1T0JA

Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
b'RREAERQAQAQLEKAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords voltage-gated calcium channel subunit beta2a
publication title Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 23
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12052 VGCC_beta4Aa_N Voltage gated calcium channel subunit beta domain 4Aa N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1t0jA00
2ABLA 2PNIA 2YT6A 4J9EA 2YUPA 1BU1A 2HDAA 1UECA 2DILA 1VYVA 2LP5A 1K4US 4JZ3A 4K11A 1M8MA 1K1ZA 3UF4A 4RTVA 2V1RA 3VS0A 1GCQA 4AFZC 2DL8A 4J9FA 1JO8A 1A0NB 5I22A 2EYZA 1WXTA 2VWFA 1U5SA 2CH4W 4JJCA 1PWTA 2LNHB 2X3WD 2DLPA 2VVKA 4F17A 1AOJA 1Z9QA 2FRYA 2CUBA 1TUCA 2F2XA 5HCKA 4Z8AA 4LUDA 2J7IA 3IQLA 2O2OA 2RPNA 2JS0A 1UGVA 3UA6A 2DRKA 2V1QA 2J6FA 2K9GA 2PTKA 2FPDA 4HVUA 2K3BA 4E6RA 2GQIA 1K9AA 3EG3A 3A98A 2LJ1A 1SSHA 2O88A 5GJVB 2JS2A 1ZSGA 2RNAA 1E6HA 4R0KA 1OV3A 2L2PA 1QLYA 3REBB 2FPEA 2PZ1A 1T3SA 1W70A 2J05A 4OMLA 2GNCA 1AWJA 2DF6A 4Y92A 1MUZA 1K76A 2EVRA 2OJ2A 1I1JA 2KRNA 2KE9A 2DA9A 1UE9A 1WLPB 3VS2A 2DJQA 3R6NA 4GBQA 3H0IA 1WFWA 1YN8A 5FW9A 4OMMA 2EYXA 1YCSB 1WA7A 2RQTA 4JZ4A 1OEBA 1UG1A 1GBQA 1M3CA 2KGTA 2KXCA 1UUEA 2DL7A 2DYBA 1X27A 1WDXA 1S1NA 1SRLA 2MOXA 4JJBA 4M4ZA 1RI9A 4LE9A 3ZL7C 2KRMA 2M51A 2LJ0A 1VA7A 4AFQC 2KR3A 3NGPA 2ED0A 4HVWA 4HXJA 3VS5A 1X6BA 5FWCA 4WCIA 3EHQA 3PE0A 1HSQA 1MV0B 2A36A 1QWEA 2OI3A 2RF0A 1G83A 1SEMA 2LZ6B 2MCNA 1PRMC 1RUWA 1W6XA 3VS3A 3ULRB 1QCFA 2JM9A 2EW3A 4AG1C 3NHNA 5I11A 2KYBA 1JU5C 4D8DA 1KSWA 1SHGA 5IHKA 2F2WA 4DEXA 1UDLA 2IIMA 2W10A 5EC7A 1WX6A 2K2MA 2RQRA 2ESWA 2RQVA 4ZNXA 2BTTA 2P4RA 1H8KA 2FEIA 2AK5A 3I35A 2EGCA 2RN8A 3VS4A 1TUDA 1PHTA 3PVLA 4JPBW 1AWXA 1PNJA 2D8JA 5IH2A 3SEMA 5ECAA 4LNPA 2ROLA 2CSQA 4LN2A 3VRYA 2EYWA 2BZYA 1WXBA 3RBBB 1U3OA 2CREA 2J06A 2KYMA 4J9BA 2DBKA 3M0RA 3GBQA 1LCKA 2DVJA 1TG0A 2EBPA 2X3XD 2DNUA 1QKWA 2L3PA 1NLPC 2H8HA 4CC4B 1JXMA 2A28A 1K0XA 2JMCA 1NLOC 1UHCA 2ROTA 1RLPC 2JT4A 2KRSA 4ORZA 1ARKA 1HJDA 2AZVA 5IXBA 3LH5A 1AEYA 2J6KA 1I07A 3EG1A 1UHFA 1YNZA 2KXDA 2SRCA 4RUGA 1X2KA 1X69A 1VYUA 2SEMA 1T0JA 2D8HA 1SRMA 2GTJA 1M27C 1KIKA 4F16A 4RTTA 1X43A 3QWXX 2BZ8A 1UJ0A 2CT3A 2C0TA 4JJDA 1JXOA 3EG2A 2EGAA 3NMZC 1WI7A 4IIOA 1OOTA 1HD3A 4GLMA 3VS1A 4J9IA 2DX1A 1NEBA 1MV3A 2AKKA 2E5KA 1M30A 1GRIA 4A63B 3H0FA 5FWBA 2MIOA 3UATA 1J3TA 3C0CA 3KFVA 2DL5A 1E7OA 3I5SA 2M0YA 4OMQA 3TVTA 2CUDA 3VS6A 1UFFA 2HSPA 3UA7A 1X6GA 2YSQA 3TSWA 4FSSA 2C0IA 2KEAA 1I0CA 1OPKA 2B86A 2DMOA 1YWOA 2D0NA 1WIEA 2J6OA 5L23A 2CSIA 2YUQA 4AFUC 1CSKA 2YUNA 2I0NA 2HEQA 1Z9ZA 1X2QA 2LMJA 2C0OA 4CC2A 4ESRA 1AD5A 1H92A 3CQTA 2EQIA 4OMOA 2JXBA 1NG2A 1ABOA 3I5RA 4Z88A 2EKHA 2K6DA 1V1CA 2KNBB 1AZGB 1EFNA 2JW4A 4HVVA 4OMNA 4CC3A 2LJ3A 2KBTA 3REAB 1QKXA 3O5ZA 1M3AA 2LQWA 3TSZA 1UJYA 3EG0A 2W0ZA 1Y57A 1PKSA 2AZSA 1ZUYA 1AVZC 5IHIA 4J9HA 2ECZA 2QDLA 4DEYA 2O9VA 3I9QA 1AZEA 2FRWA 3M0UA 1YP5A 2YDLA 4J9CA 3U23A 1GCQC 4RTUA 1GL5A 2EGEA 2GBQA 2ENMA 2JTEA 2ED1A 3EHRA 2L3SA 3THKA 1GFCA 1ZX6A 1UTIA 1ZBJA 3VS7A 1PRLC 2L0AA 1ZUKA 3FJ5A 1H3HA 4J9GA 3NPFA 1K0SA 2FPFA 4CC7A 4OMPA 4EIKA 2GGRA 3M0TA 4F14A 3QWYA 1N5ZA 1Y0MA 2CH4A 2K7AA 1IO6A 3VRZA 2O31A 1AWWA 2DL3A 1GBRA 1JQQA 1T0HA 2AKLA 2F2VA 2LQNA 2HBWA 2RMOA 4RTYA 1PKTA 2JM8A 2G6FX 4QT7A 3RNJA 2GTOA 4Z89A 2O9SA 1SPKA 1BK2A 4X1VA 1ZUUA 3M0QA 1RLQC 2CT4A 2CDTA 4LUEA 1SHFA 4AG2C 1VYTA 2VKNA 2FO0A 1ABQA 3M0PA 1NM7A 3M0SA 2RQUA 2XMFA 2KT1A 3JV3A 1CKBA 2EPDA 2LX7A 1WYXA 2YUOA 5IXFA 1BBZA 2BZXA 2K79A 4HCKA 2NUZA 1NEGA 1GCPA 1GFDA 3PVQA 1YWPA 4RTXA 2RQWA 2A37A 2NWMA 1AWOA 2LCSA 1FMKA 1U06A 4J9DA 5GJWB 1W1FA 2DE0X 4IIMA 2KT8A 2L3QA 2A08A 2DL4A 3H0HA 1E6GA 5IHNA 2DM1A 1JEGA 1NYFA 1WXUA 2KROA 3H41A 4RTWA 1ZLMA 2DRMA 1G2BA 1B3QA 3EGUA 4D8KA 1QWFA 4RTZA 1XOVA 4KRTA 1BB9A 2DBMA 1CKAA 1KFZA 2FG0A 2JMAA 1NYGA 1B07A 2HCKA 4AFSC 1OPLA 2EYYA 1T3LA 1KJWA 2OAWA 1FYNA 3SHWA 2D1XA 1M3BA
chains in the Genus database with same CATH superfamily
5KE2A 4KH0B 4F7UB 1EZZB 3RR6A 2A0FB 5GAN7 4K11A 1M8MA 2E6NA 4A4EA 3UF4A 3H6ZA 3VS0A 1TXQA 5GAOq 1JO8A 1A0NB 2FZGB 4FYWB 1JBMA 1OQKA 2EFIA 2DAQA 3R6OA 1U5SA 4FT2A 5A0DA 1TS9A 2CH4W 3OBYA 2LNHB 4HCZA 2DXCA 2VVKA 2QGGA 2P0QA 2F2XA 4Z8AA 4LUDA 7AT1B 2JS0A 3UA6A 2DRKA 2V1QA 1V76A 1WZOA 2PTKA 3G71A 3TREA 2YWWA 2X4XA 1WQ7A 3J80E 1R77A 4IUVA 1QVFP 4C92D 2FVUA 3EGDB 4E7HA 3EG3A 1PG5B 4A4GA 1PC0A 3M55A 4M75E 2RNAA 4R0KA 5CKBA 3RMQA 5GANf 3CCLT 2M02A 4M77E 1M1KU 1VQ9A 5GAN2 1O9SA 3V8KA 2OX7A 1PSFA 2HQHA 3OYKA 3LYIA 4M7AF 4OMLA 2GNCA 1JJ2S 1VQPT 3CBPA 1K9MU 1ZSZC 1I1JA 2KRNA 3RKXA 2DA9A 2M9UA 4C92B 2HQEA 3OYYA 4C8QF 3QJYA 2KK4A 2CP2A 3GLXA 4QVZA 3SWNA 4GBQA 4IUPA 1D1CA 2EYXA 3SDZA 1YCSB 5L8RE 1WA7A 1Q7YR 2RQTA 4JZ4A 2OTLQ 4M75D 1OEBA 1Q81U 2QA4A 3JB9G 1D0XA 1UUEA 5CK9A 2DL7A 2DD4A 4KGXB 1X27A 4PJMA 2MOXA 4M4ZA 4DBFA 4ELYC 1VQMQ 4M7DF 3L2VA 2DO3A 3OMCA 3ZL7C 2KRMA 2EIFA 3I56A 1X6OA 2JTMA 1IGQA 3HP9A 2LX9A 3VS5A 3QKJA 1HSQA 2HQXA 3S6WA 2RH2A 4N0AC 3WXMB 1SEMA 2Y90A 2MYSA 1PRMC 4M7AA 2D0QB 3QZ5B 1QCFA 2JM9A 4ZGJB 3KXTA 1X75C 2HL5C 1SHGA 5IHKA 2NUPA 5GMKh 4C8QA 3L42A 2IIMA 2W10A 2XI9A 5EC7A 3CPWP 2RQRA 5LJ3h 2V26A 4E7SA 2FEIA 3JAME 1K73C 3SFMA 2AK5A 5LJ5g 5FRMA 2RN8A 1LJOA 4JPBW 1PNJA 2CP5A 1IB8A 3QYGB 5CQYA 2BZYA 2RM4A 3MP1A 2JNGA 3L2QA 3CC2T 2RJDA 2X51A 4QVDA 2DNUA 1FXXA 1QKWA 2L3PA 1G5VA 2K5LA 4CC4B 5GMKm 4J8OA 4JUVA 1M1KC 4M7AG 2BUDA 2JT4A 4ORZA 1YJWT 4DBRA 1OZ2A 2YLCA 1HJDA 3LH5A 4XTXA 4FCYA 3JB9I 1M2OA 2SRCA 3OYFA 2WSFE 5GAN5 2DD5A 2D8HA 1M27C 3BDLA 4PJOF 5FU7C 2LCCA 2XDDA 1B34A 1JXOA 3L2UA 4M7AE 1HXDA 3OS2A 5CIUA 1Q81C 2HBPA 4GLMA 4M7DG 3CCLA 4PFOA 1MV3A 4C8QE 5KYYA 1YJWQ 5CCAA 3H0FA 1MNEA 2BE7D 2MIOA 1M90R 2V8JA 2DL5A 1Y96A 3J81E 4KUDK 3VS6A 1UFFA 3TQ7P 2HSPA 3UA7A 1VQPA 2C0IA 2R57A 4DA4A 1WGSA 2AHJB 2QGFB 4NL3A 1OULA 1VUBA 1WIEA 2J6OA 4JS5A 4M77C 2CSIA 2RJCA 2YUNA 1M5Q1 2I0NA 2DZCA 5J26A 2LMJA 4CC2A 2CZ7B 1AD5A 4PLIA 2WSCE 3RMSA 3I5RA 2EKHA 5CKHA 3GOXA 2V8IA 2JW4A 4OMNA 3CMAT 4L59A 1TSFA 2W0ZA 1PKSA 1YFNA 1AVZC 4J9HA 2ECZA 1MMNA 5FRNA 2QDLA 3OS0A 2O9VA 3I9QA 3M5AA 2FRWA 2QDYB 2JUFA 1YP5A 4J9CA 