1ZUKA

Yeast bbc1 sh3 domain complexed with a peptide from las17
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
EPEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFVAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords Myosin tail region-interacting protein MTI1
total genus 14
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zukA00
1VA7A 2GQIA 1OV3A 1NLPC 1MUZA 1UG1A 4Z88A 2DRMA 1W70A 1YP5A 2VKNA 1GFCA 1GFDA 1PKSA 4M4ZA 5L23A 2KR3A 3THKA 1BB9A 2HDAA 1K1ZA 2VWFA 2KBTA 3VS4A 2XMFA 2GTJA 1K4US 2A08A 4RTWA 1GBQA 4F16A 4RTUA 1X6GA 4AFSC 4OMNA 1UGVA 1CSKA 1AD5A 2YSQA 3SHWA 1NM7A 4ORZA 4RTZA 3O5ZA 1JQQA 2KYBA 1FMKA 2FPEA 2YUQA 1AWOA 4CC4B 1KJWA 1EFNA 1B3QA 1M30A 2GTOA 4OMPA 1HJDA 3VS6A 2DJQA 4WCIA 3NHNA 3QWXX 2BZ8A 2CT4A 2CREA 2DF6A 2KRMA 3M0SA 4J9CA 4AFZC 4J9HA 2DBMA 1UFFA 4J9IA 1BBZA 2FRYA 2E5KA 2K6DA 5I11A 1GRIA 1UHCA 2CUDA 1WXTA 2RN8A 2LJ0A 3UA7A 2DMOA 1NYFA 2AK5A 3PE0A 1WI7A 1A0NB 1WXUA 4OMOA 2EVRA 2CDTA 3IQLA 4GLMA 2YUPA 1TG0A 2KYMA 1K0XA 2BTTA 3EHRA 1Z9QA 2JMAA 1IO6A 2LX7A 2YT6A 5GJWB 2LJ3A 5IHIA 3RNJA 2EGEA 2DX1A 5FWCA 3A98A 2JTEA 4CC7A 2AZVA 2ED1A 1SHGA 3VS1A 3I35A 4JJDA 1G2BA 1H92A 1S1NA 2YUNA 1B07A 1AOJA 4RTVA 2C0IA 2RQTA 2KGTA 2LJ1A 2X3XD 2D0NA 2LQNA 5EC7A 1H8KA 2CH4W 2DA9A 1RI9A 1ABQA 2PZ1A 1I0CA 2O2OA 1OOTA 3EG2A 1NLOC 2L3SA 5IXFA 2EYYA 2A28A 1G83A 4ESRA 1PRMC 1ZBJA 2ED0A 2GBQA 2P4RA 2D8JA 1M3BA 3LH5A 2F2XA 1YCSB 4D8DA 5FW9A 2DVJA 1ZUYA 2OJ2A 3H0IA 2BZYA 1NYGA 4RTXA 2B86A 1M8MA 3VRYA 2FPDA 1QKXA 2DL4A 2LZ6B 2L3QA 2CT3A 5IHNA 1AWJA 1PKTA 1GCQA 4AFUC 2GGRA 2ABLA 3M0TA 3UATA 4AG2C 1X2QA 2EQIA 4JJBA 3M0RA 2JT4A 1X43A 1PNJA 2DNUA 2PNIA 2C0TA 2HBWA 2EPDA 2FRWA 1NG2A 1U5SA 3H0FA 2NUZA 1TUDA 2RQRA 1M3AA 2RMOA 4J9GA 1JU5C 2L3PA 2KRNA 2C0OA 4JPBW 5I22A 2A37A 2O31A 2JM9A 1HD3A 2J6KA 2V1QA 1SEMA 2J7IA 4AFQC 1JO8A 3TVTA 3VS3A 5ECAA 2CUBA 1X2KA 4E6RA 2SRCA 1KSWA 1AZEA 2RQWA 1T3LA 1WDXA 2DM1A 1AEYA 4DEXA 2ESWA 2PTKA 3VS0A 1XOVA 1ZUKA 4QT7A 2HSPA 1YNZA 2MOXA 2CSQA 3RBBB 2ECZA 2FO0A 1T3SA 1QWEA 2O9VA 1OPLA 2KT1A 1YWOA 1ABOA 3NPFA 1HSQA 1T0HA 2LQWA 4HVVA 3EGUA 3VS5A 3I5SA 2DL8A 4AG1C 5FWBA 3I5RA 2EW3A 1QCFA 1UJYA 3H0HA 4HXJA 2KXDA 1CKAA 2EGAA 4Y92A 1SPKA 4HVUA 1SSHA 1AVZC 2CH4A 1ZSGA 2IIMA 4F14A 3ULRB 2W10A 4EIKA 1WYXA 2FPFA 1T0JA 2O9SA 2MCNA 1E6HA 4K11A 2JM8A 1W6XA 2AKKA 1N5ZA 2L2PA 1SRLA 4OMMA 1X69A 1X6BA 2O88A 4D8KA 1JXMA 2V1RA 4LUDA 3EG3A 3REAB 2D1XA 1KIKA 1J3TA 1I1JA 1LCKA 2JW4A 2AZSA 3FJ5A 3M0QA 3QWYA 2DILA 2J05A 3TSZA 2BZXA 4HVWA 1YWPA 2CSIA 2GNCA 2QDLA 2YUOA 2KEAA 1X27A 2ENMA 1GL5A 2JMCA 1U3OA 1WFWA 4FSSA 4GBQA 3ZL7C 1PHTA 3VS7A 2RQVA 2AKLA 2F2VA 4JJCA 4LUEA 1UTIA 2SEMA 1M3CA 2JXBA 1E7OA 1U06A 2L0AA 2K9GA 2EGCA 1JEGA 4OMLA 2ROLA 2KE9A 2EKHA 2LNHB 4J9EA 2EBPA 1NEGA 1RLQC 3M0UA 1WA7A 4LE9A 5IH2A 4CC2A 2M51A 1UECA 4X1VA 2J06A 1OPKA 4KRTA 1SHFA 1V1CA 2ROTA 2KROA 3VS2A 3UA6A 1WLPB 4RUGA 3U23A 1ZUUA 1MV3A 3NGPA 2DL3A 2OI3A 4Z89A 4J9BA 1GCQC 1UJ0A 2KT8A 3EG1A 1PWTA 1BU1A 4HCKA 1JXOA 2D8HA 2J6OA 2W0ZA 2NWMA 3GBQA 4Z8AA 2LP5A 1BK2A 2F2WA 1VYVA 4J9FA 1ZX6A 2K79A 3REBB 1Y57A 1E6GA 3TSWA 2KXCA 1ARKA 1WX6A 2DL5A 1VYTA 3KFVA 4LNPA 2X3WD 3JV3A 2DL7A 2FG0A 2DRKA 2EYZA 1Z9ZA 2VVKA 4IIMA 2YDLA 1UE9A 1AWWA 1RLPC 2RQUA 2K2MA 2RPNA 1UUEA 4RTYA 1KFZA 3VRZA 2JS2A 1W1FA 2K7AA 3SEMA 3PVQA 2H8HA 2I0NA 3H41A 4IIOA 4ZNXA 1K0SA 2DLPA 1GBRA 2LMJA 5HCKA 3PVLA 2KNBB 1PRLC 1UDLA 2A36A 1QLYA 1WXBA 4DEYA 1RUWA 2RF0A 1YN8A 1GCPA 1FYNA 3C0CA 2DE0X 1UHFA 1VYUA 1QWFA 1WIEA 2LCSA 2KRSA 2G6FX 3R6NA 4CC3A 4OMQA 1TUCA 1M27C 4LN2A 3UF4A 5IHKA 3CQTA 4R0KA 2DBKA 5IXBA 1I07A 2JS0A 2FEIA 3I9QA 1OEBA 2OAWA 2K3BA 2EYWA 2DYBA 4F17A 1CKBA 3EG0A 3NMZC 1MV0B 4JZ4A 4JZ3A 1AZGB 2EYXA 3M0PA 3EHQA 1H3HA 1SRMA 2HCKA 2M0YA 4J9DA 1AWXA 5GJVB 2HEQA 1QKWA 1ZLMA 1NEBA 2MIOA 1K76A 1K9AA 1Y0MA 2J6FA 2RNAA 4A63B 4RTTA
chains in the Genus database with same CATH superfamily
3EGXB 1OV3A 1UG1A 1VQLT 3LW5E 1TUGB 1W70A 3LYIA 1VQ9Q 3JCMQ 1WHHA 3M58A 3CCUT 3QYGB 1QVFA 1BB9A 2HDAA 3CD6Q 3JRZA 1KQSP 3CXCS 1K4US 3QO3A 3CCUA 4ZN1A 3QKJA 1PSEA 3G1JA 4AFSC 1CSKA 1AD5A 2YSQA 1YI2A 5GMKm 2QGFB 3SHWA 1YIJQ 2KYBA 1FMKA 2K3YA 4M7AA 2FPEA 3MP8A 2P84A 2YUQA 1AWOA 1BKBA 4C5IA 5KE2A 1EFNA 2CZ0B 1B3QA 4OMPA 1IRXA 3VS6A 2COYA 4FW1A 4OMFB 3QWXX 3GF5A 4N0AA 2LCLA 4F7UG 2DF6A 4J8OA 4M75A 1OI1A 3CCET 3M0SA 5GMKe 2MAMA 3WVDB 4J9HA 3OS2A 2OTJA 3ZFJA 9ATCB 1I5OB 1QVGP 2RJDA 4IUTA 1HXDA 4M77G 2E5KA 2KY9A 5I11A 5KYWB 2EWNA 4R56A 3FIFA 3RUXA 2LJ0A 4JRKA 1F1BB 2DMOA 2DXTA 1D0YA 1WI7A 4MMLA 1Q82U 4OMOA 2CP0A 1WJRA 4C8QE 4XTZA 2CDTA 3IQLA 5DLQE 3ME9A 2YUPA 4L59A 1S72T 3MP6A 2QAZA 1K0XA 1Z9QA 4JS5A 5HKCA 4QQGA 5IHIA 1YITQ 2EGEA 2ED1A 1SHGA 5KYUB 3I35A 6AT1B 2P4TA 1EIFA 4YTLA 3M5AA 1VQ5A 1H92A 3HRSA 4LDUA 5HY6A 1VQOQ 1K8AR 1G5VA 1S1NA 4JLGA 2YUNA 1WGSA 4UC4A 2QA4T 3OMCA 2C0IA 2E4HA 2LJ1A 1OX8A 2X3XD 3OW2A 1G3TA 2KI7A 3LLRA 2CH4W 1VQKQ 1D09B 1I0CA 1OOTA 3EG2A 1NLOC 1VQ8Q 1VQ7Q 2A28A 1G83A 2CS7A 1H3ZA 4OB2B 1I81A 2P4RA 4M7DD 2F2XA 2JN0A 2E41A 5FW9A 4LDWA 1BI3A 1ZUYA 3I55Q 2B86A 4N4IA 3VRYA 4DOWA 2M1HA 2FPDA 1QKXA 2DL4A 1NJIC 1AWJA 4AFUC 1GCQA 5KE3A 3LWHA 5GAMg 1Y96B 3GLXA 1X43A 2NUTB 2LT4A 1N27A 3V7RA 4B9WA 2L5QA 4NL2A 2RO0A 4XU2A 3OYHA 2WSCE 1VQNA 4KT0E 2RJFA 4J9GA 2MWOA 2KRNA 4JPBW 4FW2A 5C0MA 1AHJB 3PIPA 3HL8A 4AFQC 1JO8A 2LQ8A 1YJNA 4E6RA 2SRCA 2YRDA 4BY6C 2RQWA 1TU0B 1OZ3A 4C92B 4BE0A 2GQVA 1AEYA 3QDFA 3CXCA 2ESWA 3E9FA 1M1FA 3OSVA 1UGSB 4C92F 1VQMA 1YNZA 4ZTFA 4FYVB 4M7DA 2IVWA 4V2SA 1T3SA 2O9VA 4ME7A 4ZTJA 2A3LA 1YWOA 2LQKA 1HSQA 4EMKC 2LQWA 3EG9A 3PFSA 4BY6B 4A53A 5DY9A 2VGNA 3RIRA 1N8RR 1Q82C 4RKUE 3G4SQ 4M78B 3MEUA 3SWNB 2DL8A 2PVGB 4KBMB 3VUBA 4QQ6A 3PIOA 5GAN2 1HYOA 5LJ3j 1TWBA 1Q7YU 4M7DE 3I5RA 2EW3A 3R6OA 1QCFA 3KXTA 1YJ9A 2GCXA 2KXDA 1CKAA 4Y92A 3CBMA 4Q5WA 1SPKA 4HVUA 2DTIA 4A54A 5D7UA 2IIMA 3G71A 5GANd 4EIKA 2F5KA 1WYXA 3QXEB 4K11A 4E7ZA 2RI2A 5A2QE 1I8FA 1OULA 1X69A 4D8KA 1JXMA 3QJ6A 1WPYA 2MPXC 3EH2A 3REAB 4FIBA 5CAIA 5LJ5e 3CMEQ 1KIKA 1D1BA 5A0GA 4GLKA 4M75F 2JW4A 1IGUA 3QWYA 5I2MA 1D1AA 2D6FA 4M7AC 3V8LA 4DA4A 1YWPA 2CSIA 2YUOA 5GAMh 1X27A 2ENMA 3RKWA 