1OI1A

Crystal structure of the mbt domains of human scml2
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
207
Chain Sequence
FHWEEYLKETGSISAPSECFRQSQIPPVNDFKVGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGTCEKEGDLLQPPLGYQSWPMFLLETLNGSEMASATLFKKEPPKPPLNNFKVGMKLEAIDKKNPYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPPGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCML2 PROTEIN
publication title Crystal Structure of the Malignant Brain Tumor (Mbt) Repeats in Sex Comb on Midleg-Like 2 (Scml2).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Mbt
total genus 49
structure length 207
sequence length 211
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oi1A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oi1A01
2LCCA 1WGSA 3OYAA 3H6ZA 1WJRA 4NS5A 4E7JA 4EDUA 2RI5A 2DIQA 2EQUA 5KE3A 3L2QA 3OYNA 2K3XA 4GY5A 4FU6A 3OYEA 2HQEA 2VYTA 2X4XA 4E7KA 4II1A 2BIVA 2IG0A 2JTFA 2QQSA 4C5HA 2RHYA 3MO8A 4OVAA 3S6WA 5KCHA 5KE2A 2LDMA 3OYKA 3OYGA 2RHXA 3MEAA 1OZ2A 2BUDA 3E9GA 5J26A 2CKKA 3QKJA 3OYJA 3MP1A 2BKDN 3QJ6A 3PMIA 2R58A 2WACA 3L2VA 3E9FA 2E6NA 3F70A 3MEUA 4LD6A 2O4XB 4IUUA 1OYXA 3OYDA 3S3NA 3S3MA 1MHNA 5FROA 4E7IA 2P0KA 4IUQA 2X4YA 4PLLA 2L3RA 3PFSA 3GOXA 2RJEA 3OQ5A 4CRIA 2RO0A 4BACA 2GFUA 3P8DA 3META 4QVZA 1XNIA 2EFIA 3OY9A 4BE0A 4QQGA 4A4GA 4B9XA 1N27A 2RJFA 2X4WA 4HCZA 5M9OA 3DB4A 1KHCA 2EKOA 2EQMA 3KUFA 3QBYA 3C4SA 4N4GA 5C0MA 2M1HA 2L8DA 3O8VA 2RHIA 3MEWA 4Z02A 4E7HA 2QQRA 3PNWC 3ZEHA 2K3YA 2MWPA 3LGFA 3LLRA 2M16A 2O4XA 3PMTA 3OYHA 4A4FA 3Q1JA 3P8HA 4PLIA 1OZ3A 4RG2A 3MP8A 3L2UA 3OB9A 2JZ2A 2NLUA 1RI0A 2RHUA 3OYLA 4QQ6A 2DAQA 2M0OA 3ME9A 3H8ZA 4E7LA 4IUVA 2E5QA 3S3OA 3FDRA 4PL6A 3M9QA 2PQWA 3OYCA 2R57A 3SD4A 4B9WA 3DB3A 3OS1A 1WJQA 3MEVA 2MWOA 1G5VA 3OS2A 4IURA 3OYBA 3FLGA 2LTOA 3NTKA 5KCOA 4BE2A 4N4IA 2RI2A 2RJDA 3OS0A 4QQDA 4X34A 3ASKA 3FEOA 2RI3A 3L2WA 2X35A 2R5MA 5D6XA 4BE1A 2FHDA 4ZTJA 1WJSA 4IUPA 4QW2A 5FRMA 4IKFA 3LGLA 3EAEA 3OA6A 2YRVA 3UWNA 2LVMA 4ZTFA 4C5EA 4A4HA 4L59A 2GFAA 4Q5WA 4C5IA 3LH0A 2D9TA 3OMGA 3CEYA 4BDYA 3DLMA 5KH6A 3MP6A 4C5GA 3LX7A 4A4EA 2GF7A 3L2RA 4FL6A 5FRNA 3LYIA 2EQJA 2HQXA 4IUTA 3OYMA 3OYIA 5J39A 2F5KA 2RHZA 2RJCA 3FC3A 2G3RA 2R5AA 2DIGA 3L42A 1H3ZA 4N4HA 5CIUA 1SSFA 5D6WA 4BDZA 4UC4A 1OI1A 3QIIA 3NTHA 3UT1A 4BD3A 5C6SA 5IAYA 2LRQA 3NTIA 2L89A 5IN1A 3OMCA 3BDLA 5D6YA 3OYFA 2B8AA 2XK0A 2EQKA 2XDPA
chains in the Genus database with same CATH superfamily
4AMCA 2QA4Q 1TTHB 1RAAB 2KROA 2RI5A 2DRMA 3UF4A 1X75C 2PU9B 2H3JA 2XMFA 4LE9A 3OYNA 1SEMA 1S1NA 3I56A 2PUKB 1F1BB 4OGEA 4MMLA 4OF1A 5L23A 2LDMA 2J05A 1WHGA 4IIMA 1VQLQ 4M7DC 1U1SA 4AFUC 2QGGA 1PD1A 2V8KA 2NUTB 2IIMA 4IUQA 2KRSA 2B86A 2L3RA 3PT9A 1R8OB 1OEBA 2F2XA 2RO0A 4QVZA 3CMET 4BE0A 4B9XA 2HDAA 2HMAA 3CC2Q 2O9SA 2LT4A 4Z02A 3TCJA 1K9MU 4DEYA 1VQ9T 4J6WA 1QVFA 3CD6T 2HQHA 2K3YA 3LLRA 1KD1R 1M4ZA 2LNHB 3CCJT 3P8HA 4PLIA 2YLBA 1M9SA 1VQ6T 1QVFP 2MF2A 4C8QE 2Y4XA 1I8FA 2M0OA 1UHCA 3VV0A 4A54A 2YT6A 1WYXA 2MK5A 4F14A 1TH7A 3PVLA 4NOYA 3NTKA 5FW9A 4N4IA 4ZNXA 3I55T 4OP0A 1TUCA 2YRVA 3HRTA 5LJ5e 2LJ0A 1AEYA 1BKBA 4C92A 4M7DF 2E65A 1T3LA 1M8MA 5A0DA 2KDSA 5KH6A 3OW2A 2D6FA 2DZ9A 2J6OA 4IUTA 5J39A 1QWFA 2CZ7B 3EGXB 1Y07A 3OW2P 4O6JA 1K73R 1VQ7A 2GQVA 2RPNA 4J83A 1LCKA 5IN1A 1M8VA 2QDLA 1VYVA 2VGMA 1OPLA 2EQKA 4M77E 3JV3A 4C0GA 1UGQB 2EQUA 5KYNA 2IVWA 2VYTA 1H92A 4II1A 3OYLA 2P0PA 1QWEA 2K7AA 3OYJA 2BUDA 4JJNK 2BKDN 3THKA 2VWFA 5IHNA 3X20B 1KHIA 4P5NA 4OB3B 2AZSA 1YJNQ 4PJOG 1RI9A 3CMEA 1HYOA 3H0HA 4AT1B 1FWZA 1OOTA 2V8JA 3CC2T 2XI9A 3M0SA 2FL7A 2D0NA 2RJFA 2X51A 4XAXB 1UFFA 1M90R 4DEXA 4ZN1A 1I5LA 3CD6A 1VA7A 4XTUA 3VS7A 3CCJA 4HA8A 3M0QA 3PTAA 4XU2A 2FB7A 3QSUA 1VQ6A 2NUPA 2DXCA 3JCMJ 2OTJQ 1BCOA 2RMOA 3ME9A 1PKTA 4FT4A 4JUVA 4E7LA 4OB2B 5HKCA 1YNZA 2ESWA 3QDRB 3MEVA 2MWOA 2VXEA 2FYKA 3CQTA 2CREA 2XIDA 3HRSA 2M0YA 3I55A 2Y90A 3CCQT 2JN0A 2EKHA 5IHIA 2MOXA 2RQRA 2M02A 5FU7C 1VQ4Q 2K4YA 4KGVB 3OYYA 1KFZA 2EYYA 2O31A 4A4EA 4FL6A 3VS0A 3A8OB 4BI4A 4JZ3A 3FC3A 2K57A 2EYQA 1FMVA 3ZFJA 2VGNA 3CCLQ 5CIUA 2BZXA 5I22A 4RCCA 3NTHA 5AYFA 4FSXA 1UECA 1VQMQ 3MJXA 1M2OA 2I0NA 2CSIA 1E7OA 2V8IA 2XK0A 2CP7A 3JCMb 1KK7A 3SEMA 2QEXQ 4NS5A 4JZ4A 2E12A 1SRMA 4GY5A 4FU6A 3X24B 2COYA 1C6VX 1RAIB 3E9GA 4M7AE 4RTUA 2O4XB 5FROA 3CCVA 1KQSS 4PJMA 3REBB 2A0FB 3PIPA 1KG1A 3EFRA 2DXBA 2OJ2A 4F7UG 4HCZA 2A08A 1KHCA 1YFNA 2EW3A 2M1HA 4E7HA 1Q7YU 1NYGA 2BZYA 1UGVA 1FX7A 3L2ZA 1X01A 3QXEB 1RUWA 5KYYB 4Z8AA 1IREB 1N8RU 5GAMf 4Z89A 2DL8A 4M78D 4RTWA 3OYCA 1WIEA 3UATA 2K2MA 3SWNC 2HKNA 5A0LA 2FVUA 3CCQA 2DL3A 2BTTA 3FLGA 3RERA 2CS7A 4M7DB 3TEEA 1UJYA 1SSHA 2CP6A 1VQOA 2BZ8A 1M27C 2V1QA 3A8HB 1SRLA 4EPCA 7AT1B 3IQLA 2LVMA 3VUBA 2LNVA 1WXTA 1NJIU 2ZPGB 3TVTA 3E1SA 3LX7A 4WF2A 5FRNA 1D0YA 1VQMT 2VASA 2COZA 4HCBA 4RCBA 5GAN6 1QP2A 2DD5A 2AKKA 2E70A 1K9MR 1VQ5Q 3GNFB 2QYZA 1KQ2A 3UPUA 1D1CA 2X3XD 1YITT 3QYHB 2KVQG 2BIVA 2LJ3A 4ZGEB 1B34A 2EYZA 2E6ZA 4WCIA 1PSEA 4E7ZA 2KR3A 2VB6A 1K0SA 5J26A 2QASA 4JDSA 1QW1A 3DKMA 1MHNA 2GGRA 2PVDB 2KSSA 3UA6A 3VU3C 4PJOA 3J80E 1H641 3LWIA 4X1VA 3P8DA 5LJ3d 3INZA 5GANd 4A4KA 3JCMP 3JCMd 3EHQA 3R6OA 2L8DA 3MEWA 2XKOC 3RBBB 3CCMT 2FPFA 2SEMA 1RADB 4A4FA 2JZ2A 2YSQA 3I56Q 1JXOA 1T0HA 1WDXA 3CPWA 2EQIA 1QP3A 2DTIA 2ABLA 5LJ3j 4M7DG 1C0MA 3CPWP 2YWWA 3MCAB 4C8QD 1ZUUA 2FZCB 4E7SA 1Y57A 5D6XA 3M0UA 2RM4A 2ZPIB 4QW2A 5I2MA 2A7YA 2HKQB 1R77A 5GJWB 2JOYA 2DF6A 4Q5WA 4J9DA 3CEYA 5GAOr 5CKBA 3JB9H 1WLPB 1S72A 4JRKA 2RA2A 5GAOp 1Q86C 2QDYB 2C0TA 1WI7A 2F2WA 1FMKA 5LJ3h 3M59A 2O88A 5GANh 4A63B 1I5OB 3JCMh 3OYFA 1QLYA 1M90C 2YHTA 3M53A 2LP5A 3FB9A 2QQSA 4C5HA 3RMSA 3OS5A 3MO8A 2DYIA 1YCYA 1VQKA 1JBMA 3EGUA 2DM1A 3MHXA 4N0AA 4M77D 1EX4A 1WXUA 5LJ3g 3G4ST 2P0KA 1TS9A 3PFSA 3VS6A 4E2FB 3A8GB 2JTEA 2MIOA 1I07A 3JCMg 3T9NA 1XNIA 1HD3A 2W10A 4LDUA 1VQ7Q 2C06A 4R55A 5D7UA 4F7UA 1MMGA 5M9OA 3DB4A 1SF9A 3QBYA 1IZ6A 3CCMA 4GBQA 1VQNT 2E3IA 2AHJB 4VUBA 1RAHB 4RG2A 3I35A 5A0GA 1KQSA 4J6XA 1QCNA 4L5GA 2RHUA 1JJ2S 3CXCS 4X9CA 3RMQA 4IUVA 2JXBA 5KYWB 1K1ZA 3HPWA 1KQSP 1PKSA 2KRMA 2VVKA 4M78E 1ZSGA 3QZ9B 2GNCA 3ER0A 3HSBA 2FRYA 1TUGB 4KUDK 3CMEQ 4RKUE 1Y96A 1VIEA 2KBTA 2X35A 2L3QA 1BB9A 5CK9A 3I5RA 3EG0A 4M75D 1YHQA 3BDUA 5FRMA 2HSPA 3HL8A 3CD6Q 2LQKA 4XU1A 3CCJQ 2ZZDA 1VQ6Q 4Z88A 1HXDA 1ZLMA 2PTKA 1M5Q1 2X9HA 3OYMA 3AHUA 2JNGA 2EGAA 3JAME 2GTJA 3C0CA 3QZ5B 2A28A 2DBMA 2LQNA 2WSEE 1MMNA 4EMKA 3QIIA 1Q7YR 3G6ET 5GAN2 1YI2A 2MMPA 2B8AA 3OYBA 2EWNA 4YTLA 1M3AA 1WJRA 2YDLA 2I2LA 3RESA 3JB9I 4JRPA 3I55Q 1N8RR 3M54A 1M1KC 4DOVA 4C8QB 3L2QA 4LDVA 1O75A 3TQ7P 2RHYA 4D8DA 2NUZA 1T0JA 2JVVA 2DXTA 2RQUA 2K9GA 1PRMC 3G4SA 1OQKA 2KRNA 4J9BA 3SFMA 2F2VA 1GRIA 1U1TA 