3SWNB

Structure of the lsm657 complex: an assembly intermediate of the lsm1 7 and lsm2 8 rings
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
SSPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVNGKKTNVYGDAFIRGNNVLYVSAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm7
publication title Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 15
structure length 71
sequence length 71
chains with identical sequence E, Q, T
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3swnB00
5GAMj 1Y96B 4C92B 2DXUA 4X9DA 5LJ3j 4N0AC 4M7AC 1YCYA 4M77D 2YHTA 3JCMP 2RA2A 5LJ5g 1WQWA 2RB6A 2EWNA 3RIRA 3HSBA 4M75D 5GANf 5GAN8 5GAN4 3QSUA 2HNIA 4M77F 4N0AA 2E64A 2DXTA 3V7CA 3V8LA 4M78C 4C8QE 4M7AA 4M7DE 1WQ7A 3QUIA 4M78G 4NL3A 4PJOE 4C8QG 4M75F 5GAMd 4M7DG 3EFSA 3L2ZA 5GAMe 4F7UA 2I2LA 3JCMd 4C92D 3JCMe 4PJOG 2DVEA 5LJ5d 4MMKA 5LJ3e 4M78A 3BW1A 4XTZA 1JRIA 1WNLA 4C92F 1LOJA 3AHUA 4J6WA 3SWNB 2E41A 2DEQA 1M5Q1 1MGQA 2YLCA 4JUVA 2VXEA 1D3BB 5LJ5j 4M7AE 1I81A 2RM4A 2VXFA 4JLIA 3JCMb 1I8FA 3JCMW 4HT9A 4M77C 3RESA 1B34B 4EMKA 3QHSA 5GANh 4M7AG 2JN0A 2VC8A 4NL2A 4F7UE 3HFNA 4M75C 1KQ2A 5GMKh 4M78E 4WF2A 3V8JA 4F7UG 4M77A 2DTOA 3V8KA 3BY7A 2DKGA 3EFRA 5GAOm 4XU1A 5GANg 4HA8A 4M75A 4J6YA 2DZCA 3RKWA 3RUXA 2E1HA 2EJ9A 2FB7A 3FIFA 4C92C 5LJ5e 2DZ9A 5LJ3d 4C8QB 5GAOn 4M7DB 3QO3A 4EMGA 4JRKA 5GAMf 4PJOB 2DJZA 4V2SA 3JCMf 2E65A 3JCMQ 1Y96A 4C92A 5LJ3f 4J6XA 5I21A 5GAOr 4XTUA 4RCBA 3JCMc 2E10A 4Y91A 4XTYA 4M77E 3JB9D 4EMKB 2Y90A 2RD1A 4JRIA 1KQ1A 5GAN3 4M77G 5GAN6 1HK9A 4M75E 5CAIA 3JB9F 4C8QD 5GAOl 4EMHA 4M7DD 4M7AB 5GAOp 5GANj 3BFMA 5DY9A 1LNXA 4J5YA 4M75G 1N9SA 3INZA 3FB9A 3SWNC 3V7RA 3JCMX 1WPYA 2EJFA 1JBMA 4C8QF 4QVCA 4C92E 4F7UB 5GMKj 3HFOA 3JCMJ 4RCCA 2EJGA 2QTXA 3GIBA 1BIAA 4PJOF 4DQ2A 5GAMh 2EAYA 4M78B 3JCMh 4C92G 3JB9I 3JCMV 4M7DF 4X9CA 4A54A 3SWNA 5LJ3h 1TH7A 4XTXA 5GMKm 5LJ5f 1HXDA 1I4K1 2CGHA 2FYKA 2ZGWA 4QVDA 1D3BA 3JB9J 3VU3C 5GANd 4A53A 5GANe 4OP0A 1I5LA 5GAMg 3RERA 4M7AD 1B34A 3JCMg 1M8VA 5GAN5 3M4GA 4XU3A 5GAOq 3V7SA 1BIBA 5LJ3g 1U1SA 3JB9G 2DTIA 5GMKi 5GMKe 4HT8A 4M7AF 4NOYA 1U1TA 1X01A 4XU2A 4M78D 4XTVA 3RKXA 4C8QC 3BDUA 4MMLA 3JB9H 4M7DC 4PNOA 3SB2A 1N9RA 3PGGA 4M77B 4F7UF 4PJOC 4PJOD 2YLBA 4M78F 1LJOA 3RKYA 3FJPA 4M75B 4XU0A 4C8QA 5GAN2 5GAN7 4M7DA 5GMKl 3L1AA 4PJOA 1H641 2DTHA 4XQ3A 4EMKC 5LJ5h 4XTWA 2K57A
chains in the Genus database with same CATH superfamily
3FDRA 1YI2Q 4J9BA 5LJ3j 2RA2A 5LJ5g 1VQ4T 5D6XA 1GCQC 5GAN8 3KBGA 9ATCB 1M3CA 2D0NA 3OYGA 1X6GA 1A0NB 4JZ4A 4EIKA 3X20B 2VUBA 2KRNA 1QVFA 4E7SA 3OYHA 1OU9A 1OYXA 2JZ2A 1KIKA 2EKOA 2JN0A 2VC8A 2AK5A 4RTZA 1KFZA 3DLMA 2H8HA 4M75C 5AYFA 4AFZC 2MI6A 2O4XA 3TCJA 2NYSA 1VQ8Q 3EFRA 2W0ZA 2RPNA 4HA8A 1TSFA 1VQMT 4KRTA 2E5KA 2A37A 4C8QB 5A0GA 4KUIA 3S3OA 3M9QA 2L3RA 2ZCFB 1BI0A 4F16A 2EKHA 1YHQQ 2YWWA 3JCMc 1ZUYA 2E10A 5EC7A 1CKBA 3CCSQ 2CP5A 4JRIA 2LCCA 1OZ3A 4AG2C 1HK9A 3JB9F 4C8QD 1QVFS 1IRXA 1MNDA 2ZPEB 3BFMA 1JBMA 1VYTA 3HFOA 3GPLA 1BIAA 4BDZA 3HRSA 3CEYA 1Q86R 4IIOA 1VQLA 2XK0A 2RHIA 3CD6Q 1Q81C 1LPLA 2YUNA 2LT4A 4XK8E 4OP0A 2NUPA 1Y57A 1W4SA 3M4GA 4FSXA 2DL7A 4ZGDB 1SRLA 2VV5A 2FEIA 4BI4A 1YP5A 4II1A 5KYXB 2K9GA 3QIIA 4BI8B 2ECZA 3L2QA 1Q82R 1XNIA 1W6XA 2DMOA 3OYBA 2EFIA 3CC2A 4J9EA 1XTDA 3VV0A 4HVUA 2LP5A 5L23A 1K73C 3QSUA 3RNJA 5KYYA 2RI3A 2D8JA 2O2OA 5GAMd 1I07A 2V1QA 4ZNXA 3BW1A 4C5IA 4XTZA 1JRIA 1TUGB 3VKIA 3M0QA 2ZPIB 2E4HA 1RLPC 2VXFA 3KFVA 2MOXA 3NGPA 3QJYA 2XHCA 5C0MA 4MZPA 3I9QA 1KQ2A 4JJBA 4WF2A 4OB0B 4J9HA 2C0TA 5KYUB 2QEXA 1O75A 3OW2S 5LJ5d 3CCQA 3ZEHA 3PVLA 5A2QE 3QO3A 2GNCA 2A36A 3RDVA 2R5AA 2OTLA 1M1KU 2L8DA 1YJ9A 2VVKA 1TUDA 5CKEA 4Z88A 5A0LA 2QA4A 3CBOA 2HKQB 2AZVA 2B86A 1WDXA 2LQ8A 1K9MR 2MYSA 2JS0A 1AD5A 2H3JA 1M1KR 2HMAA 1K8AU 3CC2Q 2IVWA 1OPKA 3EHRA 3QZ9B 1MMAA 2X4XA 3GF5A 3J81E 2QAZA 3FC3A 4OB2B 4BB7A 4XU2A 2DLPA 3NFCA 2D1XA 4HXJA 2J6OA 4M77B 4PJOD 3TSZA 3SFMA 1MMDA 1PHTA 1UGVA 2IIMA 4PJJA 3PIOA 2DTHA 2M0OA 2RMOA 3L42A 2AKKA 1H8KA 4RTYA 1KG1A 3OSSC 1M1GA 4M77D 3S3MA 1RACB 2CUDA 3MHXA 1CKAA 2GCXA 2JTEA 3E19A 3GBQA 5IHIA 3ZFJA 2J7IA 2QEXQ 4M75F 2F2WA 2MPXC 2P84A 4A4KA 2HKNA 1VQKA 3CCQQ 1AWWA 2DL4A 4HKEA 4L5GA 4N4GA 1ZSZA 1KC8C 2D9TA 2KRSA 1QKXA 1YJ9Q 1M2OA 3G71T 3JSCA 4WTOB 3FLGA 2E70A 5CVIA 4R56A 4OMQA 3DLLA 3CC4A 2QA4Q 5FW9A 1OU8A 2DTOA 2QQBA 2RJFA 4FYYB 2YUOA 3CBPA 1TOVA 5GANg 3CQTA 2VYTA 2LCLA 1WXBA 1VQMA 1RADB 3VUZA 5AT1B 3UA6A 4FT4A 2M02A 3LLRA 1FMKA 1TU0B 2ATCB 2KYBA 1YI2T 5FU6B 3FJ5A 3UT1A 1QQJA 5C6SA 2Y4XA 2LQNA 5GAN3 3SHWA 4MZMA 4FYXB 4J83A 1SG5A 1X43A 4M75G 3FB9A 3SWNC 1ARKA 1ZSGA 3TEEA 4QVCA 4A4GA 2QTXA 1MV0B 4AFQC 5GAMh 3HTRA 4FIBA 4OB1B 4KBMB 3OYIA 2MK5A 4AFSC 3M4YA 2E5QA 2ZGWA 3M53A 1D3BA 2FO0A 4X34A 3VU3C 2KSSA 2QGGA 2FZCB 3L2VA 4FW1A 2NUZA 4JJCA 3VS7A 4BY6C 1M9SA 1VQKQ 1VQ8T 1MNEA 4LD6A 3OYKA 3QG1A 1WJRA 2X9HA 4PJOA 2QQ9A 2K4YA 5LJ5h 4XQ3A 2CH4W 3EG3A 1BI2A 1ZHIA 5GAMj 3EG1A 1IGQA 2XD0A 5J26A 1AZGB 4A4FA 2IG0A 1WQWA 4Z02A 3CC4Q 1Q7YR 3V8LA 4M7AA 1IZ6A 4FYVB 4CC7A 4E7JA 3MJXA 5CO7A 4E7IA 3C95A 3CD6T 2JTMA 1H3HA 2YLCA 1ZUKA 2ROTA 5LJ5j 2XICA 1UDLA 2DL5A 2CYZB 4HT9A 1VQNA 2C0OA 3HP9A 4RMOA 4FU6A 4MDXA 3G4SA 3EAEA 2LC4A 4XU1A 4J6YA 4PLIA 3VS6A 2DZ9A 5LJ3d 3MEAA 4BE2A 1UHFA 2LX9A 3JCMf 2L3QA 2XMFA 1RUWA 1KQSP 3JB9D 1WJSA 4FYWB 5IN1A 3M58A 5CKBA 3R6NA 4IKFA 2CP3A 4EMHA 5KE3A 2F5KA 2J6KA 1LNXA 5EG2A 1TWBA 3MCAB 3A5ZB 1VQ7A 3V7RA 2M9UA 2M16A 4C92E 4B9WA 3GIBA 1WHHA 5FU7B 4PJMA 3TQ7P 2PVOB 1K0XA 1M2VB 3CCUA 4ELYC 5GANd 3CC7A 5KYWB 2PQWA 5GMKe 2D8HA 2DVJA 1QLYA 1VYUA 1Q81R 3X25B 3MEUA 4JJNK 2DIQA 1YIJA 3VS5A 2A3LA 2BZ8A 2RH2A 4RUGA 2ROLA 2KDSA 4N0AC 2LZ6B 1VQNQ 1T3SA 4E7KA 1KD1C 2CT4A 1Y0MA 3NMZC 2KE9A 2MF2A 3G4SQ 2RJEA 2WSFE 1YJWA 1MHNA 4PK4A 3I56A 4UC4A 4KULA 2BUDA 2CZ7B 8ATCB 4ZN3A 1NEBA 3OYMA 2YRCA 2COWA 1NLOC 1Y07A 3LW5E 3CC2T 2VXEA 2WACA 3JCMW 4JJDA 3HKSA 1IGUA 1LVKA 2D0QB 1YWPA 4QKUA 2LJ0A 3FEOA 1VQ7Q 3M0SA 1NEGA 2JUFA 4C92C 1X27A 2FB7A 2CH4A 4M4ZA 3OMCA 3CCUQ 2DRKA 1WXUA 4HCKA 3CC7Q 4J9IA 2F5TX 5FRNA 5IXFA 2FG0A 1OI1A 5GJVB 1WZOA 3OY9A 3LX7A 2JMCA 1JU5C 2O9SA 2QEXT 2E6NA 3C0CA 2MWPA 3CCQT 1YWOA 1X69A 1G3SA 2EAYA 1YIJQ 1BKBA 2OTLT 3CCMA 2M1HA 3EH2A 1I4K1 4RTXA 1YJ9T 2K3BA 2DNUA 2IPOB 2YUPA 1D1AA 1RAAB 3MP8A 5GMKi 5J3BA 3I56Q 1W2BA 2QA4T 2MMPA 3THKA 2X4YA 4C0ZA 2ENMA 3PGGA 1X2QA 3EG0A 4ZGEB 2K7AA 4M75B 4ZTJA 4M7DA 1ZBJA 5FRMA 2LNVA 3G1JA 2X4WA 3AT1B 2XDDA 1PG5B 1M1FA 4ATOA 3SDZA 1YHQA 4M75D 3ZBDA 3CCSA 2HSPA 4E7LA 3REAB 2V8IA 1JJ2A 1AVZC 4LUDA 2DD4A 1ZLMA 3P8DA 4IUUA 4LDVA 4F7UA 2F2VA 2K3YA 2OAUA 2DEQA 4OGCA 3N5BB 1W2BS 3CD6A 2G3RA 1C1AA 4D6WA 3GNGA 3RMQA 1QCOA 4KGXB 1GRIA 2F69A 4DOWA 5A0DA 5GANh 3JV3A 3NTIA 3SD4A 1KQSS 4IUVA 4PFOA 1G83A 1VQKT 1ZX6A 1KC8R 