1ZUKA

Yeast bbc1 sh3 domain complexed with a peptide from las17
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
EPEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFVAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin tail region-interacting protein MTI1
publication title Structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 14
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zukA00
2DL7A 4Z8AA 3C0CA 1RLPC 1QKXA 1SSHA 2FG0A 2GGRA 2MIOA 1ZLMA 2PZ1A 1W70A 1E7OA 2ESWA 1NYGA 1JO8A 2LJ1A 3PVLA 1SHGA 1T3LA 1LCKA 2EPDA 3THKA 2G6FX 2A28A 1I0CA 1JXMA 3H0FA 1WIEA 2CREA 2KNBB 2O9SA 2KRNA 2CSQA 1B07A 2K6DA 1X69A 5IXFA 1VYUA 4J9GA 3VS6A 4RTTA 3R6NA 2EVRA 1MV0B 2BTTA 1CKAA 2JMAA 2LQNA 2YUNA 3M0SA 2EKHA 4AG2C 1H92A 2DX1A 1M8MA 3EG0A 3EHQA 2VKNA 1S1NA 1WX6A 3LH5A 2CT3A 1SRLA 2AZSA 1X6BA 1JEGA 2AKKA 1A0NB 2FPDA 1CSKA 2CDTA 4QT7A 2KGTA 2EGEA 2RQWA 2L3SA 3EG3A 1K1ZA 2RNAA 2SRCA 4HXJA 1TUCA 4LNPA 2MOXA 4Z89A 1T0JA 1M3BA 1B3QA 5FW9A 1BBZA 1WFWA 1X27A 1WLPB 3H0HA 1GFCA 2KR3A 4HVUA 2RQTA 2LZ6B 1GBRA 4LUEA 2HCKA 2ROTA 3M0TA 2ABLA 1SRMA 2PTKA 1ZUYA 3NPFA 5FWCA 1M3AA 1GCPA 1E6HA 1K9AA 1AWXA 1GCQC 2C0IA 3UA6A 2D0NA 4OMNA 1KFZA 3I35A 2O31A 3NGPA 2KYBA 1X6GA 2J05A 2BZYA 2V1RA 2QDLA 2EBPA 1PKSA 2DRMA 2J7IA 2VWFA 2F2XA 2XMFA 2YUPA 1YNZA 3TSZA 4F16A 2EGAA 2EYZA 2PNIA 2AZVA 2YSQA 1OOTA 3VS1A 2K2MA 4CC7A 4FSSA 3VS2A 2KEAA 2JTEA 2KBTA 3IQLA 2DMOA 1TUDA 4F14A 1ABQA 5I11A 2A08A 1EFNA 2BZXA 1SEMA 2E5KA 2O2OA 3EG2A 2L0AA 2YUQA 1UHCA 1GCQA 2EYWA 3REBB 4AFZC 5GJVB 2KT1A 4A63B 4GBQA 1HJDA 4RTUA 1TG0A 4EIKA 2KT8A 1MV3A 1WXBA 3M0PA 1UE9A 2RQVA 1OPKA 1U06A 1UECA 2AK5A 3A98A 2OAWA 2DL3A 1U3OA 2OJ2A 4J9CA 1UDLA 1BB9A 1PHTA 1ZSGA 4RUGA 4WCIA 4J9DA 5L23A 3SEMA 2FPEA 3I9QA 3H0IA 3VS3A 4LN2A 4K11A 2JT4A 1Z9QA 2BZ8A 4IIMA 2ROLA 1CKBA 2EW3A 1KIKA 4OMMA 2DL4A 2L2PA 3RBBB 1G2BA 4RTXA 3VS4A 1ZX6A 1NEGA 1FMKA 1RUWA 2W10A 1NYFA 1PRLC 2DE0X 2CT4A 1AWJA 1PRMC 1QWFA 4RTVA 2KYMA 1M3CA 3RNJA 4JJCA 2J6FA 2GTOA 4HCKA 1AOJA 1ABOA 3NMZC 5EC7A 4JZ3A 1IO6A 1FYNA 1KJWA 4M4ZA 4LE9A 1V1CA 2FO0A 2VVKA 3VS0A 2CH4W 2B86A 1M27C 3M0QA 4CC4B 1AWOA 1SPKA 5HCKA 2K9GA 1UTIA 1NM7A 1MUZA 4HVWA 2JS0A 3M0UA 1Z9ZA 1AZEA 4DEYA 1RLQC 2JS2A 1K0SA 2L3PA 3O5ZA 4OMOA 1N5ZA 2GTJA 2IIMA 2F2VA 1JU5C 2DL8A 2K79A 1E6GA 4AFUC 1OEBA 1HSQA 2SEMA 5IHKA 2GNCA 2C0OA 4ESRA 2D8JA 1GFDA 1QWEA 1Y57A 1OV3A 2LJ3A 2DBKA 3NHNA 2F2WA 2DLPA 2O88A 2KROA 4IIOA 1AD5A 5IHNA 1UUEA 3EG1A 4RTYA 4JPBW 2D1XA 2FRWA 3VS7A 2JM9A 1SHFA 1H3HA 3I5RA 1UJ0A 2CUDA 3FJ5A 2P4RA 2J6OA 1X2QA 3UF4A 3U23A 1UJYA 1U5SA 3EHRA 1PKTA 4J9FA 1PNJA 2YUOA 1J3TA 2EQIA 3PVQA 4OMPA 1HD3A 1QCFA 2A37A 2DJQA 5FWBA 2NUZA 3VS5A 2M51A 1KSWA 1NLPC 2YDLA 2RQUA 1ZUKA 2KRMA 2LQWA 1YP5A 2ED1A 5ECAA 2YT6A 2JXBA 1H8KA 1UG1A 1UFFA 1NG2A 4F17A 3VRYA 2HBWA 5IH2A 3H41A 2C0TA 2JW4A 2CUBA 1UGVA 2DRKA 4X1VA 2LNHB 2LJ0A 2MCNA 1OPLA 2LP5A 1JQQA 3PE0A 1QKWA 2LCSA 1WYXA 1K0XA 1NLOC 1NEBA 1WA7A 2ECZA 1WI7A 4D8KA 2ENMA 1M30A 2CSIA 4Z88A 2HDAA 1ZUUA 3TVTA 2A36A 4LUDA 3ULRB 2FRYA 2L3QA 1Y0MA 3ZL7C 2FEIA 1AWWA 5IHIA 2DNUA 2GQIA 1W6XA 3I5SA 2RPNA 4JJDA 1I1JA 3UATA 4ZNXA 4RTWA 2RMOA 2M0YA 1WDXA 1YN8A 2X3WD 1T0HA 1WXUA 2K7AA 2CH4A 4R0KA 1GRIA 1WXTA 2NWMA 1K4US 2DILA 4RTZA 2ED0A 3UA7A 2HEQA 4AFQC 2EYYA 2DVJA 2DA9A 1VA7A 2KE9A 3QWXX 1GL5A 2D8HA 2X3XD 2DL5A 2DM1A 4OMQA 1ARKA 4HVVA 2O9VA 3M0RA 1JXOA 2AKLA 1G83A 3JV3A 1BU1A 2OI3A 2J06A 1K76A 1W1FA 1I07A 2RQRA 1QLYA 1RI9A 1AZGB 4ORZA 5GJWB 4AG1C 1BK2A 2W0ZA 2JMCA 2KRSA 2FPFA 2LMJA 3QWYA 4GLMA 4Y92A 4E6RA 1VYVA 4AFSC 3REAB 2V1QA 2DBMA 2K3BA 2GBQA 3VRZA 4D8DA 2EGCA 2LX7A 3SHWA 4CC3A 1GBQA 1X43A 4DEXA 1AEYA 1YCSB 1VYTA 4J9BA 2JM8A 1ZBJA 1AVZC 4JZ4A 4OMLA 3CQTA 4KRTA 4J9HA 2DYBA 2KXDA 2J6KA 5IXBA 3KFVA 2RN8A 2RF0A 1X2KA 2HSPA 1UHFA 4J9IA 2DF6A 2KXCA 4JJBA 3EGUA 4CC2A 1T3SA 3GBQA 5I22A 4J9EA 3TSWA 1PWTA 2I0NA 1XOVA 2H8HA 1YWPA 1YWOA 2EYXA
chains in the Genus database with same CATH superfamily
4JRIA 2DL7A 5GAMf 1PD0A 1QKXA 1FWZA 1G3YA 4BACA 1K8AC 5GMKh 4NS5A 1ZLMA 8AT1B 4EMKA 4LXCA 5AT1B 2LJ1A 2QASA 2E4HA 3OYAA 2YXYA 2R5AA 1KQSA 4MZMA 5C6SA 4JRKA 2OTJA 3H0FA 2P4TA 1I8FA 2HBPA 2KNBB 5KYNA 3FC3A 2O9SA 3DLMA 3CC7T 2QA4Q 2K6DA 2RHXA 5CKDA 4C0DC 2VGMA 3OSSC 2EVRA 2LQNA 2JMAA 3CPWS 3LYIA 1VQOQ 1U1SA 3N5BB 2DX1A 4DBRA 1M8MA 3FLGA 2CT3A 2JZ2A 1M1GA 3A1PA 3URGA 3J80E 1JEGA 1A0NB 4QT7A 4QKUA 2KGTA 1W2BS 2EGEA 2EJGA 2RQWA 4A4GA 2EWNA 2QYZA 3AT1B 1O75A 1WPYA 1O9SA 1TUGB 1M3BA 2NYSA 1WFWA 3DLLA 1X27A 1WLPB 4DQ2A 2OTLQ 2MAMA 3A8MB 2R5MA 2M16A 3M0TA 2BE7D 2ABLA 1QQJA 1VQMQ 3SD4A 1Q7YU 2MK5A 2E3IA 1HK9A 2PTKA 1TS9A 1VQ9T 1ZUYA 2A0FB 2VGNA 4FU6A 1GCPA 1E6HA 1VQ7Q 1RAEB 4J83A 2C0IA 3UA6A 2D0NA 4OMNA 4F7UB 1KFZA 1S72Q 5GANf 3L2WA 1BIAA 2BZYA 1OZ2A 1ZSZA 4OGCA 1QMCA 2DAQA 2QDLA 2RHIA 4F7UF 1VQLQ 2DRMA 3PIOA 3HRTA 2YUPA 5CKEA 3TSZA 2QXFA 3VUZA 1YJNT 2KEAA 2E70A 2E41A 2JN0A 4QQ6A 3PFSA 1Y71A 3HP9A 2RHYA 4BDZA 3M54A 2FZCB 3EG2A 2WACA 2L0AA 3MEVA 5LJ5d 2YUQA 4OB3B 5LL6S 5HKCA 3REBB 2HAXA 1WJSA 2KT1A 1Y96B 1VQ5A 4M7DF 1HJDA 1TG0A 4J8OA 4KH1B 2KVQG 3CCLA 3QYGB 1U06A 3CC2A 4QVCA 5KYWB 1LPLA 2OJ2A 4FM4B 4A4FA 4BDYA 4J9CA 4ME7A 5EG2A 4WCIA 4M77B 3SEMA 1M9SA 2LC4A 3OW2S 3VS3A 2Y90A 3OY9A 1Z9QA 1KG1A 2ROLA 2G3RA 2DXCA 4M77F 4OMMA 2DL4A 4Q5WA 4PJOB 4DOWA 3RBBB 1G2BA 2EIFA 4FW2A 3VS4A 1NEGA 4LDXA 3JCMe 2LQ8A 4RTVA 3L2RA 1JB0E 3MJXA 1NPPA 4JJCA 4GY5A 1BI3A 1ABOA 3NMZC 1TH7A 2RO0A 3LLRA 4JZ3A 1RACB 1D0YA 3EGDB 1KJWA 1FYNA 3EFSA 5CK9A 5FU6B 5CQYA 2QQAA 3M0QA 2ZPIB 1R0BG 1AWOA 2CKKA 1SPKA 2JS0A 5A0LA 1YITT 4DEYA 2L3PA 2K57A 3O5ZA 1BKBA 3CCQT 3QKJA 2IIMA 2XICA 4IUTA 2K79A 3LW5E 3G71A 3CCJA 2XD0A 5D6YA 4BI4A 2DD5A 4C92B 4BE1A 4ESRA 3VUBA 1KQSP 3GLXA 2XK0A 4XTYA 2DBKA 1PG5B 4C92F 5LJ5f 5DY9A 2O88A 1AD5A 3M9QA 2QEXQ 4OMFB 4IUPA 3U23A 4XTXA 4XU0A 1J3TA 4OMPA 1RAHB 4ATOA 1YFNA 1QCFA 2DXUA 4J6XA 2FB7A 1BI0A 5FWBA 3VS5A 1N27A 3I56T 2KRMA 1YP5A 5GANj 1UG1A 1TOVA 3OYIA 4F17A 1NG2A 3UPUA 4N0AA 3BY7A 1UGVA 3C12A 2MWPA 1IZ6A 1M5Q1 2LCSA 3V7RA 3CC7Q 5LJ3f 2LCLA 3CCST 4AMCA 2E3HA 2ECZA 1OYXA 2P0KA 4IUUA 1QP3A 4IUQA 3EGXB 3TVTA 1YJ9A 4BI3A 4M7AB 1NE8A 2CZ6B 