2EPDA

Solution structure of sh3 domain in rho-gtpase-activating protein 4
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
76
structure length
76
Chain Sequence
GSSGSSGEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERASSDWWRGEHNGMRGLIPHKYITLPAGTEKQVVGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Rho GTPase-activating protein 4
publication title Solution structure of SH3 domain in Rho-GTPase-activating protein 4
rcsb
source organism Homo sapiens
total genus 5
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2epdA00
4J9GA 2CDTA 3EG2A 3M0SA 1PKSA 1PRMC 2D8HA 4CC7A 2OI3A 1UFFA 1X2KA 1Z9ZA 1X6BA 4J9HA 1KIKA 1ABOA 1OV3A 4K11A 4Z88A 2LQWA 1JXMA 1B3QA 2GGRA 4CC4B 1GCQC 3VS4A 4JPBW 1SPKA 2VKNA 3CQTA 4OMPA 2HEQA 2X3XD 1ZSGA 2K6DA 3UA7A 1AWWA 1AWOA 1T3LA 2SRCA 4AG1C 1M30A 4OMQA 1SEMA 2PNIA 1UE9A 1PKTA 2IIMA 1CKAA 4HCKA 1N5ZA 2DL8A 2JM9A 2LJ1A 2HCKA 3NHNA 1W1FA 3C0CA 2DNUA 2FEIA 2OJ2A 3FJ5A 2DA9A 1PNJA 3M0PA 4WCIA 2LMJA 4HVUA 5IH2A 2LP5A 1AOJA 1Y0MA 2LJ0A 2MIOA 4OMOA 2YSQA 4J9FA 2SEMA 2JS0A 1AZEA 4RTZA 1E7OA 3KFVA 4DEYA 2HSPA 3EG1A 2C0OA 1WXTA 1AVZC 1MV3A 1TUDA 2RQWA 2RNAA 2EGAA 3TVTA 2A28A 1RLPC 4RTVA 2RMOA 4RTXA 1G2BA 2ESWA 2PTKA 3A98A 2ECZA 1PRLC 4E6RA 2XMFA 1X2QA 2DL3A 2FRYA 3REBB 1QWEA 1ZBJA 2HDAA 1SHFA 1WFWA 2J06A 2M0YA 2L3QA 2DBMA 1H8KA 3I5RA 4HXJA 1ZLMA 1WIEA 4IIOA 1UJ0A 3EHRA 2L2PA 3RNJA 2RPNA 3VS2A 4ESRA 1G83A 1I1JA 2B86A 1WXUA 2KROA 1YP5A 2BTTA 2FPDA 2V1QA 3I9QA 1ZX6A 4KRTA 2J6FA 2CSIA 1K0XA 3U23A 2EPDA 2RQUA 1ZUUA 4J9IA 1CKBA 2YUNA 2ABLA 2DLPA 2M51A 2AK5A 2KT1A 3UATA 2KEAA 4J9CA 2EW3A 1M8MA 4LE9A 2RN8A 2EGEA 3THKA 2ROTA 1U06A 2LQNA 1UUEA 2D1XA 2EQIA 4J9EA 3REAB 1WX6A 2MOXA 1KSWA 2FPEA 2RF0A 2LNHB 5I22A 1PWTA 4J9BA 1V1CA 2CUDA 2EYZA 1GL5A 3QWYA 1U5SA 1UECA 1BU1A 1GFCA 2KRMA 3EHQA 1YWOA 4IIMA 4JJBA 2JT4A 1SRLA 1E6HA 3QWXX 4Z89A 1KFZA 2LX7A 3SHWA 2L3PA 3SEMA 2F2WA 4ZNXA 1TUCA 4LN2A 2YUPA 1K1ZA 2OAWA 1K9AA 2O9SA 2L0AA 2RQRA 3VS5A 2GQIA 1M3BA 2FG0A 3H0HA 2JMCA 3H0IA 2GNCA 1RUWA 3TSZA 2J05A 2O2OA 4RTTA 4JZ3A 3IQLA 1WI7A 5IHIA 2KYBA 1JXOA 4D8KA 1NLOC 1Z9QA 3R6NA 3PE0A 4D8DA 1UTIA 3VRYA 2JMAA 1YNZA 2KRNA 4OMNA 5IHKA 1EFNA 3NGPA 4GBQA 1BBZA 4JJCA 1GRIA 3PVQA 1W6XA 2ED0A 2JM8A 2JXBA 1SHGA 2J6KA 2AZVA 2J6OA 2H8HA 2KNBB 1H92A 2P4RA 1UDLA 2DL7A 2MCNA 2A37A 2BZ8A 2KRSA 4OMMA 3I35A 2VWFA 4OMLA 2AKLA 1UHCA 2F2XA 1ZUYA 2EYYA 4GLMA 3ULRB 2KXCA 4RUGA 1ABQA 2J7IA 3LH5A 2CH4W 1ARKA 1YCSB 1X43A 2DL5A 2BZYA 1JO8A 5FWBA 3VS0A 2DILA 2DE0X 1NM7A 4AG2C 1U3OA 3ZL7C 3PVLA 1CSKA 1MV0B 1K76A 1WA7A 4JJDA 2EYXA 1WLPB 4LUDA 2V1RA 5I11A 2DRKA 2X3WD 1NEGA 2KE9A 1T0JA 3NMZC 2K3BA 1ZUKA 1WDXA 1JU5C 2G6FX 1QKXA 1BK2A 2EKHA 4AFSC 4RTYA 3VS7A 4HVVA 1X27A 2KBTA 5IXFA 4Z8AA 5L23A 1UG1A 3VRZA 4DEXA 2FPFA 1FMKA 2KYMA 2NUZA 2EBPA 1X69A 4M4ZA 3M0UA 3M0RA 1NEBA 1A0NB 1OOTA 2DBKA 3H0FA 2F2VA 1HSQA 4LNPA 2DL4A 2LJ3A 2E5KA 5EC7A 1MUZA 1YN8A 4A63B 1E6GA 2DVJA 1TG0A 1UHFA 2ED1A 4EIKA 2D0NA 1UGVA 2AZSA 1X6GA 1HJDA 4AFUC 1Y57A 2DJQA 1VA7A 3GBQA 1NYGA 3O5ZA 3VS3A 2K2MA 2L3SA 2A08A 2KR3A 1SSHA 1J3TA 1K0SA 2YT6A 1AZGB 2A36A 3M0QA 1S1NA 2ROLA 2DF6A 2W10A 3M0TA 1WXBA 2CH4A 2YUOA 2CREA 1M3CA 2YUQA 4AFZC 2RQTA 1QCFA 1AWJA 2I0NA 2RQVA 1VYTA 3I5SA 2EYWA 1I07A 2K9GA 3JV3A 5GJVB 4F14A 1GBQA 2C0IA 2JS2A 2DX1A 4QT7A 1NG2A 2GTJA 1W70A 2YDLA 1GCQA 2DRMA 1XOVA 2LCSA 1GCPA 2C0TA 1QWFA 2DM1A 3EGUA 2GBQA 2VVKA 2KT8A 2ENMA 1BB9A 3NPFA 5IXBA 1QKWA 1SRMA 1WYXA 4FSSA 4JZ4A 1B07A 4F16A 1RI9A 1AEYA 4X1VA 3VS6A 1AWXA 1VYUA 2AKKA 2HBWA 5FW9A 1T3SA 3H41A 4AFQC 1NLPC 3UF4A 2O88A 2O9VA 2KGTA 2DYBA 1M3AA 4R0KA 5HCKA 4CC3A 4ORZA 4F17A 2JW4A 4HVWA 2K7AA 1PHTA 2JTEA 4RTUA 1KJWA 1RLQC 2CT4A 2KXDA 2DMOA 2QDLA 5IHNA 2EGCA 2FO0A 2O31A 1YWPA 1FYNA 1JQQA 2CSQA 1T0HA 1GBRA 3TSWA 2CUBA 2FRWA 1QLYA 4LUEA 4J9DA 1VYVA 3EG3A 1OPKA 2GTOA 1OPLA 1M27C 2BZXA 5GJWB 1HD3A 2D8JA 4Y92A 5FWCA 2CT3A 1GFDA 1I0CA 1AD5A 2LZ6B 1LCKA 2K79A 1NYFA 1H3HA 2W0ZA 2NWMA 1IO6A 3UA6A 1JEGA 3EG0A 3RBBB 1K4US 2EVRA 1OEBA 2PZ1A 4RTWA 5ECAA 1UJYA 3VS1A 4CC2A
chains in the Genus database with same CATH superfamily
3CCJA 4C92B 3E9FA 1X2KA 1YJNQ 2QQRA 2KDSA 3OBYA 1KIKA 4IUPA 3G4SA 2LQWA 3MHXA 4CC4B 3OYHA 3M4YA 3OYCA 2K5LA 3VS4A 4EMKB 3EGDB 1LNXA 2VKNA 5KYWA 1HXDA 4BD3A 3CQTA 4C8QG 2M02A 3CXCS 4E47A 2GF7A 2EJGA 4MMLA 1T3LA 4XAXB 2SRCA 5GAOm 4OB1B 4PJOD 4BE2A 2HNIA 3OW2S 4F7UA 1U1SA 1Q95G 1Q81C 3OS0A 4PJOA 3HP9A 1LOJA 3PMTA 3HSBA 4JRQA 1PNJA 1BI2A 4HVUA 2BIVA 3QPHA 4HCZA 2LP5A 1AOJA 1K73U 1VQLA 2HZYA 3JCMJ 4OMOA 3Q1JA 2V8KA 3CBOA 2JS0A 4RTZA 4DEYA 3D7SB 2HSPA 3OYMA 4OVAA 2DVEA 2XIDA 3GPLA 1ZHIA 1WXTA 1FMWA 3QUIA 4M75C 1TUDA 4E7KA 2HMAA 2EGAA 1VQ7T 2DEQA 2RMOA 3A98A 2ESWA 2PTKA 3VUBA 1D3BB 2VB6A 3LH0A 2NLUA 2L3RA 3EH1A 3CCMQ 2XMFA 1X2QA 2FRYA 2WSCE 2P4TA 2V8IA 2XICA 3CCEA 2A7YA 4II1A 2HDAA 2DD4A 1QVFS 4ATOA 2L8DA 2MF2A 2DBMA 3H9NA 3V7RA 2O4XA 4NS5A 1YITA 1M1KR 1VQ4A 1S72A 4FW2A 3HFOA 3CC7A 2KROA 2ATCB 5GAN2 1ZX6A 5KYYB 1M1FA 4C5IA 1K0XA 3JCMg 1PSEA 2CS7A 5KCHA 1BKBA 3L2VA 2EFIA 4LDUA 4HT9A 1TU0B 1UB4A 3CCSQ 1KHIA 2KT1A 3UATA 4BI8B 2KEAA 4J9CA 1R0BG 2ROTA 3P8HA 3CD6Q 3G1JA 1VQOQ 3JCMX 2E65A 2EQIA 1LPLA 2QI2A 1YIJA 5LJ5e 1WX6A 3RKXA 4L5GA 2LNHB 2P0QA 4J9BA 3JB9J 2VGMA 3JCMP 2EYZA 4JLIA 1GL5A 5FU6B 4A53A 5GAOq 2FHDA 4O5VA 1BU1A 1YWOA 2JT4A 4J8OA 1SRLA 4IUVA 4M77D 4Z89A 3CCQA 1R8OB 1W4SA 4M75F 4BI3A 4QVCA 1YFNA 5CKEA 1M90R 2RK2A 2F2WA 2E6NA 4M77A 2K3XA 2YUPA 4L59A 2JJ9A 3M57A 3ZEHA 2L0AA 3VS5A 3A8GB 3H0HA 5KYXB 1RUWA 3TSZA 2O2OA 1AT1B 3RMQA 3PIPA 4BDYA 1W2BP 4A54A 5KYUB 2XU8A 3QIIA 1NLOC 1Z9QA 1VIEA 4D8DA 4QQGA 5HK0A 3LLRA 1JJ2P 4E7IA 2JTFA 4L6V5 2FZGB 1PD0A 2VV5A 4GBQA 2RH2A 2FYKA 4JJCA 3WXMB 1W6XA 1Q81U 2X4WA 3OYIA 2JXBA 3QO3A 1Y96B 2J6KA 2E41A 3H6ZA 4F04B 4IUQA 2AZVA 2HD0A 2Y90A 1M9SA 4MZPA 3V8JA 4JRKA 4M77G 3J7AF 1X01A 2NUPA 2BZ8A 4OMMA 4M7DE 1YJ9T 1RAEB 3M54A 4VUBA 2GFUA 2EYYA 3HPWA 4KH1B 4M7AB 1I4K1 2COYA 2CH4W 2CGHA 3S3OA 3ME9A 1YCSB 3BDUA 2DL5A 1JO8A 1YHQT 2CP0A 2DE0X 3HTRA 1VQ8Q 3SFMA 1VIFA 3A5ZB 3PIOA 2ZPHB 2ZPIB 2EYXA 1YI2Q 2CYZB 3FIFA 4JDSA 2DRKA 3JCMb 2X3WD 1NJIC 1T0JA 3NMZC 2PQWA 1YJWT 3X25B 1ZUKA 1JU5C 2XDDA 