2YWWA

Crystal structure of aspartate carbamoyltransferase regulatory chain from methanocaldococcus jannaschii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
141
Chain Sequence
KVKKITNGTVIDHIDAGKALMVFKVLNVPKETSVMIAINVPSKKKGKKDILKIEGIELKKEDVDKISLISPDVTINIIRNGKVVEKLKPQIPDEIEGTLKCTNPNCITNKEKVRGKFKIESKNPLKIRCYYCEKFLNEVIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aspartate carbamoyltransferase regulatory chain from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
molecule keywords Aspartate carbamoyltransferase regulatory chain
total genus 31
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
A PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 2ywwA02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 2ywwA01
2QG9B 1NBEB 4E2FB 1TU0B 1ACMB 1ZA1B 1XJWB 3D7SB 1RADB 9ATCB 2BE7D 1EZZB 1RAAB 1AT1B 2BE9B 1R0BG 2FZCB 4FYVB 2H3EB 2ATCB 4FYWB 8ATCB 4F04B 1R0CB 2FZKB 4KGXB 5AT1B 1ZA2B 4KGZB 2FZGB 4FYYB 1RAGB 2AT1B 4FYXB 1Q95G 8AT1B 4KGVB 1D09B 6AT1B 1I5OB 1RAHB 3AT1B 2A0FB 2AIRB 1TTHB 7AT1B 1RACB 2YWWA 3MPUB 1F1BB 1RABB 2QGFB 4AMCA 2IPOB 1RAEB 1RAFB 1PG5B 4AT1B 1SKUB 1TUGB 4KH0B 4WTOB 1RAIB 2HSEB 4KH1B
chains in the Genus database with same CATH superfamily
1JLEA 1TU0B 3D7SB 3KTQA 2I2LA 1S6PB 5BYQA 3MEGB 1CG2A 2LTOA 5A0GA 3D2WA 2FLLA 2DR5A 3KLIB 1TXQA 4HT5A 2LYVA 3FNNA 3D3CJ 2LJ3A 3AAWB 4JV5F 1RT1B 5CCLA 3DRPB 3PX4A 5IXBA 4RTYA 3VTIA 3IRWP 2CJXB 2HWHA 3TVZA 2RQCA 4P7TA 5GAHI 1QQJA 4YMEA 1GFDA 2YLCA 2QMUB 3BBBA 3CJRA 2DJQA 2YWWA 1FDDA 2QMWA 2NUPB 1BQNA 3KK2B 2BZ8A 2CFXA 4DR2F 2V1RA 1XR5A 3U23A 5J39A 4OJ1A 1VQOS 5K14A 4RW7B 1AZSA 4EI2A 3OJUA 4M4ZA 4GVLA 1D1AA 4LF1A 3E9FA 3DLEB 2EKHA 2B8AA 3CCVT 2QO3A 4RW7A 3CCLS 9ATCB 3PVLA 2NYHA 2YVSA 5B08A 2K5IA 4EBEA 2AZ3A 4IKFA 1JJ4A 3BDEA 2DL5A 2YKMA 1JK9B 4KT0C 4PJOC 2VPYB 4AMCA 2RI5A 2OLWA 1OU9A 1IQZA 3TUPA 3MF5A 3MEUA 2VL1A 4QJVA 2DILA 5KYUA 1M1HA 8ATCB 2AKLA 2FHJD 2YX1A 2GHWA 1KC8C 2IVYA 1ZA2B 2L9WA 3MPYA 4DSEA 4IOBA 1VQ6Q 2K7JA 1B4SA 3CCTA 4LF9J 1TWBA 4WF9Q 4J90A 1OWXA 2L0AA 4C5EA 4DPTA 2XMWA 4TVAB 2LDMA 2RB7A 3JCMV 1HHSA 1RWUA 1IVZA 4ZKAA 5GAOq 3QSIA 3ZZUA 2HGNA 1VHIA 1UHFA 2A18A 2D6FA 1S0MA 2B43A 1U09A 3R6OA 1N5SA 2HFZA 4USHA 5IHIA 2AZ1A 4FS2A 2H3EB 3AD8C 2FLPA 3A8HB 5KG0A 1X43A 3JSBA 1WIEA 2V94A 3CCQS 3HVAA 2FB0A 2QE5A 1U06A 3OL6A 3CCSA 4B9XA 4USUA 2NLWA 3GBQA 3OY9A 2XZTB 3KNGA 2UZAA 4J9VA 4KH1B 2ZZMA 4K8RA 2BQUA 4KR0B 4OB1B 4TKTA 2C3YA 2RN8A 2HLTA 1T03A 2RSQA 3JSRA 3OYHA 3SDZA 1O0PA 4DV3J 2Z30B 1U0HB 1KR4A 3MEVA 2OPQB 1PSEA 1HJDA 4F0MA 4C8NA 3QAUA 2I8EA 4AXJA 4USMA 2ZBQA 4K59A 1UW4A 4OYBA 5KAKA 1VQ8T 4OZ2A 4G1PA 5H9FJ 2K2VA 2DEQA 4OHXA 4ZGDB 2HYIB 3E51A 4Q0BA 3QHSA 3S3OA 2AZVA 3HJFA 1C1AA 1PWTA 3OTOJ 4NCAA 2ZOFA 3G71S 1DZ5A 4OZNA 2XDDA 1RA7A 3LA0A 5BXIA 4ZCKA 1I51B 4ETZA 4TLRA 1WI6A 2YNIB 4FYVB 1TL5A 4M7AF 1Y9OA 3DLKA 1FWZA 5B0FA 5EWFA 4NZ7A 2RHUA 2XSJB 3HHKA 1BIAA 2G6FX 1SRLA 1T3SA 1OY6A 1FTCA 2F3JA 4KHPF 5CABA 2HNDA 3CPWP 4ZIVA 1T3OA 3C12A 5L1LA 3NAHA 4EU0A 4JJDA 5HN0A 2GQIA 3Q86A 1WD6A 2LXFA 1KWMA 5JJBA 1K0SA 3W62A 2B9XA 3OXLA 2HPUA 4AFSC 2CWKA 4BACA 3PJWA 3M57A 1KG1A 4LBPA 2L5QA 2K79A 4TYBA 2CDTA 4OX9J 1HBUA 4QW9A 3CD6S 3OYGA 1HD1A 4G3IA 1ZPVA 4LSNA 3EG3A 1LOUA 2JEJA 3TX0A 2CZ6B 3CCVQ 2JLEA 4FIBA 4NS5A 1GMVA 1OS5A 1AA1B 1MGQA 2XMKA 3DLJA 1S4EA 2BM0A 3ILIA 3OTCA 4O4GA 5LJ3e 4URGA 4OZ5A 3L3CA 4FDFA 2W2NP 1Z9ZA 1UGVA 2SEMA 4DR3F 2KNBB 4QKUA 4ECVA 3KK2A 3A12A 4ILRA 1JXMA 5FIIA 4DEZA 2JM8A 2GF7A 1S72A 1B0PA 1EX4A 1FXRA 4IQMA 4MK9A 3T3FA 4PEOA 2DNUA 3B4DA 1Y3KA 1NHVA 2YXYA 4F4AA 1H8KA 2G2ZA 2YKAA 5LJ5e 4ZPBA 4JUZA 3GPLA 3TU4K 5F8NA 3EG2A 4PR6A 1OPZA 4RUHA 1FRXA 2DNGA 2NR0A 1U2RA 2UUTA 1U4BA 3FEYB 3C14A 5IT9Y 4BHQA 3MR3A 4RNFA 3G96A 1SI9A 3PIPQ 1OMSA 2D69A 2R7QA 4OIXA 3A8OB 2AQ4A 1PJ6A 1D3BA 1C1CB 4DV2J 4Y2IA 2ZOMA 4IKAA 1RTDB 1IKXB 2AEMA 4DX5A 4AFUC 5HVGA 3J7A1 1R7IA 1K8AT 2O9VA 1JLAA 1JJCB 2CADA 2QFIA 3PTAA 2Z0WA 3H5YA 4B9NA 3SCJE 3OBYA 3E19A 4ATNA 1KC8R 4R55A 2PA8D 1G3WA 3H40A 2FLOA 3MCAB 4P2SA 3H0PA 5E7OB 3D0GE 2F8MA 2M02A 2H54B 4B3RF 1HHTP 4M94A 2WB1D 2RQWA 2EGCA 3M1VB 4XU3A 2DIQA 4Z88A 2K5FA 3HFVA 1IHVA 2YRCA 2VBXA 2U2FA 3JCMJ 4DSLA 4WBFA 2JN0A 4ILMA 2B5JB 1NDKA 2V50A 3CNQP 2P4TA 4ECWA 4KAIA 2HIYA 3M05A 4P6QA 4DQSA 2V4JA 1MMDA 3VGSA 5D6GA 2F7VA 3HVTA 2HVHA 1VI7A 5LJ5d 2E1PA 4FZVA 3JS9A 1S1NA 4IFYB 4RZRA 5AE2A 4C92D 1I8FA 3NKYA 3OUYB 1X01A 1HQUA 4FBUA 2F40A 2NZ4A 1XMOF 1K9MT 1I94J 2JFDA 3CC2T 1EIYB 3BR8A 3M59A 4L75A 4HCBA 1W25A 4PYDA 1AT1B 3K5LA 1R0BG 3REBB 4PL6A 2QN6B 2QA4G 2JH3A 4OZ3A 3K8WA 2C2DA 3NS7B 2E44A 5LL6d 1BQMA 4FPRA 2HBWA 1A9NB 5FROA 3GJRB 3R7SB 2CDQA 2BMBA 5GAN6 1YRUA 2IDEA 2LZ6B 2EG1A 4OMMA 1D0EA 3AT1B 4CNYA 4NEZA 2QIFA 3OTDA 2RHSB 3DB3A 5HK4A 2EWNA 2FJBB 3VRYA 5F0WA 3TVYA 4ILLA 3V4MA 2RA2A 4CTAB 1GNKA 1N5TA 3DOKA 5MAOA 2CT4A 1K9AA 3ZZZA 2KYMA 2R57A 1FJEB 2QEXT 4WE1B 4F02A 2MMPA 1N33J 2HHQA 4Y3CA 3BBFA 1BCMA 3GFZA 2WW4A 3KUHA 2C2MB 4AFZC 3RERA 2B4UA 1JNRB 2E1HA 4WFXA 5HMZA 4UQTA 4XIUA 1JLCA 2F8HA 2CPJA 1UGRB 2DAQA 5E3CA 1RT5A 2RQUA 5AXMA 1YRTA 4CLFA 4ZLPA 1X8DA 3M2UA 2QASA 