5GAOn 3CCMQ 3OYYA 3PT9A 3EGXA 1JJ2S 5LJ3f 2FRWA 5I21A 3PFSA 4XTUA 1QMCA 4XTYA 4JDSA 2LQKA 5HK0A 3CC4T 5FLXE 1WLPB 1Z9QA 2FL7A 2KT8A 5GANj 2KBTA 3H9NA 3E9GA 4OMFB 1M30A 2CZ0B 1K1ZA 2EJFA 1ACMB 3QDFA 3JCMJ 3LWHA 2A08A 2GFAA 1Q86U 1TH7A 4IUTA 2AHJB 2CGHA 2JJ9A 4A53A 1VQ5A 2DA9A 3I35A 4CC3A 1QVGA 1OX9A 1N9RA 1D0YA 3NTHA 3H0FA 1UECA 3OS1A 1G5VA 4R0KA 1QP2A 2GFUA 5M9OA 5GAN7 2ZPFB 1HD3A 1Q82U 3X26B 2JW4A 2DERA 3MEWA 3OS0A 4HVWA 4HVVA 4RG8A 1EZZB 2HAXA 5KCOA 1R0BG 2QGFB 2YSQA 1SF9A 4WCIA 2VGMA 2RO0A 4NL3A 2CUBA 2DILA 3JCMe 1YFNA 4QQ6A 4MMKA 1P92A 2DK3A 4M78A 3OSVA 4C92F 1QVGS 3CXCP 2E3IA 3OYNA 1NJIC 1G3TA 2EYWA 3OW2A 1OULA 2DYIA 1UJYA 2KGTA 2JMAA 4MZTA 4J7FA 3VYHB 3WVEB 1PNJA 1UJ0A 1SSHA 3L2RA 3ME9A 3GOXA 3EGUA 1QVPA 2E1HA 4EDUA 2KRMA 2YXYA 4HCZA 2RQUA 4OVAA 2AKLA 3MP1A 1SPKA 3JCMQ 2DAQA 1CSKA 1PKTA 1VQ5Q 4ME7A 1VA7A 3OBYA 1VQNT 1UGPB 2COYA 2Y90A 3VS0A 1ABOA 2RD1A 1GL5A 1BK2A 3G4ST 1D09B 3VRZA 4JRQA 5DY9A 2FPDA 1ZUUA 4ELZC 3CCEA 1RLQC 3I5RA 1SKUB 3RR6A 4C92G 2E3HA 5CK9A 1K9MU 1GXIE 5KCHA 3KXTA 2MWOA 3RBBB 2KK4A 3CPWP 3H0IA 4LDXA 8AT1B 4XU3A 3F70A 4L6V5 4OGEA 4LDWA 1VOMA 3PMTA 1X2KA 2FRYA 4IUQA 2PNIA 1VQ7T 3META 5DLOA 2K5IA 1GBQA 3A8GB 5CCAA 4C8QA 1H92A 2X35A 3L2UA 3L1AA 2OTJA 1G3YA 5KYNA 4KGVB 4XAXB 1Y96B 3CCUT 2QYZA 1M27C 2FPFA 2L3PA 4BDYA 3CC7T 4IUPA 2YHTA 2EQJA 2EWNA 1YITQ 2Y4YA 5GAN4 4E7ZA 2YDLA 3QUIA 1WJQA 4PJOE 4LDUA 1UUEA 1U3OA 1X75C 1ZSZC 5IHKA 2K2MA 1AHJB 4LDYA 1YIJT 1U8RA 3O5ZA 1NYFA 4J6WA 3SWNB 1KD1R 2C06A 3C12A 1UB4A 2R58A 1MGQA 3WXMB 4M7AE 2RN8A 2O9VA 2BZYA 4OMMA 5HCKA 2O01E 3PE0A 1YJWT 1UGRB 3I56T 2JS2A 3V8JA 3V8KA 3CCEQ 5KYXA 2JOYA 1WXTA 3QWXX 1V29B 5CKFA 4ZTFA 1M3AA 1TXQA 4BY6B 2W10A 4V2SA 1R77A 4FT2A 1S1NA 3ER0A 2KYMA 2EYYA 1WYXA 2HEQA 3CCVA 3CCJQ 3OYLA 2RI2A 2JM8A 3I55A 2QQSA 5GAN6 3H8ZA 3TVTA 1QKWA 4AT1B 4CI0C 2DL3A 1N9SA 4QVZA 1N8RC 2H3EB 2DJQA 3VS2A 2EJGA 4DQ2A 3UPUA 2OTJQ 4X9CA 2F1LA 4J9CA 3M55A 1VQPA 1XJWB 2DL8A 3LH0A 2PVDB 4PLLA 1PM3A 2R57A 4RTWA 3H6ZA 1UGSB 1K9AA 2ZPHB 1E6GA 3CPFA 3SB2A 4PJOC 5KYUA 2V26A 3E9FA 1TTHB 2BZXA 2J06A 4P5NA 2B8AA 3CCMT 4GLMA 1VQOT 1YCSB 2KXCA 2NLUA 1MMGA 1RI9A 4PFZA 5CQXA 2RHZA 5KE2A 4M7AC 3E2UA 1M90U 1GFCA 2XKOC 3RIRA 3CXCS 2P0KA 3V7CA 1Q7YU 4M78G 2LNHB 1AZEA 4FCYA 1T3LA 2KR3A 2DVEA 1Z9ZA 5LJ3e 1N27A 1BCMA 3CPWA 1LOJA 2DO3A 4DOVA 3CCVQ 4Z8AA 5FWCA 1M90R 2DIGA 2C0IA 1YHQT 3I55Q 3NHNA 4NL2A 3CCST 2YUQA 1TUCA 2QK0A 1BBZA 2DPPB 2LRQA 4M77A 3M0UA 2DBMA 4C0FA 2FHDA 1PSFA 1WHJA 4LN2A 5GAMf 2RHYA 1VQPQ 4A4EA 1N5ZA 3EFOA 5HKCA 5IXBA 1KQ1A 3VS4A 3CPWS 5GAOp 2PTKA 2GTJA 1C6VX 3A98A 3A8HB 3CCRA 4N4IA 2QI2A 1M3BA 3JB9I 4C0DC 5LJ5f 2KAFA 4RTTA 3JRZA 4QVDA 1K76A 2HCKA 2LTOA 1YBYA 3M57A 1NM7A 4X1VA 3RKXA 1I1JA 4J9DA 2ED0A 2KROA 4J7IA 1WHLA 2KNBB 3RKYA 3FJPA 1Q81U 5GAN2 2BIVA 2CKKA 3HL8A 2WSCE 4EMKC 1J3TA 3OQ5A 1RAEB 4C92B 1VQ5T 1YCYA 2RF0A 3G6EA 3FRNA 3PIPA 3OYJA 2A0FB 2E64A 4M7DE 3QZ5B 2SRCA 1K4US 3MEVA 4Q5WA 3QDRB 4C92D 6AT1B 3WVDB 4AG1C 2P4TA 1U5SA 2AZSA 2GF7A 1YJNA 1AWOA 2ZPBB 2YRDA 1K73U 1M1KC 3M0TA 1B34B 4EMKA 4LUEA 4RKUE 1RI0A 4F7UE 2RQRA 3QBYA 1B07A 1QW1A 4O5VA 1C0MA 2OX7A 2K5LA 3CCRQ 2NUTB 3RKWA 1NJIR 3EG9B 4A4HA 1QWFA 1OPLA 1TS9A 4EMGA 3OMGA 3OBWA 1H3ZA 2HL5C 2E65A 1QVFP 3HHTB 5L8RE 3P8HA 1K73R 2KY9A 3PTAA 1K8AC 2MAMA 1T0HA 3QWYA 4E6RA 1UHCA 5DM7R 3RMSA 1I0CA 3S6WA 3REBB 2HZYA 4ORZA 4PJOF 3EGDA 1FMVA 1QCNA 4A54A 1NPPA 1AT1B 2PU9B 4JS5A 2R5MA 3CCLA 3CMAQ 3JB9J 5FROA 1VQ6A 3QJ6A 3Q1JA 4AFUC 3G6EQ 2Z0WA 2A7YA 4PJNA 4M7AF 3M54A 5I2SA 2DYBA 4M7DC 3VUBA 2O4XB 1IHWA 1HYOA 3C4SA 3CCET 3HPWA 1VQ9Q 2D6FA 1YJNQ 3S3NA 1RL2A 1FX7A 2L5QA 3VJPA 2QDLA 2FVUA 2CDTA 1M8MA 3H0HA 2ZPGB 2MCNA 2AT1B 1B7TA 3CCJT 5LL6S 2RB6A 4PJLA 3HSBA 1SRMA 2L0AA 1FWZA 2I2LA 4PJOG 4C0GA 3J80E 1G8XA 2WSEE 1M2VA 2OTJT 4J8OA 1KQSA 2DD5A 1MMNA 2E41A 2XG8D 3C94A 1IREB 3OYCA 2KVQG 5KYWA 1I8FA 1XQHA 2NUPB 4GBQA 4M7AG 2CP7A 3EG2A 4Z89A 4BD3A 4TVRA 4M78E 3OB9A 2QG9B 3BY7A 1EX4A 2JT4A 2ZZDA 2DZCA 1O9SA 1KC8U 3CCLQ 4J6XA 2X3WD 1VQ6Q 2HQEA 2X51A 2HQXA 2EBPA 5IAYA 2QDYB 2RNAA 2L89A 5CIUA 1AWJA 3LH5A 2BTTA 1KK7A 3PNWC 4L59A 5GAOl 5KYYB 4GLKA 3INZA 1OV3A 1UE9A 4IURA 2PVGB 1JXOA 3M56A 2OAWA 4OB3B 4Y28E 2K3XA 3CCVT 2V1RA 1I5LA 1S72A 3JCMg 1N8RR 2O31A 3I55T 3R6OA 2JNGA 1U1TA 1NZ9A 4XTVA 4C5EA 3VS1A 2YLBA 4FW2A 3BDLA 2QQAA 4XU0A 3OYFA 3IQLA 3LGFA 2HDAA 2JVVA 1SEMA 4FM4B 1VQPT 2KT1A 2X4JA 1JO8A 1UGQB 2RJDA 3DB3A 5D7UA 1KSWA 4F17A 2FPEA 3EHQA 2DBKA 4O6JA 4HCBA 3GLXA 1Y71A 2GGRA 1QCFA 2XU8A 5FWBA 5GANf 2HNIA 4C8QE 4M78C 4N4HA 5IT9E 2RQVA 2YRVA 5GAMe 1GCQA 3GP8A 3ULRB 1YNZA 3UDCA 4FL6A 3AHUA 1RABB 3M0PA 2RM4A 3U23A 3VS3A 5GMKh 2EYXA 1ZBXA 2PUKB 2DKGA 2PUOB 5GAOm 5I11A 3VRYA 2DETA 2XIDA 4M75A 3RUXA 2EJ9A 4QT7A 5LJ5e 3NTKA 3D7SB 2OJ2A 2RHXA 1S72Q 1GCPA 3H41A 2RHUA 4RG2A 2LMJA 1N6AA 1YITA 2KQWA 1MV3A 2K79A 4J5YA 3JCMX 5GMKj 4M7DF 3MO8A 3UATA 2CSIA 2EYQA 1QP3A 2EGAA 2JTFA 1ZSZB 1W1FA 1UEBA 2P0QA 3GNFB 3CMEA 3JB9G 1U1SA 2DTIA 2EW3A 3KUFA 4C8QC 3E1SA 4BACA 3OYEA 4E47A 4F7UF 5CKHA 1BCOA 5ECAA 1KHIA 2HL3A 4RTUA 3CCRT 1HSQA 2DXCA 2KXDA 4F04B 3O8VA 1U06A 4XTWA 2K57A 2J6FA 2DXUA 4DBHA 1ZQ1A 3MKDA 4DA4A 2GQIA 3CCJA 2K5FA 1AWXA 2GTOA 4BUGA 2X3XD 4M7DG 3PMIA 5I22A 3L2ZA 3JCMd 3QXEB 3A8LB 1VQLQ 2QQRA 3QPHA 4PL6A 1WNLA 2P0PA 1SSFA 4OMNA 1KD1U 3CMAT 1D3BB 1I81A 2LVMA 2CP6A 1EFNA 2EVRA 4CC4B 1NG2A 3I5SA 3G6ET 2SEMA 1JB0E 3QKJA 3HFNA 1X6BA 2RK2A 5GJWB 4DBQA 4F7UG 3M5AA 1G2BA 2DXBA 3QYHB 5J39A 2XI9A 4LXCA 1VQ9T 4OMLA 1YJNT 2ED1A 2QTVA 1KHCA 4JRKA 4PJOB 2DJZA 5KH6A 4IIMA 1PSEA 4OMPA 1WHKA 3CMEQ 4HCCA 2CP2A 4M77E 1OOTA 4CRIA 5CQYA 3PVQA 1D1BA 4KGZB 4DEXA 2KI7A 1UTIA 2RJCA 4M7AB 1WHMA 3DB4A 4BI3A 4OF1A 3TREA 4MDWA 4JPBW 2L2PA 4RCCA 2AIRB 1SHGA 1PC0A 2EGEA 1K8AR 4XTXA 3UF4A 4K11A 2LJ3A 2K6DA 1HXDA 1VQOA 4BE1A 2E6ZA 1UFFA 4KUDK 4M7AD 1E7OA 4ZN1A 2BE9B 2K2VA 3EFOB 3ZL7C 1M8VA 1FMWA 5LJ3g 2KMTA 2ABLA 2FZGB 1VQ4A 4YTLA 2RQWA 3JB9H 1MUZA 4F14A 5I2MA 4CC2A 7AT1B 4M78F 2CZ6B 2FZKB 3CXCA 2OTLQ 2QASA 1H641 3ASKA 3X24B 2CZ1B 4DBFA 3CCLT 2P4RA 1VQ6T 2VKNA 1NPRA 1T0JA 2XDPA 4C5HA 2LX7A 1BYMA 2LT1A 3UA7A 1K0SA 1IB8A 2VB6A 1IHVA 3EFSA 1IXDA 3A8MB 1I5OB 1AOJA 1JQQA 2EQUA 1PCXA 1SHFA 4JUVA 2ESWA 1OQKA 1WI7A 3JCMb 1VUBA 4M77C 4C0DB 4KH1B 1PD0A 1NE8A 4R55A 2I0NA 4PKCC 1BI3A 3M0RA 1WFWA 2G6FX 1AEYA 3EH1A 1W70A 2VWFA 1VQOQ 1Y96A 2DX1A 2V8KA 2LDMA 1Q86C 1JXMA 1PRLC 4QQDA 4RCBA 4Y91A 4EMKB 3JAME 1VQ4Q 2J05A 5CAIA 3URGA 2M51A 1ZA2B 2EGCA 4C8QF 1G3WA 1GFDA 2OI3A 1B3QA 3OS5A 3JCMh 4A63B 3JCMV 1R0CB 3SWNA 4DBRA 1WHGA 1Q82C 5GANe 2GBQA 4FSSA 5GAOq 3V7SA 1BIBA 2LQWA 1D1CA 2O88A 2CS7A 2QXFA 1QWEA 1LCKA 2PZ1A 1EIFA 3BE3A 3LYIA 1HJDA 1VQMQ 2BE7D 4JZ3A 5FU6C 1RAHB 3SEMA 3EGDB 5GMKl 2EIFA 4LE9A 5D6WA 3M59A 3HRUA 2ZAEA 1ABQA 