1T0JA

Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
RREAERQAQAQLEKAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords voltage-gated calcium channel subunit beta2a
total genus 23
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12052 VGCC_beta4Aa_N Voltage gated calcium channel subunit beta domain 4Aa N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1t0jA00
1CKAA 1M30A 2MOXA 1GFDA 2KBTA 2J05A 1VA7A 2KROA 1WFWA 4HCKA 1ZBJA 2JT4A 1RLPC 1UE9A 2DF6A 2G6FX 1HJDA 2DM1A 2DL3A 2VKNA 2LMJA 1NYFA 2O2OA 1T3SA 2K7AA 1G2BA 2RQVA 3VRYA 2FRWA 2A37A 4J9BA 1PRLC 4J9IA 2KRSA 2EW3A 2OJ2A 4R0KA 4ZNXA 1SRLA 3VS3A 2XMFA 3M0SA 3H0HA 1QKXA 1WXBA 1ZUKA 4AFQC 2DA9A 1X2QA 2GQIA 2V1QA 3UA7A 1AOJA 1VYTA 4E6RA 3H0FA 1NG2A 2YUNA 4RTTA 1X69A 2V1RA 4Y92A 4LUDA 1W6XA 5ECAA 2DX1A 1JEGA 4Z8AA 2VVKA 2O88A 2MCNA 1U06A 2L0AA 1UHFA 4DEYA 1OPLA 1TUCA 2HEQA 1PKSA 5FW9A 1IO6A 3RBBB 1OPKA 2DL5A 2J7IA 1SHFA 1UDLA 1PWTA 2H8HA 2F2VA 2L3SA 1G83A 1T0HA 2K2MA 4OMPA 1RUWA 2PNIA 1UGVA 2ED0A 1BB9A 4LN2A 2IIMA 4KRTA 1GCQA 2LQNA 2K6DA 4AG2C 3R6NA 2ABLA 4J9HA 2DE0X 1ZUUA 1UUEA 1NYGA 3M0UA 3M0TA 4IIOA 4Z88A 2ROLA 2VWFA 2EGCA 4OMLA 2SRCA 1GBQA 3ULRB 2EBPA 2L3PA 2L2PA 1B3QA 2LJ1A 2RF0A 2GTOA 3UF4A 3EGUA 1I07A 4JJBA 2LJ3A 2CT4A 1M8MA 4JPBW 2DL4A 2EKHA 3M0RA 1J3TA 1Z9ZA 5FWCA 3RNJA 1TG0A 1QWEA 2C0IA 4HVWA 2L3QA 1H8KA 1BK2A 1NEGA 1ZX6A 2E5KA 3O5ZA 2JMAA 4RTZA 2RQRA 4IIMA 1MUZA 3LH5A 1ZSGA 4J9DA 2LQWA 1NLPC 2QDLA 4OMNA 3NGPA 2PZ1A 2JXBA 4RUGA 1JXMA 5IHNA 4A63B 1OEBA 4M4ZA 1E6HA 2J6OA 1WXTA 2NWMA 1Z9QA 1ABOA 3VS6A 1AWJA 4QT7A 1AD5A 1WDXA 2FEIA 2YUPA 4RTXA 1MV3A 1UG1A 3PVQA 1K9AA 2KYMA 1YCSB 2ESWA 5L23A 1JXOA 2X3XD 1Y0MA 1OV3A 2RMOA 1FMKA 2JM8A 2ENMA 3THKA 4EIKA 1BU1A 4J9GA 2X3WD 2EYXA 1T3LA 4LUEA 2RQUA 2DRMA 1KIKA 2EYWA 1KFZA 2K79A 2BZXA 3C0CA 2DL8A 1GCPA 1UJYA 1VYVA 2EVRA 2KT8A 1AWWA 5FWBA 1I1JA 2W0ZA 2PTKA 5HCKA 1X27A 3I35A 4HVUA 4GBQA 4FSSA 2EYZA 5IH2A 2AKKA 2K3BA 1WI7A 1WIEA 2KEAA 1GCQC 2CSQA 3EG1A 2JTEA 3PVLA 3TSWA 2DILA 2JS2A 2HCKA 4CC2A 3FJ5A 4JJCA 1AEYA 3VS5A 2C0TA 1K0XA 2M51A 4HXJA 1YN8A 3PE0A 2KNBB 3I5RA 2KYBA 2FO0A 3I9QA 2AKLA 2DL7A 2ROTA 4K11A 4OMOA 2HSPA 2YUOA 3KFVA 1PRMC 2CSIA 1I0CA 2FPEA 2DLPA 2RQTA 4AFZC 1ZLMA 1YWPA 2D8HA 2JS0A 5I22A 2YSQA 1LCKA 1UHCA 1UTIA 1K1ZA 2DJQA 1HD3A 2O9SA 1QLYA 3H41A 4GLMA 1AZEA 1X6GA 4D8KA 1M27C 2BZYA 4CC3A 3TVTA 2KRMA 1PHTA 2CUDA 2FRYA 1UFFA 2RQWA 2J6FA 5IHKA 5EC7A 4DEXA 4CC4B 4JZ4A 1H3HA 1YP5A 2GBQA 2AZSA 1CKBA 1W1FA 2YDLA 1RLQC 1FYNA 1E7OA 1QWFA 1HSQA 1EFNA 4OMQA 1GBRA 4LNPA 4RTWA 3QWXX 3IQLA 1UJ0A 2JW4A 3EHQA 5IHIA 1CSKA 3SHWA 1KSWA 2GNCA 2MIOA 2CREA 2A08A 3QWYA 2A36A 1QCFA 2D0NA 4LE9A 4JJDA 1M3BA 2YUQA 3U23A 1X43A 1T0JA 3VS1A 2LJ0A 2LNHB 1WA7A 2EPDA 1K0SA 3I5SA 5I11A 2DRKA 2KE9A 4JZ3A 1SHGA 1A0NB 2ECZA 1UECA 2SEMA 1GFCA 2OI3A 2BZ8A 1JU5C 2F2WA 2KXDA 2DYBA 1OOTA 2FPDA 4RTYA 2O31A 1AWXA 3CQTA 3VS7A 2CUBA 3ZL7C 1WXUA 4Z89A 1YWOA 3VRZA 1WX6A 2J6KA 1JQQA 2LP5A 1M3AA 5IXFA 1B07A 3NPFA 1S1NA 4X1VA 3TSZA 1JO8A 1ZUYA 3VS4A 2W10A 2O9VA 1VYUA 2P4RA 1X2KA 2C0OA 2CH4W 3VS2A 1GRIA 2CH4A 2HDAA 2BTTA 2KR3A 2EGAA 4AFUC 2GTJA 1SEMA 2LZ6B 2AK5A 1V1CA 4D8DA 1TUDA 4OMMA 3REBB 3EG0A 2JM9A 1SSHA 4HVVA 1WLPB 4RTUA 1X6BA 1ARKA 1SRMA 1E6GA 3GBQA 1NLOC 4F14A 2LCSA 1N5ZA 2RPNA 2D8JA 2EQIA 4ORZA 4AG1C 2AZVA 2FG0A 1K76A 1YNZA 2FPFA 3H0IA 2KGTA 2NUZA 3M0QA 2DMOA 2KT1A 2LX7A 2K9GA 4ESRA 4CC7A 1XOVA 4F16A 4J9CA 1W70A 2DNUA 2YT6A 2B86A 2J06A 2OAWA 4F17A 1U3OA 1NM7A 1AZGB 4J9EA 1MV0B 3EG3A 3NMZC 2DBKA 2EYYA 2KRNA 1NEBA 5GJWB 1U5SA 1PNJA 3REAB 2I0NA 3JV3A 1M3CA 2KXCA 3VS0A 3NHNA 2ED1A 1QKWA 1SPKA 2RNAA 5GJVB 2JMCA 3M0PA 1GL5A 2M0YA 1WYXA 2CT3A 2A28A 2EGEA 3EHRA 2F2XA 1AWOA 2HBWA 3A98A 1KJWA 1AVZC 1Y57A 2CDTA 3UATA 5IXBA 1PKTA 3UA6A 2RN8A 1BBZA 4J9FA 1K4US 1RI9A 1H92A 3EG2A 4AFSC 2D1XA 4RTVA 2DBMA 2GGRA 1ABQA 2DVJA 4WCIA 3SEMA
chains in the Genus database with same CATH superfamily
2MOXA 2QTVA 3CMEQ 4BE2A 1QVFA 2KROA 4HCKA 4BD3A 1VQPT 4MMKA 1RLPC 3JCMf 4M7DC 2DF6A 3N5BB 2P0KA 3VUBA 1N27A 3QZ9B 2LMJA 1NYFA 3G71Q 4OGEA 4M75G 1QVGA 1KHCA 3E9FA 3RDVA 4M77D 1G2BA 4DBHA 3CCEQ 2HKQB 1M2VA 3L2VA 1M1KC 2KRSA 2EW3A 2OJ2A 1SRLA 2XMFA 4IUQA 4BDZA 2RK2A 3L2UA 3VU3C 4QW2A 3H0HA 1QKXA 1YBYA 5GMKm 1ZUKA 4AFQC 1IGUA 2DA9A 5GAOq 1OZ3A 3OYJA 3FC3A 1AOJA 3S3OA 4E6RA 1VQ8A 5KYNA 4M7AA 3EH1A 2V1RA 5GAN6 4X9DA 2O4XA 3L2QA 3X25B 1B34A 3CMEA 2LNVA 3MHXA 2VVKA 4C8QG 3R6OA 2O88A 1NPRA 4M7AE 1UHFA 1OPLA 1TUCA 1ZBXA 2XD0A 5FW9A 1IO6A 3RBBB 1QMCA 3UT1A 4UC4A 1OPKA 2DL5A 3NFCA 2J7IA 5KYXB 1PWTA 6AT1B 4KUDK 3CCSA 3EGDB 3QIIA 4KGZB 2EJFA 3HTRA 1VQ9Q 1BKBA 3M4YA 1RUWA 2ED0A 3CC4T 1NJIC 3UWNA 4ZTJA 4KRTA 3SD4A 5GAMf 2ZPFB 2DTHA 2RHIA 3PIPA 5KH6A 3OBYA 1ZUUA 3DKMA 3OB9A 2GFUA 3M0UA 2DFUA 1VQ5Q 2OTJT 4XU1A 2EGCA 2P4TA 4OMLA 4JRQA 1BIAA 3ULRB 5J39A 1K73R 3X20B 2GTOA 2IVWA 2EFIA 3JCMX 1Q81C 2RI3A 3OYDA 1YIJQ 1M8MA 4JPBW 2DL4A 3ZBDA 1J3TA 4XTUA 4PJOF 2X4JA 4AMCA 4LDYA 3QUIA 2FL7A 2CP2A 4X34A 4RTZA 3CCUT 2RQRA 1M1KU 4X9CA 2CP5A 1XJWB 3LH5A 5CKEA 1WGSA 4FYWB 5GMKj 1ZSGA 3OS0A 2QDLA 4OMNA 1Q82C 4JDSA 2JXBA 2HQEA 3ER0A 4RUGA 1F1BB 1OEBA 4M4ZA 3H8ZA 5LJ3h 5D6WA 1VIEA 1WXTA 1BI3A 2NWMA 3L42A 5EG2A 3VS6A 4QT7A 2XDDA 1IHWA 2OTJA 1UG1A 2ESWA 1Q81U 2QAZA 3SB2A 3J7AF 2RA2A 5L23A 4Y91A 1OV3A 2LVMA 3HSBA 1KC8C 3C4SA 1WJSA 3THKA 4OB3B 2FB7A 1SKUB 4JS4A 3RKXA 4J9GA 1P92A 2EYXA 2CZ0B 3WVEB 3JCMb 2DRMA 1KC8R 2LQKA 1K73C 2BZXA 2GCXA 1AWWA 2W0ZA 3S3NA 5HCKA 1X27A 4II1A 4HVUA 3JB9F 2ZGWA 3CMET 5IH2A 4NL2A 2AKKA 1YHQQ 2R57A 1WIEA 2KEAA 3CC4A 3LH0A 3NTKA 3PVLA 5GAN8 3TSWA 5M9OA 1R77A 2YXYA 2DILA 4IUPA 3CCST 1LNXA 2HCKA 4CC2A 1W2BP 4O5VA 2EQMA 2QQAA 2MWOA 2M51A 5GMKh 4HXJA 4XU2A 1YN8A 1FMVA 4OP0A 2FO0A 1AT1B 1VQ7A 1ZA2B 2AKLA 2DL7A 2DTIA 3JCMV 2OTJQ 4C8QC 4C8QE 1I0CA 2RQTA 4PJJA 1ZLMA 5I22A 1LCKA 4NOYA 3HFOA 3OS2A 1VQ8T 2O9SA 2H3EB 4DBRA 3CCSQ 1VQNA 1KD1R 4M7AG 2KRMA 1PHTA 1Q86R 5CKBA 2XG8D 1FMWA 5CKDA 3CCVT 2DAQA 1KK7A 2AZSA 3SWNB 1UEBA 2YDLA 4IUTA 4RKUE 1KQSA 1FYNA 3EFOB 1RADB 4OMQA 1VQ5T 1RACB 2ZPHB 5LJ5d 2JW4A 5IHIA 2CYZB 1Q7YC 2GNCA 2X35A 3HFNA 3CPWA 3GPLA 1K8AC 2K5FA 3TREA 