1T0JA

Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
RREAERQAQAQLEKAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords voltage-gated calcium channel subunit beta2a
publication title Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 23
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12052 VGCC_beta4Aa_N Voltage gated calcium channel subunit beta domain 4Aa N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1t0jA00
3EHRA 2EYWA 2AZVA 4AFZC 2NUZA 4RTXA 1T3LA 5GJVB 2O31A 4D8KA 1GFDA 5I22A 1QWEA 2JS0A 1M30A 1SPKA 1AVZC 3EG1A 2LJ1A 1ZUYA 2BTTA 4OMQA 2C0OA 1BB9A 4OMLA 3NHNA 2G6FX 1OV3A 2GGRA 3VS4A 2O88A 2K79A 3H41A 1X6BA 1UG1A 5IXFA 1K76A 2YUQA 3ZL7C 2DJQA 1AEYA 1UHFA 1QKXA 2VWFA 3H0FA 5IHKA 2L0AA 2DM1A 1WI7A 4Y92A 2J7IA 4RTUA 2M0YA 2C0IA 1AWWA 2JS2A 2KEAA 2FRWA 1LCKA 4J9CA 4RTZA 1UJ0A 1JU5C 2JT4A 4ORZA 2SRCA 1G2BA 2YUPA 3VS5A 2RN8A 3FJ5A 1ABOA 1KFZA 2O9SA 2LQWA 1AWOA 2K7AA 5GJWB 2LJ3A 2RMOA 2JM9A 3H0IA 2H8HA 5IXBA 1RLQC 2DF6A 1E7OA 1OEBA 1VA7A 3NMZC 3R6NA 2FG0A 4JJDA 1WXBA 1BK2A 4RTTA 2GTJA 4LN2A 1U3OA 2KRSA 2V1QA 4GLMA 1NLOC 1ARKA 3RNJA 2EGCA 2HCKA 2D0NA 1JXOA 2YUNA 1HD3A 1M3BA 2YDLA 2F2XA 1BBZA 1TG0A 2KBTA 4RTWA 1X2QA 2JM8A 1G83A 1ZUKA 1SHGA 3LH5A 3VS6A 3O5ZA 1X27A 2K9GA 1A0NB 1YWPA 1E6HA 2DX1A 3I5RA 2LZ6B 2CSQA 4LNPA 4F17A 5IHNA 2GBQA 1AD5A 1Y57A 3PVLA 2DBKA 2DRMA 4HVVA 1BU1A 1H92A 2W10A 4F16A 4J9HA 2I0NA 3C0CA 4M4ZA 4CC2A 3VS3A 1WX6A 5HCKA 2CUDA 2RQUA 2KRNA 3M0RA 2CT3A 2XMFA 2K3BA 5I11A 4X1VA 2DYBA 1NG2A 3SEMA 4J9BA 3REAB 1MUZA 2A08A 4AG1C 4AFQC 2A37A 1AWXA 2SEMA 1OOTA 2KXCA 2J05A 2A28A 2DLPA 1GFCA 1Z9QA 1X69A 1M8MA 1JXMA 2ABLA 2ENMA 3M0PA 2RQVA 1ZX6A 3EGUA 4J9GA 1WFWA 2CREA 2EW3A 3U23A 1HJDA 1GRIA 4ZNXA 3REBB 2PTKA 1QKWA 1QLYA 2IIMA 2RPNA 4JPBW 2EKHA 2LMJA 5FWBA 1PRMC 1I0CA 2D1XA 2F2VA 5FWCA 2DRKA 2KNBB 1JO8A 1K0SA 1YWOA 2DL3A 1FYNA 3UF4A 1K1ZA 2NWMA 4F14A 1YNZA 2DMOA 5L23A 2RNAA 1MV0B 2QDLA 1U06A 3ULRB 2J6FA 1GBQA 1V1CA 1RLPC 2CSIA 4IIMA 1H3HA 1OPLA 3VRZA 1WDXA 2KROA 2DILA 1ZUUA 2JTEA 4IIOA 1UDLA 1MV3A 2EYYA 1AZEA 2ED1A 1UE9A 3M0SA 1KIKA 1IO6A 2BZ8A 1PKTA 1PHTA 1ZSGA 2ROTA 1SEMA 4AFSC 1E6GA 2MOXA 2FPDA 2MIOA 2DE0X 4DEYA 2D8JA 3VS2A 2KRMA 1SRLA 2B86A 2K2MA 1GCQA 1WA7A 3H0HA 1VYVA 2GNCA 3RBBB 4RUGA 1HSQA 1K9AA 2CH4A 2GQIA 2ECZA 2RQRA 2OI3A 3QWYA 2JXBA 2A36A 4HVUA 4JZ3A 4R0KA 1KSWA 1ZBJA 1K0XA 1FMKA 4HXJA 2DL8A 4D8DA 2HSPA 3EHQA 1UHCA 4J9DA 3PE0A 1QWFA 2DL7A 3A98A 4WCIA 1AWJA 1M27C 1UTIA 1WXTA 3TSWA 1PNJA 4J9EA 2JMCA 1GL5A 4JJBA 5IHIA 1OPKA 1SHFA 1W1FA 3SHWA 2LX7A 2KXDA 1SSHA 4OMMA 4RTYA 1PKSA 2EBPA 2J6KA 2BZYA 3GBQA 1M3AA 3EG2A 2FPFA 1T0JA 2X3WD 1CKAA 2EQIA 2ROLA 2EYZA 2LJ0A 2DNUA 3KFVA 1X43A 1X6GA 2HEQA 3VS1A 1UUEA 3VRYA 2OJ2A 1GBRA 3THKA 2PNIA 3M0TA 5EC7A 2LP5A 2HBWA 1VYUA 4E6RA 1M3CA 1UECA 4Z89A 1X2KA 2C0TA 2CT4A 1J3TA 2KGTA 2J6OA 1UGVA 3UA7A 3I5SA 4EIKA 2YT6A 2CH4W 1Z9ZA 4Z8AA 1PWTA 2KYMA 4HCKA 2RF0A 1WYXA 2YSQA 3CQTA 1H8KA 1UJYA 2K6DA 2YUOA 1SRMA 1NEGA 4CC4B 1AZGB 4AFUC 4CC3A 2P4RA 1I1JA 1AOJA 4ESRA 3JV3A 2DBMA 5FW9A 2V1RA 2FPEA 3EG3A 3UATA 2M51A 2DL5A 3I9QA 1NYFA 4JJCA 2RQWA 1N5ZA 5IH2A 1B07A 2O9VA 1CSKA 4LUDA 3VS7A 1TUCA 3IQLA 2E5KA 1YCSB 2LCSA 2CDTA 4CC7A 4JZ4A 4K11A 4HVWA 1NLPC 4DEXA 1KJWA 2L3QA 2EPDA 2FEIA 1GCQC 2PZ1A 2KE9A 2RQTA 2X3XD 1K4US 3VS0A 1NYGA 2DA9A 2AKLA 1S1NA 2VKNA 2FO0A 4GBQA 4LUEA 2FRYA 4RTVA 2HDAA 3EG0A 1ZLMA 2DL4A 1EFNA 3M0QA 2KR3A 2BZXA 2L3SA 2F2WA 3PVQA 1JEGA 1YN8A 2J06A 2KYBA 2AZSA 1TUDA 2EVRA 4OMNA 3NGPA 2LNHB 1NEBA 2EGEA 2EYXA 1CKBA 4AG2C 2D8HA 2KT1A 2L2PA 4J9FA 2ED0A 2AKKA 2GTOA 1W70A 2CUBA 2LQNA 2L3PA 2AK5A 4QT7A 2DVJA 2MCNA 2JMAA 3I35A 1ABQA 4LE9A 2VVKA 2KT8A 4A63B 1YP5A 4Z88A 1RUWA 3NPFA 1WLPB 2OAWA 1I07A 3UA6A 1T3SA 1XOVA 1VYTA 1RI9A 2O2OA 3M0UA 1W6XA 3QWXX 1NM7A 3TVTA 1UFFA 4OMOA 5ECAA 1JQQA 4FSSA 1PRLC 1WIEA 1QCFA 1GCPA 2JW4A 2W0ZA 2EGAA 1WXUA 4OMPA 1B3QA 1T0HA 4KRTA 4J9IA 3TSZA 1U5SA 2ESWA 1Y0MA
chains in the Genus database with same CATH superfamily
2EYWA 4AFZC 1NJIU 2EJFA 3L2VA 3QUIA 4Y91A 1TTHB 1Y07A 3URGA 2F1LA 1YITT 1ZUYA 1VQ4Q 1BB9A 4M77A 1K73C 3QIIA 3BDLA 3H41A 4OGCA 5IXFA 2YUQA 5HK0A 1SG5A 1QKXA 3H0FA 3VJPA 4Y92A 3FDRA 3DB3A 3QZ5B 2JS2A 1OYXA 1PD1A 2LCLA 4AMCA 1AHJB 4FIBA 2Y4XA 1WHLA 2IVWA 2SRCA 4IUUA 4R56A 4VUBA 1QVGA 2HQXA 3OYYA 3SWNC 1OX9A 5I2MA 5M9OA 1RI0A 2KI7A 1C1AA 2JN0A 4QQ6A 2LQWA 4A53A 1UGSB 5GJWB 3G71Q 2MYSA 2LJ3A 2JM9A 2K5IA 5FRNA 1RLQC 2DF6A 2QQBA 2K3YA 2LC4A 1XTDA 2DO3A 1OEBA 1VA7A 2COYA 1IHVA 1YJNQ 3SB2A 1BK2A 4FW1A 1D0XA 4ZN1A 1D0YA 3CCMQ 1Q7YU 3MEWA 3ME9A 3RMQA 1U3OA 2V1QA 2OTLQ 4J83A 1OZ2A 4DBFA 1ARKA 3CMAQ 4OF1A 5LJ3j 3CMEQ 2ZPHB 4X9CA 3J7AF 3HRUA 2VB6A 4Y28E 2DKGA 3HP9A 3PGGA 3R6OA 3OYEA 2VASA 1X2QA 3C4SA 4M77G 4M7DE 4E2FB 1BIAA 2QQAA 4MZTA 4C8QA 4N4HA 1ZUKA 3LH5A 1X6OA 1A0NB 1YWPA 4F17A 4LNPA 2CSQA 1VQKT 3I55A 1MMAA 3AHUA 1AD5A 2DRMA 4A4HA 3G6EA 1OU8A 1BU1A 4J9HA 4M7DB 4M4ZA 3OYLA 3CXCP 1WX6A 5HCKA 3CCSQ 1YI2T 3M0RA 2HQEA 1D3BA 3L2UA 2XMFA 4M77D 3GLXA 5GAN2 1MUZA 4AFQC 2A37A 1AWXA 3EH1A 3V7CA 2XK0A 1OOTA 1RL2A 2KXCA 4OB1B 1YJ9T 4L59A 1GFCA 2QG9B 4MZMA 2ABLA 4A54A 2A3LA 2ENMA 4WF2A 3RUXA 2DERA 1QVGS 3QO3A 2PVDB 3P8HA 4F7UE 1FWZA 2RD1A 1VQ9T 5KYYB 3M56A 3LX7A 5A2QE 2DETA 3CCRT 4IUTA 2QXFA 1I0CA 1I5OB 3PNWC 3CC2A 2CZ6B 2KNBB 1O9SA 3JB9F 4F7UB 2QEXT 3UF4A 1K1ZA 2NWMA 1YNZA 1LOJA 2B8AA 1U1TA 1B7TA 5L23A 2CGHA 2QDLA 1GBQA 4NL3A 3T9NA 1RLPC 2DPPB 2VXFA 2ZZDA 1H3HA 1OPLA 2KROA 4LXCA 2DILA 2LQ8A 2X9HA 4FYXB 4M7DF 1M90U 4IIOA 1R0CB 1MV3A 1AZEA 1TUGB 4C8QD 4IUPA 4OB0B 3V7SA 2BZ8A 1PKTA 1NJIR 3Q1JA 3RR6A 1E6GA 5IAYA 4IURA 3RKXA 4PJMA 1VQPQ 3V7RA 3CCVA 2XHCA 5CQYA 4LDWA 2KRMA 1YI2Q 1VQMA 1D09B 2B86A 1YIJA 3L2RA 3MPUB 2EQJA 1GCQA 1WA7A 3CCJA 4RUGA 2K2VA 1K9AA 2YRVA 4ELZC 2GQIA 1QP3A 4EMKB 1M8VA 1S72T 2EFIA 2V8KA 5FLXE 2ECZA 5GAMj 4RG2A 4II1A 4PJOC 3CCQQ 3I56Q 1JJ2A 1WJRA 3V8KA 3QWYA 4HCBA 1KSWA 3FB9A 1U8RA 5CKEA 3JCMW 5LJ3f 3EHQA 1JB0E 5GAN5 3J81E 4F7UF 4M77E 3PE0A 1QWFA 2DL7A 3A98A 2A0FB 3QXEB 1PNJA 2WSEE 2NLUA 3HRTA 2CS7A 3CCET 2YRCA 3JCMf 2I2LA 5D6WA 3CPFA 2BZYA 1WJSA 4M77B 2COZA 4QVCA 2QQ9A 3RIRA 3SD4A 4C5IA 4HT8A 2NYSA 