5HK3A

Crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
VISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNDALAAMPGNVDLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Endoribonuclease MazF6
publication title Crystal structure of M. tuberculosis MazF-mt3 T52D-F62D mutant in complex with DNA
rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
total genus 27
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2016-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5hk3A00
2VUBA 1M1FA 3VUBA 5HK0A 5CKEA 5CKHA 3G7ZA 5CCAA 4HKEA 4MZPA 5HKCA 5DLOA 1UB4A 4ME7A 2KMTA 5CR2A 5CQXA 4MDXA 5HK3A 5CKBA 4OF1A 3HPWA 2MF2A 4VUBA 5CKFA 5CKDA 3TCJA 3JSCA 5CK9A 1X75C 4ELZC 4MZMA 5CO7A 1NE8A 2C06A 3NFCA 3JRZA 4ELYC 1VUBA 4MZTA 5CQYA
chains in the Genus database with same CATH superfamily
3JAME 2RQWA 3C95A 4XTYA 1NEGA 1X6BA 3VS5A 5D6XA 1AWXA 3AHUA 3QG1A 4TVRA 2LNHB 4F17A 3OBWA 3CCUQ 1KD1R 1S72A 1MNDA 2PUKB 4DEYA 2K3XA 2E6ZA 1K8AU 3MP8A 1PRMC 4PNOA 5CKHA 1Z9ZA 4J7IA 5CVIA 4BE0A 1NJIC 1UHFA 3EG9A 4IUQA 4NOYA 1K9MR 5LJ3e 3GOXA 4FSXA 3NTHA 1VYVA 2CS7A 1Q81R 4RMOA 2RK2A 2QGGA 2ABLA 5FU7B 2RJEA 4JZ3A 4QVCA 2D0NA 1N8RR 1SHFA 2QA4T 4RG2A 1S72Q 9ATCB 1G83A 4PKCC 3RBBB 2FO0A 2RQVA 2QQAA 1G3TA 4J9HA 1RL2A 4B9XA 5KYNA 5LJ5d 2KT8A 5IH2A 1XQHA 1Y57A 2OTJT 2EVRA 5IT9E 3HTRA 1M2VA 2YUNA 2FVUA 2CP3A 1FMVA 2ED1A 3BY7A 3OYGA 5GAN4 3G1JA 4A4KA 1KJWA 2HSPA 5J3BA 2RHUA 1VQNA 4WF2A 1Y7XA 5GAMf 1WXTA 4K11A 4J6WA 4ZGDB 1QVGA 3PMIA 2LQKA 4M7DC 4IIMA 4AG2C 3HSBA 2EQKA 2KXCA 4QVZA 5ECAA 2DILA 3RR6A 5HK3A 2KROA 4Y28E 4C92A 5GAN2 1RUWA 5J26A 3JCMb 1M90R 4PJJA 3OMCA 1WHJA 1PSEA 1OOTA 2DIQA 4M7DE 3QSUA 3WXMB 3PFSA 2DX1A 4OGEA 4LXCA 1K0XA 1VQNQ 1KC8C 2DRKA 3OMGA 4V2SA 3CPWP 4M75E 1Y07A 1Y96B 3PVLA 2OAUA 1BK2A 1I8FA 1VYTA 2WACA 2XDBA 3CCMT 1D1BA 5GMKj 3C94A 4KH0B 2FPFA 1MV3A 4HCBA 2E41A 2R5AA 1VOMA 4JJCA 3VS6A 3EG2A 1MNEA 2E12A 2P0PA 2A7YA 5IAYA 4YTLA 1TS9A 3JSCA 1PM3A 3I56A 2ATCB 2F2XA 3M59A 4C92G 4EMGA 2QDLA 4M4ZA 1VQ6A 1KHCA 2K3BA 1WYXA 4BI8B 4E7KA 4FT4A 2DEUA 3CQTA 2DXCA 3A8HB 5DLOA 1WHLA 4PK4A 2LTOA 2RQRA 2JTFA 3EG9B 3N5BB 1WZOA 2JTEA 4M7AF 3Q1JA 5CKDA 1EX4A 1UUEA 3I55A 1VQOA 2F69A 1C6VX 2K4YA 1D1CA 1YITT 1IHVA 2EFIA 4JS5A 4F7UE 3OYIA 2CKKA 1CSKA 1KQSS 2CP0A 4KGZB 3UPUA 1ZSGA 2LZ6B 3I56Q 4EMKA 3EGDA 3EAEA 1KQSA 3CC4A 1VQ6Q 4J7FA 1BB9A 2MWOA 1PD0A 2XDPA 3CXCP 3O5ZA 4XU1A 3UWNA 2QG9B 2DYIA 4OMNA 4PFOA 1JXOA 1Y0MA 2HBPA 3QIIA 1BCMA 2KXDA 4M78A 3JCMQ 4J9GA 3TSWA 1W1FA 4BY6B 1VQOQ 4DBRA 4E47A 2LQNA 3VS2A 5LJ3j 4JRKA 2QGFB 4A4EA 5GJVB 3PT9A 1H3HA 5A0GA 2BUDA 1PD1A 5CK9A 4N4IA 5DY9A 3VRYA 3OW2A 1Q86R 5FU6B 2KNBB 1IGUA 1PNJA 2ZZDA 3CC4Q 1BIAA 4QKUA 3OY9A 1W2BP 3MPUB 1D0XA 1H92A 3CCST 1D3BA 4HT9A 4MDWA 2RN8A 3RERA 3T9NA 3VS4A 4FT2A 5GANd 2JXBA 2FRWA 1P92A 2QQBA 1EZZB 4R0KA 2J6OA 4C8QA 1J3TA 1T0JA 3QWXX 4A53A 3KXTA 5GAN5 3VS1A 2DVJA 2DL7A 2FPDA 4D8KA 3G7ZA 5GAMg 1VIEA 4M78G 2LX9A 4PL6A 3HRTA 2VKNA 5IXFA 1IZ6A 2DJZA 1QVFP 1YJNA 3EHQA 2FZCB 2XHCA 2F5TX 1SSFA 2A36A 6AT1B 1TWBA 2D9TA 2KGTA 1YIJT 2OTJA 2X4YA 3WVEB 4KBMB 3OBYA 1RAAB 3VS0A 3V8KA 2E5QA 3RKXA 4X9DA 1HYOA 2QTXA 1WDXA 5A0DA 5CIUA 2NWMA 3AT1B 1O75A 2EKHA 3QYHB 4CRIA 1WHHA 2J6FA 2L3QA 1M8VA 4C0ZA 3H9NA 2DNUA 1FXXA 2AZVA 3RKWA 4ZN3A 2HAXA 1ZA2B 1AHJB 2GCXA 3X25B 4BI4A 2YUOA 1UGVA 3DB3A 4M7DF 1YI2A 1Q82C 1YJNQ 1JU5C 2XMFA 3EFOB 5GAOr 2GBQA 2RH2A 2P84A 4KT0E 3S3MA 3LGLA 2OTJQ 2DIGA 4AFQC 4RKUE 1VQLA 2Y4YA 1FMWA 1RAFB 4J9BA 3CMAA 3BW1A 3HKSA 3EH2A 3CC2A 1RLPC 2PTKA 4BE1A 2E3HA 5FW9A 3OYEA 5GJWB 1QKXA 2K9GA 1X2KA 2NUZA 3BE3A 1NJIU 1B07A 3EGDB 3V7RA 5IHIA 3ZBDA 5CKFA 3L1AA 2QQSA 5IHKA 4JJBA 3SFMA 2BKDN 2OX7A 4XTZA 1VUBA 2O9VA 3ME9A 3QDFA 4PJOF 3CCMA 1Z9QA 4LN2A 4QVDA 3G71A 1VQ4A 2HKNA 1UECA 2JM9A 3VS7A 1UB4A 4OB1B 1VQ7T 4ME7A 1UDLA 4HCKA 1VQLQ 3QYGB 4J5YA 4UC4A 4JRQA 3CMAQ 1U8RA 4LDYA 1YJWA 3CC2Q 1G2BA 1X6GA 5KYUA 2X9HA 2A37A 3L2ZA 1UJ0A 1WXUA 2X35A 2FHDA 2OI3A 1SPKA 1Q7YR 1JB0E 1YFNA 1AEYA 3SD4A 5GAN8 3QHSA 1D3BB 4Z89A 2YSQA 3JCMW 3CBOA 2LVMA 3CCMQ 2VV5A 3G71Q 4RTZA 1ZSZA 2CYZB 3R6NA 1VQ4Q 2J6KA 2YUPA 3EGXA 1SRLA 4IUUA 4C8QB 3H6ZA 4A4GA 4OB3B 3EFRA 3FDRA 3NHNA 4JRIA 3DLLA 3CCRT 1ZUYA 3MHXA 4Y92A 1YJWQ 2EBPA 2V1QA 5GAN7 1YBYA 2HD0A 3QUIA 3RKYA 4OMLA 4RTUA 1TG0A 2P4RA 5AT1B 1KD1C 2CSIA 1VQ8T 2K5LA 2IG0A 3CD6T 5FWCA 1BIBA 2EQUA 2KT1A 3EGUA 2BTTA 1M4ZA 2DTHA 2YHTA 1ZLMA 2E10A 1D0ZA 5FU7C 1ZHIA 4JDSA 2ROLA 2EW3A 2LJ0A 1VQKT 5LJ5f 2F1LA 3JB9D 1MHNA 1KC8U 2H8HA 3OYKA 4CC7A 2COYA 3FJ5A 4ZTJA 2JMAA 2XI9A 2WSCE 1Q81C 1IHWA 2CGHA 4LDUA 2EQMA 2HBWA 2LNVA 2DL8A 5C0MA 2CUBA 2HSEB 1N8RC 2LRQA 5FWBA 2Y90A 2LJ3A 2X4XA 4M7AA 2RI5A 2F5KA 2K57A 3GNFB 2EJGA 2GFAA 1RI9A 7AT1B 5EG2A 2NUTA 2VB6A 4L59A 3CC7T 2COWA 3OYCA 4M77C 4PJMA 4OGCA 1YCSB 2JS0A 3LGFA 1NPRA 2FZKB 4KGVB 2M16A 1UGRB 1DJ7B 1Y71A 3RNJA 2JVVA 3JB9J 1VQ9A 2KBTA 4JRPA 3CCET 1NEBA 2O88A 2GTJA 3G4SA 1RAGB 4M78D 3J7AF 3CCVT 3EFSA 2KY9A 2EPDA 3L2QA 1RAEB 2PZ1A 4OB2B 3X20B 2IIMA 3RIRA 3VRZA 2KYBA 4AG1C 2XG8D 1KHIA 2EKOA 1PWTA 2RI2A 2RF0A 3PNWC 5KYYA 1GBQA 3OSSC 1OQKA 2MI6A 4Q5WA 1JJ2S 2WSEE 4PLLA 1D1AA 1G3YA 4M7AG 2V8KA 1M90C 1VQ9Q 2MAMA 2LCSA 1JRIA 2EJFA 4WTOB 3G4SQ 2EWNA 4RTVA 2LQWA 1NM7A 4JLGA 3LW5E 4C8QD 1ZBXA 2JN0A 1AOJA 4C0DB 3ER0A 3X26B 1G5VA 1SEMA 4WCIA 1H3ZA 2E6NA 3A8LB 5DLQE 1ZSZB 3ULRB 2RB6A 3CCJT 1SRMA 2ZPBB 1M1KU 1NLOC 1UGSB 2CZ0B 2GNCA 4Z8AA 3TVTA 3JCMd 1VQ5T 2IVWA 1H8KA 4KRTA 4L6V5 1N27A 1RABB 3LWHA 5AYFA 3HRUA 4P5NA 1M3AA 5FRNA 2EYXA 1W4SA 4ELZC 1M8MA 3JB9I 1KG1A 4RTTA 1NE8A 2ZPEB 1OPLA 1VIFA 2JT4A 1N6AA 2A28A 4R56A 3HP9A 2R5MA 1VQ7A 2L3RA 2COZA 2JOYA 3SWNC 1YJ9T 3HHTB 4C5GA 3C4SA 3V8JA 3META 5D6YA 4M7DA 4EPCA 3GP8A 4C0GA 2MPXC 2V8IA 3CCQT 5GAOp 1IGQA 2OTLT 1RAIB 3CCLT 3IQLA 5LJ3d 3BFMA 1OZ2A 4M7AB 1I5LA 1HD3A 4BY6C 3L2UA 1PSFA 2L3SA 2NUTB 3OW2P 1TUGB 4J9EA 4M75C 1IRXA 2DF6A 4II1A 5LJ5g 4N0AC 1M2OA 5GANf 2QQ9A 1VQ7Q 5GAMh 5FU6C 4Z02A 4PJNA 1UEBA 4A54A 1Q82U 3M53A 4PJOA 1OEBA 1ZBJA 3EH1A 3JCMX 4E7JA 1VQ8A 1Q86C 1ABOA 3CD6A 3QZ5B 2EGCA 3MEAA 2W10A 3NTKA 2ZPHB 3P8HA 2CT3A 3FIFA 5CAIA 2D6FA 2DTOA 2CH4A 2AZSA 3M9QA 4M7DG 2I0NA 3FJPA 1XOVA 1GFDA 1C1AA 3OS0A 4O5VA 3RMQA 2K79A 3TREA 3TU4K 4O6JA 3L2WA 2AT1B 3UA6A 3OS2A 2MCNA 3NPFA 