3UWNA

The 3-mbt repeat domain of l3mbtl1 in complex with a methyl-lysine mimic
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
324
structure length
318
Chain Sequence
ECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein 1
publication title The 3-MBT repeat domain of L3MBTL1 in complex with a methyl-lysine mimic
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 80
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3uwnA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3uwnA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3uwnA03
3OYIA 4HCZA 3P8HA 2DIQA 3O8VA 4E7LA 2O4XB 3LYIA 2RJEA 5KCHA 2RHIA 4A4EA 3OYCA 3PMTA 3OQ5A 2P0KA 2RHYA 3P8DA 4A4GA 3OYMA 2X4XA 3OS0A 3L42A 3CEYA 1MHNA 4II1A 3MEVA 3GOXA 2NLUA 2RI3A 3OYAA 3L2VA 2GF7A 2MWOA 3H6ZA 3ME9A 3SD4A 2F5KA 3OMGA 3DB4A 3H8ZA 4IUQA 4CRIA 4N4IA 1WGSA 4BE1A 4UC4A 2M0OA 2GFUA 3MP6A 2GFAA 4RG2A 3OY9A 4IURA 3FDRA 2L8DA 4ZTJA 5J26A 4NS5A 2RI5A 3QIIA 4OVAA 3S3MA 3F70A 3KUFA 3MO8A 2RJFA 4QQDA 2M16A 2RI2A 4EDUA 3OYFA 2X35A 3MEWA 2M1HA 3OA6A 1SSFA 3L2WA 3OYGA 4BE2A 3MEAA 2E6NA 3BDLA 3S3OA 4C5HA 4BD3A 2DAQA 3QKJA 5D6XA 2HQXA 3LGLA 2K3XA 2DIGA 1OZ3A 3DB3A 3QJ6A 1OYXA 2LRQA 2MWPA 4IUVA 4QQ6A 3OYHA 5FROA 1WJQA 2EFIA 3MP1A 3EAEA 3OMCA 2EQMA 4N4HA 2G3RA 2X4WA 5CIUA 2EQUA 3M9QA 2IG0A 2BIVA 5KH6A 2EQJA 3NTIA 2QQRA 2K3YA 4BE0A 3OB9A 5KE2A 2R57A 2L89A 5IN1A 4C5EA 2YRVA 3C4SA 3LX7A 4QW2A 4B9WA 5C0MA 3NTKA 4ZTFA 3ZEHA 4BDYA 4E7IA 2LTOA 3UT1A 4QQGA 4IUUA 4GY5A 2PQWA 4L59A 3S3NA 3Q1JA 4B9XA 2R5AA 4Q5WA 3LGFA 5D6YA 3OYBA 4E7HA 3FC3A 3OYLA 3OYDA 5J39A 3L2RA 2RO0A 2RHUA 4C5IA 4FU6A 1RI0A 2X4YA 3L2QA 2RHXA 5FRNA 3MEUA 4PL6A 4BACA 2RJCA 2B8AA 3ASKA 5IAYA 5FRMA 3PMIA 3PFSA 1WJRA 3FEOA 5C6SA 3OS1A 5KE3A 2WACA 4BDZA 4N4GA 3OS2A 3DLMA 2E5QA 3PNWC 4PLLA 3S6WA 2QQSA 1G5VA 2RJDA 2EKOA 4X34A 2VYTA 4IUTA 4C5GA 5M9OA 3OYNA 1KHCA 1OI1A 2R5MA 2XDPA 3E9FA 3META 3NTHA 3LH0A 3FLGA 4E7JA 2RHZA 4A4HA 3UWNA 3OYEA 4IKFA 3QBYA 4IUPA 1XNIA 2R58A 2HQEA 2L3RA 2O4XA 4Z02A 3LLRA 3L2UA 2JZ2A 3OYKA 2CKKA 5KCOA 4E7KA 2BUDA 1N27A 3OYJA 2LCCA 1WJSA 3MP8A 4A4FA 2D9TA 1OZ2A 2LVMA 2EQKA 2JTFA 4FL6A 5D6WA 4QVZA 2BKDN 1H3ZA 2XK0A 3E9GA 2FHDA 4PLIA 4LD6A 2LDMA
chains in the Genus database with same CATH superfamily
2W0ZA 4RTTA 1UTIA 2RJEA 2DEUA 4A4EA 3OQ5A 4M7DE 3U23A 2ABLA 1BKBA 2RI3A 3VUZA 2L3SA 4PJLA 1PHTA 3CCSA 2K2MA 4RG2A 2X4JA 3CC7A 3THKA 9ATCB 5J26A 3VS4A 1X6BA 1UB4A 4M77E 4F7UF 2KNBB 3LWIA 4PJOB 2H8HA 3OYGA 5A0GA 1XTDA 3I5RA 2F5TX 1CKAA 2LCSA 2LRQA 2YSQA 1VQ6Q 1BCMA 1RLQC 4BY6B 3M9QA 4TVRA 1V29B 3NTIA 2LNVA 1ZQ1A 1VQ5A 1IGQA 2DD5A 3CCUT 1RAGB 1RAEB 1SHFA 4M7AD 2XG8D 4E2FB 2AHJB 2DZ9A 2GBQA 4LE9A 2Z0WA 2E64A 5D6YA 4XAXB 2RQTA 1VQ9T 4GBQA 1IB8A 3A8HB 4C5IA 3X26B 1RACB 2JXBA 2DO3A 1ZA1B 1NYGA 3OS1A 5KE3A 1XJWB 3SWNC 2F1LA 2RJDA 2COWA 1AHJB 5M9OA 1VQMT 4N0AC 2JNGA 1V76A 2FZKB 4M7AF 2OTJQ 1YP5A 4J9BA 3JCMf 1UFFA 1AOJA 2CKKA 2QAZA 4KRTA 1KD1R 1AWJA 1OEBA 2C0OA 4OMNA 2EQKA 2KI7A 2O31A 1O75A 2BKDN 3M0UA 3E9GA 1Z9QA 1N5ZA 4JRIA 5LJ3h 2YUQA 4FYXB 4ELZC 1D0ZA 3LYIA 4FCYA 2RD1A 2RHYA 2HEQA 1UG1A 3EH1A 2LNHB 2QA4A 5GAN4 1YIJQ 3VKIA 2YLBA 3JV3A 2F5KA 1I0CA 3OMGA 1K73R 4OB2B 1WHGA 3CC4T 2K4YA 2VKNA 1GL5A 5A0DA 1VYTA 1YITT 3QIIA 2KYBA 4PJOD 4J6XA 4XTUA 3VV0A 2NUPA 5EC7A 3NPFA 1PCXA 3EFOA 1WDXA 3S3OA 1SSHA 1PD0A 3QJYA 1K0XA 1EFNA 2KYMA 3CC7T 3EAEA 2DVEA 1PC0A 3T9NA 1TOVA 3M5AA 2K5IA 2BIVA 4C92C 3JB9G 2QQRA 3EFOB 3RERA 3EG9A 5GAOm 4LDXA 1OPKA 3CCEA 3C4SA 3UPUA 3PGGA 4B9XA 1G2BA 4RG8A 5I11A 1M1FA 2ZPBB 4Z8AA 1GCQC 4C8QC 3CCVA 1P92A 3EG9B 5CVIA 2CZ6B 1VQPQ 3H9NA 1MV3A 2FZCB 2EGCA 2PZ1A 3HL8A 4EMGA 2DTOA 4FW2A 1H641 2E70A 5LJ3e 1K76A 2P84A 3QZ5B 2R58A 2KQWA 1KC8U 3PT9A 3X28B 1M3BA 2YUOA 4PJOE 4JJNK 2X3XD 2XK0A 1YJNT 1NYFA 3LWHA 1OV3A 1ZSGA 2ROTA 4Y92A 1WYXA 3CD6Q 3TSWA 4WCIA 3JCMb 1BIBA 4QVCA 1IXDA 2X4XA 5GANd 1VQLA 2WSCE 2LMJA 1IHVA 3LH5A 2JMCA 3D7SB 4BI4A 2YRCA 4NS5A 2FO0A 1Q7YU 5KYXB 3J81E 3OYFA 4OP0A 1HK9A 5FW9A 2BZ8A 1FMWA 2FZGB 2DL8A 2I0NA 1OZ3A 3EGXA 3X25B 3CCMQ 5LJ5h 1VQKA 3SWNA 4OMLA 3V8LA 2E41A 5GANe 1ZUKA 4N0AA 1JXMA 2FYKA 1DJ7B 1KK7A 2WSFE 2DF6A 2MCNA 2RQUA 4MMKA 3CMAA 2GTJA 4ZN1A 3L2RA 2RO0A 2VUBA 1JB0E 2EKHA 1OOTA 4D8DA 1R0BG 3CCET 5C6SA 3WVDB 2D8HA 2EYQA 2QGFB 3DLMA 4X34A 3CCRQ 2A36A 1D1CA 2V1RA 4E7JA 3CMEA 3NHNA 4PFZA 1YI2Q 1TG0A 2VXEA 2KY9A 5CQYA 1QP2A 3V7CA 1FXXA 2DZCA 4HXJA 2D9TA 2ZPHB 2XD0A 5FU6C 1FX7A 4AG2C 2XDBA 3CXCA 4PLIA 1ZBJA 1TUCA 3QUIA 3RMSA 1QVFS 2QEXQ 3OYCA 3M0TA 4OMOA 3I56A 1NM7A 4DEYA 3CPWA 1KJWA 1VQ8A 4CI0C 3M57A 2LZ6B 1R0CB 2MWOA 3TREA 3VS7A 3EGDA 4KH1B 1YHQQ 1VQOA 5LJ5e 1QVFA 1PRLC 4C0GA 4NL3A 2DXBA 3H0FA 1NEBA 2C0IA 4E7ZA 4C8QA 3OS5A 2KT1A 1G3YA 1N9SA 1VQNA 4BD3A 1VQ4A 4M7DG 2EWNA 3CCQT 4J8OA 4OB1B 2QGGA 5CIUA 4M78G 5KH6A 2EQJA 4AFQC 3CC2Q 4JJDA 1T3SA 3C94A 4QW2A 1KG1A 4M77G 1M90R 1R8OB 1RAAB 2OTLA 4Q5WA 3OYDA 2E4HA 3JCMh 4E47A 2COZA 1ACMB 3UF4A 3FEOA 4LNPA 2COYA 4DBRA 2QQSA 4J9IA 3CMAT 8ATCB 1OPLA 2CP6A 2HKQB 4M78B 3HTRA 3M0SA 4XTZA 5LJ3j 4CC4B 2CDTA 1M90C 2EGEA 3E1SA 5KYYB 3PVQA 3OYJA 4J9CA 2OAUA 3LW5E 4IIOA 2KSSA 2SRCA 1KSWA 2VVKA 1GRIA 5I2MA 2D0NA 1Q86U 2XKOC 2LDMA 2YHTA 2OTJT 3CMET 3OSSC 1UGQB 2RHIA 2P0KA 3L42A 4C0DB 1TS9A 4F7UA 2VC8A 5GAOn 1D3BA 3OYAA 4M75C 2ZPFB 1ABOA 3H8ZA 1WGSA 4BE1A 2C06A 2E6ZA 4LN2A 4ZGJB 1Q81R 1YFNA 3KFVA 4MDWA 3VS5A 3CCJA 1JO8A 2GQIA 3F70A 1D09B 4PJMA 5CQXA 2HQHA 4F7UB 4BE2A 3AT1B 1WHKA 2E6NA 3QXEB 3QSUA 2F69A 3I55Q 2JTEA 2QG9B 5FU7C 5J3BA 1GCPA 3REAB 1WI7A 3M54A 1TWBA 1WHLA 3HPWA 2EQUA 1Z9ZA 5GMKl 3JB9H 2K6DA 4DOVA 5GANj 1Q81C 1VQNT 3JCMe 5KE2A 3CBOA 2DILA 3AHUA 2BE7D 1VQ4T 4JS4A 5I2SA 4M7AG 4C92F 3M0PA 2ZGWA 4NL2A 4E7IA 3SDZA 1S72Q 5CKFA 2KROA 3ULRB 1XOVA 4L59A 2EW3A 2PUKB 2ENMA 2XIDA 5HK0A 2V8KA 5IXFA 2CS7A 3HSBA 4C8QF 2EVRA 1UDLA 3PMIA 1VQ9A 4BDZA 3HRSA 4M78D 2EIFA 4IUTA 2OTLT 2QDLA 1M27C 1HJDA 1CSKA 1RL2A 1PRMC 2DA9A 5CK9A 3G6EQ 4IKFA 3QYGB 4M7AB 2GNCA 1YJ9T 1PSFA 5KYWB 3JAME 1VQMA 3VS0A 3RKWA 1WNLA 4QVZA 1RABB 1E6HA 2BZYA 2DIQA 5FWBA 3PMTA 4J7FA 5I22A 2K3BA 2QQAA 1Y07A 2J06A 4FW1A 4II1A 1YJWA 4XU2A 3CCVQ 4FM4B 4J6WA 3INZA 2GFUA 1JJ2S 2DERA 2P4RA 4PJOG 5LJ5j 2OAWA 2PNIA 3O5ZA 1A0NB 1BB9A 1X6OA 2DNUA 2DVJA 3CC4A 4OMMA 4QQDA 4JPBW 3QHSA 2PVDB 2QQBA 3M56A 4HVVA 1IRXA 1YITA 2LT1A 1JJ2A 2JS0A 1SPKA 3SEMA 1MUZA 1OX9A 1WJQA 3MP1A 3CCJT 4RMOA 4M78E 3CCLQ 1R77A 5HY6A 2ESWA 1IREB 1B07A 5GAN8 4ELYC 1CKBA 4DEXA 5IN1A 1QW1A 2E10A 5C0MA 4FSSA 2LTOA 4IUUA 1Q82U 3MPUB 1ZUYA 1VQLQ 3SFMA 3ZL7C 1UGSB 1Y96A 5CKHA 2AK5A 2EGAA 3MEUA 2K7AA 1WJRA 2DL3A 1N6AA 1X75C 4M75A 4M4ZA 1KHCA 1KQ1A 1Y96B 4AFUC 1LNXA 1VQKQ 1VYUA 3HHTB 5HKCA 3C12A 1H8KA 1N27A 4F7UE 