5HK3A

Crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
VISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNDALAAMPGNVDLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF6
publication title Crystal structure of M. tuberculosis MazF-mt3 T52D-F62D mutant in complex with DNA
rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Hydrolase/dna
total genus 27
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2016-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5hk3A00
1UB4A 3G7ZA 4ELYC 2VUBA 5CK9A 4MZPA 5CKEA 4OF1A 5DLOA 4MDXA 3VUBA 5CKDA 5CO7A 3JRZA 1X75C 3JSCA 5CKFA 5CCAA 1NE8A 1VUBA 5CKBA 5CQYA 5CQXA 1M1FA 5CR2A 5HKCA 3HPWA 4ELZC 2KMTA 2C06A 4VUBA 4ME7A 4MZTA 5CKHA 3TCJA 4MZMA 5HK0A 2MF2A 4HKEA 5HK3A 3NFCA
chains in the Genus database with same CATH superfamily
4HA8A 5D7UA 4EMGA 2K7AA 1LCKA 2F5TX 2GCXA 1ZLMA 1IRXA 4HCBA 1Q86R 5FU7B 2GFUA 1HYOA 3S3OA 5GAMd 4M75C 3VS7A 2J05A 1VQLA 3WVEB 2ZPBB 1RUWA 3VJPA 1E6HA 4EMKB 3M0QA 4PLLA 1TUDA 3JB9D 1R8OB 1U8RA 3E2UA 4RTYA 2C0TA 2L3RA 2A0FB 2CP2A 4XU2A 2K57A 2K5IA 1I8FA 2EYQA 3M53A 4L6V5 1M4ZA 2VWFA 3LLRA 4OB0B 2KT1A 3P8HA 3EGXB 1GXIE 4ZN1A 1C6VX 1PRMC 1S72A 3LH0A 4RTTA 4XTVA 1J3TA 1VYVA 3CCJA 3EH2A 2RO0A 4R0KA 3PIPA 5GAN2 3N5BB 1UDLA 4FW1A 1PKSA 2KBTA 1PC0A 3MEAA 2YRCA 2D8JA 2NUTA 1DJ7B 2QG9B 1I5LA 2DX1A 4C92D 4F14A 2MWPA 4ME7A 2QA4A 1W2BS 2E5QA 1YJ9T 4X9CA 2EKHA 3RUXA 2X3WD 3MO8A 2QI2A 2YUPA 5LJ3e 1LNXA 5IN1A 3CC2A 1B07A 2PUOB 4OF1A 1I5OB 4DBRA 2D9TA 3C95A 3VV0A 2DIGA 3CCSA 1X69A 2I2LA 4Z02A 4FCYA 4IUPA 4LDUA 4J7FA 1ACMB 2XDDA 1FXXA 5KYUA 1JXMA 1RI0A 3DLLA 1B3QA 4RG2A 2FYKA 2ESWA 2EKOA 1ZHIA 1NYGA 1QMCA 3GLXA 3CXCA 2DBKA 4QQDA 1VQ8A 4BD3A 3NTIA 3DB4A 3CCET 4B9WA 1VUBA 2CP3A 2R5MA 2K4YA 1G3WA 3EFRA 4FIBA 2EPDA 1MMAA 3URGA 4C5HA 3HP9A 4M7AF 2AK5A 3CD6T 3A8LB 3SD4A 1VQ5Q 1H3HA 4QKUA 4E7IA 3CD6Q 5LJ5j 1WHHA 3QXEB 2GTJA 2I0NA 2GQIA 2KRSA 2LX9A 1KIKA 4JS5A 1BYMA 3KXTA 2FPDA 3OYYA 1SKUB 2OI3A 1MMGA 3UT1A 1K0SA 2KXDA 4J9BA 4KULA 1VQ9Q 3JCMe 1AHJB 4X1VA 2ECZA 2E70A 2AHJB 2MOXA 4PK4A 3JCMJ 1M9SA 4RUGA 4FM4B 1BI1A 1UB4A 3CCMT 2XHCA 7AT1B 4PFZA 4LNPA 2JVVA 5LJ3d 2DFUA 1KC8U 1AT1B 4DOVA 2RQVA 4AMCA 2QQRA 5GMKh 5D6YA 3JCMg 3EG2A 2YLBA 1OOTA 4L59A 4E7KA 3JB9F 3PTAA 2DA9A 2D6FA 1UUEA 3JB9I 1JRIA 3DKMA 3M0RA 4A4HA 4B6MA 3S3NA 2X4JA 4KH1B 4YTLA 1Y96B 5EC7A 4OB1B 2DPPB 1D0XA 1QVGA 3QO3A 2MPXC 4A53A 2LQ8A 4DBHA 4C0DB 1RLQC 2AZVA 1QKXA 3LWIA 3EG0A 3VS2A 3CXCP 1WJRA 2L2PA 4JJNK 1YCSB 4PKCC 4CC2A 3BE3A 1QVFA 4QW2A 2CT4A 3MP1A 1SPKA 2DL8A 1O9SA 3UATA 2A08A 4BDZA 5IHIA 4AFSC 3FC3A 4WCIA 1MMNA 2WSFE 3CC4Q 3JAME 4M77D 1I81A 5HKCA 3CCQA 4C92F 4JDSA 5GANe 3M55A 4LN2A 4NS5A 4JRPA 1ZX6A 3AHUA 1K9MU 1M90C 2OTJQ 2KVQG 2ZPIB 2YHTA 2JTFA 2KR3A 3OMCA 2VYTA 5LJ5g 2LMJA 3JCMb 1IGUA 5C0MA 3SDZA 1GL5A 1BCOA 2ZCFB 1WXBA 1VIFA 4RKUE 2CP5A 1VQ5A 3FB9A 2NUZA 4E7ZA 2JTMA 1BU1A 2LX7A 3M57A 2VUBA 5GAOn 2LZ6B 2Z0WA 1JQQA 3G6ET 2VXFA 4JPBW 1Q7YC 2DTIA 3EFSA 1K0XA 3CCUT 1D09B 4J5YA 1IXDA 1B34B 3G6EQ 5IAYA 1M8VA 1AZGB 3M5AA 3CCUQ 2JNGA 1WNLA 1X01A 2AT1B 3QJ6A 3X25B 5GAOp 1QQJA 1QVGS 4J9DA 1VQNQ 4RTWA 2YWWA 1VQ9A 1UG1A 5KE3A 2L3PA 1YJWT 4N4GA 1PCXA 3A8GB 1QP2A 1M90R 3CC7T 2DMOA 1G3TA 3TVTA 4FU6A 5CKBA 3VS1A 1OQKA 4N4IA 8ATCB 3CC7Q 3CCLT 4MMKA 1JEGA 1EX4A 2O88A 2YT6A 3U23A 4C8QF 2K9GA 3CCLQ 4DEYA 4FSSA 1SG5A 2HDAA 1Q81U 5FRNA 1SF9A 1KG1A 3I35A 3LX7A 1VQPT 2KGTA 4NL3A 1M3CA 2FPEA 1Q7YR 1QVGP 1Q82C 1VQPQ 1FX7A 5GAMh 5AYFA 1D1AA 1QVPA 3M0SA 2RHUA 2QTVA 3HHTB 2JJ9A 2PVDB 2YUNA 2XIDA 1QVFP 1AEYA 2JT4A 5FW9A 3QDFA 2ROLA 4JLGA 1M27C 1LOJA 1YIJT 2DKGA 5CKFA 2JTEA 3BDUA 2JMAA 5KYNA 2HNIA 2K6DA 2EQJA 3LH5A 1YIJQ 1M3BA 4F7UB 2F5KA 1TTHB 3CC4A 2F69A 4ELYC 1YJNT 4OGCA 4KGXB 1GCPA 2COZA 2LCCA 5IT9E 1D1CA 2QGGA 1M2VA 2C0IA 2DTHA 1Q82R 2GF7A 3VS4A 1SSHA 2FZCB 2OTJA 3C12A 1M8MA 2H3EB 4KT0E 1Y57A 2EGAA 4M7AA 4PFPA 2FVUA 2J7IA 3OS5A 2RM4A 2CP0A 4J9HA 4XTYA 2QEXT 1YITQ 5GAOq 2PVGB 1FMWA 4KUIA 5GAOl 1GFDA 1ABQA 2CT3A 2EYZA 2E12A 1K76A 2YLCA 1R0BG 2QEXQ 4OP0A 1PSEA 3L2UA 2LTOA 5FRMA 4M75G 3GNFB 5GAN6 2KE9A 4M77F 2CSIA 1G2BA 1X43A 4M78A 3MJXA 1XNIA 3META 1SRMA 2EAYA 5IH2A 1I1JA 2FG0A 2BUDA 2X4YA 1VQNA 5I21A 1HJDA 2E6NA 2DJZA 4XTXA 4WF2A 2X3XD 3V7CA 1NE8A 3LW5E 3MEWA 1Z9ZA 1TUCA 3ZEHA 4PNOA 5GAN3 5ECAA 2RHIA 3CPWA 1MGQA 4KH0B 4NL2A 1VQ7T 2KYBA 1NPRA 3I56T 3EGDB 1V1CA 1KQSA 1G8XA 1U1SA 3CC7A 1VQ7Q 2OTLA 1QP3A 4JJCA 4TVRA 3KUFA 4M7AG 1M3AA 3ZFJA 2CKKA 4PJOF 1WQWA 3S3MA 3X20B 2HL5C 1QLYA 2DM1A 2ED1A 3NTHA 2MWOA 3FJ5A 4C5IA 2DRKA 1KQ2A 1UFFA 1KD1U 1X6BA 3I55A 3HRTA 3OYHA 2B86A 4AG1C 2RK2A 2SEMA 4M78G 2XDBA 2D0QB 2WSCE 2HBWA 1NJIC 4Y92A 4Q5WA 4OMMA 3A5ZB 4RTUA 1N9RA 2D0NA 4D6WA 3CCVQ 1UE9A 2NUPB 2DEUA 3MHXA 1QW1A 2EFIA 1U06A 2X9HA 1KC8C 2M0OA 2RK1A 1NYFA 2A3LA 2HCKA 1Y07A 3NTKA 1UJ0A 4C92A 3EG9A 4BI8B 3VYHB 5LJ3h 4FYWB 3RKXA 1GCQC 4HT8A 3T9NA 3PGGA 2MF2A 3C94A 3NMZC 1NBEB 4M75E 3JB9G 3LWHA 2NLUA 4E6RA 3M58A 3GBQA 5GJWB 3VUBA 4JJDA 2V8KA 2RQWA 4HCZA 4XU1A 3SWNB 2DF6A 2JM8A 3F70A 3QYGB 1NJIR 1YITA 5KYYA 2RI5A 5GAMf 1K9AA 1N8RU 2HEQA 2GBQA 1PNJA 2GTOA 1W6XA 1KC8R 1OPLA 4FL6A 4ANJA 3OYDA 2HBPA 1RAGB 2D1XA 2E65A 2A7YA 5GMKl 2DRMA 1EIFA 3GPLA 2JZ2A 3UPUA 4ZN3A 3OYGA 3CPWP 1K9MC 3CMAA 3OBWA 3V8LA 1K8AC 6AT1B 3EG1A 4HXJA 4A4EA 4RTZA 1KQSP 1GFCA 4HKEA 3GOXA 2HQXA 4D8KA 2ZPHB 3JCMV 4LUDA 4M7AC 4E47A 4QT7A 1OI1A 1HK9A 1ABOA 5IHNA 1VIEA 1T0HA 1PD1A 4C8QA 1RADB 4O6JA 4M78E 4MZTA 4Z88A 1NEGA 4CI0C 4KRTA 1VQ6T 3RMQA 1V76A 4M78C 1YJ9Q 1BB9A 2IG0A 1N27A 5GAOm 2NUTB 4BE0A 3JRZA 2MI6A 4PFOA 1N9SA 3M56A 1K9MR 4ZTFA 2RQUA 4OMLA 3MCAB 1K8AR 1YI2A 2EJGA 1BI0A 1G83A 2A37A 1KHCA 2DZCA 1G5VA 2LQKA 2BE9B 4PL6A 4FYYB 3RR6A 4F7UF 3CCVA 3M4YA 2RF0A 5GMKi 2QAZA 3ER0A 3E1SA 1Q81C 4M7DA 1WGSA 4R56A 2ED0A 5KYUB 2KMTA 3CCEQ 1VQ4A 2EYYA 3MPUB 2RH2A 2KT8A 1S1NA 5DY9A 3SFMA 2QASA 1IZ6A 4C8QG 4J9FA 5FU6C 1AD5A 3OSSC 5KCHA 1IB8A 2HD0A 1Y0MA 2YXYA 1ZA2B 2IIMA 4JRKA 1JJ2A 4C0ZA 2QQSA 3QBYA 2ABLA 3L42A 3BDLA 2J06A 1ZSGA 1K73U 3TCJA 4OGEA 2XD0A 4AFQC 3L2RA 4DOWA 2K5FA 4BDYA 5HK3A 2DTOA 1W4SA 1XJWB 4R55A 2DEQA 3E9FA 3V8KA 2HKQB 1P92A 4OMPA 4A4KA 2LNVA 2FRWA 4HCKA 4M77A 5GANh 1M1KU 1U1TA 2HL3A 1Q81R 3TSZA 2EVRA 4PJMA 2FHDA 3H0FA 3EFOA 1MMDA 5I22A 