2EPDA

Solution structure of sh3 domain in rho-gtpase-activating protein 4
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
76
structure length
76
Chain Sequence
b'GSSGSSGEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERASSDWWRGEHNGMRGLIPHKYITLPAGTEKQVVGAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho GTPase-activating protein 4
publication title Solution structure of SH3 domain in Rho-GTPase-activating protein 4
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 5
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2epdA00
2KRNA 4AFZC 2V1QA 1KSWA 5IH2A 1GCQA 2PZ1A 1UE9A 1NYGA 2KXCA 1AWJA 4AFUC 4D8KA 3VS1A 2CT3A 3ZL7C 2F2XA 2O88A 2HCKA 3H41A 1GL5A 2DE0X 2KXDA 3TSWA 1ZSGA 4Z8AA 3M0RA 2CH4A 1QCFA 1RUWA 2SRCA 3EGUA 1H8KA 1PRMC 4R0KA 2EYYA 2DBMA 2EBPA 1AEYA 2JT4A 4HCKA 3VS3A 2MIOA 2CSIA 1FYNA 2LJ3A 3M0QA 1ZUYA 2CDTA 2W10A 2MCNA 2HBWA 1U5SA 1SHFA 1JU5C 1UHCA 2DLPA 2DILA 3EG0A 1PRLC 2YUOA 3UATA 1K4US 3ULRB 1VYTA 2NUZA 1EFNA 4RTUA 2LJ0A 1NLOC 2ED0A 4RTZA 4X1VA 1AVZC 2YUPA 2J6OA 3CQTA 1YNZA 2EYWA 2LJ1A 1NM7A 1UFFA 1PKSA 3I5SA 4RTXA 4HVUA 2CH4W 4JPBW 2EYZA 4JZ3A 1UGVA 2FPEA 2C0OA 4JZ4A 1SSHA 1VYVA 1WIEA 1XOVA 1K0XA 3I35A 3M0TA 4AG2C 1M30A 1N5ZA 1K1ZA 2JM8A 2VKNA 3UF4A 4Z88A 2GNCA 1MV3A 1YCSB 2GBQA 2KYBA 1T3SA 2JM9A 4FSSA 1KJWA 1ZUKA 1UTIA 1NEBA 1H92A 5FWCA 2PNIA 1FMKA 4RTTA 1I1JA 1YWPA 1AD5A 1GFDA 2DL5A 2F2VA 3NHNA 1QWFA 2D1XA 2O9VA 3GBQA 1X6BA 4RTVA 3EG1A 2KT1A 1AOJA 4HXJA 2JS0A 4IIMA 1OPLA 2ECZA 3IQLA 1G83A 2EQIA 2DL8A 3VRZA 3QWYA 1AZEA 1UJ0A 4F14A 1JO8A 2DL7A 1AZGB 1PNJA 1WLPB 2J6KA 1GBRA 2YSQA 1UJYA 2KE9A 4JJCA 1WXTA 2XMFA 2VVKA 2KEAA 1BK2A 3A98A 3VS7A 2ABLA 1TUCA 1B07A 2C0IA 2FO0A 1CSKA 4J9GA 1BU1A 1UDLA 5I11A 1YWOA 1B3QA 1PWTA 2YT6A 3EHRA 1WFWA 2YUQA 2KYMA 5FW9A 2DM1A 4LNPA 1MV0B 4OMLA 1K76A 1UG1A 3KFVA 1HD3A 4Y92A 2BZ8A 1CKAA 1PHTA 3H0HA 1VA7A 2G6FX 3SHWA 1ZUUA 4JJBA 1OV3A 1IO6A 4ESRA 1LCKA 2D8JA 2ED1A 3EG2A 4IIOA 4LN2A 2J06A 4RTYA 1UUEA 2DVJA 1X69A 2EVRA 1K9AA 1OEBA 1T0HA 1TUDA 1YP5A 1ZBJA 1SPKA 2FPDA 1RI9A 2IIMA 2GTJA 2JW4A 2OI3A 4ORZA 4F17A 3C0CA 2GGRA 2F2WA 2DJQA 2KROA 1ZLMA 1TG0A 3I9QA 1W70A 4OMPA 1AWXA 1YN8A 2M0YA 2RQTA 2KT8A 2J6FA 1ABOA 2FEIA 2DA9A 4OMOA 2DX1A 2K3BA 2DYBA 1M3CA 4A63B 2JMAA 1E6HA 1QKWA 2EGAA 1NEGA 4QT7A 4E6RA 2RQVA 4CC4B 2W0ZA 5FWBA 4EIKA 1WYXA 2O31A 3H0FA 4K11A 1Z9QA 5IHKA 2K7AA 1T3LA 2E5KA 3SEMA 5HCKA 5L23A 2OAWA 1J3TA 3UA7A 3U23A 3LH5A 1Y0MA 2CUBA 2X3WD 2ROLA 2EKHA 4OMQA 1WA7A 4RTWA 2CT4A 4KRTA 1Y57A 2EGCA 4HVVA 4JJDA 1GFCA 4AFQC 3EG3A 2VWFA 1I0CA 3O5ZA 2LNHB 2A37A 3TSZA 1GCQC 4CC7A 4LE9A 2FRWA 1BBZA 4D8DA 2K2MA 1WXUA 3I5RA 2M51A 4OMMA 4CC3A 5IHIA 1WXBA 2ESWA 3THKA 2H8HA 1M8MA 1ARKA 2AZVA 2DBKA 2HDAA 2A36A 2QDLA 1JXMA 1WI7A 2LX7A 1T0JA 2KNBB 1UECA 2YDLA 1GCPA 2LCSA 3VS2A 1E7OA 2AK5A 2DMOA 1VYUA 2L3PA 1RLPC 4J9EA 1JQQA 1HSQA 3PE0A 2DRKA 2PTKA 4AFSC 4OMNA 2D0NA 1GRIA 3JV3A 1X43A 1OOTA 2RMOA 1U06A 3M0PA 1GBQA 4WCIA 1ZX6A 2P4RA 1WDXA 2L2PA 1QKXA 2L3SA 5EC7A 4DEXA 2K79A 5ECAA 2LQNA 2GQIA 3VS5A 2FG0A 2LP5A 4DEYA 2KBTA 3REAB 1W1FA 1WX6A 1UHFA 2ROTA 2OJ2A 2DF6A 3RNJA 3PVQA 1S1NA 3VS0A 3REBB 2X3XD 3RBBB 2YUNA 4Z89A 2RQUA 3NMZC 2I0NA 2JMCA 2AKKA 2LQWA 2K9GA 4CC2A 5GJVB 2JS2A 1QWEA 1U3OA 2GTOA 2C0TA 2AZSA 2KRSA 2L3QA 2J05A 2KRMA 4F16A 2O2OA 2BTTA 1NLPC 4J9CA 1I07A 2RQWA 5IHNA 5GJWB 3NGPA 1X27A 1M27C 1SEMA 2HSPA 2LMJA 2EGEA 2FPFA 2NWMA 2SEMA 1SHGA 3M0SA 1RLQC 1SRMA 2CUDA 2D8HA 4GBQA 2JXBA 1JEGA 5I22A 1A0NB 1HJDA 2FRYA 5IXFA 4ZNXA 1E6GA 1AWWA 1Z9ZA 2L0AA 4HVWA 1JXOA 2DL3A 4RUGA 2J7IA 4J9IA 2RPNA 3FJ5A 3R6NA 2DRMA 2BZYA 1KIKA 4LUDA 3M0UA 1M3BA 4J9DA 3PVLA 1PKTA 2A28A 1M3AA 3H0IA 2V1RA 3UA6A 2RF0A 2DNUA 3NPFA 4GLMA 2BZXA 3VS6A 4J9BA 2EW3A 2RNAA 1G2BA 1BB9A 2JTEA 2DL4A 1H3HA 4J9HA 3VS4A 3EHQA 2KR3A 2RQRA 1OPKA 3VRYA 2AKLA 1K0SA 1KFZA 1QLYA 1SRLA 2RN8A 4LUEA 2ENMA 2LZ6B 1V1CA 2O9SA 2EYXA 1W6XA 1MUZA 2CSQA 3TVTA 5IXBA 2HEQA 4M4ZA 2K6DA 1CKBA 2EPDA 1NYFA 2B86A 1X2KA 3QWXX 4AG1C 1ABQA 2CREA 2KGTA 1X2QA 1NG2A 2A08A 2MOXA 1X6GA 1AWOA 4J9FA
chains in the Genus database with same CATH superfamily
3RMSA 2KRNA 4AFZC 5LJ5g 4M7DA 3E19A 4M7AE 1B34A 1AHJB 1AWJA 4AFUC 1C6VX 4D8KA 3CMAQ 2F2XA 2O88A 2D6FA 3CCMA 3AT1B 1GXIE 1ZSGA 1YI2A 5GMKl 4E7JA 3CC2Q 1KHCA 4QQGA 1H8KA 3OSSC 5A0LA 4XAXB 2K57A 1MNEA 3OYIA 2R5MA 1AEYA 2JT4A 4C92F 3BDUA 1IHVA 4HCKA 3VS3A 7AT1B 4JUVA 2QTXA 5EG2A 2GQVA 3CCUT 2MCNA 2HBWA 1I5LA 3OB9A 3A8LB 4RMOA 4E7HA 1SHFA 1O9SA 1YJWT 3GNGA 1JB0E 4PLIA 2FL7A 5GMKh 1KQSS 2RI5A 2YUOA 2L8DA 1M1KR 1Q82U 1VYTA 1KQSA 4F7UE 1UGPB 1QP2A 2OX7A 1VQOT 3QKJA 4J83A 4C0ZA 1Q81R 5I2MA 3CC7T 4FSXA 3G4ST 1U1TA 2C0OA 1TUGB 3M56A 1VYVA 5KYNA 5LJ5j 4AG2C 1G8XA 3S3OA 1M30A 3JCMg 1K1ZA 4M77B 2EQMA 2DTHA 1MV3A 3CCLQ 2JM9A 1LVKA 1MGQA 4VUBA 1YFNA 2VXFA 1VQLQ 5CKDA 2HQXA 1ZUKA 1KQ2A 1UTIA 2ZPIB 2RI3A 4PJOC 1YJWQ 1M90R 4M78F 1H92A 4X9CA 3CD6T 4BE2A 1I1JA 1AD5A 1PD0A 1ZA2B 3A8GB 5AT1B 2V8IA 3CCVA 4XU3A 1IREB 3CC7Q 3MCAB 3IQLA 1G83A 3G4SQ 3CCMT 5CKEA 2EAYA 1UJ0A 1JO8A 4C8QF 4PJLA 1YI2T 1PNJA 3WVEB 4ZGEB 4E7KA 4PJOA 1MHNA 5LJ5e 4JJCA 1WXTA 1OULA 2JJ9A 2QGGA 4B9WA 2KEAA 4C92G 2KAFA 4L59A 2C0IA 2DXBA 2JNGA 4J9GA 2M1HA 5DM7R 1ZA1B 1B3QA 2YT6A 3OYLA 3EHRA 2YUQA 5GANg 2OTJA 4JLIA 2RHUA 5FW9A 3CMEA 3G7ZA 3MEVA 1K76A 3KFVA 5KYWB 2HBPA 2KQWA 3CCRQ 5FLXE 3N5BB 4ESRA 1LCKA 4OB2B 4BI4A 2J06A 1YI2Q 1EZZB 1R0CB 4ANJA 4JDSA 1YP5A 3GLXA 5GAOn 4XTXA 3UT1A 2IIMA 4A53A 1NPPA 3KUFA 1M1KU 2DJQA 2OTLA 4BI8B 5CK9A 3OYAA 1EX4A 1W70A 2QASA 2IVWA 5DLOA 1PCXA 2M0YA 4BB7A 1Q81U 2RQTA 2VB6A 5D6XA 1WZOA 2BE9B 1YJNQ 2WSCE 2YWWA 2DX1A 3O8VA 4M78G 2L89A 3C4SA 3V8JA 3QSUA 1TH7A 2EGAA 2FVUA 4FIBA 5HK3A 1UEBA 5KE2A 2RK1A 3JCMe 3CCVT 2RJFA 1D1CA 2FZKB 4QVCA 2RK2A 5GAN2 1M90U 2CP2A 3QO3A 1J3TA 3A8HB 4C8QG 2EKHA 1RAFB 4RTWA 1WA7A 5FU7B 5GANj 5LL6S 3ME9A 4M75C 3VYGA 1FWZA 2QGFB 5A0DA 4Q5WA 3EG3A 3MEUA 1I0CA 1VQNA 2A37A 4B6MA 2EQJA 4QW2A 2E70A 3OY9A 4O5VA 2PVDB 1RL2A 1XTDA 1N8RR 4A4FA 4CC3A 3NFCA 2ESWA 2Z0WA 3GIBA 2V8JA 4OMFB 2OTJT 4N4IA 3BFMA 3I56A 2AZVA 3LGLA 1K73C 2HDAA 3CCVQ 4CRIA 2CP5A 4XU1A 2QDLA 3CCJQ 4M7DE 4M75A 1T0JA 2KNBB 4ZGDB 2O4XB 3HFOA 