1QKWA

Alpha-spectrin src homology 3 domain, n47g mutant in the distal loop.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVGDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytoskeleton
molecule keywords ALPHA II SPECTRIN
publication title Thermodynamic and Structural Characterization of Asn and Ala Residues in the Disallowed II' Region of the Ramachandran Plot
pubmed rcsb
source organism Gallus gallus
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1999-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1qkwA00
2ABLA 1YWPA 3M0QA 1FYNA 3M0UA 2P4RA 4ZNXA 1E6GA 1K9AA 1NYFA 1J3TA 3REBB 1TG0A 2RNAA 2W10A 4Z89A 2KT8A 3THKA 2FEIA 2EGCA 5IHKA 1Z9QA 3UA7A 1WYXA 1N5ZA 2DF6A 3PVQA 3UATA 1YP5A 1PKTA 2LJ3A 4DEYA 1X2KA 5HCKA 2A36A 4OMOA 3PVLA 1QCFA 2GGRA 1LCKA 3CQTA 4LUEA 1B07A 2XMFA 3VS2A 1CSKA 2ECZA 1K0SA 3VRZA 3EG2A 4J9GA 1RUWA 1OOTA 3I9QA 2VWFA 2J06A 2FRYA 4RTUA 2DJQA 2KRSA 3RBBB 2DL7A 1KJWA 3VS3A 1RLPC 2NWMA 3H0FA 1H8KA 2BTTA 2GQIA 5FWBA 3QWYA 3VS7A 2L3QA 1ZX6A 2K79A 2DLPA 1SEMA 4OMPA 2JTEA 2C0IA 1M3CA 2L2PA 1PWTA 2VKNA 4GBQA 1OEBA 2O9VA 2HDAA 3RNJA 3IQLA 2RN8A 2ESWA 2FPDA 4M4ZA 2JS0A 4F17A 1PRMC 4J9DA 1KIKA 5GJVB 1ARKA 1GFCA 1ZUUA 2YDLA 4E6RA 2LZ6B 1ZSGA 4LNPA 5I22A 2F2XA 3M0PA 1I0CA 2JMCA 4QT7A 2LJ1A 3M0SA 2YUQA 1AWXA 2YUNA 2JT4A 3NHNA 3M0RA 4HVUA 3A98A 4AFQC 2EYYA 4JJCA 1AOJA 5L23A 2EBPA 3UA6A 1SSHA 1G2BA 2FPFA 2HEQA 4D8KA 1RLQC 2HCKA 1RI9A 2CT3A 2DE0X 2KT1A 5IXBA 5ECAA 1JU5C 4AG1C 1X6BA 1WI7A 3UF4A 2KYBA 2DRMA 1UE9A 4Y92A 3VS1A 1HD3A 2YUPA 2KR3A 2LNHB 1EFNA 1YNZA 1SRMA 5EC7A 1TUCA 4RTVA 2RPNA 3QWXX 2EGEA 1X69A 1UDLA 2CH4W 1X6GA 2LMJA 4OMMA 1GCQA 2DM1A 1WA7A 2GTOA 3NPFA 4CC7A 1JXMA 2RF0A 1M8MA 5IH2A 2AKKA 3C0CA 2YT6A 2OJ2A 2SEMA 2YUOA 1NEBA 1H3HA 2GBQA 5I11A 1X43A 1HSQA 4Z8AA 2D8HA 1QWFA 3PE0A 4IIMA 2B86A 2X3WD 2ROTA 2M0YA 3JV3A 3ULRB 1GBRA 1WLPB 1BU1A 2DL5A 4OMLA 1IO6A 2EYWA 2EPDA 2EYZA 1CKBA 1CKAA 4LE9A 1BB9A 4JZ3A 3EHQA 4F16A 1AWJA 1ZBJA 1PHTA 3REAB 1PKSA 2ED0A 1AWOA 2OI3A 4JPBW 1Y57A 1GCPA 2CUDA 4RTWA 1SHGA 1M3AA 1W1FA 2AK5A 2O88A 1V1CA 4JJBA 2LP5A 1FMKA 2LCSA 2CH4A 4Z88A 2JXBA 1BBZA 2L3SA 1PNJA 4RUGA 2J6KA 5IXFA 4R0KA 1SRLA 1T0HA 1T3SA 1W70A 2ENMA 2K6DA 3EHRA 4KRTA 2KBTA 2FRWA 4J9FA 2IIMA 2KEAA 4DEXA 1QKWA 2EYXA 3H0HA 4RTXA 4ESRA 4FSSA 4HXJA 1K1ZA 1B3QA 2JM9A 2M51A 2DBKA 2ROLA 2LQNA 3H0IA 1WXUA 4RTTA 2CDTA 1M27C 2DILA 1WIEA 4LUDA 1H92A 3TSWA 2CT4A 3SHWA 2K2MA 3U23A 2FG0A 1JEGA 3TSZA 4HVVA 2C0OA 1OPKA 2PNIA 2JMAA 3VRYA 4EIKA 5FW9A 1ZUKA 3VS5A 2JW4A 1ABOA 2BZ8A 2KXDA 2YSQA 1JO8A 2ED1A 2D1XA 4GLMA 2RQUA 2V1RA 4OMNA 1BK2A 4HCKA 2AZVA 1JXOA 1UUEA 4J9BA 2J6OA 2O31A 2DL4A 2MOXA 1GFDA 4K11A 3ZL7C 3I35A 1G83A 1YN8A 1W6XA 2J6FA 4LN2A 2F2VA 3I5RA 1AVZC 2RMOA 2GTJA 2OAWA 1NLPC 2I0NA 4JZ4A 1YCSB 2HSPA 2RQWA 3NGPA 1TUDA 2C0TA 1PRLC 2DL8A 2D0NA 1GRIA 2DVJA 3I5SA 2JM8A 2KRNA 2QDLA 4J9EA 1WFWA 4CC4B 2CSIA 2BZXA 1U5SA 2CUBA 1UHCA 1E6HA 2FO0A 1T0JA 4ORZA 4IIOA 1AWWA 2RQRA 1AZGB 1VYUA 2CSQA 2DA9A 4AFUC 1SHFA 1SPKA 4A63B 2A08A 1QWEA 3EG1A 3VS4A 2LQWA 1I07A 1MV0B 3VS6A 2LX7A 2H8HA 4CC3A 2RQTA 2E5KA 3TVTA 2BZYA 1I1JA 2A28A 1NLOC 1U3OA 1M30A 1UG1A 2VVKA 1S1NA 1Z9ZA 2AZSA 4J9IA 1HJDA 1NG2A 1GBQA 2KE9A 1M3BA 3H41A 1K4US 2W0ZA 1UGVA 2EGAA 2DNUA 1UTIA 1QKXA 2J7IA 1ABQA 1X27A 1UFFA 1T3LA 2JS2A 2X3XD 1UJ0A 1ZLMA 2SRCA 5FWCA 1OV3A 3EG3A 2MIOA 3O5ZA 2A37A 4J9CA 4AG2C 4CC2A 3NMZC 5IHNA 1VYVA 4WCIA 3VS0A 1UECA 2DL3A 5IHIA 1MUZA 1AD5A 2GNCA 2DMOA 2DRKA 2L3PA 4AFSC 2DBMA 1NM7A 4RTYA 1GCQC 1WX6A 2KYMA 1AZEA 2KROA 4RTZA 2CREA 1VYTA 1QLYA 3M0TA 1MV3A 1KSWA 2EQIA 2AKLA 4AFZC 1VA7A 4HVWA 1K0XA 2EVRA 1WDXA 1X2QA 1UJYA 2LJ0A 3EGUA 2V1QA 2DX1A 3SEMA 2L0AA 2O9SA 2NUZA 2PZ1A 3FJ5A 1UHFA 2K7AA 2FPEA 2J05A 1WXBA 1KFZA 1K76A 1OPLA 2MCNA 4F14A 3EG0A 1NEGA 2HBWA 1NYGA 2K9GA 3LH5A 1Y0MA 4D8DA 1E7OA 2D8JA 2G6FX 5GJWB 2EW3A 1YWOA 2DYBA 3R6NA 2KXCA 2K3BA 2RQVA 4OMQA 1JQQA 4X1VA 2KGTA 2KNBB 1GL5A 1AEYA 2O2OA 4JJDA 1XOVA 3GBQA 1WXTA 3KFVA 1ZUYA 1U06A 1A0NB 2F2WA 2EKHA 4J9HA 2KRMA 2PTKA
chains in the Genus database with same CATH superfamily
1RAHB 2ABLA 2HSEB 3JCMJ 2HNIA 1FYNA 1M1FA 3M0UA 3I55Q 4CRIA 1ACMB 2QQSA 4M75C 1N8RR 1E6GA 4FSXA 1VQ6T 1K9AA 3CCQT 4MZMA 1NYFA 1VQMA 3DB4A 3GNFB 4BY6C 1WGSA 2JZ2A 4Z89A 4C92E 1RAFB 5KYYA 1M1KU 1JJ2P 3UA7A 1N5ZA 3BY7A 3VYGA 3UATA 1U1SA 3CCVT 2H3EB 1X2KA 4KH1B 4LUEA 1X01A 2XMFA 5GMKm 3VV0A 1N8RU 1EIFA 1CSKA 1BCOA 1VIFA 3MCAB 2P84A 3I9QA 2VWFA 3A1PA 5FU7B 3Q1JA 8ATCB 3DLLA 2DJQA 1RAEB 2KRSA 2AT1B 1KK7A 4FYVB 2DL7A 5C0MA 1KJWA 2P0QA 1QCOA 2BTTA 2V8KA 4LXCA 1RACB 4ZN3A 2L3QA 1ZX6A 3RESA 5CO7A 1GXIE 3CCJA 1Y71A 1I4K1 4HCZA 1S72Q 4GBQA 2ZPIB 2JUFA 1MNDA 2LX9A 1ZSZB 5HK3A 1IRXA 1OEBA 2M9UA 2RN8A 2QA4T 2K57A 2QDYB 3I55T 1PRMC 3INZA 4J9DA 3A8MB 4C92A 1ARKA 5AT1B 4BD3A 3HFOA 1ZSGA 5I22A 4KGZB 5I21A 5KYNA 2L89A 3UWNA 4C5EA 2DXBA 3X20B 4UC4A 2RO0A 2O01E 4A53A 2DERA 3EGDB 3HP9A 3M0RA 3I56Q 4B6MA 3WXMB 2HMAA 2ZZDA 4HVUA 1VQLT 2EYYA 1Y7XA 2E6NA 2BE7D 3P8HA 4EMHA 2RHIA 3EFSA 2FPFA 1G2BA 4D8KA 3CCRA 1Q7YR 2CT3A 2XICA 2KT1A 4MZPA 3CXCA 4HCBA 1D1AA 1ZSZA 1JJ2A 2EFIA 2QK0A 1MMGA 4M77C 2KYBA 1Q86U 3FB9A 3OYHA 4IUQA 3GIBA 2K5IA 4Y92A 1N8RC 2OTLA 1MHNA 1HD3A 2YUPA 1I5LA 1AT1B 5LJ3g 1VQNA 1EFNA 1YNZA 1SRMA 1TUCA 2DD4A 3SWNC 2EGEA 1QVFS 1X69A 1Q7YU 4BI4A 3HTRA 2ZCFB 4M77E 2DM1A 1WA7A 4R55A 3EGDA 3RKWA 3OW2A 2XDDA 3NPFA 1TXQA 3QDRB 4FYWB 4ELYC 3OYLA 1K9MR 1M8MA 1VQKA 2AKKA 3C0CA 3H8ZA 2OJ2A 2WSEE 1H3HA 4X9CA 2EQJA 1HSQA 4FCYA 1ZQ1A 2DPPB 3CBOA 3I56T 2D8HA 2RK1A 1M2VA 1RADB 2EJGA 2ROTA 1HXDA 3JV3A 4DBFA 1BI1A 2HQHA 3F70A 1KQ2A 4OMLA 2EYWA 2GCXA 5J3BA 2EPDA 1NPRA 1K73U 1BB9A 4PLLA 4JZ3A 3EHQA 1AWJA 4PJOD 3EH1A 1KQSS 1PKSA 2ED0A 2OI3A 2KSSA 2CP2A 3T9NA 4DOVA 2XKOC 2O88A 2E1HA 3MP6A 2PU9B 3QJYA 3TCJA 4BB7A 1BBZA 1V29B 1OX8A 2DEQA 2J6KA 4RUGA 5IXFA 4A4HA 1T3SA 2ENMA 4DEXA 3CC4A 2DIQA 3OB9A 4RTXA 4ESRA 3QO3A 1PG5B 2ROLA 2KMTA 1QCNA 1WXUA 1XJWB 1ZHIA 2RH2A 4RTTA 4J7IA 3L2VA 3MO8A 1RAAB 5GAN8 1BIBA 3TSWA 3VUBA 3CCUA 2PUKB 5DY9A 1YI2Q 2K2MA 3FEOA 3TSZA 3CMEA 2C0OA 1OPKA 3VJPA 1KD1R 1KHIA 4PLIA 2DAQA 1ZUKA 2X4WA 3VS5A 3CCLQ 4M7AG 2JW4A 1ABOA 2KXDA 