2ZPHB 4FPIA 3DYAA 4CH1A 2BQ3A 4Q43A 3GG0A 2GFAA 3M6VA 1I1GA 4CQ1A 1S6PA 3TAQA 4DQRA 2ROTA 2MGZB 4DDFA 4IFYA 2IM0A 1N5VA 1WELA 1FRKA 2DL4A 3OTOF 4OX7A 1L3SA 3I4HX 3M55A 2DD5A 2E1MC 1OSDA 2PO4A 5GANd 1AFJA 4O3OA 5H9FK 4DPWA 3UCUP 3MAQA 4DOWA 2WOMA 3DHXA 4C6AA 2DHGA 1MU2B 2K2MA 5DETA 4M7DA 2FJXA 1XIQA 1IR2A 1SJRA 4ID8A 4JB8B 5I22A 3P5BP 1ARKA 4AQYF 2XZDB 2HHTA 4IOCQ 2PMZD 4AFQC 2UVWA 3P8BB 3G1JA 2EBGA 2AJ2A 2KN4A 2LEAA 4KBIA 2WTFA 5KG7A 2MZQA 5DDQC 1RCXB 5GAMj 1RHJB 2OUGA 4CH0S 2GIRA 4Y28C 4OHZA 2FY1A 5DQGA 2KI7A 3M32A 2EYYA 2ABLA 2MKSA 3PYDA 2H4YB 3HLUA 2E5KA 2BV3A 4NLUA 3SZ2A 3M0PA 4C4WA 5FDLA 3KMSA 1YCSB 4N4GA 2CQGA 3D9BA 3FB9A 4ZJLA 1RWKB 3GV8B 2P9EA 3HHNB 1V5IB 6FD1A 2B4PA 2GO8A 3QO9A 2ZPFB 1HI0P 3TQ7P 3KBGA 1HPZA 1DQAA 3LAMA 2OMOA 3BFMA 1T0JA 3I9QA 5CCMA 1PCAA 4OQJA 2K6DA 1B7TA 4F14A 3CC7Q 2E5GA 6FDRA 1XTDA 4I2QA 1SC6A 5KFIA 1RWNB 4O44B 2DH8A 1M2VB 3KLGA 3IP0A 2J7IA 3HZEA 1UG1A 1OYDA 4A46A 2RE1A 3ZZTA 3TEHB 1VIOA 4K4TA 3MTKA 1F3VA 2DEIA 4K4WA 1JMTA 1MN9A 2E6ZA 3OTEA 1E6VA 2P6TA 4HXJA 1Q81T 5IT9E 4AE5A 4WK3A 2BW7A 3MMJA 3G9CA 4RPFA 3UO0A 3GIIA 1YJ9Q 1CULB 3LO3A 1H2VZ 4IQXA 3CJKA 2VGNA 1CEZA 4ZVOB 5D8HB 3TUZC 2HBYB 4PUOB 4X4TA 4E7SA 4GRSA 2EGEA 1SF9A 2CQ0A 3I0RB 3QYGB 3JCMd 3F41A 3MP1A 3I9V9 5C24A 2CP3A 2V2ZA 1Z4UA 4M7AA 2NPFA 4KHRA 4JDSA 1UJ6A 3IM8A 1T0HA 2HQDA 4B3RJ 3CXCA 3QFWA 1V29B 3S6WA 4HTIA 2VXFA 3VS5A 4ICLA 2X4YA 3SWNC 2BW2A 2FTRA 2FUG9 3K5OA 1NSQA 2MMYA 4OMFB 3I9ZA 3S7RA 2P6SA 3MEAA 3OL9A 3MMBB 4DR6J 4NCGA 3PRDA 3M0UA 4XTYA 4YTLA 4QVZA 1XQIA 2EAYA 4K2JA 2F69A 2CKKA 3QO9B 1BWVA 1F9EB 2RPNA 1BQMB 1IQTA 3NTKA 3DDKA 1U0SA 1YJNT 3V7RA 1K9MU 3MUVP 4DBQA 5J1NA 3OT9A 1V9OA 5AXKA 1KD1U 3R1HA 4OYPA 4DUTA 1RAJA 3QATA 2HVZA 4A48A 5L9NA 2AJ1A 2F5TX 4MMOA 1Y0HA 3OS5A 3M4GA 2DERA 1PBAA 1TUVA 4M1KA 2OX7A 3KLFB 2AD9A 2KJVA 3AA8A 2IDLA 2WSFC 3KFWX 3RZAA 1VCTA 2G13A 4MYTA 2VYTA 4K4UA 1RL2A 4RO0A 3PMIA 4BC7A 5EX3A 4RJVA 2X3XD 3A3NB 2IVFB 4XU2A 3D1OA 4IG0A 5EG2A 2ZVIA 2DNLA 2J6UA 2F1LA 3ENVA 1N8RC 4M7DG 1X60A 3UWTA 3GILA 1PJ7A 3JB9H 2R4FA 2Y8WA 4NLVA 2V68A 2PEHA 5GAMe 3M0SA 4ZCLA 4ZOSA 4F7UE 3CMES 4IR1A 4X4UA 2KQWA 3KK3A 1FE0A 1D9DA 2EYQA 3IR7B 1HW8A 2LU1A 2BXJA 3G6EQ 3HSGA 2W9BA 2I0XA 4ZVSB 5MLCV 2MZSA 1JJHA 5C7PA 3JTOA 1N9SA 1U26A 4OJ3A 1HL6A 2BUNA 2QV6A 3LP1B 4FVMA 4OI3A 1X5SA 4DFPA 1B34B 3CCEQ 5J2MA 1M90C 2QL7B 2DT9A 2DPPB 1VRTB 1VQLS 2MDAA 4IG3B 5KE3A 1K0VA 4ZK7M 2WONB 5A8KB 4HH0A 1WA7A 1VQ8Q 2JVVA 2XKOC 1X9MA 4PQUA 3A3OB 3TYTA 5GAOn 2VU5A 2G1DA 3DN9A 3IR6B 3OYDA 1VRTA 1XMQF 1NK0A 3SSQA 1GCQC 1T9WA 4RTWA 1WHMA 4K50A 5LSLA 3RAXA 4LIWA 1ZQ1A 4ME7A 1RISA 1N34F 2GJ2A 2RIJA 3CE8A 2JTFA 3HM9A 2HS0A 3UNGC 5IT0A 3TVTA 1N9RA 3BKFA 5G0RB 2YNGB 2OP5A 3T1YF 4AL5A 1ACMB 3EUNA 1SXLA 1AOJA 2RK2A 2KEAA 3QYHB 4X62J 4KKOB 3QIDA 1W26A 1WHWA 5KFGA 2C2OB 4FP9A 1AXQA 4PG7A 2CVIA 1QE1A 2RKIA 3NL0A 4ZCIA 4H4MA 1VQOQ 1FD2A 3MHYA 1VQ7Q 4EO6A 1VBZA 3EFRA 1YHQA 2AHJB 4C3MA 1SCJB 1WLPB 1G5VA 1PSDA 4M75D 2OH2A 5KFUA 3S1TA 2VOPA 2R8IA 3MM9B 2K5LA 3GJSB 2R8KA 1UWBB 4ZPVR 1Q0NA 3PW2A 5K14B 3K5MA 4B9LA 1M90R 1T7PA 2DNOA 4MIWA 1SKWA 4JYAF 2RHYA 4ZP6A 2AMCB 3WIUA 4KBMB 1KP6A 4MFBA 1GXTA 4E0DA 2W1BA 1SKSA 4ED4A 3V6JA 1PGZA 2ZD1B 4C8QF 4DXLA 4MTPA 2QSWA 4C92G 1KQGB 5DLOA 3L95X 3I31A 4KIAA 2J6FA 3IG1A 4LSLB 2A08A 5AYFA 1W2BS 1AD5A 5A8KA 2V8PA 4C0DC 3D6FB 2YUNA 4F7UF 4B02A 1KOHA 5CCAA 3IG1B 3LAKA 3QG1A 1S1VB 4I6AA 5A8RB 3U1LA 4M75B 3MMBA 4EGLA 2GS8A 2HHHF 4PPZA 4ZHRA 2CNNB 3OFFA 4P72A 3VHQA 4QR0A 2W9AA 4RW8B 3OSNA 2XLKA 3CC2A 1RKIA 3M30A 2AWZA 2YH0A 2RHQB 2M5YA 1S99A 1H3HA 3I0SB 3CQTA 1FK9B 3CDAA 1JKHA 1XNRF 2P84A 3W61A 1O5JA 4WE1A 1U8SA 2R2UA 3M2VA 3LP2B 4I1TA 4JI6J 4NL3A 3OYAA 4F4KA 5GMKh 1VC0A 1TP7A 2C42A 3FC9A 2XY7A 3H2UB 2GCXA 4R25A 3MOZA 2HFNA 3LP2A 1T94A 5K8PA 1G7CB 1F9FA 3UVJB 3CCSS 4C8KA 3CCLA 5C6SA 2LA6A 5DM7R 5DGAA 2FLNA 3GTYX 4HI2A 2KRBA 2CIMA 2YX7A 2NUHA 2KYBA 5FD1A 1OEBA 3IBCB 3L09A 2VG7A 2DXUA 2VBZA 3E3XA 2KVIA 5CAAA 2GAGC 3D1HA 4IUUA 4JV5J 2ZH8A 3GP8A 2RRNA 3MM8A 3EGNA 3D6TB 2RJZA 1WPYA 1KD1C 4M75C 5ETNA 4ZPDA 1WTFA 5A8RA 5GADU 3KLIA 1C2PA 1E6GA 3QRRA 3T5HA 2VDIA 3O2IA 2KDSA 1S59A 2D1XA 4MMLA 2GGRA 1FD8A 1HWKA 2BACA 1SJQA 3HI9A 2V2KA 4YEAA 3B82A 3GCXP 3BO3A 3J80E 4PK4A 3C66A 1VQMS 2ZM6J 4BE2A 4BLGA 4M75G 3VF0B 1AVZC 2KHCA 3ISND 3HTRA 2GO9A 4C8QE 3OW2S 3IAM9 4L74A 1F5BA 1N27A 1W7WA 4XTVA 1LW2B 3PVQA 2VFTA 1UFKA 1PKTA 4JI3J 2KZMA 3LWLA 3FSIA 1Z9QA 1AUSL 4HR2A 2V1QA 3GIJA 3M32B 3JQJA 2F65A 3LP0A 3MZIA 1FMWA 4QPXA 1BB9A 4M78A 1M9SA 4C3LA 3D67A 4J9IA 3V8KA 2DTOA 3KLEA 5KT5A 2I0NA 1GH8A 2MQQA 5CR2A 5EWEA 4RUAA 2CSIA 1Z1ZA 2ASLA 2QFJA 5I3UA 4XO0A 3C95A 3CCMA 3ILOA 1M27C 4C0BA 3MKDA 4J9FA 1Q8LA 5D0HA 2DYIA 1PRMC 2HKQB 4DPYA 3OR1B 3ET6B 3VUBA 1JNZB 3GLJA 1QUPA 3PCOB 4QU6A 4XTWA 4UY8T 1YI2Q 4DBRA 1RTZA 1YJRA 4IUQA 2CQ2A 1KDNA 1W2BA 4RTXA 2M9UA 2B7BB 3OR1A 1TOVA 3QWXX 4OB0B 1HIYA 1YJ9A 5ETKA 4Z37A 4YY3J 2E5JA 2CZ1B 4XDDA 5KFPA 1BYMA 3R5JB 3RR7A 3LYIA 4DEYA 4Q45A 4HHHA 1AWOA 1RTIA 4NXNF 1S72S 1F9HA 1UHCA 4GY5A 3Q8RB 1AUDA 3SFMA 1IGUA 4W98A 1WFWA 4LFCJ 1OU8A 4K4SA 1HNVB 3G4SQ 2Y1JA 4CO2A 3T1HF 