3UWNA

The 3-mbt repeat domain of l3mbtl1 in complex with a methyl-lysine mimic
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
324
structure length
318
Chain Sequence
ECWSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein 1
publication title The 3-MBT repeat domain of L3MBTL1 in complex with a methyl-lysine mimic
rcsb
source organism Homo sapiens
total genus 80
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3uwnA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3uwnA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3uwnA03
3MEWA 2B8AA 3NTIA 3L2RA 1OZ2A 2RHXA 3ME9A 4BACA 3L2UA 3SD4A 3S6WA 4II1A 2RHIA 4N4HA 4QVZA 2M16A 4E7IA 3EAEA 3OYJA 4BE0A 2X4XA 2RI5A 3OS0A 2X4WA 3P8DA 5KCHA 2QQRA 2XDPA 3FDRA 3GOXA 2PQWA 3OMGA 3MP1A 4OVAA 3UT1A 3OYIA 4NS5A 3PMTA 3DLMA 5KH6A 4BDZA 3LYIA 2WACA 3KUFA 2M0OA 2RJFA 4IUUA 3MP6A 1WJQA 1SSFA 2RHZA 4LD6A 2HQXA 2RHYA 3BDLA 3LX7A 2R5MA 3PMIA 2LTOA 3QIIA 2CKKA 3QBYA 2MWPA 2YRVA 1WJSA 3MO8A 4QQDA 3FLGA 2X4YA 3S3NA 2RJCA 2HQEA 2FHDA 2BKDN 1OI1A 5C0MA 3QKJA 5FROA 3O8VA 2X35A 3MEUA 3OYAA 1KHCA 4A4GA 1N27A 2G3RA 2RJDA 3UWNA 4C5GA 3OYEA 1WJRA 2EQMA 4A4HA 4Z02A 4FU6A 5KCOA 3OS2A 5D6XA 2EFIA 4N4IA 2MWOA 4ZTJA 2BIVA 2LRQA 4QW2A 4CRIA 3FC3A 4QQ6A 4QQGA 4N4GA 2RI3A 4IUPA 2LCCA 3OYLA 3OA6A 2JZ2A 3FEOA 3OYHA 3E9GA 4X34A 5M9OA 3NTHA 3OYBA 3LGFA 2L3RA 5KE2A 1RI0A 2QQSA 2GFAA 3H6ZA 2M1HA 3META 1OYXA 3NTKA 2O4XA 2E6NA 2R57A 3OS1A 3LLRA 2E5QA 1MHNA 2F5KA 3OQ5A 4GY5A 3H8ZA 4E7HA 2LVMA 1G5VA 3OYDA 2EQKA 3DB4A 3OB9A 3S3OA 5CIUA 3L42A 4E7JA 3S3MA 3PFSA 4E7KA 3C4SA 4C5IA 3OY9A 5J39A 3OYGA 2RJEA 1XNIA 2R58A 4Q5WA 3OYCA 5D6YA 3L2QA 4IUTA 2RI2A 5C6SA 5IAYA 4A4FA 2IG0A 4PL6A 2D9TA 3LGLA 4E7LA 2GF7A 2VYTA 3MEAA 3OYFA 4BE1A 3OYNA 5IN1A 3LH0A 4IUVA 3ASKA 4C5EA 3L2VA 3F70A 1WGSA 1H3ZA 2K3YA 4L59A 4BE2A 4IUQA 3PNWC 2EQJA 3DB3A 4RG2A 3Q1JA 3OYMA 2EQUA 2DAQA 3P8HA 2GFUA 3OYKA 4HCZA 5D6WA 4IKFA 3OMCA 5FRNA 4ZTFA 2L89A 2XK0A 2NLUA 2RO0A 2JTFA 3L2WA 4IURA 4B9WA 5FRMA 4C5HA 3ZEHA 2DIQA 4BD3A 2DIGA 4PLIA 2O4XB 4BDYA 3E9FA 3M9QA 2P0KA 4PLLA 2LDMA 3MP8A 2EKOA 3CEYA 4A4EA 5J26A 5KE3A 2L8DA 2BUDA 2K3XA 4FL6A 1OZ3A 2R5AA 3QJ6A 4UC4A 4EDUA 2RHUA 4B9XA 3MEVA
chains in the Genus database with same CATH superfamily
4M77D 3CCJT 3BFMA 4KT0E 4C92F 1YJWT 2VB6A 1AWXA 1OOTA 3CQTA 2M0OA 4IUUA 1VQ8T 2HMAA 3X26B 4RCBA 2EJ9A 4KH1B 2ZPFB 5CK9A 4FYWB 2FHDA 3IQLA 4EPCA 3AHUA 1OX8A 3M55A 4OB3B 1U1SA 2EQMA 1KFZA 2QQBA 4HKEA 1UG1A 2EYZA 2LRQA 1T0JA 2CGHA 1G2BA 1BI0A 4JUVA 3CCRT 3C12A 1LOJA 3OA6A 5FU7B 4X34A 1FWZA 3I56A 2NUTA 2K4YA 1FMWA 3G71Q 2O4XA 5GAN5 4F17A 4ZN3A 1Q86U 3HFNA 3RUXA 4E7JA 3PFSA 3VUBA 2HNIA 1AT1B 1N8RU 4DBRA 1PNJA 1EIFA 2FB7A 2DXTA 1MUZA 4M77G 2GTOA 1RAEB 1WGSA 1BI3A 2KBTA 2DRKA 4DEYA 4VUBA 5IH2A 2AK5A 2EQUA 3TREA 3OMCA 2OTLA 1VYVA 3CCVA 4C5HA 2RD1A 4MDWA 5DM7R 5J26A 2GGRA 1FMKA 1ARKA 2PUKB 3E2UA 4KGXB 1PKTA 1WQ7A 1BCOA 2D8HA 3SHWA 3U23A 1N6AA 3SWNC 1WDXA 3H0FA 3FDRA 3TEEA 2X4JA 3G4ST 2ZAEA 2BZ8A 2YUQA 1M1KR 2QAZA 1T3SA 2EYXA 3HRUA 1KC8C 2RHYA 4J7FA 1X75C 3CBPA 1AOJA 2CP2A 3QIIA 1M3AA 2J7IA 1B07A 2P0PA 3A5ZB 4OMNA 3CCSA 1VQ4A 2JS2A 1N27A 4RTVA 1RAHB 2GBQA 2PVOB 3UDCA 4C8QA 3UF4A 1G3SA 1RLQC 1Y0MA 2HCKA 1UTIA 3PIOA 1NJIU 1WPYA 3RR6A 4M75F 5I22A 3P8BB 3HSBA 2C06A 1VQLA 3QG1A 2F5KA 3OQ5A 3NMZC 2PUOB 3I9QA 4BI3A 5FLXE 3MJXA 3CC2T 4P5NA 1NEGA 3V7RA 4M75E 3C4SA 1X2QA 1VQPQ 3MKDA 4X9CA 3CMET 5FU7C 2DD4A 4MZPA 3I56Q 1GCPA 4AMCA 2O01E 4DBFA 1RUWA 1ZQ1A 3QWXX 2DTIA 2DJZA 4KULA 3JB9J 1B7TA 4ZTFA 2RO0A 2RH2A 1FMVA 3L2ZA 4C92C 2DJQA 1WX6A 1I07A 4BDYA 3E9FA 1VQ7A 1UFFA 5CKEA 1N8RC 4B6MA 2QG9B 1V1CA 4J6WA 2K2VA 4OP0A 1X6GA 4KGZB 1K73U 1FXXA 1MV0B 4M75B 1Q7YC 4XTWA 3X24B 2H3JA 4ELYC 4M78D 4PKCC 1M2OA 4F14A 5KCHA 2OX7A 2PQWA 2M0YA 2OTLQ 1KHIA 2ATCB 1JU5C 3VS0A 3CCVQ 5KH6A 4KGVB 2YDLA 2CSIA 4CI0C 2ABLA 3CMAT 1VQMT 3LX7A 1MMNA 2LTOA 1XJWB 2QI2A 2Y4YA 1H8KA 1QLYA 1PWTA 1WHGA 1Z9QA 5KYXB 4HVVA 2CH4A 3CCJA 3C0CA 1UGRB 2QASA 1XTDA 1YJWA 4QQ6A 1KC8R 1M8VA 1SSHA 5GAN6 3FEOA 3NPFA 5GANe 1IRXA 5GMKl 1VQ8A 3I5SA 3LH5A 1OYXA 4C8QF 3CCSQ 3JB9H 1VQ4Q 3OS1A 1Y71A 4ME7A 2LT4A 2E6ZA 2A0FB 3DB4A 1BIAA 3X20B 5A0GA 4OMQA 1SPKA 2P84A 3JV3A 1Q82U 3MPUB 2A7YA 5HCKA 2COYA 4BB7A 4C8QE 2AHJB 4J83A 4LXCA 4HA8A 4A53A 3D7SB 4BI8B 3L2QA 4FT2A 1H641 4A4FA 4PL6A 2D9TA 2QTXA 3WVDB 4C0DB 3JSCA 4ELZC 3CCRA 5L23A 5IN1A 3CCQQ 3RERA 1YJNT 1OX9A 2VGMA 4XTVA 3HL8A 3R6OA 2EQJA 4M78G 2V8JA 5DY9A 2CDTA 4ZN1A 2CZ0B 5CKBA 3OYKA 5D6WA 3TCJA 3V8KA 1R8OB 2FG0A 2MAMA 3L2WA 5GMKe 4OMOA 2VKNA 5IT9E 2EIFA 4BI4A 1G83A 3EFOA 2J06A 1H3HA 4FM4B 2CS7A 4K11A 1WZOA 2ECZA 2D0NA 1D3BA 2HKNA 4FSSA 2YRDA 4QVZA 4AT1B 2DO3A 2NYSA 1VQ5T 4C8QB 1YHQT 3MHXA 2RI5A 3EH2A 2M9UA 3G7ZA 4WTOB 4BDZA 4JS5A 5J3BA 2JW4A 3CBOA 1N8RR 1VQ7Q 1X01A 1PHTA 2EGCA 1HXDA 2X3WD 1K9MU 1M1FA 2DZ9A 3FLGA 2FRYA 3RNJA 2RN8A 5C0MA 4A54A 1C0MA 1Q7YR 2X35A 1KQSS 3A8MB 4D8KA 1JXOA 2A28A 4ZTJA 1RAIB 4ZGEB 5GAOn 4M77E 3RKYA 1K0SA 4CRIA 2ZPIB 3JCMf 3G4SA 2RI3A 3REAB 3CXCS 2KROA 5DLQE 2JZ2A 3CCMT 2XICA 1OU8A 2L3RA 1Y96A 1EZZB 5IHNA 2MIOA 4RMOA 1ZBXA 1QP3A 1TXQA 2QTVA 2BZYA 2PNIA 2LVMA 3VKIA 3INZA 4Z89A 3VV0A 2KEAA 2OJ2A 3CCJQ 3QJYA 3OY9A 1GCQA 3EG3A 1YJWQ 1C1AA 2GCXA 3M0TA 2IG0A 4X1VA 1VQ8Q 2GF7A 2BTTA 3QPHA 1KIKA 4C5EA 2RF0A 4MZTA 4J8OA 4QVDA 2K3YA 4M7DD 2NUPB 2QGFB 1HSQA 4M77B 2QYZA 2DBKA 2L89A 2XK0A 3CC2A 4AG2C 2VV5A 1PCXA 1GFCA 1VQKT 2KNBB 2ZPEB 4E47A 3TSZA 3CMEA 1X69A 3CCRQ 4E7IA 1YWPA 4OGEA 4M7AC 2MYSA 3ZFJA 2EJGA 3S6WA 2DK3A 2YSQA 4Z88A 2SRCA 1TOVA 2VGNA 1NPRA 2BE7D 4OMMA 2WSEE 1LVKA 3OBYA 3HRSA 1CSKA 3OYIA 1JEGA 1SG5A 2CUBA 4PJMA 1IREB 3JB9F 2WACA 1Q81U 3EG2A 1I5LA 3MP6A 3LW5E 4R55A 3BDLA 2O31A 3VYHB 3QBYA 3TQ7P 4N0AA 1RABB 2KDSA 4FW1A 3JCMV 1PRMC 4JJCA 4C8QC 2E1HA 5GMKm 2K5LA 3X25B 4NL2A 2VASA 1AHJB 5GAMf 1TU0B 1UGQB 4M7AD 3E9GA 1VIEA 3NHNA 3CMAA 1VQMA 3CC7T 2JTMA 3OW2S 2GFAA 8AT1B 1K9MC 1VQLT 3PT9A 4M7DG 2R57A 3RBBB 5CO7A 1UJ0A 4ANJA 1YWOA 3QDRB 2AZSA 2EQKA 4L6V5 3GF5A 2LQWA 4C5IA 4QVCA 3OYGA 1QMCA 3G4SQ 2DM1A 1VQ9Q 4PFZA 1WLPB 1NG2A 2EWNA 5HKCA 1S72T 4RG8A 4FT4A 4E7LA 2E5KA 1N9RA 4PJJA 4A63B 4LDVA 3HTRA 1YCYA 4J5YA 3Q1JA 3KFVA 4HCZA 5FRNA 1BB9A 4J9IA 4IURA 3HHTB 3GP8A 2X51A 4MZMA 2KT1A 2CYZB 1D1AA 1J3TA 4RUGA 3QJ6A 4EDUA 5IXBA 2EW3A 1ABQA 3OBWA 3A98A 1RACB 2ZPBB 3L2UA 3FJ5A 4F16A 1W1FA 3OYYA 1YJNA 2DERA 5A0DA 4AFQC 3UT1A 4M7AG 2K79A 1QVFA 3H0IA 1BIBA 3M5AA 1MNEA 2MCNA 1WJQA 3I5RA 3JCMX 2L0AA 2P4RA 3CMEQ 2YRVA 4E7ZA 1KG1A 1VA7A 3VUZA 1K8AU 2YLCA 2G6FX 2G3RA 4A4HA 2MMPA 2A08A 3VS7A 1VQ5A 1MNDA 2HKQB 1YHQA 1QCOA 4WF2A 5EG2A 5DLOA 3EHRA 4N4GA 1M90U 1Q81C 4M78E 2ROTA 2DEQA 2DA9A 1RAFB 1NEBA 2QQSA 4AFZC 