2YWWA

Crystal structure of aspartate carbamoyltransferase regulatory chain from methanocaldococcus jannaschii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
141
Chain Sequence
b'KVKKITNGTVIDHIDAGKALMVFKVLNVPKETSVMIAINVPSKKKGKKDILKIEGIELKKEDVDKISLISPDVTINIIRNGKVVEKLKPQIPDEIEGTLKCTNPNCITNKEKVRGKFKIESKNPLKIRCYYCEKFLNEVIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate carbamoyltransferase regulatory chain
molecule tags Metal binding protein
source organism Methanocaldococcus jannaschii
publication title Crystal structure of aspartate carbamoyltransferase regulatory chain from Methanocaldococcus jannaschii
rcsb
total genus 31
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
A PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 2ywwA02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 2ywwA01
5AT1B 1RAIB 2A0FB 1AT1B 7AT1B 4KGZB 1RAGB 2BE7D 2HSEB 2IPOB 1ZA2B 2YWWA 4KH1B 1TU0B 3MPUB 4KGXB 2FZCB 4FYXB 2FZGB 4FYVB 4FYYB 1ACMB 1NBEB 4KH0B 1Q95G 1D09B 2BE9B 1RAEB 2ATCB 2AIRB 4FYWB 1F1BB 1RABB 2FZKB 8AT1B 2QGFB 9ATCB 4AMCA 1R0BG 1PG5B 4AT1B 1XJWB 1TTHB 2H3EB 4E2FB 4WTOB 1TUGB 1RADB 1EZZB 1SKUB 1R0CB 2AT1B 2QG9B 1ZA1B 1RAHB 3AT1B 4KGVB 1RAFB 1RACB 1RAAB 6AT1B 8ATCB 4F04B 3D7SB 1I5OB
chains in the Genus database with same CATH superfamily
2HKEA 4OMNA 2W7AA 1YITQ 4HDGA 2FPFA 4JJCA 4HACA 4QPTA 1NPKA 2V2VA 4P2XA 4BUGA 4PG5A 3PW2A 3BGRB 4USVA 1L5UA 1BKBA 2DILA 5GAOn 2RK1A 4IKAA 4E8UA 1C4AA 3OW2R 4P6QA 5KFHA 2L9DA 3UR0A 4UOGA 1S0NA 4A53A 3R6GB 4OX9J 2BJ7A 3HHEA 1PSEA 1NKBA 2J7WA 2V5HG 1UEUA 2YWHA 1QTNB 3MPUB 1ZM2A 1IBMJ 3CXCR 2QYGA 1FRKA 4I4BA 1N36J 1HBNA 3VS4A 5A76A 4ZLJA 4Z89A 5D6GA 1JLQA 1HHQA 3OYEA 2LX9A 4O4RA 3TEEA 1QVGR 2DIQA 1Q5VA 3M9OB 1OS5A 5AXNA 4DUTA 2OKQA 4N4GA 1UE9A 3CCVT 1Q7YT 1B0TA 2OELA 4ELZC 2R7WA 1UFWA 2UXDF 4A8KA 1RT5B 3C6TA 1JLCB 1C1BA 2QAZA 4LD9K 3PG9A 4PWWA 5KE3A 1L3KA 1P6TA 2C28A 3K2YA 5I3UB 4C8OA 3QT7A 3SSQA 3OYGA 4USWA 1MU2B 5AJ3J 4Q7AA 4Y6IA 3CCET 3HKSA 1HR0J 5D6XA 2EK1A 1G2EA 3DYAB 3DFEA 3A8OB 3I35A 2RNAA 4A8OA 2VFRA 4B9XA 2AJ2A 3R5CA 4EO6A 4QWCA 1I94J 5H9EJ 2GJFA 4NOHA 1WEYA 4IG0A 5SUHA 1VQ9T 1RTHA 3VS5A 2RHQB 2VB6A 4JZ3A 3K5MA 5EC7A 1QAXA 1JJHA 1AZSA 3C14B 1EX8A 4C48A 5I21A 3IA0A 4FBUA 1YDLA 3QGIA 3GLJA 4NRTA 2OH2A 1RAHB 1PKUA 1N54B 4U8YA 4LNPA 4ZCIA 3T5HA 3SXLA 3CCLS 4DX7A 3V6DA 1N32F 2FZGB 1IR0A 1OOTA 1YJVA 1Q7LB 4M7DF 4LT6A 2AEMA 2QG9B 2XLJA 1KFZA 1XMOJ 4AG1C 3HPOA 2RJCA 2Q1LA 2XNRA 5T7LA 4E7HA 1TKXB 2CG4A 2MZRA 1I1GA 2A6OA 5J39A 1SB6A 2P4TA 2QSFA 4RBUA 4DFKA 4PEOA 1K8AT 4A48A 1TMMA 2CKWA 4RJVA 3BN4A 5CCMA 3DGPA 3O6QA 2XMTA 2H5EA 4DBHA 2DZCA 4MFBA 1VQKQ 1TP7A 2LJ3A 1GRIA 5FIIA 1SJ3P 4MYTA 5CKFA 1G3YA 1U0SA 3M6VA 3RG6A 4ED2A 4L73A 2XD0A 4NCGA 3TZYA 2RHXA 1WG5A 1M9SA 3MURP 1SVDA 2VKZG 2F8EX 2R2RA 2JSXA 1RLDA 1S6PA 4RW6B 4J90A 4YHHF 5KG3A 4R8UB 2CKKA 1GFCA 2B4UA 4RUCA 2XYGB 1BU1A 5E3QA 3NNHA 1Q82U 2X35A 4DF4A 1X2QA 2BTTA 2VOOA 3G71Q 1M2VA 2UU9J 4KB7A 3Q8RB 1E6YA 3UD5A 3PW5A 3I56Q 2C06A 3HFKA 2QEXS 4LRBA 2HS4A 5E3PA 4GKKF 1P1LA 1U7LA 3VHQA 4JDSA 4OFZA 3AXMA 3TZXA 1RHUB 4B9TA 3FBBA 1U1LA 4ZCLA 2NQPA 2RDJA 3DI6B 2P8IA 1Q78A 1YWPA 1YJ9A 4L76A 1QVFS 5LJ3f 3A8GB 1HNVB 2CZVC 3BYPA 1JKHB 3ULHA 1BQMB 1X4FA 5DG8A 2M9KA 2J06A 4LVOP 4NLYA 4U8VA 3G9CA 2J76E 2DXFA 4ID5B 2ZUGA 4ZVGA 2XSJA 1BY9A 2W4DA 3KHLA 3DC2A 3S6WA 3PR5B 1N6QB 1XEZA 3WC2A 4NLGA 3VS1A 2OEMA 2EQUA 2ROEA 2LEAA 1FWZA 1N5VA 4CH7A 1H73A 4C5IA 2RQVA 5DDOC 2KVIA 3HHTB 4M7DE 5IXFA 3DXSX 1S1TB 1WOPA 3VGUA 4AG2C 3VQTA 1UVIA 3ZNUA 2CVEA 2EFPA 2AZ1A 2BX6A 1I6JA 3BSNA 1IB8A 4M77E 1YHQA 5AE3A 1U26A 1J2VA 2KRMA 1U2FA 2X4JA 1K1SA 2XI3A 1EX4A 4M77D 2G13A 4R55A 4MZPA 1HD0A 2CJBA 3INZA 3BREA 4ME7A 3LH2S 2LU1A 2ADBA 1GH8A 2FDNA 1Q16B 3ER0A 1P27B 2EKHA 5D0EA 1U06A 4B3RJ 1JX4A 5FROA 2PTKA 4OB0B 4XU0A 1UFFA 2KQWA 2YKPA 3DLKA 3FCWA 3OFHA 4C11A 2LJ0A 4M7DC 4ZVEA 1SUQA 3E1SA 1X5OA 5C24B 3C16B 4A4JA 1LXNA 5H1SV 1OQKA 2K79A 4Y2AA 4ZVOB 1TKTA 1DQ8A 1U8SA 4YB1P 3VAHA 2LCCA 5A8WB 5DM7Q 5GAN2 4MK7A 3UNGC 1WKLA 3GF5A 2W2OP 4M7DD 1X9WA 1Q8LA 3J81j 3QNWB 2XC9A 3ITHA 2H3EB 5FRNA 1AFJA 4QW2A 1T94A 2YNGB 2M3DA 3EVWA 1LW2B 3PR4A 3UR3C 5DJBA 3LP0A 2D9OA 1RU2A 1S4EA 3HSJA 3D6HB 3R1LA 3HSDA 5LSLA 3OVBA 3RIRA 3CCSQ 1V3ZA 1DJ7B 1N34J 4DDFA 3NMZC 4DL4A 4M78E 2CUYA 4BLGA 1R0CB 1P9YA 1U47A 3WVDB 3MAHA 1KTQA 2GFFA 3CCSS 1FKPA 2BABA 4QYRA 2HQCA 4B9LA 1AUSL 4CLTA 3A12A 2CJYB 2EFQA 4C4WA 1UJYA 4X4UA 4RO0A 2PO4A 4P2MA 2I38A 5H9FK 3B6BA 2H5IB 3BPSP 1VQ5A 4X4QA 1SKUB 5ETVA 4EBDA 3K5OA 2WSEE 3KLFA 2L3RA 2IY5B 4M8LA 2LQ9A 4ELYC 3CCRQ 3LP2B 2LP4A 4NRUA 5M9OA 1UP1A 1H2VZ 2E70A 4F4XA 1M1KT 3P8HA 4GC6A 3HVRA 3WX8A 1RI0A 4OJGA 2L5QA 1NB7A 5KT4A 4WJBA 3C94A 4B3TJ 3SEMA 2DNMA 1UG1A 4OJHA 4ZPCA 2LVMA 1N52B 3UPUA 1WDDA 3W2VB 3OYHA 2CZ6B 4USIA 1SV5B 3M8YA 1S72Q 2W10A 3NWGA 5L39A 3CDBA 5KFGA 4OI3A 3PRVA 2ZKTA 1D0XA 2LCLA 3S1TA 4QU6A 2HZVA 1WNLA 3TX0A 2KJVA 3POTA 2DXCA 4Q2LA 2CXEA 3ENWA 4CO0A 4M75F 4DPTA 2JZ5A 4C92C 1VQ4A 2PMHA 1X60A 3IR7B 2AU0A 3S3NA 4OI2A 1KFDA 1M27C 1G3TA 2W2QP 1W70A 1KQSA 3D6TB 2VA2A 4Y2KA 2QQSA 3MTKA 4P73A 3LP2A 1UPPA 