1ZUKA

Yeast bbc1 sh3 domain complexed with a peptide from las17
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
EPEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFVAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin tail region-interacting protein MTI1
publication title Structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 14
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zukA00
2RQWA 2V1QA 2OJ2A 3H0IA 3I5RA 5ECAA 2RNAA 4LNPA 1M3BA 1X6BA 4D8KA 1ZSGA 3JV3A 1YP5A 4AFQC 1RLQC 1UUEA 1GFCA 1WXBA 2YUNA 2KT8A 1M8MA 4DEYA 1NYFA 4RTYA 5I22A 1GBQA 2KR3A 4JZ3A 1VYVA 3M0SA 1YNZA 3VRZA 1K76A 1NG2A 1YWOA 3REBB 2H8HA 2K79A 1MV0B 1ZX6A 2VVKA 1JU5C 2JM9A 4LUEA 2HEQA 1GL5A 1PRMC 2LX7A 1WI7A 3RNJA 2DMOA 2O2OA 3EG2A 4HVVA 1MV3A 3I35A 1WLPB 2ED0A 1TG0A 4Z88A 4AG2C 2LP5A 1BB9A 1Z9QA 3H0FA 4J9GA 1OPLA 2ED1A 4E6RA 4Y92A 5I11A 2J05A 4HVWA 2BZXA 2ROTA 4LN2A 5HCKA 4Z89A 2CUDA 1WA7A 2F2VA 2O31A 1M3CA 2DBKA 2VWFA 1I07A 2DM1A 2JS2A 1AZEA 4D8DA 2LQWA 5IXBA 2L3SA 2SEMA 3NGPA 1UJYA 1X69A 2KXDA 1WXTA 2FPDA 2M51A 3TSWA 2DYBA 3EGUA 2EGAA 1YN8A 2KEAA 1RUWA 3TSZA 3QWXX 4JJCA 2LMJA 1KSWA 4CC2A 2A28A 4OMNA 1VYTA 5GJVB 5FWBA 2QDLA 2M0YA 1PNJA 1JO8A 3O5ZA 1WIEA 1YCSB 2CSIA 2DX1A 2DVJA 1AD5A 2HSPA 4CC7A 2NUZA 2GGRA 2RQUA 2D0NA 1UG1A 3I5SA 1OV3A 2KRNA 3KFVA 2JS0A 4JJBA 2KT1A 1X43A 1YWPA 3GBQA 4HXJA 4IIOA 2LQNA 1FMKA 2L0AA 2YDLA 2RN8A 3EHRA 2EVRA 1UECA 4HCKA 2LCSA 3LH5A 1ZUKA 2EYWA 1N5ZA 1NEGA 2C0IA 2E5KA 1B07A 2VKNA 2ECZA 2CH4A 4AFUC 1AWXA 1J3TA 2LZ6B 4HVUA 2ENMA 2FPEA 1SEMA 4RTTA 1EFNA 1BBZA 3NPFA 2EPDA 4A63B 1ARKA 4IIMA 3THKA 3UATA 2KE9A 2EBPA 2JM8A 2EYYA 3EHQA 4EIKA 2CT4A 2RF0A 3RBBB 2DRMA 1WFWA 2K7AA 2EGEA 1AZGB 4ESRA 4JJDA 2F2XA 1QLYA 1CSKA 2GQIA 3VS6A 1RLPC 1NYGA 2AKLA 1SHFA 4RTXA 1ZUYA 2C0TA 1VYUA 1SPKA 4GBQA 4OMLA 5IHNA 3EG0A 2EYZA 2P4RA 3H41A 3CQTA 3VS4A 2I0NA 2GNCA 1U3OA 4M4ZA 1NEBA 2KGTA 3NMZC 2YUOA 2RQTA 1OOTA 3FJ5A 1BK2A 2CREA 2JW4A 1M3AA 1OEBA 1UHFA 2X3WD 2JMAA 4J9HA 1W6XA 2YUQA 3SEMA 2DL4A 1PRLC 4QT7A 1ABQA 4AG1C 2AKKA 2BZYA 2KXCA 2C0OA 2K6DA 2DL5A 1W70A 3VRYA 1U06A 3SHWA 1KFZA 4J9FA 1BU1A 2CDTA 1SSHA 2LNHB 2IIMA 1GCQA 1AWJA 1K9AA 2DA9A 4OMPA 1G2BA 1UE9A 3R6NA 1NLOC 2HDAA 2EW3A 2W10A 1FYNA 2DRKA 2DJQA 2EQIA 1ZBJA 5IHIA 3EG3A 1UHCA 2LJ0A 4RTVA 2PTKA 1UJ0A 2CT3A 2FEIA 2YT6A 2J6OA 1PKSA 1T0HA 2AK5A 1T3SA 2KYBA 4OMOA 4J9EA 2K2MA 3M0QA 2BTTA 1KJWA 2JMCA 2JTEA 3M0UA 1HSQA 2KRMA 1V1CA 1JEGA 3QWYA 1G83A 4WCIA 2K3BA 4CC3A 3VS5A 1B3QA 2FRWA 1ZUUA 3ULRB 1ABOA 2GTOA 4RTWA 1CKAA 2XMFA 3I9QA 4JPBW 2DL7A 3VS1A 2YUPA 1U5SA 4RUGA 1PHTA 4Z8AA 3UA7A 1AWOA 2L3QA 1X2KA 1Y57A 1K1ZA 2HCKA 3UA6A 3ZL7C 2AZVA 1K0XA 2EGCA 4J9BA 1I0CA 1QWFA 2HBWA 2DLPA 2D8HA 1UTIA 5IXFA 2FG0A 1K0SA 1H92A 1UFFA 2YSQA 2FO0A 5EC7A 2JXBA 1QCFA 2EKHA 4CC4B 4LE9A 4AFSC 3U23A 1QWEA 1JXOA 2RPNA 2V1RA 3H0HA 3M0PA 2PZ1A 2DF6A 2MCNA 1SRMA 1I1JA 2O9VA 1AWWA 2DILA 1Z9ZA 5IHKA 4X1VA 2MOXA 2J6KA 1SHGA 1K4US 4FSSA 2DL8A 1GCQC 2GTJA 1WDXA 3M0RA 1X27A 2PNIA 2LJ1A 3VS3A 1UDLA 1T3LA 1JQQA 2DL3A 3M0TA 2SRCA 1NLPC 4J9IA 2KROA 2LJ3A 2ROLA 1GFDA 5L23A 2O88A 1Y0MA 2ABLA 1T0JA 2O9SA 4J9CA 2G6FX 2ESWA 4JZ4A 4F14A 2NWMA 2AZSA 2X3XD 1PWTA 2CUBA 4R0KA 1AVZC 2RQRA 1JXMA 2L2PA 5FW9A 4K11A 2A08A 1WYXA 1GRIA 2L3PA 2RMOA 1TUCA 1E6GA 1PKTA 1E6HA 2MIOA 2F2WA 4RTUA 3VS0A 1MUZA 1GCPA 2A37A 3A98A 2OI3A 3VS7A 2FRYA 1X6GA 2CH4W 2CSQA 1HD3A 2KYMA 2W0ZA 3VS2A 2J06A 3PVQA 2DNUA 4F16A 1WXUA 3PVLA 1M30A 1TUDA 5FWCA 3UF4A 1E7OA 4ORZA 1S1NA 3REAB 2KNBB 1UGVA 4DEXA 1AOJA 2BZ8A 4J9DA 1A0NB 1QKWA 1SRLA 1M27C 2KRSA 1NM7A 2FPFA 4AFZC 2A36A 4GLMA 4RTZA 1HJDA 1W1FA 3NHNA 2DE0X 5GJWB 2DBMA 2J6FA 1XOVA 2D8JA 4LUDA 4F17A 2GBQA 1ZLMA 3PE0A 2J7IA 4KRTA 1GBRA 2D1XA 1H8KA 3C0CA 1QKXA 1CKBA 1AEYA 1WX6A 3IQLA 1VA7A 1X2QA 2B86A 1OPKA 2OAWA 1LCKA 1RI9A 3TVTA 4OMMA 5IH2A 1H3HA 1KIKA 4OMQA 2JT4A 2KBTA 4ZNXA 2K9GA 2RQVA 1IO6A 2EYXA 3EG1A
chains in the Genus database with same CATH superfamily
4C0ZA 1BCMA 1VQ6Q 3CCSA 2X4WA 2LCLA 2RNAA 3VUZA 4XAXB 3CCET 3G4ST 1RLQC 2YWWA 1WXBA 2YUNA 1NYFA 1NE8A 4RTYA 1LPLA 2KR3A 1G3TA 3LWIA 2YXYA 1M1KU 3M0SA 4GY5A 5KYUA 4EMKC 1KQ1A 1YNZA 3RKWA 4YTLA 4LDYA 3MEUA 4HCCA 1YWOA 1KC8R 3REBB 5HK0A 2DVEA 4RKUE 2B8AA 5GAOp 2DYIA 1ZSZC 5CO7A 1OX9A 2WACA 8AT1B 3NTIA 3QYHB 2BUDA 1KQ2A 2L5QA 1JJ2A 3MCAB 3C4SA 4Z88A 3TQ7P 1ZQ1A 4GLKA 4XTUA 2J05A 4Z89A 5HCKA 3OYNA 4E7JA 2O31A 1LOJA 3UT1A 2DM1A 2JS2A 4PJOC 4D8DA 2LQWA 1NJIR 2HMAA 2DXTA 1X69A 2GQVA 5J3BA 1QVFP 2FZKB 1OU9A 1NBEB 1Q7YU 3TSWA 2QQ9A 2DJZA 1U1SA 4R56A 2EGAA 5GAOn 2C06A 3QWXX 4L6V5 1VQ6A 2KK4A 3KXTA 4OMNA 3JB9I 1ACMB 4DBFA 5J26A 5FWBA 2M0YA 3EGXA 4KBMB 1JO8A 3E9FA 2P0PA 5A0DA 2HL5C 2LCCA 3CCMA 2EQMA 4N4HA 2AHJB 2YHTA 1WHJA 1XTDA 1OV3A 3QJ6A 2BE9B 3KFVA 4XTXA 5AT1B 1YWPA 4PNOA 3HTRA 1Q81R 2RN8A 4BDYA 2AT1B 1R0CB 2DEUA 1WHLA 2C0IA 2VKNA 2DEQA 1OZ2A 2OTJA 4FYYB 3CCVT 4HVUA 4M7AC 2KQWA 1M90C 2IVWA 2EPDA 3NPFA 4M78B 4A63B 4QQGA 3QPHA 4IIMA 2EBPA 1QP2A 5FLXE 3CPFA 4EIKA 3J81E 2CT4A 3I55A 2K7AA 3CEYA 2EGEA 2DPPB 3INZA 1H641 2NUPB 5CKHA 1RLPC 5GAN3 1NYGA 2RHIA 3ASKA 1M4ZA 5GAN2 3CCST 1ZUYA 3MKDA 1VYUA 1SPKA 4GBQA 2DD5A 4M77D 3BDUA 5HY6A 1DJ7B 3CCJA 4KULA 4B6MA 1I4K1 2P4RA 3H41A 4PJOG 3CQTA 5KH6A 2V8IA 5DY9A 3G71Q 4M4ZA 3X24B 1VQ7Q 1Q82U 2RQTA 4RG8A 3M57A 3CPWA 2E1HA 3MP6A 3JCMP 3OYLA 4C5HA 3EGDA 2CREA 1R77A 1M3AA 1PD1A 1YJ9Q 3OW2S 3OS1A 1W6XA 1HYOA 2QTVA 4N4GA 2AKKA 3CBMA 1AHJB 2KXCA 4XU1A 4QKUA 4B9XA 2MI6A 3I56Q 3V7RA 4FIBA 2LNHB 2IIMA 4Z02A 1AWJA 3R6NA 1UE9A 1S72A 2ZPFB 4KGZB 1TSFA 4BDZA 1FYNA 3HKSA 4A4FA 1Q95G 3G1JA 4PFPA 2LJ0A 2PTKA 4M7DA 2YT6A 3A8HB 2CP2A 1T3SA 5CCAA 1YCYA 1K73U 1YJWQ 2K2MA 2BTTA 4FYWB 4ELYC 2KRMA 4O6JA 4C5EA 4CC3A 2RHUA 1ZUUA 1EX4A 2E4HA 3GNFB 4RTWA 5GMKl 3I9QA 3OMGA 5L8RE 3M53A 3CCLQ 1U5SA 2CP3A 3FDRA 4PJOD 3VYGA 4J83A 2L3QA 3OMCA 2K57A 3CCMT 2ZPIB 3V8JA 3OS2A 4KUDK 2M16A 4C0GA 3OYEA 1D0YA 1UTIA 4FU6A 3QYGB 4MDWA 3L2RA 5A2QE 3CBOA 3LGLA 1YJ9A 2FZCB 4FT2A 1H92A 1KHCA 3JB9G 4LE9A 4AFSC 3U23A 2E41A 3CCEQ 3G4SQ 2V1RA 3M0PA 2KDSA 2ATCB 2XK0A 2OTJT 4N0AA 1UGRB 4XTZA 2MOXA 1SHGA 3KBGA 3ME9A 2DL8A 2GTJA 1WDXA 4PFZA 4FYXB 