5IAYA

Nmr structure of uhrf1 tandem tudor domains in a complex with spacer peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
152
structure length
152
Chain Sequence
LYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Hemi-methylated DNA opens a closed conformation of UHRF1 to facilitate its histone recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 13
structure length 152
sequence length 152
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5iayA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5iayA01
2RI3A 1QVGS 3P8DA 1EIFA 1QVFA 2FHDA 1M90U 1NPPA 2O4XB 4NS5A 3CD6T 1KQSS 1Q81C 1K8AU 3FC3A 4PL6A 2XDPA 1KD1C 2RHXA 3PIOA 1YJ9A 1JJ2A 3CMEA 2RJDA 3META 5IAYA 3TREA 2EQJA 3CCUA 3CCJA 3L2QA 1M1KC 3OYCA 4HCZA 2JVVA 1VQ5T 1RL2A 3PMIA 3ASKA 2MWOA 3FLGA 4BDZA 3CCLT 3MEUA 1K73U 1BKBA 5J39A 1RI0A 2RJFA 4C5GA 1YJWT 3PMTA 2OTJT 2LRQA 3LLRA 5LL6S 2EQKA 2EQMA 3G6EA 3FDRA 2VYTA 4IUTA 2IG0A 3I56T 3FEOA 2DIGA 4BD3A 5M9OA 1N8RU 3BDLA 3CCMA 3CPWS 1VQMT 3MP8A 1VQPA 3L2UA 2K3XA 2GFAA 2LTOA 5KCHA 1Q82C 3PFSA 2JNGA 3MEWA 3G6ET 3KBGA 4GY5A 2BIVA 3OYLA 1WJQA 5FLXE 5FRMA 2RJEA 3OYFA 3CC4T 2RO0A 1VQ7A 4QQGA 3OS0A 2EIFA 1Q7YC 5J3BA 2EKOA 5D6WA 3OQ5A 3S3NA 5A2QE 1YHQT 2X4XA 3LH0A 1YI2A 3MP1A 4ZN1A 1Q81U 2MWPA 2MI6A 2GFUA 3CD6A 2L89A 4C5EA 4QVZA 2LQ8A 4LD6A 5IT9E 2NLUA 1W2BS 2BKDN 3EAEA 4ZN3A 1KC8C 5IN1A 1OI1A 3OYIA 2LDMA 1VQ4T 2EFIA 1M1KU 2M16A 1X6OA 4E7LA 1K9MC 5FROA 3L2WA 4A4EA 2OTLA 3L42A 1VQ5A 4BE1A 3OYEA 3CXCA 3CCLA 3CCQT 1SSFA 2GF7A 4II1A 5D6XA 2M1HA 1YJWA 3PNWC 5D6YA 2OTJA 3OW2S 1N27A 3CC7T 1Q86C 1VQKT 4TVRA 3OYYA 3LX7A 3NTKA 3S6WA 4B9WA 1YITT 1VQNT 2OTLT 2KDSA 1KQSA 3I56A 3J7AF 3MEVA 4A4GA 1Q82U 1VQ6T 5DM7R 2E5QA 2RHYA 1VQMA 1VQLT 3QJ6A 2BUDA 4BE0A 3M9QA 2L3RA 2QQRA 3G71T 3HKSA 1G5VA 1OZ3A 4N4HA 2G3RA 1Q7YU 1WGSA 3G4ST 3CC4A 2JOYA 2L8DA 1VQ8T 3CCET 3DLLA 2O4XA 2JZ2A 2X4WA 1VQOT 3OYHA 1YIJT 3CCST 1OZ2A 1YHQA 4IURA 1VQ9T 4Z02A 2LCLA 3OYKA 4BE2A 3NTHA 3OS1A 3CC2T 3L2RA 3S3OA 2RI5A 4FL6A 1IZ6A 2XHCA 4E7KA 2R5MA 3CPWA 1KC8U 2R57A 3KUFA 4BACA 3ME9A 4CRIA 3CPFA 2QA4T 3OYNA 2E6ZA 4YTLA 1K9MU 2B8AA 4ZTFA 2RHUA 2RHZA 3L2VA 1VQ4A 3H6ZA 1S72T 3CCVT 4N4GA 3OY9A 4Q5WA 5FRNA 3LGLA 3OMCA 2WACA 4N4IA 4A4FA 2X35A 2QEXT 1QVFS 4QW2A 3I55T 3LYIA 3PIPA 4IUPA 1OYXA 3E9GA 4A4HA 3S3MA 3CCQA 4IUQA 1MHNA 3OYDA 1Q86U 5C0MA 3DB4A 3JAME 3O8VA 3CC7A 1NJIU 3C4SA 1YBYA 1JJ2S 1VQKA 1YITA 1VQNA 2JTFA 1H3ZA 3P8BB 1WJRA 4IKFA 1VQ6A 1XTDA 2KVQG 1VQLA 2LVMA 1YJNT 1W2BA 3Q1JA 3CCRT 2PQWA 3G71A 1QVGA 4PLLA 3MP6A 2RI2A 4E7JA 3QKJA 2R58A 1WJSA 2HQEA 5KH6A 4QQ6A 1NJIC 3CMAT 3OYBA 3G4SA 4EDUA 1KHIA 3CCEA 1VQ8A 2DAQA 1VQOA 2P0KA 3OMGA 1YIJA 1M90C 3CCSA 2LCCA 3UWNA 2E70A 3ER0A 3OW2A 1VQ9A 4BDYA 1YJ9T 1K8AC 5KE2A 4IUVA 3H8ZA 3CMET 3ZEHA 3CC2A 3A5ZB 3DLMA 1KHCA 2RJCA 4OVAA 4C5HA 3OYMA 4PLIA 3LGFA 3OB9A 3CCUT 5KCOA 3CCJT 4RG2A 2QA4A 4FU6A 3E9FA 3QIIA 2D9TA 4L59A 3J80E 1S72A 2CKKA 3CCVA 1K73C 2YRVA 2M0OA 4B9XA 3DB3A 3QBYA 2DIQA 2DO3A 3J81E 2EQUA 2QEXA 5DLQE 3I55A 4C5IA 4E7IA 3CCMT 1VQPT 4E7HA 5C6SA 5HY6A 4UC4A 1N8RC 3OYJA 3CEYA 2E6NA 3UT1A 5KE3A 1XNIA 2QQSA 1VQ7T 1UEBA 1M1GA 5CIUA 2XK0A 3MEAA 3MO8A 4X34A 4ZTJA 3GOXA 3NTIA 3F70A 3OS2A 2X4YA 1YJNA 1NZ9A 1KD1U 3CCRA 2R5AA 3CXCS 3SD4A 4QQDA 2JUFA 2F5KA 2RHIA 1NPRA 5J26A 4IUUA 1YI2T 2K3YA 3P8HA 3OYGA 2HQXA 3OA6A 3CMAA 3OYAA
chains in the Genus database with same CATH superfamily
1JXOA 3CBPA 3CD6T 1KQSS 3QJYA 1T3LA 3M5AA 2OAUA 5LJ3e 2H3JA 2O31A 2MK5A 4M7DD 2V8JA 1D0YA 4DBQA 3PTAA 1KD1C 2WSFE 3PIOA 4PFPA 2C0OA 1VQ7Q 1OV3A 1TXQA 2XICA 2HD0A 1SRLA 5HK3A 1CSKA 2EQJA 3CCJA 2ESWA 3I5RA 1UUEA 3OSSC 1VQ5T 3ASKA 2MWOA 4F04B 3WVDB 4M75D 4KT0E 4BI8B 1VIEA 3LH5A 5GAN4 3PMTA 4A53A 5FWBA 2HAXA 3LLRA 4J9DA 2PU9B 2EQKA 2EQMA 2YUOA 5GMKm 1UHFA 2IG0A 3I56T 1KG1A 2XI9A 4E7ZA 1TSFA 2MPXC 3M57A 5M9OA 2D6FA 3BDLA 3JCMX 1VQPA 2HEQA 1NM7A 3L2UA 2K3XA 2DTIA 4AG2C 5CK9A 5LJ5j 2GTJA 2K2VA 3KXTA 3HTRA 2ZPIB 1H8KA 1UJYA 2K5LA 2FPEA 1OU8A 1WJQA 3JCMJ 5FRMA 2RJEA 1BI1A 2YUNA 3OYFA 2FYKA 1VQNQ 3GLXA 4BB7A 2O01E 3M0SA 2M9UA 2IVWA 4KH0B 3VS2A 2EIFA 3ULRB 2CDTA 4M77A 5J3BA 3RKWA 2KT8A 3S3NA 5A2QE 4M75B 2QGGA 1YHQT 3QYHB 1D1AA 2QI2A 4OMMA 4EPCA 4ME7A 2AHJB 3V8LA 1QVPA 5GAOr 2DL4A 1M1KR 4M77F 2COYA 2GFUA 1U5SA 2OI3A 2YDLA 1NYGA 4HA8A 2YWWA 4VUBA 2BKDN 4M77C 2CYZB 1OI1A 1EX4A 2LDMA 1VQ4T 1M1KU 4HVUA 4M78G 1UGRB 2K57A 1YWPA 2ZGWA 1XJWB 2DJQA 3L2WA 2Y4YA 2SEMA 4LE9A 5I2SA 2W0ZA 1X01A 4AFQC 3JB9H 1UE9A 2FPFA 3EGXB 3EFOB 3EG9A 1YJWA 2ZPEB 3VS7A 1YCYA 5CKEA 2CP0A 3CC7T 3FRNA 3CCVQ 2Y4XA 3VS5A 1I0CA 4TVRA 1YITT 4JZ3A 3SEMA 4ZNXA 3MEVA 1OQKA 2CH4A 1BIAA 1V29B 4WCIA 1MUZA 3I55Q 4M77E 2CP2A 3M9QA 3A8GB 2L3RA 4X1VA 3G71T 2COWA 3HKSA 4J9CA 2X9HA 5GMKi 2LP5A 2CP5A 4DA4A 2A37A 2XKOC 4JJDA 1T0HA 1WGSA 2DPPB 2E10A 3CCET 1RACB 2O4XA 2DERA 4RKUE 1D3BB 3OYHA 5FW9A 1N6AA 2O9VA 2RMOA 1KC8R 5CQXA 3CCST 4A63B 1E7OA 2YXYA 3X25B 1X6BA 3JCMb 3OS5A 2F2VA 4JJBA 1AD5A 2JW4A 4JRQA 5KYWA 3OS1A 3CC2T 3JB9I 3UA6A 3L2RA 1K9MR 3LWIA 2K5FA 3QHSA 1IZ6A 1MV0B 3THKA 1TS9A 3CPWA 1KC8U 1GFCA 1VUBA 3LWHA 4BACA 3G71Q 3ME9A 1IGUA 4CRIA 4KUIA 1GCPA 1U06A 4PJOA 5CCAA 4RTTA 4YTLA 1K9MU 3I35A 4EMGA 3RESA 1ZBJA 1YJ9Q 1SEMA 1S72T 3CMEQ 1WHJA 1WYXA 2W10A 4DOVA 3LGLA 1YWOA 3OMCA 4C8QG 5LJ5g 4A4FA 4M7AG 1SHGA 2X35A 1TUDA 4J9HA 1KQSP 3CCSQ 3BE3A 2XDDA 4IUPA 2HCKA 1OYXA 2A08A 3S3MA 1D1BA 3FIFA 5C0MA 3CC2Q 2QDLA 2D8JA 3DB4A 1IB8A 4PJLA 4QVDA 3C4SA 1VQNA 1Z9QA 2DD4A 2JTFA 4IKFA 4FYWB 2LZ6B 1EZZB 1HSQA 2DLPA 4M78F 4PKCC 2LVMA 1FYNA 2Z0WA 2D1XA 5CVIA 2RI2A 1BBZA 2V1RA 5LJ5d 4M78C 1B3QA 1UGPB 4EMKA 2HQEA 4QKUA 4DEXA 3OYBA 2HNIA 1RADB 1ZSZC 1QLYA 3UATA 4ESRA 5FU6C 1M2VA 2P0KA 4FIBA 3OMGA 2EYQA 2F5TX 1Y7XA 4XU2A 2LCCA 2AKLA 3JRZA 3UWNA 3QUIA 4BY6C 4PJOE 3ER0A 1R0BG 3OW2A 4C92A 2KEAA 1UHCA 2YLCA 1YI2Q 4GLMA 3ZEHA 3H9NA 1E6HA 5KCOA 3CCJT 4RG2A 3BFMA 2DRMA 4DOWA 1HD3A 1UGVA 2CS7A 3REAB 3VV0A 4C92F 1X6GA 1VYUA 5GAMf 2KR3A 4N0AA 4LN2A 3CBOA 2CREA 2J6KA 3E9FA 3QIIA 2X3WD 3J80E 1Y07A 4B6MA 4M78B 2V1QA 1LNXA 3CCVA 2KGTA 4C92C 2YRVA 3VS1A 5LJ5e 1NG2A 2XMFA 3QZ5B 5I2MA 1EFNA 4KRTA 1AWJA 2CH4W 4AT1B 2VXFA 1ZSZB 5FU6B 3I55A 4RUGA 4WF2A 2BTTA 2HSEB 1TWBA 2DK3A 1VQPT 1Y0MA 1FMVA 2QQAA 3CCLQ 4BY6B 2ZPHB 5C6SA 4UC4A 5HY6A 1BU1A 5GMKl 2X4JA 4OB0B 1J3TA 4LDWA 4N0AC 2E6NA 5EC7A 1QVGP 1WHHA 1NJIR 1RAFB 3C0CA 1M27C 2QQSA 3RKXA 4DBRA 3TU4K 3RKYA 5GAN5 2JM8A 2XK0A 1LJOA 3MEAA 3GOXA 2VKNA 1PSEA 3NTIA 2P0PA 3F70A 4PJMA 1M90R 4R0KA 1K0XA 1VQMQ 4OF1A 4C92E 1AZEA 4QQDA 2DE0X 2F5KA 2RHIA 4Z89A 1HYOA 2K3YA 3VU3C 4NOYA 1R0CB 4FM4B 3OA6A 1Y57A 1VYTA 2RB6A 4C8QD 2FPDA 3SWNA 3P8DA 4M7AD 1M90U 4M7AC 1GBRA 1NPPA 3R6NA 4J9FA 2K7AA 3ZBDA 2PVGB 2F1LA 9ATCB 2M51A 3FB9A 3PT9A 4PL6A 3FC3A 1MNEA 4HT9A 1YJ9A 3INZA 2KYBA 4MZPA 1K73R 3GNFB 2AZVA 3HFNA 3CMEA 2RJDA 3OBYA 1G3WA 2FZKB 1SRMA 5GAMd 4JLIA 1QQJA 2O9SA 3NFCA 3G1JA 5IHIA 3NHNA 1M1KC 3OYCA 3GF5A 2KT1A 1RL2A 3FLGA 5L23A 2ROLA 1QWFA 2GCXA 2L2PA 3MEUA 1K73U 1N8RR 1QKXA 3VRYA 1RI0A 4KBMB 1YJWT 4EIKA 3SHWA 3V7SA 5GAN8 3VS0A 