1T0JA

Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
96
Chain Sequence
RREAERQAQAQLEKAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords voltage-gated calcium channel subunit beta2a
publication title Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 23
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2004-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12052 VGCC_beta4Aa_N Voltage gated calcium channel subunit beta domain 4Aa N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1t0jA00
3NGPA 2DF6A 2JTEA 2GTOA 2IIMA 3VS3A 1UG1A 1UTIA 1WXUA 2KNBB 2FO0A 4Z8AA 2JS2A 3NPFA 1JEGA 2XMFA 2YDLA 3SHWA 1UDLA 1T0HA 2LQWA 1RUWA 2LMJA 2DILA 1X27A 1G83A 2LQNA 2JMCA 1A0NB 1M27C 4QT7A 1GL5A 2K9GA 2YUPA 1BB9A 2F2XA 2AZVA 1Y57A 4Z89A 4ESRA 1WDXA 1OPKA 2KEAA 1SRLA 2RQUA 2I0NA 1WXTA 4CC7A 1ZX6A 3ZL7C 4RTVA 2CT3A 5IHIA 4X1VA 2KXDA 2GGRA 1QLYA 3VRYA 2EYWA 2HCKA 2BZ8A 3REAB 4OMQA 2ENMA 2J7IA 4CC3A 3THKA 1QKWA 4JZ3A 1BK2A 3UF4A 2X3XD 2CUDA 2YT6A 1FMKA 1GFCA 1UHCA 2KRNA 2JS0A 2DMOA 1NEGA 1SRMA 2CDTA 1UJ0A 1BU1A 2DM1A 2KRSA 2OI3A 4M4ZA 4AG2C 1SSHA 2FPEA 4CC4B 1UJYA 2J6KA 3M0UA 4FSSA 1UFFA 1VYTA 3O5ZA 1T3SA 2FRWA 3CQTA 2ROLA 1NYFA 1WXBA 1UHFA 2ESWA 3C0CA 2E5KA 1JO8A 2FG0A 1Y0MA 4CC2A 1AWWA 2DL8A 3M0PA 1B07A 1H8KA 2FRYA 3EHRA 4J9EA 4LNPA 2LJ0A 2DL7A 2D8HA 4JJCA 5I11A 1UE9A 2CH4A 2LX7A 3I9QA 1WFWA 4LUDA 4AFSC 2HEQA 4RTUA 3NMZC 1J3TA 2HBWA 2DBMA 2X3WD 3EG1A 5ECAA 3EHQA 4OMOA 2EGCA 4Z88A 3SEMA 2CSQA 1OPLA 1AZGB 2ECZA 2ED0A 4E6RA 1PNJA 1T3LA 3JV3A 3TVTA 2LZ6B 1PWTA 3I35A 2D0NA 1X6BA 3TSWA 2G6FX 4GBQA 4RTXA 2L0AA 1HSQA 2JM9A 1ZSGA 1GBQA 2LP5A 1N5ZA 3I5SA 1AEYA 3H0HA 4DEXA 3IQLA 1TG0A 3EG3A 2CH4W 1YCSB 2O2OA 2RMOA 1M3BA 2PNIA 2EBPA 2K79A 1U06A 3VS7A 1WI7A 4KRTA 2J06A 3REBB 2YUQA 4EIKA 1RLPC 2MIOA 1X6GA 2KYBA 1K9AA 1WYXA 2K2MA 2KROA 2RN8A 1IO6A 1S1NA 3FJ5A 1KIKA 1KJWA 1ABOA 2L3SA 2HSPA 1JXOA 2L2PA 1UGVA 2EYXA 1KSWA 2EKHA 1VYVA 1X43A 1ZUKA 2DX1A 5IHKA 2DL5A 4JZ4A 5FW9A 5IHNA 4J9HA 2MCNA 2D1XA 2K3BA 2DNUA 3U23A 1XOVA 3LH5A 1PKTA 1ZUUA 1U5SA 1MUZA 3UA7A 1E6HA 2MOXA 5FWBA 4RTWA 1NLOC 1ZBJA 2RQVA 2CUBA 1H3HA 2P4RA 2JT4A 3A98A 4F16A 2FPDA 1YWPA 1H92A 1GRIA 1PRLC 2GQIA 2A08A 1GFDA 1NEBA 2ROTA 1FYNA 2KRMA 4JJBA 3EGUA 2J6FA 2RF0A 2J6OA 2GTJA 1RLQC 1WA7A 2KE9A 1YP5A 2AK5A 1OOTA 2YSQA 2C0TA 4OMLA 4WCIA 2M51A 1KFZA 2KYMA 2O9SA 5FWCA 4JPBW 2NWMA 4J9GA 1RI9A 3VS4A 2RQTA 2LNHB 1NLPC 3VS2A 2DRKA 1JU5C 4JJDA 1VA7A 3H0FA 3RNJA 4K11A 1GCQC 1E6GA 1EFNA 2NUZA 2BZYA 2QDLA 1K76A 4RTTA 4F14A 4IIOA 4RUGA 4D8DA 3UA6A 1JXMA 2DRMA 3EG2A 3R6NA 2F2VA 1AWJA 2A37A 1PRMC 1I0CA 4LN2A 1YNZA 2W10A 4J9IA 1NYGA 2EGEA 2RPNA 4IIMA 2OAWA 1HD3A 4AFUC 1E7OA 4A63B 2KGTA 4OMNA 2HDAA 3EG0A 2BTTA 4DEYA 1WX6A 1B3QA 2PZ1A 4HCKA 4HVVA 2DE0X 1NG2A 2DBKA 1JQQA 1WIEA 5IXBA 2KR3A 2FEIA 1HJDA 2LJ1A 1X2KA 3H0IA 4RTZA 4HVWA 1SEMA 5EC7A 2KT8A 2ED1A 1QWFA 3M0RA 3PVQA 3PVLA 1OEBA 3PE0A 3M0QA 1GCPA 4AFQC 1M3CA 3I5RA 3VS0A 1W6XA 2DVJA 2CSIA 1TUCA 2EPDA 2FPFA 2CREA 4GLMA 1K0XA 2ABLA 1GCQA 1ZLMA 2H8HA 4LUEA 2V1QA 1ARKA 2DA9A 2VVKA 5GJVB 4D8KA 1W70A 4R0KA 1M8MA 2EYZA 3NHNA 1K1ZA 2SRCA 4HXJA 1CSKA 2YUNA 3TSZA 4OMPA 1LCKA 1X69A 2AKLA 5I22A 2DL4A 2V1RA 1AZEA 1QWEA 1AWOA 1AOJA 5GJWB 2LCSA 2AZSA 2L3QA 2JM8A 2GNCA 2EQIA 2RQRA 1CKBA 4RTYA 4OMMA 3RBBB 1WLPB 2C0IA 4J9FA 2EVRA 2CT4A 4ZNXA 2K7AA 2F2WA 2AKKA 2L3PA 1SPKA 1SHFA 1VYUA 1UUEA 2B86A 1G2BA 1AD5A 2M0YA 3VS6A 1V1CA 2O88A 3KFVA 1W1FA 1BBZA 1MV0B 1K4US 2DYBA 3QWXX 1MV3A 2VWFA 2KXCA 1YWOA 2RQWA 1GBRA 2J05A 4LE9A 1U3OA 1QCFA 1AVZC 1Z9QA 1K0SA 2VKNA 2K6DA 2W0ZA 5IXFA 2A36A 2O31A 3ULRB 2D8JA 3M0TA 2KBTA 1TUDA 2EGAA 5L23A 2RNAA 2OJ2A 2PTKA 2EW3A 4Y92A 4AG1C 2GBQA 2LJ3A 1OV3A 1AWXA 1Z9ZA 3GBQA 1I07A 1NM7A 2DJQA 4F17A 3VS5A 1M3AA 2C0OA 1PHTA 2DLPA 2SEMA 1ABQA 4J9DA 3H41A 2YUOA 2KT1A 1SHGA 4ORZA 2JMAA 1T0JA 1CKAA 1YN8A 2DL3A 4J9BA 3QWYA 1ZUYA 2JW4A 2EYYA 4AFZC 2JXBA 1PKSA 1QKXA 3UATA 1I1JA 2O9VA 1UECA 1X2QA 3VS1A 1M30A 2BZXA 2A28A 5IH2A 3M0SA 4J9CA 4HVUA 5HCKA 3VRZA
chains in the Genus database with same CATH superfamily
2PUOB 2DF6A 4N4IA 3J7AF 3P8BB 2K57A 3VS3A 5LJ5j 4HCCA 2ZAEA 5CVIA 4Z8AA 2FB7A 2YDLA 3SHWA 4IUUA 4EPCA 2HAXA 1VQ5Q 4M7DD 2CZ0B 5FU6B 1G83A 5IT9E 2LQNA 2DZCA 4M75G 1M27C 1GL5A 3F70A 5GAN6 2VUBA 1VQOT 2F2XA 1Y57A 2JUFA 1V76A 1KD1R 3UT1A 2DZ9A 1BI0A 4OB3B 2KEAA 4PKCC 1VQ7A 2RQUA 4M7DC 1NJIU 1RAAB 2I0NA 3V7CA 1ZX6A 1VQLA 1WJQA 2A0FB 1Q82R 1WJRA 3C94A 1IRXA 5C6SA 2AHJB 4QKUA 1MGQA 1WQWA 1M1FA 2ZPFB 2J7IA 4CC3A 5LJ3e 4MDXA 1QKWA 3JB9G 5CCAA 4ME7A 1YJ9T 1UHCA 1IREB 1Q81R 1KD1C 2QQBA 1R0CB 1N9RA 1X01A 3QO3A 1SRMA 2OI3A 4XU0A 3TEEA 3JCMd 1UGSB 3M0UA 1Q82C 4F7UE 2FRWA 4FM4B 2ROLA 4E7SA 3CMAQ 1NYFA 3M53A 1YJWT 2R58A 1WXBA 2MK5A 1W2BP 1D0YA 1MNEA 3JAME 2ZGWA 2VXFA 1B07A 4BE2A 4C8QF 4LDWA 3HTRA 2NUPA 3HPWA 2CH4A 2LX7A 1Q81C 4AFSC 1KHCA 1J3TA 2XIDA 1YIJQ 3CCVT 3QIIA 3GF5A 4J5YA 1G3YA 4Z88A 1K9MR 3OYJA 1VQ9Q 3GNGA 3JB9I 4PJOD 1KK7A 3JCMQ 6AT1B 1T3LA 4C92C 2JJ9A 3N5BB 3TVTA 2VASA 3OYCA 4DA4A 3D7SB 2DJZA 2ZZDA 2XDBA 1YCYA 2JM9A 1ZSGA 1GBQA 2LP5A 1AEYA 2QXFA 4DEXA 1TG0A 2CH4W 1Q86U 1YCSB 2O2OA 2PNIA 1WQ7A 1M8VA 2RHIA 2DERA 1W2BA 3META 3A8GB 4EIKA 2CP2A 1RLPC 2KYBA 1RACB 4JRIA 1IO6A 1OZ2A 3EG9A 3LWIA 2LVMA 5FROA 1JXOA 2JZ2A 2L2PA 2WSCE 4F04B 1JRIA 1TH7A 4KUIA 5J3BA 5FU6C 3OSVA 1M1KU 1QVPA 5IHNA 4J9HA 1S72A 3CPWS 1PD1A 2H3EB 3NTHA 1ZSZC 2HQEA 5C0MA 4EMKA 1QP2A 1ZUUA 4KT0E 3HL8A 1PD0A 3OW2P 5KCOA 3GIBA 2RHXA 4M75B 4LDVA 1H3HA 5CQYA 4M77A 4HA8A 5AYFA 2OTJQ 4F16A 3L2QA 3JCMX 1YHQA 2MPXC 1KQSS 1GRIA 4M7DE 4II1A 1G3WA 1FX7A 1YBYA 3WXMB 3DKMA 3OYIA 4FYWB 1FYNA 2KRMA 4JJBA 2QASA 1PM3A 3X24B 2RF0A 4KGXB 1QVGS 3PGGA 3LYIA 3OYYA 3OSSC 5LJ3g 2KE9A 4FW1A 2AK5A 2LC4A 2K5IA 2YSQA 1N8RR 2YRDA 2LT1A 4A54A 4PJOF 2O9SA 2KQWA 3JCMV 2NWMA 4J9GA 4BY6B 1ACMB 3C95A 1NLPC 4D6WA 1VQ7Q 3WVEB 2E10A 3I56T 2RK2A 4C5GA 1M90U 1LNXA 5GANg 3E9FA 4K11A 2E3IA 4XK8E 1GCQC 3SWNA 2EJ9A 3OW2A 4HT8A 1E6GA 1QW1A 4M78D 5A0DA 2MWOA 4ZN3A 5D6XA 3GNFB 1WHLA 5KYNA 3JCMJ 3M4GA 1N8RC 4RUGA 2CP6A 1QMCA 3MP6A 4QQ6A 3LGLA 1YJWA 2DRMA 3HHTB 4V2SA 1TWBA 2F2VA 2DK3A 1AWJA 3KBGA 1PRMC 2W10A 2EGEA 