5GANe 3O8VA 1UDLA 4E7SA 4M75C 3I55T 2RHXA 2HSEB 4VUBA 5L23A 1YJWA 1Y0MA 2ABLA 1K9MC 2G6FX 1C1AA 4RMOA 5GANh 3CCJT 1BI1A 3NTHA 1GRIA 4PK4A 3CXCP 1OULA 1PKTA 3FRNA 3QDFA 5LL6S 1VQMA 2F2WA 1KC8U 3BDLA 1YBYA 4RTUA 3A98A 4FM4B 3VS7A 2F1LA 2CP6A 4M77B 1X01A 2MWOA 2EAYA 2DNUA 4F16A 2XHCA 2RM4A 4M7AE 4R55A 2YRDA 3UF4A 5GANj 5CKBA 2BZ8A 1PC0A 1QKWA 4F7UE 2KRSA 1OI1A 2FPFA 2ZPGB 1W1FA 3JB9D 2WSEE 2X4JA 4PJOF 4LD6A 3OYHA 3H9NA 2GBQA 5LJ3g 1D1AA 5D6YA 3G4SA 4C92D 5LJ3h 1S72T 5KE3A 3X28B 1NJIU 2NUTB 3BY7A 3IQLA 4C8QG 2B86A 3CD6Q 1OPKA 2DTHA 2OAWA 5GAOl 1XJWB 3QIIA 1KIKA 5LJ5d 2FB7A 1QVFS 4ZNXA 1KQSS 1N8RC 2K9GA 2E6NA 1KD1R 3PFSA 3S3NA 2V8KA 5LJ5e 2EIFA 2V1QA 3H0IA 3I5RA 1UGSB 2A3LA 1ZSGA 3JV3A 4AT1B 4J6XA 2KT8A 3CCVQ 4DEYA 5GAN6 3OBYA 1TOVA 3DKMA 3BW1A 2K4YA 3ZFJA 4P5NA 5FU7C 5GAMd 1Q81U 5FRNA 4XU2A 2HEQA 1GL5A 4FL6A 2L89A 1TH7A 4HVVA 5GAMe 4PJOB 4E2FB 1F1BB 4C0FA 3I35A 3S6WA 3CCSQ 2YLBA 1D09B 4PLIA 1WLPB 2ED0A 4Y28E 5LJ5j 4PJJA 5CK9A 3JCMe 1BB9A 3HHTB 1Z9QA 3H0FA 3GF5A 1OPLA 1VQPT 2VXEA 1M2VB 3SWNC 4EMGA 3C95A 2BZXA 1N9SA 2RHYA 5LJ5f 1WA7A 3VKIA 1BIAA 2DBKA 4B9WA 1OYXA 1I07A 1BIBA 2JUFA 2DD4A 4C8QD 3HP9A 5IXBA 1KHIA 3L2ZA 2VV5A 3CD6A 1WGSA 2PUOB 2FL7A 1UJYA 4M78A 1HXDA 2KXDA 4BE0A 4RCBA 2FPDA 1R0BG 4XK8E 2ZCFB 2DYBA 3EGUA 4PJNA 3HRSA 4NS5A 3P8DA 1IZ6A 1YN8A 3ZEHA 1RUWA 3TSZA 1JJ2P 1IREB 4JJCA 1KSWA 2R5AA 2E6ZA 5I2SA 2K5LA 4N4IA 1VYTA 5GJVB 2NUPA 1YIJQ 2EWNA 2YRCA 1QW1A 5GAMf 1WPYA 1Y96B 4A53A 5KCOA 3O5ZA 1Y71A 3CCVA 2COWA 2P4TA 3HFNA 1VQMT 4CRIA 4E7KA 3MEVA 2H3JA 2NUZA 1D0XA 5HKCA 2GGRA 2CKKA 1TS9A 1PD0A 2RI5A 5KYNA 3CCQA 2D0NA 1UG1A 1KD1C 2KRNA 1Q86U 2COZA 2LQNA 2X4YA 1ZBXA 3EH1A 2JVVA 2EQKA 2LCSA 1ZUKA 1BCOA 1J3TA 4AFUC 2K5IA 4FT4A 4M75E 2DERA 4M78E 2QASA 2ENMA 1I8FA 4LDWA 3FJPA 3A8LB 4RTTA 1EZZB 2LT1A 4O5VA 3OYFA 2KE9A 1IRXA 3CCMQ 3R6OA 1YI2T 3EHQA 1M90R 5CR2A 1D3BA 4HT9A 3RBBB 2DRMA 3FIFA 2VUBA 4C92B 1AZGB 2NYSA 4ESRA 1K8AU 1OX8A 2P84A 5KE2A 1CSKA 3VS6A 1VQKA 3L2VA 5D6WA 1MHNA 2A7YA 2R58A 3FEOA 2C0TA 3M54A 2E65A 4E47A 3G7ZA 4NL2A 5IHNA 3EG0A 5M9OA 2M1HA 2QXFA 5HK3A 2OTJQ 4BY6B 3VS4A 4EMHA 1YIJA 2I0NA 4C8QF 2JN0A 2RJEA 4ZN3A 2GNCA 4DBHA 1O75A 3NMZC 1VQLA 2FZGB 1OOTA 2OTLQ 1M9SA 3OSVA 1RL2A 3T9NA 3I55Q 3LLRA 4J9HA 2YUQA 3LYIA 3SEMA 2D0QB 2DL4A 1PRLC 4AG1C 4KH1B 2K5FA 2BZYA 2O4XB 4ZGEB 4J9FA 4KGVB 1V76A 3A8OB 4ZTJA 1GCQA 5GMKi 2E12A 2HQXA 3FLGA 3CCJQ 2EW3A 5CAIA 3JB9H 3CBPA 2HL3A 4M75F 2DRKA 3CCUQ 2DJQA 5IHIA 2MK5A 2KAFA 3CPWP 1UJ0A 7AT1B 2LTOA 3SB2A 4D6WA 2J6OA 2OAUA 1T0HA 4ZGDB 3CD6T 1G3YA 4J7IA 3UPUA 4OMOA 4JUVA 5GAN5 2PUKB 4A54A 4Q5WA 4OB0B 3J7AF 2RD1A 3EFOB 1HSQA 4HCZA 3E1SA 3KUFA 5CKFA 1V1CA 4C8QB 2JTFA 3QWYA 1G83A 3OYBA 1VQ9T 1VQ5Q 1B3QA 1H3ZA 3CXCS 1S72Q 3M58A 1NPPA 2DZCA 1RADB 5IN1A 1D0ZA 1VIEA 4Z8AA 1AWOA 1QCOA 3TCJA 4DBQA 2K2VA 4N0AC 1RAGB 3F70A 4BUGA 1K1ZA 3UA6A 2RJDA 1K0XA 2MYSA 1IGQA 2HBWA 2MMPA 2OTLA 3CMAT 3OS0A 3LW5E 2QGFB 3CCQT 2D8HA 2GFUA 3QHSA 3META 2Z0WA 2DETA 2EQUA 4M77A 4DOWA 1UFFA 1NPRA 3NFCA 2JXBA 2EKHA 5J39A 3JCMX 1RAAB 1JXOA 2RPNA 1SRMA 1AWWA 3SDZA 2DILA 3JSCA 1Z9ZA 4BE2A 5IHKA 2JNGA 5EG2A 3MP8A 1WQ7A 3V7CA 4FSSA 3OYDA 3CCUA 1XQHA 4OB3B 2DXBA 5GMKm 3X26B 2QTXA 3M0RA 2RK2A 2NUTA 1QVFA 1KQSA 1W2BP 4FYVB 2DIGA 2DL3A 4J9IA 2LJ3A 1GFDA 4MMKA 1VQKT 1I5LA 3M55A 1IGUA 4KH0B 2KSSA 2O9SA 2AZSA 1PWTA 1VQNT 1AVZC 2Y4YA 4DQ2A 1VQPQ 1K9MR 2RMOA 2L3PA 1VQ5A 1YIJT 3L42A 1UB4A 4M77E 3D7SB 2FVUA 2OI3A 1VQLT 2CSQA 2ZPBB 2X35A 2KYMA 3EFSA 1WXUA 1TUDA 2P0QA 1E7OA 1M8VA 2ZZDA 2A36A 1YHQT 2PVDB 2DZ9A 3FC3A 1BI0A 4PJOA 2RI3A 4M7AG 2DE0X 2DBMA 2J6FA 2D8JA 2RJFA 1YITA 1UEBA 1BKBA 2DAQA 1GBRA 2CZ0B 2D1XA 2DTOA 1CKBA 1AEYA 4F7UG 1WHGA 1VQMQ 1M2VA 1N27A 2X9HA 4DOVA 1RI9A 4OMMA 1RAHB 5IH2A 2PVGB 4OMQA 2DK3A 2JT4A 5FU6B 3DLLA 3M9QA 2OJ2A 1RI0A 2XKOC 1JJ2S 1N8RR 4LNPA 2Y90A 1BI3A 3GNGA 4D8KA 3M59A 4AFQC 2HQHA 3HL8A 1UUEA 1VOMA 4M7DE 5I22A 3FB9A 1VQPA 4JZ3A 1VYVA 2MAMA 4MZPA 1FXXA 1K76A 1NG2A 2VB6A 1Y96A 1YI2Q 3SWNB 1X75C 5GANd 3E9GA 1IHWA 4F04B 2HKQB 5GMKh 4L5GA 2K79A 1MV0B 1ZX6A 2OTLT 2VVKA 4PFOA 1WI7A 1ZA1B 2O2OA 1QVGS 2RJCA 4PKCC 5GAOm 1AT1B 4M78C 2X51A 4AG2C 4RG2A 3DLMA 3VUBA 5I11A 4M7AD 5GMKj 2KVQG 3WVEB 1QCNA 1M3CA 1M90U 1N6AA 2X4XA 1I81A 3CCUT 3S3MA 3ER0A 3E19A 3OBWA 1YJNT 1U8RA 1Y07A 3OB9A 2KMTA 5LJ3e 3M4YA 5D7UA 1WJRA 1IXDA 1VQ4T 3TEEA 3RMQA 4C92A 4C0DB 2A28A 3JAME 4FCYA 5GANf 1PNJA 3OS5A 2CZ1B 1VQ5T 4X9CA 2VASA 4XU0A 2GFAA 2F5KA 3CC4A 1XNIA 1YCSB 1B34B 2CSIA 2VYTA 2DVJA 2LNVA 4CC7A 3CMET 2RQUA 1YI2A 4X34A 2JS0A 2XDPA 1QVPA 2DTIA 3DB3A 4JJBA 2KT1A 4QW2A 1X43A 5I2MA 3GBQA 4HXJA 2YDLA 4EMKB 4JS4A 3P8BB 2QEXA 4OF1A 3LH5A 5LJ3j 3RDVA 4OGCA 2EYWA 1N5ZA 1NEGA 2DXUA 4BI3A 1VQ9Q 3BE3A 3CCRA 2ECZA 1AWXA 2JZ2A 2LZ6B 4FW1A 2O4XA 1YITT 1LVKA 1ZSZB 1D1CA 3RERA 1TWBA 3EFRA 3V8LA 1BBZA 1ARKA 5DLOA 3UATA 3CPWS 1LNXA 2JM8A 2L8DA 5KYWB 4C92E 2DFUA 3PMIA 5A0GA 2QI2A 4M75G 2RF0A 3CMAQ 4M78G 2L3RA 3CCQQ 5I21A 1MMAA 2V8JA 1FMWA 1Q7YC 4JJDA 2CYZB 1B7TA 2ZPHB 3ZBDA 2GQIA 1QQJA 3OQ5A 3EH2A 4BE1A 1O9SA 1G3WA 1G3SA 2AKLA 5GAN7 3Q1JA 2JTMA 4RTXA 4M7AF 1LJOA 2XG8D 4EPCA 4J6WA 3JCMd 2EYZA 3N5BB 3JCMV 4F7UF 3EFOA 3CC7T 4C8QA 3PNWC 2WSCE 3CC2T 1TTHB 1ZHIA 1VIFA 2DIQA 2DXCA 1KK7A 4OMFB 4WTOB 3NTKA 1BK2A 1UHFA 2IPOB 2X3WD 2JMAA 1ABQA 3LX7A 1PSFA 1VQKQ 3QUIA 3PTAA 4JRQA 5FROA 2K6DA 2DL5A 1W70A 3VRYA 3EAEA 1ZA2B 3GLXA 3SHWA 1KFZA 2CDTA 1SSHA 2EJGA 9ATCB 5KYXB 1VQNQ 1V29B 1K9AA 2DA9A 1VQOA 4OMPA 2LQ8A 4BI8B 2HDAA 1SSFA 1VQ9A 4JS5A 3P8HA 4LDVA 5A0LA 5CQXA 3GIBA 2PU9B 3EG3A 1VQLQ 4JLGA 4RTVA 3V8KA 2CT3A 2FEIA 4OVAA 2AK5A 1W2BS 4NL3A 2KYBA 4XTWA 3JCMf 2R5MA 4M75D 4M7AB 4XQ3A 3CMAA 3OW2A 4J9EA 2H3EB 1I5OB 4PL6A 3JCMW 2F69A 2LVMA 4IKFA 3A5ZB 2JMCA 4F7UB 5IAYA 4E7IA 1K9MU 4J5YA 1YHQQ 4L59A 4WCIA 4M77C 2K3BA 3M56A 3VS5A 2FRWA 2KI7A 1ABOA 2GTOA 2XMFA 4II1A 3EG9B 4JPBW 4XTYA 1C0MA 2DL7A 1WZOA 2YUPA 3VS1A 1PHTA 3CC4T 5DM7R 4XU3A 4DBRA 1Q82C 3RKXA 1X2KA 1Y57A 1FMVA 2VGNA 3PMTA 2HCKA 2IG0A 4Y91A 2AZVA 1I0CA 3QZ9B 4LD9K 3A8GB 2XIDA 5C6SA 3DB4A 2E70A 4KUIA 2LRQA 3AHUA 1G5VA 3H8ZA 1K0SA 2V26A 5EC7A 4JRPA 1QCFA 2QEXT 4CC4B 3M4GA 3OA6A 3CCRT 5CKEA 2MCNA 