4JLGA 2CZ1B 3ER0A 4YTLA 2PUOB 5FU6B 3HFNA 3JCMW 4BY6C 4RTUA 4KT0E 4IUTA 4BB7A 5GMKe 3A8HB 5FLXE 2MI6A 5CVIA 4DOVA 5CQXA 5LJ3e 4OGCA 1U1SA 1WHKA 1WHMA 8ATCB 4E7JA 2L0AA 2K57A 4J9GA 3NPFA 4J7IA 3FIFA 5I2MA 5LJ5f 4HCBA 3X20B 1UGSB 3QDRB 3OBWA 4L6V5 2DXTA 4PJOG 3OYCA 4C5EA 4RKUE 4RTYA 4B9XA 3OA6A 1WJRA 4F7UF 3RNJA 3P8HA 3VUZA 2O9SA 4JRKA 2YRDA 1RLQC 2CT4A 1SHFA 1VYTA 3CC2A 3MEWA 4Y28E 5GAOm 2FO0A 2CGHA 2CYZB 1NM7A 2ZPFB 3M0SA 1D3BA 5M9OA 1WNLA 5GAMd 1VOMA 2LX7A 2YUOA 2LQKA 2K79A 1YJWA 4DBHA 1IGUA 1TH7A 4HCKA 3VV0A 2VXEA 4C5GA 1AHJB 3CCQT 1GFDA 5A2QE 4RTXA 3HRUA 1FMVA 2A37A 2NWMA 1AWOA 1W2BA 3CCEQ 4IKFA 2VUBA 1WHGA 4FYXB 5GAOr 4IIMA 3LLRA 5KYXB 3S3MA 2DM1A 4BI4A 1NYFA 1WXUA 4N0AA 4RTWA 3EFOA 2WSEE 1ZLMA 4RTZA 2E10A 2DBMA 2RI2A 2XHCA 1OU8A 1NBEB 1XJWB 2XIDA 1D09B 4AFSC 2DTIA 3JCMh 1T3LA 2E64A 3BFMA 2OAWA 2D1XA 4M7AC 4PFPA 4B6MA 4C92F 3SD4A 2YUPA 5GAN3 1UEBA 2I2LA 1W2BP 1OI1A 1VYVA 1M2VB 1K4US 2V1RA 1GCQA 4C8QC 3UPUA 5I22A 3JRZA 5GAMh 3WVDB 1VQ9T 2IG0A 4J6YA 4PJLA 4WF2A 2DLPA 2ZPHB 1RADB 2DERA 2FRYA 5J39A 1TUCA 1Q82C 1WHLA 2J7IA 2O2OA 4EMKC 1TOVA 1D1AA 2K2VA 2J6FA 3CMAA 4JRPA 3G71Q 2FPDA 5GANd 4FL6A 4HVUA 5HY6A 4M7DC 4F7UG 1JB0E 4CI0C 1RAGB 4WTOB 5KCOA 2GQIA 3E1SA 1K9AA 1HYOA 3OYAA 1UB4A 4KUIA 5DLOA 2JS2A 3QDFA 1E6HA 4QQDA 3LX7A 1VQ9Q 4AT1B 1FX7A 3OYHA 1BKBA 2LQ8A 1VQKT 2KAFA 4PFZA 2XDPA 2FPEA 2MPXC 2L5QA 4O6JA 2PZ1A 1T3SA 1W2BS 2D6FA 2M1HA 4LD6A 2EWNA 1KC8U 2L3RA 1I81A 5GAN4 4QVCA 3I56T 4Y92A 5HK0A 1VQ7T 3M54A 2OJ2A 3A5ZB 1U8RA 2CP7A 2RK1A 3CC7A 1QVGP 2QAZA 3MHXA 2HAXA 5IN1A 1NZ9A 3V7CA 2L8DA 2K5IA 3GF5A 2PU9B 5FW9A 3X26B 1S72T 2ZPIB 4XQ3A 1KK7A 2IPOB 3EH1A 2QA4Q 3C12A 1VQKQ 2DYBA 1SRLA 2ZPGB 4M78B 2QASA 3I56Q 5GANh 1VQ7Q 2RD1A 1VA7A 3NGPA 4ME7A 4QQGA 3CBMA 3HTRA 1X6BA 4C92G 4WCIA 2FL7A 2A36A 2RJFA 1G83A 1MHNA 3CCQA 4PNOA 2KI7A 1M1KR 4AG1C 2EQMA 1RAIB 2E41A 5I11A 3EFSA 2JZ2A 1KSWA 2F2WA 1QVGS 1JJ2P 4PJOC 4KGVB 2K2MA 1K9MR 3JSCA 2DXBA 1IHWA 2BTTA 3VYGA 4ATOA 1H8KA 1BYMA 3QYHB 2CP3A 3JCMe 3I35A 1YITA 3FB9A 1K73U 2JJ9A 3DKMA 3PVLA 4N4IA 3SEMA 5FROA 1C1AA 4LNPA 3VRYA 3ZEHA 2EYWA 1PCXA 4TVRA 2HMAA 2LCLA 1Q81R 2CREA 1BI0A 4R56A 3M0RA 2BE9B 1DJ7B 3EAEA 1BCOA 1TG0A 2LT4A 2X3XD 3CCVA 1NLPC 2H8HA 3EGXB 1JXMA 5CKEA 3JCMQ 2VV5A 3ASKA 4A4HA 4FW1A 1ARKA 1VQOA 1K8AC 4II1A 2COYA 3RESA 1KC8C 1AEYA 2J6KA 1UHFA 4E47A 1BI2A 2KXDA 1N27A 1LNXA 2NYSA 5LJ3g 1X69A 4Z02A 1M1FA 1T0JA 2GTJA 1SRMA 1KIKA 3OYJA 4OF1A 1VQLA 3CD6T 3T9NA 1G3TA 2LVMA 2BZ8A 1UJ0A 3MO8A 1N9RA 2QYZA 3LGLA 1X01A 3JCMc 3NMZC 1OOTA 5EG2A 1HD3A 4J9IA 3FLGA 3CCLQ 2DX1A 1NEBA 4OB2B 4M77D 3DLMA 5FWBA 1VQKA 3CCRA 1YIJT 1E7OA 5KYNA 2M0YA 2DZ9A 1VQPQ 3BW1A 3CPFA 1VQ7A 4LDXA 1OPKA 4BE1A 2DMOA 4BE2A 2HKQB 1YWOA 1IREB 2DJZA 1Q86C 2QI2A 4NS5A 3RERA 2HEQA 5GMKj 1Z9ZA 1X2QA 2QK0A 4M75B 1M9SA 1QMCA 2M16A 5LJ3j 2JXBA 1S72A 4J5YA 4XU0A 1N9SA 1V1CA 3REAB 2KBTA 3UDCA 3G4SA 4JRQA 1M3AA 4C0ZA 1Y07A 1ZUYA 2DXUA 5IHIA 3CXCA 4BUGA 2XU8A 1C6VX 4AMCA 4EMKA 1PSEA 2QQRA 4OVAA 5I21A 1GCQC 4Q5WA 1ZQ1A 4ZN3A 2EGEA 3QXEB 4LD9K 5GMKl 1I5OB 4E2FB 4M7DA 2JTEA 3OS1A 5LJ5d 3BY7A 3OW2A 4JRIA 4XTUA 3HRTA 2LRQA 2ZZDA 1VIFA 2XDBA 2RO0A 4B9WA 4OMPA 2GGRA 2LNVA 2K7AA 1PD0A 3QO3A 2R5AA 1AWWA 1VIEA 1M1GA 2VGNA 2F2VA 2LQNA 2EKOA 2RMOA 2HSEB 5LL6S 1KHCA 2C06A 2COZA 1PKTA 3OQ5A 3FJPA 3QJ6A 3CBOA 2EJ9A 4PKCC 2XK0A 4Z89A 4JS4A 4EMGA 3GPLA 4A4KA 4E7IA 4FSXA 5LJ5j 3CC2Q 4EDUA 4C92C 3M0PA 2KSSA 3DB4A 2KT1A 2B8AA 2EJGA 3M58A 1UGRB 3JCMP 1BBZA 2AT1B 1I4K1 1LPLA 2E5QA 1KD1U 2HD0A 3E9FA 3GP8A 4OP0A 3VJPA 3C95A 5KYXA 4OB1B 3PVQA 1KG1A 3RKWA 5LJ3f 2O4XB 1QP2A 1O75A 2DTOA 3RIRA 2OTJT 2L3QA 2A7YA 3GNFB 2A3LA 3SWNB 3CXCS 3CD6A 3JCMJ 1JEGA 1MMDA 2M0OA 2KROA 4M7DE 2CS7A 2KMTA 4OB3B 2RHXA 4M7AD 2RB6A 4OMFB 3EGUA 1IHVA 3CCUT 4IURA 5I2SA 1BIAA 1BB9A 2X4JA 3GIBA 1OYXA 4PJOA 4C8QD 3MP8A 3P8DA 2EYYA 3OW2S 3VKIA 1YIJA 1FYNA 2YHTA 2PNIA 3CCST 2CP6A 1VQ4T 1BU1A 5AYFA 3CMET 4P5NA 2OTJQ 5CO7A 2LP5A 2QQSA 2MK5A 4FM4B 1VQ6T 4LDWA 1K1ZA 1G3YA 4C5HA 4RTVA 2E3HA 4PK4A 4PJNA 1RAHB 5A0GA 2FHDA 2D9TA 2DK3A 3V8LA 1WXTA 2VWFA 2YRCA 4LDYA 4M7DD 2X3WD 3OS5A 3I55A 1UGQB 4F17A 1D0YA 1Z9QA 2CUBA 2NUPB 1OX9A 1KQ1A 5HK3A 4M78F 3OYMA 1UGVA 1Q82U 3CMAQ 3NTHA 2HKNA 4LDVA 4R55A 3CC7T 3URGA 2RHUA 2F5TX 3CCSQ 3DB3A 3LGFA 4E6RA 2DPPB 2LJ1A 2O88A 1IXDA 2PQWA 3JCMg 1ZSGA 5GAOp 1OV3A 2L2PA 3CCJT 1QLYA 3UWNA 3OYEA 2QQAA 2P0PA 3REBB 4E7LA 5J3BA 4C0DB 2RHZA 3C4SA 1ZA2B 3HRSA 1W70A 4N4GA 4C0FA 3KBGA 1H641 4BI8B 1YI2T 1K76A 2EVRA 2VB6A 5GAMg 3L2RA 4QQ6A 5KYWB 1KD1C 1Q95G 4PJOE 2NLUA 3CC7Q 3E19A 3TCJA 2AIRB 1UE9A 3VS2A 3TU4K 2QTXA 4EMHA 3VYHB 2DJQA 3R6NA 3H0IA 1YHQT 1SG5A 1WFWA 1YN8A 4E7ZA 4M78A 3MPUB 2H3JA 3GNGA 2ZPEB 1GBQA 2KGTA 2KXCA 4RG2A 1B34B 1KQSA 1WJQA 3RUXA 5CAIA 2ZGWA 1OZ3A 2Y4XA 5D6WA 4JJBA 4BDYA 1BCMA 3JCMV 4LE9A 1YI2Q 1YITT 4AFQC 2KR3A 4F7UA 5KYUB 4HVWA 4HXJA 3OMGA 3CC4A 1LOJA 3PE0A 1MV0B 1N8RU 2OI3A 3CCQQ 4GLKA 2RI5A 6AT1B 2MCNA 3PGGA 3OYIA 3VS3A 2F5KA 3ULRB 2Z0WA 3NHNA 3V7SA 3CCVT 3G7ZA 2KYBA 3V8JA 2BKDN 2OTJA 4D8DA 4DEXA 1YJNT 1ZA1B 1KC8R 1UDLA 2MMPA 3OSSC 4PLLA 1WX6A 5FU6C 2ESWA 4M78G 2RQVA 2CZ0B 4ZNXA 1VQOT 1YITQ 1GXIE 4ZGDB 2EGCA 3CCUA 3VS4A 4BE0A 1TUDA 4E7KA 1VQ5T 3HFOA 3VU3C 1AWXA 1M90C 2D8JA 5IH2A 3EGDA 2ROLA 2CSQA 4LN2A 2LDMA 3EGXA 3M57A 1U3OA 2KYMA 1VQLT 5GANg 4QKUA 4J9BA 2DBKA 3CCSA 2ZPBB 2DVJA 1VQ4A 2EBPA 2LC4A 3A8GB 3CMEA 3CCVQ 4M78E 1VQ6A 2Y4YA 2FZKB 2A28A 4QW2A 1K0XA 4M75F 1NLOC 1UHCA 2COWA 2ROTA 1TWBA 1Y71A 2KRSA 4M77F 1WQWA 1VQOQ 3CCRT 1JRIA 4C92A 4RCCA 1K8AU 2CP0A 3OSVA 1P92A 1KHIA 3G1JA 2GFUA 1YNZA 5KH6A 2X4WA 4F7UE 5KE3A 4C5IA 1KQSS 4RUGA 4A54A 1VYUA 1VQLQ 3CCMT 4F16A 4RMOA 2DETA 4KGZB 2CT3A 4FIBA 2C0TA 3JCMf 1SSFA 1ZSZB 3META 1XTDA 2WACA 1K73R 1QP3A 3CCJA 1ACMB 3G4ST 4IUQA 4A63B 3CCRQ 3UATA 1D3BB 2VC8A 1J3TA 1NJIU 2VASA 4OMQA 3TVTA 1U1TA 4MZTA 1QQJA 3VUBA 2YSQA 4FSSA 1YI2A 1MMGA 3M59A 2B86A 4NL2A 2NUTB 1N8RC 4FT4A 5L23A 3AT1B 1HK9A 2QQ9A 2YUQA 2QTVA 4PL6A 5GAN8 1Q86U 1YHQA 1B7TA 2JVVA 1Y7XA 4OMOA 3DLLA 1S72Q 5GAOn 3FC3A 2DTHA 8AT1B 4Z88A 2K6DA 5C0MA 1D1BA 2KNBB 1AZGB 4NOYA 3QG1A 4CC3A 3G4SQ 1QKXA 3NFCA 3EG9B 1D0ZA 4J6WA 2LQWA 3EFOB 