4P5NA

Structure of cnag_02591 from cryptococcus neoformans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
74
structure length
74
Chain Sequence
b'MSVQDKQGQNINVGDTVYTPYRGGKHEGQVADIVTTKEEAAEKGVKNPPKVLFTDQNNKDVAHNPGTLTDLDKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein CNAG_02591
publication title A Small Protein Associated with Fungal Energy Metabolism Affects the Virulence of Cryptococcus neoformans in Mammals.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Structural genomics
total genus 19
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11160 Hva1_TUDOR Hypervirulence associated proteins TUDOR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1060 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4p5nA00
4P5NA
chains in the Genus database with same CATH superfamily
2ENMA 3HP9A 5HY6A 1V29B 4AFUC 2COWA 3S3MA 1X01A 1PRLC 1FWZA 2B8AA 4JZ3A 4RUGA 1IB8A 4N4IA 3EG9A 3UDCA 3HTRA 5GMKi 1ZA1B 5C0MA 2RN8A 1OU9A 1M30A 5I2MA 2MK5A 3SHWA 4M7AB 2A28A 4IUPA 4BDYA 1RAIB 3ZFJA 2DL4A 1E6GA 1YJWQ 5HKCA 5AYFA 2MI6A 2EYXA 5I2SA 1VA7A 5FU6B 1QVGP 2KI7A 2MF2A 1M8MA 3UWNA 4M77F 1M2OA 4M75A 3V7CA 2KEAA 1SSFA 1PKSA 1F1BB 3JCMe 3BY7A 1KFZA 3CCMQ 5CAIA 1KHCA 1QP3A 2XDPA 2RK2A 3SWNA 2R57A 3F70A 4E7SA 3H0FA 3EGUA 3MJXA 2G6FX 4XU2A 1K0XA 4HKEA 1UGRB 3EG0A 2XIDA 5HCKA 5GAOq 4LE9A 3E1SA 4AG2C 3CCMT 2LQNA 1Q82C 1ZSZC 1N6AA 1AVZC 4IUQA 4O6JA 5IN1A 4A4EA 3LH5A 1UG1A 5IT9E 1NJIU 3U23A 3VS5A 3LGFA 3A8HB 5FWBA 3CD6A 1AD5A 3QPHA 4D6WA 1YCSB 5CKEA 2EQUA 3I55A 3CCVA 1MGQA 1M3BA 2K5IA 2H3JA 4KUIA 1IHVA 1U06A 2E65A 4ORZA 1TUGB 2FPDA 1RI9A 2QEXA 2LMJA 2ZPGB 3CPFA 3JCMV 3WXMB 3L2WA 1KK7A 2DIQA 1IXDA 4Z02A 1IRXA 5CCAA 2VYTA 4RTVA 3LYIA 1VQNT 1GFCA 3JCMc 4MMKA 4B9WA 3QUIA 2PQWA 2KYBA 4NOYA 4PFOA 2ED1A 4HVUA 3SD4A 1KJWA 3VYGA 3NFCA 4IUTA 2BZYA 2NUPA 3OYHA 1UE9A 3EHQA 3VV0A 2V8JA 2YRVA 3RR6A 1C6VX 1H3HA 4R0KA 4HCKA 4PLIA 4C5GA 3INZA 1XQHA 4QVCA 1K8AU 2BTTA 6AT1B 1NZ9A 2M1HA 2JM9A 1EZZB 4OMNA 5CQXA 1JXOA 2BUDA 1M90C 1YHQA 3CXCA 1Q86R 1K73R 4PKCC 1U5SA 4M78C 4PLLA 1WXUA 4C8QE 4PJNA 3OBWA 3JAME 1WYXA 1QW1A 3CCRQ 2HZYA 2Z0WA 3GIBA 3RERA 2EKHA 2X3WD 1K9MC 3OYKA 1B7TA 1ZUUA 2M02A 2AZSA 3CBOA 3PVQA 4FT2A 1KQ2A 2HD0A 4P5NA 3OW2A 2CSQA 1R8OB 3HSBA 2ED0A 5FRMA 3REBB 3EGDA 3CCRT 2LX9A 2CZ7B 2GQIA 2BKDN 3M4GA 5GAMj 4N4HA 2RM4A 3FLGA 2V1QA 1BCOA 4WF2A 3WVDB 2FZGB 3X28B 2K3BA 5CO7A 2JUFA 4RTWA 2KVQG 4LD9K 4J9BA 2RQVA 3EFOA 4BDZA 3CCEA 2F2XA 2K2MA 2RH2A 2CUBA 2CUDA 2KROA 3NPFA 1VQMQ 1VQ4A 4EMGA 2OTJQ 1Q81U 2RF0A 3JCMd 3QSUA 1O9SA 3JCMb 4KBMB 1ZQ1A 5GJVB 4C5HA 4C8QD 2JM8A 1VYVA 4J9IA 1M8VA 3MEAA 1VQMT 2OTJT 4M77A 3M9QA 3CXCP 1KQSA 4JRPA 2RJFA 4C92G 2E6ZA 5GANg 4Z8AA 3QYGB 1QCFA 3ME9A 1PC0A 4PJLA 3VYHB 5EG2A 1ZA2B 1YIJA 2EKOA 4OB3B 3HL8A 4M7AC 1CKBA 5DM7R 4ZGEB 5LL6S 5A0DA 5FU6C 3OW2P 1AWWA 1YN8A 1WXBA 5LJ3g 1RACB 2CSIA 4FYVB 3KXTA 1VQ7A 5FU7B 2GF7A 4XU1A 4HCBA 2YRDA 1PHTA 2K3YA 3OBYA 2RPNA 3ULRB 5KE2A 5CKHA 1QVPA 2PTKA 1QVGS 1MMDA 2O4XB 4C92E 4M77G 2KBTA 1DJ7B 3H0HA 3JCMg 3OYGA 2QQSA 2OX7A 1LJOA 3JB9H 4HA8A 3G71Q 2LJ3A 3TQ7P 2R58A 2L5QA 3CBMA 1YITA 1G83A 5LJ3f 4DEYA 2XDDA 4XU0A 3OYJA 3G71T 3CCQA 4RCCA 1TWBA 3RUXA 4AFSC 4ZNXA 3I56Q 3C95A 1Y96A 4ZN1A 4CC7A 5LJ5f 1KQSP 2YUQA 4FIBA 3S3NA 4M75B 3GNFB 2ZPIB 2LJ1A 5GMKl 2RI3A 4NL3A 5DLOA 4XTUA 2KMTA 4IUUA 3SWNB 1QLYA 2LNVA 3JB9J 3JCMX 3I56T 3M58A 1M1FA 1FMKA 2E6NA 4BE0A 2F69A 1IO6A 1MNEA 2WACA 4M7DE 2ROTA 2KRSA 3A8LB 1G8XA 3CC2T 5CIUA 4Y92A 3RNJA 2COYA 1YP5A 2LVMA 1A0NB 1KG1A 5KYUA 1K0SA 1Q7YU 4PK4A 1X2QA 1QVFS 2K3XA 5GAOm 2JTMA 1BIBA 3G4SA 4M78D 3CBPA 1Q7YR 1UDLA 3DKMA 1V76A 1SPKA 4E47A 2JJ9A 1B3QA 3EFRA 2K7AA 5FRNA 1ZSZB 1ABQA 2M51A 1VQ8A 2EYQA 4HT8A 1I1JA 2K9GA 4JRKA 2FVUA 2K4YA 3C12A 1FMVA 4LDXA 1RI0A 4IURA 4PJOC 5CKBA 3PNWC 3V8JA 4XTXA 4C8QF 2DETA 2C0IA 4E6RA 1T3SA 1TUDA 2OTLA 4RMOA 3UPUA 2CZ1B 3VRZA 1NLPC 1NYGA 5KYYB 1OPLA 2XD0A 4IKFA 2NUTA 4M7DD 2V8IA 4ELYC 3CMEQ 4HCCA 2CKKA 2RB6A 5KYWB 1UJYA 2DX1A 3MP8A 3OS0A 3PIOA 1QCOA 4ZTFA 2L89A 2NYSA 3OYNA 4X34A 2RQWA 3CEYA 2RHUA 2EJFA 1QKXA 3PT9A 5CKFA 2MMPA 3CMET 3EH2A 1AWXA 2HL3A 3FDRA 2Y90A 4VUBA 4O5VA 3TSZA 2XDBA 1RAFB 1I0CA 2V26A 4DQ2A 3JCMQ 3QZ9B 2LRQA 2MOXA 1VQPT 2KR3A 2O9SA 1VQ5A 3VS0A 3M5AA 2VGNA 4M7AD 2EJGA 3PMTA 3PGGA 4M78B 5GAOp 1KD1U 2WSFE 2YLCA 4JLGA 2EFIA 4RTXA 2J05A 5GAOr 2NWMA 3CCMA 1LCKA 3FB9A 1D0YA 1BK2A 3EFOB 1HD3A 5FU7C 1NPPA 2A36A 2J6OA 2DJZA 2QXFA 4EMKC 3QHSA 2YRCA 1RL2A 2AT1B 2EGCA 2KT8A 4C5EA 2DYBA 3X24B 5DLQE 2RMOA 3OW2S 2COZA 4N0AC 3HKSA 2QTXA 2A37A 4FYXB 4NL2A 5CK9A 1X27A 4MDWA 5KCOA 1SRLA 2SRCA 5GAMh 4LN2A 3GF5A 1Z9ZA 2KDSA 3I35A 4FSXA 1HK9A 3VS3A 1GFDA 4EPCA 1PSEA 3OYLA 1VQNA 1B34A 2CGHA 3O5ZA 2AKLA 1VQOQ 2EW3A 2CP7A 4OMMA 4C92F 5GANe 1M1KC 2C0TA 4GLKA 1PWTA 1M2VB 2L3PA 5CR2A 1GXIE 1QKWA 4XQ3A 4AG1C 4J5YA 4QW2A 1GL5A 1XTDA 1VQOT 2A08A 4AT1B 2F5TX 3O8VA 3SWNC 4DOVA 5IAYA 4KH0B 4LNPA 2W10A 5LJ3e 2QYZA 3META 1K9AA 2EQJA 4F14A 1LOJA 3M55A 1KQSS 4JUVA 3FC3A 1Y7XA 4JS4A 1Q82U 1UB4A 4PJMA 1WQWA 4HCZA 1G3TA 1WHHA 5GJWB 3QJYA 5GAN5 3SFMA 1QVFA 3UF4A 2MPXC 1PG5B 4KULA 4QQ6A 2HBPA 1WHMA 1OOTA 2EBPA 4N4GA 4E7HA 3QXEB 2A3LA 2RQRA 1S72Q 1R77A 2ZPEB 3QO3A 1UHFA 2XKOC 1YJWT 2EAYA 3RMSA 1TS9A 1D0XA 3L2ZA 1ZLMA 3CCRA 1JU5C 4C0DC 1Y96B 3QYHB 4C8QA 4M7DF 3SB2A 2VASA 4OB0B 4UC4A 2OJ2A 2MCNA 2K2VA 4JJCA 2XK0A 