1R8OB 1I1JA 2EKOA 1VQNA 4OB1B 3VYHB 4FSXA 1VUBA 1X6OA 4X1VA 3E2UA 3JB9J 2J6KA 4TVRA 2JJ9A 1MNEA 1OU8A 1K4US 2ZPEB 3HRTA 1SKUB 2RB6A 2PNIA 2LJ1A 3VS3A 3OYIA 1T3LA 1K73C 1JQQA 1N8RU 3G6EA 3M0TA 1VQ8T 1TU0B 2XDBA 2SRCA 1NLPC 2ROLA 4MDXA 2QQRA 2HZYA 2JOYA 4M7DC 2EFIA 1RAEB 1FX7A 3OYYA 4PLLA 5AYFA 4F14A 2NWMA 2VXFA 2HNIA 3MO8A 1YHQA 4FW2A 1JXMA 2L2PA 3RMSA 4K11A 1WYXA 2RI2A 3RKYA 2XU8A 2MIOA 1PSEA 3VJPA 1TXQA 1PG5B 3VS0A 2A37A 2QDYB 1WJQA 4A4KA 1WJSA 2FRYA 3TU4K 4M78F 1KQSP 2W0ZA 3X20B 3PVQA 1RAIB 2VGMA 3QO3A 3PVLA 1QVGA 5FWCA 4ORZA 1S1NA 1YJNQ 3REAB 4M77G 3SWNA 5KCHA 2KNBB 4DEXA 1AOJA 1A0NB 1SRLA 1M27C 1VQ4Q 2PVOB 4GLMA 4RTZA 2HBPA 1HJDA 2E3IA 3HPWA 5GJWB 2ZGWA 4IUVA 1VQOT 4F17A 3AT1B 4LUDA 4LDUA 4RCCA 3M5AA 2J7IA 4KRTA 2QYZA 1QKXA 1SF9A 4IUQA 1VA7A 1X2QA 4QVCA 2R57A 2NLUA 3TVTA 4OP0A 3CMEQ 1H3HA 2PQWA 4X9DA 2RQVA 1WHKA 1UGPB 5GAOq 4JJNK 2QA4T 2RQWA 2I2LA 5ECAA 2CP0A 1M3BA 3GPLA 1X6BA 4A4HA 1YP5A 2RHZA 1GFCA 2AIRB 1M8MA 4M75B 1YITQ 2A0FB 1GBQA 3JCMc 1MNDA 3HRUA 3X25B 1KC8C 2XDDA 3VRZA 1EIFA 2D6FA 4ME7A 4E7ZA 2CZ7B 2H8HA 1KD1U 4M7DG 1B34A 1JU5C 2JM9A 1JB0E 4LUEA 1PRMC 2LX7A 3RNJA 2DMOA 3EG2A 4CI0C 1MV3A 4HCBA 2CGHA 3RESA 3MPUB 4LXCA 3OYAA 3PIPA 1YJNA 4QQ6A 1TG0A 2LP5A 1VQ4A 3JCMb 4J9GA 4V2SA 2ED1A 8ATCB 4E6RA 4EMKA 4Y92A 3MP1A 3VV0A 4HVWA 4LN2A 2ROTA 4C92C 3CC7Q 2M02A 3CC2Q 2CUDA 2F2VA 4ATOA 1MMDA 2QQAA 1NJIC 5KYYB 3L2QA 2VWFA 2LQKA 1AZEA 2O01E 3JCMQ 5CQYA 1ZSZA 2BIVA 2EJFA 2XD0A 2L3SA 2SEMA 5CKDA 3NGPA 3CMEA 1WXTA 1PM3A 2BE7D 4BY6C 2M51A 3G6ET 5KYWA 3MJXA 5GAOr 1D1BA 3BFMA 1Q86R 2QK0A 4WF2A 2KEAA 3OYGA 1HK9A 1G8XA 3LGFA 2LMJA 4MMLA 3S3OA 2EYQA 3SD4A 2E5QA 4CC2A 4JRIA 4MZTA 5KYUB 1MMNA 2QDLA 3GOXA 1D3BB 1N9RA 1MMGA 4KT0E 4A4EA 1WIEA 2DX1A 1AD5A 2HSPA 2EJ9A 3SFMA 1M1KR 3C94A 1WNLA 3I5SA 1Q81C 3URGA 2MF2A 2E64A 4M7DD 1RABB 2HD0A 4IIOA 3L2WA 1K8AR 1FMKA 2L0AA 1VQ6T 3L1AA 3MHXA 3EHRA 2EVRA 1WHHA 1UECA 4E7LA 4HCKA 4ANJA 4KGXB 2E5KA 5FU7B 1B07A 2CH4A 3TREA 5GMKe 3LWHA 1OZ3A 2FPEA 3UWNA 3G71A 1SEMA 5KYXA 1EFNA 4OGEA 3CC4Q 3CC7A 1VQ7A 3CC2A 2CP7A 3THKA 4C8QC 2EYYA 1W2BA 3LH0A 1M1GA 1WFWA 4M77F 2M9UA 4PJOE 3UDCA 2F2XA 5C0MA 1QLYA 1M1FA 3EGXB 1SHFA 1TUGB 4IUUA 4C92G 4HKEA 3I56A 1Q7YR 4M7AA 1UGQB 2QEXQ 1BI2A 4OMLA 3CCRQ 4F7UA 2HAXA 1FWZA 3V7SA 1U3OA 1NEBA 2KGTA 4JLIA 2YUOA 1SG5A 4DA4A 3FJ5A 3EG9A 3OYMA 2MPXC 2JW4A 1OEBA 4UC4A 1WQWA 1VQ8Q 1Q86C 1WHMA 2Y4XA 4QT7A 5LJ3d 2GF7A 1RAFB 2EQJA 3PT9A 1KG1A 2C0OA 5GANg 1U06A 3RR6A 1BU1A 5GAN8 3MEWA 2P0KA 2K3XA 4NOYA 2G3RA 1G2BA 4C5GA 2CS7A 1NLOC 2W10A 3CCLA 2LDMA 3H6ZA 4IURA 2EQIA 1ZBJA 2QQSA 3HSBA 1PCXA 1UHCA 2QAZA 4M7DF 2XI9A 1M1KC 1PKSA 4MZMA 3J80E 2RK1A 3M0QA 1K8AC 4BI4A 1KJWA 2JTEA 2LX9A 2BKDN 3M0UA 5GAN4 1JEGA 1GXIE 3CCEA 4ZN1A 5CIUA 3VU3C 3ULRB 1VQOQ 1CKAA 2OX7A 3WVDB 4XTVA 2VC8A 2E3HA 4RUGA 2QG9B 3EGDB 4ZTFA 4IUTA 2KY9A 3QJYA 3UA7A 2CP5A 5LJ3f 5D6XA 3ZL7C 2EGCA 4J9BA 1QWFA 2DLPA 1U1TA 1Q82R 5IXFA 3OW2P 2FG0A 1MGQA 2HQEA 2QA4Q 1VQ8A 2YSQA 4J8OA 2COYA 2FO0A 3QBYA 6AT1B 1NZ9A 4JRKA 1QWEA 3H0HA 4BACA 2PZ1A 2DF6A 2O9VA 3MEAA 3QKJA 5LJ5g 2ZAEA 2DKGA 4EDUA 5LJ5h 4M7DB 1JRIA 3CXCA 3HFOA 1M5Q1 2F5TX 5FU6C 3G71T 1JBMA 4PJLA 5CVIA 3PIOA 1YFNA 3L2UA 1Y7XA 5FRMA 1VQ7T 3QG1A 4BB7A 4QVDA 1GCQC 4BD3A 3OSSC 1OQKA 1X27A 2WSFE 1YJ9T 2RA2A 4OB2B 2K3YA 2KROA 2FYKA 2LC4A 4E7HA 2O88A 4LDXA 3QZ5B 2QGGA 1K73R 1T0JA 4J9CA 2ESWA 4JZ4A 3GP8A 4C5IA 3I56T 2X3XD 3OYJA 2CUBA 4J7FA 4R0KA 2RQRA 3QSUA 5FW9A 5GAMg 2M0OA 2A08A 5GAMh 1RACB 2DO3A 1TUCA 1IB8A 1E6GA 2CZ6B 1E6HA 3QDRB 3QXEB 1MUZA 1GCPA 1IHVA 2E10A 3JRZA 3JCMg 1X6GA 4M75A 2CH4W 3JCMh 1HD3A 3A8MB 5IT9E 3VS2A 1M2OA 3JB9F 2J06A 3RUXA 3WXMB 2XICA 1QMCA 1M30A 4JDSA 1P92A 4IUPA 3G6EQ 1YJWT 4A4GA 2LT4A 4HA8A 5GAMj 3C12A 1UGVA 1C6VX 4C92F 1QP3A 4J9DA 2QQBA 4M78D 3OY9A 1NM7A 4AFZC 4C8QE 2QA4A 4J6YA 2RO0A 4ZGJB 3NHNA 3OYKA 1XOVA 3JCMJ 1ZLMA 3OYCA 4ELZC 3PE0A 3CCLT 1H8KA 3C0CA 3PGGA 4AMCA 4QVZA 1WX6A 2MWPA 1W4SA 2RH2A 2YRVA 5DLQE 4C0DC 1LCKA 2GCXA 2HKNA 4QQDA 1BYMA 3A1PA 3RIRA 4PJMA 5KYYA 4HT8A 2YLCA 2KBTA 1QVGP 2D9TA 1IO6A 2FHDA 2EYXA 3EG1A
chains in the Genus database with same CATH topology
2RQWA 2V1QA 2OJ2A 3H0IA 3I5RA 5ECAA 2RNAA 4LNPA 1M3BA 1X6BA 4D8KA 1ZSGA 3JV3A 1YP5A 4AFQC 1RLQC 1UUEA 1GFCA 1WXBA 2YUNA 2KT8A 1M8MA 4DEYA 1NYFA 4RTYA 5I22A 1GBQA 2KR3A 4JZ3A 1VYVA 3M0SA 1YNZA 3VRZA 1K76A 1NG2A 1YWOA 3REBB 2H8HA 2K79A 1MV0B 1ZX6A 2VVKA 1JU5C 2JM9A 4LUEA 2HEQA 1GL5A 1PRMC 2LX7A 1WI7A 3RNJA 2DMOA 2O2OA 3EG2A 4HVVA 1MV3A 3I35A 1WLPB 2ED0A 1TG0A 4Z88A 4AG2C 2LP5A 1BB9A 1Z9QA 3H0FA 4J9GA 1OPLA 2ED1A 4E6RA 4Y92A 5I11A 2J05A 4HVWA 2BZXA 2ROTA 4LN2A 5HCKA 4Z89A 2CUDA 1WA7A 2F2VA 2O31A 1M3CA 2DBKA 2VWFA 1I07A 2DM1A 2JS2A 1AZEA 4D8DA 2LQWA 5IXBA 2L3SA 2SEMA 3NGPA 1UJYA 1X69A 2KXDA 1WXTA 2FPDA 2M51A 3TSWA 2DYBA 3EGUA 2EGAA 1YN8A 2KEAA 1RUWA 3TSZA 3QWXX 4JJCA 2LMJA 1KSWA 4CC2A 2A28A 4OMNA 1VYTA 5GJVB 5FWBA 2QDLA 2M0YA 1PNJA 1JO8A 3O5ZA 1WIEA 1YCSB 2CSIA 2DX1A 2DVJA 1AD5A 2HSPA 4CC7A 2NUZA 2GGRA 2RQUA 2D0NA 1UG1A 3I5SA 1OV3A 2KRNA 3KFVA 2JS0A 4JJBA 2KT1A 1X43A 1YWPA 3GBQA 4HXJA 4IIOA 2LQNA 1FMKA 2L0AA 2YDLA 2RN8A 3EHRA 2EVRA 1UECA 4HCKA 2LCSA 3LH5A 1ZUKA 2EYWA 1N5ZA 1NEGA 2C0IA 2E5KA 1B07A 2VKNA 2ECZA 2CH4A 4AFUC 1AWXA 1J3TA 2LZ6B 4HVUA 2ENMA 2FPEA 1SEMA 4RTTA 1EFNA 1BBZA 3NPFA 2EPDA 4A63B 1ARKA 4IIMA 3THKA 3UATA 2KE9A 2EBPA 2JM8A 2EYYA 3EHQA 4EIKA 2CT4A 2RF0A 3RBBB 2DRMA 1WFWA 2K7AA 2EGEA 1AZGB 4ESRA 4JJDA 2F2XA 1QLYA 1CSKA 2GQIA 3VS6A 1RLPC 1NYGA 2AKLA 1SHFA 4RTXA 1ZUYA 2C0TA 1VYUA 1SPKA 4GBQA 4OMLA 5IHNA 3EG0A 2EYZA 2P4RA 3H41A 3CQTA 3VS4A 2I0NA 2GNCA 1U3OA 4M4ZA 1NEBA 2KGTA 3NMZC 2YUOA 2RQTA 1OOTA 3FJ5A 1BK2A 2CREA 2JW4A 1M3AA 1OEBA 1UHFA 2X3WD 2JMAA 4J9HA 1W6XA 2YUQA 3SEMA 2DL4A 1PRLC 4QT7A 1ABQA 4AG1C 2AKKA 2BZYA 2KXCA 2C0OA 2K6DA 2DL5A 1W70A 3VRYA 1U06A 3SHWA 1KFZA 4J9FA 1BU1A 2CDTA 1SSHA 2LNHB 2IIMA 1GCQA 1AWJA 1K9AA 2DA9A 4OMPA 1G2BA 1UE9A 3R6NA 1NLOC 2HDAA 2EW3A 2W10A 1FYNA 2DRKA 2DJQA 2EQIA 1ZBJA 5IHIA 3EG3A 1UHCA 2LJ0A 4RTVA 2PTKA 1UJ0A 2CT3A 2FEIA 2YT6A 2J6OA 1PKSA 1T0HA 2AK5A 1T3SA 2KYBA 4OMOA 4J9EA 2K2MA 3M0QA 2BTTA 1KJWA 2JMCA 2JTEA 3M0UA 