2A0FB 1IREB 4HVVA 2NUPB 3G6EA 1WHKA 1U8RA 2DL3A 2GGRA 4CC2A 2EJFA 2DIGA 4M7AB 1PHTA 4OMQA 1M1FA 1N8RU 1MMGA 3JB9J 2QTXA 2LTOA 1B34A 5KCHA 2JNGA 4R55A 3VUBA 3MEWA 2JS0A 4CC4B 2MF2A 4GY5A 4PNOA 1VQKQ 2HKQB 4HCKA 2JTMA 1QW1A 1KJWA 3A8HB 2FG0A 1Q81R 3OS0A 4HT8A 2DZCA 3MHXA 3O5ZA 3RMSA 4M77G 2EKOA 3QO3A 4FW1A 3OQ5A 3BY7A 1IO6A 2DRKA 1WIEA 1TH7A 4J6YA 4WTOB 3LH0A 1YI2A 3GBQA 1SSHA 1Q81U 2XG8D 1O9SA 2K79A 2KXDA 2MI6A 3G4SQ 4J5YA 4OP0A 3REBB 2DBMA 1VQ8Q 1JXMA 2L3QA 1BCMA 4QVZA 2LX9A 5GAN7 2VWFA 2ABLA 2NLUA 2LX7A 4AFUC 3EAEA 1KC8C 4JS4A 1VQ9Q 1BIBA 2DL7A 2EFIA 1PKSA 4M7DA 1X6OA 1UB4A 2E4HA 1PM3A 1K9MC 5KYUB 4FW2A 5GAOq 1GXIE 2K9GA 5A0GA 3R6OA 2OTLA 1U3OA 3EGDB 3TEEA 4BE1A 4J8OA 4FYYB 2KY9A 3OYEA 2DZ9A 3CCLA 1WDXA 2D0NA 3H41A 1SSFA 5D6XA 1LVKA 5IXFA 4X9CA 4XTZA 4JS5A 5I21A 4J9EA 5CO7A 3LX7A 3EHRA 1VQNT 1M5Q1 1KQSA 1OX9A 3J7AF 1HJDA 2DA9A 3HRTA 3PE0A 5DM7R 1GRIA 1VQMA 3VS3A 1RAHB 3QJ6A 2BUDA 1OX8A 2QASA 2EVRA 4NL3A 4PFOA 2RN8A 1NYFA 4N4HA 2G3RA 3JSCA 2CP6A 1JU5C 1AVZC 2DL8A 2JOYA 5AT1B 3DLLA 1RAEB 2RA2A 3HRSA 2DILA 1W4SA 2RF0A 2PZ1A 3M0RA 5GAOp 1W1FA 2ZCFB 3ZL7C 1X2KA 2A7YA 4JJCA 2DEUA 4KULA 2LCLA 3OYKA 1LPLA 4BE2A 4M7DE 1VIFA 3MJXA 4AFSC 5GMKj 3S3OA 2NUZA 3JB9F 3CMAQ 4FL6A 2KSSA 2R5MA 4ATOA 2HQHA 2QGFB 1TU0B 4XU0A 1T3SA 1MV3A 3L2ZA 3FJ5A 3HRUA 3OYNA 2PVDB 1FMWA 4MDXA 4PJOG 1TOVA 2B8AA 1FMKA 4XK8E 3CCVT 1V76A 2PUOB 2KE9A 4A54A 5FRNA 2EYZA 4HCCA 2WACA 5GANh 3CCUQ 2RQWA 4OGEA 1QVFS 3I55T 4M77D 3PIPA 1MMNA 2RH2A 4A4HA 4IUQA 2DBKA 3M59A 2A36A 1SPKA 5CQYA 4D8DA 2KBTA 2L3PA 1PC0A 3M0UA 2DTHA 2FRYA 3WXMB 4OB1B 1JJ2S 1VQKA 2DD5A 1WHMA 2I2LA 2KMTA 1G8XA 3QSUA 1H3ZA 1K76A 2FZGB 2L5QA 4KUDK 5KYXA 4LNPA 1QCOA 3GNGA 1WHLA 2ZZDA 4K11A 1VQLA 3Q1JA 2DNUA 2PQWA 3HPWA 1QVGA 3RIRA 4C0DC 2YT6A 3QYGB 1NLOC 1WHGA 3VRZA 2ZPFB 2EQIA 1TUCA 2R58A 4XU3A 1NJIC 3GPLA 4PJJA 4RTZA 3G4SA 4EDUA 2DM1A 2ED0A 1VQ8A 2KRSA 1PRLC 2DXUA 2LJ0A 4M77B 5HKCA 5CKFA 1M90C 2BE7D 4Z8AA 3RR6A 2QDYB 3V8JA 1OEBA 1VQ9A 4C92G 1LCKA 1YJ9T 1OPKA 3AT1B 1YFNA 3H8ZA 3CMET 4C0GA 3A5ZB 4MMLA 1RUWA 5LJ5f 4PLIA 1N9RA 3JCMV 4HVWA 1BB9A 2WSCE 1VYVA 1SF9A 2KRMA 4E6RA 1RLQC 1LOJA 1TTHB 4V2SA 4J9IA 3SFMA 1K0SA 2A28A 4L59A 4RTUA 2VVKA 1K73C 2M0OA 3DB3A 2DIQA 3EG1A 2DO3A 2EYXA 3J81E 2QEXA 2C0IA 4E7IA 3TSZA 4E7HA 2EYWA 1QWEA 2EAYA 2K2MA 3EG9B 1NBEB 1N8RC 3ZFJA 1P92A 1WXTA 2OTJQ 2ED1A 2AK5A 2RD1A 2GQVA 4JDSA 1AEYA 1XNIA 1JBMA 5I11A 3E19A 2CZ1B 4PJOF 2KRNA 4JRPA 2GNCA 4BI3A 3MO8A 1G3TA 3A8LB 1R77A 3WVEB 2X4YA 1YJNA 1M30A 4RTVA 3T9NA 1KD1U 2R5AA 1NLPC 4PJOC 2E1HA 1M3CA 3CXCS 3SD4A 2CZ0B 1NPRA 5J26A 3G6EQ 2JS2A 1Q95G 1YI2T 3V7RA 3OYGA 2CZ7B 2HQXA 1C1AA 3CMAA 2RI3A 2GBQA 3CC4Q 1EIFA 1BCOA 1M3AA 2P4TA 1MGQA 2O4XB 2P0QA 4J7FA 1Q81C 3H0FA 2DX1A 4MMKA 3N5BB 1UTIA 5FU7C 4M78D 2ECZA 2XDPA 2LQWA 1XOVA 5KYWB 2SRCA 3META 5IAYA 1UDLA 2QYZA 3CCUA 1KIKA 2QAZA 4MZMA 3EG2A 3X20B 1U1TA 3HP9A 2VXEA 3CCLT 1BKBA 4OMLA 5J39A 1GL5A 4PJOB 3JV3A 2RJFA 4C5GA 3NMZC 2WSEE 4EMKC 5GANj 2RK1A 5LL6S 2JTEA 3FDRA 5KYYA 7AT1B 4FT2A 3M54A 1I5LA 2DVEA 3UDCA 2YRCA 2ROTA 1VQMT 5FU7B 1X2QA 1QKWA 1F1BB 1GCQA 3CCQQ 2E12A 3PFSA 4C92D 3OBWA 5AYFA 2NUTA 1WQWA 2L3SA 3GIBA 5FLXE 1ZLMA 3MPUB 2RQUA 2OTLQ 4QQGA 1WI7A 1IGQA 5GAN2 4DEYA 3M53A 2HSPA 5GMKe 1VQ6Q 1QVFP 2LQKA 4HKEA 1RABB 4XTUA 4P5NA 1WA7A 3LW5E 4OMNA 2CUBA 2LT1A 2E5KA 4CC7A 2X4XA 3EGUA 1ZSGA 3MP1A 4JZ4A 1OOTA 2CP3A 4ZGEB 2BZXA 1ZUYA 4EMKB 2KQWA 4AMCA 2MWPA 4JUVA 1JJ2P 3DKMA 2HL5C 2A3LA 2J7IA 1K1ZA 1M2VB 4IIMA 1VQOQ 4C8QA 1PWTA 4LXCA 4C5EA 1YIJQ 2ATCB 2X51A 4KGXB 2DFUA 1W2BS 2MOXA 2PUKB 4ZN3A 4C92B 5IN1A 5GJVB 3D7SB 5A0DA 3M0TA 1YP5A 4M7DG 4F7UA 4O6JA 4PK4A 1YCSB 2AKKA 3VS6A 1IXDA 1M8VA 1PG5B 3RBBB 2ZPBB 2DEQA 1JEGA 5L8RE 4E47A 1Q82R 1H92A 4OMFB 4X9DA 4II1A 4F7UF 4HXJA 4JRIA 2QQ9A 5D6YA 2OTJA 3H0HA 2X3XD 1R8OB 2H3EB 2HBPA 1VQKT 4B9WA 2YRDA 4J9GA 2RK2A 3SWNC 2KDSA 4XQ3A 1RAIB 1QCNA 3JCMP 1Q82U 4QVCA 1Q7YR 1BI3A 2E5QA 2EGAA 1VQLT 2EGEA 3V8KA 4BE0A 4RTXA 5GANf 2HZYA 2KAFA 1W70A 2GTOA 4XTWA 3TCJA 4L6V5 2FZCB 3X24B 2DKGA 5GAN6 2LMJA 2COZA 3HSBA 3M4YA 4ANJA 1Q7YU 3G4ST 3CC4A 2O2OA 4KGZB 1K9AA 2LT4A 2L8DA 1VQ8T 2QTVA 1WQ7A 3JB9G 2X4WA 4F17A 4C8QE 1NEGA 1VOMA 1FX7A 1VA7A 2VV5A 2OX7A 1OZ2A 4IURA 3MKDA 1VQ9T 4Z02A 2K4YA 1ZUKA 4F7UE 1CKBA 3HFOA 2HL3A 3QWXX 5GAOm 3SWNB 1WX6A 1VQLQ 1D1CA 2CZ6B 5IHKA 4OMOA 1UJ0A 2KROA 3KUFA 4AG1C 4FYVB 3X28B 5GANg 1M2OA 3M0PA 1D0XA 3CPFA 3M56A 4JLGA 1I5OB 3CXCP 4ZGJB 3A98A 2RHUA 2RHZA 2EPDA 3L2VA 6AT1B 4LDXA 1Q86R 1A0NB 3I5SA 1GFDA 2C06A 1Z9ZA 3I9QA 3M58A 1Y96A 1G2BA 4LDVA 4N4IA 2QEXT 4LD9K 4FYXB 4QW2A 2EJ9A 1B07A 2CP7A 3LYIA 1ZBXA 4C0ZA 4XTVA 2LCSA 2LQNA 2ZAEA 3CCQA 1Q86U 4E2FB 1QP2A 2HMAA 2AZSA 3RUXA 3JAME 5EG2A 1PD1A 3PVLA 2YSQA 2F2WA 1V1CA 1FXXA 2YUPA 3RMQA 5GANd 1ABOA 1WJRA 2CSIA 3V7CA 1Y71A 1VQ6A 5IHNA 5GAMh 4M7DF 1XTDA 2PTKA 3CCMQ 5GAOn 1YJNT 3VKIA 2D8HA 2DMOA 1B34B 2MMPA 4M75A 3QDRB 4MDWA 2D0QB 2LJ3A 3EHQA 2F2XA 3MP6A 4PJNA 2ZPGB 4M7DC 2M0YA 3QKJA 1RI9A 1WJSA 2QEXQ 3CMAT 3JCMQ 1AHJB 1VQOA 4M75F 3JCMh 4LDUA 1UGSB 1YIJA 1D0ZA 4Y91A 2MCNA 2YLBA 3UA7A 2J06A 2E70A 2K6DA 1ABQA 4BDYA 3EH1A 4M75C 1MNDA 1MMDA 2E41A 1BYMA 3DLMA 1O75A 4C5HA 2EBPA 2JMAA 4ELYC 1QCFA 3OB9A 3CCUT 4ELZC 1YJNQ 5GANe 3CD6Q 1Y96B 5LJ3h 1SG5A 4CI0C 2QA4A 4FU6A 4ZGDB 2DXBA 3EGXA 3URGA 1AT1B 3EFOA 2VB6A 1BI0A 4M7DB 1BI2A 4B9XA 3QBYA 1AZGB 2EJGA 2FB7A 2MYSA 3E2UA 3JB9D 2EQUA 2JXBA 4C5IA 2GQIA 1VQ5Q 3HL8A 4GBQA 4AFZC 4CC3A 1KK7A 4M75E 1W2BP 3OYJA 3CEYA 1M3BA 8AT1B 1UG1A 2QXFA 3KFVA 3BDUA 2RNAA 2ENMA 1M8MA 2AIRB 2G6FX 4RCCA 4D8KA 4J6WA 4XTXA 3I56Q 4X34A 2KXCA 1D3BA 5GAN3 2JT4A 8ATCB 3CCRA 1WXBA 1K8AR 2FRWA 1DJ7B 2B86A 1B7TA 2JUFA 1RAAB 4IUUA 1NEBA 3P8HA 4BI4A 2IPOB 2O88A 2XDBA 2KK4A 2KYMA 3QPHA 1WNLA 3OYAA 1QVGS 5FWCA 4RCBA 2FHDA 1QVFA 2HKNA 2L0AA 4NS5A 2EW3A 5DY9A 1K8AU 3HHTB 1QMCA 4RG8A 1D09B 1YHQQ 2RHXA 2Y90A 1RLPC 1OULA 1JJ2A 2XIDA 2P84A 2MIOA 1G3YA 2JMCA 5I22A 2HDAA 3TREA 2CGHA 3L2QA 4HCZA 2JVVA 2CUDA 3PMIA 3M4GA 4BDZA 4J6XA 1KQ2A 1AWOA 2DVJA 1GBQA 1ZQ1A 2OJ2A 2OTJT 1VQ4Q 2LRQA 3A8MB 1G3SA 2OAWA 2VYTA 4IUTA 3EG3A 3FEOA 2LC4A 2LNVA 4BD3A 1X27A 2DF6A 3CCMA 3CPWS 3L1AA 3MP8A 4Y92A 4C0DB 1AWXA 2GFAA 2JJ9A 5ECAA 1Q82C 1NE8A 1AOJA 2DYIA 3G6ET 3KBGA 2BIVA 4FSSA 3OYLA 3CC7Q 2QQBA 4OMPA 1YITQ 1C6VX 5GAMj 2RO0A 3CC4T 1VQ7A 4L5GA 3JCMc 3TQ7P 5KYXB 3RDVA 4RMOA 1Q7YC 4DBFA 5D6WA 1H3HA 2EGCA 1KD1R 3C95A 4HCBA 3AHUA 5A0LA 3C94A 3VJPA 4FCYA 4O5VA 3QDFA 4MZTA 3EH2A 5IH2A 2VUBA 4ZN1A 2DTOA 4J83A 2EKHA 2HBWA 3QWYA 2VGMA 2E64A 3CCEQ 3CD6A 4J7IA 2LJ1A 4PJOD 4LDYA 2L89A 1IHVA 3PVQA 4IIOA 2LQ8A 2VASA 4LD6A 5IT9E 1UECA 4NL2A 1ZUUA 5GAOl 3OYIA 1IHWA 4XTYA 2M16A 4M78A 2E3IA 2RQVA 4E7LA 4F7UG 1XQHA 3CQTA 5LJ3j 1I4K1 2KI7A 5FROA 1ZSZA 4A4EA 3E1SA 3L42A 1I81A 1VQ5A 4JRKA 1HXDA 4FSXA 3CXCA 3CCQT 1UFFA 2GF7A 2M1HA 3PNWC 4ORZA 1I1JA 3OW2S 2NYSA 1N27A 1YN8A 1S72Q 3X26B 4F14A 3NTKA 3S6WA 3OYYA 1Q86C 2VGNA 2OTLT 3I56A 3SDZA 4A4GA 2V8IA 1VQ6T 1E6GA 4KGVB 3EFSA 1W6XA 4JJNK 2DYBA 2RHYA 1JO8A 2E65A 1ARKA 2QQRA 1G5VA 3QXEB 1OZ3A 1FWZA 1S1NA 