1TWBA

Sspb disulfide crosslinked to an ssra degradation tag
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
b'SSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVECVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B homolog
molecule tags Hydrolase
source organism Haemophilus influenzae
publication title Nucleotide-Dependent Substrate Handoff from the SspB Adaptor to the AAA+ ClpXP Protease.
pubmed doi rcsb
total genus 26
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1twbA00
1TWBA 2NYSA 1OU9A 1OULA 1YFNA 2QAZA 2QASA 1OX8A 1ZSZC 1ZSZA 1OU8A 1OX9A 1ZSZB
chains in the Genus database with same CATH superfamily
2M0OA 4BY6B 2IG0A 4A63B 2HMAA 2HEQA 3UDCA 1K8AR 1Y7XA 5GAMj 8AT1B 3CCUA 5FU6C 1M5Q1 5A0LA 2D6FA 2YDLA 3L2VA 5HK0A 2ED1A 4FYXB 2X4YA 2RHZA 3HFOA 1YITQ 3EAEA 4C92A 2E5QA 2L8DA 3GF5A 2R5MA 2NUTB 2KXDA 1WGSA 3CEYA 1UUEA 2J05A 1WHLA 4FSSA 1JBMA 4Z89A 2DLPA 2EW3A 4PK4A 3G71Q 1TWBA 3VS7A 2A3LA 1HYOA 1BCOA 4HCKA 4DA4A 1D3BA 1VQNT 2DTHA 1U06A 2EQUA 2P0QA 3JB9I 3OYCA 3JCMf 4PJOF 2HSPA 2FPDA 2GFUA 1VQ6Q 4J83A 1VQ8A 2LX9A 4LDYA 2DEUA 2DK3A 2X35A 4KUDK 3S3OA 2YUNA 2K5IA 3CBPA 2KDSA 2RQRA 1VIEA 3H9NA 2PVGB 1PD1A 2NUPB 4HKEA 3JCMh 1MNEA 5GAN2 1BI0A 2MPXC 4XTYA 2RD1A 2GF7A 1VUBA 2DTIA 5GAOl 1J3TA 2LNHB 3GOXA 3OYYA 2ED0A 2AHJB 4C92F 3E2UA 2O4XA 2QTXA 1NBEB 2XIDA 5LJ3h 2CUBA 2FZKB 3GP8A 2V8JA 4PKCC 3JCMc 1WZOA 2EGCA 5CKHA 5HK3A 5C6SA 3CC7T 2RQWA 2CH4A 3VS1A 4ESRA 2X51A 3CD6T 4IUTA 1U5SA 2V8IA 1RAEB 1KQ2A 4HCZA 2E5KA 1D1BA 4C92C 4MZPA 4LDWA 1VQ4Q 3RUXA 1WFWA 2PU9B 2I2LA 3VS2A 2O88A 2VC8A 1ZA1B 4C8QA 3DB3A 1XNIA 2A0FB 3E9FA 3CCUT 2F2VA 1G3YA 4DBHA 3M57A 1JJ2P 2EYWA 4HT9A 3JCMg 1M2VA 3EHQA 2L3PA 2VGNA 2LRQA 5GANg 1ZUYA 2IIMA 2RN8A 3JCMX 3C0CA 1VQKQ 4MDXA 4J7FA 5HY6A 2JNGA 2RI5A 5GAN4 1YJNQ 1ZUUA 4E6RA 2CT3A 1D09B 2XDDA 2KK4A 1WXTA 1YI2A 1Q86R 4J6XA 2QK0A 4N4IA 2DXCA 4J6WA 4II1A 1SRMA 2JTMA 1OULA 2GQVA 1IHVA 1X75C 1N8RC 2QQSA 2WSFE 1FX7A 1VQ5Q 1PSEA 2J6OA 1H3ZA 2QDLA 1K8AU 2GQIA 5AT1B 2RI3A 4A4GA 4ELYC 2LQKA 2JZ2A 3NHNA 4JJDA 4IUQA 4B6MA 4IURA 5GAOp 4QKUA 4M75B 2AZSA 2MWOA 5KYYB 3HTRA 4X34A 2E1HA 4RUGA 2YRCA 4JJCA 1YJ9T 3OYKA 3OQ5A 3TU4K 2F69A 4M77D 2JVVA 4A4KA 1JEGA 1Q82U 1WXUA 3EH2A 4FIBA 4IUUA 3UPUA 4M7AF 1QCOA 2RJDA 1R8OB 2QQAA 4PFPA 4M75G 3I56Q 2LCLA 3PGGA 4FYYB 4C5GA 3KUFA 2EBPA 1WX6A 2YT6A 3HP9A 3HRTA 4XTXA 3JCMb 1M1FA 4C8QD 1NJIR 1KD1C 3JB9F 1E6HA 2VWFA 4DBQA 2DA9A 4M77G 2BUDA 2SRCA 1C6VX 4PFOA 3SD4A 3CCQQ 5CQXA 4D6WA 2DVJA 4O6JA 4J7IA 1BYMA 4C8QC 2QXFA 2PVOB 2LTOA 4R56A 2RB6A 3QJYA 3CCRA 3MEAA 5CKDA 2V8KA 2CS7A 1FXXA 2MMPA 3L2WA 3OYEA 3JB9G 1W4SA 1AD5A 2E4HA 4QQDA 5KE2A 5IXFA 2XDBA 2M9UA 1M90C 3HKSA 3SDZA 2HBPA 4BB7A 2PZ1A 1S72T 3JCMd 3M59A 2QQ9A 2RMOA 1M3CA 4JUVA 1NLPC 3G6EA 3FJ5A 3KFVA 3OW2S 3X20B 3CCSQ 1RLPC 3CBMA 4OB0B 3VKIA 1VQPQ 3JCMV 1YI2T 3SWNC 1VIFA 1WA7A 4BI3A 3OW2A 1B34B 4M77A 1BIBA 1W2BP 2OX7A 3BE3A 1BI2A 3RBBB 1KK7A 1KJWA 2OTJA 1K73R 2DRKA 3HRUA 4RTZA 2DL7A 3PIOA 2E64A 2D8JA 3C94A 4NS5A 2MYSA 1OYXA 2JN0A 2H3EB 2VXFA 2COWA 2HQEA 2QAZA 3OSVA 1PRLC 3L2UA 3KBGA 1K76A 1RI0A 5GMKm 2RQUA 5I11A 2KR3A 1YIJT 5LJ5e 2ZPBB 3VS6A 4AT1B 3CD6Q 2XK0A 1RAIB 4CC3A 1M8MA 1MV3A 3D7SB 2A37A 1PKSA 4KGXB 4HXJA 4PJOB 2A36A 1M90U 1K9MU 2A08A 2E10A 2KAFA 2RA2A 3MHXA 1WHKA 1AWWA 2FZCB 4LDUA 2HKQB 4FU6A 5J3BA 4AG1C 1YHQT 4J8OA 3C95A 4R0KA 4JJNK 3CC4A 1TU0B 4JPBW 1I1JA 4ZN1A 1PM3A 3CPFA 3G6EQ 5A2QE 1K9MC 5CKFA 3AHUA 4C5IA 2GBQA 2DD5A 4EMKA 1N8RR 1NEGA 1VQPA 3LH0A 3QO3A 4OMFB 3OY9A 1U1TA 3E1SA 4C0FA 1VQOA 3G71A 2DFUA 2O4XB 5FW9A 2EYZA 4LXCA 2HZYA 1YJNT 3CCRQ 3NMZC 3RKXA 4F7UB 2RO0A 4N4HA 1JQQA 1AZEA 3T9NA 3LW5E 1OZ2A 2V1RA 1VYUA 3I5SA 4J9EA 2CREA 1MGQA 2CP3A 1IHWA 2DBMA 4OGEA 3FLGA 4IUVA 1AHJB 2KGTA 1VQ6A 1N27A 1S1NA 2GGRA 1OX9A 2B8AA 1QW1A 4F7UG 4UC4A 2DYIA 3QSUA 2W10A 5GAMh 5I2SA 2KYBA 1X6BA 3META 1NE8A 4OMQA 1LNXA 1ZLMA 3A8MB 4M77C 3GNGA 3JCMJ 3OS0A 2RHUA 1VQMT 2DF6A 1Z9ZA 4OB2B 1PSFA 2L2PA 1CSKA 4B9WA 2RHXA 2MAMA 4DOWA 1W1FA 3QIIA 4XU1A 1YJ9Q 