3GOXA 3EG9A 4BACA 1SHFA 1VUBA 4EMGA 3V7CA 2D1XA 1K8AU 4M7AD 4C0DB 4LN2A 1G83A 1VQNA 1NJIR 1ZSZA 5IHKA 3RDVA 3PNWC 5KYYA 5HCKA 5LJ3e 1YCSB 1OZ3A 3MP8A 1OU8A 2MAMA 4QQ6A 3JCMe 1ABQA 5FWCA 2R57A 1JRIA 3RUXA 3BW1A 4M77B 4FCYA 1PG5B 5FLXE 1JO8A 4M7DA 1K9MC 4OMLA 3CCVQ 5LL6S 4BE1A 4HCCA 1RACB 4OMMA 2Z0WA 1K9AA 2FEIA 1VYTA 3A98A 2HQXA 1YP5A 3CC4A 1OULA 1KQ1A 1Q95G 2DETA 4RMOA 3G6EA 5D6WA 2W0ZA 1WFWA 1O9SA 3UT1A 2CUBA 2DILA 2FO0A 1YIJT 2ATCB 2AIRB 3GIBA 5GAOn 3EGDA 1Q81U 3CCQQ 2LCCA 2DYBA 1IRXA 4EDUA 2DVJA 1WXBA 5L8RE 5KE3A 2FG0A 1VQOQ 1Q82C 2JTFA 2XU8A 3S6WA 1Q82U 2FZKB 1T3SA 1X27A 3QJ6A 2EBPA 4LUDA 2R58A 3RNJA 1UB4A 1TXQA 4IUUA 1B3QA 1SG5A 1YBYA 1I81A 4HVWA 2DL7A 1TWBA 1YJWT 1ACMB 1ZA2B 2MYSA 4QVCA 2RK2A 2HNIA 2VXFA 4JS5A 3P8BB 3X25B 3NFCA 3OBWA 3ZEHA 3KBGA 1U5SA 1CSKA 4PJOE 2GTOA 2ZCFB 1W4SA 3H41A 1Q86R 1E6GA 1ZQ1A 4RTXA 2DAQA 3WVEB 3QHSA 3M0RA 3CCVT 9ATCB 5KYXA 4E47A 1I1JA 3JCMQ 4J7FA 2WSCE 1BYMA 2ZPFB 4M7AB 1TU0B 1KC8U 3CCRA 2DL5A 2K6DA 4M75E 2CH4W 4C5GA 3ZBDA 2ZPHB 3VS2A 3V8LA 4FYWB 1HJDA 4LXCA 2EAYA 5HK0A 3CBMA 4N4HA 4GLKA 1YIJA 1TSFA 2HBWA 2DLPA 2IPOB 1JU5C 3VS5A 2CZ6B 3FJ5A 3A8LB 3BDLA 3M5AA 3TSZA 1VQOT 4M4ZA 3QG1A 3OBYA 3J7AF 4RTZA 2K3XA 2X4XA 5KE2A 1OX8A 4TVRA 1XQHA 1PM3A 2KGTA 3NMZC 2DRKA 1AVZC 3PMIA 5GAMh 4C92D 4HKEA 1RLQC 3QO3A 3X26B 2RQVA 1S72Q 4J9HA 4QVDA 1I4K1 1IB8A 1YJWA 3VS4A 5FWBA 4CC4B 3EFOA 2NYSA 2O01E 2V26A 4XU0A 1W2BS 3CCEA 4LDWA 2P4TA 1AZGB 2ZPEB 5CKHA 1YITQ 3FJPA 2KT1A 1KJWA 2NLUA 1UDLA 2QAZA 1M2VA 1VQKQ 2DBKA 3MPUB 4F16A 4F7UE 3DB3A 2KE9A 1MMDA 1U8RA 1Q7YC 1MNDA 3V8JA 1M1KR 1YWOA 2HAXA 4DBFA 2DO3A 2DX1A 2EJFA 1N8RC 3QYGB 2KY9A 2MCNA 4XTWA 4JPBW 2VKNA 3NPFA 3CCMQ 2L3SA 3C12A 4KGZB 2CSQA 2J6KA 3MP6A 4C8QC 1X2QA 3QUIA 1JXMA 1ZUKA 5CQYA 2DMOA 3N5BB 3QWXX 1R0CB 2YRDA 4FYVB 1AHJB 3A5ZB 3L42A 3REAB 1K8AR 4XU3A 1OI1A 2V1RA 5DY9A 1GBRA 2LRQA 3CCUT 2L3PA 5D6YA 3JCMX 3JB9D 2CP3A 3H6ZA 4HVUA 1NJIC 3SWNA 3VKIA 1VQ8T 3CPFA 4C0DC 2YLCA 1YHQQ 1S72T 2COWA 3PVQA 3L2VA 2LX9A 3MEUA 5A2QE 3S3NA 3S3MA 3MKDA 3V7RA 4PLLA 3OQ5A 3META 1CKBA 2HL5C 1PCXA 3R6NA 4M77C 3KUFA 3O5ZA 5C0MA 3X28B 1YI2Q 4R0KA 3SB2A 1VQKT 4JRQA 1GCQC 2E10A 2NUTA 1GCPA 4C8QF 2GBQA 1RI0A 2AK5A 4Y92A 1D1AA 2RH2A 1X6BA 3CMAA 2E5QA 2KEAA 3G4SQ 1Q81R 2AT1B 2CGHA 1PNJA 1N6AA 2DZCA 5ECAA 5GAN5 1GCQA 3CCST 1WPYA 2RQWA 1BIBA 1Q82R 1Y7XA 2DVEA 3NGPA 2YRCA 1VQNQ 2E3HA 4C0ZA 2YUOA 2QTXA 2K2VA 2CUDA 2E1HA 3L2RA 2NWMA 4OGCA 4J6YA 5GANj 2LQ8A 4M75C 2DTHA 4PFZA 1QVFS 1AWOA 1ZA1B 1QCFA 3CCUA 4BDZA 3M57A 4XQ3A 2YUNA 1H8KA 3EFSA 4BD3A 1AZEA 1EIFA 4M77F 2CZ1B 2X4JA 1VQ8A 2J7IA 1YHQT 2DL4A 4E7KA 1W70A 3M55A 2IG0A 3EGXA 2CP2A 4RUGA 1M1GA 3EG3A 4M78B 4A53A 1B7TA 1NE8A 2G6FX 2AZVA 4C92E 5I21A 1YN8A 1NYFA 3CC4Q 3RKXA 2LCLA 1YI2T 3G6EQ 3G71T 1KC8R 1N5ZA 3OW2S 5KCHA 3C4SA 3EG1A 4PJNA 2MWPA 3OYHA 5FU6B 3CC7A 1JEGA 1JQQA 4M7AC 5GANg 1XJWB 1ZBJA 1WX6A 3VUZA 4M75F 3S3OA 3FDRA 3DLLA 3TSWA 1WNLA 4B9WA 3GPLA 2JW4A 1G3SA 2LMJA 3OS1A 1W2BA 3CCSA 4OMOA 3BY7A 3I5SA 1OV3A 5CCAA 4PJOD 3KXTA 2LTOA 1BIAA 5CKFA 1W6XA 1W2BP 2LJ1A 4DOWA 4IUPA 2XDDA 4IKFA 4V2SA 4ZTFA 2LC4A 4KGXB 3LH0A 1TOVA 2KYBA 5GAN7 3H0IA 3A1PA 2ZGWA 4PJLA 1QVPA 1RLPC 4J8OA 4MMKA 2RK1A 3CBOA 4LUEA 1LOJA 2CZ0B 1UJ0A 3D7SB 5C6SA 3L1AA 1PSFA 2A36A 4J9CA 2SRCA 2XDPA 4FSSA 1X2KA 3C94A 1MNEA 2RF0A 1VQPT 1X69A 4OMQA 3PIOA 2RNAA 1BBZA 4Y28E 4M7AF 3VS3A 5CKEA 4M78G 2BE7D 2YXYA 4AFQC 5GJVB 3CCRQ 3CC4T 2E6NA 4LD6A 1G3YA 2QGFB 4LDYA 3OYDA 4O5VA 1ARKA 4ZN3A 2RJEA 3EH1A 3G71A 2RD1A 1GBQA 4AFSC 3LWHA 1NZ9A 3M56A 4A4GA 1YIJQ 2XG8D 2M51A 2VUBA 1MUZA 2VC8A 4EMHA 2RHIA 5CO7A 5GAOm 4EIKA 4ZGDB 3V8KA 1WQ7A 2O4XA 2DKGA 3HP9A 4JRIA 3OB9A 1U06A 2O9VA 1M3BA 2D8JA 3M9QA 5LJ5f 1K8AC 1WJQA 1SHGA 5HK3A 3RKYA 1BI0A 4MZPA 2D0QB 2E5KA 4QKUA 1QQJA 2OTLA 1YJWQ 2RJDA 3PGGA 4X34A 1IHVA 1X6OA 5GANe 3GLXA 4DBHA 3WVDB 3CCEQ 2JTMA 5GMKi 2D9TA 3OMGA 1K76A 2PNIA 3BE3A 4FT2A 2FPEA 1X43A 5GAOl 1B34B 2M9UA 1WHLA 1NPPA 1NLOC 4J9IA 1UTIA 1SSFA 2JUFA 1W1FA 3JRZA 1OPKA 5IAYA 5CR2A 3NTIA 3OMCA 1BK2A 2OAWA 1IGQA 1VQPA 4PJOB 1SPKA 3OYAA 1YJ9A 4E7JA 4WTOB 4LDXA 2RN8A 3M4YA 5DLOA 3J81E 3CCRT 1VOMA 1I0CA 4OVAA 2D8HA 2CKKA 3NHNA 2E4HA 1VIFA 4BI8B 4OB1B 3UA7A 1M30A 4ZGJB 5AT1B 5I2SA 4R56A 4J9FA 4ELYC 3ULRB 1Q81C 2ZAEA 4JS4A 2DEQA 2JT4A 1AWWA 4C8QG 4B6MA 4HVVA 4MDWA 2DXUA 4C92C 4AG2C 2P0QA 3JCMc 4LD9K 1PD0A 4M75B 4ATOA 3VYGA 2JS2A 3V7SA 3HRUA 2HCKA 3I9QA 1QVGS 5EG2A 1Z9QA 1R0BG 4JLGA 3H8ZA 1WHMA 2CH4A 4PL6A 2PQWA 1MMAA 4J5YA 4J7IA 2RQTA 1WZOA 5IXBA 2GQIA 4CI0C 2DNUA 3QWYA 1X6GA 4BE2A 3HTRA 2QA4T 1LVKA 3ASKA 3CCET 3RR6A 4HT8A 1D0XA 2F1LA 2ED1A 1GFCA 1N9RA 1NM7A 4QT7A 3GP8A 5HY6A 4J9GA 3UWNA 4HXJA 4MZTA 4C5EA 1G3WA 1VQLT 4C0FA 2QQ9A 4M77G 5GAMd 2EGCA 4FIBA 3OYIA 2RJCA 1P92A 4JJCA 1H3ZA 2DK3A 3CMAQ 1WQWA 2HBPA 2KI7A 1PC0A 1ZHIA 2EVRA 4BY6B 4M78C 3QDFA 1KC8C 2ROTA 4C92F 1JJ2A 2L0AA 2KQWA 3CXCA 4M7DD 4K11A 1ZX6A 5IT9E 5EC7A 2E64A 2ECZA 3CPWS 2MI6A 4XK8E 3OYEA 4F17A 1JJ2P 2A37A 3CXCP 1VQ9A 5GAN3 1MGQA 1AWXA 5GAMj 4F7UB 4F04B 4BI3A 2RHXA 3MEAA 1OZ2A 3QKJA 4M78A 3MP1A 2WACA 2E41A 3F70A 1OYXA 5FU6C 2F69A 2X4YA 2XDBA 2C0OA 3E2UA 2LZ6B 2EFIA 1NBEB 3CCUQ 1UE9A 4M75G 4BB7A 3TU4K 1UGRB 2EKOA 2XICA 3H0FA 4N4GA 3O8VA 2CT4A 1VQ8Q 1Y96B 3L2UA 3EH2A 1GXIE 3GBQA 4ELZC 3FIFA 3G7ZA 4IIOA 2J6FA 1TG0A 2JS0A 3SD4A 1A0NB 1J3TA 1ZUYA 4M78F 2QQBA 4PJJA 2QA4A 2KK4A 4J9EA 1BI2A 1UHFA 1NPRA 2JM9A 3OS0A 2RI3A 4EMKB 2EJ9A 3BFMA 5GAMg 1VQLA 3EAEA 3OA6A 1D3BB 1FXXA 5KYWA 4CC2A 4C5IA 4RTVA 1HK9A 3HFOA 2LQWA 3JB9F 3CMAT 3LYIA 3CC7Q 2F5KA 2RHZA 1V76A 4XTYA 5KYUB 1MV3A 2G3RA 2R5AA 2OI3A 1YJNT 4FW1A 4OMNA 3RIRA 4FW2A 4M7AG 3CC2A 2JMAA 3CCSQ 4HT9A 4KUIA 5DM7R 1WGSA 3EG9B 1XTDA 5GMKm 3M4GA 2KAFA 2HQEA 1UUEA 4DQ2A 1FMWA 1UGPB 4PNOA 4KULA 3OYGA 2OTJT 3AT1B 1ZSZB 1NLPC 3E9FA 2OX7A 1Y0MA 4LNPA 2QK0A 1IHWA 3M0TA 4C8QA 4MZMA 1OX9A 1FYNA 4FM4B 1QKXA 1VQ4T 3QPHA 1WA7A 2DE0X 4DA4A 4PKCC 5DLQE 5GAN4 1B07A 3LGFA 3HKSA 3PMTA 5GMKj 3SHWA 5GMKl 2QG9B 4CC7A 3CCLT 3LW5E 3U23A 3RKWA 1G5VA 3OS2A 4KBMB 1OU9A 3M58A 4DBQA 1BI3A 3G1JA 8AT1B 1QVGA 2RI2A 3G71Q 2DFUA 4KH1B 2QEXT 2DEUA 1SKUB 4ZTJA 1NEBA 2FHDA 2CT3A 2EYXA 4KH0B 4E6RA 3LGLA 1VYUA 1QVGP 3CC7T 3EGDB 4A4HA 4Y91A 2GFAA 2Y4YA 4PJOC 5GMKh 4M77A 4BDYA 4C92B 1KD1C 1YJNA 1K0XA 2EQJA 2CYZB 1KD1U 1QKWA 2DIGA 1BCMA 2JJ9A 4KT0E 1HSQA 2K5LA 2L5QA 4PFPA 3OSVA 5GAMe 4D6WA 2P4RA 1UEBA 2LX7A 3HFNA 4AG1C 1PWTA 3GF5A 2HD0A 4JJDA 5J3BA 2DIQA 2OTLQ 5CKDA 4XTXA 4M7DE 4PK4A 2OTJA 3H9NA 4NL2A 3OYKA 1DJ7B 1NEGA 5CQXA 4RG8A 1LPLA 2P84A 2DPPB 1U3OA 1D0ZA 2H8HA 4XTZA 2F5TX 2JMCA 1RAGB 4OMFB 2PZ1A 4E7IA 3C95A 2CP0A 1AD5A 4CRIA 1N9SA 2HL3A 4RTTA 2GFUA 2VV5A 4AFZC 1VQ4A 3LH5A 1K73C 2EPDA 2DJZA 5KYXB 4PFOA 4M75A 