5HK3A

Crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
b'VISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNDALAAMPGNVDLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF6
publication title Crystal structure of M. tuberculosis MazF-mt3 T52D-F62D mutant in complex with DNA
rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Hydrolase/dna
total genus 27
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2016-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5hk3A00
5CCAA 5CK9A 2VUBA 5DLOA 5CKFA 3TCJA 5CQXA 5CKBA 3G7ZA 4ELZC 4ELYC 5CKEA 1UB4A 1X75C 4MZTA 4MZMA 5CQYA 5HK0A 5HK3A 5HKCA 3JSCA 4VUBA 4OF1A 4ME7A 2MF2A 1NE8A 5CKDA 3JRZA 4HKEA 3VUBA 4MZPA 1VUBA 2KMTA 3NFCA 5CKHA 1M1FA 4MDXA 5CO7A 2C06A 5CR2A 3HPWA
chains in the Genus database with same CATH superfamily
4JZ4A 2ROLA 1HSQA 1T0HA 2JMAA 2LNVA 1X6OA 4WF2A 2A08A 3C4SA 1M8VA 4BB7A 2CSIA 2K2MA 2E5KA 2Y4YA 1FMVA 1GCQA 1YIJT 1RAFB 3M0RA 1NZ9A 1D3BA 3G1JA 1FMKA 3VS1A 5I2SA 1UDLA 3VUBA 4GLMA 1F1BB 2HAXA 4JRQA 4M78F 1M5Q1 1Z9ZA 1GXIE 4HCKA 1BU1A 2HEQA 4AFUC 5CR2A 3M0SA 1S72T 4L6V5 1QWFA 3FDRA 1H3ZA 1BI1A 4PL6A 3HRTA 1TWBA 2ZGWA 2C0TA 2EQUA 4MZMA 2LX7A 3RESA 2HBWA 1JXOA 4FSXA 1K9MU 2W0ZA 1VQMT 2E64A 2FPDA 3FB9A 2D0NA 3SWNB 4J9EA 2FRWA 2EYYA 1I5OB 2ZPBB 2CYZB 2LP5A 4M7DE 3OYJA 4LD9K 5GAOp 2RN8A 2O4XB 1YITA 4RTZA 2XG8D 1U1TA 2AK5A 5AT1B 5HK0A 4ESRA 3G4SA 3BDLA 2HMAA 1D0YA 4X9CA 5EC7A 1WXUA 1TUGB 3SD4A 2RD1A 1ZHIA 3HFOA 2K5LA 2LCCA 3P8HA 1X6BA 5CK9A 1X01A 2QQSA 3T9NA 1WQWA 3EFRA 1YJWQ 2BKDN 1Z9QA 1YJ9A 1LCKA 4M7DB 4XTYA 4KULA 2RHZA 2YHTA 3ASKA 2Z0WA 2E70A 4E47A 3HSBA 4HVVA 4A63B 3SHWA 4KUDK 3CCVA 1WHJA 2DTOA 2E10A 1SG5A 3NTIA 5CKHA 2QEXQ 3LH0A 3M55A 3TEEA 3M5AA 5FRNA 4JS4A 3KUFA 3RBBB 1PG5B 2D6FA 3I5SA 4LNPA 3CPWA 2LQKA 3OSSC 4C8QE 4HCBA 2KT1A 2DA9A 2NUPA 2PZ1A 3PE0A 1W2BP 3LWHA 2A3LA 3EHRA 3SDZA 4ZN1A 2L2PA 1X69A 2DEQA 4XQ3A 5FWBA 1QVGA 4DBRA 4JLIA 1M2VA 2JM8A 3OS1A 1NYGA 3QSUA 1JJ2S 1PKTA 4GBQA 4JLGA 3H0HA 4C5GA 1DJ7B 2PQWA 1NYFA 3URGA 2LQ8A 3CMAT 2PNIA 1VQ5T 1FWZA 1WLPB 4CC7A 4QQGA 2COYA 1W4SA 4HKEA 3X28B 2HQEA 5D7UA 2CGHA 3EGXA 1M1FA 2CH4A 4MDXA 2DTIA 2O9SA 2JTEA 2BIVA 5CO7A 4PJNA 4OB3B 4QVDA 1VOMA 5LJ3h 3OMGA 1VQOA 5GAOr 3OYNA 2JNGA 2J7IA 1SPKA 1ZLMA 2O31A 2DL7A 3CCEQ 3DB4A 1R0BG 2HKQB 1IZ6A 1FYNA 1YBYA 2EYQA 2JOYA 4IUUA 2DK3A 3VKIA 3OYYA 2COWA 2EQIA 4BI8B 3ZL7C 2YUPA 3OY9A 1VUBA 2HL5C 1KQ2A 4RTVA 2DX1A 2EYZA 5KYYA 5FU7B 1VQ6Q 2JTMA 3RIRA 4F17A 1PWTA 1WZOA 3PVLA 4XK8E 3Q1JA 3GIBA 4BDZA 2H3EB 1M3CA 2RPNA 2XU8A 4HVUA 2LZ6B 1VQNQ 4C92A 4F7UF 2ATCB 4A4GA 3QKJA 1ZA1B 1S1NA 1PHTA 3OBYA 1RAIB 1FMWA 3PT9A 4A4HA 2DERA 4D8DA 3OW2A 2MWPA 1Q95G 2D1XA 4HCCA 3ZBDA 2JTFA 2X4JA 2RQWA 2RJCA 2HNIA 4DA4A 1GCQC 1YWPA 5GAOm 3JB9H 2KMTA 4M4ZA 2BTTA 4FU6A 2VWFA 3RMQA 3C95A 1S72Q 1SKUB 2J05A 2RHYA 2YT6A 2VVKA 1X43A 2GTJA 5GAOq 3OYEA 5CKEA 4KBMB 1IGQA 2DL4A 4UC4A 3M9QA 3I56T 2RQUA 1VQMQ 2FYKA 2RJFA 3EG0A 3CCJT 4E7JA 1IXDA 1ZSZA 1YP5A 2QASA 2WACA 5KH6A 2JJ9A 1YJWA 3N5BB 5KYUA 3J80E 3CCMT 4PJOC 4OF1A 3I55T 2P84A 2K5IA 2EGEA 1UJ0A 6AT1B 1AWXA 4LDVA 1R0CB 3UDCA 2EKOA 2QEXA 5KCOA 1XTDA 2KRMA 3GP8A 4Z89A 4RCCA 4LXCA 1ARKA 1BBZA 1T0JA 4RKUE 2GCXA 4IUVA 2XICA 3UA7A 3EAEA 3G71T 1J3TA 3THKA 2DBKA 4EMKA 1BCOA 1UECA 4LUDA 4MZPA 3FEOA 4ZN3A 3TVTA 2XDBA 1JB0E 1QWEA 2H8HA 2GFAA 1K76A 3LGLA 2RK1A 3KFVA 1VIEA 4QT7A 3MO8A 4PKCC 3EG9B 1B3QA 5DM7R 2WSFE 4M7AD 2DAQA 2K2VA 2RI3A 1H8KA 2DXCA 2FO0A 5J26A 2GNCA 3RNJA 1VQLT 4C92E 2LMJA 2BE7D 1Y96A 1Q82C 3PMTA 4PJOF 1NPPA 1G8XA 3CMAQ 3EH2A 3CCEA 1VQ5Q 2X3XD 4MZTA 2DBMA 2VXFA 1VYTA 2DXTA 5I22A 4OGEA 4C0GA 1WXTA 1X27A 1ZUKA 2X4WA 2CP6A 2VGMA 3H9NA 3QJ6A 1ZBXA 4M7AG 4PJJA 3HPWA 4B9XA 1VQ6A 2ZPEB 1K4US 1JU5C 2EIFA 2P0KA 1M1KR 2VC8A 3JCMV 5C6SA 4P5NA 2HQXA 1VQNA 4M77B 4ME7A 1N8RR 4FW2A 3EH1A 5CIUA 1KC8R 1O75A 4DQ2A 2A37A 4M7AF 3CXCP 4WTOB 1WJQA 3S6WA 4II1A 1OPLA 2ZPHB 4HT9A 2QAZA 2YXYA 8AT1B 3ZEHA 4AG2C 3D7SB 2LC4A 3H0IA 2Y90A 1RADB 1NEGA 1WX6A 4M75D 1JRIA 5LJ3e 3QXEB 3TREA 3RERA 2LX9A 4GLKA 1S72A 2ZCFB 3HRSA 3M0TA 3FJ5A 2X35A 3A8LB 1ZSGA 2WSEE 4ZNXA 1UUEA 1KQ1A 4DBQA 4Z02A 2DETA 1Q82R 3MPUB 2R57A 3E1SA 1VQMA 1Y7XA 4BE1A 4M78E 1M8MA 2F5KA 3X26B 2L89A 3GLXA 3LLRA 2QEXT 1N9RA 3X25B 1TUDA 4OMQA 4M75G 3EGDB 2CP5A 3EFOB 2KE9A 4AFQC 2J6OA 3I56Q 1KG1A 5AYFA 2ED0A 3V7RA 3CCJQ 2QTXA 4EDUA 3MP1A 3JAME 1N5ZA 5GMKm 4FIBA 1ZSZC 2PU9B 4J9HA 1BK2A 1EIFA 1SF9A 1UHFA 4F7UA 5CAIA 3CC2T 3TU4K 3V7SA 5LJ3d 4M78B 2DPPB 2JVVA 5LJ3f 1G3TA 4D6WA 3M0PA 4M77G 3CCMQ 4XU2A 1M1KU 3I55Q 3SB2A 1HYOA 4YTLA 1PSFA 1H641 4PFZA 1CSKA 1N8RU 2ABLA 1KC8U 1WDXA 1QCNA 1BB9A 2GQVA 1HJDA 1NJIC 3CC4T 1WYXA 1MNEA 2RB6A 1YI2T 1U8RA 3CCET 3G71Q 2KQWA 2LJ3A 2RH2A 3JSCA 2LJ1A 3CMET 2AKKA 4NL2A 4EMKC 2GTOA 4LDXA 1PSEA 1I81A 1B34A 2YRVA 3VS3A 1AWOA 3NHNA 4OMFB 1U1SA 1RAHB 1M9SA 1TUCA 4RCBA 1VQ6T 4XU3A 3UATA 3CMAA 2L3QA 1VQ5A 3E2UA 1IRXA 1JO8A 2YDLA 4AFZC 1N9SA 4J9CA 1SSHA 4FYXB 3PFSA 2EKHA 3QZ5B 3MEUA 3CCST 1JJ2A 3RKXA 1WXBA 1TSFA 1TOVA 3JCMX 3UPUA 1VQLQ 3RKWA 2YUOA 1B7TA 4F14A 4FM4B 2KI7A 5GANh 3RUXA 4O6JA 2KYMA 1HD3A 5IT9E 1W6XA 2KAFA 3QWXX 4IUPA 1NE8A 2QK0A 4DEYA 1D1AA 2ESWA 3QYGB 2VKNA 1X2KA 1TTHB 2XIDA 4EPCA 3HL8A 5LJ3j 2RHIA 3A8MB 4J6WA 2ED1A 1I4K1 2W10A 1NJIR 2L3PA 5KYNA 2ZAEA 1FXXA 1OU9A 1YN8A 2OAUA 3MKDA 2DEUA 4AMCA 1VQ8T 4OMOA 1Q86U 3QDRB 4IIOA 3S3MA 2KRSA 2OI3A 5LJ3g 4C0ZA 3JB9D 4OGCA 2J06A 4F7UE 1BI0A 1ZX6A 3AT1B 1FX7A 3JCMd 3L2UA 2QGGA 4PJOA 2D0QB 1WQ7A 2F69A 1PRLC 2YRCA 1WPYA 5I11A 4L59A 1OI1A 5GJWB 1D09B 3J81E 1I5LA 3OYHA 1PNJA 5GAN8 3RMSA 4WCIA 1N6AA 2KROA 3RDVA 1V76A 2K3YA 2IVWA 2DM1A 3UA6A 2D8HA 5HKCA 3I56A 2DILA 2M1HA 2M9UA 3U23A 3L2ZA 2KXDA 1WHGA 1LJOA 3CCJA 3JB9J 3JB9G 2LT4A 3BDUA 3HFNA 5L23A 4E7ZA 4M7AA 1LNXA 1QVPA 1VYVA 1Q81C 3OS2A 4AFSC 4CC3A 1W2BS 2LCSA 3FLGA 3CCMA 1MV0B 2MYSA 3M53A 3I55A 3NTKA 5IHKA 2K4YA 2ZPGB 1C6VX 2MK5A 3QDFA 2QA4T 1WIEA 1MV3A 2IG0A 1XNIA 2V8KA 2EWNA 1WHHA 3CC2Q 3MEVA 1KHIA 2EJGA 3OYBA 1GCPA 4JRIA 2KVQG 3G6ET 2XHCA 4FT2A 5IAYA 1H3HA 4E2FB 1MHNA 1YJNT 4OP0A 2KEAA 3G71A 3I5RA 4C0FA 4BDYA 3CBMA 5DLQE 2CDTA 1K8AC 4C8QB 4M7DD 4JZ3A 5IXFA 3VS7A 3MJXA 3SEMA 2NWMA 5A0GA 4LDYA 3E9FA 3NPFA 3NTHA 3CC4Q 3QHSA 2RQTA 2JZ2A 4IUQA 4NL3A 1YI2Q 