1TWBA

Sspb disulfide crosslinked to an ssra degradation tag
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
SSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVECVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleotide-Dependent Substrate Handoff from the SspB Adaptor to the AAA+ ClpXP Protease.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
molecule keywords Stringent starvation protein B homolog
total genus 26
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1twbA00
1OULA 1OX9A 1ZSZC 2QASA 1OU9A 1ZSZB 1OU8A 1TWBA 1YFNA 2QAZA 1ZSZA 2NYSA 1OX8A
chains in the Genus database with same CATH superfamily
3ME9A 1GBRA 2LT4A 3PTAA 1WIEA 5FU7C 2JN0A 3MO8A 4OF1A 3OYGA 1JU5C 5A0LA 3DLLA 5FRNA 4GLKA 1UUEA 3KXTA 2M0OA 4C5IA 4XTXA 4C5GA 4FCYA 4MDWA 4B9XA 3EG1A 1UTIA 3H0IA 4XTUA 2RI3A 1AWXA 3QJ6A 3G7ZA 1HYOA 2XG8D 3BY7A 3CC2Q 5KYWB 5AT1B 1VQ8Q 4LD6A 2D8HA 4B9WA 5GANe 3G71T 4AG2C 1WI7A 4ZTFA 3FEOA 1ACMB 2ZPGB 3M4GA 5EC7A 4RUGA 5LJ3f 3M0TA 2ED0A 2E64A 3FB9A 1FX7A 2DEQA 4C92F 2KI7A 2FPEA 6AT1B 4OMMA 1KD1C 2QG9B 3JV3A 5GAMh 5GMKi 1GRIA 5D6YA 1U3OA 1U1TA 2YWWA 2QEXQ 1ZBJA 3SDZA 3VS1A 4XK8E 3I56A 1WLPB 1M2VA 3V7CA 1OQKA 3NHNA 2DTHA 2MMPA 4XU1A 2EQMA 2D6FA 2EFIA 2M16A 3VUZA 4KUDK 2KROA 2Y90A 3HP9A 1QKXA 2CZ0B 2MYSA 1ABQA 2HNIA 1K9AA 3T9NA 1YI2T 3M0RA 2QA4A 1BCMA 5GAN4 2XU8A 2E1HA 4FW2A 2PVGB 1VQ7Q 1J3TA 1VQLA 1C6VX 3I56T 1IHVA 2M9UA 1I5LA 3JB9H 2DD5A 4BB7A 4J6WA 1BYMA 5DM7R 2AKKA 5GAN3 2DK3A 2IIMA 1Q82U 2O01E 2DL4A 3OW2P 2LP5A 3DB4A 2K5LA 2DA9A 1OOTA 3QWYA 5KE2A 1N27A 3RKWA 3MPUB 1LPLA 5C6SA 3H0FA 4HVVA 1JJ2P 2YRDA 1VQPT 3OYCA 3CC2T 3I55A 5LJ5e 3E19A 4J9CA 1VQKQ 1Q86U 3VKIA 3VS2A 3CCEQ 4D6WA 2L8DA 2GBQA 2PNIA 2Z0WA 3NTIA 1P92A 2XDPA 4II1A 3RNJA 4WCIA 3FJPA 3NTKA 1T0HA 1WYXA 2DXBA 4JUVA 3PGGA 5CCAA 1M1KR 1D1AA 1X2KA 1M27C 3HSBA 1TXQA 3WXMB 4BD3A 3VV0A 4A4GA 1R0BG 2LJ1A 1YJNT 5CKFA 2ZGWA 2AT1B 1YCYA 3JSCA 2RK1A 1VQ8A 3CCLA 2CP2A 2ENMA 1SRLA 2QTXA 1AHJB 4P5NA 4N4HA 1W2BP 1HK9A 2FZGB 1SG5A 1WJQA 4R55A 1N8RU 3I5RA 1M1KU 3QZ9B 3A5ZB 3OYYA 2XHCA 2RD1A 2HL5C 4BDZA 1K9MC 1M9SA 4XQ3A 4OMOA 4AT1B 4OMQA 2K57A 1W70A 4QVZA 2CT4A 3REAB 4B6MA 1VQ7T 3I56Q 1I81A 2VWFA 4M77G 3JCMe 4LUDA 2BE9B 1SKUB 5IT9E 3LWIA 2LCCA 3OB9A 2L3QA 2BUDA 2E70A 1VYVA 3H0HA 1ZUUA 2LTOA 2GQIA 2KSSA 4ELYC 1WHLA 3EG9B 1VQLQ 3KFVA 2QAZA 3NTHA 4HKEA 3JB9D 3RBBB 1OX8A 2XI9A 3JB9G 3HHTB 2DRMA 4LDXA 1MGQA 4F14A 4E7ZA 4C92A 2ZPFB 1CKBA 4OB0B 3EGXB 2ZPEB 4KGVB 3OYAA 4ZGJB 1VQPQ 5HK3A 1MV3A 2KNBB 4RTZA 3JCMc 4C0FA 3S6WA 4M78B 3EFRA 1E6HA 2DEUA 1JXOA 5IXFA 3ASKA 4IUPA 2QEXA 3G4ST 5FWBA 2HL3A 2V1RA 2EPDA 4FSXA 4AFZC 2VKNA 2HKNA 4RTYA 4LD9K 1GL5A 2X35A 1KQSP 2YXYA 5CVIA 4KGXB 3CCJA 1H8KA 2A3LA 2JTFA 2KDSA 4E7JA 3MEAA 4MMLA 1KC8R 2F5KA 2FRYA 4HCBA 1BI3A 2EVRA 3A8GB 2YUOA 4JRPA 1YHQA 3R6OA 1D3BB 4M78C 4M7AE 1IGQA 1U06A 2EBPA 4M75G 3UT1A 1OU9A 4OB3B 1ZSZC 3UWNA 2EKOA 2X4JA 2K3XA 5GAN7 1WHKA 2CH4A 2KR3A 1VQ9A 3UA6A 3PMIA 4HVWA 3VRZA 3FDRA 1XTDA 1MV0B 3E2UA 3VS3A 4QKUA 1HJDA 2BZ8A 1NJIU 1OPLA 2AKLA 5M9OA 4M7DF 1VQKA 4JLGA 1LJOA 1WPYA 2K9GA 4Q5WA 5I2MA 3RUXA 3ZL7C 4LN2A 3OBYA 2F2WA 1FMVA 2DIQA 1WQWA 1HXDA 1BKBA 3LX7A 2RNAA 4DBFA 1PD1A 2DM1A 1RLQC 1W1FA 3M0SA 2OX7A 5CKDA 1RADB 1VQNT 1I8FA 5LJ3g 4M7DA 1PG5B 5GAN5 1PRMC 3LH0A 1YIJA 1WJSA 5DY9A 2DX1A 2NUPB 4ZN1A 1M90C 2V8JA 4OGCA 2OAUA 5KYWA 4JRIA 5LJ5g 3L2ZA 4IUVA 3G4SQ 1O75A 2P4RA 2HSEB 3NMZC 2QQRA 5GAMf 2KYMA 4ZGEB 3PMTA 2ROLA 4JRKA 1I0CA 3GIBA 3CC4Q 2MIOA 2EQIA 1UJYA 2RB6A 4D8KA 2D8JA 4IIOA 1YITA 2EGAA 4MDXA 3EHQA 4PJLA 5FU6C 2LVMA 1OYXA 4J9FA 5GAOq 1MNDA 3N5BB 3OYKA 2NUTB 1V76A 2B8AA 3CMET 1AWOA 4M77C 1RLPC 3OBWA 3DLMA 2RJDA 1SSHA 1RAIB 3CPWS 4J6XA 1GFDA 1OZ2A 3J81E 1RAFB 4XTYA 2KVQG 1VQ5T 5GAMe 1NZ9A 4A4HA 1Y71A 2AZVA 2QQSA 3E1SA 1EZZB 1M4ZA 2BZYA 3VS4A 2RMOA 3VS5A 2E5KA 1VYTA 3MP6A 1VQ9Q 4BE0A 4ANJA 2ZPBB 2LJ0A 2LT1A 5KH6A 1I07A 2ATCB 3EFOB 3ZBDA 1B34B 5IHIA 4M7AB 5CQYA 4X9DA 1QWFA 2QYZA 1VQ6Q 3JCMX 1RAEB 1WA7A 1QCFA 4C8QA 4DBRA 1Q81R 4JJBA 1K73C 