1TWBA

Sspb disulfide crosslinked to an ssra degradation tag
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
106
Chain Sequence
SSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVECVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Stringent starvation protein B homolog
publication title Nucleotide-Dependent Substrate Handoff from the SspB Adaptor to the AAA+ ClpXP Protease.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 26
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1twbA00
1OX8A 1OU9A 1OU8A 1TWBA 1ZSZC 1YFNA 1ZSZA 1OULA 2NYSA 2QASA 1ZSZB 2QAZA 1OX9A
chains in the Genus database with same CATH superfamily
1ZUYA 1WHLA 4EDUA 1SSHA 3M0QA 1ZQ1A 5CKFA 4M7DD 2ZPBB 1K8AC 1TOVA 1WI7A 4B6MA 3FC3A 4J7FA 1ZBJA 3CCMA 5KYXB 3JCMe 4QT7A 2FO0A 1QKWA 2EPDA 4DBFA 5KYWA 2CP0A 3HFOA 3OYIA 2JS0A 1VQNT 1FYNA 4HVWA 3CCQT 2F5KA 4J8OA 1KSWA 1C6VX 2B86A 4M75A 3FJPA 2HCKA 3L42A 2XIDA 1HSQA 1YIJT 1UE9A 1XJWB 3JCMV 3M0UA 1S72T 3HL8A 2CZ0B 4TVRA 3PIPA 2V8KA 2ZPEB 2JJ9A 3FIFA 3PGGA 5LJ5d 4FYYB 3G4SA 1PM3A 2A37A 1U1TA 2EBPA 1PNJA 2JTEA 2EYQA 4ZNXA 1SRLA 2RHZA 3JB9G 4A54A 4JRIA 1D3BB 4HVVA 3M57A 1K73U 1VOMA 2DKGA 2E1HA 4C8QC 3OYDA 1QP2A 5D7UA 3RMSA 1QVFP 4M75C 3BDLA 3UF4A 5L23A 1AT1B 1N27A 3L1AA 2QQBA 3C94A 2VGNA 2D6FA 4NL2A 1AHJB 4XTWA 1TH7A 2KXCA 2AK5A 1RAHB 5GAN2 3CCLT 1Y96A 3I56T 2CZ6B 4F7UG 1AWXA 1YIJQ 4JZ4A 1WPYA 1UECA 2ROTA 2DM1A 1VIEA 2HL5C 5CO7A 1GRIA 3JCMg 2KEAA 1S72Q 1Z9ZA 1UEBA 2DL7A 4LN2A 1I81A 1BBZA 1FX7A 4RKUE 2I0NA 3C95A 3GPLA 2WSEE 3M59A 2A28A 1ZUKA 3JCMf 3CCVT 4Y91A 1EFNA 2K5FA 1JRIA 4RTVA 1MMAA 4PK4A 1GXIE 3CPWS 2DBMA 4P5NA 1VYUA 4PLLA 2PUOB 2FZGB 1HD3A 3DLMA 4DBHA 4M77A 4OGEA 2K9GA 3EGUA 1WHGA 4Y28E 4FCYA 1UGPB 3JCMX 2CZ7B 1F1BB 3QPHA 1NLOC 4C8QD 2NUPA 4M7AG 1UGSB 1Q7YR 4F7UB 3MPUB 1ABOA 3CCLQ 5CQXA 3I56Q 1FMWA 4JLGA 4M75D 4EMKA 1OEBA 2F2XA 2V1RA 2VVKA 1PG5B 2YRVA 2GF7A 3M56A 3M0TA 4ORZA 3DLLA 1W2BP 2YDLA 1NYFA 2CKKA 2K57A 2HQXA 1VYVA 1YJNT 4RG2A 4KUDK 3TREA 5KYXA 2PQWA 1M90R 1I4K1 3P8HA 2NUTB 1X2QA 4CRIA 1KQSA 2JW4A 4JRQA 3QZ5B 3GIBA 2YUPA 3CCUQ 4ZN3A 1KIKA 3BW1A 2Z0WA 4WF2A 4M77C 2SRCA 2DO3A 4XU0A 3PMIA 3M54A 3EG2A 1I0CA 4PFPA 2GFAA 1PKTA 3ZL7C 4IUVA 1JQQA 2EQUA 5KE2A 1VQ9T 1QQJA 1YIJA 1SHFA 4LD6A 2DIGA 2O4XB 3V7RA 1WJQA 2Y90A 1W4SA 4EMKC 2GNCA 1OZ2A 1S72A 2G3RA 5L8RE 3J7AF 1VQ8T 2HBPA 2HSPA 4CC2A 1KD1C 3JB9F 3L2UA 2H3JA 2DD4A 1R0CB 2K2VA 1D3BA 1PRLC 4DA4A 1M1KU 3M9QA 2A36A 3ME9A 4M7DG 1XQHA 1YWPA 1Y71A 4XAXB 3H0IA 2X4YA 2MIOA 1AWWA 3JCMd 1K9MR 1NG2A 4ZN1A 2HQHA 3LWIA 1CKBA 3LWHA 2H8HA 4AG1C 1SSFA 4ZTJA 2PTKA 4F7UF 3CCLA 1ACMB 3I56A 2KBTA 5CKEA 4C0GA 4KT0E 1X27A 3MCAB 4M77D 1M27C 2LX9A 1UDLA 3VS7A 2H3EB 2ECZA 3OW2A 4KGZB 1LJOA 4J9EA 2FPDA 4NOYA 4AFUC 4BI8B 4XTZA 4RUGA 3TSZA 4HVUA 1JEGA 2LNVA 3O8VA 5GANj 2EGEA 1NEGA 1NPPA 2O01E 1VQ4T 3C4SA 2CSQA 3CCUA 2E6ZA 2OAUA 2EVRA 5A0GA 1X69A 1YJWT 1WDXA 1Q81U 9ATCB 3QO3A 3F70A 1X2KA 2IG0A 1V29B 1ZBXA 1YJ9T 4M7AF 1VUBA 5LJ3j 4OMOA 2R57A 4F7UA 3LH0A 3CCJQ 1KC8C 2LNHB 3QUIA 2OAWA 1N9SA 3OYAA 2FRWA 2RO0A 4XU3A 2F5TX 1TUGB 3RNJA 4LXCA 2MI6A 5CKHA 1LCKA 4EMGA 4CI0C 4AFQC 1D09B 2RHIA 2QQAA 4FM4B 2V8IA 4B9WA 3ER0A 1YITT 1TUDA 2D0QB 2BE7D 4LD9K 2V1QA 4FYXB 4J9IA 2MCNA 2NUTA 4A4GA 2DJZA 1EIFA 5A0DA 4QQDA 1VQ4Q 2RQUA 2E5QA 2CT4A 1K0SA 1Q82R 3OSSC 5HY6A 2RM4A 5GAMh 5KYNA 2QQRA 3PMTA 1GCPA 3JSCA 4CC7A 1SG5A 2LZ6B 1Y0MA 5J3BA 2O4XA 2QDYB 4B9XA 2QEXT 3LW5E 4C8QG 4O6JA 2KSSA 3JB9I 1QCNA 1FMKA 4OMMA 2OTJQ 1H8KA 1UB4A 3HHTB 1VQ8A 4M75G 1NPRA 3UPUA 2RB6A 5GAMg 4IKFA 1KQSS 1VQ7T 1RAFB 2DXBA 4M7DF 1FWZA 1TUCA 3Q1JA 4E7SA 4A4KA 1I5LA 2ZZDA 3PT9A 4OB3B 3JB9J 2FG0A 5HK0A 3OS5A 2ZGWA 2EQJA 5GAMf 4F14A 2M1HA 1WX6A 1I1JA 2DF6A 3DB4A 1H3HA 3M0PA 4WCIA 3CCJA 2R5AA 2HKNA 2W10A 3EFOB 2COWA 2LQWA 1MMDA 3EGXB 3CC7T 1UJYA 3SDZA 4E2FB 2XHCA 2PVDB 1G3SA 4PNOA 3CMET 2EQMA 2MWPA 4C8QB 1QVGP 1K8AR 2IPOB 4OB1B 1K1ZA 4KBMB 1AEYA 1QW1A 5IXBA 1N6AA 1ZSZB 2MK5A 1QVFA 2CUBA 1MV0B 2CP6A 2AT1B 1VQ4A 2RHYA 3U23A 1VQ7Q 3X26B 3IQLA 