1ZA1B 2CP0A 1S72T 4X9DA 2EQMA 3VYGA 3OYAA 5HY6A 2LCSA 5IHNA 2HSEB 1WQ7A 1OX8A 4C8QG 1W2BP 4KT0E 3J7AF 2YT6A 4DEYA 2EPDA 2XDBA 1M5Q1 1RAFB 2GQVA 4ESRA 3UWNA 2HBPA 4VUBA 3CMAA 3RESA 1Q95G 4JRPA 2CREA 1RAIB 4AMCA 4D8DA 2MIOA 2DFUA 3MP6A 1JJ2P 3OYDA 1PKSA 2L3SA 4E7HA 4M7DB 1OZ2A 1VQ9A 1NJIU 4JLGA 3DKMA 3LWIA 1IO6A 1X6OA 1K9MC 1PD1A 1M4ZA 2NWMA 4M7DD 3A8OB 4F7UB 1VQLT 3OS2A 1WGSA 4OMOA 2CSQA 5GMKm 5GAN5 4HT8A 1WIEA 1YITT 1X01A 4PFPA 1WX6A 4PNOA 4E2FB 1TG0A 2VASA 1LJOA 2KEAA 2RQTA 2VGNA 4LNPA 2E12A 2RI5A 1BU1A 1DJ7B 1V1CA 2BKDN 1VIEA 3EGXB 1F1BB 4Y92A 1BB9A 3G71A 3CMET 1NYGA 1FYNA 3JCMP 3QYGB 2DM1A 5HK3A 2CT3A 2JM9A 4M77F 4N0AA 5FU7C 1E6HA 2DXTA 2EYZA 3T9NA 4BE0A 1QVGP 4D8KA 2COZA 2M0YA 4QQGA 4NS5A 4C5GA 1JEGA 1R8OB 2DEUA 2JXBA 2DE0X 1YI2A 4JLIA 2HD0A 5DLQE 1RAGB 5D6YA 3QHSA 1GBRA 1VYVA 4ZGJB 2V8JA 1XOVA 2EQIA 3X28B 3G7ZA 3FIFA 1PWTA 3TSWA 1D0XA 4EPCA 4C92A 1KJWA 2A28A 4B9XA 2HQHA 5GAOr 1V76A 3LGLA 2LJ1A 1YJWQ 4M77G 3OW2P 4JS4A 4M75E 4GY5A 2DRMA 3A1PA 1YN8A 4J9GA 1OEBA 1VQ8A 4B6MA 1WPYA 5CR2A 4J9FA 3HRTA 1D0ZA 1NLPC 4M78B 3MPUB 5LJ3h 1NBEB 2F2XA 1BI1A 2FYKA 3G71Q 4RTVA 3RERA 5IH2A 5GAMg 3CBMA 1B34A 4LD9K 1VIFA 4NOYA 1N8RU 1UG1A 1WA7A 1M90C 4M78D 3BDUA 4MMLA 3L2WA 2EQKA 2NUTA 4ANJA 4KH0B 1FXXA 2DF6A 3EG9A 1Q7YC 5CKDA 1Y7XA 1PRMC 4QW2A 3NPFA 2RK1A 3TU4K 3P8BB 2HBWA 3OA6A
chains in the Genus database with same CATH topology
5CQXA 2RH2A 3FDRA 2RHZA 5KE2A 2DXUA 5LJ3j 2KDSA 4N0AC 4M7AC 1ZQ1A 4E7KA 1KD1C 2RA2A 5LJ5g 4DA4A 1M90U 2XKOC 3RIRA 5D6XA 3CXCS 2P0KA 3CCJA 1VQ4T 2MF2A 5GAN8 2K5FA 2RJEA 2WSFE 3V7CA 1MHNA 3KBGA 3I56A 1YJWA 4UC4A 4BUGA 1Q7YU 4M78G 4KULA 3OYGA 4M7DG 3PMIA 3L2ZA 2BUDA 2CZ7B 3JCMd 3QXEB 3A8LB 2DVEA 2QQRA 5LJ3e 4ZN3A 3X20B 2VUBA 3QPHA 1N27A 4PL6A 3OYMA 3CPWA 1WNLA 2P0PA 1QVFA 1SSFA 1LOJA 2DO3A 4DOVA 3OYHA 1Y07A 1KD1U 3LW5E 3CC2T 2VXEA 1D3BB 2WACA 3CMAT 1I81A 3JCMW 2LVMA 1OYXA 2DIGA 2JZ2A 1YHQT 2EKOA 3HKSA 3G6ET 2JN0A 2VC8A 2D0QB 1JB0E 4NL2A 3CCST 3DLMA 3HFNA 3QKJA 4M75C 5AYFA 2RK2A 2DPPB 2MI6A 2O4XA 3FEOA 2LRQA 4F7UG 3TCJA 4M77A 3M5AA 2DXBA 3EFRA 3QYHB 5J39A 4HA8A 2JUFA 4C92C 2XI9A 1VQMT 2FB7A 4C0FA 1VQ9T 1YJNT 4C8QB 5A0GA 2FHDA 1PSFA 3OMCA 4KUIA 3S3OA 1KHCA 3M9QA 4JRKA 2DJZA 5GAMf 4PJOB 5KH6A 2RHYA 4A4EA 2L3RA 2ZCFB 1BI0A 1PSEA 2F5TX 5FRNA 3JCMc 2E10A 4HCCA 4M77E 4CRIA 5CQYA 5HKCA 4JRIA 1KQ1A 2LCCA 1OZ3A 1OI1A 3OY9A 1HK9A 3JB9F 4C8QD 3CPWS 1QVFS 2RJCA 2ZPEB 4M7AB 5GAOp 3BFMA 3DB4A 3LX7A 2QEXT 4BI3A 2E6NA 4OF1A 3TREA 4MDWA 1JBMA 2MWPA 3CCQT 3A8HB 3HFOA 4RCCA 3CCRA 3GPLA 1BIAA 4BDZA 3HRSA 1G3SA 2EAYA 3CEYA 1BKBA 4N4IA 1VQLA 2QI2A 2XK0A 3JB9I 2RHIA 1Q81C 2OTLT 3CCMA 2M1HA 4XTXA 4C0DC 5LJ5f 2KAFA 1HXDA 1I4K1 1VQOA 3JRZA 2LT4A 4QVDA 4XK8E 2E6ZA 4BE1A 4KUDK 1YJ9T 4M7AD 4OP0A 4ZN1A 2K2VA 1M8VA 1W4SA 3M4GA 4FSXA 2LTOA 3MP8A 5LJ3g 2KMTA 5GMKi 1YBYA 3M57A 1VQ4A 5J3BA 4ZGDB 4YTLA 1W2BA 3RKXA 2QA4T 2MMPA 2VV5A 2X4YA 4C0ZA 3JB9H 3PGGA 5I2MA 4BI4A 4II1A 4ZGEB 3L2QA 4M78F 3QIIA 2CZ6B 4BI8B 4J7IA 1Q81U 3RKYA 3FJPA 4M75B 4ZTJA 5GAN2 4M7DA 3CXCA 2BIVA 5FRMA 2LNVA 2CKKA 3HL8A 1H641 2WSCE 3ASKA 4EMKC 2X4WA 1XNIA 3X24B 3OQ5A 2CZ1B 2XDDA 3CCLT 4C92B 3OYBA 1VQ6T 2EFIA 1VQ5T 3CC2A 1M1FA 1YCYA 4ATOA 3SDZA 1NPRA 1YHQA 2XDPA 1XTDA 3VV0A 4C5HA 3G6EA 3FRNA 1K73C 4M75D 3ZBDA 3PIPA 3OYJA 3CCSA 3QSUA 4E7LA 2E64A 2V8IA 1JJ2A 2LT1A 2RI3A 3QZ5B 4M7DE 1BYMA 2DD4A 3P8DA 4IUUA 5GAMd 3EFSA 3MEVA 4LDVA 4Q5WA 3QDRB 4F7UA 4C92D 3WVDB 2K3YA 2OAUA 2P4TA 2GF7A 3A8MB 3BW1A 4XTZA 4C5IA 1JRIA 2ZPBB 1YJNA 3VKIA 2EQUA 2DEQA 4OGCA 3N5BB 1W2BS 3CD6A 2ZPIB 2G3RA 4D6WA 4JUVA 2VXFA 3GNGA 3RMQA 3JCMb 1K73U 1M1KC 1VUBA 4M77C 1B34B 4EMKA 2F69A 3QJYA 4DOWA 4C0DB 5A0DA 5GANh 4RKUE 2XHCA 1RI0A 5C0MA 4MZPA 4F7UE 1NE8A 4R55A 3QBYA 3NTIA 3SD4A 1KQSS 1KQ2A 4WF2A 1QW1A 4PKCC 4O5VA 4IUVA 1BI3A 4OB0B 1VQKT 2K5LA 2QEXA 1O75A 3OW2S 3RKWA 5LJ5d 3CCQA 5GAOn 3ZEHA 4A4HA 5A2QE 3OYYA 3OMGA 3QO3A 3PT9A 4EMGA 2R5AA 3OBWA 2OTLA 1H3ZA 2E65A 1Y96A 1JJ2S 5LJ3f 1M1KU 2V8KA 2L8DA 2LDMA 3HHTB 5I21A 5L8RE 3P8HA 1Q86C 2KY9A 3PFSA 1YJ9A 4QQDA 4RCBA 4XTUA 4Y91A 3PTAA 4XTYA 2MAMA 1K8AC 4EMKB 4JDSA 3JAME 2LQKA 5CKEA 5HK0A 3CC4T 5FLXE 5CAIA 2FL7A 5A0LA 3URGA 5DM7R 5GANj 2QA4A 3CBOA 3E9GA 3RMSA 4OMFB 2CZ0B 3S6WA 2EJFA 4C8QF 3JCMJ 1G3WA 3LWHA 2LQ8A 4PJOF 3OS5A 3JCMh 3JCMV 2GFAA 4A54A 3SWNA 1Q86U 1TH7A 2H3JA 1NPPA 4IUTA 2PU9B 4JS5A 2R5MA 2AHJB 1K8AU 3CCLA 2CGHA 3JB9J 1Q82C 2IVWA 5FROA 4A53A 5GANe 1VQ6A 1VQ5A 3QZ9B 3QJ6A 3Q1JA 2X4XA 5GAOq 3GF5A 3V7SA 1BIBA 3J81E 2A7YA 3FC3A 2CS7A 3M54A 2QXFA 4OB2B 4BB7A 5I2SA 1QVGA 4M7AF 4XU2A 3NFCA 4M7DC 3VUBA 2O4XB 1EIFA 1N9RA 3NTHA 4M77B 4PJOD 3C4SA 3LYIA 3CCET 3SFMA 3OS1A 1G5VA 3HPWA 2D6FA 1QP2A 2GFUA 5M9OA 5GAN7 3S3NA 5FU6C 3PIOA 2ZPFB 1RL2A 5GMKl 1FX7A 2L5QA 2DTHA 2EIFA 3VJPA 2M0OA 1Q82U 5D6WA 3L42A 3M59A 3HRUA 3X26B 2FVUA 1KG1A 3OSSC 1S72T 4X9DA 2ZPGB 1M1GA 3MEWA 2EQMA 4M77D 3VYGA 5LL6S 3OS0A 3CCJT 3S3MA 2RB6A 3MHXA 3OYAA 3HSBA 5HY6A 2GCXA 3E19A 4RG8A 2HAXA 5KCOA 3ZFJA 1WQ7A 2VGMA 2RO0A 4NL3A 4C8QG 4M75F 1VQKA 1FWZA 4A4KA 4KT0E 2I2LA 3JCMe 4PJOG 4C0GA 4HKEA 3J7AF 4QQ6A 4L5GA 4MMKA 1P92A 2DK3A 4M78A 3J80E 2XDBA 3OSVA 2WSEE 4N4GA 2OTJT 4J8OA 4C92F 1QVGS 1KQSA 2DD5A 1KC8C 2E41A 3OYNA 2XG8D 3C94A 1M5Q1 1IREB 1G3TA 2D9TA 2GQVA 3OYCA 1NJIC 3UWNA 2HBPA 4VUBA 3G71T 3JSCA 2KVQG 3OW2A 1I8FA 3CMAA 1XQHA 3RESA 4M7AG 4MZTA 3FLGA 4J7FA 2E70A 5CVIA 3VYHB 3WVEB 4BD3A 4R56A 4JRPA 3DLLA 3CC4A 4TVRA 4M78E 3OB9A 2DTOA 2QQBA 2RJFA 3MP6A 3BY7A 3L2RA 3ME9A 3GOXA 3CBPA 3OYDA 5GANg 2ZZDA 1QVPA 2DZCA 2E1HA 2LCLA 2VYTA 4EDUA 1O9SA 4E7HA 1VQMA 1KC8U 4M7DB 1OZ2A 1VQ9A 1NJIU 3VUZA 4HCZA 4FT4A 4OVAA 3MP1A 3LLRA 4JLGA 3DKMA 3LWIA 3JCMQ 2DAQA 4J6XA 1X6OA 1YI2T 2HQEA 1K9MC 2HQXA 4ME7A 5FU6B 5IAYA 2QDYB 3OBYA 1VQNT 3UT1A 1UGPB 2L89A 5CIUA 5C6SA 2Y90A 1M4ZA 2RD1A 2Y4XA 5GAN3 3PNWC 4MZMA 4L59A 4J83A 3G4ST 5GAOl 4M7DD 4JRQA 5DY9A 4M75G 4GLKA 3A8OB 3INZA 3FB9A 3SWNC 4ELZC 3TEEA 4QVCA 4IURA 4F7UB 2PVGB 4A4GA 3CCEA 1VQLT 2QTXA 3M56A 5GAMh 3OS2A 4FIBA 1WGSA 4OB1B 4KBMB 4C92G 3OYIA 4OB3B 3M4YA 5CK9A 1K9MU 1GXIE 4Y28E 5KCHA 5GMKm 3KXTA 2E5QA 2MWOA 2ZGWA 2K3XA 3M53A 2KK4A 1D3BA 4X34A 3VU3C 3CCVT 1I5LA 1S72A 4LDXA 2KSSA 3JCMg 5GAN5 4XU3A 3F70A 4L6V5 4OGEA 4HT8A 3I55T 4LDWA 3R6OA 2JNGA 1U1TA 1YITT 1X01A 1NZ9A 3L2VA 4XTVA 3PMTA 4PNOA 4BY6C 1M9SA 4IUQA 1VQ8T 1VQ7T 4LD6A 3META 4C5EA 5DLOA 2K5IA 3OYKA 2YLBA 3A8GB 3QG1A 1WJRA 1LJOA 5CCAA 3BDLA 2QQAA 4C8QA 4XU0A 3TU4K 3OYFA 2X35A 2VGNA 3LGFA 3L2UA 3L1AA 4PJOA 2QQ9A 2K4YA 2JVVA 2E12A 2RI5A 4XQ3A 4FM4B 5LJ5h 1DJ7B 2OTJA 2BKDN 1G3YA 1VIEA 1ZHIA 1BI2A 5GAMj 3CCUT 2X4JA 1Y96B 4XAXB 1VQPT 5J26A 2XD0A 1UGQB 2RJDA 3DB3A 4A4FA 4BDYA 3CC7T 2IG0A 4IUPA 3G71A 3CMET 2YHTA 3JCMP 2EQJA 1WQWA 3QYGB 4O6JA 2EWNA 