2YWWA

Crystal structure of aspartate carbamoyltransferase regulatory chain from methanocaldococcus jannaschii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
141
Chain Sequence
KVKKITNGTVIDHIDAGKALMVFKVLNVPKETSVMIAINVPSKKKGKKDILKIEGIELKKEDVDKISLISPDVTINIIRNGKVVEKLKPQIPDEIEGTLKCTNPNCITNKEKVRGKFKIESKNPLKIRCYYCEKFLNEVIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate carbamoyltransferase regulatory chain
publication title Crystal structure of aspartate carbamoyltransferase regulatory chain from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 31
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
A PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 2ywwA02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 2ywwA01
4KH1B 8AT1B 1RAIB 2AIRB 1TUGB 2ATCB 3AT1B 1R0CB 1XJWB 1RAGB 2H3EB 3D7SB 4FYYB 4KH0B 1RADB 2FZKB 3MPUB 4KGXB 4KGVB 4WTOB 1ZA1B 5AT1B 1RABB 1AT1B 1RAEB 2YWWA 8ATCB 2AT1B 1EZZB 4FYXB 1TU0B 2BE9B 1I5OB 4FYWB 1SKUB 1PG5B 1NBEB 1RAFB 1ZA2B 2HSEB 2QGFB 2IPOB 9ATCB 4KGZB 4F04B 2FZCB 4FYVB 1Q95G 2BE7D 1F1BB 4E2FB 1ACMB 1R0BG 1TTHB 2FZGB 1RAHB 6AT1B 4AMCA 4AT1B 2QG9B 7AT1B 2A0FB 1RAAB 1RACB 1D09B
chains in the Genus database with same CATH superfamily
5KOXA 4JZ3A 2J76E 2FZKB 2E44A 2Z2YB 1I3OB 4LR8A 4OZ0A 1NO8A 2R5MA 2RM4A 3QZ7A 2FHOB 2OELA 5B0EA 2K2VA 2VICA 1B99A 2RU9A 1OYEA 4ZA1A 2MSSA 1AWWA 2JC1A 1EKRA 4IDKA 4WFBQ 2WOMA 1S1TB 1U24A 4DPOA 3SI8A 2UUCJ 2XY5A 2E5JA 2QTXA 5GAMd 4M7DD 1RTHB 4P7VA 3IM8A 2KVIA 7FD1A 3WXMB 3SDEA 1NSPA 3OYYA 3VCDA 1RT6A 1KS2A 1NEBA 2B9EA 3PFEA 4FZVA 4J8OA 4ZVFA 2KVQE 4PFZA 4HI2A 5IT4A 1B07A 2JOYA 3D3CJ 2ZM6J 5IOLA 2X35A 1F2HA 2QZ8A 4ZIWA 3OLAA 1FYNA 3VAFA 2DNPA 1NK4A 3JCMQ 2MPXC 2MJUA 1OY6A 5L1LA 2HHWA 3W8GA 1UUEA 1FWLA 4J9NA 4N8NA 2XMKA 1R89A 4ECQA 3OPKA 4C3KA 3P8BB 2P9GA 3PNIA 3JAME 4F02A 3ZFVA 1WNLA 4X84A 2HNZB 1F6TA 1REVA 1OIAA 4O3OA 5EWFA 2J7KA 2XZTB 3NS7B 4DSEA 2MB0B 1TUWA 3B54A 4FT4A 3MAQA 1WC0A 4LIWA 3OTDA 2OPRB 3MAAB 4LREA 4W98A 4K0KF 3EG0A 3I55S 2LXUA 1R0AA 4M78A 4EMHA 1J5EJ 1U1NA 1SXLA 3C6TB 3U27A 3UE2A 3CB4A 1H98A 1VQSA 1D9AA 3QT5A 4QWDA 3W5ZA 2W10A 3HHLD 2JFKA 3VU3C 1ZPWX 3L2ZA 3NMRA 1RKIA 1RACB 3BPDA 5E33A 3I55A 3H0IA 2P84A 4ERDA 3I56Q 3RAQA 1A0NB 3C94A 1JLAA 1IR2A 1I81A 1I6JA 2KVQG 2IBOA 5CD4H 3I35A 1F5CA 4MJKA 3L2WA 3M8QB 5AJ3F 2MQNA 1Q86C 2R8IA 2HHVA 4Z8AA 1LWEA 2PEBA 3I87A 4XPCA 3LYIA 3QZ8A 1NDPA 1VQNS 4M75F 1FDDA 1WKKA 2C0IA 5FWBA 2VKRA 3E2UA 3VHQA 2GO9A 1VS3A 1YKWA 4NLTA 2VJVA 1N36F 5HBMB 5HQ8A 2QEXS 2PVDB 2RQVA 1FJ7A 3LOUA 3Q8YA 2YH1A 2HQXA 3EUNA 3TZYA 1D1CA 3OB9A 4ID5A 3QYYA 4X66F 1T02A 5I3QA 4IOAQ 1T95A 3OHAA 2YH0A 1REGX 1G3TA 4I2QA 2RRNA 1IGQA 2DE0X 3EM1A 4NLVA 3OYMA 5C7PA 3IXQA 3CJKA 1W2BS 1CKAA 1BXNA 2EK1A 3FCWA 3G1JA 4AFSC 1UL3A 1N6QA 3IAS9 2KYMA 2RHUA 3PYEA 3PX6A 1EQ0A 4DFPA 3K59A 1V76A 5DLQE 2B7BB 2DGQA 1N5QA 3CE8A 1U1RA 2FPHX 2CZ1B 2ZJQQ 4N0AC 2NUPB 5LXYA 3OXGA 2B8QA 2WB1D 1G1XA 1QM9A 2CP7A 3NGUA 4USIA 3U23A 1RADB 1DAXA 3JCMX 1T94A 3V7RA 4C0FA 3A13A 3CMQA 2CNLB 2YNFA 3MEKA 1OU9A 3KLHB 2EFGA 4CLUA 2C0OA 1R7IA 1N5VA 4I0WA 1WHKA 2JLFA 4IRCA 4TVAB 5J39A 2OSQA 4DR5J 2CPFA 2W8KA 2J9EA 3IGVA 4M77B 4F7UG 3OS0A 2RK2A 3JQKA 2DNOA 5KFGA 2RQUA 3QUIA 4DWIA 1NH7A 1WG5A 1WOOA 4OMFB 5B0FA 2N3LA 3HPWA 5D0EA 1VQKT 4LDVA 4DEZA 1SL0A 4MYUA 2F2XA 1R77A 1D9DA 2BX6A 3H40A 2ZPGB 2U2FA 4TXSA 5ITHA 1VIOA 1NK6A 1UMJA 3MM8B 5CKDA 5I42A 1I94J 3S3MA 2CGHA 2IRYA 2UV8G 5DDQC 2XS2A 4WTYA 1IQTA 2CQHA 3LH5A 3KG0A 1UP1A 4Y2MA 4CO0A 2XZDB 4BHQA 2JVOA 3A8EA 4DCOB 5L1IA 1DRZA 4URSA 3BYPA 2W2MP 3MKDA 1HHTP 3BV8A 1I07A 3CPWR 1HNIB 2OX7A 2ZZMA 2AHOB 1WC4A 4USWA 3CJ4A 3P4UB 2XNRA 3G2XA 2JVVA 4YB1P 4P73A 4U9RA 2ADCA 4A4KA 2KFZA 3LWIA 1LW2B 2K7JA 3IC1A 1TUCA 2UUAF 1IN0A 1Y5NB 2MLYA 4CO5A 5C2GA 3GJSB 4J9LA 4FVMA 4DV3J 1SPKA 2K9GA 4Q0BB 2DXBA 5IXUA 1FJCA 3FFIA 1HPZA 1U5SA 3VS7A 1QY7A 4ES3A 3DDIA 4ORZA 3CNQP 5GAOm 1K9MT 1Y96B 1G7CB 4X4TA 1OEBA 1K1ZA 5M2RA 4OJGA 2O9VA 1X9WA 3VKIA 3P8DA 3EFSA 4OMQA 3DOLA 2M02A 3RKXA 1JLEB 4OZ3A 4PJOD 3UFCX 4M75E 4RBTA 2L2PA 1EQMA 3CCST 3PKMA 2XMTA 3POTA 2OSRA 2QG9B 3T19A 3H7HB 5F3TA 2EC0A 2CJXB 3GJTB 5KOWA 4M8LA 3VQSA 4UQTA 3KTQA 3CD6A 3I4HX 4WCEQ 1N32F 4G6VB 5KFXA 1Q4RA 1DQAA 2BABA 3KMSA 1VQ5S 3KG4A 4PXEA 4N4IA 1SQEA 2F8MA 2V8DA 4P10A 1KHCA 1WEXA 3HK2A 4H4OA 2ZZNA 3RZAA 2P8IA 3G71S 3QRPA 3CO9A 1T9UA 3FC9A 1X4GA 4HDGA 3CMAT 1JLFB 1N4LA 4I67A 2XHCA 1UHCA 1Y07A 1IJFB 1F9FA 4FYWB 2BBEA 1CJTA 3PMIA 2RHQB 2OMLA 4R55A 5KYYA 2FGCA 1URNA 4U96A 1WOSA 3HSDA 3OQ5A 1FTRA 5LMNF 3G71A 3I32A 2E9TA 1HMVA 1S77D 1HBNA 5GAMf 5GAOr 1S72Q 1KLMA 1YHQT 3FQKA 3MR6A 4OGEA 1LNXA 2EXUA 4PG4A 5AXNA 2V2KA 1U25A 2KT8A 1O0PA 1T0HA 3K5PA 4ZPDA 2EBPA 4WK3A 1FMKA 3CD7A 3JB9J 1U0HA 5IT9Y 1XIQA 1OPIA 2XY7A 4WZMA 5HVHA 3IBFB 2GGRA 5G0RA 3TUIC 2B5JA 2QA4A 4GO7X 2B9WA 4RBVA 4Q8FA 2OFGX 4JI4J 2LQWA 2KZMA 4J7CA 2B4PA 3R6NA 5D0HA 1KIKA 2BM0A 1Q81T 2EFNA 4AXJA 3BPSP 2FVPA 2M52A 5KCOA 5ETTA 4HR2A 2LTOA 1M90R 1WD6A 5A0LA 5HANA 4A8QA 3W2VA 3RTVA 1Z9QA 4ZMMA 2RDIA 2EW9A 3TR5A 1GNKA 3HSZA 1WI6A 3VZHA 2EFQA 4LSLA 1SHGA 2RJZA 3EMTA 4DHVA 