5HK3A

Crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with dna
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
VISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNDALAAMPGNVDLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of M. tuberculosis MazF-mt3 T52D-F62D mutant in complex with DNA
rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Hydrolase/dna
molecule keywords Endoribonuclease MazF6
total genus 27
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2016-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5hk3A00
2VUBA 5CKDA 4ELZC 5CKBA 5HK0A 3JSCA 5CQYA 4MZTA 5HKCA 5HK3A 4HKEA 5CK9A 3NFCA 3JRZA 5CR2A 1NE8A 3G7ZA 3VUBA 2MF2A 1UB4A 5CQXA 4MZPA 5CO7A 1M1FA 2C06A 5CKFA 4MDXA 5CKHA 4MZMA 2KMTA 1VUBA 3HPWA 4ELYC 1X75C 4OF1A 3TCJA 5CKEA 4ME7A 4VUBA 5DLOA 5CCAA
chains in the Genus database with same CATH superfamily
4RTUA 3X25B 1QLYA 4BE2A 1QVGP 2WSCE 4KBMB 1QKXA 4PFOA 1S72Q 2K5LA 2HSEB 4DQ2A 4KUIA 2M16A 1YWPA 2X35A 3JB9G 2P0PA 1UB4A 3M55A 3OYCA 4M75G 5IAYA 4XTUA 3LLRA 2WSFE 3CCRA 3LWHA 3VRZA 2DO3A 1Q86R 5DLOA 2MYSA 4M75E 2HQHA 1UGRB 4PJOF 2QXFA 3HRUA 3CMAA 3VUZA 1DJ7B 1BI0A 1NJIU 3KXTA 5KYUA 2E1HA 3OA6A 3VYGA 1OYXA 2JNGA 3G71T 2JXBA 4PLIA 1HYOA 2M51A 4PJOA 4PJJA 5DLQE 3QG1A 1PNJA 4B9WA 2P0KA 3CC2Q 2DJQA 2RF0A 1NG2A 1V29B 3P8BB 4JJBA 2E5QA 5FU7C 1M5Q1 4KRTA 3OW2S 3JCMQ 3UT1A 1QWFA 4BD3A 1M8MA 3V7RA 1W70A 4J6XA 4QKUA 3UA7A 1BIAA 3G71Q 2ZCFB 2JTEA 4C92E 3QDRB 4HVVA 3REBB 2GQIA 4HVUA 3V7SA 5FU6B 3C4SA 2K2MA 1PCXA 4ZGEB 2DZCA 5KH6A 4M7AC 3VV0A 5C0MA 2RQWA 2EQMA 2CSQA 1R77A 2RHXA 3FEOA 3JCMP 2NLUA 4CC7A 2EPDA 2A08A 1S72T 1UEBA 1WPYA 4GBQA 3OSVA 1MMAA 4HXJA 4OVAA 4RCCA 3TVTA 1JXOA 4CC2A 1YJNQ 4F14A 1I07A 1TUCA 1PM3A 1SPKA 4QQ6A 3CMEA 5GAN6 3CC7T 2I0NA 1WJQA 1Q81R 2XHCA 1OZ3A 3FJ5A 3AT1B 5CKDA 3QWYA 4KT0E 2OTLQ 4M7AD 4EMKB 2EJFA 3SDZA 2OX7A 1W1FA 2DYIA 1U1TA 1IXDA 4XTYA 1RADB 3G1JA 4HT8A 4A4FA 3OYAA 1JQQA 3C0CA 3X20B 3CEYA 3JCMJ 2EGEA 2PU9B 4PJNA 3OYMA 2O31A 4NOYA 3FJPA 3UPUA 1M1FA 1NBEB 3M4GA 1D3BA 2CH4A 3E2UA 3EGXB 3PE0A 1G83A 4C8QB 4PJOE 1VQ5Q 2XU8A 2KXDA 2E4HA 3G4SA 4M75A 4C92C 1OULA 1MUZA 3SD4A 4N4HA 3E9GA 1VQ6A 4BE0A 5GAN7 2RI2A 2NYSA 1M90U 3RESA 1NM7A 3EG1A 2C06A 3V8LA 1WXUA 1AD5A 2FL7A 3X26B 1HSQA 2YWWA 1Y96B 4XU3A 2QEXQ 2E70A 1BIBA 1KSWA 3A1PA 2J6FA 3J7AF 1VQ8A 2JS0A 4Z8AA 4RTVA 1TWBA 2X4XA 3M0UA 4BB7A 2I2LA 4M78G 1SHFA 1NE8A 4CI0C 5HCKA 1PHTA 2ZPBB 4C8QC 3HTRA 2EQIA 1G2BA 2B86A 2HL3A 1AWXA 1R0CB 3H6ZA 4E7LA 2JW4A 5CQYA 3OY9A 3BDUA 1QQJA 3C12A 2ZZDA 3DB4A 4RTZA 2CP0A 2VGNA 3G7ZA 4M77A 4E6RA 1P92A 1QVFA 1B34B 4KGXB 4E7HA 2KMTA 2FZKB 1B3QA 1FMWA 3WXMB 1IHWA 3JAME 5GMKi 3JV3A 4J9HA 4RCBA 3EG0A 2MK5A 2YDLA 3LH0A 4OGEA 3VS7A 2KT1A 2DXTA 5I21A 5LJ5e 4C92A 2D0QB 4HCBA 4RG2A 1C1AA 1OI1A 3EG3A 5KYWA 2KSSA 3H9NA 3M53A 1XNIA 3QUIA 3TSWA 1H641 1IGUA 5LJ3g 5I2SA 5GANh 2AHJB 3JCMb 2FPEA 1K9AA 1K73R 1I5LA 5HK3A 3A8LB 1CKBA 3NFCA 3QXEB 1X43A 2NUPA 1SG5A 1UGQB 2GFAA 2LC4A 3GF5A 2YUPA 4RUGA 3G4SQ 4BY6C 1H3ZA 1EX4A 3VS4A 3RKYA 4ZGJB 2EJGA 2EYZA 1OEBA 2PTKA 4M75D 1U06A 1YIJA 2XDBA 1IZ6A 1SEMA 1G3SA 4BE1A 5KYWB 4M78F 5ECAA 4YTLA 2RMOA 1S72A 1RUWA 2FO0A 1VQNA 5KYYA 2DD5A 1YJ9T 1NJIC 4ANJA 3FLGA 1XQHA 4OMFB 3CCJA 1ZBJA 4LN2A 2LT1A 1VIFA 5LJ5h 1I1JA 3JCMf 1NPRA 3VUBA 1WJRA 2YLBA 3ER0A 1K73U 1KQSP 2QA4T 1MMGA 3OYLA 2C0IA 3CMET 4M78D 3CCST 1LNXA 3X24B 2R5MA 2XDPA 3EHQA 1U8RA 4EMKA 1YP5A 2CGHA 3MCAB 1YIJQ 3KBGA 1X2QA 1W2BS 2CYZB 4R0KA 1GBRA 4AG1C 3GP8A 4HVWA 5L23A 3P8HA 2OI3A 6AT1B 3RNJA 1KC8U 3JB9D 2EIFA 2D1XA 3META 2E12A 3CC4Q 3CC2T 1D1AA 2PUKB 1VQ7Q 1EFNA 2JZ2A 2NUTA 4JJNK 2FZCB 3I56T 2KI7A 1UHFA 2EQJA 2DXUA 2ROTA 3PIPA 3CPFA 4PFZA 4XTZA 2EQUA 2XK0A 3HPWA 1YIJT 2CT3A 4FM4B 2DXBA 2DL4A 5GAMh 3M4YA 3THKA 2VC8A 5GMKj 1K8AC 1N27A 4Y92A 2QQAA 3JSCA 4QVZA 1Q86C 1YJ9A 2AZSA 2GF7A 1TOVA 3AHUA 4DEXA 5GAN4 2Y4YA 4C8QA 1W2BP 3MEAA 1VQ9A 1ZUKA 5GAN8 3UA6A 5GAMf 2RPNA 9ATCB 4F16A 2AIRB 4E7JA 4M7AE 4ORZA 1TG0A 2KR3A 1U1SA 4OF1A 2GTJA 3CMAQ 1GCQA 1TH7A 3EG2A 1M2OA 2QQ9A 1M9SA 3QWXX 3LH5A 3QYGB 4NS5A 4LDXA 2F5KA 3M5AA 1UGSB 3JCMd 2JJ9A 3G6ET 2K3XA 4X9CA 1YJ9Q 2M9UA 3UWNA 3JCMh 1VUBA 2P84A 3DKMA 2HQXA 1UDLA 3RBBB 4BDYA 1BKBA 2DL7A 3EFOB 1K9MU 1QVPA 5HK0A 2DKGA 3ME9A 2E64A 4MZTA 3V8KA 3CC2A 2EJ9A 3EHRA 1JO8A 1T0JA 2MIOA 4XK8E 3URGA 1ABOA 1IHVA 2GFUA 4FYWB 2EGCA 2RI3A 1YHQQ 2KGTA 3TSZA 5CKHA 2EAYA 1OU9A 2H3JA 2QAZA 4J5YA 4ME7A 2D9TA 1D1BA 2FPDA 1UGVA 1Y57A 4KULA 5GAMd 1G3WA 2L2PA 1KHCA 2KT8A 1VQKQ 1XJWB 4C0GA 2X3WD 3CCEQ 1ZSZC 1KQSA 2CH4W 3I5RA 3CCEA 2IG0A 4OB0B 5FRNA 5KYXA 2CP5A 4N4IA 1E7OA 3CCUA 5IHKA 3CCRQ 2OTJT 1JRIA 1G3TA 3E1SA 2KYMA 1B7TA 1KQSS 4KH0B 4C5IA 2DTOA 5C6SA 3OBYA 4RG8A 2O9VA 2KXCA 3CCLT 2XICA 2RK2A 3OYIA 2DF6A 4MZMA 2A36A 1PSFA 3CMEQ 1D09B 3EFOA 2YRDA 4OMMA 1RLPC 2RQRA 1VQNQ 3ULRB 4QVDA 2PVGB 3OS2A 2KRMA 2K6DA 1NPPA 3CD6A 4IIOA 4MDWA 2LCCA 1C0MA 1QVGA 4FCYA 4OB3B 3VS2A 2HNIA 3RR6A 5IH2A 1Q82R 1PRLC 2VKNA 2FG0A 1I5OB 2KYBA 1ABQA 4BUGA 1UECA 2HZYA 2ZPFB 3RKWA 4PJOB 4C92B 1WJSA 1WGSA 2GCXA 2B8AA 2DL8A 2X3XD 2E41A 3RKXA 2DD4A 2MPXC 4XU0A 2DEUA 5HKCA 2ENMA 5GJVB 3CC4T 2YUQA 2RN8A 2BE7D 2DK3A 4AG2C 1M30A 1YCSB 1VQOT 2CKKA 1M3BA 4ZTFA 3LGLA 1UJYA 1ZBXA 3FC3A 1X27A 4Y28E 3S3MA 5KCHA 2RD1A 5FRMA 2MWOA 2K79A 2R5AA 2LCLA 2FEIA 1Y96A 1JXMA 5CKFA 3GNGA 3GOXA 4A4EA 2QEXA 4J83A 4B6MA 1YJNT 4E7IA 2R58A 1HD3A 1IO6A 4F7UB 3WVDB 4F04B 3EGDA 3HHTB 5GANd 1RABB 1MNDA 2E6ZA 2L5QA 3JCMW 1WXBA 2L3RA 1M27C 4R56A 3M0PA 1LJOA 1OX9A 2NWMA 2BKDN 4FYYB 1YI2A 1RAFB 3RUXA 2XIDA 3SB2A 2DM1A 3LWIA 1D0YA 5A0DA 1Q95G 1ZSZB 4NL3A 1ZHIA 1QW1A 1VQ9T 1KJWA 4M75F 3PGGA 4IURA 2AKKA 2X9HA 3M0TA 1I4K1 1FMVA 4AFUC 3M56A 2JS2A 4EDUA 5KYNA 2BZ8A 3INZA 1W2BA 4E47A 4XU1A 1H92A 3VRYA 1M1KR 2DPPB 3QKJA 3VJPA 3BE3A 4M78B 2C0TA 2H8HA 3VS5A 4M7DA 1TXQA 2OAUA 4BDZA 2KNBB 5IT9E 2O01E 4N0AA 1M1KC 4C8QE 4Z89A 3EG9B 4GLMA 4JLGA 1RI9A 3CPWS 2KAFA 2VUBA 2LNVA 4D6WA 4OGCA 1BCOA 1LCKA 5GAMj 1PWTA 1N6AA 5CIUA 4M7AF 1PD0A 1ZUYA 2BIVA 1Q7YU 1AZGB 1H3HA 1BK2A 2ROLA 3DLMA 4XQ3A 2LNHB 4J9EA 2OTLA 1YJWQ 4M78C 2PQWA 1OPLA 1X2KA 4OMOA 3UDCA 3CBOA 3H0FA 1O75A 4C92F 2KQWA 2KRNA 2DA9A 2G3RA 5GAOn 2V1QA 1K9MR 1LVKA 2DTHA 4PL6A 5GJWB 3HRTA 2ZGWA 2EQKA 2DZ9A 1VQKA 