1OI1A

Crystal structure of the mbt domains of human scml2
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
207
Chain Sequence
FHWEEYLKETGSISAPSECFRQSQIPPVNDFKVGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGTCEKEGDLLQPPLGYQSWPMFLLETLNGSEMASATLFKKEPPKPPLNNFKVGMKLEAIDKKNPYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPPGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Mbt
molecule keywords SCML2 PROTEIN
publication title Crystal Structure of the Malignant Brain Tumor (Mbt) Repeats in Sex Comb on Midleg-Like 2 (Scml2).
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 207
sequence length 211
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oi1A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oi1A01
1OYXA 4II1A 3UWNA 3OY9A 2WACA 2DAQA 3OYHA 3OA6A 2MWPA 3CEYA 5J26A 4IKFA 2VYTA 3F70A 2HQEA 2GFUA 2RJCA 3SD4A 4B9XA 3MEAA 2K3XA 3OYAA 4C5IA 4LD6A 2GF7A 3FC3A 3L2VA 5D6WA 4Z02A 4BE2A 5FRMA 5FROA 2FHDA 3M9QA 2L8DA 3OYIA 3DB4A 3H8ZA 2JTFA 4B9WA 2X4WA 4BE0A 4HCZA 1KHCA 2JZ2A 4N4IA 5C6SA 3KUFA 4EDUA 4QQDA 3OYEA 2EQMA 1OZ3A 4IURA 2G3RA 5KCHA 3OYBA 2LRQA 3NTIA 3E9GA 3MEUA 3H6ZA 2XDPA 3PFSA 2R58A 3OQ5A 4QQGA 5M9OA 4BE1A 3EAEA 3LGFA 4C5HA 3QKJA 3OYGA 4ZTFA 5J39A 3OYDA 1MHNA 3DB3A 2RI5A 2LVMA 3E9FA 3OB9A 2RJEA 3OYCA 3OMCA 2LCCA 2EKOA 2M0OA 1OZ2A 4A4HA 4CRIA 2IG0A 2L3RA 2X35A 3NTHA 4A4FA 3FDRA 3OMGA 3Q1JA 3QBYA 4IUPA 3OYKA 4PLIA 2PQWA 1XNIA 3OYNA 3PMIA 2O4XB 2RHZA 1WGSA 5KE2A 4N4HA 4C5EA 4BDZA 3PMTA 2X4XA 3OS2A 2EQKA 2BKDN 2M1HA 2RJFA 3O8VA 2RHUA 4E7KA 3MP6A 3MP8A 3UT1A 4C5GA 5KCOA 2EQJA 4IUQA 2BIVA 5IAYA 4A4GA 3OYMA 3S3OA 2L89A 3OYLA 5CIUA 2RI3A 3OYFA 2EFIA 2RHXA 3DLMA 3OS0A 3OS1A 4FU6A 2HQXA 3L42A 3QIIA 1WJRA 1OI1A 3S3MA 2RO0A 1N27A 4QW2A 4ZTJA 2E6NA 2EQUA 2M16A 4FL6A 4BDYA 3MP1A 2P0KA 2RI2A 2K3YA 3QJ6A 3LGLA 2QQSA 2LTOA 2LDMA 4A4EA 1G5VA 1WJQA 2DIQA 4L59A 3ZEHA 3L2RA 4X34A 3S6WA 4BACA 4E7JA 2YRVA 3L2UA 4NS5A 3FLGA 2MWOA 2RHYA 2BUDA 3FEOA 2E5QA 2R5MA 5FRNA 2RHIA 3ASKA 1SSFA 3MEVA 5C0MA 2NLUA 4E7LA 2X4YA 4QVZA 3LX7A 4IUUA 4QQ6A 3NTKA 3GOXA 3L2QA 3C4SA 3PNWC 3P8DA 3LH0A 2R57A 4N4GA 2GFAA 3L2WA 2O4XA 3OYJA 2R5AA 3LLRA 3MO8A 4RG2A 5IN1A 4E7HA 4IUVA 2DIGA 4Q5WA 3S3NA 3MEWA 2XK0A 1WJSA 2B8AA 2QQRA 5D6YA 3LYIA 4PLLA 4OVAA 4IUTA 2F5KA 4GY5A 3BDLA 4PL6A 3ME9A 5KH6A 4BD3A 2CKKA 2RJDA 3META 3P8HA 4UC4A 5KE3A 5D6XA 4E7IA 1H3ZA 1RI0A 2D9TA
chains in the Genus database with same CATH superfamily
3AT1B 4C0DC 4CC4B 2KK4A 4M78F 2VYTA 3A8GB 4WF2A 2OAUA 3H41A 1BB9A 1E6HA 4O5VA 2HEQA 3JCMb 3G4ST 2AHJB 4DEXA 3DB4A 4HCZA 2DPPB 3URGA 1YHQQ 1RABB 1RAIB 1FX7A 1VQNA 2RQVA 3ER0A 3ZFJA 1GBQA 3INZA 1C0MA 2K5LA 2RJEA 4E47A 3PIPA 4EPCA 2CZ1B 1M9SA 1MV3A 1ZX6A 2JM8A 2PQWA 4XU3A 2VC8A 3PMIA 2QDYB 1PG5B 1YHQA 1AVZC 2CP0A 2ZPGB 1UGQB 3PGGA 2YT6A 1E6GA 2DILA 1ZA2B 3LH5A 3MP8A 1UDLA 1M5Q1 5L8RE 2QA4T 4DBQA 2GTJA 2FZGB 1XTDA 1X6BA 1SHFA 4N0AC 2YUQA 1AWXA 2MK5A 1SEMA 4JZ4A 4F7UG 2DXCA 2DA9A 2QI2A 2DZCA 2EIFA 5I21A 4BACA 1YNZA 5GAN8 2YRVA 2XMFA 2ENMA 1WHKA 2CGHA 3VJPA 3VUZA 1Q95G 1M2VB 4ZN3A 3NTKA 3CQTA 4J9HA 4KBMB 2FZKB 3OSVA 3RMQA 4XU1A 3J80E 2YLCA 1YJNT 3MEWA 4JRQA 1KJWA 1GBRA 3VYHB 4OMQA 2DLPA 5CR2A 5KE3A 1TH7A 2D9TA 2PU9B 3M4GA 1KIKA 1ZUYA 3L2ZA 3CEYA 4KT0E 4RTYA 2HD0A 3CCMQ 1VQMQ 5GAN5 1ARKA 2DL3A 5GAN3 2QQ9A 2FRWA 2K3XA 3OW2A 1SPKA 3VS0A 2K5FA 1W2BA 3VRYA 4J9BA 4FT4A 3N5BB 3OYBA 5EC7A 8ATCB 1SRLA 1VQMA 1TG0A 4NL3A 1RADB 3EG9A 1YITQ 1OV3A 3OYCA 2V1RA 2DL8A 3A8MB 4ESRA 4R55A 3PT9A 3RKXA 1M27C 3FDRA 3KFVA 4ELZC 4AG2C 4IUPA 2NUPA 5A0DA 1M2OA 3FJPA 3CMAQ 1WDXA 1WGSA 2P84A 4OMPA 5DLOA 2KVQG 5GJVB 2EQIA 2XIDA 2EAYA 1ZBJA 2A28A 2F2VA 1C1AA 3UT1A 4EMKA 5CKBA 1H3HA 1RUWA 2BE9B 2CSIA 1BCOA 2KQWA 4LDUA 4MZMA 4HXJA 1OPKA 3DLMA 2CP3A 4FU6A 2WSEE 1VIEA 5FU6C 3V8KA 3JAME 3S3MA 2KT8A 1OU9A 1WIEA 3CMAA 3CCEQ 5IH2A 2QAZA 2OTJT 4RTTA 1RAFB 4OB0B 3GNFB 4RUGA 1WXUA 4NS5A 3L2UA 1RAGB 3CCVQ 3A5ZB 2CUBA 3MPUB 2F2WA 2J6FA 3A98A 4HA8A 1SSFA 4Y28E 1AT1B 1WHMA 3QWYA 3QDRB 2GNCA 2HL3A 4FSXA 2F69A 4HVUA 4C0ZA 2EVRA 5A0GA 4HCKA 3CCEA 1VQKQ 2B8AA 1UUEA 2ZPHB 5GAOn 4OVAA 4IUTA 5LJ3g 1M1KR 4E7IA 2P0PA 1K8AU 3CCVA 1I5LA 4EMKB 1VQ6A 1QKXA 5I2SA 3MEAA 5KYXA 1YWPA 1FYNA 2GQIA 2X9HA 1ZHIA 4OB2B 4Z02A 3L2VA 4HT9A 2FHDA 3H8ZA 1VQKA 2K79A 4MZPA 1B34A 1NYFA 2DE0X 2IIMA 5I22A 3PE0A 1YWOA 3G4SQ 3E2UA 1M8MA 1UHCA 3OB9A 1C6VX 3EH2A 1VIFA 2EKOA 4RTUA 5LJ3e 3CMET 1YJ9T 2ZPEB 2MYSA 1KC8C 4C8QG 2YXYA 2A36A 2CH4A 4IIOA 2H8HA 4BDZA 1K8AC 2CH4W 1PCXA 2XHCA 3RDVA 2M1HA 2KE9A 1QCOA 2XICA 2VGNA 3M0SA 1VYTA 1IB8A 3G4SA 1GCPA 2HZYA 2M9UA 4JJBA 4NL2A 4BY6B 4FL6A 4AFSC 1M90U 1IREB 2FYKA 2RNAA 4C0FA 1MNEA 1HSQA 2QA4Q 3CC4T 5LJ5f 1B34B 1P92A 3FLGA 2HKQB 2IVWA 3JB9D 1TUGB 2EW3A 2P4RA 1AZGB 2F1LA 3H0FA 2K4YA 4JJNK 3X28B 5FU6B 2O4XA 3OYJA 4JJDA 2YDLA 1YJWT 3CCJT 4C92E 1KD1R 1K76A 2DZ9A 1WFWA 2F5KA 2V1QA 5LJ5h 4J7FA 2QA4A 3R6OA 3META 4FYYB 1MMDA 4C92D 3JB9J 1I1JA 2K3BA 3HKSA 4PK4A 2WSCE 2KROA 2A37A 3EHQA 2GF7A 5D6WA 1M4ZA 1QVPA 2XDBA 1B07A 2JTFA 2Z0WA 5C6SA 4E7SA 1T0JA 1YI2T 2MOXA 2XD0A 2ZCFB 4BI8B 2LRQA 4D6WA 4J6YA 5DM7R 2QEXT 1GCQC 4JDSA 3R6NA 1KFZA 5GAOl 3QKJA 3QSUA 2KMTA 2ZZDA 4LE9A 2YHTA 1QW1A 3CXCS 1TUDA 1LCKA 1Y96B 4XTVA 3OMGA 3Q1JA 1K9MU 4JS5A 1Y71A 4PLIA 1JXOA 3QYHB 4AMCA 2O4XB 1V1CA 1TWBA 1SKUB 2HQHA 2DF6A 4HVWA 5GAOq 2DEUA 1SG5A 1JB0E 3V7SA 5HK3A 2GTOA 2ED1A 1M1FA 4KGXB 1QVFS 4QW2A 1WYXA 2E6NA 4M75A 4C92A 4OMOA 3MP1A 1TXQA 3TSWA 1ACMB 3RBBB 3RUXA 1T3SA 2NUTB 1HXDA 1G3TA 4A53A 3VRZA 2RK2A 3JSCA 2EPDA 3M59A 1AWWA 3L2QA 1I81A 4XU2A 2OTJQ 3MO8A 4XTYA 5FWCA 2FEIA 5CK9A 3RIRA 4FYXB 5CKFA 5GANf 2CKKA 3M0TA 2K9GA 1XOVA 2W0ZA 1GXIE 2VB6A 2DAQA 3C94A 3UPUA 2AK5A 5GAN7 1K1ZA 2O2OA 3JB9F 4LD6A 2OTJA 1FMVA 2JN0A 2Y4XA 4M7DA 3M9QA 2OX7A 3JCMV 4BB7A 4XTUA 4EDUA 2L3SA 4C92B 5GANh 1OZ3A 2V8IA 1W1FA 2QYZA 3EAEA 4C5HA 1X69A 3PIOA 4C92F 3CPFA 5GAN4 3VS3A 1J3TA 3D7SB 5ECAA 2EYYA 1N9RA 2D8JA 4E6RA 3EHRA 3TQ7P 1QMCA 2RHZA 4ZGDB 4J9GA 4LUEA 4N4HA 1BI1A 5L23A 2QDLA 1M90R 1UB4A 1VQLT 3OBYA 4J9EA 1BBZA 5HY6A 1YJ9Q 3CMEQ 2PNIA 3OYFA 2AZVA 3RESA 5FWBA 4FIBA 2RO0A 2IPOB 4XAXB 3VYGA 3SWNC 4Z89A 4M78A 1WNLA 2LTOA 2JMCA 2O01E 2C0TA 2CP6A 3REBB 4E7JA 2JMAA 1IHWA 1YJ9A 3CMEA 3QUIA 2DMOA 1UGSB 4E7LA 1N9SA 1WX6A 4MZTA 1KQSS 4OF1A 3BE3A 5LJ3j 2COYA 1JBMA 1PKSA 2RF0A 3LLRA 5IHIA 4E7HA 5IT9E 5CQYA 2HDAA 3CC4Q 4Q5WA 3S3NA 1ZSZC 5KH6A 1VYVA 2C0OA 2QQAA 4J9IA 1JRIA 3I55T 2J7IA 1RACB 3M53A 4M7AG 2EJGA 3HRTA 4M75G 1XJWB 4B9XA 1YJWQ 1QLYA 3CCJQ 3VKIA 1TSFA 3RKYA 4M77E 4M77C 4JUVA 1K9MR 2RN8A 3KUFA 3WXMB 3TU4K 4M77D 5LL6S 3VS4A 1VQ9T 3JB9I 1I4K1 1UG1A 2D8HA 1MHNA 3DB3A 2LVMA 2CUDA 4EMHA 2CDTA 1YJWA 2XU8A 3CCJA 2AT1B 1YI2Q 4HCCA 