2EPDA

Solution structure of sh3 domain in rho-gtpase-activating protein 4
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
76
structure length
76
Chain Sequence
GSSGSSGEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERASSDWWRGEHNGMRGLIPHKYITLPAGTEKQVVGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of SH3 domain in Rho-GTPase-activating protein 4
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Rho GTPase-activating protein 4
total genus 5
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2epdA00
4HCKA 4OMLA 2YUPA 1PWTA 2O88A 1WI7A 2YDLA 2PNIA 4GBQA 2FPFA 1UDLA 1I07A 2M0YA 1FMKA 2RF0A 1UECA 4FSSA 1SEMA 3REBB 2I0NA 3CQTA 1VYUA 2O31A 1JU5C 1BU1A 5FWBA 2JM8A 2FPEA 2KT1A 3PVLA 2EGEA 1JQQA 1SHGA 2RQRA 1MV3A 5EC7A 3VRZA 4AG1C 1ZLMA 1QWFA 3JV3A 2CSIA 1PRMC 1ABQA 2CUBA 2LJ1A 1MUZA 1I1JA 4LE9A 2EYXA 2GGRA 1FYNA 2LJ0A 3I35A 3M0PA 2F2VA 2L2PA 4R0KA 2HBWA 1ZUYA 1YWOA 2JMAA 2RMOA 4HVUA 2NWMA 4OMPA 2LZ6B 1M30A 4E6RA 1JEGA 2EVRA 2DA9A 2OAWA 2KEAA 2JW4A 1K0SA 2RQWA 1ZX6A 2CREA 2HSPA 3H0FA 2KRNA 3TSZA 1M3BA 3FJ5A 2DLPA 4J9HA 2EQIA 4GLMA 1M3CA 1T3SA 1ZUUA 2LJ3A 1K9AA 2ECZA 1WXUA 1UFFA 1U3OA 2K6DA 1AD5A 2KE9A 3NMZC 1G2BA 4J9IA 2KRMA 3RBBB 1X27A 2LNHB 1AWOA 1RLPC 1KFZA 1G83A 2DYBA 1KIKA 1RI9A 5IHNA 2EBPA 1NLOC 1U5SA 2DL4A 2OI3A 2YSQA 2YT6A 5GJWB 2DE0X 3M0TA 2YUQA 1NEGA 2V1QA 2GBQA 3VS3A 2DRKA 4HXJA 4RUGA 1EFNA 2FPDA 4OMOA 3SHWA 2FRYA 4Z89A 4F14A 1WFWA 1NYFA 2VKNA 4AG2C 4RTWA 1ZUKA 2C0IA 3VS7A 1A0NB 1YP5A 2AZVA 1GBQA 5IXBA 1X6GA 1K4US 1OPKA 1WXTA 2CDTA 4F17A 2SRCA 2DX1A 1RLQC 1S1NA 5IHIA 4KRTA 3ZL7C 3VS0A 2O9VA 4RTUA 1BB9A 2JXBA 1UJYA 2KBTA 3UA6A 3THKA 1XOVA 3UA7A 1YCSB 5HCKA 1X6BA 1HD3A 2L3PA 2DL3A 2RQTA 3REAB 1K1ZA 2FO0A 2BZXA 4DEXA 1JO8A 1AZGB 3GBQA 4JJDA 2J05A 4X1VA 1AOJA 3NGPA 4A63B 1GFCA 2KYMA 3QWXX 3M0SA 2RQVA 1AWJA 1GCQC 2DL7A 2O9SA 2EYWA 1UE9A 2X3WD 1CKBA 3EGUA 1UHCA 2DBKA 1HSQA 2G6FX 2LQWA 3H0IA 3R6NA 2YUNA 1UUEA 2JMCA 1V1CA 2V1RA 1E6GA 4QT7A 3EHRA 4LUEA 3EHQA 1TUDA 3I5SA 3TVTA 1H8KA 2CH4A 2C0TA 2KR3A 2KNBB 1NG2A 2LCSA 3LH5A 3ULRB 2A36A 2ABLA 1NM7A 4ZNXA 2DRMA 1SSHA 2ED1A 3UATA 1T0JA 4J9CA 2H8HA 5I22A 1QCFA 1TUCA 1WXBA 2DNUA 1ARKA 1GFDA 4OMMA 1K0XA 1ZBJA 2DF6A 2K9GA 2O2OA 4OMNA 3UF4A 3NPFA 1VYVA 2KXDA 1E7OA 2D8JA 1HJDA 1GL5A 1IO6A 1N5ZA 2HEQA 2HCKA 2J06A 2JM9A 1CKAA 2YUOA 1Z9ZA 4IIOA 3C0CA 3M0RA 4AFZC 1YWPA 1BK2A 4ORZA 1T3LA 2DBMA 2K2MA 5IHKA 2VVKA 1GRIA 4Z8AA 2W0ZA 4Z88A 5FWCA 2KYBA 3M0UA 2SEMA 2ESWA 2AK5A 4HVVA 4LNPA 1SRLA 2J7IA 3A98A 1NLPC 3VS2A 2DILA 1UHFA 4AFQC 2NUZA 2PTKA 4EIKA 1YN8A 4AFUC 2KXCA 2L3QA 1AZEA 1PKSA 2LMJA 1W6XA 2A37A 5I11A 1AWWA 1UTIA 2LQNA 1WYXA 2DMOA 3VS4A 2L3SA 4DEYA 2ROTA 4LN2A 1JXOA 1I0CA 3RNJA 2CT3A 1X2KA 4JJCA 4D8KA 4AFSC 5L23A 2KGTA 1X2QA 2CSQA 2C0OA 2ROLA 4K11A 3U23A 1OV3A 1WA7A 4JPBW 2BZ8A 2LX7A 2XMFA 3PVQA 2F2WA 4CC7A 1NYGA 1OEBA 2J6KA 2EGAA 2FEIA 2VWFA 2EPDA 4J9EA 3VS5A 1GBRA 2CH4W 1ABOA 1SRMA 2JTEA 4LUDA 4F16A 3NHNA 4CC3A 4RTTA 2IIMA 2LP5A 3EG3A 2L0AA 1LCKA 1CSKA 3KFVA 2KROA 1GCQA 4IIMA 2JT4A 2DL5A 1M8MA 2AKLA 3EG0A 4J9GA 1SHFA 1WX6A 1Z9QA 5IH2A 2EW3A 1W1FA 2KT8A 2PZ1A 1JXMA 2HDAA 4M4ZA 3IQLA 2EKHA 2E5KA 1QKXA 2KRSA 1K76A 4D8DA 1GCPA 1UJ0A 3QWYA 2K7AA 2AKKA 1QWEA 1AVZC 3I9QA 4J9BA 4J9DA 3VS1A 2DM1A 2AZSA 1PHTA 1UG1A 4RTZA 4ESRA 3H0HA 4RTYA 2JS0A 2W10A 4WCIA 2A08A 2CUDA 1PKTA 1BBZA 3M0QA 2EYYA 1AEYA 1B07A 1U06A 2RQUA 4RTVA 1T0HA 2DL8A 2J6OA 2D1XA 3PE0A 1YNZA 2M51A 2ENMA 4HVWA 1OPLA 2FG0A 1KSWA 1QKWA 2RPNA 2ED0A 1W70A 4J9FA 4CC4B 4JZ3A 3VS6A 2OJ2A 2EGCA 2EYZA 1M27C 1WLPB 4Y92A 1SPKA 2X3XD 2BTTA 2QDLA 2A28A 1WIEA 3EG1A 2D0NA 2D8HA 2K79A 2RNAA 5FW9A 4RTXA 2GTJA 1Y0MA 4JZ4A 3TSWA 1VYTA 2F2XA 2B86A 4CC2A 5IXFA 5ECAA 1ZSGA 2DVJA 1KJWA 2J6FA 2JS2A 1M3AA 1WDXA 1X69A 1B3QA 2RN8A 2GQIA 2CT4A 1NEBA 1MV0B 3EG2A 3O5ZA 3H41A 2BZYA 1OOTA 1PRLC 1X43A 1TG0A 2DJQA 1RUWA 1QLYA 1H92A 2FRWA 5GJVB 2K3BA 2MOXA 1UGVA 1PNJA 1VA7A 2MIOA 4JJBA 1H3HA 1J3TA 1E6HA 2GNCA 2GTOA 3SEMA 1Y57A 2P4RA 3VRYA 3I5RA 2MCNA 1AWXA 4OMQA
chains in the Genus database with same CATH superfamily
5HK3A 1X01A 5LL6S 3M56A 2PNIA 3EAEA 1VQLA 1UDLA 1I07A 2M0YA 1TTHB 1FMKA 2QTXA 4M77C 1YHQA 2EJ9A 1UECA 1Q82C 1SEMA 1G3YA 4J7IA 3REBB 2MWOA 5I2SA 1KQSA 4EMHA 3VYHB 1NPPA 3D7SB 1P92A 1JU5C 5KYXB 2KT1A 3MP1A 2RHUA 1JQQA 1MV3A 2P84A 1AHJB 4JRQA 1Q86C 1VQPT 3LYIA 1YCYA 8ATCB 3JV3A 1I4K1 3MPUB 4DBFA 4PJOA 1VQPQ 1PRMC 4ELYC 9ATCB 1DJ7B 2ZPHB 2LJ1A 2O01E 5CKFA 3CCQT 1I1JA 4PKCC 2EYXA 2GGRA 3EGDA 4F7UF 1FYNA 5CAIA 1I5OB 2F2VA 4B9WA 4PJJA 3CC4Q 1ZUYA 1YWOA 2C06A 1H641 3HP9A 4HVUA 1XQHA 2LZ6B 2DIQA 1VQ4T 2E3IA 3OYMA 5LJ5f 2KEAA 1K0SA 3L42A 3S3NA 2I2LA 4M7DD 3CCVA 2KRNA 5GAMh 4BACA 1M3BA 3SD4A 4C8QA 1WGSA 4J9HA 1UGQB 3CXCS 3G1JA 2HQEA 2LJ3A 3SWNA 1ZHIA 2XI9A 4QVCA 1WXUA 3PIPA 5FU6B 3OW2P 3CD6T 3X25B 3NMZC 4J9IA 1G2BA 1VQKA 2KRMA 5LJ5h 3UWNA 2KSSA 3V7SA 4ME7A 2DYBA 2XK0A 3CCJA 4XU1A 4M75D 5C0MA 1SKUB 2ZCFB 2DL4A 2K3XA 2YT6A 5GJWB 4L5GA 3CCMQ 3QKJA 4II1A 1YHQT 2OTJT 2E5QA 5GAN2 4RUGA 2CZ0B 1QVPA 2FPDA 4F04B 2COWA 4OMOA 4ATOA 4M78C 1TS9A 3QG1A 2V26A 3HFNA 1Y96B 5D7UA 8AT1B 2VKNA 3LW5E 4AG2C 4JS5A 1ZUKA 5GMKl 3LGLA 3EGDB 2FZCB 1X6GA 1OPKA 4A4KA 4XTZA 1EZZB 2E41A 3CCRT 3QDRB 2DX1A 3QYGB 3I56Q 1OX8A 3H6ZA 4KRTA 2O9VA 3QZ9B 1QVGP 1S72Q 1BB9A 2JXBA 1UJYA 1XOVA 4LXCA 2QEXT 2HL3A 2DL3A 2L3PA 3REAB 1D3BB 1YJWT 2FO0A 3GBQA 4X1VA 1AOJA 3NGPA 4A63B 5GMKe 1AT1B 4J7FA 2VGNA 5LJ3g 2HKNA 3OBYA 1D0ZA 1FX7A 2RQVA 2PVOB 3JCMQ 1GCQC 4QQ6A 2VB6A 3E19A 2EYWA 2ZPEB 4NOYA 4RG2A 1CKBA 2WACA 2HSEB 1M2VA 2RO0A 4PFPA 3QPHA 1LPLA 4E7LA 3VU3C 4M7AB 2O4XA 1M9SA 3ASKA 1UUEA 2JMCA 5C6SA 1VQLQ 3DLLA 3EHRA 3CCJT 3EHQA 1KG1A 2CH4A 2KR3A 1OI1A 4C5HA 3CC2A 3RR6A 2LCSA 2A36A 2ABLA 1NM7A 1SSHA 1MGQA 2ED1A 3UATA 1YJNA 5I22A 4OMMA 1U1SA 3HRSA 2K9GA 5DLQE 1H3ZA 4OMNA 3UF4A 2EQMA 2KXDA 3HTRA 1X75C 2HEQA 3CCEA 3CCST 2DXTA 5HKCA 2P0PA 2EWNA 1Q7YR 4J83A 3M57A 2M02A 1WHKA 1T3LA 2K2MA 2YHTA 4Z8AA 5D6YA 1JJ2P 3GNGA 4M7AD 2V8IA 4TVRA 4V2SA 5IT9E 5FWCA 3OW2A 3G7ZA 1U1TA 4HVVA 5DM7R 4A54A 3A98A 3L2VA 2QQRA 1NLPC 2DILA 2QTVA 2NUZA 2KVQG 2LC4A 5GAN8 4AFUC 4E7JA 2L3QA 1D3BA 1AWWA 2DMOA 