2EPDA

Solution structure of sh3 domain in rho-gtpase-activating protein 4
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
76
structure length
76
Chain Sequence
GSSGSSGEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERASSDWWRGEHNGMRGLIPHKYITLPAGTEKQVVGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of SH3 domain in Rho-GTPase-activating protein 4
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Rho GTPase-activating protein 4
total genus 5
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2epdA00
5FW9A 4ESRA 4K11A 3ULRB 3EG3A 1ZX6A 3ZL7C 1RI9A 1PRMC 1M30A 5I22A 2L3PA 1SRLA 3LH5A 2EKHA 2PNIA 4JPBW 2DE0X 1N5ZA 2W10A 2DILA 1K0SA 2V1RA 1JO8A 5IHIA 2JW4A 1RLPC 4AG1C 2JTEA 1K9AA 1WI7A 1LCKA 2M0YA 1FMKA 2FEIA 3SHWA 2KT1A 2KXDA 2YUNA 2EYXA 1GCQA 1PRLC 2CH4A 3M0UA 2GBQA 2J05A 2EYWA 1ARKA 2KYMA 2BZYA 4ORZA 1SEMA 2D8JA 1H92A 3TSZA 2RNAA 2RQTA 1NYFA 1E6GA 1GCQC 1OOTA 2J7IA 2VWFA 4J9GA 1UG1A 3M0PA 4WCIA 3VS2A 2SEMA 1B07A 2DRKA 1GFDA 2NWMA 1ZSGA 1T3LA 1ZLMA 3H0IA 4AFSC 1T0JA 4Z8AA 2DLPA 3EG2A 2GNCA 1PKTA 2EGAA 2K2MA 1AWWA 1U5SA 3EHQA 4LNPA 2C0OA 5L23A 4D8KA 4J9BA 2YSQA 1I07A 5FWCA 2O9SA 2HSPA 2RMOA 4OMMA 2YUQA 1JEGA 2RPNA 2ABLA 2D1XA 4RTYA 1G2BA 4LUDA 2EVRA 1CKBA 1SHFA 2BTTA 4J9EA 1WA7A 2LQWA 3REAB 1A0NB 4JJBA 1GFCA 2MOXA 1K4US 4JZ3A 3EGUA 1JQQA 3VS7A 2ROLA 1S1NA 2ED1A 4F14A 2J6OA 2FO0A 2OJ2A 3I35A 3VS6A 1UHCA 2KRMA 4OMQA 1QCFA 1OPLA 5GJVB 4HVVA 1AZGB 1BK2A 2KT8A 1Y57A 4CC2A 1WIEA 4DEYA 1GBRA 3TVTA 1KFZA 4Z89A 1VYTA 2EYZA 4J9IA 2VKNA 2RQUA 4OMNA 4J9FA 1X2QA 2CSIA 1AEYA 1AWXA 2B86A 4RTZA 1SSHA 4OMPA 1NYGA 1SHGA 1VA7A 3NGPA 3FJ5A 2J6FA 1X27A 4RTTA 2XMFA 2A28A 2K3BA 3M0QA 1M3CA 2YT6A 1GRIA 2YUOA 2AKLA 1KIKA 5IH2A 4JJCA 4RTVA 1K1ZA 2LP5A 2FRYA 1GL5A 1ZUUA 2L2PA 2CT3A 2MCNA 3VS3A 2AKKA 2HEQA 1GCPA 2A37A 1TUCA 4JZ4A 2L0AA 4CC7A 3VS0A 1EFNA 1PNJA 1YCSB 2RQRA 4OMLA 3M0SA 2DA9A 1BBZA 2FPFA 2O31A 1ZUYA 2FPEA 2MIOA 2DYBA 1QWEA 1KSWA 5IXFA 2V1QA 3PVQA 1X6BA 2KEAA 2BZXA 3PVLA 2L3QA 4KRTA 1V1CA 2YUPA 2VVKA 1WXTA 2DJQA 2JM9A 2DL7A 4RTUA 1NM7A 1W6XA 1UDLA 1YP5A 1AD5A 3H0FA 2CREA 1QKXA 4R0KA 4D8DA 1HSQA 3PE0A 2E5KA 1RUWA 2F2WA 2EPDA 2CT4A 4DEXA 2ED0A 2JXBA 3H41A 4LN2A 1K0XA 3O5ZA 1WFWA 2SRCA 1G83A 1UE9A 4Y92A 2DM1A 3I5SA 3IQLA 2DVJA 1ZUKA 4AFQC 2HBWA 2J06A 1M8MA 1AWOA 1I0CA 1YWPA 2CDTA 1BU1A 2HCKA 1YNZA 2D8HA 2DRMA 4OMOA 2C0IA 3VRYA 1TG0A 4J9CA 1OEBA 2KYBA 1AVZC 2O2OA 1FYNA 3H0HA 2GTOA 2DX1A 2L3SA 3TSWA 1T3SA 3UA6A 3NHNA 2ENMA 1U3OA 2NUZA 3VS4A 1NEGA 1WDXA 1E7OA 5FWBA 2D0NA 1UECA 4J9HA 2DL4A 1SRMA 1UTIA 2DNUA 4GLMA 3M0TA 1M3AA 2F2VA 1WYXA 2KXCA 2LJ1A 1B3QA 1Z9ZA 2EGEA 3QWYA 1OPKA 1CKAA 4GBQA 5EC7A 1WLPB 1YN8A 3UA7A 3EG1A 1NLOC 2CUBA 2BZ8A 3VRZA 2LX7A 1MV0B 2KROA 1W1FA 1H3HA 2DBKA 2RQWA 4HVWA 2I0NA 2K7AA 4AFZC 1GBQA 1TUDA 4F17A 1AOJA 4AFUC 2A08A 3EHRA 1UJYA 2FG0A 2RN8A 3REBB 3I5RA 3A98A 1ABQA 2KE9A 4HXJA 2IIMA 2C0TA 5IXBA 1HD3A 2DL8A 2AK5A 1YWOA 2EGCA 1IO6A 1WXBA 1X6GA 1XOVA 5GJWB 4J9DA 4LE9A 1CSKA 1NEBA 2KGTA 1NG2A 1OV3A 1UJ0A 5ECAA 3RBBB 1K76A 1W70A 2JS2A 1BB9A 1QKWA 1UUEA 2CUDA 3JV3A 3VS1A 3UATA 1WX6A 2X3XD 1WXUA 2DL5A 2KRSA 1Z9QA 3R6NA 5I11A 1MUZA 1NLPC 2EQIA 2EYYA 3M0RA 2JMCA 3C0CA 2LCSA 1ABOA 4IIMA 2HDAA 2O88A 1E6HA 2LJ3A 2K9GA 3UF4A 2DL3A 2K79A 3VS5A 4IIOA 4F16A 2ROTA 2YDLA 3THKA 2OI3A 2AZVA 2JS0A 3NPFA 2O9VA 2JM8A 1JXMA 1MV3A 1U06A 3SEMA 4ZNXA 2DMOA 4EIKA 1PWTA 4FSSA 2H8HA 2KNBB 2KR3A 1JXOA 1X69A 2X3WD 3RNJA 2LZ6B 1ZBJA 5HCKA 3CQTA 1H8KA 4RTXA 2A36A 3QWXX 3EG0A 4Z88A 2KRNA 2LQNA 2LMJA 4JJDA 4X1VA 4CC4B 4CC3A 2LJ0A 2PZ1A 1I1JA 2CH4W 4A63B 2FRWA 2W0ZA 1RLQC 2KBTA 2M51A 1KJWA 2LNHB 1AWJA 1AZEA 3U23A 2GGRA 1UGVA 2ESWA 3GBQA 2PTKA 1VYUA 4RTWA 2QDLA 1X43A 1UFFA 2DF6A 2RQVA 2F2XA 4HVUA 2ECZA 1SPKA 1VYVA 2CSQA 4QT7A 2FPDA 2GQIA 1QWFA 2RF0A 2P4RA 1T0HA 4E6RA 1J3TA 1JU5C 2GTJA 3KFVA 1UHFA 1X2KA 2JT4A 1M3BA 3NMZC 4AG2C 1HJDA 5IHNA 2AZSA 4HCKA 1PKSA 2G6FX 1Y0MA 1PHTA 2K6DA 2DBMA 2OAWA 1QLYA 2EW3A 5IHKA 3I9QA 4LUEA 1M27C 2EBPA 2JMAA 4M4ZA 2J6KA 4RUGA
chains in the Genus database with same CATH superfamily
5FW9A 2NUTB 2EQMA 4K11A 3MKDA 3ULRB 5KYYB 4C0ZA 4BI4A 5GMKj 4BE1A 3V8JA 3G71T 1SRLA 4KGVB 2LNVA 1K0SA 2DEQA 4PJMA 2V1RA 5GANj 2QGGA 4ELYC 3KBGA 2NYSA 5GMKh 5GANf 2KXDA 3N5BB 5GAOp 2ZPHB 4PLIA 3MEAA 2CH4A 3M0UA 2GBQA 4R56A 3OYLA 3VV0A 2BZYA 1MMNA 2CP7A 2QQRA 3S6WA 1Q81U 2D8JA 3TSZA 1SF9A 4JRKA 3EFOB 3G4SA 2IVWA 1OOTA 4J9GA 3CBMA 4WCIA 3G4SQ 1EX4A 3CCUT 2WACA 2NWMA 4A4KA 3G6EQ 2D6FA 1C6VX 1T0JA 5EG2A 4M77G 4Z8AA 3CCEQ 4FYXB 4E7IA 5IT9E 3PGGA 1N6AA 2OTLT 3LWIA 1XJWB 4LD6A 1U5SA 2R58A 1D0YA 4J9BA 5HK0A 4RMOA 2COYA 2YUQA 2RPNA 4UC4A 1R0CB 2DXBA 3CC2T 1G2BA 1VQKT 2EVRA 1MNDA 2K5IA 5LL6S 1N8RU 4XK8E 4J9EA 2L3RA 1IRXA 1K4US 4JZ3A 3HFOA 2ATCB 2RO0A 2ROLA 5CQYA 4LDXA 4F14A 4M77D 2FO0A 2E70A 3VS6A 4FT4A 4OMQA 3OS2A 4X34A 1OPLA 2VB6A 1VQLT 2E6NA 4HVVA 2EIFA 2VUBA 3V7CA 3HP9A 1WJQA 1WIEA 4DEYA 3OYCA 4BE0A 2DPPB 3M9QA 3QBYA 3RR6A 4JUVA 3L2UA 1AEYA 4BACA 1IHWA 2DYIA 3P8BB 4LDYA 4OMPA 1K73R 1VQ9A 3A8GB 4F7UB 5GAMf 3FJ5A 4XU1A 3CD6A 4RTTA 4JDSA 1M3CA 2YT6A 2OTJQ 2YUOA 3V7SA 1KIKA 5IH2A 2A7YA 1FMVA 3CMAT 1N8RR 1G3SA 2E4HA 1GL5A 2HQHA 4C8QD 3A8OB 2HEQA 3EFSA 2FZCB 1EFNA 4BD3A 3JCMd 3M0SA 5GAOq 2C06A 1Y7XA 3JB9J 3CCRT 1K73U 2DYBA 5KYWA 3H6ZA 5IXFA 4E7KA 2DVEA 3PVQA 2KEAA 2BZXA 5KYWB 2E41A 3OW2P 3JB9G 3OYFA 2KMTA 1MHNA 2RI2A 3LWHA 5GAN8 1W6XA 5LJ3h 1YP5A 5LJ3g 1ZSZA 3VUBA 1KQSA 2XDDA 2E64A 4RG2A 1RUWA 1WHHA 2CT4A 7AT1B 2F69A 2JXBA 3OYDA 3CCVQ 3EAEA 3MP1A 4LN2A 2QA4T 3O5ZA 1Q81R 2KI7A 3IQLA 1MMDA 2HBWA 1AWOA 3CC2Q 4M75D 1YWPA 1Q95G 3X20B 4M75C 2HCKA 2QEXA 2D8HA 2MYSA 4OMOA 2ZAEA 4M7DA 4J9CA 1KQ1A 3LGFA 3PFSA 1VQ6T 2DERA 3MEWA 4Q5WA 2DX1A 4FIBA 3E2UA 2QGFB 2X4JA 2QEXT 2FYKA 3VS4A 1NEGA 2OTLA 3QJYA 5FWBA 3G71A 2HMAA 2D0QB 1RABB 2DL4A 4JRQA 5GAOl 4JS5A 1WYXA 1QP2A 5J39A 5GAOr 2LJ1A 3QO3A 1OU9A 3QZ9B 1CKAA 3TEEA 1IREB 5CKDA 3I56T 2CGHA 5EC7A 3L42A 2Y4XA 4OB3B 2PVOB 3V8LA 3QDRB 2KROA 1W1FA 5GANd 5GMKe 3CCVT 2DXCA 4ZTFA 4XU3A 2Z0WA 1TUDA 4F17A 4PKCC 1AOJA 4AFUC 1MNEA 1R77A 4M78E 3EG9A 2E12A 1RI0A 4C92F 3I5RA 3A98A 4PLLA 1ABQA 2KE9A 1QW1A 3DB3A 