4P5NA

Structure of cnag_02591 from cryptococcus neoformans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
74
structure length
74
Chain Sequence
MSVQDKQGQNINVGDTVYTPYRGGKHEGQVADIVTTKEEAAEKGVKNPPKVLFTDQNNKDVAHNPGTLTDLDKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics
molecule keywords Hypothetical protein CNAG_02591
publication title A Small Protein Associated with Fungal Energy Metabolism Affects the Virulence of Cryptococcus neoformans in Mammals.
pubmed doi rcsb
source organism Cryptococcus neoformans
total genus 19
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11160 Hva1_TUDOR Hypervirulence associated proteins TUDOR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1060 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4p5nA00
4P5NA
chains in the Genus database with same CATH superfamily
5DM7R 4J83A 1NEBA 1VIFA 4HVVA 4M77B 2QGGA 1KD1U 4RKUE 1VQ8T 1G3WA 1WHGA 2RN8A 2JN0A 5D6WA 2GF7A 3LX7A 4C92C 2FO0A 2LJ1A 3VJPA 4JUVA 2O31A 2E10A 2DFUA 3V7SA 1UJ0A 5A0DA 1QMCA 4MZPA 4YTLA 1VQKT 1I5OB 2OJ2A 2K6DA 2LVMA 4QVCA 3M9QA 2K2VA 4D6WA 2VKNA 2P0KA 3QJYA 4IUPA 2D8JA 1EFNA 4JDSA 2DILA 1RUWA 3FIFA 3C4SA 3SFMA 1MV3A 4MDXA 1LJOA 3PGGA 4XTUA 1UUEA 4RUGA 2DIQA 3CD6Q 1YWOA 1PRMC 4DQ2A 4J9BA 4M7AE 1KK7A 1RACB 4ATOA 1NYGA 2Y90A 3OSSC 1UGRB 1BCMA 3OS1A 2VB6A 1QVFP 1VQOQ 4RTTA 4PJOE 4N0AC 2FRWA 4VUBA 4X34A 1YJNA 1YP5A 2RA2A 3C95A 2AKKA 3MP6A 1PC0A 1ZA1B 1AWXA 4OMNA 5KYXA 3UPUA 2LCLA 2DRKA 2M51A 1KFZA 2K5LA 1SEMA 3V8LA 1BI0A 4KRTA 4XQ3A 1GCPA 3HHTB 5A2QE 4X9DA 4CC2A 1NE8A 2CDTA 4M75G 2COWA 2FZGB 2VXEA 2QG9B 1TUGB 1O9SA 1SG5A 2C06A 1QWFA 1WQWA 4AFQC 1T3SA 1WJSA 5KCOA 3OYAA 4M7AB 4C92F 2VGMA 2YRVA 2BE9B 2CP7A 2PZ1A 2HZYA 3EGXA 2BZ8A 1U06A 1VQPQ 2WACA 3EAEA 3EG3A 2GNCA 4PJOB 1D1CA 5AYFA 2KQWA 2RM4A 3QJ6A 1YN8A 3JCMQ 1RAAB 3CD6T 1UDLA 2QI2A 2BZYA 4QQDA 1QVPA 4OF1A 3BW1A 2CYZB 4D8DA 5GANj 4EDUA 2K5IA 3CCLA 1MMAA 2MWOA 3GOXA 3JCMX 4A4GA 3ER0A 1VQOT 1KIKA 4J9CA 3JCMd 4BDYA 4IURA 3G7ZA 4LDYA 4M7DG 4LDUA 3RMQA 1QVGA 1OEBA 2IVWA 2PUOB 4MDWA 1J3TA 1KQ1A 2K57A 1K9MU 3MCAB 2ZCFB 4A4FA 2KDSA 3M53A 4FYXB 4M75A 5GAN5 2EYZA 4J7IA 2IG0A 1M3AA 1E6HA 5CR2A 2ED1A 1LNXA 2KI7A 2O4XB 2YRCA 2A36A 2KT1A 2VWFA 1PD1A 4LXCA 3HSBA 2ZAEA 5KCHA 1TOVA 4O5VA 2GTOA 2KAFA 1C1AA 1M2VB 1QKWA 3CBMA 4HCZA 1MNDA 2HEQA 3V8JA 3H0HA 1U1TA 2DJQA 2JM9A 2YXYA 1K73R 3HP9A 1ZUKA 3HRTA 4E7JA 1RAGB 1WPYA 4KUDK 1G3YA 3ULRB 5GAOp 4NL3A 4J8OA 2RQVA 4M78E 1TUDA 3QYHB 3CCRA 4OMFB 3CPWA 4M7DA 4ZTJA 1UGPB 4Y91A 5D6XA 1VQMQ 2V26A 3BDLA 3JB9H 4BI3A 2KSSA 2B8AA 2RH2A 2JMCA 1AOJA 3E2UA 4HCCA 3CCMA 2LT1A 2L89A 5KE2A 1XJWB 1K8AR 2OTLA 5CKFA 3V7CA 1I07A 2R57A 4AFZC 4XK8E 3OSVA 2PVOB 2YSQA 7AT1B 3J7AF 1D0XA 1UJYA 3EG1A 3HRUA 1BYMA 2A7YA 1BCOA 1XTDA 1GFCA 3SWNC 2JVVA 1I0CA 2Y4YA 5GANh 3QBYA 4N4IA 1VA7A 2RQWA 2YUNA 4KUIA 3QG1A 1KQSA 2KK4A 4PJNA 2DL8A 4FCYA 1VQ4A 1JB0E 1G83A 2DRMA 1G5VA 4J6XA 4OMLA 4E7HA 4FYYB 2D0NA 3OYEA 3JCMP 3OBYA 2O9SA 2DJZA 2CP6A 1W2BS 2XDBA 2RK1A 3CCSQ 2WSFE 5A0LA 1ABOA 2VUBA 4C8QG 1SRLA 4B9XA 1WQ7A 3UWNA 3A8OB 1D1BA 3PVLA 3NTKA 4X1VA 4AMCA 3GP8A 2HL3A 1JQQA 1V1CA 2NUPB 5FU6B 4ZNXA 4JPBW 5HKCA 3A8HB 1NEGA 3CCQA 5D7UA 1ZSZA 1VQMT 3CC4A 3D7SB 3CCUA 5HK0A 1M90U 1N5ZA 2CSQA 1PWTA 2QXFA 1HJDA 1YJ9A 1G3SA 1M8VA 1WDXA 4M7DF 1NJIU 2EQUA 5GMKj 3ASKA 5GANf 2E65A 1I4K1 4B6MA 5CAIA 2AK5A 1M2OA 2XK0A 2D0QB 2PNIA 1VYVA 2K7AA 1RAFB 4KULA 4A63B 2KXCA 2DETA 4M78G 1KJWA 1K76A 3OYGA 1QVFS 4Y28E 4OMPA 1H8KA 4PFPA 3OY9A 1JJ2A 3LW5E 3LH0A 2VXFA 1U1SA 1X6BA 2RNAA 2HD0A 1D0ZA 4NOYA 1XQHA 3A8GB 1VQ7Q 3G71A 2LJ3A 2L2PA 3VS0A 4C8QA 3MEUA 2PQWA 4QW2A 3CCST 3OS5A 3I9QA 5GMKm 3CC7A 1BKBA 1TSFA 3C94A 1VQ9Q 1QKXA 3OW2A 1YI2Q 5CKBA 2A37A 2FYKA 3H9NA 1HYOA 3LWIA 1VUBA 3QHSA 2EPDA 4C92E 3QZ9B 1ZUUA 3CCVA 1JEGA 1K9MC 2DYBA 1OPLA 2F2XA 3QUIA 1YIJQ 3H0FA 1QW1A 4HT8A 4R56A 4J6YA 1D3BB 4EPCA 2JTFA 1UTIA 2GQVA 5GAOm 1W70A 1JXMA 2V1RA 4XTWA 4AG2C 4LDXA 3QDRB 2FVUA 3SHWA 4E7LA 4R0KA 4RG8A 2L8DA 3LH5A 1O75A 1X75C 4KGZB 3PE0A 3ME9A 2RHZA 4L59A 5CQYA 4BY6C 4C92B 4JRPA 4C5HA 4PFZA 1X01A 4PJLA 1RAEB 2X4YA 1M3CA 1ARKA 1UHCA 3DLMA 2DBMA 2SRCA 5GANe 4QVZA 3HPWA 4FU6A 2DD5A 4C5IA 4Z8AA 3I55A 3L2RA 2DM1A 1YJWQ 2KRMA 1VQ9T 1I5LA 2FL7A 1WIEA 2HMAA 5GMKh 2CZ1B 1YI2T 4BI8B 1Q7YC 1X6OA 1MMDA 2FPFA 4E7SA 1AEYA 4C8QF 1UEBA 2P0PA 4WCIA 1R77A 2FHDA 2HBWA 4DEYA 1YBYA 2CH4A 5A0GA 3UDCA 1M3BA 1NYFA 1YIJT 3M55A 2MYSA 3UATA 1BBZA 4GLMA 3PFSA 2FPDA 3HRSA 1HK9A 1NPRA 3M0UA 2DZ9A 4EIKA 1KC8U 2EGCA 3OYFA 2DERA 1OYXA 2E12A 1WHKA 2F5KA 4JRQA 1IGQA 1OI1A 3QO3A 2ZPBB 4GBQA 5KYXB 1BB9A 2I2LA 3VS5A 5KYUA 5KYYB 5IXFA 2LC4A 5LJ5d 1H3ZA 2NLUA 3AT1B 3M56A 1YNZA 2KGTA 1GBQA 1CSKA 1PSEA 2NWMA 2XI9A 2PVDB 3CMEQ 1YJWT 1UECA 5GAN2 2K79A 2MOXA 2J7IA 4DBFA 3TU4K 2LJ0A 2XMFA 4RTXA 2P0QA 2MI6A 3EG0A 3EGXB 1IZ6A 3CMAA 2LTOA 2KYBA 2E5QA 2DA9A 1BK2A 1CKAA 4F7UA 3OMGA 4M4ZA 1M1KC 3L2QA 2GCXA 2EKHA 3BE3A 1SHFA 1SPKA 1W2BP 2AZSA 1Q86U 2DLPA 1X6GA 1NLOC 4ANJA 3QIIA 3P8BB 4L5GA 1HXDA 3CCJA 5FRNA 2JS0A 4C92D 4ZGDB 1YITA 3PMIA 2LNVA 4XU0A 2DL5A 2KY9A 2QEXQ 1JXOA 5GAN6 5LJ3d 2ZZDA 3L2UA 1SKUB 2L5QA 2LRQA 4HCKA 1UHFA 3TCJA 2FRYA 1B7TA 2RQRA 3JCMJ 2M9UA 5CKHA 1WYXA 4EMGA 3JCMW 1ACMB 3OYNA 1VQNQ 1MV0B 4PKCC 2KT8A 1YHQA 3PIPA 2E6NA 3G4SQ 4OMMA 1XNIA 5DY9A 5EG2A 2JMAA 3GNFB 5GAMj 4BI4A 2RI2A 2QAZA 1UG1A 3EGDB 4DOWA 1BI1A 3CCLQ 3CMET 1VQLQ 4FSSA 4F16A 4BE1A 2PUKB 1XOVA 4E47A 1DJ7B 4QVDA 2DEQA 3G6EA 3CXCA 4RCBA 1KQ2A 3VS1A 3L2VA 3JB9F 2JS2A 2KMTA 4A54A 1YFNA 3PTAA 8ATCB 2HSEB 2AZVA 4XU1A 4PNOA 5GMKe 5GJWB 3KBGA 2E3HA 4M77G 4FYWB 2CKKA 3ZFJA 4J9EA 3EH1A 4DBRA 1IGUA 4PJJA 2FB7A 2RD1A 4KGXB 3M0TA 3M59A 5I21A 2QQBA 4F7UF 2KBTA 4OMQA 1RAHB 1TS9A 1JO8A 1QP2A 3CCEQ 2AHJB 3OYJA 2D8HA 2QEXT 1WJQA 1K9MR 1ZBJA 2ROLA 4RMOA 1KG1A 3OYIA 2MIOA 2QDYB 2X3WD 3NTHA 2DXCA 5FLXE 2ESWA 2ZPEB 4BDZA 1H3HA 4DOVA 3NTIA 1VQNT 3JV3A 4PJMA 1D09B 3LLRA 3VS2A 3G4ST 3FC3A 2DO3A 1EZZB 3SWNB 3CCRQ 4KH1B 2XD0A 3MHXA 2DAQA 3CCLT 2A0FB 4C0FA 1VQLT 1IREB 9ATCB 4FW2A 1QQJA 3EG9A 4HVWA 2XU8A 4BD3A 4CI0C 2F1LA 2ROTA 4LN2A 2K3YA 4RTVA 1AVZC 2QK0A 4M77A 2JW4A 3CCMQ 2QDLA 1PG5B 1F1BB 2OTLQ 4M75C 4C0DC 5GAOl 3JSCA 3I5RA 4EMKC 1MHNA 4EMKA 