1U3OA 4XAXB 1K1ZA 2JMAA 4PFPA 2LT1A 1TOVA 3M0SA 1OULA 4ANJA 3OS2A 4A4FA 3UATA 4J9HA 2LNHB 2GFAA 4EDUA 5GMKe 5FROA 1NJIR 1PCXA 2L3RA 3CCLQ 2LX7A 2JXBA 4BY6C 2KYMA 4FYWB 1QMCA 1VQMA 2RHYA 2KSSA 2OTJA 4CI0C 5KYUB 2D9TA 3DLMA 3OYCA 5DY9A 4C8QG 4RTZA 2FG0A 1M90U 2F5KA 1VQ6A 1FMWA 2DLPA 2QI2A 5KE3A 5J39A 3CC4Q 4TVRA 4BACA 3VU3C 1N9RA 3VS2A 2DEQA 1QVFP 1K9MU 5HK3A 2DEUA 3GNGA 1YI2Q 3QDRB 2FZCB 3GLXA 3THKA 3JCMW 2DRMA 3CC4T 3QIIA 2JNGA 1GCQA 1U1SA 2D0NA 1M1GA 3VUBA 1X6BA 4GY5A 3NTKA 4BE1A 1K8AR 1YI2T 1WZOA 1JB0E 4FCYA 4B6MA 1BBZA 1H641 4JZ4A 1MV0B 4F16A 2AHJB 1N9SA 2NUTB 1J3TA 1I81A 1AOJA 2X4YA 4RG8A 1WQ7A 3E9FA 5GANd 3JSCA 3EGXB 1U1TA 4A4HA 2ZAEA 1YWPA 3DB4A 2GTJA 1OYXA 1VYTA 3S6WA 2AZVA 1YNZA 3VS1A 1PM3A 4PJOB 2X4WA 2MYSA 1VOMA 3G71A 2HBWA 3LGLA 2JVVA 4C92A 3EG2A 1Y57A 1PD1A 1UECA 1WNLA 2OI3A 2LC4A 5LJ3d 3DB3A 2M0OA 2JN0A 4J7FA 4M77C 2DNUA 4IUVA 2ATCB 4KUDK 3M57A 1I4K1 3GPLA 2M16A 1Q86C 1K73C 3HRTA 5D6XA 1N8RU 2HSEB 4RTUA 1UEBA 5LJ5d 3HRSA 2CP5A 2HMAA 3VS7A 3I56A 3OS1A 2O88A 2ROLA 1OPKA 2MAMA 1W4SA 2YLBA 1D1BA 3CD6Q 1N8RR 1RAGB 2LDMA 1SHGA 2JZ2A 3P8HA 4AMCA 4M75D 1Q81R 5KYXB 3FIFA 1N27A 3CC2A 1H92A 1S1NA 1UGVA 1PKTA 1X43A 4RTYA 2I2LA 3EG3A 2YHTA 3X25B 1TTHB 4Z88A 1D09B 2O9VA 1EIFA 5CKDA 3HRUA 4FL6A 1QP2A 4QT7A 1MV3A 2V1RA 1BI2A 2A0FB 4J9CA 2AKKA 4M7DA 4R55A 3QJ6A 4F7UG 1MMGA 3M0PA 2RQUA 1WFWA 2KGTA 5L8RE 4ZTJA 4EMKB 3T9NA 3ER0A 4II1A 2FEIA 2HAXA 5LJ5g 4D8KA 2LJ0A 3PFSA 3Q1JA 3NTIA 2FO0A 2DTHA 3TSWA 2BE9B 4OMOA 2D8JA 2L3SA 3CCJQ 2DF6A 1N5ZA 2DO3A 3MO8A 4CC3A 4ATOA 3X20B 2LQKA 2E3HA 2D6FA 2KXDA 2EWNA 3EG9B 3L2UA 4M78E 4M7DG 4F7UE 2E10A 5ECAA 1H3ZA 4KGXB 1WHKA 3CCJT 2F1LA 1X6OA 2L2PA 3IQLA 1TUCA 2GCXA 2JOYA 3AT1B 2JS2A 3CMEA 2YDLA 3EAEA 3N5BB 2KK4A 2G3RA 1PSFA 5GAN7 1M4ZA 1KC8C 3TREA 2QDLA 2GNCA 3JB9D 4F04B 4LUDA 3UT1A 1VQPA 1YJNQ 3CCEQ 1MHNA 1WA7A 2AIRB 4OMLA 1P92A 8ATCB 1VQ4Q 2BIVA 2DBKA 2E5KA 2RHIA 3M54A 4OMQA 2ZPHB 2IIMA 2PU9B 1YJNT 5FW9A 4BB7A 4M7AG 1MNDA 1WIEA 1ZBJA 2XG8D 1OU8A 3ASKA 3NTHA 3EFSA 5GAOn 1EFNA 1LPLA 2GFUA 2ESWA 4C5IA 4A54A 2CZ0B 5IH2A 1NEBA 4DBRA 1JXMA 1NM7A 2LCCA 5GANh 3VRYA 4C0DB 4FT4A 3FJ5A 1CSKA 5EC7A 1OQKA 2LQ8A 4ZGJB 4Y91A 4XTVA 1XJWB 3RESA 3LW5E 2RJCA 5CQYA 5IHIA 1YJ9Q 1VQ7Q 1D1CA 2RO0A 3PIPA 5LJ3h 1ZUYA 4M7AE 2A7YA 1PNJA 1VIEA 3NMZC 4OGEA 4X1VA 1JO8A 3OYIA 3GP8A 2MWOA 4M75F 3J81E 2NUPB 3MCAB 1T0JA 2PVOB 1AZEA 4HXJA 3LWHA 1VQKQ 2DL7A 1NBEB 1YJ9T 2BZ8A 2GTOA 2QGGA 3A8GB 4BY6B 4Y28E 2HKQB 4M77D 3MEUA 3OYBA 4XTWA 2DJQA 1VQOA 3JCMh 5HK0A 2OAUA 1Q7YC 3QKJA 5I22A 5IXBA 1FXXA 1VQKT 1WLPB 1YITQ 3PE0A 4L5GA 2DM1A 1OI1A 3S3OA 3JCMP 2E1HA 1AZGB 2X51A 4ME7A 4BI4A 5GAMf 1E6HA 2DTOA 5M9OA 2H8HA 7AT1B 3A98A 3JV3A 2P0KA 2X3XD 2GQVA 4MZMA 2JT4A 5KYNA 1XNIA 2FB7A 4HT9A 3LX7A 2CREA 3EHRA 3P8BB 2RD1A 3CCUQ 5KCHA 1RAAB 4J6YA 1HYOA 2KRNA 3EGDB 1VUBA 3RDVA 1YJWA 4B9XA 5GMKh 3MP6A 4AFQC 4C92B 4J9FA 1AWOA 1HSQA 3URGA 1KIKA 3CCUT 2EQMA 4M4ZA 2E12A 2PUKB 2X9HA 1SHFA 1KD1R 1BKBA 2ZPFB 1WPYA 3RKYA 1UJ0A 5GMKm 2HNIA 5GAN8 3PTAA 4DA4A 2EVRA 2EYZA 2FL7A 3RBBB 2OAWA 3OY9A 1VQ9Q 1BI1A 4Q5WA 4KH1B 1M1KU 3QBYA 3ZEHA 1VYUA 3CCSQ 4FU6A 5J26A 4A4GA 3RIRA 2HCKA 4LDVA 2RHXA 1M1KR 2DILA 3JB9F 2HSPA 3X26B 5A2QE 2E5QA 1VQ9T 1Y0MA 4M77B 4LXCA 2LT4A 4E7JA 2BE7D 2HL5C 1KHIA 3CCST 5FLXE 3CPWS 3CQTA 2DZCA 4PFZA 4OGCA 4CRIA 2DZ9A 2VVKA 2QA4Q 2F2WA 3FJPA 2DXTA 2RNAA 3MEWA 1G5VA 2LP5A 2VGMA 5GAN4 2DRKA 2K57A 5IHKA 1ZBXA 1WHLA 4E7ZA 3A1PA 3GBQA 3BDUA 2CH4A 3KFVA 3NHNA 4KT0E 3CC4A 1TU0B 2QA4T 3PVLA 5D6WA 2M0YA 4PJOE 1UTIA 4WTOB 2QAZA 4M78F 3I5SA 4F7UF 2ABLA 3HFNA 2KXCA 4RKUE 1BIAA 1JQQA 1YI2A 4C8QC 4F17A 2BZXA 4CC2A 2XU8A 1AWJA 3TU4K 2K6DA 2VC8A 3C94A 4QQGA 5LJ5e 3A5ZB 1PD0A 3FRNA 1G3SA 1QQJA 1I07A 1Q82R 4RCBA 2EPDA 4GLMA 2XICA 2HEQA 1SRMA 2WSCE 1SSHA 4JJNK 1SG5A 5GANj 1RAHB 3H0IA 1VQLQ 4R56A 1W70A 3L2QA 1OX9A 4RG2A 1UFFA 2YUPA 4QKUA 2F2VA 1TSFA 2WSEE 4IIMA 4ESRA 2J06A 2YT6A 3VUZA 2QASA 2DL3A 4Z89A 1W6XA 4OMPA 4XU3A 1D3BA 1JJ2S 1VQLT 1S72T 3I9QA 4PNOA 5LJ3j 2QDYB 5AT1B 2O2OA 3TVTA 4E7IA 2NUZA 2KT1A 2PUOB 1W2BS 2P0QA 5LJ5j 4PJOD 1M3CA 5FWCA 1CKAA 3VS6A 1I8FA 1UGSB 4KGZB 2K5FA 3KBGA 1XOVA 2SEMA 1RADB 3M0QA 3G6EQ 1GRIA 3CC7Q 1GCQC 2EQKA 4JS5A 2LQWA 2YUOA 3CMAQ 1BI0A 4M75G 4M7AF 2R5AA 2VXFA 1G3YA 4MDXA 4GBQA 3CCLT 1G2BA 1YWOA 5GAN3 1VQNQ 4HVWA 2YXYA 2CT3A 1ARKA 2PZ1A 2D0QB 4J6WA 3SDZA 3G6ET 1M90R 3CC7T 3OA6A 3J80E 1ZX6A 2FRYA 2EIFA 1ZSZA 2HDAA 3CMAT 1SF9A 4X9DA 1MMNA 1RLPC 5L23A 1YFNA 1LVKA 2P4TA 1VQ5Q 1K9MR 2GGRA 4K11A 1NPRA 1WJRA 2H3EB 2DFUA 5GMKj 1NJIC 4J9GA 1KQ1A 1BU1A 2RJEA 2QQRA 2P0PA 5IXFA 3UA7A 1BYMA 4C92C 9ATCB 5GAMe 4M75E 5KYYA 1VQ5T 5I11A 2YUNA 2KQWA 3TCJA 2CP2A 1WHJA 2RHZA 3A8OB 3H9NA 3QZ5B 1Q86U 1K73U 2IVWA 1D1AA 1T0HA 3H6ZA 4FM4B 4A63B 3M53A 5KYWA 4OB1B 4YTLA 3M56A 4MZTA 2JTEA 2R5MA 1IREB 2M9UA 5CVIA 2CZ6B 3VKIA 3BE3A 4OVAA 1R0CB 1W1FA 2HQEA 1OZ2A 4DOWA 3CCJA 2Y4YA 2JW4A 1YBYA 4OF1A 1EX4A 2E64A 5D7UA 2KAFA 3OB9A 3H41A 2FZKB 3CPWA 3L1AA 2QTVA 3OMCA 1K8AC 3H8ZA 2DERA 3FEOA 1QCNA 5GAN6 4JPBW 4ZN3A 2D8HA 2RA2A 1KSWA 4M78A 3RMQA 4KRTA 4F7UA 4OP0A 1SKUB 4D8DA 3JB9G 3DLLA 1IGUA 4OMFB 4M7DC 3I55Q 1C1AA 1Z9QA 4J8OA 3CCVQ 1YCYA 1M5Q1 5GAOl 1YJNA 1AEYA 2E3IA 3VJPA 1WJSA 2L3QA 1Y71A 2X4JA 1GBRA 4EIKA 2QEXQ 1RLQC 3CD6T 2X35A 4DBFA 2QK0A 3V8KA 3TEEA 2B86A 2DBMA 1UHCA 2RJDA 3R6OA 1WXTA 4HVVA 1VIFA 1VQ6Q 3I55T 