3FJPA 2AT1B 3MEAA 5EC7A 4QKUA 1C0MA 2M16A 1UECA 4Z89A 1KHIA 3CC7A 2PUKB 1J3TA 2XDDA 2PVOB 4EIKA 3I5SA 4ZN3A 2FYKA 2RJCA 4ELYC 4X9DA 4CRIA 4Z8AA 2CYZB 1PWTA 1N6AA 3BE3A 4HCKA 2PU9B 1VQ8Q 3CQTA 5LJ5j 1HK9A 1NEGA 1AZGB 1K8AU 1I1JA 1KG1A 1NPPA 4BDZA 2CKKA 4JRIA 1VQLA 5LL6S 4C8QE 4JRPA 4JJCA 3C95A 1S72Q 4LUDA 1CSKA 2KSSA 4XU3A 5GMKj 3JB9I 3OA6A 1NJIC 1TUCA 3BFMA 2LCSA 4MDWA 5DLOA 4K11A 1DJ7B 4QVZA 2L3QA 4C8QB 1RABB 3LW5E 2RB6A 1K4US 4D6WA 4PFZA 1KHCA 2F5KA 4M77F 4C92A 2DA9A 1C6VX 1TH7A 1VQKA 2E41A 3EG0A 3ZFJA 3O8VA 1ZLMA 1SSFA 2KR3A 5KYXA 2VUBA 2F2WA 3PVQA 3OQ5A 4NS5A 1YN8A 2J06A 2GCXA 1TUDA 3LWIA 1D3BB 2EVRA 4OMNA 1VIFA 3E1SA 4OB3B 1MHNA 3FLGA 1ZQ1A 5GANg 5FU7C 4DQ2A 2XG8D 1Q95G 1RAFB 2KT1A 2VC8A 2DD4A 4J9FA 1W4SA 2ED0A 2AKKA 4J8OA 4C0DC 4PNOA 2JVVA 5LJ3e 2AK5A 3HHTB 1YJWA 1YJ9A 1ABQA 4KGXB 1M90R 2HNIA 4PL6A 5GAMf 4X34A 4KGVB 2OAWA 1BIBA 3CXCA 2DXBA 1I4K1 1IRXA 3UA6A 2JOYA 1XOVA 6AT1B 3M0UA 2O4XA 1NM7A 3PIPA 3CCRA 1VQ7A 1PRLC 2EWNA 2OTJT 2W0ZA 1KQ1A 1JBMA 2G3RA 1B3QA 4J9IA 4C8QF 1VQ5Q 4FYYB 2MAMA 2V8IA 1P92A 5CR2A 2KMTA 3QYGB 2DJZA 3NTHA 1YHQT 3GPLA 2BIVA 1SPKA 2V26A 5A0GA 4XK8E 2ZPBB 4BACA 2ZGWA 2VV5A 2E5QA 4OMQA 2C0OA 3DKMA 3NHNA 2GGRA 4C92D 2O88A 2K79A 1RAAB 2DJQA 2P0KA 2E10A 1AEYA 2MPXC 3OBWA 5IHKA 2L0AA 4RTUA 3OBYA 2C0IA 3CCUT 2QQSA 3CD6A 1AWWA 1ZSZC 4M7AA 2FRWA 2ATCB 1WHJA 2X35A 2MI6A 3VYHB 5LJ5f 3CC2T 1JU5C 2PVGB 4QQDA 1G2BA 2CP5A 3VU3C 2RN8A 3FJ5A 1ABOA 1AWOA 5GANe 4A4GA 4MDXA 1QQJA 2X4XA 3H0IA 4RG8A 2H8HA 1QVFP 2QI2A 4JLIA 3EFSA 5I2SA 1E7OA 3OS5A 3QDRB 1B34A 5CO7A 3WVEB 1ACMB 1WXBA 4RTTA 5IN1A 5CIUA 3VUZA 3TREA 2RJFA 1JXOA 3I55Q 3VKIA 2F2XA 1BBZA 2KBTA 3X24B 4JLGA 1K8AR 2DTOA 5DY9A 3HKSA 5DM7R 2RHUA 3G6EQ 5FRMA 2JTFA 5GAN6 3RESA 3CCVT 1M90C 1SHGA 3O5ZA 2CP6A 3LH0A 1YIJT 1E6HA 2HKNA 1NBEB 3CCJT 5IHNA 1Y57A 4M7AG 2DBKA 2GFUA 4FSXA 4PJOA 3QJYA 2DZ9A 3QSUA 4BI4A 1HXDA 3DB4A 3C0CA 1IHWA 1G3WA 1LPLA 2E6ZA 1TU0B 3CBMA 2K57A 2KRNA 1WHGA 3OYCA 3KBGA 3L42A 1RADB 3OMCA 3D7SB 1M5Q1 4AG1C 2WACA 3G4SA 2YHTA 1BYMA 1MMGA 4Q5WA 2DLPA 4J7IA 3MJXA 4M7AD 1JXMA 3TEEA 3M0PA 3M4YA 1HYOA 3INZA 4EPCA 3OYAA 3F70A 5GAN4 4J9GA 4EMGA 4XTYA 4C92E 1HJDA 2LT4A 3REBB 5CKDA 1TWBA 2E3HA 3LLRA 4B6MA 3GNGA 1KQ2A 2LTOA 3UPUA 1R77A 1PRMC 3NTKA 5FWCA 2K4YA 4ZGDB 2K5LA 2QYZA 1K0SA 4B9WA 1KQSP 7AT1B 4C92B 1UB4A 4PJOG 3TU4K 3RKWA 2RNAA 3A8MB 3NTIA 4EMHA 2J6FA 3CC7T 5GMKl 5KYXB 3CC4A 2E65A 1ZUUA 1OU9A 2L89A 2CP3A 4C5HA 4JRQA 5AYFA 4LDXA 1UE9A 1YBYA 3M0SA 4N4IA 1VQMQ 2QDYB 1YIJQ 3HRSA 1PHTA 1K9MR 1RACB 1SEMA 3VYGA 1VQLT 2VXEA 2MOXA 2MWPA 1KC8U 4PJOD 2JTMA 2FPDA 5KYWA 2DE0X 2E3IA 2D8JA 3OYMA 1SRLA 2K2MA 4E7SA 1K8AC 2PQWA 1HSQA 2QK0A 1VQNT 3ASKA 2CH4A 2O4XB 5D6XA 3RERA 4FM4B 5CKBA 5GAOq 3OSVA 3OS2A 2OI3A 4ANJA 2JUFA 4HVUA 1X75C 2JJ9A 3PT9A 2OTJA 2DL8A 1PC0A 1YITQ 4GY5A 2NUTA 4C92F 1M27C 1XNIA 1JRIA 1WXTA 4MMLA 5KCHA 4J9EA 3TQ7P 3L2QA 5HKCA 5KE3A 1YHQA 1OPKA 1SHFA 1W1FA 3RDVA 3SHWA 3CCLT 2IG0A 4OMMA 4M7AE 4RTYA 2J6KA 1FMWA 1YJWT 4KULA 1WHMA 2ROLA 2EQIA 2QA4T 4LDYA 2EYZA 3JCMQ 1TS9A 4M7DC 1X43A 1TSFA 3VS1A 1I5LA 4M7AB 3CCUA 4JJNK 4E7ZA 2DXCA 2XKOC 3EG9A 1YCYA 2C06A 1VYUA 2DXTA 1VQ7T 4M75C 1M3CA 3OYKA 3OYGA 1WGSA 1QW1A 1UEBA 2EQMA 5GAOn 2KGTA 1PSEA 4KUDK 1FXXA 3UA7A 3L2ZA 1QCNA 2RF0A 1WYXA 4PFPA 2YSQA 2YLBA 2YUOA 4JUVA 3QG1A 2P4RA 1B34B 4HCZA 3HL8A 3JV3A 1AT1B 2DBMA 5FW9A 3CBPA 3OW2P 3QBYA 2V1RA 3FEOA 2FPEA 2BE7D 1MGQA 3I9QA 4BE2A 1NYFA 2DK3A 4J7FA 2RQWA 1M2VA 2O9VA 1WQWA 1M9SA 5CKHA 2FB7A 1K9MC 3IQLA 2DVEA 1ZSZA 3KXTA 1VQKQ 4R55A 2KQWA 2CDTA 4GLKA 2RI3A 1QMCA 4JZ4A 1MNDA 3CD6T 4DOWA 2QGFB 2X3XD 3VS0A 3JRZA 2AKLA 1S1NA 1UGRB 2FO0A 3X26B 1N9SA 4RMOA 2ZPFB 5KCOA 2LDMA 4A4EA 4PJOB 5LJ3h 1D1BA 5GAOl 3M0QA 5GANd 3M55A 4M7AF 2KYBA 1UGQB 2P84A 1OI1A 3G71A 2ZPGB 1YJ9Q 3HFOA 3NGPA 3L1AA 1CKBA 3TCJA 4AG2C 5KYNA 1YJNA 1G3SA 1W70A 3CCMA 1FMVA 3HFNA 5HK3A 1VQ9Q 4N0AC 2OTLA 4LE9A 3DLMA 3CCRQ 4A63B 5EG2A 3CMEA 1IGUA 4Z88A 1RUWA 3OYFA 4ZTFA 1I07A 2JZ2A 3VV0A 3UWNA 4BE0A 1VYTA 2QEXQ 3PMTA 1W6XA 3MO8A 3QWXX 4XAXB 2RI5A 1KC8R 3TVTA 2HD0A 5GMKi 2X4YA 3HSBA 3JB9H 5LJ3g 1WIEA 2MK5A 3A8OB 1QVPA 4OMPA 3FIFA 2HZYA 2LRQA 4JRKA 3QYHB 3V8LA 3DLLA 1Y0MA 1VOMA 3EHRA 1R8OB 1SF9A 2AZVA 4RTXA 5GJVB 5I22A 3JCMg 4OMFB 1M30A 1AVZC 2DFUA 2LJ1A 3G4ST 4C5GA 4OVAA 3CD6Q 3M53A 1BI2A 2BTTA 2HL3A 3EGDA 1R0BG 1M1FA 2G6FX 2K3XA 5KE2A 2GF7A 3JB9J 5GANh 2COWA 1WI7A 2J7IA 4J6YA 1IZ6A 5KYWB 1N8RU 1JJ2S 2KEAA 1FX7A 1LCKA 1PD0A 4LD9K 4E47A 4DBHA 4OB2B 4BDYA 3ER0A 1VQNA 2O9SA 1ZA2B 2K7AA 3PFSA 1QVGP 3SWNA 3P8DA 2RHZA 5C6SA 3R6NA 2FG0A 3CC4T 3CCEQ 1RAEB 3E19A 4KT0E 5FU7B 2NUTB 8AT1B 3G7ZA 5GAOp 2XI9A 3JSCA 3RNJA 5GAMh 4BI8B 2YUNA 1HD3A 2EYQA 4C8QC 4RTWA 1TG0A 1VQOT 3CCLA 5D7UA 1G83A 2FHDA 2M0OA 4BUGA 4C0ZA 2L8DA 4FL6A 1W2BP 4QQGA 3VS6A 1X27A 4ATOA 2QA4A 2LZ6B 3JCMb 2VYTA 2RHIA 5C0MA 2E1HA 3PVLA 4L5GA 2EKOA 1QP2A 4HVVA 1H92A 2W10A 3EG9B 3M54A 1KC8C 3VS3A 3JCMe 2CUDA 4FYWB 2RQUA 1KD1R 3CCQA 3I56A 4OP0A 1SKUB 3G1JA 2CT3A 4ZGEB 1NPRA 1WHKA 2VGMA 2DAQA 4X1VA 2DYBA 3KUFA 3UT1A 4M78C 3FC3A 2SEMA 5CKFA 5FU6C 5GAMg 1ZBXA 3HPWA 1ZHIA 1Z9QA 1K9MU 3OS0A 1ZX6A 2DXUA 3ZEHA 2RM4A 4XTWA 1WFWA 2RK1A 4BI3A 1Q86R 3U23A 1M2VB 4BY6B 3RMSA 4J6XA 2PTKA 3A5ZB 4JPBW 1ZSZB 2EKHA 1M4ZA 4PLIA 3X25B 2DYIA 4E7JA 2LT1A 2F2VA 1UGPB 4LDVA 2CP7A 1TOVA 4M75A 1FYNA 1G8XA 4F14A 2ZCFB 3CBOA 1IB8A 4BE1A 3OW2A 2DMOA 4KGZB 3CPWP 2KY9A 3QJ6A 3GP8A 1GXIE 1V1CA 1IREB 2CSIA 1XJWB 4WTOB 1Q81R 2HQHA 3H9NA 4RCCA 3VRZA 5GMKm 2FZGB 2O01E 2JTEA 3OMGA 4E7LA 1VQ8A 1UDLA 2RI2A 1IGQA 5J26A 2DIGA 3P8BB 4HKEA 3CXCS 1ZSGA 1RAHB 2ROTA 1VQ4T 1LNXA 5LJ5g 1N27A 4DEYA 2IPOB 3VS2A 4BB7A 3QPHA 5J3BA 3H0HA 4LDUA 2GNCA 1VIEA 1BKBA 3GNFB 4PFOA 2OTJQ 2HSEB 3OYIA 2EJGA 1N8RR 5CK9A 3OYHA 2RO0A 4M75G 4JZ3A 2A36A 2KK4A 1ZBJA 1K0XA 2VGNA 1YHQQ 1FMKA 4HXJA 5GAMe 1TXQA 5D6YA 2HSPA 4D8DA 2QQRA 4WCIA 3MEVA 1KD1C 3A8HB 3G71T 2EQKA 3TSWA 2JMCA 1GL5A 5IHIA 3JCMc 1YJNT 2K5FA 1SSHA 2DEQA 5IT9E 3CCMT 2OX7A 4NL2A 3CCUQ 2EBPA 3OW2S 4M75D 5KH6A 3EGDB 3GBQA 2OTLT 4QW2A 2R5MA 3EG2A 1LJOA 4PJLA 4LD6A 3CMAT 3WVDB 1T0JA 3CMET 4CI0C 1Q86C 2DNUA 3CC2Q 4XTZA 4A4FA 2HEQA 1UUEA 2OJ2A 