1RI9A

Structure of a helically extended sh3 domain of the t cell adapter protein adap
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
b'EKEEKDFRKKFKYDGEIRVLYSTKVTTSITSKKWGTRDLQVKPGESLEVIQTTDDTKVLCRNEEGKYGYVLRSYLAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FYN-binding protein
publication title Structure of a Helically Extended SH3 Domain of the T Cell Adapter Protein ADAP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 8
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2003-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ri9A00
4HVUA 1OV3A 5FWCA 3A98A 1WXUA 2C0OA 1X2QA 2DRMA 2YUNA 1CSKA 3H0HA 1UECA 1QWEA 2CT3A 1B3QA 1M3CA 1YWPA 1X69A 4RTVA 2G6FX 2HDAA 1WYXA 3EHQA 2CH4W 3M0QA 2LJ0A 3EG2A 1ZBJA 1NYFA 2IIMA 1SPKA 2ED1A 2RQWA 2KXDA 1WIEA 1WI7A 2DVJA 4RTXA 1PRMC 2K2MA 1J3TA 4RTUA 1UTIA 1TUCA 3SHWA 4HVVA 2KEAA 2RF0A 3THKA 2B86A 2FO0A 2RQTA 2FRYA 1S1NA 2FRWA 2KE9A 4FSSA 2HCKA 2M0YA 3REAB 5L23A 2ROTA 2A08A 3VRZA 1NYGA 2NWMA 2O2OA 2X3WD 3H0FA 2KXCA 4DEYA 2DLPA 2ECZA 2GNCA 2K7AA 2K6DA 2KRSA 2ROLA 4J9CA 2LCSA 2RNAA 1PHTA 2HSPA 3I35A 4LN2A 1PWTA 3I9QA 2SEMA 2EW3A 2AKLA 2JW4A 1ABOA 1ZX6A 2QDLA 1E6HA 4R0KA 1UE9A 4J9DA 4AFUC 3CQTA 5IXBA 3M0SA 4RUGA 3VS2A 2VWFA 2D8JA 2EBPA 1AZGB 4J9HA 1VYTA 2BZXA 1QCFA 2I0NA 2KROA 3SEMA 3PE0A 1FMKA 5FW9A 2KRMA 3PVLA 2PZ1A 1GCQA 2LMJA 2O9VA 1JQQA 2AKKA 2LX7A 1UUEA 2CH4A 1UHFA 3VRYA 1KFZA 1RLPC 2JTEA 2FPDA 4AFQC 5EC7A 1QWFA 3H41A 1RI9A 3NMZC 2OI3A 2CUDA 2F2WA 1WA7A 5I22A 2KBTA 1K0SA 2YSQA 2YT6A 5IHKA 1UFFA 2OAWA 1ARKA 1AOJA 4AFSC 2DRKA 2X3XD 2H8HA 1WLPB 1GFDA 2EPDA 1QKXA 1BB9A 2E5KA 1EFNA 2YUQA 1WXBA 4AG2C 1KIKA 2FEIA 2L2PA 1E6GA 5IHNA 1UHCA 2C0TA 2D0NA 4K11A 2LJ3A 3M0TA 4WCIA 3EG0A 2JMCA 1WX6A 2KT8A 2BZ8A 2EYYA 2W10A 3ZL7C 2KGTA 2J6KA 1AEYA 1QLYA 1JO8A 4HXJA 2A37A 4RTTA 2BTTA 1BBZA 1M8MA 5IXFA 2A36A 3NGPA 2JM9A 2O31A 4JPBW 2DMOA 1SRLA 3M0RA 2DL3A 4F17A 5ECAA 4OMLA 2KYBA 1AVZC 4JZ3A 1G2BA 1WDXA 3VS7A 1K0XA 2KR3A 3U23A 3FJ5A 1X6GA 3QWXX 2LNHB 3KFVA 2DX1A 3RBBB 1WXTA 2JS0A 1T3SA 3EG1A 4LUEA 4OMOA 1NG2A 2KYMA 1E7OA 2RQVA 1Y57A 4EIKA 2KNBB 4JJBA 2EYZA 3ULRB 2LP5A 2GTOA 5GJWB 4AG1C 1IO6A 1NM7A 1M3AA 1NEBA 1AWXA 1W6XA 5IH2A 1ZUKA 2SRCA 1GCPA 3UATA 1CKAA 2EGCA 4F14A 1TUDA 1SSHA 1T0JA 1B07A 2HEQA 3VS1A 4M4ZA 1MV0B 2NUZA 5I11A 1UG1A 4Z8AA 5FWBA 4Z88A 1OPLA 2YDLA 1OEBA 1JU5C 2PNIA 1GBRA 1SRMA 1ZLMA 4GLMA 4ORZA 1AWJA 2V1QA 1NLOC 1ABQA 1ZSGA 1VYVA 4RTWA 1VYUA 2RMOA 4ZNXA 4DEXA 4D8DA 1RLQC 3LH5A 3M0PA 1YCSB 1UDLA 2DA9A 2FG0A 4F16A 2V1RA 4CC7A 1K9AA 2XMFA 1AWWA 5IHIA 1YWOA 1K1ZA 1UGVA 3H0IA 2DE0X 1K4US 2L3QA 2L3PA 1MV3A 2F2XA 1SHGA 4ESRA 1M3BA 4AFZC 2FPFA 2MOXA 3TSWA 2W0ZA 1H8KA 1PNJA 1FYNA 2AZSA 2RQRA 4CC2A 2A28A 1NEGA 2PTKA 1QKWA 2K79A 2MIOA 1LCKA 1ZUYA 1JXMA 2KRNA 4A63B 1HSQA 2JS2A 4J9BA 1YN8A 4J9FA 2L0AA 3UF4A 1X2KA 1HD3A 2O9SA 2D1XA 5GJVB 3VS3A 1X43A 2CT4A 4OMNA 3EG3A 3EGUA 2DM1A 1H92A 1OOTA 1A0NB 1SHFA 2VVKA 1MUZA 2LJ1A 4IIMA 1W1FA 4LUDA 2F2VA 4GBQA 3VS4A 2ESWA 1OPKA 4RTZA 4LE9A 1UJYA 1U5SA 1NLPC 2EGAA 3I5SA 1AWOA 2KT1A 2DNUA 4IIOA 2AZVA 2DL5A 4JJDA 3UA6A 1GFCA 4OMMA 1JXOA 1ZUUA 1K76A 3VS0A 1AZEA 2P4RA 2LZ6B 1W70A 1KJWA 1T0HA 1GCQC 2BZYA 2OJ2A 2RN8A 4J9IA 3M0UA 2ED0A 2LQNA 2YUOA 1GBQA 2CSIA 1BU1A 3VS6A 2HBWA 1I1JA 1M27C 3JV3A 2EYXA 1H3HA 2EVRA 2J6FA 2J6OA 2JMAA 1AD5A 2MCNA 2C0IA 2EYWA 2VKNA 4E6RA 4X1VA 2FPEA 2O88A 2DILA 2EGEA 2CREA 2K3BA 1VA7A 4JZ4A 2DBMA 3TSZA 3VS5A 1RUWA 2JT4A 2D8HA 1YNZA 1I07A 3RNJA 4QT7A 2CSQA 1U3OA 1Z9QA 3IQLA 1Y0MA 2GBQA 5HCKA 2ENMA 1G83A 2DL4A 1PKTA 1KSWA 3C0CA 1TG0A 2L3SA 2YUPA 2DF6A 1Z9ZA 1HJDA 1T3LA 4J9EA 4HVWA 1N5ZA 3UA7A 2ABLA 3NHNA 2DL8A 2JM8A 2M51A 4J9GA 1V1CA 1GL5A 1SEMA 1BK2A 1CKBA 1PKSA 2J06A 1YP5A 2CDTA 4CC3A 1JEGA 1WFWA 2RPNA 2DJQA 1UJ0A 2K9GA 3QWYA 1U06A 4Y92A 2JXBA 3GBQA 4Z89A 2AK5A 1X6BA 4HCKA 2GGRA 4D8KA 3I5RA 1I0CA 4JJCA 3REBB 4CC4B 1PRLC 4LNPA 2CUBA 2DYBA 1M30A 2EQIA 2J7IA 3EHRA 2GQIA 2DL7A 1XOVA 4KRTA 3NPFA 2RQUA 2GTJA 1X27A 2J05A 4OMPA 3PVQA 2EKHA 1GRIA 2DBKA 4OMQA 3TVTA 3R6NA 3O5ZA 4RTYA 2LQWA
chains in the Genus database with same CATH superfamily
5FWCA 3CC4Q 1YITQ 1VQ5Q 4M75D 3EFOA 1CSKA 4BDZA 2DIGA 5GANh 4FYVB 3VJPA 2DKGA 1QWEA 2EJFA 2CT3A 2P0PA 4J6YA 2QDYB 1R0CB 4M7AE 5FU7C 3CPWP 1ZBJA 3ME9A 4L59A 1SPKA 4IUUA 4M78G 1KD1R 1RAIB 4KUIA 2MI6A 2KXDA 3MJXA 2VYTA 1WI7A 1PRMC 2K2MA 3CCRA 1TUCA 3G6ET 4HVVA 1BI0A 4A54A 2NUPB 5CR2A 3M58A 4PJMA 3F70A 3PFSA 2FRWA 4BY6B 4C0DB 2RJEA 4FSSA 3JCMd 2E3HA 1G8XA 3QJYA 3REAB 3JCMe 5KYYA 2RHYA 3VRZA 2NWMA 2X3WD 1IHWA 3OYBA 1D1CA 2GNCA 4Y91A 2DTOA 2V8JA 3CEYA 3FJPA 1Q81U 2LCSA 2CP3A 1PHTA 2HSPA 4RMOA 4OGCA 4LN2A 7AT1B 2E3IA 2SEMA 2JW4A 1ZX6A 3A5ZB 4R0KA 3QIIA 1SG5A 4RUGA 1BYMA 3EAEA 1VYTA 1SKUB 2KVQG 1F1BB 3G4SA 2VUBA 1MMNA 3CCLT 5FW9A 2KRMA 1QVGS 1PCXA 2O9VA 3RKWA 1JQQA 2AKKA 2LX7A 3E2UA 3VRYA 3TU4K 1RLPC 2JTEA 4RCBA 5EC7A 8ATCB 2OI3A 2CUDA 3I56T 3QHSA 3G71A 1WA7A 4KH0B 2DK3A 5FU7B 2E64A 5IHKA 1D1BA 3RESA 2OAWA 4M7DC 1M90C 1ARKA 4BDYA 3BFMA 3X24B 5GAMg 4AFSC 2LQKA 2DEUA 2OTLA 2H8HA 5J26A 5CKFA 2A7YA 2E5KA 2RHIA 2E70A 4AG2C 2PVOB 3JRZA 3HPWA 1E6GA 1UHCA 4K11A 2LJ3A 4B9WA 1PSEA 3NTIA 2BZ8A 4PJOC 1KC8R 9ATCB 4XU2A 1NJIR 1G3SA 4Y28E 3JSCA 2RB6A 1YITA 3CC4A 1VQ5A 2PVGB 1JO8A 4C92A 2OAUA 5CQYA 5IXFA 3NGPA 2DMOA 1SRLA 2NUPA 1O9SA 3AT1B 1QP3A 5GMKm 3JB9J 1WDXA 2H3EB 3OYNA 1HXDA 3JB9I 1K0XA 2JJ9A 2KAFA 1PG5B 1M4ZA 1X6GA 3KFVA 2DX1A 1M9SA 2LVMA 3EG1A 4OMOA 1AT1B 1NG2A 4M78E 1E7OA 3CCJQ 2RQVA 4J8OA 2KNBB 2JZ2A 4EIKA 1TTHB 2EYZA 3LLRA 3HP9A 2LP5A 2GTOA 5GJWB 3JCMQ 4AG1C 1IO6A 1C0MA 1NEBA 4HT8A 3L2WA 2RD1A 1VQ9T 1JRIA 2EGCA 5KCOA 5DLOA 1TUDA 1IREB 1SSHA 4M4ZA 1MV0B 1UG1A 4DBRA 3X26B 2DVEA 3PIOA 1RAFB 2HD0A 2G3RA 4M77D 8AT1B 5D6WA 4D8DA 1UDLA 4PJOB 2LC4A 1K8AC 3FLGA 5GMKh 2RM4A 4E7IA 1UGVA 3RMQA 2DE0X 1K4US 2YLCA 2L3QA 2L3PA 5CKHA 1MV3A 1HK9A 1N9RA 4ESRA 2E65A 4KGXB 3GNFB 4A4GA 4OVAA 1FYNA 4J7IA 2ATCB 2B8AA 2YXYA 1QVGA 2ZPFB 2FYKA 1Q95G 1KQSS 5KYUB 3BDLA 3FDRA 3CD6Q 1JXMA 2KRNA 1M8VA 5J3BA 4M7AB 1VQOQ 1YN8A 2AIRB 2DETA 4CI0C 2EQUA 3EG3A 2PUOB 3OYAA 3LH0A 1SHFA 4OB2B 5HY6A 4M75G 1Q7YU 5AT1B 4M75F 1WHKA 3VS4A 1OPKA 