4E7KA 3CCVT 4E2FB 3MKDA 1B07A 2CP3A 1G3WA 4IIOA 4QQDA 4PL6A 3JB9I 3ZL7C 3P8DA 1WGSA 2QEXT 2QG9B 2EQIA 4JDSA 3OYAA 1FYNA 1VQ6T 4M78G 1HJDA 4NS5A 2DK3A 1V1CA 1N8RC 4PJOF 4FW1A 1B34B 1ABOA 4LD6A 5A0GA 1NYFA 4BD3A 4JJBA 2L8DA 3M0UA 1Q81C 3M4YA 1JRIA 1RUWA 4C0GA 4MMLA 1JJ2A 4J9DA 1YHQQ 1M2VA 2FYKA 3CPWP 2EJ9A 1LNXA 5IHNA 3PMIA 1YJ9A 1U8RA 2ZCFB 1RABB 1M27C 5D6YA 1KC8U 2JS0A 3QG1A 3LLRA 2EGEA 2C06A 2HQXA 3E19A 4LDYA 2DKGA 1W2BA 1KC8R 4XK8E 2EGAA 1MUZA 1YHQT 1IHWA 4J6XA 1RAEB 3R6NA 5GANf 1VQKA 4M7AA 3OYMA 2FHDA 3EG1A 2DA9A 2RK1A 3A8MB 3J7AF 4KGVB 1BB9A 2DE0X 2VB6A 3GOXA 4X9CA 3MHXA 2YSQA 2RI5A 1Q95G 1OZ3A 3E2UA 1D0ZA 2RQTA 2LZ6B 5GAMd 1AHJB 2DTIA 3V7SA 2JMCA 2CH4W 1FX7A 2DXCA 3QDFA 3V7RA 1NG2A 3BW1A 1OEBA 1C0MA 3AHUA 2MWPA 2DVJA 4JRQA 4C8QB 3G1JA 1BI3A 4V2SA 2J6KA 1MMAA 4M77E 1D3BB 2QQ9A 2YWWA 1GCPA 1NE8A 2MIOA 3CCUA 4DBHA 2I0NA 3JCMf 1M3AA 3CCET 3QWYA 2CT4A 2CP0A 3CC2Q 1TG0A 1VQ4T 1X6GA 1X69A 2CYZB 1WJQA 1JJ2P 1SEMA 3UA6A 2IG0A 1JBMA 2RI2A 2QGFB 4LDUA 2QQAA 2VUBA 2C0OA 1UGPB 2DD4A 2EYYA 2ECZA 2VWFA 4C92D 1YIJQ 3M0TA 4CC4B 4PJJA 2DXUA 1W2BP 2O31A 4FSSA 1IGQA 1OV3A 2VKNA 1VQ9A 4A53A 4DEXA 2FRWA 2GBQA 2DVEA 2HQHA 1YIJT 1R0BG 3CCSA 2DL8A 3MPUB 3I5RA 3MEVA 1E7OA 2PVDB 5GAMg 2ZPBB 1AT1B 2K5LA 2JTFA 1M9SA 1NLOC 3L2RA 3OYYA 4XTYA 3OQ5A 1I5OB 2AK5A 4J83A 2DMOA 5LJ5h 5A0LA 1VQ7T 2D1XA 1H8KA 4BE2A 1HXDA 1ACMB 2KRMA 3VS4A 3RKWA 2P4RA 3HFOA 2FPEA 1ZHIA 2XMFA 3WVEB 1TH7A 3M59A 3C0CA 3SEMA 2X4XA 3HHTB 2QA4A 1PRMC 3G7ZA 2DL5A 2LTOA 4ZGDB 4LUEA 3OSSC 4DBQA 2QQBA 2XHCA 2LCLA 3OSVA 3OYDA 2W0ZA 2NLUA 2PNIA 2ZZDA 3OS5A 3EH1A 1WDXA 3CCQQ 4C0FA 2VV5A 3OYFA 2DIGA 3RKXA 1ZSGA 4WCIA 1IZ6A 3KUFA 3LH0A 5I21A 3EGXA 1YITT 1NEGA 1X75C 1UGQB 2LCSA 1QWFA 3REAB 3CCQT 2E4HA 4PJOA 5J3BA 1VQPQ 2DD5A 1GBQA 3BFMA 2K79A 4JJDA 1K76A 4EMHA 4QVDA 2PVGB 1UUEA 1ZUKA 4FW2A 2L0AA 1TXQA 3LWIA 2EYWA 1WI7A 1X2KA 1Y07A 2E70A 5KH6A 1VQLA 1S72A 1BCMA 4BI8B 2DPPB 2V8KA 4J9EA 1WHGA 2VXEA 1K4US 4BUGA 2KY9A 3OYEA 2CS7A 3L42A 4QVZA 2P84A 4F7UB 3HPWA 3QWXX 1WX6A 4BI3A 4LDWA 3CXCS 3G4SQ 4E7LA 2CDTA 5KYXA 4JRIA 1JEGA 4RTTA 3MP1A 4PJOG 8AT1B 4ELZC 3L2VA 3E9GA 1QVGA 1I5LA 2DAQA 4XTZA 1T3LA 2E41A 2KNBB 3G4ST 1VQ8Q 3ZBDA 2DYIA 1QWEA 2O01E 3JRZA 4L59A 2DXBA 3OMGA 3CCLA 4J7IA 2J6FA 2CP6A 4OB2B 4MZPA 1KD1C 4AFZC 3G6EA 3CC7A 5C6SA 4M7DB 2OTLQ 3CMAA 1VQ8T 2HKNA 3JCMJ 2FPFA 2KE9A 4C0ZA 2ZGWA 4EMKA 1O75A 3NGPA 1OX8A 3M0RA 3BDLA 2Y4XA 4FYYB 2OTLT 4N0AA 4JLIA 2O4XA 4A4KA 2XI9A 2J7IA 4M75C 3V8LA 2IPOB 4L6V5 3D7SB 3C4SA 5GAN2
chains in the Genus database with same CATH topology
3HP9A 4IKFA 5HY6A 4M7DD 1V29B 2RHZA 3S3MA 1X01A 2V8IA 1FWZA 4ELYC 3A8OB 2B8AA 3QZ5B 1Q86U 1K73U 2IVWA 3H6ZA 2DO3A 3MO8A 4FM4B 3M53A 4ATOA 3X20B 4HCCA 2LQKA 4OB1B 2CKKA 4N4IA 4YTLA 2RB6A 3M56A 3MP8A 4MZTA 3UDCA 3OS0A 2D6FA 2EWNA 1IREB 2M9UA 2R5MA 5CVIA 3PIOA 2CZ6B 5GMKi 3L2UA 5C0MA 3VKIA 4M78E 4ZTFA 4M7DG 5I2MA 4F7UE 4M7AB 2E10A 2L89A 4OVAA 4X34A 3OYNA 1H3ZA 4IUPA 4BDYA 3ZFJA 3CEYA 2RHUA 2EJFA 2HQEA 3CCJT 1OZ2A 4DOWA 1X6OA 3PT9A 5CKFA 3CCJA 5HKCA 2MMPA 2MI6A 5AYFA 5I2SA 2Y4YA 3CMET 2GCXA 2JOYA 1YBYA 3FDRA 5FU6B 2Y90A 3CMEA 2MF2A 4OF1A 3EAEA 3N5BB 4M77F 4VUBA 4M75A 4O5VA 3UWNA 3V7CA 2E64A 1SSFA 2KK4A 2G3RA 2KAFA 2XDBA 3OB9A 1PSFA 5GAN7 3JCMe 1M4ZA 3CPWA 3BY7A 3L1AA 1KC8C 3TREA 5CAIA 1KHCA 1QP3A 3JB9D 4DQ2A 3OMCA 3QZ9B 2LRQA 3H8ZA 2XDPA 2RK2A 3SWNA 3JCMQ 1VQPT 3UT1A 1K8AC 3FEOA 5GAN6 1VQPA 2R57A 1VQ5A 3F70A 1MHNA 4ZN3A 3M5AA 2VGNA 1P92A 2RA2A 4XU2A 4M7AD 2BIVA 4HKEA 1UGRB 4M78A 3RMQA 2EJGA 3PMTA 4F7UA 2XIDA 3PGGA 4M78B 4OP0A 2RHIA 2WSFE 5GAOp 1KD1U 2YLCA 4JLGA 5GAOq 2EFIA 3JB9G 3DLLA 3E1SA 3CCMT 3M54A 5GAOr 4OMFB 1Q82C 4M7DC 2ZPHB 1N6AA 3CCMA 4IUQA 4J8OA 2PU9B 3FB9A 1YJNT 4O6JA 4BB7A 1YCYA 4M7AG 1M5Q1 5GAOl 1YJNA 3VJPA 5IN1A 1WJSA 5FU7C 4A4EA 1NPPA 1Y71A 2XG8D 2QXFA 2DJZA 3ASKA 2X4JA 5IT9E 3NTHA 3EFSA 1NJIU 5GAOn 4EMKC 3QHSA 2GFUA 3CD6T 3LGFA 3A8HB 2X35A 1RL2A 4A54A 4C5IA 3V8KA 2CZ0B 3TEEA 3CD6A 2RJDA 3R6OA 3QPHA 4D6WA 4C5EA 1VIFA 3X24B 5CKEA 5DLQE 3I55T 4E7KA 3OW2S 3CCVT 2EQUA 4N0AC 2LCCA 3I55A 5GANh 3CCVA 1MGQA 3HKSA 4C0DB 2QTXA 4FT4A 1G3WA 2K5IA 4NL2A 5CK9A 2H3JA 4MDWA 4KUIA 4QQDA 4PL6A 5KCOA 3JB9I 5GAMh 2LQ8A 3P8DA 2E65A 1WGSA 2QEXT 4ZGJB 4Y91A 3GF5A 4XTVA 2KDSA 2QEXA 3CPFA 2ZPGB 3JCMV 4FSXA 4JDSA 3RESA 3WXMB 3OYAA 3L2WA 2DIQA 3LW5E 1VQ6T 2RJCA 4Z02A 4M78G 5CQYA 1HK9A 5CCAA 2VYTA 4EPCA 4NS5A 2DK3A 3LYIA 1VQNT 3JCMc 1PSEA 4MMKA 4B9WA 3OYLA 1N8RC 4PJOF 1VQNA 1B34A 2RO0A 3PIPA 2CGHA 5LJ3h 3QUIA 4M7AE 2PQWA 1B34B 4NOYA 2A7YA 1VIEA 4OGEA 4LD6A 5A0GA 3SD4A 3VYGA 4BD3A 3NFCA 3OYIA 2L8DA 4C92F 3GP8A 2MWOA 1Q81C 5GANe 4IUTA 3M4YA 4M75F 1JRIA 4C0GA 3J81E 1M1KC 4MMLA 1JJ2A 3MCAB 3OYHA 2PVOB 4GLKA 3VV0A 2FYKA 3LWHA 2EJ9A 5CR2A 2V8JA 2YRVA 1GXIE 1LNXA 1YJ9T 4PLIA 3A8GB 4XQ3A 4C5GA 3PMIA 4BY6B 4Y28E 1YJ9A 4J5YA 4QW2A 1XTDA 3INZA 2ZCFB 3MEUA 1XQHA 4M77D 5D6YA 3OYBA 3QG1A 1VQOT 3LLRA 4QVCA 4XTWA 2C06A 1VQOA 1K8AU 2HQXA 1NZ9A 3JCMh 3E19A 2M1HA 5HK0A 2F5TX 2OAUA 2DKGA 3O8VA 4LDYA 1W2BA 5CQXA 3SWNC 1Q7YC 4DOVA 3QKJA 4XK8E 5IAYA 1YHQT 5LJ3e 4J6XA 2BUDA 3META 1M90C 1FXXA 1YHQA 3CXCA 1VQKT 2EQJA 1LOJA 3M55A 4PKCC 5GANf 1KQSS 1VQKA 4JUVA 4L5GA 1OI1A 4M78C 4PLLA 4C8QE 3OYMA 3FC3A 3S3OA 4M7AA 2FHDA 3JCMP 2E1HA 1Y7XA 4JS4A 3OBWA 3JAME 1Q82U 1UB4A 2RK1A 4ME7A 4BI4A 1WQWA 4HCZA 5GAMf 1G3TA 3A8MB 1QW1A 3GIBA 