3SWNB

Structure of the lsm657 complex: an assembly intermediate of the lsm1 7 and lsm2 8 rings
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
SSPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVNGKKTNVYGDAFIRGNNVLYVSAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm7
publication title Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein
total genus 15
structure length 71
sequence length 71
chains with identical sequence E, Q, T
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3swnB00
3V8LA 1M5Q1 4PJOB 3QO3A 4JLIA 5LJ5g 5LJ3g 2I2LA 3L2ZA 5GAMd 3HSBA 1HK9A 4F7UA 5GAN4 5GAMf 1I5LA 1N9RA 2VXFA 5GAMj 3JB9I 5GAMe 4M75D 4C8QD 4M7DD 3RERA 3JB9G 4M7AE 1WPYA 4M78D 5LJ5f 4X9DA 4M75C 4M77F 3V8JA 2DEQA 1I4K1 2E1HA 4C8QC 1WNLA 4XTVA 5GAN6 3JCMd 4M78C 2EAYA 4XTUA 5GAOl 1JRIA 1KQ2A 4J5YA 4F7UF 4M7AG 1LOJA 5CAIA 4N0AC 1MGQA 3JCMe 4M7AA 4M7AF 4PJOA 3QHSA 4C8QA 4XTWA 4DQ2A 1YCYA 3JB9J 4M78A 1LNXA 4M77E 5GAMg 5GAN8 2QTXA 5GMKi 4HT9A 1D3BA 4WF2A 2EJ9A 2EWNA 3JCMJ 2DXTA 4F7UE 3AHUA 3EFRA 4NL3A 4M75B 3EFSA 4HA8A 1N9SA 4M77G 3RKYA 3SB2A 1U1SA 1Y96A 2FYKA 4C8QB 4M78B 4JUVA 5GAOr 4PJOF 2YHTA 3JCMg 4C8QF 1M8VA 1D3BB 3FIFA 3RESA 2E10A 4F7UG 5GAOq 4M78F 5GAOp 2JN0A 3JCMW 3BDUA 3INZA 4OP0A 4EMHA 3FB9A 2DVEA 2E65A 2DXUA 4EMGA 1Y96B 2DJZA 2RD1A 4NL2A 5I21A 3JCMf 5GMKh 4PJOE 5GANh 5GAOn 5LJ3h 4C8QE 4J6XA 2EJGA 2RB6A 4C92D 2RA2A 4M78E 2DTOA 4M75A 4M7DA 2E64A 3RIRA 3JB9D 4C92C 4PJOG 4C8QG 3RUXA 4EMKC 4M7AD 3JCMQ 4M78G 4N0AA 4RCBA 4M7AC 1I81A 3L1AA 1X01A 3RKXA 4C92A 1I8FA 4J6YA 5GANd 5DY9A 3BW1A 4XTYA 5GAN5 2CGHA 4M75F 4M7DF 2DTIA 2DKGA 2DZ9A 4XU0A 3BFMA 4MMKA 1WQWA 4M7DC 2YLBA 1H641 4QVDA 4M77D 3JCMX 3JCMb 1BIAA 1WQ7A 5GAMh 3SWNC 5GMKm 4C92B 2Y90A 4M77C 2DZCA 4EMKB 3VU3C 4XU3A 2ZGWA 4C92F 5GAN7 3JCMV 2VC8A 4JRKA 4M75E 2YLCA 4M7AB 4XTXA 4A53A 5LJ5h 3JB9F 3HFOA 4M7DB 3SWNA 4RCCA 1B34B 1JBMA 4A54A 2VXEA 5GANg 4M75G 4M7DG 4HT8A 4XU1A 2K57A 4NOYA 1HXDA 1LJOA 3V7RA 4C92E 4M7DE 4XU2A 4MMLA 2DTHA 3QUIA 3SWNB 4J6WA 3BY7A 4PJOD 4M77B 3HFNA 3QSUA 3JCMc 5LJ3d 5LJ5d 2RM4A 4EMKA 5GANf 4PJOC 2EJFA 3M4GA 2FB7A 5LJ3f 4C92G 5GMKj 5GANj 3FJPA 3V7SA 4F7UB 5GANe 4XTZA 2HNIA 5GMKe 3V8KA 5LJ3e 5LJ3j 4X9CA 5LJ5j 5LJ5e 4PNOA 3V7CA 5GAOm 3JCMP 1B34A 5GMKl 3JB9H 4V2SA 1TH7A 4JRIA 1KQ1A 4XQ3A 1BIBA 2E41A 3PGGA 5GAN2 4Y91A 5GAN3 4QVCA 3JCMh 1U1TA 4M77A 3RKWA 3GIBA
chains in the Genus database with same CATH superfamily
2QEXT 2A28A 3CC2Q 3EGXA 2VXFA 1K8AR 4J9GA 3LLRA 2JXBA 2OX7A 4A63B 3CMEA 3CPWP 2RQTA 2RN8A 4XTUA 1G3TA 3VS6A 1T3SA 4MZPA 2FVUA 3NMZC 4PJOA 4C5HA 3A8MB 3QYHB 2DK3A 2E4HA 3AHUA 3CCQT 4HA8A 4V2SA 5GAOr 3M0SA 3JCMg 2EFIA 2QAZA 1CKAA 4QQDA 2DVEA 5J39A 2F1LA 3PNWC 2NWMA 4OMNA 5CKHA 3OYKA 4E7KA 5KCOA 3MO8A 1VQ7A 3M53A 4M78E 1FMKA 5EG2A 4B6MA 3R6OA 1SRLA 4C92C 2OTJT 3I56Q 2LCLA 3PTAA 2PVOB 1KK7A 2JNGA 2LCSA 2BE9B 2K3XA 4M7DF 2DO3A 2EGEA 1G3WA 3VYGA 5FRMA 3GLXA 3TREA 1I0CA 3HRSA 2QI2A 4A53A 2YLCA 2DX1A 4J9IA 2A0FB 5KYWA 1MMAA 2QDYB 3OS1A 4M7DG 2RHIA 1VQNA 1CKBA 3L2QA 2JUFA 3CCMQ 3OYYA 3G71Q 3SWNB 4J6WA 1VQ4T 1PRMC 3M4GA 4EIKA 2NUPB 4XTZA 1Q81R 1VQPT 3JCMP 4ZN1A 2DNUA 3CC4T 2XI9A 2FZKB 4JRIA 1M4ZA 1IREB 1SHFA 2BZXA 3DB3A 2LJ0A 2LNHB 4PJMA 2NUZA 3CMEQ 3G1JA 2PTKA 1QCFA 3L2ZA 4ZN3A 2PU9B 3TEEA 2RJEA 3KFVA 1GFCA 4C8QC 1HJDA 2DEQA 4DBRA 1UEBA 1UE9A 2KNBB 1RAFB 2Y4YA 1JRIA 1M9SA 2ROTA 3HHTB 4F14A 2JM9A 3URGA 3NFCA 2V8JA 4IURA 1WXUA 4XTWA 1AHJB 3UF4A 1S1NA 3C0CA 2HBWA 3G6ET 1VIFA 3CCRA 1QVFP 1FXXA 1Q95G 3CCLA 3BDUA 2YUPA 3FB9A 2J6FA 2M02A 5GANh 1OULA 3ZFJA 3L2UA 2EJGA 2E64A 2E5QA 4OMOA 5A2QE 4M7AD 3RMSA 3FDRA 4BACA 3O8VA 4LN2A 3H0IA 3SDZA 1G5VA 2PUKB 1YJNA 1WQWA 2B86A 4EDUA 5IXBA 1VQNQ 2XDBA 2H3JA 2JMAA 4XU3A 2FHDA 2D0NA 4M7AB 3MP6A 3JAME 1H3HA 3FJ5A 4NOYA 5GJVB 4X34A 1M3BA 1UG1A 3S3OA 3HRTA 4DBFA 2HEQA 1ZA1B 1YJ9T 2X4YA 1KQSP 5LJ5e 4PNOA 1K9AA 2CT4A 2CH4W 2XDPA 2C0IA 2KRSA 4KGXB 5L23A 3WVEB 2J6KA 3I5RA 1RI0A 3VS3A 1PD0A 2ZPGB 3QIIA 4J7IA 1ZHIA 1YI2A 1FWZA 2GBQA 1M30A 3HRUA 3NTHA 5CVIA 2QGFB 4JZ4A 2SEMA 4KUDK 4M7DC 1E6HA 1ABOA 3CCRQ 2FL7A 4AMCA 4F7UF 4ATOA 1MGQA 2DL3A 1JJ2S 1J3TA 1G3SA 4YTLA 5GAMg 2V1RA 3CCLQ 5AYFA 2J06A 1VQ5T 2JT4A 1PC0A 1PRLC 4F16A 2GQVA 2QEXQ 4FYYB 2QK0A 4QQGA 2DL5A 4E47A 2KMTA 4F7UG 1JQQA 3M5AA 2GGRA 2LQNA 2AK5A 1N6AA 1YITA 1ZQ1A 5I21A 1VQ8A 2NLUA 4E7JA 4UC4A 4ZGJB 4J6XA 2RA2A 2DTOA 2DRKA 2EQJA 2K7AA 3EH1A 1YJNQ 2E70A 1GFDA 3EFOA 4LDXA 2RF0A 1UFFA 3CCQQ 2KROA 4MDXA 4B9XA 3CCJT 1NJIR 1M8MA 3BFMA 4M77D 1KJWA 2YDLA 3QDFA 1T0JA 2RJCA 1K0XA 2ZPIB 4EMKB 3JCMV 2J05A 5I2MA 4E7SA 1D09B 4FSXA 4C0GA 4RCCA 3L42A 3REAB 3H9NA 2OTJQ 3I5SA 1VYTA 3MP8A 4ZTFA 3V7RA 3BDLA 3GF5A 1OX9A 1KHCA 4M77B 1N27A 3LW5E 2H8HA 1QVGP 2YSQA 5GJWB 3QWXX 4E7LA 2RQVA 2XHCA 1YI2Q 2DAQA 4A4HA 3PMIA 2EYQA 3OYJA 1GXIE 2QQRA 1NM7A 2LX7A 1H3ZA 5LJ3g 2RI3A 1M90U 1HK9A 3CC2T 4BDZA 5GAMf 1I5LA 1PKTA 4J9BA 4FW2A 2R57A 1YIJA 4M7AE 1VQ4Q 3MEUA 2BIVA 2I0NA 2IPOB 2QDLA 4BY6C 1PNJA 2RQUA 2EAYA 3BE3A 5KYXA 2DEUA 1VQPQ 1LOJA 2ZPHB 5FROA 4HT9A 1BK2A 2CUDA 2X51A 3DB4A 1FMVA 1YITQ 2MK5A 3E1SA 4DBHA 3EGUA 1UGPB 3QZ5B 2E65A 2EQIA 2GFAA 4AFSC 3M0PA 2KE9A 2M51A 4JJNK 4FM4B 6AT1B 1BBZA 4C5IA 3I56T 3HP9A 1TWBA 1G3YA 4PFZA 2NUTB 3G6EQ 1X01A 1K8AU 1K73C 2ZPFB 1KD1C 1RLPC 1PM3A 4QKUA 4Z8AA 2L3QA 2QYZA 4X1VA 5GMKm 2Y90A 3VU3C 2YXYA 2E6ZA 1OPKA 5CCAA 3X28B 4A54A 1PSEA 5FWCA 5GANg 1VQMA 4XU1A 1QCOA 3CCMT 2QASA 3OYLA 3EG9A 3G71T 4ANJA 5IHKA 4FYVB 5LJ5d 5LJ3f 5GMKj 2EYZA 3OBYA 2IG0A 2FEIA 4FIBA 3V7CA 1M27C 2V8IA 1OI1A 1AD5A 2DBKA 1BIBA 2F5KA 1IRXA 2KVQG 2VWFA 4LD9K 5GAN3 1YIJQ 4FSSA 3M0UA 3CMET 2ABLA 3OYMA 4KBMB 4R0KA 3TCJA 3CCEA 1R0BG 2LVMA 2RK1A 5GAMj 4HXJA 4C0ZA 1D0XA 2KXDA 3QDRB 4M78D 5LJ5f 1WHMA 1WHLA 1ZUYA 2BZYA 5GAOl 1GBQA 3JCMe 2DYIA 1BI3A 1YCYA 3JB9J 1WGSA 1X43A 2JS0A 4M77E 1IGQA 3SEMA 3UWNA 4M4ZA 3VKIA 2LP5A 5KH6A 2Y4XA 1VQ7T 3H6ZA 4M78B 3OBWA 1WJQA 4BI3A 1Q81U 4JDSA 3FC3A 2D6FA 2FPFA 5DLQE 1V1CA 1VQ6A 3QJ6A 4M7DA 3RUXA 5IH2A 3JCMQ 4HKEA 4A4KA 1RABB 2XIDA 5A0GA 2PZ1A 2CZ1B 1VIEA 1N8RR 2DTIA 3L2VA 1XJWB 4J7FA 2YRCA 1G2BA 1VQNT 1WQ7A 4RTTA 2FO0A 2IVWA 2DJQA 2EYXA 4OB2B 1WXBA 2LQ8A 5FU7B 4C92E 1D1BA 2DTHA 5HCKA 2O88A 2MWPA 3BY7A 3JCMc 2LMJA 2EJFA 1SRMA 2FB7A 3CCJQ 2YT6A 2ECZA 3V7SA 1T0HA 5A0LA 5LJ3j 2LQKA 2HQEA 3RDVA 1AWOA 1M2VB 4KULA 1M3AA 2X4XA 3VJPA 4HCCA 2F2WA 5C6SA 1MV3A 2I2LA 1D1AA 4J8OA 2L8DA 4M75D 5M9OA 1OQKA 1W6XA 2KDSA 5GAN6 1WNLA 2DL4A 3CCRT 2KXCA 2HMAA 5IXFA 1IHWA 3A8LB 1TU0B 3CCLT 2F2VA 2MYSA 1SF9A 3THKA 4Y28E 1ARKA 4M75B 3RKYA 1N9SA 2O9SA 1TOVA 2FYKA 5CQXA 2YHTA 1D3BB 2E10A 2Z0WA 4M78F 1NG2A 2RHXA 5ECAA 4OP0A 4AG2C 4DOWA 2JZ2A 4PLLA 1K76A 2F5TX 2DJZA 4IKFA 2A08A 4C8QE 2MAMA 4PFOA 3E9GA 1Y57A 1SG5A 5J26A 3RIRA 3O5ZA 