5HK3A

Crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
VISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNDALAAMPGNVDLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF6
publication title Crystal structure of M. tuberculosis MazF-mt3 T52D-F62D mutant in complex with DNA
rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Hydrolase/dna
total genus 27
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2016-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5hk3A00
4MZPA 5CQYA 5CCAA 2VUBA 1X75C 4HKEA 3JSCA 1VUBA 5CQXA 5CKHA 5CKDA 4MZTA 1UB4A 4ELZC 4MZMA 1NE8A 5CK9A 3TCJA 4MDXA 3G7ZA 1M1FA 5CKBA 4ME7A 5CKFA 5CO7A 3NFCA 5CKEA 4VUBA 5HK0A 4ELYC 5CR2A 3JRZA 5DLOA 2C06A 4OF1A 5HKCA 2KMTA 5HK3A 2MF2A 3HPWA 3VUBA
chains in the Genus database with same CATH superfamily
3CCMA 4A4EA 3C4SA 2ECZA 4FIBA 1WHGA 3OYAA 3UATA 1C0MA 2RH2A 4N0AC 1OPLA 4QVDA 2JMAA 5CIUA 1QMCA 4M78C 2AKLA 4J9HA 2CUBA 4BE2A 2X9HA 2VB6A 3HFOA 4IIMA 2QA4T 1M30A 4M78D 2C0IA 3UT1A 3AT1B 2J6OA 1TG0A 2DNUA 5J3BA 2PTKA 1SRLA 5GAN3 2Y90A 1YFNA 4KGZB 3A98A 1Z9ZA 2K6DA 1NEBA 1GL5A 2M0OA 2DL8A 1VOMA 3LH0A 4PJOF 4OB3B 2QQBA 4E7SA 1JEGA 2JM8A 1R77A 3EH2A 2DO3A 3EGXA 3V8JA 4AT1B 1OEBA 1YP5A 2MOXA 2O9VA 5GAMe 1FXXA 2L3SA 1PWTA 1TOVA 1Q7YU 2ED0A 3TU4K 1N9RA 2LJ3A 3BW1A 1VQLA 1NZ9A 2JOYA 2ZPHB 4HVWA 5HKCA 2RD1A 2QQ9A 3LGLA 5I21A 1GCQA 2MWPA 4FYWB 5GANh 3CCMT 3CMAQ 1WDXA 5GAOp 4C8QC 3NHNA 1FWZA 2R5AA 1VA7A 2G6FX 1Q82U 1PCXA 2HEQA 2DEUA 4C8QD 1U06A 2BZ8A 2QYZA 4DA4A 3G4SQ 3JCMg 2BZXA 4RKUE 4A4FA 2J06A 1WFWA 2ABLA 3EHQA 1G83A 3SWNC 1UDLA 1OZ2A 1WPYA 4Y91A 1QP2A 2JJ9A 1D0XA 1VQKA 3RR6A 1GBRA 2QQRA 2ZPFB 3GPLA 4BACA 3P8HA 4FM4B 4HA8A 2EQIA 1SSFA 1WJQA 4F7UB 1AWWA 1AZEA 2OAUA 2EQKA 1VQOQ 3EG9B 3JCMb 3N5BB 5D6WA 4J9GA 1K8AC 1G3SA 2E3HA 3M9QA 2DMOA 2PVDB 1MNDA 3UA6A 4N4HA 1S72A 3I55A 1VQNA 2V8IA 2AZSA 2CZ6B 2ZPEB 1YHQA 1VQLT 3VKIA 4LDVA 2ATCB 1WX6A 3ER0A 1U3OA 2L2PA 3OMCA 2MI6A 2OJ2A 3QG1A 1NJIC 2LNVA 2X4WA 1M1KU 4M7DC 2K7AA 4OMOA 3CCUQ 1VQ5A 3T9NA 4MDXA 4M7DD 3CCLA 2LCLA 4OB0B 1GRIA 2K3YA 5IH2A 3TEEA 2F2XA 1QKXA 2FEIA 4RUGA 3VS7A 5L8RE 3L1AA 4EIKA 3DB3A 2A28A 2D6FA 1RAHB 1CKBA 2RO0A 1VQKT 1TUCA 3OSSC 4D8KA 2NUTB 5CVIA 1LPLA 2EW3A 2RJCA 3RMQA 5LJ3g 3MKDA 3CCSA 3CBOA 3WVEB 1IZ6A 3J7AF 3HL8A 1YITQ 3GOXA 1N8RR 1LVKA 2P4TA 3KBGA 4KBMB 1VQ9Q 3G71A 1Y96B 1CKAA 1QW1A 4XTYA 1YWOA 1GFCA 2XKOC 3I55T 1VQNT 1UE9A 2CZ1B 1F1BB 1YHQT 2KT1A 3JB9D 4BE1A 3SEMA 4NS5A 3QXEB 3C94A 4NOYA 3RBBB 2DTOA 2K3BA 1NE8A 1VQ5T 3R6OA 5GAMh 4CRIA 1TH7A 2CH4A 1I0CA 3JCMd 2LQKA 4HCZA 2HZYA 2LCCA 1AD5A 2E10A 1QLYA 3SDZA 2WSCE 1K4US 2W0ZA 3FRNA 3MEAA 2MYSA 2K9GA 1QCOA 1RACB 2EYWA 3CCQQ 6AT1B 1B34B 1UGSB 3G7ZA 1TUDA 2A37A 3M0SA 1N27A 4M75G 3CCST 3CC7A 4Z02A 3THKA 1IREB 1IGUA 3U23A 3E2UA 3OY9A 1WXBA 1IO6A 4PNOA 2QGGA 3GIBA 3GBQA 2CS7A 2KBTA 4R55A 1K1ZA 1W4SA 2X3WD 1QP3A 2DM1A 2AHJB 4KH0B 2XIDA 3G71T 2BE9B 4ZTJA 2HMAA 2EWNA 1XJWB 1PSFA 4KRTA 1HJDA 4MMLA 4QQDA 5CO7A 1Z9QA 2NYSA 2KRMA 4C5EA 4GBQA 1IGQA 1M8MA 3OA6A 2DK3A 1G5VA 2YLCA 1XQHA 2CREA 2K2MA 2JTMA 1SG5A 4OB2B 1T3LA 3C12A 2LX9A 4XQ3A 1WI7A 3OYDA 3LLRA 4AG2C 3EG1A 1KG1A 1PG5B 1BK2A 1D3BB 3H6ZA 4J7IA 2DXUA 3VS0A 1N6AA 2CP2A 3LX7A 4Z89A 3AHUA 1M9SA 4OVAA 3OS5A 4RG2A 1PD0A 3IQLA 3KUFA 2KAFA 2COZA 3TSWA 4ZNXA 5GANj 1ARKA 1AHJB 3NTIA 3PMIA 2LZ6B 1PSEA 3QWYA 1D1BA 3REAB 3ULRB 1OX8A 3EFOB 1PNJA 2QAZA 5LJ3d 3DKMA 3NGPA 1SPKA 3O8VA 2XD0A 1G3YA 2DJZA 3CC7T 2D8JA 4JRIA 4Y28E 2K79A 2E4HA 1UG1A 2LX7A 3VYHB 1EZZB 2RK2A 3CCJQ 5GANf 2X4YA 1AWXA 3I9QA 1T0JA 1VQMQ 2AKKA 1HXDA 3A8MB 3QWXX 2OTJQ 4JRKA 3EG3A 3PMTA 4HVUA 1WXUA 2HKQB 4R56A 4VUBA 2KNBB 3CQTA 4IUPA 4PFPA 2X3XD 1WLPB 1RUWA 2CDTA 3GP8A 3QYGB 2A08A 3A5ZB 1X2KA 3JSCA 3VS3A 4C92C 4FL6A 1D1AA 2L3QA 2XHCA 3OYEA 5KCHA 2DKGA 2PU9B 4M75F 3QJYA 3FJPA 2YT6A 3OSVA 5LL6S 1MMAA 3JCMh 4II1A 3X25B 4C92D 4EMHA 1GCPA 4EMGA 3A8OB 1OU9A 1YCYA 2CSIA 5GMKj 5FWCA 1VQ7A 2XMFA 5AT1B 5LJ5d 2P0QA 2VGNA 2RHZA 1ZX6A 3MP1A 1K8AR 1Q95G 1QVFS 3M5AA 4PFZA 4DBFA 1VQPA 4PJOB 2XDBA 2VV5A 1WJRA 4M4ZA 2K5FA 1RLPC 4JDSA 4M7AG 2K3XA 1MGQA 1BKBA 3WVDB 3M0TA 3CBMA 2OTLQ 4IUUA 4J9FA 3QKJA 2A7YA 2YUQA 3MEVA 1N9SA 1Y07A 1NJIR 3I56A 5GAN2 2AIRB 4OB1B 1M5Q1 3MEUA 2QQSA 1K9MC 4D8DA 5A2QE 1QVFP 1M4ZA 2DX1A 4M77G 3X26B 5CKBA 1AOJA 2GTJA 1SSHA 3NTKA 4J7FA 2EKOA 2P84A 2RJFA 5D7UA 2GNCA 4OP0A 4JPBW 3L2ZA 1I5OB 4CC7A 4UC4A 1RAAB 1ZA2B 1M1GA 3M59A 3VV0A 1Y96A 1ZA1B 1VQ7T 3H0IA 1KD1C 5GAN4 3CCEQ 3NPFA 2COWA 1R0CB 1M27C 3M55A 4M78B 5HK3A 4JJBA 5GMKm 1YNZA 4PJOC 5CAIA 3VUBA 2DFUA 2EQJA 2FZCB 1M1KR 3PE0A 2KXCA 1I81A 3VYGA 1AEYA 1VQPT 2VXFA 5LJ3h 1VQ8A 2KDSA 1YJNA 2GBQA 8AT1B 5GMKe 5HCKA 4PJOD 2H3JA 1UJYA 2O4XB 3E9FA 2LC4A 8ATCB 2HBWA 1G3WA 2JZ2A 3R6NA 5GAOq 2JS0A 4JRQA 2FPFA 4KT0E 1H3HA 2J6KA 3CD6Q 3I56T 2ZPGB 4J6YA 1IXDA 2RM4A 1YIJA 3RKWA 2V8KA 1FMKA 2DILA 2L0AA 2R58A 4XU0A 3VS6A 2MPXC 3H41A 2HSEB 3E19A 5KYUB 3MP8A 3C0CA 3RKYA 4DQ2A 1B34A 2DIQA 3LW5E 1EFNA 2ROTA 2V26A 3OYHA 1IRXA 3PFSA 3M53A 5KYYB 3CCVA 2HSPA 5FU7C 3KFVA 2JN0A 2IIMA 2RB6A 2PUKB 3UF4A 3OYKA 3P8BB 4C8QB 1QCFA 1KQSS 3CMEQ 1ZUUA 1Q81C 1PKTA 4FYXB 5CR2A 1YITA 2JTFA 1QVGS 1VQ9A 3QSUA 2DL7A 3X24B 4LUDA 3CPWS 2KRNA 1VQ4T 5AYFA 3I5SA 3SWNB 2P0KA 4XU2A 1YJNT 4M7AE 4EMKA 3EAEA 5A0GA 2K57A 2D8HA 2HBPA 3M58A 1M2VB 1SEMA 2OI3A 3OS1A 2ZZDA 3VS1A 1ACMB 1UGPB 1D3BA 3S3NA 1NM7A 5FWBA 2FG0A 4PJMA 4WTOB 3QUIA 2DXCA 1OZ3A 2DRKA 1KQSP 3M57A 3ME9A 1YIJT 1M90C 2CZ0B 4EDUA 3PT9A 2DL4A 1QVGP 4C0DB 1NPRA 3S3MA 3PIPA 4M77E 4PK4A 4L6V5 1YI2Q 3CPWP 2P0PA 3CC4A 3CC2T 4LE9A 3BFMA 5KCOA 4M7AA 4E6RA 1OI1A 1AWJA 3EGDA 1BIBA 2NUPB 4E7KA 2BIVA 2RI2A 1K8AU 4HKEA 4FCYA 3G6EQ 2YUOA 2I0NA 3CCVT 2XICA 4M7DB 3RIRA 1BI0A 4F14A 4BY6B 3A8GB 1FYNA 1JB0E 3L42A 2LQ8A 1BI3A 4M77A 2O88A 3HRSA 1AWOA 1NJIU 1PM3A 1J3TA 1YJWA 2O01E 3OYBA 1ZQ1A 2W10A 3FB9A 2CZ7B 2JM9A 2D9TA 2MMPA 3V7RA 1MV0B 2RQUA 3I5RA 2DL3A 3GNFB 3OYYA 4DOVA 2CP6A 4J6WA 2RQRA 3JCMV 2KVQG 2LNHB 2KROA 3ZFJA 2DD4A 2E3IA 3PTAA 1QVPA 4QQ6A 4C0DC 2LP5A 5GAOn 5IXFA 4Z88A 2EQUA 3MP6A 1TS9A 2DF6A 3JCMf 4J9IA 4AG1C 5GMKh 3OYNA 3VS5A 1BB9A 2CT3A 2RF0A 3CC4T 4LDXA 4HVVA 5GJWB 3RERA 1VQ6A 2E5QA 2LQNA 4ZGDB 1NG2A 2RNAA 4XU3A 2QA4Q 5FU6B 1ZSZA 1VQ4Q 2E1HA 4BY6C 