5I21A 4LFBF 3M2RA 5IQQA 2R2UA 5B7WA 2OAUA 4Q8EA 1ROFA 5L9XA 3CCQQ 1BK2A 2DZ9A 3G6ET 3CPFA 4IIMA 3I0RB 1K1QA 3EHQA 2Y9HA 2ZBIA 2DILA 4LN2A 2W24A 1XMQJ 1WTBA 4Z02A 1QE1A 4LF6J 5KFMA 3MEEA 4ZP9A 3ULHA 4QU6A 2VDIA 3HZGA 5DG9A 3HHKA 2LT1A 1EZZB 3AXKA 3MGJA 3Q23A 3RMSA 1IUJA 4L59A 4J37A 1QDUB 3KLFA 4PJOA 2ZH4A 3HJVA 2P4TA 2CH4W 4L3KA 1EETA 1RWNB 4MKBA 3TAMB 1FNXH 4X4OA 3WC0A 1NJXA 2YWWA 1NJIU 4H54A 2HBWA 2CP5A 5K9FA 5EHHA 1VIEA 1LWCA 2RNAA 2LDMA 1FXDA 1KG1A 4X64J 2RQCA 2DNNA 2GVZB 3SQGA 3PTWA 4CH7A 5GAOq 5ETQA 1NJIC 3Q22A 1BIBA 4YB6A 4KSEB 2A36A 3U02A 2IPOB 4GBQA 3OYHA 3I5AA 3CIMA 3MEDA 3V7SA 4ZVHA 2NSBA 4MH8A 4KB7A 4YY3J 1KRPA 1FNOA 3VS5A 4A8MP 4E7KA 3IWNC 2V8JA 1HJDA 2AX1A 3IWLA 3KLEB 3H6ZA 5LOQA 2W9BB 2VBZA 1YJWT 1R8BA 3MF5A 4DG1B 3P49B 4UUXA 3QO9B 1UVIA 2AGPA 4DPYA 4WWSA 1TK5A 2XI2A 1Y10A 3BKTA 1VQPT 1PAEX 2D74B 5T7LB 1QVGP 3FRZA 1RHKB 2DNLA 4M7AD 4NPOA 1VDHA 2FD2A 1SPBP 2C1EB 4DSIA 5DM6Q 3OL9A 2CPEA 2BTTA 2C2MB 3DU5A 4DBRA 3DYAA 2JX2A 1NYFA 1RXOB 4TVRA 4GO5X 4WTOB 2ZH7A 4QT7A 3KDOA 2FJEB 3EICA 1VYTA 3EH2A 3SHWA 1S6OA 4ED6A 4PQUB 1W4SA 4CM0A 1X2KA 2QI2A 3GZ7A 4TY9A 2OPPA 3NEKA 4KBMB 1WZOA 4J90A 2CPZA 5T41A 4V19X 2XY6A 2JJ9A 1TR0A 3LGMA 3MMCB 2QGFB 4YFUA 4ZHRA 3FRNA 2K2MA 1IWGA 1MWZA 4KGKA 1BKBA 1D9FA 4E7JA 4C92D 2VKNA 1WNEA 1H2TZ 3KXTA 2UZAA 3CDUA 5B0CA 2XHWA 3OYAA 1AOJA 2DR6A 3N6MA 2ROTA 5MLCV 2DGUA 4I1TA 3BN7A 4LDXA 5KYUB 4WE1A 4RTZA 2D0QB 4HH0A 5FU6C 3MCSA 4JJBA 1U8WA 4YDXA 2I2LA 2W7PA 1PILA 5HLFA 1SC4B 1VJWA 3OBIA 2E41A 3PRVA 1IJEB 4QW9A 4W4MA 3OL8A 5EWEA 4QOTA 1W1FA 1TMJA 2B4OA 4IOBA 4JV2A 4I7FA 2KYZA 1X6OA 2W0ZA 3D5MA 1SSHA 1L5UA 3RERA 2KEAA 4NEYA 1WDXA 1GMVA 3H5YA 3BGOP 5HMXA 2HFSA 3VAJA 3RIRA 3UVJB 5C42A 3D2WA 4UY8T 3SEMA 4PXCA 4OI0A 3HFNA 3E01A 2AKLA 3NNAA 1WHVA 1Y5LB 2G1HA 4ED0A 2CFXA 5THWA 4Y91A 1HNXF 3HVTB 1TK0A 3AA9A 4O4GA 4Y92A 4BD3A 1WSVA 2DY9A 2ZOMA 4CO2A 3MHYA 1PSFA 1JB0E 1OPZA 3I55Q 2XZWA 2ZVIA 3IRXB 1M2VB 1BMQB 2V2QA 1PCXA 1VRTA 8RUCA 4K4VA 1KQGB 3DXSX 2NYSA 3FJPA 2QLXA 2GIFA 1S1UA 4EMKC 2C3PA 2I0NA 1GH8A 4M5JA 3OS5A 3SEOA 3LP1B 2HHHF 4UQGA 3MUVP 2DBMA 2R4FA 2WAQD 1YBYA 5GVQA 2GFUA 2HLUA 2HD0A 3I4PA 2MSTA 3UDCA 2ZITA 2DRKA 3S3OA 4NZ0A 5FLXE 2EG1A 2ZH2A 1ITPA 3CCRT 1SQFA 4V19J 2WBMA 1S1WA 3A3OB 1VQOS 4NLSA 4JRKA 1U1SA 1HFEL 3BBFA 4F14A 1JJ2S 1WHYA 2MQLA 3C6UB 3GG0A 1VQ4T 2RHIA 4M5DA 3NGPA 2D69A 1UVLA 3OYIA 2CPXA 1QWFA 2DL4A 3MM5A 3MM9B 4NLPA 1VQOA 4JV0A 2MJNA 4JI6F 5LMUF 2BXJA 4JV1A 4IH6A 4E6RA 5H9EJ 3CDWA 3KNAA 1QVFA 1SV5A 2B8AA 1JJ2A 4LD9K 2YNIB 1QVGA 4LD6A 1O9SA 1N8RR 2YUPA 3G96A 1TZ0A 3SV4A 1WI8A 3ET6B 4USKA 2E7XA 5GANg 4C92A 2RI3A 1SH2A 5DO2A 2B86A 1U3OA 2VPWB 3SMZA 2L3QA 3OVBA 2N7YA 3J80E 1CSJA 4KHPF 4OGCA 3HI9A 3KDNA 4DUZF 2KFYA 3H2VE 5IXFA 2YUNA 3UN5A 3ME9A 1XMBA 2HKEA 2MIOA 4U6PA 1QLNA 2VGMA 2PC6A 2RB6A 1M3AA 2HFZA 4PJOF 4H4MB 1TK8A 5BXIA 1M90C 2NLUA 4LVOP 4F25A 2VB6A 5DDOC 4YR3A 1IR1A 3BKFA 2CXEA 4LFCJ 1VJQA 4ECVA 3TSZA 3C15A 2HS0A 2PU9B 4IG0B 3L7PA 3UPUA 3AQOA 2DTIA 2FVSA 4PEOA 4M77F 3VS3A 1WC1A 4BC9A 2GMLA 3M9MB 1QSLA 2VH7A 4F16A 4P52A 1TKXB 1R6VA 3MEGB 1ZETA 4DQ2A 4DV5F 5F9NA 1GXLA 4DV1J 1T3OA 1OU8A 4XTUA 4CNYA 2RE1A 4EMDA 3P3DA 1VQ8T 2RDJA 2XS7A 2ZBQA 4UTGA 2LP4A 2NR0A 2W9AA 4ANEA 5A8RA 4PR6A 2KE9A 4KYZA 3UR0A 2MHNA 2HGNA 5J26A 3D9BA 3LPYA 4GLKA 2LJ0A 1VRUA 2CJYB 3B4MA 2FUG9 4NLQA 4C0ZA 5KFAA 3M9OB 5DM7Q 1KFDA 3ZTOA 2A37A 4HVUA 4DX6A 2BEFA 4RW8A 2PUOB 2ZHBA 2VC8A 1FJEB 2EI5A 1YJ7A 3S01A 3TA1A 2QN6B 1U4BA 3FMWA 5J1EB 2FY8A 3BW1A 2Q1LA 2A28A 2ZNZA 2G4BA 3HT0A 2QFIA 3PW2A 2V69A 1N9RA 5FU6B 5LJ5Y 1LWFB 2VBWA 4OI3A 1UZHA 4LQ9A 4DSLA 1WXTA 4P6QA 2YXYA 3BGRB 3UD4P 2LX9A 3FZ2A 2RKIB 4E2FB 2VXFA 3MMBB 4ES2A 3NCRA 1HBUB 5IS2A 5CYQA 3BFMA 2EFVA 3OTBA 2RVJA 3UD5A 2F5KA 1CS4A 1GX5A 4RW9B 1DLOA 1QJHA 4JI1F 2GFAA 2GCFA 1AWJA 3J80Y 3MZIA 4ATNA 2J0SD 3RW7A 3GP8A 1HWLA 1SJ1A 1UEKA 2OLWA 2C0TA 1S0VA 4CC4B 2BKNA 4C5IA 2F4VF 2CJ9A 2YKMB 4C8QC 1GXIE 2MOXA 1E6YB 5KFPA 2MY8A 3U1MA 1QCFA 2R9LA 1F60B 2DY1A 2MMPA 2RAQA 3D6FB 4LQ3A 3D1HA 1VQLS 2BQUA 4OI2A 2GJIA 3CD6Q 2JZ5A 5AYFA 4LRBA 4OLPA 1BQMB 5E2QA 1PO6A 4A46A 5I2SA 4QW8A 2YNGA 4L6V5 3DGPA 4OMOA 3M6XA 4B3MF 1NDKA 3UCZP 5KFDA 4EMKB 3C12A 5CQXA 1AWOA 5KFBA 4BI8B 3P96A 1TL3A 3MR5A 5AE3A 2EJGA 1D1AA 5LJ5j 4TU8A 2R2SA 2NUUG 4HACA 1VQ5Q 2ZDPA 2X4WA 1SSFA 4E7ZA 4DOZA 1FRKA 1TG0A 4C98A 4QIEA 5GAOp 2KYBA 3CIZA 3G71Q 2GGPB 4DEYA 3GFYA 1S6PA 2F5TX 3G4ST 4C9DA 3M2UB 1KQFB 2LP5A 1D09B 2EKNA 2WSEC 5E3RA 2X1GA 2ZCFB 4J5OA 1VQKS 4OI4A 2K8GA 4KUDK 3TU4K 3GLXA 4MMOA 4PJOE 2LYVA 4JYAF 3H5UA 5KCHA 2QA4G 5GAMe 1FO1A 2FJWA 2V1QA 2HFOA 3K0JA 1VQ6A 3EXCX 3F0NA 4F4WA 2QA4Q 3PY8A 3MD1A 5GAN3 3MOZA 4CIOA 3DRXA 2VQEJ 3UATA 5J3BA 4J9OA 3OSVA 1WORA 1K8AR 2IM1A 4GVBB 1SEMA 4DL4A 1UJ5A 1Q7YU 4M77E 3MURP 2CQPA 3VAGA 4PXBA 3RB3A 3SBMA 1U09A 2QV6A 4KGMA 3NTHA 1XR6A 3R6GB 1NH8A 1IZ6A 2WVDA 3R5JB 1J2VA 2L3MA 1YDLA 1ZBJA 3N79A 5I3PA 5HSPA 3ISZA 4DPTA 5B0DA 3J81Y 4IG3A 4RNHA 4WFYA 2YX4A 1J5OB 1SUQB 1TV6B 4B9TA 1VQ7S 3MUTP 4Q5VA 3IMQJ 4KHRA 4FXVA 1EIYB 2AT1B 3M30B 2AJQA 1G8XA 3QWYA 2L9DA 3C4SA 3G6YA 3DFEA 4DV2F 4UOCA 2J7WA 3AOCA 3RKWA 