3TQ7P 4FW1A 4FL6A 2L3SA 4DEYA 4PFZA 4A4EA 1VQ9T 1BI3A 2ROTA 4BUGA 1YIJT 2MAMA 3GNFB 4M77D 1JXOA 2CT3A 3FC3A 5KH6A 5GAOm 4D8KA 3LX7A 5L23A 1QVFS 4ANJA 1QVGS 2ROLA 1WJSA 3CMEQ 1R0BG 1KQ1A 3U23A 1KD1U 1OV3A 3CPWS 2EQKA 2LX7A 2MYSA 2M0OA 3OSVA 2QA4T 4CC7A 4BI3A 3INZA 2FEIA 1NBEB 2EPDA 2LVMA 2QK0A 1XJWB 2WSEE 4J9EA 3VS5A 4EMKC 4F16A 1VQ7Q 1KQ2A 3EG3A 4M7AG 2L0AA 5CIUA 1QVFP 2KROA 4ZN1A 3AHUA 3I56T 3CBOA 2FZGB 4NS5A 1M1KU 4XU3A 3HHTB 2VGMA 4JUVA 2EW3A 2KT8A 2PZ1A 4E7ZA 1JXMA 3JCMX 3EFOB 2FHDA 1YITQ 1QKXA 3V8KA 3WVDB 3VJPA 1YJNT 2WSCE 5J26A 2FZKB 2O4XB 2MMPA 4QVZA 3VS1A 1RAEB 5D6WA 2K5FA 1PHTA 3HPWA 3QIIA 2XICA 3X20B 2M1HA 1JB0E 2W10A 4Z02A 1PG5B 2AHJB 1Q82R 1U06A 3F70A 1N8RC 4IUQA 5KYYB 2DL8A 4MMKA 2QQBA 1VQPA 3PE0A 3LWIA 3QBYA 3ZEHA 3V8LA 3H9NA 1VQMQ 2E6ZA 3I55T 2RH2A 1YFNA 5A2QE 1W2BA 2H3EB 2VUBA 2CP7A 4J9FA 4JZ3A 1LNXA 5CQXA 1QMCA 2EYZA 2LRQA 1WLPB 1YJWQ 1SPKA 3P8DA 3RMSA 1MMDA 5GMKm 1Q7YC 5KYWA 1VUBA 3FDRA 3EG1A 2K79A 2RNAA 4XK8E 4BE2A 4BY6C 4E7SA 3QJ6A 3OYNA 2F5KA 3L2ZA 3OYIA 4PJLA 1B3QA 2GQIA 3A1PA 5GAMe 2CT4A 1NEBA 4FW2A 2DVEA 2RJCA 3X24B 1M1KC 4BE0A 2BZYA 5CQYA 3CC7A 2RA2A 4E2FB 4ELZC 6AT1B 4FU6A 1YITA 3TEEA 1Q81C 2KAFA 1QLYA 3UDCA 2VXFA 1EIFA 3FIFA 3JB9I 3UPUA 2MIOA 1KHIA 2XDBA 5IN1A 1NPRA 3RIRA 4X9CA 1VQ5A 2HL5C 5I21A 4XQ3A 1SF9A 4OMLA 2YUPA 4HA8A 2ZZDA 4DA4A 1BCMA 4GLKA 4M78G 1O9SA 4C8QB 1N9SA 3G6EA 2KI7A 5FU7C 4QW2A 4QQDA 2RI2A 2QDYB 2YRCA 4BB7A 3META 2I0NA 3CQTA 1BU1A 2JM8A 3G4ST 1WQ7A 1OX9A 4PLLA 3G71A 5EC7A 3FJPA 3N5BB 4LDVA 1ZLMA 4RKUE 1YJ9A 4KH0B 1ABQA 2JTMA 2OAUA 3VKIA 1W2BS 5GAOr 4LE9A 5CO7A 1KC8C 4J8OA 4KH1B 3HSBA 4C8QG 3EH2A 4R0KA 1PSFA 3OQ5A 3OYAA 1OQKA 1BI2A 2RMOA 4OMPA 3TCJA 3MHXA 2L8DA 1OZ3A 3JCMg 2JW4A 4M7DG 2E10A 2E6NA 5J3BA 2RQWA 1ZX6A 2CREA 1WPYA 3FJ5A 3OA6A 3CMEA 4M7DF 4YTLA 2VASA 1T3SA 5LJ3j 5CCAA 3QDFA 3VUZA 3V7CA 1TWBA 2LCCA 2LX9A 3RBBB 1X27A 3WVEB 4M75C 3DKMA 1RLPC 1VQKT 4DOWA 1KK7A 3RERA 5GAOl 2QAZA 4M78D 3FB9A 3X28B 2MPXC 3HKSA 2DEQA 5GAOn 4OVAA 4BI8B 2COZA 1NEGA 1D09B 4QVDA 1RI0A 5EG2A 2V1QA 4E7HA 3NTHA 1KC8U 2GQVA 4HXJA 4PJOG 4N0AC 3M4GA 4MMLA 4BDYA 2DFUA 4O5VA 2MWPA 1R8OB 1K73U 1Y96A 2QASA 4D6WA 4QKUA 3JB9F 2IG0A 4J6XA 1U8RA 4KGZB 4AT1B 4BDZA 1YP5A 1GBQA 1K4US 2GFUA 1RL2A 4OMFB 1WXTA 1Q7YU 4XTWA 1G3TA 2SRCA 5IHIA 1N27A 3ZL7C 3JCMW 3CEYA 4RTUA 1SSFA 2LDMA 1D0XA 2KBTA 3EFRA 5LJ3h 3THKA 1FMWA 1C6VX 2DJZA 3OS5A 1YCSB 2LTOA 1HD3A 4MZMA 2RQTA 1RAHB 1NE8A 4DEXA 1K9MR 1AZGB 4JJDA 2RHXA 4PJMA 3V7RA 2D9TA 2KYMA 5AYFA 1N8RU 3QWXX 2YWWA 2RK2A 3M0SA 4M7AC 4IKFA 2RI5A 2HAXA 1AWJA 4L6V5 2O9SA 1UE9A 2X3WD 2FL7A 2DBKA 1G5VA 1HSQA 1BI1A 2LQWA 2RHIA 3A8MB 3R6NA 3JB9G 2YUNA 2EQJA 1IB8A 4E7IA 3LGFA 3JAME 2X4XA 1H8KA 2C0TA 2WSFE 4M75B 1VQ7A 3JCMf 1VQ5Q 1NG2A 4LDYA 1OULA 4ZGJB 4ZNXA 5A0LA 3ZFJA 5CVIA 2GFAA 4J9CA 4FM4B 1GFDA 1K0XA 1WXBA 1ZBJA 2DF6A 2VXEA 2DZ9A 1IXDA 5KCOA 3NPFA 2D6FA 1E7OA 2P0QA 1IO6A 1N5ZA 4PL6A 2JM9A 5KYXA 1CKAA 4XTYA 3CPWA 1Z9ZA 3CCSA 3KBGA 1ZA1B 3C0CA 3M0RA 4HT9A 1YWPA 3L2RA 1BK2A 2DBMA 2YXYA 3MP8A 2QQ9A 3KUFA 4OB1B 1RAFB 1RADB 2KYBA 2SEMA 4M77A 2AK5A 2J7IA 2YLCA 2NUPB 2LNVA 4BI4A 5GANe 4AFQC 3G71Q 1VQ7T 2JN0A 2KXCA 4HT8A 1AZEA 2LMJA 1W6XA 5I11A 1VQKQ 1QW1A 4FYWB 3ER0A 1VQOT 4F7UA 3JCMc 5CKEA 1X2KA 1M5Q1 3JB9D 2FVUA 4B6MA 4AFSC 4C92E 3L2QA 1BYMA 4K11A 1VQNT 5LJ5j 5KYUB 2E4HA 5CKBA 1YHQQ 3HRUA 1NYGA 1OEBA 4C8QE 1F1BB 3OYGA 3CMAQ 1QP3A 3EG9A 3CBPA 1GBRA 4C8QC 3J80E 2HD0A 2JTEA 3NHNA 4LD9K 2G3RA 1WQWA 3SWNC 4ZGEB 2DD4A 2AKLA 3EG0A 5AT1B 5IAYA 1R0CB 1WX6A 1Z9QA 5IH2A 4R55A 2DD5A 1YJWA 3MKDA 3I55Q 4AMCA 5KE3A 4A4HA 3IQLA 2R5AA 4D8DA 3QWYA 3KXTA 2AKKA 2PUOB 2BUDA 4M7AA 4KULA 2FYKA 5LJ3f 4MDWA 1YIJA 2AZSA 3C4SA 2PUKB 4XTVA 1QVFA 3QJYA 3E9GA 3H0HA 4N0AA 2JS0A 4WCIA 3HRTA 1JJ2S 1W4SA 1VQ4Q 2NUTB 1I8FA 3DB3A 4KUDK 2XKOC 2RQUA 4FSXA 3CMAA 3PGGA 3M59A 1YJ9Q 2YRDA 3L2WA 2LT4A 2PVGB 3G4SA 2ZPBB 1VQ5T 3RKWA 3CPFA 4KGVB 2YRVA 2RPNA 2RM4A 2RK1A 4PJOC 3OSSC 3VS6A 3FRNA 4J6YA 3E2UA 2ATCB 3RKYA 2BTTA 5GAN4 4X34A 1UB4A 2QDLA 3PNWC 2IPOB 2D8HA 1OYXA 2GTJA 1Y0MA 4JZ4A 1RABB 1VYTA 1ZA2B 2JS2A 4A53A 1WDXA 1W2BP 1C1AA 4HCCA 5GMKh 4C5IA 3H41A 1D0YA 2E12A 2QG9B 1B7TA 3M4YA 1M4ZA 1VQ8Q 3CC7T 4M78A 1YI2Q 3QXEB 1IZ6A 2K3YA 2M16A 1H92A 3CC7Q 5GAOp 5GJVB 2DXUA 5LJ3e 5KYYA 1BCOA 2HBPA 3JCMV 1PNJA 1X6OA 5CK9A 2GTOA 1Y57A 1IGQA 2IVWA 3I5RA 1AWXA 3SFMA 3BY7A 4HCKA 4M77G 1PWTA 2RHYA 3OW2S 5FRNA 3EH1A 1PM3A 4GBQA 3TREA 2HZYA 2BE7D 2RF0A 4E7KA 2CP3A 1VQNQ 3JCMe 4IUPA 2HQHA 5FWBA 2FPEA 3PVLA 4MZPA 3EFOA 4M78E 4AG1C 5GANd 1QWFA 1KQSP 3OBWA 1K73C 4KBMB 5GAN5 2CUBA 3RESA 2XD0A 4FT4A 3O8VA 3M0PA 1M1GA 4F7UE 2L2PA 4HCZA 4LDUA 2HBWA 2QEXA 5FRMA 3OS0A 2JMAA 4NL3A 4OP0A 2NWMA 1N8RR 3A8GB 2EVRA 3L1AA 2XHCA 3CCEQ 2DA9A 1QVGA 5LJ5g 2HSPA 3H0FA 2AIRB 3TSZA 3QUIA 1K9MU 1MMNA 1M3CA 4N4HA 1ZUUA 3URGA 2VYTA 1UFFA 2MK5A 1UEBA 2CS7A 3OYCA 1U3OA 1YBYA 2K6DA 3CMAT 1AD5A 2KE9A 3OYLA 3G6EQ 1D1BA 2RD1A 2LNHB 1GXIE 4HKEA 3CCMA 1VQMA 2XU8A 1KIKA 1OU9A 1RI9A 4EMKA 3JB9J 3CCJQ 4JS4A 3VV0A 1U5SA 3OYEA 3GIBA 3M0TA 3JCMd 1IREB 1QP2A 2GCXA 1WHMA 2QQSA 2GBQA 4KUIA 2E65A 1VQNA 2DRKA 1EFNA 1IHWA 2OTLA 1G8XA 2Y90A 3RUXA 2FRYA 4F14A 1WFWA 4NL2A 1NYFA 3CCUT 1KD1R 4RTWA 2C0IA 3VS7A 3CCSQ 4ZGDB 2AZVA 5IXBA 4MZTA 2EIFA 4ZTJA 2CDTA 3H8ZA 4F17A 3V8JA 3X26B 1TU0B 1RLQC 4XAXB 1S1NA 3VS0A 4DQ2A 4DOVA 3QZ5B 2R58A 3EG9B 5GAOq 3E9FA 5HCKA 2DK3A 2DKGA 1K1ZA 5KE2A 3SDZA 1UGSB 4M7AE 3I55A 4PLIA 2DERA 1C0MA 1GFCA 4M7AF 2QGFB 3CD6Q 4M7DA 2DL7A 2JVVA 1EX4A 3EGUA 3OS1A 3EGXB 4A4FA 1D1CA 2A3LA 3LWHA 1WHLA 2V1RA 3MJXA 4QT7A 3S3OA 4LUEA 1M2OA 3OYKA 1YJNQ 4C0ZA 2XG8D 1TUDA 3I5SA 1PD1A 3HL8A 2R57A 2OTLQ 3LH5A 2LQ8A 2DRMA 2LT1A 1T0JA 3P8HA 2H8HA 1ARKA 1QCFA 1TUCA 2DNUA 3OYJA 2QGGA 3G4SQ 4GY5A 1LOJA 1VYVA 2D8JA 2HQXA 4JRKA 1HJDA 4C92A 4IUVA 2HCKA 2J06A 2DETA 1ACMB 4LD6A 1ZSZB 1TSFA 2L89A 1VQOQ 4IIOA 2RJEA 1PC0A 2KDSA 4FT2A 3OYHA 1Q95G 3QHSA 4XU0A 3QO3A 4ORZA 3L2UA 3UT1A 1S72T 2W0ZA 4PJOF 3CCVQ 2ESWA 2K57A 4LNPA 4OGEA 3CCLT 2EYQA 1I81A 4EIKA 4R56A 4XU2A 1YN8A 1PKSA 1WYXA 1VQ9A 3JB9H 3VS4A 3E1SA 4OB3B 4LN2A 2V8JA 1Y7XA 2EKOA 4JJCA 1TH7A 5GAN3 4BD3A 3FEOA 2KGTA 1X2QA 2CSQA 3CBMA 3NTKA 