2L89A 3FJPA 1C0MA 2AT1B 5KCHA 2V8KA 3U23A 2M02A 3WXMB 1M2OA 1T0JA 2CKKA 2HZYA 1K73U 2WSEE 1VQ7T 2KE9A 2CZ1B 1Y96B 2DETA 4M75C 1TS9A 1UECA 1JU5C 3JRZA 3LGFA 2F2WA 2VASA 3I55A 2DYBA 2Y90A 1YJ9T 4ZGDB 3CCET 1AWXA 1BI0A 3CQTA 3VS7A 2CUBA 4BE1A 1RAIB 4E7HA 2DEQA 4AT1B 5KYXA 3G4ST 1JQQA 1MNEA 1M3AA 3M53A 3NTHA 2EQUA 1JO8A 1RAFB 2W10A 2O9VA 5FLXE 1VQOQ 1K9MU 2P4RA 1X2KA 5DY9A 5KYWA 3GLXA 1WQ7A 4E47A 5GMKl 3G71T 3QYHB 1VQPQ 2KR3A 1NE8A 2MAMA 3A8OB 3OSVA 3JAME 4LDWA 4AFUC 3HRSA 5LJ5f 2GTJA 2AIRB 1TUDA 1YHQA 2JM9A 1SSHA 2EQKA 2RJCA 4GLKA 3CCRQ 2K4YA 4C0GA 1ARKA 1QVFS 1SRMA 3TQ7P 1OYXA 4ZGJB 2DEUA 2OX7A 2LCSA 4B9WA 1RL2A 3A8HB 4HT9A 2FG0A 3OY9A 2FPFA 3LWHA 2EWNA 2NYSA 4M7AC 2JUFA 2KI7A 1KQ2A 5GAMg 3EFRA 1YIJA 4ESRA 2QA4A 3QDFA 4IUUA 1M1GA 2B86A 2OAWA 1SSFA 4FW1A 1NM7A 1AZGB 5J26A 3EG3A 2R58A 1H641 1VOMA 2EYYA 4QVCA 2KRNA 4JS5A 1M3CA 3FB9A 3CD6A 2CZ7B 1M90C 3RKWA 3L2WA 4BY6B 1YI2A 1SPKA 4LXCA 2M0YA 3OS1A 2A28A 2EGEA 3EHRA 5HKCA 3CPWS 1YHQT 4M77A 3A98A 1KJWA 1Y57A 2CDTA 3BW1A 3UA6A 3RUXA 5C6SA 5CK9A 3CCLA 1K4US 2RHYA 5D6YA 3PIOA 4IKFA 3QG1A 2QYZA 1H92A 2L8DA 1S72T 1KC8U 2JTMA 5DLQE 2D1XA 2RJFA 1WHGA 2ZCFB 2PQWA 2DVJA 3M56A 4CI0C 1R8OB 2X9HA 5GAOr 1B7TA 2J05A 1Y71A 2E4HA 1D1AA 3OQ5A 4M78A 3CMAQ 2VYTA 8AT1B 3WVDB 2VKNA 2MMPA 4C8QD 1YJ9Q 4C8QB 4TVRA 4F7UB 3L2RA 4JJNK 4M77C 4M78C 4J5YA 4J6YA 2FRWA 2O01E 1M8VA 3QKJA 1D0XA 2E70A 3RKYA 3OYFA 3CEYA 2DK3A 2DTOA 1C1AA 4BB7A 3S3MA 2A7YA 4MZTA 2YRVA 3T9NA 4A54A 4C92D 2GQIA 1VQLA 2V1QA 3CC2A 3UA7A 4DA4A 1VQMA 2RK1A 3GP8A 4OF1A 3H0FA 4EDUA 3OW2A 3A8LB 1JJ2P 4FYVB 4RTTA 3CMAA 3MP6A 3LLRA 4Z8AA 2LX9A 4FT2A 5L8RE 2L0AA 2R5MA 4FYXB 3BY7A 5LJ3j 4OB2B 3JCMh 5HK3A 1OI1A 2L3SA 1PSEA 2K2MA 1VQNT 1QW1A 2X4WA 2FVUA 3PNWC 1GCQA 2K6DA 5KYYB 5FU6C 3MEVA 2ABLA 4RCBA 3G7ZA 4PLIA 1UUEA 1M90U 1NYGA 2CP7A 3M0TA 2ZAEA 4D6WA 2LRQA 3J80E 2L3PA 1BCOA 2CS7A 1B3QA 4MZMA 2LJ1A 4PJNA 3UF4A 4M7DF 3D7SB 2LJ3A 2CT4A 3PTAA 1RAAB 4M78F 3M0RA 1Z9ZA 3NTIA 1TG0A 1QWEA 2C0IA 3QXEB 4M78B 1ZX6A 2E5KA 3BDLA 3P8DA 3GNGA 1N8RU 3PFSA 4IIMA 2KDSA 1B34B 2LQWA 8ATCB 1JXMA 5LL6S 1Q7YR 4EMKC 2YRDA 1EIFA 1U8RA 1Z9QA 1ACMB 2NUPB 4M7DE 1IRXA 1UB4A 1AD5A 1VQ7Q 2YUPA 4J8OA 3V8JA 1MV3A 3PVQA 4RCCA 1K9AA 4A53A 2EAYA 3CCJQ 1JXOA 1VQ4T 2K5IA 3VUZA 2RMOA 4LD9K 1VQ8Q 5GAN5 2OTLA 1OX8A 4EIKA 3JCMd 1AHJB 2VXFA 2YRCA 2MF2A 2X3WD 4BY6C 1T3LA 2RQUA 3KXTA 1MHNA 1KFZA 4WF2A 2D6FA 1GCPA 2EVRA 2MWPA 1KHIA 2QEXA 2KT8A 5FWBA 1I1JA 3OSSC 2DERA 3CD6T 1M9SA 4GBQA 4FSSA 2EYZA 2WSFE 2K3BA 2K57A 3HP9A 1WI7A 2QEXT 2PUOB 4M7DB 2CSQA 5GAN4 2JTEA 1M2VB 2BKDN 1YJNA 5GANf 4BUGA 2OTLQ 2OTLT 3AT1B 4JJCA 4L6V5 3VS5A 2RI2A 3H6ZA 3I5RA 3DB3A 3I9QA 2QXFA 2ROTA 4OMOA 2YUOA 3MJXA 3KFVA 1PRMC 3DB4A 5I2MA 4XTZA 3MKDA 2QQSA 4AFZC 2D8HA 2JS0A 2LCCA 5LJ5e 5CIUA 3JCMQ 1VQOT 4M7AD 1RAEB 2KK4A 4FU6A 5GAMe 1X6GA 1VQ9A 2VUBA 1M27C 4CC3A 3TVTA 4QQ6A 5GANj 1UFFA 4MDXA 5IHKA 2XDBA 3HPWA 5FU6B 4DEXA 1MMNA 3P8HA 4CC4B 1H3HA 5GAMd 2GBQA 4PKCC 2DD5A 1W1FA 4C92A 1RLQC 1M90R 1E7OA 4A4GA 1D09B 4BDYA 1GBRA 5I2SA 3QWXX 1TXQA 5CO7A 1Q82R 3V7RA 1UJ0A 1CSKA 2XU8A 3SHWA 2JNGA 1C6VX 2A36A 4A4KA 1WHMA 4JJDA 4E7KA 1M3BA 4Z02A 1X43A 1JBMA 2ZPGB 4J83A 2QG9B 2HNIA 2DO3A 1K0SA 3I5SA 5I11A 4F7UG 4M75D 4EMGA 2ECZA 1BI1A 1IXDA 3I56A 2P0QA 1OOTA 5FROA 3FEOA 4KGVB 1QVFP 4PK4A 1WXUA 4Z89A 1VQPA 1YWOA 2KMTA 5IXFA 1B07A 3INZA 4X1VA 4J7FA 3PMTA 3PGGA 3GIBA 4PFPA 1ZUYA 2Y4XA 3VS4A 5LJ3g 3M5AA 2ZZDA 3MP1A 1TWBA 3OMGA 5CKHA 3VS2A 2HDAA 1WJRA 5GANd 2BTTA 5D7UA 4BI3A 5FU7C 1D0ZA 4C0ZA 3CC2T 2LZ6B 2L5QA 3CC7A 2E6NA 3I56Q 4OMMA 3EG0A 1PC0A 1WLPB 4RTUA 1YI2Q 4XTXA 3CD6Q 1VQKT 2NLUA 1NLOC 4F14A 2QEXQ 4C92G 2RPNA 2D8JA 4KT0E 2EQIA 2F5TX 4R55A 4ORZA 4AG1C 2AZVA 4BACA 4PJOB 2JTFA 1ZSZC 3VYGA 1K76A 3H0IA 2NUZA 3MEWA 2DMOA 2LX7A 5CKFA 1VQ4Q 1OU9A 5GAN2 3JSCA 4CC7A 1FWZA 2LDMA 1TUGB 4KUIA 2J06A 2NUTB 1UGPB 4L5GA 1JRIA 2E6ZA 4IURA 1VQ6Q 3NMZC 3M55A 1BI2A 3VS0A 3NHNA 1QKWA 2RNAA 5GJVB 1GL5A 4XTYA 2NUPA 2DKGA 3L2ZA 4OVAA 2HQHA 2PVDB 5KE3A 3UATA 4M77G 5IXBA 4FT4A 3CCLQ 3CCLT 4FIBA 1SG5A 3TEEA 5KYWB 1RI9A 2V8JA 3EG2A 4XTVA 4AFSC 3EH2A 2GF7A 2DBMA 4M75A 2GGRA 4ZGEB 1VIFA 5CQXA 4WCIA 2WSCE 1QVGS 4M77E 2B8AA 3CBPA 3CCMQ 3CCQT 1G5VA 4C5GA 2ZPEB 1VQ6T 4FM4B 1VA7A 1HK9A 3CPWP 4V2SA 5KYYA 1UE9A 3X24B 2DM1A 1HJDA 2DL3A 2LCLA 3L1AA 1Q7YU 2QA4Q 3CXCP 4LD6A 2O2OA 3PMIA 4M77F 2HAXA 1XQHA 1T3SA 2K7AA 4E7LA 3EG9A 2RQVA 3VRYA 3X26B 1MMDA 4C8QF 1IHVA 3MPUB 2A37A 3HRTA 1XNIA 5KCOA 2X51A 4R0KA 4ZNXA 2DIGA 3VS3A 2C06A 3MO8A 1YFNA 1RI0A 5LJ5h 1OQKA 1QVPA 3SWNC 1X2QA 1D1BA 2D9TA 3DLMA 2HBPA 4C5IA 4QKUA 5LJ5j 3G1JA 3HL8A 2L3RA 2DJZA 4QQDA 5CQYA 3OYIA 4E2FB 3JCMe 1WZOA 5ECAA 4C92E 1G3SA 1N6AA 1YITA 2MCNA 2VC8A 1U06A 4LDXA 4DEYA 4GY5A 2K3YA 4M78E 1PKSA 2VGNA 2QI2A 1VQMQ 1UDLA 2V8IA 2F2VA 4C92B 1M1FA 5A2QE 4PJOG 4MMLA 3X28B 3TU4K 3I55T 4LN2A 4XU3A 4E7JA 2LQNA 2ZPIB 3R6NA 4ELYC 1UGSB 2D0QB 2DE0X 2EJ9A 2HD0A 1G3YA 2M0OA 4EMKB 7AT1B 4IIOA 2ROLA 2VWFA 1VQKA 4B6MA 1MGQA 2QQ9A 5GAN7 1W2BA 2L2PA 2KY9A 2RF0A 3EGUA 2XI9A 1K8AR 1KG1A 2E41A 1Y07A 1W2BS 1VQ5A 3OYEA 3RNJA 2EJGA 2RJEA 2MYSA 3URGA 5KE2A 1NZ9A 2L3QA 1H8KA 1BK2A 1NEGA 3CCVA 5DM7R 2IPOB 3O5ZA 3SDZA 4XAXB 1LJOA 2JMAA 3OYCA 3C95A 4PLLA 4MDWA 1D1CA 4FCYA 3LX7A 3DLLA 1IB8A 2PUKB 2YLBA 3E1SA 3NGPA 3ZFJA 2PZ1A 3EFOA 4A63B 4J6WA 1E6HA 5FRNA 3JCMW 3JB9G 1ABOA 3RESA 3OYNA 1PD1A 2DVEA 2EKOA 4O6JA 1PM3A 3QBYA 3CCMA 4JLGA 3JCMg 2KYMA 1YCSB 3EGXA 3H9NA 5CCAA 3QSUA 1M4ZA 2X3XD 1Y0MA 1WHKA 1OZ2A 2DZ9A 2ENMA 3OYAA 4JLIA 2O4XB 4JUVA 1UGQB 1VQLT 1NBEB 3BFMA 2QTXA 4XQ3A 2EYWA 4KULA 2K79A 2M16A 2DL8A 4RMOA 3OYYA 2RHZA 4PJLA 4VUBA 4JRPA 3I35A 2DZCA 2BE9B 2V26A 2RH2A 3E2UA 4L59A 1GCQC 3EG1A 2FZKB 4F04B 3CBMA 4M7AF 1Q86C 1JJ2A 4JRIA 3GF5A 2YLCA 2G3RA 3M59A 2LT1A 2JS2A 3FJ5A 2QK0A 1I5LA 2C0TA 1N9SA 2E3HA 1K0XA 3LWIA 2VGMA 3JB9H 1ZSZA 3E19A 4KBMB 4E7ZA 1YITT 2FPEA 4ME7A 4DBFA 2DLPA 3HRUA 1YWPA 4PJOC 1S72A 2YSQA 4Q5WA 4PFOA 1UHCA 4EMKA 1K1ZA 1HD3A 3A8GB 2VV5A 2XHCA 4DOWA 3I55Q 1QLYA 2DIQA 3H41A 1AZEA 3OYGA 4KH0B 2BZYA 2E65A 2CUDA 1WHLA 3QYGB 2FRYA 1S72Q 4FW2A 4ATOA 4FYYB 3CCUA 4LDVA 1YI2T 4JZ4A 3MEAA 2QQBA 1VQ6A 4M77B 