3EFSA 3JRZA 1V1CA 4FYWB 3CCRT 4OF1A 1M8MA 1UGRB 3BFMA 5D7UA 4LD9K 1TTHB 4LDVA 1WXTA 1YJNA 2XHCA 1MHNA 1NPRA 4JRPA 2NLUA 3VYGA 3C0CA 1I5OB 3ER0A 1AZGB 3OSVA 1ABQA 5FWCA 3A8MB 2BTTA 2L0AA 3KUFA 1MGQA 4RTXA 2QTVA 1UGVA 1YJWT 2M1HA 3VS2A 1YHQT 5CO7A 2O9SA 3QKJA 4LDYA 1PSEA 1WQ7A 2YT6A 1TUGB 2LX7A 4JLGA 3H41A 2MOXA 1SHGA 1RAFB 3EHRA 2CZ7B 4R55A 3CPFA 4LDUA 4JJCA 4M7AE 4BE0A 3OB9A 2CP2A 2RNAA 4LUEA 4EIKA 1W1FA 3I56Q 3HFOA 2KK4A 3VRZA 4BDYA 3G1JA 4QQGA 1BCOA 2PQWA 1M1GA 1VQ8Q 2RQWA 3OYLA 4A53A 1VQ7Q 1TUDA 4FU6A 2EYXA 1VQOQ 4J7IA 2CZ1B 2NUPB 1K9AA 1WXUA 1M1KC 2E5QA 1JU5C 4X1VA 1RAHB 2CP5A 3META 3G71Q 4AMCA 1JQQA 3QBYA 3BW1A 2HD0A 2CYZB 4Z02A 2DBMA 2L3QA 3EG3A 2DXUA 1NPPA 4K11A 5GANh 3KBGA 5EG2A 4LXCA 1M1KU 4MZMA 2DPPB 2RN8A 5D6WA 1KC8C 3HRUA 1KQ2A 1H3ZA 1NE8A 2MF2A 2FHDA 1HSQA 2RH2A 2A3LA 3FDRA 1TU0B 1W2BA 3OYMA 1Q7YR 4PK4A 1MMNA 3MKDA 5GAOl 1ZBXA 1ZSZC 3N5BB 2W10A 5LJ3g 4RUGA 5IT9E 4M75F 4J83A 1QWFA 3JB9J 2QTXA 4OGEA 2XU8A 2KT8A 3J80E 2D0QB 2RJFA 1U8RA 2VWFA 2P4TA 4JZ4A 2CGHA 3OA6A 2DK3A 1JEGA 3CQTA 3X20B 3IQLA 2HQXA 4M7DC 1Q7YC 3SHWA 5FROA 4RCBA 3G4SQ 1KHIA 4EMKC 2J6FA 1U5SA 4HVUA 2CH4A 3CCQA 1GFCA 2PVOB 4J9DA 1K9MU 4V2SA 3R6NA 1TXQA 4PJJA 2KRNA 4ZTFA 2FEIA 4M77C 5GAN2 5GAN7 3LGFA 3FC3A 2AIRB 1BI0A 1FYNA 2RHUA 2A7YA 1PWTA 3L2QA 3JCMV 4RTUA 3L1AA 2NUTA 4P5NA 1NZ9A 1G5VA 2LJ3A 5GANg 1UUEA 3EGXB 3NTHA 3JCMP 2MAMA 4RCCA 1C1AA 3OYEA 3SWNB 2YUNA 2DRKA 2L3RA 3RR6A 5CAIA 5DLQE 4F14A 3SB2A 2BUDA 4A4FA 3GBQA 3QZ9B 5KYUA 1G83A 4MZPA 2IVWA 4HCZA 3C95A 3RMQA 1U06A 3CXCS 2ECZA 4ME7A 2OTJA 3L2VA 3CCUQ 3OW2S 2RK2A 1M2VA 4KULA 4JLIA 1FMKA 2KXCA 3NFCA 3CPWS 1IGUA 2LJ0A 1QVGS 2GTOA 3EG1A 4X9DA 4EDUA 3OW2A 2KRMA 1BK2A 4WF2A 5L8RE 3I35A 2DAQA 5GAOq 1YIJA 3LGLA 2DIGA 4C8QG 4C92A 1QVGA 4OMPA 2FPFA 2EJ9A 2EQMA 4Z88A 1EX4A 2FRYA 1LVKA 3A5ZB 2L89A 2FPEA 5LJ5g 2HSEB 1B34A 1GCQA 3JB9F 4C92B 1KQSA 3NTKA 4GY5A 3EGDB 2EYZA 3RKXA 4JRKA 4RKUE 1GFDA 4WTOB 2DRMA 3GPLA 2FL7A 4C8QB 3PFSA 3BE3A 1S1NA 2WACA 4MZTA 1K8AU 3OS2A 3CC4Q 2CT4A 1ZSZA 2LQKA 1Q86R 2QI2A 3CXCP 1G3TA 1YITQ 3M0QA 4BI8B 1VQ6T 4IUPA 4OGCA 2O4XA 4KUIA 1HXDA 4DBHA 3LLRA 2JZ2A 4AT1B 2LC4A 4QT7A 2A08A 2LCCA 2M02A 3CCSQ 2I2LA 2DL7A 1YN8A 1YJ9A 3CC7Q 1SEMA 2CUDA 1N8RU 4M7DA 2K79A 3P8HA 4E7LA 2HL3A 2O4XB 1QVFP 2ROLA 3P8DA 2DXCA 1PKSA 1I5LA 1AD5A 1QKWA 1Q86C 2K5FA 1Y71A 2L3PA 2XDDA 2RQRA 3H6ZA 4HT9A 3QWYA 1PM3A 1IO6A 3A8LB 2QASA 4C0ZA 4F7UG 4PJOC 1QCFA 1Y57A 5A2QE 3PE0A 1LOJA 3S3MA 2LP5A 3KXTA 1VQ5Q 2M16A 1ARKA 1W70A 2QYZA 2VXFA 2V26A 1TSFA 2VB6A 5D6XA 1UECA 3QJ6A 3DB3A 4BY6C 5CR2A 2KR3A 2X51A 4F04B 3EGUA 2HDAA 4O5VA 4KH0B 2MK5A 3OMCA 1G3WA 1NEGA 1X27A 3GLXA 1VUBA 3JCMW 2JT4A 2HBWA 4DBQA 1VIFA 2IG0A 2JOYA 3H0IA 1Y0MA 4GLMA 1NJIU 2Y4YA 4C92D 2JW4A 1YIJT 1D3BB 1X43A 1YJNQ 1OX8A 2HZYA 2JTMA 3M58A 1X2QA 2L2PA 1VIEA 3V8KA 4C8QD 1SRLA 2EAYA 4J9EA 2J6KA 2DKGA 2L5QA 5FRMA 1RUWA 2IIMA 5IAYA 1H3HA 1G8XA 2VYTA 5DY9A 3E9FA 2NUZA 1WA7A 2V8IA 4J9FA 3GP8A 4BB7A 2G6FX 3JCMg 2QA4Q 2LJ1A 2HQEA 1U3OA 3OYKA 1GBRA 5GAMd 4BI3A 3M4YA 3VS6A 1WJSA 2KRSA 2A37A 3V7SA 2E5KA 2GQVA 4QVDA 1UGPB 1EIFA 3M4GA 2DJQA 5FU6B 3EHQA 3CCRA 1UJYA 4A4GA 1FWZA 1W4SA 1WHMA 1QMCA 2A0FB 2DD4A 1VQPT 3GOXA 1YI2A 2KAFA 2K5LA 1M3CA 3HRTA 4RTZA 2WSEE 4C92E 2PTKA 4XK8E 4RTYA 2KXDA 2L8DA 5GAMe 2HCKA 4OVAA 3UATA 1YBYA 3HFNA 1I1JA 2X35A 2QEXA 3CCEQ 2M51A 4PKCC 2GCXA 5GAOr 1KFZA 5GAN5 4C8QE 2EYWA 2QQ9A 5HCKA 4XU0A 4EMHA 4JJBA 4A54A 2DXTA 1JRIA 3OYHA 1Q82R 1YHQA 3CBMA 2RMOA 2X4WA 3QWXX 3CD6T 4M7DF 1ZLMA 2JUFA 3LX7A 2ZPGB 3RDVA 2Y4XA 2C0TA 2SEMA 3RNJA 4M77F 4ATOA 2DL5A 2RHXA 4RTVA 3GNFB 1Q82C 2OX7A 2M0YA 2B8AA 2OJ2A 1M9SA 2D1XA 3QYHB 3RIRA 3CC2A 4Z89A 3JCMQ 1HD3A 2MMPA 4D8KA 4ZN3A 5CKDA 3CCMT 3M0RA 2RK1A 4HA8A 1ZUUA 3FIFA 2MIOA 3QDFA 1XNIA 4PJOA 4M75G 1RAIB 1MMGA 1TH7A 3RBBB 1AEYA 3MP8A 4C0FA 2JTFA 3VU3C 1WQWA 2HAXA 1WZOA 3CCQQ 4LDWA 2E65A 1I81A 4LD6A 2PVGB 3PVLA 1C6VX 3MHXA 3O8VA 4Y91A 5IHKA 1ZA2B 1RADB 1OULA 3CEYA 3UDCA 4J9HA 3A98A 1LPLA 3PTAA 2BE9B 1SG5A 1AWOA 4N4IA 1JJ2P 4R0KA 3RKYA 1D0XA 4DA4A 3QPHA 4M75B 1FMVA 1NLOC 4R56A 1UJ0A 2V8JA 4DQ2A 4PJNA 1YI2T 2FRWA 3OYYA 3EG2A 2X3WD 4JDSA 3CMAQ 2CUBA 3H0HA 1UEBA 2G3RA 1QVPA 1VA7A 1BYMA 5FU7B 5AT1B 4JZ3A 2QEXT 4AG1C 1M4ZA 2BZXA 2DFUA 2VV5A 2KGTA 2RM4A 2YRVA 2DYBA 3FB9A 4XU3A 3UA6A 2NWMA 5GAN3 2QDYB 4NOYA 4XTWA 1K4US 2LQ8A 3I55A 1X6GA 3CMEQ 2R5AA 3OBYA 1M2OA 1M3AA 1J3TA 1M1KR 4ORZA 1I8FA 3JB9I 4VUBA 1D1AA 2EJGA 3S6WA 4E7SA 3DKMA 4B6MA 3VS1A 3I9QA 3FLGA 1S72A 2FVUA 3UWNA 4CC3A 2RF0A 2M9UA 2ZPIB 3TU4K 2EYYA 5GAMf 4E7KA 2V1QA 3ZFJA 3CC2T 1WPYA 4XTXA 1KC8R 1KD1C 4FL6A 2JVVA 1BBZA 2B86A 4A4KA 1M30A 1M5Q1 2MI6A 5KCHA 1K0SA 1WIEA 3VS3A 2AKKA 2H3EB 3G6EA 3OS0A 4HKEA 1VQNQ 2CZ0B 2RQVA 5A0LA 1KD1U 3E19A 3CCST 1QCNA 1VQ4Q 1NLPC 1YCYA 3JSCA 1W2BS 1D1BA 3SD4A 2EQIA 4X9CA 4M75D 4CRIA 1PD1A 1H92A 1E7OA 1K73C 2RB6A 5LJ3d 3OY9A 2DTIA 2DX1A 1RI9A 2LQWA 5GAMj 1SKUB 1GBQA 4PJOF 1SSFA 4OMQA 1K9MR 2NYSA 1AVZC 2ED0A 2JS2A 2KMTA 3HKSA 1K73U 2DEQA 3EH2A 2OTLQ 3URGA 2KE9A 4L6V5 4ESRA 2ZAEA 3WVEB 1MMDA 2JN0A 1VQ5T 4OMFB 2JM8A 8AT1B 1YJ9Q 3PIOA 4ANJA 2K3YA 1VYVA 2CT3A 4HCKA 4XQ3A 1K1ZA 1QCOA 1NBEB 2YLCA 1B3QA 2J6OA 1W6XA 5GMKh 1B7TA 1UHFA 2A28A 2QXFA 1EZZB 2HMAA 2HNIA 1K9MC 4KUDK 1AZEA 5GAN6 1O9SA 5J39A 4FT4A 3CCLA 1RI0A 1ZHIA 1OU8A 4OB0B 4PL6A 2GGRA 4FT2A 4J9GA 4M78C 2LCLA 3PNWC 4XU1A 4PLLA 2HBPA 3I55T 1OI1A 2R5MA 4M75E 5HK3A 3JCMJ 1WFWA 5KYXA 2LX9A 3G7ZA 4KGVB 2ZCFB 1W2BP 3TCJA 1LJOA 2P0PA 2AZVA 3V8JA 3FRNA 5IXBA 2PUOB 1VQ6A 1T0HA 4D6WA 2J05A 2J7IA 3R6OA 2CP0A 2YRDA 1JXOA 3E2UA 3I5SA 3CCJQ 2QA4T 4Y28E 1S72T 2DE0X 4C0DC 3MCAB 4ZNXA 5IHNA 2CREA 2CSQA 4QKUA 1MV0B 3MEVA 1D0YA 3OBWA 3RUXA 5IH2A 2IPOB 3L2ZA 4MMLA 4IUQA 2M0OA 2NUTB 2XICA 1RLPC 3G6ET 2DBKA 2RI5A 3MO8A 1MNDA 3CBPA 3GF5A 1BI2A 2RI2A 3MEWA 2HL5C 1JBMA 2F2VA 4HT8A 2O01E 4ZGEB 4C5HA 4FIBA 5GJVB 2CP7A 5KYUB 5GMKe 2MWPA 3TSZA 4KBMB 2AZSA 3M55A 4C92G 1VQ9Q 1T3LA 2KBTA 4BUGA 3JB9D 4PFPA 1QP3A 4C5EA 1K8AR 4B9WA 3CCVT 5CKEA 3GIBA 1UE9A 1M2VB 5IHIA 5GMKi 4O6JA 5LJ5d 2RA2A 3QG1A 4F16A 4HCCA 2YUPA 4RTWA 3OYBA 4E7HA 4EPCA 1AT1B 2CSIA 1VQMQ 1KQSS 1GXIE 4FYVB 1SRMA 1PNJA 4A63B 2RJCA 1BI3A 2MYSA 1WHHA 1U1SA 2FB7A 4J6YA 4MDXA 4M7AC 1WLPB 1N8RR 3LH0A 2ATCB 1X69A 3QO3A 3EG0A 3CCLT 1WHJA 1K8AC 3BDUA 4FSXA 1YJWQ 3VRYA 1VQ7A 3ZBDA 2F2WA 1X01A 2YWWA 1C0MA 1KIKA 1OZ2A 4XTVA 3RESA 1N9RA 3M53A 3A8GB 7AT1B 1B34B 1NG2A 1PG5B 1QQJA 2D8JA 2ZPEB 4ZGDB 1VQLT 4JS5A 2FG0A 3G71A 2DTHA 1I4K1 4PNOA 2H3JA 1N8RC 1ZX6A 2YDLA 3OW2P 2GF7A 3ME9A 3DB4A 4DBFA 2VGNA 3CPWP 1VQPA 3MP6A 2O2OA 2GFAA 5LJ3f 1QVGP 4HCBA 1ZSZB 3VJPA 4ZTJA 3PIPA 2EBPA 2ED1A 2HSPA 1VQKT 4E6RA 1NJIR 3L2WA 2EJFA 3MEAA 4FYYB 