1RI9A

Structure of a helically extended sh3 domain of the t cell adapter protein adap
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
EKEEKDFRKKFKYDGEIRVLYSTKVTTSITSKKWGTRDLQVKPGESLEVIQTTDDTKVLCRNEEGKYGYVLRSYLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords FYN-binding protein
publication title Structure of a Helically Extended SH3 Domain of the T Cell Adapter Protein ADAP.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2003-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ri9A00
1SRLA 2ENMA 4CC2A 3TSWA 4ESRA 3NPFA 4M4ZA 2RQTA 1T0JA 2CSQA 3QWYA 2W10A 3LH5A 2DJQA 1W1FA 2DILA 3H0IA 1K9AA 3I9QA 4D8KA 2BZYA 2EQIA 1W6XA 2J06A 1YWOA 2L3QA 2D8HA 1AVZC 3EHQA 1GL5A 1SHFA 1AZEA 2C0TA 1WXTA 3H0FA 1ZBJA 2FG0A 2OJ2A 2O9VA 2K7AA 1OEBA 3CQTA 4RTUA 1M3CA 5FW9A 2PTKA 1X43A 1SHGA 4FSSA 3C0CA 2EKHA 1K4US 1GFDA 4OMMA 4RTWA 2FO0A 1QKXA 2KYMA 1T0HA 3H0HA 4LNPA 1JXOA 2EGCA 1OOTA 4Z8AA 1MV3A 1AWWA 2V1RA 1NEGA 1PNJA 1YN8A 4AFUC 1QWEA 3VS3A 1KJWA 2YDLA 1FYNA 1U3OA 1WDXA 1ZX6A 4OMLA 3VS0A 3VS4A 1V1CA 2FPEA 4J9CA 1UG1A 4GBQA 2A37A 1NYGA 1E7OA 4R0KA 2ED0A 4LN2A 4Z89A 4F16A 3TSZA 1QKWA 1M3AA 1NLOC 2V1QA 2DL8A 1BK2A 4HCKA 3NMZC 2CUDA 2EW3A 2K6DA 2D0NA 3REBB 1KSWA 2GTJA 2LJ3A 2PZ1A 3VS5A 1TUDA 2DRKA 4CC3A 1GFCA 2BZ8A 2F2VA 4J9BA 1YNZA 2J7IA 4HVUA 1X6GA 2MIOA 1H8KA 1ZUUA 2CT4A 2YUQA 2RPNA 4JJCA 2FPFA 2KT1A 2JM9A 5ECAA 1YWPA 2LZ6B 1CKAA 1UHCA 4RTTA 1E6HA 3EG0A 4GLMA 4JZ3A 2C0OA 4AG2C 1Y57A 3IQLA 3PVLA 1WFWA 3EGUA 3M0PA 1PKTA 3M0UA 1SRMA 1NG2A 3UA6A 1GCQC 5I11A 2JS0A 1AOJA 2HSPA 4OMOA 2K9GA 2A08A 1LCKA 1X6BA 1ZUKA 2KRNA 5IHNA 1KFZA 1RLQC 2K2MA 1PKSA 4RTYA 1RUWA 2O88A 1G83A 1CKBA 1QWFA 1SPKA 1A0NB 4CC4B 2LNHB 1AWXA 1GCQA 2KXCA 2J6FA 1QCFA 1M27C 2JM8A 2PNIA 2XMFA 2J05A 4RTXA 1X27A 2DL3A 1Y0MA 5EC7A 3THKA 2VKNA 2EYZA 1GCPA 2VVKA 2CUBA 2DRMA 5FWBA 2KT8A 1TG0A 1AEYA 2L3SA 1OPKA 1MV0B 2M51A 1S1NA 3ULRB 4AFSC 2FRYA 2LMJA 1BBZA 5IXFA 1WXBA 2SEMA 2AZSA 3KFVA 2O31A 2D1XA 2CT3A 4J9IA 1I0CA 3GBQA 1X2QA 2RN8A 1ZUYA 2AZVA 1UHFA 3VRZA 1M8MA 1JEGA 1UFFA 1GBRA 4Z88A 2O9SA 2CDTA 1SEMA 2GNCA 1AZGB 4JJDA 1JXMA 2JT4A 1YP5A 3JV3A 1JO8A 1OPLA 1VA7A 2EGAA 2DBMA 2LJ1A 4AFZC 2G6FX 4QT7A 2YUNA 5FWCA 4A63B 1VYVA 1NM7A 2DL5A 3PE0A 4LUEA 4OMQA 5GJWB 1I07A 2BTTA 1M3BA 1VYUA 1HJDA 2O2OA 2L0AA 2E5KA 2YT6A 4OMPA 3NGPA 2RQVA 1KIKA 3VS7A 2A28A 1RI9A 2ROTA 1WIEA 2X3XD 2HEQA 2JMCA 3A98A 4OMNA 2KGTA 1UDLA 2A36A 2M0YA 1Z9ZA 2HDAA 3UF4A 1HD3A 4DEYA 1BB9A 3EG2A 2F2WA 2JMAA 1HSQA 2DYBA 1WXUA 2ROLA 2DLPA 2H8HA 1I1JA 2YUOA 1IO6A 3H41A 1GRIA 4JJBA 5IXBA 4D8DA 3I5RA 2JS2A 1E6GA 2J6OA 1ABOA 2VWFA 2DF6A 2X3WD 2AKKA 4RTVA 1XOVA 1J3TA 2JTEA 1B07A 1ABQA 4JZ4A 1RLPC 2EYWA 2RQUA 2MCNA 2DL4A 3NHNA 1K1ZA 1X69A 3VS6A 1K76A 1JU5C 4J9DA 4DEXA 2SRCA 1VYTA 2DMOA 4Y92A 2NUZA 2DNUA 4JPBW 3SHWA 2J6KA 4IIMA 2AK5A 2EBPA 2P4RA 1FMKA 3RBBB 2ED1A 1B3QA 3VS1A 1BU1A 2RNAA 1PWTA 2B86A 2JW4A 1ARKA 1N5ZA 3R6NA 3UATA 2LP5A 1NEBA 3M0TA 3VRYA 1UTIA 4F14A 2DE0X 2I0NA 2RQRA 5HCKA 1WLPB 2CREA 3SEMA 1PRLC 2RQWA 3ZL7C 1GBQA 2GGRA 1W70A 2JXBA 1UGVA 1UECA 2FEIA 1H3HA 4X1VA 1X2KA 1UJ0A 1CSKA 4KRTA 2KRMA 2W0ZA 1H92A 4J9GA 5IH2A 4AFQC 1NYFA 2KYBA 1AWOA 4HVWA 4LE9A 1UJYA 2KR3A 3M0SA 3VS2A 2KNBB 2OAWA 2HBWA 4J9EA 2LCSA 2DA9A 3FJ5A 2MOXA 1K0XA 4HXJA 2CH4W 2ECZA 5GJVB 1YCSB 1ZSGA 1TUCA 4J9HA 2KRSA 3I5SA 4E6RA 1U06A 4CC7A 3O5ZA 2YSQA 2EVRA 2GBQA 2ABLA 1AWJA 4ORZA 4RUGA 1EFNA 2DM1A 2RF0A 3RNJA 1MUZA 2KROA 1U5SA 3U23A 1Z9QA 2C0IA 2DVJA 2YUPA 3REAB 2LJ0A 4J9FA 1ZLMA 1T3LA 5L23A 2HCKA 1OV3A 2KEAA 2K3BA 2OI3A 2DBKA 3EG1A 4RTZA 2LQWA 4ZNXA 3EG3A 1AD5A 1G2BA 2KE9A 2KXDA 2CSIA 4EIKA 2CH4A 2F2XA 4HVVA 2EYXA 2K79A 4WCIA 2GQIA 3M0QA 2EPDA 1WA7A 1WX6A 2FRWA 2AKLA 1UUEA 2DX1A 2LX7A 2GTOA 2NWMA 2QDLA 2EGEA 1SSHA 1PHTA 3QWXX 2EYYA 2L3PA 2D8JA 2KBTA 2RMOA 1QLYA 2LQNA 3EHRA 4IIOA 3TVTA 3M0RA 1JQQA 4LUDA 4F17A 5I22A 4AG1C 2ESWA 2DL7A 2IIMA 3PVQA 1WI7A 2BZXA 4K11A 5IHIA 1T3SA 1UE9A 5IHKA 1M30A 1NLPC 2L2PA 1WYXA 1PRMC 3I35A 1K0SA 2FPDA 3UA7A
chains in the Genus database with same CATH superfamily
3FDRA 1VQ4Q 1TUGB 4C0DC 4CC2A 2HBPA 2CSQA 1VQ7T 3QWYA 3M56A 2JTFA 2NUPB 1N27A 2DJQA 1W1FA 2DILA 1WPYA 1JBMA 1YJNQ 2EJ9A 2DTHA 2D9TA 1SG5A 4DBFA 2A7YA 1VQOT 2L3QA 3CCJQ 4J5YA 1GL5A 2YRDA 2C0TA 4ZTJA 4LDYA 2OJ2A 1Y7XA 4MZPA 2K7AA 2AHJB 1G8XA 4RTUA 2RH2A 3L2VA 5GAMh 1VQNA 2IPOB 4OMMA 3CC2Q 2FO0A 3O8VA 4BI3A 5CQYA 3H0HA 4FT4A 4LNPA 3PMIA 2K5LA 2MMPA 2RHUA 4E7ZA 3SFMA 1D3BB 1Q81R 4Z8AA 1BYMA 2V1RA 1NEGA 1IZ6A 5KYWA 1EIFA 3CCEA 3CD6A 2NUTA 2MWPA 4JLIA 4OVAA 3RKYA 4AMCA 3EGDA 1D0YA 3VS0A 2FZGB 4ZGJB 2QQAA 1V1CA 4J9CA 3OYKA 2A37A 2QEXQ 1E7OA 4R0KA 1NPPA 1YIJQ 3EH2A 4Z89A 1M3AA 2V1QA 3X20B 2EW3A 3I55Q 1M2OA 4XK8E 3REBB 2OTLA 5IN1A 1TOVA 3QBYA 1YJWA 2DJZA 4FM4B 3OMCA 4J9BA 3BDLA 4C5EA 5GAOq 3QHSA 2WSCE 4RMOA 3L2ZA 4C8QE 4JJCA 5D6YA 2FPFA 2ZCFB 2KT1A 4FW2A 2JM9A 1V76A 5ECAA 3ASKA 3RR6A 1QCNA 2LZ6B 1VQMQ 1H3ZA 4HCCA 4JZ3A 3PIOA 2C0OA 5LJ5d 4PJJA 4AG2C 3G7ZA 2GCXA 2QGFB 3L2QA 4C92B 1PKTA 3JCMc 5FRNA 4LDXA 3CXCS 4IUTA 1GCQC 2X9HA 4KBMB 4E7HA 1AOJA 2HSPA 1G3WA 4EPCA 1WHGA 1VQLT 4BUGA 5KYNA 2K2MA 3CPWP 1TSFA 4DOWA 2X51A 1SPKA 1UGQB 2CKKA 1GXIE 4O5VA 2LNHB 1AWXA 1PD1A 1RAFB 4RG2A 4IUUA 4M75B 3T9NA 4B6MA 2J6FA 4DQ2A 1TU0B 4C0ZA 1KK7A 1VQ7A 2JM8A 3RMQA 5GMKi 2XMFA 4FCYA 4JJNK 2GFUA 2EYQA 2VKNA 1Q81U 3V7CA 2CUBA 4FL6A 4HT9A 1B34A 2FZKB 3CCUT 1MV0B 1VQOA 2CZ7B 1S1NA 4MDWA 2CP0A 1WHLA 1BBZA 1I5OB 3JB9F 3EAEA 2O31A 2CT3A 3PFSA 4J9IA 1I0CA 3CCSA 1BCMA 4E7JA 2XI9A 4EMGA 4OMFB 1BI2A 3OW2P 1AZGB 1JXMA 3JV3A 5FRMA 1OPLA 4FYVB 5CKDA 4PJOG 1YITT 1WHHA 2CS7A 3OYMA 1N9RA 5FWCA 1XNIA 1NM7A 4OMQA 5GJWB 1I07A 1ZSZC 1Q7YR 1JB0E 3HRTA 2BTTA 5D6WA 4PLLA 3X25B 4C8QB 3OYDA 2YT6A 4OMPA 2RHYA 5FU6C 1VIEA 3ZEHA 4ATOA 3NTHA 1VQ6Q 2A36A 4N4IA 2X4JA 2PVOB 3CMAA 3UF4A 3HFNA 3E9FA 4M77B 2FB7A 2JMAA 1HSQA 2DYBA 1LPLA 4XTZA 2VGMA 1MNEA 3QXEB 5GMKm 2JN0A 2DF6A 4RTVA 1XOVA 1J3TA 2ZPGB 3PGGA 1JJ2P 1ABQA 5GAN4 2EYWA 2MCNA 3OYNA 1K76A 2MF2A 4MMLA 4DEXA 3H9NA 1YHQT 1QVGP 3EGXA 2XK0A 2DNUA 2J6KA 4M7AB 2P4RA 4LDWA 2ED1A 4M7DC 3VS1A 1PWTA 2JW4A 1D1CA 4NOYA 3UATA 5GAMg 1QP3A 2DXTA 1K8AR 3H6ZA 