2YWWA

Crystal structure of aspartate carbamoyltransferase regulatory chain from methanocaldococcus jannaschii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
141
structure length
141
Chain Sequence
KVKKITNGTVIDHIDAGKALMVFKVLNVPKETSVMIAINVPSKKKGKKDILKIEGIELKKEDVDKISLISPDVTINIIRNGKVVEKLKPQIPDEIEGTLKCTNPNCITNKEKVRGKFKIESKNPLKIRCYYCEKFLNEVIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aspartate carbamoyltransferase regulatory chain from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Metal binding protein
molecule keywords Aspartate carbamoyltransferase regulatory chain
total genus 31
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
A PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 2ywwA02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 2ywwA01
2HSEB 1RABB 1RACB 1RAGB 3D7SB 2H3EB 1RAFB 1ZA1B 2A0FB 1ZA2B 4KGXB 1TU0B 1ACMB 1RADB 2BE7D 9ATCB 2FZKB 1RAIB 5AT1B 2AIRB 2QG9B 2FZGB 1RAAB 4FYXB 6AT1B 1PG5B 1AT1B 7AT1B 1XJWB 8AT1B 3AT1B 4FYVB 1SKUB 4FYYB 1RAEB 4FYWB 4KH1B 4E2FB 2AT1B 1Q95G 1R0BG 1NBEB 2QGFB 1EZZB 4WTOB 1D09B 4KGVB 2ATCB 2YWWA 1R0CB 4AT1B 4F04B 2FZCB 1TUGB 1TTHB 1I5OB 2IPOB 4AMCA 3MPUB 8ATCB 4KH0B 1F1BB 2BE9B 1RAHB 4KGZB
chains in the Genus database with same CATH superfamily
1BIBA 1ZA1B 2KROA 4DSKA 2AYMA 2LU2A 2QDLA 3DOKA 4DBQA 1U5SA 1F0XA 2DX1A 3DCAA 3E9GA 2XI3A 2EFOA 2VFTA 4UT4A 1IKVA 3CCMQ 4BC9A 2HQEA 2DHGA 3W5XA 2XZTB 5KG5A 2XY6A 4FSSA 1M1KT 2VG6A 1M90C 1RHUB 4KHPJ 1M3BA 3LUYA 3GG0A 1Q79A 2B9EA 1B3QA 1QKWA 1QVPA 3T5JA 2ZOGA 1UHFA 2NYIA 1TL1A 2K8GA 2HHHF 3M6VA 1VQ7T 1LKZA 3UQSA 3MM7B 2XO6A 2J06A 1HBNA 4NLOA 4GVBA 5KYXB 4IYQA 2JN0A 2ZC4A 4OI6A 4RCCA 3M6WA 3J81U 3C12A 5BR8J 2PGCA 2KFZA 3OLAA 5KYWA 4CYUB 1UG1A 1SHGA 2A3LA 2LJ0A 1C6VX 1XOVA 4QQGA 2P0KA 2GCXA 4QQBA 1BCOA 1XTDA 4TNOA 4DPTA 4QU6A 4DR2F 4LREA 2P0PA 2JC0A 3ILLA 2XS2A 4BI3A 1HQUA 4BE2A 2EFNA 1WTBA 4QR2A 3V6KA 5KFFA 4JDSA 3NRBA 5IAYA 3HFNA 1UVKA 1N8RR 3R6LB 4DX7A 3LTOA 3JYTB 2AX1A 3QPIA 1SHFA 2B56A 2HURA 1U6ZA 4GO7X 3GQCA 4DLGA 1KLMB 1RHMB 2GJIA 4J90A 2CP0A 3C0CA 1XC9A 1P92A 2DNLA 4OX7A 1MSWD 1YJWQ 3GLJA 3K5NA 1S1NA 1VHFA 3BBBA 2F3JA 4DUZJ 1FRXA 2BDPA 2DPPB 1SKRA 5FJ4A 3CCSA 5B0DA 1VBZA 2OSRA 2V34A 2YDLA 5AXKA 1VQLA 2VPYB 2EPDA 2A1BA 1O75A 2KG0A 1PWTA 1J2VA 4PWDA 3ZL7C 3CDBA 2BJ9A 1S4FA 4WU2A 3UW1A 3MM6A 2HEQA 1TMMA 2CDTA 5A0DA 1CJTA 1M9SA 2SEMA 1BGXT 3ISND 1TP7A 3UDVA 1G2BA 2NXUA 1PAUB 1NDLA 2MGZA 1PSEA 4C8MA 1TKZB 2R8KA 5KG6A 2L3RA 3ILJA 5HLFA 4M7DD 5HQMA 5I3QA 1I51B 3BH7B 4UTGA 4JYAJ 2XGPA 4P6QA 2XMUA 2KFYA 5D6YA 1HHSA 3D6MB 3K5OA 3DHXA 5I42A 1MWYA 1F2HA 1YITS 4UOFA 4M77F 3CMAT 3OTEA 5A2QY 3SSRA 1RAHB 2KRBA 4C3LA 3KHGA 3VS1A 2HMIB 2A18A 3IG1B 4H4OA 2KHDA 3MCMA 2MZSA 1W1FA 3G4SA 3C14A 4OX9F 3SWNA 4KSEB 1FT8A 1ABQA 2KRSA 3HVWA 4HH1A 2P6TA 3CCMA 3CCTA 5GANd 5KFTA 1E6GA 2GJ2A 5J2PA 1YQHA 2BR0A 3NCQA 5G0RB 1YI2A 3UN5A 4C8ZA 2KDOA 1FESA 3QLHB 4ZHRA 3I35A 4M7AC 2CVEA 1HKAA 5HJXA 1RYSA 3J7A1 1HBOB 1A7GE 4FN5A 3A8OB 3I55Q 1CSKA 1YJ9T 4K5SA 3NS6A 1UWBA 2LKZA 2LQJA 3JSCA 3D9BA 2KT8A 3LW5E 1VQ6T 4ILRA 5E3CA 1GRIA 2V8GA 5A6WA 1QVGA 1ITPA 4B9LA 3HP6A 4Y28C 1HWIA 1VRTB 4F8RA 5KFXA 1RAGB 3KHLA 5I4MA 5GAOp 3OVBA 1TFYA 4QPXA 2CZVC 2NZCA 4LSLB 3QZ8A 1VI7A 4Y0FA 1SC1B 1D8ZA 2CQ2A 3DLEA 4GVLA 5J1PA 2DNHA 2ZBCA 1M2VA 2O88A 1MMNA 1S1TA 3MXHP 3VJPA 2QA4T 2YKQA 1SVDA 4DL5A 1UW9A 1DURA 2NUHA 2JMCA 3UA6A 1PRMC 2KY9A 1Z1ZA 3PO4A 2G1DA 3KMQA 2DH8A 3JCMg 2AJQA 2DIUA 4JI3J 3MEGA 3OLBA 4OX9J 2GGRA 3VCDA 2MKSA 1W2BS 2COLA 2WK4A 1TL4A 2W9AA 3PR5B 1DQ9A 5DLOA 2BTTA 4JB8B 2EC2A 1SJFA 4YEAA 3TJ8A 5J39A 1VQSA 3JSRA 4H54A 1OPKA 1QWFA 1NH8A 2ZVSA 1Q7YC 3E2EA 3Q8UA 1Q82C 2KNBB 2UV8A 4CWBA 4CLTA 1FEEA 4YR3A 2QYCA 1IZ6A 1Q78A 2HK2A 5KCOA 1M90T 5LJ5Y 1TL1B 3LALA 4R55A 2JVVA 3C66A 3TUIC 2Y4XA 4PJOC 5LJ5j 2QG9B 2R3VA 4X84A 3GFXA 2VQFF 2X4WA 4HT8A 2RJFA 5GAMg 3BH6B 1S7HA 3IRXA 5GANe 1EP4A 2PMZD 2HFNA 4H4KA 2MZJA 2MKYA 4ETZA 3ZTQA 2XM3A 2E5HA 3LWIA 3JB9H 2AJ1A 1F9HA 4M78D 4C92F 2NCKL 4BCAA 3ZXWA 1RJJA 4ZCLA 4DX8H 3JCMb 2HIQA 3LF0A 2V8VA 3LGNA 1T3OA 3VR1A 1S99A 4DU8A 1RTJA 4A4KA 4PPDA 1NDCA 1RB0A 2FC9A 1Q5YA 2B43A 3EVOA 4EBCA 1KVKA 2W7AA 4XTWA 3QT7A 1B7YB 4ENOA 3JB9D 1IR0A 1DRZA 1FTRA 4PJOB 2M8HA 2HHXA 3HVTB 1X8DA 5E2QA 4WJBA 4ES1A 3DLLQ 2DTHA 3PGGA 2F4FA 1H38A 5J1EB 4JI7J 2BKDN 1C1AA 2HNZB 1F5AA 2DY1A 4WZQA 3TA2A 2CQ1A 4N4GA 3JXOA 3GCWP 1ZUUA 2E7VA 1YP5A 1D8YA 3VZHA 3V4MA 1J27A 1GH8A 3OXGA 2GVDB 2DZ9A 3MR2A 3JRZA 1IM6A 2DHXA 4DQIA 3W2WA 1ZH5A 2D3ZA 3HCXA 1T05A 4K59A 4NCBA 1F3VA 2ASDA 2FRYA 5LXRA 4KH0B 1JKHB 4URSA 3D4JA 1JKHA 5DQGA 3SCKE 3UE2A 2L08A 2W2QP 3E01A 3QIIA 3F56A 1H3HA 1U47A 4KE5A 1O5JA 3OYHA 3BR8A 3PM9A 3BBCA 4DFJA 3SWNC 1U2FA 4M5KA 4NCGB 3GFYA 4DCJB 3JAME 1I5OB 1X6GA 1PKSA 3N01A 4XPEA 2MKIA 3TUZC 5L8RE 3GIIA 2L89A 3W61A 5J2NA 2YQ1A 6AT1B 2MSTA 2EBGA 2R7QA 3BO2A 2ZD1B 4RPFA 2VFVA 2QX0A 3OW2S 2MHNA 3OT9A 2IY5B 5GAN7 2MTLA 4ERDA 1JLEA 2MPXC 2DGSA 4NL5A 4N47A 1NHKL 1FJ7A 1M30A 1HPZA 5HROA 5IWAF 2LYVA 3HSBA 2DO0A 2YVSA 2KI7A 1C0TB 1IBKJ 4FYVB 2M0YA 3KK2B 4M7AB 1JU5C 4QIVA 4R5PB 5LXYA 1FJEB 1UFFA 