2EPDA

Solution structure of sh3 domain in rho-gtpase-activating protein 4
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
76
structure length
76
Chain Sequence
GSSGSSGEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERASSDWWRGEHNGMRGLIPHKYITLPAGTEKQVVGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho GTPase-activating protein 4
publication title Solution structure of SH3 domain in Rho-GTPase-activating protein 4
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 5
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2epdA00
2DVJA 2KE9A 4OMQA 1HJDA 2VWFA 1ZUUA 1T3LA 2CT4A 2K9GA 2QDLA 1Y0MA 3VS5A 3ZL7C 1AWXA 2FRWA 2BTTA 1AWOA 1YWPA 1Z9QA 1X69A 3UA6A 1KFZA 1SHGA 2SEMA 2LJ0A 2IIMA 2J7IA 2F2WA 3H41A 2JM9A 3M0RA 1PWTA 1J3TA 1SPKA 4JJCA 2P4RA 1XOVA 1GBRA 1UTIA 4HVWA 1GFDA 3H0FA 2JMAA 2EVRA 2FPEA 4J9BA 3M0TA 4OMOA 4E6RA 4GLMA 2JTEA 1OEBA 1PNJA 1SRMA 2A36A 1AWJA 1X43A 1I0CA 3VRZA 1WLPB 1VYTA 1X2QA 4J9FA 3NGPA 1CSKA 2GTJA 1PKSA 2DRKA 2EBPA 1Z9ZA 1K0SA 2FRYA 1QKWA 2DL3A 2LX7A 3SHWA 4RTYA 2EW3A 2YUQA 2J05A 2B86A 2CUDA 2YT6A 3C0CA 4RTZA 2L3SA 2NUZA 3EG3A 1AWWA 1MV3A 5L23A 4LNPA 2YUOA 4JZ3A 1LCKA 2CSIA 2M0YA 2AKKA 2FG0A 2CDTA 2HBWA 1WDXA 1KJWA 1JQQA 1UHFA 2L0AA 3TVTA 2DF6A 4HVVA 1MUZA 3RBBB 2LP5A 1JO8A 2MOXA 2MCNA 2L2PA 3TSZA 1UDLA 2DE0X 4LE9A 4ESRA 3M0PA 1M3CA 2RQTA 1QCFA 3O5ZA 1NG2A 1YNZA 2YUNA 4AFSC 4AFZC 2CSQA 2KXDA 1NLPC 2CREA 3EHRA 4J9CA 4Z8AA 1WIEA 1ABQA 1M27C 2DX1A 1KSWA 2GTOA 2JM8A 1M30A 3ULRB 1WI7A 3SEMA 2KNBB 2EGAA 2EGCA 2KYMA 3PVLA 2X3XD 3EG0A 2JW4A 1RI9A 4D8KA 1M3BA 2ROTA 2HDAA 1M8MA 2DA9A 5FW9A 2ESWA 2ED0A 2FPFA 3UATA 1UUEA 2CH4A 4GBQA 1AZEA 1K76A 1PRLC 2HCKA 2KBTA 4QT7A 2L3PA 1GFCA 1RUWA 2EYXA 4FSSA 2LNHB 1U5SA 1SSHA 4LUDA 4F17A 1UG1A 1GL5A 1H3HA 2ABLA 4OMLA 4RTWA 3I5RA 1YN8A 1OPLA 2GNCA 2RPNA 1TG0A 1IO6A 5IXBA 1UECA 3VS4A 4RTXA 1GCQC 5EC7A 1H8KA 2K79A 1X6BA 1BU1A 3LH5A 4D8DA 1YCSB 1JEGA 2E5KA 2O2OA 4J9EA 3GBQA 4JJDA 1UFFA 2JMCA 1K0XA 2C0TA 2EYZA 3EHQA 4IIMA 1A0NB 5IHKA 2AKLA 2RNAA 2ROLA 1ZUYA 2BZXA 2J6OA 2K7AA 4K11A 4DEXA 1ZUKA 2KYBA 1X2KA 1QWFA 2O9VA 2EYYA 2EPDA 4HXJA 3VS0A 3VS6A 1QKXA 2H8HA 2GBQA 3PVQA 4F14A 2EQIA 2EGEA 2GGRA 2JS0A 5IHNA 1K4US 1AEYA 1E6HA 1I07A 2KT8A 2CT3A 1AD5A 1B07A 1PKTA 2ED1A 1ZLMA 2W10A 1MV0B 5GJWB 1NYGA 3I9QA 3EG1A 2BZYA 2RMOA 1EFNA 5GJVB 1VYVA 1UJ0A 2DM1A 2K2MA 3NMZC 3THKA 1E6GA 1E7OA 1T3SA 2KRMA 4LUEA 2M51A 4CC7A 2KRSA 2LJ1A 1KIKA 2K6DA 1AZGB 1GCQA 2JXBA 1V1CA 1GBQA 1FYNA 2YUPA 3PE0A 4M4ZA 3VRYA 1GCPA 4Y92A 1CKBA 2F2XA 2DNUA 1HD3A 2J6KA 2A28A 2DLPA 1X27A 2AZSA 2KEAA 2MIOA 2PZ1A 2DJQA 4A63B 3VS7A 1Y57A 1X6GA 4ZNXA 2LZ6B 4WCIA 1GRIA 3H0HA 2V1RA 4J9GA 1TUDA 1WYXA 2X3WD 1YWOA 2LMJA 1H92A 1ZX6A 2KROA 2DBMA 5ECAA 1G83A 2CUBA 1AVZC 2NWMA 2RQUA 2AK5A 3R6NA 1AOJA 1JU5C 3EG2A 2DYBA 2D8HA 3JV3A 4J9DA 4OMPA 1W6XA 3UA7A 1UE9A 1NEGA 2JS2A 1RLQC 4CC4B 1WFWA 3UF4A 1UGVA 3VS2A 2RF0A 1U06A 1T0JA 2VKNA 3RNJA 1SHFA 2FEIA 2KXCA 1BB9A 1WX6A 1CKAA 1U3OA 2RQRA 4AG2C 2D0NA 1I1JA 3VS3A 2A08A 2DL7A 4R0KA 1T0HA 4JJBA 3EGUA 1OOTA 1UHCA 4RUGA 4HCKA 1JXMA 1JXOA 2LCSA 4AFUC 4EIKA 1M3AA 2JT4A 3VS1A 2F2VA 2OJ2A 2KR3A 3FJ5A 4KRTA 3CQTA 1FMKA 2J6FA 1PHTA 4ORZA 2D8JA 4RTTA 4X1VA 5IXFA 2YDLA 5FWBA 2CH4W 3IQLA 3H0IA 2L3QA 4OMNA 1UJYA 2ECZA 1VA7A 5IH2A 4Z88A 2KT1A 4RTVA 4JPBW 2LQNA 4LN2A 2DRMA 3A98A 4RTUA 2PTKA 2W0ZA 3M0SA 3QWYA 5FWCA 4OMMA 2DILA 1NLOC 1ARKA 1K9AA 1K1ZA 1ZSGA 4AFQC 1G2BA 1OPKA 2YSQA 1W1FA 1PRMC 1NEBA 1WXTA 2HEQA 2RN8A 2VVKA 2K3BA 4CC2A 3REAB 4Z89A 1QLYA 2DL4A 1OV3A 2I0NA 2EYWA 2AZVA 2KGTA 1BK2A 5HCKA 1NM7A 1TUCA 1BBZA 3U23A 4CC3A 4AG1C 3M0UA 1ABOA 1S1NA 1YP5A 1ZBJA 2PNIA 2RQWA 1W70A 1SEMA 2HSPA 1HSQA 2BZ8A 2FO0A 3I5SA 4JZ4A 5I11A 2O9SA 3QWXX 2ENMA 2OI3A 2RQVA 2C0OA 2SRCA 2G6FX 2LQWA 2DMOA 1WXUA 2A37A 1QWEA 3REBB 5IHIA 3I35A 2D1XA 2V1QA 2EKHA 4J9IA 2DL8A 2XMFA 3KFVA 2GQIA 2KRNA 2DL5A 3M0QA 4J9HA 1SRLA 1VYUA 2C0IA 3TSWA 1WA7A 3NHNA 1N5ZA 4HVUA 4IIOA 5I22A 2DBKA 1B3QA 1NYFA 2J06A 2OAWA 2O88A 3NPFA 2FPDA 1RLPC 2O31A 4DEYA 4F16A 1WXBA 2LJ3A
chains in the Genus database with same CATH superfamily
4PJJA 2LTOA 2KE9A 1NJIR 3TEEA 3T9NA 3VV0A 3V8LA 1N9SA 3CCQQ 2K9GA 4C0DB 3VS5A 1Y0MA 1TTHB 2FRWA 2BTTA 5GAMf 1Z9QA 3EG9B 1X69A 3UA6A 4FT4A 2LNVA 4HCCA 4J83A 4XTWA 5J39A 4HCBA 1FWZA 1J3TA 1MMAA 5FU6C 1SPKA 4M78D 1YFNA 2P4RA 3CC7A 1GBRA 2WSEE 4JRIA 4EDUA 2RHXA 3CCUQ 2DXTA 2RHUA 4M78B 2DTOA 2K2VA 4PJOA 1SRMA 1AWJA 1X43A 1I0CA 2YHTA 4ZGEB 2CKKA 2L5QA 3JCMh 4E2FB 2X4JA 4LDVA 2JVVA 3SWNA 2ZPGB 2ATCB 3FDRA 3OS5A 3CCJQ 1Z9ZA 1F1BB 4BY6C 4CI0C 3CC7T 3ER0A 1QKWA 2LX7A 3E19A 2YT6A 3C0CA 1K9MU 2L3SA 4C92G 4E7JA 1UGQB 5L23A 2YUOA 1WZOA 4JZ3A 5A0GA 3JB9H 4XQ3A 2CSIA 3LWHA 2M0YA 1C0MA 3PMIA 3CCLQ 1KJWA 2EAYA 2DF6A 2XDBA 1K9MC 3RBBB 2LP5A 1JO8A 5A2QE 2DE0X 4MDXA 3M0PA 4A4GA 3QBYA 2E6NA 1YNZA 1K9MR 2RJFA 5LJ3d 2CP3A 3M56A 4VUBA 5A0DA 5GAMe 5KH6A 2CS7A 5GANe 2KY9A 2CP5A 2ZPEB 3EHRA 4JJNK 3C94A 2DX1A 1VQ6A 2COZA 4FCYA 4J6YA 1M30A 3GNGA 2ZPIB 3G4SQ 4JLGA 2KNBB 2EGAA 2KYMA 2X3XD 6AT1B 5LL6S 2DPPB 2LQKA 1RI9A 3M4YA 2DA9A 1K73U 2FPFA 3CPFA 3QJYA 1V29B 1K76A 4EMKC 1GXIE 2KBTA 3RKWA 1XTDA 3MEVA 3ZFJA 3G71Q 2H3JA 1VQ6T 1SSHA 3FJPA 4LUDA 4LXCA 1K73C 4PFPA 3OW2A 2GFUA 3NTHA 1UECA 3VKIA 1BCMA 2E10A 1IHWA 1K73R 4JS4A 3EH1A 4B9XA 4R55A 1O9SA 1BI2A 3CCRQ 3JCMb 2JMCA 1K0XA 2EJGA 2C0TA 2FZKB 4IIMA 2ZPHB 5KE3A 4BE2A 3X26B 2AKLA 2RK1A 2X4WA 3EFOB 4K11A 2K7AA 4DEXA 2DERA 5GAOp 1XJWB 2O9VA 1RAIB 3A1PA 2CP6A 1WHGA 1QKXA 3HTRA 3CD6A 5KYWA 3VYHB 5CK9A 1VIEA 2QTXA 3QO3A 3OYJA 4F04B 1VQ9Q 4OGCA 4C0DC 1B07A 1M90U 5KCOA 1MV0B 1NYGA 2DK3A 3I9QA 5HY6A 2RMOA 3L2ZA 4KBMB 1VYVA 4E7SA 1JBMA 4WTOB 2ZAEA 4IUVA 4XTZA 2VUBA 1M9SA 1OZ3A 1M90C 4C0FA 3CBPA 2K6DA 3CD6T 1GCQA 4X9CA 1IGUA 1M90R 1V1CA 1FYNA 1VQ7A 4FYVB 2RA2A 1GCPA 2XU8A 1U1SA 2M16A 2DNUA 2AZSA 1FMWA 2MIOA 4XTXA 2BE9B 4M78E 2RO0A 4FYWB 3H8ZA 3EGDB 4ANJA 3GIBA 2X3WD 3PTAA 3MHXA 3RKXA 3RERA 1H92A 5GAOr 3CEYA 3SFMA 2NWMA 2RQUA 1VQNT 3JV3A 3JB9J 3J81E 1VQ7T 2DXCA 2NUPA 1WHHA 2FVUA 4CC4B 1WFWA 3MEUA 4PJOE 3UF4A 4PJOF 5I21A 2QK0A 1KD1U 1QVGP 1U06A 3QKJA 1OI1A 3OW2P 3PIOA 1ZHIA 2JTMA 1CKAA 3MKDA 4AG2C 