2FRYA 3ZL7C 1SSFA 5IHIA 2DNUA 4M77E 5CR2A 3CMAA 2XDDA 3S3MA 4M7AF 3QJYA 2Z0WA 3S6WA 1OX8A 2KMTA 1UGQB 3CXCA 1KQ2A 4PJOE 5CVIA 1WDXA 1N8RR 3M55A 2K7AA 3TEEA 1VQPQ 2NWMA 2PQWA 2CP7A 3UA7A 4AFQC 2GCXA 2D0QB 1YIJT 1AHJB 4C5GA 3ER0A 4HVVA 5FU7B 4HCCA 2K3XA 2O9VA 1JXOA 1VQ9Q 2E6ZA 4M75G 3JV3A 4C0ZA 3PT9A 1N8RC 1K76A 2DXTA 1I07A 1YITA 1RI9A 1AZGB 4N0AC 2W0ZA 5AYFA 2I2LA 5GAOn 4GLMA 2YLCA 4PJOD 1VYVA 4AFSC 2P84A 1YHQA 2XG8D 3GF5A 3OMCA 2R58A 1AEYA 1VYTA 1YJNQ 1MMNA 4J9BA 3NTHA 1VQ6A 2CP3A 3ME9A 4J9HA 3VKIA 2K5IA 2X51A 2RI2A 4C92E 2HSPA 1PCXA 1UHFA 4OB2B 1RADB 2H3EB 3L1AA 2L8DA 2A7YA 3EGUA 1C0MA 4FT4A 5GMKi 3GBQA 2PVOB 2NUPA 1Q81R 3VU3C 3JCMc 2PUOB 3LX7A 3LGFA 3EFOA 1YWPA 3RDVA 4Z8AA 2OTJT 4LD9K 1MNEA 1SSHA 3JRZA 3LH0A 2BIVA 2FG0A 2PZ1A 2ESWA 1JO8A 3ASKA 1YBYA 3I56A 2PUKB 4RG2A 1SHGA 1T3LA 1LCKA 3FRNA 1W2BA 1Q81C 3THKA 3CCVA 2LT4A 2QAZA 2QGGA 4F04B 5GAOm 4V2SA 2A28A 4FSXA 1Q86R 1JXMA 3GPLA 4FYYB 1RAIB 1WIEA 1SG5A 2KRNA 3GP8A 2CSQA 2VB6A 2L3RA 4M75F 4C8QF 3JB9I 4R55A 3QHSA 2EKHA 4HKEA 1H92A 3EG0A 4C0FA 2CGHA 2VKNA 3LH5A 2FZKB 2AZSA 3DKMA 2HL3A 3MP8A 1Q86C 2DO3A 4PJNA 2RJEA 3JCMX 1K9MU 2FPDA 3CCEA 2CDTA 4E7SA 2D9TA 3SWNA 5LJ3j 3J81E 3EG3A 2SRCA 3P8BB 2RK1A 4Z89A 1T0JA 2LDMA 1TSFA 5FW9A 3CC4T 4JJNK 3E9FA 3CCQQ 4HVUA 1OU9A 3V8LA 2X4YA 2O4XB 1OI1A 2HCKA 2FYKA 2OAUA 1D0XA 1VQNA 1RAGB 4BY6C 5FWCA 3JCMb 2V8KA 1K9AA 5CAIA 2QQRA 3EG9A 2O31A 5GAMh 2CP5A 3NGPA 2KYBA 1QVGP 1M4ZA 2C06A 2DEUA 2EBPA 3QDFA 2EJFA 4CRIA 2EYZA 3OYEA 3OQ5A 1QVPA 2AZVA 1OOTA 2LX9A 5GANd 4MDXA 4IUVA 1TXQA 1VQ5T 3RKYA 2QQSA 3RKXA 2KBTA 5I11A 1TUDA 3OW2A 2X4WA 3CCLT 4O5VA 1SEMA 3QPHA 1WHLA 2EQUA 2E5KA 4XU2A 3OYJA 2O2OA 1VQ4T 1UB4A 3CC2T 1UGSB 2F5KA 3NFCA 3CXCP 1UHCA 4N4HA 1X01A 4AT1B 1M1KU 4A63B 2DTHA 4XU1A 4RTUA 2VXEA 3T9NA 2QK0A 3CD6Q 2KT8A 4EMKB 2VXFA 4QW2A 1Q82R 4E7HA 3SWNC 4R56A 1OPKA 2AK5A 3OYBA 3A98A 2L89A 1WJQA 1IRXA 1IREB 1JJ2P 1C1AA 2E12A 1TTHB 4J9DA 2DZ9A 1EX4A 3H0IA 4LN2A 4KH0B 2ZPBB 3MEAA 2ATCB 2BZ8A 2WSEE 3MEUA 4IIMA 2E65A 2EW3A 4JLIA 3M53A 3L42A 1Q82C 2CZ0B 2XKOC 4II1A 3V8JA 1ZX6A 5GAN5 1FMKA 2W10A 1NYFA 4FCYA 3MP6A 1NJIU 2DE0X 5LJ5g 4C5HA 1QWFA 3M4YA 2KYMA 3JCMW 3SB2A 2EQKA 5GAOq 2J6FA 2GTOA 3JB9D 5EC7A 4A4EA 1VQKQ 1YIJQ 1IO6A 4M4ZA 2QDYB 2VVKA 3KUFA 1WGSA 4DA4A 2B86A 3G71T 2RJCA 3CCJT 2DD4A 3CPWP 1OZ3A 5HCKA 1UGRB 4DOVA 2MMPA 1NPRA 3HTRA 2OX7A 5HY6A 3R6OA 2DK3A 3CC4A 1HSQA 3EFRA 3CMEA 1W2BP 2GNCA 2C0OA 3I55Q 3EAEA 1QWEA 1Y57A 4OB0B 4BUGA 1ZSZB 3HSBA 3UDCA 2F2WA 2DLPA 2HQHA 3JCMf 5IHNA 2ZPFB 4RTYA 2FRWA 3QZ5B 4PJJA 4PJOG 3VS7A 2EAYA 3BE3A 3I5RA 1M2VA 1M8VA 2P4RA 2J6OA 1UJYA 3MO8A 1U5SA 2HSEB 1X6OA 5GMKe 4M7DB 1N9SA 1PKTA 3ZEHA 2YUOA 3L2ZA 3PVQA 2DJQA 4M78E 2OTJQ 1WHKA 1QP2A 1BI1A 4X34A 1WJRA 1LOJA 2YT6A 2RJFA 1H8KA 3E1SA 2NLUA 4Z02A 4J6WA 5IH2A 1VQ4A 5CIUA 2V8IA 2CUBA 4CI0C 1IGUA 3BDLA 4Y91A 1FMWA 2MCNA 2DTOA 1JQQA 3OS2A 1YJ9T 1QKWA 1K0XA 5D6XA 2XDBA 1NLOC 1M2OA 2LVMA 1NEBA 4BE0A 1WA7A 3CMAT 5KYWA 1WI7A 4M78D 4E7ZA 1LJOA 4HCBA 2XDPA 1KC8U 5CKFA 4EPCA 5LJ3d 3OYFA 2A36A 3QIIA 1BI2A 1Y0MA 4NOYA 3G4SA 1Q7YR 4PJOA 1RL2A 4JJDA 4C5EA 3UATA 1R77A 2X9HA 4HCZA 4JLGA 2LNVA 3CCRA 4RTWA 2M0YA 3P8DA 1WXUA 3RR6A 4R0KA 3OW2P 5FLXE 2ED0A 5LJ5h 2HEQA 3V8KA 1H641 3VYGA 2EYYA 2DVJA 2VYTA 3QWXX 1U8RA 3CEYA 2H3JA 4KULA 2DL5A 1Q7YC 1WQ7A 1YHQT 4J6YA 3RUXA 2M1HA 1PD1A 2FVUA 1BU1A 2OI3A 3A8GB 3X24B 1VQ6T 1TWBA 2COZA 1QLYA 4AG1C 2MF2A 2JMCA 2KRSA 2LMJA 4X9CA 2DETA 5GMKj 3REAB 2LT1A 2XI9A 1GBQA 1X43A 2JNGA 2RI3A 1VQ5Q 1XNIA 4E47A 2DKGA 2JM8A 4MZPA 1ZBJA 4F7UE 1AVZC 4OMLA 4E7LA 4OGEA 2A3LA 3X28B 3KFVA 1D1BA 2RF0A 3CCLQ 3WXMB 4KBMB 4J9IA 5KYXB 3HHTB 2KXCA 3CC2Q 3QUIA 5DLOA 4M77C 1Y07A 4CC2A 1TU0B 1KK7A 1PWTA 4JDSA 1K73U 1XOVA 2PU9B 3QSUA 3CCUA 1I81A 4IURA 1YWOA 2EYXA 3QJ6A 3CCVT 1YJWA 4PJOC 4ZN3A 3TREA 2RK2A 3C0CA 1RLPC 1M90U 4PLLA 2K5FA 3KXTA 2DIQA 4M7DE 2MIOA 2K4YA 1W70A 1NYGA 3EH2A 1AT1B 3FEOA 5CO7A 1QVGA 1ZBXA 1VQ8A 4FYVB 2EPDA 2ZZDA 1OU8A 1I0CA 2X35A 4JRQA 5FU6C 4A4KA 2LCCA 5A2QE 3QYHB 1W4SA 1X69A 5IXFA 4J9GA 3VS6A 2EQMA 3CCET 4X9DA 5I2MA 1MV0B 2BTTA 4ZGJB 3E9GA 2FZGB 2NUTA 5J39A 3EHQA 4M7DD 3LWHA 1S1NA 1WX6A 3PTAA 2YHTA 1MHNA 1ZA1B 3QO3A 4C5IA 4C92C 1VQOT 4ZGDB 1CSKA 2YLBA 3G71Q 4LDUA 3CCJQ 2D6FA 2L3SA 1VQNT 1K1ZA 2RNAA 4HXJA 4LNPA 3RKWA 4DBFA 1KD1U 3JB9G 3PGGA 5GAMg 1B3QA 5A0DA 2RQTA 1JJ2A 2LZ6B 4M77D 2MPXC 4L59A 1GBRA 1QCNA 4LUEA 5FRNA 2COYA 2ROTA 4DBHA 2GF7A 4C0GA 1I5OB 3GIBA 4ANJA 4OF1A 3FDRA 3CBPA 5GAOl 2MYSA 1P92A 1AWXA 1GCQC 3A8OB 3ZFJA 4ELZC 1D3BA 5I2SA 1UGPB 3I35A 4LDYA 1X6GA 4J7IA 4XTVA 2V1RA 4KT0E 4A54A 1PKSA 2J7IA 2VWFA 2GFAA 2F2XA 2XMFA 2CYZB 1WHHA 3G6EA 1YNZA 4F16A 1X75C 2PNIA 2YSQA 3VS1A 1YI2A 3RMQA 3MP1A 2K2MA 3LGLA 4CC7A 2JTFA 4FSSA 1WHMA 3VS2A 1V29B 3JCMP 2GQVA 4XTZA 5KYYA 2DMOA 1ABQA 1VQLT 2JOYA 1FXXA 2NUPB 2BZXA 3CPWA 4KGVB 3EFOB 5I21A 5GAN2 2MI6A 3OA6A 1ZHIA 3Q1JA 2KK4A 4AFZC 4A4HA 5GJVB 4A53A 3EH1A 4PL6A 4GBQA 5KYUA 4PJLA 2QQBA 1D09B 5GAN6 3OYMA 2CP2A 3INZA 3X25B 2CZ7B 4C92D 1YJ9Q 3PMTA 1UE9A 1UECA 3MEWA 4M75B 4OVAA 1B34B 4C8QB 1K8AU 3CMAQ 2OAWA 3OB9A 2DL3A 1U3OA 3CCMA 1UDLA 2ZGWA 2IPOB 1BB9A 4N4IA 1ZSGA 4PNOA 1FX7A 4RUGA 5J3BA 5DLQE 5L23A 1G3TA 2QG9B 3BFMA 5GANg 4PFPA 4K11A 2ZPHB 4JRPA 1CKBA 2JUFA 5FU7C 2L2PA 5GAOp 3O8VA 2YRCA 3MCAB 4RTXA 2EYQA 1RUWA 3J7AF 3OYNA 4M78G 1AWJA 4L5GA 2HL5C 4D6WA 3F70A 1QVFS 1AOJA 1Q82U 2P0PA 4M7AE 3OYLA 2KQWA 1YITQ 4LE9A 1V1CA 2QA4A 4XK8E 3VS0A 3M4GA 3M59A 2E10A 1LVKA 2FL7A 2CH4W 1M27C 1WNLA 1VQOA 3X20B 1YHQQ 3CMET 2QGFB 4PFZA 2RH2A 3RESA 5HK3A 1UTIA 1NM7A 4C0DB 1D1AA 3M0UA 1Z9ZA 1AZEA 2JS2A 2GFUA 1VQ6Q 2EKOA 3C4SA 4OMOA 3RERA 3OMGA 5KCHA 4LDVA 1IB8A 2M9UA 3BDUA 1JU5C 4OB1B 1BIBA 1OEBA 4M7AD 2SEMA 2BKDN 2PVDB 2D8JA 2FHDA 3C95A 3PIPA 1OV3A 4E2FB 2LJ3A 5HK0A 3NHNA 2OTLA 2YRDA 1UEBA 1UUEA 4JPBW 2D1XA 1PSFA 5KE3A 2WSCE 4FYWB 2HKNA 3UWNA 3MHXA 4RG8A 4JS4A 3P8HA 1VQMA 3FJ5A 4M78A 3I56Q 3UF4A 1GXIE 3EHRA 4J9FA 1VQ7A 1PNJA 4MZTA 3JCMd 1HD3A 3CCVQ 1S72A 5CQXA 2IG0A 2M51A 2YDLA 1ZUKA 3OBYA 1PC0A 1G3SA 2JXBA 1VQLA 1UFFA 7AT1B 3VRYA 3H41A 3CCSQ 1OULA 2DTIA 2DRKA 4X1VA 1SKUB 2LNHB 1OPLA 1D0ZA 1N6AA 1RAAB 2VASA 