1YP5A 5CAIA 2PU9B 5FU7B 5CR2A 3CCVQ 2FZGB 1CKBA 3OYHA 3QJYA 4XU0A 3EG9B 1EX4A 5HY6A 1G3WA 3V8LA 3SFMA 3IQLA 3EHQA 1KSWA 2MIOA 1YIJT 1BYMA 4FSXA 4M7DA 1X6OA 2RM4A 2D0NA 1VQ4A 1BIBA 3QDRB 2XDPA 2YUQA 2CP3A 1MMGA 1IZ6A 2LJ0A 1QVGP 2RHUA 3CCQA 3ASKA 3CCUQ 2LNHB 1N8RR 4Y28E 4M7AB 2DRKA 2LTOA 5GAOl 1SHGA 3V7SA 1A0NB 2DXUA 1GFCA 2OI3A 3EAEA 4A4HA 2KXDA 1VQNQ 3CC7Q 3EGXB 5GAMj 1XTDA 3G71A 5GAOp 2LP5A 2RJDA 3NPFA 1IGQA 2VXEA 3M4GA 3TSZA 4OB1B 3JB9I 1NJIU 1VYUA 2CH4W 1QQJA 1GRIA 3BDUA 1ZA1B 3RMSA 1RAHB 2XKOC 2EGAA 3BE3A 2XIDA 3GNFB 3J81E 4C5HA 3OYBA 2CGHA 4D8DA 3REBB 4PL6A 3F70A 1X6BA 4E7IA 1PG5B 1E6GA 3CCMT 3CCQQ 2JVVA 1QCOA 1ZSZB 3MCAB 2E12A 4HA8A 4NL3A 4PJOD 5D6XA 3V8KA 2COYA 2K9GA 9ATCB 4ZN3A 4B9XA 2VB6A 5GAN3 1PCXA 1XOVA 4RG8A 4F16A 1KQSP 4J9CA 1D0YA 2DNUA 1U1TA 4F17A 5AYFA 3SWNA 1U3OA 5IT9E 2DD4A 1WHHA 2X4XA 5LJ3d 4J9EA 2HL5C 1RABB 1PNJA 3REAB 2KXCA 1Q95G 5IAYA 4HKEA 5I21A 2JMCA 3CMAT 3ZEHA 1WYXA 4DQ2A 1AWOA 2HBWA 2BE7D 4N4GA 2RN8A 1BBZA 1QP3A 3CBOA 2QGFB 5LJ5g 2DXCA 5GMKe 3I56T 3FLGA 3CCJA 1OX9A 1CKAA 1M30A 3VV0A 2R5AA 3HKSA 1GFDA 2KBTA 2Z0WA 3GOXA 1K9MR 2BUDA 1WFWA 3CPFA 4N0AC 2FHDA 1ZBJA 2JT4A 4M7DD 1M5Q1 2G6FX 1VQ9T 4HCZA 1DJ7B 3VJPA 3JB9D 2HMAA 1D3BB 1ZHIA 3M57A 1YJWA 2E64A 3CC2Q 4J9BA 4OMFB 1PRLC 4J9IA 3FRNA 5GAMh 1N8RC 1I4K1 3P8BB 3JCMc 5KYUB 3M58A 2LT4A 3M0SA 3UDCA 1YJWQ 1OU8A 1WXBA 3A8MB 3G6EQ 2K2VA 3OYMA 1KD1C 4PJOE 1VYTA 5IN1A 2M9UA 1YJNT 4A4EA 1QP2A 1NG2A 1TH7A 1VQOA 5LJ3e 2YUNA 1X69A 4Y92A 4LUDA 5A0DA 1W6XA 2DX1A 3OW2S 1WHJA 1JEGA 4M75E 2RI5A 1G3TA 1MMAA 5GAOn 1LVKA 4KH1B 2E1HA 4C0FA 1ZQ1A 2HEQA 5HK0A 4NS5A 2YHTA 1FX7A 3PT9A 1WNLA 2WACA 3OYLA 1SHFA 2H8HA 4M78G 1G83A 1T0HA 4OMPA 2PNIA 2XK0A 1UGVA 1NPPA 1BB9A 3QJ6A 2IIMA 1V29B 1IREB 2E3IA 2X4YA 4AG2C 4J9HA 1RAGB 2K5LA 3JCMP 4QVZA 4BI4A 4Z88A 2JZ2A 1OULA 3RIRA 1H3ZA 3QHSA 1W4SA 1GBQA 2SRCA 2EBPA 2LC4A 3M9QA 5GANh 4C0DC 2EQJA 2E10A 3M54A 3OMCA 2RO0A 1Y7XA 2HQXA 2I2LA 1Y96A 2GFAA 1I07A 4JJBA 3KBGA 1JJ2S 2EKHA 5FWCA 2OAUA 1U1SA 2K3XA 1Q86U 3AHUA 4HVWA 4MZPA 4C92C 5A0GA 2DYIA 2A0FB 2P0PA 4C0DB 3LYIA 1VUBA 2NUTA 1MUZA 2JN0A 2AHJB 3O8VA 4J9DA 3V7CA 4FL6A 1NLPC 2CP6A 3KUFA 5GAOm 5IHNA 5KYUA 3QZ5B 1O9SA 2J6OA 4M7DG 3EGDA 2DXBA 1AWJA 1GXIE 4C8QA 1WDXA 2FEIA 4F7UA 1D3BA 4RTXA 1X75C 4N4HA 2F5KA 2ZPBB 2LQ8A 2YWWA 2Y4YA 3CCJT 2QGGA 3CXCA 1WPYA 2F1LA 1FMKA 2JM8A 1BU1A 3MP8A 3CC4Q 1JB0E 1TSFA 1K8AU 3G4SQ 3E9GA 3OYKA 4LUEA 1KIKA 4XTWA 4E7SA 1BCMA 3C0CA 3CXCS 3FIFA 1UJYA 1VYVA 5GMKi 2PTKA 4KGXB 2FYKA 1YCYA 2GQVA 3META 3ME9A 4OB0B 5CVIA 3LW5E 2KAFA 2HKNA 1NJIR 2P84A 3UPUA 4BI8B 3VYHB 2A3LA 1I8FA 3RERA 1TTHB 3S6WA 1VQMT 2QQRA 2FZCB 2PVGB 4HCBA 4PNOA 1AEYA 2H3JA 2MPXC 4PJOA 1K9MC 2JOYA 2E5QA 3PE0A 2KNBB 1WJQA 2KYBA 1VQKQ 3OA6A 1X01A 4K11A 2HSPA 3LGLA 2CSIA 4PJMA 4YTLA 3HHTB 4JRKA 1TOVA 2EIFA 2MK5A 1Q81R 1MNDA 1UTIA 2DJQA 4HCCA 4GLMA 4D8KA 3RMQA 1HYOA 3OS5A 4BE0A 5FRMA 4N0AA 2DXTA 2RQWA 2J6FA 1KQ1A 5EC7A 3CCRT 4EPCA 3TCJA 4F7UF 3OBWA 2IG0A 1QWFA 1HSQA 1EFNA 4LNPA 4RTWA 1PSFA 4XK8E 4EMHA 1VQLQ 2EYQA 3G6EA 4RG2A 2CREA 2A08A 3QWYA 1I81A 3JCMJ 2BIVA 1QCFA 3FDRA 4LE9A 1UGRB 3VS1A 4LDUA 1WA7A 2EPDA 2HSEB 2MI6A 2ATCB 4JZ3A 2KVQG 4M75B 1N9RA 5GANe 2SEMA 3VKIA 5A0LA 2BZ8A 1V76A 4ZN1A 2FPDA 4RTYA 1R0CB 2QA4T 2O31A 3EFSA 3A1PA 3ZL7C 2F69A 3QO3A 2M1HA 4QQGA 3VRZA 4J7IA 1LOJA 1WX6A 2J6KA 2KSSA 1TU0B 1HXDA 2RD1A 1YITQ 1S1NA 2XICA 4PFZA 1EZZB 5DLOA 3OW2P 3JB9J 4CRIA 4ELZC 2PVOB 2JJ9A 4F7UE 2C0OA 2CH4A 4N4IA 1KQSS 4WTOB 1YJNQ 3C94A 2COWA 4QVDA 1QCNA 1SEMA 4OGCA 4IUVA 2AK5A 1V1CA 1I5OB 1SF9A 4HVVA 5C0MA 4P5NA 3GBQA 4C5EA 1N5ZA 4M78D 4DBQA 1YNZA 3G4SA 1FXXA 2KGTA 2QASA 3M0QA 1KD1U 1YJWT 2CP0A 2KT1A 1M1KR 3Q1JA 3G6ET 1YJ9A 4R56A 5AT1B 3MEUA 3C12A 1W70A 2YT6A 1O75A 4DOVA 2KQWA 2QDYB 2DPPB 3RR6A 1MV0B 2DBKA 5GANg 1NEBA 5GJWB 1U5SA 1LPLA 2I0NA 3JV3A 5J3BA 1G8XA 2RHXA 2ED1A 4A4FA 3CCRA 1R0BG 3M0PA 3QPHA 4C92F 2CT3A 2F2XA 3A5ZB 2RB6A 1AVZC 3CCEA 4M75F 3CC7T 5LJ3f 1PKTA 1Q82U 2COZA 4J9FA 2CZ6B 2HL3A 4ZTFA 4HT8A 1PD0A 4J6XA 4RTVA 4ANJA 1ABQA 1WQWA 3SEMA
chains in the Genus database with same CATH topology
1CKAA 1M30A 2MOXA 1GFDA 2KBTA 2J05A 1VA7A 2KROA 1WFWA 4HCKA 1ZBJA 2JT4A 1RLPC 1UE9A 2DF6A 2G6FX 1HJDA 2DM1A 2DL3A 2VKNA 2LMJA 1NYFA 2O2OA 1T3SA 2K7AA 1G2BA 2RQVA 3VRYA 2FRWA 2A37A 4J9BA 1PRLC 4J9IA 2KRSA 2EW3A 2OJ2A 4R0KA 4ZNXA 1SRLA 3VS3A 2XMFA 3M0SA 3H0HA 1QKXA 1WXBA 1ZUKA 4AFQC 2DA9A 1X2QA 2GQIA 2V1QA 3UA7A 1AOJA 1VYTA 4E6RA 3H0FA 1NG2A 2YUNA 4RTTA 1X69A 2V1RA 4Y92A 4LUDA 1W6XA 5ECAA 2DX1A 1JEGA 4Z8AA 2VVKA 2O88A 2MCNA 1U06A 2L0AA 1UHFA 4DEYA 1OPLA 1TUCA 2HEQA 1PKSA 5FW9A 1IO6A 3RBBB 1OPKA 2DL5A 2J7IA 1SHFA 1UDLA 1PWTA 2H8HA 2F2VA 2L3SA 1G83A 1T0HA 2K2MA 4OMPA 1RUWA 2PNIA 1UGVA 2ED0A 1BB9A 4LN2A 2IIMA 4KRTA 1GCQA 2LQNA 2K6DA 4AG2C 3R6NA 2ABLA 4J9HA 2DE0X 1ZUUA 1UUEA 1NYGA 3M0UA 3M0TA 4IIOA 4Z88A 2ROLA 2VWFA 2EGCA 4OMLA 2SRCA 1GBQA 3ULRB 2EBPA 2L3PA 2L2PA 1B3QA 2LJ1A 2RF0A 2GTOA 3UF4A 3EGUA 1I07A 4JJBA 2LJ3A 2CT4A 1M8MA 4JPBW 2DL4A 2EKHA 3M0RA 1J3TA 1Z9ZA 5FWCA 3RNJA 1TG0A 1QWEA 2C0IA 4HVWA 2L3QA 1H8KA 1BK2A 1NEGA 1ZX6A 2E5KA 3O5ZA 2JMAA 4RTZA 2RQRA 4IIMA 1MUZA 3LH5A 1ZSGA 4J9DA 2LQWA 1NLPC 2QDLA 4OMNA 3NGPA 2PZ1A 2JXBA 4RUGA 1JXMA 5IHNA 4A63B 1OEBA 4M4ZA 1E6HA 2J6OA 1WXTA 2NWMA 1Z9QA 1ABOA 3VS6A 1AWJA 4QT7A 1AD5A 1WDXA 2FEIA 2YUPA 4RTXA 1MV3A 1UG1A 3PVQA 1K9AA 2KYMA 1YCSB 2ESWA 5L23A 1JXOA 2X3XD 1Y0MA 1OV3A 2RMOA 1FMKA 2JM8A 2ENMA 3THKA 4EIKA 1BU1A 4J9GA 2X3WD 2EYXA 1T3LA 4LUEA 2RQUA 2DRMA 1KIKA 2EYWA 1KFZA 2K79A 2BZXA 3C0CA 2DL8A 1GCPA 1UJYA 1VYVA 2EVRA 2KT8A 1AWWA 5FWBA 1I1JA 2W0ZA 2PTKA 5HCKA 1X27A 3I35A 4HVUA 4GBQA 4FSSA 2EYZA 5IH2A 2AKKA 2K3BA 1WI7A 1WIEA 2KEAA 1GCQC 2CSQA 3EG1A 2JTEA 3PVLA 3TSWA 2DILA 2JS2A 2HCKA 4CC2A 3FJ5A 4JJCA 1AEYA 3VS5A 2C0TA 1K0XA 2M51A 4HXJA 1YN8A 3PE0A 2KNBB 3I5RA 2KYBA 2FO0A 3I9QA 2AKLA 2DL7A 2ROTA 4K11A 4OMOA 2HSPA 2YUOA 3KFVA 1PRMC 2CSIA 1I0CA 2FPEA 2DLPA 2RQTA 4AFZC 1ZLMA 1YWPA 2D8HA 2JS0A 5I22A 2YSQA 1LCKA 1UHCA 1UTIA 1K1ZA 2DJQA 1HD3A 2O9SA 1QLYA 3H41A 4GLMA 1AZEA 1X6GA 4D8KA 1M27C 2BZYA 4CC3A 3TVTA 2KRMA 1PHTA 2CUDA 2FRYA 1UFFA 2RQWA 