5IAYA

Nmr structure of uhrf1 tandem tudor domains in a complex with spacer peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
152
structure length
152
Chain Sequence
LYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Hemi-methylated DNA opens a closed conformation of UHRF1 to facilitate its histone recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 13
structure length 152
sequence length 152
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5iayA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5iayA01
3CCLA 2E6NA 1QVGA 1Q82U 3G6ET 1YJ9T 2R57A 1NJIC 4N4IA 2OTJA 2D9TA 3OYBA 3CCJA 2LQ8A 3Q1JA 2X4YA 1KD1C 4FU6A 3CC2T 3LYIA 5CIUA 1W2BS 3OYYA 4A4HA 3CCEA 1K8AU 3QKJA 2F5KA 3OYNA 2X4XA 1W2BA 2RO0A 2OTLT 3OS2A 3MEVA 2M1HA 4QQ6A 5FLXE 3CPFA 3CCST 3G6EA 1YJ9A 2K3XA 3LLRA 4N4HA 2NLUA 3UWNA 3C4SA 4A4GA 5D6YA 3CC2A 3LGFA 3CC7T 1RI0A 5FRNA 3EAEA 2B8AA 2P0KA 1K73U 2L89A 3L42A 4IUUA 3NTHA 2L8DA 3PNWC 3OY9A 2X35A 3MEUA 3CPWS 1VQKT 3OA6A 1VQPT 5J3BA 2E70A 2RHYA 2JTFA 4Z02A 1NJIU 1QVFS 3CPWA 3CCSA 2RI5A 1KD1U 2EQJA 1OYXA 2LRQA 3ER0A 2QEXT 3CC7A 3ZEHA 1XTDA 4L59A 2YRVA 3L2RA 3OMGA 1JJ2S 3P8BB 3CMAT 1VQKA 1VQPA 5KCHA 3G4ST 2KVQG 2DIGA 4II1A 1YHQT 1JJ2A 3M9QA 4E7IA 1YBYA 2BUDA 1K9MU 4LD6A 5KE2A 2LCLA 1VQOT 2RJDA 5HY6A 3PIOA 3E9GA 3L2UA 1IZ6A 3BDLA 2QEXA 2LVMA 2R58A 2LCCA 4BDYA 1WGSA 4X34A 2LTOA 4IUPA 1G5VA 2EFIA 3PMTA 2RHIA 2M16A 5IAYA 3CMAA 1WJRA 3G4SA 3OS0A 2DIQA 1YHQA 3NTIA 3E9FA 1VQ8T 2PQWA 5J26A 4E7LA 2E6ZA 3A5ZB 3GOXA 1VQOA 3OYMA 2XDPA 3OQ5A 2QA4T 4BD3A 3OYCA 3NTKA 3QBYA 3I56A 2DO3A 4NS5A 1X6OA 4PL6A 3MP8A 3KUFA 1BKBA 5DLQE 1OI1A 2G3RA 2KDSA 4C5GA 2BKDN 1K9MC 3SD4A 2O4XA 1RL2A 3OYHA 5IN1A 2EKOA 2RHZA 2X4WA 5M9OA 1YITA 1VQ8A 1N27A 3J81E 3LH0A 4PLIA 3S3MA 3FC3A 1OZ3A 4B9WA 3G71T 3OYIA 3MP1A 2QA4A 4TVRA 1YJWT 3TREA 1YJNT 2E5QA 1NPRA 1VQ7T 4ZN3A 2RJCA 1Q7YU 5A2QE 1OZ2A 3QIIA 1M90C 2MI6A 4YTLA 2WACA 2EQUA 4FL6A 1MHNA 1Q81C 5KH6A 4ZTFA 3L2VA 1UEBA 3CCMT 3G71A 3DB4A 1YJWA 2JUFA 3PFSA 1YJNA 3I55A 2RJFA 1VQ7A 2L3RA 1WJQA 1Q86C 4BE2A 4PLLA 2JNGA 3QJ6A 3CEYA 1S72T 2RJEA 5KCOA 4QQDA 3OYJA 4OVAA 3JAME 4BE1A 4IUVA 3MEWA 3FEOA 4RG2A 2RHXA 4ZTJA 1N8RC 3ME9A 5KE3A 3PIPA 3I56T 2HQEA 3CC4T 3CCMA 4C5HA 3P8HA 1Q7YC 3CCUT 1YIJT 2RI3A 2EQKA 4E7HA 1EIFA 3S3NA 2DAQA 3OB9A 1S72A 1VQLT 4IUTA 1KQSS 1KC8C 2K3YA 1M90U 3CXCS 3CCRT 1YITT 5FROA 2QQRA 1KQSA 3UT1A 1YI2T 1Q81U 3CXCA 3H6ZA 3OYLA 3OYGA 3S3OA 2R5AA 1M1KC 2GF7A 1SSFA 5FRMA 3CCQT 2RHUA 1VQNT 3CC4A 2GFUA 3META 3OW2S 4Q5WA 4C5IA 4UC4A 3CCUA 1YIJA 1Q86U 1H3ZA 3OW2A 2VYTA 3FLGA 3F70A 1VQLA 3OYKA 3CCRA 2XK0A 2M0OA 3O8VA 2HQXA 1VQ4T 4IKFA 4GY5A 3LGLA 3DLLA 2O4XB 4BACA 1YI2A 1N8RU 3I55T 5C0MA 3KBGA 2JOYA 4N4GA 3CCQA 3CMET 4QVZA 1VQNA 2R5MA 1KHCA 3H8ZA 4CRIA 4QW2A 3HKSA 1KC8U 3DB3A 4EDUA 4HCZA 3LX7A 2FHDA 5IT9E 1VQ5T 2OTLA 1VQ4A 1Q82C 2MWPA 2BIVA 3ASKA 1M1KU 3L2WA 1VQ6T 4IURA 4A4EA 5D6XA 4B9XA 3OYEA 3J80E 2MWOA 3OYFA 1NZ9A 2RI2A 3DLMA 3CMEA 3MO8A 5D6WA 1QVFA 2JVVA 4ZN1A 1K8AC 1VQ9T 4BE0A 3CCVT 1M1GA 3J7AF 3P8DA 4E7KA 3CD6T 4QQGA 1VQMT 2IG0A 2CKKA 2XHCA 5C6SA 3L2QA 5J39A 1VQ5A 3CCLT 1WJSA 2OTJT 4C5EA 4E7JA 3OS1A 3CCJT 2QQSA 1VQ6A 3PMIA 2JZ2A 4A4FA 5DM7R 2EQMA 1XNIA 4BDZA 3OYDA 3CCET 2GFAA 3OMCA 3S6WA 2LDMA 5LL6S 1VQ9A 3FDRA 3CCVA 3MP6A 3OYAA 1K73C 1KHIA 3CD6A 1QVGS 1VQMA 1NPPA 3MEAA 2EIFA 4IUQA
chains in the Genus database with same CATH superfamily
1QVGA 2CH4A 1Q82U 2DEUA 3V7CA 2EYWA 4N4IA 3OYBA 1GBRA 5LJ5d 4JZ3A 5CKDA 3CCJA 1VQOQ 1H3HA 1N9RA 1UHCA 3HRUA 2LQ8A 4C8QA 5LJ3j 1IGQA 4D8DA 3OW2P 4F16A 3NPFA 5GMKe 3VKIA 4M75G 3VUZA 3HFNA 3H41A 3OYNA 2FB7A 2RQWA 2X4XA 4F7UB 3EFOB 2OTLT 2RA2A 1RUWA 3MEVA 5FLXE 3M59A 4M77B 2NLUA 1I4K1 2VXFA 3I35A 3RESA 4RTTA 2LQKA 4M78G 4EMKC 2F69A 1NBEB 5D6YA 5LJ5g 2QA4Q 3LGFA 2K5FA 2A0FB 1RACB 3JCMc 4BUGA 2BZYA 1HXDA 1EZZB 2GCXA 1KFZA 4LDXA 3L42A 2BZXA 3NTHA 2L8DA 3PNWC 2AZSA 2O01E 4WF2A 3RUXA 3CPWS 1VQKT 4DEYA 5J3BA 4AG2C 1QVFS 2KGTA 3RDVA 4RKUE 4M7DF 2LRQA 4DBRA 5KYWA 3G71Q 2M02A 1WDXA 2RMOA 3VS4A 1U06A 4FCYA 1GRIA 3QWXX 2HAXA 3WVEB 4M78F 3QYHB 2K7AA 2FVUA 3QO3A 1PWTA 2EPDA 4P5NA 4LN2A 2DK3A 1VQKA 2KRSA 2XDDA 1M27C 1FWZA 2DKGA 2DIGA 2EJFA 3SFMA 2BUDA 1SHFA 2YUPA 4ELYC 2LCLA 2RJDA 3E9GA 3L2UA 3FJPA 3O5ZA 5CAIA 5HK0A 3PGGA 3G7ZA 2LCCA 1V76A 4BDYA 2E5KA 1QVGP 1NLOC 3HSBA 4RMOA 2ED1A 4MDWA 3SHWA 3HPWA 4ZNXA 5IAYA 4FYXB 2L3SA 2XIDA 2ZPGB 3HHTB 5GANe 3A8GB 1IRXA 2L2PA 3E19A 3E9FA 2RQTA 1I5LA 2AK5A 1VOMA 3JB9F 3REAB 2FPDA 1GBQA 1PD0A 4L5GA 3C94A 2DLPA 3NTKA 3I56A 1OU9A 2QDLA 4M77C 1X6OA 2KY9A 4OMPA 2QGGA 3H0HA 4OMOA 1AWXA 2G3RA 4C5GA 1K9MC 2KROA 2O4XA 2PU9B 1BU1A 2BZ8A 5IN1A 4F7UE 5AYFA 4PLIA 3S3MA 4Z88A 4RUGA 2LZ6B 1EFNA 2J7IA 3MP1A 4M77E 4TVRA 1LPLA 1YWOA 1YJNT 2LX9A 1VQ7T 3V7RA 4ZN3A 2VXEA 2G6FX 2DTIA 2ZPBB 5KYUB 4FIBA 5LJ3f 4B6MA 3QIIA 1D0ZA 1X27A 1G3SA 1M90C 1I81A 3M58A 1OEBA 3TSWA 4EMHA 1TUDA 1UDLA 2PVGB 5KH6A 2FEIA 4ZTFA 3L2VA 5GAMj 3DB4A 2DTOA 2YWWA 2KBTA 2JUFA 1E6GA 1D1BA 2RD1A 1YJNA 1VQ7A 2LJ1A 4PLLA 3BFMA 2CZ6B 2KRNA 3TVTA 2ABLA 2RJEA 2EYZA 4D6WA 4DOWA 2DFUA 4QQDA 2GQIA 1GFCA 2QAZA 2ESWA 1FMVA 4IUVA 2K5IA 1AZGB 3FEOA 5LJ5f 1VQ6Q 4RG2A 4FT4A 4XTVA 5GANd 4EIKA 1UGSB 1X2KA 5LJ3h 1W1FA 3EG0A 2KYBA 4M75A 5GAN4 2KXCA 2J6KA 2OAWA 1RAEB 3P8HA 4RTWA 1RAGB 2XI9A 2PUKB 3S3NA 3EH1A 2CP7A 2HL3A 4A63B 1VQLT 2JT4A 3NHNA 3CXCS 3CCRT 3CCLQ 5GAN5 1YITT 2QQRA 1MMNA 1RABB 1TOVA 1JB0E 4M78A 1YI2T 3H6ZA 2LQNA 1M4ZA 3JV3A 4C0DB 1NE8A 4CI0C 4OMNA 3H0FA 3CCEQ 5GANg 1WHMA 3OW2S 4AFSC 3A8MB 1TTHB 2HDAA 4JRPA 3M4GA 4C0FA 4D8KA 5CKEA 4QVDA 1Q86U 1M5Q1 3V8KA 2EAYA 2VVKA 1CKAA 5LJ5h 2VYTA 1JEGA 2JM8A 1VQLA 4Z89A 3OYKA 1AHJB 2C0TA 1PM3A 3CCRA 2M0OA 1VUBA 2PVOB 3RMSA 1X43A 1YJ9Q 4IKFA 3QPHA 4GY5A 1MMAA 3LGLA 3DLLA 2XU8A 4XQ3A 4NL2A 1K9MR 1YI2A 2JS2A 2DRKA 3A8HB 3CC2Q 5GAN2 2JOYA 2J06A 1G2BA 4QW2A 2KYMA 4AFQC 4RCBA 3DB3A 3HP9A 4AG1C 1WHJA 3LX7A 4Z8AA 3I9QA 1QKXA 5IHNA 3C0CA 5GAN6 3CCSQ 4C92C 1Q82C 1M90R 1M1FA 4M7AG 2BIVA 3ASKA 1M1KU 2DBMA 3EGXA 1NYGA 1SPKA 3RKWA 5D6XA 4HCBA 1M9SA 3M0TA 1QW1A 2F2XA 2RI2A 4ZN1A 1VQ9T 4LDVA 3P8DA 1I8FA 3R6OA 2IPOB 2QDYB 4F04B 2YXYA 1IXDA 1VQPQ 2CZ0B 3L2QA 1Z9ZA 1WJSA 2OX7A 1FX7A 1CKBA 3CBMA 3VRYA 1WHKA 2OTJT 1QCFA 1BI2A 4C5EA 4E7JA 2K3BA 2F2WA 3SWNA 4MMLA 1Y7XA 3PMIA 1R0BG 2L3QA 2DERA 4RG8A 5LJ3e 2EGCA 4LE9A 2RN8A 1M8MA 4M75C 4F7UF 2QEXQ 5GAOn 3OYDA 2X9HA 2GFAA 5GMKm 3FDRA 5CVIA 2VGMA 1VQ9A 1GXIE 4HA8A 2QK0A 4GBQA 4M77F 1JXMA 1Y96A 1QVGS 2M0YA 2SRCA 4OMLA 3MEAA 2EIFA 5IHIA 4C0DC 3G4SQ 1QWFA 1EX4A 1D3BA 5L23A 1UGPB 3G6ET 2OTJA 2D9TA 3QZ5B 1H8KA 4R0KA 5GMKh 2X4YA 5FU6B 2HZYA 2EGAA 3EHRA 4FU6A 4F17A 3C95A 2ZAEA 1U1TA 3JCMP 1K8AU 2C0OA 2CYZB 3QG1A 3QKJA 1AVZC 2RO0A 4LNPA 1VYTA 1LOJA 1RAIB 2DL7A 3PT9A 2M1HA 4QQ6A 5IHKA 2KT1A 1WA7A 1YITQ 1D1CA 3G6EA 2K3XA 2LJ0A 4ORZA 1AWOA 2DF6A 1V29B 4PJLA 2XDBA 1B34B 3QSUA 4DOVA 3TQ7P 5GJVB 4EMKB 3CC7T 4E2FB 1OX9A 4PJOG 2EW3A 4J9IA 3VJPA 2CGHA 4LXCA 1K73U 2DYIA 2XD0A 4J9FA 4ATOA 2RNAA 1MGQA 1M2OA 2X35A 4HT8A 3MEUA 3TU4K 1Q95G 2RHYA 4Z02A 1NJIU 