3MPWA 4AE5A 2KYXA 2KDSA 1D0YA 3KLFB 1VBZA 5I4MA 3AHUA 2M1HA 2IVWA 1Q7YC 4FKXA 3GJQB 2RDIA 4JI2F 1Q86T 1WHJA 1JO8A 3T5KA 2OD4A 4PXCA 4B02A 1M2OA 3BQ1A 2CUBA 1CPZA 2A1BA 5DZ7A 2KRRA 3DRRA 5GMKl 3C19A 4FW2A 1KLMB 3D66A 3FFIB 4EPCA 4AL7A 1F3VA 2BE7D 3Q8VA 2R8GA 3WIUA 5DDQC 5GJWB 1Z9QA 4FYVB 3AJ2A 3BDPA 5K8OA 3GIIA 2DJZA 4KC5A 5GAN4 5DLFA 2PMZD 3X26B 2OUGA 4H4MB 7FDRA 3EVOA 4ZS6A 2ZM6F 3C95A 4QT7A 3ET6B 1PYSB 3MM9A 2LQKA 2DO0A 1AT1B 4A8XA 1UJ4A 1WSRA 1JJ2R 2NYIA 2J6UA 3GYXB 5LJ5Y 1DARA 2DXEA 4FYWB 2IJRA 1QSYA 4B9UA 4LJMA 2CJAA 2LZ6B 4QIVA 5E5NA 1CJTB 5GMKj 3G86A 3T1HJ 4RNMA 5D77A 4F0KA 1SSFA 4A8FA 2XO6A 4RCCA 3I31A 3GFXA 4P52A 1YJRA 3K89A 3A8HB 3DLKB 2L3SA 4LFAJ 3LWLA 4UTGA 5GAEU 1C1AA 1F5CA 4NLXA 4JUVA 4LD6A 1TKZB 2HNDB 1U1QA 3J81E 1ULRA 2MZSA 2MJNA 4CLPA 1WC5A 1GXIE 1HLWA 4NLWA 5EUHA 1C1CA 3CDUA 2KB2A 3SD4A 4M75B 1TL3B 4TVAB 1TL7B 4OYBA 4QJVA 4KTQA 2PUOB 3MCMA 4DCPB 5HATA 2GTJA 1TUDA 3PT9A 2ZKUA 3RUXA 3V6JA 2YX7A 1QCNA 2R2TA 4BDYA 1WXUA 4F4KA 3C6UB 1JIHA 4DU8A 4A8YA 3TVKA 4WXWA 1Q81C 2RSQA 1RUSA 5HK0A 2YXLA 2PZ1A 2DXDA 1M3BA 4B9NA 5AYFA 3NTHA 3A8JA 4R0EA 2M9UA 3CEYA 1M1KR 4FS1A 2K1RA 3D9BA 4LIRA 4CP5A 4NE9C 3G7ZA 4DS4A 1SBRA 3KJNB 4RCBA 1QSLA 3Q8SB 3KLHA 1OZ2A 3SI8A 3KK3A 1ZQ1A 2EGCA 4X64F 2CNNB 1S6QB 1MMNA 4JJNK 1QMCA 4OMQA 1OY9A 2YPYA 2JVOA 4WIQA 4WCIA 1RLPC 1WHVA 2RKIA 2ZE2A 4NLTA 3MR5A 2MHEA 1M2VB 5A2QE 3BPDA 1CJUA 2CQ4A 2O2OA 4M77G 4MMOA 2WB1D 2K3BA 3CD6A 5BJRA 1DZ5A 5D4LA 3A13A 1OJ4A 1WQWA 3L7UA 4KPYA 8RUCA 4B08A 2PI4A 1ZAXA 4PLIA 3HDSA 3PXGa 2O5DA 3N28A 2HBWA 1LW0A 5KTQA 2XICA 1FYNA 4NCGB 1Y3JA 1QAJA 2DGOA 4RW7B 3FQLA 9ATCB 1YRXA 2JLEA 5GMDA 2DE0X 4CC2A 2J0WA 3JCMb 4YDDB 2G1DA 3DGPB 3TANA 2F2VA 1V76A 1NMEB 4QVCA 2NXJA 3M05A 2HHWA 2PMWA 1PYOB 2MCNA 4DOWA 2IAJB 4JRIA 5HMYA 3TEHB 1HNWJ 2MZ1A 3JSMB 1PKSA 3I96A 4DBFA 3EM1A 3VQSA 2KVQG 4J9EA 1U24A 3CD6S 4YB6A 3RJMB 3HT3A 3R6NA 1B3QA 3MTJA 1XWLA 3AY0A 1KG1A 3K5PA 2V8HA 2DITA 1YQHA 1SIWB 1N5YA 2PC6A 1R0AA 2ZPEB 2F2XA 3RW6A 1HW8A 2ZPHB 3MP6A 2C42A 4FXVA 5D15A 3FJ2A 2HFSA 4TYBA 2X3GA 1RT6A 3CC2T 3H98A 4RUAA 1Y07A 5A6PA 1EARA 4RNNA 4HDHA 4L6V5 5B0GA 4PWDA 2JFKA 3OD2A 2JTFA 2HWHA 2LQ5A 4R0JA 3V4IA 5LM7E 4OP0A 1Q81U 3CTRA 2R7XA 4QWEA 4DEZA 3VS2A 4N8NA 1RTHB 2O66A 4IOAQ 2DL8A 1ABOA 1KVJA 2K5FA 5LOQA 2YPZA 1CS4A 2HSEB 3ZZOA 1OO0B 1RI7A 5ETNA 4DV5J 1FJEB 1HW9A 2QTWA 3R9LA 4DR4F 5T41A 1MHNA 3GQCA 3UE2A 4ED8A 1HNWF 3PRDA 1XOVA 3WX4A 3EG1A 2HNYA 3D6FB 1YJ9T 2I8EA 3TI0A 1NM7A 1N33F 2ZBRA 3OW2A 1A0NB 2DJWA 3EG0A 2DO4A 3GE9A 3DLBA 3G8QA 5GANf 1UDLA 4RWWA 3CXCA 3VS7A 4HXJA 3HSBA 1C1BB 2JOYA 5H9FJ 3PMTA 3DOMA 2JEIA 2ACMA 3MEEA 4L75A 3RESA 3JQJA 2RHSB 1M1HA 4YR3A 3AJ1A 2PN6A 2AWZA 3RBEA 3X3UA 1OPLA 4CO2A 5J2NA 1ZA1B 1W2IA 4GLMA 3HSZA 1K9AA 4PR6A 1JLQB 4ZPVR 2HS0A 4XPEA 4NI2A 1OY8A 4I6YA 4DSFA 1ZAWA 3NGSA 4A46A 5KG0A 1URRA 3M30B 3F0NA 5I22A 3JB9I 3KK1B 1H2UX 1REGX 3RU0A 3SCJE 2GNCA 3RDVA 4ECTA 1AEYA 3X24B 3NWRA 2D9TA 5F3ZA 3H0IA 1X31C 4YEAA 3CD0A 2OX7A 3ZTSA 2MQMA 4F14A 2R5AA 1AWOA 3DHXA 3ONQA 2DYBA 3HFNA 2CS7A 2RUGA 4F7UB 2WRMA 2QLWA 3SSRA 5CKEA 2E6NA 4ZLPA 4IIMA 2IPOB 4RWXA 1SL1A 3AFGA 2F65A 4JV2A 1QJHA 4RW8B 5HN0A 5GAN5 2D3UA 4LF8F 5MLCV 2YTCA 4LIWA 1HBMB 2E5LF 4I7FB 2JJ4D 1X4CA 2FJWA 5GAMe 4KKOA 5FRMA 3THVA 3M1VB 4Z88A 1DTTA 2HFNA 2AGOA 1X4BA 2QL5B 2B43A 1Q95G 4USTA 3I82A 2B6AB 1XBWA 2QA4T 2QQAA 5C42A 3IG1B 1W2BA 2H51B 1OU9A 2MKYA 2EEYA 3QMQA 1RISA 5H9EK 3GLXA 3NGPA 3QGPA 2E9ZA 5F8HA 1TTHB 2KL8A 1FJCA 4NWBA 4OHXA 1VISA 3KLGB 5CQXA 1RT4B 1K73U 3SV3A 2AYBA 4DV0J 2HVZA 3V4IB 2I9SA 3M32B 1ZPVA 2E3HA 5M2RA 1SEMA 1J27A 3IRXB 2VKNA 3NTIA 5FWCA 3PZPA 1RAFB 4DR4J 4Y34A 1PO6A 4CT9A 1IWGA 2DJQA 2RI3A 1K73R 4LRFA 2F5GA 2HIQA 1RWVB 4ECQA 2NCKL 3I55A 2DEJA 2RU3A 1HBOB 2CQCA 1ZH5A 2V69A 2LJ1A 4E7LA 4XAKA 3W63A 1M4ZA 3EVMA 3CCUA 4MIBA 2HIYA 3W66A 3LWHA 4A47A 2VG6B 1LK7A 4RW4B 1HI8A 1E6VA 3JCMX 2C3PA 2V94A 4LUDA 1KP6A 4X4OA 2UVUA 3MKDA 4HHUA 2ZVIA 3HFOA 1W2BR 4H4KA 3A3NB 1QE1B 1I5OB 2ZOFA 3DCAA 3J7ZT 2OAUA 3MEAA 1M90C 1TL5A 2DHAA 2M88A 2HQXA 3ENAA 2C2MB 3CJSA 1WF2A 4RTTA 4OYZA 4YUDA 2PUKB 1CJKB 1EJ7L 1WD6A 2MZJA 1XNIA 2RVJA 1WDXA 5GANd 3JYTA 1LNQA 4JI4J 1IZ6A 2ASYA 3CJ5A 2EJGA 1S9FA 4C5GA 1HNZF 2LVWA 4RNHA 4DCOB 3G6ET 3HRSA 2CYZB 1LWCB 3G82A 4KPCA 2MLXA 4M78F 4XU1A 2IA6A 1VIEA 3FK4A 2JS0A 4G6VB 3QPHA 4KJIA 1ZOTA 5ETQA 2OPQB 1YNZA 2ZZDA 2L3PA 3RMQA 3D6MB 3R5BA 1VQNS 3R2DJ 2APOA 2CNKB 2L9NA 3MPYA 4HI2A 4JI5F 2HFZA 1HQUA 1Y5IB 4OI0A 2V2KA 2XDDA 2Y3YA 4JBCA 3SCIE 2PVDB 2LNHB 1S6OA 4K4WA 2VFUA 3MO8A 4QVDA 2BACA 4E7JA 4RUHA 1NJZA 2Y9HA 1XK8A 3G71A 2QL9B 3CC4Q 3FIFA 1A6LA 2QRRA 4LXCA 5D0RA 1BE4A 1HQUB 2FY8A 2XU8A 4QR0A 3BB5A 3IXQA 2VBXA 1QTMA 3IS9B 2M8HA 3CJ2A 4K4TA 4NOYA 2BKOA 2R7SA 3HM9A 4JRPA 2IBKA 1S9GA 2I0XA 5B0AA 3TQ7P 2QA4S 2M70A 5F8NA 2YDLA 4HHHA 4M5LA 4CLKA 3FB9A 2M5YA 3L95X 3O1LA 4ZVPB 2GCFA 3UVJB 2O88A 4E0DA 5ADZA 3QKJA 4DI6A 1XNRF 1PSDA 1HWJA 4DHVA 4AD6A 1PC0A 1X2KA 4FKYA 3R8YA 3X25B 4TU8A 2YHTA 1KRPA 4NMLA 3QZ5B 1FA0A 2CQGA 1A0OB 5HMZA 4K59A 3CGIA 2QA4G 3M56A 2KHCA 4FNHA 1RWKB 2X4YA 3QJPA 2NLUA 4BACA 1RCXB 2CP6A 1DFDA 1RAEB 2DPPB 3H5YA 