3SWNB

Structure of the lsm657 complex: an assembly intermediate of the lsm1 7 and lsm2 8 rings
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
SSPNEFLNKVIGKKVLIRLSSGVDYKGILSCLDGYMNLALERTEEYVNGKKTNVYGDAFIRGNNVLYVSAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm7
publication title Structure of the LSm657 complex: an assembly intermediate of the LSm1-7 and LSm2-8 rings.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 15
structure length 71
sequence length 71
chains with identical sequence E, Q, T
ec nomenclature
pdb deposition date 2011-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3swnB00
1I81A 4M77B 4M7DB 2VXFA 4J5YA 4M7AG 4M7AC 4M7AE 4C92B 4JUVA 5GAN4 4PJOB 2E1HA 3SWNC 4HT8A 5GAMf 1HK9A 4N0AA 1TH7A 5GAMg 5GAMd 1BIAA 4F7UA 5GAN7 4RCBA 4C8QB 3HSBA 2VXEA 3QUIA 1KQ2A 4MMLA 3RKXA 5GMKe 4M78C 4M78E 3FJPA 1N9SA 5LJ5e 5GAOp 5GANj 3BFMA 2YLCA 1WPYA 3JB9D 1WNLA 4M7DC 4M77C 4M77E 4M7DE 1Y96B 4XTYA 3HFNA 3JCMh 2E10A 4X9CA 4PNOA 4C92C 2DKGA 4C92G 3QHSA 4C92E 2QTXA 4M7AA 4PJOC 3JB9G 3RUXA 4M7AD 3JCMP 2K57A 3JB9F 1D3BA 4PJOE 4J6XA 2DJZA 2I2LA 1H641 2RD1A 4EMKC 3JCMd 3JB9H 1B34A 5GAOl 5LJ5f 4C8QC 4XU1A 3JCMV 4C8QE 5LJ5g 5LJ5d 3JCMW 5GMKm 3GIBA 4M75E 4QVCA 4JLIA 4M7AF 3BY7A 1LJOA 1KQ1A 4A53A 1JBMA 5GAOn 4M78D 3JB9J 2DVEA 4DQ2A 2RA2A 3PGGA 3VU3C 5GANh 4EMKB 5I21A 4J6YA 3JCMc 4HT9A 3EFRA 3M4GA 4M7DD 4M77D 2EAYA 1WQ7A 4C92A 3JCMe 4M75B 4M78G 3RESA 5GAN3 4PJOA 4C92D 2CGHA 4JRIA 3L1AA 1WQWA 3JCMQ 3RKWA 4PJOD 4M78F 5GANd 4M7DG 1U1TA 2E65A 4M77G 3V7CA 1M8VA 4NL3A 4F7UB 4M7DF 4M77F 2DTHA 4PJOG 4C8QA 3INZA 1X01A 2FYKA 1YCYA 4C92F 4XU2A 3SWNA 4C8QD 4PJOF 2HNIA 3JB9I 3JCMf 4EMGA 4MMKA 3JCMg 5GAMj 2RB6A 1Y96A 4C8QG 3EFSA 5GANe 1MGQA 4M75G 4M75C 4XTWA 3AHUA 4C8QF 3BW1A 4M78A 3SB2A 3JCMb 5LJ3j 2JN0A 3V8JA 3FB9A 3RIRA 2DTIA 4N0AC 3JCMX 4M7DA 4M77A 2E64A 1I8FA 3RKYA 4F7UE 5GAOr 4HA8A 4Y91A 3QSUA 1LOJA 4XTVA 5GANf 4NOYA 3V7SA 5GAN8 2EJ9A 5GANg 5GMKi 5GAOm 1N9RA 1U1SA 2ZGWA 1BIBA 2Y90A 5GAOq 4EMKA 2EJGA 3QO3A 1LNXA 3L2ZA 5GAMh 4XQ3A 5GMKj 4M75A 5LJ5j 5CAIA 4XTXA 1I4K1 4M75D 3V7RA 5GAN2 4WF2A 4J6WA 2DXUA 2DTOA 4OP0A 2DZCA 4XTUA 5LJ3h 1I5LA 3BDUA 2EWNA 3V8LA 1HXDA 4M7AB 4V2SA 4M75F 5LJ3f 1M5Q1 4XU0A 5LJ3g 3JCMJ 4XU3A 5LJ3d 3HFOA 3SWNB 3V8KA 5GAN5 4NL2A 2VC8A 5GMKl 2DEQA 4X9DA 4F7UG 1D3BB 2EJFA 2DZ9A 2FB7A 5GAN6 1JRIA 2RM4A 1B34B 2YHTA 2E41A 4F7UF 2YLBA 3FIFA 4A54A 5GAMe 3RERA 4JRKA 5GMKh 2DXTA 4EMHA 4M78B 5LJ5h 4RCCA 5DY9A 5LJ3e 4QVDA 4XTZA
chains in the Genus database with same CATH superfamily
1NM7A 1I0CA 1VQ8A 2BE9B 6AT1B 4PJOB 2KVQG 4N0AA 3TU4K 4E7HA 1OU9A 5GAN7 3ZBDA 3I9QA 1KQ2A 2FG0A 2X35A 1YJ9T 2MOXA 2HSEB 4L59A 4OB1B 4B6MA 4RMOA 3G1JA 2VKNA 3UA7A 1WA7A 2X51A 4C92E 2O2OA 2ZAEA 4FT4A 1H8KA 1JEGA 3GF5A 1B34A 2OTLT 3OQ5A 3JCMW 2OTLQ 3PIOA 1KQ1A 2GQIA 4AT1B 2DVEA 1R0CB 2X3XD 1ZBXA 1GBRA 3M4GA 1WQ7A 3M59A 2DL4A 3L2WA 1QLYA 5FU7C 1U1TA 1V76A 2GTJA 1NYGA 3X20B 4F7UB 2J05A 3FC3A 1K0SA 2JZ2A 2NUPA 4ELYC 4BY6C 1PG5B 4OF1A 2DEUA 1EZZB 2QYZA 1Z9ZA 4OMFB 2OTLA 4M75G 3PVLA 4HCKA 3M0SA 3PMTA 5EC7A 2EYQA 4BDYA 3JAME 4RG2A 4XTVA 1G3WA 2G6FX 2HDAA 5CCAA 1WZOA 2PNIA 1UGVA 3HRTA 2QQAA 1OOTA 4YTLA 3REAB 4N4GA 1WXTA 1OI1A 2CSQA 1LVKA 3OBYA 2DZCA 1UG1A 2MWPA 4TVRA 4XTUA 4DBHA 1D09B 2A37A 1I5LA 3BDUA 4CC2A 1RI0A 3JV3A 2X4XA 2DM1A 3DB4A 5GAN5 3QXEB 1WHLA 1RABB 2CKKA 2PVGB 1PD0A 3TEEA 1BCMA 5GMKh 3PE0A 2GCXA 4LD9K 4FCYA 3QZ9B 5ECAA 4KUDK 1Q86C 2H8HA 2V8IA 9ATCB 1JXMA 2OTJT 2OTJQ 2XMFA 5KYXA 4DOWA 2VXEA 5A0DA 1P92A 3QJ6A 1V29B 1N9SA 1XNIA 1D0YA 2MWOA 2KRMA 3JCMh 1WI7A 5KYUB 1IGQA 2QTXA 3A8OB 3OS5A 3RUXA 3JCMP 5CKEA 1M2VB 2EYZA 1JJ2A 1V1CA 2MCNA 2RJDA 2L3PA 1JBMA 4IIOA 2OTJA 4DQ2A 1X6OA 4IURA 4EMKB 3EGXA 4C92A 1FMWA 2MMPA 4C92D 3RBBB 2CZ1B 1TUGB 1OULA 3CXCP 3JB9I 4QQ6A 3CCRT 4LXCA 3CCRQ 3VS3A 2HAXA 3EG3A 2X3WD 2YT6A 1AD5A 2F2WA 1D0XA 2V1RA 1UDLA 1ZSZB 2EJ9A 1W2BP 3OW2A 2CT3A 1GRIA 2R5MA 2DO3A 5GAOq 4C5GA 3KUFA 2QA4Q 2BTTA 3M0QA 3LWHA 1K1ZA 2K3BA 2P4TA 3CCRA 2E3IA 5KE2A 2DTOA 5LJ3h 3L2UA 3JSCA 2DF6A 2XIDA 2EFIA 4HVVA 4DOVA 3JCMJ 1Q86U 1M9SA 3M57A 5L23A 4NS5A 2RMOA 1N8RR 2RM4A 5GAMe 1NPRA 1Y07A 3FIFA 2KI7A 2VWFA 1K9MR 3I5SA 4IKFA 3CCMT 4RCCA 2K4YA 4RTUA 5DY9A 2QA4A 1AHJB 4A4KA 1J3TA 3SHWA 2E3HA 3TREA 3MEUA 3OYYA 1TH7A 3EG0A 3N5BB 3BE3A 1H3ZA 2GQVA 2KNBB 2RHYA 2XDPA 3VS1A 1BI2A 1WNLA 4EDUA 1QVGA 1Y96B 3HFNA 4C5EA 2E10A 1VQPQ 1VQ5T 1RLQC 3SDZA 1RAGB 2JTFA 1VQ5Q 3VS7A 1X43A 2L8DA 3UPUA 3JCMd 2GTOA 4C0DB 3OYBA 4C8QC 1H92A 1X6GA 3H41A 1K4US 3NTIA 2DBMA 3H0HA 4VUBA 4CI0C 7AT1B 1RL2A 5KYNA 5J26A 1D0ZA 3FEOA 1VQPA 5IHKA 4PJOG 1VQ5A 2R57A 2RQRA 5J39A 4PFZA 3E1SA 2XKOC 1K73C 4KGZB 3C12A 4DBQA 1Q82R 1NLPC 3URGA 4QW2A 2QI2A 1UTIA 4Z02A 2RNAA 2EGCA 2LNVA 2DRMA 3PTAA 4PJJA 1I1JA 4MZTA 3EFOA 4D8KA 1Y57A 5GAN2 2E5KA 2O31A 1TS9A 2KXDA 1KQSA 1XQHA 4A4EA 5LJ3f 1BI1A 5LJ3d 3HFOA 3SWNB 4NL2A 4RTVA 4F04B 4F7UG 2P0KA 3OBWA 5GAN6 5IN1A 3UT1A 2AHJB 2WSFE 4DBFA 4J9FA 2DL3A 5A0LA 4M7DB 4M7AE 3MP1A 3OYEA 1BCOA 1QMCA 4O5VA 3CCST 3CCSQ 1SSFA 2QQRA 2ED0A 4M78E 3OS1A 2CP5A 2YLCA 4M77E 4PLIA 1D1AA 1UE9A 1K9AA 4J83A 3LW5E 2LP5A 4XU1A 3GIBA 5J3BA 2E4HA 4ZTFA 4R0KA 1M1KC 3VU3C 3CCSA 3JCMc 1G2BA 4M75B 2COWA 1WXUA 5CQXA 3VRYA 1WDXA 2MI6A 1Q7YR 1WYXA 1UGSB 1Q81R 4OMNA 1X01A 1OU8A 5I11A 4E47A 1UECA 2JS0A 4RTWA 1PSFA 4X1VA 2DFUA 2P4RA 1K9MC 1UGQB 4JS4A 2RI3A 3LGLA 3QSUA 4NOYA 3V7SA 4J9GA 4IUPA 4E7JA 1ABQA 2QEXT 4LD6A 1TOVA 2QEXQ 3PMIA 3TCJA 1M1GA 1FMVA 2FO0A 2JW4A 1S72T 1S72Q 5A0GA 4QQGA 1ZSGA 1QP3A 1M5Q1 2NUPB 5LJ3g 1MMNA 2M0OA 3OYLA 2COYA 3M9QA 2KR3A 1M3BA 2EQMA 2QQBA 5FU6C 2X4WA 3HHTB 4HXJA 1K8AR 2CZ7B 2JTEA 2LT4A 4HVUA 3VS5A 2VXFA 4J5YA 1HYOA 4ZN3A 2COZA 5GAMf 1X2KA 3D7SB 5GAMd 1YWOA 3GLXA 1S72A 1UHCA 3WVDB 2HD0A 3I56T 4RCBA 5CIUA 3I56Q 2EPDA 5GANj 2CYZB 4C92C 4M7AA 4PNOA 2OJ2A 1TXQA 4M7AD 1ZQ1A 4HVWA 3EG2A 1VQOT 1Q82C 1YBYA 1VQOQ 3JB9H 1UEBA 3G4ST 4JDSA 1M2OA 4M75E 1A0NB 2GF7A 1KIKA 4M78D 2QQ9A 1VQ6T 1VQ6Q 4ZNXA 3RMQA 5KYWA 3I56A 4M77D 3CCLQ 1M1FA 4AFQC 3JCMQ 1KFZA 2ZPIB 2XK0A 2RPNA 3HTRA 2AK5A 1QVPA 3OY9A 1N8RU 1K9MU 5KYXB 1NE8A 1VQOA 2LX9A 1W70A 2JJ9A 1ZBJA 4C8QF 4QVZA 1VA7A 2CDTA 5GJVB 3FB9A 3DLMA 1VQ6A 3RDVA 2DYIA 1VQNT 2ABLA 3CCLA 1VQNQ 1LOJA 1R77A 2PZ1A 5GAN8 1KD1C 3MEAA 3EGXB 1JB0E 1MMGA 1RUWA 2DBKA 3MJXA 1GFCA 2HSPA 4AFUC 1NYFA 1PSEA 3MPUB 4AFZC 4LDXA 4XU3A 3M53A 2DEQA 3VYHB 4AG1C 4ME7A 3CXCA 2DD4A 3MEWA 2CSIA 3LWIA 5L8RE 2CZ0B 1K0XA 5KE3A 2O9SA 5CKBA 3DB3A 2JT4A 2KGTA 5GAMg 1BIAA 4QT7A 3EGDB 3LX7A 4PFOA 3VS0A 1W2BA 2XHCA 5GMKe 1Q82U 3FJPA 1CSKA 2E70A 1HSQA 2DKGA 3I55T 3QHSA 1BYMA 2B86A 3I55Q 3JB9G 4JRPA 4FL6A 3CPWA 1D3BA 4JJDA 4PLLA 4PFPA 2PUOB 1PC0A 1AZGB 5GMKm 4J9EA 4KULA 2F69A 3OYHA 3R6NA 1QWEA 3EFRA 3JCMe 2RQUA 4KGXB 