1U1SA 3EFOA 3MP1A 2FZCB 2HBWA 9ATCB 4PJJA 2X51A 1X2KA 2CT4A 2Y90A 3QHSA 2J6OA 1UGVA 2DTHA 2HAXA 5CVIA 2YT6A 2CH4W 3GIBA 3JCMP 1VQ5A 3CCST 3SWNB 5GAN3 1D1CA 1H8KA 1M1KU 1UJYA 2K6DA 3QZ9B 3M9QA 3ZBDA 4CC4B 4CC3A 4PJNA 1AOJA 1Q81C 2AIRB 5LJ5e 5GAN8 1WJQA 3UATA 2M51A 1N5ZA 2XU8A 3A1PA 3C12A 3CCVQ 1Y7XA 2XIDA 3VS7A 4E7KA 2E5KA 1YCSB 2MF2A 4CC7A 2MWOA 3CCJQ 3OB9A 1VQOA 2CZ1B 4C92C 1NLPC 3MHXA 1Y71A 5GMKe 5KYUA 3M4GA 1KJWA 2EPDA 2FEIA 5DLQE 4BD3A 2DIQA 2PZ1A 2RQTA 5AT1B 3JCMX 4XTUA 1NYGA 2VKNA 1LVKA 2HL5C 2FRYA 2HDAA 3JCMV 3E9GA 2KVQG 1QCOA 2YLCA 3J80E 4DBQA 5GAOm 2M9UA 4P5NA 1N8RC 2LNHB 2P4TA 2D8HA 1MMNA 1W2BA 2GTOA 4KH1B 2CUBA 4XTXA 3EFRA 1VQ6A 2L3PA 4QT7A 2DVJA 1BI3A 2YXYA 2MCNA 2JNGA 5GAOr 3OY9A 2QTVA 5L8RE 2ZAEA 3NPFA 4M75E 3VUBA 1KK7A 4O6JA 5LJ3d 2O2OA 3LYIA 1VQPT 4OMOA 4Z02A 1QCFA 3MEUA 3CC7Q 2D9TA 1GCPA 4M75B 2JW4A 3JCMd 4DBRA 4KRTA 3PMIA 4HCCA 1U5SA 2Y4YA 2X4JA 5J39A 2XDPA 4M78A 3CCQT 3I56T 4PKCC 2NUZA 1T3LA 2O31A 4D8KA 1GFDA 1QWEA 2JS0A 1G3YA 1VQLQ 3EG1A 2E64A 3QKJA 2WSFE 4OMLA 2YRDA 1OV3A 3VS4A 1X6BA 1UG1A 1K76A 3ZL7C 4M7AC 1EIFA 1UHFA 4C0GA 2VWFA 4C8QG 2DM1A 1VQ4A 2CP0A 2M0YA 1VQNQ 3V8JA 3CPWA 4MZPA 2NUPA 5CQXA 4J9CA 1Q82R 1WQ7A 4RTZA 1EZZB 1UJ0A 4PJOE 5GANj 1OULA 3PIOA 2JT4A 4ORZA 1W2BS 2EJ9A 2DD5A 3HTRA 2YUPA 4ZTJA 3VS5A 1EX4A 1KD1U 1KFZA 1QVFA 2FL7A 1MNEA 1I81A 2RMOA 3JCMJ 2OAUA 5IXBA 3MKDA 1O75A 1M2OA 1XQHA 3NMZC 4M78G 4JJDA 4M75F 3CCLQ 4XQ3A 1VQ8T 2GTJA 4LN2A 2M1HA 4O5VA 1YJWQ 4FW2A 2KRSA 4GLMA 1NLOC 1Q86U 1M1KR 2EGCA 3CEYA 2QA4Q 2HCKA 2D0NA 1RAIB 3GOXA 4DOVA 1M3BA 2YDLA 3JCMh 8ATCB 1BCOA 2JM8A 3OS1A 4E7HA 2YWWA 4FU6A 4IKFA 3H8ZA 4PK4A 4JDSA 4N4GA 4ME7A 4HT9A 3CMAA 2K9GA 4IUVA 2HMAA 4XU0A 4M78D 1VQ7Q 2DX1A 3MCAB 1Y96A 3I5RA 2RHXA 2GBQA 1IXDA 2BUDA 2PUOB 4EMKC 3A8GB 3S3MA 2CZ7B 2DTIA 3EAEA 4F16A 2I0NA 3EFOB 3SFMA 4CC2A 1NZ9A 1K73U 5GAMd 1Q81U 1D0ZA 3AT1B 1M1GA 2K3BA 2P0PA 4J6WA 3E9FA 5I11A 2XD0A 1NG2A 3SEMA 4J9BA 3REAB 3CPWS 2A08A 1YITA 2F5TX 2J05A 2RJEA 3CCSA 1PM3A 3EGXA 3S3NA 2A28A 2GQVA 1X69A 2LX9A 1M8MA 1H641 1Q7YR 3META 2RQVA 3OYNA 4PJOF 3EGUA 4HA8A 2CREA 4M77C 2EW3A 2BE9B 1QVFS 4QVDA 1GRIA 4ZNXA 1QKWA 1QLYA 2IIMA 2RPNA 2LMJA 1KQSA 1OX8A 5FWBA 4A4KA 4J5YA 3M58A 2L3RA 2D1XA 5KYUB 2DRKA 1JO8A 2AHJB 1YWOA 2DL3A 4EDUA 1BCMA 1V29B 2X4WA 1Q82C 3OYDA 4C5EA 1PG5B 3S3OA 1MV0B 3OYBA 1U06A 3ULRB 3LGFA 4AT1B 2RH2A 4IIMA 1BI0A 1WDXA 3MP6A 1VQ5T 3LGLA 3H6ZA 2D0QB 1N9RA 2EYYA 2WSCE 3MP8A 2ED1A 1KIKA 2V8JA 5LJ5d 1IO6A 4AFSC 4RCBA 5GANf 3A8LB 2M02A 3M57A 2MIOA 2P0QA 1OQKA 4C0DB 5HY6A 1WPYA 1M1KC 2R58A 2R5AA 2ZPIB 1WHHA 1VYVA 2A7YA 4IUQA 3RBBB 2RK2A 1VUBA 2HBPA 2LNVA 5GAN7 2H3EB 3BW1A 4M78E 3C94A 4JS5A 2DEUA 5A0DA 2E12A 1VQPA 1RAGB 2RQRA 1YI2A 4R0KA 2JXBA 2E6NA 4E7IA 2KAFA 2CZ0B 2KDSA 3WXMB 2R57A 4XU2A 1F1BB 1UHCA 3G4SQ 3OSSC 4J9DA 4M78B 1WZOA 3UDCA 1AWJA 1NE8A 1UTIA 1KQSS 5FROA 4V2SA 2RJDA 5FU6B 4FT2A 4FT4A 4JJBA 2LX7A 2KXDA 1X01A 1PKSA 3L2WA 4KH0B 1VQ6T 3SDZA 4YTLA 1VQ9A 2Z0WA 2H3JA 1M3AA 3BY7A 1Q7YC 3QDFA 2FPFA 4MMKA 2X3WD 1CKAA 5I21A 3I55T 2LJ0A 3KFVA 4C92G 1X6GA 3G6ET 3PTAA 3GF5A 4XU1A 2NUPB 2QEXA 3VRYA 1GBRA 3THKA 2PNIA 3M0TA 4M7DA 4UC4A 2LP5A 3BDUA 1D1AA 3RKYA 5LJ5h 2LVMA 4E6RA 2E70A 4FYVB 2C0TA 4ZGJB 4C0FA 3CC4Q 4XTVA 3FRNA 1Z9ZA 2KYMA 3X28B 1SRMA 4AFUC 5GMKh 4NOYA 4DA4A 1K73R 4ESRA 4B9XA 4BY6C 1G5VA 1WNLA 2EAYA 1VQOQ 3EG3A 5CAIA 2DL5A 2BKDN 2RHYA 2LQKA 4M78F 2EQUA 5A0LA 4KBMB 4FCYA 5KYYA 5IH2A 1B07A 3LWHA 3JB9G 2HKQB 2D6FA 1H3ZA 4HVWA 3JAME 4DEXA 2QAZA 2L5QA 4F7UA 4KUIA 1GCQC 2KE9A 1S72A 3M59A 1Y96B 4GBQA 4LUEA 4RTVA 2CP2A 2DL4A 4M7DG 2FVUA 1EFNA 2BZXA 2L3SA 4TVRA 3NFCA 1JEGA 1VQ6Q 2AZSA 3M5AA 1OZ3A 3JB9D 3N5BB 2EIFA 1NEBA 2EGEA 2EYXA 4JS4A 3E2UA 5CCAA 3OYJA 1MMDA 2L2PA 1JJ2P 3CCEA 3EH2A 3X20B 2QGGA 2LQNA 3EGXB 2ZPEB 2FZKB 2JMAA 3I35A 2QASA 2LCCA 2VVKA 2KT8A 1VQMT 4M7DD 3S6WA 4RKUE 1YP5A 4N0AA 1WLPB 1PCXA 2MMPA 2XICA 4F04B 2GFAA 1T3SA 1RI9A 4OGEA 1Q82U 1ZA1B 4PLLA 1PSFA 1YFNA 1V76A 4EMKA 2QTXA 2DZCA 4L6V5 1I8FA 1UFFA 2RA2A 5ECAA 2E4HA 1JQQA 4FSSA 4F7UG 2XDBA 2F69A 1BI1A 1WXUA 2EGAA 1G3TA 1T0HA 3TSZA 2ESWA
chains in the Genus database with same CATH topology
3EHRA 2EYWA 2AZVA 4AFZC 2NUZA 4RTXA 1T3LA 5GJVB 2O31A 4D8KA 1GFDA 5I22A 1QWEA 2JS0A 1M30A 1SPKA 1AVZC 3EG1A 2LJ1A 1ZUYA 2BTTA 4OMQA 2C0OA 1BB9A 4OMLA 3NHNA 2G6FX 1OV3A 2GGRA 3VS4A 2O88A 2K79A 3H41A 1X6BA 1UG1A 5IXFA 1K76A 2YUQA 3ZL7C 2DJQA 1AEYA 1UHFA 1QKXA 2VWFA 3H0FA 5IHKA 2L0AA 2DM1A 1WI7A 4Y92A 2J7IA 4RTUA 2M0YA 2C0IA 1AWWA 2JS2A 2KEAA 2FRWA 1LCKA 4J9CA 4RTZA 1UJ0A 1JU5C 2JT4A 4ORZA 2SRCA 1G2BA 2YUPA 3VS5A 2RN8A 3FJ5A 1ABOA 1KFZA 2O9SA 2LQWA 1AWOA 2K7AA 5GJWB 2LJ3A 2RMOA 2JM9A 3H0IA 2H8HA 5IXBA 1RLQC 2DF6A 1E7OA 1OEBA 1VA7A 3NMZC 3R6NA 2FG0A 4JJDA 1WXBA 1BK2A 4RTTA 2GTJA 4LN2A 1U3OA 2KRSA 2V1QA 4GLMA 1NLOC 1ARKA 3RNJA 2EGCA 2HCKA 2D0NA 1JXOA 2YUNA 1HD3A 1M3BA 2YDLA 2F2XA 1BBZA 1TG0A 2KBTA 4RTWA 1X2QA 2JM8A 1G83A 1ZUKA 1SHGA 3LH5A 3VS6A 3O5ZA 1X27A 2K9GA 1A0NB 1YWPA 1E6HA 2DX1A 3I5RA 2LZ6B 2CSQA 4LNPA 4F17A 5IHNA 2GBQA 1AD5A 1Y57A 3PVLA 2DBKA 2DRMA 4HVVA 1BU1A 1H92A 2W10A 4F16A 4J9HA 2I0NA 3C0CA 4M4ZA 4CC2A 3VS3A 1WX6A 5HCKA 2CUDA 2RQUA 2KRNA 3M0RA 2CT3A 2XMFA 2K3BA 5I11A 4X1VA 2DYBA 1NG2A 3SEMA 4J9BA 3REAB 1MUZA 2A08A 4AG1C 4AFQC 2A37A 1AWXA 2SEMA 1OOTA 2KXCA 2J05A 2A28A 2DLPA 1GFCA 1Z9QA 1X69A 1M8MA 1JXMA 2ABLA 2ENMA 3M0PA 2RQVA 1ZX6A 3EGUA 4J9GA 1WFWA 2CREA 2EW3A 3U23A 1HJDA 1GRIA 4ZNXA 3REBB 2PTKA 1QKWA 1QLYA 2IIMA 2RPNA 4JPBW 2EKHA 2LMJA 5FWBA 1PRMC 1I0CA 2D1XA 2F2VA 5FWCA 2DRKA 2KNBB 1JO8A 1K0SA 1YWOA 2DL3A 1FYNA 3UF4A 1K1ZA 2NWMA 4F14A 1YNZA 2DMOA 5L23A 2RNAA 1MV0B 2QDLA 1U06A 3ULRB 2J6FA 1GBQA 1V1CA 1RLPC 2CSIA 4IIMA 1H3HA 1OPLA 3VRZA 1WDXA 2KROA 2DILA 1ZUUA 2JTEA 4IIOA 1UDLA 1MV3A 2EYYA 1AZEA 2ED1A 1UE9A 3M0SA 1KIKA 1IO6A 2BZ8A 1PKTA 1PHTA 1ZSGA 2ROTA 1SEMA 4AFSC 1E6GA 2MOXA 2FPDA 2MIOA 2DE0X 4DEYA 2D8JA 3VS2A 2KRMA 1SRLA 2B86A 2K2MA 1GCQA 1WA7A 3H0HA 1VYVA 2GNCA 3RBBB 4RUGA 1HSQA 1K9AA 2CH4A 2GQIA 2ECZA 2RQRA 2OI3A 3QWYA 2JXBA 2A36A 4HVUA 4JZ3A 4R0KA 1KSWA 1ZBJA 1K0XA 1FMKA 4HXJA 2DL8A 4D8DA 2HSPA 3EHQA 1UHCA 4J9DA 3PE0A 1QWFA 