1H3ZA 3PE0A 5CKBA 1K9MR 2LQKA 2RA2A 3SFMA 3G4ST 2QQ9A 3CCEQ 4F7UG 4XAXB 1JBMA 1QCOA 2HMAA 4PJMA 1RI0A 5GMKm 3CCRT 2ENMA 4KGXB 2CSIA 4M75E 3FIFA 1KQ1A 4C8QE 1ZUUA 1MNDA 4HA8A 3V7SA 2VUBA 3ULRB 4O6JA 2L3QA 2EQJA 2ZPEB 1K9MC 1AWWA 2GQIA 2JVVA 5GANh 1W6XA 2RPNA 4KGZB 2P0QA 1I1JA 1SF9A 3C94A 1RAFB 4RCCA 3GOXA 4ZNXA 1VQNQ 4N4GA 4M7DG 1YN8A 1T0HA 2CH4A 1GRIA 1WXTA 1YCYA 3JCMh 1PSEA 3H6ZA 4M78C 3VJPA 4TVRA 3L2QA 1VA7A 3AHUA 1GL5A 4M75D 2DM1A 1WZOA 4C8QD 4OMQA 5GAMe 2DFUA 1VQPT 3M0RA 1R0CB 4LDWA 1G83A 3DB3A 1KHCA 2XU8A 1VIFA 2HNIA 2J06A 3TCJA 1W1FA 5LJ3g 1R8OB 1XQHA 5GJWB 2KDSA 4M77G 1BK2A 2FPFA 3QWYA 5IAYA 4E6RA 1MGQA 4F7UA 2M02A 2EFIA 2V1QA 4RCBA 2K3BA 2GBQA 1M1KR 9ATCB 2LX7A 1HYOA 3WVEB 4EMKC 4DEXA 3CBMA 2AIRB 1I4K1 3CCUT 4KRTA 3CQTA 2WSFE 2DYBA 2KXDA 2E5QA 3OYGA 1YJWT 4FIBA 1M2VB 3H9NA 3E19A 3OS0A 1RABB 2DF6A 4L6V5 3NTKA 1NBEB 5I22A 3L2UA 5FROA 2Y4XA 1M1KC 2I0NA 1FMVA 3RIRA 2RD1A 4ELYC 1VQ8T 4M7DA 3MPUB 3SDZA 1Y96A 4J7FA 3X26B 2GGRA 3M58A 1NJIR 2ZPGB 2QEXA 1ACMB 1E7OA 2YRVA 3A8HB 1WHGA 3PVLA 2DXBA 3QZ9B 5IT9E 2ZCFB 2G6FX 3HL8A 4C92G 2CP0A 2CREA 1B7TA 4RMOA 4M77A 1B07A 3LWIA 1VYUA 4QVDA 5GANe 4RTTA 3R6NA 2RB6A 1NJIC 4FYXB 1CKAA 2YUNA 2PVGB 3M0SA 3ZBDA 1BYMA 4AG2C 5KCOA 1XTDA 4MMKA 4GLKA 1SRLA 5D6WA 3JB9J 5GAMj 1X6BA 5KE2A 3CC7A 2L5QA 2AKKA 2K3YA 4PJOF 3CC4Q 1PM3A 3FB9A 1ZSZC 1KQSS 3EGDA 4HT8A 3CMEQ 2HD0A 2HQEA 1TUCA 3KBGA 5FRMA 2QI2A 2MOXA 3RMSA 1BBZA 4PLIA 3H0HA 1GFCA 2KR3A 2COWA 4FW1A 4PFOA 2HQXA 1HXDA 4M7DC 4PKCC 2XHCA 1SRMA 3G6ET 2M0OA 4XTWA 2EJ9A 3JAME 3NPFA 1M3AA 2ZAEA 1G3WA 1YI2T 1VQPA 3VYHB 4C92A 1N8RU 2QTVA 3OYHA 4YTLA 2J05A 1IXDA 2E6NA 4EDUA 2F1LA 3M57A 3PNWC 3OYDA 2R57A 4BE2A 4WF2A 1Q95G 5LJ3h 4M7AG 1VQ9A 2EGAA 5D7UA 1DJ7B 3JB9H 1VQ4Q 5A0GA 3QG1A 2JTEA 3DB4A 1ZA2B 3IQLA 4F14A 4BD3A 2A08A 2K2VA 1OX9A 1EFNA 5KYXA 4ZGEB 4XU3A 1KC8R 1GCQA 2EYWA 3CCMT 1MMGA 1IGQA 1YJNA 3S3OA 2F69A 4EIKA 1MV3A 1WXBA 3S3NA 1QVFA 2Y4YA 3M0PA 2RQVA 3FJPA 3JCMQ 4XQ3A 1EIFA 3G4SQ 3OS5A 2CS7A 3OSVA 3HFNA 1PHTA 4E7JA 3CD6T 4B9XA 3CCRQ 3VV0A 1KC8C 2FPEA 3I9QA 5GAN7 1Q81U 3A5ZB 4VUBA 1MMDA 2LTOA 2JT4A 1KIKA 4LD6A 2NUTB 2QA4T 4MMLA 3EGXA 5LJ5e 1PRLC 4M7AA 3G7ZA 2CT4A 1PRMC 4PK4A 1M3CA 4ZTFA 3H8ZA 3RNJA 3GNGA 2B8AA 4HCKA 2X4XA 1KHIA 3QXEB 3HPWA 2FO0A 1Q86U 5J26A 2LRQA 4EMHA 1IHWA 4E7KA 2E64A 1EZZB 4CC4B 1VQKT 3QDRB 4UC4A 1G5VA 2K9GA 2X4JA 3OYCA 1MUZA 3JCMV 4HVWA 3L2VA 3WVDB 1RLQC 1K0SA 3E2UA 2OTLT 2KI7A 1N5ZA 2GTJA 3OYYA 5DM7R 1D1CA 2F2VA 2DL8A 3CBOA 4C8QG 4MDWA 1E6GA 2MWOA 2DIGA 1D3BB 3D7SB 4OP0A 4AFUC 1K73R 1VQMT 5IHKA 5LJ3e 1GFDA 2VC8A 4ZN1A 1M90R 1VQ7T 3CCUQ 2KSSA 3M5AA 1YJWQ 1S72T 3CCQA 3HRUA 2KROA 4IIOA 2AT1B 3EG1A 3I55T 1ZQ1A 2JM9A 1SHFA 1VIEA 1C6VX 4KUDK 1H3HA 2DERA 1UJ0A 2CUDA 2RHZA 5M9OA 5KYYB 2KAFA 1X2QA 1K73C 5GAN8 1U1TA 2DVEA 5CKHA 1BCOA 1VQ8Q 4XTUA 2EQIA 2O01E 3PMIA 2A37A 1G8XA 4QVZA 1M90C 2BUDA 4BY6B 5C0MA 2NUZA 4M7AC 4DBQA 1KSWA 3TU4K 1NLPC 2RQUA 2LQWA 2V26A 5ECAA 2ED1A 5KYUB 3OBWA 4RKUE 3OS1A 1WHJA 2V8JA 2KY9A 2HBWA 2C0TA 2JW4A 1MMAA 2DYIA 2LJ0A 2E1HA 5CCAA 3CPFA 1VOMA 2LP5A 3JB9F 4NL3A 5LJ5j 4B6MA 1WYXA 4FT2A 4FL6A 5GAOr 4M75A 2K5LA 1B34A 4C8QA 3NTIA 4JUVA 3HKSA 1N9RA 6AT1B 5GAMd 1VUBA 1QW1A 3GNFB 1LNXA 4D8KA 5KH6A 3OYKA 2DPPB 3META 1KD1R 3M56A 1M30A 3HRSA 4Z88A 1Y7XA 2HDAA 4HT9A 2RM4A 2CZ1B 1BCMA 3CD6A 3JCMg 4LUDA 1NZ9A 2QTXA 4BI8B 3CCSA 2FEIA 4Y28E 3G1JA 3I5SA 2HZYA 3V7CA 3UT1A 3SWNB 4P5NA 1IHVA 2DEQA 2RMOA 2IVWA 2X3WD 1KD1C 1WQWA 2RHUA 1K4US 2DILA 4RTZA 1QVGS 4NL2A 2HKQB 2XIDA 5L8RE 4ZTJA 4QQGA 2DA9A 2KE9A 5IN1A 2D8HA 2X3XD 5GAN4 1OQKA 1ARKA 1JRIA 3MKDA 3QBYA 3G6EQ 1F1BB 2AKLA 3HFOA 1V76A 4E7IA 3JCMJ 2RI5A 1XJWB 3A8LB 2O4XA 4WTOB 2F5TX 1YI2Q 4QQDA 2CP6A 2RJDA 1VQKA 3EG9B 4BB7A 1QVFP 2RQRA 1YIJA 4B9WA 4ORZA 4IKFA 4KUIA 4Y92A 2DBMA 3VRZA 5GMKl 3CXCS 2BE9B 4D8DA 2EGCA 3SHWA 4CC3A 2AHJB 1YCSB 3TQ7P 2DZCA 4JZ4A 4M75C 8ATCB 5IXBA 4J5YA 2VV5A 4C8QC 2YWWA 2J6KA 2RN8A 2JTMA 4M78B 1K8AR 2JJ9A 1X2KA 2DJZA 3JSCA 4JJBA 2QEXT 1T3SA 1JJ2S 4M78F 3I55A 4J9EA 3CCMQ 1M1FA 3TSWA 4EMGA 2H8HA 4JS5A 1I5LA 5GAN3 3BW1A
chains in the Genus database with same CATH topology
2DL7A 4Z8AA 3C0CA 1RLPC 1QKXA 1SSHA 2FG0A 2GGRA 2MIOA 1ZLMA 2PZ1A 1W70A 1E7OA 2ESWA 1NYGA 1JO8A 2LJ1A 3PVLA 1SHGA 1T3LA 1LCKA 2EPDA 3THKA 2G6FX 2A28A 1I0CA 1JXMA 3H0FA 1WIEA 2CREA 2KNBB 2O9SA 2KRNA 2CSQA 1B07A 2K6DA 1X69A 5IXFA 1VYUA 4J9GA 3VS6A 4RTTA 3R6NA 2EVRA 1MV0B 2BTTA 1CKAA 2JMAA 2LQNA 2YUNA 3M0SA 2EKHA 4AG2C 1H92A 2DX1A 1M8MA 3EG0A 3EHQA 2VKNA 1S1NA 1WX6A 3LH5A 2CT3A 1SRLA 2AZSA 1X6BA 1JEGA 2AKKA 1A0NB 2FPDA 1CSKA 2CDTA 4QT7A 2KGTA 2EGEA 2RQWA 2L3SA 3EG3A 1K1ZA 2RNAA 2SRCA 4HXJA 1TUCA 4LNPA 2MOXA 4Z89A 1T0JA 1M3BA 1B3QA 5FW9A 1BBZA 1WFWA 1X27A 1WLPB 3H0HA 1GFCA 2KR3A 4HVUA 2RQTA 2LZ6B 1GBRA 4LUEA 2HCKA 2ROTA 3M0TA 2ABLA 1SRMA 2PTKA 1ZUYA 3NPFA 5FWCA 1M3AA 1GCPA 1E6HA 1K9AA 1AWXA 1GCQC 2C0IA 3UA6A 2D0NA 4OMNA 1KFZA 3I35A 2O31A 3NGPA 2KYBA 1X6GA 2J05A 2BZYA 2V1RA 2QDLA 2EBPA 1PKSA 2DRMA 2J7IA 2VWFA 2F2XA 2XMFA 2YUPA 1YNZA 3TSZA 4F16A 2EGAA 2EYZA 2PNIA 2AZVA 2YSQA 1OOTA 3VS1A 2K2MA 4CC7A 4FSSA 3VS2A 2KEAA 2JTEA 2KBTA 3IQLA 2DMOA 1TUDA 4F14A 1ABQA 5I11A 2A08A 1EFNA 2BZXA 1SEMA 2E5KA 2O2OA 3EG2A 2L0AA 2YUQA 1UHCA 1GCQA 2EYWA 3REBB 4AFZC 5GJVB 2KT1A 4A63B 4GBQA 1HJDA 4RTUA 1TG0A 4EIKA 2KT8A 1MV3A 1WXBA 3M0PA 1UE9A 2RQVA 1OPKA 1U06A 1UECA 2AK5A 3A98A 2OAWA 2DL3A 1U3OA 2OJ2A 4J9CA 1UDLA 1BB9A 1PHTA 1ZSGA 4RUGA 4WCIA 4J9DA 5L23A 3SEMA 2FPEA 3I9QA 3H0IA 3VS3A 4LN2A 4K11A 2JT4A 1Z9QA 2BZ8A 4IIMA 2ROLA 1CKBA 2EW3A 1KIKA 4OMMA 2DL4A 2L2PA 3RBBB 1G2BA 4RTXA 3VS4A 1ZX6A 1NEGA 1FMKA 1RUWA 2W10A 1NYFA 1PRLC 2DE0X 2CT4A 1AWJA 1PRMC 1QWFA 4RTVA 2KYMA 1M3CA 3RNJA 4JJCA 2J6FA 2GTOA 4HCKA 1AOJA 1ABOA 3NMZC 5EC7A 4JZ3A 1IO6A 1FYNA 1KJWA 4M4ZA 4LE9A 1V1CA 2FO0A 2VVKA 3VS0A 2CH4W 2B86A 1M27C 3M0QA 4CC4B 1AWOA 1SPKA 5HCKA 2K9GA 1UTIA 1NM7A 1MUZA 4HVWA 2JS0A 3M0UA 1Z9ZA 1AZEA 4DEYA 1RLQC 2JS2A 1K0SA 2L3PA 3O5ZA 4OMOA 1N5ZA 2GTJA 2IIMA 2F2VA 1JU5C 2DL8A 2K79A 1E6GA 4AFUC 1OEBA 1HSQA 2SEMA 5IHKA 2GNCA 2C0OA 4ESRA 2D8JA 1GFDA 1QWEA 1Y57A 1OV3A 2LJ3A 2DBKA 3NHNA 2F2WA 2DLPA 2O88A 