPEA 2GNCA 4PLLA 1Y57A 1C6VX 1M30A 4C0FA 2FPDA 2VWFA 3PMTA 2L2PA 4XU1A 4XTXA 4E7IA 2O88A 1VQ5Q 1M1FA 1M4ZA 1I07A 3JCMh 2ESWA 4JPBW 3CMEA 2XMFA 4MZMA 3MJXA 3VKIA 4V2SA 1D1CA 4C0DC 1X01A 3G71A 2LT1A 3S3NA 2OTLT 1AEYA 3OYGA 3I56A 3CCVQ 2RF0A 3E1SA 5I21A 1B34A 3CC7Q 1YBYA 1ZA2B 4PJNA 3EHQA 4J6WA 5GAOp 1VQ7T 1OZ2A 4EMKA 3WVEB 3META 3CMEQ 1TUGB 2EKOA 4PK4A 5CKBA 3TQ7P 3HSBA 1TXQA 2K57A 1NYGA 3EFOB 3OYKA 5IHNA 2PQWA 4KUIA 3BDLA 3REBB 3CCQT 3V8LA 2BZYA 3TREA 5FRMA 3SB2A 2EQKA 4ZGJB 4R55A 4M7AB 3CC4A 1WYXA 1Q86U 1RAGB 4GLMA 2DTOA 3PIOA 2E3HA 2NWMA 3AHUA 2QG9B 3OW2S 2WACA 4L6V5 5KYUA 5J39A 4IUVA 2PVOB 4OGCA 4A53A 4XU0A 1Q7YU 3EAEA 4FYWB 2EGAA 1T3LA 1TOVA 4E7SA 3G71Q 4BDZA 3VRZA 4AFUC 2CUBA 4OVAA 2ED1A 2PVDB 1PWTA 2H3EB 3OYFA 3RBBB 5HK3A 5HY6A 1IGQA 1LPLA 2V8KA 2HBPA 4KULA 4PJOA 3CC4T 2NYSA 3HP9A 2MPXC 4OMLA 1YWPA 5LJ3e 5HCKA 1VQOA 1OV3A 2L3PA 4RTYA 2LX7A 2EAYA 4MDXA 3RKWA 2V8JA 3RERA 3OW2A 1SG5A 2COZA 2LRQA 3HKSA 2DJQA 3DLLA 1VQ7A 2RNAA 2DL8A 1ARKA 1X43A 1WDXA 1T0JA 3MEUA 1WZOA 2YUQA 3HRTA 1RAHB 3M59A 2ROLA 2CUDA 2RJFA 4QVZA 3UPUA 3R6OA 1YJNA 2AHJB 2LJ1A 3C95A 4PJOC 3JCMc 1Y7XA 1B34B 2BIVA 2NUTB 2C06A 4PL6A 4XK8E 5KYWB 5GAN8 4BE2A 1NJIR 1QVFS 3O8VA 1WJQA 1M1KC 2KRSA 2QA4A 2D8HA 5IHKA 2DD5A 4BI4A 3INZA 3OSSC 4F04B 3QDFA 2P0KA 5FW9A 3OYMA 2LCLA 2DL5A 1WFWA 2CT4A 2HBWA 2SEMA 3HL8A 3KFVA 4C8QA 3QWYA 3CC2T 4EIKA 2XDBA 1CKBA 2CT3A 1HJDA 2FO0A 1M27C 2KK4A 3WVDB 5CAIA 3I56T 2LX9A 2RQWA 2P84A 2JUFA 2YXYA 1QCFA 3URGA 4QT7A 2K7AA 3JB9F 3A1PA 1VQKT 3C4SA 1SHGA 3N5BB 3BDUA 3VS7A 4M75G 1SEMA 4FIBA 1X75C 1IHWA 1JU5C 2DF6A 3I55Q 3CBPA 3H0IA 1JXOA 1OX8A 3CXCS 3VYGA 1VQ6T 2CSIA 2DEQA 2DTIA 1ZHIA 1Y71A 4NS5A 1YJ9T 4EMHA 1UHCA 2PTKA 2Y4XA 4YTLA 3EG9B 2KEAA 3NHNA 3LGFA 3UWNA 3X25B 4E47A 2FYKA 4ESRA 3CC4Q 3GP8A 3OS0A 4OB2B 3VS1A 1SF9A 4M7DC 3BFMA 2QA4Q 2O31A 1G3TA 1VQMT 1D3BA 3OW2P 2VKNA 1YITA 1S1NA 4J83A 1MNDA 4J9IA 4FW2A 3V7SA 1YP5A 2YLBA 4RTWA 1Y0MA 2EYQA 3A5ZB 4M77E 3X28B 4F7UF 1U8RA 4LDVA 4BY6C 1K76A 3JCMV 4C0ZA 1YI2Q 3M9QA 1YWOA 5AT1B 4D8DA 3JB9H 5GANg 1WPYA 2EPDA 4LNPA 3S3MA 4UC4A 1YJWQ 2XDDA 1K0XA 2DE0X 1PSFA 2ZAEA 2OAWA 4PJLA 2I0NA 4IUQA 1YHQQ 2E5KA 1ZSGA 3H9NA 4XTYA 1PHTA 3VRYA 4N4IA 3CC7T 3A98A 1VQKA 5GAN7 4XQ3A 2DBKA 2A28A 1YN8A 4FSXA 2CP2A 2YLCA 1RADB 1H92A 2BZXA 3BW1A 1Q81C 4Z02A 1FXXA 1NLPC 4M78A 1JBMA 5L8RE 2YUNA 2ZGWA 4F7UG 4PJOD 5GMKh 1YJWA 1W2BP 3G7ZA 3EG1A 4C8QG 4JS4A 1UJYA 2CP6A 4JLGA 3JCMJ 3V7RA 1YCSB 2WSFE 1I8FA 4KT0E 3M4GA 5J3BA 4QKUA 4R56A 5GAOr 2LNHB 1WHGA 4EMKC 2RPNA 2CZ0B 3LWIA 4C0GA 1S72Q 3FJPA 2K3YA 3EGDB 1O75A 4LDUA 1KD1C 2X4XA 2DL4A 1IXDA 4M75E 1Q81R 1TG0A 1KIKA 3QZ9B 2WSCE 3VUZA 1JEGA 5M9OA 3V8KA 2D0NA 2M1HA 2E4HA 4A4GA 1G3SA 2HSEB 5LL6S 1D1AA 4DBFA 4J5YA 3H8ZA 2COYA 3PVQA 1KD1R 2CGHA 1VQNA 2L3RA 2QK0A 4OMQA 2VV5A 2AZSA 4WTOB 3ULRB 2QGGA 2YRCA 4RUGA 1KSWA 5AYFA 2GF7A 1SRMA 5GAOq 3RKYA 2PNIA 1M8VA 1RAEB 3OS5A 1RABB 3PGGA 1T0HA 3GPLA 1HXDA 2JS2A 1KQSP 2EYWA 2DEUA 3TU4K 1LOJA 2YUOA 2DVEA 2QI2A 3CCMA 2V26A 1E7OA 4JZ3A 3D7SB 3IQLA 3QSUA 1OU9A 2WSEE 4JZ4A 1SRLA 2X9HA 3VS6A 2QGFB 3CCLQ 1MMAA 1QWFA 4LXCA 2DK3A 3RKXA 3CCUT 3MEWA 1Q82R 2DFUA 2PVGB 3DLMA 1OZ3A 5KYUB 3M53A 2G6FX 2LJ3A 3M54A 1NZ9A 1UGRB 2YDLA 1ZBJA 1TUDA 1SSHA 2L3SA 1QLYA 2K4YA 4M77D 3SWNB 3VV0A 1ABQA 3CCEA 2KXCA 2FG0A 5LJ3g 3QJ6A 4HT8A 1R77A 3OQ5A 2PUKB 3MHXA 1M8MA 2YHTA 2HEQA 1H3HA 1B3QA 2V1QA 4M78B 4IUPA 4PNOA 3MEVA 4ORZA 1VQLQ 1PRLC 2HKNA 4M7AD 1RLQC 1VQ9Q 2RJEA 3DB3A 2X4JA 3LWHA 2BZ8A 1J3TA 2P0QA 4HA8A 3JCMX 1VQMA 1M2OA 3P8DA 4A4EA 1K8AC 3P8BB 2COWA 3KUFA 1ZQ1A 5LJ5g 1K0SA 5CKHA 2G3RA 3GIBA 4GY5A 4QQDA 4FM4B 4HCCA 1QCOA 1MV0B 2CZ6B 3CCVT 4B9WA 2HKQB 2JM8A 4PJMA 1NYFA 1U1TA 4DOWA 5KYYB 2JMAA 2D1XA 2KDSA 4XAXB 3QHSA 1DJ7B 2DAQA 3CCEQ 1BU1A 2D9TA 4TVRA 1K73C 2XICA 2P4RA 4MDWA 2RQVA 1K9MR 1XQHA 2MOXA 3GNGA 1ZUUA 2HCKA 1TSFA 2IPOB 2EQUA 2DVJA 1X6OA 3VS0A 3QKJA 2FPFA 3CCRT 2A08A 1HD3A 1GRIA 2FRYA 4BE1A 5GMKe 1QP2A 2E6NA 5CQXA 2GBQA 1FMWA 3JB9G 4C92G 2OAUA 2LQNA 3JRZA 3CC2A 2RI2A 3OYAA 3DKMA 2FL7A 3JCMg 1IZ6A 4LD6A 2E10A 5IXBA 2MWPA 2XK0A 1N8RU 1R0CB 2K5LA 1WX6A 3L2WA 4BD3A 1EFNA 2QAZA 1W6XA 4C8QE 2QDLA 4O6JA 1E6GA 1WXUA 1TU0B 4P5NA 3M57A 5FWCA 1G3YA 2CP7A 1VQ4T 3NTKA 3CBOA 1PM3A 5GAN6 1RLPC 1X27A 1B07A 1K9AA 4M7DD 1LCKA 3I35A 1VQ5T 1BB9A 1JRIA 2YSQA 1YJ9A 8AT1B 4QQ6A 5IH2A 2JNGA 2AKLA 1N9SA 5GAMf 1G2BA 4II1A 1KD1U 2QTXA 3OMCA 1T3SA 1KC8U 3OYEA 4C0DB 3CMET 1M1KR 2OJ2A 4RCBA 2EGCA 3CCQQ 3EG3A 1W4SA 1EIFA 2DIQA 4PJJA 4M77A 4J9DA 1QVGS 1Q95G 2EGEA 3L2QA 2DL7A 2ZPFB 2OTJA 5CVIA 4ZN3A 3OYNA 3X24B 2VASA 5GMKl 2JM9A 2DYBA 2ECZA 1OPKA 1OQKA 2DETA 3SHWA 1WLPB 1U5SA 2GFUA 4EDUA 4JJBA 1D09B 4J7FA 3PNWC 3EGUA 1KQSS 2RMOA 4FYXB 4J9BA 3TVTA 3L2UA 4DA4A 1AD5A 1TUCA 2P0PA 5I11A 3G6EA 1W1FA 1IO6A 2K6DA 3VJPA 2JTEA 2XKOC 2VGMA 2KR3A 3C0CA 1RAIB 3JB9D 1VQKQ 4KH0B 5CQYA 1AWJA 2OTJQ 3MKDA 4HKEA 5GANf 1NBEB 2QQ9A 2HQHA 2KT1A 3VUBA 3L2RA 5A0GA 2CKKA 1WJSA 5C6SA 2CH4A 1BCMA 2I2LA 5FU6B 4CC3A 2OX7A 4AFSC 2JW4A 1X6GA 2MI6A 1VQPQ 1KK7A 1RAAB 1Y96B 1M2VB 1WQWA 1CSKA 1YHQT 1BK2A 3G6EQ 1MNEA 1C0MA 2YUPA 4MMKA 4F7UA 2PZ1A 2DD4A 3JCMW 5GMKj 3JB9I 2KT8A 4ZGEB 1PC0A 2D8JA 4M78G 1X2KA 2RJDA 3QIIA 5GAMd 2GFAA 2DKGA 3ASKA 2RO0A 3G4SQ 4VUBA 1FYNA 2XIDA 3ZFJA 1BYMA 2E64A 5C0MA 2F2VA 1VA7A 1VQPA 1N27A 2DA9A 1BCOA 3JCMf 4ME7A 1M3AA 3TCJA 2R58A 2YRVA 3RDVA 4PFPA 1AHJB 4F7UB 3EHRA 4LUDA 2DO3A 3QDRB 4RTVA 3H6ZA 3CD6T 4M75F 