4OMMA 5I22A 4RTUA 1UGRB 4LUEA 5CKFA 5GJVB 2XI9A 1K76A 1PRMC 5KE2A 4M78E 1UHFA 2G3RA 3CCJA 4JJDA 4QT7A 1FMVA 1TU0B 4J83A 3M0QA 1MUZA 1KFZA 5KYWB 1RABB 1YJWT 4AFQC 4MZTA 3UDCA 3CCRA 2L5QA 2FYKA 1BYMA 4BE0A 3OB9A 2GCXA 4Q5WA 4QW2A 4KGXB 1XTDA 3S3OA 5GAN6 3CC2Q 2E12A 3META 4R0KA 3RNJA 1M3CA 5GAN5 2M9UA 2V8JA 3JCMW 1Y7XA 2WACA 3JCMe 4Y92A 5CKHA 3CCMQ 5LJ3j 1KHIA 4RTVA 4WF2A 1S72T 2RJEA 2KY9A 2JTEA 1KD1R 2SRCA 2DETA 1XNIA 1VQ6T 2VC8A 1W70A 5FU6C 1JJ2S 2YRCA 2RI3A 2PUOB 1ZUKA 3H0HA 1JO8A 1ZHIA 3V7CA 1KIKA 1WA7A 5LJ3f 1D0YA 1MMNA 2JNGA 2QEXA 2DIGA 2MK5A 1SHGA 4C8QE 2KQWA 3QBYA 1QVFA 1RAIB 1WQWA 4B6MA 3CCLT 3OS0A 5FW9A 5LJ5g 1K73C 1W2BA 2JT4A 1K9AA 3PNWC 4F17A 4BDYA 2EYXA 1V1CA 3QYHB 4ZN3A 2RHYA 2OX7A 3CCRT 2BE7D 3LYIA 2XU8A 4LDYA 1JJ2P 1K0XA 1OULA 4F16A 2HL3A 3JB9J 3TQ7P 2M16A 5IHNA 4GLMA 1VQLQ 3HHTB 2X51A 2R57A 3VRYA 3OYLA 3TSZA 1VUBA 2DYBA 4ELZC 1HK9A 1KQ1A 4M75C 4RMOA 1R0BG 2RHUA 2LTOA 1Q81R 4C5GA 1WHHA 3URGA 4X9DA 5FRNA 2RI5A 4M75D 4OF1A 2E65A 3A8HB 4OMNA 3HTRA 4O5VA 1KC8C 4LDWA 1SKUB 1UFFA 4XTZA 5LJ3e 1NPPA 4BUGA 3OW2S 3JB9I 4M7DE 2DZCA 4IUVA 2COYA 4PJJA 1NYFA 4KH1B 4C92B 2YRVA 1VQKQ 3MHXA 1GFDA 2DBKA 4PKCC 3NMZC 5HK0A 1MMGA 1Y57A 3C95A 3DB4A 2K5LA 4RG8A 4ZN1A 2RHIA 4OMLA 2AZVA 2QTXA 4OMFB 3I35A 4GY5A 1M90R 5D6YA 2EBPA 3JCMQ 2J7IA 4C5IA 4ORZA 2HAXA 2GQIA 1NBEB 2WSEE 3M56A 4LDUA 2EPDA 3OW2P 1YJ9A 1S72Q 4F7UE 2E70A 4M7DA 3I55Q 1VQNQ 5GMKi 3EGXB 5C0MA 3X20B 5DLOA 3JCMP 2ZCFB 2E6ZA 3MO8A 3QO3A 2Y4XA 1YHQQ 3CBPA 1K0SA 5DY9A 2KE9A 2A3LA 4D6WA 4XTXA 3FC3A 1CSKA 1E7OA 3GNGA 5LJ5e 2CP5A 3OBWA 1JU5C 2EKHA 2DVEA 3H0FA 5ECAA 2DJQA 3OYFA 1OPKA 1VQ5Q 5IXBA 2JXBA 3PVQA 3CCLQ 4MMKA 3SB2A 2EYYA 2EFIA 1I07A 5GAOm 1LJOA 2QGFB 2E41A 2QI2A 4HT8A 4J6XA 4F7UA 1T3SA 2HDAA 1XOVA 3VU3C 1VYVA 1KQSA 2FRWA 4LN2A 3MEWA 3HFNA 2RQVA 3FEOA 3EG9A 1B3QA 1K9MU 4YTLA 1UGQB 2C0OA 2DRMA 1QVGA 4KUDK 3RMSA 4J9DA 4IKFA 1G8XA 2KT8A 2DA9A 4EMKC 1QWEA 2B86A 2VXEA 4WCIA 1SRMA 3CCSQ 1RAGB 1QKWA 2F1LA 4KGVB 4HCKA 1WYXA 3CXCS 1U1SA 1NEGA 2X4XA 4MDWA 1RI9A 3EFSA 4CC2A 3G71Q 4E7HA 3PIOA 3RESA 1YBYA 2P4RA 1KD1U 2QG9B 2PVOB 2XK0A 2FRYA 1WXTA 2LRQA 2I2LA 5J26A 2QDYB 1WGSA 4MZPA 3CMAA 4P5NA 2RQTA 2JMCA 1HD3A 3H9NA 2YWWA 1GCQC 2JUFA 3G4SA 1KJWA 1WZOA 2VYTA 2DXBA 2EAYA 2LDMA 3CXCP 1IHWA 3M4YA 2NUTA 4NL2A 2RQWA 4ANJA 4A63B 1KQ2A 2KK4A 2AK5A 2EJ9A 3EFRA 3JAME 1ZBXA 1Y71A 9ATCB 2B8AA 3OYMA 2FHDA 3NFCA 5FU7B 3X28B 1VQOA 4E47A 3J80E 4DEYA 2JW4A 3UWNA 4X34A 3CC7Q 2WSFE 1OV3A 2AT1B 3VS2A 2E5KA 1MHNA 2CT4A 1N8RC 2VVKA 1P92A 4PJOG 3M4GA 3INZA 5GANd 1GXIE 4E7LA 1HYOA 1BI1A 3EHRA 1H3ZA 2EVRA 2VASA 1H92A 4LNPA 1Q81U 1X69A 1U8RA 2EJFA 3DLMA 5GAMg 4ZTFA 3CCUA 3HPWA 1RI0A 5GAOr 4L59A 3CEYA 1QCNA 4LD6A 3HSBA 3QPHA 4B9WA 2M51A 4FYVB 3LH5A 1V76A 3G4ST 3TVTA 4NL3A 1ZSZC 4HCBA 1IB8A 4PJNA 1K73R 4PLIA 1RLQC 2CP7A 4M7AF 2VUBA 2QTVA 3ZL7C 1EX4A 2GFUA 1M90U 2FZKB 3LGFA 3A1PA 4FYYB 4C92E 1I8FA 1TSFA 2DD5A 1H8KA 4ZGEB 3CPFA 5LJ5h 3UA7A 3L2UA 4CC4B 2C06A 4M78G 3OYGA 2MAMA 1BCMA 3D7SB 1LOJA 2DLPA 1U5SA 2DERA 4M77F 1Q86C 2NLUA 2KSSA 3J81E 1VQ8T 3SFMA 1I1JA 2GFAA 1OYXA 3OBYA 1AVZC 1A0NB 1YWPA 2E6NA 1B07A 5M9OA 4OGCA 4C92A 1ABOA 2GF7A 3L2QA 1KC8R 2D0QB 4AFSC 1BI2A 4FT4A 5L23A 2IVWA 2QK0A 3CCUT 2CKKA 3VUZA 4XK8E 1R8OB 2HL5C 1KSWA 2L3PA 2LT1A 2JS2A 2X35A 3GF5A 3OS2A 1AT1B 1D1CA 1JJ2A 2DEQA 3EFOA 1VQ7Q 4E2FB 2ROLA 2J6FA 2YUNA 1KHCA 3QIIA 3RUXA 1TUGB 3QZ5B 2V1RA 3RDVA 1V29B 4BI8B 2RPNA 1EIFA 3CCQA 3VS4A 1YCSB 4A53A 2DZ9A 4MZMA 5GAN7 2GTOA 3FJ5A 1VQPQ 5DM7R 4C8QG 1BCOA 1WHMA 1TWBA 7AT1B 1YITT 2HQEA 1S1NA 2L89A 2FZGB 4JS4A 1VQ9T 4PJOE 5FROA 4C0GA 1UEBA 3I56Q 3HRUA 5CQXA 3OQ5A 1VYTA 2PVGB 4C5HA 3PVLA 1H641 4QKUA 1I4K1 1VIFA 1X6GA 5GAMd 1G3TA 4QVZA 5I2MA 4JJNK 1TTHB 4RTTA 2M1HA 2EYZA 4BDZA 3NTHA 2VGMA 1Q7YC 2K2VA 5CK9A 2LJ0A 2F2VA 4M78F 5EG2A 3ASKA 2EJGA 3HP9A 5DLQE 4EPCA 4PJOA 5D6XA 3L2VA 4XTWA 3OW2A 1C1AA 4JLGA 4ESRA 3PGGA 4HT9A 4RCBA 4OGEA 2PZ1A 1LCKA 2SEMA 4J9CA 2YHTA 1VYUA 3CCQT 2LQWA 2NUZA 2F69A 4M7DG 5I2SA 5A0LA 2BKDN 1VQ8Q 1YJNQ 4AFUC 1Q82C 4PL6A 1B7TA 1WHLA 4F04B 3L2WA 5KYXB 1M2OA 4FSSA 2CSQA 4PFOA 1FX7A 4C0ZA 2RN8A 4FSXA 1VQMA 2ZPIB 3BE3A 3EH1A 5C6SA 2OTJA 2QDLA 1MMDA 3TREA 5IHIA 1K9MR 4JZ3A 1MV3A 1YIJQ 4XTVA 4HCCA 4PJLA 3MJXA 2HCKA 5CKEA 3OYJA 4F7UG 2A36A 2DVJA 4LD9K 2YRDA 1K73U 2LMJA 3BDUA 4N0AA 3EG0A 3SHWA 3V7SA 4IIOA 1X75C 2RJDA 2DAQA 1WHJA 4C8QF 4M78A 3M0PA 2BTTA 4A4KA 1BU1A 1UUEA 4BI3A 2CYZB 3CCVQ 1MNEA 1WHKA 4C0FA 1N5ZA 1OU8A 2EYQA 5GAOl 3BDLA 1FMWA 4M75B 3MCAB 1Y0MA 4PLLA 2X4JA 3JB9G 2KMTA 1ZLMA 2O4XA 1ZBJA 3RKXA 2ZGWA 4JUVA 1I5LA 1UTIA 2LT4A 1M1KC 1M3BA 3SD4A 2OTLA 2HQXA 5IN1A 1E6GA 1X2QA 2KR3A 2ESWA 2DE0X 2PQWA 5KYUA 3CXCA 2ZAEA 4FW2A 3JV3A 3CCJT 4B9XA 1KC8U 3E9GA 4DBHA 1JQQA 4JJCA 2YLBA 1VQMT 5CQYA 4XTUA 5A0DA 2DPPB 3OYCA 2OTJT 3G1JA 2CP0A 2F2WA 1NLPC 4J9EA 1JXOA 2D0NA 2Y4YA 2EIFA 2VWFA 5KYYA 5LJ5j 2HKNA 2L3RA 2RMOA 5EC7A 3QZ9B 4E7ZA 4RTWA 3OMGA 4N4IA 4AMCA 1G2BA 2FPDA 3DLLA 2YUPA 3CC4Q 4E7IA 2IG0A 2KYMA 4C8QA 4M7DF 1X6OA 1TXQA 4ZGJB 3EGUA 3HRTA 2FVUA 1BBZA 3H8ZA 3CCEA 5LJ5f 1HSQA 1JRIA 3VRZA 4L5GA 1U1TA 3SWNA 4J8OA 4GLKA 4ELYC 3WXMB 2YDLA 2M0YA 4XAXB 4A54A 1M2VA 2O9SA 1VIEA 2D1XA 1WIEA 1LNXA 1Q86R 3QDRB 2XDPA 5IHKA 1M3AA 4IURA 1E6HA 2XG8D 2DTHA 3M0UA 1YJWQ 4F7UF 5I11A 5FRMA 3FIFA 4K11A 5GAN8 2OTLT 2QASA 2QEXT 1KK7A 1M1FA 1W1FA 2R5MA 3QDFA 2K5IA 1AZGB 3CD6A 5GMKl 4E7JA 4XU1A 2CH4W 4A4HA 4FW1A 4DBQA 4EMKB 3UPUA 1JXMA 2GGRA 3E1SA 5J39A 5CKDA 3JB9H 2NUPA 5GANg 3JB9F 2EQMA 2KGTA 5KE3A 1UJ0A 1ZUYA 1M8VA 3QJ6A 4IUQA 1PC0A 2EGCA 4BB7A 2CUDA 2QQAA 3FDRA 3LWHA 1VQ6Q 2Z0WA 4JRPA 4DEXA 4AFZC 3REBB 1BIAA 1GBQA 4KUIA 4M7AB 3CMEA 1PKSA 1SHFA 1IHVA 1UHCA 3CCET 3EGDB 1UECA 4OMPA 1WJSA 2KEAA 1X01A 2M02A 2MWOA 3O5ZA 2NWMA 2A0FB 3P8DA 2QXFA 4V2SA 5HY6A 5KH6A 4N4GA 2KI7A 4C92G 1PRLC 2YSQA 3V8KA 2BUDA 4M77B 4JZ4A 2PNIA 3CCRQ 4DOWA 4CI0C 3CPWA 2LVMA 1O9SA 3BY7A 4J9BA 3CD6T 4JS5A 2DBMA 2BZYA 2FO0A 2IPOB 2HQHA 4Z8AA 1OOTA 5FLXE 2GQVA 2DYIA 4TVRA 2EGEA 4FU6A 1Q7YR 1RAFB 2LCSA 1YI2A 1UB4A 2RK1A 2MIOA 2ED1A 1T0HA 2VKNA 1YJ9T 1SF9A 1D09B 1X27A 2RHXA 2CGHA 3JCMX 3EG2A 2DL5A 1D0ZA 4ATOA 2H8HA 3G6EA 1N8RU 5KYXA 2XDDA 4M7AC 2J05A 2JVVA 1W2BS 3LWIA 4QQGA 4DBRA 3ZEHA 4O6JA 5KYWA 3CMET 1Q82R 2RA2A 1UGVA 2DXTA 4M7AD 4M75E 4ME7A 5KYNA 3M0RA 2QEXQ 1PD1A 3KXTA 1NYGA 4HXJA 2C0TA 1WNLA 1WQ7A 2E64A 5GANe 1X6BA 1ZSZB 1NLOC 1W6XA 2V1QA 1QQJA 2FB7A 1RADB 4M77C 2ZPBB 1C6VX 4CC3A 3GLXA 3TCJA 3FLGA 1X43A 4X9CA 4M77D 3V8LA 1W2BP 4BI4A 2FPEA 2L8DA 4RCCA 1ABQA 4M75A 4BD3A 4OMQA 1YI2T 3A8LB 1DJ7B 2K4YA 2F5TX 4LXCA 2MCNA 5IT9E 4KULA 3OYIA 2KXDA 3MPUB 2DTIA 3JCMc 3VJPA 4J5YA 2QA4A 2HNIA 4RTZA 4C92F 3L2RA 3G6ET 1VQ4A 3CMAT 1Q86U 1OQKA 1YN8A 1OX9A 2FL7A 3S6WA 3Q1JA 2YXYA 2CP3A 2KYBA 4QVCA 3ZBDA 2H3EB 2EGAA 5GAMj 2F5KA 2HD0A 1O75A 2KRSA 4FT2A 2OAWA 3JRZA 3M54A 2MF2A 1JBMA 5CCAA 3HKSA 1PHTA 4IUTA 4X1VA 5GAMf 3JCMJ 3CC2A 1QWFA 2LJ1A 5IAYA 4RTYA 1ZSGA 1VQOT 1RL2A 1YJ9Q 4RTXA 1RAEB 2ENMA 4A4GA 3QHSA 4JLIA 2O2OA 2O31A 3F70A