4QQDA 3DLMA 3E1SA 3PTAA 1Q81U 1YIJA 1YHQT 4BB7A 3VS7A 4A4FA 1UB4A 3FRNA 2AKLA 2SEMA 1M3CA 1ZSZA 1E7OA 2CZ1B 2K9GA 3MEWA 2EGCA 2LVMA 3RERA 1RAAB 2LNHB 4C0FA 4J9EA 3M0UA 4LE9A 3CMET 5IH2A 1MNDA 3PMIA 4E7LA 2J06A 4IKFA 3OBWA 2E5QA 3C94A 5FU6C 3LGLA 3CMEA 2C06A 4C8QG 1PD1A 3FDRA 1W2BS 2OTLQ 1VUBA 1MMNA 4M77A 4M7AG 2AIRB 2RI3A 4J83A 1Y7XA 5GAN3 3NGPA 3CBPA 4Z89A 4M7DB 1UGQB 1JXOA 2W0ZA 3GBQA 2Y4YA 4HT9A 1VYVA 2QGGA 3A8OB 2K79A 3JB9G 2NLUA 3TSWA 4XTWA 2KXCA 4PFOA 2DL5A 3AHUA 1VYTA 4KUDK 1TXQA 3CC4A 2X3WD 3JV3A 4JS4A 4A4GA 1Q7YR 3CC7Q 1XTDA 3HTRA 4HKEA 1AWWA 3MKDA 4M75E 1EZZB 5GAOn 3CMAT 2X4XA 4RTYA 5EG2A 2LCCA 3VRZA 4X9DA 1D3BA 4LDYA 1W1FA 4M7AF 2K7AA 3SEMA 3BY7A 2M02A 2E70A 2H8HA 1ZSZB 3H41A 4IIOA 3KUFA 4M7AB 1GBRA 3INZA 2LMJA 4M77F 4KGZB 1UDLA 3TU4K 4PKCC 1IZ6A 1WXBA 4DEYA 1RUWA 1VQ9A 1K9MU 4A4EA 1C0MA 1KQSS 5DLOA 1BCMA 2KRSA 2HL5C 3TQ7P 1IB8A 3UF4A 4FYWB 2DIGA 3M4YA 1I5LA 2VXEA 1QP2A 2ZPIB 4M7DF 2OAWA 4CI0C 2K3BA 3PGGA 2DPPB 4JUVA 4F17A 5KH6A 1MV0B 2XU8A 4ELYC 1D0ZA 4JZ3A 5CIUA 2YRVA 2YRCA 3QBYA 3M0PA 1RACB 3DLLA 1QVGA 3OB9A 4J9DA 5GANf 2NUTA 1NEBA 1Y0MA 4RTTA 1N8RC 4HCCA 4KGXB 2DK3A 4PJOF 1QVGS 2VKNA 1WQWA 2JOYA 1GFDA 1BCOA 1PKSA 4M78G 5FU6B 5LJ3d 1IGQA 3CC2A 4E47A 1ZHIA 1YFNA 2JTMA 3VS4A 1K9MR 2XMFA 2CZ7B 2GTJA 1WHJA 2A08A 1QP3A 2XI9A 3SB2A 5KYWA 4JJNK 4RTWA 1GBQA 2DEQA 3EFOB 1D3BB 3FJPA 3X24B 2CP3A 4RCBA 1B34B 3O5ZA 4F7UA 1PG5B 1QVFP 4M7AD 1R0CB 3SWNA 2EJGA 4M77C 3M53A 1M30A 1VQMQ 2QTXA 3HHTB 2DJQA 2BE7D 2OTJQ 2BZ8A 3EFOA 2K5LA 2CREA 2KRMA 4LXCA 2FHDA 4J9CA 2RA2A 4AFZC 4DQ2A 2DBMA 2DETA 2MF2A 2DFUA 2FRYA 4BD3A 2K6DA 1BI1A 1GRIA 1UHCA 1KD1R 5IT9E 1NZ9A 1QVPA 1JRIA 3FEOA 4IUPA 2Y90A 1NYFA 3PE0A 1K73U 3RESA 2EVRA 4NOYA 3NFCA 1Q86R 4LD9K 2JMAA 2VV5A 2Z0WA 1WJSA 4C0DB 3RNJA 2DX1A 3V7SA 2JTEA 4CC7A 4OVAA 3VS1A 2PVOB 2QG9B 4N0AC 2IPOB 4L5GA 2RQTA 4FSXA 3L2UA 1WQ7A 1LPLA 1RI9A 2D9TA 2E64A 2EYYA 1OU9A 2EJFA 1K8AU 4C0DC 1ZBJA 3J80E 2GBQA 2D8JA 3CC7T 4XTVA 4D8DA 2DVJA 3H0IA 4VUBA 3CC7A 3QHSA 3X26B 4WTOB 4XQ3A 2LZ6B 2L3QA 1Q7YC 1WHGA 2GGRA 2DVEA 3CCLA 4J6WA 4D6WA 2EQIA 2HSEB 3M0RA 1MGQA 2DNUA 1X75C 1M90C 2PNIA 2VASA 2C0TA 3UT1A 3OYJA 3DKMA 1U5SA 4EMKA 2R58A 1WHLA 3EFSA 4DBRA 2RMOA 1W4SA 1SF9A 2C0OA 2JJ9A 4BI8B 2QXFA 3RDVA 2RHIA 3L1AA 1SEMA 1V29B 5ECAA 2CUBA 4TVRA 4BI3A 1KD1C 1X2KA 2QDYB 3LGFA 2X4YA 1JB0E 3H6ZA 1C1AA 1YJWQ 2ZPHB 2ZPFB 2RHYA 4DEXA 2PTKA 2F1LA 1K73R 4ATOA 3VS0A 1SSFA 1XOVA 1ZUKA 4QT7A 2HSPA 2MOXA 1N8RU 2DYIA 4J6YA 4MMKA 5CK9A 3QUIA 1BYMA 2EJ9A 3JCMV 2P0PA 2MI6A 2X4JA 3M54A 3J81E 4CRIA 3EGUA 4HCZA 3OSSC 3VS5A 1V76A 4BE2A 3CCST 3OQ5A 4LD6A 3PMTA 2A7YA 5FWBA 1VQ4A 1NJIU 3FC3A 3G71T 4XU3A 4HXJA 2EGAA 5C6SA 3VKIA 3QPHA 5LJ5g 1OX9A 4PNOA 1VQLA 2L3RA 4F14A 2MWPA 2I2LA 5CKBA 1VQPT 1K9MC 1E6HA 1M1KU 3CCUQ 4WF2A 4PJOC 2BIVA 1NBEB 2QQ9A 2EQUA 1N5ZA 1FMVA 2L2PA 2KSSA 1VQPQ 1FXXA 1X6BA 3CBOA 3QZ5B 1LOJA 2DXCA 3I56T 2OX7A 2KAFA 3EG3A 2YLCA 3GNGA 4FYYB 3I56A 1XJWB 2M16A 3M0QA 2E6ZA 3MHXA 3JB9F 2FB7A 3TSZA 3OYBA 2XG8D 4HVWA 3OYCA 2V26A 1WJQA 2L8DA 5CKDA 4OB0B 5GANg 3HP9A 3BFMA 1U1SA 4LUEA 3L2VA 5CO7A 4KUIA 4OMLA 4M78A 4NL3A 2DXBA 1WA7A 1M1GA 2CYZB 2RHUA 1VIEA 4L6V5 5GAOl 5I2SA 3H8ZA 2XIDA 3RR6A 2G3RA 3A1PA 1I4K1 2E12A 2H3JA 3A8GB 1SHFA 1V1CA 5GAN6 3JCMg 1PSFA 2RM4A 2HL3A 2CP2A 2KROA 4FT4A 8AT1B 4PJMA 4RUGA 5FU7B 2QQBA 4PK4A 4J9BA 4N4GA 3OY9A 1BU1A 3GOXA 3OYKA 4EMHA 2FZKB 1BK2A 4EMGA 4C8QC 5CQXA 1MMAA 2MMPA 3PT9A 1E6GA 2RI5A 4J7IA 3L2ZA 1TTHB 1BI0A 2QTVA 2FG0A 4M78F 2EYZA 1Z9ZA 2EYQA 2VVKA 2QQAA 2QEXT 3CCMT 4C92D 2RPNA 1YJNQ 1QW1A 4F7UF 2ATCB 2K2VA 3HFOA 3PVQA 4ZNXA 5J26A 4E7HA 2O4XA 5LJ3g 4BACA 2KNBB 1X6OA 2DO3A 2DXUA 1WHKA 2RD1A 2RF0A 1YN8A 3JSCA 4XAXB 1FYNA 5GANj 5D6YA 2F5TX 2MYSA 1WIEA 1D1CA 3S3OA 1VQ8T 1G3YA 3R6NA 4C0GA 1QQJA 4IUVA 1VQMT 2DBKA 3A8LB 4C92E 3I9QA 1YJNT 1VQ8A 4M77D 3L2RA 2DYBA 1CKBA 2FL7A 4JZ4A 2JUFA 3CEYA 3BW1A 4QW2A 2QQSA 3AT1B 3JCMd 2DZCA 5FRNA 2X4WA 1H3HA 1SRMA 3H9NA 2RJCA 1MHNA 5D6XA 3CCSQ 2FZGB 2RH2A 3G6EQ 1K76A 1K9AA 2RNAA 2GQIA 2HQHA 1NLPC 1MUZA 2X51A 1VQ7A 3UWNA 4C5HA 3DB3A 4F7UE 4ANJA 3VV0A 2KR3A 3THKA 1GXIE 3S3MA 1M9SA 1YJ9T 1K1ZA 2YWWA 1TOVA 1IXDA 3JAME 3CCVA 4RTUA 3S3NA 1X6GA 2WSEE 2PUOB 4BE1A 3EG9B 1NM7A 4ORZA 4RTZA 2LC4A 2RB6A 1NPRA 1S72Q 3CCQT 3EGDB 4E7JA 3WXMB 2BUDA 4M77E 3QG1A 4WCIA 3NHNA 2LNVA 3OYLA 1YIJT 2ZAEA 3MCAB 3J7AF 1UGRB 3QJYA 4M7DC 3HRTA 2X35A 2BE9B 3QSUA 1UFFA 5IAYA 4J9IA 3PNWC 2P0QA 1HK9A 3TREA 4Y91A 3OW2S 2KK4A 1WXTA 4PJOB 1BIBA 1VQNQ 1R0BG 2AK5A 2E6NA 3X28B 4KH0B 1KQ1A 5LJ5f 1K8AC 2YXYA 3M4GA 4GLMA 2EQKA 3O8VA 2PQWA 1RL2A 2QYZA 1TG0A 3EHRA 1YJWT 1IO6A 2YLBA 1Q81C 5GAMf 3EH1A 5GAMe 3A98A 4N4HA 1YJWA 2AZVA 2RJEA 1QCOA 1G2BA 3VJPA 3SWNC 2MK5A 2AHJB 1AOJA 2CKKA 3JB9D 3JCMh 1VOMA 8ATCB 2LQNA 1H8KA 2PZ1A 3JCMf 3SDZA 3GNFB 4O5VA 2L3SA 5IXFA 2COWA 2LX9A 2ED0A 5GAN4 4A4HA 4C92C 1KQSA 3LX7A 2BKDN 3CCLT 2OTLA 3OW2P 2BZYA 1VQ4Q 1M8MA 4XK8E 3MPUB 1VQ6T 4RG8A 2CT3A 1NPPA 5IHNA 3UATA 2JT4A 1PNJA 4EPCA 4Z02A 2OAUA 2EPDA 2FRWA 1NG2A 1ZA1B 2K5FA 3CMAA 1TUDA 2RQRA 1WZOA 4IUQA 3CCQQ 5L8RE 2P0KA 5I22A 2A37A 3URGA 4M77B 5GAOm 2J6KA 2V1QA 1TS9A 3MEVA 4PJOD 3TVTA 4JRPA 2EQJA 4EMKB 1ACMB 5CKHA 4KH1B 1WDXA 2DM1A 4FL6A 1Q82R 5GANh 3HRUA 5CVIA 3VUZA 3VYGA 1RI0A 4MDXA 3CCJQ 2F69A 3RBBB 4QVCA 4AMCA 2ECZA 2FO0A 1QWEA 4M75C 3UPUA 3NPFA 3JB9J 3CCJT 3CCSA 2E3HA 3OBYA 1O9SA 2E10A 3X20B 5KYYB 2O4XB 4ZGJB 3MO8A 1G3SA 3I5SA 2FVUA 4AG1C 3OYDA 3F70A 3OS1A 3CC2T 4RCCA 3H0HA 1PM3A 3EFRA 4IURA 1JBMA 4JRIA 1SSHA 2QASA 1AVZC 4PJNA 3JCMX 2DIQA 1KC8U 3OA6A 1M4ZA 2VUBA 2FPFA 1U1TA 5GAOp 1YHQQ 2O9SA 5LJ5j 2MCNA 3EGXA 3Q1JA 1IHVA 2NUPA 1MMGA 1RAGB 4PFPA 1B7TA 1XQHA 2GF7A 2O88A 2PVDB 5LJ5h 2V1RA 3JCMb 2JNGA 3L2QA 2GFAA 4C0ZA 2AT1B 4FU6A 3P8BB 2D1XA 1YI2T 4X34A 2FYKA 3FJ5A 4ELZC 3CCEA 2DILA 2GFUA 5CCAA 4E7KA 1KD1U 4A4KA 1VQOT 2OTJT 4F04B 2J05A 2XICA 2GNCA 1GL5A 5J39A 2JMCA 2PUKB 1WFWA 2XD0A 3KBGA 5DM7R 2RHZA 3JCMe 1IHWA 3ER0A 2NUPB 4MDWA 4M7DG 2F2VA 4JJCA 5M9OA 5FU7C 2XK0A 2JXBA 2L0AA 1U06A 2LTOA 3GP8A 2HKQB 1JEGA 2ROLA 2KE9A 3LH0A 2EKHA 1RLQC 1UGPB 3OYGA 1WNLA 3JCMJ 3NTKA 2XHCA 2M51A 4X1VA 1OPKA 3I55T 