3BDLA 4BY6B 4J6WA 2F1LA 1WA7A 2BZ8A 2XMFA 1M1FA 4DBRA 5D6XA 3PVQA 4P5NA 2AT1B 3CCQQ 2J6KA 1G3WA 2VWFA 3M58A 1FMVA 2EQUA 2K5IA 3JRZA 4PJOE 2QXFA 4JJNK 4FYXB 4RTTA 1WZOA 2Z0WA 4JLGA 2LP5A 2KQWA 1LCKA 1CSKA 4RCBA 1NJIU 3KFVA 1GCQA 1OU8A 2JT4A 3PFSA 1M8MA 1SHFA 2LQKA 2ZPFB 4M75A 1LJOA 2HDAA 5CKDA 2EKHA 2KRSA 3GF5A 1GCPA 1KQSS 2XDDA 4C92G 1Y07A 4OB2B 2DXBA 2E3HA 2NUPA 2DTIA 1QWEA 1M2VB 1AVZC 1N9RA 4J9DA 1UG1A 3VYGA 3JSCA 5GANg 2LCLA 5KYNA 2A08A 2CUDA 1ZBXA 4DBQA 3CCUQ 2BIVA 1RAIB 2EYYA 5M9OA 1AEYA 3CC4T 2BKDN 3JCMJ 1M90R 4PK4A 3CCMT 2F69A 4M77E 1T0HA 2J6OA 2D1XA 3J7AF 3OMCA 1B34A 2OTJQ 2X51A 4C0GA 2KMTA 4C92B 2M51A 2ENMA 5FU7B 3BE3A 1RACB 2HKQB 2M9UA 2NYSA 4CC4B 1RAGB 5A0GA 3HFOA 2OJ2A 1HXDA 3S6WA 1M27C 1O75A 3I56A 5GANj 4XTUA 2QYZA 2H3JA 2KK4A 3EFSA 4JDSA 3OYDA 1NJIR 1WHJA 4RCCA 2MF2A 4RTXA 2DEUA 1D1AA 3TSWA 2K5LA 4CC2A 2B86A 5IXFA 2DTOA 1ZSGA 2DVJA 1KJWA 2J6FA 1M3AA 1X69A 1TOVA 4M7DC 2RN8A 4KGXB 2QEXQ 4C8QF 1MV0B 4Q5WA 4M7DB 1OOTA 4M7DE 4EPCA 2RHZA 1YITT 2JNGA 4Y91A 3CCRA 5GAMg 1TG0A 1VIEA 1VQ8A 3OB9A 4IURA 1N6AA 4C92D 3CCLQ 2K4YA 4KT0E 2YLBA 2MOXA 2QA4A 1UGVA 3BFMA 5GAMd 4JJBA 1H3HA 3TU4K 2L3RA 3SEMA 3VRYA 1KC8R 1VOMA 4OMQA 2P0KA 4HCBA 1M90U 1VQLT 2O88A 1WI7A 2DO3A 2YDLA 2FPFA 2EFIA 2JTFA 4N4GA 3CCET 1BIAA 3OYYA 1VIFA 4M75E 2EAYA 4FSSA 4BE1A 3S3MA 1VYUA 2O31A 1WNLA 1VQMT 4C0FA 1ZSZA 4F7UG 2EGEA 1NZ9A 1SHGA 2RQRA 3ME9A 4UC4A 3VRZA 3C94A 2HMAA 1MHNA 2KY9A 4PFOA 2CP2A 2E64A 2CSIA 2Y4XA 1MUZA 3DLMA 1M8VA 4PJOB 4JLIA 1Q86U 7AT1B 2LJ0A 3I35A 3PIOA 4C92F 3PT9A 4VUBA 1MMGA 2RI3A 3BDUA 3M53A 1M30A 2R5MA 5L8RE 4E6RA 5LJ5d 1JEGA 1MNEA 2OAWA 5KYWB 3EGXA 3CXCA 2DTHA 3OYFA 1M1KR 2DLPA 2EQIA 4GLMA 1K9AA 2ECZA 1K8AC 3MEUA 2BE9B 1K8AU 3M54A 4EMKB 4M78F 2RB6A 5FLXE 2ZPIB 4FYYB 1M90C 1VQ9Q 1OZ2A 2B8AA 2CYZB 1AWOA 2HNIA 1KFZA 1G83A 4M75F 2Y4YA 5IHNA 3CMET 2EBPA 1NLOC 2OI3A 2YSQA 3M5AA 3CPWP 2DE0X 2NLUA 5GANh 2YUQA 2ZAEA 1YJ9T 1BI0A 1XNIA 1YI2T 3VS3A 2PQWA 3SHWA 2JUFA 3A8LB 3RMQA 1JBMA 1Q86R 4Z89A 2XDPA 1NJIC 4C5EA 1A0NB 4RG8A 1LVKA 1ZQ1A 3DB4A 5FU6C 1WJRA 1Q82U 1V29B 2ZGWA 1IRXA 2GF7A 4C0DC 3CCLA 4WF2A 2X4JA 3UA6A 3BW1A 5GAMf 3UA7A 1QQJA 1X6BA 2A0FB 5KCHA 1QCOA 1VQ6Q 3QYHB 5I2MA 2BZXA 1JO8A 3GP8A 2NUTA 2J05A 4WTOB 4N4IA 1VQ6T 3A8OB 1UGRB 1K73R 4O6JA 5CKHA 2D0QB 3OMGA 3J81E 1JRIA 2EJGA 3MP6A 4A4GA 1YI2A 3OS2A 3CD6A 5DY9A 1UHCA 2G6FX 3H0IA 3ZBDA 1FXXA 1MMAA 1V1CA 2JJ9A 1E6GA 4M77F 3C95A 1WHGA 3TVTA 3MEAA 3JCMb 2K2VA 4LDXA 1VQ4A 2KNBB 3ULRB 4FYVB 3GLXA 3MEVA 2ZPGB 1VQOA 1IHVA 2OTJA 3M9QA 4MDXA 1S72A 2O2OA 3OYBA 3FLGA 2OX7A 1GL5A 2MI6A 5CR2A 3G6ET 2V8KA 3JCMh 2JOYA 2YUOA 4J5YA 1KD1C 4ZN3A 5GAN6 4EMGA 1TXQA 4AFZC 4L59A 2X35A 1TUGB 4RMOA 5IHKA 2DYIA 1GRIA 2VVKA 4Z88A 2RJFA 4DBHA 1KHCA 3M0UA 4F7UB 2RJDA 3JCMP 1UGPB 3NTIA 1SRLA 1XTDA 3A5ZB 3VS2A 2PU9B 1FWZA 5GMKj 1UHFA 2CZ6B 1PSEA 2PTKA 4FIBA 3PMTA 1QCNA 4QQGA 2A37A 1UTIA 4M78B 2LQNA 3RKXA 5HK0A 4M75G 1RAAB 2CP6A 1JJ2A 3LH0A 4EDUA 2EJFA 2P4TA 4JRPA 4B9XA 1I0CA 3RNJA 3CCQA 5GAN7 2F5TX 1HK9A 3OY9A 4IUTA 3WXMB 2C0OA 4LDWA 4JRIA 4JPBW 3CCUA 3MO8A 2VC8A 2F2WA 4PNOA 2L5QA 2EGAA 3Q1JA 2CGHA 1ZSZC 3P8BB 4PJNA 1Q81R 4OF1A 1K9MC 2CH4W 1ABOA 1SRMA 1WHHA 4LUDA 4CC3A 2IIMA 4XTXA 2A7YA 1HYOA 4IIMA 4CI0C 2QI2A 2CZ7B 3A8HB 2DL5A 4J9GA 3SB2A 4X9DA 3CXCP 2CP0A 1W1FA 1YIJQ 2X4YA 3T9NA 1Q81U 4M4ZA 1PCXA 1G3SA 1V76A 2PVDB 4C8QD 2E5KA 1VQ8T 1K76A 2OTLT 5FROA 5KYUA 1UJ0A 5A0DA 2DPPB 2K7AA 3M55A 1MNDA 3PMIA 3I9QA 4J9BA 2DM1A 1WJQA 5LJ3d 2QA4Q 3SWNB 4RTZA 2VV5A 2DXCA 3PTAA 4ESRA 4RTYA 4IUUA 3C12A 4E47A 1PKTA 1BBZA 3M0QA 3CCRQ 3GOXA 4C92C 1B07A 2XIDA 2DZCA 4RTVA 2E70A 3MEWA 3CC2T 1R77A 2X9HA 1YNZA 1VQ6A 2QQAA 4M77B 4HVWA 4C0DB 5GMKi 1OPLA 2FG0A 1KSWA 1QKWA 3CC2Q 2ED0A 1W70A 3CCVT 1SG5A 5DLOA 4CRIA 2EGCA 4Y28E 4Y92A 4PJOD 2X3XD 2FB7A 4ZTFA 3R6OA 2COYA 2A28A 2X4WA 3CC4A 1WIEA 1IGUA 2D0NA 5FW9A 2JZ2A 3G71T 2F2XA 3NFCA 5ECAA 5J39A 1Y71A 4OGCA 2CKKA 2E1HA 3LLRA 3MCAB 3QSUA 3EG2A 3O5ZA 5HY6A 5LJ5e 1PRLC 3GPLA 1X43A 3VUBA 2DJQA 1RUWA 1PD0A 1BIBA 2CP5A 3AT1B 4C5GA 1BKBA 2CZ1B 2DIGA 1B34B 4FCYA 2FRWA 2K3BA 3RDVA 5GANf 2DAQA 1VA7A 1J3TA 1K8AR 5GAMj 1E6HA 2GNCA 1I5LA 4OB0B 2P4RA 2MCNA
chains in the Genus database with same CATH topology
4HCKA 4OMLA 2YUPA 1PWTA 2O88A 1WI7A 2YDLA 2PNIA 4GBQA 2FPFA 1UDLA 1I07A 2M0YA 1FMKA 2RF0A 1UECA 4FSSA 1SEMA 3REBB 2I0NA 3CQTA 1VYUA 2O31A 1JU5C 1BU1A 5FWBA 2JM8A 2FPEA 2KT1A 3PVLA 2EGEA 1JQQA 1SHGA 2RQRA 1MV3A 5EC7A 3VRZA 4AG1C 1ZLMA 1QWFA 3JV3A 2CSIA 1PRMC 1ABQA 2CUBA 2LJ1A 1MUZA 1I1JA 4LE9A 2EYXA 2GGRA 1FYNA 2LJ0A 3I35A 3M0PA 2F2VA 2L2PA 4R0KA 2HBWA 1ZUYA 1YWOA 2JMAA 2RMOA 4HVUA 2NWMA 4OMPA 2LZ6B 1M30A 4E6RA 1JEGA 2EVRA 2DA9A 2OAWA 2KEAA 2JW4A 1K0SA 2RQWA 1ZX6A 2CREA 2HSPA 3H0FA 2KRNA 3TSZA 1M3BA 3FJ5A 2DLPA 4J9HA 2EQIA 4GLMA 1M3CA 1T3SA 1ZUUA 2LJ3A 1K9AA 2ECZA 1WXUA 1UFFA 1U3OA 2K6DA 1AD5A 2KE9A 3NMZC 1G2BA 4J9IA 2KRMA 3RBBB 1X27A 2LNHB 1AWOA 1RLPC 1KFZA 1G83A 2DYBA 1KIKA 1RI9A 5IHNA 2EBPA 1NLOC 1U5SA 2DL4A 2OI3A 2YSQA 2YT6A 5GJWB 2DE0X 3M0TA 2YUQA 1NEGA 2V1QA 2GBQA 3VS3A 2DRKA 4HXJA 4RUGA 1EFNA 2FPDA 4OMOA 3SHWA 2FRYA 4Z89A 4F14A 1WFWA 1NYFA 2VKNA 4AG2C 4RTWA 1ZUKA 2C0IA 3VS7A 1A0NB 1YP5A 2AZVA 1GBQA 5IXBA 1X6GA 1K4US 1OPKA 1WXTA 2CDTA 4F17A 2SRCA 2DX1A 1RLQC 1S1NA 5IHIA 4KRTA 3ZL7C 3VS0A 2O9VA 4RTUA 1BB9A 2JXBA 1UJYA 2KBTA 3UA6A 3THKA 1XOVA 3UA7A 1YCSB 5HCKA 1X6BA 1HD3A 2L3PA 2DL3A 2RQTA 3REAB 1K1ZA 2FO0A 2BZXA 4DEXA 1JO8A 1AZGB 3GBQA 4JJDA 2J05A 4X1VA 1AOJA 3NGPA 4A63B 1GFCA 2KYMA 3QWXX 3M0SA 2RQVA 1AWJA 1GCQC 2DL7A 2O9SA 2EYWA 1UE9A 2X3WD 1CKBA 3EGUA 1UHCA 2DBKA 1HSQA 2G6FX 2LQWA 3H0IA 3R6NA 2YUNA 1UUEA 2JMCA 1V1CA 2V1RA 1E6GA 4QT7A 3EHRA 4LUEA 3EHQA 1TUDA 3I5SA 3TVTA 1H8KA 2CH4A 2C0TA 2KR3A 2KNBB 1NG2A 2LCSA 3LH5A 3ULRB 2A36A 2ABLA 1NM7A 4ZNXA 2DRMA 1SSHA 2ED1A 3UATA 1T0JA 4J9CA 2H8HA 5I22A 1QCFA 1TUCA 1WXBA 2DNUA 1ARKA 1GFDA 4OMMA 1K0XA 1ZBJA 2DF6A 2K9GA 2O2OA 4OMNA 3UF4A 3NPFA 1VYVA 2KXDA 1E7OA 2D8JA 1HJDA 1GL5A 1IO6A 1N5ZA 2HEQA 2HCKA 2J06A 2JM9A 1CKAA 2YUOA 1Z9ZA 4IIOA 3C0CA 3M0RA 4AFZC 1YWPA 1BK2A 4ORZA 1T3LA 2DBMA 2K2MA 5IHKA 2VVKA 1GRIA 4Z8AA 2W0ZA 4Z88A 5FWCA 2KYBA 3M0UA 2SEMA 