1YJ9Q 2JM9A 4B9XA 4M7DG 1M8VA 4FW2A 1RLPC 2KMTA 1TSFA 3EG9B 3I55A 5HK0A 2SEMA 4QKUA 2RI5A 3MCAB 2KXCA 2RB6A 3EFSA 3F70A 4XTWA 1XTDA 1FX7A 2I0NA 3NPFA 3GP8A 1WJRA 1K8AC 2M02A 1AWWA 3M54A 1YJ9A 4BD3A 2RHIA 3RR6A 5GMKi 4MDWA 2MYSA 1BIBA 3MP8A 2NWMA 2CZ6B 1JXOA 5LJ5j 3CMAT 3OYKA 2A36A 1M3AA 1U3OA 3FRNA 2OI3A 3GNGA 2DAQA 1U5SA 2KE9A 1WJQA 4L5GA 5GMKl 4X9DA 3ULRB 2EKHA 2DXBA 1VQ9T 1VYVA 2K79A 1Q7YU 2FHDA 4QVDA 5LJ3e 1Q81U 1YCSB 1M30A 4A4GA 1XOVA 2FEIA 2EIFA 1UGRB 5FLXE 2AIRB 1E6HA 4ZGDB 3SD4A 2LMJA 4LUDA 1RAHB 4MMLA 4BUGA 3EFOB 1K73R 3QPHA 5LL6S 1SHGA 2WACA 4DEXA 1MNEA 4PJOE 5FU7B 3G71T 2YXYA 4EMKC 5HCKA 4ATOA 3KBGA 1C1AA 1SKUB 4BY6B 2E12A 2AZVA 1G83A 5GANh 2LJ0A 3VV0A 2K5LA 3VS4A 1ZA2B 2OAUA 4MZMA 3S3MA 4PKCC 2J6FA 4C92F 4XU2A 3LH0A 3E9FA 2A28A 1K8AU 4MMKA 1IO6A 2BIVA 3ASKA 2DTIA 2RH2A 2YSQA 2EGAA 2DIGA 2ESWA 3RKYA 4F7UE 2JVVA 1QVFS 2MIOA 2C06A 2Y90A 4AFSC 3META 2JNGA 3M58A 2ENMA 2FPDA 2QTVA 1F1BB 2DXUA 1IHVA 2D6FA 5M9OA 2HL3A 4KUIA 1HD3A 2FZKB 4OGEA 4CC7A 1U8RA 1NZ9A 2VGMA 4E7LA 1OX8A 2FB7A 1VIEA 3C0CA 1QVGS 1ABOA 2DJQA 1UHFA 1M1KR 1OPKA 4C5IA 3PNWC 3MO8A 1RAFB 2RQVA 4XTZA 4LN2A 2JTMA 4RTTA 1UUEA 3M4YA 1PD1A 4M7AC 1IB8A 2V26A 4LDVA 2DRKA 1ZA1B 1HK9A 3OS0A 4RUGA 2XICA 1WJSA 1WLPB 2PTKA 1EX4A 1H3HA 2LTOA 2HKQB 1QCFA 4KT0E 4M78C 1X2QA 3I35A 4KRTA 1WPYA 4M77C 2KEAA 4FU6A 2KY9A 4C92G 3UATA 2NUTB 1RACB 2K6DA 3CCMQ 2LJ3A 1EIFA 2K57A 3QJYA 3CBPA 4E7KA 3WVEB 3H9NA 1C0MA 3S6WA 4QVCA 2NUZA 2JXBA 1LJOA 2WSCE 3MP6A 1IXDA 2Y4YA 3VKIA 3ZL7C 3JB9J 3PGGA 1OQKA 5D6WA 3QBYA 4ZGEB 4BE0A 4PJOA 4J9IA 4JRIA 4PJOD 1KC8C 5CK9A 1NJIR 5GANd 1T0HA 2ZZDA 2YRDA 2ZPEB 2VB6A 1GFDA 3CCMA 2DVJA 1WHKA 3REBB 4Q5WA 3JCMf 2M9UA 8ATCB 3OYIA 3L2QA 2HBWA 2RHXA 2CP6A 2RJEA 4EPCA 3CPFA 3CCJT 1B7TA 2E5QA 5IHIA 3RIRA 4PJLA 2E64A 2XI9A 3EAEA 1MMDA 2HMAA 3KXTA 2DX1A 1NEBA 5GAOm 3OYMA 2ZPBB 3A1PA 4FYXB 4QQDA 3A5ZB 1SEMA 1WXBA 5KYWB 4XTXA 2MAMA 1KHIA 3CC2T 2HKNA 3OSSC 1QP2A 2EWNA 1TG0A 3E9GA 2FPEA 2M16A 3T9NA 2QQSA 2L3SA 5IT9E 2H3EB 1IHWA 4AMCA 2CP2A 5LJ5h 2KK4A 4N4IA 1FMKA 1I5OB 2ZPFB 2O4XB 3OYFA 4HT8A 3BDLA 1WX6A 3H0IA 4C8QB 3M0RA 4C0FA 2FZGB 3VUZA 3CCUT 1X6BA 5FWBA 3CCUQ 2D8HA 4II1A 2PU9B 1PNJA 5GAOl 1KD1R 4KBMB 5KCOA 5GAOn 5KCHA 2CUDA 2EQJA 4FM4B 3L2VA 5CO7A 3OYGA 2EAYA 1ZUKA 2LCLA 2LC4A 3RKWA 1OZ3A 3GBQA 1AZEA 3CBMA 3INZA 3PFSA 1YCYA 1VYUA 4FYVB 5C0MA 5FROA 2RHUA 4HCBA 5DLQE 1PKTA 1VYTA 3JCMg 1D1BA 2C0IA 5KYUA 1MMAA 2SRCA 2DETA 2VVKA 2EQIA 1M2VA 1VIFA 1M90C 2HEQA 3C94A 3CD6T 3CD6Q 1K73U 2LNHB 1U1SA 4EMKA 3QO3A 5KH6A 2V8KA 3DKMA 1X75C 1YJWT 1YJWQ 4XK8E 3I5RA 5I2MA 2DL7A 5CKDA 3QZ5B 1M3CA 2GGRA 2P84A 1BI0A 1VUBA 2FRWA 1WGSA 1JRIA 1M27C 1B34B 4LDWA 3WXMB 2C0OA 3CD6A 2AKKA 2ZCFB 3FLGA 1IRXA 3IQLA 3OYJA 5GAN4 1QCNA 2LQ8A 1YJWA 2DMOA 2E1HA 4J9CA 4J9HA 3C4SA 1XJWB 4JLGA 3TSWA 3CMET 3O5ZA 1GXIE 1WFWA 1NJIC 4RTZA 2GFAA 4OMMA 3VS2A 4BI3A 1JU5C 5GAOp 1Y0MA 2RHZA 4M7DE 5AYFA 2X4YA 3VJPA 4KH0B 1QVFP 2H3JA 1OX9A 2BZXA 2J06A 2QEXA 3M5AA 4M7AF 2XDBA 2EYYA 2F2XA 2LQKA 4OB0B 3RESA 1SHFA 4JRQA 4M78F 1K76A 4BI8B 3L42A 3QG1A 3G6ET 4M77F 2ZPGB 1UB4A 1UJYA 1M1KU 3MKDA 3E2UA 2CP7A 4OMOA 3S3OA 2RF0A 3ER0A 1Y96A 3X26B 3G4SQ 3CEYA 4OVAA 4M78A 3A8GB 2YUNA 2OAWA 3M0UA 2CREA 2YUQA 4M77A 2QGFB 4HA8A 2K7AA 1VQ4T 4RTXA 2FVUA 1VQ4Q 4Y91A 2HQEA 4IUUA 3A8HB 2LX7A 1Q95G 4A4HA 2HL5C 3LYIA 5IHNA 1TWBA 3A98A 4BE2A 2KRNA 1I4K1 5FU6B 1UJ0A 1D1CA 4GBQA 3G4SA 5DLOA 1ZHIA 4V2SA 2KDSA 1QW1A 2P0QA 3HPWA 3PT9A 2GBQA 1VQ4A 2YHTA 2QASA 3O8VA 2D0NA 1NJIU 5FWCA 2LT1A 3CPWS 4D6WA 4E7SA 4M7AG 4C92B 3VUBA 1Y7XA 2IIMA 1DJ7B 1I07A 3UDCA 2CS7A 3J81E 2DL5A 2O88A 1AT1B 3JB9D 2ECZA 1VQNA 4FT2A 4D8DA 4PJOC 4OB2B 2LRQA 4OGCA 2EYXA 2QG9B 1IREB 2FPFA 1H641 1AEYA 1VQLT 1YI2T 2D9TA 2QXFA 1YI2Q 5DM7R 3NTKA 4LE9A 4Z89A 4HT9A 4M7DD 1WHMA 3OSVA 1IZ6A 3HRSA 2CGHA 3AT1B 1YIJT 1YIJQ 3U23A 5CQYA 2Z0WA 3PIPA 4NL3A 2DK3A 1MV3A 2YDLA 3GOXA 4C8QG 3KFVA 5GANe 1MGQA 2F2VA 3NTHA 1YI2A 1RAEB 1OEBA 1GL5A 2JMAA 4CC3A 1OYXA 5HY6A 1I8FA 1FXXA 5GAOr 3MHXA 3OYNA 1YIJA 3RMSA 1Z9QA 3SEMA 3R6OA 1PWTA 4XAXB 3ZEHA 4M75A 4MDXA 4ORZA 1YJNT 4M75D 1YJNQ 3S3NA 1W4SA 1KSWA 1SRMA 2K9GA 1OZ2A 2RI2A 1KD1U 4ZGJB 2BKDN 4BE1A 1GCQC 2VYTA 1YHQT 1YHQQ 1TUCA 2LVMA 4CC4B 2K5IA 5A2QE 5C6SA 1YN8A 4EMHA 2AKLA 2K3XA 4E7IA 2GFUA 5IXFA 1KC8R 3CMAQ 1YJNA 2EQUA 1YP5A 4JZ4A 1CKBA 2NYSA 4WCIA 1IGUA 2LZ6B 1GBQA 3VYGA 2CH4W 1YHQA 3QKJA 1N27A 1PRLC 1HJDA 2KAFA 1UGPB 5I21A 2PUKB 4X9CA 1JQQA 2EBPA 1PHTA 2YUOA 1VQ9Q 2IPOB 4E6RA 4JPBW 4PK4A 1JJ2S 2I2LA 2O9VA 3CMAA 3EGUA 1ACMB 2XD0A 2MK5A 2RK1A 4A53A 2L5QA 2EKOA 1QKXA 2YWWA 2A7YA 4J6YA 4GLMA 4PJNA 2J6KA 2K2MA 3UF4A 4R55A 2B8AA 4P5NA 2KYMA 2R5AA 1QWFA 2M1HA 1T3LA 2DTHA 1NPPA 4GY5A 1VQ9A 3CBOA 1AWJA 4GLKA 2L3RA 4DEYA 5GAMj 3OYDA 4K11A 3G71Q 3MEVA 3AHUA 1PCXA 5KYYA 4RKUE 4N4HA 5CKHA 1LPLA 3M0PA 2JMCA 1PRMC 3TQ7P 3OW2S 2ATCB 4MZPA 2LCSA 4AG2C 4LNPA 4C0ZA 2PVDB 4J7FA 4UC4A 1B3QA 3L2RA 2CT4A 2O01E 4OP0A 2D8JA 3G71A 2DLPA 1HXDA 1ZUUA 1ZSZC 3GPLA 1MHNA 3V8KA 2BE7D 3A8LB 4C5HA 2PQWA 1KK7A 2EQKA 2XU8A 2DXTA 1N5ZA 3SFMA 2EW3A 2MF2A 4JUVA 3X28B 5IH2A 2LQNA 1W1FA 3FJ5A 1ZUYA 5I2SA 5LJ5e 4BACA 2XG8D 4IUQA 3OYAA 5IXBA 2ED1A 1M4ZA 3CC4T 3CC4Q 4L6V5 1M90R 1VQMT 2ROLA 1VQMQ 2QAZA 2DJZA 2RD1A 2L3QA 3M56A 3EG1A 4LDYA 5I22A 1OPLA 2BZ8A 2VASA 4IUVA 3UA6A 3P8HA 1LCKA 2VV5A 2F1LA 2E65A 2QA4T 4PL6A 4C0DC 3EGDA 3CC4A 1GCPA 1RI9A 4PJOF 2HNIA 1VQMA 4B9WA 4ESRA 4HCCA 1AOJA 1QKWA 1SSHA 2LDMA 3CPWP 5D7UA 1UFFA 3JCMX 4FIBA 2QGGA 3TSZA 1BB9A 2MPXC 1YNZA 4X34A 1QVFA 5GANf 1N9RA 1RAIB 5FRMA 3J80E 4HCZA 2R58A 4WF2A 3OS2A 3DLLA 1KQSS 4BB7A 3EG9A 1YWPA 4M7AB 1ARKA 4XU0A 3CCJQ 1T3SA 4LUEA 2V8JA 2DZ9A 2WSEE 1FYNA 1R0BG 4F7UF 4JS5A 1VQPT 3GNFB 4ZN1A 4M78B 4M4ZA 3PVQA 1I81A 4M77B 2RN8A 3CQTA 3NFCA 3LH5A 1WHHA 3SWNC 4OB3B 3CC2Q 4J7IA 4F7UA 3QDFA 2KT1A 1ZX6A 3CCJA 1W6XA 2KT8A 2F5TX 5HKCA 2X4JA 3QYGB 1SPKA 1QQJA 1O75A 3BFMA 4M7DC 1G3TA 1NBEB 2AZSA 2L89A 2ROTA 2RQWA 1RADB 2FZCB 1NLOC 1X27A 3H6ZA 5FW9A 1G8XA 3OYCA 1GCQA 3CC2A 2A3LA 2HBPA 2DIQA 3ZFJA 2DERA 1T0JA 2LJ1A 2QDLA 2X9HA 5GAN3 3L1AA 1WQWA 1MV0B 4R56A 2PVOB 1M8MA 5D6XA 4CRIA 3J7AF 1BK2A 2DXCA 1OV3A 1JO8A 3Q1JA 3QDRB 4BI4A 5D6YA 3QWYA 1KC8U 4M75C 3BW1A 1NEGA 3SB2A 3JCMb 2QK0A 2CUBA 4N0AC 1R8OB 1SRLA 2E6ZA 3CCET 5GANg 3HKSA 4IUTA 3HRUA 3CCEQ 2ZGWA 3EH2A 3TVTA 2EJGA 2RK2A 1LNXA 3L2ZA 5GAMh 4XQ3A 3CCUA 3OB9A 2EGEA 2G3RA 3V7RA 1S1NA 1U06A 1JJ2P 3V8LA 1KG1A 4J8OA 3H8ZA 4J9DA 1D3BB 2EJFA 1TU0B 4BDZA 2NLUA 2E41A 2HQXA 4JJNK 1AWOA 3CCEA 2RQTA 5EG2A 1BBZA 4JZ3A 4F14A 2Y4XA 4E2FB 2CP0A 3X24B 4J9BA 2DE0X 4F16A 4KH1B 1E6GA 4C0GA 2V1QA 2W10A 4IIMA 2L2PA 3HSBA 2BUDA 3HL8A 2JUFA 2DA9A 4XTYA 2RJCA 5CVIA 1WHGA 1G3YA 4EIKA 1PKSA 4RG8A 1KJWA 4A63B 2YRVA 1O9SA 3OW2P 2OX7A 5LJ5f 4C8QE 5LJ5d 4OMQA 