1TWBA 4OMFB 5GJWB 4PJOA 2QDLA 2KGTA 2CH4W 2XDDA 4C0GA 4PJNA 4NL3A 2XHCA 4JRIA 2DLPA 4M75A 2KYBA 1UE9A 2OAUA 5IAYA 3CMAQ 2HQHA 3EG1A 3H0HA 1K9MR 1E6HA 3FIFA 2YUNA 3MEAA 2JUFA 2HAXA 3CCMA 3JB9I 4IUVA 1QVGP 2DXUA 3DKMA 1KD1U 1WXTA 2JMCA 2RQWA 3A8GB 2GFUA 1JJ2P 4LUDA 2EBPA 1M4ZA 2H8HA 4M78B 2K7AA 5KYXA 4LD9K 2K5IA 1AWWA 5GAMj 4MMKA 2IVWA 2L8DA 3O5ZA 2K3XA 2RQVA 2LCLA 5HK3A 4B9XA 3MEWA 2RHXA 1ACMB 4LDXA 3CD6T 5FU6C 2AKLA 1AZEA 1O9SA 2JM8A 2P4TA 1VQ6T 2DMOA 2FYKA 2ESWA 2WSCE 3PMTA 1D1BA 2CT3A 3LYIA 4CC7A 2J6KA 3JAME 2V8IA 3A1PA 4RTWA 4Y92A 2VWFA 1VQKA 5A2QE 4QQDA 4AFSC 3DLLA 3R6NA 1HK9A 1YJNQ 1YNZA 3J80E 2FO0A 3QZ5B 2AZVA 3QZ9B 1TS9A 2XDBA 2QQAA 1VUBA 1KQSP 2XD0A 2IPOB 4RCCA 2GQIA 2KRNA 5KE2A 1RI0A 1ZUUA 2K2MA 2BE9B 2E12A 2EPDA 3M58A 2YWWA 3LLRA 4J7IA 1GCQC 3GIBA 1K8AC 2FEIA 1M8MA 3CCLT 1G5VA 1BBZA 4F04B 1MMAA 1YHQQ 1K4US 1SHFA 2WSFE 3S3MA 1WHKA 1QKWA 4IIMA 2RJEA 1VQOT 4JPBW 5D6YA 4PJOF 1M90C 1LPLA 2FRWA 2LMJA 2J05A 3I55T 3CC7A 2YT6A 4PJOE 1IO6A 3M56A 4DQ2A 1BI1A 2CZ6B 4IKFA 4ESRA 3ZL7C 3JCMh 3VYGA 4HCCA 1IGUA 4PLIA 3GNFB 2HDAA 5I2MA 4A4EA 1WHMA 2FZCB 1OZ3A 1YN8A 4A4KA 1RI9A 3MEVA 3CCMQ 3NTIA 1S72A 2DYIA 3GLXA 2X9HA 2FZKB 4HVWA 5KYUB 1YI2T 2M16A 5GAN4 1Q86C 1D1CA 4E6RA 4JJNK 4JZ3A 2KMTA 1NPPA 4TVRA 1TUCA 4NS5A 1ZUKA 5GJVB 2L3PA 1RAGB 2DFUA 4N0AC 3KUFA 3JCMP 4LD6A 1QWEA 2E70A 1YCSB 4O5VA 4JLGA 1YIJT 4PJOB 2LJ3A 2DTOA 2V26A 4XTZA 4HT8A 2X4YA 1Y57A 3URGA 2JM9A 3M4GA 3AT1B 2FPFA 4JJDA 2MWOA 2RA2A 4RTTA 3RDVA 5GAN3 3CCET 4FYXB 2NUPA 3FC3A 4QW2A 4M77A 3CPWS 2QQ9A 3G6ET 3SDZA 1VQKQ 4PNOA 2J6OA 4J9DA 3L1AA 3RMSA 5GAN7 5L8RE 5CKDA 1PG5B 1JB0E 1M30A 2KI7A 1XQHA 1Q95G 4C92D 5CIUA 2DD5A 1R0CB 2DL4A 4MDXA 1WQWA 3OYCA 5CR2A 1NM7A 1LCKA 1QVFP 1U06A 2DL8A 3OYFA 3I35A 3OYNA 5FWBA 2V8KA 4EMKB 4KRTA 2QXFA 2DVEA 5GAMh 3EGXB 2EVRA 4D8DA 3UA7A 3ZEHA 1I5OB 4PJLA 2ENMA 2LP5A 3EFSA 3CC4T 4Y28E 1RAAB 3CC7Q 1NJIC 2D6FA 3JCMd 1V29B 3ER0A 3PVQA 1VQLQ 4BE0A 2HZYA 2E3IA 3M53A 3OS0A 4OB0B 3PGGA 3GOXA 3OMGA 1ABOA 3H41A 3WVEB 2C0OA 5I11A 4L5GA 1D0ZA 4HCKA 2DILA 2M51A 2LQKA 2L3SA 1Q86R 3CD6A 4V2SA 4C92G 1ZSZB 5GAOl 1KHCA 2K3BA 4A4GA 2RJDA 4J9GA 1P92A 1VQ6A 4DA4A 1OU9A 5LJ3h 3FB9A 2RNAA 2Y4XA 3NGPA 2PZ1A 4IUPA 2LCCA 1QVGA 4GLKA 1W2BS 4PJOC 3VS3A 1WNLA 2COZA 5GAOr 4M77F 4RTZA 1B34A 1D0YA 3TU4K 2ED1A 4GY5A 1JJ2A 2LJ0A 2ROLA 4M75C 1K73C 2KRSA 3OB9A 3JCMJ 2HD0A 1JQQA 5CKFA 2LX7A 3A8HB 4MMLA 2RI2A 2JN0A 1YJ9T 2J6FA 1SHGA 1UGVA 2D0QB 1Y07A 3L2VA 4FYVB 4L59A 3UA6A 4EMGA 4JJBA 4BUGA 2LCSA 1VQPT 3CCLA 4JZ4A 2ED0A 3SWNA 1O75A 4XU1A 4J9HA 5KE3A 1VQOA 4JRQA 4JRPA 5GAMd 1OZ2A 2JS0A 3ME9A 4M75D 3I55A 2OTJA 2V1RA 2RB6A 3EAEA 2E65A 2X4XA 1M5Q1 1RL2A 5I2SA 2CP0A 3RKXA 1KQSA 1EX4A 1Q82C 4OVAA 3DLMA 3QO3A 2ZPGB 2FPEA 2QEXA 1SSFA 5KYYB 2B86A 2R5MA 3PMIA 3EGDB 4C0DC 1WJSA 3CXCA 1NJIR 2KK4A 2JVVA 4XU2A 1WA7A 1YP5A 1UEBA 1BCMA 2O2OA 2BKDN 1OI1A 1UHFA 1TUGB 1JO8A 3BY7A 5LJ5h 2VXEA 3OYAA 3A8LB 1CKAA 1YI2A 3OS2A 1QKXA 1M1KU 2DE0X 1KSWA 2JT4A 2KY9A 5GANf 4QQGA 1AEYA 2HL3A 2DKGA 3GPLA 1G8XA 3OSSC 4M78A 3QHSA 2QDYB 1LJOA 4Z8AA 2D1XA 1QCNA 1YIJA 4RTXA 3M57A 1IHVA 4E7HA 5EC7A 2CSQA 3JCMc 1OPKA 4OMPA 1VQ6Q 3VRYA 1U5SA 1D0XA 3LWIA 4E7KA 1NLPC 1E6GA 2NWMA 3CCEA 5C6SA 2GNCA 3ZBDA 1MGQA 2COWA 1NBEB 1M3BA 2DVJA 2VYTA 1ZHIA 3G6EA 2K57A 2DZCA 1D09B 1H3ZA 1OPLA 3CCUT 1K73R 4RG2A 4DOVA 2CREA 1IZ6A 2L2PA 2K6DA 4QKUA 1PC0A 1U8RA 3JCMg 2P0QA 4FIBA 1ZBJA 2QGGA 2VXFA 4F7UG 5GMKi 4LE9A 1G3TA 3G1JA 1GBRA 1I8FA 4C8QD 2YXYA 2XG8D 1RLPC 2VVKA 1TTHB 5LJ3f 2MPXC 3M54A 1UUEA 1B34B 2MI6A 3M0SA 2KXDA 1VQNT 3I55Q 3CC4A 5HY6A 3OW2A 2E10A 1NLOC 4EMHA 3UWNA 4M77C 1GBQA 2O88A 4Z02A 1Q82R 5D6XA 2HBPA 4OB1B 2KT8A 3CC2Q 2QA4T 4KBMB 4E7SA 3OS5A 3OYHA 3SFMA 1X6BA 4ZGJB 2RQTA 1X6OA 4XTYA 1MHNA 3CPWP 1LNXA 3SWNB 5AYFA 2GTJA 4M78F 1AWJA 4J9FA 4X9DA 1PM3A 3HP9A 5KYUA 1KC8U 2R58A 2KYMA 2MK5A 2HSPA 1G3YA 4IUTA 3V7CA 2W0ZA 2Z0WA 4C8QG 4ATOA 2KRMA 2EGAA 3E19A 1YIJQ 3QXEB 3PNWC 1GL5A 1YBYA 1FYNA 1M1GA 5GAMg 3OYMA 3EG9B 5LL6S 1YITT 3VRZA 1TG0A 1PSEA 3VU3C 3CCEQ 1X27A 4PLLA 5GANj 1NE8A 1KQ2A 3VS5A 4C92E 3CPFA 1SEMA 2DL3A 2R5AA 2V1QA 1VQMQ 3M0QA 3G6EQ 1YJ9A 4LN2A 1CKBA 1V76A 2C0TA 4OB2B 5LJ5f 4CC3A 3P8DA 3WXMB 1UDLA 4CC4B 2ZZDA 1HD3A 3RMQA 1KJWA 4C0ZA 3JCMQ 1WHHA 3HRTA 1VQPA 5GAN2 2E4HA 1Y7XA 4M7DA 3M0UA 1WHLA 2CKKA 5KYNA 2MWPA 2JOYA 2HBWA 3FRNA 3EFRA 3S3NA 2OI3A 3HFOA 2F69A 1NZ9A 1N5ZA 3EGUA 4F7UA 3OSVA 1ZSGA 5LJ3g 1BK2A 1E7OA 3C95A 4FU6A 1HYOA 4XU3A 5KYWA 2EKHA 2XIDA 4C92B 5GMKj 2BIVA 2DTHA 4EMKA 1WI7A 4YTLA 2GQVA 2HEQA 3OYBA 3A8OB 3NTHA 3EGXA 2EYQA 1QQJA 2M1HA 3NTKA 2CZ1B 3CC4Q 2FL7A 2SEMA 1WXUA 1VOMA 2KQWA 3FJPA 1Q7YU 4LNPA 2JJ9A 1W2BP 3HPWA 3S3OA 2O9SA 3REBB 1H92A 2DBMA 2F2XA 3JB9D 1W70A 5LJ3j 3LWHA 2RK2A 1TSFA 2M02A 4HVUA 4OF1A 3NFCA 2L5QA 3F70A 3V7SA 3JCMb 4BE2A 4OMLA 3CXCP 3DB3A 4M7AA 3QWYA 4J6XA 2CP7A 4FSXA 1VQ5Q 1VQ9T 1K0XA 3QUIA 1QP2A 2NLUA 2JTFA 4B9WA 2DRMA 2EAYA 5FRMA 1ZSZA 1Q81R 4DBQA 4KUDK 4UC4A 4FL6A 1UJYA 5GAN8 2OTJT 2H3EB 4N4HA 2RM4A 4ZNXA 3VS1A 1WYXA 3PIPA 3CCUA 3UATA 3QSUA 2QEXT 1IXDA 2RK1A 2VC8A 2PVGB 1GRIA 1PD0A 3M0PA 3HKSA 2LT1A 1U3OA 2D8JA 4JS4A 1NYGA 4D6WA 2BZXA 1YJ9Q 3CCQA 4C0FA 2W10A 5LJ5g 2HQEA 4XTXA 4M7DF 3MEUA 1VYUA 4WCIA 1KD1C 5KCOA 2I2LA 3QYGB 4GBQA 3JB9G 4M78C 1TUDA 3PE0A 4M7DE 5FW9A 4F7UF 2AKKA 4XU0A 3TVTA 3OYLA 2PVDB 3JCMe 3LGFA 2XMFA 2DF6A 1UHCA 4F7UE 1VQNA 2EYYA 1KQ1A 1B3QA 4RKUE 3OYDA 2F2WA 4ORZA 2DL5A 3L42A 5LJ5j 1JXMA 2NUZA 1G3WA 1M2VA 1EFNA 5CCAA 4Q5WA 4J9CA 4XAXB 1PRLC 2QA4A 2Y90A 1UGSB 2LNVA 4AFUC 5CQYA 3LH0A 1QW1A 5KYYA 1FX7A 2DXCA 4CC2A 1WIEA 3EGDA 1W6XA 3KXTA 1F1BB 5CAIA 2KXCA 3OW2P 3RESA 4M7DB 1M9SA 1M3CA 3GBQA 1IB8A 2NUTB 5GANh 1MMGA 1UECA 2E3HA 1JRIA 4BD3A 1N9SA 1RADB 2O4XB 4M7AF 1ZLMA 3N5BB 2DL7A 1SRLA 3G71T 4KUIA 4F7UB 2B8AA 2HSEB 4M4ZA 1XOVA 4BACA 1UGPB 5KYWB 4M7AE 2DX1A 3E1SA 1K9AA 3MCAB 1K8AR 2CP6A 2C0IA 2VUBA 1C6VX 2YRCA 3VS6A 3VJPA 1IHWA 2DXBA 2X4WA 2DNUA 2XKOC 2KVQG 3JCMW 2JMAA 1YITA 3T9NA 2LQNA 1M90R 2EJFA 1GFDA 1HJDA 3CPWA 3M4YA 4LDUA 2RJCA 2RPNA 3M59A 3UPUA 3CCUQ 5GMKh 1X2KA 2JXBA 1W4SA 2RQRA 3PTAA 1KK7A 1QVGS 1YFNA 2LJ1A 2EQIA 4J6YA 2FZGB 5GAMe 1VYTA 4M7AB 1JJ2S 3H6ZA 1S72Q 2KSSA 2I0NA 1ZA1B 4O6JA 3QDFA 1X43A 1KD1R 3EH1A 1IGQA 2AT1B 1BKBA 2CT4A 2E64A 3JRZA 4HCBA 1QCFA 5J39A 1A0NB 1SKUB 3EHQA 3RKWA 4RTYA 2YLBA 3LGLA 1T3LA 3VS2A 5IHIA 1K1ZA 4BE1A 2DPPB 1R0BG 1K76A 5CKHA 1MMDA 1ZX6A 1Z9ZA 2DETA 1VQNQ 3THKA 3H9NA 1WXBA 1OEBA 3TSWA 5IXFA 4KH0B 2OAWA 4JRKA 2P0KA 3GNGA 5I21A 5LJ3e 3CBMA 4LDWA 2QA4Q 3BW1A 4FYYB 4XK8E 2LX9A 5GANd 3SD4A 4II1A 2RHIA 3V8LA 5ECAA 4M7DC 4RTUA 4LDYA 2AIRB 3MP1A 3SB2A 1VQ9A 7AT1B 4J9BA 2RHZA 3I56T 2EGEA 2EYWA 2HQXA 4PJOD 1I4K1 