4GY5A 5IXBA 1M2VA 3OSSC 1IO6A 1M2VB 1RL2A 5CR2A 2XHCA 3OBYA 1OV3A 1SSFA 4C92C 2ZPEB 1K76A 1BB9A 2FZGB 3CCRA 4C8QA 3UATA 2CP2A 1WXUA 1Z9QA 2XU8A 3DKMA 1UB4A 1KG1A 5KYUB 3JB9D 5GAN4 2JMCA 2LCSA 4DA4A 2X4WA 4PL6A 3FB9A 2LJ3A 1R8OB 1VQNQ 3CCJQ 4FYWB 4D6WA 3CCEA 2YDLA 3THKA 3CCJA 1P92A 4C92A 3GF5A 2EJGA 2JS0A 2PQWA 2K57A 4M7AF 4M75G 4C92D 1VQLA 3E1SA 3RUXA 2JM8A 1JXMA 1IHVA 3CBPA 1U06A 4C5HA 2QG9B 4ZNXA 4M78D 2H8HA 2KNBB 3WVEB 1JXOA 2X3WD 3RNJA 3CQTA 3JSCA 2JOYA 3QXEB 2A36A 4N4IA 2KRNA 2E5QA 2LMJA 3MEVA 4M77F 2ZPIB 3MHXA 4A53A 1I1JA 2LT4A 2W0ZA 3RESA 1KJWA 1NPPA 1UEBA 1OI1A 3J81E 4E47A 2D9TA 3U23A 1NE8A 2FVUA 2E3IA 2PTKA 2RHYA 4PJJA 3JAME 3L2WA 1V76A 1VQPA 1M90R 4RTWA 1UGPB 2QDLA 1X43A 3GNFB 2DF6A 4HT8A 2VYTA 4HVUA 1VQKA 3ASKA 4M7DB 4FSXA 3OYYA 1QVFA 1J3TA 3BDLA 1X2KA 3E19A 3M5AA 4IKFA 3CCLT 2HD0A 4FM4B 5FU7B 1HJDA 2AZSA 4HCKA 4J83A 3TREA 2G6FX 1PHTA 2H3JA 3JB9F 3UDCA 3M58A 4LDVA 2DBMA 2OAWA 1QLYA 2EW3A 5IHKA 3I9QA 4KGZB 5FU6B 2PUOB 3C12A 2EBPA 4M4ZA 2XKOC 1D1CA 2MMPA 2J6KA 4ATOA 4VUBA 2A3LA 5LJ3f 3OW2S 3AHUA 3I56Q 2IG0A 1WJSA 1JB0E 3MPUB 3X24B 3HRSA 2L3PA 3WXMB 5LJ3e 3M54A 4OGEA 3EGDB 1N5ZA 2MWOA 1JO8A 2JW4A 4M7DD 1LPLA 3EGDA 1RLPC 2JTEA 1LCKA 1K9MU 1VQ5Q 1QVFP 2F5TX 1K9MC 3SHWA 3URGA 2EAYA 2FZKB 1C0MA 1YFNA 2EYXA 1LNXA 1VQ6Q 1GCQA 1PRLC 4Y91A 3OA6A 1K73C 2EYWA 2KYMA 4M7AE 4PFPA 1H92A 1Y96A 5C0MA 3CCVA 3PIOA 4M7AB 2X4XA 1XNIA 1Y96B 3LH0A 3M0PA 2LCCA 2SEMA 2RI3A 3CPWA 3CC2A 1B7TA 1OX9A 2E65A 2LDMA 2EQUA 1T3LA 4C8QC 1ZLMA 5GAN2 2DLPA 3NTKA 2E1HA 2EGAA 3R6OA 3EHQA 5L23A 1S72Q 1Q7YR 3RERA 5A2QE 5D6XA 4JRIA 2HSPA 1TSFA 8AT1B 1TUGB 2DTIA 2RMOA 4HT9A 3OMGA 4M7DE 4OB0B 1SG5A 1YITQ 4KUIA 3S3OA 1VQOA 2M1HA 2D1XA 5I21A 4RTYA 1KQSS 4QW2A 1VQOQ 2RJDA 3GIBA 3NFCA 1SHFA 2BTTA 3Q1JA 4M75B 3E9FA 1Q86U 2MPXC 4KH1B 1PG5B 2EKOA 1JQQA 1XQHA 2X35A 3META 1BKBA 1WHJA 5CKEA 4ZN1A 2J6OA 2OJ2A 3I35A 5HKCA 1QCFA 5CAIA 4QVDA 1BK2A 3LYIA 4J8OA 4CC2A 3HSBA 5C6SA 5CVIA 3CMEQ 3P8DA 4ZTJA 4Z89A 2EYZA 4J9IA 3CCQQ 4HCCA 4RCCA 4V2SA 2RHUA 2RK2A 4DBRA 5KYYA 2X9HA 5GANg 4E7LA 1VQ7Q 5GANh 5AYFA 3DLLA 4ANJA 2QXFA 4EMGA 3CCQA 1BI1A 1X2QA 5D6WA 3OYGA 2FL7A 1NYGA 1SHGA 2HNIA 4M77E 1VA7A 1SKUB 3OYEA 1O75A 5KCOA 2XMFA 3M0QA 2K3BA 3CCSQ 1UGRB 4RTVA 1K1ZA 3CMET 1WZOA 1ZUUA 2L2PA 2CT3A 2VXEA 4QVCA 2AKKA 1GCPA 4PJOG 3G1JA 2A37A 1I81A 3PT9A 5GMKm 4JZ4A 4CC7A 2RQRA 3SB2A 4L6V5 5AT1B 3V8KA 2P84A 2RHXA 3LW5E 4J7IA 2Y4YA 4PFZA 2E6ZA 2X4YA 3HKSA 2CP3A 1VQLQ 2WSEE 3G6ET 1BCOA 1YJ9Q 1NM7A 4P5NA 2L8DA 1AD5A 2O4XB 2CREA 5KYNA 3M55A 2XDBA 3JB9H 2X51A 2YWWA 2E5KA 1IB8A 2EPDA 3H41A 1M1GA 2VGMA 4ELZC 2EYQA 3EFRA 5I2SA 3M4GA 4Y92A 4PJOB 2NLUA 3I5SA 2V8KA 2DVJA 1ZUKA 1M8MA 2OAUA 2EQKA 2CDTA 4OGCA 2MF2A 2DETA 1YNZA 4KULA 1ZBXA 4PK4A 1LOJA 3VRYA 2K2VA 1YI2Q 1OEBA 1Y07A 2CP0A 4M78B 3ER0A 1FYNA 3RKYA 3OQ5A 5DY9A 3PIPA 2VASA 5CQXA 2JNGA 1FXXA 1U3OA 1M8VA 1I5LA 1E7OA 4F7UF 1UECA 3HRUA 2DNUA 4GLMA 1OULA 3M0TA 2F2VA 2DFUA 2QQ9A 4ME7A 4MDXA 2KXCA 1M1KU 1D0XA 2EGEA 1YHQA 3HFNA 3BE3A 5DLOA 2LX9A 2VGNA 1D3BB 3OYHA 4RCBA 1NLOC 3VRZA 1MV0B 4LDUA 4FCYA 1VOMA 2RQWA 3I56A 4O5VA 1TS9A 4HVWA 3H8ZA 3A1PA 4MZTA 3A5ZB 1OZ3A 5A0GA 1Q86R 5A0DA 2A08A 2ZPBB 4C8QG 4J6XA 5KYXB 3EHRA 2FG0A 3REBB 4B9XA 1MMGA 2KK4A 4HXJA 1VQ5A 3X25B 2K3YA 5CO7A 3OYIA 1HD3A 1OU8A 2V26A 2AK5A 2XD0A 1YWOA 3G6EA 3QYGB 1WXBA 4QQDA 4N0AA 1Q82U 1TH7A 2BE9B 1VQ6A 2KGTA 1U1SA 3OYJA 3JCMX 3CCMA 2FB7A 3CCLQ 1S72T 1UUEA 1VQ4Q 3JCMf 3VS1A 1WX6A 2NUPB 2X3XD 2KRSA 2RHZA 2WSCE 3X28B 1RAIB 1LJOA 4J6WA 2KDSA 1MUZA 3JCMe 2DIQA 3QPHA 1LVKA 2HDAA 5KYUA 3MJXA 1E6HA 2O88A 3CXCA 2VC8A 1N9RA 4M77A 3INZA 2DL3A 1WHLA 5L8RE 2K79A 1QQJA 3VS5A 1KHCA 3L2VA 2M9UA 3RKWA 1W2BS 3F70A 3CPWS 3LGLA 3OMCA 1ZQ1A 3NPFA 3M56A 4FYVB 4Z02A 3OYNA 4JLIA 3SEMA 4XTXA 4FSSA 1X69A 2KVQG 1N27A 1H8KA 2E3HA 4Z88A 3QWXX 4RTXA 2LQNA 2PVGB 4JJDA 4CC3A 4GLKA 2PZ1A 4A63B 1F1BB 1W2BA 3JCMQ 3X26B 3PTAA 1RLQC 2KBTA 4N0AC 4F7UE 3OBWA 1UGVA 1MMAA 4PJLA 3GBQA 3NTIA 1VQ9Q 3A8HB 1VYUA 4ZGDB 1YIJT 1UFFA 3CPFA 5LJ5j 2BKDN 2CSQA 1FWZA 2HL5C 4QT7A 4BI3A 1QWFA 2P4RA 1VQ7A 1JU5C 1UHFA 2ZZDA 2JT4A 2A0FB 1M3BA 2EJ9A 2HBPA 2OX7A 4AG2C 2LTOA 1PKSA 1WNLA 2LQ8A 4EMKA 1JRIA 5CKBA 5DLQE 2Y90A 2EJFA 4LUEA 2JMAA 3LLRA 4JS4A 2JZ2A 2QA4A 1M90U 1JJ2S 4ESRA 4F04B 4KUDK 2RI5A 3ZEHA 3ZL7C 1ZX6A 5I22A 4DQ2A 3TCJA 1WGSA 3LH5A 3I55Q 2FHDA 3QSUA 4X9CA 4QQ6A 5IHIA 3P8HA 4M77C 4AG1C 5CIUA 1K9AA 3M53A 1FMKA 1U1TA 2FEIA 3CCET 5GAMe 2KT1A 4C5EA 2YUNA 3QUIA 4PJOF 4IUPA 3RMSA 3C95A 3MP8A 3GLXA 4MZPA 4II1A 2J05A 2GF7A 1QP3A 1YJNT 5GMKl 4ORZA 1SEMA 4F7UG 1E6GA 1GCQC 2ZPFB 3S3NA 2J7IA 2VWFA 1N8RC 1GFDA 1ZSGA 4QQGA 1PSEA 4OF1A 4M75A 4AFSC 3H0IA 3GPLA 1YJNA 1HXDA 2AT1B 3EG2A 1YI2A 4IUVA 1YJWT 2GNCA 5D6YA 3CD6Q 4LNPA 2CZ6B 3FLGA 3MEUA 1X6OA 2HZYA 1VIEA 4M7DF 4C92E 5FWCA 3OS1A 2O9SA 5KH6A 4R55A 5HY6A 1JEGA 2ABLA 1ZSZC 3CC4A 5KCHA 1RAHB 1BI3A 5LJ5g 3QIIA 4LUDA 3CCST 1CKBA 2RJEA 3HRTA 3CC4Q 2QTXA 3REAB 4JJBA 1GFCA 3E9GA 4XTUA 3FEOA 5GAOm 1VQPT 2JUFA 5I2MA 3VS7A 5GMKi 1S1NA 3JCMW 3CD6T 4BY6C 1UHCA 2L5QA 3SWNA 2COWA 4PJOD 1AZGB 2KT8A 4BB7A 2HAXA 4NS5A 5GAN3 4HCBA 1VQMQ 4B9WA 3CCJT 5CKFA 1KQ2A 2MI6A 2VKNA 2RQUA 1VQMA 4DOWA 2LVMA 3CXCS 4FU6A 3CC7Q 4XAXB 1VQ7T 3EGXA 1AWXA 5J3BA 3EGXB 4ZN3A 3NGPA 1X01A 4QKUA 1IGQA 2J6FA 1X27A 1W4SA 1WHMA 2A28A 1PSFA 5GAMj 3CMAQ 3CCUA 2WSFE 1VQ4A 2AKLA 3VU3C 1YJ9T 3HTRA 1UGSB 4E7JA 1W2BP 1ZHIA 3VS3A 1ZSZB 1VQ8T 4FYYB 4PJNA 1G3WA 3CC4T 1I5OB 1FMWA 1JBMA 1MGQA 4FT2A 1PNJA 2BIVA 4OMLA 5GAMh 1BBZA 2FPFA 2O31A 2P0PA 1ZUYA 8ATCB 2FPEA 2MIOA 1QVGS 1KSWA 1QWEA 1KK7A 2DIGA 3UT1A 2L3QA 1TTHB 4EDUA 3D7SB 4KT0E 1YI2T 4C8QB 2VVKA 1C1AA 1WXTA 2DJQA 3HPWA 2JM9A 1KC8U 3SWNC 1UDLA 1M9SA 4JRPA 4R0KA 4D8DA 2DK3A 2M0OA 4BY6B 4CI0C 3CEYA 2V8JA 1K0XA 2HKNA 4AMCA 3OY9A 1WHKA 1BI2A 2PU9B 5LJ5d 2SRCA 2MWPA 2QQAA 1RADB 2OTJT 2J06A 4A4GA 1I0CA 1BU1A 5IAYA 4HCZA 2LC4A 2DRMA 4DOVA 2C0IA 3M59A 3L2ZA 4MDWA 1D3BA 3VYGA 2RM4A 6AT1B 1AVZC 5HK3A 3JCMV 1VQNT 1D09B 3H0HA 2M02A 2QYZA 4A4FA 5GAMd 4KBMB 2L3SA 4XTYA 3TSWA 3NHNA 3S3MA 1EIFA 9ATCB 4J5YA 5FRNA 3JB9I 1WDXA 2YHTA 2RHIA 2CS7A 2D0NA 4C0DC 1SRMA 1UTIA 1M3AA 3OYMA 2RH2A 1Z9ZA 1VQNA 3G7ZA 