5FWCA 5A0LA 1BIBA 4QT7A 4KGVB 3X20B 2EQJA 5GANf 1PG5B 2DPPB 1G83A 4FW1A 3BE3A 3EG9B 1YJWQ 3CC7A 2RPNA 5KYYA 2PTKA 5LJ3d 2YRVA 2ZPHB 3A8OB 2O2OA 2H3EB 1M3BA 3M53A 2RQUA 3P8BB 3CMAT 2HMAA 1UGVA 2X3XD 2DZCA 2LT1A 1MUZA 1MV0B 1G3WA 2KVQG 1ZSZB 4II1A 1YHQT 1JJ2A 1T3SA 2D0NA 3V8LA 1BIAA 3RERA 3PIOA 1C1AA 4KGXB 2JTMA 4ME7A 3CCMQ 3BDLA 2LX7A 5HKCA 1LJOA 3HRSA 2CUBA 3M54A 1T3LA 1WLPB 1S72Q 2KRMA 2EFIA 3JB9J 5LJ3g 1UECA 4OB2B 1DJ7B 3CMAA 2DRMA 1WJRA 2AT1B 5FU6C 2DTHA 3OS0A 2DIQA 3NTIA 1YHQA 3GPLA 4PFZA 5I2MA 1VQ8T 2WSFE 5J26A 3VS2A 4XTZA 3QJYA 1V1CA 1O9SA 1W4SA 3UA7A 3OYMA 3X25B 4C8QB 1GFDA 3CC4Q 1IB8A 1X69A 2D8HA 4BD3A 2QGFB 2RK2A 4EMGA 4DA4A 4M7DG 1QQJA 4N0AC 4PL6A 4OB1B 1BKBA 4F7UA 5CO7A 2HBPA 1U8RA 2KDSA 5CKFA 4M7AA 1GCQC 2KI7A 3X24B 2BTTA 2H8HA 4XK8E 1VQ8A 1N27A 2EYYA 3FIFA 5KYXB 5GAOl 3BW1A 4FT2A 1HJDA 5GAMe 1R77A 1TUCA 1UTIA 3A1PA 2ROLA 3PVLA 3KFVA 3VS1A 1K0SA 4MDXA 2NYSA 2RJCA 5L8RE 4E7ZA 1Q7YU 4HVWA 1W70A 1HYOA 4KUIA 4J9EA 5I2SA 4FW2A 4NOYA 3OSSC 3EG2A 1WI7A 3VS0A 1PD1A 2FG0A 3I55Q 4OP0A 1T0HA 3CMEQ 3QDRB 4V2SA 1IREB 1HK9A 2X3WD 2I0NA 2L3RA 4JUVA 1SF9A 4BE2A 1Q86C 2JNGA 1JJ2P 3QJ6A 1ZSZC 3RR6A 3JB9G 4HT9A 1SEMA 1XOVA 3GLXA 2P0PA 3D7SB 3OYJA 2QQ9A 5CKHA 1ZHIA 2CZ7B 5ECAA 4C92D 4ZTJA 3ME9A 3E2UA 2JMAA 2V1RA 3I56T 2QTVA 1RAHB 2K9GA 2ED0A 3CCUT 1YIJT 2E3HA 3CCVQ 1EIFA 1QP3A 2E3IA 2DL8A 4IUTA 2KR3A 2KQWA 2RM4A 2CH4W 2CSIA 1X75C 5CK9A 5FROA 4C8QC 1KQSA 3PE0A 1ZBJA 4XTYA 3VS3A 2DMOA 3CCJQ 3OYGA 2F1LA 1M2VA 2R5AA 4AFZC 1M1KC 2GF7A 1D0YA 5FRMA 4PJOA 1I1JA 2A28A 1BYMA 3CCQT 1VQNT 4KULA 3META 4M75D 3JCMe 4C5IA 3CCUA 1YIJA 2J6FA 2HNIA 4DQ2A 5GAMd 1SKUB 4C8QE 3FLGA 2E4HA 1VYVA 2D1XA 1B7TA 5IXBA 4J9CA 3I5SA 2YUQA 4J6YA 2ROTA 1ZA1B 3O8VA 1QCOA 1VQ4T 1M30A 2MCNA 1WXTA 5FU7B 2O4XB 1OQKA 1JO8A 4E7SA 1N8RU 4M78D 2RF0A 1PCXA 1D09B 3CCQA 1VQNA 2Y4XA 4BI8B 1OX8A 1PRMC 1VA7A 3ZFJA 2OTLQ 1PKTA 3V7SA 1KC8U 1OOTA 5GAMg 2BE9B 4EDUA 1G8XA 4JPBW 3AHUA 2FHDA 3EFSA 4M4ZA 1VQ5T 2LJ3A 2NUPA 1VQ4A 2EJ9A 1SG5A 1NEGA 1AZEA 1FMKA 4OMFB 4RTZA 2L5QA 4C92B 1TS9A 4MZMA 3MCAB 2CREA 2ENMA 2MWOA 3RMQA 2FZGB 3MO8A 5D6WA 1LNXA 2ATCB 1QVFA 1K8AC 4BE0A 1BI1A 4F14A 2KNBB 3M56A 3CD6T 1Q86R 1VQMT 1VQKQ 2H3JA 3JCMX 4HVVA 1RAAB 5C6SA 1OPLA 1VQ5A 4PNOA 4LDWA 1WX6A 2NUTA 2EYXA 1P92A 3CQTA 2EYQA 2LP5A 1Y07A 2M9UA 2QXFA 3EFRA 4M7DA 4M75B 3OMCA 3S6WA 1YCYA 4AT1B 1BK2A 3MP6A 1KQSP 4QVCA 1K73C 1KHIA 4J83A 3CD6A 3JCMd 1VQMA 1NPPA 1QLYA 3JSCA 1N5ZA 1NJIC 1OU8A 4M78B 3Q1JA 1BI3A 2CSQA 1M1KR 3LYIA 5CIUA 2M51A 4Y91A 3I56Q 1JRIA 4R55A 1SSHA 3E1SA 2RQRA 1BI0A 1W2BA 3ZL7C 1K4US 5FU7C 2OI3A 2SEMA 2E64A 2KAFA 2XICA 3H0IA 4J7FA 2LC4A 1WIEA 3JCMg 1PNJA 2YUOA 4XTXA 1HD3A 3I5RA 2E10A 1YWPA 4CC3A 3UWNA 4LDUA 3QYGB 2DILA 2P84A 3MKDA 4Y92A 2VKNA 4BY6C 5HCKA 2PZ1A 1RI0A 3WVDB 5FRNA 3AT1B 3EAEA 2B8AA 2P0KA 5GAOq 1U5SA 2MPXC 4F7UG 4IUUA 3OY9A 3M0RA 2YSQA 5DY9A 2GBQA 2O31A 1SHGA 2DVEA 4ZGJB 2E70A 4HCCA 2CP3A 2JTFA 4M77G 1QVFP 2MMPA 2QQAA 2HL5C 4A54A 1KD1U 4KH1B 5FW9A 1WXUA 1JQQA 3EGXB 4J6WA 2KK4A 3U23A 2W10A 1AD5A 3MHXA 3QDFA 1XTDA 1YJNQ 1VQ7Q 2Z0WA 2KMTA 4C92E 8AT1B 1K8AR 2O9SA 4HXJA 5CKBA 2A36A 1JJ2S 4JLIA 2CDTA 2J05A 4JRKA 2GNCA 3CBPA 3M9QA 4E7IA 1TH7A 1YBYA 4LD6A 1K9MU 3URGA 4PK4A 1VQOT 5HY6A 4LUDA 3SWNB 2COYA 2FL7A 2PUOB 1M8VA 1MNDA 3LH5A 3GNFB 4OMMA 3RBBB 4KBMB 1WGSA 2DX1A 4IUPA 4X34A 5GAMf 1X01A 3VRZA 3JCMV 1K73R 2MK5A 1Y96B 1BCMA 4M78C 4M75E 1C6VX 2GTJA 1TWBA 3EH2A 2B86A 2KEAA 5GAN7 4E7LA 5GAN3 3GOXA 1ARKA 2A08A 1VQOA 1W2BP 3OQ5A 2VWFA 2K5LA 3CBOA 1G3YA 4KRTA 2QA4T 3OYCA 4X9DA 1UGRB 1B3QA 4M78E 1PC0A 2K2MA 2DYBA 3JCMW 3A8LB 1VQLQ 2DO3A 4NS5A 2QQBA 1D0XA 3MP8A 3EGDB 3JCMQ 5DLQE 2VGNA 1OI1A 3G1JA 3CCRQ 3VU3C 2BKDN 4JJNK 3SD4A 1QWEA 1XQHA 1RL2A 1YI2Q 2X4WA 4C8QD 3GNGA 5GAMh 3J81E 3LH0A 2VC8A 5CQYA 4ESRA 1WZOA 1X6BA 4PKCC 3G71T 4RCCA 2QA4A 4E47A 4EPCA 2WSEE 2HEQA 2XKOC 2CP5A 2HSEB 3UPUA 1NLPC 5GAOr 2LNHB 1K1ZA 3QHSA 2K6DA 2RQVA 4OB0B 4OGCA 1D1AA 1OZ2A 3VV0A 3V8JA 4M7AD 2WACA 1Q82R 2EQUA 2CZ1B 2HSPA 1MHNA 3M0PA 3NFCA 5EG2A 1OULA 2K2VA 1UEBA 4KT0E 3G71A 3UF4A 2E41A 1UG1A 1Y0MA 2JN0A 1TU0B 2RJFA 3I55A 4OMQA 1VIEA 2DZ9A 3M57A 5KYYB 3CEYA 1XJWB 4GLMA 1YNZA 2CUDA 2FRWA 3RIRA 2YHTA 2YLBA 3JCMf 1TSFA 3NMZC 4GLKA 1PSEA 3H9NA 3SWNC 1TUGB 2P4TA 4OVAA 3JAME 1KQ1A 4L6V5 3EGUA 2CT4A 2RHXA 3LW5E 3VS7A 1N8RC 2VB6A 2DD5A 2ZZDA 2BE7D 1E7OA 1QMCA 2HQEA 5AT1B 3EG3A 4C92G 3VYHB 4DBFA 1VQ9Q 2RI3A 2OAUA 2LT4A 1K76A 1PRLC 3N5BB 1KQSS 1K9AA 1KC8C 2K3YA 2QYZA 3QWYA 4FYWB 4IIMA 3L1AA 2OJ2A 2OTJQ 1RI9A 2DBKA 3M4YA 2CP0A 3S3OA 1Q81U 2V1QA 1H641 2JS0A 4FSXA 3JCMh 2ZPEB 4CC2A 3LWIA 2GFUA 2PNIA 4Q5WA 4PFPA 1R8OB 4UC4A 4X1VA 1QVPA 1H3ZA 3EFOA 4ELZC 1W6XA 2COWA 4A4KA 2CS7A 2GTOA 4C92F 2FO0A 2K57A 4M77A 2HQXA 2XMFA 4M7AB 3G6EQ 1RADB 1WQWA 4IIOA 4KH0B 5CCAA 1SRMA 3BDUA 2CP2A 1TG0A 1ZUYA 1WYXA 5C0MA 1KSWA 5A0DA 5KYXA 3VS5A 4FSSA 3THKA 2GQVA 4N4GA 4PJOD 3RKXA 2RB6A 2HBWA 3ZBDA 4JZ4A 1KG1A 3HKSA 2EVRA 2ZPIB 2AHJB 4XU0A 6AT1B 3A98A 5LJ5j 5GAN8 5IT9E 2OTLA 2QASA 2VV5A 1RLQC 3L2WA 4PFOA 4M75F 1VQ6T 5KYWB 1YFNA 1GL5A 4WTOB 2D8JA 3OYEA 3HL8A 1YCSB 4J9HA 3J80E 3HRTA 4JJBA 2FZKB 3CC7Q 3OYFA 1NZ9A 3DLMA 4XTWA 1R0CB 1Y57A 2JVVA 3J7AF 2MYSA 3TSZA 4JDSA 4E7KA 4PJNA 3X28B 1Y71A 1ABOA 4X9CA 2IG0A 1WXBA 2CKKA 4HKEA 3REBB 4MMKA 1WHGA 3CCLT 2AKKA 4DEXA 4HCKA 2JXBA 3OBYA 2QQSA 1VQ6A 3RNJA 1BB9A 1UGQB 2EQMA 1XNIA 1N8RR 1MMGA 2DXTA 3GBQA 2AIRB 3HFOA 3CCET 4J5YA 1Z9QA 2VASA 1RAFB 1MMDA 1ZX6A 2I2LA 3OYAA 2HD0A 2E65A 1MNEA 1FMWA 2P4RA 3OSVA 4RTYA 3CMAQ 5CR2A 3RKYA 3CCLA 5GJWB 2E6NA 4JS4A 1YHQQ 1KC8R 5EC7A 2XG8D 2F5TX 1YJ9T 5HK3A 2R57A 3UATA 1FYNA 3KXTA 1M2VB 1KD1C 3CC2T 4XAXB 4OB3B 1W2BS 3OYYA 4PJOB 4A4HA 2QG9B 3CCEA 1MV3A 4M7DD 2DEQA 1X6GA 2F5KA 1A0NB 2YRDA 4M7AC 1KIKA 1T0JA 5A0GA 3OS2A 1UJYA 2J6OA 3CPFA 1VQ8Q 3CCST 1YJ9A 3LLRA 4N4HA 3C4SA 4A4GA 5GAOm 3CC2A 4A53A 2KE9A 4M7AE 5GMKj 2HKNA 4BY6B 2LQWA 5KYUA 2D0QB 1G3TA 2L89A 5GAOp 3OA6A 1VQPT 3M55A 2EBPA 3SB2A 5CQXA 3CPWA 2NUPB 5I21A 3CCSA 1K0XA 2QI2A 2RI5A 2LMJA 1OYXA 4C92A 3ER0A 3VYGA 2QEXT 1VIFA 3ULRB 2DL4A 3ZEHA 2YT6A 4XU3A 4L59A 3DKMA 2Y90A 3JB9D 3QXEB 3L2RA 3IQLA 5FWBA 1OV3A 3OMGA 4J9BA 3INZA 3MJXA 5KCHA 1VQPA 3G4ST 1J3TA 2V26A 2NUTB 5KE2A 5GMKi 2JMCA 1GCPA 2QTXA 3GIBA 3PVQA 4LDYA 2DD4A 4XU1A 1IZ6A 4O5VA 2CP6A 2QEXA 1C0MA 2LVMA 2R58A 5GMKl 3PTAA 1ZA2B 1FXXA 4M7DB 2DA9A 1AWWA 2LTOA 1G5VA 1LVKA 3PMTA 2WSCE 2AZVA 2RHIA 4J6XA 3BY7A 2M16A 2EQIA 3NGPA 1ZUUA 2NWMA 2DJZA 2FPFA 3G4SA 3JRZA 4ZGEB 4PJOC 2A7YA 4Y28E 2PQWA 2PVDB 1IHVA 2E6ZA 3A5ZB 3MPUB 4AFUC 4CC4B 1UHFA 2DL5A 2XDPA 5I11A 3FJ5A 1KD1R 4C0GA 1KK7A 3FB9A 3CCUQ 1YIJQ 3QBYA 4J7IA 1B07A 1SRLA 2IVWA 4KGZB 2YDLA 4NL3A 1HSQA 3KUFA 4FYVB 1ZUKA 1H92A 4PJOE 1I07A 1BBZA 2VUBA 3QZ9B 5GANj 1N6AA 1NEBA 2EWNA 3OYHA 2EKOA 2RHZA 1JXOA 5M9OA 1YITA 4VUBA 2KT8A 2A37A 2DL3A 1AOJA 2MIOA 2ZPFB 3FC3A 1OZ3A 4B9WA 3CCQQ 3M5AA 1VQNQ 4C8QG 3OYIA 3GP8A 1YJWT 2DXBA 3TREA 2E5QA 1NPRA 1NG2A 1NM7A 3M0SA 4C0ZA 3CPWP 5A2QE 4RTXA 1M3CA 2KXDA 2MI6A 1WNLA 2DXUA 1VQ4Q 8ATCB 2W0ZA 4YTLA 4OF1A 