2YWWA

Crystal structure of aspartate carbamoyltransferase regulatory chain from methanocaldococcus jannaschii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
141
Chain Sequence
KVKKITNGTVIDHIDAGKALMVFKVLNVPKETSVMIAINVPSKKKGKKDILKIEGIELKKEDVDKISLISPDVTINIIRNGKVVEKLKPQIPDEIEGTLKCTNPNCITNKEKVRGKFKIESKNPLKIRCYYCEKFLNEVIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Aspartate carbamoyltransferase regulatory chain
publication title Crystal structure of aspartate carbamoyltransferase regulatory chain from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
total genus 31
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
A PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 2ywwA02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 2ywwA01
1RAFB 2BE9B 2BE7D 2FZCB 2QG9B 1TU0B 4KGXB 7AT1B 1NBEB 2ATCB 1EZZB 2AT1B 2YWWA 3MPUB 1TUGB 1ZA1B 1RAHB 1RAAB 2H3EB 4KH0B 4AMCA 1AT1B 1XJWB 9ATCB 4FYVB 1ACMB 1ZA2B 1RACB 2FZGB 1PG5B 6AT1B 8ATCB 1TTHB 1R0CB 2AIRB 2HSEB 2FZKB 4KGVB 1RADB 1RAEB 1F1BB 1Q95G 4F04B 1R0BG 1I5OB 1RABB 1RAIB 4FYYB 4FYXB 4KH1B 2A0FB 1D09B 1SKUB 4KGZB 1RAGB 4WTOB 2IPOB 3AT1B 3D7SB 4FYWB 4AT1B 5AT1B 4E2FB 2QGFB 8AT1B
chains in the Genus database with same CATH superfamily
1X8DA 2W0ZA 3QG1A 3EDQB 4ECRA 2GC8A 1NPRA 5CKHA 1EETB 3KJVB 4C0FA 3D6FB 3CXCR 2E5GA 3CCUQ 3BB5A 1EETA 1HI8A 3KJVA 4FCYA 2QQBA 2R7UA 4F4ZA 4LFAF 5GAOp 5C0MA 2GHVC 2MKIA 1M5SA 4NEZA 2JMCA 3CBPA 2AYBA 4CLWA 3OYYA 3R6LB 1K1ZA 1JXMA 1WKLA 2P4RA 2CPHA 3UI3A 3CMET 2RSQA 1M5VC 1U8WA 2CJAA 4Z89A 3SSRA 1ZH5A 1GBQA 1OWXA 1RT5B 1LWFB 1VQKA 1TOVA 2PMZD 1RT5A 1FXLA 1RHKB 4KIAA 1LWFA 4DL0C 3DU6A 3VRZA 2C2EA 3HFNA 2CSIA 2HS0A 5DM7Q 1R6VA 3CXCP 2HDAA 5FD1A 3QGGA 2AJ4A 2RS8A 1VQNQ 2V8VA 2FPHX 4JBCA 1N33J 3BYPA 3R8YA 4BWJA 3EX7B 1QLYA 2B7CB 2BUNA 2QI2A 4PWWA 4WIIA 1Q81R 4PABA 4W92B 5KYYB 2YT6A 2L9WA 3J80U 4C8ZA 3VWSA 5F8IA 5E2QA 1TK8A 5KYYA 3N79A 3BDPA 1CBKA 3IBWA 4R0EA 3MHYA 1IM4A 2JHEA 5A8WB 1KEKA 2QL7B 4X62F 1FRIA 2H8HA 3LW5E 2HL3A 4E7LA 3IP0A 5A8WA 2KHCA 3CCRQ 1E6HA 4ZP7A 4NLOA 4J91A 3I55T 4WP8A 1UJ5A 4C11B 5I2SA 1SKSA 1Y10A 3GFXA 1XNIA 4XU3A 1P6TA 4J9RA 3CCVQ 4C11A 4M7DB 4ZJOA 4DU7A 2XNRA 4MIWA 1U0SA 1FWPA 1JJ4A 2RIJA 1HWUA 2QZ8A 4EYHB 5B0GA 3GP9A 4M7DA 3TVTA 4C4WA 1M1KR 5L9NA 1MMAA 3CCMA 4DV3F 4F36A 3CPWS 4DR5F 1AB8A 1NSKL 5D0RA 4EDUA 4K50A 5GANg 5KCHA 1SSFA 4KQZA 4OYIA 1S97A 3L2VA 2V1RA 1KHIA 5D77A 2NPFA 2R2UA 2BQUA 3VF0B 3GE9A 3MAHA 2IYIA 3V8JA 2PFDA 2XMKA 3PMIA 4PXDA 2J8SA 3RUXA 4OZ3A 1EARA 1HWKA 3H6ZA 2DISA 4Z7YA 1OULA 2CH4A 3CC4A 4F26A 2K3IA 3ULRB 3PO4A 1FRMA 4PJOC 4XDDA 4ZKAA 3I31A 3O8VA 4NL2A 4LSNB 1H73A 1OEBA 5CK9A 1IN0A 3D5MA 5DZ7A 2FHJA 1N6QB 4LSNA 1N88A 2YKAA 1PSEA 2KAFA 3GPAA 1VGYA 1WORA 4A8XA 1N6QA 1NYFA 5DS7A 2RB6A 1A7GE 3OW2S 4OMNA 2DNHA 1Y11A 5JVHQ 3HI9A 2VGNA 1GK8A 4OX7A 2PI4A 2PC6A 1YJWS 1WF1A 2HK3A 1IXDA 3QFHA 1SSHA 2R9LA 2XGPA 2FY8A 2C2DA 2COWA 1RZMA 2MAMA 3J81j 4P52A 4PZVA 1FJEB 3PW5A 2W4PA 2QYGA 4JI3F 2M3DA 3NNHA 3CMQA 1YRXA 1Q7YU 3EYZA 3HT3A 3EFOB 2CRLA 5T14A 3UNGC 4MK7A 2CQ4A 2J6KA 3EFOA 3T41A 2QLFB 1OY8A 1SRMA 2LQNA 4HVUA 3CT9A 2XKOC 3BW1A 4Q5VA 1SJFA 4B9SA 4K4UA 1IWGA 1F1BB 3R27A 1S4EA 3MAQA 1KN6A 1WD6A 5DDOC 4Q44A 2RNEA 3S8SA 2B4VA 2VZ9A 3DRXA 3GMGA 2RE1A 2M51A 3CCSS 3EGZA 3E3XA 2GTOA 2LMIA 1FHTA 2NPIA 4TY8B 4LFBF 3OA6A 2V26A 3JSRA 3SWNB 4GC7A 4YB6A 5KFEA 4J9CA 1G3SA 4ZP8A 2W4CA 3GU0A 1Q1KA 4X4QA 4TY8A 1VQNS 1BIAA 4DV0J 2DMOA 4KY3A 4DR4J 2H65B 4KTQA 5HO4A 4OB1B 1UGQB 4IDKB 4DG1B 1IB8A 2V34A 4MIAA 4HCKA 5KG0A 2Q66A 2AZ1A 4DG1A 4DSEA 4YFUA 2DR5A 1NK5A 3FKBA 2W7PA 4B9NA 2KMTA 1RWKB 2RU9A 5L1LA 1VJWA 5KG2A 4C8MA 2M8HA 1JBMA 2X3WD 2DILA 4KRTA 3BGLA 1M3CA 4FU6A 3CCRS 3FEOA 4B9VA 1AVZC 4M7DG 3NAHA 5IN1A 1RWMB 3T1YJ 1XNRJ 4OZ2A 2GJIA 2WSFE 4XPEA 3CCVS 2VBWA 1T8EA 1TS9A 3QJ6A 4BY6B 4K4TA 1UJ0A 2PN6A 4KV8B 3UQSA 5L8RC 4F3QA 3PTAA 4M75A 1N33F 3T19A 4FBUA 4KV8A 1KD1C 5A6PA 5KFJA 1N8RR 3NCRA 2KN4A 2GFUA 4J6WA 3IA0A 1YITA 1HI0P 2Y0SD 3CCZA 4LSLB 2ZWPA 2RUSA 1NO8A 4IRKA 2EFGA 1GH8A 1S7HA 4LSLA 1VQOA 2YRCA 2LCLA 3V81B 2GIFA 1MROB 1JLCB 1HXDA 2WVFA 4GLMA 4C8LA 3UCZP 1VYAA 3UPFA 2OEKA 3V81A 1QQJA 1MROA 1JLCA 2J6SA 1JXLA 2ROLA 3PO5A 3FCWA 4A8SA 4DBFA 2HWTA 3NOGA 4XAXB 5IV3A 1YJNS 2LFVA 1EZZB 5HVFA 1SJ3P 2NUPB 2AK5A 1M1KT 1Y5NB 2VKRA 4KJIA 4ATNA 1ZSGA 1HBNB 2NUPA 1KQKA 2BYCA 2DNLA 4NE9C 3CCJQ 3AD9C 3IM8A 1D0XA 1ZUKA 2DVEA 1RT1B 2JTFA 2Y1LB 3PCOB 3CMEA 1HBNA 3ZBDA 4C8QD 1LFPA 1RT1A 2J05A 2WSEE 3KUHA 1Q81U 2NYHA 3CCQT 3EG0A 2DXDA 9ATCB 2RI3A 4EBCA 2ED1A 1UFFA 3URGA 3SI8A 4USJC 5A2QY 2A36A 5CA5A 5CIUA 1EQMA 4IFVB 2D3O1 4WE1A 4IR9A 2XMTA 3L7OA 1IKVA 4L3NA 1NB2A 5HROB 3L2RA 1T94A 1GQEA 4IFVA 4ZPWR 1AW0A 4ED8A 1I3OB 2C3UA 5KFSA 3EG2A 3H9NA 2U1AA 3US5A 5HROA 4CO0A 4E0DA 4A8OA 4BHQA 1IKWB 3VS5A 1ZQ1A 4PJOF 2R2TA 1FNMA 4YQWA 5BJRA 1IKWA 4PKCC 2HFVA 3R5BA 2WW4A 4EO8A 5JJBA 2CIMA 3JSBA 1QVGR 1KVIA 5A2QE 3T5HA 3RERA 2V5HG 5CCMA 2FHOB 1H641 3PVQA 1RP5A 1CULB 1QTMA 2AJ1A 1Q7LB 1R27B 1VQ4T 3BF4A 5L38A 2ZZDA 1NK4A 3W8PA 1RBOB 2H4WB 3RB4A 3I55A 4DBQA 2M70A 1N36F 5CQXA 3TCJA 2MKYA 2GIRA 