3NTIA 5CCAA 1Q86U 1PWTA 4RCBA 1YJWA 2CZ1B 4XTUA 5CQYA 2LTOA 1VQMQ 1NJIC 3R6OA 1G2BA 5GANh 3QXEB 2LQ8A 2BIVA 5KYYB 4BE1A 4GLMA 3SD4A 2A3LA 5GAN4 1YJ9A 3BY7A 2RQVA 1UGQB 2M9UA 4GBQA 3CCMQ 4O5VA 2E4HA 1EX4A 2QK0A 2PZ1A 3A8OB 3VU3C 1N8RC 1U5SA 4IUTA 4D8KA 2DZ9A 1GCQA 2P0QA 4C5EA 2OTJA 3CC7Q 1KK7A 1K4US 1VQOT 2DVEA 2YHTA 4M78B 3CMEQ 1BYMA 4M77G 3EHQA 2E5KA 4KULA 2F69A 5GAOn 5LJ3h 1QWEA 1OPKA 2WACA 2K2MA 4OB2B 2VUBA 1QLYA 3SB2A 2A7YA 5GMKe 2B8AA 3A8MB 5D6YA 2EYXA 1UTIA 1MV3A 2YLCA 3QKJA 4II1A 5GAOp 4F17A 5GMKl 3JAME 4BI3A 3X28B 4L59A 4OMPA 4BE2A 3OMGA 1JJ2P 2XG8D 1VQLQ 1W2BA 2CGHA 1QP3A 3G7ZA 2ZCFB 5GAMd 2X51A 1VQPT 4C8QF 1X43A 4J9HA 3CD6T 1AOJA 4IUPA 4LDXA 3PVQA 1NZ9A 2QEXA 4AMCA 2LC4A 4M75F 3TQ7P 4HCZA 1SKUB 1M3AA 3P8DA 1VQOQ 2M0OA 1U8RA 1M8VA 3OYMA 2QQSA 3M53A 4LUEA 1ZA1B 3CC2T 2RF0A 4C92E 1VQ7A 1FMVA 1GBRA 3QIIA 1OU9A 1RAIB 4LDUA 1W6XA 1ZHIA 3CCRT 1GFCA 4DEYA 3MHXA 3ZEHA 3M4GA 1VQMA 2VXFA 2QG9B 3UATA 2K3XA 2GFUA 1YFNA 2ZPFB 1CKAA 2EKHA 2XDPA 3CBMA 1NYGA 3CEYA 3EFOA 1YI2T 1N9RA 1H641 2X4WA 1E6GA 3EGXA 1WNLA 2VASA 2JM8A 4JDSA 2E64A 2L3QA 4C8QA 4JLIA 2D1XA 3CC7A 2DD5A 3D7SB 3CMEA 2LT1A 2JT4A 1VQPQ 2HQEA 4QVZA 4MDWA 3CD6Q 2DVJA 1G5VA 3RESA 2JN0A 1ZSZA 4M7AE 3INZA 1MMNA 1LNXA 5IHKA 1K73C 3GLXA 2M16A 4EPCA 2OTLT 3NFCA 2DXUA 3A1PA 1QWFA 3FJ5A 2RJEA 3CC2Q 1GL5A 2DXTA 4ZGEB 3GOXA 1HK9A 1M3BA 1BIBA 1QMCA 3EH2A 3CCRQ 1YCSB 1X01A 2EIFA 5KYYA 4A4EA 2E65A 1VQLA 5EG2A 1SEMA 2GQVA 3DB3A 4RTXA 2NLUA 2RNAA 3GP8A 1B34B 1YI2Q 2RK1A 4JS4A 1KD1R 2G6FX 3FRNA 1U3OA 3CXCS 1S1NA 4QVDA 2KQWA 4HXJA 4M78A 4M77F 1VQNQ 1VQOA 4J83A 5GJVB 2E41A 1ZSZC 2HD0A 3CCQQ 4A4FA 2ESWA 3I5RA 5C0MA 5GAN6 2D8JA 4HCBA 2KRNA 1WA7A 2I2LA 4XU2A 2K5IA 2JVVA 1DJ7B 4BDYA 2AZSA 1UHCA 2ZPGB 2DAQA 1WXBA 1M5Q1 2LCSA 2QXFA 1OV3A 4ELZC 1SPKA 2FRYA 2PNIA 4XTXA 3V7CA 4ANJA 2MF2A 5M9OA 3OBWA 5GAOr 2E3IA 4PJLA 3UWNA 1VQPA 1MNEA 2MMPA 4J9DA 4PJOB 4M78C 3UT1A 2DEUA 3CD6A 1JO8A 3OYLA 2QDLA 1OX8A 1ZA2B 5I2MA 2HNIA 3CPWP 3WVEB 2DRMA 3E1SA 2EQIA 3G6ET 3CC2A 2BTTA 4C0ZA 2RJCA 2DL8A 5CR2A 3CCRA 2DL4A 1J3TA 2CSIA 2E10A 1KC8R 2LX7A 2VC8A 2DETA 1WFWA 1ZX6A 3LH5A 3S6WA 2DYBA 2P0KA 4NL3A 2BZXA 4C92B 1RAAB 2K3YA 2IVWA 1YI2A 1C0MA 4MMLA 2JM9A 3RKXA 3KFVA 3CCVQ 4FYVB 1T3SA 4JS5A 1W70A 1TTHB 2NWMA 3OS0A 1VQNA 1B7TA 2JUFA 4GY5A 2O2OA 2J6FA 5IHNA 2BUDA 2FYKA 3CCQA 2CS7A 2C0OA 1M1KC 2SEMA 5CIUA 3AT1B 3L2WA 4M78D 3ASKA 2RI2A 2ZPHB 2YUNA 3QG1A 4PFZA 1OX9A 3HPWA 4OMQA 4E47A 3MEVA 7AT1B 2X35A 2JXBA 1RLPC 2CT3A 3UA6A 1QVGA 3CC4T 4KH1B 2EKOA 4A4HA 4WTOB 3CCST 5I11A 1LOJA 1BU1A 1B34A 4HCCA 3TU4K 1YJNQ 3QDFA 1WZOA 4X9CA 3V8LA 2OJ2A 4AFSC 4FYWB 2DIQA 2MOXA 1SRMA 2X9HA 2MPXC 2RI3A 2HMAA 3MKDA 5GMKi 3VS1A 2JS2A 1IREB 1YHQT 2AKKA 2BZYA 4J9FA 1VQ9Q 3OBYA 1KJWA 3OYCA 1YCYA 1UFFA 1KFZA 4RG8A 1U06A 1YN8A 1RACB 1Y7XA 1UJ0A 3VJPA 4M75E 4JJDA 3TSWA 3VV0A 1WXTA 5LJ5j 1VQ8Q 4RCCA 2J06A 1M2VB 2QGGA 1O75A 3A8HB 1MNDA 3CBPA 2DFUA 5DLOA 4E7JA 2ZAEA 2F2VA 3OY9A 3E19A 3CCVA 3CC4Q 3VUZA 1JB0E 4PJOA 1K0XA 2MWOA 1G8XA 3GBQA 5GAMe 4DQ2A 3QBYA 2F2WA 2YRDA 2D9TA 2LT4A 3HFNA 3JRZA 3H0FA 5KCOA 3M58A 1RAEB 4LE9A 4KRTA 3G6EA 1NJIR 4OP0A 1JJ2A 1M9SA 3I9QA 3OYHA 2GQIA 3VS5A 2M51A 2DA9A 2AKLA 5IN1A 4F04B 1BIAA 2VWFA 3LGFA 2KDSA 4EMHA 3PTAA 3MP8A 4FT4A 4ME7A 4C92A 4K11A 1BCMA 4IIMA 4OMNA 1N8RR 2YT6A 1UGVA 4J6YA 1YJNA 2V8JA 3H8ZA 3VS0A 2EJGA 1Q7YU 4PJOC 4XQ3A 5GAN8 1UG1A 2XKOC 4R0KA 4J9BA 3THKA 1YJWQ 2ATCB 4UC4A 4PJNA 4DBQA 1XOVA 1G3YA 3QYHB 2X3XD 1GBQA 1KC8U 4XU1A 2KMTA 2QAZA 2HAXA 1VQ9A 4KGVB 1YJ9Q 1M90U 1IGQA 1W1FA 1PSEA 3L2QA 3NTHA 5GAN5 4HKEA 1P92A 3OB9A 1AZEA 5ECAA 1VYTA 1E7OA 1M2OA 3OMCA 4C92C 3J80E 5KH6A 1RI0A 1WLPB 4JJBA 3CC4A 1PCXA 2L3RA 1YITQ 2KRMA 4FL6A 1T0JA 4EIKA 4BI4A 1KQSP 1IO6A 5FU6B 3G71T 5GANe 2D0NA 3VRZA 4HCKA 2L2PA 1OOTA 2CP2A 3FLGA 2LQKA 1PC0A 1WJSA 3I5SA 2EQKA 4PJOD 3VS6A 1X75C 3CCET 1QCOA 2ROLA 1R77A 2CP7A 1Q86C 1RLQC 3S3OA 3N5BB 2QEXQ 2JTMA 2EYZA 4M78G 2EGAA 1BI3A 4E7HA 3S3MA 3A8GB 5LJ3e 5C6SA 2XDDA 1GFDA 4ZGJB 4KUIA 2NYSA 1K9MU 1WHKA 1KQ1A 2DX1A 