2ESWA 2AK5A 4HVVA 4LNPA 1SRLA 2J7IA 3A98A 1NLPC 3VS2A 2DILA 1UHFA 4AFQC 2NUZA 2PTKA 4EIKA 1YN8A 4AFUC 2KXCA 2L3QA 1AZEA 1PKSA 2LMJA 1W6XA 2A37A 5I11A 1AWWA 1UTIA 2LQNA 1WYXA 2DMOA 3VS4A 2L3SA 4DEYA 2ROTA 4LN2A 1JXOA 1I0CA 3RNJA 2CT3A 1X2KA 4JJCA 4D8KA 4AFSC 5L23A 2KGTA 1X2QA 2CSQA 2C0OA 2ROLA 4K11A 3U23A 1OV3A 1WA7A 4JPBW 2BZ8A 2LX7A 2XMFA 3PVQA 2F2WA 4CC7A 1NYGA 1OEBA 2J6KA 2EGAA 2FEIA 2VWFA 2EPDA 4J9EA 3VS5A 1GBRA 2CH4W 1ABOA 1SRMA 2JTEA 4LUDA 4F16A 3NHNA 4CC3A 4RTTA 2IIMA 2LP5A 3EG3A 2L0AA 1LCKA 1CSKA 3KFVA 2KROA 1GCQA 4IIMA 2JT4A 2DL5A 1M8MA 2AKLA 3EG0A 4J9GA 1SHFA 1WX6A 1Z9QA 5IH2A 2EW3A 1W1FA 2KT8A 2PZ1A 1JXMA 2HDAA 4M4ZA 3IQLA 2EKHA 2E5KA 1QKXA 2KRSA 1K76A 4D8DA 1GCPA 1UJ0A 3QWYA 2K7AA 2AKKA 1QWEA 1AVZC 3I9QA 4J9BA 4J9DA 3VS1A 2DM1A 2AZSA 1PHTA 1UG1A 4RTZA 4ESRA 3H0HA 4RTYA 2JS0A 2W10A 4WCIA 2A08A 2CUDA 1PKTA 1BBZA 3M0QA 2EYYA 1AEYA 1B07A 1U06A 2RQUA 4RTVA 1T0HA 2DL8A 2J6OA 2D1XA 3PE0A 1YNZA 2M51A 2ENMA 4HVWA 1OPLA 2FG0A 1KSWA 1QKWA 2RPNA 2ED0A 1W70A 4J9FA 4CC4B 4JZ3A 3VS6A 2OJ2A 2EGCA 2EYZA 1M27C 1WLPB 4Y92A 1SPKA 2X3XD 2BTTA 2QDLA 2A28A 1WIEA 3EG1A 2D0NA 2D8HA 2K79A 2RNAA 5FW9A 4RTXA 2GTJA 1Y0MA 4JZ4A 3TSWA 1VYTA 2F2XA 2B86A 4CC2A 5IXFA 5ECAA 1ZSGA 2DVJA 1KJWA 2J6FA 2JS2A 1M3AA 1WDXA 1X69A 1B3QA 2RN8A 2GQIA 2CT4A 1NEBA 1MV0B 3EG2A 3O5ZA 3H41A 2BZYA 1OOTA 1PRLC 1X43A 1TG0A 2DJQA 1RUWA 1QLYA 1H92A 2FRWA 5GJVB 2K3BA 2MOXA 1UGVA 1PNJA 1VA7A 2MIOA 4JJBA 1H3HA 1J3TA 1E6HA 2GNCA 2GTOA 3SEMA 1Y57A 2P4RA 3VRYA 3I5RA 2MCNA 1AWXA 4OMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HCK A;  4OML A;  2YUP A;  1PWT A;  2O88 A;  1WI7 A;  2YDL A;  2PNI A;  4GBQ A;  2FPF A;  1UDL A;  1I07 A;  2M0Y A;  1FMK A;  2RF0 A;  1UEC A;  4FSS A;  1SEM A;  3REB B;  2I0N A;  3CQT A;  1VYU A;  2O31 A;  1JU5 C;  1BU1 A;  5FWB A;  2JM8 A;  2FPE A;  2KT1 A;  3PVL A;  2EGE A;  1JQQ A;  1SHG A;  2RQR A;  1MV3 A;  5EC7 A;  3VRZ A;  4AG1 C;  1ZLM A;  1QWF A;  3JV3 A;  2CSI A;  1PRM C;  1ABQ A;  2CUB A;  2LJ1 A;  1MUZ A;  1I1J A;  4LE9 A;  2EYX A;  2GGR A;  1FYN A;  2LJ0 A;  3I35 A;  3M0P A;  2F2V A;  2L2P A;  4R0K A;  2HBW A;  1ZUY A;  1YWO A;  2JMA A;  2RMO A;  4HVU A;  2NWM A;  4OMP A;  2LZ6 B;  1M30 A;  4E6R A;  1JEG A;  2EVR A;  2DA9 A;  2OAW A;  2KEA A;  2JW4 A;  1K0S A;  2RQW A;  1ZX6 A;  2CRE A;  2HSP A;  3H0F A;  2KRN A;  3TSZ A;  1M3B A;  3FJ5 A;  2DLP A;  4J9H A;  2EQI A;  4GLM A;  1M3C A;  1T3S A;  1ZUU A;  2LJ3 A;  1K9A A;  2ECZ A;  1WXU A;  1UFF A;  1U3O A;  2K6D A;  1AD5 A;  2KE9 A;  3NMZ C;  1G2B A;  4J9I A;  2KRM A;  3RBB B;  1X27 A;  2LNH B;  1AWO A;  1RLP C;  1KFZ A;  1G83 A;  2DYB A;  1KIK A;  1RI9 A;  5IHN A;  2EBP A;  1NLO C;  1U5S A;  2DL4 A;  2OI3 A;  2YSQ A;  2YT6 A;  5GJW B;  2DE0 X;  3M0T A;  2YUQ A;  1NEG A;  2V1Q A;  2GBQ A;  3VS3 A;  2DRK A;  4HXJ A;  4RUG A;  1EFN A;  2FPD A;  4OMO A;  3SHW A;  2FRY A;  4Z89 A;  4F14 A;  1WFW A;  1NYF A;  2VKN A;  4AG2 C;  4RTW A;  1ZUK A;  2C0I A;  3VS7 A;  1A0N B;  1YP5 A;  2AZV A;  1GBQ A;  5IXB A;  1X6G A;  1K4U S;  1OPK A;  1WXT A;  2CDT A;  4F17 A;  2SRC A;  2DX1 A;  1RLQ C;  1S1N A;  5IHI A;  4KRT A;  3ZL7 C;  3VS0 A;  2O9V A;  4RTU A;  1BB9 A;  2JXB A;  1UJY A;  2KBT A;  3UA6 A;  3THK A;  1XOV A;  3UA7 A;  1YCS B;  5HCK A;  1X6B A;  1HD3 A;  2L3P A;  2DL3 A;  2RQT A;  3REA B;  1K1Z A;  2FO0 A;  2BZX A;  4DEX A;  1JO8 A;  1AZG B;  3GBQ A;  4JJD A;  2J05 A;  4X1V A;  1AOJ A;  3NGP A;  4A63 B;  1GFC A;  2KYM A;  3QWX X;  3M0S A;  2RQV A;  1AWJ A;  1GCQ C;  2DL7 A;  2O9S A;  2EYW A;  1UE9 A;  2X3W D;  1CKB A;  3EGU A;  1UHC A;  2DBK A;  1HSQ A;  2G6F X;  2LQW A;  3H0I A;  3R6N A;  2YUN A;  1UUE A;  2JMC A;  1V1C A;  2V1R A;  1E6G A;  4QT7 A;  3EHR A;  4LUE A;  3EHQ A;  1TUD A;  3I5S A;  3TVT A;  1H8K A;  2CH4 A;  2C0T A;  2KR3 A;  2KNB B;  1NG2 A;  2LCS A;  3LH5 A;  3ULR B;  2A36 A;  2ABL A;  1NM7 A;  4ZNX A;  2DRM A;  1SSH A;  2ED1 A;  3UAT A;  1T0J A;  4J9C A;  2H8H A;  5I22 A;  1QCF A;  1TUC A;  1WXB A;  2DNU A;  1ARK A;  1GFD A;  4OMM A;  1K0X A;  1ZBJ A;  2DF6 A;  2K9G A;  2O2O A;  4OMN A;  3UF4 A;  3NPF A;  1VYV A;  2KXD A;  1E7O A;  2D8J A;  1HJD A;  1GL5 A;  1IO6 A;  1N5Z A;  2HEQ A;  2HCK A;  2J06 A;  2JM9 A;  1CKA A;  2YUO A;  1Z9Z A;  4IIO A;  3C0C A;  3M0R A;  4AFZ C;  1YWP A;  1BK2 A;  4ORZ A;  1T3L A;  2DBM A;  2K2M A;  5IHK A;  2VVK A;  1GRI A;  4Z8A A;  2W0Z A;  4Z88 A;  5FWC A;  2KYB A;  3M0U A;  2SEM A;  2ESW A;  2AK5 A;  4HVV A;  4LNP A;  1SRL A;  2J7I A;  3A98 A;  1NLP C;  3VS2 A;  2DIL A;  1UHF A;  4AFQ C;  2NUZ A;  2PTK A;  4EIK A;  1YN8 A;  4AFU C;  2KXC A;  2L3Q A;  1AZE A;  1PKS A;  2LMJ A;  1W6X A;  2A37 A;  5I11 A;  1AWW A;  1UTI A;  2LQN A;  1WYX A;  2DMO A;  3VS4 A;  2L3S A;  4DEY A;  2ROT A;  4LN2 A;  1JXO A;  1I0C A;  3RNJ A;  2CT3 A;  1X2K A;  4JJC A;  4D8K A;  4AFS C;  5L23 A;  2KGT A;  1X2Q A;  2CSQ A;  2C0O A;  2ROL A;  4K11 A;  3U23 A;  1OV3 A;  1WA7 A;  4JPB W;  2BZ8 A;  2LX7 A;  2XMF A;  3PVQ A;  2F2W A;  4CC7 A;  1NYG A;  1OEB A;  2J6K A;  2EGA A;  2FEI A;  2VWF A;  2EPD A;  4J9E A;  3VS5 A;  1GBR A;  2CH4 W;  1ABO A;  1SRM A;  2JTE A;  4LUD A;  4F16 A;  3NHN A;  4CC3 A;  4RTT A;  2IIM A;  2LP5 A;  3EG3 A;  2L0A A;  1LCK A;  1CSK A;  3KFV A;  2KRO A;  1GCQ A;  4IIM A;  2JT4 A;  2DL5 A;  1M8M A;  2AKL A;  3EG0 A;  4J9G A;  1SHF A;  1WX6 A;  1Z9Q A;  5IH2 A;  2EW3 A;  1W1F A;  2KT8 A;  2PZ1 A;  1JXM A;  2HDA A;  4M4Z A;  3IQL A;  2EKH A;  2E5K A;  1QKX A;  2KRS A;  1K76 A;  4D8D A;  1GCP A;  1UJ0 A;  3QWY A;  2K7A A;  2AKK A;  1QWE A;  1AVZ C;  3I9Q A;  4J9B A;  4J9D A;  3VS1 A;  2DM1 A;  2AZS A;  1PHT A;  1UG1 A;  4RTZ A;  4ESR A;  3H0H A;  4RTY A;  2JS0 A;  2W10 A;  4WCI A;  2A08 A;  2CUD A;  1PKT A;  1BBZ A;  3M0Q A;  2EYY A;  1AEY A;  1B07 A;  1U06 A;  2RQU A;  4RTV A;  1T0H A;  2DL8 A;  2J6O A;  2D1X A;  3PE0 A;  1YNZ A;  2M51 A;  2ENM A;  4HVW A;  1OPL A;  2FG0 A;  1KSW A;  1QKW A;  2RPN A;  2ED0 A;  1W70 A;  4J9F A;  4CC4 B;  4JZ3 A;  3VS6 A;  2OJ2 A;  2EGC A;  2EYZ A;  1M27 C;  1WLP B;  4Y92 A;  1SPK A;  2X3X D;  2BTT A;  2QDL A;  2A28 A;  1WIE A;  3EG1 A;  2D0N A;  2D8H A;  2K79 A;  2RNA A;  5FW9 A;  4RTX A;  2GTJ A;  1Y0M A;  4JZ4 A;  3TSW A;  1VYT A;  2F2X A;  2B86 A;  4CC2 A;  5IXF A;  5ECA A;  1ZSG A;  2DVJ A;  1KJW A;  2J6F A;  2JS2 A;  1M3A A;  1WDX A;  1X69 A;  1B3Q A;  2RN8 A;  2GQI A;  2CT4 A;  1NEB A;  1MV0 B;  3EG2 A;  3O5Z A;  3H41 A;  2BZY A;  1OOT A;  1PRL C;  1X43 A;  1TG0 A;  2DJQ A;  1RUW A;  1QLY A;  1H92 A;  2FRW A;  5GJV B;  2K3B A;  2MOX A;  1UGV A;  1PNJ A;  1VA7 A;  2MIO A;  4JJB A;  1H3H A;  1J3T A;  1E6H A;  2GNC A;  2GTO A;  3SEM A;  1Y57 A;  2P4R A;  3VRY A;  3I5R A;  2MCN A;  1AWX A;  4OMQ A; 