4N4HA 4JJNK 2V26A 3SD4A 1M2VB 1QKXA 4AFSC 4HVVA 1X27A 4HA8A 2DO3A 2QA4Q 3TQ7P 2E5QA 4Z8AA 2H3EB 4DEXA 3GP8A 4FU6A 2KYMA 1WQ7A 4DQ2A 4M4ZA 3M0UA 4JRIA 3OYAA 2F2VA 1HSQA 3WVEB 4E7JA 4LNPA 2D9TA 1P92A 2DL4A 1JBMA 3KBGA 3F70A 3NTHA 2LJ3A 4LDWA 5CQXA 5DLOA 4ELYC 3FB9A 4E7ZA 1TG0A 2B8AA 2JTMA 5CKDA 4C0DB 2D0NA 5KYNA 2XK0A 4ZGJB 1OQKA 2E10A 5LJ5h 1HJDA 2DJQA 3GBQA 3VS3A 1K0SA 4XTVA 1KQ2A 5GMKj 1AZGB 4DBRA 4M78C 3CCJT 1WXBA 1ZSZC 2CH4A 4BB7A 2AIRB 2CREA 4WTOB 2R5MA 5GMKi 3CPWA 3M5AA 4DBQA 3OYFA 3L1AA 1MMAA 2RQTA 3HL8A 3G4ST 3OW2P 1Q7YC 1AWJA 1QVGS 1VYTA 3CC2A 4J83A 3NTKA 3JV3A 3G71Q 3OMCA 3HRTA 1O9SA 1GCQA 1M2OA 1QVPA 3A8LB 2LQKA 1O75A 2Y4XA 2GBQA 2VVKA 1VQKQ 1KC8U 2YLBA 4FYYB 3CC4Q 3JB9I 5IXBA 1B34A 1B07A 4N0AA 2QQSA 1U1TA 2COZA 3JB9H 2AKKA 1VQLT 4CI0C 3H41A 2HBPA 4OF1A 3UF4A 2O88A 1D1AA 2M9UA 1M3AA 2QYZA 4CC3A 4KGXB 3M56A 2LCCA 4RG2A 2K7AA 2RHXA 1PHTA 1KJWA 3PTAA 2KXDA 5GMKl 2QDLA 1OU9A 5GAMg 4C5GA 3JCMf 2O31A 3URGA 5LJ3g 1JQQA 3OA6A 3HRUA 1GBRA 3CCRA 4ZTJA 2DXBA 5IN1A 4LUEA 4Y91A 1KK7A 4M78F 2DTIA 1OPLA 2BZXA 2DTHA 4Y92A 3CCET 2RI5A 1TUGB 1XTDA 1BIBA 2W0ZA 1RAGB 2VXFA 3CCUA 3GLXA 1YITT 1IO6A 1JEGA 1VQ4T 1S72T 2RI2A 2PZ1A 1YJNA 3CC7T 3FEOA 1WPYA 3VS1A 3BFMA 1ZQ1A 5D7UA 2DYIA 1PRMC 2OI3A 3RMSA 1Z9ZA 3EG9B 1ABOA 4A4GA 4K11A 2VUBA 4C92C 4QW2A 3QKJA 3JCMd 3QXEB 4JPBW 1XJWB 1SPKA 3GF5A 4FSXA 4OMPA 2X3XD 3P8DA 4AG1C 2QAZA 2QTVA 4EMKC 1M30A 1YIJT 3AT1B 2CP3A 2ZAEA 4M75E 1PKTA 2MK5A 4JUVA 1N5ZA 2PU9B 2JVVA 2COWA 1WJRA 1D0ZA 5J26A 2CKKA 3FJ5A 3CCQT 1M5Q1 3SWNA 5CVIA 2LRQA 1M1KC 1VQNA 1Y0MA 2MIOA 3EGXB 1RAIB 1NZ9A 1VQ6A 2RI3A 5CK9A 4C8QB 2PVOB 3OYJA 2M16A 2MWOA 1AVZC 1N27A 1MV3A 2MYSA 3LWHA 2RQWA 2A28A 4RTXA 1G2BA 1ZSZA 2LNVA 4QVZA 4E6RA 2DL3A 3CCVQ 2QQBA 3MEVA 4FYXB 1WGSA 2J06A 4JRPA 1H8KA 3I5RA 4HXJA 1TOVA 3DLLA 4C92F 2K57A 1BIAA 1R77A 1WXUA 5KYWB 1YP5A 2FPDA 3I9QA 3OBWA 1HYOA 1K9MU 1M90C 2K5IA 2DERA 3CCSA 1MMNA 1ZUUA 2RQUA 3INZA 1MGQA 4ZN3A 4M78G 2YUNA 2ABLA 3CD6A 3GIBA 3PFSA 3RESA 1VQOA 1WHMA 2DLPA 4AT1B 3RKYA 3HHTB 4LE9A 2RN8A 4HT8A 3T9NA 2LX9A 3QDFA 2D1XA 2RK1A 1N8RC 4PLIA 5J3BA 1KSWA 2DKGA 2FPEA 5I22A 1PWTA 2KQWA 4PJLA 4M7DD 3MEWA 2CZ1B 2JUFA 1U5SA 4E2FB 1UECA 3EHQA 1UGPB 4BACA 4JJBA 4P5NA 1OX9A 4M7DA 2OTJA 1G3YA 2JOYA 1OZ3A 3FDRA 1E6HA 4PFZA 1W2BA 5DY9A 5FU6C 5AYFA 2FZCB 1M4ZA 3CMEQ 1JJ2A 2GQIA 2LCLA 2E6ZA 5HK3A 1RI0A 2J05A 4RTTA 1K8AR 3IQLA 1XNIA 3I55Q 3R6NA 2O4XB 3X26B 3S3NA 1TXQA 3VRYA 1D09B 5IHKA 5GAMj 5LJ3j 3QJ6A 6AT1B 1BBZA 1UGRB 4M7DG 1OI1A 3QDRB 2ED0A 5GAN8 2JM8A 2H8HA 2P4RA 1TS9A 1SG5A 3JB9D 2DL7A 4LD9K 1ZA2B 2MCNA 3HFNA 3I35A 4OMLA 3OYKA 1UHCA 3CC2T 3MP8A 2YLCA 1G8XA 1ABQA 1ARKA 1PCXA 4HCBA 3H8ZA 5CIUA 1IHWA 4B6MA 1K73R 5FWBA 1YI2A 4OP0A 5D6XA 5I21A 2DILA 1VQMQ 1MHNA 4M7AC 1NM7A 3PGGA 2ZZDA 3O8VA 5GAMf 1U3OA 1BI0A 3EFSA 3ZL7C 5LJ3f 1WA7A 2JZ2A 4PK4A 2V1RA 4LXCA 4RCCA 4J6WA 2K3BA 3OYBA 5GANg 2QA4A 2E3IA 1FWZA 3META 5IT9E 4M77B 3FC3A 3VU3C 5CKHA 1C0MA 1XQHA 4RTYA 1I5OB 1EX4A 3FRNA 3S6WA 3OS2A 5IXFA 3JB9G 2FPFA 3OYGA 4JLGA 2EBPA 4M78E 1NEBA 1OOTA 1OULA 2K2VA 4GLKA 3V8LA 2QEXQ 1Y7XA 3L2RA 3CCRT 3V7CA 4XU3A 1WHHA 5EC7A 4DA4A 4A63B 1IXDA 5GAMd 1QP2A 2P0PA 5GAN5 3UPUA 4EIKA 4NOYA 1Y71A 3CXCA 3JCMc 3C12A 4A4HA 3CCUT 2CZ6B 2K2MA 2L3SA 3OW2A 4C0DC 2KR3A 1SSHA 1WQWA 2NUPB 1J3TA 3CMAQ 1YJNT 2KK4A 2X4YA 2AHJB 3M0QA 1S1NA 3CPFA 2W10A 3M0TA 3EH2A 4RKUE 4GY5A 4XU0A 2LTOA 2ZCFB 4IUUA 1C1AA 2OX7A 1QQJA 4M7AF 2EKOA 4J7FA 2EAYA 3L2UA 1N8RR 2MWPA 1YCYA 1MMDA 3DKMA 4C0FA 2QGGA 2HL3A 3NTIA 5GJVB 3CCLQ 2DXUA 5IAYA 1NG2A 3LWIA 2GTJA 4LD6A 1VQKA 3OS5A 5GAOl 4WF2A 1W70A 3RDVA 3QBYA 3CC4A 2DRMA 1XOVA 5GMKe 2NUTA 4KBMB 3EGUA 2KT8A 4RG8A 3UWNA 1I5LA 4PLLA 4FYVB 4FSSA 4XTUA 4F16A 1AEYA 2PVGB 4X1VA 3VS6A 1VYUA 1VQNT 1QVFA 1VQPQ 3QSUA 2PVDB 2A3LA 1QCNA 1IGQA 2DYBA 3MO8A 4R0KA 4F17A 4XTXA 2CZ0B 1VQ6T 2HAXA 4DBFA 2JTEA 1VQ5A 4FIBA 5A2QE 2CT4A 3RUXA 2EQUA 2EGCA 1I81A 4F7UE 3JCMe 1IRXA 1FYNA 4M75D 3CBMA 2CSQA 1T0HA 3TSWA 2FRWA 1VYVA 4M75A 4C92E 2GTOA 2DXTA 5L8RE 1S72Q 1LCKA 1H3HA 2P84A 2KVQG 4BY6B 3BDLA 2E4HA 4E7SA 1OEBA 2FB7A 3JCMV 3MPUB 3JAME 3QZ9B 4RTWA 5ECAA 2GFAA 1ZA1B 4J9GA 2CDTA 3EG2A 3M0SA 1HK9A 2MI6A 3CCST 4CC7A 1UFFA 1X6BA 8AT1B 5D6YA 5C0MA 2OTLQ 3BY7A 3ZFJA 1OV3A 2VYTA 4PJNA 3CD6T 1VQOT 1JXMA 1B3QA 1MNDA 4FM4B 4M75G 1QCOA 2WACA 1N9SA 4YTLA 1B34B 2DPPB 3CXCP 2F69A 1ZSGA 2EJFA 2YRCA 1B7TA 4MMKA 1M8VA 4OMQA 1SEMA 2PNIA 2KMTA 1U8RA 2JNGA 1CKAA 4HCKA 4IUTA 2MMPA 2K5FA 1TTHB 3CCQQ 3BE3A 2DL8A 2JM9A 2LJ1A 3DB4A 4M7AG 3NHNA 2XD0A 2OTJT 3C0CA 4WCIA 4ANJA 3OS1A 2LMJA 5IH2A 4A4FA 3L2ZA 1WHLA 2LJ0A 1VQ9Q 2QASA 4E7HA 3V8KA 4J9FA 5GAOp 2SEMA 2MPXC 1BI3A 1AZEA 5GANj 4PNOA 2XG8D 3KFVA 2DXCA 2DIQA 1TSFA 3LW5E 2HQXA 3TVTA 5GMKh 1RLPC 3CCVA 4MZTA 4RTVA 4MZMA 4C8QC 2EWNA 3A8OB 4OB0B 1QWEA 1LVKA 1ZBJA 3R6OA 1SHFA 2M0YA 2YXYA 4XTYA 2R58A 2L3QA 1QVFP 2RHYA 4FW1A 2G3RA 3ASKA 1ZLMA 1Y07A 1WIEA 5GANf 3RNJA 3VS2A 2RPNA 3I56Q 2EQKA 5FRMA 5LL6S 2E1HA 1KC8R 4ESRA 2ZPBB 1RAHB 4DOWA 2BTTA 4N4GA 1X75C 4KRTA 1Q82R 2J6FA 3G6EQ 4C0ZA 1BCMA 3JCMh 1SSFA 1YI2T 2BUDA 4QQDA 2JN0A 3SDZA 1KD1R 1NJIU 2LC4A 4MDXA 2DIGA 1K8AC 2M51A 3PMIA 1VOMA 2HQHA 2AK5A 5FU7C 4TVRA 1I8FA 2EGEA 2CP7A 3SWNB 2LQNA 1UUEA 4KH0B 2QA4T 3J80E 4PJOC 3CBPA 3REAB 2MOXA 2XI9A 1V1CA 2XDPA 3QJYA 2LT4A 3N5BB 2BE9B 5GANd 3OMGA 3CMEA 3QWXX 4FT4A 4UC4A 3SHWA 2L3PA 1ACMB 4C8QF 4QQ6A 4QKUA 2ZPEB 1ZSZB 2O9SA 2ZPFB 2RQRA 4JS5A 3I55A 1QVGA 1UGQB 3H0IA 2GNCA 1K73C 2O01E 1PG5B 1PD1A 4DBHA 1WI7A 3VUZA 2KYBA 1JXOA 4D8KA 3LGFA 3GOXA 3E2UA 2DFUA 3PE0A 5KE2A 1UTIA 2IG0A 5I2SA 3EFOA 1G3SA 2KRNA 4M7AE 4ME7A 2Y4YA 1VQ7Q 1FXXA 3PVQA 2V8JA 4M78D 1Q7YU 1RAAB 3VYHB 1M1GA 5GAN6 3CCMA 2J6OA 2X51A 2KNBB 3G71T 3V7SA 3CC2Q 1H92A 4M78A 1UDLA 3HRSA 3X20B 1TH7A 5GAN3 4FCYA 2A37A 2KRSA 1YBYA 1TWBA 2AKLA 1VQMA 5CQYA 1ZUYA 3ULRB 3MP1A 1KQSS 2KXCA 1WHGA 4F7UF 4Z02A 1JRIA 1WNLA 4RUGA 3LH5A 1VQKT 1VUBA 1RL2A 3OY9A 1X43A 4PKCC 4XQ3A 1RADB 3CC4T 3C94A 4PJOF 5GAMe 1GXIE 4AG2C 5LJ3e 3PT9A 2LT1A 3PVLA 1K76A 4ZN1A 3ZBDA 1WLPB 4LUDA 5I11A 4KGVB 2OAUA 4M7DB 1D0YA 4X9DA 4XU2A 3SB2A 1X6OA 1NBEB 5KCOA 1LJOA 3L42A 1WDXA 3M55A 4KUIA 2G6FX 4KULA 1Q86R 4KGZB 