1YP5A 3ZBDA 2EW3A 3EAEA 3MO8A 3HRSA 3JCMP 4X34A 1K73R 4C92D 3GF5A 3PNWC 5LJ5h 4OB0B 4IURA 2XI9A 3MP6A 1D0YA 3G71Q 4RMOA 1IHWA 1I07A 2DPPB 3P8BB 3T9NA 3OW2S 3G4ST 1KHCA 2JNGA 3LGLA 2AHJB 3OYYA 2EGCA 2RQWA 4R55A 4LDVA 3JCMb 4C0FA 2YXYA 5HK3A 5CK9A 1V1CA 2L8DA 2RMOA 2PU9B 4C0DB 1YITA 5GANg 1MUZA 4JZ3A 2O9VA 5I21A 2KT8A 1SF9A 1T0HA 3QWXX 3BDUA 2RJFA 3M4YA 1M30A 2X4JA 3CPWA 2K6DA 2J7IA 2ZPIB 4J7IA 1ABQA 1KG1A 2XD0A 5GANf 5AYFA 1NLPC 1WJRA 4OMLA 3H0HA 4QQ6A 2YWWA 5LL6S 4FW2A 5FWBA 1OULA 5LJ3g 3SEMA 3JV3A 3O5ZA 3NMZC 2EFIA 2RN8A 1RUWA 2EAYA 4X1VA 5CKDA 1IB8A 4AFZC 2D8HA 8AT1B 2VXEA 3OYFA 2ENMA 3HP9A 4E6RA 3EG3A 5LJ3f 1Q82U 1IHVA 2PVOB 4F7UE 4MMKA 3QZ9B 4PFOA 4RTYA 4E7IA 2RH2A 1YBYA 3RDVA 4J6WA 5DY9A 3NGPA 5GJWB 3KXTA 1NEBA 5FRNA 3G71A 3NPFA 1RAGB 1M1FA 5IAYA 3RMQA 2LQNA 1V76A 3H6ZA 2JOYA 4XTVA 1FXXA 2AIRB 2RHXA 1IRXA 5GAOq 3CCEA 3QJYA 3EG9B 4MZPA 5KE3A 1WHHA 1TG0A 4M78F 2QTVA 2EJ9A 2KK4A 4FIBA 3MEAA 2W0ZA 1AWJA 2CYZB 3V8JA 2OX7A 4XTYA 2MYSA 1D1CA 4D8DA 5GAN7 3OYBA 4QQGA 4CC4B 4BUGA 2LCLA 3M0RA 4ELYC 1M4ZA 5FU6C 4C5IA 4Z89A 2LRQA 3A5ZB 3E9GA 1RI9A 2RD1A 3VS4A 1M1KR 1K8AU 1G3WA 5A2QE 4LDWA 3VKIA 1MHNA 2J6OA 1D0ZA 1JU5C 3HSBA 3QWYA 5D6WA 2X4XA 2RQTA 1WYXA 1JBMA 4OF1A 4F16A 3X25B 3TEEA 3LLRA 5GANd 1JXOA 2P0PA 1BB9A 1R8OB 2HL3A 2YUOA 4PJOG 4KH0B 3VYHB 2EYWA 1QVFS 1IGUA 5J26A 4QW2A 5CKBA 4HT8A 3JCMh 4J9GA 4GLKA 3CXCP 2K7AA 2YSQA 1XTDA 4JPBW 2QI2A 3OS2A 4MZMA 5EC7A 3MJXA 3V8KA 2CP5A 4V2SA 2DXCA 2PVGB 5LJ3d 2OTLQ 1WIEA 3EFSA 3QJ6A 1AVZC 4OVAA 2GBQA 2LP5A 2DTHA 4JRKA 5FWCA 1QKXA 1BI0A 2CDTA 1O9SA 2DILA 2R5MA 4M7DE 4C92G 1Q81R 4C5HA 2RJDA 3R6NA 4BY6B 2DK3A 1VQKT 2YRCA 1PSFA 2K4YA 3S3NA 2DMOA 2GTOA 2KI7A 5DLQE 3L2ZA 2MAMA 3JCMc 4C0DC 3CCUT 3EHRA 2OI3A 3I35A 4A63B 2DRKA 1U1SA 2Y4XA 3L2VA 2KR3A 2CP3A 2L3PA 3JCMQ 3CMAT 4HT9A 1PHTA 2FVUA 1OI1A 5D6XA 1K76A 2IIMA 1W2BS 1QVPA 1VQ6T 2LJ1A 2X3WD 4X9DA 5J39A 1H3ZA 4MZTA 4IUQA 1Q95G 2XICA 5GAOm 4HA8A 3VUBA 4XK8E 1IXDA 2YUQA 3EG9A 1ZLMA 4OMFB 4LDYA 5GAMj 6AT1B 4N4HA 4FT2A 1VQKQ 2RHUA 2JZ2A 1VA7A 4FW1A 4DEXA 1XNIA 2LJ0A 3VS3A 2QGFB 4RTUA 4L6V5 3TCJA 1Y07A 4LNPA 2FPEA 4LUDA 1NBEB 2LJ3A 2O88A 4KGXB 2OTLA 4PJMA 3PE0A 3G6EQ 2KRSA 2EJFA 3CMAQ 4E7KA 2VV5A 4IIOA 1PD1A 3PVLA 3NTKA 2ED0A 1K9AA 4M7AB 2L0AA 1AD5A 3EGDB 1T3LA 2QQ9A 3NHNA 2CH4A 1VQ6Q 2CH4W 4JJNK 3AHUA 4PJOF 1WQWA 1EZZB 2LCCA 1TS9A 2PUKB 1B07A 2COZA 2E3HA 1M1GA 1NE8A 1TWBA 3REBB 2DEQA 3WXMB 2WSCE 3A8LB 1D1AA 3SHWA 2LMJA 2BKDN 2QYZA 1E6HA 3EG0A 3JCMW 1D0XA 2XK0A 4C8QE 1IZ6A 2R58A 2HEQA 1OQKA 1Q81C 2DERA 3CCJT 1KD1U 4Q5WA 4PL6A 3META 3LYIA 1VQ5T 1X6GA 4FSXA 5A0LA 2E6NA 2HZYA 2DYIA 4C92F 2GGRA 1Q86R 4R56A 1C1AA 1KQ2A 2KGTA 3M55A 2XMFA 3CCSQ 3ULRB 4E7ZA 3PIOA 3SWNB 1ARKA 2M02A 2O31A 1OZ3A 3OYEA 1VQKA 5AT1B 5FU7B 1UUEA 5GMKm 3QYGB 1RL2A 3H9NA 3G1JA 2KROA 4M7DB 2Y4YA 5KYUB 4AT1B 2QA4T 4J5YA 1MGQA 4J9CA 1Q7YC 1YHQQ 4CC3A 1LPLA 4ATOA 1RADB 3CMAA 1D1BA 3BE3A 4M78E 3M5AA 3UDCA 4NS5A 3X24B 4QKUA 4VUBA 1OYXA 3DKMA 2FHDA 3RERA 2DLPA 3EH1A 1VQ6A 4ZTFA 1VQ5Q 2VYTA 4BY6C 2OTJT 3J81E 1LVKA 1M90C 1BK2A 4PKCC 4D6WA 2HBWA 2L3SA 4IUUA 8ATCB 3A98A 2K79A 2DL3A 4PLIA 1SHGA 4RTZA 2M0YA 2FEIA 2KXDA 3UA7A 1JXMA 3JB9H 4JUVA 1WQ7A 3TVTA 1NM7A 2J6KA 5HCKA 4DOVA 3OS1A 4AG2C 4J6XA 3MEWA 2LVMA 1M8MA 2ABLA 4JJCA 3QSUA 2KNBB 2RQRA 1UHFA 2QA4Q 1MMGA 1WHMA 2NUZA 2A0FB 4BD3A 3MP1A 4M77E 2KYMA 4JRPA 3JCMJ 4N4GA 3C0CA 3OYJA 2P4RA 2JMAA 2KT1A 2HKQB 4M7AA 5I2SA 1OPLA 3EGDA 1WHJA 1R0BG 2E70A 3QDRB 3URGA 1A0NB 2VGMA 3CQTA 3SFMA 4BACA 3HTRA 2GTJA 3CCSA 5GMKj 3OQ5A 2K5LA 3FDRA 1HXDA 4FSSA 2KVQG 5IHIA 2DNUA 2QTXA 1PD0A 5GAN3 3VYGA 2COYA 2KY9A 3V7SA 3I55T 1I5OB 1KHIA 3KUFA 3REAB 3RKYA 4RTTA 5LJ5e 1X6BA 3HKSA 2RI5A 3PFSA 3RKWA 5IT9E 5GAOl 3EFRA 1K9MC 3L2RA 2J05A 3E9FA 2BE9B 1BKBA 1YHQA 1TSFA 2FPFA 3JB9D 1VQMT 1BI1A 3RR6A 3OYKA 4OGCA 4E7LA 3FB9A 2RK2A 2K3BA 1HYOA 2F1LA 2DL5A 4Z88A 1QVGS 4M4ZA 4M7AC 1AZGB 3CCMT 1Y57A 1M2VA 3VRYA 2DJQA 5KCHA 2O9SA 3GNFB 2FL7A 1VQ5A 1ZUUA 4Z8AA 5KYWB 2CUDA 1G83A 3QHSA 2KAFA 2QASA 3SWNA 