4J6WA

Crystal structure of hfq from pseudomonas aeruginosa in complex with ctp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
67
structure length
67
Chain Sequence
HSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Protein hfq
publication title Hfq binds ribonucleotides in three different RNA-binding sites.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 17
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4j6wA00
2ZGWA 5GAN6 5GAOq 3SWNB 1YCYA 4JUVA 2DKGA 2VXFA 5GAN7 4XTZA 4V2SA 4M78B 5GAOp 5GAN5 1N9RA 3JB9D 4EMKC 2DTOA 4M75A 4MMLA 2FB7A 3BDUA 3QHSA 4X9CA 4C92F 1WQ7A 4JLIA 4XTWA 3SWNA 2JN0A 2I2LA 1D3BB 2VC8A 3V7SA 1BIBA 5LJ3j 2DZ9A 3V7CA 1U1TA 4EMGA 4F7UF 1U1SA 5GAN8 5GANg 5GAOl 3QSUA 4M78A 4WF2A 1Y96A 4M78E 4XTXA 2QTXA 5GMKe 5GMKj 4F7UE 5GAOm 4C8QF 4M7AD 4M78C 3HFNA 4N0AA 4EMKB 3RESA 3JCMV 4M7DD 2DXTA 5GAN2 4M78G 4C8QE 3BW1A 4F7UG 1D3BA 4C8QC 4QVDA 1MGQA 1I5LA 1JRIA 4PJOF 3JB9F 4J6WA 3V8LA 3L2ZA 4C8QG 5GAOn 4C92B 2FYKA 1LNXA 5I21A 2EJGA 1BIAA 3JCMQ 4PJOE 2RB6A 4Y91A 1I81A 4EMKA 5GANh 4M77F 3GIBA 4PJOC 4M75D 3QUIA 2Y90A 3INZA 4F7UB 1WQWA 4HT8A 2K57A 5GANd 3JB9H 4M77E 4PJOG 4RCCA 3VU3C 4M77C 4C8QB 3JCMW 4HT9A 2E65A 4XU2A 3V8JA 3JCMc 4M77G 4C92E 1HK9A 1KQ2A 2EJFA 4M78D 1B34B 2RA2A 3RKWA 4C92C 5CAIA 5GANf 5DY9A 3RERA 4F7UA 4J6XA 4C92G 2YHTA 1LOJA 2RD1A 1N9SA 4PNOA 4XU3A 3JCMh 4C8QA 4NL2A 4XTUA 4NL3A 3HSBA 4M77B 2E64A 5LJ3h 3JCMd 1B34A 4EMHA 3RKXA 5GAMh 4J6YA 2DEQA 5LJ3d 4PJOA 2HNIA 2YLBA 4M7AB 3FB9A 5LJ5h 5GAN4 5GAMd 1KQ1A 3JCMJ 4M7DB 3FJPA 3JCMg 3V7RA 3JCMf 4J5YA 1M8VA 3L1AA 2RM4A 4M77A 5LJ5d 3JB9G 5LJ3g 5LJ3f 3PGGA 3BFMA 4JRIA 1X01A 2DTHA 4X9DA 4DQ2A 4M7AF 1I4K1 4XU0A 3M4GA 3RUXA 5GAMg 4C92A 5GAMf 4M7DF 3SB2A 4NOYA 5GANe 5GANj 4M7AE 5LJ5g 5LJ5f 4HA8A 4M7AC 3EFRA 2E41A 4M7DE 2VXEA 2DVEA 4XU1A 4M7DC 5GMKi 4C8QD 4M7AG 3HFOA 2E1HA 3RIRA 1M5Q1 5GMKl 1JBMA 2E10A 2DZCA 3RKYA 4M7DG 2EWNA 1WNLA 1WPYA 4OP0A 5GMKm 1I8FA 2DJZA 3EFSA 4XQ3A 4M75F 1H641 1TH7A 1Y96B 4PJOD 5GMKh 1HXDA 4M75E 5GAN3 2CGHA 2DTIA 3JCMe 3QO3A 4M75C 4XTYA 3BY7A 4M77D 4A53A 5LJ3e 3AHUA 4M75G 4M78F 4QVCA 3SWNC 4RCBA 3JB9I 5GAMe 4C92D 5GAMj 3JCMP 4A54A 4JRKA 2YLCA 2DXUA 4XTVA 5LJ5e 4M7AA 5LJ5j 3V8KA 1LJOA 4M7DA 2EJ9A 2EAYA 4N0AC 3JCMb 5GAOr 4M75B 3FIFA 4MMKA 4PJOB 3JCMX 3JB9J
chains in the Genus database with same CATH superfamily
2E5KA 3KFVA 1C6VX 2X4XA 2LJ0A 2DIQA 2VXFA 5GJVB 4OMNA 3CD6T 2Y4XA 1KK7A 3EGUA 3NPFA 2HKNA 4L59A 1IHVA 4E47A 3CPWP 2DERA 2O01E 2CH4A 1M3CA 2PUKB 1JJ2A 1ZX6A 3C94A 4RTWA 4PJOB 2KXCA 1Q81C 4M78G 2WSFE 1XOVA 1WHGA 1YJWA 1PM3A 2EPDA 2X3WD 3R6OA 3TSWA 4M77F 1Q86U 3CCRT 2C0IA 2YUQA 4J9IA 2JT4A 1PD1A 3VU3C 4C8QB 1UUEA 4J7FA 2RA2A 1M1KC 1OU8A 1M27C 3OSVA 4C92G 3CCQT 4KRTA 1WJRA 1JB0E 1K9MC 4R0KA 2RQRA 1BU1A 1FMWA 3LLRA 1EIFA 1SPKA 2HNIA 1ZSZB 4JJDA 1VQ8T 4J5YA 1M8VA 3A8OB 3EG3A 1K9AA 5EG2A 4KGXB 1KQSS 4FW2A 2L89A 3EG9B 3EGDB 3M4YA 4PLLA 1WNLA 4ZGEB 3CCSQ 1RADB 1VQMA 2LX7A 4RG2A 1ZSGA 4C5HA 1YITT 2FO0A 4AFZC 3BY7A 4IUUA 2DRMA 4LUDA 3AHUA 3PE0A 3JB9I 1QCNA 3H9NA 2P0QA 1G2BA 1S1NA 3DLLA 2RJDA 4FSSA 4N4IA 1NJIU 4E7KA 2YRVA 3S3MA 2Z0WA 4BI3A 1YI2A 2XDPA 5HK3A 5FW9A 1S72A 4F14A 2LMJA 5IAYA 2KAFA 3QBYA 4UC4A 5LJ3j 1BIBA 1X27A 3BE3A 3HKSA 1M90U 3OW2S 2M51A 2X4JA 3E19A 3BW1A 4F16A 3UT1A 1ZUKA 4J6WA 1VQLA 1UECA 8ATCB 5CKDA 3JCMQ 4M75D 3QUIA 1D1BA 2VKNA 2LQ8A 2CT4A 3CXCS 2NUPB 2VUBA 4LUEA 4M77C 4AMCA 1BK2A 2EFIA 2DL4A 2KI7A 3RKWA 4RG8A 1QQJA 3RERA 4J6XA 1RI9A 5CKEA 2HKQB 3PMIA 4XTUA 1KFZA 3EGXA 2V1RA 4Z8AA 1KC8C 4PJOA 3CCMT 1BI1A 4PFZA 2ZCFB 3MPUB 1M8MA 2EYYA 4RUGA 3P8DA 2P4TA 2XG8D 1QVFS 3CCVT 2E41A 5C6SA 3SEMA 4C8QD 5IXBA 3EHQA 1TXQA 2B8AA 2YRCA 4ZN3A 1A0NB 4M75F 4K11A 3OYLA 2ROLA 4KULA 4AFSC 4WTOB 3OYDA 2LTOA 2K4YA 1QKXA 4AFQC 2KT1A 4RCBA 1M3BA 2O2OA 4WCIA 1WHJA 1WYXA 1YI2Q 3HL8A 2AKKA 1GCPA 4E7LA 3OYKA 2ZGWA 5CK9A 1MMDA 4XTZA 2JTEA 2K5FA 3S3OA 4M78B 3JB9D 3CC4Q 1VQ9T 4KH1B 3EG9A 3EGDA 1WQ7A 2JN0A 4PLIA 2I2LA 1D3BB 2H3EB 1JJ2S 2L5QA 4FYXB 2QA4Q 2LCSA 2M02A 1WXBA 3L42A 1WHHA 2DPPB 3CMAA 2AK5A 3QYGB 4C8QF 5KE2A 1OULA 4FL6A 2VVKA 3VS1A 2FPEA 5I2MA 3VUZA 4BE2A 2DO3A 1OYXA 3A8GB 4ESRA 5DLOA 1OQKA 1RAIB 2EQKA 4RTUA 4C92B 2BUDA 3VV0A 3TSZA 2BZYA 4HCKA 1Q82R 2DL7A 2K57A 4OB1B 3CCJQ 1G3YA 3LW5E 2EJFA 1B34B 1D09B 4E6RA 3MKDA 2YHTA 1N9SA 3C0CA 2IIMA 4J7IA 3JCMd 2SEMA 2KYMA 2MF2A 1KD1U 3PVQA 2RQWA 3M0UA 2CP7A 4Z89A 1KIKA 2EKOA 3JCMg 2DIGA 2FL7A 4BI4A 2KEAA 2LP5A 3BFMA 4AT1B 2DTHA 1VQ5Q 2K79A 5J3BA 4EDUA 5GANj 1G83A 4IIOA 1YJNT 1VQKT 2DILA 3MP8A 1X43A 2EWNA 4PFPA 1AWJA 2K2VA 3CBPA 1UTIA 4ANJA 4DOWA 4JS4A 3JCMe 1RAAB 1WXTA 4M75C 1IRXA 4XTYA 2X4WA 1RL2A 1U3OA 3M0RA 3CCLQ 4DBRA 2NUTB 1CKAA 4HCBA 1UJ0A 5LJ5j 2CYZB 2KVQG 5CKFA 4PJNA 5FLXE 5FRMA 2DAQA 4MMKA 1QVGP 1PSFA 4MDXA 4PK4A 2R58A 2E70A 4R56A 1OU9A 3CPWS 2A7YA 2EGAA 5KYWA 1AZEA 3L2QA 4BACA 3S6WA 1K8AR 4XTWA 3CBOA 5HK0A 3G4ST 2VC8A 3V7CA 1U1TA 5GAN8 3CMEA 1U1SA 1OOTA 1OPLA 1VYUA 1X69A 2V8IA 2OJ2A 3RESA 2DM1A 1NYGA 2DXTA 5GAN2 1R77A 3X28B 2EVRA 4C8QC 1MGQA 1ZHIA 4D8DA 4LDVA 3FC3A 4KH0B 2JNGA 5FWCA 1WQWA 3ME9A 4RCCA 4C0FA 1RACB 3JCMc 1NYFA 2DVJA 2D9TA 2K3BA 4M78D 1K76A 1K0SA 1UJYA 3I9QA 1ZSZC 4PNOA 2EQIA 1MNEA 3QWXX 4Z02A 3CC2T 3L1AA 2K9GA 3EG1A 1VQPQ 1Q81R 4JRIA 3CCST 3M4GA 2HQHA 4C92A 5GAMf 4MZTA 2RHZA 1XQHA 4F04B 1VQ7A 2PVOB 1IGUA 2GFAA 4GLMA 2D0NA 5LL6S 1XNIA 3EH1A 2BIVA 3GLXA 5GAN3 2RQUA 2HL3A 1VQ4Q 4J9HA 1M1KR 2YUPA 3NTIA 4M78F 4ATOA 3BDLA 2AZSA 3HRSA 3EAEA 4C0GA 1KQSA 2RF0A 2P84A 1BI2A 1O75A 3VS5A 5GAN7 3CMEQ 2QYZA 5FU6B 2EQJA 1D0ZA 5GAN5 1OV3A 4BY6B 1X2KA 4FIBA 1JU5C 2RJEA 4QW2A 2L0AA 4C92F 4EIKA 1J3TA 3M53A 3PNWC 3OYBA 3VYHB 2BZ8A 5CIUA 3OYJA 3A98A 1GL5A 5KYYA 2RHIA 1YCSB 2NUTA 3CCUQ 5I21A 1LNXA 2D6FA 1SRLA 4PJOE 2P0PA 4DBFA 3G71Q 2KROA 2XK0A 3O8VA 4HT8A 2MWOA 4F17A 5GANd 1UG1A 4LDUA 2M9UA 3TU4K 4XU2A 3GNFB 3UF4A 2HEQA 2LQWA 3G1JA 3H0FA 2OTJQ 5L8RE 3JCMh 3OW2A 1XJWB 2ROTA 2GQIA 4ORZA 1VQOA 2YUNA 4FU6A 4IUTA 3VS2A 2YLBA 5FU7B 1KD1R 1KQ1A 1VQ7Q 3FJPA 1BYMA 4C0DC 5LJ5d 2J05A 3CXCA 5LJ3f 3PGGA 3I56A 3I55T 1FX7A 1YHQT 5GANe 5LJ5g 5KYXB 2XIDA 2KNBB 4RTZA 1AHJB 3E2UA 4M7DG 2DZCA 3VS7A 1WPYA 3VRZA 2OTLQ 2KE9A 3QO3A 3MCAB 2OAWA 1N8RC 3JCMP 2CZ1B 3CC4T 5LJ5e 1X6GA 4N0AC 1QKWA 1C0MA 1QVFA 1E6GA 3JB9J 2LJ1A 2J6KA 5GAOq 2QA4T 1G3SA 4EPCA 1NBEB 5CKHA 4IURA 1YIJQ 4Y92A 2PQWA 4GY5A 4AG2C 2JUFA 2FB7A 3OS5A 3RNJA 1FYNA 1RAFB 1ZA2B 3OYAA 2DZ9A 2XMFA 3M58A 3OS1A 2M0OA 3CCJT 2K2MA 3H41A 2HQXA 3QIIA 4F7UG 1BB9A 4QQ6A 2CT3A 4EMKA 2PUOB 5J26A 3ZEHA 1Y0MA 2HCKA 3A5ZB 1NM7A 3EGXB 3KUFA 3META 1VQOQ 4OMFB 2FZCB 1VYVA 2JOYA 2HD0A 1LCKA 3CCEA 1VOMA 3TQ7P 3HRUA 4QVZA 1ZA1B 4NL2A 5IHKA 1VQ5T 3REAB 3UWNA 2M0YA 2E64A 2K3YA 2RHXA 3I56Q 5KCOA 1VQ6Q 