2LT4A 3BDLA 1QKXA 3MJXA 4J5YA 5CKBA 2K3XA 3FJ5A 4EMKA 2DM1A 4M78A 1IZ6A 2ZZDA 1KQSP 4QQ6A 4KGZB 4PFOA 1F1BB 2O9VA 3BY7A 4N4HA 2VGMA 3M59A 2JMAA 4M7DB 5KYYA 4M77A 2DL4A 1QLYA 3CD6A 4EMKB 5L23A 2DYIA 3UA7A 3JCMX 2KVQG 3UT1A 5LL6S 2KDSA 1SF9A 3QDRB 4IIMA 3Q1JA 3S3NA 1NJIC 2HKNA 1Y7XA 3EFRA 2E12A 1HYOA 4M77B 2E3HA 3G4SA 1MMAA 2AT1B 5GAMh 2DJZA 5FRNA 4BACA 3ASKA 1YNZA 2AKLA 4N4GA 4XTYA 5CCAA 1WXBA 1M90U 4JRQA 2XDPA 2XMFA 1IHWA 3VUBA 5GMKm 2RHZA 4A4HA 5GANf 5DLOA 2VASA 4DOWA 1QWEA 3L2UA 5DM7R 3CCMA 3NGPA 1LCKA 3JCMd 1BI1A 1AWXA 1OU9A 5ECAA 2FPDA 2CH4W 1G3SA 3I56T 2Y90A 1AWWA 2P0QA 3OYIA 4AFSC 2DMOA 1VQ8T 5GAOp 1YCSB 1VQ7T 1XQHA 1U1TA 1VQOT 4CC7A 2CP3A 4CC2A 4AFZC 2JJ9A 2D6FA 3P8BB 2OI3A 4UC4A 2F2XA 3NMZC 4IURA 3G71T 3HP9A 2O88A 3WXMB 1M8VA 3J7AF 3TQ7P 1YWOA 4LUDA 3CCUA 1OYXA 1Q81U 2E1HA 4IUVA 4M7DD 2EFIA 1PKTA 5GMKj 1MNEA 2YXYA 4M7AA 5KYWA 2XI9A 4OB3B 1VOMA 1UHCA 2KEAA 3TVTA 2EPDA 2R57A 3GNGA 3A1PA 6AT1B 1X2KA 3ZEHA 1I07A 3A8OB 5LJ5f 3JCMc 1E6GA 5GAMg 2K57A 2DETA 4M77D 2E3IA 1T0JA 3TEEA 3FJPA 3VYHB 2X4YA 5AYFA 2RPNA 4HVWA 4KGXB 1OQKA 1BU1A 2JM9A 2MPXC 4GLKA 3V7RA 3DLLA 5I21A 2EKOA 2QK0A 4C5GA 3OYNA 4M78F 2X9HA 3REBB 5GJWB 4F17A 3G4ST 2K9GA 1YWPA 5KCOA 1BIAA 4JUVA 4YTLA 1Q95G 2LVMA 3X24B 4L5GA 2DLPA 2K2VA 5KYNA 2LQNA 1WX6A 4KT0E 5FLXE 2PU9B
chains in the Genus database with same CATH topology
2YHTA 4HCZA 2MI6A 2OTJT 3CMET 3OSSC 5KCHA 2RJEA 1UGQB 3C95A 3RMQA 2RHIA 4A4EA 3OQ5A 2P0KA 4M7DE 3G6EA 3OS0A 3L42A 4HKEA 2CZ0B 5A0LA 3CXCS 3E19A 4C0DB 1KD1U 3CCST 1BKBA 4ME7A 4F7UA 2OTJA 2RI3A 2VC8A 5GAOn 1D3BA 3OYAA 4M75C 3VUZA 1YCYA 2RK2A 3JSCA 3L2VA 4KULA 3OW2S 1W2BS 4JLIA 3SD4A 4X9CA 2ZPFB 4M75D 3H8ZA 4CRIA 1WGSA 4BE1A 3NFCA 2E6ZA 3CPWS 2C06A 3CCSA 4RG2A 4ZGJB 1K73C 2RB6A 2X4JA 5LJ3d 3OY9A 3CC7A 1QVGS 4MDWA 2DTIA 5J26A 3CCJA 4X9DA 3F70A 1UB4A 4M77E 5GAMj 4F7UF 5CQXA 4PJOF 4EDUA 4F7UB 3OW2A 3LWIA 4PJOB 4WF2A 1SSFA 5L8RE 3OYGA 5A0GA 4BE2A 2E6NA 3QXEB 3QSUA 2DAQA 2KMTA 3HKSA 5GAOq 1YIJA 1XTDA 2F69A 1K73U 2DEQA 3LGLA 2DIGA 2F5TX 4C8QG 3URGA 4C92A 1QVGA 5J3BA 2LRQA 4L6V5 5FU7C 3M54A 3WVEB 2EJ9A 2EQMA 2JN0A 1VQ5T 3HPWA 4OMFB 4BY6B 2EQUA 3M9QA 4TVRA 3PIOA 1V29B 5GMKl 3A5ZB 3NTIA 3JB9H 4DOVA 5GANj 2K3YA 4XQ3A 1Q81C 3JCMe 5KE2A 2LNVA 1ZQ1A 1VQNT 3CBOA 1VQ5A 2L89A 3AHUA 1VQ4T 4JS4A 5I2SA 4M7AG 2DD5A 2YLCA 4C92F 5LJ5g 1B34A 3CCUT 3JB9F 4C92B 1KQSA 2ZGWA 3NTKA 4NL2A 5GMKh 4M7AD 4E7IA 2XG8D 3SDZA 2QXFA 5CKFA 2AHJB 1XOVA 2DZ9A 4GY5A 4L59A 2HNIA 2E64A 5D6YA 4XAXB 3RKXA 1K9MC 2PUKB 4KUDK 1VQ9T 5GAN6 1O9SA 2XIDA 3A8HB 4JRKA 5J39A 5HK0A 2V8KA 4FT4A 4C5IA 3X26B 4RKUE 3CCLA 1RI0A 1ZHIA 2CS7A 3HSBA 3GPLA 2DO3A 4OB0B 4C8QF 4PL6A 2FL7A 4C8QB 4FT2A 3PMIA 3PFSA 1VQ9A 4M78C 4BDZA 3OS1A 5KE3A 2WACA 4MZTA 1K8AU 3OS2A 2LCLA 3PNWC 3SWNC 4XU1A 4PLLA 3HRSA 4M78D 2HBPA 3I55T 2RJDA 2EIFA 4IUTA 2OTLT 1AHJB 5M9OA 1OI1A 2LQKA 2R5MA 1VQMT 2QI2A 1RL2A 4M75E 1G3TA 2JNGA 4N0AC 5CK9A 5HK3A 4BI8B 3JCMJ 2LX9A 3G7ZA 4IUPA 1VQ6T 4OGCA 2ZCFB 2O4XA 4KUIA 1HXDA 4M7AF 3QYGB 3LLRA 3TCJA 4M7AB 3JCMf 2JZ2A 1LJOA 2P0PA 2LC4A 2CKKA 1PSFA 1YJ9T 3V8JA 3JAME 1VQMA 3FRNA 2LCCA 2PUOB 1VQ6A 4D6WA 3RKWA 1WNLA 2EQKA 2I2LA 4QVZA 1O75A 3R6OA 2BKDN 1YJ9A 3E9GA 1S72T 4JRIA 1N8RU 2QA4T 5LJ3h 4Y28E 4M7DA 4C0DC 4ELZC 3P8HA 2DIQA 4E7LA 2O4XB 3LYIA 2RD1A 3PMTA 3MCAB 2RHYA 3P8DA 2DXCA 4J7FA 2QQAA 1Y07A 1I5LA 4II1A 2QA4A 5GAN4 3MEVA 3OBWA 3VKIA 1Q86C 2YLBA 2K5FA 1Y71A 3RUXA 1YJWA 4XU2A 2XDDA 3H6ZA 4HT9A 4FM4B 3L2ZA 2F5KA 4MMLA 3OMGA 4J6WA 3INZA 4IUQA 4OB2B 3CC4T 3A8LB 2M0OA 2GFUA 2K4YA 2XICA 1JJ2S 4C0ZA 4F7UG 4PJOC 4PJOG 5A0DA 5LJ5j 5A2QE 3G6ET 1LOJA 2RI5A 3QIIA 1YITT 4PJOD 3S3MA 3MO8A 4J6XA 1X6OA 3KXTA 3CC4A 3CBPA 4QQDA 2M16A 1BI2A 2RI2A 3GF5A 3QHSA 2PVDB 3MEWA 4XTUA 3VV0A 1JBMA 2QQBA 2VXFA 3M56A 4HT8A 2O01E 4ZGEB 3S3OA 4C5HA 1YITA 4FIBA 2LT1A 5D6XA 1JJ2A 3QJ6A 3DB3A 3QJYA 4BY6C 5GMKe 5CR2A 2MWPA 3CC7T 4O5VA 1WJQA 3MP1A 3EAEA 1G3WA 3OMCA 3CCJT 2DVEA 4RMOA 3GLXA 1VUBA 4KBMB 4M78E 3T9NA 3M5AA 5HY6A 5GAN8 1IREB 3JCMW 2K5IA 1VIFA 2IG0A 2JOYA 2BIVA 3M55A 4C92C 4C92G 3JB9G 2QQRA 3RERA 5GAOm 1NJIU 4BUGA 2Y4YA 4ELYC 4LDXA 4C92D 3JB9D 1YIJT 1QP3A 5IN1A 4C5EA 1QW1A 3CCEA 3C4SA 2E10A 4B9WA 5C0MA 5CKEA 1D3BB 3CCVT 3UPUA 3GIBA 2LTOA 3PGGA 3M58A 2JTMA 4O6JA 4IUUA 5GMKi 5LJ5d 1Q82U 2RA2A 3QG1A 4B9XA 4HCCA 4RG8A 3SFMA 3OYBA 4E7HA 1M1FA 1UGSB 2ZPBB 4C8QC 4EPCA 1VIEA 1Y96A 3CCVA 1KQSS 1GXIE 1P92A 5CVIA 3V8KA 2CZ6B 4C8QD 5CKHA 2EAYA 2DKGA 3MEUA 2L5QA 2RJCA 5FRMA 5IAYA 1WJRA 3HL8A 1BI3A 4EMGA 1U1SA 1N6AA 1X75C 2FB7A 4M75A 4J6YA 2DTOA 2VYTA 1H641 2E70A 5DY9A 4MDXA 4M7AC 1KHCA 3E9FA 3LH0A 1KQ1A 5LJ3e 1Y96B 2V8IA 3QO3A 3GP8A 4BB7A 3CCLT 3JCMg 3QZ5B 1K8AC 2R58A 2KQWA 2HQEA 3BDUA 4FSXA 1KC8U 1LNXA 3PT9A 3X28B 3OYKA 3HHTB 5GAMd 4BI3A 5HKCA 1VQ7A 3C12A 1N27A 3ZBDA 4F7UE 3EFSA 3M4YA 4PJOE 1WJSA 1X01A 4JJNK 1OZ2A 3JRZA 4XTVA 3V7SA 3CCRT 4OF1A 3RESA 1N9RA 3M53A 3A8GB 2GQVA 4QVDA 2XK0A 1UGPB 1YJNT 1B34B 1EIFA 1UGRB 3BFMA 3M4GA 3LWHA 2ZPEB 4ZGDB 4LD9K 5FU6B 1VQLT 3CCRA 4JS5A 4LDVA 3G71A 2DTHA 1BIBA 3JCMb 4A4GA 1FWZA 4QVCA 1W4SA 2X4XA 1YJNA 1I4K1 4PNOA 2XHCA 1MHNA 2DD4A 2H3JA 1VQPT 1NPRA 5GANd 4JRPA 3GOXA 1N8RC 2NLUA 1VQLA 2WSCE 2GF7A 3VYGA 1YI2A 2KAFA 3ME9A 2K5LA 3HRTA 2WSEE 3DB4A 4C92E 3ER0A 2VGNA 1VQPA 3MP6A 5LJ3f 2GFAA 4BI4A 4XK8E 3OSVA 4HCBA 2L8DA 3VJPA 3A8MB 5GAMe 4ZTJA 4NS5A 4IKFA 3PIPA 4OVAA 3KUFA 1MGQA 1Q7YU 3J81E 1YBYA 3OYFA 3HFNA 2X35A 4OP0A 2QEXA 2M1HA 4PKCC 1YJWT 1VQKT 2GCXA 3L2WA 5GAOr 5GAN5 2EJFA 3MEAA 1YHQT 1HK9A 2LT4A 5CO7A 3BDLA 4C8QE 3QKJA 2QQ9A 4LDYA 4J5YA 4XU0A 5CKBA 4EMHA 2K3XA 4EMKA 1OZ3A 1PSEA 4M78A 3X25B 4A54A 1IZ6A 1WQ7A 2ZZDA 5LJ5h 1VQKA 4QQ6A 2DXTA 1JRIA 3OYHA 3SWNA 1YHQA 3V8LA 3BY7A 3CBMA 4N4HA 2VGMA 3M59A 2X4WA 4JLGA 3CD6T 4M7DF 4M7DB 2E41A 5GANe 2CZ7B 4N0AA 4R55A 4M77A 3CPFA 4LDUA 4M7AE 2JUFA 4BE0A 2FYKA 3OB9A 1DJ7B 3CD6A 2WSFE 4EMKB 3LX7A 2ZPGB 3HFOA 2KK4A 3JCMX 4BDYA 2KVQG 2Y4XA 4QQGA 3UT1A 5LL6S 2KDSA 2PQWA 4MMKA 3QDRB 1M1GA 3Q1JA 3CMAA 3S3NA 1NJIC 1Y7XA 3OYLA 3EFRA 2E12A 4M77F 4ZN1A 4M77B 4A53A 3L2RA 2RO0A 4ATOA 2VUBA 1JB0E 4FU6A 3G4SA 2RHXA 2CZ1B 3GNFB 4J7IA 5GAMh 2DJZA 1Q82C 5FRNA 4BACA 3ASKA 2B8AA 3CCET 1M9SA 3QYHB 3RIRA 5C6SA 3WVDB 3CC2A 2EYQA 3JCMQ 4N4GA 2MMPA 4ZN3A 3DLMA 2E5QA 4XTYA 5CCAA 1M1KC 1M90U 5CKDA 4JRQA 4X34A 3CCMT 2XDPA 3META 3VUBA 5GMKm 2RK1A 4HA8A 4E7JA 2RHZA 4A4HA 5GANf 3FIFA 3QBYA 5DLOA 3BW1A 2HD0A 3CMEA 1XNIA 4DOWA 2CYZB 4PJOA 4M75G 4Z02A 3L2UA 5DM7R 3CCMA 2DXUA 3JCMd 1TH7A 2VXEA 1BI1A 1NPPA 2KY9A 5GANh 5CQYA 1QP2A 3KBGA 5EG2A 1FXXA 2DZCA 3MP8A 3V7CA 1M1KU 2D9TA 4MZMA 2ZPHB 4C0FA 2XD0A 1G3SA 2DPPB 5FU6C 1FX7A 2JTFA 3VU3C 5D6WA 1WQWA 2HAXA 1KC8C 3HRUA 3I56T 