2YWWA

Crystal structure of aspartate carbamoyltransferase regulatory chain from methanocaldococcus jannaschii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
141
Chain Sequence
b'KVKKITNGTVIDHIDAGKALMVFKVLNVPKETSVMIAINVPSKKKGKKDILKIEGIELKKEDVDKISLISPDVTINIIRNGKVVEKLKPQIPDEIEGTLKCTNPNCITNKEKVRGKFKIESKNPLKIRCYYCEKFLNEVIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate carbamoyltransferase regulatory chain
publication title Crystal structure of aspartate carbamoyltransferase regulatory chain from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
total genus 31
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
A PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 2ywwA02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 2ywwA01
1R0BG 1TU0B 3MPUB 4WTOB 4FYVB 1SKUB 4KH1B 1TUGB 2AIRB 2A0FB 7AT1B 1R0CB 4FYYB 1RABB 1ZA2B 4AT1B 9ATCB 4KGXB 1RAGB 5AT1B 2AT1B 4F04B 4FYXB 1EZZB 1D09B 1PG5B 2QG9B 3D7SB 8ATCB 2ATCB 4FYWB 4KH0B 1Q95G 4KGZB 2QGFB 1F1BB 2FZCB 1TTHB 1RAHB 2BE7D 1RAFB 1ZA1B 2IPOB 1AT1B 1RAEB 1RACB 2BE9B 2FZKB 1XJWB 1RAAB 1RAIB 1NBEB 2FZGB 2HSEB 2YWWA 2H3EB 4AMCA 6AT1B 4E2FB 8AT1B 4KGVB 1ACMB 3AT1B 1RADB 1I5OB
chains in the Genus database with same CATH superfamily
1IGQA 2JVOA 1B7TA 1SXLA 2VVKA 3MPYA 2YX7A 3UDEA 3QZ8A 4W90B 2ABLA 3CCLS 1KLNA 4NYZA 4ZIVA 3JCMP 3CCES 4RBVA 3PHEA 5DLFA 3CC7S 1WHLA 4DR2J 2HGNA 5KFHA 1SJQA 1OSDA 1ZSGA 2BKOA 2RJZA 3DLKB 2X3WD 1JLAA 2DPIA 1S72Q 4LFAJ 1EKRA 4ECUA 2JW4A 2QXFA 4FS2A 1IR2A 4KFBA 3LW5E 4ZVEA 4BI8B 1V3ZA 2HVHA 5KOWA 1H73A 2L08A 1J27A 4B3MJ 5G4DA 1H8KA 2IHR1 4ECTA 3OY9A 1YZ7A 2Q66A 3M54A 4DOVA 2DERA 4NXNJ 1VQ6S 2XG8A 2HRTA 1S1WB 1YJNS 3GYXB 1GBQA 3A3PB 2J9EA 4ZVFA 2HKNA 1UEBA 4LNPA 1TL3A 3HHNB 1Y9OA 1N33F 4YY3J 4C8QC 1Z2LA 2MZ1A 2W9CA 1K8AT 1K9MU 2F2WA 3SI8A 1U48A 1EHWA 4KGVB 5B0CA 4N41A 3NGSA 3CNQP 4RUCA 4WFBQ 3D66A 1UTIA 2IVMA 3HSZA 1N5VA 5I11A 4DR2F 3OS1A 3NHNA 4XTTA 2N4DA 2L3PA 5A0YA 3FRYA 2V67A 2RQUA 5T7LB 4LFAF 1N34J 3H9NA 5HP1B 1VQ8S 2BUNA 1WD6A 3K8WA 5AJ3J 4L72B 1TUDA 1DRZA 2O88A 5HCKA 4B3MF 4J9PA 1S59A 2RKIA 2XY7A 2DNQA 4ZIWA 1QWEA 2HHHF 2ZFHA 4Z02A 3A1YG 1BYMA 1OI1A 2AKKA 3DNCA 5DS7A 3HP6A 1KS2A 4HVWA 2UUAF 4LQ9A 3MAHA 4IQMA 1N5SA 1R7IA 1VRUB 2XGQA 2K57A 4PL6A 2MLYA 4YY3F 2YNFB 4ZPAA 2DYBA 4Z8AA 3S3NA 4PWDA 1GX6A 4PKCC 3L09A 3VGSA 1IKWB 4OYOA 3EUNA 1VBXA 1XMQJ 4UY85 3M32A 4TKTA 4R56A 1QTNB 1S79A 4NLQA 3KG0A 2N3LA 3HFOA 5THWA 4J6WA 2DNHA 2RA2A 3ULRB 4U96A 5LT5A 6FD1A 1T3LA 1KD1U 3KUGA 3DLBA 2COLA 1DHMA 3QT6A 5HJXA 1RT5A 3M0SA 3M1VA 1N34F 3HD1A 3CCST 2IC3B 4ZVUB 4ZN3A 5GAN3 1KG1A 5AJ3F 3MEGA 1JLAB 4F4ZA 1SH0A 2QSWA 2QDLA 5ETSA 2VOPA 4DEZA 4GKJJ 2ZPGB 1K47A 1L5UA 3GZ7A 3A3NB 2R7TA 3KWMA 4A4FA 4FF2A 1M3CA 2ZDPA 4ERDA 1K1SA 2CZ7B 3QUIA 4PLIA 1RKJA 3MPDA 4DBQA 4E0DA 2WW4A 2M88A 3MD3A 2DNRA 3HF5A 2MOXA 3GIBA 1ZAWA 5A2QY 2KYBA 1LEOA 3I5AA 3KTQA 2QMXA 1TL3B 2LU2A 1Q8LA 3SYZA 1KC8U 2HDAA 3DI6A 1VK8A 4MJKA 4C3MA 1XMQF 2RQ4A 2CZ1B 2MEWA 1TR0A 1TXQA 2CPJA 3FUYA 2WVFA 3W7BA 3S7RA 2CWKA 2XSJA 1UCNA 2MKSA 2NYSA 3L7OA 2WK4A 4DUZJ 1QSLA 5A6WA 1VRTB 1LFPA 4JS4A 1VQKS 4HLBA 4I2QA 3H2UB 2RD1A 3B4MA 5E33A 2HEQA 1W1FA 1GQEA 4LF4J 1QD1A 1SVDA 4C8QA 3CCSA 4ED4A 5CKDA 4PPDA 5KT4A 2DO3A 2PEHA 1UUEA 2D9PA 2C06A 4JI0J 3R5JB 3TNVA 2ZVSA 1IB8A 4AUKA 1YI2T 5KYWA 2RKIB 1HMVA 4TVAB 3Q24A 2IRYA 2RHIA 5CQXA 1YBYA 4MKAA 2XMAA 4K50A 1VJWA 3KOAA 2I5JB 2YXLA 5HMZA 3LLRA 4A8QA 4J9SA 1PNJA 4AFQC 3VJPA 1RUWA 3MGJA 2ZH1A 1FEHA 3P8DA 4KE5A 2XICA 1WKJA 1HYOA 3BGFA 1O8BA 3CMAT 3EX7B 3RU0A 4C3LA 2HS4A 1IKVA 1URRA 3MEEA 1D9AA 3RZAA 4K4SA 2AQ4A 1AW0A 4CTAB 1CQNA 4A8KA 1TKDA 3T19A 4P6QA 5K14B 4IG3B 2EFNA 4DUZF 2JM9A 3O3LA 4FF3A 2Y90A 5HBMA 5DQIA 4OB1B 3UATA 2O2OA 3OR1B 1EB0A 3PY8A 5IH2A 1I1JA 4M5IA 1YRUA 1H3DA 4L3NA 3HFVA 4LF4F 3D3CJ 2X3XD 3M1VB 2N4CA 3DYAA 3KK3A 2JRSA 1ZAXA 5L9XA 2MSTA 3MEGB 5HATA 4JI0F 4DSKA 5F8GA 1RWKB 1WFWA 1FFGB 3M6WA 4UQTA 4DOWA 1FE0A 2XTJP 1KHWA 1ULRA 1YI2A 2E1RA 3GG1A 5J2NB 5GMKj 4M7DC 3CC2Q 4CP5A 3TA2A 4OP0A 2HHPA 4C8ZA 2XD0A 5HANA 1NG2A 3HZEA 1SHFA 2CDTA 3AB4B 2KT8A 1DAXA 4F0MA 3MMAA 4JB8B 4TYBA 3A8JA 1J3TA 2JVVA 2YHTA 2G1HA 1FHTA 4OMFB 2BZYA 1K0VA 2VFVA 5AE2A 4C0DC 3CMAA 2CJBA 3D6TB 3DU6A 3TA0A 3R5BA 4M5HA 5DZ6A 4GY5A 4DX8H 1M30A 3HP9A 5DZ7A 1RQ0A 2LXUA 4G1QA 2B8AA 4ZJLA 3HTRA 3ZTPA 1KP6A 4WKRA 3MR3A 3BBFA 3TQ1A 4HT7A 4MIBA 1M27C 3BDLA 2OI2A 3PMIA 2MI6A 3DLHA 3F73A 2VXEA 1O5JA 3A13A 5IXUA 3MMBA 3RB0A 4CLWA 4N76A 2DXCA 4EPCA 1TWBA 2E1AA 2DZ9A 4KHRA 2P0KA 2CH4A 2MLXA 2GFFA 1XTZA 2ZE2A 1IKYA 2BOPA 1SIZA 5KYWB 5GAN6 4XTXA 1RP5A 3PJ9A 3GF5A 1HYSB 1D1BA 1IR1A 4RCBA 3SCLE 2KVQG 5HKCA 3IWLA 2PT0A 1NCLA 1QP2A 2DGOA 3GIIA 4KR0B 4USJC 4ZITA 1RWNB 5FDLB 1T03A 1KBRA 4Q7AA 2V4QA 3D68A 1FXXA 2FZCB 2WVCA 5E7OB 4LMZA 3H5YA 1PWTA 1RAEB 2Z56B 4BACA 3KFVA 1WJQA 3HSDA 4BI4A 3L2VA 2ASLA 1UGRB 3M0RA 3ITHA 1VFJA 3TJAA 1BUXA 2LT4A 1YJVA 1BQNA 3NS5A 1ZPWX 1KQSS 5DQHA 4I4BA 1S72S 4ELTA 1C4CA 5KFSA 3ADAC 4DZDA 2HWTA 5E41A 4NLVA 2NR0A 2WSEE 4ZCKA 5IT9U 3AD9C 1GK8A 4B9UA 3CCQQ 4P2MA 4Q0BB 2MTLA 3DYAB 1U8RA 4KGKA 1ZTWA 3JSMA 2CIMA 2V8KA 