5GAOp 3ULRB 1S1NA 1W2BA 2ZPHB 2K9GA 1PKSA 3QKJA 5HK0A 1AD5A 1M2VB 3C94A 4AG1C 4R56A 4EMKC 2L3QA 2YUOA 4C5GA 2FPDA 3OYEA 2YUPA 1SF9A 2EFIA 1OULA 1BYMA 1T0HA 1YITQ 3EG9A 5M9OA 4PFOA 5AT1B 3META 4FW2A 4Y91A 6AT1B 2YHTA 1AZGB 3KBGA 2CP5A 3H8ZA 2MOXA 1NYFA 2OTLT 2F5TX 4JLIA 1JBMA 3CCVT 1UB4A 5A0LA 2XI9A 4GLMA 1QWFA 2JTEA 2RQUA 1MV3A 3RIRA 4LUEA 2QK0A 4BY6B 4NOYA 3EG0A 5LJ3d 4FCYA 4PFPA 2PTKA 3CD6Q 1I81A 1ZSZC 2F2VA 2DEUA 2LC4A 5LJ5e 2LQ8A 2ZGWA 4PJOG 2DIQA 1TH7A 1BU1A 3MP8A 4IIOA 9ATCB 3CEYA 1R77A 2BUDA 8ATCB 3CCST 2K5FA 1VQ4T 4M75G 4JDSA 4C92A 3L2RA 3QYHB 4HT9A 1OQKA 3OYJA 5IHKA 2QQRA 2XDPA 1I1JA 4DBHA 2KAFA 2KR3A 4QT7A 3VS4A 2RJFA 5CQXA 2LNHB 1AVZC 4OGCA 2CZ7B 1WFWA 4PK4A 1QVPA 3CCQT 1AWOA 3MO8A 3V8JA 3G71A 3BDUA 4XQ3A 5FROA 3O8VA 1U1TA 1SRMA 4XTUA 1WJRA 5CVIA 1QVFS 4N4IA 5FWCA 3CCLQ 3EFOB 1PD1A 3SEMA 3PVLA 4HXJA 2PU9B 1OV3A 1D3BB 2O9VA 3X28B 5GAOm 1BI2A 1GXIE 2A37A 2JNGA 3M0RA 1VQOQ 3J81E 1WHJA 1PSFA 2E6NA 5FU6B 2E5QA 2OTJQ 4ZGDB 1M27C 1VIFA 5GAOq 4R0KA 2LZ6B 2XU8A 2IIMA 1VQ7T 1XNIA 2DYBA 2CUDA 2QEXQ 1ZA2B 5LJ5d 2E41A 5D7UA 2A36A 4DEXA 2RMOA 2CP3A 3ASKA 2MF2A 4IUQA 2F1LA 4DOWA 2HL5C 2DAQA 2KE9A 3P8HA 5GANg 1YI2Q 2A3LA 3BE3A 4J9EA 1Y96B 2ZCFB 2DIGA 1M1KC 1DJ7B 3M9QA 2FVUA 2LDMA 3J7AF 2EKOA 1I0CA 4E2FB 4BY6C 1ZUYA 2RHUA 4EIKA 2X3XD
chains in the Genus database with same CATH topology
5GAN8 3ZFJA 1NJIC 2D6FA 2EJGA 2OTJT 3JCMd 1V29B 3ER0A 3S6WA 4M77D 4N4HA 2DK3A 2RM4A 3CCJT 3BFMA 4E7IA 4KT0E 4BE0A 3PIPA 3CCUA 2VGNA 4C92F 1NPRA 3OS0A 3M53A 1QVGA 4OB0B 2WSEE 3OBYA 3PGGA 3GOXA 3HRSA 3OMGA 1YJWT 3QSUA 3OYIA 2QEXT 1IREB 2RK1A 2VC8A 3JB9F 2WACA 1Q81U 1I5LA 2PVGB 2M0OA 4IUUA 3MP6A 1VQ8T 3LW5E 4R55A 3BDLA 3VYHB 3WVEB 3HKSA 3QBYA 3X26B 2LT1A 4L5GA 4JS4A 4N0AA 4RCBA 2EJ9A 4D6WA 2ZPFB 2KDSA 5CK9A 3CCQA 4C0FA 5LJ5g 2HQEA 4XTXA 2FHDA 3JCMV 4M7DF 2LQKA 4EPCA 3AHUA 3CD6A 4V2SA 3MEUA 4C92G 4C8QC 5GAOl 1KHCA 4A4GA 2E1HA 2RJDA 3M55A 4OB3B 5GMKm 1U1SA 2EQMA 1KD1C 1P92A 2K5LA 2I2LA 2QQBA 5KCOA 4DA4A 1VQ6A 5LJ3h 4NL2A 3X25B 3QYGB 3JB9G 3FB9A 1AHJB 5GAMf 4HKEA 4M78C 2LRQA 2Y4XA 4M7DE 2CGHA 1UGQB 4F7UF 1BI0A 4JUVA 4M7AD 3CCRT 3C12A 4IUPA 2LCCA 4XU0A 3OYLA 1LOJA 2PVDB 3OA6A 5FU7B 3E9GA 1VIEA 4X34A 3JCMe 1FWZA 4GLKA 3CMAA 3LGFA 3I56A 1VQMA 1W2BS 3CC7T 2JTMA 3OW2S 4PJOC 2GFAA 1K9MC 2K4YA 1VQLT 3PT9A 4M7DG 2O4XA 5GAN5 2R57A 1WNLA 5GAOr 4M77F 5CO7A 1B34A 3QDRB 3TU4K 4F7UE 1VQNA 1KQ1A 4GY5A 4ZN3A 1Q86U 1JJ2A 1K73C 4M75C 3HFNA 4RKUE 2EQKA 3OYDA 4L6V5 3OB9A 3RUXA 3GF5A 3L42A 5LJ5j 4E7JA 3PFSA 3VUBA 4C5IA 4QVCA 2HD0A 3OYGA 3JCMJ 1G3WA 2HNIA 5CKFA 5CCAA 4Q5WA 1N8RU 4XAXB 3A8HB 4MMLA 2RI2A 2EWNA 2QA4A 5HKCA 1S72T 4RG8A 2JN0A 1EIFA 2Y90A 4FT4A 1UGSB 2FB7A 2LNVA 4E7LA 1YJ9T 2DXTA 5CQYA 1N9RA 2D0QB 4M77G 3LH0A 1Y07A 4LDVA 3L2VA 1WGSA 1QW1A 1FX7A 2DXCA 4L59A 1BI3A 1YCYA 4EMGA 4J5YA 3Q1JA 4VUBA 3KXTA 5CAIA 2EQUA 3TREA 3RESA 4BUGA 1VQPT 4M7DB 1M9SA 4HCZA 3CCLA 5FRNA 3OMCA 2OTLA 4IURA 5GANh 3CCVA 3SWNA 3HHTB 1JRIA 4C5HA 4BD3A 3GP8A 2RD1A 1N9SA 2O4XB 4M7AF 4MZMA 4MDWA 1O75A 4XU1A 3N5BB 2CYZB 5J26A 5DM7R 5KE3A 1VQOA 3QJ6A 4EDUA 3G71T 4JRQA 4JRPA 2PUKB 4KUIA 4F7UB 5GAMd 2B8AA 3OBWA 1OZ2A 3ME9A 4M75D 1WQ7A 1XOVA 2ZPBB 3I55A 1UGPB 3L2UA 4BACA 2OTJA 4M7AE 3E1SA 2RB6A 3MCAB 1N6AA 3EAEA 3SWNC 2E65A 2X4XA 3OYYA 1YJNA 1M5Q1 1RL2A 2VUBA 5A0DA 3VJPA 2DXBA 2X4WA 5I2SA 3FDRA 3RKXA 3TEEA 1KQSA 3UT1A 2X4JA 2XKOC 2KVQG 4OVAA 3G4ST 3JCMW 1Q82C 3DLMA 4M7AG 1QVFA 3QO3A 1YITA 1BIBA 2ZPGB 3T9NA 3M5AA 2QEXA 1WJQA 1SSFA 3HRUA 1KC8C 3JCMX 2RHYA 4J7FA 1X75C 2R5MA 3CBPA 3PMIA 3QIIA 4C0DC 2YRVA 2EJFA 1WJSA 3CXCA 2P0PA 3A5ZB 2KK4A 3CPWA 2JVVA 3M4YA 4LDUA 1KG1A 4XU2A 3CCSA 1UEBA 2RJCA 1VQ4A 2BKDN 1OI1A 3VUZA 1K8AU 2YLCA 3M59A 3BY7A 5LJ5h 2VXEA 3OYAA 3UPUA 3A8LB 1N27A 2G3RA 4A4HA 5GMKh 2MMPA 1YI2A 3OS2A 1VQ5A 1W4SA 1YHQA 4WF2A 2PVOB 5EG2A 3PTAA 5DLOA 1M1KU 3UDCA 2KY9A 4C8QA 5GANf 4QQGA 1QVGS 1G3SA 4N4GA 1M90U 4J6YA 1Q81C 5GAMe 2DKGA 3GPLA 4M78E 2DEQA 3PIOA 3OSSC 1NJIU 4M7AB 4M78A 1WPYA 3QHSA 2QQSA 1JJ2S 3H6ZA 2QDYB 4M75F 1LJOA 3P8BB 3HSBA 2KSSA 4OMFB 2C06A 1YIJA 1VQLA 3QG1A 2F5KA 3OQ5A 4O6JA 3M57A 2PUOB 4E7HA 4BI3A 3JCMc 4PJOA 5FLXE 3CC2T 2XDDA 1BKBA 4P5NA 4C0GA 4NL3A 2E64A 3JRZA 4M75E 3V7RA 3LWIA 4HCBA 4E7KA 2XHCA 3C4SA 4JRIA 5J39A 4M75A 3CCEA 2OAUA 4X9CA 3CMET 3RKWA 2YLBA 5C6SA 5FU7C 5IAYA 2DD4A 4MZPA 1MGQA 3LGLA 3ZBDA 4Y28E 2VYTA 3FIFA 2O01E 3MEAA 4BE1A 2JUFA 2DPPB 2HAXA 1ZHIA 3CCMA 3JB9I 4IUVA 3G6EA 2K57A 5CKHA 2DZCA 1ZQ1A 2DXUA 1H3ZA 2DTIA 2DJZA 3CCUT 4KULA 3DKMA 4RG2A 4DOVA 1IZ6A 3JB9J 1KD1U 1U8RA 3A8GB 2GFUA 3JCMg 4ZTFA 1M4ZA 2RO0A 2P0QA 2RH2A 4M78B 4FIBA 4JRKA 4LD9K 2K5IA 2VXFA 3L2ZA 4C92C 4F7UG 5GMKi 4BDYA 5GAMj 3E9FA 2P0KA 3GNGA 5I21A 5LJ3e 5CKEA 3CBMA 1VQ7A 4LDWA 1G3TA 4MMKA 1N8RC 3BW1A 2IVWA 2L8DA 4XK8E 2K3XA 2LCLA 2LX9A 5HK3A 4B9XA 1I8FA 3MEWA 4J6WA 5GANd 2RHXA 4LDXA 2K2VA 4OP0A 4C8QD 3CD6T 5FU6C 3SD4A 4II1A 2RHIA 1FXXA 2XG8D 1K73U 1O9SA 2P4TA 4M75B 3V8LA 1VQ6T 1Q7YC 4XTWA 2FYKA 3X24B 2H3JA 4ELYC 4M7DC 4M78D 4PKCC 5KCHA 2WSCE 4LDYA 2PQWA 3MP1A 1KHIA 3PMTA 5KH6A 3SB2A 3LYIA 5LJ3f 3M54A 4CI0C 1VQ9A 3CMAT 1VQMT 2RHZA 3JAME 3I56T 4PJOD 2HQXA 2V8IA 3LX7A 1B34B 2MI6A 2LTOA 1I4K1 5GAOp 1VQKA 5A2QE 2QI2A 4QQDA 1VQNT 3DLLA 2Y4YA 3CC4A 1W2BA 5HY6A 3OW2A 1HK9A 2ZPHB 2E10A 3QKJA 5HK0A 3C94A 4EMHA 3UWNA 4R56A 4EMKC 4C5GA 4M77C 3OYEA 3J80E 4Z02A 3CCJA 5D6XA 2HBPA 2EFIA 3QZ5B 3QZ9B 2XDBA 4OB1B 1BYMA 1UGRB 2QQAA 1VUBA 1XTDA 2QA4T 1YJWA 4QQ6A 1M8VA 2XD0A 5GAN6 4RCCA 4KBMB 3OS5A 3FEOA 5GANe 3OYHA 5M9OA 5GMKl 1VQ8A 5KE2A 1RI0A 3SFMA 3META 1OYXA 4C8QF 4ZGJB 3JB9H 4Y91A 2E12A 3M58A 2YHTA 1X6OA 3OS1A 3LLRA 4XTYA 1MHNA 4J7IA 3KBGA 1Y71A 3GIBA 1LNXA 3H8ZA 3SWNB 1K8AC 5AYFA 4ME7A 2LT4A 2E6ZA 3CCLT 1G5VA 3DB4A 4M78F 1BIAA 2F5TX 3X20B 5A0GA 1Q82U 4JLIA 1JBMA 3CCVT 2OTLT 2A7YA 1UB4A 4X9DA 3S3MA 2WSFE 5A0LA 4BB7A 2XI9A 4C8QE 2RJEA 3HP9A 1KC8U 2AHJB 2R58A 4J83A 1VQOT 4HA8A 5D6YA 4PJOF 4A53A 4BI8B 1G3YA 4IUTA 3L2QA 4FT2A 3V7CA 1M90C 1H641 4A4FA 4PL6A 2D9TA 2QTXA 3RIRA 3WVDB 3JSCA 4C0DB 4ELZC 3I55T 4BY6B 3CCRA 4C8QG 4ATOA 4NOYA 5LJ3d 5IN1A 3CC7A 3RERA 3E19A 1YJNT 2VGMA 3QXEB 4XTVA 3HL8A 3R6OA 3PNWC 2EQJA 4PJOE 4M78G 2V8JA 3M56A 5DY9A 1YBYA 4DQ2A 4ZN1A 1BI1A 1I81A 1M1GA 2CZ0B 5GAMg 3OYMA 2CZ6B 5CKBA 5LL6S 3OYKA 1YITT 2LC4A 5D6WA 3TCJA 5LJ5e 4IKFA 3V8KA 2LQ8A 1R8OB 3L2WA 2MAMA 1PSEA 2ZGWA 3JCMh 3VYGA 4HCCA 4PJOG 3VU3C 2DIQA 5GMKe 4PLIA 1TH7A 3GNFB 4PLLA 5IT9E 5I2MA 3MP8A 5GANj 1NE8A 2EIFA 3CEYA 4A4EA 4BI4A 4C92E 1KQ2A 3CPFA 2BUDA 1OZ3A 2R5AA 4A4KA 3CCST 2K5FA 1VQ4T 4JDSA 4M75G 3MEVA 4FM4B 2CS7A 3NTIA 4C92A 3L2RA 1S72A 3GLXA 1YJ9A 1D3BA 3QYHB 4QVZA 1YI2T 4HT9A 2DO3A 2M16A 5GAN4 3OYJA 