1X43A 3GP8A 2QK0A 3A1PA 4GLKA 2JZ2A 3C12A 4XAXB 1VQOT 1X69A 1YIJT 4DBHA 1PSFA 2IIMA 1YHQA 1HK9A 2DXTA 2CSQA 2AT1B 3OSVA 4M78E 3NTHA 5CR2A 2RI5A 2XHCA 4E7KA 3G7ZA 2K3BA 2RQTA 3FJPA 1I8FA 4A4KA 2R57A 2RM4A 1JRIA 1WZOA 2FVUA 2H8HA 2QA4T 3NPFA 1CKAA 1GCQC 2E6ZA 2RPNA 1TUGB 3VS4A 4LUDA 4ZTFA 4J9BA 2M02A 3JCMf 2CT4A 1VQ4A 3H6ZA 1MMAA 4QT7A 4C0FA 2J6FA 4N4GA 2DL5A 3OY9A 4Q5WA 2NUPA 1JQQA 4XU1A 3CCJQ 1QP3A 4M7AA 3VYGA 2BE9B 1C0MA 1KFZA 2PVOB 1OU9A 3E9GA 3NGPA 1UGQB 1MHNA 2KNBB 3OYDA 2EWNA 5GAMg 4FT4A 4DQ2A 3MCAB 1ZX6A 1RAGB 5CKBA 2J05A 5LJ3f 5IXBA 1OPLA 3O8VA 4C8QF 5LJ5h 4KH1B 5HK0A 3EG0A 3CC7A 1NJIU 4M7AF 1G83A 1YBYA 3JCMW 3TSWA 2EYYA 1I07A 1PD0A 5KYYB 1YITA 3PGGA 1X75C 3P8BB 2JM9A 2DXCA 4D6WA 3BW1A 1BK2A 2QA4Q 4RTWA 4R56A 2J6OA 1KSWA 2KVQG 4C8QC 4PFZA 5GMKh 1W2BA 1VQPQ 2PNIA 1U1SA 3CCRT 3JCMg 4M75G 3G71A 2XU8A 4PLLA 4Z88A 2NUTB 1M4ZA 4M4ZA 4E7JA 2QG9B 1KQ1A 4JPBW 5KH6A 4QQ6A 1ACMB 1KHIA 2C0TA 3CCEA 2DAQA 2E3HA 3RNJA 3CPWP 3SB2A 5HCKA 3CCSA 4F16A 5LJ3g 3QZ9B 4RTYA 4LUEA 1N5ZA 1K8AC 5KE2A 2BZYA 4IUVA 2VC8A 1ZA2B 3CC2A 5CKDA 1KHCA 2RJCA 4OVAA 3CBMA 3OYMA 3VUZA 1ZA1B 3LGFA 1PRMC 5KYUA 5CKHA 4M7AE 3VYHB 3JCMd 1PNJA 3CCRQ 4C8QB 3EGDA 1WPYA 3RERA 2FL7A 1H641 1PCXA 4EMHA 2CT3A 3H0IA 2YHTA 2JN0A 2D9TA 2P4RA 1S72A 5D7UA 2DETA 2CKKA 4F7UB 5KYNA 2RQRA 2V8KA 3M55A 2NWMA 1WFWA 3U23A 2F69A 3IQLA 2I0NA 4OB3B 5LJ3d 5DLQE 2BZ8A 3CCMT 5GAMe 5GJWB 1AWWA 2LNHB 2K5IA 1T0JA 1ZHIA 1N9SA 4OB2B 1YJWQ 2FO0A 1JB0E 2MAMA 3UT1A 5KE3A 4E7SA 1SHFA 2DJZA 3TVTA 3UF4A 2FEIA 1VQ7T 1UEBA 5DLOA 1YNZA 1TG0A 1M1GA 5CIUA 3UPUA 1IRXA 4Y28E 4ZTJA 3OS2A 3JCMe 1NZ9A 1WXUA 3EFRA 1PKTA 3QG1A 3A8OB 1SKUB 5CAIA 1WLPB 1K4US 4OGCA 3OW2P 3M0QA 2YUQA 4BUGA 2V26A 1M9SA 2XD0A
chains in the Genus database with same CATH topology
2RI3A 1QVGS 3SWNA 3P8DA 4RCBA 1EIFA 2FHDA 1QVFA 4M7AD 2P4TA 1M90U 4M7AC 1MGQA 1NPPA 2O4XB 4NS5A 3CBPA 3CD6T 2P0QA 4J7FA 1Q81C 1KQSS 5DY9A 3QJYA 3ZBDA 3M5AA 2PVGB 4MMKA 1K8AU 3N5BB 2OAUA 5LJ3e 3HHTB 2H3JA 3FB9A 3PT9A 4PL6A 5FU7C 3FC3A 4RG8A 4M7DD 2V8JA 4M78D 2XDPA 4HT9A 3PTAA 1KD1C 2WSFE 2RHXA 2Y90A 3PIOA 3INZA 4MZPA 1YJ9A 3GNFB 1JJ2A 2XIDA 1XOVA 3HFNA 3CMEA 2RJDA 3META 1G3YA 3OBYA 1G3WA 5IAYA 1VQ5T 2XICA 2HD0A 5HK3A 3TREA 5GAMd 2CGHA 4JLIA 2EQJA 3CCUA 3CCJA 3L2QA 3NFCA 1M1KC 4MZMA 3OYCA 3GF5A 4HCZA 2JVVA 3OSSC 1RL2A 3PMIA 3ASKA 3M4GA 2MWOA 3FLGA 4J6XA 3X20B 4BDZA 1KQ2A 1U1TA 2GCXA 3WVDB 3HP9A 2VXEA 3MEUA 4M75D 3CCLT 1K73U 1BKBA 5J39A 1RI0A 4PJOB 2RJFA 4KBMB 4KT0E 4BI8B 1VIEA 1ZQ1A 4C5GA 5GAN4 1YJWT 3PMTA 2OTJT 3V7SA 2WSEE 5GAN8 2LRQA 3A8MB 4A53A 4EMKC 5GANj 2HAXA 3LLRA 2RK1A 1IREB 2PU9B 2EQKA 1G3SA 2EQMA 5LL6S 3FDRA 3G6EA 2VYTA 5GMKm 4IUTA 1U8RA 2IG0A 2EJFA 3FEOA 2DIGA 2LC4A 4M7AB 2LNVA 3I56T 1KG1A 2XI9A 3M57A 4BD3A 4FT2A 3M54A 1I5LA 1M1FA 2DVEA 5M9OA 1N8RU 2D6FA 3BDLA 3JCMX 3UDCA 3CPWS 3CCMA 1VQMT 3L1AA 3MP8A 1VQPA 3JB9J 5FU7B 4C0DB 2K3XA 2QTXA 2GFAA 3L2UA 2LTOA 1B34A 2DTIA 5KCHA 1Q82C 1NE8A 2E12A 3PFSA 4C92D 5CK9A 5LJ5j 2K2VA 3OBWA 2JNGA 4R55A 3VUBA 3MEWA 3KXTA 5AYFA 3G6ET 1WQWA 2ZPIB 3KBGA 2MF2A 2K5LA 4GY5A 2BIVA 3OYLA 1WJQA 3GIBA 2QQBA 4PNOA 5FLXE 3JCMJ 5FRMA 2RJEA 1BI1A 2JTMA 3OYFA 2FYKA 1QW1A 3A8HB 3GLXA 4BB7A 2RO0A 4QQGA 5GAMj 3CC4T 1VQ7A 4L5GA 2O01E 3OS0A 3JCMc 5GAN2 3M53A 4HT8A 2DZCA 2M9UA 3MHXA 2IVWA 5GMKe 4RMOA 2EIFA 2LQKA 3RMSA 1Q7YC 4M77A 5J3BA 4HKEA 4M77G 3RKWA 2EKOA 4XTUA 3QO3A 5D6WA 4P5NA 3OQ5A 3S3NA 3BY7A 3C95A 3LW5E 5A2QE 5A0LA 3C94A 4HCBA 4M75B 3AHUA 2LT1A 1YHQT 1TH7A 2X4XA 3QYHB 4J6YA 3VJPA 4O5VA 2QI2A 4MZTA 3LH0A 3MP1A 1YI2A 4EPCA 4ZGEB 4EMKB 2KQWA 2VUBA 4ZN1A 1Q81U 4ME7A 2AHJB 2XG8D 1O9SA 1QVPA 2MWPA 4JUVA 3V8LA 2DTOA 3DKMA 5GAOr 4J83A 2MI6A 2A3LA 4J5YA 4M77F 4OP0A 2GFUA 2VGMA 2E64A 3CD6A 4J7IA 4HA8A 4PJOD 4LDYA 2L89A 4C8QA 4C5EA 4QVZA 3CMAA 2LQ8A 2LX9A 5GAN7 4LD6A 4VUBA 5IT9E 2NLUA 1W2BS 2BKDN 3EAEA 4M77C 4NL2A 2CYZB 2PUKB 4C92B 4ZN3A 1KC8C 5IN1A 5GAOl 4JS4A 1OI1A 3OYIA 2LDMA 4XTYA 1BIBA 5A0DA 1VQ4T 2EFIA 2M16A 1M1KU 4M7DA 4M7DG 1X6OA 4M78A 4M78G 4F7UA 4E7LA 1UGRB 1UB4A 4O6JA 1XQHA 4F7UG 2K57A 1K9MC 5LJ3j 2ZGWA 1I4K1 5FROA 3L2WA 5GAOq 1M8VA 1GXIE 4A4EA 2ZPBB 3E1SA 5A0GA 3R6OA 2OTLA 2DEQA 3L42A 1I81A 1VQ5A 4JRKA 3TEEA 2Y4YA 1HXDA 4FSXA 5L8RE 4J8OA 4E47A 5I2SA 4BE1A 2KY9A 1X01A 3OYEA 2DZ9A 3CXCA 3JB9H 3CCLA 4OMFB 3CCQT 4X9DA 1SSFA 2GF7A 4II1A 5D6XA 4F7UF 2M1HA 4JRIA 3PNWC 2QQ9A 2ZPEB 5D6YA 1YJWA 1YCYA 4X9CA 4XTZA 2OTJA 5CKEA 3OW2S 1R8OB 4JS5A 1N27A 5I21A 5CO7A 3CC7T 3FRNA 3X26B 2Y4XA 2HBPA 3NTKA 4TVRA 3LX7A 3OYYA 3S6WA 4B9WA 1Q86C 1VQKT 1YITT 2VGNA 1VQNT 2RK2A 3SWNC 2OTLT 2KDSA 1M5Q1 1KQSA 4XQ3A 3I56A 3SDZA 3MEVA 3J7AF 4A4GA 1BIAA 3JCMP 1Q82U 4QVCA 2V8IA 1VQ6T 1V29B 1BI3A 3HRTA 3EFSA 5DM7R 2E5QA 4JJNK 4M77E 2RHYA 1VQMA 1VQLT 2E65A 3QJ6A 3V8KA 2BUDA 4BE0A 3M9QA 5GANf 2KAFA 2L3RA 3A8GB 2QQRA 3G71T 3HKSA 4XTWA 3TCJA 4NL3A 5GMKi 4L6V5 1G5VA 3QXEB 1OZ3A 2DKGA 3X24B 5GAN6 1FWZA 4N4HA 2G3RA 4DA4A 3HSBA 3M4YA 2XKOC 3JSCA 1Q7YU 1WGSA 3GP8A 3G4ST 3CC4A 2JOYA 4GLKA 2LT4A 2L8DA 2DPPB 2E10A 1VQ8T 3DLLA 3CCET 2O4XA 2JZ2A 2RA2A 3C12A 1WQ7A 3HRSA 4RKUE 2X4WA 4XAXB 3JB9G 1VQOT 1D3BB 4C8QE 3OYHA 1YIJT 1W4SA 1N6AA 5GAOp 1FX7A 2VV5A 1PSFA 5CQXA 3CCST 1OZ2A 2ZCFB 3X25B 2A7YA 4IURA 1YHQA 3JCMb 3OS5A 1HK9A 1VQ9T 4Z02A 2DXTA 2K4YA 4KULA 2LCLA 3OYKA 3OSVA 4BE2A 4M7DE 4JRQA 4M78E 1VIFA 3NTHA 4F7UE 3OS1A 3CC2T 3HFOA 3JB9I 3L2RA 5GMKj 5CR2A 3S3OA 3JB9F 2RI5A 2K5FA 5GAOm 3SWNB 3LWIA 3QHSA 4FL6A 1IZ6A 2KSSA 2XHCA 4E7KA 2R5MA 3G7ZA 4ATOA 2CZ6B 3FJPA 3CPWA 4XU0A 1I8FA 1KC8U 4A4KA 2R57A 3KUFA 1VUBA 3LWHA 3X28B 4BACA 5GANg 2RM4A 1JRIA 3L2ZA 2FVUA 3ME9A 4CRIA 3CPFA 4KUIA 3HRUA 3M56A 2QA4T 3OYNA 2PVDB 2E6ZA 4JLGA 4PJOA 5CCAA 4MDXA 4YTLA 4PJOG 4ZGJB 2B8AA 1K9MU 4EMGA 4ZTFA 2RHUA 2RHZA 3RESA 3JCMf 3L2VA 1VQ4A 3H6ZA 4LDXA 1S72T 4C0FA 4XK8E 3CCVT 4N4GA 3OY9A 2PUOB 4Q5WA 4A54A 4DOVA 2C06A 5FRNA 3M58A 3LGLA 1Y96A 4HCCA 3OMCA 4XU1A 2WACA 4LDVA 4C8QG 5LJ5g 5GANh 4N4IA 4A4FA 1QP3A 4M7AA 4M7AG 3VYGA 2X35A 4OGEA 2QEXT 1QVFS 4LD9K 4QW2A 2EJ9A 2XDDA 4M77D 3I55T 3LYIA 1ZBXA 3PIPA 4IUPA 2PVOB 4C0ZA 4XTVA 1OYXA 2RH2A 3E9GA 4A4HA 3S3MA 1UGQB 3CCQA 4IUQA 1MHNA 3OYDA 2EWNA 5GAMg 1Q86U 4FT4A 4DQ2A 3M59A 3FIFA 3MCAB 5C0MA 5CQYA 1QP2A 5CKBA 3RUXA 5LJ3f 3DB4A 3JAME 3O8VA 5EG2A 4C8QF 5LJ5h 2DTHA 4QVDA 5HK0A 3C4SA 3WXMB 4OB1B 3CC7A 1NJIU 4M7AF 1YBYA 1JJ2S 3JCMW 1VQKA 2DD5A 2I2LA 1YITA 1FXXA 1VQNA 3PGGA 3RMQA 2KMTA 2DD4A 5GANd 2JTFA 3QSUA 1H3ZA 1X75C 1WJRA 3P8BB 2L5QA 3V7CA 4IKFA 2DXCA 4KUDK 1Y71A 4D6WA 3BW1A 1VQ6A 4R56A 3GNGA 5GAMh 1XTDA 2KVQG 4M78F 2ZZDA 4C8QC 4M7DF 4PKCC 1VQLA 2LVMA 5GAOn 5GMKh 3Q1JA 1YJNT 3VKIA 1W2BA 1B34B 2MMPA 1U1SA 2PQWA 3CCRT 4M75A 3JCMg 3QDRB 4M75G 4MDWA 5CVIA 2D0QB 3HPWA 3G71A 1QVGA 2XU8A 4PLLA 3RIRA 4C0DC 1M4ZA 3MP6A 3QYGB 2ZPGB 2RI2A 4M7DC 2ZPFB 5LJ5d 4E7JA 3QKJA 4M78C 1KQ1A 2R58A 4XU3A 1UGPB 1WJSA 2HQEA 4EMKA 5KH6A 4QQ6A 1NJIC 3GPLA 3CMAT 3JCMQ 1AHJB 3OYBA 3G4SA 4EDUA 2HNIA 1KHIA 3CCEA 1VQ8A 2DAQA 2DXUA 5FU6C 1VQOA 4M75F 3JCMh 2P0KA 4FIBA 4LDUA 1UGSB 2EYQA 2F5TX 3OMGA 