3HRSA 4C92C 1WZOA 3Q1JA 2DETA 4XAXB 2B8AA 4M7DG 2AKKA 3QPHA 3M0TA 1WI7A 1RAAB 4AFZC 2AZSA 3CCMQ 1YHQT 2EQUA 4GBQA 3PMTA 5CCAA 3CXCS 1G3SA 5LJ3f 1YHQQ 2PVOB 2QQAA 4X34A 4EPCA 5HK0A 2FL7A 1F1BB 3TQ7P 5CK9A 4PJOA 5HCKA 2RD1A 1NM7A 3H6ZA 5J26A 4RTXA 3QHSA 3ULRB 2LP5A 3OS0A 2EQMA 2LQNA 5GMKj 1YJ9A 2LT1A 2DVEA 4ZGJB 2HAXA 2A28A 2E3IA 1Q95G 3DLMA 2MMPA 1MV0B 5KYXA 1QWEA 1QWFA 4LDWA 3V7SA 5J39A 1TWBA 3OSVA 1JJ2S 3X28B 3JB9H 2DK3A 2IPOB 2BE7D 1ZSZA 5LJ5e 3SHWA 3PE0A 2LVMA 3X24B 2ZPGB 1I4K1 2PUKB 1JXOA 5GAN4 5GMKm 4N0AA 3OW2A 4BY6C 2HMAA 1M5Q1 5CIUA 1T3SA 2P4TA 4EDUA 2WSEE 2ZZDA 2XK0A 4IURA 1WIEA 2K2VA 4PJJA 3RKYA 1VQMT 2DILA 4C8QC 2Y4YA 3CCEA 2VASA 3MEVA 2M9UA 3CBMA 4QVZA 4XU0A 1KD1C 1JJ2P 2FO0A 4JJBA 2KEAA 1U5SA 1AWOA 1D1BA 2V8JA 4PJOG 2F2VA 3OYFA 2MIOA 3EG3A 3MP6A 1UGSB 3UDCA 1QCNA 3PMIA 3DB3A 3JCMd 3CD6A 3G1JA 3RDVA 3JCMf 3OY9A 3A1PA 3G4ST 4PJNA 2EJ9A 2DJQA 2JMCA 2DD5A 4AFUC 1R77A 1WLPB 2L3SA 4E7LA 1TS9A 1LPLA 3VRYA 4XK8E 3PIOA 1O75A 3JCMc 3UA7A 4M7DC 1UHCA 2E4HA 3ZL7C 1OEBA 5A0LA 2FB7A 2ENMA 3HFNA 1MNDA 5GAN8 1Y71A 1YJWQ 2CGHA 1KD1R 2VC8A 2CDTA 2CSQA 3HPWA 2RJEA 3HTRA 3OW2S 4HCCA 1QVFS 2AIRB 1UJYA 1UGVA 5FLXE 3CCMA 2QQ9A 2DL4A 2DXCA 3RBBB 3CCRT 1HD3A 2K79A 3QWYA 3CCRQ 4N4HA 5IXFA 3EHQA 3CMET 2FZKB 2OJ2A 3OYIA 2CS7A 1I07A 3GP8A 1VQOT 1VYUA 1YWPA 2CZ7B 5L8RE 2RQRA 4LXCA 4IIMA 5CO7A 5LJ5d 1HSQA 2DO3A 2K3YA 4M77C 4KGZB 2XKOC 1QCOA 4XU3A 1AWWA 2KXCA 3QZ9B 3RIRA 2KYMA 4HVVA 4KGVB 5GANd 3OW2P 2EGCA 3H41A 2CUBA 2V1RA 5GANf 3M4GA 2W10A 3OYBA 1SHFA 2KI7A 5GAMj 2RA2A 4A54A 3OYJA 2FRYA 3UF4A 2LJ0A 2X35A 4VUBA 5A0GA 1AVZC 4IKFA 4F7UA 2DXUA 2NYSA 2PQWA 4M75B 4LD9K 1V29B 1X6OA 1RI9A 4FSXA 1UGRB 3PFSA 4B9XA 1OU8A 4JZ3A 2RQTA 3REBB 1YJNQ 2DYBA 4PJOC 1ZUUA 1WYXA 1H92A 3VRZA 3QZ5B 3JCMX 2G6FX 1NLPC 2O4XB 5CKHA 5AT1B 2EQKA 2JXBA 2R58A 4D8DA 2LJ3A 1M2VB 2Y4XA 1ZSZC 1KQ1A 4IUTA 1ZUYA 3CEYA 1W1FA 3M59A 4J83A 4M7AB 1YFNA 1H8KA 2L5QA 4N0AC 3BW1A 1SHGA 2X4WA 1KJWA 2P0QA 4DBQA 3G6EA 3MKDA 3CCUA 2LDMA 3A98A 1KHIA 2E41A 2ZGWA 4LDXA 1WHJA 3R6NA 5KH6A 3J7AF 2KDSA 3A8MB 2G3RA 4M78B 3OS2A 2LCSA 1S72T 1YJWA 1JO8A 4J9IA 3RERA 3GF5A 1SRLA 4HT9A 2DXBA 4J6YA 2JN0A 4CC7A 1ZA1B 4Y28E 1BBZA 1K73C 4FW2A 2LQWA 3I56Q 3MEUA 4M75D 4E2FB 3EHRA 3QG1A 5KYWA 2CUDA 3CCLA 3HSBA 2E1HA 2RJDA 4O5VA 4C0FA 1M1KC 2XDPA 2HZYA 2GQVA 2ZPFB 1VQPA 1ARKA 3QDRB 1SSFA 1RL2A 5I2MA 3WXMB 1ZUKA 1YBYA 3JCMQ 2P4RA 3WVDB 4QVDA 3CC2T 1NLOC 1EZZB 5GAMg 3EH1A 5FU6B 4P5NA 3CQTA 1YNZA 3CCST 2RHXA 1M90U 2EQIA 1UECA 2NUPA 4AG2C 4LDVA 1W70A 2NWMA 2FPFA 5I11A 2K3XA 4M7AD 2PU9B 1KK7A 1YIJA 3I5RA 1K73R 2VXEA 1VQ8T 3A8HB 1UHFA 2P0PA 5CR2A 4E7JA 2JS2A 1YP5A 4RTVA 3FIFA 1D3BA 1Q7YU 2SRCA 1M1KR 2RPNA 1YJNA 1VA7A 3HKSA 4M78D 3CPWS 1FMVA 3PVLA 3H9NA 4C92B 2EYXA 2CP7A 1CKAA 1XOVA 1KQSS 3EG9B 1OPKA 2HQHA 5LJ3j 3JSCA 2A36A 1R0CB 1IGQA 4RCCA 3SWNA 4ZGDB 5LL6S 5I2SA 4Z8AA 2DD4A 2BKDN 5M9OA 2LCLA 4CC4B 3VU3C 4EMKA 3OQ5A 4MZMA 2QEXA 3OMGA 2MYSA 3QKJA 1RAHB 1TUGB 1I0CA 1AWJA 4FT2A 3LGLA 4MDXA 2L89A 2E64A 5KYYB 5CQYA 2K3BA 3JB9J 2LRQA 3EGXA 1WX6A 1UTIA 4JRIA 4M7AE 4C0GA 1KFZA 4C92G 1Q82U 2X4XA 4ZGEB 1BI3A 2RHYA 2LC4A 2EYWA 2COYA 3BFMA 2KQWA 2RN8A 3PNWC 2F2XA 3OYNA 1C0MA 3G71T 1VQ7A 2LT4A 2HSEB 4J7IA 1N5ZA 3CBPA 1Y7XA 3G71Q 3H0IA 1YN8A 3KBGA 3I56A 1MHNA 2QGFB 1WJSA 4BY6B 2KSSA 4L5GA 4BACA 3JCMh 5CVIA 1YCYA 1JB0E 1IO6A 1AOJA 1IREB 2K2MA 4J9CA 1VQ6Q 2JOYA 4GLMA 4C8QB 1PSFA 2QK0A 5DM7R 2H8HA 2KK4A 2C06A 3JV3A 1NEBA 1H3ZA 1JBMA 2XG8D 4DQ2A 3X26B 2W0ZA 4KUDK 5GJVB 3QWXX 3REAB 4M75F 1WFWA 2DVJA 5EG2A 3FLGA 1E6GA 4FYXB 3OYMA 2K5LA 4V2SA 3MP8A 3CCQT 2BZYA 2GFAA 2L3QA 1AZEA 2JM9A 1UEBA 3P8DA 1UGQB 1NG2A 1X2QA 3CCQQ 2DXTA 3NPFA 4II1A 1W2BP 1OU9A 2M1HA 4LD6A 5LJ3g 4M7DB 2O9VA 4UC4A 3VS0A 3SEMA 5LJ5h 2RI3A 1WXTA 2QTXA 1TU0B 1VQKT 2RJCA 2DE0X 1AWXA 2RHZA 1VQ5T 1VQKQ 4LUEA 4KBMB 2D8HA 4LDYA 4MZPA 4EIKA 2JW4A 2KNBB 4C92E 2GNCA 4F17A 1M1FA 1RAEB 4BE1A 3VS3A 1PHTA 4C8QD 3D7SB 2VGNA 4M78F 3TEEA 1MV3A 3ME9A 1Z9QA 1VQ9T 3O5ZA 2QDLA 4M77B 4NOYA 5GANj 4C5GA 3UWNA 2QXFA 1T0JA 3EFOB 1ZBJA 2L0AA 1QCFA 2BIVA 1M1GA 2EIFA 2OAUA 2O31A 2QDYB 4CRIA 1K4US 1Q86U 5FU7C 2QYZA 3SWNC 2XMFA 1NJIU 1LJOA 2Y90A 3H0HA 3G71A 2V8IA 4FT4A 2C0OA 2JS0A 4EMKC 1XTDA 2FEIA 1WHLA 1Y96A 1X75C 3RESA 4A4FA 3JCMP 3QSUA 1N6AA 1VQ6A 4M7DD 4M77G 3L2WA 4E7HA 1D0ZA 2O2OA 1NZ9A 4PJOB 2O9SA 2YSQA 3VUZA 3VS6A 1TSFA 3L1AA 3ZBDA 5GAOr 4XTWA 2VB6A 4J6XA 4QQGA 1IHVA 4ZTJA 4PJLA 2V26A 4C8QE 2VV5A 5KYXB 2CP6A 2CYZB 4BUGA 1TH7A 2J6KA 1ZSZB 1HXDA 2LNHB 4BI3A 3V7RA 2CH4W 2PTKA 1T3LA 2WACA 3ASKA 4A4GA 1GBRA 2KRMA 3EAEA 3CC4T 1VQMQ 3E19A 1WXUA 2DYIA 4RMOA 3RNJA 4A63B 3O8VA 2EBPA 2JUFA 1WHGA 4ORZA 2BZ8A 1X27A 5A2QE 1X2KA 4JRQA 1OZ2A 4OVAA 2E5KA 4MMLA 2OTJT 4RG8A 2CREA 2ZAEA 1K8AU 2F2WA 4FYVB 2MAMA 3VYGA 3G4SQ 2M51A 1OV3A 1VQKA 4AT1B 3TU4K 4M7DE 2P84A 1BCMA 1B34A 2DERA 3HL8A 3M0PA 2KAFA 4JLIA 2PNIA 5KCOA 2M16A 1OX8A 1FYNA 3A8OB 3E9GA 3J80E 2E10A 1YWOA 4OMFB 3RKWA 1M2OA 1ZQ1A 5GMKe 5GANg 3SB2A 5DLOA 2ZPEB 4PJOD 1VQNT 3FRNA 3CPFA 1WHMA 1XQHA 5DLQE 1WPYA 4LE9A 1G3YA 1C1AA 3GNGA 2H3JA 2P0KA 1YHQA 2HQEA 1N8RC 4OB2B 4K11A 3UA6A 1A0NB 1TXQA 2FZGB 1H641 1D0YA 2BZXA 2CZ1B 2J6OA 4M77E 2OTLT 4ESRA 1BK2A 3HRUA 3OYEA 3CMEQ 2OTLQ 2DBMA 4IIOA 5LJ5f 1VQOQ 1QKWA 2E3HA 3R6OA 4BB7A 2DNUA 3M0UA 3PT9A 3VKIA 4XQ3A 3G7ZA 2DZ9A 5FROA 1RACB 2XI9A 3IQLA 2AKLA 3BY7A 2CZ0B 4RCBA 4BI4A 4HVUA 3OYAA 3I55T 1GCQA 4XTUA 1RABB 5CKDA 2LJ1A 5L23A 5HY6A 2XU8A 3I55Q 3OYLA 5IHKA 3QYHB 1EFNA 3M54A 1JU5C 4DA4A 3JCMW 2YUOA 4M75A 2EW3A 4PJOE 5D6WA 4F04B 1N8RR 1OX9A 1MUZA 4OMQA 3L2ZA 3M9QA 3L2VA 8AT1B 2X51A 1VQMA 2RI2A 3J81E 1RAFB 3FEOA 1PD0A 3TREA 4M7DF 1TOVA 2DL3A 2O4XA 1PKTA 2M0YA 3QIIA 4XTZA 1ZBXA 2DAQA 3INZA 2QQBA 1WA7A 4WTOB 5CAIA 2XICA 2KRNA 1MNEA 3EGUA 9ATCB 4CC3A 1UGPB 2HKNA 4C0DC 2IVWA 1BKBA 3GIBA 5J3BA 5A0DA 5D6XA 3OS1A 1IHWA 2OAWA 3KFVA 1YITT 1VQLT 3S6WA 2O01E 2COWA 3G4SA 1PRLC 1TG0A 2KY9A 2YRDA 1BIAA 3OBYA 1VQLQ 1B7TA 2VVKA 3RMSA 4Y91A 4OMNA 4F7UG 4PLIA 1OULA 3CBOA 4X9DA 1WHKA 2RMOA 3OYCA 2VKNA 5KE2A 4GLKA 2MCNA 3CMAT 4J9EA 4M4ZA 3P8BB 2PZ1A 1RAIB 2ATCB 2YDLA 1X6GA 2ROTA 5GAMe 3EGDA 3CCJT 3CMAQ 4JUVA 1S72Q 2V1QA 1CKBA 3LYIA 3PVQA 4DEXA 1BI2A 1SEMA 3CCJQ 2RJFA 2GGRA 2YUQA 2DL7A 3I5SA 1PG5B 3CCRA 4J6WA 5C6SA 4EMHA 1KSWA 2F1LA 1WJQA 1U3OA 3C0CA 1NPPA 3AT1B 2QA4T 3CMEA 1VQOA 1VYTA 3I9QA 5CKEA 2VGMA 3L2QA 2QA4Q 4IUQA 5KYWB 3H8ZA 3OB9A 3C4SA 3THKA 1WQ7A 2R5AA 4F16A 5FWCA 5CQXA 3QJYA 4QVCA 2EWNA 4ELZC 3CC2Q 1FWZA 1WDXA 2CH4A 1CSKA 2EJFA 3CCSQ 2BTTA 1PWTA 4OB3B 1YI2T 2RB6A 2EGEA 5GAN7 2R57A 2L8DA 1OYXA 3NGPA 4E7SA 3OYKA 4QQ6A 4HVWA 1E7OA 1OZ3A 2J6FA 1GBQA 1YI2Q 5FWBA 1PM3A 4IUVA 2DLPA 4GY5A 1Q86C 3CCVT 1M30A 5IXBA 5GAN5 3FDRA 3TSWA 2DIQA 4MDWA 3VS5A 4JS4A 1GRIA 4DBFA 1RLPC 3V8JA 1VQ8Q 4J8OA 4J9GA 1BIBA 3LGFA 2CZ6B 1VQ4T 3NFCA 3NHNA 4C5EA 1K1ZA 1LVKA 2HSPA 2M02A 2DL5A 2YRVA 1VQ4Q 4ATOA 2E6ZA 4BE2A 3FJPA 4IUUA 3QUIA 2OX7A 1W2BA 4JZ4A 2MK5A 4ZNXA 4Z89A 2KROA 1D3BB 2RNAA 3OA6A 4OMOA 1FMKA 4F7UE 1VOMA 3HFOA