4OB0B 2RQVA 4HA8A 3VS0A 2DL5A 2O01E 5KYXA 1G3YA 1QCOA 4OB2B 3CMEQ 1KD1C 1OEBA 2RI2A 3H0FA 2LNHB 4NS5A 5FLXE 1RABB 4B9WA 5GMKe 1IHWA 3X24B 1VQLA 1CKAA 4M7DG 1A0NB 4CI0C 4N4IA 1UHCA 4O5VA 4BI4A 4MDWA 4M75A 1D3BB 2DKGA 3LYIA 3R6OA 2D9TA 3CCSQ 5KYWA 1Q81R 1UGSB 2OTLT 2B86A 1E6HA 1JEGA 1VQ9T 2L8DA 2RM4A 1AEYA 3GF5A 4L5GA 3VU3C 4C8QD 4KT0E 4PJOE 1PM3A 2YLBA 2LTOA 2AZVA 3MHXA 4K11A 1ABOA 2XDDA 3OS5A 2HL3A 4KGVB 3PNWC 4A4KA 4D8KA 4RMOA 1G83A 1KSWA 1UGPB 3M0UA 5FU7C 2FZGB 2K3BA 3QPHA 1BCMA 3CBOA 5CVIA 3BW1A 1PCXA 4Z88A 3M4YA 4C8QG 2QYZA 2ZZDA 3VYGA 2DIGA 1K0SA 2K7AA 4M7AE 3EG3A 3CQTA 4LDWA 1VQ8Q 4J9FA 1KD1R 1RI0A 1WFWA 1PKSA 2HQHA 4Y92A 4RTYA 1KQSS 4QVCA 1KQSP 2DXUA 3OMCA 5A0DA 2E12A 3V7CA 2M0YA 3O5ZA 4EMHA 5CKDA 5FU6B 3CPWP 1YCYA 3CCRT 1OZ2A 4FT4A 3JCMP 4E7LA 4Y91A 1WHKA 2E6ZA 1P92A 5CCAA 1QVGP 1B07A 2EQMA 4E7IA 2CZ0B 1QP2A 2RHXA 2DRMA 2LRQA 3L2VA 2XI9A 2NUPB 4XTVA 3LWIA 3GNGA 3OYFA 1PC0A 1OU8A 2EGCA 5A2QE 2JW4A 3JCMh 2KDSA 1M2VB 7AT1B 1I1JA 3VS2A 3FJPA 5GAN7 5A0LA 2EPDA 1AWWA 3QYHB 3CC2A 3BY7A 1VIFA 1QLYA 2MI6A 3QJYA 4PJMA 4M7AC 5KE2A 2AIRB 4EIKA 5GANd 4HT8A 4BY6C 2L5QA 1AHJB 3C0CA 1UTIA 3EGXB 2QA4Q 2RMOA 1BYMA 4QQ6A 4QVZA 1IB8A 3A1PA 4KUIA 2RQRA 2VUBA 2P4RA 4B6MA 3G6EQ 5GMKj 2RK2A 3CC4A 1OQKA 4F16A 3P8DA 1YI2A 1YJNQ 2MWOA 2WSCE 2PVDB 5C0MA 3CMEA 2ZPIB 2O9VA 2JXBA 3QO3A 1PD1A 4KRTA 2VV5A 1K9AA 2CP0A 2R58A 5KYYB 4CRIA 2L3RA 1KD1U 2NUTA 3OYGA 4KH1B 1X75C 1BKBA 4C92B 2EQJA 2FG0A 1JQQA 2K3XA 3OW2P 3V8KA 1M1GA 4CC4B 3A98A 2E1HA 1VQPT 3CCSA 2HSPA 2KK4A 3CXCS 5FRMA 2DTHA 1AZGB 4J9DA 2X9HA 2L3SA 2P0PA 3G7ZA 3JCMJ 1C0MA 3PTAA 4R56A 3OYAA 3VS5A 4M75C 3SFMA 2KBTA 2MF2A 5J3BA 2OTLQ 3CCQT 3GNFB 1VQ7T 4IIMA 1VQ9Q 4DOWA 2OTJQ 2V26A 3CCUT 3LW5E 1KHCA 1K9MC 4JJCA 2E3IA 1XJWB 2FZCB 1PRMC 2CZ1B 4PNOA 3M58A 4KGZB 1UJYA 3ME9A 3MP6A 1OYXA 3EGUA 2XMFA 5HK3A 5ECAA 1X2QA 1K73C 1G3SA 2C0OA 1N27A 4C92D 1YCSB 1ZSZB 3FC3A 3J7AF 2KGTA 2R5AA 1VQ8A 2DL8A 2F5TX 1R77A 3SWNA 4M77D 1RAGB 5CKFA 2DF6A 3O8VA 2JUFA 5LL6S 2MAMA 3OYMA 1MMDA 1VQKT 4JS5A 4BACA 2OAWA 4RTUA 5KYUB 1TXQA 2O4XA 1Y07A 1GFCA 1YHQT 3H41A 3OQ5A 1UGQB 4E6RA 3ER0A 2DYBA 1OV3A 5KCHA 2YLCA 2YUNA 5LJ5h 2EYWA 4J5YA 4XU1A 4JJDA 3WXMB 1YWOA 1CKBA 4OVAA 3L42A 1UGRB 2AHJB 4M75F 5D6YA 1MMAA 5CKBA 4C92G 3DB3A 3TQ7P 1U06A 2RNAA 2RO0A 4M7DA 1OX9A 2AZSA 4EMKB 3CCRQ 2CZ6B 2FZKB 4OMPA 1BIBA 4FCYA 4FYVB 2EW3A 2QG9B 1AT1B 4M77F 2DNUA 2VYTA 4C0DB 2QQBA 4GY5A 2DJZA 1NBEB 2E41A 2QA4A 4OMNA 4RTWA 2FB7A 2KRNA 2AKLA 1AD5A 1K73R 1Y96B 1RAAB 1TS9A 2YSQA 1W2BA 1BI2A 1MGQA 2V8JA 4ELYC 2CS7A 3G6EA 4PLIA 3PGGA 3QBYA 1V1CA 1LOJA 2DYIA 1EX4A 3CPFA 4QQDA 1K1ZA 1YJNA 1WHMA 4M78D 2EVRA 2DE0X 1RLPC 5EG2A 1Q82U 2COZA 2SEMA 1PD0A 2CSQA 3QUIA 1M4ZA 3A8OB 1TH7A 1Y0MA 4X34A 4RG8A 2LQWA 3A8HB 1TU0B 2DO3A 2J6FA 1M3AA 3PIPA 3EHQA 2DZ9A 4CC2A 3JCMe 4HCZA 1RLQC 4JDSA 2MCNA 3FRNA 1LVKA 4NOYA 2DL3A 4N0AA 2LDMA 4QKUA 1HK9A 4M78G 2C06A 3CCLT 2A36A 2DD5A 2HDAA 1E7OA 4ELZC 5IHIA 3RR6A 2DD4A 2MOXA 2KNBB 3TSWA 3GPLA 1D0ZA 3M54A 4MMLA 2VXEA 2QDLA 1KFZA 1VQPQ 1TG0A 3A8GB 3DLLA 4BI3A 1X6GA 2CUBA 3BFMA 4RTXA 3KBGA 2OTLA 1ZBJA 2J6KA 2CT3A 3NGPA 2FRYA 1VQ9A 1KK7A 3L1AA 4X9DA 1U3OA 2M0OA 2OTJA 1M30A 4E7HA 2CP3A 4R55A 3V8LA 2PTKA 1UG1A 1QW1A 1NM7A 3LGFA 1NLPC 2GF7A 3M59A 5HCKA 3CCQQ 1VQ7Q 3JCMf 2M02A 3HRUA 4BE2A 3CCUQ 5GAN5 1AZEA 1SEMA 2E65A 4KGXB 1K73U 2F2XA 4JRPA 4C5IA 4TVRA 4Z8AA 3QZ9B 3CD6T 1W1FA 4J6YA 4XU0A 3LX7A 2KYBA 1RUWA 1VA7A 2IIMA 3E19A 3JRZA 2ROTA 4F7UB 2ENMA 2FL7A 1G2BA 2K6DA 2HCKA 1QVFS 3H8ZA 3JCMc 2DLPA 3SWNC 1IREB 3WVEB 1JBMA 1QVFP 2G6FX 1UE9A 3REBB 5DLOA 1VQKQ 5GMKi 2CP7A 5DY9A 2YRDA 4AT1B 2C0IA 5GAMh 2BZXA 1YHQQ 4A4FA 3EG2A 2QI2A 4ATOA 3JB9F 2OJ2A 2MPXC 3L2QA 1VQ4T 2HSEB 3CCRA 1KQSA 2HD0A 3L2WA 2CP2A 5L8RE 4EMGA 3MP8A 1QP3A 3VJPA 3TSZA 2F2VA 1XQHA 3VUZA 4OB1B 3S3OA 4M7DC 1K0XA 2X4XA 1BI3A 3L2RA 2JN0A 3CC7T 3VRYA 1UFFA 1NJIU 1T3SA 1B34B 1IO6A 4J9IA 4J6XA 5I21A 4LDUA 3JV3A 1JJ2P 1HXDA 3PIOA 1ZUUA 2NLUA 4DOVA 2K9GA 2EAYA 3WVDB 3IQLA 4RTTA 5GAOl 5LJ5e 2CREA 3KXTA 1NPRA 1OOTA 4HVWA 3EG9A 2ECZA 2EJFA 3LH5A 4A53A 2GFUA 2FEIA 1KJWA 2EBPA 1ZA2B 3DKMA 1AOJA 2DMOA 2I0NA 1EFNA 2SRCA 5IXBA 2QQRA 4F7UG 4IUTA 4XTUA 4C8QC 3JCMg 2O88A 2E5QA 3MEAA 1MUZA 4M7DF 4IKFA 2OTJT 5J39A 2LCLA 2XK0A 1QKWA 4JUVA 3M57A 2XKOC 2LT1A 3JCMb 2YWWA 5GAN3 3C94A 4ANJA 2QTVA 5LJ5d 4M77A 1VQPA 1VYUA 4BD3A 4N0AC 2A28A 5LJ5f 3JB9I 2PVOB 3M56A 1M90C 5IH2A 3CCLQ 1RACB 1M27C 1G5VA 3OSVA 2KR3A 3HP9A 1K8AR 2M51A 2HBPA 1YITT 4J7IA 1YIJQ 4PJOB 3G4ST 2BZYA 3CXCA 1SRMA 2E6NA 2EGAA 1QMCA 3OB9A 3CCQA 1R8OB 1VQ7A 3HKSA 2NYSA 1ZQ1A 5M9OA 3MCAB 4PJLA 1AVZC 4FYYB 2BE9B 4JJNK 3CCUA 2X51A 3OYCA 2G3RA 4A54A 1YJ9T 4E7SA 5GANe 3INZA 1GL5A 2X3WD 1D1CA 2P0QA 4C8QF 4A4EA 4BE0A 1M2OA 4PLLA 1WJSA 2IPOB 2K57A 2CUDA 1SHFA 5HY6A 3CPWS 4ORZA 1XOVA 2E4HA 3QIIA 3CCVT 3NFCA 4PFPA 1LPLA 1QVGS 3GOXA 4E7KA 2DIQA 2K5FA 4M7AB 2FHDA 2FPEA 4DBFA 4DEXA 3M0QA 1VQKA 1UB4A 3CD6Q 3OYDA 2X4YA 5FW9A 3EGDA 4BY6B 3EFOA 1ZUYA 2DXBA 4FW1A 1YHQA 4OMMA 2EFIA 2V8IA 1MMNA 3QG1A 4FYWB 2O2OA 2RHUA 4ZGDB 4PJOD 1RI9A 3OYIA 1Q81U 1WI7A 1M1KC 4OMLA 2M16A 2OX7A 2RF0A 1N8RC 4M78A 3VS4A 5IN1A 1KC8C 1M90R 3MEWA 2QDYB 4HXJA 3CBPA 5GANf 4VUBA 1RL2A 2DVJA 4ZTJA 4X1VA 2V1QA 1GBQA 4XAXB 2QXFA 1VQ4Q 3C12A 5FU6C 5LJ5j 1BIAA 4LE9A 4ZGJB 2I2LA 1WGSA 5GAN6 4M75E 2ZPFB 1WJRA 2BUDA 1VQOT 2D8JA 3TCJA 5GAOn 4FSSA 4LD6A 1GFDA 4PFOA 2HKNA 4PJOG 1K8AU 2VASA 5KYXB 1WNLA 1SSFA 1WA7A 2K79A 1Q7YC 3CC7Q 2EQKA 4J9BA 3OBWA 4BUGA 5LJ5g 2P4TA 5KE3A 2GQIA 4J9GA 1Y71A 1UGVA 3AHUA 5GAMe 2CZ7B 4M77E 2DRKA 4M75B 1Y57A 2GGRA 3UWNA 1ABQA 2HZYA 4XTZA 3OW2S 3DLMA 3GBQA 5KYWB 3X20B 2RI5A 2PVGB 4N4GA 1IGUA 3H6ZA 2XDPA 1MNDA 1I8FA 3PMIA 3VV0A 1H92A 2A0FB 2DZCA 5D6WA 5CQXA 4PK4A 4JRKA 4ZTFA 4JJBA 2F1LA 3JCMW 3S3NA 3VRZA 1UEBA 2FPFA 1YFNA 2F2WA 2PUKB 2JMCA 5GMKl 3EFSA 1SRLA 2RA2A 3V8JA 1E6GA 4J8OA 2JS2A 2MMPA 9ATCB 4R0KA 4KH0B 5I2MA 2XD0A 3CCLA 1O9SA 2A7YA 5FWCA 2VB6A 8ATCB 4F04B 2BZ8A 1Q86C 5GAMd 4C92C 1M90U 3REAB 1YIJA 5GAMf 5GANj 3NMZC 2AT1B 1V29B 3A5ZB 5GAN2 3OA6A 4M77C 2JS0A 2CH4W 4Y28E 2RJEA 3R6NA 1Q7YR 3CEYA 1KIKA 1U5SA 1NLOC 1YITQ 1QQJA 1YNZA 4LN2A 1YJWT 2QGFB 3G4SQ 5GAN4 5CQYA 3ZFJA 2L0AA 2LQNA 5GANg 4J83A 1OX8A 2DVEA 2LVMA 2DJQA 2YUQA 1ACMB 5GJVB 2EJ9A 1NEBA 4QW2A 1YJ9Q 1T3LA 2V1RA 4DBHA 1OZ3A 1QCFA 1EZZB 3E9GA 2R5MA 3OYLA 4LUEA 3CD6A 1I07A 3META 4Q5WA 1OULA 3CCVQ 4V2SA 1AWJA 3PVQA 4C5EA 4J7FA 2GBQA 3QWYA 4RUGA 1SHGA 5GMKh 3P8BB 4C5HA 1OPKA 1M3BA 4C92F 3UF4A 3OYKA 4ZGEB 2JM9A 1MMGA 5D6XA 1RAEB 1D1BA 3JCMQ 4N4HA 2KXCA 1K9MR 2CT4A 1QVFA 2KSSA 2QQAA 1I0CA 1Q86R 3ULRB 1VQ4A 2KY9A 4XTXA 3FIFA 3BE3A 2Y4XA 3HHTB 4JPBW 2RJDA 1QKXA 4M78C 1WHLA 1G3WA 1NG2A 2DFUA 2H3JA 4XTWA 1W70A 2NUZA 5GAMj 2KT8A 2MIOA 2B8AA 2LJ0A 3CC7A 4MMKA 4RG2A 1JXMA 4C8QA 3RKYA 4IURA 1C1AA 2NUTB 1VQOQ 3OS0A 2CKKA 1Q7YU 3M4GA 2QQ9A 2PUOB 3I9QA 3F70A 3HTRA 2FVUA 1D0XA 3I35A 5FROA 3VS6A 1IHVA 1VQNT 4FL6A 1GBRA 4C0DC 2JT4A 3VYHB 5GAMg 2VGNA 4AG1C 1GRIA 2E3HA 3EG1A 3UT1A 5IHNA 2EYXA