1N8RC 2QQSA 1ZUYA 2J06A 1VQOA 1Q7YR 1FMVA 2EGAA 2R58A 3S3NA 5KE3A 5IN1A 4FSXA 5GAMh 2DPPB 4KBMB 2CT4A 3CCET 2LMJA 2HQEA 5FU7C 4MZTA 2ZGWA 2AT1B 2RI5A 2KXDA 2VVKA 5GMKi 4M7AG 5HY6A 1VQ4Q 1FMWA 3H6ZA 3RERA 1OQKA 1Q82C 4C0GA 2XDDA 1SSFA 2PVGB 1GFDA 1BIBA 1VQPT 1MMNA 5KH6A 4PJOG 2EJ9A 1V76A 3OMCA 1WGSA 4R55A 4IUQA 2QQ9A 2YDLA 1OPKA 1AWOA 2EW3A 8AT1B 5KYWB 2JTMA 2MMPA 3FB9A 2DVEA 3CC2Q 4M7DC 2ENMA 3CCQQ 1QVGP 2DVJA 3RUXA 3VUZA 3CC4Q 3CCUQ 4M7DD 1KHIA 3RKXA 1KD1C 1M9SA 1YJ9Q 2JOYA 2YUOA 2LQ8A 3A98A 3CCMT 4XTVA 2K4YA 2QA4Q 4FT2A 2H3EB 4JRKA 5GAMf 4B9WA 5IHKA 2LP5A 1TXQA 4AT1B 4FW1A 1PM3A 1E6GA 1ZA2B 1PRLC 4QKUA 3JCMb 4M7AA 4F14A 5CK9A 4ZGJB 3GNGA 4M75F 1VQ6Q 4KT0E 1X2QA 2ABLA 2EVRA 3J80E 2DL4A 1VQ4T 4Q5WA 1M1KR 4PJOA 1B07A 1UFFA 3R6NA 1M5Q1 1AHJB 5GJVB 4CC3A 3G71Q 1IRXA 1LOJA 3QZ5B 3UA6A 1K73U 2HDAA 3A8MB 4MMKA 4LDWA 3JCMc 2CP0A 2QYZA 3EFSA 1ZX6A 5M9OA 3PNWC 3S3OA 2M02A 5CKDA 1S72Q 2DXTA 3CPWP 2C0TA 3VRZA 3RESA 1WFWA 2L3RA 1QCOA 2YUPA 1HD3A 3PVQA 1WXTA 3X25B 3T9NA 3CC2T 4IIOA 3A8LB 4DBHA 3CCQT 2HSPA 5GAMg 4BY6B 2ZPHB 1GCQC 3CC4T 1GCQA 1ZSZC 3M4YA 4A53A 5KYNA 2EQKA 3INZA 3CCUT 4JS4A 3H0IA 2RHYA 2C0OA 1YJ9T 4XAXB 3QYGB 3QKJA 1WI7A 4ZGEB 2QA4T 1VOMA 2WSCE 2HBPA 2XG8D 1WLPB 5LJ5g 2HKQB 2O4XA 2YWWA 2E64A 6AT1B 4Z88A 3EFOB 1M27C 2KRNA 1PD0A 1KHCA 2AIRB 2DIGA 1KQSP 2J05A 1UB4A 3R6OA 2PTKA 4JJNK 1VQ6T 1TUCA 2MPXC 4PL6A 2EJGA 5HK3A 3L42A 3JB9J 3VUBA 1VYUA 4QQGA 2FZCB 3G71T 1N9RA 3M0RA 5GAMe 1UE9A 2GTJA 4C8QC 4RTZA 1SHGA 1U8RA 3I55Q 1S72T 4C8QD 4ZN3A 4PJOF 2CT3A 5EC7A 4GLKA 3ZEHA 2BIVA 4NS5A 1WJRA 1GL5A 5CKEA 2K3XA 4V2SA 4E6RA 1FX7A 1Y96B 3THKA 2E4HA 1C0MA 5LJ3g 1EIFA 1B34B 2YLCA 4FYVB 1I81A 3JCMV 1OU9A 1VQ5A 2F69A 4CRIA 2DE0X 1QLYA 2LQNA 2HAXA 3VU3C 2CSIA 3M57A 3GBQA 2DNUA 2LX7A 1W6XA 3X28B 4XTYA 4M78C 1MUZA 4M78A 2M0YA 2EKOA 2DKGA 2HNIA 2H8HA 4HXJA 4F7UB 2EYWA 1V29B 2OTJQ 3C12A 2X4JA 1G2BA 1RL2A 4J5YA 1AZGB 5I2SA 3X26B 1K0SA 3JRZA 1R8OB 3TREA 1VQ7T 1N8RR 4PFOA 5LJ3e 4J9GA 3OW2P 1UGVA 3FDRA 3E9GA 3P8HA 2ATCB 4OB0B 5C0MA 4XU3A 4E7IA 3CMAQ 1Y0MA 2DZCA 5GAN8 4OB2B 3G1JA 2CZ6B 1Q82R 3GF5A 5J26A 1FMKA 2YUQA 1GBRA 5AT1B 3A5ZB 3I5SA 5CCAA 3L2WA 2EAYA 2RF0A 3OYKA 3LGLA 1MNEA 3CCJQ 2ECZA 2O2OA 3FEOA 2DEUA 3RIRA 3A1PA 2R5MA 2KRSA 1NLPC 4FIBA 2CP5A 1OX8A 5I22A 5I11A 1PKTA 3RR6A 1YIJA 1JBMA 3NPFA 1QVGS 1KD1R 4HT9A 2OTJT 2G6FX 1G3TA 2QTXA 1W2BA 3CBOA 1IHVA 4K11A 2YHTA 3JCMg 5IT9E 4C92G 2LCCA 4M78F 1YHQQ 4J6WA 5FWBA 2RQTA 2D1XA 4DBQA 3O8VA 2O9VA 3QPHA 3I56A 4ORZA 2XHCA 4C5GA 2K3BA 3OYHA 2RHUA 1A0NB 3Q1JA 1NZ9A 4Y92A 2W0ZA 3HTRA 2HQXA 1IB8A 4OGCA 4WF2A 4AG1C 1TH7A 3JB9D 4LUEA 2DF6A 3RBBB 2DXBA 2CGHA 3G6EQ 2LQWA 1M90C 3QDFA 4JJCA 2F2WA 1X2KA 2X35A 1YJNQ 3PT9A 3RDVA 2GGRA 2EBPA 1RI0A 1W4SA 1NJIC 2OAWA 4HA8A 2DTHA 1D0YA 2P84A 1D3BA 2H3JA 1YJWA 4PLIA 4J9HA 5L23A 1AD5A 3META 1W1FA 3EGUA 1WHLA 3CCJT 4OB3B 3EG9B 3JCMe 3OYMA 2P4TA 1WXUA 3CPWS 2M1HA 1QVFA 3SDZA 4P5NA 3UF4A 2X9HA 3FJPA 4RG2A 1NM7A 5IAYA 2AKLA 1U5SA 3X20B 1OULA 5GAN3 2D9TA 1S1NA 5GAOn 1VQ8A 3WVDB 3M4GA 1K1ZA 4ESRA 2CZ7B 4C92A 4BE2A 1M4ZA 4M75B 4C0DB 2RJCA 4IUTA 2R5AA 4C0ZA 4EMKB 4M7DE 5FRMA 1YHQT 1GXIE 5GAN7 4A4HA 1Q81U 3HKSA 2QQAA 3OYLA 1ZBXA 2RO0A 1VQKA 5I2MA 5GANd 3O5ZA 2CUBA 1NG2A 2F5TX 1T0JA 3EHRA 5FU7B 2NYSA 1G8XA 4JJBA 3TEEA 1M1GA 1QWEA 4BB7A 2O88A 1X43A 2HQHA 3G6ET 3MPUB 1KQSS 2L3PA 5CQXA 3QWXX 1RADB 1YJNT 2A28A 2JT4A 5LJ5j 3REAB 2I0NA 2KEAA 1NBEB 2LCSA 4RCCA 3MEWA 3IQLA 4LD9K 2BZXA 2XIDA 3WXMB 3CMEA 1OZ3A 1X27A 1FXXA 4E7ZA 1E7OA 2M16A 4ELZC 4M7DB 3VYHB 4N0AA 3E9FA 2KNBB 4HKEA 3DLLA 2YLBA 2EIFA 2CP3A 2DBKA 2BUDA 2JM8A 1N6AA 3OS2A 3EH2A 1X69A 1M8MA 4HCBA 2GQIA 3VS7A 2VYTA 2DYIA 5FROA 5KYYA 5ECAA 2ZPIB 1N9SA 4ZN1A 2L3SA 2EQMA 4O6JA 1T3LA 4DA4A 4N4HA 2NUTA 2K2MA 3CPFA 2RHXA 4EMHA 5GMKl 2CZ0B 3J81E 2QEXA 3NHNA 1K0XA 2XKOC 4JS5A 2P4RA 2ED0A 4OB1B 4F04B 5LJ3j 2OI3A 3BDUA 4IKFA 1QP3A 2RI3A 2LZ6B 2EJFA 3CXCP 4OMOA 2FEIA 3QXEB 3EG2A 1JJ2S 1VQNA 3M5AA 3PIOA 3G4SA 2BTTA 1PHTA 3JB9I 1LPLA 4M77C 3CD6A 4XU2A 2L0AA 2FZKB 2COZA 1AZEA 4ME7A 4J9IA 4II1A 1C6VX 4L6V5 4M77D 3M0SA 1VQLA 4C5EA 3NMZC 1KC8C 4OGEA 1I1JA 4RTUA 3OW2S 2ZPFB 4M75D 2E5KA 1H641 2HCKA 2Y4XA 3H8ZA 4WTOB 1ZSZB 4FM4B 4C8QE 3KUFA 2X4XA 1TTHB 4JRIA 1HSQA 3TSZA 1PKSA 1JRIA 1M30A 3VRYA 3VS4A 3E19A 2E3IA 4ELYC 2QASA 1VYTA 5LJ5h 1SF9A 2LQKA 3CCEA 3EGDA 1WA7A 1OOTA 2X4WA 3CCRT 2HL5C 3VKIA 1VIEA 2IIMA 2JZ2A 4DEXA 5FWCA 1R0CB 4OP0A 1ZHIA 4IUVA 1VQPA 3QSUA 4KGVB 1BI3A 3TSWA 2G3RA 2QGFB 4IIMA 3JAME 2DMOA 1SSHA 1PNJA 4C8QB 1Q86C 1Q95G 4D8KA 1JU5C 1RI9A 3WVEB 1AWWA 1IO6A 2DXUA 3M54A 4HVUA 4JLGA 4XTXA 2OTLT 4LE9A 3GPLA 2X3XD 5CO7A 1K9AA 3MO8A 2JUFA 4E2FB 4QQ6A 2QTVA 1Q7YU 1YCYA 1I8FA 4M77F 2VV5A 4LD6A 3RNJA 1T0HA 1M90R 4M7AC 2ZPGB 1WHMA 2Z0WA 1RLQC 3SD4A 2JNGA 2MAMA 5LJ3h 5LJ5f 2MK5A 2D6FA 4M7AD 1NJIR 2YT6A 3GIBA 3FJ5A 4PJOC 2MF2A 4AFSC 3FLGA 1Q81C 2CS7A 4LNPA 1UGQB 3LGFA 4LDVA 5IH2A 2XDPA 3UA7A 4PJOD 2QQRA 3MKDA 4QT7A 5CVIA 3SWNA 2EYXA 3EFRA 4M78B 3CC7Q 1WXBA 5GAN4 2KYMA 3F70A 2DL7A 2W10A 2JTEA 3MEVA 3CEYA 1LVKA 3OS0A 2J6KA 4JZ3A 2DK3A 4PLLA 1QCFA 3CCVQ 2CH4W 3N5BB 2B86A 1BU1A 1R0BG 1FYNA 3FRNA 1IHWA 3MP1A 1ZLMA 2COYA 1TG0A 1VQ5Q 2SEMA 3CQTA 4J9DA 2KE9A 1ZSGA 2EQJA 1PSFA 2RPNA 2JXBA 3KFVA 1K8AU 3CC2A 1OV3A 5LJ3f 1SRMA 5IXBA 2CUDA 3M0QA 2RJFA 1VQMA 2A3LA 3DB3A 3DB4A 4BE0A 1M2VA 3MEAA 3GLXA 4JJDA 3AHUA 2QA4A 1WX6A 4FL6A 2LNHB 1M1KU 3DKMA 2DD4A 3VS6A 3VV0A 2EQIA 4JZ4A 3TQ7P 4RTYA 5FW9A 2GFAA 4M7AF 3OYYA 1GRIA 5KYWA 4J9FA 5J3BA 2E6ZA 1WZOA 4JLIA 3CC7T 1UGSB 1NPPA 4F7UE 5GAOq 3OYBA 1VQ6A 3KXTA 2VC8A 3OBWA 1AWJA 1WHJA 2LX9A 3URGA 3UT1A 3OYDA 1Y57A 5LJ5e 3CCVT 5KYUB 1QCNA 5D6YA 2HKNA 3JCMh 1RABB 2DX1A 2FPEA 2RK2A 2GBQA 3CCSA 4BACA 1RLPC 1S72A 1VQ5T 4MZMA 4NL2A 3BFMA 2BE7D 2MWPA 4CC4B 3BY7A 2BKDN 2EYQA 3EHQA 3OA6A 3HFNA 3H41A 4LUDA 3L1AA 1PCXA 5GANg 1IXDA 2V1QA 3VYGA 4CC7A 3CXCS 2KR3A 4X9CA 5GAOr 1JJ2P 4M78D 3HFOA 3I35A 3CBPA 1TU0B 1OX9A 2V8KA 3NGPA 2X51A 2CP2A 1EX4A 4GY5A 1Z9ZA 5CIUA 3SB2A 1KC8R 2VGNA 3QWYA 5C6SA 2C0IA 3I56Q 4IUUA 1K4US 5LL6S 3HL8A 4J7FA 1OU8A 3V8KA 2RHIA 3S6WA 4XTZA 4Z89A 3I55T 1BIAA 1U3OA 1N27A 4FT4A 3OB9A 3JCMf 1MGQA 5FU6C 4PK4A 2NUPA 2OAUA 2DTIA 2YRDA 1LCKA 4RTWA 4Z02A 1VQ7A 2CREA 1Y71A 2LT4A 2RJEA 4F17A 1Z9QA 3M58A 4E7KA 3C0CA 3REBB 2IPOB 3MJXA 3P8DA 1ABQA 1CKBA 3TVTA 1WNLA 1VQ9A 3JB9G 2KROA 2MCNA 4UC4A 2EFIA 4AFUC 1H92A 1YI2A 1YCSB 4N4GA 2E70A 3EFOA 1WHHA 3SEMA 1YITQ 4MMLA 5L8RE 2KVQG 2NUZA 2V8JA 2J6OA 3E1SA 1MMGA 5DLQE 2RB6A 3ZL7C 2F2VA 3S3MA 4KH0B 1VQ8Q 4F7UG 5J39A 3OYCA 2A08A 2EYYA 2PU9B 1Q86R 3RMSA 1K73C 2V8IA 3LYIA 5IHIA 2J6FA 3RKWA 5HCKA 3U23A 4A4KA 2K5FA 2DL3A 5GAMd 1N8RU 3I56T 1VQKQ 1D1AA 3L2ZA 1TWBA 2JJ9A 4A4EA 3V7RA 1ZQ1A 2M0OA 4M77E 2GFUA 2O01E 3ZBDA 2OTJA 5IHNA 1Y96A 2RJDA 2EWNA 2EGEA 1M1FA 2E41A 4M75E 2FG0A 1BI2A 3CMAT 1OZ2A 1Y7XA 1AT1B 2DTOA 4TVRA 2K9GA 1RAIB 1FWZA 3M0PA 3RKYA 1B34A 1Q82U 1P92A 4ZTFA 1Q81R 2NUTB 2XICA 1YWPA 1K8AC 4BUGA 3X24B 1KSWA 2WSEE 3LWHA 3OQ5A 3MP8A 2RQUA 2VASA 1B3QA 2LDMA 2E1HA 2OX7A 4OVAA 3PMTA 3VS3A 2L3QA 5DLOA 1YITT 1Y07A 3NFCA 2RMOA