3VUBA 2QQSA 4FYXB 3HHTB 1U5SA 1NLPC 2EGAA 1M90U 1VQNQ 2DFUA 4ZGEB 2BE9B 2RI5A 1Q82R 2DXCA 1RAEB 3ZEHA 1ZUUA 1DJ7B 1Y7XA 1AZEA 2LZ6B 1W70A 1GCQC 2RN8A 2XDBA 4J9IA 3TEEA 3CCJA 2YUOA 2EKOA 4BI3A 5A0DA 3MEWA 2JOYA 3QYGB 5FU6B 3MP1A 2KDSA 3L2ZA 2EVRA 2HL5C 2K3YA 4CRIA 2J6OA 2QASA 2CREA 3JCMf 2K3BA 3HTRA 1YNZA 4L5GA 4ME7A 4RG8A 4PJOA 1BCOA 3GLXA 4XU1A 1Y0MA 1KQSP 2JN0A 1PKTA 1KSWA 4DOVA 3C0CA 2FHDA 2L3SA 2M02A 4J7FA 1UGSB 2ZGWA 4HVWA 3UA7A 1UGRB 3JCMh 3N5BB 2LDMA 3VU3C 3FRNA 3QDFA 1V1CA 3JCMc 4XTVA 4XK8E 2CDTA 1JEGA 5KYUA 4P5NA 3PT9A 4QVCA 1WJSA 1U8RA 2DJQA 1UJ0A 3QWYA 4EPCA 2CP0A 2QQBA 4Y92A 3G6EQ 3GBQA 4BUGA 2HKQB 1YCYA 4EMKB 4HCKA 1ZA1B 3QZ9B 1OU9A 1WHMA 3GNGA 2E41A 2F5TX 2Z0WA 4M7DF 3DB4A 1KD1C 3D7SB 4XU0A 2GQIA 3CCQT 5GMKl 4DBQA 2YRVA 2RQUA 2GTJA 1X27A 3EGDB 3CD6A 3PVQA 4JRQA 5FRMA 1VQOA 1XQHA 1ZSZB 3EH2A 3HFOA 4OMQA 3QSUA 3TVTA 4D6WA 2OTJQ 1KQSA 2LQWA 3QKJA 3VYGA 2Y4YA 4M78B 1FX7A 2QA4Q 2MF2A 3HRSA 4N0AA 2C0OA 4M75E 3ER0A 4C8QC 1N8RC 2CP2A 4ZGDB 2XD0A 2EQMA 2VXFA 2JTFA 1X69A 4KT0E 4B6MA 1Q81C 2HDAA 2VGNA 3EHQA 2CH4W 3CCLQ 2GFAA 1VQ4T 4HA8A 2LJ0A 2BUDA 1IHVA 4B9XA 2ED1A 2RI2A 4XTYA 1OULA 3OYCA 2V26A 1J3TA 3I56Q 3DKMA 2KEAA 5IN1A 1RADB 3V8LA 2B86A 2FO0A 2QTVA 2K4YA 2KE9A 4BE1A 2CP7A 1G5VA 3VV0A 2EJ9A 2LX9A 2HCKA 2AT1B 5GMKe 3M9QA 2KXCA 1VIFA 1KHIA 2MK5A 2NLUA 2KRSA 1LNXA 2ROLA 4ZTFA 3NTKA 2QXFA 3CPWS 2RNAA 4J5YA 1NPPA 2KY9A 3I9QA 2O4XA 5CKBA 4M77G 1UE9A 4HCZA 4J9DA 4C92D 4NS5A 3M0SA 5GAN3 4M77F 1VQNT 2BZXA 4EMKA 4LDXA 4JJNK 4RKUE 1KC8C 2R5MA 4BY6C 4C0DC 5CAIA 2L8DA 5HK0A 2PZ1A 4J83A 1GCQA 3M55A 1EZZB 2V8IA 2MMPA 1KG1A 1KFZA 2FPDA 1R0BG 3H41A 1YJWQ 1ZSZA 2JNGA 2F2WA 3CMEQ 3CBOA 3LWIA 5LJ3g 3G6EA 2LRQA 1K0SA 2YSQA 2YHTA 4M78A 2L5QA 1WHJA 4C5GA 1AOJA 2COZA 1QVFS 2EPDA 1QKXA 1VQ9Q 3OYIA 2DD4A 4J6XA 1KIKA 1Q86R 5IHNA 4F7UB 4A4HA 2HMAA 4JS4A 2KQWA 1WX6A 4MDXA 2DTHA 4A4KA 2J6KA 1WJRA 3OYLA 3O8VA 2QA4A 1AEYA 1M1KC 2A37A 4OB0B 4L6V5 1IXDA 2QEXT 2JM9A 2O31A 3LW5E 1YJNT 1KD1U 2BIVA 4OMLA 2KYBA 1AVZC 2RH2A 3V7RA 4FL6A 1G2BA 4JZ3A 3PTAA 3M56A 3VS7A 4JRPA 3CCLA 6AT1B 3FJ5A 3P8DA 3QWXX 2YWWA 3CXCS 1T3SA 1MMAA 3OY9A 1Y57A 5DLQE 2EWNA 4QQGA 4ZN3A 2EIFA 4YTLA 3I56A 3E19A 2XKOC 2KK4A 1D1AA 1NM7A 4DQ2A 2BE7D 1N8RU 1W6XA 5LJ5g 4BE2A 1M1FA 1ZUKA 1GCPA 3UATA 1CKAA 1W4SA 2E4HA 1YBYA 4OGEA 1BIAA 1TOVA 2HNIA 1S72T 4ZN1A 2CZ6B 3OYJA 2HEQA 2OTJT 4E7HA 2K5LA 2NUZA 3LYIA 1N6AA 5I11A 1I8FA 4Z8AA 2QA4T 2PNIA 4QKUA 1QVFP 4KGZB 1SRMA 2ZZDA 2XIDA 4ORZA 4C8QA 1AWJA 5CVIA 3CMAQ 4M77E 5GAN2 5GANg 1BKBA 1VYUA 3RKXA 1VQKT 1W2BS 3CPWA 4C0FA 5GAN7 1RLQC 3LH5A 3M0PA 3SB2A 1K73R 2DEQA 3OYMA 2V1RA 4CC7A 1AWWA 3DLLA 5KE2A 5IHIA 2F69A 1Q7YC 3OYEA 5GAMj 5IT9E 3H0IA 2HZYA 4MZMA 4A53A 4EDUA 2VV5A 1VOMA 2F2XA 1SHGA 2QGFB 1VQPT 3EH1A 3P8BB 3E9FA 2GQVA 1YJWA 3TQ7P 4F7UA 2W0ZA 2EJGA 4M7DD 3CMEA 1D0XA 2RQRA 1VQMT 3V8JA 3CCMT 2PTKA 1OZ3A 5AYFA 3V8KA 3CXCP 4RG2A 3JCMX 5GAOm 1ACMB 4N4GA 2RA2A 4A63B 4ELYC 1VQ9A 1G3YA 2DO3A 1KC8U 2M1HA 3UF4A 4PJOD 5DM7R 4IUQA 1QVFA 1N27A 2DM1A 1H92A 1A0NB 4E7SA 1M1GA 2LJ1A 4IIMA 4DBFA 3QG1A 2EQJA 4PFZA 2F2VA 3RMSA 4GBQA 2ESWA 1MNEA 3CCUT 1UJYA 3QZ5B 3I5SA 1YJ9T 4KGVB 1RAAB 2L89A 4IIOA 4MDWA 2DL5A 5KE3A 1YI2T 3JAME 1U1SA 3MCAB 1U1TA 2CP6A 4XTZA 1JXOA 3CCST 2PVDB 3VS0A 1YJWT 2P4RA 2QQ9A 4M7AC 3CMET 2BZYA 2MWOA 2P4TA 3VYHB 1IB8A 2OJ2A 1W2BP 1QVPA 2ED0A 2LQNA 1K9MR 3PNWC 3OSSC 4BB7A 1GBQA 2EAYA 4DOWA 1BU1A 2PUKB 1I1JA 5KH6A 1WNLA 1UGQB 1M1KU 3CXCA 2JMAA 4GLKA 3CCQQ 2MCNA 1IGUA 2HL3A 2EYWA 2VKNA 4E6RA 2FPEA 1VA7A 4ATOA 4JZ4A 2DBMA 1RUWA 2JT4A 2PU9B 1YHQT 1QMCA 3RNJA 3LWHA 2V8KA 3IQLA 1MGQA 2GBQA 2ZCFB 4PLIA 4N0AC 4ZTJA 3FB9A 3CPFA 1C1AA 1G83A 3BDUA 4C92G 5GAOq 3OYKA 3NTHA 5I21A 1HJDA 4C92F 1T3LA 4J9EA 3FEOA 2XDPA 3RDVA 1LPLA 3CMAA 4KUDK 4OMFB 3OS5A 4R55A 3V7SA 4HKEA 4E2FB 3JB9H 2CZ0B 5FRNA 3C4SA 5FU6C 5C0MA 1SEMA 1YIJT 1VQ4Q 5C6SA 4EMHA 4F04B 1WPYA 2DTIA 2RPNA 2K9GA 3HRTA 4EMGA 1W2BA 3H6ZA 4QVDA 2FVUA 4Z89A 2KI7A 4FM4B 1X6BA 4TVRA 3SWNB 4D8KA 1TUGB 3I5RA 5KYNA 1D3BB 4CC4B 1PRLC 1MHNA 2X35A 2CUBA 2DYBA 2GCXA 2HQHA 3CCVQ 1JBMA 2E6ZA 2DL7A 2E6NA 3NPFA 2R57A 2J05A 1R77A 3AHUA 1OX8A 3EGXB 3OA6A 3LX7A 3O5ZA 1ZQ1A 4WTOB 1Y71A 2CP5A 2FL7A 3E9GA 3S3MA 1NPRA 3CMAT 1I4K1 2KMTA 2LT1A 2A3LA 3HL8A 1B34B 2DRMA 2YUNA 5A0GA 2GF7A 2CGHA 4VUBA 3C12A 4EMKC 3OS0A 1UECA 5GAN4 2X4JA 3HSBA 1ZA2B 5GAMd 1B3QA 3CBPA 4FT4A 1YFNA 1EIFA 5GAMe 1YWPA 3E1SA 4RTVA 2G6FX 3M4YA 1WYXA 4II1A 2P0QA 2XI9A 1I81A 3EG2A 1NYFA 2COWA 3MEVA 3WVEB 2FZCB 2ZPBB 3QO3A 2RHXA 1ZSZC 2DVJA 5GMKi 4FSXA 1UTIA 4BD3A 4KBMB 1HYOA 4IUVA 3SHWA 1WQ7A 1PD0A 4M78C 4M77B 2R58A 5GAOn 2DYIA 2RQTA 3A8MB 2FRYA 1S1NA 2EFIA 2A08A 3CCQA 4QQ6A 4AT1B 4LDVA 5CO7A 3CC7T 2ECZA 2D0QB 2M0OA 3G7ZA 1C6VX 4MMLA 1TS9A 3I35A 2RK2A 2CKKA 5HK3A 1PWTA 2D9TA 5GAN8 1VQ8T 3R6OA 2EW3A 1ABOA 1XJWB 1E6HA 4NL3A 2IG0A 4C92E 5IXBA 1AZGB 2QEXQ 3H9NA 5FLXE 5GAOl 1YJNQ 1QCFA 2HBPA 2I0NA 1LVKA 2KROA 3P8HA 3SDZA 1BIBA 3RERA 1FMKA 3TCJA 5M9OA 1VQ4A 4M7AA 2VXEA 3PVLA 1I5OB 1TXQA 1NBEB 2K57A 5GAOp 2ZPGB 5D6XA 4FYYB 1QWFA 4M7DG 3EG9B 2KBTA 4PKCC 3URGA 1PSFA 1QCNA 2X51A 3VUZA 1D09B 5J39A 3S3OA 4DA4A 2X3XD 2JUFA 3OB9A 3CCVA 1EFNA 1WXBA 1S72Q 3UWNA 4BE0A 4PJOG 1VQ7T 2L2PA 1ZBXA 1AHJB 5GAN6 4PJOF 2QQAA 3EG0A 2JMCA 1D0ZA 3OMGA 2JVVA 4C8QD 2EYYA 3I55T 4MZTA 3J80E 4JDSA 3JB9D 3GIBA 3VKIA 1K8AR 4RTTA 2KSSA 2FB7A 3JCMg 2YRCA 3UDCA 5KCHA 3L2VA 3S3NA 1M8MA 1VQKQ 3PIPA 4JPBW 1VQNA 3M0RA 3OYDA 5D6YA 2DL3A 4F17A 2HKNA 4V2SA 1BCMA 1WXTA 2E12A 3H8ZA 3A8GB 2D6FA 4LUEA 3CCET 2DXTA 1VQPQ 2KYMA 1WJQA 3L2RA 3RR6A 3ULRB 3TREA 4PJNA 1VQMQ 3CCVT 3HFNA 2QTXA 3CCMQ 4KH1B 1AWXA 3A1PA 2ZAEA 4F14A 2H3JA 2P84A 3OS2A 1BI1A 3VS1A 1X75C 2XDDA 1OPLA 3OYGA 2YDLA 2GFUA 1ZLMA 1WQWA 4GLMA 4O5VA 3M59A 3JCMb 2Y90A 1NLOC 4PL6A 4PK4A 1NE8A 3X28B 3CCUQ 1ZSGA 1VYVA 4XTUA 4PJJA 1NJIC 4ZNXA 4DEXA 2QEXA 1YJ9Q 2XHCA 5LJ3j 2DA9A 1KQ1A 1YJNA 3CC2T 1YI2Q 1OZ2A 2FG0A 4XTXA 3L1AA 4F16A 4GY5A 1TU0B 3C94A 3CCSQ 1K9AA 2IVWA 3EGDA 1UGPB 4ANJA 1K1ZA 4Q5WA 2MOXA 4M7DE 1OQKA 2F1LA 1PNJA 2LCLA 3X25B 3LGLA 2XICA 3OS1A 1Q86U 1NEGA 4E7KA 4RTYA 3META 1QKWA 1OI1A 4X34A 4LDWA 2NUTB 3MEAA 1LCKA 1HSQA 4J9BA 4J9FA 