4M77B 5HKCA 5CKFA 1YIJA 3SB2A 1Y7XA 4Y91A 2YLBA 4XU2A 1M90C 2LCCA 3UWNA 3JRZA 4BY6C 3QUIA 3CCSA 2E70A 5LJ3g 2QDYB 3QZ9B 4PJOE 3ER0A 3V8JA 3OW2A 4C92A 1VQ9A 4C92G 4BDYA 2YLCA 1YJ9T 5KE2A 1K8AC 4M75C 4IUVA 2VC8A 3H8ZA 3ZEHA 2E41A 3CMET 4C0GA 3CC2A 1BYMA 3A5ZB 5CKDA 3DLMA 1KHCA 1O75A 2RJCA 4OVAA 4MMLA 4C5HA 3CBMA 3OYMA 5LJ5f 3VUZA 4PLIA 1N9RA 3LGFA 3JCMV 4ELYC 3OB9A 5CKHA 3CCUT 5KCOA 3CCJT 4M7AE 4RG2A 4ELZC 5GANe 3VYHB 1Y96B 2WSCE 3BFMA 5LJ3h 3JCMd 4C8QB 4CI0C 4DOWA 1WPYA 2CS7A 3VV0A 4C92F 3RERA 2QA4A 5GAMf 2FL7A 4FU6A 1H641 4N0AA 4ZGDB 4EMHA 2DXBA 3URGA 3CBOA 1LOJA 2YHTA 2JN0A 3E9FA 4V2SA 3QIIA 3SFMA 2D9TA 4L59A 3J80E 1BI0A 1Y07A 1S72A 4M7DB 4M78B 2CKKA 1LNXA 4F7UB 3CCVA 4C92C 2YRVA 1BI2A 1K73C 2M0OA 4B9XA 5LJ5e 3QZ5B 3DB3A 3QBYA 5I2MA 2EJGA 2V8KA 2FB7A 3M55A 2DIQA 2DO3A 2VXFA 3J81E 3JB9D 2EQUA 2QEXA 2F69A 4OB3B 5LJ3d 5DLQE 5FU6B 4C5IA 3I55A 4WF2A 4E7IA 3HL8A 3CCMT 5GAMe 2DK3A 4E7HA 1VQPT 4C8QD 2QQAA 4M75E 4BY6B 2K5IA 2ZPHB 2EAYA 5C6SA 4UC4A 1ZHIA 5HY6A 1N9SA 4OB2B 2X4JA 5GMKl 1N8RC 4OB0B 3ZFJA 1P92A 4LDWA 3OYJA 4N0AC 3CEYA 2E6NA 1JB0E 2MAMA 2RD1A 2GQVA 2QXFA 4JDSA 3UT1A 5KE3A 3BDUA 2DJZA 1XNIA 1JBMA 2QQSA 3RKXA 3TU4K 3E19A 4RCCA 2CZ1B 4PJOF 4J6WA 1VQ7T 1UEBA 3RKYA 4XTXA 5DLOA 5GAN5 4JRPA 1M1GA 5CIUA 2XK0A 3UPUA 1LJOA 3MEAA 3MO8A 4Y28E 4BI3A 1G3TA 4X34A 3A8LB 3NTIA 1PSEA 3GOXA 1D3BA 2P0PA 4ZTJA 5GAN3 3F70A 3OS2A 3WVEB 3JCMe 2X4YA 1YJNA 4OF1A 1NZ9A 3T9NA 1KD1U 3EFRA 2R5AA 3QG1A 3CCRA 4PJOC 2E1HA 3A8OB 1DJ7B 4C92E 3CXCS 3SD4A 2CZ0B 4QQDA 2F5KA 2JUFA 2RHIA 1NPRA 4IUUA 5J26A 5CAIA 4OGCA 1YI2T 3V7RA 2K3YA 3P8HA 4BI4A 3OYGA 3VU3C 2CZ7B 2HQXA 4NOYA 2XDBA 4BUGA 2KK4A 1M9SA 1WNLA 3QPHA 4FM4B 3OA6A 2XD0A 2RB6A 3OYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RI3 A;  1QVG S;  3P8D A;  1EIF A;  1QVF A;  2FHD A;  1M90 U;  1NPP A;  2O4X B;  4NS5 A;  3CD6 T;  1KQS S;  1Q81 C;  1K8A U;  3FC3 A;  4PL6 A;  2XDP A;  1KD1 C;  2RHX A;  3PIO A;  1YJ9 A;  1JJ2 A;  3CME A;  2RJD A;  3MET A;  5IAY A;  3TRE A;  2EQJ A;  3CCU A;  3CCJ A;  3L2Q A;  1M1K C;  3OYC A;  4HCZ A;  2JVV A;  1VQ5 T;  1RL2 A;  3PMI A;  3ASK A;  2MWO A;  3FLG A;  4BDZ A;  3CCL T;  3MEU A;  1K73 U;  1BKB A;  5J39 A;  1RI0 A;  2RJF A;  4C5G A;  1YJW T;  3PMT A;  2OTJ T;  2LRQ A;  3LLR A;  5LL6 S;  2EQK A;  2EQM A;  3G6E A;  3FDR A;  2VYT A;  4IUT A;  2IG0 A;  3I56 T;  3FEO A;  2DIG A;  4BD3 A;  5M9O A;  1N8R U;  3BDL A;  3CCM A;  3CPW S;  1VQM T;  3MP8 A;  1VQP A;  3L2U A;  2K3X A;  2GFA A;  2LTO A;  5KCH A;  1Q82 C;  3PFS A;  2JNG A;  3MEW A;  3G6E T;  3KBG A;  4GY5 A;  2BIV A;  3OYL A;  1WJQ A;  5FLX E;  5FRM A;  2RJE A;  3OYF A;  3CC4 T;  2RO0 A;  1VQ7 A;  4QQG A;  3OS0 A;  2EIF A;  1Q7Y C;  5J3B A;  2EKO A;  5D6W A;  3OQ5 A;  3S3N A;  5A2Q E;  1YHQ T;  2X4X A;  3LH0 A;  1YI2 A;  3MP1 A;  4ZN1 A;  1Q81 U;  2MWP A;  2MI6 A;  2GFU A;  3CD6 A;  2L89 A;  4C5E A;  4QVZ A;  2LQ8 A;  4LD6 A;  5IT9 E;  2NLU A;  1W2B S;  2BKD N;  3EAE A;  4ZN3 A;  1KC8 C;  5IN1 A;  1OI1 A;  3OYI A;  2LDM A;  1VQ4 T;  2EFI A;  1M1K U;  2M16 A;  1X6O A;  4E7L A;  1K9M C;  5FRO A;  3L2W A;  4A4E A;  2OTL A;  3L42 A;  1VQ5 A;  4BE1 A;  3OYE A;  3CXC A;  3CCL A;  3CCQ T;  1SSF A;  2GF7 A;  4II1 A;  5D6X A;  2M1H A;  1YJW A;  3PNW C;  5D6Y A;  2OTJ A;  3OW2 S;  1N27 A;  3CC7 T;  1Q86 C;  1VQK T;  4TVR A;  3OYY A;  3LX7 A;  3NTK A;  3S6W A;  4B9W A;  1YIT T;  1VQN T;  2OTL T;  2KDS A;  1KQS A;  3I56 A;  3J7A F;  3MEV A;  4A4G A;  1Q82 U;  1VQ6 T;  5DM7 R;  2E5Q A;  2RHY A;  1VQM A;  1VQL T;  3QJ6 A;  2BUD A;  4BE0 A;  3M9Q A;  2L3R A;  2QQR A;  3G71 T;  3HKS A;  1G5V A;  1OZ3 A;  4N4H A;  2G3R A;  1Q7Y U;  1WGS A;  3G4S T;  3CC4 A;  2JOY A;  2L8D A;  1VQ8 T;  3CCE T;  3DLL A;  2O4X A;  2JZ2 A;  2X4W A;  1VQO T;  3OYH A;  1YIJ T;  3CCS T;  1OZ2 A;  1YHQ A;  4IUR A;  1VQ9 T;  4Z02 A;  2LCL A;  3OYK A;  4BE2 A;  3NTH A;  3OS1 A;  3CC2 T;  3L2R A;  3S3O A;  2RI5 A;  4FL6 A;  1IZ6 A;  2XHC A;  4E7K A;  2R5M A;  3CPW A;  1KC8 U;  2R57 A;  3KUF A;  4BAC A;  3ME9 A;  4CRI A;  3CPF A;  2QA4 T;  3OYN A;  2E6Z A;  4YTL A;  1K9M U;  2B8A A;  4ZTF A;  2RHU A;  2RHZ A;  3L2V A;  1VQ4 A;  3H6Z A;  1S72 T;  3CCV T;  4N4G A;  3OY9 A;  4Q5W A;  5FRN A;  3LGL A;  3OMC A;  2WAC A;  4N4I A;  4A4F A;  2X35 A;  2QEX T;  1QVF S;  4QW2 A;  3I55 T;  3LYI A;  3PIP A;  4IUP A;  1OYX A;  3E9G A;  4A4H A;  3S3M A;  3CCQ A;  4IUQ A;  1MHN A;  3OYD A;  1Q86 U;  5C0M A;  3DB4 A;  3JAM E;  3O8V A;  3CC7 A;  1NJI U;  3C4S A;  1YBY A;  1JJ2 S;  1VQK A;  1YIT A;  1VQN A;  2JTF A;  1H3Z A;  3P8B B;  1WJR A;  4IKF A;  1VQ6 A;  1XTD A;  2KVQ G;  1VQL A;  2LVM A;  1YJN T;  1W2B A;  3Q1J A;  3CCR T;  2PQW A;  3G71 A;  1QVG A;  4PLL A;  3MP6 A;  2RI2 A;  4E7J A;  3QKJ A;  2R58 A;  1WJS A;  2HQE A;  5KH6 A;  4QQ6 A;  1NJI C;  3CMA T;  3OYB A;  3G4S A;  4EDU A;  1KHI A;  3CCE A;  1VQ8 A;  2DAQ A;  1VQO A;  2P0K A;  3OMG A;  1YIJ A;  1M90 C;  3CCS A;  2LCC A;  3UWN A;  2E70 A;  3ER0 A;  3OW2 A;  1VQ9 A;  4BDY A;  1YJ9 T;  1K8A C;  5KE2 A;  4IUV A;  3H8Z A;  3CME T;  3ZEH A;  3CC2 A;  3A5Z B;  3DLM A;  1KHC A;  2RJC A;  4OVA A;  4C5H A;  3OYM A;  4PLI A;  3LGF A;  3OB9 A;  3CCU T;  5KCO A;  3CCJ T;  4RG2 A;  2QA4 A;  4FU6 A;  3E9F A;  3QII A;  2D9T A;  4L59 A;  3J80 E;  1S72 A;  2CKK A;  3CCV A;  1K73 C;  2YRV A;  2M0O A;  4B9X A;  3DB3 A;  3QBY A;  2DIQ A;  2DO3 A;  3J81 E;  2EQU A;  2QEX A;  5DLQ E;  3I55 A;  4C5I A;  4E7I A;  3CCM T;  1VQP T;  4E7H A;  5C6S A;  5HY6 A;  4UC4 A;  1N8R C;  3OYJ A;  3CEY A;  2E6N A;  3UT1 A;  5KE3 A;  1XNI A;  2QQS A;  1VQ7 T;  1UEB A;  1M1G A;  5CIU A;  2XK0 A;  3MEA A;  3MO8 A;  4X34 A;  4ZTJ A;  3GOX A;  3NTI A;  3F70 A;  3OS2 A;  2X4Y A;  1YJN A;  1NZ9 A;  1KD1 U;  3CCR A;  2R5A A;  3CXC S;  3SD4 A;  4QQD A;  2JUF A;  2F5K A;  2RHI A;  1NPR A;  5J26 A;  4IUU A;  1YI2 T;  2K3Y A;  3P8H A;  3OYG A;  2HQX A;  3OA6 A;  3CMA A;  3OYA A; 
#chains in the Genus database with same CATH topology
