1OI1A

Crystal structure of the mbt domains of human scml2
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
207
Chain Sequence
FHWEEYLKETGSISAPSECFRQSQIPPVNDFKVGMKLEARDPRNATSVCIATVIGITGARLRLRLDGSDNRNDFWRLVDSPDIQPVGTCEKEGDLLQPPLGYQSWPMFLLETLNGSEMASATLFKKEPPKPPLNNFKVGMKLEAIDKKNPYLICPATIGDVKGDEVHITFDGWSGAFDYWCKYDSRDIFPAGWCRLTGDVLQPPGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Malignant Brain Tumor (Mbt) Repeats in Sex Comb on Midleg-Like 2 (Scml2).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Mbt
molecule keywords SCML2 PROTEIN
total genus 49
structure length 207
sequence length 211
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oi1A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oi1A01
3S3MA 2G3RA 2RHXA 3OYDA 3OYIA 1WJQA 2BKDN 4HCZA 5KCHA 1KHCA 5J39A 3L2RA 4E7JA 3LX7A 2WACA 4N4GA 2MWPA 3L2VA 5FRMA 2DAQA 2LVMA 1H3ZA 2RHUA 5C0MA 4ZTFA 2LDMA 4E7HA 3DLMA 3LLRA 3KUFA 2GFAA 3FC3A 2D9TA 3LH0A 4BD3A 3L2WA 3QKJA 2K3YA 3FDRA 5C6SA 4E7LA 1XNIA 3LYIA 2LTOA 3NTIA 3MO8A 2F5KA 5KE2A 3OYEA 5KCOA 2R57A 5KH6A 2X4YA 4E7IA 5FROA 3DB4A 3LGLA 3QIIA 4QQ6A 4GY5A 2QQSA 4ZTJA 2EQJA 2L8DA 5IN1A 4Q5WA 3F70A 3MEWA 3OS1A 2DIGA 2R5AA 5IAYA 2M16A 4RG2A 2VYTA 1N27A 2E6NA 3M9QA 3OYFA 2L89A 2L3RA 2LRQA 3O8VA 3S6WA 2RHYA 3ASKA 4EDUA 3OYJA 3OYBA 2GFUA 4QW2A 5KE3A 4PLIA 2CKKA 4B9XA 4N4HA 2GF7A 4CRIA 4A4FA 2MWOA 3FEOA 5D6YA 5D6WA 3NTKA 5J26A 3OYHA 3OYKA 4QQGA 4C5IA 4E7KA 3QJ6A 4Z02A 1G5VA 2LCCA 3OYMA 3OA6A 2EQMA 3E9FA 4QVZA 4BDZA 3FLGA 3MP8A 2HQEA 2NLUA 2RJCA 3OYLA 1OI1A 1MHNA 2B8AA 2R58A 3MEVA 3OQ5A 4IUVA 1SSFA 2M1HA 3OB9A 2JZ2A 1WJRA 5FRNA 2RJFA 4LD6A 3MP1A 2RI5A 3PFSA 5CIUA 3UWNA 3ME9A 3ZEHA 4IURA 4FL6A 1OZ2A 2R5MA 2X35A 3PMIA 3C4SA 3E9GA 2EQKA 2HQXA 4BDYA 2RI3A 3NTHA 4BE1A 4PL6A 2BUDA 1OYXA 2EQUA 2FHDA 2JTFA 3OYNA 4A4EA 3OMCA 4UC4A 4A4HA 4BE0A 3PMTA 3OYAA 4IUQA 4BACA 3P8DA 2IG0A 4C5GA 4IUTA 2BIVA 2O4XB 4X34A 3OY9A 2RO0A 2EFIA 4L59A 2YRVA 3MP6A 5D6XA 3MEAA 4IKFA 3OYGA 4II1A 2X4WA 3L2QA 5M9OA 4IUUA 1WGSA 3OS0A 2RJEA 2X4XA 3S3NA 4A4GA 1RI0A 4FU6A 3GOXA 2PQWA 3META 2RHZA 3DB3A 2DIQA 3QBYA 3SD4A 2QQRA 1WJSA 2XK0A 3PNWC 3EAEA 2RI2A 2P0KA 2O4XA 3OS2A 3LGFA 3MEUA 4N4IA 3BDLA 4B9WA 2K3XA 1OZ3A 3OYCA 3CEYA 2M0OA 3P8HA 3Q1JA 3L2UA 2RJDA 4BE2A 3UT1A 4PLLA 4QQDA 2RHIA 3H6ZA 3L42A 2XDPA 4NS5A 4C5HA 4C5EA 3H8ZA 4IUPA 3S3OA 2E5QA 3OMGA 2EKOA 4OVAA
chains in the Genus database with same CATH superfamily
1PRMC 1Q95G 4B6MA 2FPDA 1WJQA 2QEXQ 4C8QB 3WVDB 1Q81U 4PKCC 1PM3A 1X6BA 2QDLA 1Z9ZA 4KH0B 2LVMA 1H3ZA 4JRPA 5LJ5h 3I55Q 2K3YA 3QDFA 2A28A 1K73R 4JLGA 4FYXB 1G3WA 4GLMA 5LJ5g 2MMPA 2EGCA 3EH2A 3OS5A 5GAOr 3VRZA 3M55A 3CXCS 5IHKA 3HRUA 4J9DA 2CH4W 2L8DA 1AOJA 2DD5A 3MHXA 2DE0X 1B3QA 2JM9A 1W4SA 3HSBA 4F04B 1JRIA 4QW2A 1ZQ1A 1RAEB 4BB7A 5D6YA 4F7UB 2E3HA 2Z0WA 1UJYA 4KUIA 4BI4A 3OYMA 3TREA 4ELYC 3E9FA 1VQMA 4C92E 1BKBA 2R58A 3TCJA 2HKQB 1YI2Q 2RD1A 4C8QG 3M4GA 1Q82C 2ATCB 3NMZC 2RQTA 1JO8A 4XTYA 5GMKh 1NJIC 3EFSA 2LC4A 5LJ5e 4UC4A 4DA4A 2CP5A 3PMTA 2IG0A 3BDUA 2O4XB 3U23A 2XI9A 1NJIU 2CP3A 1HYOA 1OU9A 2KROA 2X4WA 4EMGA 1G83A 4E6RA 3S3NA 2CT4A 5GAN3 3META 2EWNA 1TOVA 3RDVA 2XU8A 4F14A 1K9MU 1A0NB 1SRLA 4BE2A 1YITA 1QVFA 2KYBA 4C5EA 2P4RA 5DM7R 2AZVA 3S3MA 1JXMA 3VYGA 3G4SA 2A36A 5IHNA 3L2VA 1NM7A 4DBFA 1Q81C 5HY6A 1K9MC 3DLMA 2EYWA 4KRTA 1ZSZB 4M75G 3EG0A 3EFOB 2JTEA 3VS7A 5HK3A 1TUGB 3TSWA 5IH2A 3JCMc 4F7UF 2RNAA 4BI8B 2R57A 4GLKA 1EZZB 3UA6A 2KVQG 1QVFP 4PFOA 1H3HA 2JMAA 2Y4XA 1PD1A 3ASKA 1O75A 2D0NA 4FSXA 4OMFB 4YTLA 1AWWA 2EYZA 4N4HA 1YHQT 2MWOA 2ED0A 2LQKA 2QXFA 4QQGA 2RF0A 2JT4A 5AT1B 4HT8A 4FT4A 1X43A 2FRYA 1M1GA 3OYYA 2B8AA 3PGGA 4QT7A 3PVQA 1JJ2A 1E7OA 4J9FA 4C0DC 3UA7A 4CC3A 2CYZB 3M59A 3ZBDA 3RKWA 1YJ9Q 2Y4YA 4FL6A 2EIFA 4M78A 2XG8D 2DEUA 1M3BA 3RIRA 2DPPB 3OW2A 2PVDB 4ZN1A 4LD9K 2K5IA 4C5GA 5LL6S 3G6ET 5GANh 1SKUB 3VS4A 2OTJT 2CSQA 2W0ZA 4NL3A 2IIMA 2CZ0B 2X3WD 3CBOA 2DIQA 1W6XA 1YBYA 2MF2A 2P0KA 2QTXA 2RMOA 1BYMA 2K3BA 1LVKA 2CSIA 3H0FA 2OTLT 2RQWA 1PC0A 3VUBA 1WHKA 2BKDN 2PU9B 5GJVB 2WACA 2QASA 2DAQA 3BY7A 1K0SA 2EYYA 3LH5A 4KH1B 2EJ9A 3L2WA 2DVJA 3HFNA 3LYIA 1VQ4Q 3EGXB 2KY9A 2YLCA 2FEIA 1U06A 2R5AA 1K4US 2LCLA 1OEBA 2L3RA 3QXEB 3DKMA 2A08A 3OYBA 3JCMW 5KE3A 4PLIA 3UATA 3VS3A 3FEOA 5J26A 1RAIB 1D0XA 2FO0A 3HRSA 1H641 3QJ6A 2QTVA 3KBGA 4BDZA 4LDVA 1WLPB 4IIOA 4O6JA 3EFOA 2RJCA 3CCJT 5KYYA 3RUXA 2FG0A 3G4SQ 5FRNA 2DL7A 2LT4A 3X24B 3A8MB 2RI5A 1N8RR 3M58A 1VQ8T 2YWWA 2OAWA 2JW4A 4EPCA 3CC4T 2YHTA 2E64A 3C0CA 2DXUA 3VYHB 2DERA 1TUCA 2JTMA 1UFFA 4IUTA 5DLOA 3HP9A 4L59A 4E2FB 3A8HB 1PSEA 2ROTA 1Q7YU 2YRDA 3LW5E 3A1PA 3MPUB 1W70A 1NLPC 2E5KA 5HCKA 4PK4A 4N4IA 1N5ZA 1QWFA 2K3XA 4AFUC 4C92A 2F5TX 2M0OA 1UHFA 3UT1A 4J9IA 5FWBA 2EGEA 4VUBA 4K11A 3JB9F 1K8AC 1AT1B 2LT1A 4CI0C 4Y92A 3OYIA 3CCVQ 1ZX6A 2YT6A 1P92A 1KHCA 1IHWA 2SEMA 1NYFA 2BZXA 4OMQA 4N4GA 1S72A 1BI3A 1VQ7T 4J9BA 2KT8A 3I55T 4M77G 2AZSA 1OPLA 2KDSA 2COWA 3LH0A 3QKJA 2K4YA 1PSFA 2QQAA 4GBQA 2FPEA 3MO8A 5GAMh 4ELZC 3CCLQ 1WHGA 4E7IA 2L0AA 4GY5A 1BIAA 1KC8C 2XD0A 2JJ9A 1JQQA 1N27A 4XTVA 3S6WA 2K5LA 4B9XA 1MMGA 2GF7A 2CP7A 4CRIA 4DEYA 1Y7XA 3AHUA 1UGRB 4M7DG 4ORZA 4JS5A 1VQMT 2QQ9A 3E2UA 1JJ2S 5LJ3h 3CXCP 3MP8A 1ZSZA 2HZYA 2M1HA 1M1KU 1WJRA 2KMTA 4FYYB 1G2BA 1KIKA 2ZPBB 3QO3A 3QZ9B 4C8QD 2OTLA 2QA4Q 1M9SA 4C0GA 2KK4A 3C4SA 2X4JA 4J6YA 1QMCA 2E6ZA 4C0DB 2KRSA 1D3BA 2MYSA 1M90R 2MK5A 4A53A 1VQ7Q 4BACA 1RAGB 2IPOB 1WXBA 2X9HA 5LJ5f 4DQ2A 1VQ4A 2DM1A 1MV3A 1UGPB 1U8RA 3MCAB 1SF9A 4F7UG 3N5BB 1J3TA 4M7DE 1Q86C 1XQHA 2KYMA 2ZAEA 4C92D 1PWTA 3E1SA 3Q1JA 1Y71A 1WQWA 4OP0A 3EG2A 1M3AA 2WSEE 1RABB 2E5QA 1VIEA 2P84A 4RTUA 2V8JA 1Q86U 1G8XA 4ATOA 2JXBA 5FRMA 4FYWB 4OGEA 4E7HA 3KUFA 3THKA 4ANJA 2D0QB 1AWJA 2DX1A 4M77A 1R77A 3I9QA 1OPKA 2LTOA 3C94A 1SG5A 2HCKA 2VKNA 1TXQA 3CMAQ 1UGQB 2DILA 2KBTA 2BE9B 5GAN2 1YN8A 3EG1A 3R6NA 4M7AG 2VV5A 2M16A 2YUPA 3FJ5A 4XTWA 3J81E 3OYFA 3A98A 4FSSA 3JB9J 3P8BB 2OX7A 4FM4B 3H41A 5KYNA 3WXMB 2KGTA 3VS6A 2KSSA 3JCMb 4M77F 4OMLA 3CCRQ 1ACMB 1Y0MA 1XTDA 2QA4T 3TSZA 3CCET 3SWNC 3FLGA 2JS0A 1UDLA 4RCBA 5IT9E 3OYLA 4JRKA 2QAZA 4C8QC 5GANd 5KYUB 2W10A 4WTOB 2X35A 2CP0A 3CC2A 3NTHA 3CPWA 3PE0A 2VC8A 2FZKB 1N8RU 4E7ZA 4JZ4A 1VQ7A 3RKXA 1AWOA 2DYIA 1SHGA 3L2QA 1N9SA 1D0YA 2J6KA 4PJOE 3EFRA 9ATCB 1BBZA 1UE9A 2E70A 3LGFA 1KC8U 5CQYA 5IXFA 4FT2A 2RJDA 2DNUA 2A7YA 4PJOD 2MI6A 4DOVA 3OW2P 2G3RA 3OYDA 2FB7A 1LJOA 4N0AC 1Q7YC 2OAUA 1YP5A 2HL3A 2DETA 2LDMA 2RQRA 2D9TA 4M77D 1S72Q 2CUBA 3QPHA 4LDXA 1BIBA 3JCMe 1YJNQ 1M1KC 2KRMA 1FXXA 1V1CA 1BB9A 5EG2A 2E6NA 4OB1B 2L89A 4FW1A 3VS2A 4ZNXA 4M7DD 3RMQA 4PJOF 2JNGA 1RLQC 2DL3A 2DKGA 3BE3A 5KYUA 3CCJA 1VQOQ 2RB6A 1DJ7B 2HDAA 2EKHA 