1N9SA 2L0AA 1X2KA 2O9SA 1S72A 2D1XA 2LTOA 2OTJA 4PJOE 3WXMB 5GJVB 1YHQQ 2CT4A 3QJ6A 4OMNA 1H3ZA 2K5IA 3BE3A 5DY9A 2YRDA 3RKYA 2VVKA 1MUZA 1W1FA 2DJZA 1KK7A 3FIFA 2ZPEB 4LE9A 5CQXA 4M75C 5CKDA 4JRKA 1VQKA 2QK0A 1AWOA 2JTMA 1YIJQ 4JJDA 2A0FB 4WF2A 3UA6A 2QAZA 5GAMf 4MMKA 1H641 5LJ5j 4LD9K 2DIQA 1UB4A 1T0HA 2M9UA 3KBGA 3OW2S 1VQPA 4NL2A 1IZ6A 4C92B 4M78F 4XTWA 4HT9A 4BACA 3J7AF 1QW1A 2HBWA 1M27C 1VQMA 4UC4A 1G3TA 2HQXA 3CCMA 1H3HA 4E7ZA 2J6FA 5GAMh 1AD5A 2C0IA 5I2SA 4X1VA 2VC8A 3M57A 1VQLT 2O88A 2DILA 3WVDB 5GANj 4LDUA 2D8HA 1I07A 3RUXA 1Z9QA 1N8RR 4HCCA 1QCOA 5GAN5 1BI2A 2DXUA 5HCKA 2ENMA 5CCAA 1TG0A 4QQDA 1V29B 2YUPA 3UPUA 1Z9ZA 1K73U 1Q81R 2L3RA 1N5ZA 3CCUA 2ABLA 3NHNA 2DL8A 1VUBA 1YJ9A 1BK2A 4C5EA 1YI2A 1YP5A 1QQJA 2XU8A 3CCSA 1V76A 2NUTA 4JS5A 2QG9B 3CCRT 1Q82C 4M75B 2JXBA 2RK1A 2AK5A 2WSEE 3A8LB 3HRUA 1OX9A 2QGGA 4IUTA 1OYXA 2XK0A 1I0CA 2WACA 3M4GA 1EX4A 1XNIA 1M30A 3QPHA 3EHRA 3ASKA 1NJIU 1XOVA 4E7JA 2BKDN 3OW2P 3CC7Q 4OMPA 2EKHA 2RJDA 1OU8A 3RIRA 3R6NA 4C8QG 1YHQA 4HVUA 1OV3A 4C8QF 1TH7A 1VQ8Q 3JB9G 3A98A 1WXUA 1WHLA 4LD6A 5LJ3d 3JB9F 1X2QA 2MWPA 5LJ3e 4Z02A 2I2LA 3H0HA 1JB0E 1WHGA 3SWNC 1RABB 3G4ST 3MKDA 2WSCE 2OX7A 3GF5A 1M3CA 1YIJA 4M7AD 1M5Q1 3M0QA 1K9MU 1Y07A 4ZGJB 2IIMA 2MAMA 2RQWA 1Y96B 4F7UG 1WIEA 4RTXA 4RTUA 1FMWA 4F7UF 2ZPIB 1KHCA 3OYFA 3JCMV 3G71T 2RF0A 4BI4A 3THKA 4QW2A 1FXXA 2HSEB 2OTLT 2CZ1B 2M0YA 5L23A 2ROTA 3OW2A 3PMIA 1QVGP 5A2QE 1NYGA 4PNOA 2O2OA 3H0FA 4OB3B 4DEYA 3GPLA 1VQ7Q 2DLPA 4MZPA 4QVZA 3A8HB 4PFPA 5IAYA 2K7AA 2K6DA 4XQ3A 4J9CA 3MPUB 3T9NA 1M1KR 2LT4A 4XAXB 2CZ7B 3I55Q 4M7DB 3QXEB 2AKLA 3A8OB 3CC4T 1YITT 2QDLA 1VQ5T 3GOXA 4AFUC 3CQTA 1WGSA 4M75A 3VS2A 2VWFA 3S6WA 2D8JA 2EBPA 1LOJA 4J9HA 5LJ5d 4M77C 5LJ5e 3KUFA 3ZBDA 3SEMA 4LDYA 3PE0A 1FWZA 2PQWA 1X01A 2LMJA 1UUEA 2CH4A 2C06A 1UHFA 3CCEQ 4AFQC 1LJOA 3OSVA 4JLIA 1RI9A 3NMZC 5I22A 2IPOB 2YT6A 4C5IA 2NYSA 1UFFA 1TSFA 5GANd 2DAQA 5GANe 2DXBA 2DRKA 1WLPB 1GFDA 3JCMP 1BB9A 4FT2A 4OP0A 2YUQA 5LL6S 3V7CA 2FEIA 1FMVA 2EYQA 2X9HA 5KYWB 3CC7A 3HKSA 2C0TA 2D0NA 3M0TA 4WCIA 2KT8A 4C8QE 3EFSA 2W10A 3Q1JA 3ZL7C 5GMKj 2KGTA 1Q82U 1RAHB 1VQ8A 1Y96A 4FW1A 4LXCA 1QLYA 4HXJA 5CIUA 2CYZB 2BTTA 4O6JA 1D0YA 1BBZA 1PM3A 2A36A 2O01E 1Q7YR 1B7TA 2LNVA 4KULA 2VGMA 4X9DA 3CC2Q 3OYHA 5ECAA 2E10A 2KR3A 3U23A 1KQ2A 2LNHB 1M90R 5CK9A 4DBHA 3RBBB 2JS0A 3EFRA 1RI0A 1JJ2S 4M78D 3L2QA 4F7UE 3MP6A 4JJBA 2DZCA 5KYXB 2M16A 2QYZA 4N4IA 1M3AA 4E7LA 2RJFA 1MNDA 5IH2A 3DB3A 4M7DA 2COYA 2SRCA 1M2OA 4IKFA 4FU6A 1T0JA 1B07A 1VQ7A 3G1JA 5FWBA 4PFOA 4Z88A 1OEBA 1JU5C 1Q86C 1VQ6Q 1GBRA 4FIBA 4PLLA 1WZOA 1TWBA 3I55A 2R5AA 2V1QA 1X6OA 2MYSA 2AHJB 1ABQA 3SWNA 4JLGA 3BW1A 1G3WA 4RTWA 2RMOA 4XU3A 4C5HA 1D3BA 2CS7A 2DD5A 4NOYA 1YCSB 5GAOr 2HAXA 3J81E 3BY7A 2XMFA 3PMTA 5L8RE 1ZHIA 1M2VB 1YWOA 3DLMA 3EGXA 1PC0A 2FZKB 2Y4XA 4N4HA 3CCEA 3CCJT 1M3BA 1BI3A 4AFZC 5KYWA 2FPFA 2O4XB 1I5LA 3MHXA 3TSWA 5CKEA 1H8KA 5I2MA 2AZSA 4CC2A 2A28A 3NFCA 1B34A 2RHZA 4RCCA 2K79A 2MPXC 2P0KA 3M5AA 2MIOA 1ZUYA 1JJ2P 3INZA 1VQLQ 2JS2A 2RHUA 3JCMJ 1HD3A 3VS3A 3SFMA 1X43A 4X9CA 2RJCA 4OB1B 3EGUA 3QYHB 1K8AU 1OOTA 2FZGB 3QUIA 3OBWA 3X20B 4LUDA 3ZFJA 2YLBA 4C0ZA 1QP2A 2DPPB 4RTZA 4FW2A 5FROA 1P92A 3OQ5A 4M77A 4J6WA 5LJ3f 2RO0A 3CBMA 5KYXA 2KT1A 2K5FA 4M7AG 2EQKA 2DNUA 2AZVA 4ELZC 3CC2A 1GFCA 4M7AF 4OMMA 2LCCA 4BI8B 1K76A 2LQ8A 1K73C 1KJWA 3EFOB 2K2VA 3CCRQ 4IURA 3L42A 3M0UA 3M53A 2X4WA 5LJ3h 2XG8D 4FYWB 2CSIA 3VS6A 4PJLA 4AMCA 3JV3A 3LGFA 2EYXA 2VASA 1JJ2A 3QBYA 3CD6T 1XTDA 2ZPHB 2EGEA 1VQOT 1IGQA 2WSFE 4JRIA 3QDRB 3TSZA 3VS5A 1IRXA 3C95A 2E5QA 2QQRA 5HKCA 4QT7A 2CSQA 1U3OA 4IUPA 1UEBA 2X4XA 3UT1A 1M2VA 1VQ6A 2DL4A 2DERA 1VIEA 3EG9A 2DF6A 5KYYB 2VB6A 1MMGA 3OMCA 5A0LA 1RL2A 3PGGA 4R56A 4OF1A 3OBYA 3G4SQ 4C92C 2JM8A 2M51A 4A4FA 4J9GA 4JUVA 1GL5A 1CKBA 1PKSA 1SF9A 2J06A 5EG2A 1RACB 3L2UA 4CC3A 5LJ5f 2X4YA 1WFWA 4A4EA 3GP8A 1PD1A 3JCMW 1WHHA 1RAGB 5D7UA 1U06A 2K3XA 4C8QB 4FCYA 1MMDA 3G71Q 3OYYA 2HQEA 4E47A 2F5KA 2GGRA 2DZ9A 1O75A 4JJCA 3REBB 3M54A 2OTLQ 4LNPA 1K9MC 5LJ5h 2EQIA 1SSFA 1NZ9A 2J7IA 4KRTA 3MP8A 5GANf 2RI3A 3MO8A 2E1HA 3SD4A 3FC3A 1GXIE 1VQLA 4C0GA 1R8OB 3KXTA 1GRIA 1VQ6T 2DBKA 4HCBA 3MEUA 2QI2A
chains in the Genus database with same CATH topology
4HVUA 1OV3A 5FWCA 3A98A 1WXUA 2C0OA 1X2QA 2DRMA 2YUNA 1CSKA 3H0HA 1UECA 1QWEA 2CT3A 1B3QA 1M3CA 1YWPA 1X69A 4RTVA 2G6FX 2HDAA 1WYXA 3EHQA 2CH4W 3M0QA 2LJ0A 3EG2A 1ZBJA 1NYFA 2IIMA 1SPKA 2ED1A 2RQWA 2KXDA 1WIEA 1WI7A 2DVJA 4RTXA 1PRMC 2K2MA 1J3TA 4RTUA 1UTIA 1TUCA 3SHWA 4HVVA 2KEAA 2RF0A 3THKA 2B86A 2FO0A 2RQTA 2FRYA 1S1NA 2FRWA 2KE9A 4FSSA 2HCKA 2M0YA 3REAB 5L23A 2ROTA 2A08A 3VRZA 1NYGA 2NWMA 2O2OA 2X3WD 3H0FA 2KXCA 4DEYA 2DLPA 2ECZA 2GNCA 2K7AA 2K6DA 2KRSA 2ROLA 4J9CA 2LCSA 2RNAA 1PHTA 2HSPA 3I35A 4LN2A 1PWTA 3I9QA 2SEMA 2EW3A 2AKLA 2JW4A 1ABOA 1ZX6A 2QDLA 1E6HA 4R0KA 1UE9A 4J9DA 4AFUC 3CQTA 5IXBA 3M0SA 4RUGA 3VS2A 2VWFA 2D8JA 2EBPA 1AZGB 4J9HA 1VYTA 2BZXA 1QCFA 2I0NA 2KROA 3SEMA 3PE0A 1FMKA 5FW9A 2KRMA 3PVLA 2PZ1A 1GCQA 2LMJA 2O9VA 1JQQA 2AKKA 2LX7A 1UUEA 2CH4A 1UHFA 3VRYA 1KFZA 1RLPC 2JTEA 2FPDA 4AFQC 5EC7A 1QWFA 3H41A 1RI9A 3NMZC 2OI3A 2CUDA 2F2WA 1WA7A 5I22A 2KBTA 1K0SA 2YSQA 2YT6A 5IHKA 1UFFA 2OAWA 1ARKA 1AOJA 4AFSC 2DRKA 2X3XD 2H8HA 1WLPB 1GFDA 2EPDA 1QKXA 1BB9A 2E5KA 1EFNA 2YUQA 1WXBA 4AG2C 1KIKA 2FEIA 2L2PA 1E6GA 5IHNA 1UHCA 2C0TA 2D0NA 4K11A 2LJ3A 3M0TA 4WCIA 3EG0A 2JMCA 1WX6A 2KT8A 2BZ8A 2EYYA 2W10A 3ZL7C 2KGTA 2J6KA 1AEYA 1QLYA 1JO8A 4HXJA 2A37A 4RTTA 2BTTA 1BBZA 1M8MA 5IXFA 2A36A 3NGPA 2JM9A 2O31A 4JPBW 2DMOA 1SRLA 3M0RA 2DL3A 4F17A 5ECAA 4OMLA 2KYBA 1AVZC 4JZ3A 1G2BA 1WDXA 3VS7A 1K0XA 2KR3A 3U23A 3FJ5A 1X6GA 3QWXX 2LNHB 3KFVA 2DX1A 3RBBB 1WXTA 2JS0A 1T3SA 3EG1A 4LUEA 4OMOA 1NG2A 2KYMA 1E7OA 2RQVA 1Y57A 4EIKA 2KNBB 4JJBA 2EYZA 3ULRB 2LP5A 2GTOA 5GJWB 4AG1C 1IO6A 1NM7A 1M3AA 1NEBA 1AWXA 1W6XA 5IH2A 1ZUKA 2SRCA 1GCPA 3UATA 1CKAA 2EGCA 4F14A 1TUDA 1SSHA 1T0JA 1B07A 2HEQA 3VS1A 4M4ZA 1MV0B 2NUZA 5I11A 1UG1A 4Z8AA 5FWBA 4Z88A 1OPLA 2YDLA 1OEBA 1JU5C 2PNIA 1GBRA 1SRMA 1ZLMA 4GLMA 4ORZA 1AWJA 2V1QA 1NLOC 1ABQA 1ZSGA 1VYVA 4RTWA 1VYUA 2RMOA 4ZNXA 4DEXA 4D8DA 1RLQC 