1XQHA 3OYNA 1NYGA 1XNIA 2E1HA 2MIOA 2QEXQ 2EYXA 2YSQA 3SFMA 1M1KU 2YUOA 1SHGA 2I0NA 3SHWA 4KGVB 2DD4A 4PJOE 4PJOC 1ZUKA 1KK7A 2DNUA 3CD6T 4M7DG 4PJOD 1M2VA 2KT1A 2PZ1A 2VASA 5CIUA 2DVJA 3EFRA 1OOTA 5LJ5g 1KQ1A 3SDZA 1YI2A 3A8LB 1M30A 1JJ2P 3QXEB 5KYYB 2LNVA 1FXXA 4PKCC 4NOYA 2QEXA 2K2MA 4JRPA 3QJ6A 4A4EA 4C8QE 3X24B 4C8QC 2HBPA 4ZGEB 2EGEA 3MHXA 1R0CB 4PJJA 2VXEA 1WQ7A 2X4YA 2FVUA 2M02A 3HTRA 5AT1B 3JCMf 5LJ3d 3PNWC 1NLOC 1ZA1B 4ZNXA 3CCUT 1M1KC 3SWNB 5D6YA 4FYVB 2E64A 2EJFA 4XQ3A 4BI4A 2FB7A 2KRNA 3CBOA 4PL6A 2X4JA 1PKTA 1UEBA 1B3QA 5LJ5e 1W70A 3UWNA 3OY9A 2FPDA 3OYHA 3RR6A 3M0QA 3JCMh 4M78G 1VQ5T 3CPWS 2GFUA 2J05A 2EGAA 4BE2A 5FRMA 5KYNA 3E1SA 2ZGWA 1ZSZB 1NE8A 2DTOA 3ZL7C 2O31A 2EQMA 2LCLA 3EG2A 4IURA 5KCHA 1RAAB 1VQ8T 1S72T 1PNJA 4Y91A 4QQGA 2J6KA 3TCJA 3CCLT 3I56T 3OYDA 5A0LA 2VVKA 1B7TA 4F04B 2KEAA 2K5IA 2IG0A 1X2QA 4FCYA 3QDFA 2DBKA 4M77B 1KD1U 4FW2A 2EYZA 2LMJA 3HP9A 2JW4A 3CC7T 1N5ZA 3BDUA 4C5GA 2RQUA 5FLXE 4M77F 2RPNA 2DVEA 1RLPC 3CCMA 4C0DB 2K6DA 1PD1A 2LX7A 4OGEA 2E3IA 4N0AA 3HSBA 2BZ8A 3L42A 1WA7A 1HYOA 4LDVA 4BDYA 1VQ7T 1VQLQ 2EYWA 4CC2A 2RI2A 4GLMA 2QQSA 3KXTA 4PJOB 2H3JA 1TUCA 1YITA 3QG1A 5GANg 3ULRB 1NM7A 3GOXA 2J06A 5GJWB 4PJOF 2LNHB 1KD1C 2DRKA 1VQLA 2COZA 2KY9A 1CKBA 4JZ3A 3LYIA 4ANJA 4PLLA 5GMKl 3LWIA 2VGMA 2FZCB 2RJDA 1PWTA 2V8KA 4C8QB 2FPFA 1QVGS 4JLGA 3C0CA 1H8KA 1MGQA 2MWPA 3VS2A 2QK0A 3F70A 2RJCA 2RQWA 4J9FA 4EIKA 1YFNA 1X01A 3OYAA 1T0HA 1QP3A 1NLPC 1IGQA 3CCRT 1TOVA 1K0SA 5D7UA 1D3BB 3EGXA 4QQDA 3I55Q 1AZEA 2MCNA 4KUIA 4OP0A 2KYMA 1G83A 2DYBA 2DO3A 5GANe 1FWZA 3LGFA 4ZTFA 1OX9A 3OMCA 1NPRA 4CRIA 2JS2A 4CC3A 4A4FA 1WI7A 3GNGA 1MUZA 1WQWA 1VQ9Q 3I55A 3I5SA 3QPHA 1EZZB 1N6AA 3OS2A 3KBGA 3QHSA 2OTLT 1SF9A 5FU7C 3UA6A 3OYMA 2L3QA 2L89A 2LJ1A 1HJDA 9ATCB 2XG8D 4FW1A 3E19A 5CCAA 3JB9H 2O88A 1GL5A 1VQ9A 2EYQA 1WJQA 3CD6Q 2DIQA 1NJIU 3EGXB 1JO8A 3G71T 1VUBA 2EJ9A 3V7CA 2OAWA 1ZUUA 2C0IA 3UATA 3CXCP 1UE9A 2Y90A 4N4GA 1EX4A 2SEMA 3CD6A 3M57A 2YWWA 1LNXA 1K4US 1ZQ1A 4XK8E 4II1A 1VQPT 2WACA 2YUNA 4X9CA 2LJ3A 3AHUA 2EGCA 3CCUQ 3M54A 4FSSA 1QVFP 1Y96A 1OPLA 2QTXA 3FC3A 2EWNA 2L2PA 1Q81U 2E4HA 4B9WA 4BE0A 3O5ZA 2JZ2A 4V2SA 2ZPBB 1VQ5Q 2DXBA 1NEGA 1KHIA 3VU3C 3PFSA 2DYIA 3OQ5A 3M58A 2HSPA 1YBYA 5J39A 2KBTA 4PJMA 2DM1A 3T9NA 2PTKA 2RH2A 1YJNQ 4EMGA 3V7RA 4OMNA 3JRZA 4M7AE 4M7AC 1VQ8Q 1NBEB 1S72Q 2ZPFB 1M90C 1I0CA 4M75C 3JCMJ 4M7AD 4RTZA 2NUTA 1UHFA 4ME7A 3CCLQ 3I56Q 1VQ5A 3C95A 5GAMf 5LJ5j 4IUQA 3HFNA 4MDXA 3NGPA 1NG2A 3H9NA 2COWA 4WCIA 4Y92A 5IXBA 1QCFA 4X1VA 3OS0A 4OGCA 1YJNA 1K9AA 1UFFA 1S72A 5GMKh 3CC7Q 2DXTA 4J83A 5GAOm 1ABQA 3OW2S 2LDMA 1G5VA 5AYFA 3JCMg 2V8JA 5GAMh 4J5YA 3I56A 1W2BS 4X34A 3EH1A 4BI3A 1GFDA 2ZPIB 1GFCA 1BYMA 4IUUA 5GAOr 1VQ7Q 4QQ6A 3IQLA 2KGTA 3HRUA 1U1TA 1K73R 4JRKA 1BIBA 3HRSA 2R5AA 3CC7A 2AZSA 4MMLA 3LWHA 1WJSA 1LJOA 4HCBA 1RAEB 4GY5A 2KRSA 4J9DA 3M0RA 1UECA 2FG0A 2NWMA 1RI0A 1IO6A 1Y0MA 2DEQA 1QWFA 3GP8A 1WHGA 5J26A 4MMKA 3QZ5B 2HQEA 4L5GA 3QYGB 4C5IA 3JCMe 1K9MC 1UGVA 2DK3A 4F17A 5CKEA 3OYIA 2X4WA 1QCNA 4OMFB 1Q86U 3OYEA 1AOJA 3EGUA 1JQQA 4FT2A 1GCQA 4F7UE 2R58A 3RNJA 4WTOB 4A63B 4BE1A 3FIFA 1BU1A 2MF2A 3C12A 3RKWA 1KQSP 3E9FA 3CCRQ 3X20B 3OYYA 2JM9A 3FRNA 2KXCA 4PJNA 1WLPB 2LJ0A 4LNPA 2L0AA 2QG9B 2KSSA 1IHVA 1G8XA 1OX8A 4P5NA 1YIJT 5FW9A 5LJ5d 4XTZA 1N8RU 2DERA 1NJIR 2DJZA 1NEBA 3GBQA 4FYWB 5CKHA 3CC2T 2X3XD 5GAOp 3M5AA 5HKCA 1X75C 4DOVA 3CCRA 1JJ2A 2D0QB 5I2MA 3QZ9B 4E7ZA 1OI1A 2SRCA 1MMGA 4M7AB 4XTXA 1WXTA 1Q7YU 4JS4A 2OTLQ 1Z9QA 4HKEA 5I11A 1X27A 2OI3A 4KRTA 1JEGA 4L59A 2CZ6B 5GANj 4M7AF 2A08A 2A3LA 2AKKA 2R5MA 5FRNA 5C0MA 3SB2A 1RL2A 4LXCA 2CZ0B 2D1XA 3C4SA 4IIMA 2ABLA 2KI7A 2XK0A 1BKBA 3G71Q 2CS7A 1Q81R 4RTWA 2OTLA 1MMNA 2G6FX 1PRLC 3BDLA 3VUBA 3I35A 2PVOB 3PTAA 1OYXA 1YN8A 2KR3A 5KYWB 4DBHA 3NPFA 1Y07A 1M1GA 2JXBA 2EBPA 4KGZB 3JB9G 1EFNA 1U1SA 1RLQC 2LQNA 5FROA 2KDSA 3G71A 4JPBW 1RI9A 3JCMP 1VQPQ 1TTHB 1R8OB 4LDYA 4QKUA 5EG2A 1IRXA 2QASA 2DETA 1M8VA 1BIAA 1SRMA 3OYGA 2DX1A 2RI5A 2LQWA 4C92G 4RMOA 5KYYA 2BZYA 2W10A 4AFUC 1VQ6T 3ZBDA 1HD3A 3CC4A 4Z8AA 3EFOA 1VQPA 4YTLA 1ZSGA 1U5SA 3PMTA 3DLLA 2BKDN 3HFOA 1CKAA 1PD0A 1G3WA 4F7UB 1T3LA 2CT3A 3CPWP 2L3PA 3V8LA 2K7AA 5KYUB 1D09B 1I8FA 3BW1A 4ZTJA 3SWNA 4QVCA 4F7UF 5HCKA 2FL7A 4MDWA 2CSQA 3LW5E 5CKDA 3S6WA 2DL4A 5GANd 3X25B 2RHYA 2E5QA 3TEEA 4D8DA 4ZGJB 3PVQA 1TS9A 1WHLA 4PNOA 4Z88A 4RCBA 3P8DA 2HL5C 4J9CA 5CVIA 5IN1A 1ZSZA 4IUVA 4F14A 4JLIA 2GGRA 3GLXA 1F1BB 3EFOB 1UJYA 1Q86R 1GRIA 5CAIA 1X2KA 4O6JA 5DLQE 3HL8A 2B86A 4C8QD 1NPPA 3REAB 2KXDA 1AWOA 4M77A 2L5QA 2BE7D 1Q82R 3NFCA 1BI0A 4N4IA 3CCQT 2OJ2A 2G3RA 3HHTB 1OQKA 2DL7A 3H6ZA 1AWJA 2P4TA 5M9OA 1UGRB 1N8RR 1IZ6A 2JUFA 2XI9A 1LOJA 1UJ0A 1OZ2A 5GMKi 2X35A 5GAMg 3NTHA 2RD1A 2DFUA 1D1BA 2GCXA 1KSWA 2MMPA 4LN2A 3EG1A 3MKDA 4PJOA 1Q7YR 2PVGB 4DBFA 1BI2A 2QGGA 4OB1B 1BCMA 4CC7A 4DBRA 1QVGP 1CSKA 2LT4A 2BIVA 4EMKC 2BTTA 3A1PA 3S3OA 2MAMA 1TU0B 1JU5C 2EFIA 1D0ZA 5CO7A 2LP5A 3M0PA 2VXFA 1YIJQ 3HPWA 5GMKe 1K0XA 4C0GA 3CC2Q 4C8QA 5DY9A 1AEYA 2CREA 2AKLA 1V29B 2MWOA 1OULA 3FEOA 5GAMe 2RHIA 3CXCA 3A8OB 2CZ7B 2NLUA 2VUBA 2YUPA 3M55A 2P0QA 1QKWA 4LD9K 2HBWA 2KAFA 1I5OB 5IHNA 1O75A 4LDXA 1JJ2S 2J6OA 2CP2A 3JCMX 1D3BA 1YIJA 1D0XA 3OBWA 4PFOA 1X6GA 2CYZB 2DKGA 3CC2A 4F16A 1FMKA 2DTIA 2JJ9A 2MPXC 2PVDB 3GPLA 4J7IA 1QVFA 2X51A 1YP5A 2JTEA 3JCMc 1O9SA 3G6ET 4PFPA 4BY6C 2L8DA 4KULA 8AT1B 2H3EB 3QO3A 3EGDA 2YLBA 3FJ5A 2DD5A 2M0YA 1H92A 1U06A 1AD5A 3MEUA 2XDPA 4GLKA 1WHHA 1A0NB 3MCAB 5GMKm 2LCCA 2M0OA 3BY7A 1K73U 2ZAEA 4C8QF 3QBYA 3L1AA 1OEBA 1LPLA 1KG1A 2RMOA 5GAN2 2X4XA 2EQKA 3O8VA 3TREA 2M51A 1YCSB 2EQJA 4M77G 4A4GA 1VQ6Q 2E41A 2ED0A 2X3WD 3EG9B 3J81E 3JCMd 2VV5A 2DTHA 1WJRA 3X26B 1EIFA 1N27A 1VQ4T 2M16A 4HT8A 1KC8U 2NUPB 1R0BG 3EGDB 2RQTA 3MJXA 2BUDA 4J6XA 3OSSC 2CT4A 1K73C 4AFZC 4BUGA 4L6V5 1VQOT 2HMAA 2FPEA 1AHJB 4PJOG 3LH0A 2R57A 3UDCA 4RG2A 4R56A 2GQVA 2E70A 4XU0A 1E7OA 2WSFE 2XDDA 2KRMA 2Y4YA 2DJQA 4DOWA 1WPYA 3OA6A 4LDWA 4RKUE 1I07A 4IKFA 2NUZA 2QXFA 2LQKA 1LVKA 5CQXA 3GIBA 3OW2P 1X43A 1X6OA 2KYBA 4JJCA 2PUOB 2YRCA 3CBPA 2JOYA 1W2BP 3NTIA 1UTIA 1QP2A 3P8BB 1KQSA 1ZBXA 3VS7A 2E65A 2QGFB 2MI6A 1G3SA 1RAHB 4CI0C 1NZ9A 4A4HA 3CCQQ 1R77A 2L3RA 1M3BA 3CCST 1QWEA 5KYXB 3VS1A 5IXFA 3V8JA 1Y7XA 4PJLA 4C5EA 2XKOC 1NJIC 2ESWA 3EG0A 2JS0A 4X9DA 2DRMA 2E12A 4OMLA 1G2BA 2FO0A 2E6ZA 2RHXA 4QVDA 3CCUA 3CCQA 2HQXA 1M3CA 2CP7A 2LX9A 4J6WA 1MV0B 2EQUA 1PSEA 4M75E 2P0KA 4C92C 4XTWA 1D1CA 4HVVA 4LUDA 4A54A 3M4YA 4E2FB 4FM4B 4M75D 1Z9ZA 3EG3A 5HK0A 1VQNT 4R0KA 4QVZA 3LX7A 2KNBB 1Q81C 3VV0A 3JCMQ 1VQ8A 2QQRA 1Y57A 3ME9A 3H0HA 2RQRA 4UC4A 2A0FB 3CCLA 1HK9A 2E3HA 2ROTA 1H3ZA 3H0IA 1M3AA 7AT1B 1YHQT 3M56A 5FU7B 2HSEB 