1JJ2A 2GCXA 1RAAB 5FU6C 1YITT 1OYXA 1NJIR 4BE2A 1M1FA 2R5MA 1YN8A 1M1KC 2QA4Q 5LJ5e 2K3XA 2RK1A 1QCNA 4E7SA 4FL6A 1H3HA 2HL3A 1XTDA 2I0NA 2K7AA 4AFZC 5GAN5 4M7DG 1IGUA 4L5GA 1GBQA 2ZCFB 2CYZB 2KAFA 4OB2B 2DKGA 4M7DC 1UJYA 3GP8A 4C5IA 4QVZA 2XK0A 4RG8A 2C0TA 4DBQA 4M77B 1BI0A 2DL8A 4LXCA 1X6GA 1XOVA 1TOVA 4J9DA 1UJ0A 4ZGJB 5ECAA 3EH2A 2AHJB 2JS2A 3OS0A 3EFOA 1QKWA 4L59A 4WTOB 3G4ST 2RD1A 3VKIA 1PCXA 5IN1A 3SFMA 1VQ4T 1NJIU 1NJIC 2YLCA 2QI2A 1NLPC 2EQIA 1M90C 2RB6A 3C0CA 1RAFB 4LD9K 5A0LA 3QDFA 1WQ7A 2K9GA 3UF4A 2VXFA 3UWNA 3PMTA 4IIOA 4M78F 4F16A 2ROTA 2HQXA 2OI3A 1QMCA 3FJPA 2QQSA 2GFAA 2ZPGB 2AIRB 3JCMb 2JTMA 1MV3A 1QVGA 1YIJQ 3JCMJ 2DMOA 3LX7A 1G5VA 2CZ1B 3L2RA 1ZBJA 5HCKA 1ZA1B 1VQMT 3EG0A 4JJNK 4CC4B 2CH4W 3GNGA 3CC7T 2FRWA 2HQEA 2QASA 2CZ7B 2M51A 2DD5A 4C92B 1AWJA 1AZEA 2H3EB 4M7AG 3NTHA 2M16A 3EH1A 3I55T 1EZZB 1KC8R 4MMLA 2XG8D 3GOXA 2ECZA 1SPKA 1VYVA 3QZ5B 4XTWA 3ZFJA 2LRQA 3CCSA 1VIFA 2FPDA 2GQIA 1YJWA 1K9MR 2RF0A 4HKEA 3KXTA 1T0HA 4E6RA 2GQVA 3KFVA 3MO8A 5KE3A 2QEXQ 3A8MB 3NMZC 5FRMA 4IUTA 3EG9B 3OYAA 4DBFA 4DBHA 5KE2A 3UPUA 3CMAA 3CCUQ 1VQOT 2COZA 1M27C 2MK5A 2CP5A 2PUKB 2YRDA 3JCMP 5FROA 1PD1A 1UGQB 1TU0B 1S72A 2BE7D 2F5KA 3VYHB 2OTLQ 4J6YA 5LJ3j 1QCOA 3EG3A 1RI9A 1PRMC 1M30A 2VV5A 5DM7R 2GFUA 2EKHA 2PNIA 4JPBW 1Q82R 1YITA 2DE0X 2W10A 2DILA 2DTOA 1D0ZA 4F7UA 4M75E 3M57A 4CRIA 1WI7A 2IPOB 2M0YA 1M2OA 3PMIA 5KYXA 3BFMA 1V29B 3HHTB 3OYKA 1VQPQ 4IURA 5FLXE 1ARKA 5GAN6 1QVFS 2RNAA 1YCYA 1NYFA 2RQTA 4E7HA 1HK9A 3TU4K 3DLMA 2MAMA 3L1AA 1UG1A 2NUPA 3VS2A 1B07A 3MP6A 4IUQA 2DRKA 1KC8C 2DD4A 4ZGEB 2QK0A 3RKXA 1B34A 2XI9A 1GXIE 1PKTA 2EQJA 4C0DB 2K2MA 1WPYA 5D7UA 3C94A 3CCRQ 1AWWA 1WJRA 1K8AR 4M7AD 2C0OA 4A54A 4D8KA 3JCMc 2QQBA 2YSQA 1I07A 3C4SA 4M78C 1ZA2B 4OMMA 2DJZA 1I4K1 3M4YA 3T9NA 3CPWP 4LDWA 4NL3A 3O8VA 1NZ9A 1WA7A 2LQWA 1A0NB 2MOXA 3EGUA 1N9SA 4PJOC 1VQ8Q 2P0QA 3DB4A 2ED1A 1K8AU 4BUGA 2KRMA 1D1BA 5GJVB 2QAZA 1WQWA 2XIDA 2RA2A 3CBOA 1Y57A 1GBRA 3SWNB 3TVTA 4KGXB 4BI8B 5CK9A 1KFZA 1VYTA 1TXQA 3OS5A 4OMNA 2LCLA 4J9FA 2XDPA 4M78G 2CSIA 4J7FA 2B86A 4RTZA 4RKUE 1SSHA 3VJPA 2BUDA 3WVDB 4AT1B 4FW1A 1I8FA 2JVVA 1GRIA 1VQKQ 3CCMT 4JJCA 4A4HA 3JRZA 1PC0A 2LP5A 2FRYA 2MCNA 4C5GA 1TWBA 3ME9A 4XU2A 2I2LA 1H3ZA 3RDVA 1TUCA 2L0AA 3VS0A 1YCSB 4N4GA 2DA9A 3V7RA 5GAN7 1M5Q1 4E7ZA 4C0GA 1Q7YU 2DEUA 1Q7YC 2V1QA 2CP6A 1HYOA 3QKJA 1X6BA 3PVLA 1VQ9T 1YHQQ 3FC3A 5GAOn 3FIFA 1FX7A 5LJ3d 4XQ3A 4KRTA 1IXDA 1V1CA 2YUPA 2JJ9A 4EMHA 1YIJA 3BDUA 2YXYA 1KD1C 2DL7A 5LJ5h 4RTUA 4OB1B 2YRVA 1KD1U 3TQ7P 3H0FA 3SD4A 1QKXA 1HSQA 1RAGB 3J80E 1BYMA 3PE0A 2F2WA 4DEXA 2ED0A 4A4EA 1Y71A 3JCMh 1RACB 1WFWA 1BCMA 1G83A 1UE9A 3SDZA 2DM1A 1YHQT 4AFQC 4JLGA 2LT1A 3RIRA 2DTHA 2KY9A 5CCAA 1TG0A 2F1LA 1B34B 4PNOA 2RJFA 1M4ZA 3HL8A 2KYBA 2O4XA 5GANe 3QG1A 2O2OA 1YJWQ 2GTOA 1T3SA 3UA6A 2ENMA 1O9SA 2QTVA 2NUZA 2DXTA 2ZGWA 3VUZA 4J9HA 2DXUA 2V8IA 3OSVA 1JJ2P 4WF2A 5M9OA 2P0KA 4MZMA 1KD1R 1PD0A 3I55A 1B3QA 5J26A 3QWYA 2E10A 1OPKA 2K5LA 3OYBA 2KQWA 4GBQA 1WLPB 2YRCA 3UA7A 3EG1A 2RJCA 2DZ9A 2CUBA 3AT1B 2BZ8A 5CKHA 2LX7A 1Q81C 4M7AC 5FU7C 3L2QA 2K5FA 2DBKA 1KQSP 4YTLA 1D1AA 2G3RA 1WHGA 2JN0A 2KSSA 3OB9A 1VQ5T 1QVPA 2RN8A 1PM3A 1OQKA 4C8QE 4EMKB 1AT1B 2IIMA 4B6MA 1YBYA 1DJ7B 2EGCA 4O6JA 4NL2A 5GJWB 4LE9A 1CSKA 1NEBA 1YJNQ 1IZ6A 1KHIA 1NG2A 1X75C 2P4TA 4M75F 3RBBB 1W70A 2B8AA 2DAQA 2HKQB 2OTJA 3CMEA 1BIAA 2HSEB 2CUDA 3JCMg 3JV3A 4XTVA 4X9DA 2DL5A 3R6NA 2R57A 5I11A 2JTFA 2EYYA 3M0RA 4KH0B 3BY7A 4N4HA 1M1KR 1ABOA 2L89A 4IIMA 3CCQT 1R0BG 1NPRA 2PVDB 3BW1A 4PJOA 3OW2A 1G8XA 2AZVA 1Q82C 4OMFB 1RAEB 1Q86C 2O9VA 2CZ0B 1OX8A 4M7AA 1G3YA 2DZCA 4EIKA 1PWTA 4PFOA 2KR3A 2LZ6B 2YLBA 1QVGP 1OZ2A 1H641 4M78A 4NOYA 4X1VA 3RMQA 4E2FB 2LJ0A 4IUUA 3QJ6A 2CKKA 1VUBA 2LNHB 2XICA 1VQ8A 1AHJB 1NBEB 3CC7A 4HA8A 4C0FA 3KUFA 2GGRA 2ESWA 3CXCP 3A8LB 4Y28E 1YJ9A 3FDRA 3CCMQ 4MMKA 3CCLA 5LJ5f 2K4YA 4TVRA 2RQVA 2F2XA 4EMKC 4C92G 4OP0A 3H9NA 4BDYA 2O01E 4BDZA 3QHSA 2GTJA 1K8AC 3PNWC 3MCAB 3ZBDA 3G71Q 3QYHB 2EFIA 5IHNA 4PJOE 2LQKA 2R5AA 2DO3A 5GAMg 1BIBA 1Y0MA 2QDYB 1ACMB 1G3TA 3FRNA 2K6DA 4C8QF 4FW2A 4EPCA 4OVAA 1U8RA 4XU0A 2NUTA 2EWNA 4XTZA 3J7AF 4RUGA
chains in the Genus database with same CATH topology
5FW9A 4ESRA 4K11A 3ULRB 3EG3A 1ZX6A 3ZL7C 1RI9A 1PRMC 1M30A 5I22A 2L3PA 1SRLA 3LH5A 2EKHA 2PNIA 4JPBW 2DE0X 1N5ZA 2W10A 2DILA 1K0SA 2V1RA 1JO8A 5IHIA 2JW4A 1RLPC 4AG1C 2JTEA 1K9AA 1WI7A 1LCKA 2M0YA 1FMKA 2FEIA 3SHWA 2KT1A 2KXDA 2YUNA 2EYXA 1GCQA 1PRLC 2CH4A 3M0UA 2GBQA 2J05A 2EYWA 1ARKA 2KYMA 2BZYA 4ORZA 1SEMA 2D8JA 1H92A 3TSZA 2RNAA 2RQTA 1NYFA 1E6GA 1GCQC 1OOTA 2J7IA 2VWFA 4J9GA 1UG1A 3M0PA 4WCIA 3VS2A 2SEMA 1B07A 2DRKA 1GFDA 2NWMA 1ZSGA 1T3LA 1ZLMA 3H0IA 4AFSC 1T0JA 4Z8AA 2DLPA 3EG2A 2GNCA 1PKTA 2EGAA 2K2MA 1AWWA 1U5SA 3EHQA 4LNPA 2C0OA 5L23A 4D8KA 4J9BA 2YSQA 1I07A 5FWCA 2O9SA 2HSPA 2RMOA 4OMMA 2YUQA 1JEGA 2RPNA 2ABLA 2D1XA 4RTYA 1G2BA 4LUDA 2EVRA 1CKBA 1SHFA 2BTTA 4J9EA 1WA7A 2LQWA 3REAB 1A0NB 4JJBA 1GFCA 2MOXA 1K4US 4JZ3A 3EGUA 1JQQA 3VS7A 2ROLA 1S1NA 2ED1A 4F14A 2J6OA 2FO0A 2OJ2A 3I35A 3VS6A 1UHCA 2KRMA 4OMQA 1QCFA 1OPLA 5GJVB 4HVVA 1AZGB 1BK2A 2KT8A 1Y57A 4CC2A 1WIEA 4DEYA 1GBRA 3TVTA 1KFZA 4Z89A 1VYTA 2EYZA 4J9IA 2VKNA 2RQUA 4OMNA 4J9FA 1X2QA 2CSIA 1AEYA 1AWXA 2B86A 4RTZA 1SSHA 4OMPA 1NYGA 1SHGA 1VA7A 3NGPA 3FJ5A 2J6FA 1X27A 4RTTA 2XMFA 2A28A 2K3BA 3M0QA 1M3CA 2YT6A 1GRIA 2YUOA 2AKLA 1KIKA 5IH2A 4JJCA 4RTVA 1K1ZA 2LP5A 2FRYA 1GL5A 1ZUUA 2L2PA 2CT3A 2MCNA 3VS3A 2AKKA 2HEQA 1GCPA 2A37A 1TUCA 4JZ4A 2L0AA 4CC7A 3VS0A 1EFNA 1PNJA 1YCSB 2RQRA 4OMLA 3M0SA 2DA9A 1BBZA 2FPFA 2O31A 1ZUYA 2FPEA 2MIOA 2DYBA 1QWEA 1KSWA 5IXFA 2V1QA 3PVQA 1X6BA 2KEAA 2BZXA 3PVLA 2L3QA 4KRTA 1V1CA 2YUPA 2VVKA 1WXTA 2DJQA 2JM9A 2DL7A 4RTUA 1NM7A 1W6XA 1UDLA 1YP5A 1AD5A 3H0FA 2CREA 1QKXA 4R0KA 4D8DA 1HSQA 3PE0A 2E5KA 1RUWA 2F2WA 2EPDA 2CT4A 4DEXA 2ED0A 2JXBA 3H41A 4LN2A 1K0XA 3O5ZA 1WFWA 2SRCA 1G83A 1UE9A 4Y92A 2DM1A 3I5SA 3IQLA 2DVJA 1ZUKA 4AFQC 2HBWA 2J06A 1M8MA 1AWOA 1I0CA 1YWPA 2CDTA 1BU1A 2HCKA 1YNZA 2D8HA 2DRMA 4OMOA 2C0IA 3VRYA 1TG0A 4J9CA 1OEBA 2KYBA 1AVZC 2O2OA 1FYNA 3H0HA 2GTOA 2DX1A 2L3SA 3TSWA 1T3SA 3UA6A 