5IAYA

Nmr structure of uhrf1 tandem tudor domains in a complex with spacer peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
152
structure length
152
Chain Sequence
LYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Hemi-methylated DNA opens a closed conformation of UHRF1 to facilitate its histone recognition
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 152
sequence length 152
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5iayA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5iayA01
2E5QA 3CCRA 2QEXT 3UT1A 4OVAA 1S72T 2DIGA 2DO3A 2M1HA 2R5MA 1WJRA 2RJCA 4A4FA 4C5GA 1G5VA 2NLUA 3ASKA 1VQLA 3CC2A 2RI3A 3OYGA 4ZTJA 3ZEHA 3OYAA 3CC7T 3OS0A 4PLLA 4QQDA 1Q82U 1K73U 4IUVA 3CCQT 3J80E 5J39A 2JNGA 1YITT 2OTJA 1NPPA 3O8VA 1VQ5T 3I55T 1YHQA 3OYKA 1Q81U 4A4HA 1KC8C 5D6YA 3CD6A 3ER0A 3L2WA 3G6EA 2EIFA 2K3YA 3OY9A 2RHYA 3QIIA 2LDMA 2JOYA 4IKFA 1WJQA 5M9OA 3PNWC 2GFUA 3LGLA 4BACA 3E9GA 3H6ZA 3I56A 1BKBA 1KQSS 3GOXA 4IUUA 1VQ7A 3MP6A 3CCET 1VQ8T 2JVVA 3CCMT 3CMAT 5J3BA 3L2VA 3OYYA 2X4WA 1M1KC 3FDRA 3CCUA 1IZ6A 1QVGS 4IUQA 4BE2A 2RHIA 3CCVT 3FC3A 4QW2A 4E7KA 3G4ST 2R57A 2GF7A 1YJ9A 4QVZA 2CKKA 3CXCS 5KE2A 1WJSA 3CPFA 2MI6A 2LRQA 1YJWT 4BDZA 4IUTA 1Q86U 1WGSA 3HKSA 3OYFA 2RHUA 3MEAA 2XHCA 1OYXA 4ZN1A 1YI2A 3OA6A 1NZ9A 2PQWA 2LQ8A 4E7HA 4QQGA 1VQ6A 4E7IA 1QVFA 4L59A 5IAYA 1YJNT 2BIVA 3EAEA 5FRNA 2RO0A 2M16A 3C4SA 4IURA 1YIJA 4RG2A 4PLIA 3E9FA 3G71A 3CCJT 3CPWS 2MWOA 5LL6S 3DLLA 4A4EA 2QQRA 1Q82C 1K73C 3OYHA 4X34A 3DB4A 2RJFA 2L3RA 3LYIA 3MP8A 1K8AU 3SD4A 3CCLA 2LCLA 1Q81C 2L8DA 2KVQG 1VQLT 3F70A 3CC2T 3DB3A 2EQMA 2R5AA 2EFIA 2EQKA 2LCCA 3CMEA 3PIOA 2BKDN 4BD3A 2FHDA 1M90U 4Z02A 5DLQE 3S3NA 2DAQA 4B9XA 3OS2A 2OTJT 3LLRA 3NTKA 1N8RU 2P0KA 4QQ6A 2B8AA 3META 1RI0A 1YHQT 4UC4A 5KE3A 3OYDA 1KD1U 2EQJA 2QA4A 1VQ9T 3S3MA 2K3XA 3CD6T 1OI1A 5FROA 5A2QE 3NTIA 1M1GA 4TVRA 3OYNA 1YBYA 2IG0A 1KQSA 1VQ4A 4CRIA 5CIUA 3L2UA 1W2BS 3CCMA 3DLMA 2XK0A 3M9QA 3I56T 4BE0A 2RJDA 1VQPA 1VQ7T 3CEYA 4C5HA 1OZ3A 1VQMA 1QVGA 3P8HA 4II1A 1Q86C 1VQNA 1UEBA 1SSFA 3OQ5A 1VQOA 3MEUA 3CCUT 3PIPA 3LX7A 3A5ZB 4Q5WA 2JTFA 3CXCA 3MEVA 3H8ZA 1YJ9T 3L2QA 3OS1A 3L2RA 4BE1A 4N4GA 3CC4A 3PFSA 2O4XA 4EDUA 3P8BB 1VQKA 1H3ZA 4B9WA 3J7AF 2L89A 2X4XA 3QBYA 1K9MU 4FU6A 2BUDA 2OTLA 3NTHA 2RI2A 2DIQA 3OYIA 1NJIU 2D9TA 1EIFA 4A4GA 1YI2T 3KUFA 2GFAA 3L42A 5KCHA 2EKOA 1K8AC 3OYCA 5D6XA 1JJ2S 2E6NA 1VQ6T 3OYEA 2R58A 2JZ2A 3CCSA 3MP1A 1Q7YU 1XNIA 1JJ2A 2YRVA 2QEXA 3CPWA 3QKJA 2O4XB 1S72A 4NS5A 3PMTA 3CCRT 1YIJT 2KDSA 3G71T 3OYBA 5C6SA 3ME9A 1M90C 3OYLA 3OMCA 4BDYA 3LH0A 3OB9A 4PL6A 5FRMA 3CC7A 3BDLA 2LVMA 3J81E 1N8RC 3CCQA 3CCLT 1YITA 3OYJA 1KD1C 3Q1JA 1MHNA 1VQ5A 3I55A 5J26A 3MO8A 3CMET 4E7LA 2F5KA 2XDPA 4C5IA 2X4YA 2HQXA 1NPRA 4N4IA 3FEOA 2MWPA 3P8DA 2E6ZA 4ZN3A 3G6ET 4ZTFA 1VQ9A 1KHIA 2G3RA 2QA4T 3UWNA 3S3OA 2RJEA 5DM7R 3CCEA 1VQ8A 3CMAA 2RHZA 5C0MA 4HCZA 1W2BA 1KC8U 2WACA 3MEWA 2X35A 1VQ4T 1KHCA 5D6WA 3CCVA 1X6OA 4E7JA 2JUFA 3G4SA 4C5EA 1VQPT 1VQMT 2VYTA 5HY6A 1VQNT 3S6WA 1K9MC 4YTLA 2RHXA 4FL6A 1YJWA 5IT9E 2EQUA 2M0OA 1VQOT 1NJIC 3OW2S 5IN1A 3QJ6A 1M1KU 3OW2A 5KCOA 5KH6A 4N4HA 3PMIA 3LGFA 3CC4T 4LD6A 1Q7YC 2HQEA 1VQKT 2LTOA 1YJNA 5FLXE 1XTDA 1N27A 2OTLT 3OYMA 3TREA 3OMGA 2E70A 1QVFS 1OZ2A 1RL2A 3FLGA 3CCJA 4IUPA 2RI5A 3KBGA 3JAME 2QQSA 4GY5A 3CCST
chains in the Genus database with same CATH superfamily
1OU9A 3CCRA 4J8OA 4F7UE 1VQKQ 4OVAA 1S72T 4M7DA 4N0AC 2R5MA 3VKIA 5CK9A 2XIDA 3CC2A 3OYGA 1Y96A 4ZTJA 4RUGA 3NGPA 3QZ9B 5GJVB 1YIJQ 4LUEA 1JB0E 4C92F 4KH1B 4HCKA 3J80E 5J39A 1YITT 2QDLA 1M2OA 3PGGA 2RA2A 2AK5A 1P92A 3FRNA 1VQ5T 2V1RA 4F14A 2HAXA 2LJ0A 2CZ7B 2O31A 5I22A 1IHWA 1KC8C 4M78F 1ACMB 2A0FB 2QXFA 1Y57A 5IHIA 1RAFB 3G6EA 2KR3A 4M7AD 2KT8A 1GBQA 2RHYA 3QIIA 2JOYA 3LGLA 2RK1A 3EG0A 5IXBA 5FU7C 4BACA 3H6ZA 4J6XA 2EVRA 3C94A 4IUUA 2BE7D 3CCET 4FYYB 5J3BA 2XDDA 2DXCA 2XMFA 2XI9A 3FDRA 4HCBA 2C0OA 2JMAA 4M7AE 1H641 3E19A 2DTIA 1NLPC 1X6BA 2QGGA 1NE8A 3VU3C 2CKKA 4CC3A 2DKGA 1GXIE 4BY6C 5KE2A 4C92A 1WJSA 4FYVB 2MI6A 3REBB 2ZPHB 4M75B 4BDZA 3CCMQ 1I5LA 4BI3A 2RPNA 1Q86U 3PT9A 3HKSA 1X2KA 2RHUA 2O9VA 2RMOA 2DL3A 1OYXA 4ZN1A 4M77B 3OA6A 2PQWA 2CH4W 1YN8A 4M78A 2HBWA 4FCYA 5FU6B 3VJPA 1Y71A 2XKOC 4L59A 1FMVA 4DEYA 5LJ3g 3BY7A 1N8RR 1C1AA 1RI9A 2FPDA 2Y4XA 1E6GA 1Y0MA 3BE3A 2K7AA 1BI1A 2HL5C 1WQ7A 4LUDA 1M30A 2NUTA 2K2VA 1SSHA 5CKHA 2ABLA 5GMKe 3OYHA 4X34A 3MP8A 1MV0B 3A8HB 2F1LA 4OMFB 1I07A 2FO0A 3QXEB 3N5BB 3X20B 3EG1A 2EQMA 3OSSC 2EFIA 3CMEA 1QCNA 2CP5A 3FIFA 2J7IA 1FMWA 1OQKA 2EJGA 2KEAA 3QDFA 3S3NA 4B9XA 2OTJT 2RK2A 4XTWA 2K5LA 3BFMA 1SG5A 1Y96B 2LJ3A 2P0KA 5LJ3e 2DBMA 4BI4A 4EIKA 2LX9A 1RI0A 4Z88A 4XAXB 1D3BA 4C8QF 4X9CA 1OOTA 2QA4A 3S3MA 5GAN7 1OI1A 5FROA 2KYMA 5A2QE 2CZ6B 4J7FA 2CSQA 1KQSA 5CIUA 1M1FA 3L2UA 1N6AA 3M58A 3M9QA 1O75A 3I56T 2M9UA 1VQ7T 2KRSA 2DPPB 3H0FA 2EJFA 2K79A 1VQ9Q 2ATCB 3OQ5A 3CD6Q 4AT1B 3LX7A 6AT1B 1X6GA 5AYFA 2RD1A 5LJ3j 1M3BA 4OMOA 4MZPA 2GTOA 1YJ9T 3X26B 1TS9A 4WTOB 2GQVA 3P8BB 1VQKA 3QUIA 3NMZC 2L89A 1WFWA 1RADB 4KBMB 4X1VA 4OB0B 2RI2A 2DIQA 3OYIA 2LQKA 3JB9G 1NJIU 2D9TA 4C8QA 4XTZA 3OYCA 1OEBA 2VUBA 2JXBA 1M5Q1 2E6NA 3TU4K 1W6XA 3OYEA 4LXCA 1MGQA 3MJXA 3TSWA 1B34B 2JT4A 2CREA 2YRVA 3QKJA 4OMPA 1QP3A 2J6FA 2LNVA 1WI7A 3ME9A 1OV3A 1YJNQ 1C6VX 1YI2Q 5GAN3 3OYLA 3LH0A 5CCAA 3CC7A 1PC0A 2DRMA 1XOVA 1N8RC 3E2UA 2AZSA 3SWNA 1WHMA 1EZZB 2JN0A 3H9NA 2K57A 3A8LB 4JRKA 2E3IA 2BZYA 2KNBB 3LH5A 3OS5A 1MHNA 4PJOF 3CCRQ 2SEMA 4D6WA 3QSUA 2BTTA 3I55A 3HRUA 2A7YA 3VS4A 5FU7B 5A0DA 4R56A 4C5IA 2HQXA 4N4IA 1GCQC 3HHTB 3HPWA 3QPHA 3JCMh 1Z9ZA 2VVKA 1KHIA 1EFNA 1XJWB 3UWNA 1AD5A 5DM7R 2WSCE 2PNIA 3RIRA 2FRYA 2O2OA 4BY6B 8ATCB 1WHLA 1W2BA 4C0GA 2WACA 3MEWA 2X35A 2HBPA 2QG9B 1VQ4T 5KYXB 2YUPA 2DYBA 2RQUA 2CZ1B 3G4SA 1QKXA 3G6EQ 1D0ZA 4AFUC 2FRWA 1VQMT 4F7UG 1M4ZA 1BU1A 4XU1A 1FXXA 2RHXA 4FL6A 1VQOT 1O9SA 2LQNA 2F5TX 1AWWA 2EJ9A 4RKUE 3TCJA 4PJOA 1GRIA 3X24B 5GANd 4Z89A 1M1KU 1N5ZA 4LDUA 1JEGA 1OX9A 1MUZA 2DJQA 1D1BA 1ZBJA 4HT9A 3LGFA 3CC4T 1U5SA 4PFZA 1PWTA 3UPUA 4RCBA 4OMQA 4V2SA 2SRCA 1RAAB 1PKTA 4CC2A 4RTTA 5A0GA 3I9QA 2ED1A 4F16A 3OMGA 1UFFA 1KIKA 1YWOA 1VIFA 5LJ5d 2NUZA 1OZ2A 3NHNA 3KFVA 4O6JA 4IUPA 3EGUA 2DETA 1PD0A 4M75F 1QQJA 2GGRA 2E5QA 2CP6A 1WXUA 3GP8A 2DBKA 1OPKA 2QEXT 3UT1A 2DIGA 4XQ3A 1TU0B 4JRPA 4A4FA 2RJCA 5GMKi 1SPKA 4M77F 2OTLQ 3QYHB 2RF0A 2NLUA 4NOYA 1PSFA 2RI3A 3M56A 3SDZA 4NL3A 1ZQ1A 2JW4A 3OYAA 4KGZB 4M78D 1IHVA 4M7AG 1Q82U 1K73U 3CCQT 1BYMA 4RTXA 2V8IA 4DA4A 1NPPA 4J9GA 2NYSA 1RUWA 1XQHA 1Q81U 5CKBA 4A4HA 2PVGB 2YT6A 5D6YA 1Q86R 2A28A 3CD6A 1I4K1 3L2WA 2OX7A 4AFSC 5KYUB 3M59A 4FSSA 4KRTA 3CMEQ 1VOMA 4IKFA 4GBQA 2VKNA 2ZZDA 1YCSB 4HVWA 2AHJB 3ULRB 1WJQA 3PNWC 3JCMf 2A36A 1KQSS 4OMNA 1EX4A 4M7DF 3GLXA 3TSZA 1VQ8T 2EQIA 2JVVA 4EMHA 3CMAT 2E3HA 3L2VA 3OYYA 2KAFA 1ZSGA 1E6HA 4M77A 2QA4Q 3CCVT 4QW2A 4E7KA 3HTRA 4GLKA 1G3YA 2HDAA 3ZFJA 2MIOA 2BE9B 5EC7A 2NUPB 1G8XA 1NYGA 2AT1B 4QVZA 1UGSB 4PJJA 3GNGA 1UTIA 4RTZA 4ATOA 2P0PA 3URGA 4QVDA 2FYKA 