5J3BA 1AHJB 4F14A 1G3YA 5KE3A 1BCOA 2CP3A 2RQRA 2V8KA 5HCKA 3SWNB 3CEYA 4C92D 2KI7A 3MP8A 2CREA 5CKEA 5GAMf 3HPWA 3MEWA 1KC8R 2RQWA 1BIBA 3ZL7C 1YI2Q 3CCUA 1Q82R 2DTIA 2ZGWA 1UECA 5GAOr 2FEIA 4X1VA 1Q7YU 1DJ7B 1IHWA 4KRTA 3EFSA 1WJQA 2RD1A 2MYSA 1H92A 3G71Q 4J9GA 3G4ST 2BIVA 4J83A 5KYUB 1S72T 4J6YA 2LCSA 3GLXA 1YITA 4L5GA 1I8FA 5GAMe 1MHNA 2DVEA 1TUCA 3CC7T 3UDCA 3E19A 4E6RA 3BW1A 5KYXB 1Q95G 2YSQA 3MHXA 3LYIA 3I56Q 4BDZA 1QVFA 1R77A 4C92G 2E5QA 2GF7A 2H3EB 2F69A 4BE1A 2KROA 1M1KC 1ZSZA 2C0IA 1SF9A 2ATCB 5FU7B 3V7SA 1RAHB 2RB6A 1T3LA 1YBYA 2K3BA 1RAEB 2OX7A 5I2MA 3EG1A 4RCCA 4ZNXA 1G2BA 2DAQA 4II1A 5GAMj 1QCOA 2X4XA 4HVVA 4LD9K 5M9OA 2KAFA 4KGXB 2EQMA 2EYXA 1C6VX 2GQIA 3M0QA 1VQPQ 1TS9A 1K8AU 2K5FA 4UC4A 4C8QD 2FRWA 2AKLA 2E10A 2CZ0B 2DX1A 2GTOA 2QDLA 3M58A 4JS4A 1H641 1SSHA 5CVIA 2QQ9A 1PHTA 2EIFA 1KC8U 2DXBA 1KQSA 3S6WA 2D8JA 2IG0A 5LJ3j 2KBTA 2RMOA 1Q82U 1YHQA 1M2VA 4HKEA 2HL5C 3TVTA 4PL6A 3DB4A 4F7UB 5A2QE 3CCEQ 4ME7A 2YXYA 1W2BP 1Y07A 3I35A 4KUIA 1FMVA 2IVWA 4ESRA 3NPFA 2RQTA 1T0JA 2MK5A 4PJOF 4EMKA 4MDXA 2OTLQ 2W10A 3LGLA 3HL8A 3LH5A 2DZ9A 2Z0WA 4IUPA 1FX7A 3URGA 1W6XA 4C8QG 4QVCA 2G3RA 3EHQA 1SHFA 3HRUA 3P8BB 1WXTA 3CPFA 3WVDB 4NS5A 3MCAB 3G4SA 1KHIA 1LOJA 2O4XA 1OEBA 3A8HB 1S72A 2PTKA 4X9DA 3EG9A 4FSSA 2NLUA 1K4US 5LL6S 2M0OA 1M1FA 2DXUA 1JXOA 1QVFS 3CD6T 4DBHA 1WJSA 1OOTA 3CC7A 4JLGA 1MV3A 3RKXA 2RJFA 3OYLA 1YN8A 1TXQA 1QWEA 2F5KA 9ATCB 1RL2A 1U3OA 1WDXA 4N0AA 4OMLA 1VQKT 3KXTA 2FPEA 4KUDK 1BI3A 1NYGA 4QKUA 1W2BS 4F16A 1G3SA 1QKWA 1NLOC 1BK2A 4C5IA 3NMZC 2CUDA 2PUKB 2CP7A 3OSSC 1VQ7Q 2D0NA 3VU3C 1KSWA 2LJ3A 2PZ1A 4F04B 4FIBA 2DRKA 4CC3A 3DLLA 1U1TA 4ZTFA 2RJCA 2QYZA 2F2VA 1YFNA 1VQ9T 2J7IA 2RI5A 3JCMh 4IKFA 4NL3A 4XTXA 2CT4A 1XTDA 2YWWA 4J6XA 4XTVA 4ELZC 1Q81C 4PFZA 1KQSS 1QMCA 1UHCA 1I5LA 1E6HA 4GLMA 4FYXB 1IGQA 2DIGA 1BI1A 5GAOm 3PVLA 4B9XA 3PNWC 2V26A 2L8DA 3JCMV 3CCLT 3LH0A 4A54A 1WQ7A 2FYKA 5HY6A 2JS0A 5GAN2 4DBRA 4E7KA 4Y91A 4OMOA 3DLMA 1F1BB 1X6BA 1ZUKA 1IGUA 5GMKl 3PT9A 4GY5A 1G83A 2HQXA 1VOMA 6AT1B 3G6ET 1HK9A 1VQ8Q 3A5ZB 2JJ9A 4HA8A 3NFCA 3LLRA 2RJEA 3CCMT 2DL3A 3QZ5B 5EC7A 3N5BB 1IRXA 4M75E 1LNXA 2DRMA 4QQGA 2KT8A 2KMTA 2L3SA 1OPKA 2DTOA 3L2WA 4JRIA 4C0DB 4AFSC 2DYIA 4C92F 2DKGA 2AZSA 3CXCP 3CCST 1RADB 1X2QA 1UHFA 2JOYA 4LD6A 1GBRA 4Z88A 1M5Q1 2CDTA 2XU8A 1SEMA 2GNCA 4JJDA 5C0MA 4XTUA 1YP5A 1JO8A 3CC4A 4XU1A 1RI0A 2WSFE 1VA7A 3RDVA 1K73R 2DBMA 4AFZC 1VQLQ 1U8RA 4QT7A 3JCMQ 3EFOA 4A63B 3EFRA 1VQKA 4LUEA 2CYZB 2DD4A 4OB1B 5LJ3h 2OTJQ 1M3BA 1K9MR 1HJDA 5CKFA 2L0AA 4LDUA 2RQVA 3V8LA 1FMWA 1VQ4T 3JCMW 4BY6C 3CMAT 2JMCA 3X24B 2KGTA 2M0YA 1VQ9A 3CMEQ 1Z9ZA 4KULA 4BE0A 4N4GA 3AHUA 5KH6A 2E3HA 3CCUQ 1HD3A 4PJOA 2LVMA 2DLPA 2H8HA 4PFOA 2QA4T 1I1JA 2YUOA 4C92C 1OU9A 1IO6A 1RAIB 1X75C 1GRIA 4JJBA 5IXBA 4D8DA 1Q7YC 2OAUA 3I5RA 4E47A 3CCJT 4M77E 1Q86C 3HP9A 1WGSA 3CCLA 3FIFA 1B07A 1Y96A 1X69A 1WHKA 1JU5C 4J9DA 3V8KA 1YITQ 4C8QF 2PVGB 2DMOA 4O6JA 4PJOD 4C5HA 4JPBW 3MEUA 2EBPA 3MKDA 5CCAA 4XQ3A 3G6EA 1BU1A 4KGVB 2QDYB 4E2FB 5HK3A 2XIDA 4BD3A 4KH0B 2QEXT 1UTIA 4M7AE 4L6V5 2MI6A 3CCMA 2NUPA 2HQEA 5D6XA 1WLPB 3QO3A 1ZHIA 1K73U 4M78E 1UEBA 2DK3A 1GBQA 2GGRA 1ZQ1A 1H3HA 3L1AA 1X2KA 1UJ0A 4IUQA 1YJ9A 2KRMA 1LVKA 4CRIA 2QI2A 2RK2A 2DZCA 4AFQC 2X4WA 2BKDN 2KYBA 5CAIA 4KT0E 1AWOA 4M7DE 2KQWA 4LE9A 1UJYA 1IHVA 3VS2A 2KNBB 2OAWA 2HBWA 4J9EA 1K8AC 3JCMg 3FJ5A 3HSBA 2RI3A 4ZN1A 1D3BA 2ECZA 5GJVB 5C6SA 4KGZB 1YCSB 2E3IA 4C8QC 1YHQQ 2R5AA 3X26B 3S3NA 1RAGB 4FSXA 4BE2A 1KC8C 3L2RA 3VKIA 1Q86R 3M59A 3JCMf 1Q82C 2XICA 1U06A 1M8VA 4PK4A 2EVRA 4OGEA 2KK4A 1AWJA 2KVQG 2VV5A 3SDZA 2RF0A 3OY9A 2P0PA 2DPPB 3NTKA 2VB6A 3U23A 1N8RR 1P92A 2ZZDA 1EZZB 1VQ4A 3UT1A 4OB3B 3REAB 2KDSA 3C4SA 2LJ0A 4EDUA 1ZLMA 5L23A 2HCKA 2EJFA 5GAN6 2OI3A 2A0FB 2DBKA 2P84A 2LCLA 2LQWA 1UGRB 2Y90A 1AD5A 3MP1A 5KYYB 2F2XA 2QA4A 4PLIA 5FU6B 3CCQT 1O9SA 3JCMe 4CI0C 2EPDA 1WA7A 3QJYA 3CCJA 2Y4XA 5I2SA 2RHZA 4QW2A 4C92A 1UUEA 4MZTA 2LX7A 1S72Q 2NWMA 1M1GA 1ZBXA 1PSFA 3QWXX 3QZ9B 3VYGA 3CBMA 5GAOl 4GLKA 4IIOA 2EQKA 3JCMb 3CC7Q 3M0RA 2K4YA 4AG1C 2ESWA 2IIMA 4EMKC 3PVQA 1R0CB 4PJMA 4M78B 5IHIA 1T3SA 4OGCA 2HZYA 1WYXA 1PRMC 1K0SA 3OB9A 3UA7A 1SRLA 5HK0A 2EQJA 4FYYB 3DB3A 3CCVQ 1BIAA 2ENMA 3P8DA 3TSWA 4F7UE 2QEXA 3QIIA 4A4HA 2DERA 1BI0A 2QQBA 3OA6A 5DLQE 2YHTA 4RG8A 4J6WA 3H0IA 4M7DB 1K9AA 4OB0B 3I9QA 3JCMP 1XJWB 1VQ6T 4XTYA 2BZYA 2EQIA 5LJ3g 1Q86U 5GMKj 4ELYC 2J06A 3HKSA 2P0KA 2HNIA 2LQKA 1AVZC 2HKNA 4A4GA 3OBYA 3J7AF 1AZEA 3FEOA 4M75D 2FG0A 2O9VA 1WJRA 5LJ3f 3NTIA 1TWBA 3CQTA 4N0AC 1X43A 2LT4A 2R5MA 2WSEE 1GFDA 5LJ5h 4RTWA 3FC3A 3CCRQ 1QKXA 1MGQA 2KYMA 4WTOB 2COYA 1R0BG 2EGCA 3VV0A 3OYIA 3GPLA 4X34A 1AWWA 4AFUC 3VS3A 1KJWA 5CKHA 2YDLA 4YTLA 3LWHA 4RKUE 4D6WA 3VS4A 5GAN7 3QG1A 4XU0A 2JZ2A 4GBQA 1WHMA 2LCCA 4C8QA 1ZA2B 1I4K1 2LX9A 4KH1B 2X4YA 3EH1A 5LJ3e 1MMAA 4R56A 1TUDA 3M5AA 4XU3A 4JRPA 1YNZA 2RJDA 3C95A 1X6GA 2RO0A 4X9CA 4M77A 4M75G 3JCMX 4HCZA 1H8KA 1ZUUA 2YUQA 2RPNA 2RK1A 5GAOp 1KHCA 3CCQA 1YWPA 1CKAA 4RTTA 1IREB 1QVFP 5GAMd 4PJLA 1VQNQ 1Y57A 3EGUA 3ER0A 1NG2A 2VC8A 1C1AA 5KCOA 2PU9B 2K9GA 1LCKA 3CD6Q 5KE2A 2XG8D 5IHNA 4M77D 5IAYA 1RLQC 2E4HA 5L8RE 1PKSA 4RTYA 1VQKQ 1QWFA 5LJ3d 1A0NB 1LJOA 2A3LA 3BFMA 3VJPA 1QCFA 1I81A 1YJWQ 3SWNA 2PNIA 4RTXA 1X27A 2K2VA 1KQSP 1VQ9Q 2EYZA 3GNFB 2VVKA 5FWBA 1VQ6A 1TG0A 4BDYA 3A8LB 3S3MA 4M7AD 4A4KA 3TU4K 3ULRB 4PKCC 3BY7A 1WXBA 1TH7A 5IXFA 4JUVA 2SEMA 4LDVA 5GAN3 3QPHA 4M78D 2L3RA 3QSUA 2D1XA 2ZAEA 2V8IA 4C0GA 5FLXE 5GAOn 1OQKA 1QP2A 1ZUYA 4PJNA 2QQSA 3VRZA 1KG1A 1JEGA 4M77G 3CC4T 5CR2A 2O9SA 3A8GB 3CCLQ 2JT4A 4TVRA 3VUZA 1M9SA 2QTXA 2XHCA 3V8JA 2G6FX 2EFIA 2ZPBB 5KYWB 2QASA 2NUTB 2QQRA 3PE0A 5KYXA 2CZ1B 3EGDB 1RACB 3TEEA 3G6EQ 2QG9B 1VYUA 2YRCA 3OS2A 4PJOC 2YLBA 3NGPA 3VS7A 4ANJA 4M7AG 2ROTA 1WIEA 4J8OA 2X3XD 2HEQA 4R55A 4OMNA 1UDLA 2LTOA 1D0XA 4L59A 1VQOQ 1SKUB 4M78G 2C06A 1BB9A 1WHJA 2F2WA 1K73C 1YI2A 1WXUA 2ROLA 2VGNA 4HT8A 3J81E 3CCSQ 3H41A 1NBEB 1PC0A 1D09B 1MMNA 5GMKh 2JS2A 1E6GA 2J6OA 1ABOA 5A0DA 3UPUA 2VWFA 1K9MC 3OYHA 3INZA 3LW5E 2AKKA 4QQDA 2JTEA 4M7DG 1RLPC 3GOXA 2DL4A 1K1ZA 2K3XA 1NJIR 3D7SB 2BUDA 2JTMA 2SRCA 