2DL7A 3A98A 4WCIA 1AWJA 1M27C 1UTIA 1WXTA 3TSWA 1PNJA 4J9EA 2JMCA 1GL5A 4JJBA 5IHIA 1OPKA 1SHFA 1W1FA 3SHWA 2LX7A 2KXDA 1SSHA 4OMMA 4RTYA 1PKSA 2EBPA 2J6KA 2BZYA 3GBQA 1M3AA 3EG2A 2FPFA 1T0JA 2X3WD 1CKAA 2EQIA 2ROLA 2EYZA 2LJ0A 2DNUA 3KFVA 1X43A 1X6GA 2HEQA 3VS1A 1UUEA 3VRYA 2OJ2A 1GBRA 3THKA 2PNIA 3M0TA 5EC7A 2LP5A 2HBWA 1VYUA 4E6RA 1M3CA 1UECA 4Z89A 1X2KA 2C0TA 2CT4A 1J3TA 2KGTA 2J6OA 1UGVA 3UA7A 3I5SA 4EIKA 2YT6A 2CH4W 1Z9ZA 4Z8AA 1PWTA 2KYMA 4HCKA 2RF0A 1WYXA 2YSQA 3CQTA 1H8KA 1UJYA 2K6DA 2YUOA 1SRMA 1NEGA 4CC4B 1AZGB 4AFUC 4CC3A 2P4RA 1I1JA 1AOJA 4ESRA 3JV3A 2DBMA 5FW9A 2V1RA 2FPEA 3EG3A 3UATA 2M51A 2DL5A 3I9QA 1NYFA 4JJCA 2RQWA 1N5ZA 5IH2A 1B07A 2O9VA 1CSKA 4LUDA 3VS7A 1TUCA 3IQLA 2E5KA 1YCSB 2LCSA 2CDTA 4CC7A 4JZ4A 4K11A 4HVWA 1NLPC 4DEXA 1KJWA 2L3QA 2EPDA 2FEIA 1GCQC 2PZ1A 2KE9A 2RQTA 2X3XD 1K4US 3VS0A 1NYGA 2DA9A 2AKLA 1S1NA 2VKNA 2FO0A 4GBQA 4LUEA 2FRYA 4RTVA 2HDAA 3EG0A 1ZLMA 2DL4A 1EFNA 3M0QA 2KR3A 2BZXA 2L3SA 2F2WA 3PVQA 1JEGA 1YN8A 2J06A 2KYBA 2AZSA 1TUDA 2EVRA 4OMNA 3NGPA 2LNHB 1NEBA 2EGEA 2EYXA 1CKBA 4AG2C 2D8HA 2KT1A 2L2PA 4J9FA 2ED0A 2AKKA 2GTOA 1W70A 2CUBA 2LQNA 2L3PA 2AK5A 4QT7A 2DVJA 2MCNA 2JMAA 3I35A 1ABQA 4LE9A 2VVKA 2KT8A 4A63B 1YP5A 4Z88A 1RUWA 3NPFA 1WLPB 2OAWA 1I07A 3UA6A 1T3SA 1XOVA 1VYTA 1RI9A 2O2OA 3M0UA 1W6XA 3QWXX 1NM7A 3TVTA 1UFFA 4OMOA 5ECAA 1JQQA 4FSSA 1PRLC 1WIEA 1QCFA 1GCPA 2JW4A 2W0ZA 2EGAA 1WXUA 4OMPA 1B3QA 1T0HA 4KRTA 4J9IA 3TSZA 1U5SA 2ESWA 1Y0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHR A;  2EYW A;  2AZV A;  4AFZ C;  2NUZ A;  4RTX A;  1T3L A;  5GJV B;  2O31 A;  4D8K A;  1GFD A;  5I22 A;  1QWE A;  2JS0 A;  1M30 A;  1SPK A;  1AVZ C;  3EG1 A;  2LJ1 A;  1ZUY A;  2BTT A;  4OMQ A;  2C0O A;  1BB9 A;  4OML A;  3NHN A;  2G6F X;  1OV3 A;  2GGR A;  3VS4 A;  2O88 A;  2K79 A;  3H41 A;  1X6B A;  1UG1 A;  5IXF A;  1K76 A;  2YUQ A;  3ZL7 C;  2DJQ A;  1AEY A;  1UHF A;  1QKX A;  2VWF A;  3H0F A;  5IHK A;  2L0A A;  2DM1 A;  1WI7 A;  4Y92 A;  2J7I A;  4RTU A;  2M0Y A;  2C0I A;  1AWW A;  2JS2 A;  2KEA A;  2FRW A;  1LCK A;  4J9C A;  4RTZ A;  1UJ0 A;  1JU5 C;  2JT4 A;  4ORZ A;  2SRC A;  1G2B A;  2YUP A;  3VS5 A;  2RN8 A;  3FJ5 A;  1ABO A;  1KFZ A;  2O9S A;  2LQW A;  1AWO A;  2K7A A;  5GJW B;  2LJ3 A;  2RMO A;  2JM9 A;  3H0I A;  2H8H A;  5IXB A;  1RLQ C;  2DF6 A;  1E7O A;  1OEB A;  1VA7 A;  3NMZ C;  3R6N A;  2FG0 A;  4JJD A;  1WXB A;  1BK2 A;  4RTT A;  2GTJ A;  4LN2 A;  1U3O A;  2KRS A;  2V1Q A;  4GLM A;  1NLO C;  1ARK A;  3RNJ A;  2EGC A;  2HCK A;  2D0N A;  1JXO A;  2YUN A;  1HD3 A;  1M3B A;  2YDL A;  2F2X A;  1BBZ A;  1TG0 A;  2KBT A;  4RTW A;  1X2Q A;  2JM8 A;  1G83 A;  1ZUK A;  1SHG A;  3LH5 A;  3VS6 A;  3O5Z A;  1X27 A;  2K9G A;  1A0N B;  1YWP A;  1E6H A;  2DX1 A;  3I5R A;  2LZ6 B;  2CSQ A;  4LNP A;  4F17 A;  5IHN A;  2GBQ A;  1AD5 A;  1Y57 A;  3PVL A;  2DBK A;  2DRM A;  4HVV A;  1BU1 A;  1H92 A;  2W10 A;  4F16 A;  4J9H A;  2I0N A;  3C0C A;  4M4Z A;  4CC2 A;  3VS3 A;  1WX6 A;  5HCK A;  2CUD A;  2RQU A;  2KRN A;  3M0R A;  2CT3 A;  2XMF A;  2K3B A;  5I11 A;  4X1V A;  2DYB A;  1NG2 A;  3SEM A;  4J9B A;  3REA B;  1MUZ A;  2A08 A;  4AG1 C;  4AFQ C;  2A37 A;  1AWX A;  2SEM A;  1OOT A;  2KXC A;  2J05 A;  2A28 A;  2DLP A;  1GFC A;  1Z9Q A;  1X69 A;  1M8M A;  1JXM A;  2ABL A;  2ENM A;  3M0P A;  2RQV A;  1ZX6 A;  3EGU A;  4J9G A;  1WFW A;  2CRE A;  2EW3 A;  3U23 A;  1HJD A;  1GRI A;  4ZNX A;  3REB B;  2PTK A;  1QKW A;  1QLY A;  2IIM A;  2RPN A;  4JPB W;  2EKH A;  2LMJ A;  5FWB A;  1PRM C;  1I0C A;  2D1X A;  2F2V A;  5FWC A;  2DRK A;  2KNB B;  1JO8 A;  1K0S A;  1YWO A;  2DL3 A;  1FYN A;  3UF4 A;  1K1Z A;  2NWM A;  4F14 A;  1YNZ A;  2DMO A;  5L23 A;  2RNA A;  1MV0 B;  2QDL A;  1U06 A;  3ULR B;  2J6F A;  1GBQ A;  1V1C A;  1RLP C;  2CSI A;  4IIM A;  1H3H A;  1OPL A;  3VRZ A;  1WDX A;  2KRO A;  2DIL A;  1ZUU A;  2JTE A;  4IIO A;  1UDL A;  1MV3 A;  2EYY A;  1AZE A;  2ED1 A;  1UE9 A;  3M0S A;  1KIK A;  1IO6 A;  2BZ8 A;  1PKT A;  1PHT A;  1ZSG A;  2ROT A;  1SEM A;  4AFS C;  1E6G A;  2MOX A;  2FPD A;  2MIO A;  2DE0 X;  4DEY A;  2D8J A;  3VS2 A;  2KRM A;  1SRL A;  2B86 A;  2K2M A;  1GCQ A;  1WA7 A;  3H0H A;  1VYV A;  2GNC A;  3RBB B;  4RUG A;  1HSQ A;  1K9A A;  2CH4 A;  2GQI A;  2ECZ A;  2RQR A;  2OI3 A;  3QWY A;  2JXB A;  2A36 A;  4HVU A;  4JZ3 A;  4R0K A;  1KSW A;  1ZBJ A;  1K0X A;  1FMK A;  4HXJ A;  2DL8 A;  4D8D A;  2HSP A;  3EHQ A;  1UHC A;  4J9D A;  3PE0 A;  1QWF A;  2DL7 A;  3A98 A;  4WCI A;  1AWJ A;  1M27 C;  1UTI A;  1WXT A;  3TSW A;  1PNJ A;  4J9E A;  2JMC A;  1GL5 A;  4JJB A;  5IHI A;  1OPK A;  1SHF A;  1W1F A;  3SHW A;  2LX7 A;  2KXD A;  1SSH A;  4OMM A;  4RTY A;  1PKS A;  2EBP A;  2J6K A;  2BZY A;  3GBQ A;  1M3A A;  3EG2 A;  2FPF A;  1T0J A;  2X3W D;  1CKA A;  2EQI A;  2ROL A;  2EYZ A;  2LJ0 A;  2DNU A;  3KFV A;  1X43 A;  1X6G A;  2HEQ A;  3VS1 A;  1UUE A;  3VRY A;  2OJ2 A;  1GBR A;  3THK A;  2PNI A;  3M0T A;  5EC7 A;  2LP5 A;  2HBW A;  1VYU A;  4E6R A;  1M3C A;  1UEC A;  4Z89 A;  1X2K A;  2C0T A;  2CT4 A;  1J3T A;  2KGT A;  2J6O A;  1UGV A;  3UA7 A;  3I5S A;  4EIK A;  2YT6 A;  2CH4 W;  1Z9Z A;  4Z8A A;  1PWT A;  2KYM A;  4HCK A;  2RF0 A;  1WYX A;  2YSQ A;  3CQT A;  1H8K A;  1UJY A;  2K6D A;  2YUO A;  1SRM A;  1NEG A;  4CC4 B;  1AZG B;  4AFU C;  4CC3 A;  2P4R A;  1I1J A;  1AOJ A;  4ESR A;  3JV3 A;  2DBM A;  5FW9 A;  2V1R A;  2FPE A;  3EG3 A;  3UAT A;  2M51 A;  2DL5 A;  3I9Q A;  1NYF A;  4JJC A;  2RQW A;  1N5Z A;  5IH2 A;  1B07 A;  2O9V A;  1CSK A;  4LUD A;  3VS7 A;  1TUC A;  3IQL A;  2E5K A;  1YCS B;  2LCS A;  2CDT A;  4CC7 A;  4JZ4 A;  4K11 A;  4HVW A;  1NLP C;  4DEX A;  1KJW A;  2L3Q A;  2EPD A;  2FEI A;  1GCQ C;  2PZ1 A;  2KE9 A;  2RQT A;  2X3X D;  1K4U S;  3VS0 A;  1NYG A;  2DA9 A;  2AKL A;  1S1N A;  2VKN A;  2FO0 A;  4GBQ A;  4LUE A;  2FRY A;  4RTV A;  2HDA A;  3EG0 A;  1ZLM A;  2DL4 A;  1EFN A;  3M0Q A;  2KR3 A;  2BZX A;  2L3S A;  2F2W A;  3PVQ A;  1JEG A;  1YN8 A;  2J06 A;  2KYB A;  2AZS A;  1TUD A;  2EVR A;  4OMN A;  3NGP A;  2LNH B;  1NEB A;  2EGE A;  2EYX A;  1CKB A;  4AG2 C;  2D8H A;  2KT1 A;  2L2P A;  4J9F A;  2ED0 A;  2AKK A;  2GTO A;  1W70 A;  2CUB A;  2LQN A;  2L3P A;  2AK5 A;  4QT7 A;  2DVJ A;  2MCN A;  2JMA A;  3I35 A;  1ABQ A;  4LE9 A;  2VVK A;  2KT8 A;  4A63 B;  1YP5 A;  4Z88 A;  1RUW A;  3NPF A;  1WLP B;  2OAW A;  1I07 A;  3UA6 A;  1T3S A;  1XOV A;  1VYT A;  1RI9 A;  2O2O A;  3M0U A;  1W6X A;  3QWX X;  1NM7 A;  3TVT A;  1UFF A;  4OMO A;  5ECA A;  1JQQ A;  4FSS A;  1PRL C;  1WIE A;  1QCF A;  1GCP A;  2JW4 A;  2W0Z A;  2EGA A;  1WXU A;  4OMP A;  1B3Q A;  1T0H A;  4KRT A;  4J9I A;  3TSZ A;  1U5S A;  2ESW A;  1Y0M A; 