2UUBF 2H54B 2OFGX 5LL6S 4FYDA 2F9DA 1R0BG 4HXJA 1AFIA 2ZKUA 3THTA 2AJ1A 4JV0A 3OSPA 4Z7CA 1WEYA 1PSFA 4M5GA 4C92E 3MMAB 1FRMA 5L1KA 1NK0A 1U1QA 1B0TA 4F0HA 4PEOA 2F4VJ 2CPXA 3K2YA 2A2DA 2DO0A 4Y91A 1ZYQA 3V7RA 3LH0A 3VS4A 3CJTA 3META 3CJSA 4FN5A 1FWLA 1M5OC 2QYZA 5KG4A 2AP6A 1KFSA 3V7SA 1S1XB 2E5LF 1AWOA 3A8GB 4M7DA 2V94A 2DEUA 1AVZC 4H4KC 2RPNA 1VQLQ 4U8YA 2GO9A 3RMSA 3AODA 2FLPA 1Q86T 3ZTRA 2NZCA 4O23A 2BE2A 1U1RA 2WOMA 2XIDA 2W2QP 2VG7A 1YWPA 3UCUP 2EYYA 1HI0P 5GMKi 2BZ8A 1QAXA 3QBCA 2LVWA 3MMBB 2IJFA 4NI2B 3Q23A 4II1A 4MZTA 2ZVIA 3BN7A 1RBOB 3D0IE 4FBTA 2HQDA 2FDNA 4QWDA 4NA1A 3SDEA 3V8LA 1YJ7A 4X4UA 4ED6A 1IKYB 2QTWA 4RW7A 1X5PA 4J5YA 3MEDA 2FPFA 4RNOA 1FMVA 4M7AG 5SUHA 1RAAB 4XO0A 1SUQB 2HSPA 4ZK7M 2HVZA 1RTIB 3IAM9 3HFKA 4K0KJ 2DFUA 5ETOA 4LXCA 2RB6A 4JLIA 4PJNA 2E70A 1V9OA 2QGFB 2W7OA 3PM9A 4OJ3A 3BDUA 4DL3A 4C0ZA 1UPMB 3PV8A 1B07A 1ZM2A 3HT3A 1RLQC 1DTTB 4X84A 2VC8A 2ZHAA 1SRLA 2J0XA 1ZA2B 1ABQA 2HHUA 4F17A 3UNGC 1E6VA 4ZVSB 4CYUA 5HLFA 3M56A 3QRPA 2AV5A 3GFZA 4OJHA 3FBFA 1C0MA 5F8HA 3HPWA 5LJ5e 5EC7A 3C6TA 3E2UA 4U7CA 4EMHA 3JSMB 4FBUA 4K4YA 4Q43A 3RBBB 1PJ6A 3PIPQ 3LWMA 2DGTA 4KT0E 1LNQA 2LXIA 1RWVB 3VR1A 1NSAA 5K20B 4NLYA 3R2CJ 2XI2A 2U2FA 5HQ8A 4HVUA 1UFWA 4WTOB 3EGWB 1OZ2A 4B9VA 3ILLA 2IVYA 5C2GA 4CLYA 4BDZA 3QO3A 5CKHA 2BJ3A 4P2FA 1Y96B 4K0KF 3OW2S 2HQEA 2X3DA 3U23A 5D0GA 4C7QA 1AHJB 2R57A 3UD4P 1S10A 4ZPWR 3A8KA 2FVCA 2WB1D 4XDCA 2ZZNA 3OMCA 1HWLA 1DBDA 1B3QA 4JI4J 2FRYA 2JM8A 3Q1JA 2OTJA 3P8BB 3VCDA 2W2NP 3G96A 3C94A 3L3CA 2AJFE 3FNNA 3BBCA 4DLEA 1Q7YT 1UETA 4J7IA 3T5LA 1GTEA 3FEOA 5GAOq 3FSYA 3CQTA 2PVOB 1T0HA 5ETQA 3JQJA 3R1HA 1H72C 4F4AA 3LANA 3NNCA 3KUHA 2FLLA 5HSPA 1HBOA 4LJMA 4D3GA 1AWWA 4JP8A 3QJJA 2WAQD 1AWXA 1CG2A 2JNGA 1QKXA 3PT9A 2VG6A 5IT4A 4XQ3A 4UF4A 1WXTA 3PX6A 3H0FA 2GNKA 1LWCA 4JI7J 2GZOA 4ED3A 2H4WB 4KUDK 4DMZA 2M52A 3CCVA 2EAYA 3EICA 4H4KA 4GLKA 3MEDB 2R8KA 1VRQC 1WDTA 3POTA 3IGNA 2IM0A 4OZLA 1YK9A 2V9KA 1N5TA 2VC0A 4C5EA 2VASA 5C24A 4OMOA 2E66A 4H54A 4F4WA 1D0EA 2AK5A 3R5CA 2RN8A 4OHYA 3OTOF 1D0ZA 3SB2A 2J0WA 3BGOP 2UVVA 2RDJA 1YWXA 2DIUA 4NRUA 1EQMA 4EIKA 1BI3A 1X4FA 3DFEA 5CYMA 3OS0A 4FCYA 1OIAA 2GJ2A 1F3FA 5IXBA 1SSFA 4JRQA 3N9UC 5D77A 5HMWA 1WEXA 3CJQA 2XDPA 4CYUB 5CKFA 2JTFA 2W1BA 3CCET 4IUFA 1S9GB 3CC7T 2V8JA 5GAOp 4PJMA 1ICEB 4LF8J 4EMDA 2PI4A 3CC2S 3RDVA 3D5MA 2CPEA 3V6HA 5KFDA 4JI7F 1FRLA 2M02A 3ETMA 4O3OA 4IG0A 2JOYA 4CI0C 2AMCB 1ZX6A 3JSYA 1UMJA 1TQLA 2PD1A 4J9CA 5GAMe 3MR2A 3IBFB 4CM2A 5CA5A 4C2MA 1X75C 1WELA 2LCSA 4K59A 1VQNT 1OU8A 3RBZA 2JUFA 1NU4A 2CPFA 4MMOA 2RQRA 4JS5A 2J7UA 1NE8A 5BYSA 1G1XA 4GO5X 3F41A 2DLPA 3OLBA 3BR8A 2YKMB 3K5PA 4C0GA 1HK9A 4HCCA 1RT2A 4AG1C 3SSSA 3MUVP 4MIAA 4RG2A 4UZCA 1RZMA 1NJIR 5KFXA 2FHJA 3MEKA 1T8EA 5DG7A 4FKXA 3CUNA 1MMGA 2MZTA 1NMEB 2VODA 4NLXA 4MKVA 7FD1A 2CXEA 3FK4A 1M4ZA 2E7WA 3SHWA 1QLYA 3N0VA 4FSXA 2CFXA 2XB2D 3K58A 3OR2B 1HBOB 2QA4T 1KTVA 2JHEA 2JC0A 3CT9A 2GNCA 3RBDA 2A7YA 1BMQB 3SMZA 1T05A 3WZ0A 1VQ8T 5GVQA 4CWBA 1I5LA 5LXRA 2HZCA 3PIOA 3UWNA 2MPUA 5M2UA 4QU7A 1Z9ZA 4FVCA 2DL8A 2P5VA 2Q3PA 1NHUA 2J6UA 3HDSA 3POTB 3R2DJ 3KKFA 3QQCD 3L1AA 4QWBA 3A8LB 2HGMA 3OJSA 2LQ9A 5C24B 1EIYB 2PZ1A 3TRGA 2YH1A 1HQ2A 4ITSA 4RW8B 2ZNYA 5E2QA 5A8KB 1VQ9A 4WXOA 4Y92A 3A12A 3OYEA 3CDBA 3MM5A 2KVIA 3REAB 5CZVA 4ZPDA 3PNIA 1VQOQ 1YJUA 2VL1A 4X4NA 1NDPA 1TUGB 2KYMA 4OL8A 1VQYA 2DTHA 3CCQS 1ZUKA 2HEKA 2XMTA 4DV7J 4DPYA 3CCMT 1NKEA 1GFDA 1XIQA 3NNHA 5IAYA 2QA1A 2BZ2A 3PVQA 1MU2A 4WK3A 1C1BA 4JPBW 2WZ1A 4DSEA 2QEXT 1U1KA 1UZHA 4KPYA 5GAMh 5GANd 1RAJA 2D3ZA 1NPPA 4ZCMA 4WIQA 3VS3A 2BANA 1HBNA 4DFKA 3H59A 4IG0B 1Y71A 1S4FA 1MNEA 3PG9A 3KLFA 4JI3J 2Y8YA 1T3SA 2P2CB 3CPWA 2ACYA 4LRAA 2RU9A 1YFNA 2XLIA 4ECYA 1KQSP 3U1MA 3G4ST 2LJ0A 1SL1A 3W9IA 4DV6J 4LSNA 2I0NA 1LCKA 4MMLA 4WF2A 2BDPA 1ZBTA 3OYKA 1Y5NB 1RT1A 3W2VA 1IZ6A 4EWTA 2WB4A 2A08A 4O0IA 3M9MB 3HVRA 3V2UC 2OPQA 2P8IA 1JJ2S 3EFSA 3IRXA 1VQ7A 1VQLS 3FEXB 3QT5A 1N32F 3FSIA 4QYRA 2LXFA 5LMNJ 2LQ5A 3FDSA 1CJKA 2JMAA 1LQ9A 2ZJPQ 2WBRA 2YX1A 4IYQA 3D0GE 5D0EA 4ECXA 2OTLA 1TUCA 2ZH6A 1U26A 1NK5A 1S1VA 3G82A 4L76A 3UR3C 2F5KA 3CCMA 2AGQA 3CCUQ 3DHXA 2KFYA 3HKSA 1VISA 5HK3A 3JCMe 4JJDA 1NDCA 4PFPA 3BO4A 3JCMb 1SKSA 3VVUA 2CVIA 4EBCA 3BSNA 1CS4A 5HAOA 4I68A 1S9FA 1JKHA 3I56T 3QIIA 1JRIA 2K7JA 3VS2A 1G6BA 4C5GA 2ZZTA 2W4DA 5D3GA 2M4MA 1H92A 1Y10A 2W25A 4M78E 2WCXA 4KHPF 1BU1A 1JWWA 2FGCA 1RI0A 4OMFG 2NXEA 2L9DA 4A8MP 2ED0A 1HI1A 1ZOTA 1CJTA 3GFXA 4KO0A 2GBQA 2WVEA 1YP5A 1M1KT 3DXBA 2YT6A 2WBMA 2VOOA 1UGQB 2U1AA 5ETMA 1AZSB 1REVB 1CJUB 3W3SA 5LMNF 3TAQA 2C3UA 2IBKA 3MM8A 1LNXA 3MM5B 1NYFA 1AZEA 4OYMA 2CP2A 4HT5A 2B9XA 3R6GB 1UA1A 1VDHA 5KYYA 1GXUA 1PYSB 3EH2A 3VRYA 1NM2A 3VS7A 5HO4A 2MYFA 5HL7Q 3UA7A 1IBKJ 2XWXA 1E7OA 4BC7A 4DQIA 2E9ZA 2E44A 1R27B 1MN9A 2MKKA 3D1OA 1C1BB 3Q8YA 2M8HA 2V4JA 1MW7A 3JCMX 4ETXA 1BI2A 1RDRA 4C8MA 2V1RA 2ZKTA 3GR1A 2BANB 2OPSB 1NHVA 2ROEA 4ED0A 4URGA 2OP5A 1TUVA 5ADZA 3I56A 4WCEQ 5FJ4A 1IUJA 1OPIA 4Y28C 2FHMA 2XI9A 5GMKm 3RRGA 4F4XA 3HVAA 4QIVA 4NLRA 4PG5A 3BBBA 1UTAA 4C97A 1ELOA 1FRIA 2DITA 1YZ6A 3MFHA 1C1CB 2DY9A 3MM9A 