3VS7A 1V76A 3P8BB 2KBTA 2E12A 4M77C 1UG1A 3VRZA 2QG9B 5L23A 2QEXA 4FT2A 1VQ5T 1FMKA 2NUZA 4RCBA 1SKUB 1X69A 3X28B 2DBKA 2EYQA 3C95A 5A0LA 2QTXA 2YRDA 3H0FA 3TCJA 2MAMA 3M9QA 5GAOn 2E5KA 5HKCA 1MUZA 4BE0A 2DVJA 1K9MR 1UHFA 5I2MA 1FMVA 2ZGWA 3CMAA 5LJ5g 1UGVA 2AZSA 4Y28E 1X6GA 3OB9A 4AFUC 1Y57A 1VA7A 2RJCA 2H3JA 3M53A 3VKIA 2A08A 1RABB 2YT6A 2FL7A 2A36A 3M58A 2DF6A 2DK3A 2YUOA 3E1SA 1M3CA 3BW1A 3A1PA 2YUQA 3CCLA 4C5EA 2Z0WA 2I0NA 4C92D 1QVGP 2DD5A 3I5SA 2K9GA 2VGNA 2C0IA 1SF9A 4QT7A 4C92A 1OYXA 2YDLA 1YJ9Q 2CP5A 1GCPA 3X24B 5DLQE 4BUGA 1QWFA 2DM1A 1M1KU 1R0CB 2RHIA 2ENMA 1VQNQ 1YHQQ 3NPFA 4EMKA 1VQPA 3EGDA 2FVUA 1QKWA 1SRMA 2QQ9A 4M77F 1VQ8A 4OB2B 4QVDA 4JZ4A 1KQSA 1BYMA 1PM3A 2XDBA 3G7ZA 3LYIA 3DLMA 2HBWA 5FW9A 1VQ6Q 1T3SA 1WJSA 1PC0A 2P0KA 1NLPC 4F7UG 4FL6A 3OYEA 4LDYA 5HCKA 4ORZA 2JW4A 1YJWQ 4PJOG 4RTUA 2DMOA 2E64A 4C92G 5IHNA 2HQEA 2IPOB 2FO0A 1WHKA 5GAMh 3KUFA 3CCVT 1N6AA 1DJ7B 5LJ3h 1UEBA 3A8MB 4J9DA 1M27C 3GNGA 5FWCA 2CT3A 1I0CA 4DOVA 1G3WA 3OQ5A 1M90U 4J5YA 2F5TX 1D0XA 3RBBB 2EVRA 1D3BA 4N4IA 2OTLA 1UJYA 1WHJA 5LJ3d 4BY6C 4CC2A 4EMGA 2DTOA 3DB3A 1H641 1PKSA 3OSVA 2D8HA 2CZ7B 3JCMQ 4J9HA 4KT0E 2NUTB 1C6VX 4Z88A 3CCJQ 3FLGA 1MNEA 1N8RU 2GGRA 1G3TA 3MP6A 1GCQC 4B9WA 3L2WA 5CKBA 2KI7A 4XTZA 1KQ1A 2PUOB 2VXEA 2HEQA 5KYYA 3G4SQ 2K6DA 3UA7A 3VYGA 1AWWA 1AWOA 3G71A 2R57A 3QZ5B 1UE9A 4N0AC 3OSSC 5HY6A 2IIMA 8ATCB 2OTJQ 1IREB 4C8QE 3MCAB 1VQ9A 2X4JA 5KE3A 1RAFB 4R56A 2HKQB 4PL6A 2HCKA 1W1FA 5CCAA 2KY9A 3CMET 2DNUA 2FEIA 2OJ2A 4X34A 2DA9A 3M0PA 3CPWS 1KC8C 5D6WA 2X4XA 2YSQA 2DZ9A 4A4KA 1G5VA 1Q82C 3JRZA 4M75B 2I2LA 3I55T 4RMOA 1E7OA 2XHCA 1VQLQ 5EG2A 4NL2A 3TEEA 1KD1C 5FRNA 3EG1A 2C0OA 2QQAA 2EQMA 1JB0E 1NE8A 2RNAA 3OYLA 1IB8A 5GMKm 1D1BA 1FX7A 3A8HB 1ZBXA 2HKNA 2ECZA 1IHVA 1PRLC 5FROA 5FLXE 3REBB 5KYXA 1KQSP 3I56A 1Q81R 1WFWA 3UT1A 1BI1A 4A4EA 3CCMT 2DZCA 5KYUA 4V2SA 5GANe 4IIOA 1UJ0A 3EHRA 3G6EA 2L2PA 3CCEQ 4PJOE 1G83A 5LJ5j 2WSFE 3E9GA 3JSCA 1I1JA 2DEUA 2B86A 1VQMT 5DM7R 2V1QA 3TREA 2CSIA 1YITQ 3RKWA 1VQ4Q 3U23A 2EPDA 2K4YA 1Y96A 3CC7Q 2RO0A 4J9IA 1CKBA 4M7AD 3QYGB 4NL3A 3EFRA 2EW3A 1M8MA 4M7AA 3LGLA 3MKDA 3THKA 1U06A 1IGUA 3MJXA 5CR2A 2NYSA 4EMHA 2QK0A 4J9EA 2M1HA 2RHUA 5LJ5f 2RF0A 4OB3B 2CUDA 3SWNC 4BI4A 3QWYA 1YIJQ 4CRIA 1GFCA 2KRMA 4IIMA 4FYWB 2QEXT 1KFZA 1NPPA 2LX7A 3QYHB 2BE7D 3SEMA 2E70A 4XTWA 4ZNXA 5GAN7 1TUCA 4LN2A 1K1ZA 2OAWA 1K9AA 2E3HA 1M2VA 2RB6A 1M3BA 2FG0A 2DETA 3EAEA 2JMCA 2KSSA 4JZ3A 3CMAT 4OGCA 5IHIA 2CP6A 4EDUA 1VQ7A 2PUKB 4X9CA 2JMAA 2C06A 4OMFB 1YNZA 4OMNA 1EFNA 1MMGA 2GCXA 3NGPA 5CKFA 5LJ5d 4C5HA 1GRIA 4PFOA 5M9OA 5CAIA 1SHGA 1Q86C 3CCLT 1V29B 2X35A 4LDVA 2IVWA 1KHCA 2VWFA 4PJJA 2FZKB 2F2XA 4GLMA 3WVDB 3KXTA 1Q82U 2J7IA 4C0GA 4M77E 2BZYA 2YWWA 2YRVA 4PJMA 2HL5C 3VS0A 4D6WA 4J6XA 3VJPA 1KD1U 1CSKA 1MV0B 4PFPA 1K9MC 4JJDA 5AT1B 3OYNA 3MEAA 2VASA 2RHZA 1VQPT 1VQ8T 1PSFA 2LVMA 3MEUA 1NEGA 2KE9A 2LDMA 4ZGDB 4XU1A 5GAOr 2L5QA 1N9RA 5GANh 3TU4K 2GQVA 4M7DC 2LQ8A 1VQ5Q 3RR6A 1BK2A 4LDXA 2EKHA 4XK8E 2AT1B 3VV0A 4JS4A 2F5KA 3RERA 1EIFA 4IURA 3AHUA 3OYDA 3M0RA 1A0NB 5KH6A 2HSEB 1QW1A 3EFOB 2D0QB 5GAN4 2YHTA 2QXFA 2XKOC 1D1CA 2X9HA 1YN8A 1E6GA 2F1LA 3RIRA 4KUDK 3C4SA 2ED1A 2DAQA 4M78B 1NJIR 1NYGA 2EIFA 3O5ZA 1F1BB 1AHJB 2K3YA 2OTLT 2ROLA 2A0FB 2QGFB 3QG1A 5C6SA 1W2BS 2WSEE 2DJZA 1H3ZA 2RJDA 2CP2A 4HKEA 5A0DA 3E19A 4AFZC 4ELZC 2D6FA 9ATCB 2QDYB 2KAFA 1JJ2S 1QCFA 1UGSB 2RM4A 4B9XA 2RJEA 3FJPA 3L2QA 3JCMW 1YJ9A 2RA2A 2RQVA 2ZPGB 2EYWA 1I07A 1OU8A 1GBQA 4F14A 2JS2A 2DX1A 4O6JA 4ZGEB 4Q5WA 1WJQA 3CPWP 1YHQA 3HKSA 4IKFA 2LCSA 3NFCA 3EG9A 4M7DF 2C0TA 3GNFB 1OZ2A 4MDWA 4J7IA 1BB9A 1VQ9T 1OX8A 3OYYA 4ZTFA 1WYXA 1RI9A 4BE1A 2EQJA 1AWXA 4BDZA 1YJWA 4EPCA 4AFQC 3M4GA 2EJ9A 2O9VA 4OGEA 2KGTA 5CO7A 1Q86U 4HVWA 2RD1A 3CEYA 1Q7YR 5A0GA 1RLQC 3UDCA 3J81E 4AMCA 1YWPA 1RACB 3EGXA 1QMCA 1IZ6A 1WZOA 3S3MA 4C8QD 2CUBA 2R5AA 2L89A 1QLYA 2RJFA 1QP3A 3EG3A 1OPKA 5GJWB 1HD3A 2D8JA 4C8QA 3I56T 1GFDA 3CCRQ 3M59A 1AD5A 2LZ6B 1EZZB 4J6YA 4HCCA 2K79A 1NYFA 5FU7B 3JB9F 1NPRA 7AT1B 2M0OA 2NWMA 4F7UB 3G6ET 3UA6A 3EG0A 1K4US 3PNWC 3LX7A 5J39A 1KG1A 2VC8A 4PJOB 4E7LA 3QHSA 4R55A 1BCOA 3CCUQ 2BKDN 3ER0A 1K8AU
chains in the Genus database with same CATH topology
4J9GA 2CDTA 3EG2A 3M0SA 1PKSA 1PRMC 2D8HA 4CC7A 2OI3A 1UFFA 1X2KA 1Z9ZA 1X6BA 4J9HA 1KIKA 1ABOA 1OV3A 4K11A 4Z88A 2LQWA 1JXMA 1B3QA 2GGRA 4CC4B 1GCQC 3VS4A 4JPBW 1SPKA 2VKNA 3CQTA 4OMPA 2HEQA 2X3XD 1ZSGA 2K6DA 3UA7A 1AWWA 1AWOA 1T3LA 2SRCA 4AG1C 1M30A 4OMQA 1SEMA 2PNIA 1UE9A 1PKTA 2IIMA 1CKAA 4HCKA 1N5ZA 2DL8A 2JM9A 2LJ1A 2HCKA 3NHNA 1W1FA 3C0CA 2DNUA 2FEIA 2OJ2A 3FJ5A 2DA9A 1PNJA 3M0PA 4WCIA 2LMJA 4HVUA 5IH2A 2LP5A 1AOJA 1Y0MA 2LJ0A 2MIOA 4OMOA 2YSQA 4J9FA 2SEMA 2JS0A 1AZEA 4RTZA 1E7OA 3KFVA 4DEYA 2HSPA 3EG1A 2C0OA 1WXTA 1AVZC 1MV3A 1TUDA 2RQWA 2RNAA 2EGAA 3TVTA 2A28A 1RLPC 4RTVA 2RMOA 4RTXA 1G2BA 2ESWA 2PTKA 3A98A 2ECZA 1PRLC 4E6RA 2XMFA 1X2QA 2DL3A 2FRYA 3REBB 1QWEA 1ZBJA 2HDAA 1SHFA 1WFWA 2J06A 2M0YA 2L3QA 2DBMA 1H8KA 3I5RA 4HXJA 1ZLMA 1WIEA 4IIOA 1UJ0A 3EHRA 2L2PA 3RNJA 2RPNA 3VS2A 4ESRA 1G83A 1I1JA 2B86A 1WXUA 2KROA 1YP5A 2BTTA 2FPDA 2V1QA 3I9QA 1ZX6A 4KRTA 2J6FA 2CSIA 1K0XA 3U23A 2EPDA 2RQUA 1ZUUA 4J9IA 1CKBA 2YUNA 2ABLA 2DLPA 2M51A 2AK5A 2KT1A 3UATA 2KEAA 4J9CA 2EW3A 1M8MA 4LE9A 2RN8A 2EGEA 3THKA 2ROTA 1U06A 2LQNA 1UUEA 2D1XA 2EQIA 4J9EA 3REAB 1WX6A 2MOXA 1KSWA 2FPEA 2RF0A 2LNHB 5I22A 1PWTA 4J9BA 1V1CA 2CUDA 2EYZA 1GL5A 3QWYA 1U5SA 1UECA 1BU1A 1GFCA 2KRMA 3EHQA 1YWOA 4IIMA 4JJBA 2JT4A 1SRLA 1E6HA 3QWXX 4Z89A 1KFZA 2LX7A 3SHWA 2L3PA 3SEMA 2F2WA 4ZNXA 1TUCA 4LN2A 2YUPA 1K1ZA 2OAWA 1K9AA 2O9SA 2L0AA 2RQRA 3VS5A 2GQIA 1M3BA 2FG0A 3H0HA 2JMCA 3H0IA 2GNCA 1RUWA 3TSZA 2J05A 2O2OA 4RTTA 4JZ3A 3IQLA 1WI7A 5IHIA 2KYBA 1JXOA 4D8KA 1NLOC 1Z9QA 3R6NA 3PE0A 4D8DA 1UTIA 3VRYA 2JMAA 1YNZA 2KRNA 4OMNA 5IHKA 1EFNA 3NGPA 4GBQA 1BBZA 4JJCA 1GRIA 3PVQA 1W6XA 2ED0A 2JM8A 2JXBA 1SHGA 2J6KA 2AZVA 2J6OA 2H8HA 2KNBB 1H92A 2P4RA 1UDLA 2DL7A 2MCNA 2A37A 2BZ8A 2KRSA 4OMMA 3I35A 2VWFA 4OMLA 2AKLA 1UHCA 2F2XA 1ZUYA 2EYYA 4GLMA 3ULRB 2KXCA 4RUGA 1ABQA 2J7IA 3LH5A 2CH4W 1ARKA 1YCSB 1X43A 2DL5A 2BZYA 1JO8A 