3UWNA

The 3-mbt repeat domain of l3mbtl1 in complex with a methyl-lysine mimic
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
324
structure length
318
Chain Sequence
b'ECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein 1
publication title The 3-MBT repeat domain of L3MBTL1 in complex with a methyl-lysine mimic
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 80
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3uwnA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3uwnA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3uwnA03
2IG0A 3OYAA 3GOXA 3LGFA 3PNWC 3E9FA 1N27A 3MEAA 3OS1A 4A4GA 3META 3OS0A 4HCZA 4QQ6A 3OYCA 3FLGA 2EQJA 3FEOA 1SSFA 4N4HA 2BUDA 2RHXA 4NS5A 4OVAA 5FROA 3M9QA 2RO0A 3BDLA 2GFAA 1OZ3A 2K3XA 2RHYA 2LRQA 2QQSA 4X34A 5KE2A 2XK0A 5J39A 5CIUA 5C0MA 5IAYA 3PFSA 5FRMA 2EQUA 3QKJA 1G5VA 2LTOA 4Z02A 3LYIA 3PMTA 1MHNA 4IUTA 3OYDA 4IKFA 3LGLA 2RI5A 3MEVA 3MP8A 4BE2A 4A4EA 3OY9A 3S3NA 1XNIA 2BIVA 3OQ5A 3FC3A 4C5HA 4E7KA 2E6NA 3FDRA 3QJ6A 4B9WA 5J26A 4GY5A 3L2WA 3E9GA 2E5QA 3LX7A 3MEUA 4II1A 2G3RA 2K3YA 2QQRA 5D6YA 2DAQA 4N4GA 4C5GA 4BDZA 5KCOA 3UWNA 3OYIA 2L3RA 2X4YA 3DB3A 3H8ZA 4BE1A 2X4XA 4E7JA 2LCCA 5FRNA 4UC4A 3DLMA 3SD4A 3P8HA 4A4FA 4E7HA 2L8DA 2RJCA 2R57A 5IN1A 2M1HA 2F5KA 3OMGA 4L59A 2RI2A 3DB4A 3MEWA 4A4HA 5KH6A 5M9OA 2O4XA 2RHZA 4FU6A 4CRIA 1WJSA 3OB9A 1OZ2A 5D6XA 2JZ2A 3L2QA 2MWOA 4PL6A 3P8DA 3ME9A 2LDMA 2FHDA 3QIIA 3OYJA 3OYKA 3OYFA 3L2UA 4BACA 3NTHA 2WACA 2RJDA 1KHCA 4IUVA 4C5IA 5KCHA 3S3OA 2R5MA 2RHIA 4ZTJA 5C6SA 4ZTFA 3F70A 2LVMA 3H6ZA 4BD3A 4BDYA 4RG2A 1WJQA 2RI3A 3MP1A 4QQDA 3UT1A 1WJRA 3Q1JA 2DIQA 2MWPA 3OA6A 2R58A 3OMCA 3L42A 2L89A 3LH0A 3C4SA 4IUUA 3ZEHA 1OYXA 2M0OA 4FL6A 1OI1A 2X4WA 2BKDN 2EKOA 4B9XA 5KE3A 4PLIA 5D6WA 2X35A 4LD6A 4E7IA 2PQWA 2CKKA 2HQXA 2O4XB 3L2VA 2VYTA 1H3ZA 2NLUA 2RJEA 2XDPA 3NTKA 2GFUA 2EQMA 4IUPA 4PLLA 4QW2A 3CEYA 4E7LA 4QVZA 3S6WA 3O8VA 2HQEA 4Q5WA 3KUFA 3EAEA 3OYLA 3OYGA 2EFIA 2R5AA 2YRVA 2B8AA 3MO8A 3OYEA 3S3MA 3OYHA 1WGSA 3ASKA 2EQKA 2JTFA 2RJFA 2RHUA 3OYNA 4N4IA 3L2RA 3MP6A 3QBYA 4EDUA 3OS2A 2DIGA 4C5EA 4IURA 3OYMA 1RI0A 3OYBA 2M16A 2D9TA 3LLRA 3NTIA 4BE0A 3PMIA 4IUQA 2P0KA 2GF7A 4QQGA
chains in the Genus database with same CATH superfamily
3LGFA 1LCKA 5KYWB 1NG2A 3I56T 3M58A 3GPLA 2ZAEA 2BUDA 5LJ3f 4EMKC 1AWXA 1MMNA 4M75G 2KXDA 4XAXB 5CIUA 5C0MA 1BYMA 1GBRA 2JM8A 4Z02A 3OYDA 1W2BA 4M77G 1NJIR 2J05A 2ED0A 1QVFP 3EHQA 1D09B 1IGQA 3OYYA 1KIKA 5GAMj 1K8AC 4GY5A 4GLKA 1IREB 4JRQA 2HNIA 3CCQQ 4BE1A 2LCCA 3V8LA 4DOWA 5I11A 2KI7A 5GAMe 4OB0B 3VKIA 1Q7YR 2E6ZA 2DF6A 2PTKA 3A8GB 2CT4A 1ARKA 5CKDA 1WXUA 2HDAA 3RNJA 4FU6A 4MMKA 2MWOA 4CC2A 3RKYA 3HL8A 4M78G 1KD1U 4J8OA 2BE9B 3CXCP 4OGEA 1QVGS 4LE9A 1XOVA 1M8MA 1TSFA 3CMEQ 1WJRA 2C06A 1NLOC 4F16A 2OTLA 1YN8A 2DRKA 2K6DA 3TREA 1I5LA 2H8HA 3FB9A 2RMOA 2LCSA 3L2ZA 2VYTA 4C92B 5KYYB 4M7AG 2QXFA 3KUFA 3V7RA 2WSCE 1RAHB 1RL2A 4LDYA 3QWXX 2GNCA 2JTFA 1MUZA 1PSFA 1H641 4IURA 5GANj 2O88A 3WVDB 3M0UA 3CCVT 3OYAA 5EC7A 2LX7A 2WSFE 3PT9A 4GLMA 1YWOA 2PVOB 2X51A 4XU3A 4A4GA 2LX9A 4OVAA 1K9AA 1AWWA 2E3HA 4MZTA 3JV3A 2RN8A 4J6WA 3PMTA 2Y90A 2CP0A 2HKQB 3CCVA 4BE2A 4PJMA 5CO7A 1NYFA 5GAOq 2O31A 2KDSA 2LQNA 2LT4A 1RAGB 4LDWA 3CC7Q 4R56A 1S72Q 1V29B 3RMSA 3OW2S 1YHQT 3GF5A 2EBPA 1K9MR 3HFOA 3EG9B 2DNUA 1PM3A 4C5GA 2DILA 3H8ZA 5HK3A 4C8QF 3EFSA 3HP9A 4XU2A 2KE9A 3DLMA 4E7HA 2QQAA 2P0PA 1SPKA 1HSQA 1JJ2A 2RHZA 5KYXB 2B86A 3HHTB 2C0OA 1MV0B 4M75B 1VQ5T 4DOVA 1AZEA 2CZ0B 2A08A 2V8JA 3BE3A 4TVRA 3CCLA 4M77B 2VUBA 5IXFA 1R77A 1ZUKA 1WPYA 3H6ZA 2F1LA 1H3HA 4FT4A 1N9SA 2K5LA 4HXJA 3JCMJ 5A0GA 2E64A 2DLPA 1FYNA 4E7ZA 1UEBA 3CCRT 1J3TA 1HD3A 2NYSA 4RUGA 5D6WA 1H3ZA 1R8OB 1VQKQ 2JTEA 2FRWA 2HAXA 3M0RA 2AZVA 3S6WA 2AK5A 1U3OA 4M78B 1I8FA 3QUIA 4OGCA 3ASKA 5CQXA 2RJFA 3EH1A 4B6MA 1X01A 4KBMB 2GF7A 2DK3A 4AFUC 3CMAQ 3CC2T 1OX9A 1JJ2S 5LJ3j 1MNDA 4R0KA 3REBB 4M77F 2VVKA 4BI8B 3CCEA 1G5VA 4XTVA 1EZZB 3GNFB 4LN2A 4M7AB 3E1SA 1G8XA 5LJ3e 3LGLA 3MP8A 1B3QA 1YNZA 4A54A 2BIVA 2V1RA 4PJOG 3CC2A 3E9GA 2E5QA 5GAOr 5D7UA 2YRDA 2K3YA 5D6YA 4BB7A 2HQHA 1PC0A 1WHMA 5IT9E 1RADB 2K57A 3CD6T 1T3LA 3RKWA 2YUOA 2PUOB 8AT1B 2F5KA 1WA7A 3CPWA 3DB4A 5FLXE 2FRYA 2QEXT 1D3BA 2JZ2A 3OS5A 1D1AA 3TCJA 3S3OA 2KNBB 1K76A 4FYVB 1C0MA 5GAN8 2M0YA 2J6OA 2MPXC 2RI3A 2GTJA 3G1JA 2DX1A 3UA6A 3CCUT 3HPWA 3L42A 4ZN3A 3R6NA 2A37A 1ABOA 2RNAA 4WF2A 2E70A 1H8KA 2EKOA 4FYWB 4KUDK 3JCMV 4PLIA 1JO8A 2PQWA 2DM1A 1MGQA 4QVZA 4JLIA 3HRTA 4RKUE 2ZPIB 1VQMT 3VRZA 3CC4Q 1QQJA 1VQNQ 3M59A 1YJ9A 4LUEA 1AZGB 1UJ0A 2DEUA 1ABQA 1WHGA 4RTUA 1IXDA 2YWWA 2KAFA 3OW2P 3RMQA 3PE0A 2IG0A 3CPWS 2E10A 4AFSC 3NPFA 1YITT 1VQMA 1M90R 3FLGA 2FPEA 4F7UE 4JS4A 3NMZC 3PIOA 1X75C 1M8VA 1JU5C 1QVFA 4F14A 2OTJA 3EG0A 2D8JA 2XD0A 4LDVA 5GJVB 3QO3A 4HVUA 1NPRA 1T3SA 1YITA 5EG2A 5LJ5h 1VYTA 1AT1B 3RUXA 3OYIA 3G71T 1VIFA 2ROTA 1K73U 2CP5A 4KRTA 1UHFA 4JRPA 2COZA 2BZ8A 1VQ6Q 3JB9G 4XTXA 2QA4T 1VQ7A 4J9FA 3CXCA 2WACA 2RJDA 2X3WD 4C5IA 1YJWT 3X24B 5C6SA 5LJ5f 2CZ1B 2MCNA 3I56Q 3MCAB 4PJOB 3I5SA 2QG9B 3H41A 3LH0A 4BY6B 3C4SA 2EIFA 1GFCA 2L0AA 1LOJA 1WXTA 1PD1A 5KE3A 3QJYA 4HA8A 1AWOA 1GFDA 4LD6A 1QVFS 1VQ8Q 1YJWA 3NTKA 3CEYA 2ZZDA 2BTTA 3HSBA 1KC8R 2EJ9A 1RACB 2EYXA 3JCMg 1AEYA 1LPLA 2GGRA 3L2RA 3VS3A 3TVTA 4A4KA 2EWNA 2W0ZA 1Q86U 4IUQA 4PFOA 3KBGA 4M7DE 2FO0A 3PNWC 1N27A 3JCMc 3E2UA 3META 4F04B 1ZSZA 5J3BA 1N5ZA 3M9QA 2QQ9A 3SWNC 5FU7B 3CXCS 4M7DD 2EQUA 3TQ7P 5GMKl 2CH4A 5L8RE 4V2SA 2CDTA 5GMKe 3PTAA 4LDUA 2QK0A 1ZLMA 2V26A 4AFZC 2NUTA 4X9CA 3LX7A 2VWFA 3MEUA 2D8HA 1O75A 2KVQG 2DL4A 3HRUA 2KXCA 1D0XA 2X4YA 3I9QA 1XTDA 4LXCA 1KD1R 1N8RR 4LD9K 4O5VA 3OMGA 2HL5C 4DQ2A 2D0NA 2O4XA 5D6XA 1X2KA 2JW4A 4J6YA 3M56A 4F7UA 1UTIA 4BACA 7AT1B 3NTHA 5ECAA 4FIBA 1GCQC 3EGUA 4PFZA 2RK1A 1I07A 4N0AA 1X69A 1RLPC 4JJCA 1KQ1A 4IUUA 4JJBA 5HKCA 3JAME 1KJWA 1VQ4Q 1M2OA 2KROA 4C8QG 1GBQA 5GAN6 1Q82C 2OI3A 2E4HA 3V7CA 2A3LA 2EPDA 4FYYB 1X43A 1Y96A 3O8VA 1YHQQ 2E65A 5FW9A 2BE7D 2XG8D 2E5KA 1X2QA 2XDDA 2MYSA 4FSSA 4OMQA 1WGSA 2KGTA 1JEGA 3VRYA 2E3IA 1EIFA 3MP6A 3OS2A 1Q86C 2DFUA 4ORZA 1OU8A 3VYGA 1NEGA 3EFOA 3NTIA 1U5SA 2RQWA 2LNHB 3EGDA 1VQ5Q 1E7OA 2G6FX 4X1VA 3OS0A 4HVWA 3CCMA 3OS1A 1VQOQ 2RHYA 4ANJA 2XK0A 5IAYA 1YCYA 1Y07A 2IVWA 4PJJA 4FW1A 5GAN5 3H0FA 1I81A 5FWBA 3M55A 2EAYA 5J26A 3C0CA 3CCRQ 1PRLC 2IIMA 1HJDA 4Y91A 3OSSC 4ZN1A 2HEQA 2PVDB 1BCMA 3X20B 3JB9F 4M7DA 3J81E 3V8KA 3HRSA 2VGNA 1BBZA 4L5GA 3ER0A 4NOYA 1W6XA 1B34A 1NE8A 2VC8A 3UA7A 5LJ5j 5DLOA 1KQSS 1KK7A 5KYUA 1UUEA 1JXMA 3CC2Q 2VB6A 1CSKA 2LVMA 1W70A 1X27A 2O9VA 4RTYA 5LJ5e 1RAAB 2LJ3A 5A0LA 3ZL7C 2OTLT 1UHCA 8ATCB 3SHWA 2E41A 1VQLA 1UGPB 