2J8SA 2RF2B 2XM3A 4OVAA 2AYEA 2K3IA 4DJBA 2EGCA 1B34A 4I6AA 1YJRA 3W2VB 2V8IA 1HR0J 1SBRA 4QWAA 1RHRB 2YDLA 1PD0A 2OPQB 1M3AA 1S0OA 3LP2A 1V3SA 3IRXB 1LW0A 2DEJA 2EJGA 2ROGA 4M77D 5KG2A 3PE0A 1KWMA 4C8NA 5GAN4 2CQ2A 4CI0B 3C2PA 1MWQA 5I3PA 5GMKe 3QO9A 5HQMA 4TY9A 1IBKF 3DOLB 1TKZB 2EFGA 2BKPA 5DETA 2MQQA 5LJ3h 3G82B 4ZP8A 4YB5A 3OW2P 3HSBA 5KFKA 2UU9J 1UA0A 3HX9A 5EWGA 2VUGA 1TL7A 2I1RA 1RAGB 2X1AA 5SZTA 3VF0B 2FPEA 2XHCA 2NYHA 1VYAA 1WOOA 4OHVA 3A8MB 4LIWA 1CS4B 3HM9A 1FTRA 4KPCA 2JLEA 2RHYA 4CLTA 5D3GB 3M6VA 1MHNA 2JNJA 5KG5A 1N56A 2HD0A 2CT4A 3CJ4A 1OQ3A 2ILYA 4H4MB 4C4WA 1PRLC 2UXBF 3WVDB 4M78F 1RI7A 1HR0F 1YJTA 4KO0B 3EVOA 2Q1LA 3IS9A 5ECAA 2R5MA 1UVIA 2DGWA 2C2EA 1SC6A 2YKPA 2RNEA 1GMWA 1M2VA 1IR0A 4CM0A 3LUYA 3X26B 2CP7A 2ZH2A 3IFEA 1QSSA 3QWUA 2COZA 4A47A 2C2MB 4A63B 3D2WA 5JUMA 2F5TX 4DQRA 5A76A 3LWIA 2E6ZA 2B4VA 2R4FA 2UU9F 2B6AA 3KLEA 3VVTA 2C2RA 1FK9A 4EMKC 1S72T 2R2RA 2KN4A 3CPWR 1Q4RA 2V4JB 1YHQT 2K2MA 3LO3A 2L8DA 1V1CA 2JXBA 2D1XA 2D41A 4ENOA 4BUGA 5D15A 3J7YU 2HNYA 2CPHA 3QJPA 5DDQC 1FXLA 4FYYB 3KDOA 4YP3A 3TA1A 1W2BS 2K3YA 2MZQA 1UEUA 1FRXA 4MYTA 4YDDB 2XMUA 3B82A 3B78A 5J26A 2F1LA 1IKXA 2JJ4D 4IH6A 5C42B 4NOYA 1QCOA 1JLQA 3CMEA 2DRDA 3MOJB 3G71A 1HLWA 4PLLA 3MHYA 4Y2CA 3NS7B 5BYRA 3IA0A 5GMKh 1S7IA 2HQCA 2RB7A 2QL5B 1U6FA 2C0IA 2R7SA 1RA6A 4FT2A 3LP2B 2DR8A 2CZVC 1LW0B 2DNYA 3AJ1A 4B08A 3NGUA 3OT9A 2ZBPA 1OU9A 2QL7B 2EJFA 4GRSA 2KRNA 2M2BA 3UN3A 4E6RA 2VFSA 3LOUA 3MM7A 1D09B 4OGEA 2VFRA 3M2VA 3EH1A 4XTWA 5IT0A 2MHEA 2B7BB 2OJ3A 4JI1F 2GV1A 3CCSQ 3NAHA 1MNDA 4OZ1A 4P74A 4U67Q 4QW2A 1P92A 4VUBA 2R7VA 2O01C 4FVMA 1NLOC 3HK2A 1VQMT 3N6NA 4MH8A 4RG8A 3PW4A 3MF5A 2MYSA 5LJ5d 3OBWA 2CGHA 2AHOB 1H641 3I32A 3L7UA 2IAJA 4B3SJ 1NEGA 3DMJA 3NCPA 2RHQB 3TU4K 1PILA 4RW4B 4XDDA 3DLEA 2RUGA 3DLLA 2ZPFB 3IS9B 2XO7A 2E65A 3T3FA 5GJWB 1K8AR 4MZMA 3N6MA 2CP3A 4WF9Q 9ATCB 1TFYA 1ZZFA 4DN9A 1U2FA 5HJYA 4DQ2A 2X4JA 3MCOA 2AEMA 2RMOA 1SV5B 1QQJA 4M5DA 4KRTA 1WXUA 3LTOA 2RJFA 1PHTA 2L89A 1SI9A 5KFCA 4FS1A 2B6AB 4QYZJ 3KLEB 2IIMA 5IHIA 3ENVA 1W6XA 1T95A 1EJ7L 4PG8A 2ZPEB 3CWJA 1JB0E 5L23A 1C4AA 3EGNA 3CBPA 1RADB 2CP0A 2HNYB 4O6JA 2GA7A 3OVBA 5BXIA 2X4YA 2RF0A 1T9WA 3PHTA 1ZTTA 1DTQA 2RJCA 1YI2Q 3OB9A 3ZEHA 4RUHA 1RTHA 2CYYA 4E98A 4RKUE 2YBVA 4FF4A 1WOPA 3I55A 4B3SF 4RTVA 2MQMA 2FIUA 4M63A 3M53A 1JLQB 2NLUA 4CIOA 4EMKA 3IO1A 1BQMB 3VU3C 4WKYA 4ZS6A 2Q43A 1VI7A 2LC4A 2YQ1A 2NREA 2CKKA 2LFVA 3MHXA 1VYUA 1QVFS 1SH3A 3CMAQ 2E3IA 4JZ4A 3NKYA 4LN2A 3VWSA 1DY3A 2M70A 3CCUS 1U09A 1S9EA 5C6SA 1X7VA 5B0GA 4PUOA 3G6EA 3CBMA 2PNIA 1S7HA 5KT6A 1WHXA 3MM7B 3M2VB 3ZXWA 3R3TA 3NCQA 4DHVA 2KXCA 1F5BA 4FW2A 5AXMA 2QZ8A 2DJQA 2K2PA 4K7QA 4CDIA 1FF2A 5IM0A 2E7XA 4I1TA 1JJ2P 3M0QA 1G3SA 2ZPHB 4LSLA 3I0RB 3KMQA 3DLMA 2QLWA 1TUWA 4NRTA 1XERA 1AWJA 2E3HA 2LDMA 2DHHA 4GKKJ 1APSA 4YQWA 3VZHA 3OD2A 1C0TB 4R8UA 3CDAA 1RYSA 3GV8B 3PYFA 4P2SA 1VHFA 1IJEB 1Y00A 2NUZA 4ID5B 1JLFA 4G1PA 4ED7A 1UEKA 4C11B 1FJGJ 3AOBA 4ZCIA 1XR5A 2VBZA 2PC6A 2CZ9A 2L3RA 1OYEA 3OYIA 1GXTA 3RTVA 3ZNJ1 2FD2A 4LBIA 2IBOA 2J6OA 5HQLA 4KB7A 2RHUA 4P2XA 2HHXA 3VS0A 1SQFA 1TAQA 4UUWA 1TMMA 1QAYA 1T11A 4J83A 4ANEA 4M5DB 2RE1A 1PC0A 1JXMA 5KCHA 5KFEA 2ZZMA 4ESRA 2OX7A 1BK2A 2P6SA 3LW5C 2KDOA 8ATCB 5FU6C 2GIQA 3R5GA 1K73C 3QSUA 5KFGA 3KLIA 1KQFB 1U06A 4HTIA 4GKKF 1G5VA 3PGGA 4PXCA 1WKKA 3NTHA 3M8YA 4F02A 4RO0A 1OY9A 2L9WA 3QNWB 1DTQB 3NFCA 2HMIB 1LW2B 3TARA 4PG6A 1FJGF 1YNZA 2Z0WA 1IGUA 1IBLJ 2HK3A 1KJWA 1HWJA 4I7FB 5DM6Q 2VWFA 2RK2A 4X34A 1EKSA 3EFOA 3V6KA 1R43A 2VKNA 5CD4H 2V34A 2XLJA 5F8NA 4NA2A 1S9EB 2NPIA 1SIWB 3TAMA 3V8KA 2GS8A 1KHCA 4Z89A 5EGYA 2X1GA 2WTFA 2AKLA 1T94A 1S1UB 2EQIA 2BRKA 3QATA 1VBYA 2DJWA 5DQGA 2QLJB 1RISA 4X9CA 5A8RB 3DKMA 1B4SA 2CZ4A 5GAMf 3KLVA 4JYAJ 4R0KA 4HTJA 1YN8A 2MIOA 3PX0A 2Y8WA 3SDZA 3CCJT 4XU3A 5CCLA 4DUYJ 1VIFA 2LQJA 3FZBA 3H2LA 1WJSA 4DPTA 1YLXA 3PW7A 1FJCA 4FYWB 3VAIA 3C14A 2AHJB 5DGBA 4J9UE 1P27B 1U0SA 4M77B 3KHHA 2O3DA 4A4JA 5J2MA 1QTMA 2JT4A 4R8UB 4Q44A 2CG4A 4DU7A 2IM3A 5KFFA 4HHUA 4LUEA 5L1IA 2K06A 2DGXA 1IBLF 3CD0A 3H5XA 2RMLA 1JLFB 1Q8IA 1Y11A 1DJ7B 2OAUA 3T41A 2Z8QA 1RWOB 4ANCA 3CPFA 4ICLA 3OFEA 2YQ3A 3SCIE 4EO6A 2CH4W 4ZVHA 2D3UA 4M75D 3UA6A 2DPJA 1RWXB 1TVRA 3DRXA 2GFUA 2Q6CA 2ED1A 1NAQA 3OFFA 5GAN2 3D9BA 1HQUB 2L9NA 4Z2XA 4IOAQ 3CCQT 2O67A 5KT2A 4U7UD 2MGZA 1AYEA 3AXKA 4NZ0A 2HIYA 1KSPA 2YUNA 4J9KA 2GQCA 2E4HA 1JXOA 5KYXA 2Z2LA 1PC5A 1SL2A 1CBKA 2F5GA 2HKEA 1U1LA 3KLIB 4CLPA 3CCJA 1OX9A 3V4IA 4RTYA 3V5RA 5F9LA 5ETLA 2Y9HA 2KU7A 3JCMd 1LWEA 4HI2A 1WNEA 3UI3A 1FX7A 2DVIA 2VPXB 5E3QA 1RTJA 1I07A 2XY6A 1DZ5A 4GVBA 2JS0A 4DF4A 3PTWA 2K5LA 2DBBA 3N5FA 4DL2A 2GJFA 2R8HA 2LYVA 2NZ4A 3EFOB 2OLWA 5KFUA 2NSBA 1PO6A 3JB9D 1W2BP 2BQ3A 4IR9A 2RQKA 2OTJQ 1VQLT 1HHSA 2LMIA 3N5BB 4DV5F 2KO1A 4ANDA 2XI3A 3CCSS 1U1SA 2QN6B 3EGXA 1WJRA 2Z2MA 4MMKA 3NAIA 4LR8A 3BSAA 3CIZA 5BYQA 1KQKA 5GAEI 3TSWA 3TUZC 1Q79A 1WC1A 1BXNA 5K8OA 5L9NA 2UXCJ 1M2OA 1IBMJ 5G0RA 3FMWA 1UE9A 2R9LA 1D3BA 2E1CA 3C14B 3UPFA 3KLGA 3TAPA 2ASYA 2GJIA 2IRUA 2LEPA 3FBCA 1RT6B 4FT4A 3UD5A 4ILMA 1K9MT 3CCVQ 2EYQA 3QYGB 5J2MB 1VBKA 