4E2FB 1HR0F 1VQ6A 2XZWA 3QT6A 3CMAQ 1ZSZA 1HARA 1M90T 3GTYX 2H65B 3W2WA 1MUZA 4JI8J 3KBGA 1C2PA 4KULA 3HKWA 2U1AA 4KUDK 1UEKA 3J80U 4YY3J 2DNYA 1SSHA 1U1PA 4OVAA 2KGTA 2OD6A 2JW4A 3CF5Q 4ED1A 1WOSA 2Y1JA 1M5Q1 4XTUA 2YRVA 2X3WD 1TVRB 3F41A 2DGUA 2AGQA 1MV3A 2WZ1A 4NLUA 1BI2A 1LVKA 5GADU 3PNWC 1MWZA 3OA6A 2BUNA 3ZL7C 1BI0A 6AT1B 1TUVA 1U02A 3IRXA 2V4JB 3H25A 5KYYB 3LAKA 1N8RR 1I07A 2AW0A 1OV3A 2OPRA 2KVQE 5GAMd 2W01A 2XWXA 4M7AE 3QT5A 4QOTA 1D0ZA 1S57A 5KYXA 3DB3A 1TV6A 3R2CJ 2BKNA 1N0UA 2GS8A 2KO1A 2WVBA 1PAEX 3PNIA 3BGUA 1ZTTA 4Y65A 3TNVA 2VKRA 2K2VA 4L3NA 3EWGA 1N8RU 5GANj 3QYGB 2B6AA 4CYUB 2VBYA 4W4MA 4JI6F 2DFUA 2RU9A 4KFBA 4ED0A 1IN0A 3NY0A 3MMAA 2AJ4A 1VI7A 3ZZ0A 2LEPA 1U4BA 2UZAA 2HKNA 1VQ9A 4A8MP 4CM2A 1CC7A 1GBRA 4K2XA 1FRIA 1J5OB 3CCRS 3OTOJ 2DH7A 3A1PA 5E41A 3MR2A 2D41A 1O75A 4VUBA 3M8QA 3VAFA 1AROP 2YNFA 1K1ZA 2OGUA 3MR7A 4DR6F 4I6AA 3BH6B 4PFPA 4Y3CA 2QXFA 2JHEA 3LW5E 4ZIWA 2YH0A 3MM5B 3EH2A 2VV5A 3U27A 5KYXB 4D8KA 2HRTA 3MEDA 4BDZA 4XTTA 2YQ3A 3RAMA 4C92G 1YJNQ 1HFEL 2PGCA 5FLXY 2KR3A 1BI3A 2DERA 2CZ9A 1QUVA 3OY9A 5F3TA 1KLNA 2GZOA 4WTOB 4RKUE 1TKTB 2KXCA 2O9VA 4JI5J 2QA4A 2E1RA 4MDXA 4ZGEB 5LJ3d 1U48A 2DHSA 2LYVA 1VQPT 4BE1A 5LMUJ 3IBFB 2XY5A 2BM0A 3H5UA 3OLAA 1JEGA 3LGFA 5MAOA 3I4HX 3V8JA 5HI7A 3LW5C 4BI4A 4DPUA 2K3YA 4C0FA 2A10A 4IURA 4OYIA 4F16A 2EC0A 4WYLA 4DV2J 4TYAA 2ZZTA 5BYQA 5L23A 2LQWA 2DISA 3H5SA 3IN5A 1U1KA 4GVBB 2D74B 4K2JA 2PDAA 2R2UA 1RT3A 2CREA 4XDCA 4HTJA 5HVFA 3JAMY 4LF7J 3UO0A 2JC0A 2D1XA 3TX8A 1IBKF 3KFVA 2XK0A 2GAHC 4OMFG 3PX0A 3TRGA 1A7GE 5B08A 1AWWA 3G96A 3VAJA 2W9BA 1VQSA 1NJWA 1T05B 1SUQB 4CCHA 4GRSA 5HK4A 4QKUA 2EFGA 5LJ3Y 2NSCA 4AUKA 3HZGA 3CMEA 4UOCA 3JAMU 4OQJA 1NDCA 2GX8A 2ZJPQ 1SL0A 2DD5A 1SH0A 2BVZA 1KQFB 3CSKA 1N88A 2CWXA 3QBCA 1L3UA 3BGOP 1IR1A 2M0GB 4NA3A 4ECVA 2J9DE 1SH3A 4ECYA 4ZPBA 2ZJRQ 4FPRA 1R89A 3VAMA 1N5YB 4ANJA 1MN7A 4GKKJ 1WI8A 2DEUA 2FRYA 4J9IA 2HS3A 2GO8A 3DLGB 4X4VA 2G0CA 2ED1A 2Z2ZA 3OBWA 5U47A 2EJFA 1VYVA 1WHMA 4CH0S 1S1TA 2IVFB 3GG0A 1U45A 2F8HA 1NJIC 1Y7PA 4QIWD 3G2XA 3MUVP 2YWEA 2J9DA 4J9BA 4MKBA 3PX4A 4TQSA 2LP5A 4XAXB 3QRQA 4EK2A 4PG8A 3CCJA 1HD3A 4BE2A 2GF7A 3CMET 2XY7A 1Q53A 2HW3A 1UGPB 1LWFA 2UXCF 1VQ8Q 1CG2A 4JZ4A 2UXBJ 4DV7J 4KBIA 4GY5A 1HBOA 2WSEC 3D2WA 4C0DC 4C8MA 1FNOA 3KJVA 3HJVA 1UHFA 3JCMJ 4M78G 4PWDB 2BQ3A 1EAYC 2ZH2A 1NJXA 4GVLA 3CBMA 4O4GB 2CT4A 4PJOB 2WOMA 2HVEA 3Q1JA 1KC8R 1K1QA 3SDZA 2HGMA 2MSTA 3OR2B 1TWBA 3A8MB 1CJVB 3FZ2A 1XMOF 1K0XA 3E2EA 3QHSA 2Z30B 2F5KA 2XCPA 2RDDA 4EMKB 1IR2A 2X51A 3KJVB 4NLDA 2QX0A 3J81U 3M6UA 2HK2A 3THKA 4JLIA 2GO9A 1Q82R 1FJGJ 5CYQA 1VQLQ 4DL0C 2GVZA 1UGRB 1FWLA 4KH1B 4FCYA 5I3PA 2HEQA 5AXLA 2B8AA 3Q0AA 2NUZA 5LJ3h 3TARA 4DX8H 1VK8A 2JH3A 2J6OA 4UZCA 1N32J 2OTLT 4MFBB 1NG2A 4XK8E 4ECUA 3MUTP 3QZ9B 4M7AB 2BZ8A 4FT2A 4HVWA 3P5TL 5IV3A 1OYXA 3SCKE 2E29A 1YRTA 2DTHA 1ZSGA 2LQJA 4UY8T 3PYEA 2KDOA 1TKXA 2ZBIA 2CSQA 4JI6J 1YWXA 2K9GA 3N5BB 1Q1KA 2LT1A 7AT1B 4RNFA 3EH1A 2KRNA 2BUDA 2D6FA 2IM0A 1T11A 2B8QA 4JP8A 2KG1A 2VG7B 3M32A 3CCLA 2DX1A 1OYEA 1WFWA 2E5KA 1EETA 4C8ZA 3H9NA 3PKMA 4FBTA 2E5JA 3GNFB 1HWUA 5B0FA 1J5EJ 2H48B 1RT5A 4C5HA 1LWFB 4URSA 1VFJA 2XG8A 3IGNA 1FO1A 1IGUA 3A8IA 3ZTPA 1Y57A 2Q6BA 1C1CB 4DQRA 2KBTA 2IFXA 1E6GA 3BQ2A 4BC7A 1FX4A 2ASDA 1GL5A 2DH9A 5DDPC 1AD5A 1FWPA 4ED7A 4E7IA 3ILOA 1U1OA 1K44A 3KK1A 4TKTA 4WBFA 1V6HA 4ZDNA 4K4VA 2QTVA 2LC4A 1RSCA 2P9GA 4CO1A 4OZ3A 2IHR1 1VQ4S 3NHNA 2QMWA 5J2NB 4N8OA 4LDYA 1KVKA 3IBCB 1YJWQ 2RRBA 3BGRA 3TVZA 4D3HA 1S72T 3UI3A 4IDKA 1XNQF 3MGJA 4HI1A 2K7KA 5KOWA 3CPWR 3T3FA 3P49B 5D8HB 2FVRA 4PPDA 4HACB 3OL6A 1N6AA 2LDMA 1Q7YU 3M58A 3TO8A 1N5ZA 3HF5A 2MEWA 4F7UA 2BZYA 3AD7C 3ET6A 2B4PA 1ZHIA 1D9FA 1SXLA 2QFIA 1HBUB 1QM9A 4ZJOA 4AFSC 4DUYF 2EWNA 4CLFA 3I55T 4J9HA 3V7SA 3H90A 2ENMA 4LR9A 2K5LA 5JMNA 1KHCA 1TKZA 2ZITA 2HNYB 1VQLS 2EIFA 5L46A 5IOLA 4D3GA 1B34B 4URQU 3VKIA 5B0CA 1Q7YR 4P74A 2MJUA 3M30A 2G0JA 3QFWA 2RD1A 1HI0P 2E5GA 3D0GE 3H42A 3K5LA 5IS2A 4O23A 2DNOA 1UW9A 3MZIA 1XC9A 2I5JA 2QEXT 2JXBA 4UOHA 5KCHA 2AHOB 4XQ3A 4M75D 1IKXA 4F4WA 3JB9J 1ZA2B 1GAOA 4AQYF 3GPLA 3Q86A 4PQAA 4DLEA 1HA1A 3EE3A 4J9NA 2V68A 4MIAA 3QO3A 4EMDA 2YNFB 1ZZFA 2FVCA 1QP3A 2RAQA 3CBOA 2DTJA 2GIFA 2KYBA 1EB0A 5E3AA 4A54A 2A0FB 1N48A 5C7PA 1KK7A 5KE2A 4N56A 2P0PA 4LDXA 4Y2IA 5JVGQ 1JXMA 4P9SA 1QAIA 4IUQA 2X1GA 4O6JA 3OT9A 3H41A 4ZVSB 1CLFA 3POTB 2YWKA 2EGAA 4A4FA 4DR7F 1KLMA 4C8QC 5HL7Q 2FYKA 2D3OR 3NFCA 3F56A 4DL7A 4QU7A 5KFCA 4IRDA 1NB2A 2MMYA 2BJDA 4TQRA 3CMAS 2BKDN 4J8OA 4LR7A 1T7PA 3H8YA 2QDLA 1U6ZA 6FDRA 1C0UA 4CTAA 4J9GA 2BDPA 1YBTA 2DNQA 2CP0A 3MM5A 3WIVA 1FI4A 3KXDA 1FRHA 2LA6A 2DGWA 2FC8A 1ZBXA 3AODA 5KYYA 2EKYA 1GCPA 4MJKA 1FDDA 5IT9Y 1V5IB 1HNZJ 2DNLA 4KQZA 3H4BA 5KFPA 3WQPA 4GKJJ 3META 2QI2A 1X0PA 4A4EA 4Z02A 2MWOA 3MM6A 2ZM6J 2IG0A 2AYMA 4DG1B 3UDCA 4J9PA 3Q22A 1FD2A 1T9TA 1JLBB 4BWMA 2EK6A 4KGVB 3EFOB 1PYTA 2QTXA 3OTDA 2EG1A 2BJ1A 1D9DA 2AKKA 4O3NA 4RU2A 5IT9U 2IAJA 4CLYA 5GAGI 2OEKA 1FE0A 2O1PA 2LTOA 1CC8A 3KLHB 5IHNA 5C2GA 3HXMA 4DX5A 3VZHA 1IBLF 1X8DA 2ZPIB 3ITHB 2WSFE 3GV8B 3HHDA 4Z2XA 1BK2A 1WKJA 2L3QA 2Z4PA 