4RTXA 2KYBA 2NLUA 5CKHA 2DXBA 2DL8A 5IHIA 2Y4XA 2FVUA 3A5ZB 1M1KU 2YRCA 1FMKA 2DJZA 2GTOA 1M2VA 1WQWA 1RI9A 2HKNA 3VS4A 3CD6Q 4OP0A 3QBYA 3OW2A 4LNPA 2YHTA 1YI2T 3EG3A 1RAFB 4BE0A 3M53A 2QEXQ 5I21A 3GLXA 2P4TA 1G83A 3G4SA 1I5OB 4AG2C 5GAOn 3A1PA 4C8QB 2DVEA 2OJ2A 3QKJA 1ZBJA 2LMJA 3HTRA 5HY6A 3IQLA 3CCUQ 3CBMA 5GAN3 1YI2A 1IB8A 2LP5A 1E6GA 1QVPA 1XQHA 2CP7A 1OEBA 1T0HA 1ZSZC 3X28B 5KCOA 5GJWB 3UWNA 2MK5A 4BUGA 5GANe 2WSEE 2PVGB 2LT1A 5I2MA 2QASA 2DPPB 1VQMQ 2DL5A 5FRNA 2VASA 2L8DA 4EMKB 2RQRA 2HMAA 4Z89A 4CRIA 2IPOB 1PG5B 2ZPEB 1JQQA 1Q81R 4BI4A 3OYFA 2DXUA 3CCLT 4ELYC 2RQTA 3F70A 2HD0A 4E6RA 4XU0A 2EQIA 3PVLA 3FRNA 3OA6A 4MZMA 3MHXA 3LWHA 3OBWA 1OI1A 1I0CA 2X4WA 3I5RA 4B9XA 1KFZA 1WXBA 2RK2A 4J9CA 1YJNT 1M3BA 2K4YA 1QWFA 1OPLA 4J7IA 4E7LA 3VJPA 4C92E 2L3SA 1M1KC 2O01E 3M4GA 1EX4A 5LJ3g 1M3AA 1WDXA 2QTVA 4N0AC 3G71Q 1VQPQ 2CREA 1CKAA 3H0IA 3VUBA 3OYNA 4N4IA 4C92D 3QXEB 3VU3C 1VQ9T 1RI0A 3CCJA 3CQTA 2M16A 3H0HA 2QYZA 2HZYA 2ATCB 4C8QD 3INZA 1YJNA 1WX6A 1OPKA 2CP6A 1HK9A 3URGA 2QA4Q 1WHKA 2DL3A 2KRSA 3J7AF 4KGXB 2PZ1A 4NS5A 2P0QA 3EGXB 5CKFA 2RO0A 3X26B 2GFAA 2ZPFB 3SWNA 1X6GA 1N9RA 1D1CA 3PFSA 3CCET 4JS5A 1G2BA 2QGFB 2VXEA 3VS2A 3QG1A 1UGRB 1VQ9A 3CBOA 1YBYA 4K11A 3OY9A 3S3NA 1U8RA 1MMGA 2BZXA 1KQSP 2XMFA 3PIPA 3M0PA 4B9WA 1K73R 3VS1A 4FYXB 1WLPB 4N4GA 2DEQA 1NBEB 1JB0E 2JMCA 5GAN7 1Y57A 4XTYA 5IN1A 4KH0B 4L59A 4MZPA 2DYBA 5KH6A 5KYWA 4ME7A 2F2VA 2KYMA 3L2QA 1OZ2A 4M75E 4IIMA 1QKXA 2LDMA 3OYJA 4X9DA 3CCQT 4HCKA 3L2UA 1GCQA 3MJXA 4M77E 5I22A 2NUTB 2K5IA 4QVDA 2SRCA 3JCMh 2HSEB 4QQDA 5LL6S 3UPUA 4M75D 4C0GA 2R58A 1FWZA 3RR6A 4M7DC 2JTMA 3JCMd 4LDXA 4M77D 2BKDN 4D8KA 3CCQA 1TUCA 1SSHA 2YDLA 3L2VA 2O4XB 5GAN2 2XDPA 1ZUUA 1NPPA 2NWMA 4NL3A 1M30A 1V1CA 2HQEA 1Z9ZA 3DLLA 1EFNA 2YRVA 3MO8A 3JCMf 4QVCA 2ED1A 4EMHA 2QTXA 2LJ1A 3LW5E 4DBQA 5GMKm 1PKTA 5DY9A 3OSVA 4M78E 4F17A 1X6BA 2RHUA 1YJ9T 3M0QA 1XJWB 1VYUA 2JT4A 2P0KA 4QQGA 2F2WA 4M78D 1BI1A 3CMEA 4ATOA 2CZ7B 2W10A 1VOMA 1TTHB 2CP2A 2VKNA 2LTOA 1Y96B 1MHNA 1K9MU 4IKFA 1BK2A 1YFNA 1P92A 4M7AE 3RERA 4C92A 5KYYA 1R0BG 2OTJT 2MAMA 4AFQC 2E6NA 3FDRA 5CCAA 2MI6A 4J9GA 1JBMA 1BIAA 2G3RA 4M7AD 2QDLA 3ZBDA 4VUBA 3GIBA 1K8AR 4E47A 5M9OA 2QDYB 2PUKB 1S72T 2ABLA 4PK4A 3P8DA 3PVQA 2V8IA 2ZCFB 5KCHA 3G6EQ 1VQ7T 3V8JA 1Y71A 1WJQA 2H3JA 1C6VX 2EJFA 4ZGDB 3CC7A 1ZQ1A 1S72A 1FXXA 2CP3A 1VYVA 1Y0MA 1GRIA 3EG9A 2KBTA 2EGAA 2EYZA 5AYFA 2GQIA 2P84A 2AKKA 1A0NB 2EYWA 2Z0WA 3I35A 1QCFA 2ZPGB 4XU1A 5GAMd 3OYLA 3QDRB 5KYUB 4J7FA 2FYKA 2EGEA 2CUDA 4M75A 2EKHA 2AT1B 2AHJB 4QT7A 4RCBA 3OYMA 1YCSB 2KSSA 2BZYA 3LLRA 1JXOA 2I0NA 2DRMA 4RTZA 4C0DC 2RM4A 4MDXA 1QMCA 1Q82U 4A53A 4XQ3A 4Z88A 1D0ZA 4DBRA 1PNJA 3G7ZA 1K9MC 2C0IA 2QQBA 3QDFA 4DBHA 2D6FA 2RB6A 3ULRB 1F1BB 1VQKA 5IHKA 3CMAT 2OTLQ 3FC3A 4C5HA 4M7DF 1M3CA 3L2WA 2DXTA 2V8KA 2K7AA 4DEYA 1H92A 4II1A 4M78A 1QW1A 1U06A 2RH2A 1M9SA 1UECA 2L3RA 3THKA 3VYHB 4ZNXA 3GP8A 4OMPA 2RD1A 1V76A 4RCCA 5A0DA 2X9HA 4HVVA 3CMAA 2DL7A 4A63B 5CR2A 3OB9A 2DVJA 3UF4A 2YLBA 1Q95G 3JCMQ 2KT1A 3JB9H 1YI2Q 1Y7XA 4ZTFA 3NHNA 3I55T 4M7AA 1ZX6A 4J5YA 2YUNA 2PNIA 4PKCC 4PJOE 2KT8A 2KK4A 3ZEHA 2DZ9A 1OYXA 1TXQA 2FZGB 5DM7R 1M1KR 1HYOA 3WXMB 3E19A 4PJOD 2FPFA 1TG0A 3CCVQ 1BCOA 1SG5A 2GFUA 3EG2A 3I55A 3VUZA 2R5AA 1YP5A 2FZCB 2KRNA 1HXDA 2DO3A 2DKGA 1BB9A 3OYHA 2KY9A 1AWJA 1OU9A 1CKBA 2FL7A 4C5EA 1ZBXA 3QYGB 5GMKi 4CC3A 2DTOA 2SEMA 2J06A 1SSFA 3CCMT 3SDZA 4X34A 3CCLQ 4EPCA 3QZ9B 3EH2A 3NGPA 5I2SA 4LUDA 4AMCA 1N6AA 1JRIA 1K0SA 2VGMA 2QAZA 1KQSA 1OULA 5IHNA 3OQ5A 5L23A 2FG0A 3CC4A 3JCMW 4KUIA 2O9SA 1VQNA 1YJNQ 1AHJB 3CCST 5GAMg 4KULA 5LJ5g 2YXYA 3DB3A 2JNGA 4RMOA 2ESWA 4A4FA 1RAIB 2M1HA 3SWNB 1T0JA 3MPUB 4A4HA 2MF2A 4C92C 4XTWA 1FMWA 3J80E 3VS5A 1VQ9Q 1G3SA 2NUPA 3ME9A 1QCOA 5GAOl 2M51A 1QWEA 4IUVA 2DTHA 2RA2A 1UGQB 3CPFA 3CCSA 2DZCA 1OOTA 2CUBA 2DBKA 4RG2A 3MP1A 4D8DA 5LJ3d 4OB2B 2JS2A 1VQ6T 1QP3A 2L89A 1TWBA 2DD5A 3CCEQ 3JCMb 1G3WA 4FL6A 2DTIA 2JUFA 2L2PA 1VIEA 3X25B 2DETA 2CKKA 2RJEA 1ZSGA 1VQLT 1TUGB 3LH5A 4M4ZA 2XU8A 2EFIA 2RQUA 3M54A 4J9EA 1VQ6A 2F69A 6AT1B 1M90C 2GQVA 4L6V5 3NFCA 1Z9QA 2FPDA 2PU9B 1VQ8T 3SB2A 3JB9D 9ATCB 4OMOA 1QP2A 3I56A 4PJOA 5GANg 1D3BB 2CGHA 2JMAA 1ZA1B 1IHVA 2E1HA 3G4ST 1OZ3A 2K5FA 1MNEA 2C0TA 1QKWA 2GBQA 4M75C 1UG1A 2HBWA 1SHFA 1VQ8A 3A8MB 1XNIA 4M77C 3N5BB 4E7KA 1QCNA 1NEBA 2K3BA 1N8RU 4HKEA 3FJPA 2JM9A 3JB9I 2A28A 1YIJT 1AVZC 2QQRA 1GXIE 2YUQA 4KGZB 1PKSA 4FW2A 2AIRB 2L5QA 4E7JA 4Z8AA 2OX7A 3OBYA 1SKUB 4JUVA 3C95A 2JS0A 1FX7A 1VUBA 4EIKA 1YJ9Q 1QLYA 4PL6A 1W2BS 3AT1B 2YLCA 2FHDA 3QIIA 1YIJA 3BY7A 4ZTJA 4M78C 3MKDA 4R55A 1WFWA 3KXTA 4J83A 2DIQA 2KMTA 5DLQE 2X3XD 1SEMA 3R6OA 1KC8C 2J7IA 1W4SA 4PFPA 4J9IA 4F7UG 2K2MA 4JRKA 2OTJQ 1B7TA 1RLQC 2ROLA 4PLLA 1G3YA 1MV3A 4M7AC 1UE9A 2EYQA 4J9DA 1YITQ 3S3MA 1VQ4T 1BIBA 4KT0E 2ZGWA 4EDUA 2DIGA 5KYNA 3TU4K 2M02A 4NL2A 3CCJT 3GOXA 4JJDA 1M1GA 4WCIA 4C92F 3A98A 3LWIA 1MMDA 3V7SA 1VQ7Q 4C8QE 1VQ4A 3LYIA 4CC4B 2CSIA 1O9SA 3MEVA 3DKMA 1M1FA 1KD1C 1N8RC 2DYIA 1SRLA 1YHQA 2DJQA 2NUZA 1VQOT 1NJIU 1KHIA 1VA7A 4PJNA 2YT6A 3TSWA 1X6OA 1YJWQ 4RTVA 4CC7A 4UC4A 2VV5A 1D0YA 1RAEB 4HT8A 1VQ5A 2RQVA 4O6JA 1OX8A 5CAIA 1U1TA 3SFMA 4OMLA 4BI3A 1YWPA 1I1JA 3RDVA 2DE0X 1VQOA 1Q7YU 2COWA 3JRZA 3RBBB 5GMKh 4YTLA 3A8OB 4FSXA 4P5NA 4M7DG 3UT1A 4JJNK 3JCMX 2MWPA 1ZSZB 3FIFA 3TEEA 3CCRA 5AT1B 1DJ7B 2CT3A 4M75F 4XTZA 4IUPA 4XK8E 2K79A 4J6XA 1K1ZA 1WHJA 2B8AA 2DMOA 4D6WA 1WHHA 2EGCA 1LNXA 3U23A 2LQWA 4OB1B 2LQKA 3O5ZA 2LJ0A 5CVIA 1Q82R 1ZA2B 3BFMA 4XTUA 3JB9J 2D9TA 1G3TA 4CI0C 3SD4A 4OF1A 2CSQA 1QVGP 3MEAA 1UB4A 4QQ6A 4N4HA 3FEOA 3CMET 5FROA 4F7UB 2XHCA 3A8LB 2K3XA 5J39A 2LRQA 5KE2A 3I55Q 4AT1B 1Q86R 2EJGA 2MIOA 4M78F 4IUTA 2RI5A 2RPNA 1IZ6A 1W2BP 2LQ8A 1UGSB 2K2VA 3M5AA 1TS9A 2MOXA 3VS0A 3C94A 2ENMA 1NJIC 1NZ9A 4PJOC 4MMLA 1PWTA 2JXBA 2DBMA 4BDZA 3VV0A 4BY6C 3CD6A 2YUPA 3L1AA 4PJLA 1Q81U 4OMMA 1GCPA 2FZKB 3P8HA 4OB3B 4FCYA 2RJCA 1R0CB 2O2OA 4M7AF 2QEXA 3QWYA 3EHRA 1WJSA 2CYZB 5HCKA 1Q7YC 2XI9A 2CH4W 2QI2A 1K0XA 4C8QA 2ECZA 1SF9A 2JVVA 1KHCA 3EFOB 4MDWA 2R5MA 1TH7A 2D1XA 2J6FA 1ZUYA 1E6HA 2J6KA 3EGDB 3CCUA 3Q1JA 4F7UF 3CCMQ 2MMPA 2HBPA 1BKBA 3FJ5A 2JJ9A 2K9GA 5CKBA 3QSUA 1PCXA 3M0SA 3H9NA 3JSCA 3M0TA 3CC7T 1PRMC 1AD5A 4E2FB 5FU7C 2LC4A 3AHUA 3RIRA 2COYA 4AG1C 2NUPB 4EMKA 2OAWA 1LJOA 1UGVA 1WNLA 4FM4B 3CCSQ 2DA9A 2VXFA 1U1SA 4IIOA 2CZ6B 2EQKA 1UFFA 4OMFB 3JCMP 2GCXA 3QZ5B 4JZ4A 4M7DB 2QGGA 2LZ6B 5FWCA 3UDCA 1BU1A 3E9FA 2JOYA 5GAMh 3VS6A 1B34B 3OYCA 2AKLA 2DERA 3HFNA 2RHXA 3REAB 1VQPT 3BDLA 5LJ5d 5FRMA 2FEIA 5KYXA 1S1NA 4JZ3A 3HKSA 4JLGA 1AOJA 4M77A 1IGUA 1NLPC 1VQKT 4ELZC 2Y4YA 2L3QA 4PNOA 2KQWA 1TU0B 5GAOm 2H3EB 4JRIA 4HCBA 