2G6FX 3CPFA 1YJWT 3CCEQ 2D1XA 1PHTA 2DE0X 1BK2A 1WGSA 3OYFA 3EG3A 3JCMQ 3MEAA 5GAOm 1IRXA 2C0TA 1YI2A 2ZPBB 5IHNA 1MMNA 2M02A 2HL3A 2FZKB 4XU2A 3RKYA 5LJ3h 5GANg 2EWNA 4AFZC 1VQ6A 4E7IA 4OB3B 3RMSA 1QVFA 2P84A 3CBOA 2KGTA 1WXTA 2DL8A 4LNPA 2M16A 3EFOB 5GAN5 1TUDA 4PLIA 3CCJT 4C0DC 5I2SA 4CI0C 2MWOA 4PJMA 4R0KA 3DLLA 3QWYA 3RESA 1BB9A 2HSEB 2KROA 3DB4A 5LJ5g 3EG9B 3LYIA 3UA7A 2KMTA 1K8AU 3HL8A 2XD0A 1W4SA 5GMKm 2KSSA 1VUBA 1UECA 2CP2A 2LCLA 2L8DA 2KVQG 1VQLT 3F70A 4LDXA 2DYIA 1ZLMA 2R5AA 3NPFA 2EQKA 2LCCA 2BKDN 2FHDA 2EYWA 3EFSA 1M90U 4JJDA 1ARKA 2B86A 2DX1A 2DD5A 2L5QA 3VS7A 3LLRA 1WX6A 2D8HA 2IPOB 3CC7Q 2O88A 4QQ6A 3META 1AWXA 1YHQT 3OYDA 4RG8A 5CKEA 5FW9A 4WCIA 2K3BA 2K3XA 1JJ2P 2ZPGB 1ZUUA 5GAMd 1X01A 3NTIA 1A0NB 5LJ5e 2VC8A 2C06A 3I55Q 3OYNA 1NJIR 1QWEA 2EAYA 2DD4A 4CRIA 1QCFA 3V8JA 1W2BS 2L3SA 2ZPEB 1GFDA 3KXTA 1W70A 1QVGA 1W1FA 1Q86C 2VV5A 2CT3A 1T3LA 3CCUT 5GANj 1AWJA 3PIPA 1LPLA 1BIAA 4N0AA 3H8ZA 1ZX6A 2VXEA 1SEMA 2DF6A 3L2QA 1V76A 2XG8D 1IREB 3L2RA 4BE1A 4N4GA 1B34A 1M8MA 1LOJA 4LN2A 3I56Q 4EDUA 3M0RA 5KYYB 4XTXA 1VQ7Q 2VWFA 1WHJA 3G4SQ 3QBYA 5LJ5j 1K9MU 2BUDA 2OTLA 1T0HA 2DK3A 4A4GA 3KUFA 2GFAA 1KQ1A 2EKOA 4JLIA 1I5OB 5GJWB 3ZL7C 5D6XA 1JJ2S 5LJ3f 2YLCA 2CZ0B 1YP5A 3MP1A 1XNIA 1X2QA 2GBQA 3PTAA 3AHUA 1S72A 1YIJT 2LNHB 3SHWA 1RAEB 3BDUA 3G71T 1C0MA 3OYBA 4PJOD 1X75C 2CP3A 1WA7A 4FYXB 3OMCA 2C0IA 3OB9A 4PL6A 1NM7A 1JXMA 5D7UA 2LVMA 3PVLA 2E12A 3JSCA 3J81E 3LWHA 3L2ZA 2ZPFB 2K6DA 4E47A 1ABOA 1DJ7B 3CCLT 1YITA 3MPUB 3OW2P 2J6OA 1LCKA 2KI7A 1LJOA 2DLPA 1YWPA 1VQ5A 3MO8A 3QHSA 2H3EB 3LWIA 2FZCB 3FJ5A 2QTXA 3JB9H 2XDPA 5KYXA 2Z0WA 2X4YA 1J3TA 3A1PA 2V1QA 4FW1A 3FEOA 2DL5A 2E6ZA 1M1KR 4LE9A 3VRZA 3VS3A 7AT1B 4ZN3A 1Y07A 2J05A 2F2VA 4ZTFA 1QVFP 5L8RE 1NBEB 3TEEA 3M0SA 1MMGA 4AG1C 2H8HA 5HCKA 1K0XA 2G3RA 3S3OA 3MHXA 1G2BA 3CCEA 3H0HA 4QVCA 1LNXA 4M7AC 2HD0A 2PUOB 2HMAA 3HSBA 4OF1A 3CQTA 1HXDA 4OMLA 1KHCA 2JMCA 1ZUYA 4DBRA 4F7UA 2YDLA 1FX7A 4E7JA 3M0UA 5GAMg 1NEBA 1H92A 1IB8A 1E7OA 2K5IA 1MNDA 4MZMA 1VQPT 3X28B 1VQNT 1SHFA 1UGPB 3SEMA 3HRTA 2M0OA 2MK5A 1NJIC 4RMOA 4B6MA 5IN1A 3OW2S 1ZBXA 3EHRA 2E65A 5HKCA 1JO8A 1VQ4Q 4RTYA 2IVWA 2LT1A 2DA9A 4N4HA 2QQ9A 4LD6A 4J9CA 2KRMA 4KUDK 4M75D 4C0DB 1Q82R 1SF9A 1K73R 1N27A 1XTDA 3OYMA 3TREA 5HK0A 1VQOQ 1WHGA 4XU3A 2E70A 5GAN8 4M77D 1QVFS 2H3JA 2A37A 1Q81R 1TWBA 3V7RA 2DM1A 1U06A 4J5YA 3QYGB 2QQSA 5GAMe 4GY5A 3VS2A 3CC4Q 4EMKC 3CCST 2DJZA 4XTVA 2EYQA 1QWFA 4M75E 3CBPA 1U8RA 3OBWA 1B07A 1JQQA 1TXQA 1SRMA 3V8LA 2YSQA 4CC7A 2KYBA 3V7SA 4D8DA 1VQ6Q 4M7AA 4JRQA 2GCXA 2LP5A 1HYOA 1HJDA 5KYUA 4WF2A 3ZEHA 3OS0A 4PLLA 2KK4A 2HKNA 4J6WA 1QKWA 1WYXA 2DXUA 2OTJA 3H41A 2QEXQ 2PTKA 4KULA 4DOVA 3JCMb 2I0NA 3THKA 5I11A 5KYNA 1D1AA 4M7DD 1SKUB 4PJLA 1WLPB 5GAMj 2K2MA 1R8OB 2FG0A 4HT8A 2OJ2A 1AHJB 2K3YA 5GAOr 2NUPA 2YHTA 2COWA 4BB7A 2YUQA 3HP9A 2GFUA 2YUNA 3E9GA 3RUXA 1UJ0A 3I56A 4J9HA 3GOXA 4JJBA 1VQ7A 4RTVA 2V8KA 4DBFA 2CS7A 1SHGA 4M7DE 1X27A 2QYZA 1M1KC 4JZ4A 3L1AA 1QVGS 4BE2A 5HK3A 1VA7A 3RR6A 3WVDB 1YJ9A 1N9SA 4KUIA 1AWOA 1K8AR 2ROTA 2FB7A 2MF2A 3EFOA 1WXBA 1ZA1B 3REAB 4F7UB 2WSEE 3UA6A 3EHQA 2ED0A 2QGFB 1PNJA 4C0FA 1AVZC 2VB6A 3CCVQ 3EG9A 5GANh 1NZ9A 2D8JA 1M90R 4E7HA 4QQGA 1TUGB 1MMAA 5IAYA 1YJNT 2BZ8A 1GCQA 2FPFA 1KQSP 4DOWA 2M0YA 4IURA 3JCMJ 4C92D 3R6OA 4J9FA 3M0TA 4D8KA 5LJ5h 1B7TA 2CDTA 2ZPIB 3JCMP 2ZCFB 5LL6S 1Q82C 1K73C 2RJFA 2L3RA 5GAOq 3RNJA 1KJWA 4X9DA 2YLBA 4PK4A 3SD4A 3V8KA 2AZVA 3VYHB 1NEGA 3JCMV 1Q81C 5GAN4 3CC2T 2K5FA 4OP0A 2L3PA 4C92E 3DB3A 4J9BA 4ESRA 3CCJQ 1S72Q 2JM9A 2KY9A 4Z02A 1K4US 2X3XD 2DAQA 5AT1B 4MZTA 1M9SA 4M7AB 3NTKA 1B3QA 1K0SA 2X9HA 4M78E 1WNLA 2DILA 2RQVA 5KYWB 5KE3A 4UC4A 1ZSZC 1KD1U 1YITQ 2DNUA 3EH1A 1R0BG 5I2MA 2CYZB 2MOXA 1K9MR 1VQ5Q 2V8JA 1QMCA 1M1GA 4M7DC 3H0IA 2IG0A 4KGVB 1VQ4A 4ELZC 1QP2A 1K1ZA 1RACB 3UDCA 3JCMg 2YUOA 2LT4A 2DFUA 1BI0A 3DLMA 3VS0A 5KYYA 4VUBA 2RJDA 3CEYA 1HSQA 4JDSA 1VQMA 2HNIA 3U23A 3EGDB 4LDYA 1SSFA 3T9NA 2HQHA 1QVPA 1VQOA 3MEUA 4XTYA 3A5ZB 2JTFA 3CXCA 3QZ5B 3MEVA 1OULA 4DEXA 4JRIA 1G3SA 1AZGB 1WIEA 2ENMA 3CC4A 3PFSA 1I0CA 2L2PA 1OPLA 2F2XA 1YFNA 4B9WA 3GF5A 3QJYA 3J7AF 1UGQB 2EYZA 2DZ9A 4J9IA 1UHCA 4ZNXA 4F17A 1PG5B 4JUVA 4EMKB 1Y7XA 2A08A 1BI3A 2QI2A 3CCUQ 2MCNA 5CKFA 2OAWA 8AT1B 1GBRA 4NL2A 5KCHA 5GANf 4AFQC 2JM8A 2DXTA 1K8AC 4A54A 4ZGEB 2R58A 2JZ2A 2OI3A 1OX8A 2OAUA 1W2BP 1WHKA 2EW3A 1Q7YU 3QO3A 1F1BB 2QEXA 3CPWA 2O4XB 1NG2A 3PMTA 4L6V5 4J6YA 2KDSA 5C6SA 2D0QB 2AKLA 1M90C 5LJ5f 2AKKA 2ROLA 2COYA 1M27C 4C92C 4C8QD 2CSIA 1TSFA 2YWWA 3CCQA 2GQIA 3OYJA 4Z8AA 3VUZA 1WZOA 4J7IA 2QASA 1X43A 4HVVA 3Q1JA 2EYXA 3JB9F 3RERA 1JXOA 4JJNK 5GANe 2KQWA 3OSVA 3G71Q 2GNCA 3CMET 4JZ3A 1WPYA 4M78C 2RQTA 1BCOA 2F5KA 2LC4A 2LZ6B 1I8FA 1SRLA 1NPRA 5CKDA 2MWPA 3P8DA 2RM4A 4C8QE 3VRYA 2EYYA 1RLPC 3CCLQ 3DKMA 2LX7A 1NLOC 4OB1B 4OMMA 4E7ZA 2OTJQ 2L0AA 2QA4T 2VASA 1VQ8A 4J83A 3CMAA 3X25B 5C0MA 4OGEA 5EG2A 1KC8U 3HFOA 3R6NA 2QQBA 4QKUA 2PVOB 5CO7A 4A4KA 5GAMh 3RKWA 1UGRB 3CCVA 1X6OA 2XDBA 2JUFA 4IIOA 2YXYA 4C5EA 4L5GA 4E6RA 2J6KA 2MPXC 3JCMX 4RTWA 2A3LA 3M0PA 2NWMA 4XK8E 4M75G 5HY6A 2CP0A 1K9MC 3EGXB 1VIEA 1UB4A 1ZUKA 4FT4A 1YJWA 2EQUA 2JJ9A 2CP7A 4LD9K 1MV3A 1TG0A 1FMKA 4M77G 1VYUA 2Y4YA 1BBZA 1QW1A 5KCOA 4KGXB 3JB9I 2HQEA 4HKEA 4A63B 1VQPQ 2VGNA 1VQKT 2KBTA 1TH7A 2LTOA 1VQNQ 1RAIB 2ESWA 5FLXE 1YJ9Q 4JPBW 2ECZA 3C0CA 4PFOA 1M2VB 1RL2A 5ECAA 2DMOA 4P5NA 3CCJA 4JLGA 4AMCA 2ZAEA 3KBGA 3JAME 4DBQA 3GNFB 3GIBA 4MDXA 4F7UF 1PSEA 2COZA 2CH4A 2DO3A 2M1HA 2PVDB 2E10A 1WJRA 1AEYA 4C5GA 2M51A 1G5VA 5IXFA 3V7CA 3ASKA 1VQLA 2DVJA 2P4TA 4M7DG 2W10A 2JTMA 3CXCP 1U1SA 3PVQA 3CC7T 1N9RA 4QQDA 1ZSZB 1HK9A 2W0ZA 2VGMA 4PJOE 1PCXA 4IUVA 3CCSQ 2JNGA 3G7ZA 3IQLA 1S1NA 4ZGJB 2DTOA 4E7SA 1PD1A 1BCMA 4DQ2A 3O8VA 4M7DB 1RABB 4C8QC 3I55T 1YHQA 3OYKA 3VS1A 3MCAB 3JCMW 3M55A 1JBMA 2E1HA 3ER0A 5GAN2 1IGUA 2EIFA 5CQXA 1T3SA 3OY9A 2LDMA 4HXJA 1BIBA 2YRCA 1V1CA 4BI8B 5GMKj 2EGAA 5M9OA 5IH2A 1PRMC 4KT0E 4JJCA 3CPWP 1BKBA 3MP6A 2J06A 5CVIA 2IIMA 3CCMT 1NYFA 4CC4B 2JS2A 5A0LA 4XU0A 1M8VA 2X4WA 3EG2A 2PU9B 4M7AF 1BI2A 4FT2A 3CCUA 1IZ6A 2HEQA 4IIMA 4IUQA 3SWNC 3VS5A 5GAMf 2F69A 2RHIA 3FC3A 3G4ST 2R57A 2GF7A 5GAN6 4MDWA 1R0CB 3CXCS 2DXBA 5I21A 1YNZA 1ZHIA 1CSKA 2LRQA 1IO6A 2LQWA 4IUTA 4LDVA 2DRKA 1UGVA 4J9DA 1VQMQ 1IGQA 4C92G 2CUBA 2XHCA 2KXDA 2E4HA 3TQ7P 1UG1A 1WQWA 1ZA2B 2EGCA 2LQ8A 2F2WA 2LJ1A 1PRLC 2X51A 9ATCB 5FWBA 1MNEA 2BIVA 3EAEA 2P0QA 3M53A 5FRNA 2RO0A 4M78G 4C92B 3C4SA 1YIJA 4RG2A 1GL5A 3E9FA 3G71A 1KD1R 3INZA 2DVEA 3CPWS 1U1TA 4PJNA 1QVGP 5CQYA 4A4EA 2QQRA 2CUDA 2ZGWA 4M77E 2RNAA 3GPLA 2EGEA 4OGCA 4M4ZA 3VYGA 4M78B 1G3TA 3TVTA 4QT7A 1R77A 4PKCC 4JS5A 2FVUA 5KYWA 3CCLA 1Z9QA 4PJOC 4EMGA 2EPDA 5GAOp 3JB9J 1AZEA 3AT1B 1D1CA 4BD3A 3PIOA 1PKSA 3D7SB 1V29B 3I35A 2NUTB 5DLQE 4FM4B 4ANJA 4DBHA 3OS2A 2QAZA 2FL7A 3JCMd 4Y91A 1N8RU 2DERA 1HD3A 4A53A 3EGDA 1IXDA 2B8AA 4JS4A 2LMJA 3CCQQ 2EQJA 4ORZA 3CC2Q 2P4RA 4MMLA 1VQ9T 4ZGDB 4Y28E 4HCCA 1M3CA 3VUBA 1ABQA 3CD6T 3FJPA 4FYWB 4R55A 1FWZA 5DY9A 3A8OB 2VXFA 