#chains in the Genus database with same CATH topology
 5HK3 A;  1X01 A;  5LL6 S;  3M56 A;  2PNI A;  3EAE A;  1VQL A;  1UDL A;  1I07 A;  2M0Y A;  1TTH B;  1FMK A;  2QTX A;  4M77 C;  1YHQ A;  2EJ9 A;  1UEC A;  1Q82 C;  1SEM A;  1G3Y A;  4J7I A;  3REB B;  2MWO A;  5I2S A;  1KQS A;  4EMH A;  3VYH B;  1NPP A;  3D7S B;  1P92 A;  1JU5 C;  5KYX B;  2KT1 A;  3MP1 A;  2RHU A;  1JQQ A;  1MV3 A;  2P84 A;  1AHJ B;  4JRQ A;  1Q86 C;  1VQP T;  3LYI A;  1YCY A;  8ATC B;  3JV3 A;  1I4K 1;  3MPU B;  4DBF A;  4PJO A;  1VQP Q;  1PRM C;  4ELY C;  9ATC B;  1DJ7 B;  2ZPH B;  2LJ1 A;  2O01 E;  5CKF A;  3CCQ T;  1I1J A;  4PKC C;  2EYX A;  2GGR A;  3EGD A;  4F7U F;  1FYN A;  5CAI A;  1I5O B;  2F2V A;  4B9W A;  4PJJ A;  3CC4 Q;  1ZUY A;  1YWO A;  2C06 A;  1H64 1;  3HP9 A;  4HVU A;  1XQH A;  2LZ6 B;  2DIQ A;  1VQ4 T;  2E3I A;  3OYM A;  5LJ5 f;  2KEA A;  1K0S A;  3L42 A;  3S3N A;  2I2L A;  4M7D D;  3CCV A;  2KRN A;  5GAM h;  4BAC A;  1M3B A;  3SD4 A;  4C8Q A;  1WGS A;  4J9H A;  1UGQ B;  3CXC S;  3G1J A;  2HQE A;  2LJ3 A;  3SWN A;  1ZHI A;  2XI9 A;  4QVC A;  1WXU A;  3PIP A;  5FU6 B;  3OW2 P;  3CD6 T;  3X25 B;  3NMZ C;  4J9I A;  1G2B A;  1VQK A;  2KRM A;  5LJ5 h;  3UWN A;  2KSS A;  3V7S A;  4ME7 A;  2DYB A;  2XK0 A;  3CCJ A;  4XU1 A;  4M75 D;  5C0M A;  1SKU B;  2ZCF B;  2DL4 A;  2K3X A;  2YT6 A;  5GJW B;  4L5G A;  3CCM Q;  3QKJ A;  4II1 A;  1YHQ T;  2OTJ T;  2E5Q A;  5GAN 2;  4RUG A;  2CZ0 B;  1QVP A;  2FPD A;  4F04 B;  2COW A;  4OMO A;  4ATO A;  4M78 C;  1TS9 A;  3QG1 A;  2V26 A;  3HFN A;  1Y96 B;  5D7U A;  8AT1 B;  2VKN A;  3LW5 E;  4AG2 C;  4JS5 A;  1ZUK A;  5GMK l;  3LGL A;  3EGD B;  2FZC B;  1X6G A;  1OPK A;  4A4K A;  4XTZ A;  1EZZ B;  2E41 A;  3CCR T;  3QDR B;  2DX1 A;  3QYG B;  3I56 Q;  1OX8 A;  3H6Z A;  4KRT A;  2O9V A;  3QZ9 B;  1QVG P;  1S72 Q;  1BB9 A;  2JXB A;  1UJY A;  1XOV A;  4LXC A;  2QEX T;  2HL3 A;  2DL3 A;  2L3P A;  3REA B;  1D3B B;  1YJW T;  2FO0 A;  3GBQ A;  4X1V A;  1AOJ A;  3NGP A;  4A63 B;  5GMK e;  1AT1 B;  4J7F A;  2VGN A;  5LJ3 g;  2HKN A;  3OBY A;  1D0Z A;  1FX7 A;  2RQV A;  2PVO B;  3JCM Q;  1GCQ C;  4QQ6 A;  2VB6 A;  3E19 A;  2EYW A;  2ZPE B;  4NOY A;  4RG2 A;  1CKB A;  2WAC A;  2HSE B;  1M2V A;  2RO0 A;  4PFP A;  3QPH A;  1LPL A;  4E7L A;  3VU3 C;  4M7A B;  2O4X A;  1M9S A;  3ASK A;  1UUE A;  2JMC A;  5C6S A;  1VQL Q;  3DLL A;  3EHR A;  3CCJ T;  3EHQ A;  1KG1 A;  2CH4 A;  2KR3 A;  1OI1 A;  4C5H A;  3CC2 A;  3RR6 A;  2LCS A;  2A36 A;  2ABL A;  1NM7 A;  1SSH A;  1MGQ A;  2ED1 A;  3UAT A;  1YJN A;  5I22 A;  4OMM A;  1U1S A;  3HRS A;  2K9G A;  5DLQ E;  1H3Z A;  4OMN A;  3UF4 A;  2EQM A;  2KXD A;  3HTR A;  1X75 C;  2HEQ A;  3CCE A;  3CCS T;  2DXT A;  5HKC A;  2P0P A;  2EWN A;  1Q7Y R;  4J83 A;  3M57 A;  2M02 A;  1WHK A;  1T3L A;  2K2M A;  2YHT A;  4Z8A A;  5D6Y A;  1JJ2 P;  3GNG A;  4M7A D;  2V8I A;  4TVR A;  4V2S A;  5IT9 E;  5FWC A;  3OW2 A;  3G7Z A;  1U1T A;  4HVV A;  5DM7 R;  4A54 A;  3A98 A;  3L2V A;  2QQR A;  1NLP C;  2DIL A;  2QTV A;  2NUZ A;  2KVQ G;  2LC4 A;  5GAN 8;  4AFU C;  4E7J A;  2L3Q A;  1D3B A;  1AWW A;  2DMO A;  3TQ7 P;  4FW1 A;  4FL6 A;  2L3S A;  4DEY A;  4PFZ A;  4A4E A;  1VQ9 T;  1BI3 A;  2ROT A;  4BUG A;  1YIJ T;  2MAM A;  3GNF B;  4M77 D;  1JXO A;  2CT3 A;  3FC3 A;  5KH6 A;  5GAO m;  4D8K A;  3LX7 A;  5L23 A;  1QVF S;  4ANJ A;  1QVG S;  2ROL A;  1WJS A;  3CME Q;  1R0B G;  1KQ1 A;  3U23 A;  1KD1 U;  1OV3 A;  3CPW S;  2EQK A;  2LX7 A;  2MYS A;  2M0O A;  3OSV A;  2QA4 T;  4CC7 A;  4BI3 A;  3INZ A;  2FEI A;  1NBE B;  2EPD A;  2LVM A;  2QK0 A;  1XJW B;  2WSE E;  4J9E A;  3VS5 A;  4EMK C;  4F16 A;  1VQ7 Q;  1KQ2 A;  3EG3 A;  4M7A G;  2L0A A;  5CIU A;  1QVF P;  2KRO A;  4ZN1 A;  3AHU A;  3I56 T;  3CBO A;  2FZG B;  4NS5 A;  1M1K U;  4XU3 A;  3HHT B;  2VGM A;  4JUV A;  2EW3 A;  2KT8 A;  2PZ1 A;  4E7Z A;  1JXM A;  3JCM X;  3EFO B;  2FHD A;  1YIT Q;  1QKX A;  3V8K A;  3WVD B;  3VJP A;  1YJN T;  2WSC E;  5J26 A;  2FZK B;  2O4X B;  2MMP A;  4QVZ A;  3VS1 A;  1RAE B;  5D6W A;  2K5F A;  1PHT A;  3HPW A;  3QII A;  2XIC A;  3X20 B;  2M1H A;  1JB0 E;  2W10 A;  4Z02 A;  1PG5 B;  2AHJ B;  1Q82 R;  1U06 A;  3F70 A;  1N8R C;  4IUQ A;  5KYY B;  2DL8 A;  4MMK A;  2QQB A;  1VQP A;  3PE0 A;  3LWI A;  3QBY A;  3ZEH A;  3V8L A;  3H9N A;  1VQM Q;  2E6Z A;  3I55 T;  2RH2 A;  1YFN A;  5A2Q E;  1W2B A;  2H3E B;  2VUB A;  2CP7 A;  4J9F A;  4JZ3 A;  1LNX A;  5CQX A;  1QMC A;  2EYZ A;  2LRQ A;  1WLP B;  1YJW Q;  1SPK A;  3P8D A;  3RMS A;  1MMD A;  5GMK m;  1Q7Y C;  5KYW A;  1VUB A;  3FDR A;  3EG1 A;  2K79 A;  2RNA A;  4XK8 E;  4BE2 A;  4BY6 C;  4E7S A;  3QJ6 A;  3OYN A;  2F5K A;  3L2Z A;  3OYI A;  4PJL A;  1B3Q A;  2GQI A;  3A1P A;  5GAM e;  2CT4 A;  1NEB A;  4FW2 A;  2DVE A;  2RJC A;  3X24 B;  1M1K C;  4BE0 A;  2BZY A;  5CQY A;  3CC7 A;  2RA2 A;  4E2F B;  4ELZ C;  6AT1 B;  4FU6 A;  1YIT A;  3TEE A;  1Q81 C;  2KAF A;  1QLY A;  3UDC A;  2VXF A;  1EIF A;  3FIF A;  3JB9 I;  3UPU A;  2MIO A;  1KHI A;  2XDB A;  5IN1 A;  1NPR A;  3RIR A;  4X9C A;  1VQ5 A;  2HL5 C;  5I21 A;  4XQ3 A;  1SF9 A;  4OML A;  2YUP A;  4HA8 A;  2ZZD A;  4DA4 A;  1BCM A;  4GLK A;  4M78 G;  1O9S A;  4C8Q B;  1N9S A;  3G6E A;  2KI7 A;  5FU7 C;  4QW2 A;  4QQD A;  2RI2 A;  2QDY B;  2YRC A;  4BB7 A;  3MET A;  2I0N A;  3CQT A;  1BU1 A;  2JM8 A;  3G4S T;  1WQ7 A;  1OX9 A;  4PLL A;  3G71 A;  5EC7 A;  3FJP A;  3N5B B;  4LDV A;  1ZLM A;  4RKU E;  1YJ9 A;  4KH0 