2YSQA 2ED1A 4GLMA 1I5OB 2RQUA 1QVFP 1VQ8Q 4QQGA 4OMNA 1YJ9Q 1Q7YC 3JRZA 2MAMA 4N0AC 4FW2A 3BW1A 3H6ZA 3JCMc 3ZL7C 1G83A 1G3SA 1AVZC 2FZCB 2LQKA 2QGFB 2I0NA 3HKSA 1KD1U 3NGPA 1C1AA 2BKDN 3OYEA 2DL8A 3I5SA 3JCMV 4J9EA 4WTOB 5GANd 2ZPBB 3QBYA 2ZPHB 1E6HA 3NFCA 2RQRA 1VYUA 1K9MC 2CSQA 4F04B 2DA9A 3OS1A 1KQSP 1QVGS 3CD6A 1SHFA 4A63B 1QWEA 3EG1A 5GMKe 3VS4A 2LQWA 4E7KA 3QYGB 4XU3A 4ATOA 3EAEA 3TVTA 4M7AC 1YI2T 1I1JA 4IUTA 4M7DG 1F1BB 1U3OA 3CCMA 3CCLT 4AT1B 4A4EA 4J9IA 1NG2A 2L5QA 2KQWA 5KYUB 1VQ8T 1K4US 1YJ9T 1UTIA 2E41A 1ABQA 1X27A 3A8GB 4OB2B 2JS2A 2PUOB 3DKMA 1LPLA 2MI6A 1DJ7B 2GF7A 2MIOA 3O5ZA 3A5ZB 3NMZC 5IHNA 1VYVA 3VS0A 1OZ3A 1MUZA 1AD5A 2CP6A 4PK4A 3MEVA 1TH7A 3RUXA 1YIJQ 5GANf 4AFSC 1PCXA 1VQPT 2DBMA 1PM3A 2KYMA 2JNGA 2KROA 1FXXA 4RTZA 3PMIA 5GANj 2FZKB 1NE8A 1BKBA 1MV3A 1R0BG 4C0FA 2R5MA 4A4GA 1BCMA 3QG1A 1KD1C 1R77A 2DVEA 1Q95G 2K4YA 1MMAA 4HVWA 3ZBDA 5GAMf 1X2QA 5GAOl 3RKYA 3PIPA 3C95A 5KYUA 2A7YA 1G3YA 2V1QA 3SEMA 2NUZA 2RK2A 3JCMf 4C8QB 4M7DC 2K7AA 2VGNA 4RG8A 3JCMQ 4IKFA 1NYGA 2DO3A 4C8QD 2EQKA 1E7OA 5GJWB 1YHQQ 1HK9A 1QVGP 5IT9E 3C94A 1RI0A 9ATCB 4M78G 4C8QF 2DYBA 5GAN2 3R6NA 3G6EQ 4L5GA 2X4XA 2RHZA 2DJZA 4A4FA 2X9HA 2E3HA 1M9SA 4M7DE 4IUUA 2KGTA 1UGQB 2O2OA 1ZUYA 3VUZA 3OSVA 4XAXB 2F2WA 3HRSA 1K8AC 3M4YA 1MGQA 3QYHB 1G3TA 3GPLA 1YWPA 1R8OB 3CMAQ 3CCSA 3SFMA 4O6JA 4ZNXA 3M5AA 4QVZA 1YIJT 3META 2D6FA 3C12A 1YITQ 3NTHA 3JB9D 1KG1A 1TG0A 2RNAA 2COWA 3V7RA 2QAZA 2FEIA 1UEBA 5IHKA 4C8QA 1Z9QA 3JB9F 4QQ6A 3PVQA 5KE2A 5GAN7 2LCCA 5KCOA 1PKTA 4DEYA 3MEWA 5FU6B 2A36A 4OMOA 3PVLA 4N4HA 4PJNA 2F5KA 3CQTA 1D09B 3VS2A 1K0SA 4M78C 3OYAA 3EG2A 4J9GA 1VQ7A 1OOTA 4DBRA 3JCMX 1TUGB 2BUDA 4P5NA 5LJ3d 2E65A 2RJCA 3CCJQ 1M5Q1 4FT2A 3CXCS 3G6ET 3P8DA 2ZPEB 2E64A 3QUIA 4E7JA 2DLPA 4RG2A 3CC2A 4OMPA 3V8JA 2L3RA 2H3JA 1M3CA 2L2PA 4M78E 3G1JA 2O4XB 1VQ5Q 2O9VA 2HDAA 3CC7A 2FPDA 4M4ZA 3GP8A 3JB9J 1ZUUA 2IPOB 2FHDA 3CCVQ 3OW2S 4PJMA 3M0PA 2RJFA 4MZTA 2EJ9A 4QT7A 4OGCA 2DEUA 3M0SA 3L2ZA 1Y07A 1O9SA 5GAN6 3NHNA 2QYZA 5GAMg 4E7IA 4E7SA 3A98A 2JJ9A 2NYSA 1XNIA 3NTIA 3JCMg 5L23A 3UA6A 3QHSA 4FYYB 2HEQA 2HL3A 4IURA 1YJWQ 4KUDK 4J8OA 2Z0WA 5LJ3f 3LH0A 2A3LA 3ZFJA 3CCJT 2O4XA 1VQNQ 4AG1C 2LVMA 5LJ3j 2CP0A 1RAGB 2HD0A 2YHTA 2QA4Q 3DB3A 5GAN3 2JTFA 2CYZB 1VOMA 5GANe 4LDVA 4XTYA 2LNHB 2RHUA 1VQ5T 5EC7A 2RI2A 1G3WA 1IHVA 2MPXC 1M4ZA 2EQMA 3CXCP 5KYXB 1W2BA 1UDLA 1X6OA 4C92B 4LD6A 4ZN1A 5GAMe 4II1A 5HY6A 4R56A 4C92D 1JXMA 2RF0A 4M75E 1YJNA 1VQLQ 3RMSA 3JCMe 2DK3A 2YUOA 2MK5A 4C92F 2GBQA 2QEXA 3CPWA 4HT8A 1EZZB 2EKOA 1Q82R 2VXFA 2X3WD 4C0GA 3OW2P 2LCLA 1WLPB 5AYFA 1U1TA 1XTDA 3ER0A 2X4JA 2XI9A 3V8KA 4F7UE 1YJWT 1ZBXA 4LE9A 5FROA 2Y4YA 2DFUA 1ZBJA 3REAB 4JS4A 2K5LA 1VQNT 3LGFA 4JPBW 1Y57A 4GY5A 3RKXA 2CUDA 4RTWA 5KYXA 1W1FA 2AK5A 3JCMW 4KBMB 3G71A 2LP5A 1FMKA 3QZ9B 2JXBA 3KUFA 1G5VA 4R0KA 2YRDA 1SRLA 4KRTA 1W70A 1TU0B 2KBTA 2FRWA 4J9FA 2IIMA 2YWWA 1VQOA 3H0HA 3E19A 4HXJA 2DBKA 1VQKT 2XDPA 2ZPFB 2CDTA 4M75A 4JRPA 4LUDA 3ASKA 1IHWA 1FWZA 4JJNK 3SHWA 5GMKj 1VQ6A 3CCQA 2FG0A 4EIKA 3GOXA 2BZ8A 5J26A 3QPHA 4KGXB 4PJOG 2JOYA 2OTJA 2RJEA 1M2VB 1UUEA 2J6OA 2O31A 2DL4A 1VQ9A 2RHYA 2XD0A 2XG8D 4K11A 1SF9A 2F5TX 2VYTA 1AHJB 3QJ6A 3I5RA 2MWOA 2RMOA 2GTJA 2OAWA 3RIRA 3LX7A 2RQWA 2RA2A 3J80E 2D0NA 1GRIA 2DVJA 2D9TA 1MMNA 2JM8A 3CC4T 2DYIA 1NZ9A 4QQDA 2FO0A 4PL6A 2DD5A 1T0JA 2VC8A 1TS9A 4IIOA 1VQ4Q 4M77B 1UB4A 3RDVA 2P4TA 1SPKA 2A08A 3OYYA 4M77D 1I07A 2R58A 2VB6A 1Q82C 2RQTA 3I55A 2E5KA 2IG0A 2YLCA 3M4GA 4M77F 2RD1A 2GFAA 1UG1A 4PJOC 2QXFA 3H41A 1UGVA 2NUPA 1IGQA 3GF5A 3OBYA 1RL2A 1K9MU 5LJ3e 2X3XD 2KDSA 1UJ0A 2K2VA 2EAYA 2SRCA 3X24B 2Y4XA 3FJPA 3UPUA 4CC2A 5CK9A 4PJOE 4N4IA 1I8FA 4EDUA 5IHIA 3L2QA 3S6WA 3E1SA 3BDUA 1NM7A 4M77A 1GCQC 1X75C 5IN1A 4CI0C 3CD6T 3JB9I 4RCCA 2FL7A 4DOWA 1PC0A 3MKDA 1VYTA 2VGMA 2MMPA 5FRMA 1IREB 1VQ4T 2AKLA 1N27A 5GAOr 1K0XA 3SWNA 1S72A 3CCEQ 4DBQA 3CCMT 4BDZA 3EGUA 2DX1A 5D6WA 2L0AA 5GMKh 2O9SA 3L2RA 2J05A 1WXBA 2CGHA 2MCNA 4F14A 5GAN5 4RCBA 3VU3C 2V8JA 2K3YA 2QQ9A 3QXEB 2LDMA 2DTIA 2G6FX 2QI2A 5LJ5f 4LDXA 2EQUA 2F69A 3V8LA 2HAXA 3L1AA 4OVAA 4EMKC 2K3BA 2GQVA 3LW5E 3I56A 3M58A 3CCSQ 3PGGA 2EYQA 4XTVA 5D7UA 4E7ZA 2GFUA 1U06A 1VQPQ 1JBMA 2QQRA 1A0NB 1EX4A 4TVRA 2PTKA 1K8AR 3M0QA 3DLMA 3OS0A 2BIVA 2K3XA 4KULA 3E2UA 5GAMd 2KK4A 1WJRA 3MP1A 2KT8A 5A0DA 2EGCA 4QKUA 1M90R 2A0FB 3OMCA 1WYXA 3ME9A 2DF6A 3JCMd 4HKEA 2LJ3A 3CCET 3G4SQ 4ZTFA 1K8AU 5HCKA 3V7CA 2GGRA 3RMQA 1LCKA 1SKUB 3TU4K 3M59A 1B07A 4PFPA 2XDBA 2WSCE 2ECZA 3VRZA 3L2WA 3HRTA 1RUWA 1OYXA 4M7AE 2J06A 4ZGDB 2M02A 3AT1B 2FRYA 3E9GA 3RBBB 1M90U 1PSFA 3OS2A 4XU1A 2NWMA 1C6VX 4N0AA 1H8KA 4JRQA 4C5GA 2FYKA 1UGSB 5FWBA 4DBHA 3CCST 1I81A 3QWYA 1SEMA 2JTEA 4A4KA 1OI1A 2JTMA 1PWTA 2VKNA 3MP8A 4WF2A 2WSFE 3HHTB 4IUPA 3IQLA 2ESWA 2RI5A 4F17A 1W2BS 1KIKA 4BACA 1GFCA 4E6RA 4C0DC 5GAOm 4LNPA 2F2XA 4BE0A 3OSSC 5GAMj 2P0KA 2JMCA 1FMWA 2LJ1A 5CR2A 3FIFA 2L8DA 1JB0E 7AT1B 2LT4A 3G4ST 3CPWS 4AMCA 1FX7A 4XTXA 1ZA1B 4M7AA 3P8BB 4JJCA 4X34A 3HL8A 3R6OA 1VIEA 5D6YA 4NS5A 3CPFA 6AT1B 1YI2A 1IGUA 4V2SA 1BI2A 4DQ2A 3CCLA 1U8RA 4M7DB 5LJ5g 2DE0X 2EJFA 4FL6A 3OS5A 5ECAA 1VQMQ 1VQ8A 1WI7A 1YJ9A 4HT9A 2IVWA 3CC7T 2LRQA 1UE9A 3VS1A 3AHUA 1LVKA 2DZ9A 5C6SA 4M7DF 3S3OA 2CZ7B 2NLUA 1M90C 3QWXX 4PFOA 5D6XA 3UT1A 4KGVB 2CH4W 2LMJA 4L59A 4OMMA 4VUBA 1WZOA 4J6XA 3J81E 2GTOA 1OU8A 2F1LA 5IH2A 2SEMA 4HCCA 1NEBA 4QVDA 4JDSA 1W2BP 4Q5WA 1QWFA 3PE0A 2B86A 1Q81R 5LJ5e 4DA4A 4M7DA 2YLBA 1TSFA 1GBRA 2LQ8A 3LWHA 3E9FA 1BU1A 1OX9A 3VKIA 5CVIA 4D6WA 2DXTA 1N9SA 2VASA 4BUGA 3EG9A 3CPWP 4JRIA 4EMGA 2HQEA 5DM7R 4F16A 4FU6A 3OYCA 1PHTA 4N4GA 4A54A 3RR6A 1VQMT 2E70A 3MHXA 4M78B 1M3AA 2ZPGB 1Q81U 1V1CA 4JJBA 1WPYA 4C92G 2LCSA 4LDWA 1PNJA 4J5YA 2KY9A 3PMTA 3TEEA 2K6DA 1T0HA 3EHRA 5GANh 2EYXA 3BE3A 2LNVA 4FSSA 4M78F 3SD4A 1K1ZA 3FLGA 1KHCA 2JM9A 2M51A 1YJNT 2LQNA 4EPCA 1M8VA 2QASA 1H92A 2QEXT 1YIJA 3LLRA 1HYOA 3U23A 5GAMh 4HVVA 2PNIA 2VUBA 2LC4A 3VRYA 5FRNA 3CCRQ 5FW9A 2D1XA 2E6ZA 1WHGA 1D0ZA 3JCMh 2V1RA 3OYFA 3A8HB 4FT4A 2V26A 1UGPB 4PFZA 2AZVA 1JXOA 4J9BA 3CBMA 4PJJA 2OTLQ 1IB8A 2YXYA 1YN8A 4Y28E 2J6FA 2XU8A 1PD0A 4M78A 5CKEA 3L2UA 