chains in the Genus database with same CATH topology
5M9OA 3PNWC 5DM7R 4J83A 4M77C 3JB9I 3S3OA 5CKDA 1VIFA 3CD6A 4RG8A 2DXTA 2L8DA 4XU2A 4M77B 4ME7A 1KD1U 4RKUE 1VQ8T 1G3WA 1O75A 1X75C 5D6WA 2JN0A 4II1A 4L6V5 2L3RA 3RESA 4M77D 2GF7A 3ME9A 2RHZA 3LX7A 4C92C 1VQLA 4L59A 4C5EA 1KC8C 4OGEA 3CC2T 3X25B 3T9NA 5CQYA 3VJPA 4BY6C 4C92B 3A8LB 3OW2S 2ZPFB 4JUVA 3CCQT 4JRPA 4M75D 5GAMg 4C5HA 2E10A 2ZPHB 4BY6B 1X01A 3V7SA 1H641 5A0DA 3CC4T 2X4YA 3M4YA 4MZPA 3DLMA 2EQKA 3INZA 4A53A 3CCUT 2Y4XA 3H8ZA 4JS4A 4YTLA 2RHYA 1VQKT 5GANe 4FM4B 4QVZA 3HPWA 2LVMA 4FU6A 2DD5A 4XAXB 4C5IA 4C8QE 3I55A 3KUFA 3QYGB 3L2RA 2X4XA 3QKJA 4QVCA 4ZGEB 3M9QA 1VQ9T 4JRIA 2QA4T 2K2VA 2FL7A 4D6WA 1I5LA 2WSCE 5GMKh 2CZ1B 1JRIA 2HBPA 1YI2T 4BI8B 2P0KA 3QJYA 1Q7YC 2XG8D 4IUPA 5LJ5g 2O4XA 1X6OA 4JDSA 3E19A 2E64A 3FIFA 3C4SA 3SFMA 4C8QF 1UEBA 2P0PA 4MDXA 1LJOA 4ELYC 3PGGA 4XTUA 5LJ5h 2FHDA 1KHCA 2DIQA 2LQKA 1YBYA 3CCEA 5A0GA 3UDCA 4DQ2A 2DIGA 1YIJT 3M55A 1UB4A 3R6OA 4M7AE 2X4WA 4JJNK 1VQ6T 3CCRT 3VKIA 4PL6A 4ATOA 2EJGA 1VIEA 2Y90A 3OSSC 3L42A 2JZ2A 5HK3A 3JB9J 3PFSA 1UGRB 3OS1A 4OP0A 1ZHIA 3HRSA 4IUVA 1HK9A 3VUBA 1VQPA 4QQGA 1NPRA 3G71T 4PJOE 1N9RA 2DZ9A 4N0AC 5GAMe 1KC8U 3QSUA 4VUBA 1BI3A 4X34A 1YJNA 4C8QC 2RA2A 3C95A 3OYFA 2G3RA 3JAME 1U8RA 1OYXA 2E12A 2F5KA 4JRQA 4C8QB 1Q86C 3MP6A 1S72T 3UPUA 1OI1A 2LCLA 2ZPBB 3QO3A 3WVEB 2K5LA 4C8QD 4ZN3A 3V8LA 4PJOF 1BI0A 2DXUA 4XQ3A 4GLKA 3ZEHA 3M54A 4JLGA 4XTXA 2BIVA 3HHTB 4NS5A 5A2QE 1WJRA 2OTLT 5CKEA 2K3XA 2I2LA 4X9DA 4V2SA 3GPLA 1NE8A 5CO7A 4M75G 1FX7A 3MO8A 2JUFA 1Y96B 4QQ6A 2LC4A 5LJ5d 2VXEA 1Q7YU 1H3ZA 1YCYA 2NLUA 1I8FA 3M56A 4M77F 2VV5A 4LD6A 5LJ3g 1O9SA 2C06A 1EIFA 1B34B 4M7AC 2ZPGB 1WQWA 2YLCA 1PSEA 1WJSA 1I81A 3JCMV 5KCOA 3OYAA 3SD4A 2JNGA 2MAMA 2XI9A 2PVDB 4M7AB 5LJ3h 4C92F 5LJ5f 2F69A 2VGMA 2YRVA 1YJWT 4CRIA 1VQ5A 5GAN2 2D6FA 4M7AD 3TU4K 3GIBA 2HAXA 2MF2A 4PJOC 3VU3C 3FLGA 2P0QA 2WACA 3EAEA 2MI6A 3M57A 1Q81C 2CS7A 1IZ6A 3CMAA 4PJOB 1UGQB 3LGFA 4LDVA 2XDPA 5AYFA 3X28B 2LTOA 4XTYA 2KQWA 2RM4A 4M78C 4PJOD 2QQRA 3QJ6A 4M78A 3JCMQ 2EKOA 2DKGA 2E5QA 2HNIA 5CVIA 3EFRA 4M78B 3SWNA 4F7UA 3CD6T 3OMGA 2QI2A 4QQDA 1M1KC 3L2QA 1Q81U 4F7UB 5GAN4 1QVPA 4OF1A 3BW1A 2CYZB 2GCXA 3F70A 1V29B 5GANj 3C12A 3MEVA 2X4JA 4EDUA 1Q86U 2K5IA 1RL2A 3CEYA 3OS0A 3CCLA 2MWOA 3GOXA 3JCMX 2DK3A 3QIIA 3P8BB 4J5YA 1HXDA 4L5GA 4PLLA 4A4GA 5I2SA 3X26B 3ER0A 3N5BB 3CCJA 5FRNA 3JRZA 1VQOT 1R8OB 3JCMd 4BDYA 4IURA 3G7ZA 4LDYA 4C92D 4ZGDB 3TREA 4M7DG 1YITA 4LDUA 3PMIA 3RMQA 1VQ7T 3FRNA 2LNVA 1QVGA 2IVWA 2PUOB 4MDWA 4XU0A 2KY9A 3MP1A 5LJ3e 1KQ1A 5GAN6 2K57A 3FDRA 5LJ3d 1K9MU 3MCAB 2ZCFB 4A4FA 2KDSA 3E9GA 3M53A 3P8HA 2ZZDA 3L2UA 2EQJA 4OB0B 4M75A 1PSFA 2L5QA 2LRQA 5GAN5 4J7IA 3TCJA 1K8AU 3JCMJ 2IG0A 2M9UA 5C0MA 3CC2A 4XU3A 5CR2A 5CKHA 4E7IA 2DZCA 4EMGA 5GAN8 1LNXA 5LJ3f 3JCMW 4OB2B 3OYNA 2O4XB 2CZ6B 4PKCC 1YHQA 3PIPA 2RJFA 3GF5A 1VQMA 2A3LA 2E6NA 3DB3A 5J26A 3DB4A 3HSBA 4BE0A 1XNIA 5KCHA 5DY9A 5EG2A 3GNFB 5GAMj 4BI4A 2RI2A 3MEAA 4O5VA 2KAFA 3GLXA 3A5ZB 4DOWA 3AHUA 5CCAA 2QA4A 1BI1A 3L2WA 4FL6A 3CMET 3CBMA 2EAYA 4HCZA 3OYKA 1M1KU 4BE1A 3DKMA 3LGLA 3V8JA 2PUKB 2DD4A 1U1TA 1XOVA 3VV0A 4E47A 1DJ7B 4QVDA 2DEQA 3G6EA 3CXCA 3FEOA 4RCBA 3HP9A 3RIRA 1KQ2A 2GFAA 4M7AF 2R5MA 3HRTA 3L2VA 3JB9F 3OYYA 2KMTA 4E7JA 4FIBA 4A54A 1WPYA 3PTAA 1G3YA 4KUDK 5GAOp 4NL3A 4J8OA 5J3BA 4M78E 4XU1A 2E6ZA 4JLIA 1YIJA 3CC7T 4PNOA 1JBMA 5GMKe 1UGSB 1NPPA 4F7UE 5GAOq 3OYBA 1QVGS 3QYHB 1VQ6A 3KBGA 4M77G 3CCRA 4HT9A 3KXTA 2VC8A 2CKKA 4E7LA 2OTJT 4OMFB 3OBWA 1G3TA 3ZFJA 2QTXA 3CPWA 2LX9A 3URGA 3CBOA 3UT1A 1W2BA 4ZTJA 4M7DA 2FB7A 2RD1A 3OYDA 2YHTA 3JCMg 5IT9E 1UGPB 3M59A 4C92G 5LJ5e 2LCCA 4M78F 3CCVT 4Y91A 4J6WA 5D6XA 5I21A 2QQBA 5D6YA 4F7UF 3BDLA 3JB9H 3O8VA 4BI3A 2KSSA 3JCMh 2B8AA 1QP2A 3QPHA 2RH2A 2RK2A 3I56A 2XHCA 2AHJB 4C5GA 3OYJA 3OYHA 2RHUA 2QEXT 1WJQA 3CCSA 4BACA 1S72A 4RMOA 3Q1JA 4HCCA 1NZ9A 3CCMA 1VQ5T 4MZMA 4NL2A 3OYIA 1KG1A 2LT1A 2HQXA 2L89A 3BFMA 4OGCA 4WF2A 5KE2A 2QDYB 1TH7A 3NTHA 2MWPA 2DXCA 3BY7A 5FLXE 3JB9D 2BKDN 2EYQA 5CKFA 3V7CA 2OTLA 2R57A 2DXBA 2ZPEB 4XK8E 3OA6A 3OSVA 2CGHA 4BDZA 3HFNA 4DOVA 2PVOB 1M90C 3NTIA 1VQNT 3J7AF 5GAN3 2X35A 3HRUA 3L1AA 3PT9A 1BYMA 5GANg 2A7YA 1XTDA 3LLRA 3G4ST 1VQ8A 3FC3A 1RI0A 3SWNC 3VYGA 1W4SA 1NJIC 2JVVA 2DO3A 3CXCS 4HA8A 2Y4YA 2DTHA 4X9CA 5GAOr 5GANh 3SWNB 3QBYA 4M78D 4N4IA 1D3BA 2H3JA 1YJWA 3MHXA 4KUIA 3HFOA 4PLIA 2XD0A 2DAQA 3QG1A 1KQSA 3CCLT 2KK4A 4C0FA 1VQLT 3CBPA 1VQ4A 3META 1IREB 1JB0E 2V8KA 1G5VA 2XU8A 4J6XA 3CCJT 4BD3A 4OB3B 4E7HA 3JCMe 4CI0C 3OYMA 2P4TA 3OYEA 4GY5A 3JCMP 5CIUA 3OBYA 3SB2A 3CPWS 2VGNA 2M1HA 2DJZA 5C6SA 1W2BS 1QVFA 2K3YA 4IUUA 4P5NA 3SDZA 5LL6S 2XDBA 3FJPA 3HL8A 2RK1A 4J7FA 3V8KA 2RHIA 4M77A 4RG2A 2WSFE 3S6WA 4XTZA 2VUBA 5A0LA 1BIAA 4C8QG 5IAYA 3I55T 3X20B 1N27A 4B9XA 1WQ7A 2D9TA 3A8OB 4FT4A 3OB9A 3UWNA 3NTKA 3JCMf 4M75C 1MGQA 3M4GA 3WVDB 3GP8A 5FU6C 4C0DC 2CZ7B 4C92A 2OAUA 5GAOl 4BE2A 2DTIA 1M4ZA 3JSCA 4M75B 4EMKC 1MHNA 5FU6B 4C0DB 4EMKA 2RJCA 1N8RC 5HKCA 2QQSA 4IUTA 2R5AA 3A8HB 4C0ZA 4EMKB 3CCQA 1VQOA 5FRMA 1YHQT 4M7DE 1GXIE 4Z02A 1VQ7A 2R58A 1VQMT 1Y71A 2LT4A 3S3NA 3CC4A 5KE3A 5GAN7 2RJEA 5IN1A 4A4HA 5HK0A 4FSXA 3HKSA 5GAMh 2QQAA 2DPPB 3CCUA 4KBMB 1ZBXA 3M58A 2RO0A 3OYLA 4E7KA 5I2MA 2QXFA 5GANd 1VQKA 2HQEA 5FU7C 1YJ9A 4MZTA 