1TWBA

Sspb disulfide crosslinked to an ssra degradation tag
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
SSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVECVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B homolog
publication title Nucleotide-Dependent Substrate Handoff from the SspB Adaptor to the AAA+ ClpXP Protease.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 26
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1twbA00
1YFNA 2QAZA 1ZSZC 1OULA 1ZSZB 1OX9A 1ZSZA 2QASA 1TWBA 1OU8A 2NYSA 1OU9A 1OX8A
chains in the Genus database with same CATH superfamily
2LT4A 2V8IA 3TREA 1VQPQ 1I1JA 3SEMA 1WJQA 1TUDA 3QO3A 3WVDB 2KE9A 2ZZDA 1S72Q 2EJ9A 3CD6A 4CC4B 1UHFA 2KYBA 2RA2A 4IURA 4HCCA 3CCLA 1AWOA 1FWZA 2GTOA 3MEWA 3QJ6A 1RLQC 4L5GA 1D1BA 1GCQA 1K1ZA 1UFFA 5KYWB 1VQKQ 2DXBA 3EG1A 1GBRA 4Z89A 4BDZA 4AT1B 2QA4Q 3VS4A 3MEAA 2YUOA 4LXCA 1WHJA 5EC7A 3OW2S 2RHIA 1W1FA 3GOXA 2L89A 2K57A 2VYTA 1K8AU 1VQLQ 5FU6C 3SD4A 1UHCA 1G3YA 1ZA1B 2NWMA 2E1HA 3RUXA 2O2OA 1VQMA 3JB9J 1I5LA 5KYXB 1HK9A 3EHRA 1OU9A 3PTAA 1T3SA 1XJWB 2DEUA 1JB0E 2ZPGB 1UE9A 1NJIC 1KK7A 4KUIA 4WTOB 4E7LA 3BFMA 2JVVA 4AFUC 1KJWA 2DL3A 4N4IA 3JAME 2PQWA 3CMEA 2OI3A 2HAXA 4BD3A 5DLOA 4KH1B 2WSEE 2VGNA 2CYZB 3M0QA 4RTWA 4J83A 2KT1A 1VQ4T 2X3WD 4PJOG 1O75A 3PFSA 4M7DG 4EIKA 5FRNA 2ZPEB 1Z9QA 3VS0A 3ZL7C 5GJWB 2V1QA 4N0AC 4CC3A 3JCMh 1QW1A 1AZGB 1G3WA 4A63B 2IPOB 2JNGA 4KGVB 1D1CA 1SHFA 3S3MA 2KXCA 3M0RA 2YXYA 2L8DA 3CXCP 2RK1A 3EG9B 1C6VX 1UJ0A 2CDTA 3X25B 2DERA 1VUBA 2SEMA 1VQOT 1D09B 1QCNA 3J80E 1MNDA 1VQ8T 1BKBA 4TVRA 2VV5A 4IUTA 2QDYB 4M77C 1RAHB 4C92C 1OEBA 3HFNA 3G71T 4Z88A 5GAMe 1M9SA 1GFCA 2COWA 3QWXX 3JCMV 1ARKA 3CD6Q 2BE7D 3H41A 4Q5WA 3X28B 1YP5A 1WQWA 2RHXA 4XU0A 4VUBA 3M5AA 3CCLQ 2HQXA 2HD0A 1LNXA 2XKOC 1M8VA 5GAN7 4RTZA 1M30A 3RKWA 3JB9G 3GF5A 3QG1A 4E7ZA 1QLYA 2XD0A 2LQWA 2K2VA 2K3XA 5D6XA 3M57A 2XICA 3A8OB 3EFOB 1MV0B 3PE0A 1WHKA 1G3SA 3MKDA 3QZ5B 2IVWA 5FRMA 1JJ2P 3X24B 4C8QB 2GFUA 5D6YA 1KFZA 1UEBA 4RUGA 2MCNA 3V7CA 3LX7A 2ABLA 1SPKA 2E12A 1BB9A 1OX9A 1NG2A 2EQJA 2O31A 2MK5A 1VQMQ 5A0LA 5CKHA 3QSUA 2X4WA 2RQWA 3MEVA 2JW4A 4MZMA 3SB2A 1ZHIA 3E2UA 1RAFB 2EYQA 4C8QC 4KGXB 1OZ2A 3CMEQ 3UF4A 3L2RA 2RN8A 2RQUA 3EG0A 4IUVA 2OAUA 1Y96A 2GQVA 3ZFJA 4RTVA 2YRDA 2EW3A 5I22A 3CBOA 1KC8C 4M77G 1HJDA 2MAMA 3I56T 2BZYA 4C92G 1OOTA 3VS3A 3M58A 1UGVA 1KG1A 3CCJT 2H3JA 3MCAB 2M0YA 3QZ9B 1VQ4A 3VUBA 4M7AB 3A8LB 1ZBJA 3OSVA 1B7TA 3SFMA 2RQTA 4BUGA 4A4EA 2HL5C 2R58A 2B86A 3MO8A 3OS0A 1WHGA 2DRKA 1YHQA 1UJYA 4A4KA 2JM9A 3LWIA 3CCSQ 5C6SA 3PT9A 1HXDA 3QDFA 3OW2P 3P8BB 5LL6S 2RPNA 3LW5E 1TS9A 2CP0A 4YTLA 2ESWA 3CCQT 1VQ9T 1VQ8A 1JEGA 1JXOA 2D0NA 2W0ZA 1U5SA 5KH6A 1BIAA 2CSQA 1YJ9T 3RKYA 4EMHA 3P8HA 2C0IA 1M1GA 4E47A 3G71A 3FC3A 1Q86R 1A0NB 2P0PA 1PKTA 2DZ9A 4C0DC 4JRQA 3I55Q 2XG8D 1AVZC 2QASA 1U06A 1RUWA 3CCVA 1WXUA 5LJ5j 4M78E 2KRMA 2QK0A 4EMKC 1YI2Q 3VJPA 3E9GA 2EYZA 3D7SB 4OMQA 1V29B 1G5VA 5J26A 1NPPA 4FM4B 5D7UA 3OYHA 4LUEA 1PM3A 4DQ2A 3BE3A 3LH5A 5AT1B 2EYWA 4J6WA 1Q86C 1VQ7A 4HA8A 5GANf 2CH4W 3CPWP 4N4GA 3X26B 3NMZC 3EG3A 4FYVB 1E6GA 3G6ET 1PG5B 3V7SA 1EFNA 3VV0A 1PKSA 3HRTA 2DBMA 2F5KA 4J6XA 5KYWA 2OTLT 2DL4A 4OMLA 2XDPA 3VYHB 2V26A 3DKMA 3RDVA 3VS6A 3CCRT 3GLXA 2HL3A 4DOVA 3DLLA 1U1TA 1RI9A 4QVDA 2R5AA 3UT1A 1BCMA 2LNVA 4RCBA 1EZZB 2BUDA 3MHXA 4M75B 2CH4A 3JCMP 4LD9K 1ZSZC 3M55A 2DL5A 4RTUA 4D8KA 2LRQA 4XK8E 4PJLA 1BCOA 4XTWA 2O9SA 2I2LA 2KXDA 4J9GA 1MGQA 2K5LA 5KYXA 1VA7A 4N0AA 3KBGA 3CPFA 4NOYA 3VYGA 1TG0A 3MP6A 1PNJA 3I56A 4FT2A 4ELYC 1Z9ZA 4MZPA 3META 2A08A 3CCJA 2KEAA 2P4RA 1YHQQ 3EHQA 4J9EA 1OX8A 2O01E 1UB4A 1YN8A 4M75C 1R8OB 3E19A 1RAGB 2VXEA 3QDRB 2YHTA 3RERA 3J7AF 1B34B 1YITQ 3LWHA 5CQYA 3U23A 1QVFS 1Y7XA 5LJ5e 4J9IA 3CC4A 4O5VA 1R0CB 1HYOA 1OI1A 4DEXA 2EPDA 1VQ8Q 1NE8A 2DIQA 3P8DA 1YJNQ 4N4HA 3CC7T 4ATOA 4LD6A 2DE0X 1NLOC 5KCOA 4M78G 3EG9A 2JOYA 3CCQA 1ZSGA 2DRMA 1VQ9A 2VASA 3H8ZA 3QBYA 2CUDA 4CC2A 3PNWC 5I2SA 3CCVQ 4RMOA 1YJ9A 2P4TA 5GAOl 1M3BA 