4PFZA 3DKMA 4ATOA 2YRDA 1VYUA 1DJ7B 3GF5A 4M7DE 4M7DC 1KHCA 3JCMW 3WVEB 3VS6A 3PVLA 5GMKj 4OB3B 1YCYA 4M7DD 3SEMA 2AIRB 3G6EQ 3BFMA 5GAMj 4RCCA 1UGPB 1VQ7A 4AFQC 4M7AA 2FRYA 4AT1B 1D1AA 2EKHA 1ABOA 2ECZA 2ROLA 2E10A 1WHJA 1KC8R 2O9SA 2RJFA 3RERA 1BI3A 4M4ZA 4E7KA 2D0NA 3CPWA 3G6EA 1K8AR 5KCOA 4KH1B 5A2QE 4B6MA 2O9VA 4ELYC 3OYLA 2RI3A 2DBMA 3U23A 3OS1A 4JRIA 2HNIA 3UF4A 1IXDA 2JT4A 1Q82U 2ATCB 4M78E 4M78C 2GBQA 3LGLA 3FB9A 2V26A 4M78D 5KYWA 1OU8A 2HCKA 2JTMA 4KH0B 5J3BA 4VUBA 3ASKA 3MEVA 1VQ4Q 2RM4A 1VA7A 2I2LA 4OMMA 1VQMT 3CCMT 2GFAA 4KUDK 6AT1B 1Q86C 4D8KA 4RTXA 4M75B 2VKNA 2RB6A 4GBQA 4BD3A 2DXUA 3P8HA 1VQOQ 3QWXX 2JVVA 2LQ8A 4M75F 1VQ4A 1W4SA 2JNGA 4DEYA 3SD4A 5LJ3f 3VS5A 1Q82C 3EFSA 2LZ6B 3G7ZA 2K2VA 3JV3A 1W6XA 1YITT 2PUKB 1WXBA 1MMAA 2LT1A 3I5RA 1PC0A 2D6FA 1JXMA 1PSFA 3E9GA 1N8RC 1VQOA 3CMAT 3UA7A 4F7UA 5GAN6 5GAMd 4QT7A 1VOMA 3G1JA 2DL5A 1SSHA 2C06A 5LJ3h 3NHNA 1D0YA 1PRMC 5KYUA 3THKA 1KQ2A 4ZN1A 2BZXA 2VWFA 4RTVA 3OYKA 1U8RA 1ZLMA 2LCSA 2A7YA 4K11A 4DA4A 1Q7YC 4M7DB 2HKNA 1QVGA 5KE2A 1H641 2RA2A 3WVDB 2RHUA 3J7AF 1FMWA 3MP6A 1PM3A 3CCET 3TVTA 3OS5A 1QQJA 4M7DF 5IAYA 3CCSQ 2QQBA 3CCVT 3QIIA 4DQ2A 3NMZC 3QJYA 1G3YA 5IHKA 2CP5A 2QTVA 2K3YA 2LC4A 3M0UA 4TVRA 3ZEHA 3L2RA 4J8OA 1VQKT 1PHTA 1IGUA 2HAXA 3CCSA 4ORZA 2NYSA 1BK2A 2E5KA 3TSZA 4A4KA 3L2WA 3A8HB 4AG1C 3CBMA 1WZOA 2DIGA 1V76A 3RMSA 4M78B 3I9QA 1MNDA 2RK1A 2K57A 1U3OA 1S1NA 1VQNQ 5D6XA 4RG8A 2F5TX 2F2XA
chains in the Genus database with same CATH topology
4II1A 1XOVA 1VQPT 1GXIE 2WACA 2DAQA 3C94A 4C0DC 4X9CA 2KK4A 1QVFA 3UPUA 4M78F 5GAN7 2VYTA 3JCMc 3A8GB 4WF2A 3AHUA 1O9SA 2OAUA 3M54A 3G6ET 3JB9F 1Y96A 4O5VA 4BY6C 4LD6A 3JCMb 2QTXA 3FC3A 3G4ST 2OTJA 2EWNA 2JN0A 2AHJB 2Y4XA 4M7DA 3M9QA 2L8DA 1Q81U 3DB4A 4KULA 3JCMV 4B9WA 4BB7A 4BE0A 3QO3A 4HCZA 2JZ2A 4XTUA 4V2SA 4EDUA 2DPPB 2YLBA 3URGA 4C92B 5GANh 1OZ3A 2DD5A 1FX7A 2ZPBB 1VQNA 2V8IA 2DXBA 3MEUA 1KHIA 3ER0A 3VU3C 2XDPA 3PFSA 3OQ5A 4GLKA 3M58A 3ZFJA 3EAEA 4C5HA 3PIOA 1YBYA 4C92F 5J39A 3INZA 2K5LA 3MCAB 5GMKm 2RJEA 3CPFA 5GAN4 2LCCA 4E47A 3PIPA 2M0OA 4EPCA 3BY7A 2CZ1B 3T9NA 2RH2A 1K73U 4EMGA 1M9SA 3V7RA 3JRZA 4C8QF 4M7AE 4M7AC 3QBYA 3L1AA 1N9RA 2ZPFB 2PQWA 4M75C 4XU3A 1M90C 2VC8A 3PMIA 2QDYB 4ZGDB 2RHZA 5GAN2 1YHQA 1KG1A 3JCMJ 2ZPGB 1UGQB 4N4HA 4M7AD 1BI1A 3PGGA 2X4XA 4ME7A 2EQKA 1UB4A 3O8VA 1VQLT 1VQ5A 3MP8A 3TREA 3C95A 3OBYA 5GAMf 5LJ5j 2EQJA 4IUQA 3HFNA 4MDXA 4M77G 1M5Q1 5HY6A 4A4GA 5L8RE 2QA4T 2E41A 3OYFA 1XTDA 3OS0A 3J81E 3RESA 4OGCA 4FIBA 1YJNA 3JCMd 2VV5A 2DTHA 4N0AC 1WJRA 3X26B 1EIFA 2RO0A 1N27A 1VQ4T 2M16A 4XAXB 3VYGA 5GMKh 1S72A 3SWNC 4HT8A 1KC8U 4M78A 4F7UG 2DXCA 2DXTA 4J83A 5GAOm 3OW2S 1WNLA 2LTOA 2LDMA 1G5VA 2O01E 5AYFA 3JCMg 2V8JA 5GAMh 4J5YA 2QI2A 2DZCA 2EIFA 5I21A 4X34A 3I56A 1W2BS 4BACA 4E7JA 5GAN8 2YRVA 2BUDA 4BI3A 4J6XA 3OSSC 3CMEA 1YJ9A 3QUIA 1UGSB 2ZPIB 4E7LA 1N9SA 2CGHA 3VJPA 3VUZA 1K73C 1BYMA 4BUGA 4L6V5 1VQOT 4MZTA 4IUUA 5GAOr 1KQSS 4QQ6A 4ZN3A 1AHJB 3NTKA 4OF1A 3HRUA 4KBMB 5LJ3j 1U1TA 4PJOG 1JBMA 3LH0A 2R57A 3OSVA 4JRKA 3UDCA 3RMQA 1BIBA 3HRSA 2R5AA 4XU1A 3LLRA 3CC7A 4RG2A 3J80E 4MMLA 5CQYA 2YLCA 4E7HA 5IT9E 4Q5WA 3LWHA 3MEWA 4JRQA 1WJSA 3S3NA 1YJNT 1LJOA 4R56A 4HCBA 2GQVA 2E70A 4XU0A 4GY5A 3VYHB 5KH6A 5CR2A 2WSFE 2QQAA 5KE3A 2XDDA 1TH7A 1JRIA 1RI0A 2D9TA 2Y4YA 2PU9B 3I55T 3M4GA 4DOWA 4M7AG 1WPYA 2DEQA 3L2ZA 3CEYA 3M53A 4KT0E 2HD0A 4LDWA 2EJGA 4RKUE 4MMKA 3HRTA 5J26A 5GAN5 4M75G 4IKFA 3QZ5B 5GAN3 2QQ9A 2HQEA 2QXFA 2LQKA 4B9XA 2K3XA 4L5GA 3OW2A 3QYGB 5CQXA 4C5IA 3GIBA 3VKIA 3JCMe 1K9MC 2DK3A 3RKYA 4M77E 5CKEA 4M77C 3OYIA 2K5FA 1W2BA 2X4WA 1X6OA 4JUVA 4OMFB 3KUFA 4FT4A 3WXMB 2PUOB 3TU4K 3OYEA 1Q86U 3CBPA 2JOYA 3N5BB 4M77D 5LL6S 3OYBA 3NTIA 1QP2A 4FT2A 3P8BB 1VQ9T 1KQSA 4F7UE 2R58A 1ZBXA 3JB9I 2E65A 3FIFA 4BE1A 1VQMA 1I4K1 2MI6A 4NL3A 2MF2A 3C12A 1MHNA 1G3SA 3DB3A 3E9FA 2LVMA 3RKWA 3OYCA 4EMHA 3A8MB 3X20B 3OYYA 1NZ9A 4CI0C 4R55A 1YJWA 4A4HA 2XU8A 3CCJA 2L3RA 3PT9A 3RKXA 3FRNA 3CCST 4HCCA 3FDRA 1XQHA 4ELZC 5A0DA 4IUPA 3OYNA 1XNIA 2E1HA 3FJPA 3V8JA 1Y7XA 3SFMA 1M1KU 1WGSA 4C5EA 5DLOA 2XKOC 2KVQG 1NJIC 2DD4A 2KSSA 4PJOE 4PJOC 2XIDA 2EAYA 4P5NA 4X9DA 1YIJT 3UT1A 5LJ5d 1N8RU 4XTZA 5CKBA 4EMKA 2DJZA 2E12A 3CD6T 5CKHA 3CC2T 5GAOp 4M7DG 4PJOD 2KQWA 4LDUA 5CIUA 4MZMA 3M5AA 5HKCA 1X75C 2E6ZA 4DOVA 3CCRA 2RHXA 3DLMA 4QVDA 3CCUA 3EFRA 4FU6A 1JJ2A 3CCQA 2WSEE 1VIEA 2D0QB 2HQXA 5FU6C 1KQ1A 3QZ9B 5I2MA 3SDZA 5LJ5g 3V8KA 1YI2A 1OI1A 2LX9A 3JAME 3S3MA 4J6WA 3A8LB 2EQUA 3QXEB 4M7AB 2LNVA 4XTXA 1FXXA 4PKCC 1PSEA 4NOYA 2QEXA 4M75E 3CMAA 2P0KA 4C92C 4XTWA 4JRPA 1Q7YU 3QJ6A 4JS4A 4A4EA 4HKEA 2OTJT 4A54A 3M4YA 4OB0B 4L59A 4C8QE 4FM4B 3X24B 3GNFB 2HBPA 4M75D 2CZ6B 4C8QC 4ZGEB 3MHXA 3L2UA 4NS5A 5GANj 4M7AF 3A5ZB 2A3LA 2VXEA 2R5MA 4HA8A 5FRNA 5C0MA 1SSFA 4Y28E 3SB2A 1WQ7A 5HK0A 1RL2A 2X4YA 1VQNT 2CZ0B 4QVZA 3QDRB 3GPLA 2FVUA 3LX7A 4FSXA 2F69A 3JCMf 5LJ3d 4C0ZA 3C4SA 3PNWC 5A0GA 1Q81C 3VV0A 3JCMQ 1VQ8A 3CCUT 1M1KC 3SWNB 3CCEA 2XK0A 2B8AA 1BKBA 2E64A 2QQRA 2ZPHB 5D6YA 5GAOn 2CS7A 2OTLA 2EJFA 4OVAA 4IUTA 4XQ3A 5LJ3g 4BI4A 2FB7A 3BDLA 3CBOA 4PL6A 2X4JA 3ME9A 4E7IA 4UC4A 2P0PA 3VUBA 2PVOB 1K8AU 1HK9A 1UEBA 3CCLA 3PTAA 3CCVA 1YHQT 1I5LA 1H3ZA 1OYXA 3M56A 5LJ5e 3UWNA 3OY9A 3OYHA 1Y07A 5FU7B 1M1GA 4EMKB 1VQ6A 3JCMh 4M78G 5I2SA 3DKMA 1VQ5T 3CPWS 2GFUA 4ATOA 3MEAA 3JB9G 1DJ7B 1U1SA 1ZHIA 4OB2B 4Z02A 3L2VA 4BE2A 5FROA 2KDSA 5FRMA 4HT9A 2FHDA 3GF5A 4M7DE 3H8ZA 4M7DC 1VQKA 3E1SA 1KHCA 2ZGWA 3WVEB 3G71A 1NE8A 2DTOA 3JCMW 3JCMP 5GMKj 1R8OB 2EQMA 2LCLA 4IURA 4MZPA 1B34A 4OB3B 5KCHA 1VQ8T 4LDYA 1S72T 1YCYA 5EG2A 4M7DD 4Y91A 1M8VA 1BIAA 3BFMA 5GAMj 4QQGA 4RCCA 3TCJA 3CCLT 3OYGA 3I56T 3OYDA 5A0LA 2RI5A 3OB9A 1UGPB 4C92G 4RMOA 1VQ7A 1VIFA 2EKOA 2K5IA 2IG0A 4M7AA 1YJ9T 5LJ3e 3CMET 2ZPEB 1VQ6T 1KC8C 4C8QG 3ZBDA 4M77B 1KD1U 2E10A 3CC4A 3HP9A 1VQPA 4YTLA 3GP8A 4BDZA 1K8AC 2XHCA 3PMTA 3DLLA 2BKDN 2M1HA 2RJFA 1BI3A 3CC7T 2XICA 2VGNA 4E7KA 3RERA 3CPWA 3BDUA 3G6EA 3HFOA 4C5GA 5FLXE 5KCOA 4M77F 1G3WA 4F7UB 5A2QE 2DVEA 3G4SA 4ELYC 3CCMA 4C0DB 3OYLA 2RI3A 3V8LA 4OGEA 3OS1A 4JRIA 4N0AA 2HNIA 3HSBA 2M9UA 3L42A 1I8FA 4NL2A 3BW1A 4ZTJA 3SWNA 4BY6B 4QVCA 1Q82U 4FL6A 4F7UF 4LDVA 4BDYA 1VQ7T 4M78E 2FL7A 4M78C 2RI2A 1M90U 1IREB 2FYKA 2QQSA 3LGLA 4MDWA 4C0FA 3FB9A 3LW5E 3KXTA 5CKDA 3CC4T 3S6WA 4M78D 5LJ5f 5GANd 4PJOB 1P92A 1B34B 3X25B 3FLGA 2RHYA 2JTMA 5J3BA 2E5QA 2IVWA 4VUBA 3JB9D 3ASKA 3MEVA 2H3JA 3TEEA 2RM4A 4ZGJB 1YITA 2K4YA 3QG1A 4J7IA 4JJNK 5GANg 2I2LA 3GOXA 4PJOF 3X28B 4PNOA 1VQMT 5FU6B 4RCBA 3P8DA 3CCMT 1KD1C 2GFAA 4KUDK 2O4XA 3OYJA 5CVIA 5IN1A 1VQLA 4IUVA 1YJWT 1Q86C 2KY9A 3CCJT 3LYIA 4JLIA 4M75B 2DZ9A 2RB6A 4PLLA 4C92E 3GLXA 5GMKl 3LWIA 