2G6FX 3G71A 1VQ4A 3I9QA 1VQPT 1WHKA 2LVMA 2X51A 1VQ8T 3FB9A 2AKLA 3X28B 2EKOA 2RA2A 5EC7A 4BI8B 3OYGA 2EYYA 4PJOD 3OB9A 4C92D 4IUPA 4LNPA 1AVZC 4J9DA 3EH1A 2LDMA 4M77E 5GMKl 2LX9A 1VYTA 2XD0A 2COWA 2JTFA 1R8OB 3CC7Q 2VB6A 3MEUA 4OMQA 5FLXE 3PMTA 4M7DG 4JZ3A 1MNEA 2FRWA 1BB9A 1QKWA 2QDLA 2WSEE 1NJIR 3HFOA 3MJXA 5KCOA 2W0ZA 2WACA 3EFRA 4M4ZA 4C0FA 2P0QA 2V8JA 2RH2A 2BUDA 3CXCS 2XKOC 2F1LA 3LYIA 5GAN5 1UG1A 1RAHB 4L6V5 3MPUB 1W4SA 2EYWA 3JCMe 4B9XA 1WNLA 4ZTJA 3VS0A 2RQTA 5AT1B 1MHNA 1WZOA 4A54A 1VQPQ 5LJ5j 1PD1A 4ZGDB 3H41A 4FW2A 4RTWA 1GBQA 2GQVA 5KE2A 1PKSA 4EMKC 5GAN2 4F17A 5J3BA 2RJDA 2DJZA 1E6GA 3CCQQ 1M90R 2HAXA 2VASA 3I55Q 4AFQC 4FYVB 3CCQA 2KROA 4GLKA 2LQWA 3QPHA 1WYXA 3CCVA 2DYBA 1BI3A 2O9SA 5LJ5g 2RB6A 5LL6S 1KD1C 2BTTA 1AWWA 1Y7XA 2QGGA 2FRYA 1YJWT 1QCFA 4ESRA 1VQ5A 3M57A 2RQVA 2L8DA 4M7AG 1QCNA 3REAB 1M90C 2PVDB 4IIMA 3KUFA 1CKAA 2HKQB 3M9QA 4FIBA 4DEYA 1KQ2A 1UTIA 4HT9A 1VIEA 2DVEA 3NTHA 4F7UE 1K8AR 2DIGA 5IXBA 1KD1R 4FSXA 4M7AB 2RHYA 1Q7YC 3MO8A 3VS1A 1Z9QA 3GLXA 1YWOA 2ZPIB 2KY9A 2DTIA 5FU6C 2V26A 5J26A 1KQ1A 4LDUA 3QO3A 5GAOq 1TS9A 3CCLQ 4E2FB 4C0DC 2JM8A 2KBTA 1I81A 4II1A 3CCMQ 2LP5A 2RJFA 3JCMV 2CZ1B 4KUDK 1VQNT 4Z02A 2BZYA 2VWFA 3GBQA 3QIIA 3A8GB 1Y71A 1WFWA 3VYHB 2M0YA 2YUOA 2JM9A 2P4TA 5A0GA 4MMKA 3H0IA 3M59A 3PT9A 3CCSQ 4LDWA 3J80E 4FSSA 1I0CA 1M4ZA 1ZSGA 2F2VA 3TEEA 2Z0WA 1EZZB 4ZN3A 3WVEB 1WQ7A 3BDLA 1JB0E 4C5EA 5CAIA 2H3EB 2HL5C 2EFIA 2OTJA 5GMKe 2MOXA 3A98A 3OYDA 1VQ4Q 3PFSA 4PKCC 2CS7A 1EIFA 2DLPA 3P8DA 4FT2A 2R57A 3EH2A 4JLIA 1WHGA 1OPKA 3O8VA 5IXFA 2LJ1A 1X01A 2QDYB 2CREA 4LD9K 2DAQA 2K3BA 2JN0A 2W10A 4DA4A 1Q81C 3U23A 2CP6A 1GCPA 2IPOB 4QVCA 2HEQA 2YSQA 2D8JA 4GY5A 4IUTA 3SHWA 1ZQ1A 2LQNA 3QHSA 1WHJA 4M7DB 4X34A 2DL3A 2QK0A 4Q5WA 4VUBA 4AFSC 2LQ8A 4MMLA 4BI3A 4R55A 4ELZC 3JB9J 1VYUA 4Y91A 1FX7A 5DM7R 2BZXA 2E10A 2RJCA 1WQWA 2FB7A 3HRSA 5IN1A 2XI9A 1ARKA 2DEQA 2QQBA 3CC4A 3JB9H 2DL5A 4J7FA 3QSUA 1MMDA 2YRCA 2HKNA 5LJ3j 2KVQG 2LRQA 1IGQA 5AYFA 2O88A 3QBYA 1U5SA 3BW1A 4JS5A 4FW1A 3I55A 1I8FA 4EPCA 2CT4A 1YN8A 1RACB 2L3PA 3HL8A 5LJ3f 3OSSC 2QGFB 3GPLA 1KHIA 2AZVA 2F69A 4M77B 5GANf 2RHIA 4F7UF 3F70A 3PTAA 1WHMA 4J9FA 3M58A 2VGMA 2EGAA 3CCUQ 3O5ZA 4LUEA 4ATOA 1K8AU 3BY7A 2ED0A 3ZFJA 2BE9B 3L2QA 1CSKA 2COZA 3JCMc 2MF2A 4BACA 1N8RC 2EWNA 3RMQA 2J6OA 2DMOA 4C5HA 1AWJA 4HCCA 1F1BB 4M7DE 2DE0X 1NLOC 4WF2A 4J6YA 2L3SA 1X6OA 2QQSA 1QVFS 1JJ2P 2FZGB 4FL6A 2ZPHB 1N8RR 3OYYA 1Z9ZA 1GXIE 3V8JA 4CC3A 1H8KA 4JUVA 5LJ3d 3FRNA 3MEVA 1JJ2A 3QJ6A 3CCMT 2QI2A 3OMCA 1ZA2B 3CCVT 4HCZA 3OS1A 1NYGA 4PJOG 2IVWA 1PSEA 4CRIA 1FMKA 4M77C 2RHZA 5DY9A 2Y4XA 2FYKA 4O5VA 1OX8A 3NTKA 4PJLA 1MGQA 1NEGA 5D6YA 3CD6T 1XOVA 2J06A 2Y90A 3JCMg 1VQMT 2CP7A 1YITT 3SFMA 1IB8A 5D6WA 1QP2A 4AT1B 4NL2A 5J39A 4QT7A 4HKEA 3OS0A 3NGPA 4J9CA 1K73C 2QYZA 4JZ4A 1SSHA 2SRCA 2A37A 2JMAA 5FW9A 1YCYA 4A63B 2RK1A 4ZN1A 1HK9A 1TTHB 3L2UA 1KG1A 2FVUA 3PMIA 5GAOl 2EYQA 3C95A 3ZL7C 1VQ8Q 1PKTA 1ZX6A 2MWPA 3OYJA 2CUDA 3G6EQ 3HSBA 3L2WA 2MAMA 2YRVA 2VXEA 4C92G 2MCNA 4DBHA 5I11A 4OMNA 3PNWC 1MMNA 1RL2A 2M1HA 4EIKA 3CPWA 2K57A 2DVJA 2J6KA 4F7UA 1Q86U 2CZ0B 1V1CA 2K7AA 1VQLT 3TQ7P 2J05A 3CPWP 3I56Q 4FT4A 4KH1B 3RIRA 2LT4A 5CQXA 1JU5C 3OYEA 1T3LA 2ATCB 1J3TA 3OYFA 4LXCA 2DBKA 2RHUA 3S6WA 1X75C 4C5GA 2HQEA 5CCAA 1YJWA 1ZUUA 5KYXB 2ED1A 4E7KA 2K3YA 2K4YA 8ATCB 4V2SA 1ZLMA 3PVQA 2CZ7B 4Z88A 1GRIA 4D8DA 2CP3A 4M78A 5CK9A 1KC8C 2HD0A 3L42A 1SRMA 4JJDA 5KE3A 3VS3A 1IREB 3C94A 1AEYA 1YI2T 1RI0A 4IUVA 2HBWA 2YUNA 2A7YA 2O4XA 1GL5A 2CP2A 2OJ2A 1YITQ 2XMFA 3ZBDA 1IRXA 3EG9A 2DILA 1AZEA 1UUEA 5GMKm 2PZ1A 5GAMe 3G4ST 3GNFB 1PC0A 2V1RA 3R6OA 1Y07A 3QZ5B 2F2XA 1AWOA 4JRPA 2P4RA 1QVFP 2IIMA 3I55T 2YHTA 1BYMA 3EGDB 2K9GA 4FU6A 1VQOQ 1VQLQ 1V76A 2GTOA 3JCMX 4CC4B 1M2VB 4ELYC 5EG2A 3I5SA 2D8HA 4PJOC 1GFDA 2J7IA 3CBPA 1RAGB 1K1ZA 4C0DB 2D6FA 2PVOB 5FWCA 4L5GA 3OW2P 1BI2A 1K4US 4JRIA 3CXCA 3NMZC 4OB2B 3HKSA 4JPBW 3EGUA 1FWZA 3LW5E 5GAN3 3FDRA 2PUOB 4M75C 1VQ7A 2KE9A 3OS5A 3IQLA 3QYHB 1LPLA 1WI7A 1M3CA 1RAIB 1YHQT 2X4JA 5KYYB 3EFSA 4J9GA 1N5ZA 1GFCA 1BI1A 2LZ6B 2FPFA 3KFVA 4JS4A 1UGPB 2COYA 3A8OB 1WHLA 3CCMA 2VV5A 5IHNA 2O2OA 2LTOA 3M54A 1B07A 1Q7YR 2RNAA 1A0NB 3OYNA 1G5VA 2KRSA 3ASKA 2K2VA 1VQ9Q 2JUFA 4UC4A 1HJDA 1WA7A 1JBMA 4J9BA 3OYBA 1WX6A 3QJYA 3OYKA 4HCKA 3RDVA 4KGZB 3T9NA 1OU8A 2QA4A 2AT1B 2NUZA 4M7AA 1PG5B 3CCSA 1TU0B 4RMOA 1ZA1B 4DBRA 4WCIA 3CCET 1D0ZA 2RQUA 2MI6A 3TCJA 1OOTA 1K0SA 1K76A 1NYFA 3E9FA 2A0FB 1HXDA 1E6HA 2QG9B 1N9RA 4LE9A 3OQ5A 3CCJQ 3UF4A 1M2VA 3A5ZB 1RAAB 4K11A 4BY6B 1AOJA 2CSIA 2L3QA 4DOWA 2JTMA 5HY6A 2V8IA 4E7ZA 3SWNA 1YHQA 1SHGA 2LJ0A 3M0RA 1SSFA 1M1KU 4J6WA 1KIKA 3N5BB 4XU2A 3CXCP 3L1AA 2VXFA 1MV3A 1Q81U 5LJ3e 3J81E 1T3SA 3MP6A 1BCMA 3D7SB 1D0XA 3SWNB 5A2QE 2MMPA 3MP1A 5GANe 4ZNXA 3M0QA 4C8QG 4X1VA 3OYHA 1O9SA 3CBMA 4RTTA 1VQ4T 2EYXA 4M7DD 2YLCA 4OP0A 5GAMg 2O4XB 1K0XA 2HMAA 4XAXB 2XG8D 1NZ9A 2A28A 3NHNA 1GCQC 2K5FA 4A4HA 1YNZA 2KEAA 3S3NA 5D7UA 3L2RA 1X6GA 1YBYA 4BI4A 2DRMA 4DBQA 3L2ZA 3DB3A 1S1NA 5GMKh 1Q82C 3LGFA 3VS6A 4JRKA 1SKUB 5M9OA 4M7DF 2LQKA 2VYTA 2ECZA 3HFNA 1Y0MA 5FU7B 2JT4A 2JMCA 3MKDA 2X4WA 1TSFA 2ZPEB 2V8KA 1VQMA 3GIBA 1N8RU 1WLPB 1VQMQ 4O6JA 4RTXA 4QW2A 4FYXB 4X9DA 2E65A 3JB9F 1OZ2A 1OV3A 1KK7A 3ZEHA 2KK4A 2YXYA 3DLLA 2E3HA 2JOYA 3CQTA 4M77D 3SWNC 3PIOA 2DBMA 1R0BG 4M78E 3MEWA 2EW3A 5KYUB 1ACMB 4OB1B 1RLQC 1AHJB 3TU4K 1G8XA 1VQKT 1WDXA 2RI5A 3NTIA 2SEMA 3CCRT 2OTJQ 1TUDA 4XTVA 1QCOA 7AT1B 3A8HB 2QASA 2CUBA 5CKBA 4QQDA 1D3BB 1ZSZA 1YFNA 3R6NA 2XDDA 2NUPB 5GAOr 4IKFA 2E3IA 2D0NA 3BFMA 3VU3C 3CCUT 5CO7A 3UATA 3I35A 4XTXA 1UFFA 2E6NA 1UE9A 2GBQA 2LJ3A 1VQLA 1KD1U 2OAWA 1YI2Q 1VQ5T 1WXTA 5LJ5f 1N9SA 5GANj 2ESWA 1YITA 2EBPA 1BBZA 3EAEA 4PLLA 4PK4A 4TVRA 3CCLA 2RM4A 2X4YA 3PVLA 4JDSA 3QDFA 1QVGS 1LOJA 4C0ZA 1VQ7T 4HA8A 2C0OA 4C8QF 3CCVQ 4KGVB 1OQKA 4DOVA 1NEBA 3RMSA 2A3LA 4M7DC 2ABLA 1RAEB 2L0AA 1W6XA 3LX7A 2AK5A 5CVIA 1D1CA 3OBWA 4RTYA 2CDTA 1U3OA 1MV0B 1VQ6Q 1X6BA 4MZPA 5GANg 4C8QD 4EMHA 1FXXA 5LJ3h 3JB9I 4N0AC 1XTDA 3I56A 4J8OA 8AT1B 2OTLT 1UHCA 2YT6A 4LDVA 2RJEA 5GAOp 4JRQA 1B34A 2ZAEA 2DRKA 3E19A 4PFPA 2NUTB 3H0HA 1G3YA 4A4GA 4D8KA 2KDSA 3QZ9B 1VOMA 2DETA 4M75B 1NLPC 4EMGA 1M1GA 2JVVA 3V7CA 2K5IA 1VQPA 4LD6A 4RKUE 3VKIA 4L59A 3CC7A 2GGRA 2HDAA 3SEMA 2LCSA 4A53A 5GAOm 2QEXT 2RO0A 2DIQA 5D6XA 4E7SA 1YJNA 4IUUA 1AT1B 4LDYA 2HBPA 1QWEA 3G6EA 4AMCA 3MP8A 2DXCA 4OMLA 4WTOB 2QQRA 3A8MB 4LUDA 3CD6Q 2PNIA 5FWBA 2FHDA 4J7IA 1FYNA 1K9MC 1KFZA 4A4KA 3RERA 1PRMC 1QP3A 4N4GA 4OMPA 2DNUA 3JRZA 3L2VA 1TUGB 2QTVA 5IHIA 2QA4Q 4MDXA 2DERA 3M0SA 5I22A 5LJ5d 3CMAT 3FIFA 1VQOA 3EGXA 3H8ZA 4PJMA 4AFZC 3CCJT 2HSPA 5L8RE 5I2MA 1KC8R 1UJ0A 3NPFA 3MHXA 4M77G 3OW2A 4M77F 2EVRA 1SF9A 3S3OA 1JEGA 1C6VX 5FROA 2DX1A 2LMJA 4PNOA 1BU1A 2CZ6B 1T0HA 1VQ6T 2GNCA 4DBFA 4F7UG 2VVKA 2L89A 3OMGA 1JJ2S 4XTWA 2DFUA 1VA7A 1X69A 3HP9A 5CKEA 4P5NA 1QMCA 2ZPGB 3CCQT 2EKHA 3Q1JA 5A0LA 1WHHA 4IUQA 1Q82U 1VYVA 2M0OA 2LX7A 5CR2A 3TREA 2QTXA 1SRLA 2F2WA 2M02A 4JJCA 2E5KA 2HCKA 1M3AA 4QQGA 1M8VA 1WIEA 4J9IA 2F5TX
chains in the Genus database with same CATH topology
3X25B 1BI3A 4BE2A 2WSCE 1N27A 2RB6A 4KBMB 5LL6S 3CBPA 5LJ5g 2QQAA 1K8AC 3JSCA 1KD1C 4C0DB 4QVZA 1Y7XA 1Q86C 2D6FA 1YJWT 2PVOB 4L5GA 2K5LA 1VQ5A 3M57A 1YJ9A 2L8DA 1BI2A 2GF7A 4M7AG 3AHUA 4DQ2A 4JRIA 4KUIA 5GMKj 2M16A 2X35A 2Y4YA 5GAN4 4C8QA 3JB9G 1M90C 2P0PA 1UB4A 2PVDB 3MEAA 3M55A 3OYCA 4M75G 5IAYA 5GAN8 3CXCA 4XTUA 3KUFA 5GAMf 4OB2B 3HKSA 3LLRA 4E7JA 4M7AE 3M9QA 4FIBA 2WSFE 1KQ2A 3CCRA 1FWZA 3LW5E 3LWHA 4HT9A 1VIEA 2DVEA 1U1SA 2PUOB 3FDRA 3NTHA 4M75C 2DIGA 4F7UE 4OF1A 5GAN3 1VQ7A 2DO3A 3OS5A 4FSXA 4M7AB 2RHYA 1Q7YC 3QYHB 1TH7A 3MO8A 4M75E 5DLOA 1UGRB 3GLXA 4PJOF 2QQ9A 1M9SA 2X4JA 2ZPIB 3EFSA 2QXFA 3HRUA 3CMAA 1YHQT 3VUZA 3QYGB 1DJ7B 1BI0A 1NJIU 2KY9A 2DTIA 4NS5A 3KXTA 2E1HA 3OA6A 5FU6C 1OYXA 1BI1A 3VYGA 4LDXA 2JNGA 2F5KA 3M5AA 5J26A 1KQ1A 1UGSB 3JCMd 4LDUA 3QO3A 4JS4A 3G71T 1UGPB 3A8OB 5GAOq 2K3XA 4PLIA 3G6ET 4X9CA 3CCMA 2VV5A 4C0DC 1I81A 2LTOA 4II1A 4PJOA 3M54A 2M9UA 2RJFA 3UWNA 3OYNA 1G5VA 3JCMh 3JCMV 1VUBA 2CZ1B 5DLQE 3ASKA 3DKMA 3QG1A 2K2VA 4KUDK 1VQNT 2JUFA 4Z02A 2HQXA 3QIIA 3A8GB 4UC4A 4B9WA 1Y71A 4BDYA 1BKBA 2P0KA 3VYHB 1JBMA 1K9MU 1QVPA 5HK0A 3OYBA 2DKGA 2P4TA 3ME9A 3QJYA 5A0GA 2E64A 4MZTA 3V8KA 3OYKA 4MMKA 3CC2A 2EJ9A 1V29B 3M59A 3P8BB 3PT9A 3T9NA 4LDWA 2E5QA 3J80E 2QA4A 5FU7C 4XK8E 1M4ZA 3URGA 1M5Q1 4M7AA 3CCSA 3OW2S 2GFUA 4RMOA 2RI3A 3TEEA 4ZN3A 3JCMQ 5CKHA 2EAYA 3CCET 3UT1A 2H3JA 4BD3A 2MI6A 3V7RA 3WVEB 1WQ7A 3BDLA 1JB0E 3TCJA 4J6XA 4J5YA 4ME7A 2D9TA 4C5EA 1BIAA 2ZCFB 5CAIA 4C92E 3QDRB 2EFIA 2OTJA 5GMKe 4KULA 5GAMd 3E9FA 1G3WA 1KHCA 1HXDA 4C0GA 3OYDA 3V7SA 3PFSA 1N9RA 4PKCC 3OQ5A 1KQSA 2CS7A 3CCEA 5FU6B 1EIFA 3C4SA 2IG0A 4OB0B 3P8DA 5FRNA 4FT2A 2R57A 4JLIA 4ZGEB 2DZCA 3A5ZB 5KH6A 3O8VA 4N4IA 3CCUA 4M7AC 3VV0A 5C0MA 2EQMA 4BY6B 2OTJT 1JRIA 1X01A 2QDYB 2RHXA 3FEOA 1M1KC 1G3TA 3E1SA 4LD9K 4DOWA 3JCMP 2DAQA 2JTMA 2NLUA 2JN0A 5HY6A 1KQSS 4DA4A 2V8IA 3SWNA 4C5IA 1S72T 1UEBA 1WPYA 1YHQA 1Q81C 3OSVA 2DTOA 5C6SA 4QVCA 3OBYA 4RG8A 1SSFA 4OVAA 4RCCA 1M1KU 3CCLT 4GY5A 2XICA 4IUTA 2RK2A 3OYIA 1ZQ1A 4MZMA 4J6WA 1PSFA 3QHSA 3N5BB 4M7DB 4XU2A 4X34A 3L1AA 4QQ6A 3CMEA 2VXFA 5GAN6 3CC7T 4QVDA 1WJQA 2PVGB 4Q5WA 4VUBA 1Q81U 3OS2A 2LQ8A 5LJ3e 3J81E 2XHCA 1OZ3A 4MMLA 1NPPA 4BI3A 3MP6A 4ELZC 5CKDA 4R55A 3JB9J 3CD6A 3SWNB 4KT0E 4MDWA 2LCCA 4M7AD 4EMKB 2EJFA 5A2QE 1QVGA 2MMPA 3MP1A 5GANe 4PJOC 3SDZA 4C8QG 4Y91A 1FX7A 3OYHA 4OB3B 1O9SA 5DM7R 2E10A 3CBMA 1VQ4T 2RJCA 2HNIA 4M7DD 2YLCA 1WQWA 2FB7A 3HRSA 4OP0A 5IN1A 5GAMg 2O4XB 2XI9A 1U1TA 2DEQA 4XTYA 2QQBA 4BUGA 4XAXB 3CC4A 2ZPFB 3JB9H 2XG8D 4J7FA 1NZ9A 3RKWA 4PJOB 2K5FA 1WJSA 1WGSA 2GCXA 4A4HA 4C92B 3QSUA 4HT8A 2B8AA 5LJ3j 3S3NA 2KVQG 4A4FA 3L2RA 2LRQA 3OYAA 5AYFA 2E41A 3QBYA 1YBYA 3RKXA 3X20B 3CEYA 3JCMJ 3BW1A 4JS5A 2DD4A 4BI4A 3I55A 4XU0A 1I8FA 2PU9B 3L2ZA 3DB3A 4EPCA 3OYMA 5GMKh 3HL8A 5HKCA 1Q82C 3LGFA 5LJ3f 3OSSC 4JRKA 4NOYA 5M9OA 4M7DF 3CC4T 2LQKA 2VYTA 3FJPA 3GPLA 3UPUA 3HFNA 1M1FA 5FU7B 2DK3A 1KHIA 2X4WA 2F69A 3M4GA 4M77B 1D3BA 2ZPEB 5GANf 2V8KA 1VQMA 3GIBA 1N8RU 1VQOT 2CKKA 2RHIA 4F7UF 3F70A 3PTAA 4ZTFA 3M58A 4O6JA 2VGMA 3LGLA 4QW2A 4X9DA 4C8QB 4PJOE 2E65A 2XU8A 1ZBXA 3JB9F 1OZ2A 3ZEHA 2KK4A 4ATOA 3FC3A 4Y28E 1K8AU 3BY7A 5KCHA 3S3MA 2RD1A 3G4SA 4M75A 4C92C 3ZFJA 2MWOA 3DLLA 5FRMA 2XDBA 3SD4A 4N4HA 2JOYA 2R5AA 4M77D 3L2QA 3E9GA 1VQ6A 3SWNC 3PIOA 3JCMc 2LCLA 5GAN7 2RI2A 4BE0A 2MF2A 1Y96A 3RESA 1M90U 2C06A 4M78E 4BACA 5CKFA 1N8RC 3MEWA 3V8LA 3GNGA 4OB1B 2EWNA 3RMQA 3GOXA 4A4EA 2QEXA 4J83A 1YJNT 4C5HA 1AHJB 2FL7A 3TU4K 3X26B 4HCCA 4E7IA 1VQKT 1Y96B 4XU3A 2R58A 2E70A 1BIBA 2RI5A 4M7DE 3NTIA 3CCRT 4XTVA 4F7UB 3A8HB 3J7AF 1VQ8A 3WVDB 4WF2A 4J6YA 5CKBA 4QQDA 3HHTB 1X6OA 1D3BB 2QQSA 5GANd 2X4XA 1QVFS 2E6ZA 2L5QA 4BB7A 4FL6A 2ZPHB 2XDDA 3OYYA 3JCMW 1GXIE 2I2LA 3V8JA 5GAOr 4M78G 4IKFA 3VU3C 4CI0C 1NE8A 3BFMA 4JUVA 5LJ3d 3CCUT 5CO7A 3FRNA 2L3RA 2ZPBB 3MEVA 4C8QC 4R56A 1JJ2A 3QJ6A 4XTXA 3CCMT 2QI2A 3OMCA 3CCVT 1LJOA 4HCZA 3OS1A 2BKDN 2E6NA 1YI2A 3RUXA 2XIDA 3SB2A 1VQLA 1KD1U 4PJOG 2IVWA 1PSEA 3H6ZA 4CRIA 3LWIA 5A0DA 5LJ5f 1VQ5T 1N9SA 4E7LA 5GANj 5CQYA 4NL3A 3OY9A 1YITA 1ZHIA 3BDUA 3C12A 1QW1A 3EAEA 1VQ9T 4PLLA 4TVRA 4M77C 3CCLA 2ZZDA 3DB4A 3PGGA 4IURA 4M75F 2RHZA 2RM4A 2X4YA 1I4K1 2VGNA 3G7ZA 4JDSA 4M77A 1P92A 1QVGS 1QVFA 1B34B 1LOJA 5DY9A 3M56A 2Y4XA 2FYKA 4E7HA 4C0ZA 4O5VA 1VQ7T 4EDUA 3NTKA 4HA8A 4C8QF 3INZA 1W2BA 4E47A 4XU1A 2KMTA 4DOVA 1MGQA 5D6YA 3RMSA 3WXMB 1XOVA 2A3LA 2Y90A 3CD6T 3JCMg 2DPPB 5GMKi 3JAME 1VQMT 3QKJA 3VJPA 4M7DC 1YITT 3SFMA 4M78B 3LH0A 3LX7A 4OGEA 4RCBA 5D6WA 1QP2A 4M7DA 5CVIA 4NL2A 5J39A 2DXTA 5I21A 3OBWA 5LJ5e 5GAOm 4HKEA 4C92A 3OS0A 2D0QB 1K73C 4HCBA 2OAUA 4BDZA 4RG2A 5IT9E 2O01E 4MZPA 4N0AA 5GANg 1OI1A 4C8QD 4EMHA 1FXXA 1YCYA 2RK1A 5LJ3h 4ZN1A 4C8QE 2KSSA 3QUIA 3M53A 1XNIA 1XTDA 4N0AC 3JB9I 3I56A 1H641 4J8OA 1HK9A 2OTLT 3L2UA 1KG1A 5LJ3g 4LDVA 2FVUA 5I2SA 4JLGA 2RJEA 5GANh 2AHJB 5GAOp 3CPWS 4JRQA 3PMIA 5GAOl 3JCMb 2EYQA 2KAFA 2VUBA 2LNVA 1B34A 4D6WA 3C95A 4OGCA 5GAMj 3E19A 1I5LA 1N6AA 5CIUA 2MWPA 3OYJA 5HK3A 3HSBA 4M7AF 2BIVA 3A8LB 3L2WA 2MAMA 2YRVA 3NFCA 1Q7YU 1G3YA 4A4GA 2VXEA 2KDSA 3QXEB 4C92G 4XQ3A 3DLMA 3QZ9B 2OTLA 3PNWC 1RL2A 4M75B 4M78C 2M1HA 2PQWA 1UGQB 2GFAA 1M1GA 4EMGA 2JVVA 3CPWA 2LC4A 2K57A 3GF5A 3V7CA 2K5IA 1VQPA 4LD6A 4RKUE 3VKIA 3UDCA 3CBOA 4L59A 4BY6C 1H3ZA 4F7UA 1Q86U 1O75A 3CC7A 4C92F 2KQWA 2G3RA 2CZ0B 3RKYA 1VQLT 4ZGJB 