chains in the Genus database with same CATH topology
3CCMA 3M5AA 4A4EA 2R57A 3C4SA 4FIBA 3OYLA 2YHTA 1VQPA 4PJOB 2XDBA 3CCQT 1VUBA 2VV5A 3OYAA 1WJRA 4ELZC 2K5FA 4M7DA 2F69A 2RH2A 4JDSA 4N0AC 4M7AG 4M7DG 1HK9A 5I2SA 5A0LA 1KQ1A 2K3XA 4M75C 4RMOA 1MGQA 1BKBA 2BKDN 2RHUA 2LTOA 4QVDA 3WVDB 3CBMA 1Q82C 5CIUA 4M78C 4C5GA 4IUUA 4PL6A 3QKJA 3URGA 4X9DA 4BE2A 2A7YA 3MEVA 3L2WA 5FRNA 2RI5A 1N9SA 4M75D 4OF1A 2E65A 3A8HB 3HFOA 1Y07A 2QA4T 1FX7A 4O5VA 4C0ZA 1KC8C 4M78D 4LDWA 4XTZA 3I56A 4FSXA 1VQMA 3UT1A 5GAN2 2ZPIB 5LJ3e 1NPPA 4OB1B 1M5Q1 4BUGA 3OW2S 5C6SA 3MEUA 2OTJA 3JB9I 4M7DE 3TREA 2DZCA 5J3BA 4IUVA 2QQSA 1K9MC 4XTVA 5A2QE 1M4ZA 4C92B 2YRVA 4M77G 3MHXA 4HCCA 5GAN3 3X26B 2Y90A 4PKCC 5CKBA 5CKEA 3OYJA 5HK0A 4F7UG 3C95A 2M0OA 3DB4A 3NTKA 2K5LA 3LH0A 4J7FA 4RG8A 4PJOF 2EKOA 4LD9K 1K73U 4OB3B 2QQBA 4ZN1A 2RJFA 2RHIA 3BDUA 4N0AA 3V7SA 4OP0A 1NJIC 2DO3A 2QTXA 4OMFB 4GY5A 3V8JA 1X75C 2RJDA 5D6YA 2DAQA 4C8QF 3JCMQ 4M78A 3L2ZA 4C5IA 2HAXA 5GAMe 1FXXA 1Q7YU 1QVFS 2WSEE 4UC4A 3M56A 4A4KA 1M1GA 4BI3A 2CYZB 3M59A 4LDUA 3TU4K 3VV0A 1YJ9A 4C0FA 1N9RA 1Y96A 4F7UE 1VQ7T 2EYQA 5GAOl 2E70A 5GAN4 3BW1A 1KD1C 1NZ9A 2JOYA 3BDLA 2ZPHB 3MCAB 4M75B 4PLLA 3X20B 5C0MA 2X4JA 5GMKi 5DLOA 3JCMP 3JB9G 2ZCFB 2E6ZA 2RD1A 2QQ9A 2KMTA 2O4XA 3LGLA 3M55A 3MO8A 4M78B 5I21A 5HK3A 3QO3A 2Y4XA 2ZGWA 3CBPA 4JUVA 2MWPA 5DY9A 3RKXA 5GMKm 1I5LA 4PJOC 5CAIA 2A3LA 3VUBA 2EQJA 5GANh 4D6WA 4XTXA 3CCMT 3FC3A 2LT4A 1M1KC 1I81A 3VYGA 1VQPT 2VXFA 3SD4A 5LJ3h 1VQ8A 2KDSA 3GNGA 5LJ5e 5GAOp 1YJNA 5GMKe 4C8QC 4PJOD 1VQLA 2OTLA 3OBWA 2HQXA 5IN1A 1FWZA 2DVEA 2H3JA 2R5AA 2O4XB 3OYFA 1Q82U 3E9FA 2LC4A 1G3WA 4C8QD 4DA4A 2JZ2A 2PQWA 4MMKA 5GAOq 3SB2A 3JCMg 2EFIA 3CXCA 4JRQA 4RKUE 4A4FA 3CCJT 4B9XA 5GAOm 1LJOA 1KC8U 3E9GA 4KT0E 2E41A 2QI2A 4HT8A 4J6XA 3SWNC 2YLBA 2ZPGB 4F7UA 3I56T 1VQMT 5CQYA 1OZ2A 1XOVA 4J6YA 3VU3C 1WPYA 2RM4A 4Y91A 1YIJA 1QP2A 4XTUA 1KQSA 5A0DA 2DPPB 3MEWA 3RKWA 3HFNA 3OYCA 2OTJT 2V8KA 3FEOA 1VQKA 4XU0A 2R58A 1K9MU 2QQRA 2ZPFB 3GPLA 4YTLA 4BACA 1UGQB 3E19A 1QVGA 3P8HA 3MP8A 4FM4B 2Y4YA 4HA8A 4KUDK 2EIFA 1SSFA 3RMSA 5LJ5j 1WJQA 3RKYA 4DQ2A 2L3RA 4IKFA 4F7UB 3QZ9B 1B34A 4EMKC 3DLLA 3OMGA 2DIQA 4N4IA 4E7IA 2OAUA 2EQKA 2VXEA 2IG0A 3LW5E 4C8QA 3JCMb 4M7DF 3N5BB 5D6WA 1X6OA 1K8AC 3OYHA 1G3SA 4ZGJB 3M9QA 3PFSA 3M53A 2PVDB 3CXCS 3CCVA 1U1SA 2X4XA 4N4HA 5FU7C 1S72A 3HRTA 2FVUA 2JN0A 4MDWA 3CCEA 3H8ZA 3I55A 2RB6A 3OYKA 2PUKB 1VQNA 2V8IA 3EFSA 5LJ5f 2CZ6B 1JRIA 2ZPEB 3P8BB 1U1TA 4L5GA 4C8QB 3SWNA 3PIOA 3RESA 1YBYA 4J8OA 4GLKA 4E7HA 1Q81C 4ELYC 1KD1U 1KQSS 1YHQA 5CR2A 1YITA 1VQLT 3WXMB 2PVOB 2XK0A 3VKIA 4XAXB 4LDVA 4A54A 2JTFA 2LRQA 1VIEA 3ER0A 1QVGS 2I2LA 2MI6A 3OMCA 1LNXA 3QG1A 2LNVA 2QDYB 1WGSA 4MZPA 5J26A 3QDRB 3X24B 2X4WA 4P5NA 3CMAA 2XDPA 3CPWS 1M1KU 4M7DC 4IURA 1VQ4T 2XG8D 2DTHA 5AYFA 3SWNB 2P0KA 4XU2A 1YJNT 4F7UF 5FRMA 4M7AE 3FIFA 4EMKA 3EAEA 1VQ5A 5A0GA 3T9NA 5GAN8 2OTLT 2K57A 2QEXT 2JUFA 4MDXA 2HBPA 1M1FA 3M58A 3G4SA 4M7DD 3CCLA 2LCLA 4OB0B 2K3YA 2VYTA 2ZZDA 3OS1A 2DXBA 2EAYA 2LDMA 1UGPB 2R5MA 3M4YA 3TEEA 2K5IA 4NL2A 3CD6A 1D3BA 5GMKl 3S3NA 4E7JA 4XU1A 5L8RE 3QUIA 3L1AA 4A4HA 1KQ2A 3DB3A 2DXCA 1OZ3A 2KK4A 3M57A 4EMKB 3UPUA 2EJ9A 2D6FA 3ME9A 1YIJT 1M90C 2CZ0B 3E1SA 2RO0A 3EFRA 5J39A 4EDUA 5CKDA 3JAME 1VQKT 3PT9A 3OSSC 3JB9H 4C0DB 1NPRA 3S3MA 5CVIA 5GANg 1ZBXA 3JB9F 3PIPA 1Y71A 4M77E 2EQMA 2B8AA 4L6V5 2RJCA 3OYMA 3RMQA 5KE3A 2P0PA 5LJ3g 2FHDA 3CC4A 3NFCA 5FU7B 3CCSA 3CC2T 1M8VA 3BFMA 5KCOA 3X28B 1VQOA 3CBOA 3QJ6A 4E47A 3WVEB 4IUQA 1IZ6A 4M7AA 3J80E 1OI1A 3UWNA 4BB7A 3J7AF 4X34A 2WSFE 2QQAA 3FDRA 3HL8A 3LWHA 1BIBA 3GOXA 1MHNA 4E7KA 2P4TA 2BIVA 2RI2A 1N8RC 4JRPA 1K8AU 3KBGA 1P92A 4HKEA 4PJOG 3M4GA 4KBMB 3INZA 3G71A 5GANd 1Y96B 1BIAA 3CCVT 1GXIE 1QW1A 4E7LA 4KUIA 2XICA 4XTYA 4M7AB 3RIRA 3CMEA 1BI1A 4M7DB 1BI0A 3CCET 2XKOC 3I55T 1VQNT 1H3ZA 4BY6B 1WJSA 2CZ1B 1Q81U 1X01A 3A8GB 1U8RA 1YHQT 2EJFA 3DLMA 1JB0E 2MWOA 2LQ8A 3L42A 5GAMg 4ZTFA 1BI3A 4M77A 3P8DA 3HRSA 3JB9D 4BE1A 2QXFA 4PJOA 3CCUA 3HPWA 1NJIU 1RI0A 5GAOr 4L59A 4NS5A 3CEYA 1YJWA 4LD6A 4V2SA 3HSBA 3QXEB 3C94A 2O01E 3QPHA 1ZQ1A 4N4GA 4NOYA 5HY6A 4B9WA 5KH6A 3OYBA 2DTOA 1NE8A 3FB9A 2CZ7B 4C92G 2D9TA 1VQ5T 3R6OA 2MMPA 3V8KA 3V7RA 2BUDA 4M77B 5GAMh 3G4ST 4CRIA 4DOWA 4CI0C 4NL3A 1TH7A 3GNFB 4HCBA 3CPWA 3OYYA 2LVMA 4DOVA 1O9SA 3BY7A 3JCMd 4J6WA 3JCMV 2LQKA 4HCZA 3CD6T 2KVQG 4PLIA 4JS5A 2LCCA 2E10A 3ZFJA 2DD4A 3PTAA 3SDZA 2WSCE 2GQVA 1QVPA 5FLXE 4M7AF 2VUBA 4QQ6A 4TVRA 4C0DC 2GFUA 4FU6A 3LGFA 3FRNA 1M90U 3MEAA 5GAOn 1YI2A 4C92E 1UB4A 2EQUA 1I8FA 2DD5A 3MP6A 1B34B 1UGSB 2RK1A 3JCMf 3G7ZA 4ZGEB 3QSUA 3CPFA 5LJ5h 5GMKh 3OYNA 3L2UA 3CC4T 1N27A 4M75G 1YJ9T 3CCST 4LDXA 3CC7A 4Z02A 2RHXA 2CGHA 1IREB 3JCMX 3OY9A 2C06A 1VQ6A 4M78G 3OYGA 3RERA 2E5QA 2MAMA 4PNOA 4ZGDB 1LOJA 4ATOA 3GIBA 3G6EA 1N8RU 4XU3A 2CS7A 2XDDA 4R55A 4M77F 1Q86C 4M7AC 5FU6B 1W4SA 1QP3A 2NLUA 2AHJB 2KSSA 2JVVA 3J81E 1W2BS 2XIDA 3LWIA 3G71T 2E1HA 4BY6C 4QQGA 3SFMA 3ZEHA 4ZTJA 2GFAA 4O6JA 1OYXA 3CC2A 2EWNA 3OBYA 3CMET 1PSFA 2RA2A 2DXTA 1UGRB 4MMLA 4M7AD 4M75E 4QQDA 2E6NA 4ME7A 5CKFA 5CO7A 2XI9A 4C5EA 5M9OA 5KE2A 4OGCA 4C92A 4M78E 2G3RA 3OA6A 3KXTA 2GF7A 3CCJA 1WNLA 1WQ7A 2DK3A 2E64A 5GANe 3L2QA 2YLCA 2D0QB 1G5VA 1BI2A 1XQHA 4FT4A 2JTMA 2IVWA 4J83A 3CCUT 4OB2B 2CKKA 3C12A 1YJWT 2FB7A 3VUZA 2LX9A 4XK8E 4XQ3A 1R8OB 3OYDA 4MZTA 3LLRA 4M77C 2ZPBB 3UDCA 3CCRA 1KG1A 2L5QA 2FYKA 1BYMA 3GLXA 3TCJA 2LT1A 3FLGA 2X35A 4BE0A 1VQ9A 1D3BB 3OB9A 3GF5A 