5GANh 3P8HA 2VYTA 2FZGB 4XU3A 1PD0A 2E65A 4OP0A 3CMAT 3M53A 4DQ2A 3CCVQ 4KT0E 3CCLA 2AIRB 3OB9A 2XKOC 1BK2A 4Y92A 3OA6A 4F16A 1LPLA 2ESWA 4XTUA 1BU1A 3CCMT 4K11A 1Q7YR 2DAQA 1PG5B 4XU2A 2KQWA 1VQOQ 1I5OB 4OGCA 2LP5A 3TEEA 2J6FA 1MMGA 4YTLA 2XICA 2FRYA 4CC2A 2LCSA 1YNZA 4Q5WA 2R5AA 3M58A 4QQGA 3JB9D 1WYXA 3EG0A 3VS5A 2H8HA 5LJ3d 2E6NA 3M0QA 4X9DA 1U8RA 4FL6A 2MIOA 4X9CA 2KY9A 3X28B 1A0NB 2G6FX 2LQNA 3J80E 2QASA 1TG0A 4EMHA 2MF2A 2AKLA 1S72Q 4LD9K 4M78F 4RTXA 1UGPB 3VYGA 1CKBA 4RG2A 1HSQA 2RK2A 2F5KA 4V2SA 2RH2A 1X69A 2HCKA 4LDXA 3EG2A 4XQ3A 1YITT 1PKTA 2BZ8A 1N5ZA 2COYA 1K8AC 3M0TA 3S6WA 3V7SA 2DXUA 2L3RA 2LVMA 2RNAA 1IO6A 3JCMW 5KYUA 3C12A 2G3RA 2RF0A 7AT1B 4M75F 2BIVA 2L0AA 3REBB 1PC0A 2EQKA 4M7DF 5FROA 1D0XA 5CAIA 4L6V5 4M7AG 3OMGA 3NPFA 1ZX6A 2FPEA 1ABOA 1TS9A 5CO7A 2YLCA 1MHNA 3CCJA 2K9GA 4P5NA 1VQLT 3H0FA 5LJ5g 1ZSZC 2X9HA 2J6KA 3MEWA 3QZ9B 3RDVA 2D0QB 1Y0MA 3CCUQ 1WIEA 1JRIA 2CZ0B 5M9OA 4E7HA 4M78G 3ER0A 2D0NA 4OMMA 1SHFA 1VQ5T 1JO8A 2E12A 3A5ZB 1C0MA 5L8RE 1Y57A 2M0YA 3KXTA 1WHJA 5C0MA 1G3TA 1SSHA 1M2VB 3CMAA 1SRLA 2DJZA 3ZEHA 4ATOA 5I22A 3CCLT 4PJOC 1MUZA 1PRMC 3REAB 4DEYA 1G3SA 3R6OA 3M0RA 4M7DG 3GBQA 3E19A 2QA4A 4J9DA 1WNLA 2QEXT 4PJOE 5LL6S 4LD6A 2MWPA 3CCQA 2DL5A 1VQ8Q 1GCPA 1QWFA 3NTKA 1Q7YC 3CMEQ 1YIJA 1UGQB 1QMCA 1X6GA 2LJ1A 2KEAA 3CCSA 4J6YA 4OMOA 3CC2Q 3M5AA 3X24B 1VQ4T 5FU6B 5LJ5h 1X2KA 3JB9J 4E7KA 1NYFA 2P4TA 2R57A 1NLOC 4MMKA 2FRWA 5KH6A 4HT8A 2FG0A 1NJIC 4BD3A 4AFZC 4PJNA 1G2BA 3BDLA 2LNVA 3QBYA 1E7OA 1VOMA 2XI9A 3RKYA 2SEMA 3DKMA 1OV3A 1B3QA 3GLXA 3VS4A 2HKNA 2F2WA 3VV0A 4PJOD 5FWCA 5LJ3e 4JLIA 5FWBA 4BI8B 4FW1A 1HXDA 5A0DA 3CCEA 3G4SA 3RIRA 2ABLA 2AT1B 1H92A 1JJ2S 2JTEA 2QYZA 4QVDA 3CMAQ 2KRSA 1B34A 2A7YA 4M77B 3CC7Q 2DD4A 3WVEB 3I55Q 3OYFA 5CCAA 5KYXA 2QTVA 2DMOA 1VA7A 3JCMP 1H3HA 3VRYA 1LJOA 1KHCA 4IKFA 3ME9A 3A98A 4IIOA 3J7AF 2DM1A 4C92D 4C5EA 1Q82R 2E6ZA 4F7UA 2QQBA 2D9TA 5FRNA 2COZA 2CP7A 4VUBA 1V1CA 3CMEA 4JRIA 4EMGA 2F1LA 3MP1A 2K3YA 4FW2A 2JS2A 5GMKh 1UB4A 4LUEA 4C0GA 3X26B 3MKDA 4JRQA 1AOJA 2P0PA 4MZMA 2M02A 1BCMA 2RJEA 1M1KU 5GMKj 1O9SA 3MEVA 1IGQA 1W6XA 1YIJQ 2DIGA 2K57A 2QA4T 1MMNA 3QPHA 1TTHB 4M78A 3QYHB 2KE9A 5GAN3 2K5FA 1WQWA 2EQIA 3CC4T 1VQKA 2K79A 4C5HA 3QHSA 3RERA 4FT4A 4CRIA 5D6XA 3QDFA 3BY7A 2LQ8A 3FEOA 1FMVA 4M75E 3VU3C 2HQXA 3CCJT 4RCBA 1QLYA 3OBYA 4QVCA 3FC3A 1KQSS 3O8VA 1QVGA 1UHCA 2LJ3A 2E3HA 2X3XD 4LE9A 1TUCA 1ZBJA 2JJ9A 3QWYA 2PUKB 3CPWS 2M51A 4A53A 5IHKA 3LYIA 1YJNA 3A8GB 1KC8U 1NZ9A 2DERA 2NUPA 5IN1A 3X25B 2KI7A 3CCEQ 5KYXB 4WF2A 1GCQC 1KD1U 1Z9QA 1D0ZA 2GFAA 2PUOB 3MJXA 4RMOA 3V8LA 4C8QF 1YHQQ 2BZXA 5GAMe 4KGVB 4QQ6A 1RAFB 1UFFA 4FCYA 2NUZA 3NTHA 5L23A 3I56A 1UDLA 2DZCA 1QQJA 2HSEB 3EG1A 3ZBDA 2Y4XA 1YWPA 1YWOA 4JDSA 1ACMB 5GAOr 1QVGS 1QVPA 4JRKA 1NM7A 3PVLA 4QT7A 2OJ2A 4AG2C 2X4XA 1K73U 3CCMQ 2DJQA 1T0JA 1WHMA 2IPOB 5CK9A 3OYDA 2PVDB 2CSQA 1WXBA 2ZPEB 3S3MA 4LNPA 2W0ZA 1K4US 2R58A 5D6YA 3UA7A 1VQ8T 2HL3A 2ZPGB 1W70A 3L2QA 3MO8A 2K2MA 5IHIA 4GBQA 5J39A 1WQ7A 5KYYA 5GAN7 1NEBA 3CCRT 1M4ZA 4J9BA 4A4FA 4C8QG 3UATA 2CSIA 1SPKA 2EKHA 1BBZA 1T3LA 2CKKA 2ZCFB 1FMWA 1ZSZA 2M16A 3EG9B 2DIQA 5GMKi 4HA8A 2CZ6B 5GMKl 1HJDA 1RAGB 1RUWA 4XTZA 1SF9A 1NPPA 2LZ6B 4OMPA 3JV3A 4DEXA 3G6ET 4MDWA 1Q81U 2O01E 4IIMA 4KRTA 3NFCA 4ZTFA 2L89A 1JJ2A 1YCYA 1B07A 4ZNXA 5KYWA 1VQNA 4JJBA 1OPLA 3OYBA 2C0TA 3HPWA 4KULA 1OZ3A 3THKA 5CIUA 2DNUA 1Y96B 2KT1A 4KBMB 1M3AA 1X2QA 3DB4A 3RMSA 2CDTA 2QEXQ 1Q82C 2CP5A 1SHGA 2KYMA 4J5YA 1VQ9A 2OTLT 4GY5A 4X1VA 2MCNA 3NTIA 4C92E 3HL8A 1K73C 2FO0A 2CP6A 3I35A 3CMET 5LJ3f 1UGRB 1HK9A 3OYNA 4M77F 4RKUE 2C06A 2EYYA 3VRZA 3WXMB 1X6OA 3UT1A 1RAAB 3HSBA 1PCXA 2YSQA 2CH4W 4RTUA 4PJJA 4C0DB 2FPFA 2WSCE 3INZA 1D3BB 3GIBA 1Q86C 2O2OA 1U1SA 2OTJQ 1AVZC 5A0GA 1K9AA 2C0IA 2VB6A 5CKEA 2OAWA 2L3SA 2EGAA 3H41A 2QI2A 1IB8A 1M9SA 3EH1A 4B9XA 4Z88A 2FB7A 3CC2A 1DJ7B 3CCVT 3EGDA 1LVKA 1RAHB 3SEMA 1VQMA 5DLQE 1KC8C 5FRMA 2VVKA 1KQ1A 1I81A 1RACB 3A8OB 1GFCA 4F04B 1GXIE 2E3IA 1QKXA 4CC4B 3FJPA 1VQOT 3GPLA 1M90R 