1KQ2A 1H3ZA 2Y90A 2XDBA 1NE8A 2P0QA 2E65A 4LDWA 2MF2A 3CXCA 2FHDA 1I81A 4PLIA 4LD6A 2RH2A 2A3LA 3FDRA 3QUIA 2PVGB 3OYIA 1VQ8T 3MHXA 3O8VA 3RMSA 5GAOp 1W2BA 1QVFS 4Y91A 3OYCA 3OYMA 3I56A 1VQ7T 3CPWA 1XQHA 1U1TA 3CEYA 1VQOT 3UDCA 1VQ8A 4CI0C 3M57A 2MWOA 3TREA 3PTAA 5GAOl 1ZBXA 2D6FA 3P8BB 3N5BB 5LJ3g 4N4IA 4UC4A 1VQOA 5IT9E 3RKYA 4M75F 5LJ5e 4J83A 4DA4A 3QPHA 4M75B 1QVFA 4IURA 3G71T 3JB9J 3HP9A 2QTXA 4C0GA 4NL3A 4OGEA 2DXBA 2XU8A 3J80E 2D0QB 3WXMB 4R56A 2RJFA 1U8RA 4C8QA 2P4TA 2V8JA 3OS5A 4DQ2A 2CGHA 3OA6A 1M8VA 2DK3A 1G3YA 3J7AF 1YI2T 1N9SA 1VQNA 3X20B 3OYYA 4BD3A 4JDSA 1VQ4A 2HQXA 4M7DC 4M7DG 3CCUA 1Q7YC 1OYXA 2EWNA 1Q81U 2E1HA 4IUVA 3CCQT 5FROA 4RCBA 1UEBA 2EFIA 4M7DD 5GMKj 4J8OA 4OB1B 2G3RA 1QVPA 1BYMA 4M7AA 1KHIA 5CIUA 4EMKC 2XI9A 4M78G 5FU7B 5KH6A 4OB3B 2QEXT 2EQJA 1M4ZA 3CCQA 2VV5A 2PVOB 2R57A 1K9MU 4V2SA 2RM4A 3GNGA 2YRVA 3FB9A 3C94A 4QW2A 4XU3A 4ZTFA 1KG1A 4M77C 4M77G 3A8OB 3ZEHA 3JCMc 5LJ5f 5GAN2 2QDYB 5GAMg 5GAN3 1R8OB 2K57A 4NOYA 4XTWA 5GAN7 2LQ8A 3I55A 4M77D 2OTLA 2R5AA 4Q5WA 3LGFA 3OBYA 3FC3A 3OYDA 1BI0A 3TEEA 3FJPA 3VYHB 2RHUA 2A7YA 2X4YA 5AYFA 3L2QA 3JCMh 4E47A 3JCMV 3FEOA 3L1AA 4GLKA 1I8FA 3V7RA 3JB9I 3DLLA 4VUBA 4P5NA 5I21A 2EJGA 3S6WA 1NZ9A 2QQSA 1G5VA 3CMAT 2EKOA 3DKMA 4C5GA 3OYNA 4M78F 5GANg 4M78B 3NTHA 3JCMP 3FLGA 2MAMA 2FVUA 4RCCA 4XTZA 3UWNA 3OYEA 1S72A 3SWNB 2M9UA 2ZPIB 5LJ3j 3G4ST 3TU4K 2L3RA 5GAMf 5CAIA 5DLQE 1M90C 3E1SA 3SB2A 5KCOA 4E7KA 2BUDA 3ZFJA 1BIAA 3OYJA 3CC2T 1WPYA 4JUVA 4YTLA 4XTXA 4A4FA 2OAUA 3LW5E 3QZ9B 1KD1C 2LVMA 3X24B 4L5GA 4FL6A 4MZPA 2IVWA 2JVVA 2KSSA 2K2VA 4A4KA 4KT0E 5I2MA 5FLXE 2PU9B 1Q86U 1M5Q1 2XKOC 2LDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYI A;  4HCZ A;  3P8H A;  2DIQ A;  3O8V A;  4E7L A;  2O4X B;  3LYI A;  2RJE A;  5KCH A;  2RHI A;  4A4E A;  3OYC A;  3PMT A;  3OQ5 A;  2P0K A;  2RHY A;  3P8D A;  4A4G A;  3OYM A;  2X4X A;  3OS0 A;  3L42 A;  3CEY A;  1MHN A;  4II1 A;  3MEV A;  3GOX A;  2NLU A;  2RI3 A;  3OYA A;  3L2V A;  2GF7 A;  2MWO A;  3H6Z A;  3ME9 A;  3SD4 A;  2F5K A;  3OMG A;  3DB4 A;  3H8Z A;  4IUQ A;  4CRI A;  4N4I A;  1WGS A;  4BE1 A;  4UC4 A;  2M0O A;  2GFU A;  3MP6 A;  2GFA A;  4RG2 A;  3OY9 A;  4IUR A;  3FDR A;  2L8D A;  4ZTJ A;  5J26 A;  4NS5 A;  2RI5 A;  3QII A;  4OVA A;  3S3M A;  3F70 A;  3KUF A;  3MO8 A;  2RJF A;  4QQD A;  2M16 A;  2RI2 A;  4EDU A;  3OYF A;  2X35 A;  3MEW A;  2M1H A;  3OA6 A;  1SSF A;  3L2W A;  3OYG A;  4BE2 A;  3MEA A;  2E6N A;  3BDL A;  3S3O A;  4C5H A;  4BD3 A;  2DAQ A;  3QKJ A;  5D6X A;  2HQX A;  3LGL A;  2K3X A;  2DIG A;  1OZ3 A;  3DB3 A;  3QJ6 A;  1OYX A;  2LRQ A;  2MWP A;  4IUV A;  4QQ6 A;  3OYH A;  5FRO A;  1WJQ A;  2EFI A;  3MP1 A;  3EAE A;  3OMC A;  2EQM A;  4N4H A;  2G3R A;  2X4W A;  5CIU A;  2EQU A;  3M9Q A;  2IG0 A;  2BIV A;  5KH6 A;  2EQJ A;  3NTI A;  2QQR A;  2K3Y A;  4BE0 A;  3OB9 A;  5KE2 A;  2R57 A;  2L89 A;  5IN1 A;  4C5E A;  2YRV A;  3C4S A;  3LX7 A;  4QW2 A;  4B9W A;  5C0M A;  3NTK A;  4ZTF A;  3ZEH A;  4BDY A;  4E7I A;  2LTO A;  3UT1 A;  4QQG A;  4IUU A;  4GY5 A;  2PQW A;  4L59 A;  3S3N A;  3Q1J A;  4B9X A;  2R5A A;  4Q5W A;  3LGF A;  5D6Y A;  3OYB A;  4E7H A;  3FC3 A;  3OYL A;  3OYD A;  5J39 A;  3L2R A;  2RO0 A;  2RHU A;  4C5I A;  4FU6 A;  1RI0 A;  2X4Y A;  3L2Q A;  2RHX A;  5FRN A;  3MEU A;  4PL6 A;  4BAC A;  2RJC A;  2B8A A;  3ASK A;  5IAY A;  5FRM A;  3PMI A;  3PFS A;  1WJR A;  3FEO A;  5C6S A;  3OS1 A;  5KE3 A;  2WAC A;  4BDZ A;  4N4G A;  3OS2 A;  3DLM A;  2E5Q A;  3PNW C;  4PLL A;  3S6W A;  2QQS A;  1G5V A;  2RJD A;  2EKO A;  4X34 A;  2VYT A;  4IUT A;  4C5G A;  5M9O A;  3OYN A;  1KHC A;  1OI1 A;  2R5M A;  2XDP A;  3E9F A;  3MET A;  3NTH A;  3LH0 A;  3FLG A;  4E7J A;  2RHZ A;  4A4H A;  3UWN A;  3OYE A;  4IKF A;  3QBY A;  4IUP A;  1XNI A;  2R58 A;  2HQE A;  2L3R A;  2O4X A;  4Z02 A;  3LLR A;  3L2U A;  2JZ2 A;  3OYK A;  2CKK A;  5KCO A;  4E7K A;  2BUD A;  1N27 A;  3OYJ A;  2LCC A;  1WJS A;  3MP8 A;  4A4F A;  2D9T A;  1OZ2 A;  2LVM A;  2EQK A;  2JTF A;  4FL6 A;  5D6W A;  4QVZ A;  2BKD N;  1H3Z A;  2XK0 A;  3E9G A;  2FHD A;  4PLI A;  4LD6 A;  2LDM A; 
#chains in the Genus database with same CATH topology
 2W0Z A;  4RTT A;  1UTI A;  2RJE A;  2DEU A;  4A4E A;  3OQ5 A;  4M7D E;  3U23 A;  2ABL A;  1BKB A;  2RI3 A;  3VUZ A;  2L3S A;  4PJL A;  1PHT A;  3CCS A;  2K2M A;  4RG2 A;  2X4J A;  3CC7 A;  3THK A;  9ATC B;  5J26 A;  3VS4 A;  1X6B A;  1UB4 A;  4M77 E;  4F7U F;  2KNB B;  3LWI A;  4PJO B;  2H8H A;  3OYG A;  5A0G A;  1XTD A;  3I5R A;  2F5T X;  1CKA A;  2LCS A;  2LRQ A;  2YSQ A;  1VQ6 Q;  1BCM A;  1RLQ C;  4BY6 B;  3M9Q A;  4TVR A;  1V29 B;  3NTI A;  2LNV A;  1ZQ1 A;  1VQ5 A;  1IGQ A;  2DD5 A;  3CCU T;  1RAG B;  1RAE B;  1SHF A;  4M7A D;  2XG8 D;  4E2F B;  2AHJ B;  2DZ9 A;  2GBQ A;  4LE9 A;  2Z0W A;  2E64 A;  5D6Y A;  4XAX B;  2RQT A;  1VQ9 T;  4GBQ A;  1IB8 A;  3A8H B;  4C5I A;  3X26 B;  1RAC B;  2JXB A;  2DO3 A;  1ZA1 B;  1NYG A;  3OS1 A;  5KE3 A;  1XJW B;  3SWN C;  2F1L A;  2RJD A;  2COW A;  1AHJ B;  5M9O A;  1VQM T;  4N0A C;  2JNG A;  1V76 A;  2FZK B;  4M7A F;  2OTJ Q;  1YP5 A;  4J9B A;  3JCM f;  1UFF A;  1AOJ A;  2CKK A;  2QAZ A;  4KRT A;  1KD1 R;  1AWJ A;  1OEB A;  2C0O A;  4OMN A;  2EQK A;  2KI7 A;  2O31 A;  1O75 A;  2BKD N;  3M0U A;  3E9G A;  1Z9Q A;  1N5Z A;  4JRI A;  5LJ3 h;  2YUQ A;  4FYX B;  4ELZ C;  1D0Z A;  3LYI A;  4FCY A;  2RD1 A;  2RHY A;  2HEQ A;  1UG1 A;  3EH1 A;  2LNH B;  2QA4 A;  5GAN 4;  1YIJ Q;  3VKI A;  2YLB A;  3JV3 A;  2F5K A;  1I0C A;  3OMG A;  1K73 R;  4OB2 B;  1WHG A;  3CC4 T;  2K4Y A;  2VKN A;  1GL5 A;  5A0D A;  1VYT A;  1YIT T;  3QII A;  2KYB A;  4PJO D;  4J6X A;  4XTU A;  3VV0 A;  2NUP A;  5EC7 A;  3NPF A;  1PCX A;  3EFO A;  1WDX A;  3S3O A;  1SSH A;  1PD0 A;  3QJY A;  1K0X A;  1EFN A;  2KYM A;  3CC7 T;  3EAE A;  2DVE A;  1PC0 A;  3T9N A;  1TOV A;  3M5A A;  2K5I A;  2BIV A;  4C92 C;  3JB9 G;  2QQR A;  3EFO B;  3RER A;  3EG9 A;  5GAO m;  4LDX A;  1OPK A;  3CCE A;  3C4S A;  3UPU A;  3PGG A;  4B9X A;  1G2B A;  4RG8 A;  5I11 A;  1M1F A;  2ZPB B;  4Z8A A;  1GCQ C;  4C8Q C;  3CCV A;  1P92 A;  3EG9 B;  5CVI A;  2CZ6 B;  1VQP Q;  3H9N A;  1MV3 A;  2FZC B;  2EGC A;  2PZ1 A;  3HL8 A;  4EMG A;  2DTO A;  4FW2 A;  1H64 1;  2E70 A;  5LJ3 e;  1K76 A;  2P84 A;  3QZ5 B;  2R58 A;  2KQW A;  1KC8 U;  3PT9 A;  3X28 B;  1M3B A;  2YUO A;  4PJO E;  4JJN K;  2X3X D;  2XK0 A;  1YJN T;  1NYF A;  3LWH A;  1OV3 A;  1ZSG A;  2ROT A;  4Y92 A;  1WYX A;  3CD6 Q;  3TSW A;  4WCI A;  3JCM b;  1BIB A;  4QVC A;  1IXD A;  2X4X A;  5GAN d;  1VQL A;  2WSC E;  2LMJ A;  1IHV A;  3LH5 A;  