chains in the Genus database with same CATH topology
2E6ZA 1P92A 2LX9A 5CCAA 1HXDA 4GLKA 3PIOA 1S72A 2EQMA 2ZCFB 2CZ0B 2LNVA 1X6OA 1QP2A 3HRSA 2RHXA 4WF2A 4E7IA 2NLUA 2LRQA 4DOVA 2X35A 3C4SA 3L2VA 2XI9A 2EAYA 1M8VA 3A8LB 4XTVA 4BB7A 2WSEE 3WVDB 3LWIA 3GNGA 3OYFA 2Y4YA 5LJ5e 5GAOl 1KQ1A 5A2QE 3KXTA 4Z02A 1NPRA 1YIJT 1NZ9A 1D3BA 3JCMh 2KDSA 5I2SA 2EJFA 2R57A 3E1SA 3VUBA 1Y7XA 1VQMA 4BE1A 4M78E 2HAXA 4JRQA 2F5KA 4M78F 1M5Q1 2GFUA 3X26B 2L89A 3GLXA 4A53A 3FJPA 1GXIE 5GAN7 5A0LA 3LLRA 2QEXT 1N9RA 3X25B 3QYHB 5CR2A 3CC2A 3BY7A 1VIFA 1S72T 4L6V5 3FDRA 2MI6A 1BI1A 4M75G 3QJYA 4PL6A 1H3ZA 3DKMA 3HRTA 4M7AC 5KE2A 2ZGWA 2EQUA 5GANd 4MZMA 3RESA 1KG1A 4HT8A 5AYFA 2L5QA 4BY6C 1AHJB 2QQRA 3V7RA 4F7UG 4IUTA 4FSXA 2QTXA 4XTUA 4EDUA 3MP1A 1VQMT 1K9MU 3JAME 2E64A 4C8QC 3FB9A 3JCMg 5GMKm 3SWNB 1BYMA 4FIBA 2PU9B 2ZPBB 1EIFA 2E5QA 4QQ6A 4QVZA 4F7UA 5CAIA 2CYZB 3MEAA 4M7DE 3CC2T 3TU4K 3V7SA 5LJ3d 4KUIA 4M78B 4M7DF 2VUBA 2DPPB 4IKFA 2JVVA 2OTJT 5LJ3f 5J39A 3OYJA 5GMKj 2LCLA 2RK2A 1G3TA 3CC4A 4LD9K 2XK0A 5GAOp 3P8DA 4JUVA 4D6WA 1YI2A 2O4XB 1YITA 2MWOA 3M57A 2XKOC 2WSCE 2LT1A 2XG8D 4M77G 2PVDB 4XU2A 1U1TA 5HK0A 3JCMb 3G4SA 5C0MA 1M1KU 3SB2A 3BDLA 5GAN3 4YTLA 3C94A 3CMEA 1PSFA 2ZPIB 4X9CA 5LJ5d 1H641 4M77A 3QO3A 1VQPA 4BD3A 4N0AC 1N8RU 5LJ5f 2VV5A 3SD4A 3JB9I 1KC8U 2RD1A 2R58A 2PVOB 3M56A 1M90C 1ZHIA 3HFOA 4CRIA 2K5LA 2LCCA 2L3RA 2GQVA 1KD1U 3P8HA 5CK9A 1G5VA 1X01A 2QQSA 3OSVA 3OYGA 3HP9A 3T9NA 1WQWA 1NJIC 3EFRA 3CC4T 2BKDN 5I21A 1YJ9A 2HBPA 2RB6A 1YI2T 1U8RA 1YITT 4M7DB 4XTYA 1X75C 1BKBA 4J7IA 3CCET 4KULA 4C92B 2EQJA 2RHZA 2KQWA 2K3XA 4PJOB 3G4ST 2RH2A 3JSCA 3V8KA 2YHTA 3CXCA 1M1GA 2E6NA 3CMET 3OB9A 3ASKA 4E47A 2E70A 3HSBA 2E1HA 4NL2A 4EMKC 1VQPT 3CCSA 4KUDK 3CCQA 4LDXA 2KK4A 3CCVA 1R8OB 1VQ7A 3HKSA 2DTOA 2E10A 3NTIA 1ZQ1A 5CKHA 5M9OA 3CXCS 1PSEA 3MCAB 3LH0A 1I81A 3M55A 1B34A 3TEEA 5FRMA 4JJNK 2YRVA 3CCUA 2DTHA 3M5AA 5FRNA 3OYCA 4JS4A 3KUFA 2G3RA 2P0PA 3G7ZA 1U1SA 4OMFB 1M9SA 4A54A 4RCBA 5GANe 3JCMJ 4XU3A 3INZA 1VQ6T 2D6FA 3PTAA 4R56A 3OYAA 3CPWA 3CMAA 2LQKA 3OSSC 4C8QE 4HCBA 4M75C 2P0QA 3SFMA 1VQ5A 4C8QF 4A4EA 4BE0A 1YJ9T 4PLLA 1N9SA 1WJSA 3LWHA 2A3LA 3SDZA 2K57A 4ZN1A 3PFSA 2MF2A 5J3BA 5HY6A 3QZ5B 3CPWS 1XOVA 3MEUA 2DEQA 3QIIA 4XQ3A 3CCST 3RKXA 3GNFB 4JLIA 3CCQT 3CCVT 1QVGA 1JJ2A 1VQ7T 3OS1A 3NFCA 4DOWA 3QSUA 3JCMX 3UPUA 3RKWA 3CCUT 1QVGS 1JJ2S 3GOXA 4E7KA 3LW5E 2DIQA 2K5FA 1KHCA 4JLGA 4M7AB 2FHDA 4C5GA 1K9MC 1DJ7B 4FM4B 2PQWA 1VQKA 3URGA 1UB4A 2CZ1B 4PNOA 3M58A 3OYDA 2X4YA 2LQ8A 5GANh 3CMAT 4BY6B 3RUXA 1VQ5T 3ME9A 3MP6A 4O6JA 1FWZA 2DXBA 5IT9E 1OYXA 5HK3A 1YHQA 1K73C 1G3SA 2KAFA 4IUPA 2EFIA 1NE8A 2V8IA 3QG1A 1N27A 4QQGA 3X28B 1W4SA 4HKEA 2HQEA 3QYGB 4C92D 3FC3A 2CGHA 2RHUA 4ZGDB 3J7AF 1M1FA 4MDXA 4PJOD 2DTIA 5CO7A 2BIVA 3OYIA 1Q81U 1M1KC 4OB3B 4QVDA 2R5AA 1VQ8A 2F5TX 3SWNA 5LJ3h 4M77D 3OMGA 2M16A 2XIDA 4EPCA 1VQOA 5CKFA 3OYNA 5GAOr 3HL8A 2JNGA 1N8RC 3O8VA 2JUFA 4M78A 2MAMA 5LL6S 3DB4A 5LJ3j 3OYMA 5IN1A 1VQKT 4JS5A 1KC8C 2RHIA 4BACA 3A8MB 1IZ6A 2QDYB 3MEWA 1YBYA 2O4XA 1Y07A 2EYQA 2JOYA 4IUUA 4J6WA 3CBPA 1YHQT 2DK3A 5GANf 4VUBA 1RL2A 1I4K1 1UGQB 3OQ5A 3OYYA 3ER0A 3VKIA 4ZTJA 5KCHA 4XAXB 2YLCA 4BI8B 5LJ5h 4J5YA 4XU1A 2QXFA 3C12A 3OY9A 1FXXA 2OAUA 1VUBA 5FU6C 3WXMB 1BIAA 4ZGJB 5LJ5j 1KQ2A 2I2LA 4OVAA 3L42A 1WGSA 5GAN6 1VQ8T 1UGRB 2AHJB 1Q86U 4M75E 2ZPFB 1WJRA 2BUDA 4M75F 5D6YA 5FU7B 1VQOT 2JTMA 3QDRB 3TCJA 3RIRA 5GAOn 3S3MA 5CKBA 4C92G 3DB3A 4XK8E 3Q1JA 4LD6A 5LJ3g 1K8AU 4PJOG 4C0ZA 3JB9D 4OGCA 1WNLA 3GIBA 4BDZA 2RO0A 2XU8A 4M7DA 1SSFA 4C92A 4F7UE 1BI0A 3JCMd 1FX7A 3L2UA 4EMKB 4F7UF 1Q7YC 4PJOA 4A4GA 2EQKA 2D0QB 1WQ7A 2F69A 3QKJA 3OBWA 2CZ6B 4BUGA 1WPYA 1BIBA 3OBYA 5LJ5g 2P4TA 4L59A 5KE3A 1OI1A 3PT9A 4A4HA 3J81E 1Y71A 1I5LA 3OW2A 3OYHA 5GAN8 3AHUA 2MWPA 3RMSA 2CZ7B 5GAMe 4M77E 1N6AA 4M75B 2JTFA 3ZBDA 4HCCA 2X4JA 3UWNA 4M77F 2RJCA 2K3YA 2HNIA 4XTZA 3OW2S 4DA4A 2VYTA 2IVWA 4C0DB 2QQBA 4GY5A 5HKCA 3DLMA 2DJZA 3I56A 2M1HA 2M9UA 3L2ZA 3X20B 3JB9J 3CCJA 1LJOA 2E41A 3JB9G 5GAOm 2QA4A 3JB9H 2KMTA 2RI5A 2PVGB 2FB7A 3H6ZA 4N4GA 2LT4A 2XDPA 3RMQA 4FU6A 3C95A 3BDUA 1Y96B 1I8FA 3PMIA 3VV0A 2RHYA 2DZCA 3HFNA 5D6WA 5CQXA 1W2BA 1BI2A 1MGQA 2V8JA 4JRKA 5GAOq 4ELYC 3OYEA 1LNXA 5CKEA 4ZTFA 4KBMB 2CS7A 3G6EA 4M7AA 1QVPA 4PLIA 1Q81C 3PGGA 3QBYA 1LOJA 3OS2A 3CPFA 4QQDA 3JCMW 3S3NA 1YJNA 1UEBA 4UC4A 3M9QA 1W2BS 2PUKB 4M78D 3FLGA 5GMKl 3I56T 3CCMA 3EFSA 2RA2A 3M53A 3V8JA 3I55A 3NTKA 2FYKA 2K4YA 2RJFA 2ZPGB 2MMPA 4J8OA 3CCJT 5EG2A 1Q82U 4E7JA 2QA4T 5I2MA 2IG0A 1XNIA 2V8KA 2EWNA 2XD0A 3MEVA 1KHIA 2EJGA 3CCLA 3QUIA 1O9SA 3OYBA 1M4ZA 3A8OB 1TH7A 2A7YA 4JRIA 2KVQG 2WACA 4X34A 5KH6A 4RG8A 3A8HB 2DO3A 3PIPA 3G6ET 2XHCA 1YJWA 4FT2A 2DZ9A 5IAYA 1MHNA 3JCMe 5GAMd 1YJNT 1Q86C 4OP0A 4C92C 1M90U 4HCZA 4JDSA 1YIJA 5GAMf 3G71A 3N5BB 4C0FA 3J80E 3CCMT 4BDYA 3A5ZB 1V29B 4OF1A 3I55T 5GANj 3CBMA 3FRNA 2K5IA 5GAN2 5DLQE 3OA6A 1K8AC 4C8QB 4NOYA 4M77C 4M7DD 4LDVA 4N0AA 4Y28E 2LDMA 2RJEA 3UDCA 4PJOC 2EKOA 1HK9A 4M78G 2QEXA 2C06A 5KCOA 3CCLT 1XTDA 3CEYA 4LDYA 5A0GA 3GP8A 3E9FA 3NTHA 2DD5A 4RCCA 3QHSA 2JZ2A 4IUQA 4NL3A 4OB0B 4ELZC 4RKUE 4HA8A 1YJWT 2GCXA 4IUVA 2XICA 2DD4A 5GAN4 2O01E 5CQYA 1G3YA 3EAEA 4OB2B 4MMLA 3M54A 3GPLA 3G71T 1KD1C 2VXEA 3ZFJA 2RI2A 5GANg 4J83A 3A8GB 4EMKA 3DLLA 4BI3A 2DVEA 4NS5A 4MZPA 3BFMA 5FLXE 4B9WA 3KBGA 2OTLA 2LVMA 5GMKe 3FEOA 4ZN3A 1VQ9A 2XDBA 3L1AA 2EJ9A 1JB0E 4X9DA 3X24B 2M0OA 1VQLA 4QW2A 2GFAA 2OTJA 4M7DG 4E7HA 3LGLA 1OZ3A 