1T0JA

Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
RREAERQAQAQLEKAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords voltage-gated calcium channel subunit beta2a
publication title Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 23
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12052 VGCC_beta4Aa_N Voltage gated calcium channel subunit beta domain 4Aa N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1t0jA00
2C0IA 4JZ3A 1M3BA 1KIKA 4RTYA 1YWPA 1GCQC 5IHNA 2D8HA 1BU1A 2JM9A 2KR3A 5L23A 1MUZA 2CH4W 4AFQC 2QDLA 1SSHA 1B3QA 2C0TA 4ESRA 1VYUA 4GLMA 2DILA 1IO6A 4OMNA 4CC2A 1SHGA 4WCIA 2KBTA 1U3OA 3TSZA 1NYFA 2JXBA 2NUZA 1T3SA 2LNHB 2O2OA 1JO8A 4OMOA 3EG2A 2J7IA 2EYZA 1RUWA 1WXBA 3PE0A 1RLQC 2O9VA 3I9QA 4HVVA 1UDLA 4JPBW 3R6NA 2H8HA 1E6HA 1JXMA 1PKTA 3VS5A 4EIKA 2ABLA 2DVJA 3NMZC 4A63B 1KFZA 1RLPC 2CT3A 2A08A 4X1VA 5ECAA 4Z89A 2ECZA 2ED1A 3NPFA 1S1NA 2DA9A 2EPDA 3H0FA 3EG0A 2FRYA 2L3SA 1GFCA 1KJWA 2DRMA 2A36A 2X3WD 2EVRA 1WA7A 1M3AA 3QWXX 1K0XA 2CREA 1WXUA 1PWTA 1AWOA 1FYNA 2EYWA 1ARKA 4HVWA 4JJBA 1QWFA 1K76A 2FG0A 2DNUA 4RTXA 1ZX6A 2I0NA 3LH5A 1OOTA 4FSSA 2M51A 4F17A 4AFZC 1WX6A 1X6BA 3ZL7C 1ABOA 3VRZA 1NG2A 1FMKA 1H8KA 2CSQA 3UA6A 4LE9A 2KNBB 1NLOC 2ESWA 3H0HA 5GJVB 2GBQA 1YNZA 5HCKA 1MV0B 1GCPA 2C0OA 2EGAA 2LJ3A 3KFVA 2NWMA 1X2QA 2LP5A 2KT8A 3A98A 2W0ZA 2YSQA 1OPLA 2CUDA 1ZLMA 3RNJA 2JW4A 3I5RA 3JV3A 2LCSA 1A0NB 1QCFA 4KRTA 4HXJA 1CKAA 2RF0A 1K1ZA 2FPFA 3VS2A 1PRLC 1CKBA 2O88A 1VYTA 1QKWA 1SPKA 1M27C 1Y57A 3M0UA 1SRLA 1PRMC 5I11A 1B07A 1UECA 3VS3A 1OEBA 1GBQA 4ORZA 4AFUC 1ZUKA 1BK2A 4RTUA 2VVKA 1TUCA 4OMLA 1Y0MA 2GQIA 1UE9A 4GBQA 1AZGB 1WXTA 1ZBJA 3ULRB 2YUNA 5FWCA 2GNCA 2GTOA 2KXDA 1NEGA 2AKLA 4AG2C 2HEQA 1AWXA 2CT4A 2DRKA 3TVTA 2FPEA 3REBB 5IXBA 3H0IA 2L3QA 3EHQA 2RPNA 5I22A 1XOVA 1UJYA 2OAWA 1X69A 2HDAA 1V1CA 2L2PA 3VRYA 1X27A 4RTZA 3UF4A 3NHNA 1TG0A 1AD5A 2EYYA 1JU5C 1WI7A 2OI3A 2CUBA 5IHIA 2KGTA 4J9FA 2K6DA 2LJ1A 1YP5A 3CQTA 4K11A 2ROLA 3GBQA 1ZSGA 1ABQA 4QT7A 2EKHA 2ED0A 5IXFA 3M0RA 1J3TA 3THKA 4J9GA 1EFNA 1AOJA 2P4RA 2K9GA 2A37A 2IIMA 4CC7A 1E6GA 1K0SA 1AWJA 2D1XA 2JM8A 2BZXA 2RN8A 3VS7A 1GBRA 2D8JA 4AFSC 2K79A 2M0YA 3U23A 1GFDA 3IQLA 5IHKA 2FRWA 2YDLA 2K7AA 2V1QA 2J6FA 1UHFA 1UTIA 4RTWA 2OJ2A 3TSWA 2CSIA 4OMPA 4JJCA 3I35A 4RTTA 4J9BA 1QKXA 2RNAA 2O9SA 2B86A 2EYXA 1NM7A 4CC4B 1BBZA 1OPKA 2KRMA 3UA7A 2RQUA 4RUGA 2GTJA 3H41A 2GGRA 3SHWA 3O5ZA 2KROA 3NGPA 2LX7A 2EW3A 5IH2A 2JTEA 1YWOA 2JT4A 2AKKA 2F2XA 2JMAA 1M3CA 1TUDA 3RBBB 2DJQA 3M0PA 1SHFA 1AZEA 3C0CA 3M0QA 1X6GA 2YUPA 2DF6A 4F14A 2PZ1A 1I0CA 4CC3A 4ZNXA 2FO0A 2KYMA 3VS1A 2HSPA 2DM1A 3VS0A 1N5ZA 2KT1A 1RI9A 3PVLA 1UHCA 4HCKA 1ZUYA 3QWYA 2PTKA 2MIOA 2X3XD 1WDXA 2DL5A 2MOXA 3M0TA 5FWBA 2K3BA 2AZVA 1HJDA 3SEMA 1GL5A 2V1RA 1T0HA 1AVZC 1UUEA 1U06A 1WFWA 1ZUUA 5EC7A 2D0NA 4Z8AA 1K9AA 1HSQA 1NYGA 1PHTA 1I07A 2JS0A 4R0KA 1MV3A 2J06A 1X43A 2KXCA 2EQIA 1E7OA 2O31A 2F2WA 2VWFA 1H3HA 2RQWA 2KE9A 1WYXA 2E5KA 1SEMA 1M30A 1WIEA 2A28A 4LN2A 4J9EA 2DL4A 2KRNA 2LMJA 4AG1C 1W6XA 2EBPA 2J6OA 2YUQA 2L0AA 1T3LA 2KRSA 3I5SA 4M4ZA 2JS2A 2DBMA 3EGUA 4IIOA 3PVQA 2KYBA 4JJDA 1T0JA 3FJ5A 2BTTA 2LZ6B 2DL8A 4Z88A 2L3PA 4RTVA 1UGVA 2DL7A 2RQRA 1W70A 1QLYA 4LNPA 3REAB 4D8KA 2J6KA 2YUOA 4HVUA 4JZ4A 4LUEA 1AWWA 2SRCA 2FEIA 2F2VA 1VYVA 2HCKA 1VA7A 4DEXA 1PNJA 1BB9A 2RQTA 2J05A 2JMCA 2PNIA 2EGCA 2BZ8A 2W10A 1G2BA 2DMOA 4OMQA 4OMMA 2EGEA 2LQNA 2KEAA 3EHRA 2CDTA 2HBWA 2VKNA 1AEYA 1W1FA 3M0SA 2DYBA 2LJ0A 3EG1A 2XMFA 4D8DA 4F16A 1JQQA 2BZYA 2G6FX 2FPDA 4J9HA 1YN8A 2LQWA 1YCSB 1Z9QA 5FW9A 1CSKA 5GJWB 1I1JA 4IIMA 2DX1A 2AK5A 2CH4A 1NEBA 3UATA 4DEYA 1UJ0A 2ENMA 1M8MA 1SRMA 4Y92A 4J9DA 1JXOA 1UG1A 3EG3A 1OV3A 3VS6A 1GCQA 2DL3A 1HD3A 1LCKA 1PKSA 1NLPC 4E6RA 2RQVA 1GRIA 2MCNA 1WLPB 1QWEA 4LUDA 2RMOA 2K2MA 1H92A 3VS4A 2YT6A 1KSWA 1U5SA 4J9CA 1Z9ZA 1G83A 1UFFA 2DE0X 2DBKA 1JEGA 2AZSA 1K4US 2DLPA 1X2KA 2SEMA 4J9IA 2ROTA
chains in the Genus database with same CATH superfamily
4AT1B 5FROA 3CC4A 3JCMd 1N9SA 3EFOB 3M54A 1Q82C 2LC4A 5A0DA 1WJQA 5AYFA 2MMPA 2QA4Q 1KIKA 2R57A 1I4K1 3HRTA 4RTYA 3CC2T 3M5AA 4M7AA 4M77C 2DXTA 2CH4W 3QG1A 1W4SA 3A1PA 2LCLA 3S6WA 3GF5A 4EMKB 2DFUA 4ESRA 5IAYA 5GANd 1WHHA 1VQOT 4KGZB 1RAHB 3SWNC 4OMNA 2CP2A 3CCMT 3TSZA 1NYFA 4M77D 4OB0B 3CCSQ 1JO8A 3L2UA 2J7IA 2QK0A 3PE0A 1TXQA 1R8OB 4O6JA 2COYA 2CZ0B 1QVPA 1IXDA 1PKTA 4M75B 2ABLA 3NMZC 4A63B 1VQKQ 2YHTA 3OYEA 3CC7A 1KFZA 4Z02A 3NPFA 3WXMB 1K9MR 2YWWA 3CCUA 2DA9A 1VQ6Q 1YI2A 3X20B 3EG0A 4BY6C 2L3SA 4BD3A 5HKCA 2V26A 1KJWA 1TU0B 2A36A 4J6XA 1HK9A 2LRQA 1M3AA 3QWXX 4PJOF 4HCZA 3CCJQ 2DTIA 1PWTA 1FYNA 2LDMA 2FG0A 3LH5A 3E9GA 1X6BA 3ZL7C 1ABOA 4GY5A 5CKDA 1NG2A 2RK1A 3CEYA 4LE9A 2KNBB 1NLOC 1OZ2A 1QCOA 2MYSA 4KT0E 4M7AB 3H0HA 5LJ5f 3URGA 2GBQA 3J81E 1OULA 2EIFA 2LTOA 1RADB 5J3BA 2EGAA 2LJ3A 1NZ9A 3V7CA 4HA8A 1YBYA 1X2QA 2X9HA 3L2QA 4KBMB 4C0DB 3QPHA 5FU7B 3G6ET 1OPLA 2QYZA 7AT1B 2CUDA 2DAQA 1M1KR 4C8QE 2OAUA 3I5RA 3JV3A 1K9MC 2KMTA 4M78G 2QA4T 3V7SA 4HXJA 2FPFA 1I5LA 5DY9A 2FYKA 2OTLA 3JCMP 1XTDA 1ACMB 4AMCA 2VB6A 4FIBA 3A8MB 5LJ3g 4C8QA 4F7UE 2HKNA 3OYIA 1PRMC 3EG9A 1SSFA 1VQ9A 2L3RA 4ORZA 3L42A 4C0ZA 5FLXE 4LD6A 4RTUA 3CCST 5KYNA 4PFOA 2QDYB 1VOMA 2FZCB 2YUNA 4F7UA 5C0MA 2OTJQ 4GLKA 3M59A 4C92C 5LJ3d 3REBB 1VQKT 2E64A 4B9WA 2RPNA 3JB9J 1VQ6T 2HDAA 3FEOA 2C06A 4KUIA 2RM4A 1D3BA 2JVVA 1D0YA 1WQWA 4M78B 1XJWB 4C92D 3I56Q 2EYYA 3JCMW 2MAMA 3UT1A 4DOWA 2DO3A 2FZGB 4N0AC 3CCQA 4C5GA 5IXFA 3JCMQ 1J3TA 4OVAA 2P4RA 4MDWA 3DLLA 4EMHA 2RI2A 2QEXT 4X9CA 2MPXC 2IG0A 2HKQB 1K0SA 3OYJA 5FU6B 3TEEA 3I55Q 2M02A 4AFSC 2K79A 3MP8A 3NTKA 4OGCA 1GFDA 4IUQA 1QVFS 5KCHA 2FRWA 5DLQE 1UTIA 1VQ7Q 4OMPA 3EG9B 3I35A 3CBMA 1X75C 3DLMA 4RMOA 4CC4B 1BBZA 1OPKA 4IUTA 1M90U 2HL5C 1WQ7A 3AHUA 2KROA 3O8VA 2LX7A 5LJ5j 4J6WA 3MO8A 4FW1A 3X24B 5HK3A 2F2XA 4A54A 5GANe 4BI4A 5DM7R 2X35A 1SF9A 4LDVA 2DZCA 1AZEA 2LQKA 3C0CA 2YUPA 2DF6A 2PZ1A 5GAMf 1VQOA 3HRUA 3QYHB 2WSFE 2HSPA 3QXEB 1JJ2A 3PVLA 2JZ2A 1X01A 1LPLA 4HCCA 4XTXA 2H3JA 1ZUYA 2PVDB 2RHUA 4C0FA 4EMGA 1WDXA 3VU3C 2JJ9A 2RHXA 2K3BA 3GOXA 1GL5A 2V1RA 2OTJT 4M77G 2E70A 1U06A 4UC4A 