1VQ5T 4C8QB 1YHQT 1Q86C 4OB2B 5LJ5f 3MHXA 2RI5A 4JJNK 3P8DA 3WXMB 2QQRA 2M9UA 2XDPA 3G7ZA 3JCMQ 2KMTA 2ZZDA 3RMQA 1NPPA 4TVRA 4C0ZA 3HRTA 4NS5A 2KAFA 5GAN2 4BDZA 1VQPA 4JS5A 5J3BA 4N0AC 1Y7XA 3KUFA 3CBOA 2RJFA 3JCMP 4LD6A 5CQXA 1X01A 4M7DA 4OGCA 2CZ7B 2E70A 1HXDA 2CKKA 4O5VA 2MWPA 1QVPA 4JLGA 3CCQT 2JOYA 1K9MU 1M1FA 1YIJT 4PJOB 3MO8A 2DZ9A 3FLGA 3FRNA 3V8JA 2DTOA 4XTZA 3G71A 3BDUA 2X4YA 4XQ3A 3EFRA 3S3NA 4HT8A 3URGA 3HFOA 5C0MA 2F69A 5FROA 1NZ9A 3O8VA 4A54A 2X35A 1U1TA 4F7UA 3OSVA 1KQSS 5LJ3g 3C95A 4XTUA 3M4GA 1WJRA 3A8MB 5CVIA 4FU6A 1QVFS 4N4IA 2MWOA 4XU3A 2RA2A 4ZTJA 5GAN3 3CCET 4ZGEB 5GAOn 4M77E 2XIDA 3RKYA 4C92B 5GMKj 2BIVA 2DTHA 3FC3A 4QW2A 4CRIA 2PU9B 2ZPIB 3JCMf 1D3BB 4EMKA 2RI3A 4M77A 3G4SA 3X28B 4YTLA 5GAOm 3CXCS 5DLQE 1BI2A 2JZ2A 2GQVA 3CPWS 3CCMT 2XICA 1GXIE 3OYBA 3A8OB 2QQ9A 2JNGA 3NTHA 3G6ET 3J81E 2EYQA 2L3RA 3SDZA 4PNOA 1Y96A 1PSFA 2M1HA 3NTKA 4RMOA 2CZ1B 2E6NA 5FU6B 2FL7A 1ZBXA 3L1AA 1QP3A 3RMSA 2KQWA 3FJPA 2E5QA 1Q7YU 5GAN7 5L8RE 5CKDA 4ZGDB 1JB0E 2LVMA 3VKIA 1VIFA 3INZA 3VV0A 3HPWA 5GAOq 1XQHA 4C92D 3S3OA 5CIUA 2DD5A 3QJYA 2XU8A 1VQ7T 3OY9A 4MDXA 1WQWA 1XNIA 3JB9D 3OYCA 5CR2A 5LJ3j 3LWHA 5LJ5d 2GCXA 2RK2A 2E41A 2IG0A 2GF7A 3OYFA 4OF1A 3NFCA 3OYNA 2L5QA 3QPHA 3ASKA 4C5EA 3F70A 3V7SA 3JCMb 4MZTA 4J8OA 4QVDA 2K3YA 2MF2A 4BE2A 4M7DD 4IUQA 2V8KA 3DB3A 4M7AA 4EMKB 4M77B 4DOWA 4J6XA 2QXFA 2DAQA 3P8HA 5GANg 4FSXA 2DVEA 2A3LA 5GAMh 1VQ9T 2L89A 2XK0A 1QP2A 2NLUA 3QUIA 2JTFA 3CC2A 2VV5A 1Y96B 4B9WA 2EAYA 5FRMA 2ZCFB 3ZEHA 2DIGA 1M1KC 1DJ7B 3M9QA 2FVUA 2LDMA 3J7AF 4KUDK 2EKOA 1VQKT 2ZPEB 4E47A 4UC4A 4FL6A 3EFSA 4BY6C 3CMEA 3CC4T 2RHUA 4OGEA 4M7AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEW A;  2B8A A;  3NTI A;  3L2R A;  1OZ2 A;  2RHX A;  3ME9 A;  4BAC A;  3L2U A;  3SD4 A;  3S6W A;  4II1 A;  2RHI A;  4N4H A;  4QVZ A;  2M16 A;  4E7I A;  3EAE A;  3OYJ A;  4BE0 A;  2X4X A;  2RI5 A;  3OS0 A;  2X4W A;  3P8D A;  5KCH A;  2QQR A;  2XDP A;  3FDR A;  3GOX A;  2PQW A;  3OMG A;  3MP1 A;  4OVA A;  3UT1 A;  3OYI A;  4NS5 A;  3PMT A;  3DLM A;  5KH6 A;  4BDZ A;  3LYI A;  2WAC A;  3KUF A;  2M0O A;  2RJF A;  4IUU A;  3MP6 A;  1WJQ A;  1SSF A;  2RHZ A;  4LD6 A;  2HQX A;  2RHY A;  3BDL A;  3LX7 A;  2R5M A;  3PMI A;  2LTO A;  3QII A;  2CKK A;  3QBY A;  2MWP A;  2YRV A;  1WJS A;  3MO8 A;  4QQD A;  3FLG A;  2X4Y A;  3S3N A;  2RJC A;  2HQE A;  2FHD A;  2BKD N;  1OI1 A;  5C0M A;  3QKJ A;  5FRO A;  3O8V A;  2X35 A;  3MEU A;  3OYA A;  1KHC A;  4A4G A;  1N27 A;  2G3R A;  2RJD A;  3UWN A;  4C5G A;  3OYE A;  1WJR A;  2EQM A;  4A4H A;  4Z02 A;  4FU6 A;  5KCO A;  3OS2 A;  5D6X A;  2EFI A;  4N4I A;  2MWO A;  4ZTJ A;  2BIV A;  2LRQ A;  4QW2 A;  4CRI A;  3FC3 A;  4QQ6 A;  4QQG A;  4N4G A;  2RI3 A;  4IUP A;  2LCC A;  3OYL A;  3OA6 A;  2JZ2 A;  3FEO A;  3OYH A;  3E9G A;  4X34 A;  5M9O A;  3NTH A;  3OYB A;  3LGF A;  2L3R A;  5KE2 A;  1RI0 A;  2QQS A;  2GFA A;  3H6Z A;  2M1H A;  3MET A;  1OYX A;  3NTK A;  2O4X A;  2E6N A;  2R57 A;  3OS1 A;  3LLR A;  2E5Q A;  1MHN A;  2F5K A;  3OQ5 A;  4GY5 A;  3H8Z A;  4E7H A;  2LVM A;  1G5V A;  3OYD A;  2EQK A;  3DB4 A;  3OB9 A;  3S3O A;  5CIU A;  3L42 A;  4E7J A;  3S3M A;  3PFS A;  4E7K A;  3C4S A;  4C5I A;  3OY9 A;  5J39 A;  3OYG A;  2RJE A;  1XNI A;  2R58 A;  4Q5W A;  3OYC A;  5D6Y A;  3L2Q A;  4IUT A;  2RI2 A;  5C6S A;  5IAY A;  4A4F A;  2IG0 A;  4PL6 A;  2D9T A;  3LGL A;  4E7L A;  2GF7 A;  2VYT A;  3MEA A;  3OYF A;  4BE1 A;  3OYN A;  5IN1 A;  3LH0 A;  4IUV A;  3ASK A;  4C5E A;  3L2V A;  3F70 A;  1WGS A;  1H3Z A;  2K3Y A;  4L59 A;  4BE2 A;  4IUQ A;  3PNW C;  2EQJ A;  3DB3 A;  4RG2 A;  3Q1J A;  3OYM A;  2EQU A;  2DAQ A;  3P8H A;  2GFU A;  3OYK A;  4HCZ A;  5D6W A;  4IKF A;  3OMC A;  5FRN A;  4ZTF A;  2L89 A;  2XK0 A;  2NLU A;  2RO0 A;  2JTF A;  3L2W A;  4IUR A;  4B9W A;  5FRM A;  4C5H A;  3ZEH A;  2DIQ A;  4BD3 A;  2DIG A;  4PLI A;  2O4X B;  4BDY A;  3E9F A;  3M9Q A;  2P0K A;  4PLL A;  2LDM A;  3MP8 A;  2EKO A;  3CEY A;  4A4E A;  5J26 A;  5KE3 A;  2L8D A;  2BUD A;  2K3X A;  4FL6 A;  1OZ3 A;  2R5A A;  3QJ6 A;  4UC4 A;  4EDU A;  2RHU A;  4B9X A;  3MEV A; 
#chains in the Genus database with same CATH topology
 4M77 D;  3CCJ T;  3BFM A;  4KT0 E;  4C92 F;  1YJW T;  2VB6 A;  1AWX A;  1OOT A;  3CQT A;  2M0O A;  4IUU A;  1VQ8 T;  2HMA A;  3X26 B;  4RCB A;  2EJ9 A;  4KH1 B;  2ZPF B;  5CK9 A;  4FYW B;  2FHD A;  3IQL A;  4EPC A;  3AHU A;  1OX8 A;  3M55 A;  4OB3 B;  1U1S A;  2EQM A;  1KFZ A;  2QQB A;  4HKE A;  1UG1 A;  2EYZ A;  2LRQ A;  1T0J A;  2CGH A;  1G2B A;  1BI0 A;  4JUV A;  3CCR T;  3C12 A;  1LOJ A;  3OA6 A;  5FU7 B;  4X34 A;  1FWZ A;  3I56 A;  2NUT A;  2K4Y A;  1FMW A;  3G71 Q;  2O4X A;  5GAN 5;  4F17 A;  4ZN3 A;  1Q86 U;  3HFN A;  3RUX A;  4E7J A;  3PFS A;  3VUB A;  2HNI A;  1AT1 B;  1N8R U;  4DBR A;  1PNJ A;  1EIF A;  2FB7 A;  2DXT A;  1MUZ A;  4M77 G;  2GTO A;  1RAE B;  1WGS A;  1BI3 A;  2KBT A;  2DRK A;  4DEY A;  4VUB A;  5IH2 A;  2AK5 A;  2EQU A;  3TRE A;  3OMC A;  2OTL A;  1VYV A;  3CCV A;  4C5H A;  2RD1 A;  4MDW A;  5DM7 R;  5J26 A;  2GGR A;  1FMK A;  1ARK A;  2PUK B;  3E2U A;  4KGX B;  1PKT A;  1WQ7 A;  1BCO A;  2D8H A;  3SHW A;  3U23 A;  1N6A A;  3SWN C;  1WDX A;  3H0F A;  3FDR A;  3TEE A;  2X4J A;  3G4S T;  2ZAE A;  2BZ8 A;  2YUQ A;  1M1K R;  2QAZ A;  1T3S A;  2EYX A;  3HRU A;  1KC8 C;  2RHY A;  4J7F A;  1X75 C;  3CBP A;  1AOJ A;  2CP2 A;  3QII A;  1M3A A;  2J7I A;  1B07 A;  2P0P A;  3A5Z B;  4OMN A;  3CCS A;  1VQ4 A;  2JS2 A;  1N27 A;  4RTV A;  1RAH B;  2GBQ A;  2PVO B;  3UDC A;  4C8Q A;  3UF4 A;  1G3S A;  1RLQ C;  1Y0M A;  2HCK A;  1UTI A;  3PIO A;  1NJI U;  1WPY A;  3RR6 A;  4M75 F;  5I22 A;  3P8B B;  3HSB A;  2C06 A;  1VQL A;  3QG1 A;  2F5K A;  3OQ5 A;  3NMZ C;  2PUO B;  3I9Q A;  4BI3 A;  5FLX E;  3MJX A;  3CC2 T;  4P5N A;  1NEG A;  3V7R A;  4M75 E;  3C4S A;  1X2Q A;  1VQP Q;  3MKD A;  4X9C A;  3CME T;  5FU7 C;  2DD4 A;  4MZP A;  3I56 Q;  1GCP A;  4AMC A;  2O01 E;  4DBF A;  1RUW A;  1ZQ1 A;  3QWX X;  2DTI A;  2DJZ A;  4KUL A;  3JB9 J;  1B7T A;  4ZTF A;  2RO0 A;  2RH2 A;  1FMV A;  3L2Z A;  4C92 C;  2DJQ A;  1WX6 A;  1I07 A;  4BDY A;  3E9F A;  1VQ7 A;  1UFF A;  5CKE A;  1N8R C;  4B6M A;  2QG9 B;  1V1C A;  4J6W A;  2K2V A;  4OP0 A;  1X6G A;  4KGZ B;  1K73 U;  1FXX A;  1MV0 B;  4M75 B;  1Q7Y C;  4XTW A;  3X24 B;  2H3J A;  4ELY C;  4M78 D;  4PKC C;  1M2O A;  4F14 A;  5KCH A;  2OX7 A;  2PQW A;  2M0Y A;  2OTL Q;  1KHI A;  2ATC B;  1JU5 C;  3VS0 A;  3CCV Q;  5KH6 A;  4KGV B;  2YDL A;  2CSI A;  4CI0 C;  2ABL A;  3CMA T;  1VQM T;  3LX7 A;  1MMN A;  2LTO A;  1XJW B;  2QI2 A;  