2V1QA 5GAMf 2DD4A 3G71A 1VQPA 4EMGA 1VQLQ 2AZSA 1ZHIA 1Q81C 3QPHA 5HK0A 3RESA 3SEMA 1PSEA 2KEAA 3GBQA 2R57A 1RABB 3CBPA 3D7SB 2RI2A 3MEWA 2QA4A 1M2VB 1MMAA 1JJ2P 5CQYA 4OMNA 1WI7A 4JPBW 3EGXA 4RTWA 2RF0A 3OYKA 4ESRA 1ACMB 2RHIA 1BI0A 2X4JA 1M27C 2F2XA 4KGVB 3PGGA 1TUDA 2F5TX 3G4SQ 3OMCA 3QYHB 1B07A 2M9UA 2ZPHB 3T9NA 3ZFJA 1NYGA 3TSZA 5GANh 1WYXA 2X35A 4WTOB 4HCCA 1BI3A 2HL3A 1WQ7A 1KG1A 4QW2A 5GMKj 1SRMA 5GANd 1I4K1 1IHWA 1LVKA 1YIJQ 3EAEA 1NM7A 3OYGA 4RTTA 3GNGA 2XDBA 4PJOF 5CKEA 2LNVA 4ZGJB 1M5Q1 5FU6C 4Y92A 1M4ZA 3OYBA 4JDSA 5GAN4 3PMIA 2JN0A 3P8BB 5GANf 1BI2A 4DEXA 2L3PA 2FB7A 3KFVA 4KH1B 4ZGEB 4HCZA 3BW1A 1W1FA 2EQJA 1K73C 4E7SA 2QQSA 4HT9A 4Y28E 1UJYA 2HCKA 1M90U 2EVRA 4A4EA 1PHTA 3JCMe 2EW3A 2XIDA 4FT2A 2HSPA 3EG1A 3QJ6A 1UDLA 4RG8A 4DA4A 3QHSA 2I2LA 5IXBA 1K8AU 1OV3A 1KQ2A 2DAQA 3C12A 4DBFA 3CC4T 4C0DB 1C1AA 1VQNT 2LCLA 2KR3A 1WZOA 2X4XA 2XICA 5IH2A 3RKXA 4C92G 3BDUA 4C0FA 1D1BA 3CPWP 1KSWA 2D0QB 1WHLA 3A8HB 3CCJQ 4C0ZA 2EYYA 4J9HA 2CS7A 1IO6A 4BD3A 4BDYA 2DXCA 4J9BA 2OAUA 3UATA 2E12A 4QKUA 1TOVA 1OQKA 3M57A 2M0OA 3EFRA 1PD0A 2XKOC 2YSQA 2KRMA 3G6ET 4E7IA 1FMVA 2ZPBB 5CK9A 2HQXA 4C8QC 3VS7A 2EQMA 2A36A 5A2QE 5LJ3h 4Q5WA 2A0FB 1K4US 1SHGA 2P4RA 5GAOp 3OYEA 4GBQA 1RUWA 1GL5A 2A7YA 3M4YA 1IRXA 3G6EA 3WVEB 5FU6B 1KC8U 1QVGA 1WIEA
chains in the Genus database with same CATH topology
4M7DE 3GOXA 3LGFA 3PNWC 1M1GA 4M78D 1N27A 3JCMc 1BI1A 3CMEA 4C92F 3META 4ATOA 3I56T 2CZ7B 3M58A 3GPLA 5J3BA 3LWIA 3V7SA 2BUDA 5LJ3f 4EMKC 3M9QA 2QQ9A 3SWNC 4M75G 5FU7B 4XAXB 1BYMA 5CIUA 4C8QE 5C0MA 3CXCS 4M7DD 2EQUA 1VQ4A 2LTOA 5GMKl 1Y96B 4Z02A 3LYIA 1MHNA 3OYDA 1K9MU 1W2BA 4IKFA 5L8RE 4M77G 4V2SA 1O9SA 1P92A 3MEVA 4M7AE 3RERA 5GMKe 4C92A 3DKMA 1M1FA 3PTAA 2OTJT 4LDUA 2MAMA 1KD1C 1N8RC 3OYYA 2E6NA 3FDRA 5GAMj 1YHQA 1K8AC 4GY5A 5CCAA 2MI6A 4GLKA 1IREB 3LX7A 4X9CA 4JRQA 1JBMA 1BIAA 1VQOT 3MEUA 1NJIU 2G3RA 4M7AD 2HNIA 1O75A 2KVQG 1KHIA 3HRUA 2X4YA 1X6OA 4BE1A 2LCCA 3V8LA 4DOWA 4UC4A 5GAMe 1XTDA 2VV5A 4OB0B 3VKIA 3ZBDA 2E6ZA 4VUBA 4LD9K 4O5VA 3A8GB 3OMGA 4HT8A 3GIBA 5CKDA 4E47A 5M9OA 2QDYB 4DQ2A 2O4XA 1VQ5A 2PUKB 4FU6A 4O6JA 1S72T 5D6XA 5CAIA 1U1TA 4MMKA 2MWOA 3SFMA 3P8DA 4J6YA 4BI3A 3RKYA 3M56A 3HL8A 4F7UA 4M78G 1KD1U 4BACA 2V8IA 2ZCFB 3NTHA 5KCHA 1VQOA 1Q7YU 4FIBA 1VQ7T 4J8OA 3JRZA 3V8JA 4OGEA 5GMKh 4YTLA 1QVGS 1Y71A 3A8OB 4FSXA 1WJQA 2H3JA 2RK1A 1XOVA 2EJFA 4P5NA 4M7DG 3UT1A 1WJRA 4JJNK 3JCMX 2C06A 4N0AA 4ZGDB 2MWPA 1KQ1A 3FIFA 3TEEA 2OTLA 3CC7A 4IUUA 5HKCA 1ZQ1A 1S72A 1FXXA 3CCRA 3JAME 1DJ7B 3TREA 1I5LA 4C8QG 3FB9A 4M75F 5GAN6 4XTZA 3L2ZA 1Q82C 2VYTA 5AYFA 4C92B 3V7CA 2A3LA 4M7AG 4IUPA 4XK8E 1Y96A 2QXFA 3O8VA 4J6XA 2ZPGB 3KUFA 4XU1A 3V7RA 2E65A 5GAMd 3OYLA 3QDRB 2WSCE 4J7FA 2XG8D 2B8AA 4D6WA 2FYKA 2XDDA 1LNXA 1RL2A 4LDYA 4M75A 1WGSA 4OB1B 2JTFA 2LQKA 1PSFA 2AHJB 4RCBA 5CVIA 1EIFA 3MP6A 3OS2A 1Q86C 1H641 3VYGA 2KSSA 4IURA 3OYMA 5GANj 3BFMA 3WVDB 4XTUA 3LLRA 2D9TA 1G3TA 3CCVT 3JB9J 3NTIA 4CI0C 3SD4A 3OYAA 2WSFE 4C0DC 4OF1A 3PT9A 2RM4A 3MEAA 4MDXA 2PVOB 4XU3A 4A4GA 3OS0A 3CCMA 2LX9A 1UB4A 4QQ6A 1Q82U 4N4HA 3FEOA 4OVAA 4A53A 3OS1A 3CMET 5FROA 4F7UB 2XHCA 4XQ3A 3A8LB 2K3XA 2RHYA 2LRQA 4MZTA 3G7ZA 5KE2A 2XK0A 5J39A 1K9MC 5IAYA 2QQBA 1YCYA 1Y07A 4J6WA 2EJGA 2IVWA 3PMTA 4IUTA 4M78F 2D6FA 2RB6A 2Y90A 5GAN5 2RI5A 1IZ6A 3CCVA 4BE2A 1VQKA 2LQ8A 5CO7A 3CMAT 1I81A 1UGSB 5GAOq 3M55A 2K2VA 2EAYA 2KDSA 3M5AA 4C5HA 3FC3A 2LT4A 4M7DF 4LDWA 3C94A 5J26A 4R56A 3L2WA 2DXTA 2V8KA 1NJIC 1NZ9A 1V29B 3RMSA 3OW2S 4PJOC 4MMLA 1YHQT 3GF5A 4Y91A 3HFOA 3OSSC 4II1A 4M78A 1QW1A 4ZN1A 4C5GA 4BDZA 2PVDB 2RH2A 3G4ST 3VV0A 1M9SA 2L3RA 4BY6C 3CD6A 3H8ZA 3VYHB 3X20B 5HK3A 3GP8A 4C8QF 3JB9F 3L1AA 3EFSA 3HP9A 4XU2A 1Q81U 2RD1A 3DLMA 3P8HA 2QQAA 4OB3B 4E7HA 4M7DA 2RJCA 2P0PA 3J81E 4RCCA 5A0DA 4M7AF 2QEXA 3V8KA 3HRSA 3CMAA 1JJ2A 2VGNA 2RHZA 3HHTB 4L5GA 5CR2A 1WJSA 3ER0A 3OB9A 4M75B 4NOYA 2CYZB 1VQ5T 1B34A 4DOVA 2XI9A 1Q7YC 1NE8A 2YLBA 2VC8A 2CZ0B 3JCMQ 3JB9H 2QI2A 2V8JA 4TVRA 4C8QA 5LJ5j 5DLOA 2JVVA 1KQSS 3CCLA 4M77B 1KHCA 4MDWA 2VUBA 2R5MA 1TH7A 1Y7XA 4ZTFA 3I55T 4M7AA 1WPYA 2LVMA 3H6ZA 4J5YA 4FT4A 3CCUA 3Q1JA 4F7UF 2MMPA 1N9SA 2K5LA 2HBPA 4PKCC 4PJOE 1BKBA 3JCMJ 5LJ5e 2KK4A 5A0GA 5CKBA 3QSUA 3ZEHA 5A0LA 2E64A 2DZ9A 1OYXA 2OTLT 5DM7R 3JSCA 3CC7T 1UEBA 3CCRT 3WXMB 3E19A 5D6WA 2E41A 1VQLA 4PJOD 1UGPB 1H3ZA 1R8OB 2NLUA 5FU7C 2HAXA 2GFUA 2LC4A 2DXBA 5CKHA 3RIRA 3I55A 3AHUA 2Y4XA 3VUZA 2FVUA 3S6WA 4EMKA 3A5ZB 1LJOA 1M1KU 2R5AA 3CCJT 1WNLA 4FM4B 1HXDA 2DJZA 2DO3A 2VXFA 1I8FA 2DKGA 4M78B 1U1SA 3QUIA 1WQWA 2CZ6B 3OYHA 2KY9A 4OGCA 3ASKA 5CQXA 2EQKA 2RJFA 4OP0A 3QBYA 4OMFB 2FL7A 4C5EA 1ZBXA 3OW2A 3JCMP 2GCXA 2YHTA 3QYGB 3QZ5B 5GMKi 4BE0A 1YI2T 4M7DB 1X01A 4KBMB 2GF7A 3M53A 2DK3A 3UDCA 5I21A 3GLXA 3CC2T 2DTOA 3E9FA 1JJ2S 2JOYA 5GAMh 5LJ3j 2P4TA 3G4SA 1B34B 4M77F 3OYCA 1SSFA 3HFNA 2RHXA 4BI8B 5GAOn 3CCMT 3SDZA 1VQPT 3BDLA 4C8QB 3CCEA 4X34A 2DVEA 5LJ5d 4EPCA 5FRMA 3QZ9B 1G5VA 4XTVA 3QKJA 3GNFB 5I2SA 1N6AA 3E1SA 4M7AB 5HY6A 3HKSA 4JLGA 3LGLA 5LJ3e 1JRIA 2VGMA 3MP8A 3CBMA 5GAN3 1YI2A 1KQSA 4M77A 4A54A 2BIVA 3OQ5A 2Y4YA 4PJOG 4ELZC 1VQKT 3CC2A 4PNOA 1QVPA 2KQWA 5GAOm 1XQHA 3E9GA 2E5QA 4JRIA 5GAOr 3CC4A 3JCMW 4HCBA 4KUIA 5GAMf 2DD4A 2K3YA 5D6YA 3G71A 1VQNA 1AHJB 4BB7A 3CCST 1VQPA 3X28B 4KULA 4EMGA 5KCOA 3UWNA 5LJ5g 1ZHIA 5GAMg 1Q81C 3DB3A 3QPHA 4BUGA 2WSEE 5GANe 5HK0A 3RESA 2JNGA 2PVGB 5IT9E 2K57A 2LT1A 4RMOA 1PSEA 5I2MA 2DPPB 5FRNA 3CD6T 3RKWA 4A4FA 2L8DA 2PUOB 2R57A 2M1HA 4EMKB 2F5KA 3SWNB 3CBPA 3CPWA 2RI2A 3DB4A 3MEWA 4A4HA 1KC8U 2MF2A 4C92C 4XTWA 4CRIA 5FLXE 2QA4A 2QEXT 1D3BA 2JZ2A 3J80E 5CQYA 3OS5A 1G3SA 2ZPEB 3ME9A 5GAOl 4BI4A 3OYKA 3OYFA 3TCJA 3S3OA 4IUVA 2DTHA 2RA2A 1UGQB 3CPFA 3CCSA 2DZCA 2RHIA 2DXUA 5GAN8 4ELYC 3CCLT 1BI0A 2X4JA 3F70A 4RG2A 2HD0A 3PGGA 2RI3A 3MP1A 4XU0A 2F5TX 3FRNA 5LJ3d 4OB2B 3OA6A 4MZMA 1VQ6T 1QP3A 3OMCA 3QYHB 3HPWA 3L42A 2L89A 4ZN3A 3CCUT 2DD5A 2M9UA 3MHXA 2ZPHB 4WF2A 2E70A 3JCMb 1G3WA 3OBWA 3T9NA 3ZFJA 4FL6A 3LWHA 1OI1A 2X4WA 2DTIA 2EKOA 4KUDK 2JUFA 4B9XA 3JCMV 5GANh 4PLIA 1VIEA 3X25B 2X35A 2RK2A 2PQWA 2CKKA 1YJNT 4HCCA 1BI3A 2K4YA 1WQ7A 2RJEA 4J7IA 4E7LA 4QW2A 1VQLT 1KG1A 5GMKj 3VJPA 4C92E 5GANd 1I4K1 1MGQA 4QVZA 1M1KC 4JLIA 2O01E 3M4GA 3HRTA 4RKUE 2ZPIB 3EAEA 1VQMT 2XU8A 3OYGA 5LJ3g 2EFIA 3M54A 3GNGA 1VQ6A 2XDBA 2F69A 4PJOF 4N0AC 5CKEA 3M59A 2GQVA 1YJ9A 1M90C 2LNVA 4L6V5 3VUBA 3OYNA 3NFCA 1M5Q1 4N4IA 5FU6C 4C92D 4ZGJB 3QXEB 3VU3C 1M4ZA 2PU9B 1VQ9T 3OYBA 1RI0A 4JDSA 3CCJA 2M16A 1VQ8T 5GAN4 3SB2A 2KAFA 3PMIA 3JB9D 4C8QD 3INZA 2JN0A 3P8BB 3RMQA 5GANf 1YJNA 2IG0A 1BI2A 1QP2A 3I56A 3CPWS 5GANg 1HK9A 2E10A 4PJOA 2FB7A 3URGA 4ZGEB 1D3BB 2CGHA 