1QKWA

Alpha-spectrin src homology 3 domain, n47g mutant in the distal loop.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
b'KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVGDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA II SPECTRIN
publication title Thermodynamic and Structural Characterization of Asn and Ala Residues in the Disallowed II' Region of the Ramachandran Plot
pubmed rcsb
source organism Gallus gallus
molecule tags Cytoskeleton
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1999-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1qkwA00
1X69A 1M3AA 1Y57A 1VYUA 2CDTA 4HXJA 2J06A 3EGUA 3A98A 2K3BA 4HVVA 5FWCA 3VS2A 1PRLC 2RQVA 1UDLA 1CKAA 1U3OA 1AOJA 2GGRA 1UFFA 2CREA 2L3QA 2ROTA 1RLQC 4AFSC 2L0AA 1K0XA 1NEBA 3EG3A 3M0SA 1E7OA 3NGPA 4CC3A 1XOVA 4GBQA 4J9CA 4LNPA 2FRYA 2JT4A 4AG2C 2EQIA 4CC7A 4J9FA 1UHFA 1QLYA 2HBWA 2GQIA 5GJWB 2PTKA 1OPLA 4OMQA 2LJ0A 4J9BA 3FJ5A 1YWPA 4Z8AA 1JO8A 2L3PA 2A28A 4HVWA 2W10A 5HCKA 2KT8A 5FWBA 3VRYA 1QKWA 1ZUKA 2CH4W 1MV3A 2G6FX 4RTTA 1YP5A 1NLPC 3VS3A 2MCNA 3M0PA 4JJDA 2RQUA 4JPBW 2AZSA 1WI7A 2D1XA 1GFCA 1UHCA 3EHQA 2DJQA 2FRWA 2JXBA 3VS4A 3RNJA 1T3SA 3VS6A 2VKNA 1U06A 2EYZA 3SEMA 1KSWA 4Z88A 5IH2A 2E5KA 2EYXA 1K1ZA 4RTZA 1WFWA 2DVJA 1J3TA 2ECZA 1M8MA 3CQTA 1X6GA 1PWTA 1B07A 3REBB 1T3LA 2JS0A 2B86A 4CC2A 4RTVA 1S1NA 1QWFA 4OMNA 4RTUA 2HCKA 1ZUUA 5EC7A 2DL8A 1WA7A 2JM8A 3I5RA 1BBZA 2BZXA 1QCFA 2GTOA 1AZEA 2RPNA 1X27A 2X3WD 2H8HA 1W1FA 2HEQA 2CH4A 2M51A 4JZ3A 3TVTA 1OPKA 1BK2A 2KR3A 4EIKA 1GBQA 1LCKA 1OOTA 1PKSA 2YUQA 3NPFA 2DA9A 2CUDA 4AFQC 1HJDA 1H8KA 4J9IA 3UF4A 2JM9A 1WX6A 2RNAA 4J9EA 1UE9A 2K7AA 2JTEA 3SHWA 2V1RA 2EYYA 3VS0A 2F2WA 1SEMA 2HDAA 1SRLA 2EKHA 1FMKA 1H3HA 2LJ3A 4LUDA 1YNZA 1ABOA 1AWWA 2CT3A 3GBQA 3UA7A 2KRNA 2DRMA 1UECA 2LMJA 2DL7A 3H0HA 1M27C 1VYVA 2JMCA 1SSHA 4DEYA 2CSQA 2LX7A 2EBPA 2J6KA 1G83A 2M0YA 4DEXA 2D0NA 4F16A 2SEMA 1QKXA 2KXDA 5IHIA 2F2VA 3U23A 1GL5A 4AFZC 5ECAA 1GCQC 3RBBB 2KEAA 2A36A 1ZSGA 1Y0MA 1YWOA 3UATA 2FO0A 2OAWA 1ARKA 2YUPA 4AFUC 3M0QA 4D8KA 1MV0B 4HVUA 2L2PA 5IXBA 2AKKA 2C0IA 1PKTA 4OMLA 3M0TA 3PVQA 3TSZA 4RUGA 4Z89A 1CSKA 2PNIA 3VS5A 1I1JA 1NEGA 1SRMA 2FPFA 2DL3A 3H0IA 1JQQA 2O2OA 1HD3A 2ROLA 4HCKA 2KYMA 1H92A 1BB9A 2YT6A 2KGTA 2O9SA 2RN8A 2J6OA 1WIEA 1RI9A 4X1VA 2K2MA 4D8DA 2KYBA 4RTWA 2EGCA 2LQNA 2HSPA 1K76A 1T0JA 2RMOA 1UJYA 2DBKA 3NHNA 2DBMA 4M4ZA 3THKA 1ABQA 2FPDA 4OMOA 3QWYA 1WXTA 2W0ZA 2KXCA 4RTXA 1WXUA 1AD5A 1OV3A 1FYNA 3C0CA 5L23A 4ZNXA 1UTIA 2JS2A 3PE0A 3PVLA 5GJVB 2X3XD 5I22A 1GRIA 2ESWA 1AVZC 1WLPB 3TSWA 1M3CA 2P4RA 2AZVA 2BZYA 3LH5A 1X2KA 2MOXA 4AG1C 2MIOA 2DF6A 4LUEA 2CUBA 1NG2A 3EHRA 1VYTA 3JV3A 2A08A 2EGEA 3VRZA 2A37A 4J9GA 3I5SA 2C0TA 1PNJA 2YSQA 1TUCA 1PHTA 3IQLA 4IIOA 2D8HA 1HSQA 1NM7A 1AZGB 3EG0A 3H0FA 1ZBJA 1GCQA 4WCIA 1VA7A 5IHKA 2KBTA 3KFVA 1GCPA 2KRMA 3EG2A 1I0CA 3R6NA 1ZX6A 1WXBA 2DYBA 3REAB 2KT1A 2DRKA 2K9GA 3I35A 1AEYA 1NLOC 1Z9QA 1X2QA 1M3BA 1W70A 2VWFA 1G2BA 1X43A 4OMMA 1NYFA 1V1CA 2LJ1A 1RLPC 2YUOA 1KIKA 2I0NA 1IO6A 2V1QA 1AWOA 2LP5A 3NMZC 2SRCA 2GBQA 2AK5A 2XMFA 2EYWA 2EVRA 1TUDA 3M0UA 2EW3A 2ED1A 1ZUYA 4JJCA 2DILA 4GLMA 1UGVA 2RQWA 2AKLA 1JEGA 2ENMA 1K0SA 2GNCA 5FW9A 1I07A 1WDXA 2DLPA 2LQWA 2OJ2A 2GTJA 5IHNA 2NUZA 1UJ0A 2LNHB 4J9HA 1UG1A 2YUNA 3H41A 2CT4A 2D8JA 4F17A 1JU5C 1TG0A 4KRTA 3ULRB 2DE0X 3ZL7C 4CC4B 1BU1A 1ZLMA 4LE9A 1B3QA 3M0RA 2FG0A 4IIMA 3UA6A 3I9QA 1GFDA 1UUEA 2ABLA 2DMOA 4RTYA 1YN8A 4E6RA 2RQRA 2DL4A 4OMPA 2J7IA 1SHFA 2FPEA 2LZ6B 2L3SA 2LCSA 4FSSA 2KRSA 2JW4A 2IIMA 1T0HA 2CSIA 2NWMA 2DL5A 1SHGA 2DNUA 2RQTA 2J05A 1W6XA 1K9AA 4JZ4A 1MUZA 1WYXA 2JMAA 1RUWA 1CKBA 2RF0A 3VS1A 1K4US 1M30A 1AWJA 2BTTA 2KNBB 1NYGA 1U5SA 4J9DA 2K79A 2KE9A 4K11A 2ED0A 1EFNA 1AWXA 2YDLA 1X6BA 4ORZA 2DX1A 4ESRA 5I11A 2F2XA 4A63B 2DM1A 2O88A 1E6GA 3O5ZA 1E6HA 1N5ZA 2FEIA 1KJWA 1JXOA 3QWXX 2KROA 4JJBA 2O9VA 4LN2A 4QT7A 1JXMA 2PZ1A 2EGAA 5IXFA 1KFZA 2J6FA 1Z9ZA 2EPDA 2K6DA 2OI3A 2VVKA 1YCSB 1QWEA 1PRMC 3EG1A 2C0OA 4Y92A 1A0NB 2O31A 2QDLA 2BZ8A 1OEBA 3VS7A 1SPKA 4R0KA 1GBRA 4F14A
chains in the Genus database with same CATH superfamily
2NUTB 4OB3B 1VQMA 2DD5A 2CDTA 4BI8B 2DK3A 4F7UF 1NJIC 3VYGA 2K3BA 5FWCA 2MF2A 1UDLA 5KYWB 1VQ9A 3EFRA 1U3OA 4DBFA 2RH2A 3CCSQ 2CREA 2L3QA 1W2BA 4E7JA 4M7DF 4C92D 1BYMA 1HXDA 3EG3A 2YRCA 1XOVA 3MCAB 1P92A 1WHJA 2FYKA 2CZ1B 2EQIA 2DZCA 2QQRA 2R5AA 1QLYA 3HL8A 1VQKA 2QK0A 4RKUE 2GQIA 5GJWB 3JCMQ 4F7UG 2ZPGB 2EWNA 3LYIA 3I56Q 1YWPA 1PG5B 1JO8A 2L3PA 3OW2P 5C0MA 2A28A 2JZ2A 3G1JA 1QCOA 2YXYA 3JB9D 2KT8A 4M7DG 5FWBA 2CH4W 5GMKh 3CCJA 4M75F 4DQ2A 2G6FX 4XU3A 3VS3A 2MCNA 1YHQA 4EPCA 3CXCA 4E7IA 4JPBW 3M59A 2AZSA 1NBEB 4M78A 3EHQA 3L2WA 4D6WA 1T3SA 3I55Q 2KVQG 3V8JA 2EYZA 2PVDB 2XKOC 2OTLA 3LX7A 5GAMh 2EYXA 2E64A 1WFWA 4FYVB 1D09B 2QTVA 2XHCA 4XU2A 1X6GA 1PWTA 1B07A 1RADB 4M75G 1NZ9A 3REBB 3RMQA 2JS0A 2CP2A 2VXEA 3BE3A 3M54A 4OMNA 2HCKA 3SWNB 1ZUUA 1MMNA 2FL7A 5EC7A 2BZXA 1QCFA 4PK4A 1HK9A 3CC4A 3SDZA 2NUTA 4IUVA 5CKEA 3E19A 1WHMA 2ZZDA 1JBMA 4E47A 2HEQA 2CH4A 2CKKA 5KYWA 1OPKA 2KSSA 2Y90A 3MEVA 3OS1A 2H3EB 3G6EQ 4MDWA 3NPFA 2CUDA 3KXTA 3HFOA 5LL6S 5GAOn 1WX6A 1S72Q 2RNAA 4MZTA 1UE9A 3SHWA 4JRQA 2V1RA 3VS0A 2F2WA 4IUQA 2EAYA 2KQWA 1EIFA 2DEQA 3CCQT 5GANe 3CCRQ 1VQ6T 4C0DB 2DRMA 1UECA 2LMJA 2HMAA 3H0HA 1M27C 1VYVA 4RMOA 1SSHA 1UB4A 4J6YA 3S3MA 3JCMP 2DAQA 1VQ4Q 2J6KA 3ZFJA 2M0YA 3CCMT 5GAOr 3AT1B 3QDRB 1VQLA 1M2VA 1ACMB 4AFZC 2QG9B 5D7UA 5ECAA 2LX9A 4PJOD 2ATCB 3CMAQ 4C0ZA 4LDYA 5LJ5f 1RAAB 2DXTA 2DERA 3BY7A 3FRNA 1XTDA 3OYNA 3G4SQ 3M0QA 4LD6A 2L2PA 1VQMT 2DVEA 5I21A 4QVCA 4LDVA 1PKTA 4QVZA 1CSKA 5CQXA 4L5GA 1VQ9T 1NEGA 2FPFA 2DL3A 3D7SB 3H0IA 5CR2A 4NOYA 4BY6C 4HCKA 1KQSA 4ATOA 3X20B 1BB9A 2J6OA 1YJ9Q 3SWNA 2X51A 1YJWQ 4KH0B 5KYXA 2CP5A 1M9SA 4FIBA 2P0KA 2XG8D 3E9FA 1VQKT 1T0JA 3EG9B 1ZSZB 1UJYA 2DBMA 4N4HA 1QQJA 2FPDA 4OMOA 5GANh 4Y91A 1WQ7A 4LD9K 3QXEB 5M9OA 1G3WA 4C92C 3CBOA 3L2UA 3WVEB 1Q95G 4XU0A 3CC2Q 3FB9A 3M58A 3GF5A 5I22A 1KD1C 1N27A 1VQ8A 3CCJT 3A8MB 4M7AF 4M77B 4MMKA 3FC3A 1IB8A 2JVVA 5GAOl 4JS5A 4J5YA 3EHRA 3HKSA 4M7DD 1MMDA 3ASKA 2OX7A 3JCMg 2A37A 1N9SA 1WHKA 4PKCC 