4Z02A 5HK3A 4HCBA 3GLXA 2Y4YA 1Y71A 2XU8A 5GANf 5GAN4 2HNIA 4M77F 4N0AA 5FU7C 2DXTA 3V8LA 1IZ6A 4M78C 4C8QE 4E7JA 4M7AA 3QUIA 1WJQA 3T9NA 4BE0A 4N4HA 5IT9E 4PJOE 4LDUA 2YRVA 1X75C 5GAMe 3GP8A 5CO7A 4E7IA 3C95A 4QQGA 1AHJB 4LDYA 4NS5A 3UDCA 4C5GA 4FL6A 1YIJT 1U8RA 1R8OB 3CD6T 3AHUA 4J6WA 3SWNB 2C06A 3C12A 1UB4A 2R58A 1MGQA 2JTMA 2YLCA 3WXMB 5LJ5j 2XICA 1YI2A 4M7AE 2RM4A 4JLIA 2HD0A 2CYZB 5DLQE 4HT9A 1VQNA 5D6YA 3QHSA 3HP9A 2O01E 4RMOA 4FU6A 1YJWT 1UGRB 4MDXA 3I56T 4ZGJB 5GMKh 2V8JA 3G4SA 3V8JA 3EAEA 1ZBXA 1XOVA 3V8KA 2PUKB 2DKGA 2PUOB 5GAOm 3X28B 2LC4A 4XU1A 2JOYA 1V29B 2XIDA 4J6YA 4M75A 3RUXA 2EJ9A 3G7ZA 5LJ5e 3FIFA 4PLIA 2DZ9A 3NTKA 5LJ3d 5CKFA 3MEAA 4ZTFA 4BE2A 4BY6B 4V2SA 2LX9A 4FT2A 3JCMf 3ER0A 4EPCA 2RHXA 4C92A 4B9XA 5GAOr 3CCVA 3JB9D 1WJSA 2RHUA 3OYLA 3LGLA 2RI2A 4RG2A 1N6AA 5IN1A 3M58A 5CKBA 3I55A 2QQSA 4M77G 5GAN6 4JS4A 4M75E 3H8ZA 4GY5A 1YITA 4IKFA 2KQWA 4EMHA 5KE3A 2F5KA 1LNXA 4J5YA 4CI0C 5EG2A 1N9SA 4QVZA 1N8RC 3MCAB 1VQ8A 3A5ZB 1VQ7A 3V7RA 3JCMX 2M9UA 1WPYA 2M16A 5GMKj 4C92E 3MO8A 4B9WA 3HRTA 5CR2A 3GIBA 2EJGA 4M7DF 5FU7B 4DQ2A 4M78B 3UPUA 2EYQA 2PVOB 4X9CA 1QP3A 5LJ3h 2JTFA 3M55A 1BI1A 1VQPA 2FYKA 3CCUA 4ELYC 1UEBA 3LH0A 2PVDB 5GANd 4PLLA 2R57A 3RERA 2P0QA 3CBMA 3H6ZA 3GNFB 5GAMg 1B34A 3CC7A 3CMEA 1UGSB 3JB9G 2PQWA 1U1SA 2DTIA 5GMKe 4LD9K 1VIFA 2ZPHB 4NOYA 3KUFA 1N8RU 1M90C 4M78D 4C8QC 3CPFA 3E1SA 3BDUA 4MMLA 3L2WA 3OYEA 4BACA 3SB2A 4E47A 2EQKA 4PJOC 4F7UF 3X25B 5CKHA 3E9FA 3MEUA 1FXXA 1KHIA 3CCRT 1Q7YC 5CKDA 1Y7XA 4P5NA 2B8AA 2DXCA 4JJNK 2DIQA 3CCMT 1YIJA 4QW2A 3O8VA 2A3LA 2RK1A 4XTWA 2NLUA 3P8BB 1VQOT 2K57A 3OA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM j;  1Y96 B;  4C92 B;  2DXU A;  4X9D A;  5LJ3 j;  4N0A C;  4M7A C;  1YCY A;  4M77 D;  2YHT A;  3JCM P;  2RA2 A;  5LJ5 g;  1WQW A;  2RB6 A;  2EWN A;  3RIR A;  3HSB A;  4M75 D;  5GAN f;  5GAN 8;  5GAN 4;  3QSU A;  2HNI A;  4M77 F;  4N0A A;  2E64 A;  2DXT A;  3V7C A;  3V8L A;  4M78 C;  4C8Q E;  4M7A A;  4M7D E;  1WQ7 A;  3QUI A;  4M78 G;  4NL3 A;  4PJO E;  4C8Q G;  4M75 F;  5GAM d;  4M7D G;  3EFS A;  3L2Z A;  5GAM e;  4F7U A;  2I2L A;  3JCM d;  4C92 D;  3JCM e;  4PJO G;  2DVE A;  5LJ5 d;  4MMK A;  5LJ3 e;  4M78 A;  3BW1 A;  4XTZ A;  1JRI A;  1WNL A;  4C92 F;  1LOJ A;  3AHU A;  4J6W A;  3SWN B;  2E41 A;  2DEQ A;  1M5Q 1;  1MGQ A;  2YLC A;  4JUV A;  2VXE A;  1D3B B;  5LJ5 j;  4M7A E;  1I81 A;  2RM4 A;  2VXF A;  4JLI A;  3JCM b;  1I8F A;  3JCM W;  4HT9 A;  4M77 C;  3RES A;  1B34 B;  4EMK A;  3QHS A;  5GAN h;  4M7A G;  2JN0 A;  2VC8 A;  4NL2 A;  4F7U E;  3HFN A;  4M75 C;  1KQ2 A;  5GMK h;  4M78 E;  4WF2 A;  3V8J A;  4F7U G;  4M77 A;  2DTO A;  3V8K A;  3BY7 A;  2DKG A;  3EFR A;  5GAO m;  4XU1 A;  5GAN g;  4HA8 A;  4M75 A;  4J6Y A;  2DZC A;  3RKW A;  3RUX A;  2E1H A;  2EJ9 A;  2FB7 A;  3FIF A;  4C92 C;  5LJ5 e;  2DZ9 A;  5LJ3 d;  4C8Q B;  5GAO n;  4M7D B;  3QO3 A;  4EMG A;  4JRK A;  5GAM f;  4PJO B;  2DJZ A;  4V2S A;  3JCM f;  2E65 A;  3JCM Q;  1Y96 A;  4C92 A;  5LJ3 f;  4J6X A;  5I21 A;  5GAO r;  4XTU A;  4RCB A;  3JCM c;  2E10 A;  4Y91 A;  4XTY A;  4M77 E;  3JB9 D;  4EMK B;  2Y90 A;  2RD1 A;  4JRI A;  1KQ1 A;  5GAN 3;  4M77 G;  5GAN 6;  1HK9 A;  4M75 E;  5CAI A;  3JB9 F;  4C8Q D;  5GAO l;  4EMH A;  4M7D D;  4M7A B;  5GAO p;  5GAN j;  3BFM A;  5DY9 A;  1LNX A;  4J5Y A;  4M75 G;  1N9S A;  3INZ A;  3FB9 A;  3SWN C;  3V7R A;  3JCM X;  1WPY A;  2EJF A;  1JBM A;  4C8Q F;  4QVC A;  4C92 E;  4F7U B;  5GMK j;  3HFO A;  3JCM J;  4RCC A;  2EJG A;  2QTX A;  3GIB A;  1BIA A;  4PJO F;  4DQ2 A;  5GAM h;  2EAY A;  4M78 B;  3JCM h;  4C92 G;  3JB9 I;  3JCM V;  4M7D F;  4X9C A;  4A54 A;  3SWN A;  5LJ3 h;  1TH7 A;  4XTX A;  5GMK m;  5LJ5 f;  1HXD A;  1I4K 1;  2CGH A;  2FYK A;  2ZGW A;  4QVD A;  1D3B A;  3JB9 J;  3VU3 C;  5GAN d;  4A53 A;  5GAN e;  4OP0 A;  1I5L A;  5GAM g;  3RER A;  4M7A D;  1B34 A;  3JCM g;  1M8V A;  5GAN 5;  3M4G A;  4XU3 A;  5GAO q;  3V7S A;  1BIB A;  5LJ3 g;  1U1S A;  3JB9 G;  2DTI A;  5GMK i;  5GMK e;  4HT8 A;  4M7A F;  4NOY A;  1U1T A;  1X01 A;  4XU2 A;  4M78 D;  4XTV A;  3RKX A;  4C8Q C;  3BDU A;  4MML A;  3JB9 H;  4M7D C;  4PNO A;  3SB2 A;  1N9R A;  3PGG A;  4M77 B;  4F7U F;  4PJO C;  4PJO D;  2YLB A;  4M78 F;  1LJO A;  3RKY A;  3FJP A;  4M75 B;  4XU0 A;  4C8Q A;  5GAN 2;  5GAN 7;  4M7D A;  5GMK l;  3L1A A;  4PJO A;  1H64 1;  2DTH A;  4XQ3 A;  4EMK C;  5LJ5 h;  4XTW A;  2K57 A; 
#chains in the Genus database with same CATH topology
 3FDR A;  1YI2 Q;  4J9B A;  5LJ3 j;  2RA2 A;  5LJ5 g;  1VQ4 T;  5D6X A;  1GCQ C;  5GAN 8;  3KBG A;  9ATC B;  1M3C A;  2D0N A;  3OYG A;  1X6G A;  1A0N B;  4JZ4 A;  4EIK A;  3X20 B;  2VUB A;  2KRN A;  1QVF A;  4E7S A;  3OYH A;  1OU9 A;  1OYX A;  2JZ2 A;  1KIK A;  2EKO A;  2JN0 A;  2VC8 A;  2AK5 A;  4RTZ A;  1KFZ A;  3DLM A;  2H8H A;  4M75 C;  5AYF A;  4AFZ C;  2MI6 A;  2O4X A;  3TCJ A;  2NYS A;  1VQ8 Q;  3EFR A;  2W0Z A;  2RPN A;  4HA8 A;  1TSF A;  1VQM T;  4KRT A;  2E5K A;  2A37 A;  4C8Q B;  5A0G A;  4KUI A;  3S3O A;  3M9Q A;  2L3R A;  2ZCF B;  1BI0 A;  4F16 A;  2EKH A;  1YHQ Q;  2YWW A;  3JCM c;  1ZUY A;  2E10 A;  5EC7 A;  1CKB A;  3CCS Q;  2CP5 A;  4JRI A;  2LCC A;  1OZ3 A;  4AG2 C;  1HK9 A;  3JB9 F;  4C8Q D;  1QVF S;  1IRX A;  1MND A;  2ZPE B;  3BFM A;  1JBM A;  1VYT A;  3HFO A;  3GPL A;  1BIA A;  4BDZ A;  3HRS A;  3CEY A;  1Q86 R;  4IIO A;  1VQL A;  2XK0 A;  2RHI A;  3CD6 Q;  1Q81 C;  1LPL A;  2YUN A;  2LT4 A;  4XK8 E;  4OP0 A;  2NUP A;  1Y57 A;  1W4S A;  3M4G A;  4FSX A;  2DL7 A;  4ZGD B;  1SRL A;  2VV5 A;  2FEI A;  4BI4 A;  1YP5 A;  4II1 A;  5KYX B;  2K9G A;  3QII A;  4BI8 B;  2ECZ A;  3L2Q A;  1Q82 R;  1XNI A;  1W6X A;  2DMO A;  3OYB A;  2EFI A;  3CC2 A;  4J9E A;  1XTD A;  3VV0 A;  4HVU A;  2LP5 A;  5L23 A;  1K73 C;  3QSU A;  3RNJ A;  5KYY A;  2RI3 A;  2D8J A;  2O2O A;  5GAM d;  1I07 A;  2V1Q A;  4ZNX A;  3BW1 A;  4C5I A;  4XTZ A;  1JRI A;  1TUG B;  3VKI A;  3M0Q A;  2ZPI B;  2E4H A;  1RLP C;  2VXF A;  3KFV A;  2MOX A;  3NGP A;  3QJY A;  2XHC A;  5C0M A;  4MZP A;  3I9Q A;  1KQ2 A;  4JJB A;  4WF2 A;  4OB0 B;  4J9H A;  2C0T A;  5KYU B;  2QEX A;  1O75 A;  3OW2 S;  5LJ5 d;  3CCQ A;  3ZEH A;  3PVL A;  5A2Q E;  3QO3 A;  2GNC A;  2A36 A;  3RDV A;  2R5A A;  2OTL A;  1M1K U;  2L8D A;  1YJ9 A;  2VVK A;  1TUD A;  5CKE A;  4Z88 A;  5A0L A;  2QA4 A;  3CBO A;  2HKQ B;  2AZV A;  2B86 A;  1WDX A;  2LQ8 A;  1K9M R;  2MYS A;  2JS0 A;  1AD5 A;  2H3J A;  1M1K R;  2HMA A;  1K8A U;  3CC2 Q;  2IVW A;  1OPK A;  3EHR A;  3QZ9 B;  1MMA A;  2X4X A;  3GF5 A;  3J81 E;  2QAZ A;  3FC3 A;  4OB2 B;  4BB7 A;  4XU2 A;  2DLP A;  3NFC A;  2D1X A;  4HXJ A;  2J6O A;  4M77 B;  