1HSQA 2KRMA 1V1CA 1JEGA 3QWYA 1G83A 4WCIA 2K3BA 4CC3A 3VS5A 1B3QA 2FRWA 1ZUUA 3ULRB 1ABOA 2GTOA 4RTWA 1CKAA 2XMFA 3I9QA 4JPBW 2DL7A 3VS1A 2YUPA 1U5SA 4RUGA 1PHTA 4Z8AA 3UA7A 1AWOA 2L3QA 1X2KA 1Y57A 1K1ZA 2HCKA 3UA6A 3ZL7C 2AZVA 1K0XA 2EGCA 4J9BA 1I0CA 1QWFA 2HBWA 2DLPA 2D8HA 1UTIA 5IXFA 2FG0A 1K0SA 1H92A 1UFFA 2YSQA 2FO0A 5EC7A 2JXBA 1QCFA 2EKHA 4CC4B 4LE9A 4AFSC 3U23A 1QWEA 1JXOA 2RPNA 2V1RA 3H0HA 3M0PA 2PZ1A 2DF6A 2MCNA 1SRMA 1I1JA 2O9VA 1AWWA 2DILA 1Z9ZA 5IHKA 4X1VA 2MOXA 2J6KA 1SHGA 1K4US 4FSSA 2DL8A 1GCQC 2GTJA 1WDXA 3M0RA 1X27A 2PNIA 2LJ1A 3VS3A 1UDLA 1T3LA 1JQQA 2DL3A 3M0TA 2SRCA 1NLPC 4J9IA 2KROA 2LJ3A 2ROLA 1GFDA 5L23A 2O88A 1Y0MA 2ABLA 1T0JA 2O9SA 4J9CA 2G6FX 2ESWA 4JZ4A 4F14A 2NWMA 2AZSA 2X3XD 1PWTA 2CUBA 4R0KA 1AVZC 2RQRA 1JXMA 2L2PA 5FW9A 4K11A 2A08A 1WYXA 1GRIA 2L3PA 2RMOA 1TUCA 1E6GA 1PKTA 1E6HA 2MIOA 2F2WA 4RTUA 3VS0A 1MUZA 1GCPA 2A37A 3A98A 2OI3A 3VS7A 2FRYA 1X6GA 2CH4W 2CSQA 1HD3A 2KYMA 2W0ZA 3VS2A 2J06A 3PVQA 2DNUA 4F16A 1WXUA 3PVLA 1M30A 1TUDA 5FWCA 3UF4A 1E7OA 4ORZA 1S1NA 3REAB 2KNBB 1UGVA 4DEXA 1AOJA 2BZ8A 4J9DA 1A0NB 1QKWA 1SRLA 1M27C 2KRSA 1NM7A 2FPFA 4AFZC 2A36A 4GLMA 4RTZA 1HJDA 1W1FA 3NHNA 2DE0X 5GJWB 2DBMA 2J6FA 1XOVA 2D8JA 4LUDA 4F17A 2GBQA 1ZLMA 3PE0A 2J7IA 4KRTA 1GBRA 2D1XA 1H8KA 3C0CA 1QKXA 1CKBA 1AEYA 1WX6A 3IQLA 1VA7A 1X2QA 2B86A 1OPKA 2OAWA 1LCKA 1RI9A 3TVTA 4OMMA 5IH2A 1H3HA 1KIKA 4OMQA 2JT4A 2KBTA 4ZNXA 2K9GA 2RQVA 1IO6A 2EYXA 3EG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQW A;  2V1Q A;  2OJ2 A;  3H0I A;  3I5R A;  5ECA A;  2RNA A;  4LNP A;  1M3B A;  1X6B A;  4D8K A;  1ZSG A;  3JV3 A;  1YP5 A;  4AFQ C;  1RLQ C;  1UUE A;  1GFC A;  1WXB A;  2YUN A;  2KT8 A;  1M8M A;  4DEY A;  1NYF A;  4RTY A;  5I22 A;  1GBQ A;  2KR3 A;  4JZ3 A;  1VYV A;  3M0S A;  1YNZ A;  3VRZ A;  1K76 A;  1NG2 A;  1YWO A;  3REB B;  2H8H A;  2K79 A;  1MV0 B;  1ZX6 A;  2VVK A;  1JU5 C;  2JM9 A;  4LUE A;  2HEQ A;  1GL5 A;  1PRM C;  2LX7 A;  1WI7 A;  3RNJ A;  2DMO A;  2O2O A;  3EG2 A;  4HVV A;  1MV3 A;  3I35 A;  1WLP B;  2ED0 A;  1TG0 A;  4Z88 A;  4AG2 C;  2LP5 A;  1BB9 A;  1Z9Q A;  3H0F A;  4J9G A;  1OPL A;  2ED1 A;  4E6R A;  4Y92 A;  5I11 A;  2J05 A;  4HVW A;  2BZX A;  2ROT A;  4LN2 A;  5HCK A;  4Z89 A;  2CUD A;  1WA7 A;  2F2V A;  2O31 A;  1M3C A;  2DBK A;  2VWF A;  1I07 A;  2DM1 A;  2JS2 A;  1AZE A;  4D8D A;  2LQW A;  5IXB A;  2L3S A;  2SEM A;  3NGP A;  1UJY A;  1X69 A;  2KXD A;  1WXT A;  2FPD A;  2M51 A;  3TSW A;  2DYB A;  3EGU A;  2EGA A;  1YN8 A;  2KEA A;  1RUW A;  3TSZ A;  3QWX X;  4JJC A;  2LMJ A;  1KSW A;  4CC2 A;  2A28 A;  4OMN A;  1VYT A;  5GJV B;  5FWB A;  2QDL A;  2M0Y A;  1PNJ A;  1JO8 A;  3O5Z A;  1WIE A;  1YCS B;  2CSI A;  2DX1 A;  2DVJ A;  1AD5 A;  2HSP A;  4CC7 A;  2NUZ A;  2GGR A;  2RQU A;  2D0N A;  1UG1 A;  3I5S A;  1OV3 A;  2KRN A;  3KFV A;  2JS0 A;  4JJB A;  2KT1 A;  1X43 A;  1YWP A;  3GBQ A;  4HXJ A;  4IIO A;  2LQN A;  1FMK A;  2L0A A;  2YDL A;  2RN8 A;  3EHR A;  2EVR A;  1UEC A;  4HCK A;  2LCS A;  3LH5 A;  1ZUK A;  2EYW A;  1N5Z A;  1NEG A;  2C0I A;  2E5K A;  1B07 A;  2VKN A;  2ECZ A;  2CH4 A;  4AFU C;  1AWX A;  1J3T A;  2LZ6 B;  4HVU A;  2ENM A;  2FPE A;  1SEM A;  4RTT A;  1EFN A;  1BBZ A;  3NPF A;  2EPD A;  4A63 B;  1ARK A;  4IIM A;  3THK A;  3UAT A;  2KE9 A;  2EBP A;  2JM8 A;  2EYY A;  3EHQ A;  4EIK A;  2CT4 A;  2RF0 A;  3RBB B;  2DRM A;  1WFW A;  2K7A A;  2EGE A;  1AZG B;  4ESR A;  4JJD A;  2F2X A;  1QLY A;  1CSK A;  2GQI A;  3VS6 A;  1RLP C;  1NYG A;  2AKL A;  1SHF A;  4RTX A;  1ZUY A;  2C0T A;  1VYU A;  1SPK A;  4GBQ A;  4OML A;  5IHN A;  3EG0 A;  2EYZ A;  2P4R A;  3H41 A;  3CQT A;  3VS4 A;  2I0N A;  2GNC A;  1U3O A;  4M4Z A;  1NEB A;  2KGT A;  3NMZ C;  2YUO A;  2RQT A;  1OOT A;  3FJ5 A;  1BK2 A;  2CRE A;  2JW4 A;  1M3A A;  1OEB A;  1UHF A;  2X3W D;  2JMA A;  4J9H A;  1W6X A;  2YUQ A;  3SEM A;  2DL4 A;  1PRL C;  4QT7 A;  1ABQ A;  4AG1 C;  2AKK A;  2BZY A;  2KXC A;  2C0O A;  2K6D A;  2DL5 A;  1W70 A;  3VRY A;  1U06 A;  3SHW A;  1KFZ A;  4J9F A;  1BU1 A;  2CDT A;  1SSH A;  2LNH B;  2IIM A;  1GCQ A;  1AWJ A;  1K9A A;  2DA9 A;  4OMP A;  1G2B A;  1UE9 A;  3R6N A;  1NLO C;  2HDA A;  2EW3 A;  2W10 A;  1FYN A;  2DRK A;  2DJQ A;  2EQI A;  1ZBJ A;  5IHI A;  3EG3 A;  1UHC A;  2LJ0 A;  4RTV A;  2PTK A;  1UJ0 A;  2CT3 A;  2FEI A;  2YT6 A;  2J6O A;  1PKS A;  1T0H A;  2AK5 A;  1T3S A;  2KYB A;  4OMO A;  4J9E A;  2K2M A;  3M0Q A;  2BTT A;  1KJW A;  2JMC A;  2JTE A;  3M0U A;  1HSQ A;  2KRM A;  1V1C A;  1JEG A;  3QWY A;  1G83 A;  4WCI A;  2K3B A;  4CC3 A;  3VS5 A;  1B3Q A;  2FRW A;  1ZUU A;  3ULR B;  1ABO A;  2GTO A;  4RTW A;  1CKA A;  2XMF A;  3I9Q A;  4JPB W;  2DL7 A;  3VS1 A;  2YUP A;  1U5S A;  4RUG A;  1PHT A;  4Z8A A;  3UA7 A;  1AWO A;  2L3Q A;  1X2K A;  1Y57 A;  1K1Z A;  2HCK A;  3UA6 A;  3ZL7 C;  2AZV A;  1K0X A;  2EGC A;  4J9B A;  1I0C A;  1QWF A;  2HBW A;  2DLP A;  2D8H A;  1UTI A;  5IXF A;  2FG0 A;  1K0S A;  1H92 A;  1UFF A;  2YSQ A;  2FO0 A;  5EC7 A;  2JXB A;  1QCF A;  2EKH A;  4CC4 B;  4LE9 A;  4AFS C;  3U23 A;  1QWE A;  1JXO A;  2RPN A;  2V1R A;  3H0H A;  3M0P A;  2PZ1 A;  2DF6 A;  2MCN A;  1SRM A;  1I1J A;  2O9V A;  1AWW A;  2DIL A;  1Z9Z A;  5IHK A;  4X1V A;  2MOX A;  2J6K A;  1SHG A;  1K4U S;  4FSS A;  2DL8 A;  1GCQ C;  2GTJ A;  1WDX A;  3M0R A;  1X27 A;  2PNI A;  2LJ1 A;  3VS3 A;  1UDL A;  1T3L A;  1JQQ A;  2DL3 A;  3M0T A;  2SRC A;  1NLP C;  4J9I A;  2KRO A;  2LJ3 A;  2ROL A;  1GFD A;  5L23 A;  2O88 A;  1Y0M A;  2ABL A;  1T0J A;  2O9S A;  4J9C A;  2G6F X;  2ESW A;  4JZ4 A;  4F14 A;  2NWM A;  2AZS A;  2X3X D;  1PWT A;  2CUB A;  4R0K A;  1AVZ C;  2RQR A;  1JXM A;  2L2P A;  5FW9 A;  4K11 A;  2A08 A;  1WYX A;  1GRI A;  2L3P A;  2RMO A;  1TUC A;  1E6G A;  1PKT A;  1E6H A;  2MIO A;  2F2W A;  4RTU A;  3VS0 A;  1MUZ A;  1GCP A;  2A37 A;  3A98 A;  2OI3 A;  3VS7 A;  2FRY A;  1X6G A;  2CH4 W;  2CSQ A;  1HD3 A;  2KYM A;  2W0Z A;  3VS2 A;  2J06 A;  3PVQ A;  2DNU A;  4F16 A;  1WXU A;  3PVL A;  1M30 A;  1TUD A;  5FWC A;  3UF4 A;  1E7O A;  4ORZ A;  1S1N A;  3REA B;  2KNB B;  1UGV A;  4DEX A;  1AOJ A;  2BZ8 A;  4J9D A;  1A0N B;  1QKW A;  1SRL A;  1M27 C;  2KRS A;  1NM7 A;  2FPF A;  4AFZ C;  2A36 A;  4GLM A;  4RTZ A;  1HJD A;  1W1F A;  3NHN A;  2DE0 X;  5GJW B;  2DBM A;  2J6F A;  1XOV A;  2D8J A;  4LUD A;  4F17 A;  2GBQ A;  1ZLM A;  3PE0 A;  2J7I A;  4KRT A;  1GBR A;  2D1X A;  1H8K A;  3C0C A;  1QKX A;  1CKB A;  1AEY A;  1WX6 A;  3IQL A;  1VA7 A;  1X2Q A;  2B86 A;  1OPK A;  2OAW A;  1LCK A;  1RI9 A;  3TVT A;  4OMM A;  5IH2 A;  1H3H A;  1KIK A;  4OMQ A;  2JT4 A;  2KBT A;  4ZNX A;  2K9G A;  2RQV A;  1IO6 A;  2EYX A;  3EG1 A; 