5GMKi 2C0TA 2K4YA 3OYFA 2DIQA 4Y28E 2D8HA 2KI7A 4EMGA 1EZZB 5HK0A 3EG0A 4XTXA 9ATCB 1ZBJA 1G8XA 1VA7A 4EMHA 2KBTA 5CKBA 1Q7YC 4M7AG 1I0CA 2DTIA 2L5QA 1ZX6A 3REAB 2VB6A 4C8QE 1JJ2P 4ZGEB 1X2QA 1M3BA 1W70A 1X43A 2E6ZA 1NYFA 3M56A 3X24B 3BDLA 1K9MC 4PNOA 3CC4T 4FL6A 3JRZA 5I2SA 2YUOA 1Q82U 4M75D 1KIKA 5C6SA 4B9WA 1Q81C 1AWOA 1JRIA 2LP5A 2LNVA 3NMZC 1Q82R 2HAXA 1B7TA 2EQMA 4O6JA 5CCAA 5CK9A 1FMVA 1SKUB 1YI2A 4R56A 2V8IA 4A4EA 2GNCA 1K0SA 4J7IA 2LQWA 4PLLA 5LJ5j 4OB1B 5D6WA 4ELYC 4J9HA 4E7ZA 3CPWS 1UG1A 3CC7A 4ELZC 2CT4A 4F17A 3LH0A 4KRTA 1VQ5A 2M0OA 3ZL7C 1UGSB 1QVGS 2QI2A 2CGHA 5KYUA 4LE9A 4OMFB 3M0RA 2FG0A 3I9QA 2LRQA 2MWPA 5HKCA 3OYMA 1VQOA 5FU6C 2DYIA 2P84A 4RTYA 4OMPA 1MGQA 1N8RU 1VQLT 1RAHB 2LZ6B 4N4IA 2LCSA 4PJLA 2EJFA 2IIMA 1N8RR 2JJ9A 2NWMA 2DL5A 4M78G 1M1GA 1O75A 4IUTA 5GAMf 2JMAA 3RMSA 1M30A 2LTOA 5J3BA 2PVGB 4JLIA 3CMEA 4J6XA 2KE9A 2ED0A 2YDLA 1WHLA 2LCCA 2DM1A 3V8LA 3JB9I 2O88A 5FU7C 4Q5WA 4Z02A 2O9VA 2WACA 3CCVA 4N0AA 4WF2A 1Z9ZA 2X4YA 1YCSB 3FLGA 2GFAA 2C0OA 5I2MA 1A0NB 4HT8A 3QPHA 5LJ3e 1C0MA 1U8RA 3CEYA 2XK0A 1H641 3A98A 4A4GA 2NUPB 4HVVA 3VS2A 1PRLC 2EFIA 1CKAA 4C8QB 4KULA 2GGRA 1UFFA 1OULA 1VQPA 2ROTA 1RLQC 4XTUA 5GAN2 2X35A 1K0XA 1NEBA 3M0SA 1VQ8T 3NGPA 3GNGA 4ANJA 2MI6A 2JT4A 4AG2C 2MK5A 3T9NA 5CIUA 5KYNA 3CD6Q 4CC7A 1UHFA 2HBWA 3EFOB 3OYGA 2CYZB 4O5VA 3HPWA 3JCMW 2QA4A 4OMQA 3MEAA 1K73U 5IN1A 3QZ9B 3EFSA 3CCUA 3MEWA 3PIOA 2DIGA 1VIFA 4HVWA 2W10A 4JUVA 1QKWA 4XTYA 1MV3A 4RTTA 1YP5A 1NLPC 4JS4A 2XDDA 2K5FA 4JJDA 5FROA 5HY6A 5GAN6 1BIBA 2D1XA 3OYEA 2DJQA 2FRWA 1WZOA 1XNIA 2HSEB 5LJ3h 3L42A 2FZKB 2QEXA 3VS6A 2LVMA 4VUBA 4CI0C 1KSWA 2E41A 2EQUA 2RI5A 5IT9E 2M02A 4M7AD 2E5KA 1K1ZA 1YIJA 4RTZA 2DVJA 4JLGA 1LVKA 2KY9A 3RUXA 1YI2T 4ZGJB 2A3LA 4PJJA 4QW2A 1BI3A 3PIPA 4EDUA 1YITQ 1IHVA 2E6NA 4RTVA 1S1NA 4RTUA 4C92B 3RDVA 2RJCA 1M1KU 5GAMj 1WA7A 3CC7T 3OSVA 3RKYA 4TVRA 3L2RA 2HZYA 2GTOA 3BFMA 5GAN7 1AZEA 1VQ5T 1W4SA 4GY5A 2LT4A 4J6WA 3TVTA 1YCYA 2FHDA 3JCMe 4C8QA 1VQOT 4C0GA 4XTZA 1BK2A 1LCKA 3DLMA 4PJOE 3QYGB 1IREB 4ZN1A 1PCXA 2EQJA 1M90U 3UF4A 1BI2A 4J9EA 3V7SA 3CPWA 1SEMA 1M90R 8ATCB 4E7LA 1H3HA 2M16A 2NYSA 3EFOA 1YNZA 3QUIA 3QSUA 1QVGA 2VGNA 3UA7A 3CMET 4FSXA 1BIAA 1D1BA 1QP3A 5GAN3 5A0LA 2JMCA 1FWZA 2ZPBB 4PFZA 1TWBA 1R0CB 2EBPA 3EH1A 1G83A 4EMKC 5A0GA 3CCVT 3ER0A 2D0NA 1QKXA 5IHIA 3U23A 1GCQC 2E1HA 4FT4A 2V26A 2KEAA 1UEBA 3CCQQ 1N9RA 1VQ6Q 3UATA 3HRSA 1F1BB 2VGMA 2RI2A 1MV0B 4HVUA 2P0PA 3OY9A 2AKKA 4C5HA 5KYYB 3RKXA 2O4XB 4RUGA 4JJNK 4B9XA 4A4FA 3OYIA 1I1JA 2DZ9A 3CCMQ 3JCMh 2YLBA 1JQQA 2O2OA 5LJ5d 1HD3A 1VOMA 1VQPT 1QVFS 1GXIE 2YT6A 2RN8A 2GCXA 1I5LA 4M7DE 1X01A 4RCCA 4ZTJA 1B34B 1RI9A 4MZPA 3CCLQ 2JOYA 4D8DA 4BI3A 2EGCA 1VQMQ 1D0ZA 3JB9H 4QKUA 1KQ2A 3NHNA 4E7HA 1VQ4A 3THKA 3C12A 5GAOp 3QWYA 2QA4T 1WXTA 1VQ9Q 2KXCA 1G3SA 1UGRB 1WXUA 2HBPA 3H8ZA 5LJ5g 3C0CA 3CCUT 3JCMc 3A8OB 1VQ7Q 2MMPA 1PC0A 2X3XD 1LPLA 2P4TA 3CBMA 4FM4B 2VXFA 5FLXE 1M3CA 2B8AA 2AZVA 4M77E 3V7CA 1VQKQ 1V76A 3QHSA 4PJOB 3ZEHA 2RD1A 3S3NA 4II1A 1LNXA 4OGCA 2QEXT 2COWA 2HL3A 1PHTA 3IQLA 2OTJA 1HSQA 1YIJT 2CP7A 3NTKA 1AZGB 3H0FA 3CCJQ 5FRMA 4LDXA 4ZGDB 3F70A 3KFVA 1YHQQ 1ZA1B 1I81A 1OI1A 2I2LA 2CZ6B 4ME7A 1JB0E 2F69A 3H9NA 1V1CA 4M7AC 2OTLQ 4QQ6A 5J26A 1ZHIA 4OVAA 2O4XA 3OW2S 2GBQA 1BI1A 1OZ3A 3M0UA 2HQEA 2DILA 4GLMA 1UGVA 1JEGA 2ENMA 5FW9A 1YJNA 2JN0A 2OJ2A 2NUZA 3LW5E 3LWHA 2VV5A 1UJ0A 3DLLA 1Y71A 2LNHB 4F7UB 3CC4Q 3ZBDA 2VYTA 3H41A 4HT9A 1FMWA 4BB7A 2BE9B 4NL2A 3QJ6A 1KQ1A 1Q86U 3ULRB 1MMGA 3OSSC 4CC4B 1R77A 1ZLMA 3MKDA 2QGFB 3UA6A 1QVPA 4M7DB 2RHXA 3QDFA 1GFDA 2CS7A 2CP0A 5DLOA 2KMTA 3AHUA 2DFUA 1RABB 5A2QE 3MP6A 1YN8A 3GOXA 2RK1A 2L3SA 1W2BP 2M9UA 2QASA 4KUDK 5EG2A 1T0HA 5LJ3f 2LDMA 2LC4A 1SHGA 2PU9B 3RERA 4PJOA 1X6OA 1K9AA 3BW1A 4BI4A 4JZ4A 4XU1A 5CQYA 3VS1A 1CKBA 2BTTA 2XDPA 3KBGA 1I4K1 1N6AA 4M78C 3FDRA 1X6BA 2EQKA 4C0FA 5I11A 2F2XA 4M75B 1E6GA 1WGSA 1YFNA 3O5ZA 1VQLQ 3QJYA 2HQXA 1JXOA 3QWXX 5GMKm 2K5LA 4JJBA 2PZ1A 2WSEE 1KFZA 3M5AA 2QXFA 3LGLA 5GAMd 1NE8A 4A53A 1Y96B 2VVKA 3CCRT 3QYHB 3V8KA 4XQ3A 1FXXA 1QWEA 2ZCFB 2O31A 1LOJA 1I8FA 1OEBA 1RACB 2DEUA 3VS7A 1TSFA 3CXCP 1GBRA 1VQ4T 4JRKA 1RAEB 1M3AA 1IGUA 4WTOB 1M5Q1 2COYA 4FW1A 1QVFA 1AOJA 2YHTA 4AFSC 2L0AA 2G3RA 3BDUA 4CC3A 2LQKA 2F5TX 4J9CA 4LNPA 4F7UA 2FRYA 2X4XA 3P8BB 1XQHA 1R8OB 1K8AU 2RJFA 1PM3A 1BI0A 1KC8U 3RIRA 1DJ7B 2PTKA 1K8AR 2JUFA 2EJ9A 2HL5C 4M7DA 2LJ0A 3Q1JA 1KC8R 4Z8AA 3FJ5A 5CAIA 2OTJT 5AYFA 4M78F 3HSBA 2QQSA 3EG9A 1ZSZA 1D0YA 5HCKA 3UDCA 4CRIA 1VQ8Q 5FRNA 3VRYA 4ZN3A 1ZUKA 4JDSA 3GNFB 2K3XA 3INZA 3M0PA 2CZ0B 2HD0A 1OX8A 1UHCA 3VS4A 5GAN8 1KHIA 5GAOq 1W2BS 5DM7R 3MJXA 1U06A 3SEMA 2IPOB 4M77A 4PFOA 4Z88A 5IH2A 1M4ZA 2DTHA 1J3TA 3UT1A 4YTLA 2ECZA 1M8MA 4JRIA 1VQNA 3CQTA 2RA2A 4RG2A 4C5EA 3OYBA 1T3LA 3OMGA 2O01E 4HKEA 2B86A 4CC2A 1YJNT 5LJ3j 2Z0WA 1QWFA 1YBYA 4C92E 2MWOA 5CO7A 4DBHA 3HRTA 3CCEA 3I5RA 1BBZA 3SWNC 1D3BB 1PSEA 1RAGB 3G7ZA 5IAYA 2RPNA 2E70A 3NTHA 3O8VA 1ZBXA 3OW2A 3A8LB 1W1FA 2MAMA 1TU0B 2D9TA 1YI2Q 4EIKA 3G71A 1GBQA 2YUQA 1IRXA 3CXCS 1Q82C 2DA9A 1HJDA 5GANd 1H8KA 2JM9A 3M57A 2M1HA 2E5QA 3VUBA 1KQSP 2JTEA 3CC7Q 2D6FA 3FJPA 3EGXB 2RO0A 3OYHA 2HDAA 2EKHA 1FMKA 1JJ2S 2DXCA 2CP6A 2LJ3A 4OF1A 5GAN4 2E3IA 1ABOA 3C95A 3A8HB 1AWWA 4KUIA 3GBQA 4BE1A 2DL7A 3L2QA 4C5GA 4C0DC 1YITA 3VV0A 2DKGA 1WNLA 4DEYA 2CSQA 4QQDA 1OX9A 4M7AB 1UGQB 4KGVB 3SB2A 4F16A 2RHUA 2EJGA 2KXDA 1GL5A 1TOVA 2R57A 3RBBB 1BKBA 3PGGA 2A36A 1RAIB 1NJIU 1K73R 1N8RC 1ARKA 2KK4A 3PTAA 3V7RA 4AFUC 1NJIR 1C1AA 3URGA 1RL2A 4OMLA 3M0TA 4GLKA 3PVQA 2FZCB 2K3YA 4Z89A 3VS5A 2KAFA 4BY6B 1SRMA 1G3YA 3CCVQ 3MP1A 2HQHA 3QKJA 2LCLA 1WJSA 1OYXA 2KYMA 3CCSA 1H92A 2GQVA 1SF9A 2O9SA 5GMKj 4QQGA 2F5KA 2ZPFB 5CVIA 2K2MA 3OQ5A 3UWNA 2KYBA 1D3BA 2IG0A 2DBKA 4M4ZA 1UGPB 1ABQA 4PFPA 1ZSZC 2CP3A 1AD5A 3L2VA 1FYNA 5L23A 2R58A 2X4WA 4QVDA 5GANf 3I56A 1VQPQ 4ZNXA 2JS2A 1FX7A 4X9DA 1M1KR 1SSFA 1WJQA 1WQWA 3J81E 4HCBA 2ESWA 1WLPB 2PQWA 2NUPA 4BACA 3EGXA 1PSFA 3LH5A 3OBYA 3QZ5B 2MOXA 2WSFE 4MZMA 2YRVA 2DF6A 3S3OA 4LUEA 1NG2A 2QA4Q 4X9CA 3JV3A 2A08A 2EGEA 1PD1A 1PNJA 1TUCA 2ZPHB 3HTRA 3I55A 3GP8A 4BD3A 1VQNT 5CKDA 4WCIA 2HNIA 