1BKBA 4DOWA 2EYZA 2JTMA 1UFFA 2ROTA 3E1SA 8ATCB 3UA7A 1VQ8Q 2KEAA 3CD6Q 1U06A 4QW2A 1LPLA 3WVDB 3PE0A 2JW4A 3PIPA 5I2MA 4JZ4A 4D8DA 4FM4B 4M77F 1YHQT 1UE9A 2L5QA 5GAMe 5GAN3 1WHKA 4PJOG 2GTOA 3JRZA 4DBFA 3M4GA 4HVUA 1AWWA 4ZGJB 2P0QA 1MMNA 2BE9B 1MMAA 3PGGA 2CZ6B 3CCVA 2J06A 3LX7A 3TSZA 3ZEHA 2LCCA 4J9IA 2F2WA 1TUCA 2KK4A 2X3WD 5D6WA 3R6OA 2DJQA 2X3XD 4XU2A 3A98A 2YXYA 1OU8A 4J9FA 4KULA 3DLMA 5KCHA 2RNAA 4F04B 1K73R 4M7AD 2KQWA 2M0YA 2C0OA 5FLXE 4OVAA 1M2VB 1KD1U 2J05A 2RI3A 4QQGA 2ZCFB 4BD3A 2CP7A 4CI0C 3MEWA 2BE7D 2EGEA 2DA9A 4FYWB 1RACB 4FIBA 1M1KC 4XTWA 2OAWA 3CCVQ 4IKFA 4IUPA 4NL2A 5L8RE 2DO3A 4CC2A 2WSFE 4BACA 2A0FB 3M57A 2KMTA 1M9SA 4DBQA 3INZA 4OF1A 1ZUUA 1Q81U 1YWOA 4C92B 2QDYB 4GLMA 4LD9K 2YLBA 4EDUA 2EYQA 1SSHA 1N8RU 1V1CA 4X1VA 4JLIA 4HCCA 4KH1B 1F1BB 4HKEA 4AFUC 2QASA 1OPKA 1PKTA 2QA4A 1SF9A 5CQXA 4IUTA 3FC3A 2XD0A 1VYUA 2PNIA 4PJOB 3CPWS 2HNIA 2HL5C 3HRSA 1RLQC 5KYXA 2L3PA 4XQ3A 4AT1B 4E7SA 3CCUT 3CPWA 1K4US 1Q7YC 2L89A 4C8QC 4J6YA 2AK5A 1OX9A 2M1HA 5HY6A 2VASA 1BI3A 3M58A 4OP0A 1M3BA 1ACMB 1HJDA 3KFVA 3QO3A 4FYYB 2OJ2A 5GANg 1SG5A 1RI0A 1UTIA 5I11A 1QW1A 4JJNK 4OB0B 4Z88A 3J81E 2QA4Q 4C8QE 2EIFA 3CCQA 2XKOC 2OTLA 1SKUB 5GAOq 1KQ1A 3VYHB 3CCLA 4ATOA 4FYVB 1AVZC 3D7SB 1YNZA 1N9RA 2LC4A 2NUPA 5C6SA 3JV3A 4E2FB 1M90U 1BBZA 1UGPB 3GPLA 4JUVA 2MYSA 1QWEA 4XTXA 4M75F 4MZTA 2CUDA 1K8AR 2VUBA 1OZ3A 4QQDA 3NGPA 2KR3A 3QJ6A 3OS5A 1A0NB 3EG1A 2NYSA 4EMKB 2LT1A 3CCQQ 3EG3A 3HL8A 4IIOA 3VU3C 2OTLQ 3GF5A 1W6XA 3CCLQ 2MOXA 3CXCS 1X75C 3BDUA 4XTVA 4LUDA 1AWOA 4HA8A 2CH4W 4IUVA 5I21A 5CQYA 3CXCA 1WQ7A 2RQTA 3LWIA 1TOVA 1I81A 4J6XA 3GNGA 4LDWA 4XU3A 4M78B 1NYGA 5I2SA 4BDZA 3A8OB 1WI7A 2LX7A 2RJDA 2QAZA 2VXEA 5CKBA 1K1ZA 1SHGA 2QYZA 5GAMj 3P8DA 1HXDA 1WPYA 1K9AA 4RCCA 2D8HA 1GRIA 4C92D 2DK3A 3MJXA 4KUIA 2E1HA 3QKJA 1W2BS 3LLRA 5A0LA 1WJSA 1X01A 4ESRA 3J80E 4F7UF 3QDRB 2QEXT 1WA7A 2K5FA 1X69A 1W2BA 2FB7A 2PVGB 5IXBA 2DMOA 2XIDA 4VUBA 1VQNT 5IN1A 3MEUA 4PJOD 2O4XA 2QQRA 2O31A 3GIBA 2VVKA 1S1NA 3V7SA 2BZYA 1ABQA 4D6WA 3OS1A 4CC4B 3OYLA 1YITA 1V76A 4J83A 4C0DC 5GMKh 1FWZA 1MMDA 4GY5A 3A8MB 4PFPA 3RESA 2HZYA 1QMCA 3JB9F 2FL7A 2JZ2A 1Q95G 3I9QA 3JCMf 2C0TA 1KSWA 2DLPA 1U3OA 3V8LA 1QVFS 1KFZA 3OYDA 1QWFA 1XTDA 4ZTFA 4FSSA 3VUBA 2KRMA 3NMZC 2R58A 2F2VA 1NPPA 1T3LA 1NG2A 1K9MC 3G6ET 4XTUA 1YITQ 3JCMh 2PU9B 1Q86U 4BDYA 1FX7A 1I0CA 2FEIA 2H3JA 3CBMA 2DPPB 2BZ8A 1WFWA 4M77A 1VQMT 1X2QA 5LJ5h 1PKSA 2E65A 1ZUKA 3O8VA 3CCSA 4FW1A 3I5RA 2EAYA 5LJ3f 1G3SA 3I56T 1QVGP 1X6OA 3TCJA 4HXJA 4C5HA 1GCQA 1WHMA 2O9SA 2A08A 1QKWA 3TEEA 5GMKe 4F16A 3PTAA 3OA6A 2ZAEA 4M7AC 2DXUA 4MMLA 2XU8A 3CMET 3JCMJ 3I55T 1VQOT 1IREB 3M54A 3E9FA 3KBGA 3C0CA 1CKAA 2ZGWA 2VYTA 2YWWA 5KE3A 4NL3A 1ZA1B 3ZL7C 4X9CA 3CCSQ 2DXTA 3JCMV 1EFNA 2K2VA 4C8QF 2HQXA 1YIJA 2DL4A 2DL3A 5HKCA 4M7AE 3CC4T 3MCAB 3PMTA 2XK0A 1PC0A 2E4HA 1Y96A 3CPFA 3OB9A 3FLGA 2EJ9A 1JJ2A 4M77G 1O9SA 2K3YA 3THKA 2GQVA 2KDSA 2KSSA 4LUEA 5KYUB 4KGXB 1RADB 2K6DA 2YT6A 4E7ZA 1MGQA 1D0YA 5LJ5e 2A3LA 3EG0A 2KE9A 1VQPT 4LE9A 2HQHA 5GMKm 2DZCA 2L8DA 3VJPA 3OYJA 2EYYA 3H0FA 2VGMA 2C0IA 2DZ9A 2M0OA 4R55A 4L5GA 1ZX6A 1YIJQ 1UG1A 1M5Q1 2O4XB 5GMKl 1AZGB 3EGXB 4HVWA 2JMCA 1N9SA 3QWYA 2O01E 2M02A 2CREA 4PLIA 2LCLA 2RK1A 3JCMP 2DAQA 2E64A 3REBB 2LJ1A 3M56A 1MV0B 1U1TA 2EQJA 2DKGA 4DA4A 2E70A 3U23A 3H0HA 1GBRA 4NS5A 1C0MA 4N4GA 1UHCA 4E7IA 1KQSP 2FG0A 2DM1A 4ORZA 2GQIA 3SWNA 3GLXA 2CZ7B 2G6FX 4RCBA 4XK8E 1YJNT 1GL5A 3BDLA 3GBQA 3MEVA 3V7CA 1Q7YU 2HCKA 5A2QE 1H641 3M55A 3JCMg 3QBYA 3QJYA 4FYXB 4M77B 2QEXA 2LP5A 4M75A 4BI3A 2LMJA 2BIVA 1QVGS 2VGNA 4N0AA 2QTVA 5KYWA 2HL3A 3PIOA 1R0BG 1M3CA 1UJYA 3L2VA 4RUGA 1PRLC 1B3QA 4JPBW 1M1FA 1YI2T 1HK9A 2Y4XA 1K73C 3CCRA 2X4JA 2ESWA 4CC3A 4EIKA 2ZPIB 2V26A 5L23A 4J9CA 4ANJA 3P8BB 3MP6A 4RTXA 3VKIA 4FL6A 4XAXB 1VQLT 3CMAT 3HFOA 4C92C 5GAOn 3CC2T 3OYMA 4E7LA 4OMPA 3QXEB 1KK7A 2QEXQ 4GBQA 2CP6A 5GANh 2P4TA 3CEYA 5KYYB 2RHXA 5LJ3g 1QP2A 1OYXA 4Y91A 4JS4A 3FB9A 2SEMA 1WIEA 1EIFA 1VQKA 3OYYA 3G6EA 1NJIR 3E2UA 2RHZA 2ECZA 5KE2A 4PJOC 3M0QA 3CCRQ 4F7UA 3I5SA 4M75G 1OV3A 4C92E 3G71T 3E9GA 3OYAA 1VQ4T 3LH5A 4RG8A 2KYMA 2HMAA 1WJRA 2AIRB 4RTYA 2CT4A 4A4HA 3OYFA 2RA2A 1YJWT 1VQMA 1TXQA 2DE0X 4OMOA 4HVVA 2RM4A 1MMGA 2D0QB 3CC7A 2H3EB 4PJOE 2YUQA 2LQ8A 2X51A 3M0TA 2X4WA 4RTWA 3L42A 3X28B 1AWJA 1VQKQ 1OULA 3G6EQ 4J9DA 4OMMA 2ZPGB 3CCEA 3E19A 3EFOA 4AFZC 2ENMA 2DD5A 4E7HA 1JQQA 2JM8A 5GMKi 2LDMA 2MF2A 1AT1B 3CMEA 2KI7A 5IHNA 4FU6A 3ASKA 2RPNA 1ARKA 1AZEA 5GANe 1QVPA 2BZXA 2RHYA 4HCZA 4E6RA 2MIOA 4QQ6A 4LDXA 1VQMQ 4LNPA 1QQJA 5LJ5j 1PG5B 1YWPA 2HQEA 2RHIA 5HK0A 2YRDA 2RMOA 4F7UG 4GLKA 3L2RA 3CC7Q 2CZ1B 1YN8A 2KAFA 3SWNB 2JS2A 2IPOB 4B9WA 4M77D 3EHRA 4EMKC 5EC7A 1WHGA 1PHTA 5GAOm 3VUZA 3CCEQ 1TUDA 3TQ7P 1K0SA 8AT1B 1LNXA 1K8AC 4M7DB 2CSQA 2EYWA 1E6HA 4BUGA 3S3NA 3CMEQ 3I55Q 5GAOl 2VXFA 1T0HA 4ZNXA 2PUOB 1YCYA 1IB8A 3MO8A 4M78C 5GAMd 3JB9G 1QLYA 3SEMA 1K9MU 1VQPA 2AHJB 2R57A 1GFCA 4QT7A 4M75B 2CP2A 3OW2S 1KC8R 1JEGA 3VYGA 4FCYA 1WGSA 2NLUA 1G3WA 2MWPA 2RO0A 3JCMc 1CKBA 5KYWB 3FRNA 1D09B 3SHWA 1OU9A 2V8JA 3CCJA 2L2PA 2K5IA 1B34A 2KRNA 2GF7A 1IXDA 1GCPA 2DTIA 3DKMA 3RUXA 2FPEA 3OYNA 1BU1A 1VQ5A 4M78E 4OMFB 3PVQA 1RAHB 4C5EA 2JUFA 5J39A 3S6WA 1JBMA 1LVKA 1V29B 3OSVA 2DL5A 3RDVA 3S3OA 4MZMA 1VQ9T 5DM7R 1BI0A 5LL6S 3G4ST 1VQPQ 2CP5A 2XICA 1OI1A 2DVEA 3URGA 2GGRA 2YRCA 3A8GB 3OQ5A 3CCJQ 4DEXA 3M4YA 5HCKA 1YJ9A 1NLPC 1LJOA 1VQ5Q 4F7UB 1R8OB 1QCFA 2QK0A 1X43A 1VA7A 2PVDB 5CKEA 4DOVA 1WQWA 3H41A 1M27C 3F70A 2O2OA 1TTHB 1U5SA 1WLPB 1S72T 3MP1A 1AD5A 3H8ZA 5KH6A 3OYBA 2EQIA 1JO8A 3M0PA 1I1JA 4AFSC 4C8QG 1GXIE 2G3RA 1QP3A 2DD4A 1YJ9Q 2VC8A 1TSFA 1BI2A 1R0CB 4PJLA 2DERA 2YRVA 2E3IA 5FRMA 4N4HA 2VWFA 1QCNA 3DB4A 2YDLA 4BB7A 4ZGEB 3UATA 2QXFA 1M1KR 4DQ2A 1BCOA 2ZPFB 4C92F 4M7DD 4BE2A 3VS3A 1TH7A 3M0RA 4A4FA 1U1SA 2DRMA 4C0FA 4JJDA 4XU0A 1NBEB 2LT4A 2PVOB 4M75D 2XDDA 2AKKA 1WXBA 3H0IA 1YI2Q 4AMCA 1LCKA 3NFCA 4IURA 2AKLA 1M30A 2KVQG 1KQ2A 2K2MA 4ZN1A 3REAB 4DBHA 4PFZA 1K76A 5KCOA 1JJ2P 5M9OA 4MDXA 3I35A 2FZGB 1XNIA 3HPWA 2GFUA 2I2LA 3OYHA 2M9UA 2RQUA 4EMHA 5GANj 2MMPA 4B6MA 2PQWA 5CO7A 4ELYC 1YHQA 3MKDA 2DEQA 2FRYA 1T3SA 2RJFA 1B34B 2QI2A 4J8OA 1W70A 4MMKA 2DBKA 2KRSA 1PCXA 2ED0A 2FYKA 2K7AA 3FEOA 4C5IA 3UT1A 1QCOA 1WX6A 2E5KA 1FYNA 1E6GA 5GAN6 1ZSZC 1G8XA 5KYXB 2MK5A 2P0KA 1QVFA 1XJWB 4X34A 1IO6A 1B7TA 1K73U 4MZPA 2JJ9A 1WNLA 3JB9H 1Q82R 2B86A 2DFUA 1YHQQ 1BYMA 4A63B 4FW2A 1ZQ1A 3M5AA 2D8JA 2DETA 4HT8A 3SB2A 4LDVA 2B8AA 2EGAA 1NYFA 3NTIA 1I07A 2HKQB 2RJCA 3ZFJA 1R77A 2HDAA 1I5OB 2Z0WA 2M51A 5I22A 1I4K1 2V1RA 1WJQA 1HSQA 5CR2A 1M1GA 4OMQA 3C12A 2JNGA 2DXBA 3UDCA 3LYIA 1KIKA 2NUPB 5D7UA 4M78F 1YP5A 2L0AA 4LD6A 3M0SA 2C06A 2DBMA 1VQ6T 3M0UA 3HFNA 3QPHA 1FMKA 2DYBA 5CCAA 1OX8A 1JXMA 1BI1A 3RMSA 3CBPA 2D1XA 1N5ZA 3A5ZB 1E7OA 5LJ3h 2CDTA 1LOJA 2SRCA 2YLCA 3QZ9B 3VV0A 1GCQC 3A1PA 2RD1A 3X24B 3CCUA 1MUZA 1TU0B 3KUFA 3SDZA 4KUDK 3UF4A 5FROA 4M77E 4F14A 3JCMe 1NZ9A 3LH0A 2W0ZA 1UGQB 1X27A 2J7IA 2HEQA