chains in the Genus database with same CATH topology
3JCMf 4HA8A 3OY9A 4XTYA 3G4ST 4EMGA 2QEXT 4KBMB 2PVGB 5GAOq 4LDYA 2F5TX 4KUIA 4MZPA 5GAOl 2GCXA 2E12A 2EJ9A 2YLCA 4C92E 4HCBA 2DD5A 5FU7B 2GFUA 4OP0A 3S3OA 5GAMd 4M75C 1PSEA 3L2UA 2LTOA 5FRMA 1VQLA 4M75G 3GNFB 1M1FA 2ZPBB 3WVEB 5GAN6 3VJPA 4M77F 4EMKB 4M78A 4BE1A 4E7LA 4C8QD 1XNIA 3META 4PLLA 4XK8E 2EAYA 3PIOA 3JB9D 1O75A 3JCMc 4M7DC 1R8OB 1U8RA 2BUDA 2VGNA 2X4YA 4M78F 3TEEA 2L3RA 3ME9A 1VQ9T 4XU2A 2K57A 2K5IA 5A0LA 4M77B 1I8FA 2FB7A 2EYQA 3M53A 4NOYA 4L6V5 5GANj 5I21A 1M4ZA 1VQNA 3HFNA 3UWNA 4C5GA 2E6NA 2DJZA 3LLRA 4XTXA 4OB0B 2QXFA 5GAN8 1Y71A 2CGHA 4WF2A 3P8HA 2VC8A 3V7CA 1NE8A 3LW5E 3MEWA 3ZEHA 1GXIE 4ZN1A 4PNOA 5GAN3 1S72A 3HPWA 2RJEA 3OW2S 4HCCA 1QVFS 3LH0A 2RHIA 4XTVA 3CPWA 1MGQA 4NL2A 1VQ7T 2BIVA 1NPRA 1M1GA 5FLXE 3CCMA 2EIFA 2DXCA 2OAUA 2QQ9A 3CCJA 2QDYB 4CRIA 3CCRT 2RO0A 1Q86U 5FU7C 3I56T 3PIPA 3SWNC 1NJIU 5GAN2 3N5BB 1KQSA 1U1SA 1LJOA 3CC7A 2OTLA 1QP3A 2Y90A 3G71A 2V8IA 4FT4A 4N4HA 4TVRA 3CMET 4EMKC 3KUFA 4M7AG 3OYIA 2CS7A 3GP8A 1VQOT 1XTDA 3ZFJA 2CZ7B 5L8RE 5LJ5d 1Y96A 1X75C 2CKKA 3MEAA 5CO7A 2DO3A 4PJOF 3RESA 4A4FA 2K3YA 1DJ7B 3JCMP 1WQWA 1I5LA 3QSUA 1N6AA 3S3MA 3X20B 4C92D 4M77C 2MWPA 4ME7A 2QA4A 1W2BS 1VQ6A 4M7DD 2E5QA 4M77G 3NTHA 1YJ9T 2MWOA 4C5IA 1KQ2A 3L2WA 4E7HA 2XKOC 4X9CA 4XU3A 1KD1U 3RUXA 1NZ9A 3MO8A 2QI2A 3QZ9B 3RIRA 5LJ3e 4PJOB 3I55A 1LNXA 3HRTA 3VUZA 3OYHA 5IN1A 2RK2A 3CC2A 2PUOB 4M78G 3L1AA 4OF1A 3ZBDA 5GANd 5GAOr 2XDBA 2D9TA 2D0QB 4XTWA 3C95A 3VV0A 2DIGA 5GANf 2WSCE 4J6XA 3CCSA 4QQGA 4ZTJA 3M4GA 3OYBA 1NJIC 2I2LA 4Z02A 5GAMj 2RA2A 4Q5WA 4A54A 4C8QE 4IUPA 4LDUA 4J7FA 2VV5A 3OYJA 3A5ZB 2XDDA 1FXXA 2CYZB 1N9RA 2X35A 4VUBA 4BUGA 4D6WA 5A0GA 1TH7A 3MHXA 1QW1A 4IKFA 4F7UA 1RI0A 2DXUA 1HXDA 2EFIA 2PQWA 3DLLA 4RG2A 1KC8C 2FYKA 4BI3A 3V7RA 4M75B 2M0OA 2EKOA 1V29B 2RK1A 4LD9K 2WACA 1ZHIA 3ASKA 1X6OA 4FSXA 3GLXA 4A4GA 1UGRB 2A3LA 3PFSA 4QQDA 3EAEA 4B9XA 4BD3A 3CXCA 3CC4T 1Y07A 3E19A 3NTIA 3NTKA 1VQ8A 3DB4A 3CCET 4B9WA 4C92A 4RMOA 3O8VA 4BI8B 1VUBA 3VYHB 2JUFA 5LJ3h 4PJOC 5A2QE 3RKXA 4JRQA 1OZ2A 3QZ5B 4OVAA 2R5MA 3JCMX 2O4XB 2K4YA 4HT8A 3T9NA 5CKHA 4MMLA 1G3WA 3EFRA 2OTJT 4RG8A 3PGGA 2MF2A 4FIBA 3C94A 4M75E 3JB9G 2EQKA 3LWHA 3URGA 4C5HA 3HP9A 2R58A 4M7AF 2NLUA 3CD6T 3A8LB 1K8AU 3M58A 3SD4A 2MAMA 3VUBA 3CCMT 2Y4XA 2V8KA 3VYGA 4HCZA 4E7IA 1KQ1A 1VQKA 4XU1A 3SWNB 3QYGB 3F70A 5LJ5j 4M7DE 4IUTA 3TU4K 3QXEB 1YITA 3CEYA 1B34A 2RI5A 3M59A 4J83A 4M7AB 5GAMf 3HL8A 1N8RU 2L5QA 4N0AC 2KAFA 3BW1A 4JLIA 2LX9A 2X4WA 5KCOA 2M16A 2P0QA 4FL6A 3A8OB 3E9GA 3G6EA 3J80E 4JS5A 3OYDA 2E10A 4OMFB 2HBPA 3RKWA 1ZQ1A 1BYMA 3KXTA 3OYYA 5GMKe 5GANg 2LDMA 3CCUA 2E65A 2A7YA 3SB2A 5GMKl 5DLOA 3UT1A 1KHIA 2E41A 2ZGWA 1EIFA 2ZPEB 4LDXA 4KULA 2JZ2A 3GPLA 3UPUA 4PJOD 4ZN3A 3JCMe 1VQNT 3FRNA 1AHJB 3OYGA 5KH6A 3J7AF 2KDSA 1K9MC 3A8MB 2E70A 2AHJB 2G3RA 3CPFA 4M78B 3CMAA 3OBWA 3V8LA 1XQHA 1K8AC 3JCMJ 3OS2A 5DLQE 1M9SA 1WPYA 1S72T 4A4EA 1G3YA 4FM4B 1YJWA 3RERA 3GF5A 4HKEA 3GOXA 4HT9A 1BI1A 1UB4A 2DXBA 2H3JA 2HQXA 2P0KA 2JN0A 2ZPHB 3GNGA 2XHCA 4J6YA 1YHQA 3JCMV 2HQEA 4M7AC 1N8RC 4OB2B 4Y28E 1K73C 4E47A 1H641 2JVVA 4M77E 2CZ1B 2OTLT 1OI1A 1HK9A 3MEUA 4M75D 5LJ3d 1VIEA 3QG1A 3CCLA 3HRUA 4DOVA 2E1HA 1KC8U 3OYEA 3HSBA 4C8QA 2RJDA 4O6JA 5LJ5f 2QQRA 5GMKh 4M78E 4O5VA 4C0FA 4MZTA 3R6OA 1M1KC 2XDPA 5D6YA 4BB7A 3JCMg 2YLBA 3JB9F 4L59A 4E7KA 2GQVA 2ZPFB 4CI0C 1VQPA 3PT9A 1VQ6T 3VKIA 3QDRB 4XQ3A 3RMQA 3G7ZA 2DZ9A 3PTAA 2D6FA 5FROA 2XI9A 3JB9I 1JRIA 3BY7A 1SSFA 2CZ0B 3DKMA 4M78C 4A4HA 4RCBA 1RL2A 5I2MA 2IG0A 3WXMB 4BI4A 1YBYA 3OYAA 3JCMQ 3I55T 3S3NA 2X4JA 1N27A 4XTUA 1Y96B 4YTLA 3WVDB 5GAOm 4QVDA 3CC2T 5CKDA 4BE0A 3JRZA 4OB1B 5HY6A 2DPPB 2MI6A 5GAMg 2XU8A 1QVGA 5FU6B 3QO3A 1N9SA 3M56A 4P5NA 3OYLA 4ZTFA 4A53A 3CCST 2LQ8A 2RHXA 1M90U 3MCAB 3QYHB 3M54A 4C0DB 1YI2A 2EJGA 1BI0A 4DA4A 4LDVA 3JCMW 3LWIA 1KHCA 2DZCA 1G5VA 2K3XA 4M75A 4M7AD 1WJRA 2PU9B 4PJOE 2LQKA 4PL6A 5D6WA 4F7UF 3CCVA 1YIJA 4JJNK 4PKCC 3M4YA 2VXEA 3L2ZA 1QVFA 5GMKi 3ER0A 4QW2A 3MP1A 3M9QA 1O9SA 3A8HB 3E1SA 1VQ8T 4BDZA 3L2VA 1Q81C 3FC3A 4M7DA 1WGSA 4R56A 2WSFE 2P0PA 5CR2A 3JAME 4M77D 1I81A 5HKCA 3CCQA 4E7JA 2KMTA 3FIFA 4C92F 1VQMA 2RI2A 1VQ4A 3J81E 1D3BA 4JDSA 3FEOA 3TREA 5GANe 2RH2A 3M55A 1Q7YU 4M7DF 2O4XA 1YJNA 5DY9A 3SFMA 3HKSA 3QIIA 4NS5A 1IZ6A 4XTZA 4M78D 4C8QG 3CPWS 1ZBXA 2DAQA 3INZA 4JRPA 2QQBA 5FU6C 3OSSC 5KCHA 3AHUA 1K9MU 1M90C 2KVQG 5CAIA 2XICA 2YHTA 2HD0A 2ZPIB 2JTFA 4C92B 1UGPB 4C0DC 1XOVA 1KQSS 2IVWA 3OMCA 1BKBA 2VYTA 3OS5A 3GIBA 5LJ5g 5LJ3j 3JSCA 5J3BA 4JRKA 3JCMb 5C0MA 4RCCA 3SWNA 1JJ2A 3SDZA 4C0ZA 4ZGDB 5A0DA 5LL6S 5D6XA 5I2SA 2DD4A 3OS1A 2ZCFB 2BKDN 2QQSA 1VIFA 4RKUE 3QBYA 5M9OA 3L42A 3BDLA 1YITT 2LCLA 1VQ5A 1VQLT 1K73U 3FB9A 3S6WA 3TCJA 3VU3C 3OQ5A 2O01E 4MZMA 4EMKA 3G4SA 3OMGA 4OGEA 2QEXA 3L2RA 2KY9A 4DOWA 2K5FA 4BDYA 2XD0A 5HK3A 2DTOA 2JTMA 1BIAA 1W4SA 3OBYA 3QKJA 3M57A 2VUBA 4R55A 5GAOn 2DEQA 3E9FA 3V8KA 1P92A 3LGLA 4FT2A 3RMSA 4A4KA 3G6ET 2LNVA 4MDXA 2VXFA 4Y91A 1Q7YC 4M77A 2DTIA 5GANh 3EFSA 2L89A 1M1KU 4F7UG 3CCUT 4J5YA 4PLIA 1U1TA 2E64A 1B34B 5CQYA 3CBOA 4X9DA 5IAYA 3JB9J 2LRQA 2FHDA 1M8VA 3HRSA 3M5AA 2JNGA 3OYCA 1WNLA 1X01A 3QJ6A 4JRIA 3X25B 5KE2A 4C92C 4GLKA 5GAOp 1QVGS 4C0GA 4M7AE 3CMAT 3Q1JA 1VQ9A 4C92G 3P8BB 1Q82U 2X4XA 4XAXB 2B8AA 4ZGEB 1BI3A 5KE3A 4M7DG 2RHYA 4N4GA 5GAMe 2LC4A 3QPHA 3CCJT 1YJWT 3A8GB 4JUVA 1QP2A 3BFMA 2KQWA 3PNWC 3LYIA 1BI2A 3CC7T 3OYNA 1YHQT 2EQUA 3G71T 1G3TA 2RJFA 