1K73C 5IHKA 1G5VA 1GCPA 3EG2A 3R6NA 2DYBA 4B6MA 1QCNA 2KT1A 4N0AC 4NS5A 2V8JA 4M78D 3JCMX 1NLOC 1AEYA 3CCET 2VWFA 3DB4A 2XDBA 3TCJA 2QEXQ 3PMIA 4HCZA 5J39A 2PUOB 2K2VA 4E7SA 1VQ7A 2JTMA 2BE7D 1YIJQ 2I0NA 1IO6A 2V1QA 3L2ZA 2V8KA 4FCYA 3HRUA 2XMFA 2FB7A 3G71T 2IVWA 3M4YA 3A1PA 4DA4A 2VC8A 2RQWA 4AMCA 3OB9A 3META 3G6EA 1I07A 2DLPA 2GTJA 2L8DA 1QP2A 4BE0A 4FU6A 1S72A 4F7UE 4LDWA 2FZGB 2X9HA 1TG0A 3QIIA 3QO3A 1NPRA 2RHZA 4M77F 1M2VB 2Y4XA 1BU1A 1B3QA 3CCRA 1G3TA 5FU6B 4C92A 1M1KC 1YITT 3A8GB 1UUEA 8AT1B 5CKHA 4XTWA 3NFCA 3M4GA 2J7IA 2E4HA 1SHFA 3PFSA 4XAXB 2BIVA 2JW4A 5KE3A 4MMLA 1JJ2A 1BCOA 2CSIA 3CMAA 1KK7A 1M90C 5DY9A 4E7KA 1RUWA 3ME9A 4M77G 1AWJA 1BCMA 2KNBB 5KCOA 3G4SA 2DTOA 1EFNA 5FU7B 4ORZA 1VIEA 2DX1A 5GANj 4M75E 3VUZA 2FEIA 5KYXB 5LJ3d 2KROA 3KUFA 3WVDB 3X26B 2AT1B 4QT7A 1JXMA 2EGAA 2J6FA 3RR6A 3CCST 2K6DA 2VUBA 2E10A 4PLIA 5GAN5 3EG1A 1PRMC 2KDSA 4Y92A 4C5IA 1YJ9A 3J7AF 2QDLA 1YJWA 1SPKA 2XU8A 4BDZA 4R0KA 2EIFA 4F14A 1X69A 1Y57A 1VYUA 4HXJA 2J06A 3EGUA 3VKIA 1KD1U 5LJ3g 2RQVA 4JRPA 5GMKl 3I56T 3OMCA 1KD1R 2X4JA 1X75C 2ZPEB 4C8QC 2RJDA 4FYXB 2LQ8A 2ZPIB 2RHYA 3OA6A 1IZ6A 3CC2A 5KYYA 3JCMb 1KG1A 1E7OA 6AT1B 2GF7A 4GBQA 1D1CA 4BUGA 4BE2A 3PT9A 4AT1B 3LWIA 4J9FA 1XJWB 4A54A 3A5ZB 3L1AA 1VUBA 2L89A 2QQ9A 1OPLA 4KGZB 3GPLA 1B34A 4J9BA 1Q7YU 3I55T 3OYAA 1Q7YR 4N4GA 1AHJB 2OAUA 2EYQA 3CCLT 4KT0E 1WHHA 3MHXA 4DBRA 1K9MU 3OYYA 1ZA2B 3SD4A 1Q86R 2YWWA 1Q81U 1K9MR 2RQUA 4BDYA 3CPWP 3HFNA 1WI7A 1GFCA 1Q81R 5DLQE 2JTFA 1LJOA 3JAME 2QDYB 2JXBA 1OZ2A 3RNJA 2DETA 1VQ7T 2XI9A 2OTJQ 1QVGP 1KHCA 2VKNA 4OP0A 3LGFA 4FT2A 4R55A 4RCBA 3MP8A 1AT1B 2HKQB 4PJNA 1M2OA 1ZQ1A 4KBMB 1TUGB 3OYJA 4RG8A 5KCHA 3G6ET 4C8QF 3UPUA 5KYUB 1S72T 3JCMd 2RI3A 2DL8A 3JCMJ 2JM8A 4MDXA 4J83A 3M9QA 2DO3A 2DXBA 2QAZA 3CBPA 2RJEA 4KH1B 1HYOA 1X27A 2X3WD 2XICA 4J7FA 2H8HA 2BUDA 2M51A 4JZ3A 3QBYA 4IUPA 3CPFA 1YHQT 2BKDN 2KR3A 1OOTA 1PKSA 5KE2A 1YJNQ 4AFQC 2VASA 4J9IA 4C8QG 3DKMA 1Y7XA 1WHGA 2K7AA 1U1SA 2OTLT 1NPPA 2EYYA 1SRLA 4J8OA 3X28B 3P8HA 2MYSA 4FYWB 3CMAT 5GAMg 3EGDB 4LUDA 3VJPA 2CT3A 2KRNA 3R6OA 2AIRB 5L8RE 4IUUA 3G4ST 1MHNA 1M1FA 3RKWA 2ZGWA 1I5OB 3FIFA 4EMKB 4M7AE 2LX7A 4A4KA 1Q86C 3E1SA 4HA8A 2WSCE 3C94A 4OB0B 4DEXA 4M77D 2SEMA 4KGXB 4L59A 1EX4A 3HHTB 3JSCA 2LT1A 2F2VA 2NLUA 3RESA 1ZSGA 2COZA 2FVUA 7AT1B 1Y0MA 2QGGA 5HK3A 1YJ9T 1YWOA 2FO0A 2OAWA 1YJWT 2YUPA 4D8KA 4C92F 2QQAA 5IXBA 1MNDA 2C0IA 3OS5A 4PL6A 3TSZA 3C4SA 3MPUB 2RB6A 3OYLA 2PNIA 2RK2A 1H3ZA 4E2FB 1D1AA 1MNEA 2ROLA 3JCMf 3NTIA 2HKNA 3CC2T 2DD4A 1TXQA 2KGTA 1OU8A 2PUKB 3GLXA 4M75A 2JNGA 1WIEA 3FEOA 4LXCA 4X1VA 1M8VA 4OB2B 5GAOm 4RTWA 2LQNA 5LJ5e 2HSPA 1K76A 3JB9F 3M55A 2RMOA 4C92G 3CD6A 1Y96A 3OS0A 2W0ZA 4NL3A 3TREA 3EAEA 4RTXA 1QW1A 1OV3A 2E3HA 3WXMB 1UTIA 3PE0A 4L6V5 3PVLA 2PVOB 5GJVB 2P0QA 2Y4YA 2YLCA 3LLRA 2MPXC 4M78E 4FW2A 4DOWA 1QMCA 1GRIA 1AVZC 3TSWA 3JB9J 2L3RA 2P4RA 2BZYA 2E65A 1TH7A 1X2KA 4AG1C 2MIOA 3EGDA 1WPYA 5D6YA 3JB9G 2CUBA 2R5MA 1C6VX 1VYTA 4PJOC 4XK8E 2E12A 3VRZA 4J9GA 3I5SA 2YSQA 2ZAEA 2XD0A 4IIOA 4EMKA 1K8AC 1NM7A 1VQ5Q 3E9GA 1KC8C 2CZ7B 1GCQA 1VQOQ 3DB3A 2KRMA 3OYKA 1OU9A 2QYZA 1WXBA 1U1TA 2DRKA 2K9GA 3I35A 2EKOA 5GANg 3QG1A 1Z9QA 5KH6A 1G2BA 2K57A 3E2UA 4OMMA 2LJ1A 1RLPC 3OBWA 4P5NA 5LJ5h 4ZTFA 2A7YA 3OS2A 4X34A 2GFUA 2SRCA 2DJZA 2AK5A 5CKFA 1RAFB 3J80E 1VQNQ 2EYWA 3SFMA 2EVRA 3TEEA 1TUDA 2EW3A 2ED1A 1ZUYA 4JJCA 3CMEQ 3HP9A 2AKLA 2QTXA 3MO8A 1IXDA 1WDXA 3VU3C 3JCMV 5IHNA 3CCEQ 3PMTA 4IURA 4F04B 2D0QB 2A0FB 1WJRA 1SG5A 2YUNA 3N5BB 2D8JA 5A0DA 1JU5C 2DE0X 2DXUA 3MEUA 3GIBA 4C8QD 4IIMA 1R0BG 4PJOF 3G71Q 4LDUA 1IGQA 2ABLA 2DMOA 4M7DC 1OQKA 1TS9A 4DOVA 4E6RA 2RQRA 2DL4A 3VYHB 4V2SA 2C06A 1QVFP 2FPEA 3EH2A 4FSSA 2KRSA 4PJMA 1O9SA 4A4HA 2DNUA 2QQBA 4FYYB 2RQTA 2J05A 2RHIA 1W6XA 1MMAA 2AHJB 3CCQA 3M53A 1MUZA 1WYXA 2RF0A 4OGEA 4M78B 1VQ6A 1K4US 1NYGA 1U5SA 1V29B 4J9DA 3TQ7P 3S6WA 4PJOG 2K79A 4K11A 4UC4A 1AWXA 5AT1B 4ESRA 3PNWC 4A63B 4XTVA 1E6HA 1N5ZA 1KJWA 4M77C 3OYDA 4IKFA 5GMKe 3H6ZA 3P8DA 4M75C 1TTHB 3CCMA 4LN2A 5IXFA 3OYCA 3TU4K 4HCCA 1Y07A 1D0XA 2EPDA 4DBQA 3CCUQ 2OI3A 1KQSS 1IHWA 2DPPB 1PD0A 2F1LA 2RM4A 4M7AA 1RI0A 5D6XA 3X25B 2BZ8A 3CCLA 2H3JA 2K5IA 2YRDA 3CD6T 2XIDA 5GAMe
chains in the Genus database with same CATH topology
1X69A 1M3AA 1Y57A 1VYUA 2CDTA 4HXJA 2J06A 3EGUA 3A98A 2K3BA 4HVVA 5FWCA 3VS2A 1PRLC 2RQVA 1UDLA 1CKAA 1U3OA 1AOJA 2GGRA 1UFFA 2CREA 2L3QA 2ROTA 1RLQC 4AFSC 2L0AA 1K0XA 1NEBA 3EG3A 3M0SA 1E7OA 3NGPA 4CC3A 1XOVA 4GBQA 4J9CA 4LNPA 2FRYA 2JT4A 4AG2C 2EQIA 4CC7A 4J9FA 1UHFA 1QLYA 2HBWA 2GQIA 5GJWB 2PTKA 1OPLA 4OMQA 2LJ0A 4J9BA 3FJ5A 1YWPA 4Z8AA 1JO8A 2L3PA 2A28A 4HVWA 2W10A 5HCKA 2KT8A 5FWBA 3VRYA 1QKWA 1ZUKA 2CH4W 1MV3A 2G6FX 4RTTA 1YP5A 1NLPC 3VS3A 2MCNA 3M0PA 4JJDA 2RQUA 4JPBW 2AZSA 1WI7A 2D1XA 1GFCA 1UHCA 3EHQA 2DJQA 2FRWA 2JXBA 3VS4A 3RNJA 1T3SA 3VS6A 2VKNA 1U06A 2EYZA 3SEMA 1KSWA 4Z88A 5IH2A 2E5KA 2EYXA 1K1ZA 4RTZA 1WFWA 2DVJA 1J3TA 2ECZA 1M8MA 3CQTA 1X6GA 1PWTA 1B07A 3REBB 1T3LA 2JS0A 2B86A 4CC2A 4RTVA 1S1NA 1QWFA 4OMNA 4RTUA 2HCKA 1ZUUA 5EC7A 2DL8A 1WA7A 2JM8A 3I5RA 1BBZA 2BZXA 1QCFA 2GTOA 1AZEA 2RPNA 1X27A 2X3WD 2H8HA 1W1FA 2HEQA 2CH4A 2M51A 4JZ3A 3TVTA 1OPKA 1BK2A 2KR3A 4EIKA 1GBQA 1LCKA 1OOTA 1PKSA 2YUQA 3NPFA 2DA9A 2CUDA 4AFQC 1HJDA 1H8KA 4J9IA 3UF4A 2JM9A 1WX6A 2RNAA 4J9EA 1UE9A 2K7AA 2JTEA 3SHWA 2V1RA 2EYYA 3VS0A 2F2WA 1SEMA 2HDAA 1SRLA 2EKHA 1FMKA 1H3HA 2LJ3A 4LUDA 1YNZA 1ABOA 1AWWA 2CT3A 3GBQA 3UA7A 2KRNA 2DRMA 1UECA 2LMJA 2DL7A 3H0HA 1M27C 1VYVA 2JMCA 1SSHA 4DEYA 2CSQA 2LX7A 2EBPA 2J6KA 1G83A 2M0YA 4DEXA 2D0NA 4F16A 2SEMA 1QKXA 2KXDA 5IHIA 2F2VA 3U23A 1GL5A 4AFZC 5ECAA 1GCQC 3RBBB 2KEAA 2A36A 1ZSGA 1Y0MA 1YWOA 3UATA 2FO0A 2OAWA 1ARKA 2YUPA 4AFUC 3M0QA 4D8KA 1MV0B 4HVUA 2L2PA 5IXBA 2AKKA 2C0IA 1PKTA 4OMLA 3M0TA 3PVQA 3TSZA 4RUGA 4Z89A 1CSKA 2PNIA 3VS5A 1I1JA 1NEGA 1SRMA 2FPFA 2DL3A 3H0IA 1JQQA 2O2OA 1HD3A 2ROLA 4HCKA 2KYMA 1H92A 1BB9A 2YT6A 2KGTA 2O9SA 2RN8A 2J6OA 1WIEA 1RI9A 4X1VA 2K2MA 4D8DA 2KYBA 4RTWA 2EGCA 2LQNA 2HSPA 1K76A 1T0JA 2RMOA 1UJYA 2DBKA 3NHNA 2DBMA 4M4ZA 3THKA 1ABQA 2FPDA 4OMOA 3QWYA 1WXTA 2W0ZA 2KXCA 4RTXA 1WXUA 1AD5A 1OV3A 