chains in the Genus database with same CATH topology
2FHDA 5GANh 3JAME 4JLIA 2P4TA 3CEYA 1JB0E 3C95A 4HCCA 2RHXA 4XTYA 5LJ3g 3SD4A 1QP2A 4HKEA 5GAN8 1OYXA 4Y91A 4JS4A 3FB9A 3QHSA 1D3BB 5D6XA 2QA4A 1EIFA 3QG1A 4IUTA 5CQXA 3OYYA 3FC3A 3JCMW 3CBOA 2LVMA 1VQKA 2XD0A 4TVRA 3G6EA 1VQ9A 4PJOB 2VV5A 3OBWA 2CYZB 3CPWS 2RHZA 1S72A 2HNIA 5KE2A 4PJOC 3HRSA 2PUKB 4IUUA 4F7UA 2K3XA 2E6ZA 4M75G 4C92E 4XQ3A 4C8QB 3G71T 3E9GA 3OYAA 3H6ZA 4A4GA 3CPWA 3CCUT 1VQ4T 1Q7YC 4OB3B 3EFRA 3FDRA 2L89A 3MP8A 4C8QC 4JRIA 4PNOA 4RG8A 4J6YA 3DLLA 3CCRT 2M1HA 5CKHA 1WJRA 3MHXA 5HY6A 5GAN7 4J7IA 1BI3A 3M58A 4OP0A 4A4HA 1YBYA 2HD0A 3OYFA 3QUIA 5CVIA 3RKYA 4BE0A 1NJIC 2RA2A 1YJWT 4IUQA 1VQMA 1KD1C 4NOYA 3QO3A 5GANg 1VQ8T 5LJ3e 2K5LA 3GOXA 2RM4A 4FSXA 1RI0A 2IG0A 3CD6T 2D0QB 3CC7A 4PJOE 3NTHA 1BIBA 1QW1A 2CS7A 2LQ8A 4JJNK 2EQUA 2X4WA 4RMOA 4OB0B 2RK2A 3J81E 3L42A 1M4ZA 3X28B 2DTHA 2EIFA 2YHTA 5FU7B 4C8QE 3AHUA 3CCQA 2E10A 2RJEA 2XKOC 4QVCA 2OTLA 5FU7C 1ZHIA 4JDSA 5GAOq 1KQ1A 3VYHB 2ZPGB 2QA4T 3CCLA 4RG2A 3CCEA 3E19A 4ATOA 1VQKT 5LJ5f 4PKCC 2DD5A 3JB9D 1MHNA 4E7HA 1N9RA 2LC4A 5GMKi 5C6SA 1KC8U 1K8AU 2LDMA 2MF2A 2QQAA 3OYKA 3CMEA 4ZTJA 1M90U 2XI9A 2WSCE 1G3TA 1Q81C 1RL2A 4FU6A 1UGPB 2CGHA 3ASKA 4B9XA 5LJ5d 4LDUA 4JUVA 3GPLA 2EQMA 4XTXA 1XQHA 2LNVA 5GANe 1QVPA 5C0MA 4M75F 2RHYA 4HCZA 4MZTA 2OTJT 1N8RC 2LRQA 4QQ6A 4LDXA 5LJ5j 2Y90A 2VUBA 2HQEA 2RHIA 1OZ3A 4QQDA 2X4XA 5HK0A 4M7AA 3QJ6A 4F7UG 4GLKA 2RI5A 2F5KA 2K57A 3OS5A 2CZ1B 3GNFB 3L2RA 2EJGA 2GFAA 5IT9E 2KAFA 5EG2A 3SWNB 2FVUA 4B9WA 3BY7A 4L59A 3CC7T 4EMKB 2LT1A 4M77D 3OYCA 4M77C 3HL8A 3OYGA 4EMKC 3VU3C 5GAN4 3GF5A 4OGCA 4A4KA 5GAOm 5J3BA 1X75C 2RHUA 3LGFA 3VUZA 3BDUA 4XTVA 3CXCS 1NPRA 4WF2A 1Y7XA 1LNXA 1K8AC 4HA8A 5GAMf 4M7DB 1QVGA 2M16A 4J6WA 1Y71A 1UGRB 1DJ7B 4IUVA 2JVVA 3PMIA 4ZGDB 2LQKA 5CQYA 4BUGA 5I21A 3CXCA 1WQ7A 3LWIA 4JRPA 3S3NA 3CCET 1I81A 4M7DC 4J6XA 3HSBA 3GNGA 4LDWA 4XU3A 5GAOl 2VXFA 3G4SA 4M78B 2EQKA 2PUOB 1YCYA 4M78D 4QVZA 5I2SA 3MO8A 4M78C 3CCVT 3A8OB 3EFSA 5GAMd 2KY9A 4BDZA 3JB9G 1K9MU 2RJDA 5HK3A 3L2QA 2VXEA 1VQPA 2AHJB 2R57A 4Y28E 5CKBA 4M75B 3OW2S 4OB2B 3X20B 3VYGA 4C92A 5GAN2 1WGSA 2NLUA 5J26A 5GAMj 3P8DA 3JCMb 1G3WA 1HXDA 1WPYA 2MWPA 2RO0A 3RIRA 3JCMc 2XG8D 1VQNA 3OMCA 4RCCA 1KHIA 3FRNA 2EKOA 4C92D 1PSEA 2RI2A 3PNWC 2V8JA 2DK3A 2DIQA 3CCJA 4M7DE 2K5IA 1B34A 3OSSC 2E1HA 4KUIA 2GF7A 3WXMB 3QSUA 3QKJA 2DTIA 3DKMA 3PFSA 4OGEA 3RUXA 3LLRA 5A0LA 1WJSA 1W2BS 1X01A 2MI6A 4Q5WA 3OYNA 3J80E 4F7UF 3QDRB 2QEXT 1VQ5A 1JJ2S 2WSEE 4M78E 2K5FA 4PLLA 1KC8C 4OMFB 1W2BA 1G3YA 2FB7A 2PVGB 4M7AG 2V8KA 2XIDA 4C5EA 3OMGA 1M90C 4VUBA 2MAMA 1VQNT 2JUFA 4V2SA 1JRIA 2EJFA 3MEUA 4M75E 5IN1A 1Y07A 1Y96B 5J39A 4PJOD 3S6WA 1JBMA 1V29B 2O4XA 2OAUA 3OSVA 2QQRA 1I8FA 3S3OA 4MZMA 2EWNA 2WACA 1VQ9T 2XDBA 5DM7R 3CCMT 3GIBA 4JLGA 5GMKj 1BI0A 3LW5E 3V7SA 4D6WA 3C94A 4C8QD 3OS1A 1ZBXA 2JN0A 5LL6S 4C0DB 3ER0A 3X26B 3OYLA 3G4ST 1YITA 2XICA 4J83A 1G5VA 4HCBA 2E41A 2R5AA 1OI1A 2DVEA 4C0DC 3URGA 5GMKh 1FWZA 4GY5A 3A8MB 3RESA 1H3ZA 2E12A 2P0PA 3A8GB 2FL7A 3OQ5A 3JB9F 2E6NA 2JZ2A 2A7YA 3A8LB 3JCMf 1YHQT 5DLQE 5IAYA 3M4YA 4YTLA 1YJ9A 3JSCA 3V8LA 2RB6A 1QVFS 3CCJT 3I56A 2ZPBB 1LJOA 3OYDA 1M1KU 4F7UB 1R8OB 1UGSB 2CZ0B 1XTDA 3M59A 4C92G 4EMGA 4ZTFA 1VQ6A 1KHCA 3VUBA 2PVDB 3JCMd 5CKEA 1VQ5T 2IVWA 4BI8B 4E7KA 4FT4A 2DXCA 4DOVA 4L6V5 1N27A 1WQWA 3LWHA 2R58A 3A8HB 5DLOA 3F70A 1NPPA 5AYFA 1K9MC 3G6ET 2LTOA 3HRUA 4XTUA 4P5NA 2JTFA 3N5BB 5FRNA 1S72T 3MP1A 4M7AF 3Q1JA 5CKDA 3JCMh 3I55A 1W4SA 2PU9B 3H8ZA 5KH6A 3OYBA 1VQOA 2F69A 1Q86U 4ELZC 3JB9I 1KG1A 1NE8A 2K4YA 2ZPEB 1VQ8A 4BDYA 1YITT 2EFIA 4JS5A 1VIFA 4F7UE 1FX7A 4C8QG 1N6AA 2H3JA 3CBMA 2G3RA 1QP3A 3OYIA 3J7AF 1GXIE 2DPPB 2CKKA 1KQSS 2DD4A 4R56A 3HP9A 2VC8A 4M77A 3UPUA 1BI2A 3JB9J 1VQMT 2YRVA 2R5MA 4EMKA 5LJ5h 2E65A 3EAEA 3O8VA 3CCSA 1VQ7A 2L3RA 1KQSA 3CC4A 5FRMA 2JOYA 4N4HA 3SWNC 1YJ9T 2EAYA 3HHTB 3DB4A 4J7FA 1G3SA 3C4SA 5LJ3f 4C5GA 3I56T 3V8JA 3META 4BB7A 1X6OA 3TCJA 2MWOA 4C5HA 2XDPA 4ZGEB 5D6YA 4M7DA 4EPCA 4XU1A 4C0GA 3GP8A 2QXFA 2V8IA 3UWNA 3CCQT 5GAOp 2OTLT 2HBPA 3QIIA 3TEEA 5GMKe 4DQ2A 2ZPFB 3CCLT 4C92F 4M7DD 5LJ3d 4BE2A 4M78A 3JCMQ 3BFMA 1OZ2A 4M7AB 3PTAA 3OA6A 4BY6B 1TH7A 4A4FA 4M7AC 1U1SA 2DXUA 4MMLA 4C0FA 4E47A 4JRKA 5LJ3j 1I5LA 2XU8A 4BY6C 3L2UA 3CMET 4XU0A 1PSFA 4A4EA 3JCMJ 3I55T 1VQOT 1IREB 2LT4A 2PVOB 3M54A 3PT9A 4M75D 2XDDA 4M75C 5A0GA 3E9FA 2BUDA 3KBGA 5CK9A 2ZGWA 4N4IA 4II1A 5DY9A 5LJ5g 4N0AC 3NFCA 3OW2A 5FU6B 4IURA 2VYTA 5KE3A 4NL3A 5GANf 4X9CA 2QQ9A 5GAMh 5FU6C 2ZZDA 2KVQG 4Z02A 2DXTA 3JCMV 1KQ2A 2K2VA 1BIAA 4ZN1A 3OY9A 4C8QF 2HQXA 1YIJA 1UEBA 3CCST 1D3BA 4A54A 5HKCA 5KCOA 4M7AE 4HT9A 3CC4T 3MCAB 1Q82U 3PMTA 4MDWA 3RERA 3M53A 3T9NA 5GANd 2XK0A 4FT2A 5M9OA 4MDXA 1XNIA 4PJOA 3HPWA 1P92A 1Y96A 2GFUA 2I2LA 3OYHA 3CPFA 2QQBA 2M9UA 2EJ9A 3FLGA 3OB9A 3JCMX 4M77G 4EMHA 4E7JA 5GANj 1JJ2A 2MMPA 1Q86C 2PQWA 1O9SA 3QZ5B 2K3YA 4C8QA 3CD6A 2GQVA 2KDSA 2KSSA 3MEAA 5CO7A 3NTKA 4A53A 4ELYC 3KXTA 2ZPHB 3P8HA 5GAN5 1YHQA 2DEQA 3FIFA 5CAIA 2D6FA 2DTOA 2RJFA 1B34B 2QI2A 3G7ZA 3M9QA 4J8OA 4MMKA 4M7DG 1MGQA 5LJ5e 3FJPA 1XOVA 2A3LA 2FYKA 3FEOA 3OS0A 4O5VA 4C5IA 3RMQA 5GMKm 1VQPT 3TREA 2DZCA 5GAMg 1VIEA 4M78G 3UT1A 2LX9A 4O6JA 3TU4K 2L8DA 4PL6A 3HRTA 3VJPA 3L2WA 3OYJA 2VGMA 2M0OA 2DZ9A 4R55A 1IZ6A 3OS2A 4L5GA 2DJZA 1YJNA 1M5Q1 2O4XB 2XHCA 2F5TX 5GAN6 5GMKl 1BKBA 1SSFA 1N9SA 4DOWA 2D9TA 2O01E 2JTMA 1YIJT 2P0KA 2OTJA 4PLIA 2X4YA 3E1SA 3WVEB 1QVFA 2LCLA 4KBMB 