1ZSZA 4JLIA 1N8RC 1VQKT 2DPPB 1VQKQ 4F17A 2RA2A 3CMEQ 1YITT 2KBTA 2YRCA 2QDYB 1YITQ 1SG5A 4OMPA 2K3YA 2D1XA 2FYKA 3HP9A 5AT1B 3NGPA 2DYBA 2W0ZA 3OMCA 3QIIA 1N6AA 2J7IA 3H0FA 4KGVB 3M0TA 3CCVT 2NUTA 3CCVQ 4DBRA 1VQKA 3ME9A 3V8JA 3VS6A 3CMEA 4PJMA 1B07A 4OMLA 2DD5A 2FRYA 1YITA 2HQHA 3OMGA 4RTYA 2XDDA 2EVRA 2JS2A 3X25B 4Z88A 1SF9A 2GNCA 3G6EQ 5GMKj 1QVGP 5CAIA 2C0TA 1M90U 1BI3A 4J6WA 2HCKA 1E7OA 1VQ7T 4ZTJA 2JOYA 1VQ7Q 2P0PA 4ELZC 3EH1A 3CCVA 2FL7A 2VUBA 2DL8A 2IG0A 2M51A 2VC8A 4Y28E 3CXCS 4FYYB 4LDUA 3RERA 4A4FA 2YUPA 2KROA 2VGNA 1Y71A 8AT1B 1X69A 3EHQA 5KYYB 1WIEA 3THKA 2EYWA 3G6EA 2L0AA 4Y92A 2D0QB 2M0YA 1TTHB 3VRZA 2K5FA 2LQWA 3QYHB 1VQ7A 3UWNA 2KYBA 3G7ZA 3CCLT 1W2BS 3QUIA 3RKXA 2LCCA 3QWXX 3C95A 3LGFA 3OA6A 1BU1A 1C6VX 1RAAB 3RNJA 5IAYA 2AT1B 5CR2A 3M55A 3FDRA 2IVWA 3JB9F 1MUZA 4J6XA 2F5KA 3JCMV 2KRSA 5LJ5g 3BY7A 4FSXA 2RJFA 1Q86R 3EHRA 1MNDA 2O4XA 1QCOA 2JM8A 1KQSP 3CC7T 3JRZA 3NHNA 3CC7Q 2KQWA 4M78G 2A0FB 4WTOB 2RO0A 4M77G 3V7CA 4FYWB 3CCQT 2CP3A 4JJBA 3CCQQ 2KSSA 4Z8AA 4M7DF 4C8QA 1FWZA 3SWNA 4C8QD 4EMGA 2CH4A 4ANJA 2A08A 1G3SA 3P8BB 1VQLQ 4JJCA 2E6NA 2J6OA 5LJ3j 2JN0A 1AWXA 4O6JA 4M7DA 1ZLMA 1CKAA 3CC7A 3E19A 5CKFA 3A8MB 4FSSA 1AVZC 3LLRA 3P8DA 4HKEA 1TUDA 3CCQA 1VOMA 1KHCA 1YFNA 1VQ8T 1VQ8Q 1PM3A 2BZYA 4FW1A 1EFNA 1G5VA 1VQLA 2ZPHB 1Q7YC 4M75F 5GJWB 1Q81C 4DA4A 5FRNA 3NMZC 2YLBA 4A54A 5HK3A 4JRKA 1NG2A 1BKBA 1WHJA 2DNUA 2HZYA 4E7ZA 2DILA 2K2VA
chains in the Genus database with same CATH topology
2ZPFB 2VXFA 2O4XB 4J5YA 2MF2A 1VQ8A 4JUVA 3X28B 3OYFA 4PJOB 4ZN3A 2KVQG 4HT8A 5GAMf 4N0AA 5GAMd 3BDLA 3TU4K 3GLXA 4E7HA 1S72A 5GAN7 3WVDB 2HD0A 3I56T 3ZBDA 4RCBA 4C8QB 5CIUA 1KQ2A 2X35A 1YJ9T 4C0FA 5I2SA 5LJ5e 4BACA 5GANj 2XG8D 4L59A 4IUQA 4OB1B 3OYAA 2CYZB 4RMOA 1M4ZA 3VUZA 4C92C 4C92E 4PNOA 3CC4T 3CCUT 4M7AA 4L6V5 4M7AD 1VQMT 1ZQ1A 4FT4A 1VQOT 1Q82C 1YBYA 4II1A 3GF5A 2DJZA 2PU9B 2RD1A 1UEBA 3G4ST 4JDSA 3JB9H 1B34A 5GAOl 2OTLT 3OQ5A 3M56A 3JCMW 4M75E 3PIOA 4KBMB 4LDYA 1KQ1A 5KCOA 5GAOn 2GF7A 5KCHA 4M78D 2QQ9A 2DVEA 2EQJA 4FM4B 1VQ6T 3L2VA 5CO7A 1ZBXA 3RMQA 3M4GA 4IUVA 3OYGA 4M77D 2EAYA 1WQ7A 3I56A 3M59A 1M1FA 3P8HA 2LCLA 3L2WA 3JCMQ 2LC4A 3RKWA 2VV5A 2ZPIB 2XK0A 5FU7C 1OZ3A 1U1TA 2E65A 2QA4T 1QVPA 4PL6A 3X20B 4C0DC 4F7UB 3OY9A 3FC3A 1N8RU 3CBMA 3INZA 3CC4A 2JZ2A 3PFSA 1YCYA 4ELYC 1K9MU 1NE8A 5C0MA 5FROA 4PJOF 2HNIA 2RHUA 1VQMA 4B9WA 4HCBA 5DLQE 1VQOA 2LX9A 4BY6C 4HCCA 4OF1A 3JCMg 4OMFB 2LDMA 2OTLA 4M75G 4C8QF 4QVZA 3PMTA 3FB9A 3JCMX 2EYQA 4FIBA 4BDYA 1VIFA 3DLMA 1M90C 1VQ6A 1VQNT 3JAME 3CCLA 4RG2A 3C94A 3CD6T 4X34A 1LOJA 4XTVA 5GANf 5GAN8 1QVFA 1K73U 1G3WA 5CCAA 1N9RA 1U1SA 1KD1C 5FRMA 4EMKA 3MEAA 3J80E 3QO3A 3HRTA 5KH6A 2QQAA 2V8KA 3DKMA 4HCZA 1JB0E 4YTLA 1X75C 1YJWT 4N4GA 4XK8E 2R58A 1OI1A 4WF2A 3OBYA 2DZCA 2MWPA 4XTUA 4TVRA 5I2MA 4BB7A 3OS2A 3DLLA 1KQSS 1I5LA 3BDUA 1RI0A 1PSEA 2X4XA 4M7AB 5CKDA 3QZ5B 4LDXA 3DB4A 4XU0A 4XU3A 5GAN5 3M53A 3QXEB 2DEQA 3VYHB 1BI0A 1VUBA 2CKKA 1WGSA 2V8JA 2DZ9A 4ME7A 3CXCA 2PVGB 1JRIA 2WSEE 1B34B 4LDWA 4F7UF 4JS5A 3TEEA 3GNFB 3WXMB 1VQPT 2DD4A 4ZN1A 3MEWA 5GMKh 3CD6A 3LWIA 2ZCFB 3FLGA 2GCXA 5L8RE 4M78B 4LD9K 2CZ0B 3QZ9B 1I81A 4M77B 1Q86C 4KUDK 2V8IA 3NFCA 3OYJA 5KE3A 5GAN4 5CKBA 3DB3A 2LQ8A 1YJWA 2E1HA 4OB3B 3SWNC 3GIBA 3C4SA 5GAMg 1BIAA 2OTJT 4JLGA 4J7IA 4F7UA 3CMET 1GXIE 1NJIC 3LX7A 2GFAA 2VXEA 4DOWA 3CCJA 1W2BA 5A0DA 2F5TX 2XHCA 5HKCA 1P92A 3QJ6A 1V29B 3FJPA 4BI3A 1N9SA 2X4JA 3QYGB 1XNIA 5GAOp 1O75A 3BFMA 2E70A 2RHZA 1G3TA 4M7DC 4M7DE 2MWOA 2L89A 3JCMh 5AYFA 2DKGA 2X4YA 3QHSA 3VJPA 2QTXA 3I55T 1BYMA 3JB9G 3A8OB 3OS5A 3RUXA 3JCMP 4JRPA 4FL6A 3CPWA 2H3JA 1D3BA 5CKEA 4PLLA 1JJ2A 2PUOB 3H6ZA 2QEXA 3M5AA 5GMKm 2RJDA 3OYCA 4M7AF 2XDBA 4KULA 3CC2A 2F69A 1JBMA 2A3LA 2HBPA 2OTJA 4DQ2A 3OYHA 1X6OA 2DIQA 2LQKA 4IURA 3ZFJA 4EMKB 4OB0B 3EFRA 4C92A 3JCMe 3RESA 5GAN3 2MMPA 4C92D 3L1AA 1WQWA 4JRQA 4M78F 4BI8B 2CZ1B 4R56A 3L42A 4M7DG 2PVOB 3QG1A 4B9XA 1M8VA 5D6XA 4CRIA 3G6ET 3J7AF 2KMTA 4M77F 2DXCA 1UB4A 2ZPGB 1M1KU 3I55A 3JB9I 3Q1JA 5HK0A 3QDRB 4QQ6A 2RI5A 3MCAB 3CCRT 3S3OA 2HAXA 2RB6A 3ER0A 1Y96A 5D6YA 3X26B 3EFSA 4BI4A 3CEYA 3F70A 1KC8U 4M75C 4XTWA 4OVAA 3BW1A 4M78A 3A8GB 3SB2A 3JCMb 1XTDA 1FX7A 3GP8A 4N0AC 1R8OB 1WJRA 4M77A 1K8AC 4HA8A 1VQ4T 2FVUA 2E6ZA 3M54A 4Y91A 1YJ9A 2HQEA 3CCET 4IUUA 3A8HB 2RHIA 4BD3A 2EJ9A 3HKSA 4IUTA 3HRUA 5GMKi 5GANg 4MDWA 4A4HA 3OW2A 2ZGWA 1BIBA 2R5MA 2DO3A 5GAOq 3LYIA 3MP8A 2EJGA 2RK2A 1LNXA 3KUFA 3L2ZA 4XQ3A 4C5GA 5GAMh 3CCUA 2CZ6B 4BE2A 5LJ5j 3CMAT 3OB9A 3OYKA 1I4K1 3LWHA 5FU6B 2P4TA 2G3RA 3V7RA 3CCRA 5KE2A 2DTOA 5LJ3h 3L2UA 3JSCA 2XIDA 2EFIA 3G4SA 3FRNA 3GNGA 5DLOA 3V8LA 1KG1A 2DAQA 1ZHIA 4V2SA 4J8OA 2KDSA 1QW1A 2P0QA 4DOVA 3JCMJ 1WJQA 3H8ZA 1Q86U 4L5GA 1M9SA 5GMKl 3HPWA 3M57A 3PT9A 4X9DA 1D3BB 2EJFA 4NS5A 4BDZA 2RM4A 1VQ4A 2NLUA 2YHTA 1NPRA 2E41A 1Y07A 2HQXA 3FIFA 5GAMe 4JJNK 2DXBA 3O8VA 4IKFA 3CCEA 3CCMT 5EG2A 1VQ9T 4RCCA 2K4YA 1NJIU 5DY9A 2LT1A 3CPWS 1Q7YU 2FHDA 4QVDA 2Y4XA 4D6WA 5LJ3e 2QA4A 1AHJB 4A4KA 1Q81U 4M7AG 3X24B 4A4GA 1XOVA 4C92B 3TREA 3MEUA 2EIFA 3OYYA 3VUBA 1Y7XA 1UGRB 5FLXE 1TH7A 3N5BB 1H3ZA 4C0GA 4ZGDB 2GQVA 3SD4A 2RHYA 1DJ7B 3UDCA 2XDPA 3HSBA 2CS7A 4MMLA 3J81E 4BUGA 3QPHA 5LL6S 2BUDA 3HL8A 2WACA 1BI2A 3JB9D 1WNLA 4EDUA 2JUFA 1VQNA 1QVGA 1Y96B 4FT2A 3HFNA 4XTYA 2E10A 4C5EA 2RJCA 4OB2B 5CVIA 2LRQA 3SDZA 4OGCA 2JTFA 1G3YA 1VQ5T 4PJOC 4PJOE 1IREB 4RG8A 2L8DA 3UPUA 2YRVA 5FU7B 1O9SA 1H641 3JCMd 4EMKC 3G71T 4C0DB 5LJ5f 3OYBA 4C8QC 4C8QE 1VQLT 4ATOA 5LJ5d 3KBGA 1YI2T 2D9TA 2QXFA 4JLIA 3NTIA 5DM7R 1N8RC 1VQKT 5GMKe 2DPPB 3NTKA 4BY6B 2E12A 2RA2A 4VUBA 4CI0C 5GANh 3VV0A 4HT9A 1RL2A 4M7DD 2K5LA 3OSVA 1YITT 1IZ6A 3HRSA 2CGHA 2QDYB 1YIJT 2OAUA 2K3YA 5J26A 5CQYA 3PIPA 3FEOA 4MZMA 4NL3A 1VQPA 2DK3A 4PJOG 3S3MA 2FYKA 4PKCC 1VQ5A 3HP9A 4C92F 4XU2A 2R57A 3LH0A 3E9FA 1K8AU 5J39A 3GOXA 3OMCA 3QIIA 1N6AA 4MMKA 3E1SA 2XKOC 4C8QG 5GANe 1K73C 1MGQA 3NTHA 3C12A 3CCVT 1YI2A 2BIVA 1VQKA 3ASKA 3ME9A 3V8JA 2DTIA 1OYXA 2RH2A 5HY6A 3CMEA 1I8FA 2DIGA 1FXXA 3RKYA 3URGA 4F7UE 4QW2A 5GAOr 2JVVA 2QI2A 3MHXA 2DD5A 1YITA 4Z02A 1QVFS 3OYNA 3OMGA 1YIJA 3RMSA 2XDDA 2C06A 2LNVA 2Y90A 3X25B 3R6OA 3META 3PTAA 5GMKj 4XAXB 3ZEHA 2JNGA 4M75A 4MZTA 4MDXA 5CAIA 3M58A 1YJNT 1M90U 1BI3A 4M75D 5GAN2 3S3NA 4J6WA 1W4SA 2DXUA 1VQ7T 4ZTJA 2D6FA 5M9OA 1KQSA 2JOYA 1OZ2A 1XQHA 2P0PA 2RI2A 4KUIA 4A4EA 4ELZC 2FL7A 2VUBA 3CCVA 1KD1U 4OGEA 2IG0A 5LJ3f 1BI1A 4ZGJB 5LJ3d 2BKDN 3HFOA 3SWNB 4BE1A 2VYTA 4NL2A 2VC8A 1NZ9A 4Y28E 2VGMA 1YHQT 1U8RA 4F7UG 4E7LA 2LVMA 3CXCS 2FB7A 2P0KA 1VIEA 3OBWA 5IN1A 5GAN6 2K5IA 1QVGS 4LDUA 3RERA 3UT1A 4A4FA 2AHJB 5C6SA 5A2QE 2WSFE 2VGNA 4C5IA 1Y71A 4EMHA 3PNWC 3MO8A 5A0LA 3G6EA 4E7IA 2K3XA 4XTZA 2JTMA 2GFUA 4M7DB 3M4YA 4M7AC 