1GCPA 1QW1A 2LCSA 1E7OA 1JQQA 1G3TA 3J7AF 2DRKA 2LNVA 2RD1A 4OMNA 2P84A 5LJ3d 1GRIA 5GANe 3OS1A 3OYKA 2RMOA 5CQXA 2EYQA 5GMKj 4BE1A 2RO0A 4C0DC 2OTLT 2LQKA 1VUBA 2P4RA 2L2PA 5EC7A 2E6ZA 4RKUE 1NJIC 4KUDK 2LQNA 3G6EA 2FG0A 5L8RE 2DFUA 2LP5A 3QG1A 4NS5A 5GAN3 1UHFA 3JB9D 3JB9F 5GAMd 3PVQA 1RABB 2ZPEB 3HKSA 3REBB 2X3XD 3L2QA 2YUNA 1NZ9A 2I0NA 2QEXA 2DEQA 1P92A 4PJJA 3QDFA 2KRMA 2RB6A 4JRQA 1YITQ 4J9CA 1I07A 1OZ2A 1TU0B 1OQKA 5IHNA 1MNDA 3P8HA 3RUXA 4BUGA 1LOJA 2HSPA 2SEMA 5GAN8 3MP6A 1SRMA 4GBQA 1Q86U 4BD3A 4E7SA 1C0MA 4KH0B 4OF1A 5I22A 3WXMB 1A0NB 5IXFA 1E6GA 1AWWA 1Z9ZA 4HVWA 1TS9A 4XQ3A 4J9IA 3VU3C 3FJ5A 1VIFA 2DRMA 3S6WA 3MEAA 4LUDA 3M0UA 4ME7A 1M3BA 3DKMA 4J9DA 3TREA 3PVLA 4FYVB 3G1JA 1K8AC 1BIBA 4RCCA 2V1RA 5D7UA 1M9SA 2Y4YA 4J9BA 2DAQA 1D3BA 2QAZA 3CBPA 3I56T 4L6V5 1BKBA 3M59A 3G71T 5HKCA 1FMWA 5LJ5h 2EFIA 2XK0A 3M4GA 1N8RU 4MMLA 4WF2A 1OPKA 1TXQA 2ZPBB 1K0SA 1KFZA 4M7AF 4PFOA 2OAUA 3EG9B 1V1CA 2O9SA 2HD0A 2EYXA 3PMIA 1W6XA 3CMAA 1FXXA 4M77E 2HEQA 4XTUA 4R55A 2EPDA 1KG1A 3EGDA 3QUIA 2KGTA 1X2QA 3ZEHA 1BI2A 3CC2A 4PJOE 2LC4A 2LQ8A 1GCQA 1UE9A 3G6ET 4BE0A 4OGCA 3LYIA 2FYKA 3BY7A 4FU6A 5CKBA 3ZL7C 2HCKA 2DE0X 3QDRB 3G71Q 4Z8AA 2QEXT 3EFOA 3A8OB 1WHJA 4C92B 2SRCA 4Y28E 3LX7A 2KI7A 2DYIA 2EYYA 3PT9A 2YLCA 2K3YA 2NUPB 9ATCB 3JCMc 3OS2A 1WJRA 2CSIA 4F7UF 2LJ3A 3M0QA 1ZUYA 3A5ZB 4ZTJA 3FIFA 4KGVB 1RACB 1RAIB 2CDTA 2W10A 5M9OA 2ZZDA 1R77A 1SKUB 3JCMh 3JRZA 2DILA 1ZSZB 1PRLC 3RESA 1K4US 2E6NA 1Q82R 2NUZA 4MDWA 1EFNA 3D7SB 2P4TA 3CCLA 2DEUA 2ED0A 4RTZA 3M53A 4X1VA 1LNXA 3JSCA 2YUPA 1VQLA 2X35A 2LJ1A 1NM7A 1UFFA 4F04B 1PKSA 3I5SA 2BE7D 4JPBW 5I2SA 3V8KA 1Y07A 1PM3A 3PFSA 1SSHA 2CP6A 2D0QB 2K4YA 3I35A 2WACA 3M0TA 3CBMA 3OQ5A 1LPLA 2JM8A 3UF4A 3PMTA 1YCSB 4M7AG 2KYBA 1RI0A 3GOXA 1VQ7T 4M78B 5DY9A 3CC7A 1KJWA 1N9RA 3G4SA 2PVGB 4JJNK 1PD1A 1NEBA 2HNIA 4O6JA 1FMKA 1NPRA 2NUTB 2VV5A 4P5NA 2G3RA 4FYWB 1YWPA 4RG2A 8ATCB 2KY9A 3CC2T 1GFDA 1ZBXA 1KD1C 4KBMB 1M2OA 4C8QB 2CKKA 2JS0A 1Y7XA 3FLGA 1M5Q1 4XU0A 1I81A 1AZEA 3RDVA 2IG0A 3DB4A 5GANh 3OW2P 5CCAA 2COWA 1K73R 1OI1A 4EMKC 2COYA 4E7LA 1VQ7Q 2QQSA 2XMFA 1WHMA 4M75E 3CCRA 5IT9E 2ABLA 1JJ2P 1BI3A 3QJ6A 1B07A 4F7UG 4C5HA 1BU1A 5I11A 3P8BB 4RG8A 1S72T 5KYXB 3UDCA 1UGRB 2YHTA 1F1BB 1Y96A 2KYMA 4KT0E 1IHWA 1JRIA 2HKQB 4EMKA 1NJIR 4PFPA 4C92D 2YLBA 3OYHA 3JCMb 1TTHB 2EJGA 1ZUUA 3SHWA 1IO6A 2D8JA 3CCLT 1UUEA 2DVJA 1X69A 1VQLT 1K9AA 2HQEA 1T0HA 1TUDA 1YJNA 4HKEA 1RI9A 2DKGA 2LTOA 2OI3A 3C0CA 1NE8A 2KROA 2CZ7B 1LJOA 1TG0A 2KMTA 1S72Q 4E47A 2J6FA 1N27A 1W2BP 2VGNA 1VQMT 4YTLA 1M3CA 2ZCFB 3EGXB 4A63B 1QVFS 4KULA 3QIIA 1QKWA 1QVFA 4M77C 4E6RA 4J6XA 5FU6B 4CC4B 4UC4A 3J81E 1KK7A 5FWBA 3LWHA 1IGUA 3RKWA 3JAME 2CZ6B 4K11A 1Z9QA 3OS0A 1K8AR 1WHGA 2DPPB 3MHXA 5L23A 3NTIA 3DB3A 4M78D 4DBHA 4DOWA 4LDWA 2CUBA 2X3WD 5D6YA 2ZPHB 4JJDA 3FDRA 4X34A 4NL3A 4HT9A 3P8DA 2VWFA 4EMGA 2LNHB 3TSZA 3OMCA 3JCMX 3CCJA 3CCRT 3RKYA 4CC7A 4LE9A 4M77A 1BBZA 4PL6A 4C5IA 4D8DA 1VQMQ 4M7DF 1WXUA 2YRVA 3I5RA 3M57A 4C8QD 1K73U 4OMMA 5IHIA 1WHLA 1YIJQ 3THKA 2DTIA 2Y4XA 1RAAB 1M8MA 1OX9A 2PU9B 2DBKA 5GAOp 1B7TA 2VASA 2HSEB 1WI7A 1D0XA 1WQWA 2EKOA 1WGSA 3M9QA 2MWOA 5GAOr 5LJ3g 5CVIA 2AK5A 3QXEB 1VYUA 2L3PA 2F69A 2IPOB 1HSQA 5KCHA 3QBYA 5C0MA 1D1AA 1YJNT 4AFSC 2EWNA 4MDXA 4FT4A 5LJ5d 1OYXA 5C6SA 2A0FB 1NJIU 1IGQA 1U06A 4Y91A 1PC0A 1O75A 4DA4A 3L2WA 3M0PA 1GBQA 1ZX6A 5GAMg 1QKXA 2L3SA 3MEWA 4AT1B 2K79A 4J7IA 4QQDA 2X4XA 3VS5A 1YITA 2KBTA 2JOYA 2ROTA 3RNJA 1S1NA 4PKCC 4XU2A 3VS0A 5LJ3f 2RQUA 2AKKA 4A4GA 4CC2A 1VQ4T 2AZSA 2KRSA 2L3QA 4F16A 2O2OA 2RQWA 3JB9I 4C0FA 1SEMA 2FPFA 2NWMA 2RHZA 1SHGA 3M0SA 2BKDN 2D8HA 5GAMf 2DZCA 1Q86R 1Y71A 3CEYA 3FJPA 2V26A 4QQ6A 1HJDA 4JRIA 1MMNA 2MPXC 3A1PA 4R56A 2L0AA 1YCYA 2A3LA 4FL6A 1K8AU 5GAN5 3SB2A 3R6NA 3CCJT 2BZYA 2LVMA 1VQ6Q 4N4GA 4M7DG 5LJ3j 3HFNA 1PKTA 3BE3A 1PSEA 3H0IA 3PTAA 1TSFA 5FU7C 5A0GA 1VQ4Q 4GLMA 3NPFA 5KYUB 4X9DA 3VS6A 1IZ6A 2HKNA 3CPFA 1G2BA 3JCMd 1ZHIA 4M7AB 2JTEA 2RHIA 1KD1R 5GAMj 2GFAA 1QMCA 3EHQA 2KR3A 3OYFA 3VRYA 2AKLA 5GAOm 3JCMJ 2JVVA 4PJOF 4ZTFA 2KVQG 4LUEA 5CAIA 3CCEQ 4NL2A 2QTVA 2PUOB 2ZPGB 3G71A 1NYFA 4C0GA 1K9MC 2CREA 2QK0A 2A08A 3MP8A 2MOXA 1KC8C 1X6GA 4J9FA 3EAEA 4IUVA 4JRKA 1KSWA 1QP3A 5IH2A 2L3RA 2PZ1A 4LD6A 4HA8A 1YITT 5AYFA 1NYGA 2CP0A 1X6OA 3R6OA 5LJ3e 2O01E 2CT3A 2E64A 1M1GA 3VJPA 2M02A 2KXDA 3M0RA 2CH4A 1QCFA 3EGUA 2QA4T 1PRMC 4R0KA 4DBRA 5GAMe 2K5FA 4F7UB 4N4HA 1ZQ1A 1RAHB 2O4XA 2DIGA 2H3JA 2DXUA 2DD5A 3H6ZA 5GANd 4IKFA 1NBEB 3GF5A 4NOYA 4XTZA 2C06A 2X4WA 2XD0A 3OYJA 1Q7YC 4CI0C 2P0PA 1JBMA 1U5SA 1JU5C 2QQBA 1UHCA 2QQAA 3L1AA 2EQKA 3HRTA 3EG0A 3UATA 1M1FA 3CPWP 3ULRB 1D0YA 4MMKA 4RTUA 2DK3A 1NLOC 2F5TX 3CCQT 1YNZA 3S3MA 3SDZA 4RTXA 3HTRA 1RAEB 2CH4W 4M77G 2QA4Q 2EYZA 1UGVA 3VV0A 3I55Q 3PNWC 2BIVA 3X24B 1XOVA 4JLGA 5GAOq 3HRSA 2MAMA 1WPYA 3VUBA 3E2UA 3GP8A 1N5ZA 2VKNA 4PJOG 1QCNA 2GBQA 1T3SA 1VQKT 5CR2A 3RKXA 3OW2S 2DD4A 2RJCA 2CYZB 2FB7A 4IUTA 3OW2A 1KD1U 5FWCA 2PNIA 4KUIA 4ZN3A 1QWFA 4M7AD 1WHKA 1VQ7A 2O9VA 1JJ2S 3CCQQ 4RTVA 3EG1A 3V8LA 1JJ2A 2QYZA 1OPLA 3GNFB 4M75F 2EQIA 1FMVA 2GF7A 4F14A 2DL7A 2P0KA 4PJNA 3X25B 1AZGB 1WLPB 2RH2A 4ZN1A 2J6KA 3BDLA 1GBRA 2XKOC 3AHUA 2YSQA 4KGXB 2RJEA 2MMPA 1BI1A 1VQKQ 2EJFA 1UJYA 2KE9A 2HZYA 2XI9A 3URGA 2ZPFB 2JTMA 2VVKA 6AT1B 3DLMA 3VS7A 3PGGA 2GFUA 5KE3A 3VYHB 2FZCB 3EG9A 3GPLA 2ATCB 3LW5E 1VQ9T 2MYSA 1PWTA 2CGHA 1M2VB 4C92C 2MK5A 4LNPA 1MV0B 4EMHA 4KH1B 1HD3A 1CKAA 1PHTA 3H0HA 1VA7A 2G6FX 3CXCP 1OV3A 1W2BS 1QVPA 1M8VA 4IIOA 1S72A 4LN2A 4A4EA 1AT1B 4EDUA 1W2BA 2EVRA 1ACMB 1Q95G 4B9XA 1SPKA 5GAN6 2FPDA 3RIRA 2AHJB 1H3ZA 4LDUA 3PIPA 2M16A 2GTJA 2JW4A 4ELZC 2V8KA 1ZSZC 4C92A 1PG5B 3SWNB 1VQ9Q 4PK4A 3I9QA 3BW1A 1AWXA 5GMKi 2NUPA 4LDVA 4BY6B 1QCOA 1ABOA 4BY6C 3JCMV 1XQHA 4OMOA 3INZA 2K5IA 1D0ZA 2DIQA 1E6HA 2CZ1B 4FW1A 2Y90A 2RQVA 4XK8E 4M78C 1OU8A 2O31A 3F70A 5KYYB 1ZSZA 1T3LA 2JUFA 3SEMA 4M75G 5FROA 1VQMA 4II1A 5CO7A 2OAWA 1VQ5T 5D6WA 1UB4A 1G5VA 2ROLA 3EH1A 3X26B 1YIJA 2M9UA 4OMQA 2CT4A 4KRTA 2EGCA 3MPUB 4M7DB 4EPCA 3QZ5B 3O5ZA 2E3IA 2X9HA 1B34B 4C8QC 2VC8A 2FRWA 5LJ3h 2K2MA 4M78A 2RA2A 1U8RA 2HMAA 1FX7A 3QYHB 1K9MR 3RMQA 