2VD3A 3J7AN 2KTQA 1SC1B 4CQ1A 2AJQA 4JI3F 4FS2A 4J9RA 1S1VA 3R7BB 1LOUA 3ZZZA 3OJUA 3MF5A 2GHWA 1J3TA 2ZH9A 4L59A 1VBXA 4DWIA 4J9KA 4J91A 3Q2SC 3C6UA 3EFSA 3GIMA 3REAB 1W26A 2YBVA 4IRKA 3I55Q 2HLTA 2HD0A 1FF2A 5C0MA 3J80Y 1RTIB 4YTLA 4LUEA 3NS6A 1IGQA 3FSXA 4A8QA 3BSCA 2WW4A 3OSSC 4HLBA 3OMGA 4IR1A 4OMOA 3BZQA 4FXWA 4ZTJA 1YX2A 5EN1A 2HNDA 1VQKT 3QIDA 4WU3A 3M0TA 3CCUS 1S72S 3NCRA 4Q5WA 5CO7A 2YWFA 3AOCA 3U1NA 1FCAA 4NCAA 3KXTA 2EAYA 3IRWP 2R7VA 2Y90A 3NKYA 3ZZRA 2GV1A 4NPOA 1HQEA 2DCLA 1M5HA 4NZ0A 1XNRJ 5I3QA 1PIEA 2VQFJ 3TWZA 4DV6J 4C6AA 1WPYA 1SCJB 2EPDA 3PFSA 4YP3A 2E3IA 4PZVA 2Q43A 3MHXA 1QSSA 2GJ2A 1KQ1A 2JN0A 2CP3A 3UVJA 4Q45A 3DOKB 4ZHRB 2HAXA 4TXSA 2CZ7B 4LFCJ 2FC9A 5LJ5f 2VUBA 1NCLA 2MLYA 3G1JA 3BO4A 3IO1A 4MKYA 1F0XA 3KLVA 5KFRA 4WCEQ 4IQXA 4JB8B 3PKYA 4F7UG 2LQ8A 3ZZPA 4PQUB 2JEFA 1MW7A 1WJSA 1XTZA 4CH1A 2W8KA 1G1XA 2PIIA 1MMDA 4EZ9A 2DYIA 5ITHA 4OLOA 3A1YG 2VQEF 4H4OB 3N79A 3LGLA 2XWYA 4QWAA 1LPLA 2DAQA 2F40A 3HK2A 3CNQP 3CCQQ 1YITS 2RQUA 1NJIU 3I56T 3GR1A 1KEKA 1WF0A 4F3MA 1BWVA 1VJWA 4EO8A 4B3OB 1UZDA 3VWSA 2VQFF 3R3TA 4OB3B 1BQXA 2RI2A 3E01A 2R8IA 2EJ9A 1E6VB 2B0GA 1WC6A 2LRQA 3G71S 1WACA 3QWPA 1AWJA 4Q0BB 3W7BA 4JI3J 3JCMe 2K6DA 2YXYA 1KQKA 3V81B 2NXNA 1U1RA 2LQNA 1ROFA 1I5LA 3CCES 2RHZA 1K8AC 2PE8A 3BY7A 1ZX6A 2PD1A 4JPBW 2Z0WA 2Z8QA 1C4CA 5C2CA 2XMJA 4HHJA 3LWIA 2J6FA 3FCVA 2ZD1B 3WZ0A 4DR5J 2M0OA 2EQMA 4I2PA 5KG4A 2FVUA 1K4US 1GMWA 2FTRA 5GAN6 2GFUA 2D69A 3T19A 1IVZA 3PMIA 1M90U 2KM8C 1RT4A 4CC4B 1M3AA 2JC1A 3BF4A 2JMAA 2UUAF 1WELA 2ZZMA 3NTKA 1TMJA 3NBPB 2B3TB 3NMRA 2XMWA 1NPRA 3P45B 2HBYB 3R5JB 1V1CA 4HT8A 2ZFHA 3SBMA 1S5ZA 1Q81R 1KS2A 5HROA 4B3MJ 2ILYA 4RL1A 3CXCP 3AA8A 1SHGA 1GX5A 4ZN3A 1SRMA 3JQMA 3TQEA 3M1VA 3QZ8A 3VF0B 2ZH5A 1NSAA 1YIJS 1K0TA 2W2PP 1SPKA 2E5HA 2KT8A 2VDIA 2OTJT 2M0YA 2V0NA 1H641 3M2VB 1JB0C 1UVMA 1KN6A 1KHWA 3QSIA 4PNOA 3LP0B 2VC8A 2QEXQ 2JDJA 3NXZA 2COZA 4JS4A 5CQGA 1FX2A 3WVEB 4FL6A 4B9SA 5HMWA 1WHGA 2BA9A 3C6TB 4IH6A 1NEEA 4XTVA 2KFNA 1FNXH 1OQ3A 5K8PA 4ENOA 2BYCA 2EFVA 4JV5F 3CCMT 3SFGA 2FZCB 3X1LB 1SC3B 2QK0A 3WBZA 1JQQA 2C3MA 5KT5A 2CZ0B 2VXFA 4PJOF 2KG0A 1PILA 3TA2A 4CLZA 2H54B 1MG7A 1T03B 4NYPA 4M77F 3OFGA 2IMOA 1IWAA 2PI5A 4LSZB 2CP5A 4X9CA 4KO0A 2JNJA 4O0NA 1UPMB 3OBYA 1VQ9Q 2NYHA 4C11B 1QWFA 4ANCA 2GMLA 4DS5A 1NDPA 2Y0BB 4HEA9 5F0UA 1EZZB 4QWDA 2BIVA 1FMVA 1RACB 2V1RA 3QG1A 1NLOC 4NZ7A 3O5ZA 2EPIA 2YH1A 1IKYA 3D3CJ 3W1YC 3UA7A 4PPZA 4BY6B 3GSDA 4B3SJ 2J9EA 1UTAA 5KG6A 5K8MA 5J1PA 3TZWA 4EWTA 2RH3A 1R8AA 4HCKA 1RUWA 1WXBA 1UGQB 2B5JA 1YJNA 5GADI 3HHKA 3G71T 4ZJLA 1Q82T 4A4GA 4F36A 4IQMA 1H8KA 4IDKB 3DRXA 5G0RA 3KJFB 2XQCA 2ROLA 2ZPGB 2BZ2A 4M5KA 1N34F 5DS7A 5EWEA 2QA4Q 4JUZA 3A5ZB 4RTXA 4U7UD 1O8BA 1TL4A 2FEIA 3UFCX 1Q8KA 2WHOA 1UGVA 3QZ7A 2YVSA 5IHKA 3VVTA 2CUDA 3THTA 2DTIA 4JV0A 5GAN8 1JLEA 4CLSA 2E7VA 1BQNB 4M95A 3EGVA 4MTPA 4ILRA 3SQOP 4IKFA 2CADA 4LF5J 1GMUA 4QQ6A 4XK8C 2HMIA 2ZH8A 2MWPA 2KKHA 5GMKa 2MB0B 2XTJP 3GV5B 1JXVA 5LJ5e 4C3MA 3VAGA 1NH8A 4DBRA 5B0BA 3EPGA 4QW9A 5CZVA 2JTEA 3DKMA 1NAQA 1TS9A 1Y0MA 2K57A 3HHLB 2YT6A 4LBIA 1FXLA 2XY6A 3BEGB 4CC3A 4DV0F 1IM6A 4W90B 4FYYB 2MPUA 2XMMA 1HNXF 3NS5A 3JCMh 4WKYA 2HG4A 1RABB 1XJWB 5GAOl 5HVGA 1S6PB 1OEBA 1RLCL 1RI9A 2KT1A 4EMGA 3VJPA 3CDWA 3QXEB 4ZGDB 4OI4A 3BBFA 3KUFA 3EGWB 1GTHA 2DK2A 3BKUA 3N6LA 3GYGA 2JM9A 4C8QF 1Q82C 2OO4A 1QVPA 1OX8A 1LNXA 3V6HA 2DNHA 4MYUA 3AT1B 3CC2S 1T9WA 4ANEA 1YBUA 1SKWA 2RQWA 4USMA 4KRTA 1D3WA 3PIPA 4KRWA 2QQBA 4N77A 2SXLA 3RB6A 1UWAA 2O3DA 1YKWA 2JZ2A 1RT6B 2J7UA 2MLZA 3DDIA 4LMZA 4ALZA 1R0AB 4J37A 2GQCA 1E6YB 1BBZA 1OYDA 1DQAA 2B9XA 4EMKA 1VQ7Q 2HGNA 2OI2A 3T9ZA 3ETOA 2ACYA 1BGXT 3QWXX 2ZAEA 1IJFB 2L0AA 3JCMd 1RTDA 1VQ8S 1V5VA 3SCLE 2BV3A 1VQ6S 2MYFA 5AXMA 1MNEA 4JI2J 4RW6A 1TFYA 1W6XA 1S1XB 3MAAB 4NLQA 4I2PB 3BGLA 2XS5A 3OHAA 5A2QY 2D8JA 4HCBA 2CP2A 3IR5B 3KLIB 1N5TA 4LF4F 2CQIA 2RRNA 4DR1F 4DU7A 1U0HA 1YCYA 3O44A 3D54A 4K4YA 4DQPA 2DD8S 1VHIA 2RK2A 2VC1A 3AAWB 2HNIA 2Y4YA 1VGYA 4FF3A 2FJXA 2HGLA 2EG2A 3V81A 3TZZA 3GWCA 1NK7A 1JLAA 2L9WA 2EXUA 4U67Q 2NPFA 3M6WA 1OMSA 1NBEB 2AQ4A 4ZP6A 4IFYB 4M1KA 1IM4A 3ISZA 1QUPA 3L2WA 2CPZA 1S0VA 1RWWB 1S1NA 4KV8B 3FDSA 2V8DA 4O3QA 4NXNF 2R7QA 1KQSS 1R8CA 4OL8A 4B3OA 3U02A 3CCMS 2Z2YB 3MMBB 5F8IA 4ATNA 3VV2B 4WTYA 3MECA 4PUOA 1D3BB 4FF1A 5IC6B 2ED0A 2EKOA 1YHQS 2W4PA 1VLYA 3QIIA 3LX7A 4WP3A 2UUCJ 2ZCFB 1W7WA 3RKWA 2KFZA 4CNZA 2DIGA 4RBTA 2J5AA 3R7SB 1XR5A 2Z2LA 2RKIB 2J0XA 4K8RA 2PVOB 3IWXA 1NSQA 3G4SS 4CC7A 2P0KA 2OEJA 2L2PA 5HY6A 3KK3B 2MKJA 4L72B 3OPKA 1DTQA 2YUNA 2IDEA 2NPIA 2ECZA 2CJQA 5KYWB 4LF9J 1URNA 2UXCJ 9RUBA 4HVZA 1HI1A 1RA7A 4K11A 3O3LA 1KVIA 1WOOA 2OFGX 4NL2A 2LCWA 1IKWB 1NM2A 3DYAA 3FMWA 2QO3A 2GQIA 4MH8A 3PY8A 3VYGA 3S8SA 1SQFA 3WC0A 1MNDA 4OMFB 5GAGU 2OI3A 2V63A 3RBBB 3I0SA 1UHCA 3E9FA 5L9XA 1IXDA 3VUZA 4U95A 1Z2ZA 2D0NA 4IR9A 2QEXA 2M16A 1U1TA 1SH2A 2KMTA 2BANA 3JB9k 4U7UK 4ZP7A 2R7OA 1N8RC 3MM9B 3B78A 4ZCMA 3Q2TC 4Y2CA 2FHKA 3H0FA 1WKKA 1TL7A 1TXQA 3F44A 2C0OA 3I5RA 2ZH1A 2EC2A 5KT7A 2XKOC 3H0PA 2JVRA 3FCHA 4HKEA 1YZ6A 3KMSA 4KAIA 1GQEA 2FGOA 2ASLA 1OI1A 1OULA 3AA9A 1RT1B 