3H6ZA 3OS2A 2GCXA 4J7IA 1JJ2A 2DXUA 4Q5WA 4QW2A 1N6AA 4X9CA 3LX7A 4M77D 1XTDA 3V8LA 4BI4A 2DEQA 5GAN6 3S3OA 2E12A 3AHUA 2L8DA 1M9SA 3META 4OVAA 3OS5A 4RCCA 4RG2A 4M75A 1KHCA 3QIIA 3RUXA 3QZ5B 3KUFA 5GAN5 2KAFA 2M9UA 1V29B 4BI8B 2V8JA 3JCMW 5GANj 1EIFA 1AHJB 3NTIA 4BD3A 3CCQA 1Y7XA 2WACA 3PMIA 3JCMe 5CKHA 1PSEA 1YI2T 4A53A 2DZ9A 3A8LB 4MZMA 1DJ7B 5LJ3j 2K4YA 5GAN7 1KHIA 2F5TX 3JCMJ 5IT9E 4KULA 5DM7R 4WF2A 1S72T 3OYIA 2RJEA 2KY9A 4C8QG 5LJ3d 3DKMA 3O8VA 2XD0A 2DTIA 1G3YA 2DJZA 3JCMc 3CC7T 1XNIA 4JRIA 4Y28E 1YITT 3VJPA 4J5YA 1VQ6T 2VC8A 2HQEA 2QA4A 2HNIA 2L89A 5FU6C 3VYHB 2RK2A 4C92F 4JS4A 3L2RA 5GANf 2X4YA 3G6ET 1VQ9T 1VQ4A 1JJ2S 4PJOE 5FROA 2RI3A 2PUOB 1UEBA 4C0GA 1Q86U 3CMAT 1ZHIA 2FL7A 3S6WA 3V7CA 5LJ3f 3Q1JA 3HRUA 5CQXA 3OQ5A 2PVGB 1HXDA 2JNGA 4C5HA 3A8MB 2QEXA 2DIGA 4QVCA 3ZBDA 4JRKA 4C8QE 2KQWA 3QBYA 1H641 1QVFA 3PMTA 1WQWA 5GAMj 4R56A 2F5KA 1I4K1 2HD0A 3CCLT 1O75A 1VIFA 4FT2A 4VUBA 3OS0A 3JRZA 3M54A 5GAMd 1G3TA 4IUPA 4QVZA 5I2MA 5LJ5g 1K73C 1W2BA 5HKCA 2MF2A 3PNWC 4JJNK 3GP8A 1JBMA 2M1HA 3QYGB 4BDYA 5CCAA 3A5ZB 3HKSA 4BDZA 3NTHA 3JSCA 3QYHB 4C92C 2VGMA 4FL6A 4ZN3A 2XHCA 3OYEA 2RHYA 5KCHA 2DKGA 2PU9B 4M75F 3QJYA 3FJPA 1Q7YC 3CCRT 2K2VA 3OSVA 4IUTA 5CK9A 3LYIA 5LL6S 2XU8A 4LDYA 3JCMh 4M78F 5EG2A 3ASKA 2EJGA 3HP9A 4II1A 5DLQE 3X25B 4C92D 4EMGA 4EMHA 4EPCA 5GAMf 3A8OB 1YCYA 5D6XA 5GMKj 1VQ7A 3L2VA 4XTWA 5IAYA 3JB9J 3OW2A 2M16A 4JLGA 1VQOT 5LJ5d 1RL2A 3PGGA 2P0QA 1VQ8T 4A4GA 3QHSA 2VGNA 4JLIA 2RHZA 3MP1A 4HT9A 4RCBA 3HHTB 4OGEA 3F70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZP A;  5CQY A;  5CCA A;  2VUB A;  1X75 C;  4HKE A;  3JSC A;  1VUB A;  5CQX A;  5CKH A;  5CKD A;  4MZT A;  1UB4 A;  4ELZ C;  4MZM A;  1NE8 A;  5CK9 A;  3TCJ A;  4MDX A;  3G7Z A;  1M1F A;  5CKB A;  4ME7 A;  5CKF A;  5CO7 A;  3NFC A;  5CKE A;  4VUB A;  5HK0 A;  4ELY C;  5CR2 A;  3JRZ A;  5DLO A;  2C06 A;  4OF1 A;  5HKC A;  2KMT A;  5HK3 A;  2MF2 A;  3HPW A;  3VUB A; 
#chains in the Genus database with same CATH topology
 3CCM A;  4A4E A;  3C4S A;  2ECZ A;  4FIB A;  1WHG A;  3OYA A;  3UAT A;  1C0M A;  2RH2 A;  4N0A C;  1OPL A;  4QVD A;  2JMA A;  5CIU A;  1QMC A;  4M78 C;  2AKL A;  4J9H A;  2CUB A;  4BE2 A;  2X9H A;  2VB6 A;  3HFO A;  4IIM A;  2QA4 T;  1M30 A;  4M78 D;  2C0I A;  3UT1 A;  3AT1 B;  2J6O A;  1TG0 A;  2DNU A;  5J3B A;  2PTK A;  1SRL A;  5GAN 3;  2Y90 A;  1YFN A;  4KGZ B;  3A98 A;  1Z9Z A;  2K6D A;  1NEB A;  1GL5 A;  2M0O A;  2DL8 A;  1VOM A;  3LH0 A;  4PJO F;  4OB3 B;  2QQB A;  4E7S A;  1JEG A;  2JM8 A;  1R77 A;  3EH2 A;  2DO3 A;  3EGX A;  3V8J A;  4AT1 B;  1OEB A;  1YP5 A;  2MOX A;  2O9V A;  5GAM e;  1FXX A;  2L3S A;  1PWT A;  1TOV A;  1Q7Y U;  2ED0 A;  3TU4 K;  1N9R A;  2LJ3 A;  3BW1 A;  1VQL A;  1NZ9 A;  2JOY A;  2ZPH B;  4HVW A;  5HKC A;  2RD1 A;  2QQ9 A;  3LGL A;  5I21 A;  1GCQ A;  2MWP A;  4FYW B;  5GAN h;  3CCM T;  3CMA Q;  1WDX A;  5GAO p;  4C8Q C;  3NHN A;  1FWZ A;  2R5A A;  1VA7 A;  2G6F X;  1Q82 U;  1PCX A;  2HEQ A;  2DEU A;  4C8Q D;  1U06 A;  2BZ8 A;  2QYZ A;  4DA4 A;  3G4S Q;  3JCM g;  2BZX A;  4RKU E;  4A4F A;  2J06 A;  1WFW A;  2ABL A;  3EHQ A;  1G83 A;  3SWN C;  1UDL A;  1OZ2 A;  1WPY A;  4Y91 A;  1QP2 A;  2JJ9 A;  1D0X A;  1VQK A;  3RR6 A;  1GBR A;  2QQR A;  2ZPF B;  3GPL A;  4BAC A;  3P8H A;  4FM4 B;  4HA8 A;  2EQI A;  1SSF A;  1WJQ A;  4F7U B;  1AWW A;  1AZE A;  2OAU A;  2EQK A;  1VQO Q;  3EG9 B;  3JCM b;  3N5B B;  5D6W A;  4J9G A;  1K8A C;  1G3S A;  2E3H A;  3M9Q A;  2DMO A;  2PVD B;  1MND A;  3UA6 A;  4N4H A;  1S72 A;  3I55 A;  1VQN A;  2V8I A;  2AZS A;  2CZ6 B;  2ZPE B;  1YHQ A;  1VQL T;  3VKI A;  4LDV A;  2ATC B;  1WX6 A;  3ER0 A;  1U3O A;  2L2P A;  3OMC A;  2MI6 A;  2OJ2 A;  3QG1 A;  1NJI C;  2LNV A;  2X4W A;  1M1K U;  4M7D C;  2K7A A;  4OMO A;  3CCU Q;  1VQ5 A;  3T9N A;  4MDX A;  4M7D D;  3CCL A;  2LCL A;  4OB0 B;  1GRI A;  2K3Y A;  5IH2 A;  3TEE A;  2F2X A;  1QKX A;  2FEI A;  4RUG A;  3VS7 A;  5L8R E;  3L1A A;  4EIK A;  3DB3 A;  2A28 A;  2D6F A;  1RAH B;  1CKB A;  2RO0 A;  1VQK T;  1TUC A;  3OSS C;  4D8K A;  2NUT B;  5CVI A;  1LPL A;  2EW3 A;  2RJC A;  3RMQ A;  5LJ3 g;  3MKD A;  3CCS A;  3CBO A;  3WVE B;  1IZ6 A;  3J7A F;  3HL8 A;  1YIT Q;  3GOX A;  1N8R R;  1LVK A;  2P4T A;  3KBG A;  4KBM B;  1VQ9 Q;  3G71 A;  1Y96 B;  1CKA A;  1QW1 A;  4XTY A;  1YWO A;  1GFC A;  2XKO C;  3I55 T;  1VQN T;  1UE9 A;  2CZ1 B;  1F1B B;  1YHQ T;  2KT1 A;  3JB9 D;  4BE1 A;  3SEM A;  4NS5 A;  3QXE B;  3C94 A;  4NOY A;  3RBB B;  2DTO A;  2K3B A;  1NE8 A;  1VQ5 T;  3R6O A;  5GAM h;  4CRI A;  1TH7 A;  2CH4 A;  1I0C A;  3JCM d;  2LQK A;  4HCZ A;  2HZY A;  2LCC A;  1AD5 A;  2E10 A;  1QLY A;  3SDZ A;  2WSC E;  1K4U S;  2W0Z A;  3FRN A;  3MEA A;  2MYS A;  2K9G A;  1QCO A;  1RAC B;  2EYW A;  3CCQ Q;  6AT1 B;  1B34 B;  1UGS B;  3G7Z A;  1TUD A;  2A37 A;  3M0S A;  1N27 A;  4M75 G;  3CCS T;  3CC7 A;  4Z02 A;  3THK A;  1IRE B;  1IGU A;  3U23 A;  3E2U A;  3OY9 A;  1WXB A;  1IO6 A;  4PNO A;  2QGG A;  3GIB A;  3GBQ A;  2CS7 A;  2KBT A;  4R55 A;  1K1Z A;  1W4S A;  2X3W D;  1QP3 A;  2DM1 A;  2AHJ B;  4KH0 B;  2XID A;  3G71 T;  2BE9 B;  4ZTJ A;  2HMA A;  2EWN A;  1XJW B;  1PSF A;  4KRT A;  1HJD A;  4MML A;  4QQD A;  5CO7 A;  1Z9Q A;  2NYS A;  2KRM A;  4C5E A;  4GBQ A;  1IGQ A;  1M8M A;  3OA6 A;  2DK3 A;  1G5V A;  2YLC A;  1XQH A;  2CRE A;  2K2M A;  2JTM A;  1SG5 A;  4OB2 B;  1T3L A;  3C12 A;  2LX9 A;  4XQ3 A;  1WI7 A;  3OYD A;  3LLR A;  4AG2 C;  3EG1 A;  1KG1 A;  1PG5 B;  1BK2 A;  1D3B B;  3H6Z A;  4J7I A;  2DXU A;  3VS0 A;  1N6A A;  2CP2 A;  3LX7 A;  4Z89 A;  3AHU A;  1M9S A;  4OVA A;  3OS5 A;  4RG2 A;  1PD0 A;  3IQL A;  3KUF A;  2KAF A;  2COZ A;  3TSW A;  4ZNX A;  5GAN j;  1ARK A;  1AHJ B;  3NTI A;  3PMI A;  2LZ6 B;  1PSE A;  3QWY A;  1D1B A;  3REA B;  3ULR B;  1OX8 A;  3EFO B;  1PNJ A;  2QAZ A;  5LJ3 d;  3DKM A;  3NGP A;  1SPK A;  3O8V A;  2XD0 A;  1G3Y A;  2DJZ A;  3CC7 T;  2D8J A;  4JRI A;  4Y28 E;  2K79 A;  2E4H A;  1UG1 A;  2LX7 A;  3VYH B;  1EZZ B;  2RK2 A;  3CCJ Q;  5GAN f;  2X4Y A;  1AWX A;  3I9Q A;  1T0J A;  1VQM Q;  2AKK A;  1HXD A;  3A8M B;  3QWX X;  2OTJ Q;  4JRK A;  3EG3 A;  3PMT A;  4HVU A;  1WXU