#chains in the Genus database with same CATH topology
 4C0Z A;  1BCM A;  1VQ6 Q;  3CCS A;  2X4W A;  2LCL A;  2RNA A;  3VUZ A;  4XAX B;  3CCE T;  3G4S T;  1RLQ C;  2YWW A;  1WXB A;  2YUN A;  1NYF A;  1NE8 A;  4RTY A;  1LPL A;  2KR3 A;  1G3T A;  3LWI A;  2YXY A;  1M1K U;  3M0S A;  4GY5 A;  5KYU A;  4EMK C;  1KQ1 A;  1YNZ A;  3RKW A;  4YTL A;  4LDY A;  3MEU A;  4HCC A;  1YWO A;  1KC8 R;  3REB B;  5HK0 A;  2DVE A;  4RKU E;  2B8A A;  5GAO p;  2DYI A;  1ZSZ C;  5CO7 A;  1OX9 A;  2WAC A;  8AT1 B;  3NTI A;  3QYH B;  2BUD A;  1KQ2 A;  2L5Q A;  1JJ2 A;  3MCA B;  3C4S A;  4Z88 A;  3TQ7 P;  1ZQ1 A;  4GLK A;  4XTU A;  2J05 A;  4Z89 A;  5HCK A;  3OYN A;  4E7J A;  2O31 A;  1LOJ A;  3UT1 A;  2DM1 A;  2JS2 A;  4PJO C;  4D8D A;  2LQW A;  1NJI R;  2HMA A;  2DXT A;  1X69 A;  2GQV A;  5J3B A;  1QVF P;  2FZK B;  1OU9 A;  1NBE B;  1Q7Y U;  3TSW A;  2QQ9 A;  2DJZ A;  1U1S A;  4R56 A;  2EGA A;  5GAO n;  2C06 A;  3QWX X;  4L6V 5;  1VQ6 A;  2KK4 A;  3KXT A;  4OMN A;  3JB9 I;  1ACM B;  4DBF A;  5J26 A;  5FWB A;  2M0Y A;  3EGX A;  4KBM B;  1JO8 A;  3E9F A;  2P0P A;  5A0D A;  2HL5 C;  2LCC A;  3CCM A;  2EQM A;  4N4H A;  2AHJ B;  2YHT A;  1WHJ A;  1XTD A;  1OV3 A;  3QJ6 A;  2BE9 B;  3KFV A;  4XTX A;  5AT1 B;  1YWP A;  4PNO A;  3HTR A;  1Q81 R;  2RN8 A;  4BDY A;  2AT1 B;  1R0C B;  2DEU A;  1WHL A;  2C0I A;  2VKN A;  2DEQ A;  1OZ2 A;  2OTJ A;  4FYY B;  3CCV T;  4HVU A;  4M7A C;  2KQW A;  1M90 C;  2IVW A;  2EPD A;  3NPF A;  4M78 B;  4A63 B;  4QQG A;  3QPH A;  4IIM A;  2EBP A;  1QP2 A;  5FLX E;  3CPF A;  4EIK A;  3J81 E;  2CT4 A;  3I55 A;  2K7A A;  3CEY A;  2EGE A;  2DPP B;  3INZ A;  1H64 1;  2NUP B;  5CKH A;  1RLP C;  5GAN 3;  1NYG A;  2RHI A;  3ASK A;  1M4Z A;  5GAN 2;  3CCS T;  1ZUY A;  3MKD A;  1VYU A;  1SPK A;  4GBQ A;  2DD5 A;  4M77 D;  3BDU A;  5HY6 A;  1DJ7 B;  3CCJ A;  4KUL A;  4B6M A;  1I4K 1;  2P4R A;  3H41 A;  4PJO G;  3CQT A;  5KH6 A;  2V8I A;  5DY9 A;  3G71 Q;  4M4Z A;  3X24 B;  1VQ7 Q;  1Q82 U;  2RQT A;  4RG8 A;  3M57 A;  3CPW A;  2E1H A;  3MP6 A;  3JCM P;  3OYL A;  4C5H A;  3EGD A;  2CRE A;  1R77 A;  1M3A A;  1PD1 A;  1YJ9 Q;  3OW2 S;  3OS1 A;  1W6X A;  1HYO A;  2QTV A;  4N4G A;  2AKK A;  3CBM A;  1AHJ B;  2KXC A;  4XU1 A;  4QKU A;  4B9X A;  2MI6 A;  3I56 Q;  3V7R A;  4FIB A;  2LNH B;  2IIM A;  4Z02 A;  1AWJ A;  3R6N A;  1UE9 A;  1S72 A;  2ZPF B;  4KGZ B;  1TSF A;  4BDZ A;  1FYN A;  3HKS A;  4A4F A;  1Q95 G;  3G1J A;  4PFP A;  2LJ0 A;  2PTK A;  4M7D A;  2YT6 A;  3A8H B;  2CP2 A;  1T3S A;  5CCA A;  1YCY A;  1K73 U;  1YJW Q;  2K2M A;  2BTT A;  4FYW B;  4ELY C;  2KRM A;  4O6J A;  4C5E A;  4CC3 A;  2RHU A;  1ZUU A;  1EX4 A;  2E4H A;  3GNF B;  4RTW A;  5GMK l;  3I9Q A;  3OMG A;  5L8R E;  3M53 A;  3CCL Q;  1U5S A;  2CP3 A;  3FDR A;  4PJO D;  3VYG A;  4J83 A;  2L3Q A;  3OMC A;  2K57 A;  3CCM T;  2ZPI B;  3V8J A;  3OS2 A;  4KUD K;  2M16 A;  4C0G A;  3OYE A;  1D0Y A;  1UTI A;  4FU6 A;  3QYG B;  4MDW A;  3L2R A;  5A2Q E;  3CBO A;  3LGL A;  1YJ9 A;  2FZC B;  4FT2 A;  1H92 A;  1KHC A;  3JB9 G;  4LE9 A;  4AFS C;  3U23 A;  2E41 A;  3CCE Q;  3G4S Q;  2V1R A;  3M0P A;  2KDS A;  2ATC B;  2XK0 A;  2OTJ T;  4N0A A;  1UGR B;  4XTZ A;  2MOX A;  1SHG A;  3KBG A;  3ME9 A;  2DL8 A;  2GTJ A;  1WDX A;  4PFZ A;  4FYX B;  5GAN e;  3O8V A;  1UDL A;  4E7S A;  4M75 C;  3I55 T;  2RHX A;  2HSE B;  4VUB A;  5L23 A;  1YJW A;  1Y0M A;  2ABL A;  1K9M C;  2G6F X;  1C1A A;  4RMO A;  5GAN h;  3CCJ T;  1BI1 A;  3NTH A;  1GRI A;  4PK4 A;  3CXC P;  1OUL A;  1PKT A;  3FRN A;  3QDF A;  5LL6 S;  1VQM A;  2F2W A;  1KC8 U;  3BDL A;  1YBY A;  4RTU A;  3A98 A;  4FM4 B;  3VS7 A;  2F1L A;  2CP6 A;  4M77 B;  1X01 A;  2MWO A;  2EAY A;  2DNU A;  4F16 A;  2XHC A;  2RM4 A;  4M7A E;  4R55 A;  2YRD A;  3UF4 A;  5GAN j;  5CKB A;  2BZ8 A;  1PC0 A;  1QKW A;  4F7U E;  2KRS A;  1OI1 A;  2FPF A;  2ZPG B;  1W1F A;  3JB9 D;  2WSE E;  2X4J A;  4PJO F;  4LD6 A;  3OYH A;  3H9N A;  2GBQ A;  5LJ3 g;  1D1A A;  5D6Y A;  3G4S A;  4C92 D;  5LJ3 h;  1S72 T;  5KE3 A;  3X28 B;  1NJI U;  2NUT B;  3BY7 A;  3IQL A;  4C8Q G;  2B86 A;  3CD6 Q;  1OPK A;  2DTH A;  2OAW A;  5GAO l;  1XJW B;  3QII A;  1KIK A;  5LJ5 d;  2FB7 A;  1QVF S;  4ZNX A;  1KQS S;  1N8R C;  2K9G A;  2E6N A;  1KD1 R;  3PFS A;  3S3N A;  2V8K A;  5LJ5 e;  2EIF A;  2V1Q A;  3H0I A;  3I5R A;  1UGS B;  2A3L A;  1ZSG A;  3JV3 A;  4AT1 B;  4J6X A;  2KT8 A;  3CCV Q;  4DEY A;  5GAN 6;  3OBY A;  1TOV A;  3DKM A;  3BW1 A;  2K4Y A;  3ZFJ A;  4P5N A;  5FU7 C;  5GAM d;  1Q81 U;  5FRN A;  4XU2 A;  2HEQ A;  1GL5 A;  4FL6 A;  2L89 A;  1TH7 A;  4HVV A;  5GAM e;  4PJO B;  4E2F B;  1F1B B;  4C0F A;  3I35 A;  3S6W A;  3CCS Q;  2YLB A;  1D09 B;  4PLI A;  1WLP B;  2ED0 A;  4Y28 E;  5LJ5 j;  4PJJ A;  5CK9 A;  3JCM e;  1BB9 A;  3HHT B;  1Z9Q A;  3H0F A;  3GF5 A;  1OPL A;  1VQP T;  2VXE A;  1M2V B;  3SWN C;  4EMG A;  3C95 A;  2BZX A;  1N9S A;  2RHY A;  5LJ5 f;  1WA7 A;  3VKI A;  1BIA A;  2DBK A;  4B9W A;  1OYX A;  1I07 A;  1BIB A;  2JUF A;  2DD4 A;  4C8Q D;  3HP9 A;  5IXB A;  1KHI A;  3L2Z A;  2VV5 A;  3CD6 A;  1WGS A;  2PUO B;  2FL7 A;  1UJY A;  4M78 A;  1HXD A;  2KXD A;  4BE0 A;  4RCB A;  2FPD A;  1R0B G;  4XK8 E;  2ZCF B;  2DYB A;  3EGU A;  4PJN A;  3HRS A;  4NS5 A;  3P8D A;  1IZ6 A;  1YN8 A;  3ZEH A;  1RUW A;  3TSZ A;  1JJ2 P;  1IRE B;  4JJC A;  1KSW A;  2R5A A;  2E6Z A;  5I2S A;  2K5L A;  4N4I A;  1VYT A;  5GJV B;  2NUP A;  1YIJ Q;  2EWN A;  2YRC A;  1QW1 A;  5GAM f;  1WPY A;  1Y96 B;  4A53 A;  5KCO