3NHNA 2ENMA 1U3OA 2NUZA 3VS4A 1NEGA 1WDXA 1E7OA 5FWBA 2D0NA 1UECA 4J9HA 2DL4A 1SRMA 1UTIA 2DNUA 4GLMA 3M0TA 1M3AA 2F2VA 1WYXA 2KXCA 2LJ1A 1B3QA 1Z9ZA 2EGEA 3QWYA 1OPKA 1CKAA 4GBQA 5EC7A 1WLPB 1YN8A 3UA7A 3EG1A 1NLOC 2CUBA 2BZ8A 3VRZA 2LX7A 1MV0B 2KROA 1W1FA 1H3HA 2DBKA 2RQWA 4HVWA 2I0NA 2K7AA 4AFZC 1GBQA 1TUDA 4F17A 1AOJA 4AFUC 2A08A 3EHRA 1UJYA 2FG0A 2RN8A 3REBB 3I5RA 3A98A 1ABQA 2KE9A 4HXJA 2IIMA 2C0TA 5IXBA 1HD3A 2DL8A 2AK5A 1YWOA 2EGCA 1IO6A 1WXBA 1X6GA 1XOVA 5GJWB 4J9DA 4LE9A 1CSKA 1NEBA 2KGTA 1NG2A 1OV3A 1UJ0A 5ECAA 3RBBB 1K76A 1W70A 2JS2A 1BB9A 1QKWA 1UUEA 2CUDA 3JV3A 3VS1A 3UATA 1WX6A 2X3XD 1WXUA 2DL5A 2KRSA 1Z9QA 3R6NA 5I11A 1MUZA 1NLPC 2EQIA 2EYYA 3M0RA 2JMCA 3C0CA 2LCSA 1ABOA 4IIMA 2HDAA 2O88A 1E6HA 2LJ3A 2K9GA 3UF4A 2DL3A 2K79A 3VS5A 4IIOA 4F16A 2ROTA 2YDLA 3THKA 2OI3A 2AZVA 2JS0A 3NPFA 2O9VA 2JM8A 1JXMA 1MV3A 1U06A 3SEMA 4ZNXA 2DMOA 4EIKA 1PWTA 4FSSA 2H8HA 2KNBB 2KR3A 1JXOA 1X69A 2X3WD 3RNJA 2LZ6B 1ZBJA 5HCKA 3CQTA 1H8KA 4RTXA 2A36A 3QWXX 3EG0A 4Z88A 2KRNA 2LQNA 2LMJA 4JJDA 4X1VA 4CC4B 4CC3A 2LJ0A 2PZ1A 1I1JA 2CH4W 4A63B 2FRWA 2W0ZA 1RLQC 2KBTA 2M51A 1KJWA 2LNHB 1AWJA 1AZEA 3U23A 2GGRA 1UGVA 2ESWA 3GBQA 2PTKA 1VYUA 4RTWA 2QDLA 1X43A 1UFFA 2DF6A 2RQVA 2F2XA 4HVUA 2ECZA 1SPKA 1VYVA 2CSQA 4QT7A 2FPDA 2GQIA 1QWFA 2RF0A 2P4RA 1T0HA 4E6RA 1J3TA 1JU5C 2GTJA 3KFVA 1UHFA 1X2KA 2JT4A 1M3BA 3NMZC 4AG2C 1HJDA 5IHNA 2AZSA 4HCKA 1PKSA 2G6FX 1Y0MA 1PHTA 2K6DA 2DBMA 2OAWA 1QLYA 2EW3A 5IHKA 3I9QA 4LUEA 1M27C 2EBPA 2JMAA 4M4ZA 2J6KA 4RUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FW9 A;  4ESR A;  4K11 A;  3ULR B;  3EG3 A;  1ZX6 A;  3ZL7 C;  1RI9 A;  1PRM C;  1M30 A;  5I22 A;  2L3P A;  1SRL A;  3LH5 A;  2EKH A;  2PNI A;  4JPB W;  2DE0 X;  1N5Z A;  2W10 A;  2DIL A;  1K0S A;  2V1R A;  1JO8 A;  5IHI A;  2JW4 A;  1RLP C;  4AG1 C;  2JTE A;  1K9A A;  1WI7 A;  1LCK A;  2M0Y A;  1FMK A;  2FEI A;  3SHW A;  2KT1 A;  2KXD A;  2YUN A;  2EYX A;  1GCQ A;  1PRL C;  2CH4 A;  3M0U A;  2GBQ A;  2J05 A;  2EYW A;  1ARK A;  2KYM A;  2BZY A;  4ORZ A;  1SEM A;  2D8J A;  1H92 A;  3TSZ A;  2RNA A;  2RQT A;  1NYF A;  1E6G A;  1GCQ C;  1OOT A;  2J7I A;  2VWF A;  4J9G A;  1UG1 A;  3M0P A;  4WCI A;  3VS2 A;  2SEM A;  1B07 A;  2DRK A;  1GFD A;  2NWM A;  1ZSG A;  1T3L A;  1ZLM A;  3H0I A;  4AFS C;  1T0J A;  4Z8A A;  2DLP A;  3EG2 A;  2GNC A;  1PKT A;  2EGA A;  2K2M A;  1AWW A;  1U5S A;  3EHQ A;  4LNP A;  2C0O A;  5L23 A;  4D8K A;  4J9B A;  2YSQ A;  1I07 A;  5FWC A;  2O9S A;  2HSP A;  2RMO A;  4OMM A;  2YUQ A;  1JEG A;  2RPN A;  2ABL A;  2D1X A;  4RTY A;  1G2B A;  4LUD A;  2EVR A;  1CKB A;  1SHF A;  2BTT A;  4J9E A;  1WA7 A;  2LQW A;  3REA B;  1A0N B;  4JJB A;  1GFC A;  2MOX A;  1K4U S;  4JZ3 A;  3EGU A;  1JQQ A;  3VS7 A;  2ROL A;  1S1N A;  2ED1 A;  4F14 A;  2J6O A;  2FO0 A;  2OJ2 A;  3I35 A;  3VS6 A;  1UHC A;  2KRM A;  4OMQ A;  1QCF A;  1OPL A;  5GJV B;  4HVV A;  1AZG B;  1BK2 A;  2KT8 A;  1Y57 A;  4CC2 A;  1WIE A;  4DEY A;  1GBR A;  3TVT A;  1KFZ A;  4Z89 A;  1VYT A;  2EYZ A;  4J9I A;  2VKN A;  2RQU A;  4OMN A;  4J9F A;  1X2Q A;  2CSI A;  1AEY A;  1AWX A;  2B86 A;  4RTZ A;  1SSH A;  4OMP A;  1NYG A;  1SHG A;  1VA7 A;  3NGP A;  3FJ5 A;  2J6F A;  1X27 A;  4RTT A;  2XMF A;  2A28 A;  2K3B A;  3M0Q A;  1M3C A;  2YT6 A;  1GRI A;  2YUO A;  2AKL A;  1KIK A;  5IH2 A;  4JJC A;  4RTV A;  1K1Z A;  2LP5 A;  2FRY A;  1GL5 A;  1ZUU A;  2L2P A;  2CT3 A;  2MCN A;  3VS3 A;  2AKK A;  2HEQ A;  1GCP A;  2A37 A;  1TUC A;  4JZ4 A;  2L0A A;  4CC7 A;  3VS0 A;  1EFN A;  1PNJ A;  1YCS B;  2RQR A;  4OML A;  3M0S A;  2DA9 A;  1BBZ A;  2FPF A;  2O31 A;  1ZUY A;  2FPE A;  2MIO A;  2DYB A;  1QWE A;  1KSW A;  5IXF A;  2V1Q A;  3PVQ A;  1X6B A;  2KEA A;  2BZX A;  3PVL A;  2L3Q A;  4KRT A;  1V1C A;  2YUP A;  2VVK A;  1WXT A;  2DJQ A;  2JM9 A;  2DL7 A;  4RTU A;  1NM7 A;  1W6X A;  1UDL A;  1YP5 A;  1AD5 A;  3H0F A;  2CRE A;  1QKX A;  4R0K A;  4D8D A;  1HSQ A;  3PE0 A;  2E5K A;  1RUW A;  2F2W A;  2EPD A;  2CT4 A;  4DEX A;  2ED0 A;  2JXB A;  3H41 A;  4LN2 A;  1K0X A;  3O5Z A;  1WFW A;  2SRC A;  1G83 A;  1UE9 A;  4Y92 A;  2DM1 A;  3I5S A;  3IQL A;  2DVJ A;  1ZUK A;  4AFQ C;  2HBW A;  2J06 A;  1M8M A;  1AWO A;  1I0C A;  1YWP A;  2CDT A;  1BU1 A;  2HCK A;  1YNZ A;  2D8H A;  2DRM A;  4OMO A;  2C0I A;  3VRY A;  1TG0 A;  4J9C A;  1OEB A;  2KYB A;  1AVZ C;  2O2O A;  1FYN A;  3H0H A;  2GTO A;  2DX1 A;  2L3S A;  3TSW A;  1T3S A;  3UA6 A;  3NHN A;  2ENM A;  1U3O A;  2NUZ A;  3VS4 A;  1NEG A;  1WDX A;  1E7O A;  5FWB A;  2D0N A;  1UEC A;  4J9H A;  2DL4 A;  1SRM A;  1UTI A;  2DNU A;  4GLM A;  3M0T A;  1M3A A;  2F2V A;  1WYX A;  2KXC A;  2LJ1 A;  1B3Q A;  1Z9Z A;  2EGE A;  3QWY A;  1OPK A;  1CKA A;  4GBQ A;  5EC7 A;  1WLP B;  1YN8 A;  3UA7 A;  3EG1 A;  1NLO C;  2CUB A;  2BZ8 A;  3VRZ A;  2LX7 A;  1MV0 B;  2KRO A;  1W1F A;  1H3H A;  2DBK A;  2RQW A;  4HVW A;  2I0N A;  2K7A A;  4AFZ C;  1GBQ A;  1TUD A;  4F17 A;  1AOJ A;  4AFU C;  2A08 A;  3EHR A;  1UJY A;  2FG0 A;  2RN8 A;  3REB B;  3I5R A;  3A98 A;  1ABQ A;  2KE9 A;  4HXJ A;  2IIM A;  2C0T A;  5IXB A;  1HD3 A;  2DL8 A;  2AK5 A;  1YWO A;  2EGC A;  1IO6 A;  1WXB A;  1X6G A;  1XOV A;  5GJW B;  4J9D A;  4LE9 A;  1CSK A;  1NEB A;  2KGT A;  1NG2 A;  1OV3 A;  1UJ0 A;  5ECA A;  3RBB B;  1K76 A;  1W70 A;  2JS2 A;  1BB9 A;  1QKW A;  1UUE A;  2CUD A;  3JV3 A;  3VS1 A;  3UAT A;  1WX6 A;  2X3X D;  1WXU A;  2DL5 A;  2KRS A;  1Z9Q A;  3R6N A;  5I11 A;  1MUZ A;  1NLP C;  2EQI A;  2EYY A;  3M0R A;  2JMC A;  3C0C A;  2LCS A;  1ABO A;  4IIM A;  2HDA A;  2O88 A;  1E6H A;  2LJ3 A;  2K9G A;  3UF4 A;  2DL3 A;  2K79 A;  3VS5 A;  4IIO A;  4F16 A;  2ROT A;  2YDL A;  3THK A;  2OI3 A;  2AZV A;  2JS0 A;  3NPF A;  2O9V A;  2JM8 A;  1JXM A;  1MV3 A;  1U06 A;  3SEM A;  4ZNX A;  2DMO A;  4EIK A;  1PWT A;  4FSS A;  2H8H A;  2KNB B;  2KR3 A;  1JXO A;  1X69 A;  2X3W D;  3RNJ A;  2LZ6 B;  1ZBJ A;  5HCK A;  3CQT A;  1H8K A;  4RTX A;  2A36 A;  3QWX X;  3EG0 A;  4Z88 A;  2KRN A;  2LQN A;  2LMJ A;  4JJD A;  4X1V A;  4CC4 B;  4CC3 A;  2LJ0 A;  2PZ1 A;  1I1J A;  2CH4 W;  4A63 B;  2FRW A;  2W0Z A;  1RLQ C;  2KBT A;  2M51 A;  1KJW A;  2LNH B;  1AWJ A;  1AZE A;  3U23 A;  2GGR A;  1UGV A;  2ESW A;  3GBQ A;  2PTK A;  1VYU A;  4RTW A;  2QDL A;  1X43 A;  1UFF A;  2DF6 A;  2RQV A;  2F2X A;  4HVU A;  2ECZ A;  1SPK A;  1VYV A;  2CSQ A;  4QT7 A;  2FPD A;  2GQI A;  1QWF A;  2RF0 A;  2P4R A;  1T0H A;  4E6R A;  1J3T A;  1JU5 C;  2GTJ A;  3KFV A;  1UHF A;  1X2K A;  2JT4 A;  1M3B A;  3NMZ C;  4AG2 C;  1HJD A;  5IHN A;  2AZS A;  4HCK A;  1PKS A;  2G6F X;  1Y0M A;  1PHT A;  2K6D A;  2DBM A;  2OAW A;  1QLY A;  2EW3 A;  5IHK A;  3I9Q A;  4LUE A;  1M27 C;  2EBP A;  2JMA A;  4M4Z A;  2J6K A;  4RUG A; 