2EJGA 5GAOn 2DTHA 4FT4A 4M75D 4PL6A 4A53A 3HRTA 2LT4A 2RO0A 2DIQA 5CQXA 5D6XA 2ZGWA 4IUUA 3RIRA 2QEXT 2EQKA 4LDYA 1IZ6A 2DZ9A 2HBPA 3OYEA 1YIJA 3G71A 1VQKA 1G3SA 3G6EA 1VQ4A 4BE1A 3MP8A 2DXCA 3OYFA 4M78F 1VQPT 2LVMA 2RHUA 2QQRA 3S6WA 1VQ8T 1X75C 4C5GA 2HQEA 3A8MB 4YTLA 3FB9A 3X28B 2EKOA 2RA2A 4BI8B 5CCAA 2FHDA 3OYGA 1YJWA 4J7IA 1S72A 4PJOD 1VQNA 2DD5A 1YJ9T 3OB9A 4E7KA 2K3YA 2K4YA 4IUPA 4C92D 1K9MC 1NJIC 4V2SA 4A4KA 3RERA 3FLGA 1XQHA 2CZ7B 4OMFB 2LDMA 4M77E 1QP3A 5GMKl 2LX9A 3CCJA 4N4GA 2XD0A 2LT1A 1VIFA 4M78A 5CK9A 3JRZA 5LJ5h 1KC8C 2JTFA 3L2VA 1R8OB 2HD0A 3L42A 3JCMf 1NPRA 3VUBA 1WJRA 2YLBA 3ER0A 3MEUA 5KE3A 1K73U 5FLXE 3PMTA 2QA4T 4MDXA 3OYLA 1IREB 3C94A 4M7DG 3CMET 4M78D 3CCST 1YI2T 1LNXA 1RI0A 4IUVA 5LJ5d 3X24B 2A7YA 2O4XA 2WSEE 3CMAT 2R5MA 3FIFA 3HFOA 2XDPA 5KCOA 1VQOA 3H8ZA 1U8RA 2WACA 3CCJT 3EFRA 5L8RE 3ZBDA 5I2MA 4EMKA 4C0FA 2P0QA 2V8JA 2CGHA 3MHXA 3MCAB 5GMKm 2RH2A 3KBGA 4M77G 3OW2A 2BUDA 3CXCS 4M77F 2XKOC 1YJNA 1W2BS 3S3OA 5GAMe 3G4ST 3LYIA 5GAN5 3GNFB 3R6OA 2CYZB 5FROA 4L6V5 4PNOA 1Y07A 2CZ6B 1VQ6T 1W4SA 3GP8A 3JCMe 4B9XA 3QZ5B 4F7UG 1WNLA 4ZTJA 2L89A 3OMGA 3P8HA 4JRPA 1JJ2S 4XTWA 1VQ9A 5CKEA 3HP9A 3I55T 4P5NA 2EIFA 3JB9D 1KC8U 2ZPGB 3META 2E12A 3CC2T 1MHNA 4A54A 3CCQT 2PUKB 3Q1JA 5LJ5j 5A0LA 2YHTA 1BYMA 4IUQA 4FU6A 1Q82U 2JZ2A 2M0OA 4ZGDB 5CR2A 4JJNK 2GQVA 3TREA 5KE2A 2QTXA 4EMKC 3I56T 2EQJA 2DXUA 3JCMX 5GAN2 3PIPA 3CPFA 5J3BA 2RJDA 2DJZA 4XTZA 2HAXA 2EQUA 2XK0A 3HPWA 1YIJT 4ELYC 4QQGA 3CCQA 4FM4B 5EG2A 1M8VA 4GLKA 2DXBA 3QPHA 5GAMh 3M4YA 3CCVA 2VC8A 2F5TX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUB A;  5CKD A;  4ELZ C;  5CKB A;  5HK0 A;  3JSC A;  5CQY A;  4MZT A;  5HKC A;  5HK3 A;  4HKE A;  5CK9 A;  3NFC A;  3JRZ A;  5CR2 A;  1NE8 A;  3G7Z A;  3VUB A;  2MF2 A;  1UB4 A;  5CQX A;  4MZP A;  5CO7 A;  1M1F A;  2C06 A;  5CKF A;  4MDX A;  5CKH A;  4MZM A;  2KMT A;  1VUB A;  3HPW A;  4ELY C;  1X75 C;  4OF1 A;  3TCJ A;  5CKE A;  4ME7 A;  4VUB A;  5DLO A;  5CCA A; 
#chains in the Genus database with same CATH topology
 4RTU A;  3X25 B;  1QLY A;  4BE2 A;  1QVG P;  2WSC E;  4KBM B;  1QKX A;  4PFO A;  1S72 Q;  2K5L A;  2HSE B;  4DQ2 A;  4KUI A;  2M16 A;  1YWP A;  2X35 A;  3JB9 G;  2P0P A;  1UB4 A;  3M55 A;  3OYC A;  4M75 G;  5IAY A;  4XTU A;  3LLR A;  2WSF E;  3CCR A;  3LWH A;  3VRZ A;  2DO3 A;  1Q86 R;  5DLO A;  2MYS A;  4M75 E;  2HQH A;  1UGR B;  4PJO F;  2QXF A;  3HRU A;  3CMA A;  3VUZ A;  1DJ7 B;  1BI0 A;  1NJI U;  3KXT A;  5KYU A;  2E1H A;  3OA6 A;  3VYG A;  1OYX A;  2JNG A;  3G71 T;  2JXB A;  4PLI A;  1HYO A;  2M51 A;  4PJO A;  4PJJ A;  5DLQ E;  3QG1 A;  1PNJ A;  4B9W A;  2P0K A;  3CC2 Q;  2DJQ A;  2RF0 A;  1NG2 A;  1V29 B;  3P8B B;  4JJB A;  2E5Q A;  5FU7 C;  1M5Q 1;  4KRT A;  3OW2 S;  3JCM Q;  3UT1 A;  1QWF A;  4BD3 A;  1M8M A;  3V7R A;  1W70 A;  4J6X A;  4QKU A;  3UA7 A;  1BIA A;  3G71 Q;  2ZCF B;  2JTE A;  4C92 E;  3QDR B;  4HVV A;  3REB B;  2GQI A;  4HVU A;  3V7S A;  5FU6 B;  3C4S A;  2K2M A;  1PCX A;  4ZGE B;  2DZC A;  5KH6 A;  4M7A C;  3VV0 A;  5C0M A;  2RQW A;  2EQM A;  2CSQ A;  1R77 A;  2RHX A;  3FEO A;  3JCM P;  2NLU A;  4CC7 A;  2EPD A;  2A08 A;  1S72 T;  1UEB A;  1WPY A;  4GBQ A;  3OSV A;  1MMA A;  4HXJ A;  4OVA A;  4RCC A;  3TVT A;  1JXO A;  4CC2 A;  1YJN Q;  4F14 A;  1I07 A;  1TUC A;  1PM3 A;  1SPK A;  4QQ6 A;  3CME A;  5GAN 6;  3CC7 T;  2I0N A;  1WJQ A;  1Q81 R;  2XHC A;  1OZ3 A;  3FJ5 A;  3AT1 B;  5CKD A;  3QWY A;  4KT0 E;  2OTL Q;  4M7A D;  4EMK B;  2EJF A;  3SDZ A;  2OX7 A;  1W1F A;  2DYI A;  1U1T A;  1IXD A;  4XTY A;  1RAD B;  3G1J A;  4HT8 A;  4A4F A;  3OYA A;  1JQQ A;  3C0C A;  3X20 B;  3CEY A;  3JCM J;  2EGE A;  2PU9 B;  4PJN A;  3OYM A;  2O31 A;  4NOY A;  3FJP A;  3UPU A;  1M1F A;  1NBE B;  3M4G A;  1D3B A;  2CH4 A;  3E2U A;  3EGX B;  3PE0 A;  1G83 A;  4C8Q B;  4PJO E;  1VQ5 Q;  2XU8 A;  2KXD A;  2E4H A;  3G4S A;  4M75 A;  4C92 C;  1OUL A;  1MUZ A;  3SD4 A;  4N4H A;  3E9G A;  1VQ6 A;  4BE0 A;  5GAN 7;  2RI2 A;  2NYS A;  1M90 U;  3RES A;  1NM7 A;  3EG1 A;  2C06 A;  3V8L A;  1WXU A;  1AD5 A;  2FL7 A;  3X26 B;  1HSQ A;  2YWW A;  1Y96 B;  4XU3 A;  2QEX Q;  2E70 A;  1BIB A;  1KSW A;  3A1P A;  2J6F A;  3J7A F;  1VQ8 A;  2JS0 A;  4Z8A A;  4RTV A;  1TWB A;  2X4X A;  3M0U A;  4BB7 A;  2I2L A;  4M78 G;  1SHF A;  1NE8 A;  4CI0 C;  5HCK A;  1PHT A;  2ZPB B;  4C8Q C;  3HTR A;  2EQI A;  1G2B A;  2B86 A;  2HL3 A;  1AWX A;  1R0C B;  3H6Z A;  4E7L A;  2JW4 A;  5CQY A;  3OY9 A;  3BDU A;  1QQJ A;  3C12 A;  2ZZD A;  3DB4 A;  4RTZ A;  2CP0 A;  2VGN A;  3G7Z A;  4M77 A;  4E6R A;  1P92 A;  1QVF A;  1B34 B;  4KGX B;  4E7H A;  2KMT A;  2FZK B;  1B3Q A;  1FMW A;  3WXM B;  1IHW A;  3JAM E;  5GMK i;  3JV3 A;  4J9H A;  4RCB A;  3EG0 A;  2MK5 A;  2YDL A;  3LH0 A;  4OGE A;  3VS7 A;  2KT1 A;  2DXT A;  5I21 A;  5LJ5 e;  4C92 A;  2D0Q B;  4HCB A;  4RG2 A;  1C1A A;  1OI1 A;  3EG3 A;  5KYW A;  2KSS A;  3H9N A;  3M53 A;  1XNI A;  3QUI A;  3TSW A;  1H64 1;  1IGU A;  5LJ3 g;  5I2S A;  5GAN h;  2AHJ B;  3JCM b;  2FPE A;  1K9A A;  1K73 R;  1I5L A;  5HK3 A;  3A8L B;  1CKB A;  3NFC A;  3QXE B;  1X43 A;  2NUP A;  1SG5 A;  1UGQ B;  2GFA A;  2LC4 A;  3GF5 A;  2YUP A;  4RUG A;  3G4S Q;  4BY6 C;  1H3Z A;  1EX4 A;  3VS4 A;  3RKY A;  4ZGJ B;  2EJG A;  2EYZ A;  1OEB A;  2PTK A;  4M75 D;  1U06 A;  1YIJ A;  2XDB A;  1IZ6 A;  1SEM A;  1G3S A;  4BE1 A;  5KYW B;  4M78 F;  5ECA A;  4YTL A;  2RMO A;  1S72 A;  1RUW A;  2FO0 A;  1VQN A;  5KYY A;  2DD5 A;  1YJ9 T;  1NJI C;  4ANJ A;  3FLG A;  1XQH A;  4OMF B;  3CCJ A;  1ZBJ A;  4LN2 A;  2LT1 A;  1VIF A;  5LJ5 h;  1I1J A;  3JCM f;  1NPR A;  3VUB A;  1WJR A;  2YLB A;  3ER0 A;  1K73 U;  1KQS P;  2QA4 T;  1MMG A;  3OYL A;  2C0I A;  3CME T;  4M78 D;  3CCS T;  1LNX A;  3X24 B;  2R5M A;  2XDP A;  3EHQ A;  1U8R A;  4EMK A;  1YP5 A;  2CGH A;  3MCA B;  1YIJ Q;  3KBG A;  1X2Q A;  1W2B S;  2CYZ B;  4R0K A;  1GBR A;  4AG1 C;  3GP8 A;  4HVW A;  5L23 A;  3P8H A;  2OI3 A;  6AT1 B;  3RNJ A;  1KC8 U;  3JB9 D;  2EIF A;  2D1X A;  3MET A;  2E12 A;  3CC4 Q;  3CC2 T;  1D1A A;  2PUK B;  1VQ7 Q;  1EFN A;  2JZ2 A;  2NUT A;  4JJN K;  2FZC B;  3I56 T;  2KI7 A;  1UHF A;  2EQJ A;  2DXU A;  