1RI9A

Structure of a helically extended sh3 domain of the t cell adapter protein adap
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
EKEEKDFRKKFKYDGEIRVLYSTKVTTSITSKKWGTRDLQVKPGESLEVIQTTDDTKVLCRNEEGKYGYVLRSYLAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Helically Extended SH3 Domain of the T Cell Adapter Protein ADAP.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords FYN-binding protein
total genus 8
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2003-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ri9A00
4Z88A 2NUZA 3REBB 1HJDA 4K11A 4LUDA 1S1NA 1GCQA 1Z9ZA 3M0UA 2G6FX 2J05A 2B86A 1E6GA 4LNPA 3UA7A 2HSPA 3EG3A 1QCFA 3PE0A 2FO0A 2D8HA 1UTIA 1XOVA 1WYXA 3ZL7C 3THKA 1OV3A 2DE0X 1H92A 1NLOC 3EG2A 4AG1C 5FWCA 3EG0A 2JMAA 4RUGA 1AZEA 1GFCA 4LN2A 4J9CA 2A28A 1K1ZA 2LJ0A 1K0XA 2QDLA 1BBZA 1KFZA 5I11A 4J9DA 3U23A 1M3BA 3UA6A 2DL8A 1QWFA 2O2OA 1RUWA 4OMPA 2O31A 4F14A 3VS6A 2LP5A 2A08A 3VS3A 4CC7A 1OPLA 2D8JA 2M0YA 1SHGA 4KRTA 1PNJA 2PZ1A 4JZ3A 2PTKA 4A63B 2O88A 2OAWA 2KRSA 2F2VA 2MOXA 4HXJA 2W0ZA 2HDAA 3C0CA 2RPNA 1GFDA 1X6GA 3R6NA 1GL5A 4HVWA 2K9GA 1UJ0A 2GTJA 4JJCA 3H0FA 1NG2A 1X43A 2J6OA 2LX7A 2MIOA 4D8KA 2CSIA 1KIKA 4OMQA 4LUEA 1PRMC 1QKWA 5IHKA 2YUNA 1RLPC 3RBBB 2AK5A 5FWBA 2KYMA 4E6RA 3I5RA 1BB9A 2BTTA 1BK2A 4OMLA 1UDLA 3A98A 3EHRA 2KRMA 1AD5A 1T3SA 1H3HA 4IIMA 4J9IA 4JJDA 3M0TA 2KNBB 5IHIA 1T0HA 1ZUKA 3TVTA 2GTOA 2EGEA 1MV3A 2HBWA 2L3QA 4EIKA 4RTVA 1FMKA 1U3OA 2JW4A 1TUCA 1YP5A 1YWOA 5IXBA 2A36A 1KJWA 1EFNA 1VYUA 1K9AA 2KT1A 2LMJA 2X3XD 3LH5A 3I35A 1JEGA 2ED0A 1SRLA 1M30A 1W6XA 2DJQA 2K79A 2FRWA 4RTYA 1Y0MA 2KXDA 1QKXA 5IH2A 1K0SA 2AKLA 2D1XA 5GJVB 1OPKA 5I22A 2EYYA 2LZ6B 1M3CA 1M27C 4OMMA 2IIMA 2DMOA 4J9FA 1JQQA 2I0NA 1OOTA 1VYTA 2GGRA 2RN8A 1UECA 2A37A 1NM7A 1WXBA 2CSQA 3TSZA 2LQNA 2RQWA 2V1QA 2ESWA 3O5ZA 1NYFA 2K3BA 2C0TA 2BZ8A 3M0QA 4QT7A 2O9VA 2X3WD 1X2QA 5IHNA 4CC3A 3TSWA 1UG1A 5FW9A 1WXUA 1UE9A 2AKKA 4OMOA 2DBMA 1TUDA 1WI7A 1QWEA 3REAB 1SSHA 2AZVA 2DVJA 4F16A 1AWWA 4GBQA 4Y92A 2J7IA 1GBRA 2DM1A 3H0IA 1I0CA 1K4US 1T3LA 2L3SA 2DILA 3IQLA 4RTUA 1SRMA 4R0KA 2PNIA 2FPEA 3QWXX 4OMNA 1PKTA 4IIOA 1SEMA 3EGUA 4HVVA 2JTEA 2DRKA 3I9QA 4AFZC 2M51A 2BZYA 2JT4A 4FSSA 4RTZA 3RNJA 2DA9A 1E7OA 2EBPA 1J3TA 1WA7A 2W10A 2RQVA 5HCKA 4GLMA 3NHNA 2EQIA 1G2BA 2KROA 1VYVA 1FYNA 1M3AA 1WFWA 2DBKA 3VS1A 4ESRA 3QWYA 2XMFA 1A0NB 2DF6A 1ZSGA 2GBQA 4M4ZA 1B07A 1X6BA 1SHFA 1WLPB 1MUZA 2CUDA 1YN8A 3KFVA 2YUQA 2GNCA 2ROLA 2OI3A 1WIEA 3M0SA 1Z9QA 2JMCA 1GCPA 1UHCA 1JO8A 1CSKA 2LQWA 2CH4A 1ZUYA 2YUOA 3M0RA 1ABQA 1X69A 2EPDA 1AEYA 2EW3A 2J6KA 2D0NA 2JM8A 1X27A 1CKBA 2C0IA 1X2KA 3VS4A 4DEYA 2DL4A 2E5KA 1GRIA 4LE9A 2LNHB 2LJ1A 1AVZC 2L3PA 1WDXA 3VRYA 2F2WA 1TG0A 2VWFA 2JS2A 2CT3A 2CUBA 1UGVA 1SPKA 1B3QA 1K76A 1YWPA 1ZLMA 2CH4W 1U06A 2NWMA 3CQTA 2DLPA 2P4RA 2FPFA 1N5ZA 2KBTA 4ORZA 1IO6A 1HD3A 2DL5A 2ED1A 2K2MA 2FG0A 4Z8AA 2C0OA 2CREA 3VRZA 1RLQC 2YDLA 4RTXA 2AZSA 1KSWA 4WCIA 1M8MA 2YSQA 2JS0A 1V1CA 1E6HA 1PKSA 3M0PA 2OJ2A 2KR3A 3GBQA 1ABOA 2JM9A 2RQTA 2EGCA 2K6DA 2H8HA 2KRNA 3H0HA 2MCNA 2L0AA 1PHTA 4AFQC 1AWXA 4ZNXA 4Z89A 2HEQA 4HCKA 2KYBA 3PVLA 2DL3A 4CC4B 4CC2A 2CT4A 2JXBA 2RNAA 2CDTA 1PWTA 5IXFA 1JXMA 1UFFA 1GBQA 4X1VA 2EGAA 2LJ3A 3VS2A 1U5SA 4JPBW 5GJWB 3UATA 3FJ5A 4JJBA 1RI9A 3VS0A 3EHQA 2EKHA 3SEMA 2EYWA 4F17A 1ARKA 2RMOA 2DRMA 5L23A 1AWOA 2DNUA 2EVRA 4J9BA 4AFSC 2SEMA 1BU1A 1W70A 4J9HA 1T0JA 2K7AA 1NEGA 2BZXA 3SHWA 3NMZC 1QLYA 1AOJA 2KT8A 2DL7A 1VA7A 1W1FA 1AZGB 2DYBA 2GQIA 2YT6A 1UJYA 1H8KA 1UUEA 4J9EA 2KXCA 2J6FA 4DEXA 1YNZA 1AWJA 2V1RA 1LCKA 2SRCA 2KE9A 1GCQC 2ENMA 1MV0B 1I1JA 3ULRB 2FRYA 2ECZA 2ABLA 3VS7A 4RTWA 4HVUA 2O9SA 2VKNA 1CKAA 3EG1A 1OEBA 2RF0A 1UHFA 2HCKA 2VVKA 1WX6A 1G83A 2KEAA 4AG2C 3NPFA 3NGPA 5ECAA 4RTTA 1NLPC 1YCSB 2J06A 2ROTA 4J9GA 3PVQA 3JV3A 3UF4A 3I5SA 1JU5C 2EYZA 2RQUA 2KGTA 4D8DA 2FPDA 1PRLC 2RQRA 1HSQA 1ZUUA 1ZX6A 2L2PA 1I07A 1ZBJA 2F2XA 2YUPA 4AFUC 2FEIA 1JXOA 1Y57A 1NEBA 1WXTA 1NYGA 2LCSA 3H41A 2DX1A 4JZ4A 2EYXA 3VS5A 5EC7A
chains in the Genus database with same CATH superfamily
4K11A 5D7UA 1YI2T 3SDZA 1M5Q1 1GCQA 1Z9ZA 3CBOA 3MKDA 3JCMP 2J05A 1VIFA 2B86A 2FVUA 2GF7A 3EH2A 4XAXB 2QQSA 1YJ9T 4BDZA 3JCMQ 4ZGEB 4II1A 3PE0A 1RAAB 1EZZB 2CZ0B 2HKNA 3OS5A 3THKA 3H6ZA 1H92A 3JCMh 5GAMf 3EG2A 2KQWA 3HTRA 5FWCA 3EG0A 2KAFA 1N8RU 3E1SA 1K0XA 2QDLA 2V8IA 5I11A 3CMET 1N27A 3S3OA 2O2OA 1KG1A 4OMPA 3BY7A 4OF1A 3L42A 1SKUB 1TTHB 3VS3A 4CC7A 4KRTA 3CCUQ 5FRMA 2QYZA 1PNJA 2MOXA 3S3NA 2HDAA 3C0CA 1MMDA 2HAXA 1QCOA 4FCYA 3QZ9B 2CP7A 1G5VA 1X6GA 3PMIA 5L8RE 3R6NA 1GL5A 4BE2A 1VQ5Q 2NLUA 3KXTA 3SWNB 4JJCA 1NG2A 1X43A 2J6OA 2LX7A 2FZCB 4V2SA 4OMQA 4IUPA 2AK5A 3RERA 3CCJQ 1BB9A 4M77B 2BTTA 1NJIU 3RMQA 1UDLA 4OP0A 2ZPFB 1NE8A 4J9IA 4JJDA 1KD1R 3SWNC 5IHIA 1T0HA 4KBMB 4AMCA 1PM3A 1ZUKA 2VGMA 3TVTA 5IN1A 2D9TA 4M7AB 4HT9A 4DOVA 1I5OB 1YWOA 3VYGA 1KJWA 1EFNA 3OBWA 3OYMA 1VYUA 2X3XD 3C95A 4QVZA 4OB0B 2O4XB 4RTYA 1Y0MA 1YIJQ 1SSFA 5GAMe 5IH2A 3V8KA 3OW2S 4J83A 5GJVB 4M77G 1PC0A 1H3ZA 2DD4A 5I22A 3DKMA 4F7UG 1M27C 3MHXA 3ASKA 2IIMA 3VYHB 1Q86R 2P0KA 3OYBA 1VYTA 4XTVA 4FW1A 4JRIA 4M75D 1MNDA 3L1AA 2LQNA 2ESWA 3O5ZA 1NYFA 3JCMb 1D3BB 2DERA 3M0QA 1D1CA 1V76A 2O9VA 3KUFA 4CC3A 3I56Q 5GAN7 1LVKA 1NZ9A 2AKKA 4OMOA 2DBMA 4XTXA 1KHCA 1TUDA 2M0OA 1D0ZA 1Y96B 4UC4A 4F16A 1HK9A 2QA4Q 1GBRA 1UGSB 1C1AA 3OMCA 1BCOA 4J7IA 1T3LA 3IQLA 4RTUA 2QQRA 2RH2A 3FC3A 2PNIA 2FPEA 4LDUA 4IIOA 2PVOB 2OTLT 2QTXA 3L2WA 4NOYA 2ZPHB 4XU1A 1B7TA 4C0DC 4RTZA 2KDSA 2DA9A 4C92C 4XTZA 3CCEA 2EBPA 2R5AA 1J3TA 4ZTFA 5HCKA 3JCMc 4JRPA 1Y7XA 3PIPA 1VYVA 1FYNA 1M3AA 1GXIE 3QHSA 3WVEB 2DIQA 4M7DF 1O9SA 5I2SA 1JRIA 4ATOA 2XMFA 1A0NB 2DF6A 4C92F 4E7SA 9ATCB 5LJ3h 2CUDA 4C0FA 1Q86C 1YN8A 3OYAA 3CMEQ 3JB9H 2VASA 3RUXA 4Y91A 3M0SA 2EAYA 3JCMW 3URGA 1O75A 1CSKA 2LQWA 3QPHA 3A8HB 2PU9B 1ABQA 2Z0WA 2EW3A 2J6KA 4Q5WA 1X27A 2C0IA 1LJOA 2XU8A 3M59A 1P92A 2RJFA 2QGGA 3OMGA 5GMKl 2L3PA 2DXTA 3PFSA 3TQ7P 1VQLQ 2F2WA 1TG0A 1RAGB 5GAN8 3VKIA 1KQ1A 2CUBA 1UGVA 4E7KA 3FEOA 3AT1B 2NWMA 3VUZA 1U06A 1VQ6A 3VV0A 2P4RA 2OTJQ 4NL2A 2CZ7B 4M75E 4MMKA 4XK8E 1RAEB 1WPYA 1RL2A 