3LYIA 1YCSB 2HSPA 3G71T 4FW1A 5CKFA 1YHQA 2DXCA 1M1KR 2C0TA 3OMGA 1N6AA 3A8LB 4C5HA 2QDLA 4C92C 8AT1B 2CSIA 3G6EA 4XU0A 5L8RE 2CUBA 2Y90A 1VQKQ 1KQ1A 1QMCA 2E12A 3OYIA 2X35A 4ORZA 4MDWA 4KUIA 1AZGB 2JN0A 3HSBA 4Z02A 1D3BB 1SG5A 3CBPA 3CMAA 2C06A 1M1GA 5FU7C 4Y91A 3EFRA 1MV0B 4M75B 4E2FB 2LX7A 4CC3A 2RM4A 3EGXB 1Q81C 2BZYA 4BY6B 2ZAEA 1YITA 4OF1A 3QSUA 3GLXA 4RMOA 2OTJT 4M75D 4B9WA 1NPPA 2EWNA 2PVDB 5CCAA 3CCRT 4MMLA 1VQ9T 1M30A 2VVKA 1S1NA 2AZSA 4NL2A 1HJDA 2HBPA 2MF2A 1MNEA 1GBQA 2KE9A 1M3BA 2JVVA 4M75F 1JRIA 2W0ZA 2DNUA 5GMKl 2OAUA 2E3IA 4LDUA 1QQJA 1WHLA 1ZSZC 2X4YA 1T3LA 2OTLT 2M0OA 1TOVA 4F7UB 4J6YA 1IZ6A 1ZLMA 2DTHA 1OV3A 3EG3A 5M9OA 3CC4Q 4AG2C 1Q82U 1OQKA 1UECA 2DL3A 4F7UF 2RHXA 1YCYA 2DETA 4M77G 2L3PA 1H641 3CCUQ 2CKKA 3A8OB 1WX6A 4XTUA 1D3BA 1AZEA 3EFOB 3CMEQ 2QQAA 1QLYA 3M0TA 3EGXA 4J7FA 1WJSA 2RB6A 4PNOA 4ZGEB 4AFZC 3OYGA 1O75A 3X28B 2EVRA 1OULA 1WDXA 2B8AA 3UDCA 1VQ5A 4B9XA 4C5IA 1WQWA 1UJYA 2QTVA 2DIGA 2QQBA 2ATCB 2DZCA 1UHFA 2FPEA 1KFZA 3CEYA 3TREA 2HBWA 2K9GA 4JRKA 3CCVA 4HA8A 1Q86R 4F7UA 2M1HA 1Y0MA 2VXEA 2D8JA 4FYXB 1NJIR 3SB2A 2E5QA 2EW3A 2KXCA 2NUPB 2RQVA 4LDYA 4OMQA 1JQQA 3QDFA 1M1KC 1H3ZA 5LJ3h 2KNBB 1AEYA 1NBEB 1XOVA 2BE9B 3KFVA 3EFOA 3X25B 2EKHA 3CD6Q 4J9HA 4NL3A 4L6V5 1WHHA 2CP7A 4J83A 5GMKi 1YJWA 3HPWA 1NJIU 2P4RA 3JCMb 3CCUT 2AHJB 3M9QA 4XQ3A 1J3TA 3CMET 1S72T 3REBB 3CCMQ 2W10A 5KE3A 2XIDA 3THKA 3LGLA 1Y96B 2QA4A 4E47A 2E4HA 5CIUA 1YP5A 4E7HA 3SWNB 2VV5A 2HZYA 3G7ZA 4RKUE 1K73R 1QCFA 5LJ5d 4XTZA 3M57A 1YBYA 4MMKA 4PKCC 1VUBA 2I2LA 3NTKA 4RTUA 1VQLA 2K5FA 1RABB 5KH6A 1LNXA 3VS3A 5I2SA 1RLPC 3LWIA 3H0FA 4X9DA 4LD9K 4JLGA 2GQIA 1C0MA 2R57A 3VS7A 4FIBA 4PJOB 2K79A 2P0PA 1D1CA 2CP3A 5KCHA 2C0IA 4NOYA 1BI3A 4JLIA 2COZA 3RNJA 1Y96A 4OB0B 1OU9A 4PJOF 2JS0A 1WHJA 3URGA 1D0XA 5GJVB 4BE2A 2YDLA 2HL5C 2NUTB 3JB9H 2LZ6B 4ZGJB 3M56A 1B34B 1I0CA 3FC3A 2PQWA 3HRUA 1QVPA 3GNGA 5A2QE 2YUQA 1Q86C 1AWXA 2YUNA 3M55A 2JT4A 1NJIC 1WJQA 1UGRB 1WQ7A 2RI3A 4AFQC 5GAN4 1LOJA 4OB1B 1AOJA 5LJ5j 2EBPA 1SSHA 3S3MA 3WVDB 4PJOA 1RLQC 1QP2A 2HCKA 1RI9A 4C0ZA 4ELZC 5DLQE 5IXBA 1JU5C 1X6BA 3UF4A 2DRMA 3PIOA 2FVUA 3BDLA 2NUTA 2KR3A 5I2MA 4EMKB 1G8XA 3JAME 4RTVA 3KBGA 2CP5A 3BFMA 1B34A 5HKCA 3RERA 2RPNA 4C8QG 5CQYA 1TWBA 5DLOA 2HQXA 1X6GA 1GCQA 5GAOq 4QW2A 3OYNA 1K73C 4CC7A 1VQ7Q 4OP0A 2CZ1B 2LTOA 2YT6A 1M2OA 1KC8R 2CS7A 2G3RA 5I11A 1X43A 3O8VA 5GAOp 1YFNA 4Z8AA 1VQ4A 4IIMA 2M0YA 2QGGA 3CC2Q 3ULRB 4O5VA 4M7AB 4BI3A 2DL5A 1IO6A 3ZEHA 1D0YA 4IUVA 5LL6S 3JB9G 3CC7Q 4M7AD 2EYZA 1CKBA 1CKAA 5IAYA 4EMKA 4M7AF 1KC8U 1AWOA 5KYWB 1GCPA 2X51A 1SHGA 3M54A 3OA6A 1N9RA 4BDYA 2CH4A 4Z88A 2L3SA 4ZTJA 4C8QC 2KEAA 1QKWA 4KT0E 4BI8B 1QVFA 2ZGWA 5GAOn 1B3QA 3H0IA 5CAIA 2CZ0B 2XHCA 3OYBA 3OYDA 1M27C 2DILA 5CKBA 1WIEA 2CT4A 4XK8E 2MWPA 2LT1A 3PFSA 1VQ7T 2MYSA 1JEGA 2JMAA 4C8QE 1JO8A 1XQHA 3FDRA 3MPUB 1BK2A 2HKNA 2YRCA 3JSCA 4HCKA 4C0DB 4JS5A 1WHKA 2R5AA 3OQ5A 5FLXE 4ME7A 3CCEA 2MOXA 3S3NA 3CC2T 3HFNA 3OBWA 1GFDA 5LJ5h 5CKHA 4MDXA 3EH2A 3I35A 1W6XA 5KYWA 4LN2A 3KXTA 2F2VA 4M7DD 1B7TA 1NLPC 4JZ4A 5EG2A 1W4SA 1PD1A 3QIIA 1BYMA 3EG9B 1TUDA 2EIFA 1KQSA 1PRLC 2KRNA 4CC4B 3WVEB 1WFWA 2BZXA 1U5SA 2CZ6B 1UHCA 1YJNQ 5FU6C 1V76A 2M16A 2D0QB 5J39A 2PVOB 5CQXA 3JCMP 2QEXQ 1AWWA 2AIRB 1VQPA 1PSEA 4AFUC 5HK0A 1KC8C 3C4SA 1P92A 3J7AF 3PT9A 1WNLA 4OMFB 1MMDA 2RJDA 3VS6A 2KAFA 2H8HA 2QTXA 2KVQG 4E7LA 1R0CB 5A0GA 2A28A 4XTWA 1NLOC 3MJXA 3PTAA 1Z9ZA 2WACA 3SDZA 4FM4B 2EGAA 1BIAA 1QKXA 2J7IA 2V8IA 3G4SA 1UFFA 3G71Q 2HKQB 4BE1A 1YHQT 5FWCA 2KI7A 1LJOA 3MEUA 2A37A 3PNWC 1VQOQ 4J9CA 3OYJA 3L42A 1FMVA 1WHMA 1ZA2B 4WCIA 1JJ2S 3OYMA 2FB7A 4OGEA 2GNCA 4M78D 2DMOA 2DRKA 2COYA 3D7SB 1OZ2A 3V7SA 1D1BA 4RTYA 4QVCA 1VQ6Q 3CCQQ 4JUVA 3TQ7P 4M75G 3CMAT 2CREA 2E10A 1BI0A 2YRVA 1KSWA 1SSFA 2PVGB 2EQIA 2FZGB 1YITT 1VA7A 2OTJQ 1QVGA 3X26B 5GANg 4YTLA 1VQ9Q 4KH0B 2LJ0A 2XK0A 2OX7A 2PZ1A 3FJ5A 4ANJA 5KYYB 1K76A 4XU2A 1OPLA 3H9NA 2QG9B 3EG0A 1IXDA 4F7UG 1NEGA 3QKJA 4PJLA 2DTOA 3LH5A 4D8DA 3VYHB 2DKGA 1RAIB 2DXUA 3N5BB 3FRNA 4OB3B 1YWOA 1QW1A 1TTHB 5CKDA 3MEAA 4J6WA 1QP3A 4GLKA 4X1VA 1GL5A 3QZ5B 3OY9A 4JJDA 3GBQA 1WXTA 1VQOT 3OYKA 5A0LA 2KRMA 3M53A
chains in the Genus database with same CATH topology
2ABLA 1YWPA 3M0QA 1FYNA 3M0UA 2P4RA 4ZNXA 1E6GA 1K9AA 1NYFA 1J3TA 3REBB 1TG0A 2RNAA 2W10A 4Z89A 2KT8A 3THKA 2FEIA 2EGCA 5IHKA 1Z9QA 3UA7A 1WYXA 1N5ZA 2DF6A 3PVQA 3UATA 1YP5A 1PKTA 2LJ3A 4DEYA 1X2KA 5HCKA 2A36A 4OMOA 3PVLA 1QCFA 2GGRA 1LCKA 3CQTA 4LUEA 1B07A 2XMFA 3VS2A 1CSKA 2ECZA 1K0SA 3VRZA 3EG2A 4J9GA 1RUWA 1OOTA 3I9QA 2VWFA 2J06A 2FRYA 4RTUA 2DJQA 2KRSA 3RBBB 2DL7A 1KJWA 3VS3A 1RLPC 2NWMA 3H0FA 1H8KA 2BTTA 2GQIA 5FWBA 3QWYA 3VS7A 2L3QA 1ZX6A 2K79A 2DLPA 1SEMA 4OMPA 2JTEA 2C0IA 1M3CA 2L2PA 1PWTA 2VKNA 4GBQA 1OEBA 2O9VA 2HDAA 3RNJA 3IQLA 2RN8A 2ESWA 2FPDA 4M4ZA 2JS0A 4F17A 1PRMC 4J9DA 1KIKA 5GJVB 1ARKA 1GFCA 1ZUUA 2YDLA 4E6RA 2LZ6B 1ZSGA 4LNPA 5I22A 2F2XA 3M0PA 1I0CA 2JMCA 4QT7A 2LJ1A 3M0SA 2YUQA 1AWXA 2YUNA 2JT4A 3NHNA 3M0RA 4HVUA 3A98A 4AFQC 2EYYA 4JJCA 1AOJA 5L23A 2EBPA 3UA6A 1SSHA 1G2BA 2FPFA 2HEQA 4D8KA 1RLQC 2HCKA 1RI9A 2CT3A 2DE0X 2KT1A 5IXBA 5ECAA 1JU5C 4AG1C 1X6BA 1WI7A 3UF4A 2KYBA 2DRMA 1UE9A 4Y92A 3VS1A 1HD3A 2YUPA 2KR3A 2LNHB 1EFNA 1YNZA 1SRMA 5EC7A 1TUCA 4RTVA 2RPNA 3QWXX 2EGEA 1X69A 1UDLA 2CH4W 1X6GA 2LMJA 4OMMA 1GCQA 2DM1A 1WA7A 2GTOA 3NPFA 4CC7A 1JXMA 2RF0A 1M8MA 5IH2A 2AKKA 3C0CA 2YT6A 2OJ2A 2SEMA 2YUOA 1NEBA 1H3HA 2GBQA 5I11A 1X43A 1HSQA 4Z8AA 2D8HA 1QWFA 3PE0A 4IIMA 2B86A 2X3WD 2ROTA 2M0YA 3JV3A 3ULRB 1GBRA 1WLPB 1BU1A 2DL5A 4OMLA 1IO6A 2EYWA 2EPDA 2EYZA 1CKBA 1CKAA 4LE9A 1BB9A 4JZ3A 3EHQA 4F16A 1AWJA 1ZBJA 1PHTA 3REAB 1PKSA 2ED0A 1AWOA 2OI3A 4JPBW 1Y57A 1GCPA 2CUDA 4RTWA 1SHGA 1M3AA 1W1FA 2AK5A 2O88A 1V1CA 4JJBA 2LP5A 1FMKA 2LCSA 2CH4A 4Z88A 2JXBA 1BBZA 2L3SA 1PNJA 4RUGA 2J6KA 5IXFA 4R0KA 1SRLA 1T0HA 1T3SA 1W70A 2ENMA 2K6DA 3EHRA 4KRTA 2KBTA 2FRWA 4J9FA 2IIMA 2KEAA 4DEXA 1QKWA 2EYXA 3H0HA 4RTXA 4ESRA 4FSSA 4HXJA 1K1ZA 1B3QA 2JM9A 2M51A 2DBKA 2ROLA 2LQNA 3H0IA 1WXUA 4RTTA 2CDTA 1M27C 2DILA 1WIEA 4LUDA 1H92A 3TSWA 2CT4A 3SHWA 2K2MA 3U23A 2FG0A 1JEGA 3TSZA 4HVVA 