4JI2F 1IHWA 3MXHP 4OYOA 1KHWA 3D28A 3P3DA 5T41A 1G83A 2CPIA 3MCMA 2QA1A 1MW7A 3PGGA 3PW4A 3H25A 4X64J 4ZGJB 3VAKA 1M1KR 4FYDA 2DXFA 5I3PA 3OS1A 4KUDK 2QQRA 2I1RA 2O01C 3U7JA 1WI8A 3P4UB 1L3TA 1R0AA 4MJKA 4DOZA 4J6XA 4JLIA 1Q82U 3CMQA 1EIFA 3QT6A 1WOOA 3LWMA 2NYIA 3HHLD 2BRLA 4NLXA 1JU5C 2W7AA 1XNRJ 1B07A 3BE3A 3URGA 2F1FA 3CCET 3FUYA 1WXBA 2A3LA 4I64A 4C8OA 2PE8A 1NDPA 4I56A 1IGQA 1VQKQ 2QYCA 4EIKA 4MIBA 2X3GA 3DOLA 1Y07A 3D5MA 2LC4A 4DS4A 4E7IA 1FMKA 2RS8A 3POTA 2OFGX 1I0CA 1JXEA 2GC8A 5KFTA 2IAJB 4LSLA 4LRCA 4CO1A 3RAQA 1OULA 4A53A 1FT8A 3HRTA 4PKDB 2FHDA 4FT2A 4XTXA 5CQYA 5E3QA 4ZMMA 4O3NA 3UDVA 1T9YA 2AYEA 4HT9A 2Z2LA 1ZTWA 2L3RA 1WI7A 1NJIR 1IREB 2FZCB 2AP6A 2ZJQQ 4WP9A 3IFEA 1SPKA 1XR7A 3TUJC 2O2OA 1BE4A 2YHTA 3W2WB 3RDVA 4KPCA 2FG0A 1RYSA 3EGXB 2YLBA 2IJNA 2YWEA 1AROP 1UW9A 3AY0A 3SWNA 1NEGA 2EI5A 2VUGA 1JLGA 2LCCA 5J1PA 2JL9A 4DJBA 3PT9A 1NSPA 3HFKA 2HL3A 4C8MA 4OP0A 4NLTA 2LFVA 2M0YA 2MIOA 2R8GA 3DGPA 4ZVGA 3ULRB 1KKHA 3VQSA 4I69A 1RT7A 3A8GB 2AU0A 3NBPB 1CULA 4Z7CA 4IRKA 4MDXA 4B9SA 2EFIA 4TU8A 3VS2A 1PG5B 1S9EB 3JCMW 2R7RA 5GAGU 3JCMe 2DIGA 4DL6A 4CLUA 1NK5A 1K1ZA 1B7FA 4W4MA 4NYZA 3GU0A 2DITA 4QQBA 1GTHA 1JWWA 2EFQA 5B7WA 2GBQA 2NUTA 3NCRA 1OO0B 2WBRA 3M0RA 1R6YA 3CCLT 4XU1A 1FRJA 1WSRA 1QSSA 4EUVA 5C2CA 3HKWA 5HROA 4RX6A 5J2MB 2GHVC 2RH2A 2CP2A 3FBCA 1J3TA 1CQNA 3ZEHA 4MFBB 3QJJA 3I56Q 1RBOB 2CJBA 1JLQA 2FHKA 5GAN4 1KIKA 1Q7YC 5JVGQ 3N28A 1QCNA 1X4DA 2Y0BB 3JAMU 2JC1A 4J9RA 1M3AA 5FW9A 1K47A 3DC2A 1BWEA 2JLFA 3VR1A 3UWNA 2YUQA 1WWHA 3EM1A 1G3OA 1KONA 1REVB 5EHHA 3ASKA 2DEUA 4URSA 4TY9A 2DTIA 1FKOB 4BI8B 2DJWA 3G82B 2FQQB 1RUSA 3TA0A 3DRXA 4RWXA 2RF2B 3QRPA 3MHXA 2Q43A 3VZHA 5CH7B 5D3GA 4KKOA 3I5AA 4LFAJ 2CQPA 4V2SA 2UUCJ 4X9CA 5J2QA 3G8QA 4CO5A 1QLYA 3IWLA 2YH1A 4DR1J 4Y65A 2XM3A 4IO9Q 2VBYA 1UVIA 2C2NA 2YT6A 1LCKA 4DL2A 4P5NA 4C0HA 1XNQF 2R7WA 2FVUA 3E8OA 4WYWA 4IG0B 3T9ZA 4E2FB 2VG5B 1N32F 5KG3A 2JWNA 4LF4F 1VQLT 4B3TF 1LWFA 3CCMT 4NPOA 2PI5A 4JZ4A 4WCEQ 2VGMA 3LGLA 2DH9A 1RB0A 1Q86T 2C0OA 1KTQA 3AOAA 2MWOA 4ECZA 2R7OA 4ZN3A 4X65J 3QXEB 5DDOC 2NWMA 2XCPA 3DLLA 2CUBA 2M4MA 1C0TA 4QOTA 1N5QA 2E41A 4C2MA 1X9WA 2DRAA 4EYIB 4C8ZA 2QLWA 4QWAA 3HHTB 5L1KA 2C3MA 4IUTA 3MD1A 3OFGA 2HZCA 4TY8B 5D0GA 2X4JA 2ENMA 2V69A 2W10A 3CDBA 3NGUA 4YUDA 4LE9A 4DR6F 1RWMB 3J81j 3IAS9 4LREA 2MQLA 3F0NA 4DL4A 2LVMA 2DGWA 5ADZA 5HKCA 4M8LA 2QEXS 3RKYA 1UFWA 3MCNA 5KCHA 5KFYA 2Z56B 1XERA 3OD2A 1WYXA 1RK8A 1RDRA 2X9HA 1JRIA 2QC3A 3QLHB 1S6OA 2EFGA 3M6WA 2MI6A 2RILA 3CCLQ 5G0RA 2ZKTA 4G1QB 3H5UA 3V8LA 3MUTP 4LF5F 3EG1A 2LDIA 3ITHB 2HK3A 5IHNA 3D54A 1S77D 2VC8A 2Q79A 4GVBA 1LWEB 5GAMd 5CKDA 2YUOA 1HBMA 3VUZA 2BKOA 3VYHB 3QPHA 3JB9J 3H8ZA 1CJKB 3MEDB 2LP4A 3CIMA 1KHCA 3EGZA 1TUGB 1M0SA 4VUBA 2V6AA 2C1EB 1U1TA 2ZAEA 4M78F 1FWLA 3US5A 1PBUA 5KOXA 3JSCA 2GQQA 3QWPA 2JTMA 3A8IA 3OVBA 4LBHA 5I3UB 1VQ9S 3G7ZA 2JOYA 1NB2A 4C0OC 4AYBD 2XGPA 4ZTJA 4LIRA 2OTJQ 1LPLA 2HRTA 5BR8J 3MMAB 3S3NA 2GA7A 3I56S 2CQBA 1QVFP 1CJTA 1WHXA 2L3QA 3QAEA 2W4PA 1NJIT 3GG1A 1OPKA 1BI3A 2CPEA 2A2DA 4IUVA 3T6JA 1TL4A 2YNHB 4M5NA 1CLFA 4ECTA 1HD0A 2KE9A 3TJ8A 4Z8AA 1U0HA 3EFOA 2DL3A 4RNHA 3A1PA 1S9FA 3OJSA 2DLPA 3DRSA 3NTIA 4LRDA 1BMQB 5LJ5g 1KD1R 4RU2A 3ZTQA 3OUYA 2KTQA 3KMQA 3IR5B 2YY3A 2OO4A 1X7VA 3UT1A 2CNOB 2HQFA 1JLFB 4DV1F 4J5OA 1PYSB 2DKOB 3GLXA 5GANg 1VQSA 3KXDA 3RBDA 1YITA 2KDOA 1FEHA 3TAMB 2LEPA 3IMQJ 1R31A 3GPAA 1RAOA 1BKBA 3EZOA 3L7PA 4MIAA 3MCSA 1C4AA 1HMVA 4DMZA 1LK5A 1MG7A 3GE9A 1BUXA 4J6WA 1CJVA 6AT1B 1B3TA 3EAEA 3TQ1A 1DRZA 1GMUA 4LF4J 4LSNB 1G3TA 5EWGA 1OSCA 5HROB 1S49A 4ER8A 2UVVA 4KH0B 3HZGA 4BE1A 3SSRA 5CO7A 3DDIA 2KL8A 2KU7A 4UTGA 3HFZB 3RB0A 1YJ9T 5F8IA 2MJNA 4RWWA 1U3OA 2FGOA 3R6NA 1RLDA 3HP6A 2PDAA 3UVJA 2EJGA 1HBNA 1RHRB 1JLBA 1S7IA 4U7UK 2L41A 2CZVC 3D6HB 1YNZA 4DCJB 5AE1A 2MQMA 3VS4A 4YS2A 3CXCR 1IJFB 1QW1A 1TKZB 4DUZJ 4CC3A 3QFHA 2RM4A 1JB0C 4OX8A 1KLMA 3CC2S 2N4DA 5EX0A 2JZ5A 4LD6A 2OJ2A 2J0WA 1W2BR 1NM7A 1U1KA 5J2QB 4M5KA 2KXDA 2CDRB 2V2QA 1VQ7A 3QGIA 4M78E 2EKYA 1KC8U 5DM7Q 3AJ1A 3W66A 1X0PA 1RYRA 3EFOB 3NOCA 2C2KB 2FVQA 4MMKA 3NAIA 3QJPA 4AQYJ 4IIMA 2KXHA 1AZGB 1NYFA 2YKNA 4EEYA 3QDFA 1IBLF 4C0FA 3ZXWA 1R8BA 3CCEA 2DMOA 4PWUA 1KFSA 1YBAA 2Z8QA 1BI2A 1F1BB 4KB7A 3BZQA 4RKUE 5CQXA 3RUBL 2VPZB 1EETA 4DI6A 4B3OB 3TSZA 3V81B 2M0OA 4F67A 2GQVA 2FPFA 2KFZA 2D3ZA 2KT2A 1Y0MA 4Y2KA 4LDWA 5GAEU 2KG0A 1X4HA 1JXOA 4OI4A 1YITS 2BJEA 5E3RA 3NY0A 2P8IA 1IXKA 4J9UE 3QZ9B 2O4XA 2DBBA 1RT6A 2GQ2A 2QL5B 1T3LA 1TV6A 5KFNA 3X3UA 4C3KA 4OF1A 2A36A 3BGUA 3RR6A 5FLXY 1WORA 4OYZA 4IDKA 1UZDA 3HD1A 3N01A 1UB4A 4QW2A 1LWCA 5K5MA 1OPIA 1G2EA 3CJ2A 1NUEA 3NWGA 5D4OA 5AT1B 2YNIA 1LWCB 3UATA 2DE0X 5M9OA 2RU9A 3NCPA 1VMBA 2GJFA 1YP5A 3C6TA 1KN6A 3AJDA 2X7IA 1YDLA 2IYIA 4E7KA 4MH8A 4CO0A 2ASJA 1A0NB 2HBPA 4RCCA 4DQ2A 1CS4B 3OBIA 4OX9F 2LMJA 3C6TB 4KGVB 4C0ZA 2CH4A 3F44A 3LGHA 3H59A 2XNQA 2HIQA 3IRXA 1TKTA 1YLXA 1E6VB 3OYKA 3OL8A 3WBZA 4HHUA 5A6PA 1R27B 1PNJA 1MROB 3LOUA 3WXMB 1C1BB 1SIWB 1P9YA 3W5YA 4JP8A 4B9VA 2QQBA 4PJOG 1HQ2A 2P5VA 1RAEB 4DL7A 3A5ZB 1FDAA 2E5HA 5HSPA 3M8QB 1M90U 3FQLA 3H6ZA 2J6KA 