3LH5A 3M0PA 1YCSB 1UDLA 2DA9A 2FG0A 4F16A 2V1RA 4CC7A 1K9AA 2XMFA 1AWWA 5IHIA 1YWOA 1K1ZA 1UGVA 3H0IA 2DE0X 1K4US 2L3QA 2L3PA 1MV3A 2F2XA 1SHGA 4ESRA 1M3BA 4AFZC 2FPFA 2MOXA 3TSWA 2W0ZA 1H8KA 1PNJA 1FYNA 2AZSA 2RQRA 4CC2A 2A28A 1NEGA 2PTKA 1QKWA 2K79A 2MIOA 1LCKA 1ZUYA 1JXMA 2KRNA 4A63B 1HSQA 2JS2A 4J9BA 1YN8A 4J9FA 2L0AA 3UF4A 1X2KA 1HD3A 2O9SA 2D1XA 5GJVB 3VS3A 1X43A 2CT4A 4OMNA 3EG3A 3EGUA 2DM1A 1H92A 1OOTA 1A0NB 1SHFA 2VVKA 1MUZA 2LJ1A 4IIMA 1W1FA 4LUDA 2F2VA 4GBQA 3VS4A 2ESWA 1OPKA 4RTZA 4LE9A 1UJYA 1U5SA 1NLPC 2EGAA 3I5SA 1AWOA 2KT1A 2DNUA 4IIOA 2AZVA 2DL5A 4JJDA 3UA6A 1GFCA 4OMMA 1JXOA 1ZUUA 1K76A 3VS0A 1AZEA 2P4RA 2LZ6B 1W70A 1KJWA 1T0HA 1GCQC 2BZYA 2OJ2A 2RN8A 4J9IA 3M0UA 2ED0A 2LQNA 2YUOA 1GBQA 2CSIA 1BU1A 3VS6A 2HBWA 1I1JA 1M27C 3JV3A 2EYXA 1H3HA 2EVRA 2J6FA 2J6OA 2JMAA 1AD5A 2MCNA 2C0IA 2EYWA 2VKNA 4E6RA 4X1VA 2FPEA 2O88A 2DILA 2EGEA 2CREA 2K3BA 1VA7A 4JZ4A 2DBMA 3TSZA 3VS5A 1RUWA 2JT4A 2D8HA 1YNZA 1I07A 3RNJA 4QT7A 2CSQA 1U3OA 1Z9QA 3IQLA 1Y0MA 2GBQA 5HCKA 2ENMA 1G83A 2DL4A 1PKTA 1KSWA 3C0CA 1TG0A 2L3SA 2YUPA 2DF6A 1Z9ZA 1HJDA 1T3LA 4J9EA 4HVWA 1N5ZA 3UA7A 2ABLA 3NHNA 2DL8A 2JM8A 2M51A 4J9GA 1V1CA 1GL5A 1SEMA 1BK2A 1CKBA 1PKSA 2J06A 1YP5A 2CDTA 4CC3A 1JEGA 1WFWA 2RPNA 2DJQA 1UJ0A 2K9GA 3QWYA 1U06A 4Y92A 2JXBA 3GBQA 4Z89A 2AK5A 1X6BA 4HCKA 2GGRA 4D8KA 3I5RA 1I0CA 4JJCA 3REBB 4CC4B 1PRLC 4LNPA 2CUBA 2DYBA 1M30A 2EQIA 2J7IA 3EHRA 2GQIA 2DL7A 1XOVA 4KRTA 3NPFA 2RQUA 2GTJA 1X27A 2J05A 4OMPA 3PVQA 2EKHA 1GRIA 2DBKA 4OMQA 3TVTA 3R6NA 3O5ZA 4RTYA 2LQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVU A;  1OV3 A;  5FWC A;  3A98 A;  1WXU A;  2C0O A;  1X2Q A;  2DRM A;  2YUN A;  1CSK A;  3H0H A;  1UEC A;  1QWE A;  2CT3 A;  1B3Q A;  1M3C A;  1YWP A;  1X69 A;  4RTV A;  2G6F X;  2HDA A;  1WYX A;  3EHQ A;  2CH4 W;  3M0Q A;  2LJ0 A;  3EG2 A;  1ZBJ A;  1NYF A;  2IIM A;  1SPK A;  2ED1 A;  2RQW A;  2KXD A;  1WIE A;  1WI7 A;  2DVJ A;  4RTX A;  1PRM C;  2K2M A;  1J3T A;  4RTU A;  1UTI A;  1TUC A;  3SHW A;  4HVV A;  2KEA A;  2RF0 A;  3THK A;  2B86 A;  2FO0 A;  2RQT A;  2FRY A;  1S1N A;  2FRW A;  2KE9 A;  4FSS A;  2HCK A;  2M0Y A;  3REA B;  5L23 A;  2ROT A;  2A08 A;  3VRZ A;  1NYG A;  2NWM A;  2O2O A;  2X3W D;  3H0F A;  2KXC A;  4DEY A;  2DLP A;  2ECZ A;  2GNC A;  2K7A A;  2K6D A;  2KRS A;  2ROL A;  4J9C A;  2LCS A;  2RNA A;  1PHT A;  2HSP A;  3I35 A;  4LN2 A;  1PWT A;  3I9Q A;  2SEM A;  2EW3 A;  2AKL A;  2JW4 A;  1ABO A;  1ZX6 A;  2QDL A;  1E6H A;  4R0K A;  1UE9 A;  4J9D A;  4AFU C;  3CQT A;  5IXB A;  3M0S A;  4RUG A;  3VS2 A;  2VWF A;  2D8J A;  2EBP A;  1AZG B;  4J9H A;  1VYT A;  2BZX A;  1QCF A;  2I0N A;  2KRO A;  3SEM A;  3PE0 A;  1FMK A;  5FW9 A;  2KRM A;  3PVL A;  2PZ1 A;  1GCQ A;  2LMJ A;  2O9V A;  1JQQ A;  2AKK A;  2LX7 A;  1UUE A;  2CH4 A;  1UHF A;  3VRY A;  1KFZ A;  1RLP C;  2JTE A;  2FPD A;  4AFQ C;  5EC7 A;  1QWF A;  3H41 A;  1RI9 A;  3NMZ C;  2OI3 A;  2CUD A;  2F2W A;  1WA7 A;  5I22 A;  2KBT A;  1K0S A;  2YSQ A;  2YT6 A;  5IHK A;  1UFF A;  2OAW A;  1ARK A;  1AOJ A;  4AFS C;  2DRK A;  2X3X D;  2H8H A;  1WLP B;  1GFD A;  2EPD A;  1QKX A;  1BB9 A;  2E5K A;  1EFN A;  2YUQ A;  1WXB A;  4AG2 C;  1KIK A;  2FEI A;  2L2P A;  1E6G A;  5IHN A;  1UHC A;  2C0T A;  2D0N A;  4K11 A;  2LJ3 A;  3M0T A;  4WCI A;  3EG0 A;  2JMC A;  1WX6 A;  2KT8 A;  2BZ8 A;  2EYY A;  2W10 A;  3ZL7 C;  2KGT A;  2J6K A;  1AEY A;  1QLY A;  1JO8 A;  4HXJ A;  2A37 A;  4RTT A;  2BTT A;  1BBZ A;  1M8M A;  5IXF A;  2A36 A;  3NGP A;  2JM9 A;  2O31 A;  4JPB W;  2DMO A;  1SRL A;  3M0R A;  2DL3 A;  4F17 A;  5ECA A;  4OML A;  2KYB A;  1AVZ C;  4JZ3 A;  1G2B A;  1WDX A;  3VS7 A;  1K0X A;  2KR3 A;  3U23 A;  3FJ5 A;  1X6G A;  3QWX X;  2LNH B;  3KFV A;  2DX1 A;  3RBB B;  1WXT A;  2JS0 A;  1T3S A;  3EG1 A;  4LUE A;  4OMO A;  1NG2 A;  2KYM A;  1E7O A;  2RQV A;  1Y57 A;  4EIK A;  2KNB B;  4JJB A;  2EYZ A;  3ULR B;  2LP5 A;  2GTO A;  5GJW B;  4AG1 C;  1IO6 A;  1NM7 A;  1M3A A;  1NEB A;  1AWX A;  1W6X A;  5IH2 A;  1ZUK A;  2SRC A;  1GCP A;  3UAT A;  1CKA A;  2EGC A;  4F14 A;  1TUD A;  1SSH A;  1T0J A;  1B07 A;  2HEQ A;  3VS1 A;  4M4Z A;  1MV0 B;  2NUZ A;  5I11 A;  1UG1 A;  4Z8A A;  5FWB A;  4Z88 A;  1OPL A;  2YDL A;  1OEB A;  1JU5 C;  2PNI A;  1GBR A;  1SRM A;  1ZLM A;  4GLM A;  4ORZ A;  1AWJ A;  2V1Q A;  1NLO C;  1ABQ A;  1ZSG A;  1VYV A;  4RTW A;  1VYU A;  2RMO A;  4ZNX A;  4DEX A;  4D8D A;  1RLQ C;  3LH5 A;  3M0P A;  1YCS B;  1UDL A;  2DA9 A;  2FG0 A;  4F16 A;  2V1R A;  4CC7 A;  1K9A A;  2XMF A;  1AWW A;  5IHI A;  1YWO A;  1K1Z A;  1UGV A;  3H0I A;  2DE0 X;  1K4U S;  2L3Q A;  2L3P A;  1MV3 A;  2F2X A;  1SHG A;  4ESR A;  1M3B A;  4AFZ C;  2FPF A;  2MOX A;  3TSW A;  2W0Z A;  1H8K A;  1PNJ A;  1FYN A;  2AZS A;  2RQR A;  4CC2 A;  2A28 A;  1NEG A;  2PTK A;  1QKW A;  2K79 A;  2MIO A;  1LCK A;  1ZUY A;  1JXM A;  2KRN A;  4A63 B;  1HSQ A;  2JS2 A;  4J9B A;  1YN8 A;  4J9F A;  2L0A A;  3UF4 A;  1X2K A;  1HD3 A;  2O9S A;  2D1X A;  5GJV B;  3VS3 A;  1X43 A;  2CT4 A;  4OMN A;  3EG3 A;  3EGU A;  2DM1 A;  1H92 A;  1OOT A;  1A0N B;  1SHF A;  2VVK A;  1MUZ A;  2LJ1 A;  4IIM A;  1W1F A;  4LUD A;  2F2V A;  4GBQ A;  3VS4 A;  2ESW A;  1OPK A;  4RTZ A;  4LE9 A;  1UJY A;  1U5S A;  1NLP C;  2EGA A;  3I5S A;  1AWO A;  2KT1 A;  2DNU A;  4IIO A;  2AZV A;  2DL5 A;  4JJD A;  3UA6 A;  1GFC A;  4OMM A;  1JXO A;  1ZUU A;  1K76 A;  3VS0 A;  1AZE A;  2P4R A;  2LZ6 B;  1W70 A;  1KJW A;  1T0H A;  1GCQ C;  2BZY A;  2OJ2 A;  2RN8 A;  4J9I A;  3M0U A;  2ED0 A;  2LQN A;  2YUO A;  1GBQ A;  2CSI A;  1BU1 A;  3VS6 A;  2HBW A;  1I1J A;  1M27 C;  3JV3 A;  2EYX A;  1H3H A;  2EVR A;  2J6F A;  2J6O A;  2JMA A;  1AD5 A;  2MCN A;  2C0I A;  2EYW A;  2VKN A;  4E6R A;  4X1V A;  2FPE A;  2O88 A;  2DIL A;  2EGE A;  2CRE A;  2K3B A;  1VA7 A;  4JZ4 A;  2DBM A;  3TSZ A;  3VS5 A;  1RUW A;  2JT4 A;  2D8H A;  1YNZ A;  1I07 A;  3RNJ A;  4QT7 A;  2CSQ A;  1U3O A;  1Z9Q A;  3IQL A;  1Y0M A;  2GBQ A;  5HCK A;  2ENM A;  1G83 A;  2DL4 A;  1PKT A;  1KSW A;  3C0C A;  1TG0 A;  2L3S A;  2YUP A;  2DF6 A;  1Z9Z A;  1HJD A;  1T3L A;  4J9E A;  4HVW A;  1N5Z A;  3UA7 A;  2ABL A;  3NHN A;  2DL8 A;  2JM8 A;  2M51 A;  4J9G A;  1V1C A;  1GL5 A;  1SEM A;  1BK2 A;  1CKB A;  1PKS A;  2J06 A;  1YP5 A;  2CDT A;  4CC3 A;  1JEG A;  1WFW A;  2RPN A;  2DJQ A;  1UJ0 A;  2K9G A;  3QWY A;  1U06 A;  4Y92 A;  2JXB A;  3GBQ A;  4Z89 A;  2AK5 A;  1X6B A;  4HCK A;  2GGR A;  4D8K A;  3I5R A;  1I0C A;  4JJC A;  3REB B;  4CC4 B;  1PRL C;  4LNP A;  2CUB A;  2DYB A;  1M30 A;  2EQI A;  2J7I A;  3EHR A;  2GQI A;  2DL7 A;  1XOV A;  4KRT A;  3NPF A;  2RQU A;  2GTJ A;  1X27 A;  2J05 A;  4OMP A;  3PVQ A;  2EKH A;  1GRI A;  2DBK A;  4OMQ A;  3TVT A;  3R6N A;  3O5Z A;  4RTY A;  2LQW A; 