2C0OA 1OPKA 2PNIA 2JMAA 3VRYA 4EIKA 5FW9A 1ZUKA 3VS5A 2JW4A 1ABOA 2BZ8A 2KXDA 2YSQA 1JO8A 2ED1A 2D1XA 4GLMA 2RQUA 2V1RA 4OMNA 1BK2A 4HCKA 2AZVA 1JXOA 1UUEA 4J9BA 2J6OA 2O31A 2DL4A 2MOXA 1GFDA 4K11A 3ZL7C 3I35A 1G83A 1YN8A 1W6XA 2J6FA 4LN2A 2F2VA 3I5RA 1AVZC 2RMOA 2GTJA 2OAWA 1NLPC 2I0NA 4JZ4A 1YCSB 2HSPA 2RQWA 3NGPA 1TUDA 2C0TA 1PRLC 2DL8A 2D0NA 1GRIA 2DVJA 3I5SA 2JM8A 2KRNA 2QDLA 4J9EA 1WFWA 4CC4B 2CSIA 2BZXA 1U5SA 2CUBA 1UHCA 1E6HA 2FO0A 1T0JA 4ORZA 4IIOA 1AWWA 2RQRA 1AZGB 1VYUA 2CSQA 2DA9A 4AFUC 1SHFA 1SPKA 4A63B 2A08A 1QWEA 3EG1A 3VS4A 2LQWA 1I07A 1MV0B 3VS6A 2LX7A 2H8HA 4CC3A 2RQTA 2E5KA 3TVTA 2BZYA 1I1JA 2A28A 1NLOC 1U3OA 1M30A 1UG1A 2VVKA 1S1NA 1Z9ZA 2AZSA 4J9IA 1HJDA 1NG2A 1GBQA 2KE9A 1M3BA 3H41A 1K4US 2W0ZA 1UGVA 2EGAA 2DNUA 1UTIA 1QKXA 2J7IA 1ABQA 1X27A 1UFFA 1T3LA 2JS2A 2X3XD 1UJ0A 1ZLMA 2SRCA 5FWCA 1OV3A 3EG3A 2MIOA 3O5ZA 2A37A 4J9CA 4AG2C 4CC2A 3NMZC 5IHNA 1VYVA 4WCIA 3VS0A 1UECA 2DL3A 5IHIA 1MUZA 1AD5A 2GNCA 2DMOA 2DRKA 2L3PA 4AFSC 2DBMA 1NM7A 4RTYA 1GCQC 1WX6A 2KYMA 1AZEA 2KROA 4RTZA 2CREA 1VYTA 1QLYA 3M0TA 1MV3A 1KSWA 2EQIA 2AKLA 4AFZC 1VA7A 4HVWA 1K0XA 2EVRA 1WDXA 1X2QA 1UJYA 2LJ0A 3EGUA 2V1QA 2DX1A 3SEMA 2L0AA 2O9SA 2NUZA 2PZ1A 3FJ5A 1UHFA 2K7AA 2FPEA 2J05A 1WXBA 1KFZA 1K76A 1OPLA 2MCNA 4F14A 3EG0A 1NEGA 2HBWA 1NYGA 2K9GA 3LH5A 1Y0MA 4D8DA 1E7OA 2D8JA 2G6FX 5GJWB 2EW3A 1YWOA 2DYBA 3R6NA 2KXCA 2K3BA 2RQVA 4OMQA 1JQQA 4X1VA 2KGTA 2KNBB 1GL5A 1AEYA 2O2OA 4JJDA 1XOVA 3GBQA 1WXTA 3KFVA 1ZUYA 1U06A 1A0NB 2F2WA 2EKHA 4J9HA 2KRMA 2PTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ABL A;  1YWP A;  3M0Q A;  1FYN A;  3M0U A;  2P4R A;  4ZNX A;  1E6G A;  1K9A A;  1NYF A;  1J3T A;  3REB B;  1TG0 A;  2RNA A;  2W10 A;  4Z89 A;  2KT8 A;  3THK A;  2FEI A;  2EGC A;  5IHK A;  1Z9Q A;  3UA7 A;  1WYX A;  1N5Z A;  2DF6 A;  3PVQ A;  3UAT A;  1YP5 A;  1PKT A;  2LJ3 A;  4DEY A;  1X2K A;  5HCK A;  2A36 A;  4OMO A;  3PVL A;  1QCF A;  2GGR A;  1LCK A;  3CQT A;  4LUE A;  1B07 A;  2XMF A;  3VS2 A;  1CSK A;  2ECZ A;  1K0S A;  3VRZ A;  3EG2 A;  4J9G A;  1RUW A;  1OOT A;  3I9Q A;  2VWF A;  2J06 A;  2FRY A;  4RTU A;  2DJQ A;  2KRS A;  3RBB B;  2DL7 A;  1KJW A;  3VS3 A;  1RLP C;  2NWM A;  3H0F A;  1H8K A;  2BTT A;  2GQI A;  5FWB A;  3QWY A;  3VS7 A;  2L3Q A;  1ZX6 A;  2K79 A;  2DLP A;  1SEM A;  4OMP A;  2JTE A;  2C0I A;  1M3C A;  2L2P A;  1PWT A;  2VKN A;  4GBQ A;  1OEB A;  2O9V A;  2HDA A;  3RNJ A;  3IQL A;  2RN8 A;  2ESW A;  2FPD A;  4M4Z A;  2JS0 A;  4F17 A;  1PRM C;  4J9D A;  1KIK A;  5GJV B;  1ARK A;  1GFC A;  1ZUU A;  2YDL A;  4E6R A;  2LZ6 B;  1ZSG A;  4LNP A;  5I22 A;  2F2X A;  3M0P A;  1I0C A;  2JMC A;  4QT7 A;  2LJ1 A;  3M0S A;  2YUQ A;  1AWX A;  2YUN A;  2JT4 A;  3NHN A;  3M0R A;  4HVU A;  3A98 A;  4AFQ C;  2EYY A;  4JJC A;  1AOJ A;  5L23 A;  2EBP A;  3UA6 A;  1SSH A;  1G2B A;  2FPF A;  2HEQ A;  4D8K A;  1RLQ C;  2HCK A;  1RI9 A;  2CT3 A;  2DE0 X;  2KT1 A;  5IXB A;  5ECA A;  1JU5 C;  4AG1 C;  1X6B A;  1WI7 A;  3UF4 A;  2KYB A;  2DRM A;  1UE9 A;  4Y92 A;  3VS1 A;  1HD3 A;  2YUP A;  2KR3 A;  2LNH B;  1EFN A;  1YNZ A;  1SRM A;  5EC7 A;  1TUC A;  4RTV A;  2RPN A;  3QWX X;  2EGE A;  1X69 A;  1UDL A;  2CH4 W;  1X6G A;  2LMJ A;  4OMM A;  1GCQ A;  2DM1 A;  1WA7 A;  2GTO A;  3NPF A;  4CC7 A;  1JXM A;  2RF0 A;  1M8M A;  5IH2 A;  2AKK A;  3C0C A;  2YT6 A;  2OJ2 A;  2SEM A;  2YUO A;  1NEB A;  1H3H A;  2GBQ A;  5I11 A;  1X43 A;  1HSQ A;  4Z8A A;  2D8H A;  1QWF A;  3PE0 A;  4IIM A;  2B86 A;  2X3W D;  2ROT A;  2M0Y A;  3JV3 A;  3ULR B;  1GBR A;  1WLP B;  1BU1 A;  2DL5 A;  4OML A;  1IO6 A;  2EYW A;  2EPD A;  2EYZ A;  1CKB A;  1CKA A;  4LE9 A;  1BB9 A;  4JZ3 A;  3EHQ A;  4F16 A;  1AWJ A;  1ZBJ A;  1PHT A;  3REA B;  1PKS A;  2ED0 A;  1AWO A;  2OI3 A;  4JPB W;  1Y57 A;  1GCP A;  2CUD A;  4RTW A;  1SHG A;  1M3A A;  1W1F A;  2AK5 A;  2O88 A;  1V1C A;  4JJB A;  2LP5 A;  1FMK A;  2LCS A;  2CH4 A;  4Z88 A;  2JXB A;  1BBZ A;  2L3S A;  1PNJ A;  4RUG A;  2J6K A;  5IXF A;  4R0K A;  1SRL A;  1T0H A;  1T3S A;  1W70 A;  2ENM A;  2K6D A;  3EHR A;  4KRT A;  2KBT A;  2FRW A;  4J9F A;  2IIM A;  2KEA A;  4DEX A;  1QKW A;  2EYX A;  3H0H A;  4RTX A;  4ESR A;  4FSS A;  4HXJ A;  1K1Z A;  1B3Q A;  2JM9 A;  2M51 A;  2DBK A;  2ROL A;  2LQN A;  3H0I A;  1WXU A;  4RTT A;  2CDT A;  1M27 C;  2DIL A;  1WIE A;  4LUD A;  1H92 A;  3TSW A;  2CT4 A;  3SHW A;  2K2M A;  3U23 A;  2FG0 A;  1JEG A;  3TSZ A;  4HVV A;  2C0O A;  1OPK A;  2PNI A;  2JMA A;  3VRY A;  4EIK A;  5FW9 A;  1ZUK A;  3VS5 A;  2JW4 A;  1ABO A;  2BZ8 A;  2KXD A;  2YSQ A;  1JO8 A;  2ED1 A;  2D1X A;  4GLM A;  2RQU A;  2V1R A;  4OMN A;  1BK2 A;  4HCK A;  2AZV A;  1JXO A;  1UUE A;  4J9B A;  2J6O A;  2O31 A;  2DL4 A;  2MOX A;  1GFD A;  4K11 A;  3ZL7 C;  3I35 A;  1G83 A;  1YN8 A;  1W6X A;  2J6F A;  4LN2 A;  2F2V A;  3I5R A;  1AVZ C;  2RMO A;  2GTJ A;  2OAW A;  1NLP C;  2I0N A;  4JZ4 A;  1YCS B;  2HSP A;  2RQW A;  3NGP A;  1TUD A;  2C0T A;  1PRL C;  2DL8 A;  2D0N A;  1GRI A;  2DVJ A;  3I5S A;  2JM8 A;  2KRN A;  2QDL A;  4J9E A;  1WFW A;  4CC4 B;  2CSI A;  2BZX A;  1U5S A;  2CUB A;  1UHC A;  1E6H A;  2FO0 A;  1T0J A;  4ORZ A;  4IIO A;  1AWW A;  2RQR A;  1AZG B;  1VYU A;  2CSQ A;  2DA9 A;  4AFU C;  1SHF A;  1SPK A;  4A63 B;  2A08 A;  1QWE A;  3EG1 A;  3VS4 A;  2LQW A;  1I07 A;  1MV0 B;  3VS6 A;  2LX7 A;  2H8H A;  4CC3 A;  2RQT A;  2E5K A;  3TVT A;  2BZY A;  1I1J A;  2A28 A;  1NLO C;  1U3O A;  1M30 A;  1UG1 A;  2VVK A;  1S1N A;  1Z9Z A;  2AZS A;  4J9I A;  1HJD A;  1NG2 A;  1GBQ A;  2KE9 A;  1M3B A;  3H41 A;  1K4U S;  2W0Z A;  1UGV A;  2EGA A;  2DNU A;  1UTI A;  1QKX A;  2J7I A;  1ABQ A;  1X27 A;  1UFF A;  1T3L A;  2JS2 A;  2X3X D;  1UJ0 A;  1ZLM A;  2SRC A;  5FWC A;  1OV3 A;  3EG3 A;  2MIO A;  3O5Z A;  2A37 A;  4J9C A;  4AG2 C;  4CC2 A;  3NMZ C;  5IHN A;  1VYV A;  4WCI A;  3VS0 A;  1UEC A;  2DL3 A;  5IHI A;  1MUZ A;  1AD5 A;  2GNC A;  2DMO A;  2DRK A;  2L3P A;  4AFS C;  2DBM A;  1NM7 A;  4RTY A;  1GCQ C;  1WX6 A;  2KYM A;  1AZE A;  2KRO A;  4RTZ A;  2CRE A;  1VYT A;  1QLY A;  3M0T A;  1MV3 A;  1KSW A;  2EQI A;  2AKL A;  4AFZ C;  1VA7 A;  4HVW A;  1K0X A;  2EVR A;  1WDX A;  1X2Q A;  1UJY A;  2LJ0 A;  3EGU A;  2V1Q A;  2DX1 A;  3SEM A;  2L0A A;  2O9S A;  2NUZ A;  2PZ1 A;  3FJ5 A;  1UHF A;  2K7A A;  2FPE A;  2J05 A;  1WXB A;  1KFZ A;  1K76 A;  1OPL A;  2MCN A;  4F14 A;  3EG0 A;  1NEG A;  2HBW A;  1NYG A;  2K9G A;  3LH5 A;  1Y0M A;  4D8D A;  1E7O A;  2D8J A;  2G6F X;  5GJW B;  2EW3 A;  1YWO A;  2DYB A;  3R6N A;  2KXC A;  2K3B A;  2RQV A;  4OMQ A;  1JQQ A;  4X1V A;  2KGT A;  2KNB B;  1GL5 A;  1AEY A;  2O2O A;  4JJD A;  1XOV A;  3GBQ A;  1WXT A;  3KFV A;  1ZUY A;  1U06 A;  1A0N B;  2F2W A;  2EKH A;  4J9H A;  2KRM A;  2PTK A; 