2F5KA 2VGMA 5LJ5h 4J7FA 2QA4A 4BD3A 2RJDA 2DXUA 3META 3P8HA 2V8KA 3R6OA 4O6JA 4C8QB 5CAIA 4C92D 3JB9J 1QVGS 5DLQE 4JLGA 2JVVA 3OA6A 1MGQA 2MWPA 3HL8A 2LQ8A 4M75F 1VQ4A 1W4SA 3F70A 2JNGA 4C8QD 3HKSA 1NPPA 2RJCA 3SD4A 2WSCE 5LJ3f 1X01A 3OYAA 1Q82C 3EFSA 3G7ZA 2K2VA 2GF7A 1QP3A 5D6WA 4M77A 2L5QA 1YITT 2PUKB 1M4ZA 1QVPA 2XDBA 3CCRT 2JTFA 2LT1A 3NFCA 5C6SA 1BI0A 4N4IA 3CCQT 1D3BB 1YI2T 4QQDA 2G3RA 2ZCFB 3HHTB 4BI8B 2D6FA 2LRQA 4KUIA 1PSFA 2XD0A 4D6WA 4OP0A 4J6YA 3E9GA 1N8RC 5DM7R 2QEXT 1VQOA 3CMAT 3H6ZA 2DO3A 5GAN6 4F7UA 5GANe 5GAMd 1FWZA 4JDSA 2P4TA 5M9OA 1UGRB 3LGFA 5GAOl 3QKJA 2C06A 4ZTFA 1IZ6A 5LJ3h 2KMTA 2JUFA 2ZZDA 3QSUA 2XI9A 1LOJA 3OMCA 1NPRA 4CRIA 1OZ2A 2YHTA 1QW1A 1KQ2A 5GMKi 2X35A 4ZN1A 5GAMg 3NTHA 3CXCS 2RD1A 4A4FA 1Y96B 4XTVA 3OMGA 3Q1JA 3OYKA 3GNGA 4JS5A 1U8RA 2GCXA 1K9MU 1Y71A 4PLIA 2A7YA 1WQWA 3QYHB 4DA4A 1Q7YC 4M7DB 2O4XB 1QVGA 3I55A 2MMPA 5KE2A 1H641 3QPHA 2RA2A 1N6AA 4PJOA 3OS2A 3WVDB 2PVGB 1BI2A 2RHUA 3KBGA 4OB1B 3MP6A 3J7AF 3CCET 5GAOq 3QHSA 2LT4A 2OTLT 3OS5A 5FU7C 2BIVA 4EMKC 1JB0E 4M7DF 5IAYA 3OYMA 3S3OA 2L89A 3V7SA 5HK3A 2QQBA 2MAMA 1M1FA 2EFIA 2XG8D 3CCVT 5CO7A 3QIIA 4DQ2A 1QVFS 3E19A 3QJYA 1G3YA 4QW2A 5CCAA 2E6NA 3JB9H 4M75A 4C92A 3MP1A 2EYQA 2VXFA 1VQ9A 2K3YA 3HPWA 5GMKe 1WJQA 2LC4A 4C0GA 4C8QA 4TVRA 2DIQA 5DY9A 3RUXA 3ZEHA 3L2RA 1NJIU 4J8OA 1VQKT 1HXDA 1G3TA 1V29B 2MWOA 3G71T 1VUBA 2EJ9A 3FEOA 3V7CA 4A53A 5GAMe 2HAXA 2RHIA 3CXCA 3CCSA 3A8OB 2CZ7B 2RK2A 2NLUA 2VUBA 3JSCA 3M59A 3M55A 2P0QA 4LD9K 3L2QA 2KAFA 1I81A 4A4KA 3L2WA 4XU2A 2Y90A 4N4GA 1O75A 4LDXA 1JJ2S 3A8HB 3MO8A 4XTYA 3CBMA 3JCMX 1D3BA 2DIGA 1YIJA 3RMSA 5CK9A 4M78B 3OBWA 2RK1A 2CYZB 2DKGA 3CC2A 3CD6A 3RIRA 3M57A 2K57A 5CKFA 2DTIA 1LNXA 2CKKA 5GANf 2PVDB 5D6XA 1ZQ1A 4RG8A 2F5TX 4XK8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OYX A;  4II1 A;  3UWN A;  3OY9 A;  2WAC A;  2DAQ A;  3OYH A;  3OA6 A;  2MWP A;  3CEY A;  5J26 A;  4IKF A;  2VYT A;  3F70 A;  2HQE A;  2GFU A;  2RJC A;  3SD4 A;  4B9X A;  3MEA A;  2K3X A;  3OYA A;  4C5I A;  4LD6 A;  2GF7 A;  3FC3 A;  3L2V A;  5D6W A;  4Z02 A;  4BE2 A;  5FRM A;  5FRO A;  2FHD A;  3M9Q A;  2L8D A;  3OYI A;  3DB4 A;  3H8Z A;  2JTF A;  4B9W A;  2X4W A;  4BE0 A;  4HCZ A;  1KHC A;  2JZ2 A;  4N4I A;  5C6S A;  3KUF A;  4EDU A;  4QQD A;  3OYE A;  2EQM A;  1OZ3 A;  4IUR A;  2G3R A;  5KCH A;  3OYB A;  2LRQ A;  3NTI A;  3E9G A;  3MEU A;  3H6Z A;  2XDP A;  3PFS A;  2R58 A;  3OQ5 A;  4QQG A;  5M9O A;  4BE1 A;  3EAE A;  3LGF A;  4C5H A;  3QKJ A;  3OYG A;  4ZTF A;  5J39 A;  3OYD A;  1MHN A;  3DB3 A;  2RI5 A;  2LVM A;  3E9F A;  3OB9 A;  2RJE A;  3OYC A;  3OMC A;  2LCC A;  2EKO A;  2M0O A;  1OZ2 A;  4A4H A;  4CRI A;  2IG0 A;  2L3R A;  2X35 A;  3NTH A;  4A4F A;  3FDR A;  3OMG A;  3Q1J A;  3QBY A;  4IUP A;  3OYK A;  4PLI A;  2PQW A;  1XNI A;  3OYN A;  3PMI A;  2O4X B;  2RHZ A;  1WGS A;  5KE2 A;  4N4H A;  4C5E A;  4BDZ A;  3PMT A;  2X4X A;  3OS2 A;  2EQK A;  2BKD N;  2M1H A;  2RJF A;  3O8V A;  2RHU A;  4E7K A;  3MP6 A;  3MP8 A;  3UT1 A;  4C5G A;  5KCO A;  2EQJ A;  4IUQ A;  2BIV A;  5IAY A;  4A4G A;  3OYM A;  3S3O A;  2L89 A;  3OYL A;  5CIU A;  2RI3 A;  3OYF A;  2EFI A;  2RHX A;  3DLM A;  3OS0 A;  3OS1 A;  4FU6 A;  2HQX A;  3L42 A;  3QII A;  1WJR A;  1OI1 A;  3S3M A;  2RO0 A;  1N27 A;  4QW2 A;  4ZTJ A;  2E6N A;  2EQU A;  2M16 A;  4FL6 A;  4BDY A;  3MP1 A;  2P0K A;  2RI2 A;  2K3Y A;  3QJ6 A;  3LGL A;  2QQS A;  2LTO A;  2LDM A;  4A4E A;  1G5V A;  1WJQ A;  2DIQ A;  4L59 A;  3ZEH A;  3L2R A;  4X34 A;  3S6W A;  4BAC A;  4E7J A;  2YRV A;  3L2U A;  4NS5 A;  3FLG A;  2MWO A;  2RHY A;  2BUD A;  3FEO A;  2E5Q A;  2R5M A;  5FRN A;  2RHI A;  3ASK A;  1SSF A;  3MEV A;  5C0M A;  2NLU A;  4E7L A;  2X4Y A;  4QVZ A;  3LX7 A;  4IUU A;  4QQ6 A;  3NTK A;  3GOX A;  3L2Q A;  3C4S A;  3PNW C;  3P8D A;  3LH0 A;  2R57 A;  4N4G A;  2GFA A;  3L2W A;  2O4X A;  3OYJ A;  2R5A A;  3LLR A;  3MO8 A;  4RG2 A;  5IN1 A;  4E7H A;  4IUV A;  2DIG A;  4Q5W A;  3S3N A;  3MEW A;  2XK0 A;  1WJS A;  2B8A A;  2QQR A;  5D6Y A;  3LYI A;  4PLL A;  4OVA A;  4IUT A;  2F5K A;  4GY5 A;  3BDL A;  4PL6 A;  3ME9 A;  5KH6 A;  4BD3 A;  2CKK A;  2RJD A;  3MET A;  3P8H A;  4UC4 A;  5KE3 A;  5D6X A;  4E7I A;  1H3Z A;  1RI0 A;  2D9T A; 
#chains in the Genus database with same CATH topology
 3AT1 B;  4C0D C;  4CC4 B;  2KK4 A;  4M78 F;  2VYT A;  3A8G B;  4WF2 A;  2OAU A;  3H41 A;  1BB9 A;  1E6H A;  4O5V A;  2HEQ A;  3JCM b;  3G4S T;  2AHJ B;  4DEX A;  3DB4 A;  4HCZ A;  2DPP B;  3URG A;  1YHQ Q;  1RAB B;  1RAI B;  1FX7 A;  1VQN A;  2RQV A;  3ER0 A;  3ZFJ A;  1GBQ A;  3INZ A;  1C0M A;  2K5L A;  2RJE A;  4E47 A;  3PIP A;  4EPC A;  2CZ1 B;  1M9S A;  1MV3 A;  1ZX6 A;  2JM8 A;  2PQW A;  4XU3 A;  2VC8 A;  3PMI A;  2QDY B;  1PG5 B;  1YHQ A;  1AVZ C;  2CP0 A;  2ZPG B;  1UGQ B;  3PGG A;  2YT6 A;  1E6G A;  2DIL A;  1ZA2 B;  3LH5 A;  3MP8 A;  1UDL A;  1M5Q 1;  5L8R E;  2QA4 T;  4DBQ A;  2GTJ A;  2FZG B;  1XTD A;  1X6B A;  1SHF A;  4N0A C;  2YUQ A;  1AWX A;  2MK5 A;  1SEM A;  4JZ4 A;  4F7U G;  2DXC A;  2DA9 A;  2QI2 A;  2DZC A;  2EIF A;  5I21 A;  4BAC A;  1YNZ A;  5GAN 8;  2YRV A;  2XMF A;  2ENM A;  1WHK A;  2CGH A;  3VJP A;  3VUZ A;  1Q95 G;  1M2V B;  4ZN3 A;  3NTK A;  3CQT A;  4J9H A;  4KBM B;  2FZK B;  3OSV A;  3RMQ A;  4XU1 A;  3J80 E;  2YLC A;  1YJN T;  3MEW A;  4JRQ A;  1KJW A;  1GBR A;  3VYH B;  4OMQ A;  2DLP A;  5CR2 A;  5KE3 A;  1TH7 A;  2D9T A;  2PU9 B;  3M4G A;  1KIK A;  1ZUY A;  3L2Z A;  3CEY A;  4KT0 E;  4RTY A;  2HD0 A;  3CCM Q;  1VQM Q;  5GAN 5;  1ARK A;  2DL3 A;  5GAN 3;  2QQ9 A;  2FRW A;  2K3X A;  3OW2 A;  1SPK A;  3VS0 A;  2K5F A;  1W2B A;  3VRY A;  4J9B A;  4FT4 A;  3N5B B;  3OYB A;  5EC7 A;  8ATC B;  1SRL A;  1VQM A;  1TG0 A;  4NL3 A;  1RAD B;  3EG9 A;  1YIT Q;  1OV3 A;  3OYC A;  2V1R A;  2DL8 A;  3A8M B;  4ESR A;  4R55 A;  3PT9 A;  3RKX A;  1M27 C;  3FDR A;  3KFV A;  4ELZ C;  4AG2 C;  4IUP A;  2NUP A;  5A0D A;  1M2O A;  3FJP A;  3CMA Q;  1WDX A;  1WGS A;  2P84 A;  4OMP A;  5DLO A;  2KVQ G;  5GJV B;  2EQI A;  2XID A;  2EAY A;  1ZBJ A;  2A28 A;  2F2V A;  1C1A A;  3UT1 A;  4EMK A;  5CKB A;  1H3H A;  1RUW A;  2BE9 B;  2CSI A;  1BCO A;  2KQW A;  4LDU A;  4MZM A;  4HXJ A;  1OPK A;  3DLM A;  2CP3 A;  4FU6 A;  2WSE E;  1VIE A;  5FU6 C;  3V8K A;  3JAM E;  3S3M A;  2KT8 A;  1OU9 A;  1WIE A;  3CMA A;  3CCE Q;  5IH2 A;  2QAZ A;  2OTJ T;  4RTT A;  1RAF B;  4OB0 B;  3GNF B;  4RUG A;  1WXU A;  4NS5 A;  3L2U A;  1RAG B;  3CCV Q;  3A5Z B;  2CUB A;  3MPU B;  2F2W A;  2J6F A;  3A98 A;  4HA8 A;  1SSF A;  4Y28 E;  1AT1 B;  1WHM A;  3QWY A;  3QDR B;  2GNC A;  2HL3 A;  4FSX A;  2F69 A;  