2DX1A 1UEBA 3MP6A 3F70A 2VV5A 4CI0C 2QGFB 1VQLQ 1M27C 3M54A 1I8FA 2JM8A 2DL4A 4FT2A 4DBRA 4EPCA 1OEBA 2BKDN 3OSSC 2DL3A 3LH5A 4C92G 1ARKA 2LC4A 2CUDA 4ELZC 1YN8A 1NJIU 1FWZA 3FB9A 5FLXE 4KH0B 1KG1A 2KT8A 2AKKA 1PWTA 2RK1A 4JS4A 3UA6A 5GAOn 4PJLA 4PL6A 4JZ3A 3QZ5B 4R55A 2FVUA 4OB3B 3EG3A 2K2VA 3LWIA 1OQKA 4FYWB 1ZHIA 4JRPA 4WCIA 1VYTA 5FU7C 3A8LB 1Q7YU 2L3QA 2KNBB 1RL2A 4BACA 2EFIA 1GFDA 5GANj 2QGGA 4PJOG 1UHFA 4BE2A 3V7RA 1WLPB 3QWXX 2AK5A 4PLLA 2L5QA 1ABQA 2GTOA 2OTLA 4KH1B 4N0AC 2K3BA 1VQ7Q 3CCLQ 3I55T 4BY6C 4M78C 3VS3A 1VQ9Q 4GLKA 2DL8A 2XG8D 4RTYA 4HCBA 3PMTA 1M2OA 3I5RA 5KE3A 4C0DC 4D8DA 3OYLA 5GANd 3EFOA 4M78E 3OS1A 2ZPHB 4XTWA 2NYSA 2DEQA 4DBFA 2AZVA 3PTAA 3QKJA 2BE9B 4RTVA 2YWWA 4J9GA 1GBQA 3RESA 2F5TX 3G71T 4BE0A 1ZQ1A 2DETA 1R77A 1I0CA 3OYMA 4JZ4A 1KQSA 3QJ6A 3OYHA 3CC2T 4L59A 1SG5A 4E7SA 4NL2A 1KIKA 1ZA2B 3S3NA 4M7DD 3TSZA 1Q86U 1IZ6A 2VXEA 4EIKA 1VQ6T 1D1AA 2KRMA 3WVDB 5GJVB 3MCAB 1TUGB 2D1XA 3QUIA 1IGUA 3SFMA 5DM7R 2K6DA 4OVAA 2NWMA 1V76A 1AT1B 1UE9A 1OPKA 2LJ0A 2ZAEA 5GAOm 2VKNA 1UG1A 1FMKA 3L42A 4GLMA 3CCJQ 5HCKA 5I2MA 1JU5C 4RTWA 3M9QA 4ANJA 1WI7A 3OMCA 4N0AA 2Z0WA 1NG2A 2LDMA 2YRVA 1KQSP 4M7AD 1LOJA 3TSWA 1WJSA 3LGFA 3BDUA 1X27A 2OTLQ 4XU0A 4PNOA 3QDRB 3H6ZA 3V8JA 1O75A 3CD6A 1YHQA 4RG8A 3R6NA 4FSXA 1R0CB 2HQHA 4ZGDB 3CCMA 1G8XA 4MMLA 3LWHA 1TXQA 2JTFA 4IUPA 4M7AE 3ZFJA 1VQ4A 1WDXA 4AFUC 3M56A 1IXDA 5GAMg 4KUIA 3A8HB 3CC4Q 4EMKC 3OW2P 3L2ZA 4FYVB 2YUQA 4BDYA 2E70A 5EG2A 1F1BB 3ASKA 4AFSC 4XTVA 2JMCA 5KYUB 2HL5C 4QVZA 1QKWA 4L5GA 3M55A 2RM4A 1OU8A 2CGHA 4F17A 1IREB 4PJOA 2EKOA 4M7DA 1CKAA 5GJWB 2DPPB 4M75A 1I5LA 3LGLA 1BKBA 4JLGA 2DBKA 1XOVA 1UJ0A 2KMTA 1WPYA 4HVVA 2JMAA 8ATCB 1D1CA 4N4GA 5GAN6 5GANe 1VQ7A 2XMFA 3CXCA 2RJFA 2YXYA 1TOVA 3UF4A 2FYKA 3CBOA 5FU7B 3H0IA 2HDAA 5IAYA 2VASA 4M7DB 3LX7A 2A28A 2K7AA 3DLMA 4E7LA 2ZZDA 1ZSZB 1ZUKA 2DYBA 1K9MR 3JSCA 1Y07A 1QVFS 3GNFB 2X4WA 1AZGB 1M1KC 2Y90A 2QA4Q 1IRXA 2Y4YA 3G4SQ 3JB9H 5J26A 2B86A 2VGMA 3PT9A 5CKBA 5IH2A 3EGUA 2QQRA 1SEMA 2EQMA 4C0ZA 1EX4A 5ECAA 1WHGA 2P4RA 4Z02A 2LX7A 5D6WA 4ZTJA 1VQNQ 2FHDA 5CQYA 2EJFA 1JB0E 2OI3A 3M0SA 3A1PA 4C8QB 9ATCB 1QVFP 1QCFA 3SWNB 1D0YA 2D8HA 4OMLA 4F14A 2DVEA 3QYGB 1NYGA 1G83A 4M7AC 4E7IA 2KBTA 2JT4A 3CC7A 4AMCA 3TQ7P 3SB2A 1VQ5A 3VYHB 3RMQA 3OYIA 2KSSA 5IHNA 1QP3A 4M7AB 1KFZA 5IT9E 3JCMQ 1UTIA 2RQVA 1BI1A 3I56T 1M3BA 1VQKT 1GL5A 5LJ5j 2LMJA 4ZGEB 3EGXA 1YJWT 3OS5A 5D7UA 1AWJA 1ZSGA 2ATCB 1N9SA 2ENMA 1S72A 2EYXA 5GMKe 3BFMA 5KCHA 2DRMA 2K3XA 2KXCA 3MEUA 3ULRB 1QVGP 2DXTA 1YP5A 3P8BB 3PVQA 2X3WD 1G3WA 1UGSB 2CP0A 1EZZB 5HKCA 2CZ7B 2J7IA 3BW1A 4Y28E 5GANf 3QG1A 3EFOB 5AYFA 3TCJA 5EC7A 3M0UA 1GRIA 2P84A 1QVFA 2JXBA 2KVQG 4J9IA 3PE0A 3H8ZA 1MMAA 1UGVA 3PFSA 2VUBA 3I55A 5KYNA 1M8VA 2RHIA 3V8KA 3OBWA 2EAYA 4BUGA 4DOVA 2JW4A 3PIPA 4M4ZA 2O9VA 4M77E 3I9QA 3MPUB 1V29B 2DZ9A 2PNIA 4CC7A 1OX8A 2JUFA 3N5BB 3EGXB 3OYAA 5GAMd 2J06A 2EIFA 1XTDA 1W2BS 1RABB 2BTTA 2YUPA 3L2RA 4F7UF 1H641 3HRSA 5LJ3j 2HNIA 5GAN8 2YRDA 1Q81R 4M7DE 1KSWA 4RTTA 4J9FA 4LN2A 4NL3A 3CCET 1AEYA 2FEIA 4M78B 1RLQC 4A54A 2H3JA 3VUBA 1X43A 4F7UE 2WSEE 2CP2A 2LQWA 2HBWA 1YFNA 3RR6A 2O31A 1UECA 5KCOA 4WTOB 4Z8AA 1TH7A 1HD3A 2DE0X 4A4EA 1RADB 4OMNA 2JOYA 2RPNA 3FDRA 1Y71A 2RQTA 4KGZB 1C1AA 3M0PA 2EWNA 2O9SA 2XDPA 2EJGA 3VS0A 5LJ5f 2CZ1B 1YJWA 4ME7A 5LJ3g 3CCST 2BE7D 2OTJT 1M1GA 1QP2A 2BZYA 3EFSA 3IQLA 2YLBA 6AT1B 1T0HA 3G1JA 2GCXA 3EGDB 3PMIA 1M1KR 2V1QA 1N6AA 3JAME 2K5LA 2MI6A 1G5VA 1XQHA 4M78D 1JXOA 4PFZA 1M30A 3OYGA 1XJWB 3CPWA 1UJYA 2XHCA 3EHRA 1MV0B 5IXBA 3U23A 3M4GA 1B7TA 1SKUB 4J9CA 5CR2A 2RJCA 3URGA 5DLOA 3CCQT 2EYQA 2ZGWA 1LCKA 1N8RU 1K1ZA 4QW2A 1K0XA 4LDVA 4XAXB 2EPDA 1GCQA 1H8KA 2EJ9A 2RI2A 3VJPA 1NPRA 2LT4A 1OU9A 4M75D 1I4K1 3G4ST 1TSFA 4BDZA 1YI2Q 2MOXA 4NOYA 4JS5A 2CT4A 2ZPFB 4RCCA 5DY9A 5I21A 3NGPA 1VYVA 3SWNA 2QG9B 3HFNA 2XU8A 1P92A 3C4SA 3TREA 1WHHA 1AWOA 2F2XA 2DILA 3MP8A 1GBRA 2NLUA 1SSFA 2GTJA 4E2FB 5KYWB 1YJ9A 2DKGA 2X4JA 4ORZA 1YBYA 1OI1A 2CYZB 3CCVA 2PQWA 1OOTA 2EQJA 