3NGKA 2QA1A 1WDXA 4AYBD 1YJ9T 3VGUA 1NJIT 2M02A 4IKAA 3KJQB 3HULA 2E64A 2BIVA 4Z37A 4M77E 1CJTB 1SJRA 3OXFA 3O1LA 4W90B 2ZC3A 4X4RA 1RWNB 4BI3A 2F69A 3NL0A 1CJTA 5A0LA 1R6YA 1QVGP 4FYWB 1UPMB 2IJNA 3N01A 4CIOA 1PILA 1VYUA 2RM4A 3NS6A 4JJBA 4BE0A 3AY0A 5ETKA 2O01E 2OI2A 1OPIA 2IY5B 4M7DC 3OT9A 2VC0A 3UATA 3G4SQ 3CBMA 2DTJA 3A12A 3RTVA 2J8AA 1RAFB 2M16A 4M75G 4HR2A 1GX5A 4E98A 4ECQA 2V69A 1GBRA 4AMCA 2QDYB 2C06A 3Q8RB 3DDIA 4C5EA 1GXLA 3MUVP 4LUEA 2MJUA 3CC7S 1M90R 2DCUB 3GFHA 4S0MA 1HBUB 4MKYA 4OX9J 3NTHA 2XNQA 1FFGB 4XK8E 3GSDA 2CA9A 3QYGB 3HD2A 2FGOA 3C16B 3GSIA 1HBUA 5DY9A 3MPVA 4NLPA 2WB4A 3G2XA 3L2UA 1S0VA 2ILYA 3CEDA 3SDEB 3C16A 2CADA 3TQ7P 4QZVB 2L3RA 3TUZC 3SDEA 5B0FA 2K3BA 3N6MA 3AH6A 1LWCA 1Y0HA 2EKOA 1KSPA 3V6KA 1GMWA 1RL2A 3C66A 2KYXA 5CKDA 3DLGB 2HWHA 4I64A 5A8RB 3TX8A 3R2CJ 3CJ8A 3P45B 9RUBA 5KFOA 3DLGA 4B6MA 5A8RA 2BM1A 2L3SA 5HKCA 4UY85 2GQ2A 3FBFA 3H20A 3T1YF 3LALA 1XNRF 1EHWA 1RTJA 1BXNA 2RKIB 4QWDA 1UVJA 4MZMA 4YS2A 2CFXA 4E47A 4BWMA 1SL2A 4XIUA 4JV5J 5K9FA 2DLPA 1SI9A 1REGX 2RKIA 1NSAA 3GR0A 4MTPA 4E7ZA 3CPWR 2UUCJ 2CPJA 4LF8J 1YJRA 2MKKA 3ME9A 2DR7A 2V9WA 2LCCA 3EAEA 2RRBA 3GG1A 3HVTB 1FJCA 2GO8A 2HEKA 1X43A 5AJ3F 3HVTA 2XDBA 4A46A 5DG8A 2E4HA 2YX1A 3KOAA 1ZBXA 3VS4A 1RSCA 5HVHA 1YCYA 4RCCA 4CYUB 2A3JA 4LRDA 4U8YA 3R1HA 1OZ2A 2NXUA 4CYUA 5I3PA 1PJ5A 3LP0B 3S3MA 2XCPA 3BBFA 3QRPA 3EZ5A 1JJHA 2EFVA 2GAHC 1K8AU 1RWPB 1MLAA 3LP0A 3BGRB 2KRRA 2CJYB 2P4TA 2MHNA 2ZNZA 2HBWA 2OD6A 4H4OB 3TZYA 2XYGB 4OP0A 3QZ8A 2EIFA 3TREA 3BGRA 3VYHB 1DLOB 2WACA 1SQFA 2AT1B 3CPWP 2DH7A 4H4OA 3MMBA 1KC8T 3W62A 3SWNC 4Q8EA 2C28A 2I38A 3SCIE 5E33A 1N6AA 3EHRA 3GNGA 1HIYA 4Z02A 2X3GA 5E3PA 5LJ3d 3W2WB 1X4EA 3LUYA 2E7WA 2JNJA 1J3TA 1JU5C 3VU3C 3OL6A 1S72T 4P6QA 2MMPA 4PFPA 1XK8A 4RBVA 1V3ZA 3TU4K 3NGSA 3BBCA 1KWMA 3META 4LQ9A 1MMGA 4M78G 1U6ZA 4MDWA 5J26A 2JC1A 3Q8VA 4PG5A 3VGVA 1WHWA 4F7VA 3TEHB 2G2ZA 3S3NA 4ECWA 5LJ3f 4JI4J 5KT4A 5FRMA 5CYMA 3EWGA 1MMLA 4IO1A 3PYFA 3V4IB 3M4YA 3I5RA 3BGUA 2MOXA 3V4IA 3QRRA 5AE1A 3DLHA 2ZPHB 4V19X 3RRKA 3Q8SB 2W9BB 2XG8D 4M75C 1NLOC 4BY6C 3TP2A 3AD8C 3MR5A 4ATOA 4I4BA 4NMLA 2YHTA 3JCMJ 1VK3A 5GAOr 2W9BA 4OHYA 1V6HA 2DNMA 5DM7R 5B0DA 5J1PA 3FUYA 3U23A 1IJFB 4MIBA 4PYAA 3K5PA 1X5TA 5IHNA 2D74B 5A6WA 2VIHA 4WF9Q 2J7KA 2QQAA 2CP0A 2WB1D 1LQ9A 3N6NA 1N5YB 4X2BA 2C0OA 2CWXA 5GAMg 2ZE2B 3TVKA 1AXQA 4J9DA 4UQGA 1N5YA 3ENQA 3WXMB 4K4WA 2ZE2A 3G6XA 1X9WA 1ZAVA 1AOJA 2FHMA 2ZITA 2X3XD 3BDLA 4P7TA 1VQ8S 3OYIA 2PD1A 2HD0A 3CCQA 1QJHA 4FS2A 1RLQC 5K14A 3OVSA 4DLEA 1MV3A 4M7DF 1HMVB 3BEGB 1GX6A 1YI2T 2ZHOA 5ETPA 5E3CA 2XMAA 4F4YA 2GAGC 4MAKA 1VQ6T 4P5NA 1B7TA 1TL1B 4NWBA 3NY0A 2PA3A 4RKUE 4Y28E 1HMVA 2E65A 1FX4A 4ZIVA 3M59A 3B82A 3CVKA 2W2NP 1O75A 1TL1A 3POTB 4JI6J 3J80E 1QD1A 3I82A 1Z2ZA 3R7NB 2KHDA 3JCMb 4YB1P 1S10A 3POTA 4O3SA 3AHUA 2Y8WA 4X4SA 3VYGA 4X4VA 2DIVA 2JDJA 1HNXJ 2AZ3A 3QGPA 4OX9F 4F50A 2DGWA 3A5ZB 3EGNA 2B51A 1WKJA 3J7YI 1DJ7B 3I35A 3FMWA 3AJ2A 5DDQC 4P7VA 2KVQE 4O0IA 4BDZA 4OMQA 1VQ4A 1Z1ZA 5IXFA 2EPDA 2CUDA 1KQGB 2JMAA 3W2VB 2BJ1A 4R8UB 4CZCA 2PEBA 4XU1A 1U1SA 3CD6Q 4PNOA 3MPYA 4X66J 3W2VA 4R8UA 1TU0B 1YJ9A 2CPEA 2DT9A 2GJ2A 1UFWA 3RESA 1HYSB 4H4KC 1WG4A 1UUEA 1I1GA 2DRAA 4OGCA 1Y4ZB 3T6JA 1CS4B 1FO1A 2ABYA 4OI1A 2OTLQ 4N8NA 1CS4A 3RR6A 1SJ1A 4JV5F 2KL8A 1H2VZ 1LWEB 1ZTWA 3HRSA 4M7AE 4JI5F 3KKFA 2AHOB 3HSGA 2UUCF 4ED5A 1LWEA 4J9PA 4NLUA 2HZAA 5K20B 3SBMA 2Y1RI 3W9IA 3IM9A 1WEYA 1JLEB 1AZSA 2AV5A 3IR5B 3LAKA 2DL4A 1VQ7Q 3UD4P 1JLEA 2QQRA 4AFSC 4TQSA 1Y0MA 2F5TX 4PR6A 4JRPA 2DNRA 1RTIB 1SQEA 1Y5IB 4HHHA 2MGZB 3VS6A 1T05B 1KTQA 3ICLA 2KFZA 4F17A 2EI5A 4OHVA 4BDPA 1RTIA 4A8KA 4DF8A 1IREB 2VYTA 2PGCA 1Q82R 2DL3A 2MGZA 1T05A 1TUCA 4HT7A 2E9ZA 3R7BB 4CH1A 2BOAA 4LRBA 1EIYB 2RHQB 3EXYA 4OLOA 1LFWA 1ZYQA 1V1CA 3LF0A 2OPQB 2XMFA 1RCOB 2R7VA 1S9GB 2OPQA 2FPDA 4NXMJ 2KO1A 1NNDA 5KFAA 1ZAWA 3CCUT 4FF4A 1S9GA 2JS0A 3BPSP 1RAOA 2K1RB 3OLBA 3T6BA 1K73U 2H3JA 4ZNXA 3MPWA 4A48A 2K1RA 2ASYA 2C0IA 3OFGA 3PM9A 2JTEA 2C2MB 4ELUA 3NLCA 3I56Q 1L3UA 3D3BJ 3GIKA 2UUBJ 4M5LA 3LW5C 3DC2A 3ZZRA 1ZHIA 3QDRB 3T1HJ 4IUTA 2EWHA 4QVDA 4JI4F 4U96A 4F8RA 3MDFA 3T5KA 4JZ4A 2VDIA 1D8YA 4CO5A 4QPXA 4K2JA 1AUDA 3OHBA 4IRCA 3VS0A 4ECSA 2RF2B 4M75F 2AWZA 4NCBA 2P5VA 1T9TA 4JJCA 3AOBA 3WHIA 2IPOB 3TZXA 2OFHX 4M63A 2RF2A 1VQNT 1NPKA 3OS0A 2ZNYA 2V6AA 1C2PA 4J7CA 3KXDA 3CJSA 2JN0A 1VBZA 2UXCF 1TSFA 2CJQA 3ZL7C 1RACB 1NJXA 2HZVA 4XTWA 4L74A 1M4ZA 2CJKA 2J0SD 4K4YA 2L2PA 4PYDA 2KYMA 4X4OA 1Q8BA 1VQKQ 2NUHA 3HHTB 1PHTA 5H9FJ 2YNIA 3UDEA 5CO7A 2KT5A 3M8ZA 4OYPA 1JLGB 4ZVTB 3CCRT 5GAOm 5I11A 1X60A 2IIHA 2XLIA 1FTRA 1T3LA 1ABOA 1FNXH 1JLGA 3FSIA 2LT1A 3BYRA 3WVEB 2VPZB 3MR3A 2CT4A 1B0VA 1KONA 2JJ4D 3LGMA 5JVGQ 2HBYB 1S72A 1BQXA 1JB0E 3FSYA 1G1XA 3FZBA 1N5QA 1K1QA 2K5FA 2ZZNA 3CD6S 1UW4A 3R9LA 3NS7B 2CP2A 5ETLA 4C2MA 4HVVA 2LCSA 2HLTA 1WI8A 3UPUA 4C5GA 2DYBA 2IYGA 4RNFA 3HPOA 3UNYA 2EYXA 5LJ5g 2C2RA 2LQWA 1UA1A 1QVGA 3FB9A 1TWBA 3P3DA 2EK1A 1ZM9A 4WFXA 1OO0B 2CPFA 4EZ9A 2JTMA 1NG2A 3VQSA 1CSJA 1HNXF 1QSYA 4ED4A 3MCNA 3TAPA 4TXSA 5GAN4 4GO5X 1A9NB 2ZDOA 2BX6A 3W7BA 2GMHA 1IO6A 