4J6YA 3FJ5A 2YSQA 4C0ZA 2QQRA 1KC8U 3A8MB 4J5YA 2J6KA 2QQBA 1UDLA 2O9VA 1O9SA 3CCET 2GF7A 1WZOA 2VGMA 3I35A 1VQ7Q 1KQSS 1VQNT 2AKKA 3L2VA 4JLIA 2HNIA 2JMAA 5HKCA 4JRIA 2KAFA 4F7UB 2KROA 1D0ZA 5C0MA 1IREB 1GFDA 1GCPA 2CP5A 2D9TA 1K76A 2C0TA 2ZPFB 3CQTA 4A54A 3RBBB 1Q7YR 3DB3A 4PNOA 4MDXA 2DD4A 1OZ3A 3BDLA 3JB9I 4XTXA 3EFOA 3G6EA 2M16A 1VQ6T 2CZ6B 3SWNB 1J3TA 2KRSA 2BKDN 3WVEB 2DIGA 4ZGDB 4Y92A 2AZVA 3CXCA 2OTLA 4C8QA 1FXXA 5GAOn 2IG0A 2KSSA 4O6JA 1WGSA 5CKBA 1BBZA 1M3AA 3GP8A 3CCRA 2KGTA 1Y71A 4PJOB 1LVKA 1P92A 1C1AA 1AD5A 1DJ7B 1R77A 4JRKA 5CKFA 3OS5A 4M7DB 4BI3A 2RB6A 2MWPA 4J9CA 3QYHB 1BI3A 1X6GA 2LT1A 2OJ2A 1Y57A 3MP8A 3SWNC 4ZNXA 2VC8A 2Z0WA 3CMAA 2J06A 4FYYB 2KQWA 4QQGA 3NTHA 3THKA 3CC2T 2B8AA 4M7AD 4OMFB 3OY9A 2EJFA 2XMFA 2HQEA 4E7SA 1Q86U 4BE0A 4HCKA 4RG8A 2RH2A 1WX6A 4B6MA 4C5HA 1SHGA 1K73R 3M53A 4PJOC 1BI0A 4M7DC 1M2VB 1WQ7A 4KRTA 4DBRA 2DO3A 1IZ6A 2ZPIB 4LN2A 2FG0A 3CEYA 3CC4Q 4ZGJB 2E3HA 4KBMB 4CC7A 1WA7A 2Y90A 4CI0C 1JJ2A 4M7AA 1MHNA 2A28A 2YLCA 3UA6A 1NYFA 5CVIA 5FU6B 1FMKA 1PSEA 4JJCA 2DA9A 1RAIB 2KK4A 3PGGA 4OMPA 1WXBA 3EH1A 4A4FA 1U1SA 1LPLA 2JS2A 3GPLA 5GAMj 1U8RA 3BDUA 2V8KA 2YDLA 5GMKl 4XTVA 1Q82R 3ME9A 2DTHA 4M4ZA 5EG2A 3A8GB 3O8VA 3M56A 1TTHB 2F1LA 2G6FX 1YIJA 3C12A 5LJ5d 1ACMB 2EGCA 3JCMe 1N8RR 2P0KA 3A1PA 3FB9A 4QVZA 1KQ2A 2LMJA 1CKAA 4WF2A 3CCEA 3S3NA 1I4K1 1VQNA 2E41A 5J3BA 2ATCB 1UGQB 2L3PA 3VS7A 1OPLA 3TVTA 1X27A 2YLBA 2A3LA 1N8RC 3AHUA 3OYCA 1C0MA 2EQIA 4J7FA 2XK0A 5GAOr 2VKNA 2J05A 3LYIA 1BI2A 5IXBA 3OYBA 1WDXA 2FEIA 3MP1A 2COYA 1QP3A 1RLPC 3OW2A 4M77B 3Q1JA 2M51A 2CZ1B 5GAN3 4C92B 1WI7A 4JLGA 4L6V5 3PVLA 1GL5A 1RAAB 2NUPA 3CMAQ 3RMQA 4HKEA 3E9FA 3OYLA 3V8LA 1T3LA 1WNLA 4PFOA 5GAN8 2CZ0B 4X1VA 5LJ3j 3QKJA 3G4SQ 4C0FA 4QKUA 1SEMA 1YBYA 4M75A 5CR2A 2YRVA 3OMCA 4HCZA 2YUQA 2E6NA 1K0XA 3PIPA 1KQSP 3EFSA 1M90R 4RTYA 1M1KR 4XTZA 3SDZA 4XTYA 4QW2A 4LUDA 2W10A 2ED0A 5FW9A 1VYUA 2CS7A 4C0GA 1MV3A 3EGDB 3JCMW 3CPWA 1VQ5T 5FU7B 3GNFB 3VS2A 1UECA 3QHSA 2DM1A 2KMTA 1M90C 2X4XA 2RJDA 4LNPA 2A7YA 4F7UF 1B34A 3OBWA 3RNJA 3CCMT 1Q7YU 1N27A 1ZLMA 4E7IA 2KY9A 2M1HA 1U3OA 1QVGS 2G3RA 1BU1A 3HTRA 2GFAA 1YIJQ 4IKFA 2YUPA 2QGFB 4HVWA 4WCIA 1W6XA 4Z8AA 5FU7C 2DYIA 2MI6A 5CAIA 2CSIA 1Y0MA 2DL8A 3M0UA 3CCUT 2HZYA 2R57A 4L59A 1WHLA 2QEXT 3QWYA 2RQVA 1F1BB 4OGEA 4HVVA 3L42A 4XU3A 3LLRA 2VXFA 5CIUA 2KYMA 6AT1B 5GMKi 3NGPA 2Y4XA 2EQUA 2YRCA 1PC0A 5KYUB 4FCYA 2EQKA 3JSCA 4MMLA 2RJEA 2XI9A 4LDXA 3H6ZA 1JO8A 2LVMA 4X9DA 5LJ3e 1G3TA 2OTJT 5KYYB 4F7UA 3OYDA 2YUNA 2K5IA 2JTMA 3OBYA 2EYXA 2RJFA 2K4YA 4BACA 4BDYA 1QVPA 1MMDA 4AFSC 3VUZA 2XHCA 3SWNA 1N9SA 4IUPA 1B3QA 3M9QA 2RNAA 1CKBA 2JT4A 2MPXC 4AG2C 4F16A 4QVCA 4C0DB 2QTVA 4ESRA 1H3HA 3TSWA 1AWXA 1I81A 2BZXA 3VS1A 1M5Q1 2LQ8A 2JJ9A 4M7AE 2F2XA 4EMKB 5IT9E 4OMOA 4ANJA 2FO0A 4PJOA 2GCXA 5DY9A 3G7ZA 1VQOA 4M7DA 2KNBB 1QWFA 1VQPT 3PVQA 1WLPB 5DLQE 2ROTA 1S72T 1OV3A 2CKKA 1XTDA 1RI0A 4PLIA 2RQRA 2X3XD 4M78B 1N8RU 4OB0B 4E2FB 2DD5A 2GNCA 3EGUA 3M0PA 5LJ5g 1VQKT 4FIBA 4GLMA 5GAN5 1M2VA 3JB9D 1WIEA 1VQ5A 2QA4T 4DOWA 1X43A 3M54A 1S1NA 4J9HA 8ATCB 4QQDA 1RACB 2FZKB 1NM7A 2KDSA 1D3BB 1VIEA 3OA6A 2RD1A 3A8HB 1KHCA 2CREA 2WACA 1W2BS 5DM7R 1TU0B 3GBQA 4E7HA 5GAMd 2NUTB 3C4SA 1VQLT 4M78C 1KD1R 1K0SA 1GBQA 4RKUE 5HK0A 1ZSZB 3ULRB 5M9OA 1UUEA 5D6WA 5GANj 1AWJA 1CSKA 2MYSA 3OB9A 1KIKA 3ZEHA 2DKGA 3GNGA 1GRIA 5KE3A 2L0AA 2RF0A 1AZEA 1OULA 5FROA 1UTIA 4OP0A 1AWWA 2DX1A 1WYXA 3CCUA 1MMNA 1OYXA 2QXFA 3UDCA 1SSFA 1KD1C 4ZGEB 2IIMA 1D0XA 2DVEA 3OYGA 2A36A 2F2WA 4FU6A 2YWWA 5HCKA 3ZBDA 3HKSA 2KI7A 2CGHA 4EDUA 1K8AR 3J81E 2DVJA 3DB4A 1TSFA 5IHKA 3NFCA 1VQ4Q 3OYFA 3UA7A 2H3EB 3V8JA 1M90U 1YFNA 4M77D 3L2UA 3V7RA 2ZAEA 3NTIA 4C92D 1K9AA 1KHIA 1N6AA 3C95A 1MMGA 2HDAA 3HRSA 2XIDA 4DA4A 3O5ZA 4AFQC 3FIFA 3TQ7P 3RKXA 2QQ9A 2ECZA 1QVGP 1YJWT 1RL2A 4BI8B 4M77A 1VQOQ 3H9NA 1OU8A 1PWTA 4C92A 3E1SA 3L2WA 5LJ3d 2CP3A 2ZCFB 2LQNA 1T0JA 3NHNA 3CD6T 2X51A 2EKHA 3OYEA 2EGAA 2EKOA 2YT6A 3CCLT 3REAB 1NYGA 4C5IA 4ZTFA 4HVUA 3G71Q 3ASKA 4K11A 