5IAYA

Nmr structure of uhrf1 tandem tudor domains in a complex with spacer peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
152
structure length
152
Chain Sequence
LYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hemi-methylated DNA opens a closed conformation of UHRF1 to facilitate its histone recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase UHRF1
total genus 13
structure length 152
sequence length 152
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5iayA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5iayA01
3CC7A 2LDMA 2RHUA 4L59A 2CKKA 2K3YA 3Q1JA 1VQOA 3LLRA 3F70A 3OYAA 3CMAA 2GF7A 1VQLA 3H6ZA 3CCLT 2LTOA 3L2WA 1WJRA 1QVFS 5CIUA 1VQ9A 3CC2A 5KE2A 2HQEA 1XNIA 1RL2A 1K8AU 3OQ5A 4A4HA 4A4FA 2M0OA 2LQ8A 2L8DA 3CCVA 3FLGA 1YBYA 3OYIA 1VQ7T 1WGSA 2JOYA 3SD4A 3CCEA 3MP1A 4YTLA 1W2BA 2R5AA 2VYTA 2RJEA 3CC4T 4C5EA 2DIQA 4E7IA 4PL6A 1Q82C 1QVFA 1VQ8A 3CCJA 5J39A 2R57A 2HQXA 3LGFA 3CCST 1KD1C 2RHZA 3LGLA 3OW2S 2K3XA 2RI2A 1YIJT 3OYLA 5D6YA 2MWOA 3NTHA 3S3MA 3CD6A 4TVRA 4N4HA 1WJSA 1H3ZA 3OYEA 3P8HA 3L2QA 3S6WA 3MEVA 5FRNA 1VQNT 3MEWA 1YHQT 3FDRA 1YI2A 2GFUA 2O4XA 1JJ2S 5FROA 1VQ8T 3CCJT 3HKSA 1K9MC 3OYDA 4IUVA 2F5KA 4N4IA 4BD3A 1VQ4T 3OMCA 4E7KA 2MWPA 4IUPA 1BKBA 3META 4IUTA 2M1HA 3DB4A 1VQMA 1KQSA 1Q82U 2XK0A 1N8RC 4QQDA 1EIFA 4IUQA 2OTJA 1QVGA 2BUDA 2B8AA 4B9WA 3H8ZA 2JZ2A 5DLQE 2WACA 3I55T 3CCQA 1OI1A 1NJIU 5A2QE 2FHDA 2DAQA 2DIGA 2RJCA 1KC8U 4Z02A 2GFAA 4Q5WA 4ZTJA 1QVGS 1YJ9A 3LH0A 4BDYA 4X34A 3G4SA 5C6SA 2X4YA 4QQ6A 4BDZA 3QBYA 4PLLA 2D9TA 1Q81C 3A5ZB 3CXCS 3PNWC 2EQJA 5D6WA 3CCMT 1M1GA 1KC8C 1KQSS 2R58A 1VQ9T 3S3NA 3G6ET 5IN1A 2QA4T 5M9OA 1M1KU 5KCOA 2YRVA 5IT9E 1VQMT 4IKFA 2IG0A 3PIPA 3OYMA 5KCHA 3MEAA 3KUFA 3P8DA 3P8BB 1N27A 3OYKA 1YJNA 4UC4A 4ZN1A 1Q86U 3CC7T 3OA6A 3UWNA 1MHNA 2KDSA 3OYGA 4QW2A 1VQ5A 2EQKA 3CMET 1KD1U 3L2VA 4ZTFA 4IUUA 3G6EA 2L3RA 3OS1A 2QA4A 2LCLA 3PIOA 1Q81U 3O8VA 1VQKT 2EQMA 2E5QA 1YHQA 3UT1A 1YI2T 2MI6A 2RHXA 1VQ7A 3OS2A 2RI3A 1X6OA 4E7HA 3CC4A 1NPRA 2QEXT 1M1KC 1YITA 4A4EA 3C4SA 3MP6A 1UEBA 2RHIA 3NTIA 4QQGA 3CPWS 2EFIA 3CCSA 2BIVA 1K8AC 3CXCA 1OZ3A 3CPWA 5D6XA 3CD6T 3I56A 2O4XB 2X35A 2OTLA 2QQRA 3DLMA 4OVAA 1VQ6T 3EAEA 1KHIA 2G3RA 2OTJT 3CPFA 1RI0A 3ER0A 3CMAT 4B9XA 1OZ2A 1NPPA 1NJIC 3OYFA 3NTKA 1YJWT 3J80E 3CCLA 5J26A 2LRQA 3CC2T 2JTFA 1WJQA 3I56T 3QIIA 3TREA 3OW2A 5IAYA 1Q7YU 1S72T 3QJ6A 3OMGA 3PMIA 3OYJA 2X4XA 4C5HA 1K73C 3CCRA 3CCUA 3OYYA 1KHCA 2EKOA 3I55A 1G5VA 4FU6A 4BE2A 4ZN3A 1N8RU 3MEUA 2P0KA 2JVVA 1XTDA 2E70A 1YJ9T 1M90U 3MO8A 3E9FA 1K9MU 1VQ6A 4QVZA 3L2RA 3KBGA 1YJNT 4IURA 3L2UA 3ME9A 3FEOA 3CCUT 4FL6A 2RJFA 2LVMA 1VQ5T 5KE3A 3J7AF 1JJ2A 2RHYA 2XHCA 5HY6A 2RI5A 2L89A 3E9GA 3PMTA 2RO0A 3MP8A 2NLUA 3OYCA 2BKDN 3DB3A 3OS0A 2PQWA 4BE1A 1VQPT 1SSFA 4PLIA 5C0MA 3ZEHA 4II1A 1VQNA 3OYHA 4E7JA 1VQOT 1S72A 3GOXA 1Q7YC 3JAME 3CCRT 1K73U 1VQLT 3CCQT 1Q86C 2XDPA 1VQ4A 5J3BA 3CMEA 3LX7A 3S3OA 1M90C 3M9QA 2KVQG 3G71T 4C5GA 4NS5A 3OYNA 4GY5A 4E7LA 2OTLT 2E6NA 3FC3A 2X4WA 4C5IA 3J81E 1VQKA 2EIFA 2R5MA 3CCVT 3OYBA 3CEYA 1VQPA 4RG2A 2EQUA 4N4GA 2JUFA 5FLXE 3QKJA 4BE0A 4LD6A 3DLLA 3BDLA 3CCMA 2JNGA 1OYXA 1YJWA 1W2BS 2QEXA 3LYIA 1IZ6A 1YITT 4CRIA 2E6ZA 1YIJA 3G71A 4A4GA 5DM7R 3L42A 4HCZA 5FRMA 3OY9A 2RJDA 3ASKA 4EDUA 2M16A 4BACA 3G4ST 5KH6A 2LCCA 3OB9A 2DO3A 1NZ9A 3CCET 5LL6S 2QQSA 3PFSA
chains in the Genus database with same CATH superfamily
1P92A 2RHUA 4L59A 2CKKA 3Q1JA 3OYAA 3CMAA 2IVWA 3JCMc 4RMOA 3A8OB 2E41A 3I56Q 2GF7A 1UUEA 1VQLA 3HFNA 3H6ZA 1R77A 2L2PA 1SSHA 1M8MA 5GMKh 1WJRA 1QVFS 1OU9A 2VASA 5KE2A 2LNHB 1XNIA 1RL2A 2GQVA 4A53A 4RKUE 3EFOB 4N0AC 4A4HA 4A4FA 3M0SA 3O5ZA 2LJ0A 3CCVA 1IHWA 2E5KA 2AK5A 4OGCA 3SD4A 2V26A 2HBWA 1W2BA 4M7DC 1QQJA 4MZPA 4Y92A 1M4ZA 4PL6A 4OB3B 2A37A 5I22A 1H641 1PG5B 4ORZA 4FCYA 2LX9A 3LGFA 3CCQQ 2EYZA 2MYSA 1YJ9Q 1KD1C 3LGLA 4CC3A 5LJ5h 4K11A 2DBKA 3CD6A 2DVJA 4GBQA 1H3ZA 3UF4A 3R6NA 3OS5A 3MEVA 1X75C 2A36A 3MEWA 1YHQT 2MIOA 4QT7A 1YI2A 2EKHA 3VRZA 3HKSA 4ANJA 1BI3A 2ZGWA 4BD3A 1BI2A 1VQ4T 4EMHA 4WF2A 3SDZA 3TSZA 2EJFA 1JXOA 2GQIA 5EG2A 4N0AA 1KQSA 3GNFB 4XTWA 1EIFA 4F17A 4KT0E 4IUQA 2EVRA 1HXDA 2DE0X 1VQPQ 4B9WA 2FB7A 1M90R 2FO0A 1UHFA 2X4JA 4C8QF 2K57A 3FJPA 4AG2C 2CP3A 3M5AA 4XQ3A 5IXBA 5GAN5 1UFFA 4M78G 1AT1B 3N5BB 2K3BA 2DA9A 1VQLQ 1S1NA 4RTUA 4JLIA 2H3JA 2DIGA 3RKWA 3TCJA 4JPBW 3QYHB 5FU7C 1YJWQ 1W4SA 2GFAA 4Q5WA 4XTZA 5CKBA 3HP9A 1YJ9A 3H0HA 4OP0A 2K5LA 4FIBA 2O88A 4BDYA 1W70A 4X34A 3G4SA 1K4US 4QQ6A 2EAYA 2K5FA 1G3YA 1I81A 3QBYA 4F7UF 5GAN7 3CXCS 1C1AA 2QQ9A 4OF1A 3MCAB 4Y91A 1BK2A 2YWWA 1KC8C 4O5VA 3M4GA 4LN2A 2R58A 3JV3A 3NFCA 3HRTA 4BY6C 2XKOC 5GANf 1TU0B 5IHNA 3G6ET 1Y71A 2QA4T 5M9OA 3WVEB 1M1KU 3JSCA 4IKFA 2QG9B 2MOXA 3OYMA 2JS2A 1X27A 1M3CA 3P8DA 5D7UA 8AT1B 2E64A 1YJNA 1Q86U 3JCMV 2KDSA 4AFSC 4B6MA 3CMET 1PNJA 4ELYC 2ZCFB 4BI4A 3HPWA 2DILA 2L3RA 2QA4A 4ATOA 2KBTA 3REBB 3O8VA 3VS4A 1VQKT 4M7AA 2BZXA 1NZ9A 2E5QA 1YHQA 4M78A 2C0TA 3UT1A 2RHXA 3M55A 3VS2A 2FL7A 2RI3A 1M30A 4E7HA 2ED1A 3FRNA 1VQMQ 5GAN4 2ABLA 3HL8A 2RA2A 4JRIA 1UG1A 1YN8A 4XK8E 1NEBA 1ACMB 1UTIA 3CPWS 2BIVA 5GAMg 3CCSA 9ATCB 2F2VA 3A98A 4JRQA 2CZ6B 2D1XA 2KT8A 1G3TA 3CCJQ 3CD6T 3DLMA 1OOTA 1NG2A 3EAEA 2V8KA 1QCNA 1I5OB 5GAN3 2OTJT 2EJ9A 5CQXA 1C0MA 4XTYA 1MMGA 1IHVA 3ER0A 1LCKA 5KYXA 3CMAT 3SEMA 5HK3A 2M9UA 4B9XA 1OZ2A 2QYZA 1D3BA 4ZGDB 2VWFA 2FPEA 1WHLA 3A8HB 3CCEQ 5J26A 3G6EQ 1JEGA 2LRQA 2JT4A 2OTLQ 4M7AB 4C0ZA 3I56T 1EFNA 5CCAA 4MMKA 1ZLMA 4JLGA 3BFMA 1D1AA 2CH4A 1UGPB 2HNIA 4C8QC 4RTZA 5IAYA 3QJ6A 1WYXA 4C5HA 2DL3A 2SEMA 3CXCP 2QGFB 3OYYA 1KHCA 1M3AA 3AHUA 3GNGA 4FSSA 3BY7A 1K73R 3CCVQ 1U06A 2DM1A 5AYFA 1N8RU 3V8KA 1VQKQ 2P0KA 2M02A 1E7OA 5LJ3h 1K9AA 5HK0A 1XTDA 3CC7Q 3M53A 1YJ9T 3E9FA 1WZOA 3L2RA 2D0QB 2EGAA 3KBGA 1YJNT 4JJCA 3ME9A 4DOVA 4PJOC 1VQ9Q 2M51A 4M77C 2RJFA 1JO8A 2DTHA 1JJ2A 3GBQA 5HY6A 1SPKA 3E9GA 3QDRB 2NLUA 2CYZB 1N9RA 1GXIE 1QMCA 2PUKB 2EYWA 1QWEA 4PLIA 1BBZA 3OYHA 3CMAQ 1QVFP 1E6HA 1VQOT 2K2VA 4J9CA 1Q7YC 2B86A 4DBQA 2IPOB 1AWOA 1HJDA 2NUZA 4M75G 5LJ5j 1FXXA 2XDPA 3JB9F 3LX7A 3X26B 3QWXX 1BI0A 2FPFA 3G71T 4E2FB 4C5GA 4C92G 2HAXA 1TXQA 3SFMA 2BTTA 4LDVA 3OYNA 1I1JA 1K9MR 4M7DE 2VGNA 4F7UE 4F7UB 4J6YA 3H9NA 3PGGA 4N4GA 2JUFA 3QKJA 4XTVA 1WQ7A 3MJXA 1UGSB 5CKFA 3CCSQ 1NYGA 3JB9I 2WSEE 1IGUA 4J5YA 4E47A 2L3SA 2KRNA 5KYUB 3SB2A 2E6ZA 4CC4B 2DXCA 1WX6A 3G71A 1R0BG 1V1CA 2LX7A 2KSSA 4A4GA 5DM7R 3L42A 3PT9A 4C0GA 4JDSA 3RBBB 4ME7A 1WHGA 1QKWA 2GNCA 2CT4A 2M16A 2L0AA 3G4ST 2YLCA 5KH6A 2DF6A 2KK4A 1U1SA 1U1TA 3OB9A 3QHSA 2QA4Q 3GPLA 2LDMA 1UJYA 2K2MA 2VVKA 4RTVA 6AT1B 2KNBB 4FM4B 5A0DA 2HQHA 2P4RA 4WTOB 2AHJB 3VS3A 1K0XA 2CZ0B 3NHNA 2K6DA 3CCLT 3JCMd 5CIUA 4PJOA 1H3HA 4J9BA 3CC2A 1OULA 4RG8A 3CMEQ 2DYIA 2E3HA 2L8DA 4E6RA 3OYIA 1VQ7T 2DX1A 2R5AA 3CC4T 4HCBA 1CKBA 2XDDA 2OI3A 3MPUB 4E7IA 2K79A 4M75B 1VQ8A 3CCJA 4M77B 2O01E 5LJ3e 4KRTA 2LJ3A 3CCMQ 4M7DD 1YP5A 4QVCA 2RHZA 3G71Q 3OW2S 3JCMb 2RI2A 2Y4XA 2DD5A 1FYNA 2MWOA 2MF2A 1Q86R 4A4KA 5IHKA 3GLXA 2YHTA 