5FWBA 3VS0A 2DILA 2DE0X 1NM7A 4AG2C 1U3OA 3ZL7C 3PVLA 1CSKA 1MV0B 1K76A 1WA7A 4JJDA 2EYXA 1WLPB 4LUDA 2V1RA 5I11A 2DRKA 2X3WD 1NEGA 2KE9A 1T0JA 3NMZC 2K3BA 1ZUKA 1WDXA 1JU5C 2G6FX 1QKXA 1BK2A 2EKHA 4AFSC 4RTYA 3VS7A 4HVVA 1X27A 2KBTA 5IXFA 4Z8AA 5L23A 1UG1A 3VRZA 4DEXA 2FPFA 1FMKA 2KYMA 2NUZA 2EBPA 1X69A 4M4ZA 3M0UA 3M0RA 1NEBA 1A0NB 1OOTA 2DBKA 3H0FA 2F2VA 1HSQA 4LNPA 2DL4A 2LJ3A 2E5KA 5EC7A 1MUZA 1YN8A 4A63B 1E6GA 2DVJA 1TG0A 1UHFA 2ED1A 4EIKA 2D0NA 1UGVA 2AZSA 1X6GA 1HJDA 4AFUC 1Y57A 2DJQA 1VA7A 3GBQA 1NYGA 3O5ZA 3VS3A 2K2MA 2L3SA 2A08A 2KR3A 1SSHA 1J3TA 1K0SA 2YT6A 1AZGB 2A36A 3M0QA 1S1NA 2ROLA 2DF6A 2W10A 3M0TA 1WXBA 2CH4A 2YUOA 2CREA 1M3CA 2YUQA 4AFZC 2RQTA 1QCFA 1AWJA 2I0NA 2RQVA 1VYTA 3I5SA 2EYWA 1I07A 2K9GA 3JV3A 5GJVB 4F14A 1GBQA 2C0IA 2JS2A 2DX1A 4QT7A 1NG2A 2GTJA 1W70A 2YDLA 1GCQA 2DRMA 1XOVA 2LCSA 1GCPA 2C0TA 1QWFA 2DM1A 3EGUA 2GBQA 2VVKA 2KT8A 2ENMA 1BB9A 3NPFA 5IXBA 1QKWA 1SRMA 1WYXA 4FSSA 4JZ4A 1B07A 4F16A 1RI9A 1AEYA 4X1VA 3VS6A 1AWXA 1VYUA 2AKKA 2HBWA 5FW9A 1T3SA 3H41A 4AFQC 1NLPC 3UF4A 2O88A 2O9VA 2KGTA 2DYBA 1M3AA 4R0KA 5HCKA 4CC3A 4ORZA 4F17A 2JW4A 4HVWA 2K7AA 1PHTA 2JTEA 4RTUA 1KJWA 1RLQC 2CT4A 2KXDA 2DMOA 2QDLA 5IHNA 2EGCA 2FO0A 2O31A 1YWPA 1FYNA 1JQQA 2CSQA 1T0HA 1GBRA 3TSWA 2CUBA 2FRWA 1QLYA 4LUEA 4J9DA 1VYVA 3EG3A 1OPKA 2GTOA 1OPLA 1M27C 2BZXA 5GJWB 1HD3A 2D8JA 4Y92A 5FWCA 2CT3A 1GFDA 1I0CA 1AD5A 2LZ6B 1LCKA 2K79A 1NYFA 1H3HA 2W0ZA 2NWMA 1IO6A 3UA6A 1JEGA 3EG0A 3RBBB 1K4US 2EVRA 1OEBA 2PZ1A 4RTWA 5ECAA 1UJYA 3VS1A 4CC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9G A;  2CDT A;  3EG2 A;  3M0S A;  1PKS A;  1PRM C;  2D8H A;  4CC7 A;  2OI3 A;  1UFF A;  1X2K A;  1Z9Z A;  1X6B A;  4J9H A;  1KIK A;  1ABO A;  1OV3 A;  4K11 A;  4Z88 A;  2LQW A;  1JXM A;  1B3Q A;  2GGR A;  4CC4 B;  1GCQ C;  3VS4 A;  4JPB W;  1SPK A;  2VKN A;  3CQT A;  4OMP A;  2HEQ A;  2X3X D;  1ZSG A;  2K6D A;  3UA7 A;  1AWW A;  1AWO A;  1T3L A;  2SRC A;  4AG1 C;  1M30 A;  4OMQ A;  1SEM A;  2PNI A;  1UE9 A;  1PKT A;  2IIM A;  1CKA A;  4HCK A;  1N5Z A;  2DL8 A;  2JM9 A;  2LJ1 A;  2HCK A;  3NHN A;  1W1F A;  3C0C A;  2DNU A;  2FEI A;  2OJ2 A;  3FJ5 A;  2DA9 A;  1PNJ A;  3M0P A;  4WCI A;  2LMJ A;  4HVU A;  5IH2 A;  2LP5 A;  1AOJ A;  1Y0M A;  2LJ0 A;  2MIO A;  4OMO A;  2YSQ A;  4J9F A;  2SEM A;  2JS0 A;  1AZE A;  4RTZ A;  1E7O A;  3KFV A;  4DEY A;  2HSP A;  3EG1 A;  2C0O A;  1WXT A;  1AVZ C;  1MV3 A;  1TUD A;  2RQW A;  2RNA A;  2EGA A;  3TVT A;  2A28 A;  1RLP C;  4RTV A;  2RMO A;  4RTX A;  1G2B A;  2ESW A;  2PTK A;  3A98 A;  2ECZ A;  1PRL C;  4E6R A;  2XMF A;  1X2Q A;  2DL3 A;  2FRY A;  3REB B;  1QWE A;  1ZBJ A;  2HDA A;  1SHF A;  1WFW A;  2J06 A;  2M0Y A;  2L3Q A;  2DBM A;  1H8K A;  3I5R A;  4HXJ A;  1ZLM A;  1WIE A;  4IIO A;  1UJ0 A;  3EHR A;  2L2P A;  3RNJ A;  2RPN A;  3VS2 A;  4ESR A;  1G83 A;  1I1J A;  2B86 A;  1WXU A;  2KRO A;  1YP5 A;  2BTT A;  2FPD A;  2V1Q A;  3I9Q A;  1ZX6 A;  4KRT A;  2J6F A;  2CSI A;  1K0X A;  3U23 A;  2EPD A;  2RQU A;  1ZUU A;  4J9I A;  1CKB A;  2YUN A;  2ABL A;  2DLP A;  2M51 A;  2AK5 A;  2KT1 A;  3UAT A;  2KEA A;  4J9C A;  2EW3 A;  1M8M A;  4LE9 A;  2RN8 A;  2EGE A;  3THK A;  2ROT A;  1U06 A;  2LQN A;  1UUE A;  2D1X A;  2EQI A;  4J9E A;  3REA B;  1WX6 A;  2MOX A;  1KSW A;  2FPE A;  2RF0 A;  2LNH B;  5I22 A;  1PWT A;  4J9B A;  1V1C A;  2CUD A;  2EYZ A;  1GL5 A;  3QWY A;  1U5S A;  1UEC A;  1BU1 A;  1GFC A;  2KRM A;  3EHQ A;  1YWO A;  4IIM A;  4JJB A;  2JT4 A;  1SRL A;  1E6H A;  3QWX X;  4Z89 A;  1KFZ A;  2LX7 A;  3SHW A;  2L3P A;  3SEM A;  2F2W A;  4ZNX A;  1TUC A;  4LN2 A;  2YUP A;  1K1Z A;  2OAW A;  1K9A A;  2O9S A;  2L0A A;  2RQR A;  3VS5 A;  2GQI A;  1M3B A;  2FG0 A;  3H0H A;  2JMC A;  3H0I A;  2GNC A;  1RUW A;  3TSZ A;  2J05 A;  2O2O A;  4RTT A;  4JZ3 A;  3IQL A;  1WI7 A;  5IHI A;  2KYB A;  1JXO A;  4D8K A;  1NLO C;  1Z9Q A;  3R6N A;  3PE0 A;  4D8D A;  1UTI A;  3VRY A;  2JMA A;  1YNZ A;  2KRN A;  4OMN A;  5IHK A;  1EFN A;  3NGP A;  4GBQ A;  1BBZ A;  4JJC A;  1GRI A;  3PVQ A;  1W6X A;  2ED0 A;  2JM8 A;  2JXB A;  1SHG A;  2J6K A;  2AZV A;  2J6O A;  2H8H A;  2KNB B;  1H92 A;  2P4R A;  1UDL A;  2DL7 A;  2MCN A;  2A37 A;  2BZ8 A;  2KRS A;  4OMM A;  3I35 A;  2VWF A;  4OML A;  2AKL A;  1UHC A;  2F2X A;  1ZUY A;  2EYY A;  4GLM A;  3ULR B;  2KXC A;  4RUG A;  1ABQ A;  2J7I A;  3LH5 A;  2CH4 W;  1ARK A;  1YCS B;  1X43 A;  2DL5 A;  2BZY A;  1JO8 A;  5FWB A;  3VS0 A;  2DIL A;  2DE0 X;  1NM7 A;  4AG2 C;  1U3O A;  3ZL7 C;  3PVL A;  1CSK A;  1MV0 B;  1K76 A;  1WA7 A;  4JJD A;  2EYX A;  1WLP B;  4LUD A;  2V1R A;  5I11 A;  2DRK A;  2X3W D;  1NEG A;  2KE9 A;  1T0J A;  3NMZ C;  2K3B A;  1ZUK A;  1WDX A;  1JU5 C;  2G6F X;  1QKX A;  1BK2 A;  2EKH A;  4AFS C;  4RTY A;  3VS7 A;  4HVV A;  1X27 A;  2KBT A;  5IXF A;  4Z8A A;  5L23 A;  1UG1 A;  3VRZ A;  4DEX A;  2FPF A;  1FMK A;  2KYM A;  2NUZ A;  2EBP A;  1X69 A;  4M4Z A;  3M0U A;  3M0R A;  1NEB A;  1A0N B;  1OOT A;  2DBK A;  3H0F A;  2F2V A;  1HSQ A;  4LNP A;  2DL4 A;  2LJ3 A;  2E5K A;  5EC7 A;  1MUZ A;  1YN8 A;  4A63 B;  1E6G A;  2DVJ A;  1TG0 A;  1UHF A;  2ED1 A;  4EIK A;  2D0N A;  1UGV A;  2AZS A;  1X6G A;  1HJD A;  4AFU C;  1Y57 A;  2DJQ A;  1VA7 A;  3GBQ A;  1NYG A;  3O5Z A;  3VS3 A;  2K2M A;  2L3S A;  2A08 A;  2KR3 A;  1SSH A;  1J3T A;  1K0S A;  2YT6 A;  1AZG B;  2A36 A;  3M0Q A;  1S1N A;  2ROL A;  2DF6 A;  2W10 A;  3M0T A;  1WXB A;  2CH4 A;  2YUO A;  2CRE A;  1M3C A;  2YUQ A;  4AFZ C;  2RQT A;  1QCF A;  1AWJ A;  2I0N A;  2RQV A;  1VYT A;  3I5S A;  2EYW A;  1I07 A;  2K9G A;  3JV3 A;  5GJV B;  4F14 A;  1GBQ A;  2C0I A;  2JS2 A;  2DX1 A;  4QT7 A;  1NG2 A;  2GTJ A;  1W70 A;  2YDL A;  1GCQ A;  2DRM A;  1XOV A;  2LCS A;  1GCP A;  2C0T A;  1QWF A;  2DM1 A;  3EGU A;  2GBQ A;  2VVK A;  2KT8 A;  2ENM A;  1BB9 A;  3NPF A;  5IXB A;  1QKW A;  1SRM A;  1WYX A;  4FSS A;  4JZ4 A;  1B07 A;  4F16 A;  1RI9 A;  1AEY A;  4X1V A;  3VS6 A;  1AWX A;  1VYU A;  2AKK A;  2HBW A;  5FW9 A;  1T3S A;  3H41 A;  4AFQ C;  1NLP C;  3UF4 A;  2O88 A;  2O9V A;  2KGT A;  2DYB A;  1M3A A;  4R0K A;  5HCK A;  4CC3 A;  4ORZ A;  4F17 A;  2JW4 A;  4HVW A;  2K7A A;  1PHT A;  2JTE A;  4RTU A;  1KJW A;  1RLQ C;  2CT4 A;  2KXD A;  2DMO A;  2QDL A;  5IHN A;  2EGC A;  2FO0 A;  2O31 A;  1YWP A;  1FYN A;  1JQQ A;  2CSQ A;  1T0H A;  1GBR A;  3TSW A;  2CUB A;  2FRW A;  1QLY A;  4LUE A;  4J9D A;  1VYV A;  3EG3 A;  1OPK A;  2GTO A;  1OPL A;  1M27 C;  2BZX A;  5GJW B;  1HD3 A;  2D8J A;  4Y92 A;  5FWC A;  2CT3 A;  1GFD A;  1I0C A;  1AD5 A;  2LZ6 B;  1LCK A;  2K79 A;  1NYF A;  1H3H A;  2W0Z A;  2NWM A;  1IO6 A;  3UA6 A;  1JEG A;  3EG0 A;  3RBB B;  1K4U S;  2EVR A;  1OEB A;  2PZ1 A;  4RTW A;  5ECA A;  1UJY A;  3VS1 A;  4CC2 A; 