4C92G 4BI4A 2KVQG 3HFNA 2H3EB 1FX7A 2QA4A 3GPLA 3I55A 1WLPB 3NTIA 3U23A 2HBPA 3JCMW 1ZUUA 1VQKT 1RAIB 4PLIA 2OI3A 4FCYA 3EG1A 4IUUA 4HCKA 5KCOA 1VQ5T 2D8HA 2J6OA 2NWMA 1VQKA 3EAEA 4Z8AA 2KMTA 1ZX6A 2O01E 3OMGA 3L42A 3REBB 1KC8R 5CQYA 1MMDA 4KGVB 4MZMA 1ZSZC 2XKOC 1ARKA 1ZBXA 4FT2A 3NTHA 3KFVA 4LNPA 2DL7A 4C5GA 2DRKA 5FROA 3QZ9B 4IIMA 1UE9A 5HK0A 1OZ2A 1RLPC 2RQUA 2EAYA 2COZA 1M1KR 1UUEA 4LDVA 1KFZA 5GAOq 5GAN5 3OYNA 2JS2A 3EGDA 2VC8A 3BDLA 4DOVA 4PJOE 2M9UA 1K0SA 1M2VB 2DJZA 1W2BP 3PVLA 1PRLC 3E9GA 1QLYA 4PJLA 1YBYA 5KYXA 3FLGA 1VYUA 4C8QA 4CC3A 4OMQA 1TUCA 3M56A 2V8IA 5IHKA 3CCRA 4JRQA 4QKUA 4M78C 2L89A 1I07A 4M75D 5I21A 3BE3A 2FEIA 1OEBA 4HA8A 2EYWA 3CCRT 3CPFA 3X25B 3EG0A 3NMZC 1YI2Q 2Y4XA 4PJOG 5GAMj 4P5NA 3OYEA 2DD4A 3QIIA 3C4SA 2HCKA 4II1A 1AWXA 5GJVB 5LJ5d 1QMCA 3G7ZA 1WHMA 4RMOA 3CD6T 1ZLMA 1TH7A 2LT1A 4A63B 2CGHA 2J6FA 3M55A 1SKUB 4E2FB 2D0QB 1VA7A 4Z88A 1TSFA 2DRMA 2K4YA 3CD6A 1JJ2A 1YP5A 1GFCA 2CP6A 2K57A 1LJOA 1RAFB 2HQXA 4M4ZA 2R57A 3SD4A 4F7UB 4M7AE 3RKYA 2CZ6B 1RADB 5L23A 3CCVT 4QVDA 2VWFA 2KBTA 3RMSA 2HMAA 2A0FB 2VGMA 1MNEA 4ZN3A 2EFIA 3P8DA 3JCMc 1FWZA 1OQKA 4F16A 4OMNA 1UGVA 5AT1B 4DBHA 1VQPA 1C6VX 3E2UA 1JQQA 1M1KC 5LJ3h 3MP1A 2DAQA 1XNIA 2VXFA 4CC4B 1KJWA 4OB3B 2GTOA 3LWIA 3I56Q 1HJDA 5FRMA 2EKOA 4BDYA 2CT4A 4OP0A 7AT1B 3RKXA 5CKFA 1H641 2PU9B 3OS0A 4O6JA 4PJOA 3JB9H 1BBZA 2WSFE 4DBFA 2DKGA 4PL6A 3OYYA 3OYMA 4HCBA 2CUDA 4PJJA 2RN8A 3TEEA 3UA7A 2E1HA 2ZPBB 1WXUA 1A0NB 4HT8A 4NS5A 4GY5A 2KYMA 2BTTA 2HZYA 2LX7A 2YT6A 3G4SA 5GJWB 1AT1B 2JZ2A 4OGEA 1S72A 2LJ3A 3M59A 5FWCA 3S6WA 2JTFA 2IG0A 4JJDA 3G4ST 2HQEA 1VIFA 5HK3A 1KK7A 1B07A 3C12A 4RTVA 3CPWP 1ZQ1A 4C8QD 4J6XA 3OYIA 2KGTA 1OYXA 2V8JA 2D0NA 3ASKA 5EC7A 2DA9A 4BDZA 1ABQA 2O2OA 4M75B 2CP5A 3ZEHA 5KYNA 2OTLT 1B34A 4ESRA 1M90R 1PRMC 1Q95G 3LH5A 1M3BA 1KC8C 1YCSB 2XDBA 2OJ2A 3HKSA 3QDRB 3G6ET 1NYGA 4RTXA 4E7SA 1PKTA 2B8AA 2ABLA 3G6EA 3M0TA 4AG2C 3CC4T 1X2QA 4JJBA 4XU0A 4FM4B 4KULA 1R8OB 3CCRQ 1RAEB 4X9CA 1M5Q1 2HBWA 5GANe 2QEXA 3CCMA 1N9RA 3H0FA 5GMKj 2NUZA 3MEAA 5AYFA 4BUGA 5GMKl 1M3AA 2EQMA 5A0DA 2QA4Q 1JU5C 1P92A 2L3PA 1N6AA 1Y07A 4JLIA 1KG1A 2O31A 2JM9A 4M78D 3CPWS 1HD3A 2J7IA 5KCHA 1VQNT 2ZGWA 3VS3A 3A8MB 1O75A 3CCVQ 1KSWA 3G71Q 1AZEA 1M8VA 1T3LA 1PD0A 5FLXE 3ZBDA 4MZPA 4R55A 2QK0A 4XTYA 1Y96A 2CSQA 2LRQA 1OPLA 2KT1A 1ABOA 1T0HA 1U8RA 5GAMd 4HVVA 3L2WA 2HAXA 5KYUA 3CPWA 1VQ7T 4M75G 1N9SA 1K73C 3VU3C 5LL6S 2E65A 1UJYA 2HNIA 1VQ6Q 1VQ5Q 3CCLQ 3C95A 3JCMP 1Q81R 3MJXA 2ZPEB 2VB6A 2ZPGB 2V8KA 2CH4A 3SFMA 3CXCP 1LNXA 1ZSGA 3ULRB 1G8XA 2W10A 1T0JA 1YITT 1YJ9Q 1JJ2S 2QEXQ 3CCMQ 3FB9A 2JM8A 1W6XA 4LDXA 1EX4A 2KQWA 4MZTA 4E7IA 2AKKA 1JJ2P 3D7SB 3BDUA 1YITA 1SRLA 4OMMA 1QVFS 1G3WA 1FMWA 3CCQA 4QVZA 1M2OA 1Q86U 4LUDA 1KQ2A 2DTOA 2K3XA 4ZGEB 1VQOA 1KHCA 1UEBA 2QI2A 1J3TA 1I1JA 1LCKA 2AZSA 1ZA2B 4PFZA 3QYHB 1SG5A 1QCNA 1X01A 4M78E 1Y71A 2BZXA 2QDLA 4PLLA 2DD5A 2KDSA 2KEAA 4OB1B 5GAN8 2LDMA 2WACA 1U3OA 4J7FA 1NE8A 4FSSA 3OYFA 2HKNA 3CMAQ 2ZCFB 4OGCA 3CCEQ 2E3IA 4GBQA 2HD0A 3ZL7C 2K5IA 3JB9I 1PHTA 4OF1A 2RQVA 3META 2EIFA 1IREB 4B9XA 1UTIA 1YHQA 4C92A 3A8HB 1M2VA 4C8QF 3P8HA 3RMQA 3CC2Q 2DZ9A 1NEGA 2EBPA 1RABB 5KYYA 2XDDA 1W2BA 4CC2A 1UECA 5CR2A 2CP7A 4KRTA 4ZGDB 4JDSA 2ROTA 2QQRA 5CKEA 1VQLQ 3VS2A 2JVVA 3UA6A 2DERA 1OU8A 1MV3A 3WVEB 3V8KA 3M57A 3OYAA 2DL3A 1GCQC 1UJ0A 2KT8A 4EDUA 2XDPA 1PWTA 4XU1A 5LJ3f 4DBQA 5LJ3e 2LP5A 2F2WA 3CC4Q 2YHTA 4J9FA 3A5ZB 1RAHB 1Y57A 5GAN7 1VQ6A 4XTUA 1KHIA 1WX6A 4XTXA 5GMKh 1NJIR 2X9HA 2NYSA 1BIAA 2YDLA 5D6WA 2K2MA 3N5BB 2R5AA 1LVKA 3UDCA 3V7CA 3HSBA 4C8QB 1R77A 5KYXB 2I0NA 2DLPA 2FZCB 2RK1A 4RG2A 3V8JA 3T9NA 5HCKA 2A36A 1PCXA 5GMKi 3VYHB 1GCPA 3GIBA 3C0CA 2DE0X 1UHFA 1Q86C 3OS5A 1QWFA 2LCSA 2DTHA 2G6FX 1VQ9T 1M27C 4LN2A 3CQTA 5J3BA 2M0OA 2RHXA 4R0KA 1DJ7B 5A0LA 5IXBA 2JS0A 1D0XA 1BI2A 3DB4A 2VYTA 4AT1B 3TCJA 1M90U 1YCYA 3CCJA 5IN1A 1AZGB 2EYXA 2DEUA 3EHQA 3HPWA 3M9QA 4B6MA 5GAOr 3E19A 4FYXB 2M0YA 2RK2A 2ZZDA 4C5EA 1PC0A 2HEQA 1QKWA 2R5MA 4J5YA 1VQ4T 2MIOA 4Y28E
chains in the Genus database with same CATH topology
1VA7A 2GQIA 1OV3A 1NLPC 1MUZA 1UG1A 4Z88A 2DRMA 1W70A 1YP5A 2VKNA 1GFCA 1GFDA 1PKSA 4M4ZA 5L23A 2KR3A 3THKA 1BB9A 2HDAA 1K1ZA 2VWFA 2KBTA 3VS4A 2XMFA 2GTJA 1K4US 2A08A 4RTWA 1GBQA 4F16A 4RTUA 1X6GA 4AFSC 4OMNA 1UGVA 1CSKA 1AD5A 2YSQA 3SHWA 1NM7A 4ORZA 4RTZA 3O5ZA 1JQQA 2KYBA 1FMKA 2FPEA 2YUQA 1AWOA 4CC4B 1KJWA 1EFNA 1B3QA 1M30A 2GTOA 4OMPA 1HJDA 3VS6A 2DJQA 4WCIA 3NHNA 3QWXX 2BZ8A 2CT4A 2CREA 2DF6A 2KRMA 3M0SA 4J9CA 4AFZC 4J9HA 2DBMA 1UFFA 4J9IA 1BBZA 2FRYA 2E5KA 2K6DA 5I11A 1GRIA 1UHCA 2CUDA 1WXTA 2RN8A 2LJ0A 3UA7A 2DMOA 1NYFA 2AK5A 3PE0A 1WI7A 1A0NB 1WXUA 4OMOA 2EVRA 2CDTA 3IQLA 4GLMA 2YUPA 1TG0A 2KYMA 1K0XA 2BTTA 3EHRA 1Z9QA 2JMAA 1IO6A 2LX7A 2YT6A 5GJWB 2LJ3A 5IHIA 3RNJA 2EGEA 2DX1A 5FWCA 3A98A 2JTEA 4CC7A 2AZVA 2ED1A 1SHGA 3VS1A 3I35A 4JJDA 1G2BA 1H92A 1S1NA 2YUNA 1B07A 1AOJA 4RTVA 2C0IA 2RQTA 2KGTA 2LJ1A 2X3XD 2D0NA 2LQNA 5EC7A 1H8KA 2CH4W 2DA9A 1RI9A 1ABQA 2PZ1A 1I0CA 2O2OA 1OOTA 3EG2A 1NLOC 2L3SA 5IXFA 2EYYA 2A28A 1G83A 4ESRA 1PRMC 1ZBJA 2ED0A 2GBQA 2P4RA 2D8JA 1M3BA 3LH5A 2F2XA 1YCSB 4D8DA 5FW9A 2DVJA 1ZUYA 2OJ2A 3H0IA 2BZYA 1NYGA 4RTXA 2B86A 1M8MA 3VRYA 2FPDA 1QKXA 2DL4A 2LZ6B 2L3QA 2CT3A 5IHNA 1AWJA 1PKTA 1GCQA 4AFUC 2GGRA 2ABLA 3M0TA 3UATA 4AG2C 1X2QA 2EQIA 4JJBA 3M0RA 2JT4A 1X43A 1PNJA 2DNUA 2PNIA 2C0TA 2HBWA 2EPDA 2FRWA 1NG2A 1U5SA 3H0FA 2NUZA 1TUDA 2RQRA 1M3AA 2RMOA 4J9GA 1JU5C 2L3PA 2KRNA 2C0OA 4JPBW 5I22A 2A37A 2O31A 2JM9A 1HD3A 2J6KA 2V1QA 1SEMA 2J7IA 4AFQC 1JO8A 3TVTA 3VS3A 5ECAA 2CUBA 1X2KA 4E6RA 2SRCA 1KSWA 1AZEA 2RQWA 1T3LA 1WDXA 2DM1A 1AEYA 4DEXA 2ESWA 2PTKA 3VS0A 1XOVA 1ZUKA 4QT7A 2HSPA 1YNZA 2MOXA 2CSQA 3RBBB 2ECZA 2FO0A 1T3SA 1QWEA 2O9VA 1OPLA 2KT1A 1YWOA 1ABOA 3NPFA 1HSQA 1T0HA 2LQWA 4HVVA 3EGUA 3VS5A 3I5SA 2DL8A 4AG1C 5FWBA 3I5RA 2EW3A 1QCFA 1UJYA 3H0HA 4HXJA 2KXDA 1CKAA 2EGAA 4Y92A 1SPKA 4HVUA 1SSHA 1AVZC 2CH4A 1ZSGA 2IIMA 4F14A 3ULRB 2W10A 4EIKA 1WYXA 2FPFA 1T0JA 2O9SA 2MCNA 1E6HA 4K11A 2JM8A 1W6XA 2AKKA 1N5ZA 2L2PA 1SRLA 4OMMA 1X69A 1X6BA 2O88A 4D8KA 1JXMA 2V1RA 