1YJNT 2PQWA 2G6FX 1Q86C 5KE2A 4PJLA 4M78G 2BTTA 1YCSB 1QP2A 5FRNA 4WTOB 1U8RA 1O9SA 1QVGA 1BIAA 1M90C 3QXEB 1VQKA 3TU4K 2A3LA 1JXMA 1WFWA 2AKKA 1WIEA 1X27A 3SWNA 3CD6A 1B34B 2EKOA 1R77A 3QWYA 1GCPA 1UDLA 1KC8C 4JPBW 1MHNA 1ZSZC 2NUPA 2JJ9A 2V26A 1KSWA 4PJOD 1JJ2P 2PNIA 4KGVB 2AKLA 3QSUA 4IUPA 2DBMA 2KT8A 3FJPA 5GMKe 1UGQB 4ESRA 1YI2T 2BKDN 2CDTA 3GNGA 3ME9A 1WYXA 3DLMA 2KQWA 2RO0A 3KBGA 3PIOA 2GNCA 3GIBA 3OB9A 2COWA 4PJOB 1EIFA 2LDMA 4JLIA 1M1GA 3CCUA 4F7UA 1B7TA 2ZAEA 5GAMe 4C5EA 2D8JA 2DXCA 1AWJA 4GLKA 1Q7YR 1I4K1 3JCMd 1O75A 1K8AC 2K79A 3P8BB 4OMPA 4KT0E 5FU6B 2O01E 3FRNA 2GTOA 4BI8B 1K73U 1G8XA 1KD1U 3OYDA 2L5QA 2DILA 1YITT 3PT9A 1V76A 2YRDA 1VQ8T 5I2SA 5KYUA 1U1SA 2MIOA 2M16A 1G83A 3VS5A 1YN8A 2RNAA 4ELYC 1Y96B 3JCMf 2COZA 4D8DA 3OYGA 5D6XA 4L6V5 2C06A 1ZX6A 3M9QA 2YUOA 2RQWA 3MHXA 3OYCA 3JB9D 3I9QA 1YNZA 3VS2A 1VQKQ 2P4RA 4PFPA 1I8FA 5KYWB 1VQ7Q 2CGHA 1UGRB 3A5ZB 3CD6Q 4LDUA 4AFQC 4LE9A 3PVLA 4L5GA 5GAN7 1VYUA 2DRMA 4M75E 1NLPC 3A1PA 2L3PA 2DVJA 2HKQB 1UECA 4II1A 1HXDA 2P0PA 4OGEA 1S72A 2X35A 1KFZA 1XNIA 5LJ3e 3LX7A 5A0DA 3X26B 3CCUQ 3PGGA 4PKCC 1Q81C 4O6JA 2EQUA 2CZ0B 4BE2A 1YIJT 4QVCA 3I35A 1BU1A 4OB1B 1U3OA 2CP5A 1UGSB 3NTKA 1N5ZA 1B3QA 3RERA 5FW9A 5DM7R 2WSEE 1RI9A 2DE0X 3U23A 1W2BS 4MZTA 4A4GA 2CT3A 4C0DB 1X6GA 3VS7A 3CPWS 4ME7A 4FYXB 3EFRA 3CXCS 2MI6A 3EAEA 2O31A 1BB9A 2HDAA 4FYWB 3RESA 4OVAA 1TG0A 2E3IA 1WX6A 5FU7C 1X69A 2DXUA 3OSSC 2QA4A 2OAUA 4IIOA 4PJOE 1MNDA 3C12A 5CO7A 1JO8A 1NYFA 4RMOA 3NHNA 2JVVA 2R5MA 3I55A 1I81A 3D7SB 2JOYA 3L1AA 3OYEA 1NEBA 3BW1A 4BDYA 5FLXE 1YP5A 3JCMb 1H641 1XQHA 3JCMX 3CPFA 1VQMT 2QQAA 3SD4A 3C95A 4ZGDB 1S72Q 2HQHA 3JB9F 3HFOA 5HY6A 1NPPA 3CCVA 1OU8A 2R5AA 2MF2A 3HFNA 3M0TA 1OZ3A 2PVGB 3JB9G 1A0NB 1FMWA 1PHTA 3LGLA 3CCET 1TH7A 4Z02A 3PFSA 2CUBA 1ABQA 3WXMB 4CC7A 3CC7A 2VKNA 3L2RA 1XOVA 3HL8A 1RUWA 2D9TA 2PVDB 3JSCA 1BCMA 4M7AF 3PMTA 3RKWA 1M5Q1 5J3BA 3S3NA 5GAMd 1K4US 2DLPA 2DPPB 1N8RU 1N9RA 2EQMA 1ACMB 1NLOC 4XAXB 3LWHA 2KGTA 3VRYA 2RMOA 1ZSZA 2E1HA 1Q86U 4IUQA 2FZGB 3MP1A 3ZBDA 4M7AG 3QHSA 4NS5A 4DQ2A 4GBQA 1WJSA 4RTYA 2KT1A 4RTZA 3C4SA 2L0AA 1VQ6T 2KYBA 2V8KA 4DEYA 5I22A 1Q82R 1QVFS 2LRQA 4NL2A 3I55Q 1AEYA 4RTXA 1KC8U 1UB4A 5GAOn 1HSQA 2GQIA 2NUTA 4C92D 4BUGA 2L2PA 2K5LA 1VQ9A 2KAFA 4RUGA 4RG8A 4CI0C 2JMCA 1VQ8Q 1JJ2A 1QVPA 3A8OB 2OI3A 4FT4A 1QWFA 2HBPA 4IUVA 3CCVQ 2EQKA 3SWNC 4C92B 3CMAA 3VS0A 3RNJA 1NJIC 1AWWA 2VUBA 4OMLA 2RJFA 2SRCA 5CKFA 1YHQA 3S3MA 3M4YA 3LH0A 1VOMA 5FWBA 1VQOT 1CSKA 4AFUC 4DOVA 3QUIA 2RHUA 2C0TA 2K9GA 3PVQA 3CC7Q 5LJ3d 3VUZA 1PCXA 5AT1B 4ZNXA 3VRZA 1KQ1A 1VQLA 1ZUUA 2YRVA 1T3LA 3MEWA 2OJ2A 1KQSS 1TSFA 4KH1B 2ESWA 3M0QA 2K3BA 4JJBA 1AZGB 3JB9I 2CP0A 1W70A 4C8QD 4HCZA 2JS2A 1WXTA 3OW2S 4M77F 4IIMA 3M0RA 4A4EA 3EH2A 3CCSA 2P84A 2PUOB 4N0AC 2DA9A 3QZ9B 5CAIA 2HKNA 1KIKA 1OOTA 4M78A 4QT7A 5HK3A 4J9CA 2WSCE 4C8QB 4KUIA 4M77G 2HSPA 3JCMW 2L3SA 4EMHA 2BZ8A 3SFMA 1VQ9Q 1K9MR 3EGDA 1RAAB 3UATA 2O4XB 2KI7A 1OYXA 5CK9A 4A4FA 1VQKT 4JLGA 5D6YA 4M7AC 4HVWA 1ZBJA 3RKXA 2QTVA 5GANd 1YJWA 1YHQQ 1W4SA 2KR3A 1Q7YU 2E12A 3CD6T 2X4WA 2D0QB 4MMKA 3EG9B 2CZ6B 4LNPA 1P92A 1SKUB 4QQ6A 1WHJA 1JEGA 2K6DA 2IIMA 4E6RA 2DZCA 2LTOA 3X25B 1VA7A 1WA7A 2EGAA 2LNVA 4C92F 2VC8A 4D6WA 2RI2A 4XTXA 2E3HA 2JM8A 3OYIA 2ZZDA 2XDDA 4GY5A 2QQSA 5KE3A 3P8HA 4MMLA 3HTRA 1VQLQ 2KBTA 2F2XA 5GANf 4C92G 1C1AA 2HAXA 1MMDA 4IUUA 1M2VA 2COYA 1H8KA 1QWEA 4J9DA 2RHZA 1VQMQ 3CCUT 1RACB 1TTHB 4RKUE 3NTIA 2AHJB 5GAN2 4MDWA 2DD4A 3KXTA 1IXDA 3MEVA 1X6OA 1M1FA 1AZEA 1EX4A 2RH2A 1IB8A 3PIPA 5LL6S 2LT4A 1GL5A 3CCSQ 4J9EA 3VS1A 3EG3A 2D8HA 2GFUA 4M7DD 4P5NA 1LPLA 1VQOA 4C0FA 4Y92A 1C6VX 3UT1A 2LT1A 2FRYA 3CCEQ 1UUEA 2YWWA 2QTXA 1D3BA 2K5IA 1K9MC 2EJ9A 5KYYB 1FX7A 1YBYA 4M7DB 1Y0MA 2CP2A 2BE7D 4C8QF 3FIFA 2DXBA 4B9WA 2LCCA 3VV0A 2EIFA 1TXQA 4CC3A 5GMKh 2CS7A 1R8OB 1WHKA 1WHHA 4C8QG 4EMKC 1IO6A 2OAWA 3MEAA 4ZTJA 1VQ6Q 3OS0A 4XU0A 3REBB 3H8ZA 5CR2A 4CC4B 5GAMh 1SSHA 3EG0A 1NE8A 4CRIA 4M77C 1N8RC 1S72T 3DLLA 3ER0A 4JJDA 3META 2LC4A 1OPLA 1OV3A 3TVTA 4JZ3A 1W2BP 4LUDA 1IGUA 3NGPA 3G4ST 2VB6A 2RM4A 5GANj 3OYFA 2RPNA 2HNIA 5GAOm 4BI4A 2AZSA 3CXCP 4EPCA 3M55A 3HKSA 2LX9A 3OYBA 3QBYA 4ELZC 1VQOQ 3GOXA 3HSBA 5GAN4 2CSIA 1I07A 2HD0A 4KH0B 2K4YA 2WSFE 2GTJA 1WPYA 3UPUA 2J7IA 3OMCA 1M3CA 2X4JA 3EGXB 3M58A 1D0YA 1D1CA 1RADB 1PKSA 2HSEB 3A8GB 3LWIA 1YFNA 1NBEB 4FW1A 4MZMA 1I5OB 2OTLA 2QA4T 2DXTA 4N4HA 1NZ9A 1NYGA 4D8KA 2O2OA 2A7YA 4BY6B 1Y96A 1NJIU 1M8VA 1MV0B 2F69A 2JN0A 2P4TA 3INZA 1VYVA 1AOJA 2DERA 3X20B 1F1BB 3I55T 2VYTA 2FG0A 1Z9QA 3R6NA 1LVKA 1SEMA 5LJ3h 3TSZA 1K0SA 1PSFA 2XU8A 2DYBA 4N0AA 1IHVA 1BCOA 4FCYA 3ASKA 4OMFB 2XK0A 4XTYA 2M0OA 9ATCB 4M75F 1VUBA 3CCVT 1Y71A 2DMOA 3MKDA 3LYIA 1RAGB 3OY9A 1HD3A 1V29B 5LJ5h 4M7DE 2CYZB 4PL6A 3M57A 3OA6A 4M75G 1C0MA 1ZBXA 1GCQC 4XU2A 2JW4A 3CC7T 4JS4A 2MPXC 2HCKA 1XTDA 1Q82U 4F7UB 4M7AA 4LD6A 4RTVA 2CSQA 2MCNA 3OYHA 1RLQC 1SPKA 2K3YA 1U1TA 4BE0A 4J9FA 3EHRA 3E9FA 1E7OA 2AZVA 2WACA 2R58A 2HQXA 4X9DA 5KYUB 1QKWA 1X2QA 2JTMA 4M78C 2QEXA 2OTLQ 2E6NA 3E19A 2CKKA 2XKOC 2CP3A 2QG9B 1Q7YC 4ZGEB 3MPUB 2FZCB 1BI2A 3G4SA 1UTIA 3QJYA 3OYNA 2CH4A 5GMKi 3LH5A 3L2WA 3JCMJ 3TQ7P 2CREA 3OS5A 3SB2A 1M1KR 4HVVA 3CBOA 5CKDA 1EFNA 4PJOF 4VUBA 2ZPEB 1RAHB 4DEXA 1VQ9T 2EPDA 3QYGB 3GPLA 4JRQA 1X75C 3Q1JA 3CCQA 2FRWA 3UA6A 4E2FB 1U06A 2DIQA 2ENMA 2P0QA 4PJOG 5KYNA 5IAYA 3CMAT 4OGCA 2ROLA 2O9VA 2G3RA 2ZPBB 1YHQT 1BKBA 4BE1A 2LJ3A 1RAEB 2OTJA 4JJCA 2DF6A 4QVDA 3WVDB 2W10A 1X2KA 1QLYA 2L89A 2QQ9A 2VGMA 1Z9ZA 1JBMA 3OW2P 4LXCA 2VXEA 4J83A 4PJJA 5HK0A 2K57A 1LJOA 3JV3A 4DA4A 4LUEA 1VQLT 1WLPB 3FEOA 4EMKA 1X6BA 3OQ5A 2E5KA 1WJRA 5GANe 2MOXA 3A98A 3JB9H 5GMKl 2DETA 1OZ2A 3LGFA 3S6WA 1K9MU 2EYWA 1TUCA 1Y07A 2L3RA 3H41A 4XQ3A 2DFUA 5KCHA 2AT1B 4IUTA 1LCKA 1VQ4A 2ED1A 4RTUA 4M77A 3UDCA 3DKMA 4QW2A 4E7HA 1VQPA 1UJ0A 3CC4A 3GNFB 1MMNA 1SHGA 3CCST 4N4IA 3ZL7C 3M59A 3TSWA 1FYNA 3E2UA 1M1KC 3G4SQ 1AWXA 2YUNA 3EG2A 4M75C 3V8JA 4XTVA 2EKHA 2VVKA 4PJNA 2K5FA 2HL3A 1YWPA 4ORZA 4QVZA 1B07A 1LNXA 1U5SA 5D7UA 4FL6A 3VS4A 1GRIA 4F7UE 3GBQA 4L59A 4JUVA 4WCIA 3HPWA 5CQYA 3P8DA 4DBQA 4PK4A 1UHCA 5CKBA 3G6EA 2RD1A 3F70A 2RQRA 1YJWT 1RAIB 1K73R 1TUDA 1KD1R 3AT1B 4AFZC 1SSFA 4RCBA 5EC7A 3ZEHA 1YWOA 1W2BA 2QA4Q 2H3EB 4OB0B 4C92A 5DY9A 1AVZC 2M9UA 4OF1A 5IHNA 3EFOB 3CPWA 1QW1A 2CZ7B 2RI5A 2X9HA 1W1FA 1I1JA 3CXCA 4R56A 1PG5B 3G7ZA 2DL8A 4XK8E 2MMPA 2ZGWA 4K11A 2M0YA 8AT1B 2EGCA 3FLGA 3M54A 2DM1A 3JRZA 2C0OA 2K2MA 2LQWA 2BUDA 1UHFA 3T9NA 1Y7XA 4PLIA 3CBPA 4Z88A 1ZA2B 4PJOC 2ED0A 3N5BB 1JB0E 4HT8A 4HVUA 1QP3A 3CEYA 3QG1A 3CC4Q 7AT1B 1ZSZB 4Y91A 1WZOA 4Q5WA 1GBRA 3H0HA 5I11A 3JCMh 1YJ9A 1MMGA 5FU6C 1UGVA 3V8LA 1TS9A 3CBMA 5LJ5g 1ZSGA 2ZCFB 5L8RE 2D1XA 4CC2A 2QXFA 1PWTA 1IZ6A 