4M7AE 4LDVA 3MP1A 2D0QB 1YJNA 3OYEA 2EQUA 1HK9A 2K5FA 3QYHB 3OS0A 2XICA 4O5VA 1WJSA 3UWNA 1VQ7A 3CCST 3G7ZA 2LTOA 3CCLT 1W2BS 1SSFA 3QUIA 4KT0E 3RKXA 2QQRA 4M78C 2LCCA 4M78E 3VYGA 3OA6A 3C95A 3LGFA 3OS1A 1YHQA 3QKJA 2YLCA 1N27A 1WPYA 5IAYA 2KAFA 4M77C 4FU6A 2KY9A 4M77E 4PLIA 4C92G 1UGPB 5I21A 2PUKB 3M55A 3FDRA 4X9CA 5CR2A 4J83A 2IVWA 1EIFA 2K57A 3JB9F 3LW5E 4J6XA 3QJYA 1JJ2S 2I2LA 3CBPA 4E7KA 4XU1A 2F5KA 3JCMV 3WVEB 5J3BA 5LJ5g 3CMAA 3S6WA 4QVCA 2XD0A 2RK1A 3BY7A 4FSXA 1LJOA 2WSCE 3MP6A 4A53A 2RJFA 4ZTFA 2L5QA 2EKOA 2Y4YA 3VKIA 3JB9J 1M1KC 3PGGA 2A7YA 3VU3C 5D6WA 3CCSA 3QBYA 4J6YA 3JCMc 2O4XA 4ZGEB 3CC7T 3JRZA 4BE0A 2KQWA 4PJOA 4M75B 4M78G 4JRIA 4PJOD 5CQXA 4R55A 2RO0A 2B8AA 4P5NA 5CK9A 5GANd 1KC8C 2R5AA 2MI6A 4M77G 3V7CA 3CCQT 2ZZDA 2KSSA 1UGSB 2M1HA 2ZPEB 4M7DF 2DTHA 4C8QA 1X01A 1NPPA 1FWZA 4GY5A 3CCMA 3CBOA 3SWNA 4C8QD 4E47A 1VQ9A 4GLKA 4Q5WA 3JCMf 4EMGA 2L3RA 2M9UA 5GAMj 3OYDA 3OYIA 1G3SA 1PSFA 3P8BB 3L2QA 2RHXA 2RJEA 3MEVA 2E6NA 4EPCA 3AHUA 3CPFA 3CCJT 5LJ3j 2JN0A 2E5QA 3RIRA 1K9MC 4RKUE 1UGQB 4O6JA 4N4HA 5CKHA 2E64A 4JS4A 2XI9A 4M7DA 3EAEA 3KXTA 3CC7A 3E19A 5CKFA 3A8MB 2RI3A 3LGLA 3QSUA 3LLRA 3P8DA 4NOYA 3V7SA 3OW2S 5GAOm 4HKEA 4IUPA 3OYMA 3CCQA 4E7JA 2ZPBB 4MZPA 4QQDA 3A5ZB 1KHCA 4C0ZA 2QEXT 2PVDB 4LD6A 4J7FA 4UC4A 1VQ8T 4XTXA 2MAMA 3L2RA 3PMIA 1KHIA 3CC2T 2O01E 3TCJA 1M1GA 4OP0A 1G5VA 3G71A 1Q82U 3OSSC 1S72T 1VQLA 1QP2A 2ZPHB 2EWNA 5A0GA 1HXDA 1Q7YC 4QQGA 1QP3A 4M75F 3GPLA 1M5Q1 3E9GA 5LJ3g 1MHNA 1Q81C 3V8KA 4DA4A 2M16A 2M0OA 3A8LB 3OYLA 3T9NA 2QQSA 3M9QA 4C5HA 2PQWA 5FRNA 2EQMA 2YLBA 4A54A 5HK3A 5IT9E 2EQKA 4JRKA 2XU8A 1BKBA 2DXTA 2QQBA 2X4WA 3HHTB 5FU6C 5LJ5h 2CZ7B 2LT4A 3SFMA 2K2VA 2KK4A 4N4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I81 A;  4M77 B;  4M7D B;  2VXF A;  4J5Y A;  4M7A G;  4M7A C;  4M7A E;  4C92 B;  4JUV A;  5GAN 4;  4PJO B;  2E1H A;  3SWN C;  4HT8 A;  5GAM f;  1HK9 A;  4N0A A;  1TH7 A;  5GAM g;  5GAM d;  1BIA A;  4F7U A;  5GAN 7;  4RCB A;  4C8Q B;  3HSB A;  2VXE A;  3QUI A;  1KQ2 A;  4MML A;  3RKX A;  5GMK e;  4M78 C;  4M78 E;  3FJP A;  1N9S A;  5LJ5 e;  5GAO p;  5GAN j;  3BFM A;  2YLC A;  1WPY A;  3JB9 D;  1WNL A;  4M7D C;  4M77 C;  4M77 E;  4M7D E;  1Y96 B;  4XTY A;  3HFN A;  3JCM h;  2E10 A;  4X9C A;  4PNO A;  4C92 C;  2DKG A;  4C92 G;  3QHS A;  4C92 E;  2QTX A;  4M7A A;  4PJO C;  3JB9 G;  3RUX A;  4M7A D;  3JCM P;  2K57 A;  3JB9 F;  1D3B A;  4PJO E;  4J6X A;  2DJZ A;  2I2L A;  1H64 1;  2RD1 A;  4EMK C;  3JCM d;  3JB9 H;  1B34 A;  5GAO l;  5LJ5 f;  4C8Q C;  4XU1 A;  3JCM V;  4C8Q E;  5LJ5 g;  5LJ5 d;  3JCM W;  5GMK m;  3GIB A;  4M75 E;  4QVC A;  4JLI A;  4M7A F;  3BY7 A;  1LJO A;  1KQ1 A;  4A53 A;  1JBM A;  5GAO n;  4M78 D;  3JB9 J;  2DVE A;  4DQ2 A;  2RA2 A;  3PGG A;  3VU3 C;  5GAN h;  4EMK B;  5I21 A;  4J6Y A;  3JCM c;  4HT9 A;  3EFR A;  3M4G A;  4M7D D;  4M77 D;  2EAY A;  1WQ7 A;  4C92 A;  3JCM e;  4M75 B;  4M78 G;  3RES A;  5GAN 3;  4PJO A;  4C92 D;  2CGH A;  4JRI A;  3L1A A;  1WQW A;  3JCM Q;  3RKW A;  4PJO D;  4M78 F;  5GAN d;  4M7D G;  1U1T A;  2E65 A;  4M77 G;  3V7C A;  1M8V A;  4NL3 A;  4F7U B;  4M7D F;  4M77 F;  2DTH A;  4PJO G;  4C8Q A;  3INZ A;  1X01 A;  2FYK A;  1YCY A;  4C92 F;  4XU2 A;  3SWN A;  4C8Q D;  4PJO F;  2HNI A;  3JB9 I;  3JCM f;  4EMG A;  4MMK A;  3JCM g;  5GAM j;  2RB6 A;  1Y96 A;  4C8Q G;  3EFS A;  5GAN e;  1MGQ A;  4M75 G;  4M75 C;  4XTW A;  3AHU A;  4C8Q F;  3BW1 A;  4M78 A;  3SB2 A;  3JCM b;  5LJ3 j;  2JN0 A;  3V8J A;  3FB9 A;  3RIR A;  2DTI A;  4N0A C;  3JCM X;  4M7D A;  4M77 A;  2E64 A;  1I8F A;  3RKY A;  4F7U E;  5GAO r;  4HA8 A;  4Y91 A;  3QSU A;  1LOJ A;  4XTV A;  5GAN f;  4NOY A;  3V7S A;  5GAN 8;  2EJ9 A;  5GAN g;  5GMK i;  5GAO m;  1N9R A;  1U1S A;  2ZGW A;  1BIB A;  2Y90 A;  5GAO q;  4EMK A;  2EJG A;  3QO3 A;  1LNX A;  3L2Z A;  5GAM h;  4XQ3 A;  5GMK j;  4M75 A;  5LJ5 j;  5CAI A;  4XTX A;  1I4K 1;  4M75 D;  3V7R A;  5GAN 2;  4WF2 A;  4J6W A;  2DXU A;  2DTO A;  4OP0 A;  2DZC A;  4XTU A;  5LJ3 h;  1I5L A;  3BDU A;  2EWN A;  3V8L A;  1HXD A;  4M7A B;  4V2S A;  4M75 F;  5LJ3 f;  1M5Q 1;  4XU0 A;  5LJ3 g;  3JCM J;  4XU3 A;  5LJ3 d;  3HFO A;  3SWN B;  3V8K A;  5GAN 5;  4NL2 A;  2VC8 A;  5GMK l;  2DEQ A;  4X9D A;  4F7U G;  1D3B B;  2EJF A;  2DZ9 A;  2FB7 A;  5GAN 6;  1JRI A;  2RM4 A;  1B34 B;  2YHT A;  2E41 A;  4F7U F;  2YLB A;  3FIF A;  4A54 A;  5GAM e;  3RER A;  4JRK A;  5GMK h;  2DXT A;  4EMH A;  4M78 B;  5LJ5 h;  4RCC A;  5DY9 A;  5LJ3 e;  4QVD A;  4XTZ A; 
#chains in the Genus database with same CATH topology
 1NM7 A;  1I0C A;  1VQ8 A;  2BE9 B;  6AT1 B;  4PJO B;  2KVQ G;  4N0A A;  3TU4 K;  4E7H A;  1OU9 A;  5GAN 7;  3ZBD A;  3I9Q A;  1KQ2 A;  2FG0 A;  2X35 A;  1YJ9 T;  2MOX A;  2HSE B;  4L59 A;  4OB1 B;  4B6M A;  4RMO A;  3G1J A;  2VKN A;  3UA7 A;  1WA7 A;  2X51 A;  4C92 E;  2O2O A;  2ZAE A;  4FT4 A;  1H8K A;  1JEG A;  3GF5 A;  1B34 A;  2OTL T;  3OQ5 A;  3JCM W;  2OTL Q;  3PIO A;  1KQ1 A;  2GQI A;  4AT1 B;  2DVE A;  1R0C B;  2X3X D;  1ZBX A;  1GBR A;  3M4G A;  1WQ7 A;  3M59 A;  2DL4 A;  3L2W A;  1QLY A;  5FU7 C;  1U1T A;  1V76 A;  2GTJ A;  1NYG A;  3X20 B;  4F7U B;  2J05 A;  3FC3 A;  1K0S A;  2JZ2 A;  2NUP A;  4ELY C;  4BY6 C;  1PG5 B;  4OF1 A;  2DEU A;  1EZZ B;  2QYZ A;  1Z9Z A;  4OMF B;  2OTL A;  4M75 G;  3PVL A;  4HCK A;  3M0S A;  3PMT A;  5EC7 A;  2EYQ A;  4BDY A;  3JAM E;  4RG2 A;  4XTV A;  1G3W A;  2G6F X;  2HDA A;  5CCA A;  1WZO A;  2PNI A;  1UGV A;  3HRT A;  2QQA A;  1OOT A;  4YTL A;  3REA B;  4N4G A;  1WXT A;  1OI1 A;  2CSQ A;  1LVK A;  3OBY A;  2DZC A;  1UG1 A;  2MWP A;  4TVR A;  4XTU A;  4DBH A;  1D09 B;  2A37 A;  1I5L A;  3BDU A;  4CC2 A;  1RI0 A;  3JV3 A;  2X4X A;  2DM1 A;  3DB4 A;  5GAN 5;  3QXE B;  1WHL A;  1RAB B;  2CKK A;  2PVG B;  1PD0 A;  3TEE A;  1BCM A;  5GMK h;  3PE0 A;  2GCX A;  4LD9 K;  4FCY A;  3QZ9 B;  5ECA A;  4KUD K;  1Q86 C;  2H8H A;  2V8I A;  9ATC B;  1JXM A;  2OTJ T;  2OTJ Q;  2XMF A;  5KYX A;  4DOW A;  2VXE A;  5A0D A;  1P92 A;  3QJ6 A;  1V29 B;  1N9S A;  1XNI A;  1D0Y A;  2MWO A;  2KRM A;  3JCM h;  1WI7 A;  5KYU B;  1IGQ A;  2QTX A;  3A8O B;  3OS5 A;  3RUX A;  3JCM P;  5CKE A;  1M2V B;  2EYZ A;  1JJ2 A;  1V1C A;  2MCN A;  2RJD A;  2L3P A;  1JBM A;  4IIO A;  2OTJ A;  4DQ2 A;  1X6O A;  4IUR A;  4EMK B;  3EGX A;  4C92 A;  1FMW A;  2MMP A;  4C92 D;  3RBB B;  2CZ1 B;  1TUG B;  1OUL A;  3CXC P;  3JB9 I;  4QQ6 A;  3CCR T;  4LXC A;  3CCR Q;  3VS3 A;  2HAX A;  3EG3 A;  2X3W D;  2YT6 A;  1AD5 A;  2F2W A;  1D0X A;  2V1R A;  1UDL A;  1ZSZ B;  2EJ9 A;  1W2B P;  3OW2 A;  2CT3 A;  1GRI A;  2R5M A;  2DO3 A;  5GAO q;  4C5G A;  3KUF A;  2QA4 Q;  2BTT A;  3M0Q A;  3LWH A;  1K1Z