2KROA 4IIOA 1AD5A 5IHNA 1UUEA 3EG1A 4RTYA 4JPBW 2D1XA 2FRWA 3VS7A 2JM9A 1SHFA 1H3HA 3I5RA 1UJ0A 2CUDA 3FJ5A 2P4RA 2J6OA 1X2QA 3UF4A 3U23A 1UJYA 1U5SA 3EHRA 1PKTA 4J9FA 1PNJA 2YUOA 1J3TA 2EQIA 3PVQA 4OMPA 1HD3A 1QCFA 2A37A 2DJQA 5FWBA 2NUZA 3VS5A 2M51A 1KSWA 1NLPC 2YDLA 2RQUA 1ZUKA 2KRMA 2LQWA 1YP5A 2ED1A 5ECAA 2YT6A 2JXBA 1H8KA 1UG1A 1UFFA 1NG2A 4F17A 3VRYA 2HBWA 5IH2A 3H41A 2C0TA 2JW4A 2CUBA 1UGVA 2DRKA 4X1VA 2LNHB 2LJ0A 2MCNA 1OPLA 2LP5A 1JQQA 3PE0A 1QKWA 2LCSA 1WYXA 1K0XA 1NLOC 1NEBA 1WA7A 2ECZA 1WI7A 4D8KA 2ENMA 1M30A 2CSIA 4Z88A 2HDAA 1ZUUA 3TVTA 2A36A 4LUDA 3ULRB 2FRYA 2L3QA 1Y0MA 3ZL7C 2FEIA 1AWWA 5IHIA 2DNUA 2GQIA 1W6XA 3I5SA 2RPNA 4JJDA 1I1JA 3UATA 4ZNXA 4RTWA 2RMOA 2M0YA 1WDXA 1YN8A 2X3WD 1T0HA 1WXUA 2K7AA 2CH4A 4R0KA 1GRIA 1WXTA 2NWMA 1K4US 2DILA 4RTZA 2ED0A 3UA7A 2HEQA 4AFQC 2EYYA 2DVJA 2DA9A 1VA7A 2KE9A 3QWXX 1GL5A 2D8HA 2X3XD 2DL5A 2DM1A 4OMQA 1ARKA 4HVVA 2O9VA 3M0RA 1JXOA 2AKLA 1G83A 3JV3A 1BU1A 2OI3A 2J06A 1K76A 1W1FA 1I07A 2RQRA 1QLYA 1RI9A 1AZGB 4ORZA 5GJWB 4AG1C 1BK2A 2W0ZA 2JMCA 2KRSA 2FPFA 2LMJA 3QWYA 4GLMA 4Y92A 4E6RA 1VYVA 4AFSC 3REAB 2V1QA 2DBMA 2K3BA 2GBQA 3VRZA 4D8DA 2EGCA 2LX7A 3SHWA 4CC3A 1GBQA 1X43A 4DEXA 1AEYA 1YCSB 1VYTA 4J9BA 2JM8A 1ZBJA 1AVZC 4JZ4A 4OMLA 3CQTA 4KRTA 4J9HA 2DYBA 2KXDA 2J6KA 5IXBA 3KFVA 2RN8A 2RF0A 1X2KA 2HSPA 1UHFA 4J9IA 2DF6A 2KXCA 4JJBA 3EGUA 4CC2A 1T3SA 3GBQA 5I22A 4J9EA 3TSWA 1PWTA 2I0NA 1XOVA 2H8HA 1YWPA 1YWOA 2EYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DL7 A;  4Z8A A;  3C0C A;  1RLP C;  1QKX A;  1SSH A;  2FG0 A;  2GGR A;  2MIO A;  1ZLM A;  2PZ1 A;  1W70 A;  1E7O A;  2ESW A;  1NYG A;  1JO8 A;  2LJ1 A;  3PVL A;  1SHG A;  1T3L A;  1LCK A;  2EPD A;  3THK A;  2G6F X;  2A28 A;  1I0C A;  1JXM A;  3H0F A;  1WIE A;  2CRE A;  2KNB B;  2O9S A;  2KRN A;  2CSQ A;  1B07 A;  2K6D A;  1X69 A;  5IXF A;  1VYU A;  4J9G A;  3VS6 A;  4RTT A;  3R6N A;  2EVR A;  1MV0 B;  2BTT A;  1CKA A;  2JMA A;  2LQN A;  2YUN A;  3M0S A;  2EKH A;  4AG2 C;  1H92 A;  2DX1 A;  1M8M A;  3EG0 A;  3EHQ A;  2VKN A;  1S1N A;  1WX6 A;  3LH5 A;  2CT3 A;  1SRL A;  2AZS A;  1X6B A;  1JEG A;  2AKK A;  1A0N B;  2FPD A;  1CSK A;  2CDT A;  4QT7 A;  2KGT A;  2EGE A;  2RQW A;  2L3S A;  3EG3 A;  1K1Z A;  2RNA A;  2SRC A;  4HXJ A;  1TUC A;  4LNP A;  2MOX A;  4Z89 A;  1T0J A;  1M3B A;  1B3Q A;  5FW9 A;  1BBZ A;  1WFW A;  1X27 A;  1WLP B;  3H0H A;  1GFC A;  2KR3 A;  4HVU A;  2RQT A;  2LZ6 B;  1GBR A;  4LUE A;  2HCK A;  2ROT A;  3M0T A;  2ABL A;  1SRM A;  2PTK A;  1ZUY A;  3NPF A;  5FWC A;  1M3A A;  1GCP A;  1E6H A;  1K9A A;  1AWX A;  1GCQ C;  2C0I A;  3UA6 A;  2D0N A;  4OMN A;  1KFZ A;  3I35 A;  2O31 A;  3NGP A;  2KYB A;  1X6G A;  2J05 A;  2BZY A;  2V1R A;  2QDL A;  2EBP A;  1PKS A;  2DRM A;  2J7I A;  2VWF A;  2F2X A;  2XMF A;  2YUP A;  1YNZ A;  3TSZ A;  4F16 A;  2EGA A;  2EYZ A;  2PNI A;  2AZV A;  2YSQ A;  1OOT A;  3VS1 A;  2K2M A;  4CC7 A;  4FSS A;  3VS2 A;  2KEA A;  2JTE A;  2KBT A;  3IQL A;  2DMO A;  1TUD A;  4F14 A;  1ABQ A;  5I11 A;  2A08 A;  1EFN A;  2BZX A;  1SEM A;  2E5K A;  2O2O A;  3EG2 A;  2L0A A;  2YUQ A;  1UHC A;  1GCQ A;  2EYW A;  3REB B;  4AFZ C;  5GJV B;  2KT1 A;  4A63 B;  4GBQ A;  1HJD A;  4RTU A;  1TG0 A;  4EIK A;  2KT8 A;  1MV3 A;  1WXB A;  3M0P A;  1UE9 A;  2RQV A;  1OPK A;  1U06 A;  1UEC A;  2AK5 A;  3A98 A;  2OAW A;  2DL3 A;  1U3O A;  2OJ2 A;  4J9C A;  1UDL A;  1BB9 A;  1PHT A;  1ZSG A;  4RUG A;  4WCI A;  4J9D A;  5L23 A;  3SEM A;  2FPE A;  3I9Q A;  3H0I A;  3VS3 A;  4LN2 A;  4K11 A;  2JT4 A;  1Z9Q A;  2BZ8 A;  4IIM A;  2ROL A;  1CKB A;  2EW3 A;  1KIK A;  4OMM A;  2DL4 A;  2L2P A;  3RBB B;  1G2B A;  4RTX A;  3VS4 A;  1ZX6 A;  1NEG A;  1FMK A;  1RUW A;  2W10 A;  1NYF A;  1PRL C;  2DE0 X;  2CT4 A;  1AWJ A;  1PRM C;  1QWF A;  4RTV A;  2KYM A;  1M3C A;  3RNJ A;  4JJC A;  2J6F A;  2GTO A;  4HCK A;  1AOJ A;  1ABO A;  3NMZ C;  5EC7 A;  4JZ3 A;  1IO6 A;  1FYN A;  1KJW A;  4M4Z A;  4LE9 A;  1V1C A;  2FO0 A;  2VVK A;  3VS0 A;  2CH4 W;  2B86 A;  1M27 C;  3M0Q A;  4CC4 B;  1AWO A;  1SPK A;  5HCK A;  2K9G A;  1UTI A;  1NM7 A;  1MUZ A;  4HVW A;  2JS0 A;  3M0U A;  1Z9Z A;  1AZE A;  4DEY A;  1RLQ C;  2JS2 A;  1K0S A;  2L3P A;  3O5Z A;  4OMO A;  1N5Z A;  2GTJ A;  2IIM A;  2F2V A;  1JU5 C;  2DL8 A;  2K79 A;  1E6G A;  4AFU C;  1OEB A;  1HSQ A;  2SEM A;  5IHK A;  2GNC A;  2C0O A;  4ESR A;  2D8J A;  1GFD A;  1QWE A;  1Y57 A;  1OV3 A;  2LJ3 A;  2DBK A;  3NHN A;  2F2W A;  2DLP A;  2O88 A;  2KRO A;  4IIO A;  1AD5 A;  5IHN A;  1UUE A;  3EG1 A;  4RTY A;  4JPB W;  2D1X A;  2FRW A;  3VS7 A;  2JM9 A;  1SHF A;  1H3H A;  3I5R A;  1UJ0 A;  2CUD A;  3FJ5 A;  2P4R A;  2J6O A;  1X2Q A;  3UF4 A;  3U23 A;  1UJY A;  1U5S A;  3EHR A;  1PKT A;  4J9F A;  1PNJ A;  2YUO A;  1J3T A;  2EQI A;  3PVQ A;  4OMP A;  1HD3 A;  1QCF A;  2A37 A;  2DJQ A;  5FWB A;  2NUZ A;  3VS5 A;  2M51 A;  1KSW A;  1NLP C;  2YDL A;  2RQU A;  1ZUK A;  2KRM A;  2LQW A;  1YP5 A;  2ED1 A;  5ECA A;  2YT6 A;  2JXB A;  1H8K A;  1UG1 A;  1UFF A;  1NG2 A;  4F17 A;  3VRY A;  2HBW A;  5IH2 A;  3H41 A;  2C0T A;  2JW4 A;  2CUB A;  1UGV A;  2DRK A;  4X1V A;  2LNH B;  2LJ0 A;  2MCN A;  1OPL A;  2LP5 A;  1JQQ A;  3PE0 A;  1QKW A;  2LCS A;  1WYX A;  1K0X A;  1NLO C;  1NEB A;  1WA7 A;  2ECZ A;  1WI7 A;  4D8K A;  2ENM A;  1M30 A;  2CSI A;  4Z88 A;  2HDA A;  1ZUU A;  3TVT A;  2A36 A;  4LUD A;  3ULR B;  2FRY A;  2L3Q A;  1Y0M A;  3ZL7 C;  2FEI A;  1AWW A;  5IHI A;  2DNU A;  2GQI A;  1W6X A;  3I5S A;  2RPN A;  4JJD A;  1I1J A;  3UAT A;  4ZNX A;  4RTW A;  2RMO A;  2M0Y A;  1WDX A;  1YN8 A;  2X3W D;  1T0H A;  1WXU A;  2K7A A;  2CH4 A;  4R0K A;  1GRI A;  1WXT A;  2NWM A;  1K4U S;  2DIL A;  4RTZ A;  2ED0 A;  3UA7 A;  2HEQ A;  4AFQ C;  2EYY A;  2DVJ A;  2DA9 A;  1VA7 A;  2KE9 A;  3QWX X;  1GL5 A;  2D8H A;  2X3X D;  2DL5 A;  2DM1 A;  4OMQ A;  1ARK A;  4HVV A;  2O9V A;  3M0R A;  1JXO A;  2AKL A;  1G83 A;  3JV3 A;  1BU1 A;  2OI3 A;  2J06 A;  1K76 A;  1W1F A;  1I07 A;  2RQR A;  1QLY A;  1RI9 A;  1AZG B;  4ORZ A;  5GJW B;  4AG1 C;  1BK2 A;  2W0Z A;  2JMC A;  2KRS A;  2FPF A;  2LMJ A;  3QWY A;  4GLM A;  4Y92 A;  4E6R A;  1VYV A;  4AFS C;  3REA B;  2V1Q A;  2DBM A;  2K3B A;  2GBQ A;  3VRZ A;  4D8D A;  2EGC A;  2LX7 A;  3SHW A;  4CC3 A;  1GBQ A;  1X43 A;  4DEX A;  1AEY A;  1YCS B;  1VYT A;  4J9B A;  2JM8 A;  1ZBJ A;  1AVZ C;  4JZ4 A;  4OML A;  3CQT A;  4KRT A;  4J9H A;  2DYB A;  2KXD A;  2J6K A;  5IXB A;  3KFV A;  2RN8 A;  2RF0 A;  1X2K A;  2HSP A;  1UHF A;  4J9I A;  2DF6 A;  2KXC A;  4JJB A;  3EGU A;  4CC2 A;  1T3S A;  3GBQ A;  5I22 A;  4J9E A;  3TSW A;  1PWT A;  2I0N A;  1XOV A;  2H8H A;  1YWP A;  1YWO A;  2EYX A; 