4DZDA 4IIOA 3GCWP 3THTA 1MUZA 2BZ8A 1E6GA 1B70B 1KKHA 1M3BA 4X4NA 4OI3A 3GV5B 4HI1A 2XYHB 1Q8IA 1VQ7S 1ZSZB 4PG4A 2YKOA 3K89A 3RAQA 1KHCA 4GC6A 1TUVA 5KFVA 1ZSZA 2JVVA 1UGSB 3BZQA 2BM0A 4I68A 4C8QB 2FVSA 1HD3A 3QXEB 4C8QA 1I81A 2NXJA 2Q79A 1LEOA 3TJAA 2YWKA 1CSKA 2HHPA 1VHIA 3R6OA 2QXFA 1PCAA 1RI0A 3PZPA 5IFMA 1M1KC 1U2RA 4C97A 3OTOJ 3F73A 4DQIA 3I4HX 3I0RB 1HNZJ 3CC4Q 2ENMA 2X4JA 2J6TA 1NK8A 1G3OA 3I0RA 5IC6B 5M2PA 3K2YA 2V0NA 3EDRB 2BE2B 3M4XA 2H5JB 3NTIA 1W4SA 4FKYA 3RR8A 3I56S 2K3KA 2F9JA 4HVZA 2BE2A 2MPXC 2R7SA 4FW2A 4BC7A 2HQIA 3QYYA 5IT4A 3CCET 1WF2A 1YRUA 4XPCA 1HD1A 2ZUGA 2VPXB 4HT9A 2RNAA 1C4CA 4C0GA 2EVRA 5B0CA 3MCMA 2VFUA 4KYZA 2N7YA 4F2RA 2WSCE 2HGLA 2XHCA 2VPYB 4ID8A 3PW7A 4MMKA 1YK9A 4AQYJ 2JUFA 2VFVA 4LUBA 1X69A 3CTRA 4J9HA 4DCJB 2RQRA 4VUBA 4A8WA 4ECYA 4PXCA 4BI4A 1GXUA 1X4FA 2HVIA 1APSA 4NLSA 3ELHA 3VV2B 3DLLA 1P1LA 4JYAF 4FL6A 3WIVA 4DUZJ 4PJMA 5LJ3h 3CPWA 5D6XA 2BJ3A 3T1AA 1H92A 1VQKS 2UUBF 2ZEJA 1QMCA 3SSQA 2MSSA 4U95A 2JXBA 1TUDA 2HPUA 3J7AN 4FYVB 3IWLA 1NJIC 3PHTA 4OMLA 1T0JA 2XI2A 2DR6A 4MKAA 3ZZTA 5KFYA 1WI6A 2WVDA 1M5Q1 3HRTA 3X1LB 4LBIA 2PVDB 2X1GA 4M5IA 3NMRA 1BI3A 3A8KA 3R3TA 2HBPA 1T03B 4OQJA 4ECTA 2WSEC 3W61A 1T03A 3J81U 1WHLA 1WGSA 4ES3A 2DRDA 4UW2A 2V4RA 2H9ZA 3PE0A 3JTNA 3OFFA 1ZAXA 4ELVA 2D41A 2LMJA 3QBCA 3M9OB 3OW2A 4LR9A 2OEMA 3MGJA 4PL6A 1FKOB 2J9CA 4FZVA 2K7AA 5C5JA 4Q0BA 3ER0A 1FKOA 1V29B 2ZBIA 4ECUA 3MM5B 2QL9B 1PC5A 2C3YA 5J3BA 3D9BA 2K7KA 3MM8B 2RT3A 2DXFA 3MM5A 1KK7A 2N3LA 3CCUA 5AXMA 4B3OB 2ZC4A 4Y2MA 4IUQA 4L76A 3EH2A 3MM8A 1WXBA 4LT6A 1T3SA 1YJUA 3P5BP 4ZPCA 4B3OA 4C8OA 4Z88A 1WACA 4C8QG 2Z0GA 3MECB 5GMKj 4C9DA 3CCJT 2YRVA 1K9MU 3MECA 2MYFA 2EKHA 2D0QB 3QT7A 4C5HA 5I2MA 1FEEA 4OX6A 2V8GA 1REVB 4FSSA 2PEHA 2R5MA 4UZCA 4EBDA 1PAUB 4ZCMA 1REVA 3E9FA 4FW1A 2RQUA 4E6RA 1I51B 5GMKa 3NCQA 3FLGA 2HMAA 5AXNA 3CC4S 3M2UB 1EAYC 2N4DA 4OI6A 2KXCA 2PNIA 4K8RA 1NJZA 3L4BC 1VQNA 4J83A 1YHQQ 1RT3B 3M2UA 4NXNF 3W8GA 2IA0A 2HLUA 1N48A 2VV5A 4DOWA 3RMQA 4RCBA 3P4UB 3CDEA 3OLAA 1RT3A 2C42A 2RI5A 3ILOA 1IQZA 3OYNA 1E6VB 2O01C 2OTJQ 2AZVA 4XU2A 1N32J 4MYUA 1T95A 2DBBA 3R2DJ 2FL7A 1E6VA 7FDRA 3J7YU 2DGQA 2NSBA 3H2UB 4CC2A 4BLGA 1DARA 1U8SA 4I2QB 2WTFA 3AAWB 4NOHA 1WQ7A 1U1LA 2IMWP 4QVCA 1RQ0A 3HO1A 4I2QA 3CCRA 2IBKA 4ZP6A 1WNLA 1M8VA 1RI9A 1J27A 2AEFA 4Y2KA 2IG0A 3FDRA 2VDHA 3PEJA 2VG7B 4V1Ak 4XK8C 1AWXA 2IRXA 4OX8A 2LU2A 3OTOF 2VG7A 4LN2A 3GILA 1KC8C 3UA6A 1UZDA 2DR8A 1WHJA 3K5NA 2XC9A 4DR2J 4YDDB 4DEXA 2QX0A 1M5PC 1VOMA 1K9AA 1KHVA 2MPUA 4RTVA 2NLWA 2IAJB 2E1MC 1VA7A 5CD4A 1HFEL 5FJ4A 2HHQA 3FCVA 2CQ1A 2IAJA 4RW8B 2JNGA 3DRPB 2J5AA 2QASA 1OZ3A 4RW8A 2XICA 2XG8A 3DRPA 3G4ST 5LSOA 2V2KA 4I69A 5A0DA 5KT5A 2CDQA 2AJQA 2KXHA 3CJRA 4RG2A 3PYDA 2E1AA 3RB0A 4M95A 2IRYA 1Q86U 2MCNA 2AYEA 4AQYF 1TMMA 1K8AT 1IHWA 2ASDA 3Q83A 1M5OC 3KLHB 2HHUA 2M2BA 1NYGA 3NEKA 3KUGA 3EG3A 3KLHA 2O3DA 3HVRA 1U1RA 1QCNA 4RWXA 2RJFA 1L3TA 2RK1A 2EEYA 1G3YA 1LK7A 4XO0A 1HBOB 1D3WA 2LVWA 1UETA 2M0YA 4USTA 2NYSA 4DUZF 3EH1A 1FDBA 2FLOA 1HBOA 2OSQA 2MTLA 4YB5A 2LEPA 3KMQA 4NL3A 1ZSZC 4TN2A 2R7QA 5FIIA 3MEVA 2CAJA 2DD4A 3VS7A 3NNAA 2FJVA 2D8HA 2YUQA 4C8QC 2CVEA 3I9QA 2ZDPA 3UE2A 4WBFA 3VS2A 4DX5A 1FRXA 4PK4A 5KFWA 1DQAA 1F9HA 2GNCA 4B3RF 4WK1A 4LR7A 2HHWA 3FMBA 4JS5A 1U02A 1UG1A 3OSNA 2OFGX 4LDUA 4DUTA 3CCEA 1WC0A 2G2OA 1RTZA 4O6JA 3NGTA 1OSCA 3WVDB 2KDOA 2V8JA 4G3IA 2DX1A 4F0KA 5L9XA 1Q5YA 4KHMA 2ALYB 2CZVC 5GMKi 4P74A 3T9NA 4P2FA 2EGCA 1YVFA 5KCOA 2DVJA 2X9HA 2H5IB 3V7RA 1YHQS 3MD1A 1R8HA 1RTDB 4ZGDB 3S7RA 3HD1A 2N82B 3GONA 1X7VA 2EW3A 1RTDA 2MWOA 2OTJS 2LU1A 3JYTB 2HVHA 3AT1B 3PX0A 1U25A 2RUGA 1FWZA 3LX7A 2XHWA 4EEYA 4DQ2A 3JYTA 3CD0A 2WVCA 1F3FA 1NKCA 3OJSA 4HEA9 1KD1R 2LQJA 4QCLA 2LQ5A 4WWSA 1SPKA 4PPZA 2A6MA 2OX7A 2LKZA 1HSQA 1ZM4A 1RCXB 1BIBA 3EGDB 1OPKA 3AJDA 3HTRA 1UWBB 4QWAA 4LQ3A 2MIOA 3NCPA 2ZBCA 4I67A 4C0OC 3EGDA 1RHJB 1M30A 2FZGB 4WCIA 2O9VA 1UWBA 4RBUA 1MWYA 2EKNA 4OIXA 1R0BG 2RHZA 2YUPA 5D78A 1FXRA 3M4GA 2KB2A 2HBQB 1MSWD 4J90A 4DJBA 1NDPA 1X0FA 2CZ9A 2E9TA 4A54A 2HCKA 1X6BA 1KTVA 1U2FA 3N5BA 2F65A 1NEGA 3VQTA 1RAEB 3C3LA 3ZNUA 4Y28C 3NGDA 3REAB 1N32F 5GANd 1FA0A 3I55S 3JB9H 4J9QA 4K11A 4B3MJ 1B3QA 1RK8A 2WRMA 5IHIA 5KOWA 2HRYA 2RVJA 2HNIA 1SH2A 3CQTA 3IBCB 4WP3A 4N4GA 2E10A 2IMOA 3LOUA 3UVJB 3HF5A 1MWZA 2KRBA 4DX7A 1B0PA 3E19A 3OFHA 1DAXA 3OL7A 2Z0WA 1DJ0A 2M9UA 1S1NA 5GANf 3UVJA 2GF7A 3JCMg 3A8LB 3OQ5A 3CCJA 1C1CB 1H7XA 4JLGA 3OXLA 2A2DA 2B4OA 1S1TB 4J9SA 2COZA 3VS1A 3NMAA 3CW2C 3RB3A 1AFJA 2XZDB 2QO3A 1S1TA 2B6AA 4J7FA 2K6DA 2NYIA 3IWNC 4I6YA 4ERDA 4QU7A 2HS3A 1WHGA 4QVZA 2BV3A 3M30B 2J9DE 3QSIA 5KFDA 2R7WA 1LXNA 4LF6F 5FU6B 3FZ2A 5T41A 4DV6J 1LKZA 2CQ0A 3WC2A 1JMTA 2I5JB 2B9XA 2ZPEB 2YWFA 5E3AA 4IYQA 1D0EA 2KTQA 2I5JA 4AXIA 4Y2CA 3CSKA 3HSBA 5FW9A 5B0EA 5F3ZA 5SUHA 3HX9A 4NASA 2YLBA 2KM8B 1D9AA 4WXWA 3M53A 2JEGA 5DQGA 4ZLPA 2A10A 3D66A 4OV1A 3G6EQ 1XMOF 4G65A 3Q23A 1BGXT 4J9FA 2DEUA 1NJYA 1K73T 3GWCA 2CQGA 4FT2A 2L9DA 3C12A 2XO7A 1F9FA 3KG0A 2D9TA 3REBB 4JB8B 1YBAA 2HS4A 4JI0F 4ZVUB 4DV7F 4C8QF 5KYXA 3A8IA 1SBRA 2VL1A 3MMAB 4WU3A 3UCGA 3IMQJ 1F3VA 