3PIOA 4X34A 4C8QF 2EVRA 2LJ0A 1S72A 1T0HA 2ZPHB 3WXMB 1Q81R 4IUUA 8AT1B 5GANe 2JTFA 4Y28E 3DLMA 4AFZC 1VQ5Q 5GJVB 5GMKe 4JJBA 2LC4A 4J9DA 2LX9A 5A0GA 2QYZA 2CT4A 4GLKA 1JQQA 1LJOA 1VQKA 4XU2A 1VIFA 2K3YA 5I11A 1HD3A 1QKXA 2QA4A 3BY7A 4C8QD 2OX7A 4NS5A 2E65A 1OPKA 3RMSA 3EGDA 4JS4A 4RG2A 5GMKm 2BZ8A 2QQSA 3HHTB 5LJ5h 2DJQA 3FDRA 3CBPA 4JJNK 3S3OA 1VQLA 1VQMT 1LCKA 1FX7A 2L3SA 1X01A 2QG9B 1NPRA 3MEUA 2DETA 1SKUB 1I8FA 5GAN2 1M27C 2MOXA 4M7AF 4F7UE 2VUBA 1MMAA 3CMET 4DBQA 1ZX6A 5ECAA 3UPUA 4LDUA 2KR3A 3H0IA 2DXUA 2AIRB 4BY6B 1Q7YC 4PLLA 3FLGA 4CRIA 5IXFA 1TWBA 2DYBA 3EG2A 1MNEA 2PUKB 4ORZA 5CO7A 2DLPA 3M4YA 2E4HA 1KQSA 2ENMA 2PTKA 4Z02A 4OVAA 1SRLA 3I56Q 4PJMA 3OYMA 4FW2A 1NEBA 5CQXA 3CCJQ 1QMCA 1QCOA 2NLUA 5KYUA 5J39A 4HCBA 4ME7A 5CK9A 3OQ5A 4OB1B 4BY6C 3CCST 2HEQA 2MF2A 5FWCA 2H8HA 1PCXA 5KYYA 3JV3A 1YWPA 2LP5A 3RESA 1W2BP 4A4GA 1JBMA 2QI2A 4J8OA 1WPYA 2L3RA 4X9CA 3PMTA 1YJWA 2MIOA 1K73C 2RJCA 3CCQQ 1VQ9Q 2PZ1A 2FPDA 1V76A 1KD1U 2FPFA 4EMGA 1H641 2O4XB 2D8JA 2EBPA 3QJYA 3I55T 1YJ9Q 3CC7A 1PHTA 2XDBA 2E70A 4M78D 3JRZA 2RMOA 1JXMA 5GAMg 4LDWA 5FLXE 4EMKA 3FJPA 1YI2T 4HXJA 5GAMf 1G2BA 1XNIA 1YWOA 4ZN1A 5FWBA 3CBMA 1SRMA 1TOVA 5I2MA 2KBTA 1NZ9A 4JPBW 7AT1B 3OS1A 2D0QB 2V1RA 3LGLA 2DJZA 3I9QA 1IRXA 3C94A 2QDLA 1I5OB 4M78A 4FL6A 1Q82C 3M4GA 2EJGA 2RHZA 1YCSB 1ZUKA 3R6NA 1NJIR 2I0NA 2VVKA 4M75F 1E7OA 1ZQ1A 3JCMc 1G83A 3REBB 4F7UG 2K5FA 3URGA 5IAYA 2EYYA 3G6EQ 2BTTA 2HMAA 2O88A 4E7JA 3TEEA 4PFZA 2E5QA 4RCCA 2OTLQ 2DTIA 5GANd 2PNIA 4JUVA 1IB8A 1D3BA 5CKEA 2KT8A 1VQ6A 1QVFP 2K3BA 2RHUA 2P84A 3CCRQ 1D0YA 2NUTA 4AG1C 2CUBA 2M0OA 3LH0A 2X4YA 1ZSZA 3EGXB 2EWNA 4J7IA 3RR6A 1IGQA 4M75D 3OYNA 2JXBA 3MPUB 4PFPA 3EFRA 1UG1A 2MMPA 4QQ6A 4A53A 1TUGB 4FSXA 4JDSA 2K7AA 4QT7A 4XU1A 1M1FA 4JRPA 3CPWS 5IN1A 3L1AA 1YHQT 2V8JA 4M77E 5LJ3g 4Y91A 4C92E 1ZBXA 3V8KA 3HP9A 5LJ3f 2CT3A 3CC2A 2E3IA 4XAXB 3OYAA 2JMCA 1Q81U 4XQ3A 2FPEA 5GAOq 1YITT 3FRNA 1PSFA 2HKNA 2C0OA 5KYNA 1KSWA 3CCSA 2E10A 3UWNA 1YJWQ 1YJNT 2DILA 5IHNA 4JJDA 4LDVA 3FEOA 3SHWA 4PK4A 2A37A 2HQHA 4PL6A 4OMNA 3CC7Q 1RADB 1M1KC 3CCVT 4IIOA 4D6WA 2SRCA 4A4HA 1IGUA 4NL3A 3TSZA 1NBEB 4XTUA 1Y07A 3KFVA 3KUFA 2PUOB 3I55A 4MZTA 3MJXA 3M0TA 3QUIA 2A0FB 2COZA 2EQMA 3RIRA 2JN0A 3NPFA 2QAZA 4B9XA 1VQ7T 1YI2A 2ZPBB 2DFUA 1K9MR 3TU4K 2M9UA 1I0CA 3CCEQ 1RAEB 1VQNQ 2DTOA 2KRNA 3GIBA 2EIFA 2J7IA 5GAMh 4RTXA 4C8QE 4PJOF 4OB3B 3NTKA 4HT9A 1M3CA 4M7DF 1V1CA 2L3QA 2DK3A 3X20B 2RI2A 5L8RE 1K9MC 3A5ZB 2FZCB 2K6DA 3EH2A 1KC8R 5GAN6 2E64A 1VQ6Q 1MUZA 1KQ1A 2D1XA 1H3ZA 1K73U 1BI1A 2KVQG 4EPCA 1XOVA 2FB7A 1LOJA 1QVGA 2F5TX 3JCMd 2HCKA 2GTJA 4C5GA 4PJOD 2QTXA 3ER0A 4M7DD 4E6RA 5A0DA 2JS0A 3OYKA 3AT1B 2K2MA 2DEQA 2LTOA 5I21A 2BIVA 1R0BG 2RM4A 3CC2Q 1E6HA 2Y4YA 4BE2A 2LCCA 2AKLA 3JB9F 1EX4A 4BB7A 3C0CA 4E7KA 4PKCC 2D8HA 1Q82U 1UGSB 2MWOA 1WXTA 1RABB 3CC4T 2E5KA 1SG5A 4KT0E 4KH0B 2K9GA 1UGRB 5GAN4 3JCMb 1ZUUA 4PJJA 2FL7A 3OSSC 2GQIA 2ROLA 4F17A 4C5EA 2D6FA 2RI3A 3OYJA 4BI4A 1YITA 1SF9A 2LJ3A 3VRZA 1AEYA 4F04B 5HY6A 1JRIA 2LDMA 5LJ3h 3QYGB 4M7AC 1NLPC 1H8KA 3QIIA 2DBKA 1YJNA 3H0HA 1X2QA 1YCYA 5LJ5f 1NJIU 2GBQA 3JCMX 4BE1A 3T9NA 1GCQC 9ATCB 4JZ3A 2JM8A 5CCAA 3BW1A 1GXIE 3IQLA 1D1AA 1WJRA 2JZ2A 3QXEB 4FW1A 4KGZB 3CCMA 3I5SA 5GAOm 1FMVA 1M2OA 1WFWA 2F2VA 5AYFA 4C8QG 3JCMQ 2VWFA 2QGGA 4LE9A 4R56A 2FYKA 2O4XA 5L23A 5GMKj 5GANg 2JTEA 3VKIA 1QKWA 4B9WA 1FYNA 2J6OA 3EAEA 4M77F 3R6OA 4C92F 1BK2A 1QP2A 1PD1A 3S6WA 1QCFA 4PJNA 2QEXA 2BE9B 4FSSA 2JUFA 2HKQB 1VYVA 3TCJA 1ZA2B 2CP2A 1PD0A 2NUPB 2X4JA 3UATA 1N5ZA 2VB6A 4OGCA 2DXCA 1EIFA 4ZTJA 3VS5A 4AMCA 1AT1B 2AT1B 3H0FA 2FVUA 1X2KA 1W2BA 1M1KU 2DF6A 2OTJA 1HSQA 1VOMA 3OYIA 1I07A 3I5RA 4JZ4A 2HSEB 3CMAT 2DNUA 1M8MA 4M75E 1BIBA 3HFOA 4DEYA 4M7AG 2QQAA 3A98A 4D8DA 2RI5A 3G1JA 5KE2A 1K8AC 1X6BA 1ZUYA 1AOJA 3G4ST 5GAOp 2F69A 1TH7A 1YNZA 1WHHA 2RK2A 2AZSA 3EGXA 2NUZA 2J6FA 4ELZC 1WJSA 4FT4A 3LGFA 4FYXB 2M02A 2DL7A 4HT8A 1UGPB 4II1A 4NL2A 2FZGB 1VQPA 2HBPA 2PVGB 4DBFA 2WSCE 1K9MU 4LDYA 3OYYA 2DPPB 4FYWB 