#chains in the Genus database with same CATH topology
 1RAH B;  2ABL A;  2HSE B;  3JCM J;  2HNI A;  1FYN A;  1M1F A;  3M0U A;  3I55 Q;  4CRI A;  1ACM B;  2QQS A;  4M75 C;  1N8R R;  1E6G A;  4FSX A;  1VQ6 T;  1K9A A;  3CCQ T;  4MZM A;  1NYF A;  1VQM A;  3DB4 A;  3GNF B;  4BY6 C;  1WGS A;  2JZ2 A;  4Z89 A;  4C92 E;  1RAF B;  5KYY A;  1M1K U;  1JJ2 P;  3UA7 A;  1N5Z A;  3BY7 A;  3VYG A;  3UAT A;  1U1S A;  3CCV T;  2H3E B;  1X2K A;  4KH1 B;  4LUE A;  1X01 A;  2XMF A;  5GMK m;  3VV0 A;  1N8R U;  1EIF A;  1CSK A;  1BCO A;  1VIF A;  3MCA B;  2P84 A;  3I9Q A;  2VWF A;  3A1P A;  5FU7 B;  3Q1J A;  8ATC B;  3DLL A;  2DJQ A;  1RAE B;  2KRS A;  2AT1 B;  1KK7 A;  4FYV B;  2DL7 A;  5C0M A;  1KJW A;  2P0Q A;  1QCO A;  2BTT A;  2V8K A;  4LXC A;  1RAC B;  4ZN3 A;  2L3Q A;  1ZX6 A;  3RES A;  5CO7 A;  1GXI E;  3CCJ A;  1Y71 A;  1I4K 1;  4HCZ A;  1S72 Q;  4GBQ A;  2ZPI B;  2JUF A;  1MND A;  2LX9 A;  1ZSZ B;  5HK3 A;  1IRX A;  1OEB A;  2M9U A;  2RN8 A;  2QA4 T;  2K57 A;  2QDY B;  3I55 T;  1PRM C;  3INZ A;  4J9D A;  3A8M B;  4C92 A;  1ARK A;  5AT1 B;  4BD3 A;  3HFO A;  1ZSG A;  5I22 A;  4KGZ B;  5I21 A;  5KYN A;  2L89 A;  3UWN A;  4C5E A;  2DXB A;  3X20 B;  4UC4 A;  2RO0 A;  2O01 E;  4A53 A;  2DER A;  3EGD B;  3HP9 A;  3M0R A;  3I56 Q;  4B6M A;  3WXM B;  2HMA A;  2ZZD A;  4HVU A;  1VQL T;  2EYY A;  1Y7X A;  2E6N A;  2BE7 D;  3P8H A;  4EMH A;  2RHI A;  3EFS A;  2FPF A;  1G2B A;  4D8K A;  3CCR A;  1Q7Y R;  2CT3 A;  2XIC A;  2KT1 A;  4MZP A;  3CXC A;  4HCB A;  1D1A A;  1ZSZ A;  1JJ2 A;  2EFI A;  2QK0 A;  1MMG A;  4M77 C;  2KYB A;  1Q86 U;  3FB9 A;  3OYH A;  4IUQ A;  3GIB A;  2K5I A;  4Y92 A;  1N8R C;  2OTL A;  1MHN A;  1HD3 A;  2YUP A;  1I5L A;  1AT1 B;  5LJ3 g;  1VQN A;  1EFN A;  1YNZ A;  1SRM A;  1TUC A;  2DD4 A;  3SWN C;  2EGE A;  1QVF S;  1X69 A;  1Q7Y U;  4BI4 A;  3HTR A;  2ZCF B;  4M77 E;  2DM1 A;  1WA7 A;  4R55 A;  3EGD A;  3RKW A;  3OW2 A;  2XDD A;  3NPF A;  1TXQ A;  3QDR B;  4FYW B;  4ELY C;  3OYL A;  1K9M R;  1M8M A;  1VQK A;  2AKK A;  3C0C A;  3H8Z A;  2OJ2 A;  2WSE E;  1H3H A;  4X9C A;  2EQJ A;  1HSQ A;  4FCY A;  1ZQ1 A;  2DPP B;  3CBO A;  3I56 T;  2D8H A;  2RK1 A;  1M2V A;  1RAD B;  2EJG A;  2ROT A;  1HXD A;  3JV3 A;  4DBF A;  1BI1 A;  2HQH A;  3F70 A;  1KQ2 A;  4OML A;  2EYW A;  2GCX A;  5J3B A;  2EPD A;  1NPR A;  1K73 U;  1BB9 A;  4PLL A;  4JZ3 A;  3EHQ A;  1AWJ A;  4PJO D;  3EH1 A;  1KQS S;  1PKS A;  2ED0 A;  2OI3 A;  2KSS A;  2CP2 A;  3T9N A;  4DOV A;  2XKO C;  2O88 A;  2E1H A;  3MP6 A;  2PU9 B;  3QJY A;  3TCJ A;  4BB7 A;  1BBZ A;  1V29 B;  1OX8 A;  2DEQ A;  2J6K A;  4RUG A;  5IXF A;  4A4H A;  1T3S A;  2ENM A;  4DEX A;  3CC4 A;  2DIQ A;  3OB9 A;  4RTX A;  4ESR A;  3QO3 A;  1PG5 B;  2ROL A;  2KMT A;  1QCN A;  1WXU A;  1XJW B;  1ZHI A;  2RH2 A;  4RTT A;  4J7I A;  3L2V A;  3MO8 A;  1RAA B;  5GAN 8;  1BIB A;  3TSW A;  3VUB A;  3CCU A;  2PUK B;  5DY9 A;  1YI2 Q;  2K2M A;  3FEO A;  3TSZ A;  3CME A;  2C0O A;  1OPK A;  3VJP A;  1KD1 R;  1KHI A;  4PLI A;  2DAQ A;  1ZUK A;  2X4W A;  3VS5 A;  3CCL Q;  4M7A G;  2JW4 A;  1ABO A;  2KXD A;  2YSQ A;  2ED1 A;  4GLM A;  1I5O B;  2RQU A;  1QVF P;  1VQ8 Q;  4QQG A;  4OMN A;  1YJ9 Q;  1Q7Y C;  3JRZ A;  2MAM A;  4N0A C;  4FW2 A;  3BW1 A;  3H6Z A;  3JCM c;  3ZL7 C;  1G83 A;  1G3S A;  1AVZ C;  2FZC B;  2LQK A;  2QGF B;  2I0N A;  3HKS A;  1KD1 U;  3NGP A;  1C1A A;  2BKD N;  3OYE A;  2DL8 A;  3I5S A;  3JCM V;  4J9E A;  4WTO B;  5GAN d;  2ZPB B;  3QBY A;  2ZPH B;  1E6H A;  3NFC A;  2RQR A;  1VYU A;  1K9M C;  2CSQ A;  4F04 B;  2DA9 A;  3OS1 A;  1KQS P;  1QVG S;  3CD6 A;  1SHF A;  4A63 B;  1QWE A;  3EG1 A;  5GMK e;  3VS4 A;  2LQW A;  4E7K A;  3QYG B;  4XU3 A;  4ATO A;  3EAE A;  3TVT A;  4M7A C;  1YI2 T;  1I1J A;  4IUT A;  4M7D G;  1F1B B;  1U3O A;  3CCM A;  3CCL T;  4AT1 B;  4A4E A;  4J9I A;  1NG2 A;  2L5Q A;  2KQW A;  5KYU B;  1VQ8 T;  1K4U S;  1YJ9 T;  1UTI A;  2E41 A;  1ABQ A;  1X27 A;  3A8G B;  4OB2 B;  2JS2 A;  2PUO B;  3DKM A;  1LPL A;  2MI6 A;  1DJ7 B;  2GF7 A;  2MIO A;  3O5Z A;  3A5Z B;  3NMZ C;  5IHN A;  1VYV A;  3VS0 A;  1OZ3 A;  1MUZ A;  1AD5 A;  2CP6 A;  4PK4 A;  3MEV A;  1TH7 A;  3RUX A;  1YIJ Q;  5GAN f;  4AFS C;  1PCX A;  1VQP T;  2DBM A;  1PM3 A;  2KYM A;  2JNG A;  2KRO A;  1FXX A;  4RTZ A;  3PMI A;  5GAN j;  2FZK B;  1NE8 A;  1BKB A;  1MV3 A;  1R0B G;  4C0F A;  2R5M A;  4A4G A;  1BCM A;  3QG1 A;  1KD1 C;  1R77 A;  2DVE A;  1Q95 G;  2K4Y A;  1MMA A;  4HVW A;  3ZBD A;  5GAM f;  1X2Q A;  5GAO l;  3RKY A;  3PIP A;  3C95 A;  5KYU A;  2A7Y A;  1G3Y A;  2V1Q A;  3SEM A;  2NUZ A;  2RK2 A;  3JCM f;  4C8Q B;  4M7D C;  2K7A A;  2VGN A;  4RG8 A;  3JCM Q;  4IKF A;  1NYG A;  2DO3 A;  4C8Q D;  2EQK A;  1E7O A;  5GJW B;  1YHQ Q;  1HK9 A;  1QVG P;  5IT9 E;  3C94 A;  1RI0 A;  9ATC B;  4M78 G;  4C8Q F;  2DYB A;  5GAN 2;  3R6N A;  3G6E Q;  4L5G A;  2X4X A;  2RHZ A;  2DJZ A;  4A4F A;  2X9H A;  2E3H A;  1M9S A;  4M7D E;  4IUU A;  2KGT A;  1UGQ B;  2O2O A;  1ZUY A;  3VUZ A;  3OSV A;  4XAX B;  2F2W A;  3HRS A;  1K8A C;  3M4Y A;  1MGQ A;  3QYH B;  1G3T A;  3GPL A;  1YWP A;  1R8O B;  3CMA Q;  3CCS A;  3SFM A;  4O6J A;  4ZNX A;  3M5A A;  4QVZ A;  1YIJ T;  3MET A;  2D6F A;  3C12 A;  1YIT Q;  3NTH A;  3JB9 D;  1KG1 A;  1TG0 A;  2RNA A;  2COW A;  3V7R A;  2QAZ A;  2FEI A;  1UEB A;  5IHK A;  4C8Q A;  1Z9Q A;  3JB9 F;  4QQ6 A;  3PVQ A;  5KE2 A;  5GAN 7;  2LCC A;  5KCO A;  1PKT A;  4DEY A;  3MEW A;  5FU6 