2P4TA 4M75B 3CXCA 5DM7R 2DTOA 4A53A 1TXQA 2C0TA 2EYYA 3EG1A 4C5GA 3I55Q 1N5ZA 4M7DA 5KYUA 2V26A 2E12A 4QVCA 3GNGA 3RUXA 2QA4A 2KE9A 5FW9A 4BE0A 2BZ8A 3CCEQ 4RTWA 1VQLT 1G3TA 2P84A 2C0IA 2DE0X 3LX7A 2YLBA 3RBBB 3OW2P 5IH2A 4N4IA 1X6OA 1ZSGA 4BB7A 5LJ5g 3OYGA 3BFMA 3VS2A 2VB6A 2JTFA 5I22A 2VKNA 3HRUA 3OSVA 2XU8A 3SWNC 1HJDA 3CBOA 3M0SA 1Z9QA 4M7AD 1M3CA 5FU7C 5LJ5f 1PRMC 5CVIA 1NJIU 1OU8A 2FZCB 1BI2A 4PJJA 1Q82C 3X20B 2RA2A 1Y96B 2ED1A 4DBRA 4M7DC 4YTLA 5FROA 4BDZA 2EWNA 4N0AA 1BCOA 1I8FA 4ESRA 2L89A 5HKCA 4Y92A 1JJ2S 1H92A 1N8RU 2L5QA 4MDXA 1YWOA 3HRTA 4PJOE 5CAIA 2FB7A 1PKSA 1B3QA 2A08A 3G4SQ 3FEOA 2GCXA 2HDAA 2LDMA 3OA6A 5FRMA 2DBKA 2WSFE 1AWOA 3MEUA 2XDBA 3OYNA 4FU6A 4ZGDB 3CPFA 2DZCA 3WVDB 2CREA 1GCQC 2HSEB 2RPNA 3ZFJA 5IXFA 4M77B 3H41A 5FLXE 1UGRB 2DTIA 2FZKB 3RIRA 3I55A 1WXUA 1RABB 2C06A 3C12A 2NUPB 4L5GA 4N0AC 1YNZA 1QCFA 4Z02A 2AZVA 1WGSA 3E2UA 5GMKh 1VIFA 2JMCA 4EMKB 1TU0B 4DOWA 2KYBA 3KBGA 1CSKA
chains in the Genus database with same CATH topology
1OX8A 1OU9A 1OU8A 1TWBA 1ZSZC 1YFNA 1ZSZA 1OULA 2NYSA 2QASA 1ZSZB 2QAZA 1OX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OX8 A;  1OU9 A;  1OU8 A;  1TWB A;  1ZSZ C;  1YFN A;  1ZSZ A;  1OUL A;  2NYS A;  2QAS A;  1ZSZ B;  2QAZ A;  1OX9 A; 
#chains in the Genus database with same CATH topology
 1ZUY A;  1WHL A;  4EDU A;  1SSH A;  3M0Q A;  1ZQ1 A;  5CKF A;  4M7D D;  2ZPB B;  1K8A C;  1TOV A;  1WI7 A;  4B6M A;  3FC3 A;  4J7F A;  1ZBJ A;  3CCM A;  5KYX B;  3JCM e;  4QT7 A;  2FO0 A;  1QKW A;  2EPD A;  4DBF A;  5KYW A;  2CP0 A;  3HFO A;  3OYI A;  2JS0 A;  1VQN T;  1FYN A;  4HVW A;  3CCQ T;  2F5K A;  4J8O A;  1KSW A;  1C6V X;  2B86 A;  4M75 A;  3FJP A;  2HCK A;  3L42 A;  2XID A;  1HSQ A;  1YIJ T;  1UE9 A;  1XJW B;  3JCM V;  3M0U A;  1S72 T;  3HL8 A;  2CZ0 B;  4TVR A;  3PIP A;  2V8K A;  2ZPE B;  2JJ9 A;  3FIF A;  3PGG A;  5LJ5 d;  4FYY B;  3G4S A;  1PM3 A;  2A37 A;  1U1T A;  2EBP A;  1PNJ A;  2JTE A;  2EYQ A;  4ZNX A;  1SRL A;  2RHZ A;  3JB9 G;  4A54 A;  4JRI A;  1D3B B;  4HVV A;  3M57 A;  1K73 U;  1VOM A;  2DKG A;  2E1H A;  4C8Q C;  3OYD A;  1QP2 A;  5D7U A;  3RMS A;  1QVF P;  4M75 C;  3BDL A;  3UF4 A;  5L23 A;  1AT1 B;  1N27 A;  3L1A A;  2QQB A;  3C94 A;  2VGN A;  2D6F A;  4NL2 A;  1AHJ B;  4XTW A;  1TH7 A;  2KXC A;  2AK5 A;  1RAH B;  5GAN 2;  3CCL T;  1Y96 A;  3I56 T;  2CZ6 B;  4F7U G;  1AWX A;  1YIJ Q;  4JZ4 A;  1WPY A;  1UEC A;  2ROT A;  2DM1 A;  1VIE A;  2HL5 C;  5CO7 A;  1GRI A;  3JCM g;  2KEA A;  1S72 Q;  1Z9Z A;  1UEB A;  2DL7 A;  4LN2 A;  1I81 A;  1BBZ A;  1FX7 A;  4RKU E;  2I0N A;  3C95 A;  3GPL A;  2WSE E;  3M59 A;  2A28 A;  1ZUK A;  3JCM f;  3CCV T;  4Y91 A;  1EFN A;  2K5F A;  1JRI A;  4RTV A;  1MMA A;  4PK4 A;  1GXI E;  3CPW S;  2DBM A;  4P5N A;  1VYU A;  4PLL A;  2PUO B;  2FZG B;  1HD3 A;  3DLM A;  4DBH A;  4M77 A;  4OGE A;  2K9G A;  3EGU A;  1WHG A;  4Y28 E;  4FCY A;  1UGP B;  3JCM X;  2CZ7 B;  1F1B B;  3QPH A;  1NLO C;  4C8Q D;  2NUP A;  4M7A G;  1UGS B;  1Q7Y R;  4F7U B;  3MPU B;  1ABO A;  3CCL Q;  5CQX A;  3I56 Q;  1FMW A;  4JLG A;  4M75 D;  4EMK A;  1OEB A;  2F2X A;  2V1R A;  2VVK A;  1PG5 B;  2YRV A;  2GF7 A;  3M56 A;  3M0T A;  4ORZ A;  3DLL A;  1W2B P;  2YDL A;  1NYF A;  2CKK A;  2K57 A;  2HQX A;  1VYV A;  1YJN T;  4RG2 A;  4KUD K;  3TRE A;  5KYX A;  2PQW A;  1M90 R;  1I4K 1;  3P8H A;  2NUT B;  1X2Q A;  4CRI A;  1KQS A;  2JW4 A;  4JRQ A;  3QZ5 B;  3GIB A;  2YUP A;  3CCU Q;  4ZN3 A;  1KIK A;  3BW1 A;  2Z0W A;  4WF2 A;  4M77 C;  2SRC A;  2DO3 A;  4XU0 A;  3PMI A;  3M54 A;  3EG2 A;  1I0C A;  4PFP A;  2GFA A;  1PKT A;  3ZL7 C;  4IUV A;  1JQQ A;  2EQU A;  5KE2 A;  1VQ9 T;  1QQJ A;  1YIJ A;  1SHF A;  4LD6 A;  2DIG A;  2O4X B;  3V7R A;  1WJQ A;  2Y90 A;  1W4S A;  4EMK C;  2GNC A;  1OZ2 A;  1S72 A;  2G3R A;  5L8R E;  3J7A F;  1VQ8 T;  2HBP A;  2HSP A;  4CC2 A;  1KD1 C;  3JB9 F;  3L2U A;  2H3J A;  2DD4 A;  1R0C B;  2K2V A;  1D3B A;  1PRL C;  4DA4 A;  1M1K U;  3M9Q A;  2A36 A;  3ME9 