4J9FA 1O9SA 1BIAA 5GJWB 2LQKA 2F2WA 1UGPB 2HD0A 1AVZC 4N0AC 1WXBA 2DRMA 7AT1B 4FYYB 1YITQ 4N4HA 2DBMA 3AT1B 4N4GA 4X1VA 1H3ZA 4Q5WA 4M77G 4M78D 1K73U 2PUOB 1ZSZA 2EJFA 2DXTA 2EWNA 2LTOA 1MMGA 1QKXA 2O4XB 2DPPB 4A4HA 2ZPHB 5IAYA 5GAMe 1M3CA 1IGUA 4JJCA 4KGVB 1OI1A 1KQ1A 3EG0A 3CPWS 1QP3A 1TTHB 2OTLA 2RHIA 1GCQC 1MHNA 1GCPA 4JS5A 4MMLA 3RESA 1V29B 2RI3A 3OS2A 1UE9A 3CPFA 3NTHA 2DRKA 2QEXT 4PJOF 2NLUA 1MGQA 2K9GA 4AT1B 5DLOA 1BI0A 3EGXA 2KVQG 3M0TA 3OYCA 5FU6C 2LCSA 2VB6A 3RNJA 3CMAA 2K2MA 4J7IA 3ME9A 4FT4A 1X2QA 2KXDA 1NPPA 3UA7A 2RHUA 4F7UE 1G5VA 2RHYA 2CH4W 2HQEA 5GAN4 1VIFA 5A2QE 2O9SA 4ELZC 1M1GA 1QWEA 2FRWA 2PU9B 2A3LA 4RMOA 2E65A 1VYVA 2V1RA 3M58A 3U23A 3CCVA 1KG1A 3SDZA 2LCCA 2X4WA 4BDYA 1H641 1YNZA 1Q82U 1K9MU 3PT9A 4E7KA 1IRXA 4ANJA 2EQMA 1SHFA 5ECAA 3CEYA 2XU8A 2F5TX 1KHCA 1NJIC 2LC4A 4PJOB 3GF5A 2ZPGB 5KCHA 1K4US 1M3BA 2QYZA 4M7DG 3CPWP 1IHVA 3UDCA 1PKSA 1VQ8A 5A0LA 3C12A 1JJ2S 4M77C 2X51A 1W2BA 1YHQA 2LP5A 3VYHB 4JJNK 1X69A 2GQIA 2R57A 4A54A 1LVKA 1WHLA 5J26A 3OBYA 2LJ0A 1W70A 2P4TA 3ZL7C 1Q86C 1MV3A 1AZGB 2M0YA 2RQRA 3E9FA 4RTXA 4E2FB 5CKDA 2QEXQ 4ZTJA 1GXIE 3PTAA 4L59A 1GFCA 1I81A 2ROTA 3JSCA 2RK2A 5KYXA 2MIOA 4CC7A 4C92D 1N6AA 1Q7YC 3E9GA 3LYIA 4DBRA 2JOYA 4XTZA 3THKA 2HSPA 4CC4B 3JAME 2M0OA 4RTTA 3JCMb 2HNIA 3SEMA 2GGRA 1JO8A 4QVCA 1OU8A 3S3OA 4C92B 2ABLA 4OMMA 4C92E 2XG8D 4ATOA 1AWOA 1U3OA 1NG2A 3FDRA 2RM4A 3OYYA 1QKWA 4C92C 1WHKA 1VQ8Q 1HK9A 2KAFA 2DM1A 2GTOA 2CP3A 2LVMA 3HFNA 4IURA 4M75B 4Z88A 2QA4T 3M0UA 3QBYA 3FRNA 2EVRA 4IKFA 4OGEA 5FROA 5KE3A 3CCSQ 3SD4A 2KMTA 2M51A 4RG2A 1V76A 2NUTA 9ATCB 1OEBA 1JJ2A 3KXTA 2X35A 4DEYA 4M4ZA 1Y07A 1XJWB 4M75D 1WQ7A 4OMOA 1KC8R 3CCMT 4E6RA 1A0NB 3MEAA 4D8KA 4M7DA 2DZCA 2DXBA 2ZPEB 2JZ2A 2IG0A 2DLPA 1JXMA 4LE9A 4J6XA 3UF4A 3PMIA 3PIPA 3UT1A 3I56Q 4M78F 2D0QB 2A37A 2MCNA 4Z8AA 1WJRA 3EH2A 4Y91A 2DNUA 4A4KA 5EC7A 2W10A 5EG2A 2A7YA 3FB9A 5HKCA 2HL5C 4LDWA 3TSZA 1PNJA 2NUPB 1NM7A 2RD1A 2CREA 1X6BA 3H0HA 1RI9A 2HQXA 3JCMd 5GANh 4M75A 4R0KA 1D1BA 1MMDA 1ZA1B 2X3WD 4E7HA 1K8AU 5GAMj 1K73R 1PD0A 2E70A 2M02A 1JJ2P 4M77F 2KNBB 2QQRA 4KGXB 5CCAA 3BE3A 1WA7A 4RKUE 4ZNXA 2CZ7B 1WHMA 2ZPIB 4WCIA 5LJ3h 1AT1B 3M56A 1D3BB 1SSFA 3NGPA 2JT4A 4C5IA 1WXTA 2KQWA 5DLQE 4M7AC 3QPHA 1UTIA 2E5QA 1VQNQ 4AMCA 1QVFA 3FC3A 1I1JA 4QVDA 5DM7R 2RA2A 4PFOA 4B9XA 1V1CA 1Q86R 2HMAA 3MO8A 1ZUKA 2M16A 3H41A 1F1BB 1TS9A 2LNVA 3M55A 2LQ8A 1D0XA 2JVVA 3M0RA 2DXUA 1UEBA 4IIMA 3FEOA 3HPWA 3FIFA 5LJ5h 2DILA 4EPCA 2EJGA 1PKTA 2KY9A 2DXCA 1Q82C 1B7TA 2H8HA 4Y92A 4IUTA 3L42A 2F2XA 2Y90A 2CS7A 3EFSA 5FU7B 1SKUB 2IIMA 2FEIA 3GLXA 4F14A 4M7AG 3H0FA 4M78E 4AFQC 3ZBDA 2EW3A 2FZCB 1BI3A 5CK9A 1QCNA 2LMJA 3HHTB 1YCYA 3EFRA 1YJNQ 2XD0A 5KH6A 4BE0A 3R6NA 1JB0E 5D6YA 2F1LA 3CQTA 4PJOG 1M90C 2VYTA 1VQOQ 3Q1JA 4C5EA 4X34A 3NTIA 1NPRA 2RB6A 1YFNA 1LJOA 3I55A 2CDTA 3CCQA 1RAFB 4FYVB 1U06A 3NMZC 2BTTA 2CP5A 1G83A 2C0IA 2EQIA 3CD6A 3FLGA 2ED0A 2EQJA 1QQJA 4OF1A 4JRKA 3L2ZA 3A8GB 3QUIA 1BI1A 2L8DA 2OTLQ 2RN8A 3OYBA 3LH0A 2MK5A 4RTZA 3LX7A 5GAMh 3L1AA 2FZKB 2LT4A 5KCOA 3JCMP 4X9CA 3X26B 1KQSA 1H8KA 3VS3A 3CCRQ 5I2SA 3QZ5B 4DEXA 1D0YA 2Z0WA 3S6WA 4QW2A 2QTVA 1VYUA 1BBZA 2EBPA 2EYYA 1EX4A 1PG5B 2XDPA 4C8QF 1ZUYA 2GCXA 3EGXB 4HCZA 1YI2A 4JRQA 2K5IA 3RMQA 3J7AF 3VS4A 2JMCA 2K3BA 2VGNA 4ZN1A 2BE9B 1M5Q1 4L5GA 3REAB 1NE8A 2BKDN 2KRNA 1AWXA 3TEEA 5CO7A 5I22A 4BI3A 3OS1A 1KHIA 1KJWA 1ZSZB 4BUGA 4E7LA 3QG1A 4BACA 3GBQA 4J9GA 2O9VA 3CCJQ 1G8XA 2J6OA 4C8QB 4J9EA 1G3WA 3SWNA 2CSQA 3PFSA 1YJNT 5KYYA 3G6ET 5GJVB 4M78C 1VQLA 3I9QA 1Z9QA 4J9HA 1S72T 1VQ9A 3NPFA 1VIEA 1R0BG 1QVGP 1UB4A 2M9UA 2FHDA 1ZX6A 3M0QA 2KGTA 1VQOT 3VS2A 4GLKA 8ATCB 1WHJA 2X4YA 5CIUA 4C8QD 3GOXA 2FB7A 1QVGA 2RK1A 3SFMA 1UECA 4X9DA 2EYXA 3A8OB 3CCRA 4M77B 1N9RA 5DY9A 1EZZB 2RI5A 3QWXX 4LDXA 1WIEA 1BI2A 1ABOA 2EJ9A 2K2VA 3EH1A 2L5QA 3CXCP 5D7UA 3V8JA 1S72A 2J6KA 2NUZA 1OYXA 3EFOA 5IN1A 1VQMQ 3CCLT 6AT1B 4M7AE 2AT1B 3E19A 4ELYC 1VQNT 5LJ5f 1OULA 2D6FA 4M7AA 1W2BS 2KBTA 4O5VA 1M90R 2O2OA 4C8QC 2E6ZA 2H3JA 1RUWA 2F5KA 5GAN2 3CCUQ 4ZGDB 2HL3A 4RCCA 4BI8B 1LNXA 3OSVA 1VQ4A 4K11A 2CYZB 2JTMA 2EFIA 1M1KU 1GBQA 2YWWA 5KYXB 2E41A 2YRDA 3M4YA 2KE9A 1WNLA 3CMAQ 4FCYA 3T9NA 3NFCA 3CC2Q 4EMKB 2RQUA 2QQSA 5CR2A 1HYOA 4HCKA 3QYGB 4OMNA 3CCET 1VQ5A 4OB3B 2HDAA 4M7AF 1PSEA 2ZCFB 2ATCB 2RJCA 2LDMA 3CCST 1IREB 4J6YA 4OB1B 3DB4A 2HAXA 2DZ9A 2QQAA 1VQ4Q 1VQ6A 5LJ3d 4XTUA 1VQ8T 4Y28E 2DX1A 5FU7C 2L0AA 4E7ZA 4OP0A 2NUPA 5CKEA 4IUUA 3RIRA 5KYNA 1YJ9Q 4XTWA 3OBWA 4PFZA 1UGSB 4A4FA 2VUBA 4WF2A 2A0FB 2K3XA 3CPWA 3HTRA 5IHIA 4E7JA 3I55T 1NJIU 2Y4YA 3CCMQ 1K8AR 3JV3A 3P8HA 1YJWT 4KRTA 5GAOm 3RUXA 3CCUA 3QXEB 4M7DB 3VS5A 2AK5A 3G1JA 2DIGA 2E12A 3PE0A 3RR6A 1AZEA 2VXEA 3TSWA 2KYBA 5D6XA 3JCMe 2B8AA 4DQ2A 3EG9A 4C92F 1TH7A 2AIRB 3OYIA 4JRIA 3I5SA 4J8OA 4OMFB 3MP8A 2RHZA 2AKKA 1NEGA 2HZYA 3A8MB 1FMKA 1UUEA 2O01E 5L23A 3LGLA 1HSQA 2K79A 3MCAB 1Q7YR 4D6WA 2VXFA 3MP1A 1KFZA 1K9MC 2KSSA 1KC8C 4MZPA 4AFZC 4HVUA 1YI2T 2O4XA 4C92A 1N5ZA 2KYMA 2DYIA 2A36A 1VUBA 1C1AA 2FVUA 1BIBA 1VYTA 1WI7A 3M0SA 1FX7A 2CP0A 3MP6A 1I0CA 4C5GA 4JLIA 3PVLA 1XTDA 4DOVA 2QDYB 3WXMB 1MUZA 2XHCA 5FWBA 2RQTA 4F17A 1WHHA 5LJ5j 1UHFA 4NL3A 3UATA 3V7CA 3MPUB 4FU6A 3C94A 3CCJT 4BB7A 1R8OB 3G4ST
chains in the Genus database with same CATH topology