B;  1ABQ A;  2JTM A;  2OAU A;  3VKI A;  1W2B S;  5GAO r;  4LE9 A;  5CO7 A;  1KC8 C;  4J8O A;  4KH1 B;  3HSB A;  4C8Q G;  3EH2 A;  4R0K A;  1PSF A;  3OQ5 A;  3OYA A;  1OQK A;  1BI2 A;  2RMO A;  4OMP A;  3TCJ A;  3MHX A;  2L8D A;  1OZ3 A;  3JCM g;  2JW4 A;  4M7D G;  2E10 A;  2E6N A;  5J3B A;  2RQW A;  1ZX6 A;  2CRE A;  1WPY A;  3FJ5 A;  3OA6 A;  3CME A;  4M7D F;  4YTL A;  2VAS A;  1T3S A;  5LJ3 j;  5CCA A;  3QDF A;  3VUZ A;  3V7C A;  1TWB A;  2LCC A;  2LX9 A;  3RBB B;  1X27 A;  3WVE B;  4M75 C;  3DKM A;  1RLP C;  1VQK T;  4DOW A;  1KK7 A;  3RER A;  5GAO l;  2QAZ A;  4M78 D;  3FB9 A;  3X28 B;  2MPX C;  3HKS A;  2DEQ A;  5GAO n;  4OVA A;  4BI8 B;  2COZ A;  1NEG A;  1D09 B;  4QVD A;  1RI0 A;  5EG2 A;  2V1Q A;  4E7H A;  3NTH A;  1KC8 U;  2GQV A;  4HXJ A;  4PJO G;  4N0A C;  3M4G A;  4MML A;  4BDY A;  2DFU A;  4O5V A;  2MWP A;  1R8O B;  1K73 U;  1Y96 A;  2QAS A;  4D6W A;  4QKU A;  3JB9 F;  2IG0 A;  4J6X A;  1U8R A;  4KGZ B;  4AT1 B;  4BDZ A;  1YP5 A;  1GBQ A;  1K4U S;  2GFU A;  1RL2 A;  4OMF B;  1WXT A;  1Q7Y U;  4XTW A;  1G3T A;  2SRC A;  5IHI A;  1N27 A;  3ZL7 C;  3JCM W;  3CEY A;  4RTU A;  1SSF A;  2LDM A;  1D0X A;  2KBT A;  3EFR A;  5LJ3 h;  3THK A;  1FMW A;  1C6V X;  2DJZ A;  3OS5 A;  1YCS B;  2LTO A;  1HD3 A;  4MZM A;  2RQT A;  1RAH B;  1NE8 A;  4DEX A;  1K9M R;  1AZG B;  4JJD A;  2RHX A;  4PJM A;  3V7R A;  2D9T A;  2KYM A;  5AYF A;  1N8R U;  3QWX X;  2YWW A;  2RK2 A;  3M0S A;  4M7A C;  4IKF A;  2RI5 A;  2HAX A;  1AWJ A;  4L6V 5;  2O9S A;  1UE9 A;  2X3W D;  2FL7 A;  2DBK A;  1G5V A;  1HSQ A;  1BI1 A;  2LQW A;  2RHI A;  3A8M B;  3R6N A;  3JB9 G;  2YUN A;  2EQJ A;  1IB8 A;  4E7I A;  3LGF A;  3JAM E;  2X4X A;  1H8K A;  2C0T A;  2WSF E;  4M75 B;  1VQ7 A;  3JCM f;  1VQ5 Q;  1NG2 A;  4LDY A;  1OUL A;  4ZGJ B;  4ZNX A;  5A0L A;  3ZFJ A;  5CVI A;  2GFA A;  4J9C A;  4FM4 B;  1GFD A;  1K0X A;  1WXB A;  1ZBJ A;  2DF6 A;  2VXE A;  2DZ9 A;  1IXD A;  5KCO A;  3NPF A;  2D6F A;  1E7O A;  2P0Q A;  1IO6 A;  1N5Z A;  4PL6 A;  2JM9 A;  5KYX A;  1CKA A;  4XTY A;  3CPW A;  1Z9Z A;  3CCS A;  3KBG A;  1ZA1 B;  3C0C A;  3M0R A;  4HT9 A;  1YWP A;  3L2R A;  1BK2 A;  2DBM A;  2YXY A;  3MP8 A;  2QQ9 A;  3KUF A;  4OB1 B;  1RAF B;  1RAD B;  2KYB A;  2SEM A;  4M77 A;  2AK5 A;  2J7I A;  2YLC A;  2NUP B;  2LNV A;  4BI4 A;  5GAN e;  4AFQ C;  3G71 Q;  1VQ7 T;  2JN0 A;  2KXC A;  4HT8 A;  1AZE A;  2LMJ A;  1W6X A;  5I11 A;  1VQK Q;  1QW1 A;  4FYW B;  3ER0 A;  1VQO T;  4F7U A;  3JCM c;  5CKE A;  1X2K A;  1M5Q 1;  3JB9 D;  2FVU A;  4B6M A;  4AFS C;  4C92 E;  3L2Q A;  1BYM A;  4K11 A;  1VQN T;  5LJ5 j;  5KYU B;  2E4H A;  5CKB A;  1YHQ Q;  3HRU A;  1NYG A;  1OEB A;  4C8Q E;  1F1B B;  3OYG A;  3CMA Q;  1QP3 A;  3EG9 A;  3CBP A;  1GBR A;  4C8Q C;  3J80 E;  2HD0 A;  2JTE A;  3NHN A;  4LD9 K;  2G3R A;  1WQW A;  3SWN C;  4ZGE B;  2DD4 A;  2AKL A;  3EG0 A;  5AT1 B;  5IAY A;  1R0C B;  1WX6 A;  1Z9Q A;  5IH2 A;  4R55 A;  2DD5 A;  1YJW A;  3MKD A;  3I55 Q;  4AMC A;  5KE3 A;  4A4H A;  3IQL A;  2R5A A;  4D8D A;  3QWY A;  3KXT A;  2AKK A;  2PUO B;  2BUD A;  4M7A A;  4KUL A;  2FYK A;  5LJ3 f;  4MDW A;  1YIJ A;  2AZS A;  3C4S A;  2PUK B;  4XTV A;  1QVF A;  3QJY A;  3E9G A;  3H0H A;  4N0A A;  2JS0 A;  4WCI A;  3HRT A;  1JJ2 S;  1W4S A;  1VQ4 Q;  2NUT B;  1I8F A;  3DB3 A;  4KUD K;  2XKO C;  2RQU A;  4FSX A;  3CMA A;  3PGG A;  3M59 A;  1YJ9 Q;  2YRD A;  3L2W A;  2LT4 A;  2PVG B;  3G4S A;  2ZPB B;  1VQ5 T;  3RKW A;  3CPF A;  4KGV B;  2YRV A;  2RPN A;  2RM4 A;  2RK1 A;  4PJO C;  3OSS C;  3VS6 A;  3FRN A;  4J6Y A;  3E2U A;  2ATC B;  3RKY A;  2BTT A;  5GAN 4;  4X34 A;  1UB4 A;  2QDL A;  3PNW C;  2IPO B;  2D8H A;  1OYX A;  2GTJ A;  1Y0M A;  4JZ4 A;  1RAB B;  1VYT A;  1ZA2 B;  2JS2 A;  4A53 A;  1WDX A;  1W2B P;  1C1A A;  4HCC A;  5GMK h;  4C5I A;  3H41 A;  1D0Y A;  2E12 A;  2QG9 B;  1B7T A;  3M4Y A;  1M4Z A;  1VQ8 Q;  3CC7 T;  4M78 A;  1YI2 Q;  3QXE B;  1IZ6 A;  2K3Y A;  2M16 A;  1H92 A;  3CC7 Q;  5GAO p;  5GJV B;  2DXU A;  5LJ3 e;  5KYY A;  1BCO A;  2HBP A;  3JCM V;  1PNJ A;  1X6O A;  5CK9 A;  2GTO A;  1Y57 A;  1IGQ A;  2IVW A;  3I5R A;  1AWX A;  3SFM A;  3BY7 A;  4HCK A;  4M77 G;  1PWT A;  2RHY A;  3OW2 S;  5FRN A;  3EH1 A;  1PM3 A;  4GBQ A;  3TRE A;  2HZY A;  2BE7 D;  2RF0 A;  4E7K A;  2CP3 A;  1VQN Q;  3JCM e;  4IUP A;  2HQH A;  5FWB A;  2FPE A;  3PVL A;  4MZP A;  3EFO A;  4M78 E;  4AG1 C;  5GAN d;  1QWF A;  1KQS P;  3OBW A;  1K73 C;  4KBM B;  5GAN 5;  2CUB A;  3RES A;  2XD0 A;  4FT4 A;  3O8V A;  3M0P A;  1M1G A;  4F7U E;  2L2P A;  4HCZ A;  4LDU A;  2HBW A;  2QEX A;  5FRM A;  3OS0 A;  2JMA A;  4NL3 A;  4OP0 A;  2NWM A;  1N8R R;  3A8G B;  2EVR A;  3L1A A;  2XHC A;  3CCE Q;  2DA9 A;  1QVG A;  5LJ5 g;  2HSP A;  3H0F A;  2AIR B;  3TSZ A;  3QUI A;  1K9M U;  1MMN A;  1M3C A;  4N4H A;  1ZUU A;  3URG A;  2VYT A;  1UFF A;  2MK5 A;  1UEB A;  2CS7 A;  3OYC A;  1U3O A;  1YBY A;  2K6D A;  3CMA T;  1AD5 A;  2KE9 A;  3OYL A;  3G6E Q;  1D1B A;  2RD1 A;  2LNH B;  1GXI E;  4HKE A;  3CCM A;  1VQM A;  2XU8 A;  1KIK A;  1OU9 A;  1RI9 A;  4EMK A;  3JB9 J;  3CCJ Q;  4JS4 A;  3VV0 A;  1U5S A;  3OYE A;  3GIB A;  3M0T A;  3JCM d;  1IRE B;  1QP2 A;  2GCX A;  1WHM A;  2QQS A;  2GBQ A;  4KUI A;  2E65 A;  1VQN A;  2DRK A;  1EFN A;  1IHW A;  2OTL A;  1G8X A;  2Y90 A;  3RUX A;  2FRY A;  4F14 A;  1WFW A;  4NL2 A;  1NYF A;  3CCU T;  1KD1 R;  4RTW A;  2C0I A;  3VS7 A;  3CCS Q;  4ZGD B;  2AZV A;  5IXB A;  4MZT A;  2EIF A;  4ZTJ A;  2CDT A;  3H8Z A;  4F17 A;  3V8J A;  3X26 B;  1TU0 B;  1RLQ C;  4XAX B;  1S1N A;  3VS0 A;  4DQ2 A;  4DOV A;  3QZ5 B;  2R58 A;  3EG9 B;  5GAO q;  3E9F A;  5HCK A;  2DK3 A;  2DKG A;  1K1Z A;  5KE2 A;  3SDZ A;  1UGS B;  4M7A E;  3I55 A;  4PLI A;  2DER A;  1C0M A;  1GFC A;  4M7A F;  2QGF B;  3CD6 Q;  4M7D A;  2DL7 A;  2JVV A;  1EX4 A;  3EGU A;  3OS1 A;  3EGX B;  4A4F A;  1D1C A;  2A3L A;  3LWH A;  1WHL A;  2V1R A;  3MJX A;  4QT7 A;  3S3O A;  4LUE A;  1M2O A;  3OYK A;  1YJN Q;  4C0Z A;  2XG8 D;  1TUD A;  3I5S A;  1PD1 A;  3HL8 A;  2R57 A;  2OTL Q;  3LH5 A;  2LQ8 A;  2DRM A;  2LT1 A;  