4FU6A 3PMTA 5CCAA 3CXCS 5CKBA 1G3SA 4N4IA 1VQ7A 2LT4A 5LJ3f 4J7IA 3CBPA 3CCRA 1Y7XA 4J6WA 3CCLT 5C6SA 3KBGA 3I56A 1MHNA 4MMKA 2PVOB 2QQAA 4X34A 4EMHA 1WJSA 1WJQA 4EPCA 4C8QF 5HK0A 4BY6B 2KSSA 1NPPA 4L5GA 2FL7A 2QA4T 4BACA 3JCMh 3CMEA 1Q81U 5CVIA 1YCYA 5FRNA 5CK9A 1JB0E 1VQOA 1KG1A 3LX7A 4PJOA 2RD1A 1IREB 3H6ZA 5J26A 5CKEA 2VGMA 3L2QA 4NL3A 1VQPT 3QHSA 4IUQA 3H8ZA 3OB9A 2JOYA 3C4SA 4C8QB 1Q82C 1WQ7A 2R5AA 1FX7A 3OS0A 1PSFA 2EQMA 5CQXA 5GMKj 3QJYA 4QVCA 5DM7R 5AYFA 2EWNA 2DVEA 2LT1A 4ELZC 4ZGJB 2KK4A 1YJ9A 2HAXA 3DLMA 2C06A 2MMPA 1FWZA 1QVPA 1JJ2S 4LDWA 3V7SA 2RHUA 5J39A 3OSVA 3JB9H 3X28B 1H3ZA 2EJFA 2DK3A 1JBMA 2XG8D 3HHTB 4OB3B 1YI2T 2RB6A 2PVDB 5LJ5e 4DQ2A 5GAN7 2R57A 2L8DA 2LVMA 1OYXA 3OYKA 2XIDA 3X26B 4QQ6A 3X24B 2ZPGB 1I4K1 2PUKB 4KUDK 1OZ3A 4IUVA 5GAMh 5GAN4 4GY5A 4JLGA 1Q86C 4M75F 5GMKm 1LOJA 4N0AA 3CCVT 3OW2A 1YIJT 4BY6C 2DKGA 5CKFA 5EG2A 3FLGA 1M5Q1 3BDUA 5CIUA 5GAN5 3FDRA 2HNIA 2EQJA 2DIQA 2P4TA 4MDWA 4EDUA 2WSEE 4JS4A 3OYMA 2ZZDA 2XK0A 3V8JA 4IURA 2K5LA 2K2VA 4V2SA 3RKYA 4F7UB 3MP8A 4J8OA 2F5KA 1BIBA 3LGFA 3CCQT 2GFAA 1VQMT 2CZ6B 4C8QC 1VQ4T 1UEBA 3P8DA 1UGQB 3NFCA 3CC4A 2F69A 2Y4YA 4ELYC 4C5EA 1YJNT 4OGCA 3CCEA 3MEVA 2M9UA 3CBMA 2DXTA 2YRVA 2LCCA 4II1A 4ATOA 4QVZA 2E6ZA 2M1HA 4LD6A 4BE2A 5IT9E 3FJPA 4IUUA 4XU0A 1KD1C 5LJ3g 4M7DB 2DTHA 3QUIA 1W2BA 2GF7A 4UC4A 2V8JA 5LJ5h 2RI3A 4PJOG 2OTJA 1D3BB 2QTXA 3C12A 3OYFA 4KT0E 3MP6A 1UGSB 3UDCA 1VQKT 3PMIA 3OA6A 3DB3A 4M7AA 4F7UE 3JCMd 2FVUA 2RJCA 3CD6A 2RHZA 3HFOA 2RM4A 1VQ5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UB4 A;  3G7Z A;  4ELY C;  2VUB A;  5CK9 A;  4MZP A;  5CKE A;  4OF1 A;  5DLO A;  4MDX A;  3VUB A;  5CKD A;  5CO7 A;  3JRZ A;  1X75 C;  3JSC A;  5CKF A;  5CCA A;  1NE8 A;  1VUB A;  5CKB A;  5CQY A;  5CQX A;  1M1F A;  5CR2 A;  5HKC A;  3HPW A;  4ELZ C;  2KMT A;  2C06 A;  4VUB A;  4ME7 A;  4MZT A;  5CKH A;  3TCJ A;  4MZM A;  5HK0 A;  2MF2 A;  4HKE A;  5HK3 A;  3NFC A; 
#chains in the Genus database with same CATH topology
 4HA8 A;  5D7U A;  4EMG A;  2K7A A;  1LCK A;  2F5T X;  2GCX A;  1ZLM A;  1IRX A;  4HCB A;  1Q86 R;  5FU7 B;  2GFU A;  1HYO A;  3S3O A;  5GAM d;  4M75 C;  3VS7 A;  2J05 A;  1VQL A;  3WVE B;  2ZPB B;  1RUW A;  3VJP A;  1E6H A;  4EMK B;  3M0Q A;  4PLL A;  1TUD A;  3JB9 D;  1R8O B;  1U8R A;  3E2U A;  4RTY A;  2C0T A;  2L3R A;  2A0F B;  2CP2 A;  4XU2 A;  2K57 A;  2K5I A;  1I8F A;  2EYQ A;  3M53 A;  4L6V 5;  1M4Z A;  2VWF A;  3LLR A;  4OB0 B;  2KT1 A;  3P8H A;  3EGX B;  1GXI E;  4ZN1 A;  1C6V X;  1PRM C;  1S72 A;  3LH0 A;  4RTT A;  4XTV A;  1J3T A;  1VYV A;  3CCJ A;  3EH2 A;  2RO0 A;  4R0K A;  3PIP A;  5GAN 2;  3N5B B;  1UDL A;  4FW1 A;  1PKS A;  2KBT A;  1PC0 A;  3MEA A;  2YRC A;  2D8J A;  2NUT A;  1DJ7 B;  2QG9 B;  1I5L A;  2DX1 A;  4C92 D;  4F14 A;  2MWP A;  4ME7 A;  2QA4 A;  1W2B S;  2E5Q A;  1YJ9 T;  4X9C A;  2EKH A;  3RUX A;  2X3W D;  3MO8 A;  2QI2 A;  2YUP A;  5LJ3 e;  1LNX A;  5IN1 A;  3CC2 A;  1B07 A;  2PUO B;  4OF1 A;  1I5O B;  4DBR A;  2D9T A;  3C95 A;  3VV0 A;  2DIG A;  3CCS A;  1X69 A;  2I2L A;  4Z02 A;  4FCY A;  4IUP A;  4LDU A;  4J7F A;  1ACM B;  2XDD A;  1FXX A;  5KYU A;  1JXM A;  1RI0 A;  3DLL A;  1B3Q A;  4RG2 A;  2FYK A;  2ESW A;  2EKO A;  1ZHI A;  1NYG A;  1QMC A;  3GLX A;  3CXC A;  2DBK A;  4QQD A;  1VQ8 A;  4BD3 A;  3NTI A;  3DB4 A;  3CCE T;  4B9W A;  1VUB A;  2CP3 A;  2R5M A;  2K4Y A;  1G3W A;  3EFR A;  4FIB A;  2EPD A;  1MMA A;  3URG A;  4C5H A;  3HP9 A;  4M7A F;  2AK5 A;  3CD6 T;  3A8L B;  3SD4 A;  1VQ5 Q;  1H3H A;  4QKU A;  4E7I A;  3CD6 Q;  5LJ5 j;  1WHH A;  3QXE B;  2GTJ A;  2I0N A;  2GQI A;  2KRS A;  2LX9 A;  1KIK A;  4JS5 A;  1BYM A;  3KXT A;  2FPD A;  3OYY A;  1SKU B;  2OI3 A;  1MMG A;  3UT1 A;  1K0S A;  2KXD A;  4J9B A;  4KUL A;  1VQ9 Q;  3JCM e;  1AHJ B;  4X1V A;  2ECZ A;  2E70 A;  2AHJ B;  2MOX A;  4PK4 A;  3JCM J;  1M9S A;  4RUG A;  4FM4 B;  1BI1 A;  1UB4 A;  3CCM T;  2XHC A;  7AT1 B;  4PFZ A;  4LNP A;  2JVV A;  5LJ3 d;  2DFU A;  1KC8 U;  1AT1 B;  4DOV A;  2RQV A;  4AMC A;  2QQR A;  5GMK h;  5D6Y A;  3JCM g;  3EG2 A;  2YLB A;  1OOT A;  4L59 A;  4E7K A;  3JB9 F;  3PTA A;  2DA9 A;  2D6F A;  1UUE A;  3JB9 I;  1JRI A;  3DKM A;  3M0R A;  4A4H A;  4B6M A;  3S3N A;  2X4J A;  4KH1 B;  4YTL A;  1Y96 B;  5EC7 A;  4OB1 B;  2DPP B;  1D0X A;  1QVG A;  3QO3 A;  2MPX C;  4A53 A;  2LQ8 A;  4DBH A;  4C0D B;  1RLQ C;  2AZV A;  1QKX A;  3LWI A;  3EG0 A;  3VS2 A;  3CXC P;  1WJR A;  2L2P A;  4JJN K;  1YCS B;  4PKC C;  4CC2 A;  3BE3 A;  1QVF A;  4QW2 A;  2CT4 A;  3MP1 A;  1SPK A;  2DL8 A;  1O9S A;  3UAT A;  2A08 A;  4BDZ A;  5IHI A;  4AFS C;  3FC3 A;  4WCI A;  1MMN A;  2WSF E;  3CC4 Q;  3JAM E;  4M77 D;  1I81 A;  5HKC A;  3CCQ A;  4C92 F;  4JDS A;  5GAN e;  3M55 A;  4LN2 A;  4NS5 A;  4JRP A;  1ZX6 A;  3AHU A;  1K9M U;  1M90 C;  2OTJ Q;  2KVQ G;  2ZPI B;  2YHT A;  2JTF A;  2KR3 A;  3OMC A;  2VYT A;  5LJ5 g;  2LMJ A;  3JCM b;  1IGU A;  5C0M A;  3SDZ A;  1GL5 A;  1BCO A;  2ZCF B;  1WXB A;  1VIF A;  4RKU E;  2CP5 A;  1VQ5 A;  3FB9 A;  2NUZ A;  4E7Z A;  2JTM A;  1BU1 A;  2LX7 A;  3M57 A;  2VUB A;  5GAO n;  2LZ6 B;  2Z0W A;  1JQQ A;  3G6E T;  2VXF A;  4JPB W;  1Q7Y C;  2DTI A;  3EFS A;  1K0X A;  3CCU T;  1D09 B;  4J5Y A;  1IXD A;  1B34 B;  3G6E Q;  5IAY A;  1M8V A;  1AZG B;  3M5A A;  3CCU Q;  2JNG A;  1WNL A;  1X01 A;  2AT1 B;  3QJ6 A;  3X25 B;  5GAO p;  1QQJ A;  1QVG S;  4J9D A;  1VQN Q;  4RTW A;  2YWW A;  1VQ9 A;  1UG1 A;  5KE3 A;  2L3P A;  1YJW T;  4N4G A;  1PCX A;  3A8G B;  1QP2 A;  1M90 R;  3CC7 T;  2DMO A;  1G3T A;  3TVT A;  4FU6 A;  5CKB A;  3VS1 A;  1OQK A;  4N4I A;  8ATC B;  3CC7 Q;  3CCL T;  4MMK A;  1JEG A;  1EX4 A;  2O88 A;  2YT6 A;  3U23 A;  4C8Q F;  2K9G A;  3CCL Q;  4DEY A;  4FSS A;  1SG5 A;  2HDA A;  1Q81 U;  5FRN A;  1SF9 A;  1KG1 A;  3I35 A;  3LX7 A;  1VQP T;  2KGT A;  4NL3 A;  1M3C A;  2FPE A;  1Q7Y R;  1QVG P;  1Q82 C;  1VQP Q;  1FX7 A;  5GAM h;  5AYF A;  1D1A A;  1QVP A;  3M0S A;  2RHU A;  2QTV A;  3HHT B;  2JJ9 A;  2PVD B;  2YUN A;  2XID A;  1QVF P;  1AEY A;  2JT4 A;  5FW9 A;  3QDF A;  2ROL A;  4JLG A;  1M27 C;  1LOJ A;  1YIJ T;  2DKG A;  5CKF A;  2JTE A;  3BDU A;  2JMA