2NWMA 3M0PA 2BZ8A 2PNIA 2K2MA 4PJOG 1QCFA 2CREA 2L3QA 5GAN4 2J6OA 2K79A 1FMVA 2WSCE 3CC4A 1M1KR 2RI3A 1GCPA 1GBQA 5FWCA 1YWOA 2GCXA 3CC2Q 1OYXA 3CC4Q 1OV3A 2F1LA 3EHQA 4C92F 1Z9QA 3V8KA 2JVVA 3CBPA 3VU3C 3L2ZA 2YRVA 4MDXA 1Q82R 2EQIA 1ZUYA 2EYQA 1Y96A 4C92G 1NLOC 7AT1B 3PNWC 4M78F 4B9WA 1NZ9A 1OZ3A 2K7AA 4A63B 3URGA 4XU3A 4NS5A 4FCYA 1AEYA 4OB3B 3FC3A 3CPFA 2CZ1B 1MMDA 2O31A 1S72T 2QQBA 5KCHA 2FZGB 3L2RA 2AT1B 3QG1A 1T0JA 1R0CB 5GAOp 3JB9H 3G71Q 4ZTFA 1VQKQ 1VQOT 1TWBA 2QA4A 1CSKA 3FDRA 4NOYA 4RTXA 3GP8A 2HD0A 1HK9A 1H8KA 2LP5A 4HVUA 3QSUA 3DB4A 1YFNA 1AHJB 1QKWA 3A5ZB 5KYWB 2EQJA 3I35A 2OTJQ 1JBMA 1X01A 4PJLA 3CC2T 3D7SB 1AZEA 4XTXA 3I55A 1JJ2P 1MNDA 1WYXA 2DO3A 4DBQA 3I5SA 3JAME 2EYXA 5CKDA 4A54A 4C5IA 2NYSA 5LJ3g 5A0LA 3EH1A 4OMMA 1VYTA 2LQ8A 4M75E 2DEQA 2K6DA 4FIBA 4JRIA 4HCBA 5GAMd 3CCRA 3NGPA 4M7DC 2YSQA 1VA7A 3PFSA 1GFDA 3M0QA 3M0UA 2KQWA 5GAN7 4F17A 2B86A 2HQXA 1G3SA 5GMKl 1IB8A 3TVTA 4A4EA 3FB9A 1YIJT 1VQ4T 4IUQA 1VQ9T 1SSHA 2E12A 2D8JA 4D6WA 2RO0A 3KFVA 3JB9G 4IKFA 1KFZA 2DZ9A 5M9OA 4BY6C 3GLXA 1Y96B 2ESWA 1YCYA 1WFWA 1ZA1B 3VRYA 4J9HA 1TTHB 5GANg 5A0GA 3VV0A 1RAHB 4HKEA 1V76A 2RI2A 3GNGA 3VS0A 3P8HA 5CKHA 1PD0A 2CUDA 2EJFA 2YUOA 4J5YA 3DLLA 1T3SA 3PIPA 4LE9A 3M56A 1W2BA 3M0RA 2DTHA 4M78B 5I2MA 2MWPA 3RNJA 1OOTA 2MIOA 3CCMQ 2CGHA 3SB2A 1VQ8Q 3VKIA 1TH7A 1VQLQ 1NPRA 2A37A 2C0TA 2DL4A 4E7LA 1X6GA 1H92A 1VQLA 1I1JA 3VS5A 3UDCA 3GNFB 1HSQA 4RCCA 2RQVA 2C0OA 3A8LB 3QYHB 1GBRA 4JDSA 2XICA 1QP2A 2DLPA 2HNIA 2P0PA 3MEWA 2QEXA 5IAYA 2VYTA 1NYGA 4FYVB 5HK0A 3TU4K 3PT9A 2LMJA 3FRNA 4M75F 4AMCA 3CBMA 5FU7B 3M57A 2ABLA 3EGDA 4XU0A 4RG8A 2E1HA 1QWEA 2LCCA 3OA6A 2FZCB 4DEXA 1E6GA 1WI7A 3M0TA 1MHNA 3LWHA 5CIUA 1KQ1A 1UGVA 1IO6A 2RA2A 3CMEA 1QW1A 5CCAA 1C1AA 2DXTA 1MV0B 2H3EB 1K76A 3OYNA 3OMCA 4Z88A 4ZGDB 3CCLT 2V1QA 4M7AB 1M8VA 3OYAA 2ENMA 3NHNA 3CCSA 2EFIA 4X9CA 2VASA 1D1BA 3ZFJA 2LJ0A 3CCQQ 2VXFA 3R6OA 1RI9A 4C8QE 1Y07A 1B07A 3OBYA 4MZPA 5I11A 4L5GA 3CMAA 2NUPB 5CVIA 3PIOA 2J7IA 3MEUA 2E41A 4J9EA 3SWNB 3L42A 3JCMh 2EKOA 4OVAA 5GMKj 2NUTB 2FL7A 2L3SA 1PKTA 2AHJB 1VUBA 3BW1A 4E7JA 4PJJA 4XTZA 2HSPA 4MZMA 1YCSB 3X26B 1NEGA 4JJDA 1W2BS 1M2VA 2LZ6B 3SDZA 1WA7A 1C0MA 4M7DA 2EW3A 3AT1B 1UHCA 1FWZA 2J6FA 2YRCA 1GFCA 4Q5WA 4AFSC 1YI2A 1M90C 3O5ZA 5GAOm 2HAXA 1ZUUA 3OYJA 1VQ5Q 4EDUA 1M5Q1 2GFUA 1G3TA 3CXCA 2COZA 1I81A 2NUPA 1U1TA 2CP2A 1N8RC 4E7KA 3INZA 1O9SA 1Q7YR 4Z02A 1KC8R 2PVOB 1AZGB 1PCXA 4KUDK 2DA9A 3JCMd 2CS7A 4JRQA 4ZN3A 2DYBA 1R8OB 1GRIA 4LD6A 2F2VA 1PRLC 2YLBA 4PJOA 2HL5C 4ZGEB 4OB0B 1OZ2A 4MZTA 1OX8A 4E7SA 4BDYA 5CK9A 2MOXA 2YUQA 4WF2A 1M1FA 3M0SA 5CQXA 3ZL7C 2MPXC 4OGCA 1ZA2B 2KXCA 1AD5A 3QWYA 4LDUA 2ZPGB 2X4XA 1FMKA 4J7IA 1WNLA 2H8HA 3DB3A 1YJ9A 3QBYA 2QK0A 2RK2A 3SD4A 1W2BP 3MKDA 3L2UA 1WHJA 4Y91A 3SEMA 1D3BB 4XQ3A 2CZ6B 3LX7A 3RR6A 2O2OA 1VQOA 1YITT 3C95A 1PKSA 3CC7T 5CO7A 8AT1B 5KCOA 5KH6A 5FROA 2LX7A 3QIIA 1RACB 4HCKA 1ZHIA 4M78C 5I22A 1BCOA 3CCUQ 4LXCA 2DIGA 1KQ2A 1OQKA 1BU1A 2CDTA 3ULRB 3LWIA 2DF6A 2JM8A 4RTVA 1UUEA 2DK3A 2ZPEB 3X20B 1N6AA 2V26A 4AFZC 3H0HA 2EJGA 4JUVA 4A4FA 1K8AR 4CC2A 3UPUA 2PZ1A 4C92C 5GAMg 3HHTB 3HRTA 2DL5A 5I21A 1M30A 1UB4A 8ATCB 2JZ2A 3NFCA 2JMCA 1SHFA 2DBKA 4KBMB 4JS4A 2YDLA 4IURA 1WHLA 1NJIR 2C0IA 3VS1A 1TSFA 4C8QA 3G6EQ 2QI2A 2FYKA 3EHRA 4XU2A 5L23A 1UGSB 1YJWT 1Q86R 1YIJQ 2XIDA 1QCNA 3JCMf 1C6VX 4CC7A 3MJXA 2GQIA 2WSFE 5GAOn 3FIFA 4ESRA 2OTLQ 3V7RA 4A4GA 1AVZC 1VYVA 5GMKe 3QJYA 1VQ5A 4QKUA 2O4XA 2X3XD 2LNHB 4EMKA 4QVDA 2RQUA 4PLLA 3IQLA 1YI2T 3S3OA 1D0ZA 1F1BB 3REAB 5GAMe 5D6XA 5HKCA 1SEMA 2O9VA 3ER0A 3CC7Q 3HPWA 4JZ3A 2DTIA 5J39A 4KGXB 2QG9B 2D8HA 1JU5C 1W1FA 4PNOA 2D1XA 5C0MA 3WVEB 1HJDA 2BZYA 4JJNK 4BD3A 4JPBW 1XJWB 3OSVA 4LUEA 4C0FA 5GJWB 1XNIA 2F5KA 4LUDA 1VQKA 2M51A 2LX9A 4FW2A 2HEQA 1IREB 3SWNA 5IXBA 2DXCA 2GNCA 4C8QF 2FVUA 2F2XA 4JLIA 2VWFA 2CKKA 3EGXA 3JCMQ 4RMOA 3X25B 2L3PA 3OYKA 2KAFA 2DTOA 2E65A 4PFZA 2YXYA 3V8LA 4KGZB 1N9RA 4IUVA 3MEVA 4ME7A 2AKLA 1UEBA 1EFNA 1WPYA 3JRZA 3CMET 4M7AA 1QVGP 2HSEB 2QGFB 2KXDA 5FLXE 5A2QE 2J06A 3CCJQ 4E47A 2I2LA 4Z89A 1M2OA 1X27A 2V8KA 2JOYA 4M77C 2JN0A 1CKAA 3GPLA 4R56A 3OY9A 5KYYB 2DL8A 1VQ8A 1YHQQ 3REBB 4J7FA 4II1A 3EG3A 4IUUA 2ECZA 3G1JA 2L2PA 2H3JA 1RI0A 1ABQA 4OMNA 3M54A 1RAFB 4DBHA 3HFOA 2XK0A 2F69A 3CCVT 2AIRB 5DLQE 3CQTA 2LQWA 2RHIA 2XDPA 4OB2B 1Y57A 4HVVA 3UF4A 3X28B 1OU8A 1S1NA 4EMKC 2VGMA 5ECAA 1LPLA 2X51A 1VQNA 1ZLMA 1X2QA 2M0YA 2LJ1A 1BI2A 1UG1A 1MNEA 2GFAA 1IHVA 3FJPA 4M75C 1MUZA 4L6V5 1NEBA 4V2SA 1VQ9Q 3EGDB 3A8OB 5LJ3d 2FPFA 4KGVB 1K9MR 4KT0E 4HCCA 2DMOA 5IHIA 1T3LA 3M9QA 4M75A 5CAIA 2DD4A 4J8OA 3CCSQ 1YJWA 1YWPA 1LCKA 2MCNA 4RKUE 4OMOA 3VUZA 3V8JA 1AWXA 5D6WA 2LNVA 2LQNA 1WDXA 2HQHA 2IVWA 2O01E 3M4YA 2CH4A 3QHSA 4QVZA 3JCMV 4Z8AA 5LJ3f 3G7ZA 1GCQC 4X9DA 1WQ7A 1KK7A 1OX9A 2V8IA 1M90U 2VB6A 2BTTA 3PMIA 3GIBA 3I56Q 1G3YA 1SRMA 4QVCA 4BE1A 2GTJA 2CP6A 5GAN6 2JTFA 4CC4B 1GL5A 3OBWA 3JV3A 1KD1R 2KT1A 2VUBA 4C92B 2XKOC 5LJ5j 1WGSA 1X6OA 1YJ9T 1QVPA 1FMWA 1YJNT 4HXJA 1VQKT 5I2SA 3OS2A 2DZCA 3BDLA 2G6FX 4O5VA 5GMKi 3H8ZA 1ZBXA 3OMGA 3RERA 4J6WA 1VIFA 2MAMA 3HL8A 1KQSA 3CC7A 1KD1U 4LN2A 2ZPFB 2O88A 4D8KA 1V29B 5CR2A 2QDYB 5LJ3j 1XOVA 2F2WA 4P5NA 3V7CA 5C6SA 4A4KA 3HTRA 1Q82U 3SFMA 5KE2A 3OYEA 3GF5A 4F7UE 4ZGJB 3V7SA 1BCMA 4BI3A 2QQSA 3CCQT 4XTUA 4M4ZA 4RG2A 3E19A 3CCEA 1X2KA 1HXDA 4PJOC 3OYHA 3RMSA 1NPPA 2A3LA 3H9NA 2LCSA 1CKBA 2RH2A 2NLUA 1OI1A 1VOMA 3OSSC 3MP1A 2RM4A 1LOJA 3ME9A 3ZEHA 4F7UA 3TEEA 3JB9I 3CD6A 3NPFA 2L5QA 1NE8A 2DJZA 1ABOA 2FHDA 4WCIA 3G71T 3QDRB 4A4HA 1EIFA 4RTZA 1KD1C 2XHCA 1VQPT 4X34A 1EX4A 1U5SA 3MEAA 2RN8A 3QWXX 1JB0E 1VQ5T 1ZBJA 1UTIA 1TUDA 3CCMT 1VQ6A 3GBQA 4N0AA 1WJSA 1BK2A 4X1VA 4AG1C 2V1RA 1KJWA 1NG2A 3CCUA 1QP3A 2GBQA 4TVRA 1PHTA 2DBMA 2RPNA 5GAMf 5FU6B 2EBPA 3L1AA 2M9UA 2DVEA 2RHUA 1I5LA 1RUWA 3LLRA 3EGUA 2O9SA 1VQNQ 2A0FB 1I8FA 1SPKA 4RTYA 1GXIE 1ARKA 4RTTA 5LJ5d 4QQ6A 2RK1A 5A0DA 1HD3A 2AK5A 3F70A 2FRWA 5CKBA 2ZPHB 2KRNA 4DBRA 4R0KA 1I0CA 2DRMA 2I0NA 2ED1A 1VQPQ 1I5OB 1B34B 2DJQA 2YUNA 4XK8E 1FX7A 3HKSA 5FW9A 1IGUA 1G5VA 4BY6B 3PTAA 4M7AC 2EQMA 1T0HA 4MDWA 1YJNA 3OQ5A 2XDDA 2PVGB 4LDWA 3UWNA 3M53A 2R5MA 1WIEA 2EGAA 2K5FA 1B7TA 1WZOA 2NUTA 4PL6A 2EQUA 4M78D 1ZSZC 3JCMX 3CPWS 4M75B 2ZCFB 1WXUA 2K9GA 4C0ZA 4M77E 5GAN5 5J3BA 1WX6A 5L8RE 4JJCA 1QVGS 4EMHA 4J9CA 4LDYA 3EG9A 3CCVA 3GOXA 1TG0A 3CCEQ 3EAEA 4Y28E 4QQDA 1WHHA 3H6ZA 4J83A 3CCQA 3TQ7P 4NL2A 4M75D 3JCMJ 3JSCA 4LNPA 1VQNT 4HCZA 2P0QA 4AT1B 4M7AF 5D7UA 1U1SA 1X75C 1KG1A 3G4ST 2EVRA 2ROLA 3JCMP 1K73U 3J80E 3M5AA 1WXTA 2J05A 3RBBB 2JUFA 1RAAB 3QYGB 1M27C 5DY9A 1IXDA 3I56A 1IRXA 4D8DA 1B34A 5IN1A 2XMFA 3O8VA 4PJNA 2RHYA 1NBEB 1X69A 2PTKA 3G71A 2M02A 