A;  2K3B A;  2P4T A;  3CCR A;  2E3I A;  5KE2 A;  2DTO A;  5LJ3 h;  3L2U A;  3JSC A;  2DF6 A;  2XID A;  2EFI A;  4HVV A;  4DOV A;  3JCM J;  1Q86 U;  1M9S A;  3M57 A;  5L23 A;  4NS5 A;  2RMO A;  1N8R R;  2RM4 A;  5GAM e;  1NPR A;  1Y07 A;  3FIF A;  2KI7 A;  2VWF A;  1K9M R;  3I5S A;  4IKF A;  3CCM T;  4RCC A;  2K4Y A;  4RTU A;  5DY9 A;  2QA4 A;  1AHJ B;  4A4K A;  1J3T A;  3SHW A;  2E3H A;  3TRE A;  3MEU A;  3OYY A;  1TH7 A;  3EG0 A;  3N5B B;  3BE3 A;  1H3Z A;  2GQV A;  2KNB B;  2RHY A;  2XDP A;  3VS1 A;  1BI2 A;  1WNL A;  4EDU A;  1QVG A;  1Y96 B;  3HFN A;  4C5E A;  2E10 A;  1VQP Q;  1VQ5 T;  1RLQ C;  3SDZ A;  1RAG B;  2JTF A;  1VQ5 Q;  3VS7 A;  1X43 A;  2L8D A;  3UPU A;  3JCM d;  2GTO A;  4C0D B;  3OYB A;  4C8Q C;  1H92 A;  1X6G A;  3H41 A;  1K4U S;  3NTI A;  2DBM A;  3H0H A;  4VUB A;  4CI0 C;  7AT1 B;  1RL2 A;  5KYN A;  5J26 A;  1D0Z A;  3FEO A;  1VQP A;  5IHK A;  4PJO G;  1VQ5 A;  2R57 A;  2RQR A;  5J39 A;  4PFZ A;  3E1S A;  2XKO C;  1K73 C;  4KGZ B;  3C12 A;  4DBQ A;  1Q82 R;  1NLP C;  3URG A;  4QW2 A;  2QI2 A;  1UTI A;  4Z02 A;  2RNA A;  2EGC A;  2LNV A;  2DRM A;  3PTA A;  4PJJ A;  1I1J A;  4MZT A;  3EFO A;  4D8K A;  1Y57 A;  5GAN 2;  2E5K A;  2O31 A;  1TS9 A;  2KXD A;  1KQS A;  1XQH A;  4A4E A;  5LJ3 f;  1BI1 A;  5LJ3 d;  3HFO A;  3SWN B;  4NL2 A;  4RTV A;  4F04 B;  4F7U G;  2P0K A;  3OBW A;  5GAN 6;  5IN1 A;  3UT1 A;  2AHJ B;  2WSF E;  4DBF A;  4J9F A;  2DL3 A;  5A0L A;  4M7D B;  4M7A E;  3MP1 A;  3OYE A;  1BCO A;  1QMC A;  4O5V A;  3CCS T;  3CCS Q;  1SSF A;  2QQR A;  2ED0 A;  4M78 E;  3OS1 A;  2CP5 A;  2YLC A;  4M77 E;  4PLI A;  1D1A A;  1UE9 A;  1K9A A;  4J83 A;  3LW5 E;  2LP5 A;  4XU1 A;  3GIB A;  5J3B A;  2E4H A;  4ZTF A;  4R0K A;  1M1K C;  3VU3 C;  3CCS A;  3JCM c;  1G2B A;  4M75 B;  2COW A;  1WXU A;  5CQX A;  3VRY A;  1WDX A;  2MI6 A;  1Q7Y R;  1WYX A;  1UGS B;  1Q81 R;  4OMN A;  1X01 A;  1OU8 A;  5I11 A;  4E47 A;  1UEC A;  2JS0 A;  4RTW A;  1PSF A;  4X1V A;  2DFU A;  2P4R A;  1K9M C;  1UGQ B;  4JS4 A;  2RI3 A;  3LGL A;  3QSU A;  4NOY A;  3V7S A;  4J9G A;  4IUP A;  4E7J A;  1ABQ A;  2QEX T;  4LD6 A;  1TOV A;  2QEX Q;  3PMI A;  3TCJ A;  1M1G A;  1FMV A;  2FO0 A;  2JW4 A;  1S72 T;  1S72 Q;  5A0G A;  4QQG A;  1ZSG A;  1QP3 A;  1M5Q 1;  2NUP B;  5LJ3 g;  1MMN A;  2M0O A;  3OYL A;  2COY A;  3M9Q A;  2KR3 A;  1M3B A;  2EQM A;  2QQB A;  5FU6 C;  2X4W A;  3HHT B;  4HXJ A;  1K8A R;  2CZ7 B;  2JTE A;  2LT4 A;  4HVU A;  3VS5 A;  2VXF A;  4J5Y A;  1HYO A;  4ZN3 A;  2COZ A;  5GAM f;  1X2K A;  3D7S B;  5GAM d;  1YWO A;  3GLX A;  1S72 A;  1UHC A;  3WVD B;  2HD0 A;  3I56 T;  4RCB A;  5CIU A;  3I56 Q;  2EPD A;  5GAN j;  2CYZ B;  4C92 C;  4M7A A;  4PNO A;  2OJ2 A;  1TXQ A;  4M7A D;  1ZQ1 A;  4HVW A;  3EG2 A;  1VQO T;  1Q82 C;  1YBY A;  1VQO Q;  3JB9 H;  1UEB A;  3G4S T;  4JDS A;  1M2O A;  4M75 E;  1A0N B;  2GF7 A;  1KIK A;  4M78 D;  2QQ9 A;  1VQ6 T;  1VQ6 Q;  4ZNX A;  3RMQ A;  5KYW A;  3I56 A;  4M77 D;  3CCL Q;  1M1F A;  4AFQ C;  3JCM Q;  1KFZ A;  2ZPI B;  2XK0 A;  2RPN A;  3HTR A;  2AK5 A;  1QVP A;  3OY9 A;  1N8R U;  1K9M U;  5KYX B;  1NE8 A;  1VQO A;  2LX9 A;  1W70 A;  2JJ9 A;  1ZBJ A;  4C8Q F;  4QVZ A;  1VA7 A;  2CDT A;  5GJV B;  3FB9 A;  3DLM A;  1VQ6 A;  3RDV A;  2DYI A;  1VQN T;  2ABL A;  3CCL A;  1VQN Q;  1LOJ A;  1R77 A;  2PZ1 A;  5GAN 8;  1KD1 C;  3MEA A;  3EGX B;  1JB0 E;  1MMG A;  1RUW A;  2DBK A;  3MJX A;  1GFC A;  2HSP A;  4AFU C;  1NYF A;  1PSE A;  3MPU B;  4AFZ C;  4LDX A;  4XU3 A;  3M53 A;  2DEQ A;  3VYH B;  4AG1 C;  4ME7 A;  3CXC A;  2DD4 A;  3MEW A;  2CSI A;  3LWI A;  5L8R E;  2CZ0 B;  1K0X A;  5KE3 A;  2O9S A;  5CKB A;  3DB3 A;  2JT4 A;  2KGT A;  5GAM g;  1BIA A;  4QT7 A;  3EGD B;  3LX7 A;  4PFO A;  3VS0 A;  1W2B A;  2XHC A;  5GMK e;  1Q82 U;  3FJP A;  1CSK A;  2E70 A;  1HSQ A;  2DKG A;  3I55 T;  3QHS A;  1BYM A;  2B86 A;  3I55 Q;  3JB9 G;  4JRP A;  4FL6 A;  3CPW A;  1D3B A;  4JJD A;  4PLL A;  4PFP A;  2PUO B;  1PC0 A;  1AZG B;  5GMK m;  4J9E A;  4KUL A;  2F69 A;  3OYH A;  3R6N A;  1QWE A;  3EFR A;  3JCM e;  2RQU A;  4KGX B;  1YJ9 Q;  2JM9 A;  4B9X A;  4M7D G;  1M8V A;  4FW2 A;  1RLP C;  2KMT A;  1TSF A;  3EG9 B;  3I55 A;  5HK0 A;  2SEM A;  4QKU A;  2RI5 A;  3MCA B;  2KXC A;  2RB6 A;  3EFS A;  3F70 A;  4XTW A;  1XTD A;  1FX7 A;  2I0N A;  3NPF A;  3GP8 A;  1WJR A;  1K8A C;  2M02 A;  1AWW A;  3M54 A;  1YJ9 A;  4BD3 A;  2RHI A;  3RR6 A;  5GMK i;  4MDW A;  2MYS A;  1BIB A;  3MP8 A;  2NWM A;  2CZ6 B;  1JXO A;  5LJ5 j;  3CMA T;  3OYK A;  2A36 A;  1M3A A;  1U3O A;  3FRN A;  2OI3 A;  3GNG A;  2DAQ A;  1U5S A;  2KE9 A;  1WJQ A;  4L5G A;  5GMK l;  4X9D A;  3ULR B;  2EKH A;  2DXB A;  1VQ9 T;  1VYV A;  2K79 A;  1Q7Y U;  2FHD A;  4QVD A;  5LJ3 e;  1Q81 U;  1YCS B;  1M30 A;  4A4G A;  1XOV A;  2FEI A;  2EIF A;  1UGR B;  5FLX E;  2AIR B;  1E6H A;  4ZGD B;  3SD4 A;  2LMJ A;  4LUD A;  1RAH B;  4MML A;  4BUG A;  3EFO B;  1K73 R;  3QPH A;  5LL6 S;  1SHG A;  2WAC A;  4DEX A;  1MNE A;  4PJO E;  5FU7 B;  3G71 T;  2YXY A;  4EMK C;  5HCK A;  4ATO A;  3KBG A;  1C1A A;  1SKU B;  4BY6 B;  2E12 A;  2AZV A;  1G83 A;  5GAN h;  2LJ0 A;  3VV0 A;  2K5L A;  3VS4 A;  1ZA2 B;  2OAU A;  4MZM A;  3S3M A;  4PKC C;  2J6F A;  4C92 F;  4XU2 A;  3LH0 A;  3E9F A;  2A28 A;  1K8A U;  4MMK A;  1IO6 A;  2BIV A;  3ASK A;  2DTI A;  2RH2 A;  2YSQ A;  2EGA A;  2DIG A;  2ESW A;  3RKY A;  4F7U E;  2JVV A;  1QVF S;  2MIO A;  2C06 A;  2Y90 A;  4AFS C;  3MET A;  2JNG A;  3M58 A;  2ENM A;  2FPD A;  2QTV A;  1F1B B;  2DXU A;  1IHV A;  2D6F A;  5M9O A;  2HL3 A;  4KUI A;  1HD3 A;  2FZK B;  4OGE A;  4CC7 A;  1U8R A;  1NZ9 A;  2VGM A;  4E7L A;  1OX8 A;  2FB7 A;  1VIE A;  3C0C A;  1QVG S;  1ABO A;  2DJQ A;  1UHF A;  1M1K R;  1OPK A;  4C5I A;  3PNW C;  3MO8 A;  1RAF B;  2RQV A;  4XTZ A;  4LN2 A;  2JTM A;  4RTT A;  1UUE A;  3M4Y A;  1PD1 A;  4M7A C;  1IB8 A;  2V26 A;  4LDV A;  2DRK A;  1ZA1 B;  1HK9 A;  3OS0 A;  4RUG A;  2XIC A;  1WJS A;  1WLP B;  2PTK A;  1EX4 A;  1H3H A;  2LTO A;  2HKQ B;  1QCF A;  4KT0 E;  4M78 C;  1X2Q A;  3I35 A;  4KRT A;  1WPY A;  4M77 C;  2KEA A;  4FU6 A;  2KY9 A;  4C92 G;  3UAT A;  2NUT B;  1RAC B;  2K6D A;  3CCM Q;  2LJ3 A;  1EIF A;  2K57 A;  3QJY A;  3CBP A;  4E7K A;  3WVE B;  3H9N A;  1C0M A;  3S6W A;  4QVC A;  2NUZ A;  2JXB A;  1LJO A;  2WSC E;  3MP6 A;  1IXD A;  2Y4Y A;  3VKI A;  3ZL7 C;  3JB9 J;  3PGG A;  1OQK A;  5D6W A;  3QBY A;  4ZGE B;  4BE0 A;  4PJO A;  4J9I A;  4JRI A;  4PJO D;  1KC8 C;  5CK9 A;  1NJI R;  5GAN d;  1T0H A;  2ZZD A;  2YRD A;  2ZPE B;  2VB6 A;  1GFD A;  3CCM A;  2DVJ A;  1WHK A;  3REB B;  4Q5W A;  3JCM f;  2M9U A;  8ATC B;  3OYI A;  3L2Q A;  2HBW A;  2RHX A;  2CP6 