2D0NA 2QYZA 1I1JA 2BE7D 4BE1A 2A08A 3ZBDA 1KD1C 4C92D 2BUDA 1T0HA 1PG5B 4C8QA 1UHCA 2V8IA 1JXOA 1KD1R 1M3AA 4ZN1A 2JT4A 3JCMP 1KQ2A 4M7DA 2XI9A 4KRTA 4KH0B 3LH0A 2J6FA 1DJ7B 4C92B 3C12A 5IXFA 2VASA 4PNOA 4N4HA 1MMGA 4O5VA 5CKBA 3V7CA 2QDYB 2CP7A 3X25B 2KSSA 1VA7A 5IH2A 2F5TX 3CC7Q 1TWBA 5CAIA 1AHJB 5FLXE 1QVGS 4Y28E 4LN2A 2DRMA 2DJZA 4L59A 2W0ZA 5FWCA 2X51A 3UDCA 2FHDA 2P4TA 5L8RE 4PL6A 4AFQC 3JCMJ 1W1FA 1OZ2A 3TQ7P 3OS1A 1B7TA 5CQXA 5GAOm 2DZCA 4XU0A 2VVKA 2K3BA 3H9NA 2LDMA 3J80E 1LPLA 1SF9A 2AZVA 5HCKA 2FZGB 2JNGA 4BD3A 3OS2A 1ABOA 2YRVA 5LJ5d 3TCJA 3E9FA 4FT2A 1D09B 3EFSA 1RAAB 3I5SA 4JZ4A 1LNXA 2ENMA 2OI3A 2C0OA 4A4HA 2A37A 1QWEA 5IHIA 4PJOG 3V7RA 3LW5E 2M9UA 2EQUA 2BKDN 3EAEA 2V8KA 4J9HA 4IKFA 1HXDA 2M1HA 1Q7YU 1H641 1YJWA 5FU7B 3VU3C 3G71A 4P5NA 2I2LA 2DBKA 1B3QA 2GF7A 2HKQB 2FPDA 1RLPC 2KMTA 2O31A 1VUBA 2L3QA 4N4IA 2DVJA 3GP8A 3TU4K 2HNIA 1Q7YC 3OSSC 1ZUUA 1T3LA 5KYYA 2CT4A 5C0MA 3OB9A 1Q7YR 2QDLA 1YIJA 1AWXA 2RB6A 1NPPA 3CCRA 5I2MA 1YJWT 2P0QA 4ZGDB 3JB9G 2SEMA 2E12A 4UC4A 3G71T 4EPCA 1X6OA 1HYOA 2JUFA 3S3NA 2D9TA 2JM9A 3M0RA 1PWTA 3ZEHA 1G3SA 1R0CB 4JJCA 1XOVA 1UTIA 4NS5A 1GFDA 4PJNA 1SSFA 3DB4A 4XK8E 2DAQA 1WGSA 2EIFA 3M0TA 1VQ9A 1WJSA 4E6RA 1YIJT 1TH7A 1PNJA 3CCRT 4PK4A 1D0ZA 2KQWA 2B8AA 3VRZA 3JCMQ 3FRNA 1WLPB 1YJ9A 4IUUA 1X2QA 3TREA 1CSKA 1OU8A 1M5Q1 2WSFE 5IAYA 4C5EA 4BDZA 3NTIA 3RDVA 1I4K1 4XTVA 4A4EA 3A8HB 1VQ9T 4RTZA 1IZ6A 3QXEB 3OQ5A 2FB7A 1MV3A 3HFOA 1OX8A 5LJ5g 1YJ9T 2HBWA 1JQQA 1UHFA 2L0AA 4M77G 4C92C 1MUZA 2QTVA 2MCNA 3CMAA 3TSZA 2RQTA 2Z0WA 4E7ZA 3O5ZA 2XD0A 4KGXB 4C8QF 4X34A 2PVDB 5KYXB 5CKEA 1VQNQ 1IXDA 2YUNA 4LD6A 4M7DE 3G6EQ 4M7DF 2CSQA 2FZCB 3SB2A 2KXDA 1NLPC 2KAFA 4J9CA 1AT1B 1W4SA 1WIEA 2DD5A 2L89A 1M27C 1KSWA 2JJ9A 4PLIA 3N5BB 3CXCP 3PFSA 3M5AA 1U1TA 4AT1B 1WJRA 3ULRB 3GPLA 1VQKA 3CBMA 2VYTA 1TUGB 2EGCA 2VC8A 3ASKA 4QVDA 1YJNA 3CMAT 3OYIA 1QVFS 3URGA 2JW4A 5CO7A 4ME7A 3RKYA 2HDAA 3HRTA 1UUEA 4IUQA 1N9RA 4GBQA 3V8KA 5CCAA 4FM4B 1PRLC 2DYIA 3HSBA 4M75A 1GFCA 1RUWA 3QZ5B 5GANf 4XTUA 2QQBA 1PM3A 1VQLQ 1UG1A 1BCOA 1GL5A 5CIUA 1VQKT 1YN8A 2GNCA 4V2SA 4A53A 3A8OB 5IXBA 1YJNT 3MP6A 2R57A 2RK2A 2JTFA 2RH2A 1N8RU 2VXEA 5GAN2 5D7UA 1H8KA 2XIDA 3PT9A 3A8MB 1RI0A 5LJ5f 4XU1A 3LH5A 3CXCS 3M57A 4J9EA 2A0FB 2FL7A 4JJDA 1MMDA 3PGGA 3OYAA 4OVAA 1N8RC 3MP1A 1A0NB 2CZ0B 5FU7C 1D1AA 3S3MA 1ZUYA 1KQSA 4PJOD 1X2KA 2QA4Q 2DEQA 4LDYA 3PVQA 2EQIA 3CCET 4WF2A 4OGEA 1K4US 2AIRB 4PJOB 1AEYA 1I07A 3RMSA 4RG2A 2BIVA 5DLQE 3H6ZA 1ZLMA 2W10A 4N0AC 1K8AU 3EG1A 3RR6A 3SWNB 1PC0A 2BZYA 3V8JA 2OTLQ 2HQXA 1EFNA 2AHJB 4MZMA 4C8QG 5HK0A 1E6GA 5GAMj 3PNWC 1VQMA 2M51A 5GANj 1M4ZA 4M7DG 2KRSA 2LJ1A 1KIKA 2E70A 2OAUA 1K8AC 1AZGB 4L5GA 3JB9I 2CZ6B 2F2XA 4Y92A 4IUPA 1HD3A 2A28A 2DLPA 1SG5A 2EYQA 2CGHA 3G1JA 4E7LA 3VS7A 4BE0A 4ZNXA 1GRIA 2V1RA 4J9GA 2M0OA 3M4GA 3GNFB 2IVWA 1X75C 2LMJA 4ZGJB 2KROA 4F7UA 3OYEA 1VQMT 2XG8D 5ECAA 3J7AF 2EQKA 1WHJA 1IGQA 3D7SB 2D8HA 4J9DA 4OMPA 5LJ5e 1W6XA 1UEBA 3L42A 3UA7A 1X01A 1NZ9A 3INZA 4M7AA 1UGVA 3DLMA 3WVEB 5KYNA 1ZSZA 3VS2A 2ZPFB 4BDYA 4GY5A 2G3RA 2RF0A 3L2WA 1YJWQ 3WXMB 4FW2A 4B9WA 4TVRA 4E7KA 2VKNA 3RNJA 2E64A 3OYLA 4OP0A 1KG1A 1QVGA 2KXCA 4Z02A 1U3OA 4Q5WA 1HK9A 1D1CA 1Y7XA 3BDLA 3EGUA 3FB9A 3OA6A 2DVEA 2K3YA 4M77A 2GCXA 4OF1A 1YIJQ 2F2VA 4DOVA 2HBPA 2KR3A 2V8JA 3L2QA 4ORZA 3JCMd 1KQSP 1MGQA 3LLRA 2F5KA 5FRNA 4AMCA 1UJYA 2QASA 5GAN3 2ECZA 1I8FA 1BI3A 1V76A 1TOVA 2RHYA 2WSCE 4NOYA 4IUTA 2MK5A 4C0ZA 2JOYA 3JCMc 1G3WA 5I2SA 3A98A 4RTUA 1NPRA 3HL8A 4NL3A 3QWYA 4OMMA 1YHQA 1R8OB 3QPHA 4R56A 4KULA 1K1ZA 4DOWA 1YJ9Q 3LYIA 1NEBA 4FYYB 5KYWB 3EGXA 1MNEA 3BDUA 2RN8A 1TU0B 4E7IA 4CC2A 3KXTA 4FU6A 2DL4A 4Z89A 2PQWA 2O01E 1VQNA 3HRSA 1KQSS 9ATCB 2X4XA 2KGTA 3G6EA 2EJFA 1NM7A 4M75F 1Q95G 4AG1C 3M0UA 3P8HA 5LJ3g 1YHQT 4OB0B 1YP5A 2PNIA 1OX9A 2LX9A 1QW1A 5GAOq 1VQPQ 4M78C 2HSPA 5GMKe 1HSQA 5GAMh 2FO0A 4HKEA 2DTHA 3OYDA 3CPWS 2C06A 3HPWA 2KK4A 2DMOA 1WXUA 1MMNA 3CMAQ 3REBB 3I35A 2D1XA 4J9IA 3KFVA 5CKFA 2KRNA 3G6ET 3G7ZA 1PD0A 4PJOC 4LDXA 1VYUA 3JAME 3TSWA 1WA7A 5GMKm 3NHNA 1VQLA 1N5ZA 2J06A 1NYFA 3NPFA 4PKCC 1BIBA 4F16A 3SWNC 1VQKQ 4OMQA 1HJDA 2VWFA 2NUPB 1YJNQ 2NUTA 1LVKA 3VYGA 3CCMA 1BI1A 1AWOA 4OB3B 4C8QD 1KFZA 2LJ0A 4DQ2A 2XICA 5KYUA 3H41A 3OYYA 1VQLT 4M7DD 3MJXA 1VQOA 3JCMg 2QA4A 3AHUA 2VGMA 5FRMA 3MEAA 2EWNA 1OULA 3JB9F 4C8QB 2RJCA 1NE8A 1VIFA 5LJ3f 2JMAA 1SKUB 4M7DB 3MEWA 1KC8U 2FPEA 3FIFA 3CCMT 2LT4A 3CCEQ 4QVZA 2MF2A 4C5IA 2A36A 2QQ9A 3QYGB 3QZ9B 2OTLA 3OMGA 4ELYC 3VUBA 4HT9A 4J9FA 1KC8C 1VQOT 8ATCB 5D6YA 2QA4T 4F7UF 4O6JA 2GTJA 1B34A 3BY7A 1BIAA 1D0YA 2EBPA 1KC8R 2P84A 4M75G 3QYHB 4D6WA 1WJQA 3SHWA 4RTYA 2J05A 3DKMA 2B86A 4M7AF 4KGVB 2HQEA 2NUZA 2XDPA 2LCCA 1AWWA 4LNPA 5GAOl 1LCKA 1LOJA 4PFOA 2COWA 2JN0A 3VUZA 4HA8A 1QVFA 1JJ2S 2OTLT 3DLLA 3TVTA 4HVVA 3RIRA 2CYZB 2MOXA 2L2PA 2DIQA 4LE9A 4ESRA 4RCBA 1VQMQ 3WVDB 5HK3A 3L2RA 1NG2A 3BE3A 3OYBA 4M77E 4M77F 2DKGA 1VQ5A 4AFSC 4AFZC 2QG9B 2EJ9A 3JCMf 2DEUA 1YCYA 3X20B 5LJ3j 2CREA 1MHNA 3QJ6A 5FU6B 3LGLA 2JM8A 2GTOA 3PIPA 1QQJA 1RL2A 1WI7A 1WQWA 2QGFB 4C0GA 4A54A 1KHIA 3CXCA 5LJ3e 3EG0A 1MNDA 3S3OA 1NBEB 4Y91A 3LWIA 4FIBA 4D8KA 1M3BA 2DZ9A 1M8MA 5FW9A 2ESWA 1VQ5T 2HZYA 2RD1A 3HKSA 1AZEA 1RAGB 4QT7A 4N0AA 2RI3A 2L3PA 2LNHB 1W2BP 1H3HA 2P0KA 2ABLA 4OMLA 1OPLA 1Y96A 1TG0A 5KYYB 4FL6A 1G8XA 2E4HA 4BUGA 1ZBXA 2RHIA 1Y71A 3RUXA 1M1KU 2HAXA 1GCQC 3SD4A 3A8LB 2K79A 3ME9A 1ACMB 2YWWA 2DIGA 1C1AA 3JSCA 4D8DA 1YCSB 1QP3A 2E5KA 1I5LA 4F7UG 1M1KC 4B6MA 5IHKA 2RI2A 4C5HA 1XNIA 4ZN3A 3VJPA 2RNAA 2BZXA 2J6OA 5GAN4 1D1BA 3CC4A 3FEOA 2KYBA 2VV5A 1QWFA 1M1KR 2QXFA 2EYYA 2EPDA 4II1A 3VS0A 3VS6A 4M7AG 2X9HA 4J6WA 1ZQ1A 2F1LA 2H8HA 1RADB 2GBQA 3M54A 1KHCA 2EGEA 2A3LA 3OS0A 5IHNA 3M9QA 1WHMA 1YI2A 4A4FA 1E6HA 1M1GA 3JCMe 2CT3A 1W2BS 1AD5A 2OX7A 1PKTA 4EMKA 3RESA 2E6ZA 1QVFP 2VGNA 1YHQQ 1IHVA 4FYXB 2L3RA 4QVCA 1VQPA 3OYKA 2EQJA 5GJVB 3QG1A 1UJ0A 2DM1A 3NMZC 3CC4T 1YITA 1M2OA 2KRMA 4HCZA 4LUEA 3S6WA 4L6V5 1KK7A 4C8QC 2JXBA 2YUPA 1GBQA 2O4XA 4C8QE 5M9OA 3OYMA 1Q81U 3VRYA 1YI2T 1WHLA 5KYXA 4M7DC 2J6KA 1G3YA 1X27A 2PVGB 1M2VA 2KEAA 4A63B 1Y57A 1X6GA 4NL2A 3GF5A 1D0XA 2LZ6B 1QCOA 