A;  4M7D G;  1XQH A;  1YWP A;  1Y71 A;  4XAX B;  3H0I A;  2X4Y A;  2MIO A;  1AWW A;  3JCM d;  1K9M R;  1NG2 A;  4ZN1 A;  2HQH A;  3LWI A;  1CKB A;  3LWH A;  2H8H A;  4AG1 C;  1SSF A;  4ZTJ A;  2PTK A;  4F7U F;  3CCL A;  1ACM B;  3I56 A;  2KBT A;  5CKE A;  4C0G A;  4KT0 E;  1X27 A;  3MCA B;  4M77 D;  1M27 C;  2LX9 A;  1UDL A;  3VS7 A;  2H3E B;  2ECZ A;  3OW2 A;  4KGZ B;  1LJO A;  4J9E A;  2FPD A;  4NOY A;  4AFU C;  4BI8 B;  4XTZ A;  4RUG A;  3TSZ A;  4HVU A;  1JEG A;  2LNV A;  3O8V A;  5GAN j;  2EGE A;  1NEG A;  1NPP A;  2O01 E;  1VQ4 T;  3C4S A;  2CSQ A;  3CCU A;  2E6Z A;  2OAU A;  2EVR A;  5A0G A;  1X69 A;  1YJW T;  1WDX A;  1Q81 U;  9ATC B;  3QO3 A;  3F70 A;  1X2K A;  2IG0 A;  1V29 B;  1ZBX A;  1YJ9 T;  4M7A F;  1VUB A;  5LJ3 j;  4OMO A;  2R57 A;  4F7U A;  3LH0 A;  3CCJ Q;  1KC8 C;  2LNH B;  3QUI A;  2OAW A;  1N9S A;  3OYA A;  2FRW A;  2RO0 A;  4XU3 A;  2F5T X;  1TUG B;  3RNJ A;  4LXC A;  2MI6 A;  5CKH A;  1LCK A;  4EMG A;  4CI0 C;  4AFQ C;  1D09 B;  2RHI A;  2QQA A;  4FM4 B;  2V8I A;  4B9W A;  3ER0 A;  1YIT T;  1TUD A;  2D0Q B;  2BE7 D;  4LD9 K;  2V1Q A;  4FYX B;  4J9I A;  2MCN A;  2NUT A;  4A4G A;  2DJZ A;  1EIF A;  5A0D A;  4QQD A;  1VQ4 Q;  2RQU A;  2E5Q A;  2CT4 A;  1K0S A;  1Q82 R;  3OSS C;  5HY6 A;  2RM4 A;  5GAM h;  5KYN A;  2QQR A;  3PMT A;  1GCP A;  3JSC A;  4CC7 A;  1SG5 A;  2LZ6 B;  1Y0M A;  5J3B A;  2O4X A;  2QDY B;  4B9X A;  2QEX T;  3LW5 E;  4C8Q G;  4O6J A;  2KSS A;  3JB9 I;  1QCN A;  1FMK A;  4OMM A;  2OTJ Q;  1H8K A;  1UB4 A;  3HHT B;  1VQ8 A;  4M75 G;  1NPR A;  3UPU A;  2RB6 A;  5GAM g;  4IKF A;  1KQS S;  1VQ7 T;  1RAF B;  2DXB A;  4M7D F;  1FWZ A;  1TUC A;  3Q1J A;  4E7S A;  4A4K A;  1I5L A;  2ZZD A;  3PT9 A;  4OB3 B;  3JB9 J;  2FG0 A;  5HK0 A;  3OS5 A;  2ZGW A;  2EQJ A;  5GAM f;  4F14 A;  2M1H A;  1WX6 A;  1I1J A;  2DF6 A;  3DB4 A;  1H3H A;  3M0P A;  4WCI A;  3CCJ A;  2R5A A;  2HKN A;  2W10 A;  3EFO B;  2COW A;  2LQW A;  1MMD A;  3EGX B;  3CC7 T;  1UJY A;  3SDZ A;  4E2F B;  2XHC A;  2PVD B;  1G3S A;  4PNO A;  3CME T;  2EQM A;  2MWP A;  4C8Q B;  1QVG P;  1K8A R;  2IPO B;  4OB1 B;  1K1Z A;  4KBM B;  1AEY A;  1QW1 A;  5IXB A;  1N6A A;  1ZSZ B;  2MK5 A;  1QVF A;  2CUB A;  1MV0 B;  2CP6 A;  2AT1 B;  1VQ4 A;  2RHY A;  3U23 A;  1VQ7 Q;  3X26 B;  3IQL A;  3NTI A;  5CCA A;  1Q86 U;  1PWT A;  4RCB A;  1YJW A;  2CZ1 B;  4XTU A;  5CQY A;  2LTO A;  1VQM Q;  1NJI C;  3R6O A;  1G2B A;  5GAN h;  3QXE B;  2LQ8 A;  2BIV A;  5KYY B;  4BE1 A;  4GLM A;  3SD4 A;  2A3L A;  5GAN 4;  1YJ9 A;  3BY7 A;  2RQV A;  1UGQ B;  2M9U A;  4GBQ A;  3CCM Q;  4O5V A;  2E4H A;  1EX4 A;  2QK0 A;  2PZ1 A;  3A8O B;  3VU3 C;  1N8R C;  1U5S A;  4IUT A;  4D8K A;  2DZ9 A;  1GCQ A;  2P0Q A;  4C5E A;  2OTJ A;  3CC7 Q;  1KK7 A;  1K4U S;  1VQO T;  2DVE A;  2YHT A;  4M78 B;  3CME Q;  1BYM A;  4M77 G;  3EHQ A;  2E5K A;  4KUL A;  2F69 A;  5GAO n;  5LJ3 h;  1QWE A;  1OPK A;  2WAC A;  2K2M A;  4OB2 B;  2VUB A;  1QLY A;  3SB2 A;  2A7Y A;  5GMK e;  2B8A A;  3A8M B;  5D6Y A;  2EYX A;  1UTI A;  1MV3 A;  2YLC A;  3QKJ A;  4II1 A;  5GAO p;  4F17 A;  5GMK l;  3JAM E;  4BI3 A;  3X28 B;  4L59 A;  4OMP A;  4BE2 A;  3OMG A;  1JJ2 P;  2XG8 D;  1VQL Q;  1W2B A;  2CGH A;  1QP3 A;  3G7Z A;  2ZCF B;  5GAM d;  2X51 A;  1VQP T;  4C8Q F;  1X43 A;  4J9H A;  3CD6 T;  1AOJ A;  4IUP A;  4LDX A;  3PVQ A;  1NZ9 A;  2QEX A;  4AMC A;  2LC4 A;  4M75 F;  3TQ7 P;  4HCZ A;  1SKU B;  1M3A A;  3P8D A;  1VQO Q;  2M0O A;  1U8R A;  1M8V A;  3OYM A;  2QQS A;  3M53 A;  4LUE A;  1ZA1 B;  3CC2 T;  2RF0 A;  4C92 E;  1VQ7 A;  1FMV A;  1GBR A;  3QII A;  1OU9 A;  1RAI B;  4LDU A;  1W6X A;  1ZHI A;  3CCR T;  1GFC A;  4DEY A;  3MHX A;  3ZEH A;  3M4G A;  1VQM A;  2VXF A;  2QG9 B;  3UAT A;  2K3X A;  2GFU A;  1YFN A;  2ZPF B;  1CKA A;  2EKH A;  2XDP A;  3CBM A;  1NYG A;  3CEY A;  3EFO A;  1YI2 T;  1N9R A;  1H64 1;  2X4W A;  1E6G A;  3EGX A;  1WNL A;  2VAS A;  2JM8 A;  4JDS A;  2E64 A;  2L3Q A;  4C8Q A;  4JLI A;  2D1X A;  