2JMC A;  3D7S B;  4BI4 A;  2YRC A;  4NS5 A;  2FO0 A;  1Q7Y U;  5KYX B;  3J81 E;  3OYF A;  4OP0 A;  1HK9 A;  5FW9 A;  2BZ8 A;  1FMW A;  2FZG B;  2DL8 A;  2I0N A;  1OZ3 A;  3EGX A;  3X25 B;  3CCM Q;  5LJ5 h;  1VQK A;  3SWN A;  4OML A;  3V8L A;  2E41 A;  5GAN e;  1ZUK A;  4N0A A;  1JXM A;  2FYK A;  1DJ7 B;  1KK7 A;  2WSF E;  2DF6 A;  2MCN A;  2RQU A;  4MMK A;  3CMA A;  2GTJ A;  4ZN1 A;  3L2R A;  2RO0 A;  2VUB A;  1JB0 E;  2EKH A;  1OOT A;  4D8D A;  1R0B G;  3CCE T;  5C6S A;  3WVD B;  2D8H A;  2EYQ A;  2QGF B;  3DLM A;  4X34 A;  3CCR Q;  2A36 A;  1D1C A;  2V1R A;  4E7J A;  3CME A;  3NHN A;  4PFZ A;  1YI2 Q;  1TG0 A;  2VXE A;  2KY9 A;  5CQY A;  1QP2 A;  3V7C A;  1FXX A;  2DZC A;  4HXJ A;  2D9T A;  2ZPH B;  2XD0 A;  5FU6 C;  1FX7 A;  4AG2 C;  2XDB A;  3CXC A;  4PLI A;  1ZBJ A;  1TUC A;  3QUI A;  3RMS A;  1QVF S;  2QEX Q;  3OYC A;  3M0T A;  4OMO A;  3I56 A;  1NM7 A;  4DEY A;  3CPW A;  1KJW A;  1VQ8 A;  4CI0 C;  3M57 A;  2LZ6 B;  1R0C B;  2MWO A;  3TRE A;  3VS7 A;  3EGD A;  4KH1 B;  1YHQ Q;  1VQO A;  5LJ5 e;  1QVF A;  1PRL C;  4C0G A;  4NL3 A;  2DXB A;  3H0F A;  1NEB A;  2C0I A;  4E7Z A;  4C8Q A;  3OS5 A;  2KT1 A;  1G3Y A;  1N9S A;  1VQN A;  4BD3 A;  1VQ4 A;  4M7D G;  2EWN A;  3CCQ T;  4J8O A;  4OB1 B;  2QGG A;  5CIU A;  4M78 G;  5KH6 A;  2EQJ A;  4AFQ C;  3CC2 Q;  4JJD A;  1T3S A;  3C94 A;  4QW2 A;  1KG1 A;  4M77 G;  1M90 R;  1R8O B;  1RAA B;  2OTL A;  4Q5W A;  3OYD A;  2E4H A;  3JCM h;  4E47 A;  2COZ A;  1ACM B;  3UF4 A;  3FEO A;  4LNP A;  2COY A;  4DBR A;  2QQS A;  4J9I A;  3CMA T;  8ATC B;  1OPL A;  2CP6 A;  2HKQ B;  4M78 B;  3HTR A;  3M0S A;  4XTZ A;  5LJ3 j;  4CC4 B;  2CDT A;  1M90 C;  2EGE A;  3E1S A;  5KYY B;  3PVQ A;  3OYJ A;  4J9C A;  2OAU A;  3LW5 E;  4IIO A;  2KSS A;  2SRC A;  1KSW A;  2VVK A;  1GRI A;  5I2M A;  2D0N A;  1Q86 U;  2XKO C;  2LDM A;  2YHT A;  2OTJ T;  3CME T;  3OSS C;  1UGQ B;  2RHI A;  2P0K A;  3L42 A;  4C0D B;  1TS9 A;  4F7U A;  2VC8 A;  5GAO n;  1D3B A;  3OYA A;  4M75 C;  2ZPF B;  1ABO A;  3H8Z A;  1WGS A;  4BE1 A;  2C06 A;  2E6Z A;  4LN2 A;  4ZGJ B;  1Q81 R;  1YFN A;  3KFV A;  4MDW A;  3VS5 A;  3CCJ A;  1JO8 A;  2GQI A;  3F70 A;  1D09 B;  4PJM A;  5CQX A;  2HQH A;  4F7U B;  4BE2 A;  3AT1 B;  1WHK A;  2E6N A;  3QXE B;  3QSU A;  2F69 A;  3I55 Q;  2JTE A;  2QG9 B;  5FU7 C;  5J3B A;  1GCP A;  3REA B;  1WI7 A;  3M54 A;  1TWB A;  1WHL A;  3HPW A;  2EQU A;  1Z9Z A;  5GMK l;  3JB9 H;  2K6D A;  4DOV A;  5GAN j;  1Q81 C;  1VQN T;  3JCM e;  5KE2 A;  3CBO A;  2DIL A;  3AHU A;  2BE7 D;  1VQ4 T;  4JS4 A;  5I2S A;  4M7A G;  4C92 F;  3M0P A;  2ZGW A;  4NL2 A;  4E7I A;  3SDZ A;  1S72 Q;  5CKF A;  2KRO A;  3ULR B;  1XOV A;  4L59 A;  2EW3 A;  2PUK B;  2ENM A;  2XID A;  5HK0 A;  2V8K A;  5IXF A;  2CS7 A;  3HSB A;  4C8Q F;  2EVR A;  1UDL A;  3PMI A;  1VQ9 A;  4BDZ A;  3HRS A;  4M78 D;  2EIF A;  4IUT A;  2OTL T;  2QDL A;  1M27 C;  1HJD A;  1CSK A;  1RL2 A;  1PRM C;  2DA9 A;  5CK9 A;  3G6E Q;  4IKF A;  3QYG B;  4M7A B;  2GNC A;  1YJ9 T;  1PSF A;  5KYW B;  3JAM E;  1VQM A;  3VS0 A;  3RKW A;  1WNL A;  4QVZ A;  1RAB B;  1E6H A;  2BZY A;  2DIQ A;  5FWB A;  3PMT A;  4J7F A;  5I22 A;  2K3B A;  2QQA A;  1Y07 A;  2J06 A;  4FW1 A;  4II1 A;  1YJW A;  4XU2 A;  3CCV Q;  4FM4 B;  4J6W A;  3INZ A;  2GFU A;  1JJ2 S;  2DER A;  2P4R A;  4PJO G;  5LJ5 j;  2OAW A;  2PNI A;  3O5Z A;  1A0N B;  1BB9 A;  1X6O A;  2DNU A;  2DVJ A;  3CC4 A;  4OMM A;  4QQD A;  4JPB W;  3QHS A;  2PVD B;  2QQB A;  3M56 A;  4HVV A;  1IRX A;  1YIT A;  2LT1 A;  1JJ2 A;  2JS0 A;  1SPK A;  3SEM A;  1MUZ A;  1OX9 A;  1WJQ A;  3MP1 A;  3CCJ T;  4RMO A;  4M78 E;  3CCL Q;  1R77 A;  5HY6 A;  2ESW A;  1IRE B;  1B07 A;  5GAN 8;  4ELY C;  1CKB A;  4DEX A;  5IN1 A;  1QW1 A;  2E10 A;  5C0M A;  4FSS A;  2LTO A;  4IUU A;  1Q82 U;  3MPU B;  1ZUY A;  1VQL Q;  3SFM A;  3ZL7 C;  1UGS B;  1Y96 A;  5CKH A;  2AK5 A;  2EGA A;  3MEU A;  2K7A A;  1WJR A;  2DL3 A;  1N6A A;  1X75 C;  4M75 A;  4M4Z A;  1KHC A;  1KQ1 A;  1Y96 B;  4AFU C;  1LNX A;  1VQK Q;  1VYU A;  3HHT B;  5HKC A;  3C12 A;  1H8K A;  1N27 A;  4F7U E;  3EFS A;  3JRZ A;  1V1C A;  4FYW B;  3CCR T;  4OF1 A;  1M8M A;  1UGR B;  3BFM A;  5D7U A;  4LD9 K;  1TTH B;  4LDV A;  1WXT A;  1YJN A;  2XHC A;  1MHN A;  1NPR A;  4JRP A;  2NLU A;  3VYG A;  3C0C A;  1I5O B;  3ER0 A;  1AZG B;  3OSV A;  1ABQ A;  5FWC A;  3A8M B;  2BTT A;  2L0A A;  3KUF A;  1MGQ A;  4RTX A;  2QTV A;  1UGV A;  1YJW T;  2M1H A;  3VS2 A;  1YHQ T;  5CO7 A;  2O9S A;  3QKJ A;  4LDY A;  1PSE A;  1WQ7 A;  2YT6 A;  1TUG B;  2LX7 A;  4JLG A;  3H41 A;  2MOX A;  1SHG A;  1RAF B;  3EHR A;  2CZ7 B;  4R55 A;  3CPF A;  4LDU A;  4JJC A;  4M7A E;  4BE0 A;  3OB9 A;  2CP2 A;  2RNA A;  4LUE A;  4EIK A;  1W1F A;  3I56 Q;  3HFO A;  2KK4 A;  3VRZ A;  4BDY A;  3G1J A;  4QQG A;  1BCO A;  2PQW A;  1M1G A;  1VQ8 Q;  2RQW A;  3OYL A;  4A53 A;  1VQ7 Q;  1TUD A;  4FU6 A;  2EYX A;  1VQO Q;  4J7I A;  2CZ1 B;  2NUP B;  1K9A A;  1WXU A;  1M1K C;  2E5Q A;  1JU5 C;  4X1V A;  1RAH B;  2CP5 A;  3MET A;  3G71 Q;  4AMC A;  1JQQ A;  3QBY A;  3BW1 A;  2HD0 A;  2CYZ B;  4Z02 A;  2DBM A;  2L3Q A;  3EG3 A;  2DXU A;  1NPP A;  4K11 A;  5GAN h;  3KBG A;  5EG2 A;  4LXC A;  1M1K U;  4MZM A;  2DPP B;  2RN8 A;  5D6W A;  1KC8 C;  3HRU A;  1KQ2 A;  1H3Z A;  1NE8 A;  2MF2 A;  2FHD A;  1HSQ A;  2RH2 A;  2A3L A;  3FDR A;  1TU0 B;  1W2B A;  3OYM A;  1Q7Y R;  4PK4 A;  1MMN A;  3MKD A;  5GAO l;  1ZBX A;  1ZSZ C;  3N5B B;  2W10 A;  5LJ3 g;  4RUG A;  5IT9 E;  4M75 F;  4J83 A;  1QWF A;  3JB9 J;  2QTX A;  4OGE A;  2XU8 A;  2KT8 A;  3J80 E;  2D0Q B;  2RJF A;  1U8R A;  2VWF A;  2P4T A;  4JZ4 A;  2CGH A;  3OA6 A;  2DK3 A;  1JEG A;  3CQT A;  3X20 B;  3IQL A;  2HQX A;  4M7D C;  1Q7Y C;  3SHW A;  5FRO A;  4RCB A;  3G4S Q;  1KHI A;  4EMK C;  2J6F A;  1U5S A;  4HVU A;  2CH4 A;  3CCQ A;  1GFC A;  2PVO B;  4J9D A;  1K9M U;  4V2S A;  3R6N A;  1TXQ A;  4PJJ A;  2KRN A;  4ZTF A;  2FEI A;  4M77 C;  5GAN 2;  5GAN 7;  3LGF A;  3FC3 A;  2AIR B;  1BI0 A;  1FYN A;  2RHU A;  2A7Y A;  1PWT A;  3L2Q A;  3JCM V;  4RTU A;  3L1A A;  2NUT A;  4P5N A;  1NZ9 A;  1G5V A;  2LJ3 A;  5GAN g;  1UUE A;  3EGX B;  3NTH A;  3JCM P;  2MAM A;  4RCC A;  1C1A A;  3OYE A;  3SWN B;  2YUN A;  2DRK A;  2L3R A;  3RR6 A;  5CAI A;  5DLQ E;  4F14 A;  3SB2 A;  2BUD A;  4A4F A;  3GBQ A;  3QZ9 B;  5KYU A;  1G83 A;  4MZP A;  2IVW A;  4HCZ A;  3C95 A;  3RMQ A;  1U06 A;  3CXC S;  2ECZ A;  4ME7 A;  2OTJ A;  3L2V A;  3CCU Q;  3OW2 S;  2RK2 A;  1M2V A;  4KUL A;  4JLI A;  1FMK A;  2KXC A;  3NFC A;  3CPW S;  1IGU A;  2LJ0 A;  1QVG S;  2GTO A;  3EG1 A;  4X9D A;  