2J6FA 5IHKA 5EC7A 4DEXA 4CC4B 4JZ4A 1H3HA 1YP5A 2GBQA 2AZSA 1CKBA 1W1FA 2YDLA 1RLQC 1FYNA 1E7OA 1QWFA 1HSQA 1EFNA 4OMQA 1GBRA 4LNPA 4RTWA 3QWXX 3IQLA 1UJ0A 2JW4A 3EHQA 5IHIA 1CSKA 3SHWA 1KSWA 2GNCA 2MIOA 2CREA 2A08A 3QWYA 2A36A 1QCFA 2D0NA 4LE9A 4JJDA 1M3BA 2YUQA 3U23A 1X43A 1T0JA 3VS1A 2LJ0A 2LNHB 1WA7A 2EPDA 1K0SA 3I5SA 5I11A 2DRKA 2KE9A 4JZ3A 1SHGA 1A0NB 2ECZA 1UECA 2SEMA 1GFCA 2OI3A 2BZ8A 1JU5C 2F2WA 2KXDA 2DYBA 1OOTA 2FPDA 4RTYA 2O31A 1AWXA 3CQTA 3VS7A 2CUBA 3ZL7C 1WXUA 4Z89A 1YWOA 3VRZA 1WX6A 2J6KA 1JQQA 2LP5A 1M3AA 5IXFA 1B07A 3NPFA 1S1NA 4X1VA 3TSZA 1JO8A 1ZUYA 3VS4A 2W10A 2O9VA 1VYUA 2P4RA 1X2KA 2C0OA 2CH4W 3VS2A 1GRIA 2CH4A 2HDAA 2BTTA 2KR3A 2EGAA 4AFUC 2GTJA 1SEMA 2LZ6B 2AK5A 1V1CA 4D8DA 1TUDA 4OMMA 3REBB 3EG0A 2JM9A 1SSHA 4HVVA 1WLPB 4RTUA 1X6BA 1ARKA 1SRMA 1E6GA 3GBQA 1NLOC 4F14A 2LCSA 1N5ZA 2RPNA 2D8JA 2EQIA 4ORZA 4AG1C 2AZVA 2FG0A 1K76A 1YNZA 2FPFA 3H0IA 2KGTA 2NUZA 3M0QA 2DMOA 2KT1A 2LX7A 2K9GA 4ESRA 4CC7A 1XOVA 4F16A 4J9CA 1W70A 2DNUA 2YT6A 2B86A 2J06A 2OAWA 4F17A 1U3OA 1NM7A 1AZGB 4J9EA 1MV0B 3EG3A 3NMZC 2DBKA 2EYYA 2KRNA 1NEBA 5GJWB 1U5SA 1PNJA 3REAB 2I0NA 3JV3A 1M3CA 2KXCA 3VS0A 3NHNA 2ED1A 1QKWA 1SPKA 2RNAA 5GJVB 2JMCA 3M0PA 1GL5A 2M0YA 1WYXA 2CT3A 2A28A 2EGEA 3EHRA 2F2XA 1AWOA 2HBWA 3A98A 1KJWA 1AVZC 1Y57A 2CDTA 3UATA 5IXBA 1PKTA 3UA6A 2RN8A 1BBZA 4J9FA 1K4US 1RI9A 1H92A 3EG2A 4AFSC 2D1XA 4RTVA 2DBMA 2GGRA 1ABQA 2DVJA 4WCIA 3SEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKA A;  1M30 A;  2MOX A;  1GFD A;  2KBT A;  2J05 A;  1VA7 A;  2KRO A;  1WFW A;  4HCK A;  1ZBJ A;  2JT4 A;  1RLP C;  1UE9 A;  2DF6 A;  2G6F X;  1HJD A;  2DM1 A;  2DL3 A;  2VKN A;  2LMJ A;  1NYF A;  2O2O A;  1T3S A;  2K7A A;  1G2B A;  2RQV A;  3VRY A;  2FRW A;  2A37 A;  4J9B A;  1PRL C;  4J9I A;  2KRS A;  2EW3 A;  2OJ2 A;  4R0K A;  4ZNX A;  1SRL A;  3VS3 A;  2XMF A;  3M0S A;  3H0H A;  1QKX A;  1WXB A;  1ZUK A;  4AFQ C;  2DA9 A;  1X2Q A;  2GQI A;  2V1Q A;  3UA7 A;  1AOJ A;  1VYT A;  4E6R A;  3H0F A;  1NG2 A;  2YUN A;  4RTT A;  1X69 A;  2V1R A;  4Y92 A;  4LUD A;  1W6X A;  5ECA A;  2DX1 A;  1JEG A;  4Z8A A;  2VVK A;  2O88 A;  2MCN A;  1U06 A;  2L0A A;  1UHF A;  4DEY A;  1OPL A;  1TUC A;  2HEQ A;  1PKS A;  5FW9 A;  1IO6 A;  3RBB B;  1OPK A;  2DL5 A;  2J7I A;  1SHF A;  1UDL A;  1PWT A;  2H8H A;  2F2V A;  2L3S A;  1G83 A;  1T0H A;  2K2M A;  4OMP A;  1RUW A;  2PNI A;  1UGV A;  2ED0 A;  1BB9 A;  4LN2 A;  2IIM A;  4KRT A;  1GCQ A;  2LQN A;  2K6D A;  4AG2 C;  3R6N A;  2ABL A;  4J9H A;  2DE0 X;  1ZUU A;  1UUE A;  1NYG A;  3M0U A;  3M0T A;  4IIO A;  4Z88 A;  2ROL A;  2VWF A;  2EGC A;  4OML A;  2SRC A;  1GBQ A;  3ULR B;  2EBP A;  2L3P A;  2L2P A;  1B3Q A;  2LJ1 A;  2RF0 A;  2GTO A;  3UF4 A;  3EGU A;  1I07 A;  4JJB A;  2LJ3 A;  2CT4 A;  1M8M A;  4JPB W;  2DL4 A;  2EKH A;  3M0R A;  1J3T A;  1Z9Z A;  5FWC A;  3RNJ A;  1TG0 A;  1QWE A;  2C0I A;  4HVW A;  2L3Q A;  1H8K A;  1BK2 A;  1NEG A;  1ZX6 A;  2E5K A;  3O5Z A;  2JMA A;  4RTZ A;  2RQR A;  4IIM A;  1MUZ A;  3LH5 A;  1ZSG A;  4J9D A;  2LQW A;  1NLP C;  2QDL A;  4OMN A;  3NGP A;  2PZ1 A;  2JXB A;  4RUG A;  1JXM A;  5IHN A;  4A63 B;  1OEB A;  4M4Z A;  1E6H A;  2J6O A;  1WXT A;  2NWM A;  1Z9Q A;  1ABO A;  3VS6 A;  1AWJ A;  4QT7 A;  1AD5 A;  1WDX A;  2FEI A;  2YUP A;  4RTX A;  1MV3 A;  1UG1 A;  3PVQ A;  1K9A A;  2KYM A;  1YCS B;  2ESW A;  5L23 A;  1JXO A;  2X3X D;  1Y0M A;  1OV3 A;  2RMO A;  1FMK A;  2JM8 A;  2ENM A;  3THK A;  4EIK A;  1BU1 A;  4J9G A;  2X3W D;  2EYX A;  1T3L A;  4LUE A;  2RQU A;  2DRM A;  1KIK A;  2EYW A;  1KFZ A;  2K79 A;  2BZX A;  3C0C A;  2DL8 A;  1GCP A;  1UJY A;  1VYV A;  2EVR A;  2KT8 A;  1AWW A;  5FWB A;  1I1J A;  2W0Z A;  2PTK A;  5HCK A;  1X27 A;  3I35 A;  4HVU A;  4GBQ A;  4FSS A;  2EYZ A;  5IH2 A;  2AKK A;  2K3B A;  1WI7 A;  1WIE A;  2KEA A;  1GCQ C;  2CSQ A;  3EG1 A;  2JTE A;  3PVL A;  3TSW A;  2DIL A;  2JS2 A;  2HCK A;  4CC2 A;  3FJ5 A;  4JJC A;  1AEY A;  3VS5 A;  2C0T A;  1K0X A;  2M51 A;  4HXJ A;  1YN8 A;  3PE0 A;  2KNB B;  3I5R A;  2KYB A;  2FO0 A;  3I9Q A;  2AKL A;  2DL7 A;  2ROT A;  4K11 A;  4OMO A;  2HSP A;  2YUO A;  3KFV A;  1PRM C;  2CSI A;  1I0C A;  2FPE A;  2DLP A;  2RQT A;  4AFZ C;  1ZLM A;  1YWP A;  2D8H A;  2JS0 A;  5I22 A;  2YSQ A;  1LCK A;  1UHC A;  1UTI A;  1K1Z A;  2DJQ A;  1HD3 A;  2O9S A;  1QLY A;  3H41 A;  4GLM A;  1AZE A;  1X6G A;  4D8K A;  1M27 C;  2BZY A;  4CC3 A;  3TVT A;  2KRM A;  1PHT A;  2CUD A;  2FRY A;  1UFF A;  2RQW A;  2J6F A;  5IHK A;  5EC7 A;  4DEX A;  4CC4 B;  4JZ4 A;  1H3H A;  1YP5 A;  2GBQ A;  2AZS A;  1CKB A;  1W1F A;  2YDL A;  1RLQ C;  1FYN A;  1E7O A;  1QWF A;  1HSQ A;  1EFN A;  4OMQ A;  1GBR A;  4LNP A;  4RTW A;  3QWX X;  3IQL A;  1UJ0 A;  2JW4 A;  3EHQ A;  5IHI A;  1CSK A;  3SHW A;  1KSW A;  2GNC A;  2MIO A;  2CRE A;  2A08 A;  3QWY A;  2A36 A;  1QCF A;  2D0N A;  4LE9 A;  4JJD A;  1M3B A;  2YUQ A;  3U23 A;  1X43 A;  1T0J A;  3VS1 A;  2LJ0 A;  2LNH B;  1WA7 A;  2EPD A;  1K0S A;  3I5S A;  5I11 A;  2DRK A;  2KE9 A;  4JZ3 A;  1SHG A;  1A0N B;  2ECZ A;  1UEC A;  2SEM A;  1GFC A;  2OI3 A;  2BZ8 A;  1JU5 C;  2F2W A;  2KXD A;  2DYB A;  1OOT A;  2FPD A;  4RTY A;  2O31 A;  1AWX A;  3CQT A;  3VS7 A;  2CUB A;  3ZL7 C;  1WXU A;  4Z89 A;  1YWO A;  3VRZ A;  1WX6 A;  2J6K A;  1JQQ A;  2LP5 A;  1M3A A;  5IXF A;  1B07 A;  3NPF A;  1S1N A;  4X1V A;  3TSZ A;  1JO8 A;  1ZUY A;  3VS4 A;  2W10 A;  2O9V A;  1VYU A;  2P4R A;  1X2K A;  2C0O A;  2CH4 W;  3VS2 A;  1GRI A;  2CH4 A;  2HDA A;  2BTT A;  2KR3 A;  2EGA A;  4AFU C;  2GTJ A;  1SEM A;  2LZ6 B;  2AK5 A;  1V1C A;  4D8D A;  1TUD A;  4OMM A;  3REB B;  3EG0 A;  2JM9 A;  1SSH A;  4HVV A;  1WLP B;  4RTU A;  1X6B A;  1ARK A;  1SRM A;  1E6G A;  3GBQ A;  1NLO C;  4F14 A;  2LCS A;  1N5Z A;  2RPN A;  2D8J A;  2EQI A;  4ORZ A;  4AG1 C;  2AZV A;  2FG0 A;  1K76 A;  1YNZ A;  2FPF A;  3H0I A;  2KGT A;  2NUZ A;  3M0Q A;  2DMO A;  2KT1 A;  2LX7 A;  2K9G A;  4ESR A;  4CC7 A;  1XOV A;  4F16 A;  4J9C A;  1W70 A;  2DNU A;  2YT6 A;  2B86 A;  2J06 A;  2OAW A;  4F17 A;  1U3O A;  1NM7 A;  1AZG B;  4J9E A;  1MV0 B;  3EG3 A;  3NMZ C;  2DBK A;  2EYY A;  2KRN A;  1NEB A;  5GJW B;  1U5S A;  1PNJ A;  3REA B;  2I0N A;  3JV3 A;  1M3C A;  2KXC A;  3VS0 A;  3NHN A;  2ED1 A;  1QKW A;  1SPK A;  2RNA A;  5GJV B;  2JMC A;  3M0P A;  1GL5 A;  2M0Y A;  1WYX A;  2CT3 A;  2A28 A;  2EGE A;  3EHR A;  2F2X A;  1AWO A;  2HBW A;  3A98 A;  1KJW A;  1AVZ C;  1Y57 A;  2CDT A;  3UAT A;  5IXB A;  1PKT A;  3UA6 A;  2RN8 A;  1BBZ A;  4J9F A;  1K4U S;  1RI9 A;  1H92 A;  3EG2 A;  4AFS C;  2D1X A;  4RTV A;  2DBM A;  2GGR A;  1ABQ A;  2DVJ A;  4WCI A;  3SEM A; 