2R57A 5GANj 1UGPB 3TREA 1VYTA 4XAXB 4Y92A 4F7UA 4JS5A 2FVUA 2CZ6B 2AK5A 1M90R 1BKBA 4MMKA 3QYHB 2GFAA 1FMKA 1B3QA 1VQ5T 3UWNA 1N5ZA 1N6AA 3R6NA 5CQXA 2LP5A 1RAAB 1NEBA 1B7TA 5LJ5g 3VRYA 2H3JA 4XTWA 2I0NA 2HAXA 1PSEA 1KQ2A 2E65A 3CMAQ 3SEMA 3CBPA 5LJ5f 4QQ6A 3GIBA 2JXBA 2YLCA 1UGVA 1G5VA 1B34B 2HL3A 2AIRB 3OSVA 2QA4Q 1YJ9T 1CSKA 3QJ6A 2M1HA 2Y4YA 2W0ZA 2JNGA 2QK0A 3F70A 2KR3A 3M0SA 1VQPA 2XD0A 2RHXA 2RM4A 2R58A 4M75F 2MOXA 1K0XA 4HXJA 2E12A 1IXDA 3DKMA 5LJ5e 2KRSA 5DM7R 4CC7A 3PTAA 3O5ZA 4MZMA 1KD1R 3C94A 8AT1B 2GBQA 2M02A 2ABLA 3AT1B 4C0FA 4ORZA 4RUGA 1EFNA 2LC4A 2LT1A 3RNJA 1VUBA 3ZBDA 3KBGA 4E7LA 2DVJA 3QDFA 3E9GA 4F7UG 3LGFA 4J9FA 1NJIU 1VQ8T 1OV3A 5A0GA 5AT1B 2D6FA 2QTVA 1YJNT 3EG3A 1QQJA 3MJXA 2COWA 3CPWA 1O75A 2KXDA 3OS0A 3TQ7P 2CH4A 1M90U 5LJ5j 3FB9A 3L42A 1D0ZA 5HKCA 4WCIA 2EQUA 4ZN3A 4OF1A 4BY6B 1WQWA 3OYEA 3M57A 4BI4A 1WX6A 1PCXA 1FWZA 3QYGB 3MPUB 1HXDA 2P4TA 3CC2T 1N8RC 3R6OA 2EYYA 2FL7A 2L3PA 4M75C 2I2LA 4Z02A 3RMSA 8ATCB 4WF2A 2LQNA 4P5NA 5AYFA 3EGXB 4F17A 2ZPIB 1WI7A 3M4GA 2L5QA 1UE9A 1M30A 1NLPC 4FW1A 1VQ5A 3CBOA 4E7IA 2L2PA 4E7SA 3MO8A 2FPDA 4M77F 3OYFA 2MPXC 1YIJT 2FHDA 2OTJT 1IB8A 3P8HA 4M4ZA 4B9WA 2F5TX 3ME9A 3I55T 3RESA 3OW2A 2HD0A 4FYWB 2NYSA 2E41A 3MEAA 2KY9A 1VIFA 2GQVA 4OB2B 3M55A 2K57A 4D8KA 1K9MU 3M4YA 3CMET 2XDDA 1C0MA 1YWOA 4QVDA 1KD1U 2D8HA 3CCQQ 1VQMT 3A1PA 3H0FA 1ZBJA 2MWOA 1D1AA 4M7AF 5FW9A 1M3CA 4C5GA 1SHGA 3C0CA 2EKHA 2K5IA 2HKQB 4M78F 1T0HA 4A4EA 2F1LA 1KQ1A 3OBWA 3GP8A 3OMGA 1PNJA 4RCBA 5CKBA 1FYNA 1QVPA 3WVEB 1TTHB 1ZX6A 4HCBA 4BB7A 1W4SA 5GANh 1NZ9A 1PG5B 1UG1A 1D1BA 4M77C 2ED0A 4LN2A 2LRQA 3FJPA 3TSZA 3CPWS 4DA4A 4M7DF 4HCKA 2DL8A 2K6DA 1ZSZB 1JJ2A 1M4ZA 1VQ8A 4Q5WA 2GTJA 5J39A 3VS5A 2KSSA 2MAMA 1GFCA 2BZ8A 1XQHA 2ZPEB 1YJNA 4HVUA 1QVGA 2MIOA 3HHTB 2FZCB 2E1HA 4JRKA 3G4SQ 3MEVA 5CIUA 3TCJA 3RKWA 2DETA 3EG0A 3MP6A 5KCHA 4M7AC 3IQLA 2M16A 1WFWA 3M0PA 3QUIA 3M0UA 2BE7D 1SRMA 3CC2A 3UA6A 4M78C 3Q1JA 5I11A 2XDBA 4OP0A 3FRNA 5GMKe 2A08A 2LDMA 2KRNA 1KFZA 3SD4A 1FXXA 2B8AA 2EKOA 5J26A 1M2VB 2CP2A 3OYYA 3SWNC 3OW2S 1VQLA 3L2UA 1RUWA 2O88A 4M75A 1CKBA 3RERA 1QW1A 4CC4B 1GCQA 3M9QA 1YIJA 3G1JA 5GAN8 2KXCA 2OTJA 2AT1B 3KUFA 3OYBA 1M27C 5EG2A 3I55A 2VXFA 2HMAA 4V2SA 3JCMd 2J05A 4EMKB 1Y0MA 4QVZA 3THKA 3E2UA 4ZGEB 2HQHA 2P0QA 3OYJA 2D0QB 1GCPA 2LQ8A 1AEYA 2M9UA 3JRZA 3CMEA 2XDPA 2DEUA 2M51A 5CK9A 2FRYA 3ZFJA 2LMJA 1PD0A 4VUBA 4FT2A 4DBQA 1VQMA 2DEQA 3KFVA 1N8RU 3V7RA 3RIRA 3A8OB 1OI1A 4F7UF 3GBQA 2CP5A 3QKJA 2RN8A 2AZVA 2YRVA 3JB9I 1OYXA 2O4XB 1M8MA 1UFFA 3EG9B 3JB9H 2EGAA 2LJ1A 2RI2A 5FU7C 2YUNA 3HFOA 3GF5A 1JJ2S 1VYVA 3HRSA 2DL5A 4BI8B 1OULA 2E6ZA 2O2OA 5GAN5 1MNDA 1QVGS 2E5KA 1WNLA 1OX9A 3BDUA 5FROA 1KIKA 2A28A 1UGSB 2PUOB 3CCVT 1RI9A 2EJGA 3J80E 3A98A 3M53A 2DIQA 4EMHA 1YI2T 1V29B 2HDAA 4XU2A 5KYYA 4DEYA 3EG2A 1WZOA 3GNGA 2PVDB 5DY9A 2L89A 2VXEA 4J7FA 3SB2A 3WXMB 1W2BA 2DFUA 2CGHA 4IUVA 4AT1B 1RABB 3VUBA 1ZA1B 3PMTA 1EX4A 1HYOA 3G71T 2X35A 2X3WD 2JUFA 3CC4Q 1OZ3A 4LXCA 2HSEB 4JZ4A 2RQUA 3OS5A 3NHNA 3H8ZA 1NE8A 4JRQA 4PJOE 1UB4A 3VS6A 4M7AA 3CCRT 4ZGDB 1OX8A 3LX7A 2ZPFB 1OU8A 2NUZA 3SHWA 2RHIA 4IIMA 4M78A 3PIPA 3RBBB 2DO3A 2RNAA 3OYCA 3I56T 2B86A 1ARKA 3JCMJ 3RUXA 1U1SA 3M0TA 2DE0X 2WACA 4IURA 1PRLC 2COZA 3JB9D 4M7DA 2E64A 1NJIC 1W70A 1G3TA 4J7IA 5GANg 2RA2A 3S3OA 3HTRA 4Y28E 1M1KR 1M90C 5KYUA 2E70A 2JVVA 4A53A 2QXFA 2VYTA 2CP6A 2LNVA 5IH2A 5GANf 1VQPT 1NYFA 4A4FA 1NPRA 5DLOA 4HVWA 2V8JA 1SSFA 3QDRB 3A8MB 2VUBA 1N9SA 1VQNT 1X6OA 1MMGA 2DA9A 4M7DD 2CH4W 1OZ2A 1AT1B 1ZSGA 2XKOC 3JSCA 2EAYA 3EFOB 4J9HA 3CCET 5D7UA 3I5SA 1YCYA 2DXCA 1VQ5Q 2QAZA 1Y71A 1PM3A 2DM1A 3OS1A 1MUZA 4PFPA 3JB9G 4FU6A 4NL2A 3CCMQ 1U5SA 2VASA 1Z9QA 3OYGA 3CCVA 5GANe 2YUPA 5CO7A 5IT9E 3JAME 2KEAA 2OTLT 2ZPHB 1YJWT 4RTZA 3VYHB 4N4HA 2DD5A 2O01E 4DOVA 2KE9A 2CSIA 3OYAA 4EIKA 4PJOB 1MMDA 3META 1YJ9Q 2K79A 7AT1B 3C12A 1X01A 2E6NA 3M54A 3G71A 3BE3A 1KD1C 5I21A 4PNOA 3LWIA 2PQWA 2EWNA 3X28B 3OQ5A 2EGEA 4BACA 1ACMB 1Y96B 2QGGA 3CCRA 1QLYA 3EHRA 2BE9B 1R8OB 3FLGA 3JB9J 1JQQA 4LUDA 5I22A 2DL7A 2BZXA 4K11A 1JRIA 5A0LA 5IHKA 5GANd 3E1SA 3I56A 1M1KU 4C92E 4JDSA 3CXCA 2K3YA
chains in the Genus database with same CATH topology
1SRLA 2ENMA 4CC2A 3TSWA 4ESRA 3NPFA 4M4ZA 2RQTA 1T0JA 2CSQA 3QWYA 2W10A 3LH5A 2DJQA 1W1FA 2DILA 3H0IA 1K9AA 3I9QA 4D8KA 2BZYA 2EQIA 1W6XA 2J06A 1YWOA 2L3QA 2D8HA 1AVZC 3EHQA 1GL5A 1SHFA 1AZEA 2C0TA 1WXTA 3H0FA 1ZBJA 2FG0A 2OJ2A 2O9VA 2K7AA 1OEBA 3CQTA 4RTUA 1M3CA 5FW9A 2PTKA 1X43A 1SHGA 4FSSA 3C0CA 2EKHA 1K4US 1GFDA 4OMMA 4RTWA 2FO0A 1QKXA 2KYMA 1T0HA 3H0HA 4LNPA 1JXOA 2EGCA 1OOTA 4Z8AA 1MV3A 1AWWA 2V1RA 1NEGA 1PNJA 1YN8A 4AFUC 1QWEA 3VS3A 1KJWA 2YDLA 1FYNA 1U3OA 1WDXA 1ZX6A 4OMLA 3VS0A 3VS4A 1V1CA 2FPEA 4J9CA 1UG1A 4GBQA 2A37A 1NYGA 1E7OA 4R0KA 2ED0A 4LN2A 4Z89A 4F16A 3TSZA 1QKWA 1M3AA 1NLOC 2V1QA 2DL8A 1BK2A 4HCKA 3NMZC 2CUDA 2EW3A 2K6DA 2D0NA 3REBB 1KSWA 2GTJA 2LJ3A 2PZ1A 3VS5A 1TUDA 2DRKA 4CC3A 1GFCA 2BZ8A 2F2VA 4J9BA 1YNZA 2J7IA 4HVUA 1X6GA 2MIOA 1H8KA 1ZUUA 2CT4A 2YUQA 2RPNA 4JJCA 2FPFA 2KT1A 2JM9A 5ECAA 1YWPA 2LZ6B 1CKAA 1UHCA 4RTTA 1E6HA 3EG0A 4GLMA 4JZ3A 2C0OA 4AG2C 1Y57A 3IQLA 3PVLA 1WFWA 3EGUA 3M0PA 1PKTA 3M0UA 1SRMA 1NG2A 3UA6A 1GCQC 5I11A 2JS0A 1AOJA 2HSPA 4OMOA 2K9GA 2A08A 1LCKA 1X6BA 1ZUKA 2KRNA 5IHNA 1KFZA 1RLQC 2K2MA 1PKSA 4RTYA 1RUWA 2O88A 1G83A 1CKBA 1QWFA 1SPKA 1A0NB 4CC4B 2LNHB 1AWXA 1GCQA 2KXCA 2J6FA 1QCFA 1M27C 2JM8A 2PNIA 2XMFA 2J05A 4RTXA 1X27A 2DL3A 1Y0MA 5EC7A 3THKA 2VKNA 2EYZA 1GCPA 2VVKA 2CUBA 2DRMA 5FWBA 2KT8A 1TG0A 1AEYA 2L3SA 1OPKA 1MV0B 2M51A 1S1NA 3ULRB 4AFSC 2FRYA 2LMJA 1BBZA 5IXFA 1WXBA 2SEMA 2AZSA 3KFVA 2O31A 2D1XA 2CT3A 4J9IA 1I0CA 3GBQA 1X2QA 2RN8A 1ZUYA 2AZVA 1UHFA 3VRZA 1M8MA 1JEGA 1UFFA 1GBRA 4Z88A 2O9SA 2CDTA 1SEMA 2GNCA 1AZGB 4JJDA 1JXMA 2JT4A 1YP5A 3JV3A 1JO8A 1OPLA 1VA7A 2EGAA 2DBMA 2LJ1A 4AFZC 2G6FX 4QT7A 2YUNA 5FWCA 4A63B 1VYVA 1NM7A 2DL5A 3PE0A 4LUEA 4OMQA 5GJWB 1I07A 2BTTA 1M3BA 1VYUA 1HJDA 2O2OA 2L0AA 2E5KA 2YT6A 4OMPA 3NGPA 2RQVA 1KIKA 3VS7A 2A28A 1RI9A 2ROTA 1WIEA 2X3XD 2HEQA 2JMCA 3A98A 4OMNA 2KGTA 1UDLA 2A36A 2M0YA 1Z9ZA 2HDAA 3UF4A 1HD3A 4DEYA 