2FO0A 2EGEA 1M27C 1UGVA 2DL7A 1WA7A 1AWWA 4ZNXA 4Z89A 2RQWA 2DMOA 4WCIA 1QCFA 2JM9A 2DYBA 2ECZA 1OPKA 4QT7A 2K7AA 3SHWA 1WLPB 3NGPA 2JT4A 1U5SA 4LN2A 1SHGA 4JJBA 1WXTA 3EGUA 3VS7A 4F16A 1NEBA 1SEMA 4JJDA 2RMOA 1UTIA 1JU5C 3LH5A 1Z9ZA 2DF6A 4J9BA 3TVTA 3H0IA 1AD5A 1I1JA 1TUCA 1JXOA 2EYZA 1CKAA 5I11A 1W1FA 2CSIA 1IO6A 1V1CA 2K6DA 2JTEA 2KR3A 3C0CA 1UHCA 1ZUKA 3H41A 2PTKA 1AWJA 2KEAA 3NHNA 4ESRA 3M0RA 5IXFA 4IIMA 1PRMC 2KRMA 1UFFA 3VS1A 2KT1A 2DILA 2DL3A 1PKTA 2CH4A 2O31A 2VKNA 4CC3A 4AFSC 2H8HA 4Y92A 2JW4A 1X6GA 4CC2A 1S1NA 2J05A 2F2XA 2X3XD 2J6FA 1XOVA 1CSKA 4J9IA 1BK2A 1YP5A 4RTWA 1Y0MA 2YUPA 2IIMA 2PZ1A 2FEIA 4F14A 2KT8A 3H0FA 1UG1A 4AFQC 2EW3A 2D8JA 1X2KA 1K76A 2LMJA 4HVVA 1AOJA 1SPKA 3R6NA 1FYNA 1YWOA 3CQTA 2SRCA 4D8DA 2GTJA 1JQQA 2F2VA 4RTUA 2EPDA 1VA7A 4LNPA 1K0XA 2LZ6B 2DE0X 2DA9A 1M3AA 4HXJA 2OAWA 1OOTA 2CDTA 2I0NA 2YT6A 3EHRA 4AG2C 1U06A 4LUDA 3NMZC 2BTTA 1G83A 2C0IA 2E5KA 2EQIA 1ZSGA 4RTVA 1PHTA 2ED0A 3VRYA 3A98A 3EG2A 4J9FA 2DBKA 3M0PA 2A28A 1YN8A 1ZLMA 1H92A 2BZXA 5GJWB 1GCQA 4OMPA 1NLPC 2F2WA 1GFDA 1AVZC 2YUNA 4A63B 1E6HA 2RN8A 1WXBA 2DRMA 4RTZA 2DBMA 3EG1A 4X1VA 4AG1C 1UJ0A 1H8KA 1UJYA 3VS3A 4DEXA 1YCSB 4LUEA 1GL5A 1QKXA 1VYUA 1BBZA 2LNHB 2EBPA 2J7IA 2RPNA 1M3CA 2EYYA 4JJCA 2OI3A 1ZUYA 1UDLA 3EG0A 2DL4A 2C0TA 3VS4A 2JMCA 1TG0A 2K3BA 1KIKA 1GCQC 1JEGA 1GCPA 2D0NA 3REAB 2KRNA 1AWXA 1K1ZA 5I22A 1UE9A 1KJWA 2DRKA 3PVQA 4J9CA 3GBQA 4IIOA 4J9GA 2O9VA 1NLOC 2AZVA 2K9GA 2J6OA 4OMQA 4J9EA 2AZSA 2CSQA 3ULRB 5GJVB 3M0TA 2LCSA 4RUGA 1KSWA 3I9QA 3RNJA 1SRMA 1Z9QA 4J9HA 2JXBA 3NPFA 2PNIA 2K2MA 3O5ZA 2VVKA 1ZX6A 3M0QA 1T0HA 2KGTA 1X2QA 3VS2A 2B86A 2JS2A 2EYWA 2YUOA 2KXDA 2W0ZA 3UA7A 2EKHA 2LQWA 4HVWA 1OPLA 2C0OA 1E7OA 4JZ3A 2JS0A 1UECA 2CH4W 2EYXA 1GBRA 3IQLA 4JZ4A 2O9SA 1SRLA 2ENMA 3QWXX 3VS6A 1QWEA 3UA6A 1WIEA 2FRWA 1QWFA 1ABOA 1VYVA 2V1RA 4GBQA 4FSSA 3U23A 3FJ5A 2J06A 2L3QA 2KROA 3I5RA 2J6KA 2G6FX 2NUZA 2LJ3A 1YNZA 2FPEA 2GNCA 1Y57A 2YDLA 1ZBJA 1TUDA 1M30A 1SSHA 2FPDA 1SHFA 1QLYA 2L3SA 2VWFA 2L2PA 1ABQA 5ECAA 2O88A 2KXCA 2FG0A 1I07A 2ESWA 4JPBW 2XMFA 2KBTA 1K4US 2O2OA 1M3BA 1RUWA 1M8MA 1PKSA 2HEQA 1H3HA 1B3QA 2V1QA 4K11A 1AEYA 2LP5A 1GBQA 2RF0A 4ORZA 1PRLC 1RLQC 2KE9A 2BZ8A 1J3TA 1X69A 2GQIA 2RQUA 3EHQA 4HCKA 2LJ0A 4OMNA 1W70A 3ZL7C 2HDAA 1MV3A 1AZGB 2M0YA 2RQRA 4RTXA 1K0SA 1GFCA 2ROTA 2MIOA 4CC7A 1NYGA 1MV0B 5IHNA 2JM8A 2DX1A 1NYFA 2L0AA 3REBB 2BZYA 2JMAA 2D1XA 3THKA 1WYXA 2HSPA 4CC4B 4GLMA 4RTTA 2NWMA 3SEMA 2GGRA 1JO8A 1BU1A 2ABLA 4OMMA 5IHIA 1AWOA 2P4RA 2RQVA 1U3OA 1NG2A 3JV3A 4KRTA 2EGAA 1T3LA 2MOXA 3VRZA 4AFUC 1QKWA 1ZUUA 2HCKA 3VS5A 2AK5A 2CUBA 2DVJA 3PE0A 2DM1A 2GTOA 1AZEA 4Z88A 3VS0A 2ED1A 3M0UA 3TSWA 2FPFA 2A08A 2KYBA 1HD3A 1PWTA 1GRIA 2EVRA 2FRYA 3RBBB 2GBQA 2M51A 2LQNA 1OEBA 3I5SA 4OMLA 4DEYA 5IXBA 1YWPA 4M4ZA 5HCKA 1OV3A 2L3PA 4RTYA 2AKKA 1NEGA 2LX7A 4OMOA 1FMKA 1UUEA 5L23A 4E6RA 1WX6A 1A0NB 1HSQA 2K79A 1EFNA 1W6XA 2QDLA 4D8KA 1E6GA 1WXUA 1KFZA 2DLPA 1JXMA 2DJQA 4LE9A 5FWCA 2RNAA 2DL8A 3UF4A 1ARKA 1X43A 1WDXA 4AFZC 1T0JA 4HVUA 2A37A 2YUQA 1N5ZA 2MCNA 2KYMA 1RLPC 1X27A 1B07A 4Z8AA 2A36A 1K9AA 2ROLA 2CUDA 2DNUA 1LCKA 3I35A 5EC7A 1BB9A 2YSQA 2LJ1A 1VYTA 1WI7A 2W10A 3M0SA 5IH2A 3TSZA 1I0CA 1PNJA 2AKLA 1NM7A 2KRSA 3PVLA 1G2BA 2D8HA 5IHKA 1MUZA 2CREA 5FWBA 1T3SA 2OJ2A 1X6BA 5FW9A 3H0HA 1RI9A 4R0KA 2RQTA 2EGCA 2DL5A 4F17A 1WFWA 3EG3A 2CT4A 2X3WD 2HBWA 2SEMA 1UHFA 3KFVA 3UATA 3QWYA 2KNBB 4EIKA 1CKBA 4J9DA 2CT3A 1HJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FO0 A;  2EGE A;  1M27 C;  1UGV A;  2DL7 A;  1WA7 A;  1AWW A;  4ZNX A;  4Z89 A;  2RQW A;  2DMO A;  4WCI A;  1QCF A;  2JM9 A;  2DYB A;  2ECZ A;  1OPK A;  4QT7 A;  2K7A A;  3SHW A;  1WLP B;  3NGP A;  2JT4 A;  1U5S A;  4LN2 A;  1SHG A;  4JJB A;  1WXT A;  3EGU A;  3VS7 A;  4F16 A;  1NEB A;  1SEM A;  4JJD A;  2RMO A;  1UTI A;  1JU5 C;  3LH5 A;  1Z9Z A;  2DF6 A;  4J9B A;  3TVT A;  3H0I A;  1AD5 A;  1I1J A;  1TUC A;  1JXO A;  2EYZ A;  1CKA A;  5I11 A;  1W1F A;  2CSI A;  1IO6 A;  1V1C A;  2K6D A;  2JTE A;  2KR3 A;  3C0C A;  1UHC A;  1ZUK A;  3H41 A;  2PTK A;  1AWJ A;  2KEA A;  3NHN A;  4ESR A;  3M0R A;  5IXF A;  4IIM A;  1PRM C;  2KRM A;  1UFF A;  3VS1 A;  2KT1 A;  2DIL A;  2DL3 A;  1PKT A;  2CH4 A;  2O31 A;  2VKN A;  4CC3 A;  4AFS C;  2H8H A;  4Y92 A;  2JW4 A;  1X6G A;  4CC2 A;  1S1N A;  2J05 A;  2F2X A;  2X3X D;  2J6F A;  1XOV A;  1CSK A;  4J9I A;  1BK2 A;  1YP5 A;  4RTW A;  1Y0M A;  2YUP A;  2IIM A;  2PZ1 A;  2FEI A;  4F14 A;  2KT8 A;  3H0F A;  1UG1 A;  4AFQ C;  2EW3 A;  2D8J A;  1X2K A;  1K76 A;  2LMJ A;  4HVV A;  1AOJ A;  1SPK A;  3R6N A;  1FYN A;  1YWO A;  3CQT A;  2SRC A;  4D8D A;  2GTJ A;  1JQQ A;  2F2V A;  4RTU A;  2EPD A;  1VA7 A;  4LNP A;  1K0X A;  2LZ6 B;  2DE0 X;  2DA9 A;  1M3A A;  4HXJ A;  2OAW A;  1OOT A;  2CDT A;  2I0N A;  2YT6 A;  3EHR A;  4AG2 C;  1U06 A;  4LUD A;  3NMZ C;  2BTT A;  1G83 A;  2C0I A;  2E5K A;  2EQI A;  1ZSG A;  4RTV A;  1PHT A;  2ED0 A;  3VRY A;  3A98 A;  3EG2 A;  4J9F A;  2DBK A;  3M0P A;  2A28 A;  1YN8 A;  1ZLM A;  1H92 A;  2BZX A;  5GJW B;  1GCQ A;  4OMP A;  1NLP C;  2F2W A;  1GFD A;  1AVZ C;  2YUN A;  4A63 B;  1E6H A;  2RN8 A;  1WXB A;  2DRM A;  4RTZ A;  2DBM A;  3EG1 A;  4X1V A;  4AG1 C;  1UJ0 A;  1H8K A;  1UJY A;  3VS3 A;  4DEX A;  1YCS B;  4LUE A;  1GL5 A;  1QKX A;  1VYU A;  1BBZ A;  2LNH B;  2EBP A;  2J7I A;  2RPN A;  1M3C A;  2EYY A;  4JJC A;  2OI3 A;  1ZUY A;  1UDL A;  3EG0 A;  2DL4 A;  2C0T A;  3VS4 A;  2JMC A;  1TG0 A;  2K3B A;  1KIK A;  1GCQ C;  