2P4RA 1NE8A 2YWWA 1T3LA 1UEBA 4JS5A 1UB4A 1Q82U 2A37A 4J9CA 1EZZB 1SRMA 5HY6A 4X9DA 2ZPIB 3OY9A 4LE9A 2A08A 4ZGJB 1W2BS 2RQVA 2YDLA 2RK1A 2VXEA 3NMZC 2CSQA 2M16A 4XU1A 3E9FA 4OMPA 3CCLT 4M7AG 2E1HA 3J81E 3MEAA 1JQQA 3A8MB 3PIOA 2VGMA 2KY9A 2GGRA 3LGLA 1G5VA 3QZ9B 2IVWA 2ESWA 1QVGS 1WI7A 2RI2A 2YUOA 2DBMA 2DJQA 3OYEA 3OMCA 2O4XA 1NZ9A 1GFDA 2EYQA 4L5GA 3IQLA 1VQNA 5KYXA 2JZ2A 3RBBB 2DTOA 4FYWB 1FMVA 1CKBA 2COZA 2RN8A 4LDYA 3SWNA 2RI3A 2ZPFB 1WX6A 3MP6A 1H8KA 2MCNA 3F70A 4M78E 4XTXA 3HFNA 4O6JA 2BTTA 4FT4A 1QVPA 1YJ9A 2K5LA 3QDFA 3SDZA 1HSQA 2COWA 2DXBA 3GIBA 5GANh 4HKEA 1K8AU 2H8HA 1O9SA 3CPWA 4DA4A 2E5QA 4C5IA 4E7IA 4C92E 4J83A 1YJWQ 3HRTA 1VYTA 2JJ9A 5DY9A 1MMGA 3HPWA 3LWIA 1VQPT 2F2VA 3NHNA 1EFNA 2QQRA 4RTYA 2QGGA 2RMOA 3ASKA 1PKSA 1LPLA 2RHYA 3OYNA 2K6DA 5LJ5h 2M1HA 4M7DB 1RAGB 2QEXT 3GF5A 3UDCA 1V76A 3GBQA 4XU0A 1M3AA 1QLYA 1TOVA 2ZPBB 2J7IA 1TU0B 2FEIA 1VQ4T 4P5NA 2PVDB 3HFOA 2JVVA 2EYXA 3RKYA 2ZPGB 2YSQA 2DJZA 2QK0A 4PJOD 8AT1B 2LZ6B 1HXDA 3MP1A 4J9GA 4A53A 4CC3A 2MMPA 1Q81U 2D1XA 1QMCA 1NG2A 1VQNQ 5FU6C 4ZNXA 4AFUC 1VQMQ 1JXOA 5AT1B 5KYWB 5CR2A 3HHTB 4BI8B 3I35A 1Z9ZA 3CD6A 1YNZA 1N9RA 1RI0A 3PMTA 1M1KU 3CCUT 3V7SA 5I2SA 3G71T 1ZBJA 1K9MU 2MPXC 1WFWA 2WSCE 3G7ZA 1WGSA 3ZBDA 1S72Q 1JRIA 4PJOF 3X24B 5I11A 1N27A 2JS0A 2FYKA 1QP2A 2OTJT 2EJGA 4LXCA 4J9FA 1OZ3A 2QAZA 5D6XA 2IPOB 3CC7T 1FWZA 3CCRA 3KXTA 1HD3A 1DJ7B 2DF6A 4ZTJA 3LH5A 2DA9A 5EC7A 3L2WA 4M77G 2ED0A 1VQLQ 3I5SA 5FU7C 2DL8A 1NLPC 2RD1A 3CCQA 1ZQ1A 4HVUA 3HSBA 3GNGA 4C0ZA 2LNVA 2C0OA 4M7AB 2R5AA 4HCCA 3PIPA 1VQ8A 1OEBA 1PRLC 2OTLT 2MWPA 3QWYA 2XHCA 3QYHB 1H3HA 1I4K1 3RUXA 1M9SA 1PSEA 3FEOA 4NOYA 2D0QB 4A63B 3FDRA 4HA8A 2EGEA 2DVEA 1C1AA 3M5AA 2QASA 5GMKl 2KRNA 4OP0A 2JM9A 1M30A 3X20B 1R8OB 3EFSA 1TH7A 4FCYA 4PJLA 3D7SB 3UA6A 1R0CB 3G6ET 1I5OB 3H6ZA 4J9BA 1YITA 2JTMA 1B7TA 3FJ5A 1YIJT 1ACMB 3QPHA 2QTVA 4A54A 4JRKA 3CD6Q 2X51A 2QQSA 4IUPA 3OBWA 1LJOA 4M7DA 4AG1C 3FIFA 1PC0A 3JCMX 1SF9A 5CO7A 1YCYA 1BKBA 1MUZA 2F5KA 2G3RA 5CVIA 4FW1A 3GP8A 2R57A 4JJBA 2O9VA 4BD3A 4KT0E 3OQ5A 5KYYB 2LT1A 4R55A 2ATCB 4NS5A 5IN1A 2A28A 4JLGA 1K0XA 1CSKA 1KC8U 3CCRQ 4RTXA 1XTDA 4DBQA 9ATCB 3L2ZA 1BIAA 4DBHA 1OZ2A 5FWBA 1MV3A 3CMAQ 4PJOC 3VS3A 1N8RR 1RLQC 1VQ6T 4OMQA 3JCMW 2YRDA 1OPKA 3N5BB 3VS0A 1HK9A 2A0FB 2QG9B 3FRNA 3M57A 4F7UA 4D6WA 1YWOA 4NL3A 4RTVA 3UATA 1AWXA 5KCHA 5GAN4 4OB0B 3CCMA 2V8JA 3JCMJ 1N5ZA 2KT8A 2XI9A 4DQ2A 3VRYA 1K73C 1MV0B 2E3HA 1WZOA 1UE9A 4RTTA 3CCVA 2DD5A 1G3TA 3M0QA 5GMKm 1Y96B 4OMOA 4KGZB 2AKLA 1MNDA 1WLPB 2FRWA 4M75G 5L23A 4C92D 2PVGB 2OX7A 1U5SA 4XTVA 2PU9B 4M7AA 3V8KA 1UGRB 2EAYA 3OW2P 1W2BA 3M0PA 5AYFA 4E7JA 1SHFA 2DKGA 3H0IA 1Q7YC 2X4YA 3O5ZA 1I0CA 3U23A 4IUVA 2V1QA 4OMLA 1VQ9A 3CXCP 2GBQA 1IHWA 2CS7A 3QSUA 2DNUA 2HBPA 1AD5A 4Y28E 2QTXA 5GMKj 5KYUA 4EMKB 3QJYA 2FPFA 3JCMV 1K9MR 4A4HA 2JMCA 1M2VA 4LDWA 1QVGA 1E6HA 3LX7A 2LCCA 2MAMA 1YJWT 3AT1B 4C8QG 5GAOn 3JV3A 1WHLA 2LDMA 5J39A 2WACA 3UPUA 2E65A 2VGNA 5A2QE 1H92A 1UGPB 2AHJB 2KMTA 1OX8A 3CCMQ 1QVFP 1BCMA 2R5MA 2CDTA 4EMHA 2DBKA 1U8RA 1Y7XA 3CCVQ 3JCMf 3MEWA 1RUWA 2COYA 4BUGA 3JB9G 2PZ1A 3H0HA 2DRKA 1ZUUA 1Q82C 4N4GA 1Q86C 5A0DA 3KBGA 1QCFA 2L2PA 1D1CA 1X75C 2CKKA 2NUZA 2LQNA 1YJNA 3L2VA 1D1AA 1VQKA 2G6FX 1Y57A 2XDBA 1M5Q1 1UDLA 2LQKA 2DE0X 2DMOA 1Y71A 5CQYA 1H641 1OX9A 3RMSA 1VQMT 1PNJA 1WHMA 3VS6A 3ER0A 2W10A 2F2WA 4E7HA 1MMNA 3WVDB 4D8KA 2KDSA 1KG1A 2O4XB 2X3XD 2BE9B 1JJ2P 2L3PA 5FROA 3S3NA 4E7ZA 2FZKB 1YP5A 3QZ5B 2J6OA 2X35A 3VYGA 2HDAA 5GAN6 1VQ9Q 3SWNB 4A4GA 4ME7A 2CREA 1YI2T 1GCQC 4FYVB 2EQMA 3DLMA 1S72T 3G4SA 2NLUA 4EMGA 5GAOl 3MEUA 4WF2A 1Y96A 2EYZA 4M78C 4XK8E 1KC8R 4QVDA 2GTJA 2QGFB 4C5GA 1QW1A 3V8LA 1VQLT 1JXMA 1NJIC 2RB6A 1X2QA 3M0TA 4RMOA 2GQVA 2HAXA 1FMKA 4OVAA 3JB9H 1GRIA 2O88A 3PFSA 2K7AA 4C92C 5M9OA 1HYOA 5HKCA 2DL5A 2MK5A 1IGQA 1M90C 2VYTA 1BI3A 3DB3A 1IB8A 3RKXA 2X9HA 2DEQA 2HMAA 5IHIA 3NFCA 4BE0A 3CC2A 2GTOA 2WSEE 1Y07A 4OB3B 4M77A 4XAXB 3CCSA 2XDDA 4LNPA 1IREB 4M7DE 3EFRA 5C0MA 2PNIA 5D7UA 4KBMB 3EG0A 4LN2A 2DEUA 4JZ3A 1TG0A 3M59A 4PL6A 4N4HA 2DL3A 3QJ6A 2OI3A 2CGHA 1K1ZA 3C4SA 2FRYA 2D8JA 4VUBA 2MIOA 5GJWB 3EFOA 4DEXA 5ECAA 2HL5C 5GAMj 1HJDA 4MZPA 3ULRB 3VKIA 4MDWA 1P92A 5KYNA 2E6NA 2DFUA 3SD4A 3C95A 3MJXA 4Z88A 3G4SQ 2Y4YA 3NGPA 1SKUB 2D8HA 3M0SA 3QHSA 4X9CA 2JTFA 1ZUYA 1UGVA 4ZGDB 1VUBA 1B07A 3CMAT 5GMKe 4IIMA 5GAOm 1Z9QA 4F7UE 3DB4A 2J06A 2FPDA 2H3JA 2KQWA 2L3RA 3JRZA 3EH2A 2BKDN 2FVUA 4X1VA 2Y90A 2DLPA 4HT9A 3V8JA 1X6BA 5GANf 4TVRA 3CC2Q 1LOJA 5DM7R 1X6OA 3RMQA 1MMAA 2AZVA 4X34A 2KK4A 1N8RU 3PVLA 1QWEA 2VV5A 1AOJA 3CCEQ 3I55A 3OBYA 1KJWA 5D6YA 1YHQA 1IXDA 4M7AE 1OI1A 5LJ5f 2HZYA 1RLPC 2DD4A 3SFMA 1ARKA 1UFFA 2L3SA 2LC4A 1JBMA 2E10A 3LYIA 1EX4A 1SEMA 2CUDA 1AVZC 1R0BG 4KGVB 2LRQA 2RNAA 4E7SA 2JS2A 2KGTA 1PRMC 4FYYB 1ABQA 1KD1C 2K3XA 2DXUA 3OYHA 3CC4A 4LD6A 2MOXA 3HP9A 3JCMb 2RK2A 2FZGB 2BZXA 1W4SA 2PTKA 2QA4A 3JSCA 1KHIA 1YBYA 1K73R 4EMKC 4M75A 3BDUA 2O9SA 2HSEB 1M2OA 4OF1A 3CMET 1T0HA 1TSFA 2V8KA 2ZPEB 5A0LA 5IT9E 1NLOC 2JMAA 4BY6C 2YT6A 4ZTFA 1SHGA 3CCJA 2QDYB 2RJFA 4KUDK 4OGCA 1RABB 3TVTA 1I5LA 1M1FA 4QT7A 1I81A 4FSXA 4QKUA 4F7UB 2RHUA 3ZL7C 3RR6A 4L6V5 2JW4A 1YJ9Q 2ENMA 2GCXA 3EHRA 2CZ6B 1KQ2A 3THKA 1NPPA 5CAIA 4CC7A 1PKTA 3M56A 4C0DB 1Q7YR 4LDXA 2B86A 1V1CA 4C8QA 1PCXA 4QQDA 1VQ5A 2F69A 2DETA 1D0YA 5IXFA 5A0GA 4J9EA 3I55Q 4J6YA 1NEGA 2QQBA 1MHNA 2DK3A 1YHQQ 1GBRA 2EBPA 2CP5A 5GAMd 2ABLA 3VS4A 3E9GA 3V7RA 1SSFA 2KXDA 4C5EA 5GAMg 1PHTA 1ZSZA 5HCKA 4II1A 3L2UA 1VQ7T 3WXMB 1W1FA 4BE1A 3RIRA 3J7AF 3CCLA 2V26A 2FG0A 3SHWA 3UA7A 2VB6A 4XQ3A 4B9XA 5GMKh 1TUGB 5KE3A 4HVWA 3L2RA 4QVCA 3SWNC 5GAMe 3A8LB 4FM4B 1M1GA 4JJCA 1WHKA 5CCAA 2EJ9A 7AT1B 1H3ZA 2ZPHB 3Q1JA 2RH2A 4JPBW 2DX1A 1WJQA 2QQAA 4JUVA 2EGCA 4LD9K 5CQXA 2YXYA 1UHCA 4JZ4A 4CC4B 3M54A 5KYUB 1Q86R 3QG1A 2A36A 4O5VA 4JLIA 1M2VB 3PT9A 2XKOC 1BI0A 1QP3A 2CP0A 4J8OA 1K4US 2HSPA 1IO6A 4E2FB 4FT2A 4M7DD 1WA7A 1D0XA 3HTRA 4OB2B 3E1SA 2EQUA 3JB9F 2L3QA 2E3IA 3OYMA 1I1JA 2CH4W 4M77E 3TREA 3URGA 1WIEA 3OYYA 3A1PA 1KHCA 2NUPA 1AWWA 1W2BP 1VQPA 2KSSA 4JJNK 5I22A 2EYWA 3A8HB 2NWMA 3C12A 3LGFA 1VQOT 1W70A 4GLKA 5LJ3d 4A4EA 4GBQA 2RJCA 2RPNA 2E6ZA 1TTHB 3H8ZA 1T3SA 2QEXA 3CCQQ 3MO8A 5LJ3g 3I56T 1KSWA 3WVEB 1TS9A 1PD0A 1TWBA 1GXIE 3QKJA 4M7DF 2LNHB 3SB2A 1G3WA 1VQ4A 2A3LA 1KQSP 5FRNA 2C0TA 4IUQA 1VQ8Q 1NJIR 2QQ9A 1I8FA 1U06A 4PFOA 1ZLMA 2VWFA 2XD0A 2KRMA 1YWPA 3DKMA 2HQEA 2DTIA 5CKBA 2KYBA 3I5RA 2RO0A 2LCLA 5LJ3e 2RQTA 2YLCA 1M90R 2F1LA 4ELYC 1GFCA 1YITQ 2GF7A 3PTAA 2ECZA 1GCQA 3OA6A 4BDYA 4V2SA 4A4KA 1AZGB 2KRSA 4MMLA 3OYCA 2CP6A 1T0JA 2MI6A 3CCUA 4F7UF 2CSIA 4M78A 3MEVA 4M7AD 3G71A 2KR3A 1FXXA 4N0AA 2GFUA 3CPFA 1D3BA 1BCOA 2JXBA 2W0ZA 2OTJA 4Y91A 1I07A 