3MMAA 2YH1A 2ZCFB 3KNGA 1Q8KA 2KROA 2FZKB 3KHLA 2OIHA 2OTLT 3QWUA 4RTTA 3EVOA 1KNZA 3MEGB 1HW9A 1FEHA 3VAKA 3MEGA 1ZA1B 1HHTP 1BK2A 3THPA 3VV0A 3G4SA 5D8HB 5HK0A 3N0VA 5F9LA 3TVZA 3IRWP 2W9AA 1WELA 2E41A 4NOYA 4IFYB 3QYHB 4HH0A 2AP6A 2DE0X 1OX8A 1YJ9Q 1NK6A 3BKUA 1WWHA 1VUBA 2DZCA 4IFYA 1ZA2B 1WJRA 1Y71A 2RO0A 5D4PA 4LFCF 2RH2A 3PKMA 3U02A 1EX8A 3ZC4A 3H40A 3G1JA 2K4YA 1NHUA 4JI2F 3H98A 4D3GA 2PZ1A 2W7OA 2GMLA 2ZZMA 4FDFA 5CKBA 1WIEA 3H8ZA 4FF3A 3OYAA 3F0NA 3NGRA 1OV3A 3L1AA 2JM8A 3NGPA 2X1BA 1DTQB 2RHUA 3SEMA 4DDFA 1BC6A 5F8NA 4E2FB 1S59A 3E2UA 4F14A 1BD6A 5I21A 1DTQA 1VR6A 4JRIA 1M5KC 4N4HA 2F8EX 1PSDA 2IDEA 2DGUA 4U8VA 5GAHI 5RUBA 2UUTA 3OL8A 2XS2A 2U2FA 2Y90A 5HBMB 4ITSA 1LNXA 1RHQB 2X1AA 3DKMA 5GJWB 2ZOMA 5HBMA 1PKSA 4J37A 4ILRA 4QYRA 1DQ8A 3F44A 3R97A 3OMGA 2VBZA 3T9ZA 2JW4A 1OU8A 4DBRA 4R56A 5GAN2 4LR8A 4E7KA 1KOOA 4G6VB 3TZZA 5IS2A 4EZ6A 4A53A 1VBKA 2FZCB 3ET6B 2CP6A 2HQ3A 1UHFA 4M94A 2ZHAA 5B0AA 2VH7A 3ET6A 1N5ZA 5BR8J 2V2ZA 4OYBA 1B99A 3KHHA 5GAN8 4KBIA 5DDPC 1SIWB 3EPGA 2JRSA 2GHPA 1QP2A 2DHXA 1FD2A 1FE0A 4OB3B 2YWGA 3TW0A 3HHNB 1G7CB 5GAEI 3MMCB 5ETTA 1KD1U 2CPZA 1I1JA 1XTZA 3OY9A 5D7UA 5IWAJ 4GMKA 3MMCA 2DGVA 1Z9ZA 1QUPA 1TK5A 3L2ZA 1NZ9A 4NLTA 3LAMA 1IXKA 2EQKA 4N47A 4DWIA 4NA1A 2QEXT 5I3UB 3R5GA 4R5PB 3UFCX 2W25A 1Z4UA 4H4MB 1WC3A 1UFKA 4Q2MA 1UJ4A 3TEEA 1FJ7A 5LXRA 1FESA 4ANEA 1NM7A 3G6ES 5I3UA 2EYYA 4R5PA 3PVXA 2CJXB 4H4MA 3THKA 1OPZA 5IT0A 3UD5A 4RNMA 1KG1A 4MMOA 4DR7F 1FE4A 4B3TF 2YUOA 2WHOA 3M9QA 2MLYA 3PRVA 1U5SA 3JQJA 3NS5A 3DMJB 3EICA 4PJNA 3J81E 2VQFJ 3KJFB 4K7QA 3DMJA 1ZZFA 5EHHA 4LDXA 5ETNA 2XBPA 1SKRA 3Q8UA 2DPJA 3PR5B 4DV6F 2K3YA 4OYAA 3UR3C 4IQMA 2FY1A 1G2EA 4OMPA 1ULRA 1WKKA 4QW2A 2CNKB 3PJXA 3M55A 3ULHA 2QGGA 3PIPQ 4X64F 1PYOB 1VQ4S 3DRYA 3DGVA 2ZH9A 5EX3A 4LFAJ 1TKXB 2NWMA 5K8MA 2FRWA 3CDBA 1S72Q 2XMMA 4MK9A 4OFZA 4TYBA 1TKXA 3BPDA 1W70A 2EBGA 2KJWA 1O9SA 3GYXB 4YEAA 3ONQA 4JUVA 1LXJA 1B7YB 1YJ9S 3BDUA 2OLWA 4DPXA 3MZIA 4O3QA 4JUZA 3QATA 2VXEA 2MQQA 2GQCA 1D0YA 2K5IA 4CRIA 1K0TA 4USUA 5GAOn 4OVAA 2DEJA 4OB0B 3VRYA 2OPSB 2K2MA 5I42B 3NAIA 1X4GA 3D6HB 1MHNA 1SEMA 4IURA 2IIMA 4QQBA 4QWCA 1NSQA 3LWHA 3N5FA 1FERA 2OPSA 3GOXA 4D8KA 4ZK7M 3OTCA 1ZUUA 2YPYA 3OJUA 5EN1A 2FPEA 2B7BB 3ZZUA 5LSLA 1R31A 1CEZA 3P6YC 2MQOA 4DV4F 2ZGWA 4Y0FA 1KFSA 3TX0A 3CJTA 2E29A 2E5HA 1WYXA 4NYPA 1UB4A 3OYKA 2ACYA 2RRAA 2HEQA 4FXVA 1RA7A 3P49B 2Q6CA 4LF5F 4LRAA 2EJGA 2VG5B 3M6XA 4FXWA 1XNQF 2VUBA 2ZUAA 2NS1B 3UWTA 2DO3A 1QTNB 2VG5A 3HT0A 2DL5A 2KDSA 4CLZA 2CQCA 1BQNB 2DB1A 1RB0A 2X35A 2HHHF 2C2NA 4A63B 2IVFB 1I5LA 5FU6C 1BQNA 2J06A 4CM0A 3SCKE 2QE5A 3JCMc 2R7OA 2O67A 4RMOA 1YI2Q 2HHVA 2DYAA 2D9PA 1VQ6Q 2FUG9 1UVNA 4GBQA 2RILA 4J7IA 2KM8C 2MWPA 4MJKA 4ZCKA 4HI2A 1UEVA 5G0RB 1A6LA 1K9MT 2V8HA 3Q86A 2FC8A 3OBWA 1S99A 1JXVA 4RTZA 1K44A 1YJVA 5G0RA 4ZHRB 3FVYA 1YQHA 4M5MA 4ZHRA 3JAME 1YG0A 1PWTA 4F3MA 2BQRA 4MDXA 1NDKA 2OTLA 2R4FA 4ZITA 4C3KA 1SF9A 4BD3A 2EBPA 5J2MB 3M0QA 4WU2A 1JLAB 4BDYA 3OYGA 1Y7PA 3DN9A 4YR0A 2LZ6B 1TAUA 2F1FA 5J2MA 5IH2A 2R8KA 1JLAA 3WX8A 4ETZA 1I8FA 4LIRA 3BREA 1MV0B 2VHGA 2DEQA 2JFDA 1WHYA 4DPUA 3MUMP 5BR8F 3QNWB 3CO0P 1S9EB 4UOHA 3MFIA 3H2VE 2EFNA 3JCMX 2K7JA 1RUSA 2RHYA 1I07A 2ZOGA 1G4CA 1SB6A 1S9EA 4ALZA 4B08A 4N41A 2ZBPA 4O44B 3C14A 1HNWJ 4MYTA 1NDCA 2RJEA 4O44A 5GANh 3C46A 3VUBA 1U8RA 5H9EJ 4F7UE 4CNZA 4U6PA 3NWRA 2NUTB 1IKYB 3Q2SC 1UEKA 5GAN7 1U09A 1ICEB 2KNBB 3MO8A 2W2MP 3BKTA 2NUTA 1IKYA 2VKZG 2ADBA 4DBHA 1K8AC 5CXTA 3MFHA 1C0MA 2ZH5A 2E9RX 2DJWA 1PSFA 5F8JA 2BE9B 3W63A 5FROA 5IT9Y 4AUKA 1S72S 3C15B 1RI7A 4QIEA 5M2UA 1FWKA 3MCAB 2EC0A 2QYZA 1UGVA 4CM2A 3C15A 1YCSB 3Q2TC 1YDLA 2YXLA 3HHLB 1UJ6A 4TU7A 2DR9A 3SHWA 4CRJA 3AB4B 4F2SA 4DSLA 4FXDA 4MT1A 2UVVA 2ACMA 3K59A 2XZTB 3KLGB 3SEOA 5KFPA 2LXUA 1RISA 2MB0B 3RAXA 1GL5A 1MWQA 2AX0A 3G8QA 4LFBJ 1IZ6A 3KLGA 5GAMd 3RBZA 1ZLMA 5HK4A 3CC2Q 2M1HA 5J2QB 4UQTA 1WPYA 4XAKA 2G4BA 4AL7A 2VVKA 5HCKA 3ZZOA 3A3NB 2FO0A 1CC7A 1JIHA 5J2QA 1Q86T 2HQFA 5CHCB 4UOGA 2EJFA 2E66A 2OMLA 3PV8A 1LW2B 3TYTA 2DIGA 1GEHA 2X51A 3V6HA 1N27A 1YHQT 3Q24A 2E7VA 4LDVA 2K06A 1LW2A 5GAMf 5IOLA 2L89A 2YVSA 1RLDA 3A8HB 1XMQF 2D8JA 1X9MA 2EWNA 2OTJT 3X26B 4K2XA 5E3RA 3ASKA 2DITA 1H3HA 1TKZB 4XTUA 2FQQB 4DN9A 5FLXE 4JPBW 1TKZA 2QEXA 1CJVB 1WOSA 4GRSA 4IOBA 5DO2A 1PJ7A 3RDVA 2HHXA 2YNGB 2XULA 3A8EA 4HYKA 1VLOA 1DTTB 2D6FA 4FIBA 1NDLA 1CJVA 2A0FB 1IUJA 1KOHA 3ZO7A 5IQ6A 3KWMA 3C95A 1DTTA 1GT8A 1YI2S 3BGFA 3TR5A 3LGNA 2EQMA 3V5RA 1SL1A 1VQ6S 1X9SA 2DGSA 2UP1A 4NCGB 2JEIA 4O0NA 2MDAA 2B8AA 4NCGA 4WFAQ 2OP5A 2GTJA 4O3RA 3E1SA 1VQ9T 1IR1A 2DY9A 3DGPB 2PDAA 2J6UA 2V8IA 1FMVA 2EGAA 1RAJA 3DGPA 1M27C 5C6SA 1NJWA 1JX4A 4USIA 3D0GE 2OAWA 1L3VA 5HMXA 1UJYA 4QU6A 3HFVA 2AU0A 3GZ7A 3MM6B 1PBUA 3D4JA 3GIRA 3L95X 5IV4A 4LVOP 2HHSA 2Z2YB 3MM6A 3DM2B 4LBHA 5LJ5Y 4F4XA 3DM2A 2DKGA 4DOVA 4F4WA 2J7WA 2EPIA 2J7IA 2DH9A 2E5QA 2ZM6J 3OS5A 4EPCA 1QP3A 2ZJPQ 4DFJA 2GQQA 1J5EJ 4PG6A 5K8PA 1NM2A 5KFXA 2FJEB 4OF1A 1NKEA 5AE2A 3OTDA 2VD3A 3BR8A 2FJAB 5F0UA 3KNAA 5BYRA 1HD0A 3D3CJ 1U1TA 4NPOA 3BM7A 3V2UC 2WBMA 2DBMA 3KK3B 2XLKA 2P8IA 1L5UA 1T9VA 