A;  2HKQ B;  4R56 A;  4VUB A;  2KNB B;  3CQT A;  4IUP A;  4PFP A;  2X3X D;  1WLP B;  1RUW A;  2CDT A;  3GP8 A;  3QYG B;  2A08 A;  3A5Z B;  1X2K A;  3JSC A;  3VS3 A;  4C92 C;  4FL6 A;  1D1A A;  2L3Q A;  2XHC A;  3OYE A;  5KCH A;  2DKG A;  2PU9 B;  4M75 F;  3QJY A;  3FJP A;  2YT6 A;  3OSV A;  5LL6 S;  1MMA A;  3JCM h;  4II1 A;  3X25 B;  4C92 D;  4EMH A;  1GCP A;  4EMG A;  3A8O B;  1OU9 A;  1YCY A;  2CSI A;  5GMK j;  5FWC A;  1VQ7 A;  2XMF A;  5AT1 B;  5LJ5 d;  2P0Q A;  2VGN A;  2RHZ A;  1ZX6 A;  3MP1 A;  1K8A R;  1Q95 G;  1QVF S;  3M5A A;  4PFZ A;  4DBF A;  1VQP A;  4PJO B;  2XDB A;  2VV5 A;  1WJR A;  4M4Z A;  2K5F A;  1RLP C;  4JDS A;  4M7A G;  2K3X A;  1MGQ A;  1BKB A;  3WVD B;  3M0T A;  3CBM A;  2OTL Q;  4IUU A;  4J9F A;  3QKJ A;  2A7Y A;  2YUQ A;  3MEV A;  1N9S A;  1Y07 A;  1NJI R;  3I56 A;  5GAN 2;  2AIR B;  4OB1 B;  1M5Q 1;  3MEU A;  2QQS A;  1K9M C;  4D8D A;  5A2Q E;  1QVF P;  1M4Z A;  2DX1 A;  4M77 G;  3X26 B;  5CKB A;  1AOJ A;  2GTJ A;  1SSH A;  3NTK A;  4J7F A;  2EKO A;  2P84 A;  2RJF A;  5D7U A;  2GNC A;  4OP0 A;  4JPB W;  3L2Z A;  1I5O B;  4CC7 A;  4UC4 A;  1RAA B;  1ZA2 B;  1M1G A;  3M59 A;  3VV0 A;  1Y96 A;  1ZA1 B;  1VQ7 T;  3H0I A;  1KD1 C;  5GAN 4;  3CCE Q;  3NPF A;  2COW A;  1R0C B;  1M27 C;  3M55 A;  4M78 B;  5HK3 A;  4JJB A;  5GMK m;  1YNZ A;  4PJO C;  5CAI A;  3VUB A;  2DFU A;  2EQJ A;  2FZC B;  1M1K R;  3PE0 A;  2KXC A;  1I81 A;  3VYG A;  1AEY A;  1VQP T;  2VXF A;  5LJ3 h;  1VQ8 A;  2KDS A;  1YJN A;  2GBQ A;  8AT1 B;  5GMK e;  5HCK A;  4PJO D;  2H3J A;  1UJY A;  2O4X B;  3E9F A;  2LC4 A;  8ATC B;  2HBW A;  1G3W A;  2JZ2 A;  3R6N A;  5GAO q;  2JS0 A;  4JRQ A;  2FPF A;  4KT0 E;  1H3H A;  2J6K A;  3CD6 Q;  3I56 T;  2ZPG B;  4J6Y A;  1IXD A;  2RM4 A;  1YIJ A;  3RKW A;  2V8K A;  1FMK A;  2DIL A;  2L0A A;  2R58 A;  4XU0 A;  3VS6 A;  2MPX C;  3H41 A;  2HSE B;  3E19 A;  5KYU B;  3MP8 A;  3C0C A;  3RKY A;  4DQ2 A;  1B34 A;  2DIQ A;  3LW5 E;  1EFN A;  2ROT A;  2V26 A;  3OYH A;  1IRX A;  3PFS A;  3M53 A;  5KYY B;  3CCV A;  2HSP A;  5FU7 C;  3KFV A;  2JN0 A;  2IIM A;  2RB6 A;  2PUK B;  3UF4 A;  3OYK A;  3P8B B;  4C8Q B;  1QCF A;  1KQS S;  3CME Q;  1ZUU A;  1Q81 C;  1PKT A;  4FYX B;  5CR2 A;  1YIT A;  2JTF A;  1QVG S;  1VQ9 A;  3QSU A;  2DL7 A;  3X24 B;  4LUD A;  3CPW S;  2KRN A;  1VQ4 T;  5AYF A;  3I5S A;  3SWN B;  2P0K A;  4XU2 A;  1YJN T;  4M7A E;  4EMK A;  3EAE A;  5A0G A;  2K57 A;  2D8H A;  2HBP A;  3M58 A;  1M2V B;  1SEM A;  2OI3 A;  3OS1 A;  2ZZD A;  3VS1 A;  1ACM B;  1UGP B;  1D3B A;  3S3N A;  1NM7 A;  5FWB A;  2FG0 A;  4PJM A;  4WTO B;  3QUI A;  2DXC A;  1OZ3 A;  2DRK A;  1KQS P;  3M57 A;  3ME9 A;  1YIJ T;  1M90 C;  2CZ0 B;  4EDU A;  3PT9 A;  2DL4 A;  1QVG P;  4C0D B;  1NPR A;  3S3M A;  3PIP A;  4M77 E;  4PK4 A;  4L6V 5;  1YI2 Q;  3CPW P;  2P0P A;  3CC4 A;  3CC2 T;  4LE9 A;  3BFM A;  5KCO A;  4M7A A;  4E6R A;  1OI1 A;  1AWJ A;  3EGD A;  1BIB A;  2NUP B;  4E7K A;  2BIV A;  2RI2 A;  1K8A U;  4HKE A;  4FCY A;  3G6E Q;  2YUO A;  2I0N A;  3CCV T;  2XIC A;  4M7D B;  3RIR A;  1BI0 A;  4F14 A;  4BY6 B;  3A8G B;  1FYN A;  1JB0 E;  3L42 A;  2LQ8 A;  1BI3 A;  4M77 A;  2O88 A;  3HRS A;  1AWO A;  1NJI U;  1PM3 A;  1J3T A;  1YJW A;  2O01 E;  3OYB A;  1ZQ1 A;  2W10 A;  3FB9 A;  2CZ7 B;  2JM9 A;  2D9T A;  2MMP A;  3V7R A;  1MV0 B;  2RQU A;  3I5R A;  2DL3 A;  3GNF B;  3OYY A;  4DOV A;  2CP6 A;  4J6W A;  2RQR A;  3JCM V;  2KVQ G;  2LNH B;  2KRO A;  3ZFJ A;  2DD4 A;  2E3I A;  3PTA A;  1QVP A;  4QQ6 A;  4C0D C;  2LP5 A;  5GAO n;  5IXF A;  4Z88 A;  2EQU A;  3MP6 A;  1TS9 A;  2DF6 A;  3JCM f;  4J9I A;  4AG1 C;  5GMK h;  3OYN A;  3VS5 A;  1BB9 A;  2CT3 A;  2RF0 A;  3CC4 T;  4LDX A;  4HVV A;  5GJW B;  3RER A;  1VQ6 A;  2E5Q A;  2LQN A;  4ZGD B;  1NG2 A;  2RNA A;  4XU3 A;  2QA4 Q;  5FU6 B;  1ZSZ A;  1VQ4 Q;  2E1H A;  4BY6 C;  4OMM A;  5I22 A;  4RTU A;  1UGR B;  4LUE A;  5CKF A;  5GJV B;  2XI9 A;  1K76 A;  1PRM C;  5KE2 A;  4M78 E;  1UHF A;  2G3R A;  3CCJ A;  4JJD A;  4QT7 A;  1FMV A;  1TU0 B;  4J83 A;  3M0Q A;  1MUZ A;  1KFZ A;  5KYW B;  1RAB B;  1YJW T;  4AFQ C;  4MZT A;  3UDC A;  3CCR A;  2L5Q A;  2FYK A;  1BYM A;  4BE0 A;  3OB9 A;  2GCX A;  4Q5W A;  4QW2 A;  4KGX B;  1XTD A;  3S3O A;  5GAN 6;  3CC2 Q;  2E12 A;  3MET A;  4R0K A;  3RNJ A;  1M3C A;  5GAN 5;  2M9U A;  2V8J A;  3JCM W;  1Y7X A;  2WAC A;  3JCM e;  4Y92 A;  5CKH A;  3CCM Q;  5LJ3 j;  1KHI A;  4RTV A;  4WF2 A;  1S72 T;  2RJE A;  2KY9 A;  2JTE A;  1KD1 R;  2SRC A;  2DET A;  1XNI A;  1VQ6 T;  2VC8 A;  1W70 A;  5FU6 C;  1JJ2 S;  2YRC A;  2RI3 A;  2PUO B;  1ZUK A;  3H0H A;  1JO8 A;  1ZHI A;  3V7C A;  1KIK A;  1WA7 A;  5LJ3 f;  1D0Y A;  1MMN A;  2JNG A;  2QEX A;  2DIG A;  2MK5 A;  1SHG A;  4C8Q E;  2KQW A;  3QBY A;  1QVF A;  1RAI B;  1WQW A;  4B6M A;  3CCL T;  3OS0 A;  5FW9 A;  5LJ5 g;  1K73 C;  1W2B A;  2JT4 A;  1K9A A;  3PNW C;  4F17 A;  4BDY A;  2EYX A;  1V1C A;  3QYH B;  4ZN3 A;  2RHY A;  2OX7 A;  3CCR T;  2BE7 D;  3LYI A;  2XU8 A;  4LDY A;  1JJ2 P;  1K0X A;  1OUL A;  4F16 A;  2HL3 A;  3JB9 J;  3TQ7 P;  2M16 A;  5IHN A;  4GLM A;  1VQL Q;  3HHT B;  2X51 A;  2R57 A;  3VRY A;  3OYL A;  3TSZ A;  1VUB A;  2DYB A;  4ELZ C;  1HK9 A;  1KQ1 A;  4M75 C;  4RMO A;  1R0B G;  2RHU A;  2LTO A;  1Q81 R;  4C5G A;  1WHH A;  3URG A;  4X9D A;  5FRN A;  2RI5 A;  4M75 D;  4OF1 A;  2E65 A;  3A8H B;  4OMN A;  3HTR A;  4O5V A;  1KC8 C;  4LDW A;  1SKU B;  1UFF A;  4XTZ A;  5LJ3 e;  1NPP A;  4BUG A;  3OW2 S;  3JB9 I;  4M7D E;  2DZC A;  4IUV A;  2COY A;  4PJJ A;  1NYF A;  4KH1 B;  4C92 B;  2YRV A;  1VQK Q;  3MHX A;  1GFD A;  2DBK A;  4PKC C;  3NMZ C;  5HK0 A;  1MMG A;  1Y57 A;  3C95 A;  3DB4 A;  2K5L A;  4RG8 A;  4ZN1 A;  2RHI A;  4OML A;  2AZV A;  2QTX A;  4OMF B;  3I35 A;  4GY5 A;  1M90 R;  5D6Y A;  2EBP A;  3JCM Q;  2J7I A;  4C5I A;  4ORZ A;  2HAX A;  2GQI A;  1NBE B;  2WSE E;  3M56 A;  4LDU A;  2EPD A;  3OW2 P;  1YJ9 A;  1S72 Q;  4F7U E;  2E70 A;  4M7D A;  3I55 Q;  1VQN Q;  5GMK i;  3EGX B;  5C0M A;  3X20 B;  5DLO A;  3JCM P;  2ZCF B;  2E6Z A;  3MO8 A;  3QO3 A;  2Y4X A;  1YHQ Q;  3CBP A;  1K0S A;  5DY9 A;  2KE9 A;  2A3L A;  4D6W A;  4XTX A;  3FC3 A;  1CSK