2CT4A 1QAJA 2QX0A 5IC4B 3HLUA 2G0CA 3HSBA 2VGNA 2W2QP 1Q0NA 3GNFB 4PJOG 1S6QA 2GAHC 2ZFHA 4J6XA 5A6WA 3H9NA 1IHVA 5HROA 4BCAA 5GMEA 4CO4A 5BJRA 1VC6A 5KFVA 3GSDA 2GTOA 1Q7LB 2W9CB 2HNYA 1OO0B 1KR4A 1ZX6A 4IKAA 2ZD1B 1SJ3P 1GL5A 4DOWA 1GX6A 3HKZD 4NCGA 2E65A 2DNHA 3M8WA 4ESRA 2WVBA 1HNVA 3LGHA 1M1KT 5K14A 2GHPA 3EG2A 2B9YA 3MHXA 2FQQB 4TKTA 1MNDA 4OYZA 3QT8A 5KYWA 1FJGJ 3TP2A 4Q2LA 3N9UC 2CZ9A 4F04B 3RBEA 1J3TA 1YJNA 3JCMc 1N8RC 3J81j 1NK5A 3W62A 1BE4A 4KT0C 4B3SF 1HD1A 1FVQA 3B4DA 1MROA 2FL7A 4CYUB 3T6JA 2Q6CA 2RA2A 4EPCA 3VS6A 1F0XA 1NJIT 1VLYA 3MEAA 1GMWD 4CTAB 5L8RE 2I1RA 2KRMA 2DEIA 5HMYA 2Y4XA 5D6YA 3MCAB 2JM9A 4ECYA 4XAKA 2RPNA 4I2PA 1TKTA 2GVDB 2CYYA 4K59A 2H3JA 4ICLA 2YWEA 4OYXA 2FVQA 1PWTA 4ZVUB 1UGVA 4LRFA 5SZTA 3V5RA 2W25A 4JS5A 2COZA 3NBPB 1RT3A 1GFDA 3QPIA 3PO4A 2KZZA 3R5CA 2FLLA 1K0TA 4Z37A 3CC4A 1RTHA 4LDUA 3VYHB 3EVMA 5DS7A 4C8QB 2A2CA 2OEJA 4B02A 2RJCA 3QZ5B 3QPHA 2R7SA 3H20A 1TKZA 1WJSA 1SJFA 4QCLA 4GKKJ 1N33J 3TANA 4B9LA 2AW0A 2ZNYA 3U1NA 2H5EA 5F9LA 4NRUA 1NE8A 3UI3A 2DETA 3AT1B 1HHQA 2KL8A 2BKPA 4HT5A 2EQUA 2C2OB 1I51B 1P9QC 2VL1A 4G1QA 4CI0C 3KLGA 1WDTA 3EHRA 2VFSA 5GAMh 1VBXA 1N48A 1M8VA 3H0PA 4DDFA 1V29B 2E1AA 1RHJB 1X4DA 4J9IA 4NYOA 3G6ES 3W63A 2P0KA 2QL9B 2EKHA 3T5LA 4KC5A 5EGYA 3GJRB 5J2MA 1YIJS 1RLCL 1IXKA 4BACA 1RDRA 2C2KB 2DCUB 3R7SB 3V6JA 1DHMA 4DR7J 1S9GA 1KBRA 1KTVA 2V8IA 1RB0A 4LUBA 2ZJRQ 1NLOC 4DU8A 4C11B 4ZVQB 2X4YA 2MZQA 1SHFA 2ZUGA 4JBCA 1H72C 4M5IA 2E3HA 4IUVA 3MM7A 2CQ4A 3PE0A 1N52B 4DCJB 1S10A 3UA6A 2DX1A 1HNWF 4FW1A 1WYXA 2Y1JA 2PMHA 3QG1A 3CC4T 1KTQA 4DX5A 3ETMA 1RT7B 2LQ5A 3IN5A 5HP1B 2AEJA 1W7WA 2ZKTA 1B7TA 2DERA 1N9SA 3BGLA 2ZBRA 4KRTA 2LQJA 3OW2R 2H5JB 1OY9A 1BQXA 1NHUA 2OPQB 2CDQA 4DU7A 2JEFA 2DXCA 2EW3A 1K44A 1YBAA 2PZ1A 5LM7E 4B3OB 2FB7A 2Q43A 1UB4A 1SH0A 1ZOTA 2AK5A 4N4GA 4I6AA 1GMWA 4LNPA 2QSFA 2VG5B 3QO3A 2YNHA 1KQSR 3RKYA 1XTDA 2FYXA 4CT9A 5DETA 3J7ZT 3MWBA 3W3SA 3P8HA 2LJ1A 1B34B 4HVWA 3CC7T 1VQPS 4JI5J 3DMJB 1K1SA 2ASYA 3ZZPA 1KQ2A 2RMLA 3ZXWA 3PIOA 4NLWA 3M0RA 2RI2A 1PIEA 3QATA 2HGMA 2BA9A 3MMAB 1YN8A 2E7WA 4Q43A 2ZOGA 1FXXA 4FYVB 3PEHA 2XB2D 5KFEA 3HHEA 3M6UA 1FT8A 5IWAF 6AT1B 1WF1A 1IBMF 1TL7B 1JNRB 3EX7B 1V3SA 4RWWA 3D1QA 3JYTA 4MMLA 5AXLA 2RUSA 1TELA 4OMLA 2RF2B 3OR1B 1VQOQ 3F70A 3O3LA 4E0DA 4A4HA 3GNGA 1ZPVA 3I31A 3AXMA 3K17A 1BI2A 2HIYA 1YI2S 3DN9A 3F41A 3KUGA 4NA3A 1U6ZA 2JM8A 2X51A 1WLPB 4DV6F 1KSWA 4PJLA 2L9NA 3CCJT 2CWKA 1M3BA 5FWCA 1JKHB 2Z57B 5GMDA 1WIEA 4LSNA 1KOOA 2QMWA 3CXCP 4K4YA 4N41A 3V81B 5DQIA 1K8AC 4EU0A 1Z2ZA 4TNOA 3GILA 4HA8A 3KUEA 4XIUA 4PJMA 1FD8A 4C97A 1WHMA 1KC8U 3IBCB 2C2EA 3EG9B 1MMNA 3BH6B 2OTLT 3ICLA 3TEHB 1TMMA 4DV0J 4ZNXA 2XGPA 4RTXA 5IN1A 2KY9A 1IREB 3OFFA 2ZBPA 3MM8A 3BSNA 2RSQA 3L2RA 2HQCA 3BZQA 1OPKA 2KDOA 2K6DA 3TYTA 3GV7B 2HSPA 1HI0P 2I38A 2YX1A 3PNWC 5IT9U 4DR6F 2Y1IA 2D9TA 3W9HA 3QJJA 1UCNA 4PFOA 1HNIA 2YKOA 3JCMg 4ETXA 1JJ4A 3DHXA 1GCQA 4LFAF 1C0UB 1WF0A 4LVNP 4OYOA 1E6VA 5BR8F 4QQGA 3EZUA 4CI0B 2OI3A 1Q8KA 3CD0A 2BJ3A 4WPAA 3J7A1 2VUGA 2AKWB 2ZPIB 3JCMP 3UDLA 2E29A 3ZZRA 3O6QA 4MFBA 1UJ0A 2ECZA 2LQNA 3ZBDA 5KFRA 4K8RA 2ZH3A 2D8HA 3OYDA 1KWMA 1K0VA 4A4JA 2DT9A 3DDKA 3WVEB 1U49A 2A1BA 2LDIA 1E6HA 3K7RA 2P5VA 3VWSA 1RHMB 2HVEA 3CCLT 1LFPA 1Y57A 4J7FA 3D0HE 3FRYA 3VGUA 2RNEA 1S1XB 1RWMB 3FSYA 5KG2A 3SYZA 2JSXA 2FPDA 1VQ4S 4K4XA 2W7AA 4X62F 1RAJA 2V67A 2J0QD 4BDZA 2CPDA 2PN6A 3Q8VA 2FB0A 1M3CA 4DJBA 4DL5A 3QLHA 1RK8A 2OI2A 3FBBA 2R2TA 3CCVT 1UFKA 3FCHA 1RAHB 4YOEA 5CCLA 1DTTB 2HQDA 5J2NA 3H41A 1RAAB 1X43A 1QW1A 4K0KJ 4O6JA 4LXCA 3QWPA 1L3SA 2CNNB 3VGVA 3RDVA 2M0GB 1FRLA 3SCLE 1L3UA 4O23A 3VAMA 4IFYA 1NJWA 1D8ZA 2HIQA 4JRIA 4ER8A 4LUDA 4JI2J 1SJRA 2MAMA 1K9MR 1F9HA 1NPKA 3E51A 2OHDA 1QUVA 1OX8A 1VQLQ 1FKPA 4KH0B 4ZJQA 4ZP8A 2GQ2A 2XBPA 3LX7A 2BUNA 2CYZB 3HRTA 2HRUA 5CO7A 3OYLA 2CPIA 3SFMA 3JSMB 3EVOA 4K4ZA 4ZPWR 4PJNA 1RWUA 1O6XA 1BUXA 2VFTA 1OQ3A 2C2DA 3GV5B 3TCJA 4RNFA 3TUJC 4LJMA 4U7UK 1YJTA 4OX9F 2DB1A 4F7UB 3NMAA 2LQBA 4KKOB 5L38A 2JL9A 3JB9D 2F69A 3UPFA 3OLBA 3FKBA 3CXCA 4BWMA 3HSGA 1NK0A 5LJ3f 3FK4A 1MU2B 2YHTA 2NXCA 4ME7A 1QLYA 1YJVA 2VUBA 1U26A 1ZS6A 4OB1B 4LE9A 3PDNA 1VQ8S 4DN0A 2BQRA 1VQ6Q 2IBKA 1YQHA 3ENAA 2VG7A 3ENQA 3J7Z5 2LXIA 1NG2A 1TUVA 2LRQA 3JXOA 4JI3F 2MZRA 2BJDA 1M5SA 3MFHA 2IMWP 2GV1A 2IAJA 1IQZA 3BDEA 3D54A 2WHOA 1AVZC 1NB2A 3D66A 3N6NA 2DAQA 5GAHI 2MLZA 3QRQA 2OTJS 2GTJA 1R0BG 1FWZA 3ETOA 1GTEA 4UOHA 5HL7Q 4KO0A 4ES1A 4FF2A 1QCNA 3B78A 1P8GA 3VAKA 1Z9ZA 1RU1A 3EXYA 3R27A 2E5HA 2V8PA 4RG2A 4EMGA 2HZAA 5KYXA 5DGBA 1AZSB 1NHVA 4NE9C 4NA2A 4WYLA 3FDSA 5L1KA 3D7SB 3TUZC 2BZ2A 2EJ9A 4L74A 1OZ3A 2UUCF 1WELA 1Q81R 2DIVA 1PYSB 1HR0J 1Q7YT 3OXLA 2HVZA 1VQ7Q 1IKXA 1DJ7B 4IIOA 3IRWP 2KXDA 1T03B 1UVKA 2ZWOA 2PMWA 2PO4A 3PR5B 1EX8A 1B3QA 4OJ3A 4OMMA 2LU1A 2MKIA 4YTLA 1U2FA 2ZM6F 3PX4A 1UEBA 1NB7A 3EFOB 3QWUA 2VC0A 1QP3A 3HO1A 3C8YA 3ZNJ1 1C0TB 4ZPTR 1YCYA 4OJHA 3FB9A 2CVEA 3OYGA 1KQ1A 1IHWA 2FHMA 2HZVA 1LEOA 1U06A 5E3QA 3A8IA 1WACA 1FNMA 4FSSA 3AODA 2K79A 5IM0A 5LJ3g 2C2RA 1VMBA 1AD5A 4CNZA 3H4BA 3ENVA 1XQIA 1TQLA 2EPIA 4IUFA 1K73U 4LF9F 4USHA 