1T0JA

Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
RREAERQAQAQLEKAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords voltage-gated calcium channel subunit beta2a
total genus 23
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12052 VGCC_beta4Aa_N Voltage gated calcium channel subunit beta domain 4Aa N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1t0jA00
1S1NA 4J9CA 1E7OA 2EYXA 1A0NB 2BZYA 1YWPA 1I07A 4LNPA 1BB9A 2ED0A 2AKKA 1PNJA 3EHQA 2RMOA 1VYUA 2FRWA 2I0NA 4JZ3A 1IO6A 2L0AA 2J6OA 1WLPB 3TSZA 2A08A 2DL5A 1WXUA 3I35A 1HSQA 3VS5A 1X2KA 2HCKA 2EVRA 4LE9A 4AG1C 2MOXA 1UHFA 2EGEA 4F16A 2DL4A 1ABOA 3VS3A 2W10A 2CH4A 1SPKA 1TG0A 2DRMA 1QCFA 2HDAA 2RQTA 2DBKA 1PRMC 4Z8AA 2FG0A 1X69A 1ZUYA 4J9HA 2K9GA 1U5SA 4OMQA 1T3SA 1HD3A 2DVJA 1ARKA 1AZEA 4JPBW 1YWOA 4J9BA 4CC4B 1M3CA 2RPNA 4HCKA 3C0CA 4OMLA 3UA7A 3UATA 3QWYA 4RTUA 2O9SA 3EG3A 1JQQA 3PVLA 1H8KA 2DYBA 1ZUKA 2YUOA 3U23A 1ABQA 1MV0B 3I5SA 3NMZC 2KR3A 3M0QA 1I0CA 2FPDA 3REAB 3M0SA 3VS2A 2GTJA 2VVKA 1UG1A 4GLMA 1K9AA 2A37A 4AFQC 1GCQC 2CT3A 1XOVA 2OAWA 2PNIA 5EC7A 3PVQA 3NPFA 4OMMA 1GBRA 2AK5A 1SEMA 4JZ4A 1QWEA 1ZSGA 4ORZA 4J9DA 1GCQA 2BZXA 5I11A 2EKHA 2KNBB 2GTOA 2F2VA 3TVTA 1SRLA 1KJWA 2HBWA 2DLPA 2DNUA 2EGAA 1ZLMA 2EYYA 2J6FA 1AWXA 1V1CA 4D8DA 2SEMA 4ZNXA 1M30A 3H0FA 2LQWA 5FW9A 1EFNA 2YSQA 2JM8A 2D1XA 2JT4A 4D8KA 3CQTA 4RTWA 4LN2A 2IIMA 2LJ3A 2DMOA 2KXCA 5FWBA 1KFZA 1E6HA 3EG2A 5GJWB 2LJ1A 2JMAA 1UE9A 2KROA 1UUEA 1Z9ZA 1K0SA 4A63B 1G2BA 1PWTA 2KE9A 2RQUA 3H0HA 3M0RA 1WIEA 1VYVA 2LP5A 3VS7A 1MV3A 2O88A 3M0PA 4RTYA 5IHIA 2A36A 1M3BA 1RLQC 1GL5A 2G6FX 2K7AA 2HEQA 1TUDA 1WFWA 1UDLA 2B86A 1W1FA 2RQVA 4R0KA 2JS2A 2CSIA 1SRMA 1RI9A 2DRKA 2QDLA 2MIOA 1VA7A 2L2PA 2X3XD 1SSHA 1KSWA 1UGVA 3TSWA 2EQIA 3I9QA 1B07A 2J6KA 4HXJA 3UF4A 2LJ0A 1X6GA 3SEMA 1M3AA 4K11A 1PHTA 2J05A 1BBZA 1X2QA 1Z9QA 3VS4A 1WXBA 5IXFA 2RNAA 1WXTA 4X1VA 4DEXA 2FEIA 1YCSB 4OMNA 2YUPA 4KRTA 1PRLC 3M0TA 4HVWA 3VS6A 4CC2A 2RN8A 2O31A 1NEBA 2DA9A 2DL7A 4GBQA 4AFUC 5IXBA 1TUCA 2FPEA 4E6RA 1KIKA 2VKNA 4J9FA 4HVUA 4F17A 4M4ZA 4RTXA 3GBQA 2DJQA 3A98A 1CKAA 1JU5C 4LUDA 1WYXA 2YUNA 1K4US 3VS1A 3ZL7C 4CC7A 1ZBJA 2L3PA 1BU1A 4DEYA 2KRMA 2ENMA 1YNZA 2FPFA 2KT8A 1X43A 2VWFA 2OJ2A 1HJDA 4J9EA 3O5ZA 2ESWA 2KT1A 1AWWA 1NYGA 4RTVA 1PKTA 1FYNA 1GRIA 2CUDA 1GFDA 2MCNA 5FWCA 1UJ0A 2DF6A 4FSSA 2KRSA 1T3LA 1ZUUA 1T0HA 3FJ5A 1CKBA 2GQIA 2DBMA 1OV3A 1ZX6A 2XMFA 4RTTA 1FMKA 2YDLA 4J9GA 1M27C 4OMOA 1JXOA 1W6XA 1AWOA 2CSQA 2DM1A 2DILA 3ULRB 1E6GA 2CREA 3EGUA 2O2OA 1AZGB 2EBPA 3PE0A 1CSKA 4OMPA 4QT7A 1NG2A 2A28A 1QLYA 4HVVA 1UTIA 3RBBB 1AWJA 5ECAA 4JJCA 2JS0A 1WI7A 3IQLA 1WDXA 1J3TA 1G83A 2DX1A 1QWFA 2KYBA 4J9IA 1GCPA 3H0IA 2AZSA 2LMJA 1AD5A 2PZ1A 2W0ZA 2NUZA 3UA6A 2LCSA 2CT4A 2J7IA 1OPKA 1NLOC 1W70A 4WCIA 2M51A 2AZVA 2GNCA 4JJDA 3QWXX 1I1JA 2ABLA 3SHWA 4RTZA 2JMCA 2K6DA 3EG0A 2C0OA 1RUWA 2JXBA 2RF0A 1AVZC 2FO0A 4AFZC 2JTEA 3KFVA 1Y0MA 2ECZA 2PTKA 1WX6A 4Z89A 2DL3A 2LQNA 2BZ8A 2KEAA 3VS0A 1UJYA 1AOJA 1WA7A 2YT6A 1LCKA 2EGCA 2ED1A 3EHRA 5I22A 2ROTA 1JXMA 3I5RA 2GBQA 2D0NA 5IHNA 2J06A 1T0JA 4IIOA 2H8HA 1K0XA 1Y57A 2KBTA 1M8MA 1GFCA 2RQRA 4JJBA 1K1ZA 2DE0X 1QKXA 2V1RA 2SRCA 2F2WA 2KGTA 3M0UA 2E5KA 2RQWA 2EYWA 2P4RA 1H3HA 1X27A 2O9VA 2JM9A 4IIMA 1U06A 1NEGA 4AFSC 3NHNA 4EIKA 2BTTA 1OEBA 2KXDA 1MUZA 2K2MA 2LZ6B 5IH2A 2EPDA 4Y92A 2LNHB 1H92A 3R6NA 1X6BA 3VRYA 1JO8A 2L3QA 2X3WD 1OPLA 2DL8A 1UHCA 2YUQA 4ESRA 2AKLA 2NWMA 2HSPA 5HCKA 1UECA 2C0IA 2K3BA 1U3OA 2K79A 3NGPA 1QKWA 3REBB 3LH5A 5L23A 2C0TA 1BK2A 1NLPC 2F2XA 1UFFA 1NYFA 1SHGA 3JV3A 4LUEA 1YN8A 1YP5A 2LX7A 1SHFA 4F14A 4Z88A 4CC3A 2EW3A 3EG1A 1GBQA 1N5ZA 1NM7A 2CUBA 2KYMA 1OOTA 2ROLA 2CDTA 1B3QA 2KRNA 1K76A 2L3SA 1PKSA 1RLPC 1VYTA 5IHKA 3THKA 2EYZA 4RUGA 1AEYA 2JW4A 1JEGA 2FRYA 2GGRA 2M0YA 3RNJA 4AG2C 2CH4W 2V1QA 3H41A 2OI3A 2D8HA 2D8JA 5GJVB 3VRZA
chains in the Genus database with same CATH superfamily
5DM7R 4XU3A 3RMSA 2YLBA 1A0NB 4CRIA 4DOWA 1VYUA 5CAIA 4NL3A 1YHQA 4JZ3A 2X35A 2A3LA 5CKHA 1U1TA 2L0AA 2RK2A 2DERA 3KBGA 1WLPB 1Q81R 1VQNQ 3ER0A 2AHJB 1YI2T 4M78G 4NOYA 4PFOA 4C8QC 1NPPA 2X4YA 1WXUA 2YLCA 3VS5A 4TVRA 4OGEA 6AT1B 4XK8E 1VQ5A 2EGEA 2DL4A 1ABOA 4B9WA 1U1SA 2CH4A 1TS9A 1H3ZA 1TG0A 2ATCB 2DRMA 2HDAA 1JRIA 2RO0A 1M90R 1G3WA 4EDUA 4PJOF 2DVEA 2K9GA 1U5SA 3L2QA 1IXDA 1HD3A 2DVJA 3BY7A 4C0DB 1AZEA 4J9BA 4CC4B 4C8QE 3MEAA 1LNXA 3UA7A 5GAOr 3UATA 1YITT 2O9SA 3HFOA 1JQQA 4M7DC 2CGHA 3JB9G 3HP9A 2DYBA 1ZUKA 2YUOA 3NMZC 3M0QA 4RMOA 4C5GA 3CC7A 2ZPBB 2CYZB 2QQBA 1NJIR 5GANe 1YI2Q 5CQXA 2A37A 1WHGA 3C12A 1XOVA 5EC7A 1B34A 4JLIA 3META 2GFAA 1IGQA 1QVFA 4ORZA 5GANd 4R56A 1QVGP 5I11A 2KNBB 1B7TA 5KE3A 3I56Q 4UC4A 2NYSA 2EYYA 1ZLMA 1I4K1 4MZPA 1Q7YC 3H0FA 4Q5WA 2YSQA 2IVWA 2F1LA 4RTWA 2K5FA 3OBWA 3E19A 5FWBA 4BE1A 5CIUA 1FXXA 5GMKl 1WHLA 3ME9A 2KROA 5GAN3 3R6OA 4A4GA 1QVGS 5GAOn 5CCAA 1G2BA 3M55A 4HT8A 5KCOA 4Z02A 3L2VA 1LOJA 3I55A 1ZSZC 3VS7A 3G6EA 1RAEB 1MNEA 1MV3A 3WVDB 2RB6A 5GMKh 3S3OA 3M0PA 3S3NA 5IHIA 3EGDA 2Y4YA 2HKQB 2K57A 3OQ5A 4DA4A 3JB9H 3PGGA 3JCMh 4FYWB 2DEQA 1TOVA 3OS0A 1WZOA 2P84A 1RI9A 2DRKA 5GAN4 4IKFA 3G71A 1PCXA 3GLXA 4V2SA 4M78B 1M8VA 1W2BA 2HSEB 3PIOA 1Q82U 3TCJA 3CCJQ 1Q81C 1VQPT 3GPLA 3RERA 5KYWA 1M3AA 3PT9A 3CC4Q 3QYHB 5J39A 5IXFA 3M5AA 1HK9A 2EKOA 2JNGA 3OYMA 1V76A 3WXMB 2HKNA 1ZHIA 4KRTA 1PRLC 2D6FA 5CO7A 2O31A 1NEBA 2XU8A 4HT9A 3JB9J 1JB0E 1WPYA 4KGZB 5A0GA 2CP5A 4E6RA 1XQHA 3HRUA 4HVUA 3CCRQ 5D7UA 2DJQA 1JU5C 4LUDA 4M75G 1WYXA 4LDYA 2A7YA 1MMDA 2LQ8A 4E7SA 2RA2A 2L3PA 1BU1A 4PLLA 4DEYA 2ENMA 4BB7A 3JCMd 3E9GA 1YJ9A 2QQAA 3CD6Q 3NFCA 2OJ2A 4J9EA 3I55Q 1TUGB 2KT1A 4E7LA 1NYGA 1GRIA 2CUDA 1VQPQ 3PNWC 1UJ0A 2VGNA 4IUTA 3EFOB 5GAMd 3QYGB 3CC4T 1ZUUA 1M1KU 1M4ZA 1T0HA 2PVOB 2DBMA 3HRSA 2QTXA 1M27C 2LT4A 2RJDA 2QA4A 1QQJA 1JXOA 4ATOA 2DILA 5KYWB 3VYGA 3X24B 2GQVA 2E6ZA 3EGUA 3L2RA 1M90C 3CBMA 1G3SA 4OMPA 4QT7A 2MF2A 1QLYA 1TTHB 1UTIA 4HVVA 1AWJA 5ECAA 3CCRT 4M77A 3OB9A 4ZN1A 2MYSA 2VB6A 1QWFA 4J9IA 2PU9B 3CBOA 4M77C 3JB9F 1YJNT 2W0ZA 2LCSA 1Q7YU 1EX4A 2J7IA 1ACMB 4BI4A 2PUOB 1QVFS 2IPOB 2GFUA 4WCIA 2M51A 3BDUA 1BI1A 3SWNC 