2ROT A;  3PIP A;  3CPF A;  4PFZ A;  4XTZ A;  2EQU A;  2XK0 A;  3HPW A;  1YIJ T;  2CT3 A;  4FM4 B;  2DXB A;  2DL4 A;  5GAM h;  3M4Y A;  3THK A;  2VC8 A;  5GMK j;  1K8A C;  1N27 A;  4Y92 A;  2QQA A;  3JSC A;  4QVZ A;  1Q86 C;  1YJ9 A;  2AZS A;  2GF7 A;  1TOV A;  3AHU A;  4DEX A;  5GAN 4;  2Y4Y A;  4C8Q A;  1W2B P;  3MEA A;  1VQ9 A;  1ZUK A;  5GAN 8;  3UA6 A;  5GAM f;  2RPN A;  9ATC B;  4F16 A;  2AIR B;  4E7J A;  4M7A E;  4ORZ A;  1TG0 A;  2KR3 A;  1U1S A;  4OF1 A;  2GTJ A;  3CMA Q;  1GCQ A;  1TH7 A;  3EG2 A;  1M2O A;  2QQ9 A;  1M9S A;  3QWX X;  3LH5 A;  3QYG B;  4NS5 A;  4LDX A;  2F5K A;  3M5A A;  1UGS B;  3JCM d;  2JJ9 A;  3G6E T;  2K3X A;  4X9C A;  1YJ9 Q;  2M9U A;  3UWN A;  3JCM h;  1VUB A;  2P84 A;  3DKM A;  2HQX A;  1UDL A;  3RBB B;  4BDY A;  1BKB A;  2DL7 A;  3EFO B;  1K9M U;  1QVP A;  5HK0 A;  2DKG A;  3ME9 A;  2E64 A;  4MZT A;  3V8K A;  3CC2 A;  2EJ9 A;  3EHR A;  1JO8 A;  1T0J A;  2MIO A;  4XK8 E;  3URG A;  1ABO A;  1IHV A;  2GFU A;  4FYW B;  2EGC A;  2RI3 A;  1YHQ Q;  2KGT A;  3TSZ A;  5CKH A;  2EAY A;  1OU9 A;  2H3J A;  2QAZ A;  4J5Y A;  4ME7 A;  2D9T A;  1D1B A;  2FPD A;  1UGV A;  1Y57 A;  4KUL A;  5GAM d;  1G3W A;  2L2P A;  1KHC A;  2KT8 A;  1VQK Q;  1XJW B;  4C0G A;  2X3W D;  3CCE Q;  1ZSZ C;  1KQS A;  2CH4 W;  3I5R A;  3CCE A;  2IG0 A;  4OB0 B;  5FRN A;  5KYX A;  2CP5 A;  4N4I A;  1E7O A;  3CCU A;  5IHK A;  3CCR Q;  2OTJ T;  1JRI A;  1G3T A;  3E1S A;  2KYM A;  1B7T A;  1KQS S;  4KH0 B;  4C5I A;  2DTO A;  5C6S A;  3OBY A;  4RG8 A;  2O9V A;  2KXC A;  3CCL T;  2XIC A;  2RK2 A;  3OYI A;  2DF6 A;  4MZM A;  2A36 A;  1PSF A;  3CME Q;  1D09 B;  3EFO A;  2YRD A;  4OMM A;  1RLP C;  2RQR A;  1VQN Q;  3ULR B;  4QVD A;  2PVG B;  3OS2 A;  2KRM A;  2K6D A;  1NPP A;  3CD6 A;  4IIO A;  4MDW A;  2LCC A;  1C0M A;  1QVG A;  4FCY A;  4OB3 B;  3VS2 A;  2HNI A;  3RR6 A;  5IH2 A;  1Q82 R;  1PRL C;  2VKN A;  2FG0 A;  1I5O B;  2KYB A;  1ABQ A;  4BUG A;  1UEC A;  2HZY A;  2ZPF B;  3RKW A;  4PJO B;  4C92 B;  1WJS A;  1WGS A;  2GCX A;  2B8A A;  2DL8 A;  2X3X D;  2E41 A;  3RKX A;  2DD4 A;  2MPX C;  4XU0 A;  2DEU A;  5HKC A;  2ENM A;  5GJV B;  3CC4 T;  2YUQ A;  2RN8 A;  2BE7 D;  2DK3 A;  4AG2 C;  1M30 A;  1YCS B;  1VQO T;  2CKK A;  1M3B A;  4ZTF A;  3LGL A;  1UJY A;  1ZBX A;  3FC3 A;  1X27 A;  4Y28 E;  3S3M A;  5KCH A;  2RD1 A;  5FRM A;  2MWO A;  2K79 A;  2R5A A;  2LCL A;  2FEI A;  1Y96 A;  1JXM A;  5CKF A;  3GNG A;  3GOX A;  4A4E A;  2QEX A;  4J83 A;  4B6M A;  1YJN T;  4E7I A;  2R58 A;  1HD3 A;  1IO6 A;  4F7U B;  3WVD B;  4F04 B;  3EGD A;  3HHT B;  5GAN d;  1RAB B;  1MND A;  2E6Z A;  2L5Q A;  3JCM W;  1WXB A;  2L3R A;  1M27 C;  4R56 A;  3M0P A;  1LJO A;  1OX9 A;  2NWM A;  2BKD N;  4FYY B;  1YI2 A;  1RAF B;  3RUX A;  2XID A;  3SB2 A;  2DM1 A;  3LWI A;  1D0Y A;  5A0D A;  1Q95 G;  1ZSZ B;  4NL3 A;  1ZHI A;  1QW1 A;  1VQ9 T;  1KJW A;  4M75 F;  3PGG A;  4IUR A;  2AKK A;  2X9H A;  3M0T A;  1I4K 1;  1FMV A;  4AFU C;  3M56 A;  2JS2 A;  4EDU A;  5KYN A;  2BZ8 A;  3INZ A;  1W2B A;  4E47 A;  4XU1 A;  1H92 A;  3VRY A;  1M1K R;  2DPP B;  3QKJ A;  3VJP A;  3BE3 A;  4M78 B;  2C0T A;  2H8H A;  3VS5 A;  4M7D A;  1TXQ A;  2OAU A;  4BDZ A;  2KNB B;  5IT9 E;  2O01 E;  4N0A A;  1M1K C;  4C8Q E;  4Z89 A;  3EG9 B;  4GLM A;  4JLG A;  1RI9 A;  3CPW S;  2KAF A;  2VUB A;  2LNV A;  4D6W A;  4OGC A;  1BCO A;  1LCK A;  5GAM j;  1PWT A;  1N6A A;  5CIU A;  4M7A F;  1PD0 A;  1ZUY A;  2BIV A;  1Q7Y U;  1AZG B;  1H3H A;  1BK2 A;  2ROL A;  3DLM A;  4XQ3 A;  2LNH B;  4J9E A;  2OTL A;  1YJW Q;  4M78 C;  2PQW A;  1OPL A;  1X2K A;  4OMO A;  3UDC A;  3CBO A;  3H0F A;  1O75 A;  4C92 F;  2KQW A;  2KRN A;  2DA9 A;  2G3R A;  5GAO n;  2V1Q A;  1K9M R;  1LVK A;  2DTH A;  4PL6 A;  5GJW B;  3HRT A;  2ZGW A;  2EQK A;  2DZ9 A;  1VQK A;  2G6F X;  3G71 A;  1VQ4 A;  3I9Q A;  1VQP T;  1WHK A;  2LVM A;  2X51 A;  1VQ8 T;  3FB9 A;  2AKL A;  3X28 B;  2EKO A;  2RA2 A;  5EC7 A;  4BI8 B;  3OYG A;  2EYY A;  4PJO D;  3OB9 A;  4C92 D;  4IUP A;  4LNP A;  1AVZ C;  4J9D A;  3EH1 A;  2LDM A;  4M77 E;  5GMK l;  2LX9 A;  1VYT A;  2XD0 A;  2COW A;  2JTF A;  1R8O B;  3CC7 Q;  2VB6 A;  3MEU A;  4OMQ A;  5FLX E;  3PMT A;  4M7D G;  4JZ3 A;  1MNE A;  2FRW A;  1BB9 A;  1QKW A;  2QDL A;  2WSE E;  1NJI R;  3HFO A;  3MJX A;  5KCO A;  2W0Z A;  2WAC A;  3EFR A;  4M4Z A;  4C0F A;  2P0Q A;  2V8J A;  2RH2 A;  2BUD A;  3CXC S;  2XKO C;  2F1L A;  3LYI A;  5GAN 5;  1UG1 A;  1RAH B;  4L6V 5;  3MPU B;  1W4S A;  2EYW A;  3JCM e;  4B9X A;  1WNL A;  4ZTJ A;  3VS0 A;  2RQT A;  5AT1 B;  1MHN A;  1WZO A;  4A54 A;  1VQP Q;  5LJ5 j;  1PD1 A;  4ZGD B;  3H41 A;  4FW2 A;  4RTW A;  1GBQ A;  2GQV A;  5KE2 A;  1PKS A;  4EMK C;  5GAN 2;  4F17 A;  5J3B A;  2RJD A;  2DJZ A;  1E6G A;  3CCQ Q;  1M90 R;  2HAX A;  2VAS A;  3I55 Q;  4AFQ C;  4FYV B;  3CCQ A;  2KRO A;  4GLK A;  2LQW A;  3QPH A;  1WYX A;  3CCV A;  2DYB A;  1BI3 A;  2O9S A;  5LJ5 g;  2RB6 A;  5LL6 S;  1KD1 C;  2BTT A;  1AWW A;  1Y7X A;  2QGG A;  2FRY A;  1YJW T;  1QCF A;  4ESR A;  1VQ5 A;  3M57 A;  2RQV A;  2L8D A;  4M7A G;  1QCN A;  3REA B;  1M90 C;  2PVD B;  4IIM A;  3KUF A;  1CKA A;  2HKQ B;  3M9Q A;  4FIB A;  4DEY A;  1KQ2 A;  1UTI A;  4HT9 A;  1VIE A;  2DVE A;  3NTH A;  4F7U E;  1K8A R;  2DIG A;  5IXB A;  1KD1 R;  4FSX A;  4M7A B;  2RHY A;  1Q7Y C;  3MO8 A;  3VS1 A;  1Z9Q A;  3GLX A;  1YWO A;  2ZPI B;  2KY9 A;  2DTI A;  5FU6 C;  2V26 A;  5J26 A;  1KQ1 A;  4LDU A;  3QO3 A;  5GAO q;  1TS9 A;  3CCL Q;  4E2F B;  4C0D C;  2JM8 A;  2KBT A;  1I81 A;  4II1 A;  3CCM Q;  2LP5 A;  2RJF A;  3JCM V;  2CZ1 B;  4KUD K;  1VQN T;  4Z02 A;  2BZY A;  2VWF A;  3GBQ A;  3QII A;  3A8G B;  1Y71 A;  1WFW A;  3VYH B;  2M0Y A;  2YUO A;  2JM9 A;  2P4T A;  5A0G A;  4MMK A;  3H0I A;  3M59 A;  3PT9 A;  3CCS Q;  4LDW A;  3J80 E;  4FSS A;  1I0C A;  1M4Z A;  1ZSG A;  2F2V A;  3TEE A;  2Z0W A;  1EZZ B;  4ZN3 A;  3WVE B;  1WQ7 A;  3BDL A;  1JB0 E;  4C5E A;  5CAI A;  2H3E B;  2HL5 C;  2EFI A;  2OTJ A;  5GMK e;  2MOX A;  3A98 A;  3OYD A;  1VQ4 Q;  3PFS A;  4PKC C;  2CS7 A;  1EIF A;  2DLP A;  3P8D A;  4FT2 A;  2R57 A;  3EH2 A;  4JLI A;  1WHG A;  1OPK A;  3O8V A;  5IXF A;  2LJ1 A;  1X01 A;  