1K73U 2EQMA 1UG1A 4FYXB 2QI2A 3FRNA 2QQRA 1VQPQ 1ABOA 1QMCA 3A8MB 1YJ9Q 4PJOF 2K79A 3OSSC 3KFVA 2NUPB 2GCXA 3CCLA 2RB6A 1PHTA 1C1AA 1V1CA 1E6HA 1JB0E 1MV0B 2LCSA 1GFDA 1RAFB 1WHHA 3JCMW 8ATCB 1XOVA 1VQMA 2QQAA 2HEQA 1M3CA 1M1FA 4IURA 4D8KA 5LJ5d 2QEXA 2AKLA 1VQ5T 3VRZA 1Q86U 2HSEB 1CKAA 3L2WA 4ANJA 1GL5A 1V29B 1WJSA 3EG2A 4N0AC 1WHJA 2X3WD 4BY6C 1YITA 4ME7A 2YUPA 2K5FA 2DERA 4L59A 4JLIA 1M90U 1G8XA 4C92G 1ZBXA 2OAUA 3E19A 4L6V5 3DLMA 1BI1A 2GF7A 2A3LA 5GAOq 2EJGA 2K3BA 1AWJA 5LJ5j 1IO6A 5FU7B 1H3HA 5GAN8 4NL3A 4M7AA 1LNXA 2OTLT 4X9DA 1IXDA 4RTYA 3ZL7C 4OB0B 2MPXC 3Q1JA 2ZPBB 5I11A 1UGSB 2FRWA 2H3EB 1G3TA 4XTVA 3EFOB 3UDCA 3TREA 2KYMA 3I56T 1QCOA 1WHKA 2O2OA 2ENMA 1IGUA 1D1BA 2DA9A 5LJ3f 2KXCA 1LJOA 1K4US 5GANf 2L2PA 5LJ5h 1KSWA 2PVOB 1M2VB 4HCKA 3JCMf 3OY9A 2PUOB 2PVGB 4QQGA 1G2BA 3VS1A 5GMKe 1N27A 1YJ9T 2X4WA 2CP5A 2XD0A 4KRTA 3URGA 3VYHB 3HHTB 3EHRA 4JJBA 2LT1A 4OMPA 3M0PA 4FYYB 2DJQA 3JCMV 3PE0A 1NG2A 2BE9B 2M16A 2WSFE 4DBRA 1RL2A 2DTOA 4EMKC 5IH2A 1VQ9Q 2EGEA 4GLMA 1D09B 1PRLC 2K5IA 2C0IA 2ROLA 1YWPA 1EZZB 4F7UF 5LJ5g 3SDZA 5CVIA 1EFNA 2QXFA 1VQ5A 2J06A 2YUQA 6AT1B 3JB9G 2EIFA 2CDTA 3WXMB 5KCOA 2HZYA 3CBPA 4QQDA 2KXDA 3FEOA 2EYWA 3VJPA 1AOJA 2R5MA 2FPDA 2KMTA 1RAEB 1D3BA 2JM8A 1AT1B 4MDXA 4CC3A 4ESRA 1KIKA 2XHCA 1M1KU 3SWNB 2DD4A 5KYUA 3JB9J 3GNGA 1Y71A 2KNBB 5IXFA 2QTVA 1RABB 2ED0A 3JSCA 1TUDA 3QJYA 3VRYA 1Z9ZA 4UC4A 1ZSZC 4BUGA 5CAIA 2L89A 2FZGB 2KT8A 1VQ7T 4ORZA 1BU1A
chains in the Genus database with same CATH topology
2YHTA 5IT9E 3JB9D 3M53A 2E64A 3H6ZA 1NJIC 2RI5A 3SWNA 3CPWS 2MI6A 1X75C 2PU9B 2H3JA 4XK8E 3VKIA 3OYNA 3OYEA 1VQ8T 1VQ9A 3FB9A 5GAN3 2QQSA 1MGQA 4C5HA 2PUKB 3OS5A 3MO8A 4MMLA 1YCYA 3CPFA 4OF1A 2LDMA 4OGEA 2YLCA 4C0DC 4BI3A 4F7UB 2RHXA 3MEAA 1OZ2A 1VQKA 1S72T 1JBMA 3QKJA 4M78A 4M7DC 1U1SA 3MP1A 3MHXA 2WACA 3L2VA 4N0AA 2LX9A 2E41A 3F70A 3MEUA 4M77D 5A2QE 5LJ3g 1OYXA 2V8KA 5FU6C 3G4ST 3S3NA 3S3MA 3V7RA 2P0KA 2F69A 4IUQA 2X4YA 4PLLA 2L3RA 2XDBA 3PFSA 3A8GB 3PT9A 3OQ5A 1R8OB 2RO0A 3JCMg 3T9NA 3META 4QVZA 1XNIA 2EFIA 3CMET 4BE0A 4B9XA 4LDUA 4M75G 4BB7A 2C06A 4R55A 4F7UA 5M9OA 3DB4A 4M77C 3TU4K 1UGRB 2EKOA 3QBYA 2XICA 1IZ6A 3KUFA 4N4GA 5C0MA 3X28B 3CCMA 2LT4A 3O8VA 4Z02A 3TCJA 1VQ9T 1K9MU 4J6WA 1QVFA 1VQNT 3CD6T 2K3YA 2AHJB 3LLRA 3SB2A 4VUBA 1M4ZA 1VQKT 4JRQA 3CCJT 1Y96B 2E10A 3P8HA 4PLIA 4RG2A 2YLBA 5A0GA 3I56A 3L2UA 1KQSA 1GXIE 1M9SA 4J6XA 4C8QF 4L5GA 1VQ6T 4ELZC 2MF2A 1RI0A 2RHUA 3FIFA 3G7ZA 2Y4XA 4C8QE 3CXCS 1JJ2S 1I8FA 4X9CA 2M0OA 2RH2A 3RMQA 4IUVA 2E5QA 3CMAA 3VV0A 4A54A 3SD4A 3HPWA 2CGHA 4M78F 1N6AA 1TH7A 2QQBA 4M78E 3QZ9B 2DZCA 2KK4A 1BI2A 4NOYA 3ER0A 5GAN5 1NPRA 3NTKA 3CCST 3HSBA 4KUDK 1WPYA 4N4IA 4RKUE 3OS0A 1Y96A 2RI3A 1VIEA 2X35A 1BIBA 3I55T 4OP0A 1Y7XA 4EMKB 5CK9A 2DVEA 2EJ9A 5FRMA 4M75D 3BFMA 3BDUA 5GAMg 1YHQA 1VQLA 3HL8A 3EAEA 3OA6A 1D3BB 2YRVA 3HRTA 5LJ5e 1FXXA 2LQKA 4C0ZA 1BKBA 4XU1A 4C5IA 4C92A 4M7DF 2QTXA 2E65A 1HK9A 3HFOA 3JB9F 5A0DA 2K2VA 2KDSA 5KH6A 2ZZDA 3OW2A 2DZ9A 2E1HA 3L2RA 4OGCA 3CMAT 2D6FA 1HXDA 3LYIA 1M5Q1 4IUTA 4J6YA 5J39A 3OYMA 2F5KA 2RHZA 3AHUA 2CZ7B 2JNGA 4XTYA 5GANj 2G3RA 2LQ8A 2R5AA 4M75C 3JAME 1YJNT 2DTHA 1QVFS 1Y07A 3QZ5B 3RIRA 2WSEE 3CCUA 4O6JA 4BDZA 1VQ7A 3M57A 4XQ3A 2GQVA 3EFSA 4EMKA 3QIIA 4BD3A 4M7AG 3G6ET 4J83A 5IN1A 1M8VA 5GAN2 3CC2A 2VGMA 1EIFA 1YI2A 2MMPA 2B8AA 4HT9A 3OYBA 2EWNA 2EQKA 4M77F 4KUIA 5DM7R 4M77E 1WGSA 2CZ1B 4YTLA 1XTDA 2X4JA 1WJRA 3RESA 1VQ8A 2I2LA 4C0GA 3JB9I 4JRPA 1YHQT 1M1KC 3M54A 1UGQB 2EQUA 3M4GA 4C8QB 4DOVA 2IVWA 5GMKm 3L2QA 2KAFA 2HQEA 2VYTA 4LDVA 4E7KA 4II1A 3M55A 4DQ2A 2IG0A 3OYLA 1O75A 2RHYA 1UGPB 2P0PA 4PNOA 4KULA 3OYGA 2OTJT 3OYJA 2BUDA 1M1GA 2JVVA 4JJNK 2BKDN 2DXTA 3G4SA 4M78B 3X20B 3E9FA 4A53A 1NE8A 1KHIA 3SFMA 4P5NA 4OB3B 4PJOG 1U1TA 3GOXA 3CMEA 4C92E 5I21A 1FWZA 2V8JA 3RKXA 4C8QA 4BACA 3CC2T 2LCLA 2XI9A 4MZMA 1YI2T 2FL7A 1VUBA 4EMGA 3V7CA 3G71T 4FM4B 2RJFA 1K8AU 4M7AD 3OW2S 4XAXB 4C0DB 1VQ4T 1I5LA 4ZN1A 1VQNA 3CD6A 5KCHA 3QPHA 3C4SA 5GAMj 4XTUA 4DA4A 3CCJA 4HA8A 3PNWC 4PKCC 5DLQE 5GAN4 2MWPA 3LGFA 4XU2A 2FB7A 3PTAA 3QSUA 1VQ6A 3HKSA 3PMTA 5LJ3e 3OYHA 2DXCA 5FU6B 2QA4A 3CC7A 1OZ3A 3MP8A 3JCMJ 2MAMA 5GMKj 5GMKl 4M7AC 5GANg 4QQ6A 3JCMe 3ME9A 4FT4A 4JUVA 4E7LA 3VUZA 4M75F 4OB2B 3FDRA 5HKCA 3DLLA 3S3OA 3CCLT 1WNLA 2R57A 4B9WA 3GPLA 1JRIA 1G3SA 3RUXA 3OS1A 3QDRB 3MEVA 3BW1A 4M77B 3LW5E 5FLXE 1W2BA 2MWOA 3CCSA 2VXEA 2FYKA 3BY7A 3RKWA 4M7DA 1G5VA 2XIDA 3HRSA 3OS2A 1K9MC 5CCAA 4PJOD 4KBMB 3KXTA 3M58A 2LTOA 1BI3A 5LL6S 3I55A 1BIAA 2Y90A 5CKFA 3CCQT 1QVGA 2JN0A 2RI2A 2QEXT 5FU7C 4BE1A 4DOWA 4ZTJA 2FHDA 2K4YA 4IUPA 2XDDA 4HCCA 4IKFA 4V2SA 3LGLA 4ZTFA 3CC7T 4A4HA 4Y91A 2GFAA 3OYYA 2Y4YA 4PJOC 2LC4A 3LH0A 5GMKh 4M77A 5GAN7 4BDYA 4C92B 1KD1C 4A4EA 1YJNA 4FL6A 2EQJA 2HQXA 2CYZB 3A8OB 4BI4A 2ZGWA 1KD1U 1QVPA 3FC3A 2K57A 3CC4A 2EYQA 1KQ1A 2DIGA 4J8OA 4MMKA 3ZFJA 2RK1A 2VGNA 4KT0E 5CIUA 4RMOA 3G6EA 3CBOA 5D6WA 2K5LA 1LOJA 2CZ0B 2L5QA 4RCCA 3OSVA 1O9SA 3NTHA 4FSXA 5AYFA 3UT1A 4D6WA 3L1AA 1PSFA 1UEBA 5GAMe 5C6SA 3HFNA 1YIJT 3GIBA 5GAOn 2V8IA 2XK0A 3JCMb 2XDPA 1Q81U 2LCCA 3GF5A 2HD0A 3C94A 4NS5A 5J3BA 2E12A 4EDUA 2DIQA 5L8RE 1VQPT 5KE3A 5CKDA 4GY5A 4XTXA 4FU6A 4M7DE 2OTJA 3PIOA 1Q82C 2JTFA 2XU8A 4NL2A 3S6WA 3X24B 3OYKA 1DJ7B 1Q82U 4Y28E 4M7AF 3E9GA 5CQXA 5CKEA 4M78G 4RG8A 4M7AE 3QJ6A 2R58A 2DPPB 3CC4T 2E6NA 1UB4A 4LD6A 4XTZA 2F5TX 1G3YA 2O4XB 4OMFB 4IUUA 4LDYA 3OYDA 4O5VA 5FROA 4E7IA 3C95A 3CCVA 1KQSS 4ZN3A 1YBYA 1I81A 2RJEA 4CRIA 3G71A 1N9SA 2RD1A 2GFUA 2VV5A 3LWHA 1VQ4A 1NZ9A 3PIPA 1YJWT 3M56A 4A4GA 1K73C 1KG1A 2DJZA 3EFRA 2DXBA 2XG8D 4M75A 2VUBA 4F7UG 4QVCA 4HCZA 1K73U 2RK2A 2VC8A 4EMHA 1KHCA 2EQMA 2HNIA 2VXFA 4JS5A 2M1HA 2QI2A 3P8BB 2RHIA 3FRNA 4E7HA 1Q7YU 2QQRA 3X25B 3NFCA 3OBWA 5CO7A 3ZEHA 5GAOm 1FX7A 3A8MB 3L2ZA 3KBGA 4PJOF 3V8KA 4ZGDB 1WQ7A 1X01A 2O4XA 3OSSC 3QXEB 4PJOE 2DKGA 1IREB 3HP9A 4JRIA 1N8RU 5GAMf 3OB9A 2ZCFB 1W4SA 2GCXA 3CCLA 1ZQ1A 2RB6A 2DAQA 3WVEB 1JB0E 3QHSA 3M9QA 4M78D 3JCMW 5LJ5f 3CCVT 3OYCA 1K8AC 1XOVA 1VQMA 1WJQA 5HK3A 2QQAA 3SWNC 4E47A 3RKYA 2FVUA 1BI0A 5A0LA 3CCQA 1M1FA 4IURA 2D0QB 4MZPA 5LJ5d 3FLGA 2QEXA 3RERA 2CS7A 4M7DB 3TEEA 1VQ5T 1Q86U 2OTLA 3JCMQ 2RJDA 3PGGA 4X34A 4J7FA 1VQOA 3L2WA 2WSCE 1BYMA 2ZPFB 1X6OA 1V29B 1WJSA 3A8HB 4M7AB 5GANe 4N0AC 4BY6C 4EPCA 1YITA 3GLXA 1KC8U 4ME7A 2LVMA 3VUBA 2K5FA 3WVDB 2JTMA 4L59A 5GMKi 4JLIA 3CCRA 1M90U 2LNVA 4C92G 2D9TA 1ZBXA 2OAUA 3E19A 3OMGA 4L6V5 4M75E 1NJIU 2ZPGB 3DLMA 1BI1A 3E1SA 4C5GA 3LX7A 2ZPHB 2GF7A 3ZBDA 4FT2A 4WF2A 5FRNA 3V8LA 2A3LA 5GAOq 5GAOl 1B34B 1VQMT 2M9UA 2EAYA 2EJGA 5HK0A 1NPPA 3CBMA 4N4HA 1SSFA 2JUFA 4GLKA 5LJ5j 1YIJA 5FU7B 4HCBA 4RCBA 5GAN8 4NL3A 3JRZA 5GAN6 4M7AA 