3KK3A 5J1NA 2YX7A 1S7IA 4ZIWA 2FB0A 1N9SA 4TLQA 1N0UA 5GAHU 2CZ6B 4DEZA 1YX2A 1RLCL 1EP4B 3CBOA 3OYMA 3CJ0A 1TKTB 2MHEA 5F0WA 1TELA 3AOAA 4RWWA 1NEEA 1EP4A 2XO6A 2GQVA 3PKYA 1TKTA 2PMHA 2M5YA 3ILJA 2QQSA 3RZAA 3ZZ0A 1GMVA 2KQWA 3SXLA 2M88A 3MAAB 3PXGa 4DR6F 2CG4A 1HNWF 3U7JA 3MAAA 3CC2S 4PJOE 1N36J 2JM9A 4WTOB 2HSPA 4OI0A 4CLSA 2YWHA 4JS4A 3MEUA 4OZNA 5LJ3e 4QIVA 4FYDA 1OYXA 3CCUS 1K0VA 5JMNA 2C22A 4ZPAA 2A08A 1N54B 2VB6A 5GAEU 3IAM9 3G71Q 2OPPB 2AGOA 1MN7A 1NJIR 1HKAA 4ZCIA 1IRXA 4C92D 2RHSB 3SFMA 5DQHA 5LSRA 4L3KA 3WQPA 2DTIA 1CVJA 2OPPA 2AYGA 1XQHA 1KQ1A 8RUCA 1X5PA 2HRTA 4NLVA 2HGNA 2XYPB 4M77D 1QSLA 3CCEQ 2XLJA 4OV6A 2DTOA 5B09A 1T3OA 3QAEA 1K73C 4IUVA 2IA6A 1FNOA 3HMJG 4ZCLA 2JSXA 2QRRA 4C8NA 5F8HA 1WDTA 2ZD1B 3CD5A 4Y2AA 3J7AF 1JJ2S 4OJ1A 4AXJA 2P9GA 2ZD1A 2RHXA 3E51A 1R0CB 4WFYA 2VODA 3VAIA 3WZ0A 2B56A 3GB0A 4X65F 2AHJB 3SQGB 3SWNA 4DV5J 4F0MA 4U67Q 3W1YC 2CUYA 3PACA 2CPDA 3SQGA 3CO9A 3CUNA 3K57A 1G3WA 3IRXB 4HDGA 4I1TA 2SXLA 3EVMA 1XIQA 3I4PA 3GLJA 4N5SA 1WLPB 3IRXA 3KFVA 2W24A 3LH0A 4IDKA 4MKBA 2QIFA 2PUKB 3BSAA 1MW7A 1NMEB 4PQAA 4EI2A 1VQ5T 2E1CA 1NXIA 3QJJA 4DI6A 2EVZA 2VU5A 1H0HB 3VHQA 5BYSA 4P2MA 5LJ5d 2R7XA 5D6WA 5I22A 3VKIA 3HCXA 2D1XA 5KH6A 2EKYA 3A8OB 2GZOA 3NTKA 4NYOA 5HN0A 2M4MA 3CCWA 3X28B 3INZA 2MI6A 5GMKm 4NA3A 2D1CA 3Q0AA 4LUDA 4OJ3A 2HFSA 1U06A 1G6BA 1GFDA 4KULA 1FDNA 3BS9A 2XB2D 3M2VB 4P2SA 5LJ5f 2ZJQQ 3MHXA 4WPAA 4D8DA 2FEIA 1BE4A 3M2VA 4YR2A 2E3IA 3FRZA 2K9GA 1QE1B 2XU8A 1RAAB 3ZFJA 4JOUA 4K59A 5HQLA 4V2SA 1PKUA 1X5OA 4C0BA 1U4BA 3GIIA 1VMBA 1QE1A 3AXMA 4OMFB 5AJ3J 1TK0A 2GVZB 1X4HA 4HH1A 3BN7A 2BRLA 4BE1A 1XR5A 3F70A 2C2OB 2LYVA 3FJ2A 2XI3A 2GVZA 1PBAA 2FLLA 4LF1A 5L8RE 3HHLC 1URRA 3JB9k 1RADB 4LDWA 3RBXA 3KHRA 1JLBB 2VOOA 2PVOB 1FRHA 2J76E 3MCOA 3R5DA 2DETA 2YTCA 1YHQA 2DZ9A 1JLBA 4Q8FA 4KHPF 4DQQA 4RUBA 3PJWA 3JQKA 4CO3A 1RU1A 2ZM6F 4FNHA 3H41A 1QVFA 1N9RA 1J5EF 3E2EA 2OTJA 1JXEA 4F7UB 1KC8R 3HKZD 1NLKL 4CLKA 3G6ET 5KFNA 3DLEB 4F7UA 1OYEA 2DNNA 3BO4A 2HFUA 3DLEA 2V8DA 2KFNA 3L7PA 4CCHA 2CDTA 4CH0S 4DV1J 1V5VA 2EQJA 1RT2B 4WFZA 1ZPVA 2FPFA 2CWKA 3RAMA 3M7VA 3MJXA 3G71S 1RT2A 3TQ1A 2VA3A 2M8DB 1U1PA 3FC9A 1VQ9A 2NXNA 1GCQA 3G7ZA 3EMTA 1AFIA 3CEYA 3UO0A 1NAQA 5IHKA 5EWGA 4TU8A 4QWEA 1Q78A 1RJJA 1X6GA 3CCES 4KPCA 4GVBB 4KC5A 3M6VA 3QGHA 1FRKA 4GVBA 3OS1A 1M1KU 3SV3A 1BKBA 1L3KA 5KOXA 2IRUA 4H4KA 2XWYA 1WF0A 2BKOA 5HANA 2CZ4A 1CULA 1EQ0A 3C4SA 4FF1A 1FI4A 1GXTA 2BJ7A 2COLA 1BYMA 2JH3A 3L7UA 2AIRB 5JUMA 4IKFA 3LP1B 2EC2A 4DS4A 4C92E 5KAKA 5LJ3Y 4J9NA 3NGUA 1HHQA 5KFZA 2DHAA 1Q0NA 4KE5A 5ETOA 3LP1A 1WUUA 4ZJLA 3B78A 1M2OA 2I1RA 2KSSA 2ZH3A 1X2QA 4ZVQB 2K8GA 3QPIA 1TL3B 4J6YA 2E3HA 3I5AA 2BKPA 1WFWA 4O3NA 2AGPA 2RMLA 3CULA 4NLXA 4FVCA 4WIQA 2ABLA 3FFIB 2IM1A 3TUPA 4ER8A 5GAOq 4X34A 4ELTA 2R7RA 4CLLA 2DTHA 3AODA 4QIWD 3FFIA 5IC4B 1XWLA 2GV1A 1UAWA 2CREA 3UN3A 2KH9A 3QO9B 2BJ9A 5GADI 1V3RA 2VFSA 2AGQA 3O8WA 4DL4A 4RTWA 4Z2XA 2VF3A 3TA1A 3TAMB 5L39A 1UFLA 3H5UA 3VAJA 1GFCA 1HNVB 2GCFA 5GMDA 3TAMA 4DL6A 1HNVA 1UEUA 1LVKA 4DV5F 1Y5LB 2VBXA 3LGHA 5GAMh 4DS5A 4DFKA 4OMFG 4WF2A 4M7DE 5HJXA 4ZLJA 2W9CB 1WJQA 4NX9A 2UV8A 2VBYA 1TG0A 1IVZA 2W9CA 4ZGJB 1PKTA 1NJIU 4A4EA 1KQSA 2C3MA 4ZVSB 3B4MA 5EWEA 4J9EA 1D09B 1OS5A 2JEFA 3UD3P 1LNQA 2DIUA 2DRMA 4AT1B 3RKXA 4ZPTR 4JZ3A 4RW7B 4DSKA 1D9FA 3H4BA 5KFCA 1M1FA 3CJ2A 4RW7A 3ISND 1HBMB 1ZBJA 2D0NA 1FRJA 1G83A 1SJ4P 3A8GB 4YB7A 1HBMA 1YSJA 1KJWA 2QA4Q 4KFBB 4NA2A 1U3OA 1T9YA 2XSJB 5DLFA 5ECAA 1NB7A 1EB0A 3CCJS 1Y57A 4F7UG 4KFBA 4JI5J 2RD1A 4Y2IA 3O5ZA 1V9OA 4ZJQA 2R2SA 3D1OA 3JB9D 1FT8A 1FYNA 1U1QA 4ED1A 3UW1A 1TFWA 1G2BA 4M7AD 2IM2A 1K9MC 2B8QA 2OI3A 3IGVA 2HNDB 5ADZA 4KUIA 2FVCA 3QKJA 4ES1A 2C3PA 2HNDA 2XGQA 5HK3A 5CZVA 3DLMA 1S1UB 3QMQA 1TL4A 3UT1A 2GGRA 4IOCQ 3KG1A 1I94J 4OB2B 2A2CA 2BOPA 4KHRA 1S1UA 1I4K1 3OV7A 3D7SB 2WONB 1VQLQ 3EHQA 4DHVA 3CCLQ 4WYWA 3GV8B 4Y34A 3OW2R 4DA4A 2JVOA 3G96A 2WONA 4TVRA 1VQ5A 2GX8A 1DLOA 2MKHA 4DN0A 4J9KA 3GJSB 4PXEA 2P0KA 1WC1A 5HATA 4M78D 2JT4A 1N8RU 2GO9A 2XIDA 4IIMA 1UVKA 3G86A 4RUCA 3PYEA 3QT6A 4LREA 3W2WA 2JJ9A 3BE3A 2YKPA 5FWCA 2D9OA 1X5SA 4FSXA 2O1PA 3G6VA 2GVDB 2RDIA 4WP9A 4OI2A 1GXIE 2RPNA 2VWFA 2A3LA 3T3FA 2LDYA 2GVDA 4DV1F 2QGFB 1BWVA 4RZRA 2LEBA 3SCLE 2NLUA 2UXDJ 4G1PA 3MCSA 2NUZA 3S1TA 3JSMB 2CG8A 5E0OA 1GAOA 1NKBA 2EGEA 3OW2P 3JSMA 2EYZA 5A0YB 1WXTA 3QHSA 2CP5A 3RG6A 1T9XA 1YIJT 3P5TL 1URNA 5A0YA 1JJ2R 3V6DB 4X1VA 4J9UE 1PD0A 3G4SS 4GVLA 2BBEA 2UXCJ 3V6DA 3GR1A 2RN8A 1WEXA 4O3OA 5IM0B 1HI1A 2O88A 5IM0A 1S9FA 3P8HA 4LNPA 1WI7A 2UV8G 4EWTA 2BABA 3A4TA 2NZCA 5D3GB 2LQ9A 1OMSA 2J0WA 2BKDN 1G5VA 2GIQA 5GAN6 2OELA 4F04B 5D3GA 3J80Y 1PCXA 3RJMB 4M75E 3ZTRA 2DO4A 4ZVHA 2DL7A 4FNIA 4M5NA 2K2PA 3QAUA 1YWPA 4EGLA 2ILZA 2CP3A 3KLIB 5H9EK 3CMAQ 4MFBB 3G6EA 3NKYA 1R77A 3KLIA 1JJ2P 4RBTA 4MFBA 3CD7A 2F2WA 3FSXA 3BH6B 1ZS6A 3KFWX 3HXMA 2L8DA 4L72B 2VJUA 2Y0BB 4N7TA 3B6BA 2DRBA 3ILLA 4NS5A 3M1VB 2E1HA 4N8OA 2QK0A 3CIZA 5DETA 2XTJP 2O66A 2RDJA 2QA4S 2P9CA 3TJ8A 2G6FX 5EUHA 3OYHA 3M1VA 2L0AA 1RXOB 3I9ZA 1S48A 3N4WA 4CP5A 4YTLA 2AKWB 1ACMB 2VXFA 2XK0A 1LK5A 4NYZA 1B07A 