4HCZA 3BW1A 1YITT 3J7AF 1VQMA 3FLGA 2EQJA 1K73C 4NS5A 2P0QA 2E1HA 5CKFA 2RO0A 3X26B 2GFAA 1OZ3A 2ZPFB 2K5FA 3SWNA 1N9RA 2QQSA 4F7UE 4HT9A 4JS4A 3PFSA 4Y28E 3CCET 4JS5A 3PIOA 1X75C 2VXEA 4M75C 1M8VA 3QG1A 1UGRB 1VQ9A 1QVFA 2OTJA 3CBOA 1YBYA 1M90U 4A4EA 1VQ8A 3A8MB 3OY9A 3S3NA 1XNIA 4M77C 3JCMe 2XD0A 1U8RA 3N5BB 2XIDA 4E7KA 3PIPA 4FT2A 4LDVA 3QJ6A 3QO3A 4RG8A 4B9WA 3QHSA 4DA4A 1N8RU 1NPRA 4HKEA 3FJPA 1YITA 2I2LA 5EG2A 3JB9I 1YIJT 1K8AU 2QQRA 5LJ5h 1KQ2A 1GXIE 2DAQA 3C12A 3CC4T 4N4GA 2DEQA 4C0DB 3RUXA 3OYIA 3G71T 1VQNT 1VIFA 2L5QA 2LCLA 4E7JA 1JB0E 2X4XA 5GAN7 2XICA 1K73U 3OBYA 4XTYA 3RKXA 5IN1A 4C92G 3BDUA 4JRPA 4JUVA 4L59A 3C95A 4C0FA 4MZPA 5KH6A 4ME7A 1FX7A 1VUBA 3JB9G 3L2QA 1OZ2A 4XTXA 2D0QB 1W2BS 4PL6A 3A8HB 4M75E 2QA4T 1VQ7A 2LDMA 2FHDA 2YLCA 3QIIA 4X9DA 3OYJA 3CCQT 1YIJA 3L2UA 3CXCA 2WACA 2RJDA 4C5IA 4C0ZA 3BY7A 3X24B 1YJWT 4ZTJA 2CS7A 4M78C 4M77E 5C6SA 5LJ5f 2CZ1B 2K5IA 4BD3A 4QVDA 4BDYA 3MCAB 3JCMh 4R55A 4PJOB 4QQDA 5LL6S 3KXTA 3UPUA 4M75D 2DXCA 4C0GA 4J83A 2DIQA 2OAUA 2R58A 2KMTA 1FWZA 5DLQE 4M7DC 3LH0A 2E12A 4BY6B 2JTMA 3C4SA 3JCMd 4LDXA 2EIFA 3R6OA 3M57A 4M77D 1KC8C 1LOJA 2M0OA 1W4SA 3EFRA 2BKDN 2XKOC 3QJYA 4F7UG 5KE3A 4HA8A 3G6ET 4JRKA 3CCQA 4LD6A 4E7IA 2ZPBB 5CK9A 2HQXA 2O4XB 3L2VA 1QVFS 5GAN2 4C8QC 1YJWA 2XDPA 3NTKA 1NPPA 2EQMA 4PLLA 1G3YA 3CEYA 4NL3A 2ZZDA 5A2QE 5LJ3h 4Q5WA 2HQEA 4M7AC 3HSBA 2EYQA 3DLLA 2YRVA 3MO8A 3JCMf 4QVCA 5GAOp 3OYEA 4EMHA 2EJ9A 2QTXA 3LW5E 3S3MA 5GMKm 3JCMg 5DY9A 1VQ4T 3OSVA 4M78E 1BIBA 4KT0E 2RHUA 1YJ9T 3L2RA 2ZGWA 4EDUA 2A7YA 2DIGA 3M4YA 4A4KA 2EWNA 3G6EA 3TU4K 3WVEB 4NL2A 1Q86U 4IUQA 5FU6B 2P0KA 1QVGA 4QQGA 3KBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IG0 A;  3OYA A;  3GOX A;  3LGF A;  3PNW C;  3E9F A;  1N27 A;  3MEA A;  3OS1 A;  4A4G A;  3MET A;  3OS0 A;  4HCZ A;  4QQ6 A;  3OYC A;  3FLG A;  2EQJ A;  3FEO A;  1SSF A;  4N4H A;  2BUD A;  2RHX A;  4NS5 A;  4OVA A;  5FRO A;  3M9Q A;  2RO0 A;  3BDL A;  2GFA A;  1OZ3 A;  2K3X A;  2RHY A;  2LRQ A;  2QQS A;  4X34 A;  5KE2 A;  2XK0 A;  5J39 A;  5CIU A;  5C0M A;  5IAY A;  3PFS A;  5FRM A;  2EQU A;  3QKJ A;  1G5V A;  2LTO A;  4Z02 A;  3LYI A;  3PMT A;  1MHN A;  4IUT A;  3OYD A;  4IKF A;  3LGL A;  2RI5 A;  3MEV A;  3MP8 A;  4BE2 A;  4A4E A;  3OY9 A;  3S3N A;  1XNI A;  2BIV A;  3OQ5 A;  3FC3 A;  4C5H A;  4E7K A;  2E6N A;  3FDR A;  3QJ6 A;  4B9W A;  5J26 A;  4GY5 A;  3L2W A;  3E9G A;  2E5Q A;  3LX7 A;  3MEU A;  4II1 A;  2G3R A;  2K3Y A;  2QQR A;  5D6Y A;  2DAQ A;  4N4G A;  4C5G A;  4BDZ A;  5KCO A;  3UWN A;  3OYI A;  2L3R A;  2X4Y A;  3DB3 A;  3H8Z A;  4BE1 A;  2X4X A;  4E7J A;  2LCC A;  5FRN A;  4UC4 A;  3DLM A;  3SD4 A;  3P8H A;  4A4F A;  4E7H A;  2L8D A;  2RJC A;  2R57 A;  5IN1 A;  2M1H A;  2F5K A;  3OMG A;  4L59 A;  2RI2 A;  3DB4 A;  3MEW A;  4A4H A;  5KH6 A;  5M9O A;  2O4X A;  2RHZ A;  4FU6 A;  4CRI A;  1WJS A;  3OB9 A;  1OZ2 A;  5D6X A;  2JZ2 A;  3L2Q A;  2MWO A;  4PL6 A;  3P8D A;  3ME9 A;  2LDM A;  2FHD A;  3QII A;  3OYJ A;  3OYK A;  3OYF A;  3L2U A;  4BAC A;  3NTH A;  2WAC A;  2RJD A;  1KHC A;  4IUV A;  4C5I A;  5KCH A;  3S3O A;  2R5M A;  2RHI A;  4ZTJ A;  5C6S A;  4ZTF A;  3F70 A;  2LVM A;  3H6Z A;  4BD3 A;  4BDY A;  4RG2 A;  1WJQ A;  2RI3 A;  3MP1 A;  4QQD A;  3UT1 A;  1WJR A;  3Q1J A;  2DIQ A;  2MWP A;  3OA6 A;  2R58 A;  3OMC A;  3L42 A;  2L89 A;  3LH0 A;  3C4S A;  4IUU A;  3ZEH A;  1OYX A;  2M0O A;  4FL6 A;  1OI1 A;  2X4W A;  2BKD N;  2EKO A;  4B9X A;  5KE3 A;  4PLI A;  5D6W A;  2X35 A;  4LD6 A;  4E7I A;  2PQW A;  2CKK A;  2HQX A;  2O4X B;  3L2V A;  2VYT A;  1H3Z A;  2NLU A;  2RJE A;  2XDP A;  3NTK A;  2GFU A;  2EQM A;  4IUP A;  4PLL A;  4QW2 A;  3CEY A;  4E7L A;  4QVZ A;  3S6W A;  3O8V A;  2HQE A;  4Q5W A;  3KUF A;  3EAE A;  3OYL A;  3OYG A;  2EFI A;  2R5A A;  2YRV A;  2B8A A;  3MO8 A;  3OYE A;  3S3M A;  3OYH A;  1WGS A;  3ASK A;  2EQK A;  2JTF A;  2RJF A;  2RHU A;  3OYN A;  4N4I A;  3L2R A;  3MP6 A;  3QBY A;  4EDU A;  3OS2 A;  2DIG A;  4C5E A;  4IUR A;  3OYM A;  1RI0 A;  3OYB A;  2M16 A;  2D9T A;  3LLR A;  3NTI A;  4BE0 A;  3PMI A;  4IUQ A;  2P0K A;  2GF7 A;  4QQG A; 
#chains in the Genus database with same CATH topology
 3LGF A;  1LCK A;  5KYW B;  1NG2 A;  3I56 T;  3M58 A;  3GPL A;  2ZAE A;  2BUD A;  5LJ3 f;  4EMK C;  1AWX A;  1MMN A;  4M75 G;  2KXD A;  4XAX B;  5CIU A;  5C0M A;  1BYM A;  1GBR A;  2JM8 A;  4Z02 A;  3OYD A;  1W2B A;  4M77 G;  1NJI R;  2J05 A;  2ED0 A;  1QVF P;  3EHQ A;  1D09 B;  1IGQ A;  3OYY A;  1KIK A;  5GAM j;  1K8A C;  4GY5 A;  4GLK A;  1IRE B;  4JRQ A;  2HNI A;  3CCQ Q;  4BE1 A;  2LCC A;  3V8L A;  4DOW A;  5I11 A;  2KI7 A;  5GAM e;  4OB0 B;  3VKI A;  1Q7Y R;  2E6Z A;  2DF6 A;  2PTK A;  3A8G B;  2CT4 A;  1ARK A;  5CKD A;  1WXU A;  2HDA A;  3RNJ A;  4FU6 A;  4MMK A;  2MWO A;  4CC2 A;  3RKY A;  3HL8 A;  4M78 G;  1KD1 U;  4J8O A;  2BE9 B;  3CXC P;  4OGE A;  1QVG S;  4LE9 A;  1XOV A;  1M8M A;  1TSF A;  3CME Q;  1WJR A;  2C06 A;  1NLO C;  4F16 A;  2OTL A;  1YN8 A;  2DRK A;  2K6D A;  3TRE A;  1I5L A;  2H8H A;  3FB9 A;  2RMO A;  2LCS A;  3L2Z A;  2VYT A;  4C92 B;  5KYY B;  4M7A G;  2QXF A;  3KUF A;  3V7R A;  2WSC E;  1RAH B;  1RL2 A;  4LDY A;  3QWX X;  2GNC A;  2JTF A;  1MUZ A;  1PSF A;  1H64 1;  4IUR A;  5GAN j;  2O88 A;  3WVD B;  3M0U A;  3CCV T;  3OYA A;  5EC7 A;  2LX7 A;  2WSF E;  3PT9 A;  4GLM A;  1YWO A;  2PVO B;  2X51 A;  4XU3 A;  4A4G A;  2LX9 A;  4OVA A;  1K9A A;  1AWW A;  2E3H A;  4MZT A;  3JV3 A;  2RN8 A;  4J6W A;  3PMT A;  2Y90 A;  2CP0 A;  2HKQ B;  3CCV A;  4BE2 A;  4PJM A;  5CO7 A;  1NYF A;  5GAO q;  2O31 A;  2KDS A;  2LQN A;  2LT4 A;  1RAG B;  4LDW A;  3CC7 Q;  4R56 A;  1S72 Q;  1V29 B;  3RMS A;  3OW2 S;  1YHQ T;  3GF5 A;  2EBP A;  1K9M R;  3HFO A;  3EG9 B;  2DNU A;  1PM3 A;  4C5G A;  2DIL A;  3H8Z A;  5HK3 A;  4C8Q F;  3EFS A;  3HP9 A;  4XU2 A;  2KE9 A;  3DLM A;  4E7H A;  2QQA A;  2P0P A;  1SPK A;  1HSQ A;  1JJ2 A;  2RHZ A;  5KYX B;  2B86 A;  3HHT B;  2C0O A;  1MV0 B;  4M75 B;  1VQ5 T;  4DOV A;  1AZE A;  2CZ0 B;  2A08 A;  2V8J A;  3BE3 A;  4TVR A;  3CCL A;  4M77 B;  2VUB A;  5IXF A;  1R77 A;  1ZUK A;  1WPY A;  3H6Z A;  2F1L A;  1H3H A;  4FT4 A;  1N9S A;  2K5L A;  4HXJ A;  3JCM J;  5A0G A;  2E64 A;  2DLP A;  1FYN A;  4E7Z A;  1UEB A;  3CCR T;  1J3T A;  1HD3 A;  2NYS A;  4RUG A;  5D6W A;  1H3Z A;  1R8O B;  1VQK Q;  2JTE A;  2FRW A;  2HAX A;  3M0R A;  2AZV A;  3S6W A;  2AK5 A;  1U3O A;  4M78 B;  1I8F A;  3QUI A;  4OGC A;  3ASK A;  5CQX A;  2RJF A;  3EH1 A;  4B6M A;  1X01 A;  4KBM B;  2GF7 A;  2DK3 A;  4AFU C;  3CMA Q;  3CC2 T;  1OX9 A;  1JJ2 S;  5LJ3 j;  1MND