3D1QA 4O3PA 3U1LA 4G6VB 4E7JA 2W9AA 2QE5A 1AB8A 2SEMA 2DHSA 3CD6T 1K0XA 4N8OA 1FFWB 1K4US 4IFYA 1ZA1B 4QPTA 4OHWA 1L3KA 1PIEA 5K8MA 1Y3KA 4B9LA 3GIRA 5AE3A 1X6BA 3BW1A 4KHMA 3V6DA 4YR0A 4A46A 5KFTA 1VQ6A 2XU8A 4AT1B 1KC8C 2Y0SD 4RNMA 2XZDB 1TVRB 3FQLA 5LJ3f 3W2WB 1Q86R 3TEEA 2D3O1 3CC4T 2MGZB 1U1MA 1WG1A 2UXCF 3JCMc 1RYRA 2H48B 1IBMF 4WZQA 2ESWA 2JTEA 1UDLA 2OPRA 1YI2S 2MSSA 2ZJQQ 4C92D 3CCRT 1FI4A 2UP1A 1CULA 4NL3A 2KHDA 2ZH9A 3NOCA 1FVQA 2KAFA 4LFCF 2DHAA 4ZMMA 3O6QA 5KOXA 2PUKB 1WF1A 3V4IB 1SB6A 4PCQA 1FT8A 2VU5A 2O5DA 1YBTA 4IH5A 1WPYA 2C1EB 2XYGB 1O51A 2FJWA 4FDFA 1LWEB 1GNKA 4J9MA 2W4CA 3CMAS 1DQ9A 3T1YJ 2KI2A 4PJOE 1W25A 5A2QU 5D0RA 5EX3A 1FDDA 2BRLA 3W9JA 1KD1T 5FU6B 3MEWA 2CJ9A 3M2UA 3CD6A 4ZGDB 3KJVA 1N0UA 3DOKA 5ETNA 4OX7A 2YWKA 3NOGA 2DCLA 4NLSA 1JLGA 1W2IA 4ALZA 1SG5A 4KUIA 2CP6A 1FKOA 3QZ9B 2E9TA 1NSPA 3Q8SB 3MECA 1WF0A 2RILA 3Q8RB 3DB4A 4IRKA 4Y2AA 1NJZA 3CC4A 4WP9A 4JI6J 1S0MA 4MTPA 3NGRA 4LDWA 2NQPA 2M51A 3FFIB 2YRDA 3MXHP 1QVFP 2EK6A 4NYOA 1IQZA 4ZNXA 4TXSA 3DGPA 3HZGA 3KNGA 3CCRA 2DRBA 3K0JA 5G0RB 4YB7A 1VIOA 4RTXA 1UG1A 1KC8T 3I31A 3E2EA 2AJ0A 3LQVA 1WA7A 1D3BB 2GC8A 4KH0B 1U6BA 2DH9A 3PIOQ 2H5IB 5DG8A 1QLNA 1JXEA 3HT0A 2RQWA 2E1MC 2MQOA 4IO1A 4P7VA 1NPKA 4XIUA 5KFLA 1FFSB 2J06A 2GO8A 3MFIA 5B7WA 2DL5A 1WF2A 1NLKL 4IFYB 3AHPA 3DC2A 1N6QA 1IM6A 2K1RB 2CJYB 1VQ9Q 1BKBA 2E12A 2EKNA 1JNRB 3TW0A 1Q78A 1NRKA 5L38A 2WSEC 2E9RX 5A0DA 2WSFC 3BO3A 3HL8A 4CO2A 1JQQA 2DR9A 1Q7YR 4BD3A 3WC2A 3KUEA 4AMCA 2YLCA 2IYIA 3D67A 4JI6F 3CEDA 3PW5A 5IS2A 4RU2A 1OMSA 1F60B 3FGVA 4F25A 4DCOB 4K4VA 2QRRA 1RCXB 1WDDA 1XQIA 1M0SA 2ABYA 3QLHB 2W01A 2UVUA 4JOUA 1HNIB 3UVJA 3PZPA 1DQAA 1FWZA 2WVBA 3GE9A 4CC4B 4RPFA 4CO1A 2A2CA 4DV2J 4M8LA 5GADI 3H4DA 4LF6J 1C6VX 2F8MA 1YKWA 4JLGA 3PO4A 3MP1A 2MJNA 3IWXA 3C16A 2PUOB 3M2UB 4C8KA 1KQ2A 2K2VA 3JYTA 2RM4A 1YSJA 1VQ7Q 1S99A 4Q2LA 2RK1A 2VJVA 3KJVB 3DOKB 4YTLA 3N01A 1LVKA 1JLGB 3HKWA 2DBKA 3TREA 3RJMB 2OTLQ 4NWBA 2V6AA 2P9GA 8RUCA 2JLGA 2QGGA 1XEZA 4ORZA 4OV1A 3CCMQ 2NYIA 5D78A 3BKTA 3JTOA 5J3BA 3BH6B 4OYAA 3CEYA 1TL4A 2E6NA 4MAKA 3QJ6A 3QBYA 5H9EK 2ZH8A 3G1JA 3RMQA 4BCAA 6FDRA 2BYCA 1QJHA 3CSKA 5IT9Y 2D1CA 1RWWB 3OUYA 4K11A 3EG3A 2GF7A 2DIVA 4MK8A 3A98A 3GLJA 4CLFA 4LF6F 3VV2B 4ES1A 2YKNB 1Y7XA 4X2BA 2QTXA 2HFOA 4NA3A 2EKYA 3Q86A 3FJ5A 4ECQA 2FLNA 4DN0A 3ULHA 4H4OA 1R8PA 4IH7A 1NZ8A 1VQOT 1YJWA 1AD5A 2R7WA 3MAAA 4M7DE 1SKRA 3HSJA 4ECRA 4IR1A 2YWWA 2FQQB 3EXCX 1GX5A 3M30A 3RR8A 2LP4A 4BLGA 4DL6A 3SCJE 4OB0B 1D1UA 2HURA 2AZVA 3C6UA 5GAHI 2EVRA 5L39A 5BR8J 1D0XA 4FNIA 2H3EB 4J9NA 3GP8A 4KT0C 1WYXA 2BQRA 1XMOJ 2W7AA 3HVTA 1LFWA 1X4BA 2GFAA 1UWAA 1F2GA 2M1HA 4X4SA 1B7FA 3DHWC 2RD5C 1VQPT 2K5IA 3LPYA 5AXNA 4OJGA 3SV3A 3I56Q 1GCPA 4IRDA 3GBQA 2PEBA 3QHSA 2RRAA 3GNFB 2MY8A 5J1EA 1ZBJA 4DOZA 4A54A 4O3NA 2B86A 5AYFA 4M75B 2RAQA 5J2PB 1PBUA 2HW3A 1CPZA 4WCIA 3ILOA 2OTJS 1XQHA 4RZRA 2B5JB 3LP1B 2BQUA 3R8YA 3NL0A 2KNBB 4EI2A 3NS6A 2FB0A 1RT4A 3D6HB 3MZIA 1S5ZA 2ZZDA 2BJDA 2HRYA 1HL6A 2JMCA 1G7CB 3CE8A 3CCUT 2KY9A 2XDDA 5BR8F 3UF4A 1ZAVA 1U47A 1N54B 1XMOF 4RBTA 3T5JA 2P4RA 2R8IA 1XBWA 2KTQA 2XMVA 4K8RA 4DX5A 3CO0P 1REGX 3AB2B 5FLXU 2QQAA 2M8DB 4IQXA 4AXIA 3LP0B 1QDUB 3IR6B 5A8WA 2DRMA 5CKEA 4OYWA 4G65A 4DQPA 1KQSA 4F2SA 4N56A 2AZ1A 3G6VA 2HFZA 1UJ4A 2MMYA 5AE1A 2V68A 2E7VA 2DNOA 2HHQA 2ZH5A 1S1WA 2A3LA 2R7UA 3LH5A 1SSHA 5JJBA 2OEMA 5LSLA 2QK0A 2JL9A 3C19A 1FNOA 5KG6A 3ZZZA 2F9JA 2GHPA 2CSQA 4DV3J 2XMKA 2G3RA 3ISZA 3EVMA 1QCNA 5GAOr 2DJZA 4N4HA 1SQGA 3HO1A 2J9CA 4H4OB 1KR4A 3D28A 1HW9A 1KVKA 1GFCA 5F0UA 1FD8A 4LDUA 2DKOB 2J5AA 5CYQB 3J7A1 3W9HA 1M5SA 1OO0B 4LDXA 4ZVRB 1T9UA 1DURA 1T0JA 1K73U 4ETZA 3QGHA 1S77D 3CCTA 3C6UB 3PVLA 4J9LA 4CRJA 3LA0A 3GMGA 3HLUA 5T7LA 1QY7A 1H74A 5HP1A 4MIWA 3JAME 2COYA 1PCAA 2OJ2A 4M77F 3MCMA 5KG3A 3V7CA 4O3SA 4CC3A 4DR6J 3OYLA 5CQGA 2W7PA 2LKZA 4M77G 2H4YB 4C8OA 4NZ7A 3Q2SC 4E2FB 3BREA 5CCAA 1U3OA 1RUSA 4F26A 1NDKA 1RLDA 3KDNA 1YQHA 4GC6A 5J1EB 7FDRA 1X4HA 3PYEA 1H38A 3U27A 2C3PA 2YNFA 4DV3F 3GU0A 3CMEQ 4LQ3A 3QGIA 2HCKA 4TN2A 2BR0A 1X27A 2PVDB 3G71Q 3HHEA 3M8PA 1IKWA 4QYZK 5A0LA 4AFFA 2FVQA 3IAS9 2LJ3A 1HJDA 3HMJG 4XTYA 1F2HA 3FLGA 5KG1A 4ES3A 4A8WA 4B9TA 2CG8A 2QLFB 1RT4B 2VICA 1NJYA 2HRUA 3DRRB 3QSYB 4C92B 3ZZYA 5GAMj 4LD6A 1OPLA 5DY9A 2DXDA 2F2VA 3CXCS 1WHMA 1RI9A 2B9WA 4X66J 2CQ0A 2B4UA 2DILA 1VQSA 2IC3A 1KVJA 4OI1A 4M78D 4A53A 3I4HX 1ZSZC 2UZAA 2PVGB 2DIQA 3DLJA 3VS1A 1YHQQ 4F2RA 3VQSA 3X3UA 3Q0AA 1PSDA 1QAJA 5A8WB 4BDPA 4ELZC 1VLYA 2LQKA 1WEZA 2HBRB 3O5ZA 2HBWA 1VQNS 3LWHA 1OX8A 3C15A 2ASDA 3C0CA 5IC4B 3OSVA 4Y00A 2W8LA 1BB9A 1IXDA 1RK8A 4QVCA 5D4OA 4PRFA 1VQ9S 1AROP 1SKUB 3N4WA 4WBFA 3RG6A 2D0NA 4RJVA 2OSRA 3DLLQ 3TJ8A 1B3TA 2ZBRA 2N3OA 3M7VA 4URQU 3RESA 2D8JA 5IHKA 1VC0A 3C3LA 2G2OA 3PNWC 1G4CA 1VRTA 4PG7A 4MKBA 4JI5J 3GILA 4QT7A 1A6LA 1N8RC 2GHWA 3EFRA 1VC5A 2J6SA 1RTDB 1WUUA 3VTIA 2QA4S 3NEKA 1U1TA 2ILZA 3QMQA 4C9DA 3JB9I 3KXTA 2AW0A 1M9SA 2J0SD 4HCZA 4DWIA 3G8QA 1U5SA 1D1CA 3TUJC 4NYPA 3ASKA 4XK8E 1T7PA 3X24B 1I51B 3THVA 3IXQA 5DLQE 2DM1A 1WG5A 5GMEA 4QR2A 5KFYA 3AD8C 4NXNF 2Z57B 2I5JA 4J8OA 