4HHJA 3WDOA 3OB9A 2XD0A 2KBTA 3DU5A 5AT1B 4BUGA 4TU9A 3K8VA 5DLGA 2VC8A 2CH4W 5CQYA 5KYWB 1GCQC 4BCAA 3BSOA 4EMKB 2PUOB 4UY8T 5KYWA 3ZXWA 4EMKA 4NZ0A 4Z8AA 5KE3A 1ZTTA 1KRPA 1NRKA 5A0GA 4X4UA 4C0HA 2QSWA 4QR1A 4FS1A 1EFNA 7FD1A 3RR7A 4L73A 2ATCB 1YBUA 3G8TA 3SFGA 2DNQA 3D54A 2CKWA 3GJTB 3R5AA 5K8NA 1IBKJ 2LJ1A 4J9BA 5LJ5h 3JQMA 3A1YG 2BEFA 1HYSA 5DLOA 1I5OB 5E5NA 1VQLS 2RJCA 3CCLS 2KY9A 2FD2A 4R0JA 1NCLA 2VA2A 4ZVPB 1M90U 4QR2A 2CS7A 1LCKA 1YTYA 2COYA 2FDNA 5LMUJ 3DNCA 3D2WA 4RTUA 3CDAA 2RJDA 1QAXA 2I8EA 5AYFA 1OSDA 1V5IB 1QDUB 2QAZA 3PVLA 4LJMA 3KG4A 3M9MB 2B9WA 3FGVA 1UVIA 2V50A 3AXKA 4J9IA 2ZH6A 1QLNA 1MMNA 1FDAA 2AYMA 3FRYA 2J6FA 2ASJA 1BI1A 1X0PA 3C2PA 3M8WA 5EGYA 1S6UA 2YWEA 1YKWA 1WA7A 2DL8A 1XMBA 1VHFA 2LCWA 3DRSB 1ZZNA 4RU9A 3RRGA 2DA9A 2KU7A 3DB4A 3QIPB 5H1SV 1I94F 2F4VJ 1PC0A 1O51A 4M78E 1X75C 3DRSA 4NMXA 3TO8A 2CUBA 2ZBQA 3QIPA 3JCMd 1KVJA 3CC2T 2CVIA 2RRNA 3CGIA 4F0HA 3C6UB 1AWWA 2V67A 3M8RA 2CNOB 2QTWA 1IBCB 3CPFA 1N34F 3HFZB 4FPRA 3C6UA 2ATLA 1S0NA 4OZ5A 1G8XA 2MLZA 3RU0A 4QIGA 3CCSQ 4C92B 4JYAJ 1VDHA 2ZH4A 1O0PA 2FYKA 4OHZA 1B4SA 1U7LA 5IZHA 3JCMf 2HVEA 4C92A 3PFOA 5KFMA 2DEIA 4C98A 4M77B 4DPWA 1RAHB 1WHHA 4J9OA 3MTJA 3MOJB 1CJUB 1JK9B 1S77D 4M77A 3K5OA 1CJUA 1W2BA 3C94A 4DPOA 2UXDF 5HI7A 3M8QB 4KBMB 3CMAS 4JV0A 2IVWA 3EFRA 4A8FA 2CKKA 2FVRA 3M8QA 3CB4A 3G6YA 2KE9A 3D0IE 2C0TA 1D8ZA 2G13A 3EGWB 4EIKA 1IHVA 4GY5A 3SDZA 3U27A 5C42B 3PNWC 2J6OA 1BQMB 2QV6A 4IQXA 4AFQC 2LNHB 3H90A 3D6TB 4CC3A 5C42A 4WZMA 3DLJA 3NP5A 1BQMA 2E5LJ 3TAQA 4GO7X 3HRUA 1NK9A 2GA7A 3JCMW 5HLFB 5EWFA 3TANA 4LF7J 1HPZB 1IQTA 1N0VC 2R8IA 4FT4A 3PFSA 2UVRA 5HLFA 5KT6A 4KO0B 1JQGA 4P75A 1KFDA 3OR1B 1HPZA 5HSPA 2QEXQ 4E7SA 2O9SA 3BO3A 3GF5A 2Z30B 3H5YA 4KO0A 3OR1A 2L5QA 2WCXA 4WK3A 1VQMT 3PIPA 4ILMA 1X6OA 2ZAEA 4XTZA 2FHDA 3QSUA 3TNVA 5KFHA 4IUUA 2RA2A 1EJ7L 1Q7YT 1BWEA 2IJRA 3KUEA 2M9KA 4YDXA 5D6GA 1WQWA 1ZX6A 2C3OA 4BC9A 4DMZA 1WDDA 2EQIA 5KFFA 1BB9A 3AOCA 1GNKA 4F7UF 1VC5A 2RK2A 2FLNA 5GAN3 2FG0A 4NLGA 1CKBA 2L3MA 5D0GA 3NWGA 1YJNQ 2UXBF 3MMJA 1O5JA 1UGRB 4A8MP 4KGVB 3M5AA 2OGUA 4USKA 2OTLS 1FX7A 2L3QA 1H7WA 4A4GA 1CPZA 4J9MA 1RDRA 1VQYA 3H42A 5KFBA 1KQFB 2A18A 1YIJA 5GADU 3HL8A 5LMNJ 2HBZB 4NXNJ 3UWNA 1NK7A 1R3NA 1M1HA 2XMWA 3GIMA 4FYXB 4KH1B 2YLCA 3OVBA 4F25A 2W2QP 1TFYA 4IUFA 2JOQA 1WTFA 3CE8A 4OHWA 1VI7A 2MY7A 3H59A 1K76A 4K4VA 1FMWA 4UOFA 3G9CA 3MPDA 3W66A 3UDLA 3CDUA 2OAUA 4YOEA 1LOJA 1EKRA 2HSEB 1T9UA 1YFNA 3PYGA 5CAAA 2ROTA 1UVMA 3NNCA 2AJ0A 3JRZA 1PNJA 1ITPA 2KVIA 5THWA 1IBKF 3OYLA 2LXIA 2JFKA 4QIFA 1VIFA 2HZCA 4GKJF 2XDPA 2H4YB 2AZSA 2VICA 3RRHA 3K0JA 4B9MA 3EE3A 2O31A 3TUJC 4C92G 1YI2A 4CLTA 4N4IA 1VBXA 1VQ6A 3M6UA 5LMUF 2E6NA 5DGAA 4BI8B 4M77G 3G71T 3D6MB 1VQSA 3OPKA 4KSEB 5DZ6A 4DOZA 5KG7A 2DNUA 4E7HA 1S5ZA 5DRKA 2J0XA 2ZBRA 4X9CA 3ZFVA 3K8WA 4P2XA 3G82B 4NEYA 3QUIA 1WNEA 3D1QA 4DXLA 2DXCA 2XZWA 1LOUA 4DLGA 4EMGA 4C8YA 1YGYA 3G82A 2FVPA 2IM0A 4O4RA 4YR3A 3EXCX 5J39A 1S49A 3TUIC 3SYZA 5KFIA 2DHHA 3LYIA 2ALZA 2F3JA 4NLRA 1TMJA 5CABA 2QLBB 1FKPB 2WSFC 2PQWA 3RKYA 2F4VF 1NSPA 4ID5B 1FKPA 5D0EA 4F02A 1C0UB 2H3EB 2Z2MA 3G87A 3PJ9A 3PRDA 1UHCA 4UT4A 5GANe 2CPYA 4ID5A 2QDLA 3L09A 1C0UA 3OSVA 3PFEA 4L75A 2AD9A 2LNVA 1K8AR 2BRKA 4WFNQ 4EUVA 1PO6A 4U7UD 3VCDA 4ESRA 1NH8A 4DF4A 2A6OA 4M75B 1VQPQ 3MM7B 2E5KA 3RNJA 1Q81T 3ZTQA 3CC7Q 4CH7A 5HL7Q 2J0QD 1TUWA 1TL7B 3MM7A 4PG8A 3CJKB 2QEXS 4DX8H 4EMKC 1AWJA 1TL7A 3FBEA 1XJWB 2RQKA 5IXBA 4LSZB 5KFKA 1XERA 3VALA 5GAMj 2ZOFA 1GRIA 3CJKA 1M8MA 1Q82U 5L1KA 3JV3A 2WW8A 1H38A 3I5CA 1QUVA 2LEAA 1Z2LA 4B3RJ 5HMZA 2RQVA 2HYIB 4ES2A 2FJXA 1U6FA 3SFUA 2LJ3A 2BW7A 2RQTA 3SZ2A 3S01A 1ZOTA 2E6ZA 5IQQA 4B02A 3H7HB 2B43A 1DBDA 1YWOA 2YNHB 4DU8A 3MR6A 1WSVA 1TR0A 1VFJA 2F8MA 2AMCB 2YNHA 3MM9B 4MMLA 2E5LF 1PD1A 1SC1B 3QWYA 3MEWA 3S3OA 1Q79A 2Z2ZA 1Y3KA 3CCTA 4ELZC 4RW6B 4LF7F 2I0NA 3DI6B 4ZP9A 2SEMA 3MM9A 4KGZB 3VJPA 1FTCA 4RW6A 4ZVFA 4QKUA 2DJZA 4XTVA 3CC2A 3DI6A 1H74A 3BJYA 3V8LA 2HMIB 1M5HA 2PIIA 3PW4A 1FWLA 1QAYA 3ZTPA 3MI7X 2HMIA 4WE1B 1FD8A 3PTWA 1C6VX 1IKVB 5LXYA 3AFGA 2OH2A 1BHNA 3HVWA 2LRQA 1HR0J 3RBDA 1WSRA 4PLLA 5DG9A 2HHTA 1SC3B 4JJNK 1JWWA 2ERRA 2FTRA 3ZTOA 3KLFB 3ILIA 2RMOA 4TYAA 3I5SA 1D3BB 2IHR1 1P1TA 1K0SA 1D9DA 3KLFA 1KLMB 2AEMA 1D3BA 4UC4A 4M7AB 1HW8A 3HSDA 1KHWA 1UGPB 1U0HB 2MZRA 1IGUA 1ZBTA 1KLMA 4C92C 1AROP 1XR7A 4M7AA 2R58A 1JJ2A 1U0HA 4IUPA 5CYQB 1W7WA 2W2OP 2V68A 1KIKA 2HFNA 4NZ7A 1S0MA 4M77C 5CYQA 3H0IA 3L9ZA 5L1JA 2EJ9A 5HP1B 4IRDA 2G3RA 4B17A 2UU9J 1UWAA 3MF5A 5LMNF 1TKDA 2JX2A 3ISZA 2Q3PA 1S1XB 5HP1A 1OY9A 4HL9A 1PYTA 4ED2A 1SG5A 3AB2B 1S1XA 2GW8A 1YN8A 4NCAA 2ZPIB 4A4HA 3LTOA 1OU9A 1X4CA 2BTTA 2KI7A 1TUGB 5KG6A 4K0KJ 4M78B 4A4JA 3R6GB 3VGSA 1GCPA 1OOTA 4M78A 1M0SA 4LMZA 2B8PA 4QW9A 4DFMA 4R0KA 4KUDK 1VQMA 3RB6A 1A0OB 4EYIB 3AJ1A 3O5TB 4P10A 2HWIA 1PAEX 1AWOA 3A3PB 4AG2C 3FNNA 2OHDA 4ENOA 3J7ZT 3UF4A 4J9VA 1Q95G 3WBZA 4AFUC 1JXOA 1SH0A 1BY9A 2DF6A 1CKAA 1VQ9Q 2CNLB 5DDRC 1QCOA 4LBPA 2E12A 3AHPA 4JI8J 3E01B 5B08A 1QAIA 2LDMA 3W5ZA 2KT8A 3QWXX 1VQPS 1PC4A 3E01A 2NZ4A 1XTDA 4A47A 4DV2J 4Y00A 2MQMA 1SV5B 2R42A 4OZLA 