2GNCA 1SG5A 4KT0E 2JMCA 3HHTB 4QVCA 2FO0A 4AFZC 4LD6A 2CKKA 2JTEA 5FLXE 4EMKC 3OYGA 3MCAB 5FROA 2LCLA 2B8AA 1NJIU 1PSEA 2KEAA 5HK0A 1FX7A 3HFNA 4F7UF 2K5IA 2XI9A 1KC8C 3EHRA 1DJ7B 1X6OA 2R58A 2K5LA 1VIFA 4BACA 1M5Q1 2F69A 5KYXB 2J06A 1Q82R 1Y57A 4C8QA 2DXUA 4IUUA 2DE0X 1VQ6A 3CCQA 3FLGA 3M0UA 2KGTA 1X27A 3MP1A 2O9VA 2JM9A 1FMVA 5LJ3h 2LX9A 2E3IA 1MUZA 1Q7YR 1Q82C 4PJOA 3OSSC 2LZ6B 4Y92A 5L8RE 5DLOA 1H92A 2L3QA 1OPLA 2DL8A 4KGXB 1UHCA 3TREA 2QEXA 4ESRA 4HCCA 2RI3A 4PJOC 1VQ7Q 1UECA 2K3BA 2WSEE 3EFRA 1QKWA 2Y90A 4M77F 1IZ6A 3E9FA 3QHSA 8ATCB 4WF2A 4PKCC 5L23A 4XTVA 1UFFA 3TU4K 1SHGA 3CCUQ 2CZ0B 3GF5A 2ZZDA 4F14A 3CCEQ 2FZKB 2EW3A 3EG1A 1GBQA 3VKIA 4PL6A 2CUBA 1NM7A 4FCYA 1K73C 1QVGA 2ROLA 2KRNA 3OYNA 1K76A 1VYTA 1VQ9T 1YITA 5J3BA 4RUGA 1U8RA 4M7AF 2FRYA 2GGRA 2M0YA 3RNJA 4AG2C 2CH4W 2RHZA 3OYCA 4MDWA 2YRDA 1NBEB 1N27A 3G4ST 1IHWA 3VYHB 1YWPA 1LVKA 2KVQG 1I5OB 2ED0A 2QK0A 3EHQA 2D0QB 4FYXB 4PJMA 4QW2A 3M4GA 1IRXA 1VQLQ 4BY6B 4M78A 2DIGA 3TSZA 1ZQ1A 2EWNA 3G6ET 2A08A 3M9QA 1NZ9A 3CCVQ 4LDXA 3I35A 3JCMX 1HSQA 3GNGA 2KDSA 1X2KA 3OYDA 2HCKA 1OULA 2QTVA 2QA4T 1UHFA 4B6MA 3OYEA 1B34B 1RAHB 3VS3A 2E4HA 2ZCFB 3V8JA 5GAOm 2W10A 2DJZA 3CPFA 3CCSA 1Q95G 2DBKA 4J6YA 1PRMC 1M90U 3GOXA 2E65A 1YJNA 5GAN5 4XU0A 1JJ2P 1R0CB 1YWOA 2E3HA 1RACB 4OMLA 5GAOq 3LWIA 1HXDA 4FM4B 5LJ5d 4PJOB 3X28B 1AT1B 2CZ7B 3JCMf 1KQ2A 3ZBDA 1YHQT 2COWA 2EQUA 2RI5A 1KHIA 3HSBA 3REAB 2HMAA 3M0SA 1Q86U 1NPRA 1BI2A 2GTJA 1UG1A 1K9AA 3PMIA 2CT3A 2PNIA 4FT4A 3PVQA 3QZ5B 3NPFA 4ME7A 4OMMA 2AK5A 1SEMA 1O75A 2M1HA 2EKHA 3TVTA 4PJOE 1D0ZA 4M7DG 3QDRB 2HBWA 3M54A 2JOYA 2EQMA 2EGAA 3HPWA 1BIBA 4Y91A 1PSFA 3JCMW 2DAQA 1EFNA 4M7AC 2YHTA 5GMKi 2IIMA 3PFSA 2DMOA 4ELZC 2VASA 3RR6A 5FRMA 1KFZA 4M7AA 1UEBA 3OYKA 4J8OA 3CMEQ 2YXYA 1F1BB 4EPCA 2GCXA 1VQKA 1PWTA 4L59A 1XJWB 3CCSQ 2RQUA 3BDLA 1WIEA 4JDSA 2KAFA 3FDRA 2KY9A 5KH6A 5CVIA 4RG2A 3A8OB 2A36A 1M3BA 1RLQC 4M75D 2HEQA 2OAUA 1TUDA 3GNFB 1UDLA 1KD1U 1VQKT 2HAXA 4C8QF 2CS7A 5D6YA 2BIVA 1IB8A 2CSIA 2DTHA 1SRMA 5KE2A 2L2PA 2KSSA 3JCMg 3V8KA 3CXCP 4PJOG 1SSHA 1K73U 4RKUE 1B07A 2J6KA 2DFUA 3UF4A 2LJ0A 4DBHA 2OTLQ 3H6ZA 3A8GB 3SEMA 3JCMc 2BKDN 2JJ9A 4K11A 1PHTA 1UGRB 1X2QA 2RJEA 4N0AC 1WHKA 3NTIA 1OI1A 4PJJA 3QSUA 2RNAA 5KYNA 4X1VA 4KUDK 4DEXA 4FW2A 5CK9A 1YCSB 4F7UA 4N0AA 1YJ9Q 2YUPA 4FYVB 4O6JA 5A0DA 3M0TA 5KCHA 2RN8A 4C92G 5IAYA 4C5IA 1I81A 3UWNA 1FWZA 3HL8A 2DL7A 1VQPA 1W2BS 1OU8A 1TUCA 1OX9A 2QQ9A 3MEVA 4IUPA 2IG0A 2QDYB 1RAIB 4KH1B 4J9FA 2KMTA 1S72T 4RTXA 4ELYC 2BUDA 3A98A 3CC4A 1I5LA 2YUNA 1K4US 4EMKA 3LGFA 2BE9B 3QJYA 1G3TA 4XQ3A 2EIFA 3NTKA 2KT8A 2VWFA 3CPWP 2H3EB 1LPLA 4KUIA 3M53A 1VQOT 4RTVA 1PKTA 4DBFA 2M02A 1YI2A 1GFDA 5FU7B 5FWCA 3CCVA 1WHHA 1LJOA 1P92A 1Y96A 4J6XA 3J81E 1MNDA 2GQIA 2NUTB 4RTTA 4MDXA 2HL5C 4FYYB 4OMOA 2O01E 4M78E 1W6XA 3FRNA 5C0MA 1E6GA 2CREA 2WACA 2LRQA 2EJ9A 1Q86C 2NUTA 4E7IA 2V8IA 3CCVT 3JCMb 1WJSA 3PE0A 2OTLA 1W4SA 5D6XA 1WI7A 2AT1B 3OS1A 3IQLA 1WDXA 1J3TA 3OYBA 2PUKB 2DX1A 4QQ6A 2KYBA 3G4SA 2HQXA 2QA4Q 2AZSA 1QMCA 1RABB 1G8XA 2CT4A 4GLKA 4C92C 3F70A 1NLOC 2K2VA 1GXIE 3S3MA 1VQOQ 2JN0A 4JJDA 3X25B 3CCMQ 2ABLA 3SHWA 3EG0A 3MEUA 2C0OA 2VXFA 3EFSA 2CP3A 1AVZC 3BE3A 2E1HA 5FU7C 1VQ8A 3CC2T 1VUBA 4OB1B 3CMAA 3PIPA 1VQ9A 3OY9A 1Q81U 5GMKm 1UJYA 1AOJA 1WA7A 4CI0C 5I22A 4KGVB 3OYAA 2DXBA 3I5RA 3JB9D 2GBQA 4JJNK 4PJNA 1T0JA 4IIOA 2H8HA 1D1CA 1GFCA 2FL7A 4EMKB 3OYFA 2XIDA 1K1ZA 2X4JA 1Y7XA 3QG1A 2F2WA 3LLRA 4MZTA 3M59A 5GAN6 4B9XA 4N4GA 4IIMA 4OMFB 2LQKA 4C92D 2E5QA 1QP3A 5DLQE 2RJCA 4EIKA 2BTTA 1OEBA 2KXDA 3PMTA 1N9SA 1ZSZA 2QI2A 3OMCA 4C92B 4II1A 3EAEA 3R6NA 1X6BA 3VRYA 1JO8A 3JCMJ 4C92F 5LJ3g 3H8ZA 4MMLA 2XK0A 1YBYA 2R5AA 2EYQA 5I2MA 2OTJQ 2C0IA 2P4TA 2K79A 1S72A 4C92E 2C0TA 1BK2A 4XTZA 1NLPC 2FZCB 3TEEA 4JRQA 3SDZA 3CCLT 3CC7Q 5GAMe 2LX7A 4JUVA 2QQSA 3CD6T 4Z88A 2DZ9A 2QG9B 5AYFA 1VQ7T 4X9DA 2KYMA 3X20B 1OOTA 2CDTA 2KK4A 2L3SA 1RLPC 4HA8A 4R55A 2XDBA 3MPUB 3MO8A 1AEYA 3AHUA 2V1QA 2OI3A 2D8HA 1G3YA 1K9MR 3JCMQ 3VRZA 3URGA 1IHVA 4M75A 2DIQA 4RCBA 1OU9A 3G7ZA 3MJXA 5CKFA 4ZTJA 4LNPA 1BB9A 1BYMA 2FHDA 1BCMA 2AKKA 2XDDA 2RMOA 3VUZA 4F7UE 2K3XA 1BIAA 2L8DA 2FRWA 2I0NA 2OX7A 4M75B 1IO6A 2J6OA 3JB9I 2QEXT 3EG9B 2DL5A 2QGFB 3QJ6A 2OTJT 3ZFJA 3M57A 3CC2Q 2EVRA 4AG1C 2MOXA 1D3BA 4F16A 4J7IA 2JVVA 1G5VA 3O8VA 2JZ2A 1QVPA 4F7UG 4BY6C 3G71T 4Z8AA 4M7DD 1X69A 1VQMA 4J9HA 1ZBXA 4OMQA 1M2VB 1ARKA 2MPXC 2E41A 1FMWA 4HCBA 4JPBW 4JRIA 3C4SA 2E10A 4HCKA 2OTJA 2EFIA 4RTUA 2F5KA 3DLMA 4ZGJB 1S72Q 3OYYA 3PVLA 1H8KA 1VQMT 1ABQA 3I5SA 2KR3A 1TWBA 4ZGDB 2DO3A 2GF7A 2DD4A 2FPDA 2Y4XA 3VS2A 2XHCA 4PFPA 4BE2A 4GLMA 4EMGA 4AFQC 1GCQC 3S6WA 3JCMP 2QXFA 1GBRA 3BW1A 3JCMe 4JZ4A 1MMNA 1QWEA 4MZMA 1D1AA 1GCQA 4WTOB 2BZXA 3CCQQ 4DBRA 4OB2B 1SRLA 1KJWA 2VXEA 2J6FA 3CC7T 1AWXA 4D8DA 3MP8A 2SEMA 2V8JA 4KBMB 4ZNXA 1UB4A 1WNLA 1M30A 1R8OB 5FW9A 1D09B 2LQWA 4QKUA 4D6WA 4D8KA 1TSFA 1PC0A 3L42A 3I55T 4M7AD 1VOMA 1ZA1B 3EG2A 3MHXA 5GJWB 3PTAA 2LJ1A 2JMAA 1UE9A 2EJFA 1M9SA 2V8KA 1UUEA 3M56A 3VJPA 2RJFA 1K0SA 2VUBA 1PD0A 3OW2P 1PM3A 1W2BP 5HKCA 2KE9A 3M0RA 3CCEA 1VYVA 3EGXA 2BE7D 2QGGA 4YTLA 2QAZA 5GANh 5GANj 1X75C 4F7UB 2QEXQ 2O88A 1VQ7A 3RESA 4RTYA 2PQWA 4E7ZA 4A54A 4M75E 2DXCA 4F04B 3V7SA 3CMAQ 2LCCA 2B86A 5KYYA 1RAGB 4KH0B 3KUFA 3JSCA 3P8BB 3CMEA 2QDLA 2FYKA 3A8MB 3X26B 1D1BA 1VQ4Q 5A2QE 5KYUA 3V8LA 2E12A 1OX8A 2XD0A 3TSWA 1KSWA 1UGVA 2JTMA 2EQIA 4HXJA 2H3JA 1YJWA 1X6GA 1KQSA 4C5EA 2C06A 1YITQ 5LJ5f 1BBZA 1Z9QA 1K8AR 1WJQA 1WGSA 1WXBA 3C94A 7AT1B 1WXTA 2FEIA 4DBQA 3VS6A 4CC2A 1PG5B 1MMGA 5GAOl 5HK3A 1VQNT 4C92A 4GBQA 4AFUC 5IXBA 3RKWA 2FPEA 4RCCA 2VKNA 2ZGWA 5GMKe 1QVFP 1C6VX 4F17A 1C1AA 3GBQA 3M58A 2LT1A 4XTXA 2EAYA 1Y96B 3CCQT 5D6WA 3RDVA 1K8AU 4NS5A 4XU2A 3LX7A 2KRMA 5LJ3j 3QUIA 4M78C 2NUPA 4OGCA 2FPFA 3CBPA 1K73R 3JCMV 4PK4A 1HJDA 1AWWA 4L6V5 1VQNA 3G6EQ 2Z0WA 1KHCA 2DF6A 2YRCA 4FSSA 3CEYA 2KQWA 2KRSA 4IURA 1OV3A 2XMFA 1H641 1FMKA 2DKGA 2YDLA 4J9GA 1QCOA 2JTFA 3VU3C 2CSQA 2HL3A 3OW2S 3UPUA 4M7DA 2E70A 3J80E 5CQYA 3A5ZB 3OBYA 4AT1B 2HBPA 3OSVA 2XG8D 5CR2A 4VUBA 1CSKA 5GANf 3CCET 1C0MA 2DD5A 1MGQA 4JJCA 1VQ8Q 1MHNA 3SD4A 