A;  1E7O A;  3GNG A;  5LJ5 e;  2CP5 A;  3OBW A;  1JU5 C;  2EKH A;  2DVE A;  3H0F A;  5ECA A;  2DJQ A;  3OYF A;  1OPK A;  1VQ5 Q;  5IXB A;  2JXB A;  3PVQ A;  3CCL Q;  4MMK A;  3SB2 A;  2EYY A;  2EFI A;  1I07 A;  5GAO m;  1LJO A;  2QGF B;  2E41 A;  2QI2 A;  4HT8 A;  4J6X A;  4F7U A;  1T3S A;  2HDA A;  1XOV A;  3VU3 C;  1VYV A;  1KQS A;  2FRW A;  4LN2 A;  3MEW A;  3HFN A;  2RQV A;  3FEO A;  3EG9 A;  1B3Q A;  1K9M U;  4YTL A;  1UGQ B;  2C0O A;  2DRM A;  1QVG A;  4KUD K;  3RMS A;  4J9D A;  4IKF A;  1G8X A;  2KT8 A;  2DA9 A;  4EMK C;  1QWE A;  2B86 A;  2VXE A;  4WCI A;  1SRM A;  3CCS Q;  1RAG B;  1QKW A;  2F1L A;  4KGV B;  4HCK A;  1WYX A;  3CXC S;  1U1S A;  1NEG A;  2X4X A;  4MDW A;  1RI9 A;  3EFS A;  4CC2 A;  3G71 Q;  4E7H A;  3PIO A;  3RES A;  1YBY A;  2P4R A;  1KD1 U;  2QG9 B;  2PVO B;  2XK0 A;  2FRY A;  1WXT A;  2LRQ A;  2I2L A;  5J26 A;  2QDY B;  1WGS A;  4MZP A;  3CMA A;  4P5N A;  2RQT A;  2JMC A;  1HD3 A;  3H9N A;  2YWW A;  1GCQ C;  2JUF A;  3G4S A;  1KJW A;  1WZO A;  2VYT A;  2DXB A;  2EAY A;  2LDM A;  3CXC P;  1IHW A;  3M4Y A;  2NUT A;  4NL2 A;  2RQW A;  4ANJ A;  4A63 B;  1KQ2 A;  2KK4 A;  2AK5 A;  2EJ9 A;  3EFR A;  3JAM E;  1ZBX A;  1Y71 A;  9ATC B;  2B8A A;  3OYM A;  2FHD A;  3NFC A;  5FU7 B;  3X28 B;  1VQO A;  4E47 A;  3J80 E;  4DEY A;  2JW4 A;  3UWN A;  4X34 A;  3CC7 Q;  2WSF E;  1OV3 A;  2AT1 B;  3VS2 A;  2E5K A;  1MHN A;  2CT4 A;  1N8R C;  2VVK A;  1P92 A;  4PJO G;  3M4G A;  3INZ A;  5GAN d;  1GXI E;  4E7L A;  1HYO A;  1BI1 A;  3EHR A;  1H3Z A;  2EVR A;  2VAS A;  1H92 A;  4LNP A;  1Q81 U;  1X69 A;  1U8R A;  2EJF A;  3DLM A;  5GAM g;  4ZTF A;  3CCU A;  3HPW A;  1RI0 A;  5GAO r;  4L59 A;  3CEY A;  1QCN A;  4LD6 A;  3HSB A;  3QPH A;  4B9W A;  2M51 A;  4FYV B;  3LH5 A;  1V76 A;  3G4S T;  3TVT A;  4NL3 A;  1ZSZ C;  4HCB A;  1IB8 A;  4PJN A;  1K73 R;  4PLI A;  1RLQ C;  2CP7 A;  4M7A F;  2VUB A;  2QTV A;  3ZL7 C;  1EX4 A;  2GFU A;  1M90 U;  2FZK B;  3LGF A;  3A1P A;  4FYY B;  4C92 E;  1I8F A;  1TSF A;  2DD5 A;  1H8K A;  4ZGE B;  3CPF A;  5LJ5 h;  3UA7 A;  3L2U A;  4CC4 B;  2C06 A;  4M78 G;  3OYG A;  2MAM A;  1BCM A;  3D7S B;  1LOJ A;  2DLP A;  1U5S A;  2DER A;  4M77 F;  1Q86 C;  2NLU A;  2KSS A;  3J81 E;  1VQ8 T;  3SFM A;  1I1J A;  2GFA A;  1OYX A;  3OBY A;  1AVZ C;  1A0N B;  1YWP A;  2E6N A;  1B07 A;  5M9O A;  4OGC A;  4C92 A;  1ABO A;  2GF7 A;  3L2Q A;  1KC8 R;  2D0Q B;  4AFS C;  1BI2 A;  4FT4 A;  5L23 A;  2IVW A;  2QK0 A;  3CCU T;  2CKK A;  3VUZ A;  4XK8 E;  1R8O B;  2HL5 C;  1KSW A;  2L3P A;  2LT1 A;  2JS2 A;  2X35 A;  3GF5 A;  3OS2 A;  1AT1 B;  1D1C A;  1JJ2 A;  2DEQ A;  3EFO A;  1VQ7 Q;  4E2F B;  2ROL A;  2J6F A;  2YUN A;  1KHC A;  3QII A;  3RUX A;  1TUG B;  3QZ5 B;  2V1R A;  3RDV A;  1V29 B;  4BI8 B;  2RPN A;  1EIF A;  3CCQ A;  3VS4 A;  1YCS B;  4A53 A;  2DZ9 A;  4MZM A;  5GAN 7;  2GTO A;  3FJ5 A;  1VQP Q;  5DM7 R;  4C8Q G;  1BCO A;  1WHM A;  1TWB A;  7AT1 B;  1YIT T;  2HQE A;  1S1N A;  2L89 A;  2FZG B;  4JS4 A;  1VQ9 T;  4PJO E;  5FRO A;  4C0G A;  1UEB A;  3I56 Q;  3HRU A;  5CQX A;  3OQ5 A;  1VYT A;  2PVG B;  4C5H A;  3PVL A;  1H64 1;  4QKU A;  1I4K 1;  1VIF A;  1X6G A;  5GAM d;  1G3T A;  4QVZ A;  5I2M A;  4JJN K;  1TTH B;  4RTT A;  2M1H A;  2EYZ A;  4BDZ A;  3NTH A;  2VGM A;  1Q7Y C;  2K2V A;  5CK9 A;  2LJ0 A;  2F2V A;  4M78 F;  5EG2 A;  3ASK A;  2EJG A;  3HP9 A;  5DLQ E;  4EPC A;  4PJO A;  5D6X A;  3L2V A;  4XTW A;  3OW2 A;  1C1A A;  4JLG A;  4ESR A;  3PGG A;  4HT9 A;  4RCB A;  4OGE A;  2PZ1 A;  1LCK A;  2SEM A;  4J9C A;  2YHT A;  1VYU A;  3CCQ T;  2LQW A;  2NUZ A;  2F69 A;  4M7D G;  5I2S A;  5A0L A;  2BKD N;  1VQ8 Q;  1YJN Q;  4AFU C;  1Q82 C;  4PL6 A;  1B7T A;  1WHL A;  4F04 B;  3L2W A;  5KYX B;  1M2O A;  4FSS A;  2CSQ A;  4PFO A;  1FX7 A;  4C0Z A;  2RN8 A;  4FSX A;  1VQM A;  2ZPI B;  3BE3 A;  3EH1 A;  5C6S A;  2OTJ A;  2QDL A;  1MMD A;  3TRE A;  5IHI A;  1K9M R;  4JZ3 A;  1MV3 A;  1YIJ Q;  4XTV A;  4HCC A;  4PJL A;  3MJX A;  2HCK A;  5CKE A;  3OYJ A;  4F7U G;  2A36 A;  2DVJ A;  4LD9 K;  2YRD A;  1K73 U;  2LMJ A;  3BDU A;  4N0A A;  3EG0 A;  3SHW A;  3V7S A;  4IIO A;  1X75 C;  2RJD A;  2DAQ A;  1WHJ A;  4C8Q F;  4M78 A;  3M0P A;  2BTT A;  4A4K A;  1BU1 A;  1UUE A;  4BI3 A;  2CYZ B;  3CCV Q;  1MNE A;  1WHK A;  4C0F A;  1N5Z A;  1OU8 A;  2EYQ A;  5GAO l;  3BDL A;  1FMW A;  4M75 B;  3MCA B;  1Y0M A;  4PLL A;  2X4J A;  3JB9 G;  2KMT A;  1ZLM A;  2O4X A;  1ZBJ A;  3RKX A;  2ZGW A;  4JUV A;  1I5L A;  1UTI A;  2LT4 A;  1M1K C;  1M3B A;  3SD4 A;  2OTL A;  2HQX A;  5IN1 A;  1E6G A;  1X2Q A;  2KR3 A;  2ESW A;  2DE0 X;  2PQW A;  5KYU A;  3CXC A;  2ZAE A;  4FW2 A;  3JV3 A;  3CCJ T;  4B9X A;  1KC8 U;  3E9G A;  4DBH A;  1JQQ A;  4JJC A;  2YLB A;  1VQM T;  5CQY A;  4XTU A;  5A0D A;  2DPP B;  3OYC A;  2OTJ T;  3G1J A;  2CP0 A;  2F2W A;  1NLP C;  4J9E A;  1JXO A;  2D0N A;  2Y4Y A;  2EIF A;  2VWF A;  5KYY A;  5LJ5 j;  2HKN A;  2L3R A;  2RMO A;  5EC7 A;  3QZ9 B;  4E7Z A;  4RTW A;  3OMG A;  4N4I A;  4AMC A;  1G2B A;  2FPD A;  3DLL A;  2YUP A;  3CC4 Q;  4E7I A;  2IG0 A;  2KYM A;  4C8Q A;  4M7D F;  1X6O A;  1TXQ A;  4ZGJ B;  3EGU A;  3HRT A;  2FVU A;  1BBZ A;  3H8Z A;  3CCE A;  5LJ5 f;  1HSQ A;  1JRI A;  3VRZ A;  4L5G A;  1U1T A;  3SWN A;  4J8O A;  4GLK A;  4ELY C;  3WXM B;  2YDL A;  2M0Y A;  4XAX B;  4A54 A;  1M2V A;  2O9S A;  1VIE A;  2D1X A;  1WIE A;  1LNX A;  1Q86 R;  3QDR B;  2XDP A;  5IHK A;  1M3A A;  4IUR A;  1E6H A;  2XG8 D;  2DTH A;  3M0U A;  1YJW Q;  4F7U F;  5I11 A;  5FRM A;  3FIF A;  4K11 A;  5GAN 8;  2OTL T;  2QAS A;  2QEX T;  1KK7 A;  1M1F A;  1W1F A;  2R5M A;  3QDF A;  2K5I A;  1AZG B;  3CD6 A;  5GMK l;  4E7J A;  4XU1 A;  2CH4 W;  4A4H A;  4FW1 A;  4DBQ A;  4EMK B;  3UPU A;  1JXM A;  2GGR A;  3E1S A;  5J39 A;  5CKD A;  3JB9 H;  2NUP A;  5GAN g;  3JB9 F;  2EQM A;  2KGT A;  5KE3 A;  1UJ0 A;  1ZUY A;  1M8V A;  3QJ6 A;  4IUQ A;  1PC0 A;  2EGC A;  4BB7 A;  2CUD A;  2QQA A;  3FDR A;  3LWH A;  1VQ6 Q;  2Z0W A;  4JRP A;  4DEX A;  4AFZ C;  3REB B;  1BIA A;  1GBQ A;  4KUI A;  4M7A B;  3CME A;  1PKS A;  1SHF A;  1IHV A;  1UHC A;  3CCE T;  3EGD B;  1UEC A;  4OMP A;  1WJS A;  2KEA A;  1X01 