1KQ2A 1FMWA 5CAIA 3LGFA 3EGDB 4FYYB 1M90R 3C94A 2QTVA 1VUBA 4C8QC 2FRWA 2HBWA 3CC4T 2L3SA 2ZCFB 1X27A 2DBKA 3EGUA 1NYGA 2QDYB 3G4SA 2QGGA 3U23A 3M0UA 1A0NB 2EGEA 3D7SB 1JQQA 4PLIA 2E6NA 3SWNB 4ME7A 2JM9A 9ATCB 2VGMA 1SRMA 4J7FA 2DRKA 3QWXX 2RHUA 2JJ9A 2R57A 5GANh 3QDFA 3VYGA 2JVVA 3EFSA 1R77A 4IKFA 1QW1A 1M30A 1KQ1A 2OJ2A 1RACB 2IPOB 2RQUA 3V8JA 3QYHB 4L5GA 2YSQA 5AYFA 1BB9A 2EYXA 2JXBA 3C95A 1MMAA 2YT6A 1UGPB 1VQOT 5CKEA 2ROTA 2P0KA 2LQ8A 2FPDA 1SPKA 2XD0A 3CEYA 5GANd 4RTVA 4PJNA 2GFAA 2G6FX 4ZGDB 3OW2S 2V8IA 2XKOC 2E3HA 1BCOA 3KUFA 4DOWA 2J7IA 2D0NA 2KE9A 4EMKA 1VQ6T 1UG1A 2KGTA 4MZMA 1QCOA 1B3QA 4LE9A 1K1ZA 3OYDA 2HDAA 5GANf 4DA4A 2CT3A 1TS9A 4J6YA 3CBMA 2DYBA 3ZFJA 4M7DC 2DAQA 1O9SA 3VRYA 1C0MA 2K79A 3CXCS 4M75E 2JZ2A 3A8MB 3TCJA 4CRIA 1KC8U 2PVDB 3LGLA 2DPPB 2K3BA 1N5ZA 3VS6A 1HSQA 1XQHA 2KK4A 1VYUA 5D6XA 1SHGA 3TU4K 2KMTA 1VIFA 4RKUE 4ZN3A 1YFNA 3E9GA 4OB2B 1WFWA 4ELZC 4HCZA 4CC2A 2DIGA 2WSEE 1GFCA 2JTMA 4MMKA 4N0AC 2CP3A 4RCCA 2HMAA 2QI2A 1RAGB 1D0YA 2YRVA 2COYA 2EW3A 1NEGA 3TQ7P 1WHHA 1Y57A 3JB9I 2C0IA 2X9HA 4F16A 2NWMA 4Z89A 4PNOA 2CUBA 3M58A 2BKDN 2DKGA 1Y0MA 3G6ET 2DJQA 5IH2A 4PJOD 2DLPA 1SEMA 3CCQT 2CGHA 3CPWP 3LH5A 2RQRA 2A7YA 3GLXA 1NBEB 3S3MA 2QA4Q 1VQOQ 3M9QA 4MZTA 2DL5A 4M7AA 3CMAA 2VASA 4YTLA 1UHCA 2KXCA 2KT8A 4M75F 3EG3A 2QQAA 4PJOF 2VYTA 3VS7A 2SRCA 2JS0A 3V7RA 2FO0A 1LCKA 3UPUA 2LQWA 1RABB 1IRXA 2E6ZA 2X3XD 4M78G 3CCJT 2FPFA 2PTKA 2HD0A 1R8OB 4D8DA 3QO3A 2VC8A 3OMGA 4BE1A 4RTTA 3CD6T 2LX9A 4RG2A 2GQVA 5FRMA 1TSFA 2MWPA 5FU7B 2O9SA 1M2OA 2HQEA 2DL7A 2L89A 4M7DB 1I5OB 3L2RA 3TVTA 4JPBW 1KK7A 1QVGA 2FEIA 2K4YA 1ZX6A 2YUQA 3CC2A 3QSUA 2OTLA 2DTIA 3RMSA 4F04B 3ER0A 1PWTA 1UE9A 1TOVA 3CPWA 3CCUQ 1UEBA 3E9FA 1D09B 1JEGA 1WXTA 4R0KA 3CCSQ 1IGUA 2YDLA 2DTOA 3TREA 2ED1A 3HFOA 4M4ZA 3JCMP 3X25B 4E7LA 3NFCA 1H3HA 2KEAA 2DVEA 1UB4A 1QVFP 2DXCA 1UJ0A 4XAXB 3MEUA 2MCNA 5FW9A 4GY5A 5FROA 5I21A 1AVZC 1QVFS 1PC0A 2K3YA 2JNGA 3FLGA 1M1KC 1V29B 2K7AA 1VQ4T 1CKAA 3M59A 3WVEB 2L2PA 1OPKA 4C8QG 4OB1B 3CCSA 3CPFA 2GTJA 1Q7YC 3UDCA 4JRQA 3QUIA 3O5ZA 1KJWA 3OYBA 2LMJA 4JLIA 3LYIA 1QVGP 2R5AA 3EG9A 4C92D 1T3LA 3MKDA 2VVKA 2GFUA 2JUFA 2CH4W 1KG1A 3OYFA 4E47A 2RN8A 1VA7A 1PCXA 2QQBA 2DERA 4F7UA 3C12A 4LDUA 4BY6B 5CQXA 1G2BA 1X69A 3C0CA 5A2QE 2R5MA 4J9BA 5CR2A 3QPHA 3X26B 3A1PA 1Z9ZA 3VYHB 1MMGA 2V8KA 1B34A 5GJVB 2L5QA 4KH1B 1RL2A 1VQ8T 3CCVT 4ZNXA 5LJ5h 1PM3A 1KQSS 2J06A 2JMCA 2EJ9A 1X6BA 2CYZB 2DETA 2NLUA 4LDWA 2HCKA 2FVUA 1EFNA 4XU3A 3L1AA 1VQMT 1S72Q 1BK2A 5DLOA 5LJ3j 3M5AA 3OSVA 5I2SA 2V26A 4LUEA 1G3TA 1TWBA 5KCOA 3EHRA 1NEBA 1NLOC 4EMKC 1WQ7A 2VV5A 2QEXT 3L42A 4BY6C 3CCST 4ATOA 1M8MA 2JOYA 2DE0X 4PJMA 3H9NA 4NL3A 2CZ7B 1KQSA 2OTLT 5KYNA 2E65A 3WVDB 4E7SA 2RI2A 3EGDA 3VS0A 4LNPA 4EIKA 2DXUA 4KUIA 2HZYA 3JCMd 4OGEA 3MHXA 2GNCA 3URGA 3OA6A 1JO8A 4FM4B 1YJNA 4PJOA 1UGVA 4L59A 1BI0A 4PJOB 2EYYA 4HT8A 4PFPA 5LJ5j 1JRIA 2GGRA 2J6KA 3GPLA 1YP5A 5GAMd 3JCMf 1X01A 1E6GA 1BIBA 4F17A 5GAOm 1XOVA 2VUBA 1OU8A 4M77A 4A4EA 5HK0A 3CXCP 3H8ZA 3SB2A 2RHYA 3BFMA 3CCVA 1KD1U 2EQUA 1TUCA 2E10A 1VQNA 2OTJA 2O4XB 5HKCA 1YBYA 4J9HA 3HRSA 2C0OA 2COZA 1AWJA 2DD4A 2H3JA 1IHWA 2WACA 4AFQC 1QLYA 4AFSC 4M75B 1K8AC 1WNLA 3CQTA 4ORZA 5J39A 3CMAT 1VQKT 4HCCA 3X24B 1M8VA 3CCVQ 2DL3A 2YUNA 4C0ZA 3CCUA 3L2UA 2C06A 4C8QE 1F1BB 1RUWA 2LRQA 4WTOB 1ZSZB 1OEBA 4M78F 2DBMA 2RO0A 1Y96A 2LNHB 1S72T 3F70A 4E6RA 3OS5A 1KIKA 1K0XA 3GNGA 2O88A 4VUBA 5A0GA 3JRZA 3KBGA 1PKSA 4FYWB 1WDXA 2XK0A 1MMNA 1UFFA 5D6WA 3MJXA 2R58A 4LDYA 2E4HA 1QVGS 3EH1A 1M2VB 5DLQE 1OX9A 2D0QB 3VUBA 2ZPIB 3P8HA 2OTLQ 3V7SA 1FYNA 3EG0A 3META 2RK2A 1VOMA 1B7TA 1G3YA 4PK4A 3I35A 2A36A 1W2BS 1K73U 2OTJT 3BE3A 1NE8A 4M7AF 3O8VA 1IO6A 3MEVA 2H3EB 2F2XA 5J3BA 1UECA 5LJ3e 5GAN2 1H3ZA 5LJ5d 2M02A 2RHZA 4QQGA 4J83A 4X34A 4Z8AA 1U8RA 1RI9A 1AZGB 1YJWQ 4JS4A 3PIPA 2WSFE 4A53A 3RERA 2CP7A 2DJZA 3OSSC 4IURA 2LCLA 5KCHA 4RG8A 1VQLT 3CCMA 3JB9F 2RA2A 5GAMg 3PVQA 2O9VA 3CC7T 2BTTA 2OI3A 5KYUA 5IAYA 2NUZA 2DYIA 2FYKA 2X3WD 2GCXA 3OS2A 