1QQJA 4MMKA 5IHIA 1NEGA 2L2PA 2LZ6B 2NYSA 2E6ZA 2OAWA 1B07A 2LJ1A 2LCSA 1WHMA 4ZN3A 2DMOA 2K79A 3CXCS 2FHDA 4GBQA 4GY5A 1IHVA 1ABOA 1XQHA 4DBHA 4OMMA 1YIJT 3HL8A 3CCMQ 2FRWA 1Q81C 4KUDK 2X35A 1X6OA 2PU9B 1QVFA 2RHYA 2PVDB 4RTTA 3HSBA 4UC4A 1AHJB 4OB2B 2EFIA 1Y96B 4V2SA 2EGEA 3M59A 3QPHA 2R5MA 2LX7A 4IIMA 1X75C 4P5NA 3CCUQ 2ED1A 2CP7A 4J9BA 2AK5A 3JCMJ 2QEXQ 2DAQA 3OMGA 3JCMg 2RO0A 5CKDA 2XDDA 3JCMf 1IXDA 2DXTA 3HPWA 1BYMA 2EAYA 2XU8A 2L5QA 4R0KA 2ZGWA 2HSPA 3F70A 5GANh 4OF1A 1TUCA 5A2QE 2CP6A 1W70A 5GMKh 3JB9H 1H92A 1FMWA 1M4ZA 1N9RA 1SSHA 1PRMC 3L2QA 4M75G 1JJ2S 2CZ7B 2HBWA 1PRLC 2OTJQ 1QWEA 3L2ZA 3N5BB 1G8XA 3HRUA 3INZA 2LQKA 1K4US 1X69A 3M0SA 1IHWA 2WSFE 2C06A 1ABQA 4KULA 3VRYA 3OS2A 4PJOE 2LNHB 4MDWA 4M7DE 5IH2A 5HK3A 4IUQA 2FRYA 1OQKA 3KXTA 4M78F 2GGRA 1IO6A 2X9HA 1VYTA 4JS5A 1Q95G 1TXQA 2LCLA 3VU3C 2PVOB 4F14A 1W4SA 2AHJB 3G4SA 4R55A 1JU5C 3PMIA 2P0QA 5KCHA 4J9FA 2DZCA
chains in the Genus database with same CATH topology
1YFNA 2QAZA 1ZSZC 1OULA 1ZSZB 1OX9A 1ZSZA 2QASA 1TWBA 1OU8A 2NYSA 1OU9A 1OX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YFN A;  2QAZ A;  1ZSZ C;  1OUL A;  1ZSZ B;  1OX9 A;  1ZSZ A;  2QAS A;  1TWB A;  1OU8 A;  2NYS A;  1OU9 A;  1OX8 A; 
#chains in the Genus database with same CATH topology
 2LT4 A;  2V8I A;  3TRE A;  1VQP Q;  1I1J A;  3SEM A;  1WJQ A;  1TUD A;  3QO3 A;  3WVD B;  2KE9 A;  2ZZD A;  1S72 Q;  2EJ9 A;  3CD6 A;  4CC4 B;  1UHF A;  2KYB A;  2RA2 A;  4IUR A;  4HCC A;  3CCL A;  1AWO A;  1FWZ A;  2GTO A;  3MEW A;  3QJ6 A;  1RLQ C;  4L5G A;  1D1B A;  1GCQ A;  1K1Z A;  1UFF A;  5KYW B;  1VQK Q;  2DXB A;  3EG1 A;  1GBR A;  4Z89 A;  4BDZ A;  4AT1 B;  2QA4 Q;  3VS4 A;  3MEA A;  2YUO A;  4LXC A;  1WHJ A;  5EC7 A;  3OW2 S;  2RHI A;  1W1F A;  3GOX A;  2L89 A;  2K57 A;  2VYT A;  1K8A U;  1VQL Q;  5FU6 C;  3SD4 A;  1UHC A;  1G3Y A;  1ZA1 B;  2NWM A;  2E1H A;  3RUX A;  2O2O A;  1VQM A;  3JB9 J;  1I5L A;  5KYX B;  1HK9 A;  3EHR A;  1OU9 A;  3PTA A;  1T3S A;  1XJW B;  2DEU A;  1JB0 E;  2ZPG B;  1UE9 A;  1NJI C;  1KK7 A;  4KUI A;  4WTO B;  4E7L A;  3BFM A;  2JVV A;  4AFU C;  1KJW A;  2DL3 A;  4N4I A;  3JAM E;  2PQW A;  3CME A;  2OI3 A;  2HAX A;  4BD3 A;  5DLO A;  4KH1 B;  2WSE E;  2VGN A;  2CYZ B;  3M0Q A;  4RTW A;  4J83 A;  2KT1 A;  1VQ4 T;  2X3W D;  4PJO G;  1O75 A;  3PFS A;  4M7D G;  4EIK A;  5FRN A;  2ZPE B;  1Z9Q A;  3VS0 A;  3ZL7 C;  5GJW B;  2V1Q A;  4N0A C;  4CC3 A;  3JCM h;  1QW1 A;  1AZG B;  1G3W A;  4A63 B;  2IPO B;  2JNG A;  4KGV B;  1D1C A;  1SHF A;  3S3M A;  2KXC A;  3M0R A;  2YXY A;  2L8D A;  3CXC P;  2RK1 A;  3EG9 B;  1C6V X;  1UJ0 A;  2CDT A;  3X25 B;  2DER A;  1VUB A;  2SEM A;  1VQO T;  1D09 B;  1QCN A;  3J80 E;  1MND A;  1VQ8 T;  1BKB A;  4TVR A;  2VV5 A;  4IUT A;  2QDY B;  4M77 C;  1RAH B;  4C92 C;  1OEB A;  3HFN A;  3G71 T;  4Z88 A;  5GAM e;  1M9S A;  1GFC A;  2COW A;  3QWX X;  3JCM V;  1ARK A;  3CD6 Q;  2BE7 D;  3H41 A;  4Q5W A;  3X28 B;  1YP5 A;  1WQW A;  2RHX A;  4XU0 A;  4VUB A;  3M5A A;  3CCL Q;  2HQX A;  2HD0 A;  1LNX A;  2XKO C;  1M8V A;  5GAN 7;  4RTZ A;  1M30 A;  3RKW A;  3JB9 G;  3GF5 A;  3QG1 A;  4E7Z A;  1QLY A;  2XD0 A;  2LQW A;  2K2V A;  2K3X A;  5D6X A;  3M57 A;  2XIC A;  3A8O B;  3EFO B;  1MV0 B;  3PE0 A;  1WHK A;  1G3S A;  3MKD A;  3QZ5 B;  2IVW A;  5FRM A;  1JJ2 P;  3X24 B;  4C8Q B;  2GFU A;  5D6Y A;  1KFZ A;  1UEB A;  4RUG A;  2MCN A;  3V7C A;  3LX7 A;  2ABL A;  1SPK A;  2E12 A;  1BB9 A;  1OX9 A;  1NG2 A;  2EQJ A;  2O31 A;  2MK5 A;  1VQM Q;  5A0L A;  5CKH A;  3QSU A;  2X4W A;  2RQW A;  3MEV A;  2JW4 A;  4MZM A;  3SB2 A;  1ZHI A;  3E2U A;  1RAF B;  2EYQ A;  4C8Q C;  4KGX B;  1OZ2 A;  3CME Q;  3UF4 A;  3L2R A;  2RN8 A;  2RQU A;  3EG0 A;  4IUV A;  2OAU A;  1Y96 A;  2GQV A;  3ZFJ A;  4RTV A;  2YRD A;  2EW3 A;  5I22 A;  3CBO A;  1KC8 C;  4M77 G;  1HJD A;  2MAM A;  3I56 T;  2BZY A;  4C92 G;  1OOT A;  3VS3 A;  3M58 A;  1UGV A;  1KG1 A;  3CCJ T;  2H3J A;  3MCA B;  2M0Y A;  3QZ9 B;  