4HVU A;  4C0Z A;  2EVR A;  5A0G A;  4HCK A;  3CCE A;  1VQK Q;  2B8A A;  1UUE A;  2ZPH B;  5GAO n;  4OVA A;  4IUT A;  5LJ3 g;  1M1K R;  4E7I A;  2P0P A;  1K8A U;  3CCV A;  1I5L A;  4EMK B;  1VQ6 A;  1QKX A;  5I2S A;  3MEA A;  5KYX A;  1YWP A;  1FYN A;  2GQI A;  2X9H A;  1ZHI A;  4OB2 B;  4Z02 A;  3L2V A;  4HT9 A;  2FHD A;  3H8Z A;  1VQK A;  2K79 A;  4MZP A;  1B34 A;  1NYF A;  2DE0 X;  2IIM A;  5I22 A;  3PE0 A;  1YWO A;  3G4S Q;  3E2U A;  1M8M A;  1UHC A;  3OB9 A;  1C6V X;  3EH2 A;  1VIF A;  2EKO A;  4RTU A;  5LJ3 e;  3CME T;  1YJ9 T;  2ZPE B;  2MYS A;  1KC8 C;  4C8Q G;  2YXY A;  2A36 A;  2CH4 A;  4IIO A;  2H8H A;  4BDZ A;  1K8A C;  2CH4 W;  1PCX A;  2XHC A;  3RDV A;  2M1H A;  2KE9 A;  1QCO A;  2XIC A;  2VGN A;  3M0S A;  1VYT A;  1IB8 A;  3G4S A;  1GCP A;  2HZY A;  2M9U A;  4JJB A;  4NL2 A;  4BY6 B;  4FL6 A;  4AFS C;  1M90 U;  1IRE B;  2FYK A;  2RNA A;  4C0F A;  1MNE A;  1HSQ A;  2QA4 Q;  3CC4 T;  5LJ5 f;  1B34 B;  1P92 A;  3FLG A;  2HKQ B;  2IVW A;  3JB9 D;  1TUG B;  2EW3 A;  2P4R A;  1AZG B;  2F1L A;  3H0F A;  2K4Y A;  4JJN K;  3X28 B;  5FU6 B;  2O4X A;  3OYJ A;  4JJD A;  2YDL A;  1YJW T;  3CCJ T;  4C92 E;  1KD1 R;  1K76 A;  2DZ9 A;  1WFW A;  2F5K A;  2V1Q A;  5LJ5 h;  4J7F A;  2QA4 A;  3R6O A;  3MET A;  4FYY B;  1MMD A;  4C92 D;  3JB9 J;  1I1J A;  2K3B A;  3HKS A;  4PK4 A;  2WSC E;  2KRO A;  2A37 A;  3EHQ A;  2GF7 A;  5D6W A;  1M4Z A;  1QVP A;  2XDB A;  1B07 A;  2JTF A;  2Z0W A;  5C6S A;  4E7S A;  1T0J A;  1YI2 T;  2MOX A;  2XD0 A;  2ZCF B;  4BI8 B;  2LRQ A;  4D6W A;  4J6Y A;  5DM7 R;  2QEX T;  1GCQ C;  4JDS A;  3R6N A;  1KFZ A;  5GAO l;  3QKJ A;  3QSU A;  2KMT A;  2ZZD A;  4LE9 A;  2YHT A;  1QW1 A;  3CXC S;  1TUD A;  1LCK A;  1Y96 B;  4XTV A;  3OMG A;  3Q1J A;  1K9M U;  4JS5 A;  1Y71 A;  4PLI A;  1JXO A;  3QYH B;  4AMC A;  2O4X B;  1V1C A;  1TWB A;  1SKU B;  2HQH A;  2DF6 A;  4HVW A;  5GAO q;  2DEU A;  1SG5 A;  1JB0 E;  3V7S A;  5HK3 A;  2GTO A;  2ED1 A;  1M1F A;  4KGX B;  1QVF S;  4QW2 A;  1WYX A;  2E6N A;  4M75 A;  4C92 A;  4OMO A;  3MP1 A;  1TXQ A;  3TSW A;  1ACM B;  3RBB B;  3RUX A;  1T3S A;  2NUT B;  1HXD A;  1G3T A;  4A53 A;  3VRZ A;  2RK2 A;  3JSC A;  2EPD A;  3M59 A;  1AWW A;  3L2Q A;  1I81 A;  4XU2 A;  2OTJ Q;  3MO8 A;  4XTY A;  5FWC A;  2FEI A;  5CK9 A;  3RIR A;  4FYX B;  5CKF A;  5GAN f;  2CKK A;  3M0T A;  2K9G A;  1XOV A;  2W0Z A;  1GXI E;  2VB6 A;  2DAQ A;  3C94 A;  3UPU A;  2AK5 A;  5GAN 7;  1K1Z A;  2O2O A;  3JB9 F;  4LD6 A;  2OTJ A;  1FMV A;  2JN0 A;  2Y4X A;  4M7D A;  3M9Q A;  2OX7 A;  3JCM V;  4BB7 A;  4XTU A;  4EDU A;  2L3S A;  4C92 B;  5GAN h;  1OZ3 A;  2V8I A;  1W1F A;  2QYZ A;  3EAE A;  4C5H A;  1X69 A;  3PIO A;  4C92 F;  3CPF A;  5GAN 4;  3VS3 A;  1J3T A;  3D7S B;  5ECA A;  2EYY A;  1N9R A;  2D8J A;  4E6R A;  3EHR A;  3TQ7 P;  1QMC A;  2RHZ A;  4ZGD B;  4J9G A;  4LUE A;  4N4H A;  1BI1 A;  5L23 A;  2QDL A;  1M90 R;  1UB4 A;  1VQL T;  3OBY A;  4J9E A;  1BBZ A;  5HY6 A;  1YJ9 Q;  3CME Q;  2PNI A;  3OYF A;  2AZV A;  3RES A;  5FWB A;  4FIB A;  2RO0 A;  2IPO B;  4XAX B;  3VYG A;  3SWN C;  4Z89 A;  4M78 A;  1WNL A;  2LTO A;  2JMC A;  2O01 E;  2C0T A;  2CP6 A;  3REB B;  4E7J A;  2JMA A;  1IHW A;  1YJ9 A;  3CME A;  3QUI A;  2DMO A;  1UGS B;  4E7L A;  1N9S A;  1WX6 A;  4MZT A;  1KQS S;  4OF1 A;  3BE3 A;  5LJ3 j;  2COY A;  1JBM A;  1PKS A;  2RF0 A;  3LLR A;  5IHI A;  4E7H A;  5IT9 E;  5CQY A;  2HDA A;  3CC4 Q;  4Q5W A;  3S3N A;  1ZSZ C;  5KH6 A;  1VYV A;  2C0O A;  2QQA A;  4J9I A;  1JRI A;  3I55 T;  2J7I A;  1RAC B;  3M53 A;  4M7A G;  2EJG A;  3HRT A;  4M75 G;  1XJW B;  4B9X A;  1YJW Q;  1QLY A;  3CCJ Q;  3VKI A;  1TSF A;  3RKY A;  4M77 E;  4M77 C;  4JUV A;  1K9M R;  2RN8 A;  3KUF A;  3WXM B;  3TU4 K;  4M77 D;  5LL6 S;  3VS4 A;  1VQ9 T;  3JB9 I;  1I4K 1;  1UG1 A;  2D8H A;  1MHN A;  3DB3 A;  2LVM A;  2CUD A;  4EMH A;  2CDT A;  1YJW A;  2XU8 A;  3CCJ A;  2AT1 B;  1YI2 Q;  4HCC A;  1XQH A;  3OYN A;  1NYG A;  1XNI A;  2E1H A;  2MIO A;  2QEX Q;  2EYX A;  2YSQ A;  3SFM A;  1M1K U;  2YUO A;  1SHG A;  2I0N A;  3SHW A;  4KGV B;  2DD4 A;  4PJO E;  4PJO C;  1ZUK A;  1KK7 A;  2DNU A;  3CD6 T;  4M7D G;  4PJO D;  1M2V A;  2KT1 A;  2PZ1 A;  2VAS A;  5CIU A;  2DVJ A;  3EFR A;  1OOT A;  5LJ5 g;  1KQ1 A;  3SDZ A;  1YI2 A;  3A8L B;  1M30 A;  1JJ2 P;  3QXE B;  5KYY B;  2LNV A;  1FXX A;  4PKC C;  4NOY A;  2QEX A;  2K2M A;  4JRP A;  3QJ6 A;  4A4E A;  4C8Q E;  3X24 B;  4C8Q C;  2HBP A;  4ZGE B;  2EGE A;  3MHX A;  1R0C B;  4PJJ A;  2VXE A;  1WQ7 A;  2X4Y A;  2FVU A;  2M02 A;  3HTR A;  5AT1 B;  3JCM f;  5LJ3 d;  3PNW C;  1NLO C;  1ZA1 B;  4ZNX A;  3CCU T;  1M1K C;  3SWN B;  5D6Y A;  4FYV B;  2E64 A;  2EJF A;  4XQ3 A;  4BI4 A;  2FB7 A;  2KRN A;  3CBO A;  4PL6 A;  2X4J A;  1PKT A;  1UEB A;  1B3Q A;  5LJ5 e;  1W70 A;  3UWN A;  3OY9 A;  2FPD A;  3OYH A;  3RR6 A;  3M0Q A;  3JCM h;  4M78 G;  1VQ5 T;  3CPW S;  2GFU A;  2J05 A;  2EGA A;  4BE2 A;  5FRM A;  5KYN A;  3E1S A;  2ZGW A;  1ZSZ B;  1NE8 A;  2DTO A;  3ZL7 C;  2O31 A;  2EQM A;  2LCL A;  3EG2 A;  4IUR A;  5KCH A;  1RAA B;  1VQ8 T;  1S72 T;  1PNJ A;  4Y91 A;  4QQG A;  2J6K A;  3TCJ A;  3CCL T;  3I56 T;  3OYD A;  5A0L A;  2VVK A;  1B7T A;  4F04 B;  2KEA A;  2K5I A;  2IG0 A;  1X2Q A;  4FCY A;  3QDF A;  2DBK A;  4M77 B;  1KD1 U;  4FW2 A;  2EYZ A;  2LMJ A;  3HP9 A;  2JW4 A;  3CC7 T;  1N5Z A;  3BDU A;  4C5G A;  2RQU A;  5FLX E;  4M77 F;  2RPN A;  2DVE A;  1RLP C;  3CCM A;  4C0D B;  2K6D A;  1PD1 A;  2LX7 A;  4OGE A;  2E3I A;  4N0A A;  3HSB A;  2BZ8 A;  3L42 A;  1WA7 A;  1HYO A;  4LDV A;  4BDY A;  1VQ7 T;  1VQL Q;  2EYW A;  4CC2 A;  2RI2 A;  4GLM A;  2QQS A;  3KXT A;  4PJO B;  2H3J A;  1TUC A;  1YIT A;  3QG1 A;  5GAN g;  3ULR B;  1NM7 A;  3GOX A;  2J06 A;  5GJW B;  4PJO F;  2LNH B;  1KD1 C;  2DRK A;  1VQL A;  2COZ A;  2KY9 A;  1CKB A;  4JZ3 A;  3LYI A;  4ANJ A;  4PLL A;  5GMK l;  3LWI A;  2VGM A;  2FZC B;  2RJD A;  1PWT A;  2V8K A;  4C8Q B;  2FPF A;  1QVG S;  4JLG A;  3C0C A;  1H8K A;  1MGQ A;  2MWP A;  3VS2 A;  2QK0 A;  3F70 A;  2RJC A;  2RQW A;  4J9F A;  4EIK A;  1YFN A;  1X01 A;  3OYA A;  1T0H A;  1QP3 A;  1NLP C;  1IGQ A;  3CCR T;  1TOV A;  1K0S A;  5D7U A;  1D3B B;  3EGX A;  4QQD A;  3I55 Q;  1AZE A;  2MCN A;  4KUI A;  4OP0 A;  2KYM A;  1G83 A;  2DYB A;  2DO3 A;  5GAN e;  1FWZ A;  3LGF A;  4ZTF A;  1OX9 A;  3OMC A;  1NPR A;  4CRI A;  2JS2 A;  4CC3 A;  4A4F A;  1WI7 A;  3GNG A;  1MUZ A;  1WQW A;  1VQ9 Q;  3I55 A;  3I5S A;  3QPH A;  1EZZ B;  1N6A A;  3OS2 A;  3KBG A;  3QHS A;  2OTL T;  1SF9 A;  5FU7 C;  3UA6 A;  3OYM A;  2L3Q A;  2L89 A;  2LJ1 A;  1HJD A;  9ATC B;  2XG8 D;  4FW1 