4PJO D;  3TSZ A;  3SFM A;  1MMD A;  1PHT A;  1UGV A;  2IIM A;  4PJJ A;  3PIO A;  2DTH A;  2M0O A;  2RMO A;  3L42 A;  2AKK A;  1H8K A;  4RTY A;  1KG1 A;  3OSS C;  1M1G A;  4M77 D;  3S3M A;  1RAC B;  2CUD A;  3MHX A;  1CKA A;  2GCX A;  2JTE A;  3E19 A;  3GBQ A;  5IHI A;  3ZFJ A;  2J7I A;  2QEX Q;  4M75 F;  2F2W A;  2MPX C;  2P84 A;  4A4K A;  2HKN A;  1VQK A;  3CCQ Q;  1AWW A;  2DL4 A;  4HKE A;  4L5G A;  4N4G A;  1ZSZ A;  1KC8 C;  2D9T A;  2KRS A;  1QKX A;  1YJ9 Q;  1M2O A;  3G71 T;  3JSC A;  4WTO B;  3FLG A;  2E70 A;  5CVI A;  4R56 A;  4OMQ A;  3DLL A;  3CC4 A;  2QA4 Q;  5FW9 A;  1OU8 A;  2DTO A;  2QQB A;  2RJF A;  4FYY B;  2YUO A;  3CBP A;  1TOV A;  5GAN g;  3CQT A;  2VYT A;  2LCL A;  1WXB A;  1VQM A;  1RAD B;  3VUZ A;  5AT1 B;  3UA6 A;  4FT4 A;  2M02 A;  3LLR A;  1FMK A;  1TU0 B;  2ATC B;  2KYB A;  1YI2 T;  5FU6 B;  3FJ5 A;  3UT1 A;  1QQJ A;  5C6S A;  2Y4X A;  2LQN A;  5GAN 3;  3SHW A;  4MZM A;  4FYX B;  4J83 A;  1SG5 A;  1X43 A;  4M75 G;  3FB9 A;  3SWN C;  1ARK A;  1ZSG A;  3TEE A;  4QVC A;  4A4G A;  2QTX A;  1MV0 B;  4AFQ C;  5GAM h;  3HTR A;  4FIB A;  4OB1 B;  4KBM B;  3OYI A;  2MK5 A;  4AFS C;  3M4Y A;  2E5Q A;  2ZGW A;  3M53 A;  1D3B A;  2FO0 A;  4X34 A;  3VU3 C;  2KSS A;  2QGG A;  2FZC B;  3L2V A;  4FW1 A;  2NUZ A;  4JJC A;  3VS7 A;  4BY6 C;  1M9S A;  1VQK Q;  1VQ8 T;  1MNE A;  4LD6 A;  3OYK A;  3QG1 A;  1WJR A;  2X9H A;  4PJO A;  2QQ9 A;  2K4Y A;  5LJ5 h;  4XQ3 A;  2CH4 W;  3EG3 A;  1BI2 A;  1ZHI A;  5GAM j;  3EG1 A;  1IGQ A;  2XD0 A;  5J26 A;  1AZG B;  4A4F A;  2IG0 A;  1WQW A;  4Z02 A;  3CC4 Q;  1Q7Y R;  3V8L A;  4M7A A;  1IZ6 A;  4FYV B;  4CC7 A;  4E7J A;  3MJX A;  5CO7 A;  4E7I A;  3C95 A;  3CD6 T;  2JTM A;  1H3H A;  2YLC A;  1ZUK A;  2ROT A;  5LJ5 j;  2XIC A;  1UDL A;  2DL5 A;  2CYZ B;  4HT9 A;  1VQN A;  2C0O A;  3HP9 A;  4RMO A;  4FU6 A;  4MDX A;  3G4S A;  3EAE A;  2LC4 A;  4XU1 A;  4J6Y A;  4PLI A;  3VS6 A;  2DZ9 A;  5LJ3 d;  3MEA A;  4BE2 A;  1UHF A;  2LX9 A;  3JCM f;  2L3Q A;  2XMF A;  1RUW A;  1KQS P;  3JB9 D;  1WJS A;  4FYW B;  5IN1 A;  3M58 A;  5CKB A;  3R6N A;  4IKF A;  2CP3 A;  4EMH A;  5KE3 A;  2F5K A;  2J6K A;  1LNX A;  5EG2 A;  1TWB A;  3MCA B;  3A5Z B;  1VQ7 A;  3V7R A;  2M9U A;  2M16 A;  4C92 E;  4B9W A;  3GIB A;  1WHH A;  5FU7 B;  4PJM A;  3TQ7 P;  2PVO B;  1K0X A;  1M2V B;  3CCU A;  4ELY C;  5GAN d;  3CC7 A;  5KYW B;  2PQW A;  5GMK e;  2D8H A;  2DVJ A;  1QLY A;  1VYU A;  1Q81 R;  3X25 B;  3MEU A;  4JJN K;  2DIQ A;  1YIJ A;  3VS5 A;  2A3L A;  2BZ8 A;  2RH2 A;  4RUG A;  2ROL A;  2KDS A;  4N0A C;  2LZ6 B;  1VQN Q;  1T3S A;  4E7K A;  1KD1 C;  2CT4 A;  1Y0M A;  3NMZ C;  2KE9 A;  2MF2 A;  3G4S Q;  2RJE A;  2WSF E;  1YJW A;  1MHN A;  4PK4 A;  3I56 A;  4UC4 A;  4KUL A;  2BUD A;  2CZ7 B;  8ATC B;  4ZN3 A;  1NEB A;  3OYM A;  2YRC A;  2COW A;  1NLO C;  1Y07 A;  3LW5 E;  3CC2 T;  2VXE A;  2WAC A;  3JCM W;  4JJD A;  3HKS A;  1IGU A;  1LVK A;  2D0Q B;  1YWP A;  4QKU A;  2LJ0 A;  3FEO A;  1VQ7 Q;  3M0S A;  1NEG A;  2JUF A;  4C92 C;  1X27 A;  2FB7 A;  2CH4 A;  4M4Z A;  3OMC A;  3CCU Q;  2DRK A;  1WXU A;  4HCK A;  3CC7 Q;  4J9I A;  2F5T X;  5FRN A;  5IXF A;  2FG0 A;  1OI1 A;  5GJV B;  1WZO A;  3OY9 A;  3LX7 A;  2JMC A;  1JU5 C;  2O9S A;  2QEX T;  2E6N A;  3C0C A;  2MWP A;  3CCQ T;  1YWO A;  1X69 A;  1G3S A;  2EAY A;  1YIJ Q;  1BKB A;  2OTL T;  3CCM A;  2M1H A;  3EH2 A;  1I4K 1;  4RTX A;  1YJ9 T;  2K3B A;  2DNU A;  2IPO B;  2YUP A;  1D1A A;  1RAA B;  3MP8 A;  5GMK i;  5J3B A;  3I56 Q;  1W2B A;  2QA4 T;  2MMP A;  3THK A;  2X4Y A;  4C0Z A;  2ENM A;  3PGG A;  1X2Q A;  3EG0 A;  4ZGE B;  2K7A A;  4M75 B;  4ZTJ A;  4M7D A;  1ZBJ A;  5FRM A;  2LNV A;  3G1J A;  2X4W A;  3AT1 B;  2XDD A;  1PG5 B;  1M1F A;  4ATO A;  3SDZ A;  1YHQ A;  4M75 D;  3ZBD A;  3CCS A;  2HSP A;  4E7L A;  3REA B;  2V8I A;  1JJ2 A;  1AVZ C;  4LUD A;  2DD4 A;  1ZLM A;  3P8D A;  4IUU A;  4LDV A;  4F7U A;  2F2V A;  2K3Y A;  2OAU A;  2DEQ A;  4OGC A;  3N5B B;  1W2B S;  3CD6 A;  2G3R A;  1C1A A;  4D6W A;  3GNG A;  3RMQ A;  1QCO A;  4KGX B;  1GRI A;  2F69 A;  4DOW A;  5A0D A;  5GAN h;  3JV3 A;  3NTI A;  3SD4 A;  1KQS S;  4IUV A;  4PFO A;  1G83 A;  1VQK T;  1ZX6 A;  1KC8 R;  5GAO n;  3CCM Q;  3OYY A;  3PT9 A;  3EGX A;  1JJ2 S;  5LJ3 f;  2FRW A;  5I21 A;  3PFS A;  4XTU A;  1QMC A;  4XTY A;  4JDS A;  2LQK A;  5HK0 A;  3CC4 T;  5FLX E;  1WLP B;  1Z9Q A;  2FL7 A;  2KT8 A;  5GAN j;  2KBT A;  3H9N A;  3E9G A;  4OMF B;  1M30 A;  2CZ0 B;  1K1Z A;  2EJF A;  1ACM B;  3QDF A;  3JCM J;  3LWH A;  2A08 A;  2GFA A;  1Q86 U;  1TH7 A;  4IUT A;  2AHJ B;  2CGH A;  2JJ9 A;  4A53 A;  1VQ5 A;  2DA9 A;  3I35 A;  4CC3 A;  1QVG A;  1OX9 A;  1N9R A;  1D0Y A;  3NTH A;  3H0F A;  1UEC A;  3OS1 A;  1G5V A;  4R0K A;  1QP2 A;  2GFU A;  5M9O A;  5GAN 7;  2ZPF B;  1HD3 A;  1Q82 U;  3X26 B;  2JW4 A;  2DER A;  3MEW A;  3OS0 A;  4HVW A;  4HVV A;  4RG8 A;  1EZZ B;  2HAX A;  5KCO A;  1R0B G;  2QGF B;  2YSQ A;  1SF9 A;  4WCI A;  2VGM A;  2RO0 A;  4NL3 A;  2CUB A;  2DIL A;  3JCM e;  1YFN A;  4QQ6 A;  4MMK A;  1P92 A;  2DK3 A;  4M78 A;  3OSV A;  4C92 F;  1QVG S;  3CXC P;  2E3I A;  3OYN A;  1NJI C;  1G3T A;  2EYW A;  3OW2 A;  1OUL A;  2DYI A;  1UJY A;  2KGT A;  2JMA A;  4MZT A;  4J7F A;  3VYH B;  3WVE B;  1PNJ A;  1UJ0 A;  1SSH A;  3L2R A;  3ME9 A;  3GOX A;  3EGU A;  1QVP A;  2E1H A;  4EDU A;  2KRM A;  2YXY A;  4HCZ A;  2RQU A;  4OVA A;  2AKL A;  3MP1 A;  1SPK A;  3JCM Q;  2DAQ A;  1CSK A;  1PKT A;  1VQ5 Q;  4ME7 A;  1VA7 A;  3OBY A;  1VQN T;  1UGP B;  2COY A;  2Y90 A;  3VS0 A;  1ABO A;  2RD1 A;  1GL5 A;  1BK2 A;  3G4S T;  1D09 B;  3VRZ A;  4JRQ A;  5DY9 A;  2FPD A;  1ZUU A;  4ELZ C;  3CCE A;  1RLQ C;  3I5R A;  1SKU B;  3RR6 A;  4C92 G;  2E3H A;  5CK9 A;  1K9M U;  1GXI E;  5KCH A;  3KXT A;  2MWO A;  3RBB B;  2KK4 A;  3CPW P;  3H0I A;  4LDX A;  8AT1 B;  4XU3 A;  3F70 A;  4L6V 5;  4OGE A;  4LDW A;  1VOM A;  3PMT A;  1X2K A;  2FRY A;  4IUQ A;  2PNI A;  1VQ7 T;  3MET A;  5DLO A;  2K5I A;  1GBQ A;  3A8G B;  5CCA A;  4C8Q A;  1H92 A;  2X35 A;  3L2U A;  3L1A A;  2OTJ A;  1G3Y A;  5KYN A;  4KGV B;  4XAX B;  1Y96 B;  3CCU T;  2QYZ A;  1M27 C;  2FPF A;  2L3P A;  4BDY A;  3CC7 T;  4IUP A;  2YHT A;  2EQJ A;  2EWN A;  1YIT Q;  2Y4Y A;  5GAN 4;  4E7Z A;  2YDL A;  3QUI A;  1WJQ A;  4PJO E;  4LDU A;  1UUE A;  1U3O A;  1X75 C;  1ZSZ C;  5IHK A;  2K2M A;  1AHJ B;  4LDY A;  1YIJ T;  1U8R A;  3O5Z A;  1NYF A;  4J6W A;  3SWN B;  1KD1 R;  2C06 A;  3C12 A;  1UB4 A;  2R58 A;  1MGQ A;  3WXM B;  4M7A E;  2RN8 A;  2O9V A;  2BZY A;  4OMM A;  5HCK A;  2O01 E;  3PE0 A;  1YJW T;  1UGR B;  3I56 T;  2JS2 A;  3V8J A;  3V8K A;  3CCE Q;  5KYX A;  2JOY A;  1WXT