B;  2A36 A;  4OMO A;  3PVL A;  4N4H A;  4PJN A;  2F5K A;  3CQT A;  1D09 B;  3VS2 A;  1K0S A;  4M78 C;  3OYA A;  3EG2 A;  4J9G A;  1VQ7 A;  1OOT A;  4DBR A;  3JCM X;  1TUG B;  2BUD A;  4P5N A;  5LJ3 d;  2E65 A;  2RJC A;  3CCJ Q;  1M5Q 1;  4FT2 A;  3CXC S;  3G6E T;  3P8D A;  2ZPE B;  2E64 A;  3QUI A;  4E7J A;  2DLP A;  4RG2 A;  3CC2 A;  4OMP A;  3V8J A;  2L3R A;  2H3J A;  1M3C A;  2L2P A;  4M78 E;  3G1J A;  2O4X B;  1VQ5 Q;  2O9V A;  2HDA A;  3CC7 A;  2FPD A;  4M4Z A;  3GP8 A;  3JB9 J;  1ZUU A;  2IPO B;  2FHD A;  3CCV Q;  3OW2 S;  4PJM A;  3M0P A;  2RJF A;  4MZT A;  2EJ9 A;  4QT7 A;  4OGC A;  2DEU A;  3M0S A;  3L2Z A;  1Y07 A;  1O9S A;  5GAN 6;  3NHN A;  2QYZ A;  5GAM g;  4E7I A;  4E7S A;  3A98 A;  2JJ9 A;  2NYS A;  1XNI A;  3NTI A;  3JCM g;  5L23 A;  3UA6 A;  3QHS A;  4FYY B;  2HEQ A;  2HL3 A;  4IUR A;  1YJW Q;  4KUD K;  4J8O A;  2Z0W A;  5LJ3 f;  3LH0 A;  2A3L A;  3ZFJ A;  3CCJ T;  2O4X A;  1VQN Q;  4AG1 C;  2LVM A;  5LJ3 j;  2CP0 A;  1RAG B;  2HD0 A;  2YHT A;  2QA4 Q;  3DB3 A;  5GAN 3;  2JTF A;  2CYZ B;  1VOM A;  5GAN e;  4LDV A;  4XTY A;  2LNH B;  2RHU A;  1VQ5 T;  5EC7 A;  2RI2 A;  1G3W A;  1IHV A;  2MPX C;  1M4Z A;  2EQM A;  3CXC P;  5KYX B;  1W2B A;  1UDL A;  1X6O A;  4C92 B;  4LD6 A;  4ZN1 A;  5GAM e;  4II1 A;  5HY6 A;  4R56 A;  4C92 D;  1JXM A;  2RF0 A;  4M75 E;  1YJN A;  1VQL Q;  3RMS A;  3JCM e;  2DK3 A;  2YUO A;  2MK5 A;  4C92 F;  2GBQ A;  2QEX A;  3CPW A;  4HT8 A;  1EZZ B;  2EKO A;  1Q82 R;  2VXF A;  2X3W D;  4C0G A;  3OW2 P;  2LCL A;  1WLP B;  5AYF A;  1U1T A;  1XTD A;  3ER0 A;  2X4J A;  2XI9 A;  3V8K A;  4F7U E;  1YJW T;  1ZBX A;  4LE9 A;  5FRO A;  2Y4Y A;  2DFU A;  1ZBJ A;  3REA B;  4JS4 A;  2K5L A;  1VQN T;  3LGF A;  4JPB W;  1Y57 A;  4GY5 A;  3RKX A;  2CUD A;  4RTW A;  5KYX A;  1W1F A;  2AK5 A;  3JCM W;  4KBM B;  3G71 A;  2LP5 A;  1FMK A;  3QZ9 B;  2JXB A;  3KUF A;  1G5V A;  4R0K A;  2YRD A;  1SRL A;  4KRT A;  1W70 A;  1TU0 B;  2KBT A;  2FRW A;  4J9F A;  2IIM A;  2YWW A;  1VQO A;  3H0H A;  3E19 A;  4HXJ A;  2DBK A;  1VQK T;  2XDP A;  2ZPF B;  2CDT A;  4M75 A;  4JRP A;  4LUD A;  3ASK A;  1IHW A;  1FWZ A;  4JJN K;  3SHW A;  5GMK j;  1VQ6 A;  3CCQ A;  2FG0 A;  4EIK A;  3GOX A;  2BZ8 A;  5J26 A;  3QPH A;  4KGX B;  4PJO G;  2JOY A;  2OTJ A;  2RJE A;  1M2V B;  1UUE A;  2J6O A;  2O31 A;  2DL4 A;  1VQ9 A;  2RHY A;  2XD0 A;  2XG8 D;  4K11 A;  1SF9 A;  2F5T X;  2VYT A;  1AHJ B;  3QJ6 A;  3I5R A;  2MWO A;  2RMO A;  2GTJ A;  2OAW A;  3RIR A;  3LX7 A;  2RQW A;  2RA2 A;  3J80 E;  2D0N A;  1GRI A;  2DVJ A;  2D9T A;  1MMN A;  2JM8 A;  3CC4 T;  2DYI A;  1NZ9 A;  4QQD A;  2FO0 A;  4PL6 A;  2DD5 A;  1T0J A;  2VC8 A;  1TS9 A;  4IIO A;  1VQ4 Q;  4M77 B;  1UB4 A;  3RDV A;  2P4T A;  1SPK A;  2A08 A;  3OYY A;  4M77 D;  1I07 A;  2R58 A;  2VB6 A;  1Q82 C;  2RQT A;  3I55 A;  2E5K A;  2IG0 A;  2YLC A;  3M4G A;  4M77 F;  2RD1 A;  2GFA A;  1UG1 A;  4PJO C;  2QXF A;  3H41 A;  1UGV A;  2NUP A;  1IGQ A;  3GF5 A;  3OBY A;  1RL2 A;  1K9M U;  5LJ3 e;  2X3X D;  2KDS A;  1UJ0 A;  2K2V A;  2EAY A;  2SRC A;  3X24 B;  2Y4X A;  3FJP A;  3UPU A;  4CC2 A;  5CK9 A;  4PJO E;  4N4I A;  1I8F A;  4EDU A;  5IHI A;  3L2Q A;  3S6W A;  3E1S A;  3BDU A;  1NM7 A;  4M77 A;  1GCQ C;  1X75 C;  5IN1 A;  4CI0 C;  3CD6 T;  3JB9 I;  4RCC A;  2FL7 A;  4DOW A;  1PC0 A;  3MKD A;  1VYT A;  2VGM A;  2MMP A;  5FRM A;  1IRE B;  1VQ4 T;  2AKL A;  1N27 A;  5GAO r;  1K0X A;  3SWN A;  1S72 A;  3CCE Q;  4DBQ A;  3CCM T;  4BDZ A;  3EGU A;  2DX1 A;  5D6W A;  2L0A A;  5GMK h;  2O9S A;  3L2R A;  2J05 A;  1WXB A;  2CGH A;  2MCN A;  4F14 A;  5GAN 5;  4RCB A;  3VU3 C;  2V8J A;  2K3Y A;  2QQ9 A;  3QXE B;  2LDM A;  2DTI A;  2G6F X;  2QI2 A;  5LJ5 f;  4LDX A;  2EQU A;  2F69 A;  3V8L A;  2HAX A;  3L1A A;  4OVA A;  4EMK C;  2K3B A;  2GQV A;  3LW5 E;  3I56 A;  3M58 A;  3CCS Q;  3PGG A;  2EYQ A;  4XTV A;  5D7U A;  4E7Z A;  2GFU A;  1U06 A;  1VQP Q;  1JBM A;  2QQR A;  1A0N B;  1EX4 A;  4TVR A;  2PTK A;  1K8A R;  3M0Q A;  3DLM A;  3OS0 A;  2BIV A;  2K3X A;  4KUL A;  3E2U A;  5GAM d;  2KK4 A;  1WJR A;  3MP1 A;  2KT8 A;  5A0D A;  2EGC A;  4QKU A;  1M90 R;  2A0F B;  3OMC A;  1WYX A;  3ME9 A;  2DF6 A;  3JCM d;  4HKE A;  2LJ3 A;  3CCE T;  3G4S Q;  4ZTF A;  1K8A U;  5HCK A;  3V7C A;  2GGR A;  3RMQ A;  1LCK A;  1SKU B;  3TU4 K;  3M59 A;  1B07 A;  4PFP A;  2XDB A;  2WSC E;  2ECZ A;  3VRZ A;  3L2W A;  3HRT A;  1RUW A;  1OYX A;  4M7A E;  2J06 A;  4ZGD B;  2M02 A;  3AT1 B;  2FRY A;  3E9G A;  3RBB B;  1M90 U;  1PSF A;  3OS2 A;  4XU1 A;  2NWM A;  1C6V X;  4N0A A;  1H8K A;  4JRQ A;  4C5G A;  2FYK A;  1UGS B;  5FWB A;  4DBH A;  3CCS T;  1I81 A;  3QWY A;  1SEM A;  2JTE A;  4A4K A;  1OI1 A;  2JTM A;  1PWT A;  2VKN A;  3MP8 A;  4WF2 A;  2WSF E;  3HHT B;  4IUP A;  3IQL A;  2ESW A;  2RI5 A;  4F17 A;  1W2B S;  1KIK A;  4BAC A;  1GFC A;  4E6R A;  4C0D C;  5GAO m;  4LNP A;  2F2X A;  4BE0 A;  3OSS C;  5GAM j;  2P0K A;  2JMC A;  1FMW A;  2LJ1 A;  5CR2 A;  3FIF A;  2L8D A;  1JB0 E;  7AT1 B;  2LT4 A;  3G4S T;  3CPW S;  4AMC A;  1FX7 A;  4XTX A;  1ZA1 B;  4M7A A;  3P8B B;  4JJC A;  4X34 A;  3HL8 A;  3R6O A;  1VIE A;  5D6Y A;  4NS5 A;  3CPF A;  6AT1 B;  1YI2 A;  1IGU A;  4V2S A;  1BI2 A;  4DQ2 A;  3CCL A;  1U8R A;  4M7D B;  5LJ5 g;  2DE0 X;  2EJF A;  4FL6 A;  3OS5 A;  5ECA A;  1VQM Q;  1VQ8 A;  1WI7 A;  1YJ9 A;  4HT9 A;  2IVW A;  3CC7 T;  2LRQ A;  1UE9 A;  3VS1 A;  3AHU A;  1LVK A;  2DZ9 A;  5C6S A;  4M7D F;  3S3O A;  2CZ7 B;  2NLU A;  1M90 C;  3QWX X;  4PFO A;  5D6X A;  3UT1 A;  4KGV B;  2CH4 W;  2LMJ A;  4L59 A;  4OMM A;  4VUB A;  1WZO A;  4J6X A;  3J81 E;  2GTO A;  1OU8 A;  2F1L A;  5IH2 A;  2SEM A;  4HCC A;  1NEB A;  4QVD A;  4JDS A;  1W2B P;  4Q5W A;  1QWF A;  3PE0 A;  2B86 A;  1Q81 R;  5LJ5 e;  4DA4 A;  4M7D A;  2YLB A;  1TSF A;  1GBR A;  2LQ8 A;  3LWH A;  3E9F A;  1BU1 A;  1OX9 A;  3VKI A;  5CVI A;  4D6W A;  2DXT A;  1N9S A;  2VAS A;  4BUG A;  3EG9 A;  3CPW P;  4JRI A;  4EMG A;  2HQE A;  5DM7 R;  4F16 A;  4FU6 A;  3OYC A;  1PHT A;  4N4G A;  4A54 A;  3RR6 A;  1VQM T;  2E70 A;  3MHX A;  4M78 B;  1M3A