1BB9A 3EG2A 2F2WA 2JMAA 1HSQA 2DYBA 1WXUA 2ROLA 2DLPA 2H8HA 1I1JA 2YUOA 1IO6A 3H41A 1GRIA 4JJBA 5IXBA 4D8DA 3I5RA 2JS2A 1E6GA 2J6OA 1ABOA 2VWFA 2DF6A 2X3WD 2AKKA 4RTVA 1XOVA 1J3TA 2JTEA 1B07A 1ABQA 4JZ4A 1RLPC 2EYWA 2RQUA 2MCNA 2DL4A 3NHNA 1K1ZA 1X69A 3VS6A 1K76A 1JU5C 4J9DA 4DEXA 2SRCA 1VYTA 2DMOA 4Y92A 2NUZA 2DNUA 4JPBW 3SHWA 2J6KA 4IIMA 2AK5A 2EBPA 2P4RA 1FMKA 3RBBB 2ED1A 1B3QA 3VS1A 1BU1A 2RNAA 1PWTA 2B86A 2JW4A 1ARKA 1N5ZA 3R6NA 3UATA 2LP5A 1NEBA 3M0TA 3VRYA 1UTIA 4F14A 2DE0X 2I0NA 2RQRA 5HCKA 1WLPB 2CREA 3SEMA 1PRLC 2RQWA 3ZL7C 1GBQA 2GGRA 1W70A 2JXBA 1UGVA 1UECA 2FEIA 1H3HA 4X1VA 1X2KA 1UJ0A 1CSKA 4KRTA 2KRMA 2W0ZA 1H92A 4J9GA 5IH2A 4AFQC 1NYFA 2KYBA 1AWOA 4HVWA 4LE9A 1UJYA 2KR3A 3M0SA 3VS2A 2KNBB 2OAWA 2HBWA 4J9EA 2LCSA 2DA9A 3FJ5A 2MOXA 1K0XA 4HXJA 2CH4W 2ECZA 5GJVB 1YCSB 1ZSGA 1TUCA 4J9HA 2KRSA 3I5SA 4E6RA 1U06A 4CC7A 3O5ZA 2YSQA 2EVRA 2GBQA 2ABLA 1AWJA 4ORZA 4RUGA 1EFNA 2DM1A 2RF0A 3RNJA 1MUZA 2KROA 1U5SA 3U23A 1Z9QA 2C0IA 2DVJA 2YUPA 3REAB 2LJ0A 4J9FA 1ZLMA 1T3LA 5L23A 2HCKA 1OV3A 2KEAA 2K3BA 2OI3A 2DBKA 3EG1A 4RTZA 2LQWA 4ZNXA 3EG3A 1AD5A 1G2BA 2KE9A 2KXDA 2CSIA 4EIKA 2CH4A 2F2XA 4HVVA 2EYXA 2K79A 4WCIA 2GQIA 3M0QA 2EPDA 1WA7A 1WX6A 2FRWA 2AKLA 1UUEA 2DX1A 2LX7A 2GTOA 2NWMA 2QDLA 2EGEA 1SSHA 1PHTA 3QWXX 2EYYA 2L3PA 2D8JA 2KBTA 2RMOA 1QLYA 2LQNA 3EHRA 4IIOA 3TVTA 3M0RA 1JQQA 4LUDA 4F17A 5I22A 4AG1C 2ESWA 2DL7A 2IIMA 3PVQA 1WI7A 2BZXA 4K11A 5IHIA 1T3SA 1UE9A 5IHKA 1M30A 1NLPC 2L2PA 1WYXA 1PRMC 3I35A 1K0SA 2FPDA 3UA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRL A;  2ENM A;  4CC2 A;  3TSW A;  4ESR A;  3NPF A;  4M4Z A;  2RQT A;  1T0J A;  2CSQ A;  3QWY A;  2W10 A;  3LH5 A;  2DJQ A;  1W1F A;  2DIL A;  3H0I A;  1K9A A;  3I9Q A;  4D8K A;  2BZY A;  2EQI A;  1W6X A;  2J06 A;  1YWO A;  2L3Q A;  2D8H A;  1AVZ C;  3EHQ A;  1GL5 A;  1SHF A;  1AZE A;  2C0T A;  1WXT A;  3H0F A;  1ZBJ A;  2FG0 A;  2OJ2 A;  2O9V A;  2K7A A;  1OEB A;  3CQT A;  4RTU A;  1M3C A;  5FW9 A;  2PTK A;  1X43 A;  1SHG A;  4FSS A;  3C0C A;  2EKH A;  1K4U S;  1GFD A;  4OMM A;  4RTW A;  2FO0 A;  1QKX A;  2KYM A;  1T0H A;  3H0H A;  4LNP A;  1JXO A;  2EGC A;  1OOT A;  4Z8A A;  1MV3 A;  1AWW A;  2V1R A;  1NEG A;  1PNJ A;  1YN8 A;  4AFU C;  1QWE A;  3VS3 A;  1KJW A;  2YDL A;  1FYN A;  1U3O A;  1WDX A;  1ZX6 A;  4OML A;  3VS0 A;  3VS4 A;  1V1C A;  2FPE A;  4J9C A;  1UG1 A;  4GBQ A;  2A37 A;  1NYG A;  1E7O A;  4R0K A;  2ED0 A;  4LN2 A;  4Z89 A;  4F16 A;  3TSZ A;  1QKW A;  1M3A A;  1NLO C;  2V1Q A;  2DL8 A;  1BK2 A;  4HCK A;  3NMZ C;  2CUD A;  2EW3 A;  2K6D A;  2D0N A;  3REB B;  1KSW A;  2GTJ A;  2LJ3 A;  2PZ1 A;  3VS5 A;  1TUD A;  2DRK A;  4CC3 A;  1GFC A;  2BZ8 A;  2F2V A;  4J9B A;  1YNZ A;  2J7I A;  4HVU A;  1X6G A;  2MIO A;  1H8K A;  1ZUU A;  2CT4 A;  2YUQ A;  2RPN A;  4JJC A;  2FPF A;  2KT1 A;  2JM9 A;  5ECA A;  1YWP A;  2LZ6 B;  1CKA A;  1UHC A;  4RTT A;  1E6H A;  3EG0 A;  4GLM A;  4JZ3 A;  2C0O A;  4AG2 C;  1Y57 A;  3IQL A;  3PVL A;  1WFW A;  3EGU A;  3M0P A;  1PKT A;  3M0U A;  1SRM A;  1NG2 A;  3UA6 A;  1GCQ C;  5I11 A;  2JS0 A;  1AOJ A;  2HSP A;  4OMO A;  2K9G A;  2A08 A;  1LCK A;  1X6B A;  1ZUK A;  2KRN A;  5IHN A;  1KFZ A;  1RLQ C;  2K2M A;  1PKS A;  4RTY A;  1RUW A;  2O88 A;  1G83 A;  1CKB A;  1QWF A;  1SPK A;  1A0N B;  4CC4 B;  2LNH B;  1AWX A;  1GCQ A;  2KXC A;  2J6F A;  1QCF A;  1M27 C;  2JM8 A;  2PNI A;  2XMF A;  2J05 A;  4RTX A;  1X27 A;  2DL3 A;  1Y0M A;  5EC7 A;  3THK A;  2VKN A;  2EYZ A;  1GCP A;  2VVK A;  2CUB A;  2DRM A;  5FWB A;  2KT8 A;  1TG0 A;  1AEY A;  2L3S A;  1OPK A;  1MV0 B;  2M51 A;  1S1N A;  3ULR B;  4AFS C;  2FRY A;  2LMJ A;  1BBZ A;  5IXF A;  1WXB A;  2SEM A;  2AZS A;  3KFV A;  2O31 A;  2D1X A;  2CT3 A;  4J9I A;  1I0C A;  3GBQ A;  1X2Q A;  2RN8 A;  1ZUY A;  2AZV A;  1UHF A;  3VRZ A;  1M8M A;  1JEG A;  1UFF A;  1GBR A;  4Z88 A;  2O9S A;  2CDT A;  1SEM A;  2GNC A;  1AZG B;  4JJD A;  1JXM A;  2JT4 A;  1YP5 A;  3JV3 A;  1JO8 A;  1OPL A;  1VA7 A;  2EGA A;  2DBM A;  2LJ1 A;  4AFZ C;  2G6F X;  4QT7 A;  2YUN A;  5FWC A;  4A63 B;  1VYV A;  1NM7 A;  2DL5 A;  3PE0 A;  4LUE A;  4OMQ A;  5GJW B;  1I07 A;  2BTT A;  1M3B A;  1VYU A;  1HJD A;  2O2O A;  2L0A A;  2E5K A;  2YT6 A;  4OMP A;  3NGP A;  2RQV A;  1KIK A;  3VS7 A;  2A28 A;  1RI9 A;  2ROT A;  1WIE A;  2X3X D;  2HEQ A;  2JMC A;  3A98 A;  4OMN A;  2KGT A;  1UDL A;  2A36 A;  2M0Y A;  1Z9Z A;  2HDA A;  3UF4 A;  1HD3 A;  4DEY A;  1BB9 A;  3EG2 A;  2F2W A;  2JMA A;  1HSQ A;  2DYB A;  1WXU A;  2ROL A;  2DLP A;  2H8H A;  1I1J A;  2YUO A;  1IO6 A;  3H41 A;  1GRI A;  4JJB A;  5IXB A;  4D8D A;  3I5R A;  2JS2 A;  1E6G A;  2J6O A;  1ABO A;  2VWF A;  2DF6 A;  2X3W D;  2AKK A;  4RTV A;  1XOV A;  1J3T A;  2JTE A;  1B07 A;  1ABQ A;  4JZ4 A;  1RLP C;  2EYW A;  2RQU A;  2MCN A;  2DL4 A;  3NHN A;  1K1Z A;  1X69 A;  3VS6 A;  1K76 A;  1JU5 C;  4J9D A;  4DEX A;  2SRC A;  1VYT A;  2DMO A;  4Y92 A;  2NUZ A;  2DNU A;  4JPB W;  3SHW A;  2J6K A;  4IIM A;  2AK5 A;  2EBP A;  2P4R A;  1FMK A;  3RBB B;  2ED1 A;  1B3Q A;  3VS1 A;  1BU1 A;  2RNA A;  1PWT A;  2B86 A;  2JW4 A;  1ARK A;  1N5Z A;  3R6N A;  3UAT A;  2LP5 A;  1NEB A;  3M0T A;  3VRY A;  1UTI A;  4F14 A;  2DE0 X;  2I0N A;  2RQR A;  5HCK A;  1WLP B;  2CRE A;  3SEM A;  1PRL C;  2RQW A;  3ZL7 C;  1GBQ A;  2GGR A;  1W70 A;  2JXB A;  1UGV A;  1UEC A;  2FEI A;  1H3H A;  4X1V A;  1X2K A;  1UJ0 A;  1CSK A;  4KRT A;  2KRM A;  2W0Z A;  1H92 A;  4J9G A;  5IH2 A;  4AFQ C;  1NYF A;  2KYB A;  1AWO A;  4HVW A;  4LE9 A;  1UJY A;  2KR3 A;  3M0S A;  3VS2 A;  2KNB B;  2OAW A;  2HBW A;  4J9E A;  2LCS A;  2DA9 A;  3FJ5 A;  2MOX A;  1K0X A;  4HXJ A;  2CH4 W;  2ECZ A;  5GJV B;  1YCS B;  1ZSG A;  1TUC A;  4J9H A;  2KRS A;  3I5S A;  4E6R A;  1U06 A;  4CC7 A;  3O5Z A;  2YSQ A;  2EVR A;  2GBQ A;  2ABL A;  1AWJ A;  4ORZ A;  4RUG A;  1EFN A;  2DM1 A;  2RF0 A;  3RNJ A;  1MUZ A;  2KRO A;  1U5S A;  3U23 A;  1Z9Q A;  2C0I A;  2DVJ A;  2YUP A;  3REA B;  2LJ0 A;  4J9F A;  1ZLM A;  1T3L A;  5L23 A;  2HCK A;  1OV3 A;  2KEA A;  2K3B A;  2OI3 A;  2DBK A;  3EG1 A;  4RTZ A;  2LQW A;  4ZNX A;  3EG3 A;  1AD5 A;  1G2B A;  2KE9 A;  2KXD A;  2CSI A;  4EIK A;  2CH4 A;  2F2X A;  4HVV A;  2EYX A;  2K79 A;  4WCI A;  2GQI A;  3M0Q A;  2EPD A;  1WA7 A;  1WX6 A;  2FRW A;  2AKL A;  1UUE A;  2DX1 A;  2LX7 A;  2GTO A;  2NWM A;  2QDL A;  2EGE A;  1SSH A;  1PHT A;  3QWX X;  2EYY A;  2L3P A;  2D8J A;  2KBT A;  2RMO A;  1QLY A;  2LQN A;  3EHR A;  4IIO A;  3TVT A;  3M0R A;  1JQQ A;  4LUD A;  4F17 A;  5I22 A;  4AG1 C;  2ESW A;  2DL7 A;  2IIM A;  3PVQ A;  1WI7 A;  2BZX A;  4K11 A;  5IHI A;  1T3S A;  1UE9 A;  5IHK A;  1M30 A;  1NLP C;  2L2P A;  1WYX A;  1PRM C;  3I35 A;  1K0S A;  2FPD A;  3UA7 A; 