A;  3QWX X;  1V29 B;  5CKF A;  4ZTF A;  1M3A A;  1TXQ A;  4BY6 B;  2W10 A;  4V2S A;  1R77 A;  4FT2 A;  1S1N A;  3ER0 A;  2KYM A;  2EYY A;  1WYX A;  2HEQ A;  3CCV A;  3CCJ Q;  3OYL A;  2RI2 A;  2JM8 A;  3I55 A;  2QQS A;  5GAN 6;  3H8Z A;  3TVT A;  1QKW A;  4AT1 B;  4CI0 C;  2DL3 A;  1N9S A;  4QVZ A;  1N8R C;  2H3E B;  2DJQ A;  3VS2 A;  2EJG A;  4DQ2 A;  3UPU A;  2OTJ Q;  4X9C A;  2F1L A;  4J9C A;  3M55 A;  1VQP A;  1XJW B;  2DL8 A;  3LH0 A;  2PVD B;  4PLL A;  1PM3 A;  2R57 A;  4RTW A;  3H6Z A;  1UGS B;  1K9A A;  2ZPH B;  1E6G A;  3CPF A;  3SB2 A;  4PJO C;  5KYU A;  2V26 A;  3E9F A;  1TTH B;  2BZX A;  2J06 A;  4P5N A;  2B8A A;  3CCM T;  4GLM A;  1VQO T;  1YCS B;  2KXC A;  2NLU A;  1MMG A;  1RI9 A;  4PFZ A;  5CQX A;  2RHZ A;  5KE2 A;  4M7A C;  3E2U A;  1M90 U;  1GFC A;  2XKO C;  3RIR A;  3CXC S;  2P0K A;  3V7C A;  1Q7Y U;  4M78 G;  2LNH B;  1AZE A;  4FCY A;  1T3L A;  2KR3 A;  2DVE A;  1Z9Z A;  5LJ3 e;  1N27 A;  1BCM A;  3CPW A;  1LOJ A;  2DO3 A;  4DOV A;  3CCV Q;  4Z8A A;  5FWC A;  1M90 R;  2DIG A;  2C0I A;  1YHQ T;  3I55 Q;  3NHN A;  4NL2 A;  3CCS T;  2YUQ A;  1TUC A;  2QK0 A;  1BBZ A;  2DPP B;  2LRQ A;  4M77 A;  3M0U A;  2DBM A;  4C0F A;  2FHD A;  1PSF A;  1WHJ A;  4LN2 A;  5GAM f;  2RHY A;  1VQP Q;  4A4E A;  1N5Z A;  3EFO A;  5HKC A;  5IXB A;  1KQ1 A;  3VS4 A;  3CPW S;  5GAO p;  2PTK A;  2GTJ A;  1C6V X;  3A98 A;  3A8H B;  3CCR A;  4N4I A;  2QI2 A;  1M3B A;  3JB9 I;  4C0D C;  5LJ5 f;  2KAF A;  4RTT A;  3JRZ A;  4QVD A;  1K76 A;  2HCK A;  2LTO A;  1YBY A;  3M57 A;  1NM7 A;  4X1V A;  3RKX A;  1I1J A;  4J9D A;  2ED0 A;  2KRO A;  4J7I A;  1WHL A;  2KNB B;  3RKY A;  3FJP A;  1Q81 U;  5GAN 2;  2BIV A;  2CKK A;  3HL8 A;  2WSC E;  4EMK C;  1J3T A;  3OQ5 A;  1RAE B;  4C92 B;  1VQ5 T;  1YCY A;  2RF0 A;  3G6E A;  3FRN A;  3PIP A;  3OYJ A;  2A0F B;  2E64 A;  4M7D E;  3QZ5 B;  2SRC A;  1K4U S;  3MEV A;  4Q5W A;  3QDR B;  4C92 D;  6AT1 B;  3WVD B;  4AG1 C;  2P4T A;  1U5S A;  2AZS A;  2GF7 A;  1YJN A;  1AWO A;  2ZPB B;  2YRD A;  1K73 U;  1M1K C;  3M0T A;  1B34 B;  4EMK A;  4LUE A;  4RKU E;  1RI0 A;  4F7U E;  2RQR A;  3QBY A;  1B07 A;  1QW1 A;  4O5V A;  1C0M A;  2OX7 A;  2K5L A;  3CCR Q;  2NUT B;  3RKW A;  1NJI R;  3EG9 B;  4A4H A;  1QWF A;  1OPL A;  1TS9 A;  4EMG A;  3OMG A;  3OBW A;  1H3Z A;  2HL5 C;  2E65 A;  1QVF P;  3HHT B;  5L8R E;  3P8H A;  1K73 R;  2KY9 A;  3PTA A;  1K8A C;  2MAM A;  1T0H A;  3QWY A;  4E6R A;  1UHC A;  5DM7 R;  3RMS A;  1I0C A;  3S6W A;  3REB B;  2HZY A;  4ORZ A;  4PJO F;  3EGD A;  1FMV A;  1QCN A;  4A54 A;  1NPP A;  1AT1 B;  2PU9 B;  4JS5 A;  2R5M A;  3CCL A;  3CMA Q;  3JB9 J;  5FRO A;  1VQ6 A;  3QJ6 A;  3Q1J A;  4AFU C;  3G6E Q;  2Z0W A;  2A7Y A;  4PJN A;  4M7A F;  3M54 A;  5I2S A;  2DYB A;  4M7D C;  3VUB A;  2O4X B;  1IHW A;  1HYO A;  3C4S A;  3CCE T;  3HPW A;  1VQ9 Q;  2D6F A;  1YJN Q;  3S3N A;  1RL2 A;  1FX7 A;  2L5Q A;  3VJP A;  2QDL A;  2FVU A;  2CDT A;  1M8M A;  3H0H A;  2ZPG B;  2MCN A;  2AT1 B;  1B7T A;  3CCJ T;  5LL6 S;  2RB6 A;  4PJL A;  3HSB A;  1SRM A;  2L0A A;  1FWZ A;  2I2L A;  4PJO G;  4C0G A;  3J80 E;  1G8X A;  2WSE E;  1M2V A;  2OTJ T;  4J8O A;  1KQS A;  2DD5 A;  1MMN A;  2E41 A;  2XG8 D;  3C94 A;  1IRE B;  3OYC A;  2KVQ G;  5KYW A;  1I8F A;  1XQH A;  2NUP B;  4GBQ A;  4M7A G;  2CP7 A;  3EG2 A;  4Z89 A;  4BD3 A;  4TVR A;  4M78 E;  3OB9 A;  2QG9 B;  3BY7 A;  1EX4 A;  2JT4 A;  2ZZD A;  2DZC A;  1O9S A;  1KC8 U;  3CCL Q;  4J6X A;  2X3W D;  1VQ6 Q;  2HQE A;  2X51 A;  2HQX A;  2EBP A;  5IAY A;  2QDY B;  2RNA A;  2L89 A;  5CIU A;  1AWJ A;  3LH5 A;  2BTT A;  1KK7 A;  3PNW C;  4L59 A;  5GAO l;  5KYY B;  4GLK A;  3INZ A;  1OV3 A;  1UE9 A;  4IUR A;  2PVG B;  1JXO A;  3M56 A;  2OAW A;  4OB3 B;  4Y28 E;  2K3X A;  3CCV T;  2V1R A;  1I5L A;  1S72 A;  3JCM g;  1N8R R;  2O31 A;  3I55 T;  3R6O A;  2JNG A;  1U1T A;  1NZ9 A;  4XTV A;  4C5E A;  3VS1 A;  2YLB A;  4FW2 A;  3BDL A;  2QQA A;  4XU0 A;  3OYF A;  3IQL A;  3LGF A;  2HDA A;  2JVV A;  1SEM A;  4FM4 B;  1VQP T;  2KT1 A;  2X4J A;  1JO8 A;  1UGQ B;  2RJD A;  3DB3 A;  5D7U A;  1KSW A;  4F17 A;  2FPE A;  3EHQ A;  2DBK A;  4O6J A;  4HCB A;  3GLX A;  1Y71 A;  2GGR A;  1QCF A;  2XU8 A;  5FWB A;  5GAN f;  2HNI A;  4C8Q E;  4M78 C;  4N4H A;  5IT9 E;  2RQV A;  2YRV A;  5GAM e;  1GCQ A;  3GP8 A;  3ULR B;  1YNZ A;  3UDC A;  4FL6 A;  3AHU A;  1RAB B;  3M0P A;  2RM4 A;  3U23 A;  3VS3 A;  5GMK h;  2EYX A;  1ZBX A;  2PUK B;  2DKG A;  2PUO B;  5GAO m;  5I11 A;  3VRY A;  2DET A;  2XID A;  4M75 A;  3RUX A;  2EJ9 A;  4QT7 A;  5LJ5 e;  3NTK A;  3D7S B;  2OJ2 A;  2RHX A;  1S72 Q;  1GCP A;  3H41 A;  2RHU A;  4RG2 A;  2LMJ A;  1N6A A;  1YIT A;  2KQW A;  1MV3 A;  2K79 A;  4J5Y A;  3JCM X;  5GMK j;  4M7D F;  3MO8 A;  3UAT A;  2CSI A;  2EYQ A;  1QP3 A;  2EGA A;  2JTF A;  1ZSZ B;  1W1F A;  1UEB A;  2P0Q A;  3GNF B;  3CME A;  3JB9 G;  1U1S A;  2DTI A;  2EW3 A;  3KUF A;  4C8Q C;  3E1S A;  4BAC A;  3OYE A;  4E47 A;  4F7U F;  5CKH A;  1BCO A;  5ECA A;  1KHI A;  2HL3 A;  4RTU A;  3CCR T;  1HSQ A;  2DXC A;  2KXD A;  4F04 B;  3O8V A;  1U06 A;  4XTW A;  2K57 A;  2J6F A;  2DXU A;  4DBH A;  1ZQ1 A;  3MKD A;  4DA4 A;  2GQI A;  3CCJ A;  2K5F A;  1AWX A;  2GTO A;  4BUG A;  2X3X D;  4M7D G;  3PMI A;  5I22 A;  3L2Z A;  3JCM d;  3QXE B;  3A8L B;  1VQL Q;  2QQR A;  3QPH A;  4PL6 A;  1WNL A;  2P0P A;  1SSF A;  4OMN A;  1KD1 U;  3CMA T;  1D3B B;  1I81 A;  2LVM A;  2CP6 A;  1EFN A;  2EVR A;  4CC4 B;  1NG2 A;  3I5S A;  3G6E T;  2SEM A;  1JB0 E;  3QKJ A;  3HFN A;  1X6B A;  2RK2 A;  5GJW B;  4DBQ A;  4F7U G;  3M5A A;  1G2B A;  2DXB A;  3QYH B;  5J39 A;  2XI9 A;  4LXC A;  1VQ9 T;  4OML A;  1YJN T;  2ED1 A;  2QTV A;  1KHC A;  4JRK A;  4PJO B;  2DJZ A;  5KH6 A;  4IIM A;  1PSE A;  4OMP A;  1WHK A;  3CME Q;  4HCC A;  2CP2 A;  4M77 E;  1OOT A;  4CRI A;  5CQY A;  3PVQ A;  1D1B A;  4KGZ B;  4DEX A;  2KI7 A;  1UTI A;  2RJC A;  4M7A B;  1WHM A;  3DB4 A;  4BI3 A;  4OF1 A;  3TRE A;  4MDW A;  4JPB W;  2L2P A;  4RCC A;  2AIR B;  1SHG A;  1PC0 A;  2EGE A;  1K8A R;  4XTX A;  3UF4 A;  4K11 A;  2LJ3 A;  2K6D A;  1HXD A;  1VQO A;  4BE1 A;  2E6Z A;  1UFF A;  4KUD K;  4M7A D;  1E7O A;  4ZN1 A;  2BE9 B;  2K2V A;  3EFO B;  3ZL7 C;  1M8V A;  1FMW A;  5LJ3 g;  2KMT A;  2ABL A;  2FZG B;  1VQ4 A;  4YTL A;  2RQW A;  3JB9 H;  1MUZ A;  4F14 A;  5I2M A;  4CC2 A;  7AT1 B;  4M78 F;  2CZ6 B;  2FZK B;  3CXC A;  2OTL Q;  2QAS A;  1H64 1;  3ASK A;  3X24 B;  2CZ1 B;  4DBF A;  3CCL T;  2P4R A;  1VQ6 T;  2VKN A;  1NPR A;  1T0J A;  2XDP A;  4C5H A;  2LX7 A;  1BYM A;  2LT1 A;  3UA7 A;  1K0S A;  1IB8 A;  2VB6 A;  1IHV A;  3EFS A;  1IXD A;  3A8M B;  1I5O B;  1AOJ A;  1JQQ A;  