2KQWA 4JZ3A 2I0NA 1I07A 1BB9A 4C8QG 1ZHIA 3S6WA 2NUPB 1V29B 5KYNA 1VQNT 1X6BA 3JCMh 5ECAA 4LDXA 2GGRA 1JJ2S 1YCYA 4KULA 5FROA 3TVTA 3CCJT 1FMKA 4L5GA 2E3IA 1RAGB 4IUVA 3I35A 3VS6A 2EGCA 2FG0A 1KQSP 2DRKA 3GIBA 3LWHA 4E7KA 2MWPA 1Y0MA 2YXYA 4RCBA 1G83A 4ESRA 4M7DB 4M7AC 1AD5A 2XK0A 3VRYA 5LJ5d 3EG9A 1XOVA 4ZGEB 1EZZB 1AWWA 1VA7A 2OTJA 3KFVA 2J7IA 2BUDA 4P5NA 2B8AA 2JZ2A 4OGEA 2V8IA 5DLQE 3I55T 1WHMA 3CCQA 2BE7D 1OI1A 4Z88A 1SKUB 4MDXA 2FHDA 2OJ2A 2RJCA 1UE9A 1UDLA 1KC8U 4BB7A 2E1HA 2PTKA 4ZTJA 1QVGS 2XU8A 2HDAA 1O75A 2K7AA 3GF5A 2HL3A 5C6SA 2DZ9A 4KUIA 4PFZA 3KXTA 1KQ1A 4PFOA 2P0PA 4PLLA 2D9TA 4MMLA 4OMOA 1Q81C 2FYKA 2M0YA 2QASA 5D6WA 1JU5C 3CCMT 2X3WD 4JJBA 2VUBA 2YDLA 1WNLA 1IXDA 1LNXA 5KYWB 1KQSS 1VQ9T 1NEGA 2YT6A 3S3NA 1TUCA 3FJ5A 1OPLA 5KCOA 2YRVA 4C8QB 1BI1A 4OMPA 1VQMT 3PIPA 1WHJA 5KCHA 3WVDB 2RF0A 1IGQA 2KT1A 2ROLA 1QKXA 3P8BB 2JMCA 3JCMX 1LOJA 3NGPA 4QW2A 1VOMA 3M54A 1KD1U 3X25B 1IB8A 2DL5A 2Z0WA 2E65A 3OS1A 4OB0B 1MGQA 1M1KR 3QXEB 1QVPA 3RKYA 2VGMA 1SG5A 2RQWA 2DL7A 2ZPBB 1LJOA 2MI6A 1UGQB 2LQNA 1X43A 3I5RA 1Q95G 1NPRA 4HA8A 4J6WA 2QEXT 2DRMA 4C92D 1QVGP 1M1KC 1YITA 4A4EA 2QDYB 1SHFA 3NTIA 2DJZA 4QQGA 3VS7A 1D0ZA 1G3WA 3OW2P 4NOYA 1K8AC 4M75D 2I2LA 1GCQC 1OZ3A 5FU7B 3I56A 2OTLA 5L23A 1X01A 4AT1B 4PJOE 3MKDA 5LJ5g 3JRZA 1KHIA 4OMQA 1K8AR 2ROTA 1KIKA 3PVLA 3CPFA 2PU9B 4WCIA 2HMAA 4R0KA 3OYFA 2CP2A 1YJWT 3G4SQ 1HK9A 5HCKA 1D0XA 3J80E 1T0JA 3CCLA 5I2SA 4RTTA 2FRWA 2COZA 3OSVA 2COWA 2J6KA 2LZ6B 1NBEB 1WJQA 5GAOr 1QP3A 5GANe 3H0IA 1YWOA 3UA7A 2C0IA 2DKGA 2KYMA 2D0NA 4IIMA 2KYBA 4M77F 2CS7A 3PMIA 3OMGA 4M4ZA 2KROA 1BIAA 2EKOA 4RTWA 2QI2A 1M2VB 1WA7A 4DOWA 1MV0B 2V1QA 3AT1B 1HSQA 4DQ2A 3PTAA 4M75E 4XU3A 3QG1A 3MEUA 2A08A 2FPDA 3UPUA 3EG9B 3V7RA 4JJNK 4QKUA 1MV3A 4OMLA 2A7YA 2X3XD 1NE8A 4LD9K 4C92E 4JZ4A 4PJOD 1M90U 3X24B 2KGTA 3EGXB 2HSPA 1I5LA 3EH2A 4PJJA 3E1SA 3L2UA 1KQ2A 3FEOA 3LW5E 1WQWA 1RUWA 5I2MA 2QEXQ 2MK5A 2LVMA 5KE3A 1N6AA 1PWTA 2QQBA 3RDVA 3JB9J 2A28A 2RHYA 1O9SA 2V1RA 2YUOA 1KD1R 2H8HA 2RO0A 3C12A 3L1AA 2AZSA 3H0FA 2C0OA 1MNDA 4NL3A 3OYCA 4JS5A 3DB3A 5GAOl 5KYXB 5DY9A 4BE1A 2NYSA 2VKNA 2QTXA 3EFRA 2DEQA 3U23A 1X2KA 1VQPT 1SSFA 5CO7A 3HSBA 3TEEA 3ZEHA 1SRMA 4E7JA 4RCCA 2DXBA 1S72A 3GOXA 3VS0A 1IREB 1QCOA 1ZA2B 2YSQA 5GJWB 2RK2A 1RLQC 1VQLT 4NL2A 4RTXA 4M77A 2HZYA 1ZX6A 1T3LA 5J3BA 3S3OA 4D6WA 4DA4A 4R56A 3M9QA 2LC4A 2DK3A 1GFCA 5KYYA 3HTRA 2HKNA 3V8JA 4NS5A 4C92A 4E7LA 2E6NA 2OTLT 2X4WA 3J81E 1D0YA 1VQKA 4PJMA 3OYBA 3CCVT 1E6GA 4RG2A 2X51A 2RQUA 2RQTA 3OBYA 4ZGJB 2QGGA 1U3OA 5FLXE 5FU6C 1WXUA 4M77D 4O6JA 1UB4A 1ZBXA 4LD6A 3DLLA 3OSSC 2DPPB 2QEXA 3UDCA 3WXMB 1VYVA 4J7FA 1PD1A 4PK4A 1X6GA 1F1BB 4FYVB 4HVWA 1B3QA 1AEYA 2XIDA 3CBPA 1WXTA 4XU0A 1MMAA 3ASKA 1SF9A 1R0CB 1TS9A 2P0QA 1WPYA 1AWJA 1V76A 3QPHA 3QWYA 1FWZA 2AKLA 1JB0E 2XG8D 2DO3A 1ZUYA 5GAMd 5LL6S 2QQSA 3CC7A 2CSIA 2K3YA 3LLRA 3F70A 3VKIA 3THKA 5GMKi 1RAAB 1RAIB 4EMKC 4GLKA 2LTOA 1KSWA 3HFOA 3RESA 1VQ9A 4F7UG 3A8GB 3RMQA 2P4TA 1B07A 4MZTA 4M78D 3OQ5A 2KEAA 3FLGA 4KH0B 1YBYA 2LCSA 2JOYA 4YTLA 1G3SA 2RJEA 3QZ9B 4C5EA 5DLOA 1TSFA 1QW1A 2G6FX 1Q82C 1QVFA 5GAOm 5J39A 2HQXA 2ZPFB 3NMZC 4J8OA 4M7AG 1AHJB 4HT9A 2ZPIB 1QCFA 4M78F 4A54A 5CKEA 4J9HA 1X2QA 3CCST 2K3XA 3I9QA 1QP2A 4RTYA 2DNUA 1YIJT 3OYLA 3UA6A 1JJ2P 1Q7YR 3CD6Q 3SWNC 2PUOB 3NTHA 3S3MA 4TVRA 4N4HA 1WJSA 2NUPA 3M56A 1VQ5Q 1TTHB 3I55Q 1XJWB 5FRNA 4FT4A 8ATCB 1JXMA 1BU1A 3FDRA 3VJPA 1MMDA 2GFUA 4PJOF 3VS5A 2QTVA 5CVIA 2LJ1A 1VQ8T 4BY6B 1K9MC 2ZPEB 3OYDA 4N4IA 2F5KA 4BI8B 4HKEA 4DEXA 1VIEA 3OMCA 2W10A 2FZCB 2DFUA 2ED0A 2OAWA 3LH5A 1BKBA 4F14A 4OMMA 2M1HA 2EW3A 1K76A 2VXEA 3URGA 1VQMA 4JUVA 2CP7A 1Y57A 1N8RC 4QQDA 4J9IA 1AVZC 2YUNA 4X9DA 2LP5A 4ZNXA 2DEUA 4V2SA 5KYWA 5IXFA 1M27C 2J05A 4LE9A 1PCXA 2O2OA 2WACA 4D8KA 2W0ZA 1RLPC 5FW9A 1NJIU 2LT4A 3RKXA 2KE9A 1PC0A 2YLBA 5CKDA 1LPLA 3CBOA 4Z02A 4ELZC 1WLPB 4M78C 1J3TA 1YJNQ 4J9GA 3EG0A 3LWIA 2X4YA 2J6FA 4A63B 3M0QA 3EFOA 1N9SA 3CC4Q 3CCLQ 3A5ZB 2EQJA 5I11A 1G2BA 1A0NB 2FZKB 1ZSZC 1M1GA 2A0FB 1ZQ1A 5GJVB 3M58A 4F16A 2QK0A 4C92F 1M2OA 2QDLA 4J9DA 5IT9E 2IG0A 3JB9G 1UGVA 2QXFA 4HCCA 4M7AE 1D1CA 4M75F 3KUFA 4R55A 3OYKA 1WHHA 4MZMA 4UC4A 4ZN1A 1T3SA 1IO6A 3UWNA 1TH7A 3A1PA 5LJ3j 2RQVA 3L2VA 2COYA 4ZTFA 3CQTA 3JCMf 5A0GA 3G6EA 1UGRB 4HXJA 3PIOA 1TWBA 3EGDB 2JN0A 1RAEB 1GFDA 1QWFA 2EQMA 4X1VA 1YI2T 4PFPA 3C95A 1VQ7A 1BIBA 3CC4A 2HEQA 1W1FA 1ZSGA 4EPCA 1Q82R 4M75C 3C4SA 4L6V5 1YFNA 3MP6A 1UEBA 1I4K1 3NPFA 2ZPHB 4J9FA 2ATCB 1X69A 2YUQA 4KGVB 2OAUA 2EFIA 1WXBA 3C94A 4C92C 2H3EB 1WDXA 2FZGB 2CZ7B 2NUTB 3CPWA 2LQKA 2O4XB 2QQRA 4OVAA 1VQ6T 1B34B 1PM3A 3QYGB 2L3PA 3RUXA 3EHRA 4CI0C 1SRLA 1H8KA 4RUGA 2VC8A 3CCRQ 1YHQQ 2X9HA 5GAN6 1MMNA 1JBMA 1NPPA 4J83A 2ESWA 1NJIC 3NTKA 2BE9B 3V7SA 2V8JA 3V7CA 2GTJA 2KI7A 2MCNA 2EWNA 3PVQA 2O9SA 2RN8A 2F2XA 2MAMA 4OB2B 3MHXA 3M0PA 4J7IA 1PD0A 4FYXB 4AMCA 1TUGB 2BZYA 2F2WA 4EMKA 3ULRB 4XU2A 2QAZA 1C6VX 3OW2A 1YWPA 5FWCA 1S72T 2X4XA 5GAN2 2YUPA 1K73C 3CCUA 3V8LA 1PKSA 5LJ5e 3I55A 1G5VA 1M5Q1 2E4HA 4FU6A 5CR2A 4BE2A 2JW4A 4F7UA 1Y7XA 4M77G 3JB9H 2JVVA 1GBRA 2E70A 4EIKA 3MO8A 4KBMB 1K9MU 2KY9A 1VQ6A 4BUGA 2DD4A 4IURA 3ZL7C 4LUDA 2F1LA 1RABB 1NJIR 1JQQA 3VV0A 1VQ5T 2MMPA 2XMFA 3VYHB 2HL5C 1Z9ZA 1KC8R 2AIRB 4E7ZA 5EC7A 2LQWA 2RI5A 2PVGB 2L89A 2HCKA 3PMTA 3EG1A 4C0FA 4DBHA 2VXFA 2E10A 1WFWA 1T0HA 1OV3A 4PJNA 3OS0A 4F04B 1K0SA 1BCMA 1WHKA 3VUZA 5GAMf 1TOVA 5LJ3d 1VIFA 2FRYA 1RI9A 2JS0A 4II1A 2XI9A 1VQNA 1M2VA 1MNEA 2RD1A 3QSUA 4M7DF 4HT8A 1M8VA 1UHCA 1K73U 2GTOA 3CCQT 3OBWA 1VQ4A 1M90C 5GANj 1ZUUA 3JCMe 4FSXA 2DMOA 5IH2A 4GY5A 1KJWA 2HD0A 1B7TA 4C5IA 2JM8A 2EIFA 1R8OB 1VQPA 3TU4K 1VUBA 2EQUA 2JTEA 3EGUA 3REAB 4BE0A 2Y4YA 1N5ZA 2JNGA 2XDBA 2EGEA 1W2BS 1OQKA 3LYIA 5GMKj 4CRIA 2DETA 1XQHA 5KYYB 2LMJA 7AT1B 1KFZA 2FVUA 1FX7A 1GCPA 1H92A 4LDWA 3BE3A 4CC7A 4D8DA 4M7DA 2WSFE 1JRIA 4BACA 3SHWA 2LCCA 4J9EA 2DTIA 2O9VA 3PFSA 4PKCC 4CC2A 1VQOA 2HBPA 1D3BB 1RAHB 2RMOA 2KRMA 1Y07A 3GP8A 3BDUA 3L2WA 2F5TX 4DBRA 5GANh 1MUZA 5GAOq 2HQEA 1HYOA 2E12A 1YITQ 1K8AU 4PNOA 2M0OA 2LQ8A 4EMKB 2YRDA 1WGSA 5GAMj 2D8HA 1M1FA 3MP1A 3QZ5B 2PNIA 3CCEA 2VYTA 3JCMP 2DIQA 2DBMA 3G7ZA 2BZ8A 2R57A 4HCKA 2LT1A 5GAMh 3M0RA 1WIEA 2PVOB 1KG1A 1AOJA 1W2BP 4KUDK 3TQ7P 1OPKA 2P84A 4M78E 5D6YA 2L3QA 3OYEA 3P8HA 2YRCA 2DXUA 3L2QA 2WSCE 2C06A 3FB9A 2SRCA 4M7AD 4C0DB 1B34A 1IRXA 4LDYA 4QVDA 4LDUA 2RM4A 2O4XA 1G8XA 2PVDB 3SWNB 2NUTA 1PSFA 4JS4A 4PJLA 1OX9A 2DL8A 1FMVA 1CSKA 1VQ6Q 1NYFA 3CPWP 4IUPA 2DVEA 4M7AF 2HKQB 4XAXB 3META 4IUTA 1Y96A 2D6FA 3DB4A 1Q82U 2JXBA 3HRUA 1PRLC 3IQLA 2F69A 2EYQA 4Z89A 1D09B 4OMNA 3DKMA 4C92B 2RK1A 1QVGA 3EGDA 1ZSZA 1ZUKA 3H8ZA 4FT2A 4XTUA 4XU1A 1FMWA 5A2QE 3JCMW 1U8RA 3QDFA 1K1ZA 1NLPC 1ZA1B 2DAQA 4KGXB 2JJ9A 2LNVA 3TSWA 1CKAA 2DLPA 4AG1C 2OX7A 3JCMQ 3LH0A 2K5IA 5FWBA 1YIJQ 2OTJQ 1RAFB 2DYBA 4BDZA 4XTXA 3VUBA 2DZCA 5GMKl 3M59A 4HVVA 3PNWC 2CZ1B 3RR6A 4JRPA 3EH1A 2J06A 5GANg 3EGXA 5LJ3g 4MDWA 5IN1A 1I0CA 2EJGA 5I21A 3FIFA 5A0LA 2JTMA 3RIRA 1OEBA 2CSQA 3QUIA 2EBPA 2KR3A 4FYWB 