A;  2RJE A;  4EPC A;  3CPF A;  3CCJ T;  1B7T A;  2E5Q A;  5IHI A;  3RIR A;  4PJL A;  2E64 A;  2XI9 A;  3EAE A;  1MMD A;  2HMA A;  3KXT A;  2DX1 A;  1NEB A;  5GAO m;  3OYM A;  2ZPB B;  3A1P A;  4FYX B;  4QQD A;  3A5Z B;  1SEM A;  1WXB A;  5KYW B;  4XTX A;  2MAM A;  1KHI A;  3CC2 T;  2HKN A;  3OSS C;  1QP2 A;  2EWN A;  1TG0 A;  3E9G A;  2FPE A;  2M16 A;  3T9N A;  2QQS A;  2L3S A;  5IT9 E;  2H3E B;  1IHW A;  4AMC A;  2CP2 A;  5LJ5 h;  2KK4 A;  4N4I A;  1FMK A;  1I5O B;  2ZPF B;  2O4X B;  3OYF A;  4HT8 A;  3BDL A;  1WX6 A;  3H0I A;  4C8Q B;  3M0R A;  4C0F A;  2FZG B;  3VUZ A;  3CCU T;  1X6B A;  5FWB A;  3CCU Q;  2D8H A;  4II1 A;  2PU9 B;  1PNJ A;  5GAO l;  1KD1 R;  4KBM B;  5KCO A;  5GAO n;  5KCH A;  2CUD A;  2EQJ A;  4FM4 B;  3L2V A;  5CO7 A;  3OYG A;  2EAY A;  1ZUK A;  2LCL A;  2LC4 A;  3RKW A;  1OZ3 A;  3GBQ A;  1AZE A;  3CBM A;  3INZ A;  3PFS A;  1YCY A;  1VYU A;  4FYV B;  5C0M A;  5FRO A;  2RHU A;  4HCB A;  5DLQ E;  1PKT A;  1VYT A;  3JCM g;  1D1B A;  2C0I A;  5KYU A;  1MMA A;  2SRC A;  2DET A;  2VVK A;  2EQI A;  1M2V A;  1VIF A;  1M90 C;  2HEQ A;  3C94 A;  3CD6 T;  3CD6 Q;  1K73 U;  2LNH B;  1U1S A;  4EMK A;  3QO3 A;  5KH6 A;  2V8K A;  3DKM A;  1X75 C;  1YJW T;  1YJW Q;  4XK8 E;  3I5R A;  5I2M A;  2DL7 A;  5CKD A;  3QZ5 B;  1M3C A;  2GGR A;  2P84 A;  1BI0 A;  1VUB A;  2FRW A;  1WGS A;  1JRI A;  1M27 C;  1B34 B;  4LDW A;  3WXM B;  2C0O A;  3CD6 A;  2AKK A;  2ZCF B;  3FLG A;  1IRX A;  3IQL A;  3OYJ A;  5GAN 4;  1QCN A;  2LQ8 A;  1YJW A;  2DMO A;  2E1H A;  4J9C A;  4J9H A;  3C4S A;  1XJW B;  4JLG A;  3TSW A;  3CME T;  3O5Z A;  1GXI E;  1WFW A;  1NJI C;  4RTZ A;  2GFA A;  4OMM A;  3VS2 A;  4BI3 A;  1JU5 C;  5GAO p;  1Y0M A;  2RHZ A;  4M7D E;  5AYF A;  2X4Y A;  3VJP A;  4KH0 B;  1QVF P;  2H3J A;  1OX9 A;  2BZX A;  2J06 A;  2QEX A;  3M5A A;  4M7A F;  2XDB A;  2EYY A;  2F2X A;  2LQK A;  4OB0 B;  3RES A;  1SHF A;  4JRQ A;  4M78 F;  1K76 A;  4BI8 B;  3L42 A;  3QG1 A;  3G6E T;  4M77 F;  2ZPG B;  1UB4 A;  1UJY A;  1M1K U;  3MKD A;  3E2U A;  2CP7 A;  4OMO A;  3S3O A;  2RF0 A;  3ER0 A;  1Y96 A;  3X26 B;  3G4S Q;  3CEY A;  4OVA A;  4M78 A;  3A8G B;  2YUN A;  2OAW A;  3M0U A;  2CRE A;  2YUQ A;  4M77 A;  2QGF B;  4HA8 A;  2K7A A;  1VQ4 T;  4RTX A;  2FVU A;  1VQ4 Q;  4Y91 A;  2HQE A;  4IUU A;  3A8H B;  2LX7 A;  1Q95 G;  4A4H A;  2HL5 C;  3LYI A;  5IHN A;  1TWB A;  3A98 A;  4BE2 A;  2KRN A;  1I4K 1;  5FU6 B;  1UJ0 A;  1D1C A;  4GBQ A;  3G4S A;  5DLO A;  1ZHI A;  4V2S A;  2KDS A;  1QW1 A;  2P0Q A;  3HPW A;  3PT9 A;  2GBQ A;  1VQ4 A;  2YHT A;  2QAS A;  3O8V A;  2D0N A;  1NJI U;  5FWC A;  2LT1 A;  3CPW S;  4D6W A;  4E7S A;  4M7A G;  4C92 B;  3VUB A;  1Y7X A;  2IIM A;  1DJ7 B;  1I07 A;  3UDC A;  2CS7 A;  3J81 E;  2DL5 A;  2O88 A;  1AT1 B;  3JB9 D;  2ECZ A;  1VQN A;  4FT2 A;  4D8D A;  4PJO C;  4OB2 B;  2LRQ A;  4OGC A;  2EYX A;  2QG9 B;  1IRE B;  2FPF A;  1H64 1;  1AEY A;  1VQL T;  1YI2 T;  2D9T A;  2QXF A;  1YI2 Q;  5DM7 R;  3NTK A;  4LE9 A;  4Z89 A;  4HT9 A;  4M7D D;  1WHM A;  3OSV A;  1IZ6 A;  3HRS A;  2CGH A;  3AT1 B;  1YIJ T;  1YIJ Q;  3U23 A;  5CQY A;  2Z0W A;  3PIP A;  4NL3 A;  2DK3 A;  1MV3 A;  2YDL A;  3GOX A;  4C8Q G;  3KFV A;  5GAN e;  1MGQ A;  2F2V A;  3NTH A;  1YI2 A;  1RAE B;  1OEB A;  1GL5 A;  2JMA A;  4CC3 A;  1OYX A;  5HY6 A;  1I8F A;  1FXX A;  5GAO r;  3MHX A;  3OYN A;  1YIJ A;  3RMS A;  1Z9Q A;  3SEM A;  3R6O A;  1PWT A;  4XAX B;  3ZEH A;  4M75 A;  4MDX A;  4ORZ A;  1YJN T;  4M75 D;  1YJN Q;  3S3N A;  1W4S A;  1KSW A;  1SRM A;  2K9G A;  1OZ2 A;  2RI2 A;  1KD1 U;  4ZGJ B;  2BKD N;  4BE1 A;  1GCQ C;  2VYT A;  1YHQ T;  1YHQ Q;  1TUC A;  2LVM A;  4CC4 B;  2K5I A;  5A2Q E;  5C6S A;  1YN8 A;  4EMH A;  2AKL A;  2K3X A;  4E7I A;  2GFU A;  5IXF A;  1KC8 R;  3CMA Q;  1YJN A;  2EQU A;  1YP5 A;  4JZ4 A;  1CKB A;  2NYS A;  4WCI A;  1IGU A;  2LZ6 B;  1GBQ A;  3VYG A;  2CH4 W;  1YHQ A;  3QKJ A;  1N27 A;  1PRL C;  1HJD A;  2KAF A;  1UGP B;  5I21 A;  2PUK B;  4X9C A;  1JQQ A;  2EBP A;  1PHT A;  2YUO A;  1VQ9 Q;  2IPO B;  4E6R A;  4JPB W;  4PK4 A;  1JJ2 S;  2I2L A;  2O9V A;  3CMA A;  3EGU A;  1ACM B;  2XD0 A;  2MK5 A;  2RK1 A;  4A53 A;  2L5Q A;  2EKO A;  1QKX A;  2YWW A;  2A7Y A;  4J6Y A;  4GLM A;  4PJN A;  2J6K A;  2K2M A;  3UF4 A;  4R55 A;  2B8A A;  4P5N A;  2KYM A;  2R5A A;  1QWF A;  2M1H A;  1T3L A;  2DTH A;  1NPP A;  4GY5 A;  1VQ9 A;  3CBO A;  1AWJ A;  4GLK A;  2L3R A;  4DEY A;  5GAM j;  3OYD A;  4K11 A;  3G71 Q;  3MEV A;  3AHU A;  1PCX A;  5KYY A;  4RKU E;  4N4H A;  5CKH A;  1LPL A;  3M0P A;  2JMC A;  1PRM C;  3TQ7 P;  3OW2 S;  2ATC B;  4MZP A;  2LCS A;  4AG2 C;  4LNP A;  4C0Z A;  2PVD B;  4J7F A;  4UC4 A;  1B3Q A;  3L2R A;  2CT4 A;  2O01 E;  4OP0 A;  2D8J A;  3G71 A;  2DLP A;  1HXD A;  1ZUU A;  1ZSZ C;  3GPL A;  1MHN A;  3V8K A;  2BE7 D;  3A8L B;  4C5H A;  2PQW A;  1KK7 A;  2EQK A;  2XU8 A;  2DXT A;  1N5Z A;  3SFM A;  2EW3 A;  2MF2 A;  4JUV A;  3X28 B;  5IH2 A;  2LQN A;  1W1F A;  3FJ5 A;  1ZUY A;  5I2S A;  5LJ5 e;  4BAC A;  2XG8 D;  4IUQ A;  3OYA A;  5IXB A;  2ED1 A;  1M4Z A;  3CC4 T;  3CC4 Q;  4L6V 5;  1M90 R;  1VQM T;  2ROL A;  1VQM Q;  2QAZ A;  2DJZ A;  2RD1 A;  2L3Q A;  3M56 A;  3EG1 A;  4LDY A;  5I22 A;  1OPL A;  2BZ8 A;  2VAS A;  4IUV A;  3UA6 A;  3P8H A;  1LCK A;  2VV5 A;  2F1L A;  2E65 A;  2QA4 T;  4PL6 A;  4C0D C;  3EGD A;  3CC4 A;  1GCP A;  1RI9 A;  4PJO F;  2HNI A;  1VQM A;  4B9W A;  4ESR A;  4HCC A;  1AOJ A;  1QKW A;  1SSH A;  2LDM A;  3CPW P;  5D7U A;  1UFF A;  3JCM X;  4FIB A;  2QGG A;  3TSZ A;  1BB9 A;  2MPX C;  1YNZ A;  4X34 A;  1QVF A;  5GAN f;  1N9R A;  1RAI B;  5FRM A;  3J80 E;  4HCZ A;  2R58 A;  4WF2 A;  3OS2 A;  3DLL A;  1KQS S;  4BB7 A;  3EG9 A;  1YWP A;  4M7A B;  1ARK A;  4XU0 A;  3CCJ Q;  1T3S A;  4LUE A;  2V8J A;  2DZ9 A;  2WSE E;  1FYN A;  1R0B G;  4F7U F;  4JS5 A;  1VQP T;  3GNF B;  4ZN1 A;  4M78 B;  4M4Z A;  3PVQ A;  1I81 A;  4M77 B;  2RN8 A;  3CQT A;  3NFC A;  3LH5 A;  1WHH A;  3SWN C;  4OB3 B;  3CC2 Q;  4J7I A;  4F7U A;  3QDF A;  2KT1 A;  1ZX6 A;  3CCJ A;  1W6X A;  2KT8 A;  2F5T X;  5HKC A;  2X4J A;  3QYG B;  1SPK A;  1QQJ A;  1O75 A;  3BFM A;  4M7D C;  1G3T A;  1NBE B;  2AZS A;  2L89 A;  2ROT A;  2RQW A;  1RAD B;  2FZC B;  1NLO C;  1X27 A;  3H6Z A;  5FW9 A;  1G8X A;  3OYC A;  1GCQ A;  3CC2 A;  2A3L A;  2HBP A;  2DIQ A;  3ZFJ A;  2DER A;  1T0J A;  2LJ1 A;  2QDL A;  2X9H A;  5GAN 3;  3L1A A;  1WQW A;  1MV0 B;  4R56 A;  2PVO B;  1M8M A;  5D6X A;  4CRI A;  3J7A F;  1BK2 A;  2DXC A;  1OV3 A;  1JO8 A;  3Q1J A;  3QDR B;  4BI4 A;  5D6Y A;  3QWY A;  1KC8 U;  4M75 C;  3BW1 A;  1NEG A;  3SB2 A;  3JCM b;  2QK0 A;  2CUB A;  4N0A C;  1R8O B;  1SRL A;  2E6Z