2F5TX 1G3SA 2ZGWA 1M90U 2RI5A 3P8DA 5GMKi 5FU7B 1WNLA 1VQ9A 4M7AG 3JB9G 4M7DF 1M8VA 5HY6A 1NJIU 4UC4A 2EQUA 2EFIA 3H6ZA 1YJ9T 1YI2A 3TEEA 5GMKj 1M1GA 4BB7A 3RERA 4N4GA 1Q82C 2E70A 4C0GA 2XDDA 3ASKA 1SSFA 2PVGB 5GANf 1BIBA 3G6ET 1VQPT 2E65A 1KQSS 1I4K1 5KH6A 4PJOG 5CQXA 2EJ9A 5CAIA 4MMLA 5L8RE 2XK0A 2KVQG 3OMCA 1YJNT 1WGSA 2D0QB 4R55A 3CCET 5LJ5j 4IUQA 2QQ9A 2V8JA 3E1SA 5DLQE 4KULA 2RB6A 4M78G 4RCCA 3S3MA 3MEWA 3OYGA 2JTMA 2MMPA 4LD9K 2XIDA 4Y28E 4F7UG 1QVFS 5J39A 3OYCA 3FB9A 3WXMB 3CMEA 1OZ3A 1JJ2A 3OY9A 2PU9B 1FXXA 3LW5E 3LH0A 2VXFA 1U1SA 2DVEA 2M16A 3RMSA 2HD0A 1K73C 2V8IA 4M7DC 3LYIA 4NOYA 4ELZC 3RKWA 1XQHA 3A8GB 4M7DB 3VYHB 4N0AA 3E9FA 4A4KA 3G71A 2K5FA 3RUXA 3VUZA 4HKEA 4M7DD 1KHIA 5GAMd 4C8QA 3RKXA 3I56T 1N8RU 1KD1C 1M9SA 3DLLA 2YLBA 3L2ZA 3MEUA 2PQWA 4QW2A 3CCST 3OS5A 2EIFA 2JOYA 4A4EA 5GMKm 3CC7A 2LQ8A 1BKBA 2BUDA 3V7RA 3C94A 3CCMT 1ZQ1A 2M0OA 4M77E 1N6AA 2GFUA 2K4YA 4XTVA 3OS2A 4FT2A 2O01E 3OW2A 3ZBDA 4JRKA 4HCBA 2OTJA 5CKBA 2FYKA 2VYTA 5GAMf 5FROA 1Y96A 2RJDA 2EWNA 1N9SA 2ZPIB 4B9WA 4ZN1A 1M1FA 3LWIA 2E41A 4M75E 1VUBA 3QHSA 4C92E 3QZ9B 1BI2A 3CCVA 2EQMA 1OZ2A 1Y7XA 4O6JA 4DA4A 3CMAT 2DTOA 4N4HA 1K9MC 4TVRA 1FWZA 3RKYA 1B34A 1Q82U 1P92A 2RHXA 3CPFA 4ZTFA 3JCMb 2XICA 4EMHA 5GMKl 4M7AA 2CZ0B 3QUIA 1K8AC 3J81E 4BUGA 3X24B 2QEXA 5CK9A 4ZGJB 3GNGA 4M75F 2WSEE 4KT0E 2XKOC 4JS5A 3LWHA 1QW1A 4OB1B 3J80E 3OQ5A 5LJ3j 4HT8A 3BDUA 4R56A 4IKFA 1QP3A 2RI3A 3MP8A 4Q5WA 1VQ4T 4J6YA 1D3BB 2EJFA 4EPCA 2JTFA 4PJOA 2GQVA 1M5Q1 2LDMA 1AHJB 5GAOm 2E1HA 3QXEB 1LOJA 3QZ5B 4XTWA 1JJ2S 4OVAA 4LDXA 1VQNA 3M5AA 3PMTA 5GAOn 1K73U 5DLOA 1YITT 3A8MB 1Y07A 3NFCA 4MMKA 3QDRB 4LDWA 3PIOA 3JCMc 2FVUA 3G4SA 3EFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5N A; 
#chains in the Genus database with same CATH topology
 5DM7 R;  4J83 A;  1NEB A;  1VIF A;  4HVV A;  4M77 B;  2QGG A;  1KD1 U;  4RKU E;  1VQ8 T;  1G3W A;  1WHG A;  2RN8 A;  2JN0 A;  5D6W A;  2GF7 A;  3LX7 A;  4C92 C;  2FO0 A;  2LJ1 A;  3VJP A;  4JUV A;  2O31 A;  2E10 A;  2DFU A;  3V7S A;  1UJ0 A;  5A0D A;  1QMC A;  4MZP A;  4YTL A;  1VQK T;  1I5O B;  2OJ2 A;  2K6D A;  2LVM A;  4QVC A;  3M9Q A;  2K2V A;  4D6W A;  2VKN A;  2P0K A;  3QJY A;  4IUP A;  2D8J A;  1EFN A;  4JDS A;  2DIL A;  1RUW A;  3FIF A;  3C4S A;  3SFM A;  1MV3 A;  4MDX A;  1LJO A;  3PGG A;  4XTU A;  1UUE A;  4RUG A;  2DIQ A;  3CD6 Q;  1YWO A;  1PRM C;  4DQ2 A;  4J9B A;  4M7A E;  1KK7 A;  1RAC B;  4ATO A;  1NYG A;  2Y90 A;  3OSS C;  1UGR B;  1BCM A;  3OS1 A;  2VB6 A;  1QVF P;  1VQO Q;  4RTT A;  4PJO E;  4N0A C;  2FRW A;  4VUB A;  4X34 A;  1YJN A;  1YP5 A;  2RA2 A;  3C95 A;  2AKK A;  3MP6 A;  1PC0 A;  1ZA1 B;  1AWX A;  4OMN A;  5KYX A;  3UPU A;  2LCL A;  2DRK A;  2M51 A;  1KFZ A;  2K5L A;  1SEM A;  3V8L A;  1BI0 A;  4KRT A;  4XQ3 A;  1GCP A;  3HHT B;  5A2Q E;  4X9D A;  4CC2 A;  1NE8 A;  2CDT A;  4M75 G;  2COW A;  2FZG B;  2VXE A;  2QG9 B;  1TUG B;  1O9S A;  1SG5 A;  2C06 A;  1QWF A;  1WQW A;  4AFQ C;  1T3S A;  1WJS A;  5KCO A;  3OYA A;  4M7A B;  4C92 F;  2VGM A;  2YRV A;  2BE9 B;  2CP7 A;  2PZ1 A;  2HZY A;  3EGX A;  2BZ8 A;  1U06 A;  1VQP Q;  2WAC A;  3EAE A;  3EG3 A;  2GNC A;  4PJO B;  1D1C A;  5AYF A;  2KQW A;  2RM4 A;  3QJ6 A;  1YN8 A;  3JCM Q;  1RAA B;  3CD6 T;  1UDL A;  2QI2 A;  2BZY A;  4QQD A;  1QVP A;  4OF1 A;  3BW1 A;  2CYZ B;  4D8D A;  5GAN j;  4EDU A;  2K5I A;  3CCL A;  1MMA A;  2MWO A;  3GOX A;  3JCM X;  4A4G A;  3ER0 A;  1VQO T;  1KIK A;  4J9C A;  3JCM d;  4BDY A;  4IUR A;  3G7Z A;  4LDY A;  4M7D G;  4LDU A;  3RMQ A;  1QVG A;  1OEB A;  2IVW A;  2PUO B;  4MDW A;  1J3T A;  1KQ1 A;  2K57 A;  1K9M U;  3MCA B;  2ZCF B;  4A4F A;  2KDS A;  3M53 A;  4FYX B;  4M75 A;  5GAN 5;  2EYZ A;  4J7I A;  2IG0 A;  1M3A A;  1E6H A;  5CR2 A;  2ED1 A;  1LNX A;  2KI7 A;  2O4X B;  2YRC A;  2A36 A;  2KT1 A;  2VWF A;  1PD1 A;  4LXC A;  3HSB A;  2ZAE A;  5KCH A;  1TOV A;  4O5V A;  2GTO A;  2KAF A;  1C1A A;  1M2V B;  1QKW A;  3CBM A;  4HCZ A;  1MND A;  2HEQ A;  3V8J A;  3H0H A;  1U1T A;  2DJQ A;  2JM9 A;  2YXY A;  1K73 R;  3HP9 A;  1ZUK A;  3HRT A;  4E7J A;  1RAG B;  1WPY A;  4KUD K;  1G3Y A;  3ULR B;  5GAO p;  4NL3 A;  4J8O A;  2RQV A;  4M78 E;  1TUD A;  3QYH B;  3CCR A;  4OMF B;  3CPW A;  4M7D A;  4ZTJ A;  1UGP B;  4Y91 A;  5D6X A;  1VQM Q;  2V26 A;  3BDL A;  3JB9 H;  4BI3 A;  2KSS A;  2B8A A;  2RH2 A;  2JMC A;  1AOJ A;  3E2U A;  4HCC A;  3CCM A;  2LT1 A;  2L89 A;  5KE2 A;  1XJW B;  1K8A R;  2OTL A;  5CKF A;  3V7C A;  1I07 A;  2R57 A;  4AFZ C;  4XK8 E;  3OSV A;  2PVO B;  2YSQ A;  7AT1 B;  3J7A F;  1D0X A;  1UJY A;  3EG1 A;  3HRU A;  1BYM A;  2A7Y A;  1BCO A;  1XTD A;  1GFC A;  3SWN C;  2JVV A;  1I0C A;  2Y4Y A;  5GAN h;  3QBY A;  4N4I A;  1VA7 A;  2RQW A;  2YUN A;  4KUI A;  3QG1 A;  1KQS A;  2KK4 A;  4PJN A;  2DL8 A;  4FCY A;  1VQ4 A;  1JB0 E;  1G83 A;  2DRM A;  1G5V A;  4J6X A;  4OML A;  4E7H A;  4FYY B;  2D0N A;  3OYE A;  3JCM P;  3OBY A;  2O9S A;  2DJZ A;  2CP6 A;  1W2B S;  2XDB A;  2RK1 A;  3CCS Q;  2WSF E;  5A0L A;  1ABO A;  2VUB A;  4C8Q G;  1SRL A;  4B9X A;  1WQ7 A;  3UWN A;  3A8O B;  1D1B A;  3PVL A;  3NTK A;  4X1V A;  4AMC A;  3GP8 A;  2HL3 A;  1JQQ A;  1V1C A;  2NUP B;  5FU6 B;  4ZNX A;  4JPB W;  5HKC A;  3A8H B;  1NEG A;  3CCQ A;  5D7U A;  1ZSZ A;  1VQM T;  3CC4 A;  3D7S B;  3CCU A;  5HK0 A;  1M90 U;  1N5Z A;  2CSQ A;  1PWT A;  2QXF A;  1HJD A;  1YJ9 A;  1G3S A;  1M8V A;  1WDX A;  4M7D F;  1NJI U;  2EQU A;  5GMK j;  3ASK A;  5GAN f;  2E65 A;  1I4K 1;  4B6M A;  5CAI A;  2AK5 A;  1M2O A;  2XK0 A;  2D0Q B;  2PNI A;  1VYV A;  2K7A A;  1RAF B;  4KUL A;  4A63 B;  2KXC A;  2DET A;  4M78 G;  1KJW A;  1K76 A;  3OYG A;  1QVF S;  4Y28 E;  4OMP A;  1H8K A;  4PFP A;  3OY9 A;  1JJ2 A;  3LW5 E;  3LH0 A;  2VXF A;  1U1S A;  1X6B A;  2RNA A;  2HD0 A;  1D0Z A;  4NOY A;  1XQH A;  3A8G B;  1VQ7 Q;  3G71 A;  2LJ3 A;  2L2P A;  3VS0 A;  4C8Q A;  3MEU A;  2PQW A;  4QW2 A;  3CCS T;  3OS5 A;  3I9Q A;  5GMK m;  3CC7 A;  1BKB A;  1TSF A;  3C94 A;  1VQ9 Q;  1QKX A;  3OW2 A;  1YI2 Q;  5CKB A;  2A37 A;  2FYK A;  3H9N A;  1HYO A;  3LWI A;  1VUB A;  3QHS A;  2EPD A;  4C92 E;  3QZ9 