4WCIA 4DBRA 3H0HA 8AT1B 1D3BA 1VQPT 3I55A 3L1AA 1WYXA 2DO3A 1Q81C 1YITT 1YWOA 3CC2A 1ZX6A 2DBMA 2FYKA 2CUBA 1Q81R 1NJIU 2MYSA 4XU3A 3R6NA 1AOJA 1JU5C 2DYBA 1RAFB 3X28B 2QAZA 1NEGA 1BI0A 2DD4A 3DB3A 4LDWA 1NJIC 2DXBA 1PCXA 3EG9A 3MCAB 2CZ1B 3I55T 1SHFA 4M75D 3QHSA 3M58A 2FEIA 2V26A 1BB9A 2PUKB 3CC2T 2RQRA 3I56A 3VS3A 2QEXA 4R0KA 3HFNA 4JJBA 4M75B 1VQ4A 1OOTA 1BYMA 5J3BA 3CCEA 4HCKA 1JXMA 3CCMQ 3P8BB 2OJ2A 3FJ5A 2E5QA 3CQTA 1FMKA 2IG0A 1PHTA 2E65A 2D8JA 4RTTA 4M78A 2HL3A 2RJEA 2YDLA 2CH4W 1VQOQ 5AYFA 3A5ZB 2MWPA 3I56T 4BACA 1N8RR 3FLGA 2QEXT 2YRDA 3GLXA 3QUIA 4Z88A 2NYSA 5GAN7 1QMCA 4RTVA 5EG2A 2VXFA 1VQ4T 2LQNA 2GQVA 4YTLA 4J7FA 3QDFA 2DILA 1NLOC 2H3EB 1EZZB 3CPWA 1ARKA 2HQHA 2PVOB 4ZTJA 2XDDA 2XKOC 1ZSGA 3CBOA 1G2BA 2K5FA 1OPKA 5GAN5 2HEQA 4JUVA 1UGRB 1OV3A 1PD1A 3A8GB 2I0NA 2EYWA 3E2UA 2HMAA 3JB9D 1TUCA 4DA4A 4N4GA 4CC3A 1IREB 1S1NA 1K8AR 3O8VA 1G5VA 5CVIA 2K5LA 1VQ8A 2R58A 2P0PA 5LJ5j 1N27A 1EIFA 2QI2A 5I11A 3PMTA 2RQVA 4CRIA 2LQWA 2V1QA 2RHZA 2GQIA 4KH1B 1VQ5Q 1SRLA 4QQGA 2YRCA 5D6WA 3QDRB 7AT1B 5D6XA 2C0IA 4RG8A 2NLUA 4X9DA 1VQ8T 3NTKA 4M7AD 2R5MA 4IIOA 2GFAA 2D6FA 4F7UB 4DEYA 3M53A 3X24B 1WXBA 2LJ3A 2DFUA 3F70A 4M7AB 1ZSZB 3ZL7C 1S72A 1WPYA 3QSUA 1JB0E 1YWPA 4PLLA 1SHGA 4J8OA 4M77D 2IIMA 4ZTFA 2J7IA 3OYCA 2F2WA 3HRUA 4E7HA 2MPXC 2HKNA 3OSVA 5C6SA 1C6VX 4GLKA 3OYHA 3EFOA 4M77B 4HVWA 4KUIA 3H0FA 1PSFA 2EVRA 1WHKA 2RM4A 3OYGA 3JRZA 4J9BA 3FC3A 1JJ2A 4OMOA 1S72T 2OTJQ 4GLMA 2JTEA 3CPWP 2LC4A 1OEBA 3OBWA 4ATOA 2MI6A 5CQYA 4J6XA 4IURA 2LVMA 2LRQA 1U8RA 1VYTA 3KBGA 3NGPA 2XHCA 3CC4Q 2X35A 1PKSA 2DRKA 4OMFB 1H3ZA 2X4YA 1ZA1B 1K0SA 2FRYA 2QQSA 2DL3A 3Q1JA 2EFIA 2D0QB 2EW3A 3L2UA 4J7IA 2YUQA 5GAOn 2CUDA 1FX7A 1M1FA 5GMKj 5CR2A 5DM7R 1YI2Q 2LQ8A 4M75C 3EG3A 4M75E 3V7SA 3EGXB 4OB2B 5GMKi 2AKKA 2FG0A 2CDTA 5DY9A 5GAN8 1WDXA 1FXXA 3E1SA 1YBYA 2LCLA 3M55A 5IN1A 3CCSA 3CCVQ 3EGDA 1YITQ 5GANh 1UDLA 2EKOA 3CMEA 1O75A 1M3CA 1QCFA 3QIIA 1Q82U 4RKUE 3META 4MZPA 5KCHA 4KGZB 4Z8AA 3C4SA 3OYNA 1TSFA 4M78F 1ABQA 4FSXA 5LJ5h 5CKDA 3UPUA 2K3XA 1Q82C 3I55Q 3SEMA 1R77A 3PVLA 4JLIA 3CCST 3CC2Q 1Q82R 4ELZC 3CMET 3CCQA 5IT9E 4MMLA 2ROTA 5GMKl 4PJLA 3GOXA 2MMPA 1WNLA 2ED0A 2PUOB 1I81A 3UATA 2CH4A 2HCKA 2EYXA 4FSSA 1U5SA 4F17A 1RACB 2K5IA 3EH2A 4RTWA 3I5RA 4C92A 2RPNA 2E1HA 2NUTB 4JDSA 1UGSB 2CP0A 1W2BA 1IO6A 3VS4A 1LJOA 4E47A 3I56Q 4PJMA 2QGGA 3CCQT 4RTXA 1G3TA 3MPUB 2QEXQ 1P92A 1JJ2P 5EC7A 3CCUA 3JCMX 1X6BA 1BU1A 1M8VA 2DTIA 3JCMV 1VQ4Q 1JEGA 5KYUB 2O2OA 3GBQA 1Y07A 1UFFA 2K57A 2F69A 2EYZA 3EHQA 3HHTB 5CKHA 2ROLA 2COYA 1ZUKA 2E41A 2DETA 3CCJA 1EX4A 4HXJA 4F7UE 5J26A 4BI8B 4F14A 1TS9A 2ZCFB 1IRXA 2GGRA 3CCUT 2JS0A 3OW2S 2Y4YA 2KT8A 4M7AC 4M7AE 1ZSZC 2ED1A 3LGFA 4MZTA 5GJWB 1R0BG 3NFCA 5GAMd 3CCLA 1B34B 5GANd 4DBFA 2K2MA 3THKA 3MP8A 1E7OA 1T3SA 3CCJT 4CC7A 4RCCA 4J5YA 2Y4XA 2CP2A 4C5GA 2DXUA 2QQRA 5GMKh 4M78G 1FMVA 3PE0A 3BW1A 4M4ZA 4M77C 1CKBA 2HSEB 2K4YA 1UB4A 1Q86U 1KQ1A 2PZ1A 2DJQA 2KDSA 4LD9K 3EFRA 4EMHA 2RJDA 3CCLT 3G4SA 1VQ8Q 2YXYA 1TUDA 3L2VA 2QQAA 4JRPA 1Q86C 3UWNA 1G83A 1AVZC 2AK5A 4QW2A 5KE2A 3EG2A 4XAXB 1Q86R 4BI3A 1UE9A 3KUFA 3LX7A 2JS2A 1RLQC 3MO8A 1VOMA 2HD0A 1VQ6Q 3R6OA 1ZA2B 3BFMA 1T0JA 3OYFA 3G4ST 4BY6B 2XK0A 1WX6A 2LT1A 5GAN6 2E3HA 2EQMA 4A4KA 2L8DA 2E3IA 2DL7A 1TXQA 5DLOA 1PSEA 4QQ6A 4JS5A 4RUGA 2LCSA 4AFUC 4EIKA 2OTJA 1S72Q 5HKCA 3VS1A 4EMGA 1BKBA 1Y96B 4X1VA 4DBHA 5FWBA 1QVPA 1JRIA 2M02A 2YLBA 3IQLA 3H0IA 2IPOB 1IB8A 4OMNA 1OQKA 2KT1A 4BI4A 4XU2A 4DBQA 2WACA 4JPBW 2KI7A 2HL5C 2OTJT 3AT1B 2PTKA 3M0SA 4QKUA 3RMQA 1UGPB 4QQDA 3P8DA 4KT0E 1K9AA 1OU9A 1RABB 2ZGWA 2A7YA 2RI5A 4HT8A 4MMKA 2YSQA 5GAMg 1PRMC 3M59A 1WXTA 1QP2A 2KVQG 2JZ2A 5GANg 3CCVA 1N6AA 3JCMW 3E9GA 2VB6A 3OY9A 3CD6Q 3REAB 1RAHB 1QLYA 4EMKB 4JRKA 2R5AA 3OMCA 4OB1B 3UT1A 1BK2A 1BBZA 4LDUA 3U23A 4MDWA 5A0LA 5FROA 1ZBJA 2YLCA 2RQWA 1W70A 4BB7A 2MWOA 1SEMA 2PU9B 4C92E 3C95A 4C92F 1QCNA 2BZ8A 4PFZA 3HP9A 2MAMA 1OYXA 2Y90A 2O9SA 3QWXX 3CCVT 4FW1A 1RAEB 2O4XB 2SRCA 2G6FX 3CCSQ 4RMOA 3CMEQ 1XQHA 2EKHA 4JRQA 1M2VB 2DL8A 4XTYA 5AT1B 2XMFA 1VQ7Q 2ZZDA 3OBYA 2DL5A 3M0QA 2CZ7B 1D3BB 5LJ3h 1WQ7A 2ZPBB 4KUDK 2AT1B 2O88A 4HVUA 5I22A 1I5OB 2OAWA 3SDZA
chains in the Genus database with same CATH topology
2DVJA 2KE9A 4OMQA 1HJDA 2VWFA 1ZUUA 1T3LA 2CT4A 2K9GA 2QDLA 1Y0MA 3VS5A 3ZL7C 1AWXA 2FRWA 2BTTA 1AWOA 1YWPA 1Z9QA 1X69A 3UA6A 1KFZA 1SHGA 2SEMA 2LJ0A 2IIMA 2J7IA 2F2WA 3H41A 2JM9A 3M0RA 1PWTA 1J3TA 1SPKA 4JJCA 2P4RA 1XOVA 1GBRA 1UTIA 4HVWA 1GFDA 3H0FA 2JMAA 2EVRA 2FPEA 4J9BA 3M0TA 4OMOA 4E6RA 4GLMA 2JTEA 1OEBA 1PNJA 1SRMA 2A36A 1AWJA 1X43A 1I0CA 3VRZA 1WLPB 1VYTA 1X2QA 4J9FA 3NGPA 1CSKA 2GTJA 1PKSA 2DRKA 2EBPA 1Z9ZA 1K0SA 2FRYA 1QKWA 2DL3A 2LX7A 3SHWA 4RTYA 2EW3A 2YUQA 2J05A 2B86A 2CUDA 2YT6A 3C0CA 4RTZA 2L3SA 2NUZA 3EG3A 1AWWA 1MV3A 5L23A 4LNPA 2YUOA 4JZ3A 1LCKA 2CSIA 2M0YA 2AKKA 2FG0A 2CDTA 2HBWA 1WDXA 1KJWA 1JQQA 1UHFA 2L0AA 3TVTA 2DF6A 4HVVA 1MUZA 3RBBB 2LP5A 1JO8A 2MOXA 2MCNA 2L2PA 3TSZA 1UDLA 2DE0X 4LE9A 4ESRA 3M0PA 1M3CA 2RQTA 1QCFA 3O5ZA 1NG2A 1YNZA 2YUNA 4AFSC 4AFZC 2CSQA 2KXDA 1NLPC 2CREA 3EHRA 4J9CA 4Z8AA 1WIEA 1ABQA 1M27C 2DX1A 1KSWA 2GTOA 2JM8A 1M30A 3ULRB 1WI7A 3SEMA 2KNBB 2EGAA 2EGCA 2KYMA 3PVLA 2X3XD 3EG0A 2JW4A 1RI9A 4D8KA 1M3BA 2ROTA 2HDAA 1M8MA 2DA9A 5FW9A 2ESWA 2ED0A 2FPFA 3UATA 1UUEA 2CH4A 4GBQA 1AZEA 1K76A 1PRLC 2HCKA 2KBTA 4QT7A 2L3PA 1GFCA 1RUWA 2EYXA 4FSSA 2LNHB 1U5SA 1SSHA 4LUDA 4F17A 1UG1A 1GL5A 1H3HA 2ABLA 4OMLA 4RTWA 3I5RA 1YN8A 1OPLA 2GNCA 2RPNA 1TG0A 1IO6A 5IXBA 1UECA 3VS4A 4RTXA 1GCQC 5EC7A 1H8KA 2K79A 1X6BA 1BU1A 3LH5A 4D8DA 1YCSB 1JEGA 2E5KA 2O2OA 4J9EA 3GBQA 4JJDA 1UFFA 2JMCA 1K0XA 2C0TA 2EYZA 3EHQA 4IIMA 1A0NB 5IHKA 2AKLA 2RNAA 2ROLA 1ZUYA 2BZXA 2J6OA 2K7AA 4K11A 4DEXA 1ZUKA 2KYBA 1X2KA 1QWFA 2O9VA 2EYYA 2EPDA 4HXJA 3VS0A 3VS6A 1QKXA 2H8HA 2GBQA 3PVQA 4F14A 2EQIA 2EGEA 2GGRA 2JS0A 5IHNA 1K4US 1AEYA 1E6HA 1I07A 2KT8A 2CT3A 1AD5A 1B07A 1PKTA 2ED1A 1ZLMA 2W10A 1MV0B 5GJWB 1NYGA 3I9QA 3EG1A 2BZYA 2RMOA 1EFNA 5GJVB 1VYVA 1UJ0A 2DM1A 2K2MA 3NMZC 3THKA 1E6GA 1E7OA 1T3SA 2KRMA 4LUEA 2M51A 4CC7A 2KRSA 2LJ1A 1KIKA 2K6DA 1AZGB 1GCQA 2JXBA 1V1CA 1GBQA 