4J6WA 2H8HA 4L5GA 4A54A 4N0AC 1KC8R 3L2RA 5CIUA 2X4JA 2QQ9A 1BIAA 2A36A 2NUTA 4JS5A 1JXMA 5GAMh 2L5QA 2LX7A 1UECA 3C12A 1VQ5Q 5J39A 2WSFE 2DMOA 4C8QA 3TU4K 2DZ9A 4J9EA 4TVRA 2MI6A 1RAGB 2PTKA 2HAXA 2DJZA 1X43A 1OOTA 3EFRA 1VIEA 3X28B 4PNOA 4WCIA 4N0AA 2DTOA 2E3HA 1WDXA 3JB9H 2HQHA 4DEXA 3UWNA 2R5AA 5ECAA 2GQIA 3CC4Q 1D1BA 4DEYA 3REAB 1W1FA 1WX6A 1EIFA 1MMAA 2DF6A 3QYGB 3T9NA 2I2LA 5A2QE 5KYXA 3M54A 1Q7YR 5LJ5f 4Z89A 2E4HA 3NMZC 1G3WA 1VQ8Q 2LQWA 2JS2A 3CCST 2M0OA 2C0TA 4JRPA 2XHCA 1BCOA 2HL3A 2DETA 3RR6A 1NLPC 3TEEA 5GJWB 1VQ6A 3NGPA 3V7SA 1M27C 2EGEA 1RLQC 2CUDA 2KSSA 1YIJT 1JEGA 2E10A 2E65A 4LDXA 1VQ4A 1RADB 3JCMW 3OMGA 4RUGA 5FU6C 1XNIA 2JTFA 4IUQA 3L42A 2QXFA 5GAOl 2LT1A 3A8MB 2JZ2A 1M3AA 1YJ9A 3EFSA 3UA6A 3OYBA 2RF0A 2DNUA 2BZXA 3CCSQ 3NTKA 3CCEA 3CCUQ 3EGXA 4PJOB 2CS7A 2CP7A 2DL4A 1H3HA 4DBFA 4M7DD 4FM4B 3VS4A 3OS5A 3M55A 1QLYA 3FB9A 1K9MU 3L2UA 4QKUA 1SRLA 4OP0A 2CZ0B 2ENMA 2LZ6B 1VQOQ 1KC8U 1MUZA 3TVTA 1V29B 2PQWA 4M4ZA 3PIOA 5KCOA 3MKDA 1X2KA 4DQ2A 3X20B 4AG1C 5HY6A 3JCMf 1NG2A 1AWOA 3ER0A 1QVGP 4XTWA 2V1QA 3RERA 2KXCA 4J5YA 3VS1A 3S3NA 2E1HA 1UGSB 3H41A 1GL5A 1HXDA 4J7FA 3TSWA 3UPUA 1MMDA 4BACA 4MZPA 5J26A 3CD6Q 1IRXA 3META 1RUWA 3V7RA 2E41A 1N6AA 4ELYC 5FRNA 3OYCA 1X01A 3CPWS 1PSFA 3CPWA 2DBMA 2LX9A 1VQ6T 2EBPA 3JCMQ 3J80E 3CCMQ 1Q7YU 2K5LA 2MIOA 1I5OB 3FRNA 1HYOA 1FYNA 1WQ7A 3JCMP 2PUKB 3KBGA 2D9TA 2DO3A 4IUUA 5FRMA 2QA4A 2RHYA 5KYWA 5IN1A 4PFZA 3I55A 5GMKm 3HP9A 3ASKA 4HCZA 4C92E 2DLPA 2KDSA 1R0BG 3QJYA 2LJ0A 3OYNA 1YJ9T 4BDZA 5GANf 1AVZC 2RM4A 2J6OA 3CQTA 2EYWA 1Q82C 3CCET 4HVUA 4JZ3A 2FPEA 4Z02A 4JZ4A 1SG5A 2WSEE 1WIEA 4AMCA 1K0XA 3OYEA 1I8FA 4Z88A 5GAN4 3CCQA 2GNCA 3OBYA 2FZGB 3MJXA 1KQSP 4FSSA 1MMGA 2LCCA 3FC3A 4M77D 4OVAA 4M77F 4M7AC 4C5GA 3TCJA 4RTTA 2QI2A 2PVOB 4PJOD 2DL5A 2F2VA 3NHNA 4M75B 1QQJA 2D1XA 1VQKA 1YJ9Q 1TOVA 3GBQA 1X6BA 2DERA 2QG9B 2KT1A 1AOJA 4HXJA 3QPHA 3SD4A 4RCBA 1QVFP 2B8AA 4IIMA 1WJSA 2ECZA 5J3BA 3MO8A 4M78E 2XG8D 1VQPA 2F5KA 2DL8A 3VRZA 3QWYA 4KGZB 3HSBA 2XIDA 1D09B 5KYUA 2H3EB 1BYMA 3HRUA 3NTHA 5IAYA 2X51A 4DOVA 3CXCS 4M7AA 4XTYA 3CMET 3OBWA 4FW2A 3CXCA 3VKIA 1BK2A 3A98A 2ZAEA 1XJWB 2RJDA 4XTVA 1H641 1TUCA 4C8QE 2FO0A 1CSKA 1UDLA 4J6YA 4OB3B 1YHQA 1YWOA 2F1LA 4A4HA 1WFWA 1OX8A 2E12A 2DM1A 2DVEA 3I55T 2R57A 4OMLA 1UG1A 4Y92A 1OU9A 2BZ8A 4C0DB 4JJBA 2E5QA 1VQ9A 4ZGJB 4LD9K 1C1AA 3EG2A 2ED1A 3EH2A 3LLRA 1OZ3A 4RTYA 1OEBA 3OYMA 5CQYA 3TQ7P 1ZBJA 4BI3A 2R58A 2OTJQ 3CMEQ 3LH0A 8AT1B 3OYYA 4ORZA 2YRCA 4F17A 2GGRA 3E9FA 4FYYB 2F2WA 1ZLMA 2VXEA 3Q1JA 1M4ZA 5CKHA 4F7UA 2K2VA 1I4K1 4QVZA 4OMPA 1YN8A 3HL8A 1M1KC 3FEOA 2KT8A 3E1SA 2HL5C 4D6WA 2FEIA 2XU8A 2DA9A 2K3BA 1D3BB 2DYBA 2JMAA 1Q81C 3HHTB 1N9SA 4BDYA 2OTLQ 1NEGA 4FCYA 1X75C 4QT7A 1TWBA 2LCLA 3L2VA 2W0ZA 2MWPA 3C95A 4EIKA 1WYXA 5GMKe 2XICA 1VQNT 1BI0A 3H0FA 4OB0B 5IHKA 2K7AA 2DXTA 3H8ZA 2E5KA 3OYDA 3HPWA 5HCKA 3QHSA 5GAN7 1VQPT 3UA7A 4GY5A 3U23A 3LH5A 4QVDA 1Y0MA 1IB8A 2KK4A 3OA6A 3EGDB 1Y57A 4HVVA 1GFCA 2EIFA 4AFQC 1M90C 1HK9A 2DXCA 3M5AA 4M75D 1GCQC 5I21A 1VQ5A 2RHXA 3ZFJA 2VYTA 2M51A 1YHQT 1WXBA 2LRQA 3M4YA 3H9NA 3EFOB 1W4SA 4HCBA 1ARKA 2ZGWA 3QZ9B 1VQNQ 4JS4A 3ZBDA 1YBYA 3SFMA 5DLQE 1VQPQ 2YDLA 1BCMA 4HT8A 3VS2A 2LDMA 4IURA 3CC4A 1RLPC 4FT2A 2AT1B 4ATOA 3PE0A 2LT4A 2YRDA 1G3SA 2EQUA 3LGFA 2FHDA 1KHIA 3JB9G 3I56Q 2D0NA 3JV3A 1V76A 1SF9A 1G3YA 3E9GA 4E2FB 2QQRA 1VQ8A 4LDYA 3JB9J 2XDDA 1YHQQ 2P0QA 3WVDB 1VOMA 2OJ2A 3V7CA 2QDYB 1WJQA 2RI2A 3DLLA 3RBBB 4OGEA 4FYXB 2JMCA 2K3XA 1M2VA 2AIRB 2K9GA 5GJVB 1QWEA 3SWNC 1U3OA 4C5EA 2VGMA 2GTOA 4IUPA 4PLLA 2J05A 2BTTA 3G6EQ 4WTOB 1X27A 2LMJA 2X4YA 4DBQA 2JXBA 4OB1B 2FRYA 3M58A 4ZNXA 2QEXQ 3CCSA 3C94A 3KXTA 2VUBA 1JXOA 2DL3A 1R8OB 2J7IA 3CCUA 4E7ZA 1Q86C 3VUZA 2RPNA 1WHHA 3CBOA 1YJWA 4MZMA 4MZTA 4HCCA 1KIKA 1WNLA 3L2ZA 2GCXA 3SWNA 3LWIA 2JN0A 3OSVA 2A28A 4A4KA 1SSFA 2A7YA 1VQOA 5KH6A 4J8OA 1U1SA 3OYGA 5CKFA 4M7DC 3CMAT 2EW3A 2RNAA 1QVGS 1BB9A 4LXCA 4GLKA 1QVGA 3MP1A 4J9HA 1DJ7B 2RQRA 2NYSA 2EJ9A 5HK0A 1UGQB 1IXDA 5KYYA 3CC4T 2RN8A 4V2SA 2XDBA 2XDPA 2CSQA 1N8RC 2BUDA 5IXBA 4PJMA 1Y96B 2K6DA 1CKBA 2B86A 2MF2A 3QWXX 1ABQA 3CD6A 2COZA 2CP3A 2YXYA 4E7IA 2NLUA 1KQ1A 1VQ8T 4EMKB
chains in the Genus database with same CATH topology
2KRNA 4AFZC 2V1QA 1KSWA 5IH2A 1GCQA 2PZ1A 1UE9A 1NYGA 2KXCA 1AWJA 4AFUC 4D8KA 3VS1A 2CT3A 3ZL7C 2F2XA 2O88A 2HCKA 3H41A 1GL5A 2DE0X 2KXDA 3TSWA 1ZSGA 4Z8AA 3M0RA 2CH4A 1QCFA 1RUWA 2SRCA 3EGUA 1H8KA 1PRMC 4R0KA 2EYYA 2DBMA 2EBPA 1AEYA 2JT4A 4HCKA 3VS3A 2MIOA 2CSIA 1FYNA 2LJ3A 3M0QA 1ZUYA 2CDTA 2W10A 2MCNA 2HBWA 1U5SA 1SHFA 1JU5C 1UHCA 2DLPA 2DILA 3EG0A 1PRLC 2YUOA 3UATA 1K4US 3ULRB 1VYTA 2NUZA 1EFNA 4RTUA 2LJ0A 1NLOC 2ED0A 4RTZA 4X1VA 1AVZC 2YUPA 2J6OA 3CQTA 1YNZA 2EYWA 2LJ1A 1NM7A 1UFFA 1PKSA 3I5SA 4RTXA 4HVUA 2CH4W 4JPBW 2EYZA 4JZ3A 1UGVA 2FPEA 2C0OA 4JZ4A 1SSHA 1VYVA 1WIEA 1XOVA 1K0XA 3I35A 3M0TA 4AG2C 1M30A 1N5ZA 1K1ZA 2JM8A 2VKNA 3UF4A 4Z88A 2GNCA 1MV3A 1YCSB 2GBQA 2KYBA 1T3SA 2JM9A 4FSSA 1KJWA 1ZUKA 1UTIA 1NEBA 1H92A 5FWCA 2PNIA 1FMKA 4RTTA 1I1JA 1YWPA 1AD5A 1GFDA 2DL5A 2F2VA 3NHNA 1QWFA 2D1XA 2O9VA 3GBQA 1X6BA 4RTVA 3EG1A 2KT1A 1AOJA 4HXJA 2JS0A 4IIMA 1OPLA 2ECZA 3IQLA 1G83A 2EQIA 2DL8A 3VRZA 3QWYA 1AZEA 1UJ0A 4F14A 1JO8A 2DL7A 1AZGB 1PNJA 1WLPB 2J6KA 1GBRA 2YSQA 1UJYA 2KE9A 4JJCA 1WXTA 2XMFA 2VVKA 2KEAA 1BK2A 3A98A 3VS7A 2ABLA 1TUCA 1B07A 2C0IA 2FO0A 1CSKA 4J9GA 1BU1A 1UDLA 5I11A 1YWOA 1B3QA 1PWTA 2YT6A 3EHRA 1WFWA 2YUQA 2KYMA 5FW9A 2DM1A 4LNPA 1MV0B 4OMLA 1K76A 1UG1A 3KFVA 1HD3A 4Y92A 2BZ8A 1CKAA 1PHTA 3H0HA 1VA7A 2G6FX 3SHWA 1ZUUA 4JJBA 1OV3A 1IO6A 4ESRA 1LCKA 2D8JA 2ED1A 3EG2A 4IIOA 4LN2A 2J06A 4RTYA 1UUEA 2DVJA 1X69A 2EVRA 1K9AA 1OEBA 1T0HA 1TUDA 1YP5A 1ZBJA 1SPKA 2FPDA 1RI9A 2IIMA 2GTJA 2JW4A 2OI3A 4ORZA 4F17A 3C0CA 2GGRA 2F2WA 2DJQA 2KROA 1ZLMA 1TG0A 3I9QA 1W70A 4OMPA 1AWXA 1YN8A 2M0YA 2RQTA 2KT8A 2J6FA 1ABOA 2FEIA 2DA9A 4OMOA 2DX1A 2K3BA 2DYBA 1M3CA 4A63B 2JMAA 1E6HA 1QKWA 2EGAA 1NEGA 4QT7A 4E6RA 2RQVA 4CC4B 2W0ZA 5FWBA 4EIKA 1WYXA 2O31A 3H0FA 4K11A 1Z9QA 5IHKA 2K7AA 1T3LA 2E5KA 3SEMA 5HCKA 5L23A 2OAWA 1J3TA 3UA7A 3U23A 3LH5A 1Y0MA 2CUBA 2X3WD 2ROLA 2EKHA 4OMQA 