2HHXA 3NTHA 2MY8A 2UVRA 3TZXA 3BYPA 1DTTB 3OV7A 2UUBJ 3G6XA 2A1BA 4M7DD 3CMAQ 4CNZA 2HEKA 3DFEA 1Y11A 3TA2A 3HVRA 1VC5A 3G8SA 1UP1A 2PC6A 2FYKA 5J2PB 4WFBQ 3CCUT 3L2ZA 3A8KA 5IS2A 5HL7Q 3VS1A 4NA1A 2CA9A 1FX2A 2HNYA 1U2FA 3EDQB 4PJOE 4LVNP 2OFHX 2PN6A 3CJ8A 2IJFA 3V6KA 2R58A 3QBCA 4NCBA 1X5PA 3EH1A 4JJCA 1RBLA 2DRBA 1MMGA 3WHIA 4U67Q 4EBCA 4ED8A 2IFXA 4FYYB 3OYFA 1VQNS 3JB9G 1MNEA 3JCMg 3KJQB 4PJJA 2J8SA 2XC9A 3DLGB 2KB2A 1M5PC 5A6WA 4C97A 3P5TL 3PNIA 4TN2A 1QVGR 4NASA 2BQRA 2IA6A 3ZZYA 1UDLA 2V4JB 3J7ZT 2RRBA 1LK7A 1U1QA 1NJZA 1JLAB 1KHIA 2RUGA 3AJ2A 4DQQA 3CW2C 1U1PA 3THVA 1VQLA 4CIOA 2YKOA 4OI2A 2BJ9A 1V3ZA 3MM5A 1OX8A 2I9SA 1DQ8A 2KXNB 1TZ0A 1M2OA 4DQPA 1MROA 4GKKJ 2A6OA 2LMIA 4UZBA 3PMTA 2VQFF 1U25A 3U02A 2PZ1A 1X6OA 4FVCA 2ZNZA 4XK8C 2R2SA 4EO8A 2D3OR 1ZETA 4CI0B 3HFOA 1NZ8A 4U6PA 2CPDA 3C46A 1JJ2P 3UE2A 3HF5A 5THWA 5AJ3F 1HQEB 2XB2D 1NJIC 4OZ1A 2IVWA 3I5RA 2VF3A 3A8MB 2VA3A 4CO4A 3EG9A 3DOMA 3QQCD 1D3WA 1Y3JA 2V8JA 3JCMQ 4NL5A 1RWWB 4M7DF 1I3OB 1RHKB 3WZ0A 1GCPA 3K17A 4DR2J 1WF2A 1RUWA 1K8AU 1YK9A 4GBQA 3BKTA 5DS7A 2RDDA 1FESA 1U8RA 3CCWA 4D6WA 2L3MA 1G8XA 4WXWA 2HQXA 3PRVA 1F2HA 3AOBA 1YJ7A 4YQWA 2WAQD 3MDFA 2HSPA 4TU7A 2CH4W 2M9KA 2HCKA 4QT7A 3VRZA 3Q8PB 3CC4Q 2J9CA 1REVA 2DHXA 1X4FA 4X4RA 3CCUS 1HLWA 1I07A 3REAB 3G82A 1VQ5T 1KFZA 2E5IA 3DYAB 2IHR1 1EQMA 4KRWA 1M1KC 1PD1A 3OMCA 4MZPA 1SL2A 1JQGA 5T7LB 1N33F 4PJOF 3R2CJ 2XYHB 2WW8A 4QYZK 2K3KA 1RT4B 2GCFA 3CEYA 3CO0P 3KG0A 4OX6A 1FRMA 4M77G 3MEGA 3W1YC 1WGSA 1TV6B 2KG1A 4A8YA 3R6LB 2UUBF 4NLYA 2QL9B 3BW1A 3EPGA 1P9QC 2K3IA 2VG5A 4DCOB 4P75A 3TANA 2EW3A 1VQMT 1W6XA 3JCMc 2K7KA 2VHGA 3FDRA 2DR9A 2IVMA 3PIPA 3WC0A 2AGOA 1PKSA 2P2CB 3MM9A 4K4VA 1AHJB 1ZUKA 2RK1A 1XOVA 5C0MA 1IBMJ 3H98A 2A37A 4JV0A 3DRRB 4M78B 3SCLE 4ZP8A 1VIXA 3H20A 1MV3A 3BREA 3ZTOA 2RJCA 3DM2A 4PRFA 3EG9B 1YKWA 1WDDA 2DXEA 5KG1A 3GYGA 4ZGEB 1YGYA 2ZM6F 2QDYB 4WF2A 1VDHA 3NNCA 3BR9A 3QIIA 5SUHA 4O0IA 5HVHA 1WF0A 1ZTTA 4RMOA 5GMDA 4LUEA 3T41A 2WVBA 5IFMA 2QYZA 4B6MA 1D1BA 3T5LA 3KK1A 4L73A 2E9RX 4A8XA 3DLHA 4KGXB 1SSHA 2BRKA 3RU0A 4NEYA 2Y0SD 3CBMA 1SH0A 1TVRA 1ZX6A 2XNRA 2FO0A 3BSCA 2IRUA 2IYGA 4Y28E 4N4HA 1VQ9Q 1Q4RA 4MKYA 2K9GA 1VQMQ 3C3LA 1ZUYA 1VQPQ 4PZVA 1ZSZA 4KULA 3PFEA 5HI7A 4QIEA 4B3OA 2IY5B 5AXLA 2DNHA 2KT8A 5IWAJ 2B8PA 4JI8F 4J91A 1OY9A 3K7RA 1YITT 1K73U 2JT4A 2YWKA 5ETPA 5FJ4A 5J1EA 3ENAA 2DGTA 4Q8EA 5GMKi 1VYVA 1YJVA 1FRHA 4K0KF 5F41A 2ZHAA 4ALZA 3AFGA 1NG2A 1K73R 2O4XB 5IT9U 2NSCA 2XY5A 4C5HA 1XK8A 4FXVA 2ZH9A 3SCKE 2RQVA 3O5TB 1YSJA 2JHEA 2JW4A 3CF5Q 5GJVB 2HDAA 1K9MC 3VYGA 3M8ZA 3SV3A 4J9DA 4JI4F 2FJAB 2KYXA 1E7OA 1WJSA 1A0OB 2E10A 2N7YA 4P7VA 2CKWA 4XAKA 5H9EJ 2ATLA 3RW6A 1NSAA 3QJYA 2OD6A 2QX0A 5I4MA 2VG7B 3V5RA 3BN4A 3HFNA 4AL7A 2DO3A 3PO5A 3JTNA 4JI1F 3WVDB 3M8YA 4ZPCA 2VG6B 1WKJA 2B56A 4C92A 3B4MA 4X4PA 3OW2R 3CBPA 1WQ7A 2Y3YA 5FRNA 4N47A 4USTA 4NZ0A 3TP2A 2ZH4A 2DTJA 2LT4A 1HHQA 1VGYA 4WFYA 3OHBA 2OSRA 2FEIA 3FCWA 4OGCA 2UXBJ 2BYCA 4M7AD 3GSIA 3I87A 1QSYA 1MU2A 2V26A 2V5HG 4Z7YA 5HK3A 2HURA 4C5GA 2E1CA 1IKXA 1WHGA 4DCPB 4HI1A 5D77A 3PO4A 2OAWA 3C2PA 2DZ9A 3RUXA 2K2PA 2EEYA 2JLGA 4J9BA 4MKVA 4F7VA 1LWEA 2D1CA 1N5ZA 1QAJA 3PW0A 3QJ6A 1QVFR 1FEEA 2MSTA 1IWGA 2OPPB 2OEJA 2W8KA 3RR8A 3VKIA 3UA6A 2CP0A 4DX6A 3I32A 2HHSA 2XWXA 1FI4A 2ZPEB 4MYUA 3CC7A 3KYLA 1WEZA 1SRMA 5A0YA 3W64A 5I42B 4LF2A 3K0JA 2MCNA 5IC6B 1Q81C 2LXUA 1HNZF 4FM4B 2J9DE 2LCSA 4ZS6A 2KM8B 1VQNQ 4MKBA 3RRKA 4A8WA 2R9LA 1VQPT 2JMAA 4K5RA 3GMGA 3RBZA 3OLAA 1KS2A 4PG6A 2L9DA 2J7UA 1N4LA 4XPCA 2KAFA 3HXMA 1T9TA 4QZVB 4OB2B 5CKFA 4KGMA 5DDRC 3HVTB 3ENWA 3ZBDA 4PWDB 5KT6A 1FHTA 1N6AA 5F3ZA 2ZPBB 4AD6A 1HXDA 3MM6A 3W9HA 4ZITA 4DF8A 1K0TA 1BC6A 5IM0A 3PJ9A 2QI2A 1WC1A 1U45A 2ZBCA 2EBEA 3FIFA 4J9NA 4ATOA 1YJWQ 4PWWA 3JAMY 5KTQA 2KH9A 3KLVA 2UVUA 1FJ7A 3E9GA 5KYUB 1FX4A 2ACYA 1W2BP 5CA5A 2XG8A 3CCUA 3FC3A 3T5JA 1X5TA 1YIJT 2CG8A 3UPUA 2EYZA 2XI2A 2Q66A 3BDUA 4H54A 4ERDA 1NNDA 2FRWA 3W2VA 2PUOB 2VUBA 4J83A 5LSOA 3P49B 4RW6B 2BKDN 2DEJA 1LJOA 3HCXA 1ZOTA 4WIIA 4C92E 1ZM4A 1FFSB 3CJ3A 4IYQA 1C0UA 3LP0B 3CO9A 5K8OA 2X4XA 2AK5A 1QE1B 3R9LA 2APOA 4N5SA 4LF7F 4N0AC 2MSSA 1TELA 2LU2A 2OKQA 1WDXA 2OD4A 2ZC3A 4ZCMA 1JQQA 3WX8A 3EZUA 1X4BA 1N34J 1U1MA 1FERA 4WP3A 2ROEA 4FYWB 2EJFA 1UVMA 1WEXA 3SIPB 2MKHA 4I6WA 1KOOA 5JMNA 1RAHB 2FDNA 2I6WA 2H65B 4I2QB 2XG8D 3PHTA 4NCGB 8RUCA 2BJDA 2RDJA 2VPWB 1RQ0A 2XS2A 2DM1A 2ILZA 3FDSA 1V1CA 3GIRA 2QAZA 1RSCA 5D4NA 3HX9A 4I68A 4LF8F 4CLPA 3UF4A 4RTUA 3AXMA 4ZVRB 1BCOA 2XO7A 4QR1A 1CSKA 5KFOA 3O3LA 3RB3A 1S48A 2F2XA 4RU9A 4LR7A 3ZO7A 4NOHA 2DY9A 2HAXA 2DHHA 4RW4A 1CKBA 1FMVA 1QSLA 2RUSA 3BQ0A 2YNFA 8AT1B 3EFSA 1M3CA 3NMAA 1VYAA 2V8KA 3CMEA 2Z4PA 1LWFB 3K57A 4C92B 2CQHA 1I4K1 2MEWA 3M8PA 1S76D 1FRIA 3ENQA 5CYQA 2KO1A 2XSJA 2AYGA 3A8JA 2CREA 3UN3A 2DGOA 2VJUA 4JS5A 2WACA 4FNIA 2DGXA 3FBEA 1NEBA 4Y91A 1KBRA 1IZ6A 4OHWA 5DG7A 1YJ9S 3RKWA 3BN7A 1NK9A 4RW6A 4GO5X 3HPOA 2AKWB 1VQ7S 4E7ZA 3M9NB 3M9OB 4KV8B 1CJKA 2N7CA 3R1LA 2LQKA 4CYUA 1S0OA 1I6JA 3F56A 5EC7A 2Y1RI 3MP6A 2R42A 2HWTA 2QTWA 2MOXA 4F17A 1SJ1A 3ZTPA 3C94A 4LF6F 3QSYB 1SL0A 