3JB9H 1ACMB 2EGEA 2O9VA 2DE0X 2MOXA 4FL6A 1Q81C 1PKSA 1RLPC 3JB9I 2E12A 2MF2A 3VS6A 2V8IA 4K11A 4JRQA 3LWHA 1U1SA 3CCMT 1ABQA 2D6FA 1YJWA 3PFSA 2RH2A 4XTUA 3TEEA 1WJQA 4JLGA 1TXQA 1PHTA 2JW4A 1S72T 3QUIA 1QCNA 4C8QF 5KCOA 4XU2A 1YP5A 2V8KA 1VQ5Q 1UB4A 2EKHA 1LCKA 4OGEA 4BE1A 2HCKA 1F1BB 2ZCFB 3MEWA 1X2QA 2F2VA 2FRYA 4M7DC 4JJDA 1OPKA 1QKWA 2ZGWA 5KE3A 3PIPA 3X26B 4E6RA 1O75A 1JU5C 3CC4T 3OS5A 3CCMA 4BI3A 4C5HA 1Q7YC 1AT1B 1ZSGA 3L2ZA 4J9DA 2EQKA 3OBWA 4E7HA 1WPYA 2DAQA 3CD6Q 3OB9A 1S72A 4M7AF 3R6NA 2K79A 1VQMQ 4BB7A 2RK1A 5IXFA 4ANJA 2X4JA 4J8OA 1M90U 1D3BB 1UE9A 9ATCB 4M7DE 4O6JA 2DXCA 1IGUA 5IH2A 1NJIR 2MAMA 3HTRA 3UT1A 1PSFA 3OYLA 3SDZA 3T9NA 3CXCA 3SEMA 4DBQA 1UUEA 3EG1A 1SSFA 2O88A 2RHUA 2A3LA 1ZQ1A 2YLCA 3CC4A 2AKLA 2E1HA 2LCSA 1CSKA 4DBHA 1ZLMA 1S1NA 1JBMA 4R56A 2K4YA 2X51A 2C06A 1UFFA 3OW2A 2L0AA 2DNUA 3F70A 5LJ5e 2DJQA 3EGDA 4MZTA 4N0AA 2XK0A 3JCMb 1AWJA 1KJWA 4MZPA 1IO6A 1NYFA 4CC7A 2LNVA 4PJMA 1AEYA 4BACA 1B34A 1GCQA 3M0UA 4HVUA 4KUDK 1UJ0A 4BI4A 4EMKA 7AT1B 2FPEA 3I55T 2JTEA 3GF5A 3KBGA 1IHWA 3CMET 4QVZA 3M0QA 2R5MA 2JJ9A 1KHCA 3H8ZA 4CRIA 2COZA 2NUZA 5KYNA 2FYKA 4ZGDB 4FM4B 1N9SA 4WCIA 3VUBA 4LD9K 3EHQA 1ZBXA 2YUNA 2YRCA 2FZCB 1BCOA 4HCZA 2HKQB 2DETA 1WHLA 1WQ7A 4M77D 1VYUA 4RTVA 2MWPA 4PJJA 4A4EA 4IURA 2DVJA 4B9XA 3EG9A 1Q81R 2Y4YA 1WFWA 3C12A 2L3PA 1QP2A 3CMEA 4JJCA 2JM9A 2KSSA 3CCVT 1M1GA 2IIMA 4J9GA 2C0IA 3WXMB 1E6HA 4QQGA 4RTUA 2GGRA 5I22A 2XHCA 1KQ2A 4LUEA 1ZSZA 5J39A 2CT3A 1I5OB 3JCMJ 5D7UA 4JRIA 4PJOF 3OS1A 3CCJT 3TCJA 1YN8A 2JZ2A 2DM1A 4AMCA 2V8JA 4A4FA 5DM7R 4BDZA 3UA6A 4FYYB 2LDMA 5LL6S 1M3AA 4JS5A 5DLOA 3CCVA 1I0CA 2ECZA 1Q7YR 2EJGA 3FRNA 3CXCP 3UDCA 1U3OA 2P0QA 4QKUA 1WHHA 4IUQA 2HQHA 5GANh
chains in the Genus database with same CATH topology
3CCLA 2E6NA 4JS4A 1QVGA 1D3BA 2XG8D 1UGPB 2F5TX 1Q82U 3G6ET 5HK3A 3JSCA 2R57A 3V7CA 1YJ9T 1NJIC 4N4IA 3OYBA 2D9TA 2OTJA 5LJ5d 3KXTA 5CKDA 3CCJA 3QZ5B 1N9RA 3HRUA 4M78B 2LQ8A 3Q1JA 4C8QA 5GMKh 2X4YA 1KD1C 5FU6B 4FU6A 1BI3A 5LJ3j 3CC2T 4XAXB 3LYIA 5CIUA 4OB3B 3C95A 5GMKe 3OYYA 1W2BS 4Y91A 4PJOB 4A4HA 1U1TA 3CCEA 3JCMP 1K8AU 1JRIA 2CYZB 4R55A 3E1SA 3QG1A 3VKIA 3QKJA 4M75G 3HFNA 3VUZA 4M7DD 2DEQA 1BI0A 2F5KA 3OYNA 2FB7A 2X4XA 1W2BA 4F7UB 4M7AC 2RO0A 5FU7C 2OTLT 2RA2A 1LOJA 2E64A 2KAFA 2XICA 5A0GA 4J7FA 3OS2A 2LC4A 3MEVA 3PT9A 3JCMg 2M1HA 4QQ6A 5FLXE 4XTXA 3M59A 4M77B 3CPFA 2E10A 3CCST 3G6EA 1YJ9A 2K3XA 3LLRA 4N4HA 2NLUA 1I4K1 2VXFA 1V29B 3UWNA 3RESA 4LDUA 3C4SA 2XDBA 4A4GA 2LQKA 1B34B 3QYGB 4M78G 4EMKC 2F69A 5GAOm 5D6YA 5LJ5g 3QSUA 3CC2A 4A53A 4DOVA 3LGFA 2K5FA 3CC7T 4EMKB 4BY6C 4M7AE 5GMKj 1RI0A 4PJOG 3JCMc 3WVDB 3VJPA 4BUGA 2CGHA 4BY6B 5FRNA 3EAEA 2B8AA 2P0KA 5GAOq 1HXDA 1K73U 2D0QB 1G3TA 2GCXA 2XD0A 4LDXA 2L89A 4ATOA 3L42A 4F7UG 4IUUA 1MGQA 5GAOp 3NTHA 2L8DA 3PNWC 3OY9A 2X35A 4HT8A 5DY9A 3MEUA 4WF2A 2O01E 3TU4K 3RUXA 3CPWS 2DVEA 3OA6A 1VQKT 4ZGJB 3M55A 5J3BA 1VQPT 2E70A 5CQXA 3SB2A 2RHYA 4HCCA 2JTFA 4Z02A 1NJIU 1QVFS 3CPWA 5A0LA 1BIBA 3X20B 4M77G 5I21A 3CCSA 2QI2A 2MMPA 2QQAA 4A54A 2RI5A 4RKUE 2EQJA 5GANf 1KD1U 4M7DF 1OYXA 2DPPB 2LRQA 4C92A 3ER0A 4J6WA 3VYGA 2KK4A 2QEXT 1VIFA 3MHXA 3ZEHA 3CC7A 1XTDA 4XU3A 4L59A 2KMTA 4C92E 5LJ3d 2YRVA 2ZPHB 2Y90A 3A8OB 3DKMA 3QXEB 3JB9D 2HAXA 3WVEB 4M78F 3L2RA 3QYHB 3OMGA 5CKBA 2FVUA 3QO3A 3M53A 1JJ2S 4JLIA 3P8BB 3CMAT 4P5NA 3INZA 2DK3A 1VQKA 2DZCA 2LT1A 2XDDA 5KCHA 1VQPA 3G4ST 1FWZA 2DKGA 4JRKA 1G3WA 2DIGA 2KVQG 4II1A 3CBPA 3M9QA 1YHQT 1JJ2A 2EJFA 4E7IA 3SFMA 1TH7A 1YBYA 2BUDA 4LD6A 5KE2A 5GMKi 1K9MU 3URGA 3V8LA 4ELYC 1BIAA 2LCLA 1VQOT 2QTXA 3GIBA 4LDYA 2RJDA 5HY6A 3RERA 3SWNB 2DD4A 4XU1A 3PIOA 3E9GA 3L2UA 1IZ6A 2JTMA 3FJPA 2FL7A 2PUOB 3BDLA 4ME7A 4O5VA 1M8VA 5CAIA 2QEXA 2LVMA 5HK0A 5HKCA 1LJOA 2R58A 3PGGA 3G7ZA 5GMKl 2LCCA 3HRSA 3PTAA 4BDYA 3GNFB 1FXXA 3M54A 4M7DB 4KBMB 1WGSA 2LTOA 4IUPA 4X34A 5GAMf 3HSBA 1G5VA 1X01A 2EFIA 4RMOA 3PMTA 2WSCE 4J6XA 2RHIA 4MDWA 3JCMV 3BY7A 2M16A 5LJ3g 3JB9J 4OB2B 3HPWA 5IAYA 1DJ7B 1Y96B 4M78C 4M75E 3CMAA 2XIDA 2DJZA 1WJRA 2ZPGB 3HHTB 5GANe 5FU6C 3G4SA 2DTHA 3A8GB 3JRZA 3OS0A 2DIQA 4ZGEB 3NTIA 1YHQA 3GPLA 3E19A 3E9FA 4PJOC 2A7YA 4Y28E 2PQWA 2PVDB 2WSFE 5I2MA 2E6ZA 5J26A 3A5ZB 5GAN7 5GAN3 4E7LA 3GOXA 4XTZA 3QJYA 1VQOA 1I5LA 1O9SA 1W4SA 3OYMA 2XDPA 3OQ5A 3JB9F 2K5LA 3X25B 3CBOA 4C8QB 1G3YA 2QA4T 4BD3A 4C0GA 3OYCA 4L5GA 3FB9A 4X9DA 2RK2A 3C94A 3NTKA 3QBYA 4J7IA 4EMGA 3I56A 4DA4A 1UGRB 4M78E 2IVWA 4M7DG 4N0AC 4M77C 3A8LB 3JCMW 2DO3A 4NS5A 1X6OA 2QQBA 4OB1B 4PL6A 3MP8A 3KUFA 1BKBA 4F7UA 2KY9A 4NL3A 3JCMQ 5CO7A 5DLQE 4PJOE 2VGNA 1OI1A 2HBPA 1U8RA 2G3RA 2KDSA 2VUBA 5CKFA 3QZ9B 4C5GA 4M7AA 3VU3C 2BKDN 5GANj 1N6AA 4JJNK 3SD4A 2O4XA 1XQHA 1K9MC 2PU9B 3X24B 1RL2A 2EWNA 5IN1A 3OYHA 4F7UE 4XK8E 2EKOA 2RHZA 2X4WA 5AYFA 4C8QD 5M9OA 3GNGA 1YITA 1VQ8A 5GAMh 4VUBA 1N27A 3J81E 3LH0A 2VC8A 3FIFA 4PLIA 5CQYA 3S3MA 5GAOl 2ZPFB 3BW1A 4FT2A 3FC3A 1OZ3A 4B9WA 5GAMe 3M5AA 4PKCC 3G71T 4C8QG 3OYIA 3MP1A 4RCCA 4M77E 4TVRA 4E47A 4EPCA 3GP8A 2QA4A 1YJWT 2WSEE 2DXBA 3TREA 1YJNT 2E5QA 1NPRA 2LX9A 1VQ7T 3V7RA 4MDXA 4ZN3A 2XKOC 2RJCA 5L8RE 2VXEA 3UPUA 1Q7YU 4C0ZA 5GAOr 2DTIA 2ZPBB 4FIBA 5LJ3f 3QHSA 4KUIA 4OB0B 4OGCA 5A2QE 1OZ2A 3QIIA 1G3SA 1M90C 5I2SA 4NOYA 1I81A 2MI6A 1WNLA 2DXUA 3M58A 3V8JA 3VV0A 3OSSC 4M7AD 2WACA 4YTLA 2EQUA 4OF1A 4EMHA 2CZ1B 3JB9H 2PVGB 4FL6A 1MHNA 5KH6A 1Q81C 1VQ8T 3NFCA 5EG2A 3JB9I 2E12A 2MF2A 2V8IA 4ZTFA 2K2VA 4OP0A 3L2VA 4JRQA 5GAMj 1UEBA 3QDRB 4KT0E 1U1SA 3LWHA 3CCMT 3G71A 4V2SA 1IREB 3DB4A 1HK9A 2E41A 2DTOA 2D6FA 1YJWA 2JUFA 2RH2A 2JN0A 3PFSA 2RD1A 1YJNA 2RJFA 3I55A 4XTUA 3TEEA 1VQ7A 2L3RA 1VIEA 1WJQA 2DZ9A 4JLGA 4JUVA 3BFMA 2CZ6B 2JNGA 3M57A 4PLLA 3QJ6A 3CEYA 1S72T 3JB9G 3QUIA 4HT9A 1Q86C 2RJEA 3JCMf 3RIRA 2YHTA 2YLBA 4C8QF 4D6WA 1XOVA 4DOWA 4XU2A 5KCOA 1VQNT 4QQDA 2V8KA 3GLXA 2P0PA 1UB4A 4GLKA 1PSEA 3OYJA 2QQ9A 5CKHA 3SWNC 4OGEA 2P4TA 4OVAA 3JAME 4BE1A 4IUVA 1ZHIA 2K5IA 2CZ7B 2ZCFB 3MEWA 1KQ1A 3FEOA 4L6V5 5LJ5f 4RG2A 4C92D 4FT4A 4XTVA 2RHXA 3LW5E 4ZTJA 3ME9A 1N8RC 5GANd 4M7DC 2ZGWA 2DD5A 5KE3A 1UGSB 2ZZDA 3PIPA 5LJ3h 3X26B 3I56T 1O75A 5GAN4 4M75A 2HQEA 3CC4T 3OS5A 3CCMA 4BI3A 4C92G 4C5HA 3VYHB 3P8HA 1Q7YC 3CCUT 1YIJT 3L2ZA 2RI3A 2XI9A 2EQKA 2OAUA 3OBWA 1WPYA 1EIFA 4E7HA 2PUKB 2LT4A 2DAQA 3S3NA 3OB9A 3N5BB 1S72A 1QP3A 4M7AF 4BB7A 2RK1A 4IUTA 1VQLT 1KQSS 1KC8C 2K3YA 2KQWA 2RM4A 2X4JA 1X75C 4J8OA 1M90U 3CXCS 5CK9A 1D3BB 3CCRT 1YITT 5GAN5 3L1AA 5FROA 4M7DE 2QQRA 4O6JA 4C8QC 2DXCA 1KQSA 4XTYA 2MAMA 1JB0E 3UT1A 1PSFA 3M4YA 3H6ZA 4M78A 3SDZA 3T9NA 3OYLA 1M4ZA 3OYGA 3CXCA 3S3OA 1Q81U 2R5AA 1H641 1M1KC 4C0DB 2GF7A 1NE8A 4FSXA 4CI0C 1SSFA 3JCMh 2ZPEB 5FRMA 4PJOA 1BYMA 3CCQT 2RHUA 3LWIA 2A3LA 1ZQ1A 5GANg 2YLCA 4KULA 2GFUA 3META 3CC4A 4Q5WA 4M75D 1R8OB 2E1HA 3JCMe 3OW2S 3A8MB 4C5IA 4UC4A 4JRPA 3M4GA 4C0FA 4QVDA 5CKEA 3CCUA 1QVPA 1JBMA 1YIJA 1Q86U 2HNIA 1M5Q1 4DQ2A 4R56A 3V8KA 2K4YA 4ELZC 2EAYA 2C06A 5GAMd 5LJ5h 2VYTA 3OW2A 4C8QE 3FLGA 3F70A 1VQLA 4A4KA 3OYKA 2CS7A 5LJ5e 4C92F 1AHJB 4MZTA 2K57A 4N0AA 2XK0A 3CCRA 4M77A 