B;  1ZUU A;  3CCV A;  1JEG A;  1K9M C;  2DYB A;  1OPL A;  2F2X A;  3QUI A;  1YIJ Q;  3H0F A;  1QW1 A;  4HT8 A;  4R56 A;  4J6Y A;  1D3B B;  4EPC A;  2JTF A;  1UTI A;  2GQV A;  5GAO m;  1W70 A;  1JXM A;  2V1R A;  4XTW A;  4AG2 C;  4LDX A;  3QDR B;  2FVU A;  3SHW A;  4E7L A;  4R0K A;  4RG8 A;  2L8D A;  3LH5 A;  1O75 A;  1X75 C;  4KGZ B;  3PE0 A;  3ME9 A;  2RHZ A;  4L59 A;  5CQY A;  4BY6 C;  4C92 B;  4JRP A;  4C5H A;  4PFZ A;  1X01 A;  4PJL A;  1RAE B;  2X4Y A;  1M3C A;  1ARK A;  1UHC A;  3DLM A;  2DBM A;  2SRC A;  5GAN e;  4QVZ A;  3HPW A;  4FU6 A;  2DD5 A;  4C5I A;  4Z8A A;  3I55 A;  3L2R A;  2DM1 A;  1YJW Q;  2KRM A;  1VQ9 T;  1I5L A;  2FL7 A;  1WIE A;  2HMA A;  5GMK h;  2CZ1 B;  1YI2 T;  4BI8 B;  1Q7Y C;  1X6O A;  1MMD A;  2FPF A;  4E7S A;  1AEY A;  4C8Q F;  1UEB A;  2P0P A;  4WCI A;  1R77 A;  2FHD A;  2HBW A;  4DEY A;  1YBY A;  2CH4 A;  5A0G A;  3UDC A;  1M3B A;  1NYF A;  1YIJ T;  3M55 A;  2MYS A;  3UAT A;  1BBZ A;  4GLM A;  3PFS A;  2FPD A;  3HRS A;  1HK9 A;  1NPR A;  3M0U A;  2DZ9 A;  4EIK A;  1KC8 U;  2EGC A;  3OYF A;  2DER A;  1OYX A;  2E12 A;  1WHK A;  2F5K A;  4JRQ A;  1IGQ A;  1OI1 A;  3QO3 A;  2ZPB B;  4GBQ A;  5KYX B;  1BB9 A;  2I2L A;  3VS5 A;  5KYU A;  5KYY B;  5IXF A;  2LC4 A;  5LJ5 d;  1H3Z A;  2NLU A;  3AT1 B;  3M56 A;  1YNZ A;  2KGT A;  1GBQ A;  1CSK A;  1PSE A;  2NWM A;  2XI9 A;  2PVD B;  3CME Q;  1YJW T;  1UEC A;  5GAN 2;  2K79 A;  2MOX A;  2J7I A;  4DBF A;  3TU4 K;  2LJ0 A;  2XMF A;  4RTX A;  2P0Q A;  2MI6 A;  3EG0 A;  3EGX B;  1IZ6 A;  3CMA A;  2LTO A;  2KYB A;  2E5Q A;  2DA9 A;  1BK2 A;  1CKA A;  4F7U A;  3OMG A;  4M4Z A;  1M1K C;  3L2Q A;  2GCX A;  2EKH A;  3BE3 A;  1SHF A;  1SPK A;  1W2B P;  2AZS A;  1Q86 U;  2DLP A;  1X6G A;  1NLO C;  4ANJ A;  3QII A;  3P8B B;  4L5G A;  1HXD A;  3CCJ A;  5FRN A;  2JS0 A;  4C92 D;  4ZGD B;  1YIT A;  3PMI A;  2LNV A;  4XU0 A;  2DL5 A;  2KY9 A;  2QEX Q;  1JXO A;  5GAN 6;  5LJ3 d;  2ZZD A;  3L2U A;  1SKU B;  2L5Q A;  2LRQ A;  4HCK A;  1UHF A;  3TCJ A;  2FRY A;  1B7T A;  2RQR A;  3JCM J;  2M9U A;  5CKH A;  1WYX A;  4EMG A;  3JCM W;  1ACM B;  3OYN A;  1VQN Q;  1MV0 B;  4PKC C;  2KT8 A;  1YHQ A;  3PIP A;  2E6N A;  3G4S Q;  4OMM A;  1XNI A;  5DY9 A;  5EG2 A;  2JMA A;  3GNF B;  5GAM j;  4BI4 A;  2RI2 A;  2QAZ A;  1UG1 A;  3EGD B;  4DOW A;  1BI1 A;  3CCL Q;  3CME T;  1VQL Q;  4FSS A;  4F16 A;  4BE1 A;  2PUK B;  1XOV A;  4E47 A;  1DJ7 B;  4QVD A;  2DEQ A;  3G6E A;  3CXC A;  4RCB A;  1KQ2 A;  3VS1 A;  3L2V A;  3JB9 F;  2JS2 A;  2KMT A;  4A54 A;  1YFN A;  3PTA A;  8ATC B;  2HSE B;  2AZV A;  4XU1 A;  4PNO A;  5GMK e;  5GJW B;  3KBG A;  2E3H A;  4M77 G;  4FYW B;  2CKK A;  3ZFJ A;  4J9E A;  3EH1 A;  4DBR A;  1IGU A;  4PJJ A;  2FB7 A;  2RD1 A;  4KGX B;  3M0T A;  3M59 A;  5I21 A;  2QQB A;  4F7U F;  2KBT A;  4OMQ A;  1RAH B;  1TS9 A;  1JO8 A;  1QP2 A;  3CCE Q;  2AHJ B;  3OYJ A;  2D8H A;  2QEX T;  1WJQ A;  1K9M R;  1ZBJ A;  2ROL A;  4RMO A;  1KG1 A;  3OYI A;  2MIO A;  2QDY B;  2X3W D;  3NTH A;  2DXC A;  5FLX E;  2ESW A;  2ZPE B;  4BDZ A;  1H3H A;  4DOV A;  3NTI A;  1VQN T;  3JV3 A;  4PJM A;  1D09 B;  3LLR A;  3VS2 A;  3G4S T;  3FC3 A;  2DO3 A;  1EZZ B;  3SWN B;  3CCR Q;  4KH1 B;  2XD0 A;  3MHX A;  2DAQ A;  3CCL T;  2A0F B;  4C0F A;  1VQL T;  1IRE B;  9ATC B;  4FW2 A;  1QQJ A;  3EG9 A;  4HVW A;  2XU8 A;  4BD3 A;  4CI0 C;  2F1L A;  2ROT A;  4LN2 A;  2K3Y A;  4RTV A;  1AVZ C;  2QK0 A;  4M77 A;  2JW4 A;  3CCM Q;  2QDL A;  1PG5 B;  1F1B B;  2OTL Q;  4M75 C;  4C0D C;  5GAO l;  3JSC A;  3I5R A;  4EMK C;  1MHN A;  4EMK A;  1N8R C;  2QQS A;  1ZUY A;  2J06 A;  1VQO A;  1Q7Y R;  1FMV A;  2EGA A;  2R58 A;  3S3N A;  5KE3 A;  5IN1 A;  4FSX A;  5GAM h;  2DPP B;  4KBM B;  2CT4 A;  3CCE T;  2LMJ A;  2HQE A;  5FU7 C;  4MZT A;  2ZGW A;  2AT1 B;  2RI5 A;  2KXD A;  2VVK A;  5GMK i;  4M7A G;  5HY6 A;  1VQ4 Q;  1FMW A;  3H6Z A;  3RER A;  1OQK A;  1Q82 C;  4C0G A;  2XDD A;  1SSF A;  2PVG B;  1GFD A;  1BIB A;  1VQP T;  1MMN A;  5KH6 A;  4PJO G;  2EJ9 A;  1V76 A;  3OMC A;  1WGS A;  4R55 A;  4IUQ A;  2QQ9 A;  2YDL A;  1OPK A;  1AWO A;  2EW3 A;  8AT1 B;  5KYW B;  2JTM A;  2MMP A;  3FB9 A;  2DVE A;  3CC2 Q;  4M7D C;  2ENM A;  3CCQ Q;  1QVG P;  2DVJ A;  3RUX A;  3VUZ A;  3CC4 Q;  3CCU Q;  4M7D D;  1KHI A;  3RKX A;  1KD1 C;  1M9S A;  1YJ9 Q;  2JOY A;  2YUO A;  2LQ8 A;  3A98 A;  3CCM T;  4XTV A;  2K4Y A;  2QA4 Q;  4FT2 A;  2H3E B;  4JRK A;  5GAM f;  4B9W A;  5IHK A;  2LP5 A;  1TXQ A;  4AT1 B;  4FW1 A;  1PM3 A;  1E6G A;  1ZA2 B;  1PRL C;  4QKU A;  3JCM b;  4M7A A;  4F14 A;  5CK9 A;  4ZGJ B;  3GNG A;  4M75 F;  1VQ6 Q;  4KT0 E;  1X2Q A;  2ABL A;  2EVR A;  3J80 E;  2DL4 A;  1VQ4 T;  4Q5W A;  1M1K R;  4PJO A;  1B07 A;  1UFF A;  3R6N A;  1M5Q 1;  1AHJ B;  5GJV B;  4CC3 A;  3G71 Q;  1IRX A;  1LOJ A;  3QZ5 B;  3UA6 A;  1K73 U;  2HDA A;  3A8M B;  4MMK A;  4LDW A;  3JCM c;  2CP0 A;  2QYZ A;  3EFS A;  1ZX6 A;  5M9O A;  3PNW C;  3S3O A;  2M02 A;  5CKD A;  1S72 Q;  2DXT A;  3CPW P;  2C0T A;  3VRZ A;  3RES A;  1WFW A;  2L3R A;  1QCO A;  2YUP A;  1HD3 A;  3PVQ A;  1WXT A;  3X25 B;  3T9N A;  3CC2 T;  4IIO A;  3A8L B;  4DBH A;  3CCQ T;  2HSP A;  5GAM g;  4BY6 B;  2ZPH B;  1GCQ C;  3CC4 T;  1GCQ A;  1ZSZ C;  3M4Y A;  4A53 A;  5KYN A;  2EQK A;  3INZ A;  3CCU T;  4JS4 A;  3H0I A;  2RHY A;  2C0O A;  1YJ9 T;  4XAX B;  3QYG B;  3QKJ A;  1WI7 A;  4ZGE B;  2QA4 T;  1VOM A;  2WSC E;  2HBP A;  2XG8 D;  1WLP B;  5LJ5 g;  2HKQ B;  2O4X A;  2YWW A;  2E64 A;  6AT1 B;  4Z88 A;  3EFO B;  1M27 C;  2KRN A;  1PD0 A;  1KHC A;  2AIR B;  2DIG A;  1KQS P;  2J05 A;  1UB4 A;  3R6O A;  2PTK A;  4JJN K;  1VQ6 T;  1TUC A;  2MPX C;  4PL6 A;  2EJG A;  5HK3 A;  3L42 A;  3JB9 J;  3VUB A;  1VYU A;  4QQG A;  2FZC B;  3G71 T;  1N9R A;  3M0R A;  5GAM e;  1UE9 A;  2GTJ A;  4C8Q C;  4RTZ A;  1SHG A;  1U8R A;  3I55 Q;  1S72 T;  4C8Q D;  4ZN3 A;  4PJO F;  2CT3 A;  5EC7 A;  4GLK A;  3ZEH A;  2BIV A;  4NS5 A;  1WJR A;  1GL5 A;  5CKE A;  2K3X A;  4V2S A;  4E6R A;  1FX7 A;  1Y96 B;  3THK A;  2E4H A;  1C0M A;  5LJ3 g;  1EIF A;  1B34 B;  2YLC A;  4FYV B;  1I81 A;  3JCM V;  1OU9 A;  1VQ5 A;  2F69 A;  