#chains in the Genus database with same CATH topology
 5FW9 A;  2NUT B;  2EQM A;  4K11 A;  3MKD A;  3ULR B;  5KYY B;  4C0Z A;  4BI4 A;  5GMK j;  4BE1 A;  3V8J A;  3G71 T;  1SRL A;  4KGV B;  2LNV A;  1K0S A;  2DEQ A;  4PJM A;  2V1R A;  5GAN j;  2QGG A;  4ELY C;  3KBG A;  2NYS A;  5GMK h;  5GAN f;  2KXD A;  3N5B B;  5GAO p;  2ZPH B;  4PLI A;  3MEA A;  2CH4 A;  3M0U A;  2GBQ A;  4R56 A;  3OYL A;  3VV0 A;  2BZY A;  1MMN A;  2CP7 A;  2QQR A;  3S6W A;  1Q81 U;  2D8J A;  3TSZ A;  1SF9 A;  4JRK A;  3EFO B;  3G4S A;  2IVW A;  1OOT A;  4J9G A;  3CBM A;  4WCI A;  3G4S Q;  1EX4 A;  3CCU T;  2WAC A;  2NWM A;  4A4K A;  3G6E Q;  2D6F A;  1C6V X;  1T0J A;  5EG2 A;  4M77 G;  4Z8A A;  3CCE Q;  4FYX B;  4E7I A;  5IT9 E;  3PGG A;  1N6A A;  2OTL T;  3LWI A;  1XJW B;  4LD6 A;  1U5S A;  2R58 A;  1D0Y A;  4J9B A;  5HK0 A;  4RMO A;  2COY A;  2YUQ A;  2RPN A;  4UC4 A;  1R0C B;  2DXB A;  3CC2 T;  1G2B A;  1VQK T;  2EVR A;  1MND A;  2K5I A;  5LL6 S;  1N8R U;  4XK8 E;  4J9E A;  2L3R A;  1IRX A;  1K4U S;  4JZ3 A;  3HFO A;  2ATC B;  2RO0 A;  2ROL A;  5CQY A;  4LDX A;  4F14 A;  4M77 D;  2FO0 A;  2E70 A;  3VS6 A;  4FT4 A;  4OMQ A;  3OS2 A;  4X34 A;  1OPL A;  2VB6 A;  1VQL T;  2E6N A;  4HVV A;  2EIF A;  2VUB A;  3V7C A;  3HP9 A;  1WJQ A;  1WIE A;  4DEY A;  3OYC A;  4BE0 A;  2DPP B;  3M9Q A;  3QBY A;  3RR6 A;  4JUV A;  3L2U A;  1AEY A;  4BAC A;  1IHW A;  2DYI A;  3P8B B;  4LDY A;  4OMP A;  1K73 R;  1VQ9 A;  3A8G B;  4F7U B;  5GAM f;  3FJ5 A;  4XU1 A;  3CD6 A;  4RTT A;  4JDS A;  1M3C A;  2YT6 A;  2OTJ Q;  2YUO A;  3V7S A;  1KIK A;  5IH2 A;  2A7Y A;  1FMV A;  3CMA T;  1N8R R;  1G3S A;  2E4H A;  1GL5 A;  2HQH A;  4C8Q D;  3A8O B;  2HEQ A;  3EFS A;  2FZC B;  1EFN A;  4BD3 A;  3JCM d;  3M0S A;  5GAO q;  2C06 A;  1Y7X A;  3JB9 J;  3CCR T;  1K73 U;  2DYB A;  5KYW A;  3H6Z A;  5IXF A;  4E7K A;  2DVE A;  3PVQ A;  2KEA A;  2BZX A;  5KYW B;  2E41 A;  3OW2 P;  3JB9 G;  3OYF A;  2KMT A;  1MHN A;  2RI2 A;  3LWH A;  5GAN 8;  1W6X A;  5LJ3 h;  1YP5 A;  5LJ3 g;  1ZSZ A;  3VUB A;  1KQS A;  2XDD A;  2E64 A;  4RG2 A;  1RUW A;  1WHH A;  2CT4 A;  7AT1 B;  2F69 A;  2JXB A;  3OYD A;  3CCV Q;  3EAE A;  3MP1 A;  4LN2 A;  2QA4 T;  3O5Z A;  1Q81 R;  2KI7 A;  3IQL A;  1MMD A;  2HBW A;  1AWO A;  3CC2 Q;  4M75 D;  1YWP A;  1Q95 G;  3X20 B;  4M75 C;  2HCK A;  2QEX A;  2D8H A;  2MYS A;  4OMO A;  2ZAE A;  4M7D A;  4J9C A;  1KQ1 A;  3LGF A;  3PFS A;  1VQ6 T;  2DER A;  3MEW A;  4Q5W A;  2DX1 A;  4FIB A;  3E2U A;  2QGF B;  2X4J A;  2QEX T;  2FYK A;  3VS4 A;  1NEG A;  2OTL A;  3QJY A;  5FWB A;  3G71 A;  2HMA A;  2D0Q B;  1RAB B;  2DL4 A;  4JRQ A;  5GAO l;  4JS5 A;  1WYX A;  1QP2 A;  5J39 A;  5GAO r;  2LJ1 A;  3QO3 A;  1OU9 A;  3QZ9 B;  1CKA A;  3TEE A;  1IRE B;  5CKD A;  3I56 T;  2CGH A;  5EC7 A;  3L42 A;  2Y4X A;  4OB3 B;  2PVO B;  3V8L A;  3QDR B;  2KRO A;  1W1F A;  5GAN d;  5GMK e;  3CCV T;  2DXC A;  4ZTF A;  4XU3 A;  2Z0W A;  1TUD A;  4F17 A;  4PKC C;  1AOJ A;  4AFU C;  1MNE A;  1R77 A;  4M78 E;  3EG9 A;  2E12 A;  1RI0 A;  4C92 F;  3I5R A;  3A98 A;  4PLL A;  1ABQ A;  2KE9 A;  1QW1 A;  3DB3 A;  4GY5 A;  5IXB A;  1M2V A;  3OSS C;  1IO6 A;  1M2V B;  1RL2 A;  5CR2 A;  2XHC A;  3OBY A;  1OV3 A;  1SSF A;  4C92 C;  2ZPE B;  1K76 A;  1BB9 A;  2FZG B;  3CCR A;  4C8Q A;  3UAT A;  2CP2 A;  1WXU A;  1Z9Q A;  2XU8 A;  3DKM A;  1UB4 A;  1KG1 A;  5KYU B;  3JB9 D;  5GAN 4;  2JMC A;  2LCS A;  4DA4 A;  2X4W A;  4PL6 A;  3FB9 A;  2LJ3 A;  1R8O B;  1VQN Q;  3CCJ Q;  4FYW B;  4D6W A;  3CCE A;  2YDL A;  3THK A;  3CCJ A;  1P92 A;  4C92 A;  3GF5 A;  2EJG A;  2JS0 A;  2PQW A;  2K57 A;  4M7A F;  4M75 G;  4C92 D;  1VQL A;  3E1S A;  3RUX A;  2JM8 A;  1JXM A;  1IHV A;  3CBP A;  1U06 A;  4C5H A;  2QG9 B;  4ZNX A;  4M78 D;  2H8H A;  2KNB B;  3WVE B;  1JXO A;  2X3W D;  3RNJ A;  3CQT A;  3JSC A;  2JOY A;  3QXE B;  2A36 A;  4N4I A;  2KRN A;  2E5Q A;  2LMJ A;  3MEV A;  4M77 F;  2ZPI B;  3MHX A;  4A53 A;  1I1J A;  2LT4 A;  2W0Z A;  3RES A;  1KJW A;  1NPP A;  1UEB A;  1OI1 A;  3J81 E;  4E47 A;  2D9T A;  3U23 A;  1NE8 A;  2FVU A;  2E3I A;  2PTK A;  2RHY A;  4PJJ A;  3JAM E;  3L2W A;  1V76 A;  1VQP A;  1M90 R;  4RTW A;  1UGP B;  2QDL A;  1X43 A;  3GNF B;  2DF6 A;  4HT8 A;  2VYT A;  4HVU A;  1VQK A;  3ASK A;  4M7D B;  4FSX A;  3OYY A;  1QVF A;  1J3T A;  3BDL A;  1X2K A;  3E19 A;  3M5A A;  4IKF A;  3CCL T;  2HD0 A;  4FM4 B;  5FU7 B;  1HJD A;  2AZS A;  4HCK A;  4J83 A;  3TRE A;  2G6F X;  1PHT A;  2H3J A;  3JB9 F;  3UDC A;  3M58 A;  4LDV A;  2DBM A;  2OAW A;  1QLY A;  2EW3 A;  5IHK A;  3I9Q A;  4KGZ B;  5FU6 B;  2PUO B;  3C12 A;  2EBP A;  4M4Z A;  2XKO C;  1D1C A;  2MMP A;  2J6K A;  4ATO A;  4VUB A;  2A3L A;  5LJ3 f;  3OW2 S;  3AHU A;  3I56 Q;  2IG0 A;  1WJS A;  1JB0 E;  3MPU B;  3X24 B;  3HRS A;  2L3P A;  3WXM B;  5LJ3 e;  3M54 A;  4OGE A;  3EGD B;  1N5Z A;  2MWO A;  1JO8 A;  2JW4 A;  4M7D D;  1LPL A;  3EGD A;  1RLP C;  2JTE A;  1LCK A;  1K9M U;  1VQ5 Q;  1QVF P;  2F5T X;  1K9M C;  3SHW A;  3URG A;  2EAY A;  2FZK B;  1C0M A;  1YFN A;  2EYX A;  1LNX A;  1VQ6 Q;  1GCQ A;  1PRL C;  4Y91 A;  3OA6 A;  1K73 C;  2EYW A;  2KYM A;  4M7A E;  4PFP A;  1H92 A;  1Y96 A;  5C0M A;  3CCV A;  3PIO A;  4M7A B;  2X4X A;  1XNI A;  1Y96 B;  3LH0 A;  3M0P A;  2LCC A;  2SEM A;  2RI3 A;  3CPW A;  3CC2 A;  1B7T A;  1OX9 A;  2E65 A;  2LDM A;  2EQU A;  1T3L A;  4C8Q C;  1ZLM A;  5GAN 2;  2DLP A;  3NTK A;  2E1H A;  2EGA A;  3R6O A;  3EHQ A;  5L23 A;  1S72 Q;  1Q7Y R;  3RER A;  5A2Q E;  5D6X A;  4JRI A;  2HSP A;  1TSF A;  8AT1 B;  1TUG B;  2DTI A;  2RMO A;  4HT9 A;  3OMG A;  4M7D E;  4OB0 B;  1SG5 A;  1YIT Q;  4KUI A;  3S3O A;  1VQO A;  2M1H A;  2D1X A;  5I21 A;  4RTY A;  1KQS S;  4QW2 A;  1VQO Q;  2RJD A;  3GIB A;  3NFC A;  1SHF A;  2BTT A;  3Q1J A;  4M75 B;  3E9F A;  1Q86 U;  2MPX C;  4KH1 B;  1PG5 B;  2EKO A;  1JQQ A;  1XQH A;  2X35 A;  3MET A;  1BKB A;  1WHJ A;  5CKE A;  4ZN1 A;  2J6O A;  2OJ2 A;  3I35 A;  5HKC A;  1QCF A;  5CAI A;  4QVD A;  1BK2 A;  3LYI A;  4J8O A;  4CC2 A;  3HSB A;  5C6S A;  5CVI A;  3CME Q;  3P8D A;  4ZTJ A;  4Z89 A;  2EYZ A;  4J9I A;  3CCQ Q;  4HCC A;  4RCC A;  4V2S A;  2RHU A;  2RK2 A;  4DBR A;  5KYY A;  2X9H A;  5GAN g;  4E7L A;  1VQ7 Q;  5GAN h;  5AYF A;  3DLL A;  4ANJ A;  2QXF A;  4EMG A;  3CCQ A;  1BI1 A;  1X2Q A;  5D6W A;  3OYG A;  2FL7 A;  1NYG A;  1SHG A;  2HNI A;  4M77 E;  1VA7 A;  1SKU B;  3OYE A;  1O75 A;  5KCO A;  2XMF A;  3M0Q A;  2K3B A;  3CCS Q;  1UGR B;  4RTV A;  1K1Z A;  3CME T;  1WZO A;  1ZUU A;  2L2P A;  2CT3 A;  2VXE A;  4QVC A;  2AKK A;  1GCP A;  4PJO G;  3G1J A;  2A37 A;  1I81 A;  3PT9 A;  5GMK m;  4JZ4 A;  4CC7 A;  2RQR A;  3SB2 A;  4L6V 5;  5AT1 B;  3V8K A;  2P84 A;  2RHX A;  3LW5 E;  4J7I A;  2Y4Y A;  4PFZ A;  2E6Z A;  2X4Y A;  3HKS A;  2CP3 A;  1VQL Q;  2WSE E;  3G6E T;  1BCO A;  1YJ9 Q;  1NM7 A;  4P5N A;  2L8D A;  1AD5 A;  2O4X B;  2CRE A;  5KYN A;  3M55 A;  2XDB A;  3JB9 H;  2X51 A;  2YWW A;  2E5K A;  1IB8 A;  2EPD A;  3H41 A;  1M1G A;  2VGM A;  4ELZ C;  2EYQ A;  3EFR A;  5I2S A;  3M4G A;  4Y92 A;  4PJO B;  2NLU A;  3I5S A;  2V8K A;  2DVJ A;  1ZUK A;  1M8M A;  2OAU A;  2EQK A;  2CDT A;  4OGC A;  2MF2 A;  2DET A;  1YNZ A;  4KUL A;  1ZBX A;  4PK4 A;  1LOJ A;  3VRY A;  2K2V A;  1YI2 Q;  1OEB A;  1Y07 A;  2CP0 A;  4M78 B;  3ER0 A;  1FYN A;  3RKY A;  3OQ5 A;  5DY9 A;  3PIP A;  2VAS A;  5CQX A;  2JNG A;  1FXX A;  1U3O A;  1M8V A;  1I5L A;  1E7O A;  4F7U F;  1UEC A;  3HRU A;  2DNU A;  4GLM A;  1OUL A;  3M0T A;  2F2V A;  2DFU A;  2QQ9 A;  4ME7 A;  4MDX A;  2KXC A;  1M1K U;  1D0X A;  2EGE A;  1YHQ A;  3HFN A;  3BE3 A;  5DLO A;  2LX9 A;  2VGN A;  1D3B B;  3OYH A;  4RCB A;  1NLO C;  3VRZ A;  1MV0 B;  4LDU A;  4FCY A;  1VOM A;  2RQW A;  3I56 A;  4O5V A;  1TS9 A;  4HVW A;  3H8Z A;  3A1P A;  4MZT A;  3A5Z B;  1OZ3 A;  5A0G A;  1Q86 R;  5A0D A;  2A08 A;  2ZPB B;  4C8Q G;  4J6X A;  5KYX B;  3EHR A;  2FG0 A;  3REB B;  4B9X A;  1MMG A;  2KK4 A;  4HXJ A;  1VQ5 A;  3X25 B;  2K3Y A;  5CO7 A;  3OYI A;  1HD3 A;  1OU8 A;  2V26 A;  2AK5 A;  2XD0 A;  1YWO A;  3G6E A;  3QYG B;  1WXB A;  4QQD A;  4N0A A;  1Q82 U;  1TH7 A;  2BE9 B;  1VQ6 A;  2KGT A;  1U1S A;  3OYJ A;  3JCM X;  3CCM A;  2FB7 A;  3CCL Q;  1S72 T;  1UUE A;  1VQ4 Q;  3JCM f;  3VS1 A;  1WX6 A;  2NUP B;  2X3X D;  2KRS A;  2RHZ A;  2WSC E;  3X28 B;  1RAI B;  1LJO A;  4J6W A;  2KDS A;  1MUZ A;  3JCM e;  2DIQ A;  3QPH A;  1LVK A;  2HDA A;  5KYU A;  3MJX A;  1E6H A;  2O88 A;  3CXC A;  2VC8 A;  1N9R A;  4M77 A;  3INZ A;  2DL3 A;  1WHL A;  5L8R E;  2K79 A;  1QQJ A;  3VS5 A;  1KHC A;  3L2V A;  2M9U A;  3RKW A;  1W2B S;  3F70 A;  3CPW S;  3LGL A;  3OMC A;  1ZQ1 A;  3NPF A;  3M56 A;  4FYV B;  4Z02 A;  3OYN A;  4JLI A;  3SEM A;  4XTX A;  4FSS A;  1X69 A;  2KVQ G;  1N27 A;  1H8K A;  2E3H A;  4Z88 A;  3QWX X;  4RTX A;  2LQN A;  2PVG B;  4JJD A;  4CC3 A;  4GLK A;  2PZ1 A;  4A63 B;  1F1B B;  1W2B A;  3JCM Q;  3X26 B;  3PTA A;  1RLQ C;  2KBT A;  4N0A C;  4F7U E;  3OBW A;  1UGV A;  1MMA A;  4PJL A;  3GBQ A;  3NTI A;  1VQ9 Q;  3A8H B;  1VYU A;  4ZGD B;  1YIJ T;  1UFF A;  3CPF A;  5LJ5 j;  2BKD N;  2CSQ A;  1FWZ A;  2HL5 C;  4QT7 A;  4BI3 A;  1QWF A;  2P4R A;  1VQ7 A;  1JU5 C;  1UHF A;  2ZZD A;  2JT4 A;  2A0F B;  1M3B A;  2EJ9 A;  2HBP A;  2OX7 A;  4AG2 C;  2LTO A;  1PKS A;  1WNL A;  2LQ8 A;  4EMK A;  1JRI A;  5CKB A;  5DLQ E;  2Y90 A;  2EJF A;  4LUE A;  2JMA A;  3LLR A;  4JS4 A;  2JZ2 A;  2QA4 A;  1M90 U;  1JJ2 S;  4ESR A;  4F04 B;  4KUD K;  2RI5 A;  3ZEH A;  3ZL7 C;  1ZX6 A;  5I22 A;  4DQ2 A;  3TCJ A;  1WGS A;  3LH5 A;  3I55 Q;  2FHD A;  3QSU A;  4X9C A;  4QQ6 A;  5IHI A;  3P8H A;  4M77 C;  4AG1 C;  5CIU A;  1K9A A;  3M53 A;  1FMK A;  1U1T A;  2FEI A;  3CCE T;  5GAM e;  2KT1 A;  4C5E A;  2YUN A;  3QUI A;  4PJO F;  4IUP A;  3RMS A;  3C95 A;  3MP8 A;  3GLX A;  4MZP A;  4II1 A;  2J05 A;  2GF7 A;  1QP3 A;  1YJN T;  5GMK l;  4ORZ A;  1SEM A;  4F7U G;  1E6G A;  1GCQ C;  2ZPF B;  3S3N A;  2J7I A;  2VWF A;  1N8R C;  1GFD A;  1ZSG A;  4QQG A;  1PSE A;  4OF1 A;  4M75 A;  4AFS C;  3H0I A;  3GPL A;  1YJN A;  1HXD A;  2AT1 B;  3EG2 A;  1YI2 A;  4IUV A;  1YJW T;  2GNC A;  5D6Y A;  3CD6 Q;  4LNP A;  2CZ6 B;  3FLG A;  3MEU A;  1X6O A;  2HZY A;  1VIE A;  4M7D F;  4C92 E;  5FWC A;  3OS1 A;  2O9S A;  5KH6 A;  4R55 A;  5HY6 A;  1JEG A;  2ABL A;  1ZSZ C;  3CC4 A;  5KCH A;  1RAH B;  1BI3 A;  5LJ5 g;  3QII A;  4LUD A;  3CCS T;  1CKB A;  2RJE A;  3HRT A;  3CC4 Q;  2QTX A;  3REA B;  4JJB A;  1GFC A;  3E9G A;  4XTU A;  3FEO A;  5GAO m;  1VQP T;  2JUF A;  5I2M A;  3VS7 A;  5GMK i;  1S1N A;  3JCM W;  3CD6 T;  4BY6 C;  1UHC A;  2L5Q A;  3SWN A;  2COW A;  4PJO D;  1AZG B;  2KT8 A;  4BB7 A;  2HAX A;  4NS5 A;  5GAN 3;  4HCB A;  1VQM Q;  4B9W A;  3CCJ T;  5CKF A;  1KQ2 A;  2MI6 A;  2VKN A;  2RQU A;  1VQM A;  4DOW A;  2LVM A;  3CXC S;  4FU6 A;  3CC7 Q;  4XAX B;  1VQ7 T;  3EGX A;  1AWX A;  5J3B A;  3EGX B;  4ZN3 A;  3NGP A;  1X01 A;  4QKU A;  1IGQ A;  2J6F A;  1X27 A;  1W4S A;  1WHM A;  2A28 A;  1PSF A;  5GAM j;  3CMA Q;  3CCU A;  2WSF E;  1VQ4 A;  2AKL A;  3VU3 C;  1YJ9 T;  3HTR A;  1UGS B;  4E7J A;  1W2B P;  1ZHI A;  3VS3 A;  1ZSZ B;  1VQ8 T;  4FYY B;  4PJN A;  1G3W A;  3CC4 T;  1I5O B;  1FMW A;  1JBM A;  1MGQ A;  4FT2 A;  1PNJ A;  2BIV A;  4OML A;  5GAM h;  1BBZ A;  2FPF A;  2O31 A;  2P0P A;  1ZUY A;  8ATC B;  2FPE A;  2MIO A;  1QVG S;  1KSW A;  1QWE A;  1KK7 A;  2DIG A;  3UT1 A;  2L3Q A;  1TTH B;  4EDU A;  3D7S B;  4KT0 E;  1YI2 T;  4C8Q B;  2VVK A;  1C1A A;  1WXT A;  2DJQ A;  3HPW A;  2JM9 A;  1KC8 U;  