3MEAA 2AT1B 3CBMA 2K9GA 1BCOA 1AZGB 4FYYB 1N27A 5LJ5f 2GCXA 4M78B 5GAMe 3CC7T 3OA6A 3INZA 2NWMA 1MHNA 4C8QA 3EHQA 3OYGA 1VQ5A 2EQKA 2K4YA 3E19A 2EQIA 4IUUA 4LXCA 2KAFA 2LCLA 2CUDA 1Q81U 1ZBJA 2EYXA 2HSEB 3QJYA 1VQ8Q 4PJOB 3ZFJA 1PRMC 3D7SB 1HD3A 3JCMJ 3OS2A 2RQRA 1LVKA 1X6OA 3VU3C 1KK7A 3M4YA 1VQ7Q 3RERA 4HVUA 3RNJA 3CCUQ 2O31A 4FW2A 2RHIA 3QO3A 1VQOQ 1GCQA 1YCSB 5GAOp 2L5QA 1WI7A 1S72Q 3CXCA 4BI3A 5D6XA 2X35A 5L8RE 1TUDA 1SEMA 4M77E 1DJ7B 2CDTA 2EPDA 2CP5A 2G3RA 2XICA 1RI0A 1Z9QA 4M7DG 3C0CA 3T9NA 2ZAEA 4AFQC 3EG3A 3H41A 4DEYA 3VYGA 2ENMA 1YNZA 2DL4A 3VS1A 1M9SA 4JRKA 1GRIA 3CC2T 2JTFA 5CQYA 1ABQA 3RMSA 1I8FA 3EG2A 2GBQA 3QIIA 4C0DC 2IIMA 1OU8A 5CKHA 5GAOn 5CK9A 1GL5A 2CREA 3TREA 2AKKA 5GMKe 1Q7YU 2CP6A 3OYJA 4Y28E 2KXDA 2JMAA 3CCRA 3M0TA 2RH2A 1M3BA 2AZVA 2VB6A 4J6XA 5AT1B 4FW1A 2XD0A 4C8QD 1ARKA 1ZSZB 3X20B 2DJQA 4EMGA 4DBFA 2A3LA 2DTOA 2RNAA 4ZN3A 1EX4A 3G1JA 3HRSA 1UECA 3HHTB 2DERA 1U5SA 1PHTA 4PJOG 4M75A 4AFUC 2VV5A 1VYUA 1Y96B 3M57A 5IHIA 4Z8AA 1PSEA 4QVZA 1D1BA 5GAN8 1NM7A 4OMFB 3R6OA 2CUBA 3CCUT 2CT3A 4FL6A 3E2UA 3JCMg 3J7AF 2QQAA 2XHCA 2Y90A 5LJ3f 5GANd 2RPNA 3MP8A 3SWNA 2BKDN 4VUBA 1YI2Q 2RB6A 1OX8A 2DXTA 1RACB 1ABOA 2PQWA 1UJ0A 4KH1B 4E7SA 2KMTA 1SHGA 2ECZA 2FEIA 5C0MA 4JJDA 2MPXC 1AZEA 4LUEA 3JAME 4C8QE 3CCRT 3UATA 1BYMA 1Q86C 5HKCA 3CMEA 2ZPGB 2KVQG 3CC2Q 4KGZB 2ZZDA 5KYUA 2JM9A 5FU6B 2J6OA 1TG0A 3FC3A 1GBQA 2R5MA 4IIOA 3A8MB 1AWXA 3CEYA 2EYYA 1VQNQ 1VYTA 3EFSA 1RADB 3ZBDA 2PZ1A 2CP0A 3A8LB 1QLYA 3BDLA 2CGHA 1W6XA 1PKTA 3CCMA 5GMKm 1OYXA 1YJWA 4X9CA 1IZ6A 1YITT 3X28B 1Q81R 1VQ4Q 1YIJA 2CH4W 4LNPA 2D8JA 3PE0A 4AFZC 5CAIA 3M0UA 4HCZA 3L2ZA 5FRMA 1NLOC 3OY9A 2RJDA 4GLMA 3BW1A 4EDUA 2KXCA 3I5SA 4OB1B 3JB9D 1N8RR 2KRSA 3CCET
chains in the Genus database with same CATH topology
1P92A 3CC7A 2LDMA 2RHUA 4L59A 2CKKA 4PKCC 2K3YA 3Q1JA 1VQOA 3LLRA 3F70A 3OYAA 2HBPA 3CMAA 2IVWA 3VKIA 3JCMc 4RMOA 1D3BB 3A8OB 2E41A 4FM4B 2GF7A 5GMKi 1VQLA 3HFNA 5A0DA 2AHJB 2CZ0B 3H6ZA 1Y07A 4EMKC 3BDUA 2LTOA 3HFOA 4GLKA 1WJRA 5GMKh 3L2WA 3GP8A 2F5TX 3JCMd 1QVFS 5CIUA 4PJOA 3RESA 1VQ9A 4F7UG 3CC2A 5GANh 3A8GB 3RMQA 5KE2A 5GAOq 2HQEA 2P4TA 2E12A 1XNIA 4RG8A 1RL2A 2GQVA 4MZTA 4PNOA 1K8AU 4A53A 4M78D 4RKUE 4N0AC 3OQ5A 4A4HA 4A4FA 2M0OA 2LQ8A 2L8DA 4EMKB 3CCVA 3FLGA 1YBYA 3OYIA 1WGSA 5GAMj 4OGCA 2JOYA 1VQ7T 1M1FA 3MP1A 3QZ5B 3SD4A 3CCEA 4YTLA 1G3SA 1W2BA 2R5AA 2VYTA 2RJEA 3QZ9B 4C5EA 5DLOA 2DIQA 3CC4T 3JCMP 4HCBA 4M7DC 4MZPA 2XDDA 3G7ZA 1M4ZA 4E7IA 4PL6A 4OB3B 1QW1A 4M75B 1Q82C 1QVFA 1VQ8A 5GAOm 3CCJA 4M77B 5J39A 2R57A 1H641 2HQXA 2ZPFB 2O01E 4J8OA 5LJ3e 2LT1A 4M7AG 1AHJB 4HT9A 2ZPIB 5GAMh 4M78F 4A54A 2LX9A 5CKEA 3LGFA 4M7DD 2PVOB 1KG1A 4QVCA 4KUDK 3CCST 1KD1C 2RHZA 2K3XA 3LGLA 3OW2S 3JCMb 1QP2A 2RI2A 2Y4XA 2DD5A 1YIJT 5LJ5h 3OYLA 4M78E 5D6YA 2MWOA 3SWNC 2MF2A 2PUOB 4A4KA 3NTHA 3S3MA 3CD6A 4TVRA 4N4HA 1WJSA 3GLXA 3OYEA 1H3ZA 2YHTA 2KQWA 3P8HA 2DXUA 3L2QA 3M56A 2WSCE 3OS5A 2C06A 3FB9A 4C8QG 1ZHIA 3S6WA 3MEVA 1X75C 4M7AD 4C0DB 1B34A 1V29B 4FT4A 5FRNA 3MEWA 4LDYA 1VQNT 3FDRA 1YHQT 4QVDA 3JCMh 3VJPA 1YI2A 2GFUA 2RM4A 4LDUA 2O4XA 4PJOF 2PVDB 3SWNB 4LDXA 5CVIA 1JJ2S 1YCYA 4KULA 1PSFA 5FROA 1VQ8T 3CCJT 3HKSA 4L5GA 4BY6B 2ZPEB 3OYDA 4JS4A 1K9MC 1BI3A 2ZGWA 2F5KA 4IUVA 4N4IA 4HKEA 1BI2A 4BD3A 4BI8B 1VIEA 1VQ4T 3OMCA 4EMHA 4WF2A 3GIBA 3LWHA 3SDZA 4E7KA 2MWPA 2DVEA 4IUPA 4M7AF 1BKBA 2EJFA 4XAXB 3META 4IUTA 2M1HA 4RCBA 5EG2A 4N0AA 3CCLT 1Y96A 4M7DB 2D6FA 3DB4A 2VXEA 4M7AC 3URGA 1VQMA 4JUVA 1Q82U 1KQSA 2XK0A 1N8RC 4QQDA 3GNFB 4XTWA 1EIFA 3HRUA 5LJ5d 4X9DA 1XOVA 2F69A 4KT0E 4ZGEB 2EYQA 4IUQA 1HXDA 4V2SA 2OTJA 3DKMA 4C92B 2RK1A 2BUDA 1QVGA 4P5NA 2B8AA 4B9WA 2FB7A 3H8ZA 2JZ2A 4OGEA 2X4JA 4C8QF 2V8IA 5DLQE 2K57A 3FJPA 2WACA 3I55T 4FT2A 3M5AA 4XQ3A 4XTUA 5GAN5 3CCQA 1OI1A 4M78G 4XU1A 4MDXA 1NJIU 5A2QE 2LT4A 3N5BB 3RKXA 3JCMW 2YLBA 5CKDA 2FHDA 2DAQA 2H3JA 4JLIA 1U8RA 2DIGA 2LNVA 3RKWA 2RJCA 3TCJA 3QYHB 1KC8U 3CBOA 4BB7A 5FU7C 4Z02A 1W4SA 2E1HA 2GFAA 4Q5WA 4XTZA 5CKBA 4ELZC 4ZTJA 1QVGS 3JCMQ 2XU8A 3HP9A 1YJ9A 1O75A 4OP0A 2K5LA 4FIBA 4M78C 3LH0A 3GF5A 2K5IA 4BDYA 4X34A 3G4SA 3LWIA 5C6SA 2X4YA 4QQ6A 2DZ9A 4KUIA 2EAYA 3KXTA 1KQ1A 2K5FA 2P0PA 1G3YA 1I81A 3QBYA 4PLLA 4XTXA 4BDZA 2D9TA 3VUBA 1N9SA 2DZCA 4MMLA 4F7UF 5GAN7 1Q81C 5GMKl 3M59A 2FYKA 3A5ZB 3PNWC 3CXCS 2QQ9A 2EQJA 4OF1A 3MCAB 5D6WA 2CZ1B 3CCMT 4Y91A 4JRPA 1M1GA 1KC8C 2VUBA 3M4GA 4O5VA 1WNLA 1LNXA 1KQSS 1ZQ1A 5GANg 2R58A 4BY6C 3NFCA 3HRTA 3M58A 2XKOC 5LJ3g 5GANf 1VQ9T 3S3NA 4MDWA 5IN1A 3G6ET 4C92F 1Y71A 2QA4T 5M9OA 3WVEB 2EJGA 5I21A 3FIFA 1M1KU 3JSCA 2JTMA 3RIRA 5A0LA 5KCOA 2YRVA 4C8QB 1BI1A 3QUIA 5IT9E 1VQMT 4IKFA 2IG0A 3PIPA 3OYMA 3JB9G 5KCHA 3WVDB 2QXFA 3MEAA 4HCCA 4M7AE 4M75F 3CBMA 3KUFA 4R55A 3P8DA 3P8BB 1N27A 2E64A 4MZMA 4UC4A 5LJ5f 3JCMX 3OYKA 1YJNA 4ZN1A 1Q86U 1LOJA 2GCXA 4M78B 5GAMe 3CC7T 3OA6A 3UWNA 3JCMV 3INZA 4C8QA 1MHNA 2KDSA 3OYGA 4QW2A 1TH7A 1VQ5A 2EQKA 5LJ3j 3M54A 3CMET 3X25B 3L2VA 1KD1U 4ELYC 2ZCFB 4BI4A 2K4YA 4ZTFA 3E19A 3JCMf 3HPWA 5A0GA 4IUUA 3G6EA 2E65A 2KAFA 2L3RA 3OS1A 2QA4A 4ATOA 1UGRB 2LCLA 4OB0B 3PIOA 1MGQA 1Q81U 3O8VA 2JN0A 3QJYA 1VQKT 4M7AA 3QXEB 1QVPA 3RKYA 4PJOB 2VGMA 3ZFJA 2EQMA 2E5QA 1YHQA 4M78A 3UT1A 2ZPBB 1YI2T 2RHXA 2MI6A 1LJOA 3M55A 3JCMJ 3C95A 1VQ7A 3OS2A 1UGQB 2FL7A 1BIBA 2RI3A 1X6OA 3VU3C 3M4YA 4E7HA 3CC4A 3RERA 1NPRA 3FRNA 4HA8A 4EPCA 4J6WA 5GAN4 2QEXT 3HL8A 4M75C 4C92D 1M1KC 2RA2A 1YITA 4JRIA 4A4EA 2QDYB 3C4SA 1M90C 4L6V5 3MP6A 1UEBA 1I4K1 2RHIA 2ZPHB 3NTIA 4XK8E 2DJZA 4QQGA 3QO3A 3CPWS 1G3WA 2OAUA 2EFIA 2BIVA 5GAMg 5GAOp 3CCSA 4NOYA 1K8AC 3C94A 4M75D 4C92C 2L5QA 2I2LA 4JRQA 2CZ7B 2CZ6B 3CXCA 4BI3A 1OZ3A 3CPWA 1G3TA 2LQKA 5D6XA 5FU7B 3CD6T 3I56A 2O4XB 2X35A 5L8RE 2OTLA 2QQRA 3DLMA 4OVAA 1X01A 1VQ6T 1B34B 4PJOE 3QYGB 4M77E 3EAEA 5LJ5g 3JRZA 2V8KA 1DJ7B 3RUXA 1KHIA 2G3RA 5GAN3 2OTJT 4CI0C 2EJ9A 2XICA 5CQXA 3CPFA 4XTYA 2PU9B 1RI0A 2VC8A 3ER0A 3CMAT 4M7DG 5GAN6 3T9NA 5HK3A 2M9UA 4B9XA 1JBMA 1OZ2A 1NPPA 4J83A 3VYGA 1NJIC 3OYFA 3NTKA 1D3BA 4ZGDB 1YJWT 3V7SA 1HK9A 2V8JA 3V7CA 3J80E 3A8HB 2EWNA 3CCLA 5I2SA 5J26A 1M9SA 4JRKA 3OSVA 2LRQA 2MAMA 3CC2T 2JTFA 5CQYA 1WJQA 4OB2B 3RMSA 3MHXA 5GAOr 1I8FA 1QP3A 4M7AB 4C0ZA 3I56T 5GANe 5CCAA 3QIIA 4MMKA 4J7IA 4C0DC 5CKHA 3GPLA 5GAOn 2DKGA 3BFMA 4JLGA 5CK9A 1UGPB 4EMKA 2HNIA 4XU2A 3TREA 4C8QC 4M77F 5GMKe 3OW2A 2CS7A 5IAYA 1Q7YU 3PMIA 3OMGA 3QJ6A 3OYJA 1S72T 2X4XA 4Y28E 5GAN2 4C5HA 1K73C 3CCRA 3CCUA 2RH2A 3V8LA 4J6XA 1BIAA 2XD0A 3OYYA 1KHCA 2EKOA 4C8QD 2QI2A 5LJ5e 3AHUA 3GNGA 4DOWA 3I55A 1G5VA 3X20B 4EMGA 1M5Q1 3BY7A 4FU6A 4DQ2A 5CR2A 3PTAA 4M75E 4XU3A 4BE2A 2A3LA 2DTOA 3QG1A 4ZN3A 5AYFA 1N8RU 3HRSA 3MEUA 3HHTB 3V8KA 3UPUA 4JJNK 3V7RA 2P0KA 4F7UA 1Y7XA 4PJOG 2A7YA 4M77G 5LJ3h 3JB9H 2JVVA 4M75A 1NE8A 5HK0A 1XTDA 2VV5A 4C92E 2E70A 3M53A 4LD9K 4PJOD 1YJ9T 1M90U 3MO8A 1Y96B 3E9FA 3M57A 4KBMB 3X24B 1K9MU 2KY9A 1PSEA 4QVZA 1I5LA 1VQ6A 4BUGA 3L2RA 2D0QB 2DD4A 3KBGA 1YJNT 4IURA 3E1SA 5GAN8 3L2UA 1KQ2A 3ME9A 3FEOA 3LW5E 4DOVA 1WQWA 4OMFB 3R6OA 5I2MA 3VV0A 