A;  5KYN A;  2HNI A;  2K6D A;  2EQJ A;  3LH5 A;  1YIJ Q;  1M3B A;  4F7U B;  2F5K A;  1TTH B;  3CC4 A;  2F69 A;  4ELY C;  1YJN T;  4OGC A;  4KGX B;  1GCP A;  2COZ A;  2LCC A;  5IT9 E;  1D1C A;  2QGG A;  1M2V A;  2C0I A;  2DTH A;  1Q82 R;  2GF7 A;  3VS4 A;  1SSH A;  2FZC B;  2OTJ A;  3C12 A;  1M8M A;  2H3E B;  4KT0 E;  1Y57 A;  2EGA A;  4M7A A;  4PFP A;  2FVU A;  2J7I A;  3OS5 A;  2RM4 A;  2CP0 A;  4J9H A;  4XTY A;  2QEX T;  1YIT Q;  5GAO q;  2PVG B;  1FMW A;  4KUI A;  5GAO l;  1GFD A;  1ABQ A;  2CT3 A;  2EYZ A;  2E12 A;  1K76 A;  2YLC A;  1R0B G;  2QEX Q;  4OP0 A;  1PSE A;  3L2U A;  2LTO A;  5FRM A;  4M75 G;  3GNF B;  5GAN 6;  2KE9 A;  4M77 F;  2CSI A;  1G2B A;  1X43 A;  4M78 A;  3MJX A;  1XNI A;  3MET A;  1SRM A;  2EAY A;  5IH2 A;  1I1J A;  2FG0 A;  2BUD A;  2X4Y A;  1VQN A;  5I21 A;  1HJD A;  2E6N A;  2DJZ A;  4XTX A;  4WF2 A;  2X3X D;  3V7C A;  1NE8 A;  3LW5 E;  3MEW A;  1Z9Z A;  1TUC A;  3ZEH A;  4PNO A;  5GAN 3;  5ECA A;  2RHI A;  3CPW A;  1MGQ A;  4KH0 B;  4NL2 A;  1VQ7 T;  2KYB A;  1NPR A;  3I56 T;  3EGD B;  1V1C A;  1KQS A;  1G8X A;  1U1S A;  3CC7 A;  1VQ7 Q;  2OTL A;  1QP3 A;  4JJC A;  4TVR A;  3KUF A;  4M7A G;  1M3A A;  3ZFJ A;  2CKK A;  4PJO F;  1WQW A;  3S3M A;  3X20 B;  2HL5 C;  1QLY A;  2DM1 A;  2ED1 A;  3NTH A;  2MWO A;  3FJ5 A;  4C5I A;  2DRK A;  1KQ2 A;  1UFF A;  1KD1 U;  1X6B A;  3I55 A;  3HRT A;  3OYH A;  2B86 A;  4AG1 C;  2RK2 A;  2SEM A;  4M78 G;  2XDB A;  2D0Q B;  2WSC E;  2HBW A;  1NJI C;  4Y92 A;  4Q5W A;  4OMM A;  3A5Z B;  4RTU A;  1N9R A;  2D0N A;  4D6W A;  3CCV Q;  1UE9 A;  2NUP B;  2DEU A;  3MHX A;  1QW1 A;  2EFI A;  1U06 A;  2X9H A;  1KC8 C;  2M0O A;  2RK1 A;  1NYF A;  2A3L A;  2HCK A;  1Y07 A;  3NTK A;  1UJ0 A;  4C92 A;  3EG9 A;  4BI8 B;  3VYH B;  5LJ3 h;  4FYW B;  3RKX A;  1GCQ C;  4HT8 A;  3T9N A;  3PGG A;  2MF2 A;  3C94 A;  3NMZ C;  1NBE B;  4M75 E;  3JB9 G;  3LWH A;  2NLU A;  4E6R A;  3M58 A;  3GBQ A;  5GJW B;  3VUB A;  4JJD A;  2V8K A;  2RQW A;  4HCZ A;  4XU1 A;  3SWN B;  2DF6 A;  2JM8 A;  3F70 A;  3QYG B;  1NJI R;  1YIT A;  5KYY A;  2RI5 A;  5GAM f;  1K9A A;  1N8R U;  2HEQ A;  2GBQ A;  1PNJ A;  2GTO A;  1W6X A;  1KC8 R;  1OPL A;  4FL6 A;  4ANJ A;  3OYD A;  2HBP A;  1RAG B;  2D1X A;  2E65 A;  2A7Y A;  5GMK l;  2DRM A;  1EIF A;  3GPL A;  2JZ2 A;  3UPU A;  4ZN3 A;  3OYG A;  3CPW P;  1K9M C;  3CMA A;  3OBW A;  3V8L A;  1K8A C;  6AT1 B;  3EG1 A;  4HXJ A;  4A4E A;  4RTZ A;  1KQS P;  1GFC A;  4HKE A;  3GOX A;  2HQX A;  4D8K A;  2ZPH B;  3JCM V;  4LUD A;  4M7A C;  4E47 A;  4QT7 A;  1OI1 A;  1HK9 A;  1ABO A;  5IHN A;  1VIE A;  1T0H A;  1PD1 A;  4C8Q A;  1RAD B;  4O6J A;  4M78 E;  4MZT A;  4Z88 A;  1NEG A;  4CI0 C;  4KRT A;  1VQ6 T;  3RMQ A;  1V76 A;  4M78 C;  1YJ9 Q;  1BB9 A;  2IG0 A;  1N27 A;  5GAO m;  2NUT B;  4BE0 A;  3JRZ A;  2MI6 A;  4PFO A;  1N9S A;  3M56 A;  1K9M R;  4ZTF A;  2RQU A;  4OML A;  3MCA B;  1K8A R;  1YI2 A;  2EJG A;  1BI0 A;  1G83 A;  2A37 A;  1KHC A;  2DZC A;  1G5V A;  2LQK A;  2BE9 B;  4PL6 A;  4FYY B;  3RR6 A;  4F7U F;  3CCV A;  3M4Y A;  2RF0 A;  5GMK i;  2QAZ A;  3ER0 A;  3E1S A;  1Q81 C;  4M7D A;  1WGS A;  4R56 A;  2ED0 A;  5KYU B;  2KMT A;  3CCE Q;  1VQ4 A;  2EYY A;  3MPU B;  2RH2 A;  2KT8 A;  1S1N A;  5DY9 A;  3SFM A;  2QAS A;  1IZ6 A;  4C8Q G;  4J9F A;  5FU6 C;  1AD5 A;  3OSS C;  5KCH A;  1IB8 A;  2HD0 A;  1Y0M A;  2YXY A;  1ZA2 B;  2IIM A;  4JRK A;  1JJ2 A;  4C0Z A;  2QQS A;  3QBY A;  2ABL A;  3L42 A;  3BDL A;  2J06 A;  1ZSG A;  1K73 U;  3TCJ A;  4OGE A;  2XD0 A;  4AFQ C;  3L2R A;  4DOW A;  2K5F A;  4BDY A;  5HK3 A;  2DTO A;  1W4S A;  1XJW B;  4R55 A;  2DEQ A;  3E9F A;  3V8K A;  2HKQ B;  1P92 A;  4OMP A;  4A4K A;  2LNV A;  2FRW A;  4HCK A;  4M77 A;  5GAN h;  1M1K U;  1U1T A;  2HL3 A;  1Q81 R;  3TSZ A;  2EVR A;  4PJM A;  2FHD A;  3H0F A;  3EFO A;  1MMD A;  5I22 A;  3HRS A;  4C92 C;  1WZO A;  3Q1J A;  2DET A;  4XAX B;  2B8A A;  4M7D G;  2AKK A;  3QPH A;  3M0T A;  1WI7 A;  1RAA B;  4AFZ C;  2AZS A;  3CCM Q;  1YHQ T;  2EQU A;  4GBQ A;  3PMT A;  5CCA A;  3CXC S;  1G3S A;  5LJ3 f;  1YHQ Q;  2PVO B;  2QQA A;  4X34 A;  4EPC A;  5HK0 A;  2FL7 A;  1F1B B;  3TQ7 P;  5CK9 A;  4PJO A;  5HCK A;  2RD1 A;  1NM7 A;  3H6Z A;  5J26 A;  4RTX A;  3QHS A;  3ULR B;  2LP5 A;  3OS0 A;  2EQM A;  2LQN A;  5GMK j;  1YJ9 A;  2LT1 A;  2DVE A;  4ZGJ B;  2HAX A;  2A28 A;  2E3I A;  1Q95 G;  3DLM A;  2MMP A;  1MV0 B;  5KYX A;  1QWE A;  1QWF A;  4LDW A;  3V7S A;  5J39 A;  1TWB A;  3OSV A;  1JJ2 S;  3X28 B;  3JB9 H;  2DK3 A;  2IPO B;  2BE7 D;  1ZSZ A;  5LJ5 e;  3SHW A;  3PE0 A;  2LVM A;  3X24 B;  2ZPG B;  1I4K 1;  2PUK B;  1JXO A;  5GAN 4;  5GMK m;  4N0A A;  3OW2 A;  4BY6 C;  2HMA A;  1M5Q 1;  5CIU A;  1T3S A;  2P4T A;  4EDU A;  2WSE E;  2ZZD A;  2XK0 A;  4IUR A;  1WIE A;  2K2V A;  4PJJ A;  3RKY A;  1VQM T;  2DIL A;  4C8Q C;  2Y4Y A;  3CCE A;  2VAS A;  3MEV A;  2M9U A;  3CBM A;  4QVZ A;  4XU0 A;  1KD1 C;  1JJ2 P;  2FO0 A;  4JJB A;  2KEA A;  1U5S A;  1AWO A;  1D1B A;  2V8J A;  4PJO G;  2F2V A;  3OYF A;  2MIO A;  3EG3 A;  3MP6 A;  1UGS B;  3UDC A;  1QCN A;  3PMI A;  3DB3 A;  3JCM d;  3CD6 A;  3G1J A;  3RDV A;  3JCM f;  3OY9 A;  3A1P A;  3G4S T;  4PJN A;  2EJ9 A;  2DJQ A;  2JMC A;  2DD5 A;  4AFU C;  1R77 A;  1WLP B;  2L3S A;  4E7L A;  1TS9 A;  1LPL A;  3VRY A;  4XK8 E;  3PIO A;  1O75 A;  3JCM c;  3UA7 A;  4M7D C;  1UHC A;  2E4H A;  3ZL7 C;  1OEB A;  5A0L A;  2FB7 A;  2ENM A;  3HFN A;  1MND A;  5GAN 8;  1Y71 A;  1YJW Q;  2CGH A;  1KD1 R;  2VC8 A;  2CDT A;  2CSQ A;  3HPW A;  2RJE A;  3HTR A;  3OW2 S;  4HCC A;  1QVF S;  2AIR B;  1UJY A;  1UGV A;  5FLX E;  3CCM A;  2QQ9 A;  2DL4 A;  2DXC A;  3RBB B;  3CCR T;  1HD3 A;  2K79 A;  3QWY A;  3CCR Q;  4N4H A;  5IXF A;  3EHQ A;  3CME T;  2FZK B;  2OJ2 A;  3OYI A;  2CS7 A;  1I07 A;  3GP8 A;  1VQO T;  1VYU A;  1YWP A;  2CZ7 B;  5L8R E;  2RQR A;  4LXC A;  4IIM A;  5CO7 A;  5LJ5 d;  1HSQ A;  2DO3 A;  2K3Y A;  4M77 C;  4KGZ B;  2XKO C;  1QCO A;  4XU3 A;  1AWW A;  2KXC A;  3QZ9 B;  3RIR A;  2KYM A;  4HVV A;  4KGV B;  5GAN d;  3OW2 P;  2EGC A;  3H41 A;  2CUB A;  2V1R A;  5GAN f;  3M4G A;  2W10 A;  3OYB A;  1SHF A;  2KI7 A;  5GAM j;  2RA2 