A;  3E19 A;  5CCA A;  3JB9 H;  2O88 A;  1GL5 A;  1VQ9 A;  2EYQ A;  1WJQ A;  3CD6 Q;  2DIQ A;  1NJI U;  3EGX B;  1JO8 A;  3G71 T;  1VUB A;  2EJ9 A;  3V7C A;  2OAW A;  1ZUU A;  2C0I A;  3UAT A;  3CXC P;  1UE9 A;  2Y90 A;  4N4G A;  1EX4 A;  2SEM A;  3CD6 A;  3M57 A;  2YWW A;  1LNX A;  1K4U S;  1ZQ1 A;  4XK8 E;  4II1 A;  1VQP T;  2WAC A;  2YUN A;  4X9C A;  2LJ3 A;  3AHU A;  2EGC A;  3CCU Q;  3M54 A;  4FSS A;  1QVF P;  1Y96 A;  1OPL A;  2QTX A;  3FC3 A;  2EWN A;  2L2P A;  1Q81 U;  2E4H A;  4B9W A;  4BE0 A;  3O5Z A;  2JZ2 A;  4V2S A;  2ZPB B;  1VQ5 Q;  2DXB A;  1NEG A;  1KHI A;  3VU3 C;  3PFS A;  2DYI A;  3OQ5 A;  3M58 A;  2HSP A;  1YBY A;  5J39 A;  2KBT A;  4PJM A;  2DM1 A;  3T9N A;  2PTK A;  2RH2 A;  1YJN Q;  4EMG A;  3V7R A;  4OMN A;  3JRZ A;  4M7A E;  4M7A C;  1VQ8 Q;  1NBE B;  1S72 Q;  2ZPF B;  1M90 C;  1I0C A;  4M75 C;  3JCM J;  4M7A D;  4RTZ A;  2NUT A;  1UHF A;  4ME7 A;  3CCL Q;  3I56 Q;  1VQ5 A;  3C95 A;  5GAM f;  5LJ5 j;  4IUQ A;  3HFN A;  4MDX A;  3NGP A;  1NG2 A;  3H9N A;  2COW A;  4WCI A;  4Y92 A;  5IXB A;  1QCF A;  4X1V A;  3OS0 A;  4OGC A;  1YJN A;  1K9A A;  1UFF A;  1S72 A;  5GMK h;  3CC7 Q;  2DXT A;  4J83 A;  5GAO m;  1ABQ A;  3OW2 S;  2LDM A;  1G5V A;  5AYF A;  3JCM g;  2V8J A;  5GAM h;  4J5Y A;  3I56 A;  1W2B S;  4X34 A;  3EH1 A;  4BI3 A;  1GFD A;  2ZPI B;  1GFC A;  1BYM A;  4IUU A;  5GAO r;  1VQ7 Q;  4QQ6 A;  3IQL A;  2KGT A;  3HRU A;  1U1T A;  1K73 R;  4JRK A;  1BIB A;  3HRS A;  2R5A A;  3CC7 A;  2AZS A;  4MML A;  3LWH A;  1WJS A;  1LJO A;  4HCB A;  1RAE B;  4GY5 A;  2KRS A;  4J9D A;  3M0R A;  1UEC A;  2FG0 A;  2NWM A;  1RI0 A;  1IO6 A;  1Y0M A;  2DEQ A;  1QWF A;  3GP8 A;  1WHG A;  5J26 A;  4MMK A;  3QZ5 B;  2HQE A;  4L5G A;  3QYG B;  4C5I A;  3JCM e;  1K9M C;  1UGV A;  2DK3 A;  4F17 A;  5CKE A;  3OYI A;  2X4W A;  1QCN A;  4OMF B;  1Q86 U;  3OYE A;  1AOJ A;  3EGU A;  1JQQ A;  4FT2 A;  1GCQ A;  4F7U E;  2R58 A;  3RNJ A;  4WTO B;  4A63 B;  4BE1 A;  3FIF A;  1BU1 A;  2MF2 A;  3C12 A;  3RKW A;  1KQS P;  3E9F A;  3CCR Q;  3X20 B;  3OYY A;  2JM9 A;  3FRN A;  2KXC A;  4PJN A;  1WLP B;  2LJ0 A;  4LNP A;  2L0A A;  2QG9 B;  2KSS A;  1IHV A;  1G8X A;  1OX8 A;  4P5N A;  1YIJ T;  5FW9 A;  5LJ5 d;  4XTZ A;  1N8R U;  2DER A;  1NJI R;  2DJZ A;  1NEB A;  3GBQ A;  4FYW B;  5CKH A;  3CC2 T;  2X3X D;  5GAO p;  3M5A A;  5HKC A;  1X75 C;  4DOV A;  3CCR A;  1JJ2 A;  2D0Q B;  5I2M A;  3QZ9 B;  4E7Z A;  1OI1 A;  2SRC A;  1MMG A;  4M7A B;  4XTX A;  1WXT A;  1Q7Y U;  4JS4 A;  2OTL Q;  1Z9Q A;  4HKE A;  5I11 A;  1X27 A;  2OI3 A;  4KRT A;  1JEG A;  4L59 A;  2CZ6 B;  5GAN j;  4M7A F;  2A08 A;  2A3L A;  2AKK A;  2R5M A;  5FRN A;  5C0M A;  3SB2 A;  1RL2 A;  4LXC A;  2CZ0 B;  2D1X A;  3C4S A;  4IIM A;  2ABL A;  2KI7 A;  2XK0 A;  1BKB A;  3G71 Q;  2CS7 A;  1Q81 R;  4RTW A;  2OTL A;  1MMN A;  2G6F X;  1PRL C;  3BDL A;  3VUB A;  3I35 A;  2PVO B;  3PTA A;  1OYX A;  1YN8 A;  2KR3 A;  5KYW B;  4DBH A;  3NPF A;  1Y07 A;  1M1G A;  2JXB A;  2EBP A;  4KGZ B;  3JB9 G;  1EFN A;  1U1S A;  1RLQ C;  2LQN A;  5FRO A;  2KDS A;  3G71 A;  4JPB W;  1RI9 A;  3JCM P;  1VQP Q;  1TTH B;  1R8O B;  4LDY A;  4QKU A;  5EG2 A;  1IRX A;  2QAS A;  2DET A;  1M8V A;  1BIA A;  1SRM A;  3OYG A;  2DX1 A;  2RI5 A;  2LQW A;  4C92 G;  4RMO A;  5KYY A;  2BZY A;  2W10 A;  4AFU C;  1VQ6 T;  3ZBD A;  1HD3 A;  3CC4 A;  4Z8A A;  3EFO A;  1VQP A;  4YTL A;  1ZSG A;  1U5S A;  3PMT A;  3DLL A;  2BKD N;  3HFO A;  1CKA A;  1PD0 A;  1G3W A;  4F7U B;  1T3L A;  2CT3 A;  3CPW P;  2L3P A;  3V8L A;  2K7A A;  5KYU B;  1D09 B;  1I8F A;  3BW1 A;  4ZTJ A;  3SWN A;  4QVC A;  4F7U F;  5HCK A;  2FL7 A;  4MDW A;  2CSQ A;  3LW5 E;  5CKD A;  3S6W A;  2DL4 A;  5GAN d;  3X25 B;  2RHY A;  2E5Q A;  3TEE A;  4D8D A;  4ZGJ B;  3PVQ A;  1TS9 A;  1WHL A;  4PNO A;  4Z88 A;  4RCB A;  3P8D A;  2HL5 C;  4J9C A;  5CVI A;  5IN1 A;  1ZSZ A;  4IUV A;  4F14 A;  4JLI A;  2GGR A;  3GLX A;  1F1B B;  3EFO B;  1UJY A;  1Q86 R;  1GRI A;  5CAI A;  1X2K A;  4O6J A;  5DLQ E;  3HL8 A;  2B86 A;  4C8Q D;  1NPP A;  3REA B;  2KXD A;  1AWO A;  4M77 A;  2L5Q A;  2BE7 D;  1Q82 R;  3NFC A;  1BI0 A;  4N4I A;  3CCQ T;  2OJ2 A;  2G3R A;  3HHT B;  1OQK A;  2DL7 A;  3H6Z A;  1AWJ A;  2P4T A;  5M9O A;  1UGR B;  1N8R R;  1IZ6 A;  2JUF A;  2XI9 A;  1LOJ A;  1UJ0 A;  1OZ2 A;  5GMK i;  2X35 A;  5GAM g;  3NTH A;  2RD1 A;  2DFU A;  1D1B A;  2GCX A;  1KSW A;  2MMP A;  4LN2 A;  3EG1 A;  3MKD A;  4PJO A;  1Q7Y R;  2PVG B;  4DBF A;  1BI2 A;  2QGG A;  4OB1 B;  1BCM A;  4CC7 A;  4DBR A;  1QVG P;  1CSK A;  2LT4 A;  2BIV A;  4EMK C;  2BTT A;  3A1P A;  3S3O A;  2MAM A;  1TU0 B;  1JU5 C;  2EFI A;  1D0Z A;  5CO7 A;  2LP5 A;  3M0P A;  2VXF A;  1YIJ Q;  3HPW A;  5GMK e;  1K0X A;  4C0G A;  3CC2 Q;  4C8Q A;  5DY9 A;  1AEY A;  2CRE A;  2AKL A;  1V29 B;  2MWO A;  1OUL A;  3FEO A;  5GAM e;  2RHI A;  3CXC A;  3A8O B;  2CZ7 B;  2NLU A;  2VUB A;  2YUP A;  3M55 A;  2P0Q A;  1QKW A;  4LD9 K;  2HBW A;  2KAF A;  1I5O B;  5IHN A;  1O75 A;  4LDX A;  1JJ2 S;  2J6O A;  2CP2 A;  3JCM X;  1D3B A;  1YIJ A;  1D0X A;  3OBW A;  4PFO A;  1X6G A;  2CYZ B;  2DKG A;  3CC2 A;  4F16 A;  1FMK A;  2DTI A;  2JJ9 A;  2MPX C;  2PVD B;  3GPL A;  4J7I A;  1QVF A;  2X51 A;  1YP5 A;  2JTE A;  3JCM c;  1O9S A;  3G6E T;  4PFP A;  4BY6 C;  2L8D A;  4KUL A;  8AT1 B;  2H3E B;  3QO3 A;  3EGD A;  2YLB A;  3FJ5 A;  2DD5 A;  2M0Y A;  1H92 A;  1U06 A;  1AD5 A;  3MEU A;  2XDP A;  4GLK A;  1WHH A;  1A0N B;  3MCA B;  5GMK m;  2LCC A;  2M0O A;  3BY7 A;  1K73 U;  2ZAE A;  4C8Q F;  3QBY A;  3L1A A;  1OEB A;  1LPL A;  1KG1 A;  2RMO A;  5GAN 2;  2X4X A;  2EQK A;  3O8V A;  3TRE A;  2M51 A;  1YCS B;  2EQJ A;  4M77 G;  4A4G A;  1VQ6 Q;  2E41 A;  2ED0 A;  2X3W D;  3EG9 B;  3J81 E;  3JCM d;  2VV5 A;  2DTH A;  1WJR A;  3X26 B;  1EIF A;  1N27 A;  1VQ4 T;  2M16 A;  4HT8 A;  1KC8 U;  2NUP B;  1R0B G;  3EGD B;  2RQT A;  3MJX A;  2BUD A;  4J6X A;  3OSS C;  2CT4 A;  1K73 C;  4AFZ C;  4BUG A;  4L6V 5;  1VQO T;  2HMA A;  2FPE A;  1AHJ B;  4PJO G;  3LH0 A;  2R57 A;  3UDC A;  4RG2 A;  4R56 A;  2GQV A;  2E70 A;  4XU0 A;  1E7O A;  2WSF E;  2XDD A;  2KRM A;  2Y4Y A;  2DJQ A;  4DOW A;  1WPY A;  3OA6 A;  4LDW A;  4RKU E;  1I07 A;  4IKF A;  2NUZ A;  2QXF A;  2LQK A;  1LVK A;  5CQX A;  3GIB A;  3OW2 P;  1X43 A;  1X6O A;  2KYB A;  4JJC A;  2PUO B;  2YRC A;  3CBP A;  2JOY A;  1W2B P;  3NTI A;  1UTI A;  1QP2 A;  3P8B B;  1KQS A;  1ZBX A;  3VS7 A;  2E65 A;  2QGF B;  2MI6 A;  1G3S A;  1RAH B;  4CI0 C;  1NZ9 A;  4A4H A;  3CCQ Q;  1R77 A;  2L3R A;  1M3B A;  3CCS T;  1QWE A;  5KYX B;  3VS1 A;  5IXF A;  3V8J A;  1Y7X A;  4PJL A;  4C5E A;  