3LH0A 4KUIA 2HBWA 4ZN1A 3CC7A 4PJOG 3ZFJA 5DLQE 1GBQA 4CI0C 1Q95G 1UGSB 3OS0A 3CCET 3TEEA 4M4ZA 5IHNA 4XU3A 2QEXQ 4M77B 3REBB 1B34A 5GAMh 3T9NA 3GPLA 2C06A 4IKFA 3FB9A 3QDRB 2MYSA 1IZ6A 3OSSC 3TCJA 2EKHA 4A4FA 1PG5B 1VA7A 4CRIA 4JRPA 2OTLA 4M7AF 4BB7A 2QI2A 3OS2A 1WXUA 2GNCA 2CUBA 4M7DC 2DXCA 4OMMA 4JRQA 3J80E 2E4HA 3EG2A 1SSHA 3EFOB 3OYIA 1AWOA 4M75E 1YN8A 2I0NA 3G6EA 2ZZDA 1RAEB 2OAUA 1YIJA 3GOXA 2L8DA 2QXFA 2AIRB 2IG0A 4DEYA 3CEYA 2AT1B 1NPRA 2DYIA 3NTKA 5GAOr 2K5IA 2CZ7B 1VQNT 2E12A 2J6FA 3LWHA 5IH2A 5GAOp 2SRCA 2XICA 4B9WA 2NYSA 1JEGA 1YFNA 2QDLA 3M9QA 1UGQB 3M55A 5GANg 1UHFA 4BDZA 3OMGA 1VIFA 4Q5WA 4C8QE 3CC7Q 1YJ9T 1F1BB 4MZMA 2EW3A 1N6AA 2P0KA 3FLGA 1B3QA 4J9DA 1K73U 2XU8A 3INZA 1PWTA 4YTLA 3MHXA 3QXEB 2CZ0B 1QWFA 1WJSA 4QQGA 3OYFA 1VQ6A 3NTHA 1M4ZA 1AT1B 1BBZA 2LT4A 1W6XA 2LX9A 2O31A 3P8HA 1ABOA 3OB9A 3CBMA 1ZBXA 2F5TX 1E7OA 2BE7D 2JM8A 5LJ3h 2ED1A 2FHDA 2KBTA 2LVMA 4HVVA 1JO8A 6AT1B 2CP2A 4OGEA 2CP3A 3P8BB 2RM4A 1WDXA 2ZAEA 3VUBA 2F2XA 1X01A 5D6WA 1TUDA 3VJPA 1K8AC 4PJMA 1QCOA 4B6MA 4M7AC 4DOVA 1V29B 3G6EQ 1SG5A 1Q7YU 5GMKi 4HXJA 3RDVA 1AEYA 4JDSA 5KH6A 2RI5A 4ELZC 1VIEA 2LJ3A 1RAHB 3CQTA 4CC2A 3X26B 3JAME 4M77D 1G8XA 1YJNQ 1VQKQ 1LVKA 1TUCA 1NEBA 3X25B 2VASA 2EIFA 4PKCC 3R6NA 4RKUE 2DYBA 3OYGA 4HCZA 4M75B 4PJJA
chains in the Genus database with same CATH topology
1BI2A 2RK2A 1O75A 5CO7A 1W4SA 1YCYA 2QA4A 2X4XA 3JSCA 2DIQA 1BKBA 1KHIA 2VXFA 5GAN7 2F5KA 1YBYA 2G3RA 5FU6B 2EQJA 2Y4XA 5CVIA 5GAN5 3GP8A 4BY6B 4EMKC 2R57A 4FIBA 2RJEA 4M75A 4QW2A 4BD3A 3BDUA 4KT0E 4C92F 4L59A 3OQ5A 4E47A 2O01E 3M53A 3PNWC 4OF1A 3CMET 2LT1A 3OYBA 2PUKB 4R55A 2V8KA 2ZPEB 4NS5A 5IN1A 3C94A 4JLGA 3VYHB 5A0LA 1JJ2A 4PJOB 5IT9E 1Q81C 5CIUA 3OYJA 4BY6C 4ZTFA 1KC8U 3CCJA 2QDYB 4M78G 2RJFA 1XTDA 2WSFE 1XOVA 4OGCA 4KUDK 1I5LA 2RHIA 1M1FA 1YJWA 3L2ZA 3R6OA 5I21A 1LNXA 2D6FA 1BIAA 4PJOE 1OZ2A 1I81A 4M77F 4FSXA 2P0PA 4PJOC 1Q86U 2XK0A 3O8VA 4F7UB 2RHUA 2MWOA 3CCRT 4HT8A 5GANd 4L6V5 4LDUA 2M9UA 3TU4K 1VQ6T 3VU3C 4C8QB 3JCMW 4XU2A 2GCXA 3N5BB 2CZ6B 1HK9A 1KQ2A 4J7FA 3GNFB 1NPPA 2RA2A 1M1KC 3FRNA 5CAIA 3M57A 3OSVA 4F7UA 4D6WA 4C92G 3M56A 5L8RE 3CCQT 4C0DB 3JCMh 3OW2A 4LDXA 4C8QA 4NL3A 1WJRA 4QQDA 1VQ5A 2F69A 1JB0E 1VQOA 5A0GA 1K9MC 4FU6A 4IUTA 4J6YA 2QQBA 3LLRA 1MHNA 2DK3A 5KCHA 1EIFA 2HNIA 2YLBA 5FU7B 5GAN4 4OB0B 5GAMd 3CCMA 1KQ1A 2V8JA 3E9GA 3FJPA 3V7RA 3JCMJ 1VQ8T 4J5YA 1M8VA 1BYMA 4C0DC 5LJ5d 3CXCA 5LJ3f 3PGGA 2XI9A 3A8OB 1SSFA 4DQ2A 3I55T 3I56A 1K73C 4C5EA 5GAMg 1FX7A 1YHQT 5EG2A 5GANe 1KQSS 5LJ5g 4II1A 3L2UA 1VQ7T 2XIDA 2L89A 3WXMB 4BE1A 3CCVA 2DD5A 3M4YA 1G3TA 3RIRA 3J7AF 3CCLA 1AHJB 4M7DG 4PLLA 2DZCA 1WNLA 1WPYA 5GMKm 4ZGEB 4XQ3A 1Y96B 4B9XA 1VQMA 4RG2A 5GMKh 4C5HA 1YITT 3QO3A 3BY7A 3MCAB 4IUUA 5KE3A 3AHUA 4M75G 3L2RA 4QVCA 3SWNC 3JB9I 1N8RC 5GAMe 3A8LB 4FM4B 2PVGB 4C92D 3JCMP 2P0QA 4M7AD 2CZ1B 3DLLA 3CC4T 1M1GA 4XTVA 2PU9B 5LJ5e 4M7AA 3V8KA 2RJDA 5CCAA 4N4IA 1UGRB 2EJ9A 2EAYA 4N0AC 1H3ZA 2ZPHB 3Q1JA 1QVFA 1NJIU 1W2BA 3JB9J 2RH2A 5AYFA 4E7JA 5GAOq 2QA4T 4E7KA 1WJQA 2QQAA 4JUVA 1G3SA 2DKGA 2YRVA 4EPCA 4LD9K 5CKHA 4IURA 1Q7YC 2X4YA 5CQXA 3S3MA 4BI3A 3M54A 1YI2A 2PQWA 2XDPA 4GY5A 4IUVA 2JUFA 2FB7A 3OS5A 5HK3A 3QG1A 4O5VA 1VQ9A 4JLIA 1S72A 5IAYA 2KAFA 3QBYA 4UC4A 5LJ3j 1BIBA 3PT9A 3OYAA 2DZ9A 2CS7A 1BI0A 1QP3A 2XKOC 3M58A 4J8OA 3OS1A 3HKSA 1M90U 3QSUA 2HBPA 4Y28E 2QTXA 2M0OA 5GMKj 3OW2S 4FT2A 4EMKB 4M7DD 3QJYA 3JCMV 3CCJT 2X4JA 4A4HA 3E19A 4LDWA 4OB2B 1QVGA 3E1SA 3BW1A 2HQXA 3QIIA 3LX7A 4F7UG 2LCCA 2MAMA 3UT1A 1YJWT 2EQUA 3JB9F 4J6WA 4C8QG 5GAOn 1VQLA 4QQ6A 5CKDA 3JCMQ 4EMKA 4M7AE 2PUOB 5J26A 2LDMA 3ZEHA 4M75D 3QUIA 3OYMA 2LQ8A 5J39A 3CXCS 4M77E 2VUBA 2WACA 4M77C 3UPUA 3A5ZB 3META 2E65A 3KUFA 2VGNA 2EFIA 3TREA 3URGA 4OMFB 5A2QE 1UGPB 2AHJB 2KMTA 3OYYA 2JOYA 3RKWA 2HD0A 4RG8A 1KHCA 3RERA 4J6XA 5CKEA 3CCEA 3HRUA 1VQPA 3PMIA 4QVZA 4NL2A 2KSSA 4XTUA 4JJNK 1VQ5T 2R5MA 3UWNA 1VQOT 3A8HB 2E64A 3C12A 3LGFA 2K3YA 2RHXA 4GLKA 5KCOA 4EMHA 1KC8C 5LJ3d 4A4EA 1NE8A 4PJOA 2RJCA 1U8RA 1Y7XA 3CCMT 1BI1A 1UEBA 4JS5A 1UB4A 1Q82U 2E6ZA 3H8ZA 3JCMf 2ZCFB 3MEWA 2QEXA 4BUGA 3MO8A 5HY6A 5LJ3g 3I56T 3JB9G 4X9DA 3WVEB 2ZPIB 1Q82C 3OY9A 4N4GA 1Q86C 1GXIE 3QKJA 5A0DA 4M7DF 3KBGA 3SB2A 1G3WA 3CD6T 4ZGJB 3P8DA 2P4TA 2XG8D 1QVFS 2CKKA 1X75C 3CCVT 1VQ4A 2E41A 2A3LA 2RK1A 2VXEA 1W2BS 2M16A 4XU1A 5C6SA 3E9FA 3L2VA 1YJNA 1VQKA 4C8QD 4IUQA 3CCLT 5FRNA 2E1HA 3J81E 2XDBA 4M7AG 1M5Q1 2QQ9A 2LQKA 1I8FA 2B8AA 3MEAA 1Y71A 4ZN3A 4M75F 5CQYA 1H641 3RMSA 1VQMT 2XD0A 3ER0A 3OYLA 3DKMA 2HQEA 2DTIA 4KULA 5CKBA 3A8MB 3OYDA 3PIOA 4E7HA 3WVDB 2VGMA 2LTOA 2K4YA 2KY9A 2LCLA 2RO0A 2KDSA 5LJ3e 1KG1A 2O4XB 3LGLA 4RCBA 1G5VA 3QZ9B 2IVWA 2YLCA 5FROA 3S3NA 1QVGS 3HL8A 2RI2A 4ELYC 4E7LA 3QZ5B 3OYEA 3OYKA 3OMCA 3VYGA 2X35A 2ZGWA 2GF7A 2O4XA 5GAN6 1NZ9A 5CK9A 3PTAA 3SWNB 4A4GA 4ME7A 2EYQA 4L5GA 1VQNA 4XTZA 3OA6A 4BDYA 4V2SA 1YI2T 2K5FA 3S3OA 4M78B 4A4KA 2JZ2A 3JB9D 2DTOA 4MMLA 2EQMA 1VQ9T 3DLMA 3OYCA 1S72T 1WQ7A 4LDYA 3SWNA 2JN0A 4PLIA 2I2LA 2MI6A 1D3BB 2RI3A 2ZPFB 3G4SA 3CCUA 1JJ2S 2NLUA 3MP6A 2L5QA 4EMGA 4F7UF 5GAOl 3MEUA 3L42A 4M78A 2DPPB 1Y96A 3F70A 3MEVA 4M78E 4WF2A 3QYGB 4XTXA 3G71A 3CMAA 4C8QF 1FXXA 4FL6A 3HFNA 2GFUA 4M78C 3CPFA 4FT4A 4N0AA 4O6JA 5KE2A 5I2MA 3VUZA 4BE2A 2DO3A 4XK8E 1QVPA 1OYXA 3A8GB 1D3BA 2K5LA 1YJ9A 3SDZA 4QVDA 5DLOA 4C5GA 1QW1A 3V8LA 2EQKA 1VQLT 4C92B 2BUDA 2OTJA 1NJIC 2DXBA 2RB6A 4Y91A 3VV0A 5GANh 3GIBA 4RMOA 3LH0A 4KUIA 2GQVA 2HAXA 4OVAA 4ZN1A 2K57A 3CC7A 4HKEA 3JB9H 4PJOG 1K8AU 4OB1B 5DLQE 1O9SA 3ZFJA 3CPWA 1G3YA 4DA4A 3PFSA 2E5QA 4C5IA 4CI0C 3LW5E 4E7IA 1UGSB 4C92E 2EJFA 4J83A 1B34B 4C92C 5M9OA 3HRTA 5DY9A 3OS0A 5HKCA 3CCET 3HPWA 3LWIA 1VQPT 3TEEA 2YHTA 1N9SA 4XU3A 1M90C 2VYTA 2QQRA 4J7IA 4M77B 1BI3A 3JCMd 3DB3A 3ASKA 1B34A 3RKXA 2RHYA 5GAMh 3T9NA 2DEQA 3OYNA 2MF2A 1KD1U 3GPLA 3NFCA 2C06A 4BE0A 4IKFA 3FB9A 5LJ5h 3CC2A 2EKOA 3QDRB 2WSEE 2M1HA 1Y07A 4OB3B 3JCMg 4M7DB 1IZ6A 3OSSC 2DIGA 2FL7A 2QEXT 3TCJA 4M77A 4BI4A 3GF5A 4A4FA 4XAXB 4CRIA 3BFMA 4JRPA 2OTLA 2DTHA 3UDCA 3CCSA 4M7AF 4XU0A 4BB7A 2ZPBB 2XDDA 5J3BA 4EDUA 2QI2A 3OS2A 5GANj 4P5NA 1VQ4T 1IREB 4M7DE 2PVDB 3EFRA 5C0MA 1YJNT 1VQKT 4M7DC 3MP8A 2DXCA 3HFOA 4KBMB 4JRQA 2JVVA 3RKYA 2ZPGB 2EWNA 3J80E 2DJZA 2K2VA 3OYIA 3CBPA 4PJOD 3M59A 4PL6A 4N4HA 1HXDA 3QJ6A 4M75E 2CGHA 3MP1A 2ZZDA 4DOWA 3JCMe 3G6EA 4JS4A 4M75C 4XTYA 3C4SA 4A53A 2MMPA 2OAUA 4VUBA 1Q81U 2X4WA 1RL2A 1YIJA 3GOXA 2L8DA 5GAMj 2QXFA 4MZPA 5FU6C 2IG0A 4HCBA 3CEYA 3VKIA 5LJ5j 1NPRA 3NTKA 4MDWA 1P92A 2CYZB 2K5IA 2KVQG 5CKFA 5FLXE 5GAOr 2DAQA 2E6NA 2CZ7B 4MMKA 5FRMA 5CR2A 3SD4A 3HHTB 1PSFA 3C95A 4BI8B 4MDXA 1VQNT 2E12A 2Y4YA 3LWHA 3CD6A 2R58A 2E70A 4R56A 5GAOp 1N9RA 1RI0A 3PMTA 3CPWS 2A7YA 