3FBCA 5KG5A 2FHJA 3R9LA 3S1TA 4DL3A 4F4XA 5EDWA 3NS6A 3HDSA 4RUAA 3FJ2A 4NXMJ 4F8RA 2CJAA 5KFWA 1QSYA 3CBPA 1YJNQ 2Z0GA 3D6MB 4Z89A 2CKKA 2HNDA 5D0RA 4RR5A 1QUPA 4UW2A 5CKEA 2QL5B 3QT6A 2KAFA 3TI0A 1FHTA 2DIUA 5KG1A 3OY9A 3DRYA 1Q1KA 4F3QA 2J0WA 5BYRA 2CZ7B 3ZZYA 3G8SA 2UP1A 1TL4A 5FRMA 4O44B 4PAAA 2FIUA 2UXDF 1NUEA 4MAKA 4WIQA 4CC3A 3GSIA 2ZAEA 4HHUA 4QWBA 3A3NB 5D6WA 4QVZA 3HP6A 1RBOB 4YUDA 3I82A 4OYWA 3BM7A 3CC4Q 3KK1A 1K4US 1JLBA 2MKCA 5L46A 2GC8A 1UEVA 3MOJB 2PSZA 2UUBJ 2MHEA 3UCGA 2XLIA 4DSKA 4X4PA 2LKZA 2KT5A 2IHR1 1VQMS 4X4VA 3CCMS 1RAEB 1JRIA 2LJ3A 2DYIA 2KK4A 5F8JA 1WPYA 2F5GA 1RT1B 2E5KA 1S9FA 5F8HA 2DXDA 4RTUA 3UF4A 4EO6A 2XDDA 3EGWB 2H5IB 4NS5A 2UVUA 1BCOA 2EFOA 4XTTA 2YKNA 4QIGA 3FDRA 4RNMA 4CLTA 2R3VA 2E4HA 4DUYF 1TL1B 4ENOA 3N01A 3M4XA 4QVCA 4EZ9A 2DL3A 5DZ6A 2RQMA 4I68A 1KVIA 4J9QA 2AZVA 4X4RA 4YHHJ 3K5NA 2JUFA 3BDUA 1PD0A 2IM3A 2YTCA 3GFHA 3OSPA 5IHNA 1RI9A 1YIJQ 3H2LA 1T0TV 2FLNA 2E9RX 8ATCB 1YFNA 2XG8D 4IUUA 2FJVA 5H9FK 3CEDA 1RYRA 2OJ2A 2D3O1 3FBFA 4JLIA 2IC3A 1JB0C 3LP0A 2QRRA 4ZPVR 4YS2A 2VU5A 3N0VA 2ACMA 3SWNA 2EAYA 1S1VB 2A3JA 2D41A 2ZUAA 3C3LA 4GRSA 1R27B 5KFOA 1KDNA 2M88A 3PR4A 2YXLA 4G1PA 3LANA 4PWDB 1GTHA 5KFHA 1HL6A 2GJFA 2QQ9A 1ZM9A 4J9KA 2EQMA 2DL5A 3HULA 4DV4J 3ULRB 1I94F 3NS5A 2ASJA 3D1OA 1M1GA 4Y3CA 2XGQA 4LFBJ 1WQ7A 3JCMb 5FJ4A 2NSCA 3WIUA 4LRDA 1C1BB 2DNMA 3MM9A 2EYWA 2NUTB 1K9MC 3AJ2A 1YRUA 3IG1A 4NRTA 1BB9A 4OV1A 1RBAA 1OYDA 2G2ZA 3PIOQ 2ZH6A 5JVHQ 1X2QA 2XMJA 2F40A 2XU8A 5EWGA 1I1GA 3HRSA 1JLCB 2KJVA 5A6PA 4TU7A 4NI2A 1JX4A 4A63B 4RW7B 1OPLA 1QD1A 2VQFJ 4ECXA 1P1TA 2ZKUA 1RYSA 3J80U 4U7CA 2V9WA 2CSIA 1YITA 1D0YA 1X4HA 3IO1A 1Q79A 2WOMB 4F4AA 4DV3F 1RLQC 2CDTA 3BY7A 3NXZA 3EGDA 4NL5A 3OUYA 4X2BA 1N0UA 4E47A 3MEUA 5D3GB 2POKA 1CVJA 3W64A 3SDEB 3SV3A 5J2PA 4PUOB 1WG4A 3UR3C 4LUEA 4JLGA 2ZZTA 3TAQA 4OJ1A 2DVIA 1EJ7L 3PVQA 3CCUA 2FJAB 4IURA 1URRA 3DLGA 1YI2Q 2PIIA 3JB9I 3N5BB 1QSSA 3M0SA 1TKXA 2FVUA 3BGUA 2GZOA 2NUHA 5ETLA 1H74A 1S79A 4D3HA 3KOAA 2QYZA 3J7YI 3SCKE 1BU1A 3CCZA 3IA0A 2KXFA 2MKKA 2BDPA 5HY6A 4B3TJ 2P9EA 4UT4A 1XERA 4I69A 4O3PA 2XICA 1REVB 1VFJA 1X27A 2F7VA 3R97A 2XG8A 5F8MA 3BE3A 1Q82U 4ZP7A 2I5JA 2GS8A 2HBPA 5IFMA 1IKWA 4C5GA 3JQJA 4O3QA 2HFNA 3CGIA 3KHHA 1UECA 3GR0A 2HSEB 1R0AB 2B6AA 2XYPB 4LIRA 1X31C 3O5TB 4NLYA 3JSBA 4KV8A 3OSNA 1HNZJ 3KJQB 1Q81C 4C8MA 4CWBA 3KLIB 3TX8A 4KJIA 2R42A 1PRMC 1ZM4A 2CAJA 5HATA 3CPWS 3QDRB 1KC8T 4E7SA 1CBKA 1VK3A 2VBXA 3RR8A 2RJEA 1KKHA 3MR3A 2YRVA 2ZHAA 2JRSA 4DI6A 1Q53A 4NMXA 3IQLA 1JLAB 3VR1A 5CA5A 2YRCA 2QTWA 1ICEB 1I8FA 4FKXA 4PNOA 2HAXA 1C4CA 2MKSA 2D9OA 3L95X 1CG2A 3B82A 5IV3A 3CDEA 1LWEB 4Q2MA 1MW7A 2M9UA 2QK0A 2YDLA 3V4MA 3U1LA 3J81U 2DD4A 1SC6A 2AQ4A 1JQQA 2WK4A 4CRIA 3GJQB 3HFKA 3UA7A 3O8VA 4JP8A 4IO9Q 1WOPA 3AH6A 4GKJJ 4OZ2A 3LH0A 3C16A 2NCKL 5HMZA 4DR1J 4WXWA 1QVFR 4O3NA 2IIHA 2D0NA 4ID5B 4CO3A 1QVGR 2JDJA 4K4TA 3FVYA 5GMKm 3GYNA 4OI1A 2G0IA 4FF1A 5CYMA 2CA9A 4DF8A 4I2QB 3PJ9A 3CJKB 5RUBA 2AYMA 1VBZA 3RUBL 2DJWA 3FEZA 5CKHA 1N6QB 4N4HA 4KE5A 4EMKA 1S72T 1Q5VA 3OTOF 2MKHA 4FDFA 5LJ5f 2QT7A 2KT2A 4O5VA 4LF6F 1IM4A 2QTVA 3BEGB 2JC0A 5J2QA 4JRPA 3LGNA 3IBWA 2EYZA 2AGQA 3TZXA 4F26A 1Y7XA 1WFWA 2EJFA 3CJ3A 2GF7A 2QA2A 5B08A 2VG6B 4HHJA 2VWFA 3R3TA 4RKUC 6FD1A 3FGVA 4ELUA 2YWKA 1M9SA 2ERRA 2CP2A 2WACA 2KN4A 1HARA 2KHDA 5B0BA 3AA8A 1BI0A 1YP5A 3R5GA 4J6YA 3LAMA 3QIDA 2YNFB 4R56A 3IAM9 1XR7A 4BE2A 1FA0A 1R8AA 3T1YJ 3T1AA 2J6SA 5K5MA 4BE0A 2CRLA 2IVFB 2HHXA 3I0SA 5KFYA 2OTLS 3FJ5A 1RE1B 2J9CA 4WXOA 4F4ZA 2YKQA 2PA8D 3LALA 4K4SA 2RDDA 4B17A 2XDBA 3CCES 2HHHJ 4F7UF 5DRKA 2IVWA 3KFVA 3SZ2A 4BI3A 3PKYA 4XU2A 3H0HA 5AXMA 1OULA 2O01C 2MZ1A 4GVBA 1TOVA 4FVCA 4N76A 2E3IA 2VYTA 4U8VA 3CULA 3CCQT 4PJOC 4QW2A 1B4SA 4P7TA 4CH1A 4RNOA 3K5MA 2GW8A 3KYLA 1SH3A 5KT2A 1XMOF 1KHVA 1BHNA 2K57A 2DNYA 3CCEA 2HQIA 2ASDA 2VPYB 3TOQA 1YJ9S 3M53A 2DO3A 1XNRJ 2W2OP 3FNNA 2UUTA 1FERA 4C8OA 1TP7A 4GC7A 3W66A 1YNZA 4DL7A 1FWPA 1GXTA 1QTMA 1RLPC 2ZWPA 2R57A 3BREA 1ZZFA 2G0JA 3OV7A 3CBMA 4PG5A 4QIFA 5CAAA 1X0PA 1SUQA 3W9JA 3RRGA 3FEYB 2K3BA 4X34A 4B9WA 2K1RA 1OYXA 3M30A 4XTZA 1FKAF 2MQQA 3BDLA 3GPLA 1NRKA 3Q8PB 5LJ5g 3UD3P 3S6EA 2KG0A 1VRQC 3QGPA 2J6TA 3D0GE 4ILMA 1S12A 1HKAA 2DEQA 1IKVA 4ED2A 4FNHA 2EGAA 2FO0A 1FE0A 1DBDA 2OTJQ 2HKNA 4USTA 3UN2A 3M2VA 3PTAA 3CO0P 2WONB 2D9PA 4NLGA 4PJJA 2K4YA 2MWOA 2F9JA 4JRQA 1H2VZ 1FX7A 4DA4A 1HPZB 3FFIB 4QWCA 3NGKA 4D8KA 1YWPA 1FCAA 2CH4A 3ADAC 2EFPA 4FYYB 4ED8A 3RBBB 4J9FA 4HEA9 2R7WA 3DOLB 2Y1LB 1SL1A 3TRGA 2QO3A 4X9DA 2DHHA 4WF2A 2D6FA 4DZDA 4AYBD 2AIRB 3P6YC 1MLAA 3CUNA 3POTB 4M1KA 1JJCB 4GC6A 3CCVS 3CEYA 4K5RA 5CZVA 3GB0A 3I5RA 3FC3A 5DLGA 1SI9A 3BBCA 2RRAA 3J7AN 4CTAA 4H4OB 3QGIA 2AZ3A 1O8BA 2AKKA 4OYAA 2HHTA 2VA3A 4PQAA 2HURA 1RWVB 1CULA 2C2NA 2RQ4A 2HK2A 3GE9A 2KDSA 5L8RC 2DNQA 4XTYA 5KYYB 2BOAA 1U6BA 2IMOA 3MCMA 4P2SA 1HMVB 7FDRA 3DLEA 2R5AA 2COLA 1HBNB 1KLMB 2F8HA 3JB9G 2HHUA 2QMUB 3SD4A 3NCQA 1VI7A 4JUZA 3GYGA 2GQQA 1SRLA 5GAMj 4EYIB 1M1KR 1IBLJ 1VA7A 1U1TA 2HW3A 1U0HB 4JZ4A 5G0RB 1K73T 2B5JB 2R7OA 3MUMP 4X4QA 1OSCA 1SKRA 2DGVA 1KD1U 5F41A 1RTZA 3ZEHA 