3QWXX 2L3QA 4TVRA 5DLOA 1YBYA 2RB6A 3G1JA 2HCKA 2WSFE 1TTHB 3CCMA 2XK0A 4O5VA 1VYTA 4BE0A 5FWCA 1VQPA 4C5HA 1OZ3A 3RMQA 3P8HA 4II1A 1MMDA 1Q7YR 1VQNA 4EMKA 1UEBA 3HFNA 1D3BB 2DEQA 3BW1A 1TOVA 4LDWA 5IHKA 4Q5WA 1D0YA 2YRDA 5L23A 4FW2A 3CBMA 1UJYA 1KSWA 4E2FB 2MMPA 2RQRA 1VQ8Q 3CMAQ 2RN8A 2AIRB 3MKDA 3OS1A 4EPCA 1H3HA 2O4XA 1H3ZA 4J9EA 1QLYA 1KFZA 3UF4A 2X4XA 1D09B 1CKAA 2QQAA 4FU6A 1GFCA 3NTHA 1RLQC 3RDVA 4FSXA 2XU8A 1EIFA 3I5SA 1YI2T 1YJWQ 2XICA 3L42A 2JS0A 2KRNA 3M4GA 4M75C 2DL7A 1G83A 1U3OA 1TUCA 1VQ6T 2D6FA 2CGHA 3RBBB 1I1JA 3CCSA 4C8QG 1JJ2A 1KK7A 2JTEA 1D0XA 4KH0B 3SB2A 1UUEA 4NS5A 4M77C 3CCRT 2MYSA 3A8GB 2HSPA 3JB9D 2X3WD 3HRSA 4K11A 3JRZA 5FU6C 3M54A 3M57A 3JCMc 4BDYA 5FRMA 1FYNA 1LVKA 3BDLA 2RH2A 4C8QB 3A8MB 2E64A 1KC8R 4C0ZA 3JV3A 1Q95G 3M5AA 3VV0A 4PNOA 2O9SA 5CR2A 2EBPA 1JU5C 1X69A 3NFCA 3WXMB 1UE9A 1G3WA 2DL4A 2E41A 2E5KA 2I2LA 1KG1A 1KD1C 2O01E 3ZBDA 2K9GA 5J26A 3FB9A 5GAOn 3QG1A 4E7LA 3C95A 3GBQA 3E1SA 3LW5E 2FPEA 4HVUA 5GAOl 2LCSA 1VQLQ 2DTHA 1KQ2A 1H8KA 2EKHA 4FIBA 2KE9A 2HZYA 1M3AA 3G6ET 2Y90A 1YCYA 1VQ9A 4RTUA 3SWNB 1QCOA 2MAMA 1I81A 3EGXA 1GCPA 2X4JA 4F04B 3EH2A 3A98A 2DEUA 2RJEA 2RHZA 4HCZA 1K76A 1RAHB 2DZCA 2CT4A 2V26A 4ELYC 2PUKB 1YHQQ 3I5RA 4M75A 5D6WA 2GTJA 1AT1B 1JRIA 5CAIA 2K4YA 2KXCA 2VYTA 2RQWA 5GMKh 3S6WA 3UATA 3SFMA 4RCCA 4YTLA 5GMKl 1AOJA 3EFRA 3VS6A 4AG2C 4MMKA 5IT9E 1PM3A 1M2VA 3O5ZA 3C12A 2BZXA 3QJ6A 2QK0A 2QTVA 1T0JA 1UDLA 2FEIA 3RKXA 2FZGB 3WVEB 3OW2A 1UHFA 4BUGA 4OB2B 5KH6A 3PMIA 5LJ3d 4XTUA 2KT1A 1CKBA 4GLMA 1Q7YC 1WDXA 3PE0A 4PJOG 2HKQB 1OU8A 1K9AA 2QDYB 1YJNA 3JCMe 4PFPA 2OTLT 4HA8A 4ME7A 3FLGA 1RAGB 3OBYA 2D0NA 4Y92A 3M0QA 1ZSZA 1VYVA 2RI5A 3M4YA 4PJOB 1WHHA 3QDRB 2PZ1A
chains in the Genus database with same CATH topology
2E5QA 4EMKC 1PSEA 2DJZA 4XTVA 2EYQA 3CCRA 4J8OA 4M75E 3CBPA 3GP8A 1U8RA 4F7UE 2QEXT 3OBWA 3UT1A 4OVAA 2DIGA 1S72T 2DO3A 2M1HA 4XQ3A 4M7DA 3V8LA 4JRPA 2PVDB 4N0AC 2E10A 1WJRA 2R5MA 2RJCA 4A4FA 4M77F 3VKIA 3V7SA 4C5GA 5GMKi 1G5VA 3QYHB 3V7CA 2NLUA 3ASKA 5CK9A 4NOYA 1PSFA 1VQLA 2XIDA 3CC2A 4M7AA 4JRQA 2RI3A 3OYGA 1Y96A 2GCXA 2P4TA 3M56A 4ZTJA 4M7DG 3SDZA 4NL3A 2JTMA 3ZEHA 4WF2A 1ZQ1A 1U1SA 3QZ9B 3OYAA 3CC7T 3OS0A 4PLLA 1N9RA 4M78D 4QQDA 1JB0E 2KK4A 1HK9A 4C92F 2VGMA 4PJOE 4M7AG 1Q82U 4IUVA 1K73U 3CCQT 4J6WA 3J80E 1BYMA 5J39A 2JNGA 1YITT 2V8IA 2DXUA 3G7ZA 4DA4A 2OTJA 3PGGA 4ZGJB 2DTOA 2RA2A 1P92A 4KULA 4DOVA 1NPPA 3JCMb 4DQ2A 3FRNA 3O8VA 1VQ5T 4M7DB 4C8QC 2HAXA 3I55T 1YHQA 3OYKA 1XQHA 1Q81U 2CZ7B 3MCAB 5CKBA 4A4HA 3JCMW 4M7DD 3M55A 5GAMj 3J81E 1KC8C 1R8OB 2PVGB 4M78F 2QXFA 1JBMA 5D6YA 4HT8A 2E1HA 3CD6A 3ER0A 1I4K1 3L2WA 5GAN2 3G6EA 2EIFA 4M7AD 1AHJB 2K3YA 3M59A 5GAOr 5CQXA 3OY9A 2RHYA 3QIIA 2LDMA 2YHTA 1BIBA 2JOYA 4IKFA 2ZZDA 4BB7A 2AHJB 4BI8B 5GMKj 1WJQA 5M9OA 3PNWC 3HP9A 2GFUA 3LGLA 3JCMf 2RK1A 4KT0E 5FU7C 4BACA 3E9GA 3H6ZA 4J6XA 3RUXA 3I56A 1BKBA 3C94A 1KQSS 3GOXA 4IUUA 4M7DF 1VQ7A 3GLXA 3MP6A 3CCET 1VQ8T 5CVIA 2JVVA 4EMHA 3CCMT 3CMAT 2V8KA 2CS7A 5J3BA 4M7DE 3L2VA 5A0LA 2XDDA 4XU0A 2DXCA 1M8VA 3OYYA 2X4WA 2PU9B 2KAFA 1M1KC 4M7AF 1BI2A 2XI9A 3L1AA 4FT2A 3FDRA 3CCUA 1IZ6A 4HCBA 3SWNC 4IUQA 4M77A 4BE2A 1QVGS 5GAMf 4M7AE 1H641 2F69A 3E19A 2RHIA 2DTIA 3FC3A 3CCVT 4QW2A 4E7KA 5HK3A 3G4ST 4GLKA 2R57A 1G3YA 2GF7A 3WVDB 3ZFJA 5GAN6 1YJ9A 1N9SA 4KUIA 1NE8A 4MDWA 4QVZA 3VU3C 2CKKA 1UGSB 3CXCS 3GNGA 2DXBA 5I21A 2DKGA 1GXIE 4BY6C 4ATOA 5KE2A 1ZHIA 2P0PA 2FB7A 3URGA 2FYKA 4C92A 2MF2A 4QVDA 1WJSA 2LRQA 2MI6A 3CPFA 1YJWT 2ZPHB 4M75B 4BDZA 4IUTA 4F7UB 1I5LA 4LDVA 4BI3A 2WSEE 1Q86U 1WGSA 3PT9A 3HKSA 3OYFA 3JCMQ 2RHUA 3MEAA 4C92G 5GAOm 2XHCA 4C0FA 1OYXA 4ZN1A 1WQWA 1YI2A 2ZPBB 4M77B 5GANh 1NZ9A 3OA6A 2PQWA 2LQ8A 4M78A 4E7HA 4QQGA 4XU2A 3RKYA 5LJ3h 5GANg 2EWNA 1VQ6A 5FU6B 4E7IA 4OB3B 1Y71A 2XKOC 3RMSA 4L59A 3VJPA 5IAYA 1YJNT 1QVFA 2BIVA 3CBOA 5LJ3g 3BY7A 2P0QA 3EAEA 3M53A 5FRNA 2RO0A 4M78G 4C92B 2Y4XA 4DOWA 2M16A 5GAN5 3C4SA 4IURA 1BI1A 3JCMJ 4RG2A 1YIJA 4C92D 4PLIA 1WQ7A 3E9FA 3R6OA 3G71A 3CCJT 3INZA 2DVEA 4C0DC 5I2SA 1U1TA 5LJ5h 3CPWS 2K2VA 4CI0C 2ZPIB 5CKHA 3JCMP 2ZCFB 2MWOA 4C0GA 5CQYA 5LL6S 4A4EA 3DLLA 2QQRA 1Q82C 2ZGWA 1K73C 5GMKe 3RESA 3OYHA 2RJFA 3DB4A 4X34A 5LJ5g 2L3RA 4M77E 3LYIA 3GPLA 3MP8A 4OGCA 5GAOq 2KMTA 4X9DA 3VYGA 1K8AU 2YLBA 4M78B 3HL8A 1G3TA 3SD4A 3A8HB 4PKCC 1W4SA 4JS5A 2XD0A 3V8KA 2FVUA 2KSSA 5GMKm 1VUBA 3CCLA 3VYHB 4OMFB 3JCMV 2LCLA 4PJOC 1Q81C 4EMGA 2L8DA 3QXEB 2KVQG 5GAOp 1VQLT 3N5BB 3F70A 5GAN4 3JB9J 3CC2T 2K5FA 4OP0A 3X20B 4C92E 4LDXA 3DB3A 3OSSC 2EQMA 2R5AA 2EFIA 2EQKA 2LCCA 4BD3A 3PIOA 2BKDN 3CMEA 2KY9A 2FHDA 1V29B 3EFSA 4Z02A 1M90U 3FIFA 5DLQE 4FM4B 2EJGA 3S3NA 2DAQA 4MZTA 2DD5A 4B9XA 2L5QA 3OS2A 2OTJT 2RK2A 1M9SA 2K5LA 4XTWA 3BFMA 2FL7A 3LLRA 4M7AB 3NTKA 3JCMd 1Y96B 4Y91A 1N8RU 2P0KA 5LJ3e 4M78E 4A53A 1WNLA 4QQ6A 4BI4A 2B8AA 2LX9A 1RI0A 3META 4UC4A 5KE3A 4XAXB 3OYDA 4JS4A 1YHQT 1D3BA 2EQJA 4X9CA 4C8QF 1KD1U 4MMLA 4RG8A 5CKEA 2QA4A 3S3MA 4ZGDB 4Y28E 1VQ9T 4HCCA 3VUBA 2K3XA 5I2MA 3CD6T 2ZPGB 3FJPA 1OI1A 5GAN7 4R55A 1FWZA 5FROA 2CYZB 5DY9A 5GAMd 1X01A 3A8OB 3NTIA 2VXFA 5A2QE 2CZ6B 2V8JA 5LJ5e 2VC8A 1M1GA 4TVRA 2C06A 2D6FA 4J7FA 5DLOA 3OYNA 1YBYA 2RB6A 2IG0A 1KQSA 1VQ4A 4M7DC 2EAYA 4ELZC 2DD4A 4CRIA 1QP2A 3UDCA 3JCMg 5CIUA 2LT4A 1BI0A 2WSFE 1M1FA 3L2UA 3V8JA 1W2BS 1N6AA 3DLMA 2ZPEB 2XK0A 4O5VA 3M58A 3M9QA 1O75A 3CCMA 3I56T 4BE0A 2M9UA 3KXTA 4VUBA 2RJDA 1VQPA 3CEYA 4C5HA 1VQ7T 1OZ3A 4JDSA 3RMQA 1VQMA 2HNIA 3P8HA 1QVGA 4II1A 1Q86C 1VQNA 4EMKA 4LDYA 2DPPB 1UEBA 1SSFA 2EJFA 2VV5A 3HFNA 3T9NA 1D3BB 1QVPA 3OQ5A 2DEQA 3BW1A 1VQOA 3MEUA 4LDWA 3CCUT 3LX7A 4Q5WA 3A5ZB 4XTYA 3PIPA 5GANj 1BIAA 2JTFA 5AYFA 3CBMA 4N0AA 3CXCA 3QZ5B 2MMPA 2RD1A 3MEVA 5LJ3j 4JRIA 3H8ZA 1G3SA 2VXEA 4MZPA 1YJ9T 3L2QA 3OS1A 2XG8D 1IREB 4EPCA 3X26B 3L2RA 4BE1A 4N4GA 1B34A 3CC4A 1LOJA 3PFSA 2O4XA 4EDUA 2GQVA 4XTXA 3P8BB 1VQKA 3QUIA 1H3ZA 4B9WA 3GF5A 3QJYA 3J7AF 1UGQB 2DZ9A 2L89A 2X4XA 3QBYA 5LJ5j 2QQAA 4KBMB 4JUVA 4FU6A 4EMKB 2BUDA 1Y7XA 1K9MU 3NTHA 2OTLA 1BI3A 2RI2A 2QI2A 4OB0B 4FSXA 3LWHA 2DIQA 3OYIA 2LQKA 3JB9G 2XU8A 5CKFA 1NJIU 2D9TA 1EIFA 2DK3A 4A4GA 1YI2T 3KUFA 1K9MC 2GFAA 2XICA 3L42A 4C8QA 4NL2A 5KCHA 5GANf 1KQ1A 2EKOA 2DXTA 3M4GA 4XTZA 4JLIA 4M75C 1K8AC 3OYCA 2VUBA 1M5Q1 5D6XA 1JJ2S 4A54A 2E6NA 3TU4K 5LJ3f 1VQ6T 3OYEA 4ZGEB 2R58A 2CGHA 2CZ0B 2JZ2A 2YLCA 1MGQA 3CCSA 2OAUA 3MP1A 4C8QG 1Q7YU 1XNIA 1JJ2A 1B34B 3PTAA 3QO3A 2YRVA 3QKJA 3SB2A 2QEXA 2O4XB 3CPWA 3AHUA 1S72A 4NS5A 3PMTA 4M77C 1QP3A 3CCRT 1YIJT 3A8GB 4L6V5 4J6YA 2KDSA 3BDUA 2LNVA 3G71T 3OYBA 5C6SA 3JB9D 2D0QB 3HRSA 4PJOD 1X75C 3ME9A 1M90C 5LJ5f 3JRZA 5FU6C 3M54A 5GAN3 3M57A 3JCMc 3OYLA 3OMCA 4BDYA 3LH0A 3OB9A 4PL6A 5FRMA 5CCAA 3BDLA 2RH2A 4C8QB 3CC7A 3A8MB 4C92C 2E64A 4C0ZA 2LVMA 2E12A 3JSCA 3M5AA 4PNOA 1XOVA 3VV0A 3L2ZA 5CR2A 2ZPFB 3NFCA 4C8QD 1N8RC 3CCQA 4E47A 3WXMB 3CCLT 1DJ7B 1G3WA 3SWNA 3OYJA 1YITA 3VUZA 2JN0A 2E41A 2K57A 3A8LB 4JRKA 4J7IA 2I2LA 1KG1A 1KD1C 3Q1JA 2O01E 3JB9F 3RERA 4PJOF 3OS5A 1MHNA 4JJNK 5GANe 1LJOA 2KQWA 3OSVA 4D6WA 