#chains in the Genus database with same CATH topology
 2EYW A;  4AFZ C;  1NJI U;  2EJF A;  3L2V A;  3QUI A;  4Y91 A;  1TTH B;  1Y07 A;  3URG A;  2F1L A;  1YIT T;  1ZUY A;  1VQ4 Q;  1BB9 A;  4M77 A;  1K73 C;  3QII A;  3BDL A;  3H41 A;  4OGC A;  5IXF A;  2YUQ A;  5HK0 A;  1SG5 A;  1QKX A;  3H0F A;  3VJP A;  4Y92 A;  3FDR A;  3DB3 A;  3QZ5 B;  2JS2 A;  1OYX A;  1PD1 A;  2LCL A;  4AMC A;  1AHJ B;  4FIB A;  2Y4X A;  1WHL A;  2IVW A;  2SRC A;  4IUU A;  4R56 A;  4VUB A;  1QVG A;  2HQX A;  3OYY A;  3SWN C;  1OX9 A;  5I2M A;  5M9O A;  1RI0 A;  2KI7 A;  1C1A A;  2JN0 A;  4QQ6 A;  2LQW A;  4A53 A;  1UGS B;  5GJW B;  3G71 Q;  2MYS A;  2LJ3 A;  2JM9 A;  2K5I A;  5FRN A;  1RLQ C;  2DF6 A;  2QQB A;  2K3Y A;  2LC4 A;  1XTD A;  2DO3 A;  1OEB A;  1VA7 A;  2COY A;  1IHV A;  1YJN Q;  3SB2 A;  1BK2 A;  4FW1 A;  1D0X A;  4ZN1 A;  1D0Y A;  3CCM Q;  1Q7Y U;  3MEW A;  3ME9 A;  3RMQ A;  1U3O A;  2V1Q A;  2OTL Q;  4J83 A;  1OZ2 A;  4DBF A;  1ARK A;  3CMA Q;  4OF1 A;  5LJ3 j;  3CME Q;  2ZPH B;  4X9C A;  3J7A F;  3HRU A;  2VB6 A;  4Y28 E;  2DKG A;  3HP9 A;  3PGG A;  3R6O A;  3OYE A;  2VAS A;  1X2Q A;  3C4S A;  4M77 G;  4M7D E;  4E2F B;  1BIA A;  2QQA A;  4MZT A;  4C8Q A;  4N4H A;  1ZUK A;  3LH5 A;  1X6O A;  1A0N B;  1YWP A;  4F17 A;  4LNP A;  2CSQ A;  1VQK T;  3I55 A;  1MMA A;  3AHU A;  1AD5 A;  2DRM A;  4A4H A;  3G6E A;  1OU8 A;  1BU1 A;  4J9H A;  4M7D B;  4M4Z A;  3OYL A;  3CXC P;  1WX6 A;  5HCK A;  3CCS Q;  1YI2 T;  3M0R A;  2HQE A;  1D3B A;  3L2U A;  2XMF A;  4M77 D;  3GLX A;  5GAN 2;  1MUZ A;  4AFQ C;  2A37 A;  1AWX A;  3EH1 A;  3V7C A;  2XK0 A;  1OOT A;  1RL2 A;  2KXC A;  4OB1 B;  1YJ9 T;  4L59 A;  1GFC A;  2QG9 B;  4MZM A;  2ABL A;  4A54 A;  2A3L A;  2ENM A;  4WF2 A;  3RUX A;  2DER A;  1QVG S;  3QO3 A;  2PVD B;  3P8H A;  4F7U E;  1FWZ A;  2RD1 A;  1VQ9 T;  5KYY B;  3M56 A;  3LX7 A;  5A2Q E;  2DET A;  3CCR T;  4IUT A;  2QXF A;  1I0C A;  1I5O B;  3PNW C;  3CC2 A;  2CZ6 B;  2KNB B;  1O9S A;  3JB9 F;  4F7U B;  2QEX T;  3UF4 A;  1K1Z A;  2NWM A;  1YNZ A;  1LOJ A;  2B8A A;  1U1T A;  1B7T A;  5L23 A;  2CGH A;  2QDL A;  1GBQ A;  4NL3 A;  3T9N A;  1RLP C;  2DPP B;  2VXF A;  2ZZD A;  1H3H A;  1OPL A;  2KRO A;  4LXC A;  2DIL A;  2LQ8 A;  2X9H A;  4FYX B;  4M7D F;  1M90 U;  4IIO A;  1R0C B;  1MV3 A;  1AZE A;  1TUG B;  4C8Q D;  4IUP A;  4OB0 B;  3V7S A;  2BZ8 A;  1PKT A;  1NJI R;  3Q1J A;  3RR6 A;  1E6G A;  5IAY A;  4IUR A;  3RKX A;  4PJM A;  1VQP Q;  3V7R A;  3CCV A;  2XHC A;  5CQY A;  4LDW A;  2KRM A;  1YI2 Q;  1VQM A;  1D09 B;  2B86 A;  1YIJ A;  3L2R A;  3MPU B;  2EQJ A;  1GCQ A;  1WA7 A;  3CCJ A;  4RUG A;  2K2V A;  1K9A A;  2YRV A;  4ELZ C;  2GQI A;  1QP3 A;  4EMK B;  1M8V A;  1S72 T;  2EFI A;  2V8K A;  5FLX E;  2ECZ A;  5GAM j;  4RG2 A;  4II1 A;  4PJO C;  3CCQ Q;  3I56 Q;  1JJ2 A;  1WJR A;  3V8K A;  3QWY A;  4HCB A;  1KSW A;  3FB9 A;  1U8R A;  5CKE A;  3JCM W;  5LJ3 f;  3EHQ A;  1JB0 E;  5GAN 5;  3J81 E;  4F7U F;  4M77 E;  3PE0 A;  1QWF A;  2DL7 A;  3A98 A;  2A0F B;  3QXE B;  1PNJ A;  2WSE E;  2NLU A;  3HRT A;  2CS7 A;  3CCE T;  2YRC A;  3JCM f;  2I2L A;  5D6W A;  3CPF A;  2BZY A;  1WJS A;  4M77 B;  2COZ A;  4QVC A;  2QQ9 A;  3RIR A;  3SD4 A;  4C5I A;  4HT8 A;  2NYS A;  3FJP A;  2AT1 B;  3MEA A;  5EC7 A;  4QKU A;  1C0M A;  2M16 A;  1UEC A;  4Z89 A;  1KHI A;  3CC7 A;  2PUK B;  1J3T A;  2XDD A;  2PVO B;  4EIK A;  3I5S A;  4ZN3 A;  2FYK A;  2RJC A;  4ELY C;  4X9D A;  4CRI A;  4Z8A A;  2CYZ B;  1PWT A;  1N6A A;  3BE3 A;  4HCK A;  2PU9 B;  1VQ8 Q;  3CQT A;  5LJ5 j;  1HK9 A;  1NEG A;  1AZG B;  1K8A U;  1I1J A;  1KG1 A;  1NPP A;  4BDZ A;  2CKK A;  4JRI A;  1VQL A;  5LL6 S;  4C8Q E;  4JRP A;  4JJC A;  3C95 A;  1S72 Q;  4LUD A;  1CSK A;  2KSS A;  4XU3 A;  5GMK j;  3JB9 I;  3OA6 A;  1NJI C;  1TUC A;  3BFM A;  2LCS A;  4MDW A;  5DLO A;  4K11 A;  1DJ7 B;  4QVZ A;  2L3Q A;  4C8Q B;  1RAB B;  3LW5 E;  2RB6 A;  1K4U S;  4D6W A;  4PFZ A;  1KHC A;  2F5K A;  4M77 F;  4C92 A;  2DA9 A;  1C6V X;  1TH7 A;  1VQK A;  2E41 A;  3EG0 A;  3ZFJ A;  3O8V A;  1ZLM A;  1SSF A;  2KR3 A;  5KYX A;  2VUB A;  2F2W A;  3PVQ A;  3OQ5 A;  4NS5 A;  1YN8 A;  2J06 A;  2GCX A;  1TUD A;  3LWI A;  1D3B B;  2EVR A;  4OMN A;  1VIF A;  3E1S A;  4OB3 B;  1MHN A;  3FLG A;  1ZQ1 A;  5GAN g;  5FU7 C;  4DQ2 A;  2XG8 D;  1Q95 G;  1RAF B;  2KT1 A;  2VC8 A;  2DD4 A;  4J9F A;  1W4S A;  2ED0 A;  2AKK A;  4J8O A;  4C0D C;  4PNO A;  2JVV A;  5LJ3 e;  2AK5 A;  3HHT B;  1YJW A;  1YJ9 A;  1ABQ A;  4KGX B;  1M90 R;  2HNI A;  4PL6 A;  5GAM f;  4X34 A;  4KGV B;  2OAW A;  1BIB A;  3CXC A;  2DXB A;  1I4K 1;  1IRX A;  3UA6 A;  2JOY A;  1XOV A;  6AT1 B;  3M0U A;  2O4X A;  1NM7 A;  3PIP A;  3CCR A;  1VQ7 A;  1PRL C;  2EWN A;  2OTJ T;  2W0Z A;  1KQ1 A;  1JBM A;  2G3R A;  1B3Q A;  4J9I A;  4C8Q F;  1VQ5 Q;  4FYY B;  2MAM A;  2V8I A;  1P92 A;  5CR2 A;  2KMT A;  3QYG B;  2DJZ A;  3NTH A;  1YHQ T;  3GPL A;  2BIV A;  1SPK A;  2V26 A;  5A0G A;  4XK8 E;  2ZPB B;  4BAC A;  2ZGW A;  2VV5 A;  2E5Q A;  4OMQ A;  2C0O A;  3DKM A;  3NHN A;  2GGR A;  4C92 D;  2O88 A;  2K79 A;  1RAA B;  2DJQ A;  2P0K A;  2E10 A;  1AEY A;  2MPX C;  3OBW A;  5IHK A;  2L0A A;  4RTU A;  3OBY A;  2C0I A;  3CCU T;  2QQS A;  3CD6 A;  1AWW A;  1ZSZ C;  4M7A A;  2FRW A;  2ATC B;  1WHJ A;  2X35 A;  2MI6 A;  3VYH B;  5LJ5 f;  3CC2 T;  1JU5 C;  2PVG B;  4QQD A;  1G2B A;  2CP5 A;  3VU3 C;  2RN8 A;  3FJ5 A;  1ABO A;  1AWO A;  5GAN e;  4A4G A;  4MDX A;  1QQJ A;  2X4X A;  3H0I A;  