3V7RA 2B9YA 2KZMA 3NWRA 3EPGA 4OZJA 1OY8A 4DR7J 3KLHA 1OO0B 1HNZJ 4M75E 1RT2A 2VUBA 1S1VA 3HVRA 3BSNA 3FKBA 3Q2TC 2VONA 3HVTA 2WONA 3QKJA 2DK2A 5DDPC 1XNIA 4DV6F 5I2SA 3RBDA 3J81j 4E7SA 4WFAQ 2XGQA 5IS2A 4LBHA 1U0HA 1F6TA 5MAOA 3BO4A 1NKEA 3QIDA 1PCXA 1X4CA 2H65B 4PK4A 1JX4A 3DRSA 1VYVA 2M16A 2MI6A 1TKXA 2KT3A 3PRBA 4Y2CA 2DO3A 2QIFA 4OMNA 3EM1A 2ZH5A 5L23A 5KT7A 1S77D 4PG5A 5DETA 1S9FA 3BQ2A 2OPRB 3ILIA 4M78G 1TMJA 2E5LF 4ZVHA 4NE9C 1LK7A 4PXCA 1B34A 2XD0A 4A8QA 5GMKm 1BD6A 3MAQA 4HHUA 4KRWA 4P74A 1VQPQ 2PA3A 2XSJA 1EKSA 4O0IA 1NB2A 3K57A 4O3QA 2XKOC 1VQNQ 4DV5F 4BHQA 4LIRA 5A0GA 2RD1A 3PIOA 4GO5X 2VG6B 2B8QA 2QYZA 2JEGA 4DCOB 2UU9F 5L39A 1YCYA 5L46A 2ZBPA 5F3TA 1VQOS 2AU0A 3R7SB 1VQKQ 3RR7A 4CLYA 1HMVB 3A1PA 4DV7J 1HLWA 3V6JA 2BE7D 4JBCA 4GLKA 5CKFA 3FEOA 4OI1A 3TI0A 2DYBA 1U6BA 3IN5A 8AT1B 2HQ3A 4JS4A 3F73A 4IG0A 2WSCE 4FL6A 2EQIA 3GONA 5HMYA 2K79A 5B0FA 1NNDA 1S79A 2M8DB 2CSIA 1YITA 4PABA 3MEUA 3E1SA 2HZAA 3TAQA 1BXNA 4ZJOA 4C98A 2RVJA 3MHYA 2CWXA 1TOVA 5AXMA 1KWMA 5HP1B 3CCQA 1HNIB 5KFKA 2EI5A 4ZN3A 4B9SA 4OI4A 1QLYA 2JH3A 3UDCA 1KC8C 3CCJS 1WHKA 4GBQA 1IHWA 3CPWS 4DS4A 2CSQA 2Z4PA 1K73R 3M30A 5THWA 2V6AA 3TVYA 1JIHA 1FDBA 1NM2A 4O3SA 3SSQA 5A0LA 1RABB 3FJPA 1T95A 1UE9A 1AZGB 4RG8A 2BZ2A 2LA6A 3M56A 3GFZA 2LXIA 5GMKa 2KM8C 1V5IB 3FMWA 5CABA 1JB0E 1P27B 1PNJA 5F9LA 1FKAF 4J9DA 3AQOA 2HFOA 1PJ7A 4OYIA 2L41A 1V3ZA 2VQEJ 2X3XD 2O4XB 3MWBA 2ZH2A 3LP1B 4LIWA 4ZLJA 2QAZA 3PJWA 3JQMA 1W7WA 3DN9A 3K5LA 4A8WA 1SUQA 2Y1RI 2YT6A 3GOXA 3M6XA 4K4WA 2ZC3A 1JJ4A 4OFZA 1HBNB 2H4YB 3DI6B 5HVFA 4X4TA 1U45A 2W8KA 1REVB 5HP1A 4PJMA 4LF7F 2V8JA 4J9NA 3S7RA 1WEZA 4ILMA 2R8IA 2H48B 4O4GB 4M7AG 1Q0NA 3D0GE 2W01A 5DG7A 1OPIA 2J7WA 1W2BA 2BZXA 2RQKA 3IP0A 1RA6A 3G4SQ 2LFVA 5KG2A 4JI4J 1N4LA 1PYSB 4N77A 3TVKA 4C11B 3CW2C 5GMKi 2ZOMA 4FF3A 3VAFA 2C2DA 4DDFA 2BQRA 1T9VA 3THPA 3SB2A 1X4FA 2ZKUA 4RWWA 2R5MA 2QMUB 3OYKA 1WFWA 1VQMS 1FJCA 2VICA 3OYAA 1FX4A 4M78E 4B3MF 4OX8A 3PJXA 2CP3A 4RW8A 1HYSB 4HCZA 4FPIA 1TAQA 4QR1A 3R8YA 1NJXA 2IDEA 1FKOA 3MOZA 1WI7A 2GQVA 1OOTA 3OA6A 1FVQA 3CBOA 2XY5A 1UEVA 4QWEA 3J81E 2HFUA 4JUZA 3PE0A 3D0IE 1T0HA 4J9FA 4HTIA 3MZIA 5A8RA 1GX6A 2W2PP 3T5LA 3VF0B 1TWBA 3JTPA 4KKOB 5AYFA 4Y2MA 4PYDA 3MUMP 4ATOA 2F8HA 4USIA 1F3FA 4M95A 3FBBA 2ILZA 4F16A 3P5BP 2XWYA 4PLLA 3VTIA 4C2MA 3IR5B 1HW8A 2FLLA 4J9IA 2YNIA 1WG4A 3SHWA 2X7IA 1JO8A 1BQNA 2C3YA 3DLEB 1FHTA 4QT7A 1FNXH 5LJ3f 2VFUA 4LUBA 2HL5C 5LT5A 1YN8A 1UETA 4TQRA 1HD0A 4AL7A 3DOLB 4C7QA 4WU3A 3TEEA 4NLUA 1SJQA 4DA4A 4NLWA 4I7FA 4NI2A 1D1BA 2FVPA 5IXUA 5EDWA 4L73A 4YY3F 3KDNA 1ULRA 4YHHJ 4H4OB 4WFYA 3CQTA 3MEDB 4DEYA 2ZAEA 4RW4A 4LF6F 1T3SA 3CCLT 3EG9A 3I5SA 3EVMA 2G1HA 2XZDB 4F7UB 1YRUA 2OX7A 3ZEHA 4C8QF 5IV4A 1UUEA 3KUGA 2RS8A 1QAXA 2QE5A 1CKBA 4MMKA 3IR6B 3DM2B 3K5MA 4N4HA 3SQGA 2QEXA 1R8HA 2N82B 1QQJA 4JI8J 1CC7A 2CZ1B 2K2MA 2MLYA 1FMVA 1UZDA 5KFOA 1R0BG 3GPLA 3OS2A 1B64A 1G5VA 3M8PA 2VFRA 1VISA 2E44A 4U67Q 2MB0B 2YKMA 1OS5A 4RTYA 3V8LA 2FHJD 4TLQA 4EZ9A 2EBEA 1SH0A 1KQSS 1ZOTA 2ACMA 1A9NB 4IIMA 3PV8A 3FRNA 3CWJA 3GYXB 1HBOA 1EAYC 2J8SA 4MK8A 2R7WA 1SPKA 4F26A 4J6YA 4MH8A 4E7ZA 2E1HA 4DSJA 5J2MB 4CLWA 1NSPA 2MPUA 3RKYA 2QQRA 3M57A 3TX0A 1VQOT 4F4XA 1YITT 5GAOq 4CC3A 3I87A 1SG5A 2F2WA 1NXIA 4RW9B 1S0NA 3VAMA 3H2VE 3KUEA 1Q81R 1SI9A 1EKRA 2Y90A 1TELA 2EKYA 1MMGA 1K73T 2UZAA 3N4WA 1BE4A 2DXBA 1N8RT 4F0MA 3PR4A 1Y9OA 1W25A 1S1WB 2V8KA 2RHZA 1VQ5A 4A8KA 1ARKA 5GADU 4DSIA 3VGVA 1L3UA 1DTTA 3SEMA 1R0AA 1PYTA 3US5A 1S6OA 4HKQA 2ZBIA 4X65J 4EU0A 3PY8A 1DQ8A 1LOUA 3R5GA 5HMWA 2DXFA 3MECB 2CADA 3T1YJ 2J6KA 2CKKA 3CCSS 4ZPDA 5DG9A 3NLCA 4GC6A 3MM8A 1K1ZA 2QA1A 1ZPWX 2JOYA 3NWGA 3ZNUA 2KK4A 2VUGA 4QKUA 2NYHA 3KG1A 4ECTA 4CM2A 2ASYA 2N3LA 3BDUA 1K47A 2WOMB 3HFKA 3V4IB 2WRMA 3FCWA 2RUSA 3LANA 2E6ZA 4J7IA 4OX6A 3X26B 5E33A 1CEZA 4LD6A 3AOAA 4ZVSB 5KFBA 2YWWA 2CKWA 4H4MB 2DBKA 4JLGA 3D6TB 1UVNA 3EJMA 3RB6A 3CULA 1RZMA 2HHUA 4I56A 4BY6B 1M1KR 4JJDA 2RU3A 3QYHB 2FG0A 2FB7A 3IS9B 4IUUA 4EMHA 4BWMA 4ORZA 3ITHB 4M7AD 2Y0SD 1T8EA 4KGKA 1UVLA 1UEBA 4EBDA 2OTLA 2FJDB 2HBPA 4NYZA 4Y34A 2VC1A 2RRNA 5M2RA 5K8OA 5FROA 1HNVA 2K9GA 3R6NA 3VS4A 4ELZC 2VGMA 2VDHA 1D9FA 3CCVA 5D8HB 1NB7A 4JI0J 1FTCA 3V6DA 5M9OA 4IQXA 2LMIA 4WYWA 2GBQA 1ACMB 1HNWF 4RLEA 2ASJA 2DILA 4ZCKA 3KKFA 3RRGA 1Y5IB 1KNZA 3QBYA 3NAHA 3EGNA 5C24B 3ZZYA 1HIYA 4ECRA 1RTHA 1ZUYA 3AOCA 3CXCA 5C24A 2GJFA 3AD9C 2CJYB 4UW2A 3J80U 5DGBA 4DFMA 4PFOA 3C19A 4DV6J 5I2MA 3M9OB 3D68A 2AGPA 3L09A 1HNIA 1W70A 3EVWA 3QSUA 3NOGA 1FXLA 1VIEA 4O44A 3CMAA 4XAKA 4Q8EA 2ZOFA 5HKCA 1EHWA 4B9VA 1PD1A 4QWAA 2VD3A 4M1KA 2R2RA 4RZRA 3KFVA 3BDPA 3LP2A 4NCAA 2FGOA 1HWKA 3OTOJ 2WONB 2R57A 3B82A 3HSZA 1O8BA 2ENMA 4CP5A 5CKEA 1WEXA 4AFQC 4WK1A 2DEIA 2DPIA 3LO3A 2RDIA 2QSFA 2YKPA 4LUEA 1WNLA 4AXIA 1QSLA 2DJQA 5A0YB 1QTMA 4ELTA 3VQTA 4J9RA 2YHTA 2ZPIB 2GO9A 1MUZA 1HL6A 4LRBA 3FFIA 3HRSA 1P8GA 1WF2A 8ATCB 2Z57B 1U1OA 1ZSZB 2UXDF 2GQQA 3OYEA 3RG6A 1N6QB 4DV5J 3AXMA 2X3DA 2DK3A 4MJKA 2LLZA 1WSVA 2ZBRA 1RP5A 2E10A 1RT1A 1JQQA 1UWAA 1CQMA 1IWAA 2QLJB 2I2YA 4J7FA 4KHPF 4RTUA 1UGRB 3OR1A 3P4UB 2CJKA 4C8YA 3UVJB 