A;  4R0K A;  3REB B;  4M77 F;  2VVK A;  4BI8 B;  3CCE A;  1G5V A;  4XTV A;  1EZZ B;  3GNF B;  4LN2 A;  4M7A B;  3E1S A;  1G8X A;  5LJ3 e;  3LGL A;  3MP8 A;  1B3Q A;  1YNZ A;  4A54 A;  2BIV A;  2V1R A;  4PJO G;  3CC2 A;  3E9G A;  2E5Q A;  5GAO r;  5D7U A;  2YRD A;  2K3Y A;  5D6Y A;  4BB7 A;  2HQH A;  1PC0 A;  1WHM A;  5IT9 E;  1RAD B;  2K57 A;  3CD6 T;  1T3L A;  3RKW A;  2YUO A;  2PUO B;  8AT1 B;  2F5K A;  1WA7 A;  3CPW A;  3DB4 A;  5FLX E;  2FRY A;  2QEX T;  1D3B A;  2JZ2 A;  3OS5 A;  1D1A A;  3TCJ A;  3S3O A;  2KNB B;  1K76 A;  4FYV B;  1C0M A;  5GAN 8;  2M0Y A;  2J6O A;  2MPX C;  2RI3 A;  2GTJ A;  3G1J A;  2DX1 A;  3UA6 A;  3CCU T;  3HPW A;  3L42 A;  4ZN3 A;  3R6N A;  2A37 A;  1ABO A;  2RNA A;  4WF2 A;  2E70 A;  1H8K A;  2EKO A;  4FYW B;  4KUD K;  3JCM V;  4PLI A;  1JO8 A;  2PQW A;  2DM1 A;  1MGQ A;  4QVZ A;  4JLI A;  3HRT A;  4RKU E;  2ZPI B;  1VQM T;  3VRZ A;  3CC4 Q;  1QQJ A;  1VQN Q;  3M59 A;  1YJ9 A;  4LUE A;  1AZG B;  1UJ0 A;  2DEU A;  1ABQ A;  1WHG A;  4RTU A;  1IXD A;  2YWW A;  2KAF A;  3OW2 P;  3RMQ A;  3PE0 A;  2IG0 A;  3CPW S;  2E10 A;  4AFS C;  3NPF A;  1YIT T;  1VQM A;  1M90 R;  3FLG A;  2FPE A;  4F7U E;  4JS4 A;  3NMZ C;  3PIO A;  1X75 C;  1M8V A;  1JU5 C;  1QVF A;  4F14 A;  2OTJ A;  3EG0 A;  2D8J A;  2XD0 A;  4LDV A;  5GJV B;  3QO3 A;  4HVU A;  1NPR A;  1T3S A;  1YIT A;  5EG2 A;  5LJ5 h;  1VYT A;  1AT1 B;  3RUX A;  3OYI A;  3G71 T;  1VIF A;  2ROT A;  1K73 U;  2CP5 A;  4KRT A;  1UHF A;  4JRP A;  2COZ A;  2BZ8 A;  1VQ6 Q;  3JB9 G;  4XTX A;  2QA4 T;  1VQ7 A;  4J9F A;  3CXC A;  2WAC A;  2RJD A;  2X3W D;  4C5I A;  1YJW T;  3X24 B;  5C6S A;  5LJ5 f;  2CZ1 B;  2MCN A;  3I56 Q;  3MCA B;  4PJO B;  3I5S A;  2QG9 B;  3H41 A;  3LH0 A;  4BY6 B;  3C4S A;  2EIF A;  1GFC A;  2L0A A;  1LOJ A;  1WXT A;  1PD1 A;  5KE3 A;  3QJY A;  4HA8 A;  1AWO A;  1GFD A;  4LD6 A;  1QVF S;  1VQ8 Q;  1YJW A;  3NTK A;  3CEY A;  2ZZD A;  2BTT A;  3HSB A;  1KC8 R;  2EJ9 A;  1RAC B;  2EYX A;  3JCM g;  1AEY A;  1LPL A;  2GGR A;  3L2R A;  3VS3 A;  3TVT A;  4A4K A;  2EWN A;  2W0Z A;  1Q86 U;  4IUQ A;  4PFO A;  3KBG A;  4M7D E;  2FO0 A;  3PNW C;  1N27 A;  3JCM c;  3E2U A;  3MET A;  4F04 B;  1ZSZ A;  5J3B A;  1N5Z A;  3M9Q A;  2QQ9 A;  3SWN C;  5FU7 B;  3CXC S;  4M7D D;  2EQU A;  3TQ7 P;  5GMK l;  2CH4 A;  5L8R E;  4V2S A;  2CDT A;  5GMK e;  3PTA A;  4LDU A;  2QK0 A;  1ZLM A;  2V26 A;  4AFZ C;  2NUT A;  4X9C A;  3LX7 A;  2VWF A;  3MEU A;  2D8H A;  1O75 A;  2KVQ G;  2DL4 A;  3HRU A;  2KXC A;  1D0X A;  2X4Y A;  3I9Q A;  1XTD A;  4LXC A;  1KD1 R;  1N8R R;  4LD9 K;  4O5V A;  3OMG A;  2HL5 C;  4DQ2 A;  2D0N A;  2O4X A;  5D6X A;  1X2K A;  2JW4 A;  4J6Y A;  3M56 A;  4F7U A;  1UTI A;  4BAC A;  7AT1 B;  3NTH A;  5ECA A;  4FIB A;  1GCQ C;  3EGU A;  4PFZ A;  2RK1 A;  1I07 A;  4N0A A;  1X69 A;  1RLP C;  4JJC A;  1KQ1 A;  4IUU A;  4JJB A;  5HKC A;  3JAM E;  1KJW A;  1VQ4 Q;  1M2O A;  2KRO A;  4C8Q G;  1GBQ A;  5GAN 6;  1Q82 C;  2OI3 A;  2E4H A;  3V7C A;  2A3L A;  2EPD A;  4FYY B;  1X43 A;  1Y96 A;  3O8V A;  1YHQ Q;  2E65 A;  5FW9 A;  2BE7 D;  2XG8 D;  2E5K A;  1X2Q A;  2XDD A;  2MYS A;  4FSS A;  4OMQ A;  1WGS A;  2KGT A;  1JEG A;  3VRY A;  2E3I A;  1EIF A;  3MP6 A;  3OS2 A;  1Q86 C;  2DFU A;  4ORZ A;  1OU8 A;  3VYG A;  1NEG A;  3EFO A;  3NTI A;  1U5S A;  2RQW A;  2LNH B;  3EGD A;  1VQ5 Q;  1E7O A;  2G6F X;  4X1V A;  3OS0 A;  4HVW A;  3CCM A;  3OS1 A;  1VQO Q;  2RHY A;  4ANJ A;  2XK0 A;  5IAY A;  1YCY A;  1Y07 A;  2IVW A;  4PJJ A;  4FW1 A;  5GAN 5;  3H0F A;  1I81 A;  5FWB A;  3M55 A;  2EAY A;  5J26 A;  3C0C A;  3CCR Q;  1PRL C;  2IIM A;  1HJD A;  4Y91 A;  3OSS C;  4ZN1 A;  2HEQ A;  2PVD B;  1BCM A;  3X20 B;  3JB9 F;  4M7D A;  3J81 E;  3V8K A;  3HRS A;  2VGN A;  1BBZ A;  4L5G A;  3ER0 A;  4NOY A;  1W6X A;  1B34 A;  1NE8 A;  2VC8 A;  3UA7 A;  5LJ5 j;  5DLO A;  1KQS S;  1KK7 A;  5KYU A;  1UUE A;  1JXM A;  3CC2 Q;  2VB6 A;  1CSK A;  2LVM A;  1W70 A;  1X27 A;  2O9V A;  4RTY A;  5LJ5 e;  1RAA B;  2LJ3 A;  5A0L A;  3ZL7 C;  2OTL T;  1UHC A;  8ATC B;  3SHW A;  2E41 A;  1VQL A;  1UGP B;  4RTX A;  2KYB A;  2NLU A;  5CKH A;  2DXB A;  2DL8 A;  5IHI A;  2Y4X A;  2FVU A;  3A5Z B;  1M1K U;  2YRC A;  1FMK A;  2DJZ A;  2GTO A;  1M2V A;  1WQW A;  1RI9 A;  2HKN A;  3VS4 A;  3CD6 Q;  4OP0 A;  3QBY A;  3OW2 A;  4LNP A;  2YHT A;  1YI2 T;  3EG3 A;  1RAF B;  4BE0 A;  3M53 A;  2QEX Q;  5I21 A;  3GLX A;  2P4T A;  1G83 A;  3G4S A;  1I5O B;  4AG2 C;  5GAO n;  3A1P A;  4C8Q B;  2DVE A;  2OJ2 A;  3QKJ A;  1ZBJ A;  2LMJ A;  3HTR A;  5HY6 A;  3IQL A;  3CCU Q;  3CBM A;  5GAN 3;  1YI2 A;  1IB8 A;  2LP5 A;  1E6G A;  1QVP A;  1XQH A;  2CP7 A;  1OEB A;  1T0H A;  1ZSZ C;  3X28 B;  5KCO A;  5GJW B;  3UWN A;  2MK5 A;  4BUG A;  5GAN e;  2WSE E;  2PVG B;  2LT1 A;  5I2M A;  2QAS A;  2DPP B;  1VQM Q;  2DL5 A;  5FRN A;  2VAS A;  2L8D A;  4EMK B;  2RQR A;  2HMA A;  4Z89 A;  4CRI A;  2IPO B;  1PG5 B;  2ZPE B;  1JQQ A;  1Q81 R;  4BI4 A;  3OYF A;  2DXU A;  3CCL T;  4ELY C;  2RQT A;  3F70 A;  2HD0 A;  4E6R A;  4XU0 A;  2EQI A;  3PVL A;  3FRN A;  3OA6 A;  4MZM A;  3MHX A;  3LWH A;  3OBW A;  1OI1 A;  1I0C A;  2X4W A;  3I5R A;  4B9X A;  1KFZ A;  1WXB A;  2RK2 A;  4J9C A;  1YJN T;  1M3B A;  2K4Y A;  1QWF A;  1OPL A;  4J7I A;  4E7L A;  3VJP A;  4C92 E;  2L3S A;  1M1K C;  2O01 E;  3M4G A;  1EX4 A;  5LJ3 g;  1M3A A;  1WDX A;  2QTV A;  4N0A C;  3G71 Q;  1VQP Q;  2CRE A;  1CKA A;  3H0I A;  3VUB A;  3OYN A;  4N4I A;  4C92 D;  3QXE B;  3VU3 C;  1VQ9 T;  1RI0 A;  3CCJ A;  3CQT A;  2M16 A;  3H0H A;  2QYZ A;  2HZY A;  2ATC B;  4C8Q D;  3INZ A;  1YJN A;  1WX6 A;  1OPK A;  2CP6 A;  1HK9 A;  3URG A;  2QA4 Q;  1WHK A;  2DL3 A;  2KRS A;  3J7A F;  4KGX B;  2PZ1 A;  4NS5 A;  2P0Q A;  3EGX B;  5CKF A;  2RO0 A;  3X26 B;  2GFA A;  2ZPF B;  3SWN A;  1X6G A;  1N9R A;  1D1C A;  3PFS A;  3CCE T;  4JS5 A;  1G2B A;  2QGF B;  2VXE A;  3VS2 A;  3QG1 A;  1UGR B;  1VQ9 A;  3CBO A;  1YBY A;  4K11 A;  3OY9 A;  3S3N A;  1U8R A;  1MMG A;  2BZX A;  1KQS P;  2XMF A;  3PIP A;  3M0P A;  4B9W A;  1K73 R;  3VS1 A;  4FYX B;  1WLP B;  4N4G A;  2DEQ A;  1NBE B;  1JB0 E;  2JMC A;  5GAN 7;  1Y57 A;  4XTY A;  5IN1 A;  4KH0 B;  4L59 A;  4MZP A;  2DYB A;  5KH6 A;  5KYW A;  4ME7 A;  2F2V A;  2KYM A;  3L2Q A;  1OZ2 A;  4M75 E;  4IIM A;  1QKX A;  2LDM A;  3OYJ A;  4X9D A;  3CCQ T;  4HCK A;  3L2U A;  1GCQ A;  3MJX A;  4M77 E;  5I22 A;  2NUT B;  2K5I A;  4QVD A;  2SRC A;  3JCM h;  2HSE B;  4QQD A;  5LL6 S;  3UPU A;  4M75 D;  4C0G A;  2R58 A;  1FWZ A;  3RR6 A;  4M7D C;  2JTM A;  3JCM d;  4LDX A;  4M77 D;  2BKD N;  4D8K A;  3CCQ A;  1TUC