A;  3O5Z A;  1Y71 A;  3CCV A;  2COW A;  2P4T A;  3HFN A;  1VQM T;  4CRI A;  4E7K A;  3MEV A;  2H3J A;  2NUZ A;  1D0X A;  5HKC A;  2GGR A;  2CKK A;  1TS9 A;  1PD0 A;  2RI5 A;  5KYN A;  3CCQ A;  2D0N A;  1UG1 A;  1KD1 C;  2KRN A;  1Q86 U;  2COZ A;  2LQN A;  2X4Y A;  1ZBX A;  3EH1 A;  2JVV A;  2EQK A;  2LCS A;  1ZUK A;  1BCO A;  1J3T A;  4AFU C;  2K5I A;  4FT4 A;  4M75 E;  2DER A;  4M78 E;  2QAS A;  2ENM A;  1I8F A;  4LDW A;  3FJP A;  3A8L B;  4RTT A;  1EZZ B;  2LT1 A;  4O5V A;  3OYF A;  2KE9 A;  1IRX A;  3CCM Q;  3R6O A;  1YI2 T;  3EHQ A;  1M90 R;  5CR2 A;  1D3B A;  4HT9 A;  3RBB B;  2DRM A;  3FIF A;  2VUB A;  4C92 B;  1AZG B;  2NYS A;  4ESR A;  1K8A U;  1OX8 A;  2P84 A;  5KE2 A;  1CSK A;  3VS6 A;  1VQK A;  3L2V A;  5D6W A;  1MHN A;  2A7Y A;  2R58 A;  3FEO A;  2C0T A;  3M54 A;  2E65 A;  4E47 A;  3G7Z A;  4NL2 A;  5IHN A;  3EG0 A;  5M9O A;  2M1H A;  2QXF A;  5HK3 A;  2OTJ Q;  4BY6 B;  3VS4 A;  4EMH A;  1YIJ A;  2I0N A;  4C8Q F;  2JN0 A;  2RJE A;  4ZN3 A;  2GNC A;  4DBH A;  1O75 A;  3NMZ C;  1VQL A;  2FZG B;  1OOT A;  2OTL Q;  1M9S A;  3OSV A;  1RL2 A;  3T9N A;  3I55 Q;  3LLR A;  4J9H A;  2YUQ A;  3LYI A;  3SEM A;  2D0Q B;  2DL4 A;  1PRL C;  4AG1 C;  4KH1 B;  2K5F A;  2BZY A;  2O4X B;  4ZGE B;  4J9F A;  4KGV B;  1V76 A;  3A8O B;  4ZTJ A;  1GCQ A;  5GMK i;  2E12 A;  2HQX A;  3FLG A;  3CCJ Q;  2EW3 A;  5CAI A;  3JB9 H;  3CBP A;  2HL3 A;  4M75 F;  2DRK A;  3CCU Q;  2DJQ A;  5IHI A;  2MK5 A;  2KAF A;  3CPW P;  1UJ0 A;  7AT1 B;  2LTO A;  3SB2 A;  4D6W A;  2J6O A;  2OAU A;  1T0H A;  4ZGD B;  3CD6 T;  1G3Y A;  4J7I A;  3UPU A;  4OMO A;  4JUV A;  5GAN 5;  2PUK B;  4A54 A;  4Q5W A;  4OB0 B;  3J7A F;  2RD1 A;  3EFO B;  1HSQ A;  4HCZ A;  3E1S A;  3KUF A;  5CKF A;  1V1C A;  4C8Q B;  2JTF A;  3QWY A;  1G83 A;  3OYB A;  1VQ9 T;  1VQ5 Q;  1B3Q A;  1H3Z A;  3CXC S;  1S72 Q;  3M58 A;  1NPP A;  2DZC A;  1RAD B;  5IN1 A;  1D0Z A;  1VIE A;  4Z8A A;  1AWO A;  1QCO A;  3TCJ A;  4DBQ A;  2K2V A;  4N0A C;  1RAG B;  3F70 A;  4BUG A;  1K1Z A;  3UA6 A;  2RJD A;  1K0X A;  2MYS A;  1IGQ A;  2HBW A;  2MMP A;  2OTL A;  3CMA T;  3OS0 A;  3LW5 E;  2QGF B;  3CCQ T;  2D8H A;  2GFU A;  3QHS A;  3MET A;  2Z0W A;  2DET A;  2EQU A;  4M77 A;  4DOW A;  1UFF A;  1NPR A;  3NFC A;  2JXB A;  2EKH A;  5J39 A;  3JCM X;  1RAA B;  1JXO A;  2RPN A;  1SRM A;  1AWW A;  3SDZ A;  2DIL A;  3JSC A;  1Z9Z A;  4BE2 A;  5IHK A;  2JNG A;  5EG2 A;  3MP8 A;  1WQ7 A;  3V7C A;  4FSS A;  3OYD A;  3CCU A;  1XQH A;  4OB3 B;  2DXB A;  5GMK m;  3X26 B;  2QTX A;  3M0R A;  2RK2 A;  2NUT A;  1QVF A;  1KQS A;  1W2B P;  4FYV B;  2DIG A;  2DL3 A;  4J9I A;  2LJ3 A;  1GFD A;  4MMK A;  1VQK T;  1I5L A;  3M55 A;  1IGU A;  4KH0 B;  2KSS A;  2O9S A;  2AZS A;  1PWT A;  1VQN T;  1AVZ C;  2Y4Y A;  4DQ2 A;  1VQP Q;  1K9M R;  2RMO A;  2L3P A;  1VQ5 A;  1YIJ T;  3L42 A;  1UB4 A;  4M77 E;  3D7S B;  2FVU A;  2OI3 A;  1VQL T;  2CSQ A;  2ZPB B;  2X35 A;  2KYM A;  3EFS A;  1WXU A;  1TUD A;  2P0Q A;  1E7O A;  1M8V A;  2ZZD A;  2A36 A;  1YHQ T;  2PVD B;  2DZ9 A;  3FC3 A;  1BI0 A;  4PJO A;  2RI3 A;  4M7A G;  2DE0 X;  2DBM A;  2J6F A;  2D8J A;  2RJF A;  1YIT A;  1UEB A;  1BKB A;  2DAQ A;  1GBR A;  2CZ0 B;  2D1X A;  2DTO A;  1CKB A;  1AEY A;  4F7U G;  1WHG A;  1VQM Q;  1M2V A;  1N27 A;  2X9H A;  4DOV A;  1RI9 A;  4OMM A;  1RAH B;  5IH2 A;  2PVG B;  4OMQ A;  2DK3 A;  2JT4 A;  5FU6 B;  3DLL A;  3M9Q A;  2OJ2 A;  1RI0 A;  2XKO C;  1JJ2 S;  1N8R R;  4LNP A;  2Y90 A;  1BI3 A;  3GNG A;  4D8K A;  3M59 A;  4AFQ C;  2HQH A;  3HL8 A;  1UUE A;  1VOM A;  4M7D E;  5I22 A;  3FB9 A;  1VQP A;  4JZ3 A;  1VYV A;  2MAM A;  4MZP A;  1FXX A;  1K76 A;  1NG2 A;  2VB6 A;  1Y96 A;  1YI2 Q;  3SWN B;  1X75 C;  5GAN d;  3E9G A;  1IHW A;  4F04 B;  2HKQ B;  5GMK h;  4L5G A;  2K79 A;  1MV0 B;  1ZX6 A;  2OTL T;  2VVK A;  4PFO A;  1WI7 A;  1ZA1 B;  2O2O A;  1QVG S;  2RJC A;  4PKC C;  5GAO m;  1AT1 B;  4M78 C;  2X51 A;  4AG2 C;  4RG2 A;  3DLM A;  3VUB A;  5I11 A;  4M7A D;  5GMK j;  2KVQ G;  3WVE B;  1QCN A;  1M3C A;  1M90 U;  1N6A A;  2X4X A;  1I81 A;  3CCU T;  3S3M A;  3ER0 A;  3E19 A;  3OBW A;  1YJN T;  1U8R A;  1Y07 A;  3OB9 A;  2KMT A;  5LJ3 e;  3M4Y A;  5D7U A;  1WJR A;  1IXD A;  1VQ4 T;  3TEE A;  3RMQ A;  4C92 A;  4C0D B;  2A28 A;  3JAM E;  4FCY A;  5GAN f;  1PNJ A;  3OS5 A;  2CZ1 B;  1VQ5 T;  4X9C A;  2VAS A;  4XU0 A;  2GFA A;  2F5K A;  3CC4 A;  1XNI A;  1YCS B;  1B34 B;  2CSI A;  2VYT A;  2DVJ A;  2LNV A;  4CC7 A;  3CME T;  2RQU A;  1YI2 A;  4X34 A;  2JS0 A;  2XDP A;  1QVP A;  2DTI A;  3DB3 A;  4JJB A;  2KT1 A;  4QW2 A;  1X43 A;  5I2M A;  3GBQ A;  4HXJ A;  2YDL A;  4EMK B;  4JS4 A;  3P8B B;  2QEX A;  4OF1 A;  3LH5 A;  5LJ3 j;  3RDV A;  4OGC A;  2EYW A;  1N5Z A;  1NEG A;  2DXU A;  4BI3 A;  1VQ9 Q;  3BE3 A;  3CCR A;  2ECZ A;  1AWX A;  2JZ2 A;  2LZ6 B;  4FW1 A;  2O4X A;  1YIT T;  1LVK A;  1ZSZ B;  1D1C A;  3RER A;  1TWB A;  3EFR A;  3V8L A;  1BBZ A;  1ARK A;  5DLO A;  3UAT A;  3CPW S;  1LNX A;  2JM8 A;  2L8D A;  5KYW B;  4C92 E;  2DFU A;  3PMI A;  5A0G A;  2QI2 A;  4M75 G;  2RF0 A;  3CMA Q;  4M78 G;  2L3R A;  3CCQ Q;  5I21 A;  1MMA A;  2V8J A;  1FMW A;  1Q7Y C;  4JJD A;  2CYZ B;  1B7T A;  2ZPH B;  3ZBD A;  2GQI A;  1QQJ A;  3OQ5 A;  3EH2 A;  4BE1 A;  1O9S A;  1G3W A;  1G3S A;  2AKL A;  5GAN 7;  3Q1J A;  2JTM A;  4RTX A;  4M7A F;  1LJO A;  2XG8 D;  4EPC A;  4J6W A;  3JCM d;  2EYZ A;  3N5B B;  3JCM V;  4F7U F;  3EFO A;  3CC7 T;  4C8Q A;  3PNW C;  2WSC E;  3CC2 T;  1TTH B;  1ZHI A;  1VIF A;  2DIQ A;  2DXC A;  1KK7 A;  4OMF B;  4WTO B;  3NTK A;  1BK2 A;  1UHF A;  2IPO B;  2X3W D;  2JMA A;  1ABQ A;  3LX7 A;  1PSF A;  1VQK Q;  3QUI A;  3PTA A;  4JRQ A;  5FRO A;  2K6D A;  2DL5 A;  1W70 A;  3VRY A;  3EAE A;  1ZA2 B;  3GLX A;  3SHW A;  1KFZ A;  2CDT A;  1SSH A;  2EJG A;  9ATC B;  5KYX B;  1VQN Q;  1V29 B;  1K9A A;  2DA9 A;  1VQO A;  4OMP A;  2LQ8 A;  4BI8 B;  2HDA A;  1SSF A;  1VQ9 A;  4JS5 A;  3P8H A;  4LDV A;  5A0L A;  5CQX A;  3GIB A;  2PU9 B;  3EG3 A;  1VQL Q;  4JLG A;  4RTV A;  3V8K A;  2CT3 A;  2FEI A;  4OVA A;  2AK5 A;  