3CCUT 4PJOC 4FL6A 4M77C 2RJFA 2LVMA 5KE3A 1VQ5T 1N6AA 3JCMg 3J7AF 2MMPA 2QQAA 3VYHB 2QQBA 3JB9J 2DTHA 1JJ2A 2RHYA 1O9SA 2XHCA 2Y90A 2RI5A 5HY6A 5LJ3f 2PVGB 2L89A 3E9GA 3PMTA 2RO0A 5GANd 3C12A 3L1AA 3MP8A 3SWNA 4C0FA 3QDRB 2VXFA 2E10A 4NL3A 2NLUA 3OYCA 2BKDN 4VUBA 4JS5A 3DB3A 2CYZB 2RB6A 2DXTA 3OS0A 5GAOl 2PQWA 1N9RA 1GXIE 5DY9A 4BE1A 3VUZA 2PUKB 2KMTA 2QTXA 3EFRA 5GAMf 2DEQA 5LJ3d 1VIFA 4PLIA 1SSFA 5C0MA 1VQPT 5CO7A 3HSBA 3TEEA 3ZEHA 4II1A 2XI9A 3OYHA 4E7JA 4RCCA 1VQNA 2DXBA 1VQOT 2RD1A 1S72A 3GOXA 2K2VA 3QSUA 4M7DF 1Q7YC 1IREB 4HT8A 1M8VA 3JAME 4C8QE 3CCRT 2RK2A 1BYMA 5LJ5j 4M75G 1K73U 3CCQT 4NL2A 1VQLT 1FXXA 3OBWA 4M77A 1Q86C 2XDPA 5HKCA 1VQ4A 5J3BA 3JB9F 3LX7A 3X26B 4D6WA 2ZPGB 3CMEA 4R56A 3M9QA 4DA4A 3S3OA 2LC4A 5GANj 1BI0A 2DK3A 2KVQG 2ZZDA 3G71T 5FU6B 4C5GA 4C92G 4FSXA 3SFMA 3V8JA 3JCMe 2HAXA 4NS5A 4LDVA 3OYNA 4GY5A 4C92A 4E7LA 2E6NA 2OTLT 2HD0A 3FC3A 2X4WA 4C5IA 3J81E 4M7DE 2VGNA 1VQKA 2EIFA 2R5MA 3OYBA 4F7UE 3A8MB 3CCVT 3CEYA 1R8OB 1VQPA 4RG2A 4F7UB 4J6YA 3TU4K 3EFSA 1VUBA 2EQUA 3ZBDA 3PGGA 4N4GA 3OBYA 4ZGJB 2JUFA 3QKJA 5FLXE 5FU6C 4BE0A 4XTVA 1WQ7A 1UGSB 2Y4YA 3A8LB 4M77D 1UB4A 1ZBXA 4LD6A 4O6JA 5CKFA 3JB9I 2WSEE 2CGHA 3BDLA 3DLLA 3OSSC 3CCMA 2JNGA 1OYXA 5GMKm 1YJWA 2XDBA 2DPPB 4X9CA 1W2BS 4J5YA 3LYIA 3UDCA 4E47A 1IZ6A 5GMKj 2QEXA 3WXMB 4CRIA 1YITT 1XQHA 3X28B 4J7FA 3SB2A 2E6ZA 2DXCA 1YIJA 3G71A 2KSSA 2XIDA 2FVUA 4A4GA 3CBPA 1FX7A 4XU0A 3L42A 5DM7R 3PT9A 5CAIA 4HCZA 3L2ZA 5FRMA 4C0GA 4JDSA 3OY9A 4ME7A 2RJDA 4LDWA 3BW1A 3ASKA 2P0QA 4EDUA 1WPYA 2M16A 3QPHA 3CCET 4M7DA 2WSFE 1FWZA 1JRIA 4BACA 3G4ST 1JB0E 2YLCA 5KH6A 2XG8D 2KK4A 2LCCA 4OB1B 1U1SA 1U1TA 3OB9A 2DTIA 3JB9D 2DO3A 1NZ9A 3QHSA 5GAMd 5LL6S 2QQSA 3PFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 A;  2LDM A;  2RHU A;  4L59 A;  2CKK A;  2K3Y A;  3Q1J A;  1VQO A;  3LLR A;  3F70 A;  3OYA A;  3CMA A;  2GF7 A;  1VQL A;  3H6Z A;  3CCL T;  2LTO A;  3L2W A;  1WJR A;  1QVF S;  5CIU A;  1VQ9 A;  3CC2 A;  5KE2 A;  2HQE A;  1XNI A;  1RL2 A;  1K8A U;  3OQ5 A;  4A4H A;  4A4F A;  2M0O A;  2LQ8 A;  2L8D A;  3CCV A;  3FLG A;  1YBY A;  3OYI A;  1VQ7 T;  1WGS A;  2JOY A;  3SD4 A;  3CCE A;  3MP1 A;  4YTL A;  1W2B A;  2R5A A;  2VYT A;  2RJE A;  3CC4 T;  4C5E A;  2DIQ A;  4E7I A;  4PL6 A;  1Q82 C;  1QVF A;  1VQ8 A;  3CCJ A;  5J39 A;  2R57 A;  2HQX A;  3LGF A;  3CCS T;  1KD1 C;  2RHZ A;  3LGL A;  3OW2 S;  2K3X A;  2RI2 A;  1YIJ T;  3OYL A;  5D6Y A;  2MWO A;  3NTH A;  3S3M A;  3CD6 A;  4TVR A;  4N4H A;  1WJS A;  1H3Z A;  3OYE A;  3P8H A;  3L2Q A;  3S6W A;  3MEV A;  5FRN A;  1VQN T;  3MEW A;  1YHQ T;  3FDR A;  1YI2 A;  2GFU A;  2O4X A;  1JJ2 S;  5FRO A;  1VQ8 T;  3CCJ T;  3HKS A;  1K9M C;  3OYD A;  4IUV A;  2F5K A;  4N4I A;  4BD3 A;  1VQ4 T;  3OMC A;  4E7K A;  2MWP A;  4IUP A;  1BKB A;  3MET A;  4IUT A;  2M1H A;  3DB4 A;  1VQM A;  1KQS A;  1Q82 U;  2XK0 A;  1N8R C;  4QQD A;  1EIF A;  4IUQ A;  2OTJ A;  1QVG A;  2BUD A;  2B8A A;  4B9W A;  3H8Z A;  2JZ2 A;  5DLQ E;  2WAC A;  3I55 T;  3CCQ A;  1OI1 A;  1NJI U;  5A2Q E;  2FHD A;  2DAQ A;  2DIG A;  2RJC A;  1KC8 U;  4Z02 A;  2GFA A;  4Q5W A;  4ZTJ A;  1QVG S;  1YJ9 A;  3LH0 A;  4BDY A;  4X34 A;  3G4S A;  5C6S A;  2X4Y A;  4QQ6 A;  4BDZ A;  3QBY A;  4PLL A;  2D9T A;  1Q81 C;  3A5Z B;  3CXC S;  3PNW C;  2EQJ A;  5D6W A;  3CCM T;  1M1G A;  1KC8 C;  1KQS S;  2R58 A;  1VQ9 T;  3S3N A;  3G6E T;  5IN1 A;  2QA4 T;  5M9O A;  1M1K U;  5KCO A;  2YRV A;  5IT9 E;  1VQM T;  4IKF A;  2IG0 A;  3PIP A;  3OYM A;  5KCH A;  3MEA A;  3KUF A;  3P8D A;  3P8B B;  1N27 A;  3OYK A;  1YJN A;  4UC4 A;  4ZN1 A;  1Q86 U;  3CC7 T;  3OA6 A;  3UWN A;  1MHN A;  2KDS A;  3OYG A;  4QW2 A;  1VQ5 A;  2EQK A;  3CME T;  1KD1 U;  3L2V A;  4ZTF A;  4IUU A;  3G6E A;  2L3R A;  3OS1 A;  2QA4 A;  2LCL A;  3PIO A;  1Q81 U;  3O8V A;  1VQK T;  2EQM A;  2E5Q A;  1YHQ A;  3UT1 A;  1YI2 T;  2MI6 A;  2RHX A;  1VQ7 A;  3OS2 A;  2RI3 A;  1X6O A;  4E7H A;  3CC4 A;  1NPR A;  2QEX T;  1M1K C;  1YIT A;  4A4E A;  3C4S A;  3MP6 A;  1UEB A;  2RHI A;  3NTI A;  4QQG A;  3CPW S;  2EFI A;  3CCS A;  2BIV A;  1K8A C;  3CXC A;  1OZ3 A;  3CPW A;  5D6X A;  3CD6 T;  3I56 A;  2O4X B;  2X35 A;  2OTL A;  2QQR A;  3DLM A;  4OVA A;  1VQ6 T;  3EAE A;  1KHI A;  2G3R A;  2OTJ T;  3CPF A;  1RI0 A;  3ER0 A;  3CMA T;  4B9X A;  1OZ2 A;  1NPP A;  1NJI C;  3OYF A;  3NTK A;  1YJW T;  3J80 E;  3CCL A;  5J26 A;  2LRQ A;  3CC2 T;  2JTF A;  1WJQ A;  3I56 T;  3QII A;  3TRE A;  3OW2 A;  5IAY A;  1Q7Y U;  1S72 T;  3QJ6 A;  3OMG A;  3PMI A;  3OYJ A;  2X4X A;  4C5H A;  1K73 C;  3CCR A;  3CCU A;  3OYY A;  1KHC A;  2EKO A;  3I55 A;  1G5V A;  4FU6 A;  4BE2 A;  4ZN3 A;  1N8R U;  3MEU A;  2P0K A;  2JVV A;  1XTD A;  2E70 A;  1YJ9 T;  1M90 U;  3MO8 A;  3E9F A;  1K9M U;  1VQ6 A;  4QVZ A;  3L2R A;  3KBG A;  1YJN T;  4IUR A;  3L2U A;  3ME9 A;  3FEO A;  3CCU T;  4FL6 A;  2RJF A;  2LVM A;  1VQ5 T;  5KE3 A;  3J7A F;  1JJ2 A;  2RHY A;  2XHC A;  5HY6 A;  2RI5 A;  2L89 A;  3E9G A;  3PMT A;  2RO0 A;  3MP8 A;  2NLU A;  3OYC A;  2BKD N;  3DB3 A;  3OS0 A;  2PQW A;  4BE1 A;  1VQP T;  1SSF A;  4PLI A;  5C0M A;  3ZEH A;  4II1 A;  1VQN A;  3OYH A;  4E7J A;  1VQO T;  1S72 A;  3GOX A;  1Q7Y C;  3JAM E;  3CCR T;  1K73 U;  1VQL T;  3CCQ T;  1Q86 C;  2XDP A;  1VQ4 A;  5J3B A;  3CME A;  3LX7 A;  3S3O A;  1M90 C;  3M9Q A;  2KVQ G;  3G71 T;  4C5G A;  4NS5 A;  3OYN A;  4GY5 A;  4E7L A;  2OTL T;  2E6N A;  3FC3 A;  2X4W A;  4C5I A;  3J81 E;  1VQK A;  2EIF A;  2R5M A;  3CCV T;  3OYB A;  3CEY A;  1VQP A;  4RG2 A;  2EQU A;  4N4G A;  2JUF A;  5FLX E;  3QKJ A;  4BE0 A;  4LD6 A;  3DLL A;  3BDL A;  3CCM A;  2JNG A;  1OYX A;  1YJW A;  1W2B S;  2QEX A;  3LYI A;  1IZ6 A;  1YIT T;  4CRI A;  2E6Z A;  1YIJ A;  3G71 A;  4A4G A;  5DM7 R;  3L42 A;  4HCZ A;  5FRM A;  3OY9 A;  2RJD A;  3ASK A;  4EDU A;  2M16 A;  4BAC A;  3G4S T;  5KH6 A;  2LCC A;  3OB9 A;  2DO3 A;  1NZ9 A;  3CCE T;  5LL6 S;  2QQS A;  3PFS A; 
#chains in the Genus database with same CATH topology