1BCMA 5CK9A 1IRXA 2H3EB 2PQWA 3GPLA 5LL6S 2O31A 2VWFA 2RQWA 1YHQQ 2RHIA 1WIEA 1H641 3CXCA 2A28A 3CCEA 3CPWA 3MJXA 2LMJA 3I56T 4KUDK 3CCRA 3OW2A 4XU3A 3JRZA 3CMEQ 4R56A 2MI6A 3JCMc 1W6XA 4JUVA 2JS2A 3NTHA 2DBMA 4IIOA 3C95A 5CIUA 2PUKB 2DL8A 3OYBA 2KI7A 4XTUA 2AIRB 4LNPA 1QLYA 2E10A 3REAB 4D8KA 4E2FB 2J6KA 4PJOC 2O4XB 4ZGDB 4LUEA 1IHWA 1M4ZA 3I55T 2YLBA 2F2VA 1VYVA 2F5TX 3EGXB 2ATCB 4M77B 1VQ7T 2KQWA 5FRNA 2VYTA 2XDDA 4PJOD 1VIFA 2GQVA 1Y71A 2LNVA 2EGCA 2W10A 1RAAB 5EG2A 2MF2A 5IN1A 3JB9I 4OMMA 2XICA 2L5QA 2HBWA 2VKNA 1AEYA 3RR6A 2L89A 1RAFB 2DYBA 4D8DA 5GAOq 4BACA 3H6ZA 2K2VA 1JQQA 5IT9E 1QCNA 2A7YA 1S72Q 1YN8A 2LQWA 4YTLA 2Z0WA 3ZBDA 2NYSA 2CH4A 3G1JA 2QG9B 2D9TA 1M2OA 3UATA 2K3XA 1M1GA 5C6SA 1GCQA 1PKSA 1LCKA 1GRIA 3JCMV 2MCNA 5LJ3e 1WLPB 3INZA 1U5SA 1BI0A 1OZ3A 5GAMj 2EJGA 1UFFA 1QMCA 2DBKA 4Q5WA 1UB4A 2CZ7B 3EH2A 1YJWQ 4IUVA 3CCLA 1KHIA 1UEBA 5GMKj 1O9SA 3V8JA 5KYXA 2M0OA 2Y4XA 4JZ3A 1YHQT 5GAOr 1W2BS 3ME9A 2DIQA 2DXBA 3CCJA 4M7DE 1XNIA 2MK5A 3H9NA 2GCXA 2KR3A 4QVDA 2DEUA 1D1CA 4L5GA 1SSHA 1ZQ1A 3RKWA 1B3QA 4C92G 4O5VA 2DILA 1NBEB 2CS7A 4XQ3A 1SHGA 3QBYA 2A3LA 4M7DA 1K73R 2JTFA 5CR2A 1T3SA 2O2OA 2QXFA 3PIPA 1KC8U 4PKCC 2RB6A 3VUBA 2DXCA 4JRKA 1RUWA 1WXBA 1Q86C 3QIIA 2XD0A 2QQRA 4LDUA 4C5HA 4FYXB 3HFOA 3MEVA 1PSFA 3EFOA 1D1AA 2GF7A 2CT3A 5ECAA 2HAXA 2ECZA 5L8RE 2RJCA 3H0FA 3LH0A 4WF2A 2FRYA 3QDRB 4BDYA 4J5YA 1Q82R 4HKEA 1Y7XA 2HD0A 1TSFA 1QVGP 1K8AU 2CREA 2ZPFB 1PSEA 4OF1A 1S72T 1K76A 3C12A 4NS5A 2DNUA 3OSSC 1U8RA 4X34A 4BUGA 3DKMA 4AFZC 1Q7YU 4E7LA 3JB9H 3VJPA 3LGFA 2ESWA 3JCMf 3CD6A 2XI9A 4KGXB 1H3ZA 1QP2A 1YNZA 4RCCA 1R0CB 3OS0A 2DVEA 3HTRA 2RA2A 3HFNA 1W2BP 3CBOA 5I21A 3SD4A 1YJWT 2RO0A 1ZLMA 1Y96A 5GANf 3M55A 1NJIU 4QVZA 2LCSA 3M58A 3MP1A 1QCFA 5GAN6 3DB4A 2RF0A 1BI1A 4CI0C 3FC3A 3BFMA 2ZPGB 5A2QE 1QKWA 1Y57A 1M27C 2KK4A 3M0UA 4XTWA 1YFNA 3VS3A 1OEBA 3L2ZA 2M9UA 1ZUKA 1BK2A 1RACB 4M75F 3BDUA 9ATCB 4NOYA 3FIFA 2EYQA 1AZGB 4XTYA 3ULRB 2KVQG 1VQ7A 2GNCA 2GTOA 3T9NA 1NEGA 2AKLA 2AT1B 1I81A 2I2LA 3RIRA 5I22A 2GFUA 1MMGA 2CP5A 1MMNA 1X69A 3CCVQ 3NHNA 3OYKA 1G8XA 4PJOG 4JLIA 3JCMX 4DBHA 4HCBA 1VQPA 1OU8A 3QZ5B 3V8KA 1YP5A 4QT7A 2ED0A 3M0RA 1Y96B 4J9GA 2ZAEA 1LVKA 4PJMA 4M7AF 2A37A 2LT1A 3FRNA 2OX7A 2JTMA 2X4WA 3TU4K 4RG2A 1E6GA 4M78E 4XK8E 1AWJA 2JM8A 2BZXA 2D8JA 2QEXQ 2M0YA 3IQLA 2VUBA 5IHKA 3J7AF 2BUDA 2K7AA 2NLUA 5KH6A 4JJCA 2FZKB 4J9BA 1Q81U 2O9SA 1TH7A 3RUXA 4M78A 3P8BB 3UA7A 2XU8A 1YHQA 1BI2A 3SHWA 3FB9A 1PG5B 2EW3A 4FT2A 3P8HA 4J7IA 5IH2A 1YWOA 4E7JA 3CMEA 3G4SQ 1GXIE 3M0PA 1SHFA 2K57A 4ANJA 1BCOA 3M0QA 1X6GA 1BI3A 1I0CA 4ZNXA 2ZPBB 4EPCA 1R0BG 4XU0A 1N27A 5DLOA 5LJ3f 5GANj 1RI9A 4FYYB 2M16A 3GIBA 1Y07A 5GAN7 2MOXA 5CCAA 2HL3A 5CKBA 1WHGA 1UUEA 4ZN1A 1C0MA 1WGSA 3EAEA 2CYZB 2DYIA 2D0NA 3OSVA 1VQ8T 1NYGA 1PHTA 4R0KA 3JSCA 3E1SA 4J83A 2E1HA 4BB7A 4EDUA 1YJNQ 3CMAQ 2KE9A 3OS2A 1SKUB 3CCVT 5KE2A 8ATCB 5GAOn 5I2MA 3L2VA 1C6VX 3R6OA 4J9EA 2KRNA 5KYYA 1ZSZC 2XKOC 4AG1C 4OP0A 4RKUE 2EBPA 2L0AA 2A0FB 3GNFB 1WNLA 3EGUA 3PVQA 1VQLQ 2KYBA 3QUIA 2IVWA 1RAIB 4C8QF 2HMAA 1WHLA 3AT1B 2XIDA 3QKJA 2DTHA 2FEIA 2HBPA 1M90C 4F04B 1VA7A 2G3RA 2DJZA 4LDXA 2R58A 2WACA 5GAOm 4JDSA 2RQTA 1V76A 2J05A 5GAN5 2E5QA 1VQNA 4M7DC 3JCMe 4F7UF 2YRDA 1G2BA 2FHDA 4LD9K 2LQNA 2KEAA 2CDTA 3QHSA 5GAN2 5KCOA 2R5AA 3M0SA 1M1KU 5GAN4 2YLCA 3G4ST 3UPUA 3KXTA 4M77E 4M7DD 1OX8A 4V2SA 2IPOB 2FPDA 2P0QA 4PJNA 1YCSB 1N8RU 2EAYA 3CC2A 5FW9A 5GJWB 2DX1A 2O4XA 2QQ9A 1KG1A 4DBQA 1SRMA 4DA4A 3M53A 4DBFA 5KYYB 3EG3A 1OV3A 3VS6A 3EGXA 1NLPC 1WHJA 4EMKC 4M77A 3CCMA 5CKEA 2RHZA 3BE3A 3CPFA 4TVRA 3MKDA 3OYYA 3CCUQ 1B7TA 1Z9ZA 5LJ5h 2DE0X 3SWNA 3QJYA 4L59A 2XG8D 5A0GA 5KYWA 5LJ3j 5GAMg 2EQMA 4ZGEB 1QP3A 1U1TA 4M75C 1YJNT 3CMAT 1IZ6A 2YRVA 2O01E 3ZFJA 4ELZC 1N9RA 2D8HA 3QJ6A 4QKUA 4ATOA 5L23A 5CAIA 3OBYA 4M75D 5GAOl 2QDLA 2DZ9A 2K5FA 2C0TA 1VYUA 1RI0A 1JJ2S 1VQLT 1IO6A 4CC2A 1NPRA 3UDCA 4OB1B 4OB3B 8AT1B 2NUZA 3MEWA 1M5Q1 2LNHB 5CKHA 3OYDA 4QVCA 1MMAA 3FLGA 3EG2A 1QVFP 1RLQC 1G5VA 4JPBW 3R6NA 2E6NA 2H8HA 5J26A 4J6YA 3VS5A 4XTVA 4EIKA 2DVJA 3LW5E 2VXEA 3CC4T 4M7AC 2CZ6B 1RLPC 2ZCFB 4X1VA 4Z89A 2ED1A 3JB9F 3PT9A 4P5NA 2X4YA 3G6EA 2OTLQ 1GFCA 2LQ8A 4PL6A 2XK0A 5FU7C 2EVRA 3OW2S 1WA7A 4M7AD 1K0XA 2K3YA 3SWNB 1WXUA 1KC8R 2PUOB 2QA4A 1AWOA 1ARKA 2EYWA 1QVGA 4HVWA 3LGLA 6AT1B 1QWFA 3PMIA 1G3WA 5KYWB 4RTXA 5GMKm 1OOTA 4QQDA 3PNWC 3VRZA 3SB2A 1FMKA 2DPPB 1ZBXA 4LDWA 2CP6A 4C0GA 1MNDA 3OQ5A 1MV0B 1Q86R 2C0OA 3N5BB 5CO7A 2FL7A 1OYXA 3CCSA 1D09B 2GFAA 3KFVA 1WZOA 4BY6B 3CCUT 2JN0A 5CQYA 4C92E 3A98A 3TCJA 2W0ZA 1NPPA 4LXCA 3FDRA 2VASA 3CCVA 1VQKA 2JW4A 1X6OA 2X51A 1A0NB 2QGFB 3CCQQ 4KRTA 1VQ6A 1CKAA 1K1ZA 3BY7A 2EFIA 4C92A 3OYLA 2O88A 3ZEHA 2FVUA 1VYTA 4M78C 2QASA 1KC8C 1SRLA 3OY9A 5I11A 2CP7A 5GAMh 4AFUC 3ER0A 2EQUA 4BDZA 2VVKA 4PK4A 2QEXA 4M78D 1TUCA 4OMLA 5GMKh 1NJIR 4N0AA 1ZA1B 4N4IA 4GBQA 2QAZA 4AG2C 5FU6C 4E7HA 3JCMJ 1YJ9Q 3TVTA 2FPEA 2COZA 2L3QA 2QI2A 5GMKl 1K8AC 1WHMA 2JNGA 3OBWA 1UJYA 2E12A 2OAWA 2RJEA 4C8QC 3VYHB 1V1CA 2L2PA 5I2SA 3H8ZA 2OTLT 1X27A 3OS1A 4RTZA 3HSBA 1I8FA 1TG0A 1JU5C 1WI7A 1PM3A 2OI3A 2CUBA 4BE1A 1Q7YC 4FM4B 2E4HA 2LJ1A 3CQTA 3GBQA 1IHVA 3OYGA 2COWA 1ABQA 1O75A 4C8QD 3S3MA 1VQ9T 3THKA 3PIOA 3OS5A 1EFNA 1MNEA 2EJ9A 2PU9B 2K9GA 2IIMA 4CC7A 4M7DG 1YIJQ 2D1XA 1JRIA 3HP9A 4C92B 3RDVA 1GBRA 3VS7A 4HT8A 2YDLA 2V1QA 3MP6A 1ZSZB 2J6FA 4M7DF 1UHFA 1ZA2B 1NJIC 3EGDA 5M9OA 2B86A 1VQ4Q 1NM7A 4A53A 2DD5A 3EH1A 3CCEQ 2OTJA 2PVOB 2RQUA 1KD1U 4DOVA 2GTJA 3H41A 3CCRQ 2GGRA 1UGQB 3M9QA 1I5OB 5HK0A 2RK2A 1Q95G 1FXXA 3CCQT 3PMTA 1RL2A 1M3CA 1G3SA 3RMSA 1FMWA 3PFSA 3C4SA 3I56A 4F14A 3PTAA 3LLRA 1VQLA 2X4JA 2MWOA 3C94A 2QQSA 1NE8A 1PD0A 2FO0A 2KYMA 3VS1A 3OA6A 2CP3A 3VS0A 1N5ZA 2KT1A 4C5IA 4JRPA 2ZPHB 2HQHA 1UHCA 2MWPA 4PJOE 4M75G 4FCYA 2PTKA 2MIOA 2DETA 2X3XD 1BKBA 1B34A 2ZGWA 3M0TA 3OYCA 4A4KA 1HJDA 1P92A 1K73U 1WPYA 3I55A 4ZGJB 5A0LA 2BE9B 1D0XA 2QQBA 1WFWA 4BE0A 1ZUUA 1YJ9T 1HSQA 1I07A 2JS0A 5GAOp 1MV3A 1IGUA 2J06A 4E7ZA 4PJOA 4LDYA 2EQIA 1H3HA 5GAN3 1KQSS 2E5KA 1SEMA 1VQ8Q 1M30A 2E3IA 3MHXA 4LN2A 2CKKA 2DK3A 3EGDB 2DIGA 4RCBA 2VGNA 1Q82U 1VQ5Q 1UGSB 