3V7CA 1D0XA 1G83A 3D7SB 1VQ9Q 2MAMA 1RADB 4A53A 3CCUA 3EFOA 1GCPA 5LJ3e 3H0IA 4FT2A 1AD5A 5GAN8 3CCJT 2NUZA 1UGSB 2DEUA 1OPKA 2RHYA 2EQJA 4M77B 1KD1C 3QWXX 2A0FB 1N9RA 2K6DA 1RUWA 1N8RC 1WHMA 2JXBA 2VGMA 2RF0A 4LXCA 3CCRA 2P0KA 3CCLA 4BE0A 3KFVA 1KQSP 1Y0MA 3SWNB 2ZPIB 1YIJT 2ECZA 4M75C 2DL3A 2HNIA 3RIRA 4XU1A 4BI3A 5CKDA 4QVDA 2YT6A 3DB4A 1I8FA 2EGCA 2ZPHB 3OS2A 3OS5A 2L89A 2ROTA 3V7RA 1R77A 1Y07A 2D0NA 3T9NA 2RHUA 1VQ8T 1UGQB 4DQ2A 3L2UA 4X9CA 2SRCA 4EMHA 2WSCE 2E5KA 2RQWA 2EYWA 2P4RA 3CMET 1H3HA 3KXTA 2VC8A 3MKDA 4AFSC 1Y71A 3FC3A 3NHNA 1YJ9T 4OB3B 2X9HA 3OW2A 1BKBA 3ASKA 2EPDA 4BDYA 1D0YA 3OYLA 2LNHB 2RH2A 2LDMA 1QCNA 1XTDA 4Y28E 3CPWS 3FIFA 2CP6A 2YUQA 2COYA 1RI0A 2AKLA 3UDCA 2NWMA 2HSPA 5HCKA 4IUQA 5LJ5e 3FB9A 1U3OA 2LNVA 1X01A 1TXQA 2R57A 2FVUA 1UGPB 4M7AB 3RUXA 4C8QB 2CP0A 3A1PA 1NYFA 4E2FB 1BI0A 5GAMj 1YN8A 4BUGA 8AT1B 1YFNA 4HKEA 5CKBA 3E2UA 2RD1A 1N5ZA 2OTLT 3CMAT 5IHKA 1KD1R 2EJGA 2EYZA 2JW4A 2P0PA 3TQ7P 3CC2A 4M75F 4E7KA 1M2VA 3EG9A 4E47A 3CCLQ 2HD0A 1S1NA 4J9CA 1OZ3A 4C5HA 3GP8A 1E7OA 2EYXA 2X4WA 2BZYA 1I07A 3GIBA 1OYXA 3CPWA 4FL6A 1PNJA 2G3RA 2KI7A 3LH0A 4OF1A 4C0GA 2HQEA 3CCJA 2D9TA 3JAME 4ZN3A 2DZCA 3OYJA 3SB2A 2I2LA 4LE9A 2RHIA 2CP2A 4QVZA 1V29B 1JBMA 3HKSA 1VQKQ 3HTRA 3QDFA 1YCYA 1SPKA 1QCFA 3MP6A 2RQTA 2FG0A 1ZUYA 2ZPGB 5IT9E 1T3SA 2E64A 3CCMA 1QP2A 4JRPA 1M3CA 2RPNA 2XKOC 2DTIA 3L2ZA 3C0CA 3EH1A 3QWYA 4C0DC 3EG3A 5HY6A 1XNIA 5A0LA 3U23A 3NTHA 2QYZA 1MV0B 2K4YA 3RMQA 3CXCA 4J83A 3OYIA 1I0CA 1R0BG 3CD6A 3M4YA 4JRKA 1EZZB 2ZPEB 4ZTFA 2VVKA 3DB3A 1KG1A 1WQWA 1N8RU 5GMKj 2OAWA 1QW1A 3EGDB 3EGXB 3LGLA 4M77G 4N4HA 1M1GA 1ZSGA 4J9DA 5LJ3d 5LL6S 2GTOA 2F2VA 4A4EA 1M1KC 3A8LB 1VQ5T 1OZ2A 2M0OA 2DLPA 2MWOA 2DNUA 4QQGA 1V1CA 4BD3A 1D3BB 5GAOp 3DKMA 2DTOA 4QQDA 2JM8A 1EIFA 2D1XA 2JT4A 3CQTA 4LN2A 2LJ3A 3E1SA 2KXCA 5LJ5j 1VQ6T 4A4KA 1E6HA 2F5TX 4LDVA 4X34A 3OMGA 1PD1A 1WHJA 2X4XA 4FIBA 1Z9ZA 3QKJA 5FU6B 4A63B 2LTOA 4LDWA 4PJLA 3H9NA 2RK1A 3H0HA 2O4XB 3RKXA 2NLUA 2LP5A 1WJRA 2VV5A 3FEOA 1YIJQ 1GL5A 1M2OA 1RL2A 2G6FX 2K7AA 3LW5E 1WFWA 4FSXA 5GANg 3VUBA 1K9MC 1W1FA 2RQVA 2DYIA 4FU6A 4R0KA 2JS2A 2E6NA 2EQKA 2MIOA 1VA7A 1WQ7A 2X3XD 2MWPA 4A4FA 3I9QA 2L3RA 1JJ2S 3G1JA 1NJIC 4GY5A 4O5VA 2MK5A 2MMPA 5EG2A 1Q86R 5GAN7 1KC8U 1KC8R 2J05A 1SF9A 3UT1A 4BDZA 3CCMT 1JJ2A 1TU0B 3A8HB 3G4SQ 3VS4A 2L5QA 1KQSS 1RAAB 2DK3A 4OMNA 3G71Q 4M7DE 1VQ4A 2JUFA 4HVWA 4PJOD 5AT1B 1VQLT 2PVDB 1KK7A 3QXEB 1VQOA 2DA9A 1AHJB 2QASA 2M9UA 1SKUB 4C0ZA 5KYUB 3P8DA 1KIKA 4PLIA 4M4ZA 5LJ5h 2V26A 1CKAA 4ZGEB 5KYYB 4JS4A 3L1AA 3RKYA 3VS1A 3ZL7C 4CC7A 1ZBJA 3CCUT 4A4HA 1M1FA 1YNZA 2ZPFB 2DPPB 1X43A 3QZ9B 3O5ZA 2K3YA 1YJWT 2ESWA 2LVMA 1BCOA 4AMCA 1FYNA 3FJPA 2XICA 3MEWA 3Q1JA 4L5GA 2MCNA 3INZA 3WVEB 2FB7A 1T3LA 1IREB 3FJ5A 3CXCS 1CKBA 1ZX6A 4IUVA 3I56T 4OB0B 1AWOA 2DM1A 4J6WA 3ULRB 5CKEA 3I56A 3VV0A 2DETA 3LYIA 1OQKA 3QIIA 2O2OA 3LWHA 4MMKA 1AZGB 1YJNQ 2AIRB 4J7FA 2EBPA 5LJ3f 5FU6C 1SSFA 2NUPB 2YRVA 3EH2A 2VYTA 1NG2A 3HRTA 2A28A 3RBBB 4LDUA 2JS0A 3QPHA 4XTWA 4E7HA 4XTUA 3P8HA 5C6SA 1TH7A 2RHXA 4JS5A 2X51A 1ZA2B 5FRNA 2P0QA 4BI8B 4LD9K 4M78D 2CZ6B 2LMJA 2COZA 2M16A 5DY9A 2PZ1A 1HYOA 3UA6A 4HCZA 4FW1A 5LJ5g 5J26A 1W70A 2XDPA 3N5BB 2AZVA 2RM4A 1I1JA 4XTYA 4RTZA 3JRZA 1KQ1A 2HQHA 5GAMg 1M1KR 3SFMA 4M7AE 5I2SA 4KULA 4OP0A 1ZSZB 2PTKA 1WX6A 4N4IA 4Z89A 5GAN2 2PVGB 5KYXA 2LQNA 2HZYA 5GAMh 3AT1B 2BZ8A 1YHQQ 3VS0A 1LCKA 2ED1A 2FZGB 1JXMA 1BI3A 4PNOA 5IHNA 1O9SA 4M7DB 1K0XA 4M77E 2KBTA 1M8MA 2ZAEA 3QBYA 2RQRA 4JJBA 4OVAA 1QKXA 3BFMA 4C8QG 1K9MU 4M7AG 1VQ5Q 2MI6A 2V1RA 2QQRA 5IN1A 1U06A 1NEGA 4E7JA 5I21A 1N6AA 2RI2A 2K2MA 3L2WA 1VQMQ 5IH2A 1NE8A 2DXTA 1VIEA 4PFZA 1YJWQ 2X3WD 1MMAA 4M78F 3ZEHA 4ANJA 1K8AC 4M77D 4C8QD 2LC4A 4P5NA 3NGPA 3DLLA 3QO3A 3REBB 3LH5A 1VQ6Q 1RAFB 4DOVA 2CZ1B 2F2XA 3JV3A 4LUEA 3C95A 4NL2A 1VQ4T 1YP5A 4RG8A 1VQLA 4M7DF 1SHFA 1IGUA 1N8RR 3CCST 4CC3A 4XAXB 3OYHA 2O4XA 3SWNA 4C0FA 1B3QA 4J5YA 9ATCB 1PKSA 5M9OA 2CP7A 1YIJA 3THKA 3J7AF 2WSFE 1JEGA 3OA6A 2YWWA 4JLGA 3H41A 2R5MA 5GJVB 2D8JA 5GAMf
chains in the Genus database with same CATH topology
1S1NA 4J9CA 1E7OA 2EYXA 1A0NB 2BZYA 1YWPA 1I07A 4LNPA 1BB9A 2ED0A 2AKKA 1PNJA 3EHQA 2RMOA 1VYUA 2FRWA 2I0NA 4JZ3A 1IO6A 2L0AA 2J6OA 1WLPB 3TSZA 2A08A 2DL5A 1WXUA 3I35A 1HSQA 3VS5A 1X2KA 2HCKA 2EVRA 4LE9A 4AG1C 2MOXA 1UHFA 2EGEA 4F16A 2DL4A 1ABOA 3VS3A 2W10A 2CH4A 1SPKA 1TG0A 2DRMA 1QCFA 2HDAA 2RQTA 2DBKA 1PRMC 4Z8AA 2FG0A 1X69A 1ZUYA 4J9HA 2K9GA 1U5SA 4OMQA 1T3SA 1HD3A 2DVJA 1ARKA 1AZEA 4JPBW 1YWOA 4J9BA 4CC4B 1M3CA 2RPNA 4HCKA 3C0CA 4OMLA 3UA7A 3UATA 3QWYA 4RTUA 2O9SA 3EG3A 1JQQA 3PVLA 1H8KA 2DYBA 1ZUKA 2YUOA 3U23A 1ABQA 1MV0B 3I5SA 3NMZC 2KR3A 3M0QA 1I0CA 2FPDA 3REAB 3M0SA 3VS2A 2GTJA 2VVKA 1UG1A 4GLMA 1K9AA 2A37A 4AFQC 1GCQC 2CT3A 1XOVA 2OAWA 2PNIA 5EC7A 3PVQA 3NPFA 4OMMA 1GBRA 2AK5A 1SEMA 4JZ4A 1QWEA 1ZSGA 4ORZA 4J9DA 1GCQA 2BZXA 5I11A 2EKHA 2KNBB 2GTOA 2F2VA 3TVTA 1SRLA 1KJWA 2HBWA 2DLPA 2DNUA 2EGAA 1ZLMA 2EYYA 2J6FA 1AWXA 1V1CA 4D8DA 2SEMA 4ZNXA 1M30A 3H0FA 2LQWA 5FW9A 1EFNA 2YSQA 2JM8A 2D1XA 2JT4A 4D8KA 3CQTA 4RTWA 4LN2A 2IIMA 2LJ3A 2DMOA 2KXCA 5FWBA 1KFZA 1E6HA 3EG2A 5GJWB 2LJ1A 2JMAA 1UE9A 2KROA 1UUEA 1Z9ZA 1K0SA 4A63B 1G2BA 1PWTA 2KE9A 2RQUA 3H0HA 3M0RA 1WIEA 1VYVA 2LP5A 3VS7A 1MV3A 2O88A 3M0PA 4RTYA 5IHIA 2A36A 1M3BA 1RLQC 1GL5A 2G6FX 2K7AA 2HEQA 1TUDA 1WFWA 1UDLA 2B86A 1W1FA 2RQVA 4R0KA 2JS2A 2CSIA 1SRMA 1RI9A 2DRKA 2QDLA 2MIOA 1VA7A 2L2PA 2X3XD 1SSHA 1KSWA 1UGVA 3TSWA 2EQIA 3I9QA 1B07A 2J6KA 4HXJA 3UF4A 2LJ0A 1X6GA 3SEMA 1M3AA 4K11A 1PHTA 2J05A 1BBZA 1X2QA 1Z9QA 3VS4A 1WXBA 5IXFA 2RNAA 1WXTA 4X1VA 4DEXA 2FEIA 1YCSB 4OMNA 2YUPA 4KRTA 1PRLC 3M0TA 4HVWA 3VS6A 4CC2A 2RN8A 2O31A 1NEBA 2DA9A 2DL7A 4GBQA 4AFUC 5IXBA 1TUCA 2FPEA 4E6RA 1KIKA 2VKNA 4J9FA 4HVUA 4F17A 4M4ZA 4RTXA 3GBQA 2DJQA 3A98A 1CKAA 1JU5C 4LUDA 1WYXA 2YUNA 1K4US 3VS1A 3ZL7C 4CC7A 1ZBJA 2L3PA 1BU1A 4DEYA 2KRMA 2ENMA 1YNZA 2FPFA 2KT8A 1X43A 2VWFA 2OJ2A 1HJDA 4J9EA 3O5ZA 2ESWA 2KT1A 1AWWA 1NYGA 4RTVA 1PKTA 1FYNA 1GRIA 2CUDA 1GFDA 2MCNA 5FWCA 1UJ0A 2DF6A 4FSSA 2KRSA 1T3LA 1ZUUA 1T0HA 3FJ5A 1CKBA 2GQIA 2DBMA 