4FT2A 3KUFA 3RR6A 1GCQA 4KRTA 2A37A 1QQJA 1KQ2A 4J5YA 3RMQA 2EVRA 4C8QA 1WHGA 2CP6A 2LJ1A 5GAN8 2RHYA 5KYXB 4BD3A 4R55A 2EWNA 1ZLMA 4NL3A 3EFSA 5GAOq 5GAOp 2KEAA 1M2OA 3EHQA 4JS5A 1VQ5A 2O4XA 2QQBA 3MCAB 2EW3A 2VGNA 1QMCA 2FPDA 1Q82C 4E7IA 3VUBA 4JRPA 2FPEA 2X3XD 2DD5A 4HCKA 1DJ7B 1EZZB 2DIGA 1OX8A 3PE0A 1RL2A 5GAN5 2JTEA 1OU9A 2EBPA 3CQTA 4FU6A 2DKGA 2DZ9A 2XMFA 1BI1A 2YLBA 2KYMA 2A36A 3OMGA 2RK2A 4AG1C 2YUQA 8ATCB 3CCJA 3J81E 2DL7A 2K2VA 4LDWA 3RBBB 1BYMA 2RJDA 4GLMA 2KY9A 1QVFA 3M56A 1E6GA 3CMAQ 2ATCB 1BI0A 2B8AA 1WI7A 4F04B 2MWOA 3NPFA 1YJ9Q 2LZ6B 3V8KA 2QGGA 4X9CA 5DLOA 2KK4A 1HYOA 2HL5C 1WDXA 2VASA 3VYHB 2X3WD 3OSVA 1H92A 1KG1A 2EYYA 4LDVA 3QO3A 3UA7A 4C0DC 2KSSA 1MUZA 1UJYA 1ZUKA 5HKCA 1K1ZA 1KHIA 1OEBA 4BB7A 2OTLT 1TUGB 4HCBA 2NYSA 2P0KA 3ULRB 3CC2A 5KYYA 3OYAA 3J7AF 3EG1A 2AIRB 1PD1A 4WF2A 5D6WA 1QVGS 2KRNA 1VQ5Q 4RTWA 3EGDB 5IN1A 3QKJA 4F17A 1NEGA 1AT1B 2VV5A 5CIUA 1KQSA 2GF7A 2J6OA 4EMGA 3IQLA 1JU5C 5IT9E 1MNEA 1D0ZA 3A8HB 1Q86R 2KRMA 2RB6A 4M75A 2V1QA 5IHIA 2XG8D 3OW2A 4OB3B 1R0CB 2JTFA 3J80E 2XICA 3GP8A 4J6YA 1M90R 4J9HA 3OS2A 2CP7A 3I56A 4LDYA 4OMQA 2M1HA 4N4GA 4E7ZA 4C5GA 4JRKA 1KC8R 1YJWQ 3QPHA 4O5VA 3H0FA 4AT1B 1M1KU 2HZYA 3MJXA 3SHWA 4RG2A 1JXOA 4OMMA 4Z89A 1QKXA 5CKEA 5LJ5j 3C94A 2XD0A 1B34A 4KGZB 3CCMA 3G71A 4TVRA 2E41A 5C0MA 1QCNA 1NPRA 2GCXA 2W0ZA 3X24B
chains in the Genus database with same CATH topology
1M5Q1 2QEXT 5J3BA 3OYMA 4KBMB 3E9FA 3S3NA 5GAMd 3TCJA 2DPPB 3CCEA 2LVMA 2RK1A 1N8RU 1N9RA 2EQMA 2VXFA 4XAXB 5GAMj 4C0ZA 2WACA 3LLRA 2R58A 3QDRB 3LWHA 2HQXA 4M78D 4X9DA 5LJ5f 3CMEA 2E1HA 2JTMA 4M78C 2QEXA 4XTUA 2E6NA 3E19A 5GAOl 1Q86U 2CKKA 4IUQA 1G3TA 2XKOC 3MP1A 4MZPA 2FVUA 3ZBDA 3JCMe 4M7AG 1BI3A 3QHSA 4NS5A 4PJOA 4C5HA 1Q7YC 4ZGEB 4DQ2A 1YCYA 3JB9J 1WGSA 1BI2A 3G4SA 3A8MB 4M77E 3QJYA 3QYHB 3OYNA 1WJSA 5GMKi 2DK3A 3UWNA 3VKIA 3L2WA 3C4SA 3JCMJ 5KH6A 3OS5A 3AHUA 3CCQT 2Y4XA 4HA8A 3SB2A 4V2SA 3CBOA 3H6ZA 5GAOr 5CKDA 1VQ7T 4M78B 1VQ6T 4PJOF 3JCMg 2EFIA 2V8KA 3OBWA 4VUBA 1WJQA 4BI3A 2ZPEB 1Q81U 4JDSA 3FC3A 1VQ9T 2D6FA 3QYGB 4QQDA 3GPLA 2DVEA 5J39A 3PNWC 4JRQA 1QVFS 2LRQA 5CKHA 1X75C 4NL2A 3Q1JA 3CCQA 5DLQE 3OYKA 4E7KA 5KCOA 1KC8U 3MO8A 1UB4A 5GAOn 1VQ7A 3M53A 3QJ6A 1VQ6A 4C92D 4M78E 4BUGA 4M7DA 5EG2A 2K5LA 2DIQA 3R6OA 4C92C 2OTJT 2P0QA 4PJOG 1VQ9A 2KAFA 3RUXA 2LCLA 3PTAA 5IAYA 4RG8A 3JCMQ 3CMAT 4HKEA 4CI0C 2PVOB 2JNGA 4A4KA 2XIDA 4OGCA 5A0GA 2G3RA 2ZPBB 1YHQT 1JJ2A 1BKBA 2K3XA 4BE1A 1QVPA 2CZ1B 1VIEA 4M7DF 2DTIA 2DO3A 3L2VA 1G3WA 3VYGA 3A8OB 2OTJA 4J7FA 4FT4A 4QVDA 5FRMA 2HBPA 4IUVA 3WVDB 1VQNT 1WQ7A 2EQKA 3GLXA 3SWNC 4C92B 3CMAA 3TREA 2IVWA 1NJIC 2L89A 3HRSA 2QQ9A 2QI2A 4OB2B 2VUBA 5CKFA 2RJFA 1YHQA 4A53A 2YLCA 3S3MA 2VGMA 3M4YA 2LQ8A 3LH0A 1JBMA 2VXEA 2QDYB 4J83A 1VQOT 3OS1A 4M7DG 2RHIA 5HK0A 1VQNA 4DOVA 2K57A 3L2QA 2JUFA 1LJOA 5FU7B 4C92E 2DTHA 3OYYA 4DA4A 1VQLT 3QUIA 3SWNB 2RHUA 4J6WA 2MWPA 3BY7A 3FEOA 3JCMc 5LJ3d 1VQ4T 4EMKA 2EJFA 3M4GA 2FB7A 3OQ5A 3V7SA 5A0LA 1WJRA 4XTZA 5GANe 5LJ3j 3VUZA 1VQPT 2LQKA 3JCMP 3JB9H 4ZN1A 5GMKl 3CC4T 1OZ2A 3LGFA 3S6WA 1K9MU 2XI9A 2HQEA 4JRIA 2L3RA 1Y07A 1KQ1A 4XQ3A 5KCHA 1VQLA 4IUTA 2YRVA 1M4ZA 1IREB 3DB3A 1VQ4A 4KULA 2X4XA 3MEWA 3VJPA 4HCCA 1KQSS 4M77A 3UDCA 3DKMA 4QW2A 4E7HA 1VQPA 5C6SA 3CC4A 2I2LA 3GNFB 3L2ZA 4ZN3A 3CCST 2PU9B 4N4IA 3TEEA 3JB9I 4J8OA 3M59A 2RJEA 2L8DA 4M75D 4C8QD 4HCZA 5M9OA 1M1KC 3OW2S 2KDSA 4M75C 4M77F 2DEQA 3V8JA 4C8QC 5GAN6 1UEBA 1WNLA 4XTVA 3CCRT 2Y4YA 1JRIA 1M9SA 4A4EA 3HHTB 3A8LB 3CCSA 5CAIA 2PUOB 4N0AC 3QZ9B 2K5FA 3URGA 3NFCA 2V8JA 4IURA 4XTWA 1AHJB 4QVZA 4M78A 1LNXA 3CCLT 5HK3A 4FL6A 3G6ET 1VIFA 3CCRA 4Y28E 4F7UE 2WSCE 4M75B 3RKYA 4C8QB 1N9SA 4KUIA 4M77G 2FYKA 4L59A 4JUVA 5CQXA 1FXXA 2YHTA 1D3BB 2E10A 4M78F 3CCLA 3JCMW 2RHXA 3HPWA 3BDUA 3P8DA 4OP0A 5CQYA 4EMHA 3FB9A 3SFMA 4DOWA 2JZ2A 4PLLA 5CKBA 2F5TX 3G6EA 2DJZA 2RD1A 3F70A 4IKFA 5GANh 4C8QE 3ZFJA 3L2UA 1YJWT 2EJGA 2MAMA 3E9GA 2E64A 2E5QA 2O4XB 5J26A 3RIRA 1YJNT 2PQWA 1OYXA 5CK9A 1Q86C 5A2QE 4M7AD 1SSFA 4A4FA 3RMSA 5KE2A 3FDRA 4M78G 4RCBA 4BACA 4JLGA 5D6YA 3ZEHA 1VQKT 4M7AC 3O8VA 1W2BA 3RKXA 4OB0B 4C92A 5GANd 1YJWA 5DY9A 3SDZA 1QP2A 2M9UA 1W4SA 4OF1A 5FRNA 1Q7YU 2E12A 1G5VA 3CD6T 2PUKB 2X4WA 3CPWA 1QW1A 2D0QB 4MMKA 1WQWA 2CZ6B 1P92A 1O9SA 2CZ7B 1YJNA 4QQ6A 1U8RA 1QVGA 2RI5A 1BIAA 4EDUA 1M90C 3QXEB 1VQKA 3CXCA 2XDBA 4R56A 2H3JA 2DZCA 3G7ZA 3TU4K 2A3LA 2LTOA 2MMPA 4XK8E 3X25B 4XU3A 2FHDA 2ZGWA 2LNVA 4C92F 2VC8A 4M7AB 2RI2A 4D6WA 4XTXA 3FLGA 3M54A 3SWNA 3CD6A 1B34B 2EKOA 3OYIA 2ZZDA 3JRZA 3MP6A 3JAME 2XDDA 4GY5A 2QQSA 5KE3A 1KC8C 4NOYA 1MHNA 2BUDA 3P8HA 3T9NA 4MMLA 1Y7XA 4PLIA 4X34A 3S3OA 3CBPA 3HRTA 4PJOD 3QSUA 4IUPA 5GANf 4PJOC 4C92G 2HAXA 3N5BB 1JB0E 3FJPA 4IUUA 5GMKe 1YJ9T 4HT8A 2X4YA 1QP3A 1UGQB 5LJ5e 3CEYA 3QG1A 4PNOA 2RHZA 3CCUT 1YI2T 2BKDN 3GNGA 3ME9A 4RKUE 3NTIA 2AHJB 5GAN2 3DLMA 2KQWA 4MDWA 4Y91A 2DD4A 2RO0A 4Q5WA 3KXTA 2XDPA 3KBGA 3MEVA 1X6OA 3JCMh 1M1FA 3WVEB 2RH2A 5FU6C 3PIOA 1RI0A 1YJ9A 3GIBA 3OB9A 3V8LA 3PIPA 4PJOB 2ZPGB 3CBMA 3QIIA 1EIFA 2LDMA 4J7IA 4JLIA 5LL6S 5LJ5g 1M1GA 3CCUA 1ZHIA 4F7UA 2LT4A 1YI2A 1FWZA 2ZCFB 5L8RE 3HRUA 3NTHA 5CVIA 2QXFA 2GFUA 5GAMe 4C5EA 1IZ6A 4M7DD 2DXCA 4KUDK 4GLKA 4FT2A 4P5NA 3KUFA 4M7DC 1I4K1 3JCMd 1O75A 1VQOA 1K8AC 4C0FA 2FL7A 3P8BB 1KQ2A 4J5YA 4KT0E 5FU6B 4F7UF 4ATOA 2O01E 3RMQA 1MGQA 3UT1A 2LT1A 3FRNA 4BI8B 1JJ2S 4C8QA 1K73U 1KD1U 3OYDA 1G3SA 2L5QA 4YTLA 2RHYA 5GAMg 5GAN8 2QTXA 4BD3A 1D3BA 4R55A 5AYFA 1VQ5T 2K5IA 1K9MC 2EJ9A 2EWNA 1YITT 3PT9A 1FX7A 4NL3A 5I2SA 1YBYA 2GQVA 3EFSA 1VQ8T 4M7DB 1U1SA 4QQGA 4E47A 4C8QF 2KMTA 3FIFA 5GAOq 2DXBA 4F7UG 5GAOp 2M16A 3M5AA 4B9WA 2LCCA 4JS5A 4ELYC 2O4XA 1Y96B 1N6AA 2EIFA 3VV0A 1YITA 1VQ5A 1ZQ1A 5I21A 2QQBA 3JCMf 2NLUA 4E7JA 4UC4A 4ZGJB 5GMKh 3MCAB 1VQ8A 3OYGA 5D6XA 4L6V5 4J6XA 2VGNA 2C06A 2RA2A 2DTOA 2CS7A 1R8OB 2EQJA 3M9QA 3MHXA 3OYCA 1Q82C 4E7IA 3JB9D 3VUBA 4JRPA 2E70A 2DD5A 4C8QG 4EMKC 1DJ7B 4LDXA 2DIGA 3MEAA 4ZTJA 1I8FA 1RL2A 5GAN5 4B9XA 2CGHA 3CCJT 4MDXA 1UGRB 3A5ZB 3OS0A 4FU6A 2DKGA 2DZ9A 4XU0A 1BI1A 3BFMA 3H8ZA 4LDUA 2YLBA 5CR2A 4M77D 4L5GA 3OMGA 5GAMh 2RJCA 2ZPIB 2RK2A 1NE8A 4CRIA 4M77C 1N8RC 4EMKB 5GAN7 1S72T 3DLLA 3JCMV 3ER0A 4M75E 3META 5I2MA 3CCJA 2LC4A 4C0GA 4FSXA 3J81E 4RCCA 3L42A 2K2VA 4LDWA 1BYMA 2RJDA 4II1A 2KY9A 1QVFA 3M56A 3MP8A 4ZTFA 1HXDA 3V7RA 2P0PA 3BDLA 4OGEA 3GF5A 1S72A 2X35A 1KHCA 4M77B 1BI0A 2B8AA 3G4ST 2RM4A 1N27A 2MWOA 1XNIA 5GANj 3LW5E 3OYFA 2HNIA 3V8KA 5LJ3e 5GAOm 4X9CA 5DLOA 3LX7A 5A0DA 2KK4A 3X26B 4BI4A 4E7LA 2XHCA 4EPCA 2DAQA 3M55A 3HKSA 4A4HA 3PGGA 3PMIA 3VYHB 2EYQA 4PKCC 3OYJA 1Q81C 3OSVA 2EQUA 2CZ0B 2LX9A 4O6JA 4BE2A 1YIJT 4QVCA 1GXIE 2QQRA 1KG1A 3OYBA 3QBYA 4OB1B 4LDVA 1H3ZA 3QO3A 4ELZC 5LJ3g 