A;  3CCE T;  5GAN g;  3HKS A;  4IUT A;  3HRU A;  3CCE Q;  2ZGW A;  3EH2 A;  3TVT A;  2EJG A;  2RK2 A;  1LNX A;  3L2Z A;  5GAM h;  4XQ3 A;  3CCU A;  3OB9 A;  2EGE A;  2G3R A;  3V7R A;  1S1N A;  1U06 A;  1JJ2 P;  3V8L A;  1KG1 A;  4J8O A;  3H8Z A;  4J9D A;  1D3B B;  2EJF A;  1TU0 B;  4BDZ A;  2NLU A;  2E41 A;  2HQX A;  4JJN K;  1AWO A;  3CCE A;  2RQT A;  5EG2 A;  1BBZ A;  4JZ3 A;  4F14 A;  2Y4X A;  4E2F B;  2CP0 A;  3X24 B;  4J9B A;  2DE0 X;  4F16 A;  4KH1 B;  1E6G A;  4C0G A;  2V1Q A;  2W10 A;  4IIM A;  2L2P A;  3HSB A;  2BUD A;  3HL8 A;  2JUF A;  2DA9 A;  4XTY A;  2RJC A;  5CVI A;  1WHG A;  1G3Y A;  4EIK A;  1PKS A;  4RG8 A;  1KJW A;  4A63 B;  2YRV A;  1O9S A;  3OW2 P;  2OX7 A;  5LJ5 f;  4C8Q E;  5LJ5 d;  4OMQ A;  1ZSZ A;  4JLI A;  1N8R C;  1VQK T;  2DPP B;  1VQK Q;  4F17 A;  2RA2 A;  3CME Q;  1YIT T;  2KBT A;  2YRC A;  2QDY B;  1YIT Q;  1SG5 A;  4OMP A;  2K3Y A;  2D1X A;  2FYK A;  3HP9 A;  5AT1 B;  3NGP A;  2DYB A;  2W0Z A;  3OMC A;  3QII A;  1N6A A;  2J7I A;  3H0F A;  4KGV B;  3M0T A;  3CCV T;  2NUT A;  3CCV Q;  4DBR A;  1VQK A;  3ME9 A;  3V8J A;  3VS6 A;  3CME A;  4PJM A;  1B07 A;  4OML A;  2DD5 A;  2FRY A;  1YIT A;  2HQH A;  3OMG A;  4RTY A;  2XDD A;  2EVR A;  2JS2 A;  3X25 B;  4Z88 A;  1SF9 A;  2GNC A;  3G6E Q;  5GMK j;  1QVG P;  5CAI A;  2C0T A;  1M90 U;  1BI3 A;  4J6W A;  2HCK A;  1E7O A;  1VQ7 T;  4ZTJ A;  2JOY A;  1VQ7 Q;  2P0P A;  4ELZ C;  3EH1 A;  3CCV A;  2FL7 A;  2VUB A;  2DL8 A;  2IG0 A;  2M51 A;  2VC8 A;  4Y28 E;  3CXC S;  4FYY B;  4LDU A;  3RER A;  4A4F A;  2YUP A;  2KRO A;  2VGN A;  1Y71 A;  8AT1 B;  1X69 A;  3EHQ A;  5KYY B;  1WIE A;  3THK A;  2EYW A;  3G6E A;  2L0A A;  4Y92 A;  2D0Q B;  2M0Y A;  1TTH B;  3VRZ A;  2K5F A;  2LQW A;  3QYH B;  1VQ7 A;  3UWN A;  2KYB A;  3G7Z A;  3CCL T;  1W2B S;  3QUI A;  3RKX A;  2LCC A;  3QWX X;  3C95 A;  3LGF A;  3OA6 A;  1BU1 A;  1C6V X;  1RAA B;  3RNJ A;  5IAY A;  2AT1 B;  5CR2 A;  3M55 A;  3FDR A;  2IVW A;  3JB9 F;  1MUZ A;  4J6X A;  2F5K A;  3JCM V;  2KRS A;  5LJ5 g;  3BY7 A;  4FSX A;  2RJF A;  1Q86 R;  3EHR A;  1MND A;  2O4X A;  1QCO A;  2JM8 A;  1KQS P;  3CC7 T;  3JRZ A;  3NHN A;  3CC7 Q;  2KQW A;  4M78 G;  2A0F B;  4WTO B;  2RO0 A;  4M77 G;  3V7C A;  4FYW B;  3CCQ T;  2CP3 A;  4JJB A;  3CCQ Q;  2KSS A;  4Z8A A;  4M7D F;  4C8Q A;  1FWZ A;  3SWN A;  4C8Q D;  4EMG A;  2CH4 A;  4ANJ A;  2A08 A;  1G3S A;  3P8B B;  1VQL Q;  4JJC A;  2E6N A;  2J6O A;  5LJ3 j;  2JN0 A;  1AWX A;  4O6J A;  4M7D A;  1ZLM A;  1CKA A;  3CC7 A;  3E19 A;  5CKF A;  3A8M B;  4FSS A;  1AVZ C;  3LLR A;  3P8D A;  4HKE A;  1TUD A;  3CCQ A;  1VOM A;  1KHC A;  1YFN A;  1VQ8 T;  1VQ8 Q;  1PM3 A;  2BZY A;  4FW1 A;  1EFN A;  1G5V A;  1VQL A;  2ZPH B;  1Q7Y C;  4M75 F;  5GJW B;  1Q81 C;  4DA4 A;  5FRN A;  3NMZ C;  2YLB A;  4A54 A;  5HK3 A;  4JRK A;  1NG2 A;  1BKB A;  1WHJ A;  2DNU A;  2HZY A;  4E7Z A;  2DIL A;  2K2V A; 
#chains in the Genus database with same CATH homology
 2ZPF B;  2VXF A;  2O4X B;  4J5Y A;  2MF2 A;  1VQ8 A;  4JUV A;  3X28 B;  3OYF A;  4PJO B;  4ZN3 A;  2KVQ G;  4HT8 A;  5GAM f;  4N0A A;  5GAM d;  3BDL A;  3TU4 K;  3GLX A;  4E7H A;  1S72 A;  5GAN 7;  3WVD B;  2HD0 A;  3I56 T;  3ZBD A;  4RCB A;  4C8Q B;  5CIU A;  1KQ2 A;  2X35 A;  1YJ9 T;  4C0F A;  5I2S A;  5LJ5 e;  4BAC A;  5GAN j;  2XG8 D;  4L59 A;  4IUQ A;  4OB1 B;  3OYA A;  2CYZ B;  4RMO A;  1M4Z A;  3VUZ A;  4C92 C;  4C92 E;  4PNO A;  3CC4 T;  3CCU T;  4M7A A;  4L6V 5;  4M7A D;  1VQM T;  1ZQ1 A;  4FT4 A;  1VQO T;  1Q82 C;  1YBY A;  4II1 A;  3GF5 A;  2DJZ A;  2PU9 B;  2RD1 A;  1UEB A;  3G4S T;  4JDS A;  3JB9 H;  1B34 A;  5GAO l;  2OTL T;  3OQ5 A;  3M56 A;  3JCM W;  4M75 E;  3PIO A;  4KBM B;  4LDY A;  1KQ1 A;  5KCO A;  5GAO n;  2GF7 A;  5KCH A;  4M78 D;  2QQ9 A;  2DVE A;  2EQJ A;  4FM4 B;  1VQ6 T;  3L2V A;  5CO7 A;  1ZBX A;  3RMQ A;  3M4G A;  4IUV A;  3OYG A;  4M77 D;  2EAY A;  1WQ7 A;  3I56 A;  3M59 A;  1M1F A;  3P8H A;  2LCL A;  3L2W A;  3JCM Q;  2LC4 A;  3RKW A;  2VV5 A;  2ZPI B;  2XK0 A;  5FU7 C;  1OZ3 A;  1U1T A;  2E65 A;  2QA4 T;  1QVP A;  4PL6 A;  3X20 B;  4C0D C;  4F7U B;  3OY9 A;  3FC3 A;  1N8R U;  3CBM A;  3INZ A;  3CC4 A;  2JZ2 A;  3PFS A;  1YCY A;  4ELY C;  1K9M U;  1NE8 A;  5C0M A;  5FRO A;  4PJO F;  2HNI A;  2RHU A;  1VQM A;  4B9W A;  4HCB A;  5DLQ E;  1VQO A;  2LX9 A;  4BY6 C;  4HCC A;  4OF1 A;  3JCM g;  4OMF B;  2LDM A;  2OTL A;  4M75 G;  4C8Q F;  4QVZ A;  3PMT A;  3FB9 A;  3JCM X;  2EYQ A;  4FIB A;  4BDY A;  1VIF A;  3DLM A;  1M90 C;  1VQ6 A;  1VQN T;  3JAM E;  3CCL A;  4RG2 A;  3C94 A;  3CD6 T;  4X34 A;  1LOJ A;  4XTV A;  5GAN f;  5GAN 8;  1QVF A;  1K73 U;  1G3W A;  5CCA A;  1N9R A;  1U1S A;  1KD1 C;  5FRM A;  4EMK A;  3MEA A;  3J80 E;  3QO3 A;  3HRT A;  5KH6 A;  2QQA A;  2V8K A;  3DKM A;  4HCZ A;  1JB0 E;  4YTL A;  1X75 C;  1YJW T;  4N4G A;  4XK8 E;  2R58 A;  1OI1 A;  4WF2 A;  3OBY A;  2DZC A;  2MWP A;  4XTU A;  4TVR A;  5I2M A;  4BB7 A;  3OS2 A;  3DLL A;  1KQS S;  1I5L A;  3BDU A;  1RI0 A;  1PSE A;  2X4X A;  4M7A B;  5CKD A;  3QZ5 B;  4LDX A;  3DB4 A;  4XU0 A;  4XU3 A;  5GAN 5;  3M53 A;  3QXE B;  2DEQ A;  3VYH B;  1BI0 A;  1VUB A;  2CKK A;  1WGS A;  2V8J A;  2DZ9 A;  4ME7 A;  3CXC A;  2PVG B;  1JRI A;  2WSE E;  1B34 B;  4LDW A;  4F7U F;  4JS5 A;  3TEE A;  3GNF B;  3WXM B;  1VQP T;  2DD4 A;  4ZN1 A;  3MEW A;  5GMK h;  3CD6 A;  3LWI A;  2ZCF B;  3FLG A;  2GCX A;  5L8R E;  4M78 B;  4LD9 K;  2CZ0 B;  3QZ9 B;  1I81 A;  4M77 B;  1Q86 C;  4KUD K;  2V8I A;  3NFC A;  3OYJ A;  5KE3 A;  5GAN 4;  5CKB A;  3DB3 A;  2LQ8 A;  1YJW A;  2E1H A;  4OB3 B;  3SWN C;  3GIB A;  3C4S A;  5GAM g;  1BIA A;  2OTJ T;  4JLG A;  4J7I A;  4F7U A;  3CME T;  1GXI E;  1NJI C;  3LX7 A;  2GFA A;  2VXE A;  4DOW A;  3CCJ A;  1W2B A;  5A0D A;  2F5T X;  2XHC A;  5HKC A;  1P92 A;  3QJ6 A;  1V29 B;  3FJP A;  4BI3 A;  1N9S A;  2X4J A;  3QYG B;  1XNI A;  5GAO p;  1O75 A;  3BFM A;  2E70 A;  2RHZ A;  1G3T A;  4M7D C;  4M7D E;  2MWO A;  2L89 A;  3JCM h;  5AYF A;  2DKG A;  2X4Y A;  3QHS A;  3VJP A;  2QTX A;  3I55 T;  1BYM A;  3JB9 G;  3A8O B;  3OS5 A;  3RUX A;  3JCM P;  4JRP A;  4FL6 A;  3CPW A;  2H3J A;  1D3B A;  5CKE A;  4PLL A;  1JJ2 A;  2PUO B;  3H6Z A;  2QEX A;  3M5A A;  5GMK m;  2RJD A;  3OYC A;  4M7A F;  2XDB A;  4KUL A;  3CC2 A;  2F69 A;  1JBM A;  2A3L A;  2HBP A;  2OTJ A;  4DQ2 A;  3OYH A;  1X6O A;  2DIQ A;  2LQK A;  4IUR A;  3ZFJ A;  4EMK B;  4OB0 B;  3EFR A;  4C92 A;  3JCM e;  3RES A;  5GAN 3;  2MMP A;  4C92 D;  3L1A A;  1WQW A;  4JRQ A;  4M78 F;  4BI8 B;  2CZ1 B;  4R56 A;  3L42 A;  4M7D G;  2PVO B;  3QG1 A;  4B9X A;  1M8V A;  5D6X A;  4CRI A;  3G6E T;  3J7A F;  2KMT A;  4M77 F;  2DXC A;  1UB4 