4Z8AA 2DXBA 3VRZA 1RLQC 4OB2B 1D09B 1K9MR 3CCMQ 4E7ZA 1B34A 1VQ4A 4EMKB 3OW2A 1RAHB 3VUBA 3JAME 3JB9D 4LD9K 3PMTA 3AHUA 2EGCA 2R58A 2H8HA 1R0BG 3CC2T 3QZ5B 2EWNA 4PLLA 3SB2A 5M9OA 5CCAA 5GAMh 5LJ5g 2Y4YA 3EGDA 2E6ZA 2WSFE 2MMPA 5KE2A 2DL3A 1KC8C 2CS7A 2JXBA 2HL3A 2NUPA 4ZN3A 3BDLA 1OZ3A 1PWTA 1W2BP 1JXMA 3QUIA 1GBQA 4JRKA 1QVGP 3KBGA 3OYIA 4X1VA 2LJ3A 1QP3A 2BKDN 5GJWB 4JJBA 3OYDA 1FWZA 1OX8A 2OTJT 3SEMA 1ZA1B 3L2UA 3OB9A 2QEXA 3HP9A 5I2MA 3JCMJ 1VQLA 1AWOA 2EVRA 2SEMA 4FT2A 3SHWA 1NEGA 2BZXA 3HSBA 1AOJA 5DLQE 5HK0A 1W1FA 4PJJA 5FRNA 2DYBA 3JCMe 2FL7A 3OYFA 3OW2P 3CCVA 4NL3A 1M90C 3CC7T 4PFZA 2AHJB 2QDYB 3CC2Q 2PUOB 2RM4A 1OULA 2CP5A 5HKCA 1Y71A 5LJ5d 5LJ3g 2V8JA 4QW2A 2ENMA 1MV0B 3QIIA 2FRYA 1M90R 3HFNA 3CMEA 2ABLA 2XICA 3CCSQ 2L8DA 2O9SA 2DJZA 3EG1A 2RF0A 1UHFA 2R57A 2VVKA 1D3BA 1JB0E 2KEAA 3QBYA 2M16A 4PJOD 1YJNA 5KYYB 1NLPC 2MF2A 3G6EQ 2JN0A 3UF4A 5GANh 1IGUA 3I5SA 5FU7B 3CMAQ 2EYZA 2LT4A 3M53A 3CCVQ 1HSQA 1X6OA 4C92A 1ZX6A 2L2PA 3A8GB 1WJSA 1ZBJA 2F2XA 3JB9I 1C6VX 4AFUC 1XQHA 2LQKA 3EGXA 2F69A 4WF2A 5GAN2 3VS5A 1WHJA 3CCSA 1UEBA 1OYXA 4M7DC 2YLCA 4Z88A 5KYNA 3CCET 4MZTA 4LUDA 5KE3A 4KGXB 5GANj 3RIRA 1YFNA 3S3MA 1YJWT 4FSXA 4JJNK 2D8HA 4KT0E 4QKUA 1UTIA 4TVRA 1WYXA 4E47A 5GANe 4J5YA 2DE0X 4MDWA 1UB4A 4IUVA 3CCRT 2BIVA 5LJ5h 2E5QA 4J9CA 3OYJA 1YHQQ 1SF9A 3C12A 1BBZA 1KFZA 5CKEA 4J9DA 3U23A 1M3BA 2MI6A 4C0GA 3X25B 1IGQA 2YXYA 3VS6A 2F5KA 4XU2A 3ZEHA 2HNIA 2PUKB 1K73U 1BI2A 1OPLA 2M0YA 1ZSZC 1U1TA 2PZ1A 3VU3C 4PL6A 1EIFA 2PTKA 5CKBA 3MEUA 1VQKA 2EJ9A 3VJPA 3M58A 2W0ZA 2RHZA 2HQHA 1QVFP 2RPNA 3GPLA 1GFDA 1FXXA 3DLLA 2G3RA 1WJQA 1FMWA 3DLMA 1UJ0A 2JOYA 2GTJA 3E2UA 3A5ZB 4D8KA 2CSIA 1KIKA 4C92D 2YUNA 1RLPC 4FM4B 2KYMA 3CCJA 2H3JA 3FRNA 4C0ZA 4KUIA 2VXEA 3V8LA 2HQXA 2KRMA 3CPWA 1JJ2A 1H3HA 2KNBB 4M7AA 2WACA 2GTOA 1MV3A 3CXCS 4MZPA 2HBWA 3RKYA 2X4JA 3QXEB 4NS5A 2JW4A 1TUCA 2KK4A 2VB6A 1OQKA 3CMAT 2KT1A 2LMJA 3LH5A 4J6YA 3ER0A 3CC7A 4ZGJB 2CYZB 2LDMA 4IUUA 3MP1A 4JLIA 1K0SA 5FU7C 3HRTA 1QW1A 4M78A 2DTHA 3RKXA 4OMMA 1Q86U 4L59A 1QVFA 1VQ9A 3JB9G 1QP2A 3CCEQ 1QMCA 1UECA 3BW1A 1NM7A 2QEXT 2Y4XA 1S72Q 2RQWA 1QCNA 1YJWQ 2RK1A 3O8VA 5CO7A 4F7UA 3QYGB 5KYUA 5KYYA 1X2QA 4M78E 3TSWA 5FW9A 5A0GA 1WI7A 2XDPA 2DVJA 1AWWA 3OYGA 4DBFA 3G4SA 2J7IA 2DFUA 1UGQB 1I0CA 3CC2A 1K8AR 5C0MA 5GAN3 3FLGA 3SFMA 2L3SA 1SRMA 4R0KA 1VQ8A 1RAIB 1VQOT 1PKTA 2XDBA 2FB7A 1YJ9A 3J7AF 2DRKA 3I9QA 1MMNA 2M51A 2CKKA 4M77A 1E7OA 2DZCA 5GMKj 1H641 4HT8A 3CC4T 2RI2A 2JJ9A 3S6WA 3CCMT 1WFWA 2PVGB 4ESRA 4KH1B 3JSCA 1AT1B 2L5QA 3QWYA 4RKUE 1KC8U 3J80E 1N8RR 1KQ2A 4M4ZA 4KGVB 2LTOA 1SHFA 1WLPB 3LWIA 1N9SA 5CAIA 2YUQA 3M56A 2GNCA 3OYCA 4F7UF 5A0LA 4BY6B 4PJOB 2YLBA 1JO8A 2K4YA 3OY9A 3MO8A 3M0RA 1X69A 1BIBA 1ZHIA 2VYTA 1AEYA 2EIFA 1VQ4Q 1Y96A 4M7DE 6AT1B 1I8FA 1CKBA 1W2BS 2GFAA 1X2KA 4M75B 5LJ5j 2COYA 1AVZC 3OS0A 5LJ3f 1WDXA 4OVAA 3LGFA 2EQKA 2VWFA 3CD6A 1M90U 1SG5A 2XI9A 2YRDA 1LPLA 3CXCP 3M57A 3HKSA 4PJNA 3CQTA 4RMOA 2EQUA 2KBTA 1X01A 1IO6A 1HD3A 3WVDB 2DL5A 4RG2A 2ED1A 2IVWA 4A4KA 2K2MA 1R8OB 4M78G 2FG0A 4EDUA 2CREA 3CPWS 1JJ2S 5DLOA 5GAMd 4FIBA 2AZSA 4WCIA 4PLIA 2YSQA 2JS0A 4BDYA 4B9WA 4JS5A 3M4GA 4M7DD 4PKCC 3X28B 1K9MC 1VQ7T 2K6DA 2KRNA 3H0HA 2CZ6B 3LX7A 4LXCA 1PHTA 4AFQC 2P4TA 2HEQA 4HCKA 3L2VA 4C5GA 2RNAA 2ZAEA 1TH7A 2E1HA 5GAMj 2EGAA 2V26A 3A8MB 5GMKe 1U5SA 5GAOq 2ATCB 1ZQ1A 1RI9A 3VS0A 3RKWA 2RI3A 2VV5A 2EKHA 2YWWA 4F17A 3G71T 2E6NA 2RO0A 3OYEA 1ARKA 2RMOA 4OMFB 1BU1A 2M02A 4J9HA 4C92G 2K7AA 1VQMA 3NMZC 2JTFA 1OX9A 4LDYA 3PNWC 1AZGB 2E3HA 1UJYA 1VQ8T 4DEXA 3FB9A 4BE0A 1VOMA 1AWJA 1RADB 4J8OA 1QVFS 4PJOF 3EFOB 1WHLA 1I1JA 3ULRB 4F7UE 5IAYA 2CP0A 1R0CB 4HVUA 4RTWA 1K73C 2P84A 2VKNA 2IG0A 5GMKh 2HCKA 1WX6A 5I21A 4FT4A 3NPFA 3NGPA 4CI0C 4RTTA 4B9XA 1YCSB 1KQSS 3M54A 4OGCA 2DO3A 4M7AF 1MGQA 1B34B 1G8XA 2FPDA 1PRLC 3X24B 1I07A 1VIEA 4C8QC 4L6V5 1MMGA 2PQWA 3RESA 2X9HA 4X9DA 3M9QA 2EYXA 2O01E 5GMKi 3GOXA 4M7DG 3JCMX 2NUZA 3A1PA 2KY9A 3J81E 3SD4A 2ZPIB 4RCBA 4C5EA 4LDWA 4LNPA 3EFRA 3UA7A 3JCMg 1RI0A 3EG3A 1QCFA 2D0QB 3LW5E 1D0XA 5LJ3d 2DZ9A 1YIJT 2YRCA 4C8QD 5C6SA 4ANJA 1XOVA 4FYYB 1UGRB 4J6XA 1BCMA 3CCQT 1NLOC 4AG1C 2E41A 2L89A 4ZTJA 2JMAA 4RUGA 1AZEA 1GFCA 4LN2A 3HRUA 2A28A 1K1ZA 2LJ0A 2B8AA 2RHIA 4JUVA 3M4YA 2X35A 2X4WA 3ZBDA 5CKFA 1RUWA 2O31A 4F14A 1YJNQ 2LP5A 2LQ8A 1X75C 2A08A 4XU3A 1WQ7A 3CBPA 4C8QG 2D8JA 1SHGA 3P8HA 4JZ3A 1IHWA 5GAOl 4C0DB 2O88A 1OI1A 1WGSA 2OAWA 3A8LB 3OA6A 2KRSA 4C8QE 5A2QE 1W2BA 2BE9B 4HXJA 4BD3A 1VQ7Q 1NBEB 2RK2A 2K2VA 4X9CA 2XHCA 2K5IA 1ZSZB 4O6JA 5AYFA 3CCLA 4HVWA 2CP6A 3QO3A 2K9GA 5HY6A 2MWOA 2Y90A 1TSFA 3H0FA 3DB3A 3LYIA 2MIOA 3CD6T 3V7CA 4J7FA 1QKWA 1LNXA 3RBBB 5FWBA 1Q82C 7AT1B 1BK2A 2A0FB 3CC7Q 3HPWA 3ME9A 3A98A 1LOJA 3EGXB 5D6YA 2AT1B 3M0TA 2VC8A 3OSSC 4A4EA 3PTAA 4EPCA 1N9RA 2QA4A 4EIKA 1FMKA 4ELZC 5IXBA 2A36A 5J39A 3CCQA 2RI5A 2GCXA 1U1SA 3I56A 1K9AA 4OGEA 4RG8A 3I35A 2ED0A 1SRLA 1M30A 1W6XA 2DJQA 2ZPGB 1PSEA 2FRWA 2FZKB 1QKXA 4C8QA 5GAN4 5FU6B 2AKLA 2K3XA 1OPKA 2LC4A 2EYYA 3LWHA 2LZ6B 2PVDB 4MDXA 4E2FB 2EJFA 5KYXB 2QAZA 1KQSP 2KSSA 4R56A 2BE7D 1JBMA 3X20B 3CCVT 1JQQA 8ATCB 3QJ6A 2QQAA 2RN8A 3EH1A 2XKOC 2A37A 1FMVA 1WXBA 3GF5A 2L3RA 2V1QA 4N4GA 3LH0A 3CC4A 1YJ9Q 2K3BA 2BZ8A 4QT7A 1QVPA 1TOVA 3L2QA 2OAUA 1VQLT 2X3WD 2DKGA 2DPPB 2LCCA 3GNGA 5IHNA 1VQPA 1YJNT 3JRZA 4FL6A 1UG1A 1WXUA 2QQ9A 3CCQQ 1UE9A 2OTJA 2DTOA 4X34A 5FROA 3CPFA 3R6OA 1QWEA 3REAB 5EG2A 4M77C 4B6MA 1NPRA 2X4XA 4E7IA 2LT1A 3EFSA 3H0IA 2HD0A 4E7HA 1PG5B 2X51A 2DILA 4DBHA 5GAOm 2RB6A 3QWXX 4QVDA 1UGPB 1YHQT 4OMNA 4PJMA 1SEMA 4EMHA 2JTEA 4RCCA 5LJ3j 2HZYA 2DTIA 5GAOp 4AFZC 2MYSA 3BDUA 4FSSA 1G3SA 3Q1JA 3CCLQ 2RJDA 3QDFA 4CRIA 3PT9A 4KGZB 1WA7A 2W10A 1K9MU 2RA2A 2RQVA 3G7ZA 1I5LA 3L2RA 3NHNA 2KROA 1VQMT 2EFIA 3FJPA 2DEUA 2DBKA 2I2LA 2OTLQ 1U8RA 1YI2Q 3CCUA 1M2VA 1VQ6T 1MUZA 2KVQG 1D0YA 3KFVA 2XIDA 4DQ2A 2ROLA 2OI3A 1WIEA 2GFUA 1Y07A 4VUBA 1GCPA 1XTDA 3CMAA 4E7LA 2ZCFB 2KMTA 5KYUB 2HKQB 2CH4A 4M78C 1ZUYA 2YUOA 3C94A 3PIOA 2NUTB 2DIGA 1Q81C 2D0NA 3OYHA 4M75A 4GLKA 4QVCA 1HYOA 4DEYA 4R55A 4F04B 2E5KA 5GAN6 1GRIA 4LE9A 2LNHB 3CCRQ 2LJ1A 2H3EB 3MP8A 3E9GA 3A8OB 3VRYA 