2EQU A;  1PCX A;  1SHF A;  4JUV A;  2ESW A;  1OQK A;  1WI7 A;  3JCM b;  1VUB A;  4M77 C;  4C0D B;  4KH1 B;  1PD0 A;  1NE8 A;  4R55 A;  2I0N A;  4PKC C;  1BI3 A;  3M0R A;  1WFW A;  2G6F X;  1AEY A;  3EH1 A;  1W70 A;  2VWF A;  1VQO Q;  1Y96 A;  2DX1 A;  2V8K A;  2LDM A;  1Q86 C;  1JXM A;  1PRL C;  4QQD A;  4RCB A;  4Y91 A;  4EMK B;  3JAM E;  1VQ4 Q;  2J05 A;  5CAI A;  3URG A;  2M51 A;  1ZA2 B;  2EGC A;  4C8Q F;  1G3W A;  1GFD A;  2OI3 A;  1B3Q A;  3OS5 A;  3JCM h;  4A63 B;  3JCM V;  1R0C B;  3SWN A;  4DBR A;  1WHG A;  1Q82 C;  5GAN e;  2GBQ A;  4FSS A;  5GAO q;  3V7S A;  1BIB A;  2LQW A;  1D1C A;  2O88 A;  2CS7 A;  2QXF A;  1QWE A;  1LCK A;  2PZ1 A;  1EIF A;  3BE3 A;  3LYI A;  1HJD A;  1VQM Q;  2BE7 D;  4JZ3 A;  5FU6 C;  1RAH B;  3SEM A;  3EGD B;  5GMK l;  2EIF A;  4LE9 A;  5D6W A;  3M59 A;  3HRU A;  2ZAE A;  1ABQ A;  1ZA1 B;  2CP0 A;  1S72 T;  4X9D A;  2EQM A;  3VYG A;  3OYA A;  5HY6 A;  2LCS A;  5IHN A;  2HSE B;  1WQ7 A;  1OX8 A;  4C8Q G;  1W2B P;  4KT0 E;  3J7A F;  2YT6 A;  4DEY A;  2EPD A;  2XDB A;  1M5Q 1;  1RAF B;  2GQV A;  4ESR A;  3UWN A;  2HBP A;  4VUB A;  3CMA A;  3RES A;  1Q95 G;  4JRP A;  2CRE A;  1RAI B;  4AMC A;  4D8D A;  2MIO A;  2DFU A;  3MP6 A;  1JJ2 P;  3OYD A;  1PKS A;  2L3S A;  4E7H A;  4M7D B;  1OZ2 A;  1VQ9 A;  1NJI U;  4JLG A;  3DKM A;  3LWI A;  1IO6 A;  1X6O A;  1K9M C;  1PD1 A;  1M4Z A;  2NWM A;  4M7D D;  3A8O B;  4F7U B;  1VQL T;  3OS2 A;  1WGS A;  4OMO A;  2CSQ A;  5GMK m;  5GAN 5;  4HT8 A;  1WIE A;  1YIT T;  1X01 A;  4PFP A;  1WX6 A;  4PNO A;  4E2F B;  1TG0 A;  2VAS A;  1LJO A;  2KEA A;  2RQT A;  2VGN A;  4LNP A;  2E12 A;  2RI5 A;  1BU1 A;  1DJ7 B;  1V1C A;  2BKD N;  1VIE A;  3EGX B;  1F1B B;  4Y92 A;  1BB9 A;  3G71 A;  3CME T;  1NYG A;  1FYN A;  3JCM P;  3QYG B;  2DM1 A;  5HK3 A;  2CT3 A;  2JM9 A;  4M77 F;  4N0A A;  5FU7 C;  1E6H A;  2DXT A;  2EYZ A;  3T9N A;  4BE0 A;  1QVG P;  4D8K A;  2COZ A;  2M0Y A;  4QQG A;  4NS5 A;  4C5G A;  1JEG A;  1R8O B;  2DEU A;  2JXB A;  2DE0 X;  1YI2 A;  4JLI A;  2HD0 A;  5DLQ E;  1RAG B;  5D6Y A;  3QHS A;  1GBR A;  1VYV A;  4ZGJ B;  2V8J A;  1XOV A;  2EQI A;  3X28 B;  3G7Z A;  3FIF A;  1PWT A;  3TSW A;  1D0X A;  4EPC A;  4C92 A;  1KJW A;  2A28 A;  4B9X A;  2HQH A;  5GAO r;  1V76 A;  3LGL A;  2LJ1 A;  1YJW Q;  4M77 G;  3OW2 P;  4JS4 A;  4M75 E;  4GY5 A;  2DRM A;  3A1P A;  1YN8 A;  4J9G A;  1OEB A;  1VQ8 A;  4B6M A;  1WPY A;  5CR2 A;  4J9F A;  3HRT A;  1D0Z A;  1NLP C;  4M78 B;  3MPU B;  5LJ3 h;  1NBE B;  2F2X A;  1BI1 A;  2FYK A;  3G71 Q;  4RTV A;  3RER A;  5IH2 A;  5GAM g;  3CBM A;  1B34 A;  4LD9 K;  1VIF A;  4NOY A;  1N8R U;  1UG1 A;  1WA7 A;  1M90 C;  4M78 D;  3BDU A;  4MML A;  3L2W A;  2EQK A;  2NUT A;  4ANJ A;  4KH0 B;  1FXX A;  2DF6 A;  3EG9 A;  1Q7Y C;  5CKD A;  1Y7X A;  1PRM C;  4QW2 A;  3NPF A;  2RK1 A;  3TU4 K;  3P8B B;  2HBW A;  3OA6 A; 
#chains in the Genus database with same CATH homology
 5CQX A;  2RH2 A;  3FDR A;  2RHZ A;  5KE2 A;  2DXU A;  5LJ3 j;  2KDS A;  4N0A C;  4M7A C;  1ZQ1 A;  4E7K A;  1KD1 C;  2RA2 A;  5LJ5 g;  4DA4 A;  1M90 U;  2XKO C;  3RIR A;  5D6X A;  3CXC S;  2P0K A;  3CCJ A;  1VQ4 T;  2MF2 A;  5GAN 8;  2K5F A;  2RJE A;  2WSF E;  3V7C A;  1MHN A;  3KBG A;  3I56 A;  1YJW A;  4UC4 A;  4BUG A;  1Q7Y U;  4M78 G;  4KUL A;  3OYG A;  4M7D G;  3PMI A;  3L2Z A;  2BUD A;  2CZ7 B;  3JCM d;  3QXE B;  3A8L B;  2DVE A;  2QQR A;  5LJ3 e;  4ZN3 A;  3X20 B;  2VUB A;  3QPH A;  1N27 A;  4PL6 A;  3OYM A;  3CPW A;  1WNL A;  2P0P A;  1QVF A;  1SSF A;  1LOJ A;  2DO3 A;  4DOV A;  3OYH A;  1Y07 A;  1KD1 U;  3LW5 E;  3CC2 T;  2VXE A;  1D3B B;  2WAC A;  3CMA T;  1I81 A;  3JCM W;  2LVM A;  1OYX A;  2DIG A;  2JZ2 A;  1YHQ T;  2EKO A;  3HKS A;  3G6E T;  2JN0 A;  2VC8 A;  2D0Q B;  1JB0 E;  4NL2 A;  3CCS T;  3DLM A;  3HFN A;  3QKJ A;  4M75 C;  5AYF A;  2RK2 A;  2DPP B;  2MI6 A;  2O4X A;  3FEO A;  2LRQ A;  4F7U G;  3TCJ A;  4M77 A;  3M5A A;  2DXB A;  3EFR A;  3QYH B;  5J39 A;  4HA8 A;  2JUF A;  4C92 C;  2XI9 A;  1VQM T;  2FB7 A;  4C0F A;  1VQ9 T;  1YJN T;  4C8Q B;  5A0G A;  2FHD A;  1PSF A;  3OMC A;  4KUI A;  3S3O A;  1KHC A;  3M9Q A;  4JRK A;  2DJZ A;  5GAM f;  4PJO B;  5KH6 A;  2RHY A;  4A4E A;  2L3R A;  2ZCF B;  1BI0 A;  1PSE A;  2F5T X;  5FRN A;  3JCM c;  2E10 A;  4HCC A;  4M77 E;  4CRI A;  5CQY A;  5HKC A;  4JRI A;  1KQ1 A;  2LCC A;  1OZ3 A;  1OI1 A;  3OY9 A;  1HK9 A;  3JB9 F;  4C8Q D;  3CPW S;  1QVF S;  2RJC A;  2ZPE B;  4M7A B;  5GAO p;  3BFM A;  3DB4 A;  3LX7 A;  2QEX T;  4BI3 A;  2E6N A;  4OF1 A;  3TRE A;  4MDW A;  1JBM A;  2MWP A;  3CCQ T;  3A8H B;  3HFO A;  4RCC A;  3CCR A;  3GPL A;  1BIA A;  4BDZ A;  3HRS A;  1G3S A;  2EAY A;  3CEY A;  1BKB A;  4N4I A;  1VQL A;  2QI2 A;  2XK0 A;  3JB9 I;  2RHI A;  1Q81 C;  2OTL T;  3CCM A;  2M1H A;  4XTX A;  4C0D C;  5LJ5 f;  2KAF A;  1HXD A;  1I4K 1;  1VQO A;  3JRZ A;  2LT4 A;  4QVD A;  4XK8 E;  2E6Z A;  4BE1 A;  4KUD K;  1YJ9 T;  4M7A D;  4OP0 A;  4ZN1 A;  2K2V A;  1M8V A;  1W4S A;  3M4G A;  4FSX A;  2LTO A;  3MP8 A;  5LJ3 g;  2KMT A;  5GMK i;  1YBY A;  3M57 A;  1VQ4 A;  5J3B A;  4ZGD B;  4YTL A;  1W2B A;  3RKX A;  2QA4 T;  2MMP A;  2VV5 A;  2X4Y A;  4C0Z A;  3JB9 H;  3PGG A;  5I2M A;  4BI4 A;  4II1 A;  4ZGE B;  3L2Q A;  4M78 F;  3QII A;  2CZ6 B;  4BI8 B;  4J7I A;  1Q81 U;  3RKY A;  3FJP A;  4M75 B;  4ZTJ A;  5GAN 2;  4M7D A;  3CXC A;  2BIV A;  5FRM A;  2LNV A;  2CKK A;  3HL8 A;  1H64 1;  2WSC E;  3ASK A;  4EMK C;  2X4W A;  1XNI A;  3X24 B;  3OQ5 A;  2CZ1 B;  2XDD A;  3CCL T;  4C92 B;  3OYB A;  1VQ6 T;  2EFI A;  1VQ5 T;  3CC2 A;  1M1F A;  1YCY A;  4ATO A;  3SDZ A;  1NPR A;  1YHQ A;  2XDP A;  1XTD A;  3VV0 A;  4C5H A;  3G6E A;  3FRN A;  1K73 C;  4M75 D;  3ZBD A;  3PIP A;  3OYJ A;  3CCS A;  3QSU A;  4E7L A;  2E64 A;  2V8I A;  1JJ2 A;  2LT1 A;  2RI3 A;  3QZ5 B;  4M7D E;  1BYM A;  2DD4 A;  3P8D A;  4IUU A;  5GAM d;  3EFS A;  3MEV A;  4LDV A;  4Q5W A;  3QDR B;  4F7U A;  4C92 D;  3WVD B;  2K3Y A;  2OAU A;  2P4T A;  2GF7 A;  3A8M B;  3BW1 A;  4XTZ A;  4C5I A;  1JRI A;  2ZPB B;  1YJN A;  3VKI A;  2EQU A;  2DEQ A;  4OGC A;  3N5B B;  1W2B S;  3CD6 A;  2ZPI B;  2G3R A;  4D6W A;  4JUV A;  2VXF A;  3GNG A;  3RMQ A;  3JCM b;  1K73 U;  1M1K C;  1VUB A;  4M77 C;  1B34 B;  4EMK A;  2F69 A;  3QJY A;  4DOW A;  4C0D B;  5A0D A;  5GAN h;  4RKU E;  2XHC A;  1RI0 A;  5C0M A;  4MZP A;  4F7U E;  1NE8 A;  4R55 A;  3QBY A;  3NTI A;  3SD4 A;  1KQS S;  1KQ2 A;  4WF2 A;  1QW1 A;  4PKC C;  4O5V A;  4IUV A;  1BI3 A;  4OB0 B;  1VQK T;  2K5L A;  2QEX A;  1O75 A;  3OW2 S;  3RKW A;  5LJ5 d;  3CCQ A;  5GAO n;  3ZEH A;  4A4H A;  5A2Q E;  3OYY A;  3OMG A;  3QO3 A;  3PT9 A;  4EMG A;  