4RG8 A;  2H8H A;  1QVF P;  2QI2 A;  4JLI A;  3EFS A;  5I2S A;  1E7O A;  3OS5 A;  3QDR B;  1B34 A;  5CO7 A;  3WVE B;  1ACM B;  1WXB A;  4RTT A;  5IN1 A;  5CIU A;  3VUZ A;  3TRE A;  2RJF A;  1JXO A;  3I55 Q;  3VKI A;  2F2X A;  1BBZ A;  2KBT A;  3X24 B;  4JLG A;  1K8A R;  2DTO A;  5DY9 A;  3HKS A;  5DM7 R;  2RHU A;  3G6E Q;  5FRM A;  2JTF A;  5GAN 6;  3RES A;  3CCV T;  1M90 C;  1SHG A;  3O5Z A;  2CP6 A;  3LH0 A;  1YIJ T;  1E6H A;  2HKN A;  1NBE B;  3CCJ T;  5IHN A;  1Y57 A;  4M7A G;  2DBK A;  2GFU A;  4FSX A;  4PJO A;  3QJY A;  2DZ9 A;  3QSU A;  4BI4 A;  1HXD A;  3DB4 A;  3C0C A;  1IHW A;  1G3W A;  1LPL A;  2E6Z A;  1TU0 B;  3CBM A;  2K57 A;  2KRN A;  1WHG A;  3OYC A;  3KBG A;  3L42 A;  1RAD B;  3OMC A;  3D7S B;  1M5Q 1;  4AG1 C;  2WAC A;  3G4S A;  2YHT A;  1BYM A;  1MMG A;  4Q5W A;  2DLP A;  4J7I A;  3MJX A;  4M7A D;  1JXM A;  3TEE A;  3M0P A;  3M4Y A;  1HYO A;  3INZ A;  4EPC A;  3OYA A;  3F70 A;  5GAN 4;  4J9G A;  4EMG A;  4XTY A;  4C92 E;  1HJD A;  2LT4 A;  3REB B;  5CKD A;  1TWB A;  2E3H A;  3LLR A;  4B6M A;  3GNG A;  1KQ2 A;  2LTO A;  3UPU A;  1R77 A;  1PRM C;  3NTK A;  5FWC A;  2K4Y A;  4ZGD B;  2K5L A;  2QYZ A;  1K0S A;  4B9W A;  1KQS P;  7AT1 B;  4C92 B;  1UB4 A;  4PJO G;  3TU4 K;  3RKW A;  2RNA A;  3A8M B;  3NTI A;  4EMH A;  2J6F A;  3CC7 T;  5GMK l;  5KYX B;  3CC4 A;  2E65 A;  1ZUU A;  1OU9 A;  2L89 A;  2CP3 A;  4C5H A;  4JRQ A;  5AYF A;  4LDX A;  1UE9 A;  1YBY A;  3M0S A;  4N4I A;  1VQM Q;  2QDY B;  1YIJ Q;  3HRS A;  1PHT A;  1K9M R;  1RAC B;  1SEM A;  3VYG A;  1VQL T;  2VXE A;  2MOX A;  2MWP A;  1KC8 U;  4PJO D;  2JTM A;  2FPD A;  5KYW A;  2DE0 X;  2E3I A;  2D8J A;  3OYM A;  1SRL A;  2K2M A;  4E7S A;  1K8A C;  2PQW A;  1HSQ A;  2QK0 A;  1VQN T;  3ASK A;  2CH4 A;  2O4X B;  5D6X A;  3RER A;  4FM4 B;  5CKB A;  5GAO q;  3OSV A;  3OS2 A;  2OI3 A;  4ANJ A;  2JUF A;  4HVU A;  1X75 C;  2JJ9 A;  3PT9 A;  2OTJ A;  2DL8 A;  1PC0 A;  1YIT Q;  4GY5 A;  2NUT A;  4C92 F;  1M27 C;  1XNI A;  1JRI A;  1WXT A;  4MML A;  5KCH A;  4J9E A;  3TQ7 P;  3L2Q A;  5HKC A;  5KE3 A;  1YHQ A;  1OPK A;  1SHF A;  1W1F A;  3RDV A;  3SHW A;  3CCL T;  2IG0 A;  4OMM A;  4M7A E;  4RTY A;  2J6K A;  1FMW A;  1YJW T;  4KUL A;  1WHM A;  2ROL A;  2EQI A;  2QA4 T;  4LDY A;  2EYZ A;  3JCM Q;  1TS9 A;  4M7D C;  1X43 A;  1TSF A;  3VS1 A;  1I5L A;  4M7A B;  3CCU A;  4JJN K;  4E7Z A;  2DXC A;  2XKO C;  3EG9 A;  1YCY A;  2C06 A;  1VYU A;  2DXT A;  1VQ7 T;  4M75 C;  1M3C A;  3OYK A;  3OYG A;  1WGS A;  1QW1 A;  1UEB A;  2EQM A;  5GAO n;  2KGT A;  1PSE A;  4KUD K;  1FXX A;  3UA7 A;  3L2Z A;  1QCN A;  2RF0 A;  1WYX A;  4PFP A;  2YSQ A;  2YLB A;  2YUO A;  4JUV A;  3QG1 A;  2P4R A;  1B34 B;  4HCZ A;  3HL8 A;  3JV3 A;  1AT1 B;  2DBM A;  5FW9 A;  3CBP A;  3OW2 P;  3QBY A;  2V1R A;  3FEO A;  2FPE A;  2BE7 D;  1MGQ A;  3I9Q A;  4BE2 A;  1NYF A;  2DK3 A;  4J7F A;  2RQW A;  1M2V A;  2O9V A;  1WQW A;  1M9S A;  5CKH A;  2FB7 A;  1K9M C;  3IQL A;  2DVE A;  1ZSZ A;  3KXT A;  1VQK Q;  4R55 A;  2KQW A;  2CDT A;  4GLK A;  2RI3 A;  1QMC A;  4JZ4 A;  1MND A;  3CD6 T;  4DOW A;  2QGF B;  2X3X D;  3VS0 A;  3JRZ A;  2AKL A;  1S1N A;  1UGR B;  2FO0 A;  3X26 B;  1N9S A;  4RMO A;  2ZPF B;  5KCO A;  2LDM A;  4A4E A;  4PJO B;  5LJ3 h;  1D1B A;  5GAO l;  3M0Q A;  5GAN d;  3M55 A;  4M7A F;  2KYB A;  1UGQ B;  2P84 A;  1OI1 A;  3G71 A;  2ZPG B;  1YJ9 Q;  3HFO A;  3NGP A;  3L1A A;  1CKB A;  3TCJ A;  4AG2 C;  5KYN A;  1YJN A;  1G3S A;  1W70 A;  3CCM A;  1FMV A;  3HFN A;  5HK3 A;  1VQ9 Q;  4N0A C;  2OTL A;  4LE9 A;  3DLM A;  3CCR Q;  4A63 B;  5EG2 A;  3CME A;  1IGU A;  4Z88 A;  1RUW A;  3OYF A;  4ZTF A;  1I07 A;  2JZ2 A;  3VV0 A;  3UWN A;  4BE0 A;  1VYT A;  2QEX Q;  3PMT A;  1W6X A;  3MO8 A;  3QWX X;  4XAX B;  2RI5 A;  1KC8 R;  3TVT A;  2HD0 A;  5GMK i;  2X4Y A;  3HSB A;  3JB9 H;  5LJ3 g;  1WIE A;  2MK5 A;  3A8O B;  1QVP A;  4OMP A;  3FIF A;  2HZY A;  2LRQ A;  4JRK A;  3QYH B;  3V8L A;  3DLL A;  1Y0M A;  1VOM A;  3EHR A;  1R8O B;  1SF9 A;  2AZV A;  4RTX A;  5GJV B;  5I22 A;  3JCM g;  4OMF B;  1M30 A;  1AVZ C;  2DFU A;  2LJ1 A;  3G4S T;  4C5G A;  4OVA A;  3CD6 Q;  3M53 A;  1BI2 A;  2BTT A;  2HL3 A;  3EGD A;  1R0B G;  1M1F A;  2G6F X;  2K3X A;  5KE2 A;  2GF7 A;  3JB9 J;  5GAN h;  2COW A;  1WI7 A;  2J7I A;  4J6Y A;  1IZ6 A;  5KYW B;  1N8R U;  1JJ2 S;  2KEA A;  1FX7 A;  1LCK A;  1PD0 A;  4LD9 K;  4E47 A;  4DBH A;  4OB2 B;  4BDY A;  3ER0 A;  1VQN A;  2O9S A;  1ZA2 B;  2K7A A;  3PFS A;  1QVG P;  3SWN A;  3P8D A;  2RHZ A;  5C6S A;  3R6N A;  2FG0 A;  3CC4 T;  3CCE Q;  1RAE B;  3E19 A;  4KT0 E;  5FU7 B;  2NUT B;  8AT1 B;  3G7Z A;  5GAO p;  2XI9 A;  3JSC A;  3RNJ A;  5GAM h;  4BI8 B;  2YUN A;  1HD3 A;  2EYQ A;  4C8Q C;  4RTW A;  1TG0 A;  1VQO T;  3CCL A;  5D7U A;  1G83 A;  2FHD A;  2M0O A;  4BUG A;  4C0Z A;  2L8D A;  4FL6 A;  1W2B P;  4QQG A;  3VS6 A;  1X27 A;  4ATO A;  2QA4 A;  2LZ6 B;  3JCM b;  2VYT A;  2RHI A;  5C0M A;  2E1H A;  3PVL A;  4L5G A;  2EKO A;  1QP2 A;  4HVV A;  1H92 A;  2W10 A;  3EG9 B;  3M54 A;  1KC8 C;  3VS3 A;  3JCM e;  2CUD A;  4FYW B;  2RQU A;  1KD1 R;  3CCQ A;  3I56 A;  4OP0 A;  1SKU B;  3G1J A;  2CT3 A;  4ZGE B;  1NPR A;  1WHK A;  2VGM A;  2DAQ A;  4X1V A;  2DYB A;  3KUF A;  3UT1 A;  4M78 C;  3FC3 A;  2SEM A;  5CKF A;  5FU6 C;  5GAM g;  1ZBX A;  3HPW A;  1ZHI A;  1Z9Q A;  1K9M U;  3OS0 A;  1ZX6 A;  2DXU A;  3ZEH A;  2RM4 A;  4XTW A;  1WFW A;  2RK1 A;  4BI3 A;  1Q86 R;  3U23 A;  1M2V B;  4BY6 B;  3RMS A;  4J6X A;  2PTK A;  3A5Z B;  4JPB W;  1ZSZ B;  2EKH A;  1M4Z A;  4PLI A;  3X25 B;  2DYI A;  4E7J A;  2LT1 A;  2F2V A;  1UGP B;  4LDV A;  2CP7 A;  1TOV A;  4M75 A;  1FYN A;  1G8X A;  4F14 A;  2ZCF B;  3CBO A;  1IB8 A;  4BE1 A;  3OW2 A;  2DMO A;  4KGZ B;  3CPW P;  2KY9 A;  3QJ6 A;  3GP8 A;  1GXI E;  1V1C A;  1IRE B;  2CSI A;  1XJW B;  4WTO B;  1Q81 R;  2HQH A;  3H9N A;  4RCC A;  3VRZ A;  5GMK m;  2FZG B;  2O01 E;  2JTE A;  3OMG A;  4E7L A;  1VQ8 A;  1UDL A;  2RI2 A;  1IGQ A;  5J26 A;  2DIG A;  3P8B B;  4HKE A;  3CXC S;  1ZSG A;  1RAH B;  2ROT A;  1VQ4 T;  1LNX A;  5LJ5 