5CKHA 3JB9J 1OZ2A 2JS2A 2CT3A 4LD6A 4QQ6A 4N0AC 1K76A 1ZLMA 2CH4W 3E19A 2DLPA 2F5TX 4J6WA 2FPFA 3FIFA 4ORZA 2MK5A 2EYQA 2COWA 5J26A 3HFOA 5CQYA 1WHKA 1NJIR 4YTLA 2YDLA 4XTWA 2EQMA 1KSWA 4BI8B 3RDVA 3NTHA 4EMKA 5CKDA 1E6HA 1PKSA 3M0PA 1R77A 3LLRA 3I55T 2RQTA 1KK7A 5LL6S 1M2VB 3EGDB 3OQ5A 2L0AA 2X4YA 1AWXA 4ZNXA 2QA4T 4Z89A 4WTOB 3PVLA 3QG1A 4ELYC 2NUPB 4CC4B 4CC2A 2CT4A 4QQDA 5IXFA 1I4K1 1Q95G 2M1HA 1UFFA 5GAMg 1M1KR 5GMKm 2GQVA 4O5VA 3UATA 3I55A 2COZA 2K5FA 2MAMA 3EHQA 2XDDA 4M75F 2LRQA 5LJ3e 3JB9F 3OYLA 3OYKA 4A4GA 1ACMB 1Q81R 4AFSC 4LDXA 1W70A 3OYNA 1BYMA 4M7DB 1WZOA 1TXQA 2DXCA 3RR6A 1QLYA 4M75C 1VQMQ 2KT8A 2YHTA 2QGFB 1ZA2B 1VA7A 2DEQA 5LJ5f 2GQIA 2EQJA 4J9EA 2KXCA 1YNZA 1M1FA 2E64A 3META 2QXFA 1LCKA 2ZPBB 2SRCA 4OB1B 5J3BA 4A4HA 1GCQC 3QJYA 1VQOA 2NYSA 1BI0A 2ECZA 3VS7A 4PNOA 1CKAA 1OEBA 2A3LA 4FYWB 1BI3A 1G83A 2FHDA 4OB3B 3UPUA 4BB7A 4BE1A 2EKOA 2XG8D 1IXDA 3G4ST 4KUDK 2K5LA 2J06A 2ROTA 4MZMA 1VQNA 4L5GA 1S72A 1JU5C 1VQNQ 2DYIA 2KGTA 3GIBA 4HCBA 2RQRA 3H9NA 1ZUUA 1VQ9Q 3TU4K 1MMAA 1KC8R 4C92B 5GANg 1JXOA 2VUBA 1NYGA 4KULA 3EAEA 2LCSA 2RJEA 1Q82U 3OS2A 2QK0A 1Q82R 4IKFA 3REBB 1HJDA 1Q7YR 4BUGA 1VQ9T 1S1NA 1BKBA 4N4IA 4M7AE 3M0UA 2G6FX 2HSEB 1KD1C 1E6GA 2HSPA 1M1KU 3I55Q 3CXCA 2FO0A 3P8DA 1Q7YC 5KYWA 1D1BA 2VXFA 3E9FA 3ZL7C 1OV3A 2M9UA 3MEAA 4BACA 4GY5A 2DK3A 3JCMV 5CR2A 4C5IA 1NPPA 2AIRB 3M5AA 1S72T 4QQGA 1PD0A 1VQNT 3GNFB 3T9NA 3MEWA 2O4XA 5CK9A 1IHVA 2K3YA 3UA6A 4HCCA 2DL8A 1QWFA 3JCMf 4XTUA 4PJOE 2BUDA 4M7AD 1F1BB 2CP3A 2FYKA 3NFCA 2HQEA 2K57A 1M4ZA 4PFPA 4A63B 1PD1A 3OS1A 2F2VA 3CBMA 1D1AA 1VQ6Q 4XU0A 3NTIA 2ZGWA 3GP8A 5DY9A 4BI4A 1RACB 4JLGA 4M78D 2DETA 3BFMA 4HKEA 3G71A 5FU6C 5GAN5 4PJLA 1K8AC 4A4FA 1DJ7B 1TWBA 4LUEA 1PRMC 5IHKA 4E6RA 3I5RA 1VQ8Q 1QVGA 4M77D 1AHJB 4C8QF 4OMLA 3EHRA 1M8VA 1AD5A 1T3SA 4M75G 3PGGA 4IIMA 4M78F 2JNGA 2HBPA 2ZZDA 2MWPA 2C06A 3HRSA 2EGEA 4ME7A 3G4SQ 2L3QA 4RTVA 1U3OA 2E10A 1YP5A 4DA4A 2A7YA 3CCRA 1VQ7A 2RHYA 3H8ZA 1JEGA 3ZFJA 2CZ1B 3QSUA 1HXDA 2K79A 1YI2A 4C8QB 3TREA 2KXDA 1KHIA 4C92E 3NTKA 4M78B 3CCLT 1M1GA 2LNVA 2D1XA 4A53A 3L2ZA 1YJWA 2RHXA 1N8RC 1M3CA 3MP6A 2JUFA 2DMOA 3JCMd 4J9FA 2I0NA 1OOTA 1QQJA 1EX4A 2GGRA 4FU6A 2JZ2A 4HA8A 3UDCA 1M2OA 2CSQA 1IZ6A 4P5NA 3CCST 3TSZA 2CGHA 1MHNA 4D6WA 2C0TA 1Q81U 5A0DA 1IB8A 2OTLA 5D6XA 1WHMA 1RABB 5GAOr 4ZN1A 4LDVA 1G3WA 1W4SA 1SSHA 4EMGA 1OU8A 2AZVA 4GBQA 4Y92A 4Y28E 3G1JA 1TS9A 2WSEE 2E65A 4M7AG 3N5BB 2DM1A 4DBRA 1K4US 3QYHB 4FW2A 4DBQA 3FDRA 4PFOA 5GANd 2YRVA 2RJCA 3D7SB 3HL8A 1NJIC 3EGUA 4HVVA 4C5HA 2QQBA 2BZYA 2JT4A 5KCHA 4FYVB 2QG9B 2RD1A 3RNJA 1BIAA 4BI3A 1VUBA 3MJXA 3UWNA 4GLMA 3CCUT 2EQIA 1G2BA 4IUTA 5KYXA 1VQKQ 5CIUA 3VS1A 1WNLA 4JDSA 2D6FA 2QASA 1ZSGA 2GBQA 1B07A 1X6BA 8AT1B 2V8KA 1VQ5T 3C4SA 2OX7A 1Z9QA 3OBYA 2JMCA 3G6ET 5D6WA 2E4HA 1UHCA 3GLXA 2E70A 4M7AC 1YHQA 4PJOA 3TCJA 1PSFA 2LVMA 2NUTA 2E3IA 1BI1A 2EPDA 4M77E 2JM8A 4A54A 3OSVA 3CEYA 5KYWB 3VS4A 2ZPEB 2DL4A 3EFOA 4F7UB 2JVVA 1VQ5A 1WJRA 3INZA 1SPKA 2DAQA 1VQ4T 2QTVA 3SWNA 4IURA 3MPUB 1B3QA 1YWPA 2DD5A 5GAOn 1N5ZA 3HHTB 1OU9A 3M55A 1IRXA 3WXMB 5CQXA 2R5MA 2C0OA 2LCLA 1K73R 4RTXA 1RAFB 3V8JA 4JS4A 1XJWB 1TUGB 1M8MA 1YBYA 3TEEA 1V1CA 3CPWP 1JJ2P 2OJ2A 2LX9A 2KR3A 3GBQA 3X26B 2FZGB 1ABOA 1KQSA 2JM9A 2P0QA 1M9SA 2F1LA 2MPXC 4AT1B 2QI2A 5DM7R 5KH6A 2MCNA 2P0PA 4N4HA 1TU0B 2WSCE 4EMKC 3G6EA 2HL5C 1XNIA 3EG9B 3UT1A 2KYBA 1MNEA 3V7SA 2CDTA 1YCYA 1WQWA 3V7RA 1WHHA 1VQPT 3VS2A 3F70A 3CCJT 1VQOQ 4JPBW 3FJ5A 1QVGS 4N0AA 4KH0B 1I81A 1KD1U 2EYWA 1M1KC 3OYYA 4ZGDB 4IUQA 2DRMA 5L23A 1Q7YU 2DNUA 4J9BA 4M7DA 4Z02A 1T0JA 2DL7A 5CVIA 1VQKT 2IPOB 4FYXB 4MMLA 3QKJA 5FLXE 3G71Q 3MCAB 2YT6A 1H8KA 1UUEA 2XD0A 2QEXQ 5GANf 5HK3A 2J6FA 3BE3A 1C0MA 3I56T 2V1RA 2DXUA 2KE9A 2RHUA 3CD6Q 5KCOA 5IT9E 4E7JA 2JTMA 4XTYA 1N6AA 3LGLA 1IREB 1YITA 1VQPQ 2EJGA 4M77F 3DB4A 4JRQA 2CP2A 2E12A 2DVEA 4AG2C 5ECAA 1ZSZA 1WHGA 1G3TA 4J9GA 3PVQA 1ZBXA 3JV3A 4BY6C 4PJOC 1V29B 4PJOG 3CC4Q 3EG9A 1YITT 4HCZA 2RQUA 1FX7A 1G3YA 2KI7A 4D8DA 5LJ5e 2HMAA 4PK4A 3P8BB 4XQ3A 2YUPA 3RMSA 2FEIA 1Y57A 1NEBA 1WXTA 3MEVA 1PCXA 3CCMA 1K8AU 3H41A 2DX1A 4JZ4A 1YITQ 1YIJA 5EC7A 2XK0A 5AT1B 4DOWA 2VGNA 3QDRB
chains in the Genus database with same CATH topology
4Z88A 2NUZA 3REBB 1HJDA 4K11A 4LUDA 1S1NA 1GCQA 1Z9ZA 3M0UA 2G6FX 2J05A 2B86A 1E6GA 4LNPA 3UA7A 2HSPA 3EG3A 1QCFA 3PE0A 2FO0A 2D8HA 1UTIA 1XOVA 1WYXA 3ZL7C 3THKA 1OV3A 2DE0X 1H92A 1NLOC 3EG2A 4AG1C 5FWCA 3EG0A 2JMAA 4RUGA 1AZEA 1GFCA 4LN2A 4J9CA 2A28A 1K1ZA 2LJ0A 1K0XA 2QDLA 1BBZA 1KFZA 5I11A 4J9DA 3U23A 1M3BA 3UA6A 2DL8A 1QWFA 2O2OA 1RUWA 4OMPA 2O31A 4F14A 3VS6A 2LP5A 2A08A 3VS3A 4CC7A 1OPLA 2D8JA 2M0YA 1SHGA 4KRTA 1PNJA 2PZ1A 4JZ3A 2PTKA 4A63B 2O88A 2OAWA 2KRSA 2F2VA 2MOXA 4HXJA 2W0ZA 2HDAA 3C0CA 2RPNA 1GFDA 1X6GA 3R6NA 1GL5A 4HVWA 2K9GA 1UJ0A 2GTJA 4JJCA 3H0FA 1NG2A 1X43A 2J6OA 2LX7A 2MIOA 4D8KA 2CSIA 1KIKA 4OMQA 4LUEA 1PRMC 1QKWA 5IHKA 2YUNA 1RLPC 3RBBB 2AK5A 5FWBA 2KYMA 4E6RA 3I5RA 1BB9A 2BTTA 1BK2A 4OMLA 1UDLA 3A98A 3EHRA 2KRMA 1AD5A 1T3SA 1H3HA 4IIMA 4J9IA 4JJDA 3M0TA 2KNBB 5IHIA 1T0HA 1ZUKA 3TVTA 2GTOA 2EGEA 1MV3A 2HBWA 2L3QA 4EIKA 4RTVA 1FMKA 1U3OA 2JW4A 1TUCA 1YP5A 1YWOA 5IXBA 2A36A 1KJWA 1EFNA 1VYUA 1K9AA 2KT1A 2LMJA 2X3XD 3LH5A 3I35A 1JEGA 2ED0A 1SRLA 1M30A 1W6XA 2DJQA 2K79A 2FRWA 4RTYA 1Y0MA 2KXDA 1QKXA 5IH2A 1K0SA 2AKLA 2D1XA 5GJVB 1OPKA 5I22A 2EYYA 2LZ6B 1M3CA 1M27C 4OMMA 2IIMA 2DMOA 4J9FA 1JQQA 2I0NA 1OOTA 1VYTA 2GGRA 2RN8A 1UECA 2A37A 1NM7A 1WXBA 2CSQA 3TSZA 2LQNA 2RQWA 2V1QA 2ESWA 3O5ZA 1NYFA 2K3BA 2C0TA 2BZ8A 3M0QA 4QT7A 2O9VA 2X3WD 1X2QA 5IHNA 4CC3A 3TSWA 1UG1A 5FW9A 1WXUA 1UE9A 2AKKA 4OMOA 2DBMA 1TUDA 1WI7A 1QWEA 3REAB 1SSHA 2AZVA 2DVJA 4F16A 1AWWA 4GBQA 4Y92A 2J7IA 1GBRA 2DM1A 3H0IA 1I0CA 1K4US 1T3LA 2L3SA 2DILA 3IQLA 4RTUA 1SRMA 4R0KA 2PNIA 2FPEA 3QWXX 4OMNA 1PKTA 4IIOA 1SEMA 3EGUA 4HVVA 2JTEA 2DRKA 3I9QA 4AFZC 2M51A 2BZYA 2JT4A 4FSSA 4RTZA 3RNJA 2DA9A 1E7OA 2EBPA 1J3TA 1WA7A 2W10A 2RQVA 5HCKA 4GLMA 3NHNA 2EQIA 1G2BA 2KROA 1VYVA 1FYNA 1M3AA 1WFWA 2DBKA 3VS1A 4ESRA 3QWYA 2XMFA 1A0NB 2DF6A 1ZSGA 2GBQA 4M4ZA 1B07A 1X6BA 1SHFA 1WLPB 1MUZA 2CUDA 1YN8A 3KFVA 2YUQA 