1VQ4 A;  3VUB A;  4M7A B;  3A8L B;  1ZBJ A;  3OSV A;  1B7T A;  3SFM A;  2RQT A;  4BUG A;  4A4E A;  2HL5 C;  2R58 A;  2B86 A;  3MO8 A;  3OS0 A;  1WHG A;  2DRK A;  1YHQ A;  1UJY A;  4A4K A;  2JM9 A;  3LWI A;  3CCS Q;  5C6S A;  3PT9 A;  1HXD A;  3QDF A;  3OW2 P;  3P8B B;  5LL6 S;  2RPN A;  3LW5 E;  1TS9 A;  2CP0 A;  4YTL A;  2ESW A;  3CCQ T;  1VQ9 T;  1VQ8 A;  1JEG A;  1JXO A;  2D0N A;  2W0Z A;  1U5S A;  5KH6 A;  1BIA A;  2CSQ A;  1YJ9 T;  3RKY A;  4EMH A;  3P8H A;  2C0I A;  1M1G A;  4E47 A;  3G71 A;  3FC3 A;  1Q86 R;  1A0N B;  2P0P A;  1PKT A;  2DZ9 A;  4C0D C;  4JRQ A;  3I55 Q;  2XG8 D;  1AVZ C;  2QAS A;  1U06 A;  1RUW A;  3CCV A;  1WXU A;  5LJ5 j;  4M78 E;  2KRM A;  2QK0 A;  4EMK C;  1YI2 Q;  3VJP A;  3E9G A;  2EYZ A;  3D7S B;  4OMQ A;  1V29 B;  1G5V A;  5J26 A;  1NPP A;  4FM4 B;  5D7U A;  3OYH A;  4LUE A;  1PM3 A;  4DQ2 A;  3BE3 A;  3LH5 A;  5AT1 B;  2EYW A;  4J6W A;  1Q86 C;  1VQ7 A;  4HA8 A;  5GAN f;  2CH4 W;  3CPW P;  4N4G A;  3X26 B;  3NMZ C;  3EG3 A;  4FYV B;  1E6G A;  3G6E T;  1PG5 B;  3V7S A;  1EFN A;  3VV0 A;  1PKS A;  3HRT A;  2DBM A;  2F5K A;  4J6X A;  5KYW A;  2OTL T;  2DL4 A;  4OML A;  2XDP A;  3VYH B;  2V26 A;  3DKM A;  3RDV A;  3VS6 A;  3CCR T;  3GLX A;  2HL3 A;  4DOV A;  3DLL A;  1U1T A;  1RI9 A;  4QVD A;  2R5A A;  3UT1 A;  1BCM A;  2LNV A;  4RCB A;  1EZZ B;  2BUD A;  3MHX A;  4M75 B;  2CH4 A;  3JCM P;  4LD9 K;  1ZSZ C;  3M55 A;  2DL5 A;  4RTU A;  4D8K A;  2LRQ A;  4XK8 E;  4PJL A;  1BCO A;  4XTW A;  2O9S A;  2I2L A;  2KXD A;  4J9G A;  1MGQ A;  2K5L A;  5KYX A;  1VA7 A;  4N0A A;  3KBG A;  3CPF A;  4NOY A;  3VYG A;  1TG0 A;  3MP6 A;  1PNJ A;  3I56 A;  4FT2 A;  4ELY C;  1Z9Z A;  4MZP A;  3MET A;  2A08 A;  3CCJ A;  2KEA A;  2P4R A;  1YHQ Q;  3EHQ A;  4J9E A;  1OX8 A;  2O01 E;  1UB4 A;  1YN8 A;  4M75 C;  1R8O B;  3E19 A;  1RAG B;  2VXE A;  3QDR B;  2YHT A;  3RER A;  3J7A F;  1B34 B;  1YIT Q;  3LWH A;  5CQY A;  3U23 A;  1QVF S;  1Y7X A;  5LJ5 e;  4J9I A;  3CC4 A;  4O5V A;  1R0C B;  1HYO A;  1OI1 A;  4DEX A;  2EPD A;  1VQ8 Q;  1NE8 A;  2DIQ A;  3P8D A;  1YJN Q;  4N4H A;  3CC7 T;  4ATO A;  4LD6 A;  2DE0 X;  1NLO C;  5KCO A;  4M78 G;  3EG9 A;  2JOY A;  3CCQ A;  1ZSG A;  2DRM A;  1VQ9 A;  2VAS A;  3H8Z A;  3QBY A;  2CUD A;  4CC2 A;  3PNW C;  5I2S A;  3CCV Q;  4RMO A;  1YJ9 A;  2P4T A;  5GAO l;  1M3B A;  4J6Y A;  3FJ5 A;  2YSQ A;  4C0Z A;  2QQR A;  1KC8 U;  3A8M B;  4J5Y A;  2J6K A;  2QQB A;  1UDL A;  2O9V A;  1O9S A;  3CCE T;  2GF7 A;  1WZO A;  2VGM A;  3I35 A;  1VQ7 Q;  1KQS S;  1VQN T;  2AKK A;  3L2V A;  4JLI A;  2HNI A;  2JMA A;  5HKC A;  4JRI A;  2KAF A;  4F7U B;  2KRO A;  1D0Z A;  5C0M A;  1IRE B;  1GFD A;  1GCP A;  2CP5 A;  2D9T A;  1K76 A;  2C0T A;  2ZPF B;  3CQT A;  4A54 A;  3RBB B;  1Q7Y R;  3DB3 A;  4PNO A;  4MDX A;  2DD4 A;  1OZ3 A;  3BDL A;  3JB9 I;  4XTX A;  3EFO A;  3G6E A;  2M16 A;  1VQ6 T;  2CZ6 B;  3SWN B;  1J3T A;  2KRS A;  2BKD N;  3WVE B;  2DIG A;  4ZGD B;  4Y92 A;  2AZV A;  3CXC A;  2OTL A;  4C8Q A;  1FXX A;  5GAO n;  2IG0 A;  2KSS A;  4O6J A;  1WGS A;  5CKB A;  1BBZ A;  1M3A A;  3GP8 A;  3CCR A;  2KGT A;  1Y71 A;  4PJO B;  1LVK A;  1P92 A;  1C1A A;  1AD5 A;  1DJ7 B;  1R77 A;  4JRK A;  5CKF A;  3OS5 A;  4M7D B;  4BI3 A;  2RB6 A;  2MWP A;  4J9C A;  3QYH B;  1BI3 A;  1X6G A;  2LT1 A;  2OJ2 A;  1Y57 A;  3MP8 A;  3SWN C;  4ZNX A;  2VC8 A;  2Z0W A;  3CMA A;  2J06 A;  4FYY B;  2KQW A;  4QQG A;  3NTH A;  3THK A;  3CC2 T;  2B8A A;  4M7A D;  4OMF B;  3OY9 A;  2EJF A;  2XMF A;  2HQE A;  4E7S A;  1Q86 U;  4BE0 A;  4HCK A;  4RG8 A;  2RH2 A;  1WX6 A;  4B6M A;  4C5H A;  1SHG A;  1K73 R;  3M53 A;  4PJO C;  1BI0 A;  4M7D C;  1M2V B;  1WQ7 A;  4KRT A;  4DBR A;  2DO3 A;  1IZ6 A;  2ZPI B;  4LN2 A;  2FG0 A;  3CEY A;  3CC4 Q;  4ZGJ B;  2E3H A;  4KBM B;  4CC7 A;  1WA7 A;  2Y90 A;  4CI0 C;  1JJ2 A;  4M7A A;  1MHN A;  2A28 A;  2YLC A;  3UA6 A;  1NYF A;  5CVI A;  5FU6 B;  1FMK A;  1PSE A;  4JJC A;  2DA9 A;  1RAI B;  2KK4 A;  3PGG A;  