A;  2M02 A;  2MWO A;  3O5Z A;  2NWM A;  2A0F B;  3P8D A;  2QXF A;  4V2S A;  5HY6 A;  5KH6 A;  4N4G A;  2KI7 A;  4C92 G;  1PRL C;  2YSQ A;  3V8K A;  2BUD A;  4M77 B;  4JZ4 A;  2PNI A;  3CCR Q;  4DOW A;  4CI0 C;  3CPW A;  2LVM A;  1O9S A;  3BY7 A;  4J9B A;  3CD6 T;  4JS5 A;  2DBM A;  2BZY A;  2FO0 A;  2IPO B;  2HQH A;  4Z8A A;  1OOT A;  5FLX E;  2GQV A;  2DYI A;  4TVR A;  2EGE A;  4FU6 A;  1Q7Y R;  1RAF B;  2LCS A;  1YI2 A;  1UB4 A;  2RK1 A;  2MIO A;  2ED1 A;  1T0H A;  2VKN A;  1YJ9 T;  1SF9 A;  1D09 B;  1X27 A;  2RHX A;  2CGH A;  3JCM X;  3EG2 A;  2DL5 A;  1D0Z A;  4ATO A;  2H8H A;  3G6E A;  1N8R U;  5KYX A;  2XDD A;  4M7A C;  2J05 A;  2JVV A;  1W2B S;  3LWI A;  4QQG A;  4DBR A;  3ZEH A;  4O6J A;  5KYW A;  3CME T;  1Q82 R;  2RA2 A;  1UGV A;  2DXT A;  4M7A D;  4M75 E;  4ME7 A;  5KYN A;  3M0R A;  2QEX Q;  1PD1 A;  3KXT A;  1NYG A;  4HXJ A;  2C0T A;  1WNL A;  1WQ7 A;  2E64 A;  5GAN e;  1X6B A;  1ZSZ B;  1NLO C;  1W6X A;  2V1Q A;  1QQJ A;  2FB7 A;  1RAD B;  4M77 C;  2ZPB B;  1C6V X;  4CC3 A;  3GLX A;  3TCJ A;  3FLG A;  1X43 A;  4X9C A;  4M77 D;  3V8L A;  1W2B P;  4BI4 A;  2FPE A;  2L8D A;  4RCC A;  1ABQ A;  4M75 A;  4BD3 A;  4OMQ A;  1YI2 T;  3A8L B;  1DJ7 B;  2K4Y A;  2F5T X;  4LXC A;  2MCN A;  5IT9 E;  4KUL A;  3OYI A;  2KXD A;  3MPU B;  2DTI A;  3JCM c;  3VJP A;  4J5Y A;  2QA4 A;  2HNI A;  4RTZ A;  4C92 F;  3L2R A;  3G6E T;  1VQ4 A;  3CMA T;  1Q86 U;  1OQK A;  1YN8 A;  1OX9 A;  2FL7 A;  3S6W A;  3Q1J A;  2YXY A;  2CP3 A;  2KYB A;  4QVC A;  3ZBD A;  2H3E B;  2EGA A;  5GAM j;  2F5K A;  2HD0 A;  1O75 A;  2KRS A;  4FT2 A;  2OAW A;  3JRZ A;  3M54 A;  2MF2 A;  1JBM A;  5CCA A;  3HKS A;  1PHT A;  4IUT A;  4X1V A;  5GAM f;  3JCM J;  3CC2 A;  1QWF A;  2LJ1 A;  5IAY A;  4RTY A;  1ZSG A;  1VQO T;  1RL2 A;  1YJ9 Q;  4RTX A;  1RAE B;  2ENM A;  4A4G A;  3QHS A;  4JLI A;  2O2O A;  2O31 A;  3F70 A; 
#chains in the Genus database with same CATH homology
 3CCM A;  3M5A A;  4A4E A;  2R57 A;  3C4S A;  4FIB A;  3OYL A;  2YHT A;  1VQP A;  4PJO B;  2XDB A;  3CCQ T;  1VUB A;  2VV5 A;  3OYA A;  1WJR A;  4ELZ C;  2K5F A;  4M7D A;  2F69 A;  2RH2 A;  4JDS A;  4N0A C;  4M7A G;  4M7D G;  1HK9 A;  5I2S A;  5A0L A;  1KQ1 A;  2K3X A;  4M75 C;  4RMO A;  1MGQ A;  1BKB A;  2BKD N;  2RHU A;  2LTO A;  4QVD A;  3WVD B;  3CBM A;  1Q82 C;  5CIU A;  4M78 C;  4C5G A;  4IUU A;  4PL6 A;  3QKJ A;  3URG A;  4X9D A;  4BE2 A;  2A7Y A;  3MEV A;  3L2W A;  5FRN A;  2RI5 A;  1N9S A;  4M75 D;  4OF1 A;  2E65 A;  3A8H B;  3HFO A;  1Y07 A;  2QA4 T;  1FX7 A;  4O5V A;  4C0Z A;  1KC8 C;  4M78 D;  4LDW A;  4XTZ A;  3I56 A;  4FSX A;  1VQM A;  3UT1 A;  5GAN 2;  2ZPI B;  5LJ3 e;  1NPP A;  4OB1 B;  1M5Q 1;  4BUG A;  3OW2 S;  5C6S A;  3MEU A;  2OTJ A;  3JB9 I;  4M7D E;  3TRE A;  2DZC A;  5J3B A;  4IUV A;  2QQS A;  1K9M C;  4XTV A;  5A2Q E;  1M4Z A;  4C92 B;  2YRV A;  4M77 G;  3MHX A;  4HCC A;  5GAN 3;  3X26 B;  2Y90 A;  4PKC C;  5CKB A;  5CKE A;  3OYJ A;  5HK0 A;  4F7U G;  3C95 A;  2M0O A;  3DB4 A;  3NTK A;  2K5L A;  3LH0 A;  4J7F A;  4RG8 A;  4PJO F;  2EKO A;  4LD9 K;  1K73 U;  4OB3 B;  2QQB A;  4ZN1 A;  2RJF A;  2RHI A;  3BDU A;  4N0A A;  3V7S A;  4OP0 A;  1NJI C;  2DO3 A;  2QTX A;  4OMF B;  4GY5 A;  3V8J A;  1X75 C;  2RJD A;  5D6Y A;  2DAQ A;  4C8Q F;  3JCM Q;  4M78 A;  3L2Z A;  4C5I A;  2HAX A;  5GAM e;  1FXX A;  1Q7Y U;  1QVF S;  2WSE E;  4UC4 A;  3M56 A;  4A4K A;  1M1G A;  4BI3 A;  2CYZ B;  3M59 A;  4LDU A;  3TU4 K;  3VV0 A;  1YJ9 A;  4C0F A;  1N9R A;  1Y96 A;  4F7U E;  1VQ7 T;  2EYQ A;  5GAO l;  2E70 A;  5GAN 4;  3BW1 A;  1KD1 C;  1NZ9 A;  2JOY A;  3BDL A;  2ZPH B;  3MCA B;  4M75 B;  4PLL A;  3X20 B;  5C0M A;  2X4J A;  5GMK i;  5DLO A;  3JCM P;  3JB9 G;  2ZCF B;  2E6Z A;  2RD1 A;  2QQ9 A;  2KMT A;  2O4X A;  3LGL A;  3M55 A;  3MO8 A;  4M78 B;  5I21 A;  5HK3 A;  3QO3 A;  2Y4X A;  2ZGW A;  3CBP A;  4JUV A;  2MWP A;  5DY9 A;  3RKX A;  5GMK m;  1I5L A;  4PJO C;  5CAI A;  2A3L A;  3VUB A;  2EQJ A;  5GAN h;  4D6W A;  4XTX A;  3CCM T;  3FC3 A;  2LT4 A;  1M1K C;  1I81 A;  3VYG A;  1VQP T;  2VXF A;  3SD4 A;  5LJ3 h;  1VQ8 A;  2KDS A;  3GNG A;  5LJ5 e;  5GAO p;  1YJN A;  5GMK e;  4C8Q C;  4PJO D;  1VQL A;  2OTL A;  3OBW A;  2HQX A;  5IN1 A;  1FWZ A;  2DVE A;  2H3J A;  2R5A A;  2O4X B;  3OYF A;  1Q82 U;  3E9F A;  2LC4 A;  1G3W A;  4C8Q D;  4DA4 A;  2JZ2 A;  2PQW A;  4MMK A;  5GAO q;  3SB2 A;  3JCM g;  2EFI A;  3CXC A;  4JRQ A;  4RKU E;  4A4F A;  3CCJ T;  4B9X A;  5GAO m;  1LJO A;  1KC8 U;  3E9G A;  4KT0 E;  2E41 A;  2QI2 A;  4HT8 A;  4J6X A;  3SWN C;  2YLB A;  2ZPG B;  4F7U A;  3I56 T;  1VQM T;  5CQY A;  1OZ2 A;  1XOV A;  4J6Y A;  3VU3 C;  1WPY A;  2RM4 A;  4Y91 A;  1YIJ A;  1QP2 A;  4XTU A;  1KQS A;  5A0D A;  2DPP B;  3MEW A;  3RKW A;  3HFN A;  3OYC A;  2OTJ T;  2V8K A;  3FEO A;  1VQK A;  4XU0 A;  2R58 A;  1K9M U;  2QQR A;  2ZPF B;  3GPL A;  4YTL A;  4BAC A;  1UGQ B;  3E19 A;  1QVG A;  3P8H A;  3MP8 A;  4FM4 B;  2Y4Y A;  4HA8 A;  4KUD K;  2EIF A;  1SSF A;  3RMS A;  5LJ5 j;  1WJQ A;  3RKY A;  4DQ2 A;  2L3R A;  4IKF A;  4F7U B;  3QZ9 B;  1B34 A;  4EMK C;  3DLL A;  3OMG A;  2DIQ A;  4N4I A;  4E7I A;  2OAU A;  2EQK A;  2VXE A;  2IG0 A;  3LW5 E;  4C8Q A;  3JCM b;  4M7D F;  3N5B B;  5D6W A;  1X6O A;  1K8A C;  3OYH A;  1G3S A;  4ZGJ B;  3M9Q A;  3PFS A;  3M53 A;  2PVD B;  3CXC S;  3CCV A;  1U1S A;  2X4X A;  4N4H A;  5FU7 C;  1S72 A;  3HRT A;  2FVU A;  2JN0 A;  4MDW A;  3CCE A;  3H8Z A;  3I55 A;  2RB6 A;  3OYK A;  2PUK B;  1VQN A;  2V8I A;  3EFS A;  5LJ5 f;  2CZ6 B;  1JRI A;  2ZPE B;  3P8B B;  1U1T A;  4L5G A;  4C8Q B;  3SWN A;  3PIO A;  3RES A;  1YBY A;  4J8O A;  4GLK A;  4E7H A;  1Q81 C;  4ELY C;  1KD1 U;  1KQS S;  1YHQ A;  5CR2 A;  1YIT A;  1VQL T;  3WXM B;  2PVO B;  2XK0 A;  3VKI A;  4XAX B;  4LDV A;  4A54 A;  2JTF A;  2LRQ A;  1VIE A;  3ER0 A;  1QVG S;  2I2L A;  2MI6 A;  3OMC A;  1LNX A;  3QG1 A;  2LNV A;  2QDY B;  1WGS A;  4MZP A;  5J26 A;  3QDR B;  3X24 B;  2X4W A;  4P5N A;  3CMA A;  2XDP A;  3CPW S;  1M1K U;  4M7D C;  4IUR A;  1VQ4 T;  2XG8 D;  2DTH A;  5AYF A;  3SWN B;  2P0K A;  4XU2 A;  1YJN T;  4F7U F;  5FRM A;  4M7A E;  3FIF A;  4EMK A;  3EAE A;  1VQ5 