1LNXA 5IAYA 5CR2A 2OTLT 1QP2A 2DD5A 2E70A 3NTIA 2CZ6B 4X9DA 3OMCA 3A8LB 3BDLA 3M5AA 1VQOT 4OB0B 3GNFB 1VQPA 3Q1JA 4PJOB 1KQ2A 3QG1A 3OBYA 3OYAA 3UPUA 1YJ9A 3J7AF 4E7JA 2ZPBB 1UGSB 1YITT 4LDXA 2K3XA 3M4YA 3QYHB 5DLOA 3J81E 2X4XA 1G3TA 2KVQG 2BIVA 4ZGEB 3CCRT 1B34A 4XTVA 5KE2A 3UDCA 2E6ZA 4TVRA 4OVAA 1PSEA 3TREA 1XQHA 5J26A 2CKKA 3I56T 1VIFA 4JDSA 3PMIA 4BI8B 4OB1B 4ZGJB 5I2SA 5GAMh 4C92D 1QW1A 4HKEA 4R56A 3DKMA 4ELYC 3QO3A 5LJ3f 1MHNA 3X26B 1Q81C 1LJOA 2PVDB 2KSSA 3VU3C 5LJ5h 5GANf 4PJOA 3J80E 4QVDA 1H641 1I4K1 4JS4A 1YJWA 2DEQA 3LWIA 2PVOB 4C8QG 3JCMf 3P8DA 4MDWA 5LJ3d 3INZA 3OY9A 2PUOB 2PVGB 2DXUA 4QQGA 5GANd 4A4KA 5GMKe 1N27A 4C92C 2X4WA 1YJ9T 2P0QA 3JCMc 3JCMP 2O01E 4LD9K 3URGA 3VYHB 4XU0A 3HHTB 3JCMd 4M75B 3CCEA 1W2BS 2XD0A 3R6OA 4LDWA 3VYGA 2L8DA 2LT1A 3MEWA 4ATOA 2P4TA 2XKOC 2ZPEB 5CKHA 3V7SA 3HRUA 3JCMV 3CCMT 2M16A 3FJPA 1QVGS 2WSFE 5EG2A 4A4FA 1RL2A 2DTOA 2JZ2A 2NLUA 4EMKC 4JLGA 2K5IA 3H8ZA 4PL6A 4F7UF 5LJ5g 3CPWA 2PQWA 3SDZA 4F7UE 1QP3A 2DTIA 3DB3A 5CVIA 4J5YA 2QXFA 4J7IA 1VQ5A 5LJ3j 4M7DG 3RMSA 1U8RA 1Q7YC 3JB9G 2EIFA 3V8JA 3WXMB 4CI0C 5KCOA 4BE2A 2HAXA 2QA4T 3CBPA 3MCAB 4QQDA 4C8QD 2DO3A 3ASKA 3FEOA 3CCET 2EJFA 3VJPA 1N8RC 4HT8A 2R5MA 3QYGB 5D6XA 2KMTA 2KY9A 2RM4A 1D3BA 1N9RA 2ZPIB 4QW2A 5I2MA 2A7YA 4XTWA 3GP8A 5HY6A 3UWNA 4MDXA 4MZTA 4C5EA 1G3WA 2JOYA 4Q5WA 1VQLT 4C0FA 2QQ9A 2XHCA 3C12A 3CEYA 5GAOr 4M77G 5CKBA 5GAMd 3SWNB 1M1KU 3JB9H 3MP6A 4FIBA 2DD4A 4C8QC 3QUIA 1S72A 5CQYA 4JRKA 3JB9J 3GNGA 1Y71A 3OYIA 2RA2A 2RJCA 3N5BB 5GAOp 1Q86C 2QDYB 3JSCA 1P92A 3QJYA 1AHJB 3A5ZB 3L42A 1H3ZA 2DK3A 5LJ3h 1WQWA 3M59A 2HBPA 4UC4A 4XU3A 5GANh 1OI1A 1ZHIA 4BUGA 5DY9A 4BY6B 4M78C 2LRQA 5CAIA 2L89A 3CCUT 1KC8C 4C92F 1JJ2A 5D6YA 3JCMh 2KQWA 3CXCA 3JCMX 3OYFA 1VQ7T 4M7DD 1M90C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LCC A;  1WGS A;  3OYA A;  3H6Z A;  1WJR A;  4NS5 A;  4E7J A;  4EDU A;  2RI5 A;  2DIQ A;  2EQU A;  5KE3 A;  3L2Q A;  3OYN A;  2K3X A;  4GY5 A;  4FU6 A;  3OYE A;  2HQE A;  2VYT A;  2X4X A;  4E7K A;  4II1 A;  2BIV A;  2IG0 A;  2JTF A;  2QQS A;  4C5H A;  2RHY A;  3MO8 A;  4OVA A;  3S6W A;  5KCH A;  5KE2 A;  2LDM A;  3OYK A;  3OYG A;  2RHX A;  3MEA A;  1OZ2 A;  2BUD A;  3E9G A;  5J26 A;  2CKK A;  3QKJ A;  3OYJ A;  3MP1 A;  2BKD N;  3QJ6 A;  3PMI A;  2R58 A;  2WAC A;  3L2V A;  3E9F A;  2E6N A;  3F70 A;  3MEU A;  4LD6 A;  2O4X B;  4IUU A;  1OYX A;  3OYD A;  3S3N A;  3S3M A;  1MHN A;  5FRO A;  4E7I A;  2P0K A;  4IUQ A;  2X4Y A;  4PLL A;  2L3R A;  3PFS A;  3GOX A;  2RJE A;  3OQ5 A;  4CRI A;  2RO0 A;  4BAC A;  2GFU A;  3P8D A;  3MET A;  4QVZ A;  1XNI A;  2EFI A;  3OY9 A;  4BE0 A;  4QQG A;  4A4G A;  4B9X A;  1N27 A;  2RJF A;  2X4W A;  4HCZ A;  5M9O A;  3DB4 A;  1KHC A;  2EKO A;  2EQM A;  3KUF A;  3QBY A;  3C4S A;  4N4G A;  5C0M A;  2M1H A;  2L8D A;  3O8V A;  2RHI A;  3MEW A;  4Z02 A;  4E7H A;  2QQR A;  3PNW C;  3ZEH A;  2K3Y A;  2MWP A;  3LGF A;  3LLR A;  2M16 A;  2O4X A;  3PMT A;  3OYH A;  4A4F A;  3Q1J A;  3P8H A;  4PLI A;  1OZ3 A;  4RG2 A;  3MP8 A;  3L2U A;  3OB9 A;  2JZ2 A;  2NLU A;  1RI0 A;  2RHU A;  3OYL A;  4QQ6 A;  2DAQ A;  2M0O A;  3ME9 A;  3H8Z A;  4E7L A;  4IUV A;  2E5Q A;  3S3O A;  3FDR A;  4PL6 A;  3M9Q A;  2PQW A;  3OYC A;  2R57 A;  3SD4 A;  4B9W A;  3DB3 A;  3OS1 A;  1WJQ A;  3MEV A;  2MWO A;  1G5V A;  3OS2 A;  4IUR A;  3OYB A;  3FLG A;  2LTO A;  3NTK A;  5KCO A;  4BE2 A;  4N4I A;  2RI2 A;  2RJD A;  3OS0 A;  4QQD A;  4X34 A;  3ASK A;  3FEO A;  2RI3 A;  3L2W A;  2X35 A;  2R5M A;  5D6X A;  4BE1 A;  2FHD A;  4ZTJ A;  1WJS A;  4IUP A;  4QW2 A;  5FRM A;  4IKF A;  3LGL A;  3EAE A;  3OA6 A;  2YRV A;  3UWN A;  2LVM A;  4ZTF A;  4C5E A;  4A4H A;  4L59 A;  2GFA A;  4Q5W A;  4C5I A;  3LH0 A;  2D9T A;  3OMG A;  3CEY A;  4BDY A;  3DLM A;  5KH6 A;  3MP6 A;  4C5G A;  3LX7 A;  4A4E A;  2GF7 A;  3L2R A;  4FL6 A;  5FRN A;  3LYI A;  2EQJ A;  2HQX A;  4IUT A;  3OYM A;  3OYI A;  5J39 A;  2F5K A;  2RHZ A;  2RJC A;  3FC3 A;  2G3R A;  2R5A A;  2DIG A;  3L42 A;  1H3Z A;  4N4H A;  5CIU A;  1SSF A;  5D6W A;  4BDZ A;  4UC4 A;  1OI1 A;  3QII A;  3NTH A;  3UT1 A;  4BD3 A;  5C6S A;  5IAY A;  2LRQ A;  3NTI A;  2L89 A;  5IN1 A;  3OMC A;  3BDL A;  5D6Y A;  3OYF A;  2B8A A;  2XK0 A;  2EQK A;  2XDP A; 
#chains in the Genus database with same CATH topology
 4AMC A;  2QA4 Q;  1TTH B;  1RAA B;  2KRO A;  2RI5 A;  2DRM A;  3UF4 A;  1X75 C;  2PU9 B;  2H3J A;  2XMF A;  4LE9 A;  3OYN A;  1SEM A;  1S1N A;  3I56 A;  2PUK B;  1F1B B;  4OGE A;  4MML A;  4OF1 A;  5L23 A;  2LDM A;  2J05 A;  1WHG A;  4IIM A;  1VQL Q;  4M7D C;  1U1S A;  4AFU C;  2QGG A;  1PD1 A;  2V8K A;  2NUT B;  2IIM A;  4IUQ A;  2KRS A;  2B86 A;  2L3R A;  3PT9 A;  1R8O B;  1OEB A;  2F2X A;  2RO0 A;  4QVZ A;  3CME T;  4BE0 A;  4B9X A;  2HDA A;  2HMA A;  3CC2 Q;  2O9S A;  2LT4 A;  4Z02 A;  3TCJ A;  1K9M U;  4DEY A;  1VQ9 T;  4J6W A;  1QVF A;  3CD6 T;  2HQH A;  2K3Y A;  3LLR A;  1KD1 R;  1M4Z A;  2LNH B;  3CCJ T;  3P8H A;  4PLI A;  2YLB A;  1M9S A;  1VQ6 T;  1QVF P;  2MF2 A;  4C8Q E;  2Y4X A;  1I8F A;  2M0O A;  1UHC A;  3VV0 A;  4A54 A;  2YT6 A;  1WYX A;  2MK5 A;  4F14 A;  1TH7 A;  3PVL A;  4NOY A;  3NTK A;  5FW9 A;  4N4I A;  4ZNX A;  3I55 T;  4OP0 A;  1TUC A;  2YRV A;  3HRT A;  5LJ5 e;  2LJ0 A;  1AEY A;  1BKB A;  4C92 A;  4M7D F;  2E65 A;  1T3L A;  1M8M A;  5A0D A;  2KDS A;  5KH6 A;  3OW2 A;  2D6F A;  2DZ9 A;  2J6O A;  4IUT A;  5J39 A;  1QWF A;  2CZ7 B;  3EGX B;  1Y07 A;  3OW2 P;  4O6J A;  1K73 R;  1VQ7 A;  2GQV A;  2RPN A;  4J83 A;  1LCK A;  5IN1 A;  1M8V A;  2QDL A;  1VYV A;  2VGM A;  1OPL A;  2EQK A;  4M77 E;  3JV3 A;  4C0G A;  1UGQ B;  2EQU A;  5KYN A;  2IVW A;  2VYT A;  1H92 A;  4II1 A;  3OYL A;  2P0P A;  1QWE A;  2K7A A;  3OYJ A;  2BUD A;  4JJN K;  2BKD N;  3THK A;  2VWF A;  5IHN A;  3X20 B;  1KHI A;  4P5N A;  4OB3 B;  2AZS A;  1YJN Q;  4PJO G;  1RI9 A;  3CME A;  1HYO A;  3H0H A;  4AT1 B;  1FWZ A;  1OOT A;  2V8J A;  3CC2 T;  2XI9 A;  3M0S A;  2FL7 A;  2D0N A;  2RJF A;  2X51 A;  4XAX B;  1UFF A;  1M90 R;  4DEX A;  4ZN1 A;  1I5L A;  3CD6 A;  1VA7 A;  4XTU A;  3VS7 A;  3CCJ A;  4HA8 A;  3M0Q A;  3PTA A;  4XU2 A;  2FB7 A;  3QSU A;  1VQ6 A;  2NUP A;  2DXC A;  3JCM J;  2OTJ Q;  1BCO A;  2RMO A;  3ME9 A;  1PKT A;  4FT4 A;  4JUV A;  4E7L A;  4OB2 B;  5HKC A;  1YNZ A;  2ESW A;  3QDR B;  3MEV A;  2MWO A;  2VXE A;  2FYK A;  3CQT A;  2CRE A;  2XID A;  3HRS A;  2M0Y A;  3I55 A;  2Y90 A;  3CCQ T;  2JN0 A;  2EKH A;  5IHI A;  2MOX A;  2RQR A;  2M02 A;  5FU7 C;  1VQ4 Q;  2K4Y A;  4KGV B;  3OYY A;  1KFZ A;  2EYY A;  2O31 A;  4A4E A;  4FL6 A;  3VS0 A;  3A8O B;  4BI4 A;  4JZ3 A;  3FC3 A;  