#chains in the Genus database with same CATH topology
 2MOX A;  2QTV A;  3CME Q;  4BE2 A;  1QVF A;  2KRO A;  4HCK A;  4BD3 A;  1VQP T;  4MMK A;  1RLP C;  3JCM f;  4M7D C;  2DF6 A;  3N5B B;  2P0K A;  3VUB A;  1N27 A;  3QZ9 B;  2LMJ A;  1NYF A;  3G71 Q;  4OGE A;  4M75 G;  1QVG A;  1KHC A;  3E9F A;  3RDV A;  4M77 D;  1G2B A;  4DBH A;  3CCE Q;  2HKQ B;  1M2V A;  3L2V A;  1M1K C;  2KRS A;  2EW3 A;  2OJ2 A;  1SRL A;  2XMF A;  4IUQ A;  4BDZ A;  2RK2 A;  3L2U A;  3VU3 C;  4QW2 A;  3H0H A;  1QKX A;  1YBY A;  5GMK m;  1ZUK A;  4AFQ C;  1IGU A;  2DA9 A;  5GAO q;  1OZ3 A;  3OYJ A;  3FC3 A;  1AOJ A;  3S3O A;  4E6R A;  1VQ8 A;  5KYN A;  4M7A A;  3EH1 A;  2V1R A;  5GAN 6;  4X9D A;  2O4X A;  3L2Q A;  3X25 B;  1B34 A;  3CME A;  2LNV A;  3MHX A;  2VVK A;  4C8Q G;  3R6O A;  2O88 A;  1NPR A;  4M7A E;  1UHF A;  1OPL A;  1TUC A;  1ZBX A;  2XD0 A;  5FW9 A;  1IO6 A;  3RBB B;  1QMC A;  3UT1 A;  4UC4 A;  1OPK A;  2DL5 A;  3NFC A;  2J7I A;  5KYX B;  1PWT A;  6AT1 B;  4KUD K;  3CCS A;  3EGD B;  3QII A;  4KGZ B;  2EJF A;  3HTR A;  1VQ9 Q;  1BKB A;  3M4Y A;  1RUW A;  2ED0 A;  3CC4 T;  1NJI C;  3UWN A;  4ZTJ A;  4KRT A;  3SD4 A;  5GAM f;  2ZPF B;  2DTH A;  2RHI A;  3PIP A;  5KH6 A;  3OBY A;  1ZUU A;  3DKM A;  3OB9 A;  2GFU A;  3M0U A;  2DFU A;  1VQ5 Q;  2OTJ T;  4XU1 A;  2EGC A;  2P4T A;  4OML A;  4JRQ A;  1BIA A;  3ULR B;  5J39 A;  1K73 R;  3X20 B;  2GTO A;  2IVW A;  2EFI A;  3JCM X;  1Q81 C;  2RI3 A;  3OYD A;  1YIJ Q;  1M8M A;  4JPB W;  2DL4 A;  3ZBD A;  1J3T A;  4XTU A;  4PJO F;  2X4J A;  4AMC A;  4LDY A;  3QUI A;  2FL7 A;  2CP2 A;  4X34 A;  4RTZ A;  3CCU T;  2RQR A;  1M1K U;  4X9C A;  2CP5 A;  1XJW B;  3LH5 A;  5CKE A;  1WGS A;  4FYW B;  5GMK j;  1ZSG A;  3OS0 A;  2QDL A;  4OMN A;  1Q82 C;  4JDS A;  2JXB A;  2HQE A;  3ER0 A;  4RUG A;  1F1B B;  1OEB A;  4M4Z A;  3H8Z A;  5LJ3 h;  5D6W A;  1VIE A;  1WXT A;  1BI3 A;  2NWM A;  3L42 A;  5EG2 A;  3VS6 A;  4QT7 A;  2XDD A;  1IHW A;  2OTJ A;  1UG1 A;  2ESW A;  1Q81 U;  2QAZ A;  3SB2 A;  3J7A F;  2RA2 A;  5L23 A;  4Y91 A;  1OV3 A;  2LVM A;  3HSB A;  1KC8 C;  3C4S A;  1WJS A;  3THK A;  4OB3 B;  2FB7 A;  1SKU B;  4JS4 A;  3RKX A;  4J9G A;  1P92 A;  2EYX A;  2CZ0 B;  3WVE B;  3JCM b;  2DRM A;  1KC8 R;  2LQK A;  1K73 C;  2BZX A;  2GCX A;  1AWW A;  2W0Z A;  3S3N A;  5HCK A;  1X27 A;  4II1 A;  4HVU A;  3JB9 F;  2ZGW A;  3CME T;  5IH2 A;  4NL2 A;  2AKK A;  1YHQ Q;  2R57 A;  1WIE A;  2KEA A;  3CC4 A;  3LH0 A;  3NTK A;  3PVL A;  5GAN 8;  3TSW A;  5M9O A;  1R77 A;  2YXY A;  2DIL A;  4IUP A;  3CCS T;  1LNX A;  2HCK A;  4CC2 A;  1W2B P;  4O5V A;  2EQM A;  2QQA A;  2MWO A;  2M51 A;  5GMK h;  4HXJ A;  4XU2 A;  1YN8 A;  1FMV A;  4OP0 A;  2FO0 A;  1AT1 B;  1VQ7 A;  1ZA2 B;  2AKL A;  2DL7 A;  2DTI A;  3JCM V;  2OTJ Q;  4C8Q C;  4C8Q E;  1I0C A;  2RQT A;  4PJJ A;  1ZLM A;  5I22 A;  1LCK A;  4NOY A;  3HFO A;  3OS2 A;  1VQ8 T;  2O9S A;  2H3E B;  4DBR A;  3CCS Q;  1VQN A;  1KD1 R;  4M7A G;  2KRM A;  1PHT A;  1Q86 R;  5CKB A;  2XG8 D;  1FMW A;  5CKD A;  3CCV T;  2DAQ A;  1KK7 A;  2AZS A;  3SWN B;  1UEB A;  2YDL A;  4IUT A;  4RKU E;  1KQS A;  1FYN A;  3EFO B;  1RAD B;  4OMQ A;  1VQ5 T;  1RAC B;  2ZPH B;  5LJ5 d;  2JW4 A;  5IHI A;  2CYZ B;  1Q7Y C;  2GNC A;  2X35 A;  3HFN A;  3CPW A;  3GPL A;  1K8A C;  2K5F A;  3TRE A;  2L89 A;  3FJP A;  1C0M A;  2AT1 B;  5KCH A;  2V8K A;  3U23 A;  2M02 A;  3WXM B;  1M2O A;  1T0J A;  2CKK A;  2HZY A;  1K73 U;  2WSE E;  1VQ7 T;  2KE9 A;  2CZ1 B;  1Y96 B;  2DET A;  4M75 C;  1TS9 A;  1UEC A;  1JU5 C;  3JRZ A;  3LGF A;  2F2W A;  2VAS A;  3I55 A;  2DYB A;  2Y90 A;  1YJ9 T;  4ZGD B;  3CCE T;  1AWX A;  1BI0 A;  3CQT A;  3VS7 A;  2CUB A;  4BE1 A;  1RAI B;  4E7H A;  2DEQ A;  4AT1 B;  5KYX A;  3G4S T;  1JQQ A;  1MNE A;  1M3A A;  3M53 A;  3NTH A;  2EQU A;  1JO8 A;  1RAF B;  2W10 A;  2O9V A;  5FLX E;  1VQO Q;  1K9M U;  2P4R A;  1X2K A;  5DY9 A;  5KYW A;  3GLX A;  1WQ7 A;  4E47 A;  5GMK l;  3G71 T;  3QYH B;  1VQP Q;  2KR3 A;  1NE8 A;  2MAM A;  3A8O B;  3OSV A;  3JAM E;  4LDW A;  4AFU C;  3HRS A;  5LJ5 f;  2GTJ A;  2AIR B;  1TUD A;  1YHQ A;  2JM9 A;  1SSH A;  2EQK A;  2RJC A;  4GLK A;  3CCR Q;  2K4Y A;  4C0G A;  1ARK A;  1QVF S;  1SRM A;  3TQ7 P;  1OYX A;  4ZGJ B;  2DEU A;  2OX7 A;  2LCS A;  4B9W A;  1RL2 A;  3A8H B;  4HT9 A;  2FG0 A;  3OY9 A;  2FPF A;  3LWH A;  2EWN A;  2NYS A;  4M7A C;  2JUF A;  2KI7 A;  1KQ2 A;  5GAM g;  3EFR A;  1YIJ A;  4ESR A;  2QA4 A;  3QDF A;  4IUU A;  1M1G A;  2B86 A;  2OAW A;  1SSF A;  4FW1 A;  1NM7 A;  1AZG B;  5J26 A;  3EG3 A;  2R58 A;  1H64 1;  1VOM A;  2EYY A;  4QVC A;  2KRN A;  4JS5 A;  1M3C A;  3FB9 A;  3CD6 A;  2CZ7 B;  1M90 C;  3RKW A;  3L2W A;  4BY6 B;  1YI2 A;  1SPK A;  4LXC A;  2M0Y A;  3OS1 A;  2A28 A;  2EGE A;  3EHR A;  5HKC A;  3CPW S;  1YHQ T;  4M77 A;  3A98 A;  1KJW A;  1Y57 A;  2CDT A;  3BW1 A;  3UA6 A;  3RUX A;  5C6S A;  5CK9 A;  3CCL A;  1K4U S;  2RHY A;  5D6Y A;  3PIO A;  4IKF A;  3QG1 A;  2QYZ A;  1H92 A;  2L8D A;  1S72 T;  1KC8 U;  2JTM A;  5DLQ E;  2D1X A;  2RJF A;  1WHG A;  2ZCF B;  2PQW A;  2DVJ A;  3M56 A;  4CI0 C;  1R8O B;  2X9H A;  5GAO r;  1B7T A;  2J05 A;  1Y71 A;  2E4H A;  1D1A A;  3OQ5 A;  4M78 A;  3CMA Q;  2VYT A;  8AT1 B;  3WVD B;  2VKN A;  2MMP A;  4C8Q D;  1YJ9 Q;  4C8Q B;  4TVR A;  4F7U B;  3L2R A;  4JJN K;  4M77 C;  4M78 C;  4J5Y A;  4J6Y A;  2FRW A;  2O01 E;  1M8V A;  3QKJ A;  1D0X A;  2E70 A;  3RKY A;  3OYF A;  3CEY A;  2DK3 A;  2DTO A;  1C1A A;  4BB7 A;  3S3M A;  2A7Y A;  4MZT