#chains in the Genus database with same CATH topology
 3FDR A;  1VQ4 Q;  1TUG B;  4C0D C;  4CC2 A;  2HBP A;  2CSQ A;  1VQ7 T;  3QWY A;  3M56 A;  2JTF A;  2NUP B;  1N27 A;  2DJQ A;  1W1F A;  2DIL A;  1WPY A;  1JBM A;  1YJN Q;  2EJ9 A;  2DTH A;  2D9T A;  1SG5 A;  4DBF A;  2A7Y A;  1VQO T;  2L3Q A;  3CCJ Q;  4J5Y A;  1GL5 A;  2YRD A;  2C0T A;  4ZTJ A;  4LDY A;  2OJ2 A;  1Y7X A;  4MZP A;  2K7A A;  2AHJ B;  1G8X A;  4RTU A;  2RH2 A;  3L2V A;  5GAM h;  1VQN A;  2IPO B;  4OMM A;  3CC2 Q;  2FO0 A;  3O8V A;  4BI3 A;  5CQY A;  3H0H A;  4FT4 A;  4LNP A;  3PMI A;  2K5L A;  2MMP A;  2RHU A;  4E7Z A;  3SFM A;  1D3B B;  1Q81 R;  4Z8A A;  1BYM A;  2V1R A;  1NEG A;  1IZ6 A;  5KYW A;  1EIF A;  3CCE A;  3CD6 A;  2NUT A;  2MWP A;  4JLI A;  4OVA A;  3RKY A;  4AMC A;  3EGD A;  1D0Y A;  3VS0 A;  2FZG B;  4ZGJ B;  2QQA A;  1V1C A;  4J9C A;  3OYK A;  2A37 A;  2QEX Q;  1E7O A;  4R0K A;  1NPP A;  1YIJ Q;  3EH2 A;  4Z89 A;  1M3A A;  2V1Q A;  3X20 B;  2EW3 A;  3I55 Q;  1M2O A;  4XK8 E;  3REB B;  2OTL A;  5IN1 A;  1TOV A;  3QBY A;  1YJW A;  2DJZ A;  4FM4 B;  3OMC A;  4J9B A;  3BDL A;  4C5E A;  5GAO q;  3QHS A;  2WSC E;  4RMO A;  3L2Z A;  4C8Q E;  4JJC A;  5D6Y A;  2FPF A;  2ZCF B;  2KT1 A;  4FW2 A;  2JM9 A;  1V76 A;  5ECA A;  3ASK A;  3RR6 A;  1QCN A;  2LZ6 B;  1VQM Q;  1H3Z A;  4HCC A;  4JZ3 A;  3PIO A;  2C0O A;  5LJ5 d;  4PJJ A;  4AG2 C;  3G7Z A;  2GCX A;  2QGF B;  3L2Q A;  4C92 B;  1PKT A;  3JCM c;  5FRN A;  4LDX A;  3CXC S;  4IUT A;  1GCQ C;  2X9H A;  4KBM B;  4E7H A;  1AOJ A;  2HSP A;  1G3W A;  4EPC A;  1WHG A;  1VQL T;  4BUG A;  5KYN A;  2K2M A;  3CPW P;  1TSF A;  4DOW A;  2X51 A;  1SPK A;  1UGQ B;  2CKK A;  1GXI E;  4O5V A;  2LNH B;  1AWX A;  1PD1 A;  1RAF B;  4RG2 A;  4IUU A;  4M75 B;  3T9N A;  4B6M A;  2J6F A;  4DQ2 A;  1TU0 B;  4C0Z A;  1KK7 A;  1VQ7 A;  2JM8 A;  3RMQ A;  5GMK i;  2XMF A;  4FCY A;  4JJN K;  2GFU A;  2EYQ A;  2VKN A;  1Q81 U;  3V7C A;  2CUB A;  4FL6 A;  4HT9 A;  1B34 A;  2FZK B;  3CCU T;  1MV0 B;  1VQO A;  2CZ7 B;  1S1N A;  4MDW A;  2CP0 A;  1WHL A;  1BBZ A;  1I5O B;  3JB9 F;  3EAE A;  2O31 A;  2CT3 A;  3PFS A;  4J9I A;  1I0C A;  3CCS A;  1BCM A;  4E7J A;  2XI9 A;  4EMG A;  4OMF B;  1BI2 A;  3OW2 P;  1AZG B;  1JXM A;  3JV3 A;  5FRM A;  1OPL A;  4FYV B;  5CKD A;  4PJO G;  1YIT T;  1WHH A;  2CS7 A;  3OYM A;  1N9R A;  5FWC A;  1XNI A;  1NM7 A;  4OMQ A;  5GJW B;  1I07 A;  1ZSZ C;  1Q7Y R;  1JB0 E;  3HRT A;  2BTT A;  5D6W A;  4PLL A;  3X25 B;  4C8Q B;  3OYD A;  2YT6 A;  4OMP A;  2RHY A;  5FU6 C;  1VIE A;  3ZEH A;  4ATO A;  3NTH A;  1VQ6 Q;  2A36 A;  4N4I A;  2X4J A;  2PVO B;  3CMA A;  3UF4 A;  3HFN A;  3E9F A;  4M77 B;  2FB7 A;  2JMA A;  1HSQ A;  2DYB A;  1LPL A;  4XTZ A;  2VGM A;  1MNE A;  3QXE B;  5GMK m;  2JN0 A;  2DF6 A;  4RTV A;  1XOV A;  1J3T A;  2ZPG B;  3PGG A;  1JJ2 P;  1ABQ A;  5GAN 4;  2EYW A;  2MCN A;  3OYN A;  1K76 A;  2MF2 A;  4MML A;  4DEX A;  3H9N A;  1YHQ T;  1QVG P;  3EGX A;  2XK0 A;  2DNU A;  2J6K A;  4M7A B;  2P4R A;  4LDW A;  2ED1 A;  4M7D C;  3VS1 A;  1PWT A;  2JW4 A;  1D1C A;  4NOY A;  3UAT A;  5GAM g;  1QP3 A;  2DXT A;  1K8A R;  3H6Z A;  5J3B A;  1AHJ B;  4F14 A;  1G3Y A;  5KE3 A;  1BCO A;  2CP3 A;  2RQR A;  2V8K A;  5HCK A;  3SWN B;  3CEY A;  4C92 D;  2KI7 A;  3MP8 A;  2CRE A;  5CKE A;  5GAM f;  3HPW A;  3MEW A;  1KC8 R;  2RQW A;  1BIB A;  3ZL7 C;  1YI2 Q;  3CCU A;  1Q82 R;  2DTI A;  2ZGW A;  1UEC A;  5GAO r;  2FEI A;  4X1V A;  1Q7Y U;  1DJ7 B;  1IHW A;  4KRT A;  3EFS A;  1WJQ A;  2RD1 A;  2MYS A;  1H92 A;  3G71 Q;  4J9G A;  3G4S T;  2BIV A;  4J83 A;  5KYU B;  1S72 T;  4J6Y A;  2LCS A;  3GLX A;  1YIT A;  4L5G A;  1I8F A;  5GAM e;  1MHN A;  2DVE A;  1TUC A;  3CC7 T;  3UDC A;  3E19 A;  4E6R A;  3BW1 A;  5KYX B;  1Q95 G;  2YSQ A;  3MHX A;  3LYI A;  3I56 Q;  4BDZ A;  1QVF A;  1R77 A;  4C92 G;  2E5Q A;  2GF7 A;  2H3E B;  2F69 A;  4BE1 A;  2KRO A;  1M1K C;  1ZSZ A;  2C0I A;  1SF9 A;  2ATC B;  5FU7 B;  3V7S A;  1RAH B;  2RB6 A;  1T3L A;  1YBY A;  2K3B A;  1RAE B;  2OX7 A;  5I2M A;  3EG1 A;  4RCC A;  4ZNX A;  1G2B A;  2DAQ A;  4II1 A;  5GAM j;  1QCO A;  2X4X A;  4HVV A;  4LD9 K;  5M9O A;  2KAF A;  4KGX B;  2EQM A;  2EYX A;  1C6V X;  2GQI A;  3M0Q A;  1VQP Q;  1TS9 A;  1K8A U;  2K5F A;  4UC4 A;  4C8Q D;  2FRW A;  2AKL A;  2E10 A;  2CZ0 B;  2DX1 A;  2GTO A;  2QDL A;  3M58 A;  4JS4 A;  1H64 1;  1SSH A;  5CVI A;  2QQ9 A;  1PHT A;  2EIF A;  1KC8 U;  2DXB A;  1KQS A;  3S6W A;  2D8J A;  2IG0 A;  5LJ3 j;  2KBT A;  2RMO A;  1Q82 U;  1YHQ A;  1M2V A;  4HKE A;  2HL5 C;  3TVT A;  4PL6 A;  3DB4 A;  4F7U B;  5A2Q E;  3CCE Q;  4ME7 A;  2YXY A;  1W2B P;  1Y07 A;  3I35 A;  4KUI A;  1FMV A;  2IVW A;  4ESR A;  3NPF A;  2RQT A;  1T0J A;  2MK5 A;  4PJO F;  4EMK A;  4MDX A;  2OTL Q;  2W10 A;  3LGL A;  3HL8 A;  3LH5 A;  2DZ9 A;  2Z0W A;  4IUP A;  1FX7 A;  3URG A;  1W6X A;  4C8Q G;  4QVC A;  2G3R A;  3EHQ A;  1SHF A;  3HRU A;  3P8B B;  1WXT A;  3CPF A;  3WVD B;  4NS5 A;  3MCA B;  3G4S A;  1KHI A;  1LOJ A;  2O4X A;  1OEB A;  3A8H B;  1S72 A;  2PTK A;  4X9D A;  3EG9 A;  4FSS A;  2NLU A;  1K4U S;  5LL6 S;  2M0O A;  1M1F A;  2DXU A;  1JXO A;  1QVF S;  3CD6 T;  4DBH A;  1WJS A;  1OOT A;  3CC7 A;  4JLG A;  1MV3 A;  3RKX A;  2RJF A;  3OYL A;  1YN8 A;  1TXQ A;  1QWE A;  2F5K A;  9ATC B;  1RL2 A;  1U3O A;  1WDX A;  4N0A A;  4OML A;  1VQK T;  3KXT A;  2FPE A;  4KUD K;  1BI3 A;  1NYG A;  4QKU A;  1W2B S;  4F16 A;  1G3S A;  1QKW A;  1NLO