1JEG A;  1GCP A;  2D0N A;  3REA B;  2KRN A;  1AWX A;  1K1Z A;  5I22 A;  1UE9 A;  1KJW A;  2DRK A;  3PVQ A;  4J9C A;  3GBQ A;  4IIO A;  4J9G A;  2O9V A;  1NLO C;  2AZV A;  2K9G A;  2J6O A;  4OMQ A;  4J9E A;  2AZS A;  2CSQ A;  3ULR B;  5GJV B;  3M0T A;  2LCS A;  4RUG A;  1KSW A;  3I9Q A;  3RNJ A;  1SRM A;  1Z9Q A;  4J9H A;  2JXB A;  3NPF A;  2PNI A;  2K2M A;  3O5Z A;  2VVK A;  1ZX6 A;  3M0Q A;  1T0H A;  2KGT A;  1X2Q A;  3VS2 A;  2B86 A;  2JS2 A;  2EYW A;  2YUO A;  2KXD A;  2W0Z A;  3UA7 A;  2EKH A;  2LQW A;  4HVW A;  1OPL A;  2C0O A;  1E7O A;  4JZ3 A;  2JS0 A;  1UEC A;  2CH4 W;  2EYX A;  1GBR A;  3IQL A;  4JZ4 A;  2O9S A;  1SRL A;  2ENM A;  3QWX X;  3VS6 A;  1QWE A;  3UA6 A;  1WIE A;  2FRW A;  1QWF A;  1ABO A;  1VYV A;  2V1R A;  4GBQ A;  4FSS A;  3U23 A;  3FJ5 A;  2J06 A;  2L3Q A;  2KRO A;  3I5R A;  2J6K A;  2G6F X;  2NUZ A;  2LJ3 A;  1YNZ A;  2FPE A;  2GNC A;  1Y57 A;  2YDL A;  1ZBJ A;  1TUD A;  1M30 A;  1SSH A;  2FPD A;  1SHF A;  1QLY A;  2L3S A;  2VWF A;  2L2P A;  1ABQ A;  5ECA A;  2O88 A;  2KXC A;  2FG0 A;  1I07 A;  2ESW A;  4JPB W;  2XMF A;  2KBT A;  1K4U S;  2O2O A;  1M3B A;  1RUW A;  1M8M A;  1PKS A;  2HEQ A;  1H3H A;  1B3Q A;  2V1Q A;  4K11 A;  1AEY A;  2LP5 A;  1GBQ A;  2RF0 A;  4ORZ A;  1PRL C;  1RLQ C;  2KE9 A;  2BZ8 A;  1J3T A;  1X69 A;  2GQI A;  2RQU A;  3EHQ A;  4HCK A;  2LJ0 A;  4OMN A;  1W70 A;  3ZL7 C;  2HDA A;  1MV3 A;  1AZG B;  2M0Y A;  2RQR A;  4RTX A;  1K0S A;  1GFC A;  2ROT A;  2MIO A;  4CC7 A;  1NYG A;  1MV0 B;  5IHN A;  2JM8 A;  2DX1 A;  1NYF A;  2L0A A;  3REB B;  2BZY A;  2JMA A;  2D1X A;  3THK A;  1WYX A;  2HSP A;  4CC4 B;  4GLM A;  4RTT A;  2NWM A;  3SEM A;  2GGR A;  1JO8 A;  1BU1 A;  2ABL A;  4OMM A;  5IHI A;  1AWO A;  2P4R A;  2RQV A;  1U3O A;  1NG2 A;  3JV3 A;  4KRT A;  2EGA A;  1T3L A;  2MOX A;  3VRZ A;  4AFU C;  1QKW A;  1ZUU A;  2HCK A;  3VS5 A;  2AK5 A;  2CUB A;  2DVJ A;  3PE0 A;  2DM1 A;  2GTO A;  1AZE A;  4Z88 A;  3VS0 A;  2ED1 A;  3M0U A;  3TSW A;  2FPF A;  2A08 A;  2KYB A;  1HD3 A;  1PWT A;  1GRI A;  2EVR A;  2FRY A;  3RBB B;  2GBQ A;  2M51 A;  2LQN A;  1OEB A;  3I5S A;  4OML A;  4DEY A;  5IXB A;  1YWP A;  4M4Z A;  5HCK A;  1OV3 A;  2L3P A;  4RTY A;  2AKK A;  1NEG A;  2LX7 A;  4OMO A;  1FMK A;  1UUE A;  5L23 A;  4E6R A;  1WX6 A;  1A0N B;  1HSQ A;  2K79 A;  1EFN A;  1W6X A;  2QDL A;  4D8K A;  1E6G A;  1WXU A;  1KFZ A;  2DLP A;  1JXM A;  2DJQ A;  4LE9 A;  5FWC A;  2RNA A;  2DL8 A;  3UF4 A;  1ARK A;  1X43 A;  1WDX A;  4AFZ C;  1T0J A;  4HVU A;  2A37 A;  2YUQ A;  1N5Z A;  2MCN A;  2KYM A;  1RLP C;  1X27 A;  1B07 A;  4Z8A A;  2A36 A;  1K9A A;  2ROL A;  2CUD A;  2DNU A;  1LCK A;  3I35 A;  5EC7 A;  1BB9 A;  2YSQ A;  2LJ1 A;  1VYT A;  1WI7 A;  2W10 A;  3M0S A;  5IH2 A;  3TSZ A;  1I0C A;  1PNJ A;  2AKL A;  1NM7 A;  2KRS A;  3PVL A;  1G2B A;  2D8H A;  5IHK A;  1MUZ A;  2CRE A;  5FWB A;  1T3S A;  2OJ2 A;  1X6B A;  5FW9 A;  3H0H A;  1RI9 A;  4R0K A;  2RQT A;  2EGC A;  2DL5 A;  4F17 A;  1WFW A;  3EG3 A;  2CT4 A;  2X3W D;  2HBW A;  2SEM A;  1UHF A;  3KFV A;  3UAT A;  3QWY A;  2KNB B;  4EIK A;  1CKB A;  4J9D A;  2CT3 A;  1HJD A; 
#chains in the Genus database with same CATH topology
 5LJ5 e;  1UGV A;  1AWW A;  4Z89 A;  3OYJ A;  2DMO A;  4HT9 A;  2DER A;  2MWO A;  4HCB A;  4RG8 A;  5IT9 E;  2QEX A;  4LN2 A;  4FL6 A;  4F16 A;  4XU2 A;  1NEB A;  1QVP A;  4JJD A;  5HK0 A;  1PCX A;  3LH5 A;  1Z9Z A;  1RI0 A;  5GAM g;  4B6M A;  5GAN j;  2EYZ A;  1CKA A;  4KGZ B;  4C5H A;  4FT2 A;  2R5A A;  1VQP T;  4KUD K;  5GAO n;  4M75 C;  1I5O B;  1MMN A;  1VQ9 T;  1IB8 A;  5GAN d;  3ZEH A;  2L89 A;  3QYH B;  2VC8 A;  1ZSZ C;  5IXF A;  3HRS A;  1Q81 U;  1PRM C;  2ZPB B;  2KRM A;  1UFF A;  2DL3 A;  4NL2 A;  3BY7 A;  1YIJ A;  3OYL A;  4CC2 A;  2J05 A;  2X3X D;  4JUV A;  2J6F A;  1XOV A;  5I2M A;  4PJO E;  2IVW A;  5GMK i;  1VQ7 Q;  1Y96 A;  1M9S A;  1FWZ A;  1PD1 A;  3CXC A;  2DTH A;  5D6W A;  1UG1 A;  3KBG A;  4HVV A;  3OB9 A;  1RAC B;  1AOJ A;  3EGD A;  1SPK A;  2FZG B;  3F70 A;  1N8R R;  4NOY A;  2RH2 A;  4XU3 A;  3LLR A;  2SRC A;  4LDY A;  2GTJ A;  1JQQ A;  5GMK m;  3G71 T;  4RTU A;  5GAO l;  2QXF A;  3OY9 A;  5KYW A;  2EIF A;  2LZ6 B;  1QW1 A;  3ER0 A;  4HXJ A;  1OOT A;  2YT6 A;  4AG2 C;  2GQV A;  2MAM A;  2RHX A;  1M2V A;  5CKF A;  1RL2 A;  3EG2 A;  2E3I A;  3M0P A;  3JB9 J;  2MF2 A;  1ZLM A;  3G4S A;  4M7D E;  1GCQ A;  4OMP A;  4DBQ A;  4JRP A;  4PKC C;  1VQL T;  2KI7 A;  1I5L A;  2JN0 A;  4EMG A;  1GFD A;  3OMG A;  4A63 B;  1E6H A;  2BUD A;  1FMV A;  1ZBX A;  2XI9 A;  2QAS A;  2K5F A;  4KBM B;  1TWB A;  4FW1 A;  1I4K 1;  4AG1 C;  1UJ0 A;  1BKB A;  3VU3 C;  1VOM A;  1VQ6 Q;  4N0A A;  1U1S A;  1WGS A;  3OYD A;  4LUE A;  1QMC A;  2MMP A;  2BE7 D;  1GL5 A;  3A8L B;  4CI0 C;  3CBM A;  3L2V A;  5FLX E;  2CZ1 B;  2J7I A;  4BY6 B;  4LD9 K;  2DJZ A;  2F69 A;  3RMS A;  3CC7 A;  1QVF P;  2OI3 A;  4CRI A;  3A8H B;  1ACM B;  1UDL A;  1YIT T;  2C0T A;  2E1H A;  3X20 B;  1M90 U;  1P92 A;  4ZTF A;  2QQB A;  2JTF A;  3QJY A;  4KH1 B;  5GAN 3;  2ZZD A;  1YIJ Q;  3OA6 A;  1K1Z A;  1YIJ T;  5LJ3 f;  4J9C A;  3JCM Q;  4IIO A;  5GAN 5;  1KQ2 A;  1NLO C;  2AZV A;  2JJ9 A;  3J81 E;  3CD6 Q;  4JDS A;  3CCL A;  3CCS A;  3OYH A;  3HRU A;  2JXB A;  1OX9 A;  3O5Z A;  2VVK A;  5A0D A;  4XTV A;  5FRN A;  4DBH A;  2B86 A;  4M7D F;  3LW5 E;  3GNF B;  2W0Z A;  