4OMPA 5CKFA 4OF1A 2CZ7B 4RUGA 5KYWA 1VQPA 1E6HA 1RLPC 1UJ0A 3NTKA 3VJPA 2EPDA 4J6XA 1YHQA 1OULA 1PG5B 2HBPA 3CPWP 4M7DB 1MGQA 5AYFA 4M77B 2E4HA 2K2VA 2HQEA 1M2VB 1K9AA 1SSFA 2E10A 2RJFA 4KULA 4PFPA 5LJ3e 2OTJA 4MMKA 5GAOq 4HT9A 3E9GA 1IGQA 2BE7D 1YNZA 2ZGWA 2KI7A 2BUDA 1LNXA 1ZSGA 3CCRT 4M7AD 4HA8A 4BUGA 1K73C 3P8DA 2SRCA 3A8GB 2EAYA 1ZUKA 4EMKB 2BIVA 2DFUA 2PUKB 3G6EA 3OS0A 1M4ZA 2RJEA 2ZPIB 1KSWA 3J7AF 3CMEQ 1PNJA 1YITQ 4FU6A 1YIJA 4R55A 5GAMj 4MMLA 1QVGA 1VQ9A 2QQRA 1Q81R 5CKEA 3OYCA 1BI0A 3CEYA 2GGRA 1VQ6Q 4M7AE 2QGGA 2OJ2A 2HBWA 1VQMQ 4IUPA 5KYXB 1RADB 2KNBB 2RHXA 2COYA 5GMKm 1VQLT 2CT3A 1KQSS 1K8AU 2C06A 5KYXA 2AKKA 1QKXA 2P4TA 3RESA 1M8MA 4F16A 1MMAA 1TS9A 2QYZA 1JXOA 5FU6C 1K0XA 2QEXT 2Y90A 1QQJA 3NTIA 2GQVA 2KE9A 2DRKA 2E3IA 4M78E 4EIKA 3PVLA 2LJ3A 4JJBA 2X4YA 3CD6Q 1D09B 3LGLA 3C12A 1KHIA 4ZTJA 1QCOA 2VXEA 5GANe 4HVWA 1FYNA 3OS1A 2K57A 4AG2C 1JEGA 5GANf 2LRQA 5GANj 1UECA 1VYUA 2PUOB 1K1ZA 2HKNA 3EG9B 3SHWA 2NUZA 1YJWQ 4PJOB 1BI1A 1D1AA 6AT1B 4DOWA 1WHMA 5FU7C 1IZ6A 4PJMA 1D1CA 1GCQA 4XAXB 3OB9A 4XU1A 3CCLA 2KEAA 2VVKA 1MMNA 1U3OA 2GTOA 3I5RA 4M7DF 3CCST 1R0BG 3OW2S 2EQKA 2DXBA 4M78G 2OI3A 1I4K1 3H0IA 3KXTA 4BE0A 2VGNA 1TU0B 5EC7A 2D6FA 3CMAT 1I07A 2JS2A 3QZ5B 3MP6A 3OYGA 3JCMg 3CCMA 3BFMA 1KQSP 1VQ6T 2ZZDA 4IIMA 1RL2A 2PQWA 4AFQC 4RTWA 2RHZA 2KR3A 3RKYA 3CD6T 3QUIA 3T9NA 1QVFS 3CCUT 1QLYA 3I56T 2XDBA 5GAN8 5GAOl 4J9GA 4C5HA 2HMAA 3JB9D 1M3CA
chains in the Genus database with same CATH topology
1WJQA 2FL7A 4C8QB 3WVDB 2V8JA 4J6WA 1Q81U 2AHJB 1VUBA 4PKCC 3BW1A 4E7JA 1VIFA 1Q86U 2MAMA 4XTZA 4ATOA 5FRMA 4MZMA 3HL8A 1KQSA 2LVMA 3CC7A 1H3ZA 1KD1U 4OGEA 2ZPFB 3X26B 4JRPA 5LJ5h 4E7HA 1V29B 5CR2A 3KUFA 2QDYB 5LJ3j 1W2BS 1XOVA 2D0QB 4P5NA 2K3YA 3SDZA 4M77A 3V7CA 5C6SA 4A4KA 4JLGA 1G3WA 2LTOA 5LJ5g 2MMPA 3C94A 4M7DA 3OS5A 5GAOr 1Q82U 3SFMA 5KE2A 5GMKj 3OYEA 1UGQB 3GF5A 3M55A 3CXCS 1FWZA 4F7UE 4ZGJB 3HRUA 3V7SA 4BI3A 5GAN2 2QQSA 2L8DA 2DD5A 3MHXA 4M7AG 4Q5WA 2VV5A 3CCQT 1YI2A 4XTUA 1M90C 1W4SA 2M16A 4RG2A 4XTWA 5GAOm 3HSBA 2HAXA 3J81E 3OYFA 3E19A 3JB9J 3P8BB 3OYJA 4EDUA 3CCEA 4FM4B 1JRIA 1M5Q1 2GFUA 4QW2A 1G3TA 1ZQ1A 1HXDA 3WXMB 3CXCA 1I81A 4PJOC 4BB7A 5D6YA 3OYHA 1U1TA 2KSSA 4F7UB 3JCMb 3RMSA 1N8RC 4M77F 4E7KA 1NPPA 2A3LA 3INZA 1O9SA 4KUIA 4BI4A 4LD9K 4Z02A 3OYMA 1XTDA 2QA4T 3TREA 4ELYC 3E9FA 1VQMA 3CCET 3SWNC 2PVOB 2RH2A 3FLGA 1BKBA 4RCBA 4C92E 2NLUA 5IT9E 3OYLA 1OI1A 2R58A 3JCMd 4KUDK 3TCJA 4JRKA 2CS7A 4JRQA 4ZN3A 3OSSC 1R8OB 4LD6A 4C8QC 5GANd 3MP1A 2RM4A 2RD1A 1LOJA 4C8QG 3M4GA 2YLBA 1Q82C 4PJOA 3ME9A 4ZGEB 3ZEHA 4F7UA 4OB0B 1OZ2A 4MZTA 2X35A 3TEEA 3JB9I 4XTYA 3CD6A 2L5QA 5GMKh 3CC2A 1NJIC 4BDYA 1NE8A 3EFSA 2DJZA 3NTHA 3CPWA 2LC4A 2FHDA 2VC8A 5CK9A 1N8RU 3G71T 3QDRB 4UC4A 1EIFA 4A4HA 5LJ5e 4DA4A 1KD1C 4WF2A 1M1FA 3PMTA 2XHCA 1VQPT 2IG0A 1VQ7A 3BDUA 5CQXA 2O4XB 4X34A 2XI9A 3RKXA 4OGCA 1NJIU 3MEAA 3L2QA 2X4WA 4LDUA 1N9SA 4EMGA 2ZPGB 2X4XA 4PJOE 1JB0E 1VQ5T 3S3NA 3CCMT 1VQ6A 5GAN3 3META 1WNLA 4J7IA 3DB3A 3EFRA 1YJ9A 3QBYA 2RK2A 2EWNA 3SD4A 4N0AA 1WJSA 2XU8A 2E70A 3LGFA 1KC8U 5CQYA 1K9MU 3L2UA 4FT2A 4BE2A 2RJDA 1YITA 1QVFA 3CCUA 2A7YA 1QP3A 4C5EA 4PJOD 4TVRA 4Y91A 2MI6A 5DM7R 1D3BB 4XQ3A 3S3MA 4DOVA 3VYGA 2G3RA 3OYDA 3G4SA 2FB7A 1LJOA 2CZ6B 5GAMf 3LX7A 5FU6B 4N0AC 3L1AA 3L2VA 2M9UA 2OAUA 1VQOA 1YITT 1Q7YC 2DVEA 2RHUA 3C95A 1Q81C 5HY6A 2LDMA 1I5LA 3DLMA 1K9MC 3LLRA 4M75G 2D9TA 4M77D 3CC7T 5CO7A 3QPHA 5HK3A 4LDXA 3JCMc 4F7UF 1BIBA 3JCMe 1I8FA 5KCOA 1GXIE 4BI8B 2R57A 4GLKA 5KH6A 5FROA 5LJ5d 1M1KC 3QIIA 4QQ6A 2RK1A 1ZHIA 2KVQG 4M78C 5A0DA 1FXXA 3F70A 2DIGA 5CKBA 2ZPHB 1KQ2A 5EG2A 3LWIA 2E6NA 4OB1B 2L89A 2Y4XA 2DK3A 2ZPEB 3ASKA 1O75A 3X20B 1N6AA 4M7DD 4FSXA 2EJGA 4OMFB 4YTLA 3RMQA 4N4HA 1B34B 4JUVA 4PJOF 2JNGA 4A4FA 2MWOA 1YHQT 2LQKA 2QXFA 4XK8E 4QQGA 3UPUA 1FX7A 2DKGA 3HKSA 4C92C 3CCJA 5GAMg 3HHTB 1G5VA 4HT8A 4BY6B 2RB6A 3HRTA 2EQMA 1DJ7B 3PTAA 4M7AC 4FT4A 4MDWA 1M1GA 3OYYA 2B8AA 3PGGA 1YJNA 3OQ5A 5I21A 1JJ2A 1UB4A 4C0DC 2XDDA 2PVGB 4PJOG 2JZ2A 2CYZB 3M59A 3NFCA 3ZBDA 4LDWA 3RKWA 5GAN4 4KBMB 4JS4A 3UWNA 3M53A 2Y4YA 4IURA 4FL6A 2EIFA 2R5MA 2XG8D 4M78A 2WSCE 3CC4A 3RIRA 4C8QA 2K5FA 2QI2A 2RI3A 2FYKA 2DPPB 4XU2A 1UGSB 2GCXA 4PL6A 2EQUA 1OYXA 2PVDB 4ZN1A 3OW2A 2K5IA 1YJWT 4M78D 4C92F 3JCMX 3V8KA 3CPWS 4M75B 2ZCFB 4C5GA 2JVVA 4C0ZA 5LL6S 3CBPA 4M77E 2XIDA 3VU3C 5GAN5 3JCMf 3G6ET 5J3BA 3L2ZA 2YRVA 4MDXA 5L8RE 5GANh 2OTJT 1QVGS 2WSFE 2EYQA 3FIFA 5GAOn 1Y96A 3V7RA 4EMHA 4NL3A 4A4GA 4LDYA 3CCVA 4C92G 3GOXA 2CZ0B 3CBOA 2DIQA 5GMKe 3QJYA 1YBYA 1VQ5A 3PNWC 3EAEA 4M78F 2MF2A 2P0KA 2O4XA 4Y28E 2QTXA 4B9WA 4EMKA 1NZ9A 1OZ3A 4QVDA 1BYMA 3URGA 4PLLA 4QQDA 2OTLT 3H6ZA 4XU3A 4NS5A 4J83A 3CCQA 1YI2T 4NL2A 3S3OA 3VUBA 4M75D 5GAMe 4OB3B 3JSCA 5D6XA 5HKCA 3FC3A 3JCMJ 3ER0A 3CPFA 3HPWA 2CZ1B 1S72T 1VQNT 2BKDN 2PU9B 2QQBA 4HCZA 5KCHA 2DTIA 5J39A 2P0QA 4M7AF 3L2RA 1KG1A 1U1SA 1X75C 2WACA 3QG1A 3G4ST 3JCMP 5GAOp 2DAQA 3JB9H 3BY7A 1K73U 4PNOA 5C0MA 3J80E 3WVEB 3M5AA 4ZTFA 1VQOT 2JUFA 4JJNK 2EJ9A 4BD3A 3L2WA 2QA4A 3FDRA 3OSVA 3QYGB 3HFNA 4C0FA 1XNIA 3LYIA 4NOYA 3GP8A 2HD0A 1HK9A 5DY9A 2F5KA 1VQKA 3QSUA 3I56A 2LX9A 3DB4A 1AHJB 3A5ZB 1B34A 2EQJA 2KY9A 2YLCA 5IN1A 1IREB 1JBMA 2R5AA 1X01A 3CC2T 2LCLA 4XTXA 3SWNA 2DXCA 2L3RA 3QXEB 3O8VA 3I55A 2RHYA 4C8QF 3DKMA 2FVUA 3OYBA 4JLIA 3G71A 3JCMW 5CKFA 5KE3A 4PLIA 2CKKA 4OF1A 2CZ7B 2DO3A 3JCMQ 4RMOA 3FEOA 3JAME 1VQPA 3X25B 3NTKA 5J26A 3VJPA 5CKDA 3OYKA 2KAFA 4A54A 4C5IA 4J6XA 5LJ3g 1YHQA 2DTOA 2E65A 3HRSA 1H641 5A0LA 3QJ6A 4M7DB 2HBPA 1MGQA 5AYFA 3V8LA 2LQ8A 3KBGA 4M77B 4M75E 2DEQA 2K2VA 4LDVA 4BDZA 4O6JA 4FIBA 1N9RA 2HQEA 2RJCA 3CCJT 4IUVA 3MEVA 4JRIA 4ME7A 3RUXA 5GAMd 4HCBA 1UEBA 1SSFA 3CCRA 2E10A 1WPYA 4M7DC 3JRZA 3CMET 2RJFA 2LT4A 4KULA 5LJ3e 3X24B 3A8MB 5FRNA 4M7AA 2RI5A 1VIEA 3PFSA 4MMKA 4M7DG 3M58A 5GAOq 1VQ8T 5FLXE 5A2QE 4HT9A 2KQWA 3E9GA 5GAN7 4E47A 2I2LA 2HQXA 1G3SA 5GMKl 2ZGWA 2BUDA 1LNXA 4EPCA 3CCRT 3CC4T 2YHTA 2E64A 2JOYA 2V8KA 3FB9A 4HA8A 4A4EA 1YIJT 4M77C 2DXUA 1VQ4T 4BUGA 3VYHB 2JN0A 1K73C 4IUQA 1VQ9T 3P8DA 2E12A 3A8GB 2EAYA 2JTMA 4IUTA 4EMKB 2BIVA 4R56A 3OY9A 3GPLA 4D6WA 2RO0A 5DLOA 1VQ8A 3JB9G 3HP9A 4L59A 4IKFA 2PUKB 4J7FA 4II1A 2DZ9A 5M9OA 4IUUA 3G6EA 4BY6C 3OS0A 1M4ZA 2RJEA 2ZPIB 3GLXA 3A8HB 1PSEA 1Y96B 1Q7YU 1YCYA 3J7AF 3RERA 3LW5E 2H3JA 1RI0A 4FU6A 4R55A 1YIJA 5GANg 5GAMj 4MMLA 5A0GA 1QVGA 3VV0A 1VQ9A 3M54A 2QQRA 3HFOA 2XK0A 4HKEA 2RI2A 2F69A 5CKEA 3CCVT 4N4IA 3OYCA 4C92A 1BI0A 2K3XA 3GNGA 2F5TX 3CEYA 2M0OA 3P8HA 5DLQE 5CKHA 4M7AE 3UT1A 2RHIA 2XDPA 4OB2B 2EJFA 4J5YA 3DLLA 4IUPA 4VUBA 3JB9F 3PIPA 1K8AC 2LT1A 3M56A 4CI0C 2RHXA 1W2BA 3OYIA 2DTHA 3X28B 1P92A 4EMKC 5GMKm 1VQLT 1KHCA 2VGMA 