4X34A 2RK1A 1K73U 3JCMP 3OBYA 4MZPA 3V8KA 2DAQA 2E5QA 3RKXA 2E64A 4X9DA 5A0DA 2QTXA 4QW2A 1WNLA 5CIUA 3WVDB 3JB9H 3M56A 1BYMA 1O75A 3QYHB 4CRIA 3PIPA 1ZQ1A 3M5AA 5I2MA 4FM4B 1M8VA 4HT8A 4C0ZA 1U1TA 4M77F 1FXXA 4LDVA 3RKWA 3SB2A 2L5QA 5GAMe 4ZN3A 2B8AA 2EQJA 4PJOG 5GAN3 2HAXA 1AHJB 2GCXA 3JRZA 2DKGA 3M4GA 4DA4A 2E70A 4ZGJB 2P0QA 3X25B 4BI4A 3NTIA 2RJCA 4NS5A 4N4GA 3ZFJA 4E7IA 3QXEB 3DB3A 4M7DF 1I4K1 3SWNA 1YI2A 1Q82C 3GLXA 1WJQA 3PGGA 5GAOr 2CZ7B 2RH2A 5CR2A 1M1GA 2CZ6B 3C12A 2JNGA 3CCVA 2DXBA 3LX7A 3LYIA 4RCBA 3UDCA 4XK8E 3ZEHA 2LCCA 4M78F 4KT0E 3S3MA 1YJNT 3LGLA 3BDLA 2KK4A 2DIGA 5D6WA 3R6OA 4LD6A 3MEVA 2C06A 4RKUE 1VQLA 2Y4YA 1VQ6T 4XU2A 3V7CA 3CMAA 1Q7YU 3BW1A 3HKSA 5A2QE 3CC2A 3HFNA 3QPHA 1H641 3M55A 4KULA 4BE1A 3JCMg 3QBYA 3DLMA 5CCAA 3QJYA 5KCHA 1BI1A 3OYEA 4M7AD 3RMSA 3CBPA 4M77B 2KQWA 2QEXA 5FLXE 1NJIU 4M75A 4OVAA 3V7RA 4BI3A 1KD1U 2RI3A 4QQGA 3ZBDA 2BIVA 2ZCFB 2VGNA 4N0AA 4BD3A 5CKFA 3A5ZB 3L1AA 2QQSA 1QVGS 4CI0C 3MEWA 5LJ3h 3PIOA 1LOJA 4FIBA 1M1KC 2YLCA 3SFMA 2BKDN 4XTZA 3L2VA 1VUBA 4XTWA 3QZ9B 3ME9A 4PJOF 3VV0A 3CCMA 2RD1A 4QVDA 3G71A 1VQ4A 3X24B 3CCUA 1M1FA 4IKFA 4IUPA 4NL2A 5L8RE 1YI2T 1HK9A 2Y4XA 2DO3A 1K73C 4BACA 2WSFE 3CCRA 2X4JA 3KUFA 3SDZA 4KUDK 3M57A 1UB4A 4OB1B 1VQ7T 2ZPIB 4ME7A 2KMTA 1M9SA 5FROA 3QYGB 4J5YA 4M77E 4UC4A 3INZA 4OF1A 4JRQA 3JCMe 1U8RA 4LDYA 1YJWA 3P8BB 3MP6A 3VKIA 4FL6A 4XAXB 1Q81U 1VQLT 1NZ9A 4C92B 3LH0A 3L2ZA 3CMAT 3HFOA 4C92C 1UGQB 2QDYB 2X35A 5GAOn 3OYMA 3CC2T 4LD9K 2YLBA 4EDUA 4E7LA 2EYQA 1N8RU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUB A;  1M1F A;  3VUB A;  5HK0 A;  5CKE A;  5CKH A;  3G7Z A;  5CCA A;  4HKE A;  4MZP A;  5HKC A;  5DLO A;  1UB4 A;  4ME7 A;  2KMT A;  5CR2 A;  5CQX A;  4MDX A;  5HK3 A;  5CKB A;  4OF1 A;  3HPW A;  2MF2 A;  4VUB A;  5CKF A;  5CKD A;  3TCJ A;  3JSC A;  5CK9 A;  1X75 C;  4ELZ C;  4MZM A;  5CO7 A;  1NE8 A;  2C06 A;  3NFC A;  3JRZ A;  4ELY C;  1VUB A;  4MZT A;  5CQY A; 
#chains in the Genus database with same CATH topology
 3JAM E;  2RQW A;  3C95 A;  4XTY A;  1NEG A;  1X6B A;  3VS5 A;  5D6X A;  1AWX A;  3AHU A;  3QG1 A;  4TVR A;  2LNH B;  4F17 A;  3OBW A;  3CCU Q;  1KD1 R;  1S72 A;  1MND A;  2PUK B;  4DEY A;  2K3X A;  2E6Z A;  1K8A U;  3MP8 A;  1PRM C;  4PNO A;  5CKH A;  1Z9Z A;  4J7I A;  5CVI A;  4BE0 A;  1NJI C;  1UHF A;  3EG9 A;  4IUQ A;  4NOY A;  1K9M R;  5LJ3 e;  3GOX A;  4FSX A;  3NTH A;  1VYV A;  2CS7 A;  1Q81 R;  4RMO A;  2RK2 A;  2QGG A;  2ABL A;  5FU7 B;  2RJE A;  4JZ3 A;  4QVC A;  2D0N A;  1N8R R;  1SHF A;  2QA4 T;  4RG2 A;  1S72 Q;  9ATC B;  1G83 A;  4PKC C;  3RBB B;  2FO0 A;  2RQV A;  2QQA A;  1G3T A;  4J9H A;  1RL2 A;  4B9X A;  5KYN A;  5LJ5 d;  2KT8 A;  5IH2 A;  1XQH A;  1Y57 A;  2OTJ T;  2EVR A;  5IT9 E;  3HTR A;  1M2V A;  2YUN A;  2FVU A;  2CP3 A;  1FMV A;  2ED1 A;  3BY7 A;  3OYG A;  5GAN 4;  3G1J A;  4A4K A;  1KJW A;  2HSP A;  5J3B A;  2RHU A;  1VQN A;  4WF2 A;  1Y7X A;  5GAM f;  1WXT A;  4K11 A;  4J6W A;  4ZGD B;  1QVG A;  3PMI A;  2LQK A;  4M7D C;  4IIM A;  4AG2 C;  3HSB A;  2EQK A;  2KXC A;  4QVZ A;  5ECA A;  2DIL A;  3RR6 A;  5HK3 A;  2KRO A;  4Y28 E;  4C92 A;  5GAN 2;  1RUW A;  5J26 A;  3JCM b;  1M90 R;  4PJJ A;  3OMC A;  1WHJ A;  1PSE A;  1OOT A;  2DIQ A;  4M7D E;  3QSU A;  3WXM B;  3PFS A;  2DX1 A;  4OGE A;  4LXC A;  1K0X A;  1VQN Q;  1KC8 C;  2DRK A;  3OMG A;  4V2S A;  3CPW P;  4M75 E;  1Y07 A;  1Y96 B;  3PVL A;  2OAU A;  1BK2 A;  1I8F A;  1VYT A;  2WAC A;  2XDB A;  3CCM T;  1D1B A;  5GMK j;  3C94 A;  4KH0 B;  2FPF A;  1MV3 A;  4HCB A;  2E41 A;  2R5A A;  1VOM A;  4JJC A;  3VS6 A;  3EG2 A;  1MNE A;  2E12 A;  2P0P A;  2A7Y A;  5IAY A;  4YTL A;  1TS9 A;  3JSC A;  1PM3 A;  3I56 A;  2ATC B;  2F2X A;  3M59 A;  4C92 G;  4EMG A;  2QDL A;  4M4Z A;  1VQ6 A;  1KHC A;  2K3B A;  1WYX A;  4BI8 B;  4E7K A;  4FT4 A;  2DEU A;  3CQT A;  2DXC A;  3A8H B;  5DLO A;  1WHL A;  4PK4 A;  2LTO A;  2RQR A;  2JTF A;  3EG9 B;  3N5B B;  1WZO A;  2JTE A;  4M7A F;  3Q1J A;  5CKD A;  1EX4 A;  1UUE A;  3I55 A;  1VQO A;  2F69 A;  1C6V X;  2K4Y A;  1D1C A;  1YIT T;  1IHV A;  2EFI A;  4JS5 A;  4F7U E;  3OYI A;  2CKK A;  1CSK A;  1KQS S;  2CP0 A;  4KGZ B;  3UPU A;  1ZSG A;  2LZ6 B;  3I56 Q;  4EMK A;  3EGD A;  3EAE A;  1KQS A;  3CC4 A;  1VQ6 Q;  4J7F A;  1BB9 A;  2MWO A;  1PD0 A;  2XDP A;  3CXC P;  3O5Z A;  4XU1 A;  3UWN A;  2QG9 B;  2DYI A;  4OMN A;  4PFO A;  1JXO A;  1Y0M A;  2HBP A;  3QII A;  1BCM A;  2KXD A;  4M78 A;  3JCM Q;  4J9G A;  3TSW A;  1W1F A;  4BY6 B;  1VQO Q;  4DBR A;  4E47 A;  2LQN A;  3VS2 A;  5LJ3 j;  4JRK A;  2QGF B;  4A4E A;  5GJV B;  3PT9 A;  1H3H A;  5A0G A;  2BUD A;  1PD1 A;  5CK9 A;  4N4I A;  5DY9 A;  3VRY A;  3OW2 A;  1Q86 R;  5FU6 B;  2KNB B;  1IGU A;  1PNJ A;  2ZZD A;  3CC4 Q;  1BIA A;  4QKU A;  3OY9 A;  1W2B P;  3MPU B;  1D0X A;  1H92 A;  3CCS T;  1D3B A;  4HT9 A;  4MDW A;  2RN8 A;  3RER A;  3T9N A;  3VS4 A;  4FT2 A;  5GAN d;  2JXB A;  2FRW A;  1P92 A;  2QQB A;  1EZZ B;  4R0K A;  2J6O A;  4C8Q A;  1J3T A;  1T0J A;  3QWX X;  4A53 A;  3KXT A;  5GAN 5;  3VS1 A;  2DVJ A;  2DL7 A;  2FPD A;  4D8K A;  3G7Z A;  5GAM g;  1VIE A;  4M78 G;  2LX9 A;  4PL6 A;  3HRT A;  2VKN A;  5IXF A;  1IZ6 A;  2DJZ A;  1QVF P;  1YJN A;  3EHQ A;  2FZC B;  2XHC A;  2F5T X;  1SSF A;  2A36 A;  6AT1 B;  1TWB A;  2D9T A;  2KGT A;  1YIJ T;  2OTJ A;  2X4Y A;  3WVE B;  4KBM B;  3OBY A;  1RAA B;  3VS0 A;  3V8K A;  2E5Q A;  3RKX A;  4X9D A;  1HYO A;  2QTX A;  1WDX A;  5A0D A;  5CIU A;  2NWM A;  3AT1 B;  1O75 A;  2EKH A;  3QYH B;  4CRI A;  1WHH A;  2J6F A;  2L3Q A;  1M8V A;  4C0Z A;  3H9N A;  2DNU A;  1FXX A;  2AZV A;  3RKW A;  4ZN3 A;  2HAX A;  1ZA2 B;  1AHJ B;  2GCX A;  3X25 B;  4BI4 A;  2YUO A;  1UGV A;  3DB3 A;  4M7D F;  1YI2 A;  1Q82 C;  1YJN Q;  1JU5 C;  2XMF A;  3EFO B;  5GAO r;  2GBQ A;  2RH2 A;  2P84 A;  4KT0 E;  3S3M A;  3LGL A;  2OTJ Q;  2DIG A;  4AFQ C;  4RKU E;  1VQL A;  2Y4Y A;  1FMW A;  1RAF B;  4J9B A;  3CMA A;  3BW1 A;  3HKS A;  3EH2 A;  3CC2 A;  1RLP C;  2PTK A;  4BE1 A;  2E3H A;  5FW9 A;  3OYE A;  5GJW B;  1QKX A;  2K9G A;  1X2K A;  2NUZ A;  3BE3 A;  1NJI U;  1B07 A;  3EGD B;  3V7R A;  5IHI A;  3ZBD A;  5CKF A;  3L1A