3I6PA 3M0SA 1FKOA 3UDVA 1U2RA 2LQBA 2J6TA 2CQ3A 1R43A 1OSDA 1Q5YA 5DY9A 4ERDA 3FRZA 2FUG9 1VC5A 1T03A 2CPJA 2V8IA 3CVKA 2BOAA 5A2QU 4AFFA 1CJTA 2LNVA 1KOHA 1D1CA 3L2RA 4PJOE 1VQ6T 2AK5A 3HJFA 3N5FA 4I64A 1T0HA 3CC2A 3TREA 2K3KA 5GJVB 5KFAA 8AT1B 4IO9Q 2AZ3A 1X6OA 1G8XA 2RJZA 2HQIA 3TUPA 3MEDB 2PT0A 2HFUA 4W92B 4HVUA 1XERA 3CCJS 5K20B 3C3LA 1S97A 3H40A 5KFYA 2W2NP 2FHDA 1LJOA 4JRKA 5FLXU 3M4GA 3QSUA 5A0YA 1IJEB 3M8QB 5KFBA 1OIAA 1WC3A 2HBZB 4F26A 3DNCA 3EFOA 1BHNA 3NL0A 3DRRB 4TU7A 1J5OA 4R5PB 1WC0A 1EQMA 2EFNA 4YR2A 4IUPA 1F2GA 3G4SQ 4OX8A 4LSLA 1Q86R 3IM8A 3I5SA 3HI9A 2FZKB 4CYUA 4X62J 3LP1A 4MMKA 3UWTA 1W4SA 2DD4A 3CC4T 3OTOF 1S1WB 2YX1A 1H98A 2CA9A 2RJDA 4AFUC 5DQGA 1MGQA 1X4GA 4ZA1A 3KUEA 2PA8D 1JLFB 2J6SA 2JX2A 2W1BA 2FJBB 4MK9A 5AE2A 3TSZA 3UDEA 3HULA 5KFOA 3EGXA 3NEKA 5L8RE 3RW7A 2DGTA 5HLFB 2VFVA 4LSLB 2OPRB 4DPWA 1M0SA 4CLLA 3DOLA 3VUBA 3IAS9 3ZZTA 2XYHB 1ITPA 1LOJA 2H4WB 4YMEA 1QCFA 1Y11A 2QFJA 3MEGA 3T5JA 5CHCB 1T9UA 4ES3A 1RWOB 2IVMA 2UXBF 3GFYA 4TLRA 3NGDA 1JJ2S 1D1BA 1SJ1A 1GX6A 2AYEA 2QGFB 2XIDA 3MFHA 4LREA 5CK9A 5K14A 4IOCQ 4C8LA 1UVJA 5GAEI 4UOFA 3VGTA 4OMLA 1H2TZ 2W4CA 3R27A 5L1IA 4DL5A 1REVA 3JAME 2JLGA 4WK1A 3PFOA 4UUWA 2DR5A 3CW2C 3GONA 3MFIA 4XO0A 5A8WA 2RQ4A 2HQGA 1NLPC 1VQ7T 5K5MA 2QLBB 3QSYB 1K9MC 4B6MA 1X0FA 3GB0A 2RPNA 1ZSZB 3LGHA 1SJQA 2CQ1A 2AX1A 3C16A 2BQUA 2AJ1A 1FRXA 3W8GA 3GIKA 3NGTA 5JJBA 1Q0NA 4HVVA 4X4NA 4DSIA 4QYZK 4WZQA 2Q6CA 4UF4A 4X66F 1WG4A 4ETZA 1JLGB 1YWOA 3ENQA 3J7YU 5AT1B 1V9OA 2J0SD 2GGPA 2KZMA 4FT4A 4JS5A 1IKVB 4O3OA 1S12A 2FJAB 2FLPA 1UAWA 4X4RA 1RTZA 3N6MA 4M78D 3M55A 4C8QG 1UB4A 1EKRA 2ESWA 4BWJA 3DOKA 4TLQA 4B3RF 3OFFA 2BXJA 5ETLA 1WYXA 3I0SB 3D5MA 4O3RA 3MEKA 1TELA 1RQ0A 2NLWA 3PYFA 3F73A 5KG7A 3DGVA 3V4MA 5IAYA 3DLJA 3LANA 2RS2A 2HCKA 3BV8A 4NLPA 2DRDA 5HP1A 4XIUA 5IQ6A 2HHUA 2H9ZA 4ZGJB 3GG1A 1FFSB 3EFRA 5JVHQ 4DOZA 5KH6A 1DTQB 1G83A 4K5SA 4EZ6A 1K9MT 4RTYA 1TAQA 3LQVA 1HWLA 4C8NA 3QT8A 4ZKAA 2E5LJ 1RKIA 3RRKA 4DV1J 4ELUA 3M8RA 4V19J 2FB0A 3OHBA 2O01C 2OPQA 2C3YA 1CQMA 3T1AA 2FPEA 2AZSA 3DU5A 3DMJB 1VQMS 2UVVA 2FPHX 3RBDA 2GFAA 1RDRA 4LDUA 5B0DA 1UECA 1H74A 4OZJA 4M77B 2G9OA 5AE1A 4M75C 2P84A 5KFDA 2CT3A 4Q43A 4OYOA 2B9YA 1M3CA 3OFEA 3GMGA 1YJNT 2HBPA 4EYHB 2EKNA 4XU2A 4ID5A 5KYUB 1VK3A 2LMIA 2FRWA 4CIOA 2NZ4A 1IUJA 2XHWA 4ZVHA 3H59A 2W8LA 4II1A 3K0JA 1U1MA 4J9CA 5J2QA 2C2RA 4GMKA 2OHDA 1M5SA 2O9SA 2RD5C 5J1EB 4ECXA 5HSPA 2KXNB 5EX0A 4L3KA 2NR0A 1WDTA 1H3HA 3KLIA 5T7LB 3V8LA 4GO5X 2IIMA 2HWTA 5J1NA 3D1QA 1S1XA 3MAAA 3BGFA 1B7FA 1SL2A 4Y0FA 3OV7A 4OF1A 3HP6A 1YJ9S 1RTDB 2XULA 2CWKA 4C8QA 2F8MA 5KFFA 2DHXA 3NOGA 1U2CA 3IWNC 3PE0A 4USHA 2LECA 2EW3A 4QWBA 2JUFA 4WP9A 3NRBA 4YB5A 2H3JA 2AX0A 2YKMA 2XG8D 4ZOSA 3D67A 4DSEA 2LFVA 4M7AD 2NUPB 3IFEA 3SMZA 3OVSA 1YJ7A 3MP1A 1ZM3A 1NU4A 3CDAA 1HHTP 1SC4B 5HJXA 1TL1B 1YG0A 4ZTFA 3W5YA 4M5GA 2QIFA 4IG0B 3MAQA 2KI7A 4WFZA 1UJ6A 2ZEJA 4OMMA 3I5CA 2B8PA 3TJAA 3NP5A 1ZUUA 2JTMA 2A6MA 4DSKA 2CPDA 3UDLA 4DV3J 2F69A 2GIQA 3I9ZA 1LWEB 3SWNC 2WSFC 5T14A 3DLGA 3V6DB 5AJ3F 4OYPA 2BMBA 4P72A 1I4K1 1U25A 2VHGA 1AUDA 4ZIVA 2A37A 1EQ0A 2FHOB 3NAIA 2W24A 2EQJA 3BYRA 4BB7A 2FJDB 3HVTA 2CPHA 5A0LA 3IR6B 2DNGA 4LRDA 3UD4P 2CIMA 3QLHA 4RNOA 5J2PB 1HIYA 1UUEA 4QZVB 1TQLA 5HVHA 3TQ1A 4J9LA 5D3GA 1HBNB 2KFYA 3QJLA 3DM2A 1RE1B 1JLEB 2K3IA 2FHJA 2EYZA 4DEXA 4M94A 2RNEA 1UWBA 2G2OA 5L9NA 1JRIA 1VQ8T 1B34A 2L3MA 3HT0A 2DY1A 1JJ4A 1T0TV 4A4KA 1FRLA 4MAKA 5G0RB 2HNZB 5I3UA 2FVSA 1PKTA 2UV8G 2MY8A 4RG8A 3D4JA 1N5QA 4LE9A 2P6TA 2YQ0A 4C8KA 3CC7Q 1T9YA 2YNIB 3M59A 3CMES 5KFEA 5HANA 3JB9F 2PEHA 4NXNJ 3I5BA 1IKVA 4U96A 4N5SA 1JJ2A 4O0IA 1Y7XA 2KXDA 1P1TA 4PYDA 4P75A 3QDRB 3JCMW 5GAHU 5B0EA 4ICLB 4DFJA 2KYZA 1S1UB 3B54A 3OYDA 1HPZA 2AP6A 3ZXWA 4FVCA 1C0MA 1VHFA 3FLGA 5CCLA 5FD1A 3LH0A 3DM2B 2RF2B 5IXBA 2RB7A 3CJ4A 1X5SA 4ZPTR 3HZEA 1C6VX 3D1HA 2MGZB 3FKBA 2V8PA 5FU7B 4HT9A 3B82A 3FBCA 4P10A 2ZDPA 1W1FA 1NO8A 1U6BA 4AL5A 5IT9E 4HYKA 1UVKA 3W3SA 1Q86C 2HPUA 1PJ5A 3NNCA 1N9RA 3NS7B 3PO4A 3RBZA 4I69A 4M78B 2AJ0A 2HRUA 1HSQA 4UZBA 1VCTA 1SRLA 1U49A 3CB4A 3EDQB 2XDPA 1FRMA 3E8OA 3UCUP 4AMCA 3QRRA 3VRYA 1U6FA 4IYQA 3FGVA 3CBPA 3MDFA 2BE2B 4IOBA 5KFSA 1VRTA 3NCPA 4FXDA 2ZVSA 3PEHA 2HHSA 3H2UB 1SF9A 2COLA 1PSFA 4IG3B 4KE5A 5L1JA 1FFWB 2R8HA 2FPDA 3EPIA 1VQYA 5CCAA 2DBBA 2AIRB 4ZITA 3A3OB 4LFAF 3MM8B 3Q8PB 3QBYA 1IBKJ 3M57A 2DETA 2QDYB 3PO5A 4IFVA 2YNHA 4MZMA 1TK0A 4EIKA 1RKJA 3CCJT 3PTAA 2DPIA 3VRZA 4NEYA 5J2MB 2CQ0A 3W65A 5ETMA 2QASA 5HO4A 3J7AF 3AD8C 2E44A 5F9NA 5CAIA 2VJUA 3Q8UA 2KI2A 3M9MB 2RS8A 4RKUC 1SKRA 1VA7A 2DYAA 1T9VA 3CCRT 4G1QB 1EHWA 1X27A 3G87A 2YWWA 2RQRA 2D3ZA 3EGNA 1SIZA 1VLOA 1SKSA 1KIKA 3ZTQA 1B3TA 2PFFB 1VC0A 1RT7A 1EKSA 2RA2A 1FFGB 3DLEA 4M5IA 2EW9A 4ED4A 3EG9B 4JI0F 3JSCA 1UCNA 1WHHA 2QN6B 3PJ9A 3TUIC 1GTEA 4PXBA 2E4HA 2J6KA 3GIRA 4BBYA 4JJDA 1PG5B 4PG7A 5KFIA 4M7AG 1FX7A 3M5AA 4WPAA 4ED6A 2VC0A 5LMNF 2G6FX 5GANg 3LF0A 1Y96A 3AB4B 4OHYA 3CCTA 3DDNA 4DN9A 2HL5C 2MQPA 4DQIA 2R7TA 1F9FA 4CO4A 3CJRA 1YCSB 1S9EA 4LVNP 1OQ6A 4GKJF 1PWTA 3REBB 4ITSA 1GMVA 1XQHA 3V7RA 3E01B 4R0KA 2LCSA 5CXTA 2FYXA 