4M78B 1KQSS 1K8AU 2C06A 5I2MA 4N4GA 2MWPA 1S72A 1VQNA 1BI3A 2P4TA 3RESA 1VQ7T 2CGHA 3SB2A 3I55T 1BI2A 4M77G 3VKIA 1TH7A 2GFAA 2KDSA 1NPRA 3LH0A 5FU6C 3FJPA 3QKJA 2K4YA 4M75C 2QEXT 4L6V5 4E7LA 2Y90A 1PSFA 2QQAA 4V2SA 1VQLA 3NTIA 2GQVA 3MO8A 3UDCA 4M78E 5GAMh 4ELZC 3GNFB 4RCCA 2X4YA 4E7IA 3A8OB 3LGLA 5LJ3d 3A8LB 3QYHB 3C12A 1BIAA 1KHIA 4GY5A 2XICA 1QP2A 4JDSA 4ZTJA 2HNIA 2VXEA 5GANe 2P0PA 3MEWA 4KT0E 3OS1A 2K57A 1KC8C 2XD0A 2QEXA 4HCCA 5IAYA 2VYTA 1N27A 3M9QA 4XTVA 4M75A 5CAIA 2DD4A 4J8OA 2LRQA 3S6WA 5GANf 1YJWA 5GANj 5HK0A 3TU4K 3PT9A 3FRNA 2K5LA 4M75F 4B9XA 2GF7A 2PUOB 4RKUE 3VUZA 1Y7XA 4CRIA 1UGRB 3CBMA 3AHUA 3V8JA 5D6WA 5FU7B 2LNVA 3M57A 4JS5A 4XU0A 2O01E 2E1HA 1BI1A 2IVWA 2QQ9A 4RG8A 1VQMT 4PJOB 3M4YA 2LCCA 3OA6A 5LJ3h 1JJ2S 3QHSA 4QVZA 3MP8A 3JCMV 4DOWA 5FU7C 5LJ3f 1MHNA 1IZ6A 4XAXB 3G7ZA 2M1HA 3OB9A 4XU1A 1M1KU 3CCLA 1WJRA 2KMTA 1WQ7A 4X9DA 3LWHA 2ZPBB 5CIUA 1KQ1A 2V8IA 3QO3A 2RA2A 1M90U 3CCST 4M7DF 3QZ9B 4C8QD 2OTLA 3CMEA 3PMIA 1M9SA 4C0GA 2KK4A 1QW1A 3C4SA 2X4JA 4J6YA 1G3YA 3OW2S 3GIBA 2E6ZA 2EQKA 4C0DB 2DXBA 4M78G 4QVCA 5CCAA 2DXTA 4BE1A 1D3BA 5GAN6 2JTFA 3OYNA 1I4K1 3OBWA 3OMCA 4ZGDB 3KXTA 4A53A 4M7AB 3CCLT 4BE0A 1M8VA 2VGNA 3OYAA 4BACA 2D6FA 3CMAT 2VUBA 4C92B 2XKOC 3QZ5B 3CCSA 5LJ5f 2EFIA 4X9CA 4DQ2A 5LJ5j 1VQ4A 1UGPB 3MP6A 3ZFJA 3OYGA 3JCMg 1U8RA 3CCMA 3BFMA 1VQ6T 3MCAB 1WGSA 4F7UG 3N5BB 1X6OA 2VXFA 3R6OA 1YJ9T 2ZZDA 1QVPA 4M7DE 2OTJA 1RL2A 4C8QE 1Q86C 1XQHA 2PQWA 1YJNT 1Y07A 2RHZA 3OBYA 4MZPA 3RKYA 3CD6T 4L5GA 3CMAA 1VQKT 3QUIA 3T9NA 5I2SA 1QVFS 3CCUT 5CVIA 4C92D 3I56T 3PIOA 3OS2A 2DZCA 3E1SA 3MEUA 3BDLA 2XDBA 5GAN8 3Q1JA 4O5VA 1Y71A 2E41A 1WQWA 5GAOl 4OP0A 3SWNB 3L42A 4C5HA 5GMKi 4M7AD 3H8ZA 2WSEE 2E5QA 1ZBXA 3JB9D 3JCMh 3OMGA 2EKOA 4OVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S3M A;  2G3R A;  2RHX A;  3OYD A;  3OYI A;  1WJQ A;  2BKD N;  4HCZ A;  5KCH A;  1KHC A;  5J39 A;  3L2R A;  4E7J A;  3LX7 A;  2WAC A;  4N4G A;  2MWP A;  3L2V A;  5FRM A;  2DAQ A;  2LVM A;  1H3Z A;  2RHU A;  5C0M A;  4ZTF A;  2LDM A;  4E7H A;  3DLM A;  3LLR A;  3KUF A;  2GFA A;  3FC3 A;  2D9T A;  3LH0 A;  4BD3 A;  3L2W A;  3QKJ A;  2K3Y A;  3FDR A;  5C6S A;  4E7L A;  1XNI A;  3LYI A;  2LTO A;  3NTI A;  3MO8 A;  2F5K A;  5KE2 A;  3OYE A;  5KCO A;  2R57 A;  5KH6 A;  2X4Y A;  4E7I A;  5FRO A;  3DB4 A;  3LGL A;  3QII A;  4QQ6 A;  4GY5 A;  2QQS A;  4ZTJ A;  2EQJ A;  2L8D A;  5IN1 A;  4Q5W A;  3F70 A;  3MEW A;  3OS1 A;  2DIG A;  2R5A A;  5IAY A;  2M16 A;  4RG2 A;  2VYT A;  1N27 A;  2E6N A;  3M9Q A;  3OYF A;  2L89 A;  2L3R A;  2LRQ A;  3O8V A;  3S6W A;  2RHY A;  3ASK A;  4EDU A;  3OYJ A;  3OYB A;  2GFU A;  4QW2 A;  5KE3 A;  4PLI A;  2CKK A;  4B9X A;  4N4H A;  2GF7 A;  4CRI A;  4A4F A;  2MWO A;  3FEO A;  5D6Y A;  5D6W A;  3NTK A;  5J26 A;  3OYH A;  3OYK A;  4QQG A;  4C5I A;  4E7K A;  3QJ6 A;  4Z02 A;  1G5V A;  2LCC A;  3OYM A;  3OA6 A;  2EQM A;  3E9F A;  4QVZ A;  4BDZ A;  3FLG A;  3MP8 A;  2HQE A;  2NLU A;  2RJC A;  3OYL A;  1OI1 A;  1MHN A;  2B8A A;  2R58 A;  3MEV A;  3OQ5 A;  4IUV A;  1SSF A;  2M1H A;  3OB9 A;  2JZ2 A;  1WJR A;  5FRN A;  2RJF A;  4LD6 A;  3MP1 A;  2RI5 A;  3PFS A;  5CIU A;  3UWN A;  3ME9 A;  3ZEH A;  4IUR A;  4FL6 A;  1OZ2 A;  2R5M A;  2X35 A;  3PMI A;  3C4S A;  3E9G A;  2EQK A;  2HQX A;  4BDY A;  2RI3 A;  3NTH A;  4BE1 A;  4PL6 A;  2BUD A;  1OYX A;  2EQU A;  2FHD A;  2JTF A;  3OYN A;  4A4E A;  3OMC A;  4UC4 A;  4A4H A;  4BE0 A;  3PMT A;  3OYA A;  4IUQ A;  4BAC A;  3P8D A;  2IG0 A;  4C5G A;  4IUT A;  2BIV A;  2O4X B;  4X34 A;  3OY9 A;  2RO0 A;  2EFI A;  4L59 A;  2YRV A;  3MP6 A;  5D6X A;  3MEA A;  4IKF A;  3OYG A;  4II1 A;  2X4W A;  3L2Q A;  5M9O A;  4IUU A;  1WGS A;  3OS0 A;  2RJE A;  2X4X A;  3S3N A;  4A4G A;  1RI0 A;  4FU6 A;  3GOX A;  2PQW A;  3MET A;  2RHZ A;  3DB3 A;  2DIQ A;  3QBY A;  3SD4 A;  2QQR A;  1WJS A;  2XK0 A;  3PNW C;  3EAE A;  2RI2 A;  2P0K A;  2O4X A;  3OS2 A;  3LGF A;  3MEU A;  4N4I A;  3BDL A;  4B9W A;  2K3X A;  1OZ3 A;  3OYC A;  3CEY A;  2M0O A;  3P8H A;  3Q1J A;  3L2U A;  2RJD A;  4BE2 A;  3UT1 A;  4PLL A;  4QQD A;  2RHI A;  3H6Z A;  3L42 A;  2XDP A;  4NS5 A;  4C5H A;  4C5E A;  3H8Z A;  4IUP A;  3S3O A;  2E5Q A;  3OMG A;  2EKO A;  4OVA A; 
#chains in the Genus database with same CATH topology
 1PRM C;  1Q95 G;  4B6M A;  2FPD A;  1WJQ A;  2QEX Q;  4C8Q B;  3WVD B;  1Q81 U;  4PKC C;  1PM3 A;  1X6B A;  2QDL A;  1Z9Z A;  4KH0 B;  2LVM A;  1H3Z A;  4JRP A;  5LJ5 h;  3I55 Q;  2K3Y A;  3QDF A;  2A28 A;  1K73 R;  4JLG A;  4FYX B;  1G3W A;  4GLM A;  5LJ5 g;  2MMP A;  2EGC A;  3EH2 A;  3OS5 A;  5GAO r;  3VRZ A;  3M55 A;  3CXC S;  5IHK A;  3HRU A;  4J9D A;  2CH4 W;  2L8D A;  1AOJ A;  2DD5 A;  3MHX A;  2DE0 X;  1B3Q A;  2JM9 A;  1W4S A;  3HSB A;  4F04 B;  1JRI A;  4QW2 A;  1ZQ1 A;  1RAE B;  4BB7 A;  5D6Y A;  4F7U B;  2E3H A;  2Z0W A;  1UJY A;  4KUI A;  4BI4 A;  3OYM A;  3TRE A;  4ELY C;  3E9F A;  1VQM A;  4C92 E;  1BKB A;  2R58 A;  3TCJ A;  2HKQ B;  1YI2 Q;  2RD1 A;  4C8Q G;  3M4G A;  1Q82 C;  2ATC B;  3NMZ C;  2RQT A;  1JO8 A;  4XTY A;  5GMK h;  1NJI C;  3EFS A;  2LC4 A;  5LJ5 e;  4UC4 A;  4DA4 A;  2CP5 A;  3PMT A;  2IG0 A;  3BDU A;  2O4X B;  3U23 A;  2XI9 A;  1NJI U;  2CP3 A;  1HYO A;  1OU9 A;  2KRO A;  2X4W A;  4EMG A;  1G83 A;  4E6R A;  3S3N A;  2CT4 A;  5GAN 3;  3MET A;  2EWN A;  1TOV A;  3RDV A;  2XU8 A;  4F14 A;  1K9M U;  1A0N B;  1SRL A;  4BE2 A;  1YIT A;  1QVF A;  2KYB A;  4C5E A;  2P4R A;  5DM7 R;  2AZV A;  3S3M A;  1JXM A;  3VYG A;  3G4S A;  2A36 A;  5IHN A;  3L2V A;  1NM7 A;  4DBF A;  1Q81 C;  5HY6 A;  1K9M C;  3DLM A;  2EYW A;  4KRT A;  1ZSZ B;  4M75 G;  3EG0 A;  3EFO B;  2JTE A;  3VS7 A;  5HK3 A;  1TUG B;  3TSW A;  5IH2 A;  3JCM c;  4F7U F;  2RNA A;  4BI8 B;  2R57 A;  4GLK A;  1EZZ B;  3UA6 A;  2KVQ G;  1QVF P;  4PFO A;  1H3H A;  2JMA A;  2Y4X A;  1PD1 A;  3ASK A;  1O75 A;  2D0N A;  4FSX A;  4OMF B;  4YTL A;  1AWW A;  2EYZ A;  4N4H A;  1YHQ T;  2MWO A;  2ED0 A;  2LQK A;  2QXF A;  4QQG A;  2RF0 A;  2JT4 A;  5AT1 B;  4HT8 A;  4FT4 A;  1X43 A;  2FRY A;  1M1G A;  3OYY A;  2B8A A;  3PGG A;  4QT7 A;  3PVQ A;  1JJ2 A;  1E7O A;  4J9F A;  4C0D C;  3UA7 A;  4CC3 A;  2CYZ B;  3M59 A;  3ZBD A;  3RKW A;  1YJ9 Q;  2Y4Y A;  4FL6 A;  2EIF A;  4M78 A;  2XG8 D;  2DEU A;  1M3B A;  3RIR A;  2DPP B;  3OW2 A;  2PVD B;  4ZN1 A;  4LD9 K;  2K5I A;  4C5G A;  5LL6 S;  3G6E T;  5GAN h;  1SKU B;  3VS4 A;  2OTJ T;  2CSQ A;  2W0Z A;  4NL3 A;  2IIM A;  2CZ0 B;  2X3W D;  3CBO A;  2DIQ A;  1W6X A;  1YBY A;  2MF2 A;  2P0K A;  2QTX A;  2RMO A;  1BYM A;  2K3B A;  1LVK A;  2CSI A;  3H0F A;  2OTL T;  2RQW A;  1PC0 