3FUYA 4CT8A 1VQNA 2PDAA 1V5VA 3F44A 4G3IA 1QWEA 2RJFA 4JI1J 4L73A 1NPPA 4BBYA 2VODA 2EEYA 2CT3A 1CJVA 3JSCA 4F7UE 1NJIR 4ZGJB 4HI1A 1RCOB 3NOCA 5GADI 1FKOB 1KD1C 3W2VB 2F4VJ 2QEXA 1PC4A 2P4RA 2RHZA 4A47A 4DUTA 3KUFA 4LSLB 2HFVA 4JI8F 1M5Q1 3FMBA 1RCXB 1PCAA 2VFVA 4QQ6A 3M2RB 1Y7PA 1Y5IB 2DXEA 1RWXB 4RBUA 1VQMQ 1OWXA 4M7DA 3CCMQ 3PEJA 3WBZA 2D3UA 4PK4A 1HA1A 1DARA 5HO4A 4HT9A 1NZ9A 1W2BA 1RT4B 2EYQA 4B3MJ 4QIWD 1B0TA 1FMVA 2K7KA 4NL3A 3KK2A 3CMES 1QE1B 1PC5A 1HHSA 3MEEB 3I55T 5D4NA 2QQBA 3EDQB 1VYUA 2ED1A 4F50A 3PO5A 4LSZB 2CPHA 2RQWA 4PJOB 5GMKj 4OZ1A 5HP1A 2D3ZA 3EGXA 4RZRA 5D7UA 2CPYA 4KY3A 3KJNB 4Y65A 2ESWA 2A18A 1ZH5A 5D4PA 4ZVGA 2L5QA 1YRTA 1LWCB 5T14A 2BRLA 4LFCF 3M55A 4JI0F 1HQUA 3MPVA 2CP0A 5C6SA 1A7GE 1OQ6A 2EYXA 2W01A 1Q95G 3SCJE 1X6BA 2DITA 2DVEA 2UVRA 2BZXA 4K5SA 4NZ7A 3GG1A 1RU2A 4P2XA 3MEDB 1U1KA 3H0FA 3HHLA 3QAEA 4MYTA 3AD8C 2JXBA 2L0AA 3DMJA 1VHFA 4DV1F 3DI6B 2IRUA 3IP0A 4MZTA 1P1LA 1EKSA 2DR9A 3EGUA 4DR3J 1X4FA 1WXBA 2YBVA 2C3UA 4PPDA 1CLFA 3MP1A 2IDLA 3GR1A 5IT9E 1AT1B 2FC9A 4AG1C 2QIFA 3DOMA 2J8SA 1OJ4A 1VYVA 2HS4A 3RW6A 4IR1A 2ZH5A 3DRPA 2MDAA 1RWPB 3MECB 4LF7J 2CQCA 4OVAA 3DYAB 5C24A 4NXNJ 4LR7A 3WIVA 4DV2J 2HMIA 4OQJA 4NLRA 1WTFA 3GCWP 1AXQA 1WHLA 2X7IA 4ZVTB 3G8QA 1CC8A 5F8GA 4DSFA 1NKBA 4QIVA 3LP2B 2DRDA 1D1UA 1ZM2A 2OPPB 1TFWA 1RUWA 2YY3A 2J6FA 5GAGI 1YITQ 5A2QY 5HK4A 3HJFA 5A0YA 2VJUA 1MWYA 1L3VA 1T9TA 3AJ1A 3DXBA 2L3PA 4QPXA 4HHHA 1RTDA 5B0GA 1I5LA 1V1CA 1QKXA 2VKZG 4ANDA 3CCUQ 1UPMB 2CIMA 3ILIA 1KOHA 4CO1A 2KM8C 4WE1B 4EYHB 2DTJA 4CLKA 1MN9A 1MV0B 5CVIA 4CQ1A 5HKCA 3U7JA 4I64A 3M56A 1NEEA 5HLFB 4OZ5A 4FPIA 2RF0A 1NLPC 3I56S 1ELOA 2E6NA 4I7FB 1U45A 2HVIA 3BS9A 5KT5A 2CJBA 2Z2LA 3EG1A 1VQ5A 4P75A 2DYAA 1JXLA 4QJVA 3F73A 4XU0A 2FC8A 3VVTA 3E01B 1C0UA 1YGYA 3S8SA 3R1HA 3E1SA 3CQTA 1H0HB 4M78F 1R0CB 4DQSA 1N27A 2AJ4A 3G82A 3DM2A 1RWKB 2B8PA 4LBPA 2LEPA 4BE1A 4F2RA 2RQKA 4ETZA 3A8GB 2JNJA 3VYGA 1X4BA 3IS9A 4XO0A 3M59A 3M9QA 1PHTA 3H59A 4X65J 1H38A 2OPSA 2DJZA 3M8SA 2LT4A 2H9ZA 1RABB 3H42A 4C8ZA 2FLOA 1S0MA 1KK7A 1UFFA 3QQCD 1S1UB 2V4JB 3R7BB 2WRMA 1IVZA 3T5KA 1WKJA 1Q82T 4YN3B 1G5VA 3OJUA 1RP5A 2HBQB 1DZ5A 2QQSA 3TSWA 2GMHA 3GIMA 3CD6T 1JLQA 2HFUA 2C06A 3PHEA 5F3ZA 1FDAA 2MK5A 2IY5B 1LNQA 2KXCA 3H98A 2B9XA 4ED3A 4JI7J 5DDRC 4DPWA 3AJDA 1TWBA 4PXDA 4C0GA 4M5DB 1HD3A 2UVVA 1M1KU 1GT8A 2D8JA 4E8UA 2XO7A 3JRZA 1VQ5T 1LWXA 3S6WA 4X4SA 1S48A 3QZ9B 2ZDOA 3G71T 3BKUA 1SV5B 1SC1B 2DVJA 1AHJB 5HK3A 1LXJA 4OHZA 1JU5C 4DX7A 1BQNA 1LVKA 1M1KC 4M7DF 1X5OA 4ECTA 1CQMA 3KLVA 1Y0HA 2EVRA 3FSXA 5GAOn 4KBIA 3B8HA 4RPFA 3ZNUA 1HI8A 4M5MA 4EWTA 5CQGA 3CC2S 2WB4A 3TJ8A 3MEWA 1ZSZA 5L23A 3TX0A 3OQ2A 2EVZA 4ZVOB 2W4PA 2CZVC 2XNQA 2QA4T 5CHCB 3DU6A 1M8MA 4PZVA 3NCPA 3CC2A 5DQGA 4PG6A 3D0IE 2H8HA 1HK9A 4RUBA 4A8XA 2BANA 3C15B 2RQRA 2WVEA 1IR0A 1VQ9S 4QU7A 1WC3A 1SF9A 4ZCKA 2XD0A 3M5AA 4M75D 2EC2A 2O9SA 2HHSA 4C0OC 3VUZA 2ATCB 2WW4A 2AX0A 2EBGA 5GAN7 4AL7A 3OMCA 1VQ9A 3W2WA 3RAXA 2HNIA 4J9GA 3EGNA 4MKVA 1H3HA 2CNKB 4DQRA 4RTYA 4GLMA 4HTJA 4PLIA 2BE2A 1C6VX 5ETNA 2SRCA 4Y28C 1QVFP 1JJ2P 3CCEQ 4XDCA 1DQ8A 5HJXA 4E7HA 3UT1A 4FXWA 4DBQA 3P5TL 3NG8A 3R2CJ 2KROA 3ZZZA 1QCOA 4IFVA 2DXTA 2M1HA 2DH7A 2AJ2A 2Z58B 5IWAJ 1LV5A 3W9IA 1HWJA 2JMAA 1IBMJ 2Q66A 2KBTA 2ROLA 3NL0A 2V26A 3E3XA 1VRUB 3QJYA 1YJ9Q 2DXFA 2RMOA 4W90B 2VXEA 4KGXB 2QLJB 3GMGA 4F0KA 5ADZA 3META 2NZ4A 1A9NB 1LK5A 1LW0A 3D4JA 2BE9B 4RW8B 4LF8J 2UXCJ 3MEVA 2DXUA 1UWAA 3LO3A 2IRXA 1SJQA 3VGSA 2Z4PA 1SKSA 2QYGA 3S7RA 2DZCA 2KM8B 1RAOA 2XMAA 2QXFA 3CSKA 4ZK7M 4M78E 4Y00A 5IHKA 4GVLA 4KTQA 3JB9k 3MAHA 5M9OA 3B6BA 1G83A 5LL6S 2LCLA 3BH7B 2QYCA 1GQEA 2QE5A 1TXQA 2NZCA 3HRUA 1Y71A 1NKEA 2YWHA 4GKKF 1N33F 2YPYA 4Y0FA 5KG6A 3MFIA 3MPDA 1E6GA 1OI1A 3KUHA 1NPRA 2V4QA 5FD1A 5CYQB 1M5KC 4RTWA 2EBEA 1TL5A 4QZVB 4N56A 2DO4A 5A8KA 2GA7A 1NM7A 1DLOB 4EO8A 4PABA 2AHJB 2P9CA 1QP2A 1AW0A 5CXTA 5IV4A 1R43A 1ZAXA 2VPXB 2RD5C 3A1YG 1R3NA 1ZA1B 2OD6A 2PMZD 2DK2A 3M4GA 4N7TA 3GCXP 2GO8A 2EFIA 3HSJA 1P6TA 2ZVSA 1B0VA 5I2MA 1IO6A 4DR6J 5GANf 1WSRA 1UGPB 1ABOA 4R8UB 2XK0A 5AE2A 2YNGB 2MGZA 1B70B 3DGPB 3JB9H 4P72A 4M78G 2IVMA 2GHVC 1Q7YR 5J1PA 2GIRA 5DY9A 5KFCA 1TL3B 3HHNB 1T05A 4QWEA 4ECSA 2WZ1A 2VD3A 3MP6A 1HYSA 5BR8J 1GRIA 3NWRA 5LSRA 1FFGB 4M75A 1YTYA 3CXCR 3PIPA 1Y0MA 4G65A 4M7DE 4HCKA 2R7UA 1VC5A 2I2YA 3MDFA 4ZLPA 5U47A 1IRXA 4Y34A 1UW4A 3O8WA 3WHIA 4C8LA 2C42A 2CWXA 5C0MA 1BI1A 2LNVA 1BI3A 1YRXA 5CYJA 2LZ6B 4OV6A 2VZ9A 1MSWD 1U2RA 4KFBA 1CKBA 4XDDA 2JTFA 3SDZA 4M7AA 2JEIA 3QDFA 3AD7C 3GF5A 3LUYA 3TREA 2I9SA 2M4MA 3NOGA 4OFZA 2KSSA 1JLGA 2OJ3A 2XM3A 2BQ3A 3NKYA 1NKCA 3QJ6A 1VQNQ 4QKUA 2NREA 4LF2A 4WP8A 5D4OA 1K76A 4JI5F 1RJJA 2LLZA 3OR2A 4WU2A 2GX8A 3TARA 5GAOl 2E10A 3DLBA 2DNGA 4JUVA 3VALA 3A8HB 2F2WA 1RTJA 2PGCA 2QEXQ 4YB7A 1M5HA 3HTRA 2H54B 2HAFA 3GIRA 1IXDA 3SIPB 4A8WA 1JXVA 4OHVA 5D6XA 3Q24A 2R58A 1OX9A 1D1BA 4TN2A 3LWLA 5C5JA 4A8FA 3VRYA 4URGA 4M7DG 4ZITA 2XKOC 4H4KA 1UG1A 1YBTA 4Q44A 3RB6A 1FE4A 3WX8A 4OL8A 1KVKA 2M16A 3T5HA 3JCMW 4K50A 2O5DA 4BDPA 3CJTA 4EBCA 1XOVA 1KD1T 7AT1B 3RJMB 5LSOA 5FDLA 2E66A 3R6OA 1NAQA 4C0BA 