#chains in the Genus database with same CATH topology
 3CCJ A;  4C92 B;  3E9F A;  1X2K A;  1YJN Q;  2QQR A;  2KDS A;  3OBY A;  1KIK A;  4IUP A;  3G4S A;  2LQW A;  3MHX A;  4CC4 B;  3OYH A;  3M4Y A;  3OYC A;  2K5L A;  3VS4 A;  4EMK B;  3EGD B;  1LNX A;  2VKN A;  5KYW A;  1HXD A;  4BD3 A;  3CQT A;  4C8Q G;  2M02 A;  3CXC S;  4E47 A;  2GF7 A;  2EJG A;  4MML A;  1T3L A;  4XAX B;  2SRC A;  5GAO m;  4OB1 B;  4PJO D;  4BE2 A;  2HNI A;  3OW2 S;  4F7U A;  1U1S A;  1Q95 G;  1Q81 C;  3OS0 A;  4PJO A;  3HP9 A;  1LOJ A;  3PMT A;  3HSB A;  4JRQ A;  1PNJ A;  1BI2 A;  4HVU A;  2BIV A;  3QPH A;  4HCZ A;  2LP5 A;  1AOJ A;  1K73 U;  1VQL A;  2HZY A;  3JCM J;  4OMO A;  3Q1J A;  2V8K A;  3CBO A;  2JS0 A;  4RTZ A;  4DEY A;  3D7S B;  2HSP A;  3OYM A;  4OVA A;  2DVE A;  2XID A;  3GPL A;  1ZHI A;  1WXT A;  1FMW A;  3QUI A;  4M75 C;  1TUD A;  4E7K A;  2HMA A;  2EGA A;  1VQ7 T;  2DEQ A;  2RMO A;  3A98 A;  2ESW A;  2PTK A;  3VUB A;  1D3B B;  2VB6 A;  3LH0 A;  2NLU A;  2L3R A;  3EH1 A;  3CCM Q;  2XMF A;  1X2Q A;  2FRY A;  2WSC E;  2P4T A;  2V8I A;  2XIC A;  3CCE A;  2A7Y A;  4II1 A;  2HDA A;  2DD4 A;  1QVF S;  4ATO A;  2L8D A;  2MF2 A;  2DBM A;  3H9N A;  3V7R A;  2O4X A;  4NS5 A;  1YIT A;  1M1K R;  1VQ4 A;  1S72 A;  4FW2 A;  3HFO A;  3CC7 A;  2KRO A;  2ATC B;  5GAN 2;  1ZX6 A;  5KYY B;  1M1F A;  4C5I A;  1K0X A;  3JCM g;  1PSE A;  2CS7 A;  5KCH A;  1BKB A;  3L2V A;  2EFI A;  4LDU A;  4HT9 A;  1TU0 B;  1UB4 A;  3CCS Q;  1KHI A;  2KT1 A;  3UAT A;  4BI8 B;  2KEA A;  4J9C A;  1R0B G;  2ROT A;  3P8H A;  3CD6 Q;  3G1J A;  1VQO Q;  3JCM X;  2E65 A;  2EQI A;  1LPL A;  2QI2 A;  1YIJ A;  5LJ5 e;  1WX6 A;  3RKX A;  4L5G A;  2LNH B;  2P0Q A;  4J9B A;  3JB9 J;  2VGM A;  3JCM P;  2EYZ A;  4JLI A;  1GL5 A;  5FU6 B;  4A53 A;  5GAO q;  2FHD A;  4O5V A;  1BU1 A;  1YWO A;  2JT4 A;  4J8O A;  1SRL A;  4IUV A;  4M77 D;  4Z89 A;  3CCQ A;  1R8O B;  1W4S A;  4M75 F;  4BI3 A;  4QVC A;  1YFN A;  5CKE A;  1M90 R;  2RK2 A;  2F2W A;  2E6N A;  4M77 A;  2K3X A;  2YUP A;  4L59 A;  2JJ9 A;  3M57 A;  3ZEH A;  2L0A A;  3VS5 A;  3A8G B;  3H0H A;  5KYX B;  1RUW A;  3TSZ A;  2O2O A;  1AT1 B;  3RMQ A;  3PIP A;  4BDY A;  1W2B P;  4A54 A;  5KYU B;  2XU8 A;  3QII A;  1NLO C;  1Z9Q A;  1VIE A;  4D8D A;  4QQG A;  5HK0 A;  3LLR A;  1JJ2 P;  4E7I A;  2JTF A;  4L6V 5;  2FZG B;  1PD0 A;  2VV5 A;  4GBQ A;  2RH2 A;  2FYK A;  4JJC A;  3WXM B;  1W6X A;  1Q81 U;  2X4W A;  3OYI A;  2JXB A;  3QO3 A;  1Y96 B;  2J6K A;  2E41 A;  3H6Z A;  4F04 B;  4IUQ A;  2AZV A;  2HD0 A;  2Y90 A;  1M9S A;  4MZP A;  3V8J A;  4JRK A;  4M77 G;  3J7A F;  1X01 A;  2NUP A;  2BZ8 A;  4OMM A;  4M7D E;  1YJ9 T;  1RAE B;  3M54 A;  4VUB A;  2GFU A;  2EYY A;  3HPW A;  4KH1 B;  4M7A B;  1I4K 1;  2COY A;  2CH4 W;  2CGH A;  3S3O A;  3ME9 A;  1YCS B;  3BDU A;  2DL5 A;  1JO8 A;  1YHQ T;  2CP0 A;  2DE0 X;  3HTR A;  1VQ8 Q;  3SFM A;  1VIF A;  3A5Z B;  3PIO A;  2ZPH B;  2ZPI B;  2EYX A;  1YI2 Q;  2CYZ B;  3FIF A;  4JDS A;  2DRK A;  3JCM b;  2X3W D;  1NJI C;  1T0J A;  3NMZ C;  2PQW A;  1YJW T;  3X25 B;  1ZUK A;  1JU5 C;  2XDD A;  4N4H A;  4JJN K;  2V26 A;  3SD4 A;  1M2V B;  1QKX A;  4AFS C;  4HVV A;  1X27 A;  4HA8 A;  2DO3 A;  2QA4 Q;  3TQ7 P;  2E5Q A;  4Z8A A;  2H3E B;  4DEX A;  3GP8 A;  4FU6 A;  2KYM A;  1WQ7 A;  4DQ2 A;  4M4Z A;  3M0U A;  4JRI A;  3OYA A;  2F2V A;  1HSQ A;  3WVE B;  4E7J A;  4LNP A;  2D9T A;  1P92 A;  2DL4 A;  1JBM A;  3KBG A;  3F70 A;  3NTH A;  2LJ3 A;  4LDW A;  5CQX A;  5DLO A;  4ELY C;  3FB9 A;  4E7Z A;  1TG0 A;  2B8A A;  2JTM A;  5CKD A;  4C0D B;  2D0N A;  5KYN A;  2XK0 A;  4ZGJ B;  1OQK A;  2E10 A;  5LJ5 h;  1HJD A;  2DJQ A;  3GBQ A;  3VS3 A;  1K0S A;  4XTV A;  1KQ2 A;  5GMK j;  1AZG B;  4DBR A;  4M78 C;  3CCJ T;  1WXB A;  1ZSZ C;  2CH4 A;  4BB7 A;  2AIR B;  2CRE A;  4WTO B;  2R5M A;  5GMK i;  3CPW A;  3M5A A;  4DBQ A;  3OYF A;  3L1A A;  1MMA A;  2RQT A;  3HL8 A;  3G4S T;  3OW2 P;  1Q7Y C;  1AWJ A;  1QVG S;  1VYT A;  3CC2 A;  4J83 A;  3NTK A;  3JV3 A;  3G71 Q;  3OMC A;  3HRT A;  1O9S A;  1GCQ A;  1M2O A;  1QVP A;  3A8L B;  2LQK A;  1O75 A;  2Y4X A;  2GBQ A;  2VVK A;  1VQK Q;  1KC8 U;  2YLB A;  4FYY B;  3CC4 Q;  3JB9 I;  5IXB A;  1B34 A;  1B07 A;  4N0A A;  2QQS A;  1U1T A;  2COZ A;  3JB9 H;  2AKK A;  1VQL T;  4CI0 C;  3H41 A;  2HBP A;  4OF1 A;  3UF4 A;  2O88 A;  1D1A A;  2M9U A;  1M3A A;  2QYZ A;  4CC3 A;  4KGX B;  3M56 A;  2LCC A;  4RG2 A;  2K7A A;  2RHX A;  1PHT A;  1KJW A;  3PTA A;  2KXD A;  5GMK l;  2QDL A;  1OU9 A;  5GAM g;  4C5G A;  3JCM f;  2O31 A;  3URG A;  5LJ3 g;  1JQQ A;  3OA6 A;  3HRU A;  1GBR A;  3CCR A;  4ZTJ A;  2DXB A;  5IN1 A;  4LUE A;  4Y91 A;  1KK7 A;  4M78 F;  2DTI A;  1OPL A;  2BZX A;  2DTH A;  4Y92 A;  3CCE T;  2RI5 A;  1TUG B;  1XTD A;  1BIB A;  2W0Z A;  1RAG B;  2VXF A;  3CCU A;  3GLX A;  1YIT T;  1IO6 A;  1JEG A;  1VQ4 T;  1S72 T;  2RI2 A;  2PZ1 A;  1YJN A;  3CC7 T;  3FEO A;  1WPY A;  3VS1 A;  3BFM A;  1ZQ1 A;  5D7U A;  2DYI A;  1PRM C;  2OI3 A;  3RMS A;  1Z9Z A;  3EG9 B;  1ABO A;  4A4G A;  4K11 A;  2VUB A;  4C92 C;  4QW2 A;  3QKJ A;  3JCM d;  3QXE B;  4JPB W;  1XJW B;  1SPK A;  3GF5 A;  4FSX A;  4OMP A;  2X3X D;  3P8D A;  4AG1 C;  2QAZ A;  2QTV A;  4EMK C;  1M30 A;  1YIJ T;  3AT1 B;  2CP3 A;  2ZAE A;  4M75 E;  1PKT A;  2MK5 A;  4JUV A;  1N5Z A;  2PU9 B;  2JVV A;  2COW A;  1WJR A;  1D0Z A;  5J26 A;  2CKK A;  3FJ5 A;  3CCQ T;  1M5Q 1;  3SWN A;  5CVI A;  2LRQ A;  1M1K C;  