4X9DA 4DV0F 1B0TA 2CDRB 4DR4F 3TSZA 2HG4A 4NRUA 1SV5A 3JAMU 3IQLA 2PO4A 2OEJA 4LF6J 5A76A 2LC4A 1LWCB 2VJVA 1VQ8Q 5GAOl 4P73A 4RNOA 2F8HA 1ELOA 1B3TA 2P84A 3VR1A 1OI1A 3RW7A 4ETXA 2MEWA 1IR2A 4AL5A 4IH6A 1JRIA 3W9HA 4L6V3 2AX1A 2LXFA 2GFAA 3ETMA 3JCMh 1RTJB 2MMYA 4WJBA 1XMOJ 5J1EB 1OYDA 2RF0A 4RNNA 3N28A 3MURP 3TA0A 2KVQG 1N8RT 5J1EA 1EKSA 1ZM2A 5LL6S 4WFBQ 3T5LA 3FDSA 2MZ1A 5HVGA 4HLBA 4DL5A 1RAGB 2KKHA 4JI0J 2G2YA 2HL5C 4LRFA 1C1AA 4DV7J 4YHHJ 4PLIA 2G1HA 3MWBA 4FF2A 3H25A 1AEYA 2IVMA 1JEGA 1K73R 5FWBA 2B9YA 2MLXA 2P9EA 2NXCA 5ETSA 4A8QA 5E3QA 3OYJA 3IN5A 1R8AA 3M32B 2XCAA 3H5XA 5GMKh 3EGUA 3FBBA 3G71A 1VRUB 3QZ5B 3CXCA 2H51B 2QA4T 3GFYA 3PIOQ 2FHKA 4OMMA 3M32A 5EC7A 4KGMA 8AT1B 3JB9G 3SV4A 3IXQA 2GMJA 3HHLD 2YY3A 1VRUA 1AUSL 3FRNA 2ZPGB 3OL9A 4M7AG 3H5SA 3QQCD 4BBYA 2EQUA 1QSSA 1WOPA 4I2PB 4I6WA 4X84A 3MEAA 3M0TA 2BQ3A 3K7RA 1P9QC 4C8QE 3MMBB 3EUNA 2JWNA 3EZOA 1F5AA 4I2PA 5LJ5j 5KFQA 1UA0A 2JC0A 1WJ9A 2W4DA 5A8KB 1CLFA 5DGBA 1VISA 3P8BB 5L1IA 5A8KA 1J5OB 1V3SA 3R5CA 2HNYB 4LFCJ 2LDIA 1H2UX 3CWJA 3VAFA 1T0HA 5CR2A 1J5OA 2HNYA 4JI2J 2DXBA 2DIQA 1F6TA 2P0PA 3BSCA 3H0PA 1HR0F 1QVFS 1VQLT 1T9WA 3CCLT 2DFUA 1KVKA 3U1NA 1U24A 1WC6A 3VAGA 4PFZA 3MR2A 2HVDA 5CYMB 1HA1A 2CQHA 2VOPA 2X4WA 5HMWA 2QSFA 2L08A 1P8GA 5FLXU 4C92F 4RX6A 2E7XA 2ESWA 4N76A 3CJ3A 4Y91A 2XSFA 1RKJA 1SRLA 3OYEA 4ZA1A 1NBEB 4RL1A 4M77F 4IH5A 1RGVA 2DK3A 3QBYA 2DCLA 4IO9Q 2M0OA 1RYSA 4EMHA 4ED7A 3I96A 3FBCA 3EGXB 1U6BA 1FVSA 1VQ9S 2UU9F 1CQNA 1HQEB 4RJVA 3EGXA 3HHDA 3HSZA 1HQEA 3ZTSA 4M4ZA 2NXEA 4ZLLA 5FDLB 1VQ5Q 2Q43A 5CYJA 4IH7A 2HURA 1N5TA 1WG1A 2H5EA 2PU9B 5FDLA 3THVA 4RKUC 2DXUA 2ZPBB 3QJPA 3M0RA 2DKOB 4K0KF 1D1CA 4LXCA 3RBBB 3HK2A 5AXKA 2G0IA 5K14B 5C25B 3HP6A 2BXJA 1YP5A 4HKEA 3IG1B 3R6NA 1RABB 3LGLA 1DQ9A 2ECZA 3HHEA 3MTKA 5C25A 4UUXA 3IG1A 4M5HA 2D3ZA 3AQOA 4KAIA 2H48B 3NFCA 2MZJA 4EO6A 3U1MA 4CDIA 3IS9B 5CKEA 2ZFHA 2GBQA 4E8UA 4G1QB 1EX4A 1MMDA 5HQ8A 5D15A 1XOVA 3CJQA 3IS9A 1BCMA 1M90T 4G1QA 4OGEA 5KTQA 2EFPA 5KG3A 1H3DA 5BXIA 3GLXA 4JI8F 1C1CA 1S57A 1SUQB 3ISNC 4DR7J 2AQ4A 4DQSA 4B3TJ 3H2LA 3CMAT 2VUGA 4K5SA 3LP2B 1SUQA 4DV2F 1UECA 1S1VB 1T02A 1C4AA 1F2HA 3LP2A 3TJ9A 1WHMA 3PT9A 1DURA 1S1VA 3JB9J 3M30A 3GFZA 5KYUB 3LANA 1F9EB 2KJVA 2P6SA 4M1KA 4NLDA 5AE3A 3QFWA 4B3SJ 2HRUA 3H4DA 3E8OA 5KYUA 3OTBA 1N4LA 2K5LA 4M7AC 3QLHB 3UDCA 5ETQA 4ELYC 1PRMC 2ZH8A 4DL3A 1VK8A 4C3MA 3Q1JA 4OZ0A 2YUNA 2QT7A 3TEGA 3QLHA 4X64J 3IO1A 2RD5C 2CPIA 1KQSS 3LWLA 3C6TB 4PWDB 2KRSA 5GJVB 1N5SA 3OSPA 4PPDA 3C6TA 4PWDA 4RTXA 3IWXA 1T3NA 2O5DA 2VC1A 2ROEA 3G8SA 3FEXB 2BVZA 4CLPA 4KT0E 4ZMMA 3IFEA 4F4AA 1FCAA 1D1UA 4BS2A 1NUEA 3HLUA 2VGMA 2KXDA 4LF8F 4YHHF 1RBLA 4ZTFA 3VAHA 2Y1IA 4ED3A 3IBFB 2K57A 1AZSB 3GBQA 1FRLA 5K5MA 4KPYA 2JLFA 2QMXA 4M78C 4N77A 2C2KB 3MEDB 5D0HA 2DXEA 3LPEA 4USVA 5HMYA 3HHKA 3CDWA 3MEDA 2N4CA 4ILLA 1Q7YC 4DV4J 3NHNA 4CTAB 2CYZB 5GAMe 4RUGA 3ZNJ1 4Z7CA 2HQEA 2XEXA 2QYCA 4USWA 2EK6A 1UCNA 4CTAA 5JXSA 3LWIA 1YJWT 3BH7B 3IR7B 1LW0B 2HKQB 2ADCA 2FGCA 2KXNB 2CQBA 3M9NB 4KB7A 2RQ4A 2W01A 3KLVA 2HVZA 1U2CA 4LF5J 1LW0A 2M52A 2FJDB 5MLCV 1N56A 2F40A 3A98A 4ZS6A 1XNQJ 1Q16B 2GS8A 4MZPA 3D0HE 2Y8YA 2H1YA 1FXXA 1HNIB 5EX0A 1IBMJ 1R8CA 1U1OA 1F5CA 2QMUB 2WVBA 2ZH7A 4DEYA 1VBYA 2HHHJ 1VIOA 1HNIA 3KYLA 3BR9A 2YSQA 1VQ5S 3BV8A 4HHUA 1FFSB 5GAGI 2IM3A 3MEKA 4OI4A 4WKRA 2L48A 2N7CA 5CAIA 4DSFA 1P92A 4C6AA 3MXHP 1NLPC 4PJLA 3UN5A 3OVAA 1Y07A 3LH5A 2J7UA 2KGTA 3ADAC 4JLIA 1FF2A 2G1DA 2HQHA 3BQ1A 3CCST 2Y3YA 3K17A 4OJGA 3U1LA 2P0QA 2X3DA 2B4PA 2MZQA 2ZKUA 4FP9A 1WOOA 2ROPA 3DRRB 2PA8D 2LTOA 3FQLA 2XM3A 2CSQA 1K4US 4O3PA 4HTJA 1K9MR 3DRRA 4W98A 2QA4A 3HP9A 4ZGEB 2LQBA 4JP8A 5GMEA 5B7WA 4R55A 3I9V9 1VC6A 3KDOA 1O8BA 2QQ9A 1DRZA 4ZTJA 2F2XA 3FK4A 3NG8A 2G0CA 3IAS9 3NOCA 2ZHBA 1CQMA 3OXGA 1HARA 2KZMA 1LJOA 1JB0C 3HDSA 3DXSX 3GTYX 4CLUA 3VGTA 2YNIB 4CLFA 1QKXA 5LJ3j 4EMDA 2HQXA 1D0ZA 4ED0A 2C1EB 3I0SB 2APOA 3JXOA 4FYYB 3FCHA 3HJVA 4FBTA 1R43A 4P71A 2A28A 3ENAA 3I0SA 1IKXB 4ME7A 4Q2LA 2YKNB 4WXOA 2JZ2A 4II1A 1SC6A 3DLBA 2RAQA 1IKXA 3CCVT 2FRYA 2YKNA 3J81Y 3ENWA 2MSTA 3OQ2A 3CIMA 5EDWA 3KK2B 1MN9A 2DERA 4ZVEA 1VQLA 3PMTA 5C7PA 1XN9A 4D6WA 2IBOA 4XQ3A 3CCLA 2NSCA 3DOMB 2CZ0B 4TVAB 2DM1A 3KK2A 1M2VB 1S6QB 2RI2A 5HJYA 5D4LA 3W60A 4JI6F 3UA7A 4BB7A 4TY9A 1HK9A 4L59A 3DOMA 1M2VA 1S6QA 3DB3A 2BJ8A 2LX7A 1N52B 2UVUA 2DPIA 2CQDA 2DY1A 4CO2A 1E7OA 1E6YB 4NI2B 5CVIA 4K4XA 5G4DA 3Q8PB 1NU4A 6FDRA 3L2QA 1E6YA 4NI2A 3ITHB 1Q81C 4JI1J 4Y6IA 3QT8A 2MQNA 3FJ5A 3JB9F 1HWIA 3ITHA 2WOMB 2F63A 2YBVA 3GNFB 3RW6A 2XWXA 4C5IA 2QG9B 2WOMA 2L3PA 4M7AF 1BMQB 1YBTA 2QN6B 1YJNT 4B3SF 1SJQA 2HIYA 4HKQA 1H98A 5C24B 5F3TA 3PRBA 4LF9J 3CCMQ 2H54B 5C24A 4X66F 2DPPB 2Z8QA 3GQCA 1TXQA 3BDEA 2CT3A 2MJNA 3O44A 1NHVA 3BQ2A 1VS3A 3OSSC 2DVIA 3OUYB 1Q86R 2IVYA 1RUWA 4HXJA 1Q8LA 5F8GA 2CYYA 4NRTA 1WHVA 4BE2A 1XMQJ 4OJHA 4CT8A 3OUYA 2PT0A 1SCJB 2X7IA 2J9EA 7AT1B 3RYLA 1KSWA 3QZ9B 3MPUB 2E44A 1UVLA 2MQPA 4M78F 3OYCA 4FN5A 3SB2A 4J5OA 2WSCC 1QVFR 4R25A 1TV6B 4QR0A 2EYQA 2HAXA 3J7Z5 1WC5A 2RQCA 4GKKJ 2W8KA 2KG1A 3VS3A 2ZH1A 5CCAA 5I42A 1TV6A 1I6JA 1Q82T 2Q1LA 