1G4CA 4RBTA 1FXLA 1RI0A 4DOVA 2O1PA 1PSFA 1B34A 3Q2SC 2QQ9A 2W2PP 1WHHA 1JB0E 4QYRA 5I42A 4JI6F 2HNZB 1O8BA 4AL6A 1TS9A 3G8TA 5A0DA 3JCMX 2OEMA 3T19A 4B3SJ 2PQWA 1D1CA 4NMLA 4OZJA 1I81A 5ETVA 3G71A 2PUKB 3EGDA 3SI8A 3QGHA 3MTJA 4KC5A 4HLBA 2M52A 1U49A 2ZZNA 4ED3A 3FVYA 3MR5A 4HCCA 2PMWA 3RKXA 4NLQA 3OXFA 2DTHA 2GNKA 4X4OA 3PRBA 4Q8FA 4FYXB 2QGGA 2BZ2A 4B9TA 2BZYA 1VQ5A 1TAQA 2ZFHA 1SKUB 4F04B 3SHWA 1LW0B 2XS7A 2KT3A 3PR4A 1QVGP 4ES1A 3OYMA 2CS7A 2CWXA 4RNNA 4YDXA 3EE3A 1UWAA 3HSBA 2ESWA 3W3SA 2R8JA 4TXSA 1IB8A 2BJ7A 3HDSA 5C25B 1IUJA 1GTEA 5J3BA 5BYRA 1H72C 3OFHA 2UXDJ 4MZTA 1LFWA 4LF7J 2J0XA 2EVRA 3J81Y 4L76A 3M9QA 2ZUGA 5KG2A 2BKPA 3HHLA 1VRQC 3M9MB 4JI5J 2YKPA 2KT5A 4AG2C 1VQMA 2VVKA 4CYUB 3KJNB 1VQPA 4P74A 5ETMA 3QKJA 1F3FA 4XTTA 1S72Q 2G4BA 1YWOA 2N4CA 2V0NA 4U7CA 2DD8S 5B0BA 2V9KA 5B09A 3GQCA 4JPBW 2VC1A 1RTHB 2O66A 4DV5F 2W2MP 4B3MJ 1ABQA 1HYSB 2MK5A 5DLFA 3R5AA 1ZM9A 1NJIU 2LEBA 3CD6T 2D8HA 2RNEA 1GXUA 2CYYA 2ZH2A 2LECA 2CG4A 3CJ4A 2W2OP 1UGPB 3BEGB 2MPXC 4NA2A 3GYXB 2M7SA 5L39A 1VQLQ 2RQMA 1JLGB 5F0UA 1U6FA 4TQSA 2GX8A 2FVRA 5KFLA 4J9SA 3GZ7A 1CJVB 4LUBA 2EFNA 2Q1LA 3RIRA 1AZEA 1ABOA 3OB9A 5KFRA 2BE7D 1W4SA 4IO1A 1EP4A 4CZCA 2FJDB 4DWIA 1GMWA 1IBKJ 2D3O1 3BPSP 3IQLA 3UW1A 2A7YA 1JJ2R 2F4VJ 3R6GB 1BU1A 5E41A 5LJ5j 5A2QE 2KMTA 2B7CB 1RE1B 5CHCB 3BS9A 5KFJA 1U7LA 1TFWA 3NNAA 1LW0A 2DF6A 1BY9A 1FNMA 3RB6A 2RJDA 3I4PA 1QWEA 4J37A 1G3YA 4P73A 3NGPA 2MQNA 4KRTA 3LH5A 3OYIA 4CM0A 4LF6J 2EYXA 2L3PA 3OL7A 1TTHB 2K3YA 3I96A 1Q7YT 2YX4A 2VFSA 2G3RA 5ETTA 3NRBA 4CI0C 2ADCA 2YNHA 2KT1A 4KUIA 3V7SA 3ILLA 3CPWA 1UVJA 2XY6A 4IOAQ 1SQGA 4DS5A 2GMJA 4KPYA 2X1AA 3DM2B 1BHNA 1XJWB 1YCYA 2Z58B 2YWGA 2HHVA 3NMZC 3LANA 4QWDA 3Q1JA 3MP8A 4YR3A 2KRMA 4YR0A 1PD0A 2NPIA 4J7FA 3OPKA 3AB4B 3BY7A 2ACMA 2RF0A 3D4JA 4JZ3A 2ZZDA 2ED0A 2DK2A 4FN5A 2PFDA 5GAN3 5KYWA 3KHLA 1MWQA 4M7AE 1ZSGA 1WHLA 2JNJA 1XMOJ 2K8GA 2ALZA 4QWCA 2MKYA 1AEYA 4QBUA 1FKOA 4M5DA 1D0YA 1Q95G 1A7GE 1WUUA 3JSMB 1YJUA 5GMKa 3S6EA 1CBKA 5A2QY 3ZZOA 1Q86C 3K8VA 3A13A 4Q2MA 2VOOA 1RI7A 1OQKA 4ZP9A 3HJVA 1SUQA 4CLWA 2CP7A 4F8RA 1F2GA 1Y57A 3GIMA 5AE3A 4O5VA 5KFZA 1RCOB 3UR3C 4ZA1A 1VQ9T 1RT6B 4OYIA 3S3MA 3CC7T 1SUQB 4C48A 3DI6B 2GNCA 4CLTA 1WG1A 1FJGJ 1Q7YU 5GADI 2J7KA 3I56T 4J9CA 3PVXA 4IDKB 2EC2A 1ROFA 5J1EB 3PJXA 1NZAA 4DU8A 2EG2A 2HAFA 4NRTA 4MK7A 3W9JA 4M78D 4ZVTB 2RI2A 4LFBJ 3KHGA 2VONA 3GV5B 1DLOB 4R0EA 2CQIA 4JI0F 1WDTA 1YJWA 2XO6A 1K73T 4ED5A 3L2RA 1YI2T 3CD6Q 4WK1A 2XGQA 3NGKA 3F73A 2OHDA 4WU2A 2VJVA 3THKA 2YPZA 2HZVA 2HQEA 4LR8A 3X26B 1HD3A 3M58A 1N8RU 5J2PA 2RMOA 3CCSQ 3EVMA 2H5IB 1NLKL 3IBFB 4DV5J 4B3MF 3CDWA 5IQ6A 4MDWA 2V63A 3OS2A 1JX4A 1JIHA 4Z2XA 1Z2ZA 3VALA 3DGPB 1GT8A 3JSYA 2JXBA 4QR2A 2MQPA 1W2IA 3BV8A 3CCMQ 3G71T 4LF9F 2JDJA 4FT4A 3HD2A 2QQSA 4BI3A 1HNVA 2D74B 1FKPB 3FMWA 1RTHA 3IC1A 1IR0A 5IN1A 1VQ5S 5E33A 4AFFA 4B3SF 4A8SA 3G6EA 1OX9A 1N48A 5L9XA 2QXFA 5B0DA 3EJMA 1VQKA 3VWSA 3GYNA 1FX7A 3ONQA 3U27A 1I94F 1MN7A 4LXCA 3DGVA 3ILJA 3M4XA 2Z2MA 4DSFA 3HULA 5LMNF 1SQEA 4DPOA 2DVIA 1FK9A 2JTEA 1BLUA 4EMHA 2JX2A 5GAN2 5K8NA 4PFPA 3X1LB 1DARA 4LUDA 2ZE2B 2FD2A 5CZXA 4JJBA 2F5GA 1VLYA 3HSDA 1N56A 2MKIA 4L59A 3ET6A 4DV4F 2XSFA 4F7UG 1S1WB 5GAOp 1HNZJ 1YIJA 3CCRQ 2DXDA 4DV3F 2RB6A 1GXLA 3OTBA 4I7FA 4X66F 3GOXA 1ZM3A 2VFVA 4Y00A 1ZUUA 3OR2B 2DYAA 4F16A 3Q8QB 2E12A 3PEJA 4JBCA 4OGEA 2VB6A 2AJQA 1B3QA 4C8YA 1LNQA 2V4RA 2V2VA 2KR3A 4TLQA 5F8HA 3EVOA 4NYPA 4N76A 3LGFA 3PYEA 1VC6A 2B4OA 2ZGWA 3T5KA 1ICEB 2NYSA 4O44A 4WU3A 1DHMA 1FFWB 4EBDA 1HNXJ 2MXYA 3CD6A 4RG8A 1UVNA 4HCKA 4PJOA 1GBQA 2ZH7A 1D0ZA 2HFVA 1N32J 1H74A 4FW2A 4B3TJ 2J7WA 4BS2A 2L08A 3MAAA 3WX4A 3K58A 5LJ3f 2SXLA 4L6V5 2WHOA 4PG4A 3WDOA 2FJWA 3SEOA 2WOMB 1Q8IA 1M90T 1EZZB 2DHAA 3P45B 2XI3A 2FVCA 3BH6B 4N77A 3TCJA 2KXFA 1QTNB 3Q89A 2V34A 2W4CA 3U1NA 1UJYA 3FCVA 3T1AA 1IM4A 3HHLC 2NLUA 2NZCA 1VHFA 5D4LA 5LJ5f 2LQ8A 3M54A 4NL2A 5L1JA 2EC0A 5DO2A 1CC8A 1F5CA 4DBHA 4CLZA 5DG9A 1TH7A 2KVQE 4I4BA 5HVFA 4ZDNA 4HVUA 2XMFA 5KYXB 1C0MA 2R2RA 5D4PA 5C2GA 4KV8A 1IN0A 1U1LA 5B0GA 3CMET 2XEXA 2GV1A 4HVVA 4TY8A 2L9NA 5E5NA 1QY7A 4E98A 3QJLA 4JS4A 1OPLA 2RJEA 1NDCA 4ZP7A 2X1FA 1NJXA 1SVDA 3G71Q 2FZGB 2E7WA 3EGVA 3NWRA 1M5HA 1NKBA 4D3GA 1H7WA 1R8CA 5ITHA 1KD1T 2WVDA 2WVEA 2EFOA 2HBRB 4DU7A 3W2WA 5FDLB 1WOPA 4USVA 1NPKA 4K2XA 5KYWB 3SWNB 3IWNC 1VQ7T 1UA0A 1IBCB 3NGDA 4QU7A 2R7UA 4Y6IA 1SHFA 3FBFA 1KEKA 3CCJA 3DDNA 3SBMA 1CJUA 1V76A 2F2WA 2IM3A 1R43A 1WJ9A 4M5JA 4C92C 3M53A 1OYEA 2BEFA 2B6AB 2ZCFB 3R5BA 1N0VC 3R8YA 3QDRB 1RT7B 4QVCA 2HMIB 3QT8A 3VQTA 2E3HA 4F4YA 4NLSA 1IXDA 4A54A 2B9EA 1YBUA 5C42A 4ECSA 2FPDA 1TL7B 3VVUA 1S9EA 5GAGI 2Y90A 4JV1A 4Y92A 1L3VA 4LDVA 3G86A 1IKVB 3W8PA 3QT7A 5LMNJ 5AJ3J 1SB6A 1HNWF 4CLSA 3FEZA 3TW0A 4JI2J 4BWJA 1NBEB 4A4EA 3SMZA 4IH5A 4OMLA 4XK8E 4M63A 3PXGa 1UA1A 4OYWA 2WSEC 4GO7X 4NLOA 4BB7A 1EETB 2JVOA 1WNLA 2ZPIB 4PPDA 4OMPA 2NSBA 3Q8YA 1SG5A 1BD6A 1N36F 3OSVA 4BD3A 3H9NA 2LDYA 3AQOA 1SQFA 1NYGA 5FLXE 4K7QA 4X66J 3ZZPA 2LX9A 2ZE2A 2AEJA 4KE5A 3EGUA 3HKSA 1YI2A 4Y2AA 3GFXA 4A47A 3KXTA 4AUKA 4Q5WA 1NHKL 2O5DA 4UT4A 5JVHQ 4M75E 2LNHB 