1WA7A 4RTWA 2CT4A 4KRTA 1Y57A 2EGCA 4HVVA 4JJDA 1GFCA 4AFQC 3EG3A 2VWFA 1I0CA 3O5ZA 2LNHB 2A37A 3TSZA 1GCQC 4CC7A 4LE9A 2FRWA 1BBZA 4D8DA 2K2MA 1WXUA 3I5RA 2M51A 4OMMA 4CC3A 5IHIA 1WXBA 2ESWA 3THKA 2H8HA 1M8MA 1ARKA 2AZVA 2DBKA 2HDAA 2A36A 2QDLA 1JXMA 1WI7A 2LX7A 1T0JA 2KNBB 1UECA 2YDLA 1GCPA 2LCSA 3VS2A 1E7OA 2AK5A 2DMOA 1VYUA 2L3PA 1RLPC 4J9EA 1JQQA 1HSQA 3PE0A 2DRKA 2PTKA 4AFSC 4OMNA 2D0NA 1GRIA 3JV3A 1X43A 1OOTA 2RMOA 1U06A 3M0PA 1GBQA 4WCIA 1ZX6A 2P4RA 1WDXA 2L2PA 1QKXA 2L3SA 5EC7A 4DEXA 2K79A 5ECAA 2LQNA 2GQIA 3VS5A 2FG0A 2LP5A 4DEYA 2KBTA 3REAB 1W1FA 1WX6A 1UHFA 2ROTA 2OJ2A 2DF6A 3RNJA 3PVQA 1S1NA 3VS0A 3REBB 2X3XD 3RBBB 2YUNA 4Z89A 2RQUA 3NMZC 2I0NA 2JMCA 2AKKA 2LQWA 2K9GA 4CC2A 5GJVB 2JS2A 1QWEA 1U3OA 2GTOA 2C0TA 2AZSA 2KRSA 2L3QA 2J05A 2KRMA 4F16A 2O2OA 2BTTA 1NLPC 4J9CA 1I07A 2RQWA 5IHNA 5GJWB 3NGPA 1X27A 1M27C 1SEMA 2HSPA 2LMJA 2EGEA 2FPFA 2NWMA 2SEMA 1SHGA 3M0SA 1RLQC 1SRMA 2CUDA 2D8HA 4GBQA 2JXBA 1JEGA 5I22A 1A0NB 1HJDA 2FRYA 5IXFA 4ZNXA 1E6GA 1AWWA 1Z9ZA 2L0AA 4HVWA 1JXOA 2DL3A 4RUGA 2J7IA 4J9IA 2RPNA 3FJ5A 3R6NA 2DRMA 2BZYA 1KIKA 4LUDA 3M0UA 1M3BA 4J9DA 3PVLA 1PKTA 2A28A 1M3AA 3H0IA 2V1RA 3UA6A 2RF0A 2DNUA 3NPFA 4GLMA 2BZXA 3VS6A 4J9BA 2EW3A 2RNAA 1G2BA 1BB9A 2JTEA 2DL4A 1H3HA 4J9HA 3VS4A 3EHQA 2KR3A 2RQRA 1OPKA 3VRYA 2AKLA 1K0SA 1KFZA 1QLYA 1SRLA 2RN8A 4LUEA 2ENMA 2LZ6B 1V1CA 2O9SA 2EYXA 1W6XA 1MUZA 2CSQA 3TVTA 5IXBA 2HEQA 4M4ZA 2K6DA 1CKBA 2EPDA 1NYFA 2B86A 1X2KA 3QWXX 4AG1C 1ABQA 2CREA 2KGTA 1X2QA 1NG2A 2A08A 2MOXA 1X6GA 1AWOA 4J9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRN A;  4AFZ C;  2V1Q A;  1KSW A;  5IH2 A;  1GCQ A;  2PZ1 A;  1UE9 A;  1NYG A;  2KXC A;  1AWJ A;  4AFU C;  4D8K A;  3VS1 A;  2CT3 A;  3ZL7 C;  2F2X A;  2O88 A;  2HCK A;  3H41 A;  1GL5 A;  2DE0 X;  2KXD A;  3TSW A;  1ZSG A;  4Z8A A;  3M0R A;  2CH4 A;  1QCF A;  1RUW A;  2SRC A;  3EGU A;  1H8K A;  1PRM C;  4R0K A;  2EYY A;  2DBM A;  2EBP A;  1AEY A;  2JT4 A;  4HCK A;  3VS3 A;  2MIO A;  2CSI A;  1FYN A;  2LJ3 A;  3M0Q A;  1ZUY A;  2CDT A;  2W10 A;  2MCN A;  2HBW A;  1U5S A;  1SHF A;  1JU5 C;  1UHC A;  2DLP A;  2DIL A;  3EG0 A;  1PRL C;  2YUO A;  3UAT A;  1K4U S;  3ULR B;  1VYT A;  2NUZ A;  1EFN A;  4RTU A;  2LJ0 A;  1NLO C;  2ED0 A;  4RTZ A;  4X1V A;  1AVZ C;  2YUP A;  2J6O A;  3CQT A;  1YNZ A;  2EYW A;  2LJ1 A;  1NM7 A;  1UFF A;  1PKS A;  3I5S A;  4RTX A;  4HVU A;  2CH4 W;  4JPB W;  2EYZ A;  4JZ3 A;  1UGV A;  2FPE A;  2C0O A;  4JZ4 A;  1SSH A;  1VYV A;  1WIE A;  1XOV A;  1K0X A;  3I35 A;  3M0T A;  4AG2 C;  1M30 A;  1N5Z A;  1K1Z A;  2JM8 A;  2VKN A;  3UF4 A;  4Z88 A;  2GNC A;  1MV3 A;  1YCS B;  2GBQ A;  2KYB A;  1T3S A;  2JM9 A;  4FSS A;  1KJW A;  1ZUK A;  1UTI A;  1NEB A;  1H92 A;  5FWC A;  2PNI A;  1FMK A;  4RTT A;  1I1J A;  1YWP A;  1AD5 A;  1GFD A;  2DL5 A;  2F2V A;  3NHN A;  1QWF A;  2D1X A;  2O9V A;  3GBQ A;  1X6B A;  4RTV A;  3EG1 A;  2KT1 A;  1AOJ A;  4HXJ A;  2JS0 A;  4IIM A;  1OPL A;  2ECZ A;  3IQL A;  1G83 A;  2EQI A;  2DL8 A;  3VRZ A;  3QWY A;  1AZE A;  1UJ0 A;  4F14 A;  1JO8 A;  2DL7 A;  1AZG B;  1PNJ A;  1WLP B;  2J6K A;  1GBR A;  2YSQ A;  1UJY A;  2KE9 A;  4JJC A;  1WXT A;  2XMF A;  2VVK A;  2KEA A;  1BK2 A;  3A98 A;  3VS7 A;  2ABL A;  1TUC A;  1B07 A;  2C0I A;  2FO0 A;  1CSK A;  4J9G A;  1BU1 A;  1UDL A;  5I11 A;  1YWO A;  1B3Q A;  1PWT A;  2YT6 A;  3EHR A;  1WFW A;  2YUQ A;  2KYM A;  5FW9 A;  2DM1 A;  4LNP A;  1MV0 B;  4OML A;  1K76 A;  1UG1 A;  3KFV A;  1HD3 A;  4Y92 A;  2BZ8 A;  1CKA A;  1PHT A;  3H0H A;  1VA7 A;  2G6F X;  3SHW A;  1ZUU A;  4JJB A;  1OV3 A;  1IO6 A;  4ESR A;  1LCK A;  2D8J A;  2ED1 A;  3EG2 A;  4IIO A;  4LN2 A;  2J06 A;  4RTY A;  1UUE A;  2DVJ A;  1X69 A;  2EVR A;  1K9A A;  1OEB A;  1T0H A;  1TUD A;  1YP5 A;  1ZBJ A;  1SPK A;  2FPD A;  1RI9 A;  2IIM A;  2GTJ A;  2JW4 A;  2OI3 A;  4ORZ A;  4F17 A;  3C0C A;  2GGR A;  2F2W A;  2DJQ A;  2KRO A;  1ZLM A;  1TG0 A;  3I9Q A;  1W70 A;  4OMP A;  1AWX A;  1YN8 A;  2M0Y A;  2RQT A;  2KT8 A;  2J6F A;  1ABO A;  2FEI A;  2DA9 A;  4OMO A;  2DX1 A;  2K3B A;  2DYB A;  1M3C A;  4A63 B;  2JMA A;  1E6H A;  1QKW A;  2EGA A;  1NEG A;  4QT7 A;  4E6R A;  2RQV A;  4CC4 B;  2W0Z A;  5FWB A;  4EIK A;  1WYX A;  2O31 A;  3H0F A;  4K11 A;  1Z9Q A;  5IHK A;  2K7A A;  1T3L A;  2E5K A;  3SEM A;  5HCK A;  5L23 A;  2OAW A;  1J3T A;  3UA7 A;  3U23 A;  3LH5 A;  1Y0M A;  2CUB A;  2X3W D;  2ROL A;  2EKH A;  4OMQ A;  1WA7 A;  4RTW A;  2CT4 A;  4KRT A;  1Y57 A;  2EGC A;  4HVV A;  4JJD A;  1GFC A;  4AFQ C;  3EG3 A;  2VWF A;  1I0C A;  3O5Z A;  2LNH B;  2A37 A;  3TSZ A;  1GCQ C;  4CC7 A;  4LE9 A;  2FRW A;  1BBZ A;  4D8D A;  2K2M A;  1WXU A;  3I5R A;  2M51 A;  4OMM A;  4CC3 A;  5IHI A;  1WXB A;  2ESW A;  3THK A;  2H8H A;  1M8M A;  1ARK A;  2AZV A;  2DBK A;  2HDA A;  2A36 A;  2QDL A;  1JXM A;  1WI7 A;  2LX7 A;  1T0J A;  2KNB B;  1UEC A;  2YDL A;  1GCP A;  2LCS A;  3VS2 A;  1E7O A;  2AK5 A;  2DMO A;  1VYU A;  2L3P A;  1RLP C;  4J9E A;  1JQQ A;  1HSQ A;  3PE0 A;  2DRK A;  2PTK A;  4AFS C;  4OMN A;  2D0N A;  1GRI A;  3JV3 A;  1X43 A;  1OOT A;  2RMO A;  1U06 A;  3M0P A;  1GBQ A;  4WCI A;  1ZX6 A;  2P4R A;  1WDX A;  2L2P A;  1QKX A;  2L3S A;  5EC7 A;  4DEX A;  2K79 A;  5ECA A;  2LQN A;  2GQI A;  3VS5 A;  2FG0 A;  2LP5 A;  4DEY A;  2KBT A;  3REA B;  1W1F A;  1WX6 A;  1UHF A;  2ROT A;  2OJ2 A;  2DF6 A;  3RNJ A;  3PVQ A;  1S1N A;  3VS0 A;  3REB B;  2X3X D;  3RBB B;  2YUN A;  4Z89 A;  2RQU A;  3NMZ C;  2I0N A;  2JMC A;  2AKK A;  2LQW A;  2K9G A;  4CC2 A;  5GJV B;  2JS2 A;  1QWE A;  1U3O A;  2GTO A;  2C0T A;  2AZS A;  2KRS A;  2L3Q A;  2J05 A;  2KRM A;  4F16 A;  2O2O A;  2BTT A;  1NLP C;  4J9C A;  1I07 A;  2RQW A;  5IHN A;  5GJW B;  3NGP A;  1X27 A;  1M27 C;  1SEM A;  2HSP A;  2LMJ A;  2EGE A;  2FPF A;  2NWM A;  2SEM A;  1SHG A;  3M0S A;  1RLQ C;  1SRM A;  2CUD A;  2D8H A;  4GBQ A;  2JXB A;  1JEG A;  5I22 A;  1A0N B;  1HJD A;  2FRY A;  5IXF A;  4ZNX A;  1E6G A;  1AWW A;  1Z9Z A;  2L0A A;  4HVW A;  1JXO A;  2DL3 A;  4RUG A;  2J7I A;  4J9I A;  2RPN A;  3FJ5 A;  3R6N A;  2DRM A;  2BZY A;  1KIK A;  4LUD A;  3M0U A;  1M3B A;  4J9D A;  3PVL A;  1PKT A;  2A28 A;  1M3A A;  3H0I A;  2V1R A;  3UA6 A;  2RF0 A;  2DNU A;  3NPF A;  4GLM A;  2BZX A;  3VS6 A;  4J9B A;  2EW3 A;  2RNA A;  1G2B A;  1BB9 A;  2JTE A;  2DL4 A;  1H3H A;  4J9H A;  3VS4 A;  3EHQ A;  2KR3 A;  2RQR A;  1OPK A;  3VRY A;  2AKL A;  1K0S A;  1KFZ A;  1QLY A;  1SRL A;  2RN8 A;  4LUE A;  2ENM A;  2LZ6 B;  1V1C A;  2O9S A;  2EYX A;  1W6X A;  1MUZ A;  2CSQ A;  3TVT A;  5IXB A;  2HEQ A;  4M4Z A;  2K6D A;  1CKB A;  2EPD A;  1NYF A;  2B86 A;  1X2K A;  3QWX X;  4AG1 C;  1ABQ A;  2CRE A;  2KGT A;  1X2Q A;  1NG2 A;  2A08 A;  2MOX A;  1X6G A;  1AWO A;  4J9F A; 