2K57 A;  2EYQ A;  1FMV A;  3ZFJ A;  2VGN A;  3CCL Q;  5CIU A;  2BZX A;  5I22 A;  4RCC A;  3NTH A;  5AYF A;  4FSX A;  1UEC A;  1VQM Q;  3MJX A;  1M2O A;  2I0N A;  2CSI A;  1E7O A;  2V8I A;  2XK0 A;  2CP7 A;  3JCM b;  1KK7 A;  3SEM A;  2QEX Q;  4NS5 A;  4JZ4 A;  2E12 A;  1SRM A;  4GY5 A;  4FU6 A;  3X24 B;  2COY A;  1C6V X;  1RAI B;  3E9G A;  4M7A E;  4RTU A;  2O4X B;  5FRO A;  3CCV A;  1KQS S;  4PJM A;  3REB B;  2A0F B;  3PIP A;  1KG1 A;  3EFR A;  2DXB A;  2OJ2 A;  4F7U G;  4HCZ A;  2A08 A;  1KHC A;  1YFN A;  2EW3 A;  2M1H A;  4E7H A;  1Q7Y U;  1NYG A;  2BZY A;  1UGV A;  1FX7 A;  3L2Z A;  1X01 A;  3QXE B;  1RUW A;  5KYY B;  4Z8A A;  1IRE B;  1N8R U;  5GAM f;  4Z89 A;  2DL8 A;  4M78 D;  4RTW A;  3OYC A;  1WIE A;  3UAT A;  2K2M A;  3SWN C;  2HKN A;  5A0L A;  2FVU A;  3CCQ A;  2DL3 A;  2BTT A;  3FLG A;  3RER A;  2CS7 A;  4M7D B;  3TEE A;  1UJY A;  1SSH A;  2CP6 A;  1VQO A;  2BZ8 A;  1M27 C;  2V1Q A;  3A8H B;  1SRL A;  4EPC A;  7AT1 B;  3IQL A;  2LVM A;  3VUB A;  2LNV A;  1WXT A;  1NJI U;  2ZPG B;  3TVT A;  3E1S A;  3LX7 A;  4WF2 A;  5FRN A;  1D0Y A;  1VQM T;  2VAS A;  2COZ A;  4HCB A;  4RCB A;  5GAN 6;  1QP2 A;  2DD5 A;  2AKK A;  2E70 A;  1K9M R;  1VQ5 Q;  3GNF B;  2QYZ A;  1KQ2 A;  3UPU A;  1D1C A;  2X3X D;  1YIT T;  3QYH B;  2KVQ G;  2BIV A;  2LJ3 A;  4ZGE B;  1B34 A;  2EYZ A;  2E6Z A;  4WCI A;  1PSE A;  4E7Z A;  2KR3 A;  2VB6 A;  1K0S A;  5J26 A;  2QAS A;  4JDS A;  1QW1 A;  3DKM A;  1MHN A;  2GGR A;  2PVD B;  2KSS A;  3UA6 A;  3VU3 C;  4PJO A;  3J80 E;  1H64 1;  3LWI A;  4X1V A;  3P8D A;  5LJ3 d;  3INZ A;  5GAN d;  4A4K A;  3JCM P;  3JCM d;  3EHQ A;  3R6O A;  2L8D A;  3MEW A;  2XKO C;  3RBB B;  3CCM T;  2FPF A;  2SEM A;  1RAD B;  4A4F A;  2JZ2 A;  2YSQ A;  3I56 Q;  1JXO A;  1T0H A;  1WDX A;  3CPW A;  2EQI A;  1QP3 A;  2DTI A;  2ABL A;  5LJ3 j;  4M7D G;  1C0M A;  3CPW P;  2YWW A;  3MCA B;  4C8Q D;  1ZUU A;  2FZC B;  4E7S A;  1Y57 A;  5D6X A;  3M0U A;  2RM4 A;  2ZPI B;  4QW2 A;  5I2M A;  2A7Y A;  2HKQ B;  1R77 A;  5GJW B;  2JOY A;  2DF6 A;  4Q5W A;  4J9D A;  3CEY A;  5GAO r;  5CKB A;  3JB9 H;  1WLP B;  1S72 A;  4JRK A;  2RA2 A;  5GAO p;  1Q86 C;  2QDY B;  2C0T A;  1WI7 A;  2F2W A;  1FMK A;  5LJ3 h;  3M59 A;  2O88 A;  5GAN h;  4A63 B;  1I5O B;  3JCM h;  3OYF A;  1QLY A;  1M90 C;  2YHT A;  3M53 A;  2LP5 A;  3FB9 A;  2QQS A;  4C5H A;  3RMS A;  3OS5 A;  3MO8 A;  2DYI A;  1YCY A;  1VQK A;  1JBM A;  3EGU A;  2DM1 A;  3MHX A;  4N0A A;  4M77 D;  1EX4 A;  1WXU A;  5LJ3 g;  3G4S T;  2P0K A;  1TS9 A;  3PFS A;  3VS6 A;  4E2F B;  3A8G B;  2JTE A;  2MIO A;  1I07 A;  3JCM g;  3T9N A;  1XNI A;  1HD3 A;  2W10 A;  4LDU A;  1VQ7 Q;  2C06 A;  4R55 A;  5D7U A;  4F7U A;  1MMG A;  5M9O A;  3DB4 A;  1SF9 A;  3QBY A;  1IZ6 A;  3CCM A;  4GBQ A;  1VQN T;  2E3I A;  2AHJ B;  4VUB A;  1RAH B;  4RG2 A;  3I35 A;  5A0G A;  1KQS A;  4J6X A;  1QCN A;  4L5G A;  2RHU A;  1JJ2 S;  3CXC S;  4X9C A;  3RMQ A;  4IUV A;  2JXB A;  5KYW B;  1K1Z A;  3HPW A;  1KQS P;  1PKS A;  2KRM A;  2VVK A;  4M78 E;  1ZSG A;  3QZ9 B;  2GNC A;  3ER0 A;  3HSB A;  2FRY A;  1TUG B;  4KUD K;  3CME Q;  4RKU E;  1Y96 A;  1VIE A;  2KBT A;  2X35 A;  2L3Q A;  1BB9 A;  5CK9 A;  3I5R A;  3EG0 A;  4M75 D;  1YHQ A;  3BDU A;  5FRM A;  2HSP A;  3HL8 A;  3CD6 Q;  2LQK A;  4XU1 A;  3CCJ Q;  2ZZD A;  1VQ6 Q;  4Z88 A;  1HXD A;  1ZLM A;  2PTK A;  1M5Q 1;  2X9H A;  3OYM A;  3AHU A;  2JNG A;  2EGA A;  3JAM E;  2GTJ A;  3C0C A;  3QZ5 B;  2A28 A;  2DBM A;  2LQN A;  2WSE E;  1MMN A;  4EMK A;  3QII A;  1Q7Y R;  3G6E T;  5GAN 2;  1YI2 A;  2MMP A;  2B8A A;  3OYB A;  2EWN A;  4YTL A;  1M3A A;  1WJR A;  2YDL A;  2I2L A;  3RES A;  3JB9 I;  4JRP A;  3I55 Q;  1N8R R;  3M54 A;  1M1K C;  4DOV A;  4C8Q B;  3L2Q A;  4LDV A;  1O75 A;  3TQ7 P;  2RHY A;  4D8D A;  2NUZ A;  1T0J A;  2JVV A;  2DXT A;  2RQU A;  2K9G A;  1PRM C;  3G4S A;  1OQK A;  2KRN A;  4J9B A;  3SFM A;  2F2V A;  1GRI A;  1U1T A;  3GOX A;  3EG9 A;  4BAC A;  1SHF A;  1VUB A;  4EMG A;  3V7C A;  2D1X A;  1K8A U;  4M7A D;  4C0D B;  4LN2 A;  1G83 A;  1VQN A;  1NJI R;  1ZSZ A;  5IHK A;  3RDV A;  3PNW C;  5KYY A;  5HCK A;  5LJ3 e;  1YCS B;  1OZ3 A;  3MP8 A;  1OU8 A;  2MAM A;  4QQ6 A;  3JCM e;  1ABQ A;  5FWC A;  2R57 A;  1JRI A;  3RUX A;  3BW1 A;  4M77 B;  4FCY A;  1PG5 B;  5FLX E;  1JO8 A;  4M7D A;  1K9M C;  4OML A;  3CCV Q;  5LL6 S;  4BE1 A;  4HCC A;  1RAC B;  4OMM A;  2Z0W A;  1K9A A;  2FEI A;  1VYT A;  3A98 A;  2HQX A;  1YP5 A;  3CC4 A;  1OUL A;  1KQ1 A;  1Q95 G;  2DET A;  4RMO A;  3G6E A;  5D6W A;  2W0Z A;  1WFW A;  1O9S A;  3UT1 A;  2CUB A;  2DIL A;  2FO0 A;  1YIJ T;  2ATC B;  2AIR B;  3GIB A;  5GAO n;  3EGD A;  1Q81 U;  3CCQ Q;  2LCC A;  2DYB A;  1IRX A;  4EDU A;  2DVJ A;  1WXB A;  5L8R E;  5KE3 A;  2FG0 A;  1VQO Q;  1Q82 C;  2JTF A;  2XU8 A;  3S6W A;  1Q82 U;  2FZK B;  1T3S A;  1X27 A;  3QJ6 A;  2EBP A;  4LUD A;  2R58 A;  3RNJ A;  1UB4 A;  1TXQ A;  4IUU A;  1B3Q A;  1SG5 A;  1YBY A;  1I81 A;  4HVW A;  2DL7 A;  1TWB A;  1YJW T;  1ACM B;  1ZA2 B;  2MYS A;  4QVC A;  2RK2 A;  2HNI A;  2VXF A;  4JS5 A;  3P8B B;  3X25 B;  3NFC A;  3OBW A;  3ZEH A;  3KBG A;  1U5S A;  1CSK A;  4PJO E;  2GTO A;  2ZCF B;  1W4S A;  3H41 A;  1Q86 R;  1E6G A;  1ZQ1 A;  4RTX A;  2DAQ A;  3WVE B;  3QHS A;  3M0R A;  3CCV T;  9ATC B;  5KYX A;  4E47 A;  1I1J A;  3JCM Q;  4J7F A;  2WSC E;  1BYM A;  2ZPF B;  4M7A B;  1TU0 B;  1KC8 U;  3CCR A;  2DL5 A;  2K6D A;  4M75 E;  2CH4 W;  4C5G A;  3ZBD A;  2ZPH B;  3VS2 A;  3V8L A;  4FYW B;  1HJD A;  4LXC A;  2EAY A;  5HK0 A;  3CBM A;  4N4H A;  4GLK A;  1YIJ A;  1TSF A;  2HBW A;  2DLP A;  2IPO B;  1JU5 C;  3VS5 A;  2CZ6 B;  3FJ5 A;  3A8L B;  3BDL A;  3M5A A;  3TSZ A;  1VQO T;  4M4Z A;  3QG1 A;  3OBY A;  3J7A F;  4RTZ A;  2K3X A;  2X4X A;  5KE2 A;  1OX8 A;  4TVR A;  1XQH A;  1PM3 A;  2KGT A;  3NMZ C;  2DRK A;  1AVZ C;  3PMI A;  5GAM h;  4C92 D;  4HKE A;  1RLQ C;  3QO3 A;  3X26 B;  2RQV A;  1S72 Q;  4J9H A;  4QVD A;  1I4K 1;  1IB8 A;  1YJW A;  3VS4 A;  5FWB A;  4CC4 B;  3EFO A;  2NYS A;  2O01 E;  2V26 A;  4XU0 A;  1W2B S;  3CCE A;  4LDW A;  2P4T A;  1AZG B;  2ZPE B;  5CKH A;  1YIT Q;  3FJP A;  2KT1 A;  1KJW A;  2NLU A;  1UDL A;  2QAZ A;  1M2V A;  1VQK Q;  2DBK A;  3MPU B;  4F16 A;  4F7U E;  3DB3 A;  2KE9 A;  1MMD A;  1U8R A;  1Q7Y C;  1MND A;  3V8J A;  1M1K R;  1YWO A;  2HAX A;  4DBF A;  2DO3 A;  2DX1 A;  2EJF A;  1N8R C;  3QYG B;  2KY9 A;  2MCN A;  4XTW A;  4JPB W;  2VKN A;  3NPF A;  3CCM Q;  2L3S A;  3C12 A;  4KGZ B;  2CSQ A;  2J6K A;  3MP6 A;  4C8Q C;  1X2Q A;  3QUI A;  1JXM A;  1ZUK A;  5CQY A;  2DMO A;  3N5B B;  3QWX X;  1R0C B;  2YRD A;  4FYV B;  