1VQN A;  1Y0M A;  2MIO A;  3EGX B;  1RAI B;  1NZ9 A;  1VQ6 A;  2RI3 A;  5CK9 A;  4C8Q B;  2PVO B;  3OYJ A;  2M16 A;  2MWO A;  1AVZ C;  1N27 A;  1MV3 A;  2MYS A;  3LWH A;  2RQW A;  2A28 A;  4RTX A;  1G2B A;  1ZSZ A;  2LNV A;  4QVZ A;  4E6R A;  2DL3 A;  3CCV Q;  2QQB A;  3MEV A;  4FYX B;  1WGS A;  2J06 A;  4JRP A;  1H8K A;  3I5R A;  4HXJ A;  1TOV A;  3DLL A;  4C92 F;  2K57 A;  1BIA A;  1R77 A;  1WXU A;  5KYW B;  1YP5 A;  2FPD A;  3I9Q A;  3OBW A;  1HYO A;  1K9M U;  1M90 C;  2K5I A;  2DER A;  3CCS A;  1MMN A;  1ZUU A;  2RQU A;  3INZ A;  1MGQ A;  4ZN3 A;  4M78 G;  2YUN A;  2ABL A;  3CD6 A;  3GIB A;  3PFS A;  3RES A;  1VQO A;  1WHM A;  2DLP A;  4AT1 B;  3RKY A;  3HHT B;  4LE9 A;  2RN8 A;  4HT8 A;  3T9N A;  2LX9 A;  3QDF A;  2D1X A;  2RK1 A;  1N8R C;  4PLI A;  5J3B A;  1KSW A;  2DKG A;  2FPE A;  5I22 A;  1PWT A;  2KQW A;  4PJL A;  4M7D D;  3MEW A;  2CZ1 B;  2JUF A;  1U5S A;  4E2F B;  1UEC A;  3EHQ A;  1UGP B;  4BAC A;  4JJB A;  4P5N A;  1OX9 A;  4M7D A;  2OTJ A;  1G3Y A;  2JOY A;  1OZ3 A;  3FDR A;  1E6H A;  4PFZ A;  1W2B A;  5DY9 A;  5FU6 C;  5AYF A;  2FZC B;  1M4Z A;  3CME Q;  1JJ2 A;  2GQI A;  2LCL A;  2E6Z A;  5HK3 A;  1RI0 A;  2J05 A;  4RTT A;  1K8A R;  3IQL A;  1XNI A;  3I55 Q;  3R6N A;  2O4X B;  3X26 B;  3S3N A;  1TXQ A;  3VRY A;  1D09 B;  5IHK A;  5GAM j;  5LJ3 j;  3QJ6 A;  6AT1 B;  1BBZ A;  1UGR B;  4M7D G;  1OI1 A;  3QDR B;  2ED0 A;  5GAN 8;  2JM8 A;  2H8H A;  2P4R A;  1TS9 A;  1SG5 A;  3JB9 D;  2DL7 A;  4LD9 K;  1ZA2 B;  2MCN A;  3HFN A;  3I35 A;  4OML A;  3OYK A;  1UHC A;  3CC2 T;  3MP8 A;  2YLC A;  1G8X A;  1ABQ A;  1ARK A;  1PCX A;  4HCB A;  3H8Z A;  5CIU A;  1IHW A;  4B6M A;  1K73 R;  5FWB A;  1YI2 A;  4OP0 A;  5D6X A;  5I21 A;  2DIL A;  1VQM Q;  1MHN A;  4M7A C;  1NM7 A;  3PGG A;  2ZZD A;  3O8V A;  5GAM f;  1U3O A;  1BI0 A;  3EFS A;  3ZL7 C;  5LJ3 f;  1WA7 A;  2JZ2 A;  4PK4 A;  2V1R A;  4LXC A;  4RCC A;  4J6W A;  2K3B A;  3OYB A;  5GAN g;  2QA4 A;  2E3I A;  1FWZ A;  3MET A;  5IT9 E;  4M77 B;  3FC3 A;  3VU3 C;  5CKH A;  1C0M A;  1XQH A;  4RTY A;  1I5O B;  1EX4 A;  3FRN A;  3S6W A;  3OS2 A;  5IXF A;  3JB9 G;  2FPF A;  3OYG A;  4JLG A;  2EBP A;  4M78 E;  1NEB A;  1OOT A;  1OUL A;  2K2V A;  4GLK A;  3V8L A;  2QEX Q;  1Y7X A;  3L2R A;  3CCR T;  3V7C A;  4XU3 A;  1WHH A;  5EC7 A;  4DA4 A;  4A63 B;  1IXD A;  5GAM d;  1QP2 A;  2P0P A;  5GAN 5;  3UPU A;  4EIK A;  4NOY A;  1Y71 A;  3CXC A;  3JCM c;  3C12 A;  4A4H A;  3CCU T;  2CZ6 B;  2K2M A;  2L3S A;  3OW2 A;  4C0D C;  2KR3 A;  1SSH A;  1WQW A;  2NUP B;  1J3T A;  3CMA Q;  1YJN T;  2KK4 A;  2X4Y A;  2AHJ B;  3M0Q A;  1S1N A;  3CPF A;  2W10 A;  3M0T A;  3EH2 A;  4RKU E;  4GY5 A;  4XU0 A;  2LTO A;  2ZCF B;  4IUU A;  1C1A A;  2OX7 A;  1QQJ A;  4M7A F;  2EKO A;  4J7F A;  2EAY A;  3L2U A;  1N8R R;  2MWP A;  1YCY A;  1MMD A;  3DKM A;  4C0F A;  2QGG A;  2HL3 A;  3NTI A;  5GJV B;  3CCL Q;  2DXU A;  5IAY A;  1NG2 A;  3LWI A;  2GTJ A;  4LD6 A;  1VQK A;  3OS5 A;  5GAO l;  4WF2 A;  1W70 A;  3RDV A;  3QBY A;  3CC4 A;  2DRM A;  1XOV A;  5GMK e;  2NUT A;  4KBM B;  3EGU A;  2KT8 A;  4RG8 A;  3UWN A;  1I5L A;  4PLL A;  4FYV B;  4FSS A;  4XTU A;  4F16 A;  1AEY A;  2PVG B;  4X1V A;  3VS6 A;  1VYU A;  1VQN T;  1QVF A;  1VQP Q;  3QSU A;  2PVD B;  2A3L A;  1QCN A;  1IGQ A;  2DYB A;  3MO8 A;  4R0K A;  4F17 A;  4XTX A;  2CZ0 B;  1VQ6 T;  2HAX A;  4DBF A;  2JTE A;  1VQ5 A;  4FIB A;  5A2Q E;  2CT4 A;  3RUX A;  2EQU A;  2EGC A;  1I81 A;  4F7U E;  3JCM e;  1IRX A;  1FYN A;  4M75 D;  3CBM A;  2CSQ A;  1T0H A;  3TSW A;  2FRW A;  1VYV A;  4M75 A;  4C92 E;  2GTO A;  2DXT A;  5L8R E;  1S72 Q;  1LCK A;  1H3H A;  2P84 A;  2KVQ G;  4BY6 B;  3BDL A;  2E4H A;  4E7S A;  1OEB A;  2FB7 A;  3JCM V;  3MPU B;  3JAM E;  3QZ9 B;  4RTW A;  5ECA A;  2GFA A;  1ZA1 B;  4J9G A;  2CDT A;  3EG2 A;  3M0S A;  1HK9 A;  2MI6 A;  3CCS T;  4CC7 A;  1UFF A;  1X6B A;  8AT1 B;  5D6Y A;  5C0M A;  2OTL Q;  3BY7 A;  3ZFJ A;  1OV3 A;  2VYT A;  4PJN A;  3CD6 T;  1VQO T;  1JXM A;  1B3Q A;  1MND A;  4FM4 B;  4M75 G;  1QCO A;  2WAC A;  1N9S A;  4YTL A;  1B34 B;  2DPP B;  3CXC P;  2F69 A;  1ZSG A;  2EJF A;  2YRC A;  1B7T A;  4MMK A;  1M8V A;  4OMQ A;  1SEM A;  2PNI A;  2KMT A;  1U8R A;  2JNG A;  1CKA A;  4HCK A;  4IUT A;  2MMP A;  2K5F A;  1TTH B;  3CCQ Q;  3BE3 A;  2DL8 A;  2JM9 A;  2LJ1 A;  3DB4 A;  4M7A G;  3NHN A;  2XD0 A;  2OTJ T;  3C0C A;  4WCI A;  4ANJ A;  3OS1 A;  2LMJ A;  5IH2 A;  4A4F A;  3L2Z A;  1WHL A;  2LJ0 A;  1VQ9 Q;  2QAS A;  4E7H A;  3V8K A;  4J9F A;  5GAO p;  2SEM A;  2MPX C;  1BI3 A;  1AZE A;  5GAN j;  4PNO A;  2XG8 D;  3KFV A;  2DXC A;  2DIQ A;  1TSF A;  3LW5 E;  2HQX A;  3TVT A;  5GMK h;  1RLP C;  3CCV A;  4MZT A;  4RTV A;  4MZM A;  4C8Q C;  2EWN A;  3A8O B;  4OB0 B;  1QWE A;  1LVK A;  1ZBJ A;  3R6O A;  1SHF A;  2M0Y A;  2YXY A;  4XTY A;  2R58 A;  2L3Q A;  1QVF P;  2RHY A;  4FW1 A;  2G3R A;  3ASK A;  1ZLM A;  1Y07 A;  1WIE A;  5GAN f;  3RNJ A;  3VS2 A;  2RPN A;  3I56 Q;  2EQK A;  5FRM A;  5LL6 S;  2E1H A;  1KC8 R;  4ESR A;  2ZPB B;  1RAH B;  4DOW A;  2BTT A;  4N4G A;  1X75 C;  4KRT A;  1Q82 R;  2J6F A;  3G6E Q;  4C0Z A;  1BCM A;  3JCM h;  1SSF A;  1YI2 T;  2BUD A;  4QQD A;  2JN0 A;  3SDZ A;  1KD1 R;  1NJI U;  2LC4 A;  4MDX A;  2DIG A;  1K8A C;  2M51 A;  3PMI A;  1VOM A;  2HQH A;  2AK5 A;  5FU7 C;  4TVR A;  1I8F A;  2EGE A;  2CP7 A;  3SWN B;  2LQN A;  1UUE A;  4KH0 B;  2QA4 T;  3J80 E;  4PJO C;  3CBP A;  3REA B;  2MOX A;  2XI9 A;  1V1C A;  2XDP A;  3QJY A;  2LT4 A;  3N5B B;  2BE9 B;  5GAN d;  3OMG A;  3CME A;  3QWX X;  4FT4 A;  4UC4 A;  3SHW A;  2L3P A;  1ACM B;  4C8Q F;  4QQ6 A;  4QKU A;  2ZPE B;  1ZSZ B;  2O9S A;  2ZPF B;  2RQR A;  4JS5 A;  3I55 A;  1QVG A;  1UGQ B;  3H0I A;  2GNC A;  1K73 C;  2O01 E;  1PG5 B;  1PD1 A;  4DBH A;  1WI7 A;  3VUZ A;  2KYB A;  1JXO A;  4D8K A;  3LGF A;  3GOX A;  3E2U A;  2DFU A;  3PE0 A;  5KE2 A;  1UTI A;  2IG0 A;  5I2S A;  3EFO A;  1G3S A;  2KRN A;  4M7A E;  4ME7 A;  2Y4Y A;  1VQ7 Q;  1FXX A;  3PVQ A;  2V8J A;  4M78 D;  1Q7Y U;  1RAA B;  3VYH B;  1M1G A;  5GAN 6;  3CCM A;  2J6O