3EG0A 2E70A 1Y57A 1YCYA 2AZSA 4X34A 4C92E 1QVFA 4DEYA 3TEEA 1SKUB 1AZEA 5GAN6 4FW2A 4ZN1A 4JJNK 4OB0B 2YDLA 4ZTJA 1RACB 3U23A 5IT9E 1GL5A 2DKGA 3MJXA 2XKOC 4M75G 2ED1A 1V29B 3RKYA 2L3SA 5GAMe 3QUIA 1ZX6A 4M77G 1ZBJA 3VS7A 1PRLC 2MWOA 5D6YA 4IUUA 1YJNA 1IZ6A 2HL3A 1QCOA 2FPFA 3E9GA 3HSBA 3CEYA 2K3XA 3M0TA 1IRXA 4F14A 2F69A 1Y0MA 4JLIA 3VRZA 1IO6A 1NPRA 1VQNT 3KUFA 2V8KA 2O31A 4RG8A 1T0HA 1VQ5A 2AKLA 3PFSA 2JM8A 2G6FX 2E6ZA 2OTLT 1BK2A 1ZUUA 5D7UA 2CDTA 4LUEA 1VQ8A 2EYQA 2PUKB 2JN0A 2VKNA 3PT9A 4MZPA 1YJ9T 5HKCA 2XMFA 1XNIA 1VQMT 1FWZA 3A8MB 1R0BG 1RAEB 5LJ3d 1RL2A 2O4XA 5FU7B 2E3IA 5IXFA 2L89A 2BZXA 4RCBA 1MGQA 5GMKi 3X28B 1NJIC 3RDVA 1VQNQ 2XD0A 1MMAA 3V7RA 1NEGA 4XTZA 3MEUA 3QHSA 3ZFJA 9ATCB 4FYVB 3JB9J 1MNDA 4M78C 2K5FA 3L1AA 4J9DA 5GJWB 4F04B 1W1FA 2DE0X 4J6XA 2KT8A 4LXCA 2A08A 3CCMA 1QVFS 3CD6Q 5IHNA 3X25B 3CPWA 1YJ9Q 4MDXA 2DRMA 1TUGB 1G2BA 1B3QA 3I55T 1QWFA 2PVGB 4M77B 2RJEA 2QEXA 4KULA 1CKAA 1KFZA 3PMTA 2FG0A 5GANe 1NYGA 1B07A 1RAAB 2PVOB 2HCKA 3H9NA 1YIJQ 1KJWA 2EQUA 3QSUA 1M3BA 2YLBA 2ABLA 2YT6A 3QIIA 2CKKA 4J9EA 3M9QA 2ZCFB 2HDAA 1UECA 2DILA 3FRNA 4JZ3A 2VYTA 3MEVA 2ZAEA 4AFZC 2DL8A 4J9FA 3P8BB 3A8OB 3G6ET 3BE3A 2EYZA 2BIVA 3M4GA 2R58A 4DQ2A 1OX8A 1M4ZA 4JJCA 1PWTA 3I55Q 3OYDA 3JB9D 1Q7YU 1KD1R 1AOJA 5HCKA 4A53A 3IQLA 2JOYA 4BY6B 4C0GA 2RPNA 5AT1B 3HKSA 3QPHA 3D7SB 2EAYA 2K9GA 4XAXB 2K3BA 4J83A 2RHYA 1G3WA 2KDSA 3CXCP 2JTFA 4EPCA 3LH0A 4XTYA 1N6AA 3A98A 1SSHA 2K3YA 2YXYA 5GJVB 3JCMb 3G6EQ 3PNWC 1NPPA 2X4YA 1FMWA 5KYWA 3LWIA 3OW2P 2J05A 3MKDA 2XICA 4C8QG 1K9MC 1AWJA 2DF6A 5D6XA 1MUZA 3M53A 3CPWS 2DIGA 1QW1A 2DVEA 2DYIA 2KE9A 3CC4T 4BI3A 3MEAA 1WLPB 3PIPA 1VQNA 4X9CA 3UT1A 4LDUA 4OMMA 2OTLA 5LJ5h 1UG1A 1M3CA 3WVEB 2O01E 5KYUA 4DBQA 1Q82R 1WDXA 1S1NA 2RHIA 1YJ9A 1VQMA 4HT8A 3HHTB 1RI9A 4XU2A 3OYGA 2M51A 2LJ0A 2LT1A 2ED0A 4M75C 3CC4Q 1SF9A 5FWCA 4A4FA 3EHQA 4VUBA 1M2VA 4D6WA 1QWEA 2RF0A 2LZ6B 4BACA 1PD1A 1RUWA 2DEUA 1W6XA 2PVDB 2OAUA 3OYNA 2EW3A 1M8VA 2HZYA 3E2UA 1JU5C 2EQJA 2KVQG 4CRIA 3OYBA 3QZ9B 4M7AB 1WHJA 2KY9A 2QG9B 4J7FA 3A8LB 1Q7YC 2P4RA 1YBYA 1EX4A 3O8VA 4XU1A 3CCUQ 4C8QB 1PHTA 3QBYA 5ECAA 1M90U 3EH2A 1RABB 5DM7R 1WXBA 3RBBB 3ZBDA 2J06A 4FYYB 3GBQA 1LCKA 1LVKA 1VQ4Q 1WPYA 4EMKB 3CMEQ 3EFRA 2EJFA 3MP6A 1VQ6Q 3LW5E 2XG8D 5GAOl 2JMCA 3G6EA 4M7DB 1RLPC 4N4HA 2EQKA 4KBMB 1XQHA 2DEQA 2AZVA 5IXBA 2VXFA 1G3SA 1N8RR 5A0LA 3S3OA 3FDRA 3M56A 5CKDA 2FYKA 1I07A 3EG1A 2HNIA 3JCMd 5KCHA 1C0MA 3FEOA 1X2KA 1ZSZA 3CCET 2CZ6B 2SEMA 1I8FA 5CKFA 3ME9A 4BDZA 4PJJA 4OGEA 4RTTA 1X43A 4MMKA 3QWXX 1WHHA 3H8ZA 4JJDA 3EG2A 2EGAA 2LTOA 5CR2A 1WI7A 4IIOA 4UC4A 4HCCA 3VS1A 2AKKA 1WJSA 3CCJQ 2E5KA 1M30A 2GCXA 1GRIA 2NUTA 3C0CA 3KFVA 1ZHIA 3I5SA 3SWNC 4HKEA 2CUDA 4XK8E 3PTAA 1RI0A 2X35A 1X6GA 2ATCB 3TSWA 2KEAA 4Y91A 1I0CA 5KYYB 2D0NA 4PJOD 4XTWA 1Y96B 4AFUC 3OY9A 5LJ5e 1CSKA 1F1BB 4FU6A 1BI3A 1YHQQ 3EG9A 4KH1B 2C0OA 4MZMA 4ESRA 1H92A 5GAMj 3CQTA 2EQIA 1ZBXA 4MMLA 1NG2A 1ABOA 3C94A 1K8AR 1EFNA 4HVVA 2LJ3A 2YRVA 2P84A 3O5ZA 2DIQA 3S3NA 1KQSP 3TSZA 3JCMX 1UJYA 3G71T 2FB7A 4GY5A 3L2ZA 2E4HA 3PMIA 3MCAB 1NE8A 3M0UA 4PJOB 4XU3A 2G3RA 1RAFB 5DY9A 1BIBA 2E1HA 4DOWA 4ELZC 2MF2A 3NTIA 3F70A 3LWHA 2DFUA 2GBQA 2ENMA 1VQ8T 1AT1B 3EHRA 3THKA 1GFCA 1QVPA 1UTIA 1NJIR 4HA8A 2P0KA 1G8XA 1YJNQ 1ZUKA 3FJ5A 1H3HA 1K0SA 4CC7A 1H3ZA 4EIKA 3QWYA 1PM3A 1QVGA 1N5ZA 2CH4A 2MWPA 1VQ5Q 2DL3A 3NTKA 1JQQA 1GBRA 1Q86R 2MAMA 2HBWA 4C0DC 1QCNA 3X24B 4ANJA 4QT7A 2GTOA 1EIFA 2QA4T 1SPKA 2KQWA 4X1VA 2E12A 1VQ8Q 3M0QA 2RA2A 4AG2C 3BDUA 4JDSA 4BD3A 1R0CB 2QQBA 3N5BB 1ABQA 1TTHB 1TU0B 3JB9H 1BI1A 4HT9A 2RQUA 3JV3A 1CKBA 2VGMA 5C6SA 2GFAA 4M78D 3L2WA 2EPDA 2QXFA 2QEXT 3J7AF 1WYXA 2RI3A 5GANj 2R5MA 2RK2A 3AHUA 3M4YA 3OYLA 1KQ2A 1I5LA 2IVWA 2NUZA 4ZGEB 2GF7A 1W4SA 1GCPA 1YWPA 4XTVA 4ZTFA 2RQWA 3Q1JA 2F1LA 5GAMf 2LCSA 1FMKA 3A1PA 1U06A 3HPWA 4M75A 3CCEA 4V2SA 2FZCB 4MDWA 3HL8A 1JJ2A 3CCMQ 1UGPB 4M77A 3H0HA 2DL4A 1E6GA 1R8OB 5IAYA 3H41A 1OU9A 2X9HA 3JB9F 4D8KA 2H3EB 2QEXQ 1XOVA 4KRTA 3INZA 2JMAA 4X9DA 2E65A 3PIOA 4O5VA 4L5GA 1OPLA 5DLQE 2K4YA 3OB9A 3SB2A 2P4TA 3SHWA 2GQVA
chains in the Genus database with same CATH topology
2ABLA 2PNIA 2YT6A 4J9EA 2YUPA 1BU1A 2HDAA 1UECA 2DILA 1VYVA 2LP5A 1K4US 4JZ3A 4K11A 1M8MA 1K1ZA 3UF4A 4RTVA 2V1RA 3VS0A 1GCQA 4AFZC 2DL8A 4J9FA 1JO8A 1A0NB 5I22A 2EYZA 1WXTA 2VWFA 1U5SA 2CH4W 4JJCA 1PWTA 2LNHB 2X3WD 2DLPA 2VVKA 4F17A 1AOJA 1Z9QA 2FRYA 2CUBA 1TUCA 2F2XA 5HCKA 4Z8AA 4LUDA 2J7IA 3IQLA 2O2OA 2RPNA 2JS0A 1UGVA 3UA6A 2DRKA 2V1QA 2J6FA 2K9GA 2PTKA 2FPDA 4HVUA 2K3BA 4E6RA 2GQIA 1K9AA 3EG3A 3A98A 2LJ1A 1SSHA 2O88A 5GJVB 2JS2A 1ZSGA 2RNAA 1E6HA 4R0KA 1OV3A 2L2PA 1QLYA 3REBB 2FPEA 2PZ1A 1T3SA 1W70A 2J05A 4OMLA 2GNCA 1AWJA 2DF6A 4Y92A 1MUZA 1K76A 2EVRA 2OJ2A 1I1JA 2KRNA 2KE9A 2DA9A 1UE9A 1WLPB 3VS2A 2DJQA 3R6NA 4GBQA 3H0IA 1WFWA 1YN8A 5FW9A 4OMMA 2EYXA 1YCSB 1WA7A 2RQTA 4JZ4A 1OEBA 1UG1A 1GBQA 1M3CA 2KGTA 2KXCA 1UUEA 2DL7A 2DYBA 1X27A 1WDXA 1S1NA 1SRLA 2MOXA 4JJBA 4M4ZA 1RI9A 4LE9A 3ZL7C 2KRMA 2M51A 2LJ0A 1VA7A 4AFQC 2KR3A 3NGPA 2ED0A 4HVWA 4HXJA 3VS5A 1X6BA 5FWCA 4WCIA 3EHQA 3PE0A 1HSQA 1MV0B 2A36A 1QWEA 2OI3A 2RF0A 1G83A 1SEMA 2LZ6B 2MCNA 1PRMC 1RUWA 1W6XA 3VS3A 3ULRB 1QCFA 2JM9A 2EW3A 4AG1C 3NHNA 5I11A 2KYBA 1JU5C 4D8DA 1KSWA 1SHGA 5IHKA 2F2WA 4DEXA 1UDLA 2IIMA 2W10A 5EC7A 1WX6A 2K2MA 2RQRA 2ESWA 2RQVA 4ZNXA 2BTTA 2P4RA 1H8KA 2FEIA 2AK5A 3I35A 2EGCA 2RN8A 3VS4A 1TUDA 1PHTA 3PVLA 4JPBW 1AWXA 1PNJA 2D8JA 5IH2A 3SEMA 5ECAA 4LNPA 2ROLA 2CSQA 4LN2A 3VRYA 2EYWA 2BZYA 1WXBA 3RBBB 1U3OA 2CREA 2J06A 2KYMA 4J9BA 2DBKA 3M0RA 3GBQA 1LCKA 2DVJA 1TG0A 2EBPA 2X3XD 2DNUA 1QKWA 2L3PA 1NLPC 2H8HA 4CC4B 1JXMA 2A28A 1K0XA 2JMCA 1NLOC 1UHCA 2ROTA 1RLPC 2JT4A 2KRSA 4ORZA 1ARKA 1HJDA 2AZVA 5IXBA 3LH5A 1AEYA 2J6KA 1I07A 3EG1A 1UHFA 1YNZA 2KXDA 2SRCA 4RUGA 1X2KA 1X69A 1VYUA 2SEMA 1T0JA 2D8HA 1SRMA 2GTJA 1M27C 1KIKA 4F16A 4RTTA 1X43A 3QWXX 2BZ8A 1UJ0A 2CT3A 2C0TA 4JJDA 1JXOA 3EG2A 2EGAA 3NMZC 1WI7A 4IIOA 1OOTA 1HD3A 4GLMA 3VS1A 4J9IA 2DX1A 1NEBA 1MV3A 2AKKA 2E5KA 1M30A 1GRIA 4A63B 3H0FA 5FWBA 2MIOA 3UATA 1J3TA 3C0CA 3KFVA 2DL5A 1E7OA 3I5SA 2M0YA 4OMQA 3TVTA 