2GNCA 2ROLA 2OI3A 1WIEA 3M0SA 1Z9QA 2JMCA 1GCPA 1UHCA 1JO8A 1CSKA 2LQWA 2CH4A 1ZUYA 2YUOA 3M0RA 1ABQA 1X69A 2EPDA 1AEYA 2EW3A 2J6KA 2D0NA 2JM8A 1X27A 1CKBA 2C0IA 1X2KA 3VS4A 4DEYA 2DL4A 2E5KA 1GRIA 4LE9A 2LNHB 2LJ1A 1AVZC 2L3PA 1WDXA 3VRYA 2F2WA 1TG0A 2VWFA 2JS2A 2CT3A 2CUBA 1UGVA 1SPKA 1B3QA 1K76A 1YWPA 1ZLMA 2CH4W 1U06A 2NWMA 3CQTA 2DLPA 2P4RA 2FPFA 1N5ZA 2KBTA 4ORZA 1IO6A 1HD3A 2DL5A 2ED1A 2K2MA 2FG0A 4Z8AA 2C0OA 2CREA 3VRZA 1RLQC 2YDLA 4RTXA 2AZSA 1KSWA 4WCIA 1M8MA 2YSQA 2JS0A 1V1CA 1E6HA 1PKSA 3M0PA 2OJ2A 2KR3A 3GBQA 1ABOA 2JM9A 2RQTA 2EGCA 2K6DA 2H8HA 2KRNA 3H0HA 2MCNA 2L0AA 1PHTA 4AFQC 1AWXA 4ZNXA 4Z89A 2HEQA 4HCKA 2KYBA 3PVLA 2DL3A 4CC4B 4CC2A 2CT4A 2JXBA 2RNAA 2CDTA 1PWTA 5IXFA 1JXMA 1UFFA 1GBQA 4X1VA 2EGAA 2LJ3A 3VS2A 1U5SA 4JPBW 5GJWB 3UATA 3FJ5A 4JJBA 1RI9A 3VS0A 3EHQA 2EKHA 3SEMA 2EYWA 4F17A 1ARKA 2RMOA 2DRMA 5L23A 1AWOA 2DNUA 2EVRA 4J9BA 4AFSC 2SEMA 1BU1A 1W70A 4J9HA 1T0JA 2K7AA 1NEGA 2BZXA 3SHWA 3NMZC 1QLYA 1AOJA 2KT8A 2DL7A 1VA7A 1W1FA 1AZGB 2DYBA 2GQIA 2YT6A 1UJYA 1H8KA 1UUEA 4J9EA 2KXCA 2J6FA 4DEXA 1YNZA 1AWJA 2V1RA 1LCKA 2SRCA 2KE9A 1GCQC 2ENMA 1MV0B 1I1JA 3ULRB 2FRYA 2ECZA 2ABLA 3VS7A 4RTWA 4HVUA 2O9SA 2VKNA 1CKAA 3EG1A 1OEBA 2RF0A 1UHFA 2HCKA 2VVKA 1WX6A 1G83A 2KEAA 4AG2C 3NPFA 3NGPA 5ECAA 4RTTA 1NLPC 1YCSB 2J06A 2ROTA 4J9GA 3PVQA 3JV3A 3UF4A 3I5SA 1JU5C 2EYZA 2RQUA 2KGTA 4D8DA 2FPDA 1PRLC 2RQRA 1HSQA 1ZUUA 1ZX6A 2L2PA 1I07A 1ZBJA 2F2XA 2YUPA 4AFUC 2FEIA 1JXOA 1Y57A 1NEBA 1WXTA 1NYGA 2LCSA 3H41A 2DX1A 4JZ4A 2EYXA 3VS5A 5EC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z88 A;  2NUZ A;  3REB B;  1HJD A;  4K11 A;  4LUD A;  1S1N A;  1GCQ A;  1Z9Z A;  3M0U A;  2G6F X;  2J05 A;  2B86 A;  1E6G A;  4LNP A;  3UA7 A;  2HSP A;  3EG3 A;  1QCF A;  3PE0 A;  2FO0 A;  2D8H A;  1UTI A;  1XOV A;  1WYX A;  3ZL7 C;  3THK A;  1OV3 A;  2DE0 X;  1H92 A;  1NLO C;  3EG2 A;  4AG1 C;  5FWC A;  3EG0 A;  2JMA A;  4RUG A;  1AZE A;  1GFC A;  4LN2 A;  4J9C A;  2A28 A;  1K1Z A;  2LJ0 A;  1K0X A;  2QDL A;  1BBZ A;  1KFZ A;  5I11 A;  4J9D A;  3U23 A;  1M3B A;  3UA6 A;  2DL8 A;  1QWF A;  2O2O A;  1RUW A;  4OMP A;  2O31 A;  4F14 A;  3VS6 A;  2LP5 A;  2A08 A;  3VS3 A;  4CC7 A;  1OPL A;  2D8J A;  2M0Y A;  1SHG A;  4KRT A;  1PNJ A;  2PZ1 A;  4JZ3 A;  2PTK A;  4A63 B;  2O88 A;  2OAW A;  2KRS A;  2F2V A;  2MOX A;  4HXJ A;  2W0Z A;  2HDA A;  3C0C A;  2RPN A;  1GFD A;  1X6G A;  3R6N A;  1GL5 A;  4HVW A;  2K9G A;  1UJ0 A;  2GTJ A;  4JJC A;  3H0F A;  1NG2 A;  1X43 A;  2J6O A;  2LX7 A;  2MIO A;  4D8K A;  2CSI A;  1KIK A;  4OMQ A;  4LUE A;  1PRM C;  1QKW A;  5IHK A;  2YUN A;  1RLP C;  3RBB B;  2AK5 A;  5FWB A;  2KYM A;  4E6R A;  3I5R A;  1BB9 A;  2BTT A;  1BK2 A;  4OML A;  1UDL A;  3A98 A;  3EHR A;  2KRM A;  1AD5 A;  1T3S A;  1H3H A;  4IIM A;  4J9I A;  4JJD A;  3M0T A;  2KNB B;  5IHI A;  1T0H A;  1ZUK A;  3TVT A;  2GTO A;  2EGE A;  1MV3 A;  2HBW A;  2L3Q A;  4EIK A;  4RTV A;  1FMK A;  1U3O A;  2JW4 A;  1TUC A;  1YP5 A;  1YWO A;  5IXB A;  2A36 A;  1KJW A;  1EFN A;  1VYU A;  1K9A A;  2KT1 A;  2LMJ A;  2X3X D;  3LH5 A;  3I35 A;  1JEG A;  2ED0 A;  1SRL A;  1M30 A;  1W6X A;  2DJQ A;  2K79 A;  2FRW A;  4RTY A;  1Y0M A;  2KXD A;  1QKX A;  5IH2 A;  1K0S A;  2AKL A;  2D1X A;  5GJV B;  1OPK A;  5I22 A;  2EYY A;  2LZ6 B;  1M3C A;  1M27 C;  4OMM A;  2IIM A;  2DMO A;  4J9F A;  1JQQ A;  2I0N A;  1OOT A;  1VYT A;  2GGR A;  2RN8 A;  1UEC A;  2A37 A;  1NM7 A;  1WXB A;  2CSQ A;  3TSZ A;  2LQN A;  2RQW A;  2V1Q A;  2ESW A;  3O5Z A;  1NYF A;  2K3B A;  2C0T A;  2BZ8 A;  3M0Q A;  4QT7 A;  2O9V A;  2X3W D;  1X2Q A;  5IHN A;  4CC3 A;  3TSW A;  1UG1 A;  5FW9 A;  1WXU A;  1UE9 A;  2AKK A;  4OMO A;  2DBM A;  1TUD A;  1WI7 A;  1QWE A;  3REA B;  1SSH A;  2AZV A;  2DVJ A;  4F16 A;  1AWW A;  4GBQ A;  4Y92 A;  2J7I A;  1GBR A;  2DM1 A;  3H0I A;  1I0C A;  1K4U S;  1T3L A;  2L3S A;  2DIL A;  3IQL A;  4RTU A;  1SRM A;  4R0K A;  2PNI A;  2FPE A;  3QWX X;  4OMN A;  1PKT A;  4IIO A;  1SEM A;  3EGU A;  4HVV A;  2JTE A;  2DRK A;  3I9Q A;  4AFZ C;  2M51 A;  2BZY A;  2JT4 A;  4FSS A;  4RTZ A;  3RNJ A;  2DA9 A;  1E7O A;  2EBP A;  1J3T A;  1WA7 A;  2W10 A;  2RQV A;  5HCK A;  4GLM A;  3NHN A;  2EQI A;  1G2B A;  2KRO A;  1VYV A;  1FYN A;  1M3A A;  1WFW A;  2DBK A;  3VS1 A;  4ESR A;  3QWY A;  2XMF A;  1A0N B;  2DF6 A;  1ZSG A;  2GBQ A;  4M4Z A;  1B07 A;  1X6B A;  1SHF A;  1WLP B;  1MUZ A;  2CUD A;  1YN8 A;  3KFV A;  2YUQ A;  2GNC A;  2ROL A;  2OI3 A;  1WIE A;  3M0S A;  1Z9Q A;  2JMC A;  1GCP A;  1UHC A;  1JO8 A;  1CSK A;  2LQW A;  2CH4 A;  1ZUY A;  2YUO A;  3M0R A;  1ABQ A;  1X69 A;  2EPD A;  1AEY A;  2EW3 A;  2J6K A;  2D0N A;  2JM8 A;  1X27 A;  1CKB A;  2C0I A;  1X2K A;  3VS4 A;  4DEY A;  2DL4 A;  2E5K A;  1GRI A;  4LE9 A;  2LNH B;  2LJ1 A;  1AVZ C;  2L3P A;  1WDX A;  3VRY A;  2F2W A;  1TG0 A;  2VWF A;  2JS2 A;  2CT3 A;  2CUB A;  1UGV A;  1SPK A;  1B3Q A;  1K76 A;  1YWP A;  1ZLM A;  2CH4 W;  1U06 A;  2NWM A;  3CQT A;  2DLP A;  2P4R A;  2FPF A;  1N5Z A;  2KBT A;  4ORZ A;  1IO6 A;  1HD3 A;  2DL5 A;  2ED1 A;  2K2M A;  2FG0 A;  4Z8A A;  2C0O A;  2CRE A;  3VRZ A;  1RLQ C;  2YDL A;  4RTX A;  2AZS A;  1KSW A;  4WCI A;  1M8M A;  2YSQ A;  2JS0 A;  1V1C A;  1E6H A;  1PKS A;  3M0P A;  2OJ2 A;  2KR3 A;  3GBQ A;  1ABO A;  2JM9 A;  2RQT A;  2EGC A;  2K6D A;  2H8H A;  2KRN A;  3H0H A;  2MCN A;  2L0A A;  1PHT A;  4AFQ C;  1AWX A;  4ZNX A;  4Z89 A;  2HEQ A;  4HCK A;  2KYB A;  3PVL A;  2DL3 A;  4CC4 B;  4CC2 A;  2CT4 A;  2JXB A;  2RNA A;  2CDT A;  1PWT A;  5IXF A;  1JXM A;  1UFF A;  1GBQ A;  4X1V A;  2EGA A;  2LJ3 A;  3VS2 A;  1U5S A;  4JPB W;  5GJW B;  3UAT A;  3FJ5 A;  4JJB A;  1RI9 A;  3VS0 A;  3EHQ A;  2EKH A;  3SEM A;  2EYW A;  4F17 A;  1ARK A;  2RMO A;  2DRM A;  5L23 A;  1AWO A;  2DNU A;  2EVR A;  4J9B A;  4AFS C;  2SEM A;  1BU1 A;  1W70 A;  4J9H A;  1T0J A;  2K7A A;  1NEG A;  2BZX A;  3SHW A;  3NMZ C;  1QLY A;  1AOJ A;  2KT8 A;  2DL7 A;  1VA7 A;  1W1F A;  1AZG B;  2DYB A;  2GQI A;  2YT6 A;  1UJY A;  1H8K A;  1UUE A;  4J9E A;  2KXC A;  2J6F A;  4DEX A;  1YNZ A;  1AWJ A;  2V1R A;  1LCK A;  2SRC A;  2KE9 A;  1GCQ C;  2ENM A;  1MV0 B;  1I1J A;  3ULR B;  2FRY A;  2ECZ A;  2ABL A;  3VS7 A;  4RTW A;  4HVU A;  2O9S A;  2VKN A;  1CKA A;  3EG1 A;  1OEB A;  2RF0 A;  1UHF A;  2HCK A;  2VVK A;  1WX6 A;  1G83 A;  2KEA A;  4AG2 C;  3NPF A;  3NGP A;  5ECA A;  4RTT A;  1NLP C;  1YCS B;  2J06 A;  2ROT A;  4J9G A;  3PVQ A;  3JV3 A;  3UF4 A;  3I5S A;  1JU5 C;  2EYZ A;  2RQU A;  2KGT A;  4D8D A;  2FPD A;  1PRL C;  2RQR A;  1HSQ A;  1ZUU A;  1ZX6 A;  2L2P A;  1I07 A;  1ZBJ A;  2F2X A;  2YUP A;  4AFU C;  2FEI A;  1JXO A;  1Y57 A;  1NEB A;  1WXT A;  1NYG A;  2LCS A;  3H41 A;  2DX1 A;  4JZ4 A;  2EYX A;  3VS5 A;  5EC7 A; 