C;  1BK2 A;  4C5I A;  3NMZ C;  2CUD A;  2PUK B;  2CP7 A;  3OSS C;  1VQ7 Q;  2D0N A;  3VU3 C;  1KSW A;  2LJ3 A;  2PZ1 A;  4F04 B;  4FIB A;  2DRK A;  4CC3 A;  3DLL A;  1U1T A;  4ZTF A;  2RJC A;  2QYZ A;  2F2V A;  1YFN A;  1VQ9 T;  2J7I A;  2RI5 A;  3JCM h;  4IKF A;  4NL3 A;  4XTX A;  2CT4 A;  1XTD A;  2YWW A;  4J6X A;  4XTV A;  4ELZ C;  1Q81 C;  4PFZ A;  1KQS S;  1QMC A;  1UHC A;  1I5L A;  1E6H A;  4GLM A;  4FYX B;  1IGQ A;  2DIG A;  1BI1 A;  5GAO m;  3PVL A;  4B9X A;  3PNW C;  2V26 A;  2L8D A;  3JCM V;  3CCL T;  3LH0 A;  4A54 A;  1WQ7 A;  2FYK A;  5HY6 A;  2JS0 A;  5GAN 2;  4DBR A;  4E7K A;  4Y91 A;  4OMO A;  3DLM A;  1F1B B;  1X6B A;  1ZUK A;  1IGU A;  5GMK l;  3PT9 A;  4GY5 A;  1G83 A;  2HQX A;  1VOM A;  6AT1 B;  3G6E T;  1HK9 A;  1VQ8 Q;  3A5Z B;  2JJ9 A;  4HA8 A;  3NFC A;  3LLR A;  2RJE A;  3CCM T;  2DL3 A;  3QZ5 B;  5EC7 A;  3N5B B;  1IRX A;  4M75 E;  1LNX A;  2DRM A;  4QQG A;  2KT8 A;  2KMT A;  2L3S A;  1OPK A;  2DTO A;  3L2W A;  4JRI A;  4C0D B;  4AFS C;  2DYI A;  4C92 F;  2DKG A;  2AZS A;  3CXC P;  3CCS T;  1RAD B;  1X2Q A;  1UHF A;  2JOY A;  4LD6 A;  1GBR A;  4Z88 A;  1M5Q 1;  2CDT A;  2XU8 A;  1SEM A;  2GNC A;  4JJD A;  5C0M A;  4XTU A;  1YP5 A;  1JO8 A;  3CC4 A;  4XU1 A;  1RI0 A;  2WSF E;  1VA7 A;  3RDV A;  1K73 R;  2DBM A;  4AFZ C;  1VQL Q;  1U8R A;  4QT7 A;  3JCM Q;  3EFO A;  4A63 B;  3EFR A;  1VQK A;  4LUE A;  2CYZ B;  2DD4 A;  4OB1 B;  5LJ3 h;  2OTJ Q;  1M3B A;  1K9M R;  1HJD A;  5CKF A;  2L0A A;  4LDU A;  2RQV A;  3V8L A;  1FMW A;  1VQ4 T;  3JCM W;  4BY6 C;  3CMA T;  2JMC A;  3X24 B;  2KGT A;  2M0Y A;  1VQ9 A;  3CME Q;  1Z9Z A;  4KUL A;  4BE0 A;  4N4G A;  3AHU A;  5KH6 A;  2E3H A;  3CCU Q;  1HD3 A;  4PJO A;  2LVM A;  2DLP A;  2H8H A;  4PFO A;  2QA4 T;  1I1J A;  2YUO A;  4C92 C;  1OU9 A;  1IO6 A;  1RAI B;  1X75 C;  1GRI A;  4JJB A;  5IXB A;  4D8D A;  1Q7Y C;  2OAU A;  3I5R A;  4E47 A;  3CCJ T;  4M77 E;  1Q86 C;  3HP9 A;  1WGS A;  3CCL A;  3FIF A;  1B07 A;  1Y96 A;  1X69 A;  1WHK A;  1JU5 C;  4J9D A;  3V8K A;  1YIT Q;  4C8Q F;  2PVG B;  2DMO A;  4O6J A;  4PJO D;  4C5H A;  4JPB W;  3MEU A;  2EBP A;  3MKD A;  5CCA A;  4XQ3 A;  3G6E A;  1BU1 A;  4KGV B;  2QDY B;  4E2F B;  5HK3 A;  2XID A;  4BD3 A;  4KH0 B;  2QEX T;  1UTI A;  4M7A E;  4L6V 5;  2MI6 A;  3CCM A;  2NUP A;  2HQE A;  5D6X A;  1WLP B;  3QO3 A;  1ZHI A;  1K73 U;  4M78 E;  1UEB A;  2DK3 A;  1GBQ A;  2GGR A;  1ZQ1 A;  1H3H A;  3L1A A;  1X2K A;  1UJ0 A;  4IUQ A;  1YJ9 A;  2KRM A;  1LVK A;  4CRI A;  2QI2 A;  2RK2 A;  2DZC A;  4AFQ C;  2X4W A;  2BKD N;  2KYB A;  5CAI A;  4KT0 E;  1AWO A;  4M7D E;  2KQW A;  4LE9 A;  1UJY A;  1IHV A;  3VS2 A;  2KNB B;  2OAW A;  2HBW A;  4J9E A;  1K8A C;  3JCM g;  3FJ5 A;  3HSB A;  2RI3 A;  4ZN1 A;  1D3B A;  2ECZ A;  5GJV B;  5C6S A;  4KGZ B;  1YCS B;  2E3I A;  4C8Q C;  1YHQ Q;  2R5A A;  3X26 B;  3S3N A;  1RAG B;  4FSX A;  4BE2 A;  1KC8 C;  3L2R A;  3VKI A;  1Q86 R;  3M59 A;  3JCM f;  1Q82 C;  2XIC A;  1U06 A;  1M8V A;  4PK4 A;  2EVR A;  4OGE A;  2KK4 A;  1AWJ A;  2KVQ G;  2VV5 A;  3SDZ A;  2RF0 A;  3OY9 A;  2P0P A;  2DPP B;  3NTK A;  2VB6 A;  3U23 A;  1N8R R;  1P92 A;  2ZZD A;  1EZZ B;  1VQ4 A;  3UT1 A;  4OB3 B;  3REA B;  2KDS A;  3C4S A;  2LJ0 A;  4EDU A;  1ZLM A;  5L23 A;  2HCK A;  2EJF A;  5GAN 6;  2OI3 A;  2A0F B;  2DBK A;  2P84 A;  2LCL A;  2LQW A;  1UGR B;  2Y90 A;  1AD5 A;  3MP1 A;  5KYY B;  2F2X A;  2QA4 A;  4PLI A;  5FU6 B;  3CCQ T;  1O9S A;  3JCM e;  4CI0 C;  2EPD A;  1WA7 A;  3QJY A;  3CCJ A;  2Y4X A;  5I2S A;  2RHZ A;  4QW2 A;  4C92 A;  1UUE A;  4MZT A;  2LX7 A;  1S72 Q;  2NWM A;  1M1G A;  1ZBX A;  1PSF A;  3QWX X;  3QZ9 B;  3VYG A;  3CBM A;  5GAO l;  4GLK A;  4IIO A;  2EQK A;  3JCM b;  3CC7 Q;  3M0R A;  2K4Y A;  4AG1 C;  2ESW A;  2IIM A;  4EMK C;  3PVQ A;  1R0C B;  4PJM A;  4M78 B;  5IHI A;  1T3S A;  4OGC A;  2HZY A;  1WYX A;  1PRM C;  1K0S A;  3OB9 A;  3UA7 A;  1SRL A;  5HK0 A;  2EQJ A;  4FYY B;  3DB3 A;  3CCV Q;  1BIA A;  2ENM A;  3P8D A;  3TSW A;  4F7U E;  2QEX A;  3QII A;  4A4H A;  2DER A;  1BI0 A;  2QQB A;  3OA6 A;  5DLQ E;  2YHT A;  4RG8 A;  4J6W A;  3H0I A;  4M7D B;  1K9A A;  4OB0 B;  3I9Q A;  3JCM P;  1XJW B;  1VQ6 T;  4XTY A;  2BZY A;  2EQI A;  5LJ3 g;  1Q86 U;  5GMK j;  4ELY C;  2J06 A;  3HKS A;  2P0K A;  2HNI A;  2LQK A;  1AVZ C;  2HKN A;  4A4G A;  3OBY A;  3J7A F;  1AZE A;  3FEO A;  4M75 D;  2FG0 A;  2O9V A;  1WJR A;  5LJ3 f;  3NTI A;  1TWB A;  3CQT A;  4N0A C;  1X43 A;  2LT4 A;  2R5M A;  2WSE E;  1GFD A;  5LJ5 h;  4RTW A;  3FC3 A;  3CCR Q;  1QKX A;  1MGQ A;  2KYM A;  4WTO B;  2COY A;  1R0B G;  2EGC A;  3VV0 A;  3OYI A;  3GPL A;  4X34 A;  1AWW A;  4AFU C;  3VS3 A;  1KJW A;  5CKH A;  2YDL A;  4YTL A;  3LWH A;  4RKU E;  4D6W A;  3VS4 A;  5GAN 7;  3QG1 A;  4XU0 A;  2JZ2 A;  4GBQ A;  1WHM A;  2LCC A;  4C8Q A;  1ZA2 B;  1I4K 1;  2LX9 A;  4KH1 B;  2X4Y A;  3EH1 A;  5LJ3 e;  1MMA A;  4R56 A;  1TUD A;  3M5A A;  4XU3 A;  4JRP A;  1YNZ A;  2RJD A;  3C95 A;  1X6G A;  2RO0 A;  4X9C A;  4M77 A;  4M75 G;  3JCM X;  4HCZ A;  1H8K A;  1ZUU A;  2YUQ A;  2RPN A;  2RK1 A;  5GAO p;  1KHC A;  3CCQ A;  1YWP A;  1CKA A;  4RTT A;  1IRE B;  1QVF P;  5GAM d;  4PJL A;  1VQN Q;  1Y57 A;  3EGU A;  3ER0 A;  1NG2 A;  2VC8 A;  1C1A A;  5KCO A;  2PU9 B;  2K9G A;  1LCK A;  3CD6 Q;  5KE2 A;  2XG8 D;  5IHN A;  4M77 D;  5IAY A;  1RLQ C;  2E4H A;  5L8R E;  1PKS A;  4RTY A;  1VQK Q;  1QWF A;  5LJ3 d;  1A0N B;  1LJO A;  2A3L A;  3BFM A;  3VJP A;  1QCF A;  1I81 A;  1YJW Q;  3SWN A;  2PNI A;  4RTX A;  1X27 A;  2K2V A;  1KQS P;  1VQ9 Q;  2EYZ A;  3GNF B;  2VVK A;  5FWB A;  1VQ6 A;  1TG0 A;  4BDY A;  3A8L B;  3S3M A;  4M7A D;  4A4K A;  3TU4 K;  3ULR B;  4PKC C;  3BY7 A;  1WXB A;  1TH7 A;  5IXF A;  4JUV A;  2SEM A;  4LDV A;  5GAN 3;  3QPH A;  4M78 D;  2L3R A;  3QSU A;  2D1X A;  2ZAE A;  2V8I A;  4C0G A;  5FLX E;  5GAO n;  1OQK A;  1QP2 A;  1ZUY A;  4PJN A;  2QQS A;  3VRZ A;  1KG1 A;  1JEG A;  4M77 G;  3CC4 T;  5CR2 A;  2O9S A;  3A8G B;  3CCL Q;  2JT4 A;  4TVR A;  3VUZ A;  1M9S A;  2QTX A;  2XHC A;  3V8J A;  2G6F X;  2EFI A;  2ZPB