2J6OA 2YUQA 2KRSA 5CKFA 4M4ZA 3JAME 1OQKA 1G3YA 4M7AG 4JJDA 2ZZDA 3FJ5A 4Z88A 2DTOA 2L3PA 4RTVA 1UGVA 4A4EA 2RH2A 2FB7A 1W70A 2NUPA 4B9XA 1XQHA 2P84A 1Q81C 1PC0A 1YITQ 1YIJT 4HVUA 3JB9D 4PFZA 4JJNK 2NUTA 3KBGA 2HNIA 4JS5A 3RMQA 1RAEB 3CCLQ 4DEXA 2RI5A 2DXUA 1BB9A 2KY9A 1VQ4T 2JMCA 2PNIA 4A4FA 1IREB 3G71Q 2BZ8A 3A8LB 3CCET 5D7UA 4OMQA 3CCRT 2K5IA 2EGEA 1B34B 2HSEB 3D7SB 3M56A 4J8OA 3M4GA 3QO3A 1W1FA 3A8GB 3RESA 3MPUB 3EG1A 2XMFA 3F70A 2D0QB 2BKDN 2VXFA 4FYVB 4PJOB 4OGEA 2CP0A 4MZPA 1I1JA 1NEBA 2ENMA 2P0PA 1HXDA 5LJ5g 2HQXA 1VQMQ 1UG1A 1FWZA 2DL3A 2QQAA 1HD3A 4DQ2A 4MZMA 3LWHA 2ZPIB 3RKYA 4BI3A 1QWEA 4N4GA 3MEUA 4RG8A 3VS4A 3OMGA 4E47A 3OYFA 1KSWA 3JCMh 3MCAB 2XDPA 1M90R 1KQSP 1G83A 3V7RA 3OYHA 1M1FA 1JEGA 2AZSA 3CBPA 2DLPA 1X2KA 2ROTA 2NUPB 3QYGB 1N8RR 4OB2B 2C0IA 1OX9A 2NUTB 2JUFA 5LJ5d 2LT4A 2WSEE 1M3BA 5KYUA 4ZTJA 1YCYA 4M78F 3X26B 1YWPA 1GCQC 5IHNA 5GANh 4MMLA 1BU1A 3P8DA 2VV5A 2F1LA 2JM9A 1MUZA 3E9FA 4AFQC 2LVMA 1VQ5T 1K9MU 1R77A 2V8JA 1M9SA 3HKSA 3GLXA 4GLMA 4IKFA 2YXYA 3CD6Q 1WHKA 4WCIA 3J80E 1S72A 2KBTA 3SFMA 1U3OA 3A8OB 4JS4A 3VUZA 4C8QG 2JXBA 3GP8A 1YITT 4OMOA 4NL2A 2EYZA 2O9VA 3I9QA 4HVVA 1UDLA 4KULA 3NFCA 3L2RA 3BDLA 3V8LA 3CCLT 2EWNA 1QVFA 1E6HA 1JXMA 1TTHB 2A08A 1M1KC 3LYIA 1M8VA 1UGPB 4F7UG 2P0KA 1S1NA 4KH1B 2EPDA 3G71T 3TREA 3CCJT 3CC4Q 1YJWA 1N8RC 2DRMA 4KGVB 2X3WD 4FT4A 1VUBA 4XTZA 3L2WA 3L1AA 2DKGA 4II1A 4JJBA 4XU2A 1SG5A 2L8DA 4J7FA 1KQ2A 3HHTB 1ZX6A 2I0NA 2F5KA 5KYUB 4FSSA 2M51A 4F17A 4ELYC 1WX6A 2QGGA 5GMKi 4L6V5 5D6XA 4C8QB 1VQMT 1H8KA 2CSQA 3UA6A 2E65A 5GJVB 1RABB 1K8AR 5HCKA 1GCPA 4JRIA 2NWMA 1YJ9A 2RJFA 2LP5A 2KT8A 4DBRA 3CC7Q 2B8AA 2YSQA 4F7UB 2Y4YA 4JLGA 3M4YA 1BYMA 3RNJA 1MMDA 2BIVA 1DJ7B 2EJFA 1YI2Q 1TWBA 2DD4A 1VQPQ 2KDSA 4ME7A 2HZYA 2LCCA 4MDXA 2EKOA 2PVGB 1ZHIA 1KHCA 3VS2A 1D3BB 1PRLC 4ZN3A 1CKBA 5D6WA 4CRIA 1SPKA 2KAFA 1MHNA 1B07A 1UECA 3CD6T 2RHYA 4IURA 1GBQA 1M2VA 1YIJA 4BE2A 2CZ1B 3E2UA 1Y0MA 4N4HA 5LJ3h 1KK7A 2GQIA 1UE9A 1WXTA 1ZBJA 5GAMd 5FWCA 2KXDA 2HEQA 1AWXA 4PJLA 2CT4A 2DRKA 1VQ4A 1F1BB 2V8IA 4M77F 3JB9G 5IXBA 3H0IA 3EHQA 4QQGA 3A8HB 1XOVA 4IUUA 5CQXA 2E41A 1KQ1A 2LX9A 3VRYA 5KE3A 3VKIA 3UF4A 1TUGB 1AD5A 3OMCA 2RJDA 4FL6A 1JB0E 4VUBA 2VC8A 4K11A 2KGTA 2K6DA 4J9FA 5IHIA 3CXCS 2ROLA 1ZSGA 3CPWS 4C0DC 2EKHA 3M57A 2RI3A 1D0ZA 1C1AA 1AOJA 3QZ9B 3ASKA 3LX7A 1PCXA 4WTOB 1IB8A 1VQ9Q 4IUPA 4OMFB 3QSUA 3QDFA 1LJOA 2RN8A 1U1SA 3U23A 2RD1A 4Y28E 2R5MA 3BW1A 2AHJB 4RTWA 3TSWA 2OJ2A 2CSIA 5LJ5e 1EX4A 3SDZA 2YRCA 4RTTA 1PD1A 2M1HA 1QKXA 2P4TA 2RNAA 4QW2A 2EYXA 3A5ZB 1M2VB 2V8KA 4PFPA 3CC7T 2ZPEB 2KRMA 4RUGA 5J39A 1YI2T 1VQ8A 1VQPT 3O5ZA 5HY6A 3NGPA 4PLLA 2JTEA 1W2BA 2JT4A 2AKKA 2JMAA 1TUDA 1IGQA 3RBBB 3HL8A 2DJQA 1QVGS 2XDBA 1FX7A 1VQ5A 2K4YA 4FW2A 1HYOA 1Q7YR 5CVIA 2K5LA 4XAXB 1JJ2P 1LOJA 4CC3A 2DM1A 3VYGA 4MMKA 1TOVA 1BIBA 2QTVA 1YITA 4BI8B 4FSXA 1KD1R 1UGRB 1MGQA 1ZSZA 4HCKA 4XU1A 3G7ZA 4E7KA 3QWYA 2WSCE 4PJJA 2VGMA 2DL5A 4C5EA 3HRSA 5FWBA 2AZVA 1G3TA 4Y91A 1VQNQ 3SEMA 3OYNA 1T0HA 1AVZC 4B6MA 1AHJB 3JCMb 5EC7A 4Z8AA 1K9AA 3G71A 1X43A 2KXCA 1E7OA 2F2WA 3CXCP 3CMET 1WYXA 1VIEA 3CPWP 3S3NA 3DB3A 3OW2P 3EFSA 2DL4A 4MZTA 4PLIA 3CC2Q 3E19A 3FJPA 2E6ZA 3HPWA 1T3LA 3S3OA 3I5SA 1RAGB 1FMVA 3UWNA 5GAN8 3G4SA 1VQOQ 2EQKA 4C92F 1T0JA 4ZTFA 2BTTA 2LZ6B 1VQMA 3CCMQ 4R55A 3X28B 5FRMA 2DL7A 2RQRA 3OYAA 2YUOA 3KUFA 4JZ4A 4QQ6A 2KSSA 4NL3A 4FU6A 1EZZB 3RKXA 1JBMA 1AWWA 2SRCA 1KD1C 3PGGA 2HQEA 2HCKA 1PNJA 1BIAA 2E3HA 4A4HA 2QTXA 4HT9A 1WJRA 4FYWB 3OYMA 1QW1A 5AT1B 1Q86U 3RERA 2DEQA 1OI1A 4EMKA 2DMOA 4M75E 2EQJA 3WVDB 3EHRA 3Q1JA 3OB9A 1AT1B 4A4GA 5KYXB 2Y90A 2LJ0A 1YJNA 3CMAA 3EFRA 4F16A 3VV0A 2BZYA 1N6AA 2G6FX 2F69A 2X4XA 1OU9A 4J9HA 1D1BA 4D6WA 3NTIA 1Z9QA 4X9DA 2JOYA 1CSKA 3WVEB 3META 4M75A 4IIMA 2XHCA 2AK5A 4DEYA 1QQJA 1UJ0A 2D6FA 3JCMg 1M8MA 5GAMe 1K73C 4Y92A 4J9DA 1JXOA 1WJSA 3MEAA 4JRQA 4E6RA 2RQVA 5GMKe 1LNXA 5D6YA 4E7SA 1V29B 1Q81R 3TQ7P 2CGHA 4LUDA 4PNOA 1TS9A 2RMOA 1EIFA 4M7DB 2K2MA 1H92A 3LWIA 2YT6A 1VQNT 4J9CA 4KH0B 2DERA 3G6EQ 4M7AE 3X25B 4E7IA 1K4US 5GANg 2SEMA 4J9IA 1KQSA 3GNGA 2BE7D
chains in the Genus database with same CATH topology
2C0IA 4JZ3A 1M3BA 1KIKA 4RTYA 1YWPA 1GCQC 5IHNA 2D8HA 1BU1A 2JM9A 2KR3A 5L23A 1MUZA 2CH4W 4AFQC 2QDLA 1SSHA 1B3QA 2C0TA 4ESRA 1VYUA 4GLMA 2DILA 1IO6A 4OMNA 4CC2A 1SHGA 4WCIA 2KBTA 1U3OA 3TSZA 1NYFA 2JXBA 2NUZA 1T3SA 2LNHB 2O2OA 1JO8A 4OMOA 3EG2A 2J7IA 2EYZA 1RUWA 1WXBA 3PE0A 1RLQC 2O9VA 3I9QA 4HVVA 1UDLA 4JPBW 3R6NA 2H8HA 1E6HA 1JXMA 1PKTA 3VS5A 4EIKA 2ABLA 2DVJA 3NMZC 4A63B 1KFZA 1RLPC 2CT3A 2A08A 4X1VA 5ECAA 4Z89A 2ECZA 2ED1A 3NPFA 1S1NA 2DA9A 2EPDA 3H0FA 3EG0A 2FRYA 2L3SA 1GFCA 1KJWA 2DRMA 2A36A 2X3WD 2EVRA 1WA7A 1M3AA 3QWXX 1K0XA 2CREA 1WXUA 1PWTA 1AWOA 1FYNA 2EYWA 1ARKA 4HVWA 4JJBA 1QWFA 1K76A 2FG0A 2DNUA 4RTXA 1ZX6A 2I0NA 3LH5A 1OOTA 4FSSA 2M51A 4F17A 4AFZC 1WX6A 1X6BA 3ZL7C 1ABOA 3VRZA 1NG2A 1FMKA 1H8KA 2CSQA 3UA6A 4LE9A 2KNBB 1NLOC 2ESWA 3H0HA 5GJVB 2GBQA 1YNZA 5HCKA 1MV0B 1GCPA 2C0OA 2EGAA 2LJ3A 3KFVA 2NWMA 1X2QA 2LP5A 2KT8A 3A98A 2W0ZA 2YSQA 1OPLA 2CUDA 1ZLMA 3RNJA 2JW4A 3I5RA 3JV3A 2LCSA 1A0NB 1QCFA 4KRTA 4HXJA 1CKAA 2RF0A 1K1ZA 2FPFA 3VS2A 1PRLC 1CKBA 2O88A 1VYTA 1QKWA 1SPKA 1M27C 1Y57A 3M0UA 1SRLA 1PRMC 5I11A 1B07A 1UECA 3VS3A 1OEBA 1GBQA 4ORZA 4AFUC 1ZUKA 1BK2A 4RTUA 2VVKA 1TUCA 4OMLA 1Y0MA 2GQIA 1UE9A 4GBQA 1AZGB 1WXTA 1ZBJA 3ULRB 2YUNA 5FWCA 2GNCA 2GTOA 2KXDA 1NEGA 2AKLA 4AG2C 2HEQA 1AWXA 2CT4A 2DRKA 3TVTA 2FPEA 3REBB 5IXBA 3H0IA 2L3QA 3EHQA 2RPNA 5I22A 1XOVA 1UJYA 2OAWA 1X69A 2HDAA 1V1CA 2L2PA 3VRYA 1X27A 4RTZA 3UF4A 3NHNA 1TG0A 1AD5A 2EYYA 1JU5C 1WI7A 2OI3A 2CUBA 5IHIA 2KGTA 4J9FA 2K6DA 2LJ1A 1YP5A 3CQTA 4K11A 2ROLA 3GBQA 1ZSGA 1ABQA 4QT7A 2EKHA 2ED0A 5IXFA 3M0RA 1J3TA 3THKA 4J9GA 1EFNA 1AOJA 2P4RA 2K9GA 2A37A 2IIMA 4CC7A 1E6GA 1K0SA 1AWJA 2D1XA 2JM8A 2BZXA 2RN8A 3VS7A 1GBRA 2D8JA 4AFSC 2K79A 2M0YA 3U23A 1GFDA 3IQLA 5IHKA 2FRWA 2YDLA 2K7AA 2V1QA 2J6FA 1UHFA 1UTIA 4RTWA 2OJ2A 3TSWA 2CSIA 4OMPA 4JJCA 3I35A 4RTTA 4J9BA 1QKXA 2RNAA 2O9SA 2B86A 2EYXA 1NM7A 4CC4B 1BBZA 1OPKA 2KRMA 3UA7A 2RQUA 4RUGA 2GTJA 3H41A 2GGRA 3SHWA 3O5ZA 