#chains in the Genus database with same CATH topology
 4K11 A;  5D7U A;  1YI2 T;  3SDZ A;  1M5Q 1;  1GCQ A;  1Z9Z A;  3CBO A;  3MKD A;  3JCM P;  2J05 A;  1VIF A;  2B86 A;  2FVU A;  2GF7 A;  3EH2 A;  4XAX B;  2QQS A;  1YJ9 T;  4BDZ A;  3JCM Q;  4ZGE B;  4II1 A;  3PE0 A;  1RAA B;  1EZZ B;  2CZ0 B;  2HKN A;  3OS5 A;  3THK A;  3H6Z A;  1H92 A;  3JCM h;  5GAM f;  3EG2 A;  2KQW A;  3HTR A;  5FWC A;  3EG0 A;  2KAF A;  1N8R U;  3E1S A;  1K0X A;  2QDL A;  2V8I A;  5I11 A;  3CME T;  1N27 A;  3S3O A;  2O2O A;  1KG1 A;  4OMP A;  3BY7 A;  4OF1 A;  3L42 A;  1SKU B;  1TTH B;  3VS3 A;  4CC7 A;  4KRT A;  3CCU Q;  5FRM A;  2QYZ A;  1PNJ A;  2MOX A;  3S3N A;  2HDA A;  3C0C A;  1MMD A;  2HAX A;  1QCO A;  4FCY A;  3QZ9 B;  2CP7 A;  1G5V A;  1X6G A;  3PMI A;  5L8R E;  3R6N A;  1GL5 A;  4BE2 A;  1VQ5 Q;  2NLU A;  3KXT A;  3SWN B;  4JJC A;  1NG2 A;  1X43 A;  2J6O A;  2LX7 A;  2FZC B;  4V2S A;  4OMQ A;  4IUP A;  2AK5 A;  3RER A;  3CCJ Q;  1BB9 A;  4M77 B;  2BTT A;  1NJI U;  3RMQ A;  1UDL A;  4OP0 A;  2ZPF B;  1NE8 A;  4J9I A;  4JJD A;  1KD1 R;  3SWN C;  5IHI A;  1T0H A;  4KBM B;  4AMC A;  1PM3 A;  1ZUK A;  2VGM A;  3TVT A;  5IN1 A;  2D9T A;  4M7A B;  4HT9 A;  4DOV A;  1I5O B;  1YWO A;  3VYG A;  1KJW A;  1EFN A;  3OBW A;  3OYM A;  1VYU A;  2X3X D;  3C95 A;  4QVZ A;  4OB0 B;  2O4X B;  4RTY A;  1Y0M A;  1YIJ Q;  1SSF A;  5GAM e;  5IH2 A;  3V8K A;  3OW2 S;  4J83 A;  5GJV B;  4M77 G;  1PC0 A;  1H3Z A;  2DD4 A;  5I22 A;  3DKM A;  4F7U G;  1M27 C;  3MHX A;  3ASK A;  2IIM A;  3VYH B;  1Q86 R;  2P0K A;  3OYB A;  1VYT A;  4XTV A;  4FW1 A;  4JRI A;  4M75 D;  1MND A;  3L1A A;  2LQN A;  2ESW A;  3O5Z A;  1NYF A;  3JCM b;  1D3B B;  2DER A;  3M0Q A;  1D1C A;  1V76 A;  2O9V A;  3KUF A;  4CC3 A;  3I56 Q;  5GAN 7;  1LVK A;  1NZ9 A;  2AKK A;  4OMO A;  2DBM A;  4XTX A;  1KHC A;  1TUD A;  2M0O A;  1D0Z A;  1Y96 B;  4UC4 A;  4F16 A;  1HK9 A;  2QA4 Q;  1GBR A;  1UGS B;  1C1A A;  3OMC A;  1BCO A;  4J7I A;  1T3L A;  3IQL A;  4RTU A;  2QQR A;  2RH2 A;  3FC3 A;  2PNI A;  2FPE A;  4LDU A;  4IIO A;  2PVO B;  2OTL T;  2QTX A;  3L2W A;  4NOY A;  2ZPH B;  4XU1 A;  1B7T A;  4C0D C;  4RTZ A;  2KDS A;  2DA9 A;  4C92 C;  4XTZ A;  3CCE A;  2EBP A;  2R5A A;  1J3T A;  4ZTF A;  5HCK A;  3JCM c;  4JRP A;  1Y7X A;  3PIP A;  1VYV A;  1FYN A;  1M3A A;  1GXI E;  3QHS A;  3WVE B;  2DIQ A;  4M7D F;  1O9S A;  5I2S A;  1JRI A;  4ATO A;  2XMF A;  1A0N B;  2DF6 A;  4C92 F;  4E7S A;  9ATC B;  5LJ3 h;  2CUD A;  4C0F A;  1Q86 C;  1YN8 A;  3OYA A;  3CME Q;  3JB9 H;  2VAS A;  3RUX A;  4Y91 A;  3M0S A;  2EAY A;  3JCM W;  3URG A;  1O75 A;  1CSK A;  2LQW A;  3QPH A;  3A8H B;  2PU9 B;  1ABQ A;  2Z0W A;  2EW3 A;  2J6K A;  4Q5W A;  1X27 A;  2C0I A;  1LJO A;  2XU8 A;  3M59 A;  1P92 A;  2RJF A;  2QGG A;  3OMG A;  5GMK l;  2L3P A;  2DXT A;  3PFS A;  3TQ7 P;  1VQL Q;  2F2W A;  1TG0 A;  1RAG B;  5GAN 8;  3VKI A;  1KQ1 A;  2CUB A;  1UGV A;  4E7K A;  3FEO A;  3AT1 B;  2NWM A;  3VUZ A;  1U06 A;  1VQ6 A;  3VV0 A;  2P4R A;  2OTJ Q;  4NL2 A;  2CZ7 B;  4M75 E;  4MMK A;  4XK8 E;  1RAE B;  1WPY A;  1RL2 A;  4Z8A A;  2DXB A;  3VRZ A;  1RLQ C;  4OB2 B;  1D09 B;  1K9M R;  3CCM Q;  4E7Z A;  1B34 A;  1VQ4 A;  4EMK B;  3OW2 A;  1RAH B;  3VUB A;  3JAM E;  3JB9 D;  4LD9 K;  3PMT A;  3AHU A;  2EGC A;  2R58 A;  2H8H A;  1R0B G;  3CC2 T;  3QZ5 B;  2EWN A;  4PLL A;  3SB2 A;  5M9O A;  5CCA A;  5GAM h;  5LJ5 g;  2Y4Y A;  3EGD A;  2E6Z A;  2WSF E;  2MMP A;  5KE2 A;  2DL3 A;  1KC8 C;  2CS7 A;  2JXB A;  2HL3 A;  2NUP A;  4ZN3 A;  3BDL A;  1OZ3 A;  1PWT A;  1W2B P;  1JXM A;  3QUI A;  1GBQ A;  4JRK A;  1QVG P;  3KBG A;  3OYI A;  4X1V A;  2LJ3 A;  1QP3 A;  2BKD N;  5GJW B;  4JJB A;  3OYD A;  1FWZ A;  1OX8 A;  2OTJ T;  3SEM A;  1ZA1 B;  3L2U A;  3OB9 A;  2QEX A;  3HP9 A;  5I2M A;  3JCM J;  1VQL A;  1AWO A;  2EVR A;  2SEM A;  4FT2 A;  3SHW A;  1NEG A;  2BZX A;  3HSB A;  1AOJ A;  5DLQ E;  5HK0 A;  1W1F A;  4PJJ A;  5FRN A;  2DYB A;  3JCM e;  2FL7 A;  3OYF A;  3OW2 P;  3CCV A;  4NL3 A;  1M90 C;  3CC7 T;  4PFZ A;  2AHJ B;  2QDY B;  3CC2 Q;  2PUO B;  2RM4 A;  1OUL A;  2CP5 A;  5HKC A;  1Y71 A;  5LJ5 d;  5LJ3 g;  2V8J A;  4QW2 A;  2ENM A;  1MV0 B;  3QII A;  2FRY A;  1M90 R;  3HFN A;  3CME A;  2ABL A;  2XIC A;  3CCS Q;  2L8D A;  2O9S A;  2DJZ A;  3EG1 A;  2RF0 A;  1UHF A;  2R57 A;  2VVK A;  1D3B A;  1JB0 E;  2KEA A;  3QBY A;  2M16 A;  4PJO D;  1YJN A;  5KYY B;  1NLP C;  2MF2 A;  3G6E Q;  2JN0 A;  3UF4 A;  5GAN h;  1IGU A;  3I5S A;  5FU7 B;  3CMA Q;  2EYZ A;  2LT4 A;  3M53 A;  3CCV Q;  1HSQ A;  1X6O A;  4C92 A;  1ZX6 A;  2L2P A;  3A8G B;  1WJS A;  1ZBJ A;  2F2X A;  3JB9 I;  1C6V X;  4AFU C;  1XQH A;  2LQK A;  3EGX A;  2F69 A;  4WF2 A;  5GAN 2;  3VS5 A;  1WHJ A;  3CCS A;  1UEB A;  1OYX A;  4M7D C;  2YLC A;  4Z88 A;  5KYN A;  3CCE T;  4MZT A;  4LUD A;  5KE3 A;  4KGX B;  5GAN j;  3RIR A;  1YFN A;  3S3M A;  1YJW T;  4FSX A;  4JJN K;  2D8H A;  4KT0 E;  4QKU A;  1UTI A;  4TVR A;  1WYX A;  4E47 A;  5GAN e;  4J5Y A;  2DE0 X;  4MDW A;  1UB4 A;  4IUV A;  3CCR T;  2BIV A;  5LJ5 h;  2E5Q A;  4J9C A;  3OYJ A;  1YHQ Q;  1SF9 A;  3C12 A;  1BBZ A;  1KFZ A;  5CKE A;  4J9D A;  3U23 A;  1M3B A;  2MI6 A;  4C0G A;  3X25 B;  1IGQ A;  2YXY A;  3VS6 A;  2F5K A;  4XU2 A;  3ZEH A;  2HNI A;  2PUK B;  1K73 U;  1BI2 A;  1OPL A;  2M0Y A;  1ZSZ C;  1U1T A;  2PZ1 A;  3VU3 C;  4PL6 A;  1EIF A;  2PTK A;  5CKB A;  3MEU A;  1VQK A;  2EJ9 A;  3VJP A;  3M58 A;  