3RERA 3J7AF 2DTOA 5M9OA 1K9MC 3QJYA 3GOXA 5GAN5 3OYKA 4X9CA 3SFMA 3MHXA 2P0KA 2GQVA 4MZMA 1QVFA 2RI5A 3CBOA 1OZ3A 4KULA 1XNIA 2FB7A 4FT2A 3LX7A 2HD0A 4P5NA 1KQ2A 3OW2A 4QQ6A 4HT9A 2HBPA 4E7HA 4N4GA 3QXEB 2A3LA 3P8BB 5GAMd 1AHJB 2DTIA 2RD1A 3V7SA 5KCHA 1R8OB 2ZPEB 3QO3A 3HSBA 5FRMA 2XKOC 1YJWT 1FX7A 2EAYA 4J6YA 2DXCA 3RMSA 3V7RA 2LX9A 3L2ZA 2CZ7B 1VUBA 3CCRT 1YJWA 2BKDN 3M4GA 5GAMj 3BW1A 3CCRA 4N4HA 4B9XA 5GMKh 4C0DC 2RM4A 3FLGA 3AHUA 3MP6A 4WF2A 1Y96B 3QYHB 4C92B 3WVDB 4C8QA 4M7DF 2MWPA 3SB2A 4JRQA 4C8QB 4OB0B 1BI3A 4V2SA 4UC4A 3URGA 4M77E 1D3BB 2EQMA 2K2VA 2QQ9A 2XK0A 5CO7A 1NE8A 2E12A 2JUFA 2PUKB 3X28B 3CCUA 2KVQG 3JCMf 4LD9K 1BKBA 4XAXB 3CCET 2ZPFB 4BDZA 3CCEA 1WPYA 2RH2A 3RKYA 1VQ4T 5GMKm 2CYZB 2LT1A 1VQ4A 1WJQA 2HNIA 5GAN8 4EMGA 3PTAA 4DA4A 2IG0A 2FL7A 1JBMA 3OS2A 2RI2A 3OY9A 1Q81U 4A4FA 4LDUA 1BI1A 4Q5WA 2QQAA 2VUBA 1M1KU 2GFAA 3QBYA 3JCMd 4EDUA 3ZEHA 5GMKe 3QSUA 1O9SA 1UGPB 2DD4A 3JCMb 5FROA 4FU6A 2L3RA 4C92D 4KBMB 5J26A 4A4GA 1ZQ1A 3RIRA 4C5HA 4LDVA 4C8QD 2RHXA 4BY6C 2DXUA 1M8VA 3MEAA 1VQMT 3JB9F 3X26B 1VQMA 4M77A 5A2QE 2OTJT 2E5QA 2RHYA 1VQ9T 4M77B 3M9QA 2KSSA 2LT4A 1KQSA 4JRPA 2RJFA 2OTJA 4CI0C 4E7JA 2D9TA 4A53A 4C92G 1VQ9A 2E6ZA 3DLMA 5GANg 3OYCA 3QYGB 1KHIA 5DY9A 4C8QG 2DVEA 5FLXE 2F5KA 3ME9A 3CCST 1YIJT 1M90U 1VQ6A 3VYHB 3CCSA 5EG2A 3CPWS 1YIJA 2EKOA 4OB3B 3HL8A 3MEVA 5KE3A 2DZCA 2QI2A 2PVDB 5J39A 5GAMg 4M7AC 2ZPBB 4OGCA 4TVRA 3VU3C 4BACA 4CRIA 2DZ9A 2K5LA 1N9RA 5DM7R 2JTFA 1M9SA 4ZGEB 3FJPA 2DEQA 2DXTA 3L2RA 3OYYA 3MEWA 4XTYA 1K9MU 1G5VA 5HK3A 3C4SA 3OQ5A 5LL6S 5A0DA 4J83A 5FU6C 5LJ5h 3GNGA 5A0LA 3QDRB 2VGMA 1VQ7T 5LJ3g 5GAN4 2K57A 4BE2A 3KXTA 1HXDA 1ZBXA 3GLXA 5FU7B 3JCMW 1VQ7A 2GF7A 3BDUA 4XU1A 3RKWA 3CC4T 4HCBA 3QIIA 2JNGA 3HFOA 1U1SA 1ZHIA 4KT0E 1M1GA 3WVEB 1TH7A 2K3YA 3M59A 3OBYA 3VUBA 2QA4T 2X4XA 5D6WA 3HHTB 4GY5A 4PJOE 2QA4A 3G7ZA 5CKHA 5KE2A 4M78F 2LTOA 1QVPA 4F7UF 3NTKA 4BE1A 3HFNA 4ZGDB 1YI2T 3OSSC 1QVGS 2O4XB 4C92E 2QQBA 2XHCA 4RKUE 1JB0E 1BIAA 2LCLA 3OSVA 4M77G 3OYDA 1YI2A 4C8QC 2NLUA 2XU8A 2ZZDA 1DJ7B 3JCMg 3TU4K 3OYGA 3OS5A 2VC8A 1H641 2AHJB 1N9SA 2QQSA 1I81A 4C0FA 3C94A 4QQGA 1LJOA 5LJ5e 3JB9H 2VV5A 2X4YA 4HA8A 3A5ZB 4RG8A 1WQ7A 3E9FA 3FRNA 3OYFA 2DIGA 3RKXA 1G3SA 5GANd 1IZ6A 3KUFA 2R58A 3LH0A 4RCBA 5I21A 3JSCA 1YITT 2XICA 2L5QA 3CBMA 1U1TA 4A4HA 1YITA 2WSCE 3DB4A 4JJNK 5GANj 5LJ3f 1X75C 1UGQB 4R56A 2XDDA 3L2QA 1OYXA 3S6WA 4RG2A 3CCQT 4XU0A 4PJOA 5J3BA 3OYJA 4PJOB 2X4WA 3G71T 3CCQA 2DD5A 2WSEE 4RCCA 3RUXA 3G71A 3BFMA 4EMHA 4QVDA 3LGLA 2JVVA 3C95A 1Y96A 4C92A 4ZN1A 2PVGB 3VUZA 5LJ5f 3S3NA 1WNLA 4FIBA 4M75B 3GNFB 2LC4A 2ZPIB 5LJ3d 3LWIA 3CCUT 3DB3A 2M0OA 4XU3A 1JJ2S 1D3BA 2JN0A 4J7FA 5GMKl 2RI3A 4M77C 4NL3A 4IUVA 5DLOA 1S72T 1Y07A 1VQLT 4XTUA 2E70A 5KH6A 4PNOA 1VQLA 1S72A 4KUDK 3M57A 1I4K1 5LJ3j 3GPLA 2KMTA 4BI8B 2QDYB 2DPPB 2M16A 1Q86C 2V8KA 4IUUA 3SWNB 1K73C 3HRTA 5D6XA 2VXEA 2LNVA 3JB9J 1N8RU 5LJ5d 1UEBA 4BUGA 3JCMX 3I56T 3HRSA 2KY9A 3OYEA 4E7IA 3M58A 1M1FA 2CS7A 3I56A 3L42A 3OS1A 4QVZA 2E6NA 4BE0A 2F69A 2PUOB 1W2BS 2MAMA 2P0QA 4F7UB 5LJ5j 1W4SA 4PJOD 2YLBA 3HPWA 2LDMA 2WACA 1I8FA 1UGSB 4LDWA 4BI3A 3CXCS 4M7DE 4E7LA 2JZ2A 3P8HA 4M75D 4JRIA 2K5FA 3A8LB 3FIFA 3CC2T 3KBGA 5CIUA 1XOVA 1N27A 3MP1A 3CC2A 4PJOG 4ELZC 3L2VA 3E9GA 2I2LA 2EQKA 1QVGA 2DAQA 2LVMA 4JS5A 1I5LA 1KG1A 2YHTA 4XTZA 1Q7YU 3X25B 2E41A 1QVFS 2K3XA 1BI0A 5GAOm 4M75G 4M7AF 3G4ST 2R5AA 2VXFA 1G3YA 3ZBDA 4MDXA 2JTMA 4L59A 3CCLT 2O01E 1BIBA 3JRZA 3G4SA 1EIFA 2DXBA 3HRUA 5CKDA 5GAN3 3OMGA 4M78D 3CCLA 3CBPA 4FL6A 1QP2A 4J7IA 2D0QB 4OB2B 3DKMA 4J6WA 3SDZA 4E47A 3G6ET 4MZPA 3CC7T 3OA6A 1BI2A 1KD1C 3J80E 3G6EA 3CC4A 3CC7A 5C6SA 4M7DA 2EIFA 4R55A 3EFRA 3QJ6A 3CMAT 4M7DB 4X9DA 5FRNA 3CMAA 1VQ8T 3JCMJ 4F7UG 1U8RA 1KC8U 1VQ8A 2P4TA 2EYQA 4HT8A 1NPRA 4C0ZA 1WJRA 4JRKA 2ZGWA 5L8RE 1O75A 4EMKA 4ZTJA 5GMKj 1NJIC 2FVUA 2K4YA 3C12A 3T9NA 4EMKB 4LDXA 3ER0A 1KQ1A 4II1A 1RI0A 4IURA 4PJOC 2RJEA 5CKBA 2HAXA 2QQRA 2P0PA 3PNWC 5LJ5g 3V8JA 3BDLA 4XTXA 4C8QF 2Y4XA 2OTLT 4N0AA 4JLIA 2O4XA 1BYMA 4A4KA 2OTLA 2XI9A 4C92C 4RMOA 3UPUA 3PFSA 5GAMe 3Q1JA 2CZ1B 4M75E 3NTIA 4M75C 2DTHA 4L6V5 3V8LA 1VQ5T 2KQWA 3TCJA 5GAN2 2XD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5N A; 
#chains in the Genus database with same CATH topology
 2ENM A;  3HP9 A;  5HY6 A;  1V29 B;  4AFU C;  2COW A;  3S3M A;  1X01 A;  1PRL C;  1FWZ A;  2B8A A;  4JZ3 A;  4RUG A;  1IB8 A;  4N4I A;  3EG9 A;  3UDC A;  3HTR A;  5GMK i;  1ZA1 B;  5C0M A;  2RN8 A;  1OU9 A;  1M30 A;  5I2M A;  2MK5 A;  3SHW A;  4M7A B;  2A28 A;  4IUP A;  4BDY A;  1RAI B;  3ZFJ A;  2DL4 A;  1E6G A;  1YJW Q;  5HKC A;  5AYF A;  2MI6 A;  2EYX A;  5I2S A;  1VA7 A;  5FU6 B;  1QVG P;  2KI7 A;  2MF2 A;  1M8M A;  3UWN A;  4M77 F;  1M2O A;  4M75 A;  3V7C A;  2KEA A;  1SSF A;  1PKS A;  1F1B B;  3JCM e;  3BY7 A;  1KFZ A;  3CCM Q;  5CAI A;  1KHC A;  1QP3 A;  2XDP A;  2RK2 A;  3SWN A;  2R57 A;  3F70 A;  4E7S A;  3H0F A;  3EGU A;  3MJX A;  2G6F X;  4XU2 A;  1K0X A;  4HKE A;  1UGR B;  3EG0 A;  2XID A;  5HCK A;  5GAO q;  4LE9 A;  3E1S A;  4AG2 C;  3CCM T;  2LQN A;  1Q82 C;  1ZSZ C;  1N6A A;  1AVZ C;  4IUQ A;  4O6J A;  5IN1 A;  4A4E A;  3LH5 A;  1UG1 A;  5IT9 E;  1NJI U;  3U23 A;  3VS5 A;  3LGF A;  3A8H B;  5FWB A;  3CD6 A;  1AD5 A;  3QPH A;  4D6W A;  1YCS B;  5CKE A;  2EQU A;  3I55 A;  