3GOXA 2RI3A 1M90U 3HSBA 4C0DC 1HK9A 5GAN4 3CC2T 4BDZA 2HD0A 5GAMf 1I5LA 2KSSA 1UGSB 2K4YA 3NTKA 2R57A 2WSFE 5HKCA 3RERA 1YIJA 4M7AE 1WPYA 3MEUA 2BIVA 5DM7R 1KHIA 3UPUA 4BY6C 4BB7A 2WSEE 2OTLT 4HCBA 3OMCA 2EAYA 2P0KA 2X4JA 3M58A 1LOJA 1W2BS 3CC2A 4MZTA 4A4GA 2ZPHB 5FROA 3A8GB 3LWIA 4C0DB 3OYAA 3J7AF 3CPWS 4HT9A 4MZMA 4WF2A 5D6WA 4ME7A 1QVGS 2OTLA 3DB4A 2QA4T 2DXTA 4N4HA 1NZ9A 3EFRA 3CXCS 2MI6A 2A7YA 5IN1A 4BY6B 1Y96A 3EAEA 3QKJA 1NJIU 1M8VA 3RESA 3E1SA 4OVAA 2F69A 2JN0A 2VV5A 5CIUA 1UGPB 5FU7C 2P4TA 3INZA 1KQSA 3QZ5B 2E65A 2DXUA 2GF7A 2GFAA 4EMGA 3X20B 3I55T 2VYTA 3OSSC 2QA4A 2OAUA 5IT9E 3A8HB 4PJOE 5LJ3h 4JJNK 2RB6A 4FM4B 3C12A 5CO7A 4M75A 4C5IA 2XG8D 3I56T 3OW2A 1PSFA 4OB3B 3HP9A 4RMOA 2JTFA 2XU8A 1G3YA 4N0AA 3J80E 2JVVA 2R5MA 3I55A 1I81A 2JOYA 3L1AA 1X01A 3OYEA 2XICA 1K8AU 1K73C 2ZPFB 3GP8A 1KD1C 4J6YA 3ASKA 3BW1A 2XK0A 4OMFB 2M0OA 4XTYA 3OS2A 4M75F 4BDYA 5FLXE 3I56A 1VUBA 3JCMb 1H641 1XQHA 1Y71A 3JCMX 3CPFA 3CCVT 2QQAA 1VQMT 3LYIA 4LDYA 5GMKm 2Y90A 2M1HA 4N4GA 3SD4A 3VU3C 3OY9A 3C95A 4C5GA 4ZGDB 1V29B 4M7DE 4JRKA 2E6ZA 2CYZB 5LJ5h 4PL6A 3JB9F 3HFOA 3QPHA 3M57A 5HY6A 5CCAA 3X28B 4O5VA 4A54A 1PSEA 1NPPA 5GANg 3OA6A 4M75G 3CCVA 1VQMA 1M1KU 4XU1A 3CCMT 1ZBXA 3OYLA 3G71T 4XU2A 2R5AA 4RG2A 3CC7T 2MF2A 3HFNA 4JS4A 5LJ5d 1OZ3A 1XTDA 5LJ3f 1Q82U 5CKEA 5GMKj 3OBYA 2IG0A 2PVGB 4FIBA 4F7UB 5LJ5j 4M7AA 3JB9G 3C94A 3V7CA 2XD0A 4LD6A 1B34A 3LGLA 3CCMA 3G71A 1TH7A 4Z02A 2V8IA 3PFSA 1OI1A 2F5KA 4TVRA 1BIBA 3CCET 2E41A 2KVQG 5C0MA 3WXMB 4LD9K 3CC7A 1NPRA 5GAN3 3L2RA 1XOVA 2GCXA 3HL8A 3OYHA 3X24B 2D9TA 2K3YA 2PVDB 3JSCA 1U1TA 3CMET 4M7AF 4BE0A 3PMTA 3RKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8L A;  1M5Q 1;  4PJO B;  3QO3 A;  4JLI A;  5LJ5 g;  5LJ3 g;  2I2L A;  3L2Z A;  5GAM d;  3HSB A;  1HK9 A;  4F7U A;  5GAN 4;  5GAM f;  1I5L A;  1N9R A;  2VXF A;  5GAM j;  3JB9 I;  5GAM e;  4M75 D;  4C8Q D;  4M7D D;  3RER A;  3JB9 G;  4M7A E;  1WPY A;  4M78 D;  5LJ5 f;  4X9D A;  4M75 C;  4M77 F;  3V8J A;  2DEQ A;  1I4K 1;  2E1H A;  4C8Q C;  1WNL A;  4XTV A;  5GAN 6;  3JCM d;  4M78 C;  2EAY A;  4XTU A;  5GAO l;  1JRI A;  1KQ2 A;  4J5Y A;  4F7U F;  4M7A G;  1LOJ A;  5CAI A;  4N0A C;  1MGQ A;  3JCM e;  4M7A A;  4M7A F;  4PJO A;  3QHS A;  4C8Q A;  4XTW A;  4DQ2 A;  1YCY A;  3JB9 J;  4M78 A;  1LNX A;  4M77 E;  5GAM g;  5GAN 8;  2QTX A;  5GMK i;  4HT9 A;  1D3B A;  4WF2 A;  2EJ9 A;  2EWN A;  3JCM J;  2DXT A;  4F7U E;  3AHU A;  3EFR A;  4NL3 A;  4M75 B;  3EFS A;  4HA8 A;  1N9S A;  4M77 G;  3RKY A;  3SB2 A;  1U1S A;  1Y96 A;  2FYK A;  4C8Q B;  4M78 B;  4JUV A;  5GAO r;  4PJO F;  2YHT A;  3JCM g;  4C8Q F;  1M8V A;  1D3B B;  3FIF A;  3RES A;  2E10 A;  4F7U G;  5GAO q;  4M78 F;  5GAO p;  2JN0 A;  3JCM W;  3BDU A;  3INZ A;  4OP0 A;  4EMH A;  3FB9 A;  2DVE A;  2E65 A;  2DXU A;  4EMG A;  1Y96 B;  2DJZ A;  2RD1 A;  4NL2 A;  5I21 A;  3JCM f;  5GMK h;  4PJO E;  5GAN h;  5GAO n;  5LJ3 h;  4C8Q E;  4J6X A;  2EJG A;  2RB6 A;  4C92 D;  2RA2 A;  4M78 E;  2DTO A;  4M75 A;  4M7D A;  2E64 A;  3RIR A;  3JB9 D;  4C92 C;  4PJO G;  4C8Q G;  3RUX A;  4EMK C;  4M7A D;  3JCM Q;  4M78 G;  4N0A A;  4RCB A;  4M7A C;  1I81 A;  3L1A A;  1X01 A;  3RKX A;  4C92 A;  1I8F A;  4J6Y A;  5GAN d;  5DY9 A;  3BW1 A;  4XTY A;  5GAN 5;  2CGH A;  4M75 F;  4M7D F;  2DTI A;  2DKG A;  2DZ9 A;  4XU0 A;  3BFM A;  4MMK A;  1WQW A;  4M7D C;  2YLB A;  1H64 1;  4QVD A;  4M77 D;  3JCM X;  3JCM b;  1BIA A;  1WQ7 A;  5GAM h;  3SWN C;  5GMK m;  4C92 B;  2Y90 A;  4M77 C;  2DZC A;  4EMK B;  3VU3 C;  4XU3 A;  2ZGW A;  4C92 F;  5GAN 7;  3JCM V;  2VC8 A;  4JRK A;  4M75 E;  2YLC A;  4M7A B;  4XTX A;  4A53 A;  5LJ5 h;  3JB9 F;  3HFO A;  4M7D B;  3SWN A;  4RCC A;  1B34 B;  1JBM A;  4A54 A;  2VXE A;  5GAN g;  4M75 G;  4M7D G;  4HT8 A;  4XU1 A;  2K57 A;  4NOY A;  1HXD A;  1LJO A;  3V7R A;  4C92 E;  4M7D E;  4XU2 A;  4MML A;  2DTH A;  3QUI A;  3SWN B;  4J6W A;  3BY7 A;  4PJO D;  4M77 B;  3HFN A;  3QSU A;  3JCM c;  5LJ3 d;  5LJ5 d;  2RM4 A;  4EMK A;  5GAN f;  4PJO C;  2EJF A;  3M4G A;  2FB7 A;  5LJ3 f;  4C92 G;  5GMK j;  5GAN j;  3FJP A;  3V7S A;  4F7U B;  5GAN e;  4XTZ A;  2HNI A;  5GMK e;  3V8K A;  5LJ3 e;  5LJ3 j;  4X9C A;  5LJ5 j;  5LJ5 e;  4PNO A;  3V7C A;  5GAO m;  3JCM P;  1B34 A;  5GMK l;  3JB9 H;  4V2S A;  1TH7 A;  4JRI A;  1KQ1 A;  4XQ3 A;  1BIB A;  2E41 A;  3PGG A;  5GAN 2;  4Y91 A;  5GAN 3;  4QVC A;  3JCM h;  1U1T A;  4M77 A;  3RKW A;  3GIB A; 
#chains in the Genus database with same CATH topology
 2QEX T;  2A28 A;  3CC2 Q;  3EGX A;  2VXF A;  1K8A R;  4J9G A;  3LLR A;  2JXB A;  2OX7 A;  4A63 B;  3CME A;  3CPW P;  2RQT A;  2RN8 A;  4XTU A;  1G3T A;  3VS6 A;  1T3S A;  4MZP A;  2FVU A;  3NMZ C;  4PJO A;  4C5H A;  3A8M B;  3QYH B;  2DK3 A;  2E4H A;  3AHU A;  3CCQ T;  4HA8 A;  4V2S A;  5GAO r;  3M0S A;  3JCM g;  2EFI A;  2QAZ A;  1CKA A;  4QQD A;  2DVE A;  5J39 A;  2F1L A;  3PNW C;  2NWM A;  4OMN A;  5CKH A;  3OYK A;  4E7K A;  5KCO A;  3MO8 A;  1VQ7 A;  3M53 A;  4M78 E;  1FMK A;  5EG2 A;  4B6M A;  3R6O A;  1SRL A;  4C92 C;  2OTJ T;  3I56 Q;  2LCL A;  3PTA A;  2PVO B;  1KK7 A;  2JNG A;  2LCS A;  2BE9 B;  2K3X A;  4M7D F;  2DO3 A;  2EGE A;  1G3W A;  3VYG A;  5FRM A;  3GLX A;  3TRE A;  1I0C A;  3HRS A;  2QI2 A;  4A53 A;  2YLC A;  2DX1 A;  4J9I A;  2A0F B;  5KYW A;  1MMA A;  2QDY B;  3OS1 A;  4M7D G;  2RHI A;  1VQN A;  1CKB A;  3L2Q A;  2JUF A;  3CCM Q;  3OYY A;  3G71 Q;  3SWN B;  4J6W A;  1VQ4 T;  1PRM C;  3M4G A;  4EIK A;  2NUP B;  4XTZ A;  1Q81 R;  1VQP T;  3JCM P;  4ZN1 A;  2DNU A;  3CC4 T;  2XI9 A;  2FZK B;  4JRI A;  1M4Z A;  1IRE B;  1SHF A;  2BZX A;  3DB3 A;  2LJ0 A;  2LNH B;  4PJM A;  2NUZ A;  3CME Q;  3G1J A;  2PTK A;  1QCF A;  3L2Z A;  4ZN3 A;  2PU9 B;  3TEE A;  2RJE A;  3KFV A;  1GFC A;  4C8Q C;  1HJD A;  2DEQ A;  4DBR A;  1UEB A;  1UE9 A;  2KNB B;  1RAF B;  2Y4Y A;  1JRI A;  1M9S A;  2ROT A;  3HHT B;  4F14 A;  2JM9 A;  3URG A;  3NFC A;  2V8J A;  4IUR A;  1WXU A;  4XTW A;  1AHJ B;  3UF4 A;  1S1N A;  3C0C A;  2HBW A;  3G6E T;  1VIF A;  3CCR A;  1QVF P;  1FXX A;  1Q95 G;  3CCL A;  3BDU A;  2YUP A;  3FB9 A;  2J6F A;  2M02 A;  5GAN h;  1OUL A;  3ZFJ A;  3L2U A;  2EJG A;  2E64 A;  2E5Q A;  4OMO A;  5A2Q E;  4M7A D;  3RMS A;  3FDR A;  4BAC A;  3O8V A;  4LN2 A;  3H0I A;  3SDZ A;  1G5V A;  2PUK B;  1YJN A;  1WQW A;  2B86 A;  4EDU A;  5IXB A;  1VQN Q;  2XDB A;  2H3J A;  2JMA A;  4XU3 A;  2FHD A;  2D0N A;  4M7A B;  3MP6 A;  3JAM E;  1H3H A;  3FJ5 A;  4NOY A;  5GJV B;  4X34 A;  1M3B A;  1UG1 A;  3S3O A;  3HRT A;  4DBF A;  2HEQ A;  1ZA1 B;  1YJ9 T;  2X4Y A;  1KQS P;  5LJ5 e;  4PNO A;  1K9A A;  2CT4 A;  2CH4 W;  2XDP A;  2C0I A;  2KRS A;  4KGX