#chains in the Genus database with same CATH topology
 5FWC A;  3CC4 Q;  1YIT Q;  1VQ5 Q;  4M75 D;  3EFO A;  1CSK A;  4BDZ A;  2DIG A;  5GAN h;  4FYV B;  3VJP A;  2DKG A;  1QWE A;  2EJF A;  2CT3 A;  2P0P A;  4J6Y A;  2QDY B;  1R0C B;  4M7A E;  5FU7 C;  3CPW P;  1ZBJ A;  3ME9 A;  4L59 A;  1SPK A;  4IUU A;  4M78 G;  1KD1 R;  1RAI B;  4KUI A;  2MI6 A;  2KXD A;  3MJX A;  2VYT A;  1WI7 A;  1PRM C;  2K2M A;  3CCR A;  1TUC A;  3G6E T;  4HVV A;  1BI0 A;  4A54 A;  2NUP B;  5CR2 A;  3M58 A;  4PJM A;  3F70 A;  3PFS A;  2FRW A;  4BY6 B;  4C0D B;  2RJE A;  4FSS A;  3JCM d;  2E3H A;  1G8X A;  3QJY A;  3REA B;  3JCM e;  5KYY A;  2RHY A;  3VRZ A;  2NWM A;  2X3W D;  1IHW A;  3OYB A;  1D1C A;  2GNC A;  4Y91 A;  2DTO A;  2V8J A;  3CEY A;  3FJP A;  1Q81 U;  2LCS A;  2CP3 A;  1PHT A;  2HSP A;  4RMO A;  4OGC A;  4LN2 A;  7AT1 B;  2E3I A;  2SEM A;  2JW4 A;  1ZX6 A;  3A5Z B;  4R0K A;  3QII A;  1SG5 A;  4RUG A;  1BYM A;  3EAE A;  1VYT A;  1SKU B;  2KVQ G;  1F1B B;  3G4S A;  2VUB A;  1MMN A;  3CCL T;  5FW9 A;  2KRM A;  1QVG S;  1PCX A;  2O9V A;  3RKW A;  1JQQ A;  2AKK A;  2LX7 A;  3E2U A;  3VRY A;  3TU4 K;  1RLP C;  2JTE A;  4RCB A;  5EC7 A;  8ATC B;  2OI3 A;  2CUD A;  3I56 T;  3QHS A;  3G71 A;  1WA7 A;  4KH0 B;  2DK3 A;  5FU7 B;  2E64 A;  5IHK A;  1D1B A;  3RES A;  2OAW A;  4M7D C;  1M90 C;  1ARK A;  4BDY A;  3BFM A;  3X24 B;  5GAM g;  4AFS C;  2LQK A;  2DEU A;  2OTL A;  2H8H A;  5J26 A;  5CKF A;  2A7Y A;  2E5K A;  2RHI A;  2E70 A;  4AG2 C;  2PVO B;  3JRZ A;  3HPW A;  1E6G A;  1UHC A;  4K11 A;  2LJ3 A;  4B9W A;  1PSE A;  3NTI A;  2BZ8 A;  4PJO C;  1KC8 R;  9ATC B;  4XU2 A;  1NJI R;  1G3S A;  4Y28 E;  3JSC A;  2RB6 A;  1YIT A;  3CC4 A;  1VQ5 A;  2PVG B;  1JO8 A;  4C92 A;  2OAU A;  5CQY A;  5IXF A;  3NGP A;  2DMO A;  1SRL A;  2NUP A;  1O9S A;  3AT1 B;  1QP3 A;  5GMK m;  3JB9 J;  1WDX A;  2H3E B;  3OYN A;  1HXD A;  3JB9 I;  1K0X A;  2JJ9 A;  2KAF A;  1PG5 B;  1M4Z A;  1X6G A;  3KFV A;  2DX1 A;  1M9S A;  2LVM A;  3EG1 A;  4OMO A;  1AT1 B;  1NG2 A;  4M78 E;  1E7O A;  3CCJ Q;  2RQV A;  4J8O A;  2KNB B;  2JZ2 A;  4EIK A;  1TTH B;  2EYZ A;  3LLR A;  3HP9 A;  2LP5 A;  2GTO A;  5GJW B;  3JCM Q;  4AG1 C;  1IO6 A;  1C0M A;  1NEB A;  4HT8 A;  3L2W A;  2RD1 A;  1VQ9 T;  1JRI A;  2EGC A;  5KCO A;  5DLO A;  1TUD A;  1IRE B;  1SSH A;  4M4Z A;  1MV0 B;  1UG1 A;  4DBR A;  3X26 B;  2DVE A;  3PIO A;  1RAF B;  2HD0 A;  2G3R A;  4M77 D;  8AT1 B;  5D6W A;  4D8D A;  1UDL A;  4PJO B;  2LC4 A;  1K8A C;  3FLG A;  5GMK h;  2RM4 A;  4E7I A;  1UGV A;  3RMQ A;  2DE0 X;  1K4U S;  2YLC A;  2L3Q A;  2L3P A;  5CKH A;  1MV3 A;  1HK9 A;  1N9R A;  4ESR A;  2E65 A;  4KGX B;  3GNF B;  4A4G A;  4OVA A;  1FYN A;  4J7I A;  2ATC B;  2B8A A;  2YXY A;  1QVG A;  2ZPF B;  2FYK A;  1Q95 G;  1KQS S;  5KYU B;  3BDL A;  3FDR A;  3CD6 Q;  1JXM A;  2KRN A;  1M8V A;  5J3B A;  4M7A B;  1VQO Q;  1YN8 A;  2AIR B;  2DET A;  4CI0 C;  2EQU A;  3EG3 A;  2PUO B;  3OYA A;  3LH0 A;  1SHF A;  4OB2 B;  5HY6 A;  4M75 G;  1Q7Y U;  5AT1 B;  4M75 F;  1WHK A;  3VS4 A;  1OPK A;  3VUB A;  2QQS A;  4FYX B;  3HHT B;  1U5S A;  1NLP C;  2EGA A;  1M90 U;  1VQN Q;  2DFU A;  4ZGE B;  2BE9 B;  2RI5 A;  1Q82 R;  2DXC A;  1RAE B;  3ZEH A;  1ZUU A;  1DJ7 B;  1Y7X A;  1AZE A;  2LZ6 B;  1W70 A;  1GCQ C;  2RN8 A;  2XDB A;  4J9I A;  3TEE A;  3CCJ A;  2YUO A;  2EKO A;  4BI3 A;  5A0D A;  3MEW A;  2JOY A;  3QYG B;  5FU6 B;  3MP1 A;  2KDS A;  3L2Z A;  2EVR A;  2HL5 C;  2K3Y A;  4CRI A;  2J6O A;  2QAS A;  2CRE A;  3JCM f;  2K3B A;  3HTR A;  1YNZ A;  4L5G A;  4ME7 A;  4RG8 A;  4PJO A;  1BCO A;  3GLX A;  4XU1 A;  1Y0M A;  1KQS P;  2JN0 A;  1PKT A;  1KSW A;  4DOV A;  3C0C A;  2FHD A;  2L3S A;  2M02 A;  4J7F A;  1UGS B;  2ZGW A;  4HVW A;  3UA7 A;  1UGR B;  3JCM h;  3N5B B;  2LDM A;  3VU3 C;  3FRN A;  3QDF A;  1V1C A;  3JCM c;  4XTV A;  4XK8 E;  2CDT A;  1JEG A;  5KYU A;  4P5N A;  3PT9 A;  4QVC A;  1WJS A;  1U8R A;  2DJQ A;  1UJ0 A;  3QWY A;  4EPC A;  2CP0 A;  2QQB A;  4Y92 A;  3G6E Q;  3GBQ A;  4BUG A;  2HKQ B;  1YCY A;  4EMK B;  4HCK A;  1ZA1 B;  3QZ9 B;  1OU9 A;  1WHM A;  3GNG A;  2E41 A;  2F5T X;  2Z0W A;  4M7D F;  3DB4 A;  1KD1 C;  3D7S B;  4XU0 A;  2GQI A;  3CCQ T;  5GMK l;  4DBQ A;  2YRV A;  2RQU A;  2GTJ A;  1X27 A;  3EGD B;  3CD6 A;  3PVQ A;  4JRQ A;  5FRM A;  1VQO A;  1XQH A;  1ZSZ B;  3EH2 A;  3HFO A;  4OMQ A;  3QSU A;  3TVT A;  4D6W A;  2OTJ Q;  1KQS A;  2LQW A;  3QKJ A;  3VYG A;  2Y4Y A;  4M78 B;  1FX7 A;  2QA4 Q;  2MF2 A;  3HRS A;  4N0A A;  2C0O A;  4M75 E;  3ER0 A;  4C8Q C;  1N8R C;  2CP2 A;  4ZGD B;  2XD0 A;  2EQM A;  2VXF A;  2JTF A;  1X69 A;  4KT0 E;  4B6M A;  1Q81 C;  2HDA A;  2VGN A;  3EHQ A;  2CH4 W;  3CCL Q;  2GFA A;  1VQ4 T;  4HA8 A;  2LJ0 A;  2BUD A;  1IHV A;  4B9X A;  2ED1 A;  2RI2 A;  4XTY A;  1OUL A;  3OYC A;  2V26 A;  1J3T A;  3I56 Q;  3DKM A;  2KEA A;  5IN1 A;  1RAD B;  3V8L A;  2B86 A;  2FO0 A;  2QTV A;  2K4Y A;  2KE9 A;  4BE1 A;  2CP7 A;  1G5V A;  3VV0 A;  2EJ9 A;  2LX9 A;  2HCK A;  2AT1 B;  5GMK e;  3M9Q A;  2KXC A;  1VIF A;  1KHI A;  2MK5 A;  2NLU A;  2KRS A;  1LNX A;  2ROL A;  4ZTF A;  3NTK A;  2QXF A;  3CPW S;  2RNA A;  4J5Y A;  1NPP A;  2KY9 A;  3I9Q A;  2O4X A;  5CKB A;  4M77 G;  1UE9 A;  4HCZ A;  4J9D A;  4C92 D;  4NS5 A;  3M0S A;  5GAN 3;  4M77 F;  1VQN T;  2BZX A;  4EMK A;  4LDX A;  4JJN K;  4RKU E;  1KC8 C;  2R5M A;  4BY6 C;  4C0D C;  5CAI A;  2L8D A;  5HK0 A;  2PZ1 A;  