1FYNA 2YUPA 3PE0A 4M4ZA 3VRYA 1GCPA 4Y92A 1CKBA 2F2XA 2DNUA 1HD3A 2J6KA 2A28A 2DLPA 1X27A 2AZSA 2KEAA 2MIOA 2PZ1A 2DJQA 4A63B 3VS7A 1Y57A 1X6GA 4ZNXA 2LZ6B 4WCIA 1GRIA 3H0HA 2V1RA 4J9GA 1TUDA 1WYXA 2X3WD 1YWOA 2LMJA 1H92A 1ZX6A 2KROA 2DBMA 5ECAA 1G83A 2CUBA 1AVZC 2NWMA 2RQUA 2AK5A 3R6NA 1AOJA 1JU5C 3EG2A 2DYBA 2D8HA 3JV3A 4J9DA 4OMPA 1W6XA 3UA7A 1UE9A 1NEGA 2JS2A 1RLQC 4CC4B 1WFWA 3UF4A 1UGVA 3VS2A 2RF0A 1U06A 1T0JA 2VKNA 3RNJA 1SHFA 2FEIA 2KXCA 1BB9A 1WX6A 1CKAA 1U3OA 2RQRA 4AG2C 2D0NA 1I1JA 3VS3A 2A08A 2DL7A 4R0KA 1T0HA 4JJBA 3EGUA 1OOTA 1UHCA 4RUGA 4HCKA 1JXMA 1JXOA 2LCSA 4AFUC 4EIKA 1M3AA 2JT4A 3VS1A 2F2VA 2OJ2A 2KR3A 3FJ5A 4KRTA 3CQTA 1FMKA 2J6FA 1PHTA 4ORZA 2D8JA 4RTTA 4X1VA 5IXFA 2YDLA 5FWBA 2CH4W 3IQLA 3H0IA 2L3QA 4OMNA 1UJYA 2ECZA 1VA7A 5IH2A 4Z88A 2KT1A 4RTVA 4JPBW 2LQNA 4LN2A 2DRMA 3A98A 4RTUA 2PTKA 2W0ZA 3M0SA 3QWYA 5FWCA 4OMMA 2DILA 1NLOC 1ARKA 1K9AA 1K1ZA 1ZSGA 4AFQC 1G2BA 1OPKA 2YSQA 1W1FA 1PRMC 1NEBA 1WXTA 2HEQA 2RN8A 2VVKA 2K3BA 4CC2A 3REAB 4Z89A 1QLYA 2DL4A 1OV3A 2I0NA 2EYWA 2AZVA 2KGTA 1BK2A 5HCKA 1NM7A 1TUCA 1BBZA 3U23A 4CC3A 4AG1C 3M0UA 1ABOA 1S1NA 1YP5A 1ZBJA 2PNIA 2RQWA 1W70A 1SEMA 2HSPA 1HSQA 2BZ8A 2FO0A 3I5SA 4JZ4A 5I11A 2O9SA 3QWXX 2ENMA 2OI3A 2RQVA 2C0OA 2SRCA 2G6FX 2LQWA 2DMOA 1WXUA 2A37A 1QWEA 3REBB 5IHIA 3I35A 2D1XA 2V1QA 2EKHA 4J9IA 2DL8A 2XMFA 3KFVA 2GQIA 2KRNA 2DL5A 3M0QA 4J9HA 1SRLA 1VYUA 2C0IA 3TSWA 1WA7A 3NHNA 1N5ZA 4HVUA 4IIOA 5I22A 2DBKA 1B3QA 1NYFA 2J06A 2OAWA 2O88A 3NPFA 2FPDA 1RLPC 2O31A 4DEYA 4F16A 1WXBA 2LJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DVJ A;  2KE9 A;  4OMQ A;  1HJD A;  2VWF A;  1ZUU A;  1T3L A;  2CT4 A;  2K9G A;  2QDL A;  1Y0M A;  3VS5 A;  3ZL7 C;  1AWX A;  2FRW A;  2BTT A;  1AWO A;  1YWP A;  1Z9Q A;  1X69 A;  3UA6 A;  1KFZ A;  1SHG A;  2SEM A;  2LJ0 A;  2IIM A;  2J7I A;  2F2W A;  3H41 A;  2JM9 A;  3M0R A;  1PWT A;  1J3T A;  1SPK A;  4JJC A;  2P4R A;  1XOV A;  1GBR A;  1UTI A;  4HVW A;  1GFD A;  3H0F A;  2JMA A;  2EVR A;  2FPE A;  4J9B A;  3M0T A;  4OMO A;  4E6R A;  4GLM A;  2JTE A;  1OEB A;  1PNJ A;  1SRM A;  2A36 A;  1AWJ A;  1X43 A;  1I0C A;  3VRZ A;  1WLP B;  1VYT A;  1X2Q A;  4J9F A;  3NGP A;  1CSK A;  2GTJ A;  1PKS A;  2DRK A;  2EBP A;  1Z9Z A;  1K0S A;  2FRY A;  1QKW A;  2DL3 A;  2LX7 A;  3SHW A;  4RTY A;  2EW3 A;  2YUQ A;  2J05 A;  2B86 A;  2CUD A;  2YT6 A;  3C0C A;  4RTZ A;  2L3S A;  2NUZ A;  3EG3 A;  1AWW A;  1MV3 A;  5L23 A;  4LNP A;  2YUO A;  4JZ3 A;  1LCK A;  2CSI A;  2M0Y A;  2AKK A;  2FG0 A;  2CDT A;  2HBW A;  1WDX A;  1KJW A;  1JQQ A;  1UHF A;  2L0A A;  3TVT A;  2DF6 A;  4HVV A;  1MUZ A;  3RBB B;  2LP5 A;  1JO8 A;  2MOX A;  2MCN A;  2L2P A;  3TSZ A;  1UDL A;  2DE0 X;  4LE9 A;  4ESR A;  3M0P A;  1M3C A;  2RQT A;  1QCF A;  3O5Z A;  1NG2 A;  1YNZ A;  2YUN A;  4AFS C;  4AFZ C;  2CSQ A;  2KXD A;  1NLP C;  2CRE A;  3EHR A;  4J9C A;  4Z8A A;  1WIE A;  1ABQ A;  1M27 C;  2DX1 A;  1KSW A;  2GTO A;  2JM8 A;  1M30 A;  3ULR B;  1WI7 A;  3SEM A;  2KNB B;  2EGA A;  2EGC A;  2KYM A;  3PVL A;  2X3X D;  3EG0 A;  2JW4 A;  1RI9 A;  4D8K A;  1M3B A;  2ROT A;  2HDA A;  1M8M A;  2DA9 A;  5FW9 A;  2ESW A;  2ED0 A;  2FPF A;  3UAT A;  1UUE A;  2CH4 A;  4GBQ A;  1AZE A;  1K76 A;  1PRL C;  2HCK A;  2KBT A;  4QT7 A;  2L3P A;  1GFC A;  1RUW A;  2EYX A;  4FSS A;  2LNH B;  1U5S A;  1SSH A;  4LUD A;  4F17 A;  1UG1 A;  1GL5 A;  1H3H A;  2ABL A;  4OML A;  4RTW A;  3I5R A;  1YN8 A;  1OPL A;  2GNC A;  2RPN A;  1TG0 A;  1IO6 A;  5IXB A;  1UEC A;  3VS4 A;  4RTX A;  1GCQ C;  5EC7 A;  1H8K A;  2K79 A;  1X6B A;  1BU1 A;  3LH5 A;  4D8D A;  1YCS B;  1JEG A;  2E5K A;  2O2O A;  4J9E A;  3GBQ A;  4JJD A;  1UFF A;  2JMC A;  1K0X A;  2C0T A;  2EYZ A;  3EHQ A;  4IIM A;  1A0N B;  5IHK A;  2AKL A;  2RNA A;  2ROL A;  1ZUY A;  2BZX A;  2J6O A;  2K7A A;  4K11 A;  4DEX A;  1ZUK A;  2KYB A;  1X2K A;  1QWF A;  2O9V A;  2EYY A;  2EPD A;  4HXJ A;  3VS0 A;  3VS6 A;  1QKX A;  2H8H A;  2GBQ A;  3PVQ A;  4F14 A;  2EQI A;  2EGE A;  2GGR A;  2JS0 A;  5IHN A;  1K4U S;  1AEY A;  1E6H A;  1I07 A;  2KT8 A;  2CT3 A;  1AD5 A;  1B07 A;  1PKT A;  2ED1 A;  1ZLM A;  2W10 A;  1MV0 B;  5GJW B;  1NYG A;  3I9Q A;  3EG1 A;  2BZY A;  2RMO A;  1EFN A;  5GJV B;  1VYV A;  1UJ0 A;  2DM1 A;  2K2M A;  3NMZ C;  3THK A;  1E6G A;  1E7O A;  1T3S A;  2KRM A;  4LUE A;  2M51 A;  4CC7 A;  2KRS A;  2LJ1 A;  1KIK A;  2K6D A;  1AZG B;  1GCQ A;  2JXB A;  1V1C A;  1GBQ A;  1FYN A;  2YUP A;  3PE0 A;  4M4Z A;  3VRY A;  1GCP A;  4Y92 A;  1CKB A;  2F2X A;  2DNU A;  1HD3 A;  2J6K A;  2A28 A;  2DLP A;  1X27 A;  2AZS A;  2KEA A;  2MIO A;  2PZ1 A;  2DJQ A;  4A63 B;  3VS7 A;  1Y57 A;  1X6G A;  4ZNX A;  2LZ6 B;  4WCI A;  1GRI A;  3H0H A;  2V1R A;  4J9G A;  1TUD A;  1WYX A;  2X3W D;  1YWO A;  2LMJ A;  1H92 A;  1ZX6 A;  2KRO A;  2DBM A;  5ECA A;  1G83 A;  2CUB A;  1AVZ C;  2NWM A;  2RQU A;  2AK5 A;  3R6N A;  1AOJ A;  1JU5 C;  3EG2 A;  2DYB A;  2D8H A;  3JV3 A;  4J9D A;  4OMP A;  1W6X A;  3UA7 A;  1UE9 A;  1NEG A;  2JS2 A;  1RLQ C;  4CC4 B;  1WFW A;  3UF4 A;  1UGV A;  3VS2 A;  2RF0 A;  1U06 A;  1T0J A;  2VKN A;  3RNJ A;  1SHF A;  2FEI A;  2KXC A;  1BB9 A;  1WX6 A;  1CKA A;  1U3O A;  2RQR A;  4AG2 C;  2D0N A;  1I1J A;  3VS3 A;  2A08 A;  2DL7 A;  4R0K A;  1T0H A;  4JJB A;  3EGU A;  1OOT A;  1UHC A;  4RUG A;  4HCK A;  1JXM A;  1JXO A;  2LCS A;  4AFU C;  4EIK A;  1M3A A;  2JT4 A;  3VS1 A;  2F2V A;  2OJ2 A;  2KR3 A;  3FJ5 A;  4KRT A;  3CQT A;  1FMK A;  2J6F A;  1PHT A;  4ORZ A;  2D8J A;  4RTT A;  4X1V A;  5IXF A;  2YDL A;  5FWB A;  2CH4 W;  3IQL A;  3H0I A;  2L3Q A;  4OMN A;  1UJY A;  2ECZ A;  1VA7 A;  5IH2 A;  4Z88 A;  2KT1 A;  4RTV A;  4JPB W;  2LQN A;  4LN2 A;  2DRM A;  3A98 A;  4RTU A;  2PTK A;  2W0Z A;  3M0S A;  3QWY A;  5FWC A;  4OMM A;  2DIL A;  1NLO C;  1ARK A;  1K9A A;  1K1Z A;  1ZSG A;  4AFQ C;  1G2B A;  1OPK A;  2YSQ A;  1W1F A;  1PRM C;  1NEB A;  1WXT A;  2HEQ A;  2RN8 A;  2VVK A;  2K3B A;  4CC2 A;  3REA B;  4Z89 A;  1QLY A;  2DL4 A;  1OV3 A;  2I0N A;  2EYW A;  2AZV A;  2KGT A;  1BK2 A;  5HCK A;  1NM7 A;  1TUC A;  1BBZ A;  3U23 A;  4CC3 A;  4AG1 C;  3M0U A;  1ABO A;  1S1N A;  1YP5 A;  1ZBJ A;  2PNI A;  2RQW A;  1W70 A;  1SEM A;  2HSP A;  1HSQ A;  2BZ8 A;  2FO0 A;  3I5S A;  4JZ4 A;  5I11 A;  2O9S A;  3QWX X;  2ENM A;  2OI3 A;  2RQV A;  2C0O A;  2SRC A;  2G6F X;  2LQW A;  2DMO A;  1WXU A;  2A37 A;  1QWE A;  3REB B;  5IHI A;  3I35 A;  2D1X A;  2V1Q A;  2EKH A;  4J9I A;  2DL8 A;  2XMF A;  3KFV A;  2GQI A;  2KRN A;  2DL5 A;  3M0Q A;  4J9H A;  1SRL A;  1VYU A;  2C0I A;  3TSW A;  1WA7 A;  3NHN A;  1N5Z A;  4HVU A;  4IIO A;  5I22 A;  2DBK A;  1B3Q A;  1NYF A;  2J06 A;  2OAW A;  2O88 A;  3NPF A;  2FPD A;  1RLP C;  2O31 A;  4DEY A;  4F16 A;  1WXB A;  2LJ3 A; 