B;  5KYW B;  2QAS A;  2NUT B;  2QQR A;  3PE0 A;  5KYX A;  2CZ1 B;  3EGD B;  1RAC B;  3TEE A;  3G6E Q;  2QG9 B;  1VYU A;  2YRC A;  3OS2 A;  4PJO C;  2YLB A;  3NGP A;  3VS7 A;  4ANJ A;  4M7A G;  2ROT A;  1WIE A;  4J8O A;  2X3X D;  2HEQ A;  4R55 A;  4OMN A;  1UDL A;  2LTO A;  1D0X A;  4L59 A;  1VQO Q;  1SKU B;  4M78 G;  2C06 A;  1BB9 A;  1WHJ A;  2F2W A;  1K73 C;  1YI2 A;  1WXU A;  2ROL A;  2VGN A;  4HT8 A;  3J81 E;  3CCS Q;  3H41 A;  1NBE B;  1PC0 A;  1D09 B;  1MMN A;  5GMK h;  2JS2 A;  1E6G A;  2J6O A;  1ABO A;  5A0D A;  3UPU A;  2VWF A;  1K9M C;  3OYH A;  3INZ A;  3LW5 E;  2AKK A;  4QQD A;  2JTE A;  4M7D G;  1RLP C;  3GOX A;  2DL4 A;  1K1Z A;  2K3X A;  1NJI R;  3D7S B;  2BUD A;  2JTM A;  2SRC A;  2R57 A;  5GAN j;  1UGP B;  3TRE A;  1VYT A;  4XAX B;  4Y92 A;  4F7U A;  4JS5 A;  2FVU A;  2CZ6 B;  2AK5 A;  1M90 R;  1BKB A;  4MMK A;  3QYH B;  2GFA A;  1FMK A;  1B3Q A;  1VQ5 T;  3UWN A;  1N5Z A;  1N6A A;  3R6N A;  5CQX A;  2LP5 A;  1RAA B;  1NEB A;  1B7T A;  5LJ5 g;  3VRY A;  2H3J A;  4XTW A;  2I0N A;  2HAX A;  1PSE A;  1KQ2 A;  2E65 A;  3CMA Q;  3SEM A;  3CBP A;  5LJ5 f;  4QQ6 A;  3GIB A;  2JXB A;  2YLC A;  1UGV A;  1G5V A;  1B34 B;  2HL3 A;  2AIR B;  3OSV A;  2QA4 Q;  1YJ9 T;  1CSK A;  3QJ6 A;  2M1H A;  2Y4Y A;  2W0Z A;  2JNG A;  2QK0 A;  3F70 A;  2KR3 A;  3M0S A;  1VQP A;  2XD0 A;  2RHX A;  2RM4 A;  2R58 A;  4M75 F;  2MOX A;  1K0X A;  4HXJ A;  2E12 A;  1IXD A;  3DKM A;  5LJ5 e;  2KRS A;  5DM7 R;  4CC7 A;  3PTA A;  3O5Z A;  4MZM A;  1KD1 R;  3C94 A;  8AT1 B;  2GBQ A;  2M02 A;  2ABL A;  3AT1 B;  4C0F A;  4ORZ A;  4RUG A;  1EFN A;  2LC4 A;  2LT1 A;  3RNJ A;  1VUB A;  3ZBD A;  3KBG A;  4E7L A;  2DVJ A;  3QDF A;  3E9G A;  4F7U G;  3LGF A;  4J9F A;  1NJI U;  1VQ8 T;  1OV3 A;  5A0G A;  5AT1 B;  2D6F A;  2QTV A;  1YJN T;  3EG3 A;  1QQJ A;  3MJX A;  2COW A;  3CPW A;  1O75 A;  2KXD A;  3OS0 A;  3TQ7 P;  2CH4 A;  1M90 U;  5LJ5 j;  3FB9 A;  3L42 A;  1D0Z A;  5HKC A;  4WCI A;  2EQU A;  4ZN3 A;  4OF1 A;  4BY6 B;  1WQW A;  3OYE A;  3M57 A;  4BI4 A;  1WX6 A;  1PCX A;  1FWZ A;  3QYG B;  3MPU B;  1HXD A;  2P4T A;  3CC2 T;  1N8R C;  3R6O A;  2EYY A;  2FL7 A;  2L3P A;  4M75 C;  2I2L A;  4Z02 A;  3RMS A;  8ATC B;  4WF2 A;  2LQN A;  4P5N A;  5AYF A;  3EGX B;  4F17 A;  2ZPI B;  1WI7 A;  3M4G A;  2L5Q A;  1UE9 A;  1M30 A;  1NLP C;  4FW1 A;  1VQ5 A;  3CBO A;  4E7I A;  2L2P A;  4E7S A;  3MO8 A;  2FPD A;  4M77 F;  3OYF A;  2MPX C;  1YIJ T;  2FHD A;  2OTJ T;  1IB8 A;  3P8H A;  4M4Z A;  4B9W A;  2F5T X;  3ME9 A;  3I55 T;  3RES A;  3OW2 A;  2HD0 A;  4FYW B;  2NYS A;  2E41 A;  3MEA A;  2KY9 A;  1VIF A;  2GQV A;  4OB2 B;  3M55 A;  2K57 A;  4D8K A;  1K9M U;  3M4Y A;  3CME T;  2XDD A;  1C0M A;  1YWO A;  4QVD A;  1KD1 U;  2D8H A;  3CCQ Q;  1VQM T;  3A1P A;  3H0F A;  1ZBJ A;  2MWO A;  1D1A A;  4M7A F;  5FW9 A;  1M3C A;  4C5G A;  1SHG A;  3C0C A;  2EKH A;  2K5I A;  2HKQ B;  4M78 F;  1T0H A;  4A4E A;  2F1L A;  1KQ1 A;  3OBW A;  3GP8 A;  3OMG A;  1PNJ A;  4RCB A;  5CKB A;  1FYN A;  1QVP A;  3WVE B;  1TTH B;  1ZX6 A;  4HCB A;  4BB7 A;  1W4S A;  5GAN h;  1NZ9 A;  1PG5 B;  1UG1 A;  1D1B A;  4M77 C;  2ED0 A;  4LN2 A;  2LRQ A;  3FJP A;  3TSZ A;  3CPW S;  4DA4 A;  4M7D F;  4HCK A;  2DL8 A;  2K6D A;  1ZSZ B;  1JJ2 A;  1M4Z A;  1VQ8 A;  4Q5W A;  2GTJ A;  5J39 A;  3VS5 A;  2KSS A;  2MAM A;  1GFC A;  2BZ8 A;  1XQH A;  2ZPE B;  1YJN A;  4HVU A;  1QVG A;  2MIO A;  3HHT B;  2FZC B;  2E1H A;  4JRK A;  3G4S Q;  3MEV A;  5CIU A;  3TCJ A;  3RKW A;  2DET A;  3EG0 A;  3MP6 A;  5KCH A;  4M7A C;  3IQL A;  2M16 A;  1WFW A;  3M0P A;  3QUI A;  3M0U A;  2BE7 D;  1SRM A;  3CC2 A;  3UA6 A;  4M78 C;  3Q1J A;  5I11 A;  2XDB A;  4OP0 A;  3FRN A;  5GMK e;  2A08 A;  2LDM A;  2KRN A;  1KFZ A;  3SD4 A;  1FXX A;  2B8A A;  2EKO A;  5J26 A;  1M2V B;  2CP2 A;  3OYY A;  3SWN C;  3OW2 S;  1VQL A;  3L2U A;  1RUW A;  2O88 A;  4M75 A;  1CKB A;  3RER A;  1QW1 A;  4CC4 B;  1GCQ A;  3M9Q A;  1YIJ A;  3G1J A;  5GAN 8;  2KXC A;  2OTJ A;  2AT1 B;  3KUF A;  3OYB A;  1M27 C;  5EG2 A;  3I55 A;  2VXF A;  2HMA A;  4V2S A;  3JCM d;  2J05 A;  4EMK B;  1Y0M A;  4QVZ A;  3THK A;  3E2U A;  4ZGE B;  2HQH A;  2P0Q A;  3OYJ A;  2D0Q B;  1GCP A;  2LQ8 A;  1AEY A;  2M9U A;  3JRZ A;  3CME A;  2XDP A;  2DEU A;  2M51 A;  5CK9 A;  2FRY A;  3ZFJ A;  2LMJ A;  1PD0 A;  4VUB A;  4FT2 A;  4DBQ A;  1VQM A;  2DEQ A;  3KFV A;  1N8R U;  3V7R A;  3RIR A;  3A8O B;  1OI1 A;  4F7U F;  3GBQ A;  2CP5 A;  3QKJ A;  2RN8 A;  2AZV A;  2YRV A;  3JB9 I;  1OYX A;  2O4X B;  1M8M A;  1UFF A;  3EG9 B;  3JB9 H;  2EGA A;  2LJ1 A;  2RI2 A;  5FU7 C;  2YUN A;  3HFO A;  3GF5 A;  1JJ2 S;  1VYV A;  3HRS A;  2DL5 A;  4BI8 B;  1OUL A;  2E6Z A;  2O2O A;  5GAN 5;  1MND A;  1QVG S;  2E5K A;  1WNL A;  1OX9 A;  3BDU A;  5FRO A;  1KIK A;  2A28 A;  1UGS B;  2PUO B;  3CCV T;  1RI9 A;  2EJG A;  3J80 E;  3A98 A;  3M53 A;  2DIQ A;  4EMH A;  1YI2 T;  1V29 B;  2HDA A;  4XU2 A;  5KYY A;  4DEY A;  3EG2 A;  1WZO A;  3GNG A;  2PVD B;  5DY9 A;  2L89 A;  2VXE A;  4J7F A;  3SB2 A;  3WXM B;  1W2B A;  2DFU A;  2CGH A;  4IUV A;  4AT1 B;  1RAB B;  3VUB A;  1ZA1 B;  3PMT A;  1EX4 A;  1HYO A;  3G71 T;  2X35 A;  2X3W D;  2JUF A;  3CC4 Q;  1OZ3 A;  4LXC A;  2HSE B;  4JZ4 A;  2RQU A;  3OS5 A;  3NHN A;  3H8Z A;  1NE8 A;  4JRQ A;  4PJO E;  1UB4 A;  3VS6 A;  4M7A A;  3CCR T;  4ZGD B;  1OX8 A;  3LX7 A;  2ZPF B;  1OU8 A;  2NUZ A;  3SHW A;  2RHI A;  4IIM A;  4M78 A;  3PIP A;  3RBB B;  2DO3 A;  2RNA A;  3OYC A;  3I56 T;  2B86 A;  1ARK A;  3JCM J;  3RUX A;  1U1S A;  3M0T A;  2DE0 X;  2WAC A;  4IUR A;  1PRL C;  2COZ A;  3JB9 D;  4M7D A;  2E64 A;  1NJI C;  1W70 A;  1G3T A;  4J7I A;  5GAN g;  2RA2 A;  3S3O A;  3HTR A;  4Y28 E;  1M1K R;  1M90 C;  5KYU A;  2E70 A;  2JVV A;  4A53 A;  2QXF A;  2VYT A;  2CP6 A;  2LNV A;  5IH2 A;  5GAN f;  1VQP T;  1NYF A;  4A4F A;  1NPR A;  5DLO A;  4HVW A;  2V8J A;  1SSF A;  3QDR B;  3A8M B;  2VUB A;  1N9S A;  1VQN T;  1X6O A;  1MMG A;  2DA9 A;  4M7D D;  2CH4 W;  1OZ2 A;  1AT1 B;  1ZSG A;  2XKO C;  3JSC A;  2EAY A;  3EFO B;  4J9H A;  3CCE T;  5D7U A;  3I5S A;  1YCY A;  2DXC A;  1VQ5 Q;  2QAZ A;  1Y71 A;  1PM3 A;  2DM1 A;  3OS1 A;  1MUZ A;  4PFP A;  3JB9 G;  4FU6 A;  4NL2 A;  3CCM Q;  1U5S A;  2VAS A;  1Z9Q A;  3OYG A;  3CCV A;  5GAN e;  2YUP A;  5CO7 A;  5IT9 E;  3JAM E;  2KEA A;  2OTL T;  2ZPH B;  1YJW T;  4RTZ A;  3VYH B;  4N4H A;  2DD5 A;  2O01 E;  4DOV A;  2KE9 A;  2CSI A;  3OYA A;  4EIK A;  4PJO B;  1MMD A;  3MET A;  1YJ9 Q;  2K79 A;  7AT1 B;  3C12 A;  1X01 A;  2E6N A;  3M54 A;  3G71 A;  3BE3 A;  1KD1 C;  5I21 A;  4PNO A;  3LWI A;  2PQW A;  2EWN A;  3X28 B;  3OQ5 A;  2EGE A;  4BAC A;  1ACM B;  1Y96 B;  2QGG A;  3CCR A;  1QLY A;  3EHR A;  2BE9 B;  1R8O B;  3FLG A;  3JB9 J;  1JQQ A;  4LUD A;  5I22 A;  2DL7 A;  2BZX A;  4K11 A;  1JRI A;  5A0L A;  5IHK A;  5GAN d;  3E1S A;  3I56 A;  1M1K U;  4C92 E;  4JDS A;  3CXC A;  2K3Y A; 