1B70B 3W2WB 2RF0A 2CRLA 3RR6A 3SEOA 2R5MA 1D8YA 2YLCA 5IFMA 5HBMB 5KFXA 2OMLA 3FEXB 2C0TA 3CCEQ 3GFHA 4DPOA 2HHHJ 4M5DB 4LF5F 3DDKA 3B4DA 3K17A 3J7A1 3OUYA 4F4AA 4G1IA 4D6WA 4NL3A 5CYMB 5FJ4A 4F3QA 3W9HA 4X9DA 5CH7B 1SHFA 1IBMF 4IUVA 5HMXA 1B0VA 1S0MA 4GO7X 3OS2A 4PQUA 4OYWA 1WEZA 2CNLB 2O01E 2C2OB 2G2YA 1N0VC 4CLUA 3B8HA 1X5PA 3IM9A 3KWMA 3OYAA 1S9GB 2MIOA 5HP1B 4A8SA 2DKOB 3P3DA 4QBUA 3K8VA 4CLWA 4ZJQA 1Z2LA 3Q24A 4UUXA 1AOJA 2B4OA 2GGRA 2I1RA 4J9FA 1RGVA 4U7CA 2V4QA 3J7Z5 2WB4A 2C2ZB 5IT0A 4A4HA 4D8DA 3HVWA 2CDQA 5IZHA 3RGIA 4B3TF 4K0KF 2B7BB 3D28A 2JFDA 1L3TA 2MK5A 1HD1A 2DXBA 1WLPB 3FJ5A 2VBZA 3OQ2A 5THWA 3OQ5A 5CD4A 3CJKB 2B7CB 2KSSA 3JTOA 2D7SA 1ZM9A 4P5NA 2POKA 4DR1J 1YK9A 3LOUA 3PTWA 2XCAA 2H4YB 4QR2A 3EGZA 1O51A 4PKCC 4M5DA 1OPZA 4YDXA 1VQPQ 4X84A 4I0WA 4ELTA 1IBLJ 4H4MA 3MD1A 5CQYA 4K4SA 5I2SA 1F5BA 3M8WA 2MQLA 5IWAJ 1D8ZA 3JTPA 2AEFA 1BIBA 2LEBA 5KG1A 2OAWA 3FFIA 3J81Y 3C46A 1JMTA 2CPYA 1RZMA 3BSAA 3PX6A 2SEMA 2V8JA 2HHQA 2MKKA 2I2YA 3Q8YA 1YJWS 5GVQA 1WWHA 4J5YA 1FTCA 2YRCA 3NGUA 1Y0HA 1YVFA 1I81A 3A3PB 2PEBA 5GMKm 4WYWA 1VR6A 1DHMA 1Y96B 1DQ9A 3AQPA 4QIEA 2BJ9A 2MQQA 4WFAQ 1M90R 3TP2A 2RILA 4Y2MA 1VQOS 2RIJA 4BC9A 1SPBP 4QPXA 5GANh 1PD0A 1R7IA 3VV0A 5CR2A 3HSGA 2XI9A 3ZFVA 2LLZA 5F0WA 4YB7A 1VQMQ 1TG0A 4BY6C 1RT7B 4DG1A 3HP9A 1FRJA 1K73T 1WA7A 3MM6B 3ELHA 2DGVA 3DRSB 4DR2F 2JOQA 4LF8J 4DXLA 4LBHA 1EIFA 2UUCF 4RW9B 3SQGB 2ZJQQ 2UV8A 1YN8A 2O67A 1NEBA 2RRAA 4XPCA 1CEZA 4Y00A 3OTBA 2F9DA 3OXGA 2AJFE 1RU1A 3HD1A 3EG2A 1K0VA 2N3LA 4AFZC 2XDBA 3CXCS 1RWNB 5IM0A 4WKRA 3CPWP 1X4DA 4OX9F 1B07A 1CSJA 1QKWA 4USUA 1IO6A 5LJ3e 4DEYA 2HQHA 5EGYA 1UVNA 2BZXA 5BR8J 1B64A 3SWNB 4LFBJ 1C0UB 4CTAB 2R57A 5KFVA 5KFZA 5BYSA 1Z9ZA 2XMVA 4K50A 2RO0A 1OPKA 3PGGA 1NH7A 4UQGA 2P4RA 1H0HB 5DDRC 2ZH7A 3BDEA 2CQDA 1VRTB 3LGNA 2ZOGA 3GCXP 2DZ9A 2HQEA 2A3LA 2KZZA 4RTVA 2K7AA 2ZHOA 2E6ZA 4PL6A 1QWEA 5ETTA 4QW8A 1JWWA 3UCZP 3LWMA 4WE1A 3QIPB 3CJTA 4BE0A 3HCXA 3V5RA 1H72C 4I7FA 3MM7A 1BYMA 4G3IA 4KHPJ 1YJWT 1HBMA 3BFMA 4PLLA 4NASA 2IM3A 2CJ9A 1AHJB 2RT3A 1IKXB 4FF2A 2Y1RI 1PGZA 1EP4B 2BJ8A 1I0CA 2VQEJ 3R5GA 3PIOA 3L7OA 2DO3A 2IRYA 5A8KA 1RAAB 4J83A 3C4SA 2UVWA 5EX3A 2LDIA 1Y4ZB 2JRSA 3PFEA 2CQPA 2A2CA 1R3NA 4BS2A 2VG5B 3JSBA 2D0QB 2GQVA 1HKAA 1WZOA 4ECSA 1QDUB 5KFLA 3CCUT 2K2PA 2OPSB 4DV4F 2DHGA 1M5VC 5B09A 3RYLA 1JK9B 1M8VA 1T02A 1VIOA 4Z8AA 5C24A 3S3MA 2QC3A 3C15A 2GNKA 2NWMA 5CKDA 3RR7A 4WF9Q 2AYGA 4TY9A 2GW8A 4NI2B 5I11A 4LQ3A 3VYHB 4OYXA 4C0ZA 3KMQA 3GNGA 2B5JB 3NGKA 4P7TA 3CCQS 3M2UB 4QQGA 5C25B 2J9CA 4KUIA 2DY9A 4LR8A 3KHGA 2E1CA 5GMKh 5GMKe 3BO2A 1FEHA 4ER8A 3MEEB 3SZ2A 1RK8A 3N9UC 3V8KA 3M8PB 3LO3A 2E1HA 3BDLA 1VQOQ 5LL6S 5I42A 3PJWA 2IMWP 1VQNA 2O4XB 4ANDA 1B7TA 3EMTA 2E1MC 4OHWA 1D1AA 5D3GB 3GSIA 4FF4A 5GAN3 3FUYA 1RHMB 2LXFA 1WORA 4LF2A 1N6QA 3QO9B 5CABA 3BR8A 1XMBA 1N56A 2E9TA 2F63A 5IV4A 1KR4A 3PJXA 1FXRA 1M5KC 1VQ4Q 5L38A 4ZNXA 3EX7B 1AWXA 4J9VA 1BC6A 3ENVA 1SQGA 2QQRA 2OTLS 1DLOA 4DV3F 3VVUA 3CC4A 4F25A 2DGXA 2F4FA 2J7IA 2Y4XA 4G65A 3DI6A 3DXBA 3M2VA 4NCBA 3QAUA 1QVFR 3MMBA 1X01A 3JSYA 2DK3A 3N5BA 3ICLA 4J7FA 1YJWA 5ETKA 1SQEA 1WJRA 3MCOA 4ZPAA 1V29B 4RUGA 4L74A 4O44A 3ASKA 2D3O1 2HBQB 4ECWA 3UA6A 3L9ZA 1XIQA 2R8JA 3CQTA 3CCVA 1YI2A 1QE1A 2XB2D 1DAXA 2QYCA 1KQSR 5KFTA 3BJYA 5CVIA 3CCVS 2PU9B 4X2BA 3DRPB 2VG6A 4B9WA 3QAEA 3SIPB 1F60B 1F3FA 2XNQA 5AXKA 3OYYA 3CCMA 2FVQA 4DF8A 3JS9A 1UL3A 1YIJQ 2GVZB 2P9EA 5CYQB 3CCLQ 2ABLA 1AA1B 1VQPA 3MI7X 1FK9A 3OBIA 3QFHA 1UA0A 3RB0A 4HR2A 4DQ2A 4RW7A 1IBCB 1T3LA 1TU0B 1AVZC 5KG5A 2YQ1A 3FBEA 1OU8A 3OR2A 1CJVA 1RWPB 2WK4A 1IQTA 3DLLA 1YITA 4IH7A 2A28A 1VC6A 1RP5A 1M1GA 2E41A 5LMUF 1BB9A 2DVIA 3ZC4A 1IRXA 1KWMA 2I0NA 2DR9A 2EI5A 2ZUAA 1GCQC 5E33A 1NK0A 1Q4RA 1V3RA 2BW7A 3I87A 1F1BB 3BM7A 1DLOB 4M5MA 3O2IA 3LPYA 3KLGA 3PV8A 3B4MA 1WIEA 1KQSP 4HKQA 3D0HE 4KGMA 2R4FA 3CD6Q 3OR1B 2DF6A 3HFZB 5GAMf 2VGNA 4UQTA 2M7SA 4RR5A 2B4VA 4C2MA 1KQGB 2BJEA 5B7WA 3DRPA 3JRZA 3QO9A 5LJ5h 2KRBA 4OZ2A 4WWSA 4DV5F 1R6VA 1YLXA 1VIXA 3PVXA 1CULA 4DOVA 4IIOA 4NYZA 3BSOA 2CZ4A 2Z58B 3TA0A 1RT2A 2WBRA 3PYGA 3DMJA 1FVQA 1RHJB 1D1UA 1NDKA 2RHUA 2ZZNA 1ZZNA 3SHWA 2VPWB 1Y5NB 3TUJC 2MI6A 4PJOG 5E7OB 1RBAA 3F70A 4DR5F 3PHEA 3L09A 3OMCA 4FZVA 4NL5A 1S77D 2KK4A 3M2UA 2KROA 4EGLA 2MQOA 2DM1A 3CULA 1HXDA 4Q44A 4FU6A 3FMBA 2ROTA 2LKZA 1NKEA 3EZ5A 3ISND 2KEAA 3FVYA 4IUTA 3EZOA 2W9BB 1T05A 2UXDJ 3HKZD 2VPZB 3D3BJ 5GAOm 4CRJA 3VZIA 2VOPA 2EYWA 3CCLT 4F7UE 3FSYA 4NYOA 3CD7A 4OV1A 4OLPA 2XI2A 1HQEB 1S49A 4N0AC 3OSNA 2EWHA 2Y1LB 2DA9A 4WK3A 4FDFA 2YY3A 2OP5A 4HA8A 2IYIA 2WW8A 1BI1A 3OYBA 1RT3B 5IT4A 4JRQA 4N47A 4WFYA 4X4TA 1PJ6A 4ZLNA 4H4KC 1UMJA 1NZ8A 2RQMA 2OTJQ 3M9QA 2QLJB 1EP4A 3H2LA 2L08A 5HQ8A 3H2VE 2LA4A 2Y1IA 1LQ9A 5EWFA 1IKYB 1I8FA 1X69A 1RA6A 2ABYA 1G3WA 2E64A 3MM7B 3IGVA 4RBVA 3NAHA 2E7XA 1RTIA 1FJ7A 2GHPA 1U8RA 2DEQA 1JXOA 4RU9A 2EFOA 3URGA 3GP8A 1QQJA 2EBEA 4YQWA 2DRMA 1TK5A 2M52A 3C15B 1VJQA 4OYAA 1KSPA 2NUTB 2DXUA 3DLHA 3DU6A 4LFCF 4AT1B 2X7IA 5M2UA 2OPPA 2CDTA 1YI2T 1FMKA 4TVRA 5DLOA 1ZPWX 1A9NB 1S7HA 2DGSA 3N0VA 1BD6A 4CZCA 1YHQT 3M8SA 3SFUA 1ZTWA 4ORZA 