5LL6S 1YITT 4EMHA 2RJFA 4DQ2A 1S72A 5GAOp 3PNWC 3VU3C 2VB6A 3TSZA 1Y7XA 2FB7A 4DEYA 4PJOG 1BBZA 1Q81U 2JT4A 4BUGA 4BI4A 5GAMj 2MOXA 2NYSA 2A37A 1QP2A 1N8RR 3CCMT 5EG2A 4PKCC 4CI0C 1JJ2A 2X4XA 1BI2A 3OYEA 2RI5A 3QJYA 1ZA1B 4HT9A 3AHUA 4PJOE 3C4SA 2HQXA 2BZXA 2LZ6B 1D1BA 4OMLA 4OMFB 4IIMA 4KH0B 4RTUA 4M7AD 4R56A 3OYHA 1G3SA 2DVJA 2Y4YA 1WZOA 2JMAA 1G8XA 7AT1B 2PZ1A 3A8HB 4JJCA 4DBHA 5LJ3h 4XTZA 1YI2Q 3X20B 2EIFA 3AT1B 1PRLC 1TTHB 4A4KA 2OTJQ 3CBPA 1W2BA 1KD1R 2P0PA 4N4IA 2CS7A 2LQNA 4Y91A 3CCLQ 2ESWA 1BIAA 1N9RA 3L2QA 2K6DA 3UF4A 4RTXA 4FW1A 2MPXC 4BI8B 1ZSZA 4GBQA 4F7UG 1TG0A 1YJWT 3GP8A 4NOYA 2CP6A 3OS0A 3OYIA 4FYXB 4GLMA 1JBMA 5LJ3d 4C8QF 4KGZB 1JXMA 1GXIE 3V8LA 5IXBA 3CC7Q 4C92C 4EMKB 2DMOA 3EGXA 1K8AR 1ZHIA 3BW1A 2RQWA 2QXFA 3JCMg 1YITQ 1MUZA 4M75C 1VQNQ 1Y96B 2E41A 3QDRB 3QBYA 1HD3A 3CCET 2V1QA 2XIDA 3CCMQ 5ECAA 2MF2A 2RF0A 2LJ3A 1WHGA 4E7KA 2LX7A 5GMKl 2JW4A 1K0SA 4O6JA 1AEYA 1Q82C 2KRNA 4CC4B 2I2LA 3QXEB 1NG2A 3CD6A 2RJEA 2RQVA 4UC4A 1YJNQ 4C92E 3PVLA 2DL8A 1Y07A 3EFOA 2HQHA 3HL8A 5GANg 2AIRB 2FZKB 2DO3A 5GAOr 2COWA 4PLLA 2EGCA 1KHCA 3SWNA 3RKYA 1MMDA 3CMEQ 3R6NA 1Q95G 1UGSB 3J80E 4JS5A 4QQ6A 2AK5A 1FXXA 2PUOB 3PT9A 3CCLT 1NPPA 2DILA 2FHDA 3QZ5B 2DXTA 2IVWA 3GBQA 3JB9J 5GMKm 4IUTA 1R0CB 4M77B 4ESRA 3UA7A 2EQJA 1ZQ1A 1W4SA 3L2WA 3H6ZA 1AD5A 1YWOA 2VXFA 4CC3A 2I0NA 2KXDA 4IUQA 1PSFA 1VQ9T 4M7AG 3QIIA 1K4US 1WHJA 1QWEA 3M54A 2JM8A 1NJIR 2ECZA 3X28B 1N6AA 2KRSA 3M53A 1IB8A 3S3OA 4FSSA 1D0XA 2EJFA 3QG1A 2DFUA 4L6V5 3CCRA 2EQKA 1KSWA 2ZZDA 3OYJA 4QW2A 4AFUC 3I9QA 2F69A 2K5IA 4A4FA 2HKQB 4RMOA 1Q7YU 4C5EA 3Q1JA 2CDTA 2E12A 1GCQA 4NL2A 1QVPA 4M77D 3M0QA 3SHWA 1YI2A 5KYXA 2K2MA 1Z9QA 3G6EA 4LDVA 4BE2A 2ABLA 4EDUA 1JB0E 1X2QA 5CIUA 4J9GA 2QDLA 1M3AA 5FWCA 4A63B 1VIEA 3M4YA 3A8LB 3RDVA 3ZEHA 1YN8A 2XDDA 3JCMJ 2CZ1B 2FL7A 3GF5A 2P84A 1QVFA 4V2SA 3SEMA 4M77E 3HTRA 4J7IA 3LW5E 2NUTA 3HFNA 4XTVA 4HVUA 5CO7A 1WXUA 5IHKA 1YHQQ 2J6FA 5HCKA 3CMEA 5FLXE 3JCMh 2D1XA 3QKJA 2O31A 4TVRA 3JCMV 1RAAB 2FG0A 3IQLA 5GAOl 1PD0A 2AHJB 8AT1B 4C0DB 4XU0A 2VGNA 2PVOB 4AMCA 5GAN6 1GCQC 1M3BA 3DKMA 3QHSA 1EIFA 1T0JA 1MNEA 1ZUYA 2XMFA 1NPRA 2C0TA 2D9TA 4QT7A 2LCSA 5GMKj 5GAN8 5L8RE 1SSFA 5KYYB 1T3SA 2M1HA 1QCNA 4M75D 2PUKB 4X9CA 2X4YA 3OQ5A 2VXEA 2EKHA 2P0QA 1ZLMA 2KBTA 2E5QA 4HA8A 5GANj 4ZTJA 3CBOA 2EAYA 1NJIC 4FYVB 2A0FB 4IUUA 2E3IA 3A98A 1OV3A 2PQWA 2M0YA 2J05A 1LOJA 3LLRA 2DNUA 2FZCB 3RIRA 2OAWA 2Y4XA 3G71A 1YCSB 1VQMA 4DOVA 2W10A 2DZ9A 2WSCE 1N8RC 3HPWA 1Q7YR 1I4K1 3OYLA 2RJCA 4JDSA 1K9MR 3CC4A 2F1LA 2L3RA 1LNXA 1QQJA 2X51A 1W6XA 2HEQA 3GOXA 2P4TA 1EX4A 1ZBXA 5LJ5f 4FT4A 2HSPA 4WF2A 2A28A 2RHIA 3TEEA 5KYUB 3GNFB 1FWZA 1ARKA 1YJ9Q 4OVAA 2J6OA 4JJDA 8ATCB 2K2VA 3G6EQ 4NS5A 1YWPA 2DZCA 2X4WA 3BDUA 1DJ7B 1VQ5Q 4FU6A 4EMGA 1YHQT 1QP3A 4OMPA 3J7AF 4M7AC 4Z88A 1YIJT 4JZ4A 3RESA 3M0PA 5GMKe 1G3WA 4E7IA 4PJJA 1C1AA 3EH2A 3JCMQ 4O5VA 3H41A 3CXCA 2RH2A 2JTEA 1Q82R 1UHFA 1WX6A 2KYBA 3CCJQ 1S1NA 1ZSGA 2L0AA 3OY9A 4XU2A 2BIVA 1K8AU 3CD6Q 2F2VA 2SEMA 1YJWA 2EYQA 4F7UF 2LNVA 1YNZA 3OMCA 1QMCA 3HRUA 3P8DA 2BE7D 3DB3A 1BI1A 3OW2A 1AT1B 3CCUT 5GMKh 4C92B 2JS2A 1VQ4A 1NLPC 2AZSA 2G3RA 2YUPA 3PFSA 1Q86R 4N4GA 5IN1A 1JJ2S 4EPCA 1TU0B 3FIFA 3CCEA 5GAOn 2EJGA 3UATA 3RKXA 2M51A 3A8OB 4CC7A 1XNIA 4Z02A 2EYWA 1ZA2B 4M78A 3THKA 4JJNK 2LQKA 1OZ3A 5KE3A 2O2OA 5FU6B 1BU1A 2CKKA 3TSWA 2RHXA 3JAME 1VQ4Q 1YJ9T 4J5YA 3VJPA 2CREA 5I22A 4M7DG 3M55A 1GBQA 3MP1A 1OULA 3HKSA 2QASA 4JZ3A 1VQPA 3HRTA 1IREB 4J8OA 4N0AA 1YIJQ 4OP0A 5CKBA 3RMQA 4FT2A 3L2VA 4XTWA 4KULA 3CCRQ 1U1SA 1TH7A 2L3PA 4PFZA 1GCPA 1AOJA 4Y92A 4DBQA 1D3BA 1ZUKA 4J9DA 3RR6A 2NUPA 1D0ZA 4AG1C 1SF9A 5IHNA 4M7DD 4M78D 4RTWA 2XICA 4F7UE 3M57A 1G83A 1OI1A 1X6OA 1ABOA 1LVKA 3ULRB 4LXCA 1U5SA 1TUGB 3FRNA 1WGSA 1UGRB 4Y28E 1Q81C 2HBPA 4M75A 1VQMQ 3BDLA 2PU9B 1SHFA 1UDLA 2EYZA 2GF7A 2QQ9A 3I55Q 1PHTA 2YLCA 3MP8A 2CP0A 4QVCA 4HXJA 2A08A 2K5FA 1H92A 2KT1A 4FL6A 1WXBA 4M78E 1K76A 2ZPHB 2DF6A 4E7HA 3JCMb 2RPNA 4E2FB 3V8KA 1D1CA 2YLBA 2KRMA 4QQDA 5A0DA 