1W2B S;  4NL3 A;  2KYB A;  4XTW A;  3JCM f;  2R5M A;  4M75 D;  4M7A B;  4XQ3 A;  3CMA A;  3OW2 A;  4J9E A;  2H3E B;  1I5O B;  4PL6 A;  3JCM W;  2F69 A;  2LVM A;  4IKF A;  3A5Z B;  2JMC A;  4F7U B;  5IAY A;  4E7I A;  1K9M U;  4J5Y A;  1YHQ Q;  4L59 A;  4WCI A;  4M77 C;  2K3B A;  3M56 A;  3VS5 A;  2FRW A;  2KI7 A;  1ABO A;  2GTO A;  2XMF A;  4II1 A;  3EG9 B;  4JPB W;  4XTY A;  1C0M A;  2DL7 A;  1WZO A;  2YUP A;  3VS1 A;  1PHT A;  3CC4 T;  5DM7 R;  4XU3 A;  4DBR A;  1Q82 C;  3RKX A;  1X2K A;  1Y57 A;  1FMV A;  2VGN A;  3PMT A;  2HCK A;  2IG0 A;  4Y91 A;  2AZV A;  1I0C A;  3QZ9 B;  4LD9 K;  3A8G B;  2XID A;  5C6S A;  3DB4 A;  2E70 A;  4KUI A;  2LRQ A;  3AHU A;  1G5V A;  3H8Z A;  1K0S A;  2V26 A;  5EC7 A;  4JRP A;  1QCF A;  2QEX T;  4CC4 B;  3M4G A;  3OA6 A;  3CCR T;  5CKE A;  2MCN A;  1R8O B;  1I1J A;  2EKO A;  1VQN A;  4OB1 B;  3VYH B;  4FSX A;  1VUB A;  1X6O A;  4X1V A;  3E2U A;  3JB9 J;  2J6K A;  4TVR A;  2JJ9 A;  1MNE A;  1OU8 A;  1K4U S;  2ZPE B;  3HRT A;  1SKU B;  2RB6 A;  2PNI A;  2LJ1 A;  3VS3 A;  3OYI A;  1T3L A;  1K73 C;  1JQQ A;  1N8R U;  3G6E A;  3M0T A;  1VQ8 T;  1TU0 B;  2XDB A;  2SRC A;  1NLP C;  2ROL A;  4MDX A;  2QQR A;  2HZY A;  2JOY A;  4M7D C;  2EFI A;  1RAE B;  1FX7 A;  3OYY A;  4PLL A;  5AYF A;  4F14 A;  2NWM A;  2VXF A;  2HNI A;  3MO8 A;  1YHQ A;  4FW2 A;  1JXM A;  2L2P A;  3RMS A;  4K11 A;  1WYX A;  2RI2 A;  3RKY A;  2XU8 A;  2MIO A;  1PSE A;  3VJP A;  1TXQ A;  1PG5 B;  3VS0 A;  2A37 A;  2QDY B;  1WJQ A;  4A4K A;  1WJS A;  2FRY A;  3TU4 K;  4M78 F;  1KQS P;  2W0Z A;  3X20 B;  3PVQ A;  1RAI B;  2VGM A;  3QO3 A;  3PVL A;  1QVG A;  5FWC A;  4ORZ A;  1S1N A;  1YJN Q;  3REA B;  4M77 G;  3SWN A;  5KCH A;  2KNB B;  4DEX A;  1AOJ A;  1A0N B;  1SRL A;  1M27 C;  1VQ4 Q;  2PVO B;  4GLM A;  4RTZ A;  2HBP A;  1HJD A;  2E3I A;  3HPW A;  5GJW B;  2ZGW A;  4IUV A;  1VQO T;  4F17 A;  3AT1 B;  4LUD A;  4LDU A;  4RCC A;  3M5A A;  2J7I A;  4KRT A;  2QYZ A;  1QKX A;  1SF9 A;  4IUQ A;  1VA7 A;  1X2Q A;  4QVC A;  2R57 A;  2NLU A;  3TVT A;  4OP0 A;  3CME Q;  1H3H A;  2PQW A;  4X9D A;  2RQV A;  1WHK A;  1UGP B;  5GAO q;  4JJN K;  2QA4 T;  2RQW A;  2I2L A;  5ECA A;  2CP0 A;  1M3B A;  3GPL A;  1X6B A;  4A4H A;  1YP5 A;  2RHZ A;  1GFC A;  2AIR B;  1M8M A;  4M75 B;  1YIT Q;  2A0F B;  1GBQ A;  3JCM c;  1MND A;  3HRU A;  3X25 B;  1KC8 C;  2XDD A;  3VRZ A;  1EIF A;  2D6F A;  4ME7 A;  4E7Z A;  2CZ7 B;  2H8H A;  1KD1 U;  4M7D G;  1B34 A;  1JU5 C;  2JM9 A;  1JB0 E;  4LUE A;  1PRM C;  2LX7 A;  3RNJ A;  2DMO A;  3EG2 A;  4CI0 C;  1MV3 A;  4HCB A;  2CGH A;  3RES A;  3MPU B;  4LXC A;  3OYA A;  3PIP A;  1YJN A;  4QQ6 A;  1TG0 A;  2LP5 A;  1VQ4 A;  3JCM b;  4J9G A;  4V2S A;  2ED1 A;  8ATC B;  4E6R A;  4EMK A;  4Y92 A;  3MP1 A;  3VV0 A;  4HVW A;  4LN2 A;  2ROT A;  4C92 C;  3CC7 Q;  2M02 A;  3CC2 Q;  2CUD A;  2F2V A;  4ATO A;  1MMD A;  2QQA A;  1NJI C;  5KYY B;  3L2Q A;  2VWF A;  2LQK A;  1AZE A;  2O01 E;  3JCM Q;  5CQY A;  1ZSZ A;  2BIV A;  2EJF A;  2XD0 A;  2L3S A;  2SEM A;  5CKD A;  3NGP A;  3CME A;  1WXT A;  1PM3 A;  2BE7 D;  4BY6 C;  2M51 A;  3G6E T;  5KYW A;  3MJX A;  5GAO r;  1D1B A;  3BFM A;  1Q86 R;  2QK0 A;  4WF2 A;  2KEA A;  3OYG A;  1HK9 A;  1G8X A;  3LGF A;  2LMJ A;  4MML A;  3S3O A;  2EYQ A;  3SD4 A;  2E5Q A;  4CC2 A;  4JRI A;  4MZT A;  5KYU B;  1MMN A;  2QDL A;  3GOX A;  1D3B B;  1N9R A;  1MMG A;  4KT0 E;  4A4E A;  1WIE A;  2DX1 A;  1AD5 A;  2HSP A;  2EJ9 A;  3SFM A;  1M1K R;  3C94 A;  1WNL A;  3I5S A;  1Q81 C;  3URG A;  2MF2 A;  2E64 A;  4M7D D;  1RAB B;  2HD0 A;  4IIO A;  3L2W A;  1K8A R;  1FMK A;  2L0A A;  1VQ6 T;  3L1A A;  3MHX A;  3EHR A;  2EVR A;  1WHH A;  1UEC A;  4E7L A;  4HCK A;  4ANJ A;  4KGX B;  2E5K A;  5FU7 B;  1B07 A;  2CH4 A;  3TRE A;  5GMK e;  3LWH A;  1OZ3 A;  2FPE A;  3UWN A;  3G71 A;  1SEM A;  5KYX A;  1EFN A;  4OGE A;  3CC4 Q;  3CC7 A;  1VQ7 A;  3CC2 A;  2CP7 A;  3THK A;  4C8Q C;  2EYY A;  1W2B A;  3LH0 A;  1M1G A;  1WFW A;  4M77 F;  2M9U A;  4PJO E;  3UDC A;  2F2X A;  5C0M A;  1QLY A;  1M1F A;  3EGX B;  1SHF A;  1TUG B;  4IUU A;  4C92 G;  4HKE A;  3I56 A;  1Q7Y R;  4M7A A;  1UGQ B;  2QEX Q;  1BI2 A;  4OML A;  3CCR Q;  4F7U A;  2HAX A;  1FWZ A;  3V7S A;  1U3O A;  1NEB A;  2KGT A;  4JLI A;  2YUO A;  1SG5 A;  4DA4 A;  3FJ5 A;  3EG9 A;  3OYM A;  2MPX C;  2JW4 A;  1OEB A;  4UC4 A;  1WQW A;  1VQ8 Q;  1Q86 C;  1WHM A;  2Y4X A;  4QT7 A;  5LJ3 d;  2GF7 A;  1RAF B;  2EQJ A;  3PT9 A;  1KG1 A;  2C0O A;  5GAN g;  1U06 A;  3RR6 A;  1BU1 A;  5GAN 8;  3MEW A;  2P0K A;  2K3X A;  4NOY A;  2G3R A;  1G2B A;  4C5G A;  2CS7 A;  1NLO C;  2W10 A;  3CCL A;  2LDM A;  3H6Z A;  4IUR A;  2EQI A;  1ZBJ A;  2QQS A;  3HSB A;  1PCX A;  1UHC A;  2QAZ A;  4M7D F;  2XI9 A;  1M1K C;  1PKS A;  4MZM A;  3J80 E;  2RK1 A;  3M0Q A;  1K8A C;  4BI4 A;  1KJW A;  2JTE A;  2LX9 A;  2BKD N;  3M0U A;  5GAN 4;  1JEG A;  1GXI E;  3CCE A;  4ZN1 A;  5CIU A;  3VU3 C;  3ULR B;  1VQO Q;  1CKA A;  2OX7 A;  3WVD B;  4XTV A;  2VC8 A;  2E3H A;  4RUG A;  2QG9 B;  3EGD B;  4ZTF A;  4IUT A;  2KY9 A;  3QJY A;  3UA7 A;  2CP5 A;  5LJ3 f;  5D6X A;  3ZL7 C;  2EGC A;  4J9B A;  1QWF A;  2DLP A;  1U1T A;  1Q82 R;  5IXF A;  3OW2 P;  2FG0 A;  1MGQ A;  2HQE A;  2QA4 Q;  1VQ8 A;  2YSQ A;  4J8O A;  2COY A;  2FO0 A;  3QBY A;  6AT1 B;  1NZ9 A;  4JRK A;  1QWE A;  3H0H A;  4BAC A;  2PZ1 A;  2DF6 A;  2O9V A;  3MEA A;  3QKJ A;  5LJ5 g;  2ZAE A;  2DKG A;  4EDU A;  5LJ5 h;  4M7D B;  1JRI A;  3CXC A;  3HFO A;  1M5Q 1;  2F5T X;  5FU6 C;  3G71 T;  1JBM A;  4PJL A;  5CVI A;  3PIO A;  1YFN A;  3L2U A;  1Y7X A;  5FRM A;  1VQ7 T;  3QG1 A;  4BB7 A;  4QVD A;  1GCQ C;  4BD3 A;  3OSS C;  1OQK A;  1X27 A;  2WSF E;  1YJ9 T;  2RA2 A;  4OB2 B;  2K3Y A;  2KRO A;  2FYK A;  2LC4 A;  4E7H A;  2O88 A;  4LDX A;  3QZ5 B;  2QGG A;  1K73 R;  1T0J A;  4J9C A;  2ESW A;  4JZ4 A;  3GP8 A;  4C5I A;  3I56 T;  2X3X D;  3OYJ A;  2CUB A;  4J7F A;  4R0K A;  2RQR A;  3QSU A;  5FW9 A;  5GAM g;  2M0O A;  2A08 A;  5GAM h;  1RAC B;  2DO3 A;  1TUC A;  1IB8 A;  1E6G A;  2CZ6 B;  1E6H A;  3QDR B;  3QXE B;  1MUZ A;  1GCP A;  1IHV A;  2E10 A;  3JRZ A;  3JCM g;  1X6G A;  4M75 A;  2CH4 W;  3JCM h;  1HD3 A;  3A8M B;  5IT9 E;  3VS2 A;  1M2O A;  3JB9 F;  2J06 A;  3RUX A;  3WXM B;  2XIC A;  1QMC A;  1M30 A;  4JDS A;  1P92 A;  4IUP A;  3G6E Q;  1YJW T;  4A4G A;  2LT4 A;  4HA8 A;  5GAM j;  3C12 A;  1UGV A;  1C6V X;  4C92 F;  1QP3 A;  4J9D A;  2QQB A;  4M78 D;  3OY9 A;  1NM7 A;  4AFZ C;  4C8Q E;  2QA4 A;  4J6Y A;  2RO0 A;  4ZGJ B;  3NHN A;  3OYK A;  1XOV A;  3JCM J;  1ZLM A;  3OYC A;  4ELZ C;  3PE0 A;  3CCL T;  1H8K A;  3C0C A;  3PGG A;  4AMC A;  4QVZ A;  1WX6 A;  2MWP A;  1W4S A;  2RH2 A;  2YRV A;  5DLQ E;  4C0D C;  1LCK A;  2GCX A;  2HKN A;  4QQD A;  1BYM A;  3A1P A;  3RIR A;  4PJM A;  5KYY A;  4HT8 A;  2YLC A;  2KBT A;  1QVG P;  2D9T A;  1IO6 A;  2FHD A;  2EYX A;  3EG1 A; 