#chains in the Genus database with same CATH topology
 3RMS A;  2KRN A;  4AFZ C;  5LJ5 g;  4M7D A;  3E19 A;  4M7A E;  1B34 A;  1AHJ B;  1AWJ A;  4AFU C;  1C6V X;  4D8K A;  3CMA Q;  2F2X A;  2O88 A;  2D6F A;  3CCM A;  3AT1 B;  1GXI E;  1ZSG A;  1YI2 A;  5GMK l;  4E7J A;  3CC2 Q;  1KHC A;  4QQG A;  1H8K A;  3OSS C;  5A0L A;  4XAX B;  2K57 A;  1MNE A;  3OYI A;  2R5M A;  1AEY A;  2JT4 A;  4C92 F;  3BDU A;  1IHV A;  4HCK A;  3VS3 A;  7AT1 B;  4JUV A;  2QTX A;  5EG2 A;  2GQV A;  3CCU T;  2MCN A;  2HBW A;  1I5L A;  3OB9 A;  3A8L B;  4RMO A;  4E7H A;  1SHF A;  1O9S A;  1YJW T;  3GNG A;  1JB0 E;  4PLI A;  2FL7 A;  5GMK h;  1KQS S;  2RI5 A;  2YUO A;  2L8D A;  1M1K R;  1Q82 U;  1VYT A;  1KQS A;  4F7U E;  1UGP B;  1QP2 A;  2OX7 A;  1VQO T;  3QKJ A;  4J83 A;  4C0Z A;  1Q81 R;  5I2M A;  3CC7 T;  4FSX A;  3G4S T;  1U1T A;  2C0O A;  1TUG B;  3M56 A;  1VYV A;  5KYN A;  5LJ5 j;  4AG2 C;  1G8X A;  3S3O A;  1M30 A;  3JCM g;  1K1Z A;  4M77 B;  2EQM A;  2DTH A;  1MV3 A;  3CCL Q;  2JM9 A;  1LVK A;  1MGQ A;  4VUB A;  1YFN A;  2VXF A;  1VQL Q;  5CKD A;  2HQX A;  1ZUK A;  1KQ2 A;  1UTI A;  2ZPI B;  2RI3 A;  4PJO C;  1YJW Q;  1M90 R;  4M78 F;  1H92 A;  4X9C A;  3CD6 T;  4BE2 A;  1I1J A;  1AD5 A;  1PD0 A;  1ZA2 B;  3A8G B;  5AT1 B;  2V8I A;  3CCV A;  4XU3 A;  1IRE B;  3CC7 Q;  3MCA B;  3IQL A;  1G83 A;  3G4S Q;  3CCM T;  5CKE A;  2EAY A;  1UJ0 A;  1JO8 A;  4C8Q F;  4PJL A;  1YI2 T;  1PNJ A;  3WVE B;  4ZGE B;  4E7K A;  4PJO A;  1MHN A;  5LJ5 e;  4JJC A;  1WXT A;  1OUL A;  2JJ9 A;  2QGG A;  4B9W A;  2KEA A;  4C92 G;  2KAF A;  4L59 A;  2C0I A;  2DXB A;  2JNG A;  4J9G A;  2M1H A;  5DM7 R;  1ZA1 B;  1B3Q A;  2YT6 A;  3OYL A;  3EHR A;  2YUQ A;  5GAN g;  2OTJ A;  4JLI A;  2RHU A;  5FW9 A;  3CME A;  3G7Z A;  3MEV A;  1K76 A;  3KFV A;  5KYW B;  2HBP A;  2KQW A;  3CCR Q;  5FLX E;  3N5B B;  4ESR A;  1LCK A;  4OB2 B;  4BI4 A;  2J06 A;  1YI2 Q;  1EZZ B;  1R0C B;  4ANJ A;  4JDS A;  1YP5 A;  3GLX A;  5GAO n;  4XTX A;  3UT1 A;  2IIM A;  4A53 A;  1NPP A;  3KUF A;  1M1K U;  2DJQ A;  2OTL A;  4BI8 B;  5CK9 A;  3OYA A;  1EX4 A;  1W70 A;  2QAS A;  2IVW A;  5DLO A;  1PCX A;  2M0Y A;  4BB7 A;  1Q81 U;  2RQT A;  2VB6 A;  5D6X A;  1WZO A;  2BE9 B;  1YJN Q;  2WSC E;  2YWW A;  2DX1 A;  3O8V A;  4M78 G;  2L89 A;  3C4S A;  3V8J A;  3QSU A;  1TH7 A;  2EGA A;  2FVU A;  4FIB A;  5HK3 A;  1UEB A;  5KE2 A;  2RK1 A;  3JCM e;  3CCV T;  2RJF A;  1D1C A;  2FZK B;  4QVC A;  2RK2 A;  5GAN 2;  1M90 U;  2CP2 A;  3QO3 A;  1J3T A;  3A8H B;  4C8Q G;  2EKH A;  1RAF B;  4RTW A;  1WA7 A;  5FU7 B;  5GAN j;  5LL6 S;  3ME9 A;  4M75 C;  3VYG A;  1FWZ A;  2QGF B;  5A0D A;  4Q5W A;  3EG3 A;  3MEU A;  1I0C A;  1VQN A;  2A37 A;  4B6M A;  2EQJ A;  4QW2 A;  2E70 A;  3OY9 A;  4O5V A;  2PVD B;  1RL2 A;  1XTD A;  1N8R R;  4A4F A;  4CC3 A;  3NFC A;  2ESW A;  2Z0W A;  3GIB A;  2V8J A;  4OMF B;  2OTJ T;  4N4I A;  3BFM A;  3I56 A;  2AZV A;  3LGL A;  1K73 C;  2HDA A;  3CCV Q;  4CRI A;  2CP5 A;  4XU1 A;  2QDL A;  3CCJ Q;  4M7D E;  4M75 A;  1T0J A;  2KNB B;  4ZGD B;  2O4X B;  3HFO A;  1GCP A;  1QW1 A;  2LCS A;  1E7O A;  1JQQ A;  1G3T A;  3J7A F;  2DRK A;  2LNV A;  2RD1 A;  4OMN A;  2P84 A;  5LJ3 d;  1GRI A;  5GAN e;  3OS1 A;  3OYK A;  2RMO A;  5CQX A;  2EYQ A;  5GMK j;  4BE1 A;  2RO0 A;  4C0D C;  2OTL T;  2LQK A;  1VUB A;  2P4R A;  2L2P A;  5EC7 A;  2E6Z A;  4RKU E;  1NJI C;  4KUD K;  2LQN A;  3G6E A;  2FG0 A;  5L8R E;  2DFU A;  2LP5 A;  3QG1 A;  4NS5 A;  5GAN 3;  1UHF A;  3JB9 D;  3JB9 F;  5GAM d;  3PVQ A;  1RAB B;  2ZPE B;  3HKS A;  3REB B;  2X3X D;  3L2Q A;  2YUN A;  1NZ9 A;  2I0N A;  2QEX A;  2DEQ A;  1P92 A;  4PJJ A;  3QDF A;  2KRM A;  2RB6 A;  4JRQ A;  1YIT Q;  4J9C A;  1I07 A;  1OZ2 A;  1TU0 B;  1OQK A;  5IHN A;  1MND A;  3P8H A;  3RUX A;  4BUG A;  1LOJ A;  2HSP A;  2SEM A;  5GAN 8;  3MP6 A;  1SRM A;  4GBQ A;  1Q86 U;  4BD3 A;  4E7S A;  1C0M A;  4KH0 B;  4OF1 A;  5I22 A;  3WXM B;  1A0N B;  5IXF A;  1E6G A;  1AWW A;  1Z9Z A;  4HVW A;  1TS9 A;  4XQ3 A;  4J9I A;  3VU3 C;  3FJ5 A;  1VIF A;  2DRM A;  3S6W A;  3MEA A;  4LUD A;  3M0U A;  4ME7 A;  1M3B A;  3DKM A;  4J9D A;  3TRE A;  3PVL A;  4FYV B;  3G1J A;  1K8A C;  1BIB A;  4RCC A;  2V1R A;  5D7U A;  1M9S A;  2Y4Y A;  4J9B A;  2DAQ A;  1D3B A;  2QAZ A;  3CBP A;  3I56 T;  4L6V 5;  1BKB A;  3M59 A;  3G71 T;  5HKC A;  1FMW A;  5LJ5 h;  2EFI A;  2XK0 A;  3M4G A;  1N8R U;  4MML A;  4WF2 A;  1OPK A;  1TXQ A;  2ZPB B;  1K0S A;  1KFZ A;  4M7A F;  4PFO A;  2OAU A;  3EG9 B;  1V1C A;  2O9S A;  2HD0 A;  2EYX A;  3PMI A;  1W6X A;  3CMA A;  1FXX A;  4M77 E;  2HEQ A;  4XTU A;  4R55 A;  2EPD A;  1KG1 A;  3EGD A;  3QUI A;  2KGT A;  1X2Q A;  3ZEH A;  1BI2 A;  3CC2 A;  4PJO E;  2LC4 A;  2LQ8 A;  1GCQ A;  1UE9 A;  3G6E T;  4BE0 A;  4OGC A;  3LYI A;  2FYK A;  3BY7 A;  4FU6 A;  5CKB A;  3ZL7 C;  2HCK A;  2DE0 X;  3QDR B;  3G71 Q;  4Z8A A;  2QEX T;  3EFO A;  3A8O B;  1WHJ A;  4C92 B;  2SRC A;  4Y28 E;  3LX7 A;  2KI7 A;  2DYI A;  2EYY A;  3PT9 A;  2YLC A;  2K3Y A;  2NUP B;  9ATC B;  3JCM c;  3OS2 A;  1WJR A;  2CSI A;  4F7U F;  2LJ3 A;  3M0Q A;  1ZUY A;  3A5Z B;  4ZTJ A;  3FIF A;  4KGV B;  1RAC B;  1RAI B;  2CDT A;  2W10 A;  5M9O A;  2ZZD A;  1R77 A;  1SKU B;  3JCM h;  3JRZ A;  2DIL A;  1ZSZ B;  1PRL C;  3RES A;  1K4U S;  2E6N A;  1Q82 R;  2NUZ A;  4MDW A;  1EFN A;  3D7S B;  2P4T A;  3CCL A;  2DEU A;  2ED0 A;  4RTZ A;  3M53 A;  4X1V A;  1LNX A;  3JSC A;  2YUP