2MYS A;  2EKH A;  2LQW A;  3J80 E;  2R5M A;  3M5A A;  1OPL A;  1UGQ B;  4HVW A;  5LJ3 j;  2C0O A;  2JS0 A;  1GBR A;  3CCJ A;  2ENM A;  4OB0 B;  3UA6 A;  4QQG A;  5GAN e;  3QO3 A;  5KE2 A;  2OTJ T;  3HFO A;  4FSS A;  4GBQ A;  3FJ5 A;  2J06 A;  1N8R C;  2L3Q A;  2V8I A;  5LJ5 d;  2KRO A;  3CMA T;  4MZT A;  3E2U A;  1XNI A;  3I5R A;  3SWN C;  4PLI A;  1D0Z A;  2FPE A;  2GNC A;  4PLL A;  1Y57 A;  1C6V X;  1M30 A;  4C0F A;  2FPD A;  2VWF A;  3PMT A;  2L2P A;  4XU1 A;  4XTX A;  4E7I A;  2O88 A;  1VQ5 Q;  1M1F A;  1M4Z A;  1I07 A;  3JCM h;  2ESW A;  4JPB W;  3CME A;  2XMF A;  4MZM A;  3MJX A;  3VKI A;  4V2S A;  1D1C A;  4C0D C;  1X01 A;  3G71 A;  2LT1 A;  3S3N A;  2OTL T;  1AEY A;  3OYG A;  3I56 A;  3CCV Q;  2RF0 A;  3E1S A;  5I21 A;  1B34 A;  3CC7 Q;  1YBY A;  1ZA2 B;  4PJN A;  3EHQ A;  4J6W A;  5GAO p;  1VQ7 T;  1OZ2 A;  4EMK A;  3WVE B;  3MET A;  3CME Q;  1TUG B;  2EKO A;  4PK4 A;  5CKB A;  3TQ7 P;  3HSB A;  1TXQ A;  2K57 A;  1NYG A;  3EFO B;  3OYK A;  5IHN A;  2PQW A;  4KUI A;  3BDL A;  3REB B;  3CCQ T;  3V8L A;  2BZY A;  3TRE A;  5FRM A;  3SB2 A;  2EQK A;  4ZGJ B;  4R55 A;  4M7A B;  3CC4 A;  1WYX A;  1Q86 U;  1RAG B;  4GLM A;  2DTO A;  3PIO A;  2E3H A;  2NWM A;  3AHU A;  2QG9 B;  3OW2 S;  2WAC A;  4L6V 5;  5KYU A;  5J39 A;  4IUV A;  2PVO B;  4OGC A;  4A53 A;  4XU0 A;  1Q7Y U;  3EAE A;  4FYW B;  2EGA A;  1T3L A;  1TOV A;  4E7S A;  3G71 Q;  4BDZ A;  3VRZ A;  4AFU C;  2CUB A;  4OVA A;  2ED1 A;  2PVD B;  1PWT A;  2H3E B;  3OYF A;  3RBB B;  5HK3 A;  5HY6 A;  1IGQ A;  1LPL A;  2V8K A;  2HBP A;  4KUL A;  4PJO A;  3CC4 T;  2NYS A;  3HP9 A;  2MPX C;  4OML A;  1YWP A;  5LJ3 e;  5HCK A;  1VQO A;  1OV3 A;  2L3P A;  4RTY A;  2LX7 A;  2EAY A;  4MDX A;  3RKW A;  2V8J A;  3RER A;  3OW2 A;  1SG5 A;  2COZ A;  2LRQ A;  3HKS A;  2DJQ A;  3DLL A;  1VQ7 A;  2RNA A;  2DL8 A;  1ARK A;  1X43 A;  1WDX A;  1T0J A;  3MEU A;  1WZO A;  2YUQ A;  3HRT A;  1RAH B;  3M59 A;  2ROL A;  2CUD A;  2RJF A;  4QVZ A;  3UPU A;  3R6O A;  1YJN A;  2AHJ B;  2LJ1 A;  3C95 A;  4PJO C;  3JCM c;  1Y7X A;  1B34 B;  2BIV A;  2NUT B;  2C06 A;  4PL6 A;  4XK8 E;  5KYW B;  5GAN 8;  4BE2 A;  1NJI R;  1QVF S;  3O8V A;  1WJQ A;  1M1K C;  2KRS A;  2QA4 A;  2D8H A;  5IHK A;  2DD5 A;  4BI4 A;  3INZ A;  3OSS C;  4F04 B;  3QDF A;  2P0K A;  5FW9 A;  3OYM A;  2LCL A;  2DL5 A;  1WFW A;  2CT4 A;  2HBW A;  2SEM A;  3HL8 A;  3KFV A;  4C8Q A;  3QWY A;  3CC2 T;  4EIK A;  2XDB A;  1CKB A;  2CT3 A;  1HJD A;  2FO0 A;  1M27 C;  2KK4 A;  3WVD B;  5CAI A;  3I56 T;  2LX9 A;  2RQW A;  2P84 A;  2JUF A;  2YXY A;  1QCF A;  3URG A;  4QT7 A;  2K7A A;  3JB9 F;  3A1P A;  1VQK T;  3C4S A;  1SHG A;  3N5B B;  3BDU A;  3VS7 A;  4M75 G;  1SEM A;  4FIB A;  1X75 C;  1IHW A;  1JU5 C;  2DF6 A;  3I55 Q;  3CBP A;  3H0I A;  1JXO A;  1OX8 A;  3CXC S;  3VYG A;  1VQ6 T;  2CSI A;  2DEQ A;  2DTI A;  1ZHI A;  1Y71 A;  4NS5 A;  1YJ9 T;  4EMH A;  1UHC A;  2PTK A;  2Y4X A;  4YTL A;  3EG9 B;  2KEA A;  3NHN A;  3LGF A;  3UWN A;  3X25 B;  4E47 A;  2FYK A;  4ESR A;  3CC4 Q;  3GP8 A;  3OS0 A;  4OB2 B;  3VS1 A;  1SF9 A;  4M7D C;  3BFM A;  2QA4 Q;  2O31 A;  1G3T A;  1VQM T;  1D3B A;  3OW2 P;  2VKN A;  1YIT A;  1S1N A;  4J83 A;  1MND A;  4J9I A;  4FW2 A;  3V7S A;  1YP5 A;  2YLB A;  4RTW A;  1Y0M A;  2EYQ A;  3A5Z B;  4M77 E;  3X28 B;  4F7U F;  1U8R A;  4LDV A;  4BY6 C;  1K76 A;  3JCM V;  4C0Z A;  1YI2 Q;  3M9Q A;  1YWO A;  5AT1 B;  4D8D A;  3JB9 H;  5GAN g;  1WPY A;  2EPD A;  4LNP A;  3S3M A;  4UC4 A;  1YJW Q;  2XDD A;  1K0X A;  2DE0 X;  1PSF A;  2ZAE A;  2OAW A;  4PJL A;  2I0N A;  4IUQ A;  1YHQ Q;  2E5K A;  1ZSG A;  3H9N A;  4XTY A;  1PHT A;  3VRY A;  4N4I A;  3CC7 T;  3A98 A;  1VQK A;  5GAN 7;  4XQ3 A;  2DBK A;  2A28 A;  1YN8 A;  4FSX A;  2CP2 A;  2YLC A;  1RAD B;  1H92 A;  2BZX A;  3BW1 A;  1Q81 C;  4Z02 A;  1FXX A;  1NLP C;  4M78 A;  1JBM A;  5L8R E;  2YUN A;  2ZGW A;  4F7U G;  4PJO D;  5GMK h;  1YJW A;  1W2B P;  3G7Z A;  3EG1 A;  4C8Q G;  4JS4 A;  1UJY A;  2CP6 A;  4JLG A;  3JCM J;  3V7R A;  1YCS B;  2WSF E;  1I8F A;  4KT0 E;  3M4G A;  5J3B A;  4QKU A;  4R56 A;  5GAO r;  2LNH B;  1WHG A;  4EMK C;  2RPN A;  2CZ0 B;  3LWI A;  4C0G A;  1S72 Q;  3FJP A;  2K3Y A;  3EGD B;  1O75 A;  4LDU A;  1KD1 C;  2X4X A;  2DL4 A;  1IXD A;  4M75 E;  1Q81 R;  1TG0 A;  1KIK A;  3QZ9 B;  2WSC E;  3VUZ A;  1JEG A;  5M9O A;  3V8K A;  2D0N A;  2M1H A;  2E4H A;  4A4G A;  1G3S A;  2HSE B;  5LL6 S;  1D1A A;  4DBF A;  4J5Y A;  3H8Z A;  2COY A;  3PVQ A;  1KD1 R;  2CGH A;  1VQN A;  2L3R A;  2QK0 A;  4OMQ A;  2VV5 A;  2AZS A;  4WTO B;  3ULR B;  2QGG A;  2YRC A;  4RUG A;  1KSW A;  5AYF A;  2GF7 A;  1SRM A;  5GAO q;  3RKY A;  2PNI A;  1M8V A;  1RAE B;  3OS5 A;  1RAB B;  3PGG A;  1T0H A;  3GPL A;  1HXD A;  2JS2 A;  1KQS P;  2EYW A;  2DEU A;  3TU4 K;  1LOJ A;  2YUO A;  2DVE A;  2QI2 A;  3CCM A;  2V26 A;  1E7O A;  4JZ3 A;  3D7S B;  3IQL A;  3QSU A;  1OU9 A;  2WSE E;  4JZ4 A;  1SRL A;  2X9H A;  3VS6 A;  2QGF B;  3CCL Q;  1MMA A;  1QWF A;  4LXC A;  2DK3 A;  3RKX A;  3CCU T;  3MEW A;  1Q82 R;  2DFU A;  2PVG B;  3DLM A;  1OZ3 A;  5KYU B;  3M53 A;  2G6F X;  2LJ3 A;  3M54 A;  1NZ9 A;  1UGR B;  2YDL A;  1ZBJ A;  1TUD A;  1SSH A;  2L3S A;  1QLY A;  2K4Y A;  4M77 D;  3SWN B;  3VV0 A;  1ABQ A;  3CCE A;  2KXC A;  2FG0 A;  5LJ3 g;  3QJ6 A;  4HT8 A;  1R77 A;  3OQ5 A;  2PUK B;  3MHX A;  1M8M A;  2YHT