1OV3A 1ZX6A 2XMFA 4RTTA 1FMKA 2YDLA 4J9GA 1M27C 4OMOA 1JXOA 1W6XA 1AWOA 2CSQA 2DM1A 2DILA 3ULRB 1E6GA 2CREA 3EGUA 2O2OA 1AZGB 2EBPA 3PE0A 1CSKA 4OMPA 4QT7A 1NG2A 2A28A 1QLYA 4HVVA 1UTIA 3RBBB 1AWJA 5ECAA 4JJCA 2JS0A 1WI7A 3IQLA 1WDXA 1J3TA 1G83A 2DX1A 1QWFA 2KYBA 4J9IA 1GCPA 3H0IA 2AZSA 2LMJA 1AD5A 2PZ1A 2W0ZA 2NUZA 3UA6A 2LCSA 2CT4A 2J7IA 1OPKA 1NLOC 1W70A 4WCIA 2M51A 2AZVA 2GNCA 4JJDA 3QWXX 1I1JA 2ABLA 3SHWA 4RTZA 2JMCA 2K6DA 3EG0A 2C0OA 1RUWA 2JXBA 2RF0A 1AVZC 2FO0A 4AFZC 2JTEA 3KFVA 1Y0MA 2ECZA 2PTKA 1WX6A 4Z89A 2DL3A 2LQNA 2BZ8A 2KEAA 3VS0A 1UJYA 1AOJA 1WA7A 2YT6A 1LCKA 2EGCA 2ED1A 3EHRA 5I22A 2ROTA 1JXMA 3I5RA 2GBQA 2D0NA 5IHNA 2J06A 1T0JA 4IIOA 2H8HA 1K0XA 1Y57A 2KBTA 1M8MA 1GFCA 2RQRA 4JJBA 1K1ZA 2DE0X 1QKXA 2V1RA 2SRCA 2F2WA 2KGTA 3M0UA 2E5KA 2RQWA 2EYWA 2P4RA 1H3HA 1X27A 2O9VA 2JM9A 4IIMA 1U06A 1NEGA 4AFSC 3NHNA 4EIKA 2BTTA 1OEBA 2KXDA 1MUZA 2K2MA 2LZ6B 5IH2A 2EPDA 4Y92A 2LNHB 1H92A 3R6NA 1X6BA 3VRYA 1JO8A 2L3QA 2X3WD 1OPLA 2DL8A 1UHCA 2YUQA 4ESRA 2AKLA 2NWMA 2HSPA 5HCKA 1UECA 2C0IA 2K3BA 1U3OA 2K79A 3NGPA 1QKWA 3REBB 3LH5A 5L23A 2C0TA 1BK2A 1NLPC 2F2XA 1UFFA 1NYFA 1SHGA 3JV3A 4LUEA 1YN8A 1YP5A 2LX7A 1SHFA 4F14A 4Z88A 4CC3A 2EW3A 3EG1A 1GBQA 1N5ZA 1NM7A 2CUBA 2KYMA 1OOTA 2ROLA 2CDTA 1B3QA 2KRNA 1K76A 2L3SA 1PKSA 1RLPC 1VYTA 5IHKA 3THKA 2EYZA 4RUGA 1AEYA 2JW4A 1JEGA 2FRYA 2GGRA 2M0YA 3RNJA 4AG2C 2CH4W 2V1QA 3H41A 2OI3A 2D8HA 2D8JA 5GJVB 3VRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1N A;  4J9C A;  1E7O A;  2EYX A;  1A0N B;  2BZY A;  1YWP A;  1I07 A;  4LNP A;  1BB9 A;  2ED0 A;  2AKK A;  1PNJ A;  3EHQ A;  2RMO A;  1VYU A;  2FRW A;  2I0N A;  4JZ3 A;  1IO6 A;  2L0A A;  2J6O A;  1WLP B;  3TSZ A;  2A08 A;  2DL5 A;  1WXU A;  3I35 A;  1HSQ A;  3VS5 A;  1X2K A;  2HCK A;  2EVR A;  4LE9 A;  4AG1 C;  2MOX A;  1UHF A;  2EGE A;  4F16 A;  2DL4 A;  1ABO A;  3VS3 A;  2W10 A;  2CH4 A;  1SPK A;  1TG0 A;  2DRM A;  1QCF A;  2HDA A;  2RQT A;  2DBK A;  1PRM C;  4Z8A A;  2FG0 A;  1X69 A;  1ZUY A;  4J9H A;  2K9G A;  1U5S A;  4OMQ A;  1T3S A;  1HD3 A;  2DVJ A;  1ARK A;  1AZE A;  4JPB W;  1YWO A;  4J9B A;  4CC4 B;  1M3C A;  2RPN A;  4HCK A;  3C0C A;  4OML A;  3UA7 A;  3UAT A;  3QWY A;  4RTU A;  2O9S A;  3EG3 A;  1JQQ A;  3PVL A;  1H8K A;  2DYB A;  1ZUK A;  2YUO A;  3U23 A;  1ABQ A;  1MV0 B;  3I5S A;  3NMZ C;  2KR3 A;  3M0Q A;  1I0C A;  2FPD A;  3REA B;  3M0S A;  3VS2 A;  2GTJ A;  2VVK A;  1UG1 A;  4GLM A;  1K9A A;  2A37 A;  4AFQ C;  1GCQ C;  2CT3 A;  1XOV A;  2OAW A;  2PNI A;  5EC7 A;  3PVQ A;  3NPF A;  4OMM A;  1GBR A;  2AK5 A;  1SEM A;  4JZ4 A;  1QWE A;  1ZSG A;  4ORZ A;  4J9D A;  1GCQ A;  2BZX A;  5I11 A;  2EKH A;  2KNB B;  2GTO A;  2F2V A;  3TVT A;  1SRL A;  1KJW A;  2HBW A;  2DLP A;  2DNU A;  2EGA A;  1ZLM A;  2EYY A;  2J6F A;  1AWX A;  1V1C A;  4D8D A;  2SEM A;  4ZNX A;  1M30 A;  3H0F A;  2LQW A;  5FW9 A;  1EFN A;  2YSQ A;  2JM8 A;  2D1X A;  2JT4 A;  4D8K A;  3CQT A;  4RTW A;  4LN2 A;  2IIM A;  2LJ3 A;  2DMO A;  2KXC A;  5FWB A;  1KFZ A;  1E6H A;  3EG2 A;  5GJW B;  2LJ1 A;  2JMA A;  1UE9 A;  2KRO A;  1UUE A;  1Z9Z A;  1K0S A;  4A63 B;  1G2B A;  1PWT A;  2KE9 A;  2RQU A;  3H0H A;  3M0R A;  1WIE A;  1VYV A;  2LP5 A;  3VS7 A;  1MV3 A;  2O88 A;  3M0P A;  4RTY A;  5IHI A;  2A36 A;  1M3B A;  1RLQ C;  1GL5 A;  2G6F X;  2K7A A;  2HEQ A;  1TUD A;  1WFW A;  1UDL A;  2B86 A;  1W1F A;  2RQV A;  4R0K A;  2JS2 A;  2CSI A;  1SRM A;  1RI9 A;  2DRK A;  2QDL A;  2MIO A;  1VA7 A;  2L2P A;  2X3X D;  1SSH A;  1KSW A;  1UGV A;  3TSW A;  2EQI A;  3I9Q A;  1B07 A;  2J6K A;  4HXJ A;  3UF4 A;  2LJ0 A;  1X6G A;  3SEM A;  1M3A A;  4K11 A;  1PHT A;  2J05 A;  1BBZ A;  1X2Q A;  1Z9Q A;  3VS4 A;  1WXB A;  5IXF A;  2RNA A;  1WXT A;  4X1V A;  4DEX A;  2FEI A;  1YCS B;  4OMN A;  2YUP A;  4KRT A;  1PRL C;  3M0T A;  4HVW A;  3VS6 A;  4CC2 A;  2RN8 A;  2O31 A;  1NEB A;  2DA9 A;  2DL7 A;  4GBQ A;  4AFU C;  5IXB A;  1TUC A;  2FPE A;  4E6R A;  1KIK A;  2VKN A;  4J9F A;  4HVU A;  4F17 A;  4M4Z A;  4RTX A;  3GBQ A;  2DJQ A;  3A98 A;  1CKA A;  1JU5 C;  4LUD A;  1WYX A;  2YUN A;  1K4U S;  3VS1 A;  3ZL7 C;  4CC7 A;  1ZBJ A;  2L3P A;  1BU1 A;  4DEY A;  2KRM A;  2ENM A;  1YNZ A;  2FPF A;  2KT8 A;  1X43 A;  2VWF A;  2OJ2 A;  1HJD A;  4J9E A;  3O5Z A;  2ESW A;  2KT1 A;  1AWW A;  1NYG A;  4RTV A;  1PKT A;  1FYN A;  1GRI A;  2CUD A;  1GFD A;  2MCN A;  5FWC A;  1UJ0 A;  2DF6 A;  4FSS A;  2KRS A;  1T3L A;  1ZUU A;  1T0H A;  3FJ5 A;  1CKB A;  2GQI A;  2DBM A;  1OV3 A;  1ZX6 A;  2XMF A;  4RTT A;  1FMK A;  2YDL A;  4J9G A;  1M27 C;  4OMO A;  1JXO A;  1W6X A;  1AWO A;  2CSQ A;  2DM1 A;  2DIL A;  3ULR B;  1E6G A;  2CRE A;  3EGU A;  2O2O A;  1AZG B;  2EBP A;  3PE0 A;  1CSK A;  4OMP A;  4QT7 A;  1NG2 A;  2A28 A;  1QLY A;  4HVV A;  1UTI A;  3RBB B;  1AWJ A;  5ECA A;  4JJC A;  2JS0 A;  1WI7 A;  3IQL A;  1WDX A;  1J3T A;  1G83 A;  2DX1 A;  1QWF A;  2KYB A;  4J9I A;  1GCP A;  3H0I A;  2AZS A;  2LMJ A;  1AD5 A;  2PZ1 A;  2W0Z A;  2NUZ A;  3UA6 A;  2LCS A;  2CT4 A;  2J7I A;  1OPK A;  1NLO C;  1W70 A;  4WCI A;  2M51 A;  2AZV A;  2GNC A;  4JJD A;  3QWX X;  1I1J A;  2ABL A;  3SHW A;  4RTZ A;  2JMC A;  2K6D A;  3EG0 A;  2C0O A;  1RUW A;  2JXB A;  2RF0 A;  1AVZ C;  2FO0 A;  4AFZ C;  2JTE A;  3KFV A;  1Y0M A;  2ECZ A;  2PTK A;  1WX6 A;  4Z89 A;  2DL3 A;  2LQN A;  2BZ8 A;  2KEA A;  3VS0 A;  1UJY A;  1AOJ A;  1WA7 A;  2YT6 A;  1LCK A;  2EGC A;  2ED1 A;  3EHR A;  5I22 A;  2ROT A;  1JXM A;  3I5R A;  2GBQ A;  2D0N A;  5IHN A;  2J06 A;  1T0J A;  4IIO A;  2H8H A;  1K0X A;  1Y57 A;  2KBT A;  1M8M A;  1GFC A;  2RQR A;  4JJB A;  1K1Z A;  2DE0 X;  1QKX A;  2V1R A;  2SRC A;  2F2W A;  2KGT A;  3M0U A;  2E5K A;  2RQW A;  2EYW A;  2P4R A;  1H3H A;  1X27 A;  2O9V A;  2JM9 A;  4IIM A;  1U06 A;  1NEG A;  4AFS C;  3NHN A;  4EIK A;  2BTT A;  1OEB A;  2KXD A;  1MUZ A;  2K2M A;  2LZ6 B;  5IH2 A;  2EPD A;  4Y92 A;  2LNH B;  1H92 A;  3R6N A;  1X6B A;  3VRY A;  1JO8 A;  2L3Q A;  2X3W D;  1OPL A;  2DL8 A;  1UHC A;  2YUQ A;  4ESR A;  2AKL A;  2NWM A;  2HSP A;  5HCK A;  1UEC A;  2C0I A;  2K3B A;  1U3O A;  2K79 A;  3NGP A;  1QKW A;  3REB B;  3LH5 A;  5L23 A;  2C0T A;  1BK2 A;  1NLP C;  2F2X A;  1UFF A;  1NYF A;  1SHG A;  3JV3 A;  4LUE A;  1YN8 A;  1YP5 A;  2LX7 A;  1SHF A;  4F14 A;  4Z88 A;  4CC3 A;  2EW3 A;  3EG1 A;  1GBQ A;  1N5Z A;  1NM7 A;  2CUB A;  2KYM A;  1OOT A;  2ROL A;  2CDT A;  1B3Q A;  2KRN A;  1K76 A;  2L3S A;  1PKS A;  1RLP C;  1VYT A;  5IHK A;  3THK A;  2EYZ A;  4RUG A;  1AEY A;  2JW4 A;  1JEG A;  2FRY A;  2GGR A;  2M0Y A;  3RNJ A;  4AG2 C;  2CH4 W;  2V1Q A;  3H41 A;  2OI3 A;  2D8H A;  2D8J A;  5GJV B;  3VRZ A; 