2W0Z A;  2RHZ A;  2HQH A;  1QVF P;  2RPN A;  3GPL A;  1GFD A;  1FXX A;  3DLL A;  2G3R A;  1WJQ A;  1FMW A;  3DLM A;  1UJ0 A;  2JOY A;  2GTJ A;  3E2U A;  3A5Z B;  4D8K A;  2CSI A;  1KIK A;  4C92 D;  2YUN A;  1RLP C;  4FM4 B;  2KYM A;  3CCJ A;  2H3J A;  3FRN A;  4C0Z A;  4KUI A;  2VXE A;  3V8L A;  2HQX A;  2KRM A;  3CPW A;  1JJ2 A;  1H3H A;  2KNB B;  4M7A A;  2WAC A;  2GTO A;  1MV3 A;  3CXC S;  4MZP A;  2HBW A;  3RKY A;  2X4J A;  3QXE B;  4NS5 A;  2JW4 A;  1TUC A;  2KK4 A;  2VB6 A;  1OQK A;  3CMA T;  2KT1 A;  2LMJ A;  3LH5 A;  4J6Y A;  3ER0 A;  3CC7 A;  4ZGJ B;  2CYZ B;  2LDM A;  4IUU A;  3MP1 A;  4JLI A;  1K0S A;  5FU7 C;  3HRT A;  1QW1 A;  4M78 A;  2DTH A;  3RKX A;  4OMM A;  1Q86 U;  4L59 A;  1QVF A;  1VQ9 A;  3JB9 G;  1QP2 A;  3CCE Q;  1QMC A;  1UEC A;  3BW1 A;  1NM7 A;  2QEX T;  2Y4X A;  1S72 Q;  2RQW A;  1QCN A;  1YJW Q;  2RK1 A;  3O8V A;  5CO7 A;  4F7U A;  3QYG B;  5KYU A;  5KYY A;  1X2Q A;  4M78 E;  3TSW A;  5FW9 A;  5A0G A;  1WI7 A;  2XDP A;  2DVJ A;  1AWW A;  3OYG A;  4DBF A;  3G4S A;  2J7I A;  2DFU A;  1UGQ B;  1I0C A;  3CC2 A;  1K8A R;  5C0M A;  5GAN 3;  3FLG A;  3SFM A;  2L3S A;  1SRM A;  4R0K A;  1VQ8 A;  1RAI B;  1VQO T;  1PKT A;  2XDB A;  2FB7 A;  1YJ9 A;  3J7A F;  2DRK A;  3I9Q A;  1MMN A;  2M51 A;  2CKK A;  4M77 A;  1E7O A;  2DZC A;  5GMK j;  1H64 1;  4HT8 A;  3CC4 T;  2RI2 A;  2JJ9 A;  3S6W A;  3CCM T;  1WFW A;  2PVG B;  4ESR A;  4KH1 B;  3JSC A;  1AT1 B;  2L5Q A;  3QWY A;  4RKU E;  1KC8 U;  3J80 E;  1N8R R;  1KQ2 A;  4M4Z A;  4KGV B;  2LTO A;  1SHF A;  1WLP B;  3LWI A;  1N9S A;  5CAI A;  2YUQ A;  3M56 A;  2GNC A;  3OYC A;  4F7U F;  5A0L A;  4BY6 B;  4PJO B;  2YLB A;  1JO8 A;  2K4Y A;  3OY9 A;  3MO8 A;  3M0R A;  1X69 A;  1BIB A;  1ZHI A;  2VYT A;  1AEY A;  2EIF A;  1VQ4 Q;  1Y96 A;  4M7D E;  6AT1 B;  1I8F A;  1CKB A;  1W2B S;  2GFA A;  1X2K A;  4M75 B;  5LJ5 j;  2COY A;  1AVZ C;  3OS0 A;  5LJ3 f;  1WDX A;  4OVA A;  3LGF A;  2EQK A;  2VWF A;  3CD6 A;  1M90 U;  1SG5 A;  2XI9 A;  2YRD A;  1LPL A;  3CXC P;  3M57 A;  3HKS A;  4PJN A;  3CQT A;  4RMO A;  2EQU A;  2KBT A;  1X01 A;  1IO6 A;  1HD3 A;  3WVD B;  2DL5 A;  4RG2 A;  2ED1 A;  2IVW A;  4A4K A;  2K2M A;  1R8O B;  4M78 G;  2FG0 A;  4EDU A;  2CRE A;  3CPW S;  1JJ2 S;  5DLO A;  5GAM d;  4FIB A;  2AZS A;  4WCI A;  4PLI A;  2YSQ A;  2JS0 A;  4BDY A;  4B9W A;  4JS5 A;  3M4G A;  4M7D D;  4PKC C;  3X28 B;  1K9M C;  1VQ7 T;  2K6D A;  2KRN A;  3H0H A;  2CZ6 B;  3LX7 A;  4LXC A;  1PHT A;  4AFQ C;  2P4T A;  2HEQ A;  4HCK A;  3L2V A;  4C5G A;  2RNA A;  2ZAE A;  1TH7 A;  2E1H A;  5GAM j;  2EGA A;  2V26 A;  3A8M B;  5GMK e;  1U5S A;  5GAO q;  2ATC B;  1ZQ1 A;  1RI9 A;  3VS0 A;  3RKW A;  2RI3 A;  2VV5 A;  2EKH A;  2YWW A;  4F17 A;  3G71 T;  2E6N A;  2RO0 A;  3OYE A;  1ARK A;  2RMO A;  4OMF B;  1BU1 A;  2M02 A;  4J9H A;  4C92 G;  2K7A A;  1VQM A;  3NMZ C;  2JTF A;  1OX9 A;  4LDY A;  3PNW C;  1AZG B;  2E3H A;  1UJY A;  1VQ8 T;  4DEX A;  3FB9 A;  4BE0 A;  1VOM A;  1AWJ A;  1RAD B;  4J8O A;  1QVF S;  4PJO F;  3EFO B;  1WHL A;  1I1J A;  3ULR B;  4F7U E;  5IAY A;  2CP0 A;  1R0C B;  4HVU A;  4RTW A;  1K73 C;  2P84 A;  2VKN A;  2IG0 A;  5GMK h;  2HCK A;  1WX6 A;  5I21 A;  4FT4 A;  3NPF A;  3NGP A;  4CI0 C;  4RTT A;  4B9X A;  1YCS B;  1KQS S;  3M54 A;  4OGC A;  2DO3 A;  4M7A F;  1MGQ A;  1B34 B;  1G8X A;  2FPD A;  1PRL C;  3X24 B;  1I07 A;  1VIE A;  4C8Q C;  4L6V 5;  1MMG A;  2PQW A;  3RES A;  2X9H A;  4X9D A;  3M9Q A;  2EYX A;  2O01 E;  5GMK i;  3GOX A;  4M7D G;  3JCM X;  2NUZ A;  3A1P A;  2KY9 A;  3J81 E;  3SD4 A;  2ZPI B;  4RCB A;  4C5E A;  4LDW A;  4LNP A;  3EFR A;  3UA7 A;  3JCM g;  1RI0 A;  3EG3 A;  1QCF A;  2D0Q B;  3LW5 E;  1D0X A;  5LJ3 d;  2DZ9 A;  1YIJ T;  2YRC A;  4C8Q D;  5C6S A;  4ANJ A;  1XOV A;  4FYY B;  1UGR B;  4J6X A;  1BCM A;  3CCQ T;  1NLO C;  4AG1 C;  2E41 A;  2L89 A;  4ZTJ A;  2JMA A;  4RUG A;  1AZE A;  1GFC A;  4LN2 A;  3HRU A;  2A28 A;  1K1Z A;  2LJ0 A;  2B8A A;  2RHI A;  4JUV A;  3M4Y A;  2X35 A;  2X4W A;  3ZBD A;  5CKF A;  1RUW A;  2O31 A;  4F14 A;  1YJN Q;  2LP5 A;  2LQ8 A;  1X75 C;  2A08 A;  4XU3 A;  1WQ7 A;  3CBP A;  4C8Q G;  2D8J A;  1SHG A;  3P8H A;  4JZ3 A;  1IHW A;  5GAO l;  4C0D B;  2O88 A;  1OI1 A;  1WGS A;  2OAW A;  3A8L B;  3OA6 A;  2KRS A;  4C8Q E;  5A2Q E;  1W2B A;  2BE9 B;  4HXJ A;  4BD3 A;  1VQ7 Q;  1NBE B;  2RK2 A;  2K2V A;  4X9C A;  2XHC A;  2K5I A;  1ZSZ B;  4O6J A;  5AYF A;  3CCL A;  4HVW A;  2CP6 A;  3QO3 A;  2K9G A;  5HY6 A;  2MWO A;  2Y90 A;  1TSF A;  3H0F A;  3DB3 A;  3LYI A;  2MIO A;  3CD6 T;  3V7C A;  4J7F A;  1QKW A;  1LNX A;  3RBB B;  5FWB A;  1Q82 C;  7AT1 B;  1BK2 A;  2A0F B;  3CC7 Q;  3HPW A;  3ME9 A;  3A98 A;  1LOJ A;  3EGX B;  5D6Y A;  2AT1 B;  3M0T A;  2VC8 A;  3OSS C;  4A4E A;  3PTA A;  4EPC A;  1N9R A;  2QA4 A;  4EIK A;  1FMK A;  4ELZ C;  5IXB A;  2A36 A;  5J39 A;  3CCQ A;  2RI5 A;  2GCX A;  1U1S A;  3I56 A;  1K9A A;  4OGE A;  4RG8 A;  3I35 A;  2ED0 A;  1SRL A;  1M30 A;  1W6X A;  2DJQ A;  2ZPG B;  1PSE A;  2FRW A;  2FZK B;  1QKX A;  4C8Q A;  5GAN 4;  5FU6 B;  2AKL A;  2K3X A;  1OPK A;  2LC4 A;  2EYY A;  3LWH A;  2LZ6 B;  2PVD B;  4MDX A;  4E2F B;  2EJF A;  5KYX B;  2QAZ A;  1KQS P;  2KSS A;  4R56 A;  2BE7 D;  1JBM A;  3X20 B;  3CCV T;  1JQQ A;  8ATC B;  3QJ6 A;  2QQA A;  2RN8 A;  3EH1 A;  2XKO C;  2A37 A;  1FMV A;  1WXB A;  3GF5 A;  2L3R A;  2V1Q A;  4N4G A;  3LH0 A;  3CC4 A;  1YJ9 Q;  2K3B A;  2BZ8 A;  4QT7 A;  1QVP A;  1TOV A;  3L2Q A;  2OAU A;  1VQL T;  2X3W D;  2DKG A;  2DPP B;  2LCC A;  3GNG A;  5IHN A;  1VQP A;  1YJN T;  3JRZ A;  4FL6 A;  1UG1 A;  1WXU A;  2QQ9 A;  3CCQ Q;  1UE9 A;  2OTJ A;  2DTO A;  4X34 A;  5FRO A;  3CPF A;  3R6O A;  1QWE A;  3REA B;  5EG2 A;  4M77 C;  4B6M A;  1NPR A;  2X4X A;  4E7I A;  2LT1 A;  3EFS A;  3H0I A;  2HD0 A;  4E7H A;  1PG5 B;  2X51 A;  2DIL A;  4DBH A;  5GAO m;  2RB6 A;  3QWX X;  4QVD A;  1UGP B;  1YHQ T;  4OMN A;  4PJM A;  1SEM A;  4EMH A;  2JTE A;  4RCC A;  5LJ3 j;  2HZY A;  2DTI A;  5GAO p;  4AFZ C;  2MYS A;  3BDU A;  4FSS A;  1G3S A;  3Q1J A;  3CCL Q;  2RJD A;  3QDF