2KROA 3NGPA 2LX7A 2EW3A 5IH2A 2JTEA 1YWOA 2JT4A 2AKKA 2F2XA 2JMAA 1M3CA 1TUDA 3RBBB 2DJQA 3M0PA 1SHFA 1AZEA 3C0CA 3M0QA 1X6GA 2YUPA 2DF6A 4F14A 2PZ1A 1I0CA 4CC3A 4ZNXA 2FO0A 2KYMA 3VS1A 2HSPA 2DM1A 3VS0A 1N5ZA 2KT1A 1RI9A 3PVLA 1UHCA 4HCKA 1ZUYA 3QWYA 2PTKA 2MIOA 2X3XD 1WDXA 2DL5A 2MOXA 3M0TA 5FWBA 2K3BA 2AZVA 1HJDA 3SEMA 1GL5A 2V1RA 1T0HA 1AVZC 1UUEA 1U06A 1WFWA 1ZUUA 5EC7A 2D0NA 4Z8AA 1K9AA 1HSQA 1NYGA 1PHTA 1I07A 2JS0A 4R0KA 1MV3A 2J06A 1X43A 2KXCA 2EQIA 1E7OA 2O31A 2F2WA 2VWFA 1H3HA 2RQWA 2KE9A 1WYXA 2E5KA 1SEMA 1M30A 1WIEA 2A28A 4LN2A 4J9EA 2DL4A 2KRNA 2LMJA 4AG1C 1W6XA 2EBPA 2J6OA 2YUQA 2L0AA 1T3LA 2KRSA 3I5SA 4M4ZA 2JS2A 2DBMA 3EGUA 4IIOA 3PVQA 2KYBA 4JJDA 1T0JA 3FJ5A 2BTTA 2LZ6B 2DL8A 4Z88A 2L3PA 4RTVA 1UGVA 2DL7A 2RQRA 1W70A 1QLYA 4LNPA 3REAB 4D8KA 2J6KA 2YUOA 4HVUA 4JZ4A 4LUEA 1AWWA 2SRCA 2FEIA 2F2VA 1VYVA 2HCKA 1VA7A 4DEXA 1PNJA 1BB9A 2RQTA 2J05A 2JMCA 2PNIA 2EGCA 2BZ8A 2W10A 1G2BA 2DMOA 4OMQA 4OMMA 2EGEA 2LQNA 2KEAA 3EHRA 2CDTA 2HBWA 2VKNA 1AEYA 1W1FA 3M0SA 2DYBA 2LJ0A 3EG1A 2XMFA 4D8DA 4F16A 1JQQA 2BZYA 2G6FX 2FPDA 4J9HA 1YN8A 2LQWA 1YCSB 1Z9QA 5FW9A 1CSKA 5GJWB 1I1JA 4IIMA 2DX1A 2AK5A 2CH4A 1NEBA 3UATA 4DEYA 1UJ0A 2ENMA 1M8MA 1SRMA 4Y92A 4J9DA 1JXOA 1UG1A 3EG3A 1OV3A 3VS6A 1GCQA 2DL3A 1HD3A 1LCKA 1PKSA 1NLPC 4E6RA 2RQVA 1GRIA 2MCNA 1WLPB 1QWEA 4LUDA 2RMOA 2K2MA 1H92A 3VS4A 2YT6A 1KSWA 1U5SA 4J9CA 1Z9ZA 1G83A 1UFFA 2DE0X 2DBKA 1JEGA 2AZSA 1K4US 2DLPA 1X2KA 2SEMA 4J9IA 2ROTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0I A;  4JZ3 A;  1M3B A;  1KIK A;  4RTY A;  1YWP A;  1GCQ C;  5IHN A;  2D8H A;  1BU1 A;  2JM9 A;  2KR3 A;  5L23 A;  1MUZ A;  2CH4 W;  4AFQ C;  2QDL A;  1SSH A;  1B3Q A;  2C0T A;  4ESR A;  1VYU A;  4GLM A;  2DIL A;  1IO6 A;  4OMN A;  4CC2 A;  1SHG A;  4WCI A;  2KBT A;  1U3O A;  3TSZ A;  1NYF A;  2JXB A;  2NUZ A;  1T3S A;  2LNH B;  2O2O A;  1JO8 A;  4OMO A;  3EG2 A;  2J7I A;  2EYZ A;  1RUW A;  1WXB A;  3PE0 A;  1RLQ C;  2O9V A;  3I9Q A;  4HVV A;  1UDL A;  4JPB W;  3R6N A;  2H8H A;  1E6H A;  1JXM A;  1PKT A;  3VS5 A;  4EIK A;  2ABL A;  2DVJ A;  3NMZ C;  4A63 B;  1KFZ A;  1RLP C;  2CT3 A;  2A08 A;  4X1V A;  5ECA A;  4Z89 A;  2ECZ A;  2ED1 A;  3NPF A;  1S1N A;  2DA9 A;  2EPD A;  3H0F A;  3EG0 A;  2FRY A;  2L3S A;  1GFC A;  1KJW A;  2DRM A;  2A36 A;  2X3W D;  2EVR A;  1WA7 A;  1M3A A;  3QWX X;  1K0X A;  2CRE A;  1WXU A;  1PWT A;  1AWO A;  1FYN A;  2EYW A;  1ARK A;  4HVW A;  4JJB A;  1QWF A;  1K76 A;  2FG0 A;  2DNU A;  4RTX A;  1ZX6 A;  2I0N A;  3LH5 A;  1OOT A;  4FSS A;  2M51 A;  4F17 A;  4AFZ C;  1WX6 A;  1X6B A;  3ZL7 C;  1ABO A;  3VRZ A;  1NG2 A;  1FMK A;  1H8K A;  2CSQ A;  3UA6 A;  4LE9 A;  2KNB B;  1NLO C;  2ESW A;  3H0H A;  5GJV B;  2GBQ A;  1YNZ A;  5HCK A;  1MV0 B;  1GCP A;  2C0O A;  2EGA A;  2LJ3 A;  3KFV A;  2NWM A;  1X2Q A;  2LP5 A;  2KT8 A;  3A98 A;  2W0Z A;  2YSQ A;  1OPL A;  2CUD A;  1ZLM A;  3RNJ A;  2JW4 A;  3I5R A;  3JV3 A;  2LCS A;  1A0N B;  1QCF A;  4KRT A;  4HXJ A;  1CKA A;  2RF0 A;  1K1Z A;  2FPF A;  3VS2 A;  1PRL C;  1CKB A;  2O88 A;  1VYT A;  1QKW A;  1SPK A;  1M27 C;  1Y57 A;  3M0U A;  1SRL A;  1PRM C;  5I11 A;  1B07 A;  1UEC A;  3VS3 A;  1OEB A;  1GBQ A;  4ORZ A;  4AFU C;  1ZUK A;  1BK2 A;  4RTU A;  2VVK A;  1TUC A;  4OML A;  1Y0M A;  2GQI A;  1UE9 A;  4GBQ A;  1AZG B;  1WXT A;  1ZBJ A;  3ULR B;  2YUN A;  5FWC A;  2GNC A;  2GTO A;  2KXD A;  1NEG A;  2AKL A;  4AG2 C;  2HEQ A;  1AWX A;  2CT4 A;  2DRK A;  3TVT A;  2FPE A;  3REB B;  5IXB A;  3H0I A;  2L3Q A;  3EHQ A;  2RPN A;  5I22 A;  1XOV A;  1UJY A;  2OAW A;  1X69 A;  2HDA A;  1V1C A;  2L2P A;  3VRY A;  1X27 A;  4RTZ A;  3UF4 A;  3NHN A;  1TG0 A;  1AD5 A;  2EYY A;  1JU5 C;  1WI7 A;  2OI3 A;  2CUB A;  5IHI A;  2KGT A;  4J9F A;  2K6D A;  2LJ1 A;  1YP5 A;  3CQT A;  4K11 A;  2ROL A;  3GBQ A;  1ZSG A;  1ABQ A;  4QT7 A;  2EKH A;  2ED0 A;  5IXF A;  3M0R A;  1J3T A;  3THK A;  4J9G A;  1EFN A;  1AOJ A;  2P4R A;  2K9G A;  2A37 A;  2IIM A;  4CC7 A;  1E6G A;  1K0S A;  1AWJ A;  2D1X A;  2JM8 A;  2BZX A;  2RN8 A;  3VS7 A;  1GBR A;  2D8J A;  4AFS C;  2K79 A;  2M0Y A;  3U23 A;  1GFD A;  3IQL A;  5IHK A;  2FRW A;  2YDL A;  2K7A A;  2V1Q A;  2J6F A;  1UHF A;  1UTI A;  4RTW A;  2OJ2 A;  3TSW A;  2CSI A;  4OMP A;  4JJC A;  3I35 A;  4RTT A;  4J9B A;  1QKX A;  2RNA A;  2O9S A;  2B86 A;  2EYX A;  1NM7 A;  4CC4 B;  1BBZ A;  1OPK A;  2KRM A;  3UA7 A;  2RQU A;  4RUG A;  2GTJ A;  3H41 A;  2GGR A;  3SHW A;  3O5Z A;  2KRO A;  3NGP A;  2LX7 A;  2EW3 A;  5IH2 A;  2JTE A;  1YWO A;  2JT4 A;  2AKK A;  2F2X A;  2JMA A;  1M3C A;  1TUD A;  3RBB B;  2DJQ A;  3M0P A;  1SHF A;  1AZE A;  3C0C A;  3M0Q A;  1X6G A;  2YUP A;  2DF6 A;  4F14 A;  2PZ1 A;  1I0C A;  4CC3 A;  4ZNX A;  2FO0 A;  2KYM A;  3VS1 A;  2HSP A;  2DM1 A;  3VS0 A;  1N5Z A;  2KT1 A;  1RI9 A;  3PVL A;  1UHC A;  4HCK A;  1ZUY A;  3QWY A;  2PTK A;  2MIO A;  2X3X D;  1WDX A;  2DL5 A;  2MOX A;  3M0T A;  5FWB A;  2K3B A;  2AZV A;  1HJD A;  3SEM A;  1GL5 A;  2V1R A;  1T0H A;  1AVZ C;  1UUE A;  1U06 A;  1WFW A;  1ZUU A;  5EC7 A;  2D0N A;  4Z8A A;  1K9A A;  1HSQ A;  1NYG A;  1PHT A;  1I07 A;  2JS0 A;  4R0K A;  1MV3 A;  2J06 A;  1X43 A;  2KXC A;  2EQI A;  1E7O A;  2O31 A;  2F2W A;  2VWF A;  1H3H A;  2RQW A;  2KE9 A;  1WYX A;  2E5K A;  1SEM A;  1M30 A;  1WIE A;  2A28 A;  4LN2 A;  4J9E A;  2DL4 A;  2KRN A;  2LMJ A;  4AG1 C;  1W6X A;  2EBP A;  2J6O A;  2YUQ A;  2L0A A;  1T3L A;  2KRS A;  3I5S A;  4M4Z A;  2JS2 A;  2DBM A;  3EGU A;  4IIO A;  3PVQ A;  2KYB A;  4JJD A;  1T0J A;  3FJ5 A;  2BTT A;  2LZ6 B;  2DL8 A;  4Z88 A;  2L3P A;  4RTV A;  1UGV A;  2DL7 A;  2RQR A;  1W70 A;  1QLY A;  4LNP A;  3REA B;  4D8K A;  2J6K A;  2YUO A;  4HVU A;  4JZ4 A;  4LUE A;  1AWW A;  2SRC A;  2FEI A;  2F2V A;  1VYV A;  2HCK A;  1VA7 A;  4DEX A;  1PNJ A;  1BB9 A;  2RQT A;  2J05 A;  2JMC A;  2PNI A;  2EGC A;  2BZ8 A;  2W10 A;  1G2B A;  2DMO A;  4OMQ A;  4OMM A;  2EGE A;  2LQN A;  2KEA A;  3EHR A;  2CDT A;  2HBW A;  2VKN A;  1AEY A;  1W1F A;  3M0S A;  2DYB A;  2LJ0 A;  3EG1 A;  2XMF A;  4D8D A;  4F16 A;  1JQQ A;  2BZY A;  2G6F X;  2FPD A;  4J9H A;  1YN8 A;  2LQW A;  1YCS B;  1Z9Q A;  5FW9 A;  1CSK A;  5GJW B;  1I1J A;  4IIM A;  2DX1 A;  2AK5 A;  2CH4 A;  1NEB A;  3UAT A;  4DEY A;  1UJ0 A;  2ENM A;  1M8M A;  1SRM A;  4Y92 A;  4J9D A;  1JXO A;  1UG1 A;  3EG3 A;  1OV3 A;  3VS6 A;  1GCQ A;  2DL3 A;  1HD3 A;  1LCK A;  1PKS A;  1NLP C;  4E6R A;  2RQV A;  1GRI A;  2MCN A;  1WLP B;  1QWE A;  4LUD A;  2RMO A;  2K2M A;  1H92 A;  3VS4 A;  2YT6 A;  1KSW A;  1U5S A;  4J9C A;  1Z9Z A;  1G83 A;  1UFF A;  2DE0 X;  2DBK A;  1JEG A;  2AZS A;  1K4U S;  2DLP A;  1X2K A;  2SEM A;  4J9I A;  2ROT A; 