4LUDA 3EG3A 3REAB 2D1XA 1KIKA 1J3TA 1I1JA 1LCKA 2JW4A 2AZSA 3FJ5A 3M0QA 3QWYA 2DILA 2J05A 3TSZA 2BZXA 4HVWA 1YWPA 2CSIA 2GNCA 2QDLA 2YUOA 2KEAA 1X27A 2ENMA 1GL5A 2JMCA 1U3OA 1WFWA 4FSSA 4GBQA 3ZL7C 1PHTA 3VS7A 2RQVA 2AKLA 2F2VA 4JJCA 4LUEA 1UTIA 2SEMA 1M3CA 2JXBA 1E7OA 1U06A 2L0AA 2K9GA 2EGCA 1JEGA 4OMLA 2ROLA 2KE9A 2EKHA 2LNHB 4J9EA 2EBPA 1NEGA 1RLQC 3M0UA 1WA7A 4LE9A 5IH2A 4CC2A 2M51A 1UECA 4X1VA 2J06A 1OPKA 4KRTA 1SHFA 1V1CA 2ROTA 2KROA 3VS2A 3UA6A 1WLPB 4RUGA 3U23A 1ZUUA 1MV3A 3NGPA 2DL3A 2OI3A 4Z89A 4J9BA 1GCQC 1UJ0A 2KT8A 3EG1A 1PWTA 1BU1A 4HCKA 1JXOA 2D8HA 2J6OA 2W0ZA 2NWMA 3GBQA 4Z8AA 2LP5A 1BK2A 2F2WA 1VYVA 4J9FA 1ZX6A 2K79A 3REBB 1Y57A 1E6GA 3TSWA 2KXCA 1ARKA 1WX6A 2DL5A 1VYTA 3KFVA 4LNPA 2X3WD 3JV3A 2DL7A 2FG0A 2DRKA 2EYZA 1Z9ZA 2VVKA 4IIMA 2YDLA 1UE9A 1AWWA 1RLPC 2RQUA 2K2MA 2RPNA 1UUEA 4RTYA 1KFZA 3VRZA 2JS2A 1W1FA 2K7AA 3SEMA 3PVQA 2H8HA 2I0NA 3H41A 4IIOA 4ZNXA 1K0SA 2DLPA 1GBRA 2LMJA 5HCKA 3PVLA 2KNBB 1PRLC 1UDLA 2A36A 1QLYA 1WXBA 4DEYA 1RUWA 2RF0A 1YN8A 1GCPA 1FYNA 3C0CA 2DE0X 1UHFA 1VYUA 1QWFA 1WIEA 2LCSA 2KRSA 2G6FX 3R6NA 4CC3A 4OMQA 1TUCA 1M27C 4LN2A 3UF4A 5IHKA 3CQTA 4R0KA 2DBKA 5IXBA 1I07A 2JS0A 2FEIA 3I9QA 1OEBA 2OAWA 2K3BA 2EYWA 2DYBA 4F17A 1CKBA 3EG0A 3NMZC 1MV0B 4JZ4A 4JZ3A 1AZGB 2EYXA 3M0PA 3EHQA 1H3HA 1SRMA 2HCKA 2M0YA 4J9DA 1AWXA 5GJVB 2HEQA 1QKWA 1ZLMA 1NEBA 2MIOA 1K76A 1K9AA 1Y0MA 2J6FA 2RNAA 4A63B 4RTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VA7 A;  2GQI A;  1OV3 A;  1NLP C;  1MUZ A;  1UG1 A;  4Z88 A;  2DRM A;  1W70 A;  1YP5 A;  2VKN A;  1GFC A;  1GFD A;  1PKS A;  4M4Z A;  5L23 A;  2KR3 A;  3THK A;  1BB9 A;  2HDA A;  1K1Z A;  2VWF A;  2KBT A;  3VS4 A;  2XMF A;  2GTJ A;  1K4U S;  2A08 A;  4RTW A;  1GBQ A;  4F16 A;  4RTU A;  1X6G A;  4AFS C;  4OMN A;  1UGV A;  1CSK A;  1AD5 A;  2YSQ A;  3SHW A;  1NM7 A;  4ORZ A;  4RTZ A;  3O5Z A;  1JQQ A;  2KYB A;  1FMK A;  2FPE A;  2YUQ A;  1AWO A;  4CC4 B;  1KJW A;  1EFN A;  1B3Q A;  1M30 A;  2GTO A;  4OMP A;  1HJD A;  3VS6 A;  2DJQ A;  4WCI A;  3NHN A;  3QWX X;  2BZ8 A;  2CT4 A;  2CRE A;  2DF6 A;  2KRM A;  3M0S A;  4J9C A;  4AFZ C;  4J9H A;  2DBM A;  1UFF A;  4J9I A;  1BBZ A;  2FRY A;  2E5K A;  2K6D A;  5I11 A;  1GRI A;  1UHC A;  2CUD A;  1WXT A;  2RN8 A;  2LJ0 A;  3UA7 A;  2DMO A;  1NYF A;  2AK5 A;  3PE0 A;  1WI7 A;  1A0N B;  1WXU A;  4OMO A;  2EVR A;  2CDT A;  3IQL A;  4GLM A;  2YUP A;  1TG0 A;  2KYM A;  1K0X A;  2BTT A;  3EHR A;  1Z9Q A;  2JMA A;  1IO6 A;  2LX7 A;  2YT6 A;  5GJW B;  2LJ3 A;  5IHI A;  3RNJ A;  2EGE A;  2DX1 A;  5FWC A;  3A98 A;  2JTE A;  4CC7 A;  2AZV A;  2ED1 A;  1SHG A;  3VS1 A;  3I35 A;  4JJD A;  1G2B A;  1H92 A;  1S1N A;  2YUN A;  1B07 A;  1AOJ A;  4RTV A;  2C0I A;  2RQT A;  2KGT A;  2LJ1 A;  2X3X D;  2D0N A;  2LQN A;  5EC7 A;  1H8K A;  2CH4 W;  2DA9 A;  1RI9 A;  1ABQ A;  2PZ1 A;  1I0C A;  2O2O A;  1OOT A;  3EG2 A;  1NLO C;  2L3S A;  5IXF A;  2EYY A;  2A28 A;  1G83 A;  4ESR A;  1PRM C;  1ZBJ A;  2ED0 A;  2GBQ A;  2P4R A;  2D8J A;  1M3B A;  3LH5 A;  2F2X A;  1YCS B;  4D8D A;  5FW9 A;  2DVJ A;  1ZUY A;  2OJ2 A;  3H0I A;  2BZY A;  1NYG A;  4RTX A;  2B86 A;  1M8M A;  3VRY A;  2FPD A;  1QKX A;  2DL4 A;  2LZ6 B;  2L3Q A;  2CT3 A;  5IHN A;  1AWJ A;  1PKT A;  1GCQ A;  4AFU C;  2GGR A;  2ABL A;  3M0T A;  3UAT A;  4AG2 C;  1X2Q A;  2EQI A;  4JJB A;  3M0R A;  2JT4 A;  1X43 A;  1PNJ A;  2DNU A;  2PNI A;  2C0T A;  2HBW A;  2EPD A;  2FRW A;  1NG2 A;  1U5S A;  3H0F A;  2NUZ A;  1TUD A;  2RQR A;  1M3A A;  2RMO A;  4J9G A;  1JU5 C;  2L3P A;  2KRN A;  2C0O A;  4JPB W;  5I22 A;  2A37 A;  2O31 A;  2JM9 A;  1HD3 A;  2J6K A;  2V1Q A;  1SEM A;  2J7I A;  4AFQ C;  1JO8 A;  3TVT A;  3VS3 A;  5ECA A;  2CUB A;  1X2K A;  4E6R A;  2SRC A;  1KSW A;  1AZE A;  2RQW A;  1T3L A;  1WDX A;  2DM1 A;  1AEY A;  4DEX A;  2ESW A;  2PTK A;  3VS0 A;  1XOV A;  1ZUK A;  4QT7 A;  2HSP A;  1YNZ A;  2MOX A;  2CSQ A;  3RBB B;  2ECZ A;  2FO0 A;  1T3S A;  1QWE A;  2O9V A;  1OPL A;  2KT1 A;  1YWO A;  1ABO A;  3NPF A;  1HSQ A;  1T0H A;  2LQW A;  4HVV A;  3EGU A;  3VS5 A;  3I5S A;  2DL8 A;  4AG1 C;  5FWB A;  3I5R A;  2EW3 A;  1QCF A;  1UJY A;  3H0H A;  4HXJ A;  2KXD A;  1CKA A;  2EGA A;  4Y92 A;  1SPK A;  4HVU A;  1SSH A;  1AVZ C;  2CH4 A;  1ZSG A;  2IIM A;  4F14 A;  3ULR B;  2W10 A;  4EIK A;  1WYX A;  2FPF A;  1T0J A;  2O9S A;  2MCN A;  1E6H A;  4K11 A;  2JM8 A;  1W6X A;  2AKK A;  1N5Z A;  2L2P A;  1SRL A;  4OMM A;  1X69 A;  1X6B A;  2O88 A;  4D8K A;  1JXM A;  2V1R A;  4LUD A;  3EG3 A;  3REA B;  2D1X A;  1KIK A;  1J3T A;  1I1J A;  1LCK A;  2JW4 A;  2AZS A;  3FJ5 A;  3M0Q A;  3QWY A;  2DIL A;  2J05 A;  3TSZ A;  2BZX A;  4HVW A;  1YWP A;  2CSI A;  2GNC A;  2QDL A;  2YUO A;  2KEA A;  1X27 A;  2ENM A;  1GL5 A;  2JMC A;  1U3O A;  1WFW A;  4FSS A;  4GBQ A;  3ZL7 C;  1PHT A;  3VS7 A;  2RQV A;  2AKL A;  2F2V A;  4JJC A;  4LUE A;  1UTI A;  2SEM A;  1M3C A;  2JXB A;  1E7O A;  1U06 A;  2L0A A;  2K9G A;  2EGC A;  1JEG A;  4OML A;  2ROL A;  2KE9 A;  2EKH A;  2LNH B;  4J9E A;  2EBP A;  1NEG A;  1RLQ C;  3M0U A;  1WA7 A;  4LE9 A;  5IH2 A;  4CC2 A;  2M51 A;  1UEC A;  4X1V A;  2J06 A;  1OPK A;  4KRT A;  1SHF A;  1V1C A;  2ROT A;  2KRO A;  3VS2 A;  3UA6 A;  1WLP B;  4RUG A;  3U23 A;  1ZUU A;  1MV3 A;  3NGP A;  2DL3 A;  2OI3 A;  4Z89 A;  4J9B A;  1GCQ C;  1UJ0 A;  2KT8 A;  3EG1 A;  1PWT A;  1BU1 A;  4HCK A;  1JXO A;  2D8H A;  2J6O A;  2W0Z A;  2NWM A;  3GBQ A;  4Z8A A;  2LP5 A;  1BK2 A;  2F2W A;  1VYV A;  4J9F A;  1ZX6 A;  2K79 A;  3REB B;  1Y57 A;  1E6G A;  3TSW A;  2KXC A;  1ARK A;  1WX6 A;  2DL5 A;  1VYT A;  3KFV A;  4LNP A;  2X3W D;  3JV3 A;  2DL7 A;  2FG0 A;  2DRK A;  2EYZ A;  1Z9Z A;  2VVK A;  4IIM A;  2YDL A;  1UE9 A;  1AWW A;  1RLP C;  2RQU A;  2K2M A;  2RPN A;  1UUE A;  4RTY A;  1KFZ A;  3VRZ A;  2JS2 A;  1W1F A;  2K7A A;  3SEM A;  3PVQ A;  2H8H A;  2I0N A;  3H41 A;  4IIO A;  4ZNX A;  1K0S A;  2DLP A;  1GBR A;  2LMJ A;  5HCK A;  3PVL A;  2KNB B;  1PRL C;  1UDL A;  2A36 A;  1QLY A;  1WXB A;  4DEY A;  1RUW A;  2RF0 A;  1YN8 A;  1GCP A;  1FYN A;  3C0C A;  2DE0 X;  1UHF A;  1VYU A;  1QWF A;  1WIE A;  2LCS A;  2KRS A;  2G6F X;  3R6N A;  4CC3 A;  4OMQ A;  1TUC A;  1M27 C;  4LN2 A;  3UF4 A;  5IHK A;  3CQT A;  4R0K A;  2DBK A;  5IXB A;  1I07 A;  2JS0 A;  2FEI A;  3I9Q A;  1OEB A;  2OAW A;  2K3B A;  2EYW A;  2DYB A;  4F17 A;  1CKB A;  3EG0 A;  3NMZ C;  1MV0 B;  4JZ4 A;  4JZ3 A;  1AZG B;  2EYX A;  3M0P A;  3EHQ A;  1H3H A;  1SRM A;  2HCK A;  2M0Y A;  4J9D A;  1AWX A;  5GJV B;  2HEQ A;  1QKW A;  1ZLM A;  1NEB A;  2MIO A;  1K76 A;  1K9A A;  1Y0M A;  2J6F A;  2RNA A;  4A63 B;  4RTT A; 