#chains in the Genus database with same CATH topology
 4PJJ A;  2LTO A;  2KE9 A;  1NJI R;  3TEE A;  3T9N A;  3VV0 A;  3V8L A;  1N9S A;  3CCQ Q;  2K9G A;  4C0D B;  3VS5 A;  1Y0M A;  1TTH B;  2FRW A;  2BTT A;  5GAM f;  1Z9Q A;  3EG9 B;  1X69 A;  3UA6 A;  4FT4 A;  2LNV A;  4HCC A;  4J83 A;  4XTW A;  5J39 A;  4HCB A;  1FWZ A;  1J3T A;  1MMA A;  5FU6 C;  1SPK A;  4M78 D;  1YFN A;  2P4R A;  3CC7 A;  1GBR A;  2WSE E;  4JRI A;  4EDU A;  2RHX A;  3CCU Q;  2DXT A;  2RHU A;  4M78 B;  2DTO A;  2K2V A;  4PJO A;  1SRM A;  1AWJ A;  1X43 A;  1I0C A;  2YHT A;  4ZGE B;  2CKK A;  2L5Q A;  3JCM h;  4E2F B;  2X4J A;  4LDV A;  2JVV A;  3SWN A;  2ZPG B;  2ATC B;  3FDR A;  3OS5 A;  3CCJ Q;  1Z9Z A;  1F1B B;  4BY6 C;  4CI0 C;  3CC7 T;  3ER0 A;  1QKW A;  2LX7 A;  3E19 A;  2YT6 A;  3C0C A;  1K9M U;  2L3S A;  4C92 G;  4E7J A;  1UGQ B;  5L23 A;  2YUO A;  1WZO A;  4JZ3 A;  5A0G A;  3JB9 H;  4XQ3 A;  2CSI A;  3LWH A;  2M0Y A;  1C0M A;  3PMI A;  3CCL Q;  1KJW A;  2EAY A;  2DF6 A;  2XDB A;  1K9M C;  3RBB B;  2LP5 A;  1JO8 A;  5A2Q E;  2DE0 X;  4MDX A;  3M0P A;  4A4G A;  3QBY A;  2E6N A;  1YNZ A;  1K9M R;  2RJF A;  5LJ3 d;  2CP3 A;  3M56 A;  4VUB A;  5A0D A;  5GAM e;  5KH6 A;  2CS7 A;  5GAN e;  2KY9 A;  2CP5 A;  2ZPE B;  3EHR A;  4JJN K;  3C94 A;  2DX1 A;  1VQ6 A;  2COZ A;  4FCY A;  4J6Y A;  1M30 A;  3GNG A;  2ZPI B;  3G4S Q;  4JLG A;  2KNB B;  2EGA A;  2KYM A;  2X3X D;  6AT1 B;  5LL6 S;  2DPP B;  2LQK A;  1RI9 A;  3M4Y A;  2DA9 A;  1K73 U;  2FPF A;  3CPF A;  3QJY A;  1V29 B;  1K76 A;  4EMK C;  1GXI E;  2KBT A;  3RKW A;  1XTD A;  3MEV A;  3ZFJ A;  3G71 Q;  2H3J A;  1VQ6 T;  1SSH A;  3FJP A;  4LUD A;  4LXC A;  1K73 C;  4PFP A;  3OW2 A;  2GFU A;  3NTH A;  1UEC A;  3VKI A;  1BCM A;  2E10 A;  1IHW A;  1K73 R;  4JS4 A;  3EH1 A;  4B9X A;  4R55 A;  1O9S A;  1BI2 A;  3CCR Q;  3JCM b;  2JMC A;  1K0X A;  2EJG A;  2C0T A;  2FZK B;  4IIM A;  2ZPH B;  5KE3 A;  4BE2 A;  3X26 B;  2AKL A;  2RK1 A;  2X4W A;  3EFO B;  4K11 A;  2K7A A;  4DEX A;  2DER A;  5GAO p;  1XJW B;  2O9V A;  1RAI B;  3A1P A;  2CP6 A;  1WHG A;  1QKX A;  3HTR A;  3CD6 A;  5KYW A;  3VYH B;  5CK9 A;  1VIE A;  2QTX A;  3QO3 A;  3OYJ A;  4F04 B;  1VQ9 Q;  4OGC A;  4C0D C;  1B07 A;  1M90 U;  5KCO A;  1MV0 B;  1NYG A;  2DK3 A;  3I9Q A;  5HY6 A;  2RMO A;  3L2Z A;  4KBM B;  1VYV A;  4E7S A;  1JBM A;  4WTO B;  2ZAE A;  4IUV A;  4XTZ A;  2VUB A;  1M9S A;  1OZ3 A;  1M90 C;  4C0F A;  3CBP A;  2K6D A;  3CD6 T;  1GCQ A;  4X9C A;  1IGU A;  1M90 R;  1V1C A;  1FYN A;  1VQ7 A;  4FYV B;  2RA2 A;  1GCP A;  2XU8 A;  1U1S A;  2M16 A;  2DNU A;  2AZS A;  1FMW A;  2MIO A;  4XTX A;  2BE9 B;  4M78 E;  2RO0 A;  4FYW B;  3H8Z A;  3EGD B;  4ANJ A;  3GIB A;  2X3W D;  3PTA A;  3MHX A;  3RKX A;  3RER A;  1H92 A;  5GAO r;  3CEY A;  3SFM A;  2NWM A;  2RQU A;  1VQN T;  3JV3 A;  3JB9 J;  3J81 E;  1VQ7 T;  2DXC A;  2NUP A;  1WHH A;  2FVU A;  4CC4 B;  1WFW A;  3MEU A;  4PJO E;  3UF4 A;  4PJO F;  5I21 A;  2QK0 A;  1KD1 U;  1QVG P;  1U06 A;  3QKJ A;  1OI1 A;  3OW2 P;  3PIO A;  1ZHI A;  2JTM A;  1CKA A;  3MKD A;  4AG2 C;  2D0N A;  2QYZ A;  1I1J A;  2BE7 D;  4BE1 A;  2A08 A;  3ZBD A;  1KD1 C;  4C92 D;  2BUD A;  1T0H A;  1PG5 B;  4C8Q A;  1UHC A;  2V8I A;  1JXO A;  1KD1 R;  1M3A A;  4ZN1 A;  2JT4 A;  3JCM P;  1KQ2 A;  4M7D A;  2XI9 A;  4KRT A;  4KH0 B;  3LH0 A;  2J6F A;  1DJ7 B;  4C92 B;  3C12 A;  5IXF A;  2VAS A;  4PNO A;  4N4H A;  1MMG A;  4O5V A;  5CKB A;  3V7C A;  2QDY B;  2CP7 A;  3X25 B;  2KSS A;  1VA7 A;  5IH2 A;  2F5T X;  3CC7 Q;  1TWB A;  5CAI A;  1AHJ B;  5FLX E;  1QVG S;  4Y28 E;  4LN2 A;  2DRM A;  2DJZ A;  4L59 A;  2W0Z A;  5FWC A;  2X51 A;  3UDC A;  2FHD A;  2P4T A;  5L8R E;  4PL6 A;  4AFQ C;  3JCM J;  1W1F A;  1OZ2 A;  3TQ7 P;  3OS1 A;  1B7T A;  5CQX A;  5GAO m;  2DZC A;  4XU0 A;  2VVK A;  2K3B A;  3H9N A;  2LDM A;  3J80 E;  1LPL A;  1SF9 A;  2AZV A;  5HCK A;  2FZG B;  2JNG A;  4BD3 A;  3OS2 A;  1ABO A;  2YRV A;  5LJ5 d;  3TCJ A;  3E9F A;  4FT2 A;  1D09 B;  3EFS A;  1RAA B;  3I5S A;  4JZ4 A;  1LNX A;  2ENM A;  2OI3 A;  2C0O A;  4A4H A;  2A37 A;  1QWE A;  5IHI A;  4PJO G;  3V7R A;  3LW5 E;  2M9U A;  2EQU A;  2BKD N;  3EAE A;  2V8K A;  4J9H A;  4IKF A;  1HXD A;  2M1H A;  1Q7Y U;  1H64 1;  1YJW A;  5FU7 B;  3VU3 C;  3G71 A;  4P5N A;  2I2L A;  2DBK A;  1B3Q A;  2GF7 A;  2HKQ B;  2FPD A;  1RLP C;  2KMT A;  2O31 A;  1VUB A;  2L3Q A;  4N4I A;  2DVJ A;  3GP8 A;  3TU4 K;  2HNI A;  1Q7Y C;  3OSS C;  1ZUU A;  1T3L A;  5KYY A;  2CT4 A;  5C0M A;  3OB9 A;  1Q7Y R;  2QDL A;  1YIJ A;  1AWX A;  2RB6 A;  1NPP A;  3CCR A;  5I2M A;  1YJW T;  2P0Q A;  4ZGD B;  3JB9 G;  2SEM A;  2E12 A;  4UC4 A;  3G71 T;  4EPC A;  1X6O A;  1HYO A;  2JUF A;  3S3N A;  2D9T A;  2JM9 A;  3M0R A;  1PWT A;  3ZEH A;  1G3S A;  1R0C B;  4JJC A;  1XOV A;  1UTI A;  4NS5 A;  1GFD A;  4PJN A;  1SSF A;  3DB4 A;  4XK8 E;  2DAQ A;  1WGS A;  2EIF A;  3M0T A;  1VQ9 A;  1WJS A;  4E6R A;  1YIJ T;  1TH7 A;  1PNJ A;  3CCR T;  4PK4 A;  1D0Z A;  2KQW A;  2B8A A;  3VRZ A;  3JCM Q;  3FRN A;  1WLP B;  1YJ9 A;  4IUU A;  1X2Q A;  3TRE A;  1CSK A;  1OU8 A;  1M5Q 1;  2WSF E;  5IAY A;  4C5E A;  4BDZ A;  3NTI A;  3RDV A;  1I4K 1;  4XTV A;  4A4E A;  3A8H B;  1VQ9 T;  4RTZ A;  1IZ6 A;  3QXE B;  3OQ5 A;  2FB7 A;  1MV3 A;  3HFO A;  1OX8 A;  5LJ5 g;  1YJ9 T;  2HBW A;  1JQQ A;  1UHF A;  2L0A A;  4M77 G;  4C92 C;  1MUZ A;  2QTV A;  2MCN A;  3CMA A;  3TSZ A;  2RQT A;  2Z0W A;  4E7Z