2XKO C;  1NJI C;  2ESW A;  3EG0 A;  2JS0 A;  4X9D A;  2DRM A;  2E12 A;  4OML A;  1G2B A;  2FO0 A;  2E6Z A;  2RHX A;  4QVD A;  3CCU A;  3CCQ A;  2HQX A;  1M3C A;  2CP7 A;  2LX9 A;  4J6W A;  1MV0 B;  2EQU A;  1PSE A;  4M75 E;  2P0K A;  4C92 C;  4XTW A;  1D1C A;  4HVV A;  4LUD A;  4A54 A;  3M4Y A;  4E2F B;  4FM4 B;  4M75 D;  1Z9Z A;  3EG3 A;  5HK0 A;  1VQN T;  4R0K A;  4QVZ A;  3LX7 A;  2KNB B;  1Q81 C;  3VV0 A;  3JCM Q;  1VQ8 A;  2QQR A;  1Y57 A;  3ME9 A;  3H0H A;  2RQR A;  4UC4 A;  2A0F B;  3CCL A;  1HK9 A;  2E3H A;  2ROT A;  1H3Z A;  3H0I A;  1M3A A;  7AT1 B;  1YHQ T;  3M56 A;  5FU7 B;  2HSE B;  4PFZ A;  3DKM A;  4ATO A;  2YRD A;  1VYU A;  1DJ7 B;  3GF5 A;  4M7D E;  4M7D C;  1KHC A;  3JCM W;  3WVE B;  3VS6 A;  3PVL A;  5GMK j;  4OB3 B;  1YCY A;  4M7D D;  3SEM A;  2AIR B;  3G6E Q;  3BFM A;  5GAM j;  4RCC A;  1UGP B;  1VQ7 A;  4AFQ C;  4M7A A;  2FRY A;  4AT1 B;  1D1A A;  2EKH A;  1ABO A;  2ECZ A;  2ROL A;  2E10 A;  1WHJ A;  1KC8 R;  2O9S A;  2RJF A;  3RER A;  1BI3 A;  4M4Z A;  4E7K A;  2D0N A;  3CPW A;  3G6E A;  1K8A R;  5KCO A;  4KH1 B;  5A2Q E;  4B6M A;  2O9V A;  4ELY C;  3OYL A;  2RI3 A;  2DBM A;  3U23 A;  3OS1 A;  4JRI A;  2HNI A;  3UF4 A;  1IXD A;  2JT4 A;  1Q82 U;  2ATC B;  4M78 E;  4M78 C;  2GBQ A;  3LGL A;  3FB9 A;  2V26 A;  4M78 D;  5KYW A;  1OU8 A;  2HCK A;  2JTM A;  4KH0 B;  5J3B A;  4VUB A;  3ASK A;  3MEV A;  1VQ4 Q;  2RM4 A;  1VA7 A;  2I2L A;  4OMM A;  1VQM T;  3CCM T;  2GFA A;  4KUD K;  6AT1 B;  1Q86 C;  4D8K A;  4RTX A;  4M75 B;  2VKN A;  2RB6 A;  4GBQ A;  4BD3 A;  2DXU A;  3P8H A;  1VQO Q;  3QWX X;  2JVV A;  2LQ8 A;  4M75 F;  1VQ4 A;  1W4S A;  2JNG A;  4DEY A;  3SD4 A;  5LJ3 f;  3VS5 A;  1Q82 C;  3EFS A;  2LZ6 B;  3G7Z A;  2K2V A;  3JV3 A;  1W6X A;  1YIT T;  2PUK B;  1WXB A;  1MMA A;  2LT1 A;  3I5R A;  1PC0 A;  2D6F A;  1JXM A;  1PSF A;  3E9G A;  1N8R C;  1VQO A;  3CMA T;  3UA7 A;  4F7U A;  5GAN 6;  5GAM d;  4QT7 A;  1VOM A;  3G1J A;  2DL5 A;  1SSH A;  2C06 A;  5LJ3 h;  3NHN A;  1D0Y A;  1PRM C;  5KYU A;  3THK A;  1KQ2 A;  4ZN1 A;  2BZX A;  2VWF A;  4RTV A;  3OYK A;  1U8R A;  1ZLM A;  2LCS A;  2A7Y A;  4K11 A;  4DA4 A;  1Q7Y C;  4M7D B;  2HKN A;  1QVG A;  5KE2 A;  1H64 1;  2RA2 A;  3WVD B;  2RHU A;  3J7A F;  1FMW A;  3MP6 A;  1PM3 A;  3CCE T;  3TVT A;  3OS5 A;  1QQJ A;  4M7D F;  5IAY A;  3CCS Q;  2QQB A;  3CCV T;  3QII A;  4DQ2 A;  3NMZ C;  3QJY A;  1G3Y A;  5IHK A;  2CP5 A;  2QTV A;  2K3Y A;  2LC4 A;  3M0U A;  4TVR A;  3ZEH A;  3L2R A;  4J8O A;  1VQK T;  1PHT A;  1IGU A;  2HAX A;  3CCS A;  4ORZ A;  2NYS A;  1BK2 A;  2E5K A;  3TSZ A;  4A4K A;  3L2W A;  3A8H B;  4AG1 C;  3CBM A;  1WZO A;  2DIG A;  1V76 A;  3RMS A;  4M78 B;  3I9Q A;  1MND A;  2RK1 A;  2K57 A;  1U3O A;  1S1N A;  1VQN Q;  5D6X A;  4RG8 A;  2F5T X;  2F2X A; 
#chains in the Genus database with same CATH homology
 4II1 A;  1XOV A;  1VQP T;  1GXI E;  2WAC A;  2DAQ A;  3C94 A;  4C0D C;  4X9C A;  2KK4 A;  1QVF A;  3UPU A;  4M78 F;  5GAN 7;  2VYT A;  3JCM c;  3A8G B;  4WF2 A;  3AHU A;  1O9S A;  2OAU A;  3M54 A;  3G6E T;  3JB9 F;  1Y96 A;  4O5V A;  4BY6 C;  4LD6 A;  3JCM b;  2QTX A;  3FC3 A;  3G4S T;  2OTJ A;  2EWN A;  2JN0 A;  2AHJ B;  2Y4X A;  4M7D A;  3M9Q A;  2L8D A;  1Q81 U;  3DB4 A;  4KUL A;  3JCM V;  4B9W A;  4BB7 A;  4BE0 A;  3QO3 A;  4HCZ A;  2JZ2 A;  4XTU A;  4V2S A;  4EDU A;  2DPP B;  2YLB A;  3URG A;  4C92 B;  5GAN h;  1OZ3 A;  2DD5 A;  1FX7 A;  2ZPB B;  1VQN A;  2V8I A;  2DXB A;  3MEU A;  1KHI A;  3ER0 A;  3VU3 C;  2XDP A;  3PFS A;  3OQ5 A;  4GLK A;  3M58 A;  3ZFJ A;  3EAE A;  4C5H A;  3PIO A;  1YBY A;  4C92 F;  5J39 A;  3INZ A;  2K5L A;  3MCA B;  5GMK m;  2RJE A;  3CPF A;  5GAN 4;  2LCC A;  4E47 A;  3PIP A;  2M0O A;  4EPC A;  3BY7 A;  2CZ1 B;  3T9N A;  2RH2 A;  1K73 U;  4EMG A;  1M9S A;  3V7R A;  3JRZ A;  4C8Q F;  4M7A E;  4M7A C;  3QBY A;  3L1A A;  1N9R A;  2ZPF B;  2PQW A;  4M75 C;  4XU3 A;  1M90 C;  2VC8 A;  3PMI A;  2QDY B;  4ZGD B;  2RHZ A;  5GAN 2;  1YHQ A;  1KG1 A;  3JCM J;  2ZPG B;  1UGQ B;  4N4H A;  4M7A D;  1BI1 A;  3PGG A;  2X4X A;  4ME7 A;  2EQK A;  1UB4 A;  3O8V A;  1VQL T;  1VQ5 A;  3MP8 A;  3TRE A;  3C95 A;  3OBY A;  5GAM f;  5LJ5 j;  2EQJ A;  4IUQ A;  3HFN A;  4MDX A;  4M77 G;  1M5Q 1;  5HY6 A;  4A4G A;  5L8R E;  2QA4 T;  2E41 A;  3OYF A;  1XTD A;  3OS0 A;  3J81 E;  3RES A;  4OGC A;  4FIB A;  1YJN A;  3JCM d;  2VV5 A;  2DTH A;  4N0A C;  1WJR A;  3X26 B;  1EIF A;  2RO0 A;  1N27 A;  1VQ4 T;  2M16 A;  4XAX B;  3VYG A;  5GMK h;  1S72 A;  3SWN C;  4HT8 A;  1KC8 U;  4M78 A;  4F7U G;  2DXC A;  2DXT A;  4J83 A;  5GAO m;  3OW2 S;  1WNL A;  2LTO A;  2LDM A;  1G5V A;  2O01 E;  5AYF A;  3JCM g;  2V8J A;  5GAM h;  4J5Y A;  2QI2 A;  2DZC A;  2EIF A;  5I21 A;  4X34 A;  3I56 A;  1W2B S;  4BAC A;  4E7J A;  5GAN 8;  2YRV A;  2BUD A;  4BI3 A;  4J6X A;  3OSS C;  3CME A;  1YJ9 A;  3QUI A;  1UGS B;  2ZPI B;  4E7L A;  1N9S A;  2CGH A;  3VJP A;  3VUZ A;  1K73 C;  1BYM A;  4BUG A;  4L6V 5;  1VQO T;  4MZT A;  4IUU A;  5GAO r;  1KQS S;  4QQ6 A;  4ZN3 A;  1AHJ B;  3NTK A;  4OF1 A;  3HRU A;  4KBM B;  5LJ3 j;  1U1T A;  4PJO G;  1JBM A;  3LH0 A;  2R57 A;  3OSV A;  4JRK A;  3UDC A;  3RMQ A;  1BIB A;  3HRS A;  2R5A A;  4XU1 A;  3LLR A;  3CC7 A;  4RG2 A;  3J80 E;  4MML A;  5CQY A;  2YLC A;  4E7H A;  5IT9 E;  4Q5W A;  3LWH A;  3MEW A;  4JRQ A;  1WJS A;  3S3N A;  1YJN T;  1LJO A;  4R56 A;  4HCB A;  2GQV A;  2E70 A;  4XU0 A;  4GY5 A;  3VYH B;  5KH6 A;  5CR2 A;  2WSF E;  2QQA A;  5KE3 A;  2XDD A;  1TH7 A;  1JRI A;  1RI0 A;  2D9T A;  2Y4Y A;  2PU9 B;  3I55 T;  3M4G A;  4DOW A;  4M7A G;  1WPY A;  2DEQ A;  3L2Z A;  3CEY A;  3M53 A;  4KT0 E;  2HD0 A;  4LDW A;  2EJG A;  4RKU E;  4MMK A;  3HRT A;  5J26 A;  5GAN 5;  4M75 G;  4IKF A;  3QZ5 B;  5GAN 3;  2QQ9 A;  2HQE A;  2QXF A;  2LQK A;  4B9X A;  2K3X A;  4L5G A;  3OW2 A;  3QYG B;  5CQX A;  4C5I A;  3GIB A;  3VKI A;  3JCM e;  1K9M C;  2DK3 A;  3RKY A;  4M77 E;  5CKE A;  4M77 C;  3OYI A;  2K5F A;  1W2B A;  2X4W A;  1X6O A;  4JUV A;  4OMF B;  3KUF A;  4FT4 A;  3WXM B;  2PUO B;  3TU4 K;  3OYE A;  1Q86 U;  3CBP A;  2JOY A;  3N5B B;  4M77 D;  5LL6 S;  3OYB A;  3NTI A;  1QP2 A;  4FT2 A;  3P8B B;  1VQ9 T;  1KQS A;  4F7U E;  2R58 A;  1ZBX A;  3JB9 I;  2E65 A;  3FIF A;  4BE1 A;  1VQM A;  1I4K 1;  2MI6 A;  4NL3 A;  2MF2 A;  3C12 A;  1MHN A;  1G3S A;  3DB3 A;  3E9F A;  2LVM A;  3RKW A;  3OYC A;  4EMH A;  3A8M B;  3X20 B;  3OYY A;  1NZ9 A;  4CI0 C;  4R55 A;  1YJW A;  4A4H A;  2XU8 A;  3CCJ A;  2L3R A;  3PT9 A;  3RKX A;  3FRN A;  3CCS T;  4HCC A;  3FDR A;  1XQH A;  4ELZ C;  5A0D A;  4IUP A;  3OYN A;  1XNI A;  2E1H A;  