#chains in the Genus database with same CATH topology
 4JRI A;  2DL7 A;  5GAM f;  1PD0 A;  1QKX A;  1FWZ A;  1G3Y A;  4BAC A;  1K8A C;  5GMK h;  4NS5 A;  1ZLM A;  8AT1 B;  4EMK A;  4LXC A;  5AT1 B;  2LJ1 A;  2QAS A;  2E4H A;  3OYA A;  2YXY A;  2R5A A;  1KQS A;  4MZM A;  5C6S A;  4JRK A;  2OTJ A;  3H0F A;  2P4T A;  1I8F A;  2HBP A;  2KNB B;  5KYN A;  3FC3 A;  2O9S A;  3DLM A;  3CC7 T;  2QA4 Q;  2K6D A;  2RHX A;  5CKD A;  4C0D C;  2VGM A;  3OSS C;  2EVR A;  2LQN A;  2JMA A;  3CPW S;  3LYI A;  1VQO Q;  1U1S A;  3N5B B;  2DX1 A;  4DBR A;  1M8M A;  3FLG A;  2CT3 A;  2JZ2 A;  1M1G A;  3A1P A;  3URG A;  3J80 E;  1JEG A;  1A0N B;  4QT7 A;  4QKU A;  2KGT A;  1W2B S;  2EGE A;  2EJG A;  2RQW A;  4A4G A;  2EWN A;  2QYZ A;  3AT1 B;  1O75 A;  1WPY A;  1O9S A;  1TUG B;  1M3B A;  2NYS A;  1WFW A;  3DLL A;  1X27 A;  1WLP B;  4DQ2 A;  2OTL Q;  2MAM A;  3A8M B;  2R5M A;  2M16 A;  3M0T A;  2BE7 D;  2ABL A;  1QQJ A;  1VQM Q;  3SD4 A;  1Q7Y U;  2MK5 A;  2E3I A;  1HK9 A;  2PTK A;  1TS9 A;  1VQ9 T;  1ZUY A;  2A0F B;  2VGN A;  4FU6 A;  1GCP A;  1E6H A;  1VQ7 Q;  1RAE B;  4J83 A;  2C0I A;  3UA6 A;  2D0N A;  4OMN A;  4F7U B;  1KFZ A;  1S72 Q;  5GAN f;  3L2W A;  1BIA A;  2BZY A;  1OZ2 A;  1ZSZ A;  4OGC A;  1QMC A;  2DAQ A;  2QDL A;  2RHI A;  4F7U F;  1VQL Q;  2DRM A;  3PIO A;  3HRT A;  2YUP A;  5CKE A;  3TSZ A;  2QXF A;  3VUZ A;  1YJN T;  2KEA A;  2E70 A;  2E41 A;  2JN0 A;  4QQ6 A;  3PFS A;  1Y71 A;  3HP9 A;  2RHY A;  4BDZ A;  3M54 A;  2FZC B;  3EG2 A;  2WAC A;  2L0A A;  3MEV A;  5LJ5 d;  2YUQ A;  4OB3 B;  5LL6 S;  5HKC A;  3REB B;  2HAX A;  1WJS A;  2KT1 A;  1Y96 B;  1VQ5 A;  4M7D F;  1HJD A;  1TG0 A;  4J8O A;  4KH1 B;  2KVQ G;  3CCL A;  3QYG B;  1U06 A;  3CC2 A;  4QVC A;  5KYW B;  1LPL A;  2OJ2 A;  4FM4 B;  4A4F A;  4BDY A;  4J9C A;  4ME7 A;  5EG2 A;  4WCI A;  4M77 B;  3SEM A;  1M9S A;  2LC4 A;  3OW2 S;  3VS3 A;  2Y90 A;  3OY9 A;  1Z9Q A;  1KG1 A;  2ROL A;  2G3R A;  2DXC A;  4M77 F;  4OMM A;  2DL4 A;  4Q5W A;  4PJO B;  4DOW A;  3RBB B;  1G2B A;  2EIF A;  4FW2 A;  3VS4 A;  1NEG A;  4LDX A;  3JCM e;  2LQ8 A;  4RTV A;  3L2R A;  1JB0 E;  3MJX A;  1NPP A;  4JJC A;  4GY5 A;  1BI3 A;  1ABO A;  3NMZ C;  1TH7 A;  2RO0 A;  3LLR A;  4JZ3 A;  1RAC B;  1D0Y A;  3EGD B;  1KJW A;  1FYN A;  3EFS A;  5CK9 A;  5FU6 B;  5CQY A;  2QQA A;  3M0Q A;  2ZPI B;  1R0B G;  1AWO A;  2CKK A;  1SPK A;  2JS0 A;  5A0L A;  1YIT T;  4DEY A;  2L3P A;  2K57 A;  3O5Z A;  1BKB A;  3CCQ T;  3QKJ A;  2IIM A;  2XIC A;  4IUT A;  2K79 A;  3LW5 E;  3G71 A;  3CCJ A;  2XD0 A;  5D6Y A;  4BI4 A;  2DD5 A;  4C92 B;  4BE1 A;  4ESR A;  3VUB A;  1KQS P;  3GLX A;  2XK0 A;  4XTY A;  2DBK A;  1PG5 B;  4C92 F;  5LJ5 f;  5DY9 A;  2O88 A;  1AD5 A;  3M9Q A;  2QEX Q;  4OMF B;  4IUP A;  3U23 A;  4XTX A;  4XU0 A;  1J3T A;  4OMP A;  1RAH B;  4ATO A;  1YFN A;  1QCF A;  2DXU A;  4J6X A;  2FB7 A;  1BI0 A;  5FWB A;  3VS5 A;  1N27 A;  3I56 T;  2KRM A;  1YP5 A;  5GAN j;  1UG1 A;  1TOV A;  3OYI A;  4F17 A;  1NG2 A;  3UPU A;  4N0A A;  3BY7 A;  1UGV A;  3C12 A;  2MWP A;  1IZ6 A;  1M5Q 1;  2LCS A;  3V7R A;  3CC7 Q;  5LJ3 f;  2LCL A;  3CCS T;  4AMC A;  2E3H A;  2ECZ A;  1OYX A;  2P0K A;  4IUU A;  1QP3 A;  4IUQ A;  3EGX B;  3TVT A;  1YJ9 A;  4BI3 A;  4M7A B;  1NE8 A;  2CZ6 B;  2FRY A;  3ZL7 C;  1SSF A;  5IHI A;  2DNU A;  4M77 E;  5CR2 A;  3CMA A;  2XDD A;  3S3M A;  4M7A F;  3QJY A;  2Z0W A;  3S6W A;  1OX8 A;  2KMT A;  1UGQ B;  3CXC A;  1KQ2 A;  4PJO E;  5CVI A;  1WDX A;  1N8R R;  3M55 A;  2K7A A;  3TEE A;  1VQP Q;  2NWM A;  2PQW A;  2CP7 A;  3UA7 A;  4AFQ C;  2GCX A;  2D0Q B;  1YIJ T;  1AHJ B;  4C5G A;  3ER0 A;  4HVV A;  5FU7 B;  4HCC A;  2K3X A;  2O9V A;  1JXO A;  1VQ9 Q;  2E6Z A;  4M75 G;  3JV3 A;  4C0Z A;  3PT9 A;  1N8R C;  1K76 A;  2DXT A;  1I07 A;  1YIT A;  1RI9 A;  1AZG B;  4N0A C;  2W0Z A;  5AYF A;  2I2L A;  5GAO n;  4GLM A;  2YLC A;  4PJO D;  1VYV A;  4AFS C;  2P84 A;  1YHQ A;  2XG8 D;  3GF5 A;  3OMC A;  2R58 A;  1AEY A;  1VYT A;  1YJN Q;  1MMN A;  4J9B A;  3NTH A;  1VQ6 A;  2CP3 A;  3ME9 A;  4J9H A;  3VKI A;  2K5I A;  2X51 A;  2RI2 A;  4C92 E;  2HSP A;  1PCX A;  1UHF A;  4OB2 B;  1RAD B;  2H3E B;  3L1A A;  2L8D A;  2A7Y A;  3EGU A;  1C0M A;  4FT4 A;  5GMK i;  3GBQ A;  2PVO B;  2NUP A;  1Q81 R;  3VU3 C;  3JCM c;  2PUO B;  3LX7 A;  3LGF A;  3EFO A;  1YWP A;  3RDV A;  4Z8A A;  2OTJ T;  4LD9 K;  1MNE A;  1SSH A;  3JRZ A;  3LH0 A;  2BIV A;  2FG0 A;  2PZ1 A;  2ESW A;  1JO8 A;  3ASK A;  1YBY A;  3I56 A;  2PUK B;  4RG2 A;  1SHG A;  1T3L A;  1LCK A;  3FRN A;  1W2B A;  1Q81 C;  3THK A;  3CCV A;  2LT4 A;  2QAZ A;  2QGG A;  4F04 B;  5GAO m;  4V2S A;  2A28 A;  4FSX A;  1Q86 R;  1JXM A;  3GPL A;  4FYY B;  1RAI B;  1WIE A;  1SG5 A;  2KRN A;  3GP8 A;  2CSQ A;  2VB6 A;  2L3R A;  4M75 F;  4C8Q F;  3JB9 I;  4R55 A;  3QHS A;  2EKH A;  4HKE A;  1H92 A;  3EG0 A;  4C0F A;  2CGH A;  2VKN A;  3LH5 A;  2FZK B;  2AZS A;  3DKM A;  2HL3 A;  3MP8 A;  1Q86 C;  2DO3 A;  4PJN A;  2RJE A;  3JCM X;  1K9M U;  2FPD A;  3CCE A;  2CDT A;  4E7S A;  2D9T A;  3SWN A;  5LJ3 j;  3J81 E;  3EG3 A;  2SRC A;  3P8B B;  2RK1 A;  4Z89 A;  1T0J A;  2LDM A;  1TSF A;  5FW9 A;  3CC4 T;  4JJN K;  3E9F A;  3CCQ Q;  4HVU A;  1OU9 A;  3V8L A;  2X4Y A;  2O4X B;  1OI1 A;  2HCK A;  2FYK A;  2OAU A;  1D0X A;  1VQN A;  1RAG B;  4BY6 C;  5FWC A;  3JCM b;  2V8K A;  1K9A A;  5CAI A;  2QQR A;  3EG9 A;  2O31 A;  5GAM h;  2CP5 A;  3NGP A;  2KYB A;  1QVG P;  1M4Z A;  2C06 A;  2DEU A;  2EBP A;  3QDF A;  2EJF