A;  3O5Z A;  2XD0 A;  4KGX B;  4C8Q F;  4X34 A;  2PVD B;  5KYX B;  5CKE A;  1VQN Q;  1IXD A;  2YUN A;  4LD6 A;  4M7D E;  3G6E Q;  4M7D F;  2CSQ A;  2FZC B;  3SB2 A;  2KXD A;  1NLP C;  2KAF A;  4J9C A;  1AT1 B;  1W4S A;  1WIE A;  2DD5 A;  2L89 A;  1M27 C;  1KSW A;  2JJ9 A;  4PLI A;  3N5B B;  3CXC P;  3PFS A;  3M5A A;  1U1T A;  4AT1 B;  1WJR A;  3ULR B;  3GPL A;  1VQK A;  3CBM A;  2VYT A;  1TUG B;  2EGC A;  2VC8 A;  3ASK A;  4QVD A;  1YJN A;  3CMA T;  3OYI A;  1QVF S;  3URG A;  2JW4 A;  5CO7 A;  4ME7 A;  3RKY A;  2HDA A;  3HRT A;  1UUE A;  4IUQ A;  1N9R A;  4GBQ A;  3V8K A;  5CCA A;  4FM4 B;  1PRL C;  2DYI A;  3HSB A;  4M75 A;  1GFC A;  1RUW A;  3QZ5 B;  5GAN f;  4XTU A;  2QQB A;  1PM3 A;  1VQL Q;  1UG1 A;  1BCO A;  1GL5 A;  5CIU A;  1VQK T;  1YN8 A;  2GNC A;  4V2S A;  4A53 A;  3A8O B;  5IXB A;  1YJN T;  3MP6 A;  2R57 A;  2RK2 A;  2JTF A;  2RH2 A;  1N8R U;  2VXE A;  5GAN 2;  5D7U A;  1H8K A;  2XID A;  3PT9 A;  3A8M B;  1RI0 A;  5LJ5 f;  4XU1 A;  3LH5 A;  3CXC S;  3M57 A;  4J9E A;  2A0F B;  2FL7 A;  4JJD A;  1MMD A;  3PGG A;  3OYA A;  4OVA A;  1N8R C;  3MP1 A;  1A0N B;  2CZ0 B;  5FU7 C;  1D1A A;  3S3M A;  1ZUY A;  1KQS A;  4PJO D;  1X2K A;  2QA4 Q;  2DEQ A;  4LDY A;  3PVQ A;  2EQI A;  3CCE T;  4WF2 A;  4OGE A;  1K4U S;  2AIR B;  4PJO B;  1AEY A;  1I07 A;  3RMS A;  4RG2 A;  2BIV A;  5DLQ E;  3H6Z A;  1ZLM A;  2W10 A;  4N0A C;  1K8A U;  3EG1 A;  3RR6 A;  3SWN B;  1PC0 A;  2BZY A;  3V8J A;  2OTL Q;  2HQX A;  1EFN A;  2AHJ B;  4MZM A;  4C8Q G;  5HK0 A;  1E6G A;  5GAM j;  3PNW C;  1VQM A;  2M51 A;  5GAN j;  1M4Z A;  4M7D G;  2KRS A;  2LJ1 A;  1KIK A;  2E70 A;  2OAU A;  1K8A C;  1AZG B;  4L5G A;  3JB9 I;  2CZ6 B;  2F2X A;  4Y92 A;  4IUP A;  1HD3 A;  2A28 A;  2DLP A;  1SG5 A;  2EYQ A;  2CGH A;  3G1J A;  4E7L A;  3VS7 A;  4BE0 A;  4ZNX A;  1GRI A;  2V1R A;  4J9G A;  2M0O A;  3M4G A;  3GNF B;  2IVW A;  1X75 C;  2LMJ A;  4ZGJ B;  2KRO A;  4F7U A;  3OYE A;  1VQM T;  2XG8 D;  5ECA A;  3J7A F;  2EQK A;  1WHJ A;  1IGQ A;  3D7S B;  2D8H A;  4J9D A;  4OMP A;  5LJ5 e;  1W6X A;  1UEB A;  3L42 A;  3UA7 A;  1X01 A;  1NZ9 A;  3INZ A;  4M7A A;  1UGV A;  3DLM A;  3WVE B;  5KYN A;  1ZSZ A;  3VS2 A;  2ZPF B;  4BDY A;  4GY5 A;  2G3R A;  2RF0 A;  3L2W A;  1YJW Q;  3WXM B;  4FW2 A;  4B9W A;  4TVR A;  4E7K A;  2VKN A;  3RNJ A;  2E64 A;  3OYL A;  4OP0 A;  1KG1 A;  1QVG A;  2KXC A;  4Z02 A;  1U3O A;  4Q5W A;  1HK9 A;  1D1C A;  1Y7X A;  3BDL A;  3EGU A;  3FB9 A;  3OA6 A;  2DVE A;  2K3Y A;  4M77 A;  2GCX A;  4OF1 A;  1YIJ Q;  2F2V A;  4DOV A;  2HBP A;  2KR3 A;  2V8J A;  3L2Q A;  4ORZ A;  3JCM d;  1KQS P;  1MGQ A;  3LLR A;  2F5K A;  5FRN A;  4AMC A;  1UJY A;  2QAS A;  5GAN 3;  2ECZ A;  1I8F A;  1BI3 A;  1V76 A;  1TOV A;  2RHY A;  2WSC E;  4NOY A;  4IUT A;  2MK5 A;  4C0Z A;  2JOY A;  3JCM c;  1G3W A;  5I2S A;  3A98 A;  4RTU A;  1NPR A;  3HL8 A;  4NL3 A;  3QWY A;  4OMM A;  1YHQ A;  1R8O B;  3QPH A;  4R56 A;  4KUL A;  1K1Z A;  4DOW A;  1YJ9 Q;  3LYI A;  1NEB A;  4FYY B;  5KYW B;  3EGX A;  1MNE A;  3BDU A;  2RN8 A;  1TU0 B;  4E7I A;  4CC2 A;  3KXT A;  4FU6 A;  2DL4 A;  4Z89 A;  2PQW A;  2O01 E;  1VQN A;  3HRS A;  1KQS S;  9ATC B;  2X4X A;  2KGT A;  3G6E A;  2EJF A;  1NM7 A;  4M75 F;  1Q95 G;  4AG1 C;  3M0U A;  3P8H A;  5LJ3 g;  1YHQ T;  4OB0 B;  1YP5 A;  2PNI A;  1OX9 A;  2LX9 A;  1QW1 A;  5GAO q;  1VQP Q;  4M78 C;  2HSP A;  5GMK e;  1HSQ A;  5GAM h;  2FO0 A;  4HKE A;  2DTH A;  3OYD A;  3CPW S;  2C06 A;  3HPW A;  2KK4 A;  2DMO A;  1WXU A;  1MMN A;  3CMA Q;  3REB B;  3I35 A;  2D1X A;  4J9I A;  3KFV A;  5CKF A;  2KRN A;  3G6E T;  3G7Z A;  1PD0 A;  4PJO C;  4LDX A;  1VYU A;  3JAM E;  3TSW A;  1WA7 A;  5GMK m;  3NHN A;  1VQL A;  1N5Z A;  2J06 A;  1NYF A;  3NPF A;  4PKC C;  1BIB A;  4F16 A;  3SWN C;  1VQK Q;  4OMQ A;  1HJD A;  2VWF A;  2NUP B;  1YJN Q;  2NUT A;  1LVK A;  3VYG A;  3CCM A;  1BI1 A;  1AWO A;  4OB3 B;  4C8Q D;  1KFZ A;  2LJ0 A;  4DQ2 A;  2XIC A;  5KYU A;  3H41 A;  3OYY A;  1VQL T;  4M7D D;  3MJX A;  1VQO A;  3JCM g;  2QA4 A;  3AHU A;  2VGM A;  5FRM A;  3MEA A;  2EWN A;  1OUL A;  3JB9 F;  4C8Q B;  2RJC A;  1NE8 A;  1VIF A;  5LJ3 f;  2JMA A;  1SKU B;  4M7D B;  3MEW A;  1KC8 U;  2FPE A;  3FIF A;  3CCM T;  2LT4 A;  3CCE Q;  4QVZ A;  2MF2 A;  4C5I A;  2A36 A;  2QQ9 A;  3QYG B;  3QZ9 B;  2OTL A;  3OMG A;  4ELY C;  3VUB A;  4HT9 A;  4J9F A;  1KC8 C;  1VQO T;  8ATC B;  5D6Y A;  2QA4 T;  4F7U F;  4O6J A;  2GTJ A;  1B34 A;  3BY7 A;  1BIA A;  1D0Y A;  2EBP A;  1KC8 R;  2P84 A;  4M75 G;  3QYH B;  4D6W A;  1WJQ A;  3SHW A;  4RTY A;  2J05 A;  3DKM A;  2B86 A;  4M7A F;  4KGV B;  2HQE A;  2NUZ A;  2XDP A;  2LCC A;  1AWW A;  4LNP A;  5GAO l;  1LCK A;  1LOJ A;  4PFO A;  2COW A;  2JN0 A;  3VUZ A;  4HA8 A;  1QVF A;  1JJ2 S;  2OTL T;  3DLL A;  3TVT A;  4HVV A;  3RIR A;  2CYZ B;  2MOX A;  2L2P A;  2DIQ A;  4LE9 A;  4ESR A;  4RCB A;  1VQM Q;  3WVD B;  5HK3 A;  3L2R A;  1NG2 A;  3BE3 A;  3OYB A;  4M77 E;  4M77 F;  2DKG A;  1VQ5 A;  4AFS C;  4AFZ C;  2QG9 B;  2EJ9 A;  3JCM f;  2DEU A;  1YCY A;  3X20 B;  5LJ3 j;  2CRE A;  1MHN A;  3QJ6 A;  5FU6 B;  3LGL A;  2JM8 A;  2GTO A;  3PIP A;  1QQJ A;  1RL2 A;  1WI7 A;  1WQW A;  2QGF B;  4C0G A;  4A54 A;  1KHI A;  3CXC A;  5LJ3 e;  3EG0 A;  1MND A;  3S3O A;  1NBE B;  4Y91 A;  3LWI A;  4FIB A;  4D8K A;  1M3B A;  2DZ9 A;  1M8M A;  5FW9 A;  2ESW A;  1VQ5 T;  2HZY A;  2RD1 A;  3HKS A;  1AZE A;  1RAG B;  4QT7 A;  4N0A A;  2RI3 A;  2L3P A;  2LNH B;  1W2B P;  1H3H A;  2P0K A;  2ABL A;  4OML A;  1OPL A;  1Y96 A;  1TG0 A;  5KYY B;  4FL6 A;  1G8X A;  2E4H A;  4BUG A;  1ZBX A;  2RHI A;  1Y71 A;  3RUX A;  1M1K U;  2HAX A;  1GCQ C;  3SD4 A;  3A8L B;  2K79 A;  3ME9 A;  1ACM B;  2YWW A;  2DIG A;  1C1A A;  3JSC A;  4D8D A;  1YCS B;  1QP3 A;  2E5K A;  1I5L A;  4F7U G;  1M1K C;  4B6M A;  5IHK A;  2RI2 A;  4C5H A;  1XNI A;  4ZN3 A;  3VJP A;  2RNA A;  2BZX A;  2J6O A;  5GAN 4;  1D1B A;  3CC4 A;  3FEO A;  2KYB A;  2VV5 A;  1QWF A;  1M1K R;  2QXF A;  2EYY A;  2EPD A;  4II1 A;  3VS0 A;  3VS6 A;  4M7A G;  2X9H A;  4J6W A;  1ZQ1 A;  2F1L A;  2H8H A;  1RAD