1M90U 5C0MA 4C0GA 3OS1A 1X43A 3S3NA 1CSKA 3NGPA 4K11A 1PSEA 3SWNC 5CKHA 3M56A 1M3CA 1NYFA 1I1JA 1PNJA 3EAEA 3CCQQ 2MAMA 1VQ6A 1NM7A 3LWHA 4PFOA 3FC3A 4QVDA 2H8HA 3OYNA 2QA4T 4C92G 2B86A 4X1VA 2MI6A 3CCRT 1E7OA 2MK5A 3OYMA 1KFZA 3NPFA 1QKWA 1YJ9A 1V1CA 1AZEA 1PKTA 2CSQA 4HCKA 4KBMB 5L23A 2QGFB 3QYGB 1FMKA 4C8QD 5HY6A 1Q86C 1WJRA 3CCQA 1N9SA 2KQWA 1M1FA 4OMNA 3CMAQ 2QK0A 1K73R 1KHIA 3MEWA 1H641 2YHTA 2RQTA 3G71Q 5J26A 1VQOA 4M7DE 4C8QB 2KY9A 2RM4A 3G1JA 3EG2A 3INZA 5KYYA 3SFMA 2CSIA 2EWNA 2ZAEA 4DEXA 3CC7A 2HAXA 2W0ZA 3FJ5A 1X75C 5D7UA 4PL6A 4F7UB 1G5VA 3I55T 4KRTA 1KC8C 2LDMA 4FIBA 4KT0E 3I5SA 4A54A 4BACA 1IZ6A 2IG0A 2MWOA 4C0DC 2CP5A 2KAFA 3REBB 1TUDA 2YRCA 4RCBA 5I11A 3PIOA 4J9EA 5GJWB 3PE0A 4BI3A 2GTOA 1VQ7A 2XDBA 1IXDA 4M77F 1B07A 4C5HA 1X6GA 2CZ6B 1XJWB 1K9MU 3SD4A 1VQ5A 1M1GA 1M5Q1 2LC4A 2O4XA 3P8BB 4J9IA 2F5TX 3MCAB 1AWWA 3JCMW 2CUDA 4MZPA 4PJOC 5CK9A 4BDYA 1MHNA 1RAHB 5KYXB 1UGQB 1RI0A 1WHMA
chains in the Genus database with same CATH topology
1OULA 1OX9A 1ZSZC 2QASA 1OU9A 1ZSZB 1OU8A 1TWBA 1YFNA 2QAZA 1ZSZA 2NYSA 1OX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OUL A;  1OX9 A;  1ZSZ C;  2QAS A;  1OU9 A;  1ZSZ B;  1OU8 A;  1TWB A;  1YFN A;  2QAZ A;  1ZSZ A;  2NYS A;  1OX8 A; 
#chains in the Genus database with same CATH topology
 3ME9 A;  1GBR A;  2LT4 A;  3PTA A;  1WIE A;  5FU7 C;  2JN0 A;  3MO8 A;  4OF1 A;  3OYG A;  1JU5 C;  5A0L A;  3DLL A;  5FRN A;  4GLK A;  1UUE A;  3KXT A;  2M0O A;  4C5I A;  4XTX A;  4C5G A;  4FCY A;  4MDW A;  4B9X A;  3EG1 A;  1UTI A;  3H0I A;  4XTU A;  2RI3 A;  1AWX A;  3QJ6 A;  3G7Z A;  1HYO A;  2XG8 D;  3BY7 A;  3CC2 Q;  5KYW B;  5AT1 B;  1VQ8 Q;  4LD6 A;  2D8H A;  4B9W A;  5GAN e;  3G71 T;  4AG2 C;  1WI7 A;  4ZTF A;  3FEO A;  1ACM B;  2ZPG B;  3M4G A;  5EC7 A;  4RUG A;  5LJ3 f;  3M0T A;  2ED0 A;  2E64 A;  3FB9 A;  1FX7 A;  2DEQ A;  4C92 F;  2KI7 A;  2FPE A;  6AT1 B;  4OMM A;  1KD1 C;  2QG9 B;  3JV3 A;  5GAM h;  5GMK i;  1GRI A;  5D6Y A;  1U3O A;  1U1T A;  2YWW A;  2QEX Q;  1ZBJ A;  3SDZ A;  3VS1 A;  4XK8 E;  3I56 A;  1WLP B;  1M2V A;  3V7C A;  1OQK A;  3NHN A;  2DTH A;  2MMP A;  4XU1 A;  2EQM A;  2D6F A;  2EFI A;  2M16 A;  3VUZ A;  4KUD K;  2KRO A;  2Y90 A;  3HP9 A;  1QKX A;  2CZ0 B;  2MYS A;  1ABQ A;  2HNI A;  1K9A A;  3T9N A;  1YI2 T;  3M0R A;  2QA4 A;  1BCM A;  5GAN 4;  2XU8 A;  2E1H A;  4FW2 A;  2PVG B;  1VQ7 Q;  1J3T A;  1VQL A;  1C6V X;  3I56 T;  1IHV A;  2M9U A;  1I5L A;  3JB9 H;  2DD5 A;  4BB7 A;  4J6W A;  1BYM A;  5DM7 R;  2AKK A;  5GAN 3;  2DK3 A;  2IIM A;  1Q82 U;  2O01 E;  2DL4 A;  3OW2 P;  2LP5 A;  3DB4 A;  2K5L A;  2DA9 A;  1OOT A;  3QWY A;  5KE2 A;  1N27 A;  3RKW A;  3MPU B;  1LPL A;  5C6S A;  3H0F A;  4HVV A;  1JJ2 P;  2YRD A;  1VQP T;  3OYC A;  3CC2 T;  3I55 A;  5LJ5 e;  3E19 A;  4J9C A;  1VQK Q;  1Q86 U;  3VKI A;  3VS2 A;  3CCE Q;  4D6W A;  2L8D A;  2GBQ A;  2PNI A;  2Z0W A;  3NTI A;  1P92 A;  2XDP A;  4II1 A;  3RNJ A;  4WCI A;  3FJP A;  3NTK A;  1T0H A;  1WYX A;  2DXB A;  4JUV A;  3PGG A;  5CCA A;  1M1K R;  1D1A A;  1X2K A;  1M27 C;  3HSB A;  1TXQ A;  3WXM B;  4BD3 A;  3VV0 A;  4A4G A;  1R0B G;  2LJ1 A;  1YJN T;  5CKF A;  2ZGW A;  2AT1 B;  1YCY A;  3JSC A;  2RK1 A;  1VQ8 A;  3CCL A;  2CP2 A;  2ENM A;  1SRL A;  2QTX A;  1AHJ B;  4P5N A;  4N4H A;  1W2B P;  1HK9 A;  2FZG B;  1SG5 A;  1WJQ A;  4R55 A;  1N8R U;  3I5R A;  1M1K U;  3QZ9 B;  3A5Z B;  3OYY A;  2XHC A;  2RD1 A;  2HL5 C;  4BDZ A;  1K9M C;  1M9S A;  4XQ3 A;  4OMO A;  4AT1 B;  4OMQ A;  2K57 A;  1W70 A;  4QVZ A;  2CT4 A;  3REA B;  4B6M A;  1VQ7 T;  3I56 Q;  1I81 A;  2VWF A;  4M77 G;  3JCM e;  4LUD A;  2BE9 B;  1SKU B;  5IT9 E;  3LWI A;  2LCC A;  3OB9 A;  2L3Q A;  2BUD A;  2E70 A;  1VYV A;  3H0H A;  1ZUU A;  2LTO A;  2GQI A;  2KSS A;  4ELY C;  1WHL A;  3EG9 B;  1VQL Q;  3KFV A;  2QAZ A;  3NTH A;  4HKE A;  3JB9 D;  3RBB B;  1OX8 A;  2XI9 A;  3JB9 G;  3HHT B;  2DRM A;  4LDX A;  1MGQ A;  4F14 A;  4E7Z A;  4C92 A;  2ZPF B;  1CKB A;  