 1P92 A;  2RHU A;  4L59 A;  2CKK A;  3Q1J A;  3OYA A;  3CMA A;  2IVW A;  3JCM c;  4RMO A;  3A8O B;  2E41 A;  3I56 Q;  2GF7 A;  1UUE A;  1VQL A;  3HFN A;  3H6Z A;  1R77 A;  2L2P A;  1SSH A;  1M8M A;  5GMK h;  1WJR A;  1QVF S;  1OU9 A;  2VAS A;  5KE2 A;  2LNH B;  1XNI A;  1RL2 A;  2GQV A;  4A53 A;  4RKU E;  3EFO B;  4N0A C;  4A4H A;  4A4F A;  3M0S A;  3O5Z A;  2LJ0 A;  3CCV A;  1IHW A;  2E5K A;  2AK5 A;  4OGC A;  3SD4 A;  2V26 A;  2HBW A;  1W2B A;  4M7D C;  1QQJ A;  4MZP A;  4Y92 A;  1M4Z A;  4PL6 A;  4OB3 B;  2A37 A;  5I22 A;  1H64 1;  1PG5 B;  4ORZ A;  4FCY A;  2LX9 A;  3LGF A;  3CCQ Q;  2EYZ A;  2MYS A;  1YJ9 Q;  1KD1 C;  3LGL A;  4CC3 A;  5LJ5 h;  4K11 A;  2DBK A;  3CD6 A;  2DVJ A;  4GBQ A;  1H3Z A;  3UF4 A;  3R6N A;  3OS5 A;  3MEV A;  1X75 C;  2A36 A;  3MEW A;  1YHQ T;  2MIO A;  4QT7 A;  1YI2 A;  2EKH A;  3VRZ A;  3HKS A;  4ANJ A;  1BI3 A;  2ZGW A;  4BD3 A;  1BI2 A;  1VQ4 T;  4EMH A;  4WF2 A;  3SDZ A;  3TSZ A;  2EJF A;  1JXO A;  2GQI A;  5EG2 A;  4N0A A;  1KQS A;  3GNF B;  4XTW A;  1EIF A;  4F17 A;  4KT0 E;  4IUQ A;  2EVR A;  1HXD A;  2DE0 X;  1VQP Q;  4B9W A;  2FB7 A;  1M90 R;  2FO0 A;  1UHF A;  2X4J A;  4C8Q F;  2K57 A;  3FJP A;  4AG2 C;  2CP3 A;  3M5A A;  4XQ3 A;  5IXB A;  5GAN 5;  1UFF A;  4M78 G;  1AT1 B;  3N5B B;  2K3B A;  2DA9 A;  1VQL Q;  1S1N A;  4RTU A;  4JLI A;  2H3J A;  2DIG A;  3RKW A;  3TCJ A;  4JPB W;  3QYH B;  5FU7 C;  1YJW Q;  1W4S A;  2GFA A;  4Q5W A;  4XTZ A;  5CKB A;  3HP9 A;  1YJ9 A;  3H0H A;  4OP0 A;  2K5L A;  4FIB A;  2O88 A;  4BDY A;  1W70 A;  4X34 A;  3G4S A;  1K4U S;  4QQ6 A;  2EAY A;  2K5F A;  1G3Y A;  1I81 A;  3QBY A;  4F7U F;  5GAN 7;  3CXC S;  1C1A A;  2QQ9 A;  4OF1 A;  3MCA B;  4Y91 A;  1BK2 A;  2YWW A;  1KC8 C;  4O5V A;  3M4G A;  4LN2 A;  2R58 A;  3JV3 A;  3NFC A;  3HRT A;  4BY6 C;  2XKO C;  5GAN f;  1TU0 B;  5IHN A;  3G6E T;  1Y71 A;  2QA4 T;  5M9O A;  3WVE B;  1M1K U;  3JSC A;  4IKF A;  2QG9 B;  2MOX A;  3OYM A;  2JS2 A;  1X27 A;  1M3C A;  3P8D A;  5D7U A;  8AT1 B;  2E64 A;  1YJN A;  1Q86 U;  3JCM V;  2KDS A;  4AFS C;  4B6M A;  3CME T;  1PNJ A;  4ELY C;  2ZCF B;  4BI4 A;  3HPW A;  2DIL A;  2L3R A;  2QA4 A;  4ATO A;  2KBT A;  3REB B;  3O8V A;  3VS4 A;  1VQK T;  4M7A A;  2BZX A;  1NZ9 A;  2E5Q A;  1YHQ A;  4M78 A;  2C0T A;  3UT1 A;  2RHX A;  3M55 A;  3VS2 A;  2FL7 A;  2RI3 A;  1M30 A;  4E7H A;  2ED1 A;  3FRN A;  1VQM Q;  5GAN 4;  2ABL A;  3HL8 A;  2RA2 A;  4JRI A;  1UG1 A;  1YN8 A;  4XK8 E;  1NEB A;  1ACM B;  1UTI A;  3CPW S;  2BIV A;  5GAM g;  3CCS A;  9ATC B;  2F2V A;  3A98 A;  4JRQ A;  2CZ6 B;  2D1X A;  2KT8 A;  1G3T A;  3CCJ Q;  3CD6 T;  3DLM A;  1OOT A;  1NG2 A;  3EAE A;  2V8K A;  1QCN A;  1I5O B;  5GAN 3;  2OTJ T;  2EJ9 A;  5CQX A;  1C0M A;  4XTY A;  1MMG A;  1IHV A;  3ER0 A;  1LCK A;  5KYX A;  3CMA T;  3SEM A;  5HK3 A;  2M9U A;  4B9X A;  1OZ2 A;  2QYZ A;  1D3B A;  4ZGD B;  2VWF A;  2FPE A;  1WHL A;  3A8H B;  3CCE Q;  5J26 A;  3G6E Q;  1JEG A;  2LRQ A;  2JT4 A;  2OTL Q;  4M7A B;  4C0Z A;  3I56 T;  1EFN A;  5CCA A;  4MMK A;  1ZLM A;  4JLG A;  3BFM A;  1D1A A;  2CH4 A;  1UGP B;  2HNI A;  4C8Q C;  4RTZ A;  5IAY A;  3QJ6 A;  1WYX A;  4C5H A;  2DL3 A;  2SEM A;  3CXC P;  2QGF B;  3OYY A;  1KHC A;  1M3A A;  3AHU A;  3GNG A;  4FSS A;  3BY7 A;  1K73 R;  3CCV Q;  1U06 A;  2DM1 A;  5AYF A;  1N8R U;  3V8K A;  1VQK Q;  2P0K A;  2M02 A;  1E7O A;  5LJ3 h;  1K9A A;  5HK0 A;  1XTD A;  3CC7 Q;  3M53 A;  1YJ9 T;  3E9F A;  1WZO A;  3L2R A;  2D0Q B;  2EGA A;  3KBG A;  1YJN T;  4JJC A;  3ME9 A;  4DOV A;  4PJO C;  1VQ9 Q;  2M51 A;  4M77 C;  2RJF A;  1JO8 A;  2DTH A;  1JJ2 A;  3GBQ A;  5HY6 A;  1SPK A;  3E9G A;  3QDR B;  2NLU A;  2CYZ B;  1N9R A;  1GXI E;  1QMC A;  2PUK B;  2EYW A;  1QWE A;  4PLI A;  1BBZ A;  3OYH A;  3CMA Q;  1QVF P;  1E6H A;  1VQO T;  2K2V A;  4J9C A;  1Q7Y C;  2B86 A;  4DBQ A;  2IPO B;  1AWO A;  1HJD A;  2NUZ A;  4M75 G;  5LJ5 j;  1FXX A;  2XDP A;  3JB9 F;  3LX7 A;  3X26 B;  3QWX X;  1BI0 A;  2FPF A;  3G71 T;  4E2F B;  4C5G A;  4C92 G;  2HAX A;  1TXQ A;  3SFM A;  2BTT A;  4LDV A;  3OYN A;  1I1J A;  1K9M R;  4M7D E;  2VGN A;  4F7U E;  4F7U B;  4J6Y A;  3H9N A;  3PGG A;  4N4G A;  2JUF A;  3QKJ A;  4XTV A;  1WQ7 A;  3MJX A;  1UGS B;  5CKF A;  3CCS Q;  1NYG A;  3JB9 I;  2WSE E;  1IGU A;  4J5Y A;  4E47 A;  2L3S A;  2KRN A;  5KYU B;  3SB2 A;  2E6Z A;  4CC4 B;  2DXC A;  1WX6 A;  3G71 A;  1R0B G;  1V1C A;  2LX7 A;  2KSS A;  4A4G A;  5DM7 R;  3L42 A;  3PT9 A;  4C0G A;  4JDS A;  3RBB B;  4ME7 A;  1WHG A;  1QKW A;  2GNC A;  2CT4 A;  2M16 A;  2L0A A;  3G4S T;  2YLC A;  5KH6 A;  2DF6 A;  2KK4 A;  1U1S A;  1U1T A;  3OB9 A;  3QHS A;  2QA4 Q;  3GPL A;  2LDM A;  1UJY A;  2K2M A;  2VVK A;  4RTV A;  6AT1 B;  2KNB B;  4FM4 B;  5A0D A;  2HQH A;  2P4R A;  4WTO B;  2AHJ B;  3VS3 A;  1K0X A;  2CZ0 B;  3NHN A;  2K6D A;  3CCL T;  3JCM d;  5CIU A;  4PJO A;  1H3H A;  4J9B A;  3CC2 A;  1OUL A;  4RG8 A;  3CME Q;  2DYI A;  2E3H A;  2L8D A;  4E6R A;  3OYI A;  1VQ7 T;  2DX1 A;  2R5A A;  3CC4 T;  4HCB A;  1CKB A;  2XDD A;  2OI3 A;  3MPU B;  4E7I A;  2K79 A;  4M75 B;  1VQ8 A;  3CCJ A;  4M77 B;  2O01 E;  5LJ3 e;  4KRT A;  2LJ3 A;  3CCM Q;  4M7D D;  1YP5 A;  4QVC A;  2RHZ A;  3G71 Q;  3OW2 S;  3JCM b;  2RI2 A;  2Y4X A;  2DD5 A;  1FYN A;  2MWO A;  2MF2 A;  1Q86 R;  4A4K A;  5IHK A;  3GLX A;  2YHT A;  2KQW A;  4JZ3 A;  2I0N A;  1I07 A;  1BB9 A;  4C8Q G;  1ZHI A;  3S6W A;  2NUP B;  1V29 B;  5KYN A;  1VQN T;  1X6B A;  3JCM h;  5ECA A;  4LDX A;  2GGR A;  1JJ2 S;  1YCY A;  4KUL A;  5FRO A;  3TVT A;  3CCJ T;  1FMK A;  4L5G A;  2E3I A;  1RAG B;  4IUV A;  3I35 A;  3VS6 A;  2EGC A;  2FG0 A;  1KQS P;  2DRK A;  3GIB A;  3LWH A;  4E7K A;  2MWP A;  1Y0M A;  2YXY A;  4RCB A;  1G83 A;  4ESR A;  4M7D B;  4M7A C;  1AD5 A;  2XK0 A;  3VRY A;  5LJ5 d;  3EG9 A;  1XOV A;  4ZGE B;  1EZZ B;  1AWW A;  1VA7 A;  2OTJ A;  3KFV A;  2J7I A;  2BUD A;  4P5N A;  2B8A A;  2JZ2 A;  4OGE A;  2V8I A;  5DLQ E;  3I55 T;  1WHM A;  3CCQ A;  2BE7 D;  1OI1 A;  4Z88 A;  1SKU B;  4MDX A;  2FHD A;  2OJ2 A;  2RJC A;  1UE9 A;  1UDL A;  1KC8 U;  4BB7 A;  2E1H A;  2PTK A;  4ZTJ A;  1QVG S;  2XU8 A;  2HDA A;  1O75 A;  2K7A A;  3GF5 A;  2HL3 A;  5C6S A;  2DZ9 A;  4KUI A;  4PFZ A;  3KXT A;  1KQ1 A;  4PFO A;  2P0P A;  4PLL A;  2D9T A;  4MML A;  4OMO A;  1Q81 C;  2FYK A;  2M0Y A;  2QAS A;  5D6W A;  1JU5 C;  3CCM T;  2X3W D;  4JJB A;  2VUB A;  2YDL A;  1WNL A;  1IXD A;  1LNX A;  5KYW B;  1KQS S;  1VQ9 T;  1NEG A;  2YT6 A;  3S3N A;  1TUC A;  3FJ5 A;  1OPL A;  5KCO A;  2YRV A;  4C8Q B;  1BI1 A;  4OMP A;  1VQM T;  3PIP A;  1WHJ A;  5KCH A;  3WVD B;  2RF0 A;  1IGQ A;  2KT1 A;  2ROL A;  1QKX A;  3P8B B;  2JMC A;  3JCM X;  1LOJ A;  3NGP A;  4QW2 A;  1VOM A;  3M54 A;  1KD1 U;  3X25 B;  1IB8 A;  2DL5 A;  2Z0W A;  2E65 A;  3OS1 A;  4OB0 B;  1MGQ A;  1M1K R;  3QXE B;  1QVP A;  3RKY A;  2VGM A;  1SG5 A;  2RQW A;  2DL7 A;  2ZPB B;  1LJO A;  2MI6 A;  1UGQ B;  2LQN A;  1X43 A;  3I5R A;  1Q95 G;  1NPR A;  4HA8 A;  4J6W A;  2QEX T;  2DRM A;  4C92 D;  1QVG P;  1M1K C;  1YIT A;  4A4E A;  2QDY B;  1SHF A;  3NTI A;  2DJZ A;  4QQG A;  3VS7 A;  1D0Z A;  1G3W A;  3OW2 P;  4NOY A;  1K8A C;  4M75 D;  2I2L A;  1GCQ C;  1OZ3 A;  5FU7 B;  3I56 A;  2OTL A;  5L23 A;  1X01 A;  4AT1 B;  4PJO E;  3MKD A;  5LJ5 g;  3JRZ A;  1KHI A;  4OMQ A;  1K8A R;  2ROT A;  1KIK A;  3PVL A;  3CPF A;  2PU9 B;  4WCI A;  2HMA A;  4R0K A;  3OYF A;  2CP2 A;  1YJW T;  3G4S Q;  1HK9 A;  5HCK A;  1D0X A;  3J80 E;  1T0J A;  3CCL A;  5I2S A;  4RTT A;  2FRW A;  2COZ A;  3OSV A;  2COW A;  2J6K A;  2LZ6 B;  1NBE B;  1WJQ A;  5GAO r;  1QP3 A;  5GAN e;  3H0I A;  1YWO A;  3UA7 A;  2C0I A;  2DKG A;  2KYM A;  2D0N A;  4IIM A;  2KYB A;  4M77 F;  2CS7 A;  3PMI A;  3OMG A;  4M4Z A;  2KRO A;  1BIA A;  2EKO A;  4RTW A;  2QI2 A;  1M2V B;  1WA7 A;  4DOW A;  1MV0 B;  2V1Q A;  3AT1 B;  1HSQ A;  4DQ2 A;  3PTA A;  4M75 E;  4XU3 A;  3QG1 A;  3MEU A;  2A08 A;  2FPD A;  3UPU A;  3EG9 