1WX6A 1YBAA 3CD5A 4NA2A 5DZ6A 4F02A 3H8ZA 2PFDA 4XTYA 4I2QB 2R9LA 4RTUA 4M7AF 2DIUA 3OTEA 1WC1A 1VQKA 1VYTA 4X62F 2G1HA 1PRMC 4YR0A 1Q8BA 1DRZA 1TZ0A 3U23A 3UQSA 4EU0A 3X20B 2HHTA 1HJDA 1H38A 1NHUA 1RHQB 1VRUA 1P8GA 1BUXA 3EZUA 4WE1B 1XQIA 3H20A 1N8RT 2BKPA 1RWXB 3RERA 2XMUA 2IC3A 2R7RA 1PM3A 3MMAB 2HZAA 1KD1C 4CI0B 3BBCA 4KFBB 3CC7S 5HROB 2V26A 4FIBA 2IC3B 4HT5A 5HLFA 2XSFA 3EGXB 3U7JA 3GPAA 1H6KX 2HZCA 1RB0A 5CD4H 1ZETA 3NG8A 1HYOA 1VQ5S 3CCSA 2MYSA 3VALA 3I32A 1U3OA 1VQMT 4E7SA 3OS5A 3OSPA 2ZBPA 3BN7A 1T3OA 1TV6B 2FQQB 3JXOA 2OSRA 4LF4J 2K4YA 4QIFA 2MKIA 2C0IA 2A18A 2LX7A 3L2QA 4OGEA 1QVGS 2L41A 1NJIT 5KFUA 5IH2A 3NGRA 4YN3B 3T1HF 1YJNS 3LH5A 2HDAA 1LW0B 2IIHA 2K2MA 2UUBF 3CCST 2XMAA 3VGVA 1HMVB 1CQNA 4ILLA 1X75C 3CCJQ 4M7DB 4MIWA 4S0MA 4DPXA 1T8EA 3T1YF 2ZPBB 4HCZA 5HCKA 2OPPB 4M7DG 3LTOA 3EAEA 5HKCA 2MF2A 2M2BA 2MPXC 2JL9A 2RH2A 5CAAA 3CCVQ 1TVRA 3US5A 4C92F 1YI2Q 2JEJA 2OLWA 2RQKA 2HQDA 3NNAA 5RUBA 3KG1A 2AV5A 2QLXA 1FKPB 3MHYA 1FE4A 1VRUB 2ZC4A 2B86A 1FWKA 3OYKA 3T5LA 1G5VA 4I68A 4N4IA 5D78A 1KC8C 3HVAA 1QLNA 4DBQA 4R25A 4B3MF 2ZH3A 2FO0A 3CCMQ 2OFHX 2QL7B 1PC5A 1RAOA 4EYIB 4HH0A 3EGUA 5IQQA 1NJYA 4GBQA 2Q66A 1RAIB 4F2RA 4F3OA 4KR0B 1ABQA 2EQIA 1XR7A 1YP5A 2DHHA 2B9WA 1AB8A 3CMQA 4BDPA 3KK2B 2FVPA 1O0PA 4MDWA 2K06A 1LV5A 2GHVC 2BRKA 4MMLA 3PYDA 2GTOA 3E19A 3I55S 3H7HB 1RHRB 1ZM4A 4ZPDA 3TJ9A 4DZDA 5I2MA 2DT9A 2YKAA 1P9QC 2GVDB 3JCMg 5D4OA 3MJXA 4OV6A 2XGPA 3N6NA 2GVDA 1AFIA 4IUUA 3RMSA 4ZVTB 4M75A 1TL3A 4ZHRA 2NYSA 2FGCA 3BS9A 1EIYB 5D7UA 1H3DA 2RQCA 2YUOA 1GK8A 3OYCA 4AXJA 1G6BA 4TN2A 2HLUA 1N9SA 5CYMA 1TAUA 3KFWX 3OUYB 4ZMMA 2VL1A 4B3SF 1VBYA 2F3JA 1GBQA 3BH7B 2KHDA 3TOQA 3SDEB 3WDOA 1RTJB 2ADCA 1SJ4P 2HRYA 1NK6A 1S76D 3KDOA 1IHVA 3CCEA 2H8HA 1RTJA 4WFXA 5JUMA 1FXXA 4EBEA 1PJ7A 5F9LA 3GYNA 2P5VA 2C1EB 3ZTOA 3R7NB 1U1SA 3U1MA 1VQ5Q 5KYWA 2V8GA 2CGHA 4P71A 4DL2A 3E9GA 3OJSA 2OSQA 4JI4F 2WVEA 3GOXA 3CC7T 1QW1A 5FWBA 3GJRB 2MSSA 2CQ2A 4CDIA 3RBXA 4RTZA 3MEUA 5A0GA 4RX6A 1I1JA 1WJ9A 3GJTB 3ZEHA 2HHHF 2VH7A 4OZ1A 3MUMP 1X7VA 4KT0E 5D6WA 1S9EB 5K9FA 5FU7C 4DUYJ 1F9HA 1OWXA 3L7PA 3G82B 4J9QA 3P96A 2DNPA 1LWCA 2D9PA 4ZCKA 5KFQA 1NEGA 4DA4A 1NHKL 3MECB 5DG7A 2J8AA 2YUPA 3CCUQ 3M2RB 5GAOr 1S72A 3JCMP 3CIZA 1ZUKA 3JYTB 2HAFA 4M7DA 2J7KA 2KAFA 2VWFA 3EUNA 5J26A 2F1FA 3KK2A 3KNGA 2V9WA 4JLGA 4O5VA 3FEOA 4M5JA 2OTJS 2E9RX 4KH0B 4BI8B 4F2SA 3UNYA 3T9NA 2KE9A 3ILIA 1XR6A 2OTJA 1KJWA 1G2BA 4LF6J 3OL8A 3W61A 4Y28E 2UP1A 3PRBA 2CJXB 4GLKA 4RW4A 2HZYA 5CKHA 4O3SA 3I4PA 2DNNA 4ZVUB 2COYA 1M5OC 2MDAA 3TAMA 2A36A 4BCAA 4URGA 3M4YA 1LFPA 2X1FA 2QV6A 3K7RA 3VAKA 1KC8T 2C2EA 1JLBA 4M77C 2DNZA 1VQ5T 3G6VA 4ESRA 1Z4UA 2NXEA 2VJVA 4RTWA 1R8HA 3HPWA 2PSZA 3OXLA 2MZTA 3CMAA 3T1YJ 1VQKS 1ARKA 4OJ1A 4X66J 5LJ3j 3IQLA 2QSWA 5KFWA 1NK4A 2AGPA 4JYAJ 4J9OA 4USKA 2I6WA 4NZ6A 3CIMA 3AB2B 3W2VA 1IQZA 2AF6A 3VS0A 4J6YA 2AKLA 4EI2A 4NMXA 3CWJA 4PRFA 1NYFA 3MOJB 2FLLA 2W7OA 2LMJA 4OHVA 2KY9A 1LFWA 2HYIB 4V19X 3JCMV 2DR6A 2UUAJ 2AZVA 2N7YA 1B99A 2E7WA 1VYAA 4LQ9A 3TAPA 3MMCB 4ES2A 3I5AA 4UT4A 2LT4A 4MT1A 7FD1A 1UGSB 1AZSB 3IG1A 4KSEB 3ADAC 1MROB 1YRUA 3PCOB 3QJYA 1KHIA 1NRKA 3L1AA 1AW0A 2QYZA 2AD9A 2BM1A 2DXTA 3C0CA 1QP2A 2RUSA 3UCGA 1MMAA 3S6EA 2YWGA 4C3LA 2E65A 4FSXA 4I56A 1HPZB 1FERA 1B4SA 2GA7A 3UN5A 4UY85 1PHTA 1VDHA 4KHPF 3JB9G 3HHLA 1D0EA 1KSWA 2VYTA 2R42A 1QLYA 4N7TA 1TR0A 4RW8A 1ACMB 4F4YA 3AJDA 4ZVQB 4TY8B 2XLIA 2VZ9A 2X4WA 1Y71A 5LL6d 2B9EA 2DL3A 3CJ8A 3K58A 2YNIA 5KOXA 2M51A 1MWYA 1FDAA 2YNGA 5F8LA 2HHPA 2G0IA 4I2QA 4F04B 1N27A 1VOMA 1JLCA 3CT9A 3M6XA 4X1VA 4KHRA 1M8MA 1Y10A 4C0HA 1S6UA 2IJNA 3I9QA 3PEJA 3OYLA 5KYNA 1HQ2A 3C2PA 4PFOA 4A8WA 2FJVA 5DETA 1NK5A 3G6EA 2IA0A 2Y8YA 2C22A 4OI1A 5FU6B 3P6YC 1NXIA 3JCMc 2O4XA 3G4ST 1VQNT 4KT0C 1HBUA 4KBMB 1N5SA 1S1UA 4MZTA 3EG3A 1UEBA 2FHMA 2VGMA 1BCOA 4FVMA 4XTXA 2RHYA 4EDUA 2ZNYA 3DRYA 2CH4W 2CSIA 3W5ZA 3I56S 1K76A 2Y0SD 2HBRB 4NLRA 2GAGC 2KT2A 4HH1A 2EYYA 4E7ZA 2E1AA 4C92E 3FEZA 1FDBA 4OZ5A 2QA2A 2YLBA 2ZOMA 3ILJA 4Q2MA 3MD3A 4RPFA 3CE8A 3QIPA 1R31A 2G2ZA 4LFBF 3GP9A 4CT8A 2NUHA 3Q83A 4Y91A 4IUFA 4N76A 4OX6A 4N4HA 3OYNA 4DV1F 2QT7A 2VFTA 3W9IA 1QY7A 1CULB 3BQ0A 4DUZJ 2CFXA 4Y28C 3L4BC 2CPIA 2N7CA 2YKQA 3PVLA 2A7YA 1QVFA 1CBKA 2XS7A 3QDFA 1PAUB 5EDWA 4AXIA 1UWBB 2WSCE 4ZP9A 1FESA 4U6PA 4FW1A 4KY3A 3V6KA 3I0RB 4C98A 2V2QA 4J7IA 2W0ZA 3IWLA 2DTOA 2AHJB 1BQMA 4ZLLA 1AYEA 3R6LB 1NSKL 5LT5A 3CC7A 2XM3A 4ZP8A 1HNIA 1EETB 4TY8A 2KRSA 4PYAA 5LJ5j 4K4UA 1HK9A 1RCOB 1NZAA 3K59A 2MY7A 2E1PA 4PJMA 2JEGA 2VBWA 2C2DA 3AOBA 2RHIA 1CSKA 2OMOA 4ZK7M 1GXTA 5GMEA 4ETXA 3HFVA 2ZH4A 3KKFA 2XMFA 3KJQB 1I94F 4CO5A 1KHVA 1RT2B 2XEXA 1X4AA 3UW1A 4H54A 2DVEA 4C8QB 3BO3A 3G8TA 1YSJA 4X4PA 2CP7A 2DKGA 1LWEA 2EYXA 3KG0A 4R8UA 4FN5A 3UWNA 3NMAA 1HWKA 3ZTRA 2WONB 3J7YI 1TUCA 2CJKA 2GQ2A 3TEGA 1KNZA 5L1LA 3G6XA 2EQKA 1RAJA 3NBPA 2V50A 2J8SA 2HEKA 2RJFA 5J1EA 3PVQA 3MMCA 1N36F 3KTQA 1YJ9Q 2DGQA 3SWNA 2Z56B 1TL1A 2ZDOA 4RLEA 3D7SB 1GXLA 2HL3A 2IBOA 2L8DA 3C66A 2IYGA 2NXUA 2HFOA 2SRCA 1SC6A 1NYGA 3OYJA 4X4SA 2VASA 3A8KA 3OTCA 5IC4B 4NS5A 1TKDA 4PJOA 2WOMB 3S7RA 2RM4A 3TSWA 2FD2A 