A;  3VUB A;  1WHK A;  2BKD N;  2PU9 B;  5GJV B;  2WAC A;  2QAS A;  2DAQ A;  3BY7 A;  1K0S A;  2EYY A;  3LH5 A;  4KH1 B;  2EJ9 A;  3L2W A;  2DVJ A;  3HFN A;  3LYI A;  1VQ4 Q;  3EGX B;  2KY9 A;  2YLC A;  2FEI A;  1U06 A;  2R5A A;  1K4U S;  2LCL A;  1OEB A;  2L3R A;  3QXE B;  3DKM A;  2A08 A;  3OYB A;  3JCM W;  5KE3 A;  4PLI A;  3UAT A;  3VS3 A;  3FEO A;  5J26 A;  1RAI B;  1D0X A;  2FO0 A;  3HRS A;  1H64 1;  3QJ6 A;  2QTV A;  3KBG A;  4BDZ A;  4LDV A;  1WLP B;  4IIO A;  4O6J A;  3EFO A;  2RJC A;  3CCJ T;  5KYY A;  3RUX A;  2FG0 A;  3G4S Q;  5FRN A;  2DL7 A;  2LT4 A;  3X24 B;  3A8M B;  2RI5 A;  1N8R R;  3M58 A;  1VQ8 T;  2YWW A;  2OAW A;  2JW4 A;  4EPC A;  3CC4 T;  2YHT A;  2E64 A;  3C0C A;  2DXU A;  3VYH B;  2DER A;  1TUC A;  2JTM A;  1UFF A;  4IUT A;  5DLO A;  3HP9 A;  4L59 A;  4E2F B;  3A8H B;  1PSE A;  2ROT A;  1Q7Y U;  2YRD A;  3LW5 E;  3A1P A;  3MPU B;  1W70 A;  1NLP C;  2E5K A;  5HCK A;  4PK4 A;  4N4I A;  1N5Z A;  1QWF A;  2K3X A;  4AFU C;  4C92 A;  2F5T X;  2M0O A;  1UHF A;  3UT1 A;  4J9I A;  5FWB A;  2EGE A;  4VUB A;  4K11 A;  3JB9 F;  1K8A C;  1AT1 B;  2LT1 A;  4CI0 C;  4Y92 A;  3OYI A;  3CCV Q;  1ZX6 A;  2YT6 A;  1P92 A;  1KHC A;  1IHW A;  2SEM A;  1NYF A;  2BZX A;  4OMQ A;  4N4G A;  1S72 A;  1BI3 A;  1VQ7 T;  4J9B A;  2KT8 A;  3I55 T;  4M77 G;  2AZS A;  1OPL A;  2KDS A;  2COW A;  3LH0 A;  3QKJ A;  2K4Y A;  1PSF A;  2QQA A;  4GBQ A;  2FPE A;  3MO8 A;  5GAM h;  4ELZ C;  3CCL Q;  1WHG A;  4E7I A;  2L0A A;  4GY5 A;  1BIA A;  1KC8 C;  2XD0 A;  2JJ9 A;  1JQQ A;  1N27 A;  4XTV A;  3S6W A;  2K5L A;  4B9X A;  1MMG A;  2GF7 A;  2CP7 A;  4CRI A;  4DEY A;  1Y7X A;  3AHU A;  1UGR B;  4M7D G;  4ORZ A;  4JS5 A;  1VQM T;  2QQ9 A;  3E2U A;  1JJ2 S;  5LJ3 h;  3CXC P;  3MP8 A;  1ZSZ A;  2HZY A;  2M1H A;  1M1K U;  1WJR A;  2KMT A;  4FYY B;  1G2B A;  1KIK A;  2ZPB B;  3QO3 A;  3QZ9 B;  4C8Q D;  2OTL A;  2QA4 Q;  1M9S A;  4C0G A;  2KK4 A;  3C4S A;  2X4J A;  4J6Y A;  1QMC A;  2E6Z A;  4C0D B;  2KRS A;  1D3B A;  2MYS A;  1M90 R;  2MK5 A;  4A53 A;  1VQ7 Q;  4BAC A;  1RAG B;  2IPO B;  1WXB A;  2X9H A;  5LJ5 f;  4DQ2 A;  1VQ4 A;  2DM1 A;  1MV3 A;  1UGP B;  1U8R A;  3MCA B;  1SF9 A;  4F7U G;  3N5B B;  1J3T A;  4M7D E;  1Q86 C;  1XQH A;  2KYM A;  2ZAE A;  4C92 D;  1PWT A;  3E1S A;  3Q1J A;  1Y71 A;  1WQW A;  4OP0 A;  3EG2 A;  1M3A A;  2WSE E;  1RAB B;  2E5Q A;  1VIE A;  2P84 A;  4RTU A;  2V8J A;  1Q86 U;  1G8X A;  4ATO A;  2JXB A;  5FRM A;  4FYW B;  4OGE A;  4E7H A;  3KUF A;  3THK A;  4ANJ A;  2D0Q B;  1AWJ A;  2DX1 A;  4M77 A;  1R77 A;  3I9Q A;  1OPK A;  2LTO A;  3C94 A;  1SG5 A;  2HCK A;  2VKN A;  1TXQ A;  3CMA Q;  1UGQ B;  2DIL A;  2KBT A;  2BE9 B;  5GAN 2;  1YN8 A;  3EG1 A;  3R6N A;  4M7A G;  2VV5 A;  2M16 A;  2YUP A;  3FJ5 A;  4XTW A;  3J81 E;  3OYF A;  3A98 A;  4FSS A;  3JB9 J;  3P8B B;  2OX7 A;  4FM4 B;  3H41 A;  5KYN A;  3WXM B;  2KGT A;  3VS6 A;  2KSS A;  3JCM b;  4M77 F;  4OML A;  3CCR Q;  1ACM B;  1Y0M A;  1XTD A;  2QA4 T;  3TSZ A;  3CCE T;  3SWN C;  3FLG A;  2JS0 A;  1UDL A;  4RCB A;  5IT9 E;  3OYL A;  4JRK A;  2QAZ A;  4C8Q C;  5GAN d;  5KYU B;  2W10 A;  4WTO B;  2X35 A;  2CP0 A;  3CC2 A;  3NTH A;  3CPW A;  3PE0 A;  2VC8 A;  2FZK B;  1N8R U;  4E7Z A;  4JZ4 A;  1VQ7 A;  3RKX A;  1AWO A;  2DYI A;  1SHG A;  3L2Q A;  1N9S A;  1D0Y A;  2J6K A;  4PJO E;  3EFR A;  9ATC B;  1BBZ A;  1UE9 A;  2E70 A;  3LGF A;  1KC8 U;  5CQY A;  5IXF A;  4FT2 A;  2RJD A;  2DNU A;  2A7Y A;  4PJO D;  2MI6 A;  4DOV A;  3OW2 P;  2G3R A;  3OYD A;  2FB7 A;  1LJO A;  4N0A C;  1Q7Y C;  2OAU A;  1YP5 A;  2HL3 A;  2DET A;  2LDM A;  2RQR A;  2D9T A;  4M77 D;  1S72 Q;  2CUB A;  3QPH A;  4LDX A;  1BIB A;  3JCM e;  1YJN Q;  1M1K C;  2KRM A;  1FXX A;  1V1C A;  1BB9 A;  5EG2 A;  2E6N A;  4OB1 B;  2L89 A;  4FW1 A;  3VS2 A;  4ZNX A;  4M7D D;  3RMQ A;  4PJO F;  2JNG A;  1RLQ C;  2DL3 A;  2DKG A;  3BE3 A;  5KYU A;  3CCJ A;  1VQO Q;  2RB6 A;  1DJ7 B;  2HDA A;  2EKH A;  2NWM A;  3M0P A;  2BZ8 A;  2PNI A;  2K2M A;  4PJO G;  1QCF A;  2CRE A;  2L3Q A;  5GAN 4;  2J6O A;  2K79 A;  1FMV A;  2WSC E;  3CC4 A;  1M1K R;  2RI3 A;  1GCP A;  1GBQ A;  5FWC A;  1YWO A;  2GCX A;  3CC2 Q;  1OYX A;  3CC4 Q;  1OV3 A;  2F1L A;  3EHQ A;  4C92 F;  1Z9Q A;  3V8K A;  2JVV A;  3CBP A;  3VU3 C;  3L2Z A;  2YRV A;  4MDX A;  1Q82 R;  2EQI A;  1ZUY A;  2EYQ A;  1Y96 A;  4C92 G;  1NLO C;  7AT1 B;  3PNW C;  4M78 F;  4B9W A;  1NZ9 A;  1OZ3 A;  2K7A A;  4A63 B;  3URG A;  4XU3 A;  4NS5 A;  4FCY A;  1AEY A;  4OB3 B;  3FC3 A;  3CPF A;  2CZ1 B;  1MMD A;  2O31 A;  1S72 T;  2QQB A;  5KCH A;  2FZG B;  3L2R A;  2AT1 B;  3QG1 A;  1T0J A;  1R0C B;  5GAO p;  3JB9 H;  3G71 Q;  4ZTF A;  1VQK Q;  1VQO T;  1TWB A;  2QA4 A;  1CSK A;  3FDR A;  4NOY A;  4RTX A;  3GP8 A;  2HD0 A;  1HK9 A;  1H8K A;  2LP5 A;  4HVU A;  3QSU A;  3DB4 A;  1YFN A;  1AHJ B;  1QKW A;  3A5Z B;  5KYW B;  2EQJ A;  3I35 A;  2OTJ Q;  1JBM A;  1X01 A;  4PJL A;  3CC2 T;  3D7S B;  1AZE A;  4XTX A;  3I55 A;  1JJ2 P;  1MND A;  1WYX A;  2DO3 A;  4DBQ A;  3I5S A;  3JAM E;  2EYX A;  5CKD A;  4A54 A;  4C5I A;  2NYS A;  5LJ3 g;  5A0L A;  3EH1 A;  4OMM A;  1VYT A;  2LQ8 A;  4M75 E;  2DEQ A;  2K6D A;  4FIB A;  4JRI A;  4HCB A;  5GAM d;  3CCR A;  3NGP A;  4M7D C;  2YSQ A;  1VA7 A;  3PFS A;  1GFD A;  3M0Q A;  3M0U A;  2KQW A;  5GAN 7;  4F17 A;  2B86 A;  2HQX A;  1G3S A;  5GMK l;  1IB8 A;  3TVT A;  4A4E A;  3FB9 A;  1YIJ T;  1VQ4 T;  4IUQ A;  1VQ9 T;  1SSH A;  2E12 A;  2D8J A;  4D6W A;  2RO0 A;  3KFV A;  3JB9 G;  4IKF A;  1KFZ A;  2DZ9 A;  5M9O A;  4BY6 C;  3GLX A;  1Y96 B;  2ESW A;  1YCY A;  1WFW A;  1ZA1 B;  3VRY A;  4J9H A;  1TTH B;  5GAN g;  5A0G A;  3VV0 A;  1RAH B;  4HKE A;  1V76 A;  2RI2 A;  3GNG A;  3VS0 A;  3P8H A;  5CKH A;  1PD0 A;  2CUD A;  2EJF A;  2YUO A;  4J5Y A;  3DLL A;  1T3S A;  3PIP A;  4LE9 A;  3M56 A;  1W2B A;  3M0R A;  2DTH A;  4M78 B;  5I2M A;  2MWP A;  3RNJ A;  1OOT A;  2MIO A;  3CCM Q;  2CGH A;  3SB2 A;  1VQ8 Q;  3VKI A;  1TH7 A;  1VQL Q;  1NPR A;  2A37 A;  2C0T A;  2DL4 A;  4E7L A;  1X6G A;  1H92 A;  1VQL A;  1I1J A;  3VS5 A;  3UDC A;  3GNF B;  1HSQ A;  4RCC A;  2RQV A;  2C0O A;  3A8L B;  3QYH B;  1GBR A;  4JDS A;  2XIC A;  1QP2 A;  2DLP A;  2HNI A;  2P0P A;  3MEW A;  2QEX A;  5IAY A;  2VYT A;  1NYG A;  4FYV B;  5HK0 A;  3TU4 K;  3PT9 A;  2LMJ A;  3FRN A;  4M75 F;  4AMC A;  3CBM A;  5FU7 B;  3M57 A;  2ABL A;  3EGD A;  4XU0 A;  4RG8 A;  2E1H A;  1QWE A;  2LCC A;  3OA6 A;  2FZC B;  4DEX A;  1E6G A;  1WI7 A;  3M0T A;  1MHN A;  3LWH A;  5CIU A;  1KQ1 A;  1UGV A;  1IO6 A;  2RA2 A;  3CME A;  1QW1 A;  5CCA A;  1C1A A;  2DXT A;  1MV0 B;  2H3E B;  