4ZGJB 2ZPIB 2HAXA 1BB9A 3CPWP 1VQ9T 1T3SA 1EFNA 1Y96A 1YJWQ 1AWXA 2ROTA 4MZTA 2NUTA 4HVUA 1MMDA 2I0NA 3O5ZA 4C92B 3L1AA 4M7AA 1N9RA 1Q95G 4OF1A 4HVWA 2E41A 2EVRA 2GNCA 4PLIA 2QDYB 3PNWC 2DTOA 4E7ZA 2XD0A 2KROA 3FIFA 4Y91A 1KC8R 1E6GA 1BIAA 1EIFA 3M4YA 3QXEB 2M1HA 5GAOq 1X01A 1YITA 2HD0A 2C0OA 2PTKA 2DXBA 2LT1A 4LUDA 2IVWA 1R0BG 3AT1B 3EG9A 2QEXA 3DLLA 2YUOA 2WACA 4AFQC 2YHTA 2JM9A 1WJQA 1VQ7T 4HCCA 3VUZA 3SHWA 2ROLA 3HHTB 4FM4B 4EDUA 5LJ5d 2MK5A 1ZBXA 3JRZA 4E47A 3TVTA 2JS0A 2V26A 3OYJA 2RHYA 1KHIA 3LLRA 2LCCA 1VQLA 2P0KA 3G7ZA 3RKWA 1BI3A 2K4YA 1VQPT 1QCNA 4EMKB 1Q81C 1FYNA 2FL7A 4M75C 4A4HA 1MNDA 2EGEA 1TUDA 5CVIA 4M7DC 5GAN5 3CXCS 2KRNA 4TVRA 2OAUA 3P8DA 4BE1A 3FRNA 4C8QE 4ZN3A 4PJMA 2DO3A 3Q1JA 4OB1B 1WJRA 4BI4A 3RNJA 1QWEA 1K0SA 4XK8E 1W2BA 1VQMQ 3E9GA 3ZL7C 3EFRA 1YCSB 1PNJA 3UWNA 4E7JA 4O5VA 3CXCP 1RI9A 5GAMf 3CQTA 3H0HA 4J9HA 3OS2A 1U3OA 1PHTA 4D8KA 3JCMe 1KD1R 3J81E 1JXMA 3V7CA 2ECZA 1I07A
chains in the Genus database with same CATH topology
1TWBA 2NYSA 1OU9A 1OULA 1YFNA 2QAZA 2QASA 1OX8A 1ZSZC 1ZSZA 1OU8A 1OX9A 1ZSZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWB A;  2NYS A;  1OU9 A;  1OUL A;  1YFN A;  2QAZ A;  2QAS A;  1OX8 A;  1ZSZ C;  1ZSZ A;  1OU8 A;  1OX9 A;  1ZSZ B; 
#chains in the Genus database with same CATH topology
 2M0O A;  4BY6 B;  2IG0 A;  4A63 B;  2HMA A;  2HEQ A;  3UDC A;  1K8A R;  1Y7X A;  5GAM j;  8AT1 B;  3CCU A;  5FU6 C;  1M5Q 1;  5A0L A;  2D6F A;  2YDL A;  3L2V A;  5HK0 A;  2ED1 A;  4FYX B;  2X4Y A;  2RHZ A;  3HFO A;  1YIT Q;  3EAE A;  4C92 A;  2E5Q A;  2L8D A;  3GF5 A;  2R5M A;  2NUT B;  2KXD A;  1WGS A;  3CEY A;  1UUE A;  2J05 A;  1WHL A;  4FSS A;  1JBM A;  4Z89 A;  2DLP A;  2EW3 A;  4PK4 A;  3G71 Q;  1TWB A;  3VS7 A;  2A3L A;  1HYO A;  1BCO A;  4HCK A;  4DA4 A;  1D3B A;  1VQN T;  2DTH A;  1U06 A;  2EQU A;  2P0Q A;  3JB9 I;  3OYC A;  3JCM f;  4PJO F;  2HSP A;  2FPD A;  2GFU A;  1VQ6 Q;  4J83 A;  1VQ8 A;  2LX9 A;  4LDY A;  2DEU A;  2DK3 A;  2X35 A;  4KUD K;  3S3O A;  2YUN A;  2K5I A;  3CBP A;  2KDS A;  2RQR A;  1VIE A;  3H9N A;  2PVG B;  1PD1 A;  2NUP B;  4HKE A;  3JCM h;  1MNE A;  5GAN 2;  1BI0 A;  2MPX C;  4XTY A;  2RD1 A;  2GF7 A;  1VUB A;  2DTI A;  5GAO l;  1J3T A;  2LNH B;  3GOX A;  3OYY A;  2ED0 A;  2AHJ B;  4C92 F;  3E2U A;  2O4X A;  2QTX A;  1NBE B;  2XID A;  5LJ3 h;  2CUB A;  2FZK B;  3GP8 A;  2V8J A;  4PKC C;  3JCM c;  1WZO A;  2EGC A;  5CKH A;  5HK3 A;  5C6S A;  3CC7 T;  2RQW A;  2CH4 A;  3VS1 A;  4ESR A;  2X51 A;  3CD6 T;  4IUT A;  1U5S A;  2V8I A;  1RAE B;  1KQ2 A;  4HCZ A;  2E5K A;  1D1B A;  4C92 C;  4MZP A;  4LDW A;  1VQ4 Q;  3RUX A;  1WFW A;  2PU9 B;  2I2L A;  3VS2 A;  2O88 A;  2VC8 A;  1ZA1 B;  4C8Q A;  3DB3 A;  1XNI A;  2A0F B;  3E9F A;  3CCU T;  2F2V A;  1G3Y A;  4DBH A;  3M57 A;  1JJ2 P;  2EYW A;  4HT9 A;  3JCM g;  1M2V A;  3EHQ A;  2L3P A;  2VGN A;  2LRQ A;  5GAN g;  1ZUY A;  2IIM A;  2RN8 A;  3JCM X;  3C0C A;  1VQK Q;  4MDX A;  4J7F A;  5HY6 A;  2JNG A;  2RI5 A;  5GAN 4;  1YJN Q;  1ZUU A;  4E6R A;  2CT3 A;  1D09 B;  2XDD A;  2KK4 A;  1WXT A;  1YI2 A;  1Q86 R;  4J6X A;  2QK0 A;  4N4I A;  2DXC A;  4J6W A;  4II1 A;  1SRM A;  2JTM A;  1OUL A;  2GQV A;  1IHV A;  1X75 C;  1N8R C;  2QQS A;  2WSF E;  1FX7 A;  1VQ5 Q;  1PSE A;  2J6O A;  1H3Z A;  2QDL A;  1K8A U;  2GQI A;  5AT1 B;  2RI3 A;  4A4G A;  4ELY C;  2LQK A;  2JZ2 A;  3NHN A;  4JJD A;  4IUQ A;  4B6M A;  4IUR A;  5GAO p;  4QKU A;  4M75 B;  2AZS A;  2MWO A;  5KYY B;  3HTR A;  4X34 A;  2E1H A;  4RUG A;  2YRC A;  4JJC A;  1YJ9 T;  3OYK A;  3OQ5 A;  3TU4 K;  2F69 A;  4M77 D;  2JVV A;  4A4K A;  1JEG A;  1Q82 U;  1WXU A;  3EH2 A;  4FIB A;  4IUU A;  3UPU A;  4M7A F;  1QCO A;  2RJD A;  1R8O B;  2QQA A;  4PFP A;  4M75 G;  3I56 Q;  2LCL A;  3PGG A;  4FYY B;  4C5G A;  3KUF A;  2EBP A;  1WX6 A;  2YT6 A;  3HP9 A;  3HRT A;  4XTX A;  3JCM b;  1M1F A;  4C8Q D;  1NJI R;  1KD1 C;  3JB9 F;  1E6H A;  2VWF A;  4DBQ A;  2DA9 A;  4M77 G;  2BUD A;  2SRC A;  