4J6YA 3JCMb 2M0OA 1VUBA 3O8VA 2PVOB 2HQXA 4MZPA 1VQ4T 4M7AB 3RMSA 4IKFA 1WQWA 3QPHA 4GY5A 3LGLA 5FU7B 3DLLA 2O4XB 2LNVA 2XU8A 4XQ3A 4NL2A 4BACA 1YI2A 1N8RU 1B34A 4M78D 5CCAA 4KUDK 3A8HB 3BDUA 4BI4A 5GAN2 4EMKA 5C0MA 3I55T 5A0DA 3GF5A 3KBGA 2GQVA 2JOYA 4N4GA 3CMET 4QVZA 3RKXA 3CCQA 2R5MA 2RB6A 1VQNA 4PJOD 1KHCA 3H8ZA 3ZBDA 4CRIA 1KG1A 2Y4XA 4BI8B 4QW2A 3HKSA 2FYKA 2ZPIB 2AHJB 4ZGDB 4FM4B 1N9SA 3ZFJA 3VUBA 4XU0A 4LD9K 4BE2A 3V7SA 1KC8U 1ZBXA 4RCBA 3DB3A 3HP9A 5GAMg 4EDUA 4HCZA 5LJ5j 3LX7A 3AHUA 5GAN8 2FHDA 3EFSA 5IT9E 1VQ5T 2OTLA 5GAN6 1WQ7A 2VV5A 4M77D 1VQ4A 2EJ9A 4C92C 1Q82C 1M1FA 4M7AG 2MWPA 2BIVA 3ASKA 3L2WA 1M1KU 4M75F 4OMFB 4C92B 2L5QA 4IURA 3RKWA 4A4EA 1VQ6T 5D6XA 4B9XA 3OYEA 3HL8A 4MZMA 4HCBA 2Y4YA 3J80E 3HRTA 1M9SA 3C12A 3MCAB 2MWOA 1QW1A 3RMQA 3OYFA 1NZ9A 2RI2A 3DLMA 1QP2A 3CMEA 3MO8A 5D6WA 1LNXA 2KSSA 4XTWA 1QVFA 2JVVA 4ZN1A 1K8AC 1VQ9T 4LDVA 4BE0A 1BI1A 3CCVT 1M1GA 3J7AF 3P8DA 4JDSA 1I8FA 3M56A 3R6OA 4E7KA 3X28B 1Y71A 3CD6T 2QDYB 3WXMB 4QQGA 4X9CA 1VQMT 2IG0A 2H3JA 4HKEA 2CKKA 3JCMX 2XHCA 2CZ0B 1KQ2A 4MMKA 1YI2T 5C6SA 3L2QA 5J39A 1WJSA 3CCLT 4PNOA 1FX7A 4LDWA 1VQ5A 3CBMA 3JCMJ 1H3ZA 2OTJT 4JRIA 1BI2A 4PJOF 4C5EA 4E7JA 3OS1A 3CCJT 3OBYA 2QQSA 3SWNA 4MMLA 1P92A 1Y7XA 3PMIA 3TCJA 1VQ6A 2JZ2A 2EYQA 4RG8A 5LJ3e 1Y07A 1UGQB 2V8JA 4A4FA 5DM7R 4M75C 4F7UF 2EQMA 1XNIA 2M9UA 5GAOn 2QXFA 4BDZA 2DXTA 3HFOA 3OYDA 3CCET 3EFRA 4M7DA 4M75B 4J5YA 2GFAA 3OMCA 3S6WA 1YCYA 2LDMA 5LL6S 5GMKm 4JS5A 3FDRA 5CVIA 2VGMA 5DLOA 1VQ9A 3CCVA 1GXIE 4HA8A 3MP6A 2I2LA 3OYAA 4QVCA 1K73C 1KHIA 2HD0A 2EJGA 4J83A 3FRNA 4M77F 2E65A 3CD6A 1Y96A 3UDCA 1QVGS 3JCMd 1VQMA 3OSVA 1NPPA 2P0QA 5CR2A 3MEAA 2EIFA 4C0DC 4IUQA 3RKYA 5GANh
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL A;  2E6N A;  1QVG A;  1Q82 U;  3G6E T;  1YJ9 T;  2R57 A;  1NJI C;  4N4I A;  2OTJ A;  2D9T A;  3OYB A;  3CCJ A;  2LQ8 A;  3Q1J A;  2X4Y A;  1KD1 C;  4FU6 A;  3CC2 T;  3LYI A;  5CIU A;  1W2B S;  3OYY A;  4A4H A;  3CCE A;  1K8A U;  3QKJ A;  2F5K A;  3OYN A;  2X4X A;  1W2B A;  2RO0 A;  2OTL T;  3OS2 A;  3MEV A;  2M1H A;  4QQ6 A;  5FLX E;  3CPF A;  3CCS T;  3G6E A;  1YJ9 A;  2K3X A;  3LLR A;  4N4H A;  2NLU A;  3UWN A;  3C4S A;  4A4G A;  5D6Y A;  3CC2 A;  3LGF A;  3CC7 T;  1RI0 A;  5FRN A;  3EAE A;  2B8A A;  2P0K A;  1K73 U;  2L89 A;  3L42 A;  4IUU A;  3NTH A;  2L8D A;  3PNW C;  3OY9 A;  2X35 A;  3MEU A;  3CPW S;  1VQK T;  3OA6 A;  1VQP T;  5J3B A;  2E70 A;  2RHY A;  2JTF A;  4Z02 A;  1NJI U;  1QVF S;  3CPW A;  3CCS A;  2RI5 A;  1KD1 U;  2EQJ A;  1OYX A;  2LRQ A;  3ER0 A;  2QEX T;  3CC7 A;  3ZEH A;  1XTD A;  4L59 A;  2YRV A;  3L2R A;  3OMG A;  1JJ2 S;  3P8B B;  3CMA T;  1VQK A;  1VQP A;  5KCH A;  3G4S T;  2KVQ G;  2DIG A;  4II1 A;  1YHQ T;  1JJ2 A;  3M9Q A;  4E7I A;  1YBY A;  2BUD A;  1K9M U;  4LD6 A;  5KE2 A;  2LCL A;  1VQO T;  2RJD A;  5HY6 A;  3PIO A;  3E9G A;  3L2U A;  1IZ6 A;  3BDL A;  2QEX A;  2LVM A;  2R58 A;  2LCC A;  4BDY A;  1WGS A;  4X34 A;  2LTO A;  4IUP A;  1G5V A;  2EFI A;  3PMT A;  2RHI A;  2M16 A;  5IAY A;  3CMA A;  1WJR A;  3G4S A;  3OS0 A;  2DIQ A;  1YHQ A;  3NTI A;  3E9F A;  1VQ8 T;  2PQW A;  5J26 A;  4E7L A;  2E6Z A;  3A5Z B;  3GOX A;  1VQO A;  3OYM A;  2XDP A;  3OQ5 A;  2QA4 T;  4BD3 A;  3OYC A;  3NTK A;  3QBY A;  3I56 A;  2DO3 A;  4NS5 A;  1X6O A;  4PL6 A;  3MP8 A;  3KUF A;  1BKB A;  5DLQ E;  1OI1 A;  2G3R A;  2KDS A;  4C5G A;  2BKD N;  1K9M C;  3SD4 A;  2O4X A;  1RL2 A;  3OYH A;  5IN1 A;  2EKO A;  2RHZ A;  2X4W A;  5M9O A;  1YIT A;  1VQ8 A;  1N27 A;  3J81 E;  3LH0 A;  4PLI A;  3S3M A;  3FC3 A;  1OZ3 A;  4B9W A;  3G71 T;  3OYI A;  3MP1 A;  2QA4 A;  4TVR A;  1YJW T;  3TRE A;  1YJN T;  2E5Q A;  1NPR A;  1VQ7 T;  4ZN3 A;  2RJC A;  1Q7Y U;  5A2Q E;  1OZ2 A;  3QII A;  1M90 C;  2MI6 A;  4YTL A;  2WAC A;  2EQU A;  4FL6 A;  1MHN A;  1Q81 C;  5KH6 A;  4ZTF A;  3L2V A;  1UEB A;  3CCM T;  3G71 A;  3DB4 A;  1YJW A;  2JUF A;  3PFS A;  1YJN A;  3I55 A;  2RJF A;  1VQ7 A;  2L3R A;  1WJQ A;  1Q86 C;  4BE2 A;  4PLL A;  2JNG A;  3QJ6 A;  3CEY A;  1S72 T;  2RJE A;  5KCO A;  4QQD A;  3OYJ A;  4OVA A;  3JAM E;  4BE1 A;  4IUV A;  3MEW A;  3FEO A;  4RG2 A;  2RHX A;  4ZTJ A;  1N8R C;  3ME9 A;  5KE3 A;  3PIP A;  3I56 T;  2HQE A;  3CC4 T;  3CCM A;  4C5H A;  3P8H A;  1Q7Y C;  3CCU T;  1YIJ T;  2RI3 A;  2EQK A;  4E7H A;  1EIF A;  3S3N A;  2DAQ A;  3OB9 A;  1S72 A;  1VQL T;  4IUT A;  1KQS S;  1KC8 C;  2K3Y A;  1M90 U;  3CXC S;  3CCR T;  1YIT T;  5FRO A;  2QQR A;  1KQS A;  3UT1 A;  1YI2 T;  1Q81 U;  3CXC A;  3H6Z A;  3OYL A;  3OYG A;  3S3O A;  2R5A A;  1M1K C;  2GF7 A;  1SSF A;  5FRM A;  3CCQ T;  2RHU A;  1VQN T;  3CC4 A;  2GFU A;  3MET A;  3OW2 S;  4Q5W A;  4C5I A;  4UC4 A;  3CCU A;  1YIJ A;  1Q86 U;  1H3Z A;  3OW2 A;  2VYT A;  3FLG A;  3F70 A;  1VQL A;  3OYK A;  3CCR A;  2XK0 A;  2M0O A;  3O8V A;  2HQX A;  1VQ4 T;  4IKF A;  4GY5 A;  3LGL A;  3DLL A;  2O4X B;  4BAC A;  1YI2 A;  1N8R U;  3I55 T;  5C0M A;  3KBG A;  2JOY A;  4N4G A;  3CCQ A;  3CME T;  4QVZ A;  1VQN A;  2R5M A;  1KHC A;  3H8Z A;  4CRI A;  4QW2 A;  3HKS A;  1KC8 U;  3DB3 A;  4EDU A;  4HCZ A;  3LX7 A;  2FHD A;  5IT9 E;  1VQ5 T;  2OTL A;  1VQ4 A;  1Q82 C;  2MWP A;  2BIV A;  3ASK A;  1M1K U;  3L2W A;  1VQ6 T;  4IUR A;  4A4E A;  5D6X A;  4B9X A;  3OYE A;  3J80 E;  2MWO A;  3OYF A;  1NZ9 A;  2RI2 A;  3DLM A;  3CME A;  3MO8 A;  5D6W A;  1QVF A;  2JVV A;  4ZN1 A;  1K8A C;  1VQ9 T;  4BE0 A;  3CCV T;  1M1G A;  3J7A F;  3P8D A;  4E7K A;  3CD6 T;  4QQG A;  1VQM T;  2IG0 A;  2CKK A;  2XHC A;  5C6S A;  3L2Q A;  5J39 A;  1VQ5 A;  3CCL T;  1WJS A;  2OTJ T;  4C5E A;  4E7J A;  3OS1 A;  3CCJ T;  2QQS A;  1VQ6 A;  3PMI A;  2JZ2 A;  4A4F A;  5DM7 R;  2EQM A;  1XNI A;  4BDZ A;  3OYD A;  3CCE T;  2GFA A;  3OMC A;  3S6W A;  2LDM A;  5LL6 S;  1VQ9 A;  3FDR A;  3CCV A;  3MP6 A;  3OYA A;  1K73 C;  1KHI A;  3CD6 A;  1QVG S;  1VQM A;  1NPP A;  3MEA A;  2EIF A;  4IUQ A; 
#chains in the Genus database with same CATH topology