1FYNA 3C0CA 5L23A 4ZNXA 1UTIA 2JS2A 3PE0A 3PVLA 5GJVB 2X3XD 5I22A 1GRIA 2ESWA 1AVZC 1WLPB 3TSWA 1M3CA 2P4RA 2AZVA 2BZYA 3LH5A 1X2KA 2MOXA 4AG1C 2MIOA 2DF6A 4LUEA 2CUBA 1NG2A 3EHRA 1VYTA 3JV3A 2A08A 2EGEA 3VRZA 2A37A 4J9GA 3I5SA 2C0TA 1PNJA 2YSQA 1TUCA 1PHTA 3IQLA 4IIOA 2D8HA 1HSQA 1NM7A 1AZGB 3EG0A 3H0FA 1ZBJA 1GCQA 4WCIA 1VA7A 5IHKA 2KBTA 3KFVA 1GCPA 2KRMA 3EG2A 1I0CA 3R6NA 1ZX6A 1WXBA 2DYBA 3REAB 2KT1A 2DRKA 2K9GA 3I35A 1AEYA 1NLOC 1Z9QA 1X2QA 1M3BA 1W70A 2VWFA 1G2BA 1X43A 4OMMA 1NYFA 1V1CA 2LJ1A 1RLPC 2YUOA 1KIKA 2I0NA 1IO6A 2V1QA 1AWOA 2LP5A 3NMZC 2SRCA 2GBQA 2AK5A 2XMFA 2EYWA 2EVRA 1TUDA 3M0UA 2EW3A 2ED1A 1ZUYA 4JJCA 2DILA 4GLMA 1UGVA 2RQWA 2AKLA 1JEGA 2ENMA 1K0SA 2GNCA 5FW9A 1I07A 1WDXA 2DLPA 2LQWA 2OJ2A 2GTJA 5IHNA 2NUZA 1UJ0A 2LNHB 4J9HA 1UG1A 2YUNA 3H41A 2CT4A 2D8JA 4F17A 1JU5C 1TG0A 4KRTA 3ULRB 2DE0X 3ZL7C 4CC4B 1BU1A 1ZLMA 4LE9A 1B3QA 3M0RA 2FG0A 4IIMA 3UA6A 3I9QA 1GFDA 1UUEA 2ABLA 2DMOA 4RTYA 1YN8A 4E6RA 2RQRA 2DL4A 4OMPA 2J7IA 1SHFA 2FPEA 2LZ6B 2L3SA 2LCSA 4FSSA 2KRSA 2JW4A 2IIMA 1T0HA 2CSIA 2NWMA 2DL5A 1SHGA 2DNUA 2RQTA 2J05A 1W6XA 1K9AA 4JZ4A 1MUZA 1WYXA 2JMAA 1RUWA 1CKBA 2RF0A 3VS1A 1K4US 1M30A 1AWJA 2BTTA 2KNBB 1NYGA 1U5SA 4J9DA 2K79A 2KE9A 4K11A 2ED0A 1EFNA 1AWXA 2YDLA 1X6BA 4ORZA 2DX1A 4ESRA 5I11A 2F2XA 4A63B 2DM1A 2O88A 1E6GA 3O5ZA 1E6HA 1N5ZA 2FEIA 1KJWA 1JXOA 3QWXX 2KROA 4JJBA 2O9VA 4LN2A 4QT7A 1JXMA 2PZ1A 2EGAA 5IXFA 1KFZA 2J6FA 1Z9ZA 2EPDA 2K6DA 2OI3A 2VVKA 1YCSB 1QWEA 1PRMC 3EG1A 2C0OA 4Y92A 1A0NB 2O31A 2QDLA 2BZ8A 1OEBA 3VS7A 1SPKA 4R0KA 1GBRA 4F14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X69 A;  1M3A A;  1Y57 A;  1VYU A;  2CDT A;  4HXJ A;  2J06 A;  3EGU A;  3A98 A;  2K3B A;  4HVV A;  5FWC A;  3VS2 A;  1PRL C;  2RQV A;  1UDL A;  1CKA A;  1U3O A;  1AOJ A;  2GGR A;  1UFF A;  2CRE A;  2L3Q A;  2ROT A;  1RLQ C;  4AFS C;  2L0A A;  1K0X A;  1NEB A;  3EG3 A;  3M0S A;  1E7O A;  3NGP A;  4CC3 A;  1XOV A;  4GBQ A;  4J9C A;  4LNP A;  2FRY A;  2JT4 A;  4AG2 C;  2EQI A;  4CC7 A;  4J9F A;  1UHF A;  1QLY A;  2HBW A;  2GQI A;  5GJW B;  2PTK A;  1OPL A;  4OMQ A;  2LJ0 A;  4J9B A;  3FJ5 A;  1YWP A;  4Z8A A;  1JO8 A;  2L3P A;  2A28 A;  4HVW A;  2W10 A;  5HCK A;  2KT8 A;  5FWB A;  3VRY A;  1QKW A;  1ZUK A;  2CH4 W;  1MV3 A;  2G6F X;  4RTT A;  1YP5 A;  1NLP C;  3VS3 A;  2MCN A;  3M0P A;  4JJD A;  2RQU A;  4JPB W;  2AZS A;  1WI7 A;  2D1X A;  1GFC A;  1UHC A;  3EHQ A;  2DJQ A;  2FRW A;  2JXB A;  3VS4 A;  3RNJ A;  1T3S A;  3VS6 A;  2VKN A;  1U06 A;  2EYZ A;  3SEM A;  1KSW A;  4Z88 A;  5IH2 A;  2E5K A;  2EYX A;  1K1Z A;  4RTZ A;  1WFW A;  2DVJ A;  1J3T A;  2ECZ A;  1M8M A;  3CQT A;  1X6G A;  1PWT A;  1B07 A;  3REB B;  1T3L A;  2JS0 A;  2B86 A;  4CC2 A;  4RTV A;  1S1N A;  1QWF A;  4OMN A;  4RTU A;  2HCK A;  1ZUU A;  5EC7 A;  2DL8 A;  1WA7 A;  2JM8 A;  3I5R A;  1BBZ A;  2BZX A;  1QCF A;  2GTO A;  1AZE A;  2RPN A;  1X27 A;  2X3W D;  2H8H A;  1W1F A;  2HEQ A;  2CH4 A;  2M51 A;  4JZ3 A;  3TVT A;  1OPK A;  1BK2 A;  2KR3 A;  4EIK A;  1GBQ A;  1LCK A;  1OOT A;  1PKS A;  2YUQ A;  3NPF A;  2DA9 A;  2CUD A;  4AFQ C;  1HJD A;  1H8K A;  4J9I A;  3UF4 A;  2JM9 A;  1WX6 A;  2RNA A;  4J9E A;  1UE9 A;  2K7A A;  2JTE A;  3SHW A;  2V1R A;  2EYY A;  3VS0 A;  2F2W A;  1SEM A;  2HDA A;  1SRL A;  2EKH A;  1FMK A;  1H3H A;  2LJ3 A;  4LUD A;  1YNZ A;  1ABO A;  1AWW A;  2CT3 A;  3GBQ A;  3UA7 A;  2KRN A;  2DRM A;  1UEC A;  2LMJ A;  2DL7 A;  3H0H A;  1M27 C;  1VYV A;  2JMC A;  1SSH A;  4DEY A;  2CSQ A;  2LX7 A;  2EBP A;  2J6K A;  1G83 A;  2M0Y A;  4DEX A;  2D0N A;  4F16 A;  2SEM A;  1QKX A;  2KXD A;  5IHI A;  2F2V A;  3U23 A;  1GL5 A;  4AFZ C;  5ECA A;  1GCQ C;  3RBB B;  2KEA A;  2A36 A;  1ZSG A;  1Y0M A;  1YWO A;  3UAT A;  2FO0 A;  2OAW A;  1ARK A;  2YUP A;  4AFU C;  3M0Q A;  4D8K A;  1MV0 B;  4HVU A;  2L2P A;  5IXB A;  2AKK A;  2C0I A;  1PKT A;  4OML A;  3M0T A;  3PVQ A;  3TSZ A;  4RUG A;  4Z89 A;  1CSK A;  2PNI A;  3VS5 A;  1I1J A;  1NEG A;  1SRM A;  2FPF A;  2DL3 A;  3H0I A;  1JQQ A;  2O2O A;  1HD3 A;  2ROL A;  4HCK A;  2KYM A;  1H92 A;  1BB9 A;  2YT6 A;  2KGT A;  2O9S A;  2RN8 A;  2J6O A;  1WIE A;  1RI9 A;  4X1V A;  2K2M A;  4D8D A;  2KYB A;  4RTW A;  2EGC A;  2LQN A;  2HSP A;  1K76 A;  1T0J A;  2RMO A;  1UJY A;  2DBK A;  3NHN A;  2DBM A;  4M4Z A;  3THK A;  1ABQ A;  2FPD A;  4OMO A;  3QWY A;  1WXT A;  2W0Z A;  2KXC A;  4RTX A;  1WXU A;  1AD5 A;  1OV3 A;  1FYN A;  3C0C A;  5L23 A;  4ZNX A;  1UTI A;  2JS2 A;  3PE0 A;  3PVL A;  5GJV B;  2X3X D;  5I22 A;  1GRI A;  2ESW A;  1AVZ C;  1WLP B;  3TSW A;  1M3C A;  2P4R A;  2AZV A;  2BZY A;  3LH5 A;  1X2K A;  2MOX A;  4AG1 C;  2MIO A;  2DF6 A;  4LUE A;  2CUB A;  1NG2 A;  3EHR A;  1VYT A;  3JV3 A;  2A08 A;  2EGE A;  3VRZ A;  2A37 A;  4J9G A;  3I5S A;  2C0T A;  1PNJ A;  2YSQ A;  1TUC A;  1PHT A;  3IQL A;  4IIO A;  2D8H A;  1HSQ A;  1NM7 A;  1AZG B;  3EG0 A;  3H0F A;  1ZBJ A;  1GCQ A;  4WCI A;  1VA7 A;  5IHK A;  2KBT A;  3KFV A;  1GCP A;  2KRM A;  3EG2 A;  1I0C A;  3R6N A;  1ZX6 A;  1WXB A;  2DYB A;  3REA B;  2KT1 A;  2DRK A;  2K9G A;  3I35 A;  1AEY A;  1NLO C;  1Z9Q A;  1X2Q A;  1M3B A;  1W70 A;  2VWF A;  1G2B A;  1X43 A;  4OMM A;  1NYF A;  1V1C A;  2LJ1 A;  1RLP C;  2YUO A;  1KIK A;  2I0N A;  1IO6 A;  2V1Q A;  1AWO A;  2LP5 A;  3NMZ C;  2SRC A;  2GBQ A;  2AK5 A;  2XMF A;  2EYW A;  2EVR A;  1TUD A;  3M0U A;  2EW3 A;  2ED1 A;  1ZUY A;  4JJC A;  2DIL A;  4GLM A;  1UGV A;  2RQW A;  2AKL A;  1JEG A;  2ENM A;  1K0S A;  2GNC A;  5FW9 A;  1I07 A;  1WDX A;  2DLP A;  2LQW A;  2OJ2 A;  2GTJ A;  5IHN A;  2NUZ A;  1UJ0 A;  2LNH B;  4J9H A;  1UG1 A;  2YUN A;  3H41 A;  2CT4 A;  2D8J A;  4F17 A;  1JU5 C;  1TG0 A;  4KRT A;  3ULR B;  2DE0 X;  3ZL7 C;  4CC4 B;  1BU1 A;  1ZLM A;  4LE9 A;  1B3Q A;  3M0R A;  2FG0 A;  4IIM A;  3UA6 A;  3I9Q A;  1GFD A;  1UUE A;  2ABL A;  2DMO A;  4RTY A;  1YN8 A;  4E6R A;  2RQR A;  2DL4 A;  4OMP A;  2J7I A;  1SHF A;  2FPE A;  2LZ6 B;  2L3S A;  2LCS A;  4FSS A;  2KRS A;  2JW4 A;  2IIM A;  1T0H A;  2CSI A;  2NWM A;  2DL5 A;  1SHG A;  2DNU A;  2RQT A;  2J05 A;  1W6X A;  1K9A A;  4JZ4 A;  1MUZ A;  1WYX A;  2JMA A;  1RUW A;  1CKB A;  2RF0 A;  3VS1 A;  1K4U S;  1M30 A;  1AWJ A;  2BTT A;  2KNB B;  1NYG A;  1U5S A;  4J9D A;  2K79 A;  2KE9 A;  4K11 A;  2ED0 A;  1EFN A;  1AWX A;  2YDL A;  1X6B A;  4ORZ A;  2DX1 A;  4ESR A;  5I11 A;  2F2X A;  4A63 B;  2DM1 A;  2O88 A;  1E6G A;  3O5Z A;  1E6H A;  1N5Z A;  2FEI A;  1KJW A;  1JXO A;  3QWX X;  2KRO A;  4JJB A;  2O9V A;  4LN2 A;  4QT7 A;  1JXM A;  2PZ1 A;  2EGA A;  5IXF A;  1KFZ A;  2J6F A;  1Z9Z A;  2EPD A;  2K6D A;  2OI3 A;  2VVK A;  1YCS B;  1QWE A;  1PRM C;  3EG1 A;  2C0O A;  4Y92 A;  1A0N B;  2O31 A;  2QDL A;  2BZ8 A;  1OEB A;  3VS7 A;  1SPK A;  4R0K A;  1GBR A;  4F14 A; 