 1JXO A;  3CBP A;  3CD6 T;  1KQS S;  3QJY A;  1T3L A;  3M5A A;  2OAU A;  5LJ3 e;  2H3J A;  2O31 A;  2MK5 A;  4M7D D;  2V8J A;  1D0Y A;  4DBQ A;  3PTA A;  1KD1 C;  2WSF E;  3PIO A;  4PFP A;  2C0O A;  1VQ7 Q;  1OV3 A;  1TXQ A;  2XIC A;  2HD0 A;  1SRL A;  5HK3 A;  1CSK A;  2EQJ A;  3CCJ A;  2ESW A;  3I5R A;  1UUE A;  3OSS C;  1VQ5 T;  3ASK A;  2MWO A;  4F04 B;  3WVD B;  4M75 D;  4KT0 E;  4BI8 B;  1VIE A;  3LH5 A;  5GAN 4;  3PMT A;  4A53 A;  5FWB A;  2HAX A;  3LLR A;  4J9D A;  2PU9 B;  2EQK A;  2EQM A;  2YUO A;  5GMK m;  1UHF A;  2IG0 A;  3I56 T;  1KG1 A;  2XI9 A;  4E7Z A;  1TSF A;  2MPX C;  3M57 A;  5M9O A;  2D6F A;  3BDL A;  3JCM X;  1VQP A;  2HEQ A;  1NM7 A;  3L2U A;  2K3X A;  2DTI A;  4AG2 C;  5CK9 A;  5LJ5 j;  2GTJ A;  2K2V A;  3KXT A;  3HTR A;  2ZPI B;  1H8K A;  1UJY A;  2K5L A;  2FPE A;  1OU8 A;  1WJQ A;  3JCM J;  5FRM A;  2RJE A;  1BI1 A;  2YUN A;  3OYF A;  2FYK A;  1VQN Q;  3GLX A;  4BB7 A;  2O01 E;  3M0S A;  2M9U A;  2IVW A;  4KH0 B;  3VS2 A;  2EIF A;  3ULR B;  2CDT A;  4M77 A;  5J3B A;  3RKW A;  2KT8 A;  3S3N A;  5A2Q E;  4M75 B;  2QGG A;  1YHQ T;  3QYH B;  1D1A A;  2QI2 A;  4OMM A;  4EPC A;  4ME7 A;  2AHJ B;  3V8L A;  1QVP A;  5GAO r;  2DL4 A;  1M1K R;  4M77 F;  2COY A;  2GFU A;  1U5S A;  2OI3 A;  2YDL A;  1NYG A;  4HA8 A;  2YWW A;  4VUB A;  2BKD N;  4M77 C;  2CYZ B;  1OI1 A;  1EX4 A;  2LDM A;  1VQ4 T;  1M1K U;  4HVU A;  4M78 G;  1UGR B;  2K57 A;  1YWP A;  2ZGW A;  1XJW B;  2DJQ A;  3L2W A;  2Y4Y A;  2SEM A;  4LE9 A;  5I2S A;  2W0Z A;  1X01 A;  4AFQ C;  3JB9 H;  1UE9 A;  2FPF A;  3EGX B;  3EFO B;  3EG9 A;  1YJW A;  2ZPE B;  3VS7 A;  1YCY A;  5CKE A;  2CP0 A;  3CC7 T;  3FRN A;  3CCV Q;  2Y4X A;  3VS5 A;  1I0C A;  4TVR A;  1YIT T;  4JZ3 A;  3SEM A;  4ZNX A;  3MEV A;  1OQK A;  2CH4 A;  1BIA A;  1V29 B;  4WCI A;  1MUZ A;  3I55 Q;  4M77 E;  2CP2 A;  3M9Q A;  3A8G B;  2L3R A;  4X1V A;  3G71 T;  2COW A;  3HKS A;  4J9C A;  2X9H A;  5GMK i;  2LP5 A;  2CP5 A;  4DA4 A;  2A37 A;  2XKO C;  4JJD A;  1T0H A;  1WGS A;  2DPP B;  2E10 A;  3CCE T;  1RAC B;  2O4X A;  2DER A;  4RKU E;  1D3B B;  3OYH A;  5FW9 A;  1N6A A;  2O9V A;  2RMO A;  1KC8 R;  5CQX A;  3CCS T;  4A63 B;  1E7O A;  2YXY A;  3X25 B;  1X6B A;  3JCM b;  3OS5 A;  2F2V A;  4JJB A;  1AD5 A;  2JW4 A;  4JRQ A;  5KYW A;  3OS1 A;  3CC2 T;  3JB9 I;  3UA6 A;  3L2R A;  1K9M R;  3LWI A;  2K5F A;  3QHS A;  1IZ6 A;  1MV0 B;  3THK A;  1TS9 A;  3CPW A;  1KC8 U;  1GFC A;  1VUB A;  3LWH A;  4BAC A;  3G71 Q;  3ME9 A;  1IGU A;  4CRI A;  4KUI A;  1GCP A;  1U06 A;  4PJO A;  5CCA A;  4RTT A;  4YTL A;  1K9M U;  3I35 A;  4EMG A;  3RES A;  1ZBJ A;  1YJ9 Q;  1SEM A;  1S72 T;  3CME Q;  1WHJ A;  1WYX A;  2W10 A;  4DOV A;  3LGL A;  1YWO A;  3OMC A;  4C8Q G;  5LJ5 g;  4A4F A;  4M7A G;  1SHG A;  2X35 A;  1TUD A;  4J9H A;  1KQS P;  3CCS Q;  3BE3 A;  2XDD A;  4IUP A;  2HCK A;  1OYX A;  2A08 A;  3S3M A;  1D1B A;  3FIF A;  5C0M A;  3CC2 Q;  2QDL A;  2D8J A;  3DB4 A;  1IB8 A;  4PJL A;  4QVD A;  3C4S A;  1VQN A;  1Z9Q A;  2DD4 A;  2JTF A;  4IKF A;  4FYW B;  2LZ6 B;  1EZZ B;  1HSQ A;  2DLP A;  4M78 F;  4PKC C;  2LVM A;  1FYN A;  2Z0W A;  2D1X A;  5CVI A;  2RI2 A;  1BBZ A;  2V1R A;  5LJ5 d;  4M78 C;  1B3Q A;  1UGP B;  4EMK A;  2HQE A;  4QKU A;  4DEX A;  3OYB A;  2HNI A;  1RAD B;  1ZSZ C;  1QLY A;  3UAT A;  4ESR A;  5FU6 C;  1M2V A;  2P0K A;  4FIB A;  3OMG A;  2EYQ A;  2F5T X;  1Y7X A;  4XU2 A;  2LCC A;  2AKL A;  3JRZ A;  3UWN A;  3QUI A;  4BY6 C;  4PJO E;  3ER0 A;  1R0B G;  3OW2 A;  4C92 A;  2KEA A;  1UHC A;  2YLC A;  1YI2 Q;  4GLM A;  3ZEH A;  3H9N A;  1E6H A;  5KCO A;  3CCJ T;  4RG2 A;  3BFM A;  2DRM A;  4DOW A;  1HD3 A;  1UGV A;  2CS7 A;  3REA B;  3VV0 A;  4C92 F;  1X6G A;  1VYU A;  5GAM f;  2KR3 A;  4N0A A;  4LN2 A;  3CBO A;  2CRE A;  2J6K A;  3E9F A;  3QII A;  2X3W D;  3J80 E;  1Y07 A;  4B6M A;  4M78 B;  2V1Q A;  1LNX A;  3CCV A;  2KGT A;  4C92 C;  2YRV A;  3VS1 A;  5LJ5 e;  1NG2 A;  2XMF A;  3QZ5 B;  5I2M A;  1EFN A;  4KRT A;  1AWJ A;  2CH4 W;  4AT1 B;  2VXF A;  1ZSZ B;  5FU6 B;  3I55 A;  4RUG A;  4WF2 A;  2BTT A;  2HSE B;  1TWB A;  2DK3 A;  1VQP T;  1Y0M A;  1FMV A;  2QQA A;  3CCL Q;  4BY6 B;  2ZPH B;  5C6S A;  4UC4 A;  5HY6 A;  1BU1 A;  5GMK l;  2X4J A;  4OB0 B;  1J3T A;  4LDW A;  4N0A C;  2E6N A;  5EC7 A;  1QVG P;  1WHH A;  1NJI R;  1RAF B;  3C0C A;  1M27 C;  2QQS A;  3RKX A;  4DBR A;  3TU4 K;  3RKY A;  5GAN 5;  2JM8 A;  2XK0 A;  1LJO A;  3MEA A;  3GOX A;  2VKN A;  1PSE A;  3NTI A;  2P0P A;  3F70 A;  4PJM A;  1M90 R;  4R0K A;  1K0X A;  1VQM Q;  4OF1 A;  4C92 E;  1AZE A;  4QQD A;  2DE0 X;  2F5K A;  2RHI A;  4Z89 A;  1HYO A;  2K3Y A;  3VU3 C;  4NOY A;  1R0C B;  4FM4 B;  3OA6 A;  1Y57 A;  1VYT A;  2RB6 A;  4C8Q D;  2FPD A;  3SWN A;  3P8D A;  4M7A D;  1M90 U;  4M7A C;  1GBR A;  1NPP A;  3R6N A;  4J9F A;  2K7A A;  3ZBD A;  2PVG B;  2F1L A;  9ATC B;  2M51 A;  3FB9 A;  3PT9 A;  4PL6 A;  3FC3 A;  1MNE A;  4HT9 A;  1YJ9 A;  3INZ A;  2KYB A;  4MZP A;  1K73 R;  3GNF B;  2AZV A;  3HFN A;  3CME A;  2RJD A;  3OBY A;  1G3W A;  2FZK B;  1SRM A;  5GAM d;  4JLI A;  1QQJ A;  2O9S A;  3NFC A;  3G1J A;  5IHI A;  3NHN A;  1M1K C;  3OYC A;  3GF5 A;  2KT1 A;  1RL2 A;  3FLG A;  5L23 A;  2ROL A;  1QWF A;  2GCX A;  2L2P A;  3MEU A;  1K73 U;  1N8R R;  1QKX A;  3VRY A;  1RI0 A;  4KBM B;  1YJW T;  4EIK A;  3SHW A;  3V7S A;  5GAN 8;  3VS0 A;  2A0F B;  1IRE B;  4HVV A;  2NUP B;  3G6E A;  1WHK A;  1U8R A;  2DL3 A;  2GGR A;  4CC2 A;  2EJF A;  2DIG A;  4M7A B;  1PHT A;  4OMQ A;  1M1F A;  1N8R U;  1MMG A;  3JB9 J;  2QTX A;  2LTO A;  1B34 A;  5KCH A;  2JNG A;  4R55 A;  3VUB A;  3MEW A;  2JS0 A;  4CC4 B;  2MF2 A;  4GY5 A;  4PNO A;  1VQK Q;  2HKQ B;  4HCK A;  2JTM A;  1QW1 A;  1KJW A;  3A8H B;  2FG0 A;  1Q81 R;  3OS0 A;  4HT8 A;  2DZC A;  3MHX A;  3O5Z A;  3RMS A;  4M77 G;  2EKO A;  3QO3 A;  4FW1 A;  3OQ5 A;  3BY7 A;  1IO6 A;  2DRK A;  1WIE A;  1TH7 A;  4J6Y A;  4WTO B;  3LH0 A;  1YI2 A;  3GBQ A;  1SSH A;  1Q81 U;  2XG8 D;  1O9S A;  2K79 A;  2KXD A;  2MI6 A;  3G4S Q;  4J5Y A;  4OP0 A;  3REB B;  2DBM A;  1VQ8 Q;  1JXM A;  2L3Q A;  1BCM A;  4QVZ A;  2LX9 A;  5GAN 7;  2VWF A;  2ABL A;  2NLU A;  2LX7 A;  4AFU C;  3EAE A;  1KC8 C;  4JS4 A;  1VQ9 Q;  1BIB A;  2DL7 A;  2EFI A;  1PKS A;  4M7D A;  1X6O A;  1UB4 A;  2E4H A;  1PM3 A;  1K9M C;  5KYU B;  4FW2 A;  5GAO q;  1GXI E;  2K9G A;  5A0G A;  3R6O A;  2OTL A;  1U3O A;  3EGD B;  3TEE A;  4BE1 A;  4J8O A;  4FYY B;  2KY9 A;  3OYE A;  2DZ9 A;  3CCL A;  1WDX A;  2D0N A;  3H41 A;  1SSF A;  5D6X A;  1LVK A;  5IXF A;  4X9C A;  4XTZ A;  4JS5 A;  5I21 A;  4J9E A;  5CO7 A;  3LX7 A;  3EHR A;  1VQN T;  1M5Q 1;  1KQS A;  1OX9 A;  3J7A F;  1HJD A;  2DA9 A;  3HRT A;  3PE0 A;  5DM7 R;  1GRI A;  1VQM A;  3VS3 A;  1RAH B;  3QJ6 A;  2BUD A;  1OX8 A;  2QAS A;  2EVR A;  4NL3 A;  4PFO A;  2RN8 A;  1NYF A;  4N4H A;  2G3R A;  3JSC A;  2CP6 A;  1JU5 C;  1AVZ C;  2DL8 A;  2JOY A;  5AT1 B;  3DLL A;  1RAE B;  2RA2 A;  3HRS A;  2DIL A;  1W4S A;  2RF0 A;  2PZ1 A;  3M0R A;  5GAO p;  1W1F A;  2ZCF B;  3ZL7 C;  1X2K A;  2A7Y A;  4JJC A;  2DEU A;  4KUL A;  2LCL A;  3OYK A;  1LPL A;  4BE2 A;  4M7D E;  1VIF A;  3MJX A;  4AFS C;  5GMK j;  3S3O A;  2NUZ A;  3JB9 F;  3CMA Q;  4FL6 A;  2KSS A;  2R5M A;  4ATO A;  2HQH A;  2QGF B;  1TU0 B;  4XU0 A;  1T3S A;  1MV3 A;  3L2Z A;  3FJ5 A;  3HRU A;  3OYN A;  2PVD B;  1FMW A;  4MDX A;  4PJO G;  1TOV A;  2B8A A;  1FMK A;  4XK8 E;  3CCV T;  1V76 A;  2PUO B;  2KE9 A;  4A54 A;  5FRN A;  2EYZ A;  4HCC A;  2WAC A;  5GAN h;  3CCU Q;  2RQW A;  4OGE A;  1QVF S;  3I55 T;  4M77 D;  3PIP A;  1MMN A;  2RH2 A;  4A4H A;  4IUQ A;  2DBK A;  3M59 A;  2A36 A;  1SPK A;  5CQY A;  4D8D A;  2KBT A;  2L3P A;  1PC0 A;  3M0U A;  2DTH A;  2FRY A;  3WXM B;  4OB1 B;  1JJ2 S;  1VQK A;  2DD5 A;  1WHM A;  2I2L A;  2KMT A;  1G8X A;  3QSU A;  1H3Z A;  1K76 A;  2FZG B;  2L5Q A;  4KUD K;  5KYX A;  4LNP A;  1QCO A;  3GNG A;  1WHL A;  2ZZD A;  4K11 A;  1VQL A;  