3JQMA 4NLUA 9RUBA 2LMJA 4ZJLA 4C5HA 1S9EA 1GFCA 1X01A 4XTVA 3RR6A 2NS1B 3M8RA 3A3PB 4LF5J 1S6QB 3M05A 1EP4A 1J27A 3EWGA 4IH7A 2F3JA 1RISA 3E8OA 4O4RA 5HROB 4NCAA 3CMEQ 3OD2A 2DH8A 3QRRA 5HVGA 2ZBCA 4OX9J 1SKWA 1U8SA 2EGEA 3EFRA 2HNYB 3OW2S 2QLWA 2CQDA 2DKGA 5CKBA 2ASLA 2DEJA 1NYGA 4NCGB 2O88A 4A8SA 1NZ8A 4DV0F 2Y8WA 2QL7B 3RRKA 2F1LA 1RAIB 1HNVB 2HS3A 5F8IA 4QQBA 3OYBA 2J9DA 5K14B 1OOTA 3V4IA 4AFUC 1RTIB 2HYIB 1KQSS 2O4XA 1ZQ1A 2RHSB 5GAHU 3OYNA 1HI1A 5KYWB 4IQMA 3BDPA 2AMCB 1C1BA 3IFEA 1XTZA 5KAKA 4ECUA 1YLXA 3KMQA 5GMKa 1QVPA 4RUGA 2DBKA 2IJNA 1NEGA 5KG0A 1VQOT 3FZBA 1NM2A 2CKWA 5GAN2 1KN6A 1MROB 1JLCA 2VONA 2Y90A 2AV5A 4RW7A 4DPUA 3C46A 2JMCA 4A8OA 4A4GA 1FX4A 3SB2A 1H92A 3L7UA 5KH6A 4UUWA 3HVRA 3OBYA 2PTKA 1YK9A 2KXNB 3PJWA 4J7IA 3L2VA 4I2PB 1FTCA 1TKTB 1GCPA 4ICLB 5HI7A 2FG0A 2QGGA 1X69A 4CLLA 4PCQA 3Q83A 3DRRA 2JS0A 5DZ7A 1RT3B 4Y6IA 1RZMA 1SB6A 2FYKA 3V6DA 1HQEA 1PRLC 3CD5A 1MWQA 3V6KA 2RS8A 1U1OA 5D3GA 4OYMA 2DTOA 1DQ9A 4PUOA 1L3KA 1U6FA 2AYGA 3M32A 3KJVB 1XQHA 5FU7C 3QSUA 2YX7A 1VGYA 1TKZB 5F0WA 4TYAA 3RMQA 3HHDA 3J81E 4QYRA 2HL5C 2Q6BA 2C2ZB 3N5BA 2LCSA 2D3OR 2K5IA 4M95A 4OHWA 1A0OB 5EX0A 1CC7A 5GAEI 1GCQC 5KFJA 1YJRA 1WA7A 1YSJA 5DLFA 1GEHA 2COWA 1UTAA 1GK8A 4JPBW 2X3GA 4G1QB 5GMKi 3C66A 3WZ0A 3KLGB 2MF2A 3MPYA 3M1VA 4DXLA 5A8WA 3OVSA 3URGA 4R5PA 3HPOA 1V6HA 4ITSA 3ISND 3GIBA 4DR4J 4LF9J 2IA6A 5ETPA 2MMYA 1C1CA 2VBYA 2DRAA 4PLLA 3A4TA 3OYCA 1I1JA 2AEFA 3EJMA 5J2MB 2V5HG 1FF2A 4DS5A 1LFWA 2GQCA 3M0TA 2F4FA 3DDNA 1LCKA 1OQKA 1W6XA 4KGVB 4NX9A 4MZMA 2WSCE 1S9GB 4UY85 4OLOA 5L1JA 1VQLA 3PV8A 1IGUA 2MQMA 4RKUE 3JCMd 2Y8YA 2XULA 1O51A 3TVTA 2FVRA 3NGTA 3KLIA 4RW6A 2P0QA 4DV7J 4JI2F 2JLGA 3LGFA 2G3RA 4JV5J 2H65B 4F0MA 1Q86U 1YJUA 1HWIA 1HBMB 3MM7B 1MMLA 3X26B 2AYBA 2LVMA 2MYSA 2UXDJ 4DFJA 5I3UA 2KXHA 2ZE2A 4Q5WA 2M8HA 1DTQA 3K2YA 5KFLA 1KEKA 2B4VA 2HCKA 2BJ7A 1M1FA 2VOPA 3DRSA 2AP6A 1NLKL 1UVNA 3KXDA 1I4K1 1RKJA 2O01E 4HXJA 1WHWA 2BUDA 3E19A 5K8MA 2GCXA 3RBXA 1XNIA 1UW9A 4ZPAA 4ED5A 1C2PA 1NNDA 5ETVA 1BYMA 1VQKA 1VK8A 1GBRA 2OGUA 3LH2S 4UC4A 3W61A 1KJWA 1S1NA 3DLKB 5LSLA 5FRNA 1D3WA 2YNHB 4OF1A 3HFZB 2N7CA 4L72B 4M7AF 1IWAA 1UVMA 2KB2A 2KH9A 1PSDA 2DNZA 2R7VA 2ZHOA 1Q7YC 3G6VA 3THTA 3V8JA 2AJFE 2DRMA 3TQEA 1AROP 3LWHA 1KC8R 4NYPA 4DUYJ 5GAN4 1DJ0A 2V63A 1D8YA 1VQLT 2KGTA 3RR7A 3MD3A 3PW5A 2LCCA 2KFNA 1IBKF 5KYNA 2FPFA 1HBOA 4LMZA 2LA6A 3JYTB 4K4UA 3H2UB 1JQGA 3Q2TC 3REBB 5F8LA 4Q45A 1UWBA 2VG6A 3NMZC 3JAMY 1VQ7A 2R8HA 4BY6C 5GJVB 1T0JA 3ITHA 3N28A 4TY8A 2YWGA 5KFTA 4RW4A 2IG0A 4JJNK 3KHLA 1HW9A 4C92F 1HR0F 2HEQA 3MP8A 3QYGB 3BR9A 4QR0A 1M5OC 5KFFA 4LSNB 5GMKe 2MQPA 3C14A 2CPJA 3QYHB 3GONA 1QQJA 4YR2A 3LQVA 3CCSS 3TQ7P 5HCKA 1V3ZA 1VQ6T 5EN1A 2YVSA 2VVKA 3KHRA 3T5JA 2PVOB 1C0MA 1SC3B 4F0HA 3CC2Q 1X5SA 2XSJA 4ZP6A 3MM6B 4XK8E 2EG2A 3BSOA 4AQYJ 1SVDA 2G6FX 1CJUA 3CCSA 2QSWA 1TH7A 2E64A 3OYEA 3RESA 5IC6B 2R7TA 2QC3A 2KI2A 1NSQA 1Z1ZA 3CMAS 2PI4A 1T9WA 5CK9A 1WJQA 1VQ9Q 2RUGA 5C25A 2DA9A 1X7VA 1F3VA 1M5VC 4NXMF 3ASKA 1TVRA 4MK8A 1UFWA 2K7AA 4J5YA 3DOKA 3ZO7A 3BSAA 1CJKA 3PYGA 4DR2F 3CMAA 2YWFA 1R8CA 5FU7B 4A54A 1YHQS 5BYQA 2EKOA 3SCIE 3UO0A 1PC0A 4RUCA 4ILRA 1T8EA 2M70A 4KR0B 3X3UA 1FK9B 1UGQB 3W5YA 5K8NA 1N54B 4B9UA 4X9CA 1VQ7T 2L3RA 1S1TA 3BJYA 3PG9A 2ZPFB 2DD8S 1YHQA 2ROGA 2OEMA 2ENMA 3CWJA 2DIGA 3PW7A 1E6VB 2ZC3A 4USVA 1H3ZA 3QXEB 2XLKA 2CG8A 3DLHA 1S76D 2WONA 2DGWA 2EPDA 2ZOFA 4WF9Q 2N4DA 2ZH8A 4PL6A 3FEOA 5SUHA 2KTQA 3HP9A 3VV2B 5D0GA 3M0QA 3UW1A 2FJXA 1WHGA 2A08A 1B3TA 5KT7A 4MFBB 2BZYA 1ZSGA 3HFOA 2COYA 4AFZC 4RU2A 1VIFA 1IBCB 3THKA 2UUBF 2KRBA 5E3CA 4K2XA 2ZC4A 3TVKA 3CDAA 3CD6S 1UGRB 2CZ4A 3J7YU 1W2IA 2EQJA 4B3RF 3JCMJ 4NOYA 4ZPBA 5LJ3d 2HNZA 5ECAA 1EFNA 3QIPB 3KK3B 4M77D 1YJNT 4FW2A 1XNQJ 5AT1B 1NZAA 3TJ9A 3V6HA 4VUBA 2JEJA 1ZLMA 2P6TA 2OPRA 3WVDB 3MAAA 5LJ3Y 1D3BB 2RO0A 4OP0A 4M7AE 2XI9A 3C6TA 2RN8A 3QLHB 4WJBA 3G6EA 4A4FA 4PYDA 3UN3A 3GBQA 4ZVSB 3Q0AA 2UXBJ 3OYKA 1X4EA 1YIJA 3LF0A 4QR2A 4FF4A 5J2NB 5DJBA 4TYBA 1QMCA 2B3TB 5CIUA 4YHHF 4IFYB 5LL6d 1UJ6A 2C3MA 4FKYA 2UU9J 4B9NA 4B9VA 2V2ZA 2H4WB 2YQ0A 1D0EA 2CQIA 3QMQA 4ED4A 3QKJA 3M8QA 4BDYA 4OB3B 2QA4S 1FKPB 2DGSA 3RRHA 5AE1A 3T1HJ 5GANe 4OX8A 4M75G 4J6WA 3MO8A 2HWIA 3SFGA 2HKQB 3PIPQ 2BRKA 4F4YA 3PJXA 4C8YA 1Z4UA 4ELTA 3BF4A 4C92E 4PWUA 2AF6A 2FLPA 2L89A 5HBMA 4BUGA 1YWOA 1CPZA 3PXGa 2RILA 1JBMA 3I5SA 3G9CA 1TAQA 3FCVA 3PFSA 5DG7A 3OTEA 5GMKh 2J6OA 5JXSA 3UWNA 1BCMA 1X9MA 3M54A 1U47A 1Y00A 3EGVA 4P2FA 1YJWS 4MKYA 4HKEA 3REAB 3KG1A 3NTKA 4FYXB 4XU3A 4M7AG 1FKOA 3NAHA 4LBIA 1N34J 2YUQA 3K57A 5LJ3j 4CLPA 4DV4F 3BYRA 2KO1A 1WI7A 2R2RA 1ZTWA 4AMCA 4BY6B 2RIJA 2VG7B 4CLZA 1YJWA 4ZVRB 5FROA 3TAPA 4E98A 1W26A 1OMSA 1E7OA 2DYBA 2ILZA 2WVCA 3JCMf 1MN7A 4A48A 1YX2A 3M9NB 2IAJB 1VQPA 2L9WA 3DKMA 3NWGA 1RT4A 4X4NA 1YIJT 5A2QU 1UKUA 3LA0A 2CQ3A 3SWNC 3OTOJ 2GIQA 3CJ5A 4IOCQ 1B7FA 2V8GA 1RT5B 4RMOA 1SJ4P 1R31A 2J9DE 4UZCA 1BY9A 5K8OA 3NPFA 4MK7A 1ZUYA 2NUPA 1RBLA 4ALZA 2NWMA 4KUIA 4KO0B 2VQFF 4LT6A 2DNKA 4JS4A 3NNCA 3CDBA 1K73R 2JN0A 2IFXA 4A4EA 4M5LA 4F17A 4C92G 3SSSA 3KLHA 1X0FA 2IM0A 5KYXB 4KULA 