#chains in the Genus database with same CATH topology
 5DM7 R;  4XU3 A;  3RMS A;  2YLB A;  1A0N B;  4CRI A;  4DOW A;  1VYU A;  5CAI A;  4NL3 A;  1YHQ A;  4JZ3 A;  2X35 A;  2A3L A;  5CKH A;  1U1T A;  2L0A A;  2RK2 A;  2DER A;  3KBG A;  1WLP B;  1Q81 R;  1VQN Q;  3ER0 A;  2AHJ B;  1YI2 T;  4M78 G;  4NOY A;  4PFO A;  4C8Q C;  1NPP A;  2X4Y A;  1WXU A;  2YLC A;  3VS5 A;  4TVR A;  4OGE A;  6AT1 B;  4XK8 E;  1VQ5 A;  2EGE A;  2DL4 A;  1ABO A;  4B9W A;  1U1S A;  2CH4 A;  1TS9 A;  1H3Z A;  1TG0 A;  2ATC B;  2DRM A;  2HDA A;  1JRI A;  2RO0 A;  1M90 R;  1G3W A;  4EDU A;  4PJO F;  2DVE A;  2K9G A;  1U5S A;  3L2Q A;  1IXD A;  1HD3 A;  2DVJ A;  3BY7 A;  4C0D B;  1AZE A;  4J9B A;  4CC4 B;  4C8Q E;  3MEA A;  1LNX A;  3UA7 A;  5GAO r;  3UAT A;  1YIT T;  2O9S A;  3HFO A;  1JQQ A;  4M7D C;  2CGH A;  3JB9 G;  3HP9 A;  2DYB A;  1ZUK A;  2YUO A;  3NMZ C;  3M0Q A;  4RMO A;  4C5G A;  3CC7 A;  2ZPB B;  2CYZ B;  2QQB A;  1NJI R;  5GAN e;  1YI2 Q;  5CQX A;  2A37 A;  1WHG A;  3C12 A;  1XOV A;  5EC7 A;  1B34 A;  4JLI A;  3MET A;  2GFA A;  1IGQ A;  1QVF A;  4ORZ A;  5GAN d;  4R56 A;  1QVG P;  5I11 A;  2KNB B;  1B7T A;  5KE3 A;  3I56 Q;  4UC4 A;  2NYS A;  2EYY A;  1ZLM A;  1I4K 1;  4MZP A;  1Q7Y C;  3H0F A;  4Q5W A;  2YSQ A;  2IVW A;  2F1L A;  4RTW A;  2K5F A;  3OBW A;  3E19 A;  5FWB A;  4BE1 A;  5CIU A;  1FXX A;  5GMK l;  1WHL A;  3ME9 A;  2KRO A;  5GAN 3;  3R6O A;  4A4G A;  1QVG S;  5GAO n;  5CCA A;  1G2B A;  3M55 A;  4HT8 A;  5KCO A;  4Z02 A;  3L2V A;  1LOJ A;  3I55 A;  1ZSZ C;  3VS7 A;  3G6E A;  1RAE B;  1MNE A;  1MV3 A;  3WVD B;  2RB6 A;  5GMK h;  3S3O A;  3M0P A;  3S3N A;  5IHI A;  3EGD A;  2Y4Y A;  2HKQ B;  2K57 A;  3OQ5 A;  4DA4 A;  3JB9 H;  3PGG A;  3JCM h;  4FYW B;  2DEQ A;  1TOV A;  3OS0 A;  1WZO A;  2P84 A;  1RI9 A;  2DRK A;  5GAN 4;  4IKF A;  3G71 A;  1PCX A;  3GLX A;  4V2S A;  4M78 B;  1M8V A;  1W2B A;  2HSE B;  3PIO A;  1Q82 U;  3TCJ A;  3CCJ Q;  1Q81 C;  1VQP T;  3GPL A;  3RER A;  5KYW A;  1M3A A;  3PT9 A;  3CC4 Q;  3QYH B;  5J39 A;  5IXF A;  3M5A A;  1HK9 A;  2EKO A;  2JNG A;  3OYM A;  1V76 A;  3WXM B;  2HKN A;  1ZHI A;  4KRT A;  1PRL C;  2D6F A;  5CO7 A;  2O31 A;  1NEB A;  2XU8 A;  4HT9 A;  3JB9 J;  1JB0 E;  1WPY A;  4KGZ B;  5A0G A;  2CP5 A;  4E6R A;  1XQH A;  3HRU A;  4HVU A;  3CCR Q;  5D7U A;  2DJQ A;  1JU5 C;  4LUD A;  4M75 G;  1WYX A;  4LDY A;  2A7Y A;  1MMD A;  2LQ8 A;  4E7S A;  2RA2 A;  2L3P A;  1BU1 A;  4PLL A;  4DEY A;  2ENM A;  4BB7 A;  3JCM d;  3E9G A;  1YJ9 A;  2QQA A;  3CD6 Q;  3NFC A;  2OJ2 A;  4J9E A;  3I55 Q;  1TUG B;  2KT1 A;  4E7L A;  1NYG A;  1GRI A;  2CUD A;  1VQP Q;  3PNW C;  1UJ0 A;  2VGN A;  4IUT A;  3EFO B;  5GAM d;  3QYG B;  3CC4 T;  1ZUU A;  1M1K U;  1M4Z A;  1T0H A;  2PVO B;  2DBM A;  3HRS A;  2QTX A;  1M27 C;  2LT4 A;  2RJD A;  2QA4 A;  1QQJ A;  1JXO A;  4ATO A;  2DIL A;  5KYW B;  3VYG A;  3X24 B;  2GQV A;  2E6Z A;  3EGU A;  3L2R A;  1M90 C;  3CBM A;  1G3S A;  4OMP A;  4QT7 A;  2MF2 A;  1QLY A;  1TTH B;  1UTI A;  4HVV A;  1AWJ A;  5ECA A;  3CCR T;  4M77 A;  3OB9 A;  4ZN1 A;  2MYS A;  2VB6 A;  1QWF A;  4J9I A;  2PU9 B;  3CBO A;  4M77 C;  3JB9 F;  1YJN T;  2W0Z A;  2LCS A;  1Q7Y U;  1EX4 A;  2J7I A;  1ACM B;  4BI4 A;  2PUO B;  1QVF S;  2IPO B;  2GFU A;  4WCI A;  2M51 A;  3BDU A;  1BI1 A;  3SWN C;  2GNC A;  1SG5 A;  4KT0 E;  2JMC A;  3HHT B;  4QVC A;  2FO0 A;  4AFZ C;  4LD6 A;  2CKK A;  2JTE A;  5FLX E;  4EMK C;  3OYG A;  3MCA B;  5FRO A;  2LCL A;  2B8A A;  1NJI U;  1PSE A;  2KEA A;  5HK0 A;  1FX7 A;  3HFN A;  4F7U F;  2K5I A;  2XI9 A;  1KC8 C;  3EHR A;  1DJ7 B;  1X6O A;  2R58 A;  2K5L A;  1VIF A;  4BAC A;  1M5Q 1;  2F69 A;  5KYX B;  2J06 A;  1Q82 R;  1Y57 A;  4C8Q A;  2DXU A;  4IUU A;  2DE0 X;  1VQ6 A;  3CCQ A;  3FLG A;  3M0U A;  2KGT A;  1X27 A;  3MP1 A;  2O9V A;  2JM9 A;  1FMV A;  5LJ3 h;  2LX9 A;  2E3I A;  1MUZ A;  1Q7Y R;  1Q82 C;  4PJO A;  3OSS C;  2LZ6 B;  4Y92 A;  5L8R E;  5DLO A;  1H92 A;  2L3Q A;  1OPL A;  2DL8 A;  4KGX B;  1UHC A;  3TRE A;  2QEX A;  4ESR A;  4HCC A;  2RI3 A;  4PJO C;  1VQ7 Q;  1UEC A;  2K3B A;  2WSE E;  3EFR A;  1QKW A;  2Y90 A;  4M77 F;  1IZ6 A;  3E9F A;  3QHS A;  8ATC B;  4WF2 A;  4PKC C;  5L23 A;  4XTV A;  1UFF A;  3TU4 K;  1SHG A;  3CCU Q;  2CZ0 B;  3GF5 A;  2ZZD A;  4F14 A;  3CCE Q;  2FZK B;  2EW3 A;  3EG1 A;  1GBQ A;  3VKI A;  4PL6 A;  2CUB A;  1NM7 A;  4FCY A;  1K73 C;  1QVG A;  2ROL A;  2KRN A;  3OYN A;  1K76 A;  1VYT A;  1VQ9 T;  1YIT A;  5J3B A;  4RUG A;  1U8R A;  4M7A F;  2FRY A;  2GGR A;  2M0Y A;  3RNJ A;  4AG2 C;  2CH4 W;  2RHZ A;  3OYC A;  4MDW A;  2YRD A;  1NBE B;  1N27 A;  3G4S T;  1IHW A;  3VYH B;  1YWP A;  1LVK A;  2KVQ G;  1I5O B;  2ED0 A;  2QK0 A;  3EHQ A;  2D0Q B;  4FYX B;  4PJM A;  4QW2 A;  3M4G A;  1IRX A;  1VQL Q;  4BY6 B;  4M78 A;  2DIG A;  3TSZ A;  1ZQ1 A;  2EWN A;  3G6E T;  2A08 A;  3M9Q A;  1NZ9 A;  3CCV Q;  4LDX A;  3I35 A;  3JCM X;  1HSQ A;  3GNG A;  2KDS A;  1X2K A;  3OYD A;  2HCK A;  1OUL A;  2QTV A;  2QA4 T;  1UHF A;  4B6M A;  3OYE A;  1B34 B;  1RAH B;  3VS3 A;  2E4H A;  2ZCF B;  3V8J A;  5GAO m;  2W10 A;  2DJZ A;  3CPF A;  3CCS A;  1Q95 G;  2DBK A;  4J6Y A;  1PRM C;  1M90 U;  3GOX A;  2E65 A;  1YJN A;  5GAN 5;  4XU0 A;  1JJ2 P;  1R0C B;  1YWO A;  2E3H A;  1RAC B;  4OML A;  5GAO q;  3LWI A;  1HXD A;  4FM4 B;  5LJ5 d;  4PJO B;  3X28 B;  1AT1 B;  2CZ7 B;  3JCM f;  1KQ2 A;  3ZBD A;  1YHQ T;  2COW A;  2EQU A;  2RI5 A;  1KHI A;  3HSB A;  3REA B;  2HMA A;  3M0S A;  1Q86 U;  1NPR A;  1BI2 