3QSUA 1VQ5A 3ZBDA 3I55A 5J26A 3FB9A 3MO8A 5GAOn 3CMET 3QHSA 3HRUA 3QG1A 1WPYA 3LWIA 4E7LA 4M78C 2QTXA 3C95A 2A7YA 3JB9H 3E1SA 2F5KA 5FU7B 2LC4A 3LW5E 2XDPA 1I8FA 5A0DA 4R56A 4C5IA 2X4YA 1KC8U 2HQXA 5GAOl 1NPRA 2DTHA 5CKDA 4N4IA 1KQ2A 4FIBA 3FEOA 2MWPA 3P8DA 2RM4A 2E6ZA 4C8QE 3HHTB 3HPWA 4ZN3A 1Y07A 3DKMA 3G6ET 3QPHA 4ZTFA 2Y90A 1YCYA 5L8RE 3JCMh 1VQ9A 3SWNB 2MAMA 1I81A 3TEEA 1KHIA 4OB1B 2X4JA 2G3RA 2QA4T 3UWNA 3S3OA 2RJEA 3MHXA 5DM7R 3CCEA 1VQ8A 4J83A 4QVCA 3CMAA 2RHZA 3X25B 5C0MA 1LNXA 4M7AC 2WSCE 2HD0A 4OGEA 3RIRA 4HCZA 4BY6B 2DZCA 2PUOB 1W2BA 3HSBA 5EG2A 4ELYC 4OF1A 2PUKB 2WACA 3HFOA 2X35A 1HXDA 2HBPA 2QQBA 2PVOB 3MEWA 5CO7A 4A4KA 5GAMh 1VQ4T 3RKWA 1KHCA 4M75A 1UGRB 5D6WA 4F7UA 3CCVA 1X6OA 1FX7A 4E7JA 2JUFA 2XDBA 2CZ1B 3G4SA 5GAMg 4C5EA 2K5IA 4L5GA 3JCMX 4MZMA 1VQPT 3X28B 1JRIA 2A3LA 5CAIA 2K4YA 1VQMT 4XK8E 2VYTA 4M75G 5HY6A 1VQNT 4F7UG 3S6WA 5GMKh 3SFMA 1M4ZA 1UGPB 4RCCA 4YTLA 1VIEA 1UB4A 4XU1A 5GMKl 1FXXA 3EFRA 2RHXA 4FL6A 4FT4A 1YJWA 3HRTA 4MMKA 2EQUA 2M0OA 5IT9E 1VQOT 1O9SA 1NJIC 4LD9K 3C12A 4RMOA 3OW2S 5IN1A 2F5TX 1ZBXA 2EJ9A 4RKUE 4M77G 3TCJA 4PJOA 3X24B 2Y4YA 3QJ6A 2E65A 5HKCA 5GANd 3WVEB 1QW1A 3RKXA 5KCOA 3OW2A 1M1KU 4LDUA 4BUGA 2IVWA 4OB2B 5KH6A 2LT1A 4N4HA 2QQ9A 3PMIA 5LJ3d 4XTUA 4HT9A 3LGFA 3JB9I 3CC4T 4LD6A 1Q7YC 2HQEA 4HKEA 4PJOG 4KUDK 4M75D 4C0DB 2VGNA 1VQKT 1TH7A 3UPUA 2LTOA 2QDYB 4RCBA 1YJNA 3JCMe 5FLXE 4V2SA 1N27A 1XTDA 2OTLT 5A0GA 3OYMA 3TREA 5HK0A 4XU3A 3OMGA 2E70A 4HA8A 5GAN8 1VIFA 4ME7A 5LJ5d 4M77D 1OZ2A 1QVFS 2H3JA 1RL2A 3FLGA 3OBYA 4P5NA 4O6JA 3V7RA 3CCJA 4IUPA 4JLGA 2RI5A 3M4YA 4PJOB 3QDRB 3KBGA 4J5YA 3QYGB 3JAME 2QQSA 3GNFB 4M75F 5GAMe 3GIBA 4MDXA 4F7UF 4GY5A 3CCST
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5Q A;  3CCR A;  2QEX T;  3UT1 A;  4OVA A;  1S72 T;  2DIG A;  2DO3 A;  2M1H A;  2R5M A;  1WJR A;  2RJC A;  4A4F A;  4C5G A;  1G5V A;  2NLU A;  3ASK A;  1VQL A;  3CC2 A;  2RI3 A;  3OYG A;  4ZTJ A;  3ZEH A;  3OYA A;  3CC7 T;  3OS0 A;  4PLL A;  4QQD A;  1Q82 U;  1K73 U;  4IUV A;  3CCQ T;  3J80 E;  5J39 A;  2JNG A;  1YIT T;  2OTJ A;  1NPP A;  3O8V A;  1VQ5 T;  3I55 T;  1YHQ A;  3OYK A;  1Q81 U;  4A4H A;  1KC8 C;  5D6Y A;  3CD6 A;  3ER0 A;  3L2W A;  3G6E A;  2EIF A;  2K3Y A;  3OY9 A;  2RHY A;  3QII A;  2LDM A;  2JOY A;  4IKF A;  1WJQ A;  5M9O A;  3PNW C;  2GFU A;  3LGL A;  4BAC A;  3E9G A;  3H6Z A;  3I56 A;  1BKB A;  1KQS S;  3GOX A;  4IUU A;  1VQ7 A;  3MP6 A;  3CCE T;  1VQ8 T;  2JVV A;  3CCM T;  3CMA T;  5J3B A;  3L2V A;  3OYY A;  2X4W A;  1M1K C;  3FDR A;  3CCU A;  1IZ6 A;  1QVG S;  4IUQ A;  4BE2 A;  2RHI A;  3CCV T;  3FC3 A;  4QW2 A;  4E7K A;  3G4S T;  2R57 A;  2GF7 A;  1YJ9 A;  4QVZ A;  2CKK A;  3CXC S;  5KE2 A;  1WJS A;  3CPF A;  2MI6 A;  2LRQ A;  1YJW T;  4BDZ A;  4IUT A;  1Q86 U;  1WGS A;  3HKS A;  3OYF A;  2RHU A;  3MEA A;  2XHC A;  1OYX A;  4ZN1 A;  1YI2 A;  3OA6 A;  1NZ9 A;  2PQW A;  2LQ8 A;  4E7H A;  4QQG A;  1VQ6 A;  4E7I A;  1QVF A;  4L59 A;  5IAY A;  1YJN T;  2BIV A;  3EAE A;  5FRN A;  2RO0 A;  2M16 A;  3C4S A;  4IUR A;  1YIJ A;  4RG2 A;  4PLI A;  3E9F A;  3G71 A;  3CCJ T;  3CPW S;  2MWO A;  5LL6 S;  3DLL A;  4A4E A;  2QQR A;  1Q82 C;  1K73 C;  3OYH A;  4X34 A;  3DB4 A;  2RJF A;  2L3R A;  3LYI A;  3MP8 A;  1K8A U;  3SD4 A;  3CCL A;  2LCL A;  1Q81 C;  2L8D A;  2KVQ G;  1VQL T;  3F70 A;  3CC2 T;  3DB3 A;  2EQM A;  2R5A A;  2EFI A;  2EQK A;  2LCC A;  3CME A;  3PIO A;  2BKD N;  4BD3 A;  2FHD A;  1M90 U;  4Z02 A;  5DLQ E;  3S3N A;  2DAQ A;  4B9X A;  3OS2 A;  2OTJ T;  3LLR A;  3NTK A;  1N8R U;  2P0K A;  4QQ6 A;  2B8A A;  3MET A;  1RI0 A;  1YHQ T;  4UC4 A;  5KE3 A;  3OYD A;  1KD1 U;  2EQJ A;  2QA4 A;  1VQ9 T;  3S3M A;  2K3X A;  3CD6 T;  1OI1 A;  5FRO A;  5A2Q E;  3NTI A;  1M1G A;  4TVR A;  3OYN A;  1YBY A;  2IG0 A;  1KQS A;  1VQ4 A;  4CRI A;  5CIU A;  3L2U A;  1W2B S;  3CCM A;  3DLM A;  2XK0 A;  3M9Q A;  3I56 T;  4BE0 A;  2RJD A;  1VQP A;  1VQ7 T;  3CEY A;  4C5H A;  1OZ3 A;  1VQM A;  1QVG A;  3P8H A;  4II1 A;  1Q86 C;  1VQN A;  1UEB A;  1SSF A;  3OQ5 A;  1VQO A;  3MEU A;  3CCU T;  3PIP A;  3LX7 A;  3A5Z B;  4Q5W A;  2JTF A;  3CXC A;  3MEV A;  3H8Z A;  1YJ9 T;  3L2Q A;  3OS1 A;  3L2R A;  4BE1 A;  4N4G A;  3CC4 A;  3PFS A;  2O4X A;  4EDU A;  3P8B B;  1VQK A;  1H3Z A;  4B9W A;  3J7A F;  2L89 A;  2X4X A;  3QBY A;  1K9M U;  4FU6 A;  2BUD A;  2OTL A;  3NTH A;  2RI2 A;  2DIQ A;  3OYI A;  1NJI U;  2D9T A;  1EIF A;  4A4G A;  1YI2 T;  3KUF A;  2GFA A;  3L42 A;  5KCH A;  2EKO A;  1K8A C;  3OYC A;  5D6X A;  1JJ2 S;  2E6N A;  1VQ6 T;  3OYE A;  2R58 A;  2JZ2 A;  3CCS A;  3MP1 A;  1Q7Y U;  1XNI A;  1JJ2 A;  2YRV A;  2QEX A;  3CPW A;  3QKJ A;  2O4X B;  1S72 A;  4NS5 A;  3PMT A;  3CCR T;  1YIJ T;  2KDS A;  3G71 T;  3OYB A;  5C6S A;  3ME9 A;  1M90 C;  3OYL A;  3OMC A;  4BDY A;  3LH0 A;  3OB9 A;  4PL6 A;  5FRM A;  3CC7 A;  3BDL A;  2LVM A;  3J81 E;  1N8R C;  3CCQ A;  3CCL T;  1YIT A;  3OYJ A;  1KD1 C;  3Q1J A;  1MHN A;  1VQ5 A;  3I55 A;  5J26 A;  3MO8 A;  3CME T;  4E7L A;  2F5K A;  2XDP A;  4C5I A;  2X4Y A;  2HQX A;  1NPR A;  4N4I A;  3FEO A;  2MWP A;  3P8D A;  2E6Z A;  4ZN3 A;  3G6E T;  4ZTF A;  1VQ9 A;  1KHI A;  2G3R A;  2QA4 T;  3UWN A;  3S3O A;  2RJE A;  5DM7 R;  3CCE A;  1VQ8 A;  3CMA A;  2RHZ A;  5C0M A;  4HCZ A;  1W2B A;  1KC8 U;  2WAC A;  3MEW A;  2X35 A;  1VQ4 T;  1KHC A;  5D6W A;  3CCV A;  1X6O A;  4E7J A;  2JUF A;  3G4S A;  4C5E A;  1VQP T;  1VQM T;  2VYT A;  5HY6 A;  1VQN T;  3S6W A;  1K9M C;  4YTL A;  2RHX A;  4FL6 A;  1YJW A;  5IT9 E;  2EQU A;  2M0O A;  1VQO T;  1NJI C;  3OW2 S;  5IN1 A;  3QJ6 A;  1M1K U;  3OW2 A;  5KCO A;  5KH6 A;  4N4H A;  3PMI A;  3LGF A;  3CC4 T;  4LD6 A;  1Q7Y C;  2HQE A;  1VQK T;  2LTO A;  1YJN A;  5FLX E;  1XTD A;  1N27 A;  2OTL T;  3OYM A;  3TRE A;  3OMG A;  2E70 A;  1QVF S;  1OZ2 A;  1RL2 A;  3FLG A;  3CCJ A;  4IUP A;  2RI5 A;  3KBG A;  3JAM E;  2QQS A;  4GY5 A;  3CCS T; 
#chains in the Genus database with same CATH topology