A;  5A0G A;  3T9N A;  5GAN 8;  2OTL T;  2K57 A;  2QEX T;  2JUF A;  4MDX A;  2HBP A;  1M1F A;  3M58 A;  3G4S A;  4M7D D;  3CCL A;  2LCL A;  4OB0 B;  2K3Y A;  2VYT A;  2ZZD A;  3OS1 A;  2DXB A;  2EAY A;  2LDM A;  1UGP B;  2R5M A;  3M4Y A;  3TEE A;  2K5I A;  4NL2 A;  3CD6 A;  1D3B A;  5GMK l;  3S3N A;  4E7J A;  4XU1 A;  5L8R E;  3QUI A;  3L1A A;  4A4H A;  1KQ2 A;  3DB3 A;  2DXC A;  1OZ3 A;  2KK4 A;  3M57 A;  4EMK B;  3UPU A;  2EJ9 A;  2D6F A;  3ME9 A;  1YIJ T;  1M90 C;  2CZ0 B;  3E1S A;  2RO0 A;  3EFR A;  5J39 A;  4EDU A;  5CKD A;  3JAM E;  1VQK T;  3PT9 A;  3OSS C;  3JB9 H;  4C0D B;  1NPR A;  3S3M A;  5CVI A;  5GAN g;  1ZBX A;  3JB9 F;  3PIP A;  1Y71 A;  4M77 E;  2EQM A;  2B8A A;  4L6V 5;  2RJC A;  3OYM A;  3RMQ A;  5KE3 A;  2P0P A;  5LJ3 g;  2FHD A;  3CC4 A;  3NFC A;  5FU7 B;  3CCS A;  3CC2 T;  1M8V A;  3BFM A;  5KCO A;  3X28 B;  1VQO A;  3CBO A;  3QJ6 A;  4E47 A;  3WVE B;  4IUQ A;  1IZ6 A;  4M7A A;  3J80 E;  1OI1 A;  3UWN A;  4BB7 A;  3J7A F;  4X34 A;  2WSF E;  2QQA A;  3FDR A;  3HL8 A;  3LWH A;  1BIB A;  3GOX A;  1MHN A;  4E7K A;  2P4T A;  2BIV A;  2RI2 A;  1N8R C;  4JRP A;  1K8A U;  3KBG A;  1P92 A;  4HKE A;  4PJO G;  3M4G A;  4KBM B;  3INZ A;  3G71 A;  5GAN d;  1Y96 B;  1BIA A;  3CCV T;  1GXI E;  1QW1 A;  4E7L A;  4KUI A;  2XIC A;  4XTY A;  4M7A B;  3RIR A;  3CME A;  1BI1 A;  4M7D B;  1BI0 A;  3CCE T;  2XKO C;  3I55 T;  1VQN T;  1H3Z A;  4BY6 B;  1WJS A;  2CZ1 B;  1Q81 U;  1X01 A;  3A8G B;  1U8R A;  1YHQ T;  2EJF A;  3DLM A;  1JB0 E;  2MWO A;  2LQ8 A;  3L42 A;  5GAM g;  4ZTF A;  1BI3 A;  4M77 A;  3P8D A;  3HRS A;  3JB9 D;  4BE1 A;  2QXF A;  4PJO A;  3CCU A;  3HPW A;  1NJI U;  1RI0 A;  5GAO r;  4L59 A;  4NS5 A;  3CEY A;  1YJW A;  4LD6 A;  4V2S A;  3HSB A;  3QXE B;  3C94 A;  2O01 E;  3QPH A;  1ZQ1 A;  4N4G A;  4NOY A;  5HY6 A;  4B9W A;  5KH6 A;  3OYB A;  2DTO A;  1NE8 A;  3FB9 A;  2CZ7 B;  4C92 G;  2D9T A;  1VQ5 T;  3R6O A;  2MMP A;  3V8K A;  3V7R A;  2BUD A;  4M77 B;  5GAM h;  3G4S T;  4CRI A;  4DOW A;  4CI0 C;  4NL3 A;  1TH7 A;  3GNF B;  4HCB A;  3CPW A;  3OYY A;  2LVM A;  4DOV A;  1O9S A;  3BY7 A;  3JCM d;  4J6W A;  3JCM V;  2LQK A;  4HCZ A;  3CD6 T;  2KVQ G;  4PLI A;  4JS5 A;  2LCC A;  2E10 A;  3ZFJ A;  2DD4 A;  3PTA A;  3SDZ A;  2WSC E;  2GQV A;  1QVP A;  5FLX E;  4M7A F;  2VUB A;  4QQ6 A;  4TVR A;  4C0D C;  2GFU A;  4FU6 A;  3LGF A;  3FRN A;  1M90 U;  3MEA A;  5GAO n;  1YI2 A;  4C92 E;  1UB4 A;  2EQU A;  1I8F A;  2DD5 A;  3MP6 A;  1B34 B;  1UGS B;  2RK1 A;  3JCM f;  3G7Z A;  4ZGE B;  3QSU A;  3CPF A;  5LJ5 h;  5GMK h;  3OYN A;  3L2U A;  3CC4 T;  1N27 A;  4M75 G;  1YJ9 T;  3CCS T;  4LDX A;  3CC7 A;  4Z02 A;  2RHX A;  2CGH A;  1IRE B;  3JCM X;  3OY9 A;  2C06 A;  1VQ6 A;  4M78 G;  3OYG A;  3RER A;  2E5Q A;  2MAM A;  4PNO A;  4ZGD B;  1LOJ A;  4ATO A;  3GIB A;  3G6E A;  1N8R U;  4XU3 A;  2CS7 A;  2XDD A;  4R55 A;  4M77 F;  1Q86 C;  4M7A C;  5FU6 B;  1W4S A;  1QP3 A;  2NLU A;  2AHJ B;  2KSS A;  2JVV A;  3J81 E;  1W2B S;  2XID A;  3LWI A;  3G71 T;  2E1H A;  4BY6 C;  4QQG A;  3SFM A;  3ZEH A;  4ZTJ A;  2GFA A;  4O6J A;  1OYX A;  3CC2 A;  2EWN A;  3OBY A;  3CME T;  1PSF A;  2RA2 A;  2DXT A;  1UGR B;  4MML A;  4M7A D;  4M75 E;  4QQD A;  2E6N A;  4ME7 A;  5CKF A;  5CO7 A;  2XI9 A;  4C5E A;  5M9O A;  5KE2 A;  4OGC A;  4C92 A;  4M78 E;  2G3R A;  3OA6 A;  3KXT A;  2GF7 A;  3CCJ A;  1WNL A;  1WQ7 A;  2DK3 A;  2E64 A;  5GAN e;  3L2Q A;  2YLC A;  2D0Q B;  1G5V A;  1BI2 A;  1XQH A;  4FT4 A;  2JTM A;  2IVW A;  4J83 A;  3CCU T;  4OB2 B;  2CKK A;  3C12 A;  1YJW T;  2FB7 A;  3VUZ A;  2LX9 A;  4XK8 E;  4XQ3 A;  1R8O B;  3OYD A;  4MZT A;  3LLR A;  4M77 C;  2ZPB B;  3UDC A;  3CCR A;  1KG1 A;  2L5Q A;  2FYK A;  1BYM A;  3GLX A;  3TCJ A;  2LT1 A;  3FLG A;  2X35 A;  4BE0 A;  1VQ9 A;  1D3B B;  3OB9 A;  3GF5 A;  3H6Z A;  3OS2 A;  2GCX A;  4J7I A;  1JJ2 A;  2DXU A;  4Q5W A;  4QW2 A;  1N6A A;  4X9C A;  3LX7 A;  4M77 D;  1XTD A;  3V8L A;  4BI4 A;  2DEQ A;  5GAN 6;  3S3O A;  2E12 A;  3AHU A;  2L8D A;  1M9S A;  3MET A;  4OVA A;  3OS5 A;  4RCC A;  4RG2 A;  4M75 A;  1KHC A;  3QII A;  3RUX A;  3QZ5 B;  3KUF A;  5GAN 5;  2KAF A;  2M9U A;  1V29 B;  4BI8 B;  2V8J A;  3JCM W;  5GAN j;  1EIF A;  1AHJ B;  3NTI A;  4BD3 A;  3CCQ A;  1Y7X A;  2WAC A;  3PMI A;  3JCM e;  5CKH A;  1PSE A;  1YI2 T;  4A53 A;  2DZ9 A;  3A8L B;  4MZM A;  1DJ7 B;  5LJ3 j;  2K4Y A;  5GAN 7;  1KHI A;  2F5T X;  3JCM J;  5IT9 E;  4KUL A;  5DM7 R;  4WF2 A;  1S72 T;  3OYI A;  2RJE A;  2KY9 A;  4C8Q G;  5LJ3 d;  3DKM A;  3O8V A;  2XD0 A;  2DTI A;  1G3Y A;  2DJZ A;  3JCM c;  3CC7 T;  1XNI A;  4JRI A;  4Y28 E;  1YIT T;  3VJP A;  4J5Y A;  1VQ6 T;  2VC8 A;  2HQE A;  2QA4 A;  2HNI A;  2L89 A;  5FU6 C;  3VYH B;  2RK2 A;  4C92 F;  4JS4 A;  3L2R A;  5GAN f;  2X4Y A;  3G6E T;  1VQ9 T;  1VQ4 A;  1JJ2 S;  4PJO E;  5FRO A;  2RI3 A;  2PUO B;  1UEB A;  4C0G A;  1Q86 U;  3CMA T;  1ZHI A;  2FL7 A;  3S6W A;  3V7C A;  5LJ3 f;  3Q1J A;  3HRU A;  5CQX A;  3OQ5 A;  2PVG B;  1HXD A;  2JNG A;  4C5H A;  3A8M B;  2QEX A;  2DIG A;  4QVC A;  3ZBD A;  4JRK A;  4C8Q E;  2KQW A;  3QBY A;  1H64 1;  1QVF A;  3PMT A;  1WQW A;  5GAM j;  4R56 A;  2F5K A;  1I4K 1;  2HD0 A;  3CCL T;  1O75 A;  1VIF A;  4FT2 A;  4VUB A;  3OS0 A;  3JRZ A;  3M54 A;  5GAM d;  1G3T A;  4IUP A;  4QVZ A;  5I2M A;  5LJ5 g;  1K73 C;  1W2B A;  5HKC A;  2MF2 A;  3PNW C;  4JJN K;  3GP8 A;  1JBM A;  2M1H A;  3QYG B;  4BDY A;  5CCA A;  3A5Z B;  3HKS A;  4BDZ A;  3NTH A;  3JSC A;  3QYH B;  4C92 C;  2VGM A;  4FL6 A;  4ZN3 A;  2XHC A;  3OYE A;  2RHY A;  5KCH A;  2DKG A;  2PU9 B;  4M75 F;  3QJY A;  3FJP A;  1Q7Y C;  3CCR T;  2K2V A;  3OSV A;  4IUT A;  5CK9 A;  3LYI A;  5LL6 S;  2XU8 A;  4LDY A;  3JCM h;  4M78 F;  5EG2 A;  3ASK A;  2EJG A;  3HP9 A;  4II1 A;  5DLQ E;  3X25 B;  4C92 D;  4EMG A;  4EMH A;  4EPC A;  5GAM f;  3A8O B;  1YCY A;  5D6X A;  5GMK j;  1VQ7 A;  3L2V A;  4XTW A;  5IAY A;  3JB9 J;  3OW2 A;  2M16 A;  4JLG A;  1VQO T;  5LJ5 d;  1RL2 A;  3PGG A;  2P0Q A;  1VQ8 T;  4A4G A;  3QHS A;  2VGN A;  4JLI A;  2RHZ A;  3MP1 A;  4HT9 A;  4RCB A;  3HHT B;  4OGE A;  3F70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...