#chains in the Genus database with same CATH topology
 4AT1 B;  5FRO A;  3CC4 A;  3JCM d;  1N9S A;  3EFO B;  3M54 A;  1Q82 C;  2LC4 A;  5A0D A;  1WJQ A;  5AYF A;  2MMP A;  2QA4 Q;  1KIK A;  2R57 A;  1I4K 1;  3HRT A;  4RTY A;  3CC2 T;  3M5A A;  4M7A A;  4M77 C;  2DXT A;  2CH4 W;  3QG1 A;  1W4S A;  3A1P A;  2LCL A;  3S6W A;  3GF5 A;  4EMK B;  2DFU A;  4ESR A;  5IAY A;  5GAN d;  1WHH A;  1VQO T;  4KGZ B;  1RAH B;  3SWN C;  4OMN A;  2CP2 A;  3CCM T;  3TSZ A;  1NYF A;  4M77 D;  4OB0 B;  3CCS Q;  1JO8 A;  3L2U A;  2J7I A;  2QK0 A;  3PE0 A;  1TXQ A;  1R8O B;  4O6J A;  2COY A;  2CZ0 B;  1QVP A;  1IXD A;  1PKT A;  4M75 B;  2ABL A;  3NMZ C;  4A63 B;  1VQK Q;  2YHT A;  3OYE A;  3CC7 A;  1KFZ A;  4Z02 A;  3NPF A;  3WXM B;  1K9M R;  2YWW A;  3CCU A;  2DA9 A;  1VQ6 Q;  1YI2 A;  3X20 B;  3EG0 A;  4BY6 C;  2L3S A;  4BD3 A;  5HKC A;  2V26 A;  1KJW A;  1TU0 B;  2A36 A;  4J6X A;  1HK9 A;  2LRQ A;  1M3A A;  3QWX X;  4PJO F;  4HCZ A;  3CCJ Q;  2DTI A;  1PWT A;  1FYN A;  2LDM A;  2FG0 A;  3LH5 A;  3E9G A;  1X6B A;  3ZL7 C;  1ABO A;  4GY5 A;  5CKD A;  1NG2 A;  2RK1 A;  3CEY A;  4LE9 A;  2KNB B;  1NLO C;  1OZ2 A;  1QCO A;  2MYS A;  4KT0 E;  4M7A B;  3H0H A;  5LJ5 f;  3URG A;  2GBQ A;  3J81 E;  1OUL A;  2EIF A;  2LTO A;  1RAD B;  5J3B A;  2EGA A;  2LJ3 A;  1NZ9 A;  3V7C A;  4HA8 A;  1YBY A;  1X2Q A;  2X9H A;  3L2Q A;  4KBM B;  4C0D B;  3QPH A;  5FU7 B;  3G6E T;  1OPL A;  2QYZ A;  7AT1 B;  2CUD A;  2DAQ A;  1M1K R;  4C8Q E;  2OAU A;  3I5R A;  3JV3 A;  1K9M C;  2KMT A;  4M78 G;  2QA4 T;  3V7S A;  4HXJ A;  2FPF A;  1I5L A;  5DY9 A;  2FYK A;  2OTL A;  3JCM P;  1XTD A;  1ACM B;  4AMC A;  2VB6 A;  4FIB A;  3A8M B;  5LJ3 g;  4C8Q A;  4F7U E;  2HKN A;  3OYI A;  1PRM C;  3EG9 A;  1SSF A;  1VQ9 A;  2L3R A;  4ORZ A;  3L42 A;  4C0Z A;  5FLX E;  4LD6 A;  4RTU A;  3CCS T;  5KYN A;  4PFO A;  2QDY B;  1VOM A;  2FZC B;  2YUN A;  4F7U A;  5C0M A;  2OTJ Q;  4GLK A;  3M59 A;  4C92 C;  5LJ3 d;  3REB B;  1VQK T;  2E64 A;  4B9W A;  2RPN A;  3JB9 J;  1VQ6 T;  2HDA A;  3FEO A;  2C06 A;  4KUI A;  2RM4 A;  1D3B A;  2JVV A;  1D0Y A;  1WQW A;  4M78 B;  1XJW B;  4C92 D;  3I56 Q;  2EYY A;  3JCM W;  2MAM A;  3UT1 A;  4DOW A;  2DO3 A;  2FZG B;  4N0A C;  3CCQ A;  4C5G A;  5IXF A;  3JCM Q;  1J3T A;  4OVA A;  2P4R A;  4MDW A;  3DLL A;  4EMH A;  2RI2 A;  2QEX T;  4X9C A;  2MPX C;  2IG0 A;  2HKQ B;  1K0S A;  3OYJ A;  5FU6 B;  3TEE A;  3I55 Q;  2M02 A;  4AFS C;  2K79 A;  3MP8 A;  3NTK A;  4OGC A;  1GFD A;  4IUQ A;  1QVF S;  5KCH A;  2FRW A;  5DLQ E;  1UTI A;  1VQ7 Q;  4OMP A;  3EG9 B;  3I35 A;  3CBM A;  1X75 C;  3DLM A;  4RMO A;  4CC4 B;  1BBZ A;  1OPK A;  4IUT A;  1M90 U;  2HL5 C;  1WQ7 A;  3AHU A;  2KRO A;  3O8V A;  2LX7 A;  5LJ5 j;  4J6W A;  3MO8 A;  4FW1 A;  3X24 B;  5HK3 A;  2F2X A;  4A54 A;  5GAN e;  4BI4 A;  5DM7 R;  2X35 A;  1SF9 A;  4LDV A;  2DZC A;  1AZE A;  2LQK A;  3C0C A;  2YUP A;  2DF6 A;  2PZ1 A;  5GAM f;  1VQO A;  3HRU A;  3QYH B;  2WSF E;  2HSP A;  3QXE B;  1JJ2 A;  3PVL A;  2JZ2 A;  1X01 A;  1LPL A;  4HCC A;  4XTX A;  2H3J A;  1ZUY A;  2PVD B;  2RHU A;  4C0F A;  4EMG A;  1WDX A;  3VU3 C;  2JJ9 A;  2RHX A;  2K3B A;  3GOX A;  1GL5 A;  2V1R A;  2OTJ T;  4M77 G;  2E70 A;  1U06 A;  4UC4 A;  1BCM A;  5CK9 A;  1IRX A;  2H3E B;  2PQW A;  3GPL A;  5LL6 S;  2O31 A;  2VWF A;  2RQW A;  1YHQ Q;  2RHI A;  1WIE A;  1H64 1;  3CXC A;  2A28 A;  3CCE A;  3CPW A;  3MJX A;  2LMJ A;  3I56 T;  4KUD K;  3CCR A;  3OW2 A;  4XU3 A;  3JRZ A;  3CME Q;  4R56 A;  2MI6 A;  3JCM c;  1W6X A;  4JUV A;  2JS2 A;  3NTH A;  2DBM A;  4IIO A;  3C95 A;  5CIU A;  2PUK B;  2DL8 A;  3OYB A;  2KI7 A;  4XTU A;  2AIR B;  4LNP A;  1QLY A;  2E10 A;  3REA B;  4D8K A;  4E2F B;  2J6K A;  4PJO C;  2O4X B;  4ZGD B;  4LUE A;  1IHW A;  1M4Z A;  3I55 T;  2YLB A;  2F2V A;  1VYV A;  2F5T X;  3EGX B;  2ATC B;  4M77 B;  1VQ7 T;  2KQW A;  5FRN A;  2VYT A;  2XDD A;  4PJO D;  1VIF A;  2GQV A;  1Y71 A;  2LNV A;  2EGC A;  2W10 A;  1RAA B;  5EG2 A;  2MF2 A;  5IN1 A;  3JB9 I;  4OMM A;  2XIC A;  2L5Q A;  2HBW A;  2VKN A;  1AEY A;  3RR6 A;  2L89 A;  1RAF B;  2DYB A;  4D8D A;  5GAO q;  4BAC A;  3H6Z A;  2K2V A;  1JQQ A;  5IT9 E;  1QCN A;  2A7Y A;  1S72 Q;  1YN8 A;  2LQW A;  4YTL A;  2Z0W A;  3ZBD A;  2NYS A;  2CH4 A;  3G1J A;  2QG9 B;  2D9T A;  1M2O A;  3UAT A;  2K3X A;  1M1G A;  5C6S A;  1GCQ A;  1PKS A;  1LCK A;  1GRI A;  3JCM V;  2MCN A;  5LJ3 e;  1WLP B;  3INZ A;  1U5S A;  1BI0 A;  1OZ3 A;  5GAM j;  2EJG A;  1UFF A;  1QMC A;  2DBK A;  4Q5W A;  1UB4 A;  2CZ7 B;  3EH2 A;  1YJW Q;  4IUV A;  3CCL A;  1KHI A;  1UEB A;  5GMK j;  1O9S A;  3V8J A;  5KYX A;  2M0O A;  2Y4X A;  4JZ3 A;  1YHQ T;  5GAO r;  1W2B S;  3ME9 A;  2DIQ A;  2DXB A;  3CCJ A;  4M7D E;  1XNI A;  2MK5 A;  3H9N A;  2GCX A;  2KR3 A;  4QVD A;  2DEU A;  1D1C A;  4L5G A;  1SSH A;  1ZQ1 A;  3RKW A;  1B3Q A;  4C92 G;  4O5V A;  2DIL A;  1NBE B;  2CS7 A;  4XQ3 A;  1SHG A;  3QBY A;  2A3L A;  4M7D A;  1K73 R;  2JTF A;  5CR2 A;  1T3S A;  2O2O A;  2QXF A;  3PIP A;  1KC8 U;  4PKC C;  2RB6 A;  3VUB A;  2DXC A;  4JRK A;  1RUW A;  1WXB A;  1Q86 C;  3QII A;  2XD0 A;  2QQR A;  4LDU A;  4C5H A;  4FYX B;  3HFO A;  3MEV A;  1PSF A;  3EFO A;  1D1A A;  2GF7 A;  2CT3 A;  5ECA A;  2HAX A;  2ECZ A;  5L8R E;  2RJC A;  3H0F A;  3LH0 A;  4WF2 A;  2FRY A;  3QDR B;  4BDY A;  4J5Y A;  1Q82 R;  4HKE A;  1Y7X A;  2HD0 A;  1TSF A;  1QVG P;  1K8A U;  2CRE A;  2ZPF B;  1PSE A;  4OF1 A;  1S72 T;  1K76 A;  3C12 A;  4NS5 A;  