 1OU9 A;  3CCR A;  4J8O A;  4F7U E;  1VQK Q;  4OVA A;  1S72 T;  4M7D A;  4N0A C;  2R5M A;  3VKI A;  5CK9 A;  2XID A;  3CC2 A;  3OYG A;  1Y96 A;  4ZTJ A;  4RUG A;  3NGP A;  3QZ9 B;  5GJV B;  1YIJ Q;  4LUE A;  1JB0 E;  4C92 F;  4KH1 B;  4HCK A;  3J80 E;  5J39 A;  1YIT T;  2QDL A;  1M2O A;  3PGG A;  2RA2 A;  2AK5 A;  1P92 A;  3FRN A;  1VQ5 T;  2V1R A;  4F14 A;  2HAX A;  2LJ0 A;  2CZ7 B;  2O31 A;  5I22 A;  1IHW A;  1KC8 C;  4M78 F;  1ACM B;  2A0F B;  2QXF A;  1Y57 A;  5IHI A;  1RAF B;  3G6E A;  2KR3 A;  4M7A D;  2KT8 A;  1GBQ A;  2RHY A;  3QII A;  2JOY A;  3LGL A;  2RK1 A;  3EG0 A;  5IXB A;  5FU7 C;  4BAC A;  3H6Z A;  4J6X A;  2EVR A;  3C94 A;  4IUU A;  2BE7 D;  3CCE T;  4FYY B;  5J3B A;  2XDD A;  2DXC A;  2XMF A;  2XI9 A;  3FDR A;  4HCB A;  2C0O A;  2JMA A;  4M7A E;  1H64 1;  3E19 A;  2DTI A;  1NLP C;  1X6B A;  2QGG A;  1NE8 A;  3VU3 C;  2CKK A;  4CC3 A;  2DKG A;  1GXI E;  4BY6 C;  5KE2 A;  4C92 A;  1WJS A;  4FYV B;  2MI6 A;  3REB B;  2ZPH B;  4M75 B;  4BDZ A;  3CCM Q;  1I5L A;  4BI3 A;  2RPN A;  1Q86 U;  3PT9 A;  3HKS A;  1X2K A;  2RHU A;  2O9V A;  2RMO A;  2DL3 A;  1OYX A;  4ZN1 A;  4M77 B;  3OA6 A;  2PQW A;  2CH4 W;  1YN8 A;  4M78 A;  2HBW A;  4FCY A;  5FU6 B;  3VJP A;  1Y71 A;  2XKO C;  4L59 A;  1FMV A;  4DEY A;  5LJ3 g;  3BY7 A;  1N8R R;  1C1A A;  1RI9 A;  2FPD A;  2Y4X A;  1E6G A;  1Y0M A;  3BE3 A;  2K7A A;  1BI1 A;  2HL5 C;  1WQ7 A;  4LUD A;  1M30 A;  2NUT A;  2K2V A;  1SSH A;  5CKH A;  2ABL A;  5GMK e;  3OYH A;  4X34 A;  3MP8 A;  1MV0 B;  3A8H B;  2F1L A;  4OMF B;  1I07 A;  2FO0 A;  3QXE B;  3N5B B;  3X20 B;  3EG1 A;  2EQM A;  3OSS C;  2EFI A;  3CME A;  1QCN A;  2CP5 A;  3FIF A;  2J7I A;  1FMW A;  1OQK A;  2EJG A;  2KEA A;  3QDF A;  3S3N A;  4B9X A;  2OTJ T;  2RK2 A;  4XTW A;  2K5L A;  3BFM A;  1SG5 A;  1Y96 B;  2LJ3 A;  2P0K A;  5LJ3 e;  2DBM A;  4BI4 A;  4EIK A;  2LX9 A;  1RI0 A;  4Z88 A;  4XAX B;  1D3B A;  4C8Q F;  4X9C A;  1OOT A;  2QA4 A;  3S3M A;  5GAN 7;  1OI1 A;  5FRO A;  2KYM A;  5A2Q E;  2CZ6 B;  4J7F A;  2CSQ A;  1KQS A;  5CIU A;  1M1F A;  3L2U A;  1N6A A;  3M58 A;  3M9Q A;  1O75 A;  3I56 T;  2M9U A;  1VQ7 T;  2KRS A;  2DPP B;  3H0F A;  2EJF A;  2K79 A;  1VQ9 Q;  2ATC B;  3OQ5 A;  3CD6 Q;  4AT1 B;  3LX7 A;  6AT1 B;  1X6G A;  5AYF A;  2RD1 A;  5LJ3 j;  1M3B A;  4OMO A;  4MZP A;  2GTO A;  1YJ9 T;  3X26 B;  1TS9 A;  4WTO B;  2GQV A;  3P8B B;  1VQK A;  3QUI A;  3NMZ C;  2L89 A;  1WFW A;  1RAD B;  4KBM B;  4X1V A;  4OB0 B;  2RI2 A;  2DIQ A;  3OYI A;  2LQK A;  3JB9 G;  1NJI U;  2D9T A;  4C8Q A;  4XTZ A;  3OYC A;  1OEB A;  2VUB A;  2JXB A;  1M5Q 1;  2E6N A;  3TU4 K;  1W6X A;  3OYE A;  4LXC A;  1MGQ A;  3MJX A;  3TSW A;  1B34 B;  2JT4 A;  2CRE A;  2YRV A;  3QKJ A;  4OMP A;  1QP3 A;  2J6F A;  2LNV A;  1WI7 A;  3ME9 A;  1OV3 A;  1YJN Q;  1C6V X;  1YI2 Q;  5GAN 3;  3OYL A;  3LH0 A;  5CCA A;  3CC7 A;  1PC0 A;  2DRM A;  1XOV A;  1N8R C;  3E2U A;  2AZS A;  3SWN A;  1WHM A;  1EZZ B;  2JN0 A;  3H9N A;  2K57 A;  3A8L B;  4JRK A;  2E3I A;  2BZY A;  2KNB B;  3LH5 A;  3OS5 A;  1MHN A;  4PJO F;  3CCR Q;  2SEM A;  4D6W A;  3QSU A;  2BTT A;  3I55 A;  3HRU A;  2A7Y A;  3VS4 A;  5FU7 B;  5A0D A;  4R56 A;  4C5I A;  2HQX A;  4N4I A;  1GCQ C;  3HHT B;  3HPW A;  3QPH A;  3JCM h;  1Z9Z A;  2VVK A;  1KHI A;  1EFN A;  1XJW B;  3UWN A;  1AD5 A;  5DM7 R;  2WSC E;  2PNI A;  3RIR A;  2FRY A;  2O2O A;  4BY6 B;  8ATC B;  1WHL A;  1W2B A;  4C0G A;  2WAC A;  3MEW A;  2X35 A;  2HBP A;  2QG9 B;  1VQ4 T;  5KYX B;  2YUP A;  2DYB A;  2RQU A;  2CZ1 B;  3G4S A;  1QKX A;  3G6E Q;  1D0Z A;  4AFU C;  2FRW A;  1VQM T;  4F7U G;  1M4Z A;  1BU1 A;  4XU1 A;  1FXX A;  2RHX A;  4FL6 A;  1VQO T;  1O9S A;  2LQN A;  2F5T X;  1AWW A;  2EJ9 A;  4RKU E;  3TCJ A;  4PJO A;  1GRI A;  3X24 B;  5GAN d;  4Z89 A;  1M1K U;  1N5Z A;  4LDU A;  1JEG A;  1OX9 A;  1MUZ A;  2DJQ A;  1D1B A;  1ZBJ A;  4HT9 A;  3LGF A;  3CC4 T;  1U5S A;  4PFZ A;  1PWT A;  3UPU A;  4RCB A;  4OMQ A;  4V2S A;  2SRC A;  1RAA B;  1PKT A;  4CC2 A;  4RTT A;  5A0G A;  3I9Q A;  2ED1 A;  4F16 A;  3OMG A;  1UFF A;  1KIK A;  1YWO A;  1VIF A;  5LJ5 d;  2NUZ A;  1OZ2 A;  3NHN A;  3KFV A;  4O6J A;  4IUP A;  3EGU A;  2DET A;  1PD0 A;  4M75 F;  1QQJ A;  2GGR A;  2E5Q A;  2CP6 A;  1WXU A;  3GP8 A;  2DBK A;  1OPK A;  2QEX T;  3UT1 A;  2DIG A;  4XQ3 A;  1TU0 B;  4JRP A;  4A4F A;  2RJC A;  5GMK i;  1SPK A;  4M77 F;  2OTL Q;  3QYH B;  2RF0 A;  2NLU A;  4NOY A;  1PSF A;  2RI3 A;  3M56 A;  3SDZ A;  4NL3 A;  1ZQ1 A;  2JW4 A;  3OYA A;  4KGZ B;  4M78 D;  1IHV A;  4M7A G;  1Q82 U;  1K73 U;  3CCQ T;  1BYM A;  4RTX A;  2V8I A;  4DA4 A;  1NPP A;  4J9G A;  2NYS A;  1RUW A;  1XQH A;  1Q81 U;  5CKB A;  4A4H A;  2PVG B;  2YT6 A;  5D6Y A;  1Q86 R;  2A28 A;  3CD6 A;  1I4K 1;  3L2W A;  2OX7 A;  4AFS C;  5KYU B;  3M59 A;  4FSS A;  4KRT A;  3CME Q;  1VOM A;  4IKF A;  4GBQ A;  2VKN A;  2ZZD A;  1YCS B;  4HVW A;  2AHJ B;  3ULR B;  1WJQ A;  3PNW C;  3JCM f;  2A36 A;  1KQS S;  4OMN A;  1EX4 A;  4M7D F;  3GLX A;  3TSZ A;  1VQ8 T;  2EQI A;  2JVV A;  4EMH A;  3CMA T;  2E3H A;  3L2V A;  3OYY A;  2KAF A;  1ZSG A;  1E6H A;  4M77 A;  2QA4 Q;  3CCV T;  4QW2 A;  4E7K A;  3HTR A;  4GLK A;  1G3Y A;  2HDA A;  3ZFJ A;  2MIO A;  2BE9 B;  5EC7 A;  2NUP B;  1G8X A;  1NYG A;  2AT1 B;  4QVZ A;  1UGS B;  4PJJ A;  3GNG A;  1UTI A;  4RTZ A;  4ATO A;  2P0P A;  3URG A;  4QVD A;  2FYK A;  2G6F X;  3CPF A;  1YJW T;  3CCE Q;  2D1X A;  1PHT A;  2DE0 X;  1BK2 A;  1WGS A;  3OYF A;  3EG3 A;  3JCM Q;  3MEA A;  5GAO m;  1IRX A;  2C0T A;  1YI2 A;  2ZPB B;  5IHN A;  1MMN A;  2M02 A;  2HL3 A;  2FZK B;  4XU2 A;  3RKY A;  5LJ3 h;  5GAN g;  2EWN A;  4AFZ C;  1VQ6 A;  4E7I A;  4OB3 B;  3RMS A;  1QVF A;  2P84 A;  3CBO A;  2KGT A;  1WXT A;  2DL8 A;  4LNP A;  2M16 A;  3EFO B;  5GAN 5;  1TUD A;  4PLI A;  3CCJ T;  4C0D C;  5I2S A;  4CI0 C;  2MWO A;  4PJM A;  4R0K A;  3DLL A;  3QWY A;  3RES A;  1BB9 A;  2HSE B;  2KRO A;  3DB4 A;  5LJ5 g;  3EG9 B;  3LYI A;  3UA7 A;  2KMT A;  1K8A U;  3HL8 A;  2XD0 A;  1W4S A;  5GMK m;  2KSS A;  1VUB A;  1UEC A;  2CP2 A;  2LCL A;  2L8D A;  2KVQ G;  1VQL T;  3F70 A;  4LDX A;  2DYI A;  1ZLM A;  2R5A A;  3NPF A;  2EQK A;  2LCC A;  2BKD N;  2FHD A;  2EYW A;  3EFS A;  1M90 U;  4JJD A;  1ARK A;  2B86 A;  2DX1 A;  2DD5 A;  2L5Q A;  3VS7 A;  3LLR A;  1WX6 A;  2D8H A;  2IPO B;  3CC7 Q;  2O88 A;  4QQ6 A;  3MET A;  1AWX A;  1YHQ T;  3OYD A;  4RG8 A;  5CKE A;  5FW9 A;  4WCI A;  2K3B A;  2K3X A;  1JJ2 P;  2ZPG B;  1ZUU A;  5GAM d;  1X01 A;  3NTI A;  1A0N B;  5LJ5 e;  2VC8 A;  2C06 A;  3I55 Q;  3OYN A;  1NJI R;  1QWE A;  2EAY A;  2DD4 A;  4CRI A;  1QCF A;  3V8J A;  1W2B S;  2L3S A;  2ZPE B;  1GFD A;  3KXT A;  1W70 A;  1QVG A;  1W1F A;  1Q86 C;  2VV5 A;  2CT3 A;  1T3L A;  3CCU T;  5GAN j;  1AWJ A;  3PIP A;  1LPL A;  1BIA A;  4N0A A;  3H8Z A;  1ZX6 A;  2VXE A;  1SEM A;  2DF6 A;  3L2Q A;  1V76 A;  2XG8 D;  1IRE B;  3L2R A;  4BE1 A;  4N4G A;  1B34 A;  1M8M A;  1LOJ A;  4LN2 A;  3I56 Q;  4EDU A;  3M0R A;  5KYY B;  4XTX A;  1VQ7 Q;  2VWF A;  1WHJ A;  3G4S Q;  3QBY A;  5LJ5 j;  1K9M U;  2BUD A;  2OTL A;  1T0H A;  2DK3 A;  4A4G A;  3KUF A;  2GFA A;  1KQ1 A;  2EKO A;  4JLI A;  1I5O B;  5GJW B;  3ZL7 C;  5D6X A;  1JJ2 S;  5LJ3 f;  2YLC A;  2CZ0 B;  1YP5 A;  3MP1 A;  1XNI A;  1X2Q A;  2GBQ A;  3PTA A;  3AHU A;  1S72 A;  1YIJ T;  2LNH B;  3SHW A;  1RAE B;  3BDU A;  3G71 T;  1C0M A;  3OYB A;  4PJO D;  1X75 C;  2CP3 A;  1WA7 A;  4FYX B;  3OMC A;  2C0I A;  3OB9 A;  4PL6 A;  1NM7 A;  1JXM A;  5D7U A;  2LVM A;  3PVL A;  2E12 A;  3JSC A;  3J81 E;  3LWH A;  3L2Z A;  2ZPF B;  2K6D A;  4E47 A;  1ABO A;  1DJ7 B;  3CCL T;  1YIT A;  3MPU B;  3OW2 P;  2J6O A;  1LCK A;  2KI7 A;  1LJO A;  2DLP A;  1YWP A;  1VQ5 A;  3MO8 A;  3QHS A;  2H3E B;  3LWI A;  2FZC B;  3FJ5 A;  2QTX A;  3JB9 H;  2XDP A;  5KYX A;  2Z0W A;  2X4Y A;  1J3T A;  3A1P A;  2V1Q A;  4FW1 A;  3FEO A;  2DL5 A;  2E6Z A;  1M1K R;  4LE9 A;  3VRZ A;  3VS3 A;  7AT1 B;  4ZN3 