4LF5J 1UHCA 2CPJA 2J6SA 3OBIA 4FVMA 4Q2LA 2FVSA 1OJ4A 3PJ9A 5EWGA 4GY5A 1WQ7A 2MQOA 3DGPB 2DKOB 3RAXA 5CYMB 1S0VA 3L2RA 2F1LA 4XO0A 4P52A 4NMXA 4C8LA 1MV3A 2E70A 1V76A 4AT1B 2JHEA 3W65A 1Y0MA 1FCAA 3BGFA 3CJKA 4XDCA 2RQVA 3RB0A 1YIJS 3JCMc 4M94A 1BBZA 2IJNA 2VOOA 2PVGB 2A6OA 4OMOA 3M2UA 1YKWA 4U7UK 3PCOB 1X75C 2DL4A 3BFMA 2KJVA 5ADZA 7FD1A 4LF8J 1OU8A 4LVOP 5DG8A 2BEFA 3QFWA 2P5VA 1OX8A 1E6VB 4HI1A 4M7DB 2F8MA 5GANf 4XU3A 5ETLA 2OTLQ 1ZAVA 1XMBA 1MV0B 3A1YG 3EGZA 1N5QA 2J9DE 1RYRA 2KHCA 1HSQA 1M3CA 3RR6A 4GRSA 1H74A 4JI1J 4ZLLA 2RO0A 4MMLA 1G8XA 1SJ3P 4CTAA 2H3JA 2W2NP 5G4DA 1I6JA 4NXMJ 3FEXB 2COZA 4CLZA 1TL5A 4ZPCA 2EW9A 1CLFA 2HIYA 4ED7A 3I9ZA 5IXBA 2E1RA 1YJ9S 2CQGA 3CPWP 5KFEA 4KGVB 2CT3A 3NBPB 1QVGP 4TY8B 3MMAA 2KXDA 1JMTA 1VRTA 1R3NA 2B0GA 2CPZA 2MKHA 2H5EA 3T41A 3BEGB 3TNVA 2E1CA 5EG2A 2VASA 1I81A 5LJ3Y 2RQMA 3EZOA 2GFAA 2ZZNA 4ECVA 3HPWA 2DNZA 5C25A 3QIPA 1VC5A 2J7UA 3KWMA 2U1AA 4J91A 2HRYA 5GAMh 5EWFA 2X4XA 3GNGA 5CR2A 2LCSA 4N8NA 5GAMf 4YY3J 1OYEA 3BGOP 2VC8A 4JI2F 3JQJA 1N32F 1C1CB 3JB9k 1JLBA 1W26A 1K8AT 2DITA 2WW4A 4Y2IA 4RX6A 2M3DA 1HR0J 2RQCA 2C28A 2BKOA 2AEMA 3EZUA 3E19A 4BE1A 1H98A 5FIIA 3H5UA 2DNPA 3IAS9 2GAGC 3FEZA 2E5LJ 3IC1A 1KQ2A 1X7VA 1I94J 4ED3A 1QAIA 3ETMA 5H9FJ 4DPXA 3L2VA 1ZSZC 2DIGA 2AW0A 3NTHA 4C5IA 1YGYA 3BYRA 4IQMA 3SQOP 1H73A 8RUCA 3MCOA 1TL3B 2WBMA 4V19X 3TA1A 3D6FB 1S9GB 4YN3B 2L3SA 1G2EA 2ZH8A 3MM9A 3S3NA 1QP3A 1CC8A 1D0EA 2W2MP 4PWUA 1S10A 1H72C 2R4FA 5KFAA 4M5NA 3K58A 1FX2A 2PEBA 1NK7A 1N27A 2QTVA 2NXEA 3G2XA 3NGKA 2MLXA 2BJDA 4KH1B 3LX7A 2HVHA 2ROLA 3GTYX 3MTKA 2L3MA 3CCJT 1R6VA 2HQDA 3VVUA 3H2UB 1IGQA 2O66A 4C8QC 3I5RA 2V4RA 2DD4A 2C2RA 1Q86C 4F2SA 4DQ2A 1SJRA 3FRYA 2KYMA 3K89A 1LW2A 1A0OB 5GAEU 4V19J 3QAEA 3DU5A 4M75B 3N6MA 1VQLT 2JTEA 1X5SA 5C42A 4A4JA 2RI5A 3J80E 2DR9A 2XMMA 5KT3A 4WBFA 4DV3F 5ETRA 1DJ7B 4X9DA 2DBMA 2JEJA 4DX6A 5FD1A 2GV1A 2AZ3A 5GAOl 2YUPA 3P49B 1GMVA 4ED0A 4XIUA 3OL8A 2H5IB 2RHSB 3M8PB 4ZITA 1QY7A 5GAN3 4M7DG 1YJNT 4IG0B 5A8KA 4K50A 1U0SA 1H7WA 2RNEA 1KD1C 3KXDA 2CPEA 3TR5A 2D8HA 1Y96A 5ETQA 2IRUA 1K1QA 1NZ9A 2OLWA 3OHAA 2V50A 2W4DA 2VPZB 2BACA 2K7JA 1IN0A 3CGIA 1V1CA 3PIPQ 3G71Q 2RA2A 1MU2B 3RGIA 2V1RA 1S12A 3UT1A 3M59A 2JSXA 2HS0A 2I8EA 2X51A 4X62F 2G0IA 2HHPA 3CCQS 1VBYA 1H2UX 1WA7A 2OTLS 4XTUA 4ZPVR 2WVBA 3ZBDA 2ZPBB 3TYTA 2FHJA 2OPPB 4GKJF 2XI2A 3E01B 2IYGA 3UD5A 4CO1A 3HHDA 4JI4F 2C06A 3CSKA 1TV6A 3CCLS 3U7JA 4PJOG 2EPIA 4ITSA 3CCRQ 1UPPA 3HHLA 2DXTA 3IGVA 2NXCA 2OFHX 1ZTTA 1UZHA 4UUXA 3BZQA 4ESRA 1IWGA 4L5GA 3O2IA 5D15A 1FRKA 3UF4A 5J2MA 1GXIE 1UTAA 1PSFA 3EGDB 4B9XA 1X31C 2RKIB 1ZM3A 4CO3A 1U25A 3ZFJA 1IKWA 2QGFB 3OSSC 2B86A 4RTVA 3EXYA 1SF9A 4ED5A 1SSHA 4GVBB 2X1BA 1Q8KA 4J9GA 4N41A 4RJVA 4F4ZA 5AE2A 2KTQA 3G6EA 2RAQA 1F60B 3DDIA 4M7DA 2OPQB 3REAB 1WJ9A 3QWXX 1JNZB 3G6VA 2MCNA 2IC3A 1FMKA 1UGPB 2IC3B 4A47A 1VIXA 4K5RA 1J5EF 4LF9J 1X4AA 3NOCA 1CVJA 2M2BA 2RK2A 3LLRA 2DXDA 4HA8A 1M5PC 4DL6A 1B3TA 2LQBA 3R27A 1ZAWA 2WSFC 1R77A 4USJC 1X4GA 1CS4B 1RTJB 4FXDA 3T6BA 1QVFP 1ZM9A 5LM7E 3BF4A 2F5GA 1U1NA 1X5OA 2M9KA 1XMOF 2QA4S 2OEJA 1DTQA 3IR7B 2GFFA 4ELVA 1Y7PA 2YNHB 5CXTA 2KQWA 1Q7YR 2M7SA 3C8YA 3S01A 4E7LA 4DPWA 1OQ3A 5ETTA 1B07A 4M78F 4FYWB 1CJUA 4F50A 4DR6F 1X9MA 4ID5A 2YX4A 4RNNA 3CVKA 2JL9A 1Z2ZA 3KYLA 3I55A 1YWPA 1BK2A 4IRKA 4QYRA 1FERA 5JVGQ 2DNGA 4C8QE 2EKHA 5D3GA 1UB4A 2YWKA 3QJJA 1WTFA 3FDSA 2UP1A 4UQTA 1VQ4A 3HHLD 1KRPA 2KJWA 3G6EQ 1N34J 1QSSA 5K5MA 4X64F 1FDNA 2YWFA 2E6NA 1TZ0A 1TVRB 1AUSL 3D1HA 1K44A 1VFJA 4YB1P 1IKXA 2A28A 4K4XA 5D6XA 5LL6d 1KHCA 2LQ8A 1EJ7L 3K0JA 4XAXB 2H8HA 2LQNA 3IFEA 2V68A 3CC7A 3P3DA 3OMGA 4ECQA 2JS0A 4K2JA 2CP7A 4P9SA 3CCQQ 2YTCA 2UUCJ 5EX0A 2L3QA 2IMWP 3F0NA 4ZPTR 4OMFB 2A10A 2HLTA 2R9LA 3ET6A 4M77B 3T1HJ 3UPFA 1S6UA 4DG1A 4K0KJ 4AFUC 2M52A 2IHR1 5EWEA 1RLQC 2L8DA 4WF9Q 5I3UB 2OAWA 3H9NA 4DL4A 5BYQA 3WBZA 4ZCIA 4XTYA 2Y1IA 1SV5A 4N0AA 2EK6A 3D3CJ 3TA0A 3CCVT 3TSZA 1XNRJ 1Q82U 2MMYA 3A8KA 4RCBA 4YR2A 4LFBF 1M5Q1 1U26A 3CCUS 1UTIA 3VWSA 1YWOA 4BY6C 3UATA 2LEBA 3V6HA 5D3GB 4D3GA 3RMSA 2HGNA 4W98A 2FYXA 2ZHAA 2YKNA 2K3BA 4K4VA 4OJ1A 1Q8BA 3NGSA 4C6AA 4R0JA 4LUDA 3HT0A 2ACYA 3J80Y 4W92B 3V81B 4OHWA 5ETSA 4IH5A 3CO0P 1YJWA 2RHQB 4S0MA 4N8OA 4F7VA 4C8NA 3LOUA 3M32A 4IG3B 2RF0A 4KFBB 4IDKA 4ALZA 1HQ2A 2P9CA 5KFYA 1SH2A 1AVZC 3N5FA 4DXLA 1VQMQ 4RTWA 2VA2A 4PJNA 5ETKA 3M8ZA 2CQ0A 2BV3A 3UN3A 3ICLA 1VCTA 1U8SA 2NUZA 4E0DA 1Y96B 1RAIB 1HI1A 2IM2A 4KUDK 1VDHA 4DBFA 2K6DA 4QVDA 1FKPB 4MDXA 1S72Q 1VQKS 4HCKA 3BDEA 5LJ3g 3DLBA 2ZDPA 3RW6A 3FSXA 1YBUA 3JCMh 4KGMA 1VC6A 1WJQA 4IH7A 1K0XA 2A08A 1WJSA 1C0UA 2D0QB 1IKYA 4P5NA 4DOVA 3CCUQ 4OZ3A 3SQGB 4PG7A 4DR2J 3LP2B 2CUYA 2N3OA 3MEWA 3T5HA 2V2VA 3OR2B 4PR6A 1AZSA 2CZ9A 3OL9A 4NLSA 4UY85 2DXEA 3I31A 1JXEA 4KTQA 3NEKA 2BQ3A 3CC2A 1M1HA 2I9SA 1LPLA 1JLCB 4UQGA 4TLRA 3NKYA 3ZZUA 1P1LA 3BW1A 3DDKA 4PUOA 1CKAA 2CDQA 4GKKF 1FK9A 3WQPA 2OI2A 2P4TA 1X0FA 4LQ9A 3PNWC 5A76A 2QC3A 1YJWT 2W7PA 4DQSA 2DLPA 1TUCA 3F70A 5KT5A 4XK8E 2NYSA 3I56A 2DTJA 4PJOE 1VC0A 4RW7B 1A0NB 3U1MA 4JI1F 2O9VA 4MYTA 2KT1A 4HVUA 3C15A 1W2BR 1RQ0A 4RR5A 1YZ6A 