4L59A 3HRTA 1HD3A 3V8LA 1D3BA 2FVUA 4E7KA 4M7AA 1PCXA 3EG0A 2K5FA 2PZ1A 4C92E 2GFUA 4HCKA 2KVQG 1W4SA 3CCVA 4FT4A 3MJXA 4A53A 2FEIA 2DETA 3OQ5A 1SEMA 2KT8A 4BACA 1GCPA 4AFQC 3CC7Q 3UWNA 1RAFB 4M7DG 1BI3A 5CO7A 1MHNA 2EFIA 3QHSA 2O4XB 1LPLA 2EPDA 3GP8A 4GLMA 1K0XA 2L5QA 2BUDA 4LUEA 1K73R 2ZPHB 2COWA 4LXCA 9ATCB 2E5QA 3RKWA 2D9TA 3NHNA 2EYZA 2LDMA 1RADB 1OX9A 3MKDA 1WGSA 2QK0A 2Y4XA 2YUNA 2EYQA 4EMGA 2AKLA 4PL6A 5I22A 1JBMA 3J80E 3TREA 3DLMA 4C0DB 1U8RA 3H9NA 2AZSA 2LCSA 8AT1B 2YLBA 5KYXB 3E2UA 3ZEHA 4OMMA 3RBBB 1IGQA 4HCBA 2AKKA 1K73C 4BD3A 4F7UB 1ZHIA 2B86A 2RI5A 1W2BS 1NPPA 5LJ5f 2YHTA 3BFMA 2M0OA 3CCEQ 5KYUB 1MV0B 3HFOA 1KC8U 1YJNA 2DYBA 1AT1B 3QWXX 3CCST 2KXCA 1GBRA 2J05A 4LE9A 2QG9B 2YRVA 1QCFA 4BY6C 3OYHA 2HQXA 1AVZC 4PFZA 2VXEA 2EAYA 2W0ZA 1VQ4T 2O31A 1YHQQ 3M9QA 4MZMA 5HKCA 3ULRB 1IZ6A 2PUKB 3P8HA 2KBTA 2GQVA 3BDUA 5CKDA 4EDUA 1H641 2RHYA 3MP8A 5FRMA 2XDPA 4MZTA 4RCCA 2F69A 4AG1C 4M77D 4PJOG 4XAXB 1OV3A 1YITA 2JTFA 2RB6A 1NM7A 3I56A 4JLGA 4JRQA 3EGDB 3G4ST 3CC2Q 3H41A 2KT1A 2X9HA 1T0JA 4M78E 3QWYA 1ZUYA 2VGNA 2HKNA 2JW4A 4C0FA 1YI2Q 3M54A 4OF1A 4XTZA 2JXBA 3UATA 1I1JA 1X2QA 2A28A 1EX4A 3CXCP 5IH2A 2OTLA 1KQ2A 5LJ3d 2NUTA 5GMKj 5HCKA 3OB9A 3NGPA 2YXYA 3EFOB 3OW2S 1IXDA 2IIMA 1IHWA 1WXUA 2KNBB 3BE3A 5L8RE 3CCRQ 2DXTA 2JS2A 3NPFA 3CD6T 1UDLA 5GAMh 5J26A 2LQWA 4FSXA 2LMJA 1C1AA 2QA4A 2JMCA 1VQPQ 4QT7A 4M7DB 2RJFA 1BB9A 2DIQA 3JB9J 1OPKA 1SRLA 1MMGA 4C0ZA 3RKXA 1VQNQ 2AT1B 1FMWA 5DLQE 2CP7A 1B34A 5GAOr 3A5ZB 1G5VA 2BIVA 2CZ6B 2KXDA 2P0KA 1SF9A 1VQMT 3S6WA 2EYWA 5LJ5h 2MAMA 3CXCA 3REAB 1Q81U 4OMQA 2ZPGB 1TTHB 3WVDB 3UF4A 2YLCA 2L89A 3OYAA 2X3XD 2O01E 1VQKT 2JS0A 1P92A 1BU1A 4AG2C 5GANj 4ZTJA 1SKUB 1UJYA 3OA6A 5GAOl 1VYTA 3O5ZA 1WHKA 1T3SA 3UPUA 4M78G 2DTHA 3CCJQ 2XDDA 1M2OA 3HRUA 1QVFP 3VUZA 3I55T 4J9EA 4DBFA 3CCSA 4JJCA 4RG2A 1K9MU 1UE9A 3CBPA 3I9QA 2HEQA 2HBWA 4PJLA 3LGFA 4C92B 2DBMA 4BE0A 4FYXB 2EGCA 1G3TA 1KHIA 1OPLA 4E6RA 1OU8A 3JV3A 1YJNQ 1EIFA 3I35A 1WJSA 1X6BA 1MMDA 4B9XA 4KH1B 4GBQA 4RTXA 3MP1A 1HSQA 4Q5WA 4M77E 3IQLA 4IUQA 3EG3A 3CMEA 3G4SA 2E6ZA 3VS7A 4KRTA 2V8JA 2DEUA 3E9GA 5FU7C 2J06A 4M7AF 3A8OB 1JJ2P 5KYWB 1XQHA 1MMNA 4YTLA 4C8QC 1QVFA 1WYXA 4JRKA 3JRZA 1S1NA 1YITQ 2Y90A 1ZSZB 2EKHA 1X43A 1XTDA 3OS2A 4IUTA 4JZ4A 5CQXA 3A1PA 2V26A 2D1XA 4J7FA 5EG2A 1U5SA 3AHUA 1O75A 4E7LA 5FWBA 4RTWA 2PQWA 5D7UA 4R55A 1GXIE 1ZA1B 1H92A 2QGFB 4A4EA 5I21A 1VQ8T 2PVDB 2FL7A 1NEBA 3QG1A 2J6FA 3PIOA 3ER0A 2J6OA 4ANJA 1N8RU 3L2WA 1JJ2A 3RDVA 1YP5A 4NS5A 1TXQA 4FIBA 1OOTA 1YI2T 1VQ6Q 4OMLA 2QA4Q 1WHGA 2QEXA 4BDYA 4BI4A 3CC4Q 1KQ1A 1I4K1 3C12A 1VQMA 4JPBW 1RI9A 2RQTA 2RA2A 2LNHB 3CEYA 3VS2A 4PJMA 1HK9A 5KH6A 4JDSA 3LW5E 4N4HA 1D1AA 3E19A 1VQKA 1DJ7B 2CP3A 3CCRT 4M77G 2RHZA 2R5AA 1EFNA 4XTVA 2NUZA 2BZYA 4M78B 4GLKA 4N4GA 5FRNA 4D8DA 3UA6A 3OS0A 3CCUA 3CXCS 4XQ3A 1K8AR 4M75A 2RPNA 4IIMA 2FZCB 4AFUC 3FLGA 1E7OA 2KGTA 3CCQT 4XU3A 4OMNA 1OX8A 4PJOC 1WX6A 3CCMQ 3RKYA 3MO8A 1Q7YU 4E7ZA 1LVKA 4HVVA 1I8FA 3L2RA 1JQQA 5GAMe 1R77A 2D0QB 5DY9A 4QVCA 3H0IA 4MDWA 3JCMb 2QQRA 2EQUA 3A8HB 3G71Q 2RJCA 2ED1A 1QWFA 1OEBA 3M0QA 2DD5A 1K73U 4A4FA 1QCOA 3S3MA 4LDYA 3VS0A 1K8AC 3G6EQ 2DVJA 2G3RA 5KE3A 2DIGA 1N27A 2Z0WA 3LLRA 2DAQA 2V1QA 5CK9A 1ARKA 4C8QE 2VVKA 1BCMA 4DBRA 1M8MA 2A3LA 5LJ5e 3OS5A 2FZGB 4Z02A 2SRCA 4O5VA 4JS5A 1CSKA 2QTVA 4OMPA 1LCKA 3OS1A 1O9SA 3CCLQ 1OULA 5GJWB 4E2FB 5DM7R 2L3QA 1VQOA 2RQRA 1CKBA 4RTYA 2XI9A 3CMEQ 4DOVA 1H3ZA 3OYFA 5GAOp 1VOMA 2CT4A 1OZ3A 3E1SA 1SPKA 2H3JA 1VYUA 1G2BA 1BCOA 1V29B 2M0YA 3RUXA 3VS6A 1V1CA 4X9CA 2O88A 2LNVA 3KFVA 5I2SA 1QVFS 1BBZA 1VIEA 4RMOA 4C0GA 1VQ8A 3OMCA 2F1LA 3PFSA 1YJ9A 1VQLQ 2HD0A 1TS9A 3H8ZA 4E7HA 1K0SA 2LTOA 2VKNA 1RAIB 1BI1A 2O4XA 2KDSA 1VQ5T 1FMVA 2QGGA 1TUDA 2WACA 2OJ2A 2PTKA 2EW3A 4M78C 2GBQA 1WHMA 2JVVA 3A8MB 2YRCA 1I07A 2DJQA 1KG1A 2KMTA 4M77B 1JJ2S 3URGA 2LCCA 2YUOA 4R56A 1U1SA 2QEXQ 1Y71A 3L2UA 2JMAA 4C8QG 5A2QE 4JRPA 3KUFA 2VV5A 3S3OA 3ZBDA 2HBPA 5I2MA 1QKXA 2M16A 2O9VA 4F7UA 2YWWA 3VS1A 3L2VA 4PJOE 3FRNA 2XICA 4J9CA 3M57A 4WTOB 3TU4K 3PT9A 2COZA 3QZ5B 3CCQA 1UG1A 2P4TA 3T9NA 1UTIA 4N0AA 1OU9A 4XTUA 3CCUQ 4OB1B 2XKOC 5GAMf 2EQKA 3CMAT 3VU3C 4ELYC 4RKUE 2DILA 1X27A 3OMGA 1A0NB 4P5NA 5M9OA 1NBEB 1PSEA 5GAOn 2YUPA 3GPLA 5GMKi 5FLXE 4QW2A 5LJ5g 4FYYB 2E41A 5IAYA 1Y96B 4CC7A 3ZL7C 4M75D 1YIJT 2CT3A 5IHIA 4DQ2A 1X6OA 5GMKh 1M1KR 4X1VA 1VQ9T 3EGDA 2GGRA 1QLYA 2VC8A 2DTOA 3VRYA 3MEVA 2BZ8A 4BE1A 3ZFJA 4KGVB 4LDUA 1BK2A 3PTAA 1FMKA 3MEUA 1N6AA 4RG8A 5KYYB 2DO3A 1S72Q 1NEGA 2BE7D 1UJ0A 2DM1A 2KRSA 2VB6A 2PU9B 1F1BB 1SSHA 2FPEA 2HZYA 2J6KA 2K4YA 3TCJA 1UFFA 1M1KC 1SG5A 3CQTA 4XU1A 1EZZB 3NTIA 2E5KA 1JO8A 3X26B 1VQOQ 4CC2A 1AWWA 1BYMA 3FDRA 5GAN7 5AT1B 1AHJB 3M0PA 1H8KA 4XU2A 2EIFA 3EHRA 2DL7A 2D8HA 1PG5B 1WHJA 2LT4A 3G7ZA 5I11A 4M7DA 2LRQA 2E64A 4QQDA 4EMKC 3NMZC 3M4YA 2RI3A 2AIRB 4OMOA 4KH0B 2R57A 3OYLA 5A0GA 3JB9H 3SEMA 4M77C 2HSEB 1AZGB 2ECZA 1VQ5A 5GANh 2VYTA 2OTJT 5GAOq 1PNJA 2LZ6B 3O8VA 3Q1JA 2COYA 3MCAB 1PWTA 2D0NA 4C5IA 1BIBA 2G6FX 4E47A 2L0AA 1YJ9Q 5D6YA 3EGXB 4PLIA 2KAFA 1X75C 3I5SA 3H0HA 5FU7B 4TVRA 3INZA 2BKDN 4M75F 4C8QB 3SB2A 2JNGA 2EBPA 1U06A 1HYOA 2PVOB 1PSFA 2I2LA 3V7RA 4PLLA 2E70A 3PNWC 1YJWQ 2MIOA 5LL6S 1X6GA 1K9AA 2C06A 2RN8A 4BI3A 1KD1U 2K5LA 3FJ5A 1UGQB 1KJWA 2L3SA 2LQKA 4J7IA 1UGVA 2QQAA 5CIUA 3JCMP 5HK3A 1VQ7T 2DX1A 1ZUKA 2DL5A 3JCMf 4OGEA 1Q82U 3NFCA 3SWNC 3KXTA 1M2VA 2M1HA 2K3BA 3U23A 1Y7XA 5GMKl 4XTYA 1PKTA 2CP5A 3CCVQ 2E3HA 3JB9F 3QDFA 4OB2B 1E6HA 2RK1A 2EQJA 5LJ3j 2HL3A 4M7AD 1ZBJA 1JB0E 3CMAA 4X34A 3A98A 4C92A 2HQHA 3NTKA 1PRLC 2DXCA 2ROTA 2F5KA 5CKBA 3VYHB 5CAIA 4M7AC 2QAZA 2RI2A 3RERA 1WA7A 4DBQA 1UGRB 1YIJA 4VUBA 4BB7A 4Y91A 2E1HA 2M51A 1VQ9A 3L1AA 2EJFA 2CZ1B 5FWCA 2CYZB 5GAMd 2FYKA 4J8OA 2VGMA 1OYXA 3VS4A 3FB9A 3CC7T 5KYWA 2DRKA 4OVAA 2OAUA 1JU5C 2KSSA 4JJDA 1D0XA 4NOYA 1KC8R 2XU8A 5HY6A 1VA7A 3RNJA 1PC0A 2WSFE 1ZSZA 3QJYA 3GOXA 2M9UA 1U1TA 1K8AU 3BDLA 1JXMA 1VQ4A 2RO0A 3JCMW 2E12A 2IG0A 3LH0A 3R6NA 5D6WA 1SSFA 4A4GA 2A37A 1I0CA 1B34B 5LJ5d 1B7TA 1YNZA 4PJOB 2LCLA 1G8XA 1NYGA 3LWHA 3EFRA 2OAWA 1M5Q1 3RIRA 1I5LA 2HDAA 1KC8C 2BTTA 3OYMA 4DOWA 2DE0X 1NG2A 