B;  2GBQ A;  3M54 A;  1KHC A;  2EGE A;  2A3L A;  3OS0 A;  5IHN A;  3M9Q A;  1WHM A;  1YI2 A;  4A4F A;  1E6H A;  1M1G A;  3JCM e;  2CT3 A;  1W2B S;  1AD5 A;  2OX7 A;  1PKT A;  4EMK A;  3RES A;  2E6Z A;  1QVF P;  2VGN A;  1YHQ Q;  1IHV A;  4FYX B;  2L3R A;  4QVC A;  1VQP A;  3OYK A;  2EQJ A;  5GJV B;  3QG1 A;  1UJ0 A;  2DM1 A;  3NMZ C;  3CC4 T;  1YIT A;  1M2O A;  2KRM A;  4HCZ A;  4LUE A;  3S6W A;  4L6V 5;  1KK7 A;  4C8Q C;  2JXB A;  2YUP A;  1GBQ A;  2O4X A;  4C8Q E;  5M9O A;  3OYM A;  1Q81 U;  3VRY A;  1YI2 T;  1WHL A;  5KYX A;  4M7D C;  2J6K A;  1G3Y A;  1X27 A;  2PVG B;  1M2V A;  2KEA A;  4A63 B;  1Y57 A;  1X6G A;  4NL2 A;  3GF5 A;  1D0X A;  2LZ6 B;  1QCO A;  4WCI A;  4DBR A;  3H0H A;  8AT1 B;  1D3B A;  1VQP T;  3I55 A;  3L1A A;  1WYX A;  2DO3 A;  1Q81 C;  1YIT T;  1YWO A;  3CC2 A;  1ZX6 A;  2DBM A;  2FYK A;  2CUB A;  1Q81 R;  1NJI U;  2MYS A;  4XU3 A;  3R6N A;  1AOJ A;  1JU5 C;  2DYB A;  1RAF B;  3X28 B;  2QAZ A;  1NEG A;  1BI0 A;  2DD4 A;  3DB3 A;  4LDW A;  1NJI C;  2DXB A;  1PCX A;  3EG9 A;  3MCA B;  2CZ1 B;  3I55 T;  1SHF A;  4M75 D;  3QHS A;  3M58 A;  2FEI A;  2V26 A;  1BB9 A;  2PUK B;  3CC2 T;  2RQR A;  3I56 A;  3VS3 A;  2QEX A;  4R0K A;  3HFN A;  4JJB A;  4M75 B;  1VQ4 A;  1OOT A;  1BYM A;  5J3B A;  3CCE A;  4HCK A;  1JXM A;  3CCM Q;  3P8B B;  2OJ2 A;  3FJ5 A;  2E5Q A;  3CQT A;  1FMK A;  2IG0 A;  1PHT A;  2E65 A;  2D8J A;  4RTT A;  4M78 A;  2HL3 A;  2RJE A;  2YDL A;  2CH4 W;  1VQO Q;  5AYF A;  3A5Z B;  2MWP A;  3I56 T;  4BAC A;  1N8R R;  3FLG A;  2QEX T;  2YRD A;  3GLX A;  3QUI A;  4Z88 A;  2NYS A;  5GAN 7;  1QMC A;  4RTV A;  5EG2 A;  2VXF A;  1VQ4 T;  2LQN A;  2GQV A;  4YTL A;  4J7F A;  3QDF A;  2DIL A;  1NLO C;  2H3E B;  1EZZ B;  3CPW A;  1ARK A;  2HQH A;  2PVO B;  4ZTJ A;  2XDD A;  2XKO C;  1ZSG A;  3CBO A;  1G2B A;  2K5F A;  1OPK A;  5GAN 5;  2HEQ A;  4JUV A;  1UGR B;  1OV3 A;  1PD1 A;  3A8G B;  2I0N A;  2EYW A;  3E2U A;  2HMA A;  3JB9 D;  1TUC A;  4DA4 A;  4N4G A;  4CC3 A;  1IRE B;  1S1N A;  1K8A R;  3O8V A;  1G5V A;  5CVI A;  2K5L A;  1VQ8 A;  2R58 A;  2P0P A;  5LJ5 j;  1N27 A;  1EIF A;  2QI2 A;  5I11 A;  3PMT A;  2RQV A;  4CRI A;  2LQW A;  2V1Q A;  2RHZ A;  2GQI A;  4KH1 B;  1VQ5 Q;  1SRL A;  4QQG A;  2YRC A;  5D6W A;  3QDR B;  7AT1 B;  5D6X A;  2C0I A;  4RG8 A;  2NLU A;  4X9D A;  1VQ8 T;  3NTK A;  4M7A D;  2R5M A;  4IIO A;  2GFA A;  2D6F A;  4F7U B;  4DEY A;  3M53 A;  3X24 B;  1WXB A;  2LJ3 A;  2DFU A;  3F70 A;  4M7A B;  1ZSZ B;  3ZL7 C;  1S72 A;  1WPY A;  3QSU A;  1JB0 E;  1YWP A;  4PLL A;  1SHG A;  4J8O A;  4M77 D;  2IIM A;  4ZTF A;  2J7I A;  3OYC A;  2F2W A;  3HRU A;  4E7H A;  2MPX C;  2HKN A;  3OSV A;  5C6S A;  1C6V X;  4GLK A;  3OYH A;  3EFO A;  4M77 B;  4HVW A;  4KUI A;  3H0F A;  1PSF A;  2EVR A;  1WHK A;  2RM4 A;  3OYG A;  3JRZ A;  4J9B A;  3FC3 A;  1JJ2 A;  4OMO A;  1S72 T;  2OTJ Q;  4GLM A;  2JTE A;  3CPW P;  2LC4 A;  1OEB A;  3OBW A;  4ATO A;  2MI6 A;  5CQY A;  4J6X A;  4IUR A;  2LVM A;  2LRQ A;  1U8R A;  1VYT A;  3KBG A;  3NGP A;  2XHC A;  3CC4 Q;  2X35 A;  1PKS A;  2DRK A;  4OMF B;  1H3Z A;  2X4Y A;  1ZA1 B;  1K0S A;  2FRY A;  2QQS A;  2DL3 A;  3Q1J A;  2EFI A;  2D0Q B;  2EW3 A;  3L2U A;  4J7I A;  2YUQ A;  5GAO n;  2CUD A;  1FX7 A;  1M1F A;  5GMK j;  5CR2 A;  5DM7 R;  1YI2 Q;  2LQ8 A;  4M75 C;  3EG3 A;  4M75 E;  3V7S A;  3EGX B;  4OB2 B;  5GMK i;  2AKK A;  2FG0 A;  2CDT A;  5DY9 A;  5GAN 8;  1WDX A;  1FXX A;  3E1S A;  1YBY A;  2LCL A;  3M55 A;  5IN1 A;  3CCS A;  3CCV Q;  3EGD A;  1YIT Q;  5GAN h;  1UDL A;  2EKO A;  3CME A;  1O75 A;  1M3C A;  1QCF A;  3QII A;  1Q82 U;  4RKU E;  3MET A;  4MZP A;  5KCH A;  4KGZ B;  4Z8A A;  3C4S A;  3OYN A;  1TSF A;  4M78 F;  1ABQ A;  4FSX A;  5LJ5 h;  5CKD A;  3UPU A;  2K3X A;  1Q82 C;  3I55 Q;  3SEM A;  1R77 A;  3PVL A;  4JLI A;  3CCS T;  3CC2 Q;  1Q82 R;  4ELZ C;  3CME T;  3CCQ A;  5IT9 E;  4MML A;  2ROT A;  5GMK l;  4PJL A;  3GOX A;  2MMP A;  1WNL A;  2ED0 A;  2PUO B;  1I81 A;  3UAT A;  2CH4 A;  2HCK A;  2EYX A;  4FSS A;  1U5S A;  4F17 A;  1RAC B;  2K5I A;  3EH2 A;  4RTW A;  3I5R A;  4C92 A;  2RPN A;  2E1H A;  2NUT B;  4JDS A;  1UGS B;  2CP0 A;  1W2B A;  1IO6 A;  3VS4 A;  1LJO A;  4E47 A;  3I56 Q;  4PJM A;  2QGG A;  3CCQ T;  4RTX A;  1G3T A;  3MPU B;  2QEX Q;  1P92 A;  1JJ2 P;  5EC7 A;  3CCU A;  3JCM X;  1X6B A;  1BU1 A;  1M8V A;  2DTI A;  3JCM V;  1VQ4 Q;  1JEG A;  5KYU B;  2O2O A;  3GBQ A;  1Y07 A;  1UFF A;  2K57 A;  2F69 A;  2EYZ A;  3EHQ A;  3HHT B;  5CKH A;  2ROL A;  2COY A;  1ZUK A;  2E41 A;  2DET A;  3CCJ A;  1EX4 A;  4HXJ A;  4F7U E;  5J26 A;  4BI8 B;  4F14 A;  1TS9 A;  2ZCF B;  1IRX A;  2GGR A;  3CCU T;  2JS0 A;  3OW2 S;  2Y4Y A;  2KT8 A;  4M7A C;  4M7A E;  1ZSZ C;  2ED1 A;  3LGF A;  4MZT A;  5GJW B;  1R0B G;  3NFC A;  5GAM d;  3CCL A;  1B34 B;  5GAN d;  4DBF A;  2K2M A;  3THK A;  3MP8 A;  1E7O A;  1T3S A;  3CCJ T;  4CC7 A;  4RCC A;  4J5Y A;  2Y4X A;  2CP2 A;  4C5G A;  2DXU A;  2QQR A;  5GMK h;  4M78 G;  1FMV A;  3PE0 A;  3BW1 A;  4M4Z A;  4M77 C;  1CKB A;  2HSE B;  2K4Y A;  1UB4 A;  1Q86 U;  1KQ1 A;  2PZ1 A;  2DJQ A;  2KDS A;  4LD9 K;  3EFR A;  4EMH A;  2RJD A;  3CCL T;  3G4S A;  1VQ8 Q;  2YXY A;  1TUD A;  3L2V A;  2QQA A;  4JRP A;  1Q86 C;  3UWN A;  1G83 A;  1AVZ C;  2AK5 A;  4QW2 A;  5KE2 A;  3EG2 A;  4XAX B;  1Q86 R;  4BI3 A;  1UE9 A;  3KUF A;  3LX7 A;  2JS2 A;  1RLQ C;  3MO8 A;  1VOM A;  2HD0 A;  1VQ6 Q;  3R6O A;  1ZA2 B;  3BFM A;  1T0J A;  3OYF A;  3G4S T;  4BY6 B;  2XK0 A;  1WX6 A;  2LT1 A;  5GAN 6;  2E3H A;  2EQM A;  4A4K A;  2L8D A;  2E3I A;  2DL7 A;  1TXQ A;  5DLO A;  1PSE A;  4QQ6 A;  4JS5 A;  4RUG A;  2LCS A;  4AFU C;  4EIK A;  2OTJ A;  1S72 Q;  5HKC A;  3VS1 A;  4EMG A;  1BKB A;  1Y96 B;  4X1V A;  4DBH A;  5FWB A;  1QVP A;  1JRI A;  2M02 A;  2YLB A;  3IQL A;  3H0I A;  2IPO B;  1IB8 A;  4OMN A;  1OQK A;  2KT1 A;  4BI4 A;  4XU2 A;  4DBQ A;  2WAC A;  4JPB W;  2KI7 A;  2HL5 C;  2OTJ T;  3AT1 B;  2PTK A;  3M0S A;  4QKU A;  3RMQ A;  1UGP B;  4QQD A;  3P8D A;  4KT0 E;  1K9A A;  1OU9 A;  1RAB B;  2ZGW A;  2A7Y A;  2RI5 A;  4HT8 A;  4MMK A;  2YSQ A;  5GAM g;  1PRM C;  3M59 A;  1WXT A;  1QP2 A;  2KVQ G;  2JZ2 A;  5GAN g;  3CCV A;  1N6A A;  3JCM W;  3E9G A;  2VB6 A;  3OY9 A;  3CD6 Q;  3REA B;  1RAH B;  1QLY A;  4EMK B;  4JRK A;  2R5A A;  3OMC A;  4OB1 B;  3UT1 A;  1BK2 A;  1BBZ A;  4LDU A;  3U23 A;  4MDW A;  5A0L A;  5FRO A;  1ZBJ A;  2YLC A;  2RQW A;  1W70 A;  4BB7 A;  2MWO A;  1SEM A;  2PU9 B;  4C92 E;  3C95 A;  4C92 F;  1QCN A;  2BZ8 A;  4PFZ A;  3HP9 A;  2MAM A;  1OYX A;  2Y90 A;  2O9S A;  3QWX X;  3CCV T;  4FW1 A;  1RAE B;  2O4X B;  2SRC A;  2G6F X;  3CCS Q;  4RMO A;  3CME Q;  1XQH A;  2EKH A;  4JRQ A;  1M2V B;  2DL8 A;  4XTY A;  5AT1 B;  2XMF A;  1VQ7 Q;  2ZZD A;  3OBY A;  2DL5 A;  3M0Q A;  2CZ7 B;  1D3B B;  5LJ3 h;  1WQ7 A;  2ZPB B;  4KUD K;  2AT1 B;  2O88 A;  4HVU A;  5I22 A;  1I5O B;  2OAW A;  3SDZ A; 