4OB0 B;  3EGX B;  2ZPE B;  4KGV B;  3OYA A;  4ZGJ B;  1VQP Q;  5HK3 A;  1MV3 A;  2KNB B;  4RTZ A;  3JCM c;  4C0F A;  3S6W A;  4M78 B;  3EFR A;  1E6H A;  2DEU A;  1JXO A;  5IXF A;  3ASK A;  4IUP A;  2QEX A;  3G4S T;  5FWB A;  2HL3 A;  2V1R A;  2EPD A;  4FSX A;  4AFZ C;  2VKN A;  2HKN A;  4RTY A;  4LD9 K;  1GL5 A;  2X35 A;  1KQS P;  2YXY A;  5CVI A;  4KGX B;  3CCJ A;  1H8K A;  2A3L A;  2JTF A;  2KDS A;  4E7J A;  3MEA A;  4MML A;  1KC8 R;  2F5K A;  2FRY A;  4HCB A;  1BI3 A;  2EVR A;  3A8G B;  2YUO A;  4JRP A;  1YHQ A;  3R6O A;  1D3B B;  4M78 C;  4M7A E;  1IGQ A;  1U06 A;  2EBP A;  4M75 G;  3UT1 A;  1OU9 A;  4OB3 B;  1ZSZ C;  3UWN A;  2EKO A;  2X4J A;  2K3X A;  5GAN 7;  1WHK A;  2CH4 A;  2KR3 A;  1VQ9 A;  3UA6 A;  3PMI A;  4HVW A;  3VRZ A;  3FDR A;  1XTD A;  1MV0 B;  3E2U A;  3VS3 A;  4QKU A;  1HJD A;  2BZ8 A;  1NJI U;  1OPL A;  2AKL A;  5M9O A;  4M7D F;  1VQK A;  4JLG A;  1LJO A;  1WPY A;  2K9G A;  4Q5W A;  5I2M A;  3RUX A;  3ZL7 C;  4LN2 A;  3OBY A;  2F2W A;  1FMV A;  2DIQ A;  1WQW A;  1HXD A;  1BKB A;  3LX7 A;  2RNA A;  4DBF A;  1PD1 A;  2DM1 A;  1RLQ C;  1W1F A;  3M0S A;  2OX7 A;  5CKD A;  1RAD B;  1VQN T;  1I8F A;  5LJ3 g;  4M7D A;  1PG5 B;  5GAN 5;  1PRM C;  3LH0 A;  1YIJ A;  1WJS A;  5DY9 A;  2DX1 A;  2NUP B;  4ZN1 A;  1M90 C;  2V8J A;  4OGC A;  2OAU A;  5KYW A;  4JRI A;  5LJ5 g;  3L2Z A;  4IUV A;  3G4S Q;  1O75 A;  2P4R A;  2HSE B;  3NMZ C;  2QQR A;  5GAM f;  2KYM A;  4ZGE B;  3PMT A;  2ROL A;  4JRK A;  1I0C A;  3GIB A;  3CC4 Q;  2MIO A;  2EQI A;  1UJY A;  2RB6 A;  4D8K A;  2D8J A;  4IIO A;  1YIT A;  2EGA A;  4MDX A;  3EHQ A;  4PJL A;  5FU6 C;  2LVM A;  1OYX A;  4J9F A;  5GAO q;  1MND A;  3N5B B;  3OYK A;  2NUT B;  1V76 A;  2B8A A;  3CME T;  1AWO A;  4M77 C;  1RLP C;  3OBW A;  3DLM A;  2RJD A;  1SSH A;  1RAI B;  3CPW S;  4J6X A;  1GFD A;  1OZ2 A;  3J81 E;  1RAF B;  4XTY A;  2KVQ G;  1VQ5 T;  5GAM e;  1NZ9 A;  4A4H A;  1Y71 A;  2AZV A;  2QQS A;  3E1S A;  1EZZ B;  1M4Z A;  2BZY A;  3VS4 A;  2RMO A;  3VS5 A;  2E5K A;  1VYT A;  3MP6 A;  1VQ9 Q;  4BE0 A;  4ANJ A;  2ZPB B;  2LJ0 A;  2LT1 A;  5KH6 A;  1I07 A;  2ATC B;  3EFO B;  3ZBD A;  1B34 B;  5IHI A;  4M7A B;  5CQY A;  4X9D A;  1QWF A;  2QYZ A;  1VQ6 Q;  3JCM X;  1RAE B;  1WA7 A;  1QCF A;  4C8Q A;  4DBR A;  1Q81 R;  4JJB A;  1K73 C;  1KQ2 A;  1FMW A;  5CAI A;  3LGF A;  3EGD B;  4FYY B;  1M90 R;  3C94 A;  2QTV A;  1VUB A;  4C8Q C;  2FRW A;  2HBW A;  3CC4 T;  2L3S A;  2ZCF B;  1X27 A;  2DBK A;  3EGU A;  1NYG A;  2QDY B;  3G4S A;  2QGG A;  3U23 A;  3M0U A;  1A0N B;  2EGE A;  3D7S B;  1JQQ A;  4PLI A;  2E6N A;  3SWN B;  4ME7 A;  2JM9 A;  9ATC B;  2VGM A;  1SRM A;  4J7F A;  2DRK A;  3QWX X;  2RHU A;  2JJ9 A;  2R57 A;  5GAN h;  3QDF A;  3VYG A;  2JVV A;  3EFS A;  1R77 A;  4IKF A;  1QW1 A;  1M30 A;  1KQ1 A;  2OJ2 A;  1RAC B;  2IPO B;  2RQU A;  3V8J A;  3QYH B;  4L5G A;  2YSQ A;  5AYF A;  1BB9 A;  2EYX A;  2JXB A;  3C95 A;  1MMA A;  2YT6 A;  1UGP B;  1VQO T;  5CKE A;  2ROT A;  2P0K A;  2LQ8 A;  2FPD A;  1SPK A;  2XD0 A;  3CEY A;  5GAN d;  4RTV A;  4PJN A;  2GFA A;  2G6F X;  4ZGD B;  3OW2 S;  2V8I A;  2XKO C;  2E3H A;  1BCO A;  3KUF A;  4DOW A;  2J7I A;  2D0N A;  2KE9 A;  4EMK A;  1VQ6 T;  1UG1 A;  2KGT A;  4MZM A;  1QCO A;  1B3Q A;  4LE9 A;  1K1Z A;  3OYD A;  2HDA A;  5GAN f;  4DA4 A;  2CT3 A;  1TS9 A;  4J6Y A;  3CBM A;  2DYB A;  3ZFJ A;  4M7D C;  2DAQ A;  1O9S A;  3VRY A;  1C0M A;  2K79 A;  3CXC S;  4M75 E;  2JZ2 A;  3A8M B;  3TCJ A;  4CRI A;  1KC8 U;  2PVD B;  3LGL A;  2DPP B;  2K3B A;  1N5Z A;  3VS6 A;  1HSQ A;  1XQH A;  2KK4 A;  1VYU A;  5D6X A;  1SHG A;  3TU4 K;  2KMT A;  1VIF A;  4RKU E;  4ZN3 A;  1YFN A;  3E9G A;  4OB2 B;  1WFW A;  4ELZ C;  4HCZ A;  4CC2 A;  2DIG A;  2WSE E;  1GFC A;  2JTM A;  4MMK A;  4N0A C;  2CP3 A;  4RCC A;  2HMA A;  2QI2 A;  1RAG B;  1D0Y A;  2YRV A;  2COY A;  2EW3 A;  1NEG A;  3TQ7 P;  1WHH A;  1Y57 A;  3JB9 I;  2C0I A;  2X9H A;  4F16 A;  2NWM A;  4Z89 A;  4PNO A;  2CUB