4J83 A;  1GCQ A;  3M55 A;  1EZZ B;  2V8I A;  2MMP A;  1KG1 A;  1KFZ A;  2FPD A;  1R0B G;  3H41 A;  1YJW Q;  1ZSZ A;  2JNG A;  2F2W A;  3CME Q;  3CBO A;  3LWI A;  5LJ3 g;  3G6E A;  2LRQ A;  1K0S A;  2YSQ A;  2YHT A;  4M78 A;  2L5Q A;  1WHJ A;  4C5G A;  1AOJ A;  2COZ A;  1QVF S;  2EPD A;  1QKX A;  1VQ9 Q;  3OYI A;  2DD4 A;  4J6X A;  1KIK A;  1Q86 R;  5IHN A;  4F7U B;  4A4H A;  2HMA A;  4JS4 A;  2KQW A;  1WX6 A;  4MDX A;  2DTH A;  4A4K A;  2J6K A;  1WJR A;  3OYL A;  3O8V A;  2QA4 A;  1AEY A;  1M1K C;  2A37 A;  4OB0 B;  4L6V 5;  1IXD A;  2QEX T;  2JM9 A;  2O31 A;  3LW5 E;  1YJN T;  1KD1 U;  2BIV A;  4OML A;  2KYB A;  1AVZ C;  2RH2 A;  3V7R A;  4FL6 A;  1G2B A;  4JZ3 A;  3PTA A;  3M56 A;  3VS7 A;  4JRP A;  3CCL A;  6AT1 B;  3FJ5 A;  3P8D A;  3QWX X;  2YWW A;  3CXC S;  1T3S A;  1MMA A;  3OY9 A;  1Y57 A;  5DLQ E;  2EWN A;  4QQG A;  4ZN3 A;  2EIF A;  4YTL A;  3I56 A;  3E19 A;  2XKO C;  2KK4 A;  1D1A A;  1NM7 A;  4DQ2 A;  2BE7 D;  1N8R U;  1W6X A;  5LJ5 g;  4BE2 A;  1M1F A;  1ZUK A;  1GCP A;  3UAT A;  1CKA A;  1W4S A;  2E4H A;  1YBY A;  4OGE A;  1BIA A;  1TOV A;  2HNI A;  1S72 T;  4ZN1 A;  2CZ6 B;  3OYJ A;  2HEQ A;  2OTJ T;  4E7H A;  2K5L A;  2NUZ A;  3LYI A;  1N6A A;  5I11 A;  1I8F A;  4Z8A A;  2QA4 T;  2PNI A;  4QKU A;  1QVF P;  4KGZ B;  1SRM A;  2ZZD A;  2XID A;  4ORZ A;  4C8Q A;  1AWJ A;  5CVI A;  3CMA Q;  4M77 E;  5GAN 2;  5GAN g;  1BKB A;  1VYU A;  3RKX A;  1VQK T;  1W2B S;  3CPW A;  4C0F A;  5GAN 7;  1RLQ C;  3LH5 A;  3M0P A;  3SB2 A;  1K73 R;  2DEQ A;  3OYM A;  2V1R A;  4CC7 A;  1AWW A;  3DLL A;  5KE2 A;  5IHI A;  2F69 A;  1Q7Y C;  3OYE A;  5GAM j;  5IT9 E;  3H0I A;  2HZY A;  4MZM A;  4A53 A;  4EDU A;  2VV5 A;  1VOM A;  2F2X A;  1SHG A;  2QGF B;  1VQP T;  3EH1 A;  3P8B B;  3E9F A;  2GQV A;  1YJW A;  3TQ7 P;  4F7U A;  2W0Z A;  2EJG A;  4M7D D;  3CME A;  1D0X A;  2RQR A;  1VQM T;  3V8J A;  3CCM T;  2PTK A;  1OZ3 A;  5AYF A;  3V8K A;  3CXC P;  4RG2 A;  3JCM X;  5GAO m;  1ACM B;  4N4G A;  2RA2 A;  4A63 B;  4ELY C;  1VQ9 A;  1G3Y A;  2DO3 A;  1KC8 U;  2M1H A;  3UF4 A;  4PJO D;  5DM7 R;  4IUQ A;  1QVF A;  1N27 A;  2DM1 A;  1H92 A;  1A0N B;  4E7S A;  1M1G A;  2LJ1 A;  4IIM A;  4DBF A;  3QG1 A;  2EQJ A;  4PFZ A;  2F2V A;  3RMS A;  4GBQ A;  2ESW A;  1MNE A;  3CCU T;  1UJY A;  3QZ5 B;  3I5S A;  1YJ9 T;  4KGV B;  1RAA B;  2L89 A;  4IIO A;  4MDW A;  2DL5 A;  5KE3 A;  1YI2 T;  3JAM E;  1U1S A;  3MCA B;  1U1T A;  2CP6 A;  4XTZ A;  1JXO A;  3CCS T;  2PVD B;  3VS0 A;  1YJW T;  2P4R A;  2QQ9 A;  4M7A C;  3CME T;  2BZY A;  2MWO A;  2P4T A;  3VYH B;  1IB8 A;  2OJ2 A;  1W2B P;  1QVP A;  2ED0 A;  2LQN A;  1K9M R;  3PNW C;  3OSS C;  4BB7 A;  1GBQ A;  2EAY A;  4DOW A;  1BU1 A;  2PUK B;  1I1J A;  5KH6 A;  1WNL A;  1UGQ B;  1M1K U;  3CXC A;  2JMA A;  4GLK A;  3CCQ Q;  2MCN A;  1IGU A;  2HL3 A;  2EYW A;  2VKN A;  4E6R A;  2FPE A;  1VA7 A;  4ATO A;  4JZ4 A;  2DBM A;  1RUW A;  2JT4 A;  2PU9 B;  1YHQ T;  1QMC A;  3RNJ A;  3LWH A;  2V8K A;  3IQL A;  1MGQ A;  2GBQ A;  2ZCF B;  4PLI A;  4N0A C;  4ZTJ A;  3FB9 A;  3CPF A;  1C1A A;  1G83 A;  3BDU A;  4C92 G;  5GAO q;  3OYK A;  3NTH A;  5I21 A;  1HJD A;  4C92 F;  1T3L A;  4J9E A;  3FEO A;  2XDP A;  3RDV A;  1LPL A;  3CMA A;  4KUD K;  4OMF B;  3OS5 A;  4R55 A;  3V7S A;  4HKE A;  4E2F B;  3JB9 H;  2CZ0 B;  5FRN A;  3C4S A;  5FU6 C;  5C0M A;  1SEM A;  1YIJ T;  1VQ4 Q;  5C6S A;  4EMH A;  4F04 B;  1WPY A;  2DTI A;  2RPN A;  2K9G A;  3HRT A;  4EMG A;  1W2B A;  3H6Z A;  4QVD A;  2FVU A;  4Z89 A;  2KI7 A;  4FM4 B;  1X6B A;  4TVR A;  3SWN B;  4D8K A;  1TUG B;  3I5R A;  5KYN A;  1D3B B;  4CC4 B;  1PRL C;  1MHN A;  2X35 A;  2CUB A;  2DYB A;  2GCX A;  2HQH A;  3CCV Q;  1JBM A;  2E6Z A;  2DL7 A;  2E6N A;  3NPF A;  2R57 A;  2J05 A;  1R77 A;  3AHU A;  1OX8 A;  3EGX B;  3OA6 A;  3LX7 A;  3O5Z A;  1ZQ1 A;  4WTO B;  1Y71 A;  2CP5 A;  2FL7 A;  3E9G A;  3S3M A;  1NPR A;  3CMA T;  1I4K 1;  2KMT A;  2LT1 A;  2A3L A;  3HL8 A;  1B34 B;  2DRM A;  2YUN A;  5A0G A;  2GF7 A;  2CGH A;  4VUB A;  3C12 A;  4EMK C;  3OS0 A;  1UEC A;  5GAN 4;  2X4J A;  3HSB A;  1ZA2 B;  5GAM d;  1B3Q A;  3CBP A;  4FT4 A;  1YFN A;  1EIF A;  5GAM e;  1YWP A;  3E1S A;  4RTV A;  2G6F X;  3M4Y A;  1WYX A;  4II1 A;  2P0Q A;  2XI9 A;  1I81 A;  3EG2 A;  1NYF A;  2COW A;  3MEV A;  3WVE B;  2FZC B;  2ZPB B;  3QO3 A;  2RHX A;  1ZSZ C;  2DVJ A;  5GMK i;  4FSX A;  1UTI A;  4BD3 A;  4KBM B;  1HYO A;  4IUV A;  3SHW A;  1WQ7 A;  1PD0 A;  4M78 C;  4M77 B;  2R58 A;  5GAO n;  2DYI A;  2RQT A;  3A8M B;  2FRY A;  1S1N A;  2EFI A;  2A08 A;  3CCQ A;  4QQ6 A;  4AT1 B;  4LDV A;  5CO7 A;  3CC7 T;  2ECZ A;  2D0Q B;  2M0O A;  3G7Z A;  1C6V X;  4MML A;  1TS9 A;  3I35 A;  2RK2 A;  2CKK A;  5HK3 A;  1PWT A;  2D9T A;  5GAN 8;  1VQ8 T;  3R6O A;  2EW3 A;  1ABO A;  1XJW B;  1E6H A;  4NL3 A;  2IG0 A;  4C92 E;  5IXB A;  1AZG B;  2QEX Q;  3H9N A;  5FLX E;  5GAO l;  1YJN Q;  1QCF A;  2HBP A;  2I0N A;  1LVK A;  2KRO A;  3P8H A;  3SDZ A;  1BIB A;  3RER A;  1FMK A;  3TCJ A;  5M9O A;  1VQ4 A;  4M7A A;  2VXE A;  3PVL A;  1I5O B;  1TXQ A;  1NBE B;  2K57 A;  5GAO p;  2ZPG B;  5D6X A;  4FYY B;  1QWF A;  4M7D G;  3EG9 B;  2KBT A;  4PKC C;  3URG A;  1PSF A;  1QCN A;  2X51 A;  3VUZ A;  1D09 B;  5J39 A;  3S3O A;  4DA4 A;  2X3X D;  2JUF A;  3OB9 A;  3CCV A;  1EFN A;  1WXB A;  1S72 Q;  3UWN A;  4BE0 A;  4PJO G;  1VQ7 T;  2L2P A;  1ZBX A;  1AHJ B;  5GAN 6;  4PJO F;  2QQA A;  3EG0 A;  2JMC A;  1D0Z A;  3OMG A;  2JVV A;  4C8Q D;  2EYY A;  3I55 T;  4MZT A;  3J80 E;  4JDS A;  3JB9 D;  3GIB A;  3VKI A;  1K8A R;  4RTT A;  2KSS A;  2FB7 A;  3JCM g;  2YRC A;  3UDC A;  5KCH A;  3L2V A;  3S3N A;  1M8M A;  1VQK Q;  3PIP A;  4JPB W;  1VQN A;  3M0R A;  3OYD A;  5D6Y A;  2DL3 A;  4F17 A;  2HKN A;  4V2S A;  1BCM A;  1WXT A;  2E12 A;  3H8Z A;  3A8G B;  2D6F A;  4LUE A;  3CCE T;  2DXT A;  1VQP Q;  2KYM A;  1WJQ A;  3L2R A;  3RR6 A;  3ULR B;  3TRE A;  4PJN A;  1VQM Q;  3CCV T;  3HFN A;  2QTX A;  3CCM Q;  4KH1 B;  1AWX A;  3A1P A;  2ZAE A;  4F14 A;  2H3J A;  2P84 A;  3OS2 A;  1BI1 A;  3VS1 A;  1X75 C;  2XDD A;  1OPL A;  