1VQMQ 1QMCA 4P75A 4NLWA 2BJ8A 4BC9A 3PJXA 4JJBA 2V50A 5C25A 4I2PA 2RHZA 2F69A 2VV5A 1HNXJ 4YR3A 2O9SA 3I55Q 2EFQA 3CJ2A 1VQ7S 5FIIA 2E5JA 2V26A 3M8PB 4ED5A 4R55A 1TKTB 4KULA 2DL7A 4CTAA 5F41A 2V5HG 3F0NA 5K14A 4IG3A 5B0FA 2JTMA 3JCMV 2G0IA 5E3AA 4KJIA 3MM6B 4P7TA 3OMGA 2JVRA 3CCMS 4X4VA 1SRMA 3H25A 2VZ9A 4NMLA 3LGMA 4JI5F 5H1SV 4J9GA 3OR1A 1S0VA 2QSFA 5F3ZA 3G6EQ 4O5VA 2KT3A 2YPZA 4DV1J 2QEXS 1KOOA 2DGVA 1CKAA 1KQSR 4JDSA 1JJ4A 5L46A 3K7RA 2PTKA 3NG8A 4QR0A 1M3BA 1I3OB 2HBZB 3OYHA 1NH7A 5E0OA 2JOQA 4JRIA 5LJ3Y 2RS8A 4U8VA 4M78C 2CQPA 3EYZA 1W7WA 3ONQA 2X4WA 2NWMA 5DDOC 3FBEA 1JLBB 3G4SS 3OL6A 3OVSA 4N5SA 5J2NA 1M1GA 2FJVA 5I3QA 4X4RA 2XMJA 3J7Z5 2YPYA 3DRYA 3C15B 4S0MA 4B9WA 3OYYA 2CNKB 3RGIA 3U02A 2KXNB 1NM7A 2VGNA 3ME9A 4A8FA 1NSKL 2NUTB 2AD9A 1M90R 4OX9J 4YFUA 1MN7A 5HK4A 2O1PA 3BYPA 1ZSZA 1IHVA 4IUUA 2VDHA 3ISND 2MHNA 2V8DA 1V6HA 2O9VA 5LJ3j 2DO4A 3PTAA 2ZPIB 4NEZA 1Q95G 4HT8A 2CJKA 2HFSA 4NPOA 5E3CA 3WHIA 4LRCA 3UT1A 1X01A 3MPUB 4GVLA 1Q0NA 3RUXA 3O44A 4F7VA 1WNLA 3H6ZA 2QV6A 2XQCA 1N5ZA 4NE9C 3OFHA 4M5LA 3BY7A 1UVJA 1KHVA 1LK7A 1LKZA 2X9HA 3I56S 1PYOB 2GGPA 4GKJF 1Q8KA 4D8KA 4QIGA 2EK1A 5LJ5g 3G2XA 4WXWA 3THKA 2BA9A 1HYSA 3RB3A 3MAQA 1ITPA 2RH2A 2OHDA 2R7QA 3O1LA 3CCZA 3UO0A 4QVDA 4A4HA 1QVGS 5IZHA 2DCUB 4OX9F 4LFBJ 5C25B 3DN9A 4I2PB 4LIRA 1T3NA 1RHMB 5FDLA 4B3OB 1T9YA 2NLWA 1JQGA 4KV8B 2C3MA 5L1JA 2IMWP 3RR6A 2BEFA 1VK3A 2YKQA 3NBPB 3M6XA 1N9RA 3OYCA 4K4WA 3MURP 4DBRA 2X4XA 1G3TA 1U24A 1ZS6A 4DQQA 2EFPA 3TZXA 1JEGA 2YUPA 2G0CA 4EEYA 4XPCA 1SC1B 2OKQA 3EGUA 2BV3A 1BI1A 4Q0BA 4Z88A 2OELA 4FPIA 3OXGA 4M75E 3J81E 2RQTA 5C2CA 1K0TA 2VONA 3LYIA 2M3DA 4JV2A 4LT6A 3NMAA 2C2ZB 1S0NA 4LBHA 4I0WA 4UT4A 1FE4A 3M9QA 3Q8VA 4F0KA 2VD3A 2PMWA 2J6KA 3P3DA 3C95A 4CO5A 4R5PB 4LFBF 1AA1B 3FDRA 5GANj 3K8VA 1F9HA 3FMBA 5L8RE 4OZ3A 1NB7A 1NYGA 1T9XA 5KFIA 2NUPB 1QWFA 5GMKl 1S6QA 1TK8A 1D1AA 2UVRA 1NJIC 2VA2A 2XY5A 3OW2R 1ZSZB 3MCSA 4KY3A 2W4PA 1FTCA 2NXUA 3I5RA 4M78A 2CZ6B 1FKAF 3QT7A 3W5XA 2NXJA 1UVMA 2K9GA 4EZ9A 3WXMB 3ISNC 1S1XA 3HRTA 1WI6A 1IWGA 3PFSA 2RVJA 2AYGA 5GAGI 2VF3A 2BJEA 2MLZA 3GIKA 3QIPA 3CW2C 3C66A 2KXDA 4RTZA 4FYXB 1Y5LB 3A8IA 3D54A 2X1FA 1F9EB 1H2TZ 3OBYA 2AX0A 3CMQA 3EZUA 4J9VA 1KNZA 4CT9A 2RJDA 2VQEJ 4NI2A 1EAYC 4LVNP 5KYUA 2CREA 4TU7A 4HT9A 2MKIA 4IFVB 2GGPB 1U1PA 2MQPA 4KGMA 1PJ5A 3M8WA 5T41A 3CCJQ 2HAIA 3SWNB 2JN0A 3O8VA 3CMES 4CC2A 3J80E 3NLCA 3P6YC 2KG1A 3G71S 1YTYA 1SUQA 4PJLA 3TX0A 2HGLA 3VALA 5KTQA 2DXUA 2OH2A 1RTIA 3JSCA 1WC0A 2VHGA 4NEYA 1JIHA 2LVMA 4FW1A 1WC3A 1CC7A 3P49B 3PRBA 5J39A 5K8PA 6AT1B 2CDRB 4OMPA 1DTTA 4J9IA 4CLUA 1SH2A 3G8SA 1TV6B 3SEMA 1EP4B 3DRSA 1YHQS 3T1AA 1M90U 4E7HA 4X4TA 3QRRA 4EGLA 2DNGA 4FYVB 1IREB 1V5IB 1JNZB 4BDYA 2AGPA 4PQUA 2RRNA 3A8EA 3R27A 3JB9H 1X0PA 2B3TB 2CQDA 3OJUA 3EXYA 2J6TA 2CQBA 3VGUA 5IN1A 3GFYA 2H8HA 1HD0A 2DETA 4M75F 5FU7C 3JB9J 4UQGA 4DS5A 1IVZA 4M75G 2KRBA 1U1NA 3CXCP 4DSLA 4MDWA 1Y96A 3T6BA 4WP8A 1DARA 4USUA 4ATOA 1LXJA 1S6QB 4C48A 2FJXA 2EQKA 1UL3A 1SPBP 2GQVA 3UDVA 3ICLA 4PK4A 5FW9A 1JK9B 2ZCFB 3QJYA 4YEAA 4M78B 1SCJB 1QP3A 3JAMY 2ERRA 4HKEA 1RLCL 3LH2S 4OYPA 3HXMA 4YN3B 4AFUC 1R3NA 2FPHX 3KFWX 4A8OA 1TAUA 1JB0C 1O0PA 2C2OB 3AOCA 3W5YA 2HZAA 3QIPB 2DB1A 3VAKA 2HQXA 3H0HA 2I0XA 2MWOA 3TJ9A 4B02A 3H41A 1Z9QA 2GCXA 3IG1A 4WU2A 4Q8FA 5KYUB 2PN6A 1OS5A 3PVXA 1VQMS 3NRBA 3LAKA 2MKYA 1N8RR 3DM2A 5DM7Q 3TVZA 1FRHA 2OGUA 3JB9F 2HFUA 2HNZB 4RKUC 3ZNUA 4NXMJ 2YX4A 4ZHRB 2MQNA 3EM1A 3I55S 1AFJA 5HY6A 1SKWA 3I0SB 3TVTA 4LBPA 3KHGA 2HBPA 2QYCA 5EDWA 3BV8A 4HH0A 2YKAA 3H90A 2EVZA 1N6AA 2NCKL 1EFNA 2VH7A 2DXBA 2FVPA 1QKWA 4RWXA 4GLMA 2F4VF 4WYWA 2ZUGA 5D6XA 5GAN7 2A28A 1WSRA 2IVWA 3AD7C 4M94A 1EZZB 1P9QC 1UHCA 1C0UB 3G6ES 3CD6Q 3R9LA 3MR7A 2OTJT 2BUDA 4FNHA 2QO3A 3PEJA 4ELYC 3MEVA 1VJQA 4RLEA 4M95A 2W9BA 1FA0A 5B0AA 1VHIA 1U4BA 2PA3A 4ELVA 1GT8A 4LRBA 3SZ2A 2ATCB 3B8HA 3PX4A 2OAWA 1F5AA 2GTJA 1HNZJ 1S9GA 3DRSB 3PDNA 1NK4A 5E3PA 3OL9A 2DKGA 2HQFA 4FXDA 4B9NA 4F7UE 3CC4Q 4PQUB 2DNUA 2RI2A 4BWMA 3OLAA 3T9NA 2BZXA 2XCAA 5ETKA 3JCMg 4OYZA 3FBBA 4NXMF 1KKHA 2FHOB 2VA3A 1LPLA 3CBOA 2I6WA 3ZZPA 3CCRQ 1MUZA 2EWHA 4DPXA 4P52A 4LREA 3CCVT 4K5SA 2HL5C 3NTIA 2VB6A 2V2KA 1FDNA 1UZDA 1LOUA 2HNIA 2F40A 2ROLA 1U45A 3VRZA 1T0TV 2V0NA 2KRSA 2IJNA 3UNYA 3K57A 3TWZA 3IM8A 4C92F 3GJSB 2LECA 2FO0A 2YKMA 3D1HA 4C92G 3REBB 4L74A 1JJ2R 5J2QB 2EQUA 2UVWA 5CYJA 3S6WA 3DDKA 4YDXA 3ZTSA 1DFDA 1UKUA 5EX0A 2HS0A 3ZO7A 2RQMA 1WG4A 4X9DA 3VKIA 2CKWA 2LJ1A 4RW6B 2OEKA 4DR4J 2J05A 1OY6A 5B08A 3CCWA 1UW9A 2ZUAA 4KIAA 3IG1B 3OR2A 4FKYA 3D6FB 2J9DA 3R1LA 3PKMA 1CQMA 1UVLA 1VUBA 3DM2B 1ZUYA 1LJOA 1J2VA 4DSJA 3KHRA 1YJ9T 1LWFB 2M5YA 1R77A 1FVSA 3KJNB 3BGRB 5GAN5 4JUVA 2EYWA 2M9KA 4DFPA 4F3QA 1SPKA 1ROFA 4LUDA 3OS2A 1M5VC 4ID8A 1OEBA 2XWYA 5H9FK 3JQKA 1M5HA 4OX6A 3SXLA 1QE1A 2DL3A 2ZOMA 1XR6A 3RIRA 4WFAQ 3CGIA 4RW8A 4JI4F 2BABA 5A8KA 1ZM4A 1K44A 3MR6A 4HVZA 4ED8A 1NEBA 3VS6A 5F8MA 4F67A 2KM8B 3OYGA 5F9NA 5C0MA 1RHUB 2W9BB 2DGQA 4B6MA 3M8ZA 1OPKA 1QVGP 2KRRA 5IXFA 3MI7X 4NASA 3M0PA 4UY8T 4B3TJ 2FVSA 4XTZA 4IDKB 4F50A 4OZNA 3FZ2A 2D9OA 4AYBD 3L2UA 2KK4A 