2DNU A;  3OSS C;  1U8R A;  4X34 A;  4BUG A;  3DKM A;  4AFZ C;  1Q7Y U;  4E7L A;  3JB9 H;  3VJP A;  3LGF A;  2ESW A;  3JCM f;  3CD6 A;  2XI9 A;  4KGX B;  1H3Z A;  1QP2 A;  1YNZ A;  4RCC A;  1R0C B;  3OS0 A;  2DVE A;  3HTR A;  2RA2 A;  3HFN A;  1W2B P;  3CBO A;  5I21 A;  3SD4 A;  1YJW T;  2RO0 A;  1ZLM A;  1Y96 A;  5GAN f;  3M55 A;  1NJI U;  4QVZ A;  2LCS A;  3M58 A;  3MP1 A;  1QCF A;  5GAN 6;  3DB4 A;  2RF0 A;  1BI1 A;  4CI0 C;  3FC3 A;  3BFM A;  2ZPG B;  5A2Q E;  1QKW A;  1Y57 A;  1M27 C;  2KK4 A;  3M0U A;  4XTW A;  1YFN A;  3VS3 A;  1OEB A;  3L2Z A;  2M9U A;  1ZUK A;  1BK2 A;  1RAC B;  4M75 F;  3BDU A;  9ATC B;  4NOY A;  3FIF A;  2EYQ A;  1AZG B;  4XTY A;  3ULR B;  2KVQ G;  1VQ7 A;  2GNC A;  2GTO A;  3T9N A;  1NEG A;  2AKL A;  2AT1 B;  1I81 A;  2I2L A;  3RIR A;  5I22 A;  2GFU A;  1MMG A;  2CP5 A;  1MMN A;  1X69 A;  3CCV Q;  3NHN A;  3OYK A;  1G8X A;  4PJO G;  4JLI A;  3JCM X;  4DBH A;  4HCB A;  1VQP A;  1OU8 A;  3QZ5 B;  3V8K A;  1YP5 A;  4QT7 A;  2ED0 A;  3M0R A;  1Y96 B;  4J9G A;  2ZAE A;  1LVK A;  4PJM A;  4M7A F;  2A37 A;  2LT1 A;  3FRN A;  2OX7 A;  2JTM A;  2X4W A;  3TU4 K;  4RG2 A;  1E6G A;  4M78 E;  4XK8 E;  1AWJ A;  2JM8 A;  2BZX A;  2D8J A;  2QEX Q;  2M0Y A;  3IQL A;  2VUB A;  5IHK A;  3J7A F;  2BUD A;  2K7A A;  2NLU A;  5KH6 A;  4JJC A;  2FZK B;  4J9B A;  1Q81 U;  2O9S A;  1TH7 A;  3RUX A;  4M78 A;  3P8B B;  3UA7 A;  2XU8 A;  1YHQ A;  1BI2 A;  3SHW A;  3FB9 A;  1PG5 B;  2EW3 A;  4FT2 A;  3P8H A;  4J7I A;  5IH2 A;  1YWO A;  4E7J A;  3CME A;  3G4S Q;  1GXI E;  3M0P A;  1SHF A;  2K57 A;  4ANJ A;  1BCO A;  3M0Q A;  1X6G A;  1BI3 A;  1I0C A;  4ZNX A;  2ZPB B;  4EPC A;  1R0B G;  4XU0 A;  1N27 A;  5DLO A;  5LJ3 f;  5GAN j;  1RI9 A;  4FYY B;  2M16 A;  3GIB A;  1Y07 A;  5GAN 7;  2MOX A;  5CCA A;  2HL3 A;  5CKB A;  1WHG A;  1UUE A;  4ZN1 A;  1C0M A;  1WGS A;  3EAE A;  2CYZ B;  2DYI A;  2D0N A;  3OSV A;  1VQ8 T;  1NYG A;  1PHT A;  4R0K A;  3JSC A;  3E1S A;  4J83 A;  2E1H A;  4BB7 A;  4EDU A;  1YJN Q;  3CMA Q;  2KE9 A;  3OS2 A;  1SKU B;  3CCV T;  5KE2 A;  8ATC B;  5GAO n;  5I2M A;  3L2V A;  1C6V X;  3R6O A;  4J9E A;  2KRN A;  5KYY A;  1ZSZ C;  2XKO C;  4AG1 C;  4OP0 A;  4RKU E;  2EBP A;  2L0A A;  2A0F B;  3GNF B;  1WNL A;  3EGU A;  3PVQ A;  1VQL Q;  2KYB A;  3QUI A;  2IVW A;  1RAI B;  4C8Q F;  2HMA A;  1WHL A;  3AT1 B;  2XID A;  3QKJ A;  2DTH A;  2FEI A;  2HBP A;  1M90 C;  4F04 B;  1VA7 A;  2G3R A;  2DJZ A;  4LDX A;  2R58 A;  2WAC A;  5GAO m;  4JDS A;  2RQT A;  1V76 A;  2J05 A;  5GAN 5;  2E5Q A;  1VQN A;  4M7D C;  3JCM e;  4F7U F;  2YRD A;  1G2B A;  2FHD A;  4LD9 K;  2LQN A;  2KEA A;  2CDT A;  3QHS A;  5GAN 2;  5KCO A;  2R5A A;  3M0S A;  1M1K U;  5GAN 4;  2YLC A;  3G4S T;  3UPU A;  3KXT A;  4M77 E;  4M7D D;  1OX8 A;  4V2S A;  2IPO B;  2FPD A;  2P0Q A;  4PJN A;  1YCS B;  1N8R U;  2EAY A;  3CC2 A;  5FW9 A;  5GJW B;  2DX1 A;  2O4X A;  2QQ9 A;  1KG1 A;  4DBQ A;  1SRM A;  4DA4 A;  3M53 A;  4DBF A;  5KYY B;  3EG3 A;  1OV3 A;  3VS6 A;  3EGX A;  1NLP C;  1WHJ A;  4EMK C;  4M77 A;  3CCM A;  5CKE A;  2RHZ A;  3BE3 A;  3CPF A;  4TVR A;  3MKD A;  3OYY A;  3CCU Q;  1B7T A;  1Z9Z A;  5LJ5 h;  2DE0 X;  3SWN A;  3QJY A;  4L59 A;  2XG8 D;  5A0G A;  5KYW A;  5LJ3 j;  5GAM g;  2EQM A;  4ZGE B;  1QP3 A;  1U1T A;  4M75 C;  1YJN T;  3CMA T;  1IZ6 A;  2YRV A;  2O01 E;  3ZFJ A;  4ELZ C;  1N9R A;  2D8H A;  3QJ6 A;  4QKU A;  4ATO A;  5L23 A;  5CAI A;  3OBY A;  4M75 D;  5GAO l;  2QDL A;  2DZ9 A;  2K5F A;  2C0T A;  1VYU A;  1RI0 A;  1JJ2 S;  1VQL T;  1IO6 A;  4CC2 A;  1NPR A;  3UDC A;  4OB1 B;  4OB3 B;  8AT1 B;  2NUZ A;  3MEW A;  1M5Q 1;  2LNH B;  5CKH A;  3OYD A;  4QVC A;  1MMA A;  3FLG A;  3EG2 A;  1QVF P;  1RLQ C;  1G5V A;  4JPB W;  3R6N A;  2E6N A;  2H8H A;  5J26 A;  4J6Y A;  3VS5 A;  4XTV A;  4EIK A;  2DVJ A;  3LW5 E;  2VXE A;  3CC4 T;  4M7A C;  2CZ6 B;  1RLP C;  2ZCF B;  4X1V A;  4Z89 A;  2ED1 A;  3JB9 F;  3PT9 A;  4P5N A;  2X4Y A;  3G6E A;  2OTL Q;  1GFC A;  2LQ8 A;  4PL6 A;  2XK0 A;  5FU7 C;  2EVR A;  3OW2 S;  1WA7 A;  4M7A D;  1K0X A;  2K3Y A;  3SWN B;  1WXU A;  1KC8 R;  2PUO B;  2QA4 A;  1AWO A;  1ARK A;  2EYW A;  1QVG A;  4HVW A;  3LGL A;  6AT1 B;  1QWF A;  3PMI A;  1G3W A;  5KYW B;  4RTX A;  5GMK m;  1OOT A;  4QQD A;  3PNW C;  3VRZ A;  3SB2 A;  1FMK A;  2DPP B;  1ZBX A;  4LDW A;  2CP6 A;  4C0G A;  1MND A;  3OQ5 A;  1MV0 B;  1Q86 R;  2C0O A;  3N5B B;  5CO7 A;  2FL7 A;  1OYX A;  3CCS A;  1D09 B;  2GFA A;  3KFV A;  1WZO A;  4BY6 B;  3CCU T;  2JN0 A;  5CQY A;  4C92 E;  3A98 A;  3TCJ A;  2W0Z A;  1NPP A;  4LXC A;  3FDR A;  2VAS A;  3CCV A;  1VQK A;  2JW4 A;  1X6O A;  2X51 A;  1A0N B;  2QGF B;  3CCQ Q;  4KRT A;  1VQ6 A;  1CKA A;  1K1Z A;  3BY7 A;  2EFI A;  4C92 A;  3OYL A;  2O88 A;  3ZEH A;  2FVU A;  1VYT A;  4M78 C;  2QAS A;  1KC8 C;  1SRL A;  3OY9 A;  5I11 A;  2CP7 A;  5GAM h;  4AFU C;  3ER0 A;  2EQU A;  4BDZ A;  2VVK A;  4PK4 A;  2QEX A;  4M78 D;  1TUC A;  4OML A;  5GMK h;  1NJI R;  4N0A A;  1ZA1 B;  4N4I A;  4GBQ A;  2QAZ A;  4AG2 C;  5FU6 C;  4E7H A;  3JCM J;  1YJ9 Q;  3TVT A;  2FPE A;  2COZ A;  2L3Q A;  2QI2 A;  5GMK l;  1K8A C;  1WHM A;  2JNG A;  3OBW A;  1UJY A;  2E12 A;  2OAW A;  2RJE A;  4C8Q C;  3VYH B;  1V1C A;  2L2P A;  5I2S A;  3H8Z A;  2OTL T;  1X27 A;  3OS1 A;  4RTZ A;  3HSB A;  1I8F A;  1TG0 A;  1JU5 C;  1WI7 A;  1PM3 A;  2OI3 A;  2CUB A;  4BE1 A;  1Q7Y C;  4FM4 B;  2E4H A;  2LJ1 A;  3CQT A;  3GBQ A;  1IHV A;  3OYG A;  2COW A;  1ABQ A;  1O75 A;  4C8Q D;  3S3M A;  1VQ9 T;  3THK A;  3PIO A;  3OS5 A;  1EFN A;  1MNE A;  2EJ9 A;  2PU9 B;  2K9G A;  2IIM A;  4CC7 A;  4M7D G;  1YIJ Q;  2D1X A;  1JRI A;  3HP9 A;  4C92 B;  3RDV A;  1GBR A;  3VS7 A;  4HT8 A;  2YDL A;  2V1Q A;  3MP6 A;  1ZSZ B;  2J6F A;  4M7D F;  1UHF A;  1ZA2 B;  1NJI C;  3EGD A;  5M9O A;  2B86 A;  1VQ4 Q;  1NM7 A;  4A53 A;  2DD5 A;  3EH1 A;  3CCE Q;  2OTJ A;  2PVO B;  2RQU A;  1KD1 U;  4DOV A;  2GTJ A;  3H41 A;  3CCR Q;  2GGR A;  1UGQ B;  3M9Q A;  1I5O B;  5HK0 A;  2RK2 A;  1Q95 G;  1FXX A;  3CCQ T;  3PMT A;  1RL2 A;  1M3C A;  1G3S A;  3RMS A;  1FMW