g;  1N27 A;  4DEY A;  2IPO B;  3VS2 A;  4BB7 A;  3QPH A;  5J3B A;  3H0H A;  4LDU A;  2GNC A;  1VIE A;  1BKB A;  3GNF B;  4PFO A;  2OTJ Q;  2HSE B;  3OYI A;  2EJG A;  1N8R R;  5CK9 A;  3OYH A;  2RO0 A;  4M75 G;  4JZ3 A;  2A36 A;  2KK4 A;  1ZBJ A;  1K0X A;  2VGN A;  1YHQ Q;  1FMK A;  4HXJ A;  5GAM e;  1TXQ A;  5D6Y A;  2HSP A;  4D8D A;  2QQR A;  4WCI A;  3MEV A;  1KD1 C;  3A8H B;  3G71 T;  2EQK A;  3TSW A;  2JMC A;  1GL5 A;  5IHI A;  3JCM c;  1YJN T;  2K5F A;  1SSH A;  2DEQ A;  5IT9 E;  3CCM T;  2OX7 A;  4NL2 A;  3CCU Q;  2EBP A;  3OW2 S;  4M75 D;  5KH6 A;  3EGD B;  3GBQ A;  2OTL T;  4QW2 A;  2R5M A;  3EG2 A;  1LJO A;  4PJL A;  4LD6 A;  3CMA T;  3WVD B;  1T0J A;  3CME T;  4CI0 C;  1Q86 C;  2DNU A;  3CC2 Q;  4XTZ A;  4A4F A;  2HEQ A;  1UUE A;  2OJ2 A;  1U1S A;  3EFO A;  3MP1 A;  2FZC B;  2HBW A;  9ATC B;  4PJJ A;  2X51 A;  1X2K A;  2CT4 A;  2Y90 A;  3QHS A;  2J6O A;  1UGV A;  2DTH A;  2HAX A;  5CVI A;  2YT6 A;  2CH4 W;  3GIB A;  3JCM P;  1VQ5 A;  3CCS T;  3SWN B;  5GAN 3;  1D1C A;  1H8K A;  1M1K U;  1UJY A;  2K6D A;  3QZ9 B;  3M9Q A;  3ZBD A;  4CC4 B;  4CC3 A;  4PJN A;  1AOJ A;  1Q81 C;  2AIR B;  5LJ5 e;  5GAN 8;  1WJQ A;  3UAT A;  2M51 A;  1N5Z A;  2XU8 A;  3A1P A;  3C12 A;  3CCV Q;  1Y7X A;  2XID A;  3VS7 A;  4E7K A;  2E5K A;  1YCS B;  2MF2 A;  4CC7 A;  2MWO A;  3CCJ Q;  3OB9 A;  1VQO A;  2CZ1 B;  4C92 C;  1NLP C;  3MHX A;  1Y71 A;  5GMK e;  5KYU A;  3M4G A;  1KJW A;  2EPD A;  2FEI A;  5DLQ E;  4BD3 A;  2DIQ A;  2PZ1 A;  2RQT A;  5AT1 B;  3JCM X;  4XTU A;  1NYG A;  2VKN A;  1LVK A;  2HL5 C;  2FRY A;  2HDA A;  3JCM V;  3E9G A;  2KVQ G;  1QCO A;  2YLC A;  3J80 E;  4DBQ A;  5GAO m;  2M9U A;  4P5N A;  1N8R C;  2LNH B;  2P4T A;  2D8H A;  1MMN A;  1W2B A;  2GTO A;  4KH1 B;  2CUB A;  4XTX A;  3EFR A;  1VQ6 A;  2L3P A;  4QT7 A;  2DVJ A;  1BI3 A;  2YXY A;  2MCN A;  2JNG A;  5GAO r;  3OY9 A;  2QTV A;  5L8R E;  2ZAE A;  3NPF A;  4M75 E;  3VUB A;  1KK7 A;  4O6J A;  5LJ3 d;  2O2O A;  3LYI A;  1VQP T;  4OMO A;  4Z02 A;  1QCF A;  3MEU A;  3CC7 Q;  2D9T A;  1GCP A;  4M75 B;  2JW4 A;  3JCM d;  4DBR A;  4KRT A;  3PMI A;  4HCC A;  1U5S A;  2Y4Y A;  2X4J A;  5J39 A;  2XDP A;  4M78 A;  3CCQ T;  3I56 T;  4PKC C;  2NUZ A;  1T3L A;  2O31 A;  4D8K A;  1GFD A;  1QWE A;  2JS0 A;  1G3Y A;  1VQL Q;  3EG1 A;  2E64 A;  3QKJ A;  2WSF E;  4OML A;  2YRD A;  1OV3 A;  3VS4 A;  1X6B A;  1UG1 A;  1K76 A;  3ZL7 C;  4M7A C;  1EIF A;  1UHF A;  4C0G A;  2VWF A;  4C8Q G;  2DM1 A;  1VQ4 A;  2CP0 A;  2M0Y A;  1VQN Q;  3V8J A;  3CPW A;  4MZP A;  2NUP A;  5CQX A;  4J9C A;  1Q82 R;  1WQ7 A;  4RTZ A;  1EZZ B;  1UJ0 A;  4PJO E;  5GAN j;  1OUL A;  3PIO A;  2JT4 A;  4ORZ A;  1W2B S;  2EJ9 A;  2DD5 A;  3HTR A;  2YUP A;  4ZTJ A;  3VS5 A;  1EX4 A;  1KD1 U;  1KFZ A;  1QVF A;  2FL7 A;  1MNE A;  1I81 A;  2RMO A;  3JCM J;  2OAU A;  5IXB A;  3MKD A;  1O75 A;  1M2O A;  1XQH A;  3NMZ C;  4M78 G;  4JJD A;  4M75 F;  3CCL Q;  4XQ3 A;  1VQ8 T;  2GTJ A;  4LN2 A;  2M1H A;  4O5V A;  1YJW Q;  4FW2 A;  2KRS A;  4GLM A;  1NLO C;  1Q86 U;  1M1K R;  2EGC A;  3CEY A;  2QA4 Q;  2HCK A;  2D0N A;  1RAI B;  3GOX A;  4DOV A;  1M3B A;  2YDL A;  3JCM h;  8ATC B;  1BCO A;  2JM8 A;  3OS1 A;  4E7H A;  2YWW A;  4FU6 A;  4IKF A;  3H8Z A;  4PK4 A;  4JDS A;  4N4G A;  4ME7 A;  4HT9 A;  3CMA A;  2K9G A;  4IUV A;  2HMA A;  4XU0 A;  4M78 D;  1VQ7 Q;  2DX1 A;  3MCA B;  1Y96 A;  3I5R A;  2RHX A;  2GBQ A;  1IXD A;  2BUD A;  2PUO B;  4EMK C;  3A8G B;  3S3M A;  2CZ7 B;  2DTI A;  3EAE A;  4F16 A;  2I0N A;  3EFO B;  3SFM A;  4CC2 A;  1NZ9 A;  1K73 U;  5GAM d;  1Q81 U;  1D0Z A;  3AT1 B;  1M1G A;  2K3B A;  2P0P A;  4J6W A;  3E9F A;  5I11 A;  2XD0 A;  1NG2 A;  3SEM A;  4J9B A;  3REA B;  3CPW S;  2A08 A;  1YIT A;  2F5T X;  2J05 A;  2RJE A;  3CCS A;  1PM3 A;  3EGX A;  3S3N A;  2A28 A;  2GQV A;  1X69 A;  2LX9 A;  1M8M A;  1H64 1;  1Q7Y R;  3MET A;  2RQV A;  3OYN A;  4PJO F;  3EGU A;  4HA8 A;  2CRE A;  4M77 C;  2EW3 A;  2BE9 B;  1QVF S;  4QVD A;  1GRI A;  4ZNX A;  1QKW A;  1QLY A;  2IIM A;  2RPN A;  2LMJ A;  1KQS A;  1OX8 A;  5FWB A;  4A4K A;  4J5Y A;  3M58 A;  2L3R A;  2D1X A;  5KYU B;  2DRK A;  1JO8 A;  2AHJ B;  1YWO A;  2DL3 A;  4EDU A;  1BCM A;  1V29 B;  2X4W A;  1Q82 C;  3OYD A;  4C5E A;  1PG5 B;  3S3O A;  1MV0 B;  3OYB A;  1U06 A;  3ULR B;  3LGF A;  4AT1 B;  2RH2 A;  4IIM A;  1BI0 A;  1WDX A;  3MP6 A;  1VQ5 T;  3LGL A;  3H6Z A;  2D0Q B;  1N9R A;  2EYY A;  2WSC E;  3MP8 A;  2ED1 A;  1KIK A;  2V8J A;  5LJ5 d;  1IO6 A;  4AFS C;  4RCB A;  5GAN f;  3A8L B;  2M02 A;  3M57 A;  2MIO A;  2P0Q A;  1OQK A;  4C0D B;  5HY6 A;  1WPY A;  1M1K C;  2R58 A;  2R5A A;  2ZPI B;  1WHH A;  1VYV A;  2A7Y A;  4IUQ A;  3RBB B;  2RK2 A;  1VUB A;  2HBP A;  2LNV A;  5GAN 7;  2H3E B;  3BW1 A;  4M78 E;  3C94 A;  4JS5 A;  2DEU A;  5A0D A;  2E12 A;  1VQP A;  1RAG B;  2RQR A;  1YI2 A;  4R0K A;  2JXB A;  2E6N A;  4E7I A;  2KAF A;  2CZ0 B;  2KDS A;  3WXM B;  2R57 A;  4XU2 A;  1F1B B;  1UHC A;  3G4S Q;  3OSS C;  4J9D A;  4M78 B;  1WZO A;  3UDC A;  1AWJ A;  1NE8 A;  1UTI A;  1KQS S;  5FRO A;  4V2S A;  2RJD A;  5FU6 B;  4FT2 A;  4FT4 A;  4JJB A;  2LX7 A;  2KXD A;  1X01 A;  1PKS A;  3L2W A;  4KH0 B;  1VQ6 T;  3SDZ A;  4YTL A;  1VQ9 A;  2Z0W A;  2H3J A;  1M3A A;  3BY7 A;  1Q7Y C;  3QDF A;  2FPF A;  4MMK A;  2X3W D;  1CKA A;  5I21 A;  3I55 T;  2LJ0 A;  3KFV A;  4C92 G;  1X6G A;  3G6E T;  3PTA A;  3GF5 A;  4XU1 A;  2NUP B;  2QEX A;  3VRY A;  1GBR A;  3THK A;  2PNI A;  3M0T A;  4M7D A;  4UC4 A;  2LP5 A;  3BDU A;  1D1A A;  3RKY A;  5LJ5 h;  2LVM A;  4E6R A;  2E70 A;  4FYV B;  2C0T A;  4ZGJ B;  4C0F A;  3CC4 Q;  4XTV A;  3FRN A;  1Z9Z A;  2KYM A;  3X28 B;  1SRM A;  4AFU C;  5GMK h;  4NOY A;  4DA4 A;  1K73 R;  4ESR A;  4B9X A;  4BY6 C;  1G5V A;  1WNL A;  2EAY A;  1VQO Q;  3EG3 A;  5CAI A;  2DL5 A;  2BKD N;  2RHY A;  2LQK A;  4M78 F;  2EQU A;  5A0L A;  4KBM B;  4FCY A;  5KYY A;  5IH2 A;  1B07 A;  3LWH A;  3JB9 G;  2HKQ B;  2D6F A;  1H3Z A;  4HVW A;  3JAM E;  4DEX A;  2QAZ A;  2L5Q A;  4F7U A;  4KUI A;  1GCQ C;  2KE9 A;  1S72 A;  3M59 A;  1Y96 B;  4GBQ A;  4LUE A;  4RTV A;  2CP2 A;  2DL4 A;  4M7D G;  2FVU A;  1EFN A;  2BZX A;  2L3S A;  4TVR A;  3NFC A;  1JEG A;  1VQ6 Q;  2AZS A;  3M5A A;  1OZ3 A;  3JB9 D;  3N5B B;  2EIF A;  1NEB A;  2EGE A;  2EYX A;  4JS4 A;  3E2U A;  5CCA A;  3OYJ A;  1MMD A;  2L2P A;  1JJ2 P;  3CCE A;  3EH2 A;  3X20 B;  2QGG A;  2LQN A;  3EGX B;  2ZPE B;  2FZK B;  2JMA A;  3I35 A;  2QAS A;  2LCC A;  2VVK A;  2KT8 A;  1VQM T;  4M7D D;  3S6W A;  4RKU E;  1YP5 A;  4N0A A;  1WLP B;  1PCX A;  2MMP A;  2XIC A;  4F04 B;  2GFA A;  1T3S A;  1RI9 A;  4OGE A;  1Q82 U;  1ZA1 B;  4PLL A;  1PSF A;  1YFN A;  1V76 A;  4EMK A;  2QTX A;  2DZC A;  4L6V 5;  1I8F A;  1UFF A;  2RA2 A;  5ECA A;  2E4H A;  1JQQ A;  4FSS A;  4F7U G;  2XDB A;  2F69 A;  1BI1 A;  1WXU A;  2EGA A;  1G3T A;  1T0H A;  3TSZ A;  2ESW A; 