4OMP A;  1WXB A;  3EH1 A;  4A4F A;  1U1S A;  1LPL A;  2JS2 A;  3GPL A;  5GAM j;  1U8R A;  3BDU A;  2V8K A;  2YDL A;  5GMK l;  4XTV A;  1Q82 R;  3ME9 A;  2DTH A;  4M4Z A;  5EG2 A;  3A8G B;  3O8V A;  3M56 A;  1TTH B;  2F1L A;  2G6F X;  1YIJ A;  3C12 A;  5LJ5 d;  1ACM B;  2EGC A;  3JCM e;  1N8R R;  2P0K A;  3A1P A;  3FB9 A;  4QVZ A;  1KQ2 A;  2LMJ A;  1CKA A;  4WF2 A;  3CCE A;  3S3N A;  1I4K 1;  1VQN A;  2E41 A;  5J3B A;  2ATC B;  1UGQ B;  2L3P A;  3VS7 A;  1OPL A;  3TVT A;  1X27 A;  2YLB A;  2A3L A;  1N8R C;  3AHU A;  3OYC A;  1C0M A;  2EQI A;  4J7F A;  2XK0 A;  5GAO r;  2VKN A;  2J05 A;  3LYI A;  1BI2 A;  5IXB A;  3OYB A;  1WDX A;  2FEI A;  3MP1 A;  2COY A;  1QP3 A;  1RLP C;  3OW2 A;  4M77 B;  3Q1J A;  2M51 A;  2CZ1 B;  5GAN 3;  4C92 B;  1WI7 A;  4JLG A;  4L6V 5;  3PVL A;  1GL5 A;  1RAA B;  2NUP A;  3CMA Q;  3RMQ A;  4HKE A;  3E9F A;  3OYL A;  3V8L A;  1T3L A;  1WNL A;  4PFO A;  5GAN 8;  2CZ0 B;  4X1V A;  5LJ3 j;  3QKJ A;  3G4S Q;  4C0F A;  4QKU A;  1SEM A;  1YBY A;  4M75 A;  5CR2 A;  2YRV A;  3OMC A;  4HCZ A;  2YUQ A;  2E6N A;  1K0X A;  3PIP A;  1KQS P;  3EFS A;  1M90 R;  4RTY A;  1M1K R;  4XTZ A;  3SDZ A;  4XTY A;  4QW2 A;  4LUD A;  2W10 A;  2ED0 A;  5FW9 A;  1VYU A;  2CS7 A;  4C0G A;  1MV3 A;  3EGD B;  3JCM W;  3CPW A;  1VQ5 T;  5FU7 B;  3GNF B;  3VS2 A;  1UEC A;  3QHS A;  2DM1 A;  2KMT A;  1M90 C;  2X4X A;  2RJD A;  4LNP A;  2A7Y A;  4F7U F;  1B34 A;  3OBW A;  3RNJ A;  3CCM T;  1Q7Y U;  1N27 A;  1ZLM A;  4E7I A;  2KY9 A;  2M1H A;  1U3O A;  1QVG S;  2G3R A;  1BU1 A;  3HTR A;  2GFA A;  1YIJ Q;  4IKF A;  2YUP A;  2QGF B;  4HVW A;  4WCI A;  1W6X A;  4Z8A A;  5FU7 C;  2DYI A;  2MI6 A;  5CAI A;  2CSI A;  1Y0M A;  2DL8 A;  3M0U A;  3CCU T;  2HZY A;  2R57 A;  4L59 A;  1WHL A;  2QEX T;  3QWY A;  2RQV A;  1F1B B;  4OGE A;  4HVV A;  3L42 A;  4XU3 A;  3LLR A;  2VXF A;  5CIU A;  2KYM A;  6AT1 B;  5GMK i;  3NGP A;  2Y4X A;  2EQU A;  2YRC A;  1PC0 A;  5KYU B;  4FCY A;  2EQK A;  3JSC A;  4MML A;  2RJE A;  2XI9 A;  4LDX A;  3H6Z A;  1JO8 A;  2LVM A;  4X9D A;  5LJ3 e;  1G3T A;  2OTJ T;  5KYY B;  4F7U A;  3OYD A;  2YUN A;  2K5I A;  2JTM A;  3OBY A;  2EYX A;  2RJF A;  2K4Y A;  4BAC A;  4BDY A;  1QVP A;  1MMD A;  4AFS C;  3VUZ A;  2XHC A;  3SWN A;  1N9S A;  4IUP A;  1B3Q A;  3M9Q A;  2RNA A;  1CKB A;  2JT4 A;  2MPX C;  4AG2 C;  4F16 A;  4QVC A;  4C0D B;  2QTV A;  4ESR A;  1H3H A;  3TSW A;  1AWX A;  1I81 A;  2BZX A;  3VS1 A;  1M5Q 1;  2LQ8 A;  2JJ9 A;  4M7A E;  2F2X A;  4EMK B;  5IT9 E;  4OMO A;  4ANJ A;  2FO0 A;  4PJO A;  2GCX A;  5DY9 A;  3G7Z A;  1VQO A;  4M7D A;  2KNB B;  1QWF A;  1VQP T;  3PVQ A;  1WLP B;  5DLQ E;  2ROT A;  1S72 T;  1OV3 A;  2CKK A;  1XTD A;  1RI0 A;  4PLI A;  2RQR A;  2X3X D;  4M78 B;  1N8R U;  4OB0 B;  4E2F B;  2DD5 A;  2GNC A;  3EGU A;  3M0P A;  5LJ5 g;  1VQK T;  4FIB A;  4GLM A;  5GAN 5;  1M2V A;  3JB9 D;  1WIE A;  1VQ5 A;  2QA4 T;  4DOW A;  1X43 A;  3M54 A;  1S1N A;  4J9H A;  8ATC B;  4QQD A;  1RAC B;  2FZK B;  1NM7 A;  2KDS A;  1D3B B;  1VIE A;  3OA6 A;  2RD1 A;  3A8H B;  1KHC A;  2CRE A;  2WAC A;  1W2B S;  5DM7 R;  1TU0 B;  3GBQ A;  4E7H A;  5GAM d;  2NUT B;  3C4S A;  1VQL T;  4M78 C;  1KD1 R;  1K0S A;  1GBQ A;  4RKU E;  5HK0 A;  1ZSZ B;  3ULR B;  5M9O A;  1UUE A;  5D6W A;  5GAN j;  1AWJ A;  1CSK A;  2MYS A;  3OB9 A;  1KIK A;  3ZEH A;  2DKG A;  3GNG A;  1GRI A;  5KE3 A;  2L0A A;  2RF0 A;  1AZE A;  1OUL A;  5FRO A;  1UTI A;  4OP0 A;  1AWW A;  2DX1 A;  1WYX A;  3CCU A;  1MMN A;  1OYX A;  2QXF A;  3UDC A;  1SSF A;  1KD1 C;  4ZGE B;  2IIM A;  1D0X A;  2DVE A;  3OYG A;  2A36 A;  2F2W A;  4FU6 A;  2YWW A;  5HCK A;  3ZBD A;  3HKS A;  2KI7 A;  2CGH A;  4EDU A;  1K8A R;  3J81 E;  2DVJ A;  3DB4 A;  1TSF A;  5IHK A;  3NFC A;  1VQ4 Q;  3OYF A;  3UA7 A;  2H3E B;  3V8J A;  1M90 U;  1YFN A;  4M77 D;  3L2U A;  3V7R A;  2ZAE A;  3NTI A;  4C92 D;  1K9A A;  1KHI A;  1N6A A;  3C95 A;  1MMG A;  2HDA A;  3HRS A;  2XID A;  4DA4 A;  3O5Z A;  4AFQ C;  