1K76 A;  3OYN A;  3OMC A;  4Z88 A;  4ZGD B;  3CCL T;  2V1Q A;  4M7A B;  1M8V A;  3OYA A;  2ENM A;  3NHN A;  3CCS A;  2EFI A;  4X9C A;  2VAS A;  1D1B A;  3ZFJ A;  2LJ0 A;  3CCQ Q;  2VXF A;  3R6O A;  1RI9 A;  4C8Q E;  1Y07 A;  1B07 A;  3OBY A;  4MZP A;  5I11 A;  4L5G A;  3CMA A;  2NUP B;  5CVI A;  3PIO A;  2J7I A;  3MEU A;  2E41 A;  4J9E A;  3SWN B;  3L42 A;  3JCM h;  2EKO A;  4OVA A;  5GMK j;  2NUT B;  2FL7 A;  2L3S A;  1PKT A;  2AHJ B;  1VUB A;  3BW1 A;  4E7J A;  4PJJ A;  4XTZ A;  2HSP A;  4MZM A;  1YCS B;  3X26 B;  1NEG A;  4JJD A;  1W2B S;  1M2V A;  2LZ6 B;  3SDZ A;  1WA7 A;  1C0M A;  4M7D A;  2EW3 A;  3AT1 B;  1UHC A;  1FWZ A;  2J6F A;  2YRC A;  1GFC A;  4Q5W A;  4AFS C;  1YI2 A;  1M90 C;  3O5Z A;  5GAO m;  2HAX A;  1ZUU A;  3OYJ A;  1VQ5 Q;  4EDU A;  1M5Q 1;  2GFU A;  1G3T A;  3CXC A;  2COZ A;  1I81 A;  2NUP A;  1U1T A;  2CP2 A;  1N8R C;  4E7K A;  3INZ A;  1O9S A;  1Q7Y R;  4Z02 A;  1KC8 R;  2PVO B;  1AZG B;  1PCX A;  4KUD K;  2DA9 A;  3JCM d;  2CS7 A;  4JRQ A;  4ZN3 A;  2DYB A;  1R8O B;  1GRI A;  4LD6 A;  2F2V A;  1PRL C;  2YLB A;  4PJO A;  2HL5 C;  4ZGE B;  4OB0 B;  1OZ2 A;  4MZT A;  1OX8 A;  4E7S A;  4BDY A;  5CK9 A;  2MOX A;  2YUQ A;  4WF2 A;  1M1F A;  3M0S A;  5CQX A;  3ZL7 C;  2MPX C;  4OGC A;  1ZA2 B;  2KXC A;  1AD5 A;  3QWY A;  4LDU A;  2ZPG B;  2X4X A;  1FMK A;  4J7I A;  1WNL A;  2H8H A;  3DB3 A;  1YJ9 A;  3QBY A;  2QK0 A;  2RK2 A;  3SD4 A;  1W2B P;  3MKD A;  3L2U A;  1WHJ A;  4Y91 A;  3SEM A;  1D3B B;  4XQ3 A;  2CZ6 B;  3LX7 A;  3RR6 A;  2O2O A;  1VQO A;  1YIT T;  3C95 A;  1PKS A;  3CC7 T;  5CO7 A;  8AT1 B;  5KCO A;  5KH6 A;  5FRO A;  2LX7 A;  3QII A;  1RAC B;  4HCK A;  1ZHI A;  4M78 C;  5I22 A;  1BCO A;  3CCU Q;  4LXC A;  2DIG A;  1KQ2 A;  1OQK A;  1BU1 A;  2CDT A;  3ULR B;  3LWI A;  2DF6 A;  2JM8 A;  4RTV A;  1UUE A;  2DK3 A;  2ZPE B;  3X20 B;  1N6A A;  2V26 A;  4AFZ C;  3H0H A;  2EJG A;  4JUV A;  4A4F A;  1K8A R;  4CC2 A;  3UPU A;  2PZ1 A;  4C92 C;  5GAM g;  3HHT B;  3HRT A;  2DL5 A;  5I21 A;  1M30 A;  1UB4 A;  8ATC B;  2JZ2 A;  3NFC A;  2JMC A;  1SHF A;  2DBK A;  4KBM B;  4JS4 A;  2YDL A;  4IUR A;  1WHL A;  1NJI R;  2C0I A;  3VS1 A;  1TSF A;  4C8Q A;  3G6E Q;  2QI2 A;  2FYK A;  3EHR A;  4XU2 A;  5L23 A;  1UGS B;  1YJW T;  1Q86 R;  1YIJ Q;  2XID A;  1QCN A;  3JCM f;  1C6V X;  4CC7 A;  3MJX A;  2GQI A;  2WSF E;  5GAO n;  3FIF A;  4ESR A;  2OTL Q;  3V7R A;  4A4G A;  1AVZ C;  1VYV A;  5GMK e;  3QJY A;  1VQ5 A;  4QKU A;  2O4X A;  2X3X D;  2LNH B;  4EMK A;  4QVD A;  2RQU A;  4PLL A;  3IQL A;  1YI2 T;  3S3O A;  1D0Z A;  1F1B B;  3REA B;  5GAM e;  5D6X A;  5HKC A;  1SEM A;  2O9V A;  3ER0 A;  3CC7 Q;  3HPW A;  4JZ3 A;  2DTI A;  5J39 A;  4KGX B;  2QG9 B;  2D8H A;  1JU5 C;  1W1F A;  4PNO A;  2D1X A;  5C0M A;  3WVE B;  1HJD A;  2BZY A;  4JJN K;  4BD3 A;  4JPB W;  1XJW B;  3OSV A;  4LUE A;  4C0F A;  5GJW B;  1XNI A;  2F5K A;  4LUD A;  1VQK A;  2M51 A;  2LX9 A;  4FW2 A;  2HEQ A;  1IRE B;  3SWN A;  5IXB A;  2DXC A;  2GNC A;  4C8Q F;  2FVU A;  2F2X A;  4JLI A;  2VWF A;  2CKK A;  3EGX A;  3JCM Q;  4RMO A;  3X25 B;  2L3P A;  3OYK A;  2KAF A;  2DTO A;  2E65 A;  4PFZ A;  2YXY A;  3V8L A;  4KGZ B;  1N9R A;  4IUV A;  3MEV A;  4ME7 A;  2AKL A;  1UEB A;  1EFN A;  1WPY A;  3JRZ A;  3CME T;  4M7A A;  1QVG P;  2HSE B;  2QGF B;  2KXD A;  5FLX E;  5A2Q E;  2J06 A;  3CCJ Q;  4E47 A;  2I2L A;  4Z89 A;  1M2O A;  1X27 A;  2V8K A;  2JOY A;  4M77 C;  2JN0 A;  1CKA A;  3GPL A;  4R56 A;  3OY9 A;  5KYY B;  2DL8 A;  1VQ8 A;  1YHQ Q;  3REB B;  4J7F A;  4II1 A;  3EG3 A;  4IUU A;  2ECZ A;  3G1J A;  2L2P A;  2H3J A;  1RI0 A;  1ABQ A;  4OMN A;  3M54 A;  1RAF B;  4DBH A;  3HFO A;  2XK0 A;  2F69 A;  3CCV T;  2AIR B;  5DLQ E;  3CQT A;  2LQW A;  2RHI A;  2XDP A;  4OB2 B;  1Y57 A;  4HVV A;  3UF4 A;  3X28 B;  1OU8 A;  1S1N A;  4EMK C;  2VGM A;  5ECA A;  1LPL A;  2X51 A;  1VQN A;  1ZLM A;  1X2Q A;  2M0Y A;  2LJ1 A;  1BI2 A;  1UG1 A;  1MNE A;  2GFA A;  1IHV A;  3FJP A;  4M75 C;  1MUZ A;  4L6V 5;  1NEB A;  4V2S A;  1VQ9 Q;  3EGD B;  3A8O B;  5LJ3 d;  2FPF A;  4KGV B;  1K9M R;  4KT0 E;  4HCC A;  2DMO A;  5IHI A;  1T3L A;  3M9Q A;  4M75 A;  5CAI A;  2DD4 A;  4J8O A;  3CCS Q;  1YJW A;  1YWP A;  1LCK A;  2MCN A;  4RKU E;  4OMO A;  3VUZ A;  3V8J A;  1AWX A;  5D6W A;  2LNV A;  2LQN A;  1WDX A;  2HQH A;  2IVW A;  2O01 E;  3M4Y A;  2CH4 A;  3QHS A;  4QVZ A;  3JCM V;  4Z8A A;  5LJ3 f;  3G7Z A;  1GCQ C;  4X9D A;  1WQ7 A;  1KK7 A;  1OX9 A;  2V8I A;  1M90 U;  2VB6 A;  2BTT A;  3PMI A;  3GIB A;  3I56 Q;  1G3Y A;  1SRM A;  4QVC A;  4BE1 A;  2GTJ A;  2CP6 A;  5GAN 6;  2JTF A;  4CC4 B;  1GL5 A;  3OBW A;  3JV3 A;  1KD1 R;  2KT1 A;  2VUB A;  4C92 B;  2XKO C;  5LJ5 j;  1WGS A;  1X6O A;  1YJ9 T;  1QVP A;  1FMW A;  1YJN T;  4HXJ A;  1VQK T;  5I2S A;  3OS2 A;  2DZC A;  3BDL A;  2G6F X;  4O5V A;  5GMK i;  3H8Z A;  1ZBX A;  3OMG A;  3RER A;  4J6W A;  1VIF A;  2MAM A;  3HL8 A;  1KQS A;  3CC7 A;  1KD1 U;  4LN2 A;  2ZPF B;  2O88 A;  4D8K A;  1V29 B;  5CR2 A;  2QDY B;  5LJ3 j;  1XOV A;  2F2W A;  4P5N A;  3V7C A;  5C6S A;  4A4K A;  3HTR A;  1Q82 U;  3SFM A;  5KE2 A;  3OYE A;  3GF5 A;  4F7U E;  4ZGJ B;  3V7S A;  1BCM A;  4BI3 A;  2QQS A;  3CCQ T;  4XTU A;  4M4Z A;  4RG2 A;  3E19 A;  3CCE A;  1X2K A;  1HXD A;  4PJO C;  3OYH A;  3RMS A;  1NPP A;  2A3L A;  3H9N A;  2LCS A;  1CKB A;  2RH2 A;  2NLU A;  1OI1 A;  1VOM A;  3OSS C;  3MP1 A;  2RM4 A;  1LOJ A;  3ME9 A;  3ZEH A;  4F7U A;  3TEE A;  3JB9 I;  3CD6 A;  3NPF A;  2L5Q A;  1NE8 A;  2DJZ A;  1ABO A;  2FHD A;  4WCI A;  3G71 T;  3QDR B;  4A4H A;  1EIF A;  4RTZ A;  1KD1 C;  2XHC A;  1VQP T;  4X34 A;  1EX4 A;  1U5S A;  3MEA A;  2RN8 A;  3QWX X;  1JB0 E;  1VQ5 T;  1ZBJ A;  1UTI A;  1TUD A;  3CCM T;  1VQ6 A;  3GBQ A;  4N0A A;  1WJS A;  1BK2 A;  4X1V A;  4AG1 C;  2V1R A;  1KJW A;  1NG2 A;  3CCU A;  1QP3 A;  2GBQ A;  4TVR A;  1PHT A;  2DBM A;  2RPN A;  5GAM f;  5FU6 B;  2EBP A;  3L1A A;  2M9U A;  2DVE A;  2RHU A;  1I5L A;  1RUW A;  3LLR A;  3EGU A;  2O9S A;  1VQN Q;  2A0F B;  1I8F A;  1SPK A;  4RTY A;  1GXI E;  1ARK A;  4RTT A;  5LJ5 d;  4QQ6 A;  2RK1 A;  5A0D A;  1HD3 A;  2AK5 A;  3F70 A;  2FRW A;  5CKB A;  2ZPH B;  2KRN A;  4DBR A;  4R0K A;  1I0C A;  2DRM A;  2I0N A;  2ED1 A;  1VQP Q;  1I5O B;  1B34 B;  2DJQ A;  2YUN A;  4XK8 E;  1FX7 A;  3HKS A;  5FW9 A;  1IGU A;  1G5V A;  4BY6 B;  3PTA A;  4M7A C;  2EQM A;  1T0H A;  4MDW A;  1YJN A;  3OQ5 A;  2XDD A;  2PVG B;  4LDW A;  3UWN A;  3M53 A;  2R5M A;  1WIE A;  2EGA A;  2K5F A;  1B7T A;  1WZO A;  2NUT A;  4PL6 A;  2EQU A;  4M78 D;  1ZSZ C;  3JCM X;  3CPW S;  4M75 B;  2ZCF B;  1WXU A;  