3CC7 A;  2DD5 A;  3D7S B;  3CME A;  2LT1 A;  2JT4 A;  1VQP Q;  2HQE A;  4QVZ A;  4MDW A;  3CD6 Q;  2DVJ A;  1G5V A;  3RES A;  2JN0 A;  1ZSZ A;  4M7A E;  3INZ A;  1MMN A;  1LNX A;  5IHK A;  1K73 C;  3GLX A;  2M16 A;  4EPC A;  2OTL T;  3NFC A;  2DXU A;  3A1P A;  1QWF A;  3FJ5 A;  2RJE A;  3CC2 Q;  1GL5 A;  2DXT A;  4ZGE B;  3GOX A;  1HK9 A;  1M3B A;  1BIB A;  1QMC A;  3EH2 A;  3CCR Q;  1YCS B;  1X01 A;  2EIF A;  5KYY A;  4A4E A;  2E65 A;  1VQL A;  5EG2 A;  1SEM A;  2GQV A;  3DB3 A;  4RTX A;  2NLU A;  2RNA A;  3GP8 A;  1B34 B;  1YI2 Q;  2RK1 A;  4JS4 A;  1KD1 R;  2G6F X;  3FRN A;  1U3O A;  3CXC S;  1S1N A;  4QVD A;  2KQW A;  4HXJ A;  4M78 A;  4M77 F;  1VQN Q;  1VQO A;  4J83 A;  5GJV B;  2E41 A;  1ZSZ C;  2HD0 A;  3CCQ Q;  4A4F A;  2ESW A;  3I5R A;  5C0M A;  5GAN 6;  2D8J A;  4HCB A;  2KRN A;  1WA7 A;  2I2L A;  4XU2 A;  2K5I A;  2JVV A;  1DJ7 B;  4BDY A;  2AZS A;  1UHC A;  2ZPG B;  2DAQ A;  1WXB A;  1M5Q 1;  2LCS A;  2QXF A;  1OV3 A;  4ELZ C;  1SPK A;  2FRY A;  2PNI A;  4XTX A;  3V7C A;  4ANJ A;  2MF2 A;  5M9O A;  3OBW A;  5GAO r;  2E3I A;  4PJL A;  3UWN A;  1VQP A;  1MNE A;  2MMP A;  4J9D A;  4PJO B;  4M78 C;  3UT1 A;  2DEU A;  3CD6 A;  1JO8 A;  3OYL A;  2QDL A;  1OX8 A;  1ZA2 B;  5I2M A;  2HNI A;  3CPW P;  3WVE B;  2DRM A;  3E1S A;  2EQI A;  3G6E T;  3CC2 A;  2BTT A;  4C0Z A;  2RJC A;  2DL8 A;  5CR2 A;  3CCR A;  2DL4 A;  1J3T A;  2CSI A;  2E10 A;  1KC8 R;  2LX7 A;  2VC8 A;  2DET A;  1WFW A;  1ZX6 A;  3LH5 A;  3S6W A;  2DYB A;  2P0K A;  4NL3 A;  2BZX A;  4C92 B;  1RAA B;  2K3Y A;  2IVW A;  1YI2 A;  1C0M A;  4MML A;  2JM9 A;  3RKX A;  3KFV A;  3CCV Q;  4FYV B;  1T3S A;  4JS5 A;  1W70 A;  1TTH B;  2NWM A;  3OS0 A;  1VQN A;  1B7T A;  2JUF A;  4GY5 A;  2O2O A;  2J6F A;  5IHN A;  2BUD A;  2FYK A;  3CCQ A;  2CS7 A;  2C0O A;  1M1K C;  2SEM A;  5CIU A;  3AT1 B;  3L2W A;  4M78 D;  3ASK A;  2RI2 A;  2ZPH B;  2YUN A;  3QG1 A;  4PFZ A;  1OX9 A;  3HPW A;  4OMQ A;  4E47 A;  3MEV A;  7AT1 B;  2X35 A;  2JXB A;  1RLP C;  2CT3 A;  3UA6 A;  1QVG A;  3CC4 T;  4KH1 B;  2EKO A;  4A4H A;  4WTO B;  3CCS T;  5I11 A;  1LOJ A;  1BU1 A;  1B34 A;  4HCC A;  3TU4 K;  1YJN Q;  3QDF A;  1WZO A;  4X9C A;  3V8L A;  2OJ2 A;  4AFS C;  4FYW B;  2DIQ A;  2MOX A;  1SRM A;  2X9H A;  2MPX C;  2RI3 A;  2HMA A;  3MKD A;  5GMK i;  3VS1 A;  2JS2 A;  1IRE B;  1YHQ T;  2AKK A;  2BZY A;  4J9F A;  1VQ9 Q;  3OBY A;  1KJW A;  3OYC A;  1YCY A;  1UFF A;  1KFZ A;  4RG8 A;  1U06 A;  1YN8 A;  1RAC B;  1Y7X A;  1UJ0 A;  3VJP A;  4M75 E;  4JJD A;  3TSW A;  3VV0 A;  1WXT A;  5LJ5 j;  1VQ8 Q;  4RCC A;  2J06 A;  1M2V B;  2QGG A;  1O75 A;  3A8H B;  1MND A;  3CBP A;  2DFU A;  5DLO A;  4E7J A;  2ZAE A;  2F2V A;  3OY9 A;  3E19 A;  3CCV A;  3CC4 Q;  3VUZ A;  1JB0 E;  4PJO A;  1K0X A;  2MWO A;  1G8X A;  3GBQ A;  5GAM e;  4DQ2 A;  3QBY A;  2F2W A;  2YRD A;  2D9T A;  2LT4 A;  3HFN A;  3JRZ A;  3H0F A;  5KCO A;  3M58 A;  1RAE B;  4LE9 A;  4KRT A;  3G6E A;  1NJI R;  4OP0 A;  1JJ2 A;  1M9S A;  3I9Q A;  3OYH A;  2GQI A;  3VS5 A;  2M51 A;  2DA9 A;  2AKL A;  5IN1 A;  4F04 B;  1BIA A;  2VWF A;  3LGF A;  2KDS A;  4EMH A;  3PTA A;  3MP8 A;  4FT4 A;  4ME7 A;  4C92 A;  4K11 A;  1BCM A;  4IIM A;  4OMN A;  1N8R R;  2YT6 A;  1UGV A;  4J6Y A;  1YJN A;  2V8J A;  3H8Z A;  3VS0 A;  2EJG A;  1Q7Y U;  4PJO C;  4XQ3 A;  5GAN 8;  1UG1 A;  2XKO C;  4R0K A;  4J9B A;  3THK A;  1YJW Q;  2ATC B;  4UC4 A;  4PJN A;  4DBQ A;  1XOV A;  1G3Y A;  3QYH B;  2X3X D;  1GBQ A;  1KC8 U;  4XU1 A;  2KMT A;  2QAZ A;  2HAX A;  1VQ9 A;  4KGV B;  1YJ9 Q;  1M90 U;  1IGQ A;  1W1F A;  1PSE A;  3L2Q A;  3NTH A;  5GAN 5;  4HKE A;  1P92 A;  3OB9 A;  1AZE A;  5ECA A;  1VYT A;  1E7O A;  1M2O A;  3OMC A;  4C92 C;  3J80 E;  5KH6 A;  1RI0 A;  1WLP B;  4JJB A;  3CC4 A;  1PCX A;  2L3R A;  1YIT Q;  2KRM A;  4FL6 A;  1T0J A;  4EIK A;  4BI4 A;  1KQS P;  1IO6 A;  5FU6 B;  3G71 T;  5GAN e;  2D0N A;  3VRZ A;  4HCK A;  2L2P A;  1OOT A;  2CP2 A;  3FLG A;  2LQK A;  1PC0 A;  1WJS