3FIF A;  3TQ7 P;  3RKX A;  2QQ9 A;  2ECZ A;  1QVG P;  1YJW T;  1RL2 A;  4BI8 B;  4M77 A;  1VQO Q;  3H9N A;  1OU8 A;  1PWT A;  4C92 A;  3E1S A;  3L2W A;  5LJ3 d;  2CP3 A;  2ZCF B;  2LQN A;  1T0J A;  3NHN A;  3CD6 T;  2X51 A;  2EKH A;  3OYE A;  2EGA A;  2EKO A;  2YT6 A;  3CCL T;  3REA B;  1NYG A;  4C5I A;  4ZTF A;  4HVU A;  3G71 Q;  3ASK A;  4K11 A;  3PIO A;  4X34 A;  4C8Q F;  2EVR A;  2LJ0 A;  1S72 A;  1T0H A;  2ZPH B;  3WXM B;  1Q81 R;  4IUU A;  8AT1 B;  5GAN e;  2JTF A;  4Y28 E;  3DLM A;  4AFZ C;  1VQ5 Q;  5GJV B;  5GMK e;  4JJB A;  2LC4 A;  4J9D A;  2LX9 A;  5A0G A;  2QYZ A;  2CT4 A;  4GLK A;  1JQQ A;  1LJO A;  1VQK A;  4XU2 A;  1VIF A;  2K3Y A;  5I11 A;  1HD3 A;  1QKX A;  2QA4 A;  3BY7 A;  4C8Q D;  2OX7 A;  4NS5 A;  2E65 A;  1OPK A;  3RMS A;  3EGD A;  4JS4 A;  4RG2 A;  5GMK m;  2BZ8 A;  2QQS A;  3HHT B;  5LJ5 h;  2DJQ A;  3FDR A;  3CBP A;  4JJN K;  3S3O A;  1VQL A;  1VQM T;  1LCK A;  1FX7 A;  2L3S A;  1X01 A;  2QG9 B;  1NPR A;  3MEU A;  2DET A;  1SKU B;  1I8F A;  5GAN 2;  1M27 C;  2MOX A;  4M7A F;  4F7U E;  2VUB A;  1MMA A;  3CME T;  4DBQ A;  1ZX6 A;  5ECA A;  3UPU A;  4LDU A;  2KR3 A;  3H0I A;  2DXU A;  2AIR B;  4BY6 B;  1Q7Y C;  4PLL A;  3FLG A;  4CRI A;  5IXF A;  1TWB A;  2DYB A;  3EG2 A;  1MNE A;  2PUK B;  4ORZ A;  5CO7 A;  2DLP A;  3M4Y A;  2E4H A;  1KQS A;  2ENM A;  2PTK A;  4Z02 A;  4OVA A;  1SRL A;  3I56 Q;  4PJM A;  3OYM A;  4FW2 A;  1NEB A;  5CQX A;  3CCJ Q;  1QMC A;  1QCO A;  2NLU A;  5KYU A;  5J39 A;  4HCB A;  4ME7 A;  5CK9 A;  3OQ5 A;  4OB1 B;  4BY6 C;  3CCS T;  2HEQ A;  2MF2 A;  5FWC A;  2H8H A;  1PCX A;  5KYY A;  3JV3 A;  1YWP A;  2LP5 A;  3RES A;  1W2B P;  4A4G A;  1JBM A;  2QI2 A;  4J8O A;  1WPY A;  2L3R A;  4X9C A;  3PMT A;  1YJW A;  2MIO A;  1K73 C;  2RJC A;  3CCQ Q;  1VQ9 Q;  2PZ1 A;  2FPD A;  1V76 A;  1KD1 U;  2FPF A;  4EMG A;  1H64 1;  2O4X B;  2D8J A;  2EBP A;  3QJY A;  3I55 T;  1YJ9 Q;  3CC7 A;  1PHT A;  2XDB A;  2E70 A;  4M78 D;  3JRZ A;  2RMO A;  1JXM A;  5GAM g;  4LDW A;  5FLX E;  4EMK A;  3FJP A;  1YI2 T;  4HXJ A;  5GAM f;  1G2B A;  1XNI A;  1YWO A;  4ZN1 A;  5FWB A;  3CBM A;  1SRM A;  1TOV A;  5I2M A;  2KBT A;  1NZ9 A;  4JPB W;  7AT1 B;  3OS1 A;  2D0Q B;  2V1R A;  3LGL A;  2DJZ A;  3I9Q A;  1IRX A;  3C94 A;  2QDL A;  1I5O B;  4M78 A;  4FL6 A;  1Q82 C;  3M4G A;  2EJG A;  2RHZ A;  1YCS B;  1ZUK A;  3R6N A;  1NJI R;  2I0N A;  2VVK A;  4M75 F;  1E7O A;  1ZQ1 A;  3JCM c;  1G83 A;  3REB B;  4F7U G;  2K5F A;  3URG A;  5IAY A;  2EYY A;  3G6E Q;  2BTT A;  2HMA A;  2O88 A;  4E7J A;  3TEE A;  4PFZ A;  2E5Q A;  4RCC A;  2OTL Q;  2DTI A;  5GAN d;  2PNI A;  4JUV A;  1IB8 A;  1D3B A;  5CKE A;  2KT8 A;  1VQ6 A;  1QVF P;  2K3B A;  2RHU A;  2P84 A;  3CCR Q;  1D0Y A;  2NUT A;  4AG1 C;  2CUB A;  2M0O A;  3LH0 A;  2X4Y A;  1ZSZ A;  3EGX B;  2EWN A;  4J7I A;  3RR6 A;  1IGQ A;  4M75 D;  3OYN A;  2JXB A;  3MPU B;  4PFP A;  3EFR A;  1UG1 A;  2MMP A;  4QQ6 A;  4A53 A;  1TUG B;  4FSX A;  4JDS A;  2K7A A;  4QT7 A;  4XU1 A;  1M1F A;  4JRP A;  3CPW S;  5IN1 A;  3L1A A;  1YHQ T;  2V8J A;  4M77 E;  5LJ3 g;  4Y91 A;  4C92 E;  1ZBX A;  3V8K A;  3HP9 A;  5LJ3 f;  2CT3 A;  3CC2 A;  2E3I A;  4XAX B;  3OYA A;  2JMC A;  1Q81 U;  4XQ3 A;  2FPE A;  5GAO q;  1YIT T;  3FRN A;  1PSF A;  2HKN A;  2C0O A;  5KYN A;  1KSW A;  3CCS A;  2E10 A;  3UWN A;  1YJW Q;  1YJN T;  2DIL A;  5IHN A;  4JJD A;  4LDV A;  3FEO A;  3SHW A;  4PK4 A;  2A37 A;  2HQH A;  4PL6 A;  4OMN A;  3CC7 Q;  1RAD B;  1M1K C;  3CCV T;  4IIO A;  4D6W A;  2SRC A;  4A4H A;  1IGU A;  4NL3 A;  3TSZ A;  1NBE B;  4XTU A;  1Y07 A;  3KFV A;  3KUF A;  2PUO B;  3I55 A;  4MZT A;  3MJX A;  3M0T A;  3QUI A;  2A0F B;  2COZ A;  2EQM A;  3RIR A;  2JN0 A;  3NPF A;  2QAZ A;  4B9X A;  1VQ7 T;  1YI2 A;  2ZPB B;  2DFU A;  1K9M R;  3TU4 K;  2M9U A;  1I0C A;  3CCE Q;  1RAE B;  1VQN Q;  2DTO A;  2KRN A;  3GIB A;  2EIF A;  2J7I A;  5GAM h;  4RTX A;  4C8Q E;  4PJO F;  4OB3 B;  3NTK A;  4HT9 A;  1M3C A;  4M7D