2K9G A;  4C0Z A;  4M77 E;  5GAN 5;  5J3B A;  1WX6 A;  5L8R E;  4JJC A;  1QVG S;  4EMH A;  4J9C A;  4LDY A;  3EG9 A;  3CCV A;  3GOX A;  1TG0 A;  3CCE Q;  3EAE A;  4Y28 E;  4QQD A;  1WHH A;  3H6Z A;  4J83 A;  3CCQ A;  3TQ7 P;  4NL2 A;  4M75 D;  3JCM J;  3JSC A;  4LNP A;  1VQN T;  4HCZ A;  2P0Q A;  4AT1 B;  4M7A F;  5D7U A;  1U1S A;  1X75 C;  1KG1 A;  3G4S T;  2EVR A;  2ROL A;  3JCM P;  1K73 U;  3J80 E;  3M5A A;  1WXT A;  2J05 A;  3RBB B;  2JUF A;  1RAA B;  3QYG B;  1M27 C;  5DY9 A;  1IXD A;  3I56 A;  1IRX A;  4D8D A;  1B34 A;  5IN1 A;  2XMF A;  3O8V A;  4PJN A;  2RHY A;  1NBE B;  1X69 A;  2PTK A;  3G71 A;  2M02 A;  4OMP A;  5CKF A;  4OF1 A;  2CZ7 B;  4RUG A;  5KYW A;  1VQP A;  1E6H A;  1RLP C;  1UJ0 A;  3NTK A;  3VJP A;  2EPD A;  4J6X A;  1YHQ A;  1OUL A;  1PG5 B;  2HBP A;  3CPW P;  4M7D B;  1MGQ A;  5AYF A;  4M77 B;  2E4H A;  2K2V A;  2HQE A;  1M2V B;  1K9A A;  1SSF A;  2E10 A;  2RJF A;  4KUL A;  4PFP A;  5LJ3 e;  2OTJ A;  4MMK A;  5GAO q;  4HT9 A;  3E9G A;  1IGQ A;  2BE7 D;  1YNZ A;  2ZGW A;  2KI7 A;  2BUD A;  1LNX A;  1ZSG A;  3CCR T;  4M7A D;  4HA8 A;  4BUG A;  1K73 C;  3P8D A;  2SRC A;  3A8G B;  2EAY A;  1ZUK A;  4EMK B;  2BIV A;  2DFU A;  2PUK B;  3G6E A;  3OS0 A;  1M4Z A;  2RJE A;  2ZPI B;  1KSW A;  3J7A F;  3CME Q;  1PNJ A;  1YIT Q;  4FU6 A;  1YIJ A;  4R55 A;  5GAM j;  4MML A;  1QVG A;  1VQ9 A;  2QQR A;  1Q81 R;  5CKE A;  3OYC A;  1BI0 A;  3CEY A;  2GGR A;  1VQ6 Q;  4M7A E;  2QGG A;  2OJ2 A;  2HBW A;  1VQM Q;  4IUP A;  5KYX B;  1RAD B;  2KNB B;  2RHX A;  2COY A;  5GMK m;  1VQL T;  2CT3 A;  1KQS S;  1K8A U;  2C06 A;  5KYX A;  2AKK A;  1QKX A;  2P4T A;  3RES A;  1M8M A;  4F16 A;  1MMA A;  1TS9 A;  2QYZ A;  1JXO A;  5FU6 C;  1K0X A;  2QEX T;  2Y90 A;  1QQJ A;  3NTI A;  2GQV A;  2KE9 A;  2DRK A;  2E3I A;  4M78 E;  4EIK A;  3PVL A;  2LJ3 A;  4JJB A;  2X4Y A;  3CD6 Q;  1D09 B;  3LGL A;  3C12 A;  1KHI A;  4ZTJ A;  1QCO A;  2VXE A;  5GAN e;  4HVW A;  1FYN A;  3OS1 A;  2K57 A;  4AG2 C;  1JEG A;  5GAN f;  2LRQ A;  5GAN j;  1UEC A;  1VYU A;  2PUO B;  1K1Z A;  2HKN A;  3EG9 B;  3SHW A;  2NUZ A;  1YJW Q;  4PJO B;  1BI1 A;  1D1A A;  6AT1 B;  4DOW A;  1WHM A;  5FU7 C;  1IZ6 A;  4PJM A;  1D1C A;  1GCQ A;  4XAX B;  3OB9 A;  4XU1 A;  3CCL A;  2KEA A;  2VVK A;  1MMN A;  1U3O A;  2GTO A;  3I5R A;  4M7D F;  3CCS T;  1R0B G;  3OW2 S;  2EQK A;  2DXB A;  4M78 G;  2OI3 A;  1I4K 1;  3H0I A;  3KXT A;  4BE0 A;  2VGN A;  1TU0 B;  5EC7 A;  2D6F A;  3CMA T;  1I07 A;  2JS2 A;  3QZ5 B;  3MP6 A;  3OYG A;  3JCM g;  3CCM A;  3BFM A;  1KQS P;  1VQ6 T;  2ZZD A;  4IIM A;  1RL2 A;  2PQW A;  4AFQ C;  4RTW A;  2RHZ A;  2KR3 A;  3RKY A;  3CD6 T;  3QUI A;  3T9N A;  1QVF S;  3CCU T;  1QLY A;  3I56 T;  2XDB A;  5GAN 8;  5GAO l;  4J9G A;  4C5H A;  2HMA A;  3JB9 D;  1M3C A; 
#chains in the Genus database with same CATH homology
 1WJQ A;  2FL7 A;  4C8Q B;  3WVD B;  2V8J A;  4J6W A;  1Q81 U;  2AHJ B;  1VUB A;  4PKC C;  3BW1 A;  4E7J A;  1VIF A;  1Q86 U;  2MAM A;  4XTZ A;  4ATO A;  5FRM A;  4MZM A;  3HL8 A;  1KQS A;  2LVM A;  3CC7 A;  1H3Z A;  1KD1 U;  4OGE A;  2ZPF B;  3X26 B;  4JRP A;  5LJ5 h;  4E7H A;  1V29 B;  5CR2 A;  3KUF A;  2QDY B;  5LJ3 j;  1W2B S;  1XOV A;  2D0Q B;  4P5N A;  2K3Y A;  3SDZ A;  4M77 A;  3V7C A;  5C6S A;  4A4K A;  4JLG A;  1G3W A;  2LTO A;  5LJ5 g;  2MMP A;  3C94 A;  4M7D A;  3OS5 A;  5GAO r;  1Q82 U;  3SFM A;  5KE2 A;  5GMK j;  3OYE A;  1UGQ B;  3GF5 A;  3M55 A;  3CXC S;  1FWZ A;  4F7U E;  4ZGJ B;  3HRU A;  3V7S A;  4BI3 A;  5GAN 2;  2QQS A;  2L8D A;  2DD5 A;  3MHX A;  4M7A G;  4Q5W A;  2VV5 A;  3CCQ T;  1YI2 A;  4XTU A;  1M90 C;  1W4S A;  2M16 A;  4RG2 A;  4XTW A;  5GAO m;  3HSB A;  2HAX A;  3J81 E;  3OYF A;  3E19 A;  3JB9 J;  3P8B B;  3OYJ A;  4EDU A;  3CCE A;  4FM4 B;  1JRI A;  1M5Q 1;  2GFU A;  4QW2 A;  1G3T A;  1ZQ1 A;  1HXD A;  3WXM B;  3CXC A;  1I81 A;  4PJO C;  4BB7 A;  5D6Y A;  3OYH A;  1U1T A;  2KSS A;  4F7U B;  3JCM b;  3RMS A;  1N8R C;  4M77 F;  4E7K A;  1NPP A;  2A3L A;  3INZ A;  1O9S A;  4KUI A;  4BI4 A;  4LD9 K;  4Z02 A;  3OYM A;  1XTD A;  2QA4 T;  3TRE A;  4ELY C;  3E9F A;  1VQM A;  3CCE T;  3SWN C;  2PVO B;  2RH2 A;  3FLG A;  1BKB A;  4RCB A;  4C92 E;  2NLU A;  5IT9 E;  3OYL A;  1OI1 A;  2R58 A;  3JCM d;  4KUD K;  3TCJ A;  4JRK A;  2CS7 A;  4JRQ A;  4ZN3 A;  3OSS C;  1R8O B;  4LD6 A;  4C8Q C;  5GAN d;  3MP1 A;  2RM4 A;  2RD1 A;  1LOJ A;  4C8Q G;  3M4G A;  2YLB A;  1Q82 C;  4PJO A;  3ME9 A;  4ZGE B;  3ZEH A;  4F7U A;  4OB0 B;  1OZ2 A;  4MZT A;  2X35 A;  3TEE A;  3JB9 I;  4XTY A;  3CD6 A;  2L5Q A;  5GMK h;  3CC2 A;  1NJI C;  4BDY A;  1NE8 A;  3EFS A;  2DJZ A;  3NTH A;  3CPW A;  2LC4 A;  2FHD A;  2VC8 A;  5CK9 A;  1N8R U;  3G71 T;  3QDR B;  4UC4 A;  1EIF A;  4A4H A;  5LJ5 e;  4DA4 A;  1KD1 C;  4WF2 A;  1M1F A;  3PMT A;  2XHC A;  1VQP T;  2IG0 A;  1VQ7 A;  3BDU A;  5CQX A;  2O4X B;  4X34 A;  2XI9 A;  3RKX A;  4OGC A;  1NJI U;  3MEA A;  3L2Q A;  2X4W A;  4LDU A;  1N9S A;  4EMG A;  2ZPG B;  2X4X A;  4PJO E;  1JB0 E;  1VQ5 T;  3S3N A;  3CCM T;  1VQ6 A;  5GAN 3;  3MET A;  1WNL A;  4J7I A;  3DB3 A;  3EFR A;  1YJ9 A;  3QBY A;  2RK2 A;  2EWN A;  3SD4 A;  4N0A A;  1WJS A;  2XU8 A;  2E70 A;  3LGF A;  1KC8 U;  5CQY A;  1K9M U;  3L2U A;  4FT2 A;  4BE2 A;  2RJD A;  1YIT A;  1QVF A;  3CCU A;  2A7Y A;  1QP3 A;  4C5E A;  4PJO D;  4TVR A;  4Y91 A;  2MI6 A;  5DM7 R;  1D3B B;  4XQ3 A;  3S3M A;  4DOV A;  3VYG A;  2G3R A;  3OYD A;  3G4S A;  2FB7 A;  1LJO A;  2CZ6 B;  5GAM f;  3LX7 A;  5FU6 B;  4N0A C;  3L1A A;  3L2V A;  2M9U A;  2OAU A;  1VQO A;  1YIT T;  1Q7Y C;  2DVE A;  2RHU A;  3C95 A;  1Q81 C;  5HY6 A;  2LDM A;  1I5L A;  3DLM A;  1K9M C;  3LLR A;  4M75 G;  2D9T A;  4M77 D;  3CC7 T;  5CO7 A;  3QPH A;  5HK3 A;  4LDX A;  3JCM c;  4F7U F;  1BIB A;  3JCM e;  1I8F A;  5KCO A;  1GXI E;  4BI8 B;  2R57 A;  4GLK A;  5KH6 A;  5FRO A;  5LJ5 d;  1M1K C;  3QII A;  4QQ6 A;  2RK1 A;  1ZHI A;  2KVQ G;  4M78 C;  5A0D A;  1FXX A;  3F70 A;  2DIG A;  5CKB A;  2ZPH B;  1KQ2 A;  5EG2 A;  3LWI A;  2E6N A;  4OB1 B;  2L89 A;  2Y4X A;  2DK3 A;  2ZPE B;  3ASK A;  1O75 A;  3X20 B;  1N6A A;  4M7D D;  4FSX A;  2EJG A;  4OMF B;  4YTL A;  3RMQ A;  4N4H A;  1B34 B;  4JUV A;  4PJO F;  2JNG A;  4A4F A;  2MWO A;  1YHQ T;  2LQK A;  2QXF A;  4XK8 E;  4QQG A;  3UPU A;  1FX7 A;  2DKG A;  3HKS A;  4C92 C;  3CCJ A;  5GAM g;  3HHT B;  1G5V A;  4HT8 A;  4BY6 B;  2RB6 A;  3HRT A;  2EQM A;  1DJ7 B;  3PTA A;  4M7A C;  4FT4 A;  4MDW A;  1M1G A;  3OYY A;  2B8A A;  3PGG A;  1YJN A;  3OQ5 A;  5I21 A;  1JJ2 A;  1UB4 A;  4C0D C;  2XDD A;  2PVG B;  4PJO G;  2JZ2 A;  2CYZ B;  3M59 A;  3NFC