1GMUA 5DQHA 3NGRA 3WC2A 4KAIA 4QVDA 3ILLA 2HVDA 2ILYA 1RAFB 2Z2ZA 5GAMg 3HX9A 4O0IA 4M77A 1YI2A 3IGNA 1IKXB 1YG0A 3THPA 2PFDA 4ZIVA 3NGDA 5GAN5 2BM1A 2ZH1A 2XYHB 2W4CA 3HM9A 3OT9A 1G3SA 5I11A 3A98A 3SSQA 3T3FA 2J8AA 1U7LA 1FFSB 2CREA 4PFPA 2HZYA 1LXNA 4WFAQ 2C22A 1Q78A 3DI6A 1KC8C 4R0EA 2CQGA 1XMOJ 3BB5A 4J9VA 2E5LJ 4HT7A 4D6WA 4LF4F 1PG5B 3PMTA 3QHSA 5IM0B 2QFJA 3THVA 3L2QA 2BJ8A 2OP5A 3F56A 4LRAA 4B3TF 1KLNA 1SQGA 2MPUA 4UZBA 3ZTRA 1M30A 4OHYA 3RB4A 1NXIA 3CJSA 5CCMA 1Y4ZB 3D6HB 3VGTA 1XC9A 4ZPCA 3DLLA 3ZC4A 1JWWA 1X4CA 3UDEA 1N5YB 3G86A 3Q2SC 3QWXX 4XU1A 2QQRA 4AE5A 2MQ8A 3MECA 2DTHA 2WSFE 5HQMA 4DF4A 1HNZF 5HJYA 3RB0A 2AZSA 3CJ0A 3M6WA 4L6V3 1U1LA 2HNDB 2YKPA 4DX8H 4S0MA 3QSYB 3CJRA 5KFQA 2HAIA 3H5XA 3O2IA 1PAUB 1LW2A 1PBUA 3H4DA 2MI6A 1B7YB 3VJPA 1F5BA 3A8MB 2F2VA 4ZKAA 2W8LA 2VASA 3PGGA 4IO1A 4Z7YA 4V1Ak 4Q0BA 2NXJA 4HCBA 3LP2A 2SEMA 2ACYA 1Y96A 1JO8A 2JH3A 3LAKA 3EVWA 1YI2T 2O3DA 5A0GA 3EH1A 1IKYB 5GANh 1JLEA 2F63A 2B4UA 1H2UX 3KK1B 3GLJA 4ZS6A 1LJOA 5BYSA 1X9SA 3O1LA 1JLBB 2VOOA 4P2MA 4DBFA 2XWXA 5K20B 3L3CA 2Z8QA 3CCRS 2Z30B 4EBEA 3HD2A 1OV3A 1NCLA 3A12A 1ZTTA 4IH5A 2W2NP 3T9NA 2SXLA 2E7VA 3A8OB 4GKJF 4C0HA 5CQYA 1CEZA 1W2BR 4DR1F 2MKJA 1BGXT 3PM9A 3CCRA 4CC7A 5AXKA 2BMBA 2B0GA 3TNVA 1RUSA 4U7UD 3RGIA 2V9KA 2DD5A 1G2EA 1HWUA 4HVZA 1UDLA 4TLQA 1JLFA 1VQ4A 3EAEA 2YKNB 3ZZOA 3QFWA 1LK7A 3M6VA 2GQVA 3MTKA 1ZUKA 2MTLA 2J05A 1WKLA 5E0OA 2IJFA 5L39A 3OVAA 2BIVA 1KSPA 3LTOA 4ANCA 2DHSA 1PJ7A 1RA6A 2HDAA 2ZJPQ 4ZVPB 5IQ6A 3N6LA 2L08A 2MZSA 4F3OA 4DQPA 4NLOA 2K3IA 2XCPA 1WJRA 2LEAA 4KGZB 2NXEA 5AJ3J 2NYIA 1ZM3A 2XCAA 4OMNA 2E5GA 2V8KA 1N6AA 4WU3A 3PX0A 2PFFB 3ZFJA 1HW8A 3I6PA 2PI5A 1PKTA 2IC3B 3T1YF 1BC6A 3VS0A 2WW8A 2RRBA 1U0SA 5DG8A 2V4JA 4MDXA 3AY0A 3LP0B 2IYIA 2Z0WA 5EG2A 2HRYA 1RA7A 1JXEA 5HN0A 1MMGA 3DLMA 1EHWA 3R7NB 3SWNB 4WK1A 5GADU 2ATLA 2YKAA 1HLWA 1N36J 4N0AA 4AXIA 5DM7R 4C48A 2QDYB 2KRRA 2XDPA 2AGOA 1HWKA 4ZTFA 4FS1A 4Y28E 4MIAA 4X66J 1RT2B 2KHCA 5M2PA 1MMDA 5IH2A 5GJWB 2V8HA 1VQKQ 2G9OA 1UETA 1XNRF 1G6BA 2X3WD 1Q86T 1QAYA 4JI8J 1VQ8A 3I0RA 2AD9A 3LLRA 1QVFS 2YPZA 1BD6A 1QVGS 2N4CA 1G3WA 1WDDA 2FHKA 4EZ6A 5A0DA 4HH1A 2L8DA 2CJKA 3IG1B 3IWXA 4JJCA 3TEGA 3UDVA 2EIFA 3QGGA 2HQFA 3BQ2A 1HIYA 1HD0A 3OL7A 4NI2B 3CBOA 3OFGA 2DR8A 4QBUA 2OTJA 3IR7B 1SKUB 4N8OA 4F4KA 4PG8A 3QBCA 5CAIA 5LT5A 4KPCA 4NOHA 5ETRA 5CZXA 3TAMA 5IHIA 3R8YA 5KFIA 1QAXA 2OMOA 1M90U 1Q8LA 4I4BA 2M7SA 3X25B 2IIMA 4ECRA 1JIHA 1Q82R 4R0KA 3Q89A 1FDBA 5HQLA 4RTTA 1T9YA 2K3XA 2GVZA 5L9NA 1TKDA 1ARKA 2CJQA 2K3YA 3EGDB 2DISA 4X1VA 3QT7A 4DMZA 2J6KA 4CM2A 4CLWA 3OUYB 3NHNA 4JI0J 2FRYA 4RL1A 3D68A 5J2PB 4FBTA 1AFIA 5B0AA 3EDRB 2XEXA 1GAOA 2DJQA 4HCCA 4KRWA 1H73A 4IRKA 3DLGB 3KLEA 2W9BA 3KKFA 3CCWA 4NEZA 2XMFA 2YLCA 2FPEA 4C0DC 4KIAA 4DOVA 4DG1A 4F7VA 3QO9A 1APSA 3EE3A 3CCSQ 5T7LA 4LR9A 1TUDA 3C0CA 4QR1A 2GBQA 2JHEA 3OSSC 4PPZA 4WP9A 1P92A 3K5OA 3DLJA 4DPXA 3J7AF 1Z2LA 3A5ZB 1J5EF 2F1FA 1K73C 4G1IA 4L76A 1VBYA 4FSXA 2I5JB 2RB7A 2IVYA 4F2SA 3I9QA 1PGZA 3QNWB 1IKWB 3L42A 2KRNA 2HWHA 1N5TA 3HMJG 2KT1A 2RH2A 2OTJT 3OFEA 2B6AB 5FLXY 3R6LB 5IZHA 4KV8B 5LJ5d 2KG1A 3L2UA 3CMAQ 3AOBA 2WVFA 3G4SS 3M8PB 4PQUA 2E1PA 1K9AA 3AHPA 2CQBA 1F1BB 1ULRA 2X1AA 2UUAJ 2ALZA 1S59A 1S4FA 5GAGU 2MZTA 4P9SA 1PKSA 1DY3A 3T6BA 1FI4A 3MMCA 3QAUA 2MQOA 1KFZA 3G4SA 1YHQQ 1IBLF 2KI7A 2ZPHB 3RBZA 4M78C 3L9ZA 5E41A 3OTCA 2Y1RI 4AT1B 2JTMA 4DL6A 4M4ZA 2CUDA 2CP6A 1FX2A 2PVGB 4CC2A 5KYUA 4A8YA 2QDLA 2D7SA 1WEZA 5A76A 4M94A 2WBRA 2XMVA 4NZ6A 3LPEA 4K7QA 3UNGC 4AL5A 2DCLA 3VF0B 4C8KA 4QYZK 1D0ZA 1VQMA 5KG7A 3C16B 5KG4A 3CCMA 4WFXA 3JTPA 1N32J 3HCXA 1GBQA 2DRBA 4C3MA 2E6ZA 2QASA 1UA0A 1PNJA 5IAYA 3L4BC 2ABYA 4R8UA 3UVJA 5CYMB 3DCAA 3Q8UA 3FIFA 5GAN8 4O3RA 4IUPA 4RCCA 3HVTA 4ECWA 3OJSA 2JNGA 3G6EQ 3M0UA 3L7OA 5LMNJ 1P9YA 5J2QB 1UJ4A 2F9DA 3GPAA 4XPEA 2HWTA 3K89A 2W2PP 3UCUP 1Q8IA 3CPWP 2LQ8A 1PM3A 1S0NA 4IUTA 3IRXA 4LBHA 1M2VA 2RD1A 2CUYA 2RH3A 2HGLA 1WG1A 3KBGA 4USUA 4Z88A 4AFFA 3MI7X 4UOFA 1U1QA 5KT4A 3DC2A 1WGSA 1VQ6S 4DR5F 4M7DC 3LP1A 3MR2A 2CG4A 4DCPB 2DLPA 3NTIA 2N3OA 1PBAA 3I0SB 5DLOA 2M0YA 3OA6A 2M51A 5JMNA 2X4XA 4OX6A 4RJVA 4N47A 3WDOA 1FFWB 1ZUUA 4PWWA 4FXDA 2V8VA 3IR6B 4WKYA 1PYTA 1VQMT 3LW5E 2XI3A 3CCMT 4E7IA 3FQLA 2PEHA 3OYFA 3C6UA 4HL9A 5KFUA 1H641 1F3FA 4DR3F 1ZAVA 2DHAA 4ED7A 2UUWA 3I5CA 2W1BA 1WC6A 2M5YA 2MEWA 4D3GA 2CUBA 3AB4B 2DHGA 1UA1A 2YNIA 5KE2A 1YJWQ 3AQPA 1Q5YA 3GFZA 4AUKA 3E9FA 2M9KA 1C1AA 4FU6A 3ET6A 3VV0A 2PUKB 1VQPQ 2M2BA 4HT8A 2K1RB 4LF7F 5K8PA 3MMJA 2C28A 2LEBA 3C19A 3R5BA 4NXNF 1WQWA 5IT0A 2O2OA 3HHLC 3AHUA 4NCBA 1YZ7A 2OH2A 3FLGA 2ZZDA 5KT3A 4F3MA 2KU7A 3JCMe 4NYZA 4J9SA 4C0DB 4IDKB 1IB8A 1AUSL 2GMJA 1IKVB 2V0NA 4H4MA 1LQ9A 2JS2A 3EYZA 4ELYC 4F67A 5D15A 2OD4A 2V2VA 2J06A 3M2VB 4J83A 2YLBA 1YBUA 2FEIA 1HYOA 4IG0A 4YQWA 4XTWA 1WC5A 4HLBA 4YDDB 3NP5A 2GQIA 1XEZA 1RT6B 4Z7CA 2YSQA 4M77G 2HG4A 2A3LA 2XYGB 4N5SA 2C3OA 2J7UA 1UJYA 2A6MA 1TAUA 4J9CA 4OMFG 3MEGA 2KYXA 2DH9A 1YJNS 1RWOB 1N8RU 3INZA 2IA0A 2DR7A 5E3PA 1RTIA 1VC0A 3KNGA 4ZCMA 4K11A 4A8KA 2F8EX 3MCOA 5CR2A 1SL2A 2L41A 1NJYA 4UF4A 2K5LA 4EBDA 