A;  2QQS A;  5IHK A;  4JJB A;  3SFM A;  2BKD N;  2OX7 A;  4XTZ A;  1VUB A;  2O9V A;  3ME9 A;  3QDF A;  4PJO F;  3CCM A;  1Z9Q A;  4LN2 A;  4QVD A;  3G71 A;  1VQ4 A;  2HKN A;  1UEC A;  2JM9 A;  3VS7 A;  1UB4 A;  4OB1 B;  1VQ7 T;  4ME7 A;  1UDL A;  4HCK A;  1VQL Q;  3QYG B;  4J5Y A;  4UC4 A;  4JRQ A;  3CMA Q;  1U8R A;  4LDY A;  1YJW A;  3CC2 Q;  1G2B A;  1X6G A;  5KYU A;  2X9H A;  2A37 A;  3L2Z A;  1UJ0 A;  1WXU A;  2X35 A;  2FHD A;  2OI3 A;  1SPK A;  1Q7Y R;  1JB0 E;  1YFN A;  1AEY A;  3SD4 A;  5GAN 8;  3QHS A;  1D3B B;  4Z89 A;  2YSQ A;  3JCM W;  3CBO A;  2LVM A;  3CCM Q;  2VV5 A;  3G71 Q;  4RTZ A;  1ZSZ A;  2CYZ B;  3R6N A;  1VQ4 Q;  2J6K A;  2YUP A;  3EGX A;  1SRL A;  4IUU A;  4C8Q B;  3H6Z A;  4A4G A;  4OB3 B;  3EFR A;  3FDR A;  3NHN A;  4JRI A;  3DLL A;  3CCR T;  1ZUY A;  3MHX A;  4Y92 A;  1YJW Q;  2EBP A;  2V1Q A;  5GAN 7;  1YBY A;  2HD0 A;  3QUI A;  3RKY A;  4OML A;  4RTU A;  1TG0 A;  2P4R A;  5AT1 B;  1KD1 C;  2CSI A;  1VQ8 T;  2K5L A;  2IG0 A;  3CD6 T;  5FWC A;  1BIB A;  2EQU A;  2KT1 A;  3EGU A;  2BTT A;  1M4Z A;  2DTH A;  2YHT A;  1ZLM A;  2E10 A;  1D0Z A;  5FU7 C;  1ZHI A;  4JDS A;  2ROL A;  2EW3 A;  2LJ0 A;  1VQK T;  5LJ5 f;  2F1L A;  3JB9 D;  1MHN A;  1KC8 U;  2H8H A;  3OYK A;  4CC7 A;  2COY A;  3FJ5 A;  4ZTJ A;  2JMA A;  2XI9 A;  2WSC E;  1Q81 C;  1IHW A;  2CGH A;  4LDU A;  2EQM A;  2HBW A;  2LNV A;  2DL8 A;  5C0M A;  2CUB A;  2HSE B;  1N8R C;  2LRQ A;  5FWB A;  2Y90 A;  2LJ3 A;  2X4X A;  4M7A A;  2RI5 A;  2F5K A;  2K57 A;  3GNF B;  2EJG A;  2GFA A;  1RI9 A;  7AT1 B;  5EG2 A;  2NUT A;  2VB6 A;  4L59 A;  3CC7 T;  2COW A;  3OYC A;  4M77 C;  4PJM A;  4OGC A;  1YCS B;  2JS0 A;  3LGF A;  1NPR A;  2FZK B;  4KGV B;  2M16 A;  1UGR B;  1DJ7 B;  1Y71 A;  3RNJ A;  2JVV A;  3JB9 J;  1VQ9 A;  2KBT A;  4JRP A;  3CCE T;  1NEB A;  2O88 A;  2GTJ A;  3G4S A;  1RAG B;  4M78 D;  3J7A F;  3CCV T;  3EFS A;  2KY9 A;  2EPD A;  3L2Q A;  1RAE B;  2PZ1 A;  4OB2 B;  3X20 B;  2IIM A;  3RIR A;  3VRZ A;  2KYB A;  4AG1 C;  2XG8 D;  1KHI A;  2EKO A;  1PWT A;  2RI2 A;  2RF0 A;  3PNW C;  5KYY A;  1GBQ A;  3OSS C;  1OQK A;  2MI6 A;  4Q5W A;  1JJ2 S;  2WSE E;  4PLL A;  1D1A A;  1G3Y A;  4M7A G;  2V8K A;  1M90 C;  1VQ9 Q;  2MAM A;  2LCS A;  1JRI A;  2EJF A;  4WTO B;  3G4S Q;  2EWN A;  4RTV A;  2LQW A;  1NM7 A;  4JLG A;  3LW5 E;  4C8Q D;  1ZBX A;  2JN0 A;  1AOJ A;  4C0D B;  3ER0 A;  3X26 B;  1G5V A;  1SEM A;  4WCI A;  1H3Z A;  2E6N A;  3A8L B;  5DLQ E;  1ZSZ B;  3ULR B;  2RB6 A;  3CCJ T;  1SRM A;  2ZPB B;  1M1K U;  1NLO C;  1UGS B;  2CZ0 B;  2GNC A;  4Z8A A;  3TVT A;  3JCM d;  1VQ5 T;  2IVW A;  1H8K A;  4KRT A;  4L6V 5;  1N27 A;  1RAB B;  3LWH A;  5AYF A;  3HRU A;  4P5N A;  1M3A A;  5FRN A;  2EYX A;  1W4S A;  4ELZ C;  1M8M A;  3JB9 I;  1KG1 A;  4RTT A;  1NE8 A;  2ZPE B;  1OPL A;  1VIF A;  2JT4 A;  1N6A A;  2A28 A;  4R56 A;  3HP9 A;  2R5M A;  1VQ7 A;  2L3R A;  2COZ A;  2JOY A;  3SWN C;  1YJ9 T;  3HHT B;  4C5G A;  3C4S A;  3V8J A;  3MET A;  5D6Y A;  4M7D A;  4EPC A;  3GP8 A;  4C0G A;  2MPX C;  2V8I A;  3CCQ T;  5GAO p;  1IGQ A;  2OTL T;  1RAI B;  3CCL T;  3IQL A;  5LJ3 d;  3BFM A;  1OZ2 A;  4M7A B;  1I5L A;  1HD3 A;  4BY6 C;  3L2U A;  1PSF A;  2L3S A;  2NUT B;  3OW2 P;  1TUG B;  4J9E A;  4M75 C;  1IRX A;  2DF6 A;  4II1 A;  5LJ5 g;  4N0A C;  1M2O A;  5GAN f;  2QQ9 A;  1VQ7 Q;  5GAM h;  5FU6 C;  4Z02 A;  4PJN A;  1UEB A;  4A54 A;  1Q82 U;  3M53 A;  4PJO A;  1OEB A;  1ZBJ A;  3EH1 A;  3JCM X;  4E7J A;  1VQ8 A;  1Q86 C;  1ABO A;  3CD6 A;  3QZ5 B;  2EGC A;  3MEA A;  2W10 A;  3NTK A;  2ZPH B;  3P8H A;  2CT3 A;  3FIF A;  5CAI A;  2D6F A;  2DTO A;  2CH4 A;  2AZS A;  3M9Q A;  4M7D G;  2I0N A;  3FJP A;  1XOV A;  1GFD A;  1C1A A;  3OS0 A;  4O5V A;  3RMQ A;  2K79 A;  3TRE A;  3TU4 K;  4O6J A;  3L2W A;  2AT1 B;  3UA6 A;  3OS2 A;  2MCN A;  3NPF A;  1BKB A;  4DOW A;  2EYZ A;  2JTM A;  1UFF A;  2ROT A;  3E1S A;  8ATC B;  3UA7 A;  1VQ8 Q;  2KEA A;  3CD6 Q;  1U06 A;  4QW2 A;  1LPL A;  3WVD B;  3PE0 A;  2JW4 A;  3PIP A;  5I2M A;  4JZ4 A;  4D8D A;  4FM4 B;  4M77 F;  1YHQ T;  1UE9 A;  2L5Q A;  5GAM e;  5GAN 3;  1WHK A;  4PJO G;  2GTO A;  3JRZ A;  4DBF A;  3M4G A;  4HVU A;  1AWW A;  4ZGJ B;  2P0Q A;  1MMN A;  2BE9 B;  1MMA A;  3PGG A;  2CZ6 B;  3CCV A;  2J06 A;  3LX7 A;  3TSZ A;  3ZEH A;  2LCC A;  4J9I A;  2F2W A;  1TUC A;  2KK4 A;  2X3W D;  5D6W A;  3R6O A;  2DJQ A;  2X3X D;  4XU2 A;  3A98 A;  2YXY A;  1OU8 A;  4J9F A;  4KUL A;  3DLM A;  5KCH A;  2RNA A;  4F04 B;  1K73 R;  4M7A D;  2KQW A;  2M0Y A;  2C0O A;  5FLX E;  4OVA A;  1M2V B;  1KD1 U;  2J05 A;  2RI3 A;  4QQG A;  2ZCF B;  4BD3 A;  2CP7 A;  4CI0 C;  3MEW A;  2BE7 D;  2EGE A;  2DA9 A;  4FYW B;  1RAC B;  4FIB A;  1M1K C;  4XTW A;  2OAW A;  3CCV Q;  4IKF A;  4IUP A;  4NL2 A;  5L8R E;  2DO3 A;  4CC2 A;  2WSF E;  4BAC A;  2A0F B;  3M57 A;  2KMT A;  1M9S A;  4DBQ A;  3INZ A;  4OF1 A;  1ZUU A;  1Q81 U;  1YWO A;  4C92 B;  2QDY B;  4GLM A;  4LD9 K;  2YLB A;  4EDU A;  2EYQ A;  1SSH A;  1N8R U;  1V1C A;  4X1V A;  4JLI A;  4HCC A;  4KH1 B;  1F1B B;  4HKE A;  4AFU C;  2QAS A;  1OPK A;  1PKT A;  2QA4 A;  1SF9 A;  5CQX A;  4IUT A;  3FC3 A;  2XD0 A;  1VYU A;  2PNI A;  4PJO B;  3CPW S;  2HNI A;  2HL5 C;  3HRS A;  1RLQ C;  5KYX A;  2L3P A;  4XQ3 A;  4AT1 B;  4E7S A;  3CCU T;  3CPW A;  1K4U S;  1Q7Y C;  2L89 A;  4C8Q C;  4J6Y A;  2AK5 A;  1OX9 A;  2M1H A;  5HY6 A;  2VAS A;  1BI3 A;  3M58 A;  4OP0 A;  1M3B A;  1ACM B;  1HJD A;  3KFV A;  3QO3 A;  4FYY B;  2OJ2 A;  5GAN g;  1SG5 A;  1RI0 A;  1UTI A;  5I11 A;  1QW1 A;  4JJN K;  4OB0 B;  4Z88 A;  3J81 E;  2QA4 Q;  4C8Q E;  2EIF A;  3CCQ A;  2XKO C;  2OTL A;  1SKU B;  5GAO q;  1KQ1 A;  3VYH B;  3CCL A;  4ATO A;  4FYV B;  1AVZ C;  3D7S B;  1YNZ A;  1N9R A;  2LC4 A;  2NUP A;  5C6S A;  3JV3 A;  4E2F B;  1M90 U;  1BBZ A;  1UGP B;  3GPL A;  4JUV A;  2MYS A;  1QWE A;  4XTX A;  4M75 F;  4MZT A;  2CUD A;  1K8A R;  2VUB A;  1OZ3 A;  4QQD A;  3NGP A;  2KR3 A;  3QJ6 A;  3OS5 A;  1A0N B;  3EG1 A;  2NYS A;  4EMK B;  2LT1 A;  3CCQ Q;  3EG3 A;  3HL8 A;  4IIO A;  3VU3 C;  2OTL Q;  3GF5 A;  1W6X A;  3CCL Q;  2MOX A;  3CXC S;  1X75 C;  3BDU A;  4XTV A;  4LUD A;  1AWO