#chains in the Genus database with same CATH topology
 3EGX B;  1OV3 A;  1UG1 A;  1VQL T;  3LW5 E;  1TUG B;  1W70 A;  3LYI A;  1VQ9 Q;  3JCM Q;  1WHH A;  3M58 A;  3CCU T;  3QYG B;  1QVF A;  1BB9 A;  2HDA A;  3CD6 Q;  3JRZ A;  1KQS P;  3CXC S;  1K4U S;  3QO3 A;  3CCU A;  4ZN1 A;  3QKJ A;  1PSE A;  3G1J A;  4AFS C;  1CSK A;  1AD5 A;  2YSQ A;  1YI2 A;  5GMK m;  2QGF B;  3SHW A;  1YIJ Q;  2KYB A;  1FMK A;  2K3Y A;  4M7A A;  2FPE A;  3MP8 A;  2P84 A;  2YUQ A;  1AWO A;  1BKB A;  4C5I A;  5KE2 A;  1EFN A;  2CZ0 B;  1B3Q A;  4OMP A;  1IRX A;  3VS6 A;  2COY A;  4FW1 A;  4OMF B;  3QWX X;  3GF5 A;  4N0A A;  2LCL A;  4F7U G;  2DF6 A;  4J8O A;  4M75 A;  1OI1 A;  3CCE T;  3M0S A;  5GMK e;  2MAM A;  3WVD B;  4J9H A;  3OS2 A;  2OTJ A;  3ZFJ A;  9ATC B;  1I5O B;  1QVG P;  2RJD A;  4IUT A;  1HXD A;  4M77 G;  2E5K A;  2KY9 A;  5I11 A;  5KYW B;  2EWN A;  4R56 A;  3FIF A;  3RUX A;  2LJ0 A;  4JRK A;  1F1B B;  2DMO A;  2DXT A;  1D0Y A;  1WI7 A;  4MML A;  1Q82 U;  4OMO A;  2CP0 A;  1WJR A;  4C8Q E;  4XTZ A;  2CDT A;  3IQL A;  5DLQ E;  3ME9 A;  2YUP A;  4L59 A;  1S72 T;  3MP6 A;  2QAZ A;  1K0X A;  1Z9Q A;  4JS5 A;  5HKC A;  4QQG A;  5IHI A;  1YIT Q;  2EGE A;  2ED1 A;  1SHG A;  5KYU B;  3I35 A;  6AT1 B;  2P4T A;  1EIF A;  4YTL A;  3M5A A;  1VQ5 A;  1H92 A;  3HRS A;  4LDU A;  5HY6 A;  1VQO Q;  1K8A R;  1G5V A;  1S1N A;  4JLG A;  2YUN A;  1WGS A;  4UC4 A;  2QA4 T;  3OMC A;  2C0I A;  2E4H A;  2LJ1 A;  1OX8 A;  2X3X D;  3OW2 A;  1G3T A;  2KI7 A;  3LLR A;  2CH4 W;  1VQK Q;  1D09 B;  1I0C A;  1OOT A;  3EG2 A;  1NLO C;  1VQ8 Q;  1VQ7 Q;  2A28 A;  1G83 A;  2CS7 A;  1H3Z A;  4OB2 B;  1I81 A;  2P4R A;  4M7D D;  2F2X A;  2JN0 A;  2E41 A;  5FW9 A;  4LDW A;  1BI3 A;  1ZUY A;  3I55 Q;  2B86 A;  4N4I A;  3VRY A;  4DOW A;  2M1H A;  2FPD A;  1QKX A;  2DL4 A;  1NJI C;  1AWJ A;  4AFU C;  1GCQ A;  5KE3 A;  3LWH A;  5GAM g;  1Y96 B;  3GLX A;  1X43 A;  2NUT B;  2LT4 A;  1N27 A;  3V7R A;  4B9W A;  2L5Q A;  4NL2 A;  2RO0 A;  4XU2 A;  3OYH A;  2WSC E;  1VQN A;  4KT0 E;  2RJF A;  4J9G A;  2MWO A;  2KRN A;  4JPB W;  4FW2 A;  5C0M A;  1AHJ B;  3PIP A;  3HL8 A;  4AFQ C;  1JO8 A;  2LQ8 A;  1YJN A;  4E6R A;  2SRC A;  2YRD A;  4BY6 C;  2RQW A;  1TU0 B;  1OZ3 A;  4C92 B;  4BE0 A;  2GQV A;  1AEY A;  3QDF A;  3CXC A;  2ESW A;  3E9F A;  1M1F A;  3OSV A;  1UGS B;  4C92 F;  1VQM A;  1YNZ A;  4ZTF A;  4FYV B;  4M7D A;  2IVW A;  4V2S A;  1T3S A;  2O9V A;  4ME7 A;  4ZTJ A;  2A3L A;  1YWO A;  2LQK A;  1HSQ A;  4EMK C;  2LQW A;  3EG9 A;  3PFS A;  4BY6 B;  4A53 A;  5DY9 A;  2VGN A;  3RIR A;  1N8R R;  1Q82 C;  4RKU E;  3G4S Q;  4M78 B;  3MEU A;  3SWN B;  2DL8 A;  2PVG B;  4KBM B;  3VUB A;  4QQ6 A;  3PIO A;  5GAN 2;  1HYO A;  5LJ3 j;  1TWB A;  1Q7Y U;  4M7D E;  3I5R A;  2EW3 A;  3R6O A;  1QCF A;  3KXT A;  1YJ9 A;  2GCX A;  2KXD A;  1CKA A;  4Y92 A;  3CBM A;  4Q5W A;  1SPK A;  4HVU A;  2DTI A;  4A54 A;  5D7U A;  2IIM A;  3G71 A;  5GAN d;  4EIK A;  2F5K A;  1WYX A;  3QXE B;  4K11 A;  4E7Z A;  2RI2 A;  5A2Q E;  1I8F A;  1OUL A;  1X69 A;  4D8K A;  1JXM A;  3QJ6 A;  1WPY A;  2MPX C;  3EH2 A;  3REA B;  4FIB A;  5CAI A;  5LJ5 e;  3CME Q;  1KIK A;  1D1B A;  5A0G A;  4GLK A;  4M75 F;  2JW4 A;  1IGU A;  3QWY A;  5I2M A;  1D1A A;  2D6F A;  4M7A C;  3V8L A;  4DA4 A;  1YWP A;  2CSI A;  2YUO A;  5GAM h;  1X27 A;  2ENM A;  3RKW A;  4QQD A;  3DLM A;  3E1S A;  3PTA A;  1Q81 U;  1YIJ A;  1YHQ T;  4BB7 A;  3VS7 A;  4A4F A;  1UB4 A;  3FRN A;  2AKL A;  2SEM A;  1M3C A;  1ZSZ A;  1E7O A;  2CZ1 B;  2K9G A;  3MEW A;  2EGC A;  2LVM A;  3RER A;  1RAA B;  2LNH B;  4C0F A;  4J9E A;  3M0U A;  4LE9 A;  3CME T;  5IH2 A;  1MND A;  3PMI A;  4E7L A;  2J06 A;  4IKF A;  3OBW A;  2E5Q A;  3C94 A;  5FU6 C;  3LGL A;  3CME A;  2C06 A;  4C8Q G;  1PD1 A;  3FDR A;  1W2B S;  2OTL Q;  1VUB A;  1MMN A;  4M77 A;  4M7A G;  2AIR B;  2RI3 A;  4J83 A;  1Y7X A;  5GAN 3;  3NGP A;  3CBP A;  4Z89 A;  4M7D B;  1UGQ B;  1JXO A;  2W0Z A;  3GBQ A;  2Y4Y A;  4HT9 A;  1VYV A;  2QGG A;  3A8O B;  2K79 A;  3JB9 G;  2NLU A;  3TSW A;  4XTW A;  2KXC A;  4PFO A;  2DL5 A;  3AHU A;  1VYT A;  4KUD K;  1TXQ A;  3CC4 A;  2X3W D;  3JV3 A;  4JS4 A;  4A4G A;  1Q7Y R;  3CC7 Q;  1XTD A;  3HTR A;  4HKE A;  1AWW A;  3MKD A;  4M75 E;  1EZZ B;  5GAO n;  3CMA T;  2X4X A;  4RTY A;  5EG2 A;  2LCC A;  3VRZ A;  4X9D A;  1D3B A;  4LDY A;  1W1F A;  4M7A F;  2K7A A;  3SEM A;  3BY7 A;  2M02 A;  2E70 A;  2H8H A;  1ZSZ B;  3H41 A;  4IIO A;  3KUF A;  4M7A B;  1GBR A;  3INZ A;  2LMJ A;  4M77 F;  4KGZ B;  1UDL A;  3TU4 K;  4PKC C;  1IZ6 A;  1WXB A;  4DEY A;  1RUW A;  1VQ9 A;  1K9M U;  4A4E A;  1C0M A;  1KQS S;  5DLO A;  1BCM A;  2KRS A;  2HL5 C;  3TQ7 P;  1IB8 A;  3UF4 A;  4FYW B;  2DIG A;  3M4Y A;  1I5L A;  2VXE A;  1QP2 A;  2ZPI B;  4M7D F;  2OAW A;  4CI0 C;  2K3B A;  3PGG A;  2DPP B;  4JUV A;  4F17 A;  5KH6 A;  1MV0 B;  2XU8 A;  4ELY C;  1D0Z A;  4JZ3 A;  5CIU A;  2YRV A;  2YRC A;  3QBY A;  3M0P A;  1RAC B;  3DLL A;  1QVG A;  3OB9 A;  4J9D A;  5GAN f;  2NUT A;  1NEB A;  1Y0M A;  4RTT A;  1N8R C;  4HCC A;  4KGX B;  2DK3 A;  4PJO F;  1QVG S;  2VKN A;  1WQW A;  2JOY A;  1GFD A;  1BCO A;  1PKS A;  4M78 G;  5FU6 B;  5LJ3 d;  1IGQ A;  3CC2 A;  4E47 A;  1ZHI A;  1YFN A;  2JTM A;  3VS4 A;  1K9M R;  2XMF A;  2CZ7 B;  2GTJ A;  1WHJ A;  2A08 A;  1QP3 A;  2XI9 A;  3SB2 A;  5KYW A;  4JJN K;  4RTW A;  1GBQ A;  2DEQ A;  3EFO B;  1D3B B;  3FJP A;  3X24 B;  2CP3 A;  4RCB A;  1B34 B;  3O5Z A;  4F7U A;  1PG5 B;  1QVF P;  4M7A D;  1R0C B;  3SWN A;  