5D77A 1OSDA 2AWZA 4MT1A 1JK9B 5CABA 1UZDA 2N82B 4RLEA 1KD1R 1NSKL 3EGZA 4M78B 1F9EB 2ZH9A 1ZHIA 1S49A 2J5AA 2O66A 1LOJA 4PG7A 3VS2A 1FXRA 1TTHB 2JEGA 1WEYA 1Q82C 3DLLQ 1LPLA 2HMAA 5J1EA 4ILLA 4OX7A 3CC4S 2DO0A 2RU3A 1CULB 3MR7A 3T9ZA 3RNJA 1MGQA 2B7CB 1S7HA 1YITT 1U8RA 1S4EA 1LWFA 4HVVA 5KFSA 3DLEB 5DGAA 3BGRA 3JB9F 4EFAC 4X65F 4OB2B 3CPWA 4FNIA 5CD4A 4C4WA 2DMOA 2CDRB 5KT6A 4ATOA 1C4AA 2RKIA 3VS1A 4O3SA 3MMBA 4YEAA 2JT4A 1K0XA 1HBUA 3DGVA 2MYFA 3KJVA 4TQSA 1NBEB 4ELVA 4JI4F 1ACMB 2FVCA 3CCUT 4B9XA 2FY1A 4RW9A 1JJHA 4ZJOA 5EX3A 2E70A 5KFKA 3D28A 1XJWB 2ABLA 4ZVEA 3PCOB 4KQZA 4MIBA 2VFRA 3AAWB 3CC7S 4MIWA 3X28B 3S3NA 3PT9A 1KHIA 2VC1A 4FF3A 1YZ6A 2YKMA 3BR8A 1FXLA 1T3NA 4C5EA 4NLDA 1JJ2R 3ENWA 4M63A 1E6YA 3JAMU 1CJVB 1ZZNA 1T3SA 3GTYX 3CC7A 4JI7F 2XTJP 1BQMA 1ZYQA 4ZCLA 4WBFA 1U1PA 1VUBA 1BIAA 1RLDA 2JOQA 2MKYA 3CCRQ 2AYEA 3V8LA 3BSCA 3TA2A 2RQTA 3TUPA 1XMQF 4M7DB 3MTJA 4ELZC 3WQPA 2LA4A 1FRIA 1VQ4Q 2ED0A 1TSFA 3V7CA 2LCWA 1HNXJ 5KG3A 3C95A 1AZGB 2KT3A 4E7LA 4Z2XA 3KK2B 4L75A 1G3YA 2WSCC 1HBMA 1FRXA 3CCJS 3GFXA 1X4AA 1T7PA 2GGPA 3UWTA 2PD1A 3ZTSA 4IRDA 3ILJA 5EC7A 1RL2A 3M2UA 1BWVA 2V4RA 3E2EA 2PA3A 2O67A 4L3NA 4ZCIA 3E9GA 3EGXB 3CCJA 4X64F 3JCMh 3HD1A 2R8GA 1Q8BA 1MNEA 2W7OA 3KWMA 4HDHA 2EWHA 1RHQB 4OZNA 2DL7A 4EDUA 1HQUB 4DZ6A 3K58A 3WX4A 1NMEB 2OTLA 4C8QD 4YY3F 3DLKA 1DFDA 1W25A 2DPJA 3AOAA 3RU0A 3DHWC 3VTIA 3HHLB 2HPUA 2ROPA 1KNZA 5I42B 3A8LB 6FDRA 4D8DA 2KNBB 1I0CA 2ALYB 2E12A 4FBUA 1ZSZC 1W2BP 2JJ4D 4USJC 4DL0C 1K0SA 3OMGA 1RI0A 3PYDA 1YJ9A 1G4CA 3M8YA 5LJ3e 2XWYA 1HSQA 1J5OA 5I4MA 3MJXA 3X24B 1TV6A 4BI4A 3CJQA 4DSJA 1S57A 4JI6J 5LMUJ 3QBYA 1VQ8Q 3DOMB 2DF6A 2JTEA 3ILOA 1S6UA 4RNNA 3NGSA 2HL3A 3DRPB 2DHXA 2HZCA 2CS7A 2G13A 4QQDA 4DFKA 2EYYA 4LF8F 2UXCF 4PKCC 1NK9A 2FJBB 2OO4A 5C24B 4KHPJ 3TO8A 3PHTA 3MPWA 2ROEA 4DUZJ 2HMIB 3OYJA 2ZEJA 1K8AU 3VAHA 3CT9A 4FL6A 1GFWB 2CNOB 3GQCA 2W9CA 4MDWA 2BW2A 4FM4B 2ZD1A 4EEYA 1Y9OA 3QIIA 3O44A 4DLGA 4P71A 4M5GA 2Q79A 2X4JA 3CCLS 5A0YB 3BO3A 1RI7A 3MM6A 4LF1A 4PKDB 1H7WA 2JWNA 2G1DA 4YMEA 4WYWA 4K4WA 4JJDA 2D1CA 3TW0A 3L09A 1RTDB 4DV5J 3CCET 2CADA 2QMXA 1Q16B 5EUHA 3CCLA 2EGCA 2H3EB 1O5JA 3ZZ0A 3TQ1A 2CSQA 2EKYA 3HT3A 1NJZA 1M0SA 3AD9C 3GU0A 4XK8C 3HL8A 1TFYA 4CYUA 3N4WA 1ZBXA 4P74A 2A0FB 1M90T 1YJ9T 3PW4A 2NLWA 3OFHA 4KH1B 4YR0A 2YRDA 2Y3YA 3G87A 1X6GA 3G7ZA 3QGHA 3CCVA 5IXBA 2Q3PA 1WHJA 4OYIA 1JMTA 1I5OB 2GNCA 1YWXA 2HLTA 1PJ6A 2GVDA 2K2PA 1FK9A 1EARA 2ZPEB 1XK8A 3H5SA 3RBDA 1RHRB 1V5IB 1CJTB 4NASA 5KFNA 3Q8QB 3KFWX 2DM1A 1NK8A 2E5IA 4DFMA 3NBPA 1PKUA 1FDNA 2JLEA 1KONA 2O1PA 3G82B 3DM2B 3Q8SB 4C8QA 2FHDA 3I96A 4WIIA 4C2MA 4B9MA 2LECA 1AA1B 2MWPA 3BQ0A 3IS9B 4ZGDB 3JTNA 1MUZA 2OPSB 2DNUA 4LDWA 3PFOA 2CZ0B 1FD2A 1NDCA 4J9PA 4WZQA 5GAEU 2LNHB 3K8WA 3G4SQ 2VV5A 1R6YA 1R8HA 4MZPA 2XMWA 5D8HB 1S0OA 1FMWA 2FTRA 4IYQA 1RQ0A 1WHXA 4QPTA 4R25A 1KP6A 2RK1A 3FEXB 3QIPA 3KK3A 1LOUA 4USMA 4M75C 2B43A 2E5QA 1JLQB 1M1HA 4ZN1A 2QLBB 4J9DA 2QLFB 3W65A 3D3BJ 1D3BA 3CW2C 3BQ1A 5ETSA 1ZBTA 4ZLNA 5JVGQ 4Y2IA 2XMMA 3TEEA 2HQHA 1UFLA 1KVJA 3TJAA 2H4YB 1U1MA 4BLGA 5A2QE 4C11A 1N88A 1R8OB 1NSAA 2P2CB 2LFVA 3EZOA 4ZOSA 2X3DA 5LJ3h 2PQWA 2R8JA 4M7AC 3RG6A 2YUOA 4M5KA 4KHMA 3IM9A 2FZCB 2WCXA 2DBBA 4CP5A 4MMKA 2VFUA 2DPPB 3ZL7C 2KMTA 1MHNA 4ZLLA 4GY5A 3DB4A 3KLFB 5HVFA 1RT7A 1BQNB 2FHJD 2AEMA 3CMEA 3Q86A 1EETB 4JDSA 4J9EA 1WXUA 4LF5F 2OPQA 2X3XD 3CXCS 2KQWA 2QAZA 1M4ZA 1FEHA 1ZSZB 2J0XA 1MG7A 5G4DA 4AL6A 1QKWA 3H25A 2RHYA 4B3OA 3V8KA 2L48A 3I9V9 3SQGB 3W1YC 4J9UE 4JYAJ 5D6GA 1FWKA 1VQNT 2MY7A 4FT2A 3A8KA 2A6OA 2OUGA 2VG5A 1B0PA 3JTOA 4H4KC 2BANB 4DEXA 4NLXA 1T3LA 4OYBA 2O31A 4C92C 4NMLA 3HXMA 2BACA 5D4LA 2A2DA 2NQPA 3R1LA 1B34A 4C3LA 4IR9A 4JOUA 2M0OA 2QEXT 3PYFA 5H1SV 1VQYA 1VR6A 1SRMA 2YQ3A 3W2WB 3OXFA 2DL8A 3MMAA 1UTIA 2APOA 2OFHX 4ZLJA 2W4DA 3LGLA 2BE2B 1Y3JA 2HBZB 4CRJA 2I6WA 4M5HA 2PT0A 2AJ1A 2BV3A 4C8NA 5KTQA 1TL7A 5F8NA 2HQ3A 1RT5A 3W5XA 5CCAA 3HZEA 2RF2A 3OR1A 4IFVB 5GANd 4CDIA 1IBKJ 2I8EA 2XQCA 2V34A 1OZ2A 3GIKA 2HEKA 2V50A 2NXUA 4CLSA 3I9ZA 2G2YA 1F5AA 1O75A 2H51B 4NL2A 1NK7A 3CMET 1LW0B 2DFUA 3VRZA 1UHFA 1FRMA 1FESA 1JKHA 5GMKl 1SBRA 4ANJA 3R5DA 3V81A 2HRTA 3VZIA 2HBYB 4L5GA 2KKHA 4Q7AA 3NRBA 1AB8A 2DKOB 4OHXA 3X20B 4ZHRB 1V3RA 3FBEA 3K5LA 1AUDA 4WKRA 3EG9A 1H6KX 3M58A 2BKDN 2BOPA 1U02A 4DQIA 2LQKA 4BWJA 5JUMA 2YT6A 3EG3A 2V68A 2XIDA 4OB0B 4BS2A 3HF5A 1M27C 5A8KB 3PACA 4CZCA 2GHWA 4NWBA 3IR5B 2H1YA 2AU0A 3DB3A 4OMPA 3I5BA 5GAN6 3SQOP 3ELHA 4DR4F 2C3YA 5E7OB 2MLXA 4M5NA 4B3SJ 3GV8B 2RT3A 1BWEA 3NNHA 4UOGA 1WX6A 1N5YA 3CCTA 1FVSA 2HBRB 3EPIA 2JFDA 1WUUA 4FIBA 2NXNA 4DR2J 4RTVA 1HQ2A 9ATCB 5C42B 3UQSA 3I56A 3QJLA 3R5AA 3A8JA 4X4UA 2AZ1A 2MGZB 3BBBA 5GANj 4DV7F 4MKAA 4JV5F 2J6UA 3MPUB 3NY0A 3VS4A 3TVZA 1MV3A 1VLOA 1XWLA 3M7VA 4O4GB 5DDPC 3PW0A 1T05B 3GOXA 2Y0SD 2WSFC 2R7XA 1FEEA 1P27B 1HYSB 4TU9A 2Y4YA 2P0PA 1N8RT 4M75B 3HVAA 3R2DJ 2QA1A 4K2JA 5FW9A 3QFHA 4WFNQ 4CLYA 2LXFA 1VRTB 3ZZUA 4J9RA 1AWXA 1IKYA 3GYXB 2ADBA 5E5NA 1SIZA 5ETMA 2R7RA 3W60A 4GMKA 1UVJA 1ZA2B 4B9SA 2KJWA 4C8QF 2BE7D 3M57A 2FZGB 4HCZA 4TLRA 3VVUA 3QSIA 2OEKA 3RAMA