A;  4HA8 A;  2CH4 W;  4IUV A;  5I21 A;  5CQY A;  3CXC A;  1WQ7 A;  2RQT A;  3LWI A;  1TOV A;  1I81 A;  4J6X A;  3GNG A;  4LDW A;  4XU3 A;  4M78 B;  1NYG A;  5I2S A;  4BDZ A;  3A8O B;  1WI7 A;  2LX7 A;  2RJD A;  2QAZ A;  2VXE A;  5CKB A;  1K1Z A;  1SHG A;  2QYZ A;  5GAM j;  3P8D A;  1HXD A;  1WPY A;  1K9A A;  4RCC A;  2D8H A;  1GRI A;  4C92 D;  2DK3 A;  3MJX A;  4KUI A;  2E1H A;  3QKJ A;  1W2B S;  3LLR A;  5A0L A;  1WJS A;  1X01 A;  4ESR A;  3J80 E;  4F7U F;  3QDR B;  2QEX T;  1WA7 A;  2K5F A;  1X69 A;  1W2B A;  2FB7 A;  2PVG B;  5IXB A;  2DMO A;  2XID A;  4VUB A;  1VQN T;  5IN1 A;  3MEU A;  4PJO D;  2O4X A;  2QQR A;  2O31 A;  3GIB A;  2VVK A;  1S1N A;  3V7S A;  2BZY A;  1ABQ A;  4D6W A;  3OS1 A;  4CC4 B;  3OYL A;  1YIT A;  1V76 A;  4J83 A;  4C0D C;  5GMK h;  1FWZ A;  1MMD A;  4GY5 A;  3A8M B;  4PFP A;  3RES A;  2HZY A;  1QMC A;  3JB9 F;  2FL7 A;  2JZ2 A;  1Q95 G;  3I9Q A;  3JCM f;  2C0T A;  1KSW A;  2DLP A;  1U3O A;  3V8L A;  1QVF S;  1KFZ A;  3OYD A;  1QWF A;  1XTD A;  4ZTF A;  4FSS A;  3VUB A;  2KRM A;  3NMZ C;  2R58 A;  2F2V A;  1NPP A;  1T3L A;  1NG2 A;  1K9M C;  3G6E T;  4XTU A;  1YIT Q;  3JCM h;  2PU9 B;  1Q86 U;  4BDY A;  1FX7 A;  1I0C A;  2FEI A;  2H3J A;  3CBM A;  2DPP B;  2BZ8 A;  1WFW A;  4M77 A;  1VQM T;  1X2Q A;  5LJ5 h;  1PKS A;  2E65 A;  1ZUK A;  3O8V A;  3CCS A;  4FW1 A;  3I5R A;  2EAY A;  5LJ3 f;  1G3S A;  3I56 T;  1QVG P;  1X6O A;  3TCJ A;  4HXJ A;  4C5H A;  1GCQ A;  1WHM A;  2O9S A;  2A08 A;  1QKW A;  3TEE A;  5GMK e;  4F16 A;  3PTA A;  3OA6 A;  2ZAE A;  4M7A C;  2DXU A;  4MML A;  2XU8 A;  3CME T;  3JCM J;  3I55 T;  1VQO T;  1IRE B;  3M54 A;  3E9F A;  3KBG A;  3C0C A;  1CKA A;  2ZGW A;  2VYT A;  2YWW A;  5KE3 A;  4NL3 A;  1ZA1 B;  3ZL7 C;  4X9C A;  3CCS Q;  2DXT A;  3JCM V;  1EFN A;  2K2V A;  4C8Q F;  2HQX A;  1YIJ A;  2DL4 A;  2DL3 A;  5HKC A;  4M7A E;  3CC4 T;  3MCA B;  3PMT A;  2XK0 A;  1PC0 A;  2E4H A;  1Y96 A;  3CPF A;  3OB9 A;  3FLG A;  2EJ9 A;  1JJ2 A;  4M77 G;  1O9S A;  2K3Y A;  3THK A;  2GQV A;  2KDS A;  2KSS A;  4LUE A;  5KYU B;  4KGX B;  1RAD B;  2K6D A;  2YT6 A;  4E7Z A;  1MGQ A;  1D0Y A;  5LJ5 e;  2A3L A;  3EG0 A;  2KE9 A;  1VQP T;  4LE9 A;  2HQH A;  5GMK m;  2DZC A;  2L8D A;  3VJP A;  3OYJ A;  2EYY A;  3H0F A;  2VGM A;  2C0I A;  2DZ9 A;  2M0O A;  4R55 A;  4L5G A;  1ZX6 A;  1YIJ Q;  1UG1 A;  1M5Q 1;  2O4X B;  5GMK l;  1AZG B;  3EGX B;  4HVW A;  2JMC A;  1N9S A;  3QWY A;  2O01 E;  2M02 A;  2CRE A;  4PLI A;  2LCL A;  2RK1 A;  3JCM P;  2DAQ A;  2E64 A;  3REB B;  2LJ1 A;  3M56 A;  1MV0 B;  1U1T A;  2EQJ A;  2DKG A;  4DA4 A;  2E70 A;  3U23 A;  3H0H A;  1GBR A;  4NS5 A;  1C0M A;  4N4G A;  1UHC A;  4E7I A;  1KQS P;  2FG0 A;  2DM1 A;  4ORZ A;  2GQI A;  3SWN A;  3GLX A;  2CZ7 B;  2G6F X;  4RCB A;  4XK8 E;  1YJN T;  1GL5 A;  3BDL A;  3GBQ A;  3MEV A;  3V7C A;  1Q7Y U;  2HCK A;  5A2Q E;  1H64 1;  3M55 A;  3JCM g;  3QBY A;  3QJY A;  4FYX B;  4M77 B;  2QEX A;  2LP5 A;  4M75 A;  4BI3 A;  2LMJ A;  2BIV A;  1QVG S;  2VGN A;  4N0A A;  2QTV A;  5KYW A;  2HL3 A;  3PIO A;  1R0B G;  1M3C A;  1UJY A;  3L2V A;  4RUG A;  1PRL C;  1B3Q A;  4JPB W;  1M1F A;  1YI2 T;  1HK9 A;  2Y4X A;  1K73 C;  3CCR A;  2X4J A;  2ESW A;  4CC3 A;  4EIK A;  2ZPI B;  2V26 A;  5L23 A;  4J9C A;  4ANJ A;  3P8B B;  3MP6 A;  4RTX A;  3VKI A;  4FL6 A;  4XAX B;  1VQL T;  3CMA T;  3HFO A;  4C92 C;  5GAO n;  3CC2 T;  3OYM A;  4E7L A;  4OMP A;  3QXE B;  1KK7 A;  2QEX Q;  4GBQ A;  2CP6 A;  5GAN h;  2P4T A;  3CEY A;  5KYY B;  2RHX A;  5LJ3 g;  1QP2 A;  1OYX A;  4Y91 A;  4JS4 A;  3FB9 A;  2SEM A;  1WIE A;  1EIF A;  1VQK A;  3OYY A;  3G6E A;  1NJI R;  3E2U A;  2RHZ A;  2ECZ A;  5KE2 A;  4PJO C;  3M0Q A;  3CCR Q;  4F7U A;  3I5S A;  4M75 G;  1OV3 A;  4C92 E;  3G71 T;  3E9G A;  3OYA A;  1VQ4 T;  3LH5 A;  4RG8 A;  2KYM A;  2HMA A;  1WJR A;  2AIR B;  4RTY A;  2CT4 A;  4A4H A;  3OYF A;  2RA2 A;  1YJW T;  1VQM A;  1TXQ A;  2DE0 X;  4OMO A;  4HVV A;  2RM4 A;  1MMG A;  2D0Q B;  3CC7 A;  2H3E B;  4PJO E;  2YUQ A;  2LQ8 A;  2X51 A;  3M0T A;  2X4W A;  4RTW A;  3L42 A;  3X28 B;  1AWJ A;  1VQK Q;  1OUL A;  3G6E Q;  4J9D A;  4OMM A;  2ZPG B;  3CCE A;  3E19 A;  3EFO A;  4AFZ C;  2ENM A;  2DD5 A;  4E7H A;  1JQQ A;  2JM8 A;  5GMK i;  2LDM A;  2MF2 A;  1AT1 B;  3CME A;  2KI7 A;  5IHN A;  4FU6 A;  3ASK A;  2RPN A;  1ARK A;  1AZE A;  5GAN e;  1QVP A;  2BZX A;  2RHY A;  4HCZ A;  4E6R A;  2MIO A;  4QQ6 A;  4LDX A;  1VQM Q;  4LNP A;  1QQJ A;  5LJ5 j;  1PG5 B;  1YWP A;  2HQE A;  2RHI A;  5HK0 A;  2YRD A;  2RMO A;  4F7U G;  4GLK A;  3L2R A;  3CC7 Q;  2CZ1 B;  1YN8 A;  2KAF A;  3SWN B;  2JS2 A;  2IPO B;  4B9W A;  4M77 D;  3EHR A;  4EMK C;  5EC7 A;  1WHG A;  1PHT A;  5GAO m;  3VUZ A;  3CCE Q;  1TUD A;  3TQ7 P;  1K0S A;  8AT1 B;  1LNX A;  1K8A C;  4M7D B;  2CSQ A;  2EYW A;  1E6H A;  4BUG A;  3S3N A;  3CME Q;  3I55 Q;  5GAO l;  2VXF A;  1T0H A;  4ZNX A;  2PUO B;  1YCY A;  1IB8 A;  3MO8 A;  4M78 C;  5GAM d;  3JB9 G;  1QLY A;  3SEM A;  1K9M U;  1VQP A;  2AHJ B;  2R57 A;  1GFC A;  4QT7 A;  4M75 B;  2CP2 A;  3OW2 S;  1KC8 R;  1JEG A;  3VYG A;  4FCY A;  1WGS A;  2NLU A;  1G3W A;  2MWP A;  2RO0 A;  3JCM c;  1CKB A;  5KYW B;  3FRN A;  1D09 B;  3SHW A;  1OU9 A;  2V8J A;  3CCJ A;  2L2P A;  2K5I A;  1B34 A;  2KRN A;  2GF7 A;  1IXD A;  1GCP A;  2DTI A;  3DKM A;  3RUX A;  2FPE A;  3OYN A;  1BU1 A;  1VQ5 A;  4M78 E;  4OMF B;  3PVQ A;  1RAH B;  4C5E A;  2JUF A;  5J39 A;  3S6W A;  1JBM A;  1LVK A;  1V29 B;  3OSV A;  2DL5 A;  3RDV A;  3S3O A;  4MZM A;  1VQ9 T;  5DM7 R;  1BI0 A;  5LL6 S;  3G4S T;  1VQP Q;  2CP5 A;  2XIC A;  1OI1 A;  2DVE A;  3URG A;  2GGR A;  2YRC A;  3A8G B;  3OQ5 A;  3CCJ Q;  4DEX A;  3M4Y A;  5HCK A;  1YJ9 A;  1NLP C;  1LJO A;  1VQ5 Q;  4F7U B;  1R8O B;  1QCF A;  2QK0 A;  1X43 A;  1VA7 A;  2PVD B;  5CKE A;  4DOV A;  1WQW A;  3H41 A;  1M27 C;  3F70 A;  2O2O A;  1TTH B;  1U5S A;  1WLP B;  1S72 T;  3MP1 A;  1AD5 A;  3H8Z A;  5KH6 A;  3OYB A;  2EQI A;  1JO8 A;  3M0P A;  1I1J A;  4AFS C;  4C8Q G;  1GXI E;  2G3R A;  1QP3 A;  2DD4 A;  1YJ9 Q;  2VC8 A;  1TSF A;  1BI2 A;  1R0C B;  4PJL A;  2DER A;  2YRV A;  2E3I A;  5FRM A;  4N4H A;  2VWF A;  1QCN