3OYG A;  2YDL A;  2GFU A;  1ZLM A;  1WQW A;  4GLM A;  4O5V A;  3M59 A;  3JCM b;  2Y90 A;  1NLO C;  4PL6 A;  4PK4 A;  1NE8 A;  3X28 B;  3CCU Q;  1ZSG A;  1VYV A;  4XTU A;  4PJJ A;  1NJI C;  4ZNX A;  4DEX A;  2QEX A;  1YJ9 Q;  2XHC A;  5LJ3 j;  2DA9 A;  1KQ1 A;  1YJN A;  3CC2 T;  1YI2 Q;  1OZ2 A;  2FG0 A;  4XTX A;  3L1A A;  4F16 A;  4GY5 A;  1TU0 B;  3C94 A;  3CCS Q;  1K9A A;  2IVW A;  3EGD A;  1UGP B;  4ANJ A;  1K1Z A;  4Q5W A;  2MOX A;  4M7D E;  1OQK A;  2F1L A;  1PNJ A;  2LCL A;  3X25 B;  3LGL A;  2XIC A;  3OS1 A;  1Q86 U;  1NEG A;  4E7K A;  4RTY A;  3MET A;  1QKW A;  1OI1 A;  4X34 A;  4LDW A;  2NUT B;  3MEA A;  1LCK A;  1HSQ A;  4J9B A;  4J9F A;  1N9S A;  2L0A A;  1X2K A;  2O9S A;  1S72 A;  2D1X A;  2LTO A;  2OTJ A;  4PJO E;  3WXM B;  5GJV B;  1YHQ Q;  2CT4 A;  3QJ6 A;  4OMN A;  1H3Z A;  2K5I A;  3BE3 A;  5DY9 A;  2YRD A;  3RKY A;  2VVK A;  1MUZ A;  1W1F A;  2DJZ A;  1KK7 A;  3FIF A;  2ZPE B;  4LE9 A;  5CQX A;  4M75 C;  5CKD A;  4JRK A;  1VQK A;  2QK0 A;  1AWO A;  2JTM A;  1YIJ Q;  4JJD A;  2A0F B;  4WF2 A;  3UA6 A;  2QAZ A;  5GAM f;  4MMK A;  1H64 1;  5LJ5 j;  4LD9 K;  2DIQ A;  1UB4 A;  1T0H A;  2M9U A;  3KBG A;  3OW2 S;  1VQP A;  4NL2 A;  1IZ6 A;  4C92 B;  4M78 F;  4XTW A;  4HT9 A;  4BAC A;  3J7A F;  1QW1 A;  2HBW A;  1M27 C;  1VQM A;  4UC4 A;  1G3T A;  2HQX A;  3CCM A;  1H3H A;  4E7Z A;  2J6F A;  5GAM h;  1AD5 A;  2C0I A;  5I2S A;  4X1V A;  2VC8 A;  3M57 A;  1VQL T;  2O88 A;  2DIL A;  3WVD B;  5GAN j;  4LDU A;  2D8H A;  1I07 A;  3RUX A;  1Z9Q A;  1N8R R;  4HCC A;  1QCO A;  5GAN 5;  1BI2 A;  2DXU A;  5HCK A;  2ENM A;  5CCA A;  1TG0 A;  4QQD A;  1V29 B;  2YUP A;  3UPU A;  1Z9Z A;  1K73 U;  1Q81 R;  2L3R A;  1N5Z A;  3CCU A;  2ABL A;  3NHN A;  2DL8 A;  1VUB A;  1YJ9 A;  1BK2 A;  4C5E A;  1YI2 A;  1YP5 A;  1QQJ A;  2XU8 A;  3CCS A;  1V76 A;  2NUT A;  4JS5 A;  2QG9 B;  3CCR T;  1Q82 C;  4M75 B;  2JXB A;  2RK1 A;  2AK5 A;  2WSE E;  3A8L B;  3HRU A;  1OX9 A;  2QGG A;  4IUT A;  1OYX A;  2XK0 A;  1I0C A;  2WAC A;  3M4G A;  1EX4 A;  1XNI A;  1M30 A;  3QPH A;  3EHR A;  3ASK A;  1NJI U;  1XOV A;  4E7J A;  2BKD N;  3OW2 P;  3CC7 Q;  4OMP A;  2EKH A;  2RJD A;  1OU8 A;  3RIR A;  3R6N A;  4C8Q G;  1YHQ A;  4HVU A;  1OV3 A;  4C8Q F;  1TH7 A;  1VQ8 Q;  3JB9 G;  3A98 A;  1WXU A;  1WHL A;  4LD6 A;  5LJ3 d;  3JB9 F;  1X2Q A;  2MWP A;  5LJ3 e;  4Z02 A;  2I2L A;  3H0H A;  1JB0 E;  1WHG A;  3SWN C;  1RAB B;  3G4S T;  3MKD A;  2WSC E;  2OX7 A;  3GF5 A;  1M3C A;  1YIJ A;  4M7A D;  1M5Q 1;  3M0Q A;  1K9M U;  1Y07 A;  4ZGJ B;  2IIM A;  2MAM A;  2RQW A;  1Y96 B;  4F7U G;  1WIE A;  4RTX A;  4RTU A;  1FMW A;  4F7U F;  2ZPI B;  1KHC A;  3OYF A;  3JCM V;  3G71 T;  2RF0 A;  4BI4 A;  3THK A;  4QW2 A;  1FXX A;  2HSE B;  2OTL T;  2CZ1 B;  2M0Y A;  5L23 A;  2ROT A;  3OW2 A;  3PMI A;  1QVG P;  5A2Q E;  1NYG A;  4PNO A;  2O2O A;  3H0F A;  4OB3 B;  4DEY A;  3GPL A;  1VQ7 Q;  2DLP A;  4MZP A;  4QVZ A;  3A8H B;  4PFP A;  5IAY A;  2K7A A;  2K6D A;  4XQ3 A;  4J9C A;  3MPU B;  3T9N A;  1M1K R;  2LT4 A;  4XAX B;  2CZ7 B;  3I55 Q;  4M7D B;  3QXE B;  2AKL A;  3A8O B;  3CC4 T;  1YIT T;  2QDL A;  1VQ5 T;  3GOX A;  4AFU C;  3CQT A;  1WGS A;  4M75 A;  3VS2 A;  2VWF A;  3S6W A;  2D8J A;  2EBP A;  1LOJ A;  4J9H A;  5LJ5 d;  4M77 C;  5LJ5 e;  3KUF A;  3ZBD A;  3SEM A;  4LDY A;  3PE0 A;  1FWZ A;  2PQW A;  1X01 A;  2LMJ A;  1UUE A;  2CH4 A;  2C06 A;  1UHF A;  3CCE Q;  4AFQ C;  1LJO A;  3OSV A;  4JLI A;  1RI9 A;  3NMZ C;  5I22 A;  2IPO B;  2YT6 A;  4C5I A;  2NYS A;  1UFF A;  1TSF A;  5GAN d;  2DAQ A;  5GAN e;  2DXB A;  2DRK A;  1WLP B;  1GFD A;  3JCM P;  1BB9 A;  4FT2 A;  4OP0 A;  2YUQ A;  5LL6 S;  3V7C A;  2FEI A;  1FMV A;  2EYQ A;  2X9H A;  5KYW B;  3CC7 A;  3HKS A;  2C0T A;  2D0N A;  3M0T A;  4WCI A;  2KT8 A;  4C8Q E;  3EFS A;  2W10 A;  3Q1J A;  3ZL7 C;  5GMK j;  2KGT A;  1Q82 U;  1RAH B;  1VQ8 A;  1Y96 A;  4FW1 A;  4LXC A;  1QLY A;  4HXJ A;  5CIU A;  2CYZ B;  2BTT A;  4O6J A;  1D0Y A;  1BBZ A;  1PM3 A;  2A36 A;  2O01 E;  1Q7Y R;  1B7T A;  2LNV A;  4KUL A;  2VGM A;  4X9D A;  3CC2 Q;  3OYH A;  5ECA A;  2E10 A;  2KR3 A;  3U23 A;  1KQ2 A;  2LNH B;  1M90 R;  5CK9 A;  4DBH A;  3RBB B;  2JS0 A;  3EFR A;  1RI0 A;  1JJ2 S;  4M78 D;  3L2Q A;  4F7U E;  3MP6 A;  4JJB A;  2DZC A;  5KYX B;  2M16 A;  2QYZ A;  4N4I A;  1M3A A;  4E7L A;  2RJF A;  1MND A;  5IH2 A;  3DB3 A;  4M7D A;  2COY A;  2SRC A;  1M2O A;  4IKF A;  4FU6 A;  1T0J A;  1B07 A;  1VQ7 A;  3G1J A;  5FWB A;  4PFO A;  4Z88 A;  1OEB A;  1JU5 C;  1Q86 C;  1VQ6 Q;  1GBR A;  4FIB A;  4PLL A;  1WZO A;  1TWB A;  3I55 A;  2R5A A;  2V1Q A;  1X6O A;  2MYS A;  2AHJ B;  1ABQ A;  3SWN A;  4JLG A;  3BW1 A;  1G3W A;  4RTW A;  2RMO A;  4XU3 A;  4C5H A;  1D3B A;  2CS7 A;  2DD5 A;  4NOY A;  1YCS B;  5GAO r;  2HAX A;  3J81 E;  3BY7 A;  2XMF A;  3PMT A;  5L8R E;  1ZHI A;  1M2V B;  1YWO A;  3DLM A;  3EGX A;  1PC0 A;  2FZK B;  2Y4X A;  4N4H A;  3CCE A;  3CCJ T;  1M3B A;  1BI3 A;  4AFZ C;  5KYW A;  2FPF A;  2O4X B;  1I5L A;  3MHX A;  3TSW A;  5CKE A;  1H8K A;  5I2M A;  2AZS A;  4CC2 A;  2A28 A;  3NFC A;  1B34 A;  2RHZ A;  4RCC A;  2K79 A;  2MPX C;  2P0K A;  3M5A A;  2MIO A;  1ZUY A;  1JJ2 P;  3INZ A;  1VQL Q;  2JS2 A;  2RHU A;  3JCM J;  1HD3 A;  3VS3 A;  3SFM A;  1X43 A;  4X9C A;  2RJC A;  4OB1 B;  3EGU A;  3QYH B;  1K8A U;  1OOT A;  2FZG B;  3QUI A;  3OBW A;  3X20 B;  4LUD A;  3ZFJ A;  2YLB A;  4C0Z A;  1QP2 A;  2DPP B;  4RTZ A;  4FW2 A;  5FRO A;  1P92 A;  3OQ5 A;  4M77 A;  4J6W A;  5LJ3 f;  2RO0 A;  3CBM A;  5KYX A;  2KT1 A;  2K5F A;  4M7A G;  2EQK A;  2DNU A;  2AZV A;  4ELZ C;  3CC2 A;  1GFC A;  4M7A F;  4OMM A;  2LCC A;  4BI8 B;  1K76 A;  2LQ8 A;  1K73 C;  1KJW A;  3EFO B;  2K2V A;  3CCR Q;  4IUR A;  3L42 A;  3M0U A;  3M53 A;  2X4W A;  5LJ3 h;  2XG8 D;  4FYW B;  2CSI A;  3VS6 A;  4PJL A;  4AMC A;  3JV3 A;  3LGF A;  2EYX A;  2VAS A;  1JJ2 A;  3QBY A;  3CD6 T;  1XTD A;  2ZPH B;  2EGE A;  1VQO T;  1IGQ A;  2WSF E;  4JRI A;  3QDR B;  3TSZ A;  3VS5 A;  1IRX A;  3C95 A;  2E5Q A;  2QQR A;  5HKC A;  4QT7 A;  2CSQ A;  1U3O A;  4IUP A;  1UEB A;  2X4X A;  3UT1 A;  1M2V A;  1VQ6 A;  2DL4 A;  2DER A;  1VIE A;  3EG9 A;  2DF6 A;  5KYY B;  2VB6 A;  1MMG A;  3OMC A;  5A0L A;  1RL2 A;  3PGG A;  4R56 A;  4OF1 A;  3OBY A;  3G4S Q;  4C92 C;  2JM8 A;  2M51 A;  4A4F A;  4J9G A;  4JUV A;  1GL5 A;  1CKB A;  1PKS A;  1SF9 A;  2J06 A;  5EG2 A;  1RAC B;  3L2U A;  4CC3 A;  5LJ5 f;  2X4Y A;  1WFW A;  4A4E A;  3GP8 A;  1PD1 A;  3JCM W;  1WHH A;  1RAG B;  5D7U A;  1U06 A;  2K3X A;  4C8Q B;  4FCY A;  1MMD A;  3G71 Q;  3OYY A;  2HQE A;  4E47 A;  2F5K A;  2GGR A;  2DZ9 A;  1O75 A;  4JJC A;  3REB B;  3M54 A;  2OTL Q;  4LNP A;  1K9M C;  5LJ5 h;  2EQI A;  1SSF A;  1NZ9 A;  2J7I A;  4KRT A;  3MP8 A;  5GAN f;  2RI3 A;  3MO8 A;  2E1H A;  3SD4 A;  3FC3 A;  1GXI E;  1VQL A;  4C0G A;  1R8O B;  3KXT A;  1GRI A;  1VQ6 T;  2DBK A;  4HCB A;  3MEU A;  2QI2 A; 