2CUDA 3VS6A 1UFFA 2HSPA 3UA7A 1X6GA 2YSQA 3TSWA 4FSSA 2C0IA 2KEAA 1I0CA 1OPKA 2B86A 2DMOA 1YWOA 2D0NA 1WIEA 2J6OA 5L23A 2CSIA 2YUQA 4AFUC 1CSKA 2YUNA 2I0NA 2HEQA 1Z9ZA 1X2QA 2LMJA 2C0OA 4CC2A 4ESRA 1AD5A 1H92A 3CQTA 2EQIA 4OMOA 2JXBA 1NG2A 1ABOA 3I5RA 4Z88A 2EKHA 2K6DA 1V1CA 2KNBB 1AZGB 1EFNA 2JW4A 4HVVA 4OMNA 4CC3A 2LJ3A 2KBTA 3REAB 1QKXA 3O5ZA 1M3AA 2LQWA 3TSZA 1UJYA 3EG0A 2W0ZA 1Y57A 1PKSA 2AZSA 1ZUYA 1AVZC 5IHIA 4J9HA 2ECZA 2QDLA 4DEYA 2O9VA 3I9QA 1AZEA 2FRWA 3M0UA 1YP5A 2YDLA 4J9CA 3U23A 1GCQC 4RTUA 1GL5A 2EGEA 2GBQA 2ENMA 2JTEA 2ED1A 3EHRA 2L3SA 3THKA 1GFCA 1ZX6A 1UTIA 1ZBJA 3VS7A 1PRLC 2L0AA 1ZUKA 3FJ5A 1H3HA 4J9GA 3NPFA 1K0SA 2FPFA 4CC7A 4OMPA 4EIKA 2GGRA 3M0TA 4F14A 3QWYA 1N5ZA 1Y0MA 2CH4A 2K7AA 1IO6A 3VRZA 2O31A 1AWWA 2DL3A 1GBRA 1JQQA 1T0HA 2AKLA 2F2VA 2LQNA 2HBWA 2RMOA 4RTYA 1PKTA 2JM8A 2G6FX 4QT7A 3RNJA 2GTOA 4Z89A 2O9SA 1SPKA 1BK2A 4X1VA 1ZUUA 3M0QA 1RLQC 2CT4A 2CDTA 4LUEA 1SHFA 4AG2C 1VYTA 2VKNA 2FO0A 1ABQA 3M0PA 1NM7A 3M0SA 2RQUA 2XMFA 2KT1A 3JV3A 1CKBA 2EPDA 2LX7A 1WYXA 2YUOA 5IXFA 1BBZA 2BZXA 2K79A 4HCKA 2NUZA 1NEGA 1GCPA 1GFDA 3PVQA 1YWPA 4RTXA 2RQWA 2A37A 2NWMA 1AWOA 2LCSA 1FMKA 1U06A 4J9DA 5GJWB 1W1FA 2DE0X 4IIMA 2KT8A 2L3QA 2A08A 2DL4A 3H0HA 1E6GA 5IHNA 2DM1A 1JEGA 1NYFA 1WXUA 2KROA 3H41A 4RTWA 1ZLMA 2DRMA 1G2BA 1B3QA 3EGUA 4D8KA 1QWFA 4RTZA 1XOVA 4KRTA 1BB9A 2DBMA 1CKAA 1KFZA 2FG0A 2JMAA 1NYGA 1B07A 2HCKA 4AFSC 1OPLA 2EYYA 1T3LA 1KJWA 2OAWA 1FYNA 3SHWA 2D1XA 1M3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ABL A;  2PNI A;  2YT6 A;  4J9E A;  2YUP A;  1BU1 A;  2HDA A;  1UEC A;  2DIL A;  1VYV A;  2LP5 A;  1K4U S;  4JZ3 A;  4K11 A;  1M8M A;  1K1Z A;  3UF4 A;  4RTV A;  2V1R A;  3VS0 A;  1GCQ A;  4AFZ C;  2DL8 A;  4J9F A;  1JO8 A;  1A0N B;  5I22 A;  2EYZ A;  1WXT A;  2VWF A;  1U5S A;  2CH4 W;  4JJC A;  1PWT A;  2LNH B;  2X3W D;  2DLP A;  2VVK A;  4F17 A;  1AOJ A;  1Z9Q A;  2FRY A;  2CUB A;  1TUC A;  2F2X A;  5HCK A;  4Z8A A;  4LUD A;  2J7I A;  3IQL A;  2O2O A;  2RPN A;  2JS0 A;  1UGV A;  3UA6 A;  2DRK A;  2V1Q A;  2J6F A;  2K9G A;  2PTK A;  2FPD A;  4HVU A;  2K3B A;  4E6R A;  2GQI A;  1K9A A;  3EG3 A;  3A98 A;  2LJ1 A;  1SSH A;  2O88 A;  5GJV B;  2JS2 A;  1ZSG A;  2RNA A;  1E6H A;  4R0K A;  1OV3 A;  2L2P A;  1QLY A;  3REB B;  2FPE A;  2PZ1 A;  1T3S A;  1W70 A;  2J05 A;  4OML A;  2GNC A;  1AWJ A;  2DF6 A;  4Y92 A;  1MUZ A;  1K76 A;  2EVR A;  2OJ2 A;  1I1J A;  2KRN A;  2KE9 A;  2DA9 A;  1UE9 A;  1WLP B;  3VS2 A;  2DJQ A;  3R6N A;  4GBQ A;  3H0I A;  1WFW A;  1YN8 A;  5FW9 A;  4OMM A;  2EYX A;  1YCS B;  1WA7 A;  2RQT A;  4JZ4 A;  1OEB A;  1UG1 A;  1GBQ A;  1M3C A;  2KGT A;  2KXC A;  1UUE A;  2DL7 A;  2DYB A;  1X27 A;  1WDX A;  1S1N A;  1SRL A;  2MOX A;  4JJB A;  4M4Z A;  1RI9 A;  4LE9 A;  3ZL7 C;  2KRM A;  2M51 A;  2LJ0 A;  1VA7 A;  4AFQ C;  2KR3 A;  3NGP A;  2ED0 A;  4HVW A;  4HXJ A;  3VS5 A;  1X6B A;  5FWC A;  4WCI A;  3EHQ A;  3PE0 A;  1HSQ A;  1MV0 B;  2A36 A;  1QWE A;  2OI3 A;  2RF0 A;  1G83 A;  1SEM A;  2LZ6 B;  2MCN A;  1PRM C;  1RUW A;  1W6X A;  3VS3 A;  3ULR B;  1QCF A;  2JM9 A;  2EW3 A;  4AG1 C;  3NHN A;  5I11 A;  2KYB A;  1JU5 C;  4D8D A;  1KSW A;  1SHG A;  5IHK A;  2F2W A;  4DEX A;  1UDL A;  2IIM A;  2W10 A;  5EC7 A;  1WX6 A;  2K2M A;  2RQR A;  2ESW A;  2RQV A;  4ZNX A;  2BTT A;  2P4R A;  1H8K A;  2FEI A;  2AK5 A;  3I35 A;  2EGC A;  2RN8 A;  3VS4 A;  1TUD A;  1PHT A;  3PVL A;  4JPB W;  1AWX A;  1PNJ A;  2D8J A;  5IH2 A;  3SEM A;  5ECA A;  4LNP A;  2ROL A;  2CSQ A;  4LN2 A;  3VRY A;  2EYW A;  2BZY A;  1WXB A;  3RBB B;  1U3O A;  2CRE A;  2J06 A;  2KYM A;  4J9B A;  2DBK A;  3M0R A;  3GBQ A;  1LCK A;  2DVJ A;  1TG0 A;  2EBP A;  2X3X D;  2DNU A;  1QKW A;  2L3P A;  1NLP C;  2H8H A;  4CC4 B;  1JXM A;  2A28 A;  1K0X A;  2JMC A;  1NLO C;  1UHC A;  2ROT A;  1RLP C;  2JT4 A;  2KRS A;  4ORZ A;  1ARK A;  1HJD A;  2AZV A;  5IXB A;  3LH5 A;  1AEY A;  2J6K A;  1I07 A;  3EG1 A;  1UHF A;  1YNZ A;  2KXD A;  2SRC A;  4RUG A;  1X2K A;  1X69 A;  1VYU A;  2SEM A;  1T0J A;  2D8H A;  1SRM A;  2GTJ A;  1M27 C;  1KIK A;  4F16 A;  4RTT A;  1X43 A;  3QWX X;  2BZ8 A;  1UJ0 A;  2CT3 A;  2C0T A;  4JJD A;  1JXO A;  3EG2 A;  2EGA A;  3NMZ C;  1WI7 A;  4IIO A;  1OOT A;  1HD3 A;  4GLM A;  3VS1 A;  4J9I A;  2DX1 A;  1NEB A;  1MV3 A;  2AKK A;  2E5K A;  1M30 A;  1GRI A;  4A63 B;  3H0F A;  5FWB A;  2MIO A;  3UAT A;  1J3T A;  3C0C A;  3KFV A;  2DL5 A;  1E7O A;  3I5S A;  2M0Y A;  4OMQ A;  3TVT A;  2CUD A;  3VS6 A;  1UFF A;  2HSP A;  3UA7 A;  1X6G A;  2YSQ A;  3TSW A;  4FSS A;  2C0I A;  2KEA A;  1I0C A;  1OPK A;  2B86 A;  2DMO A;  1YWO A;  2D0N A;  1WIE A;  2J6O A;  5L23 A;  2CSI A;  2YUQ A;  4AFU C;  1CSK A;  2YUN A;  2I0N A;  2HEQ A;  1Z9Z A;  1X2Q A;  2LMJ A;  2C0O A;  4CC2 A;  4ESR A;  1AD5 A;  1H92 A;  3CQT A;  2EQI A;  4OMO A;  2JXB A;  1NG2 A;  1ABO A;  3I5R A;  4Z88 A;  2EKH A;  2K6D A;  1V1C A;  2KNB B;  1AZG B;  1EFN A;  2JW4 A;  4HVV A;  4OMN A;  4CC3 A;  2LJ3 A;  2KBT A;  3REA B;  1QKX A;  3O5Z A;  1M3A A;  2LQW A;  3TSZ A;  1UJY A;  3EG0 A;  2W0Z A;  1Y57 A;  1PKS A;  2AZS A;  1ZUY A;  1AVZ C;  5IHI A;  4J9H A;  2ECZ A;  2QDL A;  4DEY A;  2O9V A;  3I9Q A;  1AZE A;  2FRW A;  3M0U A;  1YP5 A;  2YDL A;  4J9C A;  3U23 A;  1GCQ C;  4RTU A;  1GL5 A;  2EGE A;  2GBQ A;  2ENM A;  2JTE A;  2ED1 A;  3EHR A;  2L3S A;  3THK A;  1GFC A;  1ZX6 A;  1UTI A;  1ZBJ A;  3VS7 A;  1PRL C;  2L0A A;  1ZUK A;  3FJ5 A;  1H3H A;  4J9G A;  3NPF A;  1K0S A;  2FPF A;  4CC7 A;  4OMP A;  4EIK A;  2GGR A;  3M0T A;  4F14 A;  3QWY A;  1N5Z A;  1Y0M A;  2CH4 A;  2K7A A;  1IO6 A;  3VRZ A;  2O31 A;  1AWW A;  2DL3 A;  1GBR A;  1JQQ A;  1T0H A;  2AKL A;  2F2V A;  2LQN A;  2HBW A;  2RMO A;  4RTY A;  1PKT A;  2JM8 A;  2G6F X;  4QT7 A;  3RNJ A;  2GTO A;  4Z89 A;  2O9S A;  1SPK A;  1BK2 A;  4X1V A;  1ZUU A;  3M0Q A;  1RLQ C;  2CT4 A;  2CDT A;  4LUE A;  1SHF A;  4AG2 C;  1VYT A;  2VKN A;  2FO0 A;  1ABQ A;  3M0P A;  1NM7 A;  3M0S A;  2RQU A;  2XMF A;  2KT1 A;  3JV3 A;  1CKB A;  2EPD A;  2LX7 A;  1WYX A;  2YUO A;  5IXF A;  1BBZ A;  2BZX A;  2K79 A;  4HCK A;  2NUZ A;  1NEG A;  1GCP A;  1GFD A;  3PVQ A;  1YWP A;  4RTX A;  2RQW A;  2A37 A;  2NWM A;  1AWO A;  2LCS A;  1FMK A;  1U06 A;  4J9D A;  5GJW B;  1W1F A;  2DE0 X;  4IIM A;  2KT8 A;  2L3Q A;  2A08 A;  2DL4 A;  3H0H A;  1E6G A;  5IHN A;  2DM1 A;  1JEG A;  1NYF A;  1WXU A;  2KRO A;  3H41 A;  4RTW A;  1ZLM A;  2DRM A;  1G2B A;  1B3Q A;  3EGU A;  4D8K A;  1QWF A;  4RTZ A;  1XOV A;  4KRT A;  1BB9 A;  2DBM A;  1CKA A;  1KFZ A;  2FG0 A;  2JMA A;  1NYG A;  1B07 A;  2HCK A;  4AFS C;  1OPL A;  2EYY A;  1T3L A;  1KJW A;  2OAW A;  1FYN A;  3SHW A;  2D1X A;  1M3B A; 