4CI0C 2RK1A 4N4IA 4O5VA 4BI4A 4R55A 3V8LA 1VIEA 3E9GA 1QW1A 2R5MA 4M75A 4MDWA 1D3BB 3MO8A 4PKCC 3OYLA 3CD6A 2DKGA 5DM7R 3LYIA 3LGFA 3R6OA 2D9TA 2WSFE 4M7AD 2GF7A 3META 4Q5WA 2DAQA 3M59A 3JCMf 4V2SA 1UGSB 3HRUA 2K2VA 2OTLT 4BE2A 2RI3A 4C5EA 2L8DA 2DXCA 2RM4A 4J7FA 1VQ9T 5GAN5 5J26A 3GF5A 4L5GA 5GMKh 3P8BB 4C5HA 1VQLT 4C92E 2E65A 3VU3C 1K73U 4C8QD 4KT0E 4C92F 4PJOE 1Y96A 1Q82C 3PMTA 3OYKA 4PJOF 4ZGEB 1NPPA 4JRPA 2YLBA 4C5IA 5D6XA 3CCEA 2LTOA 4MZTA 4TVRA 3JCMQ 3QZ9B 3CD6T 2VXFA 4N4HA 3MHXA 4J6YA 2XDDA 3OS5A 3PNWC 4A4KA 4XU0A 2DXTA 3LX7A 1QVFA 3E19A 3JRZA 2KSSA 2QQAA 4RMOA 4OGEA 4C0GA 2X4WA 4F7UB 2FL7A 1VQ4A 2VGMA 2KY9A 4XTXA 3QJ6A 1QVFS 3H8ZA 3FIFA 3JCMc 1UGPB 1ZBXA 4M7AG 3SWNC 3HPWA 1IREB 3WVEB 1JBMA 4B9XA 5DLOA 2Y4XA 3HHTB 5FU7C 2RJDA 1VQ6A 4M78C 5GMKi 5DY9A 2ZPEB 3QPHA 3CBOA 5CVIA 2EIFA 3BW1A 2P0KA 5GAMh 1G3WA 2VC8A 3JCMV 5C6SA 2H3JA 4XTWA 4P5NA 2HQXA 1VQNA 3M4YA 4C8QG 5GAMj 4A4FA 4M77B 4ME7A 2QI2A 2ZZDA 4ATOA 3VYGA 2B8AA 3JB9F 2DIGA 3CC7A 4MMKA 5CIUA 4RG2A 4M7AE 3L2QA 1O75A 4C8QA 4DQ2A 4LDWA 3RKYA 3CCRA 1VQ4T 1KQSA 2HD0A 4M7AF 3L2WA 1WJQA 4IURA 3S6WA 4II1A 3OS0A 1RI0A 5L8RE 4EMGA 2CKKA 3MP8A 1Q7YU 1QP3A 3M4GA 3VJPA 2QQ9A 2PUOB 2ZPHB 4HT9A 1KQSS 3F70A 1XQHA 3VUZA 2FVUA 4QVCA 3ZEHA 4OB1B 2LC4A 5FROA 3S3OA 2DXUA 3OMCA 4M7DC 2X4XA 5A0DA 2E12A 3V7CA 2Y90A 1VQNT 4FL6A 4C0DC 3VYHB 5GAMg 4EMHA 1BI3A 2VGNA 3L2RA 5CKDA 5FU6B 2JN0A 3CC7T 4M75D 1YCYA 1NJIU 3CCRT 1OZ2A 4FT4A 3JCMP 1B34B 1JRIA 3UT1A 5LJ3e 4E7LA 3QXEB 3TREA 4Y91A 3RERA 4J6XA 4LDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCA A;  5CK9 A;  2VUB A;  5DLO A;  5CKF A;  3TCJ A;  5CQX A;  5CKB A;  3G7Z A;  4ELZ C;  4ELY C;  5CKE A;  1UB4 A;  1X75 C;  4MZT A;  4MZM A;  5CQY A;  5HK0 A;  5HK3 A;  5HKC A;  3JSC A;  4VUB A;  4OF1 A;  4ME7 A;  2MF2 A;  1NE8 A;  5CKD A;  3JRZ A;  4HKE A;  3VUB A;  4MZP A;  1VUB A;  2KMT A;  3NFC A;  5CKH A;  1M1F A;  4MDX A;  5CO7 A;  2C06 A;  5CR2 A;  3HPW A; 
#chains in the Genus database with same CATH topology
 4JZ4 A;  2ROL A;  1HSQ A;  1T0H A;  2JMA A;  2LNV A;  1X6O A;  4WF2 A;  2A08 A;  3C4S A;  1M8V A;  4BB7 A;  2CSI A;  2K2M A;  2E5K A;  2Y4Y A;  1FMV A;  1GCQ A;  1YIJ T;  1RAF B;  3M0R A;  1NZ9 A;  1D3B A;  3G1J A;  1FMK A;  3VS1 A;  5I2S A;  1UDL A;  3VUB A;  4GLM A;  1F1B B;  2HAX A;  4JRQ A;  4M78 F;  1M5Q 1;  1Z9Z A;  1GXI E;  4HCK A;  1BU1 A;  2HEQ A;  4AFU C;  5CR2 A;  3M0S A;  1S72 T;  4L6V 5;  1QWF A;  3FDR A;  1H3Z A;  1BI1 A;  4PL6 A;  3HRT A;  1TWB A;  2ZGW A;  2C0T A;  2EQU A;  4MZM A;  2LX7 A;  3RES A;  2HBW A;  1JXO A;  4FSX A;  1K9M U;  2W0Z A;  1VQM T;  2E64 A;  2FPD A;  3FB9 A;  2D0N A;  3SWN B;  4J9E A;  2FRW A;  2EYY A;  1I5O B;  2ZPB B;  2CYZ B;  2LP5 A;  4M7D E;  3OYJ A;  4LD9 K;  5GAO p;  2RN8 A;  2O4X B;  1YIT A;  4RTZ A;  2XG8 D;  1U1T A;  2AK5 A;  5AT1 B;  5HK0 A;  4ESR A;  3G4S A;  3BDL A;  2HMA A;  1D0Y A;  4X9C A;  5EC7 A;  1WXU A;  1TUG B;  3SD4 A;  2RD1 A;  1ZHI A;  3HFO A;  2K5L A;  2LCC A;  3P8H A;  1X6B A;  5CK9 A;  1X01 A;  2QQS A;  3T9N A;  1WQW A;  3EFR A;  1YJW Q;  2BKD N;  1Z9Q A;  1YJ9 A;  1LCK A;  4M7D B;  4XTY A;  4KUL A;  2RHZ A;  2YHT A;  3ASK A;  2Z0W A;  2E70 A;  4E47 A;  3HSB A;  4HVV A;  4A63 B;  3SHW A;  4KUD K;  3CCV A;  1WHJ A;  2DTO A;  2E10 A;  1SG5 A;  3NTI A;  5CKH A;  2QEX Q;  3LH0 A;  3M55 A;  3TEE A;  3M5A A;  5FRN A;  4JS4 A;  3KUF A;  3RBB B;  1PG5 B;  2D6F A;  3I5S A;  4LNP A;  3CPW A;  2LQK A;  3OSS C;  4C8Q E;  4HCB A;  2KT1 A;  2DA9 A;  2NUP A;  2PZ1 A;  3PE0 A;  1W2B P;  3LWH A;  2A3L A;  3EHR A;  3SDZ A;  4ZN1 A;  2L2P A;  1X69 A;  2DEQ A;  4XQ3 A;  5FWB A;  1QVG A;  4DBR A;  4JLI A;  1M2V A;  2JM8 A;  3OS1 A;  1NYG A;  3QSU A;  1JJ2 S;  1PKT A;  4GBQ A;  4JLG A;  3H0H A;  4C5G A;  1DJ7 B;  2PQW A;  1NYF A;  3URG A;  2LQ8 A;  3CMA T;  2PNI A;  1VQ5 T;  1FWZ A;  1WLP B;  4CC7 A;  4QQG A;  2COY A;  1W4S A;  4HKE A;  3X28 B;  2HQE A;  5D7U A;  2CGH A;  3EGX A;  1M1F A;  2CH4 A;  4MDX A;  2DTI A;  2O9S A;  2JTE A;  2BIV A;  5CO7 A;  4PJN A;  4OB3 B;  4QVD A;  1VOM A;  5LJ3 h;  3OMG A;  1VQO A;  5GAO r;  3OYN A;  2JNG A;  2J7I A;  1SPK A;  1ZLM A;  2O31 A;  2DL7 A;  3CCE Q;  3DB4 A;  1R0B G;  2HKQ B;  1IZ6 A;  1FYN A;  1YBY A;  2EYQ A;  2JOY A;  4IUU A;  2DK3 A;  3VKI A;  3OYY A;  2COW A;  2EQI A;  4BI8 B;  3ZL7 C;  2YUP A;  3OY9 A;  1VUB A;  2HL5 C;  1KQ2 A;  4RTV A;  2DX1 A;  2EYZ A;  5KYY A;  5FU7 B;  1VQ6 Q;  2JTM A;  3RIR A;  4F17 A;  1PWT A;  1WZO A;  3PVL A;  4XK8 E;  3Q1J A;  3GIB A;  4BDZ A;  2H3E B;  1M3C A;  2RPN A;  2XU8 A;  4HVU A;  2LZ6 B;  1VQN Q;  4C92 A;  4F7U F;  2ATC B;  4A4G A;  3QKJ A;  1ZA1 B;  1S1N A;  1PHT A;  3OBY A;  1RAI B;  1FMW A;  3PT9 A;  4A4H A;  2DER A;  4D8D A;  3OW2 A;  2MWP A;  1Q95 G;  2D1X A;  4HCC A;  3ZBD A;  2JTF A;  2X4J A;  2RQW A;  2RJC A;  2HNI A;  4DA4 A;  1GCQ C;  1YWP A;  5GAO m;  3JB9 H;  2KMT A;  4M4Z A;  2BTT A;  4FU6 A;  2VWF A;  3RMQ A;  3C95 A;  1S72 Q;  1SKU B;  2J05 A;  2RHY A;  2YT6 A;  2VVK A;  1X43 A;  2GTJ A;  5GAO q;  3OYE A;  5CKE A;  4KBM B;  1IGQ A;  2DL4 A;  4UC4 A;  3M9Q A;  3I56 T;  2RQU A;  1VQM Q;  2FYK A;  2RJF A;  3EG0 A;  3CCJ T;  4E7J A;  1IXD A;  1ZSZ A;  1YP5 A;  2QAS A;  2WAC A;  5KH6 A;  2JJ9 A;  1YJW A;  3N5B B;  5KYU A;  3J80 E;  3CCM T;  4PJO C;  4OF1 A;  3I55 T;  2P84 A;  2K5I A;  2EGE A;  1UJ0 A;  6AT1 B;  1AWX A;  4LDV A;  1R0C B;  3UDC A;  2EKO A;  2QEX A;  5KCO A;  1XTD A;  2KRM A;  3GP8 A;  4Z89 A;  4RCC A;  4LXC A;  1ARK A;  1BBZ A;  1T0J A;  4RKU E;  2GCX A;  4IUV A;  2XIC A;  3UA7 A;  3EAE A;  3G71 T;  1J3T A;  3THK A;  2DBK A;  4EMK A;  1BCO A;  1UEC A;  4LUD A;  4MZP A;  3FEO A;  4ZN3 A;  3TVT A;  2XDB A;  1JB0 E;  1QWE A;  2H8H A;  2GFA A;  1K76 A;  3LGL A;  2RK1 A;  3KFV A;  1VIE A;  4QT7 A;  3MO8 A;  4PKC C;  3EG9 B;  1B3Q A;  5DM7 R;  2WSF E;  4M7A D;  2DAQ A;  2K2V A;  2RI3 A;  1H8K A;  2DXC A;  2FO0 A;  5J26 A;  2GNC A;  3RNJ A;  1VQL T;  4C92 E;  2LMJ A;  2BE7 D;  1Y96 A;  1Q82 C;  3PMT A;  4PJO F;  1NPP A;  1G8X A;  3CMA Q;  3EH2 A;  3CCE A;  1VQ5 Q;  2X3X D;  4MZT A;  2DBM A;  2VXF A;  1VYT A;  2DXT A;  5I22 A;  4OGE A;  4C0G A;  1WXT