4EDU A;  3OW2 A;  2KRM A;  1BK2 A;  4WF2 A;  5L8R E;  3I35 A;  2DAQ A;  5GAO q;  1YIJ A;  3LGL A;  2DIG A;  4C8Q G;  4C92 A;  1QVG A;  4OMP A;  2FPF A;  2EJ9 A;  2EQM A;  4Z88 A;  1EX4 A;  2FRY A;  1LVK A;  3A5Z B;  2L89 A;  2FPE A;  5LJ5 g;  2HSE B;  1B34 A;  1GCQ A;  3JB9 F;  4C92 B;  1KQS A;  3NTK A;  4GY5 A;  3EGD B;  2EYZ A;  3RKX A;  4JRK A;  4RKU E;  1GFD A;  4WTO B;  2DRM A;  3GPL A;  2FL7 A;  4C8Q B;  3PFS A;  3BE3 A;  1S1N A;  2WAC A;  4MZT A;  1K8A U;  3OS2 A;  3CC4 Q;  2CT4 A;  1ZSZ A;  2LQK A;  1Q86 R;  2QI2 A;  3CXC P;  1G3T A;  1YIT Q;  3M0Q A;  4BI8 B;  1VQ6 T;  4IUP A;  4OGC A;  2O4X A;  4KUI A;  1HXD A;  4DBH A;  3LLR A;  2JZ2 A;  4AT1 B;  2LC4 A;  4QT7 A;  2A08 A;  2LCC A;  2M02 A;  3CCS Q;  2I2L A;  2DL7 A;  1YN8 A;  1YJ9 A;  3CC7 Q;  1SEM A;  2CUD A;  1N8R U;  4M7D A;  2K79 A;  3P8H A;  4E7L A;  2HL3 A;  2O4X B;  1QVF P;  2ROL A;  3P8D A;  2DXC A;  1PKS A;  1I5L A;  1AD5 A;  1QKW A;  1Q86 C;  2K5F A;  1Y71 A;  2L3P A;  2XDD A;  2RQR A;  3H6Z A;  4HT9 A;  3QWY A;  1PM3 A;  1IO6 A;  3A8L B;  2QAS A;  4C0Z A;  4F7U G;  4PJO C;  1QCF A;  1Y57 A;  5A2Q E;  3PE0 A;  1LOJ A;  3S3M A;  2LP5 A;  3KXT A;  1VQ5 Q;  2M16 A;  1ARK A;  1W70 A;  2QYZ A;  2VXF A;  2V26 A;  1TSF A;  2VB6 A;  5D6X A;  1UEC A;  3QJ6 A;  3DB3 A;  4BY6 C;  5CR2 A;  2KR3 A;  2X51 A;  4F04 B;  3EGU A;  2HDA A;  4O5V A;  4KH0 B;  2MK5 A;  3OMC A;  1G3W A;  1NEG A;  1X27 A;  3GLX A;  1VUB A;  3JCM W;  2JT4 A;  2HBW A;  4DBQ A;  1VIF A;  2IG0 A;  2JOY A;  3H0I A;  1Y0M A;  4GLM A;  1NJI U;  2Y4Y A;  4C92 D;  2JW4 A;  1YIJ T;  1D3B B;  1X43 A;  1YJN Q;  1OX8 A;  2HZY A;  2JTM A;  3M58 A;  1X2Q A;  2L2P A;  1VIE A;  3V8K A;  4C8Q D;  1SRL A;  2EAY A;  4J9E A;  2J6K A;  2DKG A;  2L5Q A;  5FRM A;  1RUW A;  2IIM A;  5IAY A;  1H3H A;  1G8X A;  2VYT A;  5DY9 A;  3E9F A;  2NUZ A;  1WA7 A;  2V8I A;  4J9F A;  3GP8 A;  4BB7 A;  2G6F X;  3JCM g;  2QA4 Q;  2LJ1 A;  2HQE A;  1U3O A;  3OYK A;  1GBR A;  5GAM d;  4BI3 A;  3M4Y A;  3VS6 A;  1WJS A;  2KRS A;  2A37 A;  3V7S A;  2E5K A;  2GQV A;  4QVD A;  1UGP B;  1EIF A;  3M4G A;  2DJQ A;  5FU6 B;  3EHQ A;  3CCR A;  1UJY A;  4A4G A;  1FWZ A;  1W4S A;  1WHM A;  1QMC A;  2A0F B;  2DD4 A;  1VQP T;  3GOX A;  1YI2 A;  2KAF A;  2K5L A;  1M3C A;  3HRT A;  4RTZ A;  2WSE E;  4C92 E;  2PTK A;  4XK8 E;  4RTY A;  2KXD A;  2L8D A;  5GAM e;  2HCK A;  4OVA A;  3UAT A;  1YBY A;  3HFN A;  1I1J A;  2X35 A;  2QEX A;  3CCE Q;  2M51 A;  4PKC C;  2GCX A;  5GAO r;  1KFZ A;  5GAN 5;  4C8Q E;  2EYW A;  2QQ9 A;  5HCK A;  4XU0 A;  4EMH A;  4JJB A;  4A54 A;  2DXT A;  1JRI A;  3OYH A;  1Q82 R;  1YHQ A;  3CBM A;  2RMO A;  2X4W A;  3QWX X;  3CD6 T;  4M7D F;  1ZLM A;  2JUF A;  3LX7 A;  2ZPG B;  3RDV A;  2Y4X A;  2C0T A;  2SEM A;  3RNJ A;  4M77 F;  4ATO A;  2DL5 A;  2RHX A;  4RTV A;  3GNF B;  1Q82 C;  2OX7 A;  2M0Y A;  2B8A A;  2OJ2 A;  1M9S A;  2D1X A;  3QYH B;  3RIR A;  3CC2 A;  4Z89 A;  3JCM Q;  1HD3 A;  2MMP A;  4D8K A;  4ZN3 A;  5CKD A;  3CCM T;  3M0R A;  2RK1 A;  4HA8 A;  1ZUU A;  3FIF A;  2MIO A;  3QDF A;  1XNI A;  4PJO A;  4M75 G;  1RAI B;  1MMG A;  1TH7 A;  3RBB B;  1AEY A;  3MP8 A;  4C0F A;  2JTF A;  3VU3 C;  1WQW A;  2HAX A;  1WZO A;  3CCQ Q;  4LDW A;  2E65 A;  1I81 A;  4LD6 A;  2PVG B;  3PVL A;  1C6V X;  3MHX A;  3O8V A;  4Y91 A;  5IHK A;  1ZA2 B;  1RAD B;  1OUL A;  3CEY A;  3UDC A;  4J9H A;  3A98 A;  1LPL A;  3PTA A;  2BE9 B;  1SG5 A;  1AWO A;  4N4I A;  1JJ2 P;  4R0K A;  3RKY A;  1D0X A;  4DA4 A;  3QPH A;  4M75 B;  1FMV A;  1NLO C;  4R56 A;  1UJ0 A;  2V8J A;  4DQ2 A;  4PJN A;  1YI2 T;  2FRW A;  3OYY A;  3EG2 A;  2X3W D;  4JDS A;  3CMA Q;  2CUB A;  3H0H A;  1UEB A;  2G3R A;  1QVP A;  1VA7 A;  1BYM A;  5FU7 B;  5AT1 B;  4JZ3 A;  2QEX T;  4AG1 C;  1M4Z A;  2BZX A;  2DFU A;  2VV5 A;  2KGT A;  2RM4 A;  2YRV A;  2DYB A;  3FB9 A;  4XU3 A;  3UA6 A;  2NWM A;  5GAN 3;  2QDY B;  4NOY A;  4XTW A;  1K4U S;  2LQ8 A;  3I55 A;  1X6G A;  3CME Q;  2R5A A;  3OBY A;  1M2O A;  1M3A A;  1J3T A;  1M1K R;  4ORZ A;  1I8F A;  3JB9 I;  4VUB A;  1D1A A;  2EJG A;  3S6W A;  4E7S A;  3DKM A;  4B6M A;  3VS1 A;  3I9Q A;  3FLG A;  1S72 A;  2FVU A;  3UWN A;  4CC3 A;  2RF0 A;  2M9U A;  2ZPI B;  3TU4 K;  2EYY A;  5GAM f;  4E7K A;  2V1Q A;  3ZFJ A;  3CC2 T;  1WPY A;  4XTX A;  1KC8 R;  1KD1 C;  4FL6 A;  2JVV A;  1BBZ A;  2B86 A;  4A4K A;  1M30 A;  1M5Q 1;  2MI6 A;  5KCH A;  1K0S A;  1WIE A;  3VS3 A;  2AKK A;  2H3E B;  3G6E A;  3OS0 A;  4HKE A;  1VQN Q;  2CZ0 B;  2RQV A;  5A0L A;  1KD1 U;  3E19 A;  3CCS T;  1QCN A;  1VQ4 Q;  1NLP C;  1YCY A;  3JSC A;  1W2B S;  1D1B A;  3SD4 A;  2EQI A;  4X9C A;  4M75 D;  4CRI A;  1PD1 A;  1H92 A;  1E7O A;  1K73 C;  2RB6 A;  5LJ3 d;  3OY9 A;  2DTI A;  2DX1 A;  1RI9 A;  2LQW A;  5GAM j;  1SKU B;  1GBQ A;  4PJO F;  1SSF A;  4OMQ A;  1K9M R;  2NYS A;  1AVZ C;  2ED0 A;  2JS2 A;  2KMT A;  3HKS A;  1K73 U;  2DEQ A;  3EH2 A;  2OTL Q;  3URG A;  2KE9 A;  4L6V 5;  4ESR A;  2ZAE A;  3WVE B;  1MMD A;  2JN0 A;  1VQ5 T;  4OMF B;  2JM8 A;  8AT1 B;  1YJ9 Q;  3PIO A;  4ANJ A;  2K3Y A;  1VYV A;  2CT3 A;  4HCK A;  4XQ3 A;  1K1Z A;  1QCO A;  1NBE B;  2YLC A;  1B3Q A;  2J6O A;  1W6X A;  5GMK h;  1B7T A;  1UHF A;  2A28 A;  2QXF A;  1EZZ B;  2HMA A;  2HNI A;  1K9M C;  4KUD K;  1AZE A;  5GAN 6;  1O9S A;  5J39 A;  4FT4 A;  3CCL A;  1RI0 A;  1ZHI A;  1OU8 A;  4OB0 B;  4PL6 A;  2GGR A;  4FT2 A;  4J9G A;  4M78 C;  2LCL A;  3PNW C;  4XU1 A;  4PLL A;  2HBP A;  3I55 T;  1OI1 A;  2R5M A;  4M75 E;  5HK3 A;  3JCM J;  1WFW A;  5KYX A;  2LX9 A;  3G7Z A;  4KGV B;  2ZCF B;  1W2B P;  3TCJ A;  1LJO A;  2P0P A;  2AZV A;  3V8J A;  3FRN A;  5IXB A;  2PUO B;  1VQ6 A;  1T0H A;  4D6W A;  2J05 A;  2J7I A;  3R6O A;  2CP0 A;  2YRD A;  1JXO A;  3E2U A;  3I5S A;  3CCJ Q;  2QA4 T;  4Y28 E;  1S72 T;  2DE0 X;  4C0D C;  3MCA B;  4ZNX A;  5IHN A;  2CRE A;  2CSQ A;  4QKU A;  1MV0 B;  3MEV A;  1D0Y A;  3OBW A;  3RUX A;  5IH2 A;  2IPO B;  3L2Z A;  4MML A;  4IUQ A;  2M0O A;  2NUT B;  2XIC A;  1RLP C;  3G6E T;  2DBK A;  2RI5 A;  3MO8 A;  1MND A;  3CBP A;  3GF5 A;  1BI2 A;  2RI2 A;  3MEW A;  2HL5 C;  1JBM A;  2F2V A;  4HT8 A;  2O01 E;  4ZGE B;  4C5H A;  4FIB A;  5GJV B;  2CP7 A;  5KYU B;  5GMK e;  2MWP A;  3TSZ A;  4KBM B;  2AZS A;  3M55 A;  4C92 G;  1VQ9 Q;  1T3L A;  2KBT A;  4BUG A;  3JB9 D;  4PFP A;  1QP3 A;  4C5E A;  1K8A R;  4B9W A;  3CCV T;  5CKE A;  3GIB A;  1UE9 A;  1M2V B;  5IHI A;  5GMK i;  4O6J A;  5LJ5 d;  2RA2 A;  3QG1 A;  4F16 A;  4HCC A;  2YUP A;  4RTW A;  3OYB A;  4E7H A;  4EPC A;  1AT1 B;  2CSI A;  1VQM Q;  1KQS S;  1GXI E;  4FYV B;  1SRM A;  1PNJ A;  