3QHSA 4X9CA 1M1KU 2JTFA 2XICA 3L2QA 4BACA 3S6WA 4XTWA 3CBOA 5HK0A 3G4ST 3CCUT 2VC8A 3V7SA 4B9WA 4ZGDB 1VUBA 1U1TA 3V7CA 5GAN8 1U1SA 3M9QA 1UGQB 3M55A 5I2SA 5GANg 3CMEA 3G71T 3CMAT 5GMKe 5GAOm 2V8IA 4F7UE 3DB4A 3OMGA 4BDZA 1K9MU 3RESA 1VIFA 2DXTA 2WSCE 3G7ZA 5GAN2 1WGSA 2H3JA 2KQWA 2L3RA 3JRZA 4Q5WA 4C8QE 3X28B 3ZBDA 1YJ9T 4C8QC 1MGQA 4MZMA 1JRIA 1ZHIA 4PJOF 3X24B 1N27A 2BKDN 2FVUA 1N6AA 2FYKA 1QP2A 2P0KA 3FLGA 2EJGA 4LDVA 2OTJT 3FC3A 1K73U 2JNGA 2XU8A 1OZ3A 2Y90A 3INZA 5D6XA 1WQWA 3CC7T 1FWZA 3ME9A 4YTLA 3KXTA 3CCRA 3MHXA 3QXEB 2CZ0B 4RCCA 4C0FA 4HT9A 1WJSA 4QQGA 1DJ7B 3OYFA 3NTHA 1M4ZA 4ZTJA 3V8JA 1VQ6A 3JCMc 3L2WA 2LT4A 4M77G 2D9TA 4M78D 2LX9A 3P8HA 5GANf 5FU7C 4TVRA 3OB9A 3CBMA 1LOJA 2RD1A 4PNOA 1X6OA 5DM7R 1ZQ1A 3CCQA 3RMQA 3HSBA 1ZBXA 2F5TX 5LJ3h 2FHDA 2LVMA 3GNGA 4C0ZA 2LNVA 4Z02A 4X34A 2KK4A 3CC2T 4M7AB 2R5AA 4HCCA 4OGEA 1N8RU 3PIPA 2VV5A 1VQ8A 3P8BB 3L1AA 2RM4A 2OTLT 2MWPA 3VUBA 4JRIA 3CCST 1X01A 2XHCA 3QYHB 5D6WA 1I4K1 3RUXA 3M4GA 1M9SA 3OBYA 4C92A 5GAMf 3I55A 1PSEA 3VJPA 5D6YA 3FEOA 4NOYA 1YHQA 1OI1A 2D0QB 2RHZA 4MZTA 3FDRA 5LJ5f 1XQHA 1K8AC 4HA8A 4M7AC 1VQ7A 4DOVA 1V29B 2PVOB 1Q7YU 2DVEA 2DD4A 3M5AA 3SFMA 5GMKi 2GFAA 2LC4A 4JDSA 5KH6A 5GMKl 1JBMA 2E10A 2RI5A 3LYIA 4ELZC 4OP0A 1VIEA 5LL6S 3X20B 1R8OB 1XNIA 3EFSA 2LRQA 1TH7A 2BIVA 3G6ET 3GLXA 5GAN3 3H6ZA 3X26B 3JAME 1YITA 2JTMA 4M77D 1KD1C 3NTIA 4M78F 1YIJT 4ATOA 3BDLA 3QPHA 3X25B 2EIFA 2K3XA 4PKCC 4A54A 4JRKA 2DXUA 3OYHA 4RKUE 3CC4A 2QQSA 4IUPA 4LD6A 3OYGA 3OBWA 3HRSA 1LJOA 4M7DA 3EAEA 4C0GA 3HP9A 4HCZA 3JCMb 1KQSA 4M75B 3FIFA 3JCMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZGW A;  5GAN 6;  5GAO q;  3SWN B;  1YCY A;  4JUV A;  2DKG A;  2VXF A;  5GAN 7;  4XTZ A;  4V2S A;  4M78 B;  5GAO p;  5GAN 5;  1N9R A;  3JB9 D;  4EMK C;  2DTO A;  4M75 A;  4MML A;  2FB7 A;  3BDU A;  3QHS A;  4X9C A;  4C92 F;  1WQ7 A;  4JLI A;  4XTW A;  3SWN A;  2JN0 A;  2I2L A;  1D3B B;  2VC8 A;  3V7S A;  1BIB A;  5LJ3 j;  2DZ9 A;  3V7C A;  1U1T A;  4EMG A;  4F7U F;  1U1S A;  5GAN 8;  5GAN g;  5GAO l;  3QSU A;  4M78 A;  4WF2 A;  1Y96 A;  4M78 E;  4XTX A;  2QTX A;  5GMK e;  5GMK j;  4F7U E;  5GAO m;  4C8Q F;  4M7A D;  4M78 C;  3HFN A;  4N0A A;  4EMK B;  3RES A;  3JCM V;  4M7D D;  2DXT A;  5GAN 2;  4M78 G;  4C8Q E;  3BW1 A;  4F7U G;  1D3B A;  4C8Q C;  4QVD A;  1MGQ A;  1I5L A;  1JRI A;  4PJO F;  3JB9 F;  4J6W A;  3V8L A;  3L2Z A;  4C8Q G;  5GAO n;  4C92 B;  2FYK A;  1LNX A;  5I21 A;  2EJG A;  1BIA A;  3JCM Q;  4PJO E;  2RB6 A;  4Y91 A;  1I81 A;  4EMK A;  5GAN h;  4M77 F;  3GIB A;  4PJO C;  4M75 D;  3QUI A;  2Y90 A;  3INZ A;  4F7U B;  1WQW A;  4HT8 A;  2K57 A;  5GAN d;  3JB9 H;  4M77 E;  4PJO G;  4RCC A;  3VU3 C;  4M77 C;  4C8Q B;  3JCM W;  4HT9 A;  2E65 A;  4XU2 A;  3V8J A;  3JCM c;  4M77 G;  4C92 E;  1HK9 A;  1KQ2 A;  2EJF A;  4M78 D;  1B34 B;  2RA2 A;  3RKW A;  4C92 C;  5CAI A;  5GAN f;  5DY9 A;  3RER A;  4F7U A;  4J6X A;  4C92 G;  2YHT A;  1LOJ A;  2RD1 A;  1N9S A;  4PNO A;  4XU3 A;  3JCM h;  4C8Q A;  4NL2 A;  4XTU A;  4NL3 A;  3HSB A;  4M77 B;  2E64 A;  5LJ3 h;  3JCM d;  1B34 A;  4EMH A;  3RKX A;  5GAM h;  4J6Y A;  2DEQ A;  5LJ3 d;  4PJO A;  2HNI A;  2YLB A;  4M7A B;  3FB9 A;  5LJ5 h;  5GAN 4;  5GAM d;  1KQ1 A;  3JCM J;  4M7D B;  3FJP A;  3JCM g;  3V7R A;  3JCM f;  4J5Y A;  1M8V A;  3L1A A;  2RM4 A;  4M77 A;  5LJ5 d;  3JB9 G;  5LJ3 g;  5LJ3 f;  3PGG A;  3BFM A;  4JRI A;  1X01 A;  2DTH A;  4X9D A;  4DQ2 A;  4M7A F;  1I4K 1;  4XU0 A;  3M4G A;  3RUX A;  5GAM g;  4C92 A;  5GAM f;  4M7D F;  3SB2 A;  4NOY A;  5GAN e;  5GAN j;  4M7A E;  5LJ5 g;  5LJ5 f;  4HA8 A;  4M7A C;  3EFR A;  2E41 A;  4M7D E;  2VXE A;  2DVE A;  4XU1 A;  4M7D C;  5GMK i;  4C8Q D;  4M7A G;  3HFO A;  2E1H A;  3RIR A;  1M5Q 1;  5GMK l;  1JBM A;  2E10 A;  2DZC A;  3RKY A;  4M7D G;  2EWN A;  1WNL A;  1WPY A;  4OP0 A;  5GMK m;  1I8F A;  2DJZ A;  3EFS A;  4XQ3 A;  4M75 F;  1H64 1;  1TH7 A;  1Y96 B;  4PJO D;  5GMK h;  1HXD A;  4M75 E;  5GAN 3;  2CGH A;  2DTI A;  3JCM e;  3QO3 A;  4M75 C;  4XTY A;  3BY7 A;  4M77 D;  4A53 A;  5LJ3 e;  3AHU A;  4M75 G;  4M78 F;  4QVC A;  3SWN C;  4RCB A;  3JB9 I;  5GAM e;  4C92 D;  5GAM j;  3JCM P;  4A54 A;  4JRK A;  2YLC A;  2DXU A;  4XTV A;  5LJ5 e;  4M7A A;  5LJ5 j;  3V8K A;  1LJO A;  4M7D A;  2EJ9 A;  2EAY A;  4N0A C;  3JCM b;  5GAO r;  4M75 B;  3FIF A;  4MMK A;  4PJO B;  3JCM X;  3JB9 J; 
#chains in the Genus database with same CATH topology
 2E5K A;  3KFV A;  1C6V X;  2X4X A;  2LJ0 A;  2DIQ A;  2VXF A;  5GJV B;  4OMN A;  3CD6 T;  2Y4X A;  1KK7 A;  3EGU A;  3NPF A;  2HKN A;  4L59 A;  1IHV A;  4E47 A;  3CPW P;  2DER A;  2O01 E;  2CH4 A;  1M3C A;  2PUK B;  1JJ2 A;  1ZX6 A;  3C94 A;  4RTW A;  4PJO B;  2KXC A;  1Q81 C;  4M78 G;  2WSF E;  1XOV A;  1WHG A;  1YJW A;  1PM3 A;  2EPD A;  2X3W D;  3R6O A;  3TSW A;  4M77 F;  1Q86 U;  3CCR T;  2C0I A;  2YUQ A;  4J9I A;  2JT4 A;  1PD1 A;  3VU3 C;  4C8Q B;  1UUE A;  4J7F A;  2RA2 A;  1M1K C;  1OU8 A;  1M27 C;  3OSV A;  4C92 G;  3CCQ T;  4KRT A;  1WJR A;  1JB0 E;  1K9M C;  4R0K A;  2RQR A;  1BU1 A;  1FMW A;  3LLR A;  1EIF A;  1SPK A;  2HNI A;  1ZSZ B;  4JJD A;  1VQ8 T;  4J5Y A;  1M8V A;  3A8O B;  3EG3 A;  1K9A A;  5EG2 A;  4KGX B;  1KQS S;  4FW2 A;  2L89 A;  3EG9 B;  3EGD B;  3M4Y A;  4PLL A;  1WNL A;  4ZGE B;  3CCS Q;  1RAD B;  1VQM A;  2LX7 A;  4RG2 A;  1ZSG A;  4C5H A;  1YIT T;  2FO0 A;  4AFZ C;  3BY7 A;  4IUU A;  2DRM A;  4LUD A;  3AHU A;  3PE0 A;  3JB9 I;  1QCN A;  3H9N A;  2P0Q A;  1G2B A;  1S1N A;  3DLL A;  2RJD A;  4FSS A;  4N4I A;  1NJI U;  4E7K A;  2YRV A;  3S3M A;  2Z0W A;  4BI3 A;  1YI2 A;  2XDP A;  5HK3 A;  5FW9 A;  1S72 A;  4F14 A;  2LMJ A;  5IAY A;  2KAF A;  3QBY A;  4UC4 A;  5LJ3 j;  1BIB A;  1X27 A;  3BE3 A;  3HKS A;  1M90 U;  3OW2 S;  2M51 A;  2X4J A;  3E19 A;  3BW1 A;  4F16 A;  3UT1 A;  1ZUK A;  4J6W A;  1VQL A;  1UEC A;  8ATC B;  5CKD A;  3JCM Q;  4M75 D;  3QUI A;  1D1B A;  2VKN A;  2LQ8 A;  2CT4 A;  3CXC S;  2NUP B;  2VUB A;  4LUE A;  4M77 C;  4AMC A;  1BK2 A;  2EFI A;  2DL4 A;  2KI7 A;  3RKW A;  4RG8 A;  1QQJ A;  3RER A;  4J6X A;  1RI9 A;  5CKE A;  2HKQ B;  3PMI A;  4XTU A;  1KFZ A;  3EGX A;  2V1R A;  4Z8A A;  1KC8 C;  4PJO A;  3CCM T;  1BI1 A;  4PFZ A;  2ZCF B;  3MPU B;  1M8M A;  2EYY A;  4RUG A;  3P8D A;  2P4T A;  2XG8 D;  1QVF S;  3CCV T;  2E41 A;  5C6S A;  3SEM A;  4C8Q D;  5IXB A;  3EHQ A;  1TXQ A;  2B8A A;  2YRC A;  4ZN3 A;  1A0N B;  4M75 F;  4K11 A;  3OYL A;  2ROL A;  4KUL A;  4AFS C;  4WTO B;  3OYD A;  2LTO A;  2K4Y A;  1QKX A;  4AFQ C;  2KT1 A;  4RCB A;  1M3B A;  2O2O A;  4WCI A;  1WHJ A;  1WYX A;  1YI2 Q;  3HL8 A;  2AKK A;  1GCP A;  4E7L A;  3OYK