#chains in the Genus database with same CATH topology
 2NUT B;  4OB3 B;  1VQM A;  2DD5 A;  2CDT A;  4BI8 B;  2DK3 A;  4F7U F;  1NJI C;  3VYG A;  2K3B A;  5FWC A;  2MF2 A;  1UDL A;  5KYW B;  1VQ9 A;  3EFR A;  1U3O A;  4DBF A;  2RH2 A;  3CCS Q;  2CRE A;  2L3Q A;  1W2B A;  4E7J A;  4M7D F;  4C92 D;  1BYM A;  1HXD A;  3EG3 A;  2YRC A;  1XOV A;  3MCA B;  1P92 A;  1WHJ A;  2FYK A;  2CZ1 B;  2EQI A;  2DZC A;  2QQR A;  2R5A A;  1QLY A;  3HL8 A;  1VQK A;  2QK0 A;  4RKU E;  2GQI A;  5GJW B;  3JCM Q;  4F7U G;  2ZPG B;  2EWN A;  3LYI A;  3I56 Q;  1YWP A;  1PG5 B;  1JO8 A;  2L3P A;  3OW2 P;  5C0M A;  2A28 A;  2JZ2 A;  3G1J A;  1QCO A;  2YXY A;  3JB9 D;  2KT8 A;  4M7D G;  5FWB A;  2CH4 W;  5GMK h;  3CCJ A;  4M75 F;  4DQ2 A;  2G6F X;  4XU3 A;  3VS3 A;  2MCN A;  1YHQ A;  4EPC A;  3CXC A;  4E7I A;  4JPB W;  3M59 A;  2AZS A;  1NBE B;  4M78 A;  3EHQ A;  3L2W A;  4D6W A;  1T3S A;  3I55 Q;  2KVQ G;  3V8J A;  2EYZ A;  2PVD B;  2XKO C;  2OTL A;  3LX7 A;  5GAM h;  2EYX A;  2E64 A;  1WFW A;  4FYV B;  1D09 B;  2QTV A;  2XHC A;  4XU2 A;  1X6G A;  1PWT A;  1B07 A;  1RAD B;  4M75 G;  1NZ9 A;  3REB B;  3RMQ A;  2JS0 A;  2CP2 A;  2VXE A;  3BE3 A;  3M54 A;  4OMN A;  2HCK A;  3SWN B;  1ZUU A;  1MMN A;  2FL7 A;  5EC7 A;  2BZX A;  1QCF A;  4PK4 A;  1HK9 A;  3CC4 A;  3SDZ A;  2NUT A;  4IUV A;  5CKE A;  3E19 A;  1WHM A;  2ZZD A;  1JBM A;  4E47 A;  2HEQ A;  2CH4 A;  2CKK A;  5KYW A;  1OPK A;  2KSS A;  2Y90 A;  3MEV A;  3OS1 A;  2H3E B;  3G6E Q;  4MDW A;  3NPF A;  2CUD A;  3KXT A;  3HFO A;  5LL6 S;  5GAO n;  1WX6 A;  1S72 Q;  2RNA A;  4MZT A;  1UE9 A;  3SHW A;  4JRQ A;  2V1R A;  3VS0 A;  2F2W A;  4IUQ A;  2EAY A;  2KQW A;  1EIF A;  2DEQ A;  3CCQ T;  5GAN e;  3CCR Q;  1VQ6 T;  4C0D B;  2DRM A;  1UEC A;  2LMJ A;  2HMA A;  3H0H A;  1M27 C;  1VYV A;  4RMO A;  1SSH A;  1UB4 A;  4J6Y A;  3S3M A;  3JCM P;  2DAQ A;  1VQ4 Q;  2J6K A;  3ZFJ A;  2M0Y A;  3CCM T;  5GAO r;  3AT1 B;  3QDR B;  1VQL A;  1M2V A;  1ACM B;  4AFZ C;  2QG9 B;  5D7U A;  5ECA A;  2LX9 A;  4PJO D;  2ATC B;  3CMA Q;  4C0Z A;  4LDY A;  5LJ5 f;  1RAA B;  2DXT A;  2DER A;  3BY7 A;  3FRN A;  1XTD A;  3OYN A;  3G4S Q;  3M0Q A;  4LD6 A;  2L2P A;  1VQM T;  2DVE A;  5I21 A;  4QVC A;  4LDV A;  1PKT A;  4QVZ A;  1CSK A;  5CQX A;  4L5G A;  1VQ9 T;  1NEG A;  2FPF A;  2DL3 A;  3D7S B;  3H0I A;  5CR2 A;  4NOY A;  4BY6 C;  4HCK A;  1KQS A;  4ATO A;  3X20 B;  1BB9 A;  2J6O A;  1YJ9 Q;  3SWN A;  2X51 A;  1YJW Q;  4KH0 B;  5KYX A;  2CP5 A;  1M9S A;  4FIB A;  2P0K A;  2XG8 D;  3E9F A;  1VQK T;  1T0J A;  3EG9 B;  1ZSZ B;  1UJY A;  2DBM A;  4N4H A;  1QQJ A;  2FPD A;  4OMO A;  5GAN h;  4Y91 A;  1WQ7 A;  4LD9 K;  3QXE B;  5M9O A;  1G3W A;  4C92 C;  3CBO A;  3L2U A;  3WVE B;  1Q95 G;  4XU0 A;  3CC2 Q;  3FB9 A;  3M58 A;  3GF5 A;  5I22 A;  1KD1 C;  1N27 A;  1VQ8 A;  3CCJ T;  3A8M B;  4M7A F;  4M77 B;  4MMK A;  3FC3 A;  1IB8 A;  2JVV A;  5GAO l;  4JS5 A;  4J5Y A;  3EHR A;  3HKS A;  4M7D D;  1MMD A;  3ASK A;  2OX7 A;  3JCM g;  2A37 A;  1N9S A;  1WHK A;  4PKC C;  5GMK i;  2C0T A;  2K4Y A;  3OYF A;  2DIQ A;  4Y28 E;  2D8H A;  2KI7 A;  4EMG A;  1EZZ B;  5HK0 A;  3EG0 A;  4XTX A;  9ATC B;  1ZBJ A;  1G8X A;  1VA7 A;  4EMH A;  2KBT A;  5CKB A;  1Q7Y C;  4M7A G;  1I0C A;  2DTI A;  2L5Q A;  1ZX6 A;  3REA B;  2VB6 A;  4C8Q E;  1JJ2 P;  4ZGE B;  1X2Q A;  1M3B A;  1W70 A;  1X43 A;  2E6Z A;  1NYF A;  3M56 A;  3X24 B;  3BDL A;  1K9M C;  4PNO A;  3CC4 T;  4FL6 A;  3JRZ A;  5I2S A;  2YUO A;  1Q82 U;  4M75 D;  1KIK A;  5C6S A;  4B9W A;  1Q81 C;  1AWO A;  1JRI A;  2LP5 A;  2LNV A;  3NMZ C;  1Q82 R;  2HAX A;  1B7T A;  2EQM A;  4O6J A;  5CCA A;  5CK9 A;  1FMV A;  1SKU B;  1YI2 A;  4R56 A;  2V8I A;  4A4E A;  2GNC A;  1K0S A;  4J7I A;  2LQW A;  4PLL A;  5LJ5 j;  4OB1 B;  5D6W A;  4ELY C;  4J9H A;  4E7Z A;  3CPW S;  1UG1 A;  3CC7 A;  4ELZ C;  2CT4 A;  4F17 A;  3LH0 A;  4KRT A;  1VQ5 A;  2M0O A;  3ZL7 C;  1UGS B;  1QVG S;  2QI2 A;  2CGH A;  5KYU A;  4LE9 A;  4OMF B;  3M0R A;  2FG0 A;  3I9Q A;  2LRQ A;  2MWP A;  5HKC A;  3OYM A;  1VQO A;  5FU6 C;  2DYI A;  2P84 A;  4RTY A;  4OMP A;  1MGQ A;  1N8R U;  1VQL T;  1RAH B;  2LZ6 B;  4N4I A;  2LCS A;  4PJL A;  2EJF A;  2IIM A;  1N8R R;  2JJ9 A;  2NWM A;  2DL5 A;  4M78 G;  1M1G A;  1O75 A;  4IUT A;  5GAM f;  2JMA A;  3RMS A;  1M30 A;  2LTO A;  5J3B A;  2PVG B;  4JLI A;  3CME A;  4J6X A;  2KE9 A;  2ED0 A;  2YDL A;  1WHL A;  2LCC A;  2DM1 A;  3V8L A;  3JB9 I;  2O88 A;  5FU7 C;  4Q5W A;  4Z02 A;  2O9V A;  2WAC A;  3CCV A;  4N0A A;  4WF2 A;  1Z9Z A;  2X4Y A;  1YCS B;  3FLG A;  2GFA A;  2C0O A;  5I2M A;  1A0N B;  4HT8 A;  3QPH A;  5LJ3 e;  1C0M A;  1U8R A;  3CEY A;  2XK0 A;  1H64 1;  3A98 A;  4A4G A;  2NUP B;  4HVV A;  3VS2 A;  1PRL C;  2EFI A;  1CKA A;  4C8Q B;  4KUL A;  2GGR A;  1UFF A;  1OUL A;  1VQP A;  2ROT A;  1RLQ C;  4XTU A;  5GAN 2;  2X35 A;  1K0X A;  1NEB A;  3M0S A;  1VQ8 T;  3NGP A;  3GNG A;  4ANJ A;  2MI6 A;  2JT4 A;  4AG2 C;  2MK5 A;  3T9N A;  5CIU A;  5KYN A;  3CD6 Q;  4CC7 A;  1UHF A;  2HBW A;  3EFO B;  3OYG A;  2CYZ B;  4O5V A;  3HPW A;  3JCM W;  2QA4 A;  4OMQ A;  3MEA A;  1K73 U;  5IN1 A;  3QZ9 B;  3EFS A;  3CCU A;  3MEW A;  3PIO A;  2DIG A;  1VIF A;  4HVW A;  2W10 A;  4JUV A;  1QKW A;  4XTY A;  1MV3 A;  4RTT A;  1YP5 A;  1NLP C;  4JS4 A;  2XDD A;  2K5F A;  4JJD A;  5FRO A;  5HY6 A;  5GAN 6;  1BIB A;  2D1X A;  3OYE A;  2DJQ A;  2FRW A;  1WZO A;  1XNI A;  