4A63 B;  2RJC A;  1BI3 A;  2MYS A;  1WHH A;  1U1S A;  2FB7 A;  4J6Y A;  4MDX A;  4M7A C;  1WLP B;  1N8R R;  3LH0 A;  2ATC B;  1X69 A;  3QO3 A;  3EG0 A;  3CCL T;  1WHJ A;  1K8A C;  3BDU A;  4FSX A;  1YJW Q;  3VRY A;  1VQ7 A;  3ZBD A;  2F2W A;  1X01 A;  2YWW A;  1C0M A;  1KIK A;  1OZ2 A;  4XTV A;  3RES A;  1N9R A;  3M53 A;  3A8G B;  7AT1 B;  1B34 B;  1NG2 A;  1PG5 B;  1QQJ A;  2D8J A;  2ZPE B;  4ZGD B;  1VQL T;  4JS5 A;  2FG0 A;  3G71 A;  2DTH A;  1I4K 1;  4PNO A;  2H3J A;  1N8R C;  1ZX6 A;  2YDL A;  3OW2 P;  2GF7 A;  3ME9 A;  3DB4 A;  4DBF A;  2VGN A;  3CPW P;  1VQP A;  3MP6 A;  2O2O A;  2GFA A;  5LJ3 f;  1QVG P;  4HCB A;  1ZSZ B;  3VJP A;  4ZTJ A;  3PIP A;  2EBP A;  2ED1 A;  2HSP A;  1VQK T;  4E6R A;  1NJI R;  3L2W A;  2EJF A;  3MEA A;  4FYY B;  2LT4 A;  3BDL A;  1QKX A;  3MJX A;  4J5Y A;  5CKB A;  2K3X A;  3FJ5 A;  4EMK A;  2DM1 A;  4M78 A;  1IZ6 A;  2ZZD A;  1KQS P;  4QQ6 A;  4KGZ B;  4PFO A;  1F1B B;  2O9V A;  3BY7 A;  4N4H A;  2VGM A;  3M59 A;  2JMA A;  4M7D B;  5KYY A;  4M77 A;  2DL4 A;  1QLY A;  3CD6 A;  4EMK B;  5L23 A;  2DYI A;  3UA7 A;  3JCM X;  2KVQ G;  3UT1 A;  5LL6 S;  2KDS A;  1SF9 A;  3QDR B;  4IIM A;  3Q1J A;  3S3N A;  1NJI C;  2HKN A;  1Y7X A;  3EFR A;  2E12 A;  1HYO A;  4M77 B;  2E3H A;  3G4S A;  1MMA A;  2AT1 B;  5GAM h;  2DJZ A;  5FRN A;  4BAC A;  3ASK A;  1YNZ A;  2AKL A;  4N4G A;  4XTY A;  5CCA A;  1WXB A;  1M90 U;  4JRQ A;  2XDP A;  2XMF A;  1IHW A;  3VUB A;  5GMK m;  2RHZ A;  4A4H A;  5GAN f;  5DLO A;  2VAS A;  4DOW A;  1QWE A;  3L2U A;  5DM7 R;  3CCM A;  3NGP A;  1LCK A;  3JCM d;  1BI1 A;  1AWX A;  1OU9 A;  5ECA A;  2FPD A;  2CH4 W;  1G3S A;  3I56 T;  2Y90 A;  1AWW A;  2P0Q A;  3OYI A;  4AFS C;  2DMO A;  1VQ8 T;  5GAO p;  1YCS B;  1VQ7 T;  1XQH A;  1U1T A;  1VQO T;  4CC7 A;  2CP3 A;  4CC2 A;  4AFZ C;  2JJ9 A;  2D6F A;  3P8B B;  2OI3 A;  4UC4 A;  2F2X A;  3NMZ C;  4IUR A;  3G71 T;  3HP9 A;  2O88 A;  3WXM B;  1M8V A;  3J7A F;  3TQ7 P;  1YWO A;  4LUD A;  3CCU A;  1OYX A;  1Q81 U;  2E1H A;  4IUV A;  4M7D D;  2EFI A;  1PKT A;  5GMK j;  1MNE A;  2YXY A;  4M7A A;  5KYW A;  2XI9 A;  4OB3 B;  1VOM A;  1UHC A;  2KEA A;  3TVT A;  2EPD A;  2R57 A;  3GNG A;  3A1P A;  6AT1 B;  1X2K A;  3ZEH A;  1I07 A;  3A8O B;  5LJ5 f;  3JCM c;  1E6G A;  5GAM g;  2K57 A;  2DET A;  4M77 D;  2E3I A;  1T0J A;  3TEE A;  3FJP A;  3VYH B;  2X4Y A;  5AYF A;  2RPN A;  4HVW A;  4KGX B;  1OQK A;  1BU1 A;  2JM9 A;  2MPX C;  4GLK A;  3V7R A;  3DLL A;  5I21 A;  2EKO A;  2QK0 A;  4C5G A;  3OYN A;  4M78 F;  2X9H A;  3REB B;  5GJW B;  4F17 A;  3G4S T;  2K9G A;  1YWP A;  5KCO A;  1BIA A;  4JUV A;  4YTL A;  1Q95 G;  2LVM A;  3X24 B;  4L5G A;  2DLP A;  2K2V A;  5KYN A;  2LQN A;  1WX6 A;  4KT0 E;  5FLX E;  2PU9 B; 
#chains in the Genus database with same CATH homology
 2YHT A;  4HCZ A;  2MI6 A;  2OTJ T;  3CME T;  3OSS C;  5KCH A;  2RJE A;  1UGQ B;  3C95 A;  3RMQ A;  2RHI A;  4A4E A;  3OQ5 A;  2P0K A;  4M7D E;  3G6E A;  3OS0 A;  3L42 A;  4HKE A;  2CZ0 B;  5A0L A;  3CXC S;  3E19 A;  4C0D B;  1KD1 U;  3CCS T;  1BKB A;  4ME7 A;  4F7U A;  2OTJ A;  2RI3 A;  2VC8 A;  5GAO n;  1D3B A;  3OYA A;  4M75 C;  3VUZ A;  1YCY A;  2RK2 A;  3JSC A;  3L2V A;  4KUL A;  3OW2 S;  1W2B S;  4JLI A;  3SD4 A;  4X9C A;  2ZPF B;  4M75 D;  3H8Z A;  4CRI A;  1WGS A;  4BE1 A;  3NFC A;  2E6Z A;  3CPW S;  2C06 A;  3CCS A;  4RG2 A;  4ZGJ B;  1K73 C;  2RB6 A;  2X4J A;  5LJ3 d;  3OY9 A;  3CC7 A;  1QVG S;  4MDW A;  2DTI A;  5J26 A;  3CCJ A;  4X9D A;  3F70 A;  1UB4 A;  4M77 E;  5GAM j;  4F7U F;  5CQX A;  4PJO F;  4EDU A;  4F7U B;  3OW2 A;  3LWI A;  4PJO B;  4WF2 A;  1SSF A;  5L8R E;  3OYG A;  5A0G A;  4BE2 A;  2E6N A;  3QXE B;  3QSU A;  2DAQ A;  2KMT A;  3HKS A;  5GAO q;  1YIJ A;  1XTD A;  2F69 A;  1K73 U;  2DEQ A;  3LGL A;  2DIG A;  2F5T X;  4C8Q G;  3URG A;  4C92 A;  1QVG A;  5J3B A;  2LRQ A;  4L6V 5;  5FU7 C;  3M54 A;  3WVE B;  2EJ9 A;  2EQM A;  2JN0 A;  1VQ5 T;  3HPW A;  4OMF B;  4BY6 B;  2EQU A;  3M9Q A;  4TVR A;  3PIO A;  1V29 B;  5GMK l;  3A5Z B;  3NTI A;  3JB9 H;  4DOV A;  5GAN j;  2K3Y A;  4XQ3 A;  1Q81 C;  3JCM e;  5KE2 A;  2LNV A;  1ZQ1 A;  1VQN T;  3CBO A;  1VQ5 A;  2L89 A;  3AHU A;  1VQ4 T;  4JS4 A;  5I2S A;  4M7A G;  2DD5 A;  2YLC A;  4C92 F;  5LJ5 g;  1B34 A;  3CCU T;  3JB9 F;  4C92 B;  1KQS A;  2ZGW A;  3NTK A;  4NL2 A;  5GMK h;  4M7A D;  4E7I A;  2XG8 D;  3SDZ A;  2QXF A;  5CKF A;  2AHJ B;  1XOV A;  2DZ9 A;  4GY5 A;  4L59 A;  2HNI A;  2E64 A;  5D6Y A;  4XAX B;  3RKX A;  1K9M C;  2PUK B;  4KUD K;  1VQ9 T;  5GAN 6;  1O9S A;  2XID A;  3A8H B;  4JRK A;  5J39 A;  5HK0 A;  2V8K A;  4FT4 A;  4C5I A;  3X26 B;  4RKU E;  3CCL A;  1RI0 A;  1ZHI A;  2CS7 A;  3HSB A;  3GPL A;  2DO3 A;  4OB0 B;  4C8Q F;  4PL6 A;  2FL7 A;  4C8Q B;  4FT2 A;  3PMI A;  3PFS A;  1VQ9 A;  4M78 C;  4BDZ A;  3OS1 A;  5KE3 A;  2WAC A;  4MZT A;  1K8A U;  3OS2 A;  2LCL A;  3PNW C;  3SWN C;  4XU1 A;  4PLL A;  3HRS A;  4M78 D;  2HBP A;  3I55 T;  2RJD A;  2EIF A;  4IUT A;  2OTL T;  1AHJ B;  5M9O A;  1OI1 A;  2LQK A;  2R5M A;  1VQM T;  2QI2 A;  1RL2 A;  4M75 E;  1G3T A;  2JNG A;  4N0A C;  5CK9 A;  5HK3 A;  4BI8 B;  3JCM J;  2LX9 A;  3G7Z A;  4IUP A;  1VQ6 T;  4OGC A;  2ZCF B;  2O4X A;  4KUI A;  1HXD A;  4M7A F;  3QYG B;  3LLR A;  3TCJ A;  4M7A B;  3JCM f;  2JZ2 A;  1LJO A;  2P0P A;  2LC4 A;  2CKK A;  1PSF A;  1YJ9 T;  3V8J A;  3JAM E;  1VQM A;  3FRN A;  2LCC A;  2PUO B;  1VQ6 A;  4D6W A;  3RKW A;  1WNL A;  2EQK A;  2I2L A;  4QVZ A;  1O75 A;  3R6O A;  2BKD N;  1YJ9 A;  3E9G A;  1S72 T;  4JRI A;  1N8R U;  2QA4 T;  5LJ3 h;  4Y28 E;  4M7D A;  4C0D C;  4ELZ C;  3P8H A;  2DIQ A;  4E7L A;  2O4X B;  3LYI A;  2RD1 A;  3PMT A;  3MCA B;  2RHY A;  3P8D A;  2DXC A;  4J7F A;  2QQA A;  1Y07 A;  1I5L A;  4II1 A;  2QA4 A;  5GAN 4;  3MEV A;  3OBW A;  3VKI A;  1Q86 C;  2YLB A;  2K5F A;  1Y71 A;  3RUX A;  1YJW A;  4XU2 A;  2XDD A;  3H6Z A;  4HT9 A;  4FM4 B;  3L2Z A;  2F5K A;  4MML A;  3OMG A;  4J6W A;  3INZ A;  4IUQ A;  4OB2 B;  3CC4 T;  3A8L B;  2M0O A;  2GFU A;  2K4Y A;  2XIC A;  1JJ2 S;  4C0Z A;  4F7U G;  4PJO C;  4PJO G;  5A0D A;  5LJ5 j;  5A2Q E;  3G6E T;  1LOJ A;  2RI5 A;  3QII A;  1YIT T;  4PJO D;  3S3M A;  3MO8 A;  4J6X A;  1X6O A;  3KXT A;  3CC4 A;  3CBP A;  4QQD A;  2M16 A;  1BI2 A;  2RI2 A;  3GF5 A;  3QHS A;  2PVD B;  3MEW A;  4XTU A;  3VV0 A;  1JBM A;  2QQB A;  2VXF A;  3M56 A;  4HT8 A;  2O01 E;  4ZGE B;  3S3O A;  4C5H A;  1YIT A;  4FIB A;  2LT1 A;  5D6X A;  1JJ2 A;  3QJ6 A;  3DB3 A;  3QJY A;  4BY6 C;  5GMK e;  5CR2 A;  2MWP A;  3CC7 T;  4O5V A;  1WJQ A;  3MP1 A;  3EAE A;  1G3W A;  3OMC