A;  3M58 A;  2BKD N;  2DKG A;  1Y0M A;  3G6E T;  2DJQ A;  5IH2 A;  4PJO D;  2DLP A;  1SEM A;  3CCQ T;  2CGH A;  3CPW P;  3LH5 A;  2RQR A;  2A7Y A;  3GLX A;  1NBE B;  3S3M A;  2QA4 Q;  1VQO Q;  3M9Q A;  4MZT A;  2DL5 A;  4M7A A;  3CMA A;  2VAS A;  4YTL A;  1UHC A;  2KXC A;  2KT8 A;  4M75 F;  3EG3 A;  2QQA A;  4PJO F;  2VYT A;  3VS7 A;  2SRC A;  2JS0 A;  3V7R A;  2FO0 A;  1LCK A;  3UPU A;  2LQW A;  1RAB B;  1IRX A;  2E6Z A;  2X3X D;  4M78 G;  3CCJ T;  2FPF A;  2PTK A;  2HD0 A;  1R8O B;  4D8D A;  3QO3 A;  2VC8 A;  3OMG A;  4BE1 A;  4RTT A;  3CD6 T;  2LX9 A;  4RG2 A;  2GQV A;  5FRM A;  1TSF A;  2MWP A;  5FU7 B;  2O9S A;  1M2O A;  2HQE A;  2DL7 A;  2L89 A;  4M7D B;  1I5O B;  3L2R A;  3TVT A;  4JPB W;  1KK7 A;  1QVG A;  2FEI A;  2K4Y A;  1ZX6 A;  2YUQ A;  3CC2 A;  3QSU A;  2OTL A;  2DTI A;  3RMS A;  4F04 B;  3ER0 A;  1PWT A;  1UE9 A;  1TOV A;  3CPW A;  3CCU Q;  1UEB A;  3E9F A;  1D09 B;  1JEG A;  1WXT A;  4R0K A;  3CCS Q;  1IGU A;  2YDL A;  2DTO A;  3TRE A;  2ED1 A;  3HFO A;  4M4Z A;  3JCM P;  3X25 B;  4E7L A;  3NFC A;  1H3H A;  2KEA A;  2DVE A;  1UB4 A;  1QVF P;  2DXC A;  1UJ0 A;  4XAX B;  3MEU A;  2MCN A;  5FW9 A;  4GY5 A;  5FRO A;  5I21 A;  1AVZ C;  1QVF S;  1PC0 A;  2K3Y A;  2JNG A;  3FLG A;  1M1K C;  1V29 B;  2K7A A;  1VQ4 T;  1CKA A;  3M59 A;  3WVE B;  2L2P A;  1OPK A;  4C8Q G;  4OB1 B;  3CCS A;  3CPF A;  2GTJ A;  1Q7Y C;  3UDC A;  4JRQ A;  3QUI A;  3O5Z A;  1KJW A;  3OYB A;  2LMJ A;  4JLI A;  3LYI A;  1QVG P;  2R5A A;  3EG9 A;  4C92 D;  1T3L A;  3MKD A;  2VVK A;  2GFU A;  2JUF A;  2CH4 W;  1KG1 A;  3OYF A;  4E47 A;  2RN8 A;  1VA7 A;  1PCX A;  2QQB A;  2DER A;  4F7U A;  3C12 A;  4LDU A;  4BY6 B;  5CQX A;  1G2B A;  1X69 A;  3C0C A;  5A2Q E;  2R5M A;  4J9B A;  5CR2 A;  3QPH A;  3X26 B;  3A1P A;  1Z9Z A;  3VYH B;  1MMG A;  2V8K A;  1B34 A;  5GJV B;  2L5Q A;  4KH1 B;  1RL2 A;  1VQ8 T;  3CCV T;  4ZNX A;  5LJ5 h;  1PM3 A;  1KQS S;  2J06 A;  2JMC A;  2EJ9 A;  1X6B A;  2CYZ B;  2DET A;  2NLU A;  4LDW A;  2HCK A;  2FVU A;  1EFN A;  4XU3 A;  3L1A A;  1VQM T;  1S72 Q;  1BK2 A;  5DLO A;  5LJ3 j;  3M5A A;  3OSV A;  5I2S A;  2V26 A;  4LUE A;  1G3T A;  1TWB A;  5KCO A;  3EHR A;  1NEB A;  1NLO C;  4EMK C;  1WQ7 A;  2VV5 A;  2QEX T;  3L42 A;  4BY6 C;  3CCS T;  4ATO A;  1M8M A;  2JOY A;  2DE0 X;  4PJM A;  3H9N A;  4NL3 A;  2CZ7 B;  1KQS A;  2OTL T;  5KYN A;  2E65 A;  3WVD B;  4E7S A;  2RI2 A;  3EGD A;  3VS0 A;  4LNP A;  4EIK A;  2DXU A;  4KUI A;  2HZY A;  3JCM d;  4OGE A;  3MHX A;  2GNC A;  3URG A;  3OA6 A;  1JO8 A;  4FM4 B;  1YJN A;  4PJO A;  1UGV A;  4L59 A;  1BI0 A;  4PJO B;  2EYY A;  4HT8 A;  4PFP A;  5LJ5 j;  1JRI A;  2GGR A;  2J6K A;  3GPL A;  1YP5 A;  5GAM d;  3JCM f;  1X01 A;  1E6G A;  1BIB A;  4F17 A;  5GAO m;  1XOV A;  2VUB A;  1OU8 A;  4M77 A;  4A4E A;  5HK0 A;  3CXC P;  3H8Z A;  3SB2 A;  2RHY A;  3BFM A;  3CCV A;  1KD1 U;  2EQU A;  1TUC A;  2E10 A;  1VQN A;  2OTJ A;  2O4X B;  5HKC A;  1YBY A;  4J9H A;  3HRS A;  2C0O A;  2COZ A;  1AWJ A;  2DD4 A;  2H3J A;  1IHW A;  2WAC A;  4AFQ C;  1QLY A;  4AFS C;  4M75 B;  1K8A C;  1WNL A;  3CQT A;  4ORZ A;  5J39 A;  3CMA T;  1VQK T;  4HCC A;  3X24 B;  1M8V A;  3CCV Q;  2DL3 A;  2YUN A;  4C0Z A;  3CCU A;  3L2U A;  2C06 A;  4C8Q E;  1F1B B;  1RUW A;  2LRQ A;  4WTO B;  1ZSZ B;  1OEB A;  4M78 F;  2DBM A;  2RO0 A;  1Y96 A;  2LNH B;  1S72 T;  3F70 A;  4E6R A;  3OS5 A;  1KIK A;  1K0X A;  3GNG A;  2O88 A;  4VUB A;  5A0G A;  3JRZ A;  3KBG A;  1PKS A;  4FYW B;  1WDX A;  2XK0 A;  1MMN A;  1UFF A;  5D6W A;  3MJX A;  2R58 A;  4LDY A;  2E4H A;  1QVG S;  3EH1 A;  1M2V B;  5DLQ E;  1OX9 A;  2D0Q B;  3VUB A;  2ZPI B;  3P8H A;  2OTL Q;  3V7S A;  1FYN A;  3EG0 A;  3MET A;  2RK2 A;  1VOM A;  1B7T A;  1G3Y A;  4PK4 A;  3I35 A;  2A36 A;  1W2B S;  1K73 U;  2OTJ T;  3BE3 A;  1NE8 A;  4M7A F;  3O8V A;  1IO6 A;  3MEV A;  2H3E B;  2F2X A;  5J3B A;  1UEC A;  5LJ3 e;  5GAN 2;  1H3Z A;  5LJ5 d;  2M02 A;  2RHZ A;  4QQG A;  4J83 A;  4X34 A;  