A;  2GTJ A;  1UG1 A;  1K9A A;  3PMI A;  2CT3 A;  2PNI A;  4FT4 A;  3PVQ A;  3QZ5 B;  3NPF A;  4ME7 A;  4OMM A;  2AK5 A;  1SEM A;  1O75 A;  2M1H A;  2EKH A;  3TVT A;  4PJO E;  1D0Z A;  4M7D G;  3QDR B;  2HBW A;  3M54 A;  2JOY A;  2EQM A;  2EGA A;  3HPW A;  1BIB A;  4Y91 A;  1PSF A;  3JCM W;  2DAQ A;  1EFN A;  4M7A C;  2YHT A;  5GMK i;  2IIM A;  3PFS A;  2DMO A;  4ELZ C;  2VAS A;  3RR6 A;  5FRM A;  1KFZ A;  4M7A A;  1UEB A;  3OYK A;  4J8O A;  3CME Q;  2YXY A;  1F1B B;  4EPC A;  2GCX A;  1VQK A;  1PWT A;  4L59 A;  1XJW B;  3CCS Q;  2RQU A;  3BDL A;  1WIE A;  4JDS A;  2KAF A;  3FDR A;  2KY9 A;  5KH6 A;  5CVI A;  4RG2 A;  3A8O B;  2A36 A;  1M3B A;  1RLQ C;  4M75 D;  2HEQ A;  2OAU A;  1TUD A;  3GNF B;  1UDL A;  1KD1 U;  1VQK T;  2HAX A;  4C8Q F;  2CS7 A;  5D6Y A;  2BIV A;  1IB8 A;  2CSI A;  2DTH A;  1SRM A;  5KE2 A;  2L2P A;  2KSS A;  3JCM g;  3V8K A;  3CXC P;  4PJO G;  1SSH A;  1K73 U;  4RKU E;  1B07 A;  2J6K A;  2DFU A;  3UF4 A;  2LJ0 A;  4DBH A;  2OTL Q;  3H6Z A;  3A8G B;  3SEM A;  3JCM c;  2BKD N;  2JJ9 A;  4K11 A;  1PHT A;  1UGR B;  1X2Q A;  2RJE A;  4N0A C;  1WHK A;  3NTI A;  1OI1 A;  4PJJ A;  3QSU A;  2RNA A;  5KYN A;  4X1V A;  4KUD K;  4DEX A;  4FW2 A;  5CK9 A;  1YCS B;  4F7U A;  4N0A A;  1YJ9 Q;  2YUP A;  4FYV B;  4O6J A;  5A0D A;  3M0T A;  5KCH A;  2RN8 A;  4C92 G;  5IAY A;  4C5I A;  1I81 A;  3UWN A;  1FWZ A;  3HL8 A;  2DL7 A;  1VQP A;  1W2B S;  1OU8 A;  1TUC A;  1OX9 A;  2QQ9 A;  3MEV A;  4IUP A;  2IG0 A;  2QDY B;  1RAI B;  4KH1 B;  4J9F A;  2KMT A;  1S72 T;  4RTX A;  4ELY C;  2BUD A;  3A98 A;  3CC4 A;  1I5L A;  2YUN A;  1K4U S;  4EMK A;  3LGF A;  2BE9 B;  3QJY A;  1G3T A;  4XQ3 A;  2EIF A;  3NTK A;  2KT8 A;  2VWF A;  3CPW P;  2H3E B;  1LPL A;  4KUI A;  3M53 A;  1VQO T;  4RTV A;  1PKT A;  4DBF A;  2M02 A;  1YI2 A;  1GFD A;  5FU7 B;  5FWC A;  3CCV A;  1WHH A;  1LJO A;  1P92 A;  1Y96 A;  4J6X A;  3J81 E;  1MND A;  2GQI A;  2NUT B;  4RTT A;  4MDX A;  2HL5 C;  4FYY B;  4OMO A;  2O01 E;  4M78 E;  1W6X A;  3FRN A;  5C0M A;  1E6G A;  2CRE A;  2WAC A;  2LRQ A;  2EJ9 A;  1Q86 C;  2NUT A;  4E7I A;  2V8I A;  3CCV T;  3JCM b;  1WJS A;  3PE0 A;  2OTL A;  1W4S A;  5D6X A;  1WI7 A;  2AT1 B;  3OS1 A;  3IQL A;  1WDX A;  1J3T A;  3OYB A;  2PUK B;  2DX1 A;  4QQ6 A;  2KYB A;  3G4S A;  2HQX A;  2QA4 Q;  2AZS A;  1QMC A;  1RAB B;  1G8X A;  2CT4 A;  4GLK A;  4C92 C;  3F70 A;  1NLO C;  2K2V A;  1GXI E;  3S3M A;  1VQO Q;  2JN0 A;  4JJD A;  3X25 B;  3CCM Q;  2ABL A;  3SHW A;  3EG0 A;  3MEU A;  2C0O A;  2VXF A;  3EFS A;  2CP3 A;  1AVZ C;  3BE3 A;  2E1H A;  5FU7 C;  1VQ8 A;  3CC2 T;  1VUB A;  4OB1 B;  3CMA A;  3PIP A;  1VQ9 A;  3OY9 A;  1Q81 U;  5GMK m;  1UJY A;  1AOJ A;  1WA7 A;  4CI0 C;  5I22 A;  4KGV B;  3OYA A;  2DXB A;  3I5R A;  3JB9 D;  2GBQ A;  4JJN K;  4PJN A;  1T0J A;  4IIO A;  2H8H A;  1D1C A;  1GFC A;  2FL7 A;  4EMK B;  3OYF A;  2XID A;  1K1Z A;  2X4J A;  1Y7X A;  3QG1 A;  2F2W A;  3LLR A;  4MZT A;  3M59 A;  5GAN 6;  4B9X A;  4N4G A;  4IIM A;  4OMF B;  2LQK A;  4C92 D;  2E5Q A;  1QP3 A;  5DLQ E;  2RJC A;  4EIK A;  2BTT A;  1OEB A;  2KXD A;  3PMT A;  1N9S A;  1ZSZ A;  2QI2 A;  3OMC A;  4C92 B;  4II1 A;  3EAE A;  3R6N A;  1X6B A;  3VRY A;  1JO8 A;  3JCM J;  4C92 F;  5LJ3 g;  3H8Z A;  4MML A;  2XK0 A;  1YBY A;  2R5A A;  2EYQ A;  5I2M A;  2OTJ Q;  2C0I A;  2P4T A;  2K79 A;  1S72 A;  4C92 E;  2C0T A;  1BK2 A;  4XTZ A;  1NLP C;  2FZC B;  3TEE A;  4JRQ A;  3SDZ A;  3CCL T;  3CC7 Q;  5GAM e;  2LX7 A;  4JUV A;  2QQS A;  3CD6 T;  4Z88 A;  2DZ9 A;  2QG9 B;  5AYF A;  1VQ7 T;  4X9D A;  2KYM A;  3X20 B;  1OOT A;  2CDT A;  2KK4 A;  2L3S A;  1RLP C;  4HA8 A;  4R55 A;  2XDB A;  3MPU B;  3MO8 A;  1AEY A;  3AHU A;  2V1Q A;  2OI3 A;  2D8H A;  1G3Y A;  1K9M R;  3JCM Q;  3VRZ A;  3URG A;  1IHV A;  4M75 A;  2DIQ A;  4RCB A;  1OU9 A;  3G7Z A;  3MJX A;  5CKF A;  4ZTJ A;  4LNP A;  1BB9 A;  1BYM A;  2FHD A;  1BCM A;  2AKK A;  2XDD A;  2RMO A;  3VUZ A;  4F7U E;  2K3X A;  1BIA A;  2L8D A;  2FRW A;  2I0N A;  2OX7 A;  4M75 B;  1IO6 A;  2J6O A;  3JB9 I;  2QEX T;  3EG9 B;  2DL5 A;  2QGF B;  3QJ6 A;  2OTJ T;  3ZFJ A;  3M57 A;  3CC2 Q;  2EVR A;  4AG1 C;  2MOX A;  1D3B A;  4F16 A;  4J7I A;  2JVV A;  1G5V A;  3O8V A;  2JZ2 A;  1QVP A;  4F7U G;  4BY6 C;  3G71 T;  4Z8A A;  4M7D D;  1X69 A;  1VQM A;  4J9H A;  1ZBX A;  4OMQ A;  1M2V B;  1ARK A;  2MPX C;  2E41 A;  1FMW A;  4HCB A;  4JPB W;  4JRI A;  3C4S A;  2E10 A;  4HCK A;  2OTJ A;  2EFI A;  4RTU A;  2F5K A;  3DLM A;  4ZGJ B;  1S72 Q;  3OYY A;  3PVL A;  1H8K A;  1VQM T;  1ABQ A;  3I5S A;  2KR3 A;  1TWB A;  4ZGD B;  2DO3 A;  2GF7 A;  2DD4 A;  2FPD A;  2Y4X A;  3VS2 A;  2XHC A;  4PFP A;  4BE2 A;  4GLM A;  4EMG A;  4AFQ C;  1GCQ C;  3S6W A;  3JCM P;  2QXF A;  1GBR A;  3BW1 A;  3JCM e;  4JZ4 A;  1MMN A;  1QWE A;  4MZM A;  1D1A A;  1GCQ A;  4WTO B;  2BZX A;  3CCQ Q;  4DBR A;  4OB2 B;  1SRL A;  1KJW A;  2VXE A;  2J6F A;  3CC7 T;  1AWX A;  4D8D A;  3MP8 A;  2SEM A;  2V8J A;  4KBM B;  4ZNX A;  1UB4 A;  1WNL A;  1M30 A;  1R8O B;  5FW9 A;  1D09 B;  2LQW A;  4QKU A;  4D6W A;  4D8K A;  1TSF A;  1PC0 A;  3L42 A;  3I55 T;  4M7A D;  1VOM A;  1ZA1 B;  3EG2 A;  3MHX A;  5GJW B;  3PTA A;  2LJ1 A;  2JMA A;  1UE9 A;  2EJF A;  1M9S A;  2V8K A;  1UUE A;  3M56 A;  3VJP A;  2RJF A;  1K0S A;  2VUB A;  1PD0 A;  3OW2 P;  1PM3 A;  1W2B P;  5HKC A;  2KE9 A;  3M0R A;  3CCE A;  1VYV A;  3EGX A;  2BE7 D;  2QGG A;  4YTL A;  2QAZ A;  5GAN h;  5GAN j;  1X75 C;  4F7U B;  2QEX Q;  2O88 A;  1VQ7 A;  3RES A;  4RTY A;  2PQW A;  4E7Z A;  4A54 A;  4M75 E;  2DXC A;  4F04 B;  3V7S A;  3CMA Q;  2LCC A;  2B86 A;  5KYY A;  1RAG B;  4KH0 B;  3KUF A;  3JSC A;  3P8B B;  3CME A;  2QDL A;  2FYK A;  3A8M B;  3X26 B;  1D1B A;  1VQ4 Q;  5A2Q E;  5KYU A;  3V8L A;  2E12 A;  1OX8 A;  2XD0 A;  3TSW A;  1KSW A;  1UGV A;  2JTM A;  2EQI A;  4HXJ A;  2H3J A;  1YJW A;  1X6G A;  1KQS A;  4C5E A;  2C06 A;  1YIT Q;  5LJ5 f;  1BBZ A;  1Z9Q A;  1K8A R;  1WJQ A;  1WGS A;  1WXB A;  3C94 A;  7AT1 B;  1WXT A;  2FEI A;  4DBQ A;  3VS6 A;  4CC2 A;  1PG5 B;  1MMG A;  