2QDY B;  2CRE A;  4LD9 K;  2DAQ A;  2K3B A;  2JN0 A;  2W10 A;  4DA4 A;  1Q81 C;  3U23 A;  2CP6 A;  1GCP A;  2IPO B;  4QVC A;  2HEQ A;  2YSQ A;  2D8J A;  4GY5 A;  4IUT A;  3SHW A;  1ZQ1 A;  2LQN A;  3QHS A;  1WHJ A;  4M7D B;  4X34 A;  2DL3 A;  2QK0 A;  4Q5W A;  4VUB A;  4AFS C;  2LQ8 A;  4MML A;  4BI3 A;  4R55 A;  4ELZ C;  3JB9 J;  1VYU A;  4Y91 A;  1FX7 A;  5DM7 R;  2BZX A;  2E10 A;  2RJC A;  1WQW A;  2FB7 A;  3HRS A;  5IN1 A;  2XI9 A;  1ARK A;  2DEQ A;  2QQB A;  3CC4 A;  3JB9 H;  2DL5 A;  4J7F A;  3QSU A;  1MMD A;  2YRC A;  2HKN A;  5LJ3 j;  2KVQ G;  2LRQ A;  1IGQ A;  5AYF A;  2O88 A;  3QBY A;  1U5S A;  3BW1 A;  4JS5 A;  4FW1 A;  3I55 A;  1I8F A;  4EPC A;  2CT4 A;  1YN8 A;  1RAC B;  2L3P A;  3HL8 A;  5LJ3 f;  3OSS C;  2QGF B;  3GPL A;  1KHI A;  2AZV A;  2F69 A;  4M77 B;  5GAN f;  2RHI A;  4F7U F;  3F70 A;  3PTA A;  1WHM A;  4J9F A;  3M58 A;  2VGM A;  2EGA A;  3CCU Q;  3O5Z A;  4LUE A;  4ATO A;  1K8A U;  3BY7 A;  2ED0 A;  3ZFJ A;  2BE9 B;  3L2Q A;  1CSK A;  2COZ A;  3JCM c;  2MF2 A;  4BAC A;  1N8R C;  2EWN A;  3RMQ A;  2J6O A;  2DMO A;  4C5H A;  1AWJ A;  4HCC A;  1F1B B;  4M7D E;  2DE0 X;  1NLO C;  4WF2 A;  4J6Y A;  2L3S A;  1X6O A;  2QQS A;  1QVF S;  1JJ2 P;  2FZG B;  4FL6 A;  2ZPH B;  1N8R R;  3OYY A;  1Z9Z A;  1GXI E;  3V8J A;  4CC3 A;  1H8K A;  4JUV A;  5LJ3 d;  3FRN A;  3MEV A;  1JJ2 A;  3QJ6 A;  3CCM T;  2QI2 A;  3OMC A;  1ZA2 B;  3CCV T;  4HCZ A;  3OS1 A;  1NYG A;  4PJO G;  2IVW A;  1PSE A;  4CRI A;  1FMK A;  4M77 C;  2RHZ A;  5DY9 A;  2Y4X A;  2FYK A;  4O5V A;  1OX8 A;  3NTK A;  4PJL A;  1MGQ A;  1NEG A;  5D6Y A;  3CD6 T;  1XOV A;  2J06 A;  2Y90 A;  3JCM g;  1VQM T;  2CP7 A;  1YIT T;  3SFM A;  1IB8 A;  5D6W A;  1QP2 A;  4AT1 B;  4NL2 A;  5J39 A;  4QT7 A;  4HKE A;  3OS0 A;  3NGP A;  4J9C A;  1K73 C;  2QYZ A;  4JZ4 A;  1SSH A;  2SRC A;  2A37 A;  2JMA A;  5FW9 A;  1YCY A;  4A63 B;  2RK1 A;  4ZN1 A;  1HK9 A;  1TTH B;  3L2U A;  1KG1 A;  2FVU A;  3PMI A;  5GAO l;  2EYQ A;  3C95 A;  3ZL7 C;  1VQ8 Q;  1PKT A;  1ZX6 A;  2MWP A;  3OYJ A;  2CUD A;  3G6E Q;  3HSB A;  3L2W A;  2MAM A;  2YRV A;  2VXE A;  4C92 G;  2MCN A;  4DBH A;  5I11 A;  4OMN A;  3PNW C;  1MMN A;  1RL2 A;  2M1H A;  4EIK A;  3CPW A;  2K57 A;  2DVJ A;  2J6K A;  4F7U A;  1Q86 U;  2CZ0 B;  1V1C A;  2K7A A;  1VQL T;  3TQ7 P;  2J05 A;  3CPW P;  3I56 Q;  4FT4 A;  4KH1 B;  3RIR A;  2LT4 A;  5CQX A;  1JU5 C;  3OYE A;  1T3L A;  2ATC B;  1J3T A;  3OYF A;  4LXC A;  2DBK A;  2RHU A;  3S6W A;  1X75 C;  4C5G A;  2HQE A;  5CCA A;  1YJW A;  1ZUU A;  5KYX B;  2ED1 A;  4E7K A;  2K3Y A;  2K4Y A;  8ATC B;  4V2S A;  1ZLM A;  3PVQ A;  2CZ7 B;  4Z88 A;  1GRI A;  4D8D A;  2CP3 A;  4M78 A;  5CK9 A;  1KC8 C;  2HD0 A;  3L42 A;  1SRM A;  4JJD A;  5KE3 A;  3VS3 A;  1IRE B;  3C94 A;  1AEY A;  1YI2 T;  1RI0 A;  4IUV A;  2HBW A;  2YUN A;  2A7Y A;  2O4X A;  1GL5 A;  2CP2 A;  2OJ2 A;  1YIT Q;  2XMF A;  3ZBD A;  1IRX A;  3EG9 A;  2DIL A;  1AZE A;  1UUE A;  5GMK m;  2PZ1 A;  5GAM e;  3G4S T;  3GNF B;  1PC0 A;  2V1R A;  3R6O A;  1Y07 A;  3QZ5 B;  2F2X A;  1AWO A;  4JRP A;  2P4R A;  1QVF P;  2IIM A;  3I55 T;  2YHT A;  1BYM A;  3EGD B;  2K9G A;  4FU6 A;  1VQO Q;  1VQL Q;  1V76 A;  2GTO A;  3JCM X;  4CC4 B;  1M2V B;  4ELY C;  5EG2 A;  3I5S A;  2D8H A;  4PJO C;  1GFD A;  2J7I A;  3CBP A;  1RAG B;  1K1Z A;  4C0D B;  2D6F A;  2PVO B;  5FWC A;  4L5G A;  3OW2 P;  1BI2 A;  1K4U S;  4JRI A;  3CXC A;  3NMZ C;  4OB2 B;  3HKS A;  4JPB W;  3EGU A;  1FWZ A;  3LW5 E;  5GAN 3;  3FDR A;  2PUO B;  4M75 C;  1VQ7 A;  2KE9 A;  3OS5 A;  3IQL A;  3QYH B;  1LPL A;  1WI7 A;  1M3C A;  1RAI B;  1YHQ T;  2X4J A;  5KYY B;  3EFS A;  4J9G A;  1N5Z A;  1GFC A;  1BI1 A;  2LZ6 B;  2FPF A;  3KFV A;  4JS4 A;  1UGP B;  2COY A;  3A8O B;  1WHL A;  3CCM A;  2VV5 A;  5IHN A;  2O2O A;  2LTO A;  3M54 A;  1B07 A;  1Q7Y R;  2RNA A;  1A0N B;  3OYN A;  1G5V A;  2KRS A;  3ASK A;  2K2V A;  1VQ9 Q;  2JUF A;  4UC4 A;  1HJD A;  1WA7 A;  1JBM A;  4J9B A;  3OYB A;  1WX6 A;  3QJY A;  3OYK A;  4HCK A;  3RDV A;  4KGZ B;  3T9N A;  1OU8 A;  2QA4 A;  2AT1 B;  2NUZ A;  4M7A A;  1PG5 B;  3CCS A;  1TU0 B;  4RMO A;  1ZA1 B;  4DBR A;  4WCI A;  3CCE T;  1D0Z A;  2RQU A;  2MI6 A;  3TCJ A;  1OOT A;  1K0S A;  1K76 A;  1NYF A;  3E9F A;  2A0F B;  1HXD A;  1E6H A;  2QG9 B;  1N9R A;  4LE9 A;  3OQ5 A;  3CCJ Q;  3UF4 A;  1M2V A;  3A5Z B;  1RAA B;  4K11 A;  4BY6 B;  1AOJ A;  2CSI A;  2L3Q A;  4DOW A;  2JTM A;  5HY6 A;  2V8I A;  4E7Z A;  3SWN A;  1YHQ A;  1SHG A;  2LJ0 A;  3M0R A;  1SSF A;  1M1K U;  4J6W A;  1KIK A;  3N5B B;  4XU2 A;  3CXC P;  3L1A A;  2VXF A;  1MV3 A;  1Q81 U;  5LJ3 e;  3J81 E;  1T3S A;  3MP6 A;  1BCM A;  3D7S B;  1D0X A;  3SWN B;  5A2Q E;  2MMP A;  3MP1 A;  5GAN e;  4ZNX A;  3M0Q A;  4C8Q G;  4X1V A;  3OYH A;  1O9S A;  3CBM A;  4RTT A;  1VQ4 T;  2EYX A;  4M7D D;  2YLC A;  4OP0 A;  5GAM g;  2O4X B;  1K0X A;  2HMA A;  4XAX B;  2XG8 D;  1NZ9 A;  2A28 A;  3NHN A;  1GCQ C;  2K5F A;  4A4H A;  1YNZ A;  2KEA A;  3S3N A;  5D7U A;  3L2R A;  1X6G A;  1YBY A;  4BI4 A;  2DRM A;  4DBQ A;  3L2Z A;  3DB3 A;  1S1N A;  5GMK h;  1Q82 C;  3LGF A;  3VS6 A;  4JRK A;  1SKU B;  5M9O A;  4M7D F;  2LQK A;  2VYT A;  2ECZ A;  3HFN A;  1Y0M A;  5FU7 B;  2JT4 A;  2JMC A;  3MKD A;  2X4W A;  1TSF A;  2ZPE B;  2V8K A;  1VQM A;  3GIB A;  1N8R U;  1WLP B;  1VQM Q;  4O6J A;  4RTX A;  4QW2 A;  4FYX B;  4X9D A;  2E65 A;  3JB9 F;  1OZ2 A;  1OV3 A;  1KK7 A;  3ZEH A;  2KK4 A;  2YXY A;  3DLL A;  2E3H A;  2JOY A;  3CQT A;  4M77 D;  3SWN C;  3PIO A;  2DBM A;  1R0B G;  4M78 E;  3MEW A;  2EW3 A;  5KYU B;  1ACM B;  4OB1 B;  1RLQ C;  1AHJ B;  3TU4 K;  1G8X A;  1VQK T;  1WDX A;  2RI5 A;  3NTI A;  2SEM A;  3CCR T;  2OTJ Q;  1TUD A;  4XTV A;  1QCO A;  7AT1 B;  3A8H B;  2QAS A;  2CUB A;  5CKB A;  4QQD A;  1D3B B;  1ZSZ A;  1YFN A;  3R6N A;  2XDD A;  2NUP B;  5GAO r;  4IKF A;  2E3I A;  2D0N A;  3BFM A;  3VU3 C;  3CCU T;  5CO7 A;  3UAT A;  3I35 A;  4XTX A;  1UFF A;  2E6N A;  1UE9 A;  2GBQ A;  2LJ3 A;  1VQL A;  1KD1 U;  2OAW A;  1YI2 Q;  1VQ5 T;  1WXT A;  5LJ5 f;  1N9S A;  5GAN j;  2ESW A;  1YIT A;  2EBP A;  1BBZ A;  3EAE A;  4PLL A;  4PK4 A;  4TVR A;  3CCL A;  2RM4 A;  2X4Y A;  