2Y4Y A;  1H8K A;  1QLY A;  1PWT A;  1WHG A;  1Z9Q A;  5KYX B;  4HVV A;  2CH4 A;  3CCJ A;  3C0C A;  1UGR B;  2QAS A;  1XTD A;  1YJW A;  4QQ6 A;  1KC8 R;  1M8V A;  1SSH A;  5GAN 6;  3FEO A;  3NPF A;  5GAN e;  1IRX A;  5GMK l;  1VQ8 A;  3I5S A;  3LH5 A;  1OYX A;  4C8Q F;  3CCS Q;  3JB9 H;  1VQ4 Q;  3OS1 A;  1Y71 A;  4ME7 A;  2LT4 A;  2E6Z A;  2A0F B;  3DB4 A;  1BIA A;  3X20 B;  5A0G A;  4OMQ A;  1SPK A;  2P84 A;  3JV3 A;  1Q82 U;  3MPU B;  2A7Y A;  5HCK A;  2COY A;  4BB7 A;  4C8Q E;  2AHJ B;  4J83 A;  4LXC A;  4HA8 A;  4A53 A;  3D7S B;  4BI8 B;  3L2Q A;  4FT2 A;  1H64 1;  4A4F A;  4PL6 A;  2D9T A;  2QTX A;  3WVD B;  4C0D B;  3JSC A;  4ELZ C;  3CCR A;  5L23 A;  5IN1 A;  3CCQ Q;  3RER A;  1YJN T;  1OX9 A;  2VGM A;  4XTV A;  3HL8 A;  3R6O A;  2EQJ A;  4M78 G;  2V8J A;  5DY9 A;  2CDT A;  4ZN1 A;  2CZ0 B;  5CKB A;  3OYK A;  5D6W A;  3TCJ A;  3V8K A;  1R8O B;  2FG0 A;  2MAM A;  3L2W A;  5GMK e;  4OMO A;  2VKN A;  5IT9 E;  2EIF A;  4BI4 A;  1G83 A;  3EFO A;  2J06 A;  1H3H A;  4FM4 B;  2CS7 A;  4K11 A;  1WZO A;  2ECZ A;  2D0N A;  1D3B A;  2HKN A;  4FSS A;  2YRD A;  4QVZ A;  4AT1 B;  2DO3 A;  2NYS A;  1VQ5 T;  4C8Q B;  1YHQ T;  3MHX A;  2RI5 A;  3EH2 A;  2M9U A;  3G7Z A;  4WTO B;  4BDZ A;  4JS5 A;  5J3B A;  2JW4 A;  3CBO A;  1N8R R;  1VQ7 Q;  1X01 A;  1PHT A;  2EGC A;  1HXD A;  2X3W D;  1K9M U;  1M1F A;  2DZ9 A;  3FLG A;  2FRY A;  3RNJ A;  2RN8 A;  5C0M A;  4A54 A;  1C0M A;  1Q7Y R;  2X35 A;  1KQS S;  3A8M B;  4D8K A;  1JXO A;  2A28 A;  4ZTJ A;  1RAI B;  4ZGE B;  5GAO n;  4M77 E;  3RKY A;  1K0S A;  4CRI A;  2ZPI B;  3JCM f;  3G4S A;  2RI3 A;  3REA B;  3CXC S;  2KRO A;  5DLQ E;  2JZ2 A;  3CCM T;  2XIC A;  1OU8 A;  2L3R A;  1Y96 A;  1EZZ B;  5IHN A;  2MIO A;  4RMO A;  1ZBX A;  1QP3 A;  1TXQ A;  2QTV A;  2BZY A;  2PNI A;  2LVM A;  3VKI A;  3INZ A;  4Z89 A;  3VV0 A;  2KEA A;  2OJ2 A;  3CCJ Q;  3QJY A;  3OY9 A;  1GCQ A;  3EG3 A;  1YJW Q;  1C1A A;  2GCX A;  3M0T A;  2IG0 A;  4X1V A;  1VQ8 Q;  2GF7 A;  2BTT A;  3QPH A;  1KIK A;  4C5E A;  2RF0 A;  4MZT A;  4J8O A;  4QVD A;  2K3Y A;  4M7D D;  2NUP B;  2QGF B;  1HSQ A;  4M77 B;  2QYZ A;  2DBK A;  2L89 A;  2XK0 A;  3CC2 A;  4AG2 C;  2VV5 A;  1PCX A;  1GFC A;  1VQK T;  2KNB B;  2ZPE B;  4E47 A;  3TSZ A;  3CME A;  1X69 A;  3CCR Q;  4E7I A;  1YWP A;  4OGE A;  4M7A C;  2MYS A;  3ZFJ A;  2EJG A;  3S6W A;  2DK3 A;  2YSQ A;  4Z88 A;  2SRC A;  1TOV A;  2VGN A;  1NPR A;  2BE7 D;  4OMM A;  2WSE E;  1LVK A;  3OBY A;  3HRS A;  1CSK A;  3OYI A;  1JEG A;  1SG5 A;  2CUB A;  4PJM A;  1IRE B;  3JB9 F;  2WAC A;  1Q81 U;  3EG2 A;  1I5L A;  3MP6 A;  3LW5 E;  4R55 A;  3BDL A;  2O31 A;  3VYH B;  3QBY A;  3TQ7 P;  4N0A A;  1RAB B;  2KDS A;  4FW1 A;  3JCM V;  1PRM C;  4JJC A;  4C8Q C;  2E1H A;  5GMK m;  2K5L A;  3X25 B;  4NL2 A;  2VAS A;  1AHJ B;  5GAM f;  1TU0 B;  1UGQ B;  4M7A D;  3E9G A;  1VIE A;  3NHN A;  3CMA A;  1VQM A;  3CC7 T;  2JTM A;  3OW2 S;  2GFA A;  8AT1 B;  1K9M C;  1VQL T;  3PT9 A;  4M7D G;  2R57 A;  3RBB B;  5CO7 A;  1UJ0 A;  4ANJ A;  1YWO A;  3QDR B;  2AZS A;  2EQK A;  4L6V 5;  3GF5 A;  2LQW A;  4C5I A;  4QVC A;  3OYG A;  1QMC A;  3G4S Q;  2DM1 A;  1VQ9 Q;  4PFZ A;  1WLP B;  1NG2 A;  2EWN A;  5HKC A;  1S72 T;  4RG8 A;  4FT4 A;  4E7L A;  2E5K A;  1N9R A;  4PJJ A;  4A63 B;  4LDV A;  3HTR A;  1YCY A;  4J5Y A;  3Q1J A;  3KFV A;  4HCZ A;  5FRN A;  1BB9 A;  4J9I A;  4IUR A;  3HHT B;  3GP8 A;  2X51 A;  4MZM A;  2KT1 A;  2CYZ B;  1D1A A;  1J3T A;  4RUG A;  3QJ6 A;  4EDU A;  5IXB A;  2EW3 A;  1ABQ A;  3OBW A;  3A98 A;  1RAC B;  2ZPB B;  3L2U A;  3FJ5 A;  4F16 A;  1W1F A;  3OYY A;  1YJN A;  2DER A;  5A0D A;  4AFQ C;  3UT1 A;  4M7A G;  2K79 A;  1QVF A;  3H0I A;  1BIB A;  3M5A A;  1MNE A;  2MCN A;  1WJQ A;  3I5R A;  3JCM X;  2L0A A;  2P4R A;  3CME Q;  2YRV A;  4E7Z A;  1KG1 A;  1VA7 A;  3VUZ A;  1K8A U;  2YLC A;  2G6F X;  2G3R A;  4A4H A;  2MMP A;  2A08 A;  3VS7 A;  1VQ5 A;  1MND A;  2HKQ B;  1YHQ A;  1QCO A;  4WF2 A;  5EG2 A;  5DLO A;  3EHR A;  4N4G A;  1M90 U;  1Q81 C;  4M78 E;  2ROT A;  2DEQ A;  2DA9 A;  1RAF B;  1NEB A;  2QQS A;  4AFZ C;  1TWB A;  4OMF B;  5GJW B;  4PJO A;  2QDL A;  2KGT A;  2CH4 W;  2XDD A;  4C0G A;  4PJN A;  4NL3 A;  2XHC A;  4JRI A;  2DLP A;  4M75 A;  2KYB A;  1UE9 A;  2OAU A;  5IAY A;  3CMA Q;  2HQH A;  3EG1 A;  3H0H A;  1K9M R;  1E6H A;  3FIF A;  2YUN A;  3MEA A;  2JUF A;  2HAX A;  3CCM A;  3JB9 I;  4IUV A;  1QVG P;  2DXU A;  3DKM A;  1KD1 U;  1WXT A;  2JMC A;  2RQW A;  3A8G B;  2GFU A;  1JJ2 P;  4LUD A;  2EBP A;  1M4Z A;  2H8H A;  4M78 B;  2K7A A;  5KYX A;  4LD9 K;  2K5I A;  1AWW A;  5GAM j;  4MMK A;  2IVW A;  2L8D A;  3O5Z A;  2K3X A;  2RQV A;  2LCL A;  5HK3 A;  4B9X A;  3MEW A;  2RHX A;  1ACM B;  4LDX A;  3CD6 T;  5FU6 C;  2AKL A;  1AZE A;  1O9S A;  2JM8 A;  2P4T A;  1VQ6 T;  2DMO A;  2FYK A;  2ESW A;  2WSC E;  3PMT A;  1D1B A;  2CT3 A;  3LYI A;  4CC7 A;  2J6K A;  3JAM E;  2V8I A;  3A1P A;  4RTW A;  4Y92 A;  2VWF A;  1VQK A;  5A2Q E;  4QQD A;  4AFS C;  3DLL A;  3R6N A;  1HK9 A;  1YJN Q;  1YNZ A;  3J80 E;  2FO0 A;  3QZ5 B;  2AZV A;  3QZ9 B;  1TS9 A;  2XDB A;  2QQA A;  1VUB A;  1KQS P;  2XD0 A;  2IPO B;  4RCC A;  2GQI A;  2KRN A;  5KE2 A;  1RI0 A;  1ZUU A;  2K2M A;  2BE9 B;  2E12 A;  2EPD A;  3M58 A;  2YWW A;  3LLR A;  4J7I A;  1GCQ C;  3GIB A;  1K8A C;  2FEI A;  1M8M A;  3CCL T;  1G5V A;  1BBZ A;  4F04 B;  1MMA A;  1YHQ Q;  1K4U S;  1SHF A;  2WSF E;  3S3M A;  1WHK A;  1QKW A;  4IIM A;  2RJE A;  1VQO T;  4JPB W;  5D6Y A;  4PJO F;  1M90 C;  1LPL A;  2FRW A;  2LMJ A;  2J05 A;  3I55 T;  3CC7 A;  2YT6 A;  4PJO E;  1IO6 A;  3M56 A;  4DQ2 A;  1BI1 A;  2CZ6 B;  4IKF A;  4ESR A;  3ZL7 C;  3JCM h;  3VYG A;  4HCC A;  1IGU A;  4PLI A;  3GNF B;  2HDA A;  5I2M A;  4A4E A;  1WHM A;  2FZC B;  1OZ3 A;  1YN8 A;  4A4K A;  1RI9 A;  3MEV A;  3CCM Q;  3NTI A;  1S72 A;  2DYI A;  3GLX A;  2X9H A;  2FZK B;  4HVW A;  5KYU B;  1YI2 T;  2M16 A;  5GAN 4;  1Q86 C;  1D1C A;  4E6R A;  4JJN K;  4JZ3 A;  2KMT A;  1NPP A;  4TVR A;  1TUC A;  4NS5 A;  1ZUK A;  5GJV B;  2L3P A;  1RAG B;  2DFU A;  4N0A C;  3KUF A;  3JCM P;  4LD6 A;  1QWE A;  2E70 A;  1YCS B;  4O5V A;  4JLG A;  1YIJ T;  4PJO B;  2LJ3 A;  2DTO A;  2V26 A;  4XTZ A;  4HT8 A;  2X4Y A;  1Y57 A;  3URG A;  2JM9 A;  3M4G A;  3AT1 B;  2FPF A;  4JJD A;  2MWO A;  2RA2 A;  4RTT A;  3RDV A;  5GAN 3;  3CCE T;  4FYX B;  2NUP A;  3FC3 A;  4QW2 A;  4M77 A;  3CPW S;  2QQ9 A;  3G6E T;  3SDZ A;  1VQK Q;  4PNO A;  2J6O A;  4J9D A;  3L1A A;  3RMS A;  5GAN 7;  5L8R E;  5CKD A;  1PG5 B;  1JB0 E;  1M30 A;  2KI7 A;  1XQH A;  1Q95 G;  4C92 D;  5CIU A;  