5KFBA 1ZUUA 3MWBA 1WHYA 4RTUA 3A4TA 3L95X 2GVZA 2JZ5A 3EPGA 2OEJA 1FDAA 2RUSA 2L0AA 2K8GA 3LALA 5CK9A 3MTJA 1I6JA 4C0FA 4MDXA 4CT8A 1UWBB 1YITA 4PJJA 1YJ9A 3LGFA 2JDJA 4P72A 2BVZA 3QZ7A 2YNGB 1RJJA 3V6JA 3S8SA 3M57A 4XTVA 2AZ3A 4ZCLA 1P8GA 1YRTA 2MKHA 2H9ZA 1BE4A 2OMOA 4N0AC 1TKXA 2CAJA 4QW8A 2VGMA 2W2MP 2PIIA 2Y0BB 4CO3A 1NK9A 1KD1R 1VQ9T 4C8QD 1RWPB 5KT7A 4XU2A 2VBWA 3P5BP 1VOMA 2LX7A 5CAIA 1YJWQ 1N8RU 3FEZA 4LD9K 4USIA 1QSYA 4Q8EA 3OYDA 1WWHA 4WFXA 1VQ4A 4LF9J 3HRUA 3FCHA 2ZBIA 5FU7B 4PZVA 3HHDA 2OFHX 5FRMA 5EWFA 4B3TF 5J1PA 1Q82R 3RB6A 3D4JA 3CDWA 2VFTA 2CDQA 2R2UA 4J91A 5I21A 2KYXA 5CD4A 1QVFA 4LF8F 3CCJS 2ENMA 1W4SA 1S6OA 1Q81R 4OYXA 2VG5A 2DA9A 2C0OA 1TTHB 2BM1A 2EFVA 4PJOD 2KT5A 3HHKA 3OV7A 3ETOA 5M2PA 3BPDA 3THPA 3CDEA 1VGYA 3FRZA 4OIXA 3N28A 3OQ2A 4A8SA 1K8AC 2GQIA 4FP9A 4NCGA 1HWIA 2K7KA 2KMTA 4QWCA 1WC5A 2FVUA 3WIVA 4QQGA 1QE1B 4B9XA 1I1GA 2FL7A 2FVRA 1EIFA 1AZSA 1REVA 4OB3B 1Q53A 3ENQA 1VQ7T 1CJUA 1HARA 2F1FA 3EG0A 1HFEL 1SJ4P 4EMGA 4LF9F 3J81Y 3ZFVA 2VC1A 2BOAA 2PQWA 5D7UA 4IUTA 2PU9B 2OTLT 4NCBA 1EX4A 1PD1A 4ELUA 1N33J 4ZPVR 4E7ZA 4OZ5A 2O31A 1U02A 3RR7A 1FNMA 1HQEA 2MY7A 4TVRA 5KE3A 3O2IA 1AEYA 2OPPB 3IRWP 4OMLA 1ZM9A 1KRPA 1YG0A 2QLXA 3QFHA 3W5ZA 3MEAA 3DLGB 2GVZB 2COWA 1XNQJ 1FESA 5BJRA 3BGLA 4JV1A 1VS3A 2OPSA 3OTCA 3W60A 2CJQA 5IWAJ 3J81j 2DD4A 4MYUA 3MPVA 2LQ8A 1VQPQ 3IN5A 4KGZB 1OQ6A 4TY8A 3UPUA 5KFAA 3CO9A 1U0HA 2XDBA 1P1TA 3ZTOA 3CD5A 1W2BR 2E5QA 2CQIA 1XK8A 1C1CA 1FKPB 2EPIA 1JLCA 2RF2A 4JZ3A 4RL1A 3SBMA 3RBEA 5E5NA 2BM0A 2HKQB 4J9RA 2KGTA 2HHHJ 1TKXB 4J7CA 2JEFA 1B0VA 2UUAJ 4ZKAA 1A0OB 4ZPBA 5KFRA 3IWNC 3KXDA 1RXOB 4JRPA 2HLTA 1Q5YA 4JV5J 3M0TA 4DV7F 2O66A 4EU0A 1I81A 2QG9B 4ZLPA 3DOLA 1TKZA 3TP2A 2DR6A 1X4GA 4J90A 1MMDA 3WX4A 1RACB 2FZKB 3J80Y 4HH1A 1ZHIA 3UWTA 2CPYA 3Q89A 3BYRA 4IIMA 3QYHB 1FNXH 1R8AA 2IDLA 1XNQF 2C2DA 4N0AA 3PEHA 2XBPA 2MMPA 5FRNA 2LDIA 2CPDA 2XNQA 3R6NA 2RRBA 4PR6A 1K1ZA 1FXRA 4USHA 2VG5B 4BY6B 2EC2A 5IWAF 5LJ3e 2P4TA 3BQ1A 3DKDA 4JI3F 3MR5A 1HBUB 1RL2A 2F65A 2G2ZA 2XO6A 1CEZA 4LDVA 4PJOC 1D0YA 4DV6F 3SQGB 1BGXT 2HQ3A 3K89A 4NCGB 4H4MA 3CD6S 1S1NA 3QWYA 3AH6A 3AFGA 3DU5A 3I6PA 1OYXA 2Y1IA 3KG1A 4HI1A 5J1NA 1S48A 1D9DA 2L2PA 2XC9A 4ZJOA 3OHBA 2A10A 1MROA 2FHKA 3HKZD 4TNOA 2XLKA 4JV5F 4P73A 2OD4A 4LF1A 1NDLA 4OB2B 2E10A 4Y3CA 2ZHBA 2KT2A 4RUAA 2DHXA 2A0FB 3PRVA 3CC4S 1HQEB 3DOMA 2B8QA 1HA1A 1UVKA 1ZM3A 4WFYA 3CCRS 2M0OA 2VBYA 4KRWA 3ZL7C 4JI2J 4WU3A 1QM9A 1TSFA 2CQ3A 3E51A 4DR1J 3Q8UA 1UFKA 4N8NA 4I6WA 4C98A 3RYLA 5ITHA 3A8OB 3BO2A 2AEFA 2A36A 1H7WA 4PQAA 2R58A 2MXYA 1NK8A 3TUPA 1HKAA 4MT1A 4ATNA 2W2OP 4TY8B 2XULA 1NJIU 1U0HB 4KC5A 4DR5J 4M7DD 3A8HB 4KFBB 1Q82U 1BI0A 5C42A 1MG7A 2RNAA 2ACMA 3JSBA 1YRXA 5FWBA 1KDNA 2QYGA 3RB4A 2RI3A 1JLCB 2B4PA 3FJPA 2R8GA 3AY0A 2RH3A 3OFGA 3H0PA 2AJ4A 2GIFA 1Q81U 1CSJA 2P6TA 4ILRA 1N5QA 4NLPA 2ZWOA 3CJ5A 4OLPA 3TYTA 1QVFR 2Y1RI 2FYKA 2XMMA 1T02A 2W9CB 4J6YA 1YX2A 1O6XA 2HWHA 3BM7A 5GANe 2WSCE 5B0EA 1WZOA 1LK5A 4JI2F 1YIJT 4KSEB 3I5SA 1LXNA 2V69A 4DR1F 5A0YB 1Y4ZB 5LSRA 1KONA 1RT7A 3KJFB 2XMFA 5GAOm 1EETA 4TQRA 1IWAA 2AEJA 3G6XA 1WX6A 3FEYB 2L3MA 4DR5F 1UP1A 2KVQE 3UFCX 2Z58B 4EYIB 2IMOA 2DR7A 3WX8A 3CMET 2HQHA 1ZZNA 3D7SB 3G71T 3OTEA 2HHSA 5CO7A 2MPXC 1O9SA 2JLFA 4DBFA 4RW4A 4RCCA 1S12A 2C3YA 2LU1A 4M78G 1T3OA 3QWPA 4V19J 1X8DA 3VUZA 3A5ZB 2ZD1A 4J6XA 4F04B 1MROB 3RKYA 2X1BA 4Y2KA 4OI3A 3D3BJ 1HPZA 4OJ1A 4PWDB 1SV5A 2QFIA 4PJOA 2HL3A 2LEAA 2KI7A 3M32B 1LV5A 5C5JA 3FIFA 4ME7A 3VV0A 1M8MA 2RIJA 3NMRA 1FMKA 2CYZB 3DOMB 1G8XA 4ZPCA 2ZBCA 5HN0A 2DD5A 5KG7A 2KEAA 2DT9A 4TLQA 2LRQA 2V1QA 2WACA 3AAWB 2WHOA 1YIJA 3B4DA 3GYGA 2H65B 1BC6A 2UUCJ 2DH7A 2GQ2A 3I96A 1N9SA 1RT5B 2KKHA 2GHVC 1NO8A 1AZGB 2HYIB 2AT1B 3RKWA 3QSIA 1PG5B 1KSWA 1FWPA 3BFMA 1OV3A 1RHQB 1X9WA 3KBGA 2EFIA 4G3IA 4I67A 3M4YA 2YSQA 3L2RA 2OMLA 4U6PA 1IQTA 1YJWS 5I3UA 1BQMA 3I87A 2IIHA 2VPWB 4CNYA 3KUFA 3AA9A 3L9ZA 3MO8A 1F0XA 2J8AA 1F9FA 5KFWA 3TEHB 1KK7A 3EJMA 4ZLJA 2HZVA 1OQKA 4XPEA 3RUBL 5GANh 4CLSA 3O5TB 3EZOA 4NL2A 3DI6B 3HD2A 2GTOA 4XTUA 1IXKA 4M77C 2DD8S 3H20A 1GMVA 1GAOA 2XSJB 4FL6A 4QW9A 4NX9A 3GJQB 2D74B 2FGOA 3IGVA 3W8GA 4FXVA 5GMKa 2AF6A 2D3OR 2UUCF 4I2QB 3BB5A 1EQ0A 4DX7A 3I0RA 4N4IA 1RT7B 2DR5A 2MQ8A 1WQWA 4NMXA 2EG2A 1EETB 2QQSA 5CHCB 5D8HB 3EG9A 4C8QB 4M7AE 1C0TA 4F36A 3I55T 4RMOA 3JS9A 4DV4J 4ID5A 3Q8PB 4NS5A 3QZ5B 1LOJA 1N52B 4A4EA 2LQNA 2UUBJ 1HMVB 1RU1A 1S1TA 4NL5A 3PFOA 4AL5A 1VQOS 4C11A 4YB1P 4O4GA 1UAWA 4D3HA 2VDIA 1FWKA 3I9V9 4HA8A 1Q86C 2ZD1B 1WIEA 2KFZA 1Q1KA 3I82A 1HPZB 4HYKA 3G6ET 4GBQA 2K3XA 4AL6A 4DSIA 2KJWA 1IKVB 2HLUA 3MEEB 1HIYA 4PJOB 3MCAB 1B64A 2V8HA 4CO0A 1S76D 4DUTA 4ZJQA 4OLOA 3Q83A 5HBMB 3TSZA 2E5LJ 1VQPS 3QDRB 1G2BA 4TQSA 4DDFA 4Q5WA 1TL1A 4U7UK 4AD6A 4L75A 4Q45A 3LGHA 2R8JA 2WSFE 4ZDNA 4YB6A 1XN9A 1I0CA 3KK3B 2LMJA 4ZVOB 3ILJA 3T5HA 2QX0A 1AUDA 4DPWA 2HMIA 2RJEA 1LW2A 2FHJD 4DV4F 1NB2A 3MD1A 3GNGA 2BIVA 1X5OA 3MOZA 4K4ZA 4ANJA 5KFVA 5I3UB 1EX8A 2KROA 3JTNA 2DGSA 5JXSA 1JU5C 4I7FA 2B8PA 3R5DA 4ECVA 1R31A 1KOHA 3H4BA 8AT1B 4USMA 4UC4A 3GFHA 4F3OA 1YCYA 4EBDA 3EPIA 2AJ2A 2CNLB 1ZETA 