F;  1V1C A;  2L3Q A;  2DK3 A;  3X20 B;  2RI2 A;  5L8R E;  1K9M C;  3A5Z B;  2FZC B;  2K6D A;  3EH2 A;  1KC8 R;  5GAN 6;  2E64 A;  1VQ6 Q;  1MUZ A;  1KQ1 A;  2D1X A;  1H3Z A;  1K73 U;  1BI1 A;  2KVQ G;  4EPC A;  1XOV A;  2FB7 A;  1LOJ A;  1QVG A;  2F5T X;  3JCM d;  2HCK A;  2GTJ A;  4C5G A;  4PJO D;  2QTX A;  3ER0 A;  4M7D D;  4E6R A;  5A0D A;  2JS0 A;  3OYK A;  3AT1 B;  2K2M A;  2DEQ A;  2LTO A;  5I21 A;  2BIV A;  1R0B G;  2RM4 A;  3CC2 Q;  1E6H A;  2Y4Y A;  4BE2 A;  2LCC A;  2AKL A;  3JB9 F;  1EX4 A;  4BB7 A;  3C0C A;  4E7K A;  4PKC C;  2D8H A;  1Q82 U;  1UGS B;  2MWO A;  1WXT A;  1RAB B;  3CC4 T;  2E5K A;  1SG5 A;  4KT0 E;  4KH0 B;  2K9G A;  1UGR B;  5GAN 4;  3JCM b;  1ZUU A;  4PJJ A;  2FL7 A;  3OSS C;  2GQI A;  2ROL A;  4F17 A;  4C5E A;  2D6F A;  2RI3 A;  3OYJ A;  4BI4 A;  1YIT A;  1SF9 A;  2LJ3 A;  3VRZ A;  1AEY A;  4F04 B;  5HY6 A;  1JRI A;  2LDM A;  5LJ3 h;  3QYG B;  4M7A C;  1NLP C;  1H8K A;  3QII A;  2DBK A;  1YJN A;  3H0H A;  1X2Q A;  1YCY A;  5LJ5 f;  1NJI U;  2GBQ A;  3JCM X;  4BE1 A;  3T9N A;  1GCQ C;  9ATC B;  4JZ3 A;  2JM8 A;  5CCA A;  3BW1 A;  1GXI E;  3IQL A;  1D1A A;  1WJR A;  2JZ2 A;  3QXE B;  4FW1 A;  4KGZ B;  3CCM A;  3I5S A;  5GAO m;  1FMV A;  1M2O A;  1WFW A;  2F2V A;  5AYF A;  4C8Q G;  3JCM Q;  2VWF A;  2QGG A;  4LE9 A;  4R56 A;  2FYK A;  2O4X A;  5L23 A;  5GMK j;  5GAN g;  2JTE A;  3VKI A;  1QKW A;  4B9W A;  1FYN A;  2J6O A;  3EAE A;  4M77 F;  3R6O A;  4C92 F;  1BK2 A;  1QP2 A;  1PD1 A;  3S6W A;  1QCF A;  4PJN A;  2QEX A;  2BE9 B;  4FSS A;  2JUF A;  2HKQ B;  1VYV A;  3TCJ A;  1ZA2 B;  2CP2 A;  1PD0 A;  2NUP B;  2X4J A;  3UAT A;  1N5Z A;  2VB6 A;  4OGC A;  2DXC A;  1EIF A;  4ZTJ A;  3VS5 A;  4AMC A;  1AT1 B;  2AT1 B;  3H0F A;  2FVU A;  1X2K A;  1W2B A;  1M1K U;  2DF6 A;  2OTJ A;  1HSQ A;  1VOM A;  3OYI A;  1I07 A;  3I5R A;  4JZ4 A;  2HSE B;  3CMA T;  2DNU A;  1M8M A;  4M75 E;  1BIB A;  3HFO A;  4DEY A;  4M7A G;  2QQA A;  3A98 A;  4D8D A;  2RI5 A;  3G1J A;  5KE2 A;  1K8A C;  1X6B A;  1ZUY A;  1AOJ A;  3G4S T;  5GAO p;  2F69 A;  1TH7 A;  1YNZ A;  1WHH A;  2RK2 A;  2AZS A;  3EGX A;  2NUZ A;  2J6F A;  4ELZ C;  1WJS A;  4FT4 A;  3LGF A;  4FYX B;  2M02 A;  2DL7 A;  4HT8 A;  1UGP B;  4II1 A;  4NL2 A;  2FZG B;  1VQP A;  2HBP A;  2PVG B;  4DBF A;  2WSC E;  1K9M U;  4LDY A;  3OYY A;  2DPP B;  4FYW B;  1QQJ A;  4MMK A;  5IHI A;  1NEG A;  2L2P A;  2LZ6 B;  2NYS A;  2E6Z A;  2OAW A;  1B07 A;  2LJ1 A;  2LCS A;  1WHM A;  4ZN3 A;  2DMO A;  2K79 A;  3CXC S;  2FHD A;  4GBQ A;  4GY5 A;  1IHV A;  1ABO A;  1XQH A;  4DBH A;  4OMM A;  1YIJ T;  3HL8 A;  3CCM Q;  2FRW A;  1Q81 C;  4KUD K;  2X35 A;  1X6O A;  2PU9 B;  1QVF A;  2RHY A;  2PVD B;  4RTT A;  3HSB A;  4UC4 A;  1AHJ B;  4OB2 B;  2EFI A;  1Y96 B;  4V2S A;  2EGE A;  3M59 A;  3QPH A;  2R5M A;  2LX7 A;  4IIM A;  1X75 C;  4P5N A;  3CCU Q;  2ED1 A;  2CP7 A;  4J9B A;  2AK5 A;  3JCM J;  2QEX Q;  2DAQ A;  3OMG A;  3JCM g;  2RO0 A;  5CKD A;  2XDD A;  3JCM f;  1IXD A;  2DXT A;  3HPW A;  1BYM A;  2EAY A;  2XU8 A;  2L5Q A;  4R0K A;  2ZGW A;  2HSP A;  3F70 A;  5GAN h;  4OF1 A;  1TUC A;  5A2Q E;  2CP6 A;  1W70 A;  5GMK h;  3JB9 H;  1H92 A;  1FMW A;  1M4Z A;  1N9R A;  1SSH A;  1PRM C;  3L2Q A;  4M75 G;  1JJ2 S;  2CZ7 B;  2HBW A;  1PRL C;  2OTJ Q;  1QWE A;  3L2Z A;  3N5B B;  1G8X A;  3HRU A;  3INZ A;  2LQK A;  1K4U S;  1X69 A;  3M0S A;  1IHW A;  2WSF E;  2C06 A;  1ABQ A;  4KUL A;  3VRY A;  3OS2 A;  4PJO E;  2LNH B;  4MDW A;  4M7D E;  5IH2 A;  5HK3 A;  4IUQ A;  2FRY A;  1OQK A;  3KXT A;  4M78 F;  2GGR A;  1IO6 A;  2X9H A;  1VYT A;  4JS5 A;  1Q95 G;  1TXQ A;  2LCL A;  3VU3 C;  2PVO B;  4F14 A;  1W4S A;  2AHJ B;  3G4S A;  4R55 A;  1JU5 C;  3PMI A;  2P0Q A;  5KCH A;  4J9F A;  2DZC A; 
#chains in the Genus database with same CATH homology
 1YFN A;  2QAZ A;  1ZSZ C;  1OUL A;  1ZSZ B;  1OX9 A;  1ZSZ A;  2QAS A;  1TWB A;  1OU8 A;  2NYS A;  1OU9 A;  1OX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...