A;  1X27 A;  1ZUK A;  2X4W A;  2CP6 A;  2VGM A;  3H9N A;  3QJ6 A;  1ZBX A;  4M7A G;  4PJJ A;  3HPW A;  4B9X A;  1VQ6 A;  2ZPE B;  1K4U S;  1JU5 C;  2EIF A;  2P0K A;  1M1K R;  2VC8 A;  3JCM V;  5C6S A;  4P5N A;  2HQX A;  1VQN A;  4M77 B;  4ME7 A;  1N8R R;  4FW2 A;  3EH1 A;  5CIU A;  1KC8 R;  1O75 A;  4DQ2 A;  2A37 A;  4M7A F;  3CXC P;  4WTO B;  1WJQ A;  3S6W A;  4II1 A;  1OPL A;  2ZPH B;  4HT9 A;  2QAZ A;  2YXY A;  8AT1 B;  3ZEH A;  4AG2 C;  3D7S B;  2LC4 A;  3H0I A;  2Y90 A;  1RAD B;  1NEG A;  1WX6 A;  4M75 D;  1JRI A;  5LJ3 e;  3QXE B;  3TRE A;  3RER A;  2LX9 A;  4GLK A;  1S72 A;  2ZCF B;  3HRS A;  3M0T A;  3FJ5 A;  2X35 A;  3A8L B;  1ZSG A;  2WSE E;  4ZNX A;  1UUE A;  1KQ1 A;  4DBQ A;  4Z02 A;  2DET A;  1Q82 R;  3MPU B;  2R57 A;  3E1S A;  1VQM A;  1Y7X A;  4BE1 A;  4M78 E;  1M8M A;  2F5K A;  3X26 B;  2L89 A;  3GLX A;  3LLR A;  2QEX T;  1N9R A;  3X25 B;  1TUD A;  4OMQ A;  4M75 G;  3EGD B;  2CP5 A;  3EFO B;  2KE9 A;  4AFQ C;  2J6O A;  3I56 Q;  1KG1 A;  5AYF A;  2ED0 A;  3V7R A;  3CCJ Q;  2QTX A;  4EDU A;  3MP1 A;  3JAM E;  1N5Z A;  5GMK m;  4FIB A;  1ZSZ C;  2PU9 B;  4J9H A;  1BK2 A;  1EIF A;  1SF9 A;  1UHF A;  4F7U A;  5CAI A;  3CC2 T;  3TU4 K;  3V7S A;  5LJ3 d;  4M78 B;  2DPP B;  2JVV A;  5LJ3 f;  1G3T A;  4D6W A;  3M0P A;  4M77 G;  3CCM Q;  4XU2 A;  1M1K U;  3I55 Q;  3SB2 A;  1HYO A;  4YTL A;  1PSF A;  1H64 1;  4PFZ A;  1CSK A;  1N8R U;  2ABL A;  1KC8 U;  1WDX A;  1QCN A;  1BB9 A;  2GQV A;  1HJD A;  1NJI C;  3CC4 T;  1WYX A;  1MNE A;  2RB6 A;  1YI2 T;  1U8R A;  3CCE T;  3G71 Q;  2KQW A;  2LJ3 A;  2RH2 A;  3JSC A;  2LJ1 A;  3CME T;  2AKK A;  4NL2 A;  4EMK C;  2GTO A;  4LDX A;  1PSE A;  1I81 A;  1B34 A;  2YRV A;  3VS3 A;  1AWO A;  3NHN A;  4OMF B;  1U1S A;  1RAH B;  1M9S A;  1TUC A;  4RCB A;  1VQ6 T;  4XU3 A;  3UAT A;  3CMA A;  2L3Q A;  1VQ5 A;  3E2U A;  1IRX A;  1JO8 A;  2YDL A;  4AFZ C;  1N9S A;  4J9C A;  1SSH A;  4FYX B;  3PFS A;  2EKH A;  3QZ5 B;  3MEU A;  3CCS T;  1JJ2 A;  3RKX A;  1WXB A;  1TSF A;  1TOV A;  3JCM X;  3UPU A;  1VQL Q;  3RKW A;  2YUO A;  1B7T A;  4F14 A;  4FM4 B;  2KI7 A;  5GAN h;  3RUX A;  4O6J A;  2KYM A;  1HD3 A;  5IT9 E;  1W6X A;  2KAF A;  3QWX X;  4IUP A;  1NE8 A;  2QK0 A;  4DEY A;  1D1A A;  2ESW A;  3QYG B;  2VKN A;  1X2K A;  1TTH B;  2XID A;  4EPC A;  3HL8 A;  5LJ3 j;  2RHI A;  3A8M B;  4J6W A;  2ED1 A;  1I4K 1;  2W10 A;  1NJI R;  2L3P A;  5KYN A;  2ZAE A;  1FXX A;  1OU9 A;  1YN8 A;  2OAU A;  3MKD A;  2DEU A;  4AMC A;  1VQ8 T;  4OMO A;  1Q86 U;  3QDR B;  4IIO A;  3S3M A;  2KRS A;  2OI3 A;  5LJ3 g;  4C0Z A;  3JB9 D;  4OGC A;  2J06 A;  4F7U E;  1BI0 A;  1ZX6 A;  3AT1 B;  1FX7 A;  3JCM d;  3L2U A;  2QGG A;  4PJO A;  2D0Q B;  1WQ7 A;  2F69 A;  1PRL C;  2YRC A;  1WPY A;  5I11 A;  4L59 A;  1OI1 A;  5GJW B;  1D09 B;  3J81 E;  1I5L A;  3OYH A;  1PNJ A;  5GAN 8;  3RMS A;  4WCI A;  1N6A A;  2KRO A;  3RDV A;  1V76 A;  2K3Y A;  2IVW A;  2DM1 A;  3UA6 A;  2D8H A;  5HKC A;  3I56 A;  2DIL A;  2M1H A;  2M9U A;  3U23 A;  3L2Z A;  2KXD A;  1WHG A;  1LJO A;  3CCJ A;  3JB9 J;  3JB9 G;  2LT4 A;  3BDU A;  3HFN A;  5L23 A;  4E7Z A;  4M7A A;  1LNX A;  1QVP A;  1VYV A;  1Q81 C;  3OS2 A;  4AFS C;  4CC3 A;  1W2B S;  2LCS A;  3FLG A;  3CCM A;  1MV0 B;  2MYS A;  3M53 A;  3I55 A;  3NTK A;  5IHK A;  2K4Y A;  2ZPG B;  1C6V X;  2MK5 A;  3QDF A;  2QA4 T;  1WIE A;  1MV3 A;  2IG0 A;  1XNI A;  2V8K A;  2EWN A;  1WHH A;  3CC2 Q;  3MEV A;  1KHI A;  2EJG A;  3OYB A;  1GCP A;  4JRI A;  2KVQ G;  3G6E T;  2XHC A;  4FT2 A;  5IAY A;  1H3H A;  4E2F B;  1MHN A;  1YJN T;  4OP0 A;  2KEA A;  3G71 A;  3I5R A;  4C0F A;  4BDY A;  3CBM A;  5DLQ E;  2CDT A;  1K8A C;  4C8Q B;  4M7D D;  4JZ3 A;  5IXF A;  3VS7 A;  3MJX A;  3SEM A;  2NWM A;  5A0G A;  4LDY A;  3E9F A;  3NPF A;  3NTH A;  3CC4 Q;  3QHS A;  2RQT A;  2JZ2 A;  4IUQ A;  4NL3 A;  1YI2 Q;  4OB0 B;  2RQV A;  4HA8 A;  3VS0 A;  2DL5 A;  2O01 E;  5KYX A;  1G3Y A;  1QCO A;  4OB2 B;  3CME Q;  1KD1 C;  1OEB A;  2RI2 A;  3H0F A;  2LNH B;  4NS5 A;  5FLX E;  1RAB B;  4B9W A;  5GMK e;  1IHW A;  3X24 B;  1VQL A;  1CKA A;  4M7D G;  1A0N B;  4CI0 C;  4N4I A;  1UHC A;  4O5V A;  4BI4 A;  4MDW A;  4M75 A;  1D3B B;  2DKG A;  3LYI A;  3R6O A;  2D9T A;  3CCS Q;  5KYW A;  1Q81 R;  1UGS B;  2OTL T;  2B86 A;  1E6H A;  1JEG A;  1VQ9 T;  2L8D A;  2RM4 A;  1AEY A;  3GF5 A;  4L5G A;  3VU3 C;  4C8Q D;  4KT0 E;  4PJO E;  1PM3 A;  2YLB A;  2LTO A;  2AZV A;  3MHX A;  4K11 A;  1ABO A;  2XDD A;  3OS5 A;  2HL3 A;  4KGV B;  3PNW C;  4A4K A;  4D8K A;  4RMO A;  1G83 A;  1KSW A;  1UGP B;  3M0U A;  5FU7 C;  2FZG B;  2K3B A;  3QPH A;  1BCM A;  3CBO A;  5CVI A;  3BW1 A;  1PCX A;  4Z88 A;  3M4Y A;  4C8Q G;  2QYZ A;  2ZZD A;  3VYG A;  2DIG A;  1K0S A;  2K7A A;  4M7A E;  3EG3 A;  3CQT A;  4LDW A;  1VQ8 Q;  4J9F A;  1KD1 R;  1RI0 A;  1WFW A;  1PKS A;  2HQH A;  4Y92 A;  4RTY A;  1KQS S;  4QVC A;  1KQS P;  2DXU A;  3OMC A;  5A0D A;  2E12 A;  3V7C A;  2M0Y A;  3O5Z A;  4EMH A;  5CKD A;  5FU6 B;  3CPW P;  1YCY A;  3CCR T;  1OZ2 A;  4FT4 A;  3JCM P;  4E7L A;  4Y91 A;  1WHK A;  2E6Z A;  1P92 A;  5CCA A;  1QVG P;  1B07 A;  2EQM A;  4E7I A;  2CZ0 B;  1QP2 A;  2RHX A;  2DRM A;  2LRQ A;  3L2V A;  2XI9 A;  2NUP B;  4XTV A;  3LWI A;  3GNG A;  3OYF A;  1PC0 A;  1OU8 A;  2EGC A;  5A2Q E;  2JW4 A;  3JCM h;  2KDS A;  1M2V B;  7AT1 B;  1I1J A;  3VS2 A;  3FJP A;  5GAN 7;  5A0L A;  2EPD A;  1AWW A;  3QYH B;  3CC2 A;  3BY7 A;  1VIF A;  1QLY A;  2MI6 A;  3QJY A;  4PJM A;  4M7A C;  5KE2 A;  2AIR B;  4EIK A;  5GAN d;  4HT8 A;  4BY6 C;  2L5Q A;  1AHJ B;  3C0C A;  1UTI A;  3EGX B;  2QA4 Q;  2RMO A;  1BYM A;  4QQ6 A;  4QVZ A;  1IB8 A;  3A1P A;  4KUI A;  2RQR A;  2VUB A;  2P4R A;  4B6M A;  3G6E Q;  5GMK j;  2RK2 A;  3CC4 A;  1OQK A;  4F16 A;  3P8D A;  1YI2 A;  1YJN Q;  2MWO A;  2WSC E;  2PVD B;  5C0M A;  3CME A;  2ZPI B;  2O9V A;  2JXB A;  3QO3 A;  1PD1 A;  4KRT A;  2VV5 A;  1K9A A;  2CP0 A;  2R58 A;  5KYY B;  4CRI A;  2L3R A;  1KD1 U;  2NUT A;  3OYG A;  4KH1 B;  1X75 C;  1BKB A;  4C92 B;  2EQJ A;  2FG0 A;  1JQQ A;  2K3X A;  3OW2 P;  3V8K A;  1M1G A;  4CC4 B;  3A98 A;  2E1H A;  1VQP T;  3CCS A;  2HSP A;  2KK4 A;  3CXC S;  5FRM