A;  1SSH A;  2YDL A;  3L2V A;  2O4X B;  5GAN 2;  2XDP A;  1ZUU A;  1NPP A;  2NWM A;  4NL3 A;  1M30 A;  1V1C A;  2HQE A;  1Z9Z A;  3DLL A;  1EFN A;  2YRV A;  3MO8 A;  3JCM f;  4QVC A;  2ED1 A;  4EMH A;  2QTX A;  2LJ1 A;  3LW5 E;  4DBQ A;  5GMK m;  1PKT A;  5DY9 A;  3OSV A;  4M78 E;  4F17 A;  1X6B A;  2RHU A;  1YJ9 T;  3M0Q A;  1XJW B;  1VYU A;  2JT4 A;  2P0K A;  4QQG A;  2F2W A;  4M78 D;  1BI1 A;  3CME A;  4ATO A;  2CZ7 B;  2W10 A;  1VOM A;  1TTH B;  2CP2 A;  2VKN A;  2LTO A;  1Y96 B;  1MHN A;  1K9M U;  4IKF A;  1BK2 A;  1YFN A;  1P92 A;  4M7A E;  3RER A;  4C92 A;  5KYY A;  1R0B G;  2OTJ T;  2MAM A;  4AFQ C;  2E6N A;  3FDR A;  5CCA A;  2MI6 A;  4J9G A;  1JBM A;  1BIA A;  2G3R A;  4M7A D;  2QDL A;  3ZBD A;  4VUB A;  3GIB A;  1K8A R;  4E47 A;  5M9O A;  2QDY B;  2PUK B;  1S72 T;  2ABL A;  4PK4 A;  3P8D A;  3PVQ A;  2V8I A;  2ZCF B;  5KCH A;  3G6E Q;  1VQ7 T;  3V8J A;  1Y71 A;  1WJQ A;  2H3J A;  1C6V X;  2EJF A;  4ZGD B;  3CC7 A;  1ZQ1 A;  1S72 A;  1FXX A;  2CP3 A;  1VYV A;  1Y0M A;  1GRI A;  3EG9 A;  2KBT A;  2EGA A;  2EYZ A;  5AYF A;  2GQI A;  2P84 A;  2AKK A;  1A0N B;  2EYW A;  2Z0W A;  3I35 A;  1QCF A;  2ZPG B;  4XU1 A;  5GAM d;  3OYL A;  3QDR B;  5KYU B;  4J7F A;  2FYK A;  2EGE A;  2CUD A;  4M75 A;  2EKH A;  2AT1 B;  2AHJ B;  4QT7 A;  4RCB A;  3OYM A;  1YCS B;  2KSS A;  2BZY A;  3LLR A;  1JXO A;  2I0N A;  2DRM A;  4RTZ A;  4C0D C;  2RM4 A;  4MDX A;  1QMC A;  1Q82 U;  4A53 A;  4XQ3 A;  4Z88 A;  1D0Z A;  4DBR A;  1PNJ A;  3G7Z A;  1K9M C;  2C0I A;  2QQB A;  3QDF A;  4DBH A;  2D6F A;  2RB6 A;  3ULR B;  1F1B B;  1VQK A;  5IHK A;  3CMA T;  2OTL Q;  3FC3 A;  4C5H A;  4M7D F;  1M3C A;  3L2W A;  2DXT A;  2V8K A;  2K7A A;  4DEY A;  1H92 A;  4II1 A;  4M78 A;  1QW1 A;  1U06 A;  2RH2 A;  1M9S A;  1UEC A;  2L3R A;  3THK A;  3VYH B;  4ZNX A;  3GP8 A;  4OMP A;  2RD1 A;  1V76 A;  4RCC A;  5A0D A;  2X9H A;  4HVV A;  3CMA A;  2DL7 A;  4A63 B;  5CR2 A;  3OB9 A;  2DVJ A;  3UF4 A;  2YLB A;  1Q95 G;  3JCM Q;  2KT1 A;  3JB9 H;  1YI2 Q;  1Y7X A;  4ZTF A;  3NHN A;  3I55 T;  4M7A A;  1ZX6 A;  4J5Y A;  2YUN A;  2PNI A;  4PKC C;  4PJO E;  2KT8 A;  2KK4 A;  3ZEH A;  2DZ9 A;  1OYX A;  1TXQ A;  2FZG B;  5DM7 R;  1M1K R;  1HYO A;  3WXM B;  3E19 A;  4PJO D;  2FPF A;  1TG0 A;  3CCV Q;  1BCO A;  1SG5 A;  2GFU A;  3EG2 A;  3I55 A;  3VUZ A;  2R5A A;  1YP5 A;  2FZC B;  2KRN A;  1HXD A;  2DO3 A;  2DKG A;  1BB9 A;  3OYH A;  2KY9 A;  1AWJ A;  1OU9 A;  1CKB A;  2FL7 A;  4C5E A;  1ZBX A;  3QYG B;  5GMK i;  4CC3 A;  2DTO A;  2SEM A;  2J06 A;  1SSF A;  3CCM T;  3SDZ A;  4X34 A;  3CCL Q;  4EPC A;  3QZ9 B;  3EH2 A;  3NGP A;  5I2S A;  4LUD A;  4AMC A;  1N6A A;  1JRI A;  1K0S A;  2VGM A;  2QAZ A;  1KQS A;  1OUL A;  5IHN A;  3OQ5 A;  5L23 A;  2FG0 A;  3CC4 A;  3JCM W;  4KUI A;  2O9S A;  1VQN A;  1YJN Q;  1AHJ B;  3CCS T;  5GAM g;  4KUL A;  5LJ5 g;  2YXY A;  3DB3 A;  2JNG A;  4RMO A;  2ESW A;  4A4F A;  1RAI B;  2M1H A;  3SWN B;  1T0J A;  3MPU B;  4A4H A;  2MF2 A;  4C92 C;  4XTW A;  1FMW A;  3J80 E;  3VS5 A;  1VQ9 Q;  1G3S A;  2NUP A;  3ME9 A;  1QCO A;  5GAO l;  2M51 A;  1QWE A;  4IUV A;  2DTH A;  2RA2 A;  1UGQ B;  3CPF A;  3CCS A;  2DZC A;  1OOT A;  2CUB A;  2DBK A;  4RG2 A;  3MP1 A;  4D8D A;  5LJ3 d;  4OB2 B;  2JS2 A;  1VQ6 T;  1QP3 A;  2L89 A;  1TWB A;  2DD5 A;  3CCE Q;  3JCM b;  1G3W A;  4FL6 A;  2DTI A;  2JUF A;  2L2P A;  1VIE A;  3X25 B;  2DET A;  2CKK A;  2RJE A;  1ZSG A;  1VQL T;  1TUG B;  3LH5 A;  4M4Z A;  2XU8 A;  2EFI A;  2RQU A;  3M54 A;  4J9E A;  1VQ6 A;  2F69 A;  6AT1 B;  1M90 C;  2GQV A;  4L6V 5;  3NFC A;  1Z9Q A;  2FPD A;  2PU9 B;  1VQ8 T;  3SB2 A;  3JB9 D;  9ATC B;  4OMO A;  1QP2 A;  3I56 A;  4PJO A;  5GAN g;  1D3B B;  2CGH A;  2JMA A;  1ZA1 B;  1IHV A;  2E1H A;  3G4S T;  1OZ3 A;  2K5F A;  1MNE A;  2C0T A;  1QKW A;  2GBQ A;  4M75 C;  1UG1 A;  2HBW A;  1SHF A;  1VQ8 A;  3A8M B;  1XNI A;  4M77 C;  3N5B B;  4E7K A;  1QCN A;  1NEB A;  2K3B A;  1N8R U;  4HKE A;  3FJP A;  2JM9 A;  3JB9 I;  2A28 A;  1YIJ T;  1AVZ C;  2QQR A;  1GXI E;  2YUQ A;  4KGZ B;  1PKS A;  4FW2 A;  2AIR B;  2L5Q A;  4E7J A;  4Z8A A;  2OX7 A;  3OBY A;  1SKU B;  4JUV A;  3C95 A;  2JS0 A;  1FX7 A;  1VUB A;  4EIK A;  1YJ9 Q;  1QLY A;  4PL6 A;  1W2B S;  3AT1 B;  2YLC A;  2FHD A;  3QII A;  1YIJ A;  3BY7 A;  4ZTJ A;  4M78 C;  3MKD A;  4R55 A;  1WFW A;  3KXT A;  4J83 A;  2DIQ A;  2KMT A;  5DLQ E;  2X3X D;  1SEM A;  3R6O A;  1KC8 C;  2J7I A;  1W4S A;  4PFP A;  4J9I A;  4F7U G;  2K2M A;  4JRK A;  2OTJ Q;  1B7T A;  1RLQ C;  2ROL A;  4PLL A;  1G3Y A;  1MV3 A;  4M7A C;  1UE9 A;  2EYQ A;  4J9D A;  1YIT Q;  3S3M A;  1VQ4 T;  1BIB A;  4KT0 E;  2ZGW A;  4EDU A;  2DIG A;  5KYN A;  3TU4 K;  2M02 A;  4NL2 A;  3CCJ T;  3GOX A;  4JJD A;  1M1G A;  4WCI A;  4C92 F;  3A98 A;  3LWI A;  1MMD A;  3V7S A;  1VQ7 Q;  4C8Q E;  1VQ4 A;  3LYI A;  4CC4 B;  2CSI A;  1O9S A;  3MEV A;  3DKM A;  1M1F A;  1KD1 C;  1N8R C;  2DYI A;  1SRL A;  1YHQ A;  2DJQ A;  2NUZ A;  1VQO T;  1NJI U;  1KHI A;  1VA7 A;  4PJN A;  2YT6 A;  3TSW A;  1X6O A;  1YJW Q;  4RTV A;  4CC7 A;  4UC4 A;  2VV5 A;  1D0Y A;  1RAE B;  4HT8 A;  1VQ5 A;  2RQV A;  4O6J A;  1OX8 A;  5CAI A;  1U1T A;  3SFM A;  4OML A;  4BI3 A;  1YWP A;  1I1J A;  3RDV A;  2DE0 X;  1VQO A;  1Q7Y U;  2COW A;  3JRZ A;  3RBB B;  5GMK h;  4YTL A;  3A8O B;  4FSX A;  4P5N A;  4M7D G;  3UT1 A;  4JJN K;  3JCM X;  2MWP A;  1ZSZ B;  3FIF A;  3TEE A;  3CCR A;  5AT1 B;  1DJ7 B;  2CT3 A;  4M75 F;  4XTZ A;  4IUP A;  4XK8 E;  2K79 A;  4J6X A;  1K1Z A;  1WHJ A;  2B8A A;  2DMO A;  4D6W A;  1WHH A;  2EGC A;  1LNX A;  3U23 A;  2LQW A;  4OB1 B;  2LQK A;  3O5Z A;  2LJ0 A;  5CVI A;  1Q82 R;  1ZA2 B;  3BFM A;  4XTU A;  3JB9 J;  2D9T A;  1G3T A;  4CI0 C;  3SD4 A;  4OF1 A;  2CSQ A;  1QVG P;  3MEA A;  1UB4 A;  4QQ6 A;  4N4H A;  3FEO A;  3CME T;  5FRO A;  4F7U B;  2XHC A;  3A8L B;  2K3X A;  5J39 A;  2LRQ A;  5KE2 A;  3I55 Q;  4AT1 B;  1Q86 R;  2EJG A;  2MIO A;  4M78 F;  4IUT A;  2RI5 A;  2RPN A;  1IZ6 A;  1W2B P;  2LQ8 A;  1UGS B;  2K2V A;  3M5A A;  1TS9 A;  2MOX A;  3VS0 A;  3C94 A;  2ENM A;  1NJI C;  1NZ9 A;  4PJO C;  4MML A;  1PWT A;  2JXB A;  2DBM A;  4BDZ A;  3VV0 A;  4BY6 C;  3CD6 A;  2YUP A;  3L1A A;  4PJL A;  1Q81 U;  4OMM A;  1GCP A;  2FZK B;  3P8H A;  4OB3 B;  4FCY A;  2RJC A;  1R0C B;  2O2O A;  4M7A F;  2QEX A;  3QWY A;  3EHR A;  1WJS A;  2CYZ B;  5HCK A;  1Q7Y C;  2XI9 A;  2CH4 W;  2QI2 A;  1K0X A;  4C8Q A;  2ECZ A;  1SF9 A;  2JVV A;  1KHC A;  3EFO B;  4MDW A;  2R5M A;  1TH7 A;  2D1X A;  2J6F A;  1ZUY A;  1E6H A;  2J6K A;  3EGD B;  3CCU A;  3Q1J A;  4F7U F;  3CCM Q;  2MMP