A;  2YRV A;  3T9N A;  4A54 A;  4C92 D;  2GQI A;  1VQL A;  2V1Q A;  3CC2 A;  3UA7 A;  4DA4 A;  1VQM A;  2RK1 A;  3GP8 A;  4OF1 A;  3H0F A;  4EDU A;  3OW2 A;  3A8L B;  1JJ2 P;  4FYV B;  4RTT A;  3CMA A;  3MP6 A;  3LLR A;  4Z8A A;  2LX9 A;  4FT2 A;  5L8R E;  2L0A A;  2R5M A;  4FYX B;  3BY7 A;  5LJ3 j;  4OB2 B;  3JCM h;  5HK3 A;  1OI1 A;  2L3S A;  1PSE A;  2K2M A;  1VQN T;  1QW1 A;  2X4W A;  2FVU A;  3PNW C;  1GCQ A;  2K6D A;  5KYY B;  5FU6 C;  3MEV A;  2ABL A;  4RCB A;  3G7Z A;  4PLI A;  1UUE A;  1M90 U;  1NYG A;  2CP7 A;  3M0T A;  2ZAE A;  4D6W A;  2LRQ A;  3J80 E;  2L3P A;  1BCO A;  2CS7 A;  1B3Q A;  4MZM A;  2LJ1 A;  4PJN A;  3UF4 A;  4M7D F;  3D7S B;  2LJ3 A;  2CT4 A;  3PTA A;  1RAA B;  4M78 F;  3M0R A;  1Z9Z A;  3NTI A;  1TG0 A;  1QWE A;  2C0I A;  3QXE B;  4M78 B;  1ZX6 A;  2E5K A;  3BDL A;  3P8D A;  3GNG A;  1N8R U;  3PFS A;  4IIM A;  2KDS A;  1B34 B;  2LQW A;  8ATC B;  1JXM A;  5LL6 S;  1Q7Y R;  4EMK C;  2YRD A;  1EIF A;  1U8R A;  1Z9Q A;  1ACM B;  2NUP B;  4M7D E;  1IRX A;  1UB4 A;  1AD5 A;  1VQ7 Q;  2YUP A;  4J8O A;  3V8J A;  1MV3 A;  3PVQ A;  4RCC A;  1K9A A;  4A53 A;  2EAY A;  3CCJ Q;  1JXO A;  1VQ4 T;  2K5I A;  3VUZ A;  2RMO A;  4LD9 K;  1VQ8 Q;  5GAN 5;  2OTL A;  1OX8 A;  4EIK A;  3JCM d;  1AHJ B;  2VXF A;  2YRC A;  2MF2 A;  2X3W D;  4BY6 C;  1T3L A;  2RQU A;  3KXT A;  1MHN A;  1KFZ A;  4WF2 A;  2D6F A;  1GCP A;  2EVR A;  2MWP A;  1KHI A;  2QEX A;  2KT8 A;  5FWB A;  1I1J A;  3OSS C;  2DER A;  3CD6 T;  1M9S A;  4GBQ A;  4FSS A;  2EYZ A;  2WSF E;  2K3B A;  2K57 A;  3HP9 A;  1WI7 A;  2QEX T;  2PUO B;  4M7D B;  2CSQ A;  5GAN 4;  2JTE A;  1M2V B;  2BKD N;  1YJN A;  5GAN f;  4BUG A;  2OTL Q;  2OTL T;  3AT1 B;  4JJC A;  4L6V 5;  3VS5 A;  2RI2 A;  3H6Z A;  3I5R A;  3DB3 A;  3I9Q A;  2QXF A;  2ROT A;  4OMO A;  2YUO A;  3MJX A;  3KFV A;  1PRM C;  3DB4 A;  5I2M A;  4XTZ A;  3MKD A;  2QQS A;  4AFZ C;  2D8H A;  2JS0 A;  2LCC A;  5LJ5 e;  5CIU A;  3JCM Q;  1VQO T;  4M7A D;  1RAE B;  2KK4 A;  4FU6 A;  5GAM e;  1X6G A;  1VQ9 A;  2VUB A;  1M27 C;  4CC3 A;  3TVT A;  4QQ6 A;  5GAN j;  1UFF A;  4MDX A;  5IHK A;  2XDB A;  3HPW A;  5FU6 B;  4DEX A;  1MMN A;  3P8H A;  4CC4 B;  1H3H A;  5GAM d;  2GBQ A;  4PKC C;  2DD5 A;  1W1F A;  4C92 A;  1RLQ C;  1M90 R;  1E7O A;  4A4G A;  1D09 B;  4BDY A;  1GBR A;  5I2S A;  3QWX X;  1TXQ A;  5CO7 A;  1Q82 R;  3V7R A;  1UJ0 A;  1CSK A;  2XU8 A;  3SHW A;  2JNG A;  1C6V X;  2A36 A;  4A4K A;  1WHM A;  4JJD A;  4E7K A;  1M3B A;  4Z02 A;  1X43 A;  1JBM A;  2ZPG B;  4J83 A;  2QG9 B;  2HNI A;  2DO3 A;  1K0S A;  3I5S A;  5I11 A;  4F7U G;  4M75 D;  4EMG A;  2ECZ A;  1BI1 A;  1IXD A;  3I56 A;  2P0Q A;  1OOT A;  5FRO A;  3FEO A;  4KGV B;  1QVF P;  4PK4 A;  1WXU A;  4Z89 A;  1VQP A;  1YWO A;  2KMT A;  5IXF A;  1B07 A;  3INZ A;  4X1V A;  4J7F A;  3PMT A;  3PGG A;  3GIB A;  4PFP A;  1ZUY A;  2Y4X A;  3VS4 A;  5LJ3 g;  3M5A A;  2ZZD A;  3MP1 A;  1TWB A;  3OMG A;  5CKH A;  3VS2 A;  2HDA A;  1WJR A;  5GAN d;  2BTT A;  5D7U A;  4BI3 A;  5FU7 C;  1D0Z A;  4C0Z A;  3CC2 T;  2LZ6 B;  2L5Q A;  3CC7 A;  2E6N A;  3I56 Q;  4OMM A;  3EG0 A;  1PC0 A;  1WLP B;  4RTU A;  1YI2 Q;  4XTX A;  3CD6 Q;  1VQK T;  2NLU A;  1NLO C;  4F14 A;  2QEX Q;  4C92 G;  2RPN A;  2D8J A;  4KT0 E;  2EQI A;  2F5T X;  4R55 A;  4ORZ A;  4AG1 C;  2AZV A;  4BAC A;  4PJO B;  2JTF A;  1ZSZ C;  3VYG A;  1K76 A;  3H0I A;  2NUZ A;  3MEW A;  2DMO A;  2LX7 A;  5CKF A;  1VQ4 Q;  1OU9 A;  5GAN 2;  3JSC A;  4CC7 A;  1FWZ A;  2LDM A;  1TUG B;  4KUI A;  2J06 A;  2NUT B;  1UGP B;  4L5G A;  1JRI A;  2E6Z A;  4IUR A;  1VQ6 Q;  3NMZ C;  3M55 A;  1BI2 A;  3VS0 A;  3NHN A;  1QKW A;  2RNA A;  5GJV B;  1GL5 A;  4XTY A;  2NUP A;  2DKG A;  3L2Z A;  4OVA A;  2HQH A;  2PVD B;  5KE3 A;  3UAT A;  4M77 G;  5IXB A;  4FT4 A;  3CCL Q;  3CCL T;  4FIB A;  1SG5 A;  3TEE A;  5KYW B;  1RI9 A;  2V8J A;  3EG2 A;  4XTV A;  4AFS C;  3EH2 A;  2GF7 A;  2DBM A;  4M75 A;  2GGR A;  4ZGE B;  1VIF A;  5CQX A;  4WCI A;  2WSC E;  1QVG S;  4M77 E;  2B8A A;  3CBP A;  3CCM Q;  3CCQ T;  1G5V A;  4C5G A;  2ZPE B;  1VQ6 T;  4FM4 B;  1VA7 A;  1HK9 A;  3CPW P;  4V2S A;  5KYY A;  1UE9 A;  3X24 B;  2DM1 A;  1HJD A;  2DL3 A;  2LCL A;  3L1A A;  1Q7Y U;  2QA4 Q;  3CXC P;  4LD6 A;  2O2O A;  3PMI A;  4M77 F;  2HAX A;  1XQH A;  1T3S A;  2K7A A;  4E7L A;  3EG9 A;  2RQV A;  3VRY A;  3X26 B;  1MMD A;  4C8Q F;  1IHV A;  3MPU B;  2A37 A;  3HRT A;  1XNI A;  5KCO A;  2X51 A;  4R0K A;  4ZNX A;  2DIG A;  3VS3 A;  2C06 A;  3MO8 A;  1YFN A;  1RI0 A;  5LJ5 h;  1OQK A;  1QVP A;  3SWN C;  1X2Q A;  1D1B A;  2D9T A;  3DLM A;  2HBP A;  4C5I A;  4QKU A;  5LJ5 j;  3G1J A;  3HL8 A;  2L3R A;  2DJZ A;  4QQD A;  5CQY A;  3OYI A;  4E2F B;  3JCM e;  1WZO A;  5ECA A;  4C92 E;  1G3S A;  1N6A A;  1YIT A;  2MCN A;  2VC8 A;  1U06 A;  4LDX A;  4DEY A;  4GY5 A;  2K3Y A;  4M78 E;  1PKS A;  2VGN A;  2QI2 A;  1VQM Q;  1UDL A;  2V8I A;  2F2V A;  4C92 B;  1M1F A;  5A2Q E;  4PJO G;  4MML A;  3X28 B;  3TU4 K;  3I55 T;  4LN2 A;  4XU3 A;  4E7J A;  2LQN A;  2ZPI B;  3R6N A;  4ELY C;  1UGS B;  2D0Q B;  2DE0 X;  2EJ9 A;  2HD0 A;  1G3Y A;  2M0O A;  4EMK B;  7AT1 B;  4IIO A;  2ROL A;  2VWF A;  1VQK A;  4B6M A;  1MGQ A;  2QQ9 A;  5GAN 7;  1W2B A;  2L2P A;  2KY9 A;  2RF0 A;  3EGU A;  2XI9 A;  1K8A R;  1KG1 A;  2E41 A;  1Y07 A;  1W2B S;  1VQ5 A;  3OYE A;  3RNJ A;  2EJG A;  2RJE A;  2MYS A;  3URG A;  5KE2 A;  1NZ9 A;  2L3Q A;  1H8K A;  1BK2 A;  1NEG A;  3CCV A;  5DM7 R;  2IPO B;  3O5Z A;  3SDZ A;  4XAX B;  1LJO A;  2JMA A;  3OYC A;  3C95 A;  4PLL A;  4MDW A;  1D1C A;  4FCY A;  3LX7 A;  3DLL A;  1IB8 A;  2PUK B;  2YLB A;  3E1S A;  3NGP A;  3ZFJ A;  2PZ1 A;  3EFO A;  4A63 B;  4J6W A;  1E6H A;  5FRN A;  3JCM W;  3JB9 G;  1ABO A;  3RES A;  3OYN A;  1PD1 A;  2DVE A;  2EKO A;  4O6J A;  1PM3 A;  3QBY A;  3CCM A;  4JLG A;  3JCM g;  2KYM A;  1YCS B;  3EGX A;  3H9N A;  5CCA A;  3QSU A;  1M4Z A;  2X3X D;  1Y0M A;  1WHK A;  1OZ2 A;  2DZ9 A;  2ENM A;  3OYA A;  4JLI A;  2O4X B;  4JUV A;  1UGQ B;  1VQL T;  1NBE B;  3BFM A;  2QTX A;  4XQ3 A;  2EYW A;  