2P9GA 1HFEL 5K20B 3I56Q 2R7TA 4OZ5A 3PW0A 3OD2A 2E1MC 4JJNK 5KTQA 1Y3JA 5MLCV 1NK9A 3RESA 4ZLNA 4BDPA 5CIUA 4Y3CA 2JNGA 1FO1A 2MZ1A 5DLGA 4ZVEA 3TQ1A 1JQGA 3X3UA 4RNHA 4P2XA 3NNHA 4OHXA 2OAUA 2HGMA 4BS2A 1KOHA 2KRMA 4C97A 4YB6A 2YWEA 1VQNA 5KFPA 2G0JA 4Q0BA 4OJGA 1OZ2A 4J8OA 3PW5A 2DGUA 2KXCA 3KK3B 3INZA 4ZDNA 3MTJA 4F17A 3MCAB 2V5HG 4FNIA 1EX4A 2KR3A 3TAMB 1Y7XA 3Q8RB 2XBPA 1AA1B 2GMHA 4CLLA 4OMFG 4BI4A 4ID5B 1WHWA 2W7OA 2R8HA 1K76A 1VQ7S 1ZLMA 3M54A 1Q81C 4KGZB 4X4NA 1X01A 1XMOJ 2LQKA 2UVUA 1JNRB 2Q6BA 4U8YA 2DGWA 2QTWA 3OR2A 2HNDA 3Q24A 3MURP 2YQ3A 2HFSA 1U6FA 3OYNA 2M0OA 2RHYA 1JXLA 4BD3A 4HHHA 2GVZB 4LR9A 3BSOA 3V4IA 3I6PA 1PHTA 2RPNA 3K2YA 3B6BA 3D6HB 4URGA 5KG3A 1U1RA 1Q7YU 3L2ZA 1N9SA 4C92A 4Q7AA 1NHUA 2IVWA 4XTVA 3E8OA 4K4TA 2HHSA 3DYAB 2YKNB 3PFOA 1VMBA 1ZSGA 1X6BA 3RRKA 3HFZB 4PCQA 2QFIA 2LDMA 4LSZB 5L1LA 4ED8A 4NASA 4Y91A 3W2WB 4M5HA 4NA1A 5DY9A 3TW0A 2FY1A 3MPWA 4FPRA 3KK2A 4B9WA 3J7YU 1VRUA 3OHBA 2LNHB 2LCLA 4XU2A 1HXDA 2JLFA 3DMJB 3CC4Q 2NPIA 4FXVA 2DF6A 2DXCA 2NSCA 2EFQA 5JMNA 2NREA 4DG1B 4JI3F 3G6ES 3U1NA 1X60A 2JWNA 1AWWA 2BE2B 3A13A 3HSGA 4R8UA 2YKOA 4U95A 5CO7A 3MJXA 2VPXB 4KHMA 1RTIA 1FEHA 2CFXA 5A8WB 3T3FA 2IM1A 4C0FA 1QVFR 5I11A 1WHXA 4LNPA 2RRAA 1RWVB 4AG1C 2YY3A 4OJ3A 2CJXB 1OWXA 4C8QB 1KHWA 3ISZA 5D4OA 1TKZA 1U2RA 1D1UA 5GMKe 2BRKA 4P72A 3JB9F 3PO5A 3WX4A 1O9SA 2JFDA 4WTOB 3SFMA 1VHIA 4CC4B 1VUBA 2B51A 5DZ6A 3MAAB 2JJ9A 1IQTA 3VAKA 4KO0B 3CPWA 4ZK7M 3GIKA 2CP2A 2HLUA 5ETPA 3RU0A 1VQ8S 1VQ9Q 1UJ4A 4OJHA 3H0IA 3W7BA 1NZ8A 4N76A 2ZWPA 3OBYA 1UVMA 5F8JA 3C6TB 3V7SA 2V1QA 2J5AA 3KNGA 2NXJA 2KO1A 2UXCJ 2CVIA 3R5DA 4Q0BB 2DJZA 3A8MB 4R56A 5KFRA 1KLMA 4JYAF 1JLGA 3OY9A 4DEZA 3CXCS 2MYFA 2RM4A 3T9NA 4QWCA 3MPDA 2HNZA 5F8NA 2D1CA 4LRAA 2YNFB 1TKTB 3CJQA 2OPSA 3HRUA 2QK0A 4H4KC 1MHNA 2NWMA 4NZ7A 5CYQA 4YS2A 1JLFA 2BE2A 4PEOA 1QUVA 3DRPB 3MKDA 4NPOA 4B3TF 3HSDA 4QBUA 4XPCA 1HYOA 1YZ7A 3VZIA 3H40A 2XSFA 4NX9A 1WKKA 5IV3A 4LDWA 2QJ3A 1NEBA 1PBUA 4X4UA 3CJKB 4M5LA 1YJ9A 3MMBA 4WZMA 1G1XA 3A12A 4F02A 4G3IA 3NFCA 3RKWA 3MM9B 4LSLA 1D9DA 4JI2J 4DCPB 1CULA 1VJQA 3JCMQ 1PCAA 4B3SF 3R5BA 3CCUA 1L5UA 2V63A 1NLOC 3F41A 2HKQB 3I32A 4QW9A 1JLAB 4ID8A 1L3SA 2RH2A 4RW7A 3M0SA 2YRDA 2OPPA 5HATA 5FLXY 2I1RA 1KQSP 4JRPA 4I2QA 1Q5VA 2CZ0B 2B4VA 4HLBA 1DAXA 4DEXA 3VV0A 2HQGA 1AXQA 2QI2A 1GBRA 3WXMB 5IWAJ 3B78A 4OB3B 2GIRA 1SQGA 3CD5A 4URQU 3R2DJ 3CD6S 3G71A 5CQXA 1REVA 1G3WA 4IUPA 2Q1LA 1K0TA 4GC7A 5M2PA 3OTBA 2HS4A 5K14B 1ZETA 1UW4A 4DOWA 5HQLA 2KI2A 4ZVOB 2P9EA 1Q53A 3MMCA 3CCEA 3CD6T 2V26A 2E64A 3ITHA 4O5VA 3S8SA 1KC8T 1WIEA 2XY7A 5GMKh 3O6QA 1QP2A 4U6PA 4HYKA 3BS9A 5E3PA 3VS7A 3CPFA 2CG4A 4DL2A 3CBPA 1WWHA 2F40A 3OXLA 2GHPA 3SFGA 3NP5A 2QDYB 3NGRA 2DAQA 4B08A 4I4BA 1YTYA 3CMET 2C2ZB 2MKJA 4WFNQ 2W9BB 4H4MA 2J0XA 4EMKA 1VYTA 2GTOA 1ZTWA 1RU2A 1RWNB 2ROEA 3CUNA 3VS0A 1S1WA 4LBIA 3MAHA 1PRLC 2FPEA 3W2VA 3QT6A 4ZGJB 4J9MA 1NMEB 2DYAA 4MKVA 1Q1KA 3ZZPA 3NTKA 3QYGB 3CC7Q 4NMLA 3CMES 3BBFA 2VODA 2YPYA 2EFIA 2DT9A 5LOQA 5KCHA 1CJVB 3BY7A 3OYIA 4K8RA 3D66A 4YP3A 3C95A 4JV5F 2CJBA 1WC1A 2JM9A 3MR3A 4ZP6A 2HEKA 4DUYF 2E5GA 2GHWA 1HW9A 3C16A 2PEHA 3KK1B 2FPFA 4CO4A 3JAMU 1S5ZA 3H25A 2DB1A 2E4HA 4AD6A 4UY8T 1TUWA 3FBFA 1JJ2S 4CI0C 1VQKT 3C46A 4IUFA 4UC4A 1S59A 2B4PA 3OVSA 2DRDA 4X4QA 2HBWA 1QTNB 1AOJA 3UNGC 2CZ6B 2HMIA 5GVQA 2VKZG 3EH1A 4JRIA 1T3LA 3U27A 4X62J 3M4GA 5C7PA 1LWXA 1FF2A 2QLBB 1L3TA 2CNNB 1RKIA 4K0KF 3TWZA 2VXFA 2D9OA 1SC4B 2XB2D 4PRFA 1JEGA 2APOA 4P2MA 1WLPB 2HD0A 3HVAA 4G1IA 2XULA 3N6NA 3QYYA 4ZJLA 3M05A 2RK1A 3R6OA 4DLEA 1MNEA 2PSZA 3Q8SB 1QSYA 2AJ0A 2XSJB 2W10A 4JUVA 1RT5B 1OI1A 3HLUA 3RRHA 1VQ9A 1RTDB 1IJEB 2CQIA 3HHLC 1IKVB 2DBBA 3TO8A 2ATLA 1YI2Q 3TCJA 1KC8R 1JLGB 1VK8A 3QO3A 4B3SJ 1NJIT 3SDZA 3REBB 3C6TA 2RUGA 3VALA 1M8MA 1CS4A 2AJ2A 2GZOA 2VG7B 1YFNA 1PBAA 2OMOA 2DNOA 1B0PA 3Q0AA 1GAOA 4BBYA 2DL7A 3CF5Q 4Q5VA 2PT0A 1KQGB 4M77A 2Y0BB 2YXYA 3MMAB 4CRJA 4X9CA 4C0DB 5DQIA 2RHXA 2MQNA 2BUNA 4RU9A 1BY9A 1YIJT 5GANg 2DRMA 5AXNA 1WNEA 4LF2A 2HNYA 1RISA 2K5FA 2GNKA 5CA5A 4EO6A 1I4K1 4DBRA 3MCSA 4PPZA 1X69A 1QMCA 4R5PA 2GF7A 3H2LA 1IKWB 1RLPC 3JV3A 4DU7A 3G4SS 2F4VF 1D09B 4C3MA 5CCLA 2HZVA 3BQ0A 1NYGA 2BJ3A 1V5VA 4A4HA 4DN9A 3ET6B 1IHVA 2PI5A 2FYKA 3R5JB 3DXSX 1BU1A 2MZRA 3G4ST 2CPFA 2U2FA 3RR8A 4CO2A 2VG5B 2D41A 2K57A 2OJ3A 5F8GA 2QA4G 2BVZA 3MFHA 3I0SB 4ED4A 1FKOB 2C2NA 1RBLA 3GU0A 3OMCA 3H5YA 4FT4A 3MR5A 4USWA 3MGJA 2A0FB 4K4UA 3QUIA 2AZVA 1LW0B 1S0MA 1SEMA 1S9EA 1EIFA 2LECA 4ZVRB 3WZ0A 4LQ3A 4O4RA 3JS9A 3TQEA 1FXDA 2KYBA 2HK3A 5LMUJ 2EBPA 2DHSA 2EIFA 2OUGA 3HFVA 3W62A 5D4NA 3HM9A 4WFBQ 1SIWB 2QXFA 3G87A 4EFAC 2DGTA 1IBLF 1Y3KA 2SXLA 3DRRB 4X66F 4AFZC 4LRDA 2DXUA 3AJ1A 2CRLA 3VYGA 2XS5A 1TAUA 2CZ4A 2FHOB 3D5MA 1TK0A 2B5JA 4OI0A 3TZXA 4JPBW 1RA7A 1C4CA 2IFXA 3AD8C 3PRDA 4ES2A 2CZ7B 1LOJA 2GX8A 5HK3A 4NL3A 5KYUB 3FBCA 1SXLA 1Z2LA 4F7UE 3J7AF 4ZGEB 4M77G 2RH3A 3H0PA 5GAN6 3M32B 4B6MA 2KYXA 5U47A 4KHRA 3PYGA 1FE0A 2H4WB 2RI3A 3EH2A 3BGUA 2KB2A 2OTJA 5HK0A 2F69A 3QDRB 1K4US 1HBMB 1RWXB 3M2VB 1QUPA 1RBAA 2HS3A 4MZPA 2C2EA 2MQMA 2ROGA 1DY3A 4Y2AA 5A2QE 3QSYB 3VQSA 