A;  1VQL A;  2X35 A;  2LJ1 A;  1NM7 A;  1UFF A;  4F04 B;  1PKS A;  3I5S A;  2BE7 D;  4JPB W;  5I2S A;  3V8K A;  1Y07 A;  1PM3 A;  3PFS A;  1SSH A;  2CP6 A;  2D0Q B;  2K4Y A;  3I35 A;  2WAC A;  3M0T A;  3CBM A;  3OQ5 A;  1LPL A;  2JM8 A;  3UF4 A;  3PMT A;  1YCS B;  4M7A G;  2KYB A;  1RI0 A;  3GOX A;  1VQ7 T;  4M78 B;  5DY9 A;  3CC7 A;  1KJW A;  1N9R A;  3G4S A;  2PVG B;  4JJN K;  1PD1 A;  1NEB A;  2HNI A;  4O6J A;  1FMK A;  1NPR A;  2NUT B;  2VV5 A;  4P5N A;  2G3R A;  4FYW B;  1YWP A;  4RG2 A;  8ATC B;  2KY9 A;  3CC2 T;  1GFD A;  1ZBX A;  1KD1 C;  4KBM B;  1M2O A;  4C8Q B;  2CKK A;  2JS0 A;  1Y7X A;  3FLG A;  1M5Q 1;  4XU0 A;  1I81 A;  1AZE A;  3RDV A;  2IG0 A;  3DB4 A;  5GAN h;  3OW2 P;  5CCA A;  2COW A;  1K73 R;  1OI1 A;  4EMK C;  2COY A;  4E7L A;  1VQ7 Q;  2QQS A;  2XMF A;  1WHM A;  4M75 E;  3CCR A;  5IT9 E;  2ABL A;  1JJ2 P;  1BI3 A;  3QJ6 A;  1B07 A;  4F7U G;  4C5H A;  1BU1 A;  5I11 A;  3P8B B;  4RG8 A;  1S72 T;  5KYX B;  3UDC A;  1UGR B;  2YHT A;  1F1B B;  1Y96 A;  2KYM A;  4KT0 E;  1IHW A;  1JRI A;  2HKQ B;  4EMK A;  1NJI R;  4PFP A;  4C92 D;  2YLB A;  3OYH A;  3JCM b;  1TTH B;  2EJG A;  1ZUU A;  3SHW A;  1IO6 A;  2D8J A;  3CCL T;  1UUE A;  2DVJ A;  1X69 A;  1VQL T;  1K9A A;  2HQE A;  1T0H A;  1TUD A;  1YJN A;  4HKE A;  1RI9 A;  2DKG A;  2LTO A;  2OI3 A;  3C0C A;  1NE8 A;  2KRO A;  2CZ7 B;  1LJO A;  1TG0 A;  2KMT A;  1S72 Q;  4E47 A;  2J6F A;  1N27 A;  1W2B P;  2VGN A;  1VQM T;  4YTL A;  1M3C A;  2ZCF B;  3EGX B;  4A63 B;  1QVF S;  4KUL A;  3QII A;  1QKW A;  1QVF A;  4M77 C;  4E6R A;  4J6X A;  5FU6 B;  4CC4 B;  4UC4 A;  3J81 E;  1KK7 A;  5FWB A;  3LWH A;  1IGU A;  3RKW A;  3JAM E;  2CZ6 B;  4K11 A;  1Z9Q A;  3OS0 A;  1K8A R;  1WHG A;  2DPP B;  3MHX A;  5L23 A;  3NTI A;  3DB3 A;  4M78 D;  4DBH A;  4DOW A;  4LDW A;  2CUB A;  2X3W D;  5D6Y A;  2ZPH B;  4JJD A;  3FDR A;  4X34 A;  4NL3 A;  4HT9 A;  3P8D A;  2VWF A;  4EMG A;  2LNH B;  3TSZ A;  3OMC A;  3JCM X;  3CCJ A;  3CCR T;  3RKY A;  4CC7 A;  4LE9 A;  4M77 A;  1BBZ A;  4PL6 A;  4C5I A;  4D8D A;  1VQM Q;  4M7D F;  1WXU A;  2YRV A;  3I5R A;  3M57 A;  4C8Q D;  1K73 U;  4OMM A;  5IHI A;  1WHL A;  1YIJ Q;  3THK A;  2DTI A;  2Y4X A;  1RAA B;  1M8M A;  1OX9 A;  2PU9 B;  2DBK A;  5GAO p;  1B7T A;  2VAS A;  2HSE B;  1WI7 A;  1D0X A;  1WQW A;  2EKO A;  1WGS A;  3M9Q A;  2MWO A;  5GAO r;  5LJ3 g;  5CVI A;  2AK5 A;  3QXE B;  1VYU A;  2L3P A;  2F69 A;  2IPO B;  1HSQ A;  5KCH A;  3QBY A;  5C0M A;  1D1A A;  1YJN T;  4AFS C;  2EWN A;  4MDX A;  4FT4 A;  5LJ5 d;  1OYX A;  5C6S A;  2A0F B;  1NJI U;  1IGQ A;  1U06 A;  4Y91 A;  1PC0 A;  1O75 A;  4DA4 A;  3L2W A;  3M0P A;  1GBQ A;  1ZX6 A;  5GAM g;  1QKX A;  2L3S A;  3MEW A;  4AT1 B;  2K79 A;  4J7I A;  4QQD A;  2X4X A;  3VS5 A;  1YIT A;  2KBT A;  2JOY A;  2ROT A;  3RNJ A;  1S1N A;  4PKC C;  4XU2 A;  3VS0 A;  5LJ3 f;  2RQU A;  2AKK A;  4A4G A;  4CC2 A;  1VQ4 T;  2AZS A;  2KRS A;  2L3Q A;  4F16 A;  2O2O A;  2RQW A;  3JB9 I;  4C0F A;  1SEM A;  2FPF A;  2NWM A;  2RHZ A;  1SHG A;  3M0S A;  2BKD N;  2D8H A;  5GAM f;  2DZC A;  1Q86 R;  1Y71 A;  3CEY A;  3FJP A;  2V26 A;  4QQ6 A;  1HJD A;  4JRI A;  1MMN A;  2MPX C;  3A1P A;  4R56 A;  2L0A A;  1YCY A;  2A3L A;  4FL6 A;  1K8A U;  5GAN 5;  3SB2 A;  3R6N A;  3CCJ T;  2BZY A;  2LVM A;  1VQ6 Q;  4N4G A;  4M7D G;  5LJ3 j;  3HFN A;  1PKT A;  3BE3 A;  1PSE A;  3H0I A;  3PTA A;  1TSF A;  5FU7 C;  5A0G A;  1VQ4 Q;  4GLM A;  3NPF A;  5KYU B;  4X9D A;  3VS6 A;  1IZ6 A;  2HKN A;  3CPF A;  1G2B A;  3JCM d;  1ZHI A;  4M7A B;  2JTE A;  2RHI A;  1KD1 R;  5GAM j;  2GFA A;  1QMC A;  3EHQ A;  2KR3 A;  3OYF A;  3VRY A;  2AKL A;  5GAO m;  3JCM J;  2JVV A;  4PJO F;  4ZTF A;  2KVQ G;  4LUE A;  5CAI A;  3CCE Q;  4NL2 A;  2QTV A;  2PUO B;  2ZPG B;  3G71 A;  1NYF A;  4C0G A;  1K9M C;  2CRE A;  2QK0 A;  2A08 A;  3MP8 A;  2MOX A;  1KC8 C;  1X6G A;  4J9F A;  3EAE A;  4IUV A;  4JRK A;  1KSW A;  1QP3 A;  5IH2 A;  2L3R A;  2PZ1 A;  4LD6 A;  4HA8 A;  1YIT T;  5AYF A;  1NYG A;  2CP0 A;  1X6O A;  3R6O A;  5LJ3 e;  2O01 E;  2CT3 A;  2E64 A;  1M1G A;  3VJP A;  2M02 A;  2KXD A;  3M0R A;  2CH4 A;  1QCF A;  3EGU A;  2QA4 T;  1PRM C;  4R0K A;  4DBR A;  5GAM e;  2K5F A;  4F7U B;  4N4H A;  1ZQ1 A;  1RAH B;  2O4X A;  2DIG A;  2H3J A;  2DXU A;  2DD5 A;  3H6Z A;  5GAN d;  4IKF A;  1NBE B;  3GF5 A;  4NOY A;  4XTZ A;  2C06 A;  2X4W A;  2XD0 A;  3OYJ A;  1Q7Y C;  4CI0 C;  2P0P A;  1JBM A;  1U5S A;  1JU5 C;  2QQB A;  1UHC A;  2QQA A;  3L1A A;  2EQK A;  3HRT A;  3EG0 A;  3UAT A;  1M1F A;  3CPW P;  3ULR B;  1D0Y A;  4MMK A;  4RTU A;  2DK3 A;  1NLO C;  2F5T X;  3CCQ T;  1YNZ A;  3S3M A;  3SDZ A;  4RTX A;  3HTR A;  1RAE B;  2CH4 W;  4M77 G;  2QA4 Q;  2EYZ A;  1UGV A;  3VV0 A;  3I55 Q;  3PNW C;  2BIV A;  3X24 B;  1XOV A;  4JLG A;  5GAO q;  3HRS A;  2MAM A;  1WPY A;  3VUB A;  3E2U A;  3GP8 A;  1N5Z A;  2VKN A;  4PJO G;  1QCN A;  2GBQ A;  1T3S A;  1VQK T;  5CR2 A;  3RKX A;  3OW2 S;  2DD4 A;  2RJC A;  2CYZ B;  2FB7 A;  4IUT A;  3OW2 A;  1KD1 U;  5FWC A;  2PNI A;  4KUI A;  4ZN3 A;  1QWF A;  4M7A D;  1WHK A;  1VQ7 A;  2O9V A;  1JJ2 S;  3CCQ Q;  4RTV A;  3EG1 A;  3V8L A;  1JJ2 A;  2QYZ A;  1OPL A;  3GNF B;  4M75 F;  2EQI A;  1FMV A;  2GF7 A;  4F14 A;  2DL7 A;  2P0K A;  4PJN A;  3X25 B;  1AZG B;  1WLP B;  2RH2 A;  4ZN1 A;  2J6K A;  3BDL A;  1GBR A;  2XKO C;  3AHU A;  2YSQ A;  4KGX B;  2RJE A;  2MMP A;  1BI1 A;  1VQK Q;  2EJF A;  1UJY A;  2KE9 A;  2HZY A;  2XI9 A;  3URG A;  2ZPF B;  2JTM A;  2VVK A;  6AT1 B;  3DLM A;  3VS7 A;  3PGG A;  2GFU A;  5KE3 A;  3VYH B;  2FZC B;  3EG9 A;  3GPL A;  2ATC B;  3LW5 E;  1VQ9 T;  2MYS A;  1PWT A;  2CGH A;  1M2V B;  4C92 C;  2MK5 A;  4LNP A;  1MV0 B;  4EMH A;  4KH1 B;  1HD3 A;  1CKA A;  1PHT A;  3H0H A;  1VA7 A;  2G6F X;  3CXC P;  1OV3 A;  1W2B S;  1QVP A;  1M8V A;  4IIO A;  1S72 A;  4LN2 A;  4A4E A;  1AT1 B;  4EDU A;  1W2B A;  2EVR A;  1ACM B;  1Q95 G;  4B9X A;  1SPK A;  5GAN 6;  2FPD A;  3RIR A;  2AHJ B;  1H3Z A;  4LDU A;  3PIP A;  2M16 A;  2GTJ A;  2JW4 A;  4ELZ C;  2V8K A;  1ZSZ C;  4C92 A;  1PG5 B;  3SWN B;  1VQ9 