4CRI A;  2DE0 X;  1QLY A;  2LQN A;  2HAX A;  3VU3 C;  2CSI A;  3M57 A;  3GBQ A;  2DNU A;  2LX7 A;  1W6X A;  3X28 B;  4XTY A;  4M78 C;  1MUZ A;  4M78 A;  2M0Y A;  2EKO A;  2DKG A;  2HNI A;  2H8H A;  4HXJ A;  4F7U B;  2EYW A;  1V29 B;  2OTJ Q;  3C12 A;  2X4J A;  1G2B A;  1RL2 A;  4J5Y A;  1AZG B;  5I2S A;  3X26 B;  1K0S A;  3JRZ A;  1R8O B;  3TRE A;  1VQ7 T;  1N8R R;  4PFO A;  5LJ3 e;  4J9G A;  3OW2 P;  1UGV A;  3FDR A;  3E9G A;  3P8H A;  2ATC B;  4OB0 B;  5C0M A;  4XU3 A;  4E7I A;  3CMA Q;  1Y0M A;  2DZC A;  5GAN 8;  4OB2 B;  3G1J A;  2CZ6 B;  1Q82 R;  3GF5 A;  5J26 A;  1FMK A;  2YUQ A;  1GBR A;  5AT1 B;  3A5Z B;  3I5S A;  5CCA A;  3L2W A;  2EAY A;  2RF0 A;  3OYK A;  3LGL A;  1MNE A;  3CCJ Q;  2ECZ A;  2O2O A;  3FEO A;  2DEU A;  3RIR A;  3A1P A;  2R5M A;  2KRS A;  1NLP C;  4FIB A;  2CP5 A;  1OX8 A;  5I22 A;  5I11 A;  1PKT A;  3RR6 A;  1YIJ A;  1JBM A;  3NPF A;  1QVG S;  1KD1 R;  4HT9 A;  2OTJ T;  2G6F X;  1G3T A;  2QTX A;  1W2B A;  3CBO A;  1IHV A;  4K11 A;  2YHT A;  3JCM g;  5IT9 E;  4C92 G;  2LCC A;  4M78 F;  1YHQ Q;  4J6W A;  5FWB A;  2RQT A;  2D1X A;  4DBQ A;  3O8V A;  2O9V A;  3QPH A;  3I56 A;  4ORZ A;  2XHC A;  4C5G A;  2K3B A;  3OYH A;  2RHU A;  1A0N B;  3Q1J A;  1NZ9 A;  4Y92 A;  2W0Z A;  3HTR A;  2HQX A;  1IB8 A;  4OGC A;  4WF2 A;  4AG1 C;  1TH7 A;  3JB9 D;  4LUE A;  2DF6 A;  3RBB B;  2DXB A;  2CGH A;  3G6E Q;  2LQW A;  1M90 C;  3QDF A;  4JJC A;  2F2W A;  1X2K A;  2X35 A;  1YJN Q;  3PT9 A;  3RDV A;  2GGR A;  2EBP A;  1RI0 A;  1W4S A;  1NJI C;  2OAW A;  4HA8 A;  2DTH A;  1D0Y A;  2P84 A;  1D3B A;  2H3J A;  1YJW A;  4PLI A;  4J9H A;  5L23 A;  1AD5 A;  3MET A;  1W1F A;  3EGU A;  1WHL A;  3CCJ T;  4OB3 B;  3EG9 B;  3JCM e;  3OYM A;  2P4T A;  1WXU A;  3CPW S;  2M1H A;  1QVF A;  3SDZ A;  4P5N A;  3UF4 A;  2X9H A;  3FJP A;  4RG2 A;  1NM7 A;  5IAY A;  2AKL A;  1U5S A;  3X20 B;  1OUL A;  5GAN 3;  2D9T A;  1S1N A;  5GAO n;  1VQ8 A;  3WVD B;  3M4G A;  1K1Z A;  4ESR A;  2CZ7 B;  4C92 A;  4BE2 A;  1M4Z A;  4M75 B;  4C0D B;  2RJC A;  4IUT A;  2R5A A;  4C0Z A;  4EMK B;  4M7D E;  5FRM A;  1YHQ T;  1GXI E;  5GAN 7;  4A4H A;  1Q81 U;  3HKS A;  2QQA A;  3OYL A;  1ZBX A;  2RO0 A;  1VQK A;  5I2M A;  5GAN d;  3O5Z A;  2CUB A;  1NG2 A;  2F5T X;  1T0J A;  3EHR A;  5FU7 B;  2NYS A;  1G8X A;  4JJB A;  3TEE A;  1M1G A;  1QWE A;  4BB7 A;  2O88 A;  1X43 A;  2HQH A;  3G6E T;  3MPU B;  1KQS S;  2L3P A;  5CQX A;  3QWX X;  1RAD B;  1YJN T;  2A28 A;  2JT4 A;  5LJ5 j;  3REA B;  2I0N A;  2KEA A;  1NBE B;  2LCS A;  4RCC A;  3MEW A;  3IQL A;  4LD9 K;  2BZX A;  2XID A;  3WXM B;  3CME A;  1OZ3 A;  1X27 A;  1FXX A;  4E7Z A;  1E7O A;  2M16 A;  4ELZ C;  4M7D B;  3VYH B;  4N0A A;  3E9F A;  2KNB B;  4HKE A;  3DLL A;  2YLB A;  2EIF A;  2CP3 A;  2DBK A;  2BUD A;  2JM8 A;  1N6A A;  3OS2 A;  3EH2 A;  1X69 A;  1M8M A;  4HCB A;  2GQI A;  3VS7 A;  2VYT A;  2DYI A;  5FRO A;  5KYY A;  5ECA A;  2ZPI B;  1N9S A;  4ZN1 A;  2L3S A;  2EQM A;  4O6J A;  1T3L A;  4DA4 A;  4N4H A;  2NUT A;  2K2M A;  3CPF A;  2RHX A;  4EMH A;  5GMK l;  2CZ0 B;  3J81 E;  2QEX A;  3NHN A;  1K0X A;  2XKO C;  4JS5 A;  2P4R A;  2ED0 A;  4OB1 B;  4F04 B;  5LJ3 j;  2OI3 A;  3BDU A;  4IKF A;  1QP3 A;  2RI3 A;  2LZ6 B;  2EJF A;  3CXC P;  4OMO A;  2FEI A;  3QXE B;  3EG2 A;  1JJ2 S;  1VQN A;  3M5A A;  3PIO A;  3G4S A;  2BTT A;  1PHT A;  3JB9 I;  1LPL A;  4M77 C;  3CD6 A;  4XU2 A;  2L0A A;  2FZK B;  2COZ A;  1AZE A;  4ME7 A;  4J9I A;  4II1 A;  1C6V X;  4L6V 5;  4M77 D;  3M0S A;  1VQL A;  4C5E A;  3NMZ C;  1KC8 C;  4OGE A;  1I1J A;  4RTU A;  3OW2 S;  2ZPF B;  4M75 D;  2E5K A;  1H64 1;  2HCK A;  2Y4X A;  3H8Z A;  4WTO B;  1ZSZ B;  4FM4 B;  4C8Q E;  3KUF A;  2X4X A;  1TTH B;  4JRI A;  1HSQ A;  3TSZ A;  1PKS A;  1JRI A;  1M30 A;  3VRY A;  3VS4 A;  3E19 A;  2E3I A;  4ELY C;  2QAS A;  1VYT A;  5LJ5 h;  1SF9 A;  2LQK A;  3CCE A;  3EGD A;  1WA7 A;  1OOT A;  2X4W A;  3CCR T;  2HL5 C;  3VKI A;  1VIE A;  2IIM A;  2JZ2 A;  4DEX A;  5FWC A;  1R0C B;  4OP0 A;  1ZHI A;  4IUV A;  1VQP A;  3QSU A;  4KGV B;  1BI3 A;  3TSW A;  2G3R A;  2QGF B;  4IIM A;  3JAM E;  2DMO A;  1SSH A;  1PNJ A;  4C8Q B;  1Q86 C;  1Q95 G;  4D8K A;  1JU5 C;  1RI9 A;  3WVE B;  1AWW A;  1IO6 A;  2DXU A;  3M54 A;  4HVU A;  4JLG A;  4XTX A;  2OTL T;  4LE9 A;  3GPL A;  2X3X D;  5CO7 A;  1K9A A;  3MO8 A;  2JUF A;  4E2F B;  4QQ6 A;  2QTV A;  1Q7Y U;  1YCY A;  1I8F A;  4M77 F;  2VV5 A;  4LD6 A;  3RNJ A;  1T0H A;  1M90 R;  4M7A C;  2ZPG B;  1WHM A;  2Z0W A;  1RLQ C;  3SD4 A;  2JNG A;  2MAM A;  5LJ3 h;  5LJ5 f;  2MK5 A;  2D6F A;  4M7A D;  1NJI R;  2YT6 A;  3GIB A;  3FJ5 A;  4PJO C;  2MF2 A;  4AFS C;  3FLG A;  1Q81 C;  2CS7 A;  4LNP A;  1UGQ B;  3LGF A;  4LDV A;  5IH2 A;  2XDP A;  3UA7 A;  4PJO D;  2QQR A;  3MKD A;  4QT7 A;  5CVI A;  3SWN A;  2EYX A;  3EFR A;  4M78 B;  3CC7 Q;  1WXB A;  5GAN 4;  2KYM A;  3F70 A;  2DL7 A;  2W10 A;  2JTE A;  3MEV A;  3CEY A;  1LVK A;  3OS0 A;  2J6K A;  4JZ3 A;  2DK3 A;  4PLL A;  1QCF A;  3CCV Q;  2CH4 W;  3N5B B;  2B86 A;  1BU1 A;  1R0B G;  1FYN A;  3FRN A;  1IHW A;  3MP1 A;  1ZLM A;  2COY A;  1TG0 A;  1VQ5 Q;  2SEM A;  3CQT A;  4J9D A;  2KE9 A;  1ZSG A;  2EQJ A;  1PSF A;  2RPN A;  2JXB A;  3KFV A;  1K8A U;  3CC2 A;  1OV3 A;  5LJ3 f;  1SRM A;  5IXB A;  2CUD A;  3M0Q A;  2RJF A;  1VQM A;  2A3L A;  3DB3 A;  3DB4 A;  4BE0 A;  1M2V A;  3MEA A;  3GLX A;  4JJD A;  3AHU A;  2QA4 A;  1WX6 A;  4FL6 A;  2LNH B;  1M1K U;  3DKM A;  2DD4 A;  3VS6 A;  3VV0 A;  2EQI A;  4JZ4 A;  3TQ7 P;  4RTY A;  5FW9 A;  2GFA A;  4M7A F;  3OYY A;  1GRI A;  5KYW A;  4J9F A;  5J3B A;  2E6Z A;  1WZO A;  4JLI A;  3CC7 T;  1UGS B;  1NPP A;  4F7U E;  5GAO q;  3OYB A;  1VQ6 A;  3KXT A;  2VC8 A;  3OBW A;  1AWJ A;  1WHJ A;  2LX9 A;  3URG A;  3UT1 A;  3OYD A;  1Y57 A;  5LJ5 e;  3CCV T;  5KYU B;  1QCN A;  5D6Y A;  2HKN A;  3JCM h;  1RAB B;  2DX1 A;  2FPE A;  2RK2 A;  2GBQ A;  3CCS A;  4BAC A;  1RLP C;  1S72 A;  1VQ5 T;  4MZM A;  4NL2 A;  3BFM A;  2BE7 D;  2MWP A;  4CC4 B;  3BY7 A;  2BKD N;  2EYQ A;  3EHQ A;  3OA6 A;  3HFN A;  3H41 A;  4LUD A;  3L1A A;  1PCX A;  5GAN g;  1IXD A;  2V1Q A;  3VYG