A;  2HBP A;  1BKB A;  3FJ5 A;  2JJ9 A;  2K9G A;  5CKB A;  3QSU A;  1PCX A;  3M0S A;  3H9N A;  3JSC A;  3M0T A;  3CC7 T;  1PRM C;  1AD5 A;  4E2F B;  5FU7 C;  2LC4 A;  3AHU A;  3RIR A;  2COY A;  4AG1 C;  2NUP B;  4EMK A;  2OAW A;  1LJO A;  1UGV A;  1WNL A;  4FM4 B;  3CCS Q;  2DA9 A;  2VXF A;  1U1S A;  4IIO A;  2CZ6 B;  2EQK A;  1UFF A;  4OMF B;  3JCM P;  2GCX A;  3QZ5 B;  4JZ4 A;  4M7D B;  2QGG A;  2LZ6 B;  5FWC A;  3UDC A;  1BU1 A;  3E9F A;  2JOY A;  5GAM h;  3VS6 A;  1B34 B;  3OYC A;  2AKL A;  2DER A;  3HFN A;  2RHX A;  3REA B;  1VQP T;  3BDL A;  5LJ5 d;  5FRM A;  2FEI A;  5KYX A;  1S1N A;  4JZ3 A;  3HKS A;  4JLG A;  1AOJ A;  4M77 A;  1IGU A;  1NLP C;  1VQK T;  4ELZ C;  2Y4Y A;  2L3Q A;  4PNO A;  2KQW A;  1TU0 B;  5GAO m;  2H3E B;  4JRI A;  4HCB A;  2V1Q A;  5GAM f;  2DD4 A;  3G71 A;  1VQP A;  4EMG A;  1VQL Q;  2AZS A;  1ZHI A;  1Q81 C;  3QPH A;  5HK0 A;  3RES A;  3SEM A;  1PSE A;  2KEA A;  3GBQ A;  2R57 A;  1RAB B;  3CBP A;  3D7S B;  2RI2 A;  3MEW A;  2QA4 A;  1M2V B;  1MMA A;  1JJ2 P;  5CQY A;  4OMN A;  1WI7 A;  4JPB W;  3EGX A;  4RTW A;  2RF0 A;  3OYK A;  4ESR A;  1ACM B;  2RHI A;  1BI0 A;  2X4J A;  1M27 C;  2F2X A;  4KGV B;  3PGG A;  1TUD A;  2F5T X;  3G4S Q;  3OMC A;  3QYH B;  1B07 A;  2M9U A;  2ZPH B;  3T9N A;  3ZFJ A;  1NYG A;  3TSZ A;  5GAN h;  1WYX A;  2X35 A;  4WTO B;  4HCC A;  1BI3 A;  2HL3 A;  1WQ7 A;  1KG1 A;  4QW2 A;  5GMK j;  1SRM A;  5GAN d;  1I4K 1;  1IHW A;  1LVK A;  1YIJ Q;  3EAE A;  1NM7 A;  3OYG A;  4RTT A;  3GNG A;  2XDB A;  4PJO F;  5CKE A;  2LNV A;  4ZGJ B;  1M5Q 1;  5FU6 C;  4Y92 A;  1M4Z A;  3OYB A;  4JDS A;  5GAN 4;  3PMI A;  2JN0 A;  3P8B B;  5GAN f;  1BI2 A;  4DEX A;  2L3P A;  2FB7 A;  3KFV A;  4KH1 B;  4ZGE B;  4HCZ A;  3BW1 A;  1W1F A;  2EQJ A;  1K73 C;  4E7S A;  2QQS A;  4HT9 A;  4Y28 E;  1UJY A;  2HCK A;  1M90 U;  2EVR A;  4A4E A;  1PHT A;  3JCM e;  2EW3 A;  2XID A;  4FT2 A;  2HSP A;  3EG1 A;  3QJ6 A;  1UDL A;  4RG8 A;  4DA4 A;  3QHS A;  2I2L A;  5IXB A;  1K8A U;  1OV3 A;  1KQ2 A;  2DAQ A;  3C12 A;  4DBF A;  3CC4 T;  4C0D B;  1C1A A;  1VQN T;  2LCL A;  2KR3 A;  1WZO A;  2X4X A;  2XIC A;  5IH2 A;  3RKX A;  4C92 G;  3BDU A;  4C0F A;  1D1B A;  3CPW P;  1KSW A;  2D0Q B;  1WHL A;  3A8H B;  3CCJ Q;  4C0Z A;  2EYY A;  4J9H A;  2CS7 A;  1IO6 A;  4BD3 A;  4BDY A;  2DXC A;  4J9B A;  2OAU A;  3UAT A;  2E12 A;  4QKU A;  1TOV A;  1OQK A;  3M57 A;  2M0O A;  3EFR A;  1PD0 A;  2XKO C;  2YSQ A;  2KRM A;  3G6E T;  4E7I A;  1FMV A;  2ZPB B;  5CK9 A;  2HQX A;  4C8Q C;  3VS7 A;  2EQM A;  2A36 A;  5A2Q E;  5LJ3 h;  4Q5W A;  2A0F B;  1K4U S;  1SHG A;  2P4R A;  5GAO p;  3OYE A;  4GBQ A;  1RUW A;  1GL5 A;  2A7Y A;  3M4Y A;  1IRX A;  3G6E A;  3WVE B;  5FU6 B;  1KC8 U;  1QVG A;  1WIE A; 
#chains in the Genus database with same CATH homology
 4M7D E;  3GOX A;  3LGF A;  3PNW C;  1M1G A;  4M78 D;  1N27 A;  3JCM c;  1BI1 A;  3CME A;  4C92 F;  3MET A;  4ATO A;  3I56 T;  2CZ7 B;  3M58 A;  3GPL A;  5J3B A;  3LWI A;  3V7S A;  2BUD A;  5LJ3 f;  4EMK C;  3M9Q A;  2QQ9 A;  3SWN C;  4M75 G;  5FU7 B;  4XAX B;  1BYM A;  5CIU A;  4C8Q E;  5C0M A;  3CXC S;  4M7D D;  2EQU A;  1VQ4 A;  2LTO A;  5GMK l;  1Y96 B;  4Z02 A;  3LYI A;  1MHN A;  3OYD A;  1K9M U;  1W2B A;  4IKF A;  5L8R E;  4M77 G;  4V2S A;  1O9S A;  1P92 A;  3MEV A;  4M7A E;  3RER A;  5GMK e;  4C92 A;  3DKM A;  1M1F A;  3PTA A;  2OTJ T;  4LDU A;  2MAM A;  1KD1 C;  1N8R C;  3OYY A;  2E6N A;  3FDR A;  5GAM j;  1YHQ A;  1K8A C;  4GY5 A;  5CCA A;  2MI6 A;  4GLK A;  1IRE B;  3LX7 A;  4X9C A;  4JRQ A;  1JBM A;  1BIA A;  1VQO T;  3MEU A;  1NJI U;  2G3R A;  4M7A D;  2HNI A;  1O75 A;  2KVQ G;  1KHI A;  3HRU A;  2X4Y A;  1X6O A;  4BE1 A;  2LCC A;  3V8L A;  4DOW A;  4UC4 A;  5GAM e;  1XTD A;  2VV5 A;  4OB0 B;  3VKI A;  3ZBD A;  2E6Z A;  4VUB A;  4LD9 K;  4O5V A;  3A8G B;  3OMG A;  4HT8 A;  3GIB A;  5CKD A;  4E47 A;  5M9O A;  2QDY B;  4DQ2 A;  2O4X A;  1VQ5 A;  2PUK B;  4FU6 A;  4O6J A;  1S72 T;  5D6X A;  5CAI A;  1U1T A;  4MMK A;  2MWO A;  3SFM A;  3P8D A;  4J6Y A;  4BI3 A;  3RKY A;  3M56 A;  3HL8 A;  4F7U A;  4M78 G;  1KD1 U;  4BAC A;  2V8I A;  2ZCF B;  3NTH A;  5KCH A;  1VQO A;  1Q7Y U;  4FIB A;  1VQ7 T;  4J8O A;  3JRZ A;  3V8J A;  4OGE A;  5GMK h;  4YTL A;  1QVG S;  1Y71 A;  3A8O B;  4FSX A;  1WJQ A;  2H3J A;  2RK1 A;  1XOV A;  2EJF A;  4P5N A;  4M7D G;  3UT1 A;  1WJR A;  4JJN K;  3JCM X;  2C06 A;  4N0A A;  4ZGD B;  2MWP A;  1KQ1 A;  3FIF A;  3TEE A;  2OTL A;  3CC7 A;  4IUU A;  5HKC A;  1ZQ1 A;  1S72 A;  1FXX A;  3CCR A;  3JAM E;  1DJ7 B;  3TRE A;  1I5L A;  4C8Q G;  3FB9 A;  4M75 F;  5GAN 6;  4XTZ A;  3L2Z A;  1Q82 C;  2VYT A;  5AYF A;  4C92 B;  3V7C A;  2A3L A;  4M7A G;  4IUP A;  4XK8 E;  1Y96 A;  2QXF A;  3O8V A;  4J6X A;  2ZPG B;  3KUF A;  4XU1 A;  3V7R A;  2E65 A;  5GAM d;  3OYL A;  3QDR B;  2WSC E;  4J7F A;  2XG8 D;  2B8A A;  4D6W A;  2FYK A;  2XDD A;  1LNX A;  1RL2 A;  4LDY A;  4M75 A;  1WGS A;  4OB1 B;  2JTF A;  2LQK A;  1PSF A;  2AHJ B;  4RCB A;  5CVI A;  1EIF A;  3MP6 A;  3OS2 A;  1Q86 C;  1H64 1;  3VYG A;  2KSS A;  4IUR A;  3OYM A;  5GAN j;  3BFM A;  3WVD B;  4XTU A;  3LLR A;  2D9T A;  1G3T A;  3CCV T;  3JB9 J;  3NTI A;  4CI0 C;  3SD4 A;  3OYA A;  2WSF E;  4C0D C;  4OF1 A;  3PT9 A;  2RM4 A;  3MEA A;  4MDX A;  2PVO B;  4XU3 A;  4A4G A;  3OS0 A;  3CCM A;  2LX9 A;  1UB4 A;  4QQ6 A;  1Q82 U;  4N4H A;  3FEO A;  4OVA A;  4A53 A;  3OS1 A;  3CME T;  5FRO A;  4F7U B;  2XHC A;  4XQ3 A;  3A8L B;  2K3X A;  2RHY A;  2LRQ A;  4MZT A;  3G7Z A;  5KE2 A;  2XK0 A;  5J39 A;  1K9M C;  5IAY A;  2QQB A;  1YCY A;  1Y07 A;  4J6W A;  2EJG A;  2IVW A;  3PMT A;  4IUT A;  4M78 F;  2D6F A;  2RB6 A;  2Y90 A;  5GAN 5;  2RI5 A;  1IZ6 A;  3CCV A;  4BE2 A;  1VQK A;  2LQ8 A;  5CO7 A;  3CMA T;  1I81 A;  1UGS B;  5GAO q;  3M55 A;  2K2V A;  2EAY A;  2KDS A;  3M5A A;  4C5H A;  3FC3 A;  2LT4 A;  4M7D F;  4LDW A;  3C94 A;  5J26 A;  4R56 A;  3L2W A;  2DXT A;  2V8K A;  1NJI C;  1NZ9 A;  1V29 B;  3RMS A;  3OW2 S;  4PJO C;  4MML A;  1YHQ T;  3GF5 A;  4Y91 A;  3HFO A;  3OSS C;  4II1 A;  4M78 A;  1QW1 A;  4ZN1 A;  4C5G A;  4BDZ A;  2PVD B;  2RH2 A;  3G4S T;  3VV0 A;  1M9S A;  2L3R A;  4BY6 C;  3CD6 A;  3H8Z A;  3VYH B;  3X20 B;  5HK3 A;  3GP8 A;  4C8Q F;  3JB9 F;  3L1A A;  3EFS A;  3HP9 A;  4XU2 A;  1Q81 U;  2RD1 A;  3DLM A;  3P8H A;  2QQA A;  4OB3 B;  4E7H A;  4M7D A;  2RJC A;  2P0P A;  3J81 E;  4RCC A;  5A0D A;  4M7A F;  2QEX A;  3V8K A;  3HRS A;  3CMA A;  1JJ2 A;  2VGN A;  2RHZ A;  3HHT B;  4L5G A;  5CR2 A;  1WJS A;  3ER0 A;  3OB9 A;  4M75 B;  4NOY A;  2CYZ B;  1VQ5 T;  1B34 A;  4DOV