2HSE B;  5LJ3 h;  3L42 A;  2FZK B;  2QEX A;  3VS6 A;  2LVM A;  4VUB A;  4CI0 C;  1KSW A;  2E41 A;  2EQU A;  2RI5 A;  5IT9 E;  2M02 A;  4M7A D;  2E5K A;  1K1Z A;  1YIJ A;  4RTZ A;  2DVJ A;  4JLG A;  1LVK A;  2KY9 A;  3RUX A;  1YI2 T;  4ZGJ B;  2A3L A;  4PJJ A;  4QW2 A;  1BI3 A;  3PIP A;  4EDU A;  1YIT Q;  1IHV A;  2E6N A;  4RTV A;  1S1N A;  4RTU A;  4C92 B;  3RDV A;  2RJC A;  1M1K U;  5GAM j;  1WA7 A;  3CC7 T;  3OSV A;  3RKY A;  4TVR A;  3L2R A;  2HZY A;  2GTO A;  3BFM A;  5GAN 7;  1AZE A;  1VQ5 T;  1W4S A;  4GY5 A;  2LT4 A;  4J6W A;  3TVT A;  1YCY A;  2FHD A;  3JCM e;  4C8Q A;  1VQO T;  4C0G A;  4XTZ A;  1BK2 A;  1LCK A;  3DLM A;  4PJO E;  3QYG B;  1IRE B;  4ZN1 A;  1PCX A;  2EQJ A;  1M90 U;  3UF4 A;  1BI2 A;  4J9E A;  3V7S A;  3CPW A;  1SEM A;  1M90 R;  8ATC B;  4E7L A;  1H3H A;  2M16 A;  2NYS A;  3EFO A;  1YNZ A;  3QUI A;  3QSU A;  1QVG A;  2VGN A;  3UA7 A;  3CME T;  4FSX A;  1BIA A;  1D1B A;  1QP3 A;  5GAN 3;  5A0L A;  2JMC A;  1FWZ A;  2ZPB B;  4PFZ A;  1TWB A;  1R0C B;  2EBP A;  3EH1 A;  1G83 A;  4EMK C;  5A0G A;  3CCV T;  3ER0 A;  2D0N A;  1QKX A;  5IHI A;  3U23 A;  1GCQ C;  2E1H A;  4FT4 A;  2V26 A;  2KEA A;  1UEB A;  3CCQ Q;  1N9R A;  1VQ6 Q;  3UAT A;  3HRS A;  1F1B B;  2VGM A;  2RI2 A;  1MV0 B;  4HVU A;  2P0P A;  3OY9 A;  2AKK A;  4C5H A;  5KYY B;  3RKX A;  2O4X B;  4RUG A;  4JJN K;  4B9X A;  4A4F A;  3OYI A;  1I1J A;  2DZ9 A;  3CCM Q;  3JCM h;  2YLB A;  1JQQ A;  2O2O A;  5LJ5 d;  1HD3 A;  1VOM A;  1VQP T;  1QVF S;  1GXI E;  2YT6 A;  2RN8 A;  2GCX A;  1I5L A;  4M7D E;  1X01 A;  4RCC A;  4ZTJ A;  1B34 B;  1RI9 A;  4MZP A;  3CCL Q;  2JOY A;  4D8D A;  4BI3 A;  2EGC A;  1VQM Q;  1D0Z A;  3JB9 H;  4QKU A;  1KQ2 A;  3NHN A;  4E7H A;  1VQ4 A;  3THK A;  3C12 A;  5GAO p;  3QWY A;  2QA4 T;  1WXT A;  1VQ9 Q;  2KXC A;  1G3S A;  1UGR B;  1WXU A;  2HBP A;  3H8Z A;  5LJ5 g;  3C0C A;  3CCU T;  3JCM c;  3A8O B;  1VQ7 Q;  2MMP A;  1PC0 A;  2X3X D;  1LPL A;  2P4T A;  3CBM A;  4FM4 B;  2VXF A;  5FLX E;  1M3C A;  2B8A A;  2AZV A;  4M77 E;  3V7C A;  1VQK Q;  1V76 A;  3QHS A;  4PJO B;  3ZEH A;  2RD1 A;  3S3N A;  4II1 A;  1LNX A;  4OGC A;  2QEX T;  2COW A;  2HL3 A;  1PHT A;  3IQL A;  2OTJ A;  1HSQ A;  1YIJ T;  2CP7 A;  3NTK A;  1AZG B;  3H0F A;  3CCJ Q;  5FRM A;  4LDX A;  4ZGD B;  3F70 A;  3KFV A;  1YHQ Q;  1ZA1 B;  1I81 A;  1OI1 A;  2I2L A;  2CZ6 B;  4ME7 A;  1JB0 E;  2F69 A;  3H9N A;  1V1C A;  4M7A C;  2OTL Q;  4QQ6 A;  5J26 A;  1ZHI A;  4OVA A;  2O4X A;  3OW2 S;  2GBQ A;  1BI1 A;  1OZ3 A;  3M0U A;  2HQE A;  2DIL A;  4GLM A;  1UGV A;  1JEG A;  2ENM A;  5FW9 A;  1YJN A;  2JN0 A;  2OJ2 A;  2NUZ A;  3LW5 E;  3LWH A;  2VV5 A;  1UJ0 A;  3DLL A;  1Y71 A;  2LNH B;  4F7U B;  3CC4 Q;  3ZBD A;  2VYT A;  3H41 A;  4HT9 A;  1FMW A;  4BB7 A;  2BE9 B;  4NL2 A;  3QJ6 A;  1KQ1 A;  1Q86 U;  3ULR B;  1MMG A;  3OSS C;  4CC4 B;  1R77 A;  1ZLM A;  3MKD A;  2QGF B;  3UA6 A;  1QVP A;  4M7D B;  2RHX A;  3QDF A;  1GFD A;  2CS7 A;  2CP0 A;  5DLO A;  2KMT A;  3AHU A;  2DFU A;  1RAB B;  5A2Q E;  3MP6 A;  1YN8 A;  3GOX A;  2RK1 A;  2L3S A;  1W2B P;  2M9U A;  2QAS A;  4KUD K;  5EG2 A;  1T0H A;  5LJ3 f;  2LDM A;  2LC4 A;  1SHG A;  2PU9 B;  3RER A;  4PJO A;  1X6O A;  1K9A A;  3BW1 A;  4BI4 A;  4JZ4 A;  4XU1 A;  5CQY A;  3VS1 A;  1CKB A;  2BTT A;  2XDP A;  3KBG A;  1I4K 1;  1N6A A;  4M78 C;  3FDR A;  1X6B A;  2EQK A;  4C0F A;  5I11 A;  2F2X A;  4M75 B;  1E6G A;  1WGS A;  1YFN A;  3O5Z A;  1VQL Q;  3QJY A;  2HQX A;  1JXO A;  3QWX X;  5GMK m;  2K5L A;  4JJB A;  2PZ1 A;  2WSE E;  1KFZ A;  3M5A A;  2QXF A;  3LGL A;  5GAM d;  1NE8 A;  4A53 A;  1Y96 B;  2VVK A;  3CCR T;  3QYH B;  3V8K A;  4XQ3 A;  1FXX A;  1QWE A;  2ZCF B;  2O31 A;  1LOJ A;  1I8F A;  1OEB A;  1RAC B;  2DEU A;  3VS7 A;  1TSF A;  3CXC P;  1GBR A;  1VQ4 T;  4JRK A;  1RAE B;  1M3A A;  1IGU A;  4WTO B;  1M5Q 1;  2COY A;  4FW1 A;  1QVF A;  1AOJ A;  2YHT A;  4AFS C;  2L0A A;  2G3R A;  3BDU A;  4CC3 A;  2LQK A;  2F5T X;  4J9C A;  4LNP A;  4F7U A;  2FRY A;  2X4X A;  3P8B B;  1XQH A;  1R8O B;  1K8A U;  2RJF A;  1PM3 A;  1BI0 A;  1KC8 U;  3RIR A;  1DJ7 B;  2PTK A;  1K8A R;  2JUF A;  2EJ9 A;  2HL5 C;  4M7D A;  2LJ0 A;  3Q1J A;  1KC8 R;  4Z8A A;  3FJ5 A;  5CAI A;  2OTJ T;  5AYF A;  4M78 F;  3HSB A;  2QQS A;  3EG9 A;  1ZSZ A;  1D0Y A;  5HCK A;  3UDC A;  4CRI A;  1VQ8 Q;  5FRN A;  3VRY A;  4ZN3 A;  1ZUK A;  4JDS A;  3GNF B;  2K3X A;  3INZ A;  3M0P A;  2CZ0 B;  2HD0 A;  1OX8 A;  1UHC A;  3VS4 A;  5GAN 8;  1KHI A;  5GAO q;  1W2B S;  5DM7 R;  3MJX A;  1U06 A;  3SEM A;  2IPO B;  4M77 A;  4PFO A;  4Z88 A;  5IH2 A;  1M4Z A;  2DTH A;  1J3T A;  3UT1 A;  4YTL A;  2ECZ A;  1M8M A;  4JRI A;  1VQN A;  3CQT A;  2RA2 A;  4RG2 A;  4C5E A;  3OYB A;  1T3L A;  3OMG A;  2O01 E;  4HKE A;  2B86 A;  4CC2 A;  1YJN T;  5LJ3 j;  2Z0W A;  1QWF A;  1YBY A;  4C92 E;  2MWO A;  5CO7 A;  4DBH A;  3HRT A;  3CCE A;  3I5R A;  1BBZ A;  3SWN C;  1D3B B;  1PSE A;  1RAG B;  3G7Z A;  5IAY A;  2RPN A;  2E70 A;  3NTH A;  3O8V A;  1ZBX A;  3OW2 A;  3A8L B;  1W1F A;  2MAM A;  1TU0 B;  2D9T A;  1YI2 Q;  4EIK A;  3G71 A;  1GBQ A;  2YUQ A;  1IRX A;  3CXC S;  1Q82 C;  2DA9 A;  1HJD A;  5GAN d;  1H8K A;  2JM9 A;  3M57 A;  2M1H A;  2E5Q A;  3VUB A;  1KQS P;  2JTE A;  3CC7 Q;  2D6F A;  3FJP A;  3EGX B;  2RO0 A;  3OYH A;  2HDA A;  2EKH A;  1FMK A;  1JJ2 S;  2DXC A;  2CP6 A;  2LJ3 A;  4OF1 A;  5GAN 4;  2E3I A;  1ABO A;  3C95 A;  3A8H B;  1AWW A;  4KUI A;  3GBQ A;  4BE1 A;  2DL7 A;  3L2Q A;  4C5G A;  4C0D C;  1YIT A;  3VV0 A;  2DKG A;  1WNL A;  4DEY A;  2CSQ A;  4QQD A;  1OX9 A;  4M7A B;  1UGQ B;  4KGV B;  3SB2 A;  4F16 A;  2RHU A;  2EJG A;  2KXD A;  1GL5 A;  1TOV A;  2R57 A;  3RBB B;  1BKB A;  3PGG A;  2A36 A;  1RAI B;  1NJI U;  1K73 R;  1N8R C;  1ARK A;  2KK4 A;  3PTA A;  3V7R A;  4AFU C;  1NJI R;  1C1A A;  3URG A;  1RL2 A;  4OML A;  3M0T A;  4GLK A;  3PVQ A;  2FZC B;  2K3Y A;  4Z89 A;  3VS5 A;  2KAF A;  4BY6 B;  1SRM A;  1G3Y A;  3CCV Q;  3MP1 A;  2HQH A;  3QKJ A;  2LCL A;  1WJS A;  1OYX A;  2KYM A;  3CCS A;  1H92 A;  2GQV A;  1SF9 A;  2O9S A;  5GMK j;  4QQG A;  2F5K