A;  2ZGW A;  5CK9 A;  1MMD A;  4XTZ A;  2JTE A;  2K5F A;  3S3O A;  4M78 B;  3JB9 D;  3CC4 Q;  1VQ9 T;  4KH1 B;  3EG9 A;  3EGD A;  1WQ7 A;  2JN0 A;  4PLI A;  2I2L A;  1D3B B;  2H3E B;  1JJ2 S;  2L5Q A;  4FYX B;  2QA4 Q;  2LCS A;  2M02 A;  1WXB A;  3L42 A;  1WHH A;  2DPP B;  3CMA A;  2AK5 A;  3QYG B;  4C8Q F;  5KE2 A;  1OUL A;  4FL6 A;  2VVK A;  3VS1 A;  2FPE A;  5I2M A;  3VUZ A;  4BE2 A;  2DO3 A;  1OYX A;  3A8G B;  4ESR A;  5DLO A;  1OQK A;  1RAI B;  2EQK A;  4RTU A;  4C92 B;  2BUD A;  3VV0 A;  3TSZ A;  2BZY A;  4HCK A;  1Q82 R;  2DL7 A;  2K57 A;  4OB1 B;  3CCJ Q;  1G3Y A;  3LW5 E;  2EJF A;  1B34 B;  1D09 B;  4E6R A;  3MKD A;  2YHT A;  1N9S A;  3C0C A;  2IIM A;  4J7I A;  3JCM d;  2SEM A;  2KYM A;  2MF2 A;  1KD1 U;  3PVQ A;  2RQW A;  3M0U A;  2CP7 A;  4Z89 A;  1KIK A;  2EKO A;  3JCM g;  2DIG A;  2FL7 A;  4BI4 A;  2KEA A;  2LP5 A;  3BFM A;  4AT1 B;  2DTH A;  1VQ5 Q;  2K79 A;  5J3B A;  4EDU A;  5GAN j;  1G83 A;  4IIO A;  1YJN T;  1VQK T;  2DIL A;  3MP8 A;  1X43 A;  2EWN A;  4PFP A;  1AWJ A;  2K2V A;  3CBP A;  1UTI A;  4ANJ A;  4DOW A;  4JS4 A;  3JCM e;  1RAA B;  1WXT A;  4M75 C;  1IRX A;  4XTY A;  2X4W A;  1RL2 A;  1U3O A;  3M0R A;  3CCL Q;  4DBR A;  2NUT B;  1CKA A;  4HCB A;  1UJ0 A;  5LJ5 j;  2CYZ B;  2KVQ G;  5CKF A;  4PJN A;  5FLX E;  5FRM A;  2DAQ A;  4MMK A;  1QVG P;  1PSF A;  4MDX A;  4PK4 A;  2R58 A;  2E70 A;  4R56 A;  1OU9 A;  3CPW S;  2A7Y A;  2EGA A;  5KYW A;  1AZE A;  3L2Q A;  4BAC A;  3S6W A;  1K8A R;  4XTW A;  3CBO A;  5HK0 A;  3G4S T;  2VC8 A;  3V7C A;  1U1T A;  5GAN 8;  3CME A;  1U1S A;  1OOT A;  1OPL A;  1VYU A;  1X69 A;  2V8I A;  2OJ2 A;  3RES A;  2DM1 A;  1NYG A;  2DXT A;  5GAN 2;  1R77 A;  3X28 B;  2EVR A;  4C8Q C;  1MGQ A;  1ZHI A;  4D8D A;  4LDV A;  3FC3 A;  4KH0 B;  2JNG A;  5FWC A;  1WQW A;  3ME9 A;  4RCC A;  4C0F A;  1RAC B;  3JCM c;  1NYF A;  2DVJ A;  2D9T A;  2K3B A;  4M78 D;  1K76 A;  1K0S A;  1UJY A;  3I9Q A;  1ZSZ C;  4PNO A;  2EQI A;  1MNE A;  3QWX X;  4Z02 A;  3CC2 T;  3L1A A;  2K9G A;  3EG1 A;  1VQP Q;  1Q81 R;  4JRI A;  3CCS T;  3M4G A;  2HQH A;  4C92 A;  5GAM f;  4MZT A;  2RHZ A;  1XQH A;  4F04 B;  1VQ7 A;  2PVO B;  1IGU A;  2GFA A;  4GLM A;  2D0N A;  5LL6 S;  1XNI A;  3EH1 A;  2BIV A;  3GLX A;  5GAN 3;  2RQU A;  2HL3 A;  1VQ4 Q;  4J9H A;  1M1K R;  2YUP A;  3NTI A;  4M78 F;  4ATO A;  3BDL A;  2AZS A;  3HRS A;  3EAE A;  4C0G A;  1KQS A;  2RF0 A;  2P84 A;  1BI2 A;  1O75 A;  3VS5 A;  5GAN 7;  3CME Q;  2QYZ A;  5FU6 B;  2EQJ A;  1D0Z A;  5GAN 5;  1OV3 A;  4BY6 B;  1X2K A;  4FIB A;  1JU5 C;  2RJE A;  4QW2 A;  2L0A A;  4C92 F;  4EIK A;  1J3T A;  3M53 A;  3PNW C;  3OYB A;  3VYH B;  2BZ8 A;  5CIU A;  3OYJ A;  3A98 A;  1GL5 A;  5KYY A;  2RHI A;  1YCS B;  2NUT A;  3CCU Q;  5I21 A;  1LNX A;  2D6F A;  1SRL A;  4PJO E;  2P0P A;  4DBF A;  3G71 Q;  2KRO A;  2XK0 A;  3O8V A;  4HT8 A;  2MWO A;  4F17 A;  5GAN d;  1UG1 A;  4LDU A;  2M9U A;  3TU4 K;  4XU2 A;  3GNF B;  3UF4 A;  2HEQ A;  2LQW A;  3G1J A;  3H0F A;  2OTJ Q;  5L8R E;  3JCM h;  3OW2 A;  1XJW B;  2ROT A;  2GQI A;  4ORZ A;  1VQO A;  2YUN A;  4FU6 A;  4IUT A;  3VS2 A;  2YLB A;  5FU7 B;  1KD1 R;  1KQ1 A;  1VQ7 Q;  3FJP A;  1BYM A;  4C0D C;  5LJ5 d;  2J05 A;  3CXC A;  5LJ3 f;  3PGG A;  3I56 A;  3I55 T;  1FX7 A;  1YHQ T;  5GAN e;  5LJ5 g;  5KYX B;  2XID A;  2KNB B;  4RTZ A;  1AHJ B;  3E2U A;  4M7D G;  2DZC A;  3VS7 A;  1WPY A;  3VRZ A;  2OTL Q;  2KE9 A;  3QO3 A;  3MCA B;  2OAW A;  1N8R C;  3JCM P;  2CZ1 B;  3CC4 T;  5LJ5 e;  1X6G A;  4N0A C;  1QKW A;  1C0M A;  1QVF A;  1E6G A;  3JB9 J;  2LJ1 A;  2J6K A;  5GAO q;  2QA4 T;  1G3S A;  4EPC A;  1NBE B;  5CKH A;  4IUR A;  1YIJ Q;  4Y92 A;  2PQW A;  4GY5 A;  4AG2 C;  2JUF A;  2FB7 A;  3OS5 A;  3RNJ A;  1FYN A;  1RAF B;  1ZA2 B;  3OYA A;  2DZ9 A;  2XMF A;  3M58 A;  3OS1 A;  2M0O A;  3CCJ T;  2K2M A;  3H41 A;  2HQX A;  3QII A;  4F7U G;  1BB9 A;  4QQ6 A;  2CT3 A;  4EMK A;  2PUO B;  5J26 A;  3ZEH A;  1Y0M A;  2HCK A;  3A5Z B;  1NM7 A;  3EGX B;  3KUF A;  3MET A;  1VQO Q;  4OMF B;  2FZC B;  1VYV A;  2JOY A;  2HD0 A;  1LCK A;  3CCE A;  1VOM A;  3TQ7 P;  3HRU A;  4QVZ A;  1ZA1 B;  4NL2 A;  5IHK A;  1VQ5 T;  3REA B;  3UWN A;  2M0Y A;  2E64 A;  2K3Y A;  2RHX A;  3I56 Q;  5KCO A;  1VQ6 Q;  2P4R A;  1NE8 A;  2YWW A;  1T3L A;  1UEB A;  4JS5 A;  1UB4 A;  1Q82 U;  2A37 A;  4J9C A;  1EZZ B;  1SRM A;  5HY6 A;  4X9D A;  2ZPI B;  3OY9 A;  4LE9 A;  2A08 A;  4ZGJ B;  1W2B S;  2RQV A;  2YDL A;  2RK1 A;  2VXE A;  3NMZ C;  2CSQ A;  2M16 A;  4XU1 A;  3E9F A;  4OMP A;  3CCL T;  4M7A G;  2E1H A;  3J81 E;  3MEA A;  1JQQ A;  3A8M B;  3PIO A;  2VGM A;  2KY9 A;  2GGR A;  3LGL A;  1G5V A;  3QZ9 B;  2IVW A;  2ESW A;  1QVG S;  1WI7 A;  2RI2 A;  2YUO A;  2DBM A;  2DJQ A;  3OYE A;  3OMC A;  2O4X A;  1NZ9 A;  1GFD A;  2EYQ A;  4L5G A;  3IQL A;  1VQN A;  5KYX A;  2JZ2 A;  3RBB B;  2DTO A;  4FYW B;  1FMV A;  1CKB A;  2COZ A;  2RN8 A;  4LDY A;  3SWN A;  2RI3 A;  2ZPF B;  1WX6 A;  3MP6 A;  1H8K A;  2MCN A;  3F70 A;  4M78 E;  4XTX A;  3HFN A;  4O6J A;  2BTT A;  4FT4 A;  1QVP A;  1YJ9 A;  2K5L A;  3QDF A;  3SDZ A;  1HSQ A;  2COW A;  2DXB A;  3GIB A;  5GAN h;  4HKE A;  1K8A U;  2H8H A;  1O9S A;  3CPW A;  4DA4 A;  2E5Q A;  4C5I A;  4E7I A;  4C92 E;  4J83 A;  1YJW Q;  3HRT A;  1VYT A;  2JJ9 A;  5DY9 A;  1MMG A;  3HPW A;  3LWI A;  1VQP T;  2F2V A;  3NHN A;  1EFN A;  2QQR A;  4RTY A;  2QGG A;  2RMO A;  3ASK A;  1PKS A;  1LPL A;  2RHY A;  3OYN A;  2K6D A;  5LJ5 h;  2M1H A;  4M7D B;  1RAG B;  2QEX T;  3GF5 A;  3UDC A;  1V76 A;  3GBQ A;  4XU0 A;  1M3A A;  1QLY A;  1TOV A;  2ZPB B;  2J7I A;  1TU0 B;  2FEI A;  1VQ4 T;  4P5N A;  2PVD B;  3HFO A;  2JVV A;  2EYX A;  3RKY A;  2ZPG B;  2YSQ A;  2DJZ A;  2QK0 A;  4PJO D;  8AT1 B;  2LZ6 B;  1HXD A;  3MP1 A;  4J9G A;  4A53 A;  4CC3 A;  2MMP A;  1Q81 U;  2D1X A;  1QMC A;  1NG2 A;  1VQN Q;  5FU6 C;  4ZNX A;  4AFU C;  1VQM Q;  1JXO A;  5AT1 B;  5KYW B;  5CR2 A;  3HHT B;  4BI8 B;  3I35 A;  1Z9Z A;  3CD6 A;  1YNZ A;  1N9R A;  1RI0 A;  3PMT A;  1M1K U;  3CCU T;  3V7S A;  5I2S A;  3G71 T;  1ZBJ A;  1K9M U;  2MPX C;  1WFW A;  2WSC E;  3G7Z A;  1WGS A;  3ZBD A;  1S72 Q;  1JRI A;  4PJO F;  3X24 B;  5I11 A;  1N27 A;  2JS0 A;  2FYK A;  1QP2 A;  2OTJ T;  2EJG A;  4LXC A;  4J9F A;  1OZ3 A;  2QAZ A;  5D6X A;  2IPO B;  3CC7 T;  1FWZ A;  3CCR A;  3KXT A;  1HD3 A;  1DJ7 B;  2DF6 A;  4ZTJ A;  3LH5 A;  2DA9 A;  5EC7 A;  3L2W A;  4M77 G;  2ED0 A;  1VQL Q;  3I5S A;  5FU7 C;  2DL8 A;  1NLP C;  2RD1 A;  3CCQ A;  1ZQ1 A;  4HVU A;  3HSB A;  3GNG A;  4C0Z A;  2LNV A;  2C0O A;  4M7A B;  2R5A A;  4HCC A;  3PIP A;  1VQ8 A;  1OEB A;  1PRL C;  2OTL T;  2MWP A;  3QWY A;  