2ZPFB 4IRDA 5FDLB 3RJMB 3LAKA 1NK0A 4M5MA 3MEKA 1P6TA 4CTAB 1TG0A 2A3JA 1FFSB 1K0VA 2CQ4A 2CQPA 3MMJA 1NEGA 4NLVA 1KQFB 1OEBA 1H3ZA 4IIOA 1PILA 5I3UA 4HEA9 1FMWA 4E2FB 1OX9A 1WHYA 1GTEA 4ZP8A 2K1RA 5A8KB 4OZLA 1Z9ZA 3FZ2A 4ZVTB 3V5RA 2O67A 3BGRA 1WHLA 4MZTA 2YNGB 1RADB 3C2PA 3C15B 4RBUA 3UR0A 4U7CA 5HMXA 3TREA 2O3DA 4O4GA 2Y8YA 1S1XA 2L3PA 2ZH4A 5FWBA 3NCPA 1HNZF 4WP9A 4WF2A 2YX1A 4KBMB 2IRYA 2LXUA 2NPFA 3NPFA 1CPZA 2J0QD 2HVEA 1YIJA 2HQXA 9RUBA 1YHQT 4GLMA 1A6LA 4PKCC 1B99A 1SRMA 1K9AA 5C0MA 4TU9A 2VH7A 3MUTP 1I3OB 2AT1B 1EQ0A 4CC7A 2JW4A 4FSXA 1S49A 1GMUA 2MGZB 4J6WA 2KXFA 3VGUA 2G3RA 3EFRA 4DSLA 2JT4A 1WDTA 3MDFA 1T9XA 4A8YA 4DR5F 3A5ZB 1LFPA 4PJOF 2EJGA 2UVVA 2KRNA 3G82B 2PN6A 3L7UA 3OYFA 3CC4A 3VAGA 1XERA 3O8WA 3K17A 3OYGA 3VS2A 2OH2A 2CNLB 1AFIA 1YJRA 5CH7B 2OTJQ 2LZ6B 3CT9A 2XWXA 1WKLA 2D3OR 4M78A 1F9EB 2RMLA 5LJ5h 1HMVA 2N4DA 3GIBA 4MK9A 1JLBB 1Q8LA 3R3TA 4AQYF 3T1AA 2B3TB 2CP5A 4DZDA 2N7CA 1BQXA 3GFHA 2FJXA 2Z2MA 2V2ZA 4C92C 2AYGA 1FD8A 2XLKA 1IBMF 3D1OA 1KQ1A 2E7WA 5ITHA 4A46A 5IOLA 3S6EA 4YB7A 2XNRA 2LJ1A 4O6JA 2V69A 4CDIA 1UAWA 3L95X 3PRVA 4GKJJ 1G3OA 4PG6A 2DNMA 2AX0A 3W8PA 1EX8A 3OUYA 4IG3A 2VBXA 3UCZP 4USUA 1R8OB 2P6SA 2LU1A 1TUVA 1YBAA 1KFZA 3KFWX 1VJWA 1HNVB 1GL5A 3NMZC 1BWVA 1B0TA 2OPRA 4B9MA 3OFGA 1U7LA 2LRQA 3BB5A 3FQLA 3WIVA 1WC3A 4HTJA 7FDRA 1T11A 1JLCA 3W2VB 1R8PA 1SQFA 1R0AB 2ESWA 3BKFA 5L8RC 1HBMA 1PJ6A 1U1PA 1AW0A 3SWNB 5D6GA 3I9QA 1LWFA 4B9NA 1U4BA 2X3GA 4USMA 3BR9A 3GV7B 5HAOA 4MKAA 3SDEA 1IBKF 4ECXA 4CO5A 3HXMA 2VB6A 4KR0B 2HSEB 1WF0A 5KFWA 3SXLA 4DR3J 3BSAA 2PFFB 2W9CA 2Z0GA 1H0HB 1IXKA 1QCFA 4DV1F 3TARA 2I5JA 3NGTA 3KBGA 3PHEA 3ZZOA 2MQ8A 2F5TX 4TN2A 3T5KA 1YG0A 2WZ1A 5GMDA 2DGQA 2CUBA 2PDAA 1GK8A 3O3LA 3KHHA 4P71A 2I6WA 1RWPB 4Z02A 1M5OC 2UVWA 2CDRB 1YX2A 4LDYA 2Y1JA 4OI3A 2EVRA 1YJNS 5KFDA 2J8AA 3QZ7A 4I68A 4BUGA 4BDZA 4ETXA 3ZC4A 1FXXA 3CNQP 2GS8A 4PG4A 1PG5B 2FL7A 4IFYA 5E7OB 2XNQA 3AJDA 4DBHA 2BYCA 3SYZA 3TOQA 4IUQA 4NLDA 2KE9A 2CNOB 3WVEB 2EYQA 3QDFA 1T03A 2ZPEB 1XR6A 5C2GA 3KJVB 1XN9A 1MN7A 2CJQA 4RW9A 2ZH6A 3W63A 2ZHOA 3SMZA 3QHSA 3M0RA 3PACA 1WD6A 2OP5A 1S76D 5CD4A 1YJ7A 4LFCF 2DNNA 3WX8A 2G6FX 4DPYA 3VAIA 1M0SA 1SV5B 4M78C 1NDKA 2QEXQ 2VG5A 2DNYA 5KFZA 5LJ5e 2R7RA 3JTOA 2EQKA 2MHEA 3CJ2A 2EFPA 5CHCB 4HDHA 4HCBA 3LP0B 3MP8A 3M30B 3CCJA 1C0UB 2VBZA 2RHUA 2Z2YB 4FVCA 3H90A 1MROB 3MPYA 5GAGI 2GCFA 4ECWA 3LGMA 1KS2A 3TJ9A 3HD1A 2HRUA 1SKSA 3L1AA 1FKPA 3U02A 1E6YA 3DU6A 1KD1T 4LFBJ 4BACA 1X5PA 3CJ3A 3BKTA 2GIFA 1U24A 2F8EX 5FLXE 4FNHA 3DLHA 3PYFA 4NA3A 2RQ4A 2HBRB 2M1HA 2QQSA 2XYHB 1ABOA 1U1MA 3DXBA 3D2WA 2R8GA 2PVOB 5HI7A 1G6BA 3BPSP 4QZVB 1T0TV 4IFVB 3W66A 1S1UA 1U49A 2D9TA 2FDNA 1PSDA 1SKUB 2R7UA 1M1KU 4DS5A 1RSCA 3Q86A 2HL3A 1V3RA 2EKNA 2AYEA 2BANB 2K06A 1FDAA 1VQ5Q 3MI7X 3GPAA 2MLZA 4M75C 4OYZA 1SB6A 3D0HE 1WSRA 4X2BA 2HGLA 1CQNA 2E9TA 2P84A 1RAOA 2YNHA 4IRCA 5KE3A 2AP6A 2VKNA 1YRXA 2XDPA 1T9YA 3OJUA 2ROTA 1AD5A 2FZKB 1F5BA 1SUQB 4B9TA 4C5HA 4PQAA 3IWNC 3HX9A 4N4IA 3ZTRA 3DLLA 2KMTA 3CMAQ 4MFBA 2Y3YA 5CK9A 3ELHA 2OTJS 1Y57A 4QYZJ 4DV4F 2M9UA 3K59A 1FWPA 3CCEQ 1HWUA 2PO4A 3GIJA 4KULA 3OS5A 2DNRA 3J81Y 4UF4A 2Y8WA 2CT4A 3OJSA 3JSMB 1TV6B 3GJTB 2HNYB 4CNYA 1S97A 3KLGB 4JJCA 2QA4A 3NAIA 2V4JA 3JCMJ 2CIMA 1H8KA 2N4CA 1VQPS 2GIQA 4QU7A 2V8DA 3FQKA 4KIAA 2DA9A 1Y5NB 3RBEA 4CC2A 3I55S 3HHLB 3X25B 1K8AU 5CZVA 2VOPA 4F25A 4RUBA 3QO9B 3ETOA 1RWKB 2R8JA 4OYAA 2DH7A 3PHTA 3M58A 1SKWA 5GAN4 2ZH9A 3FDRA 3IG1A 3G6YA 3VRYA 2HVZA 4M4ZA 4J37A 3G8SA 3VS6A 3MEGB 2BM0A 3M4YA 2ZDOA 3RBBB 1JWWA 1RK8A 2JOQA 2AKWB 4EMKB 2L9WA 3BE3A 2QQAA 4M5DB 2FLNA 3P5TL 1AZSB 3QRQA 1UGQB 2WB4A 4UOCA 3X1LB 5HJYA 3TAPA 4X4OA 3OSNA 2JDJA 4NRTA 1RT6A 5A2QU 3P96A 1WGSA 1Y07A 3QAUA 4DV2F 3NHNA 4QR0A 4EYHB 3CCES 3QT8A 2P8IA 4ZTFA 2WVEA 3VGSA 5DDQC 3T9ZA 2FLPA 4Z37A 3TP2A 1M90U 2CQDA 1PIEA 4L59A 2AGOA 4R8UB 3OYDA 4QPTA 1N54B 2OSQA 3MMCB 3TVTA 2E1AA 1HBUB 2WVFA 4F3QA 3H4BA 2CPHA 3RAQA 4X4PA 2FJVA 1GCQC 4I0WA 4K7QA 3R97A 1M1FA 2X1GA 4DF8A 1F2GA 4IKFA 1LEOA 4DV4J 2B7BB 5IFMA 4TU7A 4FM4B 1VR6A 4ECSA 1RLCL 4BLGA 1IB8A 1REGX 4FF4A 3OVAA 3LAMA 2QEXS 4A8FA 5IXFA 2ZZMA 2V9KA 3CMEA 4HHJA 2WACA 2ZHBA 4D8DA 3QXEB 1ZM2A 1X0PA 1S6PB 2NLWA 2Q66A 1FWZA 1BI3A 1YJWS 1G3TA 4CZCA 5KFCA 3X24B 5F8LA 5IH2A 3TU4K 2NS1B 3FIFA 3HJFA 4AL6A 1FDDA 4LSNA 2ZE2A 4O3PA 2C0TA 1NJZA 3AA9A 2J9DA 2K5IA 3HKZD 3FJ5A 1G7CB 5IT9U 1K9MC 4ZA1A 3GMGA 1Q86T 4XTXA 3QQCD 1XNQF 1RTZA 1LV5A 5E3RA 2XDBA 4M5JA 4P7VA 5HLFB 2ZWOA 3ENQA 4PG8A 3DM2A 5A8RB 1BQNB 4A53A 4M7AA 2Z0WA 4OGEA 1M3AA 2EJFA 2LT1A 2MIOA 3HT3A 4G1QA 5D4LA 3N28A 1HD3A 1N5YA 1HNWJ 3NNAA 2ZITA 2GAHC 3D7SB 1HI8A 2ZM6F 1RT7B 2I0NA 1QE1A 4ZPWR 2W2OP 2HPUA 4PWDB 2DE0X 2IA0A 1EETB 3RBXA 4HI2A 1O51A 2DGXA 3PTWA 2KXHA 3VGTA 3KLEA 4EUVA 1VQ9S 3M8QA 4C8KA 4M75G 3Q22A 2QL7B 4EEYA 3LPYA 4DSEA 1CJKA 1H7XA 5D0GA 2FJEB 3BM7A 4A8XA 3CMQA 2LVMA 4NLXA 1OYDA 2NUUG 2MJNA 3QGHA 1NM7A 1LW0A 4II1A 3MAAA 1PKTA 1Q82R 5GAMd 4I6AA 3NBPA 1HI0P 1RTDA 1YK9A 1YHQA 4FYYB 2E3IA 3OFEA 4OYBA 4IDKB 4YOEA 4PKDB 3T1HF 1G4CA 2WSEC 2UXDJ 2R42A 3H98A 2KVQG 2LT4A 4LDUA 1MMLA 1NPKA 4JI6J 