B;  5L23 A;  3WVE B;  2J6K A;  3I5R A;  1RI0 A;  3VS3 A;  1PD0 A;  2ZPG B;  3QII A;  4J7I A;  1ZHI A;  1YI2 A;  1FWZ A;  2GBQ A;  1M30 A;  3HRU A;  3NTH A;  5CVI A;  2QGF B;  4JZ4 A;  2SEM A;  4KUD K;  4M7D C;  1E6H A;  1ABO A;  3CCR Q;  2FL7 A;  4AMC A;  4F7U F;  4ATO A;  1MGQ A;  2DL3 A;  1JJ2 S;  1J3T A;  1G3S A;  4YTL A;  5GAM g;  2V1R A;  3CCL Q;  5AYF A;  2J06 A;  1VQ5 T;  2JT4 A;  1PC0 A;  1PRL C;  4F16 A;  2GQV A;  2QEX Q;  4FYY B;  2QK0 A;  4QQG A;  2DL5 A;  4E47 A;  2KMT A;  4F7U G;  1JQQ A;  3M5A A;  2GGR A;  2LQN A;  2AK5 A;  1N6A A;  1YIT A;  1ZQ1 A;  5I21 A;  1VQ8 A;  2NLU A;  4E7J A;  4UC4 A;  4ZGJ B;  4J6X A;  2RA2 A;  2DTO A;  2DRK A;  2EQJ A;  2K7A A;  3EH1 A;  1YJN Q;  2E70 A;  1GFD A;  3EFO A;  4LDX A;  2RF0 A;  1UFF A;  3CCQ Q;  2KRO A;  4MDX A;  4B9X A;  3CCJ T;  1NJI R;  1M8M A;  3BFM A;  4M77 D;  1KJW A;  2YDL A;  3QDF A;  1T0J A;  2RJC A;  1K0X A;  2ZPI B;  4EMK B;  3JCM V;  2J05 A;  5I2M A;  4E7S A;  1D09 B;  4FSX A;  4C0G A;  4RCC A;  3L42 A;  3REA B;  3H9N A;  2OTJ Q;  3I5S A;  1VYT A;  3MP8 A;  4ZTF A;  3V7R A;  3BDL A;  3GF5 A;  1OX9 A;  1KHC A;  4M77 B;  1N27 A;  3LW5 E;  2H8H A;  1QVG P;  2YSQ A;  5GJW B;  3QWX X;  4E7L A;  2RQV A;  2XHC A;  1YI2 Q;  2DAQ A;  4A4H A;  3PMI A;  2EYQ A;  3OYJ A;  1GXI E;  2QQR A;  1NM7 A;  2LX7 A;  1H3Z A;  5LJ3 g;  2RI3 A;  1M90 U;  1HK9 A;  3CC2 T;  4BDZ A;  5GAM f;  1I5L A;  1PKT A;  4J9B A;  4FW2 A;  2R57 A;  1YIJ A;  4M7A E;  1VQ4 Q;  3MEU A;  2BIV A;  2I0N A;  2IPO B;  2QDL A;  4BY6 C;  1PNJ A;  2RQU A;  2EAY A;  3BE3 A;  5KYX A;  2DEU A;  1VQP Q;  1LOJ A;  2ZPH B;  5FRO A;  4HT9 A;  1BK2 A;  2CUD A;  2X51 A;  3DB4 A;  1FMV A;  1YIT Q;  2MK5 A;  3E1S A;  4DBH A;  3EGU A;  1UGP B;  3QZ5 B;  2E65 A;  2EQI A;  2GFA A;  4AFS C;  3M0P A;  2KE9 A;  2M51 A;  4JJN K;  4FM4 B;  6AT1 B;  1BBZ A;  4C5I A;  3I56 T;  3HP9 A;  1TWB A;  1G3Y A;  4PFZ A;  2NUT B;  3G6E Q;  1X01 A;  1K8A U;  1K73 C;  2ZPF B;  1KD1 C;  1RLP C;  1PM3 A;  4QKU A;  4Z8A A;  2L3Q A;  2QYZ A;  4X1V A;  5GMK m;  2Y90 A;  3VU3 C;  2YXY A;  2E6Z A;  1OPK A;  5CCA A;  3X28 B;  4A54 A;  1PSE A;  5FWC A;  5GAN g;  1VQM A;  4XU1 A;  1QCO A;  3CCM T;  2QAS A;  3OYL A;  3EG9 A;  3G71 T;  4ANJ A;  5IHK A;  4FYV B;  5LJ5 d;  5LJ3 f;  5GMK j;  2EYZ A;  3OBY A;  2IG0 A;  2FEI A;  4FIB A;  3V7C A;  1M27 C;  2V8I A;  1OI1 A;  1AD5 A;  2DBK A;  1BIB A;  2F5K A;  1IRX A;  2KVQ G;  2VWF A;  4LD9 K;  5GAN 3;  1YIJ Q;  4FSS A;  3M0U A;  3CME T;  2ABL A;  3OYM A;  4KBM B;  4R0K A;  3TCJ A;  3CCE A;  1R0B G;  2LVM A;  2RK1 A;  5GAM j;  4HXJ A;  4C0Z A;  1D0X A;  2KXD A;  3QDR B;  4M78 D;  5LJ5 f;  1WHM A;  1WHL A;  1ZUY A;  2BZY A;  5GAO l;  1GBQ A;  3JCM e;  2DYI A;  1BI3 A;  1YCY A;  3JB9 J;  1WGS A;  1X43 A;  2JS0 A;  4M77 E;  1IGQ A;  3SEM A;  3UWN A;  4M4Z A;  3VKI A;  2LP5 A;  5KH6 A;  2Y4X A;  1VQ7 T;  3H6Z A;  4M78 B;  3OBW A;  1WJQ A;  4BI3 A;  1Q81 U;  4JDS A;  3FC3 A;  2D6F A;  2FPF A;  5DLQ E;  1V1C A;  1VQ6 A;  3QJ6 A;  4M7D A;  3RUX A;  5IH2 A;  3JCM Q;  4HKE A;  4A4K A;  1RAB B;  2XID A;  5A0G A;  2PZ1 A;  2CZ1 B;  1VIE A;  1N8R R;  2DTI A;  3L2V A;  1XJW B;  4J7F A;  2YRC A;  1G2B A;  1VQN T;  1WQ7 A;  4RTT A;  2FO0 A;  2IVW A;  2DJQ A;  2EYX A;  4OB2 B;  1WXB A;  2LQ8 A;  5FU7 B;  4C92 E;  1D1B A;  2DTH A;  5HCK A;  2O88 A;  2MWP A;  3BY7 A;  3JCM c;  2LMJ A;  2EJF A;  1SRM A;  2FB7 A;  3CCJ Q;  2YT6 A;  2ECZ A;  3V7S A;  1T0H A;  5A0L A;  5LJ3 j;  2LQK A;  2HQE A;  3RDV A;  1AWO A;  1M2V B;  4KUL A;  1M3A A;  2X4X A;  3VJP A;  4HCC A;  2F2W A;  5C6S A;  1MV3 A;  2I2L A;  1D1A A;  4J8O A;  2L8D A;  4M75 D;  5M9O A;  1OQK A;  1W6X A;  2KDS A;  5GAN 6;  1WNL A;  2DL4 A;  3CCR T;  2KXC A;  2HMA A;  5IXF A;  1IHW A;  3A8L B;  1TU0 B;  3CCL T;  2F2V A;  2MYS A;  1SF9 A;  3THK A;  4Y28 E;  1ARK A;  4M75 B;  3RKY A;  1N9S A;  2O9S A;  1TOV A;  2FYK A;  5CQX A;  2YHT A;  1D3B B;  2E10 A;  2Z0W A;  4M78 F;  1NG2 A;  2RHX A;  5ECA A;  4OP0 A;  4AG2 C;  4DOW A;  2JZ2 A;  4PLL A;  1K76 A;  2F5T X;  2DJZ A;  4IKF A;  2A08 A;  4C8Q E;  2MAM A;  4PFO A;  3E9G A;  1Y57 A;  1SG5 A;  5J26 A;  3RIR A;  3O5Z A;  1YJN T;  2PQW A;  2G6F X;  1Q86 C;  5KE2 A;  4PJL A;  4M78 G;  2BTT A;  1YCS B;  1QP2 A;  5FRN A;  4WTO B;  1U8R A;  1O9S A;  1QVG A;  1BIA A;  1M90 C;  3QXE B;  1VQK A;  3TU4 K;  2A3L A;  1JXM A;  1WFW A;  2AKK A;  1WIE A;  1X27 A;  3SWN A;  3CD6 A;  1B34 B;  2EKO A;  1R77 A;  3QWY A;  1GCP A;  1UDL A;  1KC8 C;  4JPB W;  1MHN A;  1ZSZ C;  2NUP A;  2JJ9 A;  2V26 A;  1KSW A;  4PJO D;  1JJ2 P;  2PNI A;  4KGV B;  2AKL A;  3QSU A;  4IUP A;  2DBM A;  2KT8 A;  3FJP A;  5GMK e;  1UGQ B;  4ESR A;  1YI2 T;  2BKD N;  2CDT A;  3GNG A;  3ME9 A;  1WYX A;  3DLM A;  2KQW A;  2RO0 A;  3KBG A;  3PIO A;  2GNC A;  3GIB A;  3OB9 A;  2COW A;  4PJO B;  1EIF A;  2LDM A;  4JLI A;  1M1G A;  3CCU A;  4F7U A;  1B7T A;  2ZAE A;  5GAM e;  4C5E A;  2D8J A;  2DXC A;  1AWJ A;  4GLK A;  1Q7Y R;  1I4K 1;  3JCM d;  1O75 A;  1K8A C;  2K79 A;  3P8B B;  4OMP A;  4KT0 E;  5FU6 B;  2O01 E;  3FRN A;  2GTO A;  4BI8 B;  1K73 U;  1G8X A;  1KD1 U;  3OYD A;  2L5Q A;  2DIL A;  1YIT T;  3PT9 A;  1V76 A;  2YRD A;  1VQ8 T;  5I2S A;  5KYU A;  1U1S A;  2MIO A;  2M16 A;  1G83 A;  3VS5 A;  1YN8 A;  2RNA A;  4ELY C;  1Y96 B;  3JCM f;  2COZ A;  4D8D A;  3OYG A;  5D6X A;  4L6V 5;  2C06 A;  1ZX6 A;  3M9Q A;  2YUO A;  2RQW A;  3MHX A;  3OYC A;  3JB9 D;  3I9Q A;  1YNZ A;  3VS2 A;  1VQK Q;  2P4R A;  4PFP A;  1I8F A;  5KYW B;  1VQ7 Q;  2CGH A;  1UGR B;  3A5Z B;  3CD6 Q;  4LDU A;  4AFQ C;  4LE9 A;  3PVL A;  4L5G A;  5GAN 7;  1VYU A;  2DRM A;  4M75 E;  1NLP C;  3A1P A;  2L3P A;  2DVJ A;  2HKQ B;  1UEC A;  4II1 A;  1HXD A;  2P0P A;  4OGE A;  1S72 A;  2X35 A;  1KFZ A;  1XNI A;  5LJ3 e;  3LX7 A;  5A0D A;  3X26 B;  3CCU Q;  3PGG A;  4PKC C;  1Q81 C;  4O6J A;  2EQU A;  2CZ0 B;  4BE2 A;  1YIJ T;  4QVC A;  3I35 A;  1BU1 A;  4OB1 B;  1U3O A;  2CP5 A;  1UGS B;  3NTK A;  1N5Z A;  1B3Q A;  3RER A;  5FW9 A;  5DM7 R;  2WSE E;  1RI9 A;  2DE0 X;  3U23 A;  1W2B S;  4MZT A;  4A4G A;  2CT3 A;  4C0D B;  1X6G A;  3VS7 A;  3CPW S;  4ME7 A;  4FYX B;  3EFR A;  3CXC S;  2MI6 A;  3EAE A;  2O31 A;  1BB9 A;  2HDA A;  4FYW B;  3RES A;  4OVA A;  1TG0 A;  2E3I A;  1WX6 A;  5FU7 C;  1X69 A;  2DXU A;  3OSS C;  2QA4 A;  2OAU A;  4IIO A;  4PJO E;  1MND A;  3C12 A;  5CO7 A;  1JO8 A;  1NYF A;  4RMO A;  3NHN A;  2JVV A;  2R5M A;  3I55 A;  1I81 A;  3D7S B;  2JOY A;  3L1A A;  3OYE A;  1NEB A;  3BW1 A;  4BDY A;  5FLX E;  1YP5 A;  3JCM b;  1H64 1;  1XQH A;  3JCM X;  3CPF A;  1VQM T;  2QQA A;  3SD4 A;  3C95 A;  4ZGD B;  1S72 Q;  2HQH A;  