2XHC A;  3QYH B;  1H3H A;  1I4K 1;  3RUX A;  1M9S A;  1PSE A;  3FEO A;  4NOY A;  2D0Q B;  4A63 B;  3FDR A;  4HA8 A;  2EGE A;  2DVE A;  1C1A A;  3M5A A;  2QAS A;  5GMK l;  2KRN A;  4OP0 A;  2JM9 A;  1M30 A;  3X20 B;  1R8O B;  3EFS A;  1TH7 A;  4FCY A;  4PJL A;  3D7S B;  3UA6 A;  1R0C B;  3G6E T;  1I5O B;  3H6Z A;  4J9B A;  1YIT A;  2JTM A;  1B7T A;  3FJ5 A;  1YIJ T;  1ACM B;  3QPH A;  2QTV A;  4A54 A;  4JRK A;  3CD6 Q;  2X51 A;  2QQS A;  4IUP A;  3OBW A;  1LJO A;  4M7D A;  4AG1 C;  3FIF A;  1PC0 A;  3JCM X;  1SF9 A;  5CO7 A;  1YCY A;  1BKB A;  1MUZ A;  2F5K A;  2G3R A;  5CVI A;  4FW1 A;  3GP8 A;  2R57 A;  4JJB A;  2O9V A;  4BD3 A;  4KT0 E;  3OQ5 A;  5KYY B;  2LT1 A;  4R55 A;  2ATC B;  4NS5 A;  5IN1 A;  2A28 A;  4JLG A;  1K0X A;  1CSK A;  1KC8 U;  3CCR Q;  4RTX A;  1XTD A;  4DBQ A;  9ATC B;  3L2Z A;  1BIA A;  4DBH A;  1OZ2 A;  5FWB A;  1MV3 A;  3CMA Q;  4PJO C;  3VS3 A;  1N8R R;  1RLQ C;  1VQ6 T;  4OMQ A;  3JCM W;  2YRD A;  1OPK A;  3N5B B;  3VS0 A;  1HK9 A;  2A0F B;  2QG9 B;  3FRN A;  3M57 A;  4F7U A;  4D6W A;  1YWO A;  4NL3 A;  4RTV A;  3UAT A;  1AWX A;  5KCH A;  5GAN 4;  4OB0 B;  3CCM A;  2V8J A;  3JCM J;  1N5Z A;  2KT8 A;  2XI9 A;  4DQ2 A;  3VRY A;  1K73 C;  1MV0 B;  2E3H A;  1WZO A;  1UE9 A;  4RTT A;  3CCV A;  2DD5 A;  1G3T A;  3M0Q A;  5GMK m;  1Y96 B;  4OMO A;  4KGZ B;  2AKL A;  1MND A;  1WLP B;  2FRW A;  4M75 G;  5L23 A;  4C92 D;  2PVG B;  2OX7 A;  1U5S A;  4XTV A;  2PU9 B;  4M7A A;  3V8K A;  1UGR B;  2EAY A;  3OW2 P;  1W2B A;  3M0P A;  5AYF A;  4E7J A;  1SHF A;  2DKG A;  3H0I A;  1Q7Y C;  2X4Y A;  3O5Z A;  1I0C A;  3U23 A;  4IUV A;  2V1Q A;  4OML A;  1VQ9 A;  3CXC P;  2GBQ A;  1IHW A;  2CS7 A;  3QSU A;  2DNU A;  2HBP A;  1AD5 A;  4Y28 E;  2QTX A;  5GMK j;  5KYU A;  4EMK B;  3QJY A;  2FPF A;  3JCM V;  1K9M R;  4A4H A;  2JMC A;  1M2V A;  4LDW A;  1QVG A;  1E6H A;  3LX7 A;  2LCC A;  2MAM A;  1YJW T;  3AT1 B;  4C8Q G;  5GAO n;  3JV3 A;  1WHL A;  2LDM A;  5J39 A;  2WAC A;  3UPU A;  2E65 A;  2VGN A;  5A2Q E;  1H92 A;  1UGP B;  2AHJ B;  2KMT A;  1OX8 A;  3CCM Q;  1QVF P;  1BCM A;  2R5M A;  2CDT A;  4EMH A;  2DBK A;  1U8R A;  1Y7X A;  3CCV Q;  3JCM f;  3MEW A;  1RUW A;  2COY A;  4BUG A;  3JB9 G;  2PZ1 A;  3H0H A;  2DRK A;  1ZUU A;  1Q82 C;  4N4G A;  1Q86 C;  5A0D A;  3KBG A;  1QCF A;  2L2P A;  1D1C A;  1X75 C;  2CKK A;  2NUZ A;  2LQN A;  1YJN A;  3L2V A;  1D1A A;  1VQK A;  2G6F X;  1Y57 A;  2XDB A;  1M5Q 1;  1UDL A;  2LQK A;  2DE0 X;  2DMO A;  1Y71 A;  5CQY A;  1H64 1;  1OX9 A;  3RMS A;  1VQM T;  1PNJ A;  1WHM A;  3VS6 A;  3ER0 A;  2W10 A;  2F2W A;  4E7H A;  1MMN A;  3WVD B;  4D8K A;  2KDS A;  1KG1 A;  2O4X B;  2X3X D;  2BE9 B;  1JJ2 P;  2L3P A;  5FRO A;  3S3N A;  4E7Z A;  2FZK B;  1YP5 A;  3QZ5 B;  2J6O A;  2X35 A;  3VYG A;  2HDA A;  5GAN 6;  1VQ9 Q;  3SWN B;  4A4G A;  4ME7 A;  2CRE A;  1YI2 T;  1GCQ C;  4FYV B;  2EQM A;  3DLM A;  1S72 T;  3G4S A;  2NLU A;  4EMG A;  5GAO l;  3MEU A;  4WF2 A;  1Y96 A;  2EYZ A;  4M78 C;  4XK8 E;  1KC8 R;  4QVD A;  2GTJ A;  2QGF B;  4C5G A;  1QW1 A;  3V8L A;  1VQL T;  1JXM A;  1NJI C;  2RB6 A;  1X2Q A;  3M0T A;  4RMO A;  2GQV A;  2HAX A;  1FMK A;  4OVA A;  3JB9 H;  1GRI A;  2O88 A;  3PFS A;  2K7A A;  4C92 C;  5M9O A;  1HYO A;  5HKC A;  2DL5 A;  2MK5 A;  1IGQ A;  1M90 C;  2VYT A;  1BI3 A;  3DB3 A;  1IB8 A;  3RKX A;  2X9H A;  2DEQ A;  2HMA A;  5IHI A;  3NFC A;  4BE0 A;  3CC2 A;  2GTO A;  2WSE E;  1Y07 A;  4OB3 B;  4M77 A;  4XAX B;  3CCS A;  2XDD A;  4LNP A;  1IRE B;  4M7D E;  3EFR A;  5C0M A;  2PNI A;  5D7U A;  4KBM B;  3EG0 A;  4LN2 A;  2DEU A;  4JZ3 A;  1TG0 A;  3M59 A;  4PL6 A;  4N4H A;  2DL3 A;  3QJ6 A;  2OI3 A;  2CGH A;  1K1Z A;  3C4S A;  2FRY A;  2D8J A;  4VUB A;  2MIO A;  5GJW B;  3EFO A;  4DEX A;  5ECA A;  2HL5 C;  5GAM j;  1HJD A;  4MZP A;  3ULR B;  3VKI A;  4MDW A;  1P92 A;  5KYN A;  2E6N A;  2DFU A;  3SD4 A;  3C95 A;  3MJX A;  4Z88 A;  3G4S Q;  2Y4Y A;  3NGP A;  1SKU B;  2D8H A;  3M0S A;  3QHS A;  4X9C A;  2JTF A;  1ZUY A;  1UGV A;  4ZGD B;  1VUB A;  1B07 A;  3CMA T;  5GMK e;  4IIM A;  5GAO m;  1Z9Q A;  4F7U E;  3DB4 A;  2J06 A;  2FPD A;  2H3J A;  2KQW A;  2L3R A;  3JRZ A;  3EH2 A;  2BKD N;  2FVU A;  4X1V A;  2Y90 A;  2DLP A;  4HT9 A;  3V8J A;  1X6B A;  5GAN f;  4TVR A;  3CC2 Q;  1LOJ A;  5DM7 R;  1X6O A;  3RMQ A;  1MMA A;  2AZV A;  4X34 A;  2KK4 A;  1N8R U;  3PVL A;  1QWE A;  2VV5 A;  1AOJ A;  3CCE Q;  3I55 A;  3OBY A;  1KJW A;  5D6Y A;  1YHQ A;  1IXD A;  4M7A E;  1OI1 A;  5LJ5 f;  2HZY A;  1RLP C;  2DD4 A;  3SFM A;  1ARK A;  1UFF A;  2L3S A;  2LC4 A;  1JBM A;  2E10 A;  3LYI A;  1EX4 A;  1SEM A;  2CUD A;  1AVZ C;  1R0B G;  4KGV B;  2LRQ A;  2RNA A;  4E7S A;  2JS2 A;  2KGT A;  1PRM C;  4FYY B;  1ABQ A;  1KD1 C;  2K3X A;  2DXU A;  3OYH A;  3CC4 A;  4LD6 A;  2MOX A;  3HP9 A;  3JCM b;  2RK2 A;  2FZG B;  2BZX A;  1W4S A;  2PTK A;  2QA4 A;  3JSC A;  1KHI A;  1YBY A;  1K73 R;  4EMK C;  4M75 A;  3BDU A;  2O9S A;  2HSE B;  1M2O A;  4OF1 A;  3CME T;  1T0H A;  1TSF A;  2V8K A;  2ZPE B;  5A0L A;  5IT9 E;  1NLO C;  2JMA A;  4BY6 C;  2YT6 A;  4ZTF A;  1SHG A;  3CCJ A;  2QDY B;  2RJF A;  4KUD K;  4OGC A;  1RAB B;  3TVT A;  1I5L A;  1M1F A;  4QT7 A;  1I81 A;  4FSX A;  4QKU A;  4F7U B;  2RHU A;  3ZL7 C;  3RR6 A;  4L6V 5;  2JW4 A;  1YJ9 Q;  2ENM A;  2GCX A;  3EHR A;  2CZ6 B;  1KQ2 A;  3THK A;  1NPP A;  5CAI A;  4CC7 A;  1PKT A;  3M56 A;  4C0D B;  1Q7Y R;  4LDX A;  2B86 A;  1V1C A;  4C8Q A;  1PCX A;  4QQD A;  1VQ5 A;  2F69 A;  2DET A;  1D0Y A;  5IXF A;  5A0G A;  4J9E A;  3I55 Q;  4J6Y A;  1NEG A;  2QQB A;  1MHN A;  2DK3 A;  1YHQ Q;  1GBR A;  2EBP A;  2CP5 A;  5GAM d;  2ABL A;  3VS4 A;  3E9G A;  3V7R A;  1SSF A;  2KXD A;  4C5E A;  5GAM g;  1PHT A;  1ZSZ A;  5HCK A;  4II1 A;  3L2U A;  1VQ7 T;  3WXM B;  1W1F A;  4BE1 A;  3RIR A;  3J7A F;  3CCL A;  2V26 A;  2FG0 A;  3SHW A;  3UA7 A;  2VB6 A;  4XQ3 A;  4B9X A;  5GMK h;  1TUG B;  5KE3 A;  4HVW A;  3L2R A;  4QVC A;  3SWN C;  5GAM e;  3A8L B;  4FM4 B;  1M1G A;  4JJC A;  1WHK A;  5CCA A;  2EJ9 A;  7AT1 B;  1H3Z A;  2ZPH B;  3Q1J A;  2RH2 A;  4JPB W;  2DX1 A;  1WJQ A;  2QQA A;  4JUV A;  2EGC A;  4LD9 K;  5CQX A;  2YXY A;  1UHC A;  4JZ4 A;  4CC4 B;  3M54 A;  5KYU B;  1Q86 R;  3QG1 A;  2A36 A;  4O5V A;  4JLI A;  1M2V B;  3PT9 A;  2XKO C;  1BI0 A;  1QP3 A;  2CP0 A;  4J8O A;  1K4U S;  2HSP A;  1IO6 A;  4E2F B;  4FT2 A;  4M7D D;  1WA7 A;  1D0X A;  3HTR A;  4OB2 B;  3E1S A;  2EQU A;  3JB9 F;  2L3Q A;  2E3I A;  3OYM A;  1I1J A;  2CH4 W;  4M77 E;  3TRE A;  3URG A;  1WIE A;  3OYY A;  3A1P A;  1KHC A;  2NUP A;  1AWW A;  1W2B P;  1VQP A;  2KSS A;  4JJN K;  5I22 A;  2EYW A;  3A8H B;  2NWM