5AE3A 1YJ9Q 2C2KB 3HHKA 2J7IA 4DV0F 1H3DA 4NXNJ 4NCGA 3DLJA 1GEHA 3W1YC 2EC0A 1J5EJ 2DVEA 3VV2B 2KKHA 1QCNA 2I5JB 4OF1A 4FF1A 1VQ6Q 3H8YA 5ETMA 3SCLE 4LF4F 2KSSA 3L2QA 2RQUA 5FU6C 4XU0A 4PAAA 1RAFB 1K8AR 3FVYA 4GMKA 2R7XA 1X4DA 1KFSA 3DDNA 1Y5LB 4L6V3 1EIYB 2AF6A 1JJ2A 4OVAA 2YWGA 2ABLA 4W90B 2XK0A 3JCMd 3G8QA 2BJ1A 3RKXA 1NSQA 3R5AA 3URGA 5HROB 3A8JA 2F63A 3UFCX 2FHDA 1WHGA 2M02A 1WC5A 2MKCA 1RXOB 5EX3A 1BLUA 3HDSA 1VQLS 2RS2A 3C4SA 2HMAA 2KL8A 2OPSB 4NYOA 1ZBXA 3MD3A 3DGPA 1E7OA 3EFOA 2PQWA 2YLCA 2EG2A 4LR8A 3HULA 3CJTA 3GCXP 4C11A 4EPCA 1K9MT 2ED0A 1P9QC 3FBEA 2RKIA 2K2PA 3N9UC 1R27B 1JXVA 2GMJA 1QW1A 2VL1A 2ASLA 1L3VA 3QMQA 4PXBA 2DL8A 3PFSA 1R7IA 3CXCP 2VWFA 3BV8A 3EWGA 1N6QA 2R7SA 2FRWA 4CLUA 4DV0J 1RKJA 2B7CB 3LW5C 3JTNA 1OMSA 4DV3J 4DQQA 4G65A 4JI5F 2CQBA 2DJWA 3AAWB 1N32J 5FWCA 4C8QD 3CCQT 1B7FA 1VQPT 4DZ6A 2GHVC 4ZTJA 4DR1F 2FVRA 4FBUA 2O5DA 3M0UA 2J0WA 3CO9A 2PU9B 4DV2J 2FC8A 1OQ6A 2B8PA 2XO7A 5HCKA 4HACB 4Z8AA 3CEDA 3QT5A 3TAMA 2M51A 1T05B 1KSWA 4C0ZA 4WK3A 3CDEA 2DR8A 1HK9A 4N7TA 2K3YA 1JRIA 5DLFA 3DLMA 1UEUA 5HMZA 3UA7A 1KC8U 1KQSR 4RTTA 3PW7A 3OTDA 3I5BA 4TKTA 4U96A 2W24A 3EHRA 1RWWB 4BC7A 3NGUA 2GGPB 1FI4A 1WX6A 4OIXA 2E3HA 1ZHIA 4NZ0A 4CLSA 2QN6B 4DR5J 4A4GA 2LX9A 4DI6A 3KJVA 5C42B 4KRTA 1QVGS 5L9XA 3P45B 2Z2LA 1LNXA 3H0HA 4QWDA 3CDUA 4J5YA 3CPWR 1Y71A 1FA0A 2LQ9A 2DCUB 4F0KA 5CQYA 2DM1A 3SFUA 2ZZDA 4OYWA 2H9ZA 4C4WA 2LCWA 2KT2A 4Q43A 4LF5F 1DQAA 5CCMA 1RTHB 1CULB 2V8HA 3AB4B 1WPYA 3OXFA 4TQSA 2HAXA 5B0GA 3UWTA 3ZTPA 3DKDA 5CD4H 3J7YI 5ETVA 5K8NA 5D6WA 2L48A 2E7XA 3F44A 3OV7A 2DNKA 1U09A 1WHJA 4TXSA 1RCXB 4MAKA 4OQJA 3VS5A 2HBQB 2DCLA 2E66A 1FVSA 4DR4F 1PM3A 1JXMA 1ELOA 1V9OA 4LF9F 4JOUA 4NL2A 1S7IA 4XTTA 3CIZA 2C3MA 4OV6A 4LRCA 2K3IA 2AV5A 3TZWA 4PWWA 5GAHU 2C22A 3VRZA 4DR1J 2CYYA 3CCWA 1X43A 1LWFB 3E3XA 2HRTA 4ED1A 1K1SA 3MOJB 2HDAA 4AE5A 1VQ6A 3AB2B 1XK8A 1QVFS 1NZAA 2PNIA 2XMJA 5BYSA 1M90R 5KOWA 2CUDA 5IT4A 2JEFA 4LF7J 5CKBA 5E0OA 2CA9A 1VLOA 1UPMB 1NH7A 4OLPA 4CH1A 1T7PA 2EYXA 1GBQA 3S6WA 1T02A 4L74A 4RBTA 2JM8A 1XEZA 3RYLA 2G2YA 4KO0A 1BC6A 1FRMA 3RUBL 2UUAJ 3KHRA 3GE9A 5C25B 2PE8A 5K8MA 3KK1A 3EZ5A 1S1TB 3C6UB 4KFBA 2Z8QA 1I8FA 5M2UA 4F7UG 3DC2A 4L75A 3I56T 3HZEA 3LWMA 4QCLA 2GC8A 2RSQA 5AXLA 5KFMA 1WEYA 2UUCF 1ZBJA 4ICLB 1ZBTA 2F5KA 3M1VB 1RAEB 3AY0A 4WCIA 3X28B 2DR6A 1WELA 5A8WA 1XQIA 1AWJA 5IHKA 1X4BA 4PQUB 3KXTA 3H0FA 5GAN5 2KVQE 4PFZA 1T9WA 1I5LA 2B6AB 3MFIA 1R43A 2OHDA 4NXNF 3ME9A 4WIIA 4YUDA 3GNFB 2DO4A 3HPOA 3O44A 3OYYA 3QJ6A 4CLPA 1N0UA 1HBUA 2GMLA 4QIEA 4JJBA 3DGVA 2FHKA 5GMEA 2R2SA 2E65A 1VQNT 5BYRA 3EG1A 4EZ6A 3GIRA 3G96A 4PFPA 3EXCX 2GA7A 1GMWD 3M2RA 2YXLA 4IH6A 4DOZA 1DARA 5K9FA 4WE1A 4ANDA 2XIDA 5KT2A 4LXCA 3CCSQ 5FDLA 3OFFA 2CYZB 2BM1A 3AA8A 1J3TA 3FUYA 4C5EA 2MEWA 4LR7A 2L0AA 2G0CA 2IPOB 4WKRA 3EG9B 3FGVA 4C92B 2QV6A 3G9CA 1X2KA 3M0QA 3D67A 2QFJA 5KG0A 2WOMA 4AL5A 4A4EA 3H8ZA 4W4MA 1KVIA 3PKYA 1XJWB 3RUXA 4QVCA 3ZZ0A 1EARA 2K4YA 4J9HA 1KLNA 4CYUA 4M8LA 5KG1A 4RU2A 3G86A 4UOGA 2MOXA 2KT5A 5KOXA 1URRA 4B3OA 1LJOA 3CCRS 2E1PA 3P8HA 5DM7R 3OW2A 2OD6A 1T9UA 5FRMA 2UXBJ 3BYPA 4VUBA 1OQKA 4O23A 3A8IA 4AG2C 5DQHA 2A36A 1RL2A 4M77C 1XMQJ 3DRRA 1RAJA 3MPUB 2KAFA 1XR5A 3QG1A 5B0EA 4L76A 4O3OA 4V2SA 4JV0A 4WCEQ 4JLIA 4DQPA 3C3LA 3CC4T 2H5JB 1WC6A 4LF8F 4PLIA 1RI7A 1U1SA 2DVJA 4EIKA 3AFGA 2LVWA 3MR6A 3FB9A 3ZO7A 5H9EK 2X4JA 5RUBA 3C94A 2FJAB 2ZJRQ 5KYYB 4J9CA 1ZA2B 2RU9A 1BI2A 1IQZA 4CH7A 2EQJA 2JC1A 3PVXA 1IBCB 4KUIA 2PMWA 3L7OA 2W1BA 3OYMA 4N5SA 3HD2A 3IWLA 5K8PA 4CNZA 4HVVA 3MMBB 1TFWA 4ECUA 2MQQA 2C2MB 1VLYA 1BCMA 4C0GA 4KJIA 3TRGA 2NR0A 1R89A 3RB3A 4IOBA 4Y6IA 3K8WA 2RQWA 1EQMA 2DETA 5CKDA 1TH7A 1PO6A 1VQ4Q 2E9RX 4FU6A 2R7VA 4MFBB 2LP5A 2ZPHB 3TX8A 2G2OA 1UGSB 2B9WA 5G0RA 4J9VA 5BXIA 1JBMA 1JLFB 2VG7A 3RIRA 3KLHB 3KJQB 5LMNF 2F2VA 3GSIA 2VF3A 1M5SA 4KYZA 4KKOA 5KFGA 5FW9A 1KDNA 2VJUA 5GAN8 5GJVB 3M7VA 2UUAF 1UFLA 2QLXA 2HNIA 3EX7B 3PXGa 1BUXA 2MDAA 2J0SD 2WCXA 1GNKA 5KYNA 1C0TA 3PYDA 1JJCB 1NEEA 1DJ0A 1OPZA 3IM9A 1VBXA 1S9EB 3D1QA 3GLXA 4IUVA 2DRAA 1AFJA 3U23A 3Q89A 5JVHQ 1VIFA 3ISNC 1VQOA 2Q79A 4I6YA 4ZLPA 1YJNA 2JUFA 3CBMA 5GAOm 1KG1A 2FJWA 1R6YA 5DLQE 1UVJA 1VQMA 4CQ1A 1UJ5A 2W8LA 2PD1A 3M8QB 5CAAA 3CC2T 3NGDA 3A8EA 3EDRB 5IC6B 3VAJA 2L5QA 4XDDA 2CPXA 3VS3A 3JCMX 3O1LA 2O01C 5C6SA 1QM9A 3MUVP 3PIPA 2ZH3A 1QD1A 4A48A 4ER8A 4P2SA 3BREA 3R1LA 2XYPB 1ZSZA 2X35A 2KG1A 4I6WA 3HF5A 3K7RA 1BQMA 1ZM4A 1G83A 3CCVS 4G1PA 5SUHA 2DEQA 1UKUA 3L2WA 2AHJB 1G3SA 1FJGF 4USKA 1I0CA 3MP6A 2I0XA 3HHEA 2DD8S 4X4VA 4YDXA 3GP8A 3LP0A 1ZZFA 3WC2A 5JXSA 3UN2A 3RB4A 1K73U 4D3HA 1N33J 3LA0A 3QWUA 2HZYA 4DWIA 3FCVA 3ER0A 1UCNA 3EG0A 4RKUC 1RHQB 3GJRB 4J9BA 3EGDA 3C6UA 3EGWB 4M75A 3HL8A 2BOAA 3JSMA 7AT1B 4A63B 3SBMA 3N0VA 3TQ7P 1PAEX 4FKXA 2QQ9A 4AYBD 1HA1A 4IR9A 2XU8A 3QGGA 3IBFB 3GF5A 1DLOA 3BDLA 4DMZA 3CMAS 2E5KA 4ICLA 1PYOB 3A4TA 4NEZA 3AD7C 5FU6B 2LDYA 1TK8A 1RT5A 2CQCA 3B4MA 5CCAA 1MMDA 1GQEA 3SCIE 2RB6A 1RCOB 4FZVA 1LQ9A 1ZUKA 1W4SA 1TKXB 3IO1A 3VU3C 2VA3A 3X20B 5KYXA 5LJ3h 5IM0B 5KG4A 1WDDA 2PI4A 3AHUA 5B7WA 2SRCA 1T0JA 2EFGA 3ENVA 4JI6F 4J9KA 