2IVWA 1RI0A 2CP0A 2KR3A 1HJDA 2LJ1A 1X2KA 2LQ8A 4RTZA 4UC4A 4FCYA 3CCET 2OTJA 3PVLA 2QDYB 3PE0A 8ATCB 1M3CA 4C5HA 3OYDA 3HP9A 1R8OB 3I56Q 2CSIA 3JCMh 2FPFA 3PIPA 2CREA 4PNOA 4F7UF 2ZCFB 2ABLA 1GCQA 2H8HA 2F5TX 5GMKe 5GJVB 3TQ7P 4Y28E 4A4HA 4B6MA 4R0KA 2EWNA 1YHQT 3OY9A 2Y4YA 1TUGB 1TSFA 3FJPA 2OX7A 4HXJA 3CPFA 3CD6A 1X69A 2DL4A 2V1RA 1BIAA 4M78A 1AOJA 2D6FA 1WNLA 4IUPA 1QCNA 2OTLQ 4MMLA 2JM8A 2GNCA 2EQIA 3GLXA 4J9FA 4PFOA 1UB4A 4ZNXA 2NYSA 3CC2T 2K7AA 1TU0B 2F2WA 2KI7A 1SHFA 4X9DA 2GFAA 2ZPBB 1BI2A 1OI1A 1W1FA 1FXXA 4M7AE 1K4US 2L3RA 5GAN8 1M1GA 2QQ9A 5CKHA 3RMSA 1Z9QA 3C4SA 2P0QA 2WSEE 2A36A 4L6V5 5GANe 4QVDA 4BDZA 4ATOA 1VQPT 5L23A 2RNAA 2JOYA 3OYGA 4Y92A 2RM4A 4OP0A 3CC7A 1Z9ZA 2BE9B 4FYVB 4C92D 3EH2A 1VQNT 3MEWA 3A8LB 3I55A 1PHTA 2DLPA 4J9DA 1IB8A 2K3YA 4ZGEB 3QKJA 4A4KA 4OMFB 3ASKA 4ORZA 1XJWB 4IUVA 1CKAA 1RAHB 1YN8A 3JCMc 3FEOA 4J9BA 4M7DF 4HCZA 4AFZC 1UEBA 3BY7A 1D1BA 1PKSA 3J81E 1UECA 2E65A 2BZXA 2FZKB 3CCSQ 3VRZA 4PJJA 3QZ9B 1RABB 2JTEA 2GTOA 4FU6A 2XG8D 2FO0A 3DB4A 3RMQA 1D1CA 4BI8B 2XMFA 1K9MC 1JEGA 1VQ4Q 1T0HA 1RUWA 5GMKm 3CCEA 3CCJT 2NUPB 4ZGDB 2K9GA 4M7AG 2AZVA 4Z89A 2X35A 4ESRA 2X51A 1WDXA 1WXTA 4DBHA 4L5GA 3G4SQ 4RTVA 1C0MA 4LD9K 1HXDA 3X25B 1NJIR 4F7UG 3AT1B 2X4YA 2HCKA 1N9SA 1YJNT 3EH1A 2ENMA 3EFSA 3THKA 1QP3A 3HRSA 3QUIA 4JZ3A 5GAOm 2MI6A 4IKFA 2CUDA 2YT6A 1GFCA 4C92F 2KRNA 3QYGB 2JN0A 2DMOA 4OB0B 2CDTA 2CKKA 4M4ZA 2V8KA 3S3NA 3CC2A 4CC4B 2RD1A 4FSSA 4FW2A 3EG9B 4E7JA 3CD6Q 1NJIC 1YI2A 5LJ3f 1UHFA 2ESWA 3C0CA 3X28B 3HKSA 2FG0A 1YITT 1Y0MA 2DL8A 4EMKB 2B8AA 2E6NA 2RJEA 2FRYA 4LNPA 2LJ0A 3QYHB 1M9SA 1MMAA 2KY9A 1WFWA 4LUDA 4RTUA 4ZTFA 3BW1A 2DTIA 4IURA 2X3WD 3EG1A 5ECAA 3EHQA 5KYXA 3CCRA 2MWPA 2X4WA 3VYGA 1Y96A 2CSQA 1VQMQ 2ED0A 3SFMA 5GANf 3V8KA 2EKOA 1VQPA 3TSWA 2OTLT 1VIFA 4NL3A 1I5OB 2ZPEB 3VJPA 2ATCB 4FT2A 3JCMe 5GAMg 1VQKQ 1N5ZA 4OGCA 2K3XA 4PK4A 1VQNA 5KYUA 2RMOA 1M3BA 3PMIA 2K79A 2EQMA 1WI7A 5KYYA 2A7YA 3FIFA 4QVZA 2QA4T 1Q7YR 1VQ6T 3REBB 3CC4T 3HSBA 2YUQA 4JUVA 2HNIA 1Q86R 4KULA 4J6YA 1C6VX 1IGUA 2CS7A 1WPYA 2K2MA 2KROA 3RR6A 3PMTA 3OBWA 1KIKA 1ABOA 1RAEB 3SWNB 2GCXA 3QBYA 2HSPA 2EYXA 1KSWA 3H6ZA 1VYVA 1VUBA 5IHKA 3M59A 2R5MA 2QTXA 3V8JA 3X20B 4JS4A 3I55Q 5FW9A 1LJOA 1Y07A 4KUDK 2FHDA 2MCNA 5GAN3 2DNUA 2MMPA 1XOVA 3LH5A 3M55A 1MUZA 3JSCA 3OBYA 3UA7A 2MOXA 3QPHA 4XTWA 4ELZC 1NLOC 3VUBA 3P8DA 4BUGA 2RQVA 2CUBA 1Q7YC 4ZN1A 2P4RA 4WF2A 1D3BB 2JT4A 2RHUA 1D0ZA 1Q86C 2FPDA 1YWPA 2DVEA 4KGZB 4M7AB 2CGHA 2JTMA 2GQIA 3CCJA 4M75C 2A08A 1GFDA 3EGUA 4J6XA 2GTJA 1RLQC 2QYZA 2K2VA 4M78F 3CCMT 2EJGA 5KCHA 3EGXA 1WHHA 3JB9D 2P0PA 2C0TA 4WCIA 2DXBA 4B9WA 2P84A 1KFZA 2KYMA 4C8QA 3EFOA 3G71T 3VV0A 2DXUA 5LJ3h 5A0LA 3MPUB 3G6ET 3H0FA 4JJNK 2DFUA 4J83A 1I81A 2DKGA 3VKIA 2V8IA 4C92G 4E7IA 1M90R 2QDLA 1K76A 4RTTA 4F14A 1XNIA 4IIOA 2M02A 4C5EA 2PVGB 3UDCA 2GF7A 2RH2A 3SDZA 3CCLT 3EG2A 3OYBA 3RESA 2X4JA 4FL6A 5GAN5 4LN2A 1VQ8Q 4J9IA 3CMET 4A63B 1G3SA 1WZOA 4NL2A 5CKFA 4DEYA 1B3QA 2DBKA 3M56A 1WIEA 1D09B 4PJNA 1M90C 4JLIA 5IXBA 3JCMg 2HL5C 1LOJA 3LX7A 1QQJA 4HVWA 1Q95G 5EC7A 3M0RA 3PVQA 4HKEA 1IHVA 1OQKA 2MF2A 3HFNA 3I5RA 2DYIA 3ME9A 1W6XA 1TUCA 2NLUA 3QDRB 2HMAA 1VQLT 3R6OA 1ZLMA 3FC3A 2DA9A 3OYNA 4PFPA 2DPPB 4D8KA 1W70A 3DB3A 1K1ZA 1VQ6A 4GY5A 4J6WA 5CR2A 3CC4A 2LX9A 3MEAA 4EMHA 3TSZA 2CZ7B 5CKEA 1NZ9A 5HK0A 1AZEA 1QWEA 5GANd 3OYKA 1AWOA 4CI0C 1R0BG 5KE2A 5J39A 3DLLA 4MMKA 3MHXA 3QJ6A 2HKQB 4RCBA 1WLPB 4C0DC 3CCQQ 2C0IA 1ZA2B 2EVRA 4LDXA 4PJOA 1BKBA 2QEXT 2L3PA 4O6JA 1UGPB 5IN1A 2MYSA 2XHCA 1UUEA 3CPWP 1AD5A 1M4ZA 2E4HA 4M75E 2KK4A 1ZBXA 3L2ZA 2NUTB 4XTXA 5GAN4 3M58A 1ZQ1A 2QQSA 3L42A 7AT1B 1YFNA 2DEQA 3CBOA 4M77F 1FWZA 2XD0A 5DLOA 1MV3A 3SD4A 1KQSP 2VWFA 1YWOA 2IPOB 2RQWA 3QXEB 4ZGJB 1U3OA 4HT9A 4KBMB 3CCMA 4AMCA 4N0AC 2K6DA 3G1JA 1QVGP 5IXFA 2XK0A 3CCUT 2D8JA 3M0TA 5GAN2 2RJDA 2X4XA 1M2VB 3G71A 2EGAA 1MNDA 2L8DA 1RAGB 4QQGA 2ZPIB 3V7SA 2LJ3A 1AWXA 4LD6A 1NE8A 4MZPA 3GBQA 3G6EA 2DD4A 4F17A 3VS5A 1M3AA 4AT1B 3CPWA 5GAMj 3CBMA 2C0OA 2SEMA 1ABQA 4CRIA 1SHGA 1NPRA 2DL3A 3EAEA 2EYYA 1TOVA 3QSUA 3OYEA 2QI2A 1KQSA 3CCLA 1M30A 4C8QD 3M0SA 1RL2A 4HVUA 1S72T 1QVGA 3M5AA
chains in the Genus database with same CATH topology
3NGPA 2DF6A 2JTEA 2GTOA 2IIMA 3VS3A 1UG1A 1UTIA 1WXUA 2KNBB 2FO0A 4Z8AA 2JS2A 3NPFA 1JEGA 2XMFA 2YDLA 3SHWA 1UDLA 1T0HA 2LQWA 1RUWA 2LMJA 2DILA 1X27A 1G83A 2LQNA 2JMCA 1A0NB 1M27C 4QT7A 1GL5A 2K9GA 2YUPA 1BB9A 2F2XA 2AZVA 1Y57A 4Z89A 4ESRA 1WDXA 1OPKA 2KEAA 1SRLA 2RQUA 2I0NA 1WXTA 4CC7A 1ZX6A 3ZL7C 4RTVA 2CT3A 5IHIA 4X1VA 2KXDA 2GGRA 1QLYA 3VRYA 2EYWA 2HCKA 2BZ8A 3REAB 4OMQA 2ENMA 2J7IA 4CC3A 3THKA 1QKWA 4JZ3A 1BK2A 3UF4A 2X3XD 2CUDA 2YT6A 1FMKA 1GFCA 1UHCA 2KRNA 2JS0A 2DMOA 1NEGA 1SRMA 2CDTA 1UJ0A 1BU1A 2DM1A 2KRSA 2OI3A 4M4ZA 4AG2C 1SSHA 2FPEA 4CC4B 1UJYA 2J6KA 3M0UA 4FSSA 1UFFA 1VYTA 3O5ZA 1T3SA 2FRWA 3CQTA 2ROLA 1NYFA 1WXBA 1UHFA 2ESWA 3C0CA 2E5KA 1JO8A 2FG0A 1Y0MA 4CC2A 1AWWA 2DL8A 3M0PA 1B07A 1H8KA 2FRYA 3EHRA 4J9EA 4LNPA 2LJ0A 2DL7A 2D8HA 4JJCA 5I11A 1UE9A 2CH4A 2LX7A 3I9QA 1WFWA 4LUDA 4AFSC 2HEQA 4RTUA 3NMZC 1J3TA 2HBWA 2DBMA 2X3WD 3EG1A 5ECAA 3EHQA 4OMOA 2EGCA 4Z88A 3SEMA 2CSQA 1OPLA 1AZGB 2ECZA 2ED0A 4E6RA 1PNJA 1T3LA 3JV3A 3TVTA 2LZ6B 1PWTA 3I35A 2D0NA 1X6BA 3TSWA 2G6FX 4GBQA 4RTXA 2L0AA 1HSQA 2JM9A 1ZSGA 1GBQA 2LP5A 1N5ZA 3I5SA 1AEYA 3H0HA 4DEXA 3IQLA 1TG0A 3EG3A 2CH4W 1YCSB 2O2OA 2RMOA 1M3BA 2PNIA 2EBPA 2K79A 1U06A 3VS7A 1WI7A 4KRTA 2J06A 3REBB 2YUQA 4EIKA 1RLPC 2MIOA 1X6GA 2KYBA 1K9AA 1WYXA 2K2MA 2KROA 2RN8A 1IO6A 1S1NA 3FJ5A 1KIKA 1KJWA 1ABOA 2L3SA 2HSPA 1JXOA 2L2PA 1UGVA 2EYXA 1KSWA 2EKHA 1VYVA 1X43A 1ZUKA 2DX1A 5IHKA 2DL5A 4JZ4A 5FW9A 5IHNA 4J9HA 2MCNA 2D1XA 2K3BA 2DNUA 3U23A 1XOVA 3LH5A 1PKTA 1ZUUA 1U5SA 1MUZA 3UA7A 1E6HA 2MOXA 5FWBA 4RTWA 1NLOC 1ZBJA 2RQVA 2CUBA 1H3HA 2P4RA 2JT4A 3A98A 4F16A 2FPDA 1YWPA 1H92A 1GRIA 1PRLC 2GQIA 2A08A 1GFDA 1NEBA 2ROTA 1FYNA 2KRMA 4JJBA 3EGUA 2J6FA 2RF0A 2J6OA 2GTJA 1RLQC 1WA7A 2KE9A 1YP5A 2AK5A 1OOTA 2YSQA 2C0TA 4OMLA 4WCIA 2M51A 1KFZA 2KYMA 2O9SA 5FWCA 4JPBW 2NWMA 4J9GA 1RI9A 3VS4A 2RQTA 2LNHB 1NLPC 3VS2A 2DRKA 1JU5C 4JJDA 1VA7A 3H0FA 3RNJA 