A;  2ZPF B;  5CVI A;  2K2M A;  3OQ5 A;  3UWN A;  2KYB A;  1D3B A;  2IG0 A;  2DBK A;  4M4Z A;  1UGP B;  1ABQ A;  4PFP A;  1ZSZ C;  2CP3 A;  1AD5 A;  3L2V A;  1FYN A;  5L23 A;  2R58 A;  2X4W A;  4QVD A;  5GAN f;  3I56 A;  1VQP Q;  4ZNX A;  2JS2 A;  1FX7 A;  4X9D A;  1M1K R;  1SSF A;  1WJQ A;  1WQW A;  3J81 E;  4HCB A;  2ESW A;  1WLP B;  2PQW A;  2NUP A;  4BAC A;  3EGX A;  1PSF A;  3LH5 A;  3OBY A;  3QZ5 B;  2MOX A;  2WSF E;  4MZM A;  2YRV A;  2DF6 A;  3S3O A;  4LUE A;  1NG2 A;  2QA4 Q;  4X9C A;  3JV3 A;  2A08 A;  2EGE A;  1PD1 A;  1PNJ A;  1TUC A;  2ZPH B;  3HTR A;  3I55 A;  3GP8 A;  4BD3 A;  1VQN T;  5CKD A;  4WCI A;  2HNI A;  1K73 C;  5IHK A;  1G5V A;  1GCP A;  3EG2 A;  3R6N A;  2DYB A;  4B6M A;  1QCN A;  2KT1 A;  4N0A C;  4NS5 A;  2V8J A;  4M78 D;  3JCM X;  1NLO C;  1AEY A;  3CCE T;  2VWF A;  3DB4 A;  2XDB A;  3TCJ A;  2QEX Q;  3PMI A;  4HCZ A;  5J39 A;  2PUO B;  2K2V A;  4E7S A;  1VQ7 A;  2JTM A;  2BE7 D;  1YIJ Q;  2I0N A;  1IO6 A;  2V1Q A;  3L2Z A;  2V8K A;  4FCY A;  3HRU A;  2XMF A;  2FB7 A;  3G71 T;  2IVW A;  3M4Y A;  3A1P A;  4DA4 A;  2VC8 A;  2RQW A;  4AMC A;  3OB9 A;  3MET A;  3G6E A;  1I07 A;  2DLP A;  2GTJ A;  2L8D A;  1QP2 A;  4BE0 A;  4FU6 A;  1S72 A;  4F7U E;  4LDW A;  2FZG B;  2X9H A;  1TG0 A;  3QII A;  3QO3 A;  1NPR A;  2RHZ A;  4M77 F;  1M2V B;  2Y4X A;  1BU1 A;  1B3Q A;  3CCR A;  1G3T A;  5FU6 B;  4C92 A;  1M1K C;  1YIT T;  3A8G B;  1UUE A;  8AT1 B;  5CKH A;  4XTW A;  3NFC A;  3M4G A;  2J7I A;  2E4H A;  1SHF A;  3PFS A;  4XAX B;  2BIV A;  2JW4 A;  5KE3 A;  4MML A;  1JJ2 A;  1BCO A;  2CSI A;  3CMA A;  1KK7 A;  1M90 C;  5DY9 A;  4E7K A;  1RUW A;  3ME9 A;  4M77 G;  1AWJ A;  1BCM A;  2KNB B;  5KCO A;  3G4S A;  2DTO A;  1EFN A;  5FU7 B;  4ORZ A;  1VIE A;  2DX1 A;  5GAN j;  4M75 E;  3VUZ A;  2FEI A;  5KYX B;  5LJ3 d;  2KRO A;  3KUF A;  3WVD B;  3X26 B;  2AT1 B;  4QT7 A;  1JXM A;  2EGA A;  2J6F A;  3RR6 A;  3CCS T;  2K6D A;  2VUB A;  2E10 A;  4PLI A;  5GAN 5;  3EG1 A;  1PRM C;  2KDS A;  4Y92 A;  4C5I A;  1YJ9 A;  3J7A F;  2QDL A;  1YJW A;  1SPK A;  2XU8 A;  4BDZ A;  4R0K A;  2EIF A;  4F14 A;  1X69 A;  1Y57 A;  1VYU A;  4HXJ A;  2J06 A;  3EGU A;  3VKI A;  1KD1 U;  5LJ3 g;  2RQV A;  4JRP A;  5GMK l;  3I56 T;  3OMC A;  1KD1 R;  2X4J A;  1X75 C;  2ZPE B;  4C8Q C;  2RJD A;  4FYX B;  2LQ8 A;  2ZPI B;  2RHY A;  3OA6 A;  1IZ6 A;  3CC2 A;  5KYY A;  3JCM b;  1KG1 A;  1E7O A;  6AT1 B;  2GF7 A;  4GBQ A;  1D1C A;  4BUG A;  4BE2 A;  3PT9 A;  4AT1 B;  3LWI A;  4J9F A;  1XJW B;  4A54 A;  3A5Z B;  3L1A A;  1VUB A;  2L89 A;  2QQ9 A;  1OPL A;  4KGZ B;  3GPL A;  1B34 A;  4J9B A;  1Q7Y U;  3I55 T;  3OYA A;  1Q7Y R;  4N4G A;  1AHJ B;  2OAU A;  2EYQ A;  3CCL T;  4KT0 E;  1WHH A;  3MHX A;  4DBR A;  1K9M U;  3OYY A;  1ZA2 B;  3SD4 A;  1Q86 R;  2YWW A;  1Q81 U;  1K9M R;  2RQU A;  4BDY A;  3CPW P;  3HFN A;  1WI7 A;  1GFC A;  1Q81 R;  5DLQ E;  2JTF A;  1LJO A;  3JAM E;  2QDY B;  2JXB A;  1OZ2 A;  3RNJ A;  2DET A;  1VQ7 T;  2XI9 A;  2OTJ Q;  1QVG P;  1KHC A;  2VKN A;  4OP0 A;  3LGF A;  4FT2 A;  4R55 A;  4RCB A;  3MP8 A;  1AT1 B;  2HKQ B;  4PJN A;  1M2O A;  1ZQ1 A;  4KBM B;  1TUG B;  3OYJ A;  4RG8 A;  5KCH A;  3G6E T;  4C8Q F;  3UPU A;  5KYU B;  1S72 T;  3JCM d;  2RI3 A;  2DL8 A;  3JCM J;  2JM8 A;  4MDX A;  4J83 A;  3M9Q A;  2DO3 A;  2DXB A;  2QAZ A;  3CBP A;  2RJE A;  4KH1 B;  1HYO A;  1X27 A;  2X3W D;  2XIC A;  4J7F A;  2H8H A;  2BUD A;  2M51 A;  4JZ3 A;  3QBY A;  4IUP A;  3CPF A;  1YHQ T;  2BKD N;  2KR3 A;  1OOT A;  1PKS A;  5KE2 A;  1YJN Q;  4AFQ C;  2VAS A;  4J9I A;  4C8Q G;  3DKM A;  1Y7X A;  1WHG A;  2K7A A;  1U1S A;  2OTL T;  1NPP A;  2EYY A;  1SRL A;  4J8O A;  3X28 B;  3P8H A;  2MYS A;  4FYW B;  3CMA T;  5GAM g;  3EGD B;  4LUD A;  3VJP A;  2CT3 A;  2KRN A;  3R6O A;  2AIR B;  5L8R E;  4IUU A;  3G4S T;  1MHN A;  1M1F A;  3RKW A;  2ZGW A;  1I5O B;  3FIF A;  4EMK B;  4M7A E;  2LX7 A;  4A4K A;  1Q86 C;  3E1S A;  4HA8 A;  2WSC E;  3C94 A;  4OB0 B;  4DEX A;  4M77 D;  2SEM A;  4KGX B;  4L59 A;  1EX4 A;  3HHT B;  3JSC A;  2LT1 A;  2F2V A;  2NLU A;  3RES A;  1ZSG A;  2COZ A;  2FVU A;  7AT1 B;  1Y0M A;  2QGG A;  5HK3 A;  1YJ9 T;  1YWO A;  2FO0 A;  2OAW A;  1YJW T;  2YUP A;  4D8K A;  4C92 F;  2QQA A;  5IXB A;  1MND A;  2C0I A;  3OS5 A;  4PL6 A;  3TSZ A;  3C4S A;  3MPU B;  2RB6 A;  3OYL A;  2PNI A;  2RK2 A;  1H3Z A;  4E2F B;  1D1A A;  1MNE A;  2ROL A;  3JCM f;  3NTI A;  2HKN A;  3CC2 T;  2DD4 A;  1TXQ A;  2KGT A;  1OU8 A;  2PUK B;  3GLX A;  4M75 A;  2JNG A;  1WIE A;  3FEO A;  4LXC A;  4X1V A;  1M8V A;  4OB2 B;  5GAO m;  4RTW A;  2LQN A;  5LJ5 e;  2HSP A;  1K76 A;  3JB9 F;  3M55 A;  2RMO A;  4C92 G;  3CD6 A;  1Y96 A;  3OS0 A;  2W0Z A;  4NL3 A;  3TRE A;  3EAE A;  4RTX A;  1QW1 A;  1OV3 A;  2E3H A;  3WXM B;  1UTI A;  3PE0 A;  4L6V 5;  3PVL A;  2PVO B;  5GJV B;  2P0Q A;  2Y4Y A;  2YLC A;  3LLR A;  2MPX C;  4M78 E;  4FW2 A;  4DOW A;  1QMC A;  1GRI A;  1AVZ C;  3TSW A;  3JB9 J;  2L3R A;  2P4R A;  2BZY A;  2E65 A;  1TH7 A;  1X2K A;  4AG1 C;  2MIO A;  3EGD A;  1WPY A;  5D6Y A;  3JB9 G;  2CUB A;  2R5M A;  1C6V X;  1VYT A;  4PJO C;  4XK8 E;  2E12 A;  3VRZ A;  4J9G A;  3I5S A;  2YSQ A;  2ZAE A;  2XD0 A;  4IIO A;  4EMK A;  1K8A C;  1NM7 A;  1VQ5 Q;  3E9G A;  1KC8 C;  2CZ7 B;  1GCQ A;  1VQO Q;  3DB3 A;  2KRM A;  3OYK A;  1OU9 A;  2QYZ A;  1WXB A;  1U1T A;  2DRK A;  2K9G A;  3I35 A;  2EKO A;  5GAN g;  3QG1 A;  1Z9Q A;  5KH6 A;  1G2B A;  2K57 A;  3E2U A;  4OMM A;  2LJ1 A;  1RLP C;  3OBW A;  4P5N A;  5LJ5 h;  4ZTF A;  2A7Y A;  3OS2 A;  4X34 A;  2GFU A;  2SRC A;  2DJZ A;  2AK5 A;  5CKF A;  1RAF B;  3J80 E;  1VQN Q;  2EYW A;  3SFM A;  2EVR A;  3TEE A;  1TUD A;  2EW3 A;  2ED1 A;  1ZUY A;  4JJC A;  3CME Q;  3HP9 A;  2AKL A;  2QTX A;  3MO8 A;  1IXD A;  1WDX A;  3VU3 C;  3JCM V;  5IHN A;  3CCE Q;  3PMT A;  4IUR A;  4F04 B;  2D0Q B;  2A0F B;  1WJR A;  1SG5 A;  2YUN A;  3N5B B;  2D8J A;  5A0D A;  1JU5 C;  2DE0 X;  2DXU A;  3MEU A;  3GIB A;  4C8Q D;  4IIM A;  1R0B G;  4PJO F;  3G71 Q;  4LDU A;  1IGQ A;  2ABL A;  2DMO A;  4M7D C;  1OQK A;  1TS9 A;  4DOV A;  4E6R A;  2RQR A;  2DL4 A;  3VYH B;  4V2S A;  2C06 A;  1QVF P;  2FPE A;  3EH2 A;  4FSS A;  2KRS A;  4PJM A;  1O9S A;  4A4H A;  2DNU A;  2QQB A;  4FYY B;  2RQT A;  2J05 A;  2RHI A;  1W6X A;  1MMA A;  2AHJ B;  3CCQ A;  3M53 A;  1MUZ A;  1WYX A;  2RF0 A;  4OGE A;  4M78 B;  1VQ6 A;  1K4U S;  1NYG A;  1U5S A;  1V29 B;  4J9D A;  3TQ7 P;  3S6W A;  4PJO G;  2K79 A;  4K11 A;  4UC4 A;  1AWX A;  5AT1 B;  4ESR A;  3PNW C;  4A63 B;  4XTV A;  1E6H A;  1N5Z A;  1KJW A;  4M77 C;  3OYD A;  4IKF A;  5GMK e;  3H6Z A;  3P8D A;  4M75 C;  1TTH B;  3CCM A;  4LN2 A;  5IXF A;  3OYC A;  3TU4 K;  4HCC A;  1Y07 A;  1D0X A;  2EPD A;  4DBQ A;  3CCU Q;  2OI3 A;  1KQS S;  1IHW A;  2DPP B;  1PD0 A;  2F1L A;  2RM4 A;  4M7A A;  1RI0 A;  5D6X A;  3X25 B;  2BZ8 A;  3CCL A;  2H3J A;  2K5I A;  2YRD A;  3CD6 T;  2XID A;  5GAM e; 