A;  4CRI A;  3PT9 A;  4KGZ B;  1WA7 A;  2W10 A;  1K9M U;  2RA2 A;  2RQV A;  3G7Z A;  1I5L A;  3L2R A;  3NHN A;  2KRO A;  1VQM T;  2EFI A;  3FJP A;  2DEU A;  2DBK A;  2I2L A;  2OTL Q;  1U8R A;  1YI2 Q;  3CCU A;  1M2V A;  1VQ6 T;  1MUZ A;  2KVQ G;  1D0Y A;  3KFV A;  2XID A;  4DQ2 A;  2ROL A;  2OI3 A;  1WIE A;  2GFU A;  1Y07 A;  4VUB A;  1GCP A;  1XTD A;  3CMA A;  4E7L A;  2ZCF B;  2KMT A;  5KYU B;  2HKQ B;  2CH4 A;  4M78 C;  1ZUY A;  2YUO A;  3C94 A;  3PIO A;  2NUT B;  2DIG A;  1Q81 C;  2D0N A;  3OYH A;  4M75 A;  4GLK A;  4QVC A;  1HYO A;  4DEY A;  4R55 A;  4F04 B;  2E5K A;  5GAN 6;  1GRI A;  4LE9 A;  2LNH B;  3CCR Q;  2LJ1 A;  2H3E B;  3MP8 A;  3E9G A;  3A8O B;  3VRY A;  5CKH A;  3JB9 J;  1OZ2 A;  2JS2 A;  2CT3 A;  4LD6 A;  4QQ6 A;  4N0A C;  1K76 A;  1ZLM A;  2CH4 W;  3E19 A;  2DLP A;  2F5T X;  4J6W A;  2FPF A;  3FIF A;  4ORZ A;  2MK5 A;  2EYQ A;  2COW A;  5J26 A;  3HFO A;  5CQY A;  1WHK A;  1NJI R;  4YTL A;  2YDL A;  4XTW A;  2EQM A;  1KSW A;  4BI8 B;  3RDV A;  3NTH A;  4EMK A;  5CKD A;  1E6H A;  1PKS A;  3M0P A;  1R77 A;  3LLR A;  3I55 T;  2RQT A;  1KK7 A;  5LL6 S;  1M2V B;  3EGD B;  3OQ5 A;  2L0A A;  2X4Y A;  1AWX A;  4ZNX A;  2QA4 T;  4Z89 A;  4WTO B;  3PVL A;  3QG1 A;  4ELY C;  2NUP B;  4CC4 B;  4CC2 A;  2CT4 A;  4QQD A;  5IXF A;  1I4K 1;  1Q95 G;  2M1H A;  1UFF A;  5GAM g;  1M1K R;  5GMK m;  2GQV A;  4O5V A;  3UAT A;  3I55 A;  2COZ A;  2K5F A;  2MAM A;  3EHQ A;  2XDD A;  4M75 F;  2LRQ A;  5LJ3 e;  3JB9 F;  3OYL A;  3OYK A;  4A4G A;  1ACM B;  1Q81 R;  4AFS C;  4LDX A;  1W70 A;  3OYN A;  1BYM A;  4M7D B;  1WZO A;  1TXQ A;  2DXC A;  3RR6 A;  1QLY A;  4M75 C;  1VQM Q;  2KT8 A;  2YHT A;  2QGF B;  1ZA2 B;  1VA7 A;  2DEQ A;  5LJ5 f;  2GQI A;  2EQJ A;  4J9E A;  2KXC A;  1YNZ A;  1M1F A;  2E64 A;  3MET A;  2QXF A;  1LCK A;  2ZPB B;  2SRC A;  4OB1 B;  5J3B A;  4A4H A;  1GCQ C;  3QJY A;  1VQO A;  2NYS A;  1BI0 A;  2ECZ A;  3VS7 A;  4PNO A;  1CKA A;  1OEB A;  2A3L A;  4FYW B;  1BI3 A;  1G83 A;  2FHD A;  4OB3 B;  3UPU A;  4BB7 A;  4BE1 A;  2EKO A;  2XG8 D;  1IXD A;  3G4S T;  4KUD K;  2K5L A;  2J06 A;  2ROT A;  4MZM A;  1VQN A;  4L5G A;  1S72 A;  1JU5 C;  1VQN Q;  2DYI A;  2KGT A;  3GIB A;  4HCB A;  2RQR A;  3H9N A;  1ZUU A;  1VQ9 Q;  3TU4 K;  1MMA A;  1KC8 R;  4C92 B;  5GAN g;  1JXO A;  2VUB A;  1NYG A;  4KUL A;  3EAE A;  2LCS A;  2RJE A;  1Q82 U;  3OS2 A;  2QK0 A;  1Q82 R;  4IKF A;  3REB B;  1HJD A;  1Q7Y R;  4BUG A;  1VQ9 T;  1S1N A;  1BKB A;  4N4I A;  4M7A E;  3M0U A;  2G6F X;  2HSE B;  1KD1 C;  1E6G A;  2HSP A;  1M1K U;  3I55 Q;  3CXC A;  2FO0 A;  3P8D A;  1Q7Y C;  5KYW A;  1D1B A;  2VXF A;  3E9F A;  3ZL7 C;  1OV3 A;  2M9U A;  3MEA A;  4BAC A;  4GY5 A;  2DK3 A;  3JCM V;  5CR2 A;  4C5I A;  1NPP A;  2AIR B;  3M5A A;  1S72 T;  4QQG A;  1PD0 A;  1VQN T;  3GNF B;  3T9N A;  3MEW A;  2O4X A;  5CK9 A;  1IHV A;  2K3Y A;  3UA6 A;  4HCC A;  2DL8 A;  1QWF A;  3JCM f;  4XTU A;  4PJO E;  2BUD A;  4M7A D;  1F1B B;  2CP3 A;  2FYK A;  3NFC A;  2HQE A;  2K57 A;  1M4Z A;  4PFP A;  4A63 B;  1PD1 A;  3OS1 A;  2F2V A;  3CBM A;  1D1A A;  1VQ6 Q;  4XU0 A;  3NTI A;  2ZGW A;  3GP8 A;  5DY9 A;  4BI4 A;  1RAC B;  4JLG A;  4M78 D;  2DET A;  3BFM A;  4HKE A;  3G71 A;  5FU6 C;  5GAN 5;  4PJL A;  1K8A C;  4A4F A;  1DJ7 B;  1TWB A;  4LUE A;  1PRM C;  5IHK A;  4E6R A;  3I5R A;  1VQ8 Q;  1QVG A;  4M77 D;  1AHJ B;  4C8Q F;  4OML A;  3EHR A;  1M8V A;  1AD5 A;  1T3S A;  4M75 G;  3PGG A;  4IIM A;  4M78 F;  2JNG A;  2HBP A;  2ZZD A;  2MWP A;  2C06 A;  3HRS A;  2EGE A;  4ME7 A;  3G4S Q;  2L3Q A;  4RTV A;  1U3O A;  2E10 A;  1YP5 A;  4DA4 A;  2A7Y A;  3CCR A;  1VQ7 A;  2RHY A;  3H8Z A;  1JEG A;  3ZFJ A;  2CZ1 B;  3QSU A;  1HXD A;  2K79 A;  1YI2 A;  4C8Q B;  3TRE A;  2KXD A;  1KHI A;  4C92 E;  3NTK A;  4M78 B;  3CCL T;  1M1G A;  2LNV A;  2D1X A;  4A53 A;  3L2Z A;  1YJW A;  2RHX A;  1N8R C;  1M3C A;  3MP6 A;  2JUF A;  2DMO A;  3JCM d;  4J9F A;  2I0N A;  1OOT A;  1QQJ A;  1EX4 A;  2GGR A;  4FU6 A;  2JZ2 A;  4HA8 A;  3UDC A;  1M2O A;  2CSQ A;  1IZ6 A;  4P5N A;  3CCS T;  3TSZ A;  2CGH A;  1MHN A;  4D6W A;  2C0T A;  1Q81 U;  5A0D A;  1IB8 A;  2OTL A;  5D6X A;  1WHM A;  1RAB B;  5GAO r;  4ZN1 A;  4LDV A;  1G3W A;  1W4S A;  1SSH A;  4EMG A;  1OU8 A;  2AZV A;  4GBQ A;  4Y92 A;  4Y28 E;  3G1J A;  1TS9 A;  2WSE E;  2E65 A;  4M7A G;  3N5B B;  2DM1 A;  4DBR A;  1K4U S;  3QYH B;  4FW2 A;  4DBQ A;  3FDR A;  4PFO A;  5GAN d;  2YRV A;  2RJC A;  3D7S B;  3HL8 A;  1NJI C;  3EGU A;  4HVV A;  4C5H A;  2QQB A;  2BZY A;  2JT4 A;  5KCH A;  4FYV B;  2QG9 B;  2RD1 A;  3RNJ A;  1BIA A;  4BI3 A;  1VUB A;  3MJX A;  3UWN A;  4GLM A;  3CCU T;  2EQI A;  1G2B A;  4IUT A;  5KYX A;  1VQK Q;  5CIU A;  3VS1 A;  1WNL A;  4JDS A;  2D6F A;  2QAS A;  1ZSG A;  2GBQ A;  1B07 A;  1X6B A;  8AT1 B;  2V8K A;  1VQ5 T;  3C4S A;  2OX7 A;  1Z9Q A;  3OBY A;  2JMC A;  3G6E T;  5D6W A;  2E4H A;  1UHC A;  3GLX A;  2E70 A;  4M7A C;  1YHQ A;  4PJO A;  3TCJ A;  1PSF A;  2LVM A;  2NUT A;  2E3I A;  1BI1 A;  2EPD A;  4M77 E;  2JM8 A;  4A54 A;  3OSV A;  3CEY A;  5KYW B;  3VS4 A;  2ZPE B;  2DL4 A;  3EFO A;  4F7U B;  2JVV A;  1VQ5 A;  1WJR A;  3INZ A;  1SPK A;  2DAQ A;  1VQ4 T;  2QTV A;  3SWN A;  4IUR A;  3MPU B;  1B3Q A;  1YWP A;  2DD5 A;  5GAO n;  1N5Z A;  3HHT B;  1OU9 A;  3M55 A;  1IRX A;  3WXM B;  5CQX A;  2R5M A;  2C0O A;  2LCL A;  1K73 R;  4RTX A;  1RAF B;  3V8J A;  4JS4 A;  1XJW B;  1TUG B;  1M8M A;  1YBY A;  3TEE A;  1V1C A;  3CPW P;  1JJ2 P;  2OJ2 A;  2LX9 A;  2KR3 A;  3GBQ A;  3X26 B;  2FZG B;  1ABO A;  1KQS A;  2JM9 A;  2P0Q A;  1M9S A;  2F1L A;  2MPX C;  4AT1 B;  2QI2 A;  5DM7 R;  5KH6 A;  2MCN A;  2P0P A;  4N4H A;  1TU0 B;  2WSC E;  4EMK C;  3G6E A;  2HL5 C;  1XNI A;  3EG9 B;  3UT1 A;  2KYB A;  1MNE A;  3V7S A;  2CDT A;  1YCY A;  1WQW A;  3V7R A;  1WHH A;  1VQP T;  3VS2 A;  3F70 A;  3CCJ T;  1VQO Q;  4JPB W;  3FJ5 A;  1QVG S;  4N0A A;  4KH0 B;  1I81 A;  1KD1 U;  2EYW A;  1M1K C;  3OYY A;  4ZGD B;  4IUQ A;  2DRM A;  5L23 A;  1Q7Y U;  2DNU A;  4J9B A;  4M7D A;  4Z02 A;  1T0J A;  2DL7 A;  5CVI A;  1VQK T;  2IPO B;  4FYX B;  4MML A;  3QKJ A;  5FLX E;  3G71 Q;  3MCA B;  2YT6 A;  1H8K A;  1UUE A;  2XD0 A;  2QEX Q;  5GAN f;  5HK3 A;  2J6F A;  3BE3 A;  1C0M A;  3I56 T;  2V1R A;  2DXU A;  2KE9 A;  2RHU A;  3CD6 Q;  5KCO A;  5IT9 E;  4E7J A;  2JTM A;  4XTY A;  1N6A A;  3LGL A;  1IRE B;  1YIT A;  1VQP Q;  2EJG A;  4M77 F;  3DB4 A;  4JRQ A;  2CP2 A;  2E12 A;  2DVE A;  4AG2 C;  5ECA A;  1ZSZ A;  1WHG A;  1G3T A;  4J9G A;  3PVQ A;  1ZBX A;  3JV3 A;  4BY6 C;  4PJO C;  1V29 B;  4PJO G;  3CC4 Q;  3EG9 A;  1YIT T;  4HCZ A;  2RQU A;  1FX7 A;  1G3Y A;  2KI7 A;  4D8D A;  5LJ5 e;  2HMA A;  4PK4 A;  3P8B B;  4XQ3 A;  2YUP A;  3RMS A;  2FEI A;  1Y57 A;  1NEB A;  1WXT A;  3MEV A;  1PCX A;  3CCM A;  1K8A U;  3H41 A;  2DX1 A;  4JZ4 A;  1YIT Q;  1YIJ A;  5EC7 A;  2XK0 A;  5AT1 B;  4DOW A;  2VGN A;  3QDR B; 