#chains in the Genus database with same CATH topology
 5KE2 A;  4KH0 B;  4F7U B;  1EZZ B;  3RR6 A;  2A0F B;  5GAN 7;  4K11 A;  1M8M A;  2E6N A;  4A4E A;  3UF4 A;  3H6Z A;  3VS0 A;  1TXQ A;  5GAO q;  1JO8 A;  1A0N B;  2FZG B;  4FYW B;  1JBM A;  1OQK A;  2EFI A;  2DAQ A;  3R6O A;  1U5S A;  4FT2 A;  5A0D A;  1TS9 A;  2CH4 W;  3OBY A;  2LNH B;  4HCZ A;  2DXC A;  2VVK A;  2QGG A;  2P0Q A;  2F2X A;  4Z8A A;  4LUD A;  7AT1 B;  2JS0 A;  3UA6 A;  2DRK A;  2V1Q A;  1V76 A;  1WZO A;  2PTK A;  3G71 A;  3TRE A;  2YWW A;  2X4X A;  1WQ7 A;  3J80 E;  1R77 A;  4IUV A;  1QVF P;  4C92 D;  2FVU A;  3EGD B;  4E7H A;  3EG3 A;  1PG5 B;  4A4G A;  1PC0 A;  3M55 A;  4M75 E;  2RNA A;  4R0K A;  5CKB A;  3RMQ A;  5GAN f;  3CCL T;  2M02 A;  4M77 E;  1M1K U;  1VQ9 A;  5GAN 2;  1O9S A;  3V8K A;  2OX7 A;  1PSF A;  2HQH A;  3OYK A;  3LYI A;  4M7A F;  4OML A;  2GNC A;  1JJ2 S;  1VQP T;  3CBP A;  1K9M U;  1ZSZ C;  1I1J A;  2KRN A;  3RKX A;  2DA9 A;  2M9U A;  4C92 B;  2HQE A;  3OYY A;  4C8Q F;  3QJY A;  2KK4 A;  2CP2 A;  3GLX A;  4QVZ A;  3SWN A;  4GBQ A;  4IUP A;  1D1C A;  2EYX A;  3SDZ A;  1YCS B;  5L8R E;  1WA7 A;  1Q7Y R;  2RQT A;  4JZ4 A;  2OTL Q;  4M75 D;  1OEB A;  1Q81 U;  2QA4 A;  3JB9 G;  1D0X A;  1UUE A;  5CK9 A;  2DL7 A;  2DD4 A;  4KGX B;  1X27 A;  4PJM A;  2MOX A;  4M4Z A;  4DBF A;  4ELY C;  1VQM Q;  4M7D F;  3L2V A;  2DO3 A;  3OMC A;  3ZL7 C;  2KRM A;  2EIF A;  3I56 A;  1X6O A;  2JTM A;  1IGQ A;  3HP9 A;  2LX9 A;  3VS5 A;  3QKJ A;  1HSQ A;  2HQX A;  3S6W A;  2RH2 A;  4N0A C;  3WXM B;  1SEM A;  2Y90 A;  2MYS A;  1PRM C;  4M7A A;  2D0Q B;  3QZ5 B;  1QCF A;  2JM9 A;  4ZGJ B;  3KXT A;  1X75 C;  2HL5 C;  1SHG A;  5IHK A;  2NUP A;  5GMK h;  4C8Q A;  3L42 A;  2IIM A;  2W10 A;  2XI9 A;  5EC7 A;  3CPW P;  2RQR A;  5LJ3 h;  2V26 A;  4E7S A;  2FEI A;  3JAM E;  1K73 C;  3SFM A;  2AK5 A;  5LJ5 g;  5FRM A;  2RN8 A;  1LJO A;  4JPB W;  1PNJ A;  2CP5 A;  1IB8 A;  3QYG B;  5CQY A;  2BZY A;  2RM4 A;  3MP1 A;  2JNG A;  3L2Q A;  3CC2 T;  2RJD A;  2X51 A;  4QVD A;  2DNU A;  1FXX A;  1QKW A;  2L3P A;  1G5V A;  2K5L A;  4CC4 B;  5GMK m;  4J8O A;  4JUV A;  1M1K C;  4M7A G;  2BUD A;  2JT4 A;  4ORZ A;  1YJW T;  4DBR A;  1OZ2 A;  2YLC A;  1HJD A;  3LH5 A;  4XTX A;  4FCY A;  3JB9 I;  1M2O A;  2SRC A;  3OYF A;  2WSF E;  5GAN 5;  2DD5 A;  2D8H A;  1M27 C;  3BDL A;  4PJO F;  5FU7 C;  2LCC A;  2XDD A;  1B34 A;  1JXO A;  3L2U A;  4M7A E;  1HXD A;  3OS2 A;  5CIU A;  1Q81 C;  2HBP A;  4GLM A;  4M7D G;  3CCL A;  4PFO A;  1MV3 A;  4C8Q E;  5KYY A;  1YJW Q;  5CCA A;  3H0F A;  1MNE A;  2BE7 D;  2MIO A;  1M90 R;  2V8J A;  2DL5 A;  1Y96 A;  3J81 E;  4KUD K;  3VS6 A;  1UFF A;  3TQ7 P;  2HSP A;  3UA7 A;  1VQP A;  2C0I A;  2R57 A;  4DA4 A;  1WGS A;  2AHJ B;  2QGF B;  4NL3 A;  1OUL A;  1VUB A;  1WIE A;  2J6O A;  4JS5 A;  4M77 C;  2CSI A;  2RJC A;  2YUN A;  1M5Q 1;  2I0N A;  2DZC A;  5J26 A;  2LMJ A;  4CC2 A;  2CZ7 B;  1AD5 A;  4PLI A;  2WSC E;  3RMS A;  3I5R A;  2EKH A;  5CKH A;  3GOX A;  2V8I A;  2JW4 A;  4OMN A;  3CMA T;  4L59 A;  1TSF A;  2W0Z A;  1PKS A;  1YFN A;  1AVZ C;  4J9H A;  2ECZ A;  1MMN A;  5FRN A;  2QDL A;  3OS0 A;  2O9V A;  3I9Q A;  3M5A A;  2FRW A;  2QDY B;  2JUF A;  1YP5 A;  4J9C A;  4JLG A;  2CZ1 B;  3ER0 A;  4YTL A;  2PUO B;  5FU6 B;  3HFN A;  3JCM W;  4BY6 C;  4RTU A;  4KT0 E;  4IUT A;  4BB7 A;  5GMK e;  3A8H B;  5FLX E;  2MI6 A;  5CVI A;  4DOV A;  5CQX A;  5LJ3 e;  4OGC A;  1U1S A;  1WHK A;  1WHM A;  8ATC B;  4E7J A;  2L0A A;  2K57 A;  4J9G A;  3NPF A;  4J7I A;  3FIF A;  5I2M A;  5LJ5 f;  4HCB A;  3X20 B;  1UGS B;  3QDR B;  3OBW A;  4L6V 5;  2DXT A;  4PJO G;  3OYC A;  4C5E A;  4RKU E;  4RTY A;  4B9X A;  3OA6 A;  1WJR A;  4F7U F;  3RNJ A;  3P8H A;  3VUZ A;  2O9S A;  4JRK A;  2YRD A;  1RLQ C;  2CT4 A;  1SHF A;  1VYT A;  3CC2 A;  3MEW A;  4Y28 E;  5GAO m;  2FO0 A;  2CGH A;  2CYZ B;  1NM7 A;  2ZPF B;  3M0S A;  1D3B A;  5M9O A;  1WNL A;  5GAM d;  1VOM A;  2LX7 A;  2YUO A;  2LQK A;  2K79 A;  1YJW A;  4DBH A;  1IGU A;  1TH7 A;  4HCK A;  3VV0 A;  2VXE A;  4C5G A;  1AHJ B;  3CCQ T;  1GFD A;  5A2Q E;  4RTX A;  3HRU A;  1FMV A;  2A37 A;  2NWM A;  1AWO A;  1W2B A;  3CCE Q;  4IKF A;  2VUB A;  1WHG A;  4FYX B;  5GAO r;  4IIM A;  3LLR A;  5KYX B;  3S3M A;  2DM1 A;  4BI4 A;  1NYF A;  1WXU A;  4N0A A;  4RTW A;  3EFO A;  2WSE E;  1ZLM A;  4RTZ A;  2E10 A;  2DBM A;  2RI2 A;  2XHC A;  1OU8 A;  1NBE B;  1XJW B;  2XID A;  1D09 B;  4AFS C;  2DTI A;  3JCM h;  1T3L A;  2E64 A;  3BFM A;  2OAW A;  2D1X A;  4M7A C;  4PFP A;  4B6M A;  4C92 F;  3SD4 A;  2YUP A;  5GAN 3;  1UEB A;  2I2L A;  1W2B P;  1OI1 A;  1VYV A;  1M2V B;  1K4U S;  2V1R A;  1GCQ A;  4C8Q C;  3UPU A;  5I22 A;  3JRZ A;  5GAM h;  3WVD B;  1VQ9 T;  2IG0 A;  4J6Y A;  4PJL A;  4WF2 A;  2DLP A;  2ZPH B;  1RAD B;  2DER A;  2FRY A;  5J39 A;  1TUC A;  1Q82 C;  1WHL A;  2J7I A;  2O2O A;  4EMK C;  1TOV A;  1D1A A;  2K2V A;  2J6F A;  3CMA A;  4JRP A;  3G71 Q;  2FPD A;  5GAN d;  4FL6 A;  4HVU A;  5HY6 A;  4M7D C;  4F7U G;  1JB0 E;  4CI0 C;  1RAG B;  4WTO B;  5KCO A;  2GQI A;  3E1S A;  1K9A A;  1HYO A;  3OYA A;  1UB4 A;  4KUI A;  5DLO A;  2JS2 A;  3QDF A;  1E6H A;  4QQD A;  3LX7 A;  1VQ9 Q;  4AT1 B;  1FX7 A;  3OYH A;  1BKB A;  2LQ8 A;  1VQK T;  2KAF A;  4PFZ A;  2XDP A;  2FPE A;  2MPX C;  2L5Q A;  4O6J A;  2PZ1 A;  1T3S A;  1W2B S;  2D6F A;  2M1H A;  4LD6 A;  2EWN A;  1KC8 U;  2L3R A;  1I81 A;  5GAN 4;  4QVC A;  3I56 T;  4Y92 A;  5HK0 A;  1VQ7 T;  3M54 A;  