3Q1J A;  2DNU A;  2PQW A;  3HPW A;  1QVG A;  3RIR A;  4C0D C;  2YT6 A;  3QYG B;  1NLO C;  1WHG A;  3VRZ A;  2ZPF B;  2EQI A;  1TUC A;  2R58 A;  4XU3 A;  1NJI C;  3GPL A;  4PJJ A;  4RTZ A;  3G4S A;  4EDU A;  2DM1 A;  2ED0 A;  1VQ8 A;  2KRS A;  1PRL C;  2DXU A;  2LJ0 A;  4M77 B;  5HKC A;  5CKF A;  1M90 C;  2BE7 D;  4Z8A A;  3RR6 A;  2QDY B;  3V8J A;  1OEB A;  1VQ9 A;  4C92 G;  1LCK A;  1YJ9 T;  1OPK A;  3AT1 B;  1YFN A;  3H8Z A;  3CME T;  4C0G A;  3A5Z B;  4MML A;  1RUW A;  5LJ5 f;  4PLI A;  1N9R A;  3JCM V;  4HVW A;  1BB9 A;  2WSC E;  1VYV A;  1SF9 A;  2KRM A;  4E6R A;  1RLQ C;  1LOJ A;  1TTH B;  4V2S A;  4J9I A;  3SFM A;  1K0S A;  2A28 A;  4L59 A;  4RTU A;  2VVK A;  1K73 C;  2M0O A;  3DB3 A;  2DIQ A;  3EG1 A;  2DO3 A;  2EYX A;  3J81 E;  2QEX A;  2C0I A;  4E7I A;  3TSZ A;  4E7H A;  2EYW A;  1QWE A;  2EAY A;  2K2M A;  3EG9 B;  1NBE B;  1N8R C;  3ZFJ A;  1P92 A;  1WXT A;  2OTJ Q;  2ED1 A;  2AK5 A;  2RD1 A;  2GQV A;  4JDS A;  1AEY A;  1XNI A;  1JBM A;  5I11 A;  3E19 A;  2CZ1 B;  4PJO F;  2KRN A;  4JRP A;  2GNC A;  4BI3 A;  3MO8 A;  1G3T A;  3A8L B;  1R77 A;  3WVE B;  2X4Y A;  1YJN A;  1M30 A;  4RTV A;  3T9N A;  1KD1 U;  2R5A A;  1NLP C;  4PJO C;  2E1H A;  1M3C A;  3CXC S;  3SD4 A;  2CZ0 B;  1NPR A;  5J26 A;  3G6E Q;  2JS2 A;  1Q95 G;  1YI2 T;  3V7R A;  3OYG A;  2CZ7 B;  2HQX A;  1C1A A;  3CMA A;  2RI3 A;  2GBQ A;  3CC4 Q;  1EIF A;  1BCO A;  1M3A A;  2P4T A;  1MGQ A;  2O4X B;  2P0Q A;  4J7F A;  1Q81 C;  3H0F A;  2DX1 A;  4MMK A;  3N5B B;  1UTI A;  5FU7 C;  4M78 D;  2ECZ A;  2XDP A;  2LQW A;  1XOV A;  5KYW B;  2SRC A;  3MET A;  5IAY A;  1UDL A;  2QYZ A;  3CCU A;  1KIK A;  2QAZ A;  4MZM A;  3EG2 A;  3X20 B;  1U1T A;  3HP9 A;  2VXE A;  3CCL T;  1BKB A;  4OML A;  5J39 A;  1GL5 A;  4PJO B;  3JV3 A;  2RJF A;  4C5G A;  3NMZ C;  2WSE E;  4EMK C;  5GAN j;  2RK1 A;  5LL6 S;  2JTE A;  3FDR A;  5KYY A;  7AT1 B;  4FT2 A;  3M54 A;  1I5L A;  2DVE A;  3UDC A;  2YRC A;  2ROT A;  1VQM T;  5FU7 B;  1X2Q A;  1QKW A;  1F1B B;  1GCQ A;  3CCQ Q;  2E12 A;  3PFS A;  4C92 D;  3OBW A;  5AYF A;  2NUT A;  1WQW A;  2L3S A;  3GIB A;  5FLX E;  1ZLM A;  3MPU B;  2RQU A;  2OTL Q;  4QQG A;  1WI7 A;  1IGQ A;  5GAN 2;  4DEY A;  3M53 A;  2HSP A;  5GMK e;  1VQ6 Q;  1QVF P;  2LQK A;  4HKE A;  1RAB B;  4XTU A;  4P5N A;  1WA7 A;  3LW5 E;  4OMN A;  2CUB A;  2LT1 A;  2E5K A;  4CC7 A;  2X4X A;  3EGU A;  1ZSG A;  3MP1 A;  4JZ4 A;  1OOT A;  2CP3 A;  4ZGE B;  2BZX A;  1ZUY A;  4EMK B;  2KQW A;  4AMC A;  2MWP A;  4JUV A;  1JJ2 P;  3DKM A;  2HL5 C;  2A3L A;  2J7I A;  1K1Z A;  1M2V B;  4IIM A;  1VQO Q;  4C8Q A;  1PWT A;  4LXC A;  4C5E A;  1YIJ Q;  2ATC B;  2X51 A;  4KGX B;  2DFU A;  1W2B S;  2MOX A;  2PUK B;  4ZN3 A;  4C92 B;  5IN1 A;  5GJV B;  3D7S B;  5A0D A;  3M0T A;  1YP5 A;  4M7D G;  4F7U A;  4O6J A;  4PK4 A;  1YCS B;  2AKK A;  3VS6 A;  1IXD A;  1M8V A;  1PG5 B;  3RBB B;  2ZPB B;  2DEQ A;  1JEG A;  5L8R E;  4E47 A;  1Q82 R;  1H92 A;  4OMF B;  4X9D A;  4II1 A;  4F7U F;  4HXJ A;  4JRI A;  2QQ9 A;  5D6Y A;  2OTJ A;  3H0H A;  2X3X D;  1R8O B;  2H3E B;  2HBP A;  1VQK T;  4B9W A;  2YRD A;  4J9G A;  2RK2 A;  3SWN C;  2KDS A;  4XQ3 A;  1RAI B;  1QCN A;  3JCM P;  1Q82 U;  4QVC A;  1Q7Y R;  1BI3 A;  2E5Q A;  2EGA A;  1VQL T;  2EGE A;  3V8K A;  4BE0 A;  4RTX A;  5GAN f;  2HZY A;  2KAF A;  1W70 A;  2GTO A;  4XTW A;  3TCJ A;  4L6V 5;  2FZC B;  3X24 B;  2DKG A;  5GAN 6;  2LMJ A;  2COZ A;  3HSB A;  3M4Y A;  4ANJ A;  1Q7Y U;  3G4S T;  3CC4 A;  2O2O A;  4KGZ B;  1K9A A;  2LT4 A;  2L8D A;  1VQ8 T;  2QTV A;  1WQ7 A;  3JB9 G;  2X4W A;  4F17 A;  4C8Q E;  1NEG A;  1VOM A;  1FX7 A;  1VA7 A;  2VV5 A;  2OX7 A;  1OZ2 A;  4IUR A;  3MKD A;  1VQ9 T;  4Z02 A;  2K4Y A;  1ZUK A;  4F7U E;  1CKB A;  3HFO A;  2HL3 A;  3QWX X;  5GAO m;  3SWN B;  1WX6 A;  1VQL Q;  1D1C A;  2CZ6 B;  5IHK A;  4OMO A;  1UJ0 A;  2KRO A;  3KUF A;  4AG1 C;  4FYV B;  3X28 B;  5GAN g;  1M2O A;  3M0P A;  1D0X A;  3CPF A;  3M56 A;  4JLG A;  1I5O B;  3CXC P;  4ZGJ B;  3A98 A;  2RHU A;  2RHZ A;  2EPD A;  3L2V A;  6AT1 B;  4LDX A;  1Q86 R;  1A0N B;  3I5S A;  1GFD A;  2C06 A;  1Z9Z A;  3I9Q A;  3M58 A;  1Y96 A;  1G2B A;  4LDV A;  4N4I A;  2QEX T;  4LD9 K;  4FYX B;  4QW2 A;  2EJ9 A;  1B07 A;  2CP7 A;  3LYI A;  1ZBX A;  4C0Z A;  4XTV A;  2LCS A;  2LQN A;  2ZAE A;  3CCQ A;  1Q86 U;  4E2F B;  1QP2 A;  2HMA A;  2AZS A;  3RUX A;  3JAM E;  5EG2 A;  1PD1 A;  3PVL A;  2YSQ A;  2F2W A;  1V1C A;  1FXX A;  2YUP A;  3RMQ A;  5GAN d;  1ABO A;  1WJR A;  2CSI A;  3V7C A;  1Y71 A;  1VQ6 A;  5IHN A;  5GAM h;  4M7D F;  1XTD A;  2PTK A;  3CCM Q;  5GAO n;  1YJN T;  3VKI A;  2D8H A;  2DMO A;  1B34 B;  2MMP A;  4M75 A;  3QDR B;  4MDW A;  2D0Q B;  2LJ3 A;  3EHQ A;  2F2X A;  3MP6 A;  4PJN A;  2ZPG B;  4M7D C;  2M0Y A;  3QKJ A;  1RI9 A;  1WJS A;  2QEX Q;  3CMA T;  3JCM Q;  1AHJ B;  1VQO A;  4M75 F;  3JCM h;  4LDU A;  1UGS B;  1YIJ A;  1D0Z A;  4Y91 A;  2MCN A;  2YLB A;  3UA7 A;  2J06 A;  2E70 A;  2K6D A;  1ABQ A;  4BDY A;  3EH1 A;  4M75 C;  1MND A;  1MMD A;  2E41 A;  1BYM A;  3DLM A;  1O75 A;  4C5H A;  2EBP A;  2JMA A;  4ELY C;  1QCF A;  3OB9 A;  3CCU T;  4ELZ C;  1YJN Q;  5GAN e;  3CD6 Q;  1Y96 B;  5LJ3 h;  1SG5 A;  4CI0 C;  2QA4 A;  4FU6 A;  4ZGD B;  2DXB A;  3EGX A;  3URG A;  1AT1 B;  3EFO A;  2VB6 A;  1BI0 A;  4M7D B;  1BI2 A;  4B9X A;  3QBY A;  1AZG B;  2EJG A;  2FB7 A;  2MYS A;  3E2U A;  3JB9 D;  2EQU A;  2JXB A;  4C5I A;  2GQI A;  1VQ5 Q;  3HL8 A;  4GBQ A;  4AFZ C;  4CC3 A;  1KK7 A;  4M75 E;  1W2B P;  3OYJ A;  3CEY A;  1M3B A;  8AT1 B;  1UG1 A;  2QXF A;  3KFV A;  3BDU A;  2RNA A;  2ENM A;  1M8M A;  2AIR B;  2G6F X;  4RCC A;  4D8K A;  4J6W A;  4XTX A;  3I56 Q;  4X34 A;  2KXC A;  1D3B A;  5GAN 3;  2JT4 A;  8ATC B;  3CCR A;  1WXB A;  1K8A R;  2FRW A;  1DJ7 B;  2B86 A;  1B7T A;  2JUF A;  1RAA B;  4IUU A;  1NEB A;  3P8H A;  4BI4 A;  2IPO B;  2O88 A;  2XDB A;  2KK4 A;  2KYM A;  3QPH A;  1WNL A;  3OYA A;  1QVG S;  5FWC A;  4RCB A;  2FHD A;  1QVF A;  2HKN A;  2L0A A;  4NS5 A;  2EW3 A;  5DY9 A;  1K8A U;  3HHT B;  1QMC A;  4RG8 A;  1D09 B;  1YHQ Q;  2RHX A;  2Y90 A;  1RLP C;  1OUL A;  1JJ2 A;  2XID A;  2P84 A;  2MIO A;  1G3Y A;  2JMC A;  5I22 A;  2HDA A;  3TRE A;  2CGH A;  3L2Q A;  4HCZ A;  2JVV A;  2CUD A;  3PMI A;  3M4G A;  4BDZ A;  4J6X A;  1KQ2 A;  1AWO A;  2DVJ A;  1GBQ A;  1ZQ1 A;  2OJ2 A;  2OTJ T;  1VQ4 Q;  2LRQ A;  3A8M B;  1G3S A;  2OAW A;  2VYT A;  4IUT A;  3EG3 A;  3FEO A;  2LC4 A;  2LNV A;  4BD3 A;  1X27 A;  2DF6 A;  3CCM A;  3CPW S;  3L1A A;  3MP8 A;  4Y92 A;  4C0D B;  1AWX A;  2GFA A;  2JJ9 A;  5ECA A;  1Q82 C;  1NE8 A;  1AOJ A;  2DYI A;  3G6E T;  3KBG A;  2BIV A;  4FSS A;  3OYL A;  3CC7 Q;  2QQB A;  4OMP A;  1YIT Q;  1C6V X;  5GAM j;  2RO0 A;  3CC4 T;  1VQ7 A;  4L5G A;  3JCM c;  3TQ7 P;  5KYX B;  3RDV A;  4RMO A;  1Q7Y C;  4DBF A;  5D6W A;  1H3H A;  2EGC A;  1KD1 R;  3C95 A;  4HCB A;  3AHU A;  5A0L A;  3C94 A;  3VJP A;  4FCY A;  4O5V A;  3QDF A;  4MZT A;  