1C6V X;  4PFO A;  3SD4 A;  3CCQ Q;  5CQX A;  4D6W A;  2DVJ A;  4O6J A;  4J7I A;  1BYM A;  4C8Q C;  2QXF A;  2PVO B;  2LTO A;  4R56 A;  2RB6 A;  3QJY A;  3CCR A;  3MEA A;  5CKD A;  2V8K A;  2CS7 A;  1FXX A;  2MMP A;  3L2W A;  3OYE A;  3JB9 G;  1W4S A;  1AD5 A;  2E4H A;  4QQD A;  5KE2 A;  5IXF A;  2XDB A;  2M9U A;  1M90 C;  3HKS A;  3SDZ A;  2HBP A;  4BB7 A;  2PZ1 A;  1S72 T;  3JCM d;  3M59 A;  2QQ9 A;  2RMO A;  1M3C A;  4JUV A;  1NLP C;  3G6E A;  3FJ5 A;  3KFV A;  3OW2 S;  3X20 B;  3CCS Q;  1RLP C;  3CBM A;  4OB0 B;  3VKI A;  1VQP Q;  3JCM V;  1YI2 T;  3SWN C;  1VIF A;  1WA7 A;  4BI3 A;  3OW2 A;  1B34 B;  4M77 A;  1BIB A;  1W2B P;  2OX7 A;  3BE3 A;  1BI2 A;  3RBB B;  1KK7 A;  1KJW A;  2OTJ A;  1K73 R;  2DRK A;  3HRU A;  4RTZ A;  2DL7 A;  3PIO A;  2E64 A;  2D8J A;  3C94 A;  4NS5 A;  2MYS A;  1OYX A;  2JN0 A;  2H3E B;  2VXF A;  2COW A;  2HQE A;  2QAZ A;  3OSV A;  1PRL C;  3L2U A;  3KBG A;  1K76 A;  1RI0 A;  5GMK m;  2RQU A;  5I11 A;  2KR3 A;  1YIJ T;  5LJ5 e;  2ZPB B;  3VS6 A;  4AT1 B;  3CD6 Q;  2XK0 A;  1RAI B;  4CC3 A;  1M8M A;  1MV3 A;  3D7S B;  2A37 A;  1PKS A;  4KGX B;  4HXJ A;  4PJO B;  2A36 A;  1M90 U;  1K9M U;  2A08 A;  2E10 A;  2KAF A;  2RA2 A;  3MHX A;  1WHK A;  1AWW A;  2FZC B;  4LDU A;  2HKQ B;  4FU6 A;  5J3B A;  4AG1 C;  1YHQ T;  4J8O A;  3C95 A;  4R0K A;  4JJN K;  3CC4 A;  1TU0 B;  4JPB W;  1I1J A;  4ZN1 A;  1PM3 A;  3CPF A;  3G6E Q;  5A2Q E;  1K9M C;  5CKF A;  3AHU A;  4C5I A;  2GBQ A;  2DD5 A;  4EMK A;  1N8R R;  1NEG A;  1VQP A;  3LH0 A;  3QO3 A;  4OMF B;  3OY9 A;  1U1T A;  3E1S A;  4C0F A;  1VQO A;  3G71 A;  2DFU A;  2O4X B;  5FW9 A;  2EYZ A;  4LXC A;  2HZY A;  1YJN T;  3CCR Q;  3NMZ C;  3RKX A;  4F7U B;  2RO0 A;  4N4H A;  1JQQ A;  1AZE A;  3T9N A;  3LW5 E;  1OZ2 A;  2V1R A;  1VYU A;  3I5S A;  4J9E A;  2CRE A;  1MGQ A;  2CP3 A;  1IHW A;  2DBM A;  4OGE A;  3FLG A;  4IUV A;  1AHJ B;  2KGT A;  1VQ6 A;  1N27 A;  1S1N A;  2GGR A;  1OX9 A;  2B8A A;  1QW1 A;  4F7U G;  4UC4 A;  2DYI A;  3QSU A;  2W10 A;  5GAM h;  5I2S A;  2KYB A;  1X6B A;  3MET A;  1NE8 A;  4OMQ A;  1LNX A;  1ZLM A;  3A8M B;  4M77 C;  3GNG A;  3JCM J;  3OS0 A;  2RHU A;  1VQM T;  2DF6 A;  1Z9Z A;  4OB2 B;  1PSF A;  2L2P A;  1CSK A;  4B9W A;  2RHX A;  2MAM A;  4DOW A;  1W1F A;  3QII A;  4XU1 A;  1YJ9 Q;  5GAN h;  3P8H A;  2VYT A;  2FZG B;  4XU3 A;  1PD0 A;  2E65 A;  4OP0 A;  3CMA T;  3M53 A;  4DQ2 A;  3CCV Q;  4KT0 E;  3CCL A;  2AIR B;  3OB9 A;  2XKO C;  1BK2 A;  4Y92 A;  3OA6 A;  4F16 A;  1LPL A;  2ESW A;  4XTU A;  1BU1 A;  3CCM T;  4K11 A;  1Q7Y R;  2DAQ A;  1PG5 B;  4XU2 A;  2KQW A;  1VQO Q;  1I5O B;  4OGC A;  2LP5 A;  3TEE A;  2J6F A;  1MMG A;  4YTL A;  2XIC A;  2FRY A;  4CC2 A;  2LCS A;  1YNZ A;  4Q5W A;  2R5A A;  3M58 A;  4QQG A;  3JB9 D;  1WYX A;  3EG0 A;  3VS5 A;  2H8H A;  5LJ3 d;  2E6N A;  3M0Q A;  4X9D A;  1U8R A;  4FL6 A;  2MIO A;  4X9C A;  2KY9 A;  3X28 B;  1A0N B;  2G6F X;  2LQN A;  3J80 E;  2QAS A;  1TG0 A;  4EMH A;  2MF2 A;  2AKL A;  1S72 Q;  4LD9 K;  4M78 F;  4RTX A;  1UGP B;  3VYG A;  1CKB A;  4RG2 A;  1HSQ A;  2RK2 A;  2F5K A;  4V2S A;  2RH2 A;  1X69 A;  2HCK A;  4LDX A;  3EG2 A;  4XQ3 A;  1YIT T;  1PKT A;  2BZ8 A;  1N5Z A;  2COY A;  1K8A C;  3M0T A;  3S6W A;  3V7S A;  2DXU A;  2L3R A;  2LVM A;  2RNA A;  1IO6 A;  3JCM W;  5KYU A;  3C12 A;  2G3R A;  2RF0 A;  7AT1 B;  4M75 F;  2BIV A;  2L0A A;  3REB B;  1PC0 A;  2EQK A;  4M7D F;  5FRO A;  1D0X A;  5CAI A;  4L6V 5;  4M7A G;  3OMG A;  3NPF A;  1ZX6 A;  2FPE A;  1ABO A;  1TS9 A;  5CO7 A;  2YLC A;  1MHN A;  3CCJ A;  2K9G A;  4P5N A;  1VQL T;  3H0F A;  5LJ5 g;  1ZSZ C;  2X9H A;  2J6K A;  3MEW A;  3QZ9 B;  3RDV A;  2D0Q B;  1Y0M A;  3CCU Q;  1WIE A;  1JRI A;  2CZ0 B;  5M9O A;  4E7H A;  4M78 G;  3ER0 A;  2D0N A;  4OMM A;  1SHF A;  1VQ5 T;  1JO8 A;  2E12 A;  3A5Z B;  1C0M A;  5L8R E;  1Y57 A;  2M0Y A;  3KXT A;  1WHJ A;  5C0M A;  1G3T A;  1SSH A;  1M2V B;  3CMA A;  1SRL A;  2DJZ A;  3ZEH A;  4ATO A;  5I22 A;  3CCL