A;  3DB4 A;  2YDL A;  4BB7 A;  4ZGE B;  3UAT A;  2QXF A;  1M1K R;  4DQ2 A;  1BCO A;  2ZPF B;  4C92 F;  4M7D D;  4BE2 A;  3VS3 A;  1TH7 A;  3M0R A;  4A4F A;  1U1S A;  2DRM A;  4C0F A;  4JJD A;  4XU0 A;  1NBE B;  2LT4 A;  2PVO B;  4M75 D;  2XDD A;  2AKK A;  1WXB A;  3H0I A;  1YI2 Q;  4AMC A;  1LCK A;  3NFC A;  4IUR A;  2AKL A;  1M30 A;  2KVQ G;  1KQ2 A;  2K2M A;  4ZN1 A;  3REA B;  4DBH A;  4PFZ A;  1K76 A;  5KCO A;  1JJ2 P;  5M9O A;  4MDX A;  3I35 A;  2FZG B;  1XNI A;  3HPW A;  2GFU A;  2I2L A;  3OYH A;  2M9U A;  2RQU A;  4EMH A;  5GAN j;  2MMP A;  4B6M A;  2PQW A;  5CO7 A;  4ELY C;  1YHQ A;  3MKD A;  2DEQ A;  2FRY A;  1T3S A;  2RJF A;  1B34 B;  2QI2 A;  4J8O A;  1W70 A;  4MMK A;  2DBK A;  2KRS A;  1PCX A;  2ED0 A;  2FYK A;  2K7A A;  3FEO A;  4C5I A;  3UT1 A;  1QCO A;  1WX6 A;  2E5K A;  1FYN A;  1E6G A;  5GAN 6;  1ZSZ C;  1G8X A;  5KYX B;  2MK5 A;  2P0K A;  1QVF A;  1XJW B;  4X34 A;  1IO6 A;  1B7T A;  1K73 U;  4MZP A;  2JJ9 A;  1WNL A;  3JB9 H;  1Q82 R;  2B86 A;  2DFU A;  1YHQ Q;  1BYM A;  4A63 B;  4FW2 A;  1ZQ1 A;  3M5A A;  2D8J A;  2DET A;  4HT8 A;  3SB2 A;  4LDV A;  2B8A A;  2EGA A;  1NYF A;  3NTI A;  1I07 A;  2HKQ B;  2RJC A;  3ZFJ A;  1R77 A;  2HDA A;  1I5O B;  2Z0W A;  2M51 A;  5I22 A;  1I4K 1;  2V1R A;  1WJQ A;  1HSQ A;  5CR2 A;  1M1G A;  4OMQ A;  3C12 A;  2JNG A;  2DXB A;  3UDC A;  3LYI A;  1KIK A;  2NUP B;  5D7U A;  4M78 F;  1YP5 A;  2L0A A;  4LD6 A;  3M0S A;  2C06 A;  2DBM A;  1VQ6 T;  3M0U A;  3HFN A;  3QPH A;  1FMK A;  2DYB A;  5CCA A;  1OX8 A;  1JXM A;  1BI1 A;  3RMS A;  3CBP A;  2D1X A;  1N5Z A;  3A5Z B;  1E7O A;  5LJ3 h;  2CDT A;  1LOJ A;  2SRC A;  2YLC A;  3QZ9 B;  3VV0 A;  1GCQ C;  3A1P A;  2RD1 A;  3X24 B;  3CCU A;  1MUZ A;  1TU0 B;  3KUF A;  3SDZ A;  4KUD K;  3UF4 A;  5FRO A;  4M77 E;  4F14 A;  3JCM e;  1NZ9 A;  3LH0 A;  2W0Z A;  1UGQ B;  1X27 A;  2J7I A;  2HEQ A; 
#chains in the Genus database with same CATH homology
 2FHD A;  5GAN h;  3JAM E;  4JLI A;  2P4T A;  3CEY A;  1JB0 E;  3C95 A;  4HCC A;  2RHX A;  4XTY A;  5LJ3 g;  3SD4 A;  1QP2 A;  4HKE A;  5GAN 8;  1OYX A;  4Y91 A;  4JS4 A;  3FB9 A;  3QHS A;  1D3B B;  5D6X A;  2QA4 A;  1EIF A;  3QG1 A;  4IUT A;  5CQX A;  3OYY A;  3FC3 A;  3JCM W;  3CBO A;  2LVM A;  1VQK A;  2XD0 A;  4TVR A;  3G6E A;  1VQ9 A;  4PJO B;  2VV5 A;  3OBW A;  2CYZ B;  3CPW S;  2RHZ A;  1S72 A;  2HNI A;  5KE2 A;  4PJO C;  3HRS A;  2PUK B;  4IUU A;  4F7U A;  2K3X A;  2E6Z A;  4M75 G;  4C92 E;  4XQ3 A;  4C8Q B;  3G71 T;  3E9G A;  3OYA A;  3H6Z A;  4A4G A;  3CPW A;  3CCU T;  1VQ4 T;  1Q7Y C;  4OB3 B;  3EFR A;  3FDR A;  2L89 A;  3MP8 A;  4C8Q C;  4JRI A;  4PNO A;  4RG8 A;  4J6Y A;  3DLL A;  3CCR T;  2M1H A;  5CKH A;  1WJR A;  3MHX A;  5HY6 A;  5GAN 7;  4J7I A;  1BI3 A;  3M58 A;  4OP0 A;  4A4H A;  1YBY A;  2HD0 A;  3OYF A;  3QUI A;  5CVI A;  3RKY A;  4BE0 A;  1NJI C;  2RA2 A;  1YJW T;  4IUQ A;  1VQM A;  1KD1 C;  4NOY A;  3QO3 A;  5GAN g;  1VQ8 T;  5LJ3 e;  2K5L A;  3GOX A;  2RM4 A;  4FSX A;  1RI0 A;  2IG0 A;  3CD6 T;  2D0Q B;  3CC7 A;  4PJO E;  3NTH A;  1BIB A;  1QW1 A;  2CS7 A;  2LQ8 A;  4JJN K;  2EQU A;  2X4W A;  4RMO A;  4OB0 B;  2RK2 A;  3J81 E;  3L42 A;  1M4Z A;  3X28 B;  2DTH A;  2EIF A;  2YHT A;  5FU7 B;  4C8Q E;  3AHU A;  3CCQ A;  2E10 A;  2RJE A;  2XKO C;  4QVC A;  2OTL A;  5FU7 C;  1ZHI A;  4JDS A;  5GAO q;  1KQ1 A;  3VYH B;  2ZPG B;  2QA4 T;  3CCL A;  4RG2 A;  3CCE A;  3E19 A;  4ATO A;  1VQK T;  5LJ5 f;  4PKC C;  2DD5 A;  3JB9 D;  1MHN A;  4E7H A;  1N9R A;  2LC4 A;  5GMK i;  5C6S A;  1KC8 U;  1K8A U;  2LDM A;  2MF2 A;  2QQA A;  3OYK A;  3CME A;  4ZTJ A;  1M90 U;  2XI9 A;  2WSC E;  1G3T A;  1Q81 C;  1RL2 A;  4FU6 A;  1UGP B;  2CGH A;  3ASK A;  4B9X A;  5LJ5 d;  4LDU A;  4JUV A;  3GPL A;  2EQM A;  4XTX A;  1XQH A;  2LNV A;  5GAN e;  1QVP A;  5C0M A;  4M75 F;  2RHY A;  4HCZ A;  4MZT A;  2OTJ T;  1N8R C;  2LRQ A;  4QQ6 A;  4LDX A;  5LJ5 j;  2Y90 A;  2VUB A;  2HQE A;  2RHI A;  1OZ3 A;  4QQD A;  2X4X A;  5HK0 A;  4M7A A;  3QJ6 A;  4F7U G;  4GLK A;  2RI5 A;  2F5K A;  2K57 A;  3OS5 A;  2CZ1 B;  3GNF B;  3L2R A;  2EJG A;  2GFA A;  5IT9 E;  2KAF A;  5EG2 A;  3SWN B;  2FVU A;  4B9W A;  3BY7 A;  4L59 A;  3CC7 T;  4EMK B;  2LT1 A;  4M77 D;  3OYC A;  4M77 C;  3HL8 A;  3OYG A;  4EMK C;  3VU3 C;  5GAN 4;  3GF5 A;  4OGC A;  4A4K A;  5GAO m;  5J3B A;  1X75 C;  2RHU A;  3LGF A;  3VUZ A;  3BDU A;  4XTV A;  3CXC S;  1NPR A;  4WF2 A;  1Y7X A;  1LNX A;  1K8A C;  4HA8 A;  5GAM f;  4M7D B;  1QVG A;  2M16 A;  4J6W A;  1Y71 A;  1UGR B;  1DJ7 B;  4IUV A;  2JVV A;  3PMI A;  4ZGD B;  2LQK A;  5CQY A;  4BUG A;  5I21 A;  3CXC A;  1WQ7 A;  3LWI A;  4JRP A;  3S3N A;  3CCE T;  1I81 A;  4M7D C;  4J6X A;  3HSB A;  3GNG A;  4LDW A;  4XU3 A;  5GAO l;  2VXF A;  3G4S A;  4M78 B;  2EQK A;  2PUO B;  1YCY A;  4M78 D;  4QVZ A;  5I2S A;  3MO8 A;  4M78 C;  3CCV T;  3A8O B;  3EFS A;  5GAM d;  2KY9 A;  4BDZ A;  3JB9 G;  1K9M U;  2RJD A;  5HK3 A;  3L2Q A;  2VXE A;  1VQP A;  2AHJ B;  2R57 A;  4Y28 E;  5CKB A;  4M75 B;  3OW2 S;  4OB2 B;  3X20 B;  3VYG A;  4C92 A;  5GAN 2;  1WGS A;  2NLU A;  5J26 A;  5GAM j;  3P8D A;  3JCM b;  1G3W A;  1HXD A;  1WPY A;  2MWP A;  2RO0 A;  3RIR A;  3JCM c;  2XG8 D;  1VQN A;  3OMC A;  4RCC A;  1KHI A;  3FRN A;  2EKO A;  4C92 D;  1PSE A;  2RI2 A;  3PNW C;  2V8J A;  2DK3 A;  2DIQ A;  3CCJ A;  4M7D E;  2K5I A;  1B34 A;  3OSS C;  2E1H A;  4KUI A;  2GF7 A;  3WXM B;  3QSU A;  3QKJ A;  2DTI A;  3DKM A;  3PFS A;  4OGE A;  3RUX A;  3LLR A;  5A0L A;  1WJS A;  1W2B S;  1X01 A;  2MI6 A;  4Q5W A;  3OYN A;  3J80 E;  4F7U F;  3QDR B;  2QEX T;  1VQ5 A;  1JJ2 S;  2WSE E;  4M78 E;  2K5F A;  4PLL A;  1KC8 C;  4OMF B;  1W2B A;  1G3Y A;  2FB7 A;  2PVG B;  4M7A G;  2V8K A;  2XID A;  4C5E A;  3OMG A;  1M90 C;  4VUB A;  2MAM A;  1VQN T;  2JUF A;  4V2S A;  1JRI A;  2EJF A;  3MEU A;  4M75 E;  5IN1 A;  1Y07 A;  1Y96 B;  5J39 A;  4PJO D;  3S6W A;  1JBM A;  1V29 B;  2O4X A;  2OAU A;  3OSV A;  2QQR A;  1I8F A;  3S3O A;  4MZM A;  2EWN A;  2WAC A;  1VQ9 T;  2XDB A;  5DM7 R;  3CCM T;  3GIB A;  4JLG A;  5GMK j;  1BI0 A;  3LW5 E;  3V7S A;  4D6W A;  3C94 A;  4C8Q D;  3OS1 A;  1ZBX A;  2JN0 A;  5LL6 