4KUL A;  2K79 A;  2M16 A;  2DL8 A;  4RMO A;  3OYY A;  2RHZ A;  4PJL A;  4VUB A;  4JRP A;  3I35 A;  2DZC A;  2BE9 B;  2V26 A;  2RH2 A;  3E2U A;  4L59 A;  1GCQ C;  3EG1 A;  2FZK B;  4F04 B;  3CBM A;  4M7A F;  1Q86 C;  1JJ2 A;  4JRI A;  3GF5 A;  2YLC A;  2G3R A;  3M59 A;  2LT1 A;  2JS2 A;  3FJ5 A;  2QK0 A;  1I5L A;  2C0T A;  1N9S A;  2E3H A;  1K0X A;  3LWI A;  2VGM A;  3JB9 H;  1ZSZ A;  3E19 A;  4KBM B;  4E7Z A;  1YIT T;  2FPE A;  4ME7 A;  4DBF A;  2DLP A;  3HRU A;  1YWP A;  4PJO C;  1S72 A;  2YSQ A;  4Q5W A;  4PFO A;  1UHC A;  4EMK A;  1K1Z A;  1HD3 A;  3A8G B;  2VV5 A;  2XHC A;  4DOW A;  3I55 Q;  1QLY A;  2DIQ A;  3H41 A;  1AZE A;  3OYG A;  4KH0 B;  2BZY A;  2E65 A;  2CUD A;  1WHL A;  3QYG B;  2FRY A;  1S72 Q;  4FW2 A;  4ATO A;  4FYY B;  3CCU A;  4LDV A;  1YI2 T;  4JZ4 A;  3MEA A;  2QQB A;  1VQ6 A;  4M77 B;  1YP5 A;  5CAI A;  2PU9 B;  5FU7 B;  5CR2 A;  3CCV Q;  2FZG B;  1CKB A;  3OYH A;  3QJY A;  4XU0 A;  3EG9 B;  1EX4 A;  5HY6 A;  1G3W A;  3V8L A;  3SFM A;  3IQL A;  3EHQ A;  1KSW A;  2MIO A;  1YIJ T;  1BYM A;  4FSX A;  4M7D A;  1X6O A;  2RM4 A;  2D0N A;  1VQ4 A;  1BIB A;  3QDR B;  2XDP A;  2YUQ A;  2CP3 A;  1MMG A;  1IZ6 A;  2LJ0 A;  1QVG P;  2RHU A;  3CCQ A;  3ASK A;  3CCU Q;  2LNH B;  1N8R R;  4Y28 E;  4M7A B;  2DRK A;  2LTO A;  5GAO l;  1SHG A;  3V7S A;  1A0N B;  2DXU A;  1GFC A;  2OI3 A;  3EAE A;  4A4H A;  2KXD A;  1VQN Q;  3CC7 Q;  3EGX B;  5GAM j;  1XTD A;  3G71 A;  5GAO p;  2LP5 A;  2RJD A;  3NPF A;  1IGQ A;  2VXE A;  3M4G A;  3TSZ A;  4OB1 B;  3JB9 I;  1NJI U;  1VYU A;  2CH4 W;  1QQJ A;  1GRI A;  3BDU A;  1ZA1 B;  3RMS A;  1RAH B;  2XKO C;  2EGA A;  3BE3 A;  2XID A;  3GNF B;  3J81 E;  4C5H A;  3OYB A;  2CGH A;  4D8D A;  3REB B;  4PL6 A;  3F70 A;  1X6B A;  4E7I A;  1PG5 B;  1E6G A;  3CCM T;  3CCQ Q;  2JVV A;  1QCO A;  1ZSZ B;  3MCA B;  2E12 A;  4HA8 A;  4NL3 A;  4PJO D;  5D6X A;  3V8K A;  2COY A;  2K9G A;  9ATC B;  4ZN3 A;  4B9X A;  2VB6 A;  5GAN 3;  1PCX A;  1XOV A;  4RG8 A;  4F16 A;  1KQS P;  4J9C A;  1D0Y A;  2DNU A;  1U1T A;  4F17 A;  5AYF A;  3SWN A;  1U3O A;  5IT9 E;  2DD4 A;  1WHH A;  2X4X A;  5LJ3 d;  4J9E A;  2HL5 C;  1RAB B;  1PNJ A;  3REA B;  2KXC A;  1Q95 G;  5IAY A;  4HKE A;  5I21 A;  2JMC A;  3CMA T;  3ZEH A;  1WYX A;  4DQ2 A;  1AWO A;  2HBW A;  2BE7 D;  4N4G A;  2RN8 A;  1BBZ A;  1QP3 A;  3CBO A;  2QGF B;  5LJ5 g;  2DXC A;  5GMK e;  3I56 T;  3FLG A;  3CCJ A;  1OX9 A;  1CKA A;  1M30 A;  3VV0 A;  2R5A A;  3HKS A;  1GFD A;  2KBT A;  2Z0W A;  3GOX A;  1K9M R;  2BUD A;  1WFW A;  3CPF A;  4N0A C;  2FHD A;  1ZBJ A;  2JT4 A;  4M7D D;  1M5Q 1;  2G6F X;  1VQ9 T;  4HCZ A;  1DJ7 B;  3VJP A;  3JB9 D;  2HMA A;  1D3B B;  1ZHI A;  3M57 A;  1YJW A;  2E64 A;  3CC2 Q;  4J9B A;  4OMF B;  1PRL C;  4J9I A;  3FRN A;  5GAM h;  1N8R C;  1I4K 1;  3P8B B;  3JCM c;  5KYU B;  3M58 A;  2LT4 A;  3M0S A;  3UDC A;  1YJW Q;  1OU8 A;  1WXB A;  3A8M B;  3G6E Q;  2K2V A;  3OYM A;  1KD1 C;  4PJO E;  1VYT A;  5IN1 A;  2M9U A;  1YJN T;  4A4E A;  1QP2 A;  1NG2 A;  1TH7 A;  1VQO A;  5LJ3 e;  2YUN A;  1X69 A;  4Y92 A;  4LUD A;  5A0D A;  1W6X A;  2DX1 A;  3OW2 S;  1WHJ A;  1JEG A;  4M75 E;  2RI5 A;  1G3T A;  1MMA A;  5GAO n;  1LVK A;  4KH1 B;  2E1H A;  4C0F A;  1ZQ1 A;  2HEQ A;  5HK0 A;  4NS5 A;  2YHT A;  1FX7 A;  3PT9 A;  1WNL A;  2WAC A;  3OYL A;  1SHF A;  2H8H A;  4M78 G;  1G83 A;  1T0H A;  4OMP A;  2PNI A;  2XK0 A;  1UGV A;  1NPP A;  1BB9 A;  3QJ6 A;  2IIM A;  1V29 B;  1IRE B;  2E3I A;  2X4Y A;  4AG2 C;  4J9H A;  1RAG B;  2K5L A;  3JCM P;  4QVZ A;  4BI4 A;  4Z88 A;  2JZ2 A;  1OUL A;  3RIR A;  1H3Z A;  3QHS A;  1W4S A;  1GBQ A;  2SRC A;  2EBP A;  2LC4 A;  3M9Q A;  5GAN h;  4C0D C;  2EQJ A;  2E10 A;  3M54 A;  3OMC A;  2RO0 A;  1Y7X A;  2HQX A;  2I2L A;  1Y96 A;  2GFA A;  1I07 A;  4JJB A;  3KBG A;  1JJ2 S;  2EKH A;  5FWC A;  2OAU A;  1U1S A;  2K3X A;  1Q86 U;  3AHU A;  4HVW A;  4MZP A;  4C92 C;  5A0G A;  2DYI A;  2A0F B;  2P0P A;  4C0D B;  3LYI A;  1VUB A;  2NUT A;  1MUZ A;  2JN0 A;  2AHJ B;  3O8V A;  4J9D A;  3V7C A;  4FL6 A;  1NLP C;  2CP6 A;  3KUF A;  5GAO m;  5IHN A;  5KYU A;  3QZ5 B;  1O9S A;  2J6O A;  4M7D G;  3EGD A;  2DXB A;  1AWJ A;  1GXI E;  4C8Q A;  1WDX A;  2FEI A;  4F7U A;  1D3B A;  4RTX A;  1X75 C;  4N4H A;  2F5K A;  2ZPB B;  2LQ8 A;  2YWW A;  2Y4Y A;  3CCJ T;  2QGG A;  3CXC A;  1WPY A;  2F1L A;  1FMK A;  2JM8 A;  1BU1 A;  3MP8 A;  3CC4 Q;  1JB0 E;  1TSF A;  1K8A U;  3G4S Q;  3E9G A;  3OYK A;  4LUE A;  1KIK A;  4XTW A;  4E7S A;  1BCM A;  3C0C A;  3CXC S;  3FIF A;  1UJY A;  1VYV A;  5GMK i;  2PTK A;  4KGX B;  2FYK A;  1YCY A;  2GQV A;  3MET A;  3ME9 A;  4OB0 B;  5CVI A;  3LW5 E;  2KAF A;  2HKN A;  1NJI R;  2P84 A;  3UPU A;  4BI8 B;  3VYH B;  2A3L A;  1I8F A;  3RER A;  1TTH B;  3S6W A;  1VQM T;  2QQR A;  2FZC B;  2PVG B;  4HCB A;  4PNO A;  1AEY A;  2H3J A;  2MPX C;  4PJO A;  1K9M C;  2JOY A;  2E5Q A;  3PE0 A;  2KNB B;  1WJQ A;  2KYB A;  1VQK Q;  3OA6 A;  1X01 A;  4K11 A;  2HSP A;  3LGL A;  2CSI A;  4PJM A;  4YTL A;  3HHT B;  4JRK A;  1TOV A;  2EIF A;  2MK5 A;  1Q81 R;  1MND A;  1UTI A;  2DJQ A;  4HCC A;  4GLM A;  4D8K A;  3RMQ A;  1HYO A;  3OS5 A;  4BE0 A;  5FRM A;  4N0A A;  2DXT A;  2RQW A;  2J6F A;  1KQ1 A;  5EC7 A;  3CCR T;  4EPC A;  3TCJ A;  4F7U F;  3OBW A;  2IG0 A;  1QWF A;  1HSQ A;  1EFN A;  4LNP A;  4RTW A;  1PSF A;  4XK8 E;  4EMH A;  1VQL Q;  2EYQ A;  3G6E A;  4RG2 A;  2CRE A;  2A08 A;  3QWY A;  1I81 A;  3JCM J;  2BIV A;  1QCF A;  3FDR A;  4LE9 A;  1UGR B;  3VS1 A;  4LDU A;  1WA7 A;  2EPD A;  2HSE B;  2MI6 A;  2ATC B;  4JZ3 A;  2KVQ G;  4M75 B;  1N9R A;  5GAN e;  2SEM A;  3VKI A;  5A0L A;  2BZ8 A;  1V76 A;  4ZN1 A;  2FPD A;  4RTY A;  1R0C B;  2QA4 T;  2O31 A;  3EFS A;  3A1P A;  3ZL7 C;  2F69 A;  3QO3 A;  2M1H A;  4QQG A;  3VRZ A;  4J7I A;  1LOJ A;  1WX6 A;  2J6K A;  2KSS A;  1TU0 B;  1HXD A;  2RD1 A;  1YIT Q;  1S1N A;  2XIC A;  4PFZ A;  1EZZ B;  5DLO A;  3OW2 P;  3JB9 J;  4CRI A;  4ELZ C;  2PVO B;  2JJ9 A;  4F7U E;  2C0O A;  2CH4 A;  4N4I A;  1KQS S;  4WTO B;  1YJN Q;  3C94 A;  2COW A;  4QVD A;  1QCN A;  1SEM A;  4OGC A;  4IUV A;  2AK5 A;  1V1C A;  1I5O B;  1SF9 A;  4HVV A;  5C0M A;  4P5N A;  3GBQ A;  4C5E A;  1N5Z A;  4M78 D;  4DBQ A;  1YNZ A;  3G4S A;  1FXX A;  2KGT A;  2QAS A;  3M0Q A;  1KD1 U;  1YJW T;  2CP0 A;  2KT1 A;  1M1K R;  3Q1J A;  3G6E T;  1YJ9 A;  4R56 A;  5AT1 B;  3MEU A;  3C12 A;  1W70 A;  2YT6 A;  1O75 A;  4DOV A;  2KQW A;  2QDY B;  2DPP B;  3RR6 A;  1MV0 B;  2DBK A;  5GAN g;  1NEB A;  5GJW B;  1U5S A;  1LPL A;  2I0N A;  3JV3 A;  5J3B A;  1G8X A;  2RHX A;  2ED1 A;  4A4F A;  3CCR A;  1R0B G;  3M0P A;  3QPH A;  4C92 F;  2CT3 A;  2F2X A;  3A5Z B;  2RB6 A;  1AVZ C;  3CCE A;  4M75 F;  3CC7 T;  5LJ3 f;  1PKT A;  1Q82 U;  2COZ A;  4J9F A;  2CZ6 B;  2HL3 A;  4ZTF A;  4HT8 A;  1PD0 A;  4J6X A;  4RTV A;  4ANJ A;  1ABQ A;  1WQW A;  3SEM A; 