T;  4PJO C;  1MUZ A;  1PRM C;  3REA B;  4DEY A;  1G3S A;  3R6O A;  3M0R A;  4M7D G;  3GBQ A;  3E19 A;  2QA4 A;  4J9D A;  1WNL A;  2QEX T;  4PJO E;  5LL6 S;  4LD6 A;  2MWP A;  3CCQ A;  2DL5 A;  1VQ8 Q;  1GCP A;  1QWF A;  3NTK A;  1Q7Y C;  3CME Q;  1YIJ A;  1UGQ B;  1QMC A;  1X6G A;  2LJ1 A;  2KEA A;  3CCS A;  4J6Y A;  4OMO A;  3CC2 Q;  3M5A A;  3X24 B;  1VQ4 T;  5FU6 B;  5LJ5 h;  1X2K A;  3JB9 J;  4E7K A;  1NYF A;  2P4T A;  2R57 A;  1NLO C;  4MMK A;  2FRW A;  5KH6 A;  4HT8 A;  2FG0 A;  1NJI C;  4BD3 A;  4AFZ C;  4PJN A;  1G2B A;  3BDL A;  2LNV A;  3QBY A;  1E7O A;  1VOM A;  2XI9 A;  3RKY A;  2SEM A;  3DKM A;  1OV3 A;  1B3Q A;  3GLX A;  3VS4 A;  2HKN A;  2F2W A;  3VV0 A;  4PJO D;  5FWC A;  5LJ3 e;  4JLI A;  5FWB A;  4BI8 B;  4FW1 A;  1HXD A;  5A0D A;  3CCE A;  3G4S A;  3RIR A;  2ABL A;  2AT1 B;  1H92 A;  1JJ2 S;  2JTE A;  2QYZ A;  4QVD A;  3CMA Q;  2KRS A;  1B34 A;  2A7Y A;  4M77 B;  3CC7 Q;  2DD4 A;  3WVE B;  3I55 Q;  3OYF A;  5CCA A;  5KYX A;  2QTV A;  2DMO A;  1VA7 A;  3JCM P;  1H3H A;  3VRY A;  1LJO A;  1KHC A;  4IKF A;  3ME9 A;  3A98 A;  4IIO A;  3J7A F;  2DM1 A;  4C92 D;  4C5E A;  1Q82 R;  2E6Z A;  4F7U A;  2QQB A;  2D9T A;  5FRN A;  2COZ A;  2CP7 A;  4VUB A;  1V1C A;  3CME A;  4JRI A;  4EMG A;  2F1L A;  3MP1 A;  2K3Y A;  4FW2 A;  2JS2 A;  5GMK h;  1UB4 A;  4LUE A;  4C0G A;  3X26 B;  3MKD A;  4JRQ A;  1AOJ A;  2P0P A;  4MZM A;  2M02 A;  1BCM A;  2RJE A;  1M1K U;  5GMK j;  1O9S A;  3MEV A;  1IGQ A;  1W6X A;  1YIJ Q;  2DIG A;  2K57 A;  2QA4 T;  1MMN A;  3QPH A;  1TTH B;  4M78 A;  3QYH B;  2KE9 A;  5GAN 3;  2K5F A;  1WQW A;  2EQI A;  3CC4 T;  1VQK A;  2K79 A;  4C5H A;  3QHS A;  3RER A;  4FT4 A;  4CRI A;  5D6X A;  3QDF A;  3BY7 A;  2LQ8 A;  3FEO A;  1FMV A;  4M75 E;  3VU3 C;  2HQX A;  3CCJ T;  4RCB A;  1QLY A;  3OBY A;  4QVC A;  3FC3 A;  1KQS S;  3O8V A;  1QVG A;  1UHC A;  2LJ3 A;  2E3H A;  2X3X D;  4LE9 A;  1TUC A;  1ZBJ A;  2JJ9 A;  3QWY A;  2PUK B;  3CPW S;  2M51 A;  4A53 A;  5IHK A;  3LYI A;  1YJN A;  3A8G B;  1KC8 U;  1NZ9 A;  2DER A;  2NUP A;  5IN1 A;  3X25 B;  2KI7 A;  3CCE Q;  5KYX B;  4WF2 A;  1GCQ C;  1KD1 U;  1Z9Q A;  1D0Z A;  2GFA A;  2PUO B;  3MJX A;  4RMO A;  3V8L A;  4C8Q F;  1YHQ Q;  2BZX A;  5GAM e;  4KGV B;  4QQ6 A;  1RAF B;  1UFF A;  4FCY A;  2NUZ A;  3NTH A;  5L23 A;  3I56 A;  1UDL A;  2DZC A;  1QQJ A;  2HSE B;  3EG1 A;  3ZBD A;  2Y4X A;  1YWP A;  1YWO A;  4JDS A;  1ACM B;  5GAO r;  1QVG S;  1QVP A;  4JRK A;  1NM7 A;  3PVL A;  4QT7 A;  2OJ2 A;  4AG2 C;  2X4X A;  1K73 U;  3CCM Q;  2DJQ A;  1T0J A;  1WHM A;  2IPO B;  5CK9 A;  3OYD A;  2PVD B;  2CSQ A;  1WXB A;  2ZPE B;  3S3M A;  4LNP A;  2W0Z A;  1K4U S;  2R58 A;  5D6Y A;  3UA7 A;  1VQ8 T;  2HL3 A;  2ZPG B;  1W70 A;  3L2Q A;  3MO8 A;  2K2M A;  5IHI A;  4GBQ A;  5J39 A;  1WQ7 A;  5KYY A;  5GAN 7;  1NEB A;  3CCR T;  1M4Z A;  4J9B A;  4A4F A;  4C8Q G;  3UAT A;  2CSI A;  1SPK A;  2EKH A;  1BBZ A;  1T3L A;  2CKK A;  2ZCF B;  1FMW A;  1ZSZ A;  2M16 A;  3EG9 B;  2DIQ A;  5GMK i;  4HA8 A;  2CZ6 B;  5GMK l;  1HJD A;  1RAG B;  1RUW A;  4XTZ A;  1SF9 A;  1NPP A;  2LZ6 B;  4OMP A;  3JV3 A;  4DEX A;  3G6E T;  4MDW A;  1Q81 U;  2O01 E;  4IIM A;  4KRT A;  3NFC A;  4ZTF A;  2L89 A;  1JJ2 A;  1YCY A;  1B07 A;  4ZNX A;  5KYW A;  1VQN A;  4JJB A;  1OPL A;  3OYB A;  2C0T A;  3HPW A;  4KUL A;  1OZ3 A;  3THK A;  5CIU A;  2DNU A;  1Y96 B;  2KT1 A;  4KBM B;  1M3A A;  1X2Q A;  3DB4 A;  3RMS A;  2CDT A;  2QEX Q;  1Q82 C;  2CP5 A;  1SHG A;  2KYM A;  4J5Y A;  1VQ9 A;  2OTL T;  4GY5 A;  4X1V A;  2MCN A;  3NTI A;  4C92 E;  3HL8 A;  1K73 C;  2FO0 A;  2CP6 A;  3I35 A;  3CME T;  5LJ3 f;  1UGR B;  1HK9 A;  3OYN A;  4M77 F;  4RKU E;  2C06 A;  2EYY A;  3VRZ A;  3WXM B;  1X6O A;  3UT1 A;  1RAA B;  3HSB A;  1PCX A;  2YSQ A;  2CH4 W;  4RTU A;  4PJJ A;  4C0D B;  2FPF A;  2WSC E;  3INZ A;  1D3B B;  3GIB A;  1Q86 C;  2O2O A;  1U1S A;  2OTJ Q;  1AVZ C;  5A0G A;  1K9A A;  2C0I A;  2VB6 A;  5CKE A;  2OAW A;  2L3S A;  