 1QVG A;  2CH4 A;  1Q82 U;  2DEU A;  3V7C A;  2EYW A;  4N4I A;  3OYB A;  1GBR A;  5LJ5 d;  4JZ3 A;  5CKD A;  3CCJ A;  1VQO Q;  1H3H A;  1N9R A;  1UHC A;  3HRU A;  2LQ8 A;  4C8Q A;  5LJ3 j;  1IGQ A;  4D8D A;  3OW2 P;  4F16 A;  3NPF A;  5GMK e;  3VKI A;  4M75 G;  3VUZ A;  3HFN A;  3H41 A;  3OYN A;  2FB7 A;  2RQW A;  2X4X A;  4F7U B;  3EFO B;  2OTL T;  2RA2 A;  1RUW A;  3MEV A;  5FLX E;  3M59 A;  4M77 B;  2NLU A;  1I4K 1;  2VXF A;  3I35 A;  3RES A;  4RTT A;  2LQK A;  4M78 G;  4EMK C;  2F69 A;  1NBE B;  5D6Y A;  5LJ5 g;  2QA4 Q;  3LGF A;  2K5F A;  2A0F B;  1RAC B;  3JCM c;  4BUG A;  2BZY A;  1HXD A;  1EZZ B;  2GCX A;  1KFZ A;  4LDX A;  3L42 A;  2BZX A;  3NTH A;  2L8D A;  3PNW C;  2AZS A;  2O01 E;  4WF2 A;  3RUX A;  3CPW S;  1VQK T;  4DEY A;  5J3B A;  4AG2 C;  1QVF S;  2KGT A;  3RDV A;  4RKU E;  4M7D F;  2LRQ A;  4DBR A;  5KYW A;  3G71 Q;  2M02 A;  1WDX A;  2RMO A;  3VS4 A;  1U06 A;  4FCY A;  1GRI A;  3QWX X;  2HAX A;  3WVE B;  4M78 F;  3QYH B;  2K7A A;  2FVU A;  3QO3 A;  1PWT A;  2EPD A;  4P5N A;  4LN2 A;  2DK3 A;  1VQK A;  2KRS A;  2XDD A;  1M27 C;  1FWZ A;  2DKG A;  2DIG A;  2EJF A;  3SFM A;  2BUD A;  1SHF A;  2YUP A;  4ELY C;  2LCL A;  2RJD A;  3E9G A;  3L2U A;  3FJP A;  3O5Z A;  5CAI A;  5HK0 A;  3PGG A;  3G7Z A;  2LCC A;  1V76 A;  4BDY A;  2E5K A;  1QVG P;  1NLO C;  3HSB A;  4RMO A;  2ED1 A;  4MDW A;  3SHW A;  3HPW A;  4ZNX A;  5IAY A;  4FYX B;  2L3S A;  2XID A;  2ZPG B;  3HHT B;  5GAN e;  3A8G B;  1IRX A;  2L2P A;  3E19 A;  3E9F A;  2RQT A;  1I5L A;  2AK5 A;  1VOM A;  3JB9 F;  3REA B;  2FPD A;  1GBQ A;  1PD0 A;  4L5G A;  3C94 A;  2DLP A;  3NTK A;  3I56 A;  1OU9 A;  2QDL A;  4M77 C;  1X6O A;  2KY9 A;  4OMP A;  2QGG A;  3H0H A;  4OMO A;  1AWX A;  2G3R A;  4C5G A;  1K9M C;  2KRO A;  2O4X A;  2PU9 B;  1BU1 A;  2BZ8 A;  5IN1 A;  4F7U E;  5AYF A;  4PLI A;  3S3M A;  4Z88 A;  4RUG A;  2LZ6 B;  1EFN A;  2J7I A;  3MP1 A;  4M77 E;  4TVR A;  1LPL A;  1YWO A;  1YJN T;  2LX9 A;  1VQ7 T;  3V7R A;  4ZN3 A;  2VXE A;  2G6F X;  2DTI A;  2ZPB B;  5KYU B;  4FIB A;  5LJ3 f;  4B6M A;  3QII A;  1D0Z A;  1X27 A;  1G3S A;  1M90 C;  1I81 A;  3M58 A;  1OEB A;  3TSW A;  4EMH A;  1TUD A;  1UDL A;  2PVG B;  5KH6 A;  2FEI A;  4ZTF A;  3L2V A;  5GAM j;  3DB4 A;  2DTO A;  2YWW A;  2KBT A;  2JUF A;  1E6G A;  1D1B A;  2RD1 A;  1YJN A;  1VQ7 A;  2LJ1 A;  4PLL A;  3BFM A;  2CZ6 B;  2KRN A;  3TVT A;  2ABL A;  2RJE A;  2EYZ A;  4D6W A;  4DOW A;  2DFU A;  4QQD A;  2GQI A;  1GFC A;  2QAZ A;  2ESW A;  1FMV A;  4IUV A;  2K5I A;  1AZG B;  3FEO A;  5LJ5 f;  1VQ6 Q;  4RG2 A;  4FT4 A;  4XTV A;  5GAN d;  4EIK A;  1UGS B;  1X2K A;  5LJ3 h;  1W1F A;  3EG0 A;  2KYB A;  4M75 A;  5GAN 4;  2KXC A;  2J6K A;  2OAW A;  1RAE B;  3P8H A;  4RTW A;  1RAG B;  2XI9 A;  2PUK B;  3S3N A;  3EH1 A;  2CP7 A;  2HL3 A;  4A63 B;  1VQL T;  2JT4 A;  3NHN A;  3CXC S;  3CCR T;  3CCL Q;  5GAN 5;  1YIT T;  2QQR A;  1MMN A;  1RAB B;  1TOV A;  1JB0 E;  4M78 A;  1YI2 T;  3H6Z A;  2LQN A;  1M4Z A;  3JV3 A;  4C0D B;  1NE8 A;  4CI0 C;  4OMN A;  3H0F A;  3CCE Q;  5GAN g;  1WHM A;  3OW2 S;  4AFS C;  3A8M B;  1TTH B;  2HDA A;  4JRP A;  3M4G A;  4C0F A;  4D8K A;  5CKE A;  4QVD A;  1Q86 U;  1M5Q 1;  3V8K A;  2EAY A;  2VVK A;  1CKA A;  5LJ5 h;  2VYT A;  1JEG A;  2JM8 A;  1VQL A;  4Z89 A;  3OYK A;  1AHJ B;  2C0T A;  1PM3 A;  3CCR A;  2M0O A;  1VUB A;  2PVO B;  3RMS A;  1X43 A;  1YJ9 Q;  4IKF A;  3QPH A;  4GY5 A;  1MMA A;  3LGL A;  3DLL A;  2XU8 A;  4XQ3 A;  4NL2 A;  1K9M R;  1YI2 A;  2JS2 A;  2DRK A;  3A8H B;  3CC2 Q;  5GAN 2;  2JOY A;  2J06 A;  1G2B A;  4QW2 A;  2KYM A;  4AFQ C;  4RCB A;  3DB3 A;  3HP9 A;  4AG1 C;  1WHJ A;  3LX7 A;  4Z8A A;  3I9Q A;  1QKX A;  5IHN A;  3C0C A;  5GAN 6;  3CCS Q;  4C92 C;  1Q82 C;  1M90 R;  1M1F A;  4M7A G;  2BIV A;  3ASK A;  1M1K U;  2DBM A;  3EGX A;  1NYG A;  1SPK A;  3RKW A;  5D6X A;  4HCB A;  1M9S A;  3M0T A;  1QW1 A;  2F2X A;  2RI2 A;  4ZN1 A;  1VQ9 T;  4LDV A;  3P8D A;  1I8F A;  3R6O A;  2IPO B;  2QDY B;  4F04 B;  2YXY A;  1IXD A;  1VQP Q;  2CZ0 B;  3L2Q A;  1Z9Z A;  1WJS A;  2OX7 A;  1FX7 A;  1CKB A;  3CBM A;  3VRY A;  1WHK A;  2OTJ T;  1QCF A;  1BI2 A;  4C5E A;  4E7J A;  2K3B A;  2F2W A;  3SWN A;  4MML A;  1Y7X A;  3PMI A;  1R0B G;  2L3Q A;  2DER A;  4RG8 A;  5LJ3 e;  2EGC A;  4LE9 A;  2RN8 A;  1M8M A;  4M75 C;  4F7U F;  2QEX Q;  5GAO n;  3OYD A;  2X9H A;  2GFA A;  5GMK m;  3FDR A;  5CVI A;  2VGM A;  1VQ9 A;  1GXI E;  4HA8 A;  2QK0 A;  4GBQ A;  4M77 F;  1JXM A;  1Y96 A;  1QVG S;  2M0Y A;  2SRC A;  4OML A;  3MEA A;  2EIF A;  5IHI A;  4C0D C;  3G4S Q;  1QWF A;  1EX4 A;  1D3B A;  5L23 A;  1UGP B;  3G6E T;  2OTJ A;  2D9T A;  3QZ5 B;  1H8K A;  4R0K A;  5GMK h;  2X4Y A;  5FU6 B;  2HZY A;  2EGA A;  3EHR A;  4FU6 A;  4F17 A;  3C95 A;  2ZAE A;  1U1T A;  3JCM P;  1K8A U;  2C0O A;  2CYZ B;  3QG1 A;  3QKJ A;  1AVZ C;  2RO0 A;  4LNP A;  1VYT A;  1LOJ A;  1RAI B;  2DL7 A;  3PT9 A;  2M1H A;  4QQ6 A;  5IHK A;  2KT1 A;  1WA7 A;  1YIT Q;  1D1C A;  3G6E A;  2K3X A;  2LJ0 A;  4ORZ A;  1AWO A;  2DF6 A;  1V29 B;  4PJL A;  2XDB A;  1B34 B;  3QSU A;  4DOV A;  3TQ7 P;  5GJV B;  4EMK B;  3CC7 T;  4E2F B;  1OX9 A;  4PJO G;  2EW3 A;  4J9I A;  3VJP A;  2CGH A;  4LXC A;  1K73 U;  2DYI A;  2XD0 A;  4J9F A;  4ATO A;  2RNA A;  1MGQ A;  1M2O A;  2X35 A;  4HT8 A;  3MEU A;  3TU4 K;  1Q95 G;  2RHY A;  4Z02 A;  1NJI U;  5FWC A;  5A0L A;  1BIB A;  4QT7 A;  4KGV B;  3X20 B;  2EQJ A;  5GAN f;  1PG5 B;  2DPP B;  1G83 A;  4FW1 A;  3BE3 A;  3EG9 B;  1YJW Q;  3CC7 A;  2RPN A;  5KYY A;  2PTK A;  5LJ3 d;  2YRV A;  2ZPH B;  3A8O B;  2O2O A;  2H3E B;  1M3B A;  3M53 A;  2RQU A;  3P8B B;  3CMA T;  2HMA A;  1UGV A;  2X3X D;  2DZC A;  2LT1 A;  1MUZ A;  1MV0 B;  1G3W A;  2KVQ G;  1ZSZ B;  4II1 A;  1YHQ T;  1JJ2 A;  1T3S A;  2D0N A;  3V8L A;  1BIA A;  3RER A;  3PIO A;  1C1A A;  4KGX B;  2JTM A;  4ME7 A;  3CCM Q;  3BDL A;  2LX7 A;  5HKC A;  1LJO A;  3HRS A;  2CUB A;  3M54 A;  1T3L A;  1WLP B;  1S72 Q;  2KRM A;  2EFI A;  3JB9 J;  5LJ3 g;  1UEC A;  4OB2 B;  1DJ7 B;  3CMA A;  2DRM A;  1WJR A;  2AT1 B;  5FU6 C;  2DTH A;  3OS0 A;  2DIQ A;  3NTI A;  1YHQ A;  3GPL A;  4PFZ A;  5I2M A;  1VQ8 T;  2WSF E;  5J26 A;  3VS2 A;  4XTZ A;  3QJY A;  1V1C A;  1O9S A;  1W4S A;  3UA7 A;  3OYM A;  3X25 B;  4C8Q B;  1GFD A;  3CC4 Q;  1IB8 A;  1X69 A;  2D8H A;  4BD3 A;  2QGF B;  2RK2 A;  4EMG A;  4DA4 A;  4M7D G;  1QQJ A;  4N0A C;  4PL6 A;  4OB1 B;  1BKB A;  4F7U A;  5CO7 A;  2HBP A;  1U8R A;  2KDS A;  5CKF A;  4M7A A;  1GCQ C;  2KI7 A;  3X24 B;  2BTT A;  2H8H A;  4XK8 E;  1VQ8 A;  1N27 A;  2EYY A;  3FIF A;  5KYX B;  5GAO l;  3BW1 A;  4FT2 A;  1HJD A;  5GAM e;  1R77 A;  1TUC A;  1UTI A;  3A1P A;  2ROL A;  3PVL A;  3KFV A;  3VS1 A;  1K0S A;  4MDX A;  2NYS A;  2RJC A;  5L8R E;  4E7Z A;  1Q7Y U;  4HVW A;  1W70 A;  1HYO A;  4KUI A;  4J9E A;  5I2S A;  4FW2 A;  4NOY A;  3OSS C;  3EG2 A;  1WI7 A;  3VS0 A;  1PD1 A;  2FG0 A;  3I55 Q;  4OP0 A;  1T0H A;  3CME Q;  3QDR B;  4V2S A;  1IRE B;  1HK9 A;  2X3W D;  2I0N A;  2L3R A;  4JUV A;  1SF9 A;  4BE2 A;  1Q86 C;  2JNG A;  1JJ2 P;  3QJ6 A;  1ZSZ C;  3RR6 A;  3JB9 G;  4HT9 A;  1SEM A;  1XOV A;  3GLX A;  2P0P A;  3D7S B;  3OYJ A;  2QQ9 A;  5CKH A;  1ZHI A;  2CZ7 B;  5ECA A;  4C92 D;  4ZTJ A;  3ME9 A;  3E2U A;  2JMA A;  2V1R A;  3I56 T;  2QTV A;  1RAH B;  2K9G A;  2ED0 A;  3CCU T;  1YIJ T;  2E3H A;  3CCV Q;  1EIF A;  1QP3 A;  2E3I A;  2DL8 A;  4IUT A;  2KR3 A;  2KQW A;  2RM4 A;  2CH4 W;  2CSI A;  1X75 C;  5CK9 A;  5FRO A;  4C8Q C;  1KQS A;  3PE0 A;  1ZBJ A;  4XTY A;  3VS3 A;  2DMO A;  3CCJ Q;  3OYG A;  2F1L A;  1M2V A;  2R5A A;  4AFZ C;  1M1K C;  2GF7 A;  1D0Y A;  5FRM A;  4PJO A;  1I1J A;  2A28 A;  1BYM A;  3CCQ T;  1VQN T;  4KUL A;  3MET A;  4M75 D;  3JCM e;  4C5I A;  3CCU A;  1YIJ A;  2J6F A;  2HNI A;  4DQ2 A;  5GAM d;  1SKU B;  4C8Q E;  3FLG A;  2E4H A;  1VYV A;  2D1X A;  1B7T A;  5IXB A;  4J9C A;  3I5S A;  2YUQ A;  4J6Y A;  2ROT A;  1ZA1 B;  3O8V