#chains in the Genus database with same CATH homology
 3EHR A;  2EYW A;  2AZV A;  4AFZ C;  2NUZ A;  4RTX A;  1T3L A;  5GJV B;  2O31 A;  4D8K A;  1GFD A;  5I22 A;  1QWE A;  2JS0 A;  1M30 A;  1SPK A;  1AVZ C;  3EG1 A;  2LJ1 A;  1ZUY A;  2BTT A;  4OMQ A;  2C0O A;  1BB9 A;  4OML A;  3NHN A;  2G6F X;  1OV3 A;  2GGR A;  3VS4 A;  2O88 A;  2K79 A;  3H41 A;  1X6B A;  1UG1 A;  5IXF A;  1K76 A;  2YUQ A;  3ZL7 C;  2DJQ A;  1AEY A;  1UHF A;  1QKX A;  2VWF A;  3H0F A;  5IHK A;  2L0A A;  2DM1 A;  1WI7 A;  4Y92 A;  2J7I A;  4RTU A;  2M0Y A;  2C0I A;  1AWW A;  2JS2 A;  2KEA A;  2FRW A;  1LCK A;  4J9C A;  4RTZ A;  1UJ0 A;  1JU5 C;  2JT4 A;  4ORZ A;  2SRC A;  1G2B A;  2YUP A;  3VS5 A;  2RN8 A;  3FJ5 A;  1ABO A;  1KFZ A;  2O9S A;  2LQW A;  1AWO A;  2K7A A;  5GJW B;  2LJ3 A;  2RMO A;  2JM9 A;  3H0I A;  2H8H A;  5IXB A;  1RLQ C;  2DF6 A;  1E7O A;  1OEB A;  1VA7 A;  3NMZ C;  3R6N A;  2FG0 A;  4JJD A;  1WXB A;  1BK2 A;  4RTT A;  2GTJ A;  4LN2 A;  1U3O A;  2KRS A;  2V1Q A;  4GLM A;  1NLO C;  1ARK A;  3RNJ A;  2EGC A;  2HCK A;  2D0N A;  1JXO A;  2YUN A;  1HD3 A;  1M3B A;  2YDL A;  2F2X A;  1BBZ A;  1TG0 A;  2KBT A;  4RTW A;  1X2Q A;  2JM8 A;  1G83 A;  1ZUK A;  1SHG A;  3LH5 A;  3VS6 A;  3O5Z A;  1X27 A;  2K9G A;  1A0N B;  1YWP A;  1E6H A;  2DX1 A;  3I5R A;  2LZ6 B;  2CSQ A;  4LNP A;  4F17 A;  5IHN A;  2GBQ A;  1AD5 A;  1Y57 A;  3PVL A;  2DBK A;  2DRM A;  4HVV A;  1BU1 A;  1H92 A;  2W10 A;  4F16 A;  4J9H A;  2I0N A;  3C0C A;  4M4Z A;  4CC2 A;  3VS3 A;  1WX6 A;  5HCK A;  2CUD A;  2RQU A;  2KRN A;  3M0R A;  2CT3 A;  2XMF A;  2K3B A;  5I11 A;  4X1V A;  2DYB A;  1NG2 A;  3SEM A;  4J9B A;  3REA B;  1MUZ A;  2A08 A;  4AG1 C;  4AFQ C;  2A37 A;  1AWX A;  2SEM A;  1OOT A;  2KXC A;  2J05 A;  2A28 A;  2DLP A;  1GFC A;  1Z9Q A;  1X69 A;  1M8M A;  1JXM A;  2ABL A;  2ENM A;  3M0P A;  2RQV A;  1ZX6 A;  3EGU A;  4J9G A;  1WFW A;  2CRE A;  2EW3 A;  3U23 A;  1HJD A;  1GRI A;  4ZNX A;  3REB B;  2PTK A;  1QKW A;  1QLY A;  2IIM A;  2RPN A;  4JPB W;  2EKH A;  2LMJ A;  5FWB A;  1PRM C;  1I0C A;  2D1X A;  2F2V A;  5FWC A;  2DRK A;  2KNB B;  1JO8 A;  1K0S A;  1YWO A;  2DL3 A;  1FYN A;  3UF4 A;  1K1Z A;  2NWM A;  4F14 A;  1YNZ A;  2DMO A;  5L23 A;  2RNA A;  1MV0 B;  2QDL A;  1U06 A;  3ULR B;  2J6F A;  1GBQ A;  1V1C A;  1RLP C;  2CSI A;  4IIM A;  1H3H A;  1OPL A;  3VRZ A;  1WDX A;  2KRO A;  2DIL A;  1ZUU A;  2JTE A;  4IIO A;  1UDL A;  1MV3 A;  2EYY A;  1AZE A;  2ED1 A;  1UE9 A;  3M0S A;  1KIK A;  1IO6 A;  2BZ8 A;  1PKT A;  1PHT A;  1ZSG A;  2ROT A;  1SEM A;  4AFS C;  1E6G A;  2MOX A;  2FPD A;  2MIO A;  2DE0 X;  4DEY A;  2D8J A;  3VS2 A;  2KRM A;  1SRL A;  2B86 A;  2K2M A;  1GCQ A;  1WA7 A;  3H0H A;  1VYV A;  2GNC A;  3RBB B;  4RUG A;  1HSQ A;  1K9A A;  2CH4 A;  2GQI A;  2ECZ A;  2RQR A;  2OI3 A;  3QWY A;  2JXB A;  2A36 A;  4HVU A;  4JZ3 A;  4R0K A;  1KSW A;  1ZBJ A;  1K0X A;  1FMK A;  4HXJ A;  2DL8 A;  4D8D A;  2HSP A;  3EHQ A;  1UHC A;  4J9D A;  3PE0 A;  1QWF A;  2DL7 A;  3A98 A;  4WCI A;  1AWJ A;  1M27 C;  1UTI A;  1WXT A;  3TSW A;  1PNJ A;  4J9E A;  2JMC A;  1GL5 A;  4JJB A;  5IHI A;  1OPK A;  1SHF A;  1W1F A;  3SHW A;  2LX7 A;  2KXD A;  1SSH A;  4OMM A;  4RTY A;  1PKS A;  2EBP A;  2J6K A;  2BZY A;  3GBQ A;  1M3A A;  3EG2 A;  2FPF A;  1T0J A;  2X3W D;  1CKA A;  2EQI A;  2ROL A;  2EYZ A;  2LJ0 A;  2DNU A;  3KFV A;  1X43 A;  1X6G A;  2HEQ A;  3VS1 A;  1UUE A;  3VRY A;  2OJ2 A;  1GBR A;  3THK A;  2PNI A;  3M0T A;  5EC7 A;  2LP5 A;  2HBW A;  1VYU A;  4E6R A;  1M3C A;  1UEC A;  4Z89 A;  1X2K A;  2C0T A;  2CT4 A;  1J3T A;  2KGT A;  2J6O A;  1UGV A;  3UA7 A;  3I5S A;  4EIK A;  2YT6 A;  2CH4 W;  1Z9Z A;  4Z8A A;  1PWT A;  2KYM A;  4HCK A;  2RF0 A;  1WYX A;  2YSQ A;  3CQT A;  1H8K A;  1UJY A;  2K6D A;  2YUO A;  1SRM A;  1NEG A;  4CC4 B;  1AZG B;  4AFU C;  4CC3 A;  2P4R A;  1I1J A;  1AOJ A;  4ESR A;  3JV3 A;  2DBM A;  5FW9 A;  2V1R A;  2FPE A;  3EG3 A;  3UAT A;  2M51 A;  2DL5 A;  3I9Q A;  1NYF A;  4JJC A;  2RQW A;  1N5Z A;  5IH2 A;  1B07 A;  2O9V A;  1CSK A;  4LUD A;  3VS7 A;  1TUC A;  3IQL A;  2E5K A;  1YCS B;  2LCS A;  2CDT A;  4CC7 A;  4JZ4 A;  4K11 A;  4HVW A;  1NLP C;  4DEX A;  1KJW A;  2L3Q A;  2EPD A;  2FEI A;  1GCQ C;  2PZ1 A;  2KE9 A;  2RQT A;  2X3X D;  1K4U S;  3VS0 A;  1NYG A;  2DA9 A;  2AKL A;  1S1N A;  2VKN A;  2FO0 A;  4GBQ A;  4LUE A;  2FRY A;  4RTV A;  2HDA A;  3EG0 A;  1ZLM A;  2DL4 A;  1EFN A;  3M0Q A;  2KR3 A;  2BZX A;  2L3S A;  2F2W A;  3PVQ A;  1JEG A;  1YN8 A;  2J06 A;  2KYB A;  2AZS A;  1TUD A;  2EVR A;  4OMN A;  3NGP A;  2LNH B;  1NEB A;  2EGE A;  2EYX A;  1CKB A;  4AG2 C;  2D8H A;  2KT1 A;  2L2P A;  4J9F A;  2ED0 A;  2AKK A;  2GTO A;  1W70 A;  2CUB A;  2LQN A;  2L3P A;  2AK5 A;  4QT7 A;  2DVJ A;  2MCN A;  2JMA A;  3I35 A;  1ABQ A;  4LE9 A;  2VVK A;  2KT8 A;  4A63 B;  1YP5 A;  4Z88 A;  1RUW A;  3NPF A;  1WLP B;  2OAW A;  1I07 A;  3UA6 A;  1T3S A;  1XOV A;  1VYT A;  1RI9 A;  2O2O A;  3M0U A;  1W6X A;  3QWX X;  1NM7 A;  3TVT A;  1UFF A;  4OMO A;  5ECA A;  1JQQ A;  4FSS A;  1PRL C;  1WIE A;  1QCF A;  1GCP A;  2JW4 A;  2W0Z A;  2EGA A;  1WXU A;  4OMP A;  1B3Q A;  1T0H A;  4KRT A;  4J9I A;  3TSZ A;  1U5S A;  2ESW A;  1Y0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...