B;  3V7R A;  4JJN K;  4QKU A;  1MV3 A;  4OML A;  2A7Y A;  2X3X D;  1NE8 A;  4LD9 K;  4C92 E;  4JZ4 A;  4PJO D;  1M90 U;  3X24 B;  2KGT A;  3EGX B;  2HSP A;  1I5L A;  3EH2 A;  4PJJ A;  3E1S A;  3L2U A;  1KQ2 A;  3FEO A;  3LW5 E;  1WQW A;  1RUW A;  5I2M A;  2QEX Q;  2MK5 A;  2LVM A;  5KE3 A;  1N6A A;  1PWT A;  2QQB A;  3RDV A;  3JB9 J;  2A28 A;  2RHY A;  1O9S A;  2V1R A;  2YUO A;  1KD1 R;  2H8H A;  2RO0 A;  3C12 A;  3L1A A;  2AZS A;  3H0F A;  2C0O A;  1MND A;  4NL3 A;  3OYC A;  4JS5 A;  3DB3 A;  5GAO l;  5KYX B;  5DY9 A;  4BE1 A;  2NYS A;  2VKN A;  2QTX A;  3EFR A;  2DEQ A;  3U23 A;  1X2K A;  1VQP T;  1SSF A;  5CO7 A;  3HSB A;  3TEE A;  3ZEH A;  1SRM A;  4E7J A;  4RCC A;  2DXB A;  1S72 A;  3GOX A;  3VS0 A;  1IRE B;  1QCO A;  1ZA2 B;  2YSQ A;  5GJW B;  2RK2 A;  1RLQ C;  1VQL T;  4NL2 A;  4RTX A;  4M77 A;  2HZY A;  1ZX6 A;  1T3L A;  5J3B A;  3S3O A;  4D6W A;  4DA4 A;  4R56 A;  3M9Q A;  2LC4 A;  2DK3 A;  1GFC A;  5KYY A;  3HTR A;  2HKN A;  3V8J A;  4NS5 A;  4C92 A;  4E7L A;  2E6N A;  2OTL T;  2X4W A;  3J81 E;  1D0Y A;  1VQK A;  4PJM A;  3OYB A;  3CCV T;  1E6G A;  4RG2 A;  2X51 A;  2RQU A;  2RQT A;  3OBY A;  4ZGJ B;  2QGG A;  1U3O A;  5FLX E;  5FU6 C;  1WXU A;  4M77 D;  4O6J A;  1UB4 A;  1ZBX A;  4LD6 A;  3DLL A;  3OSS C;  2DPP B;  2QEX A;  3UDC A;  3WXM B;  1VYV A;  4J7F A;  1PD1 A;  4PK4 A;  1X6G A;  1F1B B;  4FYV B;  4HVW A;  1B3Q A;  1AEY A;  2XID A;  3CBP A;  1WXT A;  4XU0 A;  1MMA A;  3ASK A;  1SF9 A;  1R0C B;  1TS9 A;  2P0Q A;  1WPY A;  1AWJ A;  1V76 A;  3QPH A;  3QWY A;  1FWZ A;  2AKL A;  1JB0 E;  2XG8 D;  2DO3 A;  1ZUY A;  5GAM d;  5LL6 S;  2QQS A;  3CC7 A;  2CSI A;  2K3Y A;  3LLR A;  3F70 A;  3VKI A;  3THK A;  5GMK i;  1RAA B;  1RAI B;  4EMK C;  4GLK A;  2LTO A;  1KSW A;  3HFO A;  3RES A;  1VQ9 A;  4F7U G;  3A8G B;  3RMQ A;  2P4T A;  1B07 A;  4MZT A;  4M78 D;  3OQ5 A;  2KEA A;  3FLG A;  4KH0 B;  1YBY A;  2LCS A;  2JOY A;  4YTL A;  1G3S A;  2RJE A;  3QZ9 B;  4C5E A;  5DLO A;  1TSF A;  1QW1 A;  2G6F X;  1Q82 C;  1QVF A;  5GAO m;  5J39 A;  2HQX A;  2ZPF B;  3NMZ C;  4J8O A;  4M7A G;  1AHJ B;  4HT9 A;  2ZPI B;  1QCF A;  4M78 F;  4A54 A;  5CKE A;  4J9H A;  1X2Q A;  3CCS T;  2K3X A;  3I9Q A;  1QP2 A;  4RTY A;  2DNU A;  1YIJ T;  3OYL A;  3UA6 A;  1JJ2 P;  1Q7Y R;  3CD6 Q;  3SWN C;  2PUO B;  3NTH A;  3S3M A;  4TVR A;  4N4H A;  1WJS A;  2NUP A;  3M56 A;  1VQ5 Q;  1TTH B;  3I55 Q;  1XJW B;  5FRN A;  4FT4 A;  8ATC B;  1JXM A;  1BU1 A;  3FDR A;  3VJP A;  1MMD A;  2GFU A;  4PJO F;  3VS5 A;  2QTV A;  5CVI A;  2LJ1 A;  1VQ8 T;  4BY6 B;  1K9M C;  2ZPE B;  3OYD A;  4N4I A;  2F5K A;  4BI8 B;  4HKE A;  4DEX A;  1VIE A;  3OMC A;  2W10 A;  2FZC B;  2DFU A;  2ED0 A;  2OAW A;  3LH5 A;  1BKB A;  4F14 A;  4OMM A;  2M1H A;  2EW3 A;  1K76 A;  2VXE A;  3URG A;  1VQM A;  4JUV A;  2CP7 A;  1Y57 A;  1N8R C;  4QQD A;  4J9I A;  1AVZ C;  2YUN A;  4X9D A;  2LP5 A;  4ZNX A;  2DEU A;  4V2S A;  5KYW A;  5IXF A;  1M27 C;  2J05 A;  4LE9 A;  1PCX A;  2O2O A;  2WAC A;  4D8K A;  2W0Z A;  1RLP C;  5FW9 A;  1NJI U;  2LT4 A;  3RKX A;  2KE9 A;  1PC0 A;  2YLB A;  5CKD A;  1LPL A;  3CBO A;  4Z02 A;  4ELZ C;  1WLP B;  4M78 C;  1J3T A;  1YJN Q;  4J9G A;  3EG0 A;  3LWI A;  2X4Y A;  2J6F A;  4A63 B;  3M0Q A;  3EFO A;  1N9S A;  3CC4 Q;  3CCL Q;  3A5Z B;  2EQJ A;  5I11 A;  1G2B A;  1A0N B;  2FZK B;  1ZSZ C;  1M1G A;  2A0F B;  1ZQ1 A;  5GJV B;  3M58 A;  4F16 A;  2QK0 A;  4C92 F;  1M2O A;  2QDL A;  4J9D A;  5IT9 E;  2IG0 A;  3JB9 G;  1UGV A;  2QXF A;  4HCC A;  4M7A E;  1D1C A;  4M75 F;  3KUF A;  4R55 A;  3OYK A;  1WHH A;  4MZM A;  4UC4 A;  4ZN1 A;  1T3S A;  1IO6 A;  3UWN A;  1TH7 A;  3A1P A;  5LJ3 j;  2RQV A;  3L2V A;  2COY A;  4ZTF A;  3CQT A;  3JCM f;  5A0G A;  3G6E A;  1UGR B;  4HXJ A;  3PIO A;  1TWB A;  3EGD B;  2JN0 A;  1RAE B;  1GFD A;  1QWF A;  2EQM A;  4X1V A;  1YI2 T;  4PFP A;  3C95 A;  1VQ7 A;  1BIB A;  3CC4 A;  2HEQ A;  1W1F A;  1ZSG A;  4EPC A;  1Q82 R;  4M75 C;  3C4S A;  4L6V 5;  1YFN A;  3MP6 A;  1UEB A;  1I4K 1;  3NPF A;  2ZPH B;  4J9F A;  2ATC B;  1X69 A;  2YUQ A;  4KGV B;  2OAU A;  2EFI A;  1WXB A;  3C94 A;  4C92 C;  2H3E B;  1WDX A;  2FZG B;  2CZ7 B;  2NUT B;  3CPW A;  2LQK A;  2O4X B;  2QQR A;  4OVA A;  1VQ6 T;  1B34 B;  1PM3 A;  3QYG B;  2L3P A;  3RUX A;  3EHR A;  4CI0 C;  1SRL A;  1H8K A;  4RUG A;  2VC8 A;  3CCR Q;  1YHQ Q;  2X9H A;  5GAN 6;  1MMN A;  1JBM A;  1NPP A;  4J83 A;  2ESW A;  1NJI C;  3NTK A;  2BE9 B;  3V7S A;  2V8J A;  3V7C A;  2GTJ A;  2KI7 A;  2MCN A;  2EWN A;  3PVQ A;  2O9S A;  2RN8 A;  2F2X A;  2MAM A;  4OB2 B;  3MHX A;  3M0P A;  4J7I A;  1PD0 A;  4FYX B;  4AMC A;  1TUG B;  2BZY A;  2F2W A;  4EMK A;  3ULR B;  4XU2 A;  2QAZ A;  1C6V X;  3OW2 A;  1YWP A;  5FWC A;  1S72 T;  2X4X A;  5GAN 2;  2YUP A;  1K73 C;  3CCU A;  3V8L A;  1PKS A;  5LJ5 e;  3I55 A;  1G5V A;  1M5Q 1;  2E4H A;  4FU6 A;  5CR2 A;  4BE2 A;  2JW4 A;  4F7U A;  1Y7X A;  4M77 G;  3JB9 H;  2JVV A;  1GBR A;  2E70 A;  4EIK A;  3MO8 A;  4KBM B;  1K9M U;  2KY9 A;  1VQ6 A;  4BUG A;  2DD4 A;  4IUR A;  3ZL7 C;  4LUD A;  2F1L A;  1RAB B;  1NJI R;  1JQQ A;  3VV0 A;  1VQ5 T;  2MMP A;  2XMF A;  3VYH B;  2HL5 C;  1Z9Z A;  1KC8 R;  2AIR B;  4E7Z A;  5EC7 A;  2LQW A;  2RI5 A;  2PVG B;  2L89 A;  2HCK A;  3PMT A;  3EG1 A;  4C0F A;  4DBH A;  2VXF A;  2E10 A;  1WFW A;  1T0H A;  1OV3 A;  4PJN A;  3OS0 A;  4F04 B;  1K0S A;  1BCM A;  1WHK A;  3VUZ A;  5GAM f;  1TOV A;  5LJ3 d;  1VIF A;  2FRY A;  1RI9 A;  2JS0 A;  4II1 A;  2XI9 A;  1VQN A;  1M2V A;  1MNE A;  2RD1 A;  3QSU A;  4M7D F;  4HT8 A;  1M8V A;  1UHC A;  1K73 U;  2GTO A;  3CCQ T;  3OBW A;  1VQ4 A;  1M90 C;  5GAN j;  1ZUU A;  3JCM e;  4FSX A;  2DMO A;  5IH2 A;  4GY5 A;  1KJW A;  2HD0 A;  1B7T A;  4C5I A;  2JM8 A;  2EIF A;  1R8O B;  1VQP A;  3TU4 K;  1VUB A;  2EQU A;  2JTE A;  3EGU A;  3REA B;  4BE0 A;  2Y4Y A;  1N5Z A;  2JNG A;  2XDB A;  2EGE A;  1W2B S;  1OQK A;  3LYI A;  5GMK j;  4CRI A;  2DET A;  1XQH A;  5KYY B;  2LMJ A;  7AT1 B;  1KFZ A;  2FVU A;  1FX7 A;  1GCP A;  1H92 A;  4LDW A;  3BE3 A;  4CC7 A;  4D8D A;  4M7D A;  2WSF E;  1JRI A;  4BAC A;  3SHW A;  2LCC A;  4J9E A;  2DTI A;  2O9V A;  3PFS A;  4PKC C;  4CC2 A;  1VQO A;  2HBP A;  1D3B B;  1RAH B;  2RMO A;  2KRM A;  1Y07 A;  3GP8 A;  3BDU A;  3L2W A;  2F5T X;  4DBR A;  5GAN h;  1MUZ A;  5GAO q;  2HQE A;  1HYO A;  2E12 A;  1YIT Q;  1K8A U;  4PNO A;  2M0O A;  2LQ8 A;  4EMK B;  2YRD A;  1WGS A;  5GAM j;  2D8H A;  1M1F A;  3MP1 A;  3QZ5 B;  2PNI A;  3CCE A;  2VYT A;  3JCM P;  2DIQ A;  2DBM A;  3G7Z A;  2BZ8 A;  2R57 A;  4HCK A;  2LT1 A;  5GAM h;  3M0R A;  1WIE A;  2PVO B;  1KG1 A;  1AOJ A;  1W2B P;  4KUD K;  3TQ7 P;  1OPK A;  2P84 A;  4M78 E;  5D6Y A;  2L3Q A;  3OYE A;  3P8H A;  2YRC A;  2DXU A;  3L2Q A;  2WSC E;  2C06 A;  3FB9 A;  2SRC A;  4M7A D;  4C0D B;  1B34 A;  1IRX A;  4LDY A;  4QVD A;  4LDU A;  2RM4 A;  2O4X A;  1G8X A;  2PVD B;  3SWN B;  2NUT A;  1PSF A;  4JS4 A;  4PJL A;  1OX9 A;  2DL8 