4K11A 1GCQC 1E6GA 1EFNA 2NUZA 2BZYA 2QDLA 1K76A 4RTTA 4F14A 4IIOA 4RUGA 4D8DA 3UA6A 1JXMA 2DRMA 3EG2A 3R6NA 2F2VA 1AWJA 2A37A 1PRMC 1I0CA 4LN2A 1YNZA 2W10A 4J9IA 1NYGA 2EGEA 2RPNA 4IIMA 2OAWA 1HD3A 4AFUC 1E7OA 4A63B 2KGTA 4OMNA 2HDAA 3EG0A 2BTTA 4DEYA 1WX6A 1B3QA 2PZ1A 4HCKA 4HVVA 2DE0X 1NG2A 2DBKA 1JQQA 1WIEA 5IXBA 2KR3A 2FEIA 1HJDA 2LJ1A 1X2KA 3H0IA 4RTZA 4HVWA 1SEMA 5EC7A 2KT8A 2ED1A 1QWFA 3M0RA 3PVQA 3PVLA 1OEBA 3PE0A 3M0QA 1GCPA 4AFQC 1M3CA 3I5RA 3VS0A 1W6XA 2DVJA 2CSIA 1TUCA 2EPDA 2FPFA 2CREA 4GLMA 1K0XA 2ABLA 1GCQA 1ZLMA 2H8HA 4LUEA 2V1QA 1ARKA 2DA9A 2VVKA 5GJVB 4D8KA 1W70A 4R0KA 1M8MA 2EYZA 3NHNA 1K1ZA 2SRCA 4HXJA 1CSKA 2YUNA 3TSZA 4OMPA 1LCKA 1X69A 2AKLA 5I22A 2DL4A 2V1RA 1AZEA 1QWEA 1AWOA 1AOJA 5GJWB 2LCSA 2AZSA 2L3QA 2JM8A 2GNCA 2EQIA 2RQRA 1CKBA 4RTYA 4OMMA 3RBBB 1WLPB 2C0IA 4J9FA 2EVRA 2CT4A 4ZNXA 2K7AA 2F2WA 2AKKA 2L3PA 1SPKA 1SHFA 1VYUA 1UUEA 2B86A 1G2BA 1AD5A 2M0YA 3VS6A 1V1CA 2O88A 3KFVA 1W1FA 1BBZA 1MV0B 1K4US 2DYBA 3QWXX 1MV3A 2VWFA 2KXCA 1YWOA 2RQWA 1GBRA 2J05A 4LE9A 1U3OA 1QCFA 1AVZC 1Z9QA 1K0SA 2VKNA 2K6DA 2W0ZA 5IXFA 2A36A 2O31A 3ULRB 2D8JA 3M0TA 2KBTA 1TUDA 2EGAA 5L23A 2RNAA 2OJ2A 2PTKA 2EW3A 4Y92A 4AG1C 2GBQA 2LJ3A 1OV3A 1AWXA 1Z9ZA 3GBQA 1I07A 1NM7A 2DJQA 4F17A 3VS5A 1M3AA 2C0OA 1PHTA 2DLPA 2SEMA 1ABQA 4J9DA 3H41A 2YUOA 2KT1A 1SHGA 4ORZA 2JMAA 1T0JA 1CKAA 1YN8A 2DL3A 4J9BA 3QWYA 1ZUYA 2JW4A 2EYYA 4AFZC 2JXBA 1PKSA 1QKXA 3UATA 1I1JA 2O9VA 1UECA 1X2QA 3VS1A 1M30A 2BZXA 2A28A 5IH2A 3M0SA 4J9CA 4HVUA 5HCKA 3VRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGP A;  2DF6 A;  2JTE A;  2GTO A;  2IIM A;  3VS3 A;  1UG1 A;  1UTI A;  1WXU A;  2KNB B;  2FO0 A;  4Z8A A;  2JS2 A;  3NPF A;  1JEG A;  2XMF A;  2YDL A;  3SHW A;  1UDL A;  1T0H A;  2LQW A;  1RUW A;  2LMJ A;  2DIL A;  1X27 A;  1G83 A;  2LQN A;  2JMC A;  1A0N B;  1M27 C;  4QT7 A;  1GL5 A;  2K9G A;  2YUP A;  1BB9 A;  2F2X A;  2AZV A;  1Y57 A;  4Z89 A;  4ESR A;  1WDX A;  1OPK A;  2KEA A;  1SRL A;  2RQU A;  2I0N A;  1WXT A;  4CC7 A;  1ZX6 A;  3ZL7 C;  4RTV A;  2CT3 A;  5IHI A;  4X1V A;  2KXD A;  2GGR A;  1QLY A;  3VRY A;  2EYW A;  2HCK A;  2BZ8 A;  3REA B;  4OMQ A;  2ENM A;  2J7I A;  4CC3 A;  3THK A;  1QKW A;  4JZ3 A;  1BK2 A;  3UF4 A;  2X3X D;  2CUD A;  2YT6 A;  1FMK A;  1GFC A;  1UHC A;  2KRN A;  2JS0 A;  2DMO A;  1NEG A;  1SRM A;  2CDT A;  1UJ0 A;  1BU1 A;  2DM1 A;  2KRS A;  2OI3 A;  4M4Z A;  4AG2 C;  1SSH A;  2FPE A;  4CC4 B;  1UJY A;  2J6K A;  3M0U A;  4FSS A;  1UFF A;  1VYT A;  3O5Z A;  1T3S A;  2FRW A;  3CQT A;  2ROL A;  1NYF A;  1WXB A;  1UHF A;  2ESW A;  3C0C A;  2E5K A;  1JO8 A;  2FG0 A;  1Y0M A;  4CC2 A;  1AWW A;  2DL8 A;  3M0P A;  1B07 A;  1H8K A;  2FRY A;  3EHR A;  4J9E A;  4LNP A;  2LJ0 A;  2DL7 A;  2D8H A;  4JJC A;  5I11 A;  1UE9 A;  2CH4 A;  2LX7 A;  3I9Q A;  1WFW A;  4LUD A;  4AFS C;  2HEQ A;  4RTU A;  3NMZ C;  1J3T A;  2HBW A;  2DBM A;  2X3W D;  3EG1 A;  5ECA A;  3EHQ A;  4OMO A;  2EGC A;  4Z88 A;  3SEM A;  2CSQ A;  1OPL A;  1AZG B;  2ECZ A;  2ED0 A;  4E6R A;  1PNJ A;  1T3L A;  3JV3 A;  3TVT A;  2LZ6 B;  1PWT A;  3I35 A;  2D0N A;  1X6B A;  3TSW A;  2G6F X;  4GBQ A;  4RTX A;  2L0A A;  1HSQ A;  2JM9 A;  1ZSG A;  1GBQ A;  2LP5 A;  1N5Z A;  3I5S A;  1AEY A;  3H0H A;  4DEX A;  3IQL A;  1TG0 A;  3EG3 A;  2CH4 W;  1YCS B;  2O2O A;  2RMO A;  1M3B A;  2PNI A;  2EBP A;  2K79 A;  1U06 A;  3VS7 A;  1WI7 A;  4KRT A;  2J06 A;  3REB B;  2YUQ A;  4EIK A;  1RLP C;  2MIO A;  1X6G A;  2KYB A;  1K9A A;  1WYX A;  2K2M A;  2KRO A;  2RN8 A;  1IO6 A;  1S1N A;  3FJ5 A;  1KIK A;  1KJW A;  1ABO A;  2L3S A;  2HSP A;  1JXO A;  2L2P A;  1UGV A;  2EYX A;  1KSW A;  2EKH A;  1VYV A;  1X43 A;  1ZUK A;  2DX1 A;  5IHK A;  2DL5 A;  4JZ4 A;  5FW9 A;  5IHN A;  4J9H A;  2MCN A;  2D1X A;  2K3B A;  2DNU A;  3U23 A;  1XOV A;  3LH5 A;  1PKT A;  1ZUU A;  1U5S A;  1MUZ A;  3UA7 A;  1E6H A;  2MOX A;  5FWB A;  4RTW A;  1NLO C;  1ZBJ A;  2RQV A;  2CUB A;  1H3H A;  2P4R A;  2JT4 A;  3A98 A;  4F16 A;  2FPD A;  1YWP A;  1H92 A;  1GRI A;  1PRL C;  2GQI A;  2A08 A;  1GFD A;  1NEB A;  2ROT A;  1FYN A;  2KRM A;  4JJB A;  3EGU A;  2J6F A;  2RF0 A;  2J6O A;  2GTJ A;  1RLQ C;  1WA7 A;  2KE9 A;  1YP5 A;  2AK5 A;  1OOT A;  2YSQ A;  2C0T A;  4OML A;  4WCI A;  2M51 A;  1KFZ A;  2KYM A;  2O9S A;  5FWC A;  4JPB W;  2NWM A;  4J9G A;  1RI9 A;  3VS4 A;  2RQT A;  2LNH B;  1NLP C;  3VS2 A;  2DRK A;  1JU5 C;  4JJD A;  1VA7 A;  3H0F A;  3RNJ A;  4K11 A;  1GCQ C;  1E6G A;  1EFN A;  2NUZ A;  2BZY A;  2QDL A;  1K76 A;  4RTT A;  4F14 A;  4IIO A;  4RUG A;  4D8D A;  3UA6 A;  1JXM A;  2DRM A;  3EG2 A;  3R6N A;  2F2V A;  1AWJ A;  2A37 A;  1PRM C;  1I0C A;  4LN2 A;  1YNZ A;  2W10 A;  4J9I A;  1NYG A;  2EGE A;  2RPN A;  4IIM A;  2OAW A;  1HD3 A;  4AFU C;  1E7O A;  4A63 B;  2KGT A;  4OMN A;  2HDA A;  3EG0 A;  2BTT A;  4DEY A;  1WX6 A;  1B3Q A;  2PZ1 A;  4HCK A;  4HVV A;  2DE0 X;  1NG2 A;  2DBK A;  1JQQ A;  1WIE A;  5IXB A;  2KR3 A;  2FEI A;  1HJD A;  2LJ1 A;  1X2K A;  3H0I A;  4RTZ A;  4HVW A;  1SEM A;  5EC7 A;  2KT8 A;  2ED1 A;  1QWF A;  3M0R A;  3PVQ A;  3PVL A;  1OEB A;  3PE0 A;  3M0Q A;  1GCP A;  4AFQ C;  1M3C A;  3I5R A;  3VS0 A;  1W6X A;  2DVJ A;  2CSI A;  1TUC A;  2EPD A;  2FPF A;  2CRE A;  4GLM A;  1K0X A;  2ABL A;  1GCQ A;  1ZLM A;  2H8H A;  4LUE A;  2V1Q A;  1ARK A;  2DA9 A;  2VVK A;  5GJV B;  4D8K A;  1W70 A;  4R0K A;  1M8M A;  2EYZ A;  3NHN A;  1K1Z A;  2SRC A;  4HXJ A;  1CSK A;  2YUN A;  3TSZ A;  4OMP A;  1LCK A;  1X69 A;  2AKL A;  5I22 A;  2DL4 A;  2V1R A;  1AZE A;  1QWE A;  1AWO A;  1AOJ A;  5GJW B;  2LCS A;  2AZS A;  2L3Q A;  2JM8 A;  2GNC A;  2EQI A;  2RQR A;  1CKB A;  4RTY A;  4OMM A;  3RBB B;  1WLP B;  2C0I A;  4J9F A;  2EVR A;  2CT4 A;  4ZNX A;  2K7A A;  2F2W A;  2AKK A;  2L3P A;  1SPK A;  1SHF A;  1VYU A;  1UUE A;  2B86 A;  1G2B A;  1AD5 A;  2M0Y A;  3VS6 A;  1V1C A;  2O88 A;  3KFV A;  1W1F A;  1BBZ A;  1MV0 B;  1K4U S;  2DYB A;  3QWX X;  1MV3 A;  2VWF A;  2KXC A;  1YWO A;  2RQW A;  1GBR A;  2J05 A;  4LE9 A;  1U3O A;  1QCF A;  1AVZ C;  1Z9Q A;  1K0S A;  2VKN A;  2K6D A;  2W0Z A;  5IXF A;  2A36 A;  2O31 A;  3ULR B;  2D8J A;  3M0T A;  2KBT A;  1TUD A;  2EGA A;  5L23 A;  2RNA A;  2OJ2 A;  2PTK A;  2EW3 A;  4Y92 A;  4AG1 C;  2GBQ A;  2LJ3 A;  1OV3 A;  1AWX A;  1Z9Z A;  3GBQ A;  1I07 A;  1NM7 A;  2DJQ A;  4F17 A;  3VS5 A;  1M3A A;  2C0O A;  1PHT A;  2DLP A;  2SEM A;  1ABQ A;  4J9D A;  3H41 A;  2YUO A;  2KT1 A;  1SHG A;  4ORZ A;  2JMA A;  1T0J A;  1CKA A;  1YN8 A;  2DL3 A;  4J9B A;  3QWY A;  1ZUY A;  2JW4 A;  2EYY A;  4AFZ C;  2JXB A;  1PKS A;  1QKX A;  3UAT A;  1I1J A;  2O9V A;  1UEC A;  1X2Q A;  3VS1 A;  1M30 A;  2BZX A;  2A28 A;  5IH2 A;  3M0S A;  4J9C A;  4HVU A;  5HCK A;  3VRZ A; 