2EGA A;  3H41 A;  2QI2 A;  1IB8 A;  1M9S A;  3EH1 A;  4B9X A;  4Z88 A;  2FB7 A;  3CC2 A;  1DJ7 B;  3CCV T;  3EGD A;  1LVK A;  1RAH B;  3SEM A;  1VQM A;  5DLQ E;  1KC8 C;  5FRM A;  2VVK A;  1KQ1 A;  1I81 A;  1RAC B;  3A8O B;  1GFC A;  4F04 B;  1GXI E;  2E3I A;  1QKX A;  4CC4 B;  3FJP A;  1VQO T;  3GPL A;  1M90 R;  2DX1 A;  1UEB A;  3MP6 A;  3F70 A;  2VV5 A;  4CI0 C;  2QGF B;  1VQL Q;  1M27 C;  3M54 A;  1I8F A;  2JM8 A;  2DL4 A;  4FT2 A;  4DBR A;  4EPC A;  1OEB A;  2BKD N;  3OSS C;  2DL3 A;  3LH5 A;  4C92 G;  1ARK A;  2LC4 A;  2CUD A;  4ELZ C;  1YN8 A;  1NJI U;  1FWZ A;  3FB9 A;  5FLX E;  4KH0 B;  1KG1 A;  2KT8 A;  2AKK A;  1PWT A;  2RK1 A;  4JS4 A;  3UA6 A;  5GAO n;  4PJL A;  4PL6 A;  4JZ3 A;  3QZ5 B;  4R55 A;  2FVU A;  4OB3 B;  3EG3 A;  2K2V A;  3LWI A;  1OQK A;  4FYW B;  1ZHI A;  4JRP A;  4WCI A;  1VYT A;  5FU7 C;  3A8L B;  1Q7Y U;  2L3Q A;  2KNB B;  1RL2 A;  4BAC A;  2EFI A;  1GFD A;  5GAN j;  2QGG A;  4PJO G;  1UHF A;  4BE2 A;  3V7R A;  1WLP B;  3QWX X;  2AK5 A;  4PLL A;  2L5Q A;  1ABQ A;  2GTO A;  2OTL A;  4KH1 B;  4N0A C;  2K3B A;  1VQ7 Q;  3CCL Q;  3I55 T;  4BY6 C;  4M78 C;  3VS3 A;  1VQ9 Q;  4GLK A;  2DL8 A;  2XG8 D;  4RTY A;  4HCB A;  3PMT A;  1M2O A;  3I5R A;  5KE3 A;  4C0D C;  4D8D A;  3OYL A;  5GAN d;  3EFO A;  4M78 E;  3OS1 A;  2ZPH B;  4XTW A;  2NYS A;  2DEQ A;  4DBF A;  2AZV A;  3PTA A;  3QKJ A;  2BE9 B;  4RTV A;  2YWW A;  4J9G A;  1GBQ A;  3RES A;  2F5T X;  3G71 T;  4BE0 A;  1ZQ1 A;  2DET A;  1R77 A;  1I0C A;  3OYM A;  4JZ4 A;  1KQS A;  3QJ6 A;  3OYH A;  3CC2 T;  4L59 A;  1SG5 A;  4E7S A;  4NL2 A;  1KIK A;  1ZA2 B;  3S3N A;  4M7D D;  3TSZ A;  1Q86 U;  1IZ6 A;  2VXE A;  4EIK A;  1VQ6 T;  1D1A A;  2KRM A;  3WVD B;  5GJV B;  3MCA B;  1TUG B;  2D1X A;  3QUI A;  1IGU A;  3SFM A;  5DM7 R;  2K6D A;  4OVA A;  2NWM A;  1V76 A;  1AT1 B;  1UE9 A;  1OPK A;  2LJ0 A;  2ZAE A;  5GAO m;  2VKN A;  1UG1 A;  1FMK A;  3L42 A;  4GLM A;  3CCJ Q;  5HCK A;  5I2M A;  1JU5 C;  4RTW A;  3M9Q A;  4ANJ A;  1WI7 A;  3OMC A;  4N0A A;  2Z0W A;  1NG2 A;  2LDM A;  2YRV A;  1KQS P;  4M7A D;  1LOJ A;  3TSW A;  1WJS A;  3LGF A;  3BDU A;  1X27 A;  2OTL Q;  4XU0 A;  4PNO A;  3QDR B;  3H6Z A;  3V8J A;  1O75 A;  3CD6 A;  1YHQ A;  4RG8 A;  3R6N A;  4FSX A;  1R0C B;  2HQH A;  4ZGD B;  3CCM A;  1G8X A;  4MML A;  3LWH A;  1TXQ A;  2JTF A;  4IUP A;  4M7A E;  3ZFJ A;  1VQ4 A;  1WDX A;  4AFU C;  3M56 A;  1IXD A;  5GAM g;  4KUI A;  3A8H B;  3CC4 Q;  4EMK C;  3OW2 P;  3L2Z A;  4FYV B;  2YUQ A;  4BDY A;  2E70 A;  5EG2 A;  1F1B B;  3ASK A;  4AFS C;  4XTV A;  2JMC A;  5KYU B;  2HL5 C;  4QVZ A;  1QKW A;  4L5G A;  3M55 A;  2RM4 A;  1OU8 A;  2CGH A;  4F17 A;  1IRE B;  4PJO A;  2EKO A;  4M7D A;  1CKA A;  5GJW B;  2DPP B;  4M75 A;  1I5L A;  3LGL A;  1BKB A;  4JLG A;  2DBK A;  1XOV A;  1UJ0 A;  2KMT A;  1WPY A;  4HVV A;  2JMA A;  8ATC B;  1D1C A;  4N4G A;  5GAN 6;  5GAN e;  1VQ7 A;  2XMF A;  3CXC A;  2RJF A;  2YXY A;  1TOV A;  3UF4 A;  2FYK A;  3CBO A;  5FU7 B;  3H0I A;  2HDA A;  5IAY A;  2VAS A;  4M7D B;  3LX7 A;  2A28 A;  2K7A A;  3DLM A;  4E7L A;  2ZZD A;  1ZSZ B;  1ZUK A;  2DYB A;  1K9M R;  3JSC A;  1Y07 A;  1QVF S;  3GNF B;  2X4W A;  1AZG B;  1M1K C;  2Y90 A;  2QA4 Q;  1IRX A;  2Y4Y A;  3G4S Q;  3JB9 H;  5J26 A;  2B86 A;  2VGM A;  3PT9 A;  5CKB A;  5IH2 A;  3EGU A;  2QQR A;  1SEM A;  2EQM A;  4C0Z A;  1EX4 A;  5ECA A;  1WHG A;  2P4R A;  4Z02 A;  2LX7 A;  5D6W A;  4ZTJ A;  1VQN Q;  2FHD A;  5CQY A;  2EJF A;  1JB0 E;  2OI3 A;  3M0S A;  3A1P A;  4C8Q B;  9ATC B;  1QVF P;  1QCF A;  3SWN B;  1D0Y A;  2D8H A;  4OML A;  4F14 A;  2DVE A;  3QYG B;  1NYG A;  1G83 A;  4M7A C;  4E7I A;  2KBT A;  2JT4 A;  3CC7 A;  4AMC A;  3TQ7 P;  3SB2 A;  1VQ5 A;  3VYH B;  3RMQ A;  3OYI A;  2KSS A;  5IHN A;  1QP3 A;  4M7A B;  1KFZ A;  5IT9 E;  3JCM Q;  1UTI A;  2RQV A;  1BI1 A;  3I56 T;  1M3B A;  1VQK T;  1GL5 A;  5LJ5 j;  2LMJ A;  4ZGE B;  3EGX A;  1YJW T;  3OS5 A;  5D7U A;  1AWJ A;  1ZSG A;  2ATC B;  1N9S