Q;  4PK4 A;  3I9Q A;  3BW1 A;  1AWX A;  5GMK i;  2NUP A;  4LDV A;  4BY6 B;  1QCO A;  1ABO A;  4BY6 C;  3JCM V;  1XQH A;  4OMO A;  3INZ A;  2K5I A;  1D0Z A;  2DIQ A;  1E6H A;  2CZ1 B;  4FW1 A;  2Y90 A;  2RQV A;  4XK8 E;  4M78 C;  1OU8 A;  2O31 A;  3F70 A;  5KYY B;  1ZSZ A;  1T3L A;  2JUF A;  3SEM A;  4M75 G;  5FRO A;  1VQM A;  4II1 A;  5CO7 A;  2OAW A;  1VQ5 T;  5D6W A;  1UB4 A;  1G5V A;  2ROL A;  3EH1 A;  3X26 B;  1YIJ A;  2M9U A;  4OMQ A;  2CT4 A;  4KRT A;  2EGC A;  3MPU B;  4M7D B;  4EPC A;  3QZ5 B;  3O5Z A;  2E3I A;  2X9H A;  1B34 B;  4C8Q C;  2VC8 A;  2FRW A;  5LJ3 h;  2K2M A;  4M78 A;  2RA2 A;  1U8R A;  2HMA A;  1FX7 A;  3QYH B;  1K9M R;  3RMQ A;  4J6W A;  2H8H A;  4L5G A;  4A54 A;  4N0A C;  1KC8 R;  3L2R A;  5CIU A;  2X4J A;  2QQ9 A;  1BIA A;  2A36 A;  2NUT A;  4JS5 A;  1JXM A;  5GAM h;  2L5Q A;  2LX7 A;  1UEC A;  3C12 A;  1VQ5 Q;  5J39 A;  2WSF E;  2DMO A;  4C8Q A;  3TU4 K;  2DZ9 A;  4J9E A;  4TVR A;  2MI6 A;  1RAG B;  2PTK A;  2HAX A;  2DJZ A;  1X43 A;  1OOT A;  3EFR A;  1VIE A;  3X28 B;  4PNO A;  4WCI A;  4N0A A;  2DTO A;  2E3H A;  1WDX A;  3JB9 H;  2HQH A;  4DEX A;  3UWN A;  2R5A A;  5ECA A;  2GQI A;  3CC4 Q;  1D1B A;  4DEY A;  3REA B;  1W1F A;  1WX6 A;  1EIF A;  1MMA A;  2DF6 A;  3QYG B;  3T9N A;  2I2L A;  5A2Q E;  5KYX A;  3M54 A;  1Q7Y R;  5LJ5 f;  4Z89 A;  2E4H A;  3NMZ C;  1G3W A;  1VQ8 Q;  2LQW A;  2JS2 A;  3CCS T;  2M0O A;  2C0T A;  4JRP A;  2XHC A;  1BCO A;  2HL3 A;  2DET A;  3RR6 A;  1NLP C;  3TEE A;  5GJW B;  1VQ6 A;  3NGP A;  3V7S A;  1M27 C;  2EGE A;  1RLQ C;  2CUD A;  2KSS A;  1YIJ T;  1JEG A;  2E10 A;  2E65 A;  4LDX A;  1VQ4 A;  1RAD B;  3JCM W;  3OMG A;  4RUG A;  5FU6 C;  1XNI A;  2JTF A;  4IUQ A;  3L42 A;  2QXF A;  5GAO l;  2LT1 A;  3A8M B;  2JZ2 A;  1M3A A;  1YJ9 A;  3EFS A;  3UA6 A;  3OYB A;  2RF0 A;  2DNU A;  2BZX A;  3CCS Q;  3NTK A;  3CCE A;  3CCU Q;  3EGX A;  4PJO B;  2CS7 A;  2CP7 A;  2DL4 A;  1H3H A;  4DBF A;  4M7D D;  4FM4 B;  3VS4 A;  3OS5 A;  3M55 A;  1QLY A;  3FB9 A;  1K9M U;  3L2U A;  4QKU A;  1SRL A;  4OP0 A;  2CZ0 B;  2ENM A;  2LZ6 B;  1VQO Q;  1KC8 U;  1MUZ A;  3TVT A;  1V29 B;  2PQW A;  4M4Z A;  3PIO A;  5KCO A;  3MKD A;  1X2K A;  4DQ2 A;  3X20 B;  4AG1 C;  5HY6 A;  3JCM f;  1NG2 A;  1AWO A;  3ER0 A;  1QVG P;  4XTW A;  2V1Q A;  3RER A;  2KXC A;  4J5Y A;  3VS1 A;  3S3N A;  2E1H A;  1UGS B;  3H41 A;  1GL5 A;  1HXD A;  4J7F A;  3TSW A;  3UPU A;  1MMD A;  4BAC A;  4MZP A;  5J26 A;  3CD6 Q;  1IRX A;  3MET A;  1RUW A;  3V7R A;  2E41 A;  1N6A A;  4ELY C;  5FRN A;  3OYC A;  1X01 A;  3CPW S;  1PSF A;  3CPW A;  2DBM A;  2LX9 A;  1VQ6 T;  2EBP A;  3JCM Q;  3J80 E;  3CCM Q;  1Q7Y U;  2K5L A;  2MIO A;  1I5O B;  3FRN A;  1HYO A;  1FYN A;  1WQ7 A;  3JCM P;  2PUK B;  3KBG A;  2D9T A;  2DO3 A;  4IUU A;  5FRM A;  2QA4 A;  2RHY A;  5KYW A;  5IN1 A;  4PFZ A;  3I55 A;  5GMK m;  3HP9 A;  3ASK A;  4HCZ A;  4C92 E;  2DLP A;  2KDS A;  1R0B G;  3QJY A;  2LJ0 A;  3OYN A;  1YJ9 T;  4BDZ A;  5GAN f;  1AVZ C;  2RM4 A;  2J6O A;  3CQT A;  2EYW A;  1Q82 C;  3CCE T;  4HVU A;  4JZ3 A;  2FPE A;  4Z02 A;  4JZ4 A;  1SG5 A;  2WSE E;  1WIE A;  4AMC A;  1K0X A;  3OYE A;  1I8F A;  4Z88 A;  5GAN 4;  3CCQ A;  2GNC A;  3OBY A;  2FZG B;  3MJX A;  1KQS P;  4FSS A;  1MMG A;  2LCC A;  3FC3 A;  4M77 D;  4OVA A;  4M77 F;  4M7A C;  4C5G A;  3TCJ A;  4RTT A;  2QI2 A;  2PVO B;  4PJO D;  2DL5 A;  2F2V A;  3NHN A;  4M75 B;  1QQJ A;  2D1X A;  1VQK A;  1YJ9 Q;  1TOV A;  3GBQ A;  1X6B A;  2DER A;  2QG9 B;  2KT1 A;  1AOJ A;  4HXJ A;  3QPH A;  3SD4 A;  4RCB A;  1QVF P;  2B8A A;  4IIM A;  1WJS A;  2ECZ A;  5J3B A;  3MO8 A;  4M78 E;  2XG8 D;  1VQP A;  2F5K A;  2DL8 A;  3VRZ A;  3QWY A;  4KGZ B;  3HSB A;  2XID A;  1D09 B;  5KYU A;  2H3E B;  1BYM A;  3HRU A;  3NTH A;  5IAY A;  2X51 A;  4DOV A;  3CXC S;  4M7A A;  4XTY A;  3CME T;  3OBW A;  4FW2 A;  3CXC A;  3VKI A;  1BK2 A;  3A98 A;  2ZAE A;  1XJW B;  2RJD A;  4XTV A;  1H64 1;  1TUC A;  4C8Q E;  2FO0 A;  1CSK A;  1UDL A;  4J6Y A;  4OB3 B;  1YHQ A;  1YWO A;  2F1L A;  4A4H A;  1WFW A;  1OX8 A;  2E12 A;  2DM1 A;  2DVE A;  3I55 T;  2R57 A;  4OML A;  1UG1 A;  4Y92 A;  1OU9 A;  2BZ8 A;  4C0D B;  4JJB A;  2E5Q A;  1VQ9 A;  4ZGJ B;  4LD9 K;  1C1A A;  3EG2 A;  2ED1 A;  3EH2 A;  3LLR A;  1OZ3 A;  4RTY A;  1OEB A;  3OYM A;  5CQY A;  3TQ7 P;  1ZBJ A;  4BI3 A;  2R58 A;  2OTJ Q;  3CME Q;  3LH0 A;  8AT1 B;  3OYY A;  4ORZ A;  2YRC A;  4F17 A;  2GGR A;  3E9F A;  4FYY B;  2F2W A;  1ZLM A;  2VXE A;  3Q1J A;  1M4Z A;  5CKH A;  4F7U A;  2K2V A;  1I4K 1;  4QVZ A;  4OMP A;  1YN8 A;  3HL8 A;  1M1K C;  3FEO A;  2KT8 A;  3E1S A;  2HL5 C;  4D6W A;  2FEI A;  2XU8 A;  2DA9 A;  2K3B A;  1D3B B;  2DYB A;  2JMA A;  1Q81 C;  3HHT B;  1N9S A;  4BDY A;  2OTL Q;  1NEG A;  4FCY A;  1X75 C;  4QT7 A;  1TWB A;  2LCL A;  3L2V A;  2W0Z A;  2MWP A;  3C95 A;  4EIK A;  1WYX A;  5GMK e;  2XIC A;  1VQN T;  1BI0 A;  3H0F A;  4OB0 B;  5IHK A;  2K7A A;  2DXT A;  3H8Z A;  2E5K A;  3OYD A;  3HPW A;  5HCK A;  3QHS A;  5GAN 7;  1VQP T;  3UA7 A;  4GY5 A;  3U23 A;  3LH5 A;  4QVD A;  1Y0M A;  1IB8 A;  2KK4 A;  3OA6 A;  3EGD B;  1Y57 A;  4HVV A;  1GFC A;  2EIF A;  4AFQ C;  1M90 C;  1HK9 A;  2DXC A;  3M5A A;  4M75 D;  1GCQ C;  5I21 A;  1VQ5 A;  2RHX A;  3ZFJ A;  2VYT A;  2M51 A;  1YHQ T;  1WXB A;  2LRQ A;  3M4Y A;  3H9N A;  3EFO B;  1W4S A;  4HCB A;  1ARK A;  2ZGW A;  3QZ9 B;  1VQN Q;  4JS4 A;  3ZBD A;  1YBY A;  3SFM A;  5DLQ E;  1VQP Q;  2YDL A;  1BCM A;  4HT8 A;  3VS2 A;  2LDM A;  4IUR A;  3CC4 A;  1RLP C;  4FT2 A;  2AT1 B;  4ATO A;  3PE0 A;  2LT4 A;  2YRD A;  1G3S A;  2EQU A;  3LGF A;  2FHD A;  1KHI A;  3JB9 G;  3I56 Q;  2D0N A;  3JV3 A;  1V76 A;  1SF9 A;  1G3Y A;  3E9G A;  4E2F B;  2QQR A;  1VQ8 A;  4LDY A;  3JB9 J;  2XDD A;  1YHQ Q;  2P0Q A;  3WVD B;  1VOM A;  2OJ2 A;  3V7C A;  2QDY B;  1WJQ A;  2RI2 A;  3DLL A;  3RBB B;  4OGE A;  4FYX B;  2JMC A;  2K3X A;  1M2V A;  2AIR B;  2K9G A;  5GJV B;  1QWE A;  3SWN C;  1U3O A;  4C5E A;  2VGM A;  2GTO A;  4IUP A;  4PLL A;  2J05 A;  2BTT A;  3G6E Q;  4WTO B;  1X27 A;  2LMJ A;  2X4Y A;  4DBQ A;  2JXB A;  4OB1 B;  2FRY A;  3M58 A;  4ZNX A;  2QEX Q;  3CCS A;  3C94 A;  3KXT A;  2VUB A;  1JXO A;  2DL3 A;  1R8O B;  2J7I A;  3CCU A;  4E7Z A;  1Q86 C;  3VUZ A;  2RPN A;  1WHH A;  3CBO A;  1YJW A;  4MZM A;  4MZT A;  4HCC A;  1KIK A;  1WNL A;  3L2Z A;  2GCX A;  3SWN A;  3LWI A;  2JN0 A;  3OSV A;  2A28 A;  4A4K A;  1SSF A;  2A7Y A;  1VQO A;  5KH6 A;  4J8O A;  1U1S A;  3OYG A;  5CKF A;  4M7D C;  3CMA T;  2EW3 A;  2RNA A;  1QVG S;  1BB9 A;  4LXC A;  4GLK A;  1QVG A;  3MP1 A;  4J9H A;  1DJ7 B;  2RQR A;  2NYS A;  2EJ9 A;  5HK0 A;  1UGQ B;  1IXD A;  5KYY A;  3CC4 T;  2RN8 A;  4V2S A;  2XDB A;  2XDP A;  2CSQ A;  1N8R C;  2BUD A;  5IXB A;  4PJM A;  1Y96 B;  2K6D A;  1CKB A;  2B86 A;  2MF2 A;  3QWX X;  1ABQ A;  3CD6 A;  2COZ A;  2CP3 A;  2YXY A;  4E7I A;  2NLU A;  1KQ1 A;  1VQ8 T;  4EMK B; 