5KH6A 4J9UE 3O5ZA 4LF1A 4ATNA 2E29A 4CIOA 5EC7A 4ZPBA 2HQCA 3HSJA 2BZYA 3OYCA 1GXTA 4I67A 5D4PA 2EW3A 2A37A 1P9YA 1NCLA 1GFDA 1YBTA 1GX5A 1XNRF 3DOKB 2HQHA 3SIPB 3EICA 1XTZA 1KOOA 2BABA 3GV8B 4O3NA 4L3NA 4OYXA 5F8HA 5H1SV 2EWHA 3CC7T 4PYAA 4TVRA 2GNCA 1YITQ 1NJIU 2OMLA 4XK8C 3VVTA 1WORA 3A98A 4Z89A 2EGEA 3WVDB 3DNCA 1R0CB 2MK5A 2O31A 2G13A 2Y4YA 2DFUA 3NMRA 2HHTA 1QE1B 2PFDA 3W9JA 3CJRA 2DPJA 2JZ5A 2IIHA 3IAM9 3M0PA 1M4ZA 2HHVA 1BIAA 1B34B 2R58A 3UD3P 1L3KA 2OO4A 2DR5A 3OQ5A 3SD4A 3V2UC 2R7OA 1OV3A 1VQPA 1Y11A 2LNVA 2C42A 1VQ8Q 4M7DE 3SI8A 4U8VA 4NYPA 1KSPA 2FPHX 2DD5A 4OHVA 1UFKA 5E3QA 1U8WA 4JI8F 4OMPA 5E3AA 3DLGA 3NCRA 1SC3B 4CT9A 3IGNA 1RT4B 2OTLT 2ZVIA 4EO8A 4PUOB 4KAIA 4HACA 1WJRA 1DFDA 2V2QA 5J1EA 3KLVA 1V29B 2JLGA 2VQFJ 1H641 1T03B 2ZPGB 4J6XA 3PTAA 3KG0A 2FVQA 1B70B 5LMNJ 1SC6A 1U8RA 4FYXB 5BJRA 3ADAC 4MIWA 1GXLA 4UZCA 4WTYA 3THKA 4ECZA 1BI0A 5AE1A 5D0HA 4DR6J 1AROP 3J7Z5 1NAQA 2UUWA 2GTJA 2ZD1A 1UA1A 4PZVA 1RACB 4KT0C 3M8WA 5L1KA 3HRTA 3P8DA 2A2CA 2DZCA 4X34A 1JJ2P 4EWTA 1NJYA 2IJFA 4C8QG 4B3RJ 1RHJB 4LBPA 2EQUA 1WXTA 4Z88A 4EBEA 1WUUA 3HHNB 2RJZA 3EMTA 2LQ5A 2EXUA 1NLPC 2NUPA 3DRYA 3EFOB 1K9MR 2MQPA 1D3WA 4RUHA 1U06A 3IA0A 5DS7A 5GANj 4YB5A 5ECAA 4FIBA 2W9CB 4F14A 4DV1J 1NPRA 4A8SA 2MQLA 5DM7Q 1DLOB 2FIUA 1CSJA 3RTVA 1N33F 2OEMA 1KD1R 2BW7A 5KAKA 3PX4A 3IXQA 2KDSA 3L42A 3RW7A 1RUSA 4PL6A 3S1TA 2QO3A 3EGXA 3CCMT 3DB4A 1N8RC 1NHVA 2WW8A 1TUGB 1GFCA 4AFFA 3LP1A 2XMVA 1VQ7A 4OZ2A 1MROA 4OB1B 1KP6A 1HWJA 2G4BA 2BW2A 3DMJA 4RW6A 2DVIA 2JXBA 2ABYA 1J5OA 3LYIA 4HT9A 5F8MA 3THVA 2MXYA 1VQ7Q 2BA9A 2IIMA 3LQVA 1LNQA 2XMKA 1HQEB 5I21A 4HL9A 1WXBA 4IFYB 1NK6A 4O44B 3JCMf 3OYBA 4JRQA 1N52B 2LA4A 4ZNXA 1FJGJ 4B17A 1N5YB 2O4XA 4C9DA 2BBEA 5LSRA 4F4KA 3GB0A 4LVNP 3GJQB 3VKIA 1KONA 3OL7A 4C3KA 1KTVA 4HR2A 3FLGA 2HBZB 4P73A 4RTXA 1OSDA 3EYZA 2KU7A 2B6AA 3QBCA 3Q1JA 4P75A 1X2QA 1Q81T 1U2CA 2WSFE 2RNAA 1HWLA 2H54B 1EP4B 4EK2A 6FD1A 2ZM6J 5HO4A 4MIAA 4KQZA 2EYYA 3V6DB 3QJLA 1FRHA 5GMKl 2DGVA 5D0EA 2IG0A 2IBOA 5D0RA 1AT1B 3M8YA 1N34F 1D0ZA 2YRCA 2EFVA 4IURA 4OZNA 2DMOA 2HAIA 3OBWA 1TK5A 2IJRA 5KT6A 1RT1B 4OMLA 4FYDA 1KFDA 3Q2SC 2HCKA 3GV5B 3MEDA 4M75D 4M75F 3KLFB 5LSOA 3PIOQ 4XTZA 5HANA 2W25A 3D28A 3UD4P 3CDAA 1ZYQA 2PZ1A 3PT9A 4CT8A 4EMDA 1VQ4S 2RE1A 4CLFA 2ZJPQ 3RMQA 3LPEA 1HD1A 3DOLA 4X1VA 2MYSA 5IN1A 1VRUB 1K8AC 1QVGR 2XLJA 1YNZA 2XYGB 2E12A 4CRIA 4OMMA 1MW7A 1NJWA 1M1GA 2BOPA 5T41A 2V8PA 2PTKA 4RTZA 4GKKJ 2B4OA 2RB7A 3CC7S 2PC6A 4MZMA 3I4HX 1FFWB 1VYAA 2QMXA 2X1AA 2IM3A 1N8RU 1IR1A 3G1JA 2NSBA 1BMQB 3KK3A 1N5ZA 2AMCB 3VHQA 3PVLA 3AQPA 3FNNA 5HBMB 4ZGDB 1HARA 2FTRA 4PJOD 2QTXA 2WTFA 3NXZA 2W4PA 4R0EA 1FWLA 3UDEA 2PMHA 1Q16B 3VAHA 3K5PA 3SZ2A 3CCRT 2JLEA 3EAEA 2HHWA 1NSKL 1T3NA 3SEOA 2CQ3A 4ZIWA 4OYOA 4XU1A 2E41A 2J6FA 2XCPA 4KY3A 3W64A 4M7AF 1V6HA 2VVKA 1YHQQ 2X4YA 1UJ0A 1RWMB 4PQUA 3CD0A 1N56A 2RQTA 1K0SA 2ERRA 2Y9HA 4BB7A 1WC0A 3LH0A 2Z30B 2UUTA 3RBZA 4RG2A 4ED2A 1WOOA 5J3BA 4F04B 4E47A 3UI3A 3C16B 5GANh 3I55T 2KH9A 2YX7A 4E6RA 2AZSA 3LGFA 2D7SA 5EGYA 4RWXA 4LFAJ 1SL0A 3HP9A 2H51B 4JI5J 3Q8YA 1NKBA 1XBWA 2K3XA 1IJFB 1AWOA 2ZGWA 2D8JA 1T9TA 3PX6A 5CKHA 3OB9A 1YJVA 1C2PA 2IVFB 2K2VA 1IR2A 4QYZK 4A8OA 2ALYB 3EGVA 2NQPA 4I1TA 3UWNA 2RF2A 2QA4Q 4DUZF 2CP6A 3NMAA 4ZKAA 1KQKA 4Z7CA 1LXJA 4B02A 3Q8VA 3M9NB 3N5BB 1RT6B 5KG7A 1H2TZ 2NUPB 4C92E 1SJ1A 4NA2A 2MKKA 1FD2A 2EGAA 1K73C 2ZKTA 1DTTB 3M9QA 2EJ9A 4Q44A 3DFEA 2E5QA 1AYEA 1VRQC 4F4WA 5KFHA 1HJDA 4HT7A 3O5TB 3FC3A 4RO0A 3QATA 2ZZTA 4J9SA 4E98A 2XCAA 1OZ3A 2JMAA 3I0SA 4X64J 1GXUA 4NZ6A 4JV1A 1WZOA 3IWXA 4QOTA 2HHQA 4ZOSA 5T7LB 4LN2A 4F7UA 4UUWA 1YLXA 2UV8G 3TEHB 2EYWA 5ETOA 3FJ2A 1WC4A 3CJSA 1SL2A 3K8VA 2RJDA 1XWLA 1UVIA 3AODA 2ZH7A 2RJCA 4NOYA 4M5GA 3ULRB 1Q95G 2Y1LB 3CC2S 3QWYA 4NOHA 4DJBA 2IVMA 1VQLQ 2FD2A 4IOCQ 3KLGA 4KGXB 2V94A 1TU0B 5FU7C 2YNIB 3L3CA 2YUQA 4KPYA 2QL5B 1YVFA 5F3ZA 1N6AA 1PKUA 2O9SA 2FUG9 5GAMe 4DR3F 1I07A 1NSAA 3R5CA 4E7IA 1AUDA 3Q8PB 2PA8D 3M53A 5KYWB 3CCVQ 3TZZA 2KXNB 4MT1A 3LGHA 2HG4A 2MY7A 2CH4A 2V4QA 4OB0B 1YJNQ 2DIQA 4BI8B 2D9PA 2YLBA 1BB9A 4A8MP 2EQMA 1Z9QA 1UL3A 4IFVA 2OIHA 3H59A 2XLIA 1KQSA 3BN7A 3G71T 2XG8A 2QL9B 3MM7A 1RAAB 1ICEB 2AKKA 2LMJA 4WFXA 1UGVA 2MY8A 1VOMA 1WG5A 3KTQA 5HQ8A 3IRWP 3QGPA 2RT3A 1VIOA 2LP4A 3PMIA 2CXEA 3A8HB 2VBYA 2XMTA 3CCRA 3ILOA 1KHVA 2ALZA 4MK7A 4HVWA 1DBDA 4CI0B 3QO9A 5LSLA 4J5OA 3S3OA 5LL6S 4PXDA 2HYIB 1M5VC 2QMWA 2QYGA 1VQKA 1VQMT 4QQDA 4OZ0A 5KFNA 2HKEA 1Q82T 3UR3C 1BI1A 5H9EJ 4B3OB 3SSSA 2DEUA 1APSA 2OKQA 2V4JB 1EFNA 3ENWA 2AGQA 1HR0F 1WG1A 1RU1A 4X4RA 4R0KA 3W5YA 2O01E 1X5TA 1S72T 1QAJA 3LWLA 1QJHA 1N5TA 1XR7A 4L6V5 1E6YB 4ZVGA 4F7UF 1VGYA 1HQEA 5KFJA 2XEXA 3DKMA 1VQYA 1GCPA 3PX0A 3UPUA 3LWHA 2CWKA 2VJVA 2DNQA 4ZCMA 2O2OA 2ATCB 3BPDA 2P2CB 4ZVPB 2FZCB 4ZVFA 3MM8B 3GYGA 1S6QB 3THTA 1NE8A 2IBKA 2ZE2B 2YH1A 3FRZA 4FKYA 3M0TA 1IBMJ 4ZMMA 1LFWA 1D1CA 3PEHA 3AXKA 5KFQA 3QPHA 3TANA 1NU4A 4E7HA 2V9WA 5LJ5g 1SJ4P 2XQCA 1TL7A 1Q86R 2D0NA 1UMJA 2AIRB 4X4SA 2Z56B 2V0NA 2DRKA 1P1TA 2D69A 4RBVA 4O3RA 2YUOA 2ADBA 3FC9A 1WF1A 2C2OB 3WDOA 4Y28E 1LXNA 3M2UB 1S6PA 2VGNA 