#chains in the Genus database with same CATH topology
 2PUO B;  2DF6 A;  4N4I A;  3J7A F;  3P8B B;  2K57 A;  3VS3 A;  5LJ5 j;  4HCC A;  2ZAE A;  5CVI A;  4Z8A A;  2FB7 A;  2YDL A;  3SHW A;  4IUU A;  4EPC A;  2HAX A;  1VQ5 Q;  4M7D D;  2CZ0 B;  5FU6 B;  1G83 A;  5IT9 E;  2LQN A;  2DZC A;  4M75 G;  1M27 C;  1GL5 A;  3F70 A;  5GAN 6;  2VUB A;  1VQO T;  2F2X A;  1Y57 A;  2JUF A;  1V76 A;  1KD1 R;  3UT1 A;  2DZ9 A;  1BI0 A;  4OB3 B;  2KEA A;  4PKC C;  1VQ7 A;  2RQU A;  4M7D C;  1NJI U;  1RAA B;  2I0N A;  3V7C A;  1ZX6 A;  1VQL A;  1WJQ A;  2A0F B;  1Q82 R;  1WJR A;  3C94 A;  1IRX A;  5C6S A;  2AHJ B;  4QKU A;  1MGQ A;  1WQW A;  1M1F A;  2ZPF B;  2J7I A;  4CC3 A;  5LJ3 e;  4MDX A;  1QKW A;  3JB9 G;  5CCA A;  4ME7 A;  1YJ9 T;  1UHC A;  1IRE B;  1Q81 R;  1KD1 C;  2QQB A;  1R0C B;  1N9R A;  1X01 A;  3QO3 A;  1SRM A;  2OI3 A;  4XU0 A;  3TEE A;  3JCM d;  1UGS B;  3M0U A;  1Q82 C;  4F7U E;  2FRW A;  4FM4 B;  2ROL A;  4E7S A;  3CMA Q;  1NYF A;  3M53 A;  1YJW T;  2R58 A;  1WXB A;  2MK5 A;  1W2B P;  1D0Y A;  1MNE A;  3JAM E;  2ZGW A;  2VXF A;  1B07 A;  4BE2 A;  4C8Q F;  4LDW A;  3HTR A;  2NUP A;  3HPW A;  2CH4 A;  2LX7 A;  1Q81 C;  4AFS C;  1KHC A;  1J3T A;  2XID A;  1YIJ Q;  3CCV T;  3QII A;  3GF5 A;  4J5Y A;  1G3Y A;  4Z88 A;  1K9M R;  3OYJ A;  1VQ9 Q;  3GNG A;  3JB9 I;  4PJO D;  1KK7 A;  3JCM Q;  6AT1 B;  1T3L A;  4C92 C;  2JJ9 A;  3N5B B;  3TVT A;  2VAS A;  3OYC A;  4DA4 A;  3D7S B;  2DJZ A;  2ZZD A;  2XDB A;  1YCY A;  2JM9 A;  1ZSG A;  1GBQ A;  2LP5 A;  1AEY A;  2QXF A;  4DEX A;  1TG0 A;  2CH4 W;  1Q86 U;  1YCS B;  2O2O A;  2PNI A;  1WQ7 A;  1M8V A;  2RHI A;  2DER A;  1W2B A;  3MET A;  3A8G B;  4EIK A;  2CP2 A;  1RLP C;  2KYB A;  1RAC B;  4JRI A;  1IO6 A;  1OZ2 A;  3EG9 A;  3LWI A;  2LVM A;  5FRO A;  1JXO A;  2JZ2 A;  2L2P A;  2WSC E;  4F04 B;  1JRI A;  1TH7 A;  4KUI A;  5J3B A;  5FU6 C;  3OSV A;  1M1K U;  1QVP A;  5IHN A;  4J9H A;  1S72 A;  3CPW S;  1PD1 A;  2H3E B;  3NTH A;  1ZSZ C;  2HQE A;  5C0M A;  4EMK A;  1QP2 A;  1ZUU A;  4KT0 E;  3HL8 A;  1PD0 A;  3OW2 P;  5KCO A;  3GIB A;  2RHX A;  4M75 B;  4LDV A;  1H3H A;  5CQY A;  4M77 A;  4HA8 A;  5AYF A;  2OTJ Q;  4F16 A;  3L2Q A;  3JCM X;  1YHQ A;  2MPX C;  1KQS S;  1GRI A;  4M7D E;  4II1 A;  1G3W A;  1FX7 A;  1YBY A;  3WXM B;  3DKM A;  3OYI A;  4FYW B;  1FYN A;  2KRM A;  4JJB A;  2QAS A;  1PM3 A;  3X24 B;  2RF0 A;  4KGX B;  1QVG S;  3PGG A;  3LYI A;  3OYY A;  3OSS C;  5LJ3 g;  2KE9 A;  4FW1 A;  2AK5 A;  2LC4 A;  2K5I A;  2YSQ A;  1N8R R;  2YRD A;  2LT1 A;  4A54 A;  4PJO F;  2O9S A;  2KQW A;  3JCM V;  2NWM A;  4J9G A;  4BY6 B;  1ACM B;  3C95 A;  1NLP C;  4D6W A;  1VQ7 Q;  3WVE B;  2E10 A;  3I56 T;  2RK2 A;  4C5G A;  1M90 U;  1LNX A;  5GAN g;  3E9F A;  4K11 A;  2E3I A;  4XK8 E;  1GCQ C;  3SWN A;  2EJ9 A;  3OW2 A;  4HT8 A;  1E6G A;  1QW1 A;  4M78 D;  5A0D A;  2MWO A;  4ZN3 A;  5D6X A;  3GNF B;  1WHL A;  5KYN A;  3JCM J;  3M4G A;  1N8R C;  4RUG A;  2CP6 A;  1QMC A;  3MP6 A;  4QQ6 A;  3LGL A;  1YJW A;  2DRM A;  3HHT B;  4V2S A;  1TWB A;  2F2V A;  2DK3 A;  1AWJ A;  3KBG A;  1PRM C;  2W10 A;  2EGE A;  4L59 A;  3HRT A;  1HD3 A;  3V8L A;  1D3B A;  2FVU A;  4E7K A;  4M7A A;  1PCX A;  3EG0 A;  2K5F A;  2PZ1 A;  4C92 E;  2GFU A;  4HCK A;  2KVQ G;  1W4S A;  3CCV A;  4FT4 A;  3MJX A;  4A53 A;  2FEI A;  2DET A;  3OQ5 A;  1SEM A;  2KT8 A;  4BAC A;  1GCP A;  4AFQ C;  3CC7 Q;  3UWN A;  1RAF B;  4M7D G;  1BI3 A;  5CO7 A;  1MHN A;  2EFI A;  3QHS A;  2O4X B;  1LPL A;  2EPD A;  3GP8 A;  4GLM A;  1K0X A;  2L5Q A;  2BUD A;  4LUE A;  1K73 R;  2ZPH B;  2COW A;  4LXC A;  9ATC B;  2E5Q A;  3RKW A;  2D9T A;  3NHN A;  2EYZ A;  2LDM A;  1RAD B;  1OX9 A;  3MKD A;  1WGS A;  2QK0 A;  2Y4X A;  2YUN A;  2EYQ A;  4EMG A;  2AKL A;  4PL6 A;  5I22 A;  1JBM A;  3J80 E;  3TRE A;  3DLM A;  4C0D B;  1U8R A;  3H9N A;  2AZS A;  2LCS A;  8AT1 B;  2YLB A;  5KYX B;  3E2U A;  3ZEH A;  4OMM A;  3RBB B;  1IGQ A;  4HCB A;  2AKK A;  1K73 C;  4BD3 A;  4F7U B;  1ZHI A;  2B86 A;  2RI5 A;  1W2B S;  1NPP A;  5LJ5 f;  2YHT A;  3BFM A;  2M0O A;  3CCE Q;  5KYU B;  1MV0 B;  3HFO A;  1KC8 U;  1YJN A;  2DYB A;  1AT1 B;  3QWX X;  3CCS T;  2KXC A;  1GBR A;  2J05 A;  4LE9 A;  2QG9 B;  2YRV A;  1QCF A;  4BY6 C;  3OYH A;  2HQX A;  1AVZ C;  4PFZ A;  2VXE A;  2EAY A;  2W0Z A;  1VQ4 T;  2O31 A;  1YHQ Q;  3M9Q A;  4MZM A;  5HKC A;  3ULR B;  1IZ6 A;  2PUK B;  3P8H A;  2KBT A;  2GQV A;  3BDU A;  5CKD A;  4EDU A;  1H64 1;  2RHY A;  3MP8 A;  5FRM A;  2XDP A;  4MZT A;  4RCC A;  2F69 A;  4AG1 C;  4M77 D;  4PJO G;  4XAX B;  1OV3 A;  1YIT A;  2JTF A;  2RB6 A;  1NM7 A;  3I56 A;  4JLG A;  4JRQ A;  3EGD B;  3G4S T;  3CC2 Q;  3H41 A;  2KT1 A;  2X9H A;  1T0J A;  4M78 E;  3QWY A;  1ZUY A;  2VGN A;  2HKN A;  2JW4 A;  4C0F A;  1YI2 Q;  3M54 A;  4OF1 A;  4XTZ A;  2JXB A;  3UAT A;  1I1J A;  1X2Q A;  2A28 A;  1EX4 A;  3CXC P;  5IH2 A;  2OTL A;  1KQ2 A;  5LJ3 d;  2NUT A;  5GMK j;  5HCK A;  3OB9 A;  3NGP A;  2YXY A;  3EFO B;  3OW2 S;  1IXD A;  2IIM A;  1IHW A;  1WXU A;  2KNB B;  3BE3 A;  5L8R E;  3CCR Q;  2DXT A;  2JS2 A;  3NPF A;  3CD6 T;  1UDL A;  5GAM h;  5J26 A;  2LQW A;  4FSX A;  2LMJ A;  1C1A A;  2QA4 A;  2JMC A;  1VQP Q;  4QT7 A;  4M7D B;  2RJF A;  1BB9 A;  2DIQ A;  3JB9 J;  1OPK A;  1SRL A;  1MMG A;  4C0Z A;  3RKX A;  1VQN Q;  2AT1 B;  1FMW A;  5DLQ E;  2CP7 A;  1B34 A;  5GAO r;  3A5Z B;  1G5V A;  2BIV A;  2CZ6 B;  2KXD A;  2P0K A;  1SF9 A;  1VQM T;  