#chains in the Genus database with same CATH homology
 4Z88 A;  2NUZ A;  3REB B;  1HJD A;  4K11 A;  4LUD A;  1S1N A;  1GCQ A;  1Z9Z A;  3M0U A;  2G6F X;  2J05 A;  2B86 A;  1E6G A;  4LNP A;  3UA7 A;  2HSP A;  3EG3 A;  1QCF A;  3PE0 A;  2FO0 A;  2D8H A;  1UTI A;  1XOV A;  1WYX A;  3ZL7 C;  3THK A;  1OV3 A;  2DE0 X;  1H92 A;  1NLO C;  3EG2 A;  4AG1 C;  5FWC A;  3EG0 A;  2JMA A;  4RUG A;  1AZE A;  1GFC A;  4LN2 A;  4J9C A;  2A28 A;  1K1Z A;  2LJ0 A;  1K0X A;  2QDL A;  1BBZ A;  1KFZ A;  5I11 A;  4J9D A;  3U23 A;  1M3B A;  3UA6 A;  2DL8 A;  1QWF A;  2O2O A;  1RUW A;  4OMP A;  2O31 A;  4F14 A;  3VS6 A;  2LP5 A;  2A08 A;  3VS3 A;  4CC7 A;  1OPL A;  2D8J A;  2M0Y A;  1SHG A;  4KRT A;  1PNJ A;  2PZ1 A;  4JZ3 A;  2PTK A;  4A63 B;  2O88 A;  2OAW A;  2KRS A;  2F2V A;  2MOX A;  4HXJ A;  2W0Z A;  2HDA A;  3C0C A;  2RPN A;  1GFD A;  1X6G A;  3R6N A;  1GL5 A;  4HVW A;  2K9G A;  1UJ0 A;  2GTJ A;  4JJC A;  3H0F A;  1NG2 A;  1X43 A;  2J6O A;  2LX7 A;  2MIO A;  4D8K A;  2CSI A;  1KIK A;  4OMQ A;  4LUE A;  1PRM C;  1QKW A;  5IHK A;  2YUN A;  1RLP C;  3RBB B;  2AK5 A;  5FWB A;  2KYM A;  4E6R A;  3I5R A;  1BB9 A;  2BTT A;  1BK2 A;  4OML A;  1UDL A;  3A98 A;  3EHR A;  2KRM A;  1AD5 A;  1T3S A;  1H3H A;  4IIM A;  4J9I A;  4JJD A;  3M0T A;  2KNB B;  5IHI A;  1T0H A;  1ZUK A;  3TVT A;  2GTO A;  2EGE A;  1MV3 A;  2HBW A;  2L3Q A;  4EIK A;  4RTV A;  1FMK A;  1U3O A;  2JW4 A;  1TUC A;  1YP5 A;  1YWO A;  5IXB A;  2A36 A;  1KJW A;  1EFN A;  1VYU A;  1K9A A;  2KT1 A;  2LMJ A;  2X3X D;  3LH5 A;  3I35 A;  1JEG A;  2ED0 A;  1SRL A;  1M30 A;  1W6X A;  2DJQ A;  2K79 A;  2FRW A;  4RTY A;  1Y0M A;  2KXD A;  1QKX A;  5IH2 A;  1K0S A;  2AKL A;  2D1X A;  5GJV B;  1OPK A;  5I22 A;  2EYY A;  2LZ6 B;  1M3C A;  1M27 C;  4OMM A;  2IIM A;  2DMO A;  4J9F A;  1JQQ A;  2I0N A;  1OOT A;  1VYT A;  2GGR A;  2RN8 A;  1UEC A;  2A37 A;  1NM7 A;  1WXB A;  2CSQ A;  3TSZ A;  2LQN A;  2RQW A;  2V1Q A;  2ESW A;  3O5Z A;  1NYF A;  2K3B A;  2C0T A;  2BZ8 A;  3M0Q A;  4QT7 A;  2O9V A;  2X3W D;  1X2Q A;  5IHN A;  4CC3 A;  3TSW A;  1UG1 A;  5FW9 A;  1WXU A;  1UE9 A;  2AKK A;  4OMO A;  2DBM A;  1TUD A;  1WI7 A;  1QWE A;  3REA B;  1SSH A;  2AZV A;  2DVJ A;  4F16 A;  1AWW A;  4GBQ A;  4Y92 A;  2J7I A;  1GBR A;  2DM1 A;  3H0I A;  1I0C A;  1K4U S;  1T3L A;  2L3S A;  2DIL A;  3IQL A;  4RTU A;  1SRM A;  4R0K A;  2PNI A;  2FPE A;  3QWX X;  4OMN A;  1PKT A;  4IIO A;  1SEM A;  3EGU A;  4HVV A;  2JTE A;  2DRK A;  3I9Q A;  4AFZ C;  2M51 A;  2BZY A;  2JT4 A;  4FSS A;  4RTZ A;  3RNJ A;  2DA9 A;  1E7O A;  2EBP A;  1J3T A;  1WA7 A;  2W10 A;  2RQV A;  5HCK A;  4GLM A;  3NHN A;  2EQI A;  1G2B A;  2KRO A;  1VYV A;  1FYN A;  1M3A A;  1WFW A;  2DBK A;  3VS1 A;  4ESR A;  3QWY A;  2XMF A;  1A0N B;  2DF6 A;  1ZSG A;  2GBQ A;  4M4Z A;  1B07 A;  1X6B A;  1SHF A;  1WLP B;  1MUZ A;  2CUD A;  1YN8 A;  3KFV A;  2YUQ A;  2GNC A;  2ROL A;  2OI3 A;  1WIE A;  3M0S A;  1Z9Q A;  2JMC A;  1GCP A;  1UHC A;  1JO8 A;  1CSK A;  2LQW A;  2CH4 A;  1ZUY A;  2YUO A;  3M0R A;  1ABQ A;  1X69 A;  2EPD A;  1AEY A;  2EW3 A;  2J6K A;  2D0N A;  2JM8 A;  1X27 A;  1CKB A;  2C0I A;  1X2K A;  3VS4 A;  4DEY A;  2DL4 A;  2E5K A;  1GRI A;  4LE9 A;  2LNH B;  2LJ1 A;  1AVZ C;  2L3P A;  1WDX A;  3VRY A;  2F2W A;  1TG0 A;  2VWF A;  2JS2 A;  2CT3 A;  2CUB A;  1UGV A;  1SPK A;  1B3Q A;  1K76 A;  1YWP A;  1ZLM A;  2CH4 W;  1U06 A;  2NWM A;  3CQT A;  2DLP A;  2P4R A;  2FPF A;  1N5Z A;  2KBT A;  4ORZ A;  1IO6 A;  1HD3 A;  2DL5 A;  2ED1 A;  2K2M A;  2FG0 A;  4Z8A A;  2C0O A;  2CRE A;  3VRZ A;  1RLQ C;  2YDL A;  4RTX A;  2AZS A;  1KSW A;  4WCI A;  1M8M A;  2YSQ A;  2JS0 A;  1V1C A;  1E6H A;  1PKS A;  3M0P A;  2OJ2 A;  2KR3 A;  3GBQ A;  1ABO A;  2JM9 A;  2RQT A;  2EGC A;  2K6D A;  2H8H A;  2KRN A;  3H0H A;  2MCN A;  2L0A A;  1PHT A;  4AFQ C;  1AWX A;  4ZNX A;  4Z89 A;  2HEQ A;  4HCK A;  2KYB A;  3PVL A;  2DL3 A;  4CC4 B;  4CC2 A;  2CT4 A;  2JXB A;  2RNA A;  2CDT A;  1PWT A;  5IXF A;  1JXM A;  1UFF A;  1GBQ A;  4X1V A;  2EGA A;  2LJ3 A;  3VS2 A;  1U5S A;  4JPB W;  5GJW B;  3UAT A;  3FJ5 A;  4JJB A;  1RI9 A;  3VS0 A;  3EHQ A;  2EKH A;  3SEM A;  2EYW A;  4F17 A;  1ARK A;  2RMO A;  2DRM A;  5L23 A;  1AWO A;  2DNU A;  2EVR A;  4J9B A;  4AFS C;  2SEM A;  1BU1 A;  1W70 A;  4J9H A;  1T0J A;  2K7A A;  1NEG A;  2BZX A;  3SHW A;  3NMZ C;  1QLY A;  1AOJ A;  2KT8 A;  2DL7 A;  1VA7 A;  1W1F A;  1AZG B;  2DYB A;  2GQI A;  2YT6 A;  1UJY A;  1H8K A;  1UUE A;  4J9E A;  2KXC A;  2J6F A;  4DEX A;  1YNZ A;  1AWJ A;  2V1R A;  1LCK A;  2SRC A;  2KE9 A;  1GCQ C;  2ENM A;  1MV0 B;  1I1J A;  3ULR B;  2FRY A;  2ECZ A;  2ABL A;  3VS7 A;  4RTW A;  4HVU A;  2O9S A;  2VKN A;  1CKA A;  3EG1 A;  1OEB A;  2RF0 A;  1UHF A;  2HCK A;  2VVK A;  1WX6 A;  1G83 A;  2KEA A;  4AG2 C;  3NPF A;  3NGP A;  5ECA A;  4RTT A;  1NLP C;  1YCS B;  2J06 A;  2ROT A;  4J9G A;  3PVQ A;  3JV3 A;  3UF4 A;  3I5S A;  1JU5 C;  2EYZ A;  2RQU A;  2KGT A;  4D8D A;  2FPD A;  1PRL C;  2RQR A;  1HSQ A;  1ZUU A;  1ZX6 A;  2L2P A;  1I07 A;  1ZBJ A;  2F2X A;  2YUP A;  4AFU C;  2FEI A;  1JXO A;  1Y57 A;  1NEB A;  1WXT A;  1NYG A;  2LCS A;  3H41 A;  2DX1 A;  4JZ4 A;  2EYX A;  3VS5 A;  5EC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...