3W7BA 4X4QA 1KLNA 4IH7A 1Q81R 2GJIA 2BJ1A 4DLGA 2O31A 4WTYA 3J80Y 4C11A 3BM7A 4ZPAA 3J7YI 3SFGA 3MFHA 4M78G 4J7CA 4B08A 4EWTA 4GC7A 3JB9D 3G6VA 2ASYA 1QKXA 3DXSX 4DG1A 1NK8A 2JEGA 4ZVUB 1GFWB 3C6UB 4EMKC 3SDEB 1UPMB 5DJBA 3FZBA 3MM7B 5IQQA 1M5OC 1J2VA 3CDEA 2BKNA 2CNLB 2GVDA 1YQHA 2MPUA 3EXCX 2A28A 3KJVA 3V4IB 3HRUA 1DTQB 5LOQA 3CPWS 2POKA 5F8GA 4LDXA 3GR1A 2M0GB 1U1RA 1YHQS 3H0HA 4CC4B 1WOSA 3PHEA 2RAQA 3P8DA 3D0IE 5KFAA 4DUZF 3PNWC 3QSUA 4YY3F 4ECXA 2C2EA 3PW7A 1G6BA 1RGVA 3T1YJ 4IRDA 1QJHA 4BDZA 5CAIA 1K73C 4OMNA 4PQAA 2YXLA 3G4SS 2DNMA 1VQ4Q 1NHUA 3N5BA 2WVCA 1JLBB 5K20B 2WSCE 2RJFA 4A4KA 2PEBA 4FSSA 3H90A 3AH6A 2CQ1A 4X62F 2R5MA 2LVWA 1YHQQ 4EK2A 3HHDA 1KQ2A 3KLHB 1K1QA 4KT0E 1YTYA 2MTLA 3OSPA 2KROA 1HWLA 1MHNA 3LWHA 1IKYB 2DFUA 2LQNA 2NQPA 2NUTB 2GMHA 2BTTA 3VS7A 2DNPA 4ZTFA 5FU7B 1GXIE 1RLCL 2GFFA 2GTJA 3DLMA 5GAEI 4M77D 4PJOB 3MJXA 1U6BA 2QLBB 5F3TA 2ZH3A 2QGFB 2MHEA 4J9LA 1VQYA 3K59A 2YQ3A 2JZ2A 4F36A 2DBMA 2C2RA 3TEGA 3RW7A 4W90B 1ZHIA 1SKRA 3SDEA 2FHMA 4FF3A 1V6HA 4HA8A 4J9EA 1VR6A 1NZ9A 1RLQC 4C8QB 1OIAA 1BGXT 1JLCB 1KQ1A 3V4IA 2HRYA 4DZDA 1PC5A 1VBKA 3PACA 4C7QA 3KLGB 3LH2S 1IBKF 2DX1A 1VQ9A 2HGLA 1FO1A 5KG4A 3VV0A 1QDUB 3D0HE 1NK7A 3IM9A 3CCVS 3TJ9A 5D7UA 1XMQJ 5D3GB 2GQCA 4D8DA 4HVWA 4Q2LA 4USJC 2WVFA 1HNWJ 5ETQA 1Q86R 3N6NA 4LRFA 2YWHA 3MM5B 4H4OB 1GX6A 3JB9k 2MZ1A 2UUCF 5BYSA 5SZTA 2D3UA 1YJWT 2SRCA 5LJ3Y 4M5GA 1E6YB 4G6VB 4K4XA 3L2VA 2F2VA 2ROLA 4OV6A 2QQAA 4UUWA 1VQ6S 1VRUA 1KQSS 5I3QA 1S0VA 1NM2A 1HSQA 3A3PB 5AXNA 1WC3A 1T03B 4BC9A 3KK3B 1TKDA 1S4FA 5CKEA 1SBRA 2NXEA 4CC2A 3D3BJ 3Q0AA 1D9FA 2WB4A 3I56A 3OW2A 2NS1B 1B99A 1DFDA 1D09B 3G6YA 3D1QA 4PLLA 4O3PA 5KFVA 4TQRA 4A4GA 1ZBTA 1N52B 2ZD1A 2DRDA 3CD5A 2ZBRA 1XMBA 4JYAJ 4Q7AA 3P8HA 2EQJA 2HLUA 3FJ2A 3QZ8A 1VQ4T 1VQKT 1VK3A 3BGFA 4PFZA 1WX6A 1T11A 1TKXB 1YZ7A 3SB2A 4F3QA 4M5DB 4C8QC 1PC4A 2E65A 2YSQA 2CQ4A 2IG0A 1Y10A 4DG1B 4ID5A 1FDNA 3VS0A 3M56A 4DEXA 3KHHA 2P0KA 2IMOA 2XK0A 4J5YA 4ED0A 3NGRA 5KYYA 3LALA 1GBRA 2E7XA 2EWHA 4EDUA 3W2VB 1YI2S 1T0TV 3E01A 3CJTA 2X3WD 2RF2A 3LF0A 4XDCA 2ATCB 4ANCA 3BBCA 2FL7A 2OI3A 4R5PB 2LP5A 1SJ4P 3G6ET 3DNCA 5EGYA 4QWBA 2B86A 1OQ3A 4MK8A 2EGAA 2B3TB 1EARA 1X2QA 4JJNK 1RT4A 2ZH1A 3IA0A 3PZPA 2L8DA 3MPVA 1PM3A 2ZHBA 2EXUA 4C11B 2CPYA 1KQSR 3Q83A 2PU9B 1DY3A 1ZSZC 4CC7A 1VOMA 2E7VA 1O6XA 1RACB 2COYA 1GAOA 4NXMF 2BBEA 2D9TA 4WPAA 3L7UA 3WC2A 1Q7LB 5HJXA 3JYTA 2HK2A 5LT5A 1VYUA 4R0KA 3C15B 4TNOA 2ZJRQ 4ZVPB 3CCQA 3AHPA 5GAMf 4ELZC 2RQKA 4EZ9A 2OTLT 1NK4A 5KH6A 1FA0A 1WEYA 2BVZA 3MI7X 4OYAA 1QVFS 4PLIA 3DRSB 1FKAF 3MMCB 4UY85 3UQSA 1BI1A 4W92B 5HANA 2Z57B 1J27A 2DO0A 2FC9A 4DN9A 1T9VA 2ZZTA 2UP1A 4J9GA 4EMGA 1HI1A 2NXNA 4PJNA 1UECA 1F5AA 2FY8A 2E70A 5CZVA 1ZM2A 2R7TA 1C6VX 2E6NA 4X64F 1RZMA 5E2QA 1QP3A 2W24A 2DGQA 2ZH5A 3A4TA 4U9RA 1WNEA 3AA9A 2ZKUA 2KFYA 4G1IA 2E1AA 1KVIA 1VLOA 3UCZP 2G9OA 1APSA 1X9SA 5T7LA 3FEXB 3H0IA 3BQ2A 7FD1A 1ZH5A 1KSWA 4UC4A 1UVKA 3J7Z5 1R6VA 3RMSA 2VWFA 1M8VA 4I6YA 4FF4A 4FKXA 2L48A 4N7TA 1P8GA 3ZZ0A 3UD4P 4CLKA 1YBTA 3CCJT 2EK6A 1AWWA 4I7FB 1M5Q1 5M2RA 4DZ6A 1VQOA 1NCLA 3META 1PYOB 1O51A 3PEHA 4IIOA 4QIGA 1D8YA 3JV3A 3QNWB 3WIVA 4FF2A 1CS4A 2RQ4A 3L2WA 3LW5E 2I5JB 1P1TA 3CC4T 1T8EA 2DRMA 5DLQE 4DV7J 1Q8BA 3KNAA 3RG6A 1N0UA 3GIBA 3O1LA 1N54B 4FF1A 1F60B 1AB8A 2LQJA 1ZLMA 2QEXQ 2ZWOA 3CT9A 1CVJA 3MAAB 3ZFVA 1YBYA 3J81U 5HCKA 3Q22A 4Y34A 2H9ZA 3D68A 3MGJA 3W60A 2DR6A 3CCQQ 4BDYA 2DETA 2PIIA 1WTBA 3MR2A 4QW8A 1KVJA 5KG6A 1P1LA 1HBOB 1P92A 3GCWP 2R7SA 3SD4A 2NCKL 3CC7S 2HQHA 2C3OA 4NRUA 1QCFA 1DURA 3H41A 4LFCF 2EQMA 2GMLA 5A8WA 3OYCA 2LKZA 3ZZRA 2JC0A 3V6DB 5E3AA 1D9AA 2CQCA 3OYEA 1R0AB 5LJ3g 5D6YA 3KWMA 4X4SA 3CD0A 4M7DC 1DAXA 1GCQA 4K5SA 4P9SA 3V6DA 3UDEA 3H8YA 3DI6A 1CSJA 2E29A 2FPHX 4IR9A 2VA2A 3DOLB 4BDPA 1X5OA 5J2NB 3V81A 4A63B 3OBWA 1M30A 2K1RA 4EFAC 4OMOA 3HT3A 4DR5J 2P0PA 3I5SA 1H7XA 4UOCA 2H51B 2HZAA 1S10A 2HHPA 1VIEA 1VQ6A 3JCMP 5ETOA 2QA4Q 2L3SA 1WF1A 3QRQA 4A4JA 2LT1A 4GMKA 4CTAA 1TMMA 4E7HA 1PAEX 2RS2A 3CXCS 1C0UB 4OZLA 1X27A 2CUDA 2E5LJ 5A0LA 3JCMb 3NHNA 1RT5B 3LPEA 2XD0A 4KO0A 2MWPA 3JTPA 2AYMA 1VQ4A 2DY1A 3H0FA 1V3SA 4OMFG 3ZNJ1 1DJ0A 3INZA 3OS0A 1RABB 3NLCA 4YR2A 1V5VA 3CGIA 1QTMA 4HYKA 2MYFA 3LX7A 2YWFA 4WCIA 4X4NA 4CM2A 3HKZD 1VUBA 2VQEJ 4LRBA 4KSEB 5HK0A 1R77A 3CCRS 3OYBA 1X4AA 1M5KC 2DHSA 4OV1A 4F0KA 4ED7A 1UUEA 1NPPA 1VQ5Q 3TO8A 3IRXB 2BZXA 4EZ6A 1RT1A 3LLRA 2JFKA 2J8AA 3DRPA 4CLYA 2OGUA 3CTRA 1EJ7L 1HWJA 4OJGA 1FE4A 2RT3A 2JEIA 1MMAA 5KFSA 2ROGA 1VYTA 1T3NA 4DV6F 2QA4T 1JEGA 3FSYA 4P10A 1YZ6A 4UOHA 1KNZA 2DNYA 4WKYA 4FKYA 1NB7A 4JI1J 3W9IA 3H2VE 1R8HA 4HEA9 3M8QA 1ZYQA 2EKNA 3V8JA 4P2FA 2JUFA 5I11A 2KBTA 2CVEA 1G1XA 1WC4A 1ZPWX 3FRZA 4U7UD 2EFPA 4YB1P 2IBOA 1QCOA 1HBMB 2EQUA 4DFKA 3BO4A 4X65F 3SQGA 3BSAA 3GIKA 5HQLA 2L2PA 3QZ7A 3TX8A 2WZ1A 1VJWA 1RHQB 3FMBA 2DNZA 4DV7F 1SPBP 4NXMJ 2PFFB 3CCQT 3JCMh 1Q82C 3NXZA 4RNMA 4YB7A 3C8YA 2GIFA 4KHPJ 1KRPA 2BJ8A 1YJTA 2HD0A 4NLPA 4IUPA 3UN2A 4URQU 2ZH6A 1FNOA 1KQSA 7AT1B 3MECA 3N5FA 5GAHU 2BOAA 1JXVA 2W9CB 4LNPA 2ZHOA 2IC3A 1JJ2A 3GFYA 2GGPA 2E4HA 1RWOB 2HSEB 1M8MA 1VK8A 