A;  1Y07 A;  2J05 A;  2F2V A;  4ZTF A;  1QVF P;  5L8R E;  1NBE B;  3TEE A;  3M0S A;  1MMG A;  4AG1 C;  2H8H A;  5HCK A;  1K0X A;  2G3R A;  3S3O A;  3MHX A;  1G2B A;  3CCE A;  3H0H A;  4QVC A;  1LNX A;  4M7A C;  2HD0 A;  2PUO B;  2HMA A;  3HSB A;  4OF1 A;  3CQT A;  1HXD A;  4OML A;  1KHC A;  2JMC A;  1ZUY A;  4DBR A;  4F7U A;  2YDL A;  1FX7 A;  4E7J A;  3M0U A;  5GAM g;  1NEB A;  1H92 A;  1IB8 A;  1E7O A;  2K5I A;  1MND A;  4MZM A;  1VQP T;  3X28 B;  1VQN T;  1SHF A;  1UGP B;  3SEM A;  3HRT A;  2M0O A;  2MK5 A;  1NJI C;  4RMO A;  4B6M A;  5IN1 A;  3OW2 S;  1ZBX A;  3EHR A;  2E65 A;  5HKC A;  1JO8 A;  1VQ4 Q;  4RTY A;  2IVW A;  2LT1 A;  2DA9 A;  4N4H A;  2QQ9 A;  4LD6 A;  4J9C A;  2KRM A;  4KUD K;  4M75 D;  4C0D B;  1Q82 R;  1SF9 A;  1K73 R;  1N27 A;  1XTD A;  3OYM A;  3TRE A;  5HK0 A;  1VQO Q;  1WHG A;  4XU3 A;  2E70 A;  5GAN 8;  4M77 D;  1QVF S;  2H3J A;  2A37 A;  1Q81 R;  1TWB A;  3V7R A;  2DM1 A;  1U06 A;  4J5Y A;  3QYG B;  2QQS A;  5GAM e;  4GY5 A;  3VS2 A;  3CC4 Q;  4EMK C;  3CCS T;  2DJZ A;  4XTV A;  2EYQ A;  1QWF A;  4M75 E;  3CBP A;  1U8R A;  3OBW A;  1B07 A;  1JQQ A;  1TXQ A;  1SRM A;  3V8L A;  2YSQ A;  4CC7 A;  2KYB A;  3V7S A;  4D8D A;  1VQ6 Q;  4M7A A;  4JRQ A;  2GCX A;  2LP5 A;  1HYO A;  1HJD A;  5KYU A;  4WF2 A;  3ZEH A;  3OS0 A;  4PLL A;  2KK4 A;  2HKN A;  4J6W A;  1QKW A;  1WYX A;  2DXU A;  2OTJ A;  3H41 A;  2QEX Q;  2PTK A;  4KUL A;  4DOV A;  3JCM b;  2I0N A;  3THK A;  5I11 A;  5KYN A;  1D1A A;  4M7D D;  1SKU B;  4PJL A;  1WLP B;  5GAM j;  2K2M A;  1R8O B;  2FG0 A;  4HT8 A;  2OJ2 A;  1AHJ B;  2K3Y A;  5GAO r;  2NUP A;  2YHT A;  2COW A;  4BB7 A;  2YUQ A;  3HP9 A;  2GFU A;  2YUN A;  3E9G A;  3RUX A;  1UJ0 A;  3I56 A;  4J9H A;  3GOX A;  4JJB A;  1VQ7 A;  4RTV A;  2V8K A;  4DBF A;  2CS7 A;  1SHG A;  4M7D E;  1X27 A;  2QYZ A;  1M1K C;  4JZ4 A;  3L1A A;  1QVG S;  4BE2 A;  5HK3 A;  1VA7 A;  3RR6 A;  3WVD B;  1YJ9 A;  1N9S A;  4KUI A;  1AWO A;  1K8A R;  2ROT A;  2FB7 A;  2MF2 A;  3EFO A;  1WXB A;  1ZA1 B;  3REA B;  4F7U B;  2WSE E;  3UA6 A;  3EHQ A;  2ED0 A;  2QGF B;  1PNJ A;  4C0F A;  1AVZ C;  2VB6 A;  3CCV Q;  3EG9 A;  5GAN h;  1NZ9 A;  2D8J A;  1M90 R;  4E7H A;  4QQG A;  1TUG B;  1MMA A;  5IAY A;  1YJN T;  2BZ8 A;  1GCQ A;  2FPF A;  1KQS P;  4DOW A;  2M0Y A;  4IUR A;  3JCM J;  4C92 D;  3R6O A;  4J9F A;  3M0T A;  4D8K A;  5LJ5 h;  1B7T A;  2CDT A;  2ZPI B;  3JCM P;  2ZCF B;  5LL6 S;  1Q82 C;  1K73 C;  2RJF A;  2L3R A;  5GAO q;  3RNJ A;  1KJW A;  4X9D A;  2YLB A;  4PK4 A;  3SD4 A;  3V8K A;  2AZV A;  3VYH B;  1NEG A;  3JCM V;  1Q81 C;  5GAN 4;  3CC2 T;  2K5F A;  4OP0 A;  2L3P A;  4C92 E;  3DB3 A;  4J9B A;  4ESR A;  3CCJ Q;  1S72 Q;  2JM9 A;  2KY9 A;  4Z02 A;  1K4U S;  2X3X D;  2DAQ A;  5AT1 B;  4MZT A;  1M9S A;  4M7A B;  3NTK A;  1B3Q A;  1K0S A;  2X9H A;  4M78 E;  1WNL A;  2DIL A;  2RQV A;  5KYW B;  5KE3 A;  4UC4 A;  1ZSZ C;  1KD1 U;  1YIT Q;  2DNU A;  3EH1 A;  1R0B G;  5I2M A;  2CYZ B;  2MOX A;  1K9M R;  1VQ5 Q;  2V8J A;  1QMC A;  1M1G A;  4M7D C;  3H0I A;  2IG0 A;  4KGV B;  1VQ4 A;  4ELZ C;  1QP2 A;  1K1Z A;  1RAC B;  3UDC A;  3JCM g;  2YUO A;  2LT4 A;  2DFU A;  1BI0 A;  3DLM A;  3VS0 A;  5KYY A;  4VUB A;  2RJD A;  3CEY A;  1HSQ A;  4JDS A;  1VQM A;  2HNI A;  3U23 A;  3EGD B;  4LDY A;  1SSF A;  3T9N A;  2HQH A;  1QVP A;  1VQO A;  3MEU A;  4XTY A;  3A5Z B;  2JTF A;  3CXC A;  3QZ5 B;  3MEV A;  1OUL A;  4DEX A;  4JRI A;  1G3S A;  1AZG B;  1WIE A;  2ENM A;  3CC4 A;  3PFS A;  1I0C A;  2L2P A;  1OPL A;  2F2X A;  1YFN A;  4B9W A;  3GF5 A;  3QJY A;  3J7A F;  1UGQ B;  2EYZ A;  2DZ9 A;  4J9I A;  1UHC A;  4ZNX A;  4F17 A;  1PG5 B;  4JUV A;  4EMK B;  1Y7X A;  2A08 A;  1BI3 A;  2QI2 A;  3CCU Q;  2MCN A;  5CKF A;  2OAW A;  8AT1 B;  1GBR A;  4NL2 A;  5KCH A;  5GAN f;  4AFQ C;  2JM8 A;  2DXT A;  1K8A C;  4A54 A;  4ZGE B;  2R58 A;  2JZ2 A;  2OI3 A;  1OX8 A;  2OAU A;  1W2B P;  1WHK A;  2EW3 A;  1Q7Y U;  3QO3 A;  1F1B B;  2QEX A;  3CPW A;  2O4X B;  1NG2 A;  3PMT A;  4L6V 5;  4J6Y A;  2KDS A;  5C6S A;  2D0Q B;  2AKL A;  1M90 C;  5LJ5 f;  2AKK A;  2ROL A;  2COY A;  1M27 C;  4C92 C;  4C8Q D;  2CSI A;  1TSF A;  2YWW A;  3CCQ A;  2GQI A;  3OYJ A;  4Z8A A;  3VUZ A;  1WZO A;  4J7I A;  2QAS A;  1X43 A;  4HVV A;  3Q1J A;  2EYX A;  3JB9 F;  3RER A;  1JXO A;  4JJN K;  5GAN e;  2KQW A;  3OSV A;  3G71 Q;  2GNC A;  3CME T;  4JZ3 A;  1WPY A;  4M78 C;  2RQT A;  1BCO A;  2F5K A;  2LC4 A;  2LZ6 B;  1I8F A;  1SRL A;  1NPR A;  5CKD A;  2MWP A;  3P8D A;  2RM4 A;  4C8Q E;  3VRY A;  2EYY A;  1RLP C;  3CCL Q;  3DKM A;  2LX7 A;  1NLO C;  4OB1 B;  4OMM A;  4E7Z A;  2OTJ Q;  2L0A A;  2QA4 T;  2VAS A;  1VQ8 A;  4J83 A;  3CMA A;  3X25 B;  5C0M A;  4OGE A;  5EG2 A;  1KC8 U;  3HFO A;  3R6N A;  2QQB A;  4QKU A;  2PVO B;  5CO7 A;  4A4K A;  5GAM h;  3RKW A;  1UGR B;  3CCV A;  1X6O A;  2XDB A;  2JUF A;  4IIO A;  2YXY A;  4C5E A;  4L5G A;  4E6R A;  2J6K A;  2MPX C;  3JCM X;  4RTW A;  2A3L A;  3M0P A;  2NWM A;  4XK8 E;  4M75 G;  5HY6 A;  2CP0 A;  1K9M C;  3EGX B;  1VIE A;  1UB4 A;  1ZUK A;  4FT4 A;  1YJW A;  2EQU A;  2JJ9 A;  2CP7 A;  4LD9 K;  1MV3 A;  1TG0 A;  1FMK A;  4M77 G;  1VYU A;  2Y4Y A;  1BBZ A;  1QW1 A;  5KCO A;  4KGX B;  3JB9 I;  2HQE A;  4HKE A;  4A63 B;  1VQP Q;  2VGN A;  1VQK T;  2KBT A;  1TH7 A;  2LTO A;  1VQN Q;  1RAI B;  2ESW A;  5FLX E;  1YJ9 Q;  4JPB W;  2ECZ A;  3C0C A;  4PFO A;  1M2V B;  1RL2 A;  5ECA A;  2DMO A;  4P5N A;  3CCJ A;  4JLG A;  4AMC A;  2ZAE A;  3KBG A;  3JAM E;  4DBQ A;  3GNF B;  3GIB A;  4MDX A;  4F7U F;  1PSE A;  2COZ A;  2CH4 A;  2DO3 A;  2M1H A;  2PVD B;  2E10 A;  1WJR A;  1AEY A;  4C5G A;  2M51 A;  1G5V A;  5IXF A;  3V7C A;  3ASK A;  1VQL A;  2DVJ A;  2P4T A;  4M7D G;  2W10 A;  2JTM A;  3CXC P;  1U1S A;  3PVQ A;  3CC7 T;  1N9R A;  4QQD A;  1ZSZ B;  1HK9 A;  2W0Z A;  2VGM A;  4PJO E;  1PCX A;  4IUV A;  3CCS Q;  2JNG A;  3G7Z A;  3IQL A;  1S1N A;  4ZGJ B;  2DTO A;  4E7S A;  1PD1 A;  1BCM A;  4DQ2 A;  3O8V A;  4M7D B;  1RAB B;  4C8Q C;  3I55 T;  1YHQ A;  3OYK A;  3VS1 A;  3MCA B;  3JCM W;  3M55 A;  1JBM A;  2E1H A;  3ER0 A;  5GAN 2;  1IGU A;  2EIF A;  5CQX A;  1T3S A;  3OY9 A;  2LDM A;  4HXJ A;  1BIB A;  2YRC A;  1V1C A;  4BI8 B;  5GMK j;  2EGA A;  5M9O A;  5IH2 A;  1PRM C;  4KT0 E;  4JJC A;  3CPW P;  1BKB A;  3MP6 A;  2J06 A;  5CVI A;  2IIM A;  3CCM T;  1NYF A;  4CC4 B;  2JS2 A;  5A0L A;  4XU0 A;  1M8V A;  2X4W A;  3EG2 A;  2PU9 B;  4M7A F;  1BI2 A;  4FT2 A;  3CCU A;  1IZ6 A;  2HEQ A;  4IIM A;  4IUQ A;  3SWN C;  3VS5 A;  5GAM f;  2F69 A;  2RHI A;  3FC3 A;  3G4S T;  2R57 A;  2GF7 A;  5GAN 6;  4MDW A;  1R0C B;  3CXC S;  2DXB A;  5I21 A;  1YNZ A;  1ZHI A;  1CSK A;  2LRQ A;  1IO6 A;  2LQW A;  4IUT A;  4LDV A;  2DRK A;  1UGV A;  4J9D A;  1VQM Q;  1IGQ A;  4C92 G;  2CUB A;  2XHC A;  2KXD A;  2E4H A;  3TQ7 P;  1UG1 A;  1WQW A;  1ZA2 B;  2EGC A;  2LQ8 A;  2F2W A;  2LJ1 A;  1PRL C;  2X51 A;  9ATC B;  5FWB A;  1MNE A;  2BIV A;  3EAE A;  2P0Q