A;  2ZPG B;  1Q81 U;  1V1C A;  4JJB A;  1WPY A;  4C92 G;  2LCS A;  4LDW A;  1PNJ A;  4J5Y A;  2KY9 A;  3PMT A;  3TEE A;  2K6D A;  1T0H A;  3EHR A;  5GAN h;  2EYX A;  3BE3 A;  2LNV A;  4FSS A;  4M78 F;  3SD4 A;  1K1Z A;  3FLG A;  1KHC A;  2JM9 A;  2M51 A;  1YJN T;  2LQN A;  4EPC A;  1M8V A;  2QAS A;  1H92 A;  2QEX T;  1YIJ A;  3LLR A;  1HYO A;  3U23 A;  5GAM h;  4HVV A;  2PNI A;  2VUB A;  2LC4 A;  3VRY A;  5FRN A;  3CCR Q;  5FW9 A;  2D1X A;  2E6Z A;  1WHG A;  1D0Z A;  3JCM h;  2V1R A;  3OYF A;  3A8H B;  4FT4 A;  2V26 A;  1UGP B;  4PFZ A;  2AZV A;  1JXO A;  4J9B A;  3CBM A;  4PJJ A;  2OTL Q;  1IB8 A;  2YXY A;  1YN8 A;  4Y28 E;  2J6F A;  2XU8 A;  1PD0 A;  4M78 A;  5CKE A;  3L2U A;  3LYI A;  1YCS B;  2HSP A;  3G71 T;  4FW1 A;  5CKF A;  1YHQ A;  2DXC A;  1M1K R;  2C0T A;  3OMG A;  1N6A A;  3A8L B;  4C5H A;  2QDL A;  4C92 C;  8AT1 B;  2CSI A;  3G6E A;  4XU0 A;  5L8R E;  2CUB A;  2Y90 A;  1VQK Q;  1KQ1 A;  1QMC A;  2E12 A;  3OYI A;  2X35 A;  4ORZ A;  4MDW A;  4KUI A;  1AZG B;  2JN0 A;  3HSB A;  4Z02 A;  1D3B B;  1SG5 A;  3CBP A;  3CMA A;  2C06 A;  1M1G A;  5FU7 C;  4Y91 A;  3EFR A;  1MV0 B;  4M75 B;  4E2F B;  2LX7 A;  4CC3 A;  2RM4 A;  3EGX B;  1Q81 C;  2BZY A;  4BY6 B;  2ZAE A;  1YIT A;  4OF1 A;  3QSU A;  3GLX A;  4RMO A;  2OTJ T;  4M75 D;  4B9W A;  1NPP A;  2EWN A;  2PVD B;  5CCA A;  3CCR T;  4MML A;  1VQ9 T;  1M30 A;  2VVK A;  1S1N A;  2AZS A;  4NL2 A;  1HJD A;  2HBP A;  2MF2 A;  1MNE A;  1GBQ A;  2KE9 A;  1M3B A;  2JVV A;  4M75 F;  1JRI A;  2W0Z A;  2DNU A;  5GMK l;  2OAU A;  2E3I A;  4LDU A;  1QQJ A;  1WHL A;  1ZSZ C;  2X4Y A;  1T3L A;  2OTL T;  2M0O A;  1TOV A;  4F7U B;  4J6Y A;  1IZ6 A;  1ZLM A;  2DTH A;  1OV3 A;  3EG3 A;  5M9O A;  3CC4 Q;  4AG2 C;  1Q82 U;  1OQK A;  1UEC A;  2DL3 A;  4F7U F;  2RHX A;  1YCY A;  2DET A;  4M77 G;  2L3P A;  1H64 1;  3CCU Q;  2CKK A;  3A8O B;  1WX6 A;  4XTU A;  1D3B A;  1AZE A;  3EFO B;  3CME Q;  2QQA A;  1QLY A;  3M0T A;  3EGX A;  4J7F A;  1WJS A;  2RB6 A;  4PNO A;  4ZGE B;  4AFZ C;  3OYG A;  1O75 A;  3X28 B;  2EVR A;  1OUL A;  1WDX A;  2B8A A;  3UDC A;  1VQ5 A;  4B9X A;  4C5I A;  1WQW A;  1UJY A;  2QTV A;  2DIG A;  2QQB A;  2ATC B;  2DZC A;  1UHF A;  2FPE A;  1KFZ A;  3CEY A;  3TRE A;  2HBW A;  2K9G A;  4JRK A;  3CCV A;  4HA8 A;  1Q86 R;  4F7U A;  2M1H A;  1Y0M A;  2VXE A;  2D8J A;  4FYX B;  1NJI R;  3SB2 A;  2E5Q A;  2EW3 A;  2KXC A;  2NUP B;  2RQV A;  4LDY A;  4OMQ A;  1JQQ A;  3QDF A;  1M1K C;  1H3Z A;  5LJ3 h;  2KNB B;  1AEY A;  1NBE B;  1XOV A;  2BE9 B;  3KFV A;  3EFO A;  3X25 B;  2EKH A;  3CD6 Q;  4J9H A;  4NL3 A;  4L6V 5;  1WHH A;  2CP7 A;  4J83 A;  5GMK i;  1YJW A;  3HPW A;  1NJI U;  2P4R A;  3JCM b;  3CCU T;  2AHJ B;  3M9Q A;  4XQ3 A;  1J3T A;  3CME T;  1S72 T;  3REB B;  3CCM Q;  2W10 A;  5KE3 A;  2XID A;  3THK A;  3LGL A;  1Y96 B;  2QA4 A;  4E47 A;  2E4H A;  5CIU A;  1YP5 A;  4E7H A;  3SWN B;  2VV5 A;  2HZY A;  3G7Z A;  4RKU E;  1K73 R;  1QCF A;  5LJ5 d;  4XTZ A;  3M57 A;  1YBY A;  4MMK A;  4PKC C;  1VUB A;  2I2L A;  3NTK A;  4RTU A;  1VQL A;  2K5F A;  1RAB B;  5KH6 A;  1LNX A;  3VS3 A;  5I2S A;  1RLP C;  3LWI A;  3H0F A;  4X9D A;  4LD9 K;  4JLG A;  2GQI A;  1C0M A;  2R57 A;  3VS7 A;  4FIB A;  4PJO B;  2K79 A;  2P0P A;  1D1C A;  2CP3 A;  5KCH A;  2C0I A;  4NOY A;  1BI3 A;  4JLI A;  2COZ A;  3RNJ A;  1Y96 A;  4OB0 B;  1OU9 A;  4PJO F;  2JS0 A;  1WHJ A;  3URG A;  1D0X A;  5GJV B;  4BE2 A;  2YDL A;  2HL5 C;  2NUT B;  3JB9 H;  2LZ6 B;  4ZGJ B;  3M56 A;  1B34 B;  1I0C A;  3FC3 A;  2PQW A;  3HRU A;  1QVP A;  3GNG A;  5A2Q E;  2YUQ A;  1Q86 C;  1AWX A;  2YUN A;  3M55 A;  2JT4 A;  1NJI C;  1WJQ A;  1UGR B;  1WQ7 A;  2RI3 A;  4AFQ C;  5GAN 4;  1LOJ A;  4OB1 B;  1AOJ A;  5LJ5 j;  2EBP A;  1SSH A;  3S3M A;  3WVD B;  4PJO A;  1RLQ C;  1QP2 A;  2HCK A;  1RI9 A;  4C0Z A;  4ELZ C;  5DLQ E;  5IXB A;  1JU5 C;  1X6B A;  3UF4 A;  2DRM A;  3PIO A;  2FVU A;  3BDL A;  2NUT A;  2KR3 A;  5I2M A;  4EMK B;  1G8X A;  3JAM E;  4RTV A;  3KBG A;  2CP5 A;  3BFM A;  1B34 A;  5HKC A;  3RER A;  2RPN A;  4C8Q G;  5CQY A;  1TWB A;  5DLO A;  2HQX A;  1X6G A;  1GCQ A;  5GAO q;  4QW2 A;  3OYN A;  1K73 C;  4CC7 A;  1VQ7 Q;  4OP0 A;  2CZ1 B;  2LTO A;  2YT6 A;  1M2O A;  1KC8 R;  2CS7 A;  2G3R A;  5I11 A;  1X43 A;  3O8V A;  5GAO p;  1YFN A;  4Z8A A;  1VQ4 A;  4IIM A;  2M0Y A;  2QGG A;  3CC2 Q;  3ULR B;  4O5V A;  4M7A B;  4BI3 A;  2DL5 A;  1IO6 A;  3ZEH A;  1D0Y A;  4IUV A;  5LL6 S;  3JB9 G;  3CC7 Q;  4M7A D;  2EYZ A;  1CKB A;  1CKA A;  5IAY A;  4EMK A;  4M7A F;  1KC8 U;  1AWO A;  5KYW B;  1GCP A;  2X51 A;  1SHG A;  3M54 A;  3OA6 A;  1N9R A;  4BDY A;  2CH4 A;  4Z88 A;  2L3S A;  4ZTJ A;  4C8Q C;  2KEA A;  1QKW A;  4KT0 E;  4BI8 B;  1QVF A;  2ZGW A;  5GAO n;  1B3Q A;  3H0I A;  5CAI A;  2CZ0 B;  2XHC A;  3OYB A;  3OYD A;  1M27 C;  2DIL A;  5CKB A;  1WIE A;  2CT4 A;  4XK8 E;  2MWP A;  2LT1 A;  3PFS A;  1VQ7 T;  2MYS A;  1JEG A;  2JMA A;  4C8Q E;  1JO8 A;  1XQH A;  3FDR A;  3MPU B;  1BK2 A;  2HKN A;  2YRC A;  3JSC A;  4HCK A;  4C0D B;  4JS5 A;  1WHK A;  2R5A A;  3OQ5 A;  5FLX E;  4ME7 A;  3CCE A;  2MOX A;  3S3N A;  3CC2 T;  3HFN A;  3OBW A;  1GFD A;  5LJ5 h;  5CKH A;  4MDX A;  3EH2 A;  3I35 A;  1W6X A;  5KYW A;  4LN2 A;  3KXT A;  2F2V A;  4M7D D;  1B7T A;  1NLP C;  4JZ4 A;  5EG2 A;  1W4S A;  1PD1 A;  3QII A;  1BYM A;  3EG9 B;  1TUD A;  2EIF A;  1KQS A;  1PRL C;  2KRN A;  4CC4 B;  3WVE B;  1WFW A;  2BZX A;  1U5S A;  2CZ6 B;  1UHC A;  1YJN Q;  5FU6 C;  1V76 A;  2M16 A;  2D0Q B;  5J39 A;  2PVO B;  5CQX A;  3JCM P;  2QEX Q;  1AWW A;  2AIR B;  1VQP A;  1PSE A;  4AFU C;  5HK0 A;  1KC8 C;  3C4S A;  1P92 A;  3J7A F;  3PT9 A;  1WNL A;  4OMF B;  1MMD A;  2RJD A;  3VS6 A;  2KAF A;  2H8H A;  2QTX A;  2KVQ G;  4E7L A;  1R0C B;  5A0G A;  2A28 A;  4XTW A;  1NLO C;  3MJX A;  3PTA A;  1Z9Z A;  2WAC A;  3SDZ A;  4FM4 B;  2EGA A;  1BIA A;  1QKX A;  2J7I A;  2V8I A;  3G4S A;  1UFF A;  3G71 Q;  2HKQ B;  4BE1 A;  1YHQ T;  5FWC A;  2KI7 A;  1LJO A;  3MEU A;  2A37 A;  3PNW C;  1VQO Q;  4J9C A;  3OYJ A;  3L42 A;  1FMV A;  1WHM A;  1ZA2 B;  4WCI A;  1JJ2 S;  3OYM A;  2FB7 A;  4OGE A;  2GNC A;  4M78 D;  2DMO A;  2DRK A;  2COY A;  3D7S B;  1OZ2 A;  3V7S A;  1D1B A;  4RTY A;  4QVC A;  1VQ6 Q;  3CCQ Q;  4JUV A;  3TQ7 P;  4M75 G;  3CMA T;  2CRE A;  2E10 A;  1BI0 A;  2YRV A;  1KSW A;  1SSF A;  2PVG B;  2EQI A;  2FZG B;  1YIT T;  1VA7 A;  2OTJ Q;  1QVG A;  3X26 B;  5GAN g;  4YTL A;  1VQ9 Q;  4KH0 B;  2LJ0 A;  2XK0 A;  2OX7 A;  2PZ1 A;  3FJ5 A;  4ANJ A;  5KYY B;  1K76 A;  4XU2 A;  1OPL A;  3H9N A;  2QG9 B;  3EG0 A;  1IXD A;  4F7U G;  1NEG A;  3QKJ A;  4PJL A;  2DTO A;  3LH5 A;  4D8D A;  3VYH B;  2DKG A;  1RAI B;  2DXU A;  3N5B B;  3FRN A;  4OB3 B;  1YWO A;  1QW1 A;  1TTH B;  5CKD A;  3MEA A;  4J6W A;  1QP3 A;  4GLK A;  4X1V A;  1GL5 A;  3QZ5 B;  3OY9 A;  4JJD A;  3GBQ A;  1WXT A;  1VQO T;  3OYK A;  5A0L A;  2KRM A;  3M53 A; 