A;  3PFS A;  3C4S A;  3I56 A;  4F14 A;  3PTA A;  3LLR A;  1VQL A;  2X4J A;  2MWO A;  3C94 A;  2QQS A;  1NE8 A;  1PD0 A;  2FO0 A;  2KYM A;  3VS1 A;  3OA6 A;  2CP3 A;  3VS0 A;  1N5Z A;  2KT1 A;  4C5I A;  4JRP A;  2ZPH B;  2HQH A;  1UHC A;  2MWP A;  4PJO E;  4M75 G;  4FCY A;  2PTK A;  2MIO A;  2DET A;  2X3X D;  1BKB A;  1B34 A;  2ZGW A;  3M0T A;  3OYC A;  4A4K A;  1HJD A;  1P92 A;  1K73 U;  1WPY A;  3I55 A;  4ZGJ B;  5A0L A;  2BE9 B;  1D0X A;  2QQB A;  1WFW A;  4BE0 A;  1ZUU A;  1YJ9 T;  1HSQ A;  1I07 A;  2JS0 A;  5GAO p;  1MV3 A;  1IGU A;  2J06 A;  4E7Z A;  4PJO A;  4LDY A;  2EQI A;  1H3H A;  5GAN 3;  1KQS S;  2E5K A;  1SEM A;  1VQ8 Q;  1M30 A;  2E3I A;  3MHX A;  4LN2 A;  2CKK A;  2DK3 A;  3EGD B;  2DIG A;  4RCB A;  2VGN A;  1Q82 U;  1VQ5 Q;  1UGS B;  2J6O A;  2YUQ A;  2KRS A;  5CKF A;  4M4Z A;  3JAM E;  1OQK A;  1G3Y A;  4M7A G;  4JJD A;  2ZZD A;  3FJ5 A;  4Z88 A;  2DTO A;  2L3P A;  4RTV A;  1UGV A;  4A4E A;  2RH2 A;  2FB7 A;  1W70 A;  2NUP A;  4B9X A;  1XQH A;  2P84 A;  1Q81 C;  1PC0 A;  1YIT Q;  1YIJ T;  4HVU A;  3JB9 D;  4PFZ A;  4JJN K;  2NUT A;  3KBG A;  2HNI A;  4JS5 A;  3RMQ A;  1RAE B;  3CCL Q;  4DEX A;  2RI5 A;  2DXU A;  1BB9 A;  2KY9 A;  1VQ4 T;  2JMC A;  2PNI A;  4A4F A;  1IRE B;  3G71 Q;  2BZ8 A;  3A8L B;  3CCE T;  5D7U A;  4OMQ A;  3CCR T;  2K5I A;  2EGE A;  1B34 B;  2HSE B;  3D7S B;  3M56 A;  4J8O A;  3M4G A;  3QO3 A;  1W1F A;  3A8G B;  3RES A;  3MPU B;  3EG1 A;  2XMF A;  3F70 A;  2D0Q B;  2BKD N;  2VXF A;  4FYV B;  4PJO B;  4OGE A;  2CP0 A;  4MZP A;  1I1J A;  1NEB A;  2ENM A;  2P0P A;  1HXD A;  5LJ5 g;  2HQX A;  1VQM Q;  1UG1 A;  1FWZ A;  2DL3 A;  2QQA A;  1HD3 A;  4DQ2 A;  4MZM A;  3LWH A;  2ZPI B;  3RKY A;  4BI3 A;  1QWE A;  4N4G A;  3MEU A;  4RG8 A;  3VS4 A;  3OMG A;  4E47 A;  3OYF A;  1KSW A;  3JCM h;  3MCA B;  2XDP A;  1M90 R;  1KQS P;  1G83 A;  3V7R A;  3OYH A;  1M1F A;  1JEG A;  2AZS A;  3CBP A;  2DLP A;  1X2K A;  2ROT A;  2NUP B;  3QYG B;  1N8R R;  4OB2 B;  2C0I A;  1OX9 A;  2NUT B;  2JUF A;  5LJ5 d;  2LT4 A;  2WSE E;  1M3B A;  5KYU A;  4ZTJ A;  1YCY A;  4M78 F;  3X26 B;  1YWP A;  1GCQ C;  5IHN A;  5GAN h;  4MML A;  1BU1 A;  3P8D A;  2VV5 A;  2F1L A;  2JM9 A;  1MUZ A;  3E9F A;  4AFQ C;  2LVM A;  1VQ5 T;  1K9M U;  1R77 A;  2V8J A;  1M9S A;  3HKS A;  3GLX A;  4GLM A;  4IKF A;  2YXY A;  3CD6 Q;  1WHK A;  4WCI A;  3J80 E;  1S72 A;  2KBT A;  3SFM A;  1U3O A;  3A8O B;  4JS4 A;  3VUZ A;  4C8Q G;  2JXB A;  3GP8 A;  1YIT T;  4OMO A;  4NL2 A;  2EYZ A;  2O9V A;  3I9Q A;  4HVV A;  1UDL A;  4KUL A;  3NFC A;  3L2R A;  3BDL A;  3V8L A;  3CCL T;  2EWN A;  1QVF A;  1E6H A;  1JXM A;  1TTH B;  2A08 A;  1M1K C;  3LYI A;  1M8V A;  1UGP B;  4F7U G;  2P0K A;  1S1N A;  4KH1 B;  2EPD A;  3G71 T;  3TRE A;  3CCJ T;  3CC4 Q;  1YJW A;  1N8R C;  2DRM A;  4KGV B;  2X3W D;  4FT4 A;  1VUB A;  4XTZ A;  3L2W A;  3L1A A;  2DKG A;  4II1 A;  4JJB A;  4XU2 A;  1SG5 A;  2L8D A;  4J7F A;  1KQ2 A;  3HHT B;  1ZX6 A;  2I0N A;  2F5K A;  5KYU B;  4FSS A;  2M51 A;  4F17 A;  4ELY C;  1WX6 A;  2QGG A;  5GMK i;  4L6V 5;  5D6X A;  4C8Q B;  1VQM T;  1H8K A;  2CSQ A;  3UA6 A;  2E65 A;  5GJV B;  1RAB B;  1K8A R;  5HCK A;  1GCP A;  4JRI A;  2NWM A;  1YJ9 A;  2RJF A;  2LP5 A;  2KT8 A;  4DBR A;  3CC7 Q;  2B8A A;  2YSQ A;  4F7U B;  2Y4Y A;  4JLG A;  3M4Y A;  1BYM A;  3RNJ A;  1MMD A;  2BIV A;  1DJ7 B;  2EJF A;  1YI2 Q;  1TWB A;  2DD4 A;  1VQP Q;  2KDS A;  4ME7 A;  2HZY A;  2LCC A;  4MDX A;  2EKO A;  2PVG B;  1ZHI A;  1KHC A;  3VS2 A;  1D3B B;  1PRL C;  4ZN3 A;  1CKB A;  5D6W A;  4CRI A;  1SPK A;  2KAF A;  1MHN A;  1B07 A;  1UEC A;  3CD6 T;  2RHY A;  4IUR A;  1GBQ A;  1M2V A;  1YIJ A;  4BE2 A;  2CZ1 B;  3E2U A;  1Y0M A;  4N4H A;  5LJ3 h;  1KK7 A;  2GQI A;  1UE9 A;  1WXT A;  1ZBJ A;  5GAM d;  5FWC A;  2KXD A;  2HEQ A;  1AWX A;  4PJL A;  2CT4 A;  2DRK A;  1VQ4 A;  1F1B B;  2V8I A;  4M77 F;  3JB9 G;  5IXB A;  3H0I A;  3EHQ A;  4QQG A;  3A8H B;  1XOV A;  4IUU A;  5CQX A;  2E41 A;  1KQ1 A;  2LX9 A;  3VRY A;  5KE3 A;  3VKI A;  3UF4 A;  1TUG B;  1AD5 A;  3OMC A;  2RJD A;  4FL6 A;  1JB0 E;  4VUB A;  2VC8 A;  4K11 A;  2KGT A;  2K6D A;  4J9F A;  5IHI A;  3CXC S;  2ROL A;  1ZSG A;  3CPW S;  4C0D C;  2EKH A;  3M57 A;  2RI3 A;  1D0Z A;  1C1A A;  1AOJ A;  3QZ9 B;  3ASK A;  3LX7 A;  1PCX A;  4WTO B;  1IB8 A;  1VQ9 Q;  4IUP A;  4OMF B;  3QSU A;  3QDF A;  1LJO A;  2RN8 A;  1U1S A;  3U23 A;  2RD1 A;  4Y28 E;  2R5M A;  3BW1 A;  2AHJ B;  4RTW A;  3TSW A;  2OJ2 A;  2CSI A;  5LJ5 e;  1EX4 A;  3SDZ A;  2YRC A;  4RTT A;  1PD1 A;  2M1H A;  1QKX A;  2P4T A;  2RNA A;  4QW2 A;  2EYX A;  3A5Z B;  1M2V B;  2V8K A;  4PFP A;  3CC7 T;  2ZPE B;  2KRM A;  4RUG A;  5J39 A;  1YI2 T;  1VQ8 A;  1VQP T;  3O5Z A;  5HY6 A;  3NGP A;  4PLL A;  2JTE A;  1W2B A;  2JT4 A;  2AKK A;  2JMA A;  1TUD A;  1IGQ A;  3RBB B;  3HL8 A;  2DJQ A;  1QVG S;  2XDB A;  1FX7 A;  1VQ5 A;  2K4Y A;  4FW2 A;  1HYO A;  1Q7Y R;  5CVI A;  2K5L A;  4XAX B;  1JJ2 P;  1LOJ A;  4CC3 A;  2DM1 A;  3VYG A;  4MMK A;  1TOV A;  1BIB A;  2QTV A;  1YIT A;  4BI8 B;  4FSX A;  1KD1 R;  1UGR B;  1MGQ A;  1ZSZ A;  4HCK A;  4XU1 A;  3G7Z A;  4E7K A;  3QWY A;  2WSC E;  4PJJ A;  2VGM A;  2DL5 A;  4C5E A;  3HRS A;  5FWB A;  2AZV A;  1G3T A;  4Y91 A;  1VQN Q;  3SEM A;  3OYN A;  1T0H A;  1AVZ C;  4B6M A;  1AHJ B;  3JCM b;  5EC7 A;  4Z8A A;  1K9A A;  3G71 A;  1X43 A;  2KXC A;  1E7O A;  2F2W A;  3CXC P;  3CME T;  1WYX A;  1VIE A;  3CPW P;  3S3N A;  3DB3 A;  3OW2 P;  3EFS A;  2DL4 A;  4MZT A;  4PLI A;  3CC2 Q;  3E19 A;  3FJP A;  2E6Z A;  3HPW A;  1T3L A;  3S3O A;  3I5S A;  1RAG B;  1FMV A;  3UWN A;  5GAN 8;  3G4S A;  1VQO Q;  2EQK A;  4C92 F;  1T0J A;  4ZTF A;  2BTT A;  2LZ6 B;  1VQM A;  3CCM Q;  4R55 A;  3X28 B;  5FRM A;  2DL7 A;  2RQR A;  3OYA A;  2YUO A;  3KUF A;  4JZ4 A;  4QQ6 A;  2KSS A;  4NL3 A;  4FU6 A;  1EZZ B;  3RKX A;  1JBM A;  1AWW A;  2SRC A;  1KD1 C;  3PGG A;  2HQE A;  2HCK A;  1PNJ A;  1BIA A;  2E3H A;  4A4H A;  2QTX A;  4HT9 A;  1WJR A;  4FYW B;  3OYM A;  1QW1 A;  5AT1 B;  1Q86 U;  3RER A;  2DEQ A;  1OI1 A;  4EMK A;  2DMO A;  4M75 E;  2EQJ A;  3WVD B;  3EHR A;  3Q1J A;  3OB9 A;  1AT1 B;  4A4G A;  5KYX B;  2Y90 A;  2LJ0 A;  1YJN A;  3CMA A;  3EFR A;  4F16 A;  3VV0 A;  2BZY A;  1N6A A;  2G6F X;  2F69 A;  2X4X A;  1OU9 A;  4J9H A;  1D1B A;  4D6W A;  3NTI A;  1Z9Q A;  4X9D A;  2JOY A;  1CSK A;  3WVE B;  3MET A;  4M75 A;  4IIM A;  2XHC A;  2AK5 A;  4DEY A;  1QQJ A;  1UJ0 A;  2D6F A;  3JCM g;  1M8M A;  5GAM e;  1K73 C;  4Y92 A;  4J9D A;  1JXO A;  1WJS A;  3MEA A;  4JRQ A;  4E6R A;  2RQV A;  5GMK e;  1LNX A;  5D6Y A;  4E7S A;  1V29 B;  1Q81 R;  3TQ7 P;  2CGH A;  4LUD A;  4PNO A;  1TS9 A;  2RMO A;  1EIF A;  4M7D B;  2K2M A;  1H92 A;  3LWI A;  2YT6 A;  1VQN T;  4J9C A;  4KH0 B;  2DER A;  3G6E Q;  4M7A E;  3X25 B;  4E7I A;  1K4U S;  5GAN g;  2SEM A;  4J9I A;  1KQS A;  3GNG A;  2BE7 D; 