3SWN C;  1UDL A;  1M9S A;  4JRP A;  4R0K A;  4D8D A;  2DK3 A;  2M0O A;  4BY6 B;  4CI0 C;  3CEY A;  2V8J A;  1K0X A;  2HKN A;  4AMC A;  3OY9 A;  1WHK A;  1BI2 A;  2PU9 B;  5LJ5 d;  2SRC A;  2MWP A;  2QQA A;  1RAD B;  2OTJ T;  2J06 A;  4A4G A;  1I0C A;  1BU1 A;  5IAY A;  4HCZ A;  2LC4 A;  2DRM A;  4DOV A;  2C0I A;  3M59 A;  3L2Z A;  4MDW A;  1D3B A;  3VYG A;  2RM4 A;  6AT1 B;  1AVZ C;  5HK3 A;  3JCM V;  1VQN T;  1D09 B;  3H0H A;  2M02 A;  2QYZ A;  4A4F A;  5GAM d;  4KBM B;  2L3S A;  4XTY A;  3TSW A;  3NHN A;  3S3M A;  1EIF A;  9ATC B;  4J5Y A;  5FRN A;  3JB9 I;  1WDX A;  2YHT A;  2RHI A;  2CS7 A;  2D0N A;  4C0D C;  1SRM A;  1UTI A;  1M3A A;  3OYM A;  2RH2 A;  1Z9Z A;  1VQN A;  3G7Z A;  1JJ2 A;  2GCX A;  1RAA B;  5FU6 C;  1YIT T;  1OYX A;  1NJI R;  4BE2 A;  1M1F A;  2R5M A;  1YN8 A;  1M1K C;  2QA4 Q;  5LJ5 e;  2K3X A;  2RK1 A;  1QCN A;  4E7S A;  4FL6 A;  1H3H A;  2HL3 A;  1XTD A;  2I0N A;  2K7A A;  4AFZ C;  5GAN 5;  4M7D G;  1IGU A;  4L5G A;  1GBQ A;  2ZCF B;  2CYZ B;  2KAF A;  4OB2 B;  2DKG A;  4M7D C;  1UJY A;  3GP8 A;  4C5I A;  4QVZ A;  2XK0 A;  4RG8 A;  2C0T A;  4DBQ A;  4M77 B;  1BI0 A;  2DL8 A;  4LXC A;  1X6G A;  1XOV A;  1TOV A;  4J9D A;  1UJ0 A;  4ZGJ B;  5ECA A;  3EH2 A;  2AHJ B;  2JS2 A;  3OS0 A;  3EFO A;  1QKW A;  4L59 A;  4WTO B;  3G4S T;  2RD1 A;  3VKI A;  1PCX A;  5IN1 A;  3SFM A;  1VQ4 T;  1NJI U;  1NJI C;  2YLC A;  2QI2 A;  1NLP C;  2EQI A;  1M90 C;  2RB6 A;  3C0C A;  1RAF B;  4LD9 K;  5A0L A;  3QDF A;  1WQ7 A;  2K9G A;  3UF4 A;  2VXF A;  3UWN A;  3PMT A;  4IIO A;  4M78 F;  4F16 A;  2ROT A;  2HQX A;  2OI3 A;  1QMC A;  3FJP A;  2QQS A;  2GFA A;  2ZPG B;  2AIR B;  3JCM b;  2JTM A;  1MV3 A;  1QVG A;  1YIJ Q;  3JCM J;  2DMO A;  3LX7 A;  1G5V A;  2CZ1 B;  3L2R A;  1ZBJ A;  5HCK A;  1ZA1 B;  1VQM T;  3EG0 A;  4JJN K;  4CC4 B;  2CH4 W;  3GNG A;  3CC7 T;  2FRW A;  2HQE A;  2QAS A;  2CZ7 B;  2M51 A;  2DD5 A;  4C92 B;  1AWJ A;  1AZE A;  2H3E B;  4M7A G;  3NTH A;  2M16 A;  3EH1 A;  3I55 T;  1EZZ B;  1KC8 R;  4MML A;  2XG8 D;  3GOX A;  2ECZ A;  1SPK A;  1VYV A;  3QZ5 B;  4XTW A;  3ZFJ A;  2LRQ A;  3CCS A;  1VIF A;  2FPD A;  2GQI A;  1YJW A;  1K9M R;  2RF0 A;  4HKE A;  3KXT A;  1T0H A;  4E6R A;  2GQV A;  3KFV A;  3MO8 A;  5KE3 A;  2QEX Q;  3A8M B;  3NMZ C;  5FRM A;  4IUT A;  3EG9 B;  3OYA A;  4DBF A;  4DBH A;  5KE2 A;  3UPU A;  3CMA A;  3CCU Q;  1VQO T;  2COZ A;  1M27 C;  2MK5 A;  2CP5 A;  2PUK B;  2YRD A;  3JCM P;  5FRO A;  1PD1 A;  1UGQ B;  1TU0 B;  1S72 A;  2BE7 D;  2F5K A;  3VYH B;  2OTL Q;  4J6Y A;  5LJ3 j;  1QCO A;  3EG3 A;  1RI9 A;  1PRM C;  1M30 A;  2VV5 A;  5DM7 R;  2GFU A;  2EKH A;  2PNI A;  4JPB W;  1Q82 R;  1YIT A;  2DE0 X;  2W10 A;  2DIL A;  2DTO A;  1D0Z A;  4F7U A;  4M75 E;  3M57 A;  4CRI A;  1WI7 A;  2IPO B;  2M0Y A;  1M2O A;  3PMI A;  5KYX A;  3BFM A;  1V29 B;  3HHT B;  3OYK A;  1VQP Q;  4IUR A;  5FLX E;  1ARK A;  5GAN 6;  1QVF S;  2RNA A;  1YCY A;  1NYF A;  2RQT A;  4E7H A;  1HK9 A;  3TU4 K;  3DLM A;  2MAM A;  3L1A A;  1UG1 A;  2NUP A;  3VS2 A;  1B07 A;  3MP6 A;  4IUQ A;  2DRK A;  1KC8 C;  2DD4 A;  4ZGE B;  2QK0 A;  3RKX A;  1B34 A;  2XI9 A;  1GXI E;  1PKT A;  2EQJ A;  4C0D B;  2K2M A;  1WPY A;  5D7U A;  3C94 A;  3CCR Q;  1AWW A;  1WJR A;  1K8A R;  4M7A D;  2C0O A;  4A54 A;  4D8K A;  3JCM c;  2QQB A;  2YSQ A;  1I07 A;  3C4S A;  4M78 C;  1ZA2 B;  4OMM A;  2DJZ A;  1I4K 1;  3M4Y A;  3T9N A;  3CPW P;  4LDW A;  4NL3 A;  3O8V A;  1NZ9 A;  1WA7 A;  2LQW A;  1A0N B;  2MOX A;  3EGU A;  1N9S A;  4PJO C;  1VQ8 Q;  2P0Q A;  3DB4 A;  2ED1 A;  1K8A U;  4BUG A;  2KRM A;  1D1B A;  5GJV B;  2QAZ A;  1WQW A;  2XID A;  2RA2 A;  3CBO A;  1Y57 A;  1GBR A;  3SWN B;  3TVT A;  4KGX B;  4BI8 B;  5CK9 A;  1KFZ A;  1VYT A;  1TXQ A;  3OS5 A;  4OMN A;  2LCL A;  4J9F A;  2XDP A;  4M78 G;  2CSI A;  4J7F A;  2B86 A;  4RTZ A;  4RKU E;  1SSH A;  3VJP A;  2BUD A;  3WVD B;  4AT1 B;  4FW1 A;  1I8F A;  2JVV A;  1GRI A;  1VQK Q;  3CCM T;  4JJC A;  4A4H A;  3JRZ A;  1PC0 A;  2LP5 A;  2FRY A;  2MCN A;  4C5G A;  1TWB A;  3ME9 A;  4XU2 A;  2I2L A;  1H3Z A;  3RDV A;  1TUC A;  2L0A A;  3VS0 A;  1YCS B;  4N4G A;  2DA9 A;  3V7R A;  5GAN 7;  1M5Q 1;  4E7Z A;  4C0G A;  1Q7Y U;  2DEU A;  1Q7Y C;  2V1Q A;  2CP6 A;  1HYO A;  3QKJ A;  1X6B A;  3PVL A;  1VQ9 T;  1YHQ Q;  3FC3 A;  5GAO n;  3FIF A;  1FX7 A;  5LJ3 d;  4XQ3 A;  4KRT A;  1IXD A;  1V1C A;  2YUP A;  2JJ9 A;  4EMH A;  1YIJ A;  3BDU A;  2YXY A;  1KD1 C;  2DL7 A;  5LJ5 h;  4RTU A;  4OB1 B;  2YRV A;  1KD1 U;  3TQ7 P;  3H0F A;  3SD4 A;  1QKX A;  1HSQ A;  1RAG B;  3J80 E;  1BYM A;  3PE0 A;  2F2W A;  4DEX A;  2ED0 A;  4A4E A;  1Y71 A;  3JCM h;  1RAC B;  1WFW A;  1BCM A;  1G83 A;  1UE9 A;  3SDZ A;  2DM1 A;  1YHQ T;  4AFQ C;  4JLG A;  2LT1 A;  3RIR A;  2DTH A;  2KY9 A;  5CCA A;  1TG0 A;  2F1L A;  1B34 B;  4PNO A;  2RJF A;  1M4Z A;  3HL8 A;  2KYB A;  2O4X A;  5GAN e;  3QG1 A;  2O2O A;  1YJW Q;  2GTO A;  1T3S A;  3UA6 A;  2ENM A;  1O9S A;  2QTV A;  2NUZ A;  2DXT A;  2ZGW A;  3VUZ A;  4J9H A;  2DXU A;  2V8I A;  3OSV A;  1JJ2 P;  4WF2 A;  5M9O A;  2P0K A;  4MZM A;  1KD1 R;  1PD0 A;  3I55 A;  1B3Q A;  5J26 A;  3QWY A;  2E10 A;  1OPK A;  2K5L A;  3OYB A;  2KQW A;  4GBQ A;  1WLP B;  2YRC A;  3UA7 A;  3EG1 A;  2RJC A;  2DZ9 A;  2CUB A;  3AT1 B;  2BZ8 A;  5CKH A;  2LX7 A;  1Q81 C;  4M7A C;  5FU7 C;  3L2Q A;  2K5F A;  2DBK A;  1KQS P;  4YTL A;  1D1A A;  2G3R A;  1WHG A;  2JN0 A;  2KSS A;  3OB9 A;  1VQ5 T;  1QVP A;  2RN8 A;  1PM3 A;  1OQK A;  4C8Q E;  4EMK B;  1AT1 B;  2IIM A;  4B6M A;  1YBY A;  1DJ7 B;  2EGC A;  4O6J A;  4NL2 A;  5GJW B;  4LE9 A;  1CSK A;  1NEB A;  1YJN Q;  1IZ6 A;  1KHI A;  1NG2 A;  1X75 C;  2P4T A;  4M75 F;  3RBB B;  1W70 A;  2B8A A;  2DAQ A;  2HKQ B;  2OTJ A;  3CME A;  1BIA A;  2HSE B;  2CUD A;  3JCM g;  3JV3 A;  4XTV A;  4X9D A;  2DL5 A;  3R6N A;  2R57 A;  5I11 A;  2JTF A;  2EYY A;  3M0R A;  4KH0 B;  3BY7 A;  4N4H A;  1M1K R;  1ABO A;  2L89 A;  4IIM A;  3CCQ T;  1R0B G;  1NPR A;  2PVD B;  3BW1 A;  4PJO A;  3OW2 A;  1G8X A;  2AZV A;  1Q82 C;  4OMF B;  1RAE B;  1Q86 C;  2O9V A;  2CZ0 B;  1OX8 A;  4M7A A;  1G3Y A;  2DZC A;  4EIK A;  1PWT A;  4PFO A;  2KR3 A;  2LZ6 B;  2YLB A;  1QVG P;  1OZ2 A;  1H64 1;  4M78 A;  4NOY A;  4X1V A;  3RMQ A;  4E2F B;  2LJ0 A;  4IUU A;  3QJ6 A;  2CKK A;  1VUB A;  2LNH B;  2XIC A;  1VQ8 A;  1AHJ B;  1NBE B;  3CC7 A;  4HA8 A;  4C0F A;  3KUF A;  2GGR A;  2ESW A;  3CXC P;  3A8L B;  4Y28 E;  1YJ9 A;  3FDR A;  3CCM Q;  4MMK A;  3CCL A;  5LJ5 f;  2K4Y A;  4TVR A;  2RQV A;  2F2X A;  4EMK C;  4C92 G;  4OP0 A;  3H9N A;  4BDY A;  2O01 E;  4BDZ A;  3QHS A;  2GTJ A;  1K8A C;  3PNW C;  3MCA B;  3ZBD A;  3G71 Q;  3QYH B;  2EFI A;  5IHN A;  4PJO E;  2LQK A;  2R5A A;  2DO3 A;  5GAM g;  1BIB A;  1Y0M A;  2QDY B;  1ACM B;  1G3T A;  3FRN A;  2K6D A;  4C8Q F;  4FW2 A;  4EPC A;  4OVA A;  1U8R A;  4XU0 A;  2NUT A;  2EWN A;  4XTZ A;  3J7A F;  4RUG A; 