A;  2X51 A;  2KNB B;  3G71 T;  3V7S A;  3CC2 Q;  1H92 A;  4M78 A;  1UDL A;  3HRS A;  3X20 B;  1TH7 A;  5GAN 3;  4FCY A;  2A37 A;  2KRS A;  1YBY A;  1TWB A;  2AKL A;  1VQM A;  5CQY A;  1ZUY A;  3ULR B;  3MP1 A;  1KQS S;  2KXC A;  1WHG A;  4F7U F;  4Z02 A;  1JRI A;  1WNL A;  4RUG A;  3LH5 A;  1VQK T;  1VUB A;  1RL2 A;  3OY9 A;  1X43 A;  4PKC C;  4XQ3 A;  1RAD B;  3CC4 T;  3C94 A;  4PJO F;  5GAM e;  1GXI E;  4AG2 C;  5LJ3 e;  3PT9 A;  2LT1 A;  3PVL A;  1K76 A;  4ZN1 A;  3ZBD A;  1WLP B;  4LUD A;  5I11 A;  4KGV B;  2OAU A;  4M7D B;  1D0Y A;  4X9D A;  4XU2 A;  3SB2 A;  1X6O A;  1NBE B;  5KCO A;  1LJO A;  3L42 A;  1WDX A;  3M55 A;  4KUI A;  2G6F X;  4KUL A;  1Q86 R;  4KGZ B;  3VS7 A;  1V76 A;  3P8B B;  2KBT A;  2E12 A;  4M77 C;  1UG1 A;  3VRZ A;  2QG9 B;  5L23 A;  2QEX A;  4FT2 A;  1VQ5 T;  1FMK A;  2NUZ A;  4RCB A;  1SKU B;  1X69 A;  3X28 B;  2DBK A;  2EYQ A;  3C95 A;  5A0L A;  2QTX A;  2YRD A;  3H0F A;  3TCJ A;  2MAM A;  3M9Q A;  5GAO n;  2E5K A;  5HKC A;  1MUZ A;  4BE0 A;  2DVJ A;  1K9M R;  1UHF A;  5I2M A;  1FMV A;  2ZGW A;  3CMA A;  5LJ5 g;  1UGV A;  2AZS A;  4Y28 E;  1X6G A;  3OB9 A;  4AFU C;  1Y57 A;  1VA7 A;  2RJC A;  2H3J A;  3M53 A;  3VKI A;  2A08 A;  1RAB B;  2YT6 A;  2FL7 A;  2A36 A;  3M58 A;  2DF6 A;  2DK3 A;  2YUO A;  3E1S A;  1M3C A;  3BW1 A;  3A1P A;  2YUQ A;  3CCL A;  4C5E A;  2Z0W A;  2I0N A;  4C92 D;  1QVG P;  2DD5 A;  3I5S A;  2K9G A;  2VGN A;  2C0I A;  1SF9 A;  4QT7 A;  4C92 A;  1OYX A;  2YDL A;  1YJ9 Q;  2CP5 A;  1GCP A;  3X24 B;  5DLQ E;  4BUG A;  1QWF A;  2DM1 A;  1M1K U;  1R0C B;  2RHI A;  2ENM A;  1VQN Q;  1YHQ Q;  3NPF A;  4EMK A;  1VQP A;  3EGD A;  2FVU A;  1QKW A;  1SRM A;  2QQ9 A;  4M77 F;  1VQ8 A;  4OB2 B;  4QVD A;  4JZ4 A;  1KQS A;  1BYM A;  1PM3 A;  2XDB A;  3G7Z A;  3LYI A;  3DLM A;  2HBW A;  5FW9 A;  1VQ6 Q;  1T3S A;  1WJS A;  1PC0 A;  2P0K A;  1NLP C;  4F7U G;  4FL6 A;  3OYE A;  4LDY A;  5HCK A;  4ORZ A;  2JW4 A;  1YJW Q;  4PJO G;  4RTU A;  2DMO A;  2E64 A;  4C92 G;  5IHN A;  2HQE A;  2IPO B;  2FO0 A;  1WHK A;  5GAM h;  3KUF A;  3CCV T;  1N6A A;  1DJ7 B;  5LJ3 h;  1UEB A;  3A8M B;  4J9D A;  1M27 C;  3GNG A;  5FWC A;  2CT3 A;  1I0C A;  4DOV A;  1G3W A;  3OQ5 A;  1M90 U;  4J5Y A;  2F5T X;  1D0X A;  3RBB B;  2EVR A;  1D3B A;  4N4I A;  2OTL A;  1UJY A;  1WHJ A;  5LJ3 d;  4BY6 C;  4CC2 A;  4EMG A;  2DTO A;  3DB3 A;  1H64 1;  1PKS A;  3OSV A;  2D8H A;  2CZ7 B;  3JCM Q;  4J9H A;  4KT0 E;  2NUT B;  1C6V X;  4Z88 A;  3CCJ Q;  3FLG A;  1MNE A;  1N8R U;  2GGR A;  1G3T A;  3MP6 A;  1GCQ C;  4B9W A;  3L2W A;  5CKB A;  2KI7 A;  4XTZ A;  1KQ1 A;  2PUO B;  2VXE A;  2HEQ A;  5KYY A;  3G4S Q;  2K6D A;  3UA7 A;  3VYG A;  1AWW A;  1AWO A;  3G71 A;  2R57 A;  3QZ5 B;  1UE9 A;  4N0A C;  3OSS C;  5HY6 A;  2IIM A;  8ATC B;  2OTJ Q;  1IRE B;  4C8Q E;  3MCA B;  1VQ9 A;  2X4J A;  5KE3 A;  1RAF B;  4R56 A;  2HKQ B;  4PL6 A;  2HCK A;  1W1F A;  5CCA A;  2KY9 A;  3CME T;  2DNU A;  2FEI A;  2OJ2 A;  4X34 A;  2DA9 A;  3M0P A;  3CPW S;  1KC8 C;  5D6W A;  2X4X A;  2YSQ A;  2DZ9 A;  4A4K A;  1G5V A;  1Q82 C;  3JRZ A;  4M75 B;  2I2L A;  3I55 T;  4RMO A;  1E7O A;  2XHC A;  1VQL Q;  5EG2 A;  4NL2 A;  3TEE A;  1KD1 C;  5FRN A;  3EG1 A;  2C0O A;  2QQA A;  2EQM A;  1JB0 E;  1NE8 A;  2RNA A;  3OYL A;  1IB8 A;  5GMK m;  1D1B A;  1FX7 A;  3A8H B;  1ZBX A;  2HKN A;  2ECZ A;  1IHV A;  1PRL C;  5FRO A;  5FLX E;  3REB B;  5KYX A;  1KQS P;  3I56 A;  1Q81 R;  1WFW A;  3UT1 A;  1BI1 A;  4A4E A;  3CCM T;  2DZC A;  5KYU A;  4V2S A;  5GAN e;  4IIO A;  1UJ0 A;  3EHR A;  3G6E A;  2L2P A;  3CCE Q;  4PJO E;  1G83 A;  5LJ5 j;  2WSF E;  3E9G A;  3JSC A;  1I1J A;  2DEU A;  2B86 A;  1VQM T;  5DM7 R;  2V1Q A;  3TRE A;  2CSI A;  1YIT Q;  3RKW A;  1VQ4 Q;  3U23 A;  2EPD A;  2K4Y A;  1Y96 A;  3CC7 Q;  2RO0 A;  4J9I A;  1CKB A;  4M7A D;  3QYG B;  4NL3 A;  3EFR A;  2EW3 A;  1M8M A;  4M7A A;  3LGL A;  3MKD A;  3THK A;  1U06 A;  1IGU A;  3MJX A;  5CR2 A;  2NYS A;  4EMH A;  2QK0 A;  4J9E A;  2M1H A;  2RHU A;  5LJ5 f;  2RF0 A;  4OB3 B;  2CUD A;  3SWN C;  4BI4 A;  3QWY A;  1YIJ Q;  4CRI A;  1GFC A;  2KRM A;  4IIM A;  4FYW B;  2QEX T;  1KFZ A;  1NPP A;  2LX7 A;  3QYH B;  2BE7 D;  3SEM A;  2E70 A;  4XTW A;  4ZNX A;  5GAN 7;  1TUC A;  4LN2 A;  1K1Z A;  2OAW A;  1K9A A;  2E3H A;  1M2V A;  2RB6 A;  1M3B A;  2FG0 A;  2DET A;  3EAE A;  2JMC A;  2KSS A;  4JZ3 A;  3CMA T;  4OGC A;  5IHI A;  2CP6 A;  4EDU A;  1VQ7 A;  2PUK B;  4X9C A;  2JMA A;  2C06 A;  4OMF B;  1YNZ A;  4OMN A;  1EFN A;  1MMG A;  2GCX A;  3NGP A;  5CKF A;  5LJ5 d;  4C5H A;  1GRI A;  4PFO A;  5M9O A;  5CAI A;  1SHG A;  1Q86 C;  3CCL T;  1V29 B;  2X35 A;  4LDV A;  2IVW A;  1KHC A;  2VWF A;  4PJJ A;  2FZK B;  2F2X A;  4GLM A;  3WVD B;  3KXT A;  1Q82 U;  2J7I A;  4C0G A;  4M77 E;  2BZY A;  2YWW A;  2YRV A;  4PJM A;  2HL5 C;  3VS0 A;  4D6W A;  4J6X A;  3VJP A;  1KD1 U;  1CSK A;  1MV0 B;  4PFP A;  1K9M C;  4JJD A;  5AT1 B;  3OYN A;  3MEA A;  2VAS A;  2RHZ A;  1VQP T;  1VQ8 T;  1PSF A;  2LVM A;  3MEU A;  1NEG A;  2KE9 A;  2LDM A;  4ZGD B;  4XU1 A;  5GAO r;  2L5Q A;  1N9R A;  5GAN h;  3TU4 K;  2GQV A;  4M7D C;  2LQ8 A;  1VQ5 Q;  3RR6 A;  1BK2 A;  4LDX A;  2EKH A;  4XK8 E;  2AT1 B;  3VV0 A;  4JS4 A;  2F5K A;  3RER A;  1EIF A;  4IUR A;  3AHU A;  3OYD A;  3M0R A;  1A0N B;  5KH6 A;  2HSE B;  1QW1 A;  3EFO B;  2D0Q B;  5GAN 4;  2YHT A;  2QXF A;  2XKO C;  1D1C A;  2X9H A;  1YN8 A;  1E6G A;  2F1L A;  3RIR A;  4KUD K;  3C4S A;  2ED1 A;  2DAQ A;  4M78 B;  1NJI R;  1NYG A;  2EIF A;  3O5Z A;  1F1B B;  1AHJ B;  2K3Y A;  2OTL T;  2ROL A;  2A0F B;  2QGF B;  3QG1 A;  5C6S A;  1W2B S;  2WSE E;  2DJZ A;  1H3Z A;  2RJD A;  2CP2 A;  4HKE A;  5A0D A;  3E19 A;  4AFZ C;  4ELZ C;  2D6F A;  9ATC B;  2QDY B;  2KAF A;  1JJ2 S;  1QCF A;  1UGS B;  2RM4 A;  4B9X A;  2RJE A;  3FJP A;  3L2Q A;  3JCM W;  1YJ9 A;  2RA2 A;  2RQV A;  2ZPG B;  2EYW A;  1I07 A;  1OU8 A;  1GBQ A;  4F14 A;  2JS2 A;  2DX1 A;  4O6J A;  4ZGE B;  4Q5W A;  1WJQ A;  3CPW P;  1YHQ A;  3HKS A;  4IKF A;  2LCS A;  3NFC A;  3EG9 A;  4M7D F;  2C0T A;  3GNF B;  1OZ2 A;  4MDW A;  4J7I A;  1BB9 A;  1VQ9 T;  1OX8 A;  3OYY A;  4ZTF A;  1WYX A;  1RI9 A;  4BE1 A;  2EQJ A;  1AWX A;  4BDZ A;  1YJW A;  4EPC A;  4AFQ C;  3M4G A;  2EJ9 A;  2O9V A;  4OGE A;  2KGT A;  5CO7 A;  1Q86 U;  4HVW A;  2RD1 A;  3CEY A;  1Q7Y R;  5A0G A;  1RLQ C;  3UDC A;  3J81 E;  4AMC A;  1YWP A;  1RAC B;  3EGX A;  1QMC A;  1IZ6 A;  1WZO A;  3S3M A;  4C8Q D;  2CUB A;  2R5A A;  2L89 A;  1QLY A;  2RJF A;  1QP3 A;  3EG3 A;  1OPK A;  5GJW B;  1HD3 A;  2D8J A;  4C8Q A;  3I56 T;  1GFD A;  3CCR Q;  3M59 A;  1AD5 A;  2LZ6 B;  1EZZ B;  4J6Y A;  4HCC A;  2K79 A;  1NYF A;  5FU7 B;  3JB9 F;  1NPR A;  7AT1 B;  2M0O A;  2NWM A;  4F7U B;  3G6E T;  3UA6 A;  3EG0 A;  1K4U S;  3PNW C;  3LX7 A;  5J39 A;  1KG1 A;  2VC8 A;  4PJO B;  4E7L A;  3QHS A;  4R55 A;  1BCO A;  3CCU Q;  2BKD N;  3ER0 A;  1K8A U; 