3EH2 A;  5IH2 A;  2VUB A;  4ZN1 A;  2DTO A;  4J83 A;  2EKH A;  2HBW A;  3QWY A;  2VGM A;  2E64 A;  3CCE Q;  3CD6 A;  4J7I A;  2LJ1 A;  4PJO D;  4LDY A;  2L89 A;  1IHV A;  3PVQ A;  4IIO A;  2LQ8 A;  2VAS A;  4LD6 A;  5IT9 E;  1UEC A;  4NL2 A;  1ZUU A;  5GAO l;  3OYI A;  1IHW A;  4XTY A;  2M16 A;  4M78 A;  2E3I A;  2RQV A;  4E7L A;  4F7U G;  1XQH A;  3CQT A;  5LJ3 j;  1I4K 1;  2KI7 A;  5FRO A;  1ZSZ A;  4A4E A;  3E1S A;  3L42 A;  1I81 A;  1VQ5 A;  4JRK A;  1HXD A;  4FSX A;  3CXC A;  3CCQ T;  1UFF A;  2GF7 A;  2M1H A;  3PNW C;  4ORZ A;  1I1J A;  3OW2 S;  2NYS A;  1N27 A;  1YN8 A;  1S72 Q;  3X26 B;  4F14 A;  3NTK A;  3S6W A;  3OYY A;  1Q86 C;  2VGN A;  2OTL T;  3I56 A;  3SDZ A;  4A4G A;  2V8I A;  1VQ6 T;  1E6G A;  4KGV B;  3EFS A;  1W6X A;  4JJN K;  2DYB A;  2RHY A;  1JO8 A;  2E65 A;  1ARK A;  2QQR A;  1G5V A;  3QXE B;  1OZ3 A;  1FWZ A;  1S1N A;  1X43 A;  3GP8 A;  2QK0 A;  3A1P A;  4GLK A;  2JZ2 A;  3C12 A;  4XAX B;  1VQO T;  1X69 A;  1YIJ T;  4DBH A;  1PSF A;  2IIM A;  1YHQ A;  1HK9 A;  2DXT A;  2CSQ A;  2AT1 B;  3OSV A;  4M78 E;  3NTH A;  5CR2 A;  2RI5 A;  2XHC A;  4E7K A;  3G7Z A;  2K3B A;  2RQT A;  3FJP A;  1I8F A;  4A4K A;  2R57 A;  2RM4 A;  1JRI A;  1WZO A;  2FVU A;  2H8H A;  2QA4 T;  3NPF A;  1CKA A;  1GCQ C;  2E6Z A;  2RPN A;  1TUG B;  3VS4 A;  4LUD A;  4ZTF A;  4J9B A;  2M02 A;  3JCM f;  2CT4 A;  1VQ4 A;  3H6Z A;  1MMA A;  4QT7 A;  4C0F A;  2J6F A;  4N4G A;  2DL5 A;  3OY9 A;  4Q5W A;  2NUP A;  1JQQ A;  4XU1 A;  3CCJ Q;  1QP3 A;  4M7A A;  3VYG A;  2BE9 B;  1C0M A;  1KFZ A;  2PVO B;  1OU9 A;  3E9G A;  3NGP A;  1UGQ B;  1MHN A;  2KNB B;  3OYD A;  2EWN A;  5GAM g;  4FT4 A;  4DQ2 A;  3MCA B;  1ZX6 A;  1RAG B;  5CKB A;  2J05 A;  5LJ3 f;  5IXB A;  1OPL A;  3O8V A;  4C8Q F;  5LJ5 h;  4KH1 B;  5HK0 A;  3EG0 A;  3CC7 A;  1NJI U;  4M7A F;  1G83 A;  1YBY A;  3JCM W;  3TSW A;  2EYY A;  1I07 A;  1PD0 A;  5KYY B;  1YIT A;  3PGG A;  1X75 C;  3P8B B;  2JM9 A;  2DXC A;  4D6W A;  3BW1 A;  1BK2 A;  2QA4 Q;  4RTW A;  4R56 A;  2J6O A;  1KSW A;  2KVQ G;  4C8Q C;  4PFZ A;  5GMK h;  1W2B A;  1VQP Q;  2PNI A;  1U1S A;  3CCR T;  3JCM g;  4M75 G;  3G71 A;  2XU8 A;  4PLL A;  4Z88 A;  2NUT B;  1M4Z A;  4M4Z A;  4E7J A;  2QG9 B;  1KQ1 A;  4JPB W;  5KH6 A;  4QQ6 A;  1ACM B;  1KHI A;  2C0T A;  3CCE A;  2DAQ A;  2E3H A;  3RNJ A;  3CPW P;  3SB2 A;  5HCK A;  3CCS A;  4F16 A;  5LJ3 g;  3QZ9 B;  4RTY A;  4LUE A;  1N5Z A;  1K8A C;  5KE2 A;  2BZY A;  4IUV A;  2VC8 A;  1ZA2 B;  3CC2 A;  5CKD A;  1KHC A;  2RJC A;  4OVA A;  3CBM A;  3OYM A;  3VUZ A;  1ZA1 B;  3LGF A;  1PRM C;  5KYU A;  5CKH A;  4M7A E;  3VYH B;  3JCM d;  1PNJ A;  3CCR Q;  4C8Q B;  3EGD A;  1WPY A;  3RER A;  2FL7 A;  1H64 1;  1PCX A;  4EMH A;  2CT3 A;  3H0I A;  2YHT A;  2JN0 A;  2D9T A;  2P4R A;  1S72 A;  5D7U A;  2DET A;  2CKK A;  4F7U B;  5KYN A;  2RQR A;  2V8K A;  3M55 A;  2NWM A;  1WFW A;  3U23 A;  2F69 A;  3IQL A;  2I0N A;  4OB3 B;  5LJ3 d;  5DLQ E;  2BZ8 A;  3CCM T;  5GAM e;  5GJW B;  1AWW A;  2LNH B;  2K5I A;  1T0J A;  1ZHI A;  1N9S A;  4OB2 B;  1YJW Q;  2FO0 A;  1JB0 E;  2MAM A;  3UT1 A;  5KE3 A;  4E7S A;  1SHF A;  2DJZ A;  3TVT A;  3UF4 A;  2FEI A;  1VQ7 T;  1UEB A;  5DLO A;  1YNZ A;  1TG0 A;  1M1G A;  5CIU A;  3UPU A;  1IRX A;  4Y28 E;  4ZTJ A;  3OS2 A;  3JCM e;  1NZ9 A;  1WXU A;  3EFR A;  1PKT A;  3QG1 A;  3A8O B;  1SKU B;  5CAI A;  1WLP B;  1K4U S;  4OGC A;  3OW2 P;  3M0Q A;  2YUQ A;  4BUG A;  2V26 A;  1M9S A;  2XD0 A; 
#chains in the Genus database with same CATH homology
 2RI3 A;  1QVG S;  3SWN A;  3P8D A;  4RCB A;  1EIF A;  2FHD A;  1QVF A;  4M7A D;  2P4T A;  1M90 U;  4M7A C;  1MGQ A;  1NPP A;  2O4X B;  4NS5 A;  3CBP A;  3CD6 T;  2P0Q A;  4J7F A;  1Q81 C;  1KQS S;  5DY9 A;  3QJY A;  3ZBD A;  3M5A A;  2PVG B;  4MMK A;  1K8A U;  3N5B B;  2OAU A;  5LJ3 e;  3HHT B;  2H3J A;  3FB9 A;  3PT9 A;  4PL6 A;  5FU7 C;  3FC3 A;  4RG8 A;  4M7D D;  2V8J A;  4M78 D;  2XDP A;  4HT9 A;  3PTA A;  1KD1 C;  2WSF E;  2RHX A;  2Y90 A;  3PIO A;  3INZ A;  4MZP A;  1YJ9 A;  3GNF B;  1JJ2 A;  2XID A;  1XOV A;  3HFN A;  3CME A;  2RJD A;  3MET A;  1G3Y A;  3OBY A;  1G3W A;  5IAY A;  1VQ5 T;  2XIC A;  2HD0 A;  5HK3 A;  3TRE A;  5GAM d;  2CGH A;  4JLI A;  2EQJ A;  3CCU A;  3CCJ A;  3L2Q A;  3NFC A;  1M1K C;  4MZM A;  3OYC A;  3GF5 A;  4HCZ A;  2JVV A;  3OSS C;  1RL2 A;  3PMI A;  3ASK A;  3M4G A;  2MWO A;  3FLG A;  4J6X A;  3X20 B;  4BDZ A;  1KQ2 A;  1U1T A;  2GCX A;  3WVD B;  3HP9 A;  2VXE A;  3MEU A;  4M75 D;  3CCL T;  1K73 U;  1BKB A;  5J39 A;  1RI0 A;  4PJO B;  2RJF A;  4KBM B;  4KT0 E;  4BI8 B;  1VIE A;  1ZQ1 A;  4C5G A;  5GAN 4;  1YJW T;  3PMT A;  2OTJ T;  3V7S A;  2WSE E;  5GAN 8;  2LRQ A;  3A8M B;  4A53 A;  4EMK C;  5GAN j;  2HAX A;  3LLR A;  2RK1 A;  1IRE B;  2PU9 B;  2EQK A;  1G3S A;  2EQM A;  5LL6 S;  3FDR A;  3G6E A;  2VYT A;  5GMK m;  4IUT A;  1U8R A;  2IG0 A;  2EJF A;  3FEO A;  2DIG A;  2LC4 A;  4M7A B;  2LNV A;  3I56 T;  1KG1 A;  2XI9 A;  3M57 A;  4BD3 A;  4FT2 A;  3M54 A;  1I5L A;  1M1F A;  2DVE A;  5M9O A;  1N8R U;  2D6F A;  3BDL A;  3JCM X;  3UDC A;  3CPW S;  3CCM A;  1VQM T;  3L1A A;  3MP8 A;  1VQP A;  3JB9 J;  5FU7 B;  4C0D B;  2K3X A;  2QTX A;  2GFA A;  3L2U A;  2LTO A;  1B34 A;  2DTI A;  5KCH A;  1Q82 C;  1NE8 A;  2E12 A;  3PFS A;  4C92 D;  5CK9 A;  5LJ5 j;  2K2V A;  3OBW A;  2JNG A;  4R55 A;  3VUB A;  3MEW A;  3KXT A;  5AYF A;  3G6E T;  1WQW A;  2ZPI B;  3KBG A;  2MF2 A;  2K5L A;  4GY5 A;  2BIV A;  3OYL A;  1WJQ A;  3GIB A;  2QQB A;  4PNO A;  5FLX E;  3JCM J;  5FRM A;  2RJE A;  1BI1 A;  2JTM A;  3OYF A;  2FYK A;  1QW1 A;  3A8H B;  3GLX A;  4BB7 A;  2RO0 A;  4QQG A;  5GAM j;  3CC4 T;  1VQ7 A;  4L5G A;  2O01 E;  3OS0 A;  3JCM c;  5GAN 2;  3M53 A;  4HT8 A;  2DZC A;  2M9U A;  3MHX A;  2IVW A;  5GMK e;  4RMO A;  2EIF A;  2LQK A;  3RMS A;  1Q7Y C;  4M77 A;  5J3B A;  4HKE A;  4M77 G;  3RKW A;  2EKO A;  4XTU A;  3QO3 A;  5D6W A;  4P5N A;  3OQ5 A;  3S3N A;  3BY7 A;  3C95 A;  3LW5 E;  5A2Q E;  5A0L A;  3C94 A;  4HCB A;  4M75 B;  3AHU A;  2LT1 A;  1YHQ T;  1TH7 A;  2X4X A;  3QYH B;  4J6Y A;  3VJP A;  4O5V A;  2QI2 A;  4MZT A;  3LH0 A;  3MP1 A;  1YI2 A;  4EPC A;  4ZGE B;  4EMK B;  2KQW A;  2VUB A;  4ZN1 A;  1Q81 U;  4ME7 A;  2AHJ B;  2XG8 D;  1O9S A;  1QVP A;  2MWP A;  4JUV A;  3V8L A;  2DTO A;  3DKM A;  5GAO r;  4J83 A;  2MI6 A;  2A3L A;  4J5Y A;  4M77 F;  4OP0 A;  2GFU A;  2VGM A;  2E64 A;  3CD6 A;  4J7I A;  4HA8 A;  4PJO D;  4LDY A;  2L89 A;  4C8Q A;  4C5E A;  4QVZ A;  3CMA A;  2LQ8 A;  2LX9 A;  5GAN 7;  4LD6 A;  4VUB A;  5IT9 E;  2NLU A;  1W2B S;  2BKD N;  3EAE A;  4M77 C;  4NL2 A;  2CYZ B;  2PUK B;  4C92 B;  4ZN3 A;  1KC8 C;  5IN1 A;  5GAO l;  4JS4 A;  1OI1 A;  3OYI A;  2LDM A;  4XTY A;  1BIB A;  5A0D A;  1VQ4 T;  2EFI A;  2M16 A;  1M1K U;  4M7D A;  4M7D G;  1X6O A;  4M78 A;  4M78 G;  4F7U A;  4E7L A;  1UGR B;  1UB4 A;  4O6J A;  1XQH A;  4F7U G;  2K57 A;  1K9M C;  5LJ3 j;  2ZGW A;  1I4K 1;  5FRO