1ZS6A 3ZFVA 1IKYB 2AEFA 4EMGA 3R9LA 4HCCA 5T14A 3OR1B 2VKRA 2J76E 1XQHA 3ZTSA 3R2CJ 3GR1A 1YHQS 2RRBA 4DUTA 3G6ET 5B08A 4DV7F 3WIUA 2BKPA 2EK1A 3H7HB 4AMCA 2RF2B 4XQ3A 1YDLA 2DRBA 3QGIA 1WXUA 2CG8A 3SDEB 4WFZA 2ZCFB 1WI8A 2CQHA 4NEYA 4KBIA 5B0CA 2YSQA 2NLUA 5I22A 5F9NA 3GSDA 1RTIB 2DL3A 1WOSA 5LJ5f 1FNOA 3CJ5A 2UXCF 2ZUGA 3BQ1A 3CCLA 1MWZA 1PD0A 1QDUB 5DRKA 4Q2MA 3I96A 2QRRA 3NL0A 3EE3A 3A3PB 2FPDA 3BN4A 1RDRA 3PNIA 2LEPA 2V8IA 2XC9A 3TEGA 2EEYA 3Q83A 1S57A 5FU7B 4M5DA 4OGCA 1PJ5A 2A2DA 1UFWA 1TL7B 2ZNYA 1N0VC 3QSIA 1LWEA 2MMPA 3RDVA 2M88A 3ENAA 1HNXJ 5IT9Y 2OJ2A 3BKUA 1URNA 5IHIA 1RGVA 5KFUA 4DL0C 3PEJA 4OLOA 2DEJA 3DLGB 3M8SA 3DOMB 2D1XA 3POTA 2CJAA 3AHPA 4B3RF 3T6JA 3QIPB 2QSWA 2XI9A 2C0OA 3I0RA 3UCUP 2RD5C 4JV5J 4M77D 2KBTA 1X9SA 4U9RA 3W3SA 4DUYJ 1MNDA 3JQKA 1Y0HA 2KVIA 1UJYA 4N56A 3ZZRA 2YNGA 2OI3A 4OB2B 3KOAA 3QZ9B 3QJYA 3HFOA 1LW2B 1NK4A 1JJHA 3AJ2A 1GTHA 1Q7LB 3S3MA 1QLNA 1R8BA 3R7NB 2NXNA 2DHHA 4JZ3A 2CPIA 2HNDB 2VDIA 4ZIVA 3W9HA 4LDXA 4FCYA 4K11A 4WYLA 1HQUB 1WACA 3QJPA 5LJ5d 4OP0A 4E7JA 2ROPA 3AH6A 4I64A 4QW2A 5CVIA 1F9FA 1N36F 3IS9A 5I3PA 2VFSA 1PGZA 1D3BB 3C14B 2FQQB 3KUFA 4EYIB 2C3PA 3EPIA 3OTCA 3W8GA 1VK3A 3KLEB 1JLEB 2K5LA 3E9FA 1AEYA 3A8GB 1WDXA 5J26A 4I2PA 4Y2KA 1ROFA 1D9AA 5I42B 3CCUT 4DN0A 5IZHA 1GMWA 2XMWA 2DKGA 2OGUA 5IT0A 4EDUA 1KD1U 4YDDB 3G71S 3GWCA 5KT4A 3EHQA 4FF2A 2JTMA 2FGCA 2POKA 1MN9A 3TUJC 1VQ8A 2HQIA 2DYIA 3PMTA 3PFEA 2XHCA 5JUMA 2ADCA 3JB9J 2BMBA 1Q7YT 3MM6B 2BE9B 4RNOA 2LXFA 4KC5A 4AUKA 3DRSB 3VUBA 4F4AA 4I7FB 3QWPA 3H5SA 3M9MB 4C0HA 4PXEA 1SRLA 2YBVA 3L4BC 2H1YA 2BXJA 3FEYB 4TU8A 2WVDA 2VBWA 3MM5A 3DRXA 1AHJB 5ETNA 3HKSA 4K2XA 5IHNA 5CYQB 5BR8F 4IO9Q 2HZCA 5DM6Q 2EG1A 2K1RB 4NLQA 2FZGB 2AYBA 1HHTP 3I56S 4Y00A 4ES3A 4KV8B 5AJ3F 4DX5A 2VIHA 1NLKL 1S72A 4HKEA 5E5NA 3M2RB 1KTQA 2Z58B 5FRNA 4HVZA 1RUWA 2C0IA 1OY9A 3GBQA 2BIVA 3T1YF 4FS2A 2WHOA 1NRKA 4YHHF 2UVRA 3UNYA 3ZNJ1 4YMEA 3MPVA 4X65F 2GGPA 3WC0A 4K4YA 2CS7A 2F65A 2WB1D 2HKNA 3NTIA 4F67A 1VQ6S 5J2NB 2H3EB 3SV3A 1KJWA 1QVFA 2HAFA 2YKMB 1M27C 4Z7YA 4WKYA 3EGXB 3RZAA 2PUKB 5EHHA 2V2KA 3JSYA 2IM0A 5F41A 1VQNS 4USTA 3AOBA 2X3WD 1QAYA 4E7KA 1FFGB 1RBOB 4L3KA 2BQUA 1IO6A 2O1PA 9ATCB 2GVZA 2DTIA 3IRXB 3EG3A 2V67A 2PUOB 3JCMe 1FE4A 2GO8A 1WHHA 4J7CA 2VV5A 1KK7A 2MWPA 3MM5B 4MIBA 2Q6CA 4DFPA 1OIAA 4HT5A 1MG7A 5HVGA 5L1JA 2ZBQA 3MCNA 4DR7F 2WBRA 1NYFA 4I69A 4JZ4A 4ILLA 2JVOA 1FYNA 3BO3A 3UCGA 3H20A 4ZVQB 2LTOA 2CNKB 1VS3A 1E6HA 1TUDA 1WOPA 3LGLA 5IC4B 3CCLQ 5F0UA 2M4MA 5LJ3d 2GQ2A 2MSSA 4DPOA 2B4UA 3OL6A 4C8QA 4CO0A 1NUEA 2Z2ZA 4J9QA 2G9OA 3OYLA 2ZUAA 1PC4A 2ZFHA 4FT2A 3KUHA 1ZAXA 4CH0S 3KJNB 4FW2A 1RT7A 4WIQA 1YSJA 4B3MJ 4F2RA 3META 1JLQB 2IVYA 4RW6B 1OY6A 2E5IA 4F3MA 5GAOr 1X9WA 2W0ZA 1U48A 2F4VJ 3TSWA 1R8AA 1FX7A 4A4FA 2ECZA 2QASA 4OHYA 2LQWA 3JCMV 1O0PA 4Q5WA 1DTQB 1JXOA 4QJVA 2XMFA 3QRRA 3JB9G 1QWEA 1NKCA 1NO8A 1T94A 2QGGA 2CREA 4ELYC 3IBCB 3CJ4A 2LCCA 4RUCA 1G3YA 4TYBA 4ZS6A 1N5SA 1AB8A 4NS5A 1NK8A 4OI2A 3OW2R 1W6XA 4MDWA 4J9EA 3OFHA 4D6WA 3QFHA 4TYAA 4RNFA 4O0NA 1VQOQ 3QLHA 4ZHRB 1ZZNA 1IGUA 5DJBA 4L72B 2OD4A 2A6MA 1LWCA 2EYZA 4MYUA 2Q43A 3FK4A 5L1IA 1WHMA 2HWTA 2DISA 4RKUE 1I94F 4YQWA 1IKXB 4FW1A 4QW8A 1FWKA 1CJVA 2C3OA 1VQ9T 3NNCA 4M7AE 5GAEI 5LMUF 4RW8B 1HYSA 1YJTA 1YRTA 3T19A 4RUAA 3JCMW 1CJKB 3N5BA 4A54A 5A0YA 1BWEA 3HK2A 1RWOB 4X66J 4PNOA 2XICA 4JP8A 3RAMA 5FLXU 3P8BB 4DSFA 2COYA 4C5GA 2QA2A 3FZBA 3CIMA 3HKWA 4ZP9A 1U1QA 2HVIA 5AJ3J 3A3NB 5LJ3e 4LJMA 1RLDA 2KFNA 1Y4ZB 2C3UA 2AKLA 3QNWB 1JB0C 4B3TJ 4LT6A 3B54A 3TUPA 4LE9A 4QIFA 2J6OA 4LFAF 1Y10A 2B9XA 3GYNA 1OYXA 1N5VA 3HO1A 1YJUA 3I9V9 4MMOA 1U1KA 4AQYJ 4ZPAA 5KFLA 1D0XA 1UJ6A 4ANJA 3DI6A 4LF6J 1U1TA 3GG1A 2Q3PA 3EG2A 2L9NA 3EFSA 1ZPVA 1VA7A 3PDNA 2R2UA 1NPPA 5DDOC 2KM8B 1YI2T 5GAMj 2RN8A 3JB9I 5J2QB 2JEIA 2CJ9A 4WXWA 1F5CA 1KKHA 4QIWD 1SQEA 2E5JA 1RT3B 1X4HA 2PVDB 3WHIA 3CCMS 4NRUA 2F7VA 1OPLA 2DIVA 1RT3A 1MGQA 4IOAQ 2L2PA 5J2PB 3GIMA 4LFCJ 1BHNA 1YI2S 2AJ4A 3NY0A 3DB3A 1Z4UA 1HNXF 1Y00A 5CZXA 1JJ2R 2XZWA 4ZP7A 2HWHA 4DL3A 4Y92A 1H92A 1DZ5A 3MP1A 2RDJA 3JCMP 4Q8FA 1TXQA 1CBKA 3HTRA 5DO2A 5IQQA 4RUGA 1W2IA 2WSCC 1LWCB 2IMOA 3KMSA 2BX6A 3DHWC 2KYZA 2DHAA 4PJLA 2HVDA 3KLIB 3MEVA 3G7ZA 2RHIA 1D0YA 4RL1A 1DHMA 3Q8QB 1Q8IA 4J83A 1ZQ1A 3ULHA 3D3BJ 4NWBA 5HVHA 2KN4A 5HK4A 1TL3A 1ZX6A 1IUJA 2EKOA 5K14A 1FXRA 2FY8A 2KRRA 2MZQA 5B0AA 2DL5A 2W9BA 4ECYA 3BJYA 1Q81U 4NLTA 2A7YA 4OYPA 4E8UA 3DLKA 4P7TA 4DF4A 3VYHB 3L9ZA 1WHVA 3LH2S 1X4EA 1TKDA 1EB0A 3OYJA 4IR1A 3CD6Q 4KPCA 1MU2A 3ASKA 5KFSA 3MF5A 3MEEB 1NJIC 2M0GB 1TS9A 1MLAA 2GQIA 2YKAA 4J9LA 3GP9A 4WWSA 3U1LA 4BWJA 3UDLA 1M5KC 1IXDA 4N0AC 1VYUA 3GZ7A 1XMQF 4M7DC 5DDRC 2M5YA 4OMQA 3AT1B 4WP3A 3CMEQ 1UEKA 1X27A 3EGUA 3H5XA 1KEKA 4QQ6A 5D78A 1SIZA 2XDDA 4JRKA 2IAJB 2MJUA 3M4XA 3W5ZA 3OQ2A 2VYTA 3IM8A 2XMAA 3R1HA 2UUBF 3Q23A 5HY6A 3BSCA 1YBYA 1S1XB 4UZBA 2QZ8A 3E51A 1D3BA 3JSBA 5L9NA 1EZZB 5KE2A 1UDLA 1JLAA 1TTHB 3B8HA 1U3OA 4Z2XA 3CC4S 3OUYB 1N88A 3BGRB 1C4AA 1SH3A 1TSFA 3KNAA 3JYTA 5C5JA 3A3OB 2XHWA 5CYJA 2C1EB 1SCJB 1C1BB 4RMOA 2FB0A 1IBLJ 3I4PA 4ANCA 2DR7A 2GQCA 4MTPA 1LK5A 2YUNA