2DD5 A;  1R0C B;  2DL4 A;  4MDX A;  1WQW A;  3OYC A;  5CR2 A;  1NM7 A;  1LCK A;  1QVF P;  1U06 A;  2DL8 A;  3OYF A;  3I35 A;  3OYN A;  5FWB A;  2V8K A;  4EMK B;  4KRT A;  2QXF A;  2DVE A;  5GAM h;  3EGX B;  2EVR A;  4D8D A;  3UA7 A;  3ZEH A;  1I5O B;  4PJL A;  2ENM A;  2LP5 A;  3EFS A;  3CC4 T;  4Y28 E;  1RAA B;  3CC7 Q;  1NJI C;  2D6F A;  3JCM d;  1V29 B;  3ER0 A;  3PVQ A;  1VQL Q;  4BE0 A;  2HZY A;  2E3I A;  3M53 A;  3OS0 A;  4OB0 B;  3PGG A;  3GOX A;  3OMG A;  1ABO A;  3H41 A;  3WVE B;  2C0O A;  5I11 A;  4L5G A;  1D0Z A;  4HCK A;  2DIL A;  2M51 A;  2LQK A;  2L3S A;  1Q86 R;  3CD6 A;  4V2S A;  4C92 G;  1ZSZ B;  5GAO l;  1KHC A;  2K3B A;  4A4G A;  2RJD A;  4J9G A;  1P92 A;  1VQ6 A;  4DA4 A;  1OU9 A;  5LJ3 h;  3FB9 A;  2RNA A;  2Y4X A;  3NGP A;  2PZ1 A;  4IUP A;  2LCC A;  1QVG A;  4GLK A;  1W2B S;  4PJO C;  3VS3 A;  1WNL A;  2COZ A;  5GAO r;  4M77 F;  4RTZ A;  1B34 A;  1D0Y A;  3TU4 K;  2ED1 A;  4GY5 A;  1JJ2 A;  2LJ0 A;  2ROL A;  4M75 C;  1K73 C;  2KRS A;  3OB9 A;  3JCM J;  2HD0 A;  1JQQ A;  5CKF A;  2LX7 A;  3A8H B;  4MML A;  2RI2 A;  2JN0 A;  1YJ9 T;  2J6F A;  1SHG A;  1UGV A;  2D0Q B;  1Y07 A;  3L2V A;  4FYV B;  4L59 A;  3UA6 A;  4EMG A;  4JJB A;  4BUG A;  2LCS A;  1VQP T;  3CCL A;  4JZ4 A;  2ED0 A;  3SWN A;  1O75 A;  4XU1 A;  4J9H A;  5KE3 A;  1VQO A;  4JRQ A;  4JRP A;  5GAM d;  1OZ2 A;  2JS0 A;  3ME9 A;  4M75 D;  3I55 A;  2OTJ A;  2V1R A;  2RB6 A;  3EAE A;  2E65 A;  2X4X A;  1M5Q 1;  1RL2 A;  5I2S A;  2CP0 A;  3RKX A;  1KQS A;  1EX4 A;  1Q82 C;  4OVA A;  3DLM A;  3QO3 A;  2ZPG B;  2FPE A;  2QEX A;  1SSF A;  5KYY B;  2B86 A;  2R5M A;  3PMI A;  3EGD B;  4C0D C;  1WJS A;  3CXC A;  1NJI R;  2KK4 A;  2JVV A;  4XU2 A;  1WA7 A;  1YP5 A;  1UEB A;  1BCM A;  2O2O A;  2BKD N;  1OI1 A;  1UHF A;  1TUG B;  1JO8 A;  3BY7 A;  5LJ5 h;  2VXE A;  3OYA A;  3A8L B;  1CKA A;  1YI2 A;  3OS2 A;  1QKX A;  1M1K U;  2DE0 X;  1KSW A;  2JT4 A;  2KY9 A;  5GAN f;  4QQG A;  1AEY A;  2HL3 A;  2DKG A;  3GPL A;  1G8X A;  3OSS C;  4M78 A;  3QHS A;  2QDY B;  1LJO A;  4Z8A A;  2D1X A;  1QCN A;  1YIJ A;  4RTX A;  3M57 A;  1IHV A;  4E7H A;  5EC7 A;  2CSQ A;  3JCM c;  1OPK A;  4OMP A;  1VQ6 Q;  3VRY A;  1U5S A;  1D0X A;  3LWI A;  4E7K A;  1NLP C;  1E6G A;  2NWM A;  3CCE A;  5C6S A;  2GNC A;  3ZBD A;  1MGQ A;  2COW A;  1NBE B;  1M3B A;  2DVJ A;  2VYT A;  1ZHI A;  3G6E A;  2K57 A;  2DZC A;  1D09 B;  1H3Z A;  1OPL A;  3CCU T;  1K73 R;  4RG2 A;  4DOV A;  2CRE A;  1IZ6 A;  2L2P A;  2K6D A;  4QKU A;  1PC0 A;  1U8R A;  3JCM g;  2P0Q A;  4FIB A;  1ZBJ A;  2QGG A;  2VXF A;  4F7U G;  5GMK i;  4LE9 A;  1G3T A;  3G1J A;  1GBR A;  1I8F A;  4C8Q D;  2YXY A;  2XG8 D;  1RLP C;  2VVK A;  1TTH B;  5LJ3 f;  2MPX C;  3M54 A;  1UUE A;  1B34 B;  2MI6 A;  3M0S A;  2KXD A;  1VQN T;  3I55 Q;  3CC4 A;  5HY6 A;  3OW2 A;  2E10 A;  1NLO C;  4EMH A;  3UWN A;  4M77 C;  1GBQ A;  2O88 A;  4Z02 A;  1Q82 R;  5D6X A;  2HBP A;  4OB1 B;  2KT8 A;  3CC2 Q;  2QA4 T;  4KBM B;  4E7S A;  3OS5 A;  3OYH A;  3SFM A;  1X6B A;  4ZGJ B;  2RQT A;  1X6O A;  4XTY A;  1MHN A;  3CPW P;  1LNX A;  3SWN B;  5AYF A;  2GTJ A;  4M78 F;  1AWJ A;  4J9F A;  4X9D A;  1PM3 A;  3HP9 A;  5KYU A;  1KC8 U;  2R58 A;  2KYM A;  2MK5 A;  2HSP A;  1G3Y A;  4IUT A;  3V7C A;  2W0Z A;  2Z0W A;  4C8Q G;  4ATO A;  2KRM A;  2EGA A;  3E19 A;  1YIJ Q;  3QXE B;  3PNW C;  1GL5 A;  1YBY A;  1FYN A;  1M1G A;  5GAM g;  3OYM A;  3EG9 B;  5LL6 S;  1YIT T;  3VRZ A;  1TG0 A;  1PSE A;  3VU3 C;  3CCE Q;  1X27 A;  4PLL A;  5GAN j;  1NE8 A;  1KQ2 A;  3VS5 A;  4C92 E;  3CPF A;  1SEM A;  2DL3 A;  2R5A A;  2V1Q A;  1VQM Q;  3M0Q A;  3G6E Q;  1YJ9 A;  4LN2 A;  1CKB A;  1V76 A;  2C0T A;  4OB2 B;  5LJ5 f;  4CC3 A;  3P8D A;  3WXM B;  1UDL A;  4CC4 B;  2ZZD A;  1HD3 A;  3RMQ A;  1KJW A;  4C0Z A;  3JCM Q;  1WHH A;  3HRT A;  1VQP A;  5GAN 2;  2E4H A;  1Y7X A;  4M7D A;  3M0U A;  1WHL A;  2CKK A;  5KYN A;  2MWP A;  2JOY A;  2HBW A;  3FRN A;  3EFR A;  3S3N A;  2OI3 A;  3HFO A;  2F69 A;  1NZ9 A;  1N5Z A;  3EGU A;  4F7U A;  3OSV A;  1ZSG A;  5LJ3 g;  1BK2 A;  1E7O A;  3C95 A;  4FU6 A;  1HYO A;  4XU3 A;  5KYW A;  2EKH A;  2XID A;  4C92 B;  5GMK j;  2BIV A;  2DTH A;  4EMK A;  1WI7 A;  4YTL A;  2GQV A;  2HEQ A;  3OYB A;  3A8O B;  3NTH A;  3EGX A;  2EYQ A;  1QQJ A;  2M1H A;  3NTK A;  2CZ1 B;  3CC4 Q;  2FL7 A;  2SEM A;  1WXU A;  1VOM A;  2KQW A;  3FJP A;  1Q7Y U;  4LNP A;  2JJ9 A;  1W2B P;  3HPW A;  3S3O A;  2O9S A;  3REB B;  1H92 A;  2DBM A;  2F2X A;  3JB9 D;  1W70 A;  5LJ3 j;  3LWH A;  2RK2 A;  1TSF A;  2M02 A;  4HVU A;  4OF1 A;  3NFC A;  2L5Q A;  3F70 A;  3V7S A;  3JCM b;  4BE2 A;  4OML A;  3CXC P;  3DB3 A;  4M7A A;  3QWY A;  4J6X A;  2CP7 A;  4FSX A;  1VQ5 Q;  1VQ9 T;  1K0X A;  3QUI A;  1QP2 A;  2NLU A;  2JTF A;  4B9W A;  2DRM A;  2EAY A;  5FRM A;  1ZSZ A;  1Q81 R;  4DBQ A;  4KUD K;  4UC4 A;  4FL6 A;  1UJY A;  5GAN 8;  2OTJ T;  2H3E B;  4N4H A;  2RM4 A;  4ZNX A;  3VS1 A;  1WYX A;  3PIP A;  3CCU A;  3UAT A;  3QSU A;  2QEX T;  1IXD A;  2RK1 A;  2VC8 A;  2PVG B;  1GRI A;  1PD0 A;  3M0P A;  3HKS A;  2LT1 A;  1U3O A;  2D8J A;  4JS4 A;  1NYG A;  4D6W A;  2BZX A;  1YJ9 Q;  3CCQ A;  4C0F A;  2W10 A;  5LJ5 g;  2HQE A;  4XTX A;  4M7D F;  3MEU A;  1VYU A;  4WCI A;  1KD1 C;  5KCO A;  2I2L A;  3QYG B;  4GBQ A;  3JB9 G;  4M78 C;  1TUD A;  3PE0 A;  4M7D E;  5FW9 A;  4F7U F;  2AKK A;  4XU0 A;  3TVT A;  3OYL A;  2PVD B;  3JCM e;  3LGF A;  2XMF A;  2DF6 A;  1UHC A;  4F7U E;  1VQN A;  2EYY A;  1KQ1 A;  1B3Q A;  4RKU E;  3OYD A;  2F2W A;  4ORZ A;  2DL5 A;  3L42 A;  5LJ5 j;  1JXM A;  2NUZ A;  1G3W A;  1M2V A;  1EFN A;  5CCA A;  4Q5W A;  4J9C A;  4XAX B;  1PRL C;  2QA4 A;  2Y90 A;  1UGS B;  2LNV A;  4AFU C;  5CQY A;  3LH0 A;  1QW1 A;  5KYY A;  1FX7 A;  2DXC A;  4CC2 A;  1WIE A;  3EGD A;  1W6X A;  3KXT A;  1F1B B;  5CAI A;  2KXC A;  3OW2 P;  3RES A;  4M7D B;  1M9S A;  1M3C A;  3GBQ A;  1IB8 A;  2NUT B;  5GAN h;  1MMG A;  1UEC A;  2E3H A;  1JRI A;  4BD3 A;  1N9S A;  1RAD B;  2O4X B;  4M7A F;  1ZLM A;  3N5B B;  2DL7 A;  1SRL A;  3G71 T;  4KUI A;  4F7U B;  2B8A A;  2HSE B;  4M4Z A;  1XOV A;  4BAC A;  1UGP B;  5KYW B;  4M7A E;  2DX1 A;  3E1S A;  1K9A A;  3MCA B;  1K8A R;  2CP6 A;  2C0I A;  2VUB A;  1C6V X;  2YRC A;  3VS6 A;  3VJP A;  1IHW A;  2DXB A;  2X4W A;  2DNU A;  2XKO C;  2KVQ G;  3JCM W;  2JMA A;  1YIT A;  3T9N A;  2LQN A;  1M90 R;  2EJF A;  1GFD A;  1HJD A;  3CPW A;  3M4Y A;  4LDU A;  2RJC A;  2RPN A;  3M59 A;  3UPU A;  3CCU Q;  5GMK h;  1X2K A;  2JXB A;  1W4S A;  2RQR A;  3PTA A;  1KK7 A;  1QVG S;  1YFN A;  2LJ1 A;  2EQI A;  4J6Y A;  2FZG B;  5GAM e;  