2R5A A;  3OBW A;  2OTL A;  1H3Z A;  2E65 A;  1Y96 A;  1JJ2 S;  5LJ3 f;  1M1K U;  2V8K A;  2L8D A;  2LDM A;  3HHT B;  5I21 A;  5L8R E;  3P8H A;  1Q86 C;  2KY9 A;  3PFS A;  1YJ9 A;  4QQD A;  4RCB A;  4XTU A;  4Y91 A;  3PTA A;  4XTY A;  2MAM A;  1K8A C;  4EMK B;  4JDS A;  3JAM E;  2LQK A;  5CKE A;  5HK0 A;  3CC4 T;  5FLX E;  5CAI A;  2FL7 A;  5A0L A;  3URG A;  5DM7 R;  5GAN j;  2QA4 A;  3CBO A;  3E9G A;  3RMS A;  4OMF B;  2CZ0 B;  3S6W A;  2EJF A;  4C8Q F;  3JCM J;  1G3W A;  3LWH A;  2LQ8 A;  4PJO F;  3OS5 A;  3JCM h;  3JCM V;  2GFA A;  4A54 A;  3SWN A;  1Q86 U;  1TH7 A;  2H3J A;  1NPP A;  4IUT A;  2PU9 B;  4JS5 A;  2R5M A;  2AHJ B;  1K8A U;  3CCL A;  2CGH A;  3JB9 J;  1Q82 C;  2IVW A;  5FRO A;  4A53 A;  5GAN e;  1VQ6 A;  1VQ5 A;  3QZ9 B;  3QJ6 A;  3Q1J A;  2X4X A;  5GAO q;  3GF5 A;  3V7S A;  1BIB A;  3J81 E;  2A7Y A;  3FC3 A;  2CS7 A;  3M54 A;  2QXF A;  4OB2 B;  4BB7 A;  5I2S A;  1QVG A;  4M7A F;  4XU2 A;  3NFC A;  4M7D C;  3VUB A;  2O4X B;  1EIF A;  1N9R A;  3NTH A;  4M77 B;  4PJO D;  3C4S A;  3LYI A;  3CCE T;  3SFM A;  3OS1 A;  1G5V A;  3HPW A;  2D6F A;  1QP2 A;  2GFU A;  5M9O A;  5GAN 7;  3S3N A;  5FU6 C;  3PIO A;  2ZPF B;  1RL2 A;  5GMK l;  1FX7 A;  2L5Q A;  2DTH A;  2EIF A;  3VJP A;  2M0O A;  1Q82 U;  5D6W A;  3L42 A;  3M59 A;  3HRU A;  3X26 B;  2FVU A;  1KG1 A;  3OSS C;  1S72 T;  4X9D A;  2ZPG B;  1M1G A;  3MEW A;  2EQM A;  4M77 D;  3VYG A;  5LL6 S;  3OS0 A;  3CCJ T;  3S3M A;  2RB6 A;  3MHX A;  3OYA A;  3HSB A;  5HY6 A;  2GCX A;  3E19 A;  4RG8 A;  2HAX A;  5KCO A;  3ZFJ A;  1WQ7 A;  2VGM A;  2RO0 A;  4NL3 A;  4C8Q G;  4M75 F;  1VQK A;  1FWZ A;  4A4K A;  4KT0 E;  2I2L A;  3JCM e;  4PJO G;  4C0G A;  4HKE A;  3J7A F;  4QQ6 A;  4L5G A;  4MMK A;  1P92 A;  2DK3 A;  4M78 A;  3J80 E;  2XDB A;  3OSV A;  2WSE E;  4N4G A;  2OTJ T;  4J8O A;  4C92 F;  1QVG S;  1KQS A;  2DD5 A;  1KC8 C;  2E41 A;  3OYN A;  2XG8 D;  3C94 A;  1M5Q 1;  1IRE B;  1G3T A;  2D9T A;  2GQV A;  3OYC A;  1NJI C;  3UWN A;  2HBP A;  4VUB A;  3G71 T;  3JSC A;  2KVQ G;  3OW2 A;  1I8F A;  3CMA A;  1XQH A;  3RES A;  4M7A G;  4MZT A;  3FLG A;  4J7F A;  2E70 A;  5CVI A;  3VYH B;  3WVE B;  4BD3 A;  4R56 A;  4JRP A;  3DLL A;  3CC4 A;  4TVR A;  4M78 E;  3OB9 A;  2DTO A;  2QQB A;  2RJF A;  3MP6 A;  3BY7 A;  3L2R A;  3ME9 A;  3GOX A;  3CBP A;  3OYD A;  5GAN g;  2ZZD A;  1QVP A;  2DZC A;  2E1H A;  2LCL A;  2VYT A;  4EDU A;  1O9S A;  4E7H A;  1VQM A;  1KC8 U;  4M7D B;  1OZ2 A;  1VQ9 A;  1NJI U;  3VUZ A;  4HCZ A;  4FT4 A;  4OVA A;  3MP1 A;  3LLR A;  4JLG A;  3DKM A;  3LWI A;  3JCM Q;  2DAQ A;  4J6X A;  1X6O A;  1YI2 T;  2HQE A;  1K9M C;  2HQX A;  4ME7 A;  5FU6 B;  5IAY A;  2QDY B;  3OBY A;  1VQN T;  3UT1 A;  1UGP B;  2L89 A;  5CIU A;  5C6S A;  2Y90 A;  1M4Z A;  2RD1 A;  2Y4X A;  5GAN 3;  3PNW C;  4MZM A;  4L59 A;  4J83 A;  3G4S T;  5GAO l;  4M7D D;  4JRQ A;  5DY9 A;  4M75 G;  4GLK A;  3A8O B;  3INZ A;  3FB9 A;  3SWN C;  4ELZ C;  3TEE A;  4QVC A;  4IUR A;  4F7U B;  2PVG B;  4A4G A;  3CCE A;  1VQL T;  2QTX A;  3M56 A;  5GAM h;  3OS2 A;  4FIB A;  1WGS A;  4OB1 B;  4KBM B;  4C92 G;  3OYI A;  4OB3 B;  3M4Y A;  5CK9 A;  1K9M U;  1GXI E;  4Y28 E;  5KCH A;  5GMK m;  3KXT A;  2E5Q A;  2MWO A;  2ZGW A;  2K3X A;  3M53 A;  2KK4 A;  1D3B A;  4X34 A;  3VU3 C;  3CCV T;  1I5L A;  1S72 A;  4LDX A;  2KSS A;  3JCM g;  5GAN 5;  4XU3 A;  3F70 A;  4L6V 5;  4OGE A;  4HT8 A;  3I55 T;  4LDW A;  3R6O A;  2JNG A;  1U1T A;  1YIT T;  1X01 A;  1NZ9 A;  3L2V A;  4XTV A;  3PMT A;  4PNO A;  4BY6 C;  1M9S A;  4IUQ A;  1VQ8 T;  1VQ7 T;  4LD6 A;  3MET A;  4C5E A;  5DLO A;  2K5I A;  3OYK A;  2YLB A;  3A8G B;  3QG1 A;  1WJR A;  1LJO A;  5CCA A;  3BDL A;  2QQA A;  4C8Q A;  4XU0 A;  3TU4 K;  3OYF A;  2X35 A;  2VGN A;  3LGF A;  3L2U A;  3L1A A;  4PJO A;  2QQ9 A;  2K4Y A;  2JVV A;  2E12 A;  2RI5 A;  4XQ3 A;  4FM4 B;  5LJ5 h;  1DJ7 B;  2OTJ A;  2BKD N;  1G3Y A;  1VIE A;  1ZHI A;  1BI2 A;  5GAM j;  3CCU T;  2X4J A;  1Y96 B;  4XAX B;  1VQP T;  5J26 A;  2XD0 A;  1UGQ B;  2RJD A;  3DB3 A;  4A4F A;  4BDY A;  3CC7 T;  2IG0 A;  4IUP A;  3G71 A;  3CME T;  2YHT A;  3JCM P;  2EQJ A;  1WQW A;  3QYG B;  4O6J A;  2EWN A;  4Z02 A;  5HK3 A;  4HCB A;  3GLX A;  2Y4Y A;  1Y71 A;  2XU8 A;  5GAN f;  5GAN 4;  2HNI A;  4M77 F;  4N0A A;  5FU7 C;  2DXT A;  3V8L A;  1IZ6 A;  4M78 C;  4C8Q E;  4E7J A;  4M7A A;  3QUI A;  1WJQ A;  3T9N A;  4BE0 A;  4N4H A;  5IT9 E;  4PJO E;  4LDU A;  2YRV A;  1X75 C;  5GAM e;  3GP8 A;  5CO7 A;  4E7I A;  3C95 A;  4QQG A;  1AHJ B;  4LDY A;  4NS5 A;  3UDC A;  4C5G A;  4FL6 A;  1YIJ T;  1U8R A;  1R8O B;  3CD6 T;  3AHU A;  4J6W A;  3SWN B;  2C06 A;  3C12 A;  1UB4 A;  2R58 A;  1MGQ A;  2JTM A;  2YLC A;  3WXM B;  5LJ5 j;  2XIC A;  1YI2 A;  4M7A E;  2RM4 A;  4JLI A;  2HD0 A;  2CYZ B;  5DLQ E;  4HT9 A;  1VQN A;  5D6Y A;  3QHS A;  3HP9 A;  2O01 E;  4RMO A;  4FU6 A;  1YJW T;  1UGR B;  4MDX A;  3I56 T;  4ZGJ B;  5GMK h;  2V8J A;  3G4S A;  3V8J A;  3EAE A;  1ZBX A;  1XOV A;  3V8K A;  2PUK B;  2DKG A;  2PUO B;  5GAO m;  3X28 B;  2LC4 A;  4XU1 A;  2JOY A;  1V29 B;  2XID A;  4J6Y A;  4M75 A;  3RUX A;  2EJ9 A;  3G7Z A;  5LJ5 e;  3FIF A;  4PLI A;  2DZ9 A;  3NTK A;  5LJ3 d;  5CKF A;  3MEA A;  4ZTF A;  4BE2 A;  4BY6 B;  4V2S A;  2LX9 A;  4FT2 A;  3JCM f;  3ER0 A;  4EPC A;  2RHX A;  4C92 A;  4B9X A;  5GAO r;  3CCV A;  3JB9 D;  1WJS A;  2RHU A;  3OYL A;  3LGL A;  2RI2 A;  4RG2 A;  1N6A A;  5IN1 A;  3M58 A;  5CKB A;  3I55 A;  2QQS A;  4M77 G;  5GAN 6;  4JS4 A;  4M75 E;  3H8Z A;  4GY5 A;  1YIT A;  4IKF A;  2KQW A;  4EMH A;  5KE3 A;  2F5K A;  1LNX A;  4J5Y A;  4CI0 C;  5EG2 A;  1N9S A;  4QVZ A;  1N8R C;  3MCA B;  1VQ8 A;  3A5Z B;  1VQ7 A;  3V7R A;  3JCM X;  2M9U A;  1WPY A;  2M16 A;  5GMK j;  4C92 E;  3MO8 A;  4B9W A;  3HRT A;  5CR2 A;  3GIB A;  2EJG A;  4M7D F;  5FU7 B;  4DQ2 A;  4M78 B;  3UPU A;  2EYQ A;  2PVO B;  4X9C A;  1QP3 A;  5LJ3 h;  2JTF A;  3M55 A;  1BI1 A;  1VQP A;  2FYK A;  3CCU A;  4ELY C;  1UEB A;  3LH0 A;  2PVD B;  5GAN d;  4PLL A;  2R57 A;  3RER A;  2P0Q A;  3CBM A;  3H6Z A;  3GNF B;  5GAM g;  1B34 A;  3CC7 A;  3CME A;  1UGS B;  3JB9 G;  2PQW A;  1U1S A;  2DTI A;  5GMK e;  4LD9 K;  1VIF A;  2ZPH B;  4NOY A;  3KUF A;  1N8R U;  1M90 C;  4M78 D;  4C8Q C;  3CPF A;  3E1S A;  3BDU A;  4MML A;  3L2W A;  3OYE A;  4BAC A;  3SB2 A;  4E47 A;  2EQK A;  4PJO C;  4F7U F;  3X25 B;  5CKH A;  3E9F A;  3MEU A;  1FXX A;  1KHI A;  3CCR T;  1Q7Y C;  5CKD A;  1Y7X A;  4P5N A;  2B8A A;  2DXC A;  4JJN K;  2DIQ A;  3CCM T;  1YIJ A;  4QW2 A;  3O8V A;  2A3L A;  2RK1 A;  4XTW A;  2NLU A;  3P8B B;  1VQO T;  2K57 A;  3OA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...