1AHJ B;  3A5Z B;  3L42 A;  3REA B;  1K8A R;  4XU3 A;  1OI1 A;  2V1R A;  5DY9 A;  1GBR A;  2LRQ A;  3CCU T;  2L3P A;  5D6Y A;  3JCM X;  3JB9 D;  2CP3 A;  3H6Z A;  4HVU A;  1NJI C;  3SWN A;  3VKI A;  1VQ8 T;  3CPF A;  4C0D C;  2YLC A;  1YHQ Q;  1S72 T;  2COW A;  3PVQ A;  3L2V A;  2LX9 A;  3MEU A;  5A2Q E;  3S3N A;  3S3M A;  3MKD A;  3V7R A;  4PLL A;  3OQ5 A;  3MET A;  1CKB A;  2HL5 C;  1PCX A;  3R6N A;  4M77 C;  3KUF A;  3O5Z A;  5C0M A;  3X28 B;  1YI2 Q;  4R0K A;  3SB2 A;  1VQK T;  4JRQ A;  1GCQ C;  2E10 A;  2NUT A;  1GCP A;  4C8Q F;  2GBQ A;  1RI0 A;  2AK5 A;  4Y92 A;  1D1A A;  2RH2 A;  1X6B A;  3CMA A;  2E5Q A;  2KEA A;  3G4S Q;  1Q81 R;  2AT1 B;  2CGH A;  1PNJ A;  1N6A A;  2DZC A;  5ECA A;  5GAN 5;  1GCQ A;  3CCS T;  1WPY A;  2RQW A;  1BIB A;  1Q82 R;  1Y7X A;  2DVE A;  3NGP A;  2YRC A;  1VQN Q;  2E3H A;  4C0Z A;  2YUO A;  2QTX A;  2K2V A;  2CUD A;  2E1H A;  3L2R A;  2NWM A;  4OGC A;  4J6Y A;  5GAN j;  2LQ8 A;  4M75 C;  2DTH A;  4PFZ A;  1QVF S;  1AWO A;  1ZA1 B;  1QCF A;  3CCU A;  4BDZ A;  3M57 A;  4XQ3 A;  2YUN A;  1H8K A;  3EFS A;  4BD3 A;  1AZE A;  1EIF A;  4M77 F;  2CZ1 B;  2X4J A;  1VQ8 A;  2J7I A;  1YHQ T;  2DL4 A;  4E7K A;  1W70 A;  3M55 A;  2IG0 A;  3EGX A;  2CP2 A;  4RUG A;  1M1G A;  3EG3 A;  4M78 B;  4A53 A;  1B7T A;  1NE8 A;  2G6F X;  2AZV A;  4C92 E;  5I21 A;  1YN8 A;  1NYF A;  3CC4 Q;  3RKX A;  2LCL A;  1YI2 T;  3G6E Q;  3G71 T;  1KC8 R;  1N5Z A;  3OW2 S;  5KCH A;  3C4S A;  3EG1 A;  4PJN A;  2MWP A;  3OYH A;  5FU6 B;  3CC7 A;  1JEG A;  1JQQ A;  4M7A C;  5GAN g;  1XJW B;  1ZBJ A;  1WX6 A;  3VUZ A;  4M75 F;  3S3O A;  3FDR A;  3DLL A;  3TSW A;  1WNL A;  4B9W A;  3GPL A;  2JW4 A;  1G3S A;  2LMJ A;  3OS1 A;  1W2B A;  3CCS A;  4OMO A;  3BY7 A;  3I5S A;  1OV3 A;  5CCA A;  4PJO D;  3KXT A;  2LTO A;  1BIA A;  5CKF A;  1W6X A;  1W2B P;  2LJ1 A;  4DOW A;  4IUP A;  2XDD A;  4IKF A;  4V2S A;  4ZTF A;  2LC4 A;  4KGX B;  3LH0 A;  1TOV A;  2KYB A;  5GAN 7;  3H0I A;  3A1P A;  2ZGW A;  4PJL A;  1QVP A;  1RLP C;  4J8O A;  4MMK A;  2RK1 A;  3CBO A;  4LUE A;  1LOJ A;  2CZ0 B;  1UJ0 A;  3D7S B;  5C6S A;  3L1A A;  1PSF A;  2A36 A;  4J9C A;  2SRC A;  2XDP A;  4FSS A;  1X2K A;  3C94 A;  1MNE A;  2RF0 A;  1VQP T;  1X69 A;  4OMQ A;  3PIO A;  2RNA A;  1BBZ A;  4Y28 E;  4M7A F;  3VS3 A;  5CKE A;  4M78 G;  2BE7 D;  2YXY A;  4AFQ C;  5GJV B;  3CCR Q;  3CC4 T;  2E6N A;  4LD6 A;  1G3Y A;  2QGF B;  4LDY A;  3OYD A;  4O5V A;  1ARK A;  4ZN3 A;  2RJE A;  3EH1 A;  3G71 A;  2RD1 A;  1GBQ A;  4AFS C;  3LWH A;  1NZ9 A;  3M56 A;  4A4G A;  1YIJ Q;  2XG8 D;  2M51 A;  2VUB A;  1MUZ A;  2VC8 A;  4EMH A;  2RHI A;  5CO7 A;  5GAO m;  4EIK A;  4ZGD B;  3V8K A;  1WQ7 A;  2O4X A;  2DKG A;  3HP9 A;  4JRI A;  3OB9 A;  1U06 A;  2O9V A;  1M3B A;  2D8J A;  3M9Q A;  5LJ5 f;  1K8A C;  1WJQ A;  1SHG A;  5HK3 A;  3RKY A;  1BI0 A;  4MZP A;  2D0Q B;  2E5K A;  4QKU A;  1QQJ A;  2OTL A;  1YJW Q;  2RJD A;  3PGG A;  4X34 A;  1IHV A;  1X6O A;  5GAN e;  3GLX A;  4DBH A;  3WVD B;  3CCE Q;  2JTM A;  5GMK i;  2D9T A;  3OMG A;  1K76 A;  2PNI A;  3BE3 A;  4FT2 A;  2FPE A;  1X43 A;  5GAO l;  1B34 B;  2M9U A;  1WHL A;  1NPP A;  1NLO C;  4J9I A;  1UTI A;  1SSF A;  2JUF A;  1W1F A;  3JRZ A;  1OPK A;  5IAY A;  5CR2 A;  3NTI A;  3OMC A;  1BK2 A;  2OAW A;  1IGQ A;  1VQP A;  4PJO B;  1SPK A;  3OYA A;  1YJ9 A;  4E7J A;  4WTO B;  4LDX A;  2RN8 A;  3M4Y A;  5DLO A;  3J81 E;  3CCR T;  1VOM A;  1I0C A;  4OVA A;  2D8H A;  2CKK A;  3NHN A;  2E4H A;  1VIF A;  4BI8 B;  4OB1 B;  3UA7 A;  1M30 A;  4ZGJ B;  5AT1 B;  5I2S A;  4R56 A;  4J9F A;  4ELY C;  3ULR B;  1Q81 C;  2ZAE A;  4JS4 A;  2DEQ A;  2JT4 A;  1AWW A;  4C8Q G;  4B6M A;  4HVV A;  4MDW A;  2DXU A;  4C92 C;  4AG2 C;  2P0Q A;  3JCM c;  4LD9 K;  1PD0 A;  4M75 B;  4ATO A;  3VYG A;  2JS2 A;  3V7S A;  3HRU A;  2HCK A;  3I9Q A;  1QVG S;  5EG2 A;  1Z9Q A;  1R0B G;  4JLG A;  3H8Z A;  1WHM A;  2CH4 A;  4PL6 A;  2PQW A;  1MMA A;  4J5Y A;  4J7I A;  2RQT A;  1WZO A;  5IXB A;  2GQI A;  4CI0 C;  2DNU A;  3QWY A;  1X6G A;  4BE2 A;  3HTR A;  2QA4 T;  1LVK A;  3ASK A;  3CCE T;  3RR6 A;  4HT8 A;  1D0X A;  2F1L A;  2ED1 A;  1GFC A;  1N9R A;  1NM7 A;  4QT7 A;  3GP8 A;  5HY6 A;  4J9G A;  3UWN A;  4HXJ A;  4MZT A;  4C5E A;  1G3W A;  1VQL T;  4C0F A;  2QQ9 A;  4M77 G;  5GAM d;  2EGC A;  4FIB A;  3OYI A;  2RJC A;  1P92 A;  4JJC A;  1H3Z A;  2DK3 A;  3CMA Q;  1WQW A;  2HBP A;  2KI7 A;  1PC0 A;  1ZHI A;  2EVR A;  4BY6 B;  4M78 C;  3QDF A;  1KC8 C;  2ROT A;  4C92 F;  1JJ2 A;  2L0A A;  2KQW A;  3CXC A;  4M7D D;  4K11 A;  1ZX6 A;  5IT9 E;  5EC7 A;  2E64 A;  2ECZ A;  3CPW S;  2MI6 A;  4XK8 E;  3OYE A;  4F17 A;  1JJ2 P;  2A37 A;  3CXC P;  1VQ9 A;  5GAN 3;  1MGQ A;  1AWX A;  5GAM j;  4F7U B;  4F04 B;  4BI3 A;  2RHX A;  3MEA A;  1OZ2 A;  3QKJ A;  4M78 A;  3MP1 A;  2WAC A;  2E41 A;  3F70 A;  1OYX A;  5FU6 C;  2F69 A;  2X4Y A;  2XDB A;  2C0O A;  3E2U A;  2LZ6 B;  2EFI A;  1NBE B;  3CCU Q;  1UE9 A;  4M75 G;  4BB7 A;  3TU4 K;  1UGR B;  2EKO A;  2XIC A;  3H0F A;  4N4G A;  3O8V A;  2CT4 A;  1VQ8 Q;  1Y96 B;  3L2U A;  3EH2 A;  1GXI E;  3GBQ A;  4ELZ C;  3FIF A;  3G7Z A;  4IIO A;  2J6F A;  1TG0 A;  2JS0 A;  3SD4 A;  1A0N B;  1J3T A;  1ZUY A;  4M78 F;  2QQB A;  4PJJ A;  2QA4 A;  2KK4 A;  4J9E A;  1BI2 A;  1UHF A;  1NPR A;  2JM9 A;  3OS0 A;  2RI3 A;  4EMK B;  2EJ9 A;  3BFM A;  5GAM g;  1VQL A;  3EAE A;  3OA6 A;  1D3B B;  1FXX A;  5KYW A;  4CC2 A;  4C5I A;  4RTV A;  1HK9 A;  3HFO A;  2LQW A;  3JB9 F;  3CMA T;  3LYI A;  3CC7 Q;  2F5K A;  2RHZ A;  1V76 A;  4XTY A;  5KYU B;  1MV3 A;  2G3R A;  2R5A A;  2OI3 A;  1YJN T;  4FW1 A;  4OMN A;  3RIR A;  4FW2 A;  4M7A G;  3CC2 A;  2JMA A;  3CCS Q;  4HT9 A;  4KUI A;  5DM7 R;  1WGS A;  3EG9 B;  1XTD A;  5GMK m;  3M4G A;  2KAF A;  2HQE A;  1UUE A;  4DQ2 A;  1FMW A;  1UGP B;  4PNO A;  4KUL A;  3OYG A;  2OTJ T;  3AT1 B;  1ZSZ B;  1NLP C;  3E9F A;  2OX7 A;  1Y0M A;  4LNP A;  2QK0 A;  1IHW A;  3M0T A;  4C8Q A;  4MZM A;  1OX9 A;  1FYN A;  4FM4 B;  1QKX A;  1VQ4 T;  3QPH A;  1WA7 A;  2DE0 X;  4DA4 A;  4PKC C;  5DLQ E;  5GAN 4;  1B07 A;  3LGF A;  3HKS A;  3PMT A;  5GMK j;  3SHW A;  5GMK l;  2QG9 B;  4CC7 A;  3CCL T;  3LW5 E;  3U23 A;  3RKW A;  1G5V A;  3OS2 A;  4KBM B;  1OU9 A;  3M58 A;  4DBQ A;  1BI3 A;  3G1J A;  8AT1 B;  1QVG A;  2RI2 A;  3G71 Q;  2DFU A;  4KH1 B;  2QEX T;  2DEU A;  1SKU B;  4ZTJ A;  1NEB A;  2FHD A;  2CT3 A;  2EYX A;  4KH0 B;  4E6R A;  3LGL A;  1VYU A;  1QVG P;  3CC7 T;  3EGD B;  4A4H A;  4Y91 A;  2GFA A;  2Y4Y A;  4PJO C;  5GMK h;  4M77 A;  4BDY A;  4C92 B;  1KD1 C;  1YJN A;  1K0X A;  2EQJ A;  2CYZ B;  1KD1 U;  1QKW A;  2DIG