A;  3I5S A;  2EQK A;  4PJO D;  3VS6 A;  1X75 C;  3CCE T;  1QCO A;  2ROL A;  1R77 A;  2CP7 A;  1Q86 C;  1RLQ C;  3S3O A;  3N5B B;  2QEX Q;  2JTM A;  2EYZ A;  4M78 G;  2EGA A;  1BI3 A;  4E7H A;  3S3M A;  3A8G B;  5LJ3 e;  5C6S A;  2XDD A;  1GFD A;  4ZGJ B;  4KUI A;  2NYS A;  1K9M U;  1WHK A;  1KQ1 A;  2DX1 A;  1YP5 A;  3ZBD A;  2EW3 A;  3EAE A;  3MO8 A;  3HRS A;  3JCM P;  4X34 A;  1K73 R;  4C92 D;  3GF5 A;  3PNW C;  5LJ5 h;  4OB0 B;  4IUR A;  2XI9 A;  3MP6 A;  1D0Y A;  3G71 Q;  4RMO A;  1IHW A;  1I07 A;  2DPP B;  3P8B B;  3T9N A;  3OW2 S;  3G4S T;  1KHC A;  2JNG A;  3LGL A;  2AHJ B;  3OYY A;  2EGC A;  2RQW A;  4R55 A;  4LDV A;  3JCM b;  4C0F A;  2YXY A;  5HK3 A;  5CK9 A;  1V1C A;  2L8D A;  2RMO A;  2PU9 B;  4C0D B;  1YIT A;  5GAN g;  1MUZ A;  4JZ3 A;  2O9V A;  5I21 A;  2KT8 A;  1SF9 A;  1T0H A;  3QWX X;  3BDU A;  2RJF A;  3M4Y A;  1M30 A;  2X4J A;  3CPW A;  2K6D A;  2J7I A;  2ZPI B;  4J7I A;  1ABQ A;  1KG1 A;  2XD0 A;  5GAN f;  5AYF A;  1NLP C;  1WJR A;  4OML A;  3H0H A;  4QQ6 A;  2YWW A;  5LL6 S;  4FW2 A;  5FWB A;  1OUL A;  5LJ3 g;  3SEM A;  3JV3 A;  3O5Z A;  3NMZ C;  2EFI A;  2RN8 A;  1RUW A;  2EAY A;  4X1V A;  5CKD A;  1IB8 A;  4AFZ C;  2D8H A;  8AT1 B;  2VXE A;  3OYF A;  2ENM A;  3HP9 A;  4E6R A;  3EG3 A;  5LJ3 f;  1Q82 U;  1IHV A;  2PVO B;  4F7U E;  4MMK A;  3QZ9 B;  4PFO A;  4RTY A;  4E7I A;  2RH2 A;  1YBY A;  3RDV A;  4J6W A;  5DY9 A;  3NGP A;  5GJW B;  3KXT A;  1NEB A;  5FRN A;  3G71 A;  3NPF A;  1RAG B;  1M1F A;  5IAY A;  3RMQ A;  2LQN A;  1V76 A;  3H6Z A;  2JOY A;  4XTV A;  1FXX A;  2AIR B;  2RHX A;  1IRX A;  5GAO q;  3CCE A;  3QJY A;  3EG9 B;  4MZP A;  5KE3 A;  1WHH A;  1TG0 A;  4M78 F;  2QTV A;  2EJ9 A;  2KK4 A;  4FIB A;  3MEA A;  2W0Z A;  1AWJ A;  2CYZ B;  3V8J A;  2OX7 A;  4XTY A;  2MYS A;  1D1C A;  4D8D A;  5GAN 7;  3OYB A;  4QQG A;  4CC4 B;  4BUG A;  2LCL A;  3M0R A;  4ELY C;  1M4Z A;  5FU6 C;  4C5I A;  4Z89 A;  2LRQ A;  3A5Z B;  3E9G A;  1RI9 A;  2RD1 A;  3VS4 A;  1M1K R;  1K8A U;  1G3W A;  5A2Q E;  4LDW A;  3VKI A;  1MHN A;  2J6O A;  1D0Z A;  1JU5 C;  3HSB A;  3QWY A;  5D6W A;  2X4X A;  2RQT A;  1WYX A;  1JBM A;  4OF1 A;  4F16 A;  3X25 B;  3TEE A;  3LLR A;  5GAN d;  1JXO A;  2P0P A;  1BB9 A;  1R8O B;  2HL3 A;  2YUO A;  4PJO G;  4KH0 B;  3VYH B;  2EYW A;  1QVF S;  1IGU A;  5J26 A;  4QW2 A;  5CKB A;  4HT8 A;  3JCM h;  4J9G A;  4GLK A;  3CXC P;  2K7A A;  2YSQ A;  1XTD A;  4JPB W;  2QI2 A;  3OS2 A;  4MZM A;  5EC7 A;  3MJX A;  3V8K A;  2CP5 A;  4V2S A;  2DXC A;  2PVG B;  5LJ3 d;  2OTL Q;  1WIE A;  3EFS A;  3QJ6 A;  1AVZ C;  4OVA A;  2GBQ A;  2LP5 A;  2DTH A;  4JRK A;  5FWC A;  1QKX A;  1BI0 A;  2CDT A;  1O9S A;  2DIL A;  2R5M A;  4M7D E;  4C92 G;  1Q81 R;  4C5H A;  2RJD A;  3R6N A;  4BY6 B;  2DK3 A;  1VQK T;  2YRC A;  1PSF A;  2K4Y A;  3S3N A;  2DMO A;  2GTO A;  2KI7 A;  5DLQ E;  3L2Z A;  2MAM A;  3JCM c;  4C0D C;  3CCU T;  3EHR A;  2OI3 A;  3I35 A;  4A63 B;  2DRK A;  1U1S A;  2Y4X A;  3L2V A;  2KR3 A;  2CP3 A;  2L3P A;  3JCM Q;  3CMA T;  4HT9 A;  1PHT A;  2FVU A;  1OI1 A;  5D6X A;  1K76 A;  2IIM A;  1W2B S;  1QVP A;  1VQ6 T;  2LJ1 A;  2X3W D;  4X9D A;  5J39 A;  1H3Z A;  4MZT A;  4IUQ A;  1Q95 G;  2XIC A;  5GAO m;  4HA8 A;  3VUB A;  4XK8 E;  1IXD A;  2YUQ A;  3EG9 A;  1ZLM A;  4OMF B;  4LDY A;  5GAM j;  6AT1 B;  4N4H A;  4FT2 A;  1VQK Q;  2RHU A;  2JZ2 A;  1VA7 A;  4FW1 A;  4DEX A;  1XNI A;  2LJ0 A;  3VS3 A;  2QGF B;  4RTU A;  4L6V 5;  3TCJ A;  1Y07 A;  4LNP A;  2FPE A;  4LUD A;  1NBE B;  2LJ3 A;  2O88 A;  4KGX B;  2OTL A;  4PJM A;  3PE0 A;  3G6E Q;  2KRS A;  2EJF A;  3CMA Q;  4E7K A;  2VV5 A;  4IIO A;  1PD1 A;  3PVL A;  3NTK A;  2ED0 A;  1K9A A;  4M7A B;  2L0A A;  1AD5 A;  3EGD B;  1T3L A;  2QQ9 A;  3NHN A;  2CH4 A;  1VQ6 Q;  2CH4 W;  4JJN K;  3AHU A;  4PJO F;  1WQW A;  1EZZ B;  2LCC A;  1TS9 A;  2PUK B;  1B07 A;  2COZ A;  2E3H A;  1M1G A;  1NE8 A;  1TWB A;  3REB B;  2DEQ A;  3WXM B;  2WSC E;  3A8L B;  1D1A A;  3SHW A;  2LMJ A;  