A;  3ZBD A;  4LDW A;  3RKW A;  5GAN 4;  4KBM B;  4JS4 A;  3UWN A;  3M53 A;  2Y4Y A;  4IUR A;  4FL6 A;  2EIF A;  2R5M A;  2XG8 D;  4M78 A;  2WSC E;  3CC4 A;  3RIR A;  4C8Q A;  2K5F A;  2QI2 A;  2RI3 A;  2FYK A;  2DPP B;  4XU2 A;  1UGS B;  2GCX A;  4PL6 A;  2EQU A;  1OYX A;  2PVD B;  4ZN1 A;  3OW2 A;  2K5I A;  1YJW T;  4M78 D;  4C92 F;  3JCM X;  3V8K A;  3CPW S;  4M75 B;  2ZCF B;  4C5G A;  2JVV A;  4C0Z A;  5LL6 S;  3CBP A;  4M77 E;  2XID A;  3VU3 C;  5GAN 5;  3JCM f;  3G6E T;  5J3B A;  3L2Z A;  2YRV A;  4MDX A;  5L8R E;  5GAN h;  2OTJ T;  1QVG S;  2WSF E;  2EYQ A;  3FIF A;  5GAO n;  1Y96 A;  3V7R A;  4EMH A;  4NL3 A;  4A4G A;  4LDY A;  3CCV A;  4C92 G;  3GOX A;  2CZ0 B;  3CBO A;  2DIQ A;  5GMK e;  3QJY A;  1YBY A;  1VQ5 A;  3PNW C;  3EAE A;  4M78 F;  2MF2 A;  2P0K A;  2O4X A;  4Y28 E;  2QTX A;  4B9W A;  4EMK A;  1NZ9 A;  1OZ3 A;  4QVD A;  1BYM A;  3URG A;  4PLL A;  4QQD A;  2OTL T;  3H6Z A;  4XU3 A;  4NS5 A;  4J83 A;  3CCQ A;  1YI2 T;  4NL2 A;  3S3O A;  3VUB A;  4M75 D;  5GAM e;  4OB3 B;  3JSC A;  5D6X A;  5HKC A;  3FC3 A;  3JCM J;  3ER0 A;  3CPF A;  3HPW A;  2CZ1 B;  1S72 T;  1VQN T;  2BKD N;  2PU9 B;  2QQB A;  4HCZ A;  5KCH A;  2DTI A;  5J39 A;  2P0Q A;  4M7A F;  3L2R A;  1KG1 A;  1U1S A;  1X75 C;  2WAC A;  3QG1 A;  3G4S T;  3JCM P;  5GAO p;  2DAQ A;  3JB9 H;  3BY7 A;  1K73 U;  4PNO A;  5C0M A;  3J80 E;  3WVE B;  3M5A A;  4ZTF A;  1VQO T;  2JUF A;  4JJN K;  2EJ9 A;  4BD3 A;  3L2W A;  2QA4 A;  3FDR A;  3OSV A;  3QYG B;  3HFN A;  4C0F A;  1XNI A;  3LYI A;  4NOY A;  3GP8 A;  2HD0 A;  1HK9 A;  5DY9 A;  2F5K A;  1VQK A;  3QSU A;  3I56 A;  2LX9 A;  3DB4 A;  1AHJ B;  3A5Z B;  1B34 A;  2EQJ A;  2KY9 A;  2YLC A;  5IN1 A;  1IRE B;  1JBM A;  2R5A A;  1X01 A;  3CC2 T;  2LCL A;  4XTX A;  3SWN A;  2DXC A;  2L3R A;  3QXE B;  3O8V A;  3I55 A;  2RHY A;  4C8Q F;  3DKM A;  2FVU A;  3OYB A;  4JLI A;  3G71 A;  3JCM W;  5CKF A;  5KE3 A;  4PLI A;  2CKK A;  4OF1 A;  2CZ7 B;  2DO3 A;  3JCM Q;  4RMO A;  3FEO A;  3JAM E;  1VQP A;  3X25 B;  3NTK A;  5J26 A;  3VJP A;  5CKD A;  3OYK A;  2KAF A;  4A54 A;  4C5I A;  4J6X A;  5LJ3 g;  1YHQ A;  2DTO A;  2E65 A;  3HRS A;  1H64 1;  5A0L A;  3QJ6 A;  4M7D B;  2HBP A;  1MGQ A;  5AYF A;  3V8L A;  2LQ8 A;  3KBG A;  4M77 B;  4M75 E;  2DEQ A;  2K2V A;  4LDV A;  4BDZ A;  4O6J A;  4FIB A;  1N9R A;  2HQE A;  2RJC A;  3CCJ T;  4IUV A;  3MEV A;  4JRI A;  4ME7 A;  3RUX A;  5GAM d;  4HCB A;  1UEB A;  1SSF A;  3CCR A;  2E10 A;  1WPY A;  4M7D C;  3JRZ A;  3CME T;  2RJF A;  2LT4 A;  4KUL A;  5LJ3 e;  3X24 B;  3A8M B;  5FRN A;  4M7A A;  2RI5 A;  1VIE A;  3PFS A;  4MMK A;  4M7D G;  3M58 A;  5GAO q;  1VQ8 T;  5FLX E;  5A2Q E;  4HT9 A;  2KQW A;  3E9G A;  5GAN 7;  4E47 A;  2I2L A;  2HQX A;  1G3S A;  5GMK l;  2ZGW A;  2BUD A;  1LNX A;  4EPC A;  3CCR T;  3CC4 T;  2YHT A;  2E64 A;  2JOY A;  2V8K A;  3FB9 A;  4HA8 A;  4A4E A;  1YIJ T;  4M77 C;  2DXU A;  1VQ4 T;  4BUG A;  3VYH B;  2JN0 A;  1K73 C;  4IUQ A;  1VQ9 T;  3P8D A;  2E12 A;  3A8G B;  2EAY A;  2JTM A;  4IUT A;  4EMK B;  2BIV A;  4R56 A;  3OY9 A;  3GPL A;  4D6W A;  2RO0 A;  5DLO A;  1VQ8 A;  3JB9 G;  3HP9 A;  4L59 A;  4IKF A;  2PUK B;  4J7F A;  4II1 A;  2DZ9 A;  5M9O A;  4IUU A;  3G6E A;  4BY6 C;  3OS0 A;  1M4Z A;  2RJE A;  2ZPI B;  3GLX A;  3A8H B;  1PSE A;  1Y96 B;  1Q7Y U;  1YCY A;  3J7A F;  3RER A;  3LW5 E;  2H3J A;  1RI0 A;  4FU6 A;  4R55 A;  1YIJ A;  5GAN g;  5GAM j;  4MML A;  5A0G A;  1QVG A;  3VV0 A;  1VQ9 A;  3M54 A;  2QQR A;  3HFO A;  2XK0 A;  4HKE A;  2RI2 A;  2F69 A;  5CKE A;  3CCV T;  4N4I A;  3OYC A;  4C92 A;  1BI0 A;  2K3X A;  3GNG A;  2F5T X;  3CEY A;  2M0O A;  3P8H A;  5DLQ E;  5CKH A;  4M7A E;  3UT1 A;  2RHI A;  2XDP A;  4OB2 B;  2EJF A;  4J5Y A;  3DLL A;  4IUP A;  4VUB A;  3JB9 F;  3PIP A;  1K8A C;  2LT1 A;  3M56 A;  4CI0 C;  2RHX A;  1W2B A;  3OYI A;  2DTH A;  3X28 B;  1P92 A;  4EMK C;  5GMK m;  1VQL T;  1KHC A;  2VGM A;  4M78 B;  1KQS S;  1K8A U;  2C06 A;  5I2M A;  4N4G A;  2MWP A;  1S72 A;  1VQN A;  1BI3 A;  2P4T A;  3RES A;  1VQ7 T;  2CGH A;  3SB2 A;  3I55 T;  1BI2 A;  4M77 G;  3VKI A;  1TH7 A;  2GFA A;  2KDS A;  1NPR A;  3LH0 A;  5FU6 C;  3FJP A;  3QKJ A;  2K4Y A;  4M75 C;  2QEX T;  4L6V 5;  4E7L A;  2Y90 A;  1PSF A;  2QQA A;  4V2S A;  1VQL A;  3NTI A;  2GQV A;  3MO8 A;  3UDC A;  4M78 E;  5GAM h;  4ELZ C;  3GNF B;  4RCC A;  2X4Y A;  4E7I A;  3A8O B;  3LGL A;  5LJ3 d;  3A8L B;  3QYH B;  3C12 A;  1BIA A;  1KHI A;  4GY5 A;  2XIC A;  1QP2 A;  4JDS A;  4ZTJ A;  2HNI A;  2VXE A;  5GAN e;  2P0P A;  3MEW A;  4KT0 E;  3OS1 A;  2K57 A;  1KC8 C;  2XD0 A;  2QEX A;  4HCC A;  5IAY A;  2VYT A;  1N27 A;  3M9Q A;  4XTV A;  4M75 A;  5CAI A;  2DD4 A;  4J8O A;  2LRQ A;  3S6W A;  5GAN f;  1YJW A;  5GAN j;  5HK0 A;  3TU4 K;  3PT9 A;  3FRN A;  2K5L A;  4M75 F;  4B9X A;  2GF7 A;  2PUO B;  4RKU E;  3VUZ A;  1Y7X A;  4CRI A;  1UGR B;  3CBM A;  3AHU A;  3V8J A;  5D6W A;  5FU7 B;  2LNV A;  3M57 A;  4JS5 A;  4XU0 A;  2O01 E;  2E1H A;  1BI1 A;  2IVW A;  2QQ9 A;  4RG8 A;  1VQM T;  4PJO B;  3M4Y A;  2LCC A;  3OA6 A;  5LJ3 h;  1JJ2 S;  3QHS A;  4QVZ A;  3MP8 A;  3JCM V;  4DOW A;  5FU7 C;  5LJ3 f;  1MHN A;  1IZ6 A;  4XAX B;  3G7Z A;  2M1H A;  3OB9 A;  4XU1 A;  1M1K U;  3CCL A;  1WJR A;  2KMT A;  1WQ7 A;  4X9D A;  3LWH A;  2ZPB B;  5CIU A;  1KQ1 A;  2V8I A;  3QO3 A;  2RA2 A;  1M90 U;  3CCS T;  4M7D F;  3QZ9 B;  4C8Q D;  2OTL A;  3CME A;  3PMI A;  1M9S A;  4C0G A;  2KK4 A;  1QW1 A;  3C4S A;  2X4J A;  4J6Y A;  1G3Y A;  3OW2 S;  3GIB A;  2E6Z A;  2EQK A;  4C0D B;  2DXB A;  4M78 G;  4QVC A;  5CCA A;  2DXT A;  4BE1 A;  1D3B A;  5GAN 6;  2JTF A;  3OYN A;  1I4K 1;  3OBW A;  3OMC A;  4ZGD B;  3KXT A;  4A53 A;  4M7A B;  3CCL T;  4BE0 A;  1M8V A;  2VGN A;  3OYA A;  4BAC A;  2D6F A;  3CMA T;  2VUB A;  4C92 B;  2XKO C;  3QZ5 B;  3CCS A;  5LJ5 f;  2EFI A;  4X9C A;  4DQ2 A;  5LJ5 j;  1VQ4 A;  1UGP B;  3MP6 A;  3ZFJ A;  3OYG A;  3JCM g;  1U8R A;  3CCM A;  3BFM A;  1VQ6 T;  3MCA B;  1WGS A;  4F7U G;  3N5B B;  1X6O A;  2VXF A;  3R6O A;  1YJ9 T;  2ZZD A;  1QVP A;  4M7D E;  2OTJ A;  1RL2 A;  4C8Q E;  1Q86 C;  1XQH A;  2PQW A;  1YJN T;  1Y07 A;  2RHZ A;  3OBY A;  4MZP A;  3RKY A;  3CD6 T;  4L5G A;  3CMA A;  1VQK T;  3QUI A;  3T9N A;  5I2S A;  1QVF S;  3CCU T;  5CVI A;  4C92 D;  3I56 T;  3PIO A;  3OS2 A;  2DZC A;  3E1S A;  3MEU A;  3BDL A;  2XDB A;  5GAN 8;  3Q1J A;  4O5V A;  1Y71 A;  2E41 A;  1WQW A;  5GAO l;  4OP0 A;  3SWN B;  3L42 A;  4C5H A;  5GMK i;  4M7A D;  3H8Z A;  2WSE E;  2E5Q A;  1ZBX A;  3JB9 D;  3JCM h;  3OMG A;  2EKO A;  4OVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...