3CCV A;  1MGQ A;  1M3B A;  2K5I A;  2H3J A;  4KUI A;  1IHV A;  1U06 A;  2E65 A;  4ORZ A;  1TUG B;  2FPD A;  1RI9 A;  2QEX A;  2LMJ A;  2ZPG B;  3CPF A;  3JCM V;  3WXM B;  3L2W A;  1KK7 A;  2DIQ A;  1IXD A;  4Z02 A;  1IRX A;  5CCA A;  2VYT A;  4RTV A;  3LYI A;  1VQN T;  1GFC A;  3JCM c;  4MMK A;  4B9W A;  3QUI A;  2PQW A;  2KYB A;  4NOY A;  4PFO A;  2ED1 A;  4HVU A;  3SD4 A;  1KJW A;  3VYG A;  3NFC A;  4IUT A;  2BZY A;  2NUP A;  3OYH A;  1UE9 A;  3EHQ A;  3VV0 A;  2V8J A;  2YRV A;  3RR6 A;  1C6V X;  1H3H A;  4R0K A;  4HCK A;  4PLI A;  4C5G A;  3INZ A;  1XQH A;  4QVC A;  1K8A U;  2BTT A;  6AT1 B;  1NZ9 A;  2M1H A;  2JM9 A;  1EZZ B;  4OMN A;  5CQX A;  1JXO A;  2BUD A;  1M90 C;  1YHQ A;  3CXC A;  1Q86 R;  1K73 R;  4PKC C;  1U5S A;  4M78 C;  4PLL A;  1WXU A;  4C8Q E;  4PJN A;  3OBW A;  3JAM E;  1WYX A;  1QW1 A;  3CCR Q;  2HZY A;  2Z0W A;  3GIB A;  3RER A;  2EKH A;  2X3W D;  1K9M C;  3OYK A;  1B7T A;  1ZUU A;  2M02 A;  2AZS A;  3CBO A;  3PVQ A;  4FT2 A;  1KQ2 A;  2HD0 A;  4P5N A;  3OW2 A;  2CSQ A;  1R8O B;  3HSB A;  2ED0 A;  5FRM A;  3REB B;  3EGD A;  3CCR T;  2LX9 A;  2CZ7 B;  2GQI A;  2BKD N;  3M4G A;  5GAM j;  4N4H A;  2RM4 A;  3FLG A;  2V1Q A;  1BCO A;  4WF2 A;  3WVD B;  2FZG B;  3X28 B;  2K3B A;  5CO7 A;  2JUF A;  4RTW A;  2KVQ G;  4LD9 K;  4J9B A;  2RQV A;  3EFO A;  4BDZ A;  3CCE A;  2F2X A;  2K2M A;  2RH2 A;  2CUB A;  2CUD A;  2KRO A;  3NPF A;  1VQM Q;  1VQ4 A;  4EMG A;  2OTJ Q;  1Q81 U;  2RF0 A;  3JCM d;  3QSU A;  1O9S A;  3JCM b;  4KBM B;  1ZQ1 A;  5GJV B;  4C5H A;  4C8Q D;  2JM8 A;  1VYV A;  4J9I A;  1M8V A;  3MEA A;  1VQM T;  2OTJ T;  4M77 A;  3M9Q A;  3CXC P;  1KQS A;  4JRP A;  2RJF A;  4C92 G;  2E6Z A;  5GAN g;  4Z8A A;  3QYG B;  1QCF A;  3ME9 A;  1PC0 A;  4PJL A;  3VYH B;  5EG2 A;  1ZA2 B;  1YIJ A;  2EKO A;  4OB3 B;  3HL8 A;  4M7A C;  1CKB A;  5DM7 R;  4ZGE B;  5LL6 S;  5A0D A;  5FU6 C;  3OW2 P;  1AWW A;  1YN8 A;  1WXB A;  5LJ3 g;  1RAC B;  2CSI A;  4FYV B;  3KXT A;  1VQ7 A;  5FU7 B;  2GF7 A;  4XU1 A;  4HCB A;  2YRD A;  1PHT A;  2K3Y A;  3OBY A;  2RPN A;  3ULR B;  5KE2 A;  5CKH A;  1QVP A;  2PTK A;  1QVG S;  1MMD A;  2O4X B;  4C92 E;  4M77 G;  2KBT A;  1DJ7 B;  3H0H A;  3JCM g;  3OYG A;  2QQS A;  2OX7 A;  1LJO A;  3JB9 H;  4HA8 A;  3G71 Q;  2LJ3 A;  3TQ7 P;  2R58 A;  2L5Q A;  3CBM A;  1YIT A;  1G83 A;  5LJ3 f;  4DEY A;  2XDD A;  4XU0 A;  3OYJ A;  3G71 T;  3CCQ A;  4RCC A;  1TWB A;  3RUX A;  4AFS C;  4ZNX A;  3I56 Q;  3C95 A;  1Y96 A;  4ZN1 A;  4CC7 A;  5LJ5 f;  1KQS P;  2YUQ A;  4FIB A;  3S3N A;  4M75 B;  3GNF B;  2ZPI B;  2LJ1 A;  5GMK l;  2RI3 A;  4NL3 A;  5DLO A;  4XTU A;  2KMT A;  4IUU A;  3SWN B;  1QLY A;  2LNV A;  3JB9 J;  3JCM X;  3I56 T;  3M58 A;  1M1F A;  1FMK A;  2E6N A;  4BE0 A;  2F69 A;  1IO6 A;  1MNE A;  2WAC A;  4M7D E;  2ROT A;  2KRS A;  3A8L B;  1G8X A;  3CC2 T;  5CIU A;  4Y92 A;  3RNJ A;  2COY A;  1YP5 A;  2LVM A;  1A0N B;  1KG1 A;  5KYU A;  1K0S A;  1Q7Y U;  4PK4 A;  1X2Q A;  1QVF S;  2K3X A;  5GAO m;  2JTM A;  1BIB A;  3G4S A;  4M78 D;  3CBP A;  1Q7Y R;  1UDL A;  3DKM A;  1V76 A;  1SPK A;  4E47 A;  2JJ9 A;  1B3Q A;  3EFR A;  2K7A A;  5FRN A;  1ZSZ B;  1ABQ A;  2M51 A;  1VQ8 A;  2EYQ A;  4HT8 A;  1I1J A;  2K9G A;  4JRK A;  2FVU A;  2K4Y A;  3C12 A;  1FMV A;  4LDX A;  1RI0 A;  4IUR A;  4PJO C;  5CKB A;  3PNW C;  3V8J A;  4XTX A;  4C8Q F;  2DET A;  2C0I A;  4E6R A;  1T3S A;  1TUD A;  2OTL A;  4RMO A;  3UPU A;  2CZ1 B;  3VRZ A;  1NLP C;  1NYG A;  5KYY B;  1OPL A;  2XD0 A;  4IKF A;  2NUT A;  4M7D D;  2V8I A;  4ELY C;  3CME Q;  4HCC A;  2CKK A;  2RB6 A;  5KYW B;  1UJY A;  2DX1 A;  3MP8 A;  3OS0 A;  3PIO A;  1QCO A;  4ZTF A;  2L89 A;  2NYS A;  3OYN A;  4X34 A;  2RQW A;  3CEY A;  2RHU A;  2EJF A;  1QKX A;  3PT9 A;  5CKF A;  2MMP A;  3CME T;  3EH2 A;  1AWX A;  2HL3 A;  3FDR A;  2Y90 A;  4VUB A;  4O5V A;  3TSZ A;  2XDB A;  1RAF B;  1I0C A;  2V26 A;  4DQ2 A;  3JCM Q;  3QZ9 B;  2LRQ A;  2MOX A;  1VQP T;  2KR3 A;  2O9S A;  1VQ5 A;  3VS0 A;  3M5A A;  2VGN A;  4M7A D;  2EJG A;  3PMT A;  3PGG A;  4M78 B;  5GAO p;  1KD1 U;  2WSF E;  2YLC A;  4JLG A;  2EFI A;  4RTX A;  2J05 A;  5GAO r;  2NWM A;  3CCM A;  1LCK A;  3FB9 A;  1D0Y A;  1BK2 A;  3EFO B;  1HD3 A;  5FU7 C;  1NPP A;  2A36 A;  2J6O A;  2DJZ A;  2QXF A;  4EMK C;  3QHS A;  2YRC A;  1RL2 A;  2AT1 B;  2EGC A;  2KT8 A;  4C5E A;  2DYB A;  3X24 B;  5DLQ E;  2RMO A;  3OW2 S;  2COZ A;  4N0A C;  3HKS A;  2QTX A;  2A37 A;  4FYX B;  4NL2 A;  5CK9 A;  1X27 A;  4MDW A;  5KCO A;  1SRL A;  2SRC A;  5GAM h;  4LN2 A;  3GF5 A;  1Z9Z A;  2KDS A;  3I35 A;  4FSX A;  1HK9 A;  3VS3 A;  1GFD A;  4EPC A;  1PSE A;  3OYL A;  1VQN A;  1B34 A;  2CGH A;  3O5Z A;  2AKL A;  1VQO Q;  2EW3 A;  2CP7 A;  4OMM A;  4C92 F;  5GAN e;  1M1K C;  2C0T A;  4GLK A;  1PWT A;  1M2V B;  2L3P A;  5CR2 A;  1GXI E;  1QKW A;  4XQ3 A;  4AG1 C;  4J5Y A;  4QW2 A;  1GL5 A;  1XTD A;  1VQO T;  2A08 A;  4AT1 B;  2F5T X;  3O8V A;  3SWN C;  4DOV A;  5IAY A;  4KH0 B;  4LNP A;  2W10 A;  5LJ3 e;  2QYZ A;  3MET A;  1K9A A;  2EQJ A;  4F14 A;  1LOJ A;  3M55 A;  1KQS S;  4JUV A;  3FC3 A;  1Y7X A;  4JS4 A;  1Q82 U;  1UB4 A;  4PJM A;  1WQW A;  4HCZ A;  1G3T A;  1WHH A;  5GJW B;  3QJY A;  5GAN 5;  3SFM A;  1QVF A;  3UF4 A;  2MPX C;  1PG5 B;  4KUL A;  4QQ6 A;  2HBP A;  1WHM A;  