A;  2HEQ A;  1H3H A;  1B3Q A;  2V1Q A;  4M78 B;  4IUP A;  4PNO A;  3MEV A;  4ORZ A;  1VQL Q;  1PRL C;  2HKN A;  4M7A D;  1RLQ C;  1VQ9 Q;  2RJE A;  3DB3 A;  2X4J A;  3LWH A;  2BZ8 A;  1J3T A;  2P0Q A;  4HA8 A;  3JCM X;  1VQM A;  1M2O A;  3P8D A;  4A4E A;  1K8A C;  3P8B B;  2COW A;  3KUF A;  1ZQ1 A;  5LJ5 g;  1K0S A;  5CKH A;  2G3R A;  3GIB A;  4GY5 A;  4QQD A;  4FM4 B;  4HCC A;  1QCO A;  1MV0 B;  2CZ6 B;  3CCV T;  4B9W A;  2HKQ B;  2JM8 A;  4PJM A;  1NYF A;  1U1T A;  4DOW A;  5KYY B;  2JMA A;  2D1X A;  2KDS A;  4XAX B;  3QHS A;  1DJ7 B;  2DAQ A;  3CCE Q;  1BU1 A;  2D9T A;  4TVR A;  1K73 C;  2XIC A;  2P4R A;  4MDW A;  2RQV A;  1K9M R;  1XQH A;  2MOX A;  3GNG A;  1ZUU A;  2HCK A;  1TSF A;  2IPO B;  2EQU A;  2DVJ A;  1X6O A;  3VS0 A;  3QKJ A;  2FPF A;  3CCR T;  2A08 A;  1HD3 A;  1GRI A;  2FRY A;  4BE1 A;  5GMK e;  1QP2 A;  2E6N A;  5CQX A;  2GBQ A;  1FMW A;  3JB9 G;  4C92 G;  2OAU A;  2LQN A;  3JRZ A;  3CC2 A;  2RI2 A;  3OYA A;  3DKM A;  2FL7 A;  3JCM g;  1IZ6 A;  4LD6 A;  2E10 A;  5IXB A;  2MWP A;  2XK0 A;  1N8R U;  1R0C B;  2K5L A;  1WX6 A;  3L2W A;  4BD3 A;  1EFN A;  2QAZ A;  1W6X A;  4C8Q E;  2QDL A;  4O6J A;  1E6G A;  1WXU A;  1TU0 B;  4P5N A;  3M57 A;  5FWC A;  1G3Y A;  2CP7 A;  1VQ4 T;  3NTK A;  3CBO A;  1PM3 A;  5GAN 6;  1RLP C;  1X27 A;  1B07 A;  1K9A A;  4M7D D;  1LCK A;  3I35 A;  1VQ5 T;  1BB9 A;  1JRI A;  2YSQ A;  1YJ9 A;  8AT1 B;  4QQ6 A;  5IH2 A;  2JNG A;  2AKL A;  1N9S A;  5GAM f;  1G2B A;  4II1 A;  1KD1 U;  2QTX A;  3OMC A;  1T3S A;  1KC8 U;  3OYE A;  4C0D B;  3CME T;  1M1K R;  2OJ2 A;  4RCB A;  2EGC A;  3CCQ Q;  3EG3 A;  1W4S A;  1EIF A;  2DIQ A;  4PJJ A;  4M77 A;  4J9D A;  1QVG S;  1Q95 G;  2EGE A;  3L2Q A;  2DL7 A;  2ZPF B;  2OTJ A;  5CVI A;  4ZN3 A;  3OYN A;  3X24 B;  2VAS A;  5GMK l;  2JM9 A;  2DYB A;  2ECZ A;  1OPK A;  1OQK A;  2DET A;  3SHW A;  1WLP B;  1U5S A;  2GFU A;  4EDU A;  4JJB A;  1D09 B;  4J7F A;  3PNW C;  3EGU A;  1KQS S;  2RMO A;  4FYX B;  4J9B A;  3TVT A;  3L2U A;  4DA4 A;  1AD5 A;  1TUC A;  2P0P A;  5I11 A;  3G6E A;  1W1F A;  1IO6 A;  2K6D A;  3VJP A;  2JTE A;  2XKO C;  2VGM A;  2KR3 A;  3C0C A;  1RAI B;  3JB9 D;  1VQK Q;  4KH0 B;  5CQY A;  1AWJ A;  2OTJ Q;  3MKD A;  4HKE A;  5GAN f;  1NBE B;  2QQ9 A;  2HQH A;  2KT1 A;  3VUB A;  3L2R A;  5A0G A;  2CKK A;  1WJS A;  5C6S A;  2CH4 A;  1BCM A;  2I2L A;  5FU6 B;  4CC3 A;  2OX7 A;  4AFS C;  2JW4 A;  1X6G A;  2MI6 A;  1VQP Q;  1KK7 A;  1RAA B;  1Y96 B;  1M2V B;  1WQW A;  1CSK A;  1YHQ T;  1BK2 A;  3G6E Q;  1MNE A;  1C0M A;  2YUP A;  4MMK A;  4F7U A;  2PZ1 A;  2DD4 A;  3JCM W;  5GMK j;  3JB9 I;  2KT8 A;  4ZGE B;  1PC0 A;  2D8J A;  4M78 G;  1X2K A;  2RJD A;  3QII A;  5GAM d;  2GFA A;  2DKG A;  3ASK A;  2RO0 A;  3G4S Q;  4VUB A;  1FYN A;  2XID A;  3ZFJ A;  1BYM A;  2E64 A;  5C0M A;  2F2V A;  1VA7 A;  1VQP A;  1N27 A;  2DA9 A;  1BCO A;  3JCM f;  4ME7 A;  1M3A A;  3TCJ A;  2R58 A;  2YRV A;  3RDV A;  4PFP A;  1AHJ B;  4F7U B;  3EHR A;  4LUD A;  2DO3 A;  3QDR B;  4RTV A;  3H6Z A;  3CD6 T;  4M75 F;  4J9F A;  1O9S A;  1BIA A;  5GJW B;  2LQK A;  2F2W A;  1UGP B;  2HD0 A;  1AVZ C;  4N0A C;  1WXB A;  2DRM A;  7AT1 B;  4FYY B;  1YIT Q;  4N4H A;  2DBM A;  3AT1 B;  4N4G A;  4X1V A;  1H3Z A;  4Q5W A;  4M77 G;  4M78 D;  1K73 U;  2PUO B;  1ZSZ A;  2EJF A;  2DXT A;  2EWN A;  2LTO A;  1MMG A;  1QKX A;  2O4X B;  2DPP B;  4A4H A;  2ZPH B;  5IAY A;  5GAM e;  1M3C A;  1IGU A;  4JJC A;  4KGV B;  1OI1 A;  1KQ1 A;  3EG0 A;  3CPW S;  1QP3 A;  1TTH B;  2OTL A;  2RHI A;  1GCQ C;  1MHN A;  1GCP A;  4JS5 A;  4MML A;  3RES A;  1V29 B;  2RI3 A;  3OS2 A;  1UE9 A;  3CPF A;  3NTH A;  2DRK A;  2QEX T;  4PJO F;  2NLU A;  1MGQ A;  2K9G A;  4AT1 B;  5DLO A;  1BI0 A;  3EGX A;  2KVQ G;  3M0T A;  3OYC A;  5FU6 C;  2LCS A;  2VB6 A;  3RNJ A;  3CMA A;  2K2M A;  4J7I A;  3ME9 A;  4FT4 A;  1X2Q A;  2KXD A;  1NPP A;  3UA7 A;  2RHU A;  4F7U E;  1G5V A;  2RHY A;  2CH4 W;  2HQE A;  5GAN 4;  1VIF A;  5A2Q E;  2O9S A;  4ELZ C;  1M1G A;  1QWE A;  2FRW A;  2PU9 B;  2A3L A;  4RMO A;  2E65 A;  1VYV A;  2V1R A;  3M58 A;  3U23 A;  3CCV A;  1KG1 A;  3SDZ A;  2LCC A;  2X4W A;  4BDY A;  1H64 1;  1YNZ A;  1Q82 U;  1K9M U;  3PT9 A;  4E7K A;  1IRX A;  4ANJ A;  2EQM A;  1SHF A;  5ECA A;  3CEY A;  2XU8 A;  2F5T X;  1KHC A;  1NJI C;  2LC4 A;  4PJO B;  3GF5 A;  2ZPG B;  5KCH A;  1K4U S;  1M3B A;  2QYZ A;  4M7D G;  3CPW P;  1IHV A;  3UDC A;  1PKS A;  1VQ8 A;  5A0L A;  3C12 A;  1JJ2 S;  4M77 C;  2X51 A;  1W2B A;  1YHQ A;  2LP5 A;  3VYH B;  4JJN K;  1X69 A;  2GQI A;  2R57 A;  4A54 A;  1LVK A;  1WHL A;  5J26 A;  3OBY A;  2LJ0 A;  1W70 A;  2P4T A;  3ZL7 C;  1Q86 C;  1MV3 A;  1AZG B;  2M0Y A;  2RQR A;  3E9F A;  4RTX A;  4E2F B;  5CKD A;  2QEX Q;  4ZTJ A;  1GXI E;  3PTA A;  4L59 A;  1GFC A;  1I81 A;  2ROT A;  3JSC A;  2RK2 A;  5KYX A;  2MIO A;  4CC7 A;  4C92 D;  1N6A A;  1Q7Y C;  3E9G A;  3LYI A;  4DBR A;  2JOY A;  4XTZ A;  3THK A;  2HSP A;  4CC4 B;  3JAM E;  2M0O A;  4RTT A;  3JCM b;  2HNI A;  3SEM A;  2GGR A;  1JO8 A;  4QVC A;  1OU8 A;  3S3O A;  4C92 B;  2ABL A;  4OMM A;  4C92 E;  2XG8 D;  4ATO A;  1AWO A;  1U3O A;  1NG2 A;  3FDR A;  2RM4 A;  3OYY A;  1QKW A;  4C92 C;  1WHK A;  1VQ8 Q;  1HK9 A;  2KAF A;  2DM1 A;  2GTO A;  2CP3 A;  2LVM A;  3HFN A;  4IUR A;  4M75 B;  4Z88 A;  2QA4 T;  3M0U A;  3QBY A;  3FRN A;  2EVR A;  4IKF A;  4OGE