3JB9 F;  3HFO A;  5HY6 A;  1NPP A;  3CCV A;  1OU8 A;  2R5A A;  2MF2 A;  3HFN A;  3M0T A;  1OZ3 A;  2PVG B;  3JB9 G;  1A0N B;  1FMW A;  1PHT A;  3LGL A;  3CCE T;  1TH7 A;  4Z02 A;  3PFS A;  2CUB A;  1ABQ A;  3WXM B;  4CC7 A;  3CC7 A;  2VKN A;  3L2R A;  1XOV A;  3HL8 A;  1RUW A;  2D9T A;  2PVD B;  3JSC A;  1BCM A;  4M7A F;  3PMT A;  3RKW A;  1M5Q 1;  5J3B A;  3S3N A;  5GAM d;  1K4U S;  2DLP A;  2DPP B;  1N8R U;  1N9R A;  2EQM A;  1ACM B;  1NLO C;  4XAX B;  3LWH A;  2KGT A;  3VRY A;  2RMO A;  1ZSZ A;  2E1H A;  1Q86 U;  4IUQ A;  2FZG B;  3MP1 A;  3ZBD A;  4M7A G;  3QHS A;  4NS5 A;  4DQ2 A;  4GBQ A;  1WJS A;  4RTY A;  2KT1 A;  4RTZ A;  3C4S A;  2L0A A;  1VQ6 T;  2KYB A;  2V8K A;  4DEY A;  5I22 A;  1Q82 R;  1QVF S;  2LRQ A;  4NL2 A;  3I55 Q;  1AEY A;  4RTX A;  1KC8 U;  1UB4 A;  5GAO n;  1HSQ A;  2GQI A;  2NUT A;  4C92 D;  4BUG A;  2L2P A;  2K5L A;  1VQ9 A;  2KAF A;  4RUG A;  4RG8 A;  4CI0 C;  2JMC A;  1VQ8 Q;  1JJ2 A;  1QVP A;  3A8O B;  2OI3 A;  4FT4 A;  1QWF A;  2HBP A;  4IUV A;  3CCV Q;  2EQK A;  3SWN C;  4C92 B;  3CMA A;  3VS0 A;  3RNJ A;  1NJI C;  1AWW A;  2VUB A;  4OML A;  2RJF A;  2SRC A;  5CKF A;  1YHQ A;  3S3M A;  3M4Y A;  3LH0 A;  1VOM A;  5FWB A;  1VQO T;  1CSK A;  4AFU C;  4DOV A;  3QUI A;  2RHU A;  2C0T A;  2K9G A;  3PVQ A;  3CC7 Q;  5LJ3 d;  3VUZ A;  1PCX A;  5AT1 B;  4ZNX A;  3VRZ A;  1KQ1 A;  1VQL A;  1ZUU A;  2YRV A;  1T3L A;  3MEW A;  2OJ2 A;  1KQS S;  1TSF A;  4KH1 B;  2ESW A;  3M0Q A;  2K3B A;  4JJB A;  1AZG B;  3JB9 I;  2CP0 A;  1W70 A;  4C8Q D;  4HCZ A;  2JS2 A;  1WXT A;  3OW2 S;  4M77 F;  4IIM A;  3M0R A;  4A4E A;  3EH2 A;  3CCS A;  2P84 A;  2PUO B;  4N0A C;  2DA9 A;  3QZ9 B;  5CAI A;  2HKN A;  1KIK A;  1OOT A;  4M78 A;  4QT7 A;  5HK3 A;  4J9C A;  2WSC E;  4C8Q B;  4KUI A;  4M77 G;  2HSP A;  3JCM W;  2L3S A;  4EMH A;  2BZ8 A;  3SFM A;  1VQ9 Q;  1K9M R;  3EGD A;  1RAA B;  3UAT A;  2O4X B;  2KI7 A;  1OYX A;  5CK9 A;  4A4F A;  1VQK T;  4JLG A;  5D6Y A;  4M7A C;  4HVW A;  1ZBJ A;  3RKX A;  2QTV A;  5GAN d;  1YJW A;  1YHQ Q;  1W4S A;  2KR3 A;  1Q7Y U;  2E12 A;  3CD6 T;  2X4W A;  2D0Q B;  4MMK A;  3EG9 B;  2CZ6 B;  4LNP A;  1P92 A;  1SKU B;  4QQ6 A;  1WHJ A;  1JEG A;  2K6D A;  2IIM A;  4E6R A;  2DZC A;  2LTO A;  3X25 B;  1VA7 A;  1WA7 A;  2EGA A;  2LNV A;  4C92 F;  2VC8 A;  4D6W A;  2RI2 A;  4XTX A;  2E3H A;  2JM8 A;  3OYI A;  2ZZD A;  2XDD A;  4GY5 A;  2QQS A;  5KE3 A;  3P8H A;  4MML A;  3HTR A;  1VQL Q;  2KBT A;  2F2X A;  5GAN f;  4C92 G;  1C1A A;  2HAX A;  1MMD A;  4IUU A;  1M2V A;  2COY A;  1H8K A;  1QWE A;  4J9D A;  2RHZ A;  1VQM Q;  3CCU T;  1RAC B;  1TTH B;  4RKU E;  3NTI A;  2AHJ B;  5GAN 2;  4MDW A;  2DD4 A;  3KXT A;  1IXD A;  3MEV A;  1X6O A;  1M1F A;  1AZE A;  1EX4 A;  2RH2 A;  1IB8 A;  3PIP A;  5LL6 S;  2LT4 A;  1GL5 A;  3CCS Q;  4J9E A;  3VS1 A;  3EG3 A;  2D8H A;  2GFU A;  4M7D D;  4P5N A;  1LPL A;  1VQO A;  4C0F A;  4Y92 A;  1C6V X;  3UT1 A;  2LT1 A;  2FRY A;  3CCE Q;  1UUE A;  2YWW A;  2QTX A;  1D3B A;  2K5I A;  1K9M C;  2EJ9 A;  5KYY B;  1FX7 A;  1YBY A;  4M7D B;  1Y0M A;  2CP2 A;  2BE7 D;  4C8Q F;  3FIF A;  2DXB A;  4B9W A;  2LCC A;  3VV0 A;  2EIF A;  1TXQ A;  4CC3 A;  5GMK h;  2CS7 A;  1R8O B;  1WHK A;  1WHH A;  4C8Q G;  4EMK C;  1IO6 A;  2OAW A;  3MEA A;  4ZTJ A;  1VQ6 Q;  3OS0 A;  4XU0 A;  3REB B;  3H8Z A;  5CR2 A;  4CC4 B;  5GAM h;  1SSH A;  3EG0 A;  1NE8 A;  4CRI A;  4M77 C;  1N8R C;  1S72 T;  3DLL A;  3ER0 A;  4JJD A;  3MET A;  2LC4 A;  1OPL A;  1OV3 A;  3TVT A;  4JZ3 A;  1W2B P;  4LUD A;  1IGU A;  3NGP A;  3G4S T;  2VB6 A;  2RM4 A;  5GAN j;  3OYF A;  2RPN A;  2HNI A;  5GAO m;  4BI4 A;  2AZS A;  3CXC P;  4EPC A;  3M55 A;  3HKS A;  2LX9 A;  3OYB A;  3QBY A;  4ELZ C;  1VQO Q;  3GOX A;  3HSB A;  5GAN 4;  2CSI A;  1I07 A;  2HD0 A;  4KH0 B;  2K4Y A;  2WSF E;  2GTJ A;  1WPY A;  3UPU A;  2J7I A;  3OMC A;  1M3C A;  2X4J A;  3EGX B;  3M58 A;  1D0Y A;  1D1C A;  1RAD B;  1PKS A;  2HSE B;  3A8G B;  3LWI A;  1YFN A;  1NBE B;  4FW1 A;  4MZM A;  1I5O B;  2OTL A;  2QA4 T;  2DXT A;  4N4H A;  1NZ9 A;  1NYG A;  4D8K A;  2O2O A;  2A7Y A;  4BY6 B;  1Y96 A;  1NJI U;  1M8V A;  1MV0 B;  2F69 A;  2JN0 A;  2P4T A;  3INZ A;  1VYV A;  1AOJ A;  2DER A;  3X20 B;  1F1B B;  3I55 T;  2VYT A;  2FG0 A;  1Z9Q A;  3R6N A;  1LVK A;  1SEM A;  5LJ3 h;  3TSZ A;  1K0S A;  1PSF A;  2XU8 A;  2DYB A;  4N0A A;  1IHV A;  1BCO A;  4FCY A;  3ASK A;  4OMF B;  2XK0 A;  4XTY A;  2M0O A;  9ATC B;  4M75 F;  1VUB A;  3CCV T;  1Y71 A;  2DMO A;  3MKD A;  3LYI A;  1RAG B;  3OY9 A;  1HD3 A;  1V29 B;  5LJ5 h;  4M7D E;  2CYZ B;  4PL6 A;  3M57 A;  3OA6 A;  4M75 G;  1C0M A;  1ZBX A;  1GCQ C;  4XU2 A;  2JW4 A;  3CC7 T;  4JS4 A;  2MPX C;  2HCK A;  1XTD A;  1Q82 U;  4F7U B;  4M7A A;  4LD6 A;  4RTV A;  2CSQ A;  2MCN A;  3OYH A;  1RLQ C;  1SPK A;  2K3Y A;  1U1T A;  4BE0 A;  4J9F A;  3EHR A;  3E9F A;  1E7O A;  2AZV A;  2WAC A;  2R58 A;  2HQX A;  4X9D A;  5KYU B;  1QKW A;  1X2Q A;  2JTM A;  4M78 C;  2QEX A;  2OTL Q;  2E6N A;  3E19 A;  2CKK A;  2XKO C;  2CP3 A;  2QG9 B;  1Q7Y C;  4ZGE B;  3MPU B;  2FZC B;  1BI2 A;  3G4S A;  1UTI A;  3QJY A;  3OYN A;  2CH4 A;  5GMK i;  3LH5 A;  3L2W A;  3JCM J;  3TQ7 P;  2CRE A;  3OS5 A;  3SB2 A;  1M1K R;  4HVV A;  3CBO A;  5CKD A;  1EFN A;  4PJO F;  4VUB A;  2ZPE B;  1RAH B;  4DEX A;  1VQ9 T;  2EPD A;  3QYG B;  3GPL A;  4JRQ A;  1X75 C;  3Q1J A;  3CCQ A;  2FRW A;  3UA6 A;  4E2F B;  1U06 A;  2DIQ A;  2ENM A;  2P0Q A;  4PJO G;  5KYN A;  5IAY A;  3CMA T;  4OGC A;  2ROL A;  2O9V A;  2G3R A;  2ZPB B;  1YHQ T;  1BKB A;  4BE1 A;  2LJ3 A;  1RAE B;  2OTJ A;  4JJC A;  2DF6 A;  4QVD A;  3WVD B;  2W10 A;  1X2K A;  1QLY A;  2L89 A;  2QQ9 A;  2VGM A;  1Z9Z A;  1JBM A;  3OW2 P;  4LXC A;  2VXE A;  4J83 A;  4PJJ A;  5HK0 A;  2K57 A;  1LJO A;  3JV3 A;  4DA4 A;  4LUE A;  1VQL T;  1WLP B;  3FEO A;  4EMK A;  1X6B A;  3OQ5 A;  2E5K A;  1WJR A;  5GAN e;  2MOX A;  3A98 A;  3JB9 H;  5GMK l;  2DET A;  1OZ2 A;  3LGF A;  3S6W A;  1K9M U;  2EYW A;  1TUC A;  1Y07 A;  2L3R A;  3H41 A;  4XQ3 A;  2DFU A;  5KCH A;  2AT1 B;  4IUT A;  1LCK A;  1VQ4 A;  2ED1 A;  4RTU A;  4M77 A;  3UDC A;  3DKM A;  4QW2 A;  4E7H A;  1VQP A;  1UJ0 A;  3CC4 A;  3GNF B;  1MMN A;  1SHG A;  3CCS T;  4N4I A;  3ZL7 C;  3M59 A;  3TSW A;  1FYN A;  3E2U A;  1M1K C;  3G4S Q;  1AWX A;  2YUN A;  3EG2 A;  4M75 C;  3V8J A;  4XTV A;  2EKH A;  2VVK A;  4PJN A;  2K5F A;  2HL3 A;  1YWP A;  4ORZ A;  4QVZ A;  1B07 A;  1LNX A;  1U5S A;  5D7U A;  4FL6 A;  3VS4 A;  1GRI A;  4F7U E;  3GBQ A;  4L59 A;  4JUV A;  4WCI A;  3HPW A;  5CQY A;  3P8D A;  4DBQ A;  4PK4 A;  1UHC A;  5CKB A;  3G6E A;  2RD1 A;  3F70 A;  2RQR A;  1YJW T;  1RAI