A;  1QCO A;  1VQ4 T;  1M30 A;  2MCN A;  1WXT A;  5FU7 B;  2O4X B;  1OQK A;  1JO8 A;  4E7S A;  1N8R U;  4M78 D;  2RF0 A;  1PCX A;  1D09 B;  3CCQ A;  1VQN A;  2Y4X A;  4BI8 B;  1OX8 A;  1PRM C;  1VA7 A;  3ZFJ A;  2OTL Q;  1PKT A;  3V7S A;  1KC8 U;  1OOT A;  5GAM g;  2BE9 B;  4EDU A;  1G8X A;  4JPB W;  3AHU A;  2FHD A;  3EFS A;  4M4Z A;  1VQ5 T;  2LJ3 A;  2NUP A;  1VQ4 A;  2EJ9 A;  1SG5 A;  1NEG A;  1AZE A;  1FMK A;  4OMF B;  4RTZ A;  2L5Q A;  4C92 B;  1TS9 A;  4MZM A;  3MCA B;  2CRE A;  2ENM A;  2MWO A;  3RMQ A;  2FZG B;  3MO8 A;  5D6W A;  1LNX A;  2ATC B;  1QVF A;  1K8A C;  4BE0 A;  1BI1 A;  4F14 A;  2KNB B;  3M56 A;  3CD6 T;  1Q86 R;  1VQM T;  1VQK Q;  2H3J A;  3JCM X;  4HVV A;  1RAA B;  5C6S A;  1OPL A;  1VQ5 A;  4PNO A;  4LDW A;  1WX6 A;  2NUT A;  2EYX A;  1P92 A;  3CQT A;  2EYQ A;  2LP5 A;  1Y07 A;  2M9U A;  2QXF A;  3EFR A;  4M7D A;  4M75 B;  3OMC A;  3S6W A;  1YCY A;  4AT1 B;  1BK2 A;  3MP6 A;  1KQS P;  4QVC A;  1K73 C;  1KHI A;  4J83 A;  3CD6 A;  3JCM d;  1VQM A;  1NPP A;  1QLY A;  3JSC A;  1N5Z A;  1NJI C;  1OU8 A;  4M78 B;  3Q1J A;  1BI3 A;  2CSQ A;  1M1K R;  3LYI A;  5CIU A;  2M51 A;  4Y91 A;  3I56 Q;  1JRI A;  4R55 A;  1SSH A;  3E1S A;  2RQR A;  1BI0 A;  1W2B A;  3ZL7 C;  1K4U S;  5FU7 C;  2OI3 A;  2SEM A;  2E64 A;  2KAF A;  2XIC A;  3H0I A;  4J7F A;  2LC4 A;  1WIE A;  3JCM g;  1PNJ A;  2YUO A;  4XTX A;  1HD3 A;  3I5R A;  2E10 A;  1YWP A;  4CC3 A;  3UWN A;  4LDU A;  3QYG B;  2DIL A;  2P84 A;  3MKD A;  4Y92 A;  2VKN A;  4BY6 C;  5HCK A;  2PZ1 A;  1RI0 A;  3WVD B;  5FRN A;  3AT1 B;  3EAE A;  2B8A A;  2P0K A;  5GAO q;  1U5S A;  2MPX C;  4F7U G;  4IUU A;  3OY9 A;  3M0R A;  2YSQ A;  5DY9 A;  2GBQ A;  2O31 A;  1SHG A;  2DVE A;  4ZGJ B;  2E70 A;  4HCC A;  2CP3 A;  2JTF A;  4M77 G;  1QVF P;  2MMP A;  2QQA A;  2HL5 C;  4A54 A;  1KD1 U;  4KH1 B;  5FW9 A;  1WXU A;  1JQQ A;  3EGX B;  4J6W A;  2KK4 A;  3U23 A;  2W10 A;  1AD5 A;  3MHX A;  3QDF A;  1XTD A;  1YJN Q;  1VQ7 Q;  2Z0W A;  2KMT A;  4C92 E;  8AT1 B;  1K8A R;  2O9S A;  4HXJ A;  5CKB A;  2A36 A;  1JJ2 S;  4JLI A;  2CDT A;  2J05 A;  4JRK A;  2GNC A;  3CBP A;  3M9Q A;  4E7I A;  1TH7 A;  1YBY A;  4LD6 A;  1K9M U;  3URG A;  4PK4 A;  1VQO T;  5HY6 A;  4LUD A;  3SWN B;  2COY A;  2FL7 A;  2PUO B;  1M8V A;  1MND A;  3LH5 A;  3GNF B;  4OMM A;  3RBB B;  4KBM B;  1WGS A;  2DX1 A;  4IUP A;  4X34 A;  5GAM f;  1X01 A;  3VRZ A;  3JCM V;  1K73 R;  2MK5 A;  1Y96 B;  1BCM A;  4M78 C;  4M75 E;  1C6V X;  2GTJ A;  1TWB A;  3EH2 A;  2B86 A;  2KEA A;  5GAN 7;  4E7L A;  5GAN 3;  3GOX A;  1ARK A;  2A08 A;  1VQO A;  1W2B P;  3OQ5 A;  2VWF A;  2K5L A;  3CBO A;  1G3Y A;  4KRT A;  2QA4 T;  3OYC A;  4X9D A;  1UGR B;  1B3Q A;  4M78 E;  1PC0 A;  2K2M A;  2DYB A;  3JCM W;  3A8L B;  1VQL Q;  2DO3 A;  4NS5 A;  2QQB A;  1D0X A;  3MP8 A;  3EGD B;  3JCM Q;  5DLQ E;  2VGN A;  1OI1 A;  3G1J A;  3CCR Q;  3VU3 C;  2BKD N;  4JJN K;  3SD4 A;  1QWE A;  1XQH A;  1RL2 A;  1YI2 Q;  2X4W A;  4C8Q D;  3GNG A;  5GAM h;  3J81 E;  3LH0 A;  2VC8 A;  5CQY A;  4ESR A;  1WZO A;  1X6B A;  4PKC C;  3G71 T;  4RCC A;  2QA4 A;  4E47 A;  4EPC A;  2WSE E;  2HEQ A;  2XKO C;  2CP5 A;  2HSE B;  3UPU A;  1NLP C;  5GAO r;  2LNH B;  1K1Z A;  3QHS A;  2K6D A;  2RQV A;  4OB0 B;  4OGC A;  1D1A A;  1OZ2 A;  3VV0 A;  3V8J A;  4M7A D;  2WAC A;  1Q82 R;  2EQU A;  2CZ1 B;  2HSP A;  1MHN A;  3M0P A;  3NFC A;  5EG2 A;  1OUL A;  2K2V A;  1UEB A;  4KT0 E;  3G71 A;  3UF4 A;  2E41 A;  1UG1 A;  1Y0M A;  2JN0 A;  1TU0 B;  2RJF A;  3I55 A;  4OMQ A;  1VIE A;  2DZ9 A;  3M57 A;  5KYY B;  3CEY A;  1XJW B;  4GLM A;  1YNZ A;  2CUD A;  2FRW A;  3RIR A;  2YHT A;  2YLB A;  3JCM f;  1TSF A;  3NMZ C;  4GLK A;  1PSE A;  3H9N A;  3SWN C;  1TUG B;  2P4T A;  4OVA A;  3JAM E;  1KQ1 A;  4L6V 5;  3EGU A;  2CT4 A;  2RHX A;  3LW5 E;  3VS7 A;  1N8R C;  2VB6 A;  2DD5 A;  2ZZD A;  2BE7 D;  1E7O A;  1QMC A;  2HQE A;  5AT1 B;  3EG3 A;  4C92 G;  3VYH B;  4DBF A;  1VQ9 Q;  2RI3 A;  2OAU A;  2LT4 A;  1K76 A;  1PRL C;  3N5B B;  1KQS S;  1K9A A;  1KC8 C;  2K3Y A;  2QYZ A;  3QWY A;  4FYW B;  4IIM A;  3L1A A;  2OJ2 A;  2OTJ Q;  1RI9 A;  2DBK A;  3M4Y A;  2CP0 A;  3S3O A;  1Q81 U;  2V1Q A;  1H64 1;  2JS0 A;  4FSX A;  3JCM h;  2ZPE B;  4CC2 A;  3LWI A;  2GFU A;  2PNI A;  4Q5W A;  4PFP A;  1R8O B;  4UC4 A;  4X1V A;  1QVP A;  1H3Z A;  3EFO A;  4ELZ C;  1W6X A;  2COW A;  4A4K A;  2CS7 A;  2GTO A;  4C92 F;  2FO0 A;  2K57 A;  4M77 A;  2HQX A;  2XMF A;  4M7A B;  3G6E Q;  1RAD B;  1WQW A;  4IIO A;  4KH0 B;  5CCA A;  1SRM A;  3BDU A;  2CP2 A;  1TG0 A;  1ZUY A;  1WYX A;  5C0M A;  1KSW A;  5A0D A;  5KYX A;  3VS5 A;  4FSS A;  3THK A;  2GQV A;  4N4G A;  4PJO D;  3RKX A;  2RB6 A;  2HBW A;  3ZBD A;  4JZ4 A;  1KG1 A;  3HKS A;  2EVR A;  2ZPI B;  2AHJ B;  4XU0 A;  6AT1 B;  3A98 A;  5LJ5 j;  5GAN 8;  5IT9 E;  2OTL A;  2QAS A;  2VV5 A;  1RLQ C;  3L2W A;  4PFO A;  4M75 F;  1VQ6 T;  5KYW B;  1YFN A;  1GL5 A;  4WTO B;  2D8J A;  3OYE A;  3HL8 A;  1YCS B;  4J9H A;  3J80 E;  3HRT A;  4JJB A;  2FZK B;  3CC7 Q;  3OYF A;  1NZ9 A;  3DLM A;  4XTW A;  1R0C B;  1Y57 A;  2JVV A;  3J7A F;  2MYS A;  3TSZ A;  4JDS A;  4E7K A;  4PJN A;  3X28 B;  1Y71 A;  1ABO A;  4X9C A;  2IG0 A;  1WXB A;  2CKK A;  4HKE A;  3REB B;  4MMK A;  1WHG A;  3CCL T;  2AKK A;  4DEX A;  4HCK A;  2JXB A;  3OBY A;  2QQS A;  1VQ6 A;  3RNJ A;  1BB9 A;  1UGQ B;  2EQM A;  1XNI A;  1N8R R;  1MMG A;  2DXT A;  3GBQ A;  2AIR B;  3HFO A;  3CCE T;  4J5Y A;  1Z9Q A;  2VAS A;  1RAF B;  1MMD A;  1ZX6 A;  2I2L A;  3OYA A;  2HD0 A;  2E65 A;  1MNE A;  1FMW A;  2P4R A;  3OSV A;  4RTY A;  3CMA Q;  5CR2 A;  3RKY A;  3CCL A;  5GJW B;  2E6N A;  4JS4 A;  1YHQ Q;  1KC8 R;  5EC7 A;  2XG8 D;  2F5T X;  1YJ9 T;  5HK3 A;  2R57 A;  3UAT A;  1FYN A;  3KXT A;  1M2V B;  1KD1 C;  3CC2 T;  4XAX B;  4OB3 B;  1W2B S;  3OYY A;  4PJO B;  4A4H A;  2QG9 B;  3CCE A;  1MV3 A;  4M7D D;  2DEQ A;  1X6G A;  2F5K A;  1A0N B;  2YRD A;  4M7A C;  1KIK A;  1T0J A;  5A0G A;  3OS2 A;  1UJY A;  2J6O A;  3CPF A;  1VQ8 Q;  3CCS T;  1YJ9 A;  3LLR A;  4N4H A;  3C4S A;  4A4G A;  5GAO m;  3CC2 A;  4A53 A;  2KE9 A;  4M7A E;  5GMK j;  2HKN A;  4BY6 B;  2LQW A;  5KYU A;  2D0Q B;  1G3T A;  2L89 A;  5GAO p;  3OA6 A;  1VQP T;  3M55 A;  2EBP A;  3SB2 A;  5CQX A;  3CPW A;  2NUP B;  5I21 A;  3CCS A;  1K0X A;  2QI2 A;  2RI5 A;  2LMJ A;  1OYX A;  4C92 A;  3ER0 A;  3VYG A;  2QEX T;  1VIF A;  3ULR B;  2DL4 A;  3ZEH A;  2YT6 A;  4XU3 A;  4L59 A;  3DKM A;  2Y90 A;  3JB9 D;  3QXE B;  3L2R A;  3IQL A;  5FWB A;  1OV3 A;  3OMG A;  4J9B A;  3INZ A;  3MJX A;  5KCH A;  1VQP A;  3G4S T;  1J3T A;  2V26 A;  2NUT B;  5KE2 A;  5GMK i;  2JMC A;  1GCP A;  2QTX A;  3GIB A;  3PVQ A;  4LDY A;  2DD4 A;  4XU1 A;  1IZ6 A;  4O5V A;  2CP6 A;  2QEX A;  1C0M A;  2LVM A;  2R58 A;  5GMK l;  3PTA A;  1ZA2 B;  1FXX A;  4M7D B;  2DA9 A;  1AWW A;  2LTO A;  1G5V A;  1LVK A;  3PMT A;  2WSC E;  2AZV A;  2RHI A;  4J6X A;  3BY7 A;  2M16 A;  2EQI A;  3NGP A;  