A;  5FRO A;  5KE3 A;  3CCS Q;  3SD4 A;  2KMT A;  2M51 A;  4RG2 A;  1V76 A;  2NUT A;  9ATC B;  1OEB A;  1JJ2 A;  3KXT A;  2X35 A;  4DEY A;  4M4Z A;  1Y07 A;  1XJW B;  4M75 D;  1WQ7 A;  4OMO A;  1KC8 R;  3CCM T;  4E6R A;  1A0N B;  3MEA A;  4D8K A;  4M7D A;  2DZC A;  2DXB A;  2ZPE B;  2JZ2 A;  2IG0 A;  2DLP A;  1JXM A;  4LE9 A;  4J6X A;  3UF4 A;  3PMI A;  3PIP A;  3UT1 A;  3I56 Q;  4M78 F;  2D0Q B;  2A37 A;  2MCN A;  4Z8A A;  1WJR A;  3EH2 A;  4Y91 A;  2DNU A;  4A4K A;  5EC7 A;  2W10 A;  5EG2 A;  2A7Y A;  3FB9 A;  5HKC A;  2HL5 C;  4LDW A;  3TSZ A;  1PNJ A;  2NUP B;  1NM7 A;  2RD1 A;  2CRE A;  1X6B A;  3H0H A;  1RI9 A;  2HQX A;  3JCM d;  5GAN h;  4M75 A;  4R0K A;  1D1B A;  1MMD A;  1ZA1 B;  2X3W D;  4E7H A;  1K8A U;  5GAM j;  1K73 R;  1PD0 A;  2E70 A;  2M02 A;  1JJ2 P;  4M77 F;  2KNB B;  2QQR A;  4KGX B;  5CCA A;  3BE3 A;  1WA7 A;  4RKU E;  4ZNX A;  2CZ7 B;  1WHM A;  2ZPI B;  4WCI A;  5LJ3 h;  1AT1 B;  3M56 A;  1D3B B;  1SSF A;  3NGP A;  2JT4 A;  4C5I A;  1WXT A;  2KQW A;  5DLQ E;  4M7A C;  3QPH A;  1UTI A;  2E5Q A;  1VQN Q;  4AMC A;  1QVF A;  3FC3 A;  1I1J A;  4QVD A;  5DM7 R;  2RA2 A;  4PFO A;  4B9X A;  1V1C A;  1Q86 R;  2HMA A;  3MO8 A;  1ZUK A;  2M16 A;  3H41 A;  1F1B B;  1TS9 A;  2LNV A;  3M55 A;  2LQ8 A;  1D0X A;  2JVV A;  3M0R A;  2DXU A;  1UEB A;  4IIM A;  3FEO A;  3HPW A;  3FIF A;  5LJ5 h;  2DIL A;  4EPC A;  2EJG A;  1PKT A;  2KY9 A;  2DXC A;  1Q82 C;  1B7T A;  2H8H A;  4Y92 A;  4IUT A;  3L42 A;  2F2X A;  2Y90 A;  2CS7 A;  3EFS A;  5FU7 B;  1SKU B;  2IIM A;  2FEI A;  3GLX A;  4F14 A;  4M7A G;  3H0F A;  4M78 E;  4AFQ C;  3ZBD A;  2EW3 A;  2FZC B;  1BI3 A;  5CK9 A;  1QCN A;  2LMJ A;  3HHT B;  1YCY A;  3EFR A;  1YJN Q;  2XD0 A;  5KH6 A;  4BE0 A;  3R6N A;  1JB0 E;  5D6Y A;  2F1L A;  3CQT A;  4PJO G;  1M90 C;  2VYT A;  1VQO Q;  3Q1J A;  4C5E A;  4X34 A;  3NTI A;  1NPR A;  2RB6 A;  1YFN A;  1LJO A;  3I55 A;  2CDT A;  3CCQ A;  1RAF B;  4FYV B;  1U06 A;  3NMZ C;  2BTT A;  2CP5 A;  1G83 A;  2C0I A;  2EQI A;  3CD6 A;  3FLG A;  2ED0 A;  2EQJ A;  1QQJ A;  4OF1 A;  4JRK A;  3L2Z A;  3A8G B;  3QUI A;  1BI1 A;  2L8D A;  2OTL Q;  2RN8 A;  3OYB A;  3LH0 A;  2MK5 A;  4RTZ A;  3LX7 A;  5GAM h;  3L1A A;  2FZK B;  2LT4 A;  5KCO A;  3JCM P;  4X9C A;  3X26 B;  1KQS A;  1H8K A;  3VS3 A;  3CCR Q;  5I2S A;  3QZ5 B;  4DEX A;  1D0Y A;  2Z0W A;  3S6W A;  4QW2 A;  2QTV A;  1VYU A;  1BBZ A;  2EBP A;  2EYY A;  1EX4 A;  1PG5 B;  2XDP A;  4C8Q F;  1ZUY A;  2GCX A;  3EGX B;  4HCZ A;  1YI2 A;  4JRQ A;  2K5I A;  3RMQ A;  3J7A F;  3VS4 A;  2JMC A;  2K3B A;  2VGN A;  4ZN1 A;  2BE9 B;  1M5Q 1;  4L5G A;  3REA B;  1NE8 A;  2BKD N;  2KRN A;  1AWX A;  3TEE A;  5CO7 A;  5I22 A;  4BI3 A;  3OS1 A;  1KHI A;  1KJW A;  1ZSZ B;  4BUG A;  4E7L A;  3QG1 A;  4BAC A;  3GBQ A;  4J9G A;  2O9V A;  3CCJ Q;  1G8X A;  2J6O A;  4C8Q B;  4J9E A;  1G3W A;  3SWN A;  2CSQ A;  3PFS A;  1YJN T;  5KYY A;  3G6E T;  5GJV B;  4M78 C;  1VQL A;  3I9Q A;  1Z9Q A;  4J9H A;  1S72 T;  1VQ9 A;  3NPF A;  1VIE A;  1R0B G;  1QVG P;  1UB4 A;  2M9U A;  2FHD A;  1ZX6 A;  3M0Q A;  2KGT A;  1VQO T;  3VS2 A;  4GLK A;  8ATC B;  1WHJ A;  2X4Y A;  5CIU A;  4C8Q D;  3GOX A;  2FB7 A;  1QVG A;  2RK1 A;  3SFM A;  1UEC A;  4X9D A;  2EYX A;  3A8O B;  3CCR A;  4M77 B;  1N9R A;  5DY9 A;  1EZZ B;  2RI5 A;  3QWX X;  4LDX A;  1WIE A;  1BI2 A;  1ABO A;  2EJ9 A;  2K2V A;  3EH1 A;  2L5Q A;  3CXC P;  5D7U A;  3V8J A;  1S72 A;  2J6K A;  2NUZ A;  1OYX A;  3EFO A;  5IN1 A;  1VQM Q;  3CCL T;  6AT1 B;  4M7A E;  2AT1 B;  3E19 A;  4ELY C;  1VQN T;  5LJ5 f;  1OUL A;  2D6F A;  4M7A A;  1W2B S;  2KBT A;  4O5V A;  1M90 R;  2O2O A;  4C8Q C;  2E6Z A;  2H3J A;  1RUW A;  2F5K A;  5GAN 2;  3CCU Q;  4ZGD B;  2HL3 A;  4RCC A;  4BI8 B;  1LNX A;  3OSV A;  1VQ4 A;  4K11 A;  2CYZ B;  2JTM A;  2EFI A;  1M1K U;  1GBQ A;  2YWW A;  5KYX B;  2E41 A;  2YRD A;  3M4Y A;  2KE9 A;  1WNL A;  3CMA Q;  4FCY A;  3T9N A;  3NFC A;  3CC2 Q;  4EMK B;  2RQU A;  2QQS A;  5CR2 A;  1HYO A;  4HCK A;  3QYG B;  4OMN A;  3CCE T;  1VQ5 A;  4OB3 B;  2HDA A;  4M7A F;  1PSE A;  2ZCF B;  2ATC B;  2RJC A;  2LDM A;  3CCS T;  1IRE B;  4J6Y A;  4OB1 B;  3DB4 A;  2HAX A;  2DZ9 A;  2QQA A;  1VQ4 Q;  1VQ6 A;  5LJ3 d;  4XTU A;  1VQ8 T;  4Y28 E;  2DX1 A;  5FU7 C;  2L0A A;  4E7Z A;  4OP0 A;  2NUP A;  5CKE A;  4IUU A;  3RIR A;  5KYN A;  1YJ9 Q;  4XTW A;  3OBW A;  4PFZ A;  1UGS B;  4A4F A;  2VUB A;  4WF2 A;  2A0F B;  2K3X A;  3CPW A;  3HTR A;  5IHI A;  4E7J A;  3I55 T;  1NJI U;  2Y4Y A;  3CCM Q;  1K8A R;  3JV3 A;  3P8H A;  1YJW T;  4KRT A;  5GAO m;  3RUX A;  3CCU A;  3QXE B;  4M7D B;  3VS5 A;  2AK5 A;  3G1J A;  2DIG A;  2E12 A;  3PE0 A;  3RR6 A;  1AZE A;  2VXE A;  3TSW A;  2KYB A;  5D6X A;  3JCM e;  2B8A A;  4DQ2 A;  3EG9 A;  4C92 F;  1TH7 A;  2AIR B;  3OYI A;  4JRI A;  3I5S A;  4J8O A;  4OMF B;  3MP8 A;  2RHZ A;  2AKK A;  1NEG A;  2HZY A;  3A8M B;  1FMK A;  1UUE A;  2O01 E;  5L23 A;  3LGL A;  1HSQ A;  2K79 A;  3MCA B;  1Q7Y R;  4D6W A;  2VXF A;  3MP1 A;  1KFZ A;  1K9M C;  2KSS A;  1KC8 C;  4MZP A;  4AFZ C;  4HVU A;  1YI2 T;  2O4X A;  4C92 A;  1N5Z A;  2KYM A;  2DYI A;  2A36 A;  1VUB A;  1C1A A;  2FVU A;  1BIB A;  1VYT A;  1WI7 A;  3M0S A;  1FX7 A;  2CP0 A;  3MP6 A;  1I0C A;  4C5G A;  4JLI A;  3PVL A;  1XTD A;  4DOV A;  2QDY B;  3WXM B;  1MUZ A;  2XHC A;  5FWB A;  2RQT A;  4F17 A;  1WHH A;  5LJ5 j;  1UHF A;  4NL3 A;  3UAT A;  3V7C A;  3MPU B;  4FU6 A;  3C94 A;  3CCJ T;  4BB7 A;  1R8O B;  3G4S T; 