A;  3M53 A;  5FRN A;  2RO0 A;  4M78 G;  4C92 B;  3C4S A;  1YIJ A;  4RG2 A;  1GL5 A;  3E9F A;  3G71 A;  1KD1 R;  3INZ A;  2DVE A;  3CPW S;  1U1T A;  4PJN A;  1QVG P;  5CQY A;  4A4E A;  2QQR A;  2CUD A;  2ZGW A;  4M77 E;  2RNA A;  3GPL A;  2EGE A;  4OGC A;  4M4Z A;  3VYG A;  4M78 B;  1G3T A;  3TVT A;  4QT7 A;  1R77 A;  4PKC C;  4JS5 A;  2FVU A;  5KYW A;  3CCL A;  1Z9Q A;  4PJO C;  4EMG A;  2EPD A;  5GAO p;  3JB9 J;  1AZE A;  3AT1 B;  1D1C A;  4BD3 A;  3PIO A;  1PKS A;  3D7S B;  1V29 B;  3I35 A;  2NUT B;  5DLQ E;  4FM4 B;  4ANJ A;  4DBH A;  3OS2 A;  2QAZ A;  2FL7 A;  3JCM d;  4Y91 A;  1N8R U;  2DER A;  1HD3 A;  4A53 A;  3EGD A;  1IXD A;  2B8A A;  4JS4 A;  2LMJ A;  3CCQ Q;  2EQJ A;  4ORZ A;  3CC2 Q;  2P4R A;  4MML A;  1VQ9 T;  4ZGD B;  4Y28 E;  4HCC A;  1M3C A;  3VUB A;  1ABQ A;  3CD6 T;  3FJP A;  4FYW B;  4R55 A;  1FWZ A;  5DY9 A;  3A8O B;  2VXF A;  3QWX X;  2L3Q A;  4TVR A;  5DLO A;  1YBY A;  2RB6 A;  3G1J A;  2HCK A;  2WSF E;  1TTH B;  3CCM A;  2XK0 A;  4O5V A;  1VYT A;  4BE0 A;  5FWC A;  1VQP A;  4C5H A;  1OZ3 A;  3RMQ A;  3P8H A;  4II1 A;  1MMD A;  1Q7Y R;  1VQN A;  4EMK A;  1UEB A;  3HFN A;  1D3B B;  2DEQ A;  3BW1 A;  1TOV A;  4LDW A;  5IHK A;  4Q5W A;  1D0Y A;  2YRD A;  5L23 A;  4FW2 A;  3CBM A;  1UJY A;  1KSW A;  4E2F B;  2MMP A;  2RQR A;  1VQ8 Q;  3CMA Q;  2RN8 A;  2AIR B;  3MKD A;  3OS1 A;  4EPC A;  1H3H A;  2O4X A;  1H3Z A;  4J9E A;  1QLY A;  1KFZ A;  3UF4 A;  2X4X A;  1D09 B;  1CKA A;  2QQA A;  4FU6 A;  1GFC A;  3NTH A;  1RLQ C;  3RDV A;  4FSX A;  2XU8 A;  1EIF A;  3I5S A;  1YI2 T;  1YJW Q;  2XIC A;  3L42 A;  2JS0 A;  2KRN A;  3M4G A;  4M75 C;  2DL7 A;  1G83 A;  1U3O A;  1TUC A;  1VQ6 T;  2D6F A;  2CGH A;  3RBB B;  1I1J A;  3CCS A;  4C8Q G;  1JJ2 A;  1KK7 A;  2JTE A;  1D0X A;  4KH0 B;  3SB2 A;  1UUE A;  4NS5 A;  4M77 C;  3CCR T;  2MYS A;  3A8G B;  2HSP A;  3JB9 D;  2X3W D;  3HRS A;  4K11 A;  3JRZ A;  5FU6 C;  3M54 A;  3M57 A;  3JCM c;  4BDY A;  5FRM A;  1FYN A;  1LVK A;  3BDL A;  2RH2 A;  4C8Q B;  3A8M B;  2E64 A;  1KC8 R;  4C0Z A;  3JV3 A;  1Q95 G;  3M5A A;  3VV0 A;  4PNO A;  2O9S A;  5CR2 A;  2EBP A;  1JU5 C;  1X69 A;  3NFC A;  3WXM B;  1UE9 A;  1G3W A;  2DL4 A;  2E41 A;  2E5K A;  2I2L A;  1KG1 A;  1KD1 C;  2O01 E;  3ZBD A;  2K9G A;  5J26 A;  3FB9 A;  5GAO n;  3QG1 A;  4E7L A;  3C95 A;  3GBQ A;  3E1S A;  3LW5 E;  2FPE A;  4HVU A;  5GAO l;  2LCS A;  1VQL Q;  2DTH A;  1KQ2 A;  1H8K A;  2EKH A;  4FIB A;  2KE9 A;  2HZY A;  1M3A A;  3G6E T;  2Y90 A;  1YCY A;  1VQ9 A;  4RTU A;  3SWN B;  1QCO A;  2MAM A;  1I81 A;  3EGX A;  1GCP A;  2X4J A;  4F04 B;  3EH2 A;  3A98 A;  2DEU A;  2RJE A;  2RHZ A;  4HCZ A;  1K76 A;  1RAH B;  2DZC A;  2CT4 A;  2V26 A;  4ELY C;  2PUK B;  1YHQ Q;  3I5R A;  4M75 A;  5D6W A;  2GTJ A;  1AT1 B;  1JRI A;  5CAI A;  2K4Y A;  2KXC A;  2VYT A;  2RQW A;  5GMK h;  3S6W A;  3UAT A;  3SFM A;  4RCC A;  4YTL A;  5GMK l;  1AOJ A;  3EFR A;  3VS6 A;  4AG2 C;  4MMK A;  5IT9 E;  1PM3 A;  1M2V A;  3O5Z A;  3C12 A;  2BZX A;  3QJ6 A;  2QK0 A;  2QTV A;  1T0J A;  1UDL A;  2FEI A;  3RKX A;  2FZG B;  3WVE B;  3OW2 A;  1UHF A;  4BUG A;  4OB2 B;  5KH6 A;  3PMI A;  5LJ3 d;  4XTU A;  2KT1 A;  1CKB A;  4GLM A;  1Q7Y C;  1WDX A;  3PE0 A;  4PJO G;  2HKQ B;  1OU8 A;  1K9A A;  2QDY B;  1YJN A;  3JCM e;  4PFP A;  2OTL T;  4HA8 A;  4ME7 A;  3FLG A;  1RAG B;  3OBY A;  2D0N A;  4Y92 A;  3M0Q A;  1ZSZ A;  1VYV A;  2RI5 A;  3M4Y A;  4PJO B;  1WHH A;  3QDR B;  2PZ1 A; 
#chains in the Genus database with same CATH homology
 2E5Q A;  4EMK C;  1PSE A;  2DJZ A;  4XTV A;  2EYQ A;  3CCR A;  4J8O A;  4M75 E;  3CBP A;  3GP8 A;  1U8R A;  4F7U E;  2QEX T;  3OBW A;  3UT1 A;  4OVA A;  2DIG A;  1S72 T;  2DO3 A;  2M1H A;  4XQ3 A;  4M7D A;  3V8L A;  4JRP A;  2PVD B;  4N0A C;  2E10 A;  1WJR A;  2R5M A;  2RJC A;  4A4F A;  4M77 F;  3VKI A;  3V7S A;  4C5G A;  5GMK i;  1G5V A;  3QYH B;  3V7C A;  2NLU A;  3ASK A;  5CK9 A;  4NOY A;  1PSF A;  1VQL A;  2XID A;  3CC2 A;  4M7A A;  4JRQ A;  2RI3 A;  3OYG A;  1Y96 A;  2GCX A;  2P4T A;  3M56 A;  4ZTJ A;  4M7D G;  3SDZ A;  4NL3 A;  2JTM A;  3ZEH A;  4WF2 A;  1ZQ1 A;  1U1S A;  3QZ9 B;  3OYA A;  3CC7 T;  3OS0 A;  4PLL A;  1N9R A;  4M78 D;  4QQD A;  1JB0 E;  2KK4 A;  1HK9 A;  4C92 F;  2VGM A;  4PJO E;  4M7A G;  1Q82 U;  4IUV A;  1K73 U;  3CCQ T;  4J6W A;  3J80 E;  1BYM A;  5J39 A;  2JNG A;  1YIT T;  2V8I A;  2DXU A;  3G7Z A;  4DA4 A;  2OTJ A;  3PGG A;  4ZGJ B;  2DTO A;  2RA2 A;  1P92 A;  4KUL A;  4DOV A;  1NPP A;  3JCM b;  4DQ2 A;  3FRN A;  3O8V A;  1VQ5 T;  4M7D B;  4C8Q C;  2HAX A;  3I55 T;  1YHQ A;  3OYK A;  1XQH A;  1Q81 U;  2CZ7 B;  3MCA B;  5CKB A;  4A4H A;  3JCM W;  4M7D D;  3M55 A;  5GAM j;  3J81 E;  1KC8 C;  1R8O B;  2PVG B;  4M78 F;  2QXF A;  1JBM A;  5D6Y A;  4HT8 A;  2E1H A;  3CD6 A;  3ER0 A;  1I4K 1;  3L2W A;  5GAN 2;  3G6E A;  2EIF A;  4M7A D;  1AHJ B;  2K3Y A;  3M59 A;  5GAO r;  5CQX A;  3OY9 A;  2RHY A;  3QII A;  2LDM A;  2YHT A;  1BIB A;  2JOY A;  4IKF A;  2ZZD A;  4BB7 A;  2AHJ B;  4BI8 B;  5GMK j;  1WJQ A;  5M9O A;  3PNW C;  3HP9 A;  2GFU A;  3LGL A;  3JCM f;  2RK1 A;  4KT0 E;  5FU7 C;  4BAC A;  3E9G A;  3H6Z A;  4J6X A;  3RUX A;  3I56 A;  1BKB A;  3C94 A;  1KQS S;  3GOX A;  4IUU A;  4M7D F;  1VQ7 A;  3GLX A;  3MP6 A;  3CCE T;  1VQ8 T;  5CVI A;  2JVV A;  4EMH A;  3CCM T;  3CMA T;  2V8K A;  2CS7 A;  5J3B A;  4M7D E;  3L2V A;  5A0L A;  2XDD A;  4XU0 A;  2DXC A;  1M8V A;  3OYY A;  2X4W A;  2PU9 B;  2KAF A;  1M1K C;  4M7A F;  1BI2 A;  2XI9 A;  3L1A A;  4FT2 A;  3FDR A;  3CCU A;  1IZ6 A;  4HCB A;  3SWN C;  4IUQ A;  4M77 A;  4BE2 A;  1QVG S;  5GAM f;  4M7A E;  1H64 1;  2F69 A;  3E19 A;  2RHI A;  2DTI A;  3FC3 A;  3CCV T;  4QW2 A;  4E7K A;  5HK3 A;  3G4S T;  4GLK A;  2R57 A;  1G3Y A;  2GF7 A;  3WVD B;  3ZFJ A;  5GAN 6;  1YJ9 A;  1N9S A;  4KUI A;  1NE8 A;  4MDW A;  4QVZ A;  3VU3 C;  2CKK A;  1UGS B;  3CXC S;  3GNG A;  2DXB A;  5I21 A;  2DKG A;  1GXI E;  4BY6 C;  4ATO A;  5KE2 A;  1ZHI A;  2P0P A;  2FB7 A;  3URG A;  2FYK A;  4C92 A;  2MF2 A;  4QVD A;  1WJS A;  2LRQ A;  2MI6 A;  3CPF A;  1YJW T;  2ZPH B;  4M75 B;  4BDZ A;  4IUT A;  4F7U B;  1I5L A;  4LDV A;  4BI3 A;  2WSE E;  1Q86 U;  1WGS A;  3PT9 A;  3HKS A;  3OYF A;  3JCM Q;  2RHU A;  3MEA A;  4C92 G;  5GAO m;  2XHC A;  4C0F A;  1OYX A;  4ZN1 A;  1WQW A;  1YI2 A;  2ZPB B;  4M77 B;  5GAN h;  1NZ9 A;  3OA6 A;  2PQW A;  2LQ8 A;  4M78 A;  4E7H A;  4QQG A;  4XU2 A;  3RKY A;  5LJ3 h;  5GAN g;  2EWN A;  1VQ6 A;  5FU6 B;  4E7I A;  4OB3 B;  1Y71 A;  2XKO C;  3RMS A;  4L59 A;  3VJP A;  5IAY A;  1YJN T;  1QVF A;  2BIV A;  3CBO A;  5LJ3 g;  3BY7 A;  2P0Q A;  3EAE A;  3M53 A;  5FRN A;  2RO0 A;  4M78 G;  4C92 B;  2Y4X A;  4DOW A;  2M16 A;  5GAN 5;  3C4S A;  4IUR A;  1BI1 A;  3JCM J;  4RG2 A;  1YIJ A;  4C92 D;  4PLI A;  1WQ7 A;  3E9F A;  3R6O A;  3G71 A;  3CCJ T;  3INZ A;  2DVE A;  4C0D C;  5I2S A;  1U1T A;  5LJ5 h;  3CPW S;  2K2V A;  4CI0 C;  2ZPI B;  5CKH A;  3JCM P;  