5GAO l;  5HK3 A;  1VQN T;  4C92 A;  4GBQ A;  4AFU C;  5IXB A;  3RKW A;  2FPE A;  4RCC A;  2VKN A;  2ZGW A;  5GMK e;  1QVF P;  1C6V X;  4F17 A;  1C1A A;  3GBQ A;  3M58 A;  2LT1 A;  4XTX A;  2EAY A;  1Y96 B;  3CCQ T;  5D6W A;  3RDV A;  1K8A U;  4NS5 A;  4XU2 A;  3LX7 A;  2KRM A;  5LJ3 j;  3QUI A;  4M78 C;  2NUP A;  4OGC A;  2FPF A;  3CBP A;  1K73 R;  3JCM V;  4PK4 A;  1HJD A;  1AWW A;  4L6V 5;  1VQN A;  3G6E Q;  2Z0W A;  1KHC A;  2DF6 A;  2YRC A;  4FSS A;  3CEY A;  2KQW A;  2KRS A;  4IUR A;  1OV3 A;  2XMF A;  1H64 1;  1FMK A;  2DKG A;  2YDL A;  4J9G A;  1QCO A;  2JTF A;  3VU3 C;  2CSQ A;  2HL3 A;  3OW2 S;  3UPU A;  4M7D A;  2E70 A;  3J80 E;  5CQY A;  3A5Z B;  3OBY A;  4AT1 B;  2HBP A;  3OSV A;  2XG8 D;  5CR2 A;  4VUB A;  1CSK A;  5GAN f;  3CCE T;  1C0M A;  2DD5 A;  1MGQ A;  4JJC A;  1VQ8 Q;  1MHN A;  3SD4 A;  3V7C A;  1D0X A;  1G83 A;  3D7S B;  1VQ9 Q;  2MAM A;  1RAD B;  4A53 A;  3CCU A;  3EFO A;  1GCP A;  5LJ3 e;  3H0I A;  4FT2 A;  1AD5 A;  5GAN 8;  3CCJ T;  2NUZ A;  1UGS B;  2DEU A;  1OPK A;  2RHY A;  2EQJ A;  4M77 B;  1KD1 C;  3QWX X;  2A0F B;  1N9R A;  2K6D A;  1RUW A;  1N8R C;  1WHM A;  2JXB A;  2VGM A;  2RF0 A;  4LXC A;  3CCR A;  2P0K A;  3CCL A;  4BE0 A;  3KFV A;  1KQS P;  1Y0M A;  3SWN B;  2ZPI B;  1YIJ T;  2ECZ A;  4M75 C;  2DL3 A;  2HNI A;  3RIR A;  4XU1 A;  4BI3 A;  5CKD A;  4QVD A;  2YT6 A;  3DB4 A;  1I8F A;  2EGC A;  2ZPH B;  3OS2 A;  3OS5 A;  2L89 A;  2ROT A;  3V7R A;  1R77 A;  1Y07 A;  2D0N A;  3T9N A;  2RHU A;  1VQ8 T;  1UGQ B;  4DQ2 A;  3L2U A;  4X9C A;  2SRC A;  4EMH A;  2WSC E;  2E5K A;  2RQW A;  2EYW A;  2P4R A;  3CME T;  1H3H A;  3KXT A;  2VC8 A;  3MKD A;  4AFS C;  1Y71 A;  3FC3 A;  3NHN A;  1YJ9 T;  4OB3 B;  2X9H A;  3OW2 A;  1BKB A;  3ASK A;  2EPD A;  4BDY A;  1D0Y A;  3OYL A;  2LNH B;  2RH2 A;  2LDM A;  1QCN A;  1XTD A;  4Y28 E;  3CPW S;  3FIF A;  2CP6 A;  2YUQ A;  2COY A;  1RI0 A;  2AKL A;  3UDC A;  2NWM A;  2HSP A;  5HCK A;  4IUQ A;  5LJ5 e;  3FB9 A;  1U3O A;  2LNV A;  1X01 A;  1TXQ A;  2R57 A;  2FVU A;  1UGP B;  4M7A B;  3RUX A;  4C8Q B;  2CP0 A;  3A1P A;  1NYF A;  4E2F B;  1BI0 A;  5GAM j;  1YN8 A;  4BUG A;  8AT1 B;  1YFN A;  4HKE A;  5CKB A;  3E2U A;  2RD1 A;  1N5Z A;  2OTL T;  3CMA T;  5IHK A;  1KD1 R;  2EJG A;  2EYZ A;  2JW4 A;  2P0P A;  3TQ7 P;  3CC2 A;  4M75 F;  4E7K A;  1M2V A;  3EG9 A;  4E47 A;  3CCL Q;  2HD0 A;  1S1N A;  4J9C A;  1OZ3 A;  4C5H A;  3GP8 A;  1E7O A;  2EYX A;  2X4W A;  2BZY A;  1I07 A;  3GIB A;  1OYX A;  3CPW A;  4FL6 A;  1PNJ A;  2G3R A;  2KI7 A;  3LH0 A;  4OF1 A;  4C0G A;  2HQE A;  3CCJ A;  2D9T A;  3JAM E;  4ZN3 A;  2DZC A;  3OYJ A;  3SB2 A;  2I2L A;  4LE9 A;  2RHI A;  2CP2 A;  4QVZ A;  1V29 B;  1JBM A;  3HKS A;  1VQK Q;  3HTR A;  3QDF A;  1YCY A;  1SPK A;  1QCF A;  3MP6 A;  2RQT A;  2FG0 A;  1ZUY A;  2ZPG B;  5IT9 E;  1T3S A;  2E64 A;  3CCM A;  1QP2 A;  4JRP A;  1M3C A;  2RPN A;  2XKO C;  2DTI A;  3L2Z A;  3C0C A;  3EH1 A;  3QWY A;  4C0D C;  3EG3 A;  5HY6 A;  1XNI A;  5A0L A;  3U23 A;  3NTH A;  2QYZ A;  1MV0 B;  2K4Y A;  3RMQ A;  3CXC A;  4J83 A;  3OYI A;  1I0C A;  1R0B G;  3CD6 A;  3M4Y A;  4JRK A;  1EZZ B;  2ZPE B;  4ZTF A;  2VVK A;  3DB3 A;  1KG1 A;  1WQW A;  1N8R U;  5GMK j;  2OAW A;  1QW1 A;  3EGD B;  3EGX B;  3LGL A;  4M77 G;  4N4H A;  1M1G A;  1ZSG A;  4J9D A;  5LJ3 d;  5LL6 S;  2GTO A;  2F2V A;  4A4E A;  1M1K C;  3A8L B;  1VQ5 T;  1OZ2 A;  2M0O A;  2DLP A;  2MWO A;  2DNU A;  4QQG A;  1V1C A;  4BD3 A;  1D3B B;  5GAO p;  3DKM A;  2DTO A;  4QQD A;  2JM8 A;  1EIF A;  2D1X A;  2JT4 A;  3CQT A;  4LN2 A;  2LJ3 A;  3E1S A;  2KXC A;  5LJ5 j;  1VQ6 T;  4A4K A;  1E6H A;  2F5T X;  4LDV A;  4X34 A;  3OMG A;  1PD1 A;  1WHJ A;  2X4X A;  4FIB A;  1Z9Z A;  3QKJ A;  5FU6 B;  4A63 B;  2LTO A;  4LDW A;  4PJL A;  3H9N A;  2RK1 A;  3H0H A;  2O4X B;  3RKX A;  2NLU A;  2LP5 A;  1WJR A;  2VV5 A;  3FEO A;  1YIJ Q;  1GL5 A;  1M2O A;  1RL2 A;  2G6F X;  2K7A A;  3LW5 E;  1WFW A;  4FSX A;  5GAN g;  3VUB A;  1K9M C;  1W1F A;  2RQV A;  2DYI A;  4FU6 A;  4R0K A;  2JS2 A;  2E6N A;  2EQK A;  2MIO A;  1VA7 A;  1WQ7 A;  2X3X D;  2MWP A;  4A4F A;  3I9Q A;  2L3R A;  1JJ2 S;  3G1J A;  1NJI C;  4GY5 A;  4O5V A;  2MK5 A;  2MMP A;  5EG2 A;  1Q86 R;  5GAN 7;  1KC8 U;  1KC8 R;  2J05 A;  1SF9 A;  3UT1 A;  4BDZ A;  3CCM T;  1JJ2 A;  1TU0 B;  3A8H B;  3G4S Q;  3VS4 A;  2L5Q A;  1KQS S;  1RAA B;  2DK3 A;  4OMN A;  3G71 Q;  4M7D E;  1VQ4 A;  2JUF A;  4HVW A;  4PJO D;  5AT1 B;  1VQL T;  2PVD B;  1KK7 A;  3QXE B;  1VQO A;  2DA9 A;  1AHJ B;  2QAS A;  2M9U A;  1SKU B;  4C0Z A;  5KYU B;  3P8D A;  1KIK A;  4PLI A;  4M4Z A;  5LJ5 h;  2V26 A;  1CKA A;  4ZGE B;  5KYY B;  4JS4 A;  3L1A A;  3RKY A;  3VS1 A;  3ZL7 C;  4CC7 A;  1ZBJ A;  3CCU T;  4A4H A;  1M1F A;  1YNZ A;  2ZPF B;  2DPP B;  1X43 A;  3QZ9 B;  3O5Z A;  2K3Y A;  1YJW T;  2ESW A;  2LVM A;  1BCO A;  4AMC A;  1FYN A;  3FJP A;  2XIC A;  3MEW A;  3Q1J A;  4L5G A;  2MCN A;  3INZ A;  3WVE B;  2FB7 A;  1T3L A;  1IRE B;  3FJ5 A;  3CXC S;  1CKB A;  1ZX6 A;  4IUV A;  3I56 T;  4OB0 B;  1AWO A;  2DM1 A;  4J6W A;  3ULR B;  5CKE A;  3I56 A;  3VV0 A;  2DET A;  3LYI A;  1OQK A;  3QII A;  2O2O A;  3LWH A;  4MMK A;  1AZG B;  1YJN Q;  2AIR B;  4J7F A;  2EBP A;  5LJ3 f;  5FU6 C;  1SSF A;  2NUP B;  2YRV A;  3EH2 A;  2VYT A;  1NG2 A;  3HRT A;  2A28 A;  3RBB B;  4LDU A;  2JS0 A;  3QPH A;  4XTW A;  4E7H A;  4XTU A;  3P8H A;  5C6S A;  1TH7 A;  2RHX A;  4JS5 A;  2X51 A;  1ZA2 B;  5FRN A;  2P0Q A;  4BI8 B;  4LD9 K;  4M78 D;  2CZ6 B;  2LMJ A;  2COZ A;  2M16 A;  5DY9 A;  2PZ1 A;  1HYO A;  3UA6 A;  4HCZ A;  4FW1 A;  5LJ5 g;  5J26 A;  1W70 A;  2XDP A;  3N5B B;  2AZV A;  2RM4 A;  1I1J A;  4XTY A;  4RTZ A;  3JRZ A;  1KQ1 A;  2HQH A;  5GAM g;  1M1K R;  3SFM A;  4M7A E;  5I2S A;  4KUL A;  4OP0 A;  1ZSZ B;  2PTK A;  1WX6 A;  4N4I A;  4Z89 A;  5GAN 2;  2PVG B;  5KYX A;  2LQN A;  2HZY A;  5GAM h;  3AT1 B;  2BZ8 A;  1YHQ Q;  3VS0 A;  1LCK A;  2ED1 A;  2FZG B;  1JXM A;  1BI3 A;  4PNO A;  5IHN A;  1O9S A;  4M7D B;  1K0X A;  4M77 E;  2KBT A;  1M8M A;  2ZAE A;  3QBY A;  2RQR A;  4JJB A;  4OVA A;  1QKX A;  3BFM A;  4C8Q G;  1K9M U;  4M7A G;  1VQ5 Q;  2MI6 A;  2V1R A;  2QQR A;  5IN1 A;  1U06 A;  1NEG A;  4E7J A;  5I21 A;  1N6A A;  2RI2 A;  2K2M A;  3L2W A;  1VQM Q;  5IH2 A;  1NE8 A;  2DXT A;  1VIE A;  4PFZ A;  1YJW Q;  2X3W D;  1MMA A;  4M78 F;  3ZEH A;  4ANJ A;  1K8A C;  4M77 D;  4C8Q D;  2LC4 A;  4P5N A;  3NGP A;  3DLL A;  3QO3 A;  3REB B;  3LH5 A;  1VQ6 Q;  1RAF B;  4DOV A;  2CZ1 B;  2F2X A;  3JV3 A;  4LUE A;  3C95 A;  4NL2 A;  1VQ4 T;  1YP5 A;  4RG8 A;  1VQL A;  4M7D F;  1SHF A;  1IGU A;  1N8R R;  3CCS T;  4CC3 A;  4XAX B;  3OYH A;  2O4X A;  3SWN A;  4C0F A;  1B3Q A;  4J5Y A;  9ATC B;  1PKS A;  5M9O A;  2CP7 A;  1YIJ A;  3THK A;  3J7A F;  2WSF E;  1JEG A;  3OA6 A;  2YWW A;  4JLG A;  3H41 A;  2R5M A;  5GJV B;  2D8J A;  5GAM f; 