4Z8A A;  1U8R A;  1RI9 A;  1AZG B;  1YJW Q;  4JS4 A;  3PIP A;  2WSF E;  4A53 A;  3RER A;  2CP7 A;  2DJZ A;  3OSS C;  4IUR A;  2LCL A;  5KCH A;  4RG8 A;  1VQL T;  3CCM A;  3JB9 F;  2RA2 A;  5GAM g;  3PVQ A;  2O9V A;  3CC7 T;  2BTT A;  2OI3 A;  5KYU A;  5IAY A;  2NUZ A;  2DYI A;  2FYK A;  2X3W D;  2GCX A;  3OS2 A;  5LL6 S;  1YIT T;  4EMH A;  2RJF A;  4DQ2 A;  1S72 A;  5GAO p;  3PNW C;  3VU3 C;  2VB6 A;  3TSZ A;  1Y7X A;  2FB7 A;  4DEY A;  4PJO G;  1BBZ A;  1Q81 U;  2JT4 A;  4BUG A;  4BI4 A;  5GAM j;  2MOX A;  2NYS A;  2A37 A;  1QP2 A;  1N8R R;  3CCM T;  5EG2 A;  4PKC C;  4CI0 C;  1JJ2 A;  2X4X A;  1BI2 A;  3OYE A;  2RI5 A;  3QJY A;  1ZA1 B;  4HT9 A;  3AHU A;  4PJO E;  3C4S A;  2HQX A;  2BZX A;  2LZ6 B;  1D1B A;  4OML A;  4OMF B;  4IIM A;  4KH0 B;  4RTU A;  4M7A D;  4R56 A;  3OYH A;  1G3S A;  2DVJ A;  2Y4Y A;  1WZO A;  2JMA A;  1G8X A;  7AT1 B;  2PZ1 A;  3A8H B;  4JJC A;  4DBH A;  5LJ3 h;  4XTZ A;  1YI2 Q;  3X20 B;  2EIF A;  3AT1 B;  1PRL C;  1TTH B;  4A4K A;  2OTJ Q;  3CBP A;  1W2B A;  1KD1 R;  2P0P A;  4N4I A;  2CS7 A;  2LQN A;  4Y91 A;  3CCL Q;  2ESW A;  1BIA A;  1N9R A;  3L2Q A;  2K6D A;  3UF4 A;  4RTX A;  4FW1 A;  2MPX C;  4BI8 B;  1ZSZ A;  4GBQ A;  4F7U G;  1TG0 A;  1YJW T;  3GP8 A;  4NOY A;  2CP6 A;  3OS0 A;  3OYI A;  4FYX B;  4GLM A;  1JBM A;  5LJ3 d;  4C8Q F;  4KGZ B;  1JXM A;  1GXI E;  3V8L A;  5IXB A;  3CC7 Q;  4C92 C;  4EMK B;  2DMO A;  3EGX A;  1K8A R;  1ZHI A;  3BW1 A;  2RQW A;  2QXF A;  3JCM g;  1YIT Q;  1MUZ A;  4M75 C;  1VQN Q;  1Y96 B;  2E41 A;  3QDR B;  3QBY A;  1HD3 A;  3CCE T;  2V1Q A;  2XID A;  3CCM Q;  5ECA A;  2MF2 A;  2RF0 A;  2LJ3 A;  1WHG A;  4E7K A;  2LX7 A;  5GMK l;  2JW4 A;  1K0S A;  4O6J A;  1AEY A;  1Q82 C;  2KRN A;  4CC4 B;  2I2L A;  3QXE B;  1NG2 A;  3CD6 A;  2RJE A;  2RQV A;  4UC4 A;  1YJN Q;  4C92 E;  3PVL A;  2DL8 A;  1Y07 A;  3EFO A;  2HQH A;  3HL8 A;  5GAN g;  2AIR B;  2FZK B;  2DO3 A;  5GAO r;  2COW A;  4PLL A;  2EGC A;  1KHC A;  3SWN A;  3RKY A;  1MMD A;  3CME Q;  3R6N A;  1Q95 G;  1UGS B;  3J80 E;  4JS5 A;  4QQ6 A;  2AK5 A;  1FXX A;  2PUO B;  3PT9 A;  3CCL T;  1NPP A;  2DIL A;  2FHD A;  3QZ5 B;  2DXT A;  2IVW A;  3GBQ A;  3JB9 J;  5GMK m;  4IUT A;  1R0C B;  4M77 B;  4ESR A;  3UA7 A;  2EQJ A;  1ZQ1 A;  1W4S A;  3L2W A;  3H6Z A;  1AD5 A;  1YWO A;  2VXF A;  4CC3 A;  2I0N A;  2KXD A;  4IUQ A;  1PSF A;  1VQ9 T;  4M7A G;  3QII A;  1K4U S;  1WHJ A;  1QWE A;  3M54 A;  2JM8 A;  1NJI R;  2ECZ A;  3X28 B;  1N6A A;  2KRS A;  3M53 A;  1IB8 A;  3S3O A;  4FSS A;  1D0X A;  2EJF A;  3QG1 A;  2DFU A;  4L6V 5;  3CCR A;  2EQK A;  1KSW A;  2ZZD A;  3OYJ A;  4QW2 A;  4AFU C;  3I9Q A;  2F69 A;  2K5I A;  4A4F A;  2HKQ B;  4RMO A;  1Q7Y U;  4C5E A;  3Q1J A;  2CDT A;  2E12 A;  1GCQ A;  4NL2 A;  1QVP A;  4M77 D;  3M0Q A;  3SHW A;  1YI2 A;  5KYX A;  2K2M A;  1Z9Q A;  3G6E A;  4LDV A;  4BE2 A;  2ABL A;  4EDU A;  1JB0 E;  1X2Q A;  5CIU A;  4J9G A;  2QDL A;  1M3A A;  5FWC A;  4A63 B;  1VIE A;  3M4Y A;  3A8L B;  3RDV A;  3ZEH A;  1YN8 A;  2XDD A;  3JCM J;  2CZ1 B;  2FL7 A;  3GF5 A;  2P84 A;  1QVF A;  4V2S A;  3SEM A;  4M77 E;  3HTR A;  4J7I A;  3LW5 E;  2NUT A;  3HFN A;  4XTV A;  4HVU A;  5CO7 A;  1WXU A;  5IHK A;  1YHQ Q;  2J6F A;  5HCK A;  3CME A;  5FLX E;  3JCM h;  2D1X A;  3QKJ A;  2O31 A;  4TVR A;  3JCM V;  1RAA B;  2FG0 A;  3IQL A;  5GAO l;  1PD0 A;  2AHJ B;  8AT1 B;  4C0D B;  4XU0 A;  2VGN A;  2PVO B;  4AMC A;  5GAN 6;  1GCQ C;  1M3B A;  3DKM A;  3QHS A;  1EIF A;  1T0J A;  1MNE A;  1ZUY A;  2XMF A;  1NPR A;  2C0T A;  2D9T A;  4QT7 A;  2LCS A;  5GMK j;  5GAN 8;  5L8R E;  1SSF A;  5KYY B;  1T3S A;  2M1H A;  1QCN A;  4M75 D;  2PUK B;  4X9C A;  2X4Y A;  3OQ5 A;  2VXE A;  2EKH A;  2P0Q A;  1ZLM A;  2KBT A;  2E5Q A;  4HA8 A;  5GAN j;  4ZTJ A;  3CBO A;  2EAY A;  1NJI C;  4FYV B;  2A0F B;  4IUU A;  2E3I A;  3A98 A;  1OV3 A;  2PQW A;  2M0Y A;  2J05 A;  1LOJ A;  3LLR A;  2DNU A;  2FZC B;  3RIR A;  2OAW A;  2Y4X A;  3G71 A;  1YCS B;  