A;  4CC7 A;  3CXC S;  2KR3 A;  4X9C A;  5GAO r;  1JJ2 P;  4M78 D;  3HFO A;  3I35 A;  3CBP A;  1TU0 B;  1OX9 A;  2V8K A;  3NGP A;  2X51 A;  2CP2 A;  1EX4 A;  4GY5 A;  1Z9Z A;  5CIU A;  3SB2 A;  1KC8 R;  2VGN A;  3QWY A;  5C6S A;  2C0I A;  3I56 Q;  4IUU A;  1K4U S;  5LL6 S;  3HL8 A;  4J7F A;  1OU8 A;  3V8K A;  2RHI A;  3S6W A;  4XTZ A;  4Z89 A;  3I55 T;  1BIA A;  1U3O A;  1N27 A;  4FT4 A;  3OB9 A;  3JCM f;  1MGQ A;  5FU6 C;  4PK4 A;  2NUP A;  2OAU A;  2DTI A;  2YRD A;  1LCK A;  4RTW A;  4Z02 A;  1VQ7 A;  2CRE A;  1Y71 A;  2LT4 A;  2RJE A;  4F17 A;  1Z9Q A;  3M58 A;  4E7K A;  3C0C A;  3REB B;  2IPO B;  3MJX A;  3P8D A;  1ABQ A;  1CKB A;  3TVT A;  1WNL A;  1VQ9 A;  3JB9 G;  2KRO A;  2MCN A;  4UC4 A;  2EFI A;  4AFU C;  1H92 A;  1YI2 A;  1YCS B;  4N4G A;  2E70 A;  3EFO A;  1WHH A;  3SEM A;  1YIT Q;  4MML A;  5L8R E;  2KVQ G;  2NUZ A;  2V8J A;  2J6O A;  3E1S A;  1MMG A;  5DLQ E;  2RB6 A;  3ZL7 C;  2F2V A;  3S3M A;  4KH0 B;  1VQ8 Q;  4F7U G;  5J39 A;  3OYC A;  2A08 A;  2EYY A;  2PU9 B;  1Q86 R;  3RMS A;  1K73 C;  2V8I A;  3LYI A;  5IHI A;  2J6F A;  3RKW A;  5HCK A;  3U23 A;  4A4K A;  2K5F A;  2DL3 A;  5GAM d;  1N8R U;  3I56 T;  1VQK Q;  1D1A A;  3L2Z A;  1TWB A;  2JJ9 A;  4A4E A;  3V7R A;  1ZQ1 A;  2M0O A;  4M77 E;  2GFU A;  2O01 E;  3ZBD A;  2OTJ A;  5IHN A;  1Y96 A;  2RJD A;  2EWN A;  2EGE A;  1M1F A;  2E41 A;  4M75 E;  2FG0 A;  1BI2 A;  3CMA T;  1OZ2 A;  1Y7X A;  1AT1 B;  2DTO A;  4TVR A;  2K9G A;  1RAI B;  1FWZ A;  3M0P A;  3RKY A;  1B34 A;  1Q82 U;  1P92 A;  4ZTF A;  1Q81 R;  2NUT B;  2XIC A;  1YWP A;  1K8A C;  4BUG A;  3X24 B;  1KSW A;  2WSE E;  3LWH A;  3OQ5 A;  3MP8 A;  2RQU A;  2VAS A;  1B3Q A;  2LDM A;  2E1H A;  2OX7 A;  4OVA A;  3PMT A;  3VS3 A;  2L3Q A;  5DLO A;  1YIT T;  1Y07 A;  3NFC A;  2RMO A; 
#chains in the Genus database with same CATH homology
 5M9O A;  3PNW C;  5DM7 R;  4J83 A;  4M77 C;  3JB9 I;  3S3O A;  5CKD A;  1VIF A;  3CD6 A;  4RG8 A;  2DXT A;  2L8D A;  4XU2 A;  4M77 B;  4ME7 A;  1KD1 U;  4RKU E;  1VQ8 T;  1G3W A;  1O75 A;  1X75 C;  5D6W A;  2JN0 A;  4II1 A;  4L6V 5;  2L3R A;  3RES A;  4M77 D;  2GF7 A;  3ME9 A;  2RHZ A;  3LX7 A;  4C92 C;  1VQL A;  4L59 A;  4C5E A;  1KC8 C;  4OGE A;  3CC2 T;  3X25 B;  3T9N A;  5CQY A;  3VJP A;  4BY6 C;  4C92 B;  3A8L B;  3OW2 S;  2ZPF B;  4JUV A;  3CCQ T;  4JRP A;  4M75 D;  5GAM g;  4C5H A;  2E10 A;  2ZPH B;  4BY6 B;  1X01 A;  3V7S A;  1H64 1;  5A0D A;  3CC4 T;  2X4Y A;  3M4Y A;  4MZP A;  3DLM A;  2EQK A;  3INZ A;  4A53 A;  3CCU T;  2Y4X A;  3H8Z A;  4JS4 A;  4YTL A;  2RHY A;  1VQK T;  5GAN e;  4FM4 B;  4QVZ A;  3HPW A;  2LVM A;  4FU6 A;  2DD5 A;  4XAX B;  4C5I A;  4C8Q E;  3I55 A;  3KUF A;  3QYG B;  3L2R A;  2X4X A;  3QKJ A;  4QVC A;  4ZGE B;  3M9Q A;  1VQ9 T;  4JRI A;  2QA4 T;  2K2V A;  2FL7 A;  4D6W A;  1I5L A;  2WSC E;  5GMK h;  2CZ1 B;  1JRI A;  2HBP A;  1YI2 T;  4BI8 B;  2P0K A;  3QJY A;  1Q7Y C;  2XG8 D;  4IUP A;  5LJ5 g;  2O4X A;  1X6O A;  4JDS A;  3E19 A;  2E64 A;  3FIF A;  3C4S A;  3SFM A;  4C8Q F;  1UEB A;  2P0P A;  4MDX A;  1LJO A;  4ELY C;  3PGG A;  4XTU A;  5LJ5 h;  2FHD A;  1KHC A;  2DIQ A;  2LQK A;  1YBY A;  3CCE A;  5A0G A;  3UDC A;  4DQ2 A;  2DIG A;  1YIJ T;  3M55 A;  1UB4 A;  3R6O A;  4M7A E;  2X4W A;  4JJN K;  1VQ6 T;  3CCR T;  3VKI A;  4PL6 A;  4ATO A;  2EJG A;  1VIE A;  2Y90 A;  3OSS C;  3L42 A;  2JZ2 A;  5HK3 A;  3JB9 J;  3PFS A;  1UGR B;  3OS1 A;  4OP0 A;  1ZHI A;  3HRS A;  4IUV A;  1HK9 A;  3VUB A;  1VQP A;  4QQG A;  1NPR A;  3G71 T;  4PJO E;  1N9R A;  2DZ9 A;  4N0A C;  5GAM e;  1KC8 U;  3QSU A;  4VUB A;  1BI3 A;  4X34 A;  1YJN A;  4C8Q C;  2RA2 A;  3C95 A;  3OYF A;  2G3R A;  3JAM E;  1U8R A;  1OYX A;  2E12 A;  2F5K A;  4JRQ A;  4C8Q B;  1Q86 C;  3MP6 A;  1S72 T;  3UPU A;  1OI1 A;  2LCL A;  2ZPB B;  3QO3 A;  3WVE B;  2K5L A;  4C8Q D;  4ZN3 A;  3V8L A;  4PJO F;  1BI0 A;  2DXU A;  4XQ3 A;  4GLK A;  3ZEH A;  3M54 A;  4JLG A;  4XTX A;  2BIV A;  3HHT B;  4NS5 A;  5A2Q E;  1WJR A;  2OTL T;  5CKE A;  2K3X A;  2I2L A;  4X9D A;  4V2S A;  3GPL A;  1NE8 A;  5CO7 A;  4M75 G;  1FX7 A;  3MO8 A;  2JUF A;  1Y96 B;  4QQ6 A;  2LC4 A;  5LJ5 d;  2VXE A;  1Q7Y U;  1H3Z A;  1YCY A;  2NLU A;  1I8F A;  3M56 A;  4M77 F;  2VV5 A;  4LD6 A;  5LJ3 g;  1O9S A;  2C06 A;  1EIF A;  1B34 B;  4M7A C;  2ZPG B;  1WQW A;  2YLC A;  1PSE A;  1WJS A;  1I81 A;  3JCM V;  5KCO A;  3OYA A;  3SD4 A;  2JNG A;  2MAM A;  2XI9 A;  2PVD B;  4M7A B;  5LJ3 h;  4C92 F;  5LJ5 f;  2F69 A;  2VGM A;  2YRV A;  1YJW T;  4CRI A;  1VQ5 A;  5GAN 2;  2D6F A;  4M7A D;  3TU4 K;  3GIB A;  2HAX A;  2MF2 A;  4PJO C;  3VU3 C;  3FLG A;  2P0Q A;  2WAC A;  3EAE A;  2MI6 A;  3M57 A;  1Q81 C;  2CS7 A;  1IZ6 A;  3CMA A;  4PJO B;  1UGQ B;  3LGF A;  4LDV A;  2XDP A;  5AYF A;  3X28 B;  2LTO A;  4XTY A;  2KQW A;  2RM4 A;  4M78 C;  4PJO D;  2QQR A;  3QJ6 A;  4M78 A;  3JCM Q;  2EKO A;  2DKG A;  2E5Q A;  2HNI A;  5CVI A;  3EFR A;  4M78 B;  3SWN A;  4F7U A;  3CD6 T;  3OMG A;  2QI2 A;  4QQD A;  1M1K C;  3L2Q A;  1Q81 U;  4F7U B;  5GAN 4;  1QVP A;  4OF1 A;  3BW1 A;  2CYZ B;  2GCX A;  3F70 A;  1V29 B;  5GAN j;  3C12 A;  3MEV A;  2X4J A;  4EDU A;  1Q86 U;  2K5I A;  1RL2 A;  3CEY A;  3OS0 A;  3CCL A;  2MWO A;  3GOX A;  3JCM X;  2DK3 A;  3QII A;  3P8B B;  4J5Y A;  1HXD A;  4L5G A;  4PLL A;  4A4G A;  5I2S A;  3X26 B;  3ER0 A;  3N5B B;  3CCJ A;  5FRN A;  3JRZ A;  1VQO T;  1R8O B;  3JCM d;  4BDY A;  4IUR A;  3G7Z A;  4LDY A;  4C92 D;  4ZGD B;  3TRE A;  4M7D G;  1YIT A;  4LDU A;  3PMI A;  3RMQ A;  1VQ7 T;  3FRN A;  2LNV A;  1QVG A;  2IVW A;  2PUO B;  4MDW A;  4XU0 A;  2KY9 A;  3MP1 A;  5LJ3 e;  1KQ1 A;  5GAN 6;  2K57 A;  3FDR A;  5LJ3 d;  1K9M U;  3MCA B;  2ZCF B;  4A4F A;  2KDS A;  3E9G A;  3M53 A;  3P8H A;  2ZZD A;  3L2U A;  2EQJ A;  4OB0 B;  4M75 A;  1PSF A;  2L5Q A;  2LRQ A;  5GAN 5;  4J7I A;  3TCJ A;  1K8A U;  3JCM J;  2IG0 A;  2M9U A;  5C0M A;  3CC2 A;  4XU3 A;  5CR2 A;  5CKH A;  4E7I A;  2DZC A;  4EMG A;  5GAN 8;  1LNX A;  5LJ3 f;  3JCM W;  4OB2 B;  3OYN A;  2O4X B;  2CZ6 B;  4PKC C;  1YHQ A;  3PIP A;  2RJF A;  3GF5 A;  1VQM A;  2A3L A;  2E6N A;  3DB3 A;  