#chains in the Genus database with same CATH homology
 5FW9 A;  4ESR A;  4K11 A;  3ULR B;  3EG3 A;  1ZX6 A;  3ZL7 C;  1RI9 A;  1PRM C;  1M30 A;  5I22 A;  2L3P A;  1SRL A;  3LH5 A;  2EKH A;  2PNI A;  4JPB W;  2DE0 X;  1N5Z A;  2W10 A;  2DIL A;  1K0S A;  2V1R A;  1JO8 A;  5IHI A;  2JW4 A;  1RLP C;  4AG1 C;  2JTE A;  1K9A A;  1WI7 A;  1LCK A;  2M0Y A;  1FMK A;  2FEI A;  3SHW A;  2KT1 A;  2KXD A;  2YUN A;  2EYX A;  1GCQ A;  1PRL C;  2CH4 A;  3M0U A;  2GBQ A;  2J05 A;  2EYW A;  1ARK A;  2KYM A;  2BZY A;  4ORZ A;  1SEM A;  2D8J A;  1H92 A;  3TSZ A;  2RNA A;  2RQT A;  1NYF A;  1E6G A;  1GCQ C;  1OOT A;  2J7I A;  2VWF A;  4J9G A;  1UG1 A;  3M0P A;  4WCI A;  3VS2 A;  2SEM A;  1B07 A;  2DRK A;  1GFD A;  2NWM A;  1ZSG A;  1T3L A;  1ZLM A;  3H0I A;  4AFS C;  1T0J A;  4Z8A A;  2DLP A;  3EG2 A;  2GNC A;  1PKT A;  2EGA A;  2K2M A;  1AWW A;  1U5S A;  3EHQ A;  4LNP A;  2C0O A;  5L23 A;  4D8K A;  4J9B A;  2YSQ A;  1I07 A;  5FWC A;  2O9S A;  2HSP A;  2RMO A;  4OMM A;  2YUQ A;  1JEG A;  2RPN A;  2ABL A;  2D1X A;  4RTY A;  1G2B A;  4LUD A;  2EVR A;  1CKB A;  1SHF A;  2BTT A;  4J9E A;  1WA7 A;  2LQW A;  3REA B;  1A0N B;  4JJB A;  1GFC A;  2MOX A;  1K4U S;  4JZ3 A;  3EGU A;  1JQQ A;  3VS7 A;  2ROL A;  1S1N A;  2ED1 A;  4F14 A;  2J6O A;  2FO0 A;  2OJ2 A;  3I35 A;  3VS6 A;  1UHC A;  2KRM A;  4OMQ A;  1QCF A;  1OPL A;  5GJV B;  4HVV A;  1AZG B;  1BK2 A;  2KT8 A;  1Y57 A;  4CC2 A;  1WIE A;  4DEY A;  1GBR A;  3TVT A;  1KFZ A;  4Z89 A;  1VYT A;  2EYZ A;  4J9I A;  2VKN A;  2RQU A;  4OMN A;  4J9F A;  1X2Q A;  2CSI A;  1AEY A;  1AWX A;  2B86 A;  4RTZ A;  1SSH A;  4OMP A;  1NYG A;  1SHG A;  1VA7 A;  3NGP A;  3FJ5 A;  2J6F A;  1X27 A;  4RTT A;  2XMF A;  2A28 A;  2K3B A;  3M0Q A;  1M3C A;  2YT6 A;  1GRI A;  2YUO A;  2AKL A;  1KIK A;  5IH2 A;  4JJC A;  4RTV A;  1K1Z A;  2LP5 A;  2FRY A;  1GL5 A;  1ZUU A;  2L2P A;  2CT3 A;  2MCN A;  3VS3 A;  2AKK A;  2HEQ A;  1GCP A;  2A37 A;  1TUC A;  4JZ4 A;  2L0A A;  4CC7 A;  3VS0 A;  1EFN A;  1PNJ A;  1YCS B;  2RQR A;  4OML A;  3M0S A;  2DA9 A;  1BBZ A;  2FPF A;  2O31 A;  1ZUY A;  2FPE A;  2MIO A;  2DYB A;  1QWE A;  1KSW A;  5IXF A;  2V1Q A;  3PVQ A;  1X6B A;  2KEA A;  2BZX A;  3PVL A;  2L3Q A;  4KRT A;  1V1C A;  2YUP A;  2VVK A;  1WXT A;  2DJQ A;  2JM9 A;  2DL7 A;  4RTU A;  1NM7 A;  1W6X A;  1UDL A;  1YP5 A;  1AD5 A;  3H0F A;  2CRE A;  1QKX A;  4R0K A;  4D8D A;  1HSQ A;  3PE0 A;  2E5K A;  1RUW A;  2F2W A;  2EPD A;  2CT4 A;  4DEX A;  2ED0 A;  2JXB A;  3H41 A;  4LN2 A;  1K0X A;  3O5Z A;  1WFW A;  2SRC A;  1G83 A;  1UE9 A;  4Y92 A;  2DM1 A;  3I5S A;  3IQL A;  2DVJ A;  1ZUK A;  4AFQ C;  2HBW A;  2J06 A;  1M8M A;  1AWO A;  1I0C A;  1YWP A;  2CDT A;  1BU1 A;  2HCK A;  1YNZ A;  2D8H A;  2DRM A;  4OMO A;  2C0I A;  3VRY A;  1TG0 A;  4J9C A;  1OEB A;  2KYB A;  1AVZ C;  2O2O A;  1FYN A;  3H0H A;  2GTO A;  2DX1 A;  2L3S A;  3TSW A;  1T3S A;  3UA6 A;  3NHN A;  2ENM A;  1U3O A;  2NUZ A;  3VS4 A;  1NEG A;  1WDX A;  1E7O A;  5FWB A;  2D0N A;  1UEC A;  4J9H A;  2DL4 A;  1SRM A;  1UTI A;  2DNU A;  4GLM A;  3M0T A;  1M3A A;  2F2V A;  1WYX A;  2KXC A;  2LJ1 A;  1B3Q A;  1Z9Z A;  2EGE A;  3QWY A;  1OPK A;  1CKA A;  4GBQ A;  5EC7 A;  1WLP B;  1YN8 A;  3UA7 A;  3EG1 A;  1NLO C;  2CUB A;  2BZ8 A;  3VRZ A;  2LX7 A;  1MV0 B;  2KRO A;  1W1F A;  1H3H A;  2DBK A;  2RQW A;  4HVW A;  2I0N A;  2K7A A;  4AFZ C;  1GBQ A;  1TUD A;  4F17 A;  1AOJ A;  4AFU C;  2A08 A;  3EHR A;  1UJY A;  2FG0 A;  2RN8 A;  3REB B;  3I5R A;  3A98 A;  1ABQ A;  2KE9 A;  4HXJ A;  2IIM A;  2C0T A;  5IXB A;  1HD3 A;  2DL8 A;  2AK5 A;  1YWO A;  2EGC A;  1IO6 A;  1WXB A;  1X6G A;  1XOV A;  5GJW B;  4J9D A;  4LE9 A;  1CSK A;  1NEB A;  2KGT A;  1NG2 A;  1OV3 A;  1UJ0 A;  5ECA A;  3RBB B;  1K76 A;  1W70 A;  2JS2 A;  1BB9 A;  1QKW A;  1UUE A;  2CUD A;  3JV3 A;  3VS1 A;  3UAT A;  1WX6 A;  2X3X D;  1WXU A;  2DL5 A;  2KRS A;  1Z9Q A;  3R6N A;  5I11 A;  1MUZ A;  1NLP C;  2EQI A;  2EYY A;  3M0R A;  2JMC A;  3C0C A;  2LCS A;  1ABO A;  4IIM A;  2HDA A;  2O88 A;  1E6H A;  2LJ3 A;  2K9G A;  3UF4 A;  2DL3 A;  2K79 A;  3VS5 A;  4IIO A;  4F16 A;  2ROT A;  2YDL A;  3THK A;  2OI3 A;  2AZV A;  2JS0 A;  3NPF A;  2O9V A;  2JM8 A;  1JXM A;  1MV3 A;  1U06 A;  3SEM A;  4ZNX A;  2DMO A;  4EIK A;  1PWT A;  4FSS A;  2H8H A;  2KNB B;  2KR3 A;  1JXO A;  1X69 A;  2X3W D;  3RNJ A;  2LZ6 B;  1ZBJ A;  5HCK A;  3CQT A;  1H8K A;  4RTX A;  2A36 A;  3QWX X;  3EG0 A;  4Z88 A;  2KRN A;  2LQN A;  2LMJ A;  4JJD A;  4X1V A;  4CC4 B;  4CC3 A;  2LJ0 A;  2PZ1 A;  1I1J A;  2CH4 W;  4A63 B;  2FRW A;  2W0Z A;  1RLQ C;  2KBT A;  2M51 A;  1KJW A;  2LNH B;  1AWJ A;  1AZE A;  3U23 A;  2GGR A;  1UGV A;  2ESW A;  3GBQ A;  2PTK A;  1VYU A;  4RTW A;  2QDL A;  1X43 A;  1UFF A;  2DF6 A;  2RQV A;  2F2X A;  4HVU A;  2ECZ A;  1SPK A;  1VYV A;  2CSQ A;  4QT7 A;  2FPD A;  2GQI A;  1QWF A;  2RF0 A;  2P4R A;  1T0H A;  4E6R A;  1J3T A;  1JU5 C;  2GTJ A;  3KFV A;  1UHF A;  1X2K A;  2JT4 A;  1M3B A;  3NMZ C;  4AG2 C;  1HJD A;  5IHN A;  2AZS A;  4HCK A;  1PKS A;  2G6F X;  1Y0M A;  1PHT A;  2K6D A;  2DBM A;  2OAW A;  1QLY A;  2EW3 A;  5IHK A;  3I9Q A;  4LUE A;  1M27 C;  2EBP A;  2JMA A;  4M4Z A;  2J6K A;  4RUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...