A;  3CCJ T;  2DVE A;  4RMO A;  3GLX A;  1VUB A;  4KBM B;  4M78 E;  3T9N A;  3M5A A;  5HY6 A;  5GAN 8;  1IRE B;  3JCM W;  2K5I A;  1VIF A;  2IG0 A;  2JOY A;  2BIV A;  3M55 A;  4C92 C;  4C92 G;  3JB9 G;  2QQR A;  3RER A;  5GAO m;  1NJI U;  4BUG A;  2Y4Y A;  4ELY C;  4LDX A;  4C92 D;  3JB9 D;  1YIJ T;  1QP3 A;  5IN1 A;  4C5E A;  1QW1 A;  3CCE A;  3C4S A;  2E10 A;  4B9W A;  5C0M A;  5CKE A;  1D3B B;  3CCV T;  3UPU A;  3GIB A;  2LTO A;  3PGG A;  3M58 A;  2JTM A;  4O6J A;  4IUU A;  5GMK i;  5LJ5 d;  1Q82 U;  2RA2 A;  3QG1 A;  4B9X A;  4HCC A;  4RG8 A;  3SFM A;  3OYB A;  4E7H A;  1M1F A;  1UGS B;  2ZPB B;  4C8Q C;  4EPC A;  1VIE A;  1Y96 A;  3CCV A;  1KQS S;  1GXI E;  1P92 A;  5CVI A;  3V8K A;  2CZ6 B;  4C8Q D;  5CKH A;  2EAY A;  2DKG A;  3MEU A;  2L5Q A;  2RJC A;  5FRM A;  5IAY A;  1WJR A;  3HL8 A;  1BI3 A;  4EMG A;  1U1S A;  1N6A A;  1X75 C;  2FB7 A;  4M75 A;  4J6Y A;  2DTO A;  2VYT A;  1H64 1;  2E70 A;  5DY9 A;  4MDX A;  4M7A C;  1KHC A;  3E9F A;  3LH0 A;  1KQ1 A;  5LJ3 e;  1Y96 B;  2V8I A;  3QO3 A;  3GP8 A;  4BB7 A;  3CCL T;  3JCM g;  3QZ5 B;  1K8A C;  2R58 A;  2KQW A;  2HQE A;  3BDU A;  4FSX A;  1KC8 U;  1LNX A;  3PT9 A;  3X28 B;  3OYK A;  3HHT B;  5GAM d;  4BI3 A;  5HKC A;  1VQ7 A;  3C12 A;  1N27 A;  3ZBD A;  4F7U E;  3EFS A;  3M4Y A;  4PJO E;  1WJS A;  1X01 A;  4JJN K;  1OZ2 A;  3JRZ A;  4XTV A;  3V7S A;  3CCR T;  4OF1 A;  3RES A;  1N9R A;  3M53 A;  3A8G B;  2GQV A;  4QVD A;  2XK0 A;  1UGP B;  1YJN T;  1B34 B;  1EIF A;  1UGR B;  3BFM A;  3M4G A;  3LWH A;  2ZPE B;  4ZGD B;  4LD9 K;  5FU6 B;  1VQL T;  3CCR A;  4JS5 A;  4LDV A;  3G71 A;  2DTH A;  1BIB A;  3JCM b;  4A4G A;  1FWZ A;  4QVC A;  1W4S A;  2X4X A;  1YJN A;  1I4K 1;  4PNO A;  2XHC A;  1MHN A;  2DD4 A;  2H3J A;  1VQP T;  1NPR A;  5GAN d;  4JRP A;  3GOX A;  1N8R C;  2NLU A;  1VQL A;  2WSC E;  2GF7 A;  3VYG A;  1YI2 A;  2KAF A;  3ME9 A;  2K5L A;  3HRT A;  2WSE E;  3DB4 A;  4C92 E;  3ER0 A;  2VGN A;  1VQP A;  3MP6 A;  5LJ3 f;  2GFA A;  4BI4 A;  4XK8 E;  3OSV A;  4HCB A;  2L8D A;  3VJP A;  3A8M B;  5GAM e;  4ZTJ A;  4NS5 A;  4IKF A;  3PIP A;  4OVA A;  3KUF A;  1MGQ A;  1Q7Y U;  3J81 E;  1YBY A;  3OYF A;  3HFN A;  2X35 A;  4OP0 A;  2QEX A;  2M1H A;  4PKC C;  1YJW T;  1VQK T;  2GCX A;  3L2W A;  5GAO r;  5GAN 5;  2EJF A;  3MEA A;  1YHQ T;  1HK9 A;  2LT4 A;  5CO7 A;  3BDL A;  4C8Q E;  3QKJ A;  2QQ9 A;  4LDY A;  4J5Y A;  4XU0 A;  5CKB A;  4EMH A;  2K3X A;  4EMK A;  1OZ3 A;  1PSE A;  4M78 A;  3X25 B;  4A54 A;  1IZ6 A;  1WQ7 A;  2ZZD A;  5LJ5 h;  1VQK A;  4QQ6 A;  2DXT A;  1JRI A;  3OYH A;  3SWN A;  1YHQ A;  3V8L A;  3BY7 A;  3CBM A;  4N4H A;  2VGM A;  3M59 A;  2X4W A;  4JLG A;  3CD6 T;  4M7D F;  4M7D B;  2E41 A;  5GAN e;  2CZ7 B;  4N0A A;  4R55 A;  4M77 A;  3CPF A;  4LDU A;  4M7A E;  2JUF A;  4BE0 A;  2FYK A;  3OB9 A;  1DJ7 B;  3CD6 A;  2WSF E;  4EMK B;  3LX7 A;  2ZPG B;  3HFO A;  2KK4 A;  3JCM X;  4BDY A;  2KVQ G;  2Y4X A;  4QQG A;  3UT1 A;  5LL6 S;  2KDS A;  2PQW A;  4MMK A;  3QDR B;  1M1G A;  3Q1J A;  3CMA A;  3S3N A;  1NJI C;  1Y7X A;  3OYL A;  3EFR A;  2E12 A;  4M77 F;  4ZN1 A;  4M77 B;  4A53 A;  3L2R A;  2RO0 A;  4ATO A;  2VUB A;  1JB0 E;  4FU6 A;  3G4S A;  2RHX A;  2CZ1 B;  3GNF B;  4J7I A;  5GAM h;  2DJZ A;  1Q82 C;  5FRN A;  4BAC A;  3ASK A;  2B8A A;  3CCE T;  1M9S A;  3QYH B;  3RIR A;  5C6S A;  3WVD B;  3CC2 A;  2EYQ A;  3JCM Q;  4N4G A;  2MMP A;  4ZN3 A;  3DLM A;  2E5Q A;  4XTY A;  5CCA A;  1M1K C;  1M90 U;  5CKD A;  4JRQ A;  4X34 A;  3CCM T;  2XDP A;  3MET A;  3VUB A;  5GMK m;  2RK1 A;  4HA8 A;  4E7J A;  2RHZ A;  4A4H A;  5GAN f;  3FIF A;  3QBY A;  5DLO A;  3BW1 A;  2HD0 A;  3CME A;  1XNI A;  4DOW A;  2CYZ B;  4PJO A;  4M75 G;  4Z02 A;  3L2U A;  5DM7 R;  3CCM A;  2DXU A;  3JCM d;  1TH7 A;  2VXE A;  1BI1 A;  1NPP A;  2KY9 A;  5GAN h;  5CQY A;  1QP2 A;  3KBG A;  5EG2 A;  1FXX A;  2DZC A;  3MP8 A;  3V7C A;  1M1K U;  2D9T A;  4MZM A;  2ZPH B;  4C0F A;  2XD0 A;  1G3S A;  2DPP B;  5FU6 C;  1FX7 A;  2JTF A;  3VU3 C;  5D6W A;  1WQW A;  2HAX A;  1KC8 C;  3HRU A;  3I56 T;  1KQ2 A;  1H3Z A;  2Y90 A;  2XDB A;  1NE8 A;  2P0Q A;  2E65 A;  4LDW A;  2MF2 A;  3CXC A;  2FHD A;  1I81 A;  4PLI A;  4LD6 A;  2RH2 A;  2A3L A;  3FDR A;  3QUI A;  2PVG B;  3OYI A;  1VQ8 T;  3MHX A;  3O8V A;  3RMS A;  5GAO p;  1W2B A;  1QVF S;  4Y91 A;  3OYC A;  3OYM A;  3I56 A;  1VQ7 T;  3CPW A;  1XQH A;  1U1T A;  3CEY A;  1VQO T;  3UDC A;  1VQ8 A;  4CI0 C;  3M57 A;  2MWO A;  3TRE A;  3PTA A;  5GAO l;  1ZBX A;  2D6F A;  3P8B B;  3N5B B;  5LJ3 g;  4N4I A;  4UC4 A;  1VQO A;  5IT9 E;  3RKY A;  4M75 F;  5LJ5 e;  4J83 A;  4DA4 A;  3QPH A;  4M75 B;  1QVF A;  4IUR A;  3G71 T;  3JB9 J;  3HP9 A;  2QTX A;  4C0G A;  4NL3 A;  4OGE A;  2DXB A;  2XU8 A;  3J80 E;  2D0Q B;  3WXM B;  4R56 A;  2RJF A;  1U8R A;  4C8Q A;  2P4T A;  2V8J A;  3OS5 A;  4DQ2 A;  2CGH A;  3OA6 A;  1M8V A;  2DK3 A;  1G3Y A;  3J7A F;  1YI2 T;  1N9S A;  1VQN A;  3X20 B;  3OYY A;  4BD3 A;  4JDS A;  1VQ4 A;  2HQX A;  4M7D C;  4M7D G;  3CCU A;  1Q7Y C;  1OYX A;  2EWN A;  1Q81 U;  2E1H A;  4IUV A;  3CCQ T;  5FRO A;  4RCB A;  1UEB A;  2EFI A;  4M7D D;  5GMK j;  4J8O A;  4OB1 B;  2G3R A;  1QVP A;  1BYM A;  4M7A A;  1KHI A;  5CIU A;  4EMK C;  2XI9 A;  4M78 G;  5FU7 B;  5KH6 A;  4OB3 B;  2QEX T;  2EQJ A;  1M4Z A;  3CCQ A;  2VV5 A;  2PVO B;  2R57 A;  1K9M U;  4V2S A;  2RM4 A;  3GNG A;  2YRV A;  3FB9 A;  3C94 A;  4QW2 A;  4XU3 A;  4ZTF A;  1KG1 A;  4M77 C;  4M77 G;  3A8O B;  3ZEH A;  3JCM c;  5LJ5 f;  5GAN 2;  2QDY B;  5GAM g;  5GAN 3;  1R8O B;  2K57 A;  4NOY A;  4XTW A;  5GAN 7;  2LQ8 A;  3I55 A;  4M77 D;  2OTL A;  2R5A A;  4Q5W A;  3LGF A;  3OBY A;  3FC3 A;  3OYD A;  1BI0 A;  3TEE A;  3FJP A;  3VYH B;  2RHU A;  2A7Y A;  2X4Y A;  5AYF A;  3L2Q A;  3JCM h;  4E47 A;  3JCM V;  3FEO A;  3L1A A;  4GLK A;  1I8F A;  3V7R A;  3JB9 I;  3DLL A;  4VUB A;  4P5N A;  5I21 A;  2EJG A;  3S6W A;  1NZ9 A;  2QQS A;  1G5V A;  3CMA T;  2EKO A;  3DKM A;  4C5G A;  3OYN A;  4M78 F;  5GAN g;  4M78 B;  3NTH A;  3JCM P;  3FLG A;  2MAM A;  2FVU A;  4RCC A;  4XTZ A;  3UWN A;  3OYE A;  1S72 A;  3SWN B;  2M9U A;  2ZPI B;  5LJ3 j;  3G4S T;  3TU4 K;  2L3R A;  5GAM f;  5CAI A;  5DLQ E;  1M90 C;  3E1S A;  3SB2 A;  5KCO A;  4E7K A;  2BUD A;  3ZFJ A;  1BIA A;  3OYJ A;  3CC2 T;  1WPY A;  4JUV A;  4YTL A;  4XTX A;  4A4F A;  2OAU A;  3LW5 E;  3QZ9 B;  1KD1 C;  2LVM A;  3X24 B;  4L5G A;  4FL6 A;  4MZP A;  2IVW A;  2JVV A;  2KSS A;  2K2V A;  4A4K A;  4KT0 E;  5I2M A;  5FLX E;  2PU9 B;  1Q86 U;  1M5Q 1;  2XKO C;  2LDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...