A;  2DTH A;  1AZG B;  4J9D A;  2X9H A;  2L3S A;  2P0P A;  3G7Z A;  3JCM J;  1C0M A;  3PTA A;  4R56 A;  3OYA A;  3VS5 A;  4M75 C;  3SFM A;  2KBT A;  2MF2 A;  5J3B A;  2OTL Q;  3CCQ T;  3GNF B;  1VQ7 T;  4IIM A;  1VQ9 Q;  4DOW A;  2OTJ Q;  2V26 A;  3CCU T;  3LW5 E;  1KHC A;  1K9M C;  4JJC A;  2E3I A;  1XJW B;  2FZC B;  1PRM C;  2CZ1 B;  4PNO A;  3M58 A;  4KGZ B;  1UJY A;  3ME9 A;  3MP6 A;  1OYX A;  3EGU A;  2XMF A;  5HK3 A;  5ECA A;  1X2Q A;  1K73 C;  1G3S A;  2C0O A;  1N27 A;  4C92 D;  1YCS B;  1ZSZ B;  3FC3 A;  3J7A F;  2KGT A;  2R5A A;  1VQ8 A;  2DL8 A;  2F5T X;  1R77 A;  3SWN A;  4M77 D;  1RAG B;  5CKF A;  2DF6 A;  3O8V A;  2JUF A;  5LL6 S;  2MAM A;  3OYM A;  1MMD A;  1VQK T;  4JS5 A;  4BAC A;  2OAW A;  4RTU A;  5KYU B;  1TXQ A;  2O4X A;  1Y07 A;  1GFC A;  1YHQ T;  3H41 A;  3OQ5 A;  1UGQ B;  4E6R A;  3ER0 A;  2DYB A;  1OV3 A;  5KCH A;  2YLC A;  2YUN A;  5LJ5 h;  2EYW A;  4J5Y A;  4XU1 A;  4JJD A;  3WXM B;  1YWO A;  1CKB A;  4OVA A;  3L42 A;  1UGR B;  2AHJ B;  4M75 F;  5D6Y A;  1MMA A;  5CKB A;  4C92 G;  3DB3 A;  3TQ7 P;  1U06 A;  2RNA A;  2RO0 A;  4M7D A;  1OX9 A;  2AZS A;  4EMK B;  3CCR Q;  2CZ6 B;  2FZK B;  4OMP A;  1BIB A;  4FCY A;  4FYV B;  2EW3 A;  2QG9 B;  1AT1 B;  4M77 F;  2DNU A;  2VYT A;  4C0D B;  2QQB A;  4GY5 A;  2DJZ A;  1NBE B;  2E41 A;  2QA4 A;  4OMN A;  4RTW A;  2FB7 A;  2KRN A;  2AKL A;  1AD5 A;  1K73 R;  1Y96 B;  1RAA B;  1TS9 A;  2YSQ A;  1W2B A;  1BI2 A;  1MGQ A;  2V8J A;  4ELY C;  2CS7 A;  3G6E A;  4PLI A;  3PGG A;  3QBY A;  1V1C A;  1LOJ A;  2DYI A;  1EX4 A;  3CPF A;  4QQD A;  1K1Z A;  1YJN A;  1WHM A;  4M78 D;  2EVR A;  2DE0 X;  1RLP C;  5EG2 A;  1Q82 U;  2COZ A;  2SEM A;  1PD0 A;  2CSQ A;  3QUI A;  1M4Z A;  3A8O B;  1TH7 A;  1Y0M A;  4X34 A;  4RG8 A;  2LQW A;  3A8H B;  1TU0 B;  2DO3 A;  2J6F A;  1M3A A;  3PIP A;  3EHQ A;  2DZ9 A;  4CC2 A;  3JCM e;  4HCZ A;  1RLQ C;  4JDS A;  2MCN A;  3FRN A;  1LVK A;  4NOY A;  2DL3 A;  4N0A A;  2LDM A;  4QKU A;  1HK9 A;  4M78 G;  2C06 A;  3CCL T;  2A36 A;  2DD5 A;  2HDA A;  1E7O A;  4ELZ C;  5IHI A;  3RR6 A;  2DD4 A;  2MOX A;  2KNB B;  3TSW A;  3GPL A;  1D0Z A;  3M54 A;  4MML A;  2VXE A;  2QDL A;  1KFZ A;  1VQP Q;  1TG0 A;  3A8G B;  3DLL A;  4BI3 A;  1X6G A;  2CUB A;  3BFM A;  4RTX A;  3KBG A;  2OTL A;  1ZBJ A;  2J6K A;  2CT3 A;  3NGP A;  2FRY A;  1VQ9 A;  1KK7 A;  3L1A A;  4X9D A;  1U3O A;  2M0O A;  2OTJ A;  1M30 A;  4E7H A;  2CP3 A;  4R55 A;  3V8L A;  2PTK A;  1UG1 A;  1QW1 A;  1NM7 A;  3LGF A;  1NLP C;  2GF7 A;  3M59 A;  5HCK A;  3CCQ Q;  1VQ7 Q;  3JCM f;  2M02 A;  3HRU A;  4BE2 A;  3CCU Q;  5GAN 5;  1AZE A;  1SEM A;  2E65 A;  4KGX B;  1K73 U;  2F2X A;  4JRP A;  4C5I A;  4TVR A;  4Z8A A;  3QZ9 B;  3CD6 T;  1W1F A;  4J6Y A;  4XU0 A;  3LX7 A;  2KYB A;  1RUW A;  1VA7 A;  2IIM A;  3E19 A;  3JRZ A;  2ROT A;  4F7U B;  2ENM A;  2FL7 A;  1G2B A;  2K6D A;  2HCK A;  1QVF S;  3H8Z A;  3JCM c;  2DLP A;  3SWN C;  1IRE B;  3WVE B;  1JBM A;  1QVF P;  2G6F X;  1UE9 A;  3REB B;  5DLO A;  1VQK Q;  5GMK i;  2CP7 A;  5DY9 A;  2YRD A;  4AT1 B;  2C0I A;  5GAM h;  2BZX A;  1YHQ Q;  4A4F A;  3EG2 A;  2QI2 A;  4ATO A;  3JB9 F;  2OJ2 A;  2MPX C;  3L2Q A;  1VQ4 T;  2HSE B;  3CCR A;  1KQS A;  2HD0 A;  3L2W A;  2CP2 A;  5L8R E;  4EMG A;  3MP8 A;  1QP3 A;  3VJP A;  3TSZ A;  2F2V A;  1XQH A;  3VUZ A;  4OB1 B;  3S3O A;  4M7D C;  1K0X A;  2X4X A;  1BI3 A;  3L2R A;  2JN0 A;  3CC7 T;  3VRY A;  1UFF A;  1NJI U;  1T3S A;  1B34 B;  1IO6 A;  4J9I A;  4J6X A;  5I21 A;  4LDU A;  3JV3 A;  1JJ2 P;  1HXD A;  3PIO A;  1ZUU A;  2NLU A;  4DOV A;  2K9G A;  2EAY A;  3WVD B;  3IQL A;  4RTT A;  5GAO l;  5LJ5 e;  2CRE A;  3KXT A;  1NPR A;  1OOT A;  4HVW A;  3EG9 A;  2ECZ A;  2EJF A;  3LH5 A;  4A53 A;  2GFU A;  2FEI A;  1KJW A;  2EBP A;  1ZA2 B;  3DKM A;  1AOJ A;  2DMO A;  2I0N A;  1EFN A;  2SRC A;  5IXB A;  2QQR A;  4F7U G;  4IUT A;  4XTU A;  4C8Q C;  3JCM g;  2O88 A;  2E5Q A;  3MEA A;  1MUZ A;  4M7D F;  4IKF A;  2OTJ T;  5J39 A;  2LCL A;  2XK0 A;  1QKW A;  4JUV A;  3M57 A;  2XKO C;  2LT1 A;  3JCM b;  2YWW A;  5GAN 3;  3C94 A;  4ANJ A;  2QTV A;  5LJ5 d;  4M77 A;  1VQP A;  1VYU A;  4BD3 A;  4N0A C;  2A28 A;  5LJ5 f;  3JB9 I;  2PVO B;  3M56 A;  1M90 C;  5IH2 A;  3CCL Q;  1RAC B;  1M27 C;  1G5V A;  3OSV A;  2KR3 A;  3HP9 A;  1K8A R;  2M51 A;  2HBP A;  1YIT T;  4J7I A;  1YIJ Q;  4PJO B;  3G4S T;  2BZY A;  3CXC A;  1SRM A;  2E6N A;  2EGA A;  1QMC A;  3OB9 A;  3CCQ A;  1R8O B;  1VQ7 A;  3HKS A;  2NYS A;  1ZQ1 A;  5M9O A;  3MCA B;  4PJL A;  1AVZ C;  4FYY B;  2BE9 B;  4JJN K;  3CCU A;  2X51 A;  3OYC A;  2G3R A;  4A54 A;  1YJ9 T;  4E7S A;  5GAN e;  3INZ A;  1GL5 A;  2X3W D;  1D1C A;  2P0Q A;  4C8Q F;  4A4E A;  4BE0 A;  1M2O A;  4PLL A;  1WJS A;  2IPO B;  2K57 A;  2CUD A;  1SHF A;  5HY6 A;  3CPW S;  4ORZ A;  1XOV A;  2E4H A;  3QII A;  3CCV T;  3NFC A;  4PFP A;  1LPL A;  1QVG S;  3GOX A;  4E7K A;  2DIQ A;  2K5F A;  4M7A B;  2FHD A;  2FPE A;  4DBF A;  4DEX A;  3M0Q A;  1VQK A;  1UB4 A;  3CD6 Q;  3OYD A;  2X4Y A;  5FW9 A;  3EGD A;  4BY6 B;  3EFO A;  1ZUY A;  2DXB A;  4FW1 A;  1YHQ A;  4OMM A;  2EFI A;  2V8I A;  1MMN A;  3QG1 A;  4FYW B;  2O2O A;  2RHU A;  4ZGD B;  4PJO D;  1RI9 A;  3OYI A;  1Q81 U;  1WI7 A;  1M1K C;  4OML A;  2M16 A;  2OX7 A;  2RF0 A;  1N8R C;  4M78 A;  3VS4 A;  5IN1 A;  1KC8 C;  1M90 R;  3MEW A;  2QDY B;  4HXJ A;  3CBP A;  5GAN f;  4VUB A;  1RL2 A;  2DVJ A;  4ZTJ A;  4X1V A;  2V1Q A;  1GBQ A;  4XAX B;  2QXF A;  1VQ4 Q;  3C12 A;  5FU6 C;  5LJ5 j;  1BIA A;  4LE9 A;  4ZGJ B;  2I2L A;  1WGS A;  5GAN 6;  4M75 E;  2ZPF B;  1WJR A;  2BUD A;  1VQO T;  2D8J A;  3TCJ A;  5GAO n;  4FSS A;  4LD6 A;  1GFD A;  4PFO A;  2HKN A;  4PJO G;  1K8A U;  2VAS A;  5KYX B;  1WNL A;  1SSF A;  1WA7 A;  2K79 A;  1Q7Y C;  3CC7 Q;  2EQK A;  4J9B A;  3OBW A;  4BUG A;  5LJ5 g;  2P4T A;  5KE3 A;  2GQI A;  4J9G A;  1Y71 A;  1UGV A;  3AHU A;  5GAM e;  2CZ7 B;  4M77 E;  2DRK A;  4M75 B;  1Y57 A;  2GGR A;  3UWN A;  1ABQ A;  2HZY A;  4XTZ A;  3OW2 S;  3DLM A;  3GBQ A;  5KYW B;  3X20 B;  2RI5 A;  2PVG B;  4N4G A;  1IGU A;  3H6Z A;  2XDP A;  1MND A;  1I8F A;  3PMI A;  3VV0 A;  1H92 A;  2A0F B;  2DZC A;  5D6W