2ZCF B;  2MWO A;  4C0G A;  5CQY A;  5LL6 S;  4A4E A;  3DLL A;  2QQR A;  1Q82 C;  2ZGW A;  1K73 C;  5GMK e;  3RES A;  3OYH A;  2RJF A;  3DB4 A;  4X34 A;  5LJ5 g;  2L3R A;  4M77 E;  3LYI A;  3GPL A;  3MP8 A;  4OGC A;  5GAO q;  2KMT A;  4X9D A;  3VYG A;  1K8A U;  2YLB A;  4M78 B;  3HL8 A;  1G3T A;  3SD4 A;  3A8H B;  4PKC C;  1W4S A;  4JS5 A;  2XD0 A;  3V8K A;  2FVU A;  2KSS A;  5GMK m;  1VUB A;  3CCL A;  3VYH B;  4OMF B;  3JCM V;  2LCL A;  4PJO C;  1Q81 C;  4EMG A;  2L8D A;  3QXE B;  2KVQ G;  5GAO p;  1VQL T;  3N5B B;  3F70 A;  5GAN 4;  3JB9 J;  3CC2 T;  2K5F A;  4OP0 A;  3X20 B;  4C92 E;  4LDX A;  3DB3 A;  3OSS C;  2EQM A;  2R5A A;  2EFI A;  2EQK A;  2LCC A;  4BD3 A;  3PIO A;  2BKD N;  3CME A;  2KY9 A;  2FHD A;  1V29 B;  3EFS A;  4Z02 A;  1M90 U;  3FIF A;  5DLQ E;  4FM4 B;  2EJG A;  3S3N A;  2DAQ A;  4MZT A;  2DD5 A;  4B9X A;  2L5Q A;  3OS2 A;  2OTJ T;  2RK2 A;  1M9S A;  2K5L A;  4XTW A;  3BFM A;  2FL7 A;  3LLR A;  4M7A B;  3NTK A;  3JCM d;  1Y96 B;  4Y91 A;  1N8R U;  2P0K A;  5LJ3 e;  4M78 E;  4A53 A;  1WNL A;  4QQ6 A;  4BI4 A;  2B8A A;  2LX9 A;  1RI0 A;  3MET A;  4UC4 A;  5KE3 A;  4XAX B;  3OYD A;  4JS4 A;  1YHQ T;  1D3B A;  2EQJ A;  4X9C A;  4C8Q F;  1KD1 U;  4MML A;  4RG8 A;  5CKE A;  2QA4 A;  3S3M A;  4ZGD B;  4Y28 E;  1VQ9 T;  4HCC A;  3VUB A;  2K3X A;  5I2M A;  3CD6 T;  2ZPG B;  3FJP A;  1OI1 A;  5GAN 7;  4R55 A;  1FWZ A;  5FRO A;  2CYZ B;  5DY9 A;  5GAM d;  1X01 A;  3A8O B;  3NTI A;  2VXF A;  5A2Q E;  2CZ6 B;  2V8J A;  5LJ5 e;  2VC8 A;  1M1G A;  4TVR A;  2C06 A;  2D6F A;  4J7F A;  5DLO A;  3OYN A;  1YBY A;  2RB6 A;  2IG0 A;  1KQS A;  1VQ4 A;  4M7D C;  2EAY A;  4ELZ C;  2DD4 A;  4CRI A;  1QP2 A;  3UDC A;  3JCM g;  5CIU A;  2LT4 A;  1BI0 A;  2WSF E;  1M1F A;  3L2U A;  3V8J A;  1W2B S;  1N6A A;  3DLM A;  2ZPE B;  2XK0 A;  4O5V A;  3M58 A;  3M9Q A;  1O75 A;  3CCM A;  3I56 T;  4BE0 A;  2M9U A;  3KXT A;  4VUB A;  2RJD A;  1VQP A;  3CEY A;  4C5H A;  1VQ7 T;  1OZ3 A;  4JDS A;  3RMQ A;  1VQM A;  2HNI A;  3P8H A;  1QVG A;  4II1 A;  1Q86 C;  1VQN A;  4EMK A;  4LDY A;  2DPP B;  1UEB A;  1SSF A;  2EJF A;  2VV5 A;  3HFN A;  3T9N A;  1D3B B;  1QVP A;  3OQ5 A;  2DEQ A;  3BW1 A;  1VQO A;  3MEU A;  4LDW A;  3CCU T;  3LX7 A;  4Q5W A;  3A5Z B;  4XTY A;  3PIP A;  5GAN j;  1BIA A;  2JTF A;  5AYF A;  3CBM A;  4N0A A;  3CXC A;  3QZ5 B;  2MMP A;  2RD1 A;  3MEV A;  5LJ3 j;  4JRI A;  3H8Z A;  1G3S A;  2VXE A;  4MZP A;  1YJ9 T;  3L2Q A;  3OS1 A;  2XG8 D;  1IRE B;  4EPC A;  3X26 B;  3L2R A;  4BE1 A;  4N4G A;  1B34 A;  3CC4 A;  1LOJ A;  3PFS A;  2O4X A;  4EDU A;  2GQV A;  4XTX A;  3P8B B;  1VQK A;  3QUI A;  1H3Z A;  4B9W A;  3GF5 A;  3QJY A;  3J7A F;  1UGQ B;  2DZ9 A;  2L89 A;  2X4X A;  3QBY A;  5LJ5 j;  2QQA A;  4KBM B;  4JUV A;  4FU6 A;  4EMK B;  2BUD A;  1Y7X A;  1K9M U;  3NTH A;  2OTL A;  1BI3 A;  2RI2 A;  2QI2 A;  4OB0 B;  4FSX A;  3LWH A;  2DIQ A;  3OYI A;  2LQK A;  3JB9 G;  2XU8 A;  5CKF A;  1NJI U;  2D9T A;  1EIF A;  2DK3 A;  4A4G A;  1YI2 T;  3KUF A;  1K9M C;  2GFA A;  2XIC A;  3L42 A;  4C8Q A;  4NL2 A;  5KCH A;  5GAN f;  1KQ1 A;  2EKO A;  2DXT A;  3M4G A;  4XTZ A;  4JLI A;  4M75 C;  1K8A C;  3OYC A;  2VUB A;  1M5Q 1;  5D6X A;  1JJ2 S;  4A54 A;  2E6N A;  3TU4 K;  5LJ3 f;  1VQ6 T;  3OYE A;  4ZGE B;  2R58 A;  2CGH A;  2CZ0 B;  2JZ2 A;  2YLC A;  1MGQ A;  3CCS A;  2OAU A;  3MP1 A;  4C8Q G;  1Q7Y U;  1XNI A;  1JJ2 A;  1B34 B;  3PTA A;  3QO3 A;  2YRV A;  3QKJ A;  3SB2 A;  2QEX A;  2O4X B;  3CPW A;  3AHU A;  1S72 A;  4NS5 A;  3PMT A;  4M77 C;  1QP3 A;  3CCR T;  1YIJ T;  3A8G B;  4L6V 5;  4J6Y A;  2KDS A;  3BDU A;  2LNV A;  3G71 T;  3OYB A;  5C6S A;  3JB9 D;  2D0Q B;  3HRS A;  4PJO D;  1X75 C;  3ME9 A;  1M90 C;  5LJ5 f;  3JRZ A;  5FU6 C;  3M54 A;  5GAN 3;  3M57 A;  3JCM c;  3OYL A;  3OMC A;  4BDY A;  3LH0 A;  3OB9 A;  4PL6 A;  5FRM A;  5CCA A;  3BDL A;  2RH2 A;  4C8Q B;  3CC7 A;  3A8M B;  4C92 C;  2E64 A;  4C0Z A;  2LVM A;  2E12 A;  3JSC A;  3M5A A;  4PNO A;  1XOV A;  3VV0 A;  3L2Z A;  5CR2 A;  2ZPF B;  3NFC A;  4C8Q D;  1N8R C;  3CCQ A;  4E47 A;  3WXM B;  3CCL T;  1DJ7 B;  1G3W A;  3SWN A;  3OYJ A;  1YIT A;  3VUZ A;  2JN0 A;  2E41 A;  2K57 A;  3A8L B;  4JRK A;  4J7I A;  2I2L A;  1KG1 A;  1KD1 C;  3Q1J A;  2O01 E;  3JB9 F;  3RER A;  4PJO F;  3OS5 A;  1MHN A;  4JJN K;  5GAN e;  1LJO A;  2KQW A;  3OSV A;  4D6W A;  3QSU A;  1VQ5 A;  3ZBD A;  3I55 A;  5J26 A;  3FB9 A;  3MO8 A;  5GAO n;  3CME T;  3QHS A;  3HRU A;  3QG1 A;  1WPY A;  3LWI A;  4E7L A;  4M78 C;  2QTX A;  3C95 A;  2A7Y A;  3JB9 H;  3E1S A;  2F5K A;  5FU7 B;  2LC4 A;  3LW5 E;  2XDP A;  1I8F A;  5A0D A;  4R56 A;  4C5I A;  2X4Y A;  1KC8 U;  2HQX A;  5GAO l;  1NPR A;  2DTH A;  5CKD A;  4N4I A;  1KQ2 A;  4FIB A;  3FEO A;  2MWP A;  3P8D A;  2RM4 A;  2E6Z A;  4C8Q E;  3HHT B;  3HPW A;  4ZN3 A;  1Y07 A;  3DKM A;  3G6E T;  3QPH A;  4ZTF A;  2Y90 A;  1YCY A;  5L8R E;  3JCM h;  1VQ9 A;  3SWN B;  2MAM A;  1I81 A;  3TEE A;  1KHI A;  4OB1 B;  2X4J A;  2G3R A;  2QA4 T;  3UWN A;  3S3O A;  2RJE A;  3MHX A;  5DM7 R;  3CCE A;  1VQ8 A;  4J83 A;  4QVC A;  3CMA A;  2RHZ A;  3X25 B;  5C0M A;  1LNX A;  4M7A C;  2WSC E;  2HD0 A;  4OGE A;  3RIR A;  4HCZ A;  4BY6 B;  2DZC A;  2PUO B;  1W2B A;  3HSB A;  5EG2 A;  4ELY C;  4OF1 A;  2PUK B;  2WAC A;  3HFO A;  2X35 A;  1HXD A;  2HBP A;  2QQB A;  2PVO B;  3MEW A;  5CO7 A;  4A4K A;  5GAM h;  1VQ4 T;  3RKW A;  1KHC A;  4M75 A;  1UGR B;  5D6W A;  4F7U A;  3CCV A;  1X6O A;  1FX7 A;  4E7J A;  2JUF A;  2XDB A;  2CZ1 B;  3G4S A;  5GAM g;  4C5E A;  2K5I A;  4L5G A;  3JCM X;  4MZM A;  1VQP T;  3X28 B;  1JRI A;  2A3L A;  5CAI A;  2K4Y A;  1VQM T;  4XK8 E;  2VYT A;  4M75 G;  5HY6 A;  1VQN T;  4F7U G;  3S6W A;  5GMK h;  3SFM A;  1M4Z A;  1UGP B;  4RCC A;  4YTL A;  1VIE A;  1UB4 A;  4XU1 A;  5GMK l;  1FXX A;  3EFR A;  2RHX A;  4FL6 A;  4FT4 A;  1YJW A;  3HRT A;  4MMK A;  2EQU A;  2M0O A;  5IT9 E;  1VQO T;  1O9S A;  1NJI C;  4LD9 K;  3C12 A;  4RMO A;  3OW2 S;  5IN1 A;  2F5T X;  1ZBX A;  2EJ9 A;  4RKU E;  4M77 G;  3TCJ A;  4PJO A;  3X24 B;  2Y4Y A;  3QJ6 A;  2E65 A;  5HKC A;  5GAN d;  3WVE B;  1QW1 A;  3RKX A;  5KCO A;  3OW2 A;  1M1K U;  4LDU A;  4BUG A;  2IVW A;  4OB2 B;  5KH6 A;  2LT1 A;  4N4H A;  2QQ9 A;  3PMI A;  5LJ3 d;  4XTU A;  4HT9 A;  3LGF A;  3JB9 I;  3CC4 T;  4LD6 A;  1Q7Y C;  2HQE A;  4HKE A;  4PJO G;  4KUD K;  4M75 D;  4C0D B;  2VGN A;  1VQK T;  1TH7 A;  3UPU A;  2LTO A;  2QDY B;  4RCB A;  1YJN A;  3JCM e;  5FLX E;  4V2S A;  1N27 A;  1XTD A;  2OTL T;  5A0G A;  3OYM A;  3TRE A;  5HK0 A;  4XU3 A;  3OMG A;  2E70 A;  4HA8 A;  5GAN 8;  1VIF A;  4ME7 A;  5LJ5 d;  4M77 D;  1OZ2 A;  1QVF S;  2H3J A;  1RL2 A;  3FLG A;  3OBY A;  4P5N A;  4O6J A;  3V7R A;  3CCJ A;  4IUP A;  4JLG A;  2RI5 A;  3M4Y A;  4PJO B;  3QDR B;  3KBG A;  4J5Y A;  3QYG B;  3JAM E;  2QQS A;  3GNF B;  4M75 F;  5GAM e;  3GIB A;  4MDX A;  4F7U F;  4GY5 A;  3CCS T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...