1OOT A;  2EBP A;  4N4G A;  4E7H A;  3QXE B;  2A3L A;  2RQR A;  1S72 Q;  1R77 A;  2ZPE B;  3QO3 A;  1UHF A;  2XKO C;  1YJW T;  2EAY A;  3RMS A;  1TS9 A;  1D0X A;  3L2Z A;  1ZLM A;  3CCR A;  1JU5 C;  4C0D C;  1Y96 B;  3QYH B;  4C8Q A;  4M7D F;  3SB2 A;  2VAS A;  4OB0 B;  4UC4 A;  2OJ2 A;  2MCN A;  2K2V A;  4JJC A;  2XK0 A;  1U3O A;  4XAX B;  1K1Z A;  2JMA A;  4PFP A;  2LT1 A;  1TOV A;  3M0S A;  1OUL A;  4ANJ A;  3OS2 A;  4A4F A;  3UAT A;  4J9H A;  2LNH B;  2GFA A;  4EDU A;  5GMK e;  5FRO A;  1NJI R;  1PCX A;  2L3R A;  3CCL Q;  2LX7 A;  2JXB A;  4BY6 C;  2KYM A;  4FYW B;  1QMC A;  1VQM A;  2RHY A;  2KSS A;  2OTJ A;  4CI0 C;  5KYU B;  2D9T A;  3DLM A;  3OYC A;  5DY9 A;  4C8Q G;  4RTZ A;  2FG0 A;  1M90 U;  2F5K A;  1VQ6 A;  1FMW A;  2DLP A;  2QI2 A;  5KE3 A;  5J39 A;  3CC4 Q;  4TVR A;  4BAC A;  3VU3 C;  1N9R A;  3VS2 A;  2DEQ A;  1QVF P;  1K9M U;  5HK3 A;  2DEU A;  3GNG A;  1YI2 Q;  3QDR B;  2FZC B;  3GLX A;  3THK A;  3JCM W;  2DRM A;  3CC4 T;  3QII A;  2JNG A;  1GCQ A;  1U1S A;  2D0N A;  1M1G A;  3VUB A;  1X6B A;  4GY5 A;  3NTK A;  4BE1 A;  1K8A R;  1YI2 T;  1WZO A;  1JB0 E;  4FCY A;  4B6M A;  1BBZ A;  1H64 1;  4JZ4 A;  1MV0 B;  4F16 A;  2AHJ B;  1N9S A;  2NUT B;  1J3T A;  1I81 A;  1AOJ A;  2X4Y A;  4RG8 A;  1WQ7 A;  3E9F A;  5GAN d;  3JSC A;  3EGX B;  1U1T A;  4A4H A;  2ZAE A;  1YWP A;  3DB4 A;  2GTJ A;  1OYX A;  1VYT A;  3S6W A;  2AZV A;  1YNZ A;  3VS1 A;  1PM3 A;  4PJO B;  2X4W A;  2MYS A;  1VOM A;  3G71 A;  2HBW A;  3LGL A;  2JVV A;  4C92 A;  3EG2 A;  1Y57 A;  1PD1 A;  1UEC A;  1WNL A;  2OI3 A;  2LC4 A;  5LJ3 d;  3DB3 A;  2M0O A;  2JN0 A;  4J7F A;  4M77 C;  2DNU A;  4IUV A;  2ATC B;  4KUD K;  3M57 A;  1I4K 1;  3GPL A;  2M16 A;  1Q86 C;  1K73 C;  3HRT A;  5D6X A;  1N8R U;  2HSE B;  4RTU A;  1UEB A;  5LJ5 d;  3HRS A;  2CP5 A;  2HMA A;  3VS7 A;  3I56 A;  3OS1 A;  2O88 A;  2ROL A;  1OPK A;  2MAM A;  1W4S A;  2YLB A;  1D1B A;  3CD6 Q;  1N8R R;  1RAG B;  2LDM A;  1SHG A;  2JZ2 A;  3P8H A;  4AMC A;  4M75 D;  1Q81 R;  5KYX B;  3FIF A;  1N27 A;  3CC2 A;  1H92 A;  1S1N A;  1UGV A;  1PKT A;  1X43 A;  4RTY A;  2I2L A;  3EG3 A;  2YHT A;  3X25 B;  1TTH B;  4Z88 A;  1D09 B;  2O9V A;  1EIF A;  5CKD A;  3HRU A;  4FL6 A;  1QP2 A;  4QT7 A;  1MV3 A;  2V1R A;  1BI2 A;  2A0F B;  4J9C A;  2AKK A;  4M7D A;  4R55 A;  3QJ6 A;  4F7U G;  1MMG A;  3M0P A;  2RQU A;  1WFW A;  2KGT A;  5L8R E;  4ZTJ A;  4EMK B;  3T9N A;  3ER0 A;  4II1 A;  2FEI A;  2HAX A;  5LJ5 g;  4D8K A;  2LJ0 A;  3PFS A;  3Q1J A;  3NTI A;  2FO0 A;  2DTH A;  3TSW A;  2BE9 B;  4OMO A;  2D8J A;  2L3S A;  3CCJ Q;  2DF6 A;  1N5Z A;  2DO3 A;  3MO8 A;  4CC3 A;  4ATO A;  3X20 B;  2LQK A;  2E3H A;  2D6F A;  2KXD A;  2EWN A;  3EG9 B;  3L2U A;  4M78 E;  4M7D G;  4F7U E;  2E10 A;  5ECA A;  1H3Z A;  4KGX B;  1WHK A;  3CCJ T;  2F1L A;  1X6O A;  2L2P A;  3IQL A;  1TUC A;  2GCX A;  2JOY A;  3AT1 B;  2JS2 A;  3CME A;  2YDL A;  3EAE A;  3N5B B;  2KK4 A;  2G3R A;  1PSF A;  5GAN 7;  1M4Z A;  1KC8 C;  3TRE A;  2QDL A;  2GNC A;  3JB9 D;  4F04 B;  4LUD A;  3UT1 A;  1VQP A;  1YJN Q;  3CCE Q;  1MHN A;  1WA7 A;  2AIR B;  4OML A;  1P92 A;  8ATC B;  1VQ4 Q;  2BIV A;  2DBK A;  2E5K A;  2RHI A;  3M54 A;  4OMQ A;  2ZPH B;  2IIM A;  2PU9 B;  1YJN T;  5FW9 A;  4BB7 A;  4M7A G;  1MND A;  1WIE A;  1ZBJ A;  2XG8 D;  1OU8 A;  3ASK A;  3NTH A;  3EFS A;  5GAO n;  1EFN A;  1LPL A;  2GFU A;  2ESW A;  4C5I A;  4A54 A;  2CZ0 B;  5IH2 A;  1NEB A;  4DBR A;  1JXM A;  1NM7 A;  2LCC A;  5GAN h;  3VRY A;  4C0D B;  4FT4 A;  3FJ5 A;  1CSK A;  5EC7 A;  1OQK A;  2LQ8 A;  4ZGJ B;  4Y91 A;  4XTV A;  1XJW B;  3RES A;  3LW5 E;  2RJC A;  5CQY A;  5IHI A;  1YJ9 Q;  1VQ7 Q;  1D1C A;  2RO0 A;  3PIP A;  5LJ3 h;  1ZUY A;  4M7A E;  2A7Y A;  1PNJ A;  1VIE A;  3NMZ C;  4OGE A;  4X1V A;  1JO8 A;  3OYI A;  3GP8 A;  2MWO A;  4M75 F;  3J81 E;  2NUP B;  3MCA B;  1T0J A;  2PVO B;  1AZE A;  4HXJ A;  3LWH A;  1VQK Q;  2DL7 A;  1NBE B;  1YJ9 T;  2BZ8 A;  2GTO A;  2QGG A;  3A8G B;  4BY6 B;  4Y28 E;  2HKQ B;  4M77 D;  3MEU A;  3OYB A;  4XTW A;  2DJQ A;  1VQO A;  3JCM h;  5HK0 A;  2OAU A;  1Q7Y C;  3QKJ A;  5I22 A;  5IXB A;  1FXX A;  1VQK T;  1WLP B;  1YIT Q;  3PE0 A;  4L5G A;  2DM1 A;  1OI1 A;  3S3O A;  3JCM P;  2E1H A;  1AZG B;  2X51 A;  4ME7 A;  4BI4 A;  5GAM f;  1E6H A;  2DTO A;  5M9O A;  2H8H A;  7AT1 B;  3A98 A;  3JV3 A;  2P0K A;  2X3X D;  2GQV A;  4MZM A;  2JT4 A;  5KYN A;  1XNI A;  2FB7 A;  4HT9 A;  3LX7 A;  2CRE A;  3EHR A;  3P8B B;  2RD1 A;  3CCU Q;  5KCH A;  1RAA B;  4J6Y A;  1HYO A;  2KRN A;  3EGD B;  1VUB A;  3RDV A;  1YJW A;  4B9X A;  5GMK h;  3MP6 A;  4AFQ C;  4C92 B;  4J9F A;  1AWO A;  1HSQ A;  3URG A;  1KIK A;  3CCU T;  2EQM A;  4M4Z A;  2E12 A;  2PUK B;  2X9H A;  1SHF A;  1KD1 R;  1BKB A;  2ZPF B;  1WPY A;  3RKY A;  1UJ0 A;  5GMK m;  2HNI A;  5GAN 8;  3PTA A;  4DA4 A;  2EVR A;  2EYZ A;  2FL7 A;  3RBB B;  2OAW A;  3OY9 A;  1VQ9 Q;  1BI1 A;  4Q5W A;  4KH1 B;  1M1K U;  3QBY A;  3ZEH A;  1VYU A;  3CCS Q;  4FU6 A;  5J26 A;  4A4G A;  3RIR A;  2HCK A;  4LDV A;  2RHX A;  1M1K R;  2DIL A;  3JB9 F;  2HSP A;  3X26 B;  5A2Q E;  2E5Q A;  1VQ9 T;  1Y0M A;  4M77 B;  4LXC A;  2LT4 A;  4E7J A;  2BE7 D;  2HL5 C;  1KHI A;  3CCS T;  5FLX E;  3CPW S;  3CQT A;  2DZC A;  4PFZ A;  4OGC A;  4CRI A;  2DZ9 A;  2VVK A;  