A;  5CQX A;  4PK4 A;  4JRK A;  4ZTF A;  4JJB A;  2F1L A;  3JCM W;  3S3N A;  3VRZ A;  1UEB A;  2FPF A;  1YFN A;  2F2W A;  2PUK B;  2JMC A;  5GMK l;  3EFS A;  1SRL A;  2RA2 A;  3V8J A;  1E6G A;  4J8O A;  2JS2 A;  2MMP A;  9ATC B;  4R0K A;  4KH0 B;  5I2M A;  2XD0 A;  3CCL A;  1O9S A;  2A7Y A;  5FWC A;  2VB6 A;  8ATC B;  4F04 B;  2BZ8 A;  1Q86 C;  5GAM d;  4C92 C;  1M90 U;  3REA B;  1YIJ A;  5GAM f;  5GAN j;  3NMZ C;  2AT1 B;  1V29 B;  3A5Z B;  5GAN 2;  3OA6 A;  4M77 C;  2JS0 A;  2CH4 W;  4Y28 E;  2RJE A;  3R6N A;  1Q7Y R;  3CEY A;  1KIK A;  1U5S A;  1NLO C;  1YIT Q;  1QQJ A;  1YNZ A;  4LN2 A;  1YJW T;  2QGF B;  3G4S Q;  5GAN 4;  5CQY A;  3ZFJ A;  2L0A A;  2LQN A;  5GAN g;  4J83 A;  1OX8 A;  2DVE A;  2LVM A;  2DJQ A;  2YUQ A;  1ACM B;  5GJV B;  2EJ9 A;  1NEB A;  4QW2 A;  1YJ9 Q;  1T3L A;  2V1R A;  4DBH A;  1OZ3 A;  1QCF A;  1EZZ B;  3E9G A;  2R5M A;  3OYL A;  4LUE A;  3CD6 A;  1I07 A;  3MET A;  4Q5W A;  1OUL A;  3CCV Q;  4V2S A;  1AWJ A;  3PVQ A;  4C5E A;  4J7F A;  2GBQ A;  3QWY A;  4RUG A;  1SHG A;  5GMK h;  3P8B B;  4C5H A;  1OPK A;  1M3B A;  4C92 F;  3UF4 A;  3OYK A;  4ZGE B;  2JM9 A;  1MMG A;  5D6X A;  1RAE B;  1D1B A;  3JCM Q;  4N4H A;  2KXC A;  1K9M R;  2CT4 A;  1QVF A;  2KSS A;  2QQA A;  1I0C A;  1Q86 R;  3ULR B;  1VQ4 A;  2KY9 A;  4XTX A;  3FIF A;  3BE3 A;  2Y4X A;  3HHT B;  4JPB W;  2RJD A;  1QKX A;  4M78 C;  1WHL A;  1G3W A;  1NG2 A;  2DFU A;  2H3J A;  4XTW A;  1W70 A;  2NUZ A;  5GAM j;  2KT8 A;  2MIO A;  2B8A A;  2LJ0 A;  3CC7 A;  4MMK A;  4RG2 A;  1JXM A;  4C8Q A;  3RKY A;  4IUR A;  1C1A A;  2NUT B;  1VQO Q;  3OS0 A;  2CKK A;  1Q7Y U;  3M4G A;  2QQ9 A;  2PUO B;  3I9Q A;  3F70 A;  3HTR A;  2FVU A;  1D0X A;  3I35 A;  5FRO A;  3VS6 A;  1IHV A;  1VQN T;  4FL6 A;  1GBR A;  4C0D C;  2JT4 A;  3VYH B;  5GAM g;  2VGN A;  4AG1 C;  1GRI A;  2E3H A;  3EG1 A;  3UT1 A;  5IHN A;  2EYX A; 
#chains in the Genus database with same CATH homology
 2E6Z A;  1P92 A;  2LX9 A;  5CCA A;  1HXD A;  4GLK A;  3PIO A;  1S72 A;  2EQM A;  2ZCF B;  2CZ0 B;  2LNV A;  1X6O A;  1QP2 A;  3HRS A;  2RHX A;  4WF2 A;  4E7I A;  2NLU A;  2LRQ A;  4DOV A;  2X35 A;  3C4S A;  3L2V A;  2XI9 A;  2EAY A;  1M8V A;  3A8L B;  4XTV A;  4BB7 A;  2WSE E;  3WVD B;  3LWI A;  3GNG A;  3OYF A;  2Y4Y A;  5LJ5 e;  5GAO l;  1KQ1 A;  5A2Q E;  3KXT A;  4Z02 A;  1NPR A;  1YIJ T;  1NZ9 A;  1D3B A;  3JCM h;  2KDS A;  5I2S A;  2EJF A;  2R57 A;  3E1S A;  3VUB A;  1Y7X A;  1VQM A;  4BE1 A;  4M78 E;  2HAX A;  4JRQ A;  2F5K A;  4M78 F;  1M5Q 1;  2GFU A;  3X26 B;  2L89 A;  3GLX A;  4A53 A;  3FJP A;  1GXI E;  5GAN 7;  5A0L A;  3LLR A;  2QEX T;  1N9R A;  3X25 B;  3QYH B;  5CR2 A;  3CC2 A;  3BY7 A;  1VIF A;  1S72 T;  4L6V 5;  3FDR A;  2MI6 A;  1BI1 A;  4M75 G;  3QJY A;  4PL6 A;  1H3Z A;  3DKM A;  3HRT A;  4M7A C;  5KE2 A;  2ZGW A;  2EQU A;  5GAN d;  4MZM A;  3RES A;  1KG1 A;  4HT8 A;  5AYF A;  2L5Q A;  4BY6 C;  1AHJ B;  2QQR A;  3V7R A;  4F7U G;  4IUT A;  4FSX A;  2QTX A;  4XTU A;  4EDU A;  3MP1 A;  1VQM T;  1K9M U;  3JAM E;  2E64 A;  4C8Q C;  3FB9 A;  3JCM g;  5GMK m;  3SWN B;  1BYM A;  4FIB A;  2PU9 B;  2ZPB B;  1EIF A;  2E5Q A;  4QQ6 A;  4QVZ A;  4F7U A;  5CAI A;  2CYZ B;  3MEA A;  4M7D E;  3CC2 T;  3TU4 K;  3V7S A;  5LJ3 d;  4KUI A;  4M78 B;  4M7D F;  2VUB A;  2DPP B;  4IKF A;  2JVV A;  2OTJ T;  5LJ3 f;  5J39 A;  3OYJ A;  5GMK j;  2LCL A;  2RK2 A;  1G3T A;  3CC4 A;  4LD9 K;  2XK0 A;  5GAO p;  3P8D A;  4JUV A;  4D6W A;  1YI2 A;  2O4X B;  1YIT A;  2MWO A;  3M57 A;  2XKO C;  2WSC E;  2LT1 A;  2XG8 D;  4M77 G;  2PVD B;  4XU2 A;  1U1T A;  5HK0 A;  3JCM b;  3G4S A;  5C0M A;  1M1K U;  3SB2 A;  3BDL A;  5GAN 3;  4YTL A;  3C94 A;  3CME A;  1PSF A;  2ZPI B;  4X9C A;  5LJ5 d;  1H64 1;  4M77 A;  3QO3 A;  1VQP A;  4BD3 A;  4N0A C;  1N8R U;  5LJ5 f;  2VV5 A;  3SD4 A;  3JB9 I;  1KC8 U;  2RD1 A;  2R58 A;  2PVO B;  3M56 A;  1M90 C;  1ZHI A;  3HFO A;  4CRI A;  2K5L A;  2LCC A;  2L3R A;  2GQV A;  1KD1 U;  3P8H A;  5CK9 A;  1G5V A;  1X01 A;  2QQS A;  3OSV A;  3OYG A;  3HP9 A;  3T9N A;  1WQW A;  1NJI C;  3EFR A;  3CC4 T;  2BKD N;  5I21 A;  1YJ9 A;  2HBP A;  2RB6 A;  1YI2 T;  1U8R A;  1YIT T;  4M7D B;  4XTY A;  1X75 C;  1BKB A;  4J7I A;  3CCE T;  4KUL A;  4C92 B;  2EQJ A;  2RHZ A;  2KQW A;  2K3X A;  4PJO B;  3G4S T;  2RH2 A;  3JSC A;  3V8K A;  2YHT A;  3CXC A;  1M1G A;  2E6N A;  3CME T;  3OB9 A;  3ASK A;  4E47 A;  2E70 A;  3HSB A;  2E1H A;  4NL2 A;  4EMK C;  1VQP T;  3CCS A;  4KUD K;  3CCQ A;  4LDX A;  2KK4 A;  3CCV A;  1R8O B;  1VQ7 A;  3HKS A;  2DTO A;  2E10 A;  3NTI A;  1ZQ1 A;  5CKH A;  5M9O A;  3CXC S;  1PSE A;  3MCA B;  3LH0 A;  1I81 A;  3M55 A;  1B34 A;  3TEE A;  5FRM A;  4JJN K;  2YRV A;  3CCU A;  2DTH A;  3M5A A;  5FRN A;  3OYC A;  4JS4 A;  3KUF A;  2G3R A;  2P0P A;  3G7Z A;  1U1S A;  4OMF B;  1M9S A;  4A54 A;  4RCB A;  5GAN e;  3JCM J;  4XU3 A;  3INZ A;  1VQ6 T;  2D6F A;  3PTA A;  4R56 A;  3OYA A;  3CPW A;  3CMA A;  2LQK A;  3OSS C;  4C8Q E;  4HCB A;  4M75 C;  2P0Q A;  3SFM A;  1VQ5 A;  4C8Q F;  4A4E A;  4BE0 A;  1YJ9 T;  4PLL A;  1N9S A;  1WJS A;  3LWH A;  2A3L A;  3SDZ A;  2K57 A;  4ZN1 A;  3PFS A;  2MF2 A;  5J3B A;  5HY6 A;  3QZ5 B;  3CPW S;  1XOV A;  3MEU A;  2DEQ A;  3QII A;  4XQ3 A;  3CCS T;  3RKX A;  3GNF B;  4JLI A;  3CCQ T;  3CCV T;  1QVG A;  1JJ2 A;  1VQ7 T;  3OS1 A;  3NFC A;  4DOW A;  3QSU A;  3JCM X;  3UPU A;  3RKW A;  3CCU T;  1QVG S;  1JJ2 S;  3GOX A;  4E7K A;  3LW5 E;  2DIQ A;  2K5F A;  1KHC A;  4JLG A;  4M7A B;  2FHD A;  4C5G A;  1K9M C;  1DJ7 B;  4FM4 B;  2PQW A;  1VQK A;  3URG A;  1UB4 A;  2CZ1 B;  4PNO A;  3M58 A;  3OYD A;  2X4Y A;  2LQ8 A;  5GAN h;  3CMA T;  4BY6 B;  3RUX A;  1VQ5 T;  3ME9 A;  3MP6 A;  4O6J A;  1FWZ A;  2DXB A;  5IT9 E;  1OYX A;  5HK3 A;  1YHQ A;  1K73 C;  1G3S A;  2KAF A;  4IUP A;  2EFI A;  1NE8 A;  2V8I A;  3QG1 A;  1N27 A;  4QQG A;  3X28 B;  1W4S A;  4HKE A;  2HQE A;  3QYG B;  4C92 D;  3FC3 A;  2CGH A;  2RHU A;  4ZGD B;  3J7A F;  1M1F A;  4MDX A;  4PJO D;  2DTI A;  5CO7 A;  2BIV A;  3OYI A;  1Q81 U;  1M1K C;  4OB3 B;  4QVD A;  2R5A A;  1VQ8 A;  2F5T X;  3SWN A;  5LJ3 h;  4M77 D;  3OMG A;  2M16 A;  2XID A;  4EPC A;  1VQO