A;  4CRI A;  2EYZ A;  3OYE A;  3OQ5 A;  1QVP A;  2AZV A;  1OOT A;  2LX9 A;  5GAN d;  4MDX A;  4IUV A;  1TXQ A;  1VQ5 T;  3RKY A;  2QQS A;  3RKX A;  2KBT A;  5I11 A;  1TUD A;  3OW2 A;  2X4W A;  3CCL T;  4O5V A;  1SEM A;  3QPH A;  1WHL A;  2EQU A;  2E5K A;  4XU2 A;  3OYJ A;  2O2O A;  1VQ4 T;  1UB4 A;  3CC2 T;  1UGS B;  2F5K A;  3NFC A;  3CXC P;  1UHC A;  4N4H A;  1X01 A;  4AT1 B;  1M1K U;  4A63 B;  2DTH A;  4XU1 A;  4RTU A;  2VXE A;  3T9N A;  2QK0 A;  3CD6 Q;  2KT8 A;  4EMK B;  2VXF A;  4QW2 A;  1Q82 R;  4E7H A;  3SWN C;  4R56 A;  1OPK A;  2AK5 A;  3OYB A;  3A98 A;  2L89 A;  1WJQ A;  1IRX A;  1IRE B;  1JJ2 P;  1C1A A;  2E12 A;  1TTH B;  4J9D A;  2DZ9 A;  1EX4 A;  3H0I A;  4LN2 A;  4KH0 B;  2ZPB B;  3MEA A;  2ATC B;  2BZ8 A;  2WSE E;  3MEU A;  4IIM A;  2E65 A;  2EW3 A;  4JLI A;  3M53 A;  3L42 A;  1Q82 C;  2CZ0 B;  2XKO C;  4II1 A;  3V8J A;  1ZX6 A;  5GAN 5;  1FMK A;  2W10 A;  1NYF A;  4FCY A;  3MP6 A;  1NJI U;  2DE0 X;  5LJ5 g;  4C5H A;  1QWF A;  3M4Y A;  2KYM A;  3JCM W;  3SB2 A;  2EQK A;  5GAO q;  2J6F A;  2GTO A;  3JB9 D;  5EC7 A;  4A4E A;  1VQK Q;  1YIJ Q;  1IO6 A;  4M4Z A;  2QDY B;  2VVK A;  3KUF A;  1WGS A;  4DA4 A;  2B86 A;  3G71 T;  2RJC A;  3CCJ T;  2DD4 A;  3CPW P;  1OZ3 A;  5HCK A;  1UGR B;  4DOV A;  2MMP A;  1NPR A;  3HTR A;  2OX7 A;  5HY6 A;  3R6O A;  2DK3 A;  3CC4 A;  1HSQ A;  3EFR A;  3CME A;  1W2B P;  2GNC A;  2C0O A;  3I55 Q;  3EAE A;  1QWE A;  1Y57 A;  4OB0 B;  4BUG A;  1ZSZ B;  3HSB A;  3UDC A;  2F2W A;  2DLP A;  2HQH A;  3JCM f;  5IHN A;  2ZPF B;  4RTY A;  2FRW A;  3QZ5 B;  4PJJ A;  4PJO G;  3VS7 A;  2EAY A;  3BE3 A;  3I5R A;  1M2V A;  1M8V A;  2P4R A;  2J6O A;  1UJY A;  3MO8 A;  1U5S A;  2HSE B;  1X6O A;  5GMK e;  4M7D B;  1N9S A;  1PKT A;  3ZEH A;  2YUO A;  3L2Z A;  3PVQ A;  2DJQ A;  4M78 E;  2OTJ Q;  1WHK A;  1QP2 A;  1BI1 A;  4X34 A;  1WJR A;  1LOJ A;  2YT6 A;  2RJF A;  1H8K A;  3E1S A;  2NLU A;  4Z02 A;  4J6W A;  5IH2 A;  1VQ4 A;  5CIU A;  2V8I A;  2CUB A;  4CI0 C;  1IGU A;  3BDL A;  4Y91 A;  1FMW A;  2MCN A;  2DTO A;  1JQQ A;  3OS2 A;  1YJ9 T;  1QKW A;  1K0X A;  5D6X A;  2XDB A;  1NLO C;  1M2O A;  2LVM A;  1NEB A;  4BE0 A;  1WA7 A;  3CMA T;  5KYW A;  1WI7 A;  4M78 D;  4E7Z A;  1LJO A;  4HCB A;  2XDP A;  1KC8 U;  5CKF A;  4EPC A;  5LJ3 d;  3OYF A;  2A36 A;  3QII A;  1BI2 A;  1Y0M A;  4NOY A;  3G4S A;  1Q7Y R;  4PJO A;  1RL2 A;  4JJD A;  4C5E A;  3UAT A;  1R77 A;  2X9H A;  4HCZ A;  4JLG A;  2LNV A;  3CCR A;  4RTW A;  2M0Y A;  3P8D A;  1WXU A;  3RR6 A;  4R0K A;  3OW2 P;  5FLX E;  2ED0 A;  5LJ5 h;  2HEQ A;  3V8K A;  1H64 1;  3VYG A;  2EYY A;  2DVJ A;  2VYT A;  3QWX X;  1U8R A;  3CEY A;  2H3J A;  4KUL A;  2DL5 A;  1Q7Y C;  1WQ7 A;  1YHQ T;  4J6Y A;  3RUX A;  2M1H A;  1PD1 A;  2FVU A;  1BU1 A;  2OI3 A;  3A8G B;  3X24 B;  1VQ6 T;  1TWB A;  2COZ A;  1QLY A;  4AG1 C;  2MF2 A;  2JMC A;  2KRS A;  2LMJ A;  4X9C A;  2DET A;  5GMK j;  3REA B;  2LT1 A;  2XI9 A;  1GBQ A;  1X43 A;  2JNG A;  2RI3 A;  1VQ5 Q;  1XNI A;  4E47 A;  2DKG A;  2JM8 A;  4MZP A;  1ZBJ A;  4F7U E;  1AVZ C;  4OML A;  4E7L A;  4OGE A;  2A3L A;  3X28 B;  3KFV A;  1D1B A;  2RF0 A;  3CCL Q;  3WXM B;  4KBM B;  4J9I A;  5KYX B;  3HHT B;  2KXC A;  3CC2 Q;  3QUI A;  5DLO A;  4M77 C;  1Y07 A;  4CC2 A;  1TU0 B;  1KK7 A;  1PWT A;  4JDS A;  1K73 U;  1XOV A;  2PU9 B;  3QSU A;  3CCU A;  1I81 A;  4IUR A;  1YWO A;  2EYX A;  3QJ6 A;  3CCV T;  1YJW A;  4PJO C;  4ZN3 A;  3TRE A;  2RK2 A;  3C0C A;  1RLP C;  1M90 U;  4PLL A;  2K5F A;  3KXT A;  2DIQ A;  4M7D E;  2MIO A;  2K4Y A;  1W70 A;  1NYG A;  3EH2 A;  1AT1 B;  3FEO A;  5CO7 A;  1QVG A;  1ZBX A;  1VQ8 A;  4FYV B;  2EPD A;  2ZZD A;  1OU8 A;  1I0C A;  2X35 A;  4JRQ A;  5FU6 C;  4A4K A;  2LCC A;  5A2Q E;  3QYH B;  1W4S A;  1X69 A;  5IXF A;  4J9G A;  3VS6 A;  2EQM A;  3CCE T;  4X9D A;  5I2M A;  1MV0 B;  2BTT A;  4ZGJ B;  3E9G A;  2FZG B;  2NUT A;  5J39 A;  3EHQ A;  4M7D D;  3LWH A;  1S1N A;  1WX6 A;  3PTA A;  2YHT A;  1MHN A;  1ZA1 B;  3QO3 A;  4C5I A;  4C92 C;  1VQO T;  4ZGD B;  1CSK A;  2YLB A;  3G71 Q;  4LDU A;  3CCJ Q;  2D6F A;  2L3S A;  1VQN T;  1K1Z A;  2RNA A;  4HXJ A;  4LNP A;  3RKW A;  4DBF A;  1KD1 U;  3JB9 G;  3PGG A;  5GAM g;  1B3Q A;  5A0D A;  2RQT A;  1JJ2 A;  2LZ6 B;  4M77 D;  2MPX C;  4L59 A;  1GBR A;  1QCN A;  4LUE A;  5FRN A;  2COY A;  2ROT A;  4DBH A;  2GF7 A;  4C0G A;  1I5O B;  3GIB A;  4ANJ A;  4OF1 A;  3FDR A;  3CBP A;  5GAO l;  2MYS A;  1P92 A;  1AWX A;  1GCQ C;  3A8O B;  3ZFJ A;  4ELZ C;  1D3B A;  5I2S A;  1UGP B;  3I35 A;  4LDY A;  1X6G A;  4J7I A;  4XTV A;  2V1R A;  4KT0 E;  4A54 A;  1PKS A;  2J7I A;  2VWF A;  2GFA A;  2F2X A;  2XMF A;  2CYZ B;  1WHH A;  3G6E A;  1YNZ A;  4F16 A;  1X75 C;  2PNI A;  2YSQ A;  3VS1 A;  1YI2 A;  3RMQ A;  3MP1 A;  2K2M A;  3LGL A;  4CC7 A;  2JTF A;  4FSS A;  1WHM A;  3VS2 A;  1V29 B;  3JCM P;  2GQV A;  4XTZ A;  5KYY A;  2DMO A;  1ABQ A;  1VQL T;  2JOY A;  1FXX A;  2NUP B;  2BZX A;  3CPW A;  4KGV B;  3EFO B;  5I21 A;  5GAN 2;  2MI6 A;  3OA6 A;  1ZHI A;  3Q1J A;  2KK4 A;  4AFZ C;  4A4H A;  5GJV B;  4A53 A;  3EH1 A;  4PL6 A;  4GBQ A;  5KYU A;  4PJL A;  2QQB A;  1D09 B;  5GAN 6;  3OYM A;  2CP2 A;  3INZ A;  3X25 B;  2CZ7 B;  4C92 D;  1YJ9 Q;  3PMT A;  1UE9 A;  1UEC A;  3MEW A;  4M75 B;  4OVA A;  1B34 B;  4C8Q B;  1K8A U;  3CMA Q;  2OAW A;  3OB9 A;  2DL3 A;  1U3O A;  3CCM A;  1UDL A;  2ZGW A;  2IPO B;  1BB9 A;  4N4I A;  1ZSG A;  4PNO A;  1FX7 A;  4RUG A;  5J3B A;  5DLQ E;  5L23 A;  1G3T A;  2QG9 B;  3BFM A;  5GAN g;  4PFP A;  4K11 A;  2ZPH B;  4JRP A;  1CKB A;  2JUF A;  5FU7 C;  2L2P A;  5GAO p;  3O8V A;  2YRC A;  3MCA B;  4RTX A;  2EYQ A;  1RUW A;  3J7A F;  3OYN A;  4M78 G;  1AWJ A;  4L5G A;  2HL5 C;  4D6W A;  3F70 A;  1QVF S;  1AOJ A;  1Q82 U;  2P0P A;  4M7A E;  3OYL A;  2KQW A;  1YIT Q;  4LE9 A;  1V1C A;  2QA4 A;  4XK8 E;  3VS0 A;  3M4G A;  3M59 A;  2E10 A;  1LVK A;  2FL7 A;  2CH4 W;  1M27 C;  1WNL A;  1VQO A;  3X20 B;  1YHQ Q;  3CME T;  2QGF B;  4PFZ A;  2RH2 A;  3RES A;  5HK3 A;  1UTI A;  1NM7 A;  4C0D B;  1D1A A;  3M0U A;  1Z9Z A;  