1T0J A;  3P8H A;  2H8H A;  1ARK A;  1QCF A;  1TUC A;  2DNU A;  3OYJ A;  2QGG A;  3G4S Q;  4GY5 A;  1LOJ A;  1VYV A;  2D8J A;  2HQX A;  4JRK A;  1HJD A;  4C92 A;  4IUV A;  2HCK A;  2J06 A;  2DET A;  1ACM B;  4LD6 A;  1ZSZ B;  1TSF A;  2L89 A;  1VQO Q;  4IIO A;  2RJE A;  1PC0 A;  2KDS A;  4FT2 A;  3OYH A;  1Q95 G;  3QHS A;  4XU0 A;  3QO3 A;  4ORZ A;  3L2U A;  3UT1 A;  1S72 T;  2W0Z A;  4PJO F;  3CCV Q;  2ESW A;  2K57 A;  4LNP A;  4OGE A;  3CCL T;  2EYQ A;  1I81 A;  4EIK A;  4R56 A;  4XU2 A;  1YN8 A;  1PKS A;  1WYX A;  1VQ9 A;  3JB9 H;  3VS4 A;  3E1S A;  4OB3 B;  4LN2 A;  2V8J A;  1Y7X A;  2EKO A;  4JJC A;  1TH7 A;  5GAN 3;  4BD3 A;  3FEO A;  2KGT A;  1X2Q A;  2CSQ A;  3CBM A;  3NTK A;  3BDL A;  4BY6 B;  4J6W A;  2F1L A;  1WA7 A;  2BZ8 A;  2XMF A;  1M1F A;  4DBR A;  5D6X A;  3PVQ A;  4P5N A;  2AT1 B;  3CCQ Q;  2J6K A;  1G3W A;  2VWF A;  3M58 A;  1FMV A;  2EQU A;  2K5I A;  3JRZ A;  4PJO E;  2QXF A;  4JJN K;  4FYX B;  4RTT A;  1WZO A;  2Z0W A;  4JLG A;  2LP5 A;  2KQW A;  1LCK A;  1CSK A;  4RCB A;  1NJI U;  3KFV A;  1GCQ A;  1OU8 A;  2JT4 A;  3PFS A;  1M8M A;  1SHF A;  2LQK A;  2ZPF B;  4M75 A;  1LJO A;  2HDA A;  5CKD A;  2EKH A;  2KRS A;  3GF5 A;  1GCP A;  1KQS S;  2XDD A;  4C92 G;  1Y07 A;  4OB2 B;  2DXB A;  2E3H A;  2NUP A;  2DTI A;  1QWE A;  1M2V B;  1AVZ C;  1N9R A;  4J9D A;  1UG1 A;  3VYG A;  3JSC A;  5GAN g;  2LCL A;  5KYN A;  2A08 A;  2CUD A;  1ZBX A;  4DBQ A;  3CCU Q;  2BIV A;  1RAI B;  2EYY A;  5M9O A;  1AEY A;  3CC4 T;  2BKD N;  3JCM J;  1M90 R;  4PK4 A;  3CCM T;  2F69 A;  4M77 E;  1T0H A;  2J6O A;  2D1X A;  3J7A F;  3OMC A;  1B34 A;  2OTJ Q;  2X51 A;  4C0G A;  2KMT A;  4C92 B;  2M51 A;  2ENM A;  5FU7 B;  3BE3 A;  1RAC B;  2HKQ B;  2M9U A;  2NYS A;  4CC4 B;  1RAG B;  5A0G A;  3HFO A;  2OJ2 A;  1HXD A;  3S6W A;  1M27 C;  1O75 A;  3I56 A;  5GAN j;  4XTU A;  2QYZ A;  2H3J A;  2KK4 A;  3EFS A;  4JDS A;  3OYD A;  1NJI R;  1WHJ A;  4RCC A;  2MF2 A;  4RTX A;  2DEU A;  1D1A A;  3TSW A;  2K5L A;  4CC2 A;  2B86 A;  5IXF A;  2DTO A;  1ZSG A;  2DVJ A;  1KJW A;  2J6F A;  1M3A A;  1X69 A;  1TOV A;  4M7D C;  2RN8 A;  4KGX B;  2QEX Q;  4C8Q F;  1MV0 B;  4Q5W A;  4M7D B;  1OOT A;  4M7D E;  4EPC A;  2RHZ A;  1YIT T;  2JNG A;  4Y91 A;  3CCR A;  5GAM g;  1TG0 A;  1VIE A;  1VQ8 A;  3OB9 A;  4IUR A;  1N6A A;  4C92 D;  3CCL Q;  2K4Y A;  4KT0 E;  2YLB A;  2MOX A;  2QA4 A;  1UGV A;  3BFM A;  5GAM d;  4JJB A;  1H3H A;  3TU4 K;  2L3R A;  3SEM A;  3VRY A;  1KC8 R;  1VOM A;  4OMQ A;  2P0K A;  4HCB A;  1M90 U;  1VQL T;  2O88 A;  1WI7 A;  2DO3 A;  2YDL A;  2FPF A;  2EFI A;  2JTF A;  4N4G A;  3CCE T;  1BIA A;  3OYY A;  1VIF A;  4M75 E;  2EAY A;  4FSS A;  4BE1 A;  3S3M A;  1VYU A;  2O31 A;  1WNL A;  1VQM T;  4C0F A;  1ZSZ A;  4F7U G;  2EGE A;  1NZ9 A;  1SHG A;  2RQR A;  3ME9 A;  4UC4 A;  3VRZ A;  3C94 A;  2HMA A;  1MHN A;  2KY9 A;  4PFO A;  2CP2 A;  2E64 A;  2CSI A;  2Y4X A;  1MUZ A;  3DLM A;  1M8V A;  4PJO B;  4JLI A;  1Q86 U;  7AT1 B;  2LJ0 A;  3I35 A;  3PIO A;  4C92 F;  3PT9 A;  4VUB A;  1MMG A;  2RI3 A;  3BDU A;  3M53 A;  1M30 A;  2R5M A;  5L8R E;  4E6R A;  5LJ5 d;  1JEG A;  1MNE A;  2OAW A;  5KYW B;  3EGX A;  3CXC A;  2DTH A;  3OYF A;  1M1K R;  2DLP A;  2EQI A;  4GLM A;  1K9A A;  2ECZ A;  1K8A C;  3MEU A;  2BE9 B;  1K8A U;  3M54 A;  4EMK B;  4M78 F;  2RB6 A;  5FLX E;  2ZPI B;  4FYY B;  1M90 C;  1VQ9 Q;  1OZ2 A;  2B8A A;  2CYZ B;  1AWO A;  2HNI A;  1KFZ A;  1G83 A;  4M75 F;  2Y4Y A;  5IHN A;  3CME T;  2EBP A;  1NLO C;  2OI3 A;  2YSQ A;  3M5A A;  3CPW P;  2DE0 X;  2NLU A;  5GAN h;  2YUQ A;  2ZAE A;  1YJ9 T;  1BI0 A;  1XNI A;  1YI2 T;  3VS3 A;  2PQW A;  3SHW A;  2JUF A;  3A8L B;  3RMQ A;  1JBM A;  1Q86 R;  4Z89 A;  2XDP A;  1NJI C;  4C5E A;  1A0N B;  4RG8 A;  1LVK A;  1ZQ1 A;  3DB4 A;  5FU6 C;  1WJR A;  1Q82 U;  1V29 B;  2ZGW A;  1IRX A;  2GF7 A;  4C0D C;  3CCL A;  4WF2 A;  2X4J A;  3UA6 A;  3BW1 A;  5GAM f;  3UA7 A;  1QQJ A;  1X6B A;  2A0F B;  5KCH A;  1QCO A;  1VQ6 Q;  3QYH B;  5I2M A;  2BZX A;  1JO8 A;  3GP8 A;  2NUT A;  2J05 A;  4WTO B;  4N4I A;  1VQ6 T;  3A8O B;  1UGR B;  1K73 R;  4O6J A;  5CKH A;  2D0Q B;  3OMG A;  3J81 E;  1JRI A;  2EJG A;  3MP6 A;  4A4G A;  1YI2 A;  3OS2 A;  3CD6 A;  5DY9 A;  1UHC A;  2G6F X;  3H0I A;  3ZBD A;  1FXX A;  1MMA A;  1V1C A;  2JJ9 A;  1E6G A;  4M77 F;  3C95 A;  1WHG A;  3TVT A;  3MEA A;  3JCM b;  2K2V A;  4LDX A;  1VQ4 A;  2KNB B;  3ULR B;  4FYV B;  3GLX A;  3MEV A;  2ZPG B;  1VQO A;  1IHV A;  2OTJ A;  3M9Q A;  4MDX A;  1S72 A;  2O2O A;  3OYB A;  3FLG A;  2OX7 A;  1GL5 A;  2MI6 A;  5CR2 A;  3G6E T;  2V8K A;  3JCM h;  2JOY A;  2YUO A;  4J5Y A;  1KD1 C;  4ZN3 A;  5GAN 6;  4EMG A;  1TXQ A;  4AFZ C;  4L59 A;  2X35 A;  1TUG B;  4RMO A;  5IHK A;  2DYI A;  1GRI A;  2VVK A;  4Z88 A;  2RJF A;  4DBH A;  1KHC A;  3M0U A;  4F7U B;  2RJD A;  3JCM P;  1UGP B;  3NTI A;  1SRL A;  1XTD A;  3A5Z B;  3VS2 A;  2PU9 B;  1FWZ A;  5GMK j;  1UHF A;  2CZ6 B;  1PSE A;  2PTK A;  4FIB A;  3PMT A;  1QCN A;  4QQG A;  2A37 A;  1UTI A;  4M78 B;  2LQN A;  3RKX A;  5HK0 A;  4M75 G;  1RAA B;  2CP6 A;  1JJ2 A;  3LH0 A;  4EDU A;  2EJF A;  2P4T A;  4JRP A;  4B9X A;  1I0C A;  3RNJ A;  3CCQ A;  5GAN 7;  2F5T X;  1HK9 A;  3OY9 A;  4IUT A;  3WXM B;  2C0O A;  4LDW A;  4JRI A;  4JPB W;  3CCU A;  3MO8 A;  2VC8 A;  2F2W A;  4PNO A;  2L5Q A;  2EGA A;  3Q1J A;  2CGH A;  1ZSZ C;  3P8B B;  4PJN A;  1Q81 R;  4OF1 A;  1K9M C;  2CH4 W;  1ABO A;  1SRM A;  1WHH A;  4LUD A;  4CC3 A;  2IIM A;  4XTX A;  2A7Y A;  1HYO A;  4IIM A;  4CI0 C;  2QI2 A;  2CZ7 B;  3A8H B;  2DL5 A;  4J9G A;  3SB2 A;  4X9D A;  3CXC P;  2CP0 A;  1W1F A;  1YIJ Q;  2X4Y A;  3T9N A;  1Q81 U;  4M4Z A;  1PCX A;  1G3S A;  1V76 A;  2PVD B;  4C8Q D;  2E5K A;  1VQ8 T;  1K76 A;  2OTL T;  5FRO A;  5KYU A;  1UJ0 A;  5A0D A;  2DPP B;  2K7A A;  3M55 A;  1MND A;  3PMI A;  3I9Q A;  4J9B A;  2DM1 A;  1WJQ A;  5LJ3 d;  2QA4 Q;  3SWN B;  4RTZ A;  2VV5 A;  2DXC A;  3PTA A;  4ESR A;  4RTY A;  4IUU A;  3C12 A;  4E47 A;  1PKT A;  1BBZ A;  3M0Q A;  3CCR Q;  3GOX A;  4C92 C;  1B07 A;  2XID A;  2DZC A;  4RTV A;  2E70 A;  3MEW A;  3CC2 T;  1R77 A;  2X9H A;  1YNZ A;  1VQ6 A;  2QQA A;  4M77 B;  4HVW A;  4C0D B;  5GMK i;  1OPL A;  2FG0 A;  1KSW A;  1QKW A;  3CC2 Q;  2ED0 A;  1W70 A;  3CCV T;  1SG5 A;  5DLO A;  4CRI A;  2EGC A;  4Y28 E;  4Y92 A;  4PJO D;  2X3X D;  2FB7 A;  4ZTF A;  3R6O A;  2COY A;  2A28 A;  2X4W A;  3CC4 A;  1WIE A;  1IGU A;  2D0N A;  5FW9 A;  2JZ2 A;  3G71 T;  2F2X A;  3NFC A;  5ECA A;  5J39 A;  1Y71 A;  4OGC A;  2CKK A;  2E1H A;  3LLR A;  3MCA B;  3QSU A;  3EG2 A;  3O5Z A;  5HY6 A;  5LJ5 e;  1PRL C;  3GPL A;  1X43 A;  3VUB A;  2DJQ A;  1RUW A;  1PD0 A;  1BIB A;  2CP5 A;  3AT1 B;  4C5G A;  1BKB A;  2CZ1 B;  2DIG A;  1B34 B;  4FCY A;  2FRW A;  2K3B A;  3RDV A;  5GAN f;  2DAQ A;  1VA7 A;  1J3T A;  1K8A R;  5GAM j;  1E6H A;  2GNC A;  1I5L A;  4OB0 B;  2P4R A;  2MCN A; 