2OJ2 A;  3A5Z B;  1U8R A;  2CP7 A;  2RK1 A;  3CC7 A;  1QVG P;  2QAZ A;  3MHX A;  2HAX A;  5IN1 A;  1NZ9 A;  3V7C A;  2L8D A;  2K5I A;  3GF5 A;  2PU9 B;  5FW9 A;  3X26 B;  1S72 T;  2ZPI B;  4XQ3 A;  1KK7 A;  2IPO B;  3EH1 A;  2QA4 Q;  3C12 A;  1VQK Q;  2DYB A;  1SRL A;  2ZPG B;  4M78 B;  2QAS A;  3I56 Q;  5GAN h;  1VQ7 Q;  2RD1 A;  1VA7 A;  3NGP A;  4ME7 A;  4QQG A;  3CBM A;  3HTR A;  1X6B A;  4C92 G;  4WCI A;  2FL7 A;  2A36 A;  2RJF A;  1G83 A;  1MHN A;  3CCQ A;  4PNO A;  2KI7 A;  1M1K R;  4AG1 C;  2EQM A;  1RAI B;  2E41 A;  5I11 A;  3EFS A;  2JZ2 A;  1KSW A;  2F2W A;  1QVG S;  1JJ2 P;  4PJO C;  4KGV B;  2K2M A;  1K9M R;  3JSC A;  2DXB A;  1IHW A;  2BTT A;  3VYG A;  4ATO A;  1H8K A;  1BYM A;  3QYH B;  2CP3 A;  3JCM e;  3I35 A;  1YIT A;  3FB9 A;  1K73 U;  2JJ9 A;  3DKM A;  3PVL A;  4N4I A;  3SEM A;  5FRO A;  1C1A A;  4LNP A;  3VRY A;  3ZEH A;  2EYW A;  1PCX A;  4TVR A;  2HMA A;  2LCL A;  1Q81 R;  2CRE A;  1BI0 A;  4R56 A;  3M0R A;  2BE9 B;  1DJ7 B;  3EAE A;  1BCO A;  1TG0 A;  2LT4 A;  2X3X D;  3CCV A;  1NLP C;  2H8H A;  3EGX B;  1JXM A;  5CKE A;  3JCM Q;  2VV5 A;  3ASK A;  4A4H A;  4FW1 A;  1ARK A;  1VQO A;  1K8A C;  4II1 A;  2COY A;  3RES A;  1KC8 C;  1AEY A;  2J6K A;  1UHF A;  4E47 A;  1BI2 A;  2KXD A;  1N27 A;  1LNX A;  2NYS A;  5LJ3 g;  1X69 A;  4Z02 A;  1M1F A;  1T0J A;  2GTJ A;  1SRM A;  1KIK A;  3OYJ A;  4OF1 A;  1VQL A;  3CD6 T;  3T9N A;  1G3T A;  2LVM A;  2BZ8 A;  1UJ0 A;  3MO8 A;  1N9R A;  2QYZ A;  3LGL A;  1X01 A;  3JCM c;  3NMZ C;  1OOT A;  5EG2 A;  1HD3 A;  4J9I A;  3FLG A;  3CCL Q;  2DX1 A;  1NEB A;  4OB2 B;  4M77 D;  3DLM A;  5FWB A;  1VQK A;  3CCR A;  1YIJ T;  1E7O A;  5KYN A;  2M0Y A;  2DZ9 A;  1VQP Q;  3BW1 A;  3CPF A;  1VQ7 A;  4LDX A;  1OPK A;  4BE1 A;  2DMO A;  4BE2 A;  2HKQ B;  1YWO A;  1IRE B;  2DJZ A;  1Q86 C;  2QI2 A;  4NS5 A;  3RER A;  2HEQ A;  5GMK j;  1Z9Z A;  1X2Q A;  2QK0 A;  4M75 B;  1M9S A;  1QMC A;  2M16 A;  5LJ3 j;  2JXB A;  1S72 A;  4J5Y A;  4XU0 A;  1N9S A;  1V1C A;  3REA B;  2KBT A;  3UDC A;  3G4S A;  4JRQ A;  1M3A A;  4C0Z A;  1Y07 A;  1ZUY A;  2DXU A;  5IHI A;  3CXC A;  4BUG A;  2XU8 A;  1C6V X;  4AMC A;  4EMK A;  1PSE A;  2QQR A;  4OVA A;  5I21 A;  1GCQ C;  4Q5W A;  1ZQ1 A;  4ZN3 A;  2EGE A;  3QXE B;  4LD9 K;  5GMK l;  1I5O B;  4E2F B;  4M7D A;  2JTE A;  3OS1 A;  5LJ5 d;  3BY7 A;  3OW2 A;  4JRI A;  4XTU A;  3HRT A;  2LRQ A;  2ZZD A;  1VIF A;  2XDB A;  2RO0 A;  4B9W A;  4OMP A;  2GGR A;  2LNV A;  2K7A A;  1PD0 A;  3QO3 A;  2R5A A;  1AWW A;  1VIE A;  1M1G A;  2VGN A;  2F2V A;  2LQN A;  2EKO A;  2RMO A;  2HSE B;  5LL6 S;  1KHC A;  2C06 A;  2COZ A;  1PKT A;  3OQ5 A;  3FJP A;  3QJ6 A;  3CBO A;  2EJ9 A;  4PKC C;  2XK0 A;  4Z89 A;  4JS4 A;  4EMG A;  3GPL A;  4A4K A;  4E7I A;  4FSX A;  5LJ5 j;  3CC2 Q;  4EDU A;  4C92 C;  3M0P A;  2KSS A;  3DB4 A;  2KT1 A;  2B8A A;  2EJG A;  3M58 A;  1UGR B;  3JCM P;  1BBZ A;  2AT1 B;  1I4K 1;  1LPL A;  2E5Q A;  1KD1 U;  2HD0 A;  3E9F A;  3GP8 A;  4OP0 A;  3VJP A;  3C95 A;  5KYX A;  4OB1 B;  3PVQ A;  1KG1 A;  3RKW A;  5LJ3 f;  2O4X B;  1QP2 A;  1O75 A;  2DTO A;  3RIR A;  2OTJ T;  2L3Q A;  2A7Y A;  3GNF B;  2A3L A;  3SWN B;  3CXC S;  3CD6 A;  3JCM J;  1JEG A;  1MMD A;  2M0O A;  2KRO A;  4M7D E;  2CS7 A;  2KMT A;  4OB3 B;  2RHX A;  4M7A D;  2RB6 A;  4OMF B;  3EGU A;  1IHV A;  3CCU T;  4IUR A;  5I2S A;  1BIA A;  1BB9 A;  2X4J A;  3GIB A;  1OYX A;  4PJO A;  4C8Q D;  3MP8 A;  3P8D A;  2EYY A;  3OW2 S;  3VKI A;  1YIJ A;  1FYN A;  2YHT A;  2PNI A;  3CCS T;  2CP6 A;  1VQ4 T;  1BU1 A;  5AYF A;  3CME T;  4P5N A;  2OTJ Q;  5CO7 A;  2LP5 A;  2QQS A;  2MK5 A;  4FM4 B;  1VQ6 T;  4LDW A;  1K1Z A;  1G3Y A;  4C5H A;  4RTV A;  2E3H A;  4PK4 A;  4PJN A;  1RAH B;  5A0G A;  2FHD A;  2D9T A;  2DK3 A;  3V8L A;  1WXT A;  2VWF A;  2YRC A;  4LDY A;  4M7D D;  2X3W D;  3OS5 A;  3I55 A;  1UGQ B;  4F17 A;  1D0Y A;  1Z9Q A;  2CUB A;  2NUP B;  1OX9 A;  1KQ1 A;  5HK3 A;  4M78 F;  3OYM A;  1UGV A;  1Q82 U;  3CMA Q;  3NTH A;  2HKN A;  4LDV A;  4R55 A;  3CC7 T;  3URG A;  2RHU A;  2F5T X;  3CCS Q;  3DB3 A;  3LGF A;  4E6R A;  2DPP B;  2LJ1 A;  2O88 A;  1IXD A;  2PQW A;  3JCM g;  1ZSG A;  5GAO p;  1OV3 A;  2L2P A;  3CCJ T;  1QLY A;  3UWN A;  3OYE A;  2QQA A;  2P0P A;  3REB B;  4E7L A;  5J3B A;  4C0D B;  2RHZ A;  3C4S A;  1ZA2 B;  3HRS A;  1W70 A;  4N4G A;  4C0F A;  3KBG A;  1H64 1;  4BI8 B;  1YI2 T;  1K76 A;  2EVR A;  2VB6 A;  5GAM g;  3L2R A;  4QQ6 A;  5KYW B;  1KD1 C;  1Q95 G;  4PJO E;  2NLU A;  3CC7 Q;  3E19 A;  3TCJ A;  2AIR B;  1UE9 A;  3VS2 A;  3TU4 K;  2QTX A;  4EMH A;  3VYH B;  2DJQ A;  3R6N A;  3H0I A;  1YHQ T;  1SG5 A;  1WFW A;  1YN8 A;  4E7Z A;  4M78 A;  3MPU B;  2H3J A;  3GNG A;  2ZPE B;  1GBQ A;  2KGT A;  2KXC A;  4RG2 A;  1B34 B;  1KQS A;  1WJQ A;  3RUX A;  5CAI A;  2ZGW A;  1OZ3 A;  2Y4X A;  5D6W A;  4JJB A;  4BDY A;  1BCM A;  3JCM V;  4LE9 A;  1YI2 Q;  1YIT T;  4AFQ C;  2KR3 A;  4F7U A;  5KYU B;  4HVW A;  4HXJ A;  3OMG A;  3CC4 A;  1LOJ A;  3PE0 A;  1MV0 B;  1N8R U;  2OI3 A;  3CCQ Q;  4GLK A;  2RI5 A;  6AT1 B;  2MCN A;  3PGG A;  3OYI A;  3VS3 A;  2F5K A;  3ULR B;  2Z0W A;  3NHN A;  3V7S A;  3CCV T;  3G7Z A;  2KYB A;  3V8J A;  2BKD N;  2OTJ A;  4D8D A;  4DEX A;  1YJN T;  1ZA1 B;  1KC8 R;  1UDL A;  2MMP A;  3OSS C;  4PLL A;  1WX6 A;  5FU6 C;  2ESW A;  4M78 G;  2RQV A;  2CZ0 B;  4ZNX A;  1VQO T;  1YIT Q;  1GXI E;  4ZGD B;  2EGC A;  3CCU A;  3VS4 A;  4BE0 A;  1TUD A;  4E7K A;  1VQ5 T;  3HFO A;  3VU3 C;  1AWX A;  1M90 C;  2D8J A;  5IH2 A;  3EGD A;  2ROL A;  2CSQ A;  4LN2 A;  2LDM A;  3EGX A;  3M57 A;  1U3O A;  2KYM A;  1VQL T;  5GAN g;  4QKU A;  4J9B A;  2DBK A;  3CCS A;  2ZPB B;  2DVJ A;  1VQ4 A;  2EBP A;  2LC4 A;  3A8G B;  3CME A;  3CCV Q;  4M78 E;  1VQ6 A;  2Y4Y A;  2FZK B;  2A28 A;  4QW2 A;  1K0X A;  4M75 F;  1NLO C;  1UHC A;  2COW A;  2ROT A;  1TWB A;  1Y71 A;  2KRS A;  4M77 F;  1WQW A;  1VQO Q;  3CCR T;  1JRI A;  4C92 A;  4RCC A;  1K8A U;  2CP0 A;  3OSV A;  1P92 A;  1KHI A;  3G1J A;  2GFU A;  1YNZ A;  5KH6 A;  2X4W A;  4F7U E;  5KE3 A;  4C5I A;  1KQS S;  4RUG