A;  2XI9 A;  1Q7Y C;  1NE8 A;  2YLB A;  2VC8 A;  2CZ0 B;  3JCM Q;  3JB9 H;  2QI2 A;  2V8J A;  4TVR A;  4C8Q A;  5LJ5 j;  5DLO A;  2JVV A;  1KQS S;  3CCL A;  4M77 B;  1KHC A;  4MDW A;  2VUB A;  2R5M A;  1TH7 A;  1Y7X A;  4ZTF A;  3I55 T;  4M7A A;  1WPY A;  2LVM A;  3H6Z A;  4J5Y A;  4FT4 A;  3CCU A;  3Q1J A;  4F7U F;  2MMP A;  1N9S A;  2K5L A;  2HBP A;  4PKC C;  4PJO E;  1BKB A;  3JCM J;  5LJ5 e;  2KK4 A;  5A0G A;  5CKB A;  3QSU A;  3ZEH A;  5A0L A;  2E64 A;  2DZ9 A;  1OYX A;  2OTL T;  5DM7 R;  3JSC A;  3CC7 T;  1UEB A;  3CCR T;  3WXM B;  3E19 A;  5D6W A;  2E41 A;  1VQL A;  4PJO D;  1UGP B;  1H3Z A;  1R8O B;  2NLU A;  5FU7 C;  2HAX A;  2GFU A;  2LC4 A;  2DXB A;  5CKH A;  3RIR A;  3I55 A;  3AHU A;  2Y4X A;  3VUZ A;  2FVU A;  3S6W A;  4EMK A;  3A5Z B;  1LJO A;  1M1K U;  2R5A A;  3CCJ T;  1WNL A;  4FM4 B;  1HXD A;  2DJZ A;  2DO3 A;  2VXF A;  1I8F A;  2DKG A;  4M78 B;  1U1S A;  3QUI A;  1WQW A;  2CZ6 B;  3OYH A;  2KY9 A;  4OGC A;  3ASK A;  5CQX A;  2EQK A;  2RJF A;  4OP0 A;  3QBY A;  4OMF B;  2FL7 A;  4C5E A;  1ZBX A;  3OW2 A;  3JCM P;  2GCX A;  2YHT A;  3QYG B;  3QZ5 B;  5GMK i;  4BE0 A;  1YI2 T;  4M7D B;  1X01 A;  4KBM B;  2GF7 A;  3M53 A;  2DK3 A;  3UDC A;  5I21 A;  3GLX A;  3CC2 T;  2DTO A;  3E9F A;  1JJ2 S;  2JOY A;  5GAM h;  5LJ3 j;  2P4T A;  3G4S A;  1B34 B;  4M77 F;  3OYC A;  1SSF A;  3HFN A;  2RHX A;  4BI8 B;  5GAO n;  3CCM T;  3SDZ A;  1VQP T;  3BDL A;  4C8Q B;  3CCE A;  4X34 A;  2DVE A;  5LJ5 d;  4EPC A;  5FRM A;  3QZ9 B;  1G5V A;  4XTV A;  3QKJ A;  3GNF B;  5I2S A;  1N6A A;  3E1S A;  4M7A B;  5HY6 A;  3HKS A;  4JLG A;  3LGL A;  5LJ3 e;  1JRI A;  2VGM A;  3MP8 A;  3CBM A;  5GAN 3;  1YI2 A;  1KQS A;  4M77 A;  4A54 A;  2BIV A;  3OQ5 A;  2Y4Y A;  4PJO G;  4ELZ C;  1VQK T;  3CC2 A;  4PNO A;  1QVP A;  2KQW A;  5GAO m;  1XQH A;  3E9G A;  2E5Q A;  4JRI A;  5GAO r;  3CC4 A;  3JCM W;  4HCB A;  4KUI A;  5GAM f;  2DD4 A;  2K3Y A;  5D6Y A;  3G71 A;  1VQN A;  1AHJ B;  4BB7 A;  3CCS T;  1VQP A;  3X28 B;  4KUL A;  4EMG A;  5KCO A;  3UWN A;  5LJ5 g;  1ZHI A;  5GAM g;  1Q81 C;  3DB3 A;  3QPH A;  4BUG A;  2WSE E;  5GAN e;  5HK0 A;  3RES A;  2JNG A;  2PVG B;  5IT9 E;  2K57 A;  2LT1 A;  4RMO A;  1PSE A;  5I2M A;  2DPP B;  5FRN A;  3CD6 T;  3RKW A;  4A4F A;  2L8D A;  2PUO B;  2R57 A;  2M1H A;  4EMK B;  2F5K A;  3SWN B;  3CBP A;  3CPW A;  2RI2 A;  3DB4 A;  3MEW A;  4A4H A;  1KC8 U;  2MF2 A;  4C92 C;  4XTW A;  4CRI A;  5FLX E;  2QA4 A;  2QEX T;  1D3B A;  2JZ2 A;  3J80 E;  5CQY A;  3OS5 A;  1G3S A;  2ZPE B;  3ME9 A;  5GAO l;  4BI4 A;  3OYK A;  3OYF A;  3TCJ A;  3S3O A;  4IUV A;  2DTH A;  2RA2 A;  1UGQ B;  3CPF A;  3CCS A;  2DZC A;  2RHI A;  2DXU A;  5GAN 8;  4ELY C;  3CCL T;  1BI0 A;  2X4J A;  3F70 A;  4RG2 A;  2HD0 A;  3PGG A;  2RI3 A;  3MP1 A;  4XU0 A;  2F5T X;  3FRN A;  5LJ3 d;  4OB2 B;  3OA6 A;  4MZM A;  1VQ6 T;  1QP3 A;  3OMC A;  3QYH B;  3HPW A;  3L42 A;  2L89 A;  4ZN3 A;  3CCU T;  2DD5 A;  2M9U A;  3MHX A;  2ZPH B;  4WF2 A;  2E70 A;  3JCM b;  1G3W A;  3OBW A;  3T9N A;  3ZFJ A;  4FL6 A;  3LWH A;  1OI1 A;  2X4W A;  2DTI A;  2EKO A;  4KUD K;  2JUF A;  4B9X A;  3JCM V;  5GAN h;  4PLI A;  1VIE A;  3X25 B;  2X35 A;  2RK2 A;  2PQW A;  2CKK A;  1YJN T;  4HCC A;  1BI3 A;  2K4Y A;  1WQ7 A;  2RJE A;  4J7I A;  4E7L A;  4QW2 A;  1VQL T;  1KG1 A;  5GMK j;  3VJP A;  4C92 E;  5GAN d;  1I4K 1;  1MGQ A;  4QVZ A;  1M1K C;  4JLI A;  2O01 E;  3M4G A;  3HRT A;  4RKU E;  2ZPI B;  3EAE A;  1VQM T;  2XU8 A;  3OYG A;  5LJ3 g;  2EFI A;  3M54 A;  3GNG A;  1VQ6 A;  2XDB A;  2F69 A;  4PJO F;  4N0A C;  5CKE A;  3M59 A;  2GQV A;  1YJ9 A;  1M90 C;  2LNV A;  4L6V 5;  3VUB A;  3OYN A;  3NFC A;  1M5Q 1;  4N4I A;  5FU6 C;  4C92 D;  4ZGJ B;  3QXE B;  3VU3 C;  1M4Z A;  2PU9 B;  1VQ9 T;  3OYB A;  1RI0 A;  4JDS A;  3CCJ A;  2M16 A;  1VQ8 T;  5GAN 4;  3SB2 A;  2KAF A;  3PMI A;  3JB9 D;  4C8Q D;  3INZ A;  2JN0 A;  3P8B B;  3RMQ A;  5GAN f;  1YJN A;  2IG0 A;  1BI2 A;  1QP2 A;  3I56 A;  3CPW S;  5GAN g;  1HK9 A;  2E10 A;  4PJO A;  2FB7 A;  3URG A;  4ZGE B;  1D3B B;  2CGH A;  4HCZ A;  3BW1 A;  1YIT T;  3J7A F;  1VQM A;  3FLG A;  2EQJ A;  1K73 C;  4NS5 A;  2P0Q A;  2E1H A;  5CKF A;  2RO0 A;  3X26 B;  2GFA A;  1OZ3 A;  2ZPF B;  2K5F A;  3SWN A;  1N9R A;  2QQS A;  4F7U E;  4HT9 A;  4JS4 A;  3PFS A;  4Y28 E;  3CCE T;  4JS5 A;  3PIO A;  1X75 C;  2VXE A;  4M75 C;  1M8V A;  3QG1 A;  1UGR B;  1VQ9 A;  1QVF A;  2OTJ A;  3CBO A;  1YBY A;  1M90 U;  4A4E A;  1VQ8 A;  3A8M B;  3OY9 A;  3S3N A;  1XNI A;  4M77 C;  3JCM e;  2XD0 A;  1U8R A;  3N5B B;  2XID A;  4E7K A;  3PIP A;  4FT2 A;  4LDV A;  3QJ6 A;  3QO3 A;  4RG8 A;  4B9W A;  3QHS A;  4DA4 A;  1N8R U;  1NPR A;  4HKE A;  3FJP A;  1YIT A;  2I2L A;  5EG2 A;  3JB9 I;  1YIJ T;  1K8A U;  2QQR A;  5LJ5 h;  1KQ2 A;  1GXI E;  2DAQ A;  3C12 A;  3CC4 T;  4N4G A;  2DEQ A;  4C0D B;  3RUX A;  3OYI A;  3G71 T;  1VQN T;  1VIF A;  2L5Q A;  2LCL A;  4E7J A;  1JB0 E;  2X4X A;  5GAN 7;  2XIC A;  1K73 U;  3OBY A;  4XTY A;  3RKX A;  5IN1 A;  4C92 G;  3BDU A;  4JRP A;  4JUV A;  4L59 A;  3C95 A;  4C0F A;  4MZP A;  5KH6 A;  4ME7 A;  1FX7 A;  1VUB A;  3JB9 G;  3L2Q A;  1OZ2 A;  4XTX A;  2D0Q B;  1W2B S;  4PL6 A;  3A8H B;  4M75 E;  2QA4 T;  1VQ7 A;  2LDM A;  2FHD A;  2YLC A;  3QII A;  4X9D A;  3OYJ A;  3CCQ T;  1YIJ A;  3L2U A;  3CXC A;  2WAC A;  2RJD A;  4C5I A;  4C0Z A;  3BY7 A;  3X24 B;  1YJW T;  4ZTJ A;  2CS7 A;  4M78 C;  4M77 E;  5C6S A;  5LJ5 f;  2CZ1 B;  2K5I A;  4BD3 A;  4QVD A;  4BDY A;  3MCA B;  3JCM h;  4R55 A;  4PJO B;  4QQD A;  5LL6 S;  3KXT A;  3UPU A;  4M75 D;  2DXC A;  4C0G A;  4J83 A;  2DIQ A;  2OAU A;  2R58 A;  2KMT A;  1FWZ A;  5DLQ E;  4M7D C;  3LH0 A;  2E12 A;  4BY6 B;  2JTM A;  3C4S A;  3JCM d;  4LDX A;  2EIF A;  3R6O A;  3M57 A;  4M77 D;  1KC8 C;  1LOJ A;  2M0O A;  1W4S A;  3EFR A;  2BKD N;  2XKO C;  3QJY A;  4F7U G;  5KE3 A;  4HA8 A;  3G6E T;  4JRK A;  3CCQ A;  4LD6 A;  4E7I A;  2ZPB B;  5CK9 A;  2HQX A;  2O4X B;  3L2V A;  1QVF S;  5GAN 2;  4C8Q C;  1YJW A;  2XDP A;  3NTK A;  1NPP A;  2EQM A;  4PLL A;  1G3Y A;  3CEY A;  4NL3 A;  2ZZD A;  5A2Q E;  5LJ3 h;  4Q5W A;  2HQE A;  4M7A C;  3HSB A;  2EYQ A;  3DLL A;  2YRV A;  3MO8 A;  3JCM f;  4QVC A;  5GAO p;  3OYE A;  4EMH A;  2EJ9 A;  2QTX A;  3LW5 E;  3S3M A;  5GMK m;  3JCM g;  5DY9 A;  1VQ4 T;  3OSV A;  4M78 E;  1BIB A;  4KT0 E;  2RHU A;  1YJ9 T;  3L2R A;  2ZGW A;  4EDU A;  2A7Y A;  2DIG A;  3M4Y A;  4A4K A;  2EWN A;  3G6E A;  3TU4 K;  3WVE B;  4NL2 A;  1Q86 U;  4IUQ A;  5FU6 B;  2P0K A;  1QVG A;  4QQG A;  3KBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...