#chains in the Genus database with same CATH homology
 2FO0 A;  2EGE A;  1M27 C;  1UGV A;  2DL7 A;  1WA7 A;  1AWW A;  4ZNX A;  4Z89 A;  2RQW A;  2DMO A;  4WCI A;  1QCF A;  2JM9 A;  2DYB A;  2ECZ A;  1OPK A;  4QT7 A;  2K7A A;  3SHW A;  1WLP B;  3NGP A;  2JT4 A;  1U5S A;  4LN2 A;  1SHG A;  4JJB A;  1WXT A;  3EGU A;  3VS7 A;  4F16 A;  1NEB A;  1SEM A;  4JJD A;  2RMO A;  1UTI A;  1JU5 C;  3LH5 A;  1Z9Z A;  2DF6 A;  4J9B A;  3TVT A;  3H0I A;  1AD5 A;  1I1J A;  1TUC A;  1JXO A;  2EYZ A;  1CKA A;  5I11 A;  1W1F A;  2CSI A;  1IO6 A;  1V1C A;  2K6D A;  2JTE A;  2KR3 A;  3C0C A;  1UHC A;  1ZUK A;  3H41 A;  2PTK A;  1AWJ A;  2KEA A;  3NHN A;  4ESR A;  3M0R A;  5IXF A;  4IIM A;  1PRM C;  2KRM A;  1UFF A;  3VS1 A;  2KT1 A;  2DIL A;  2DL3 A;  1PKT A;  2CH4 A;  2O31 A;  2VKN A;  4CC3 A;  4AFS C;  2H8H A;  4Y92 A;  2JW4 A;  1X6G A;  4CC2 A;  1S1N A;  2J05 A;  2F2X A;  2X3X D;  2J6F A;  1XOV A;  1CSK A;  4J9I A;  1BK2 A;  1YP5 A;  4RTW A;  1Y0M A;  2YUP A;  2IIM A;  2PZ1 A;  2FEI A;  4F14 A;  2KT8 A;  3H0F A;  1UG1 A;  4AFQ C;  2EW3 A;  2D8J A;  1X2K A;  1K76 A;  2LMJ A;  4HVV A;  1AOJ A;  1SPK A;  3R6N A;  1FYN A;  1YWO A;  3CQT A;  2SRC A;  4D8D A;  2GTJ A;  1JQQ A;  2F2V A;  4RTU A;  2EPD A;  1VA7 A;  4LNP A;  1K0X A;  2LZ6 B;  2DE0 X;  2DA9 A;  1M3A A;  4HXJ A;  2OAW A;  1OOT A;  2CDT A;  2I0N A;  2YT6 A;  3EHR A;  4AG2 C;  1U06 A;  4LUD A;  3NMZ C;  2BTT A;  1G83 A;  2C0I A;  2E5K A;  2EQI A;  1ZSG A;  4RTV A;  1PHT A;  2ED0 A;  3VRY A;  3A98 A;  3EG2 A;  4J9F A;  2DBK A;  3M0P A;  2A28 A;  1YN8 A;  1ZLM A;  1H92 A;  2BZX A;  5GJW B;  1GCQ A;  4OMP A;  1NLP C;  2F2W A;  1GFD A;  1AVZ C;  2YUN A;  4A63 B;  1E6H A;  2RN8 A;  1WXB A;  2DRM A;  4RTZ A;  2DBM A;  3EG1 A;  4X1V A;  4AG1 C;  1UJ0 A;  1H8K A;  1UJY A;  3VS3 A;  4DEX A;  1YCS B;  4LUE A;  1GL5 A;  1QKX A;  1VYU A;  1BBZ A;  2LNH B;  2EBP A;  2J7I A;  2RPN A;  1M3C A;  2EYY A;  4JJC A;  2OI3 A;  1ZUY A;  1UDL A;  3EG0 A;  2DL4 A;  2C0T A;  3VS4 A;  2JMC A;  1TG0 A;  2K3B A;  1KIK A;  1GCQ C;  1JEG A;  1GCP A;  2D0N A;  3REA B;  2KRN A;  1AWX A;  1K1Z A;  5I22 A;  1UE9 A;  1KJW A;  2DRK A;  3PVQ A;  4J9C A;  3GBQ A;  4IIO A;  4J9G A;  2O9V A;  1NLO C;  2AZV A;  2K9G A;  2J6O A;  4OMQ A;  4J9E A;  2AZS A;  2CSQ A;  3ULR B;  5GJV B;  3M0T A;  2LCS A;  4RUG A;  1KSW A;  3I9Q A;  3RNJ A;  1SRM A;  1Z9Q A;  4J9H A;  2JXB A;  3NPF A;  2PNI A;  2K2M A;  3O5Z A;  2VVK A;  1ZX6 A;  3M0Q A;  1T0H A;  2KGT A;  1X2Q A;  3VS2 A;  2B86 A;  2JS2 A;  2EYW A;  2YUO A;  2KXD A;  2W0Z A;  3UA7 A;  2EKH A;  2LQW A;  4HVW A;  1OPL A;  2C0O A;  1E7O A;  4JZ3 A;  2JS0 A;  1UEC A;  2CH4 W;  2EYX A;  1GBR A;  3IQL A;  4JZ4 A;  2O9S A;  1SRL A;  2ENM A;  3QWX X;  3VS6 A;  1QWE A;  3UA6 A;  1WIE A;  2FRW A;  1QWF A;  1ABO A;  1VYV A;  2V1R A;  4GBQ A;  4FSS A;  3U23 A;  3FJ5 A;  2J06 A;  2L3Q A;  2KRO A;  3I5R A;  2J6K A;  2G6F X;  2NUZ A;  2LJ3 A;  1YNZ A;  2FPE A;  2GNC A;  1Y57 A;  2YDL A;  1ZBJ A;  1TUD A;  1M30 A;  1SSH A;  2FPD A;  1SHF A;  1QLY A;  2L3S A;  2VWF A;  2L2P A;  1ABQ A;  5ECA A;  2O88 A;  2KXC A;  2FG0 A;  1I07 A;  2ESW A;  4JPB W;  2XMF A;  2KBT A;  1K4U S;  2O2O A;  1M3B A;  1RUW A;  1M8M A;  1PKS A;  2HEQ A;  1H3H A;  1B3Q A;  2V1Q A;  4K11 A;  1AEY A;  2LP5 A;  1GBQ A;  2RF0 A;  4ORZ A;  1PRL C;  1RLQ C;  2KE9 A;  2BZ8 A;  1J3T A;  1X69 A;  2GQI A;  2RQU A;  3EHQ A;  4HCK A;  2LJ0 A;  4OMN A;  1W70 A;  3ZL7 C;  2HDA A;  1MV3 A;  1AZG B;  2M0Y A;  2RQR A;  4RTX A;  1K0S A;  1GFC A;  2ROT A;  2MIO A;  4CC7 A;  1NYG A;  1MV0 B;  5IHN A;  2JM8 A;  2DX1 A;  1NYF A;  2L0A A;  3REB B;  2BZY A;  2JMA A;  2D1X A;  3THK A;  1WYX A;  2HSP A;  4CC4 B;  4GLM A;  4RTT A;  2NWM A;  3SEM A;  2GGR A;  1JO8 A;  1BU1 A;  2ABL A;  4OMM A;  5IHI A;  1AWO A;  2P4R A;  2RQV A;  1U3O A;  1NG2 A;  3JV3 A;  4KRT A;  2EGA A;  1T3L A;  2MOX A;  3VRZ A;  4AFU C;  1QKW A;  1ZUU A;  2HCK A;  3VS5 A;  2AK5 A;  2CUB A;  2DVJ A;  3PE0 A;  2DM1 A;  2GTO A;  1AZE A;  4Z88 A;  3VS0 A;  2ED1 A;  3M0U A;  3TSW A;  2FPF A;  2A08 A;  2KYB A;  1HD3 A;  1PWT A;  1GRI A;  2EVR A;  2FRY A;  3RBB B;  2GBQ A;  2M51 A;  2LQN A;  1OEB A;  3I5S A;  4OML A;  4DEY A;  5IXB A;  1YWP A;  4M4Z A;  5HCK A;  1OV3 A;  2L3P A;  4RTY A;  2AKK A;  1NEG A;  2LX7 A;  4OMO A;  1FMK A;  1UUE A;  5L23 A;  4E6R A;  1WX6 A;  1A0N B;  1HSQ A;  2K79 A;  1EFN A;  1W6X A;  2QDL A;  4D8K A;  1E6G A;  1WXU A;  1KFZ A;  2DLP A;  1JXM A;  2DJQ A;  4LE9 A;  5FWC A;  2RNA A;  2DL8 A;  3UF4 A;  1ARK A;  1X43 A;  1WDX A;  4AFZ C;  1T0J A;  4HVU A;  2A37 A;  2YUQ A;  1N5Z A;  2MCN A;  2KYM A;  1RLP C;  1X27 A;  1B07 A;  4Z8A A;  2A36 A;  1K9A A;  2ROL A;  2CUD A;  2DNU A;  1LCK A;  3I35 A;  5EC7 A;  1BB9 A;  2YSQ A;  2LJ1 A;  1VYT A;  1WI7 A;  2W10 A;  3M0S A;  5IH2 A;  3TSZ A;  1I0C A;  1PNJ A;  2AKL A;  1NM7 A;  2KRS A;  3PVL A;  1G2B A;  2D8H A;  5IHK A;  1MUZ A;  2CRE A;  5FWB A;  1T3S A;  2OJ2 A;  1X6B A;  5FW9 A;  3H0H A;  1RI9 A;  4R0K A;  2RQT A;  2EGC A;  2DL5 A;  4F17 A;  1WFW A;  3EG3 A;  2CT4 A;  2X3W D;  2HBW A;  2SEM A;  1UHF A;  3KFV A;  3UAT A;  3QWY A;  2KNB B;  4EIK A;  1CKB A;  4J9D A;  2CT3 A;  1HJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...