A;  4A54 A;  3OYJ A;  2FRY A;  3UF4 A;  2LJ0 A;  2X35 A;  4VUB A;  5A0G A;  1AVZ C;  4IKF A;  4F7U A;  2DXU A;  2NYS A;  2PQW A;  4M75 B;  4LD9 K;  1V29 B;  1X6O A;  1RI9 A;  4FSX A;  1UGR B;  3PFS A;  4B9X A;  1OU8 A;  4JZ3 A;  2RQT A;  3REB B;  1YJN Q;  2DYB A;  4PJO C;  1ZUU A;  1WYX A;  1H92 A;  3VRZ A;  3QZ5 B;  3JCM X;  2G6F X;  1NLP C;  2O4X B;  5CKH A;  5AT1 B;  2EQK A;  2JXB A;  2R58 A;  4D8D A;  2LJ3 A;  1M2V B;  2Y4X A;  1ZSZ C;  1KQ1 A;  4IUT A;  1ZUY A;  3CEY A;  1W1F A;  3M59 A;  4J83 A;  4M7A B;  1YFN A;  1H8K A;  2L5Q A;  4N0A C;  3BW1 A;  1SHG A;  2X4W A;  1KJW A;  2P0Q A;  4DBQ A;  3G6E A;  3MKD A;  3CCU A;  2LDM A;  3A98 A;  1KHI A;  2E41 A;  2ZGW A;  4LDX A;  1WHJ A;  3R6N A;  5KH6 A;  3J7A F;  2KDS A;  3A8M B;  2G3R A;  4M78 B;  3OS2 A;  2LCS A;  1S72 T;  1YJW A;  1JO8 A;  4J9I A;  3RER A;  3GF5 A;  1SRL A;  4HT9 A;  2DXB A;  4J6Y A;  2JN0 A;  4CC7 A;  1ZA1 B;  4Y28 E;  1BBZ A;  1K73 C;  4FW2 A;  2LQW A;  3I56 Q;  3MEU A;  4M75 D;  4E2F B;  3EHR A;  3QG1 A;  5KYW A;  2CUD A;  3CCL A;  3HSB A;  2E1H A;  2RJD A;  4O5V A;  4C0F A;  1M1K C;  2XDP A;  2HZY A;  2GQV A;  2ZPF B;  1VQP A;  1ARK A;  3QDR B;  1SSF A;  1RL2 A;  5I2M A;  3WXM B;  1ZUK A;  1YBY A;  3JCM Q;  2P4R A;  3WVD B;  4QVD A;  3CC2 T;  1NLO C;  1EZZ B;  5GAM g;  3EH1 A;  5FU6 B;  4P5N A;  3CQT A;  1YNZ A;  3CCS T;  2RHX A;  1M90 U;  2EQI A;  1UEC A;  2NUP A;  4AG2 C;  4LDV A;  1W70 A;  2NWM A;  2FPF A;  5I11 A;  2K3X A;  4M7A D;  2PU9 B;  1KK7 A;  1YIJ A;  3I5R A;  1K73 R;  2VXE A;  1VQ8 T;  3A8H B;  1UHF A;  2P0P A;  5CR2 A;  4E7J A;  2JS2 A;  1YP5 A;  4RTV A;  3FIF A;  1D3B A;  1Q7Y U;  2SRC A;  1M1K R;  2RPN A;  1YJN A;  1VA7 A;  3HKS A;  4M78 D;  3CPW S;  1FMV A;  3PVL A;  3H9N A;  4C92 B;  2EYX A;  2CP7 A;  1CKA A;  1XOV A;  1KQS S;  3EG9 B;  1OPK A;  2HQH A;  5LJ3 j;  3JSC A;  2A36 A;  1R0C B;  1IGQ A;  4RCC A;  3SWN A;  4ZGD B;  5LL6 S;  5I2S A;  4Z8A A;  2DD4 A;  2BKD N;  5M9O A;  2LCL A;  4CC4 B;  3VU3 C;  4EMK A;  3OQ5 A;  4MZM A;  2QEX A;  3OMG A;  2MYS A;  3QKJ A;  1RAH B;  1TUG B;  1I0C A;  1AWJ A;  4FT2 A;  3LGL A;  4MDX A;  2L89 A;  2E64 A;  5KYY B;  5CQY A;  2K3B A;  3JB9 J;  2LRQ A;  3EGX A;  1WX6 A;  1UTI A;  4JRI A;  4M7A E;  4C0G A;  1KFZ A;  4C92 G;  1Q82 U;  2X4X A;  4ZGE B;  1BI3 A;  2RHY A;  2LC4 A;  2EYW A;  2COY A;  3BFM A;  2KQW A;  2RN8 A;  3PNW C;  2F2X A;  3OYN A;  1C0M A;  3G71 T;  1VQ7 A;  2LT4 A;  2HSE B;  4J7I A;  1N5Z A;  3CBP A;  1Y7X A;  3G71 Q;  3H0I A;  1YN8 A;  3KBG A;  3I56 A;  1MHN A;  2QGF B;  1WJS A;  4BY6 B;  2KSS A;  4L5G A;  4BAC A;  3JCM h;  5CVI A;  1YCY A;  1JB0 E;  1IO6 A;  1AOJ A;  1IRE B;  2K2M A;  4J9C A;  1VQ6 Q;  2JOY A;  4GLM A;  4C8Q B;  1PSF A;  2QK0 A;  5DM7 R;  2H8H A;  2KK4 A;  2C06 A;  3JV3 A;  1NEB A;  1H3Z A;  1JBM A;  2XG8 D;  4DQ2 A;  3X26 B;  2W0Z A;  4KUD K;  5GJV B;  3QWX X;  3REA B;  4M75 F;  1WFW A;  2DVJ A;  5EG2 A;  3FLG A;  1E6G A;  4FYX B;  3OYM A;  2K5L A;  4V2S A;  3MP8 A;  3CCQ T;  2BZY A;  2GFA A;  2L3Q A;  1AZE A;  2JM9 A;  1UEB A;  3P8D A;  1UGQ B;  1NG2 A;  1X2Q A;  3CCQ Q;  2DXT A;  3NPF A;  4II1 A;  1W2B P;  1OU9 A;  2M1H A;  4LD6 A;  5LJ3 g;  4M7D B;  2O9V A;  4UC4 A;  3VS0 A;  3SEM A;  5LJ5 h;  2RI3 A;  1WXT A;  2QTX A;  1TU0 B;  1VQK T;  2RJC A;  2DE0 X;  1AWX A;  2RHZ A;  1VQ5 T;  1VQK Q;  4LUE A;  4KBM B;  2D8H A;  4LDY A;  4MZP A;  4EIK A;  2JW4 A;  2KNB B;  4C92 E;  2GNC A;  4F17 A;  1M1F A;  1RAE B;  4BE1 A;  3VS3 A;  1PHT A;  4C8Q D;  3D7S B;  2VGN A;  4M78 F;  3TEE A;  1MV3 A;  3ME9 A;  1Z9Q A;  1VQ9 T;  3O5Z A;  2QDL A;  4M77 B;  4NOY A;  5GAN j;  4C5G A;  3UWN A;  2QXF A;  1T0J A;  3EFO B;  1ZBJ A;  2L0A A;  1QCF A;  2BIV A;  1M1G A;  2EIF A;  2OAU A;  2O31 A;  2QDY B;  4CRI A;  1K4U S;  1Q86 U;  5FU7 C;  2QYZ A;  3SWN C;  2XMF A;  1NJI U;  1LJO A;  2Y90 A;  3H0H A;  3G71 A;  2V8I A;  4FT4 A;  2C0O A;  2JS0 A;  4EMK C;  1XTD A;  2FEI A;  1WHL A;  1Y96 A;  1X75 C;  3RES A;  4A4F A;  3JCM P;  3QSU A;  1N6A A;  1VQ6 A;  4M7D D;  4M77 G;  3L2W A;  4E7H A;  1D0Z A;  2O2O A;  1NZ9 A;  4PJO B;  2O9S A;  2YSQ A;  3VUZ A;  3VS6 A;  1TSF A;  3L1A A;  3ZBD A;  5GAO r;  4XTW A;  2VB6 A;  4J6X A;  4QQG A;  1IHV A;  4ZTJ A;  4PJL A;  2V26 A;  4C8Q E;  2VV5 A;  5KYX B;  2CP6 A;  2CYZ B;  4BUG A;  1TH7 A;  2J6K A;  1ZSZ B;  1HXD A;  2LNH B;  4BI3 A;  3V7R A;  2CH4 W;  2PTK A;  1T3L A;  2WAC A;  3ASK A;  4A4G A;  1GBR A;  2KRM A;  3EAE A;  3CC4 T;  1VQM Q;  3E19 A;  1WXU A;  2DYI A;  4RMO A;  3RNJ A;  4A63 B;  3O8V A;  2EBP A;  2JUF A;  1WHG A;  4ORZ A;  2BZ8 A;  1X27 A;  5A2Q E;  1X2K A;  4JRQ A;  1OZ2 A;  4OVA A;  2E5K A;  4MML A;  2OTJ T;  4RG8 A;  2CRE A;  2ZAE A;  1K8A U;  2F2W A;  4FYV B;  2MAM A;  3VYG A;  3G4S Q;  2M51 A;  1OV3 A;  1VQK A;  4AT1 B;  3TU4 K;  4M7D E;  2P84 A;  1BCM A;  1B34 A;  2DER A;  3HL8 A;  3M0P A;  2KAF A;  4JLI A;  2PNI A;  5KCO A;  2M16 A;  1OX8 A;  1FYN A;  3A8O B;  3E9G A;  3J80 E;  2E10 A;  1YWO A;  4OMF B;  3RKW A;  1M2O A;  1ZQ1 A;  5GMK e;  5GAN g;  3SB2 A;  5DLO A;  2ZPE B;  4PJO D;  1VQN T;  3FRN A;  3CPF A;  1WHM A;  1XQH A;  5DLQ E;  1WPY A;  4LE9 A;  1G3Y A;  1C1A A;  3GNG A;  2H3J A;  2P0K A;  1YHQ A;  2HQE A;  1N8R C;  4OB2 B;  4K11 A;  3UA6 A;  1A0N B;  1TXQ A;  2FZG B;  1H64 1;  1D0Y A;  2BZX A;  2CZ1 B;  2J6O A;  4M77 E;  2OTL T;  4ESR A;  1BK2 A;  3HRU A;  3OYE A;  3CME Q;  2OTL Q;  2DBM A;  4IIO A;  5LJ5 f;  1VQO Q;  1QKW A;  2E3H A;  3R6O A;  4BB7 A;  2DNU A;  3M0U A;  3PT9 A;  3VKI A;  4XQ3 A;  3G7Z A;  2DZ9 A;  5FRO A;  1RAC B;  2XI9 A;  3IQL A;  2AKL A;  3BY7 A;  2CZ0 B;  4RCB A;  4BI4 A;  4HVU A;  3OYA A;  3I55 T;  1GCQ A;  4XTU A;  1RAB B;  5CKD A;  2LJ1 A;  5L23 A;  5HY6 A;  2XU8 A;  3I55 Q;  3OYL A;  5IHK A;  3QYH B;  1EFN A;  3M54 A;  1JU5 C;  4DA4 A;  3JCM W;  2YUO A;  4M75 A;  2EW3 A;  4PJO E;  5D6W A;  4F04 B;  1N8R R;  1OX9 A;  1MUZ A;  4OMQ A;  3L2Z A;  3M9Q A;  3L2V A;  8AT1 B;  2X51 A;  1VQM A;  2RI2 A;  3J81 E;  1RAF B;  3FEO A;  1PD0 A;  3TRE A;  4M7D F;  1TOV A;  2DL3 A;  2O4X A;  1PKT A;  2M0Y A;  3QII A;  4XTZ A;  1ZBX A;  2DAQ A;  3INZ A;  2QQB A;  1WA7 