2PMHA 2YY3A 2D9TA 4ZTFA 4DCPB 1Q16B 2CVEA 4J9DA 3KLHA 1S1UA 2Z4PA 4BE1A 5A8RA 2DNPA 3M8SA 1FEEA 4JJCA 4G1QB 2QA2A 5D4LA 2XGPA 2QLBB 1NXIA 4MK9A 5IOLA 4USWA 2XYHB 3HHLD 2QMWA 5FLXY 1XJWB 1G3OA 1JXVA 2YLBA 3EG9B 4BE0A 4M77A 2DZCA 2QQBA 2OI3A 1PAUB 2E64A 4B17A 1M5KC 3VAFA 2ZE2B 4M7AF 5K5MA 2J0QD 3NWGA 4L5GA 2DXEA 3TEGA 1S1TB 1YVFA 4O4GB 4AFZC 4A4KA 2FZGB 5IT9E 4P9SA 1Q7YC 1PCXA 2NPFA 5GAMd 3BZQA 4HCBA 2JH3A 4QJVA 3QXEB 3M5AA 1T03B 2DYIA 2N82B 3WQPA 3UD3P 1BBZA 3EHRA 1HQUA 1Y0HA 5AXLA 3K17A 1PBAA 3ITHB 1GBRA 1X9SA 1RSCA 3PCOB 2LCCA 1BQNB 2Y1LB 2GW8A 2ZOFA 2UXDJ 1TL1B 2E5KA 3T1HJ 1WKLA 1VQ5T 2LCLA 4EUVA 2AX1A 5CKBA 1UJ0A 1PKSA 3EE3A 2N7YA 2QT7A 4E7KA 3GWCA 3M8QA 4FF1A 4IKAA 2X7IA 3V8JA 2F4FA 2FRWA 1HSQA 2EYXA 2BTTA 4WJBA 5HROA 2YWFA 3H40A 3W62A 3HRSA 3RBXA 1R6VA 5KE2A 2HZYA 4M5KA 2QASA 4ZVTB 1NUEA 2DEIA 3ILIA 4CLLA 3NMZC 1T9TA 1U25A 1T9VA 1X31C 1X4CA 3E19A 4OF1A 2CQGA 2IA6A 4OYBA 2RI5A 3H8YA 3N5BA 2DAQA 4EO8A 2VJUA 3TR5A 4ZGEB 3PW2A 4USVA 5KT3A 2FHDA 3C46A 4C0HA 3J7AN 3OTOJ 3RNJA 3KLHB 3OTDA 3M9NB 2CWXA 1H6KX 4B9MA 4F16A 4XK8C 3PFEA 4C3KA 4M7DB 4EDUA 4HDGA 2UXDF 4DR3J 1ZH5A 3T1HF 4C8LA 4MZPA 1N0VC 1K8AU 2BE2B 1V5VA 1UJ6A 2WOMB 1QAIA 3EGZA 1YDLA 2MKJA 3P5TL 5KFQA 2VG7B 1VQ5A 2MDAA 5JVGQ 3HFNA 2GGRA 3IBWA 3PKYA 4NZ6A 1RT6A 3BDPA 4C0DB 2KL8A 2IFXA 1ZBXA 1XOVA 3P96A 2FTRA 2V9WA 2FC9A 4O0NA 3HHLC 3I4PA 4RX6A 1GFWB 1GRIA 3SDEB 2FJAB 5DDRC 4RW7B 4A8XA 1B0PA 1HHQA 2W10A 2YNIA 2NS1B 3JTPA 1K73T 1PSEA 3GP9A 2O4XA 2UV8A 3R7SB 2XS5A 4ED1A 2PDAA 3TZWA 1WHKA 4LRFA 1S97A 4NLOA 3IP0A 2ZHOA 1YCSB 1NJWA 1HWKA 2BKDN 1FXDA 2GAGC 4IUVA 3W2WA 2UUWA 2WW8A 3UR0A 1U8WA 3ZFJA 2EG1A 4V2SA 1RAFB 2MCNA 2HFVA 1Q7LB 2J7IA 2C22A 4J9FA 1IM4A 1SJ3P 4JYAF 4JUZA 5LJ5h 3OS5A 1M1FA 1H3ZA 4DR3F 2IM2A 1RWUA 3BPSP 2YTCA 4LR9A 1E6VB 1PC4A 4DUYF 1VLOA 2AZSA 3CCLT 1WJ9A 5HLFB 4MFBA 2POKA 2WVDA 2Q79A 3C6TB 2VPZB 4IUPA 4ZA1A 4W92B 1GXIE 3I9ZA 3FRNA 2DNKA 4UOCA 3IBCB 1H2UX 1MWZA 2CT3A 3M8QB 4BWJA 4ER8A 2AYMA 1VA7A 1VYVA 3CVKA 1D8YA 5LJ3d 2XSFA 1S49A 1RU2A 5HROB 1XWLA 1L3UA 5KCOA 4RR5A 5IQQA 2LCWA 5EN1A 2YWHA 3GTYX 3FC9A 1VQ6T 4YOEA 3PRDA 2DTJA 1RBLA 1Q5VA 1YJNT 4G1IA 3H5SA 1S4EA 2KR3A 5CIUA 2DY1A 1BCOA 4X65J 4ED2A 2I9SA 1MSWD 3NPFA 3RKXA 1D3WA 4PABA 3EDQB 4QCLA 1R89A 3CIMA 3TI0A 4M5JA 4O44A 2KXFA 5B09A 3FFIA 3R6LB 4Y2IA 4FU6A 1X4AA 1Y7PA 1SJFA 2UUTA 4F3MA 1GMWD 3CCLA 2R5AA 5L1LA 2QDYB 1KQ1A 4WFNQ 3CCEA 3TZYA 2CPZA 3CC7A 3PXGa 3CXCA 2AWZA 4CQ1A 3CJ3A 3H0IA 1BLUA 5ETTA 2CUDA 2V4RA 3OSSC 3ZZTA 3W66A 2VG6B 5D6WA 4DQSA 3HPOA 2LX9A 2H5EA 1LWCB 2JX2A 4RUGA 2NXCA 4OQJA 4C6AA 2SXLA 2YVSA 3TZZA 2A6MA 2DRKA 2VYTA 3G8TA 2YNIB 1YBAA 2O4XB 4CH0S 2BJ7A 2R7OA 2K1RA 1GL5A 1I5OB 1VQNA 1Y5IB 4J37A 4K2XA 2GQQA 4OYIA 3UCGA 5A6PA 4J9OA 1F3VA 2N7CA 1FO1A 4AXJA 2EFOA 2CJAA 2ZWPA 4X64J 4X65F 1YJNA 3JV3A 4DZ6A 4U95A 1D9FA 4DL4A 4O4RA 4OFZA 2L3SA 2NUUG 4K4TA 4C8QE 4M75C 3HHLA 2HK2A 2ROPA 1N32J 2Y4YA 5CYMB 4JRKA 2KXHA 1N48A 4WP3A 4HACA 2R7RA 1FX4A 2DEQA 2BACA 3L4BC 2CPIA 2CQ4A 2EIFA 4IOCQ 1XC9A 3QLHA 2HWIA 4CO4A 2ZAEA 4CC7A 4PFOA 3M9OB 4MFBB 1RHKB 2EXUA 1HNIA 2ADBA 4E8UA 1GH8A 2KBTA 1M1KC 1YITQ 5L8RC 3K5NA 1YJ9Q 2QA4A 3S1TA 2IA0A 3UN2A 4LF5J 4A8YA 4CH7A 1NJXA 4RNNA 2ALYB 4C5HA 2ADCA 4LF2A 1VQ8A 2GX8A 3TQ7P 2HIQA 4L59A 3OYAA 3RERA 4KAIA 1TS9A 2MWPA 3M2RA 3EAEA 2PFDA 2RHSB 1IBCB 2QC3A 4KHPJ 2Z2ZA 3QGGA 3C12A 1E6YA 1L3VA 4X64F 3AXMA 2XHWA 5ETPA 2K4YA 2OD6A 4RTWA 1VQ4Q 2OO4A 1M8VA 1TELA 4WFZA 3CJ0A 4PWWA 4DS4A 3NGDA 1FMWA 4C8YA 2DE0X 7AT1B 2IVFB 2DVEA 4LF7J 4IUQA 1K0SA 1RT2B 3QGPA 2LLZA 1YBUA 2XNRA 3G6YA 1CKBA 1X4EA 2YNHA 2DRAA 3QT8A 4C0BA 4HR2A 2DTIA 3PO5A 3EDRB 4O44B 5I42A 3FKBA 1I94J 3EHQA 4LDYA 2Q6BA 1B7YB 2QJ3A 1NNDA 1U2RA 3RW7A 1VQKT 3PYGA 2K3BA 2KFNA 1P6TA 3VAJA 2QEXA 4LF5F 4BE2A 2DK2A 4IKFA 2XZWA 3H2VE 3BN4A 4Z7YA 3SIPB 3T1YF 3QJLA 2YKNA 2ZNZA 1T05B 3AT1B 2BKNA 3FC3A 3E8OA 1KQGB 5F3TA 5HVFA 1U1OA 2XEXA 4ZLNA 2P0PA 1Y3JA 3MDFA 4L3KA 1JJCB 5GAEU 1SQEA 4PKDB 3G4SA 5IQ6A 5GANf 3AJ2A 2BE9B 4OI2A 2MAMA 3E1SA 5DGAA 2HNDA 3MUMP 1IO6A 3W64A 3J7YI 2HVEA 4NLUA 1SL0A 2C3OA 1MMLA 5F0WA 4LF7F 5DJBA 4URSA 2JZ2A 3UQSA 1UGPB 1X43A 2LP5A 3HHLB 2YXYA 2CP5A 4KYZA 3PR4A 4IOBA 4RWWA 2PMZD 1ACMB 4KBIA 5D0HA 1A7GE 1I94F 3MJXA 2EGEA 4HACB 3ZC4A 2F8EX 4C8QF 3L2ZA 5IV3A 4ECZA 5GAOn 2XMWA 2EBEA 3WVEB 3W1YC 3UW1A 1VR6A 4C8QG 2EYZA 1MU2B 1VQKA 1NHKL 2DMOA 4C92C 4DCJB 1TG0A 2AIRB 2WRMA 4QBUA 1HBNB 4WZMA 3G7ZA 4M75A 5J2PA 3R7BB 3WDOA 1MMAA 3KLFB 1RTZA 3GONA 1F1BB 4MKYA 3GJRB 3AOAA 3OL8A 2CUYA 2HSEB 3E3XA 1UPPA 3W63A 1YJWT 2B5JA 3LP1A 3M2RB 3JSRA 1QW1A 4N7TA 4PJOF 1AUSL 1H7XA 4LSNB 5H9EJ 2K3KA 5DRKA 2HHVA 4OZ0A 1E6YB 1B70B 2GAHC 2I8EA 4HVVA 4PJOG 2UXBJ 1RT1B 2KHCA 1BCMA 1QVGA 3H7HB 1AXQA 1G3YA 3QPIA 3R97A 4ZVPB 1MV0B 2JFKA 3PR5B 5KH6A 2KJVA 1CJKB 1BQXA 2MZSA 3W8PA 3JCMh 3IM9A 2YNHB 3CXCR 4K4UA 3SSRA 5IC6B 4LRDA 3NTKA 5I42B 4I6YA 1S1VB 5D4PA 2ZPBB 4M4ZA 3LP0A 3P4UB 1VYTA 4QR1A 1M90C 1CJVA 3LPEA 4OGCA 5DDPC 3T5KA 1XTDA 4DV2F 5GAN8 2PI5A 5FROA 1NK7A 3AQOA 1JKHB 4NLDA 1VIEA 1Q86U 4FSSA 2QMUB 3LAMA 1OPZA 2CNOB 3UCZP 4EBEA 4DU8A 2FY1A 3M6UA 2YRCA 1GXLA 2KE9A 2JFDA 