1ZUU A;  2NWM A;  2DJZ A;  2FPF A;  3G4S A;  3JRZ A;  4ZGE B;  4PJO C;  2A7Y A;  4Y28 E;  2PQW A;  2PVD B;  1IHV A;  2E6Z A;  3A5Z B;  3MPU B;  4AFU C;  4CC4 B;  1UHF A;  2DL5 A;  2XDP A;  5I11 A;  3FJ5 A;  1KD1 R;  4C0G A;  1KK7 A;  3FB9 A;  3CCU Q;  1YIJ Q;  3QBY A;  4J7I A;  1B07 A;  1SRL A;  2IVW A;  4KGZ B;  2YDL A;  4NL3 A;  1HSQ A;  3KUF A;  4FYV B;  1ZUK A;  1H92 A;  4PJO E;  1I07 A;  1BBZ A;  2VUB A;  3QZ9 B;  5GAN j;  1N6A A;  1NEB A;  2EWN A;  3OYH A;  2EKO A;  2RHZ A;  1JXO A;  5M9O A;  1YIT A;  4VUB A;  2KT8 A;  2A37 A;  2DL3 A;  1AOJ A;  2MIO A;  2ZPF B;  3FC3 A;  1OZ3 A;  4B9W A;  3CCQ Q;  3M5A A;  1VQN Q;  4C8Q G;  3OYI A;  3GP8 A;  1YJW T;  2DXB A;  3TRE A;  2E5Q A;  1NPR A;  1NG2 A;  1NM7 A;  3M0S A;  4C0Z A;  3CPW P;  5A2Q E;  4RTX A;  1M3C A;  2KXD A;  2MI6 A;  1WNL A;  2DXU A;  1VQ4 Q;  8ATC B;  2W0Z A;  4YTL A;  4OF1 A;  3JB9 H;  1ACM B;  2EGE A;  2O9V A;  2DE0 X;  2MOX A;  4FL6 A;  1Q81 C;  1PKS A;  1RLP C;  3JB9 I;  2E12 A;  2MF2 A;  3VS6 A;  2V8I A;  4K11 A;  4JRQ A;  3LWH A;  1U1S A;  3CCM T;  1ABQ A;  2D6F A;  1YJW A;  3PFS A;  2RH2 A;  4XTU A;  3TEE A;  1WJQ A;  4JLG A;  1TXQ A;  1PHT A;  2JW4 A;  1S72 T;  3QUI A;  1QCN A;  4C8Q F;  5KCO A;  4XU2 A;  1YP5 A;  2V8K A;  1VQ5 Q;  1UB4 A;  2EKH A;  1LCK A;  4OGE A;  4BE1 A;  2HCK A;  1F1B B;  2ZCF B;  3MEW A;  1X2Q A;  2F2V A;  2FRY A;  4M7D C;  4JJD A;  1OPK A;  1QKW A;  2ZGW A;  5KE3 A;  3PIP A;  3X26 B;  4E6R A;  1O75 A;  1JU5 C;  3CC4 T;  3OS5 A;  3CCM A;  4BI3 A;  4C5H A;  1Q7Y C;  1AT1 B;  1ZSG A;  3L2Z A;  4J9D A;  2EQK A;  3OBW A;  4E7H A;  1WPY A;  2DAQ A;  3CD6 Q;  3OB9 A;  1S72 A;  4M7A F;  3R6N A;  2K79 A;  1VQM Q;  4BB7 A;  2RK1 A;  5IXF A;  4ANJ A;  2X4J A;  4J8O A;  1M90 U;  1D3B B;  1UE9 A;  9ATC B;  4M7D E;  4O6J A;  2DXC A;  1IGU A;  5IH2 A;  1NJI R;  2MAM A;  3HTR A;  3UT1 A;  1PSF A;  3OYL A;  3SDZ A;  3T9N A;  3CXC A;  3SEM A;  4DBQ A;  1UUE A;  3EG1 A;  1SSF A;  2O88 A;  2RHU A;  2A3L A;  1ZQ1 A;  2YLC A;  3CC4 A;  2AKL A;  2E1H A;  2LCS A;  1CSK A;  4DBH A;  1ZLM A;  1S1N A;  1JBM A;  4R56 A;  2K4Y A;  2X51 A;  2C06 A;  1UFF A;  3OW2 A;  2L0A A;  2DNU A;  3F70 A;  5LJ5 e;  2DJQ A;  3EGD A;  4MZT A;  4N0A A;  2XK0 A;  3JCM b;  1AWJ A;  1KJW A;  4MZP A;  1IO6 A;  1NYF A;  4CC7 A;  2LNV A;  4PJM A;  1AEY A;  4BAC A;  1B34 A;  1GCQ A;  3M0U A;  4HVU A;  4KUD K;  1UJ0 A;  4BI4 A;  4EMK A;  7AT1 B;  2FPE A;  3I55 T;  2JTE A;  3GF5 A;  3KBG A;  1IHW A;  3CME T;  4QVZ A;  3M0Q A;  2R5M A;  2JJ9 A;  1KHC A;  3H8Z A;  4CRI A;  2COZ A;  2NUZ A;  5KYN A;  2FYK A;  4ZGD B;  4FM4 B;  1N9S A;  4WCI A;  3VUB A;  4LD9 K;  3EHQ A;  1ZBX A;  2YUN A;  2YRC A;  2FZC B;  1BCO A;  4HCZ A;  2HKQ B;  2DET A;  1WHL A;  1WQ7 A;  4M77 D;  1VYU A;  4RTV A;  2MWP A;  4PJJ A;  4A4E A;  4IUR A;  2DVJ A;  4B9X A;  3EG9 A;  1Q81 R;  2Y4Y A;  1WFW A;  3C12 A;  2L3P A;  1QP2 A;  3CME A;  4JJC A;  2JM9 A;  2KSS A;  3CCV T;  1M1G A;  2IIM A;  4J9G A;  2C0I A;  3WXM B;  1E6H A;  4QQG A;  4RTU A;  2GGR A;  5I22 A;  2XHC A;  1KQ2 A;  4LUE A;  1ZSZ A;  5J39 A;  2CT3 A;  1I5O B;  3JCM J;  5D7U A;  4JRI A;  4PJO F;  3OS1 A;  3CCJ T;  3TCJ A;  1YN8 A;  2JZ2 A;  2DM1 A;  4AMC A;  2V8J A;  4A4F A;  5DM7 R;  4BDZ A;  3UA6 A;  4FYY B;  2LDM A;  5LL6 S;  1M3A A;  4JS5 A;  5DLO A;  3CCV A;  1I0C A;  2ECZ A;  1Q7Y R;  2EJG A;  3FRN A;  3CXC P;  3UDC A;  1U3O A;  2P0Q A;  4QKU A;  1WHH A;  4IUQ A;  2HQH A;  5GAN h; 
#chains in the Genus database with same CATH homology
 3CCL A;  2E6N A;  4JS4 A;  1QVG A;  1D3B A;  2XG8 D;  1UGP B;  2F5T X;  1Q82 U;  3G6E T;  5HK3 A;  3JSC A;  2R57 A;  3V7C A;  1YJ9 T;  1NJI C;  4N4I A;  3OYB A;  2D9T A;  2OTJ A;  5LJ5 d;  3KXT A;  5CKD A;  3CCJ A;  3QZ5 B;  1N9R A;  3HRU A;  4M78 B;  2LQ8 A;  3Q1J A;  4C8Q A;  5GMK h;  2X4Y A;  1KD1 C;  5FU6 B;  4FU6 A;  1BI3 A;  5LJ3 j;  3CC2 T;  4XAX B;  3LYI A;  5CIU A;  4OB3 B;  3C95 A;  5GMK e;  3OYY A;  1W2B S;  4Y91 A;  4PJO B;  4A4H A;  1U1T A;  3CCE A;  3JCM P;  1K8A U;  1JRI A;  2CYZ B;  4R55 A;  3E1S A;  3QG1 A;  3VKI A;  3QKJ A;  4M75 G;  3HFN A;  3VUZ A;  4M7D D;  2DEQ A;  1BI0 A;  2F5K A;  3OYN A;  2FB7 A;  2X4X A;  1W2B A;  4F7U B;  4M7A C;  2RO0 A;  5FU7 C;  2OTL T;  2RA2 A;  1LOJ A;  2E64 A;  2KAF A;  2XIC A;  5A0G A;  4J7F A;  3OS2 A;  2LC4 A;  3MEV A;  3PT9 A;  3JCM g;  2M1H A;  4QQ6 A;  5FLX E;  4XTX A;  3M59 A;  4M77 B;  3CPF A;  2E10 A;  3CCS T;  3G6E A;  1YJ9 A;  2K3X A;  3LLR A;  4N4H A;  2NLU A;  1I4K 1;  2VXF A;  1V29 B;  3UWN A;  3RES A;  4LDU A;  3C4S A;  2XDB A;  4A4G A;  2LQK A;  1B34 B;  3QYG B;  4M78 G;  4EMK C;  2F69 A;  5GAO m;  5D6Y A;  5LJ5 g;  3QSU A;  3CC2 A;  4A53 A;  4DOV A;  3LGF A;  2K5F A;  3CC7 T;  4EMK B;  4BY6 C;  4M7A E;  5GMK j;  1RI0 A;  4PJO G;  3JCM c;  3WVD B;  3VJP A;  4BUG A;  2CGH A;  4BY6 B;  5FRN A;  3EAE A;  2B8A A;  2P0K A;  5GAO q;  1HXD A;  1K73 U;  2D0Q B;  1G3T A;  2GCX A;  2XD0 A;  4LDX A;  2L89 A;  4ATO A;  3L42 A;  4F7U G;  4IUU A;  1MGQ A;  5GAO p;  3NTH A;  2L8D A;  3PNW C;  3OY9 A;  2X35 A;  4HT8 A;  5DY9 A;  3MEU A;  4WF2 A;  2O01 E;  3TU4 K;  3RUX A;  3CPW S;  2DVE A;  3OA6 A;  1VQK T;  4ZGJ B;  3M55 A;  5J3B A;  1VQP T;  2E70 A;  5CQX A;  3SB2 A;  2RHY A;  4HCC A;  2JTF A;  4Z02 A;  1NJI U;  1QVF S;  3CPW A;  5A0L A;  1BIB A;  3X20 B;  4M77 G;  5I21 A;  3CCS A;  2QI2 A;  2MMP A;  2QQA A;  4A54 A;  2RI5 A;  4RKU E;  2EQJ A;  5GAN f;  1KD1 U;  4M7D F;  1OYX A;  2DPP B;  2LRQ A;  4C92 A;  3ER0 A;  4J6W A;  3VYG A;  2KK4 A;  2QEX T;  1VIF A;  3MHX A;  3ZEH A;  3CC7 A;  1XTD A;  4XU3 A;  4L59 A;  2KMT A;  4C92 E;  5LJ3 d;  2YRV A;  2ZPH B;  2Y90 A;  3A8O B;  3DKM A;  3QXE B;  3JB9 D;  2HAX A;  3WVE B;  4M78 F;  3L2R A;  3QYH B;  3OMG A;  5CKB A;  2FVU A;  3QO3 A;  3M53 A;  1JJ2 S;  4JLI A;  3P8B B;  3CMA T;  4P5N A;  3INZ A;  2DK3 A;  1VQK A;  2DZC A;  2LT1 A;  2XDD A;  5KCH A;  1VQP A;  3G4S T;  1FWZ A;  2DKG A;  4JRK A;  1G3W A;  2DIG A;  2KVQ G;  4II1 A;  3CBP A;  3M9Q A;  1YHQ T;  1JJ2 A;  2EJF A;  4E7I A;  3SFM A;  1TH7 A;  1YBY A;  2BUD A;  4LD6 A;  5KE2 A;  5GMK i;  1K9M U;  3URG A;  3V8L A;  4ELY C;  1BIA A;  2LCL A;  1VQO T;  2QTX A;  3GIB A;  4LDY A;  2RJD A;  5HY6 A;  3RER A;  3SWN B;  2DD4 A;  4XU1 A;  3PIO A;  3E9G A;  3L2U A;  1IZ6 A;  2JTM A;  3FJP A;  2FL7 A;  2PUO B;  3BDL A;  4ME7 A;  4O5V A;  1M8V A;  5CAI A;  2QEX A;  2LVM A;  5HK0 A;  5HKC A;  1LJO A;  2R58 A;  3PGG A;  3G7Z A;  5GMK l;  2LCC A;  3HRS A;  3PTA A;  4BDY A;  3GNF B;  1FXX A;  3M54 A;  4M7D B;  4KBM B;  1WGS A;  2LTO A;  4IUP A;  4X34 A;  5GAM f;  3HSB A;  1G5V A;  1X01 A;  2EFI A;  4RMO A;  3PMT A;  2WSC E;  4J6X A;  2RHI A;  4MDW A;  3JCM V;  3BY7 A;  2M16 A;  5LJ3 g;  3JB9 J;  4OB2 B;  3HPW A;  5IAY A;  1DJ7 B;  1Y96 B;  4M78 C;  4M75 E;  3CMA A;  2XID A;  2DJZ A;  1WJR A;  2ZPG B;  3HHT B;  5GAN e;  5FU6 C;  3G4S A;  2DTH A;  3A8G B;  3JRZ A;  3OS0 A;  2DIQ A;  