2EJG A;  4M77 C;  3M53 A;  1M30 A;  1VQM Q;  2QTX A;  3HHT B;  2DJQ A;  2BE7 D;  2OTJ Q;  2BZ8 A;  3EFO A;  2K5L A;  2CRE A;  2KRM A;  4LXC A;  2FHD A;  4J9C A;  2RA2 A;  4AFZ C;  4DQ2 A;  2DBM A;  2DET A;  2MF2 A;  2DFU A;  2FRY A;  4BD3 A;  2K6D A;  1BI1 A;  1GRI A;  1UHC A;  1KD1 R;  5IT9 E;  1NZ9 A;  1QVP A;  1JRI A;  3FEO A;  4IUP A;  2Y90 A;  1NYF A;  3PE0 A;  1K73 U;  3RES A;  2EVR A;  4NOY A;  3NFC A;  1Q86 R;  4LD9 K;  2JMA A;  2VV5 A;  2Z0W A;  1WJS A;  4C0D B;  3RNJ A;  2DX1 A;  3V7S A;  2JTE A;  4CC7 A;  4OVA A;  3VS1 A;  2PVO B;  2QG9 B;  4N0A C;  2IPO B;  4L5G A;  2RQT A;  4FSX A;  3L2U A;  1WQ7 A;  1LPL A;  1RI9 A;  2D9T A;  2E64 A;  2EYY A;  1OU9 A;  2EJF A;  1K8A U;  4C0D C;  1ZBJ A;  3J80 E;  2GBQ A;  2D8J A;  3CC7 T;  4XTV A;  4D8D A;  2DVJ A;  3H0I A;  4VUB A;  3CC7 A;  3QHS A;  3X26 B;  4WTO B;  4XQ3 A;  2LZ6 B;  2L3Q A;  1Q7Y C;  1WHG A;  2GGR A;  2DVE A;  3CCL A;  4J6W A;  4D6W A;  2EQI A;  2HSE B;  3M0R A;  1MGQ A;  2DNU A;  1X75 C;  1M90 C;  2PNI A;  2VAS A;  2C0T A;  3UT1 A;  3OYJ A;  3DKM A;  1U5S A;  4EMK A;  2R58 A;  1WHL A;  3EFS A;  4DBR A;  2RMO A;  1W4S A;  1SF9 A;  2C0O A;  2JJ9 A;  4BI8 B;  2QXF A;  3RDV A;  2RHI A;  3L1A A;  1SEM A;  1V29 B;  5ECA A;  2CUB A;  4TVR A;  4BI3 A;  1KD1 C;  1X2K A;  2QDY B;  3LGF A;  2X4Y A;  1JB0 E;  3H6Z A;  1C1A A;  1YJW Q;  2ZPH B;  2ZPF B;  2RHY A;  4DEX A;  2PTK A;  2F1L A;  1K73 R;  4ATO A;  3VS0 A;  1SSF A;  1XOV A;  1ZUK A;  4QT7 A;  2HSP A;  2MOX A;  1N8R U;  2DYI A;  4J6Y A;  4MMK A;  5CK9 A;  3QUI A;  1BYM A;  2EJ9 A;  3JCM V;  2P0P A;  2MI6 A;  2X4J A;  3M54 A;  3J81 E;  4CRI A;  3EGU A;  4HCZ A;  3OSS C;  3VS5 A;  1V76 A;  4BE2 A;  3CCS T;  3OQ5 A;  4LD6 A;  3PMT A;  2A7Y A;  5FWB A;  1VQ4 A;  1NJI U;  3FC3 A;  3G71 T;  4XU3 A;  4HXJ A;  2EGA A;  5C6S A;  3VKI A;  3QPH A;  5LJ5 g;  1OX9 A;  4PNO A;  1VQL A;  2L3R A;  4F14 A;  2MWP A;  2I2L A;  5CKB A;  1VQP T;  1K9M C;  1E6H A;  1M1K U;  3CCU Q;  4WF2 A;  4PJO C;  2BIV A;  1NBE B;  2QQ9 A;  2EQU A;  1N5Z A;  1FMV A;  2L2P A;  2KSS A;  1VQP Q;  1FXX A;  1X6B A;  3CBO A;  3QZ5 B;  1LOJ A;  2DXC A;  3I56 T;  2OX7 A;  2KAF A;  3EG3 A;  2YLC A;  3GNG A;  4FYY B;  3I56 A;  1XJW B;  2M16 A;  3M0Q A;  2E6Z A;  3MHX A;  3JB9 F;  2FB7 A;  3TSZ A;  3OYB A;  2XG8 D;  4HVW A;  3OYC A;  2V26 A;  1WJQ A;  2L8D A;  5CKD A;  4OB0 B;  5GAN g;  3HP9 A;  3BFM A;  1U1S A;  4LUE A;  3L2V A;  5CO7 A;  4KUI A;  4OML A;  4M78 A;  4NL3 A;  2DXB A;  1WA7 A;  1M1G A;  2CYZ B;  2RHU A;  1VIE A;  4L6V 5;  5GAO l;  5I2S A;  3H8Z A;  2XID A;  3RR6 A;  2G3R A;  3A1P A;  1I4K 1;  2E12 A;  2H3J A;  3A8G B;  1SHF A;  1V1C A;  5GAN 6;  3JCM g;  1PSF A;  2RM4 A;  2HL3 A;  2CP2 A;  2KRO A;  4FT4 A;  8AT1 B;  4PJM A;  4RUG A;  5FU7 B;  2QQB A;  4PK4 A;  4J9B A;  4N4G A;  3OY9 A;  1BU1 A;  3GOX A;  3OYK A;  4EMH A;  2FZK B;  1BK2 A;  4EMG A;  4C8Q C;  5CQX A;  1MMA A;  2MMP A;  3PT9 A;  1E6G A;  2RI5 A;  4J7I A;  3L2Z A;  1TTH B;  1BI0 A;  2QTV A;  2FG0 A;  4M78 F;  2EYZ A;  1Z9Z A;  2EYQ A;  2VVK A;  2QQA A;  2QEX T;  3CCM T;  4C92 D;  2RPN A;  1YJN Q;  1QW1 A;  4F7U F;  2ATC B;  2K2V A;  3HFO A;  3PVQ A;  4ZNX A;  5J26 A;  4E7H A;  2O4X A;  5LJ3 g;  4BAC A;  2KNB B;  1X6O A;  2DO3 A;  2DXU A;  1WHK A;  2RD1 A;  2RF0 A;  1YN8 A;  3JSC A;  4XAX B;  1FYN A;  5GAN j;  5D6Y A;  2F5T X;  2MYS A;  1WIE A;  1D1C A;  3S3O A;  1VQ8 T;  1G3Y A;  3R6N A;  4C0G A;  1QQJ A;  4IUV A;  1VQM T;  2DBK A;  3A8L B;  4C92 E;  3I9Q A;  1YJN T;  1VQ8 A;  4M77 D;  3L2R A;  2DYB A;  1CKB A;  2FL7 A;  4JZ4 A;  2JUF A;  3CEY A;  3BW1 A;  4QW2 A;  2QQS A;  3AT1 B;  3JCM d;  2DZC A;  5FRN A;  2X4W A;  1H3H A;  1SRM A;  3H9N A;  2RJC A;  1MHN A;  5D6X A;  3CCS Q;  2FZG B;  2RH2 A;  3G6E Q;  1K76 A;  1K9A A;  2RNA A;  2GQI A;  2HQH A;  1NLP C;  1MUZ A;  2X51 A;  1VQ7 A;  3UWN A;  4C5H A;  3DB3 A;  4F7U E;  4ANJ A;  3VV0 A;  2KR3 A;  3THK A;  1GXI E;  3S3M A;  1M9S A;  1YJ9 T;  1K1Z A;  2YWW A;  1TOV A;  1IXD A;  3JAM E;  3CCV A;  4RTU A;  3S3N A;  1X6G A;  2WSE E;  2PUO B;  4BE1 A;  3EG9 B;  1NM7 A;  4ORZ A;  4RTZ A;  2LC4 A;  2RB6 A;  1NPR A;  1S72 Q;  3CCQ T;  3EGD B;  4E7J A;  3WXM B;  2BUD A;  4M77 E;  3QG1 A;  4WCI A;  3NHN A;  2LNV A;  3OYL A;  1YIJ T;  2ZAE A;  3MCA B;  3J7A F;  1UGR B;  3QJY A;  4M7D C;  3HRT A;  2X35 A;  2BE9 B;  3QSU A;  1UFF A;  5IAY A;  4J9I A;  3PNW C;  2P0Q A;  1HK9 A;  3TRE A;  4Y91 A;  3OW2 S;  2KK4 A;  1WXT A;  4PJO B;  1BIB A;  1VQN Q;  1R0B G;  2AK5 A;  2E6N A;  3X28 B;  4KH0 B;  1KQ1 A;  5LJ5 f;  1K8A C;  2YXY A;  3M4G A;  4GLM A;  2EQK A;  3O8V A;  2PQW A;  1RL2 A;  2QYZ A;  1TG0 A;  3EHR A;  1YJW T;  1IO6 A;  2YLB A;  1Q81 C;  5GAM f;  3EH1 A;  5GAM e;  3A98 A;  4N4H A;  1YJW A;  2AZV A;  2RJE A;  1QCO A;  1G2B A;  3VJP A;  3SWN C;  2MK5 A;  2AHJ B;  1AOJ A;  2CKK A;  3JB9 D;  3JCM h;  1VOM A;  8ATC B;  2LQN A;  1H8K A;  2PZ1 A;  3JCM f;  3SDZ A;  3GNF B;  4O5V A;  2L3S A;  5IXF A;  2COW A;  2LX9 A;  2ED0 A;  5GAN 4;  4A4H A;  4C92 C;  1KQS A;  3LX7 A;  2BKD N;  3CCL T;  2OTL A;  3OW2 P;  2BZY A;  1VQ4 Q;  1M8M A;  4XK8 E;  3MPU B;  1VQ6 T;  4RG8 A;  2CT3 A;  1NPP A;  5IHN A;  3UAT A;  2JT4 A;  1PNJ A;  4EPC A;  4Z02 A;  2OAU A;  2EPD A;  2FRW A;  1NG2 A;  1ZA1 B;  2K5F A;  3CMA A;  1TUD A;  2RQR A;  1WZO A;  4IUQ A;  3CCQ Q;  5L8R E;  2P0K A;  5I22 A;  2A37 A;  3URG A;  4M77 B;  5GAO m;  2J6K A;  2V1Q A;  1TS9 A;  3MEV A;  4PJO D;  3TVT A;  4JRP A;  2EQJ A;  4EMK B;  1ACM B;  5CKH A;  4KH1 B;  1WDX A;  2DM1 A;  4FL6 A;  1Q82 R;  5GAN h;  3HRU A;  5CVI A;  3VUZ A;  3VYG A;  1RI0 A;  4MDX A;  3CCJ Q;  2F69 A;  3RBB B;  4QVC A;  4AMC A;  2ECZ A;  2FO0 A;  1QWE A;  4M75 C;  3UPU A;  3NPF A;  3JB9 J;  3CCJ T;  3CCS A;  2E3H A;  3OBY A;  1O9S A;  2E10 A;  3X20 B;  5KYY B;  2O4X B;  4ZGJ B;  3MO8 A;  1G3S A;  3I5S A;  2FVU A;  4AG1 C;  3OYD A;  3F70 A;  3OS1 A;  3CC2 T;  4RCC A;  3H0H A;  1PM3 A;  3EFR A;  4IUR A;  1JBM A;  4JRI A;  1SSH A;  2QAS A;  1AVZ C;  4PJN A;  3JCM X;  2DIQ A;  1KC8 U;  