A;  1BCM A;  2JJ9 A;  4KT0 E;  1HSQ A;  2K5L A;  2L5Q A;  4PFP A;  3OSV A;  5GAM e;  4D6W A;  2P4R A;  1UEB A;  2LX7 A;  3HFN A;  4AG1 C;  1PWT A;  3GF5 A;  2HD0 A;  4JJD A;  5J3B A;  2DIQ A;  2OTL Q;  5CKD A;  4XTX A;  4M7D E;  4PK4 A;  2OTJ A;  3H9N A;  4NL2 A;  3OYK A;  1DJ7 B;  1NEG A;  5CQX A;  4RG8 A;  1LPL A;  2P84 A;  2DPP B;  1U3O A;  1D0Z A;  2H8H A;  4XTZ A;  2F5T X;  2JMC A;  1RAG B;  4OMF B;  2PZ1 A;  4E7I A;  3C95 A;  2CP0 A;  1AD5 A;  4CRI A;  1N9S A;  2HL3 A;  4RTT A;  2GFU A;  2VV5 A;  4AFZ C;  1VQ4 A;  3LH5 A;  1K73 C;  2EPD A;  2DJZ A;  5KYX B;  4PFO A;  4M75 A;  1K73 U;  2EQM A;  1UG1 A;  4FYX B;  2QI2 A;  3FRN A;  2QQR A;  1VQP Q;  1ABO A;  1QMC A;  3A8M B;  1YJ9 Q;  4PJO F;  2K79 A;  3OSS C;  3KFV A;  2NUP B;  2GCX A;  3CCL A;  2RB6 A;  1PHT A;  1C1A A;  1V1C A;  1E6H A;  1JB0 E;  1MV0 B;  2LCS A;  1GFD A;  1RAF B;  1WHH A;  3JCM W;  8ATC B;  1XOV A;  1VQM A;  2QQA A;  2HEQ A;  1M3C A;  1M1F A;  4IUR A;  4D8K A;  5LJ5 d;  2QEX A;  2AKL A;  1VQ5 T;  3VRZ A;  1Q86 U;  2HSE B;  1CKA A;  3L2W A;  4ANJ A;  1GL5 A;  1V29 B;  1WJS A;  3EG2 A;  4N0A C;  1WHJ A;  2X3W D;  4BY6 C;  1YIT A;  4ME7 A;  2YUP A;  2K5F A;  2DER A;  4L59 A;  4JLI A;  1M90 U;  1G8X A;  4C92 G;  1ZBX A;  2OAU A;  3E19 A;  4L6V 5;  3DLM A;  1BI1 A;  2GF7 A;  2A3L A;  5GAO q;  2EJG A;  2K3B A;  1AWJ A;  5LJ5 j;  1IO6 A;  5FU7 B;  1H3H A;  5GAN 8;  4NL3 A;  4M7A A;  1LNX A;  2OTL T;  4X9D A;  1IXD A;  4RTY A;  3ZL7 C;  4OB0 B;  2MPX C;  3Q1J A;  2ZPB B;  5I11 A;  1UGS B;  2FRW A;  2H3E B;  1G3T A;  4XTV A;  3EFO B;  3UDC A;  3TRE A;  2KYM A;  3I56 T;  1QCO A;  1WHK A;  2O2O A;  2ENM A;  1IGU A;  1D1B A;  2DA9 A;  5LJ3 f;  2KXC A;  1LJO A;  1K4U S;  5GAN f;  2L2P A;  5LJ5 h;  1KSW A;  2PVO B;  1M2V B;  4HCK A;  3JCM f;  3OY9 A;  2PUO B;  2PVG B;  4QQG A;  1G2B A;  3VS1 A;  5GMK e;  1N27 A;  1YJ9 T;  2X4W A;  2CP5 A;  2XD0 A;  4KRT A;  3URG A;  3VYH B;  3HHT B;  3EHR A;  4JJB A;  2LT1 A;  4OMP A;  3M0P A;  4FYY B;  2DJQ A;  3JCM V;  3PE0 A;  1NG2 A;  2BE9 B;  2M16 A;  2WSF E;  4DBR A;  1RL2 A;  2DTO A;  4EMK C;  5IH2 A;  1VQ9 Q;  2EGE A;  4GLM A;  1D09 B;  1PRL C;  2K5I A;  2C0I A;  2ROL A;  1YWP A;  1EZZ B;  4F7U F;  5LJ5 g;  3SDZ A;  5CVI A;  1EFN A;  2QXF A;  1VQ5 A;  2J06 A;  2YUQ A;  6AT1 B;  3JB9 G;  2EIF A;  2CDT A;  3WXM B;  5KCO A;  2HZY A;  3CBP A;  4QQD A;  2KXD A;  3FEO A;  2EYW A;  3VJP A;  1AOJ A;  2R5M A;  2FPD A;  2KMT A;  1RAE B;  1D3B A;  2JM8 A;  1AT1 B;  4MDX A;  4CC3 A;  4ESR A;  1KIK A;  2XHC A;  1M1K U;  3SWN B;  2DD4 A;  5KYU A;  3JB9 J;  3GNG A;  1Y71 A;  2KNB B;  5IXF A;  2QTV A;  1RAB B;  2ED0 A;  3JSC A;  1TUD A;  3QJY A;  3VRY A;  1Z9Z A;  4UC4 A;  1ZSZ C;  4BUG A;  5CAI A;  2L89 A;  2FZG B;  2KT8 A;  1VQ7 T;  4ORZ A;  1BU1 A; 
#chains in the Genus database with same CATH homology
 2YHT A;  5IT9 E;  3JB9 D;  3M53 A;  2E64 A;  3H6Z A;  1NJI C;  2RI5 A;  3SWN A;  3CPW S;  2MI6 A;  1X75 C;  2PU9 B;  2H3J A;  4XK8 E;  3VKI A;  3OYN A;  3OYE A;  1VQ8 T;  1VQ9 A;  3FB9 A;  5GAN 3;  2QQS A;  1MGQ A;  4C5H A;  2PUK B;  3OS5 A;  3MO8 A;  4MML A;  1YCY A;  3CPF A;  4OF1 A;  2LDM A;  4OGE A;  2YLC A;  4C0D C;  4BI3 A;  4F7U B;  2RHX A;  3MEA A;  1OZ2 A;  1VQK A;  1S72 T;  1JBM A;  3QKJ A;  4M78 A;  4M7D C;  1U1S A;  3MP1 A;  3MHX A;  2WAC A;  3L2V A;  4N0A A;  2LX9 A;  2E41 A;  3F70 A;  3MEU A;  4M77 D;  5A2Q E;  5LJ3 g;  1OYX A;  2V8K A;  5FU6 C;  3G4S T;  3S3N A;  3S3M A;  3V7R A;  2P0K A;  2F69 A;  4IUQ A;  2X4Y A;  4PLL A;  2L3R A;  2XDB A;  3PFS A;  3A8G B;  3PT9 A;  3OQ5 A;  1R8O B;  2RO0 A;  3JCM g;  3T9N A;  3MET A;  4QVZ A;  1XNI A;  2EFI A;  3CME T;  4BE0 A;  4B9X A;  4LDU A;  4M75 G;  4BB7 A;  2C06 A;  4R55 A;  4F7U A;  5M9O A;  3DB4 A;  4M77 C;  3TU4 K;  1UGR B;  2EKO A;  3QBY A;  2XIC A;  1IZ6 A;  3KUF A;  4N4G A;  5C0M A;  3X28 B;  3CCM A;  2LT4 A;  3O8V A;  4Z02 A;  3TCJ A;  1VQ9 T;  1K9M U;  4J6W A;  1QVF A;  1VQN T;  3CD6 T;  2K3Y A;  2AHJ B;  3LLR A;  3SB2 A;  4VUB A;  1M4Z A;  1VQK T;  4JRQ A;  3CCJ T;  1Y96 B;  2E10 A;  3P8H A;  4PLI A;  4RG2 A;  2YLB A;  5A0G A;  3I56 A;  3L2U A;  1KQS A;  1GXI E;  1M9S A;  4J6X A;  4C8Q F;  4L5G A;  1VQ6 T;  4ELZ C;  2MF2 A;  1RI0 A;  2RHU A;  3FIF A;  3G7Z A;  2Y4X A;  4C8Q E;  3CXC S;  1JJ2 S;  1I8F A;  4X9C A;  2M0O A;  2RH2 A;  3RMQ A;  4IUV A;  2E5Q A;  3CMA A;  3VV0 A;  4A54 A;  3SD4 A;  3HPW A;  2CGH A;  4M78 F;  1N6A A;  1TH7 A;  2QQB A;  4M78 E;  3QZ9 B;  2DZC A;  2KK4 A;  1BI2 A;  4NOY A;  3ER0 A;  5GAN 5;  1NPR A;  3NTK A;  3CCS T;  3HSB A;  4KUD K;  1WPY A;  4N4I A;  4RKU E;  3OS0 A;  1Y96 A;  2RI3 A;  1VIE A;  2X35 A;  1BIB A;  3I55 T;  4OP0 A;  1Y7X A;  4EMK B;  5CK9 A;  2DVE A;  2EJ9 A;  5FRM A;  4M75 D;  3BFM A;  3BDU A;  5GAM g;  1YHQ A;  1VQL A;  3HL8 A;  3EAE A;  3OA6 A;  1D3B B;  2YRV A;  3HRT A;  5LJ5 e;  1FXX A;  2LQK A;  4C0Z A;  1BKB A;  4XU1 A;  4C5I A;  4C92 A;  4M7D F;  2QTX A;  2E65 A;  1HK9 A;  3HFO A;  3JB9 F;  5A0D A;  2K2V A;  2KDS A;  5KH6 A;  2ZZD A;  3OW2 A;  2DZ9 A;  2E1H A;  3L2R A;  4OGC A;  3CMA T;  2D6F A;  1HXD A;  3LYI A;  1M5Q 1;  4IUT A;  4J6Y A;  5J39 A;  3OYM A;  2F5K A;  2RHZ A;  3AHU A;  2CZ7 B;  2JNG A;  4XTY A;  5GAN j;  2G3R A;  2LQ8 A;  2R5A A;  4M75 C;  3JAM E;  1YJN T;  2DTH A;  1QVF S;  1Y07 A;  3QZ5 B;  3RIR A;  2WSE E;  3CCU A;  4O6J A;  4BDZ A;  1VQ7 A;  3M57 A;  4XQ3 A;  2GQV A;  3EFS A;  4EMK A;  3QII A;  4BD3 A;  4M7A G;  3G6E T;  4J83 A;  5IN1 A;  1M8V A;  5GAN 2;  3CC2 A;  2VGM A;  1EIF A;  1YI2 A;  2MMP A;  2B8A A;  4HT9 A;  3OYB A;  2EWN A;  2EQK A;  4M77 F;  4KUI A;  5DM7 R;  4M77 E;  1WGS A;  2CZ1 B;  4YTL A;  1XTD A;  2X4J A;  1WJR A;  3RES A;  1VQ8 A;  2I2L A;  4C0G A;  3JB9 I;  4JRP A;  1YHQ T;  1M1K C;  3M54 A;  1UGQ B;  2EQU A;  3M4G A;  4C8Q B;  4DOV A;  2IVW A;  5GMK m;  3L2Q A;  2KAF A;  2HQE A;  2VYT A;  4LDV A;  4E7K A;  4II1 A;  3M55 A;  4DQ2 A;  2IG0 A;  3OYL A;  1O75 A;  2RHY A;  1UGP B;  2P0P A;  4PNO A;  4KUL A;  3OYG A;  2OTJ T;  3OYJ A;  2BUD A;  1M1G A;  2JVV A;  4JJN K;  2BKD N;  2DXT A;  3G4S A;  4M78 B;  3X20 B;  3E9F A;  4A53 A;  1NE8 A;  1KHI A;  3SFM A;  4P5N A;  4OB3 B;  4PJO G;  1U1T A;  3GOX A;  3CME A;  4C92 E;  5I21 A;  1FWZ A;  2V8J A;  3RKX A;  4C8Q A;  4BAC A;  3CC2 T;  2LCL A;  2XI9 A;  4MZM A;  1YI2 T;  2FL7 A;  1VUB A;  4EMG A;  3V7C A;  3G71 T;  4FM4 B;  2RJF A;  1K8A U;  4M7A D;  3OW2 S;  4XAX B;  4C0D B;  1VQ4 T;  1I5L A;  4ZN1 A;  1VQN A;  3CD6 A;  5KCH A;  3QPH A;  3C4S A;  5GAM j;  4XTU A;  4DA4 A;  3CCJ A;  4HA8 A;  3PNW C;  4PKC C;  5DLQ E;  5GAN 4;  