3FJP A;  3V8J A;  1Y7X A;  3SFM A;  1M1K U;  1WGS A;  4C5E A;  5DLO A;  2XKO C;  2KVQ G;  1NJI C;  2DD4 A;  2KSS A;  4PJO E;  4PJO C;  2XID A;  2EAY A;  4P5N A;  4X9D A;  1YIJ T;  3UT1 A;  5LJ5 d;  1N8R U;  4XTZ A;  5CKB A;  4EMK A;  2DJZ A;  2E12 A;  3CD6 T;  5CKH A;  3CC2 T;  5GAO p;  4M7D G;  4PJO D;  2KQW A;  4LDU A;  5CIU A;  4MZM A;  3M5A A;  5HKC A;  1X75 C;  2E6Z A;  4DOV A;  3CCR A;  2RHX A;  3DLM A;  4QVD A;  3CCU A;  3EFR A;  4FU6 A;  1JJ2 A;  3CCQ A;  2WSE E;  1VIE A;  2D0Q B;  2HQX A;  5FU6 C;  1KQ1 A;  3QZ9 B;  5I2M A;  3SDZ A;  5LJ5 g;  3V8K A;  1YI2 A;  1OI1 A;  2LX9 A;  3JAM E;  3S3M A;  4J6W A;  3A8L B;  2EQU A;  3QXE B;  4M7A B;  2LNV A;  4XTX A;  1FXX A;  4PKC C;  1PSE A;  4NOY A;  2QEX A;  4M75 E;  3CMA A;  2P0K A;  4C92 C;  4XTW A;  4JRP A;  1Q7Y U;  3QJ6 A;  4JS4 A;  4A4E A;  4HKE A;  2OTJ T;  4A54 A;  3M4Y A;  4OB0 B;  4L59 A;  4C8Q E;  4FM4 B;  3X24 B;  3GNF B;  2HBP A;  4M75 D;  2CZ6 B;  4C8Q C;  4ZGE B;  3MHX A;  3L2U A;  4NS5 A;  5GAN j;  4M7A F;  3A5Z B;  2A3L A;  2VXE A;  2R5M A;  4HA8 A;  5FRN A;  5C0M A;  1SSF A;  4Y28 E;  3SB2 A;  1WQ7 A;  5HK0 A;  1RL2 A;  2X4Y A;  1VQN T;  2CZ0 B;  4QVZ A;  3QDR B;  3GPL A;  2FVU A;  3LX7 A;  4FSX A;  2F69 A;  3JCM f;  5LJ3 d;  4C0Z A;  3C4S A;  3PNW C;  5A0G A;  1Q81 C;  3VV0 A;  3JCM Q;  1VQ8 A;  3CCU T;  1M1K C;  3SWN B;  3CCE A;  2XK0 A;  2B8A A;  1BKB A;  2E64 A;  2QQR A;  2ZPH B;  5D6Y A;  5GAO n;  2CS7 A;  2OTL A;  2EJF A;  4OVA A;  4IUT A;  4XQ3 A;  5LJ3 g;  4BI4 A;  2FB7 A;  3BDL A;  3CBO A;  4PL6 A;  2X4J A;  3ME9 A;  4E7I A;  4UC4 A;  2P0P A;  3VUB A;  2PVO B;  1K8A U;  1HK9 A;  1UEB A;  3CCL A;  3PTA A;  3CCV A;  1YHQ T;  1I5L A;  1H3Z A;  1OYX A;  3M56 A;  5LJ5 e;  3UWN A;  3OY9 A;  3OYH A;  1Y07 A;  5FU7 B;  1M1G A;  4EMK B;  1VQ6 A;  3JCM h;  4M78 G;  5I2S A;  3DKM A;  1VQ5 T;  3CPW S;  2GFU A;  4ATO A;  3MEA A;  3JB9 G;  1DJ7 B;  1U1S A;  1ZHI A;  4OB2 B;  4Z02 A;  3L2V A;  4BE2 A;  5FRO A;  2KDS A;  5FRM A;  4HT9 A;  2FHD A;  3GF5 A;  4M7D E;  3H8Z A;  4M7D C;  1VQK A;  3E1S A;  1KHC A;  2ZGW A;  3WVE B;  3G71 A;  1NE8 A;  2DTO A;  3JCM W;  3JCM P;  5GMK j;  1R8O B;  2EQM A;  2LCL A;  4IUR A;  4MZP A;  1B34 A;  4OB3 B;  5KCH A;  1VQ8 T;  4LDY A;  1S72 T;  1YCY A;  5EG2 A;  4M7D D;  4Y91 A;  1M8V A;  1BIA A;  3BFM A;  5GAM j;  4QQG A;  4RCC A;  3TCJ A;  3CCL T;  3OYG A;  3I56 T;  3OYD A;  5A0L A;  2RI5 A;  3OB9 A;  1UGP B;  4C92 G;  4RMO A;  1VQ7 A;  1VIF A;  2EKO A;  2K5I A;  2IG0 A;  4M7A A;  1YJ9 T;  5LJ3 e;  3CME T;  2ZPE B;  1VQ6 T;  1KC8 C;  4C8Q G;  3ZBD A;  4M77 B;  1KD1 U;  2E10 A;  3CC4 A;  3HP9 A;  1VQP A;  4YTL A;  3GP8 A;  4BDZ A;  1K8A C;  2XHC A;  3PMT A;  3DLL A;  2BKD N;  2M1H A;  2RJF A;  1BI3 A;  3CC7 T;  2XIC A;  2VGN A;  4E7K A;  3RER A;  3CPW A;  3BDU A;  3G6E A;  3HFO A;  4C5G A;  5FLX E;  5KCO A;  4M77 F;  1G3W A;  4F7U B;  5A2Q E;  2DVE A;  3G4S A;  4ELY C;  3CCM A;  4C0D B;  3OYL A;  2RI3 A;  3V8L A;  4OGE A;  3OS1 A;  4JRI A;  4N0A A;  2HNI A;  3HSB A;  2M9U A;  3L42 A;  1I8F A;  4NL2 A;  3BW1 A;  4ZTJ A;  3SWN A;  4BY6 B;  4QVC A;  1Q82 U;  4FL6 A;  4F7U F;  4LDV A;  4BDY A;  1VQ7 T;  4M78 E;  2FL7 A;  4M78 C;  2RI2 A;  1M90 U;  1IRE B;  2FYK A;  2QQS A;  3LGL A;  4MDW A;  4C0F A;  3FB9 A;  3LW5 E;  3KXT A;  5CKD A;  3CC4 T;  3S6W A;  4M78 D;  5LJ5 f;  5GAN d;  4PJO B;  1P92 A;  1B34 B;  3X25 B;  3FLG A;  2RHY A;  2JTM A;  5J3B A;  2E5Q A;  2IVW A;  4VUB A;  3JB9 D;  3ASK A;  3MEV A;  2H3J A;  3TEE A;  2RM4 A;  4ZGJ B;  1YIT A;  2K4Y A;  3QG1 A;  4J7I A;  4JJN K;  5GAN g;  2I2L A;  3GOX A;  4PJO F;  3X28 B;  4PNO A;  1VQM T;  5FU6 B;  4RCB A;  3P8D A;  3CCM T;  1KD1 C;  2GFA A;  4KUD K;  2O4X A;  3OYJ A;  5CVI A;  5IN1 A;  1VQL A;  4IUV A;  1YJW T;  1Q86 C;  2KY9 A;  3CCJ T;  3LYI A;  4JLI A;  4M75 B;  2DZ9 A;  2RB6 A;  4PLL A;  4C92 E;  3GLX A;  5GMK l;  3LWI A;  2F5K A;  2VGM A;  5LJ5 h;  4J7F A;  2QA4 A;  4BD3 A;  2RJD A;  2DXU A;  3MET A;  3P8H A;  2V8K A;  3R6O A;  4O6J A;  4C8Q B;  5CAI A;  4C92 D;  3JB9 J;  1QVG S;  5DLQ E;  4JLG A;  2JVV A;  3OA6 A;  1MGQ A;  2MWP A;  3HL8 A;  2LQ8 A;  4M75 F;  1VQ4 A;  1W4S A;  3F70 A;  2JNG A;  4C8Q D;  3HKS A;  1NPP A;  2RJC A;  3SD4 A;  2WSC E;  5LJ3 f;  1X01 A;  3OYA A;  1Q82 C;  3EFS A;  3G7Z A;  2K2V A;  2GF7 A;  1QP3 A;  5D6W A;  4M77 A;  2L5Q A;  1YIT T;  2PUK B;  1M4Z A;  1QVP A;  2XDB A;  3CCR T;  2JTF A;  2LT1 A;  3NFC A;  5C6S A;  1BI0 A;  4N4I A;  3CCQ T;  1D3B B;  1YI2 T;  4QQD A;  2G3R A;  2ZCF B;  3HHT B;  4BI8 B;  2D6F A;  2LRQ A;  4KUI A;  1PSF A;  2XD0 A;  4D6W A;  4OP0 A;  4J6Y A;  3E9G A;  1N8R C;  5DM7 R;  2QEX T;  1VQO A;  3CMA T;  3H6Z A;  2DO3 A;  5GAN 6;  4F7U A;  5GAN e;  5GAM d;  1FWZ A;  4JDS A;  2P4T A;  5M9O A;  1UGR B;  3LGF A;  5GAO l;  3QKJ A;  2C06 A;  4ZTF A;  1IZ6 A;  5LJ3 h;  2KMT A;  2JUF A;  2ZZD A;  3QSU A;  2XI9 A;  1LOJ A;  3OMC A;  1NPR A;  4CRI A;  1OZ2 A;  2YHT A;  1QW1 A;  1KQ2 A;  5GMK i;  2X35 A;  4ZN1 A;  5GAM g;  3NTH A;  3CXC S;  2RD1 A;  4A4F A;  1Y96 B;  4XTV A;  3OMG A;  3Q1J A;  3OYK A;  3GNG A;  4JS5 A;  1U8R A;  2GCX A;  1K9M U;  1Y71 A;  4PLI A;  2A7Y A;  1WQW A;  3QYH B;  4DA4 A;  1Q7Y C;  4M7D B;  2O4X B;  1QVG A;  3I55 A;  2MMP A;  5KE2 A;  1H64 1;  3QPH A;  2RA2 A;  1N6A A;  4PJO A;  3OS2 A;  3WVD B;  2PVG B;  1BI2 A;  2RHU A;  3KBG A;  4OB1 B;  3MP6 A;  3J7A F;  3CCE T;  5GAO q;  3QHS A;  2LT4 A;  2OTL T;  3OS5 A;  5FU7 C;  2BIV A;  4EMK C;  1JB0 E;  4M7D F;  5IAY A;  3OYM A;  3S3O A;  2L89 A;  3V7S A;  5HK3 A;  2QQB A;  2MAM A;  1M1F A;  2EFI A;  2XG8 D;  3CCV T;  5CO7 A;  3QII A;  4DQ2 A;  1QVF S;  3E19 A;  3QJY A;  1G3Y A;  4QW2 A;  5CCA A;  2E6N A;  3JB9 H;  4M75 A;  4C92 A;  3MP1 A;  2EYQ A;  2VXF A;  1VQ9 A;  2K3Y A;  3HPW A;  5GMK e;  1WJQ A;  2LC4 A;  4C0G A;  4C8Q A;  4TVR A;  2DIQ A;  5DY9 A;  3RUX A;  3ZEH A;  3L2R A;  1NJI U;  4J8O A;  1VQK T;  1HXD A;  1G3T A;  1V29 B;  2MWO A;  3G71 T;  1VUB A;  2EJ9 A;  3FEO A;  3V7C A;  4A53 A;  5GAM e;  2HAX A;  2RHI A;  3CXC A;  3CCS A;  3A8O B;  2CZ7 B;  2RK2 A;  2NLU A;  2VUB A;  3JSC A;  3M59 A;  3M55 A;  2P0Q A;  4LD9 K;  3L2Q A;  2KAF A;  1I81 A;  4A4K A;  3L2W A;  4XU2 A;  2Y90 A;  4N4G A;  1O75 A;  4LDX A;  1JJ2 S;  3A8H B;  3MO8 A;  4XTY A;  3CBM A;  3JCM X;  1D3B A;  2DIG A;  1YIJ A;  3RMS A;  5CK9 A;  4M78 B;  3OBW A;  2RK1 A;  2CYZ B;  2DKG A;  3CC2 A;  3CD6 A;  3RIR A;  3M57 A;  2K57 A;  5CKF A;  2DTI A;  1LNX A;  2CKK A;  5GAN f;  2PVD B;  5D6X A;  1ZQ1 A;  4RG8 A;  2F5T X;  4XK8 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...