#chains in the Genus database with same CATH homology
 2KRN A;  4AFZ C;  2V1Q A;  1KSW A;  5IH2 A;  1GCQ A;  2PZ1 A;  1UE9 A;  1NYG A;  2KXC A;  1AWJ A;  4AFU C;  4D8K A;  3VS1 A;  2CT3 A;  3ZL7 C;  2F2X A;  2O88 A;  2HCK A;  3H41 A;  1GL5 A;  2DE0 X;  2KXD A;  3TSW A;  1ZSG A;  4Z8A A;  3M0R A;  2CH4 A;  1QCF A;  1RUW A;  2SRC A;  3EGU A;  1H8K A;  1PRM C;  4R0K A;  2EYY A;  2DBM A;  2EBP A;  1AEY A;  2JT4 A;  4HCK A;  3VS3 A;  2MIO A;  2CSI A;  1FYN A;  2LJ3 A;  3M0Q A;  1ZUY A;  2CDT A;  2W10 A;  2MCN A;  2HBW A;  1U5S A;  1SHF A;  1JU5 C;  1UHC A;  2DLP A;  2DIL A;  3EG0 A;  1PRL C;  2YUO A;  3UAT A;  1K4U S;  3ULR B;  1VYT A;  2NUZ A;  1EFN A;  4RTU A;  2LJ0 A;  1NLO C;  2ED0 A;  4RTZ A;  4X1V A;  1AVZ C;  2YUP A;  2J6O A;  3CQT A;  1YNZ A;  2EYW A;  2LJ1 A;  1NM7 A;  1UFF A;  1PKS A;  3I5S A;  4RTX A;  4HVU A;  2CH4 W;  4JPB W;  2EYZ A;  4JZ3 A;  1UGV A;  2FPE A;  2C0O A;  4JZ4 A;  1SSH A;  1VYV A;  1WIE A;  1XOV A;  1K0X A;  3I35 A;  3M0T A;  4AG2 C;  1M30 A;  1N5Z A;  1K1Z A;  2JM8 A;  2VKN A;  3UF4 A;  4Z88 A;  2GNC A;  1MV3 A;  1YCS B;  2GBQ A;  2KYB A;  1T3S A;  2JM9 A;  4FSS A;  1KJW A;  1ZUK A;  1UTI A;  1NEB A;  1H92 A;  5FWC A;  2PNI A;  1FMK A;  4RTT A;  1I1J A;  1YWP A;  1AD5 A;  1GFD A;  2DL5 A;  2F2V A;  3NHN A;  1QWF A;  2D1X A;  2O9V A;  3GBQ A;  1X6B A;  4RTV A;  3EG1 A;  2KT1 A;  1AOJ A;  4HXJ A;  2JS0 A;  4IIM A;  1OPL A;  2ECZ A;  3IQL A;  1G83 A;  2EQI A;  2DL8 A;  3VRZ A;  3QWY A;  1AZE A;  1UJ0 A;  4F14 A;  1JO8 A;  2DL7 A;  1AZG B;  1PNJ A;  1WLP B;  2J6K A;  1GBR A;  2YSQ A;  1UJY A;  2KE9 A;  4JJC A;  1WXT A;  2XMF A;  2VVK A;  2KEA A;  1BK2 A;  3A98 A;  3VS7 A;  2ABL A;  1TUC A;  1B07 A;  2C0I A;  2FO0 A;  1CSK A;  4J9G A;  1BU1 A;  1UDL A;  5I11 A;  1YWO A;  1B3Q A;  1PWT A;  2YT6 A;  3EHR A;  1WFW A;  2YUQ A;  2KYM A;  5FW9 A;  2DM1 A;  4LNP A;  1MV0 B;  4OML A;  1K76 A;  1UG1 A;  3KFV A;  1HD3 A;  4Y92 A;  2BZ8 A;  1CKA A;  1PHT A;  3H0H A;  1VA7 A;  2G6F X;  3SHW A;  1ZUU A;  4JJB A;  1OV3 A;  1IO6 A;  4ESR A;  1LCK A;  2D8J A;  2ED1 A;  3EG2 A;  4IIO A;  4LN2 A;  2J06 A;  4RTY A;  1UUE A;  2DVJ A;  1X69 A;  2EVR A;  1K9A A;  1OEB A;  1T0H A;  1TUD A;  1YP5 A;  1ZBJ A;  1SPK A;  2FPD A;  1RI9 A;  2IIM A;  2GTJ A;  2JW4 A;  2OI3 A;  4ORZ A;  4F17 A;  3C0C A;  2GGR A;  2F2W A;  2DJQ A;  2KRO A;  1ZLM A;  1TG0 A;  3I9Q A;  1W70 A;  4OMP A;  1AWX A;  1YN8 A;  2M0Y A;  2RQT A;  2KT8 A;  2J6F A;  1ABO A;  2FEI A;  2DA9 A;  4OMO A;  2DX1 A;  2K3B A;  2DYB A;  1M3C A;  4A63 B;  2JMA A;  1E6H A;  1QKW A;  2EGA A;  1NEG A;  4QT7 A;  4E6R A;  2RQV A;  4CC4 B;  2W0Z A;  5FWB A;  4EIK A;  1WYX A;  2O31 A;  3H0F A;  4K11 A;  1Z9Q A;  5IHK A;  2K7A A;  1T3L A;  2E5K A;  3SEM A;  5HCK A;  5L23 A;  2OAW A;  1J3T A;  3UA7 A;  3U23 A;  3LH5 A;  1Y0M A;  2CUB A;  2X3W D;  2ROL A;  2EKH A;  4OMQ A;  1WA7 A;  4RTW A;  2CT4 A;  4KRT A;  1Y57 A;  2EGC A;  4HVV A;  4JJD A;  1GFC A;  4AFQ C;  3EG3 A;  2VWF A;  1I0C A;  3O5Z A;  2LNH B;  2A37 A;  3TSZ A;  1GCQ C;  4CC7 A;  4LE9 A;  2FRW A;  1BBZ A;  4D8D A;  2K2M A;  1WXU A;  3I5R A;  2M51 A;  4OMM A;  4CC3 A;  5IHI A;  1WXB A;  2ESW A;  3THK A;  2H8H A;  1M8M A;  1ARK A;  2AZV A;  2DBK A;  2HDA A;  2A36 A;  2QDL A;  1JXM A;  1WI7 A;  2LX7 A;  1T0J A;  2KNB B;  1UEC A;  2YDL A;  1GCP A;  2LCS A;  3VS2 A;  1E7O A;  2AK5 A;  2DMO A;  1VYU A;  2L3P A;  1RLP C;  4J9E A;  1JQQ A;  1HSQ A;  3PE0 A;  2DRK A;  2PTK A;  4AFS C;  4OMN A;  2D0N A;  1GRI A;  3JV3 A;  1X43 A;  1OOT A;  2RMO A;  1U06 A;  3M0P A;  1GBQ A;  4WCI A;  1ZX6 A;  2P4R A;  1WDX A;  2L2P A;  1QKX A;  2L3S A;  5EC7 A;  4DEX A;  2K79 A;  5ECA A;  2LQN A;  2GQI A;  3VS5 A;  2FG0 A;  2LP5 A;  4DEY A;  2KBT A;  3REA B;  1W1F A;  1WX6 A;  1UHF A;  2ROT A;  2OJ2 A;  2DF6 A;  3RNJ A;  3PVQ A;  1S1N A;  3VS0 A;  3REB B;  2X3X D;  3RBB B;  2YUN A;  4Z89 A;  2RQU A;  3NMZ C;  2I0N A;  2JMC A;  2AKK A;  2LQW A;  2K9G A;  4CC2 A;  5GJV B;  2JS2 A;  1QWE A;  1U3O A;  2GTO A;  2C0T A;  2AZS A;  2KRS A;  2L3Q A;  2J05 A;  2KRM A;  4F16 A;  2O2O A;  2BTT A;  1NLP C;  4J9C A;  1I07 A;  2RQW A;  5IHN A;  5GJW B;  3NGP A;  1X27 A;  1M27 C;  1SEM A;  2HSP A;  2LMJ A;  2EGE A;  2FPF A;  2NWM A;  2SEM A;  1SHG A;  3M0S A;  1RLQ C;  1SRM A;  2CUD A;  2D8H A;  4GBQ A;  2JXB A;  1JEG A;  5I22 A;  1A0N B;  1HJD A;  2FRY A;  5IXF A;  4ZNX A;  1E6G A;  1AWW A;  1Z9Z A;  2L0A A;  4HVW A;  1JXO A;  2DL3 A;  4RUG A;  2J7I A;  4J9I A;  2RPN A;  3FJ5 A;  3R6N A;  2DRM A;  2BZY A;  1KIK A;  4LUD A;  3M0U A;  1M3B A;  4J9D A;  3PVL A;  1PKT A;  2A28 A;  1M3A A;  3H0I A;  2V1R A;  3UA6 A;  2RF0 A;  2DNU A;  3NPF A;  4GLM A;  2BZX A;  3VS6 A;  4J9B A;  2EW3 A;  2RNA A;  1G2B A;  1BB9 A;  2JTE A;  2DL4 A;  1H3H A;  4J9H A;  3VS4 A;  3EHQ A;  2KR3 A;  2RQR A;  1OPK A;  3VRY A;  2AKL A;  1K0S A;  1KFZ A;  1QLY A;  1SRL A;  2RN8 A;  4LUE A;  2ENM A;  2LZ6 B;  1V1C A;  2O9S A;  2EYX A;  1W6X A;  1MUZ A;  2CSQ A;  3TVT A;  5IXB A;  2HEQ A;  4M4Z A;  2K6D A;  1CKB A;  2EPD A;  1NYF A;  2B86 A;  1X2K A;  3QWX X;  4AG1 C;  1ABQ A;  2CRE A;  2KGT A;  1X2Q A;  1NG2 A;  2A08 A;  2MOX A;  1X6G A;  1AWO A;  4J9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...