A;  1FMV A;  1CSK A;  1VQ6 Q;  1NYF A;  3CPW P;  4IUP A;  2DVE A;  4M7A F;  2HKQ B;  4XAX B;  3MET A;  4IUT A;  1Y96 A;  2D6F A;  3DB4 A;  1Q82 U;  2JXB A;  3HRU A;  1PRL C;  3IQL A;  2F69 A;  2EYQ A;  4Z89 A;  1D09 B;  4OMN A;  3DKM A;  4C92 B;  2RK1 A;  1QVG A;  3EGD A;  1ZSZ A;  1ZUK A;  3H8Z A;  4FT2 A;  4XTU A;  4XU1 A;  1FMW A;  5A2Q E;  3JCM W;  1U8R A;  3QDF A;  1K1Z A;  1NLP C;  1ZA1 B;  2DAQ A;  4KGX B;  2JJ9 A;  2LNV A;  3TSW A;  1CKA A;  2DLP A;  4AG1 C;  2OX7 A;  3JCM Q;  3LH0 A;  2K5I A;  5FWB A;  1YIJ Q;  2OTJ Q;  1RAF B;  2DYB A;  4BDZ A;  4XTX A;  3VUB A;  2DZC A;  5GMK l;  3M59 A;  4HVV A;  3PNW C;  2CZ1 B;  3RR6 A;  4JRP A;  3EH1 A;  2J06 A;  5GAN g;  3EGX A;  5LJ3 g;  4MDW A;  5IN1 A;  1I0C A;  2EJG A;  5I21 A;  3FIF A;  5A0L A;  2JTM A;  3RIR A;  1OEB A;  2CSQ A;  3QUI A;  2EBP A;  2KR3 A;  4FYW B;  3MEA A;  2AT1 B;  3CBM A;  2K9G A;  1BCO A;  1AZG B;  4FYY B;  1N27 A;  5LJ5 f;  2GCX A;  4M78 B;  5GAM e;  3CC7 T;  3OA6 A;  3INZ A;  2NWM A;  1MHN A;  4C8Q A;  3EHQ A;  3OYG A;  1VQ5 A;  2EQK A;  2K4Y A;  3E19 A;  2EQI A;  4IUU A;  4LXC A;  2KAF A;  2LCL A;  2CUD A;  1Q81 U;  1ZBJ A;  2EYX A;  2HSE B;  3QJY A;  1VQ8 Q;  4PJO B;  3ZFJ A;  1PRM C;  3D7S B;  1HD3 A;  3JCM J;  3OS2 A;  2RQR A;  1LVK A;  1X6O A;  3VU3 C;  1KK7 A;  3M4Y A;  1VQ7 Q;  3RER A;  4HVU A;  3RNJ A;  3CCU Q;  2O31 A;  4FW2 A;  2RHI A;  3QO3 A;  1VQO Q;  1GCQ A;  1YCS B;  5GAO p;  2L5Q A;  1WI7 A;  1S72 Q;  3CXC A;  4BI3 A;  5D6X A;  2X35 A;  5L8R E;  1TUD A;  1SEM A;  4M77 E;  1DJ7 B;  2CDT A;  2EPD A;  2CP5 A;  2G3R A;  2XIC A;  1RI0 A;  1Z9Q A;  4M7D G;  3C0C A;  3T9N A;  2ZAE A;  4AFQ C;  3EG3 A;  3H41 A;  4DEY A;  3VYG A;  2ENM A;  1YNZ A;  2DL4 A;  3VS1 A;  1M9S A;  4JRK A;  1GRI A;  3CC2 T;  2JTF A;  5CQY A;  1ABQ A;  3RMS A;  1I8F A;  3EG2 A;  2GBQ A;  3QII A;  4C0D C;  2IIM A;  1OU8 A;  5CKH A;  5GAO n;  5CK9 A;  1GL5 A;  2CRE A;  3TRE A;  2AKK A;  5GMK e;  1Q7Y U;  2CP6 A;  3OYJ A;  4Y28 E;  2KXD A;  2JMA A;  3CCR A;  3M0T A;  2RH2 A;  1M3B A;  2AZV A;  2VB6 A;  4J6X A;  5AT1 B;  4FW1 A;  2XD0 A;  4C8Q D;  1ARK A;  1ZSZ B;  3X20 B;  2DJQ A;  4EMG A;  4DBF A;  2A3L A;  2DTO A;  2RNA A;  4ZN3 A;  1EX4 A;  3G1J A;  3HRS A;  1UEC A;  3HHT B;  2DER A;  1U5S A;  1PHT A;  4PJO G;  4M75 A;  4AFU C;  2VV5 A;  1VYU A;  1Y96 B;  3M57 A;  5IHI A;  4Z8A A;  1PSE A;  4QVZ A;  1D1B A;  5GAN 8;  1NM7 A;  4OMF B;  3R6O A;  2CUB A;  3CCU T;  2CT3 A;  4FL6 A;  3E2U A;  3JCM g;  3J7A F;  2QQA A;  2XHC A;  2Y90 A;  5LJ3 f;  5GAN d;  2RPN A;  3MP8 A;  3SWN A;  2BKD N;  4VUB A;  1YI2 Q;  2RB6 A;  1OX8 A;  2DXT A;  1RAC B;  1ABO A;  2PQW A;  1UJ0 A;  4KH1 B;  4E7S A;  2KMT A;  1SHG A;  2ECZ A;  2FEI A;  5C0M A;  4JJD A;  2MPX C;  1AZE A;  4LUE A;  3JAM E;  4C8Q E;  3CCR T;  3UAT A;  1BYM A;  1Q86 C;  5HKC A;  3CME A;  2ZPG B;  2KVQ G;  3CC2 Q;  4KGZ B;  2ZZD A;  5KYU A;  2JM9 A;  5FU6 B;  2J6O A;  1TG0 A;  3FC3 A;  1GBQ A;  2R5M A;  4IIO A;  3A8M B;  1AWX A;  3CEY A;  2EYY A;  1VQN Q;  1VYT A;  3EFS A;  1RAD B;  3ZBD A;  2PZ1 A;  2CP0 A;  3A8L B;  1QLY A;  3BDL A;  2CGH A;  1W6X A;  1PKT A;  3CCM A;  5GMK m;  1OYX A;  1YJW A;  4X9C A;  1IZ6 A;  1YIT T;  3X28 B;  1Q81 R;  1VQ4 Q;  1YIJ A;  2CH4 W;  4LNP A;  2D8J A;  3PE0 A;  4AFZ C;  5CAI A;  3M0U A;  4HCZ A;  3L2Z A;  5FRM A;  1NLO C;  3OY9 A;  2RJD A;  4GLM A;  3BW1 A;  4EDU A;  2KXC A;  3I5S A;  4OB1 B;  3JB9 D;  1N8R R;  2KRS A;  3CCE T; 
#chains in the Genus database with same CATH homology
 1P92 A;  3CC7 A;  2LDM A;  2RHU A;  4L59 A;  2CKK A;  4PKC C;  2K3Y A;  3Q1J A;  1VQO A;  3LLR A;  3F70 A;  3OYA A;  2HBP A;  3CMA A;  2IVW A;  3VKI A;  3JCM c;  4RMO A;  1D3B B;  3A8O B;  2E41 A;  4FM4 B;  2GF7 A;  5GMK i;  1VQL A;  3HFN A;  5A0D A;  2AHJ B;  2CZ0 B;  3H6Z A;  1Y07 A;  4EMK C;  3BDU A;  2LTO A;  3HFO A;  4GLK A;  1WJR A;  5GMK h;  3L2W A;  3GP8 A;  2F5T X;  3JCM d;  1QVF S;  5CIU A;  4PJO A;  3RES A;  1VQ9 A;  4F7U G;  3CC2 A;  5GAN h;  3A8G B;  3RMQ A;  5KE2 A;  5GAO q;  2HQE A;  2P4T A;  2E12 A;  1XNI A;  4RG8 A;  1RL2 A;  2GQV A;  4MZT A;  4PNO A;  1K8A U;  4A53 A;  4M78 D;  4RKU E;  4N0A C;  3OQ5 A;  4A4H A;  4A4F A;  2M0O A;  2LQ8 A;  2L8D A;  4EMK B;  3CCV A;  3FLG A;  1YBY A;  3OYI A;  1WGS A;  5GAM j;  4OGC A;  2JOY A;  1VQ7 T;  1M1F A;  3MP1 A;  3QZ5 B;  3SD4 A;  3CCE A;  4YTL A;  1G3S A;  1W2B A;  2R5A A;  2VYT A;  2RJE A;  3QZ9 B;  4C5E A;  5DLO A;  2DIQ A;  3CC4 T;  3JCM P;  4HCB A;  4M7D C;  4MZP A;  2XDD A;  3G7Z A;  1M4Z A;  4E7I A;  4PL6 A;  4OB3 B;  1QW1 A;  4M75 B;  1Q82 C;  1QVF A;  1VQ8 A;  5GAO m;  3CCJ A;  4M77 B;  5J39 A;  2R57 A;  1H64 1;  2HQX A;  2ZPF B;  2O01 E;  4J8O A;  5LJ3 e;  2LT1 A;  4M7A G;  1AHJ B;  4HT9 A;  2ZPI B;  5GAM h;  4M78 F;  4A54 A;  2LX9 A;  5CKE A;  3LGF A;  4M7D D;  2PVO B;  1KG1 A;  4QVC A;  4KUD K;  3CCS T;  1KD1 C;  2RHZ A;  2K3X A;  3LGL A;  3OW2 S;  3JCM b;  1QP2 A;  2RI2 A;  2Y4X A;  2DD5 A;  1YIJ T;  5LJ5 h;  3OYL A;  4M78 E;  5D6Y A;  2MWO A;  3SWN C;  2MF2 A;  2PUO B;  4A4K A;  3NTH A;  3S3M A;  3CD6 A;  4TVR A;  4N4H A;  1WJS A;  3GLX A;  3OYE A;  1H3Z A;  2YHT A;  2KQW A;  3P8H A;  2DXU A;  3L2Q A;  3M56 A;  2WSC E;  3OS5 A;  2C06 A;  3FB9 A;  4C8Q G;  1ZHI A;  3S6W A;  3MEV A;  1X75 C;  4M7A D;  4C0D B;  1B34 A;  1V29 B;  4FT4 A;  5FRN A;  3MEW A;  4LDY A;  1VQN T;  3FDR A;  1YHQ T;  4QVD A;  3JCM h;  3VJP A;  1YI2 A;  2GFU A;  2RM4 A;  4LDU A;  2O4X A;  4PJO F;  2PVD B;  3SWN B;  4LDX A;  5CVI A;  1JJ2 S;  1YCY A;  4KUL A;  1PSF A;  5FRO A;  1VQ8 T;  3CCJ T;  3HKS A;  4L5G A;  4BY6 B;  2ZPE B;  3OYD A;  4JS4 A;  1K9M C;  1BI3 A;  2ZGW A;  2F5K A;  4IUV A;  4N4I A;  4HKE A;  1BI2 A;  4BD3 A;  4BI8 B;  1VIE A;  1VQ4 T;  3OMC A;  4EMH A;  4WF2 A;  3GIB A;  3LWH A;  3SDZ A;  4E7K A;  2MWP A;  2DVE A;  4IUP A;  4M7A F;  1BKB A;  2EJF A;  4XAX B;  3MET A;  4IUT A;  2M1H A;  4RCB A;  5EG2 A;  4N0A A;  3CCL T;  1Y96 A;  4M7D B;  2D6F A;  3DB4 A;  2VXE A;  4M7A C;  3URG A;  1VQM A;  4JUV A;  1Q82 U;  1KQS A;  2XK0 A;  1N8R C;  4QQD A;  3GNF B;  4XTW A;  1EIF A;  3HRU A;  5LJ5 d;  4X9D A;  1XOV A;  2F69 A;  4KT0 E;  4ZGE B;  2EYQ A;  4IUQ A;  1HXD A;  4V2S A;  2OTJ A;  3DKM A;  4C92 B;  2RK1 A;  2BUD A;  1QVG A;  4P5N A;  2B8A A;  4B9W A;  2FB7 A;  3H8Z A;  2JZ2 A;  4OGE A;  2X4J A;  4C8Q F;  2V8I A;  5DLQ E;  2K57 A;  3FJP A;  2WAC A;  3I55 T;  4FT2 A;  3M5A A;  4XQ3 A;  4XTU A;  5GAN 5;  3CCQ A;  1OI1 A;  4M78 G;  4XU1 A;  4MDX A;  1NJI U;  5A2Q E;  2LT4 A;  3N5B B;  3RKX A;  3JCM W;  2YLB A;  5CKD A;  2FHD A;  2DAQ A;  2H3J A;  4JLI A;  1U8R A;  2DIG A;  2LNV A;  3RKW A;  2RJC A;  3TCJ A;  3QYH B;  1KC8 U;  3CBO A;  4BB7 A;  5FU7 C;  4Z02 A;  1W4S A;  2E1H A;  2GFA A;  4Q5W A;  4XTZ A;  5CKB A;  4ELZ C;  4ZTJ A;  1QVG S;  3JCM Q;  2XU8 A;  3HP9 A;  1YJ9 A;  1O75 A;  4OP0 A;  2K5L A;  4FIB A;  4M78 C;  3LH0 A;  3GF5 A;  2K5I A;  4BDY A;  4X34 