A;  3C12 A;  3LGF A;  1VQO T;  1W70 A;  4GLK A;  5LJ3 d;  4A4E A;  4GBQ A;  2RJC A;  2RPN A;  2E6Z A;  1TTH B;  3H8Z A;  1T3S A;  2QEX A;  3CCQ Q;  3MO8 A;  5LJ3 g;  3I56 T;  1KSW A;  3WVE B;  1TS9 A;  1PD0 A;  1TWB A;  1GXI E;  3QKJ A;  4M7D F;  2LNH B;  3SB2 A;  1G3W A;  1VQ4 A;  2A3L A;  1KQS P;  5FRN A;  2C0T A;  4IUQ A;  1VQ8 Q;  1NJI R;  2QQ9 A;  1I8F A;  1U06 A;  4PFO A;  1ZLM A;  2VWF A;  2XD0 A;  2KRM A;  1YWP A;  3DKM A;  2HQE A;  2DTI A;  5CKB A;  2KYB A;  3I5R A;  2RO0 A;  2LCL A;  5LJ3 e;  2RQT A;  2YLC A;  1M90 R;  2F1L A;  4ELY C;  1GFC A;  1YIT Q;  2GF7 A;  3PTA A;  2ECZ A;  1GCQ A;  3OA6 A;  4BDY A;  4V2S A;  4A4K A;  1AZG B;  2KRS A;  4MML A;  3OYC A;  2CP6 A;  1T0J A;  2MI6 A;  3CCU A;  4F7U F;  2CSI A;  4M78 A;  3MEV A;  4M7A D;  3G71 A;  2KR3 A;  1FXX A;  4N0A A;  2GFU A;  3CPF A;  1D3B A;  1BCO A;  2JXB A;  2W0Z A;  2OTJ A;  4Y91 A;  1I07 A;  3LH0 A;  4KUI A;  2HBW A;  4ZN1 A;  3CC7 A;  4PJO G;  3ZFJ A;  5DLQ E;  1GBQ A;  4CI0 C;  1Q95 G;  1UGS B;  3OS0 A;  3CCE T;  3TEE A;  4M4Z A;  5IHN A;  4XU3 A;  2QEX Q;  4M77 B;  3REB B;  1B34 A;  5GAM h;  3T9N A;  3GPL A;  2C06 A;  4IKF A;  3FB9 A;  3QDR B;  2MYS A;  1IZ6 A;  3OSS C;  3TCJ A;  2EKH A;  4A4F A;  1PG5 B;  1VA7 A;  4CRI A;  4JRP A;  2OTL A;  4M7A F;  4BB7 A;  2QI2 A;  3OS2 A;  1WXU A;  2GNC A;  2CUB A;  4M7D C;  2DXC A;  4OMM A;  4JRQ A;  3J80 E;  2E4H A;  3EG2 A;  1SSH A;  3EFO B;  3OYI A;  1AWO A;  4M75 E;  1YN8 A;  2I0N A;  3G6E A;  2ZZD A;  1RAE B;  2OAU A;  1YIJ A;  3GOX A;  2L8D A;  2QXF A;  2AIR B;  2IG0 A;  4DEY A;  3CEY A;  2AT1 B;  1NPR A;  2DYI A;  3NTK A;  5GAO r;  2K5I A;  2CZ7 B;  1VQN T;  2E12 A;  2J6F A;  3LWH A;  5IH2 A;  5GAO p;  2SRC A;  2XIC A;  4B9W A;  2NYS A;  1JEG A;  1YFN A;  2QDL A;  3M9Q A;  1UGQ B;  3M55 A;  5GAN g;  1UHF A;  4BDZ A;  3OMG A;  1VIF A;  4Q5W A;  4C8Q E;  3CC7 Q;  1YJ9 T;  1F1B B;  4MZM A;  2EW3 A;  1N6A A;  2P0K A;  3FLG A;  1B3Q A;  4J9D A;  1K73 U;  2XU8 A;  3INZ A;  1PWT A;  4YTL A;  3MHX A;  3QXE B;  2CZ0 B;  1QWF A;  1WJS A;  4QQG A;  3OYF A;  1VQ6 A;  3NTH A;  1M4Z A;  1AT1 B;  1BBZ A;  2LT4 A;  1W6X A;  2LX9 A;  2O31 A;  3P8H A;  1ABO A;  3OB9 A;  3CBM A;  1ZBX A;  2F5T X;  1E7O A;  2BE7 D;  2JM8 A;  5LJ3 h;  2ED1 A;  2FHD A;  2KBT A;  2LVM A;  4HVV A;  1JO8 A;  6AT1 B;  2CP2 A;  4OGE A;  2CP3 A;  3P8B B;  2RM4 A;  1WDX A;  2ZAE A;  3VUB A;  2F2X A;  1X01 A;  5D6W A;  1TUD A;  3VJP A;  1K8A C;  4PJM A;  1QCO A;  4B6M A;  4M7A C;  4DOV A;  1V29 B;  3G6E Q;  1SG5 A;  1Q7Y U;  5GMK i;  4HXJ A;  3RDV A;  1AEY A;  4JDS A;  5KH6 A;  2RI5 A;  4ELZ C;  1VIE A;  2LJ3 A;  1RAH B;  3CQT A;  4CC2 A;  3X26 B;  3JAM E;  4M77 D;  1G8X A;  1YJN Q;  1VQK Q;  1LVK A;  1TUC A;  1NEB A;  3X25 B;  2VAS A;  2EIF A;  4PKC C;  3R6N A;  4RKU E;  2DYB A;  3OYG A;  4HCZ A;  4M75 B;  4PJJ A; 
#chains in the Genus database with same CATH homology
 1BI2 A;  2RK2 A;  1O75 A;  5CO7 A;  1W4S A;  1YCY A;  2QA4 A;  2X4X A;  3JSC A;  2DIQ A;  1BKB A;  1KHI A;  2VXF A;  5GAN 7;  2F5K A;  1YBY A;  2G3R A;  5FU6 B;  2EQJ A;  2Y4X A;  5CVI A;  5GAN 5;  3GP8 A;  4BY6 B;  4EMK C;  2R57 A;  4FIB A;  2RJE A;  4M75 A;  4QW2 A;  4BD3 A;  3BDU A;  4KT0 E;  4C92 F;  4L59 A;  3OQ5 A;  4E47 A;  2O01 E;  3M53 A;  3PNW C;  4OF1 A;  3CME T;  2LT1 A;  3OYB A;  2PUK B;  4R55 A;  2V8K A;  2ZPE B;  4NS5 A;  5IN1 A;  3C94 A;  4JLG A;  3VYH B;  5A0L A;  1JJ2 A;  4PJO B;  5IT9 E;  1Q81 C;  5CIU A;  3OYJ A;  4BY6 C;  4ZTF A;  1KC8 U;  3CCJ A;  2QDY B;  4M78 G;  2RJF A;  1XTD A;  2WSF E;  1XOV A;  4OGC A;  4KUD K;  1I5L A;  2RHI A;  1M1F A;  1YJW A;  3L2Z A;  3R6O A;  5I21 A;  1LNX A;  2D6F A;  1BIA A;  4PJO E;  1OZ2 A;  1I81 A;  4M77 F;  4FSX A;  2P0P A;  4PJO C;  1Q86 U;  2XK0 A;  3O8V A;  4F7U B;  2RHU A;  2MWO A;  3CCR T;  4HT8 A;  5GAN d;  4L6V 5;  4LDU A;  2M9U A;  3TU4 K;  1VQ6 T;  3VU3 C;  4C8Q B;  3JCM W;  4XU2 A;  2GCX A;  3N5B B;  2CZ6 B;  1HK9 A;  1KQ2 A;  4J7F A;  3GNF B;  1NPP A;  2RA2 A;  1M1K C;  3FRN A;  5CAI A;  3M57 A;  3OSV A;  4F7U A;  4D6W A;  4C92 G;  3M56 A;  5L8R E;  3CCQ T;  4C0D B;  3JCM h;  3OW2 A;  4LDX A;  4C8Q A;  4NL3 A;  1WJR A;  4QQD A;  1VQ5 A;  2F69 A;  1JB0 E;  1VQO A;  5A0G A;  1K9M C;  4FU6 A;  4IUT A;  4J6Y A;  2QQB A;  3LLR A;  1MHN A;  2DK3 A;  5KCH A;  1EIF A;  2HNI A;  2YLB A;  5FU7 B;  5GAN 4;  4OB0 B;  5GAM d;  3CCM A;  1KQ1 A;  2V8J A;  3E9G A;  3FJP A;  3V7R A;  3JCM J;  1VQ8 T;  4J5Y A;  1M8V A;  1BYM A;  4C0D C;  5LJ5 d;  3CXC A;  5LJ3 f;  3PGG A;  2XI9 A;  3A8O B;  1SSF A;  4DQ2 A;  3I55 T;  3I56 A;  1K73 C;  4C5E A;  5GAM g;  1FX7 A;  1YHQ T;  5EG2 A;  5GAN e;  1KQS S;  5LJ5 g;  4II1 A;  3L2U A;  1VQ7 T;  2XID A;  2L89 A;  3WXM B;  4BE1 A;  3CCV A;  2DD5 A;  3M4Y A;  1G3T A;  3RIR A;  3J7A F;  3CCL A;  1AHJ B;  4M7D G;  4PLL A;  2DZC A;  1WNL A;  1WPY A;  5GMK m;  4ZGE B;  4XQ3 A;  1Y96 B;  4B9X A;  1VQM A;  4RG2 A;  5GMK h;  4C5H A;  1YIT T;  3QO3 A;  3BY7 A;  3MCA B;  4IUU A;  5KE3 A;  3AHU A;  4M75 G;  3L2R A;  4QVC A;  3SWN C;  3JB9 I;  1N8R C;  5GAM e;  3A8L B;  4FM4 B;  2PVG B;  4C92 D;  3JCM P;  2P0Q A;  4M7A D;  2CZ1 B;  3DLL A;  3CC4 T;  1M1G A;  4XTV A;  2PU9 B;  5LJ5 e;  4M7A A;  3V8K A;  2RJD A;  5CCA A;  4N4I A;  1UGR B;  2EJ9 A;  2EAY A;  4N0A C;  1H3Z A;  2ZPH B;  3Q1J A;  1QVF A;  1NJI U;  1W2B A;  3JB9 J;  2RH2 A;  5AYF A;  4E7J A;  5GAO q;  2QA4 T;  4E7K A;  1WJQ A;  2QQA A;  4JUV A;  1G3S A;  2DKG A;  2YRV A;  4EPC A;  4LD9 K;  5CKH A;  4IUR A;  1Q7Y C;  2X4Y A;  5CQX A;  3S3M A;  4BI3 A;  3M54 A;  1YI2 A;  2PQW A;  2XDP A;  4GY5 A;  4IUV A;  2JUF A;  2FB7 A;  3OS5 A;  5HK3 A;  3QG1 A;  4O5V A;  1VQ9 A;  4JLI A;  1S72 A;  5IAY A;  2KAF A;  3QBY A;  4UC4 A;  5LJ3 j;  1BIB A;  3PT9 A;  3OYA A;  2DZ9 A;  2CS7 A;  1BI0 A;  1QP3 A;  2XKO C;  3M58 A;  4J8O A;  3OS1 A;  3HKS A;  1M90 U;  3QSU A;  2HBP A;  4Y28 E;  2QTX A;  2M0O A;  5GMK j;  3OW2 S;  4FT2 A;  4EMK B;  4M7D D;  3QJY A;  3JCM V;  3CCJ T;  2X4J A;  4A4H A;  3E19 A;  4LDW A;  4OB2 B;  1QVG A;  3E1S A;  3BW1 A;  2HQX A;  3QII A;  3LX7 A;  4F7U G;  2LCC A;  2MAM A;  3UT1 A;  1YJW T;  2EQU A;  3JB9 F;  4J6W A;  4C8Q G;  5GAO n;  1VQL A;  4QQ6 A;  5CKD A;  3JCM Q;  4EMK A;  4M7A E;  2PUO B;  5J26 A;  2LDM A;  3ZEH A;  4M75 D;  3QUI A;  3OYM A;  2LQ8 A;  5J39 A;  3CXC S;  4M77 E;  2VUB A;  2WAC A;  4M77 C;  3UPU A;  3A5Z B;  3MET A;  2E65 A;  3KUF A;  2VGN A;  2EFI A;  3TRE A;  3URG A;  4OMF B;  5A2Q E;  1UGP B;  2AHJ B;  2KMT A;  3OYY A;  2JOY A;  3RKW A;  2HD0 A;  4RG8 A;  1KHC A;  3RER A;  4J6X A;  5CKE A;  3CCE A;  3HRU A;  1VQP A;  3PMI A;  4QVZ A;  