#chains in the Genus database with same CATH homology
 2DVJ A;  2KE9 A;  4OMQ A;  1HJD A;  2VWF A;  1ZUU A;  1T3L A;  2CT4 A;  2K9G A;  2QDL A;  1Y0M A;  3VS5 A;  3ZL7 C;  1AWX A;  2FRW A;  2BTT A;  1AWO A;  1YWP A;  1Z9Q A;  1X69 A;  3UA6 A;  1KFZ A;  1SHG A;  2SEM A;  2LJ0 A;  2IIM A;  2J7I A;  2F2W A;  3H41 A;  2JM9 A;  3M0R A;  1PWT A;  1J3T A;  1SPK A;  4JJC A;  2P4R A;  1XOV A;  1GBR A;  1UTI A;  4HVW A;  1GFD A;  3H0F A;  2JMA A;  2EVR A;  2FPE A;  4J9B A;  3M0T A;  4OMO A;  4E6R A;  4GLM A;  2JTE A;  1OEB A;  1PNJ A;  1SRM A;  2A36 A;  1AWJ A;  1X43 A;  1I0C A;  3VRZ A;  1WLP B;  1VYT A;  1X2Q A;  4J9F A;  3NGP A;  1CSK A;  2GTJ A;  1PKS A;  2DRK A;  2EBP A;  1Z9Z A;  1K0S A;  2FRY A;  1QKW A;  2DL3 A;  2LX7 A;  3SHW A;  4RTY A;  2EW3 A;  2YUQ A;  2J05 A;  2B86 A;  2CUD A;  2YT6 A;  3C0C A;  4RTZ A;  2L3S A;  2NUZ A;  3EG3 A;  1AWW A;  1MV3 A;  5L23 A;  4LNP A;  2YUO A;  4JZ3 A;  1LCK A;  2CSI A;  2M0Y A;  2AKK A;  2FG0 A;  2CDT A;  2HBW A;  1WDX A;  1KJW A;  1JQQ A;  1UHF A;  2L0A A;  3TVT A;  2DF6 A;  4HVV A;  1MUZ A;  3RBB B;  2LP5 A;  1JO8 A;  2MOX A;  2MCN A;  2L2P A;  3TSZ A;  1UDL A;  2DE0 X;  4LE9 A;  4ESR A;  3M0P A;  1M3C A;  2RQT A;  1QCF A;  3O5Z A;  1NG2 A;  1YNZ A;  2YUN A;  4AFS C;  4AFZ C;  2CSQ A;  2KXD A;  1NLP C;  2CRE A;  3EHR A;  4J9C A;  4Z8A A;  1WIE A;  1ABQ A;  1M27 C;  2DX1 A;  1KSW A;  2GTO A;  2JM8 A;  1M30 A;  3ULR B;  1WI7 A;  3SEM A;  2KNB B;  2EGA A;  2EGC A;  2KYM A;  3PVL A;  2X3X D;  3EG0 A;  2JW4 A;  1RI9 A;  4D8K A;  1M3B A;  2ROT A;  2HDA A;  1M8M A;  2DA9 A;  5FW9 A;  2ESW A;  2ED0 A;  2FPF A;  3UAT A;  1UUE A;  2CH4 A;  4GBQ A;  1AZE A;  1K76 A;  1PRL C;  2HCK A;  2KBT A;  4QT7 A;  2L3P A;  1GFC A;  1RUW A;  2EYX A;  4FSS A;  2LNH B;  1U5S A;  1SSH A;  4LUD A;  4F17 A;  1UG1 A;  1GL5 A;  1H3H A;  2ABL A;  4OML A;  4RTW A;  3I5R A;  1YN8 A;  1OPL A;  2GNC A;  2RPN A;  1TG0 A;  1IO6 A;  5IXB A;  1UEC A;  3VS4 A;  4RTX A;  1GCQ C;  5EC7 A;  1H8K A;  2K79 A;  1X6B A;  1BU1 A;  3LH5 A;  4D8D A;  1YCS B;  1JEG A;  2E5K A;  2O2O A;  4J9E A;  3GBQ A;  4JJD A;  1UFF A;  2JMC A;  1K0X A;  2C0T A;  2EYZ A;  3EHQ A;  4IIM A;  1A0N B;  5IHK A;  2AKL A;  2RNA A;  2ROL A;  1ZUY A;  2BZX A;  2J6O A;  2K7A A;  4K11 A;  4DEX A;  1ZUK A;  2KYB A;  1X2K A;  1QWF A;  2O9V A;  2EYY A;  2EPD A;  4HXJ A;  3VS0 A;  3VS6 A;  1QKX A;  2H8H A;  2GBQ A;  3PVQ A;  4F14 A;  2EQI A;  2EGE A;  2GGR A;  2JS0 A;  5IHN A;  1K4U S;  1AEY A;  1E6H A;  1I07 A;  2KT8 A;  2CT3 A;  1AD5 A;  1B07 A;  1PKT A;  2ED1 A;  1ZLM A;  2W10 A;  1MV0 B;  5GJW B;  1NYG A;  3I9Q A;  3EG1 A;  2BZY A;  2RMO A;  1EFN A;  5GJV B;  1VYV A;  1UJ0 A;  2DM1 A;  2K2M A;  3NMZ C;  3THK A;  1E6G A;  1E7O A;  1T3S A;  2KRM A;  4LUE A;  2M51 A;  4CC7 A;  2KRS A;  2LJ1 A;  1KIK A;  2K6D A;  1AZG B;  1GCQ A;  2JXB A;  1V1C A;  1GBQ A;  1FYN A;  2YUP A;  3PE0 A;  4M4Z A;  3VRY A;  1GCP A;  4Y92 A;  1CKB A;  2F2X A;  2DNU A;  1HD3 A;  2J6K A;  2A28 A;  2DLP A;  1X27 A;  2AZS A;  2KEA A;  2MIO A;  2PZ1 A;  2DJQ A;  4A63 B;  3VS7 A;  1Y57 A;  1X6G A;  4ZNX A;  2LZ6 B;  4WCI A;  1GRI A;  3H0H A;  2V1R A;  4J9G A;  1TUD A;  1WYX A;  2X3W D;  1YWO A;  2LMJ A;  1H92 A;  1ZX6 A;  2KRO A;  2DBM A;  5ECA A;  1G83 A;  2CUB A;  1AVZ C;  2NWM A;  2RQU A;  2AK5 A;  3R6N A;  1AOJ A;  1JU5 C;  3EG2 A;  2DYB A;  2D8H A;  3JV3 A;  4J9D A;  4OMP A;  1W6X A;  3UA7 A;  1UE9 A;  1NEG A;  2JS2 A;  1RLQ C;  4CC4 B;  1WFW A;  3UF4 A;  1UGV A;  3VS2 A;  2RF0 A;  1U06 A;  1T0J A;  2VKN A;  3RNJ A;  1SHF A;  2FEI A;  2KXC A;  1BB9 A;  1WX6 A;  1CKA A;  1U3O A;  2RQR A;  4AG2 C;  2D0N A;  1I1J A;  3VS3 A;  2A08 A;  2DL7 A;  4R0K A;  1T0H A;  4JJB A;  3EGU A;  1OOT A;  1UHC A;  4RUG A;  4HCK A;  1JXM A;  1JXO A;  2LCS A;  4AFU C;  4EIK A;  1M3A A;  2JT4 A;  3VS1 A;  2F2V A;  2OJ2 A;  2KR3 A;  3FJ5 A;  4KRT A;  3CQT A;  1FMK A;  2J6F A;  1PHT A;  4ORZ A;  2D8J A;  4RTT A;  4X1V A;  5IXF A;  2YDL A;  5FWB A;  2CH4 W;  3IQL A;  3H0I A;  2L3Q A;  4OMN A;  1UJY A;  2ECZ A;  1VA7 A;  5IH2 A;  4Z88 A;  2KT1 A;  4RTV A;  4JPB W;  2LQN A;  4LN2 A;  2DRM A;  3A98 A;  4RTU A;  2PTK A;  2W0Z A;  3M0S A;  3QWY A;  5FWC A;  4OMM A;  2DIL A;  1NLO C;  1ARK A;  1K9A A;  1K1Z A;  1ZSG A;  4AFQ C;  1G2B A;  1OPK A;  2YSQ A;  1W1F A;  1PRM C;  1NEB A;  1WXT A;  2HEQ A;  2RN8 A;  2VVK A;  2K3B A;  4CC2 A;  3REA B;  4Z89 A;  1QLY A;  2DL4 A;  1OV3 A;  2I0N A;  2EYW A;  2AZV A;  2KGT A;  1BK2 A;  5HCK A;  1NM7 A;  1TUC A;  1BBZ A;  3U23 A;  4CC3 A;  4AG1 C;  3M0U A;  1ABO A;  1S1N A;  1YP5 A;  1ZBJ A;  2PNI A;  2RQW A;  1W70 A;  1SEM A;  2HSP A;  1HSQ A;  2BZ8 A;  2FO0 A;  3I5S A;  4JZ4 A;  5I11 A;  2O9S A;  3QWX X;  2ENM A;  2OI3 A;  2RQV A;  2C0O A;  2SRC A;  2G6F X;  2LQW A;  2DMO A;  1WXU A;  2A37 A;  1QWE A;  3REB B;  5IHI A;  3I35 A;  2D1X A;  2V1Q A;  2EKH A;  4J9I A;  2DL8 A;  2XMF A;  3KFV A;  2GQI A;  2KRN A;  2DL5 A;  3M0Q A;  4J9H A;  1SRL A;  1VYU A;  2C0I A;  3TSW A;  1WA7 A;  3NHN A;  1N5Z A;  4HVU A;  4IIO A;  5I22 A;  2DBK A;  1B3Q A;  1NYF A;  2J06 A;  2OAW A;  2O88 A;  3NPF A;  2FPD A;  1RLP C;  2O31 A;  4DEY A;  4F16 A;  1WXB A;  2LJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...