3OA6 A;  1M4Z A;  2VUB A;  2FPF A;  1U1T A;  5GAO p;  1YHQ Q;  2O9S A;  5LJ5 j;  2MCN A;  3EGX A;  3Q1J A;  1IHV A;  2NUP A;  1MMG A;  1RAG B;  4PFP A;  1B7T A;  1XQH A;  2GF7 A;  2O88 A;  2PVD B;  5LJ5 h;  2V1R A;  3JCM b;  2JNG A;  3L2Q A;  2GFA A;  4C0Z A;  2AT1 B;  4FU6 A;  3P8B B;  2D1X A;  1YI2 T;  4X34 A;  2FYK A;  3FJ5 A;  4ELZ C;  3CCE A;  2DIL A;  2GFU A;  5CCA A;  4E7K A;  1KD1 U;  4A4K A;  1VQO T;  2OTJ T;  4F04 B;  2J05 A;  2XIC A;  2GNC A;  1GL5 A;  5J39 A;  2JMC A;  2PUK B;  1WFW A;  2XD0 A;  3KBG A;  5DM7 R;  2RHZ A;  3JCM e;  1IHW A;  3ER0 A;  2NUP B;  4MDW A;  4M7D G;  2F2V A;  4JJC A;  5M9O A;  5FU7 C;  2XK0 A;  2JXB A;  2L0A A;  1U06 A;  2LTO A;  3GP8 A;  2HKQ B;  1JEG A;  2ROL A;  2KE9 A;  3LH0 A;  2EKH A;  1RLQ C;  1UGP B;  3OYG A;  1WNL A;  3JCM J;  3NTK A;  2XHC A;  2M51 A;  4X1V A;  1OPK A;  3I55 T;  4C92 G;  4BI4 A;  2KVQ G;  3HFN A;  2H3E B;  1FX7 A;  2QA4 A;  3GPL A;  3I55 A;  1WLP B;  3NTI A;  3U23 A;  2HBP A;  3JCM W;  1ZUU A;  1VQK T;  1RAI B;  4PLI A;  2OI3 A;  4FCY A;  3EG1 A;  4IUU A;  4HCK A;  5KCO A;  1VQ5 T;  2D8H A;  2J6O A;  2NWM A;  1VQK A;  3EAE A;  4Z8A A;  2KMT A;  1ZX6 A;  2O01 E;  3OMG A;  3L42 A;  3REB B;  1KC8 R;  5CQY A;  1MMD A;  4KGV B;  4MZM A;  1ZSZ C;  2XKO C;  1ARK A;  1ZBX A;  4FT2 A;  3NTH A;  3KFV A;  4LNP A;  2DL7 A;  4C5G A;  2DRK A;  5FRO A;  3QZ9 B;  4IIM A;  1UE9 A;  5HK0 A;  1OZ2 A;  1RLP C;  2RQU A;  2EAY A;  2COZ A;  1M1K R;  1UUE A;  4LDV A;  1KFZ A;  5GAO q;  5GAN 5;  3OYN A;  2JS2 A;  3EGD A;  2VC8 A;  3BDL A;  4DOV A;  4PJO E;  2M9U A;  1K0S A;  1M2V B;  2DJZ A;  1W2B P;  3PVL A;  1PRL C;  3E9G A;  1QLY A;  4PJL A;  1YBY A;  5KYX A;  3FLG A;  1VYU A;  4C8Q A;  4CC3 A;  4OMQ A;  1TUC A;  3M56 A;  2V8I A;  5IHK A;  3CCR A;  4JRQ A;  4QKU A;  4M78 C;  2L89 A;  1I07 A;  4M75 D;  5I21 A;  3BE3 A;  2FEI A;  1OEB A;  4HA8 A;  2EYW A;  3CCR T;  3CPF A;  3X25 B;  3EG0 A;  3NMZ C;  1YI2 Q;  2Y4X A;  4PJO G;  5GAM j;  4P5N A;  3OYE A;  2DD4 A;  3QII A;  3C4S A;  2HCK A;  4II1 A;  1AWX A;  5GJV B;  5LJ5 d;  1QMC A;  3G7Z A;  1WHM A;  4RMO A;  3CD6 T;  1ZLM A;  1TH7 A;  2LT1 A;  4A63 B;  2CGH A;  2J6F A;  3M55 A;  1SKU B;  4E2F B;  2D0Q B;  1VA7 A;  4Z88 A;  1TSF A;  2DRM A;  2K4Y A;  3CD6 A;  1JJ2 A;  1YP5 A;  1GFC A;  2CP6 A;  2K57 A;  1LJO A;  1RAF B;  2HQX A;  4M4Z A;  2R57 A;  3SD4 A;  4F7U B;  4M7A E;  3RKY A;  2CZ6 B;  1RAD B;  5L23 A;  3CCV T;  4QVD A;  2VWF A;  2KBT A;  3RMS A;  2HMA A;  2A0F B;  2VGM A;  1MNE A;  4ZN3 A;  2EFI A;  3P8D A;  3JCM c;  1FWZ A;  1OQK A;  4F16 A;  4OMN A;  1UGV A;  5AT1 B;  4DBH A;  1VQP A;  1C6V X;  3E2U A;  1JQQ A;  1M1K C;  5LJ3 h;  3MP1 A;  2DAQ A;  1XNI A;  2VXF A;  4CC4 B;  1KJW A;  4OB3 B;  2GTO A;  3LWI A;  3I56 Q;  1HJD A;  5FRM A;  2EKO A;  4BDY A;  2CT4 A;  4OP0 A;  7AT1 B;  3RKX A;  5CKF A;  1H64 1;  2PU9 B;  3OS0 A;  4O6J A;  4PJO A;  3JB9 H;  1BBZ A;  2WSF E;  4DBF A;  2DKG A;  4PL6 A;  3OYY A;  3OYM A;  4HCB A;  2CUD A;  4PJJ A;  2RN8 A;  3TEE A;  3UA7 A;  2E1H A;  2ZPB B;  1WXU A;  1A0N B;  4HT8 A;  4NS5 A;  4GY5 A;  2KYM A;  2BTT A;  2HZY A;  2LX7 A;  2YT6 A;  3G4S A;  5GJW B;  1AT1 B;  2JZ2 A;  4OGE A;  1S72 A;  2LJ3 A;  3M59 A;  5FWC A;  3S6W A;  2JTF A;  2IG0 A;  4JJD A;  3G4S T;  2HQE A;  1VIF A;  5HK3 A;  1KK7 A;  1B07 A;  3C12 A;  4RTV A;  3CPW P;  1ZQ1 A;  4C8Q D;  4J6X A;  3OYI A;  2KGT A;  1OYX A;  2V8J A;  2D0N A;  3ASK A;  5EC7 A;  2DA9 A;  4BDZ A;  1ABQ A;  2O2O A;  4M75 B;  2CP5 A;  3ZEH A;  5KYN A;  2OTL T;  1B34 A;  4ESR A;  1M90 R;  1PRM C;  1Q95 G;  3LH5 A;  1M3B A;  1KC8 C;  1YCS B;  2XDB A;  2OJ2 A;  3HKS A;  3QDR B;  3G6E T;  1NYG A;  4RTX A;  4E7S A;  1PKT A;  2B8A A;  2ABL A;  3G6E A;  3M0T A;  4AG2 C;  3CC4 T;  1X2Q A;  4JJB A;  4XU0 A;  4FM4 B;  4KUL A;  1R8O B;  3CCR Q;  1RAE B;  4X9C A;  1M5Q 1;  2HBW A;  5GAN e;  2QEX A;  3CCM A;  1N9R A;  3H0F A;  5GMK j;  2NUZ A;  3MEA A;  5AYF A;  4BUG A;  5GMK l;  1M3A A;  2EQM A;  5A0D A;  2QA4 Q;  1JU5 C;  1P92 A;  2L3P A;  1N6A A;  1Y07 A;  4JLI A;  1KG1 A;  2O31 A;  2JM9 A;  4M78 D;  3CPW S;  1HD3 A;  2J7I A;  5KCH A;  1VQN T;  2ZGW A;  3VS3 A;  3A8M B;  1O75 A;  3CCV Q;  1KSW A;  3G71 Q;  1AZE A;  1M8V A;  1T3L A;  1PD0 A;  5FLX E;  3ZBD A;  4MZP A;  4R55 A;  2QK0 A;  4XTY A;  1Y96 A;  2CSQ A;  2LRQ A;  1OPL A;  2KT1 A;  1ABO A;  1T0H A;  1U8R A;  5GAM d;  4HVV A;  3L2W A;  2HAX A;  5KYU A;  3CPW A;  1VQ7 T;  4M75 G;  1N9S A;  1K73 C;  3VU3 C;  5LL6 S;  2E65 A;  1UJY A;  2HNI A;  1VQ6 Q;  1VQ5 Q;  3CCL Q;  3C95 A;  3JCM P;  1Q81 R;  3MJX A;  2ZPE B;  2VB6 A;  2ZPG B;  2V8K A;  2CH4 A;  3SFM A;  3CXC P;  1LNX A;  1ZSG A;  3ULR B;  1G8X A;  2W10 A;  1T0J A;  1YIT T;  1YJ9 Q;  1JJ2 S;  2QEX Q;  3CCM Q;  3FB9 A;  2JM8 A;  1W6X A;  4LDX A;  1EX4 A;  2KQW A;  4MZT A;  4E7I A;  2AKK A;  1JJ2 P;  3D7S B;  3BDU A;  1YIT A;  1SRL A;  4OMM A;  1QVF S;  1G3W A;  1FMW A;  3CCQ A;  4QVZ A;  1M2O A;  1Q86 U;  4LUD A;  1KQ2 A;  2DTO A;  2K3X A;  4ZGE B;  1VQO A;  1KHC A;  1UEB A;  2QI2 A;  1J3T A;  1I1J A;  1LCK A;  2AZS A;  1ZA2 B;  4PFZ A;  3QYH B;  1SG5 A;  1QCN A;  1X01 A;  4M78 E;  1Y71 A;  2BZX A;  2QDL A;  4PLL A;  2DD5 A;  2KDS A;  2KEA A;  4OB1 B;  5GAN 8;  2LDM A;  2WAC A;  1U3O A;  4J7F A;  1NE8 A;  4FSS A;  3OYF A;  2HKN A;  3CMA Q;  2ZCF B;  4OGC A;  3CCE Q;  2E3I A;  4GBQ A;  2HD0 A;  3ZL7 C;  2K5I A;  3JB9 I;  1PHT A;  4OF1 A;  2RQV A;  3MET A;  2EIF A;  1IRE B;  4B9X A;  1UTI A;  1YHQ A;  4C92 A;  3A8H B;  1M2V A;  4C8Q F;  3P8H A;  3RMQ A;  3CC2 Q;  2DZ9 A;  1NEG A;  2EBP A;  1RAB B;  5KYY A;  2XDD A;  1W2B A;  4CC2 A;  1UEC A;  5CR2 A;  2CP7 A;  4KRT A;  4ZGD B;  4JDS A;  2ROT A;  2QQR A;  5CKE A;  1VQL Q;  3VS2 A;  2JVV A;  3UA6 A;  2DER A;  1OU8 A;  1MV3 A;  3WVE B;  3V8K A;  3M57 A;  3OYA A;  2DL3 A;  1GCQ C;  1UJ0 A;  2KT8 A;  4EDU A;  2XDP A;  1PWT A;  4XU1 A;  5LJ3 f;  4DBQ A;  5LJ3 e;  2LP5 A;  2F2W A;  3CC4 Q;  2YHT A;  4J9F A;  3A5Z B;  1RAH B;  1Y57 A;  5GAN 7;  1VQ6 A;  4XTU A;  1KHI A;  1WX6 A;  4XTX A;  5GMK h;  1NJI R;  2X9H A;  2NYS A;  1BIA A;  2YDL A;  5D6W A;  2K2M A;  3N5B B;  2R5A A;  1LVK A;  3UDC A;  3V7C A;  3HSB A;  4C8Q B;  1R77 A;  5KYX B;  2I0N A;  2DLP A;  2FZC B;  2RK1 A;  4RG2 A;  3V8J A;  3T9N A;  5HCK A;  2A36 A;  1PCX A;  5GMK i;  3VYH B;  1GCP A;  3GIB A;  3C0C A;  2DE0 X;  1UHF A;  1Q86 C;  3OS5 A;  1QWF A;  2LCS A;  2DTH A;  2G6F X;  1VQ9 T;  1M27 C;  4LN2 A;  3CQT A;  5J3B A;  2M0O A;  2RHX A;  4R0K A;  1DJ7 B;  5A0L A;  5IXB A;  2JS0 A;  1D0X A;  1BI2 A;  3DB4 A;  2VYT A;  4AT1 B;  3TCJ A;  1M90 U;  1YCY A;  3CCJ A;  5IN1 A;  1AZG B;  2EYX A;  2DEU A;  3EHQ A;  3HPW A;  3M9Q A;  4B6M A;  5GAO r;  3E19 A;  4FYX B;  2M0Y A;  2RK2 A;  2ZZD A;  4C5E A;  1PC0 A;  2HEQ A;  1QKW A;  2R5M A;  4J5Y A;  1VQ4 T;  2MIO A;  4Y28 E; 