3PVL A;  4JDS A;  3QDF A;  1QVG S;  1LOJ A;  4C0Z A;  1VQ7 T;  4HA8 A;  2C0O A;  4C8Q F;  3CCV Q;  4KGV B;  1OQK A;  4DOV A;  1NEB A;  3RMS A;  2A3L A;  4M7D C;  2ABL A;  1RAE B;  2L0A A;  1W6X A;  3LX7 A;  2AK5 A;  5CVI A;  1D1C A;  3OBW A;  4RTY A;  2CDT A;  1U3O A;  1MV0 B;  1VQ6 Q;  1X6B A;  4MZP A;  5GAN g;  4C8Q D;  4EMH A;  1FXX A;  5LJ3 h;  3JB9 I;  4N0A C;  1XTD A;  3I56 A;  4J8O A;  8AT1 B;  2OTL T;  1UHC A;  2YT6 A;  4LDV A;  2RJE A;  5GAO p;  4JRQ A;  1B34 A;  2ZAE A;  2DRK A;  3E19 A;  4PFP A;  2NUT B;  3H0H A;  1G3Y A;  4A4G A;  4D8K A;  2KDS A;  3QZ9 B;  1VOM A;  2DET A;  4M75 B;  1NLP C;  4EMG A;  1M1G A;  2JVV A;  3V7C A;  2K5I A;  1VQP A;  4LD6 A;  4RKU E;  3VKI A;  4L59 A;  3CC7 A;  2GGR A;  2HDA A;  3SEM A;  2LCS A;  4A53 A;  5GAO m;  2QEX T;  2RO0 A;  2DIQ A;  5D6X A;  4E7S A;  1YJN A;  4IUU A;  1AT1 B;  4LDY A;  2HBP A;  1QWE A;  3G6E A;  4AMC A;  3MP8 A;  2DXC A;  4OML A;  4WTO B;  2QQR A;  3A8M B;  4LUD A;  3CD6 Q;  2PNI A;  5FWB A;  2FHD A;  4J7I A;  1FYN A;  1K9M C;  1KFZ A;  4A4K A;  3RER A;  1PRM C;  1QP3 A;  4N4G A;  4OMP A;  2DNU A;  3JRZ A;  3L2V A;  1TUG B;  2QTV A;  5IHI A;  2QA4 Q;  4MDX A;  2DER A;  3M0S A;  5I22 A;  5LJ5 d;  3CMA T;  3FIF A;  1VQO A;  3EGX A;  3H8Z A;  4PJM A;  4AFZ C;  3CCJ T;  2HSP A;  5L8R E;  5I2M A;  1KC8 R;  1UJ0 A;  3NPF A;  3MHX A;  4M77 G;  3OW2 A;  4M77 F;  2EVR A;  1SF9 A;  3S3O A;  1JEG A;  1C6V X;  5FRO A;  2DX1 A;  2LMJ A;  4PNO A;  1BU1 A;  2CZ6 B;  1T0H A;  1VQ6 T;  2GNC A;  4DBF A;  4F7U G;  2VVK A;  2L89 A;  3OMG A;  1JJ2 S;  4XTW A;  2DFU A;  1VA7 A;  1X69 A;  3HP9 A;  5CKE A;  4P5N A;  1QMC A;  2ZPG B;  3CCQ T;  2EKH A;  3Q1J A;  5A0L A;  1WHH A;  4IUQ A;  1Q82 U;  1VYV A;  2M0O A;  2LX7 A;  5CR2 A;  3TRE A;  2QTX A;  1SRL A;  2F2W A;  2M02 A;  4JJC A;  2E5K A;  2HCK A;  1M3A A;  4QQG A;  1M8V A;  1WIE A;  4J9I A;  2F5T X; 
#chains in the Genus database with same CATH homology
 3X25 B;  1BI3 A;  4BE2 A;  2WSC E;  1N27 A;  2RB6 A;  4KBM B;  5LL6 S;  3CBP A;  5LJ5 g;  2QQA A;  1K8A C;  3JSC A;  1KD1 C;  4C0D B;  4QVZ A;  1Y7X A;  1Q86 C;  2D6F A;  1YJW T;  2PVO B;  4L5G A;  2K5L A;  1VQ5 A;  3M57 A;  1YJ9 A;  2L8D A;  1BI2 A;  2GF7 A;  4M7A G;  3AHU A;  4DQ2 A;  4JRI A;  4KUI A;  5GMK j;  2M16 A;  2X35 A;  2Y4Y A;  5GAN 4;  4C8Q A;  3JB9 G;  1M90 C;  2P0P A;  1UB4 A;  2PVD B;  3MEA A;  3M55 A;  3OYC A;  4M75 G;  5IAY A;  5GAN 8;  3CXC A;  4XTU A;  3KUF A;  5GAM f;  4OB2 B;  3HKS A;  3LLR A;  4E7J A;  4M7A E;  3M9Q A;  4FIB A;  2WSF E;  1KQ2 A;  3CCR A;  1FWZ A;  3LW5 E;  3LWH A;  4HT9 A;  1VIE A;  2DVE A;  1U1S A;  2PUO B;  3FDR A;  3NTH A;  4M75 C;  2DIG A;  4F7U E;  4OF1 A;  5GAN 3;  1VQ7 A;  2DO3 A;  3OS5 A;  4FSX A;  4M7A B;  2RHY A;  1Q7Y C;  3QYH B;  1TH7 A;  3MO8 A;  4M75 E;  5DLO A;  1UGR B;  3GLX A;  4PJO F;  2QQ9 A;  1M9S A;  2X4J A;  2ZPI B;  3EFS A;  2QXF A;  3HRU A;  3CMA A;  1YHQ T;  3VUZ A;  3QYG B;  1DJ7 B;  1BI0 A;  1NJI U;  2KY9 A;  2DTI A;  4NS5 A;  3KXT A;  2E1H A;  3OA6 A;  5FU6 C;  1OYX A;  1BI1 A;  3VYG A;  4LDX A;  2JNG A;  2F5K A;  3M5A A;  5J26 A;  1KQ1 A;  1UGS B;  3JCM d;  4LDU A;  3QO3 A;  4JS4 A;  3G71 T;  1UGP B;  3A8O B;  5GAO q;  2K3X A;  4PLI A;  3G6E T;  4X9C A;  3CCM A;  2VV5 A;  4C0D C;  1I81 A;  2LTO A;  4II1 A;  4PJO A;  3M54 A;  2M9U A;  2RJF A;  3UWN A;  3OYN A;  1G5V A;  3JCM h;  3JCM V;  1VUB A;  2CZ1 B;  5DLQ E;  3ASK A;  3DKM A;  3QG1 A;  2K2V A;  4KUD K;  1VQN T;  2JUF A;  4Z02 A;  2HQX A;  3QII A;  3A8G B;  4UC4 A;  4B9W A;  1Y71 A;  4BDY A;  1BKB A;  2P0K A;  3VYH B;  1JBM A;  1K9M U;  1QVP A;  5HK0 A;  3OYB A;  2DKG A;  2P4T A;  3ME9 A;  3QJY A;  5A0G A;  2E64 A;  4MZT A;  3V8K A;  3OYK A;  4MMK A;  3CC2 A;  2EJ9 A;  1V29 B;  3M59 A;  3P8B B;  3PT9 A;  3T9N A;  4LDW A;  2E5Q A;  3J80 E;  2QA4 A;  5FU7 C;  4XK8 E;  1M4Z A;  3URG A;  1M5Q 1;  4M7A A;  3CCS A;  3OW2 S;  2GFU A;  4RMO A;  2RI3 A;  3TEE A;  4ZN3 A;  3JCM Q;  5CKH A;  2EAY A;  3CCE T;  3UT1 A;  2H3J A;  4BD3 A;  2MI6 A;  3V7R A;  3WVE B;  1WQ7 A;  3BDL A;  1JB0 E;  3TCJ A;  4J6X A;  4J5Y A;  4ME7 A;  2D9T A;  4C5E A;  1BIA A;  2ZCF B;  5CAI A;  4C92 E;  3QDR B;  2EFI A;  2OTJ A;  5GMK e;  4KUL A;  5GAM d;  3E9F A;  1G3W A;  1KHC A;  1HXD A;  4C0G A;  3OYD A;  3V7S A;  3PFS A;  1N9R A;  4PKC C;  3OQ5 A;  1KQS A;  2CS7 A;  3CCE A;  5FU6 B;  1EIF A;  3C4S A;  2IG0 A;  4OB0 B;  3P8D A;  5FRN A;  4FT2 A;  2R57 A;  4JLI A;  4ZGE B;  2DZC A;  3A5Z B;  5KH6 A;  3O8V A;  4N4I A;  3CCU A;  4M7A C;  3VV0 A;  5C0M A;  2EQM A;  4BY6 B;  2OTJ T;  1JRI A;  1X01 A;  2QDY B;  2RHX A;  3FEO A;  1M1K C;  1G3T A;  3E1S A;  4LD9 K;  4DOW A;  3JCM P;  2DAQ A;  2JTM A;  2NLU A;  2JN0 A;  5HY6 A;  1KQS S;  4DA4 A;  2V8I A;  3SWN A;  4C5I A;  1S72 T;  1UEB A;  1WPY A;  1YHQ A;  1Q81 C;  3OSV A;  2DTO A;  5C6S A;  4QVC A;  3OBY A;  4RG8 A;  1SSF A;  4OVA A;  4RCC A;  1M1K U;  3CCL T;  4GY5 A;  2XIC A;  4IUT A;  2RK2 A;  3OYI A;  1ZQ1 A;  4MZM A;  4J6W A;  1PSF A;  3QHS A;  3N5B B;  4M7D B;  4XU2 A;  4X34 A;  3L1A A;  4QQ6 A;  3CME A;  2VXF A;  5GAN 6;  3CC7 T;  4QVD A;  1WJQ A;  2PVG B;  4Q5W A;  4VUB A;  1Q81 U;  3OS2 A;  2LQ8 A;  5LJ3 e;  3J81 E;  2XHC A;  1OZ3 A;  4MML A;  1NPP A;  4BI3 A;  3MP6 A;  4ELZ C;  5CKD A;  4R55 A;  3JB9 J;  3CD6 A;  3SWN B;  4KT0 E;  4MDW A;  2LCC A;  4M7A D;  4EMK B;  2EJF A;  5A2Q E;  1QVG A;  2MMP A;  3MP1 A;  5GAN e;  4PJO C;  3SDZ A;  4C8Q G;  4Y91 A;  1FX7 A;  3OYH A;  4OB3 B;  1O9S A;  5DM7 R;  2E10 A;  3CBM A;  1VQ4 T;  2RJC A;  2HNI A;  4M7D D;  2YLC A;  1WQW A;  2FB7 A;  3HRS A;  4OP0 A;  5IN1 A;  5GAM g;  2O4X B;  2XI9 A;  1U1T A;  2DEQ A;  4XTY A;  2QQB A;  4BUG A;  4XAX B;  3CC4 A;  2ZPF B;  3JB9 H;  2XG8 D;  4J7F A;  1NZ9 A;  3RKW A;  4PJO B;  2K5F A;  1WJS A;  1WGS A;  2GCX A;  4A4H A;  4C92 B;  3QSU A;  4HT8 A;  2B8A A;  5LJ3 j;  3S3N A;  2KVQ G;  4A4F A;  3L2R A;  2LRQ A;  3OYA A;  5AYF A;  2E41 A;  3QBY A;  1YBY A;  3RKX A;  3X20 B;  3CEY A;  3JCM J;  3BW1 A;  4JS5 A;  2DD4 A;  4BI4 A;  3I55 A;  4XU0 A;  1I8F A;  2PU9 B;  3L2Z A;  3DB3 A;  4EPC A;  3OYM A;  5GMK h;  3HL8 A;  5HKC A;  1Q82 C;  