A;  2ENM A;  1S72 A;  2EYX A;  5GMK e;  3BFM A;  5KCH A;  2DRM A;  2K3X A;  2KXC A;  3MEU A;  3ULR B;  1QVG P;  2DXT A;  1YP5 A;  3P8B B;  3PVQ A;  2X3W D;  1G3W A;  1UGS B;  2CP0 A;  1EZZ B;  5HKC A;  2CZ7 B;  2J7I A;  3BW1 A;  4Y28 E;  5GAN f;  3QG1 A;  3EFO B;  5AYF A;  3TCJ A;  5EC7 A;  3M0U A;  1GRI A;  2P84 A;  1QVF A;  2JXB A;  2KVQ G;  4J9I A;  3PE0 A;  3H8Z A;  1MMA A;  1UGV A;  3PFS A;  2VUB A;  3I55 A;  5KYN A;  1M8V A;  2RHI A;  3V8K A;  3OBW A;  2EAY A;  4BUG A;  4DOV A;  2JW4 A;  3PIP A;  4M4Z A;  2O9V A;  4M77 E;  3I9Q A;  3MPU B;  1V29 B;  2DZ9 A;  2PNI A;  4CC7 A;  1OX8 A;  2JUF A;  3N5B B;  3EGX B;  3OYA A;  5GAM d;  2J06 A;  2EIF A;  1XTD A;  1W2B S;  1RAB B;  2BTT A;  2YUP A;  3L2R A;  4F7U F;  1H64 1;  3HRS A;  5LJ3 j;  2HNI A;  5GAN 8;  2YRD A;  1Q81 R;  4M7D E;  1KSW A;  4RTT A;  4J9F A;  4LN2 A;  4NL3 A;  3CCE T;  1AEY A;  2FEI A;  4M78 B;  1RLQ C;  4A54 A;  2H3J A;  3VUB A;  1X43 A;  4F7U E;  2WSE E;  2CP2 A;  2LQW A;  2HBW A;  1YFN A;  3RR6 A;  2O31 A;  1UEC A;  5KCO A;  4WTO B;  4Z8A A;  1TH7 A;  1HD3 A;  2DE0 X;  4A4E A;  1RAD B;  4OMN A;  2JOY A;  2RPN A;  3FDR A;  1Y71 A;  2RQT A;  4KGZ B;  1C1A A;  3M0P A;  2EWN A;  2O9S A;  2XDP A;  2EJG A;  3VS0 A;  5LJ5 f;  2CZ1 B;  1YJW A;  4ME7 A;  5LJ3 g;  3CCS T;  2BE7 D;  2OTJ T;  1M1G A;  1QP2 A;  2BZY A;  3EFS A;  3IQL A;  2YLB A;  6AT1 B;  1T0H A;  3G1J A;  2GCX A;  3EGD B;  3PMI A;  1M1K R;  2V1Q A;  1N6A A;  3JAM E;  2K5L A;  2MI6 A;  1G5V A;  1XQH A;  4M78 D;  1JXO A;  4PFZ A;  1M30 A;  3OYG A;  1XJW B;  3CPW A;  1UJY A;  2XHC A;  3EHR A;  1MV0 B;  5IXB A;  3U23 A;  3M4G A;  1B7T A;  1SKU B;  4J9C A;  5CR2 A;  2RJC A;  3URG A;  5DLO A;  3CCQ T;  2EYQ A;  2ZGW A;  1LCK A;  1N8R U;  1K1Z A;  4QW2 A;  1K0X A;  4LDV A;  4XAX B;  2EPD A;  1GCQ A;  1H8K A;  2EJ9 A;  2RI2 A;  3VJP A;  1NPR A;  2LT4 A;  1OU9 A;  4M75 D;  1I4K 1;  3G4S T;  1TSF A;  4BDZ A;  1YI2 Q;  2MOX A;  4NOY A;  4JS5 A;  2CT4 A;  2ZPF B;  4RCC A;  5DY9 A;  5I21 A;  3NGP A;  1VYV A;  3SWN A;  2QG9 B;  3HFN A;  2XU8 A;  1P92 A;  3C4S A;  3TRE A;  1WHH A;  1AWO A;  2F2X A;  2DIL A;  3MP8 A;  1GBR A;  2NLU A;  1SSF A;  2GTJ A;  4E2F B;  5KYW B;  1YJ9 A;  2DKG A;  2X4J A;  4ORZ A;  1YBY A;  1OI1 A;  2CYZ B;  3CCV A;  2PQW A;  1OOT A;  2EQJ A;  4ZGJ B;  2ZPI B;  2HAX A;  1BB9 A;  3CPW P;  1VQ9 T;  1T3S A;  1EFN A;  1Y96 A;  1YJW Q;  1AWX A;  2ROT A;  4MZT A;  2NUT A;  4HVU A;  1MMD A;  2I0N A;  3O5Z A;  4C92 B;  3L1A A;  4M7A A;  1N9R A;  1Q95 G;  4OF1 A;  4HVW A;  2E41 A;  2EVR A;  2GNC A;  4PLI A;  2QDY B;  3PNW C;  2DTO A;  4E7Z A;  2XD0 A;  2KRO A;  3FIF A;  4Y91 A;  1KC8 R;  1E6G A;  1BIA A;  1EIF A;  3M4Y A;  3QXE B;  2M1H A;  5GAO q;  1X01 A;  1YIT A;  2HD0 A;  2C0O A;  2PTK A;  2DXB A;  2LT1 A;  4LUD A;  2IVW A;  1R0B G;  3AT1 B;  3EG9 A;  2QEX A;  3DLL A;  2YUO A;  2WAC A;  4AFQ C;  2YHT A;  2JM9 A;  1WJQ A;  1VQ7 T;  4HCC A;  3VUZ A;  3SHW A;  2ROL A;  3HHT B;  4FM4 B;  4EDU A;  5LJ5 d;  2MK5 A;  1ZBX A;  3JRZ A;  4E47 A;  3TVT A;  2JS0 A;  2V26 A;  3OYJ A;  2RHY A;  1KHI A;  3LLR A;  2LCC A;  1VQL A;  2P0K A;  3G7Z A;  3RKW A;  1BI3 A;  2K4Y A;  1VQP T;  1QCN A;  4EMK B;  1Q81 C;  1FYN A;  2FL7 A;  4M75 C;  4A4H A;  1MND A;  2EGE A;  1TUD A;  5CVI A;  4M7D C;  5GAN 5;  3CXC S;  2KRN A;  4TVR A;  2OAU A;  3P8D A;  4BE1 A;  3FRN A;  4C8Q E;  4ZN3 A;  4PJM A;  2DO3 A;  3Q1J A;  4OB1 B;  1WJR A;  4BI4 A;  3RNJ A;  1QWE A;  1K0S A;  4XK8 E;  1W2B A;  1VQM Q;  3E9G A;  3ZL7 C;  3EFR A;  1YCS B;  1PNJ A;  3UWN A;  4E7J A;  4O5V A;  3CXC P;  1RI9 A;  5GAM f;  3CQT A;  3H0H A;  4J9H A;  3OS2 A;  1U3O A;  1PHT A;  4D8K A;  3JCM e;  1KD1 R;  3J81 E;  1JXM A;  3V7C A;  2ECZ A;  1I07 A; 
#chains in the Genus database with same CATH homology
 1TWB A;  2NYS A;  1OU9 A;  1OUL A;  1YFN A;  2QAZ A;  2QAS A;  1OX8 A;  1ZSZ C;  1ZSZ A;  1OU8 A;  1OX9 A;  1ZSZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...