#chains in the Genus database with same CATH homology
 4HVU A;  1OV3 A;  5FWC A;  3A98 A;  1WXU A;  2C0O A;  1X2Q A;  2DRM A;  2YUN A;  1CSK A;  3H0H A;  1UEC A;  1QWE A;  2CT3 A;  1B3Q A;  1M3C A;  1YWP A;  1X69 A;  4RTV A;  2G6F X;  2HDA A;  1WYX A;  3EHQ A;  2CH4 W;  3M0Q A;  2LJ0 A;  3EG2 A;  1ZBJ A;  1NYF A;  2IIM A;  1SPK A;  2ED1 A;  2RQW A;  2KXD A;  1WIE A;  1WI7 A;  2DVJ A;  4RTX A;  1PRM C;  2K2M A;  1J3T A;  4RTU A;  1UTI A;  1TUC A;  3SHW A;  4HVV A;  2KEA A;  2RF0 A;  3THK A;  2B86 A;  2FO0 A;  2RQT A;  2FRY A;  1S1N A;  2FRW A;  2KE9 A;  4FSS A;  2HCK A;  2M0Y A;  3REA B;  5L23 A;  2ROT A;  2A08 A;  3VRZ A;  1NYG A;  2NWM A;  2O2O A;  2X3W D;  3H0F A;  2KXC A;  4DEY A;  2DLP A;  2ECZ A;  2GNC A;  2K7A A;  2K6D A;  2KRS A;  2ROL A;  4J9C A;  2LCS A;  2RNA A;  1PHT A;  2HSP A;  3I35 A;  4LN2 A;  1PWT A;  3I9Q A;  2SEM A;  2EW3 A;  2AKL A;  2JW4 A;  1ABO A;  1ZX6 A;  2QDL A;  1E6H A;  4R0K A;  1UE9 A;  4J9D A;  4AFU C;  3CQT A;  5IXB A;  3M0S A;  4RUG A;  3VS2 A;  2VWF A;  2D8J A;  2EBP A;  1AZG B;  4J9H A;  1VYT A;  2BZX A;  1QCF A;  2I0N A;  2KRO A;  3SEM A;  3PE0 A;  1FMK A;  5FW9 A;  2KRM A;  3PVL A;  2PZ1 A;  1GCQ A;  2LMJ A;  2O9V A;  1JQQ A;  2AKK A;  2LX7 A;  1UUE A;  2CH4 A;  1UHF A;  3VRY A;  1KFZ A;  1RLP C;  2JTE A;  2FPD A;  4AFQ C;  5EC7 A;  1QWF A;  3H41 A;  1RI9 A;  3NMZ C;  2OI3 A;  2CUD A;  2F2W A;  1WA7 A;  5I22 A;  2KBT A;  1K0S A;  2YSQ A;  2YT6 A;  5IHK A;  1UFF A;  2OAW A;  1ARK A;  1AOJ A;  4AFS C;  2DRK A;  2X3X D;  2H8H A;  1WLP B;  1GFD A;  2EPD A;  1QKX A;  1BB9 A;  2E5K A;  1EFN A;  2YUQ A;  1WXB A;  4AG2 C;  1KIK A;  2FEI A;  2L2P A;  1E6G A;  5IHN A;  1UHC A;  2C0T A;  2D0N A;  4K11 A;  2LJ3 A;  3M0T A;  4WCI A;  3EG0 A;  2JMC A;  1WX6 A;  2KT8 A;  2BZ8 A;  2EYY A;  2W10 A;  3ZL7 C;  2KGT A;  2J6K A;  1AEY A;  1QLY A;  1JO8 A;  4HXJ A;  2A37 A;  4RTT A;  2BTT A;  1BBZ A;  1M8M A;  5IXF A;  2A36 A;  3NGP A;  2JM9 A;  2O31 A;  4JPB W;  2DMO A;  1SRL A;  3M0R A;  2DL3 A;  4F17 A;  5ECA A;  4OML A;  2KYB A;  1AVZ C;  4JZ3 A;  1G2B A;  1WDX A;  3VS7 A;  1K0X A;  2KR3 A;  3U23 A;  3FJ5 A;  1X6G A;  3QWX X;  2LNH B;  3KFV A;  2DX1 A;  3RBB B;  1WXT A;  2JS0 A;  1T3S A;  3EG1 A;  4LUE A;  4OMO A;  1NG2 A;  2KYM A;  1E7O A;  2RQV A;  1Y57 A;  4EIK A;  2KNB B;  4JJB A;  2EYZ A;  3ULR B;  2LP5 A;  2GTO A;  5GJW B;  4AG1 C;  1IO6 A;  1NM7 A;  1M3A A;  1NEB A;  1AWX A;  1W6X A;  5IH2 A;  1ZUK A;  2SRC A;  1GCP A;  3UAT A;  1CKA A;  2EGC A;  4F14 A;  1TUD A;  1SSH A;  1T0J A;  1B07 A;  2HEQ A;  3VS1 A;  4M4Z A;  1MV0 B;  2NUZ A;  5I11 A;  1UG1 A;  4Z8A A;  5FWB A;  4Z88 A;  1OPL A;  2YDL A;  1OEB A;  1JU5 C;  2PNI A;  1GBR A;  1SRM A;  1ZLM A;  4GLM A;  4ORZ A;  1AWJ A;  2V1Q A;  1NLO C;  1ABQ A;  1ZSG A;  1VYV A;  4RTW A;  1VYU A;  2RMO A;  4ZNX A;  4DEX A;  4D8D A;  1RLQ C;  3LH5 A;  3M0P A;  1YCS B;  1UDL A;  2DA9 A;  2FG0 A;  4F16 A;  2V1R A;  4CC7 A;  1K9A A;  2XMF A;  1AWW A;  5IHI A;  1YWO A;  1K1Z A;  1UGV A;  3H0I A;  2DE0 X;  1K4U S;  2L3Q A;  2L3P A;  1MV3 A;  2F2X A;  1SHG A;  4ESR A;  1M3B A;  4AFZ C;  2FPF A;  2MOX A;  3TSW A;  2W0Z A;  1H8K A;  1PNJ A;  1FYN A;  2AZS A;  2RQR A;  4CC2 A;  2A28 A;  1NEG A;  2PTK A;  1QKW A;  2K79 A;  2MIO A;  1LCK A;  1ZUY A;  1JXM A;  2KRN A;  4A63 B;  1HSQ A;  2JS2 A;  4J9B A;  1YN8 A;  4J9F A;  2L0A A;  3UF4 A;  1X2K A;  1HD3 A;  2O9S A;  2D1X A;  5GJV B;  3VS3 A;  1X43 A;  2CT4 A;  4OMN A;  3EG3 A;  3EGU A;  2DM1 A;  1H92 A;  1OOT A;  1A0N B;  1SHF A;  2VVK A;  1MUZ A;  2LJ1 A;  4IIM A;  1W1F A;  4LUD A;  2F2V A;  4GBQ A;  3VS4 A;  2ESW A;  1OPK A;  4RTZ A;  4LE9 A;  1UJY A;  1U5S A;  1NLP C;  2EGA A;  3I5S A;  1AWO A;  2KT1 A;  2DNU A;  4IIO A;  2AZV A;  2DL5 A;  4JJD A;  3UA6 A;  1GFC A;  4OMM A;  1JXO A;  1ZUU A;  1K76 A;  3VS0 A;  1AZE A;  2P4R A;  2LZ6 B;  1W70 A;  1KJW A;  1T0H A;  1GCQ C;  2BZY A;  2OJ2 A;  2RN8 A;  4J9I A;  3M0U A;  2ED0 A;  2LQN A;  2YUO A;  1GBQ A;  2CSI A;  1BU1 A;  3VS6 A;  2HBW A;  1I1J A;  1M27 C;  3JV3 A;  2EYX A;  1H3H A;  2EVR A;  2J6F A;  2J6O A;  2JMA A;  1AD5 A;  2MCN A;  2C0I A;  2EYW A;  2VKN A;  4E6R A;  4X1V A;  2FPE A;  2O88 A;  2DIL A;  2EGE A;  2CRE A;  2K3B A;  1VA7 A;  4JZ4 A;  2DBM A;  3TSZ A;  3VS5 A;  1RUW A;  2JT4 A;  2D8H A;  1YNZ A;  1I07 A;  3RNJ A;  4QT7 A;  2CSQ A;  1U3O A;  1Z9Q A;  3IQL A;  1Y0M A;  2GBQ A;  5HCK A;  2ENM A;  1G83 A;  2DL4 A;  1PKT A;  1KSW A;  3C0C A;  1TG0 A;  2L3S A;  2YUP A;  2DF6 A;  1Z9Z A;  1HJD A;  1T3L A;  4J9E A;  4HVW A;  1N5Z A;  3UA7 A;  2ABL A;  3NHN A;  2DL8 A;  2JM8 A;  2M51 A;  4J9G A;  1V1C A;  1GL5 A;  1SEM A;  1BK2 A;  1CKB A;  1PKS A;  2J06 A;  1YP5 A;  2CDT A;  4CC3 A;  1JEG A;  1WFW A;  2RPN A;  2DJQ A;  1UJ0 A;  2K9G A;  3QWY A;  1U06 A;  4Y92 A;  2JXB A;  3GBQ A;  4Z89 A;  2AK5 A;  1X6B A;  4HCK A;  2GGR A;  4D8K A;  3I5R A;  1I0C A;  4JJC A;  3REB B;  4CC4 B;  1PRL C;  4LNP A;  2CUB A;  2DYB A;  1M30 A;  2EQI A;  2J7I A;  3EHR A;  2GQI A;  2DL7 A;  1XOV A;  4KRT A;  3NPF A;  2RQU A;  2GTJ A;  1X27 A;  2J05 A;  4OMP A;  3PVQ A;  2EKH A;  1GRI A;  2DBK A;  4OMQ A;  3TVT A;  3R6N A;  3O5Z A;  4RTY A;  2LQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...