2QA4 Q;  2F2W A;  3FJP A;  2DXT A;  2RNA A;  3MEW A;  1G5V A;  2LP5 A;  2VGM A;  5GAN 4;  2DRK A;  2K57 A;  5IHK A;  1ZBX A;  1WHL A;  4E7Z A;  3A1P A;  3GBQ A;  3BDU A;  2CH4 A;  3KFV A;  3NHN A;  4KT0 E;  3CC4 A;  1TU0 B;  2QA4 T;  3PVL A;  5D6W A;  2M0Y A;  4PJO E;  1UTI A;  4WTO B;  2QAZ A;  4M78 F;  3I5S A;  4F7U F;  2ABL A;  3HFN A;  2KXC A;  4RKU E;  1BIA A;  1JQQ A;  1YI2 A;  4C8Q C;  4F17 A;  2BZX A;  4CC2 A;  2XU8 A;  1AWJ A;  3TU4 K;  2K6D A;  2VC8 A;  3C94 A;  4QQG A;  5LJ5 e;  3A5Z B;  1PD0 A;  3FRN A;  1G3S A;  1QQJ A;  1I07 A;  1Q82 R;  4RCB A;  2EPD A;  4GLM A;  2XIC A;  2HEQ A;  1SRM A;  2WSC E;  1SSH A;  4JJN K;  1SG5 A;  5GAN j;  1RAH B;  3H0I A;  1VQL Q;  4R56 A;  1W70 A;  3L2Q A;  1OX9 A;  4RG2 A;  1UFF A;  2YUP A;  4QKU A;  2F2V A;  1TSF A;  2WSE E;  4IIM A;  4ESR A;  2J06 A;  2YT6 A;  3VUZ A;  2QAS A;  2DL3 A;  4Z89 A;  1W6X A;  4OMP A;  4XU3 A;  1D3B A;  1JJ2 S;  1VQL T;  1S72 T;  3I9Q A;  4PNO A;  5LJ3 j;  2QDY B;  5AT1 B;  2O2O A;  3TVT A;  4E7I A;  2NUZ A;  2KT1 A;  2PUO B;  1W2B S;  2P0Q A;  5LJ5 j;  4PJO D;  1M3C A;  5FWC A;  1CKA A;  3VS6 A;  1I8F A;  1UGS B;  4KGZ B;  2K5F A;  3KBG A;  1XOV A;  2SEM A;  1RAD B;  3M0Q A;  3G6E Q;  1GRI A;  3CC7 Q;  1GCQ C;  2EQK A;  4JS5 A;  2LQW A;  2YUO A;  3CMA Q;  1BI0 A;  4M75 G;  4M7A F;  2R5A A;  2VXF A;  1G3Y A;  4MDX A;  4GBQ A;  3CCL T;  1G2B A;  1YWO A;  5GAN 3;  1VQN Q;  4HVW A;  2YXY A;  2CT3 A;  1ARK A;  2PZ1 A;  2D0Q B;  4J6W A;  3SDZ A;  3G6E T;  1M90 R;  3CC7 T;  3OA6 A;  3J80 E;  1ZX6 A;  2FRY A;  2EIF A;  1ZSZ A;  2HDA A;  3CMA T;  1SF9 A;  4X9D A;  1MMN A;  1RLP C;  5L23 A;  1YFN A;  1LVK A;  2P4T A;  1VQ5 Q;  1K9M R;  2GGR A;  4K11 A;  1NPR A;  1WJR A;  2H3E B;  2DFU A;  5GMK j;  1NJI C;  4J9G A;  1KQ1 A;  1BU1 A;  2RJE A;  2QQR A;  2P0P A;  5IXF A;  3UA7 A;  1BYM A;  4C92 C;  9ATC B;  5GAM e;  4M75 E;  5KYY A;  1VQ5 T;  5I11 A;  2YUN A;  2KQW A;  3TCJ A;  2CP2 A;  1WHJ A;  2RHZ A;  3A8O B;  3H9N A;  3QZ5 B;  1Q86 U;  1K73 U;  2IVW A;  1D1A A;  1T0H A;  3H6Z A;  4FM4 B;  4A63 B;  3M53 A;  5KYW A;  4OB1 B;  4YTL A;  3M56 A;  4MZT A;  2JTE A;  2R5M A;  1IRE B;  2M9U A;  5CVI A;  2CZ6 B;  3VKI A;  3BE3 A;  4OVA A;  1R0C B;  1W1F A;  2HQE A;  1OZ2 A;  4DOW A;  3CCJ A;  2Y4Y A;  2JW4 A;  1YBY A;  4OF1 A;  1EX4 A;  2E64 A;  5D7U A;  2KAF A;  3OB9 A;  3H41 A;  2FZK B;  3CPW A;  3L1A A;  2QTV A;  3OMC A;  1K8A C;  3H8Z A;  2DER A;  3FEO A;  1QCN A;  5GAN 6;  4JPB W;  4ZN3 A;  2D8H A;  2RA2 A;  1KSW A;  4M78 A;  3RMQ A;  4KRT A;  4F7U A;  4OP0 A;  1SKU B;  4D8D A;  3JB9 G;  3DLL A;  1IGU A;  4OMF B;  4M7D C;  3I55 Q;  1C1A A;  1Z9Q A;  4J8O A;  3CCV Q;  1YCY A;  1M5Q 1;  5GAO l;  1YJN A;  1AEY A;  2E3I A;  3VJP A;  1WJS A;  2L3Q A;  1Y71 A;  2X4J A;  1GBR A;  4EIK A;  2QEX Q;  1RLQ C;  3CD6 T;  2X35 A;  4DBF A;  2QK0 A;  3V8K A;  3TEE A;  2B86 A;  2DBM A;  1UHC A;  2RJD A;  3R6O A;  1WXT A;  4HVV A;  1VIF A;  1VQ6 Q;  3I55 T;  4E7K A;  3CCV T;  4E2F B;  3MKD A;  1B07 A;  2CP3 A;  1G3W A;  4IIO A;  4QQD A;  4PL6 A;  3JB9 I;  3ZL7 C;  3P8D A;  1WGS A;  2QEX T;  2QG9 B;  2EQI A;  4JDS A;  3OYA A;  1FYN A;  1VQ6 T;  4M78 G;  1HJD A;  4NS5 A;  2DK3 A;  1V1C A;  1N8R C;  4PJO F;  4FW1 A;  1B34 B;  1ABO A;  4LD6 A;  5A0G A;  1NYF A;  4BD3 A;  4JJB A;  2L8D A;  3M0U A;  1Q81 C;  3M4Y A;  1JRI A;  1RUW A;  4C0G A;  4MML A;  1JJ2 A;  4J9D A;  1YHQ Q;  1M2V A;  2FYK A;  3CPW P;  2EJ9 A;  1LNX A;  5IHN A;  3PMI A;  1YJ9 A;  1U8R A;  2ZCF B;  1RAB B;  1M27 C;  5D6Y A;  1KC8 U;  2JS0 A;  3QG1 A;  3LLR A;  2EGE A;  2C06 A;  2HQX A;  3E19 A;  4LDY A;  2DKG A;  1W2B A;  1KC8 R;  4XK8 E;  2EGA A;  1MUZ A;  1YHQ T;  1IHW A;  4J6X A;  1RAE B;  3R6N A;  5GAN f;  1VQK A;  4M7A A;  3OYM A;  2FHD A;  3EG1 A;  2DA9 A;  2RK1 A;  3A8M B;  3J7A F;  4KGV B;  1BB9 A;  2DE0 X;  2VB6 A;  3GOX A;  4X9C A;  3MHX A;  2YSQ A;  2RI5 A;  1Q95 G;  1OZ3 A;  3E2U A;  1D0Z A;  2RQT A;  2LZ6 B;  5GAM d;  1AHJ B;  2DTI A;  3V7S A;  2JMC A;  2CH4 W;  1FX7 A;  2DXC A;  3QDF A;  3V7R A;  1NG2 A;  3BW1 A;  1OEB A;  1C0M A;  3AHU A;  2MWP A;  2DVJ A;  4JRQ A;  4C8Q B;  3G1J A;  1BI3 A;  4V2S A;  2J6K A;  1MMA A;  4M77 E;  1D3B B;  2QQ9 A;  2YWW A;  1GCP A;  1NE8 A;  2MIO A;  3CCU A;  4DBH A;  2I0N A;  3JCM f;  1M3A A;  3CCE T;  3QWY A;  2CT4 A;  2CP0 A;  3CC2 Q;  1TG0 A;  1VQ4 T;  1X6G A;  1X69 A;  2CYZ B;  1WJQ A;  1JJ2 P;  1SEM A;  3UA6 A;  2IG0 A;  1JBM A;  2RI2 A;  2QGF B;  4LDU A;  2QQA A;  2VUB A;  2C0O A;  1UGP B;  2DD4 A;  2EYY A;  2ECZ A;  2VWF A;  4C92 D;  1YIJ Q;  3M0T A;  4CC4 B;  4PJJ A;  2DXU A;  1W2B P;  2O31 A;  4FSS A;  1IGQ A;  1OV3 A;  2VKN A;  1VQ9 A;  4A53 A;  4DEX A;  2FRW A;  2GBQ A;  2DVE A;  2HQH A;  1YIJ T;  1R0B G;  3CCS A;  2DL8 A;  3MPU B;  3I5R A;  3MEV A;  1E7O A;  2PVD B;  5GAM g;  2ZPB B;  1AT1 B;  2K5L A;  2JTF A;  1M9S A;  1NLO C;  3L2R A;  3OYY A;  4XTY A;  3OQ5 A;  1I5O B;  2AK5 A;  4J83 A;  2DMO A;  5LJ5 h;  5A0L A;  1VQ7 T;  2D1X A;  1H8K A;  4BE2 A;  1HXD A;  1ACM B;  2KRM A;  3VS4 A;  3RKW A;  2P4R A;  3HFO A;  2FPE A;  1ZHI A;  2XMF A;  3WVE B;  1TH7 A;  3M59 A;  3C0C A;  3SEM A;  2X4X A;  3HHT B;  2QA4 A;  1PRM C;  3G7Z A;  2DL5 A;  2LTO A;  4ZGD B;  4LUE A;  3OSS C;  4DBQ A;  2QQB A;  2XHC A;  2LCL A;  