1CKBA 3M2RA 1ICEB 2C3UA 1K8AR 1ELOA 4F67A 1WSVA 4EUVA 3JQKA 4DFMA 2N4DA 1CJUB 1KDNA 5ETOA 1FK9B 2ZNZA 2CH4A 3FDRA 2HVDA 3MMJA 4UW2A 4XTWA 3MPVA 1O5JA 4NLSA 1H7XA 1UETA 1S6QA 4K5RA 1AZGB 4Q0BA 4NXMF 4ZN1A 4YFUA 3LUYA 2K3XA 3W64A 1K8AU 3R97A 4M4ZA 2VUGA 4F4ZA 3OYIA 2GMHA 1Y00A 4F7UF 3E2UA 1RWMB 3W9JA 2W9AA 2UUTA 5I42B 5E0OA 3A4TA 1WGSA 3NLCA 1VRQC 2BJ3A 5BXIA 2EBGA 4CNYA 4C8QD 8ATCB 4FPIA 2DL5A 4X64J 2FLOA 2VONA 4J6WA 4IRCA 5GANe 4DR6J 3KDNA 1WG1A 5E2QA 3GJSB 4RG2A 3QYHB 4CWBA 2VDHA 5C25A 3TR5A 1RYSA 2KYMA 3M4XA 4HTIA 4V1Ak 3UPFA 4JI0J 1UW4A 3BW1A 2AEJA 2B56A 3L2UA 1OPIA 3TUZC 3R6OA 1RBLA 2A08A 3IS9A 4PXDA 2FL7A 3IMQJ 1MSWD 2C2KB 1N4LA 3TW0A 1MLAA 3EJMA 3CJKA 3WHIA 2OPSA 1JLGA 4PG6A 4C97A 1UVLA 3VU3C 2RB6A 1CKAA 4F7VA 1X4HA 1PCAA 4N41A 3HTRA 2YKNB 3OL7A 3P8BB 2P6SA 2JMCA 2QLFB 2ZWPA 4J9DA 2DR8A 2FG0A 4UC4A 3M53A 3M8PA 3GBQA 1SJFA 3ZZYA 2NS1B 4R56A 3LGMA 3VTIA 3DN9A 1NLKL 4L6V3 1FD8A 2QGGA 2DL7A 4GVBA 4OHZA 5A8RB 1WNEA 4BHQA 4TU9A 4X65J 4PG4A 4DR3F 1W25A 4KYZA 2X1BA 1NZ9A 4PABA 1VMBA 2C2NA 3BBBA 4B17A 1FDNA 3G4SA 3H0HA 4N0AA 2YUQA 4Q5VA 1I51B 2DBKA 3M0PA 1DJ0A 4DR2J 3P5BP 1ZYQA 4LF7F 5LMNJ 2F2WA 5EG2A 3FEYB 2B51A 4CI0C 3QGHA 1VQPS 3S01A 3OSVA 2DL4A 5DG9A 3KHRA 1KOOA 3ZNJ1 4DV2F 1DURA 4ECZA 2V2ZA 1RBOB 3VAIA 1VUBA 3DLEB 3FRYA 4JI8F 2U2FA 3QWYA 4ECRA 5LJ5g 4CRIA 2RMOA 4LDVA 2WTFA 3R5DA 5A8KB 2X3XD 1RJJA 1JLFA 4G1PA 1BCMA 1X5TA 5DM6Q 3ZO7A 4LF1A 2NSBA 4DV4J 4C0OC 1WHXA 2JWNA 1F5AA 4DN0A 1JQGA 4Z7CA 1QCOA 3LAMA 3RAXA 1WI7A 3UATA 1WI6A 1VQ7S 3GV7B 1NK8A 3UF4A 3RKXA 1Q86U 3UT1A 4RW9A 3SQGA 1F6TA 3NCQA 2GIRA 3N4WA 3KNAA 3HHLC 4DCJB 2DBMA 1ZBJA 5K8NA 5HK3A 4M7AC 1X6BA 4Z37A 1WC4A 4QVZA 4Q8EA 2VIHA 4ED3A 1HMVA 5E3RA 3O5TB 4A63B 1WHKA 1XN9A 4HL9A 2MXYA 2J0QD 2P0QA 3AH6A 5DQHA 3JCMQ 3DOLB 2BW2A 3SV4A 2DRKA 3HHNB 1U5SA 2LDYA 1GNKA 2V4RA 2FB7A 2F9JA 1BLUA 3OL9A 2P2CB 3TVTA 1WTFA 1FJGF 2NREA 4DLGA 4YHHJ 2Z57B 3M7VA 1JJ2P 4DPYA 1HHSA 4PJNA 4B9VA 1RXOB 3P4UB 1FT8A 5KFKA 3BKTA 3CD6T 2ZH6A 1UTIA 1AZEA 1TUGB 1KBRA 4F17A 2OTLQ 3FQKA 3LP1B 3OW2P 4BD3A 1JNRB 3LLRA 5C6SA 1V3SA 1I3OB 4RMOA 2I2LA 1YJUA 5KFJA 1S4FA 2RF2A 2EYQA 3A8EA 4MKVA 1X4EA 2AMCB 2F5TX 5GAOq 2BR0A 2HQ3A 2KM8B 2VICA 3T41A 4OGCA 1GCQA 3OS1A 2X9HA 4DL3A 2AT1B 2MQNA 4ICLA 4KKOB 3PIPQ 2R58A 4NXMJ 2ERRA 4DQQA 1QVGP 2GQQA 1S48A 3CPWA 2H1YA 2IRUA 2ZGWA 3UD3P 1M1FA 4J7CA 3RB3A 3HL8A 1D09B 2EBPA 2JM8A 1C0TB 2K5IA 1NK9A 3QGGA 1VQ7A 2F1LA 1SJRA 4M63A 2CQHA 3M8ZA 3CCWA 1VQOT 1VQ6Q 2EVRA 4C8QE 4XTZA 1YFNA 3MXHP 3P8DA 5D4PA 1FHTA 1FMWA 2IM1A 2N4CA 1M30A 4USJC 3L3CA 1E6HA 2ZWOA 3IC1A 4I6WA 5E3CA 4JV1A 3FC9A 2V1QA 3JB9D 5EHHA 4WF2A 2QJ3A 5ETSA 1TSFA 1VIFA 1E7OA 4FYXB 4JI1F 4WFNQ 2BBEA 3MR6A 1S10A 4DR3J 1IXKA 3TU4K 1WF1A 3GR0A 1KD1T 2MMPA 2DNKA 1VYUA 2RI5A 3A98A 4ZPWR 3TA1A 4FM4B 4DL6A 4LF9F 3RTVA 3R5AA 3HVTB 2ZHBA 2DEIA 2E5QA 2VXEA 2KXFA 3OB9A 1EFNA 1D3BA 3MWBA 4NX9A 2FIUA 2DIVA 2WAQD 3DKDA 4LN2A 1BXNA 1S0OA 2CVIA 5KT2A 5GAMj 2ALYB 2VU5A 1X43A 2L48A 1JB0E 1WTBA 1IKWA 5A0DA 2XSJB 2PNIA 4ZVRB 3PDNA 3MCNA 4FNIA 1KC8U 3O8WA 1T3SA 4Z7YA 2DB1A 3AQOA 2X3DA 3Q8QB 2ZC3A 5J3BA 3RB4A 1T95A 3HD2A 4LF6F 2NXCA 2QQ9A 1HNVA 4FP9A 4V2SA 2N82B 4LRAA 2BQRA 3EXCX 2VG7A 3D1OA 1GFWB 2F4VF 1GFDA 3K5NA 3EGDB 1M1KU 3W8PA 3X28B 1R8OB 3EG9A 3W5XA 4C8YA 1YGYA 1QD1A 1VQOA 3HMJG 4AFQC 1TUWA 1FXDA 3TVYA 1LCKA 1VQNQ 3CMEQ 3KYLA 1L3VA 3J80E 4YOEA 1YIJT 1G4CA 4M7AA 1KONA 1UJ5A 4OZNA 2CNOB 5KT3A 4JV5J 5DGAA 3WXMB 5IXUA 4F8RA 1R6YA 4OYMA 3E51A 1YTYA 4NLOA 1KTVA 1MWQA 3JSMA 2DR7A 1D9AA 3L42A 5DQIA 1MMGA 4C0DB 4DSJA 4IFYA 3SYZA 6FD1A 1WEXA 4I67A 1KKHA 2L89A 3OR1A 2ZHAA 3GIJA 2YNHB 3A8LB 2J05A 3GU0A 4IFVB 4M78C 2JJ9A 3OVAA 3AXKA 1PD1A 1OSCA 2HVHA 1MN9A 2V67A 5LXYA 4PXEA 2WCXA 3MEWA 4DQSA 5KYUA 1NUEA 3EHRA 3D0IE 2UVRA 1QVFP 2PA3A 2OIHA 2W7PA 1M1KC 1Y9OA 2Y8WA 3S3OA 4ATOA 3EHQA 1XNQJ 4ES1A 3ZZUA 5CYJA 4O4GA 3FBFA 1FNMA 4M77A 2HQFA 1G3SA 1KFSA 4C92D 3KUHA 1RYRA 4OI6A 2JNGA 3ZFJA 5F8JA 2CG8A 3MCAB 4Y92A 4LUBA 2MOXA 3OLBA 3KHHA 1O6XA 2CDRB 1OX9A 3TCJA 1LEOA 2BE9B 2DNRA 2KT5A 5D4NA 1CVJA 3TJ8A 5C42B 4E6RA 4ILMA 5J2QB 2EGEA 2GCXA 4ELVA 2X1AA 4MK8A 2QMUB 3H6ZA 2QA1A 2BEFA 2E12A 5KFNA 1B7YB 1BQNA 2WVDA 1NDLA 3JSRA 3DLLQ 5SZTA 4O44B 3I0RA 3GIBA 4PAAA 4M5HA 1VQLA 4K7QA 3CO9A 2C3OA 2ATLA 3O8VA 4IH5A 2MHNA 1P92A 1T3NA 4QYZJ 3L2VA 2MAMA 3OYMA 1WXTA 3NOCA 3C8YA 1J5EF 4KGKA 1JXLA 1RHKB 3BR9A 2HSPA 3JB9H 2XMKA 1MU2A 2WVCA 4X34A 3IBWA 1JU5C 3OYFA 5DGBA 2LXIA 3CCQA 5D0HA 4WFBQ 2YRDA 1RL2A 2K7JA 2Q3PA 2V34A 1IHWA 5G4DA 4OB1B 3LA0A 4DUZF 2M4MA 2DRAA 3T6BA 2XYPB 1VS3A 2XS2A 2OTLA 5KFMA 2XZTB 2UU9F 3MEVA 2UUWA 1HNXJ 5DRKA 1VQ8A 3MP8A 3H5XA 2DMOA 2JLFA 2KH9A 3MCSA 1RLQC 2UUBJ 3RRHA 5LSRA 3JV3A 4KO0B 1FVSA 3NPFA 3QATA 4ED5A 2XBPA 4C0GA 2HFVA 4C9DA 1K73C 3QLHB 4OZLA 1O9SA 4P2SA 3KOAA 1HWIA 2VFSA 4M5NA 1K9MR 3G8SA 4DFPA 3CCRA 1WQ7A 3CCZA 4PJLA 2HAIA 4B9MA 2HURA 1VQ9S 2AKWB 3VS3A 4M75G 4EBCA 4L5GA 1YZ7A 2DH8A 3LALA 4C0BA 1LK5A 3MPDA 4IO1A 3DOMB 4O3PA 1QKXA 3PW0A 3K57A 5GAMh 1ZLMA 2M8DB 3BDUA 2MQ8A 4FYDA 3QYYA 2N3OA 3DLMA 4C92B 1C0TA 2G4BA 2XLKA 2HNZA 1XTDA 4KGXB 1F9EB 5LJ3g 2RQTA 3FSIA 4P2FA 1K9MU