4X1VA 2BE7D 5MAOA 3UN5A 4ZP7A 2HNDB 4RBUA 1CJTB 5CYQA 1I8FA 4IO9Q 4F4YA 3KYLA 1FRJA 1WHVA 4J9HA 3LF0A 2HVDA 2HG4A 3MM8B 1ZLMA 1U8SA 3PYDA 2LDYA 1WXBA 4CNZA 1U2CA 3BEGB 4Y0FA 3HULA 4KTQA 5KYYB 3NP5A 4UOFA 1S6PA 3OTBA 1NZAA 3GV5B 3IMQJ 3OVAA 4ZGJB 2B7CB 4OI0A 5DO2A 2HAXA 3K59A 4FIBA 4JI1J 5C7PA 4X4QA 1HNVA 4D6WA 5MLCV 2EWNA 2F63A 4E7SA 1FD2A 4IURA 3L2WA 3GYNA 2Z0GA 4YHHJ 1ZPVA 1PJ7A 2V2VA 4DFMA 5HVHA 2YWGA 3OL7A 2LQBA 1M90T 2XKOC 4QKUA 1KHIA 3MM9B 3JAMU 2BX6A 4ZP6A 1B34B 3EZ5A 3OXFA 3F56A 4PG4A 1B99A 3DRRA 4P71A 3GIMA 4ECSA 4C92A 4CZCA 2LA4A 2QQ9A 3U7JA 5HK0A 1LWXA 2HHTA 1M5PC 1OWXA 3GIJA 1OJ4A 3M4XA 1HD3A 3GV7B 2HVIA 2DF6A 4AQYJ 1NKCA 5GADU 1RAOA 1X69A 4NLGA 3QO9B 4QQ6A 3OYBA 2DX1A 3DRPA 4OI6A 3RAQA 3OPKA 2K79A 3CCVS 2LT1A 3VAMA 2HBYB 1FYNA 2M0YA 2EC0A 1CJVB 3ZZRA 1KTQA 1S72A 2F8HA 4KBMB 1TL7B 4UOHA 1YHQA 1VBZA 2QIFA 1Q7YU 2M0GB 3BDEA 1WGSA 2EI5A 3BE3A 3D0HE 3QPHA 3DDNA 4YHHF 2RDDA 2XZTB 1NLPC 4QQBA 1N4LA 1V29B 5AT1B 4M5NA 1X5SA 2CA9A 1Z1ZA 1X2KA 4N47A 5ETRA 2IPOB 3JXOA 2IY5B 2M7SA 5KYNA 3L2QA 4M7DF 1HW8A 5HI7A 4ZN1A 1M2VB 2W24A 3PACA 2D7SA 2RDIA 3UDLA 3SV4A 2H1YA 2FY8A 3S6EA 1RTDA 4M7DG 5KFJA 4AQYF 2J9DE 3J7AF 2CS7A 2KRMA 2HMAA 5KFMA 4X4OA 3A1PA 5KAKA 4HHJA 3UE2A 1L3TA 1KN6A 1YITS 5EHHA 1WOSA 2KH9A 3MPWA 3CDUA 4PNOA 2Y1JA 1YJ9S 1YIJQ 1UJ5A 1S6PB 1BIAA 1PRMC 2BXJA 4FXWA 2MK5A 1FK9B 2E29A 4EZ6A 3QKJA 2QFJA 5LXYA 5CQYA 1V3RA 2X3GA 4L6V5 4C5IA 2EKOA 2IRXA 5GMDA 1WQ7A 1CVJA 4DBHA 1DLOA 1CSKA 1HNVB 1XNRJ 5B0DA 4F7UA 3OYNA 2K7AA 4C0OC 4J9QA 3FB9A 1OOTA 5A0GA 2DNZA 1VQMA 3QG1A 3HJFA 1QVGR 1M1KR 3T6JA 3QWXX 5GAHU 4PXEA 4OMNA 1VQ4S 2EBPA 1TKTA 1PM3A 1RAIB 1IKXB 2B56A 2F3JA 1TU0B 5DLGA 5D6YA 3B54A 4I56A 3PMTA 1I4K1 2Y3YA 3MM6A 2G1DA 3I5CA 3JCMQ 1OY8A 4QZVB 2JC1A 2HFNA 2G2YA 4FZVA 5LJ5f 2OIHA 2L3QA 1HI8A 2JSXA 1SHGA 2RHXA 4PXBA 3P8HA 2LA6A 5AXKA 9RUBA 4OX8A 1S6UA 4UW2A 1NK6A 4PAAA 5CVIA 1Y57A 4CLZA 3V4MA 3NNAA 2NSCA 2C2KB 3DRPB 2AU0A 2B9YA 1FRKA 4DR6F 3Q22A 2XCPA 2ZGWA 1JLBA 1WDXA 4DV0J 4N77A 2QL9B 1VCTA 1OSCA 3O8WA 4OHZA 3IC1A 1PKUA 2DXTA 1XNRF 1RB0A 3RW6A 2NUTA 3MUTP 1N36J 5DLOA 2DPPB 4JI8J 1WTBA 3TVYA 3ZTQA 3MEUA 4WE1A 2W2PP 1RABB 2B4OA 4XAXB 2H5JB 2ZEJA 2ZM6J 2B43A 3RAXA 4QOTA 1C2PA 3NCRA 5KG0A 2IAJB 3SWNC 3DMJB 2G6FX 3MMCA 3CJKA 4TYAA 1WSVA 1JMTA 2WONA 2K5FA 4I69A 1R6YA 2C28A 3KMSA 3DLEB 3CULA 3GSIA 2JS2A 3OW2A 2M16A 1N27A 4X66F 4R0JA 2FEIA 2VFUA 2GMJA 2ECZA 1QUVA 3ZBDA 3GG0A 3QAEA 2CQ1A 2G9OA 4V1Ak 3U1NA 1QCFA 4E7IA 2A1BA 3CD7A 3TVKA 3CPWS 3SSQA 4D8DA 5I4MA 4DV0F 4DL7A 5KT5A 4OHXA 2HHWA 1FJEB 2H3JA 3M4GA 1K76A 1UGVA 2ATLA 2FG0A 3ZZOA 3H5UA 2PSZA 2F2XA 1H98A 4WPAA 2X35A 4YUDA 2IJRA 3JB9k 1N36F 1KIKA 1DLOB 3CC2T 4F7UB 4JI8F 3OQ5A 3FQKA 2Y4XA 3SFMA 2E1PA 4CCHA 4B3OA 2UV8G 4PWUA 4DPUA 1R0AA 3MP8A 4KV8A 1RTHB 1WACA 1YWOA 2EW9A 1RE1B 2ZM6F 3K5MA 2OTLS 4USTA 3NBPA 1FX2A 1RBAA 4XAKA 5HMYA 2XK0A 4EMKB 4UTGA 3AJDA 3CJRA 2EEYA 1J5EJ 1WORA 4ZPTR 5U47A 2YUOA 2RQVA 2KDSA 3QAUA 1BIBA 4DEXA 4DXLA 2I2YA 3INZA 3NY0A 1R8BA 1RT3A 3X28B 2E5HA 4PUOB 4HDHA 1WHGA 2KT1A 4A4GA 2A18A 4RUBA 4WK1A 4W98A 3E01A 3C8YA 2BJ1A 3VYGA 2HBQB 3HFZB 3SEOA 2D8HA 3JCMW 3GSDA 4USKA 1IRXA 5IM0B 5D6GA 3NGKA 5EWEA 4CRIA 1SC4B 3LX7A 5ETVA 3TUIC 4R5PA 1N8RT 3JRZA 1HNXF 4LSLB 1MWYA 3GJTB 2OSQA 1X5TA 2NUPA 3CC2A 3KJQB 1RCOB 1CC8A 1HWUA 4YMEA 1TH7A 4MK7A 3EVWA 4WE1B 1BWEA 2PFFB 3GR0A 4J9EA 1H2VZ 3J81U 1J5EF 2KZZA 3G86A 5CZXA 3GOXA 2VBXA 1AT1B 3AQPA 3MMCB 3CJKB 3WIUA 4DV1F 2WONB 4Y2MA 2ZJRQ 5CAAA 1KFZA 1J5OA 1SJRA 2R7XA 2RO0A 4HL9A 2BJ9A 3H8ZA 2C0TA 3C4SA 2RSQA 1TK0A 4ZOSA 1PKTA 4DPOA 4QQDA 3FVYA 1M1HA 4UZBA 1M1KU 4V19X 4DV5J 4IFVA 3FSXA 1K9MC 4LSZB 3UDCA 2AYBA 2KB2A 2MB0B 4LUBA 3N6LA 2JEJA 4Z37A 3SWNA 2M9UA 2E5IA 1XR7A 1Z4UA 2V8VA 3M58A 1NBEB 2P84A 2RT3A 1HXDA 5HVGA 1WC6A 2CUBA 2JJ9A 3BGUA 3FCWA 4J5OA 2XYPB 1R0AB 4BHQA 1XMBA 3HHTB 2C2NA 4HCKA 1FDBA 5KFPA 1UB4A 3BS9A 5CXTA 2EJ9A 1X2QA 2DVJA 4E47A 2F7VA 2EQMA 5KFZA 2VXFA 4OZ2A 2WSCC 1R8HA 1WHJA 1TV6A 3W65A 1RA7A 2MQLA 1D8ZA 2E5GA 2LEBA 4Q5VA 1EP4A 5IHNA 1UGSB 3M05A 3J80U 2ASJA 2G4BA 1JJHA 4M7AD 1RT3B 2EBGA 2RU3A 4OV6A 3TAMB 4IIOA 3KNAA 3OYFA 2KZMA 5LSOA 2ZOGA 3E01B 2QQRA 2RS2A 2YWEA 3CCQA 2D69A 3BF4A 4L6V3 1K1QA 2QA4G 5LL6d 2DBMA 1U7LA 1YGYA 3GB0A 1VQ5Q 1DJ0A 3VQTA 4JJNK 1KD1C 4PYDA 4X62J 4KKOA 3DXSX 1IJFB 4PFZA 1Z2ZA 2V2QA 1K9AA 1OYDA 4LFCJ 1ARKA 2PO4A 1RHJB 2IM1A 1JXLA 5EG2A 3RRHA 2V8GA 5I22A 3ER0A 2FB7A 4ECWA 2P0QA 1JO8A 1Q82C 5LMUJ 4NCAA 2DNLA 4RNHA 3BSOA 2VQFJ 2ZH3A 1NPRA 4BBYA 3F70A 3R5AA 3LGLA 1Q81C 3S3MA 3NGTA 1GTHA 4Y65A 3LGNA 1GMUA 1WTFA 4QU6A 1J5OB 4ICLB 3JCMf 4WYLA 1YIJS 2J7KA 1JJ2A 4M1KA 1VQLA 3ET6A 2A37A 1C1AA 5IFMA 2YH0A 4ES2A 1U6ZA 1BWVA 4ZTJA 2CQCA 3ENWA 4N4GA 2HNZA 3TCJA 4W4MA 4RW9A 2KM8C 2A3JA 4ZHRA 4TU9A 3I0SA 2IYGA 1SC3B 5KYXB 4X62F 4ZLLA 2I2LA 3Q8QB 2G13A 3N79A 2AKWB 2KG0A 2ALZA 3ELHA 5JVHQ 3Q2TC 1KFDA 1N88A 4ILLA 5GAOl 4FM4B 2B0GA 2P9EA 3RAMA 5GAMg 3NGPA 4FPRA 5GJVB 2FYXA 3F44A 3CJ8A 2FLOA 2G0JA 1KEKA 3EG2A 2CQHA 3G87A 3I35A 5LMUF 1C0UA 3GPLA 3URGA 3MCNA 4ZP9A 4Q2MA 2VQFF 1G2EA 3TO8A 3TQEA 1RTJB 3H98A 5B0BA 2V2ZA 2J7WA 4OMQA 5CABA 1ZQ1A