3LGF A;  5LJ3 f;  3OSS C;  4JRK A;  4NOY A;  5M9O A;  4M7D F;  3CC4 T;  2LQK A;  2VYT A;  3FJP A;  3GPL A;  3UPU A;  3HFN A;  1M1F A;  5FU7 B;  2DK3 A;  1KHI A;  2X4W A;  2F69 A;  3M4G A;  4M77 B;  1D3B A;  2ZPE B;  5GAN f;  2V8K A;  1VQM A;  3GIB A;  1N8R U;  1VQO T;  2CKK A;  2RHI A;  4F7U F;  3F70 A;  3PTA A;  4ZTF A;  3M58 A;  4O6J A;  2VGM A;  3LGL A;  4QW2 A;  4X9D A;  4C8Q B;  4PJO E;  2E65 A;  2XU8 A;  1ZBX A;  3JB9 F;  1OZ2 A;  3ZEH A;  2KK4 A;  4ATO A;  3FC3 A;  4Y28 E;  1K8A U;  3BY7 A;  5KCH A;  3S3M A;  2RD1 A;  3G4S A;  4M75 A;  4C92 C;  3ZFJ A;  2MWO A;  3DLL A;  5FRM A;  2XDB A;  3SD4 A;  4N4H A;  2JOY A;  2R5A A;  4M77 D;  3L2Q A;  3E9G A;  1VQ6 A;  3SWN C;  3PIO A;  3JCM c;  2LCL A;  5GAN 7;  2RI2 A;  4BE0 A;  2MF2 A;  1Y96 A;  3RES A;  1M90 U;  2C06 A;  4M78 E;  4BAC A;  5CKF A;  1N8R C;  3MEW A;  3V8L A;  3GNG A;  4OB1 B;  2EWN A;  3RMQ A;  3GOX A;  4A4E A;  2QEX A;  4J83 A;  1YJN T;  4C5H A;  1AHJ B;  2FL7 A;  3TU4 K;  3X26 B;  4HCC A;  4E7I A;  1VQK T;  1Y96 B;  4XU3 A;  2R58 A;  2E70 A;  1BIB A;  2RI5 A;  4M7D E;  3NTI A;  3CCR T;  4XTV A;  4F7U B;  3A8H B;  3J7A F;  1VQ8 A;  3WVD B;  4WF2 A;  4J6Y A;  5CKB A;  4QQD A;  3HHT B;  1X6O A;  1D3B B;  2QQS A;  5GAN d;  2X4X A;  1QVF S;  2E6Z A;  2L5Q A;  4BB7 A;  4FL6 A;  2ZPH B;  2XDD A;  3OYY A;  3JCM W;  1GXI E;  2I2L A;  3V8J A;  5GAO r;  4M78 G;  4IKF A;  3VU3 C;  4CI0 C;  1NE8 A;  3BFM A;  4JUV A;  5LJ3 d;  3CCU T;  5CO7 A;  3FRN A;  2L3R A;  2ZPB B;  3MEV A;  4C8Q C;  4R56 A;  1JJ2 A;  3QJ6 A;  4XTX A;  3CCM T;  2QI2 A;  3OMC A;  3CCV T;  1LJO A;  4HCZ A;  3OS1 A;  2BKD N;  2E6N A;  1YI2 A;  3RUX A;  2XID A;  3SB2 A;  1VQL A;  1KD1 U;  4PJO G;  2IVW A;  1PSE A;  3H6Z A;  4CRI A;  3LWI A;  5A0D A;  5LJ5 f;  1VQ5 T;  1N9S A;  4E7L A;  5GAN j;  5CQY A;  4NL3 A;  3OY9 A;  1YIT A;  1ZHI A;  3BDU A;  3C12 A;  1QW1 A;  3EAE A;  1VQ9 T;  4PLL A;  4TVR A;  4M77 C;  3CCL A;  2ZZD A;  3DB4 A;  3PGG A;  4IUR A;  4M75 F;  2RHZ A;  2RM4 A;  2X4Y A;  1I4K 1;  2VGN A;  3G7Z A;  4JDS A;  4M77 A;  1P92 A;  1QVG S;  1QVF A;  1B34 B;  1LOJ A;  5DY9 A;  3M56 A;  2Y4X A;  2FYK A;  4E7H A;  4C0Z A;  4O5V A;  1VQ7 T;  4EDU A;  3NTK A;  4HA8 A;  4C8Q F;  3INZ A;  1W2B A;  4E47 A;  4XU1 A;  2KMT A;  4DOV A;  1MGQ A;  5D6Y A;  3RMS A;  3WXM B;  1XOV A;  2A3L A;  2Y90 A;  3CD6 T;  3JCM g;  2DPP B;  5GMK i;  3JAM E;  1VQM T;  3QKJ A;  3VJP A;  4M7D C;  1YIT T;  3SFM A;  4M78 B;  3LH0 A;  3LX7 A;  4OGE A;  4RCB A;  5D6W A;  1QP2 A;  4M7D A;  5CVI A;  4NL2 A;  5J39 A;  2DXT A;  5I21 A;  3OBW A;  5LJ5 e;  5GAO m;  4HKE A;  4C92 A;  3OS0 A;  2D0Q B;  1K73 C;  4HCB A;  2OAU A;  4BDZ A;  4RG2 A;  5IT9 E;  2O01 E;  4MZP A;  4N0A A;  5GAN g;  1OI1 A;  4C8Q D;  4EMH A;  1FXX A;  1YCY A;  2RK1 A;  5LJ3 h;  4ZN1 A;  4C8Q E;  2KSS A;  3QUI A;  3M53 A;  1XNI A;  1XTD A;  4N0A C;  3JB9 I;  3I56 A;  1H64 1;  4J8O A;  1HK9 A;  2OTL T;  3L2U A;  1KG1 A;  5LJ3 g;  4LDV A;  2FVU A;  5I2S A;  4JLG A;  2RJE A;  5GAN h;  2AHJ B;  5GAO p;  3CPW S;  4JRQ A;  3PMI A;  5GAO l;  3JCM b;  2EYQ A;  2KAF A;  2VUB A;  2LNV A;  1B34 A;  4D6W A;  3C95 A;  4OGC A;  5GAM j;  3E19 A;  1I5L A;  1N6A A;  5CIU A;  2MWP A;  3OYJ A;  5HK3 A;  3HSB A;  4M7A F;  2BIV A;  3A8L B;  3L2W A;  2MAM A;  2YRV A;  3NFC A;  1Q7Y U;  1G3Y A;  4A4G A;  2VXE A;  2KDS A;  3QXE B;  4C92 G;  4XQ3 A;  3DLM A;  3QZ9 B;  2OTL A;  3PNW C;  1RL2 A;  4M75 B;  4M78 C;  2M1H A;  2PQW A;  1UGQ B;  2GFA A;  1M1G A;  4EMG A;  2JVV A;  3CPW A;  2LC4 A;  2K57 A;  3GF5 A;  3V7C A;  2K5I A;  1VQP A;  4LD6 A;  4RKU E;  3VKI A;  3UDC A;  3CBO A;  4L59 A;  4BY6 C;  1H3Z A;  4F7U A;  1Q86 U;  1O75 A;  3CC7 A;  4C92 F;  2KQW A;  2G3R A;  2CZ0 B;  3RKY A;  1VQL T;  4ZGJ B;  2EJG A;  5GAO n;  2DTH A;  4FT4 A;  4M75 D;  4PL6 A;  4A53 A;  3HRT A;  2LT4 A;  2RO0 A;  2DIQ A;  5CQX A;  5D6X A;  2ZGW A;  4IUU A;  3RIR A;  2QEX T;  2EQK A;  4LDY A;  1IZ6 A;  2DZ9 A;  2HBP A;  3OYE A;  1YIJ A;  3G71 A;  1VQK A;  1G3S A;  3G6E A;  1VQ4 A;  4BE1 A;  3MP8 A;  2DXC A;  3OYF A;  4M78 F;  1VQP T;  2LVM A;  2RHU A;  2QQR A;  3S6W A;  1VQ8 T;  1X75 C;  4C5G A;  2HQE A;  3A8M B;  4YTL A;  3FB9 A;  3X28 B;  2EKO A;  2RA2 A;  4BI8 B;  5CCA A;  2FHD A;  3OYG A;  1YJW A;  4J7I A;  1S72 A;  4PJO D;  1VQN A;  2DD5 A;  1YJ9 T;  3OB9 A;  4E7K A;  2K3Y A;  2K4Y A;  4IUP A;  4C92 D;  1K9M C;  1NJI C;  4V2S A;  4A4K A;  3RER A;  3FLG A;  1XQH A;  2CZ7 B;  4OMF B;  2LDM A;  4M77 E;  1QP3 A;  5GMK l;  2LX9 A;  3CCJ A;  4N4G A;  2XD0 A;  2LT1 A;  1VIF A;  4M78 A;  5CK9 A;  3JRZ A;  5LJ5 h;  1KC8 C;  2JTF A;  3L2V A;  1R8O B;  2HD0 A;  3L42 A;  3JCM f;  1NPR A;  3VUB A;  1WJR A;  2YLB A;  3ER0 A;  3MEU A;  5KE3 A;  1K73 U;  5FLX E;  3PMT A;  2QA4 T;  4MDX A;  3OYL A;  1IRE B;  3C94 A;  4M7D G;  3CME T;  4M78 D;  3CCS T;  1YI2 T;  1LNX A;  1RI0 A;  4IUV A;  5LJ5 d;  3X24 B;  2A7Y A;  2O4X A;  2WSE E;  3CMA T;  2R5M A;  3FIF A;  3HFO A;  2XDP A;  5KCO A;  1VQO A;  3H8Z A;  1U8R A;  2WAC A;  3CCJ T;  3EFR A;  5L8R E;  3ZBD A;  5I2M A;  4EMK A;  4C0F A;  2P0Q A;  2V8J A;  2CGH A;  3MHX A;  3MCA B;  5GMK m;  2RH2 A;  3KBG A;  4M77 G;  3OW2 A;  2BUD A;  3CXC S;  4M77 F;  2XKO C;  1YJN A;  1W2B S;  3S3O A;  5GAM e;  3G4S T;  3LYI A;  5GAN 5;  3GNF B;  3R6O A;  2CYZ B;  5FRO A;  4L6V 5;  4PNO A;  1Y07 A;  2CZ6 B;  1VQ6 T;  1W4S A;  3GP8 A;  3JCM e;  4B9X A;  3QZ5 B;  4F7U G;  1WNL A;  4ZTJ A;  2L89 A;  3OMG A;  3P8H A;  4JRP A;  1JJ2 S;  4XTW A;  1VQ9 A;  5CKE A;  3HP9 A;  3I55 T;  4P5N A;  2EIF A;  3JB9 D;  1KC8 U;  2ZPG B;  3MET A;  2E12 A;  3CC2 T;  1MHN A;  4A54 A;  3CCQ T;  2PUK B;  3Q1J A;  5LJ5 j;  5A0L A;  2YHT A;  1BYM A;  4IUQ A;  4FU6 A;  1Q82 U;  2JZ2 A;  2M0O A;  4ZGD B;  5CR2 A;  4JJN K;  2GQV A;  3TRE A;  5KE2 A;  2QTX A;  4EMK C;  3I56 T;  2EQJ A;  2DXU A;  3JCM X;  5GAN 2;  3PIP A;  3CPF A;  5J3B A;  2RJD A;  2DJZ A;  4XTZ A;  2HAX A;  2EQU A;  2XK0 A;  3HPW A;  1YIJ T;  4ELY C;  4QQG A;  3CCQ A;  4FM4 B;  5EG2 A;  1M8V A;  4GLK A;  2DXB A;  3QPH A;  5GAM h;  3M4Y A;  3CCV A;  2VC8 A;  2F5T X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...