#chains in the Genus database with same CATH homology
 1X69 A;  1M3A A;  1Y57 A;  1VYU A;  2CDT A;  4HXJ A;  2J06 A;  3EGU A;  3A98 A;  2K3B A;  4HVV A;  5FWC A;  3VS2 A;  1PRL C;  2RQV A;  1UDL A;  1CKA A;  1U3O A;  1AOJ A;  2GGR A;  1UFF A;  2CRE A;  2L3Q A;  2ROT A;  1RLQ C;  4AFS C;  2L0A A;  1K0X A;  1NEB A;  3EG3 A;  3M0S A;  1E7O A;  3NGP A;  4CC3 A;  1XOV A;  4GBQ A;  4J9C A;  4LNP A;  2FRY A;  2JT4 A;  4AG2 C;  2EQI A;  4CC7 A;  4J9F A;  1UHF A;  1QLY A;  2HBW A;  2GQI A;  5GJW B;  2PTK A;  1OPL A;  4OMQ A;  2LJ0 A;  4J9B A;  3FJ5 A;  1YWP A;  4Z8A A;  1JO8 A;  2L3P A;  2A28 A;  4HVW A;  2W10 A;  5HCK A;  2KT8 A;  5FWB A;  3VRY A;  1QKW A;  1ZUK A;  2CH4 W;  1MV3 A;  2G6F X;  4RTT A;  1YP5 A;  1NLP C;  3VS3 A;  2MCN A;  3M0P A;  4JJD A;  2RQU A;  4JPB W;  2AZS A;  1WI7 A;  2D1X A;  1GFC A;  1UHC A;  3EHQ A;  2DJQ A;  2FRW A;  2JXB A;  3VS4 A;  3RNJ A;  1T3S A;  3VS6 A;  2VKN A;  1U06 A;  2EYZ A;  3SEM A;  1KSW A;  4Z88 A;  5IH2 A;  2E5K A;  2EYX A;  1K1Z A;  4RTZ A;  1WFW A;  2DVJ A;  1J3T A;  2ECZ A;  1M8M A;  3CQT A;  1X6G A;  1PWT A;  1B07 A;  3REB B;  1T3L A;  2JS0 A;  2B86 A;  4CC2 A;  4RTV A;  1S1N A;  1QWF A;  4OMN A;  4RTU A;  2HCK A;  1ZUU A;  5EC7 A;  2DL8 A;  1WA7 A;  2JM8 A;  3I5R A;  1BBZ A;  2BZX A;  1QCF A;  2GTO A;  1AZE A;  2RPN A;  1X27 A;  2X3W D;  2H8H A;  1W1F A;  2HEQ A;  2CH4 A;  2M51 A;  4JZ3 A;  3TVT A;  1OPK A;  1BK2 A;  2KR3 A;  4EIK A;  1GBQ A;  1LCK A;  1OOT A;  1PKS A;  2YUQ A;  3NPF A;  2DA9 A;  2CUD A;  4AFQ C;  1HJD A;  1H8K A;  4J9I A;  3UF4 A;  2JM9 A;  1WX6 A;  2RNA A;  4J9E A;  1UE9 A;  2K7A A;  2JTE A;  3SHW A;  2V1R A;  2EYY A;  3VS0 A;  2F2W A;  1SEM A;  2HDA A;  1SRL A;  2EKH A;  1FMK A;  1H3H A;  2LJ3 A;  4LUD A;  1YNZ A;  1ABO A;  1AWW A;  2CT3 A;  3GBQ A;  3UA7 A;  2KRN A;  2DRM A;  1UEC A;  2LMJ A;  2DL7 A;  3H0H A;  1M27 C;  1VYV A;  2JMC A;  1SSH A;  4DEY A;  2CSQ A;  2LX7 A;  2EBP A;  2J6K A;  1G83 A;  2M0Y A;  4DEX A;  2D0N A;  4F16 A;  2SEM A;  1QKX A;  2KXD A;  5IHI A;  2F2V A;  3U23 A;  1GL5 A;  4AFZ C;  5ECA A;  1GCQ C;  3RBB B;  2KEA A;  2A36 A;  1ZSG A;  1Y0M A;  1YWO A;  3UAT A;  2FO0 A;  2OAW A;  1ARK A;  2YUP A;  4AFU C;  3M0Q A;  4D8K A;  1MV0 B;  4HVU A;  2L2P A;  5IXB A;  2AKK A;  2C0I A;  1PKT A;  4OML A;  3M0T A;  3PVQ A;  3TSZ A;  4RUG A;  4Z89 A;  1CSK A;  2PNI A;  3VS5 A;  1I1J A;  1NEG A;  1SRM A;  2FPF A;  2DL3 A;  3H0I A;  1JQQ A;  2O2O A;  1HD3 A;  2ROL A;  4HCK A;  2KYM A;  1H92 A;  1BB9 A;  2YT6 A;  2KGT A;  2O9S A;  2RN8 A;  2J6O A;  1WIE A;  1RI9 A;  4X1V A;  2K2M A;  4D8D A;  2KYB A;  4RTW A;  2EGC A;  2LQN A;  2HSP A;  1K76 A;  1T0J A;  2RMO A;  1UJY A;  2DBK A;  3NHN A;  2DBM A;  4M4Z A;  3THK A;  1ABQ A;  2FPD A;  4OMO A;  3QWY A;  1WXT A;  2W0Z A;  2KXC A;  4RTX A;  1WXU A;  1AD5 A;  1OV3 A;  1FYN A;  3C0C A;  5L23 A;  4ZNX A;  1UTI A;  2JS2 A;  3PE0 A;  3PVL A;  5GJV B;  2X3X D;  5I22 A;  1GRI A;  2ESW A;  1AVZ C;  1WLP B;  3TSW A;  1M3C A;  2P4R A;  2AZV A;  2BZY A;  3LH5 A;  1X2K A;  2MOX A;  4AG1 C;  2MIO A;  2DF6 A;  4LUE A;  2CUB A;  1NG2 A;  3EHR A;  1VYT A;  3JV3 A;  2A08 A;  2EGE A;  3VRZ A;  2A37 A;  4J9G A;  3I5S A;  2C0T A;  1PNJ A;  2YSQ A;  1TUC A;  1PHT A;  3IQL A;  4IIO A;  2D8H A;  1HSQ A;  1NM7 A;  1AZG B;  3EG0 A;  3H0F A;  1ZBJ A;  1GCQ A;  4WCI A;  1VA7 A;  5IHK A;  2KBT A;  3KFV A;  1GCP A;  2KRM A;  3EG2 A;  1I0C A;  3R6N A;  1ZX6 A;  1WXB A;  2DYB A;  3REA B;  2KT1 A;  2DRK A;  2K9G A;  3I35 A;  1AEY A;  1NLO C;  1Z9Q A;  1X2Q A;  1M3B A;  1W70 A;  2VWF A;  1G2B A;  1X43 A;  4OMM A;  1NYF A;  1V1C A;  2LJ1 A;  1RLP C;  2YUO A;  1KIK A;  2I0N A;  1IO6 A;  2V1Q A;  1AWO A;  2LP5 A;  3NMZ C;  2SRC A;  2GBQ A;  2AK5 A;  2XMF A;  2EYW A;  2EVR A;  1TUD A;  3M0U A;  2EW3 A;  2ED1 A;  1ZUY A;  4JJC A;  2DIL A;  4GLM A;  1UGV A;  2RQW A;  2AKL A;  1JEG A;  2ENM A;  1K0S A;  2GNC A;  5FW9 A;  1I07 A;  1WDX A;  2DLP A;  2LQW A;  2OJ2 A;  2GTJ A;  5IHN A;  2NUZ A;  1UJ0 A;  2LNH B;  4J9H A;  1UG1 A;  2YUN A;  3H41 A;  2CT4 A;  2D8J A;  4F17 A;  1JU5 C;  1TG0 A;  4KRT A;  3ULR B;  2DE0 X;  3ZL7 C;  4CC4 B;  1BU1 A;  1ZLM A;  4LE9 A;  1B3Q A;  3M0R A;  2FG0 A;  4IIM A;  3UA6 A;  3I9Q A;  1GFD A;  1UUE A;  2ABL A;  2DMO A;  4RTY A;  1YN8 A;  4E6R A;  2RQR A;  2DL4 A;  4OMP A;  2J7I A;  1SHF A;  2FPE A;  2LZ6 B;  2L3S A;  2LCS A;  4FSS A;  2KRS A;  2JW4 A;  2IIM A;  1T0H A;  2CSI A;  2NWM A;  2DL5 A;  1SHG A;  2DNU A;  2RQT A;  2J05 A;  1W6X A;  1K9A A;  4JZ4 A;  1MUZ A;  1WYX A;  2JMA A;  1RUW A;  1CKB A;  2RF0 A;  3VS1 A;  1K4U S;  1M30 A;  1AWJ A;  2BTT A;  2KNB B;  1NYG A;  1U5S A;  4J9D A;  2K79 A;  2KE9 A;  4K11 A;  2ED0 A;  1EFN A;  1AWX A;  2YDL A;  1X6B A;  4ORZ A;  2DX1 A;  4ESR A;  5I11 A;  2F2X A;  4A63 B;  2DM1 A;  2O88 A;  1E6G A;  3O5Z A;  1E6H A;  1N5Z A;  2FEI A;  1KJW A;  1JXO A;  3QWX X;  2KRO A;  4JJB A;  2O9V A;  4LN2 A;  4QT7 A;  1JXM A;  2PZ1 A;  2EGA A;  5IXF A;  1KFZ A;  2J6F A;  1Z9Z A;  2EPD A;  2K6D A;  2OI3 A;  2VVK A;  1YCS B;  1QWE A;  1PRM C;  3EG1 A;  2C0O A;  4Y92 A;  1A0N B;  2O31 A;  2QDL A;  2BZ8 A;  1OEB A;  3VS7 A;  1SPK A;  4R0K A;  1GBR A;  4F14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...