B;  1K73 R;  1TUD A;  1KD1 R;  3AT1 B;  4AFZ C;  1SSF A;  4RCB A;  5EC7 A;  3ZEH A;  1YWO A;  1W2B A;  2QA4 Q;  2H3E B;  4OB0 B;  4C92 A;  5DY9 A;  1AVZ C;  2M9U A;  4OF1 A;  5IHN A;  3EFO B;  3CPW A;  1QW1 A;  2CZ7 B;  2RI5 A;  2X9H A;  1W1F A;  1I1J A;  3CXC A;  4R56 A;  1PG5 B;  3G7Z A;  2DL8 A;  4XK8 E;  2MMP A;  2ZGW A;  4K11 A;  2M0Y A;  8AT1 B;  2EGC A;  3FLG A;  3M54 A;  2DM1 A;  3JRZ A;  2C0O A;  2K2M A;  2LQW A;  2BUD A;  1UHF A;  3T9N A;  1Y7X A;  4PLI A;  3CBP A;  4Z88 A;  1ZA2 B;  4PJO C;  2ED0 A;  3N5B B;  1JB0 E;  4HT8 A;  4HVU A;  1QP3 A;  3CEY A;  3QG1 A;  3CC4 Q;  7AT1 B;  1ZSZ B;  4Y91 A;  1WZO A;  4Q5W A;  1GBR A;  3H0H A;  5I11 A;  3JCM h;  1YJ9 A;  1MMG A;  5FU6 C;  1UGV A;  3V8L A;  1TS9 A;  3CBM A;  5LJ5 g;  1ZSG A;  2ZCF B;  5L8R E;  2D1X A;  4CC2 A;  2QXF A;  1PWT A;  1IZ6 A;  4FT2 A;  3KUF A;  3RR6 A;  1GCQ A;  4KRT A;  2A37 A;  1QQJ A;  1KQ2 A;  4J5Y A;  3RMQ A;  2EVR A;  4C8Q A;  1WHG A;  2CP6 A;  2LJ1 A;  5GAN 8;  2RHY A;  5KYX B;  4BD3 A;  4R55 A;  2EWN A;  1ZLM A;  4NL3 A;  3EFS A;  5GAO q;  5GAO p;  2KEA A;  1M2O A;  3EHQ A;  4JS5 A;  1VQ5 A;  2O4X A;  2QQB A;  3MCA B;  2EW3 A;  2VGN A;  1QMC A;  2FPD A;  1Q82 C;  4E7I A;  3VUB A;  4JRP A;  2FPE A;  2X3X D;  2DD5 A;  4HCK A;  1DJ7 B;  1EZZ B;  2DIG A;  1OX8 A;  3PE0 A;  1RL2 A;  5GAN 5;  2JTE A;  1OU9 A;  2EBP A;  3CQT A;  4FU6 A;  2DKG A;  2DZ9 A;  2XMF A;  1BI1 A;  2YLB A;  2KYM A;  2A36 A;  3OMG A;  2RK2 A;  4AG1 C;  2YUQ A;  8ATC B;  3CCJ A;  3J81 E;  2DL7 A;  2K2V A;  4LDW A;  3RBB B;  1BYM A;  2RJD A;  4GLM A;  2KY9 A;  1QVF A;  3M56 A;  1E6G A;  3CMA Q;  2ATC B;  1BI0 A;  2B8A A;  1WI7 A;  4F04 B;  2MWO A;  3NPF A;  1YJ9 Q;  2LZ6 B;  3V8K A;  2QGG A;  4X9C A;  5DLO A;  2KK4 A;  1HYO A;  2HL5 C;  1WDX A;  2VAS A;  3VYH B;  2X3W D;  3OSV A;  1H92 A;  1KG1 A;  2EYY A;  4LDV A;  3QO3 A;  3UA7 A;  4C0D C;  2KSS A;  1MUZ A;  1UJY A;  1ZUK A;  5HKC A;  1K1Z A;  1KHI A;  1OEB A;  4BB7 A;  2OTL T;  1TUG B;  4HCB A;  2NYS A;  2P0K A;  3ULR B;  3CC2 A;  5KYY A;  3OYA A;  3J7A F;  3EG1 A;  2AIR B;  1PD1 A;  4WF2 A;  5D6W A;  1QVG S;  2KRN A;  1VQ5 Q;  4RTW A;  3EGD B;  5IN1 A;  3QKJ A;  4F17 A;  1NEG A;  1AT1 B;  2VV5 A;  5CIU A;  1KQS A;  2GF7 A;  2J6O A;  4EMG A;  3IQL A;  1JU5 C;  5IT9 E;  1MNE A;  1D0Z A;  3A8H B;  1Q86 R;  2KRM A;  2RB6 A;  4M75 A;  2V1Q A;  5IHI A;  2XG8 D;  3OW2 A;  4OB3 B;  1R0C B;  2JTF A;  3J80 E;  2XIC A;  3GP8 A;  4J6Y A;  1M90 R;  4J9H A;  3OS2 A;  2CP7 A;  3I56 A;  4LDY A;  4OMQ A;  2M1H A;  4N4G A;  4E7Z A;  4C5G A;  4JRK A;  1KC8 R;  1YJW Q;  3QPH A;  4O5V A;  3H0F A;  4AT1 B;  1M1K U;  2HZY A;  3MJX A;  3SHW A;  4RG2 A;  1JXO A;  4OMM A;  4Z89 A;  1QKX A;  5CKE A;  5LJ5 j;  3C94 A;  2XD0 A;  1B34 A;  4KGZ B;  3CCM A;  3G71 A;  4TVR A;  2E41 A;  5C0M A;  1QCN A;  1NPR A;  2GCX A;  2W0Z A;  3X24 B; 
#chains in the Genus database with same CATH homology
 1M5Q 1;  2QEX T;  5J3B A;  3OYM A;  4KBM B;  3E9F A;  3S3N A;  5GAM d;  3TCJ A;  2DPP B;  3CCE A;  2LVM A;  2RK1 A;  1N8R U;  1N9R A;  2EQM A;  2VXF A;  4XAX B;  5GAM j;  4C0Z A;  2WAC A;  3LLR A;  2R58 A;  3QDR B;  3LWH A;  2HQX A;  4M78 D;  4X9D A;  5LJ5 f;  3CME A;  2E1H A;  2JTM A;  4M78 C;  2QEX A;  4XTU A;  2E6N A;  3E19 A;  5GAO l;  1Q86 U;  2CKK A;  4IUQ A;  1G3T A;  2XKO C;  3MP1 A;  4MZP A;  2FVU A;  3ZBD A;  3JCM e;  4M7A G;  1BI3 A;  3QHS A;  4NS5 A;  4PJO A;  4C5H A;  1Q7Y C;  4ZGE B;  4DQ2 A;  1YCY A;  3JB9 J;  1WGS A;  1BI2 A;  3G4S A;  3A8M B;  4M77 E;  3QJY A;  3QYH B;  3OYN A;  1WJS A;  5GMK i;  2DK3 A;  3UWN A;  3VKI A;  3L2W A;  3C4S A;  3JCM J;  5KH6 A;  3OS5 A;  3AHU A;  3CCQ T;  2Y4X A;  4HA8 A;  3SB2 A;  4V2S A;  3CBO A;  3H6Z A;  5GAO r;  5CKD A;  1VQ7 T;  4M78 B;  1VQ6 T;  4PJO F;  3JCM g;  2EFI A;  2V8K A;  3OBW A;  4VUB A;  1WJQ A;  4BI3 A;  2ZPE B;  1Q81 U;  4JDS A;  3FC3 A;  1VQ9 T;  2D6F A;  3QYG B;  4QQD A;  3GPL A;  2DVE A;  5J39 A;  3PNW C;  4JRQ A;  1QVF S;  2LRQ A;  5CKH A;  1X75 C;  4NL2 A;  3Q1J A;  3CCQ A;  5DLQ E;  3OYK A;  4E7K A;  5KCO A;  1KC8 U;  3MO8 A;  1UB4 A;  5GAO n;  1VQ7 A;  3M53 A;  3QJ6 A;  1VQ6 A;  4C92 D;  4M78 E;  4BUG A;  4M7D A;  5EG2 A;  2K5L A;  2DIQ A;  3R6O A;  4C92 C;  2OTJ T;  2P0Q A;  4PJO G;  1VQ9 A;  2KAF A;  3RUX A;  2LCL A;  3PTA A;  5IAY A;  4RG8 A;  3JCM Q;  3CMA T;  4HKE A;  4CI0 C;  2PVO B;  2JNG A;  4A4K A;  2XID A;  4OGC A;  5A0G A;  2G3R A;  2ZPB B;  1YHQ T;  1JJ2 A;  1BKB A;  2K3X A;  4BE1 A;  1QVP A;  2CZ1 B;  1VIE A;  4M7D F;  2DTI A;  2DO3 A;  3L2V A;  1G3W A;  3VYG A;  3A8O B;  2OTJ A;  4J7F A;  4FT4 A;  4QVD A;  5FRM A;  2HBP A;  4IUV A;  3WVD B;  1VQN T;  1WQ7 A;  2EQK A;  3GLX A;  3SWN C;  4C92 B;  3CMA A;  3TRE A;  2IVW A;  1NJI C;  2L89 A;  3HRS A;  2QQ9 A;  2QI2 A;  4OB2 B;  2VUB A;  5CKF A;  2RJF A;  1YHQ A;  4A53 A;  2YLC A;  3S3M A;  2VGM A;  3M4Y A;  2LQ8 A;  3LH0 A;  1JBM A;  2VXE A;  2QDY B;  4J83 A;  1VQO T;  3OS1 A;  4M7D G;  2RHI A;  5HK0 A;  1VQN A;  4DOV A;  2K57 A;  3L2Q A;  2JUF A;  1LJO A;  5FU7 B;  4C92 E;  2DTH A;  3OYY A;  4DA4 A;  1VQL T;  3QUI A;  3SWN B;  2RHU A;  4J6W A;  2MWP A;  3BY7 A;  3FEO A;  3JCM c;  5LJ3 d;  1VQ4 T;  4EMK A;  2EJF A;  3M4G A;  2FB7 A;  3OQ5 A;  3V7S A;  5A0L A;  1WJR A;  4XTZ A;  5GAN e;  5LJ3 j;  3VUZ A;  1VQP T;  2LQK A;  3JCM P;  3JB9 H;  4ZN1 A;  5GMK l;  3CC4 T;  1OZ2 A;  3LGF A;  3S6W A;  1K9M U;  2XI9 A;  2HQE A;  4JRI A;  2L3R A;  1Y07 A;  1KQ1 A;  4XQ3 A;  5KCH A;  1VQL A;  4IUT A;  2YRV A;  1M4Z A;  1IRE B;  3DB3 A;  1VQ4 A;  4KUL A;  2X4X A;  3MEW A;  3VJP A;  4HCC A;  1KQS S;  4M77 A;  3UDC A;  3DKM A;  4QW2 A;  4E7H A;  1VQP A;  5C6S A;  3CC4 A;  2I2L A;  3GNF B;  3L2Z A;  4ZN3 A;  3CCS T;  2PU9 B;  4N4I A;  3TEE A;  3JB9 I;  4J8O A;  3M59 A;  2RJE A;  2L8D A;  4M75 D;  4C8Q D;  4HCZ A;  5M9O A;  1M1K C;  3OW2 S;  2KDS A;  4M75 C;  4M77 F;  2DEQ A;  3V8J A;  4C8Q C;  5GAN 6;  1UEB A;  1WNL A;  4XTV A;  3CCR T;  2Y4Y A;  1JRI A;  1M9S A;  4A4E A;  3HHT B;  3A8L B;  3CCS A;  5CAI A;  2PUO B;  4N0A C;  3QZ9 B;  2K5F A;  3URG A;  3NFC A;  2V8J A;  4IUR A;  4XTW A;  1AHJ B;  4QVZ A;  4M78 A;  1LNX A;  3CCL T;  5HK3 A;  4FL6 A;  3G6E T;  1VIF A;  3CCR A;  4Y28 E;  4F7U E;  2WSC E;  4M75 B;  3RKY A;  4C8Q B;  1N9S A;  4KUI A;  4M77 G;  2FYK A;  4L59 A;  4JUV A;  5CQX A;  1FXX A;  2YHT A;  1D3B B;  2E10 A;  4M78 F;  3CCL A;  3JCM W;  2RHX A;  3HPW A;  3BDU A;  3P8D A;  4OP0 A;  5CQY A;  4EMH A;  3FB9 A;  3SFM A;  4DOW A;  2JZ2 A;  4PLL A;  5CKB A;  2F5T X;  3G6E A;  2DJZ A;  2RD1 A;  3F70 A;  4IKF A;  5GAN h;  4C8Q E;  3ZFJ A;  3L2U A;  1YJW T;  2EJG A;  