#chains in the Genus database with same CATH homology
 2ABL A;  1YWP A;  3M0Q A;  1FYN A;  3M0U A;  2P4R A;  4ZNX A;  1E6G A;  1K9A A;  1NYF A;  1J3T A;  3REB B;  1TG0 A;  2RNA A;  2W10 A;  4Z89 A;  2KT8 A;  3THK A;  2FEI A;  2EGC A;  5IHK A;  1Z9Q A;  3UA7 A;  1WYX A;  1N5Z A;  2DF6 A;  3PVQ A;  3UAT A;  1YP5 A;  1PKT A;  2LJ3 A;  4DEY A;  1X2K A;  5HCK A;  2A36 A;  4OMO A;  3PVL A;  1QCF A;  2GGR A;  1LCK A;  3CQT A;  4LUE A;  1B07 A;  2XMF A;  3VS2 A;  1CSK A;  2ECZ A;  1K0S A;  3VRZ A;  3EG2 A;  4J9G A;  1RUW A;  1OOT A;  3I9Q A;  2VWF A;  2J06 A;  2FRY A;  4RTU A;  2DJQ A;  2KRS A;  3RBB B;  2DL7 A;  1KJW A;  3VS3 A;  1RLP C;  2NWM A;  3H0F A;  1H8K A;  2BTT A;  2GQI A;  5FWB A;  3QWY A;  3VS7 A;  2L3Q A;  1ZX6 A;  2K79 A;  2DLP A;  1SEM A;  4OMP A;  2JTE A;  2C0I A;  1M3C A;  2L2P A;  1PWT A;  2VKN A;  4GBQ A;  1OEB A;  2O9V A;  2HDA A;  3RNJ A;  3IQL A;  2RN8 A;  2ESW A;  2FPD A;  4M4Z A;  2JS0 A;  4F17 A;  1PRM C;  4J9D A;  1KIK A;  5GJV B;  1ARK A;  1GFC A;  1ZUU A;  2YDL A;  4E6R A;  2LZ6 B;  1ZSG A;  4LNP A;  5I22 A;  2F2X A;  3M0P A;  1I0C A;  2JMC A;  4QT7 A;  2LJ1 A;  3M0S A;  2YUQ A;  1AWX A;  2YUN A;  2JT4 A;  3NHN A;  3M0R A;  4HVU A;  3A98 A;  4AFQ C;  2EYY A;  4JJC A;  1AOJ A;  5L23 A;  2EBP A;  3UA6 A;  1SSH A;  1G2B A;  2FPF A;  2HEQ A;  4D8K A;  1RLQ C;  2HCK A;  1RI9 A;  2CT3 A;  2DE0 X;  2KT1 A;  5IXB A;  5ECA A;  1JU5 C;  4AG1 C;  1X6B A;  1WI7 A;  3UF4 A;  2KYB A;  2DRM A;  1UE9 A;  4Y92 A;  3VS1 A;  1HD3 A;  2YUP A;  2KR3 A;  2LNH B;  1EFN A;  1YNZ A;  1SRM A;  5EC7 A;  1TUC A;  4RTV A;  2RPN A;  3QWX X;  2EGE A;  1X69 A;  1UDL A;  2CH4 W;  1X6G A;  2LMJ A;  4OMM A;  1GCQ A;  2DM1 A;  1WA7 A;  2GTO A;  3NPF A;  4CC7 A;  1JXM A;  2RF0 A;  1M8M A;  5IH2 A;  2AKK A;  3C0C A;  2YT6 A;  2OJ2 A;  2SEM A;  2YUO A;  1NEB A;  1H3H A;  2GBQ A;  5I11 A;  1X43 A;  1HSQ A;  4Z8A A;  2D8H A;  1QWF A;  3PE0 A;  4IIM A;  2B86 A;  2X3W D;  2ROT A;  2M0Y A;  3JV3 A;  3ULR B;  1GBR A;  1WLP B;  1BU1 A;  2DL5 A;  4OML A;  1IO6 A;  2EYW A;  2EPD A;  2EYZ A;  1CKB A;  1CKA A;  4LE9 A;  1BB9 A;  4JZ3 A;  3EHQ A;  4F16 A;  1AWJ A;  1ZBJ A;  1PHT A;  3REA B;  1PKS A;  2ED0 A;  1AWO A;  2OI3 A;  4JPB W;  1Y57 A;  1GCP A;  2CUD A;  4RTW A;  1SHG A;  1M3A A;  1W1F A;  2AK5 A;  2O88 A;  1V1C A;  4JJB A;  2LP5 A;  1FMK A;  2LCS A;  2CH4 A;  4Z88 A;  2JXB A;  1BBZ A;  2L3S A;  1PNJ A;  4RUG A;  2J6K A;  5IXF A;  4R0K A;  1SRL A;  1T0H A;  1T3S A;  1W70 A;  2ENM A;  2K6D A;  3EHR A;  4KRT A;  2KBT A;  2FRW A;  4J9F A;  2IIM A;  2KEA A;  4DEX A;  1QKW A;  2EYX A;  3H0H A;  4RTX A;  4ESR A;  4FSS A;  4HXJ A;  1K1Z A;  1B3Q A;  2JM9 A;  2M51 A;  2DBK A;  2ROL A;  2LQN A;  3H0I A;  1WXU A;  4RTT A;  2CDT A;  1M27 C;  2DIL A;  1WIE A;  4LUD A;  1H92 A;  3TSW A;  2CT4 A;  3SHW A;  2K2M A;  3U23 A;  2FG0 A;  1JEG A;  3TSZ A;  4HVV A;  2C0O A;  1OPK A;  2PNI A;  2JMA A;  3VRY A;  4EIK A;  5FW9 A;  1ZUK A;  3VS5 A;  2JW4 A;  1ABO A;  2BZ8 A;  2KXD A;  2YSQ A;  1JO8 A;  2ED1 A;  2D1X A;  4GLM A;  2RQU A;  2V1R A;  4OMN A;  1BK2 A;  4HCK A;  2AZV A;  1JXO A;  1UUE A;  4J9B A;  2J6O A;  2O31 A;  2DL4 A;  2MOX A;  1GFD A;  4K11 A;  3ZL7 C;  3I35 A;  1G83 A;  1YN8 A;  1W6X A;  2J6F A;  4LN2 A;  2F2V A;  3I5R A;  1AVZ C;  2RMO A;  2GTJ A;  2OAW A;  1NLP C;  2I0N A;  4JZ4 A;  1YCS B;  2HSP A;  2RQW A;  3NGP A;  1TUD A;  2C0T A;  1PRL C;  2DL8 A;  2D0N A;  1GRI A;  2DVJ A;  3I5S A;  2JM8 A;  2KRN A;  2QDL A;  4J9E A;  1WFW A;  4CC4 B;  2CSI A;  2BZX A;  1U5S A;  2CUB A;  1UHC A;  1E6H A;  2FO0 A;  1T0J A;  4ORZ A;  4IIO A;  1AWW A;  2RQR A;  1AZG B;  1VYU A;  2CSQ A;  2DA9 A;  4AFU C;  1SHF A;  1SPK A;  4A63 B;  2A08 A;  1QWE A;  3EG1 A;  3VS4 A;  2LQW A;  1I07 A;  1MV0 B;  3VS6 A;  2LX7 A;  2H8H A;  4CC3 A;  2RQT A;  2E5K A;  3TVT A;  2BZY A;  1I1J A;  2A28 A;  1NLO C;  1U3O A;  1M30 A;  1UG1 A;  2VVK A;  1S1N A;  1Z9Z A;  2AZS A;  4J9I A;  1HJD A;  1NG2 A;  1GBQ A;  2KE9 A;  1M3B A;  3H41 A;  1K4U S;  2W0Z A;  1UGV A;  2EGA A;  2DNU A;  1UTI A;  1QKX A;  2J7I A;  1ABQ A;  1X27 A;  1UFF A;  1T3L A;  2JS2 A;  2X3X D;  1UJ0 A;  1ZLM A;  2SRC A;  5FWC A;  1OV3 A;  3EG3 A;  2MIO A;  3O5Z A;  2A37 A;  4J9C A;  4AG2 C;  4CC2 A;  3NMZ C;  5IHN A;  1VYV A;  4WCI A;  3VS0 A;  1UEC A;  2DL3 A;  5IHI A;  1MUZ A;  1AD5 A;  2GNC A;  2DMO A;  2DRK A;  2L3P A;  4AFS C;  2DBM A;  1NM7 A;  4RTY A;  1GCQ C;  1WX6 A;  2KYM A;  1AZE A;  2KRO A;  4RTZ A;  2CRE A;  1VYT A;  1QLY A;  3M0T A;  1MV3 A;  1KSW A;  2EQI A;  2AKL A;  4AFZ C;  1VA7 A;  4HVW A;  1K0X A;  2EVR A;  1WDX A;  1X2Q A;  1UJY A;  2LJ0 A;  3EGU A;  2V1Q A;  2DX1 A;  3SEM A;  2L0A A;  2O9S A;  2NUZ A;  2PZ1 A;  3FJ5 A;  1UHF A;  2K7A A;  2FPE A;  2J05 A;  1WXB A;  1KFZ A;  1K76 A;  1OPL A;  2MCN A;  4F14 A;  3EG0 A;  1NEG A;  2HBW A;  1NYG A;  2K9G A;  3LH5 A;  1Y0M A;  4D8D A;  1E7O A;  2D8J A;  2G6F X;  5GJW B;  2EW3 A;  1YWO A;  2DYB A;  3R6N A;  2KXC A;  2K3B A;  2RQV A;  4OMQ A;  1JQQ A;  4X1V A;  2KGT A;  2KNB B;  1GL5 A;  1AEY A;  2O2O A;  4JJD A;  1XOV A;  3GBQ A;  1WXT A;  3KFV A;  1ZUY A;  1U06 A;  1A0N B;  2F2W A;  2EKH A;  4J9H A;  2KRM A;  2PTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...