#chains in the Genus database with same CATH homology
 2C0I A;  4JZ3 A;  1M3B A;  1KIK A;  4RTY A;  1YWP A;  1GCQ C;  5IHN A;  2D8H A;  1BU1 A;  2JM9 A;  2KR3 A;  5L23 A;  1MUZ A;  2CH4 W;  4AFQ C;  2QDL A;  1SSH A;  1B3Q A;  2C0T A;  4ESR A;  1VYU A;  4GLM A;  2DIL A;  1IO6 A;  4OMN A;  4CC2 A;  1SHG A;  4WCI A;  2KBT A;  1U3O A;  3TSZ A;  1NYF A;  2JXB A;  2NUZ A;  1T3S A;  2LNH B;  2O2O A;  1JO8 A;  4OMO A;  3EG2 A;  2J7I A;  2EYZ A;  1RUW A;  1WXB A;  3PE0 A;  1RLQ C;  2O9V A;  3I9Q A;  4HVV A;  1UDL A;  4JPB W;  3R6N A;  2H8H A;  1E6H A;  1JXM A;  1PKT A;  3VS5 A;  4EIK A;  2ABL A;  2DVJ A;  3NMZ C;  4A63 B;  1KFZ A;  1RLP C;  2CT3 A;  2A08 A;  4X1V A;  5ECA A;  4Z89 A;  2ECZ A;  2ED1 A;  3NPF A;  1S1N A;  2DA9 A;  2EPD A;  3H0F A;  3EG0 A;  2FRY A;  2L3S A;  1GFC A;  1KJW A;  2DRM A;  2A36 A;  2X3W D;  2EVR A;  1WA7 A;  1M3A A;  3QWX X;  1K0X A;  2CRE A;  1WXU A;  1PWT A;  1AWO A;  1FYN A;  2EYW A;  1ARK A;  4HVW A;  4JJB A;  1QWF A;  1K76 A;  2FG0 A;  2DNU A;  4RTX A;  1ZX6 A;  2I0N A;  3LH5 A;  1OOT A;  4FSS A;  2M51 A;  4F17 A;  4AFZ C;  1WX6 A;  1X6B A;  3ZL7 C;  1ABO A;  3VRZ A;  1NG2 A;  1FMK A;  1H8K A;  2CSQ A;  3UA6 A;  4LE9 A;  2KNB B;  1NLO C;  2ESW A;  3H0H A;  5GJV B;  2GBQ A;  1YNZ A;  5HCK A;  1MV0 B;  1GCP A;  2C0O A;  2EGA A;  2LJ3 A;  3KFV A;  2NWM A;  1X2Q A;  2LP5 A;  2KT8 A;  3A98 A;  2W0Z A;  2YSQ A;  1OPL A;  2CUD A;  1ZLM A;  3RNJ A;  2JW4 A;  3I5R A;  3JV3 A;  2LCS A;  1A0N B;  1QCF A;  4KRT A;  4HXJ A;  1CKA A;  2RF0 A;  1K1Z A;  2FPF A;  3VS2 A;  1PRL C;  1CKB A;  2O88 A;  1VYT A;  1QKW A;  1SPK A;  1M27 C;  1Y57 A;  3M0U A;  1SRL A;  1PRM C;  5I11 A;  1B07 A;  1UEC A;  3VS3 A;  1OEB A;  1GBQ A;  4ORZ A;  4AFU C;  1ZUK A;  1BK2 A;  4RTU A;  2VVK A;  1TUC A;  4OML A;  1Y0M A;  2GQI A;  1UE9 A;  4GBQ A;  1AZG B;  1WXT A;  1ZBJ A;  3ULR B;  2YUN A;  5FWC A;  2GNC A;  2GTO A;  2KXD A;  1NEG A;  2AKL A;  4AG2 C;  2HEQ A;  1AWX A;  2CT4 A;  2DRK A;  3TVT A;  2FPE A;  3REB B;  5IXB A;  3H0I A;  2L3Q A;  3EHQ A;  2RPN A;  5I22 A;  1XOV A;  1UJY A;  2OAW A;  1X69 A;  2HDA A;  1V1C A;  2L2P A;  3VRY A;  1X27 A;  4RTZ A;  3UF4 A;  3NHN A;  1TG0 A;  1AD5 A;  2EYY A;  1JU5 C;  1WI7 A;  2OI3 A;  2CUB A;  5IHI A;  2KGT A;  4J9F A;  2K6D A;  2LJ1 A;  1YP5 A;  3CQT A;  4K11 A;  2ROL A;  3GBQ A;  1ZSG A;  1ABQ A;  4QT7 A;  2EKH A;  2ED0 A;  5IXF A;  3M0R A;  1J3T A;  3THK A;  4J9G A;  1EFN A;  1AOJ A;  2P4R A;  2K9G A;  2A37 A;  2IIM A;  4CC7 A;  1E6G A;  1K0S A;  1AWJ A;  2D1X A;  2JM8 A;  2BZX A;  2RN8 A;  3VS7 A;  1GBR A;  2D8J A;  4AFS C;  2K79 A;  2M0Y A;  3U23 A;  1GFD A;  3IQL A;  5IHK A;  2FRW A;  2YDL A;  2K7A A;  2V1Q A;  2J6F A;  1UHF A;  1UTI A;  4RTW A;  2OJ2 A;  3TSW A;  2CSI A;  4OMP A;  4JJC A;  3I35 A;  4RTT A;  4J9B A;  1QKX A;  2RNA A;  2O9S A;  2B86 A;  2EYX A;  1NM7 A;  4CC4 B;  1BBZ A;  1OPK A;  2KRM A;  3UA7 A;  2RQU A;  4RUG A;  2GTJ A;  3H41 A;  2GGR A;  3SHW A;  3O5Z A;  2KRO A;  3NGP A;  2LX7 A;  2EW3 A;  5IH2 A;  2JTE A;  1YWO A;  2JT4 A;  2AKK A;  2F2X A;  2JMA A;  1M3C A;  1TUD A;  3RBB B;  2DJQ A;  3M0P A;  1SHF A;  1AZE A;  3C0C A;  3M0Q A;  1X6G A;  2YUP A;  2DF6 A;  4F14 A;  2PZ1 A;  1I0C A;  4CC3 A;  4ZNX A;  2FO0 A;  2KYM A;  3VS1 A;  2HSP A;  2DM1 A;  3VS0 A;  1N5Z A;  2KT1 A;  1RI9 A;  3PVL A;  1UHC A;  4HCK A;  1ZUY A;  3QWY A;  2PTK A;  2MIO A;  2X3X D;  1WDX A;  2DL5 A;  2MOX A;  3M0T A;  5FWB A;  2K3B A;  2AZV A;  1HJD A;  3SEM A;  1GL5 A;  2V1R A;  1T0H A;  1AVZ C;  1UUE A;  1U06 A;  1WFW A;  1ZUU A;  5EC7 A;  2D0N A;  4Z8A A;  1K9A A;  1HSQ A;  1NYG A;  1PHT A;  1I07 A;  2JS0 A;  4R0K A;  1MV3 A;  2J06 A;  1X43 A;  2KXC A;  2EQI A;  1E7O A;  2O31 A;  2F2W A;  2VWF A;  1H3H A;  2RQW A;  2KE9 A;  1WYX A;  2E5K A;  1SEM A;  1M30 A;  1WIE A;  2A28 A;  4LN2 A;  4J9E A;  2DL4 A;  2KRN A;  2LMJ A;  4AG1 C;  1W6X A;  2EBP A;  2J6O A;  2YUQ A;  2L0A A;  1T3L A;  2KRS A;  3I5S A;  4M4Z A;  2JS2 A;  2DBM A;  3EGU A;  4IIO A;  3PVQ A;  2KYB A;  4JJD A;  1T0J A;  3FJ5 A;  2BTT A;  2LZ6 B;  2DL8 A;  4Z88 A;  2L3P A;  4RTV A;  1UGV A;  2DL7 A;  2RQR A;  1W70 A;  1QLY A;  4LNP A;  3REA B;  4D8K A;  2J6K A;  2YUO A;  4HVU A;  4JZ4 A;  4LUE A;  1AWW A;  2SRC A;  2FEI A;  2F2V A;  1VYV A;  2HCK A;  1VA7 A;  4DEX A;  1PNJ A;  1BB9 A;  2RQT A;  2J05 A;  2JMC A;  2PNI A;  2EGC A;  2BZ8 A;  2W10 A;  1G2B A;  2DMO A;  4OMQ A;  4OMM A;  2EGE A;  2LQN A;  2KEA A;  3EHR A;  2CDT A;  2HBW A;  2VKN A;  1AEY A;  1W1F A;  3M0S A;  2DYB A;  2LJ0 A;  3EG1 A;  2XMF A;  4D8D A;  4F16 A;  1JQQ A;  2BZY A;  2G6F X;  2FPD A;  4J9H A;  1YN8 A;  2LQW A;  1YCS B;  1Z9Q A;  5FW9 A;  1CSK A;  5GJW B;  1I1J A;  4IIM A;  2DX1 A;  2AK5 A;  2CH4 A;  1NEB A;  3UAT A;  4DEY A;  1UJ0 A;  2ENM A;  1M8M A;  1SRM A;  4Y92 A;  4J9D A;  1JXO A;  1UG1 A;  3EG3 A;  1OV3 A;  3VS6 A;  1GCQ A;  2DL3 A;  1HD3 A;  1LCK A;  1PKS A;  1NLP C;  4E6R A;  2RQV A;  1GRI A;  2MCN A;  1WLP B;  1QWE A;  4LUD A;  2RMO A;  2K2M A;  1H92 A;  3VS4 A;  2YT6 A;  1KSW A;  1U5S A;  4J9C A;  1Z9Z A;  1G83 A;  1UFF A;  2DE0 X;  2DBK A;  1JEG A;  2AZS A;  1K4U S;  2DLP A;  1X2K A;  2SEM A;  4J9I A;  2ROT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...