2MAM A;  3E9G A;  2E64 A;  2E5Q A;  2O4X B;  5J26 A;  3RIR A;  1YJN T;  2PQW A;  1OYX A;  5CK9 A;  1Q86 C;  5A2Q E;  4M7A D;  1SSF A;  4A4F A;  3RMS A;  5KE2 A;  3FDR A;  4M78 G;  4RCB A;  4BAC A;  4JLG A;  5D6Y A;  3ZEH A;  1VQK T;  4M7A C;  3O8V A;  1W2B A;  3RKX A;  4OB0 B;  4C92 A;  5GAN d;  1YJW A;  5DY9 A;  3SDZ A;  1QP2 A;  2M9U A;  1W4S A;  4OF1 A;  5FRN A;  1Q7Y U;  2E12 A;  1G5V A;  3CD6 T;  2PUK B;  2X4W A;  3CPW A;  1QW1 A;  2D0Q B;  4MMK A;  1WQW A;  2CZ6 B;  1P92 A;  1O9S A;  2CZ7 B;  1YJN A;  4QQ6 A;  1U8R A;  1QVG A;  2RI5 A;  1BIA A;  4EDU A;  1M90 C;  3QXE B;  1VQK A;  3CXC A;  2XDB A;  4R56 A;  2H3J A;  2DZC A;  3G7Z A;  3TU4 K;  2A3L A;  2LTO A;  2MMP A;  4XK8 E;  3X25 B;  4XU3 A;  2FHD A;  2ZGW A;  2LNV A;  4C92 F;  2VC8 A;  4M7A B;  2RI2 A;  4D6W A;  4XTX A;  3FLG A;  3M54 A;  3SWN A;  3CD6 A;  1B34 B;  2EKO A;  3OYI A;  2ZZD A;  3JRZ A;  3MP6 A;  3JAM E;  2XDD A;  4GY5 A;  2QQS A;  5KE3 A;  1KC8 C;  4NOY A;  1MHN A;  2BUD A;  3P8H A;  3T9N A;  4MML A;  1Y7X A;  4PLI A;  4X34 A;  3S3O A;  3CBP A;  3HRT A;  4PJO D;  3QSU A;  4IUP A;  5GAN f;  4PJO C;  4C92 G;  2HAX A;  3N5B B;  1JB0 E;  3FJP A;  4IUU A;  5GMK e;  1YJ9 T;  4HT8 A;  2X4Y A;  1QP3 A;  1UGQ B;  5LJ5 e;  3CEY A;  3QG1 A;  4PNO A;  2RHZ A;  3CCU T;  1YI2 T;  2BKD N;  3GNG A;  3ME9 A;  4RKU E;  3NTI A;  2AHJ B;  5GAN 2;  3DLM A;  2KQW A;  4MDW A;  4Y91 A;  2DD4 A;  2RO0 A;  4Q5W A;  3KXT A;  2XDP A;  3KBG A;  3MEV A;  1X6O A;  3JCM h;  1M1F A;  3WVE B;  2RH2 A;  5FU6 C;  3PIO A;  1RI0 A;  1YJ9 A;  3GIB A;  3OB9 A;  3V8L A;  3PIP A;  4PJO B;  2ZPG B;  3CBM A;  3QII A;  1EIF A;  2LDM A;  4J7I A;  4JLI A;  5LL6 S;  5LJ5 g;  1M1G A;  3CCU A;  1ZHI A;  4F7U A;  2LT4 A;  1YI2 A;  1FWZ A;  2ZCF B;  5L8R E;  3HRU A;  3NTH A;  5CVI A;  2QXF A;  2GFU A;  5GAM e;  4C5E A;  1IZ6 A;  4M7D D;  2DXC A;  4KUD K;  4GLK A;  4FT2 A;  4P5N A;  3KUF A;  4M7D C;  1I4K 1;  3JCM d;  1O75 A;  1VQO A;  1K8A C;  4C0F A;  2FL7 A;  3P8B B;  1KQ2 A;  4J5Y A;  4KT0 E;  5FU6 B;  4F7U F;  4ATO A;  2O01 E;  3RMQ A;  1MGQ A;  3UT1 A;  2LT1 A;  3FRN A;  4BI8 B;  1JJ2 S;  4C8Q A;  1K73 U;  1KD1 U;  3OYD A;  1G3S A;  2L5Q A;  4YTL A;  2RHY A;  5GAM g;  5GAN 8;  2QTX A;  4BD3 A;  1D3B A;  4R55 A;  5AYF A;  1VQ5 T;  2K5I A;  1K9M C;  2EJ9 A;  2EWN A;  1YIT T;  3PT9 A;  1FX7 A;  4NL3 A;  5I2S A;  1YBY A;  2GQV A;  3EFS A;  1VQ8 T;  4M7D B;  1U1S A;  4QQG A;  4E47 A;  4C8Q F;  2KMT A;  3FIF A;  5GAO q;  2DXB A;  4F7U G;  5GAO p;  2M16 A;  3M5A A;  4B9W A;  2LCC A;  4JS5 A;  4ELY C;  2O4X A;  1Y96 B;  1N6A A;  2EIF A;  3VV0 A;  1YIT A;  1VQ5 A;  1ZQ1 A;  5I21 A;  2QQB A;  3JCM f;  2NLU A;  4E7J A;  4UC4 A;  4ZGJ B;  5GMK h;  3MCA B;  1VQ8 A;  3OYG A;  5D6X A;  4L6V 5;  4J6X A;  2VGN A;  2C06 A;  2RA2 A;  2DTO A;  2CS7 A;  1R8O B;  2EQJ A;  3M9Q A;  3MHX A;  3OYC A;  1Q82 C;  4E7I A;  3JB9 D;  3VUB A;  4JRP A;  2E70 A;  2DD5 A;  4C8Q G;  4EMK C;  1DJ7 B;  4LDX A;  2DIG A;  3MEA A;  4ZTJ A;  1I8F A;  1RL2 A;  5GAN 5;  4B9X A;  2CGH A;  3CCJ T;  4MDX A;  1UGR B;  3A5Z B;  3OS0 A;  4FU6 A;  2DKG A;  2DZ9 A;  4XU0 A;  1BI1 A;  3BFM A;  3H8Z A;  4LDU A;  2YLB A;  5CR2 A;  4M77 D;  4L5G A;  3OMG A;  5GAM h;  2RJC A;  2ZPI B;  2RK2 A;  1NE8 A;  4CRI A;  4M77 C;  1N8R C;  4EMK B;  5GAN 7;  1S72 T;  3DLL A;  3JCM V;  3ER0 A;  4M75 E;  3MET A;  5I2M A;  3CCJ A;  2LC4 A;  4C0G A;  4FSX A;  3J81 E;  4RCC A;  3L42 A;  2K2V A;  4LDW A;  1BYM A;  2RJD A;  4II1 A;  2KY9 A;  1QVF A;  3M56 A;  3MP8 A;  4ZTF A;  1HXD A;  3V7R A;  2P0P A;  3BDL A;  4OGE A;  3GF5 A;  1S72 A;  2X35 A;  1KHC A;  4M77 B;  1BI0 A;  2B8A A;  3G4S T;  2RM4 A;  1N27 A;  2MWO A;  1XNI A;  5GAN j;  3LW5 E;  3OYF A;  2HNI A;  3V8K A;  5LJ3 e;  5GAO m;  4X9C A;  5DLO A;  3LX7 A;  5A0D A;  2KK4 A;  3X26 B;  4BI4 A;  4E7L A;  2XHC A;  4EPC A;  2DAQ A;  3M55 A;  3HKS A;  4A4H A;  3PGG A;  3PMI A;  3VYH B;  2EYQ A;  4PKC C;  3OYJ A;  1Q81 C;  3OSV A;  2EQU A;  2CZ0 B;  2LX9 A;  4O6J A;  4BE2 A;  1YIJ T;  4QVC A;  1GXI E;  2QQR A;  1KG1 A;  3OYB A;  3QBY A;  4OB1 B;  4LDV A;  1H3Z A;  3QO3 A;  4ELZ C;  5LJ3 g;  3GOX A;  2RI3 A;  1M90 U;  3HSB A;  4C0D C;  1HK9 A;  5GAN 4;  3CC2 T;  4BDZ A;  2HD0 A;  5GAM f;  1I5L A;  2KSS A;  1UGS B;  2K4Y A;  3NTK A;  2R57 A;  2WSF E;  5HKC A;  3RER A;  1YIJ A;  4M7A E;  1WPY A;  3MEU A;  2BIV A;  5DM7 R;  1KHI A;  3UPU A;  4BY6 C;  4BB7 A;  2WSE E;  2OTL T;  4HCB A;  3OMC A;  2EAY A;  2P0K A;  2X4J A;  3M58 A;  1LOJ A;  1W2B S;  3CC2 A;  4MZT A;  4A4G A;  2ZPH B;  5FRO A;  3A8G B;  3LWI A;  4C0D B;  3OYA A;  3J7A F;  3CPW S;  4HT9 A;  4MZM A;  4WF2 A;  5D6W A;  4ME7 A;  1QVG S;  2OTL A;  3DB4 A;  2QA4 T;  2DXT A;  4N4H A;  1NZ9 A;  3EFR A;  3CXC S;  2MI6 A;  2A7Y A;  5IN1 A;  4BY6 B;  1Y96 A;  3EAE A;  3QKJ A;  1NJI U;  1M8V A;  3RES A;  3E1S A;  4OVA A;  2F69 A;  2JN0 A;  2VV5 A;  5CIU A;  1UGP B;  5FU7 C;  2P4T A;  3INZ A;  1KQS A;  3QZ5 B;  2E65 A;  2DXU A;  2GF7 A;  2GFA A;  4EMG A;  3X20 B;  3I55 T;  2VYT A;  3OSS C;  2QA4 A;  2OAU A;  5IT9 E;  3A8H B;  4PJO E;  5LJ3 h;  4JJN K;  2RB6 A;  4FM4 B;  3C12 A;  5CO7 A;  4M75 A;  4C5I A;  2XG8 D;  3I56 T;  3OW2 A;  1PSF A;  4OB3 B;  3HP9 A;  4RMO A;  2JTF A;  2XU8 A;  1G3Y A;  4N0A A;  3J80 E;  2JVV A;  2R5M A;  3I55 A;  1I81 A;  2JOY A;  3L1A A;  1X01 A;  3OYE A;  2XIC A;  1K8A U;  1K73 C;  2ZPF B;  3GP8 A;  1KD1 C;  4J6Y A;  3ASK A;  3BW1 A;  2XK0 A;  4OMF B;  2M0O A;  4XTY A;  3OS2 A;  4M75 F;  4BDY A;  5FLX E;  3I56 A;  1VUB A;  3JCM b;  1H64 1;  1XQH A;  1Y71 A;  3JCM X;  3CPF A;  3CCV T;  2QQA A;  1VQM T;  3LYI A;  4LDY A;  5GMK m;  2Y90 A;  2M1H A;  4N4G A;  3SD4 A;  3VU3 C;  3OY9 A;  3C95 A;  4C5G A;  4ZGD B;  1V29 B;  4M7D E;  4JRK A;  2E6Z A;  2CYZ B;  5LJ5 h;  4PL6 A;  3JB9 F;  3HFO A;  3QPH A;  3M57 A;  5HY6 A;  5CCA A;  3X28 B;  4O5V A;  4A54 A;  1PSE A;  1NPP A;  5GAN g;  3OA6 A;  4M75 G;  3CCV A;  1VQM A;  1M1K U;  4XU1 A;  3CCM T;  1ZBX A;  3OYL A;  3G71 T;  4XU2 A;  2R5A A;  4RG2 A;  3CC7 T;  2MF2 A;  3HFN A;  4JS4 A;  5LJ5 d;  1OZ3 A;  1XTD A;  5LJ3 f;  1Q82 U;  5CKE A;  5GMK j;  3OBY A;  2IG0 A;  2PVG B;  4FIB A;  4F7U B;  5LJ5 j;  4M7A A;  3JB9 G;  3C94 A;  3V7C A;  2XD0 A;  4LD6 A;  1B34 A;  3LGL A;  3CCM A;  3G71 A;  1TH7 A;  4Z02 A;  2V8I A;  3PFS A;  1OI1 A;  2F5K A;  4TVR A;  1BIB A;  3CCE T;  2E41 A;  2KVQ G;  5C0M A;  3WXM B;  4LD9 K;  3CC7 A;  1NPR A;  5GAN 3;  3L2R A;  1XOV A;  2GCX A;  3HL8 A;  3OYH A;  3X24 B;  2D9T A;  2K3Y A;  2PVD B;  3JSC A;  1U1T A;  3CME T;  4M7A F;  4BE0 A;  3PMT A;  3RKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...