#chains in the Genus database with same CATH homology
 4HCK A;  4OML A;  2YUP A;  1PWT A;  2O88 A;  1WI7 A;  2YDL A;  2PNI A;  4GBQ A;  2FPF A;  1UDL A;  1I07 A;  2M0Y A;  1FMK A;  2RF0 A;  1UEC A;  4FSS A;  1SEM A;  3REB B;  2I0N A;  3CQT A;  1VYU A;  2O31 A;  1JU5 C;  1BU1 A;  5FWB A;  2JM8 A;  2FPE A;  2KT1 A;  3PVL A;  2EGE A;  1JQQ A;  1SHG A;  2RQR A;  1MV3 A;  5EC7 A;  3VRZ A;  4AG1 C;  1ZLM A;  1QWF A;  3JV3 A;  2CSI A;  1PRM C;  1ABQ A;  2CUB A;  2LJ1 A;  1MUZ A;  1I1J A;  4LE9 A;  2EYX A;  2GGR A;  1FYN A;  2LJ0 A;  3I35 A;  3M0P A;  2F2V A;  2L2P A;  4R0K A;  2HBW A;  1ZUY A;  1YWO A;  2JMA A;  2RMO A;  4HVU A;  2NWM A;  4OMP A;  2LZ6 B;  1M30 A;  4E6R A;  1JEG A;  2EVR A;  2DA9 A;  2OAW A;  2KEA A;  2JW4 A;  1K0S A;  2RQW A;  1ZX6 A;  2CRE A;  2HSP A;  3H0F A;  2KRN A;  3TSZ A;  1M3B A;  3FJ5 A;  2DLP A;  4J9H A;  2EQI A;  4GLM A;  1M3C A;  1T3S A;  1ZUU A;  2LJ3 A;  1K9A A;  2ECZ A;  1WXU A;  1UFF A;  1U3O A;  2K6D A;  1AD5 A;  2KE9 A;  3NMZ C;  1G2B A;  4J9I A;  2KRM A;  3RBB B;  1X27 A;  2LNH B;  1AWO A;  1RLP C;  1KFZ A;  1G83 A;  2DYB A;  1KIK A;  1RI9 A;  5IHN A;  2EBP A;  1NLO C;  1U5S A;  2DL4 A;  2OI3 A;  2YSQ A;  2YT6 A;  5GJW B;  2DE0 X;  3M0T A;  2YUQ A;  1NEG A;  2V1Q A;  2GBQ A;  3VS3 A;  2DRK A;  4HXJ A;  4RUG A;  1EFN A;  2FPD A;  4OMO A;  3SHW A;  2FRY A;  4Z89 A;  4F14 A;  1WFW A;  1NYF A;  2VKN A;  4AG2 C;  4RTW A;  1ZUK A;  2C0I A;  3VS7 A;  1A0N B;  1YP5 A;  2AZV A;  1GBQ A;  5IXB A;  1X6G A;  1K4U S;  1OPK A;  1WXT A;  2CDT A;  4F17 A;  2SRC A;  2DX1 A;  1RLQ C;  1S1N A;  5IHI A;  4KRT A;  3ZL7 C;  3VS0 A;  2O9V A;  4RTU A;  1BB9 A;  2JXB A;  1UJY A;  2KBT A;  3UA6 A;  3THK A;  1XOV A;  3UA7 A;  1YCS B;  5HCK A;  1X6B A;  1HD3 A;  2L3P A;  2DL3 A;  2RQT A;  3REA B;  1K1Z A;  2FO0 A;  2BZX A;  4DEX A;  1JO8 A;  1AZG B;  3GBQ A;  4JJD A;  2J05 A;  4X1V A;  1AOJ A;  3NGP A;  4A63 B;  1GFC A;  2KYM A;  3QWX X;  3M0S A;  2RQV A;  1AWJ A;  1GCQ C;  2DL7 A;  2O9S A;  2EYW A;  1UE9 A;  2X3W D;  1CKB A;  3EGU A;  1UHC A;  2DBK A;  1HSQ A;  2G6F X;  2LQW A;  3H0I A;  3R6N A;  2YUN A;  1UUE A;  2JMC A;  1V1C A;  2V1R A;  1E6G A;  4QT7 A;  3EHR A;  4LUE A;  3EHQ A;  1TUD A;  3I5S A;  3TVT A;  1H8K A;  2CH4 A;  2C0T A;  2KR3 A;  2KNB B;  1NG2 A;  2LCS A;  3LH5 A;  3ULR B;  2A36 A;  2ABL A;  1NM7 A;  4ZNX A;  2DRM A;  1SSH A;  2ED1 A;  3UAT A;  1T0J A;  4J9C A;  2H8H A;  5I22 A;  1QCF A;  1TUC A;  1WXB A;  2DNU A;  1ARK A;  1GFD A;  4OMM A;  1K0X A;  1ZBJ A;  2DF6 A;  2K9G A;  2O2O A;  4OMN A;  3UF4 A;  3NPF A;  1VYV A;  2KXD A;  1E7O A;  2D8J A;  1HJD A;  1GL5 A;  1IO6 A;  1N5Z A;  2HEQ A;  2HCK A;  2J06 A;  2JM9 A;  1CKA A;  2YUO A;  1Z9Z A;  4IIO A;  3C0C A;  3M0R A;  4AFZ C;  1YWP A;  1BK2 A;  4ORZ A;  1T3L A;  2DBM A;  2K2M A;  5IHK A;  2VVK A;  1GRI A;  4Z8A A;  2W0Z A;  4Z88 A;  5FWC A;  2KYB A;  3M0U A;  2SEM A;  2ESW A;  2AK5 A;  4HVV A;  4LNP A;  1SRL A;  2J7I A;  3A98 A;  1NLP C;  3VS2 A;  2DIL A;  1UHF A;  4AFQ C;  2NUZ A;  2PTK A;  4EIK A;  1YN8 A;  4AFU C;  2KXC A;  2L3Q A;  1AZE A;  1PKS A;  2LMJ A;  1W6X A;  2A37 A;  5I11 A;  1AWW A;  1UTI A;  2LQN A;  1WYX A;  2DMO A;  3VS4 A;  2L3S A;  4DEY A;  2ROT A;  4LN2 A;  1JXO A;  1I0C A;  3RNJ A;  2CT3 A;  1X2K A;  4JJC A;  4D8K A;  4AFS C;  5L23 A;  2KGT A;  1X2Q A;  2CSQ A;  2C0O A;  2ROL A;  4K11 A;  3U23 A;  1OV3 A;  1WA7 A;  4JPB W;  2BZ8 A;  2LX7 A;  2XMF A;  3PVQ A;  2F2W A;  4CC7 A;  1NYG A;  1OEB A;  2J6K A;  2EGA A;  2FEI A;  2VWF A;  2EPD A;  4J9E A;  3VS5 A;  1GBR A;  2CH4 W;  1ABO A;  1SRM A;  2JTE A;  4LUD A;  4F16 A;  3NHN A;  4CC3 A;  4RTT A;  2IIM A;  2LP5 A;  3EG3 A;  2L0A A;  1LCK A;  1CSK A;  3KFV A;  2KRO A;  1GCQ A;  4IIM A;  2JT4 A;  2DL5 A;  1M8M A;  2AKL A;  3EG0 A;  4J9G A;  1SHF A;  1WX6 A;  1Z9Q A;  5IH2 A;  2EW3 A;  1W1F A;  2KT8 A;  2PZ1 A;  1JXM A;  2HDA A;  4M4Z A;  3IQL A;  2EKH A;  2E5K A;  1QKX A;  2KRS A;  1K76 A;  4D8D A;  1GCP A;  1UJ0 A;  3QWY A;  2K7A A;  2AKK A;  1QWE A;  1AVZ C;  3I9Q A;  4J9B A;  4J9D A;  3VS1 A;  2DM1 A;  2AZS A;  1PHT A;  1UG1 A;  4RTZ A;  4ESR A;  3H0H A;  4RTY A;  2JS0 A;  2W10 A;  4WCI A;  2A08 A;  2CUD A;  1PKT A;  1BBZ A;  3M0Q A;  2EYY A;  1AEY A;  1B07 A;  1U06 A;  2RQU A;  4RTV A;  1T0H A;  2DL8 A;  2J6O A;  2D1X A;  3PE0 A;  1YNZ A;  2M51 A;  2ENM A;  4HVW A;  1OPL A;  2FG0 A;  1KSW A;  1QKW A;  2RPN A;  2ED0 A;  1W70 A;  4J9F A;  4CC4 B;  4JZ3 A;  3VS6 A;  2OJ2 A;  2EGC A;  2EYZ A;  1M27 C;  1WLP B;  4Y92 A;  1SPK A;  2X3X D;  2BTT A;  2QDL A;  2A28 A;  1WIE A;  3EG1 A;  2D0N A;  2D8H A;  2K79 A;  2RNA A;  5FW9 A;  4RTX A;  2GTJ A;  1Y0M A;  4JZ4 A;  3TSW A;  1VYT A;  2F2X A;  2B86 A;  4CC2 A;  5IXF A;  5ECA A;  1ZSG A;  2DVJ A;  1KJW A;  2J6F A;  2JS2 A;  1M3A A;  1WDX A;  1X69 A;  1B3Q A;  2RN8 A;  2GQI A;  2CT4 A;  1NEB A;  1MV0 B;  3EG2 A;  3O5Z A;  3H41 A;  2BZY A;  1OOT A;  1PRL C;  1X43 A;  1TG0 A;  2DJQ A;  1RUW A;  1QLY A;  1H92 A;  2FRW A;  5GJV B;  2K3B A;  2MOX A;  1UGV A;  1PNJ A;  1VA7 A;  2MIO A;  4JJB A;  1H3H A;  1J3T A;  1E6H A;  2GNC A;  2GTO A;  3SEM A;  1Y57 A;  2P4R A;  3VRY A;  3I5R A;  2MCN A;  1AWX A;  4OMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...