A;  2ZPG B;  1M1K U;  3I55 A;  3JB9 I;  3Q1J A;  5HK0 A;  3QDR B;  4QQ6 A;  2RI5 A;  3MCA B;  3CCR T;  3S3O A;  2HAX A;  2RB6 A;  3ER0 A;  1Y96 A;  5D6Y A;  3X26 B;  3EFS A;  4BI4 A;  3CEY A;  3F70 A;  1KC8 U;  4M75 C;  4XTW A;  4OVA A;  3BW1 A;  4M78 A;  3A8G B;  3SB2 A;  3JCM b;  1XTD A;  1FX7 A;  3GP8 A;  4N0A C;  1R8O B;  1WJR A;  4M77 A;  1K8A C;  4HA8 A;  1VQ4 T;  2FVU A;  2E6Z A;  3M54 A;  4Y91 A;  1YJ9 A;  2HQE A;  3CCE T;  4IUU A;  3A8H B;  2RHI A;  4BD3 A;  2EJ9 A;  3HKS A;  4IUT A;  3HRU A;  5GMK i;  5GAN g;  4MDW A;  4A4H A;  3OW2 A;  2ZGW A;  1BIB A;  2R5M A;  2DO3 A;  5GAO q;  3LYI A;  3MP8 A;  2EJG A;  2RK2 A;  1LNX A;  3KUF A;  3L2Z A;  4XQ3 A;  4C5G A;  5GAM h;  3CCU A;  2CZ6 B;  4BE2 A;  5LJ5 j;  3CMA T;  3OB9 A;  3OYK A;  1I4K 1;  3LWH A;  5FU6 B;  2P4T A;  2G3R A;  3V7R A;  3CCR A;  5KE2 A;  2DTO A;  5LJ3 h;  3L2U A;  3JSC A;  2XID A;  2EFI A;  3G4S A;  3FRN A;  3GNG A;  5DLO A;  3V8L A;  1KG1 A;  2DAQ A;  1ZHI A;  4V2S A;  4J8O A;  2KDS A;  1QW1 A;  2P0Q A;  4DOV A;  3JCM J;  1WJQ A;  3H8Z A;  1Q86 U;  4L5G A;  1M9S A;  5GMK l;  3HPW A;  3M57 A;  3PT9 A;  4X9D A;  1D3B B;  2EJF A;  4NS5 A;  4BDZ A;  2RM4 A;  1VQ4 A;  2NLU A;  2YHT A;  1NPR A;  2E41 A;  1Y07 A;  2HQX A;  3FIF A;  5GAM e;  4JJN K;  2DXB A;  3O8V A;  4IKF A;  3CCE A;  3CCM T;  5EG2 A;  1VQ9 T;  4RCC A;  2K4Y A;  1NJI U;  5DY9 A;  2LT1 A;  3CPW S;  1Q7Y U;  2FHD A;  4QVD A;  2Y4X A;  4D6W A;  5LJ3 e;  2QA4 A;  1AHJ B;  4A4K A;  1Q81 U;  4M7A G;  3X24 B;  4A4G A;  1XOV A;  4C92 B;  3TRE A;  3MEU A;  2EIF A;  3OYY A;  3VUB A;  1Y7X A;  1UGR B;  5FLX E;  1TH7 A;  3N5B B;  1H3Z A;  4C0G A;  4ZGD B;  2GQV A;  3SD4 A;  2RHY A;  1DJ7 B;  3UDC A;  2XDP A;  3HSB A;  2CS7 A;  4MML A;  3J81 E;  4BUG A;  3QPH A;  5LL6 S;  2BUD A;  3HL8 A;  2WAC A;  1BI2 A;  3JB9 D;  1WNL A;  4EDU A;  2JUF A;  1VQN A;  1QVG A;  1Y96 B;  4FT2 A;  3HFN A;  4XTY A;  2E10 A;  4C5E A;  2RJC A;  4OB2 B;  5CVI A;  2LRQ A;  3SDZ A;  4OGC A;  2JTF A;  1G3Y A;  1VQ5 T;  4PJO C;  4PJO E;  1IRE B;  4RG8 A;  2L8D A;  3UPU A;  2YRV A;  5FU7 B;  1O9S A;  1H64 1;  3JCM d;  4EMK C;  3G71 T;  4C0D B;  5LJ5 f;  3OYB A;  4C8Q C;  4C8Q E;  1VQL T;  4ATO A;  5LJ5 d;  3KBG A;  1YI2 T;  2D9T A;  2QXF A;  4JLI A;  3NTI A;  5DM7 R;  1N8R C;  1VQK T;  5GMK e;  2DPP B;  3NTK A;  4BY6 B;  2E12 A;  2RA2 A;  4VUB A;  4CI0 C;  5GAN h;  3VV0 A;  4HT9 A;  1RL2 A;  4M7D D;  2K5L A;  3OSV A;  1YIT T;  1IZ6 A;  3HRS A;  2CGH A;  2QDY B;  1YIJ T;  2OAU A;  2K3Y A;  5J26 A;  5CQY A;  3PIP A;  3FEO A;  4MZM A;  4NL3 A;  1VQP A;  2DK3 A;  4PJO G;  3S3M A;  2FYK A;  4PKC C;  1VQ5 A;  3HP9 A;  4C92 F;  4XU2 A;  2R57 A;  3LH0 A;  3E9F A;  1K8A U;  5J39 A;  3GOX A;  3OMC A;  3QII A;  1N6A A;  4MMK A;  3E1S A;  2XKO C;  4C8Q G;  5GAN e;  1K73 C;  1MGQ A;  3NTH A;  3C12 A;  3CCV T;  1YI2 A;  2BIV A;  1VQK A;  3ASK A;  3ME9 A;  3V8J A;  2DTI A;  1OYX A;  2RH2 A;  5HY6 A;  3CME A;  1I8F A;  2DIG A;  1FXX A;  3RKY A;  3URG A;  4F7U E;  4QW2 A;  5GAO r;  2JVV A;  2QI2 A;  3MHX A;  2DD5 A;  1YIT A;  4Z02 A;  1QVF S;  3OYN A;  3OMG A;  1YIJ A;  3RMS A;  2XDD A;  2C06 A;  2LNV A;  2Y90 A;  3X25 B;  3R6O A;  3MET A;  3PTA A;  5GMK j;  4XAX B;  3ZEH A;  2JNG A;  4M75 A;  4MZT A;  4MDX A;  5CAI A;  3M58 A;  1YJN T;  1M90 U;  1BI3 A;  4M75 D;  5GAN 2;  3S3N A;  4J6W A;  1W4S A;  2DXU A;  1VQ7 T;  4ZTJ A;  2D6F A;  5M9O A;  1KQS A;  2JOY A;  1OZ2 A;  1XQH A;  2P0P A;  2RI2 A;  4KUI A;  4A4E A;  4ELZ C;  2FL7 A;  2VUB A;  3CCV A;  1KD1 U;  4OGE A;  2IG0 A;  5LJ3 f;  1BI1 A;  4ZGJ B;  5LJ3 d;  2BKD N;  3HFO A;  3SWN B;  4BE1 A;  2VYT A;  4NL2 A;  2VC8 A;  1NZ9 A;  4Y28 E;  2VGM A;  1YHQ T;  1U8R A;  4F7U G;  4E7L A;  2LVM A;  3CXC S;  2FB7 A;  2P0K A;  1VIE A;  3OBW A;  5IN1 A;  5GAN 6;  2K5I A;  1QVG S;  4LDU A;  3RER A;  3UT1 A;  4A4F A;  2AHJ B;  5C6S A;  5A2Q E;  2WSF E;  2VGN A;  4C5I A;  1Y71 A;  4EMH A;  3PNW C;  3MO8 A;  5A0L A;  3G6E A;  4E7I A;  2K3X A;  4XTZ A;  2JTM A;  2GFU A;  4M7D B;  3M4Y A;  4M7A C;  4M7A E;  4LDV A;  3MP1 A;  2D0Q B;  1YJN A;  3OYE A;  2EQU A;  1HK9 A;  2K5F A;  3QYH B;  3OS0 A;  2XIC A;  4O5V A;  1WJS A;  3UWN A;  1VQ7 A;  3CCS T;  3G7Z A;  2LTO A;  3CCL T;  1W2B S;  1SSF A;  3QUI A;  4KT0 E;  3RKX A;  2QQR A;  4M78 C;  2LCC A;  4M78 E;  3VYG A;  3OA6 A;  3C95 A;  3LGF A;  3OS1 A;  1YHQ A;  3QKJ A;  2YLC A;  1N27 A;  1WPY A;  5IAY A;  2KAF A;  4M77 C;  4FU6 A;  2KY9 A;  4M77 E;  4PLI A;  4C92 G;  1UGP B;  5I21 A;  2PUK B;  3M55 A;  3FDR A;  4X9C A;  5CR2 A;  4J83 A;  2IVW A;  1EIF A;  2K57 A;  3JB9 F;  3LW5 E;  4J6X A;  3QJY A;  1JJ2 S;  2I2L A;  3CBP A;  4E7K A;  4XU1 A;  2F5K A;  3JCM V;  3WVE B;  5J3B A;  5LJ5 g;  3CMA A;  3S6W A;  4QVC A;  2XD0 A;  2RK1 A;  3BY7 A;  4FSX A;  1LJO A;  2WSC E;  3MP6 A;  4A53 A;  2RJF A;  4ZTF A;  2L5Q A;  2EKO A;  2Y4Y A;  3VKI A;  3JB9 J;  1M1K C;  3PGG A;  2A7Y A;  3VU3 C;  5D6W A;  3CCS A;  3QBY A;  4J6Y A;  3JCM c;  2O4X A;  4ZGE B;  3CC7 T;  3JRZ A;  4BE0 A;  2KQW A;  4PJO A;  4M75 B;  4M78 G;  4JRI A;  4PJO D;  5CQX A;  4R55 A;  2RO0 A;  2B8A A;  4P5N A;  5CK9 A;  5GAN d;  1KC8 C;  2R5A A;  2MI6 A;  4M77 G;  3V7C A;  3CCQ T;  2ZZD A;  2KSS A;  1UGS B;  2M1H A;  2ZPE B;  4M7D F;  2DTH A;  4C8Q A;  1X01 A;  1NPP A;  1FWZ A;  4GY5 A;  3CCM A;  3CBO A;  3SWN A;  4C8Q D;  4E47 A;  1VQ9 A;  4GLK A;  4Q5W A;  3JCM f;  4EMG A;  2L3R A;  2M9U A;  5GAM j;  3OYD A;  3OYI A;  1G3S A;  1PSF A;  3P8B B;  3L2Q A;  2RHX A;  2RJE A;  3MEV A;  2E6N A;  4EPC A;  3AHU A;  3CPF A;  3CCJ T;  5LJ3 j;  2JN0 A;  2E5Q A;  3RIR A;  1K9M C;  4RKU E;  1UGQ B;  4O6J A;  4N4H A;  5CKH A;  2E64 A;  4JS4 A;  2XI9 A;  4M7D A;  3EAE A;  3KXT A;  3CC7 A;  3E19 A;  5CKF A;  3A8M B;  2RI3 A;  3LGL A;  3QSU A;  3LLR A;  3P8D A;  4NOY A;  3V7S A;  3OW2 S;  5GAO m;  4HKE A;  4IUP A;  3OYM A;  3CCQ A;  4E7J A;  2ZPB B;  4MZP A;  4QQD A;  3A5Z B;  1KHC A;  4C0Z A;  2QEX T;  2PVD B;  4LD6 A;  4J7F A;  4UC4 A;  1VQ8 T;  4XTX A;  2MAM A;  3L2R A;  3PMI A;  1KHI A;  3CC2 T;  2O01 E;  3TCJ A;  1M1G A;  4OP0 A;  1G5V A;  3G71 A;  1Q82 U;  3OSS C;  1S72 T;  1VQL A;  1QP2 A;  2ZPH B;  2EWN A;  5A0G A;  1HXD A;  1Q7Y C;  4QQG A;  1QP3 A;  4M75 F;  3GPL A;  1M5Q 1;  3E9G A;  5LJ3 g;  1MHN A;  1Q81 C;  3V8K A;  4DA4 A;  2M16 A;  2M0O A;  3A8L B;  3OYL A;  3T9N A;  2QQS A;  3M9Q A;  4C5H A;  2PQW A;  5FRN A;  2EQM A;  2YLB A;  4A54 A;  5HK3 A;  5IT9 E;  2EQK A;  4JRK A;  2XU8 A;  1BKB A;  2DXT A;  2QQB A;  2X4W A;  3HHT B;  5FU6 C;  5LJ5 h;  2CZ7 B;  2LT4 A;  3SFM A;  2K2V A;  2KK4 A;  4N4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...