2MWP A;  3LGF A;  4XU2 A;  2FB7 A;  3PTA A;  3QSU A;  1VQ6 A;  3HKS A;  3PMT A;  5LJ3 e;  3OYH A;  2DXC A;  5FU6 B;  2QA4 A;  3CC7 A;  1OZ3 A;  3MP8 A;  3JCM J;  2MAM A;  5GMK j;  5GMK l;  4M7A C;  5GAN g;  4QQ6 A;  3JCM e;  3ME9 A;  4FT4 A;  4JUV A;  4E7L A;  3VUZ A;  4M75 F;  4OB2 B;  3FDR A;  5HKC A;  3DLL A;  3S3O A;  3CCL T;  1WNL A;  2R57 A;  4B9W A;  3GPL A;  1JRI A;  1G3S A;  3RUX A;  3OS1 A;  3QDR B;  3MEV A;  3BW1 A;  4M77 B;  3LW5 E;  5FLX E;  1W2B A;  2MWO A;  3CCS A;  2VXE A;  2FYK A;  3BY7 A;  3RKW A;  4M7D A;  1G5V A;  2XID A;  3HRS A;  3OS2 A;  1K9M C;  5CCA A;  4PJO D;  4KBM B;  3KXT A;  3M58 A;  2LTO A;  1BI3 A;  5LL6 S;  3I55 A;  1BIA A;  2Y90 A;  5CKF A;  3CCQ T;  1QVG A;  2JN0 A;  2RI2 A;  2QEX T;  5FU7 C;  4BE1 A;  4DOW A;  4ZTJ A;  2FHD A;  2K4Y A;  4IUP A;  2XDD A;  4HCC A;  4IKF A;  4V2S A;  3LGL A;  4ZTF A;  3CC7 T;  4A4H A;  4Y91 A;  2GFA A;  3OYY A;  2Y4Y A;  4PJO C;  2LC4 A;  3LH0 A;  5GMK h;  4M77 A;  5GAN 7;  4BDY A;  4C92 B;  1KD1 C;  4A4E A;  1YJN A;  4FL6 A;  2EQJ A;  2HQX A;  2CYZ B;  3A8O B;  4BI4 A;  2ZGW A;  1KD1 U;  1QVP A;  3FC3 A;  2K57 A;  3CC4 A;  2EYQ A;  1KQ1 A;  2DIG A;  4J8O A;  4MMK A;  3ZFJ A;  2RK1 A;  2VGN A;  4KT0 E;  5CIU A;  4RMO A;  3G6E A;  3CBO A;  5D6W A;  2K5L A;  1LOJ A;  2CZ0 B;  2L5Q A;  4RCC A;  3OSV A;  1O9S A;  3NTH A;  4FSX A;  5AYF A;  3UT1 A;  4D6W A;  3L1A A;  1PSF A;  1UEB A;  5GAM e;  5C6S A;  3HFN A;  1YIJ T;  3GIB A;  5GAO n;  2V8I A;  2XK0 A;  3JCM b;  2XDP A;  1Q81 U;  2LCC A;  3GF5 A;  2HD0 A;  3C94 A;  4NS5 A;  5J3B A;  2E12 A;  4EDU A;  2DIQ A;  5L8R E;  1VQP T;  5KE3 A;  5CKD A;  4GY5 A;  4XTX A;  4FU6 A;  4M7D E;  2OTJ A;  3PIO A;  1Q82 C;  2JTF A;  2XU8 A;  4NL2 A;  3S6W A;  3X24 B;  3OYK A;  1DJ7 B;  1Q82 U;  4Y28 E;  4M7A F;  3E9G A;  5CQX A;  5CKE A;  4M78 G;  4RG8 A;  4M7A E;  3QJ6 A;  2R58 A;  2DPP B;  3CC4 T;  2E6N A;  1UB4 A;  4LD6 A;  4XTZ A;  2F5T X;  1G3Y A;  2O4X B;  4OMF B;  4IUU A;  4LDY A;  3OYD A;  4O5V A;  5FRO A;  4E7I A;  3C95 A;  3CCV A;  1KQS S;  4ZN3 A;  1YBY A;  1I81 A;  2RJE A;  4CRI A;  3G71 A;  1N9S A;  2RD1 A;  2GFU A;  2VV5 A;  3LWH A;  1VQ4 A;  1NZ9 A;  3PIP A;  1YJW T;  3M56 A;  4A4G A;  1K73 C;  1KG1 A;  2DJZ A;  3EFR A;  2DXB A;  2XG8 D;  4M75 A;  2VUB A;  4F7U G;  4QVC A;  4HCZ A;  1K73 U;  2RK2 A;  2VC8 A;  4EMH A;  1KHC A;  2EQM A;  2HNI A;  2VXF A;  4JS5 A;  2M1H A;  2QI2 A;  3P8B B;  2RHI A;  3FRN A;  4E7H A;  1Q7Y U;  2QQR A;  3X25 B;  3NFC A;  3OBW A;  5CO7 A;  3ZEH A;  5GAO m;  1FX7 A;  3A8M B;  3L2Z A;  3KBG A;  4PJO F;  3V8K A;  4ZGD B;  1WQ7 A;  1X01 A;  2O4X A;  3OSS C;  3QXE B;  4PJO E;  2DKG A;  1IRE B;  3HP9 A;  4JRI A;  1N8R U;  5GAM f;  3OB9 A;  2ZCF B;  1W4S A;  2GCX A;  3CCL A;  1ZQ1 A;  2RB6 A;  2DAQ A;  3WVE B;  1JB0 E;  3QHS A;  3M9Q A;  4M78 D;  3JCM W;  5LJ5 f;  3CCV T;  3OYC A;  1K8A C;  1XOV A;  1VQM A;  1WJQ A;  5HK3 A;  2QQA A;  3SWN C;  4E47 A;  3RKY A;  2FVU A;  1BI0 A;  5A0L A;  3CCQ A;  1M1F A;  4IUR A;  2D0Q B;  4MZP A;  5LJ5 d;  3FLG A;  2QEX A;  3RER A;  2CS7 A;  4M7D B;  3TEE A;  1VQ5 T;  1Q86 U;  2OTL A;  3JCM Q;  2RJD A;  3PGG A;  4X34 A;  4J7F A;  1VQO A;  3L2W A;  2WSC E;  1BYM A;  2ZPF B;  1X6O A;  1V29 B;  1WJS A;  3A8H B;  4M7A B;  5GAN e;  4N0A C;  4BY6 C;  4EPC A;  1YIT A;  3GLX A;  1KC8 U;  4ME7 A;  2LVM A;  3VUB A;  2K5F A;  3WVD B;  2JTM A;  4L59 A;  5GMK i;  4JLI A;  3CCR A;  1M90 U;  2LNV A;  4C92 G;  2D9T A;  1ZBX A;  2OAU A;  3E19 A;  3OMG A;  4L6V 5;  4M75 E;  1NJI U;  2ZPG B;  3DLM A;  1BI1 A;  3E1S A;  4C5G A;  3LX7 A;  2ZPH B;  2GF7 A;  3ZBD A;  4FT2 A;  4WF2 A;  5FRN A;  3V8L A;  2A3L A;  5GAO q;  5GAO l;  1B34 B;  1VQM T;  2M9U A;  2EAY A;  2EJG A;  5HK0 A;  1NPP A;  3CBM A;  4N4H A;  1SSF A;  2JUF A;  4GLK A;  5LJ5 j;  1YIJ A;  5FU7 B;  4HCB A;  4RCB A;  5GAN 8;  4NL3 A;  3JRZ A;  5GAN 6;  4M7A A;  1LNX A;  5IAY A;  5CR2 A;  2OTL T;  1QP2 A;  2DD5 A;  2E70 A;  3NTI A;  2CZ6 B;  4X9D A;  3OMC A;  3A8L B;  3BDL A;  3M5A A;  1VQO T;  4OB0 B;  3GNF B;  1VQP A;  3Q1J A;  4PJO B;  1KQ2 A;  3QG1 A;  3OBY A;  3OYA A;  3UPU A;  1YJ9 A;  3J7A F;  4E7J A;  2ZPB B;  1UGS B;  1YIT T;  4LDX A;  2K3X A;  3M4Y A;  3QYH B;  5DLO A;  3J81 E;  2X4X A;  1G3T A;  2KVQ G;  2BIV A;  4ZGE B;  3CCR T;  1B34 A;  4XTV A;  5KE2 A;  3UDC A;  2E6Z A;  4TVR A;  4OVA A;  1PSE A;  3TRE A;  1XQH A;  5J26 A;  2CKK A;  3I56 T;  1VIF A;  4JDS A;  3PMI A;  4BI8 B;  4OB1 B;  4ZGJ B;  5I2S A;  5GAM h;  4C92 D;  1QW1 A;  4HKE A;  4R56 A;  3DKM A;  4ELY C;  3QO3 A;  5LJ3 f;  1MHN A;  3X26 B;  1Q81 C;  1LJO A;  2PVD B;  2KSS A;  3VU3 C;  5LJ5 h;  5GAN f;  4PJO A;  3J80 E;  4QVD A;  1H64 1;  1I4K 1;  4JS4 A;  1YJW A;  2DEQ A;  3LWI A;  2PVO B;  4C8Q G;  3JCM f;  3P8D A;  4MDW A;  5LJ3 d;  3INZ A;  3OY9 A;  2PUO B;  2PVG B;  2DXU A;  4QQG A;  5GAN d;  4A4K A;  5GMK e;  1N27 A;  4C92 C;  2X4W A;  1YJ9 T;  2P0Q A;  3JCM c;  3JCM P;  2O01 E;  4LD9 K;  3URG A;  3VYH B;  4XU0 A;  3HHT B;  3JCM d;  4M75 B;  3CCE A;  1W2B S;  2XD0 A;  3R6O A;  4LDW A;  3VYG A;  2L8D A;  2LT1 A;  3MEW A;  4ATO A;  2P4T A;  2XKO C;  2ZPE B;  5CKH A;  3V7S A;  3HRU A;  3JCM V;  3CCM T;  2M16 A;  3FJP A;  1QVG S;  2WSF E;  5EG2 A;  4A4F A;  1RL2 A;  2DTO A;  2JZ2 A;  2NLU A;  4EMK C;  4JLG A;  2K5I A;  3H8Z A;  4PL6 A;  4F7U F;  5LJ5 g;  3CPW A;  2PQW A;  3SDZ A;  4F7U E;  1QP3 A;  2DTI A;  3DB3 A;  5CVI A;  4J5Y A;  2QXF A;  4J7I A;  1VQ5 A;  5LJ3 j;  4M7D G;  3RMS A;  1U8R A;  1Q7Y C;  3JB9 G;  2EIF A;  3V8J A;  3WXM B;  4CI0 C;  5KCO A;  4BE2 A;  2HAX A;  2QA4 T;  3CBP A;  3MCA B;  4QQD A;  4C8Q D;  2DO3 A;  3ASK A;  3FEO A;  3CCE T;  2EJF A;  3VJP A;  1N8R C;  4HT8 A;  2R5M A;  3QYG B;  5D6X A;  2KMT A;  2KY9 A;  2RM4 A;  1D3B A;  1N9R A;  2ZPI B;  4QW2 A;  5I2M A;  2A7Y A;  4XTW A;  3GP8 A;  5HY6 A;  3UWN A;  4MDX A;  4MZT A;  4C5E A;  1G3W A;  2JOY A;  4Q5W A;  1VQL T;  4C0F A;  2QQ9 A;  2XHC A;  3C12 A;  3CEY A;  5GAO r;  4M77 G;  5CKB A;  5GAM d;  3SWN B;  1M1K U;  3JB9 H;  3MP6 A;  4FIB A;  2DD4 A;  4C8Q C;  3QUI A;  1S72 A;  5CQY A;  4JRK A;  3JB9 J;  3GNG A;  1Y71 A;  3OYI A;  2RA2 A;  2RJC A;  3N5B B;  5GAO p;  1Q86 C;  2QDY B;  3JSC A;  1P92 A;  3QJY A;  1AHJ B;  3A5Z B;  3L42 A;  1H3Z A;  2DK3 A;  5LJ3 h;  1WQW A;  3M59 A;  2HBP A;  4UC4 A;  4XU3 A;  5GAN h;  1OI1 A;  1ZHI A;  4BUG A;  5DY9 A;  4BY6 B;  4M78 C;  2LRQ A;  5CAI A;  2L89 A;  3CCU T;  1KC8 C;  4C92 F;  1JJ2 A;  5D6Y A;  3JCM h;  2KQW A;  3CXC A;  3JCM X;  3OYF A;  1VQ7 T;  4M7D D;  1M90 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...