#chains in the Genus database with same CATH homology
 1SRL A;  2ENM A;  4CC2 A;  3TSW A;  4ESR A;  3NPF A;  4M4Z A;  2RQT A;  1T0J A;  2CSQ A;  3QWY A;  2W10 A;  3LH5 A;  2DJQ A;  1W1F A;  2DIL A;  3H0I A;  1K9A A;  3I9Q A;  4D8K A;  2BZY A;  2EQI A;  1W6X A;  2J06 A;  1YWO A;  2L3Q A;  2D8H A;  1AVZ C;  3EHQ A;  1GL5 A;  1SHF A;  1AZE A;  2C0T A;  1WXT A;  3H0F A;  1ZBJ A;  2FG0 A;  2OJ2 A;  2O9V A;  2K7A A;  1OEB A;  3CQT A;  4RTU A;  1M3C A;  5FW9 A;  2PTK A;  1X43 A;  1SHG A;  4FSS A;  3C0C A;  2EKH A;  1K4U S;  1GFD A;  4OMM A;  4RTW A;  2FO0 A;  1QKX A;  2KYM A;  1T0H A;  3H0H A;  4LNP A;  1JXO A;  2EGC A;  1OOT A;  4Z8A A;  1MV3 A;  1AWW A;  2V1R A;  1NEG A;  1PNJ A;  1YN8 A;  4AFU C;  1QWE A;  3VS3 A;  1KJW A;  2YDL A;  1FYN A;  1U3O A;  1WDX A;  1ZX6 A;  4OML A;  3VS0 A;  3VS4 A;  1V1C A;  2FPE A;  4J9C A;  1UG1 A;  4GBQ A;  2A37 A;  1NYG A;  1E7O A;  4R0K A;  2ED0 A;  4LN2 A;  4Z89 A;  4F16 A;  3TSZ A;  1QKW A;  1M3A A;  1NLO C;  2V1Q A;  2DL8 A;  1BK2 A;  4HCK A;  3NMZ C;  2CUD A;  2EW3 A;  2K6D A;  2D0N A;  3REB B;  1KSW A;  2GTJ A;  2LJ3 A;  2PZ1 A;  3VS5 A;  1TUD A;  2DRK A;  4CC3 A;  1GFC A;  2BZ8 A;  2F2V A;  4J9B A;  1YNZ A;  2J7I A;  4HVU A;  1X6G A;  2MIO A;  1H8K A;  1ZUU A;  2CT4 A;  2YUQ A;  2RPN A;  4JJC A;  2FPF A;  2KT1 A;  2JM9 A;  5ECA A;  1YWP A;  2LZ6 B;  1CKA A;  1UHC A;  4RTT A;  1E6H A;  3EG0 A;  4GLM A;  4JZ3 A;  2C0O A;  4AG2 C;  1Y57 A;  3IQL A;  3PVL A;  1WFW A;  3EGU A;  3M0P A;  1PKT A;  3M0U A;  1SRM A;  1NG2 A;  3UA6 A;  1GCQ C;  5I11 A;  2JS0 A;  1AOJ A;  2HSP A;  4OMO A;  2K9G A;  2A08 A;  1LCK A;  1X6B A;  1ZUK A;  2KRN A;  5IHN A;  1KFZ A;  1RLQ C;  2K2M A;  1PKS A;  4RTY A;  1RUW A;  2O88 A;  1G83 A;  1CKB A;  1QWF A;  1SPK A;  1A0N B;  4CC4 B;  2LNH B;  1AWX A;  1GCQ A;  2KXC A;  2J6F A;  1QCF A;  1M27 C;  2JM8 A;  2PNI A;  2XMF A;  2J05 A;  4RTX A;  1X27 A;  2DL3 A;  1Y0M A;  5EC7 A;  3THK A;  2VKN A;  2EYZ A;  1GCP A;  2VVK A;  2CUB A;  2DRM A;  5FWB A;  2KT8 A;  1TG0 A;  1AEY A;  2L3S A;  1OPK A;  1MV0 B;  2M51 A;  1S1N A;  3ULR B;  4AFS C;  2FRY A;  2LMJ A;  1BBZ A;  5IXF A;  1WXB A;  2SEM A;  2AZS A;  3KFV A;  2O31 A;  2D1X A;  2CT3 A;  4J9I A;  1I0C A;  3GBQ A;  1X2Q A;  2RN8 A;  1ZUY A;  2AZV A;  1UHF A;  3VRZ A;  1M8M A;  1JEG A;  1UFF A;  1GBR A;  4Z88 A;  2O9S A;  2CDT A;  1SEM A;  2GNC A;  1AZG B;  4JJD A;  1JXM A;  2JT4 A;  1YP5 A;  3JV3 A;  1JO8 A;  1OPL A;  1VA7 A;  2EGA A;  2DBM A;  2LJ1 A;  4AFZ C;  2G6F X;  4QT7 A;  2YUN A;  5FWC A;  4A63 B;  1VYV A;  1NM7 A;  2DL5 A;  3PE0 A;  4LUE A;  4OMQ A;  5GJW B;  1I07 A;  2BTT A;  1M3B A;  1VYU A;  1HJD A;  2O2O A;  2L0A A;  2E5K A;  2YT6 A;  4OMP A;  3NGP A;  2RQV A;  1KIK A;  3VS7 A;  2A28 A;  1RI9 A;  2ROT A;  1WIE A;  2X3X D;  2HEQ A;  2JMC A;  3A98 A;  4OMN A;  2KGT A;  1UDL A;  2A36 A;  2M0Y A;  1Z9Z A;  2HDA A;  3UF4 A;  1HD3 A;  4DEY A;  1BB9 A;  3EG2 A;  2F2W A;  2JMA A;  1HSQ A;  2DYB A;  1WXU A;  2ROL A;  2DLP A;  2H8H A;  1I1J A;  2YUO A;  1IO6 A;  3H41 A;  1GRI A;  4JJB A;  5IXB A;  4D8D A;  3I5R A;  2JS2 A;  1E6G A;  2J6O A;  1ABO A;  2VWF A;  2DF6 A;  2X3W D;  2AKK A;  4RTV A;  1XOV A;  1J3T A;  2JTE A;  1B07 A;  1ABQ A;  4JZ4 A;  1RLP C;  2EYW A;  2RQU A;  2MCN A;  2DL4 A;  3NHN A;  1K1Z A;  1X69 A;  3VS6 A;  1K76 A;  1JU5 C;  4J9D A;  4DEX A;  2SRC A;  1VYT A;  2DMO A;  4Y92 A;  2NUZ A;  2DNU A;  4JPB W;  3SHW A;  2J6K A;  4IIM A;  2AK5 A;  2EBP A;  2P4R A;  1FMK A;  3RBB B;  2ED1 A;  1B3Q A;  3VS1 A;  1BU1 A;  2RNA A;  1PWT A;  2B86 A;  2JW4 A;  1ARK A;  1N5Z A;  3R6N A;  3UAT A;  2LP5 A;  1NEB A;  3M0T A;  3VRY A;  1UTI A;  4F14 A;  2DE0 X;  2I0N A;  2RQR A;  5HCK A;  1WLP B;  2CRE A;  3SEM A;  1PRL C;  2RQW A;  3ZL7 C;  1GBQ A;  2GGR A;  1W70 A;  2JXB A;  1UGV A;  1UEC A;  2FEI A;  1H3H A;  4X1V A;  1X2K A;  1UJ0 A;  1CSK A;  4KRT A;  2KRM A;  2W0Z A;  1H92 A;  4J9G A;  5IH2 A;  4AFQ C;  1NYF A;  2KYB A;  1AWO A;  4HVW A;  4LE9 A;  1UJY A;  2KR3 A;  3M0S A;  3VS2 A;  2KNB B;  2OAW A;  2HBW A;  4J9E A;  2LCS A;  2DA9 A;  3FJ5 A;  2MOX A;  1K0X A;  4HXJ A;  2CH4 W;  2ECZ A;  5GJV B;  1YCS B;  1ZSG A;  1TUC A;  4J9H A;  2KRS A;  3I5S A;  4E6R A;  1U06 A;  4CC7 A;  3O5Z A;  2YSQ A;  2EVR A;  2GBQ A;  2ABL A;  1AWJ A;  4ORZ A;  4RUG A;  1EFN A;  2DM1 A;  2RF0 A;  3RNJ A;  1MUZ A;  2KRO A;  1U5S A;  3U23 A;  1Z9Q A;  2C0I A;  2DVJ A;  2YUP A;  3REA B;  2LJ0 A;  4J9F A;  1ZLM A;  1T3L A;  5L23 A;  2HCK A;  1OV3 A;  2KEA A;  2K3B A;  2OI3 A;  2DBK A;  3EG1 A;  4RTZ A;  2LQW A;  4ZNX A;  3EG3 A;  1AD5 A;  1G2B A;  2KE9 A;  2KXD A;  2CSI A;  4EIK A;  2CH4 A;  2F2X A;  4HVV A;  2EYX A;  2K79 A;  4WCI A;  2GQI A;  3M0Q A;  2EPD A;  1WA7 A;  1WX6 A;  2FRW A;  2AKL A;  1UUE A;  2DX1 A;  2LX7 A;  2GTO A;  2NWM A;  2QDL A;  2EGE A;  1SSH A;  1PHT A;  3QWX X;  2EYY A;  2L3P A;  2D8J A;  2KBT A;  2RMO A;  1QLY A;  2LQN A;  3EHR A;  4IIO A;  3TVT A;  3M0R A;  1JQQ A;  4LUD A;  4F17 A;  5I22 A;  4AG1 C;  2ESW A;  2DL7 A;  2IIM A;  3PVQ A;  1WI7 A;  2BZX A;  4K11 A;  5IHI A;  1T3S A;  1UE9 A;  5IHK A;  1M30 A;  1NLP C;  2L2P A;  1WYX A;  1PRM C;  3I35 A;  1K0S A;  2FPD A;  3UA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...