#chains in the Genus database with same CATH homology
 1CKA A;  1M30 A;  2MOX A;  1GFD A;  2KBT A;  2J05 A;  1VA7 A;  2KRO A;  1WFW A;  4HCK A;  1ZBJ A;  2JT4 A;  1RLP C;  1UE9 A;  2DF6 A;  2G6F X;  1HJD A;  2DM1 A;  2DL3 A;  2VKN A;  2LMJ A;  1NYF A;  2O2O A;  1T3S A;  2K7A A;  1G2B A;  2RQV A;  3VRY A;  2FRW A;  2A37 A;  4J9B A;  1PRL C;  4J9I A;  2KRS A;  2EW3 A;  2OJ2 A;  4R0K A;  4ZNX A;  1SRL A;  3VS3 A;  2XMF A;  3M0S A;  3H0H A;  1QKX A;  1WXB A;  1ZUK A;  4AFQ C;  2DA9 A;  1X2Q A;  2GQI A;  2V1Q A;  3UA7 A;  1AOJ A;  1VYT A;  4E6R A;  3H0F A;  1NG2 A;  2YUN A;  4RTT A;  1X69 A;  2V1R A;  4Y92 A;  4LUD A;  1W6X A;  5ECA A;  2DX1 A;  1JEG A;  4Z8A A;  2VVK A;  2O88 A;  2MCN A;  1U06 A;  2L0A A;  1UHF A;  4DEY A;  1OPL A;  1TUC A;  2HEQ A;  1PKS A;  5FW9 A;  1IO6 A;  3RBB B;  1OPK A;  2DL5 A;  2J7I A;  1SHF A;  1UDL A;  1PWT A;  2H8H A;  2F2V A;  2L3S A;  1G83 A;  1T0H A;  2K2M A;  4OMP A;  1RUW A;  2PNI A;  1UGV A;  2ED0 A;  1BB9 A;  4LN2 A;  2IIM A;  4KRT A;  1GCQ A;  2LQN A;  2K6D A;  4AG2 C;  3R6N A;  2ABL A;  4J9H A;  2DE0 X;  1ZUU A;  1UUE A;  1NYG A;  3M0U A;  3M0T A;  4IIO A;  4Z88 A;  2ROL A;  2VWF A;  2EGC A;  4OML A;  2SRC A;  1GBQ A;  3ULR B;  2EBP A;  2L3P A;  2L2P A;  1B3Q A;  2LJ1 A;  2RF0 A;  2GTO A;  3UF4 A;  3EGU A;  1I07 A;  4JJB A;  2LJ3 A;  2CT4 A;  1M8M A;  4JPB W;  2DL4 A;  2EKH A;  3M0R A;  1J3T A;  1Z9Z A;  5FWC A;  3RNJ A;  1TG0 A;  1QWE A;  2C0I A;  4HVW A;  2L3Q A;  1H8K A;  1BK2 A;  1NEG A;  1ZX6 A;  2E5K A;  3O5Z A;  2JMA A;  4RTZ A;  2RQR A;  4IIM A;  1MUZ A;  3LH5 A;  1ZSG A;  4J9D A;  2LQW A;  1NLP C;  2QDL A;  4OMN A;  3NGP A;  2PZ1 A;  2JXB A;  4RUG A;  1JXM A;  5IHN A;  4A63 B;  1OEB A;  4M4Z A;  1E6H A;  2J6O A;  1WXT A;  2NWM A;  1Z9Q A;  1ABO A;  3VS6 A;  1AWJ A;  4QT7 A;  1AD5 A;  1WDX A;  2FEI A;  2YUP A;  4RTX A;  1MV3 A;  1UG1 A;  3PVQ A;  1K9A A;  2KYM A;  1YCS B;  2ESW A;  5L23 A;  1JXO A;  2X3X D;  1Y0M A;  1OV3 A;  2RMO A;  1FMK A;  2JM8 A;  2ENM A;  3THK A;  4EIK A;  1BU1 A;  4J9G A;  2X3W D;  2EYX A;  1T3L A;  4LUE A;  2RQU A;  2DRM A;  1KIK A;  2EYW A;  1KFZ A;  2K79 A;  2BZX A;  3C0C A;  2DL8 A;  1GCP A;  1UJY A;  1VYV A;  2EVR A;  2KT8 A;  1AWW A;  5FWB A;  1I1J A;  2W0Z A;  2PTK A;  5HCK A;  1X27 A;  3I35 A;  4HVU A;  4GBQ A;  4FSS A;  2EYZ A;  5IH2 A;  2AKK A;  2K3B A;  1WI7 A;  1WIE A;  2KEA A;  1GCQ C;  2CSQ A;  3EG1 A;  2JTE A;  3PVL A;  3TSW A;  2DIL A;  2JS2 A;  2HCK A;  4CC2 A;  3FJ5 A;  4JJC A;  1AEY A;  3VS5 A;  2C0T A;  1K0X A;  2M51 A;  4HXJ A;  1YN8 A;  3PE0 A;  2KNB B;  3I5R A;  2KYB A;  2FO0 A;  3I9Q A;  2AKL A;  2DL7 A;  2ROT A;  4K11 A;  4OMO A;  2HSP A;  2YUO A;  3KFV A;  1PRM C;  2CSI A;  1I0C A;  2FPE A;  2DLP A;  2RQT A;  4AFZ C;  1ZLM A;  1YWP A;  2D8H A;  2JS0 A;  5I22 A;  2YSQ A;  1LCK A;  1UHC A;  1UTI A;  1K1Z A;  2DJQ A;  1HD3 A;  2O9S A;  1QLY A;  3H41 A;  4GLM A;  1AZE A;  1X6G A;  4D8K A;  1M27 C;  2BZY A;  4CC3 A;  3TVT A;  2KRM A;  1PHT A;  2CUD A;  2FRY A;  1UFF A;  2RQW A;  2J6F A;  5IHK A;  5EC7 A;  4DEX A;  4CC4 B;  4JZ4 A;  1H3H A;  1YP5 A;  2GBQ A;  2AZS A;  1CKB A;  1W1F A;  2YDL A;  1RLQ C;  1FYN A;  1E7O A;  1QWF A;  1HSQ A;  1EFN A;  4OMQ A;  1GBR A;  4LNP A;  4RTW A;  3QWX X;  3IQL A;  1UJ0 A;  2JW4 A;  3EHQ A;  5IHI A;  1CSK A;  3SHW A;  1KSW A;  2GNC A;  2MIO A;  2CRE A;  2A08 A;  3QWY A;  2A36 A;  1QCF A;  2D0N A;  4LE9 A;  4JJD A;  1M3B A;  2YUQ A;  3U23 A;  1X43 A;  1T0J A;  3VS1 A;  2LJ0 A;  2LNH B;  1WA7 A;  2EPD A;  1K0S A;  3I5S A;  5I11 A;  2DRK A;  2KE9 A;  4JZ3 A;  1SHG A;  1A0N B;  2ECZ A;  1UEC A;  2SEM A;  1GFC A;  2OI3 A;  2BZ8 A;  1JU5 C;  2F2W A;  2KXD A;  2DYB A;  1OOT A;  2FPD A;  4RTY A;  2O31 A;  1AWX A;  3CQT A;  3VS7 A;  2CUB A;  3ZL7 C;  1WXU A;  4Z89 A;  1YWO A;  3VRZ A;  1WX6 A;  2J6K A;  1JQQ A;  2LP5 A;  1M3A A;  5IXF A;  1B07 A;  3NPF A;  1S1N A;  4X1V A;  3TSZ A;  1JO8 A;  1ZUY A;  3VS4 A;  2W10 A;  2O9V A;  1VYU A;  2P4R A;  1X2K A;  2C0O A;  2CH4 W;  3VS2 A;  1GRI A;  2CH4 A;  2HDA A;  2BTT A;  2KR3 A;  2EGA A;  4AFU C;  2GTJ A;  1SEM A;  2LZ6 B;  2AK5 A;  1V1C A;  4D8D A;  1TUD A;  4OMM A;  3REB B;  3EG0 A;  2JM9 A;  1SSH A;  4HVV A;  1WLP B;  4RTU A;  1X6B A;  1ARK A;  1SRM A;  1E6G A;  3GBQ A;  1NLO C;  4F14 A;  2LCS A;  1N5Z A;  2RPN A;  2D8J A;  2EQI A;  4ORZ A;  4AG1 C;  2AZV A;  2FG0 A;  1K76 A;  1YNZ A;  2FPF A;  3H0I A;  2KGT A;  2NUZ A;  3M0Q A;  2DMO A;  2KT1 A;  2LX7 A;  2K9G A;  4ESR A;  4CC7 A;  1XOV A;  4F16 A;  4J9C A;  1W70 A;  2DNU A;  2YT6 A;  2B86 A;  2J06 A;  2OAW A;  4F17 A;  1U3O A;  1NM7 A;  1AZG B;  4J9E A;  1MV0 B;  3EG3 A;  3NMZ C;  2DBK A;  2EYY A;  2KRN A;  1NEB A;  5GJW B;  1U5S A;  1PNJ A;  3REA B;  2I0N A;  3JV3 A;  1M3C A;  2KXC A;  3VS0 A;  3NHN A;  2ED1 A;  1QKW A;  1SPK A;  2RNA A;  5GJV B;  2JMC A;  3M0P A;  1GL5 A;  2M0Y A;  1WYX A;  2CT3 A;  2A28 A;  2EGE A;  3EHR A;  2F2X A;  1AWO A;  2HBW A;  3A98 A;  1KJW A;  1AVZ C;  1Y57 A;  2CDT A;  3UAT A;  5IXB A;  1PKT A;  3UA6 A;  2RN8 A;  1BBZ A;  4J9F A;  1K4U S;  1RI9 A;  1H92 A;  3EG2 A;  4AFS C;  2D1X A;  4RTV A;  2DBM A;  2GGR A;  1ABQ A;  2DVJ A;  4WCI A;  3SEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...