#chains in the Genus database with same CATH homology
 4J9G A;  2CDT A;  3EG2 A;  3M0S A;  1PKS A;  1PRM C;  2D8H A;  4CC7 A;  2OI3 A;  1UFF A;  1X2K A;  1Z9Z A;  1X6B A;  4J9H A;  1KIK A;  1ABO A;  1OV3 A;  4K11 A;  4Z88 A;  2LQW A;  1JXM A;  1B3Q A;  2GGR A;  4CC4 B;  1GCQ C;  3VS4 A;  4JPB W;  1SPK A;  2VKN A;  3CQT A;  4OMP A;  2HEQ A;  2X3X D;  1ZSG A;  2K6D A;  3UA7 A;  1AWW A;  1AWO A;  1T3L A;  2SRC A;  4AG1 C;  1M30 A;  4OMQ A;  1SEM A;  2PNI A;  1UE9 A;  1PKT A;  2IIM A;  1CKA A;  4HCK A;  1N5Z A;  2DL8 A;  2JM9 A;  2LJ1 A;  2HCK A;  3NHN A;  1W1F A;  3C0C A;  2DNU A;  2FEI A;  2OJ2 A;  3FJ5 A;  2DA9 A;  1PNJ A;  3M0P A;  4WCI A;  2LMJ A;  4HVU A;  5IH2 A;  2LP5 A;  1AOJ A;  1Y0M A;  2LJ0 A;  2MIO A;  4OMO A;  2YSQ A;  4J9F A;  2SEM A;  2JS0 A;  1AZE A;  4RTZ A;  1E7O A;  3KFV A;  4DEY A;  2HSP A;  3EG1 A;  2C0O A;  1WXT A;  1AVZ C;  1MV3 A;  1TUD A;  2RQW A;  2RNA A;  2EGA A;  3TVT A;  2A28 A;  1RLP C;  4RTV A;  2RMO A;  4RTX A;  1G2B A;  2ESW A;  2PTK A;  3A98 A;  2ECZ A;  1PRL C;  4E6R A;  2XMF A;  1X2Q A;  2DL3 A;  2FRY A;  3REB B;  1QWE A;  1ZBJ A;  2HDA A;  1SHF A;  1WFW A;  2J06 A;  2M0Y A;  2L3Q A;  2DBM A;  1H8K A;  3I5R A;  4HXJ A;  1ZLM A;  1WIE A;  4IIO A;  1UJ0 A;  3EHR A;  2L2P A;  3RNJ A;  2RPN A;  3VS2 A;  4ESR A;  1G83 A;  1I1J A;  2B86 A;  1WXU A;  2KRO A;  1YP5 A;  2BTT A;  2FPD A;  2V1Q A;  3I9Q A;  1ZX6 A;  4KRT A;  2J6F A;  2CSI A;  1K0X A;  3U23 A;  2EPD A;  2RQU A;  1ZUU A;  4J9I A;  1CKB A;  2YUN A;  2ABL A;  2DLP A;  2M51 A;  2AK5 A;  2KT1 A;  3UAT A;  2KEA A;  4J9C A;  2EW3 A;  1M8M A;  4LE9 A;  2RN8 A;  2EGE A;  3THK A;  2ROT A;  1U06 A;  2LQN A;  1UUE A;  2D1X A;  2EQI A;  4J9E A;  3REA B;  1WX6 A;  2MOX A;  1KSW A;  2FPE A;  2RF0 A;  2LNH B;  5I22 A;  1PWT A;  4J9B A;  1V1C A;  2CUD A;  2EYZ A;  1GL5 A;  3QWY A;  1U5S A;  1UEC A;  1BU1 A;  1GFC A;  2KRM A;  3EHQ A;  1YWO A;  4IIM A;  4JJB A;  2JT4 A;  1SRL A;  1E6H A;  3QWX X;  4Z89 A;  1KFZ A;  2LX7 A;  3SHW A;  2L3P A;  3SEM A;  2F2W A;  4ZNX A;  1TUC A;  4LN2 A;  2YUP A;  1K1Z A;  2OAW A;  1K9A A;  2O9S A;  2L0A A;  2RQR A;  3VS5 A;  2GQI A;  1M3B A;  2FG0 A;  3H0H A;  2JMC A;  3H0I A;  2GNC A;  1RUW A;  3TSZ A;  2J05 A;  2O2O A;  4RTT A;  4JZ3 A;  3IQL A;  1WI7 A;  5IHI A;  2KYB A;  1JXO A;  4D8K A;  1NLO C;  1Z9Q A;  3R6N A;  3PE0 A;  4D8D A;  1UTI A;  3VRY A;  2JMA A;  1YNZ A;  2KRN A;  4OMN A;  5IHK A;  1EFN A;  3NGP A;  4GBQ A;  1BBZ A;  4JJC A;  1GRI A;  3PVQ A;  1W6X A;  2ED0 A;  2JM8 A;  2JXB A;  1SHG A;  2J6K A;  2AZV A;  2J6O A;  2H8H A;  2KNB B;  1H92 A;  2P4R A;  1UDL A;  2DL7 A;  2MCN A;  2A37 A;  2BZ8 A;  2KRS A;  4OMM A;  3I35 A;  2VWF A;  4OML A;  2AKL A;  1UHC A;  2F2X A;  1ZUY A;  2EYY A;  4GLM A;  3ULR B;  2KXC A;  4RUG A;  1ABQ A;  2J7I A;  3LH5 A;  2CH4 W;  1ARK A;  1YCS B;  1X43 A;  2DL5 A;  2BZY A;  1JO8 A;  5FWB A;  3VS0 A;  2DIL A;  2DE0 X;  1NM7 A;  4AG2 C;  1U3O A;  3ZL7 C;  3PVL A;  1CSK A;  1MV0 B;  1K76 A;  1WA7 A;  4JJD A;  2EYX A;  1WLP B;  4LUD A;  2V1R A;  5I11 A;  2DRK A;  2X3W D;  1NEG A;  2KE9 A;  1T0J A;  3NMZ C;  2K3B A;  1ZUK A;  1WDX A;  1JU5 C;  2G6F X;  1QKX A;  1BK2 A;  2EKH A;  4AFS C;  4RTY A;  3VS7 A;  4HVV A;  1X27 A;  2KBT A;  5IXF A;  4Z8A A;  5L23 A;  1UG1 A;  3VRZ A;  4DEX A;  2FPF A;  1FMK A;  2KYM A;  2NUZ A;  2EBP A;  1X69 A;  4M4Z A;  3M0U A;  3M0R A;  1NEB A;  1A0N B;  1OOT A;  2DBK A;  3H0F A;  2F2V A;  1HSQ A;  4LNP A;  2DL4 A;  2LJ3 A;  2E5K A;  5EC7 A;  1MUZ A;  1YN8 A;  4A63 B;  1E6G A;  2DVJ A;  1TG0 A;  1UHF A;  2ED1 A;  4EIK A;  2D0N A;  1UGV A;  2AZS A;  1X6G A;  1HJD A;  4AFU C;  1Y57 A;  2DJQ A;  1VA7 A;  3GBQ A;  1NYG A;  3O5Z A;  3VS3 A;  2K2M A;  2L3S A;  2A08 A;  2KR3 A;  1SSH A;  1J3T A;  1K0S A;  2YT6 A;  1AZG B;  2A36 A;  3M0Q A;  1S1N A;  2ROL A;  2DF6 A;  2W10 A;  3M0T A;  1WXB A;  2CH4 A;  2YUO A;  2CRE A;  1M3C A;  2YUQ A;  4AFZ C;  2RQT A;  1QCF A;  1AWJ A;  2I0N A;  2RQV A;  1VYT A;  3I5S A;  2EYW A;  1I07 A;  2K9G A;  3JV3 A;  5GJV B;  4F14 A;  1GBQ A;  2C0I A;  2JS2 A;  2DX1 A;  4QT7 A;  1NG2 A;  2GTJ A;  1W70 A;  2YDL A;  1GCQ A;  2DRM A;  1XOV A;  2LCS A;  1GCP A;  2C0T A;  1QWF A;  2DM1 A;  3EGU A;  2GBQ A;  2VVK A;  2KT8 A;  2ENM A;  1BB9 A;  3NPF A;  5IXB A;  1QKW A;  1SRM A;  1WYX A;  4FSS A;  4JZ4 A;  1B07 A;  4F16 A;  1RI9 A;  1AEY A;  4X1V A;  3VS6 A;  1AWX A;  1VYU A;  2AKK A;  2HBW A;  5FW9 A;  1T3S A;  3H41 A;  4AFQ C;  1NLP C;  3UF4 A;  2O88 A;  2O9V A;  2KGT A;  2DYB A;  1M3A A;  4R0K A;  5HCK A;  4CC3 A;  4ORZ A;  4F17 A;  2JW4 A;  4HVW A;  2K7A A;  1PHT A;  2JTE A;  4RTU A;  1KJW A;  1RLQ C;  2CT4 A;  2KXD A;  2DMO A;  2QDL A;  5IHN A;  2EGC A;  2FO0 A;  2O31 A;  1YWP A;  1FYN A;  1JQQ A;  2CSQ A;  1T0H A;  1GBR A;  3TSW A;  2CUB A;  2FRW A;  1QLY A;  4LUE A;  4J9D A;  1VYV A;  3EG3 A;  1OPK A;  2GTO A;  1OPL A;  1M27 C;  2BZX A;  5GJW B;  1HD3 A;  2D8J A;  4Y92 A;  5FWC A;  2CT3 A;  1GFD A;  1I0C A;  1AD5 A;  2LZ6 B;  1LCK A;  2K79 A;  1NYF A;  1H3H A;  2W0Z A;  2NWM A;  1IO6 A;  3UA6 A;  1JEG A;  3EG0 A;  3RBB B;  1K4U S;  2EVR A;  1OEB A;  2PZ1 A;  4RTW A;  5ECA A;  1UJY A;  3VS1 A;  4CC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...