A;  4A54 A;  1VYU A;  1VQL Q;  3CCM T;  4F16 A;  4RMO A;  2DET A;  4KGZ B;  2CT3 A;  4FIB A;  2C0T A;  3JCM f;  1SSF A;  1ZSZ B;  3MET A;  1XTD A;  2WAC A;  1K73 R;  1QP3 A;  3CCJ A;  1ACM B;  3G4S T;  4IUQ A;  4A63 B;  3CCR Q;  3UAT A;  1D3B B;  2VC8 A;  1J3T A;  1NJI U;  2VAS A;  4OMQ A;  3TVT A;  1U1T A;  4MZT A;  1QQJ A;  3VUB A;  2YSQ A;  4FSS A;  1YI2 A;  1MMG A;  3M59 A;  2B86 A;  4NL2 A;  2NUT B;  1N8R C;  4FT4 A;  5L23 A;  3AT1 B;  1HK9 A;  2QQ9 A;  2YUQ A;  2QTV A;  4PL6 A;  5GAN 8;  1Q86 U;  1YHQ A;  1B7T A;  2JVV A;  1Y7X A;  4OMO A;  3DLL A;  1S72 Q;  5GAO n;  3FC3 A;  2DTH A;  8AT1 B;  4Z88 A;  2K6D A;  5C0M A;  1D1B A;  2KNB B;  1AZG B;  4NOY A;  3QG1 A;  4CC3 A;  3G4S Q;  1QKX A;  3NFC A;  3EG9 B;  1D0Z A;  4J6W A;  2LQW A;  3EFO B;  3EG0 A;  2E70 A;  1Y57 A;  1YCY A;  2AZS A;  4X34 A;  4C92 E;  1QVF A;  4DEY A;  3TEE A;  1SKU B;  1AZE A;  5GAN 6;  4FW2 A;  4ZN1 A;  4JJN K;  4OB0 B;  2YDL A;  4ZTJ A;  1RAC B;  3U23 A;  5IT9 E;  1GL5 A;  2DKG A;  3MJX A;  2XKO C;  4M75 G;  2ED1 A;  1V29 B;  3RKY A;  2L3S A;  5GAM e;  3QUI A;  1ZX6 A;  4M77 G;  1ZBJ A;  3VS7 A;  1PRL C;  2MWO A;  5D6Y A;  4IUU A;  1YJN A;  1IZ6 A;  2HL3 A;  1QCO A;  2FPF A;  3E9G A;  3HSB A;  3CEY A;  2K3X A;  3M0T A;  1IRX A;  4F14 A;  2F69 A;  1Y0M A;  4JLI A;  3VRZ A;  1IO6 A;  1NPR A;  1VQN T;  3KUF A;  2V8K A;  2O31 A;  4RG8 A;  1T0H A;  1VQ5 A;  2AKL A;  3PFS A;  2JM8 A;  2G6F X;  2E6Z A;  2OTL T;  1BK2 A;  1ZUU A;  5D7U A;  2CDT A;  4LUE A;  1VQ8 A;  2EYQ A;  2PUK B;  2JN0 A;  2VKN A;  3PT9 A;  4MZP A;  1YJ9 T;  5HKC A;  2XMF A;  1XNI A;  1VQM T;  1FWZ A;  3A8M B;  1R0B G;  1RAE B;  5LJ3 d;  1RL2 A;  2O4X A;  5FU7 B;  2E3I A;  5IXF A;  2L89 A;  2BZX A;  4RCB A;  1MGQ A;  5GMK i;  3X28 B;  1NJI C;  3RDV A;  1VQN Q;  2XD0 A;  1MMA A;  3V7R A;  1NEG A;  4XTZ A;  3MEU A;  3QHS A;  3ZFJ A;  9ATC B;  4FYV B;  3JB9 J;  1MND A;  4M78 C;  2K5F A;  3L1A A;  4J9D A;  5GJW B;  4F04 B;  1W1F A;  2DE0 X;  4J6X A;  2KT8 A;  4LXC A;  2A08 A;  3CCM A;  1QVF S;  3CD6 Q;  5IHN A;  3X25 B;  3CPW A;  1YJ9 Q;  4MDX A;  2DRM A;  1TUG B;  1G2B A;  1B3Q A;  3I55 T;  1QWF A;  2PVG B;  4M77 B;  2RJE A;  2QEX A;  4KUL A;  1CKA A;  1KFZ A;  3PMT A;  2FG0 A;  5GAN e;  1NYG A;  1B07 A;  1RAA B;  2PVO B;  2HCK A;  3H9N A;  1YIJ Q;  1KJW A;  2EQU A;  3QSU A;  1M3B A;  2YLB A;  2ABL A;  2YT6 A;  3QII A;  2CKK A;  4J9E A;  3M9Q A;  2ZCF B;  2HDA A;  1UEC A;  2DIL A;  3FRN A;  4JZ3 A;  2VYT A;  3MEV A;  2ZAE A;  4AFZ C;  2DL8 A;  4J9F A;  3P8B B;  3A8O B;  3G6E T;  3BE3 A;  2EYZ A;  2BIV A;  3M4G A;  2R58 A;  4DQ2 A;  1OX8 A;  1M4Z A;  4JJC A;  1PWT A;  3I55 Q;  3OYD A;  3JB9 D;  1Q7Y U;  1KD1 R;  1AOJ A;  5HCK A;  4A53 A;  3IQL A;  2JOY A;  4BY6 B;  4C0G A;  2RPN A;  5AT1 B;  3HKS A;  3QPH A;  3D7S B;  2EAY A;  2K9G A;  4XAX B;  2K3B A;  4J83 A;  2RHY A;  1G3W A;  2KDS A;  3CXC P;  2JTF A;  4EPC A;  3LH0 A;  4XTY A;  1N6A A;  3A98 A;  1SSH A;  2K3Y A;  2YXY A;  5GJV B;  3JCM b;  3G6E Q;  3PNW C;  1NPP A;  2X4Y A;  1FMW A;  5KYW A;  3LWI A;  3OW2 P;  2J05 A;  3MKD A;  2XIC A;  4C8Q G;  1K9M C;  1AWJ A;  2DF6 A;  5D6X A;  1MUZ A;  3M53 A;  3CPW S;  2DIG A;  1QW1 A;  2DVE A;  2DYI A;  2KE9 A;  3CC4 T;  4BI3 A;  3MEA A;  1WLP B;  3PIP A;  1VQN A;  4X9C A;  3UT1 A;  4LDU A;  4OMM A;  2OTL A;  5LJ5 h;  1UG1 A;  1M3C A;  3WVE B;  2O01 E;  5KYU A;  4DBQ A;  1Q82 R;  1WDX A;  1S1N A;  2RHI A;  1YJ9 A;  1VQM A;  4HT8 A;  3HHT B;  1RI9 A;  4XU2 A;  3OYG A;  2M51 A;  2LJ0 A;  2LT1 A;  2ED0 A;  4M75 C;  3CC4 Q;  1SF9 A;  5FWC A;  4A4F A;  3EHQ A;  4VUB A;  1M2V A;  4D6W A;  1QWE A;  2RF0 A;  2LZ6 B;  4BAC A;  1PD1 A;  1RUW A;  2DEU A;  1W6X A;  2PVD B;  2OAU A;  3OYN A;  2EW3 A;  1M8V A;  2HZY A;  3E2U A;  1JU5 C;  2EQJ A;  2KVQ G;  4CRI A;  3OYB A;  3QZ9 B;  4M7A B;  1WHJ A;  2KY9 A;  2QG9 B;  4J7F A;  3A8L B;  1Q7Y C;  2P4R A;  1YBY A;  1EX4 A;  3O8V A;  4XU1 A;  3CCU Q;  4C8Q B;  1PHT A;  3QBY A;  5ECA A;  1M90 U;  3EH2 A;  1RAB B;  5DM7 R;  1WXB A;  3RBB B;  3ZBD A;  2J06 A;  4FYY B;  3GBQ A;  1LCK A;  1LVK A;  1VQ4 Q;  1WPY A;  4EMK B;  3CME Q;  3EFR A;  2EJF A;  3MP6 A;  1VQ6 Q;  3LW5 E;  2XG8 D;  5GAO l;  2JMC A;  3G6E A;  4M7D B;  1RLP C;  4N4H A;  2EQK A;  4KBM B;  1XQH A;  2DEQ A;  2AZV A;  5IXB A;  2VXF A;  1G3S A;  1N8R R;  5A0L A;  3S3O A;  3FDR A;  3M56 A;  5CKD A;  2FYK A;  1I07 A;  3EG1 A;  2HNI A;  3JCM d;  5KCH A;  1C0M A;  3FEO A;  1X2K A;  1ZSZ A;  3CCE T;  2CZ6 B;  2SEM A;  1I8F A;  5CKF A;  3ME9 A;  4BDZ A;  4PJJ A;  4OGE A;  4RTT A;  1X43 A;  4MMK A;  3QWX X;  1WHH A;  3H8Z A;  4JJD A;  3EG2 A;  2EGA A;  2LTO A;  5CR2 A;  1WI7 A;  4IIO A;  4UC4 A;  4HCC A;  3VS1 A;  2AKK A;  1WJS A;  3CCJ Q;  2E5K A;  1M30 A;  2GCX A;  1GRI A;  2NUT A;  3C0C A;  3KFV A;  1ZHI A;  3I5S A;  3SWN C;  4HKE A;  2CUD A;  4XK8 E;  3PTA A;  1RI0 A;  2X35 A;  1X6G A;  2ATC B;  3TSW A;  2KEA A;  4Y91 A;  1I0C A;  5KYY B;  2D0N A;  4PJO D;  4XTW A;  1Y96 B;  4AFU C;  3OY9 A;  5LJ5 e;  1CSK A;  1F1B B;  4FU6 A;  1BI3 A;  1YHQ Q;  3EG9 A;  4KH1 B;  2C0O A;  4MZM A;  4ESR A;  1H92 A;  5GAM j;  3CQT A;  2EQI A;  1ZBX A;  4MML A;  1NG2 A;  1ABO A;  3C94 A;  1K8A R;  1EFN A;  4HVV A;  2LJ3 A;  2YRV A;  2P84 A;  3O5Z A;  2DIQ A;  3S3N A;  1KQS P;  3TSZ A;  3JCM X;  1UJY A;  3G71 T;  2FB7 A;  4GY5 A;  3L2Z A;  2E4H A;  3PMI A;  3MCA B;  1NE8 A;  3M0U A;  4PJO B;  4XU3 A;  2G3R A;  1RAF B;  5DY9 A;  1BIB A;  2E1H A;  4DOW A;  4ELZ C;  2MF2 A;  3NTI A;  3F70 A;  3LWH A;  2DFU A;  2GBQ A;  2ENM A;  1VQ8 T;  1AT1 B;  3EHR A;  3THK A;  1GFC A;  1QVP A;  1UTI A;  1NJI R;  4HA8 A;  2P0K A;  1G8X A;  1YJN Q;  1ZUK A;  3FJ5 A;  1H3H A;  1K0S A;  4CC7 A;  1H3Z A;  4EIK A;  3QWY A;  1PM3 A;  1QVG A;  1N5Z A;  2CH4 A;  2MWP A;  1VQ5 Q;  2DL3 A;  3NTK A;  1JQQ A;  1GBR A;  1Q86 R;  2MAM A;  2HBW A;  4C0D C;  1QCN A;  3X24 B;  4ANJ A;  4QT7 A;  2GTO A;  1EIF A;  2QA4 T;  1SPK A;  2KQW A;  4X1V A;  2E12 A;  1VQ8 Q;  3M0Q A;  2RA2 A;  4AG2 C;  3BDU A;  4JDS A;  4BD3 A;  1R0C B;  2QQB A;  3N5B B;  1ABQ A;  1TTH B;  1TU0 B;  3JB9 H;  1BI1 A;  4HT9 A;  2RQU A;  3JV3 A;  1CKB A;  2VGM A;  5C6S A;  2GFA A;  4M78 D;  3L2W A;  2EPD A;  2QXF A;  2QEX T;  3J7A F;  1WYX A;  2RI3 A;  5GAN j;  2R5M A;  2RK2 A;  3AHU A;  3M4Y A;  3OYL A;  1KQ2 A;  1I5L A;  2IVW A;  2NUZ A;  4ZGE B;  2GF7 A;  1W4S A;  1GCP A;  1YWP A;  4XTV A;  4ZTF A;  2RQW A;  3Q1J A;  2F1L A;  5GAM f;  2LCS A;  1FMK A;  3A1P A;  1U06 A;  3HPW A;  4M75 A;  3CCE A;  4V2S A;  2FZC B;  4MDW A;  3HL8 A;  1JJ2 A;  3CCM Q;  1UGP B;  4M77 A;  3H0H A;  2DL4 A;  1E6G A;  1R8O B;  5IAY A;  3H41 A;  1OU9 A;  2X9H A;  3JB9 F;  4D8K A;  2H3E B;  2QEX Q;  1XOV A;  4KRT A;  3INZ A;  2JMA A;  4X9D A;  2E65 A;  3PIO A;  4O5V A;  4L5G A;  1OPL A;  5DLQ E;  2K4Y A;  3OB9 A;  3SB2 A;  2P4T A;  3SHW A;  2GQV A; 