#chains in the Genus database with same CATH homology
 2RQW A;  2V1Q A;  2OJ2 A;  3H0I A;  3I5R A;  5ECA A;  2RNA A;  4LNP A;  1M3B A;  1X6B A;  4D8K A;  1ZSG A;  3JV3 A;  1YP5 A;  4AFQ C;  1RLQ C;  1UUE A;  1GFC A;  1WXB A;  2YUN A;  2KT8 A;  1M8M A;  4DEY A;  1NYF A;  4RTY A;  5I22 A;  1GBQ A;  2KR3 A;  4JZ3 A;  1VYV A;  3M0S A;  1YNZ A;  3VRZ A;  1K76 A;  1NG2 A;  1YWO A;  3REB B;  2H8H A;  2K79 A;  1MV0 B;  1ZX6 A;  2VVK A;  1JU5 C;  2JM9 A;  4LUE A;  2HEQ A;  1GL5 A;  1PRM C;  2LX7 A;  1WI7 A;  3RNJ A;  2DMO A;  2O2O A;  3EG2 A;  4HVV A;  1MV3 A;  3I35 A;  1WLP B;  2ED0 A;  1TG0 A;  4Z88 A;  4AG2 C;  2LP5 A;  1BB9 A;  1Z9Q A;  3H0F A;  4J9G A;  1OPL A;  2ED1 A;  4E6R A;  4Y92 A;  5I11 A;  2J05 A;  4HVW A;  2BZX A;  2ROT A;  4LN2 A;  5HCK A;  4Z89 A;  2CUD A;  1WA7 A;  2F2V A;  2O31 A;  1M3C A;  2DBK A;  2VWF A;  1I07 A;  2DM1 A;  2JS2 A;  1AZE A;  4D8D A;  2LQW A;  5IXB A;  2L3S A;  2SEM A;  3NGP A;  1UJY A;  1X69 A;  2KXD A;  1WXT A;  2FPD A;  2M51 A;  3TSW A;  2DYB A;  3EGU A;  2EGA A;  1YN8 A;  2KEA A;  1RUW A;  3TSZ A;  3QWX X;  4JJC A;  2LMJ A;  1KSW A;  4CC2 A;  2A28 A;  4OMN A;  1VYT A;  5GJV B;  5FWB A;  2QDL A;  2M0Y A;  1PNJ A;  1JO8 A;  3O5Z A;  1WIE A;  1YCS B;  2CSI A;  2DX1 A;  2DVJ A;  1AD5 A;  2HSP A;  4CC7 A;  2NUZ A;  2GGR A;  2RQU A;  2D0N A;  1UG1 A;  3I5S A;  1OV3 A;  2KRN A;  3KFV A;  2JS0 A;  4JJB A;  2KT1 A;  1X43 A;  1YWP A;  3GBQ A;  4HXJ A;  4IIO A;  2LQN A;  1FMK A;  2L0A A;  2YDL A;  2RN8 A;  3EHR A;  2EVR A;  1UEC A;  4HCK A;  2LCS A;  3LH5 A;  1ZUK A;  2EYW A;  1N5Z A;  1NEG A;  2C0I A;  2E5K A;  1B07 A;  2VKN A;  2ECZ A;  2CH4 A;  4AFU C;  1AWX A;  1J3T A;  2LZ6 B;  4HVU A;  2ENM A;  2FPE A;  1SEM A;  4RTT A;  1EFN A;  1BBZ A;  3NPF A;  2EPD A;  4A63 B;  1ARK A;  4IIM A;  3THK A;  3UAT A;  2KE9 A;  2EBP A;  2JM8 A;  2EYY A;  3EHQ A;  4EIK A;  2CT4 A;  2RF0 A;  3RBB B;  2DRM A;  1WFW A;  2K7A A;  2EGE A;  1AZG B;  4ESR A;  4JJD A;  2F2X A;  1QLY A;  1CSK A;  2GQI A;  3VS6 A;  1RLP C;  1NYG A;  2AKL A;  1SHF A;  4RTX A;  1ZUY A;  2C0T A;  1VYU A;  1SPK A;  4GBQ A;  4OML A;  5IHN A;  3EG0 A;  2EYZ A;  2P4R A;  3H41 A;  3CQT A;  3VS4 A;  2I0N A;  2GNC A;  1U3O A;  4M4Z A;  1NEB A;  2KGT A;  3NMZ C;  2YUO A;  2RQT A;  1OOT A;  3FJ5 A;  1BK2 A;  2CRE A;  2JW4 A;  1M3A A;  1OEB A;  1UHF A;  2X3W D;  2JMA A;  4J9H A;  1W6X A;  2YUQ A;  3SEM A;  2DL4 A;  1PRL C;  4QT7 A;  1ABQ A;  4AG1 C;  2AKK A;  2BZY A;  2KXC A;  2C0O A;  2K6D A;  2DL5 A;  1W70 A;  3VRY A;  1U06 A;  3SHW A;  1KFZ A;  4J9F A;  1BU1 A;  2CDT A;  1SSH A;  2LNH B;  2IIM A;  1GCQ A;  1AWJ A;  1K9A A;  2DA9 A;  4OMP A;  1G2B A;  1UE9 A;  3R6N A;  1NLO C;  2HDA A;  2EW3 A;  2W10 A;  1FYN A;  2DRK A;  2DJQ A;  2EQI A;  1ZBJ A;  5IHI A;  3EG3 A;  1UHC A;  2LJ0 A;  4RTV A;  2PTK A;  1UJ0 A;  2CT3 A;  2FEI A;  2YT6 A;  2J6O A;  1PKS A;  1T0H A;  2AK5 A;  1T3S A;  2KYB A;  4OMO A;  4J9E A;  2K2M A;  3M0Q A;  2BTT A;  1KJW A;  2JMC A;  2JTE A;  3M0U A;  1HSQ A;  2KRM A;  1V1C A;  1JEG A;  3QWY A;  1G83 A;  4WCI A;  2K3B A;  4CC3 A;  3VS5 A;  1B3Q A;  2FRW A;  1ZUU A;  3ULR B;  1ABO A;  2GTO A;  4RTW A;  1CKA A;  2XMF A;  3I9Q A;  4JPB W;  2DL7 A;  3VS1 A;  2YUP A;  1U5S A;  4RUG A;  1PHT A;  4Z8A A;  3UA7 A;  1AWO A;  2L3Q A;  1X2K A;  1Y57 A;  1K1Z A;  2HCK A;  3UA6 A;  3ZL7 C;  2AZV A;  1K0X A;  2EGC A;  4J9B A;  1I0C A;  1QWF A;  2HBW A;  2DLP A;  2D8H A;  1UTI A;  5IXF A;  2FG0 A;  1K0S A;  1H92 A;  1UFF A;  2YSQ A;  2FO0 A;  5EC7 A;  2JXB A;  1QCF A;  2EKH A;  4CC4 B;  4LE9 A;  4AFS C;  3U23 A;  1QWE A;  1JXO A;  2RPN A;  2V1R A;  3H0H A;  3M0P A;  2PZ1 A;  2DF6 A;  2MCN A;  1SRM A;  1I1J A;  2O9V A;  1AWW A;  2DIL A;  1Z9Z A;  5IHK A;  4X1V A;  2MOX A;  2J6K A;  1SHG A;  1K4U S;  4FSS A;  2DL8 A;  1GCQ C;  2GTJ A;  1WDX A;  3M0R A;  1X27 A;  2PNI A;  2LJ1 A;  3VS3 A;  1UDL A;  1T3L A;  1JQQ A;  2DL3 A;  3M0T A;  2SRC A;  1NLP C;  4J9I A;  2KRO A;  2LJ3 A;  2ROL A;  1GFD A;  5L23 A;  2O88 A;  1Y0M A;  2ABL A;  1T0J A;  2O9S A;  4J9C A;  2G6F X;  2ESW A;  4JZ4 A;  4F14 A;  2NWM A;  2AZS A;  2X3X D;  1PWT A;  2CUB A;  4R0K A;  1AVZ C;  2RQR A;  1JXM A;  2L2P A;  5FW9 A;  4K11 A;  2A08 A;  1WYX A;  1GRI A;  2L3P A;  2RMO A;  1TUC A;  1E6G A;  1PKT A;  1E6H A;  2MIO A;  2F2W A;  4RTU A;  3VS0 A;  1MUZ A;  1GCP A;  2A37 A;  3A98 A;  2OI3 A;  3VS7 A;  2FRY A;  1X6G A;  2CH4 W;  2CSQ A;  1HD3 A;  2KYM A;  2W0Z A;  3VS2 A;  2J06 A;  3PVQ A;  2DNU A;  4F16 A;  1WXU A;  3PVL A;  1M30 A;  1TUD A;  5FWC A;  3UF4 A;  1E7O A;  4ORZ A;  1S1N A;  3REA B;  2KNB B;  1UGV A;  4DEX A;  1AOJ A;  2BZ8 A;  4J9D A;  1A0N B;  1QKW A;  1SRL A;  1M27 C;  2KRS A;  1NM7 A;  2FPF A;  4AFZ C;  2A36 A;  4GLM A;  4RTZ A;  1HJD A;  1W1F A;  3NHN A;  2DE0 X;  5GJW B;  2DBM A;  2J6F A;  1XOV A;  2D8J A;  4LUD A;  4F17 A;  2GBQ A;  1ZLM A;  3PE0 A;  2J7I A;  4KRT A;  1GBR A;  2D1X A;  1H8K A;  3C0C A;  1QKX A;  1CKB A;  1AEY A;  1WX6 A;  3IQL A;  1VA7 A;  1X2Q A;  2B86 A;  1OPK A;  2OAW A;  1LCK A;  1RI9 A;  3TVT A;  4OMM A;  5IH2 A;  1H3H A;  1KIK A;  4OMQ A;  2JT4 A;  2KBT A;  4ZNX A;  2K9G A;  2RQV A;  1IO6 A;  2EYX A;  3EG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...