A;  3L2W A;  5GAO q;  1M8V A;  1GXI E;  4A4E A;  2ZPB B;  3E1S A;  5A0G A;  3R6O A;  2OTL A;  2DEQ A;  3L42 A;  1I81 A;  1VQ5 A;  4JRK A;  3TEE A;  2Y4Y A;  1HXD A;  4FSX A;  5L8R E;  4J8O A;  4E47 A;  5I2S A;  4BE1 A;  2KY9 A;  1X01 A;  3OYE A;  2DZ9 A;  3CXC A;  3JB9 H;  3CCL A;  4OMF B;  3CCQ T;  4X9D A;  1SSF A;  2GF7 A;  4II1 A;  5D6X A;  4F7U F;  2M1H A;  4JRI A;  3PNW C;  2QQ9 A;  2ZPE B;  5D6Y A;  1YJW A;  1YCY A;  4X9C A;  4XTZ A;  2OTJ A;  5CKE A;  3OW2 S;  1R8O B;  4JS5 A;  1N27 A;  5I21 A;  5CO7 A;  3CC7 T;  3FRN A;  3X26 B;  2Y4X A;  2HBP A;  3NTK A;  4TVR A;  3LX7 A;  3OYY A;  3S6W A;  4B9W A;  1Q86 C;  1VQK T;  1YIT T;  2VGN A;  1VQN T;  2RK2 A;  3SWN C;  2OTL T;  2KDS A;  1M5Q 1;  1KQS A;  4XQ3 A;  3I56 A;  3SDZ A;  3MEV A;  3J7A F;  4A4G A;  1BIA A;  3JCM P;  1Q82 U;  4QVC A;  2V8I A;  1VQ6 T;  1V29 B;  1BI3 A;  3HRT A;  3EFS A;  5DM7 R;  2E5Q A;  4JJN K;  4M77 E;  2RHY A;  1VQM A;  1VQL T;  2E65 A;  3QJ6 A;  3V8K A;  2BUD A;  4BE0 A;  3M9Q A;  5GAN f;  2KAF A;  2L3R A;  3A8G B;  2QQR A;  3G71 T;  3HKS A;  4XTW A;  3TCJ A;  4NL3 A;  5GMK i;  4L6V 5;  1G5V A;  3QXE B;  1OZ3 A;  2DKG A;  3X24 B;  5GAN 6;  1FWZ A;  4N4H A;  2G3R A;  4DA4 A;  3HSB A;  3M4Y A;  2XKO C;  3JSC A;  1Q7Y U;  1WGS A;  3GP8 A;  3G4S T;  3CC4 A;  2JOY A;  4GLK A;  2LT4 A;  2L8D A;  2DPP B;  2E10 A;  1VQ8 T;  3DLL A;  3CCE T;  2O4X A;  2JZ2 A;  2RA2 A;  3C12 A;  1WQ7 A;  3HRS A;  4RKU E;  2X4W A;  4XAX B;  3JB9 G;  1VQO T;  1D3B B;  4C8Q E;  3OYH A;  1YIJ T;  1W4S A;  1N6A A;  5GAO p;  1FX7 A;  2VV5 A;  1PSF A;  5CQX A;  3CCS T;  1OZ2 A;  2ZCF B;  3X25 B;  2A7Y A;  4IUR A;  1YHQ A;  3JCM b;  3OS5 A;  1HK9 A;  1VQ9 T;  4Z02 A;  2DXT A;  2K4Y A;  4KUL A;  2LCL A;  3OYK A;  3OSV A;  4BE2 A;  4M7D E;  4JRQ A;  4M78 E;  1VIF A;  3NTH A;  4F7U E;  3OS1 A;  3CC2 T;  3HFO A;  3JB9 I;  3L2R A;  5GMK j;  5CR2 A;  3S3O A;  3JB9 F;  2RI5 A;  2K5F A;  5GAO m;  3SWN B;  3LWI A;  3QHS A;  4FL6 A;  1IZ6 A;  2KSS A;  2XHC A;  4E7K A;  2R5M A;  3G7Z A;  4ATO A;  2CZ6 B;  3FJP A;  3CPW A;  4XU0 A;  1I8F A;  1KC8 U;  4A4K A;  2R57 A;  3KUF A;  1VUB A;  3LWH A;  3X28 B;  4BAC A;  5GAN g;  2RM4 A;  1JRI A;  3L2Z A;  2FVU A;  3ME9 A;  4CRI A;  3CPF A;  4KUI A;  3HRU A;  3M56 A;  2QA4 T;  3OYN A;  2PVD B;  2E6Z A;  4JLG A;  4PJO A;  5CCA A;  4MDX A;  4YTL A;  4PJO G;  4ZGJ B;  2B8A A;  1K9M U;  4EMG A;  4ZTF A;  2RHU A;  2RHZ A;  3RES A;  3JCM f;  3L2V A;  1VQ4 A;  3H6Z A;  4LDX A;  1S72 T;  4C0F A;  4XK8 E;  3CCV T;  4N4G A;  3OY9 A;  2PUO B;  4Q5W A;  4A54 A;  4DOV A;  2C06 A;  5FRN A;  3M58 A;  3LGL A;  1Y96 A;  4HCC A;  3OMC A;  4XU1 A;  2WAC A;  4LDV A;  4C8Q G;  5LJ5 g;  5GAN h;  4N4I A;  4A4F A;  1QP3 A;  4M7A A;  4M7A G;  3VYG A;  2X35 A;  4OGE A;  2QEX T;  1QVF S;  4LD9 K;  4QW2 A;  2EJ9 A;  2XDD A;  4M77 D;  3I55 T;  3LYI A;  1ZBX A;  3PIP A;  4IUP A;  2PVO B;  4C0Z A;  4XTV A;  1OYX A;  2RH2 A;  3E9G A;  4A4H A;  3S3M A;  1UGQ B;  3CCQ A;  4IUQ A;  1MHN A;  3OYD A;  2EWN A;  5GAM g;  1Q86 U;  4FT4 A;  4DQ2 A;  3M59 A;  3FIF A;  3MCA B;  5C0M A;  5CQY A;  1QP2 A;  5CKB A;  3RUX A;  5LJ3 f;  3DB4 A;  3JAM E;  3O8V A;  5EG2 A;  4C8Q F;  5LJ5 h;  2DTH A;  4QVD A;  5HK0 A;  3C4S A;  3WXM B;  4OB1 B;  3CC7 A;  1NJI U;  4M7A F;  1YBY A;  1JJ2 S;  3JCM W;  1VQK A;  2DD5 A;  2I2L A;  1YIT A;  1FXX A;  1VQN A;  3PGG A;  3RMQ A;  2KMT A;  2DD4 A;  5GAN d;  2JTF A;  3QSU A;  1H3Z A;  1X75 C;  1WJR A;  3P8B B;  2L5Q A;  3V7C A;  4IKF A;  2DXC A;  4KUD K;  1Y71 A;  4D6W A;  3BW1 A;  1VQ6 A;  4R56 A;  3GNG A;  5GAM h;  1XTD A;  2KVQ G;  4M78 F;  2ZZD A;  4C8Q C;  4M7D F;  4PKC C;  1VQL A;  2LVM A;  5GAO n;  5GMK h;  3Q1J A;  1YJN T;  3VKI A;  1W2B A;  1B34 B;  2MMP A;  1U1S A;  2PQW A;  3CCR T;  4M75 A;  3JCM g;  3QDR B;  4M75 G;  4MDW A;  5CVI A;  2D0Q B;  3HPW A;  3G71 A;  1QVG A;  2XU8 A;  4PLL A;  3RIR A;  4C0D C;  1M4Z A;  3MP6 A;  3QYG B;  2ZPG B;  2RI2 A;  4M7D C;  2ZPF B;  5LJ5 d;  4E7J A;  3QKJ A;  4M78 C;  1KQ1 A;  2R58 A;  4XU3 A;  1UGP B;  1WJS A;  2HQE A;  4EMK A;  5KH6 A;  4QQ6 A;  1NJI C;  3GPL A;  3CMA T;  3JCM Q;  1AHJ B;  3OYB A;  3G4S A;  4EDU A;  2HNI A;  1KHI A;  3CCE A;  1VQ8 A;  2DAQ A;  2DXU A;  5FU6 C;  1VQO A;  4M75 F;  3JCM h;  2P0K A;  4FIB A;  4LDU A;  1UGS B;  2EYQ A;  2F5T X;  3OMG A;  4M77 B;  5HKC A;  5CKF A;  1YIJ A;  3SB2 A;  1Y7X A;  4Y91 A;  2YLB A;  4XU2 A;  1M90 C;  2LCC A;  3UWN A;  3JRZ A;  4BY6 C;  3QUI A;  3CCS A;  2E70 A;  5LJ3 g;  2QDY B;  3QZ9 B;  4PJO E;  3ER0 A;  3V8J A;  3OW2 A;  4C92 A;  1VQ9 A;  4C92 G;  4BDY A;  2YLC A;  1YJ9 T;  5KE2 A;  1K8A C;  4M75 C;  4IUV A;  2VC8 A;  3H8Z A;  3ZEH A;  2E41 A;  3CME T;  4C0G A;  3CC2 A;  1BYM A;  3A5Z B;  5CKD A;  3DLM A;  1KHC A;  1O75 A;  2RJC A;  4OVA A;  4MML A;  4C5H A;  3CBM A;  3OYM A;  5LJ5 f;  3VUZ A;  4PLI A;  1N9R A;  3LGF A;  3JCM V;  4ELY C;  3OB9 A;  5CKH A;  3CCU T;  5KCO A;  3CCJ T;  4M7A E;  4RG2 A;  4ELZ C;  5GAN e;  3VYH B;  1Y96 B;  2WSC E;  3BFM A;  5LJ3 h;  3JCM d;  4C8Q B;  4CI0 C;  4DOW A;  1WPY A;  2CS7 A;  3VV0 A;  4C92 F;  3RER A;  2QA4 A;  5GAM f;  2FL7 A;  4FU6 A;  1H64 1;  4N0A A;  4ZGD B;  4EMH A;  2DXB A;  3URG A;  3CBO A;  1LOJ A;  2YHT A;  2JN0 A;  3E9F A;  4V2S A;  3QII A;  3SFM A;  2D9T A;  4L59 A;  3J80 E;  1BI0 A;  1Y07 A;  1S72 A;  4M7D B;  4M78 B;  2CKK A;  1LNX A;  4F7U B;  3CCV A;  4C92 C;  2YRV A;  1BI2 A;  1K73 C;  2M0O A;  4B9X A;  5LJ5 e;  3QZ5 B;  3DB3 A;  3QBY A;  5I2M A;  2EJG A;  2V8K A;  2FB7 A;  3M55 A;  2DIQ A;  2DO3 A;  2VXF A;  3J81 E;  3JB9 D;  2EQU A;  2QEX A;  2F69 A;  4OB3 B;  5LJ3 d;  5DLQ E;  5FU6 B;  4C5I A;  3I55 A;  4WF2 A;  4E7I A;  3HL8 A;  3CCM T;  5GAM e;  2DK3 A;  4E7H A;  1VQP T;  4C8Q D;  2QQA A;  4M75 E;  4BY6 B;  2K5I A;  2ZPH B;  2EAY A;  5C6S A;  4UC4 A;  1ZHI A;  5HY6 A;  1N9S A;  4OB2 B;  2X4J A;  5GMK l;  1N8R C;  4OB0 B;  3ZFJ A;  1P92 A;  4LDW A;  3OYJ A;  4N0A C;  3CEY A;  2E6N A;  1JB0 E;  2MAM A;  2RD1 A;  2GQV A;  2QXF A;  4JDS A;  3UT1 A;  5KE3 A;  3BDU A;  2DJZ A;  1XNI A;  1JBM A;  2QQS A;  3RKX A;  3TU4 K;  3E19 A;  4RCC A;  2CZ1 B;  4PJO F;  4J6W A;  1VQ7 T;  1UEB A;  3RKY A;  4XTX A;  5DLO A;  5GAN 5;  4JRP A;  1M1G A;  5CIU A;  2XK0 A;  3UPU A;  1LJO A;  3MEA A;  3MO8 A;  4Y28 E;  4BI3 A;  1G3T A;  4X34 A;  3A8L B;  3NTI A;  1PSE A;  3GOX A;  1D3B A;  2P0P A;  4ZTJ A;  5GAN 3;  3F70 A;  3OS2 A;  3WVE B;  3JCM e;  2X4Y A;  1YJN A;  4OF1 A;  1NZ9 A;  3T9N A;  1KD1 U;  3EFR A;  2R5A A;  3QG1 A;  3CCR A;  4PJO C;  2E1H A;  3A8O B;  1DJ7 B;  4C92 E;  3CXC S;  3SD4 A;  2CZ0 B;  4QQD A;  2F5K A;  2JUF A;  2RHI A;  1NPR A;  4IUU A;  5J26 A;  5CAI A;  4OGC A;  1YI2 T;  3V7R A;  2K3Y A;  3P8H A;  4BI4 A;  3OYG A;  3VU3 C;  2CZ7 B;  2HQX A;  4NOY A;  2XDB A;  4BUG A;  2KK4 A;  1M9S A;  1WNL A;  3QPH A;  4FM4 B;  3OA6 A;  2XD0 A;  2RB6 A;  3OYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...