4ZGE B;  3NTI A;  1YHQ A;  3GPL A;  3E19 A;  3E9F A;  4PJO C;  2A7Y A;  4Y28 E;  2PQW A;  2PVD B;  2WSF E;  5I2M A;  2E6Z A;  5J26 A;  3A5Z B;  5GAN 7;  5GAN 3;  4E7L A;  3GOX A;  4XTZ A;  3QJY A;  1VQO A;  1I5L A;  1O9S A;  1W4S A;  3OYM A;  2XDP A;  3OQ5 A;  3JB9 F;  2K5L A;  3X25 B;  3CBO A;  4C8Q B;  1G3Y A;  2QA4 T;  4BD3 A;  4C0G A;  3OYC A;  4L5G A;  3FB9 A;  4X9D A;  2RK2 A;  3C94 A;  3NTK A;  3QBY A;  4J7I A;  4EMG A;  3I56 A;  4DA4 A;  1UGR B;  4M78 E;  2IVW A;  4M7D G;  4N0A C;  4M77 C;  3A8L B;  3JCM W;  2DO3 A;  4NS5 A;  1X6O A;  2QQB A;  4OB1 B;  4PL6 A;  3MP8 A;  3KUF A;  1BKB A;  4F7U A;  2KY9 A;  4NL3 A;  3JCM Q;  5CO7 A;  5DLQ E;  4PJO E;  2VGN A;  1OI1 A;  2HBP A;  1U8R A;  2G3R A;  2KDS A;  2VUB A;  5CKF A;  3QZ9 B;  4C5G A;  4M7A A;  3VU3 C;  2BKD N;  5GAN j;  1N6A A;  4JJN K;  3SD4 A;  2O4X A;  1XQH A;  1K9M C;  2PU9 B;  3X24 B;  1RL2 A;  2EWN A;  5IN1 A;  3OYH A;  4F7U E;  4XK8 E;  2EKO A;  2RHZ A;  2X4W A;  5AYF A;  4C8Q D;  5M9O A;  3GNG A;  1YIT A;  1VQ8 A;  5GAM h;  4VUB A;  1N27 A;  3J81 E;  3LH0 A;  2VC8 A;  3FIF A;  4PLI A;  5CQY A;  3S3M A;  5GAO l;  2ZPF B;  3BW1 A;  4FT2 A;  3FC3 A;  1OZ3 A;  4B9W A;  5GAM e;  3M5A A;  4PKC C;  3G71 T;  4C8Q G;  3OYI A;  3MP1 A;  4RCC A;  4M77 E;  4TVR A;  4E47 A;  4EPC A;  3GP8 A;  2QA4 A;  1YJW T;  2WSE E;  2DXB A;  3TRE A;  1YJN T;  2E5Q A;  1NPR A;  2LX9 A;  1VQ7 T;  3V7R A;  4MDX A;  4ZN3 A;  2XKO C;  2RJC A;  5L8R E;  2VXE A;  3UPU A;  1Q7Y U;  4C0Z A;  5GAO r;  2DTI A;  2ZPB B;  4FIB A;  5LJ3 f;  3QHS A;  4KUI A;  4OB0 B;  4OGC A;  5A2Q E;  1OZ2 A;  3QII A;  1G3S A;  1M90 C;  5I2S A;  4NOY A;  1I81 A;  2MI6 A;  1WNL A;  2DXU A;  3M58 A;  3V8J A;  3VV0 A;  3OSS C;  4M7A D;  2WAC A;  4YTL A;  2EQU A;  4OF1 A;  4EMH A;  2CZ1 B;  3JB9 H;  2PVG B;  4FL6 A;  1MHN A;  5KH6 A;  1Q81 C;  1VQ8 T;  3NFC A;  5EG2 A;  3JB9 I;  2E12 A;  2MF2 A;  2V8I A;  4ZTF A;  2K2V A;  4OP0 A;  3L2V A;  4JRQ A;  5GAM j;  1UEB A;  3QDR B;  4KT0 E;  1U1S A;  3LWH A;  3CCM T;  3G71 A;  4V2S A;  1IRE B;  3DB4 A;  1HK9 A;  2E41 A;  2DTO A;  2D6F A;  1YJW A;  2JUF A;  2RH2 A;  2JN0 A;  3PFS A;  2RD1 A;  1YJN A;  2RJF A;  3I55 A;  4XTU A;  3TEE A;  1VQ7 A;  2L3R A;  1VIE A;  1WJQ A;  2DZ9 A;  4JLG A;  4JUV A;  3BFM A;  2CZ6 B;  2JNG A;  3M57 A;  4PLL A;  3QJ6 A;  3CEY A;  1S72 T;  3JB9 G;  3QUI A;  4HT9 A;  1Q86 C;  2RJE A;  3JCM f;  3RIR A;  2YHT A;  2YLB A;  4C8Q F;  4D6W A;  1XOV A;  4DOW A;  4XU2 A;  5KCO A;  1VQN T;  4QQD A;  2V8K A;  3GLX A;  2P0P A;  1UB4 A;  4GLK A;  1PSE A;  3OYJ A;  2QQ9 A;  5CKH A;  3SWN C;  4OGE A;  2P4T A;  4OVA A;  3JAM E;  4BE1 A;  4IUV A;  1ZHI A;  2K5I A;  2CZ7 B;  2ZCF B;  3MEW A;  1KQ1 A;  3FEO A;  4L6V 5;  5LJ5 f;  4RG2 A;  4C92 D;  4FT4 A;  4XTV A;  2RHX A;  3LW5 E;  4ZTJ A;  3ME9 A;  1N8R C;  5GAN d;  4M7D C;  2ZGW A;  2DD5 A;  5KE3 A;  1UGS B;  2ZZD A;  3PIP A;  5LJ3 h;  3X26 B;  3I56 T;  1O75 A;  5GAN 4;  4M75 A;  2HQE A;  3CC4 T;  3OS5 A;  3CCM A;  4BI3 A;  4C92 G;  4C5H A;  3VYH B;  3P8H A;  1Q7Y C;  3CCU T;  1YIJ T;  3L2Z A;  2RI3 A;  2XI9 A;  2EQK A;  2OAU A;  3OBW A;  1WPY A;  1EIF A;  4E7H A;  2PUK B;  2LT4 A;  2DAQ A;  3S3N A;  3OB9 A;  3N5B B;  1S72 A;  1QP3 A;  4M7A F;  4BB7 A;  2RK1 A;  4IUT A;  1VQL T;  1KQS S;  1KC8 C;  2K3Y A;  2KQW A;  2RM4 A;  2X4J A;  1X75 C;  4J8O A;  1M90 U;  3CXC S;  5CK9 A;  1D3B B;  3CCR T;  1YIT T;  5GAN 5;  3L1A A;  5FRO A;  4M7D E;  2QQR A;  4O6J A;  4C8Q C;  2DXC A;  1KQS A;  4XTY A;  2MAM A;  1JB0 E;  3UT1 A;  1PSF A;  3M4Y A;  3H6Z A;  4M78 A;  3SDZ A;  3T9N A;  3OYL A;  1M4Z A;  3OYG A;  3CXC A;  3S3O A;  1Q81 U;  2R5A A;  1H64 1;  1M1K C;  4C0D B;  2GF7 A;  1NE8 A;  4FSX A;  4CI0 C;  1SSF A;  3JCM h;  2ZPE B;  5FRM A;  4PJO A;  1BYM A;  3CCQ T;  2RHU A;  3LWI A;  2A3L A;  1ZQ1 A;  5GAN g;  2YLC A;  4KUL A;  2GFU A;  3MET A;  3CC4 A;  4Q5W A;  4M75 D;  1R8O B;  2E1H A;  3JCM e;  3OW2 S;  3A8M B;  4C5I A;  4UC4 A;  4JRP A;  3M4G A;  4C0F A;  4QVD A;  5CKE A;  3CCU A;  1QVP A;  1JBM A;  1YIJ A;  1Q86 U;  2HNI A;  1M5Q 1;  4DQ2 A;  4R56 A;  3V8K A;  2K4Y A;  4ELZ C;  2EAY A;  2C06 A;  5GAM d;  5LJ5 h;  2VYT A;  3OW2 A;  4C8Q E;  3FLG A;  3F70 A;  1VQL A;  4A4K A;  3OYK A;  2CS7 A;  5LJ5 e;  4C92 F;  1AHJ B;  4MZT A;  2K57 A;  4N0A A;  2XK0 A;  3CCR A;  4M77 A;  4J6Y A;  3JCM b;  2M0O A;  1VUB A;  3O8V A;  2PVO B;  2HQX A;  4MZP A;  1VQ4 T;  4M7A B;  3RMS A;  4IKF A;  1WQW A;  3QPH A;  4GY5 A;  3LGL A;  5FU7 B;  3DLL A;  2O4X B;  2LNV A;  2XU8 A;  4XQ3 A;  4NL2 A;  4BAC A;  1YI2 A;  1N8R U;  1B34 A;  4M78 D;  5CCA A;  4KUD K;  3A8H B;  3BDU A;  4BI4 A;  5GAN 2;  4EMK A;  5C0M A;  3I55 T;  5A0D A;  3GF5 A;  3KBG A;  2GQV A;  2JOY A;  4N4G A;  3CME T;  4QVZ A;  3RKX A;  3CCQ A;  2R5M A;  2RB6 A;  1VQN A;  4PJO D;  1KHC A;  3H8Z A;  3ZBD A;  4CRI A;  1KG1 A;  2Y4X A;  4BI8 B;  4QW2 A;  3HKS A;  2FYK A;  2ZPI B;  2AHJ B;  4ZGD B;  4FM4 B;  1N9S A;  3ZFJ A;  3VUB A;  4XU0 A;  4LD9 K;  4BE2 A;  3V7S A;  1KC8 U;  1ZBX A;  4RCB A;  3DB3 A;  3HP9 A;  5GAM g;  4EDU A;  4HCZ A;  5LJ5 j;  3LX7 A;  3AHU A;  5GAN 8;  2FHD A;  3EFS A;  5IT9 E;  1VQ5 T;  2OTL A;  5GAN 6;  1WQ7 A;  2VV5 A;  4M77 D;  1VQ4 A;  2EJ9 A;  4C92 C;  1Q82 C;  1M1F A;  4M7A G;  2MWP A;  2BIV A;  3ASK A;  3L2W A;  1M1K U;  4M75 F;  4OMF B;  4C92 B;  2L5Q A;  4IUR A;  3RKW A;  4A4E A;  1VQ6 T;  5D6X A;  4B9X A;  3OYE A;  3HL8 A;  4MZM A;  4HCB A;  2Y4Y A;  3J80 E;  3HRT A;  1M9S A;  3C12 A;  3MCA B;  2MWO A;  1QW1 A;  3RMQ A;  3OYF A;  1NZ9 A;  2RI2 A;  3DLM A;  1QP2 A;  3CME A;  3MO8 A;  5D6W A;  1LNX A;  2KSS A;  4XTW A;  1QVF A;  2JVV A;  4ZN1 A;  1K8A C;  1VQ9 T;  4LDV A;  4BE0 A;  1BI1 A;  3CCV T;  1M1G A;  3J7A F;  3P8D A;  4JDS A;  1I8F A;  3M56 A;  3R6O A;  4E7K A;  3X28 B;  1Y71 A;  3CD6 T;  2QDY B;  3WXM B;  4QQG A;  4X9C A;  1VQM T;  2IG0 A;  2H3J A;  4HKE A;  2CKK A;  3JCM X;  2XHC A;  2CZ0 B;  1KQ2 A;  4MMK A;  1YI2 T;  5C6S A;  3L2Q A;  5J39 A;  1WJS A;  3CCL T;  4PNO A;  1FX7 A;  4LDW A;  1VQ5 A;  3CBM A;  3JCM J;  1H3Z A;  2OTJ T;  4JRI A;  1BI2 A;  4PJO F;  4C5E A;  4E7J A;  3OS1 A;  3CCJ T;  3OBY A;  2QQS A;  3SWN A;  4MML A;  1P92 A;  1Y7X A;  3PMI A;  3TCJ A;  1VQ6 A;  2JZ2 A;  2EYQ A;  4RG8 A;  5LJ3 e;  1Y07 A;  1UGQ B;  2V8J A;  4A4F A;  5DM7 R;  4M75 C;  4F7U F;  2EQM A;  1XNI A;  2M9U A;  5GAO n;  2QXF A;  4BDZ A;  2DXT A;  3HFO A;  3OYD A;  3CCE T;  3EFR A;  4M7D A;  4M75 B;  4J5Y A;  2GFA A;  3OMC A;  3S6W A;  1YCY A;  2LDM A;  5LL6 S;  5GMK m;  4JS5 A;  3FDR A;  5CVI A;  2VGM A;  5DLO A;  1VQ9 A;  3CCV A;  1GXI E;  4HA8 A;  3MP6 A;  2I2L A;  3OYA A;  4QVC A;  1K73 C;  1KHI A;  2HD0 A;  2EJG A;  4J83 A;  3FRN A;  4M77 F;  2E65 A;  3CD6 A;  1Y96 A;  3UDC A;  1QVG S;  3JCM d;  1VQM A;  3OSV A;  1NPP A;  2P0Q A;  5CR2 A;  3MEA A;  2EIF A;  4C0D C;  4IUQ A;  3RKY A;  5GAN h; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...