A;  4WTO B;  5CAI A;  2XIC A;  2KRN A;  1MNE A;  3EGU A;  9ATC B;  4CC3 A;  1UGP B;  2HKN A;  4C0D C;  2IVW A;  1BKB A;  3GIB A;  5J3B A;  5A0D A;  5D6X A;  3OS1 A;  1IHW A;  2OAW A;  3KFV A;  1YIT T;  1VQL T;  3S6W A;  2O01 E;  2COW A;  3G4S A;  1PRL C;  1TG0 A;  2KY9 A;  2YRD A;  1BIA A;  3OBY A;  1VQL Q;  1B7T A;  2VVK A;  3RMS A;  4Y91 A;  4OMN A;  4F7U G;  4PLI A;  1OUL A;  3CBO A;  4X9D A;  1WHK A;  2RMO A;  3OYC A;  2VKN A;  5KE2 A;  4GLK A;  2MCN A;  3CMA T;  4J9E A;  4M4Z A;  3P8B B;  2PZ1 A;  1RAI B;  2ATC B;  2YDL A;  1X6G A;  2ROT A;  5GAM e;  3EGD A;  3CCJ T;  3CMA Q;  4JUV A;  1S72 Q;  2V1Q A;  1CKB A;  3LYI A;  3PVQ A;  4DEX A;  1BI2 A;  1SEM A;  3CCJ Q;  2RJF A;  2GGR A;  2YUQ A;  2DL7 A;  3I5S A;  1PG5 B;  3CCR A;  4J6W A;  5C6S A;  4EMH A;  1KSW A;  2F1L A;  1WJQ A;  1U3O A;  3C0C A;  1NPP A;  3AT1 B;  2QA4 T;  3CME A;  1VQO A;  1VYT A;  3I9Q A;  5CKE A;  2VGM A;  3L2Q A;  2QA4 Q;  4IUQ A;  5KYW B;  3H8Z A;  3OB9 A;  3C4S A;  3THK A;  1WQ7 A;  2R5A A;  4F16 A;  5FWC A;  5CQX A;  3QJY A;  4QVC A;  2EWN A;  4ELZ C;  3CC2 Q;  1FWZ A;  1WDX A;  2CH4 A;  1CSK A;  2EJF A;  3CCS Q;  2BTT A;  1PWT A;  4OB3 B;  1YI2 T;  2RB6 A;  2EGE A;  5GAN 7;  2R57 A;  2L8D A;  1OYX A;  3NGP A;  4E7S A;  3OYK A;  4QQ6 A;  4HVW A;  1E7O A;  1OZ3 A;  2J6F A;  1GBQ A;  1YI2 Q;  5FWB A;  1PM3 A;  4IUV A;  2DLP A;  4GY5 A;  1Q86 C;  3CCV T;  1M30 A;  5IXB A;  5GAN 5;  3FDR A;  3TSW A;  2DIQ A;  4MDW A;  3VS5 A;  4JS4 A;  1GRI A;  4DBF A;  1RLP C;  3V8J A;  1VQ8 Q;  4J8O A;  4J9G A;  1BIB A;  3LGF A;  2CZ6 B;  1VQ4 T;  3NFC A;  3NHN A;  4C5E A;  1K1Z A;  1LVK A;  2HSP A;  2M02 A;  2DL5 A;  2YRV A;  1VQ4 Q;  4ATO A;  2E6Z A;  4BE2 A;  3FJP A;  4IUU A;  3QUI A;  2OX7 A;  1W2B A;  4JZ4 A;  2MK5 A;  4ZNX A;  4Z89 A;  2KRO A;  1D3B B;  2RNA A;  3OA6 A;  4OMO A;  1FMK A;  4F7U E;  1VOM A;  3HFO A; 
#chains in the Genus database with same CATH homology
 3JCM f;  4HA8 A;  3OY9 A;  4XTY A;  3G4S T;  4EMG A;  2QEX T;  4KBM B;  2PVG B;  5GAO q;  4LDY A;  2F5T X;  4KUI A;  4MZP A;  5GAO l;  2GCX A;  2E12 A;  2EJ9 A;  2YLC A;  4C92 E;  4HCB A;  2DD5 A;  5FU7 B;  2GFU A;  4OP0 A;  3S3O A;  5GAM d;  4M75 C;  1PSE A;  3L2U A;  2LTO A;  5FRM A;  1VQL A;  4M75 G;  3GNF B;  1M1F A;  2ZPB B;  3WVE B;  5GAN 6;  3VJP A;  4M77 F;  4EMK B;  4M78 A;  4BE1 A;  4E7L A;  4C8Q D;  1XNI A;  3MET A;  4PLL A;  4XK8 E;  2EAY A;  3PIO A;  3JB9 D;  1O75 A;  3JCM c;  4M7D C;  1R8O B;  1U8R A;  2BUD A;  2VGN A;  2X4Y A;  4M78 F;  3TEE A;  2L3R A;  3ME9 A;  1VQ9 T;  4XU2 A;  2K57 A;  2K5I A;  5A0L A;  4M77 B;  1I8F A;  2FB7 A;  2EYQ A;  3M53 A;  4NOY A;  4L6V 5;  5GAN j;  5I21 A;  1M4Z A;  1VQN A;  3HFN A;  3UWN A;  4C5G A;  2E6N A;  2DJZ A;  3LLR A;  4XTX A;  4OB0 B;  2QXF A;  5GAN 8;  1Y71 A;  2CGH A;  4WF2 A;  3P8H A;  2VC8 A;  3V7C A;  1NE8 A;  3LW5 E;  3MEW A;  3ZEH A;  1GXI E;  4ZN1 A;  4PNO A;  5GAN 3;  1S72 A;  3HPW A;  2RJE A;  3OW2 S;  4HCC A;  1QVF S;  3LH0 A;  2RHI A;  4XTV A;  3CPW A;  1MGQ A;  4NL2 A;  1VQ7 T;  2BIV A;  1NPR A;  1M1G A;  5FLX E;  3CCM A;  2EIF A;  2DXC A;  2OAU A;  2QQ9 A;  3CCJ A;  2QDY B;  4CRI A;  3CCR T;  2RO0 A;  1Q86 U;  5FU7 C;  3I56 T;  3PIP A;  3SWN C;  1NJI U;  5GAN 2;  3N5B B;  1KQS A;  1U1S A;  1LJO A;  3CC7 A;  2OTL A;  1QP3 A;  2Y90 A;  3G71 A;  2V8I A;  4FT4 A;  4N4H A;  4TVR A;  3CME T;  4EMK C;  3KUF A;  4M7A G;  3OYI A;  2CS7 A;  3GP8 A;  1VQO T;  1XTD A;  3ZFJ A;  2CZ7 B;  5L8R E;  5LJ5 d;  1Y96 A;  1X75 C;  2CKK A;  3MEA A;  5CO7 A;  2DO3 A;  4PJO F;  3RES A;  4A4F A;  2K3Y A;  1DJ7 B;  3JCM P;  1WQW A;  1I5L A;  3QSU A;  1N6A A;  3S3M A;  3X20 B;  4C92 D;  4M77 C;  2MWP A;  4ME7 A;  2QA4 A;  1W2B S;  1VQ6 A;  4M7D D;  2E5Q A;  4M77 G;  3NTH A;  1YJ9 T;  2MWO A;  4C5I A;  1KQ2 A;  3L2W A;  4E7H A;  2XKO C;  4X9C A;  4XU3 A;  1KD1 U;  3RUX A;  1NZ9 A;  3MO8 A;  2QI2 A;  3QZ9 B;  3RIR A;  5LJ3 e;  4PJO B;  3I55 A;  1LNX A;  3HRT A;  3VUZ A;  3OYH A;  5IN1 A;  2RK2 A;  3CC2 A;  2PUO B;  4M78 G;  3L1A A;  4OF1 A;  3ZBD A;  5GAN d;  5GAO r;  2XDB A;  2D9T A;  2D0Q B;  4XTW A;  3C95 A;  3VV0 A;  2DIG A;  5GAN f;  2WSC E;  4J6X A;  3CCS A;  4QQG A;  4ZTJ A;  3M4G A;  3OYB A;  1NJI C;  2I2L A;  4Z02 A;  5GAM j;  2RA2 A;  4Q5W A;  4A54 A;  4C8Q E;  4IUP A;  4LDU A;  4J7F A;  2VV5 A;  3OYJ A;  3A5Z B;  2XDD A;  1FXX A;  2CYZ B;  1N9R A;  2X35 A;  4VUB A;  4BUG A;  4D6W A;  5A0G A;  1TH7 A;  3MHX A;  1QW1 A;  4IKF A;  4F7U A;  1RI0 A;  2DXU A;  1HXD A;  2EFI A;  2PQW A;  3DLL A;  4RG2 A;  1KC8 C;  2FYK A;  4BI3 A;  3V7R A;  4M75 B;  2M0O A;  2EKO A;  1V29 B;  2RK1 A;  4LD9 K;  2WAC A;  1ZHI A;  3ASK A;  1X6O A;  4FSX A;  3GLX A;  4A4G A;  1UGR B;  2A3L A;  3PFS A;  4QQD A;  3EAE A;  4B9X A;  4BD3 A;  3CXC A;  3CC4 T;  1Y07 A;  3E19 A;  3NTI A;  3NTK A;  1VQ8 A;  3DB4 A;  3CCE T;  4B9W A;  4C92 A;  4RMO A;  3O8V A;  4BI8 B;  1VUB A;  3VYH B;  2JUF A;  5LJ3 h;  4PJO C;  5A2Q E;  3RKX A;  4JRQ A;  1OZ2 A;  3QZ5 B;  4OVA A;  2R5M A;  3JCM X;  2O4X B;  2K4Y A;  4HT8 A;  3T9N A;  5CKH A;  4MML A;  1G3W A;  3EFR A;  2OTJ T;  4RG8 A;  3PGG A;  2MF2 A;  4FIB A;  3C94 A;  4M75 E;  3JB9 G;  2EQK A;  3LWH A;  3URG A;  4C5H A;  3HP9 A;  2R58 A;  4M7A F;  2NLU A;  3CD6 T;  3A8L B;  1K8A U;  3M58 A;  3SD4 A;  2MAM A;  3VUB A;  3CCM T;  2Y4X A;  2V8K A;  3VYG A;  4HCZ A;  4E7I A;  1KQ1 A;  1VQK A;  4XU1 A;  3SWN B;  3QYG B;  3F70 A;  5LJ5 j;  4M7D E;  4IUT A;  3TU4 K;  3QXE B;  1YIT A;  3CEY A;  1B34 A;  2RI5 A;  3M59 A;  4J83 A;  4M7A B;  5GAM f;  3HL8 A;  1N8R U;  2L5Q A;  4N0A C;  2KAF A;  3BW1 A;  4JLI A;  2LX9 A;  2X4W A;  5KCO A;  2M16 A;  2P0Q A;  4FL6 A;  3A8O B;  3E9G A;  3G6E A;  3J80 E;  4JS5 A;  3OYD A;  2E10 A;  4OMF B;  2HBP A;  3RKW A;  1ZQ1 A;  1BYM A;  3KXT A;  3OYY A;  5GMK e;  5GAN g;  2LDM A;  3CCU A;  2E65 A;  2A7Y A;  3SB2 A;  5GMK l;  5DLO A;  3UT1 A;  1KHI A;  2E41 A;  2ZGW A;  1EIF A;  2ZPE B;  4LDX A;  4KUL A;  2JZ2 A;  3GPL A;  3UPU A;  4PJO D;  4ZN3 A;  3JCM e;  1VQN T;  3FRN A;  1AHJ B;  3OYG A;  5KH6 A;  3J7A F;  2KDS A;  1K9M C;  3A8M B;  2E70 A;  2AHJ B;  2G3R A;  3CPF A;  4M78 