5ETRA 1O9SA 1KTVA 1M3BA 4K11A 4P71A 1UJ5A 1YWXA 4ECQA 2DIVA 2XMTA 3M2UB 2LNVA 1JXLA 3FSXA 4BI4A 1YRXA 1X0FA 3PKYA 2G2YA 1BXNA 3UDLA 1S1TA 2M1HA 3BF4A 4LQ3A 1RWVB 2COZA 4HVZA 2G0CA 5KYYB 3O8VA 3VVTA 2FVPA 3G2XA 5GAN8 3CVKA 1TKTB 2W7PA 3G6ES 4CH7A 3V6HA 4ECUA 5IM0B 1M1KU 2XHCA 3NOGA 3X24B 1SC4B 5FU7C 2RKIB 2GIQA 5FU6C 5GJWB 2MQ8A 2CGHA 3CMAA 5A8WB 1MMLA 1U02A 4RTZA 2DNQA 2W4DA 2E64A 3EVWA 2A2CA 1U24A 5CYMA 1WC5A 4M7AB 1VFJA 3POTB 4Y2MA 3GP9A 1A6LA 5DM6Q 2DGSA 1QLNA 2E1RA 7FDRA 1BBZA 2QA2A 3LP1A 2JS2A 3DMJA 2FPEA 4OMQA 3EHQA 3SQGB 1Y7PA 3R3TA 4N41A 3DOMB 1JJ2S 5KFWA 3M0QA 5LJ5h 1WZOA 4ZJOA 4F3OA 1X69A 4PG8A 2NXJA 2Y1LB 2DKGA 4PG5A 4E47A 3MECB 2B9WA 3C16B 1JO8A 1IJEB 4C8QA 2F8EX 4DR4J 1QVGS 2G2OA 2NXCA 4NXNJ 4EMDA 5U47A 1W1FA 2HNIA 2HFUA 4KY3A 2VICA 3T1HJ 4HKEA 3FK4A 4HACA 2RRAA 4DX7A 3LUYA 4TU9A 2VFRA 3L2QA 4GLKA 1ZZNA 3JQMA 1GFCA 3C6UA 1KVKA 3THPA 2M70A 3MWBA 3E2UA 3BSOA 1PAUB 5GVQA 4JRIA 2C3PA 5DY9A 1XC9A 4RUBA 4ZPWR 2EJ9A 1HNIB 2FHJA 3QBYA 4LBIA 1EAYC 5RUBA 4OFZA 2QMXA 3KJFB 3BB5A 2B51A 3JQKA 4BCAA 2DL7A 1S1WA 5H9EK 4ENOA 3HK2A 1H3ZA 4WTOB 4B9UA 4OI6A 1WHVA 2DO4A 1TK0A 2AJFE 4UOGA 2JOQA 4UOFA 3J81E 3BGRB 2DR8A 3ME9A 1AWXA 3FKBA 5EUHA 2QLXA 1U48A 1NPRA 2XI9A 1LWXA 1S0NA 4HTJA 3ETMA 1KC8T 3LTOA 3RRHA 3CCRA 1TKZA 4MKAA 3ISZA 3CJQA 3KKFA 3K5PA 2C06A 4ETXA 2PA3A 1XQHA 5GAN7 3AB2B 2QZ8A 1Y5LB 1HQEA 2WRMA 5CIUA 5IAYA 5D78A 2KSSA 1DQ9A 3CUNA 5I2SA 1RWXB 5H1SV 1X4CA 5BR8F 4ITSA 2E5LF 2HBZB 4JOUA 4JI7J 2PVOB 1URNA 5E0OA 1QAIA 1IKWB 3A8LB 4KGZB 3TAPA 2M8HA 1SIZA 3S01A 3OLBA 4DFJA 4E8UA 3SQOP 3CCUQ 3OYLA 2WSCC 4C8LA 3KJVB 4RKUC 4O4RA 4DSKA 2C0IA 3R97A 5FLXU 1UL3A 5CKHA 3M6UA 2CUYA 1RTJA 4J9QA 3OMGA 1UGSB 4QPTA 1ZZFA 2BOPA 5D15A 2PTKA 2C2ZB 4PUOA 4WFAQ 3QWYA 1VS3A 3TOQA 4F7UA 3MEWA 2CPZA 3TA1A 4FCYA 2BM1A 1X6BA 4O3QA 3DLKB 1RKJA 2QA4A 1QD1A 4ES3A 1Q78A 1FF2A 2B6AA 2AGQA 3I0RA 2ALYB 1HA1A 4KFBB 2YPYA 5CYJA 2IIHA 2QTVA 5HBMA 1IBLJ 3CBOA 2ZUAA 2RI3A 1S1TB 2G0IA 2OTLS 5LJ3j 2BE2B 1PHTA 2AKKA 4DV6J 1S12A 2AF6A 2ZOGA 2UV8G 4E6RA 3I6PA 5E3PA 3I35A 4NWBA 4NA3A 4ECYA 3R5CA 2E9ZA 1FXXA 3DKDA 2QT7A 2DPIA 3H2LA 2HRUA 3BGRA 1PKUA 4M7AC 3GONA 1WSVA 1MLAA 2PI4A 2DIUA 5HP1B 4PXCA 1AFIA 4GC6A 2E3IA 2ZJPQ 4WJBA 4IRCA 5C25A 2EBPA 2GGPB 2V67A 3GF5A 2FGCA 1QMCA 2XMJA 2WBMA 3DU5A 1S7HA 2RU3A 3AODA 2H5JB 2R8HA 2ASDA 4M75F 4F25A 4J9KA 1WACA 3CCJS 1Y5NB 3GWCA 4FSXA 3CMEQ 1U1SA 1VQOT 1HQUB 5IXUA 1SC3B 3VAMA 2CQDA 1KQSP 1OZ2A 1VJQA 1HR0J 3UI3A 1S1XB 1K1SA 2P9GA 2KRSA 1OY8A 1R89A 4YOEA 1LKZA 2A6MA 2NXUA 4UW2A 3OFEA 2X4WA 3TVKA 2IBKA 4ZLLA 2OPSB 1RT2A 5HO4A 2LJ0A 5FU6B 4DR1F 3UPFA 2KJWA 4NX9A 2RVJA 4BE0A 1HW9A 4JI5F 3GSDA 1N5YB 1QWFA 3OQ5A 3T6BA 1UTIA 2VH7A 4EPCA 4C0DB 3AXKA 5HLFA 1VQ6T 5KYXA 2QJ3A 1Y96B 3Q2TC 4L5GA 1FCAA 2B9YA 1QAXA 3U1MA 3C19A 1TR0A 4JRKA 3K5NA 4C8QG 1YJWS 4DR7F 4F4ZA 1CKAA 3DB4A 1OQ6A 1NRKA 3ULHA 3EHRA 4DSJA 4KYZA 1LFPA 4F2SA 4C0GA 2HNYB 2ABYA 4R5PA 2C22A 4CO3A 4YP3A 2FRYA 5KCOA 1HK9A 2NREA 4ANEA 2DR7A 4Y2CA 4H4MB 1Q86U 2AYBA 2VKZG 5HATA 3SFUA 4XTUA 4U8VA 3ETOA 2D7SA 1NEEA 1YJNQ 1V3RA 1KHVA 1WHYA 4WWSA 1HARA 3P96A 1NE8A 2YKMB 3V2UC 1HYSA 1BI0A 4DX8H 4M7AG 1PYTA 1QVFA 2F4VF 2VODA 4DL0C 2F5KA 1DBDA 1X4GA 5FRMA 2CJAA 3HT0A 4ED1A 5CK9A 3HO1A 4M77C 2Z0GA 4X9DA 2EK1A 3R5DA 5KFHA 3KDOA 3OVSA 4LT6A 1M4ZA 3NS5A 1S1UA 4I67A 2FJEB 3R7NB 1RADB 1Q79A 2J6OA 1UCNA 4M77F 1RA6A 4ZIWA 4PYAA 1K4US 4OVAA 3OSSC 1CJUB 2DCUB 2UU9F 3RGIA 3JCMf 3BGLA 4O3RA 3K2YA 2N3OA 4I2PA 1S79A 5HQMA 1PILA 3SEMA 2OPSA 2OIHA 3PYFA 3ER0A 1F6TA 4M5HA 3CWJA 4LRAA 3MM6B 2KKHA 3MPDA 3EMTA 3EWGA 3JB9F 4D8KA 3I5CA 3UD3P 4LF5J 3GNFB 2V8IA 4ZJQA 4HDGA 1LW2A 4O3SA 2HZYA 1S97A 2H1YA 2BABA 2BJ3A 4M7DB 4CRJA 2DVEA 5CVIA 2W0ZA 3QIPB 4LJMA 5C24B 3I5BA 5LM7E 3O8WA 3KFVA 2YKQA 1VISA 3QIPA 3RYLA 3ZNUA 2HS4A 3M1VA 1RJJA 2DISA 4Z89A 3DLEA 1WHKA 4J8OA 4JRQA 1TMJA 4FW1A 4FU6A 4NI2B 1SL1A 4B9MA 1NO8A 1X2KA 2B0GA 2DD4A 1U1NA 3Q8VA 2VDHA 2MLXA 1K9MR 2KFNA 2VQEF 3EDRB 4CRIA 2HBQB 1NXIA 2QA4S 1FJGF 2E66A 1YIJS 3NP5A 3KDNA 3VAIA 2NUUG 3N0VA 3D6MB 2CZ9A 2KYZA 2MF2A 4F7UB 1SC1B 3EGDB 1FYNA 2DBKA 2XBPA 3SYZA 3VJPA 3KLFA 2QRRA 5KFEA 4HCZA 4HH1A 4FL6A 3QYYA 4JI0J 4AG1C 2OJ3A 3UR0A 4M5MA 3PE0A 1X75C 4DR3J 1NH8A 3FGVA 3RESA 3CMAT 2KY9A 5HMXA 2QLFB 2BE9B 3CD7A 4QIFA 3J80U 4A8KA 1WKLA 3PX0A 2ILYA 4OLPA 3MAHA 4ELVA 3OYYA 1D0XA 4F4WA 1NKCA 3RBBB 4M5IA 3MD3A 2ZC4A 4J7IA 2GHPA 1UETA 4L72B 2CZ0B 1UJ0A 3EH2A 2Y4XA 2DGVA 4LSZB 1IKVA 2LQ9A 1T05B 2M2BA 1P6TA 3QT5A 2VZ9A 2K3BA 2QDLA 3HHLB 1TL3A 4EYHB 4QQ6A 4L3NA 3M7VA 5CQGA 2D0QB 4ZLNA 2ZITA 2Y1IA 5M2UA 2DXBA 3CC4S 3I55S 2K3XA 3PV8A 1UJ4A 2YUPA 2BIVA 3CCST 3RAMA 3NFCA 1IBMF 2XLIA 4P2MA 2EVZA 2Q6CA 2ZDOA 4NYOA 2ZNYA 3P6YC 2OTJS 1GK8A 1E6HA 3M2RA 2KZZA 2DRKA 1HYOA 3BGOP 2A3JA 3JAME 1MUZA 1GQEA 1HBNB 2G1HA 2YDLA 3CPFA 1UGQB 3N9UC 1H2UX 2DPJA 2MLZA 3R2DJ 5KFQA 1JLFA 1C4CA 2CJKA 1RT2B 2HQGA 3EICA 5LMUF 4N0AA 3TWZA 2XMUA 3J7YU 4IFVB 1G3SA 1WG5A 2MHNA 3TAMA 2UV8A 1VQ8A 2HS3A 2OTLQ 3T9NA 2EPIA 3W63A 1VA7A 4I0WA 2FYXA 4DV4J 2JJ4D 2Q3PA 3NGTA 2AHOB 4J9PA 3PR5B 1TL7A 2GVDB 4OLOA 1KQFB 3VV2B 1ZSZB 2ZWPA 2EYWA 3JSMA 