A;  3G4S A;  3LWI A;  5C6S A;  2X4Y A;  4QQ6 A;  2DZ9 A;  4KUI A;  2EAY A;  3KXT A;  1KQ1 A;  2K5F A;  2P0P A;  1G3Y A;  1I81 A;  3QBY A;  4PLL A;  4XTX A;  4BDZ A;  2D9T A;  3VUB A;  1N9S A;  2DZC A;  4MML A;  4F7U F;  5GAN 7;  1Q81 C;  5GMK l;  3M59 A;  2FYK A;  3A5Z B;  3PNW C;  3CXC S;  2QQ9 A;  2EQJ A;  4OF1 A;  3MCA B;  5D6W A;  2CZ1 B;  3CCM T;  4Y91 A;  4JRP A;  1M1G A;  1KC8 C;  2VUB A;  3M4G A;  4O5V A;  1WNL A;  1LNX A;  1KQS S;  1ZQ1 A;  5GAN g;  2R58 A;  4BY6 C;  3NFC A;  3HRT A;  3M58 A;  2XKO C;  5LJ3 g;  5GAN f;  1VQ9 T;  3S3N A;  4MDW A;  5IN1 A;  3G6E T;  4C92 F;  1Y71 A;  2QA4 T;  5M9O A;  3WVE B;  2EJG A;  5I21 A;  3FIF A;  1M1K U;  3JSC A;  2JTM A;  3RIR A;  5A0L A;  5KCO A;  2YRV A;  4C8Q B;  1BI1 A;  3QUI A;  5IT9 E;  1VQM T;  4IKF A;  2IG0 A;  3PIP A;  3OYM A;  3JB9 G;  5KCH A;  3WVD B;  2QXF A;  3MEA A;  4HCC A;  4M7A E;  4M75 F;  3CBM A;  3KUF A;  4R55 A;  3P8D A;  3P8B B;  1N27 A;  2E64 A;  4MZM A;  4UC4 A;  5LJ5 f;  3JCM X;  3OYK A;  1YJN A;  4ZN1 A;  1Q86 U;  1LOJ A;  2GCX A;  4M78 B;  5GAM e;  3CC7 T;  3OA6 A;  3UWN A;  3JCM V;  3INZ A;  4C8Q A;  1MHN A;  2KDS A;  3OYG A;  4QW2 A;  1TH7 A;  1VQ5 A;  2EQK A;  5LJ3 j;  3M54 A;  3CME T;  3X25 B;  3L2V A;  1KD1 U;  4ELY C;  2ZCF B;  4BI4 A;  2K4Y A;  4ZTF A;  3E19 A;  3JCM f;  3HPW A;  5A0G A;  4IUU A;  3G6E A;  2E65 A;  2KAF A;  2L3R A;  3OS1 A;  2QA4 A;  4ATO A;  1UGR B;  2LCL A;  4OB0 B;  3PIO A;  1MGQ A;  1Q81 U;  3O8V A;  2JN0 A;  3QJY A;  1VQK T;  4M7A A;  3QXE B;  1QVP A;  3RKY A;  4PJO B;  2VGM A;  3ZFJ A;  2EQM A;  2E5Q A;  1YHQ A;  4M78 A;  3UT1 A;  2ZPB B;  1YI2 T;  2RHX A;  2MI6 A;  1LJO A;  3M55 A;  3JCM J;  3C95 A;  1VQ7 A;  3OS2 A;  1UGQ B;  2FL7 A;  1BIB A;  2RI3 A;  1X6O A;  3VU3 C;  3M4Y A;  4E7H A;  3CC4 A;  3RER A;  1NPR A;  3FRN A;  4HA8 A;  4EPC A;  4J6W A;  5GAN 4;  2QEX T;  3HL8 A;  4M75 C;  4C92 D;  1M1K C;  2RA2 A;  1YIT A;  4JRI A;  4A4E A;  2QDY B;  3C4S A;  1M90 C;  4L6V 5;  3MP6 A;  1UEB A;  1I4K 1;  2RHI A;  2ZPH B;  3NTI A;  4XK8 E;  2DJZ A;  4QQG A;  3QO3 A;  3CPW S;  1G3W A;  2OAU A;  2EFI A;  2BIV A;  5GAM g;  5GAO p;  3CCS A;  4NOY A;  1K8A C;  3C94 A;  4M75 D;  4C92 C;  2L5Q A;  2I2L A;  4JRQ A;  2CZ7 B;  2CZ6 B;  3CXC A;  4BI3 A;  1OZ3 A;  3CPW A;  1G3T A;  2LQK A;  5D6X A;  5FU7 B;  3CD6 T;  3I56 A;  2O4X B;  2X35 A;  5L8R E;  2OTL A;  2QQR A;  3DLM A;  4OVA A;  1X01 A;  1VQ6 T;  1B34 B;  4PJO E;  3QYG B;  4M77 E;  3EAE A;  5LJ5 g;  3JRZ A;  2V8K A;  1DJ7 B;  3RUX A;  1KHI A;  2G3R A;  5GAN 3;  2OTJ T;  4CI0 C;  2EJ9 A;  2XIC A;  5CQX A;  3CPF A;  4XTY A;  2PU9 B;  1RI0 A;  2VC8 A;  3ER0 A;  3CMA T;  4M7D G;  5GAN 6;  3T9N A;  5HK3 A;  2M9U A;  4B9X A;  1JBM A;  1OZ2 A;  1NPP A;  4J83 A;  3VYG A;  1NJI C;  3OYF A;  3NTK A;  1D3B A;  4ZGD B;  1YJW T;  3V7S A;  1HK9 A;  2V8J A;  3V7C A;  3J80 E;  3A8H B;  2EWN A;  3CCL A;  5I2S A;  5J26 A;  1M9S A;  4JRK A;  3OSV A;  2LRQ A;  2MAM A;  3CC2 T;  2JTF A;  5CQY A;  1WJQ A;  4OB2 B;  3RMS A;  3MHX A;  5GAO r;  1I8F A;  1QP3 A;  4M7A B;  4C0Z A;  3I56 T;  5GAN e;  5CCA A;  3QII A;  4MMK A;  4J7I A;  4C0D C;  5CKH A;  3GPL A;  5GAO n;  2DKG A;  3BFM A;  4JLG A;  5CK9 A;  1UGP B;  4EMK A;  2HNI A;  4XU2 A;  3TRE A;  4C8Q C;  4M77 F;  5GMK e;  3OW2 A;  2CS7 A;  5IAY A;  1Q7Y U;  3PMI A;  3OMG A;  3QJ6 A;  3OYJ A;  1S72 T;  2X4X A;  4Y28 E;  5GAN 2;  4C5H A;  1K73 C;  3CCR A;  3CCU A;  2RH2 A;  3V8L A;  4J6X A;  1BIA A;  2XD0 A;  3OYY A;  1KHC A;  2EKO A;  4C8Q D;  2QI2 A;  5LJ5 e;  3AHU A;  3GNG A;  4DOW A;  3I55 A;  1G5V A;  3X20 B;  4EMG A;  1M5Q 1;  3BY7 A;  4FU6 A;  4DQ2 A;  5CR2 A;  3PTA A;  4M75 E;  4XU3 A;  4BE2 A;  2A3L A;  2DTO A;  3QG1 A;  4ZN3 A;  5AYF A;  1N8R U;  3HRS A;  3MEU A;  3HHT B;  3V8K A;  3UPU A;  4JJN K;  3V7R A;  2P0K A;  4F7U A;  1Y7X A;  4PJO G;  2A7Y A;  4M77 G;  5LJ3 h;  3JB9 H;  2JVV A;  4M75 A;  1NE8 A;  5HK0 A;  1XTD A;  2VV5 A;  4C92 E;  2E70 A;  3M53 A;  4LD9 K;  4PJO D;  1YJ9 T;  1M90 U;  3MO8 A;  1Y96 B;  3E9F A;  3M57 A;  4KBM B;  3X24 B;  1K9M U;  2KY9 A;  1PSE A;  4QVZ A;  1I5L A;  1VQ6 A;  4BUG A;  3L2R A;  2D0Q B;  2DD4 A;  3KBG A;  1YJN T;  4IUR A;  3E1S A;  5GAN 8;  3L2U A;  1KQ2 A;  3ME9 A;  3FEO A;  3LW5 E;  4DOV A;  1WQW A;  4OMF B;  3R6O A;  5I2M A;  3VV0 A;  3CCU T;  4PJO C;  4FL6 A;  4M77 C;  2RJF A;  2LVM A;  5KE3 A;  1VQ5 T;  1N6A A;  3JCM g;  3J7A F;  2MMP A;  2QQA A;  3VYH B;  2QQB A;  3JB9 J;  2DTH A;  1JJ2 A;  2RHY A;  1O9S A;  2XHC A;  2Y90 A;  2RI5 A;  5HY6 A;  5LJ3 f;  2PVG B;  2L89 A;  3E9G A;  3PMT A;  2RO0 A;  5GAN d;  3C12 A;  3L1A A;  3MP8 A;  3SWN A;  4C0F A;  3QDR B;  2VXF A;  2E10 A;  4NL3 A;  2NLU A;  3OYC A;  2BKD N;  4VUB A;  4JS5 A;  3DB3 A;  2CYZ B;  2RB6 A;  2DXT A;  3OS0 A;  5GAO l;  2PQW A;  1N9R A;  1GXI E;  5DY9 A;  4BE1 A;  3VUZ A;  2PUK B;  2KMT A;  2QTX A;  3EFR A;  5GAM f;  2DEQ A;  5LJ3 d;  1VIF A;  4PLI A;  1SSF A;  5C0M A;  1VQP T;  5CO7 A;  3HSB A;  3TEE A;  3ZEH A;  4II1 A;  2XI9 A;  3OYH A;  4E7J A;  4RCC A;  1VQN A;  2DXB A;  1VQO T;  2RD1 A;  1S72 A;  3GOX A;  2K2V A;  3QSU A;  4M7D F;  1Q7Y C;  1IRE B;  4HT8 A;  1M8V A;  3JAM E;  4C8Q E;  3CCR T;  2RK2 A;  1BYM A;  5LJ5 j;  4M75 G;  1K73 U;  3CCQ T;  4NL2 A;  1VQL T;  1FXX A;  3OBW A;  4M77 A;  1Q86 C;  2XDP A;  5HKC A;  1VQ4 A;  5J3B A;  3JB9 F;  3LX7 A;  3X26 B;  4D6W A;  2ZPG B;  3CME A;  4R56 A;  3M9Q A;  4DA4 A;  3S3O A;  2LC4 A;  5GAN j;  1BI0 A;  2DK3 A;  2KVQ G;  2ZZD A;  3G71 T;  5FU6 B;  4C5G A;  4C92 G;  4FSX A;  3SFM A;  3V8J A;  3JCM e;  2HAX A;  4NS5 A;  4LDV A;  3OYN A;  4GY5 A;  4C92 A;  4E7L A;  2E6N A;  2OTL T;  2HD0 A;  3FC3 A;  2X4W A;  4C5I A;  3J81 E;  4M7D E;  2VGN A;  1VQK A;  2EIF A;  2R5M A;  3OYB A;  4F7U E;  3A8M B;  3CCV T;  3CEY A;  1R8O B;  1VQP A;  4RG2 A;  4F7U B;  4J6Y A;  3TU4 K;  3EFS A;  1VUB A;  2EQU A;  3ZBD A;  3PGG A;  4N4G A;  3OBY A;  4ZGJ B;  2JUF A;  3QKJ A;  5FLX E;  5FU6 C;  4BE0 A;  4XTV A;  1WQ7 A;  1UGS B;  2Y4Y A;  3A8L B;  4M77 D;  1UB4 A;  1ZBX A;  4LD6 A;  4O6J A;  5CKF A;  3JB9 I;  2WSE E;  2CGH A;  3BDL A;  3DLL A;  3OSS C;  3CCM A;  2JNG A;  1OYX A;  5GMK m;  1YJW A;  2XDB A;  2DPP B;  4X9C A;  1W2B S;  4J5Y A;  3LYI A;  3UDC A;  4E47 A;  1IZ6 A;  5GMK j;  2QEX A;  3WXM B;  4CRI A;  1YIT T;  1XQH A;  3X28 B;  4J7F A;  3SB2 A;  2E6Z A;  2DXC A;  1YIJ A;  3G71 A;  2KSS A;  2XID A;  2FVU A;  4A4G A;  3CBP A;  1FX7 A;  4XU0 A;  3L42 A;  5DM7 R;  3PT9 A;  5CAI A;  4HCZ A;  3L2Z A;  5FRM A;  4C0G A;  4JDS A;  3OY9 A;  4ME7 A;  2RJD A;  4LDW A;  3BW1 A;  3ASK A;  2P0Q A;  4EDU A;  1WPY A;  2M16 A;  3QPH A;  3CCE T;  4M7D A;  2WSF E;  1FWZ A;  1JRI A;  4BAC A;  3G4S T;  1JB0 E;  2YLC A;  5KH6 A;  2XG8 D;  2KK4 A;  2LCC A;  4OB1 B;  1U1S A;  1U1T A;  3OB9 A;  2DTI A;  3JB9 D;  2DO3 A;  1NZ9 A;  3QHS A;  5GAM d;  5LL6 S;  2QQS A;  3PFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...