1AZE A;  2JS2 A;  2GFU A;  1VQ6 Q;  2EKO A;  3C4S A;  4OMO A;  3RER A;  3OMG A;  5KCH A;  4LDV A;  1IB8 A;  2M9U A;  3BDU A;  1JU5 C;  4OB1 B;  1BIB A;  1OEB A;  4M7A D;  2SEM A;  2BKD N;  2PVD B;  2D8J A;  2FHD A;  3C95 A;  3PIP A;  1OV3 A;  4E2F B;  2LJ3 A;  5HK0 A;  3NHN A;  2OTL A;  2YRD A;  1UEB A;  1UUE A;  4JPB W;  2D1X A;  1PSF A;  5KE3 A;  2WSC E;  4FYW B;  2HKN A;  3UWN A;  3MHX A;  4RG8 A;  4JS4 A;  3P8H A;  1VQM A;  3FJ5 A;  4M78 A;  3I56 Q;  3UF4 A;  1GXI E;  3EHR A;  4J9F A;  1VQ7 A;  1PNJ A;  4MZT A;  3JCM d;  1HD3 A;  3CCV Q;  1S72 A;  5CQX A;  2IG0 A;  2M51 A;  2YDL A;  1ZUK A;  3OBY A;  1PC0 A;  1G3S A;  2JXB A;  1VQL A;  1UFF A;  7AT1 B;  3VRY A;  3H41 A;  3CCS Q;  1OUL A;  2DTI A;  2DRK A;  4X1V A;  1SKU B;  2LNH B;  1OPL A;  1D0Z A;  1N6A A;  1RAA B;  2VAS A;  1H3Z A;  3PE0 A;  5CKB A;  1K9M R;  2LQK A;  2RA2 A;  3SFM A;  3G4S T;  2QQ9 A;  3CCE Q;  4F7U G;  4XAX B;  1JBM A;  1QCO A;  2HMA A;  4PJM A;  1RI0 A;  5GMK m;  3CCR T;  2ENM A;  4KGX B;  2CSI A;  4M75 E;  3FIF A;  1KQ1 A;  4C8Q E;  1ZUU A;  1MND A;  4HA8 A;  3V7S A;  2VUB A;  3ULR B;  4O6J A;  2L3Q A;  2EQJ A;  2ZPE B;  1K9M C;  1AWW A;  2GQI A;  2JVV A;  5GAN h;  1W6X A;  2RPN A;  4KGZ B;  2P0Q A;  1I1J A;  1SF9 A;  3C94 A;  1RAF B;  4RCC A;  3GOX A;  4ZNX A;  1VQN Q;  4N4G A;  4M7D G;  1YN8 A;  1T0H A;  2CH4 A;  1GRI A;  1WXT A;  1YCY A;  3JCM h;  1PSE A;  3H6Z A;  4M78 C;  3VJP A;  4TVR A;  3L2Q A;  1VA7 A;  3AHU A;  1GL5 A;  4M75 D;  2DM1 A;  1WZO A;  4C8Q D;  4OMQ A;  5GAM e;  2DFU A;  1VQP T;  3M0R A;  1R0C B;  4LDW A;  1G83 A;  3DB3 A;  1KHC A;  2XU8 A;  1VIF A;  2HNI A;  2J06 A;  3TCJ A;  1W1F A;  5LJ3 g;  1R8O B;  1XQH A;  5GJW B;  2KDS A;  4M77 G;  1BK2 A;  2FPF A;  3QWY A;  5IAY A;  4E6R A;  1MGQ A;  4F7U A;  2M02 A;  2EFI A;  2V1Q A;  4RCB A;  2K3B A;  2GBQ A;  1M1K R;  9ATC B;  2LX7 A;  1HYO A;  3WVE B;  4EMK C;  4DEX A;  3CBM A;  2AIR B;  1I4K 1;  3CCU T;  4KRT A;  3CQT A;  2WSF E;  2DYB A;  2KXD A;  2E5Q A;  3OYG A;  1YJW T;  4FIB A;  1M2V B;  3H9N A;  3E19 A;  3OS0 A;  1RAB B;  2DF6 A;  4L6V 5;  3NTK A;  1NBE B;  5I22 A;  3L2U A;  5FRO A;  2Y4X A;  1M1K C;  2I0N A;  1FMV A;  3RIR A;  2RD1 A;  4ELY C;  1VQ8 T;  4M7D A;  3MPU B;  3SDZ A;  1Y96 A;  4J7F A;  3X26 B;  2GGR A;  3M58 A;  1NJI R;  2ZPG B;  2QEX A;  1ACM B;  1E7O A;  2YRV A;  3A8H B;  1WHG A;  3PVL A;  2DXB A;  3QZ9 B;  5IT9 E;  2ZCF B;  2G6F X;  3HL8 A;  4C92 G;  2CP0 A;  2CRE A;  1B7T A;  4RMO A;  4M77 A;  1B07 A;  3LWI A;  1VYU A;  4QVD A;  5GAN e;  4RTT A;  3R6N A;  2RB6 A;  1NJI C;  4FYX B;  1CKA A;  2YUN A;  2PVG B;  3M0S A;  3ZBD A;  1BYM A;  4AG2 C;  5KCO A;  1XTD A;  4MMK A;  4GLK A;  1SRL A;  5D6W A;  3JB9 J;  5GAM j;  1X6B A;  5KE2 A;  3CC7 A;  2L5Q A;  2AKK A;  2K3Y A;  4PJO F;  3CC4 Q;  1PM3 A;  3FB9 A;  1ZSZ C;  1KQS S;  3EGD A;  4HT8 A;  3CME Q;  2HD0 A;  2HQE A;  1TUC A;  3KBG A;  5FRM A;  2QI2 A;  2MOX A;  3RMS A;  1BBZ A;  4PLI A;  3H0H A;  1GFC A;  2KR3 A;  2COW A;  4FW1 A;  4PFO A;  2HQX A;  1HXD A;  4M7D C;  4PKC C;  2XHC A;  1SRM A;  3G6E T;  2M0O A;  4XTW A;  2EJ9 A;  3JAM E;  3NPF A;  1M3A A;  2ZAE A;  1G3W A;  1YI2 T;  1VQP A;  3VYH B;  4C92 A;  1N8R U;  2QTV A;  3OYH A;  4YTL A;  2J05 A;  1IXD A;  2E6N A;  4EDU A;  2F1L A;  3M57 A;  3PNW C;  3OYD A;  2R57 A;  4BE2 A;  4WF2 A;  1Q95 G;  5LJ3 h;  4M7A G;  1VQ9 A;  2EGA A;  5D7U A;  1DJ7 B;  3JB9 H;  1VQ4 Q;  5A0G A;  3QG1 A;  2JTE A;  3DB4 A;  1ZA2 B;  3IQL A;  4F14 A;  4BD3 A;  2A08 A;  2K2V A;  1OX9 A;  1EFN A;  5KYX A;  4ZGE B;  4XU3 A;  1KC8 R;  1GCQ A;  2EYW A;  3CCM T;  1MMG A;  1IGQ A;  1YJN A;  3S3O A;  2F69 A;  4EIK A;  1MV3 A;  1WXB A;  3S3N A;  1QVF A;  2Y4Y A;  3M0P A;  2RQV A;  3FJP A;  3JCM Q;  4XQ3 A;  1EIF A;  3G4S Q;  3OS5 A;  2CS7 A;  3OSV A;  3HFN A;  1PHT A;  4E7J A;  3CD6 T;  4B9X A;  3CCR Q;  3VV0 A;  1KC8 C;  2FPE A;  3I9Q A;  5GAN 7;  1Q81 U;  3A5Z B;  4VUB A;  1MMD A;  2LTO A;  2JT4 A;  1KIK A;  4LD6 A;  2NUT B;  2QA4 T;  4MML A;  3EGX A;  5LJ5 e;  1PRL C;  4M7A A;  3G7Z A;  2CT4 A;  1PRM C;  4PK4 A;  1M3C A;  4ZTF A;  3H8Z A;  3RNJ A;  3GNG A;  2B8A A;  4HCK A;  2X4X A;  1KHI A;  3QXE B;  3HPW A;  2FO0 A;  1Q86 U;  5J26 A;  2LRQ A;  4EMH A;  1IHW A;  4E7K A;  2E64 A;  1EZZ B;  4CC4 B;  1VQK T;  3QDR B;  4UC4 A;  1G5V A;  2K9G A;  2X4J A;  3OYC A;  1MUZ A;  3JCM V;  4HVW A;  3L2V A;  3WVD B;  1RLQ C;  1K0S A;  3E2U A;  2OTL T;  2KI7 A;  1N5Z A;  2GTJ A;  3OYY A;  5DM7 R;  1D1C A;  2F2V A;  2DL8 A;  3CBO A;  4C8Q G;  4MDW A;  1E6G A;  2MWO A;  2DIG A;  1D3B B;  3D7S B;  4OP0 A;  4AFU C;  1K73 R;  1VQM T;  5IHK A;  5LJ3 e;  1GFD A;  2VC8 A;  4ZN1 A;  1M90 R;  1VQ7 T;  3CCU Q;  2KSS A;  3M5A A;  1YJW Q;  1S72 T;  3CCQ A;  3HRU A;  2KRO A;  4IIO A;  2AT1 B;  3EG1 A;  3I55 T;  1ZQ1 A;  2JM9 A;  1SHF A;  1VIE A;  1C6V X;  4KUD K;  1H3H A;  2DER A;  1UJ0 A;  2CUD A;  2RHZ A;  5M9O A;  5KYY B;  2KAF A;  1X2Q A;  1K73 C;  5GAN 8;  1U1T A;  2DVE A;  5CKH A;  1BCO A;  1VQ8 Q;  4XTU A;  2EQI A;  2O01 E;  3PMI A;  2A37 A;  1G8X A;  4QVZ A;  1M90 C;  2BUD A;  4BY6 B;  5C0M A;  2NUZ A;  4M7A C;  4DBQ A;  1KSW A;  3TU4 K;  1NLP C;  2RQU A;  2LQW A;  2V26 A;  5ECA A;  2ED1 A;  5KYU B;  3OBW A;  4RKU E;  3OS1 A;  1WHJ A;  2V8J A;  2KY9 A;  2HBW A;  2C0T A;  2JW4 A;  1MMA A;  2DYI A;  2LJ0 A;  2E1H A;  5CCA A;  3CPF A;  1VOM A;  2LP5 A;  3JB9 F;  4NL3 A;  5LJ5 j;  4B6M A;  1WYX A;  4FT2 A;  4FL6 A;  5GAO r;  4M75 A;  2K5L A;  1B34 A;  4C8Q A;  3NTI A;  4JUV A;  3HKS A;  1N9R A;  6AT1 B;  5GAM d;  1VUB A;  1QW1 A;  3GNF B;  1LNX A;  4D8K A;  5KH6 A;  3OYK A;  2DPP B;  3MET A;  1KD1 R;  3M56 A;  1M30 A;  3HRS A;  4Z88 A;  1Y7X A;  2HDA A;  4HT9 A;  2RM4 A;  2CZ1 B;  1BCM A;  3CD6 A;  3JCM g;  4LUD A;  1NZ9 A;  2QTX A;  4BI8 B;  3CCS A;  2FEI A;  4Y28 E;  3G1J A;  3I5S A;  2HZY A;  3V7C A;  3UT1 A;  3SWN B;  4P5N A;  1IHV A;  2DEQ A;  2RMO A;  2IVW A;  2X3W D;  1KD1 C;  1WQW A;  2RHU A;  1K4U S;  2DIL A;  4RTZ A;  1QVG S;  4NL2 A;  2HKQ B;  2XID A;  5L8R E;  4ZTJ A;  4QQG A;  2DA9 A;  2KE9 A;  5IN1 A;  2D8H A;  2X3X D;  5GAN 4;  1OQK A;  1ARK A;  1JRI A;  3MKD A;  3QBY A;  3G6E Q;  1F1B B;  2AKL A;  3HFO A;  1V76 A;  4E7I A;  3JCM J;  2RI5 A;  1XJW B;  3A8L B;  2O4X A;  4WTO B;  2F5T X;  1YI2 Q;  4QQD A;  2CP6 A;  2RJD A;  1VQK A;  3EG9 B;  4BB7 A;  1QVF P;  2RQR A;  1YIJ A;  4B9W A;  4ORZ A;  4IKF A;  4KUI A;  4Y92 A;  2DBM A;  3VRZ A;  5GMK l;  3CXC S;  2BE9 B;  4D8D A;  2EGC A;  3SHW A;  4CC3 A;  2AHJ B;  1YCS B;  3TQ7 P;  2DZC A;  4JZ4 A;  4M75 C;  8ATC B;  5IXB A;  4J5Y A;  2VV5 A;  4C8Q C;  2YWW A;  2J6K A;  2RN8 A;  2JTM A;  4M78 B;  1K8A R;  2JJ9 A;  1X2K A;  2DJZ A;  3JSC A;  4JJB A;  2QEX T;  1T3S A;  1JJ2 S;  4M78 F;  3I55 A;  4J9E A;  3CCM Q;  1M1F A;  3TSW A;  4EMG A;  2H8H A;  4JS5 A;  1I5L A;  5GAN 3;  3BW1 A; 