2BKD N;  2QYZ A;  1E6H A;  3EG0 A;  3JCM W;  1D0X A;  2XK0 A;  4C8Q E;  1IZ6 A;  2R58 A;  2HEQ A;  1OQK A;  1Q81 C;  2DER A;  3CCJ T;  1KD1 U;  4Q5W A;  4PL6 A;  3MET A;  3LYI A;  1VQ5 T;  1X6G A;  4FSX A;  5A0L A;  2E6N A;  2HZY A;  2DYI A;  4C92 F;  2GGR A;  1Q86 R;  4R56 A;  1C1A A;  1KQ2 A;  2KGT A;  3M55 A;  2XMF A;  3CCS Q;  3ULR B;  4E7Z A;  3PIO A;  3SWN B;  1ARK A;  2M02 A;  2O31 A;  1OZ3 A;  3OYE A;  1VQK A;  5AT1 B;  5FU7 B;  1UUE A;  5GMK m;  3QYG B;  1RL2 A;  3H9N A;  3G1J A;  2KRO A;  4M7D B;  2Y4Y A;  5KYU B;  4AT1 B;  2QA4 T;  4J5Y A;  1MGQ A;  4J9C A;  1Q7Y C;  1YHQ Q;  4CC3 A;  1LPL A;  4ATO A;  1RAD B;  3CMA A;  1D1B A;  3BE3 A;  4M78 E;  3M5A A;  3UDC A;  4NS5 A;  3X24 B;  4QKU A;  4VUB A;  1OYX A;  3DKM A;  2FHD A;  3RER A;  2DLP A;  3EH1 A;  1VQ6 A;  4ZTF A;  1VQ5 Q;  2VYT A;  4BY6 C;  2OTJ T;  3J81 E;  1LVK A;  1M90 C;  1BK2 A;  4PKC C;  4D6W A;  2HBW A;  2L3S A;  4IUU A;  8ATC B;  3A98 A;  2K79 A;  2DL3 A;  4PLI A;  1SHG A;  4RTZ A;  2M0Y A;  2FEI A;  2KXD A;  3UA7 A;  1JXM A;  3JB9 H;  4JUV A;  1WQ7 A;  3TVT A;  1NM7 A;  2J6K A;  5HCK A;  4DOV A;  3OS1 A;  4AG2 C;  4J6X A;  3MEW A;  2LVM A;  1M8M A;  2ABL A;  4JJC A;  3QSU A;  2KNB B;  2RQR A;  1UHF A;  2QA4 Q;  1MMG A;  1WHM A;  2NUZ A;  2A0F B;  4BD3 A;  3MP1 A;  4M77 E;  2KYM A;  4JRP A;  3JCM J;  4N4G A;  3C0C A;  3OYJ A;  2P4R A;  2JMA A;  2KT1 A;  2HKQ B;  4M7A A;  5I2S A;  1OPL A;  3EGD A;  1WHJ A;  1R0B G;  2E70 A;  3QDR B;  3URG A;  1A0N B;  2VGM A;  3CQT A;  3SFM A;  4BAC A;  3HTR A;  2GTJ A;  3CCS A;  5GMK j;  3OQ5 A;  2K5L A;  3FDR A;  1HXD A;  4FSS A;  2KVQ G;  5IHI A;  2DNU A;  2QTX A;  1PD0 A;  5GAN 3;  3VYG A;  2COY A;  2KY9 A;  3V7S A;  3I55 T;  1I5O B;  1KHI A;  3KUF A;  3REA B;  3RKY A;  4RTT A;  5LJ5 e;  1X6B A;  3HKS A;  2RI5 A;  3PFS A;  3RKW A;  5IT9 E;  5GAO l;  3EFR A;  1K9M C;  3L2R A;  2J05 A;  3E9F A;  2BE9 B;  1BKB A;  1YHQ A;  1TSF A;  2FPF A;  3JB9 D;  1VQM T;  1BI1 A;  3RR6 A;  3OYK A;  4OGC A;  4E7L A;  3FB9 A;  2RK2 A;  2K3B A;  1HYO A;  2F1L A;  2DL5 A;  4Z88 A;  1QVG S;  4M4Z A;  4M7A C;  1AZG B;  3CCM T;  1Y57 A;  1M2V A;  3VRY A;  2DJQ A;  5KCH A;  2O9S A;  3GNF B;  2FL7 A;  1VQ5 A;  1ZUU A;  4Z8A A;  5KYW B;  2CUD A;  1G83 A;  3QHS A;  2KAF A;  2QAS A;  3SWN A;  2P4T A;  4M75 B;  3CXC A;  5DM7 R;  2DTO A;  4A53 A;  1TXQ A;  2C0T A;  2EYY A;  3EG1 A;  4C5G A;  3I55 Q;  1N5Z A;  4M7D A;  5KYU A;  2V26 A;  2E12 A;  4QVC A;  3GNG A;  3RUX A;  2QA4 A;  2KE9 A;  5FW9 A;  4BE0 A;  2BZ8 A;  3CCE Q;  4RTW A;  1VQL T;  1G3T A;  2P84 A;  2C0I A;  2DE0 X;  3LX7 A;  2YLB A;  3RBB B;  3OW2 P;  5IH2 A;  4N4I A;  1X6O A;  1ZSG A;  4BB7 A;  5LJ5 g;  3OYG A;  3BFM A;  3VS2 A;  2VB6 A;  2JTF A;  5I22 A;  2VKN A;  3HRU A;  3OSV A;  2XU8 A;  3SWN C;  1HJD A;  3CBO A;  3M0S A;  1Z9Q A;  4M7A D;  1M3C A;  5FU7 C;  5LJ5 f;  1PRM C;  5CVI A;  1NJI U;  1OU8 A;  2FZC B;  1BI2 A;  4PJJ A;  1Q82 C;  3X20 B;  2RA2 A;  1Y96 B;  2ED1 A;  4DBR A;  4M7D C;  4YTL A;  5FRO A;  4BDZ A;  2EWN A;  4N0A A;  1BCO A;  1I8F A;  4ESR A;  2L89 A;  5HKC A;  4Y92 A;  1JJ2 S;  1H92 A;  1N8R U;  2L5Q A;  4MDX A;  1YWO A;  3HRT A;  4PJO E;  5CAI A;  2FB7 A;  1PKS A;  1B3Q A;  2A08 A;  3G4S Q;  3FEO A;  2GCX A;  2HDA A;  2LDM A;  3OA6 A;  5FRM A;  2DBK A;  2WSF E;  1AWO A;  3MEU A;  2XDB A;  3OYN A;  4FU6 A;  4ZGD B;  3CPF A;  2DZC A;  3WVD B;  2CRE A;  1GCQ C;  2HSE B;  2RPN A;  3ZFJ A;  5IXF A;  4M77 B;  3H41 A;  5FLX E;  1UGR B;  2DTI A;  2FZK B;  3RIR A;  3I55 A;  1WXU A;  1RAB B;  2C06 A;  3C12 A;  2NUP B;  4L5G A;  4N0A C;  1YNZ A;  1QCF A;  4Z02 A;  2AZV A;  1WGS A;  3E2U A;  5GMK h;  1VIF A;  2JMC A;  4EMK B;  1TU0 B;  4DOW A;  2KYB A;  3KBG A;  1CSK A; 
#chains in the Genus database with same CATH homology
 1OX8 A;  1OU9 A;  1OU8 A;  1TWB A;  1ZSZ C;  1YFN A;  1ZSZ A;  1OUL A;  2NYS A;  2QAS A;  1ZSZ B;  2QAZ A;  1OX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...