3S6W A;  2EYW A;  5LJ5 h;  2MAM A;  3CXC A;  3REA B;  1Q81 U;  4OMQ A;  2ZPG B;  1TTH B;  3WVD B;  3UF4 A;  2YLC A;  2L89 A;  3OYA A;  2X3X D;  2O01 E;  1VQK T;  2JS0 A;  1P92 A;  1BU1 A;  4AG2 C;  5GAN j;  4ZTJ A;  1SKU B;  1UJY A;  3OA6 A;  5GAO l;  1VYT A;  3O5Z A;  1WHK A;  1T3S A;  3UPU A;  4M78 G;  2DTH A;  3CCJ Q;  2XDD A;  1M2O A;  3HRU A;  1QVF P;  3VUZ A;  3I55 T;  4J9E A;  4DBF A;  3CCS A;  4JJC A;  4RG2 A;  1K9M U;  1UE9 A;  3CBP A;  3I9Q A;  2HEQ A;  2HBW A;  4PJL A;  3LGF A;  4C92 B;  2DBM A;  4BE0 A;  4FYX B;  2EGC A;  1G3T A;  1KHI A;  1OPL A;  4E6R A;  1OU8 A;  3JV3 A;  1YJN Q;  1EIF A;  3I35 A;  1WJS A;  1X6B A;  1MMD A;  4B9X A;  4KH1 B;  4GBQ A;  4RTX A;  3MP1 A;  1HSQ A;  4Q5W A;  4M77 E;  3IQL A;  4IUQ A;  3EG3 A;  3CME A;  3G4S A;  2E6Z A;  3VS7 A;  4KRT A;  2V8J A;  2DEU A;  3E9G A;  5FU7 C;  2J06 A;  4M7A F;  3A8O B;  1JJ2 P;  5KYW B;  1XQH A;  1MMN A;  4YTL A;  4C8Q C;  1QVF A;  1WYX A;  4JRK A;  3JRZ A;  1S1N A;  1YIT Q;  2Y90 A;  1ZSZ B;  2EKH A;  1X43 A;  1XTD A;  3OS2 A;  4IUT A;  4JZ4 A;  5CQX A;  3A1P A;  2V26 A;  2D1X A;  4J7F A;  5EG2 A;  1U5S A;  3AHU A;  1O75 A;  4E7L A;  5FWB A;  4RTW A;  2PQW A;  5D7U A;  4R55 A;  1GXI E;  1ZA1 B;  1H92 A;  2QGF B;  4A4E A;  5I21 A;  1VQ8 T;  2PVD B;  2FL7 A;  1NEB A;  3QG1 A;  2J6F A;  3PIO A;  3ER0 A;  2J6O A;  4ANJ A;  1N8R U;  3L2W A;  1JJ2 A;  3RDV A;  1YP5 A;  4NS5 A;  1TXQ A;  4FIB A;  1OOT A;  1YI2 T;  1VQ6 Q;  4OML A;  2QA4 Q;  1WHG A;  2QEX A;  4BDY A;  4BI4 A;  3CC4 Q;  1KQ1 A;  1I4K 1;  3C12 A;  1VQM A;  4JPB W;  1RI9 A;  2RQT A;  2RA2 A;  2LNH B;  3CEY A;  3VS2 A;  4PJM A;  1HK9 A;  5KH6 A;  4JDS A;  3LW5 E;  4N4H A;  1D1A A;  3E19 A;  1VQK A;  1DJ7 B;  2CP3 A;  3CCR T;  4M77 G;  2RHZ A;  2R5A A;  1EFN A;  4XTV A;  2NUZ A;  2BZY A;  4M78 B;  4GLK A;  4N4G A;  5FRN A;  4D8D A;  3UA6 A;  3OS0 A;  3CCU A;  3CXC S;  4XQ3 A;  1K8A R;  4M75 A;  2RPN A;  4IIM A;  2FZC B;  4AFU C;  3FLG A;  1E7O A;  2KGT A;  3CCQ T;  4XU3 A;  4OMN A;  1OX8 A;  4PJO C;  1WX6 A;  3CCM Q;  3RKY A;  3MO8 A;  1Q7Y U;  4E7Z A;  1LVK A;  4HVV A;  1I8F A;  3L2R A;  1JQQ A;  5GAM e;  1R77 A;  2D0Q B;  5DY9 A;  4QVC A;  3H0I A;  4MDW A;  3JCM b;  2QQR A;  2EQU A;  3A8H B;  3G71 Q;  2RJC A;  2ED1 A;  1QWF A;  1OEB A;  3M0Q A;  2DD5 A;  1K73 U;  4A4F A;  1QCO A;  3S3M A;  4LDY A;  3VS0 A;  1K8A C;  3G6E Q;  2DVJ A;  2G3R A;  5KE3 A;  2DIG A;  1N27 A;  2Z0W A;  3LLR A;  2DAQ A;  2V1Q A;  5CK9 A;  1ARK A;  4C8Q E;  2VVK A;  1BCM A;  4DBR A;  1M8M A;  2A3L A;  5LJ5 e;  3OS5 A;  2FZG B;  4Z02 A;  2SRC A;  4O5V A;  4JS5 A;  1CSK A;  2QTV A;  4OMP A;  1LCK A;  3OS1 A;  1O9S A;  3CCL Q;  1OUL A;  5GJW B;  4E2F B;  5DM7 R;  2L3Q A;  1VQO A;  2RQR A;  1CKB A;  4RTY A;  2XI9 A;  3CME Q;  4DOV A;  1H3Z A;  3OYF A;  5GAO p;  1VOM A;  2CT4 A;  1OZ3 A;  3E1S A;  1SPK A;  2H3J A;  1VYU A;  1G2B A;  1BCO A;  1V29 B;  2M0Y A;  3RUX A;  3VS6 A;  1V1C A;  4X9C A;  2O88 A;  2LNV A;  3KFV A;  5I2S A;  1QVF S;  1BBZ A;  1VIE A;  4RMO A;  4C0G A;  1VQ8 A;  3OMC A;  2F1L A;  3PFS A;  1YJ9 A;  1VQL Q;  2HD0 A;  1TS9 A;  3H8Z A;  4E7H A;  1K0S A;  2LTO A;  2VKN A;  1RAI B;  1BI1 A;  2O4X A;  2KDS A;  1VQ5 T;  1FMV A;  2QGG A;  1TUD A;  2WAC A;  2OJ2 A;  2PTK A;  2EW3 A;  4M78 C;  2GBQ A;  1WHM A;  2JVV A;  3A8M B;  2YRC A;  1I07 A;  2DJQ A;  1KG1 A;  2KMT A;  4M77 B;  1JJ2 S;  3URG A;  2LCC A;  2YUO A;  4R56 A;  1U1S A;  2QEX Q;  1Y71 A;  3L2U A;  2JMA A;  4C8Q G;  5A2Q E;  4JRP A;  3KUF A;  2VV5 A;  3S3O A;  3ZBD A;  2HBP A;  5I2M A;  1QKX A;  2M16 A;  2O9V A;  4F7U A;  2YWW A;  3VS1 A;  3L2V A;  4PJO E;  3FRN A;  2XIC A;  4J9C A;  3M57 A;  4WTO B;  3TU4 K;  3PT9 A;  2COZ A;  3QZ5 B;  3CCQ A;  1UG1 A;  2P4T A;  3T9N A;  1UTI A;  4N0A A;  1OU9 A;  4XTU A;  3CCU Q;  4OB1 B;  2XKO C;  5GAM f;  2EQK A;  3CMA T;  3VU3 C;  4ELY C;  4RKU E;  2DIL A;  1X27 A;  3OMG A;  1A0N B;  4P5N A;  5M9O A;  1NBE B;  1PSE A;  5GAO n;  2YUP A;  3GPL A;  5GMK i;  5FLX E;  4QW2 A;  5LJ5 g;  4FYY B;  2E41 A;  5IAY A;  1Y96 B;  4CC7 A;  3ZL7 C;  4M75 D;  1YIJ T;  2CT3 A;  5IHI A;  4DQ2 A;  1X6O A;  5GMK h;  1M1K R;  4X1V A;  1VQ9 T;  3EGD A;  2GGR A;  1QLY A;  2VC8 A;  2DTO A;  3VRY A;  3MEV A;  2BZ8 A;  4BE1 A;  3ZFJ A;  4KGV B;  4LDU A;  1BK2 A;  3PTA A;  1FMK A;  3MEU A;  1N6A A;  4RG8 A;  5KYY B;  2DO3 A;  1S72 Q;  1NEG A;  2BE7 D;  1UJ0 A;  2DM1 A;  2KRS A;  2VB6 A;  2PU9 B;  1F1B B;  1SSH A;  2FPE A;  2HZY A;  2J6K A;  2K4Y A;  3TCJ A;  1UFF A;  1M1K C;  1SG5 A;  3CQT A;  4XU1 A;  1EZZ B;  3NTI A;  2E5K A;  1JO8 A;  3X26 B;  1VQO Q;  4CC2 A;  1AWW A;  1BYM A;  3FDR A;  5GAN 7;  5AT1 B;  1AHJ B;  3M0P A;  1H8K A;  4XU2 A;  2EIF A;  3EHR A;  2DL7 A;  2D8H A;  1PG5 B;  1WHJ A;  2LT4 A;  3G7Z A;  5I11 A;  4M7D A;  2LRQ A;  2E64 A;  4QQD A;  4EMK C;  3NMZ C;  3M4Y A;  2RI3 A;  2AIR B;  4OMO A;  4KH0 B;  2R57 A;  3OYL A;  5A0G A;  3JB9 H;  3SEM A;  4M77 C;  2HSE B;  1AZG B;  2ECZ A;  1VQ5 A;  5GAN h;  2VYT A;  2OTJ T;  5GAO q;  1PNJ A;  2LZ6 B;  3O8V A;  3Q1J A;  2COY A;  3MCA B;  1PWT A;  2D0N A;  4C5I A;  1BIB A;  2G6F X;  4E47 A;  2L0A A;  1YJ9 Q;  5D6Y A;  3EGX B;  4PLI A;  2KAF A;  1X75 C;  3I5S A;  3H0H A;  5FU7 B;  4TVR A;  3INZ A;  2BKD N;  4M75 F;  4C8Q B;  3SB2 A;  2JNG A;  2EBP A;  1U06 A;  1HYO A;  2PVO B;  1PSF A;  2I2L A;  3V7R A;  4PLL A;  2E70 A;  3PNW C;  1YJW Q;  2MIO A;  5LL6 S;  1X6G A;  1K9A A;  2C06 A;  2RN8 A;  4BI3 A;  1KD1 U;  2K5L A;  3FJ5 A;  1UGQ B;  1KJW A;  2L3S A;  2LQK A;  4J7I A;  1UGV A;  2QQA A;  5CIU A;  3JCM P;  5HK3 A;  1VQ7 T;  2DX1 A;  1ZUK A;  2DL5 A;  3JCM f;  4OGE A;  1Q82 U;  3NFC A;  3SWN C;  3KXT A;  1M2V A;  2M1H A;  2K3B A;  3U23 A;  1Y7X A;  5GMK l;  4XTY A;  1PKT A;  2CP5 A;  3CCV Q;  2E3H A;  3JB9 F;  3QDF A;  4OB2 B;  1E6H A;  2RK1 A;  2EQJ A;  5LJ3 j;  2HL3 A;  4M7A D;  1ZBJ A;  1JB0 E;  3CMA A;  4X34 A;  3A98 A;  4C92 A;  2HQH A;  3NTK A;  1PRL C;  2DXC A;  2ROT A;  2F5K A;  5CKB A;  3VYH B;  5CAI A;  4M7A C;  2QAZ A;  2RI2 A;  3RER A;  1WA7 A;  4DBQ A;  