4YDDB 1R3NA 5GAMh 1WQWA 1DTQA 2HMIA 2HNDB 2AEFA 4WYLA 1MV0B 2EQIA 4V19J 4DV1J 3MCOA 4I2PB 1JLEB 3J7AN 3TREA 1M5SA 3PFSA 2OTJA 2ZEJA 3DCAA 5KG5A 2CSQA 3GFHA 5F8MA 4V1Ak 2JS0A 1KQKA 1T05A 3NBPA 1IRXA 4USKA 1QM9A 3L4BC 5KE2A 1YG0A 2YNFB 4OYMA 4GKJF 5L8RC 1R8PA 5LJ5Y 2O01E 3EGWB 3BJYA 4QQGA 5I2MA 1FWKA 3CDUA 4JUVA 2VXEA 5KFKA 4F50A 1Z2LA 4R8UB 4IUFA 2YRVA 4RCBA 3MR6A 1FTRA 4JRPA 4O23A 5GAOm 1LEOA 2EW9A 2VIHA 5K9FA 1H6KX 2COLA 3QO3A 3BSNA 2GZOA 1AZSB 5HY6A 2KGTA 4L3KA 2UXDF 3L42A 4ES2A 3CCRT 2JEFA 3TZWA 2YTCA 2WONA 5KFCA 1TUCA 4IH6A 5B0CA 2AT1B 5ECAA 1HPZB 2XCAA 2HKNA 3QLHA 4NZ6A 4IFVA 1S72T 5A0YB 2XZWA 1TG0A 1EQ0A 5D0EA 1DJ7B 2FIUA 1YWPA 5CXTA 3PFOA 4ESRA 1D3BB 1C1CA 1TVRB 3FRYA 4PCQA 2UU9J 3W5ZA 3G87A 3ICLA 1XNQJ 1S5ZA 2P9CA 2WCXA 1ZA1B 4U8YA 4ELUA 4A8OA 1RWPB 4F4XA 3PG9A 3AQPA 3OQ2A 2HEQA 1M1KT 1Q5VA 2D9OA 4JLGA 2BR0A 1WHJA 3MO8A 2BX6A 4S0MA 5C42B 4C98A 3M4YA 5DDPC 2AGPA 4WZMA 4PXDA 2HQCA 4XPEA 4CLLA 3HSJA 2MZTA 5GANh 4RUCA 2PT0A 1U8WA 1EKSA 1ZAXA 4BY6B 3NG8A 3NCQA 1SJ3P 4JI8J 2O67A 4X4VA 3M0TA 3H5SA 1Q82R 2M8DB 3PM9A 1C0TB 4HT7A 1TSFA 2PVDB 1UEUA 5LXYA 5JXSA 1L5UA 4K0KJ 2V4QA 1MWZA 2HVDA 3TZZA 4HL9A 3TEEA 5DZ6A 2CRLA 2HHUA 3CJ5A 3DRRA 1EFNA 2LX7A 3WVEB 2XLJA 2XMVA 1K44A 4ELYC 4YB5A 1N8RT 3MEKA 2X3DA 1SH3A 4JI4J 1QVPA 2HHHJ 1NLPC 1LQ9A 1XBWA 1T02A 1M1GA 1QP2A 2R2TA 3IO1A 3B54A 4ZLJA 1NLOC 2AZSA 1RTJB 1WXTA 3IGNA 2HHWA 1X31C 4DPXA 3EZ5A 2CJQA 2F9DA 3V7CA 1Y4ZB 3VS6A 4B17A 1HMVB 2O3DA 4UF4A 3VCDA 4HACB 3EYZA 4KFBA 1N88A 3R5GA 3ZL7C 4ZHRB 4BUGA 2K7AA 2IA0A 4G1QA 2WSFE 1Y00A 3HP9A 4ANJA 4GKKF 5GANf 5GAN5 2XICA 5IZHA 2IMWP 4LMZA 1ELOA 1M5VC 4NE9C 5L38A 2DJZA 4R56A 2KM8C 2XHWA 1NDLA 2J9EA 5B0EA 4GKJJ 2PMHA 1RBAA 2V8VA 2XYPB 2IM1A 4K4YA 4PKCC 4CDIA 3UA7A 2FVSA 3Q8UA 2U1AA 1IM6A 3FFIB 5KYNA 1VRUB 4LN2A 5L1IA 3BDLA 2VBWA 3M2RB 3QPIA 1TQLA 2DA9A 2CP5A 2K57A 2OPPA 1VBXA 1DLOA 1NKEA 4J9HA 4HT8A 1SJFA 1VQNA 1MWYA 2RQTA 1EKRA 3I82A 1GMWD 1CQMA 1NAQA 4DSIA 1VIFA 4WXOA 2DGUA 5DQIA 3MM7A 1HR0F 2Z2ZA 1WC6A 1I1JA 5CD4H 2MB0B 2XMAA 3RB4A 4A4HA 4PJOD 4WFZA 2GFUA 4KTQA 3D66A 1H92A 3LW5C 1K8AC 2OELA 2XWYA 1FVQA 1PIEA 2DNRA 2HQ3A 3GB0A 2XU8A 3PW5A 3L9ZA 5IHKA 3LH0A 2GAHC 3ZTSA 4XAXB 1W70A 4ICLB 2MKCA 2RDIA 5DRKA 3WQPA 1T95A 3Q8SB 3VAFA 4RLEA 1IKWA 2LQBA 5IXFA 3QUIA 1M1FA 4PAAA 1X6GA 4BY6C 5DLGA 4HHJA 1HBOA 2MLYA 3W5XA 2IC3B 3LQVA 1I5OB 2ZDPA 4USIA 1Q81U 1RI9A 2H8HA 2RHZA 4ID5B 3CCMS 1PC0A 1HNIA 4DR5F 1RAFB 3RRGA 2IRYA 5D0RA 3FEOA 2RMLA 3KLHA 2X1BA 3H42A 4K4ZA 4CT8A 1LNXA 1YJNS 4QWEA 2VQFJ 3QGGA 4DV0F 2JVRA 2F4FA 1KFDA 1Y96A 3H7HB 1BIBA 2R7VA 4FXWA 5K8MA 2ROPA 2CT3A 2AJ0A 4OYXA 3E2EA 2NUPA 1BQNB 2C3UA 3SV4A 1O75A 4YN3B 3KLEB 4RW9A 2W8LA 3HHEA 1VQ8S 4RTVA 3OR2A 5M2PA 3GV7B 2F9JA 4ZVQB 5JUMA 1H2TZ 4F26A 1RHMB 1MMNA 2J9DA 4TVRA 3FBBA 2B5JA 3DLBA 4KGKA 3CCES 2OTLA 4RNOA 2EKOA 2HNZA 1TL1A 2GVZB 2Y8YA 1AW0A 1KJWA 2VKNA 2I2YA 3CC2Q 1S1UB 4PJMA 2IM2A 2XTJP 2DK3A 3DU6A 2LJ1A 3NPFA 2UXCJ 1MSWD 3CULA 2M3DA 2AX1A 2VD3A 1KLMB 3DLGA 1M2VA 4DBFA 2OSQA 2VG6A 3VAJA 2LCLA 5IC4B 1WG4A 2RHXA 2KK4A 1S9GB 2IRXA 1REGX 1VBYA 5D6WA 2ZVSA 4QCLA 2P4RA 3BH7B 3TRGA 3AOCA 2CJYB 5IOLA 4OB3B 1YITQ 2DB1A 1HBUB 3PTWA 5LL6S 1WKKA 3M8RA 5D6XA 4NLGA 9RUBA 2LQWA 1SV5A 3PIOA 2D0NA 1FDBA 4RW4B 2YBVA 1RT3A 1LXJA 4J9MA 1PO6A 3CJKB 4ZVFA 3QMQA 3FZ2A 3TUIC 1G2BA 4ZPTR 2VKRA 1SV5B 4FS1A 5KT4A 1IO6A 4P52A 4F3MA 3BQ1A 4PXEA 2ADBA 2BANB 5G4DA 3ISNC 3MMAA 3B78A 4CT9A 2DYBA 2G0JA 2W25A 3DKMA 2K4YA 3QZ5B 4C92F 1H3DA 4RUGA 4M78C 3TZYA 2CXEA 4BWMA 1XEZA 3RTVA 5GMKm 2IAJA 3MOJB 4DV2F 1KK7A 2MKJA 1YVFA 1HKAA 1JLQB 1XR6A 1K76A 1CPZA 1EB0A 3IN5A 3C16A 3CMAS 1WJQA 3VAGA 3IBWA 3FRNA 3I55A 1ZS6A 2XIDA 2Q6BA 2KXCA 3CC4A 3LPYA 5LJ3d 3AD7C 4G65A 5KT7A 3HMJG 3SCIE 1YFNA 5DZ7A 2PVGB 2Y4YA 3VS3A 3RJMB 3KK1B 3N4WA 2B8QA 4C9DA 2CZ7B 2GVZA 2EFVA 3GNGA 1B0VA 1OI1A 1QAYA 5DQHA 2AX0A 4N56A 1VQPS 4AXIA 3C15A 4PNOA 2KHDA 5BJRA 2H5EA 5LJ3h 3HL8A 1J5EF 2QK0A 2OPRA 2OTJT 3E01B 3ELHA 2GTOA 4ZVEA 1EP4B 3X20B 4OL8A 5B0AA 4QIVA 2PGCA 2DNKA 1RU2A 1U2CA 3BPDA 3CCZA 5DGBA 1YJNA 1ITPA 2YQ0A 5GANj 1UEVA 1LVKA 1WJRA 3MURP 1Q82T 5CKBA 3JXOA 3H5XA 4LVOP 5HLFB 3FJPA 2PD1A 1NMEB 1TK5A 4CCHA 1LOJA 3C0CA 2HGMA 5HJYA 2YKNB 4N8NA 4AT1B 1Q53A 4UUXA 5HQ8A 2XQCA 3L2UA 2OEKA 3NMRA 2RQRA 2R7XA 2BUDA 3TARA 1U47A 2JMCA 4LD9K 4R8UA 5IWAF 4KJIA 3B6BA 5J2NA 5CYMB 4UZCA 2W2QP 1IKYA 1H98A 1UAWA 1N8RR 3NS6A 3DRYA 3A98A 1PRLC 2D41A 1U1OA 4O6JA 3OYJA 2AJ4A 3BKUA 1AWJA 3A1YG 2XDBA 1XWLA 2LCWA 2IIMA 2J06A 4TYAA 1GRIA 3OA6A 2D8JA 1ZAVA 3NEKA 3BO2A 1NJWA 3UDCA 3MPWA 2RNAA 1SSFA 2K06A 4BBYA 1UEBA 2HQIA 2A0FB 1U5SA 2C0TA 4DFMA 4LR9A 2VPXB 3K89A 1N6QB 1Q5YA 1QUVA 4KO0B 5LMUJ 1UFFA 2HKEA 3BDPA 2MYSA 2W7OA 3BYRA 2DH7A 4HDHA 2MKKA 1I5LA 1UEKA 5HP1A 3FCHA 5T14A 4LFAF 4EMKB 2M16A 2MY7A 4ANDA 4DUYF 3VGUA 2B4VA 1MNDA 2JNGA 1TUWA 1R8AA 4YB6A 2DNNA 4WFNQ 3M6XA 5I21A 2W9CA 2FZKB 2XMMA 3RBXA 3ITHA 1D8ZA 3KUFA 2W01A 3KG1A 5FWBA 3IXQA 3B8HA 3ADAC 1UZHA 4DA4A 3HPWA 4X2BA 2MQOA 2QLJB 5GAOr 4Q5VA 5KFMA 4UQGA 1S9GA 3CB4A 2YNGA 3LGNA 1P27B 4DF4A 2OMLA 4OZ0A 1RAGB 3M8PB 1FXDA 4F2RA 3FQKA 3N5BB 1QKWA 3Q24A 2Z2YB