#chains in the Genus database with same CATH homology
 2DL7 A;  4Z8A A;  3C0C A;  1RLP C;  1QKX A;  1SSH A;  2FG0 A;  2GGR A;  2MIO A;  1ZLM A;  2PZ1 A;  1W70 A;  1E7O A;  2ESW A;  1NYG A;  1JO8 A;  2LJ1 A;  3PVL A;  1SHG A;  1T3L A;  1LCK A;  2EPD A;  3THK A;  2G6F X;  2A28 A;  1I0C A;  1JXM A;  3H0F A;  1WIE A;  2CRE A;  2KNB B;  2O9S A;  2KRN A;  2CSQ A;  1B07 A;  2K6D A;  1X69 A;  5IXF A;  1VYU A;  4J9G A;  3VS6 A;  4RTT A;  3R6N A;  2EVR A;  1MV0 B;  2BTT A;  1CKA A;  2JMA A;  2LQN A;  2YUN A;  3M0S A;  2EKH A;  4AG2 C;  1H92 A;  2DX1 A;  1M8M A;  3EG0 A;  3EHQ A;  2VKN A;  1S1N A;  1WX6 A;  3LH5 A;  2CT3 A;  1SRL A;  2AZS A;  1X6B A;  1JEG A;  2AKK A;  1A0N B;  2FPD A;  1CSK A;  2CDT A;  4QT7 A;  2KGT A;  2EGE A;  2RQW A;  2L3S A;  3EG3 A;  1K1Z A;  2RNA A;  2SRC A;  4HXJ A;  1TUC A;  4LNP A;  2MOX A;  4Z89 A;  1T0J A;  1M3B A;  1B3Q A;  5FW9 A;  1BBZ A;  1WFW A;  1X27 A;  1WLP B;  3H0H A;  1GFC A;  2KR3 A;  4HVU A;  2RQT A;  2LZ6 B;  1GBR A;  4LUE A;  2HCK A;  2ROT A;  3M0T A;  2ABL A;  1SRM A;  2PTK A;  1ZUY A;  3NPF A;  5FWC A;  1M3A A;  1GCP A;  1E6H A;  1K9A A;  1AWX A;  1GCQ C;  2C0I A;  3UA6 A;  2D0N A;  4OMN A;  1KFZ A;  3I35 A;  2O31 A;  3NGP A;  2KYB A;  1X6G A;  2J05 A;  2BZY A;  2V1R A;  2QDL A;  2EBP A;  1PKS A;  2DRM A;  2J7I A;  2VWF A;  2F2X A;  2XMF A;  2YUP A;  1YNZ A;  3TSZ A;  4F16 A;  2EGA A;  2EYZ A;  2PNI A;  2AZV A;  2YSQ A;  1OOT A;  3VS1 A;  2K2M A;  4CC7 A;  4FSS A;  3VS2 A;  2KEA A;  2JTE A;  2KBT A;  3IQL A;  2DMO A;  1TUD A;  4F14 A;  1ABQ A;  5I11 A;  2A08 A;  1EFN A;  2BZX A;  1SEM A;  2E5K A;  2O2O A;  3EG2 A;  2L0A A;  2YUQ A;  1UHC A;  1GCQ A;  2EYW A;  3REB B;  4AFZ C;  5GJV B;  2KT1 A;  4A63 B;  4GBQ A;  1HJD A;  4RTU A;  1TG0 A;  4EIK A;  2KT8 A;  1MV3 A;  1WXB A;  3M0P A;  1UE9 A;  2RQV A;  1OPK A;  1U06 A;  1UEC A;  2AK5 A;  3A98 A;  2OAW A;  2DL3 A;  1U3O A;  2OJ2 A;  4J9C A;  1UDL A;  1BB9 A;  1PHT A;  1ZSG A;  4RUG A;  4WCI A;  4J9D A;  5L23 A;  3SEM A;  2FPE A;  3I9Q A;  3H0I A;  3VS3 A;  4LN2 A;  4K11 A;  2JT4 A;  1Z9Q A;  2BZ8 A;  4IIM A;  2ROL A;  1CKB A;  2EW3 A;  1KIK A;  4OMM A;  2DL4 A;  2L2P A;  3RBB B;  1G2B A;  4RTX A;  3VS4 A;  1ZX6 A;  1NEG A;  1FMK A;  1RUW A;  2W10 A;  1NYF A;  1PRL C;  2DE0 X;  2CT4 A;  1AWJ A;  1PRM C;  1QWF A;  4RTV A;  2KYM A;  1M3C A;  3RNJ A;  4JJC A;  2J6F A;  2GTO A;  4HCK A;  1AOJ A;  1ABO A;  3NMZ C;  5EC7 A;  4JZ3 A;  1IO6 A;  1FYN A;  1KJW A;  4M4Z A;  4LE9 A;  1V1C A;  2FO0 A;  2VVK A;  3VS0 A;  2CH4 W;  2B86 A;  1M27 C;  3M0Q A;  4CC4 B;  1AWO A;  1SPK A;  5HCK A;  2K9G A;  1UTI A;  1NM7 A;  1MUZ A;  4HVW A;  2JS0 A;  3M0U A;  1Z9Z A;  1AZE A;  4DEY A;  1RLQ C;  2JS2 A;  1K0S A;  2L3P A;  3O5Z A;  4OMO A;  1N5Z A;  2GTJ A;  2IIM A;  2F2V A;  1JU5 C;  2DL8 A;  2K79 A;  1E6G A;  4AFU C;  1OEB A;  1HSQ A;  2SEM A;  5IHK A;  2GNC A;  2C0O A;  4ESR A;  2D8J A;  1GFD A;  1QWE A;  1Y57 A;  1OV3 A;  2LJ3 A;  2DBK A;  3NHN A;  2F2W A;  2DLP A;  2O88 A;  2KRO A;  4IIO A;  1AD5 A;  5IHN A;  1UUE A;  3EG1 A;  4RTY A;  4JPB W;  2D1X A;  2FRW A;  3VS7 A;  2JM9 A;  1SHF A;  1H3H A;  3I5R A;  1UJ0 A;  2CUD A;  3FJ5 A;  2P4R A;  2J6O A;  1X2Q A;  3UF4 A;  3U23 A;  1UJY A;  1U5S A;  3EHR A;  1PKT A;  4J9F A;  1PNJ A;  2YUO A;  1J3T A;  2EQI A;  3PVQ A;  4OMP A;  1HD3 A;  1QCF A;  2A37 A;  2DJQ A;  5FWB A;  2NUZ A;  3VS5 A;  2M51 A;  1KSW A;  1NLP C;  2YDL A;  2RQU A;  1ZUK A;  2KRM A;  2LQW A;  1YP5 A;  2ED1 A;  5ECA A;  2YT6 A;  2JXB A;  1H8K A;  1UG1 A;  1UFF A;  1NG2 A;  4F17 A;  3VRY A;  2HBW A;  5IH2 A;  3H41 A;  2C0T A;  2JW4 A;  2CUB A;  1UGV A;  2DRK A;  4X1V A;  2LNH B;  2LJ0 A;  2MCN A;  1OPL A;  2LP5 A;  1JQQ A;  3PE0 A;  1QKW A;  2LCS A;  1WYX A;  1K0X A;  1NLO C;  1NEB A;  1WA7 A;  2ECZ A;  1WI7 A;  4D8K A;  2ENM A;  1M30 A;  2CSI A;  4Z88 A;  2HDA A;  1ZUU A;  3TVT A;  2A36 A;  4LUD A;  3ULR B;  2FRY A;  2L3Q A;  1Y0M A;  3ZL7 C;  2FEI A;  1AWW A;  5IHI A;  2DNU A;  2GQI A;  1W6X A;  3I5S A;  2RPN A;  4JJD A;  1I1J A;  3UAT A;  4ZNX A;  4RTW A;  2RMO A;  2M0Y A;  1WDX A;  1YN8 A;  2X3W D;  1T0H A;  1WXU A;  2K7A A;  2CH4 A;  4R0K A;  1GRI A;  1WXT A;  2NWM A;  1K4U S;  2DIL A;  4RTZ A;  2ED0 A;  3UA7 A;  2HEQ A;  4AFQ C;  2EYY A;  2DVJ A;  2DA9 A;  1VA7 A;  2KE9 A;  3QWX X;  1GL5 A;  2D8H A;  2X3X D;  2DL5 A;  2DM1 A;  4OMQ A;  1ARK A;  4HVV A;  2O9V A;  3M0R A;  1JXO A;  2AKL A;  1G83 A;  3JV3 A;  1BU1 A;  2OI3 A;  2J06 A;  1K76 A;  1W1F A;  1I07 A;  2RQR A;  1QLY A;  1RI9 A;  1AZG B;  4ORZ A;  5GJW B;  4AG1 C;  1BK2 A;  2W0Z A;  2JMC A;  2KRS A;  2FPF A;  2LMJ A;  3QWY A;  4GLM A;  4Y92 A;  4E6R A;  1VYV A;  4AFS C;  3REA B;  2V1Q A;  2DBM A;  2K3B A;  2GBQ A;  3VRZ A;  4D8D A;  2EGC A;  2LX7 A;  3SHW A;  4CC3 A;  1GBQ A;  1X43 A;  4DEX A;  1AEY A;  1YCS B;  1VYT A;  4J9B A;  2JM8 A;  1ZBJ A;  1AVZ C;  4JZ4 A;  4OML A;  3CQT A;  4KRT A;  4J9H A;  2DYB A;  2KXD A;  2J6K A;  5IXB A;  3KFV A;  2RN8 A;  2RF0 A;  1X2K A;  2HSP A;  1UHF A;  4J9I A;  2DF6 A;  2KXC A;  4JJB A;  3EGU A;  4CC2 A;  1T3S A;  3GBQ A;  5I22 A;  4J9E A;  3TSW A;  1PWT A;  2I0N A;  1XOV A;  2H8H A;  1YWP A;  1YWO A;  2EYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...