1UGR B;  1YIJ A;  4VUB A;  4BB7 A;  4Y91 A;  2E1H A;  2M51 A;  1VQ9 A;  3L1A A;  2EJF A;  2CZ1 B;  5FWC A;  2CYZ B;  5GAM d;  2FYK A;  4J8O A;  2VGM A;  1OYX A;  3VS4 A;  3FB9 A;  3CC7 T;  5KYW A;  2DRK A;  4OVA A;  2OAU A;  1JU5 C;  2KSS A;  4JJD A;  1D0X A;  4NOY A;  1KC8 R;  2XU8 A;  5HY6 A;  1VA7 A;  3RNJ A;  1PC0 A;  2WSF E;  1ZSZ A;  3QJY A;  3GOX A;  2M9U A;  1U1T A;  1K8A U;  3BDL A;  1JXM A;  1VQ4 A;  2RO0 A;  3JCM W;  2E12 A;  2IG0 A;  3LH0 A;  3R6N A;  5D6W A;  1SSF A;  4A4G A;  2A37 A;  1I0C A;  1B34 B;  5LJ5 d;  1B7T A;  1YNZ A;  4PJO B;  2LCL A;  1G8X A;  1NYG A;  3LWH A;  3EFR A;  2OAW A;  1M5Q 1;  3RIR A;  1I5L A;  2HDA A;  1KC8 C;  2BTT A;  3OYM A;  4DOW A;  2DE0 X;  1NG2 A;  2IVW A;  1RI0 A;  2CP0 A;  2KR3 A;  1HJD A;  2LJ1 A;  1X2K A;  2LQ8 A;  4RTZ A;  4UC4 A;  4FCY A;  3CCE T;  2OTJ A;  3PVL A;  2QDY B;  3PE0 A;  8ATC B;  1M3C A;  4C5H A;  3OYD A;  3HP9 A;  1R8O B;  3I56 Q;  2CSI A;  3JCM h;  2FPF A;  3PIP A;  2CRE A;  4PNO A;  4F7U F;  2ZCF B;  2ABL A;  1GCQ A;  2H8H A;  2F5T X;  5GMK e;  5GJV B;  3TQ7 P;  4Y28 E;  4A4H A;  4B6M A;  4R0K A;  2EWN A;  1YHQ T;  3OY9 A;  2Y4Y A;  1TUG B;  1TSF A;  3FJP A;  2OX7 A;  4HXJ A;  3CPF A;  3CD6 A;  1X69 A;  2DL4 A;  2V1R A;  1BIA A;  4M78 A;  1AOJ A;  2D6F A;  1WNL A;  4IUP A;  1QCN A;  2OTL Q;  4MML A;  2JM8 A;  2GNC A;  2EQI A;  3GLX A;  4J9F A;  4PFO A;  1UB4 A;  4ZNX A;  2NYS A;  3CC2 T;  2K7A A;  1TU0 B;  2F2W A;  2KI7 A;  1SHF A;  4X9D A;  2GFA A;  2ZPB B;  1BI2 A;  1OI1 A;  1W1F A;  1FXX A;  4M7A E;  1K4U S;  2L3R A;  5GAN 8;  1M1G A;  2QQ9 A;  5CKH A;  3RMS A;  1Z9Q A;  3C4S A;  2P0Q A;  2WSE E;  2A36 A;  4L6V 5;  5GAN e;  4QVD A;  4BDZ A;  4ATO A;  1VQP T;  5L23 A;  2RNA A;  2JOY A;  3OYG A;  4Y92 A;  2RM4 A;  4OP0 A;  3CC7 A;  1Z9Z A;  2BE9 B;  4FYV B;  4C92 D;  3EH2 A;  1VQN T;  3MEW A;  3A8L B;  3I55 A;  1PHT A;  2DLP A;  4J9D A;  1IB8 A;  2K3Y A;  4ZGE B;  3QKJ A;  4A4K A;  4OMF B;  3ASK A;  4ORZ A;  1XJW B;  4IUV A;  1CKA A;  1RAH B;  1YN8 A;  3JCM c;  3FEO A;  4J9B A;  4M7D F;  4HCZ A;  4AFZ C;  1UEB A;  3BY7 A;  1D1B A;  1PKS A;  3J81 E;  1UEC A;  2E65 A;  2BZX A;  2FZK B;  3CCS Q;  3VRZ A;  4PJJ A;  3QZ9 B;  1RAB B;  2JTE A;  2GTO A;  4FU6 A;  2XG8 D;  2FO0 A;  3DB4 A;  3RMQ A;  1D1C A;  4BI8 B;  2XMF A;  1K9M C;  1JEG A;  1VQ4 Q;  1T0H A;  1RUW A;  5GMK m;  3CCE A;  3CCJ T;  2NUP B;  4ZGD B;  2K9G A;  4M7A G;  2AZV A;  4Z89 A;  2X35 A;  4ESR A;  2X51 A;  1WDX A;  1WXT A;  4DBH A;  4L5G A;  3G4S Q;  4RTV A;  1C0M A;  4LD9 K;  1HXD A;  3X25 B;  1NJI R;  4F7U G;  3AT1 B;  2X4Y A;  2HCK A;  1N9S A;  1YJN T;  3EH1 A;  2ENM A;  3EFS A;  3THK A;  1QP3 A;  3HRS A;  3QUI A;  4JZ3 A;  5GAO m;  2MI6 A;  4IKF A;  2CUD A;  2YT6 A;  1GFC A;  4C92 F;  2KRN A;  3QYG B;  2JN0 A;  2DMO A;  4OB0 B;  2CDT A;  2CKK A;  4M4Z A;  2V8K A;  3S3N A;  3CC2 A;  4CC4 B;  2RD1 A;  4FSS A;  4FW2 A;  3EG9 B;  4E7J A;  3CD6 Q;  1NJI C;  1YI2 A;  5LJ3 f;  1UHF A;  2ESW A;  3C0C A;  3X28 B;  3HKS A;  2FG0 A;  1YIT T;  1Y0M A;  2DL8 A;  4EMK B;  2B8A A;  2E6N A;  2RJE A;  2FRY A;  4LNP A;  2LJ0 A;  3QYH B;  1M9S A;  1MMA A;  2KY9 A;  1WFW A;  4LUD A;  4RTU A;  4ZTF A;  3BW1 A;  2DTI A;  4IUR A;  2X3W D;  3EG1 A;  5ECA A;  3EHQ A;  5KYX A;  3CCR A;  2MWP A;  2X4W A;  3VYG A;  1Y96 A;  2CSQ A;  1VQM Q;  2ED0 A;  3SFM A;  5GAN f;  3V8K A;  2EKO A;  1VQP A;  3TSW A;  2OTL T;  1VIF A;  4NL3 A;  1I5O B;  2ZPE B;  3VJP A;  2ATC B;  4FT2 A;  3JCM e;  5GAM g;  1VQK Q;  1N5Z A;  4OGC A;  2K3X A;  4PK4 A;  1VQN A;  5KYU A;  2RMO A;  1M3B A;  3PMI A;  2K79 A;  2EQM A;  1WI7 A;  5KYY A;  2A7Y A;  3FIF A;  4QVZ A;  2QA4 T;  1Q7Y R;  1VQ6 T;  3REB B;  3CC4 T;  3HSB A;  2YUQ A;  4JUV A;  2HNI A;  1Q86 R;  4KUL A;  4J6Y A;  1C6V X;  1IGU A;  2CS7 A;  1WPY A;  2K2M A;  2KRO A;  3RR6 A;  3PMT A;  3OBW A;  1KIK A;  1ABO A;  1RAE B;  3SWN B;  2GCX A;  3QBY A;  2HSP A;  2EYX A;  1KSW A;  3H6Z A;  1VYV A;  1VUB A;  5IHK A;  3M59 A;  2R5M A;  2QTX A;  3V8J A;  3X20 B;  4JS4 A;  3I55 Q;  5FW9 A;  1LJO A;  1Y07 A;  4KUD K;  2FHD A;  2MCN A;  5GAN 3;  2DNU A;  2MMP A;  1XOV A;  3LH5 A;  3M55 A;  1MUZ A;  3JSC A;  3OBY A;  3UA7 A;  2MOX A;  3QPH A;  4XTW A;  4ELZ C;  1NLO C;  3VUB A;  3P8D A;  4BUG A;  2RQV A;  2CUB A;  1Q7Y C;  4ZN1 A;  2P4R A;  4WF2 A;  1D3B B;  2JT4 A;  2RHU A;  1D0Z A;  1Q86 C;  2FPD A;  1YWP A;  2DVE A;  4KGZ B;  4M7A B;  2CGH A;  2JTM A;  2GQI A;  3CCJ A;  4M75 C;  2A08 A;  1GFD A;  3EGU A;  4J6X A;  2GTJ A;  1RLQ C;  2QYZ A;  2K2V A;  4M78 F;  3CCM T;  2EJG A;  5KCH A;  3EGX A;  1WHH A;  3JB9 D;  2P0P A;  2C0T A;  4WCI A;  2DXB A;  4B9W A;  2P84 A;  1KFZ A;  2KYM A;  4C8Q A;  3EFO A;  3G71 T;  3VV0 A;  2DXU A;  5LJ3 h;  5A0L A;  3MPU B;  3G6E T;  3H0F A;  4JJN K;  2DFU A;  4J83 A;  1I81 A;  2DKG A;  3VKI A;  2V8I A;  4C92 G;  4E7I A;  1M90 R;  2QDL A;  1K76 A;  4RTT A;  4F14 A;  1XNI A;  4IIO A;  2M02 A;  4C5E A;  2PVG B;  3UDC A;  2GF7 A;  2RH2 A;  3SDZ A;  3CCL T;  3EG2 A;  3OYB A;  3RES A;  2X4J A;  4FL6 A;  5GAN 5;  4LN2 A;  1VQ8 Q;  4J9I A;  3CME T;  4A63 B;  1G3S A;  1WZO A;  4NL2 A;  5CKF A;  4DEY A;  1B3Q A;  2DBK A;  3M56 A;  1WIE A;  1D09 B;  4PJN A;  1M90 C;  4JLI A;  5IXB A;  3JCM g;  2HL5 C;  1LOJ A;  3LX7 A;  1QQJ A;  4HVW A;  1Q95 G;  5EC7 A;  3M0R A;  3PVQ A;  4HKE A;  1IHV A;  1OQK A;  2MF2 A;  3HFN A;  3I5R A;  2DYI A;  3ME9 A;  1W6X A;  1TUC A;  2NLU A;  3QDR B;  2HMA A;  1VQL T;  3R6O A;  1ZLM A;  3FC3 A;  2DA9 A;  3OYN A;  4PFP A;  2DPP B;  4D8K A;  1W70 A;  3DB3 A;  1K1Z A;  1VQ6 A;  4GY5 A;  4J6W A;  5CR2 A;  3CC4 A;  2LX9 A;  3MEA A;  4EMH A;  3TSZ A;  2CZ7 B;  5CKE A;  1NZ9 A;  5HK0 A;  1AZE A;  1QWE A;  5GAN d;  3OYK A;  1AWO A;  4CI0 C;  1R0B G;  5KE2 A;  5J39 A;  3DLL A;  4MMK A;  3MHX A;  3QJ6 A;  2HKQ B;  4RCB A;  1WLP B;  4C0D C;  3CCQ Q;  2C0I A;  1ZA2 B;  2EVR A;  4LDX A;  4PJO A;  1BKB A;  2QEX T;  2L3P A;  4O6J A;  1UGP B;  5IN1 A;  2MYS A;  2XHC A;  1UUE A;  3CPW P;  1AD5 A;  1M4Z A;  2E4H A;  4M75 E;  2KK4 A;  1ZBX A;  3L2Z A;  2NUT B;  4XTX A;  5GAN 4;  3M58 A;  1ZQ1 A;  2QQS A;  3L42 A;  7AT1 B;  1YFN A;  2DEQ A;  3CBO A;  4M77 F;  1FWZ A;  2XD0 A;  5DLO A;  1MV3 A;  3SD4 A;  1KQS P;  2VWF A;  1YWO A;  2IPO B;  2RQW A;  3QXE B;  4ZGJ B;  1U3O A;  4HT9 A;  4KBM B;  3CCM A;  4AMC A;  4N0A C;  2K6D A;  3G1J A;  1QVG P;  5IXF A;  2XK0 A;  3CCU T;  2D8J A;  3M0T A;  5GAN 2;  2RJD A;  2X4X A;  1M2V B;  3G71 A;  2EGA A;  1MND A;  2L8D A;  1RAG B;  4QQG A;  2ZPI B;  3V7S A;  2LJ3 A;  1AWX A;  4LD6 A;  1NE8 A;  4MZP A;  3GBQ A;  3G6E A;  2DD4 A;  4F17 A;  3VS5 A;  1M3A A;  4AT1 B;  3CPW A;  5GAM j;  3CBM A;  2C0O A;  2SEM A;  1ABQ A;  4CRI A;  1SHG A;  1NPR A;  2DL3 A;  3EAE A;  2EYY A;  1TOV A;  3QSU A;  3OYE A;  2QI2 A;  1KQS A;  3CCL A;  1M30 A;  4C8Q D;  3M0S A;  1RL2 A;  4HVU A;  1S72 T;  1QVG A;  3M5A A; 