#chains in the Genus database with same CATH homology
 2ABL A;  2PNI A;  2YT6 A;  4J9E A;  2YUP A;  1BU1 A;  2HDA A;  1UEC A;  2DIL A;  1VYV A;  2LP5 A;  1K4U S;  4JZ3 A;  4K11 A;  1M8M A;  1K1Z A;  3UF4 A;  4RTV A;  2V1R A;  3VS0 A;  1GCQ A;  4AFZ C;  2DL8 A;  4J9F A;  1JO8 A;  1A0N B;  5I22 A;  2EYZ A;  1WXT A;  2VWF A;  1U5S A;  2CH4 W;  4JJC A;  1PWT A;  2LNH B;  2X3W D;  2DLP A;  2VVK A;  4F17 A;  1AOJ A;  1Z9Q A;  2FRY A;  2CUB A;  1TUC A;  2F2X A;  5HCK A;  4Z8A A;  4LUD A;  2J7I A;  3IQL A;  2O2O A;  2RPN A;  2JS0 A;  1UGV A;  3UA6 A;  2DRK A;  2V1Q A;  2J6F A;  2K9G A;  2PTK A;  2FPD A;  4HVU A;  2K3B A;  4E6R A;  2GQI A;  1K9A A;  3EG3 A;  3A98 A;  2LJ1 A;  1SSH A;  2O88 A;  5GJV B;  2JS2 A;  1ZSG A;  2RNA A;  1E6H A;  4R0K A;  1OV3 A;  2L2P A;  1QLY A;  3REB B;  2FPE A;  2PZ1 A;  1T3S A;  1W70 A;  2J05 A;  4OML A;  2GNC A;  1AWJ A;  2DF6 A;  4Y92 A;  1MUZ A;  1K76 A;  2EVR A;  2OJ2 A;  1I1J A;  2KRN A;  2KE9 A;  2DA9 A;  1UE9 A;  1WLP B;  3VS2 A;  2DJQ A;  3R6N A;  4GBQ A;  3H0I A;  1WFW A;  1YN8 A;  5FW9 A;  4OMM A;  2EYX A;  1YCS B;  1WA7 A;  2RQT A;  4JZ4 A;  1OEB A;  1UG1 A;  1GBQ A;  1M3C A;  2KGT A;  2KXC A;  1UUE A;  2DL7 A;  2DYB A;  1X27 A;  1WDX A;  1S1N A;  1SRL A;  2MOX A;  4JJB A;  4M4Z A;  1RI9 A;  4LE9 A;  3ZL7 C;  2KRM A;  2M51 A;  2LJ0 A;  1VA7 A;  4AFQ C;  2KR3 A;  3NGP A;  2ED0 A;  4HVW A;  4HXJ A;  3VS5 A;  1X6B A;  5FWC A;  4WCI A;  3EHQ A;  3PE0 A;  1HSQ A;  1MV0 B;  2A36 A;  1QWE A;  2OI3 A;  2RF0 A;  1G83 A;  1SEM A;  2LZ6 B;  2MCN A;  1PRM C;  1RUW A;  1W6X A;  3VS3 A;  3ULR B;  1QCF A;  2JM9 A;  2EW3 A;  4AG1 C;  3NHN A;  5I11 A;  2KYB A;  1JU5 C;  4D8D A;  1KSW A;  1SHG A;  5IHK A;  2F2W A;  4DEX A;  1UDL A;  2IIM A;  2W10 A;  5EC7 A;  1WX6 A;  2K2M A;  2RQR A;  2ESW A;  2RQV A;  4ZNX A;  2BTT A;  2P4R A;  1H8K A;  2FEI A;  2AK5 A;  3I35 A;  2EGC A;  2RN8 A;  3VS4 A;  1TUD A;  1PHT A;  3PVL A;  4JPB W;  1AWX A;  1PNJ A;  2D8J A;  5IH2 A;  3SEM A;  5ECA A;  4LNP A;  2ROL A;  2CSQ A;  4LN2 A;  3VRY A;  2EYW A;  2BZY A;  1WXB A;  3RBB B;  1U3O A;  2CRE A;  2J06 A;  2KYM A;  4J9B A;  2DBK A;  3M0R A;  3GBQ A;  1LCK A;  2DVJ A;  1TG0 A;  2EBP A;  2X3X D;  2DNU A;  1QKW A;  2L3P A;  1NLP C;  2H8H A;  4CC4 B;  1JXM A;  2A28 A;  1K0X A;  2JMC A;  1NLO C;  1UHC A;  2ROT A;  1RLP C;  2JT4 A;  2KRS A;  4ORZ A;  1ARK A;  1HJD A;  2AZV A;  5IXB A;  3LH5 A;  1AEY A;  2J6K A;  1I07 A;  3EG1 A;  1UHF A;  1YNZ A;  2KXD A;  2SRC A;  4RUG A;  1X2K A;  1X69 A;  1VYU A;  2SEM A;  1T0J A;  2D8H A;  1SRM A;  2GTJ A;  1M27 C;  1KIK A;  4F16 A;  4RTT A;  1X43 A;  3QWX X;  2BZ8 A;  1UJ0 A;  2CT3 A;  2C0T A;  4JJD A;  1JXO A;  3EG2 A;  2EGA A;  3NMZ C;  1WI7 A;  4IIO A;  1OOT A;  1HD3 A;  4GLM A;  3VS1 A;  4J9I A;  2DX1 A;  1NEB A;  1MV3 A;  2AKK A;  2E5K A;  1M30 A;  1GRI A;  4A63 B;  3H0F A;  5FWB A;  2MIO A;  3UAT A;  1J3T A;  3C0C A;  3KFV A;  2DL5 A;  1E7O A;  3I5S A;  2M0Y A;  4OMQ A;  3TVT A;  2CUD A;  3VS6 A;  1UFF A;  2HSP A;  3UA7 A;  1X6G A;  2YSQ A;  3TSW A;  4FSS A;  2C0I A;  2KEA A;  1I0C A;  1OPK A;  2B86 A;  2DMO A;  1YWO A;  2D0N A;  1WIE A;  2J6O A;  5L23 A;  2CSI A;  2YUQ A;  4AFU C;  1CSK A;  2YUN A;  2I0N A;  2HEQ A;  1Z9Z A;  1X2Q A;  2LMJ A;  2C0O A;  4CC2 A;  4ESR A;  1AD5 A;  1H92 A;  3CQT A;  2EQI A;  4OMO A;  2JXB A;  1NG2 A;  1ABO A;  3I5R A;  4Z88 A;  2EKH A;  2K6D A;  1V1C A;  2KNB B;  1AZG B;  1EFN A;  2JW4 A;  4HVV A;  4OMN A;  4CC3 A;  2LJ3 A;  2KBT A;  3REA B;  1QKX A;  3O5Z A;  1M3A A;  2LQW A;  3TSZ A;  1UJY A;  3EG0 A;  2W0Z A;  1Y57 A;  1PKS A;  2AZS A;  1ZUY A;  1AVZ C;  5IHI A;  4J9H A;  2ECZ A;  2QDL A;  4DEY A;  2O9V A;  3I9Q A;  1AZE A;  2FRW A;  3M0U A;  1YP5 A;  2YDL A;  4J9C A;  3U23 A;  1GCQ C;  4RTU A;  1GL5 A;  2EGE A;  2GBQ A;  2ENM A;  2JTE A;  2ED1 A;  3EHR A;  2L3S A;  3THK A;  1GFC A;  1ZX6 A;  1UTI A;  1ZBJ A;  3VS7 A;  1PRL C;  2L0A A;  1ZUK A;  3FJ5 A;  1H3H A;  4J9G A;  3NPF A;  1K0S A;  2FPF A;  4CC7 A;  4OMP A;  4EIK A;  2GGR A;  3M0T A;  4F14 A;  3QWY A;  1N5Z A;  1Y0M A;  2CH4 A;  2K7A A;  1IO6 A;  3VRZ A;  2O31 A;  1AWW A;  2DL3 A;  1GBR A;  1JQQ A;  1T0H A;  2AKL A;  2F2V A;  2LQN A;  2HBW A;  2RMO A;  4RTY A;  1PKT A;  2JM8 A;  2G6F X;  4QT7 A;  3RNJ A;  2GTO A;  4Z89 A;  2O9S A;  1SPK A;  1BK2 A;  4X1V A;  1ZUU A;  3M0Q A;  1RLQ C;  2CT4 A;  2CDT A;  4LUE A;  1SHF A;  4AG2 C;  1VYT A;  2VKN A;  2FO0 A;  1ABQ A;  3M0P A;  1NM7 A;  3M0S A;  2RQU A;  2XMF A;  2KT1 A;  3JV3 A;  1CKB A;  2EPD A;  2LX7 A;  1WYX A;  2YUO A;  5IXF A;  1BBZ A;  2BZX A;  2K79 A;  4HCK A;  2NUZ A;  1NEG A;  1GCP A;  1GFD A;  3PVQ A;  1YWP A;  4RTX A;  2RQW A;  2A37 A;  2NWM A;  1AWO A;  2LCS A;  1FMK A;  1U06 A;  4J9D A;  5GJW B;  1W1F A;  2DE0 X;  4IIM A;  2KT8 A;  2L3Q A;  2A08 A;  2DL4 A;  3H0H A;  1E6G A;  5IHN A;  2DM1 A;  1JEG A;  1NYF A;  1WXU A;  2KRO A;  3H41 A;  4RTW A;  1ZLM A;  2DRM A;  1G2B A;  1B3Q A;  3EGU A;  4D8K A;  1QWF A;  4RTZ A;  1XOV A;  4KRT A;  1BB9 A;  2DBM A;  1CKA A;  1KFZ A;  2FG0 A;  2JMA A;  1NYG A;  1B07 A;  2HCK A;  4AFS C;  1OPL A;  2EYY A;  1T3L A;  1KJW A;  2OAW A;  1FYN A;  3SHW A;  2D1X A;  1M3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...