#chains in the Genus database with same CATH homology
 1S1N A;  4J9C A;  1E7O A;  2EYX A;  1A0N B;  2BZY A;  1YWP A;  1I07 A;  4LNP A;  1BB9 A;  2ED0 A;  2AKK A;  1PNJ A;  3EHQ A;  2RMO A;  1VYU A;  2FRW A;  2I0N A;  4JZ3 A;  1IO6 A;  2L0A A;  2J6O A;  1WLP B;  3TSZ A;  2A08 A;  2DL5 A;  1WXU A;  3I35 A;  1HSQ A;  3VS5 A;  1X2K A;  2HCK A;  2EVR A;  4LE9 A;  4AG1 C;  2MOX A;  1UHF A;  2EGE A;  4F16 A;  2DL4 A;  1ABO A;  3VS3 A;  2W10 A;  2CH4 A;  1SPK A;  1TG0 A;  2DRM A;  1QCF A;  2HDA A;  2RQT A;  2DBK A;  1PRM C;  4Z8A A;  2FG0 A;  1X69 A;  1ZUY A;  4J9H A;  2K9G A;  1U5S A;  4OMQ A;  1T3S A;  1HD3 A;  2DVJ A;  1ARK A;  1AZE A;  4JPB W;  1YWO A;  4J9B A;  4CC4 B;  1M3C A;  2RPN A;  4HCK A;  3C0C A;  4OML A;  3UA7 A;  3UAT A;  3QWY A;  4RTU A;  2O9S A;  3EG3 A;  1JQQ A;  3PVL A;  1H8K A;  2DYB A;  1ZUK A;  2YUO A;  3U23 A;  1ABQ A;  1MV0 B;  3I5S A;  3NMZ C;  2KR3 A;  3M0Q A;  1I0C A;  2FPD A;  3REA B;  3M0S A;  3VS2 A;  2GTJ A;  2VVK A;  1UG1 A;  4GLM A;  1K9A A;  2A37 A;  4AFQ C;  1GCQ C;  2CT3 A;  1XOV A;  2OAW A;  2PNI A;  5EC7 A;  3PVQ A;  3NPF A;  4OMM A;  1GBR A;  2AK5 A;  1SEM A;  4JZ4 A;  1QWE A;  1ZSG A;  4ORZ A;  4J9D A;  1GCQ A;  2BZX A;  5I11 A;  2EKH A;  2KNB B;  2GTO A;  2F2V A;  3TVT A;  1SRL A;  1KJW A;  2HBW A;  2DLP A;  2DNU A;  2EGA A;  1ZLM A;  2EYY A;  2J6F A;  1AWX A;  1V1C A;  4D8D A;  2SEM A;  4ZNX A;  1M30 A;  3H0F A;  2LQW A;  5FW9 A;  1EFN A;  2YSQ A;  2JM8 A;  2D1X A;  2JT4 A;  4D8K A;  3CQT A;  4RTW A;  4LN2 A;  2IIM A;  2LJ3 A;  2DMO A;  2KXC A;  5FWB A;  1KFZ A;  1E6H A;  3EG2 A;  5GJW B;  2LJ1 A;  2JMA A;  1UE9 A;  2KRO A;  1UUE A;  1Z9Z A;  1K0S A;  4A63 B;  1G2B A;  1PWT A;  2KE9 A;  2RQU A;  3H0H A;  3M0R A;  1WIE A;  1VYV A;  2LP5 A;  3VS7 A;  1MV3 A;  2O88 A;  3M0P A;  4RTY A;  5IHI A;  2A36 A;  1M3B A;  1RLQ C;  1GL5 A;  2G6F X;  2K7A A;  2HEQ A;  1TUD A;  1WFW A;  1UDL A;  2B86 A;  1W1F A;  2RQV A;  4R0K A;  2JS2 A;  2CSI A;  1SRM A;  1RI9 A;  2DRK A;  2QDL A;  2MIO A;  1VA7 A;  2L2P A;  2X3X D;  1SSH A;  1KSW A;  1UGV A;  3TSW A;  2EQI A;  3I9Q A;  1B07 A;  2J6K A;  4HXJ A;  3UF4 A;  2LJ0 A;  1X6G A;  3SEM A;  1M3A A;  4K11 A;  1PHT A;  2J05 A;  1BBZ A;  1X2Q A;  1Z9Q A;  3VS4 A;  1WXB A;  5IXF A;  2RNA A;  1WXT A;  4X1V A;  4DEX A;  2FEI A;  1YCS B;  4OMN A;  2YUP A;  4KRT A;  1PRL C;  3M0T A;  4HVW A;  3VS6 A;  4CC2 A;  2RN8 A;  2O31 A;  1NEB A;  2DA9 A;  2DL7 A;  4GBQ A;  4AFU C;  5IXB A;  1TUC A;  2FPE A;  4E6R A;  1KIK A;  2VKN A;  4J9F A;  4HVU A;  4F17 A;  4M4Z A;  4RTX A;  3GBQ A;  2DJQ A;  3A98 A;  1CKA A;  1JU5 C;  4LUD A;  1WYX A;  2YUN A;  1K4U S;  3VS1 A;  3ZL7 C;  4CC7 A;  1ZBJ A;  2L3P A;  1BU1 A;  4DEY A;  2KRM A;  2ENM A;  1YNZ A;  2FPF A;  2KT8 A;  1X43 A;  2VWF A;  2OJ2 A;  1HJD A;  4J9E A;  3O5Z A;  2ESW A;  2KT1 A;  1AWW A;  1NYG A;  4RTV A;  1PKT A;  1FYN A;  1GRI A;  2CUD A;  1GFD A;  2MCN A;  5FWC A;  1UJ0 A;  2DF6 A;  4FSS A;  2KRS A;  1T3L A;  1ZUU A;  1T0H A;  3FJ5 A;  1CKB A;  2GQI A;  2DBM A;  1OV3 A;  1ZX6 A;  2XMF A;  4RTT A;  1FMK A;  2YDL A;  4J9G A;  1M27 C;  4OMO A;  1JXO A;  1W6X A;  1AWO A;  2CSQ A;  2DM1 A;  2DIL A;  3ULR B;  1E6G A;  2CRE A;  3EGU A;  2O2O A;  1AZG B;  2EBP A;  3PE0 A;  1CSK A;  4OMP A;  4QT7 A;  1NG2 A;  2A28 A;  1QLY A;  4HVV A;  1UTI A;  3RBB B;  1AWJ A;  5ECA A;  4JJC A;  2JS0 A;  1WI7 A;  3IQL A;  1WDX A;  1J3T A;  1G83 A;  2DX1 A;  1QWF A;  2KYB A;  4J9I A;  1GCP A;  3H0I A;  2AZS A;  2LMJ A;  1AD5 A;  2PZ1 A;  2W0Z A;  2NUZ A;  3UA6 A;  2LCS A;  2CT4 A;  2J7I A;  1OPK A;  1NLO C;  1W70 A;  4WCI A;  2M51 A;  2AZV A;  2GNC A;  4JJD A;  3QWX X;  1I1J A;  2ABL A;  3SHW A;  4RTZ A;  2JMC A;  2K6D A;  3EG0 A;  2C0O A;  1RUW A;  2JXB A;  2RF0 A;  1AVZ C;  2FO0 A;  4AFZ C;  2JTE A;  3KFV A;  1Y0M A;  2ECZ A;  2PTK A;  1WX6 A;  4Z89 A;  2DL3 A;  2LQN A;  2BZ8 A;  2KEA A;  3VS0 A;  1UJY A;  1AOJ A;  1WA7 A;  2YT6 A;  1LCK A;  2EGC A;  2ED1 A;  3EHR A;  5I22 A;  2ROT A;  1JXM A;  3I5R A;  2GBQ A;  2D0N A;  5IHN A;  2J06 A;  1T0J A;  4IIO A;  2H8H A;  1K0X A;  1Y57 A;  2KBT A;  1M8M A;  1GFC A;  2RQR A;  4JJB A;  1K1Z A;  2DE0 X;  1QKX A;  2V1R A;  2SRC A;  2F2W A;  2KGT A;  3M0U A;  2E5K A;  2RQW A;  2EYW A;  2P4R A;  1H3H A;  1X27 A;  2O9V A;  2JM9 A;  4IIM A;  1U06 A;  1NEG A;  4AFS C;  3NHN A;  4EIK A;  2BTT A;  1OEB A;  2KXD A;  1MUZ A;  2K2M A;  2LZ6 B;  5IH2 A;  2EPD A;  4Y92 A;  2LNH B;  1H92 A;  3R6N A;  1X6B A;  3VRY A;  1JO8 A;  2L3Q A;  2X3W D;  1OPL A;  2DL8 A;  1UHC A;  2YUQ A;  4ESR A;  2AKL A;  2NWM A;  2HSP A;  5HCK A;  1UEC A;  2C0I A;  2K3B A;  1U3O A;  2K79 A;  3NGP A;  1QKW A;  3REB B;  3LH5 A;  5L23 A;  2C0T A;  1BK2 A;  1NLP C;  2F2X A;  1UFF A;  1NYF A;  1SHG A;  3JV3 A;  4LUE A;  1YN8 A;  1YP5 A;  2LX7 A;  1SHF A;  4F14 A;  4Z88 A;  4CC3 A;  2EW3 A;  3EG1 A;  1GBQ A;  1N5Z A;  1NM7 A;  2CUB A;  2KYM A;  1OOT A;  2ROL A;  2CDT A;  1B3Q A;  2KRN A;  1K76 A;  2L3S A;  1PKS A;  1RLP C;  1VYT A;  5IHK A;  3THK A;  2EYZ A;  4RUG A;  1AEY A;  2JW4 A;  1JEG A;  2FRY A;  2GGR A;  2M0Y A;  3RNJ A;  4AG2 C;  2CH4 W;  2V1Q A;  3H41 A;  2OI3 A;  2D8H A;  2D8J A;  5GJV B;  3VRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...