4NL2 A;  2KSS A;  4XTU A;  4JJN K;  1VQ5 T;  2R5M A;  3UWN A;  1VQO T;  3A8H B;  2E64 A;  3C12 A;  3LGF A;  2K3Y A;  2RHX A;  4GLK A;  5KCO A;  4EMH A;  1KC8 C;  5LJ3 d;  4A4E A;  1NE8 A;  4PJO A;  2RJC A;  1U8R A;  1Y7X A;  3CCM T;  1BI1 A;  1UEB A;  4JS5 A;  1UB4 A;  1Q82 U;  2E6Z A;  3H8Z A;  3JCM f;  2ZCF B;  3MEW A;  2QEX A;  4BUG A;  3MO8 A;  5HY6 A;  5LJ3 g;  3I56 T;  3JB9 G;  4X9D A;  3WVE B;  2ZPI B;  1Q82 C;  3OY9 A;  4N4G A;  1Q86 C;  1GXI E;  3QKJ A;  5A0D A;  4M7D F;  3KBG A;  3SB2 A;  1G3W A;  3CD6 T;  4ZGJ B;  3P8D A;  2P4T A;  2XG8 D;  1QVF S;  2CKK A;  1X75 C;  3CCV T;  1VQ4 A;  2E41 A;  2A3L A;  2RK1 A;  2VXE A;  1W2B S;  2M16 A;  4XU1 A;  5C6S A;  3E9F A;  3L2V A;  1YJN A;  1VQK A;  4C8Q D;  4IUQ A;  3CCL T;  5FRN A;  2E1H A;  3J81 E;  2XDB A;  4M7A G;  1M5Q 1;  2QQ9 A;  2LQK A;  1I8F A;  2B8A A;  3MEA A;  1Y71 A;  4ZN3 A;  4M75 F;  5CQY A;  1H64 1;  3RMS A;  1VQM T;  2XD0 A;  3ER0 A;  3OYL A;  3DKM A;  2HQE A;  2DTI A;  4KUL A;  5CKB A;  3A8M B;  3OYD A;  3PIO A;  4E7H A;  3WVD B;  2VGM A;  2LTO A;  2K4Y A;  2KY9 A;  2LCL A;  2RO0 A;  2KDS A;  5LJ3 e;  1KG1 A;  2O4X B;  3LGL A;  4RCB A;  1G5V A;  3QZ9 B;  2IVW A;  2YLC A;  5FRO A;  3S3N A;  1QVG S;  3HL8 A;  2RI2 A;  4ELY C;  4E7L A;  3QZ5 B;  3OYE A;  3OYK A;  3OMC A;  3VYG A;  2X35 A;  2ZGW A;  2GF7 A;  2O4X A;  5GAN 6;  1NZ9 A;  5CK9 A;  3PTA A;  3SWN B;  4A4G A;  4ME7 A;  2EYQ A;  4L5G A;  1VQN A;  4XTZ A;  3OA6 A;  4BDY A;  4V2S A;  1YI2 T;  2K5F A;  3S3O A;  4M78 B;  4A4K A;  2JZ2 A;  3JB9 D;  2DTO A;  4MML A;  2EQM A;  1VQ9 T;  3DLM A;  3OYC A;  1S72 T;  1WQ7 A;  4LDY A;  3SWN A;  2JN0 A;  4PLI A;  2I2L A;  2MI6 A;  1D3B B;  2RI3 A;  2ZPF B;  3G4S A;  3CCU A;  1JJ2 S;  2NLU A;  3MP6 A;  2L5Q A;  4EMG A;  4F7U F;  5GAO l;  3MEU A;  3L42 A;  4M78 A;  2DPP B;  1Y96 A;  3F70 A;  3MEV A;  4M78 E;  4WF2 A;  3QYG B;  4XTX A;  3G71 A;  3CMA A;  4C8Q F;  1FXX A;  4FL6 A;  3HFN A;  2GFU A;  4M78 C;  3CPF A;  4FT4 A;  4N0A A;  4O6J A;  5KE2 A;  5I2M A;  3VUZ A;  4BE2 A;  2DO3 A;  4XK8 E;  1QVP A;  1OYX A;  3A8G B;  1D3B A;  2K5L A;  1YJ9 A;  3SDZ A;  4QVD A;  5DLO A;  4C5G A;  1QW1 A;  3V8L A;  2EQK A;  1VQL T;  4C92 B;  2BUD A;  2OTJ A;  1NJI C;  2DXB A;  2RB6 A;  4Y91 A;  3VV0 A;  5GAN h;  3GIB A;  4RMO A;  3LH0 A;  4KUI A;  2GQV A;  2HAX A;  4OVA A;  4ZN1 A;  2K57 A;  3CC7 A;  4HKE A;  3JB9 H;  4PJO G;  1K8A U;  4OB1 B;  5DLQ E;  1O9S A;  3ZFJ A;  3CPW A;  1G3Y A;  4DA4 A;  3PFS A;  2E5Q A;  4C5I A;  4CI0 C;  3LW5 E;  4E7I A;  1UGS B;  4C92 E;  2EJF A;  4J83 A;  1B34 B;  4C92 C;  5M9O A;  3HRT A;  5DY9 A;  3OS0 A;  5HKC A;  3CCE T;  3HPW A;  3LWI A;  1VQP T;  3TEE A;  2YHT A;  1N9S A;  4XU3 A;  1M90 C;  2VYT A;  2QQR A;  4J7I A;  4M77 B;  1BI3 A;  3JCM d;  3DB3 A;  3ASK A;  1B34 A;  3RKX A;  2RHY A;  5GAM h;  3T9N A;  2DEQ A;  3OYN A;  2MF2 A;  1KD1 U;  3GPL A;  3NFC A;  2C06 A;  4BE0 A;  4IKF A;  3FB9 A;  5LJ5 h;  3CC2 A;  2EKO A;  3QDR B;  2WSE E;  2M1H A;  1Y07 A;  4OB3 B;  3JCM g;  4M7D B;  1IZ6 A;  3OSS C;  2DIG A;  2FL7 A;  2QEX T;  3TCJ A;  4M77 A;  4BI4 A;  3GF5 A;  4A4F A;  4XAX B;  4CRI A;  3BFM A;  4JRP A;  2OTL A;  2DTH A;  3UDC A;  3CCS A;  4M7A F;  4XU0 A;  4BB7 A;  2ZPB B;  2XDD A;  5J3B A;  4EDU A;  2QI2 A;  3OS2 A;  5GAN j;  4P5N A;  1VQ4 T;  1IRE B;  4M7D E;  2PVD B;  3EFR A;  5C0M A;  1YJN T;  1VQK T;  4M7D C;  3MP8 A;  2DXC A;  3HFO A;  4KBM B;  4JRQ A;  2JVV A;  3RKY A;  2ZPG B;  2EWN A;  3J80 E;  2DJZ A;  2K2V A;  3OYI A;  3CBP A;  4PJO D;  3M59 A;  4PL6 A;  4N4H A;  1HXD A;  3QJ6 A;  4M75 E;  2CGH A;  3MP1 A;  2ZZD A;  4DOW A;  3JCM e;  3G6E A;  4JS4 A;  4M75 C;  4XTY A;  3C4S A;  4A53 A;  2MMP A;  2OAU A;  4VUB A;  1Q81 U;  2X4W A;  1RL2 A;  1YIJ A;  3GOX A;  2L8D A;  5GAM j;  2QXF A;  4MZP A;  5FU6 C;  2IG0 A;  4HCB A;  3CEY A;  3VKI A;  5LJ5 j;  1NPR A;  3NTK A;  4MDW A;  1P92 A;  2CYZ B;  2K5I A;  2KVQ G;  5CKF A;  5FLX E;  5GAO r;  2DAQ A;  2E6N A;  2CZ7 B;  4MMK A;  5FRM A;  5CR2 A;  3SD4 A;  3HHT B;  1PSF A;  3C95 A;  4BI8 B;  4MDX A;  1VQN T;  2E12 A;  2Y4Y A;  3LWH A;  3CD6 A;  2R58 A;  2E70 A;  4R56 A;  5GAO p;  1N9R A;  1RI0 A;  3PMT A;  3CPW S;  2A7Y A;  3QHS A;  4X9C A;  1M1K U;  2JTF A;  2XIC A;  3L2Q A;  4BAC A;  3S6W A;  4XTW A;  3CBO A;  5HK0 A;  3G4S T;  3CCU T;  2VC8 A;  3V7S A;  4B9W A;  4ZGD B;  1VUB A;  1U1T A;  3V7C A;  5GAN 8;  1U1S A;  3M9Q A;  1UGQ B;  3M55 A;  5I2S A;  5GAN g;  3CME A;  3G71 T;  3CMA T;  5GMK e;  5GAO m;  2V8I A;  4F7U E;  3DB4 A;  3OMG A;  4BDZ A;  1K9M U;  3RES A;  1VIF A;  2DXT A;  2WSC E;  3G7Z A;  5GAN 2;  1WGS A;  2H3J A;  2KQW A;  2L3R A;  3JRZ A;  4Q5W A;  4C8Q E;  3X28 B;  3ZBD A;  1YJ9 T;  4C8Q C;  1MGQ A;  4MZM A;  1JRI A;  1ZHI A;  4PJO F;  3X24 B;  1N27 A;  2BKD N;  2FVU A;  1N6A A;  2FYK A;  1QP2 A;  2P0K A;  3FLG A;  2EJG A;  4LDV A;  2OTJ T;  3FC3 A;  1K73 U;  2JNG A;  2XU8 A;  1OZ3 A;  2Y90 A;  3INZ A;  5D6X A;  1WQW A;  3CC7 T;  1FWZ A;  3ME9 A;  4YTL A;  3KXT A;  3CCR A;  3MHX A;  3QXE B;  2CZ0 B;  4RCC A;  4C0F A;  4HT9 A;  1WJS A;  4QQG A;  1DJ7 B;  3OYF A;  3NTH A;  1M4Z A;  4ZTJ A;  3V8J A;  1VQ6 A;  3JCM c;  3L2W A;  2LT4 A;  4M77 G;  2D9T A;  4M78 D;  2LX9 A;  3P8H A;  5GAN f;  5FU7 C;  4TVR A;  3OB9 A;  3CBM A;  1LOJ A;  2RD1 A;  4PNO A;  1X6O A;  5DM7 R;  1ZQ1 A;  3CCQ A;  3RMQ A;  3HSB A;  1ZBX A;  2F5T X;  5LJ3 h;  2FHD A;  2LVM A;  3GNG A;  4C0Z A;  2LNV A;  4Z02 A;  4X34 A;  2KK4 A;  3CC2 T;  4M7A B;  2R5A A;  4HCC A;  4OGE A;  1N8R U;  3PIP A;  2VV5 A;  1VQ8 A;  3P8B B;  3L1A A;  2RM4 A;  2OTL T;  2MWP A;  3VUB A;  4JRI A;  3CCS T;  1X01 A;  2XHC A;  3QYH B;  5D6W A;  1I4K 1;  3RUX A;  3M4G A;  1M9S A;  3OBY A;  4C92 A;  5GAM f;  3I55 A;  1PSE A;  3VJP A;  5D6Y A;  3FEO A;  4NOY A;  1YHQ A;  1OI1 A;  2D0Q B;  2RHZ A;  4MZT A;  3FDR A;  5LJ5 f;  1XQH A;  1K8A C;  4HA8 A;  4M7A C;  1VQ7 A;  4DOV A;  1V29 B;  2PVO B;  1Q7Y U;  2DVE A;  2DD4 A;  3M5A A;  3SFM A;  5GMK i;  2GFA A;  2LC4 A;  4JDS A;  5KH6 A;  5GMK l;  1JBM A;  2E10 A;  2RI5 A;  3LYI A;  4ELZ C;  4OP0 A;  1VIE A;  5LL6 S;  3X20 B;  1R8O B;  1XNI A;  3EFS A;  2LRQ A;  1TH7 A;  2BIV A;  3G6E T;  3GLX A;  5GAN 3;  3H6Z A;  3X26 B;  3JAM E;  1YIT A;  2JTM A;  4M77 D;  1KD1 C;  3NTI A;  4M78 F;  1YIJ T;  4ATO A;  3BDL A;  3QPH A;  3X25 B;  2EIF A;  2K3X A;  4PKC C;  4A54 A;  4JRK A;  2DXU A;  3OYH A;  4RKU E;  3CC4 A;  2QQS A;  4IUP A;  4LD6 A;  3OYG A;  3OBW A;  3HRS A;  1LJO A;  4M7D A;  3EAE A;  4C0G A;  3HP9 A;  4HCZ A;  3JCM b;  1KQS A;  4M75 B;  3FIF A;  3JCM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...