5J26 A;  3DB4 A;  3HSB A;  4BE0 A;  1XNI A;  5KCH A;  5DY9 A;  5EG2 A;  3GNF B;  5GAM j;  4BI4 A;  2RI2 A;  3MEA A;  4O5V A;  2KAF A;  3GLX A;  3A5Z B;  4DOW A;  3AHU A;  5CCA A;  2QA4 A;  1BI1 A;  3L2W A;  4FL6 A;  3CME T;  3CBM A;  2EAY A;  4HCZ A;  3OYK A;  1M1K U;  4BE1 A;  3DKM A;  3LGL A;  3V8J A;  2PUK B;  2DD4 A;  1U1T A;  1XOV A;  3VV0 A;  4E47 A;  1DJ7 B;  4QVD A;  2DEQ A;  3G6E A;  3CXC A;  3FEO A;  4RCB A;  3HP9 A;  3RIR A;  1KQ2 A;  2GFA A;  4M7A F;  2R5M A;  3HRT A;  3L2V A;  3JB9 F;  3OYY A;  2KMT A;  4E7J A;  4FIB A;  4A54 A;  1WPY A;  3PTA A;  1G3Y A;  4KUD K;  5GAO p;  4NL3 A;  4J8O A;  5J3B A;  4M78 E;  4XU1 A;  2E6Z A;  4JLI A;  1YIJ A;  3CC7 T;  4PNO A;  1JBM A;  5GMK e;  1UGS B;  1NPP A;  4F7U E;  5GAO q;  3OYB A;  1QVG S;  3QYH B;  1VQ6 A;  3KBG A;  4M77 G;  3CCR A;  4HT9 A;  3KXT A;  2VC8 A;  2CKK A;  4E7L A;  2OTJ T;  4OMF B;  3OBW A;  1G3T A;  3ZFJ A;  2QTX A;  3CPW A;  2LX9 A;  3URG A;  3CBO A;  3UT1 A;  1W2B A;  4ZTJ A;  4M7D A;  2FB7 A;  2RD1 A;  3OYD A;  2YHT A;  3JCM g;  5IT9 E;  1UGP B;  3M59 A;  4C92 G;  5LJ5 e;  2LCC A;  4M78 F;  3CCV T;  4Y91 A;  4J6W A;  5D6X A;  5I21 A;  2QQB A;  5D6Y A;  4F7U F;  3BDL A;  3JB9 H;  3O8V A;  4BI3 A;  2KSS A;  3JCM h;  2B8A A;  1QP2 A;  3QPH A;  2RH2 A;  2RK2 A;  3I56 A;  2XHC A;  2AHJ B;  4C5G A;  3OYJ A;  3OYH A;  2RHU A;  2QEX T;  1WJQ A;  3CCS A;  4BAC A;  1S72 A;  4RMO A;  3Q1J A;  4HCC A;  1NZ9 A;  3CCM A;  1VQ5 T;  4MZM A;  4NL2 A;  3OYI A;  1KG1 A;  2LT1 A;  2HQX A;  2L89 A;  3BFM A;  4OGC A;  4WF2 A;  5KE2 A;  2QDY B;  1TH7 A;  3NTH A;  2MWP A;  2DXC A;  3BY7 A;  5FLX E;  3JB9 D;  2BKD N;  2EYQ A;  5CKF A;  3V7C A;  2OTL A;  2R57 A;  2DXB A;  2ZPE B;  4XK8 E;  3OA6 A;  3OSV A;  2CGH A;  4BDZ A;  3HFN A;  4DOV A;  2PVO B;  1M90 C;  3NTI A;  1VQN T;  3J7A F;  5GAN 3;  2X35 A;  3HRU A;  3L1A A;  3PT9 A;  1BYM A;  5GAN g;  2A7Y A;  1XTD A;  3LLR A;  3G4S T;  1VQ8 A;  3FC3 A;  1RI0 A;  3SWN C;  3VYG A;  1W4S A;  1NJI C;  2JVV A;  2DO3 A;  3CXC S;  4HA8 A;  2Y4Y A;  2DTH A;  4X9C A;  5GAO r;  5GAN h;  3SWN B;  3QBY A;  4M78 D;  4N4I A;  1D3B A;  2H3J A;  1YJW A;  3MHX A;  4KUI A;  3HFO A;  4PLI A;  2XD0 A;  2DAQ A;  3QG1 A;  1KQS A;  3CCL T;  2KK4 A;  4C0F A;  1VQL T;  3CBP A;  1VQ4 A;  3MET A;  1IRE B;  1JB0 E;  2V8K A;  1G5V A;  2XU8 A;  4J6X A;  3CCJ T;  4BD3 A;  4OB3 B;  4E7H A;  3JCM e;  4CI0 C;  3OYM A;  2P4T A;  3OYE A;  4GY5 A;  3JCM P;  5CIU A;  3OBY A;  3SB2 A;  3CPW S;  2VGN A;  2M1H A;  2DJZ A;  5C6S A;  1W2B S;  1QVF A;  2K3Y A;  4IUU A;  4P5N A;  3SDZ A;  5LL6 S;  2XDB A;  3FJP A;  3HL8 A;  2RK1 A;  4J7F A;  3V8K A;  2RHI A;  4M77 A;  4RG2 A;  2WSF E;  3S6W A;  4XTZ A;  2VUB A;  5A0L A;  1BIA A;  4C8Q G;  5IAY A;  3I55 T;  3X20 B;  1N27 A;  4B9X A;  1WQ7 A;  2D9T A;  3A8O B;  4FT4 A;  3OB9 A;  3UWN A;  3NTK A;  3JCM f;  4M75 C;  1MGQ A;  3M4G A;  3WVD B;  3GP8 A;  5FU6 C;  4C0D C;  2CZ7 B;  4C92 A;  2OAU A;  5GAO l;  4BE2 A;  2DTI A;  1M4Z A;  3JSC A;  4M75 B;  4EMK C;  1MHN A;  5FU6 B;  4C0D B;  4EMK A;  2RJC A;  1N8R C;  5HKC A;  2QQS A;  4IUT A;  2R5A A;  3A8H B;  4C0Z A;  4EMK B;  3CCQ A;  1VQO A;  5FRM A;  1YHQ T;  4M7D E;  1GXI E;  4Z02 A;  1VQ7 A;  2R58 A;  1VQM T;  1Y71 A;  2LT4 A;  3S3N A;  3CC4 A;  5KE3 A;  5GAN 7;  2RJE A;  5IN1 A;  4A4H A;  5HK0 A;  4FSX A;  3HKS A;  5GAM h;  2QQA A;  2DPP B;  3CCU A;  4KBM B;  1ZBX A;  3M58 A;  2RO0 A;  3OYL A;  4E7K A;  5I2M A;  2QXF A;  5GAN d;  1VQK A;  2HQE A;  5FU7 C;  1YJ9 A;  4MZT A;  2F5T X;  1G3S A;  2ZGW A;  1M90 U;  2RI5 A;  3P8D A;  5GMK i;  5FU7 B;  1WNL A;  1VQ9 A;  4M7A G;  3JB9 G;  4M7D F;  1M8V A;  5HY6 A;  1NJI U;  4UC4 A;  2EQU A;  2EFI A;  3H6Z A;  1YJ9 T;  1YI2 A;  3TEE A;  5GMK j;  1M1G A;  4BB7 A;  3RER A;  4N4G A;  1Q82 C;  2E70 A;  4C0G A;  2XDD A;  3ASK A;  1SSF A;  2PVG B;  5GAN f;  1BIB A;  3G6E T;  1VQP T;  2E65 A;  1KQS S;  1I4K 1;  5KH6 A;  4PJO G;  5CQX A;  2EJ9 A;  5CAI A;  4MML A;  5L8R E;  2XK0 A;  2KVQ G;  3OMC A;  1YJN T;  1WGS A;  2D0Q B;  4R55 A;  3CCE T;  5LJ5 j;  4IUQ A;  2QQ9 A;  2V8J A;  3E1S A;  5DLQ E;  4KUL A;  2RB6 A;  4M78 G;  4RCC A;  3S3M A;  3MEW A;  3OYG A;  2JTM A;  2MMP A;  4LD9 K;  2XID A;  4Y28 E;  4F7U G;  1QVF S;  5J39 A;  3OYC A;  3FB9 A;  3WXM B;  3CME A;  1OZ3 A;  1JJ2 A;  3OY9 A;  2PU9 B;  1FXX A;  3LW5 E;  3LH0 A;  2VXF A;  1U1S A;  2DVE A;  2M16 A;  3RMS A;  2HD0 A;  1K73 C;  2V8I A;  4M7D C;  3LYI A;  4NOY A;  4ELZ C;  3RKW A;  1XQH A;  3A8G B;  4M7D B;  3VYH B;  4N0A A;  3E9F A;  4A4K A;  3G71 A;  2K5F A;  3RUX A;  3VUZ A;  4HKE A;  4M7D D;  1KHI A;  5GAM d;  4C8Q A;  3RKX A;  3I56 T;  1N8R U;  1KD1 C;  1M9S A;  3DLL A;  2YLB A;  3L2Z A;  3MEU A;  2PQW A;  4QW2 A;  3CCS T;  3OS5 A;  2EIF A;  2JOY A;  4A4E A;  5GMK m;  3CC7 A;  2LQ8 A;  1BKB A;  2BUD A;  3V7R A;  3C94 A;  3CCM T;  1ZQ1 A;  2M0O A;  4M77 E;  1N6A A;  2GFU A;  2K4Y A;  4XTV A;  3OS2 A;  4FT2 A;  2O01 E;  3OW2 A;  3ZBD A;  4JRK A;  4HCB A;  2OTJ A;  5CKB A;  2FYK A;  2VYT A;  5GAM f;  5FRO A;  1Y96 A;  2RJD A;  2EWN A;  1N9S A;  2ZPI B;  4B9W A;  4ZN1 A;  1M1F A;  3LWI A;  2E41 A;  4M75 E;  1VUB A;  3QHS A;  4C92 E;  3QZ9 B;  1BI2 A;  3CCV A;  2EQM A;  1OZ2 A;  1Y7X A;  4O6J A;  4DA4 A;  3CMA T;  2DTO A;  4N4H A;  1K9M C;  4TVR A;  1FWZ A;  3RKY A;  1B34 A;  1Q82 U;  1P92 A;  2RHX A;  3CPF A;  4ZTF A;  3JCM b;  2XIC A;  4EMH A;  5GMK l;  4M7A A;  2CZ0 B;  3QUI A;  1K8A C;  3J81 E;  4BUG A;  3X24 B;  2QEX A;  5CK9 A;  4ZGJ B;  3GNG A;  4M75 F;  2WSE E;  4KT0 E;  2XKO C;  4JS5 A;  3LWH A;  1QW1 A;  4OB1 B;  3J80 E;  3OQ5 A;  5LJ3 j;  4HT8 A;  3BDU A;  4R56 A;  4IKF A;  1QP3 A;  2RI3 A;  3MP8 A;  4Q5W A;  1VQ4 T;  4J6Y A;  1D3B B;  2EJF A;  4EPC A;  2JTF A;  4PJO A;  2GQV A;  1M5Q 1;  2LDM A;  1AHJ B;  5GAO m;  2E1H A;  3QXE B;  1LOJ A;  3QZ5 B;  4XTW A;  1JJ2 S;  4OVA A;  4LDX A;  1VQN A;  3M5A A;  3PMT A;  5GAO n;  1K73 U;  5DLO A;  1YIT T;  3A8M B;  1Y07 A;  3NFC A;  4MMK A;  3QDR B;  4LDW A;  3PIO A;  3JCM c;  2FVU A;  3G4S A;  3EFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...