3CNQP 3OBYA 5I3QA 1R0AB 1YIJQ 5CKFA 4M5KA 3CMAA 1V76A 3NPFA 5DQIA 2OSRA 3TI0A 2G9OA 1R0AA 3B8HA 4PWUA 2V63A 1Y00A 1GTEA 4IG3B 1VIEA 3N9UC 2QMWA 2LX9A 2QA4G 3PHEA 2N3OA 4IG3A 4QYZJ 5F9NA 3EG9B 2FVUA 2KYBA 1OX9A 3JSCA 2ZWOA 2Z4PA 1IJEB 2W7AA 1VIXA 2GFFA 2A7YA 5HAOA 3EG9A 3WIUA 5HQMA 4QJVA 3DLKB 2HQCA 4QBUA 4NXMF 2YNFB 2LA6A 2YXYA 4ANJA 3DOKB 1QVFP 1IBMF 3DLKA 4NZ6A 2YNFA 4RLEA 4ANCA 1WTBA 1TZ0A 3DOKA 1PRLC 3UN2A 3KLEB 2WAQD 1SKUB 2E70A 2B9EA 5KG1A 4ZVRB 5LJ5e 3FQKA 4ZLNA 2KT3A 3JAMY 2SRCA 5KFRA 3KLEA 2R57A 4UOCA 2LQKA 4DSIA 2RDDA 3QPHA 3T1HF 2M7SA 3SD4A 4E7IA 3ENVA 1BCOA 2D3UA 2YKQA 3MEEB 3B54A 1K0XA 3HJFA 4DR3J 2DH8A 1QY7A 3LWMA 3KJNB 3MEEA 3X24B 4HTIA 2JLGA 2Y4XA 2V2QA 2CQPA 2B5JB 2NREA 1HQUB 4G1IA 5M2RA 2HK2A 2W10A 2BZYA 4NLYA 1XC9A 2VASA 1VQPT 1QWEA 2B5JA 3KTQA 1HQUA 4J9GA 2XMVA 3CC7T 1W2BS 2DGOA 1RU2A 1X4AA 3DOLB 3KUFA 2I2LA 1NPPA 3MR7A 1YNZA 3DOLA 5DG7A 4RTYA 1YZ6A 1UDLA 4Q0BB 3D28A 2NR0A 4MKVA 1KBRA 1RBAA 4XDCA 4U7CA 3Q22A 1YJWA 2UUWA 3KXTA 3HZGA 1ZETA 1DHMA 1UZHA 1UW9A 3X25B 2J9DA 1TP7A 3QZ7A 3GJRB 1Q4RA 3MP6A 4I56A 2CQ2A 2CJ9A 3OR2B 1QVPA 4CLYA 4DR6J 1OJ4A 5LT5A 4Y92A 3OR2A 4PKDB 4KGKA 4PXBA 2DK2A 2EFQA 1L3SA 1ZUYA 1KQSR 1U1NA 3PG9A 3CCMS 4F67A 1RWOB 5HY6A 2MZTA 1YITQ 3M0UA 3V8KA 3M8SA 2KRMA 2BZ2A 3JCMQ 2BR0A 1AA1B 5KYNA 4OYWA 3IGNA 4PJOD 3A13A 1VQOQ 3DHWC 2E1PA 5DJBA 4Y3CA 3QSYB 2FC9A 3HKSA 3CCSA 2RJZA 4Y65A 3RUBL 2QC3A 1M9SA 2EYWA 4TNOA 1T7PA 3S6EA 1S76D 3OYFA 4B9UA 4XTTA 2V1QA 1N8RC 2HFZA 4CWBA 1R8PA 5GAN5 2V8PA 3HHLA 4JI1F 4JI7J 4GLKA 4RPFA 3I87A 3ZZPA 2AKLA 4YMEA 2R3VA 3VAMA 1RLPC 1WEZA 2L9NA 1KS2A 1X4DA 1OPLA 3VUZA 1KQSP 4ZPVR 3PW2A 3HKWA 4EK2A 4E7JA 5J2PB 4DSJA 4TLRA 2VG6B 3CMEQ 4LVNP 4DCOB 4X65J 1G3TA 3FEZA 1YIJS 2HQGA 4ORZA 5J2PA 2K3XA 4QQ6A 4LF9F 2VG6A 4XTYA 1C1BB 2OKQA 5FLXY 1YJ7A 6AT1B 2UVWA 1ARKA 2B0GA 1S4FA 1C1BA 1ABQA 3NXZA 4A4FA 1RWVB 2CQIA 2KRNA 2QJ3A 2BA9A 2FIUA 4QT7A 4EU0A 2LP5A 2IFXA 1AT1B 1HLWA 2XY7A 3L42A 1PM3A 1NH7A 4LRCA 3X3UA 4NL5A 3CCVA 2QLXA 2MF2A 1HNZF 2D3OR 1IR0A 1W26A 2OJ2A 2B4UA 4C3LA 2BACA 3A8JA 1U48A 1WG5A 1JJCB 1X4BA 2OO4A 4GKKF 5FRNA 4FPIA 4J5YA 4UUWA 2KFYA 5LJ3g 1WX6A 4CQ1A 2YNGA 1F5BA 2XMUA 2A1BA 1U1MA 2R2RA 4PQUB 3QJYA 4KRWA 4PRFA 1RA6A 2EG1A 4HT5A 3O6QA 3ZZZA 4PQUA 3HFOA 4CO1A 2RHIA 4HT8A 4I0WA 3I55Q 2Z2LA 2DBKA 1D1AA 4N56A 4Q5WA 4L5GA 2BKNA 2CP7A 2BUDA 3OD2A 1YJNA 2MZSA 1AHJB 4ED6A 3TARA 4FM4B 1XBWA 4LIWA 5U47A 1FX2A 2HNZB 4USMA 4C7QA 3M6WA 3BY7A 2OD4A 1VQMQ 2HNZA 1X01A 5ETRA 3MP8A 3RMSA 3GYGA 1VQ8T 1QKWA 4OZ1A 2KR3A 2VFRA 2Z56B 5KFLA 2R8GA 3NRBA 1HHSA 1UP1A 5KT2A 1JNZB 3RKWA 4KHPJ 4XU0A 1H2TZ 2OUGA 2XMJA 5AXLA 2ASLA 2B86A 2PTKA 1DFDA 4OL8A 3TWZA 3LGFA 2XQCA 2GNKA 2YQ3A 1HJDA 1U45A 4DR3F 3V6JA 2JL9A 1IGQA 1AZEA 2QL5B 2F5KA 4QQDA 1UMJA 1F60B 2XS5A 3MOZA 4JV1A 2YDLA 1MU2B 1W1FA 5GAGU 3PDNA 1JNRB 1RHMB 4URSA 1MU2A 2VQEJ 1TL5A 1YITS 1W6XA 1SVDA 1U1KA 4V19J 2Y1JA 1JLFB 1M1GA 3EVWA 3LO3A 3BQ0A 4OZJA 5C2CA 2RB7A 1VQOS 2HAIA 1JLFA 3C19A 1Q53A 2FVQA 2NUUG 4MH8A 1M90C 2WZ1A 1FK9B 2F2VA 2RH3A 5IT9U 3LPYA 2HFOA 4AFZC 2V94A 2ZH2A 8ATCB 1VC0A 2YPZA 1FK9A 2HKEA 3H0FA 1GTHA 4WZQA 2HBRB 2YKMB 1FFWB 2LECA 4QQGA 2D7SA 2CZ1B 4ZVGA 2QTVA 2XI9A 2YKMA 3R7SB 3E9GA 3ZZYA 3HPWA 1R89A 3A1PA 3TVYA 3DXBA 4ZVOB 4MK8A 1FMKA 1ZM3A 3KMSA 1U26A 3CMES 4W4MA 3SMZA 5E41A 2FLPA 4C0ZA 4I7FB 5T7LB 1R8BA 4DL2A 2OJ3A 3OYBA 2AEJA 2DHGA 4ZPDA 3QGIA 4I7FA 3BKFA 5T7LA 4IOAQ 4PAAA 2UZAA 5B0BA 1JKHB 4RW9B 3KBGA 1WJSA 2DAQA 1DY3A 2R7TA 2EFIA 2BJEA 3OTEA 4AL6A 1JKHA 4RW9A 4DUYJ 2CXEA 4YN3B 1RT4B 1XEZA 3VVTA 2DJQA 5CH7B 2PVGB 2YWWA 2BANB 3GPLA 3M58A 1HL6A 1RT4A 2R8HA 4D3HA 3SQOP 5FU7B 4P72A 2BANA 1TTHB 1VQPA 2MXYA 4FKXA 3CC7A 4AG1C 1BI2A 4JI7F 3OS2A 2CGHA 3PX4A 1SHFA 2Q6BA 2O4XB 3AA8A 4ECZA 1SPBP 2UUAJ 3J7A1 3SSSA 1H72C 2EBEA 3N5BB 2RU3A 2W1BA 2O4XA 4DZ6A 5KFUA 5F8MA 1KP6A 3EZUA 4YY3J 1YBYA 4ZN1A 3ETOA 4OLPA 3TRGA 4ZOSA 3LH2S 1F0XA 1IM6A 4N0AA 2NQPA 3W5XA 3DYAB 3F56A 1BU1A 5KG5A 3V7CA 3EFSA 3DYAA 2G0JA 1CJKB 3QT5A 5I4MA 4RU2A 1OIAA 2ZPFB 1R7IA 1J2VA 3VVUA 4J6XA 1CJKA 4M7DD 4B9TA 2E1RA 4DFPA 2KG0A 1ZPWX 3A3OB 3A8MB 1PIEA 1WHKA 4CC7A 2P2CB 1YZ7A 3RIRA 4DR2F 1VQMS 1BI0A 2KK4A 2F4FA 2I9SA 1SH3A 4DPTA 4C0DB 4HA8A 2B6AB 3DKDA 4HACB 4Q7AA 3RGIA 3GIBA 1X2KA 2ZVSA 2A37A 1RHUB 4F16A 4ZDNA 1RYRA 4QW8A 4HACA 4P9SA 4USHA 1WC4A 1SHGA 3K58A 2MKCA 1Z9QA 2QFIA 4LD6A 4JRQA 2F9DA 3PEHA 3NMZC 1W2BR 4KT0C 1K1SA 1SKWA 5L23A 2FHJD 2E5JA 2IC3B 2EFOA 3LA0A 1SXLA 4JRKA 4CNYA 2AKKA 2X4XA 4J8OA 4WKYA 3CJ5A 2IC3A 2BW2A 4J9LA 4OYZA 1W2IA 3M2RB 2VPWB 1EIFA 2AJFE 3EG1A 3PY8A 2KXFA 2KI2A 4TQRA 3M2RA 3CCQQ 3DCAA 1QAJA 1YJTA 2FJBB 2AJ2A 1VYVA 5CD4H 3VZIA 2XY6A 4LF2A 2KZZA 3W65A 3MKDA 4PEOA 4JDSA 4L6V5 4LF4J 4CI0B 4F4KA 5LM7E 5KYXB 1PG5B 1NHKL 4IG0B 3CD6T 6FD1A 3GYNA 5F41A 3SCJE 1S1WB 1MGQA 5KE2A 1RE1B 4IG0A 2W8LA 3I32A 1T11A 1HWLA 5D6YA 3EM1A 1W2BP 2ROGA 1S1WA 2LP4A 3VZHA 2KEAA 2WK4A 4RO0A 4QOTA 2DD5A 1WHXA 1S12A 4HCBA 4HCCA 2VQEF 1CG2A 1GFWB 4KGXB 2LJ0A 4RUAA 1S6PB 4DCPB 3CF5Q 4B9XA 3GG0A 1VQ4Q 5M9OA 1JO8A 1B64A 1B34B 1QM9A 1S6PA 3CXCS 1K47A 3GIJA 1WZOA 1F2GA 1O6XA 1B34A 2EG2A 1SL0A 1TVRB