#chains in the Genus database with same CATH homology
 3NGP A;  2DF6 A;  2JTE A;  2GTO A;  2IIM A;  3VS3 A;  1UG1 A;  1UTI A;  1WXU A;  2KNB B;  2FO0 A;  4Z8A A;  2JS2 A;  3NPF A;  1JEG A;  2XMF A;  2YDL A;  3SHW A;  1UDL A;  1T0H A;  2LQW A;  1RUW A;  2LMJ A;  2DIL A;  1X27 A;  1G83 A;  2LQN A;  2JMC A;  1A0N B;  1M27 C;  4QT7 A;  1GL5 A;  2K9G A;  2YUP A;  1BB9 A;  2F2X A;  2AZV A;  1Y57 A;  4Z89 A;  4ESR A;  1WDX A;  1OPK A;  2KEA A;  1SRL A;  2RQU A;  2I0N A;  1WXT A;  4CC7 A;  1ZX6 A;  3ZL7 C;  4RTV A;  2CT3 A;  5IHI A;  4X1V A;  2KXD A;  2GGR A;  1QLY A;  3VRY A;  2EYW A;  2HCK A;  2BZ8 A;  3REA B;  4OMQ A;  2ENM A;  2J7I A;  4CC3 A;  3THK A;  1QKW A;  4JZ3 A;  1BK2 A;  3UF4 A;  2X3X D;  2CUD A;  2YT6 A;  1FMK A;  1GFC A;  1UHC A;  2KRN A;  2JS0 A;  2DMO A;  1NEG A;  1SRM A;  2CDT A;  1UJ0 A;  1BU1 A;  2DM1 A;  2KRS A;  2OI3 A;  4M4Z A;  4AG2 C;  1SSH A;  2FPE A;  4CC4 B;  1UJY A;  2J6K A;  3M0U A;  4FSS A;  1UFF A;  1VYT A;  3O5Z A;  1T3S A;  2FRW A;  3CQT A;  2ROL A;  1NYF A;  1WXB A;  1UHF A;  2ESW A;  3C0C A;  2E5K A;  1JO8 A;  2FG0 A;  1Y0M A;  4CC2 A;  1AWW A;  2DL8 A;  3M0P A;  1B07 A;  1H8K A;  2FRY A;  3EHR A;  4J9E A;  4LNP A;  2LJ0 A;  2DL7 A;  2D8H A;  4JJC A;  5I11 A;  1UE9 A;  2CH4 A;  2LX7 A;  3I9Q A;  1WFW A;  4LUD A;  4AFS C;  2HEQ A;  4RTU A;  3NMZ C;  1J3T A;  2HBW A;  2DBM A;  2X3W D;  3EG1 A;  5ECA A;  3EHQ A;  4OMO A;  2EGC A;  4Z88 A;  3SEM A;  2CSQ A;  1OPL A;  1AZG B;  2ECZ A;  2ED0 A;  4E6R A;  1PNJ A;  1T3L A;  3JV3 A;  3TVT A;  2LZ6 B;  1PWT A;  3I35 A;  2D0N A;  1X6B A;  3TSW A;  2G6F X;  4GBQ A;  4RTX A;  2L0A A;  1HSQ A;  2JM9 A;  1ZSG A;  1GBQ A;  2LP5 A;  1N5Z A;  3I5S A;  1AEY A;  3H0H A;  4DEX A;  3IQL A;  1TG0 A;  3EG3 A;  2CH4 W;  1YCS B;  2O2O A;  2RMO A;  1M3B A;  2PNI A;  2EBP A;  2K79 A;  1U06 A;  3VS7 A;  1WI7 A;  4KRT A;  2J06 A;  3REB B;  2YUQ A;  4EIK A;  1RLP C;  2MIO A;  1X6G A;  2KYB A;  1K9A A;  1WYX A;  2K2M A;  2KRO A;  2RN8 A;  1IO6 A;  1S1N A;  3FJ5 A;  1KIK A;  1KJW A;  1ABO A;  2L3S A;  2HSP A;  1JXO A;  2L2P A;  1UGV A;  2EYX A;  1KSW A;  2EKH A;  1VYV A;  1X43 A;  1ZUK A;  2DX1 A;  5IHK A;  2DL5 A;  4JZ4 A;  5FW9 A;  5IHN A;  4J9H A;  2MCN A;  2D1X A;  2K3B A;  2DNU A;  3U23 A;  1XOV A;  3LH5 A;  1PKT A;  1ZUU A;  1U5S A;  1MUZ A;  3UA7 A;  1E6H A;  2MOX A;  5FWB A;  4RTW A;  1NLO C;  1ZBJ A;  2RQV A;  2CUB A;  1H3H A;  2P4R A;  2JT4 A;  3A98 A;  4F16 A;  2FPD A;  1YWP A;  1H92 A;  1GRI A;  1PRL C;  2GQI A;  2A08 A;  1GFD A;  1NEB A;  2ROT A;  1FYN A;  2KRM A;  4JJB A;  3EGU A;  2J6F A;  2RF0 A;  2J6O A;  2GTJ A;  1RLQ C;  1WA7 A;  2KE9 A;  1YP5 A;  2AK5 A;  1OOT A;  2YSQ A;  2C0T A;  4OML A;  4WCI A;  2M51 A;  1KFZ A;  2KYM A;  2O9S A;  5FWC A;  4JPB W;  2NWM A;  4J9G A;  1RI9 A;  3VS4 A;  2RQT A;  2LNH B;  1NLP C;  3VS2 A;  2DRK A;  1JU5 C;  4JJD A;  1VA7 A;  3H0F A;  3RNJ A;  4K11 A;  1GCQ C;  1E6G A;  1EFN A;  2NUZ A;  2BZY A;  2QDL A;  1K76 A;  4RTT A;  4F14 A;  4IIO A;  4RUG A;  4D8D A;  3UA6 A;  1JXM A;  2DRM A;  3EG2 A;  3R6N A;  2F2V A;  1AWJ A;  2A37 A;  1PRM C;  1I0C A;  4LN2 A;  1YNZ A;  2W10 A;  4J9I A;  1NYG A;  2EGE A;  2RPN A;  4IIM A;  2OAW A;  1HD3 A;  4AFU C;  1E7O A;  4A63 B;  2KGT A;  4OMN A;  2HDA A;  3EG0 A;  2BTT A;  4DEY A;  1WX6 A;  1B3Q A;  2PZ1 A;  4HCK A;  4HVV A;  2DE0 X;  1NG2 A;  2DBK A;  1JQQ A;  1WIE A;  5IXB A;  2KR3 A;  2FEI A;  1HJD A;  2LJ1 A;  1X2K A;  3H0I A;  4RTZ A;  4HVW A;  1SEM A;  5EC7 A;  2KT8 A;  2ED1 A;  1QWF A;  3M0R A;  3PVQ A;  3PVL A;  1OEB A;  3PE0 A;  3M0Q A;  1GCP A;  4AFQ C;  1M3C A;  3I5R A;  3VS0 A;  1W6X A;  2DVJ A;  2CSI A;  1TUC A;  2EPD A;  2FPF A;  2CRE A;  4GLM A;  1K0X A;  2ABL A;  1GCQ A;  1ZLM A;  2H8H A;  4LUE A;  2V1Q A;  1ARK A;  2DA9 A;  2VVK A;  5GJV B;  4D8K A;  1W70 A;  4R0K A;  1M8M A;  2EYZ A;  3NHN A;  1K1Z A;  2SRC A;  4HXJ A;  1CSK A;  2YUN A;  3TSZ A;  4OMP A;  1LCK A;  1X69 A;  2AKL A;  5I22 A;  2DL4 A;  2V1R A;  1AZE A;  1QWE A;  1AWO A;  1AOJ A;  5GJW B;  2LCS A;  2AZS A;  2L3Q A;  2JM8 A;  2GNC A;  2EQI A;  2RQR A;  1CKB A;  4RTY A;  4OMM A;  3RBB B;  1WLP B;  2C0I A;  4J9F A;  2EVR A;  2CT4 A;  4ZNX A;  2K7A A;  2F2W A;  2AKK A;  2L3P A;  1SPK A;  1SHF A;  1VYU A;  1UUE A;  2B86 A;  1G2B A;  1AD5 A;  2M0Y A;  3VS6 A;  1V1C A;  2O88 A;  3KFV A;  1W1F A;  1BBZ A;  1MV0 B;  1K4U S;  2DYB A;  3QWX X;  1MV3 A;  2VWF A;  2KXC A;  1YWO A;  2RQW A;  1GBR A;  2J05 A;  4LE9 A;  1U3O A;  1QCF A;  1AVZ C;  1Z9Q A;  1K0S A;  2VKN A;  2K6D A;  2W0Z A;  5IXF A;  2A36 A;  2O31 A;  3ULR B;  2D8J A;  3M0T A;  2KBT A;  1TUD A;  2EGA A;  5L23 A;  2RNA A;  2OJ2 A;  2PTK A;  2EW3 A;  4Y92 A;  4AG1 C;  2GBQ A;  2LJ3 A;  1OV3 A;  1AWX A;  1Z9Z A;  3GBQ A;  1I07 A;  1NM7 A;  2DJQ A;  4F17 A;  3VS5 A;  1M3A A;  2C0O A;  1PHT A;  2DLP A;  2SEM A;  1ABQ A;  4J9D A;  3H41 A;  2YUO A;  2KT1 A;  1SHG A;  4ORZ A;  2JMA A;  1T0J A;  1CKA A;  1YN8 A;  2DL3 A;  4J9B A;  3QWY A;  1ZUY A;  2JW4 A;  2EYY A;  4AFZ C;  2JXB A;  1PKS A;  1QKX A;  3UAT A;  1I1J A;  2O9V A;  1UEC A;  1X2Q A;  3VS1 A;  1M30 A;  2BZX A;  2A28 A;  5IH2 A;  3M0S A;  4J9C A;  4HVU A;  5HCK A;  3VRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...