1VYT A;  4M7A B;  1JJ2 S;  3H6Z A;  1S72 Q;  2KSS A;  2I0N A;  1ZA1 B;  4O6J A;  3QDF A;  1X43 A;  1KD1 R;  3EH1 A;  1IGQ A;  2AT1 B;  1BKB A;  2CT4 A;  2E64 A;  3JRZ A;  4HCB A;  1QCF A;  5J39 A;  1A0N B;  1SKU B;  3EHQ A;  3RKW A;  4RTY A;  2YLB A;  3LGL A;  1T3L A;  3VS2 A;  5IHI A;  1K1Z A;  4BE1 A;  2DPP B;  1R0B G;  1K76 A;  5CKH A;  1MMD A;  1ZX6 A;  1Z9Z A;  2DET A;  1VQN Q;  3THK A;  3H9N A;  1WXB A;  1OEB A;  3TSW A;  5IXF A;  4KH0 B;  2OAW A;  4JRK A;  2P0K A;  3GNG A;  5I21 A;  5LJ3 e;  3CBM A;  4LDW A;  2QA4 Q;  3BW1 A;  4FYY B;  4XK8 E;  2LX9 A;  5GAN d;  3SD4 A;  4II1 A;  2RHI A;  3V8L A;  5ECA A;  4M7D C;  4RTU A;  4LDY A;  2AIR B;  3MP1 A;  3SB2 A;  1VQ9 A;  7AT1 B;  4J9B A;  2RHZ A;  3I56 T;  2EGE A;  2EYW A;  2HQX A;  4PJO D;  1I4K 1;  5GAO p;  3ULR B;  1S1N A;  1W2B A;  2ZPH B;  2K9G A;  1PKS A;  3QKJ A;  5HK0 A;  1AD5 A;  1M2V B;  3C94 A;  4AG1 C;  4R56 A;  4EMK C;  2L3Q A;  2YUO A;  4C5G A;  2FPD A;  3OYE A;  2YUP A;  1SF9 A;  2EFI A;  1OUL A;  1BYM A;  1T0H A;  1YIT Q;  3EG9 A;  5M9O A;  4PFO A;  5AT1 B;  3MET A;  4FW2 A;  4Y91 A;  6AT1 B;  2YHT A;  1AZG B;  3KBG A;  2CP5 A;  3H8Z A;  2MOX A;  1NYF A;  2OTL T;  2F5T X;  4JLI A;  1JBM A;  3CCV T;  1UB4 A;  5A0L A;  2XI9 A;  4GLM A;  1QWF A;  2JTE A;  2RQU A;  1MV3 A;  3RIR A;  4LUE A;  2QK0 A;  4BY6 B;  4NOY A;  3EG0 A;  5LJ3 d;  4FCY A;  4PFP A;  2PTK A;  3CD6 Q;  1I81 A;  1ZSZ C;  2F2V A;  2DEU A;  2LC4 A;  5LJ5 e;  2LQ8 A;  2ZGW A;  4PJO G;  2DIQ A;  1TH7 A;  1BU1 A;  3MP8 A;  4IIO A;  9ATC B;  3CEY A;  1R77 A;  2BUD A;  8ATC B;  3CCS T;  2K5F A;  1VQ4 T;  4M75 G;  4JDS A;  4C92 A;  3L2R A;  3QYH B;  4HT9 A;  1OQK A;  3OYJ A;  5IHK A;  2QQR A;  2XDP A;  1I1J A;  4DBH A;  2KAF A;  2KR3 A;  4QT7 A;  3VS4 A;  2RJF A;  5CQX A;  2LNH B;  1AVZ C;  4OGC A;  2CZ7 B;  1WFW A;  4PK4 A;  1QVP A;  3CCQ T;  1AWO A;  3MO8 A;  3V8J A;  3G71 A;  3BDU A;  4XQ3 A;  5FRO A;  3O8V A;  1U1T A;  1SRM A;  4XTU A;  1WJR A;  5CVI A;  1QVF S;  4N4I A;  5FWC A;  3CCL Q;  3EFO B;  1PD1 A;  3SEM A;  3PVL A;  4HXJ A;  2PU9 B;  1OV3 A;  1D3B B;  2O9V A;  3X28 B;  5GAO m;  1BI2 A;  1GXI E;  2A37 A;  2JNG A;  3M0R A;  1VQO Q;  3J81 E;  1WHJ A;  1PSF A;  2E6N A;  5FU6 B;  2E5Q A;  2OTJ Q;  4ZGD B;  1M27 C;  1VIF A;  5GAO q;  4R0K A;  2LZ6 B;  2XU8 A;  2IIM A;  1VQ7 T;  1XNI A;  2DYB A;  2CUD A;  2QEX Q;  1ZA2 B;  5LJ5 d;  2E41 A;  5D7U A;  2A36 A;  4DEX A;  2RMO A;  2CP3 A;  3ASK A;  2MF2 A;  4IUQ A;  2F1L A;  4DOW A;  2HL5 C;  2DAQ A;  2KE9 A;  3P8H A;  5GAN g;  1YI2 Q;  2A3L A;  3BE3 A;  4J9E A;  1Y96 B;  2ZCF B;  2DIG A;  1M1K C;  1DJ7 B;  3M9Q A;  2FVU A;  2LDM A;  3J7A F;  2EKO A;  1I0C A;  4E2F B;  4BY6 C;  1ZUY A;  2RHU A;  4EIK A;  2X3X D; 
#chains in the Genus database with same CATH homology
 5GAN 8;  3ZFJ A;  1NJI C;  2D6F A;  2EJG A;  2OTJ T;  3JCM d;  1V29 B;  3ER0 A;  3S6W A;  4M77 D;  4N4H A;  2DK3 A;  2RM4 A;  3CCJ T;  3BFM A;  4E7I A;  4KT0 E;  4BE0 A;  3PIP A;  3CCU A;  2VGN A;  4C92 F;  1NPR A;  3OS0 A;  3M53 A;  1QVG A;  4OB0 B;  2WSE E;  3OBY A;  3PGG A;  3GOX A;  3HRS A;  3OMG A;  1YJW T;  3QSU A;  3OYI A;  2QEX T;  1IRE B;  2RK1 A;  2VC8 A;  3JB9 F;  2WAC A;  1Q81 U;  1I5L A;  2PVG B;  2M0O A;  4IUU A;  3MP6 A;  1VQ8 T;  3LW5 E;  4R55 A;  3BDL A;  3VYH B;  3WVE B;  3HKS A;  3QBY A;  3X26 B;  2LT1 A;  4L5G A;  4JS4 A;  4N0A A;  4RCB A;  2EJ9 A;  4D6W A;  2ZPF B;  2KDS A;  5CK9 A;  3CCQ A;  4C0F A;  5LJ5 g;  2HQE A;  4XTX A;  2FHD A;  3JCM V;  4M7D F;  2LQK A;  4EPC A;  3AHU A;  3CD6 A;  4V2S A;  3MEU A;  4C92 G;  4C8Q C;  5GAO l;  1KHC A;  4A4G A;  2E1H A;  2RJD A;  3M55 A;  4OB3 B;  5GMK m;  1U1S A;  2EQM A;  1KD1 C;  1P92 A;  2K5L A;  2I2L A;  2QQB A;  5KCO A;  4DA4 A;  1VQ6 A;  5LJ3 h;  4NL2 A;  3X25 B;  3QYG B;  3JB9 G;  3FB9 A;  1AHJ B;  5GAM f;  4HKE A;  4M78 C;  2LRQ A;  2Y4X A;  4M7D E;  2CGH A;  1UGQ B;  4F7U F;  1BI0 A;  4JUV A;  4M7A D;  3CCR T;  3C12 A;  4IUP A;  2LCC A;  4XU0 A;  3OYL A;  1LOJ A;  2PVD B;  3OA6 A;  5FU7 B;  3E9G A;  1VIE A;  4X34 A;  3JCM e;  1FWZ A;  4GLK A;  3CMA A;  3LGF A;  3I56 A;  1VQM A;  1W2B S;  3CC7 T;  2JTM A;  3OW2 S;  4PJO C;  2GFA A;  1K9M C;  2K4Y A;  1VQL T;  3PT9 A;  4M7D G;  2O4X A;  5GAN 5;  2R57 A;  1WNL A;  5GAO r;  4M77 F;  5CO7 A;  1B34 A;  3QDR B;  3TU4 K;  4F7U E;  1VQN A;  1KQ1 A;  4GY5 A;  4ZN3 A;  1Q86 U;  1JJ2 A;  1K73 C;  4M75 C;  3HFN A;  4RKU E;  2EQK A;  3OYD A;  4L6V 5;  3OB9 A;  3RUX A;  3GF5 A;  3L42 A;  5LJ5 j;  4E7J A;  3PFS A;  3VUB A;  4C5I A;  4QVC A;  2HD0 A;  3OYG A;  3JCM J;  1G3W A;  2HNI A;  5CKF A;  5CCA A;  4Q5W A;  1N8R U;  4XAX B;  3A8H B;  4MML A;  2RI2 A;  2EWN A;  2QA4 A;  5HKC A;  1S72 T;  4RG8 A;  2JN0 A;  1EIF A;  2Y90 A;  4FT4 A;  1UGS B;  2FB7 A;  2LNV A;  4E7L A;  1YJ9 T;  2DXT A;  5CQY A;  1N9R A;  2D0Q B;  4M77 G;  3LH0 A;  1Y07 A;  4LDV A;  3L2V A;  1WGS A;  1QW1 A;  1FX7 A;  2DXC A;  4L59 A;  1BI3 A;  1YCY A;  4EMG A;  4J5Y A;  3Q1J A;  4VUB A;  3KXT A;  5CAI A;  2EQU A;  3TRE A;  3RES A;  4BUG A;  1VQP T;  4M7D B;  1M9S A;  4HCZ A;  3CCL A;  5FRN A;  3OMC A;  2OTL A;  4IUR A;  5GAN h;  3CCV A;  3SWN A;  3HHT B;  1JRI A;  4C5H A;  4BD3 A;  3GP8 A;  2RD1 A;  1N9S A;  2O4X B;  4M7A F;  4MZM A;  4MDW A;  1O75 A;  4XU1 A;  3N5B B;  2CYZ B;  5J26 A;  5DM7 R;  5KE3 A;  1VQO A;  3QJ6 A;  4EDU A;  3G71 T;  4JRQ A;  4JRP A;  2PUK B;  4KUI A;  4F7U B;  5GAM d;  2B8A A;  3OBW A;  1OZ2 A;  3ME9 A;  4M75 D;  1WQ7 A;  1XOV A;  2ZPB B;  3I55 A;  1UGP B;  3L2U A;  4BAC A;  2OTJ A;  4M7A E;  3E1S A;  2RB6 A;  3MCA B;  1N6A A;  3EAE A;  3SWN C;  2E65 A;  2X4X A;  3OYY A;  1YJN A;  1M5Q 1;  1RL2 A;  2VUB A;  5A0D A;  3VJP A;  2DXB A;  2X4W A;  5I2S A;  3FDR A;  3RKX A;  3TEE A;  1KQS A;  3UT1 A;  2X4J A;  2XKO C;  2KVQ G;  4OVA A;  3G4S T;  3JCM W;  1Q82 C;  3DLM A;  4M7A G;  1QVF A;  3QO3 A;  1YIT A;  1BIB A;  2ZPG B;  3T9N A;  3M5A A;  2QEX A;  1WJQ A;  1SSF A;  3HRU A;  1KC8 C;  3JCM X;  2RHY A;  4J7F A;  1X75 C;  2R5M A;  3CBP A;  3PMI A;  3QII A;  4C0D C;  2YRV A;  2EJF A;  1WJS A;  3CXC A;  2P0P A;  3A5Z B;  2KK4 A;  3CPW A;  2JVV A;  3M4Y A;  4LDU A;  1KG1 A;  4XU2 A;  3CCS A;  1UEB A;  2RJC A;  1VQ4 A;  2BKD N;  1OI1 A;  3VUZ A;  1K8A U;  2YLC A;  3M59 A;  3BY7 A;  5LJ5 h;  2VXE A;  3OYA A;  3UPU A;  3A8L B;  1N27 A;  2G3R A;  4A4H A;  5GMK h;  2MMP A;  1YI2 A;  3OS2 A;  1VQ5 A;  1W4S A;  1YHQ A;  4WF2 A;  2PVO B;  5EG2 A;  3PTA A;  5DLO A;  1M1K U;  3UDC A;  2KY9 A;  4C8Q A;  5GAN f;  4QQG A;  1QVG S;  1G3S A;  4N4G A;  1M90 U;  4J6Y A;  1Q81 C;  