1VQM A;  4DOV A;  2W10 A;  2DZ9 A;  2WSC E;  1N8R C;  3HPW A;  1Q7Y R;  1I4K 1;  3OYL A;  2RJC A;  4JDS A;  1K9M R;  3CC4 A;  2F1L A;  2L3R A;  1LNX A;  1QQJ A;  2X51 A;  1W6X A;  2HEQ A;  3GOX A;  2P4T A;  1EX4 A;  1ZBX A;  5LJ5 f;  4FT4 A;  2HSP A;  4WF2 A;  2A28 A;  2RHI A;  3TEE A;  5KYU B;  3GNF B;  1FWZ A;  1ARK A;  1YJ9 Q;  4OVA A;  2J6O A;  4JJD A;  8ATC B;  2K2V A;  3G6E Q;  4NS5 A;  1YWP A;  2DZC A;  2X4W A;  3BDU A;  1DJ7 B;  1VQ5 Q;  4FU6 A;  4EMG A;  1YHQ T;  1QP3 A;  4OMP A;  3J7A F;  4M7A C;  4Z88 A;  1YIJ T;  4JZ4 A;  3RES A;  3M0P A;  5GMK e;  1G3W A;  4E7I A;  4PJJ A;  1C1A A;  3EH2 A;  3JCM Q;  4O5V A;  3H41 A;  3CXC A;  2RH2 A;  2JTE A;  1Q82 R;  1UHF A;  1WX6 A;  2KYB A;  3CCJ Q;  1S1N A;  1ZSG A;  2L0A A;  3OY9 A;  4XU2 A;  2BIV A;  1K8A U;  3CD6 Q;  2F2V A;  2SEM A;  1YJW A;  2EYQ A;  4F7U F;  2LNV A;  1YNZ A;  3OMC A;  1QMC A;  3HRU A;  3P8D A;  2BE7 D;  3DB3 A;  1BI1 A;  3OW2 A;  1AT1 B;  3CCU T;  5GMK h;  4C92 B;  2JS2 A;  1VQ4 A;  1NLP C;  2AZS A;  2G3R A;  2YUP A;  3PFS A;  1Q86 R;  4N4G A;  5IN1 A;  1JJ2 S;  4EPC A;  1TU0 B;  3FIF A;  3CCE A;  5GAO n;  2EJG A;  3UAT A;  3RKX A;  2M51 A;  3A8O B;  4CC7 A;  1XNI A;  4Z02 A;  2EYW A;  1ZA2 B;  4M78 A;  3THK A;  4JJN K;  2LQK A;  1OZ3 A;  5KE3 A;  2O2O A;  5FU6 B;  1BU1 A;  2CKK A;  3TSW A;  2RHX A;  3JAM E;  1VQ4 Q;  1YJ9 T;  4J5Y A;  3VJP A;  2CRE A;  5I22 A;  4M7D G;  3M55 A;  1GBQ A;  3MP1 A;  1OUL A;  3HKS A;  2QAS A;  4JZ3 A;  1VQP A;  3HRT A;  1IRE B;  4J8O A;  4N0A A;  1YIJ Q;  4OP0 A;  5CKB A;  3RMQ A;  4FT2 A;  3L2V A;  4XTW A;  4KUL A;  3CCR Q;  1U1S A;  1TH7 A;  2L3P A;  4PFZ A;  1GCP A;  1AOJ A;  4Y92 A;  4DBQ A;  1D3B A;  1ZUK A;  4J9D A;  3RR6 A;  2NUP A;  1D0Z A;  4AG1 C;  1SF9 A;  5IHN A;  4M7D D;  4M78 D;  4RTW A;  2XIC A;  4F7U E;  3M57 A;  1G83 A;  1OI1 A;  1X6O A;  1ABO A;  1LVK A;  3ULR B;  4LXC A;  1U5S A;  1TUG B;  3FRN A;  1WGS A;  1UGR B;  4Y28 E;  1Q81 C;  2HBP A;  4M75 A;  1VQM Q;  3BDL A;  2PU9 B;  1SHF A;  1UDL A;  2EYZ A;  2GF7 A;  2QQ9 A;  3I55 Q;  1PHT A;  2YLC A;  3MP8 A;  2CP0 A;  4QVC A;  4HXJ A;  2A08 A;  2K5F A;  1H92 A;  2KT1 A;  4FL6 A;  1WXB A;  4M78 E;  1K76 A;  2ZPH B;  2DF6 A;  4E7H A;  3JCM b;  2RPN A;  4E2F B;  3V8K A;  1D1C A;  2YLB A;  2KRM A;  4QQD A;  5A0D A;  1M90 U;  5C0M A;  4C0G A;  3OS1 A;  1X43 A;  3S3N A;  1CSK A;  3NGP A;  4K11 A;  1PSE A;  3SWN C;  5CKH A;  3M56 A;  1M3C A;  1NYF A;  1I1J A;  1PNJ A;  3EAE A;  3CCQ Q;  2MAM A;  1VQ6 A;  1NM7 A;  3LWH A;  4PFO A;  3FC3 A;  4QVD A;  2H8H A;  3OYN A;  2QA4 T;  4C92 G;  2B86 A;  4X1V A;  2MI6 A;  3CCR T;  1E7O A;  2MK5 A;  3OYM A;  1KFZ A;  3NPF A;  1QKW A;  1YJ9 A;  1V1C A;  1AZE A;  1PKT A;  2CSQ A;  4HCK A;  4KBM B;  5L23 A;  2QGF B;  3QYG B;  1FMK A;  4C8Q D;  5HY6 A;  1Q86 C;  1WJR A;  3CCQ A;  1N9S A;  2KQW A;  1M1F A;  4OMN A;  3CMA Q;  2QK0 A;  1K73 R;  1KHI A;  3MEW A;  1H64 1;  2YHT A;  2RQT A;  3G71 Q;  5J26 A;  1VQO A;  4M7D E;  4C8Q B;  2KY9 A;  2RM4 A;  3G1J A;  3EG2 A;  3INZ A;  5KYY A;  3SFM A;  2CSI A;  2EWN A;  2ZAE A;  4DEX A;  3CC7 A;  2HAX A;  2W0Z A;  3FJ5 A;  1X75 C;  5D7U A;  4PL6 A;  4F7U B;  1G5V A;  3I55 T;  4KRT A;  1KC8 C;  2LDM A;  4FIB A;  4KT0 E;  3I5S A;  4A54 A;  4BAC A;  1IZ6 A;  2IG0 A;  2MWO A;  4C0D C;  2CP5 A;  2KAF A;  3REB B;  1TUD A;  2YRC A;  4RCB A;  5I11 A;  3PIO A;  4J9E A;  5GJW B;  3PE0 A;  4BI3 A;  2GTO A;  1VQ7 A;  2XDB A;  1IXD A;  4M77 F;  1B07 A;  4C5H A;  1X6G A;  2CZ6 B;  1XJW B;  1K9M U;  3SD4 A;  1VQ5 A;  1M1G A;  1M5Q 1;  2LC4 A;  2O4X A;  3P8B B;  4J9I A;  2F5T X;  3MCA B;  1AWW A;  3JCM W;  2CUD A;  4MZP A;  4PJO C;  5CK9 A;  4BDY A;  1MHN A;  1RAH B;  5KYX B;  1UGQ B;  1RI0 A;  1WHM A; 
#chains in the Genus database with same CATH homology
 1OUL A;  1OX9 A;  1ZSZ C;  2QAS A;  1OU9 A;  1ZSZ B;  1OU8 A;  1TWB A;  1YFN A;  2QAZ A;  1ZSZ A;  2NYS A;  1OX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...