A;  5CKF A;  3OYN A;  5GAO r;  3HL8 A;  2JNG A;  1N8R C;  3O8V A;  2JUF A;  4M78 A;  2MAM A;  5LL6 S;  3DB4 A;  5LJ3 j;  3OYM A;  5IN1 A;  1VQK T;  4JS5 A;  1KC8 C;  2RHI A;  4BAC A;  3A8M B;  1IZ6 A;  2QDY B;  3MEW A;  1YBY A;  2O4X A;  1Y07 A;  2EYQ A;  2JOY A;  4IUU A;  4J6W A;  3CBP A;  1YHQ T;  2DK3 A;  5GAN f;  4VUB A;  1RL2 A;  1I4K 1;  1UGQ B;  3OQ5 A;  3OYY A;  3ER0 A;  3VKI A;  4ZTJ A;  5KCH A;  4XAX B;  2YLC A;  4BI8 B;  5LJ5 h;  4J5Y A;  4XU1 A;  2QXF A;  3C12 A;  3OY9 A;  1FXX A;  2OAU A;  1VUB A;  5FU6 C;  3WXM B;  1BIA A;  4ZGJ B;  5LJ5 j;  1KQ2 A;  2I2L A;  4OVA A;  3L42 A;  1WGS A;  5GAN 6;  1VQ8 T;  1UGR B;  2AHJ B;  1Q86 U;  4M75 E;  2ZPF B;  1WJR A;  2BUD A;  4M75 F;  5D6Y A;  5FU7 B;  1VQO T;  2JTM A;  3QDR B;  3TCJ A;  3RIR A;  5GAO n;  3S3M A;  5CKB A;  4C92 G;  3DB3 A;  4XK8 E;  3Q1J A;  4LD6 A;  5LJ3 g;  1K8A U;  4PJO G;  4C0Z A;  3JB9 D;  4OGC A;  1WNL A;  3GIB A;  4BDZ A;  2RO0 A;  2XU8 A;  4M7D A;  1SSF A;  4C92 A;  4F7U E;  1BI0 A;  3JCM d;  1FX7 A;  3L2U A;  4EMK B;  4F7U F;  1Q7Y C;  4PJO A;  4A4G A;  2EQK A;  2D0Q B;  1WQ7 A;  2F69 A;  3QKJ A;  3OBW A;  2CZ6 B;  4BUG A;  1WPY A;  1BIB A;  3OBY A;  5LJ5 g;  2P4T A;  4L59 A;  5KE3 A;  1OI1 A;  3PT9 A;  4A4H A;  3J81 E;  1Y71 A;  1I5L A;  3OW2 A;  3OYH A;  5GAN 8;  3AHU A;  2MWP A;  3RMS A;  2CZ7 B;  5GAM e;  4M77 E;  1N6A A;  4M75 B;  2JTF A;  3ZBD A;  4HCC A;  2X4J A;  3UWN A;  4M77 F;  2RJC A;  2K3Y A;  2HNI A;  4XTZ A;  3OW2 S;  4DA4 A;  2VYT A;  2IVW A;  4C0D B;  2QQB A;  4GY5 A;  5HKC A;  3DLM A;  2DJZ A;  3I56 A;  2M1H A;  2M9U A;  3L2Z A;  3X20 B;  3JB9 J;  3CCJ A;  1LJO A;  2E41 A;  3JB9 G;  5GAO m;  2QA4 A;  3JB9 H;  2KMT A;  2RI5 A;  2PVG B;  2FB7 A;  3H6Z A;  4N4G A;  2LT4 A;  2XDP A;  3RMQ A;  4FU6 A;  3C95 A;  3BDU A;  1Y96 B;  1I8F A;  3PMI A;  3VV0 A;  2RHY A;  2DZC A;  3HFN A;  5D6W A;  5CQX A;  1W2B A;  1BI2 A;  1MGQ A;  2V8J A;  4JRK A;  5GAO q;  4ELY C;  3OYE A;  1LNX A;  5CKE A;  4ZTF A;  4KBM B;  2CS7 A;  3G6E A;  4M7A A;  1QVP A;  4PLI A;  1Q81 C;  3PGG A;  3QBY A;  1LOJ A;  3OS2 A;  3CPF A;  4QQD A;  3JCM W;  3S3N A;  1YJN A;  1UEB A;  4UC4 A;  3M9Q A;  1W2B S;  2PUK B;  4M78 D;  3FLG A;  5GMK l;  3I56 T;  3CCM A;  3EFS A;  2RA2 A;  3M53 A;  3V8J A;  3I55 A;  3NTK A;  2FYK A;  2K4Y A;  2RJF A;  2ZPG B;  2MMP A;  4J8O A;  3CCJ T;  5EG2 A;  1Q82 U;  4E7J A;  2QA4 T;  5I2M A;  2IG0 A;  1XNI A;  2V8K A;  2EWN A;  2XD0 A;  3MEV A;  1KHI A;  2EJG A;  3CCL A;  3QUI A;  1O9S A;  3OYB A;  1M4Z A;  3A8O B;  1TH7 A;  2A7Y A;  4JRI A;  2KVQ G;  2WAC A;  4X34 A;  5KH6 A;  4RG8 A;  3A8H B;  2DO3 A;  3PIP A;  3G6E T;  2XHC A;  1YJW A;  4FT2 A;  2DZ9 A;  5IAY A;  1MHN A;  3JCM e;  5GAM d;  1YJN T;  1Q86 C;  4OP0 A;  4C92 C;  1M90 U;  4HCZ A;  4JDS A;  1YIJ A;  5GAM f;  3G71 A;  3N5B B;  4C0F A;  3J80 E;  3CCM T;  4BDY A;  3A5Z B;  1V29 B;  4OF1 A;  3I55 T;  5GAN j;  3CBM A;  3FRN A;  2K5I A;  5GAN 2;  5DLQ E;  3OA6 A;  1K8A C;  4C8Q B;  4NOY A;  4M77 C;  4M7D D;  4LDV A;  4N0A A;  4Y28 E;  2LDM A;  2RJE A;  3UDC A;  4PJO C;  2EKO A;  1HK9 A;  4M78 G;  2QEX A;  2C06 A;  5KCO A;  3CCL T;  1XTD A;  3CEY A;  4LDY A;  5A0G A;  3GP8 A;  3E9F A;  3NTH A;  2DD5 A;  4RCC A;  3QHS A;  2JZ2 A;  4IUQ A;  4NL3 A;  4OB0 B;  4ELZ C;  4RKU E;  4HA8 A;  1YJW T;  2GCX A;  4IUV A;  2XIC A;  2DD4 A;  5GAN 4;  2O01 E;  5CQY A;  1G3Y A;  3EAE A;  4OB2 B;  4MML A;  3M54 A;  3GPL A;  3G71 T;  1KD1 C;  2VXE A;  3ZFJ A;  2RI2 A;  5GAN g;  4J83 A;  3A8G B;  4EMK A;  3DLL A;  4BI3 A;  2DVE A;  4NS5 A;  4MZP A;  3BFM A;  5FLX E;  4B9W A;  3KBG A;  2OTL A;  2LVM A;  5GMK e;  3FEO A;  4ZN3 A;  1VQ9 A;  2XDB A;  3L1A A;  2EJ9 A;  1JB0 E;  4X9D A;  3X24 B;  2M0O A;  1VQL A;  4QW2 A;  2GFA A;  2OTJ A;  4M7D G;  4E7H A;  3LGL A;  1OZ3 A;  4CI0 C;  2RK1 A;  4N4I A;  4O5V A;  4BI4 A;  4R55 A;  3V8L A;  1VIE A;  3E9G A;  1QW1 A;  2R5M A;  4M75 A;  4MDW A;  1D3B B;  3MO8 A;  4PKC C;  3OYL A;  3CD6 A;  2DKG A;  5DM7 R;  3LYI A;  3LGF A;  3R6O A;  2D9T A;  2WSF E;  4M7A D;  2GF7 A;  3MET A;  4Q5W A;  2DAQ A;  3M59 A;  3JCM f;  4V2S A;  1UGS B;  3HRU A;  2K2V A;  2OTL T;  4BE2 A;  2RI3 A;  4C5E A;  2L8D A;  2DXC A;  2RM4 A;  4J7F A;  1VQ9 T;  5GAN 5;  5J26 A;  3GF5 A;  4L5G A;  5GMK h;  3P8B B;  4C5H A;  1VQL T;  4C92 E;  2E65 A;  3VU3 C;  1K73 U;  4C8Q D;  4KT0 E;  4C92 F;  4PJO E;  1Y96 A;  1Q82 C;  3PMT A;  3OYK A;  4PJO F;  4ZGE B;  1NPP A;  4JRP A;  2YLB A;  4C5I A;  5D6X A;  3CCE A;  2LTO A;  4MZT A;  4TVR A;  3JCM Q;  3QZ9 B;  3CD6 T;  2VXF A;  4N4H A;  3MHX A;  4J6Y A;  2XDD A;  3OS5 A;  3PNW C;  4A4K A;  4XU0 A;  2DXT A;  3LX7 A;  1QVF A;  3E19 A;  3JRZ A;  2KSS A;  2QQA A;  4RMO A;  4OGE A;  4C0G A;  2X4W A;  4F7U B;  2FL7 A;  1VQ4 A;  2VGM A;  2KY9 A;  4XTX A;  3QJ6 A;  1QVF S;  3H8Z A;  3FIF A;  3JCM c;  1UGP B;  1ZBX A;  4M7A G;  3SWN C;  3HPW A;  1IRE B;  3WVE B;  1JBM A;  4B9X A;  5DLO A;  2Y4X A;  3HHT B;  5FU7 C;  2RJD A;  1VQ6 A;  4M78 C;  5GMK i;  5DY9 A;  2ZPE B;  3QPH A;  3CBO A;  5CVI A;  2EIF A;  3BW1 A;  2P0K A;  5GAM h;  1G3W A;  2VC8 A;  3JCM V;  5C6S A;  2H3J A;  4XTW A;  4P5N A;  2HQX A;  1VQN A;  3M4Y A;  4C8Q G;  5GAM j;  4A4F A;  4M77 B;  4ME7 A;  2QI2 A;  2ZZD A;  4ATO A;  3VYG A;  2B8A A;  3JB9 F;  2DIG A;  3CC7 A;  4MMK A;  5CIU A;  4RG2 A;  4M7A E;  3L2Q A;  1O75 A;  4C8Q A;  4DQ2 A;  4LDW A;  3RKY A;  3CCR A;  1VQ4 T;  1KQS A;  2HD0 A;  4M7A F;  3L2W A;  1WJQ A;  4IUR A;  3S6W A;  4II1 A;  3OS0 A;  1RI0 A;  5L8R E;  4EMG A;  2CKK A;  3MP8 A;  1Q7Y U;  1QP3 A;  3M4G A;  3VJP A;  2QQ9 A;  2PUO B;  2ZPH B;  4HT9 A;  1KQS S;  3F70 A;  1XQH A;  3VUZ A;  2FVU A;  4QVC A;  3ZEH A;  4OB1 B;  2LC4 A;  5FRO A;  3S3O A;  2DXU A;  3OMC A;  4M7D C;  2X4X A;  5A0D A;  2E12 A;  3V7C A;  2Y90 A;  1VQN T;  4FL6 A;  4C0D C;  3VYH B;  5GAM g;  4EMH A;  1BI3 A;  2VGN A;  3L2R A;  5CKD A;  5FU6 B;  2JN0 A;  3CC7 T;  4M75 D;  1YCY A;  1NJI U;  3CCR T;  1OZ2 A;  4FT4 A;  3JCM P;  1B34 B;  1JRI A;  3UT1 A;  5LJ3 e;  4E7L A;  3QXE B;  3TRE A;  4Y91 A;  3RER A;  4J6X A;  4LDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...