5GAM e;  2DKG A;  3GPL A;  4M78 E;  2DEQ A;  3PIO A;  3OSS C;  1NJI U;  4M7A B;  4M78 A;  1WPY A;  3QHS A;  2QQS A;  1JJ2 S;  3H6Z A;  2QDY B;  4M75 F;  1LJO A;  3P8B B;  3HSB A;  2KSS A;  4OMF B;  2C06 A;  1YIJ A;  1VQL A;  3QG1 A;  2F5K A;  3OQ5 A;  4O6J A;  3M57 A;  2PUO B;  4E7H A;  4BI3 A;  3JCM c;  4PJO A;  5FLX E;  3CC2 T;  2XDD A;  1BKB A;  4P5N A;  4C0G A;  4NL3 A;  2E64 A;  3JRZ A;  4M75 E;  3V7R A;  3LWI A;  4HCB A;  4E7K A;  2XHC A;  3C4S A;  4JRI A;  5J39 A;  4M75 A;  3CCE A;  2OAU A;  4X9C A;  3CME T;  3RKW A;  2YLB A;  5C6S A;  5FU7 C;  5IAY A;  2DD4 A;  4MZP A;  1MGQ A;  3LGL A;  3ZBD A;  4Y28 E;  2VYT A;  3FIF A;  2O01 E;  3MEA A;  4BE1 A;  2JUF A;  2DPP B;  2HAX A;  1ZHI A;  3CCM A;  3JB9 I;  4IUV A;  3G6E A;  2K57 A;  5CKH A;  2DZC A;  1ZQ1 A;  2DXU A;  1H3Z A;  2DTI A;  2DJZ A;  3CCU T;  4KUL A;  3DKM A;  4RG2 A;  4DOV A;  1IZ6 A;  3JB9 J;  1KD1 U;  1U8R A;  3A8G B;  2GFU A;  3JCM g;  4ZTF A;  1M4Z A;  2RO0 A;  2P0Q A;  2RH2 A;  4M78 B;  4FIB A;  4JRK A;  4LD9 K;  2K5I A;  2VXF A;  3L2Z A;  4C92 C;  4F7U G;  5GMK i;  4BDY A;  5GAM j;  3E9F A;  2P0K A;  3GNG A;  5I21 A;  5LJ3 e;  5CKE A;  3CBM A;  1VQ7 A;  4LDW A;  1G3T A;  4MMK A;  1N8R C;  3BW1 A;  2IVW A;  2L8D A;  4XK8 E;  2K3X A;  2LCL A;  2LX9 A;  5HK3 A;  4B9X A;  1I8F A;  3MEW A;  4J6W A;  5GAN d;  2RHX A;  4LDX A;  2K2V A;  4OP0 A;  4C8Q D;  3CD6 T;  5FU6 C;  3SD4 A;  4II1 A;  2RHI A;  1FXX A;  2XG8 D;  1K73 U;  1O9S A;  2P4T A;  4M75 B;  3V8L A;  1VQ6 T;  1Q7Y C;  4XTW A;  2FYK A;  3X24 B;  2H3J A;  4ELY C;  4M7D C;  4M78 D;  4PKC C;  5KCH A;  2WSC E;  4LDY A;  2PQW A;  3MP1 A;  1KHI A;  3PMT A;  5KH6 A;  3SB2 A;  3LYI A;  5LJ3 f;  3M54 A;  4CI0 C;  1VQ9 A;  3CMA T;  1VQM T;  2RHZ A;  3JAM E;  3I56 T;  4PJO D;  2HQX A;  2V8I A;  3LX7 A;  1B34 B;  2MI6 A;  2LTO A;  1I4K 1;  5GAO p;  1VQK A;  5A2Q E;  2QI2 A;  4QQD A;  1VQN T;  3DLL A;  2Y4Y A;  3CC4 A;  1W2B A;  5HY6 A;  3OW2 A;  1HK9 A;  2ZPH B;  2E10 A;  3QKJ A;  5HK0 A;  3C94 A;  4EMH A;  3UWN A;  4R56 A;  4EMK C;  4C5G A;  4M77 C;  3OYE A;  3J80 E;  4Z02 A;  3CCJ A;  5D6X A;  2HBP A;  2EFI A;  3QZ5 B;  3QZ9 B;  2XDB A;  4OB1 B;  1BYM A;  1UGR B;  2QQA A;  1VUB A;  1XTD A;  2QA4 T;  1YJW A;  4QQ6 A;  1M8V A;  2XD0 A;  5GAN 6;  4RCC A;  4KBM B;  3OS5 A;  3FEO A;  5GAN e;  3OYH A;  5M9O A;  5GMK l;  1VQ8 A;  5KE2 A;  1RI0 A;  3SFM A;  3MET A;  1OYX A;  4C8Q F;  4ZGJ B;  3JB9 H;  4Y91 A;  2E12 A;  3M58 A;  2YHT A;  1X6O A;  3OS1 A;  3LLR A;  4XTY A;  1MHN A;  4J7I A;  3KBG A;  1Y71 A;  3GIB A;  1LNX A;  3H8Z A;  3SWN B;  1K8A C;  5AYF A;  4ME7 A;  2LT4 A;  2E6Z A;  3CCL T;  1G5V A;  3DB4 A;  4M78 F;  1BIA A;  2F5T X;  3X20 B;  5A0G A;  1Q82 U;  4JLI A;  1JBM A;  3CCV T;  2OTL T;  2A7Y A;  1UB4 A;  4X9D A;  3S3M A;  2WSF E;  5A0L A;  4BB7 A;  2XI9 A;  4C8Q E;  2RJE A;  3HP9 A;  1KC8 U;  2AHJ B;  2R58 A;  4J83 A;  1VQO T;  4HA8 A;  5D6Y A;  4PJO F;  4A53 A;  4BI8 B;  1G3Y A;  4IUT A;  3L2Q A;  4FT2 A;  3V7C A;  1M90 C;  1H64 1;  4A4F A;  4PL6 A;  2D9T A;  2QTX A;  3RIR A;  3WVD B;  3JSC A;  4C0D B;  4ELZ C;  3I55 T;  4BY6 B;  3CCR A;  4C8Q G;  4ATO A;  4NOY A;  5LJ3 d;  5IN1 A;  3CC7 A;  3RER A;  3E19 A;  1YJN T;  2VGM A;  3QXE B;  4XTV A;  3HL8 A;  3R6O A;  3PNW C;  2EQJ A;  4PJO E;  4M78 G;  2V8J A;  3M56 A;  5DY9 A;  1YBY A;  4DQ2 A;  4ZN1 A;  1BI1 A;  1I81 A;  1M1G A;  2CZ0 B;  5GAM g;  3OYM A;  2CZ6 B;  5CKB A;  5LL6 S;  3OYK A;  1YIT T;  2LC4 A;  5D6W A;  3TCJ A;  5LJ5 e;  4IKF A;  3V8K A;  2LQ8 A;  1R8O B;  3L2W A;  2MAM A;  1PSE A;  2ZGW A;  3JCM h;  3VYG A;  4HCC A;  4PJO G;  3VU3 C;  2DIQ A;  5GMK e;  4PLI A;  1TH7 A;  3GNF B;  4PLL A;  5IT9 E;  5I2M A;  3MP8 A;  5GAN j;  1NE8 A;  2EIF A;  3CEY A;  4A4E A;  4BI4 A;  4C92 E;  1KQ2 A;  3CPF A;  2BUD A;  1OZ3 A;  2R5A A;  4A4K A;  3CCS T;  2K5F A;  1VQ4 T;  4JDS A;  4M75 G;  3MEV A;  4FM4 B;  2CS7 A;  3NTI A;  4C92 A;  3L2R A;  1S72 A;  3GLX A;  1YJ9 A;  1D3B A;  3QYH B;  4QVZ A;  1YI2 T;  4HT9 A;  2DO3 A;  2M16 A;  5GAN 4;  3OYJ A;  1VQ5 T;  4C8Q B;  1YHQ T;  1Q86 C;  4OB2 B;  5LJ5 f;  3MHX A;  2RI5 A;  4JJN K;  3P8D A;  3WXM B;  2QQR A;  2M9U A;  2XDP A;  3G7Z A;  3JCM Q;  2KMT A;  2ZZD A;  3RMQ A;  1NPP A;  4TVR A;  4C0Z A;  3HRT A;  4NS5 A;  2KAF A;  5GAN 2;  4BDZ A;  1VQP A;  4JS5 A;  5J3B A;  4N0A C;  1Y7X A;  3KUF A;  3CBO A;  2RJF A;  3JCM P;  4LD6 A;  5CQX A;  1X01 A;  4M7D A;  4OGC A;  2CZ7 B;  2E70 A;  1HXD A;  2CKK A;  4O5V A;  2MWP A;  1QVP A;  4JLG A;  3CCQ T;  2JOY A;  1K9M U;  1M1F A;  1YIJ T;  4PJO B;  3MO8 A;  2DZ9 A;  3FLG A;  3FRN A;  3V8J A;  2DTO A;  4XTZ A;  3G71 A;  3BDU A;  2X4Y A;  4XQ3 A;  3EFR A;  3S3N A;  4HT8 A;  3URG A;  3HFO A;  5C0M A;  2F69 A;  5FRO A;  1NZ9 A;  3O8V A;  4A54 A;  2X35 A;  1U1T A;  4F7U A;  3OSV A;  1KQS S;  5LJ3 g;  3C95 A;  4XTU A;  3M4G A;  1WJR A;  3A8M B;  5CVI A;  4FU6 A;  1QVF S;  4N4I A;  2MWO A;  4XU3 A;  2RA2 A;  4ZTJ A;  5GAN 3;  3CCE T;  4ZGE B;  5GAO n;  4M77 E;  2XID A;  3RKY A;  4C92 B;  5GMK j;  2BIV A;  2DTH A;  3FC3 A;  4QW2 A;  4CRI A;  2PU9 B;  2ZPI B;  3JCM f;  1D3B B;  4EMK A;  2RI3 A;  4M77 A;  3G4S A;  3X28 B;  4YTL A;  5GAO m;  3CXC S;  5DLQ E;  1BI2 A;  2JZ2 A;  2GQV A;  3CPW S;  3CCM T;  2XIC A;  1GXI E;  3OYB A;  3A8O B;  2QQ9 A;  2JNG A;  3NTH A;  3G6E T;  3J81 E;  2EYQ A;  2L3R A;  3SDZ A;  4PNO A;  1Y96 A;  1PSF A;  2M1H A;  3NTK A;  4RMO A;  2CZ1 B;  2E6N A;  5FU6 B;  2FL7 A;  1ZBX A;  3L1A A;  1QP3 A;  3RMS A;  2KQW A;  3FJP A;  2E5Q A;  1Q7Y U;  5GAN 7;  5L8R E;  5CKD A;  4ZGD B;  1JB0 E;  2LVM A;  3VKI A;  1VIF A;  3INZ A;  3VV0 A;  3HPW A;  5GAO q;  1XQH A;  4C92 D;  3S3O A;  5CIU A;  2DD5 A;  3QJY A;  2XU8 A;  1VQ7 T;  3OY9 A;  4MDX A;  1WQW A;  1XNI A;  3JB9 D;  3OYC A;  5CR2 A;  5LJ3 j;  3LWH A;  5LJ5 d;  2GCX A;  2RK2 A;  2E41 A;  2IG0 A;  2GF7 A;  3OYF A;  4OF1 A;  3NFC A;  3OYN A;  2L5Q A;  3QPH A;  3ASK A;  4C5E A;  3F70 A;  3V7S A;  3JCM b;  4MZT A;  4J8O A;  4QVD A;  2K3Y A;  2MF2 A;  4BE2 A;  4M7D D;  4IUQ A;  2V8K A;  3DB3 A;  4M7A A;  4EMK B;  4M77 B;  4DOW A;  4J6X A;  2QXF A;  2DAQ A;  3P8H A;  5GAN g;  4FSX A;  2DVE A;  2A3L A;  5GAM h;  1VQ9 T;  2L89 A;  2XK0 A;  1QP2 A;  2NLU A;  3QUI A;  2JTF A;  3CC2 A;  2VV5 A;  1Y96 B;  4B9W A;  2EAY A;  5FRM A;  2ZCF B;  3ZEH A;  2DIG A;  1M1K C;  1DJ7 B;  3M9Q A;  2FVU A;  2LDM A;  3J7A F;  4KUD K;  2EKO A;  1VQK T;  2ZPE B;  4E47 A;  4UC4 A;  4FL6 A;  3EFS A;  4BY6 C;  3CME A;  3CC4 T;  2RHU A;  4OGE A;  4M7A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...