B;  3CMA A;  3OBW A;  3V8L A;  1XQH A;  1K8A C;  3JCM J;  3OS2 A;  5DLQ E;  1M9S A;  1WPY A;  1S72 T;  4A4E A;  1G3Y A;  4FM4 B;  1YJW A;  3RER A;  3GF5 A;  4HKE A;  3GOX A;  4HT9 A;  1BI1 A;  1UB4 A;  2DXB A;  2H3J A;  2HQX A;  2P0K A;  2JN0 A;  2ZPH B;  3GNG A;  2XHC A;  4J6Y A;  1YHQ A;  3JCM V;  2HQE A;  4M7A C;  1N8R C;  4OB2 B;  4Y28 E;  1K73 C;  4E47 A;  1H64 1;  2JVV A;  4M77 E;  2CZ1 B;  2OTL T;  1OI1 A;  1HK9 A;  3MEU A;  4M75 D;  5LJ3 d;  1VIE A;  3QG1 A;  3CCL A;  3HRU A;  4DOV A;  2E1H A;  1KC8 U;  3OYE A;  3HSB A;  4C8Q A;  2RJD A;  4O6J A;  5LJ5 f;  2QQR A;  5GMK h;  4M78 E;  4O5V A;  4C0F A;  4MZT A;  3R6O A;  1M1K C;  2XDP A;  5D6Y A;  4BB7 A;  3JCM g;  2YLB A;  3JB9 F;  4L59 A;  4E7K A;  2GQV A;  2ZPF B;  4CI0 C;  1VQP A;  3PT9 A;  1VQ6 T;  3VKI A;  3QDR B;  4XQ3 A;  3RMQ A;  3G7Z A;  2DZ9 A;  3PTA A;  2D6F A;  5FRO A;  2XI9 A;  3JB9 I;  1JRI A;  3BY7 A;  1SSF A;  2CZ0 B;  3DKM A;  4M78 C;  4A4H A;  4RCB A;  1RL2 A;  5I2M A;  2IG0 A;  3WXM B;  4BI4 A;  1YBY A;  3OYA A;  3JCM Q;  3I55 T;  3S3N A;  2X4J A;  1N27 A;  4XTU A;  1Y96 B;  4YTL A;  3WVD B;  5GAO m;  4QVD A;  3CC2 T;  5CKD A;  4BE0 A;  3JRZ A;  4OB1 B;  5HY6 A;  2DPP B;  2MI6 A;  5GAM g;  2XU8 A;  1QVG A;  5FU6 B;  3QO3 A;  1N9S A;  3M56 A;  4P5N A;  3OYL A;  4ZTF A;  4A53 A;  3CCS T;  2LQ8 A;  2RHX A;  1M90 U;  3MCA B;  3QYH B;  3M54 A;  4C0D B;  1YI2 A;  2EJG A;  1BI0 A;  4DA4 A;  4LDV A;  3JCM W;  3LWI A;  1KHC A;  2DZC A;  1G5V A;  2K3X A;  4M75 A;  4M7A D;  1WJR A;  2PU9 B;  4PJO E;  2LQK A;  4PL6 A;  5D6W A;  4F7U F;  3CCV A;  1YIJ A;  4JJN K;  4PKC C;  3M4Y A;  2VXE A;  3L2Z A;  1QVF A;  5GMK i;  3ER0 A;  4QW2 A;  3MP1 A;  3M9Q A;  1O9S A;  3A8H B;  3E1S A;  1VQ8 T;  4BDZ A;  3L2V A;  1Q81 C;  3FC3 A;  4M7D A;  1WGS A;  4R56 A;  2WSF E;  2P0P A;  5CR2 A;  3JAM E;  4M77 D;  1I81 A;  5HKC A;  3CCQ A;  4E7J A;  2KMT A;  3FIF A;  4C92 F;  1VQM A;  2RI2 A;  1VQ4 A;  3J81 E;  1D3B A;  4JDS A;  3FEO A;  3TRE A;  5GAN e;  2RH2 A;  3M55 A;  1Q7Y U;  4M7D F;  2O4X A;  1YJN A;  5DY9 A;  3SFM A;  3HKS A;  3QII A;  4NS5 A;  1IZ6 A;  4XTZ A;  4M78 D;  4C8Q G;  3CPW S;  1ZBX A;  2DAQ A;  3INZ A;  4JRP A;  2QQB A;  5FU6 C;  3OSS C;  5KCH A;  3AHU A;  1K9M U;  1M90 C;  2KVQ G;  5CAI A;  2XIC A;  2YHT A;  2HD0 A;  2ZPI B;  2JTF A;  4C92 B;  1UGP B;  4C0D C;  1XOV A;  1KQS S;  2IVW A;  3OMC A;  1BKB A;  2VYT A;  3OS5 A;  3GIB A;  5LJ5 g;  5LJ3 j;  3JSC A;  5J3B A;  4JRK A;  3JCM b;  5C0M A;  4RCC A;  3SWN A;  1JJ2 A;  3SDZ A;  4C0Z A;  4ZGD B;  5A0D A;  5LL6 S;  5D6X A;  5I2S A;  2DD4 A;  3OS1 A;  2ZCF B;  2BKD N;  2QQS A;  1VIF A;  4RKU E;  3QBY A;  5M9O A;  3L42 A;  3BDL A;  1YIT T;  2LCL A;  1VQ5 A;  1VQL T;  1K73 U;  3FB9 A;  3S6W A;  3TCJ A;  3VU3 C;  3OQ5 A;  2O01 E;  4MZM A;  4EMK A;  3G4S A;  3OMG A;  4OGE A;  2QEX A;  3L2R A;  2KY9 A;  4DOW A;  2K5F A;  4BDY A;  2XD0 A;  5HK3 A;  2DTO A;  2JTM A;  1BIA A;  1W4S A;  3OBY A;  3QKJ A;  3M57 A;  2VUB A;  4R55 A;  5GAO n;  2DEQ A;  3E9F A;  3V8K A;  1P92 A;  3LGL A;  4FT2 A;  3RMS A;  4A4K A;  3G6E T;  2LNV A;  4MDX A;  2VXF A;  4Y91 A;  1Q7Y C;  4M77 A;  2DTI A;  5GAN h;  3EFS A;  2L89 A;  1M1K U;  4F7U G;  3CCU T;  4J5Y A;  4PLI A;  1U1T A;  2E64 A;  1B34 B;  5CQY A;  3CBO A;  4X9D A;  5IAY A;  3JB9 J;  2LRQ A;  2FHD A;  1M8V A;  3HRS A;  3M5A A;  2JNG A;  3OYC A;  1WNL A;  1X01 A;  3QJ6 A;  4JRI A;  3X25 B;  5KE2 A;  4C92 C;  4GLK A;  5GAO p;  1QVG S;  4C0G A;  4M7A E;  3CMA T;  3Q1J A;  1VQ9 A;  4C92 G;  3P8B B;  1Q82 U;  2X4X A;  4XAX B;  2B8A A;  4ZGE B;  1BI3 A;  5KE3 A;  4M7D G;  2RHY A;  4N4G A;  5GAM e;  2LC4 A;  3QPH A;  3CCJ T;  1YJW T;  3A8G B;  4JUV A;  1QP2 A;  3BFM A;  2KQW A;  3PNW C;  3LYI A;  1BI2 A;  3CC7 T;  3OYN A;  1YHQ T;  2EQU A;  3G71 T;  1G3T A;  2RJF A;  4FU6 A;  3PMT A;  5CCA A;  3CXC S;  5CKB A;  1G3S A;  4N4I A;  1VQ7 A;  2LT4 A;  5LJ3 f;  4J7I A;  3CBP A;  3CCR A;  1Y7X A;  4J6W A;  3CCL T;  5C6S A;  3KBG A;  3I56 A;  1MHN A;  4MMK A;  2PVO B;  2QQA A;  4X34 A;  4EMH A;  1WJS A;  1WJQ A;  4EPC A;  4C8Q F;  5HK0 A;  4BY6 B;  2KSS A;  1NPP A;  4L5G A;  2FL7 A;  2QA4 T;  4BAC A;  3JCM h;  3CME A;  1Q81 U;  5CVI A;  1YCY A;  5FRN A;  5CK9 A;  1JB0 E;  1VQO A;  1KG1 A;  3LX7 A;  4PJO A;  2RD1 A;  1IRE B;  3H6Z A;  5J26 A;  5CKE A;  2VGM A;  3L2Q A;  4NL3 A;  1VQP T;  3QHS A;  4IUQ A;  3H8Z A;  3OB9 A;  2JOY A;  3C4S A;  4C8Q B;  1Q82 C;  1WQ7 A;  2R5A A;  1FX7 A;  3OS0 A;  1PSF A;  2EQM A;  5CQX A;  5GMK j;  3QJY A;  4QVC A;  5DM7 R;  5AYF A;  2EWN A;  2DVE A;  2LT1 A;  4ELZ C;  4ZGJ B;  2KK4 A;  1YJ9 A;  2HAX A;  3DLM A;  2C06 A;  2MMP A;  1FWZ A;  1QVP A;  1JJ2 S;  4LDW A;  3V7S A;  2RHU A;  5J39 A;  3OSV A;  3JB9 H;  3X28 B;  1H3Z A;  2EJF A;  2DK3 A;  1JBM A;  2XG8 D;  3HHT B;  4OB3 B;  1YI2 T;  2RB6 A;  2PVD B;  5LJ5 e;  4DQ2 A;  5GAN 7;  2R57 A;  2L8D A;  2LVM A;  1OYX A;  3OYK A;  2XID A;  3X26 B;  4QQ6 A;  3X24 B;  2ZPG B;  1I4K 1;  2PUK B;  4KUD K;  1OZ3 A;  4IUV A;  5GAM h;  5GAN 4;  4GY5 A;  4JLG A;  1Q86 C;  4M75 F;  5GMK m;  1LOJ A;  4N0A A;  3CCV T;  3OW2 A;  1YIJ T;  4BY6 C;  2DKG A;  5CKF A;  5EG2 A;  3FLG A;  1M5Q 1;  3BDU A;  5CIU A;  5GAN 5;  3FDR A;  2HNI A;  2EQJ A;  2DIQ A;  2P4T A;  4MDW A;  4EDU A;  2WSE E;  4JS4 A;  3OYM A;  2ZZD A;  2XK0 A;  3V8J A;  4IUR A;  2K5L A;  2K2V A;  4V2S A;  3RKY A;  4F7U B;  3MP8 A;  4J8O A;  2F5K A;  1BIB A;  3LGF A;  3CCQ T;  2GFA A;  1VQM T;  2CZ6 B;  4C8Q C;  1VQ4 T;  1UEB A;  3P8D A;  1UGQ B;  3NFC A;  3CC4 A;  2F69 A;  2Y4Y A;  4ELY C;  4C5E A;  1YJN T;  4OGC A;  3CCE A;  3MEV A;  2M9U A;  3CBM A;  2DXT A;  2YRV A;  2LCC A;  4II1 A;  4ATO A;  4QVZ A;  2E6Z A;  2M1H A;  4LD6 A;  4BE2 A;  5IT9 E;  3FJP A;  4IUU A;  4XU0 A;  1KD1 C;  5LJ3 g;  4M7D B;  2DTH A;  3QUI A;  1W2B A;  2GF7 A;  4UC4 A;  2V8J A;  5LJ5 h;  2RI3 A;  4PJO G;  2OTJ A;  1D3B B;  2QTX A;  3C12 A;  3OYF A;  4KT0 E;  3MP6 A;  1UGS B;  3UDC A;  1VQK T;  3PMI A;  3OA6 A;  3DB3 A;  4M7A A;  4F7U E;  3JCM d;  2FVU A;  2RJC A;  3CD6 A;  2RHZ A;  3HFO A;  2RM4 A;  1VQ5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...