S;  4C0D B;  3ER0 A;  3X26 B;  3OYL A;  3G4S T;  1YIT A;  2XIC A;  4J83 A;  1G5V A;  4HCB A;  2E41 A;  2R5A A;  1OI1 A;  2DVE A;  4C0D C;  3URG A;  5GMK h;  1FWZ A;  4GY5 A;  3A8M B;  3RES A;  1H3Z A;  2E12 A;  2P0P A;  3A8G B;  2FL7 A;  3OQ5 A;  3JB9 F;  2E6N A;  2JZ2 A;  2A7Y A;  3A8L B;  3JCM f;  1YHQ T;  5DLQ E;  5IAY A;  3M4Y A;  4YTL A;  1YJ9 A;  3JSC A;  3V8L A;  2RB6 A;  1QVF S;  3CCJ T;  3I56 A;  2ZPB B;  1LJO A;  3OYD A;  1M1K U;  4F7U B;  1R8O B;  1UGS B;  2CZ0 B;  1XTD A;  3M59 A;  4C92 G;  4EMG A;  4ZTF A;  1VQ6 A;  1KHC A;  3VUB A;  2PVD B;  3JCM d;  5CKE A;  1VQ5 T;  2IVW A;  4BI8 B;  4E7K A;  4FT4 A;  2DXC A;  4DOV A;  4L6V 5;  1N27 A;  1WQW A;  3LWH A;  2R58 A;  3A8H B;  5DLO A;  3F70 A;  1NPP A;  5AYF A;  1K9M C;  3G6E T;  2LTO A;  3HRU A;  4XTU A;  4P5N A;  2JTF A;  3N5B B;  5FRN A;  1S72 T;  3MP1 A;  4M7A F;  3Q1J A;  5CKD A;  3JCM h;  3I55 A;  1W4S A;  2PU9 B;  3H8Z A;  5KH6 A;  3OYB A;  1VQO A;  2F69 A;  1Q86 U;  4ELZ C;  3JB9 I;  1KG1 A;  1NE8 A;  2K4Y A;  2ZPE B;  1VQ8 A;  4BDY A;  1YIT T;  2EFI A;  4JS5 A;  1VIF A;  4F7U E;  1FX7 A;  4C8Q G;  1N6A A;  2H3J A;  3CBM A;  2G3R A;  1QP3 A;  3OYI A;  3J7A F;  1GXI E;  2DPP B;  2CKK A;  1KQS S;  2DD4 A;  4R56 A;  3HP9 A;  2VC8 A;  4M77 A;  3UPU A;  1BI2 A;  3JB9 J;  1VQM T;  2YRV A;  2R5M A;  4EMK A;  5LJ5 h;  2E65 A;  3EAE A;  3O8V A;  3CCS A;  1VQ7 A;  2L3R A;  1KQS A;  3CC4 A;  5FRM A;  2JOY A;  4N4H A;  3SWN C;  1YJ9 T;  2EAY A;  3HHT B;  3DB4 A;  4J7F A;  1G3S A;  3C4S A;  5LJ3 f;  4C5G A;  3I56 T;  3V8J A;  3MET A;  4BB7 A;  1X6O A;  3TCJ A;  2MWO A;  4C5H A;  2XDP A;  4ZGE B;  5D6Y A;  4M7D A;  4EPC A;  4XU1 A;  4C0G A;  3GP8 A;  2QXF A;  2V8I A;  3UWN A;  3CCQ T;  5GAO p;  2OTL T;  2HBP A;  3QII A;  3TEE A;  5GMK e;  4DQ2 A;  2ZPF B;  3CCL T;  4C92 F;  4M7D D;  5LJ3 d;  4BE2 A;  4M78 A;  3JCM Q;  3BFM A;  1OZ2 A;  4M7A B;  3PTA A;  3OA6 A;  4BY6 B;  1TH7 A;  4A4F A;  4M7A C;  1U1S A;  2DXU A;  4MML A;  4C0F A;  4E47 A;  4JRK A;  5LJ3 j;  1I5L A;  2XU8 A;  4BY6 C;  3L2U A;  3CME T;  4XU0 A;  1PSF A;  4A4E A;  3JCM J;  3I55 T;  1VQO T;  1IRE B;  2LT4 A;  2PVO B;  3M54 A;  3PT9 A;  4M75 D;  2XDD A;  4M75 C;  5A0G A;  3E9F A;  2BUD A;  3KBG A;  5CK9 A;  2ZGW A;  4N4I A;  4II1 A;  5DY9 A;  5LJ5 g;  4N0A C;  3NFC A;  3OW2 A;  5FU6 B;  4IUR A;  2VYT A;  5KE3 A;  4NL3 A;  5GAN f;  4X9C A;  2QQ9 A;  5GAM h;  5FU6 C;  2ZZD A;  2KVQ G;  4Z02 A;  2DXT A;  3JCM V;  1KQ2 A;  2K2V A;  1BIA A;  4ZN1 A;  3OY9 A;  4C8Q F;  2HQX A;  1YIJ A;  1UEB A;  3CCS T;  1D3B A;  4A54 A;  5HKC A;  5KCO A;  4M7A E;  4HT9 A;  3CC4 T;  3MCA B;  1Q82 U;  3PMT A;  4MDW A;  3RER A;  3M53 A;  3T9N A;  5GAN d;  2XK0 A;  4FT2 A;  5M9O A;  4MDX A;  1XNI A;  4PJO A;  3HPW A;  1P92 A;  1Y96 A;  2GFU A;  2I2L A;  3OYH A;  3CPF A;  2QQB A;  2M9U A;  2EJ9 A;  3FLG A;  3OB9 A;  3JCM X;  4M77 G;  4EMH A;  4E7J A;  5GAN j;  1JJ2 A;  2MMP A;  1Q86 C;  2PQW A;  1O9S A;  3QZ5 B;  2K3Y A;  4C8Q A;  3CD6 A;  2GQV A;  2KDS A;  2KSS A;  3MEA A;  5CO7 A;  3NTK A;  4A53 A;  4ELY C;  3KXT A;  2ZPH B;  3P8H A;  5GAN 5;  1YHQ A;  2DEQ A;  3FIF A;  5CAI A;  2D6F A;  2DTO A;  2RJF A;  1B34 B;  2QI2 A;  3G7Z A;  3M9Q A;  4J8O A;  4MMK A;  4M7D G;  1MGQ A;  5LJ5 e;  3FJP A;  1XOV A;  2A3L A;  2FYK A;  3FEO A;  3OS0 A;  4O5V A;  4C5I A;  3RMQ A;  5GMK m;  1VQP T;  3TRE A;  2DZC A;  5GAM g;  1VIE A;  4M78 G;  3UT1 A;  2LX9 A;  4O6J A;  3TU4 K;  2L8D A;  4PL6 A;  3HRT A;  3VJP A;  3L2W A;  3OYJ A;  2VGM A;  2M0O A;  2DZ9 A;  4R55 A;  1IZ6 A;  3OS2 A;  4L5G A;  2DJZ A;  1YJN A;  1M5Q 1;  2O4X B;  2XHC A;  2F5T X;  5GAN 6;  5GMK l;  1BKB A;  1SSF A;  1N9S A;  4DOW A;  2D9T A;  2O01 E;  2JTM A;  1YIJ T;  2P0K A;  2OTJ A;  4PLI A;  2X4Y A;  3E1S A;  3WVE B;  1QVF A;  2LCL A;  4KBM B;  4X34 A;  2RK1 A;  1K73 U;  3JCM P;  3OBY A;  4MZP A;  3V8K A;  2DAQ A;  2E5Q A;  3RKX A;  2E64 A;  4X9D A;  5A0D A;  2QTX A;  4QW2 A;  1WNL A;  5CIU A;  3WVD B;  3JB9 H;  3M56 A;  1BYM A;  1O75 A;  3QYH B;  4CRI A;  3PIP A;  1ZQ1 A;  3M5A A;  5I2M A;  4FM4 B;  1M8V A;  4HT8 A;  4C0Z A;  1U1T A;  4M77 F;  1FXX A;  4LDV A;  3RKW A;  3SB2 A;  2L5Q A;  5GAM e;  4ZN3 A;  2B8A A;  2EQJ A;  4PJO G;  5GAN 3;  2HAX A;  1AHJ B;  2GCX A;  3JRZ A;  2DKG A;  3M4G A;  4DA4 A;  2E70 A;  4ZGJ B;  2P0Q A;  3X25 B;  4BI4 A;  3NTI A;  2RJC A;  4NS5 A;  4N4G A;  3ZFJ A;  4E7I A;  3QXE B;  3DB3 A;  4M7D F;  1I4K 1;  3SWN A;  1YI2 A;  1Q82 C;  3GLX A;  1WJQ A;  3PGG A;  5GAO r;  2CZ7 B;  2RH2 A;  5CR2 A;  1M1G A;  2CZ6 B;  3C12 A;  2JNG A;  3CCV A;  2DXB A;  3LX7 A;  3LYI A;  4RCB A;  3UDC A;  4XK8 E;  3ZEH A;  2LCC A;  4M78 F;  4KT0 E;  3S3M A;  1YJN T;  3LGL A;  3BDL A;  2KK4 A;  2DIG A;  5D6W A;  3R6O A;  4LD6 A;  3MEV A;  2C06 A;  4RKU E;  1VQL A;  2Y4Y A;  1VQ6 T;  4XU2 A;  3V7C A;  3CMA A;  1Q7Y U;  3BW1 A;  3HKS A;  5A2Q E;  3CC2 A;  3HFN A;  3QPH A;  1H64 1;  3M55 A;  4KUL A;  4BE1 A;  3JCM g;  3QBY A;  3DLM A;  5CCA A;  3QJY A;  5KCH A;  1BI1 A;  3OYE A;  4M7A D;  3RMS A;  3CBP A;  4M77 B;  2KQW A;  2QEX A;  5FLX E;  1NJI U;  4M75 A;  4OVA A;  3V7R A;  4BI3 A;  1KD1 U;  2RI3 A;  4QQG A;  3ZBD A;  2BIV A;  2ZCF B;  2VGN A;  4N0A A;  4BD3 A;  5CKF A;  3A5Z B;  3L1A A;  2QQS A;  1QVG S;  4CI0 C;  3MEW A;  5LJ3 h;  3PIO A;  1LOJ A;  4FIB A;  1M1K C;  2YLC A;  3SFM A;  2BKD N;  4XTZ A;  3L2V A;  1VUB A;  4XTW A;  3QZ9 B;  3ME9 A;  4PJO F;  3VV0 A;  3CCM A;  2RD1 A;  4QVD A;  3G71 A;  1VQ4 A;  3X24 B;  3CCU A;  1M1F A;  4IKF A;  4IUP A;  4NL2 A;  5L8R E;  1YI2 T;  1HK9 A;  2Y4X A;  2DO3 A;  1K73 C;  4BAC A;  2WSF E;  3CCR A;  2X4J A;  3KUF A;  3SDZ A;  4KUD K;  3M57 A;  1UB4 A;  4OB1 B;  1VQ7 T;  2ZPI B;  4ME7 A;  2KMT A;  1M9S A;  5FRO A;  3QYG B;  4J5Y A;  4M77 E;  4UC4 A;  3INZ A;  4OF1 A;  4JRQ A;  3JCM e;  1U8R A;  4LDY A;  1YJW A;  3P8B B;  3MP6 A;  3VKI A;  4FL6 A;  4XAX B;  1Q81 U;  1VQL T;  1NZ9 A;  4C92 B;  3LH0 A;  3L2Z A;  3CMA T;  3HFO A;  4C92 C;  1UGQ B;  2QDY B;  2X35 A;  5GAO n;  3OYM A;  3CC2 T;  4LD9 K;  2YLB A;  4EDU A;  4E7L A;  2EYQ A;  1N8R U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...