#chains in the Genus database with same CATH homology
 1VA7 A;  2GQI A;  1OV3 A;  1NLP C;  1MUZ A;  1UG1 A;  4Z88 A;  2DRM A;  1W70 A;  1YP5 A;  2VKN A;  1GFC A;  1GFD A;  1PKS A;  4M4Z A;  5L23 A;  2KR3 A;  3THK A;  1BB9 A;  2HDA A;  1K1Z A;  2VWF A;  2KBT A;  3VS4 A;  2XMF A;  2GTJ A;  1K4U S;  2A08 A;  4RTW A;  1GBQ A;  4F16 A;  4RTU A;  1X6G A;  4AFS C;  4OMN A;  1UGV A;  1CSK A;  1AD5 A;  2YSQ A;  3SHW A;  1NM7 A;  4ORZ A;  4RTZ A;  3O5Z A;  1JQQ A;  2KYB A;  1FMK A;  2FPE A;  2YUQ A;  1AWO A;  4CC4 B;  1KJW A;  1EFN A;  1B3Q A;  1M30 A;  2GTO A;  4OMP A;  1HJD A;  3VS6 A;  2DJQ A;  4WCI A;  3NHN A;  3QWX X;  2BZ8 A;  2CT4 A;  2CRE A;  2DF6 A;  2KRM A;  3M0S A;  4J9C A;  4AFZ C;  4J9H A;  2DBM A;  1UFF A;  4J9I A;  1BBZ A;  2FRY A;  2E5K A;  2K6D A;  5I11 A;  1GRI A;  1UHC A;  2CUD A;  1WXT A;  2RN8 A;  2LJ0 A;  3UA7 A;  2DMO A;  1NYF A;  2AK5 A;  3PE0 A;  1WI7 A;  1A0N B;  1WXU A;  4OMO A;  2EVR A;  2CDT A;  3IQL A;  4GLM A;  2YUP A;  1TG0 A;  2KYM A;  1K0X A;  2BTT A;  3EHR A;  1Z9Q A;  2JMA A;  1IO6 A;  2LX7 A;  2YT6 A;  5GJW B;  2LJ3 A;  5IHI A;  3RNJ A;  2EGE A;  2DX1 A;  5FWC A;  3A98 A;  2JTE A;  4CC7 A;  2AZV A;  2ED1 A;  1SHG A;  3VS1 A;  3I35 A;  4JJD A;  1G2B A;  1H92 A;  1S1N A;  2YUN A;  1B07 A;  1AOJ A;  4RTV A;  2C0I A;  2RQT A;  2KGT A;  2LJ1 A;  2X3X D;  2D0N A;  2LQN A;  5EC7 A;  1H8K A;  2CH4 W;  2DA9 A;  1RI9 A;  1ABQ A;  2PZ1 A;  1I0C A;  2O2O A;  1OOT A;  3EG2 A;  1NLO C;  2L3S A;  5IXF A;  2EYY A;  2A28 A;  1G83 A;  4ESR A;  1PRM C;  1ZBJ A;  2ED0 A;  2GBQ A;  2P4R A;  2D8J A;  1M3B A;  3LH5 A;  2F2X A;  1YCS B;  4D8D A;  5FW9 A;  2DVJ A;  1ZUY A;  2OJ2 A;  3H0I A;  2BZY A;  1NYG A;  4RTX A;  2B86 A;  1M8M A;  3VRY A;  2FPD A;  1QKX A;  2DL4 A;  2LZ6 B;  2L3Q A;  2CT3 A;  5IHN A;  1AWJ A;  1PKT A;  1GCQ A;  4AFU C;  2GGR A;  2ABL A;  3M0T A;  3UAT A;  4AG2 C;  1X2Q A;  2EQI A;  4JJB A;  3M0R A;  2JT4 A;  1X43 A;  1PNJ A;  2DNU A;  2PNI A;  2C0T A;  2HBW A;  2EPD A;  2FRW A;  1NG2 A;  1U5S A;  3H0F A;  2NUZ A;  1TUD A;  2RQR A;  1M3A A;  2RMO A;  4J9G A;  1JU5 C;  2L3P A;  2KRN A;  2C0O A;  4JPB W;  5I22 A;  2A37 A;  2O31 A;  2JM9 A;  1HD3 A;  2J6K A;  2V1Q A;  1SEM A;  2J7I A;  4AFQ C;  1JO8 A;  3TVT A;  3VS3 A;  5ECA A;  2CUB A;  1X2K A;  4E6R A;  2SRC A;  1KSW A;  1AZE A;  2RQW A;  1T3L A;  1WDX A;  2DM1 A;  1AEY A;  4DEX A;  2ESW A;  2PTK A;  3VS0 A;  1XOV A;  1ZUK A;  4QT7 A;  2HSP A;  1YNZ A;  2MOX A;  2CSQ A;  3RBB B;  2ECZ A;  2FO0 A;  1T3S A;  1QWE A;  2O9V A;  1OPL A;  2KT1 A;  1YWO A;  1ABO A;  3NPF A;  1HSQ A;  1T0H A;  2LQW A;  4HVV A;  3EGU A;  3VS5 A;  3I5S A;  2DL8 A;  4AG1 C;  5FWB A;  3I5R A;  2EW3 A;  1QCF A;  1UJY A;  3H0H A;  4HXJ A;  2KXD A;  1CKA A;  2EGA A;  4Y92 A;  1SPK A;  4HVU A;  1SSH A;  1AVZ C;  2CH4 A;  1ZSG A;  2IIM A;  4F14 A;  3ULR B;  2W10 A;  4EIK A;  1WYX A;  2FPF A;  1T0J A;  2O9S A;  2MCN A;  1E6H A;  4K11 A;  2JM8 A;  1W6X A;  2AKK A;  1N5Z A;  2L2P A;  1SRL A;  4OMM A;  1X69 A;  1X6B A;  2O88 A;  4D8K A;  1JXM A;  2V1R A;  4LUD A;  3EG3 A;  3REA B;  2D1X A;  1KIK A;  1J3T A;  1I1J A;  1LCK A;  2JW4 A;  2AZS A;  3FJ5 A;  3M0Q A;  3QWY A;  2DIL A;  2J05 A;  3TSZ A;  2BZX A;  4HVW A;  1YWP A;  2CSI A;  2GNC A;  2QDL A;  2YUO A;  2KEA A;  1X27 A;  2ENM A;  1GL5 A;  2JMC A;  1U3O A;  1WFW A;  4FSS A;  4GBQ A;  3ZL7 C;  1PHT A;  3VS7 A;  2RQV A;  2AKL A;  2F2V A;  4JJC A;  4LUE A;  1UTI A;  2SEM A;  1M3C A;  2JXB A;  1E7O A;  1U06 A;  2L0A A;  2K9G A;  2EGC A;  1JEG A;  4OML A;  2ROL A;  2KE9 A;  2EKH A;  2LNH B;  4J9E A;  2EBP A;  1NEG A;  1RLQ C;  3M0U A;  1WA7 A;  4LE9 A;  5IH2 A;  4CC2 A;  2M51 A;  1UEC A;  4X1V A;  2J06 A;  1OPK A;  4KRT A;  1SHF A;  1V1C A;  2ROT A;  2KRO A;  3VS2 A;  3UA6 A;  1WLP B;  4RUG A;  3U23 A;  1ZUU A;  1MV3 A;  3NGP A;  2DL3 A;  2OI3 A;  4Z89 A;  4J9B A;  1GCQ C;  1UJ0 A;  2KT8 A;  3EG1 A;  1PWT A;  1BU1 A;  4HCK A;  1JXO A;  2D8H A;  2J6O A;  2W0Z A;  2NWM A;  3GBQ A;  4Z8A A;  2LP5 A;  1BK2 A;  2F2W A;  1VYV A;  4J9F A;  1ZX6 A;  2K79 A;  3REB B;  1Y57 A;  1E6G A;  3TSW A;  2KXC A;  1ARK A;  1WX6 A;  2DL5 A;  1VYT A;  3KFV A;  4LNP A;  2X3W D;  3JV3 A;  2DL7 A;  2FG0 A;  2DRK A;  2EYZ A;  1Z9Z A;  2VVK A;  4IIM A;  2YDL A;  1UE9 A;  1AWW A;  1RLP C;  2RQU A;  2K2M A;  2RPN A;  1UUE A;  4RTY A;  1KFZ A;  3VRZ A;  2JS2 A;  1W1F A;  2K7A A;  3SEM A;  3PVQ A;  2H8H A;  2I0N A;  3H41 A;  4IIO A;  4ZNX A;  1K0S A;  2DLP A;  1GBR A;  2LMJ A;  5HCK A;  3PVL A;  2KNB B;  1PRL C;  1UDL A;  2A36 A;  1QLY A;  1WXB A;  4DEY A;  1RUW A;  2RF0 A;  1YN8 A;  1GCP A;  1FYN A;  3C0C A;  2DE0 X;  1UHF A;  1VYU A;  1QWF A;  1WIE A;  2LCS A;  2KRS A;  2G6F X;  3R6N A;  4CC3 A;  4OMQ A;  1TUC A;  1M27 C;  4LN2 A;  3UF4 A;  5IHK A;  3CQT A;  4R0K A;  2DBK A;  5IXB A;  1I07 A;  2JS0 A;  2FEI A;  3I9Q A;  1OEB A;  2OAW A;  2K3B A;  2EYW A;  2DYB A;  4F17 A;  1CKB A;  3EG0 A;  3NMZ C;  1MV0 B;  4JZ4 A;  4JZ3 A;  1AZG B;  2EYX A;  3M0P A;  3EHQ A;  1H3H A;  1SRM A;  2HCK A;  2M0Y A;  4J9D A;  1AWX A;  5GJV B;  2HEQ A;  1QKW A;  1ZLM A;  1NEB A;  2MIO A;  1K76 A;  1K9A A;  1Y0M A;  2J6F A;  2RNA A;  4A63 B;  4RTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...