3OSV A;  3OYD A;  2W0Z A;  2NLU A;  2PNI A;  2ZZD A;  3OS5 A;  3EH1 A;  1WDX A;  3CCQ Q;  4C0F A;  2VV5 A;  3OYF A;  2DIG A;  3RKX A;  1ZSG A;  4WCI A;  1IZ6 A;  3KUF A;  3LH0 A;  5I21 A;  3EGX A;  1YIT T;  1NEG A;  1X75 C;  1UGQ B;  2LCS A;  1QWF A;  3REA B;  3CCQ T;  2E4H A;  4PJO A;  5J3B A;  1VQP Q;  2DD5 A;  1GBQ A;  3BFM A;  2K79 A;  4JJD A;  1K76 A;  4EMH A;  4QVD A;  2PVG B;  1UUE A;  1ZUK A;  4FW2 A;  2L0A A;  1TXQ A;  3LWI A;  2EYW A;  1WI7 A;  1X2K A;  1Y07 A;  2E70 A;  5KH6 A;  1VQL A;  1S72 A;  1BCM A;  4BI8 B;  2DPP B;  2V8K A;  4J9E A;  1WHG A;  2VXE A;  1K4U S;  4BUG A;  2KY9 A;  3OYE A;  2CS7 A;  3L42 A;  4QVZ A;  2P84 A;  4F7U B;  3HPW A;  3QWX X;  1WX6 A;  4BI3 A;  4LDW A;  3CXC S;  3G4S Q;  4E7L A;  2CDT A;  5KYX A;  4JRI A;  1JEG A;  4RTT A;  3MP1 A;  4PJO G;  8AT1 B;  4ELZ C;  3L2V A;  3E9G A;  1QVG A;  1I5L A;  2DAQ A;  4XTZ A;  1T3L A;  2E41 A;  2KNB B;  3G4S T;  1VQ8 Q;  3ZBD A;  2DYI A;  1QWE A;  2O01 E;  3JRZ A;  4L59 A;  2DXB A;  3OMG A;  3CCL A;  4J7I A;  2J6F A;  2CP6 A;  4OB2 B;  4MZP A;  1KD1 C;  4AFZ C;  3G6E A;  3CC7 A;  5C6S A;  4M7D B;  2OTL Q;  3CMA A;  1VQ8 T;  2HKN A;  3JCM J;  2FPF A;  2KE9 A;  4C0Z A;  2ZGW A;  4EMK A;  1O75 A;  3NGP A;  1OX8 A;  3M0R A;  3BDL A;  2Y4X A;  4FYY B;  2OTL T;  4N0A A;  4JLI A;  2O4X A;  4A4K A;  2XI9 A;  2J7I A;  4M75 C;  3V8L A;  2IPO B;  4L6V 5;  3D7S B;  3C4S A;  5GAN 2; 
#chains in the Genus database with same CATH homology
 3HP9 A;  4IKF A;  5HY6 A;  4M7D D;  1V29 B;  2RHZ A;  3S3M A;  1X01 A;  2V8I A;  1FWZ A;  4ELY C;  3A8O B;  2B8A A;  3QZ5 B;  1Q86 U;  1K73 U;  2IVW A;  3H6Z A;  2DO3 A;  3MO8 A;  4FM4 B;  3M53 A;  4ATO A;  3X20 B;  4HCC A;  2LQK A;  4OB1 B;  2CKK A;  4N4I A;  4YTL A;  2RB6 A;  3M56 A;  3MP8 A;  4MZT A;  3UDC A;  3OS0 A;  2D6F A;  2EWN A;  1IRE B;  2M9U A;  2R5M A;  5CVI A;  3PIO A;  2CZ6 B;  5GMK i;  3L2U A;  5C0M A;  3VKI A;  4M78 E;  4ZTF A;  4M7D G;  5I2M A;  4F7U E;  4M7A B;  2E10 A;  2L89 A;  4OVA A;  4X34 A;  3OYN A;  1H3Z A;  4IUP A;  4BDY A;  3ZFJ A;  3CEY A;  2RHU A;  2EJF A;  2HQE A;  3CCJ T;  1OZ2 A;  4DOW A;  1X6O A;  3PT9 A;  5CKF A;  3CCJ A;  5HKC A;  2MMP A;  2MI6 A;  5AYF A;  5I2S A;  2Y4Y A;  3CME T;  2GCX A;  2JOY A;  1YBY A;  3FDR A;  5FU6 B;  2Y90 A;  3CME A;  2MF2 A;  4OF1 A;  3EAE A;  3N5B B;  4M77 F;  4VUB A;  4M75 A;  4O5V A;  3UWN A;  3V7C A;  2E64 A;  1SSF A;  2KK4 A;  2G3R A;  2KAF A;  2XDB A;  3OB9 A;  1PSF A;  5GAN 7;  3JCM e;  1M4Z A;  3CPW A;  3BY7 A;  3L1A A;  1KC8 C;  3TRE A;  5CAI A;  1KHC A;  1QP3 A;  3JB9 D;  4DQ2 A;  3OMC A;  3QZ9 B;  2LRQ A;  3H8Z A;  2XDP A;  2RK2 A;  3SWN A;  3JCM Q;  1VQP T;  3UT1 A;  1K8A C;  3FEO A;  5GAN 6;  1VQP A;  2R57 A;  1VQ5 A;  3F70 A;  1MHN A;  4ZN3 A;  3M5A A;  2VGN A;  1P92 A;  2RA2 A;  4XU2 A;  4M7A D;  2BIV A;  4HKE A;  1UGR B;  4M78 A;  3RMQ A;  2EJG A;  3PMT A;  4F7U A;  2XID A;  3PGG A;  4M78 B;  4OP0 A;  2RHI A;  2WSF E;  5GAO p;  1KD1 U;  2YLC A;  4JLG A;  5GAO q;  2EFI A;  3JB9 G;  3DLL A;  3E1S A;  3CCM T;  3M54 A;  5GAO r;  4OMF B;  1Q82 C;  4M7D C;  2ZPH B;  1N6A A;  3CCM A;  4IUQ A;  4J8O A;  2PU9 B;  3FB9 A;  1YJN T;  4O6J A;  4BB7 A;  1YCY A;  4M7A G;  1M5Q 1;  5GAO l;  1YJN A;  3VJP A;  5IN1 A;  1WJS A;  5FU7 C;  4A4E A;  1NPP A;  1Y71 A;  2XG8 D;  2QXF A;  2DJZ A;  3ASK A;  2X4J A;  5IT9 E;  3NTH A;  3EFS A;  1NJI U;  5GAO n;  4EMK C;  3QHS A;  2GFU A;  3CD6 T;  3LGF A;  3A8H B;  2X35 A;  1RL2 A;  4A54 A;  4C5I A;  3V8K A;  2CZ0 B;  3TEE A;  3CD6 A;  2RJD A;  3R6O A;  3QPH A;  4D6W A;  4C5E A;  1VIF A;  3X24 B;  5CKE A;  5DLQ E;  3I55 T;  4E7K A;  3OW2 S;  3CCV T;  2EQU A;  4N0A C;  2LCC A;  3I55 A;  5GAN h;  3CCV A;  1MGQ A;  3HKS A;  4C0D B;  2QTX A;  4FT4 A;  1G3W A;  2K5I A;  4NL2 A;  5CK9 A;  2H3J A;  4MDW A;  4KUI A;  4QQD A;  4PL6 A;  5KCO A;  3JB9 I;  5GAM h;  2LQ8 A;  3P8D A;  2E65 A;  1WGS A;  2QEX T;  4ZGJ B;  4Y91 A;  3GF5 A;  4XTV A;  2KDS A;  2QEX A;  3CPF A;  2ZPG B;  3JCM V;  4FSX A;  4JDS A;  3RES A;  3WXM B;  3OYA A;  3L2W A;  2DIQ A;  3LW5 E;  1VQ6 T;  2RJC A;  4Z02 A;  4M78 G;  5CQY A;  1HK9 A;  5CCA A;  2VYT A;  4EPC A;  4NS5 A;  2DK3 A;  3LYI A;  1VQN T;  3JCM c;  1PSE A;  4MMK A;  4B9W A;  3OYL A;  1N8R C;  4PJO F;  1VQN A;  1B34 A;  2RO0 A;  3PIP A;  2CGH A;  5LJ3 h;  3QUI A;  4M7A E;  2PQW A;  1B34 B;  4NOY A;  2A7Y A;  1VIE A;  4OGE A;  4LD6 A;  5A0G A;  3SD4 A;  3VYG A;  4BD3 A;  3NFC A;  3OYI A;  2L8D A;  4C92 F;  3GP8 A;  2MWO A;  1Q81 C;  5GAN e;  4IUT A;  3M4Y A;  4M75 F;  1JRI A;  4C0G A;  3J81 E;  1M1K C;  4MML A;  1JJ2 A;  3MCA B;  3OYH A;  2PVO B;  4GLK A;  3VV0 A;  2FYK A;  3LWH A;  2EJ9 A;  5CR2 A;  2V8J A;  2YRV A;  1GXI E;  1LNX A;  1YJ9 T;  4PLI A;  3A8G B;  4XQ3 A;  4C5G A;  3PMI A;  4BY6 B;  4Y28 E;  1YJ9 A;  4J5Y A;  4QW2 A;  1XTD A;  3INZ A;  2ZCF B;  3MEU A;  1XQH A;  4M77 D;  5D6Y A;  3OYB A;  3QG1 A;  1VQO T;  3LLR A;  4QVC A;  4XTW A;  2C06 A;  1VQO A;  1K8A U;  2HQX A;  1NZ9 A;  3JCM h;  3E19 A;  2M1H A;  5HK0 A;  2F5T X;  2OAU A;  2DKG A;  3O8V A;  4LDY A;  1W2B A;  5CQX A;  3SWN C;  1Q7Y C;  4DOV A;  3QKJ A;  4XK8 E;  5IAY A;  1YHQ T;  5LJ3 e;  4J6X A;  2BUD A;  3MET A;  1M90 C;  1FXX A;  1YHQ A;  3CXC A;  1VQK T;  2EQJ A;  1LOJ A;  3M55 A;  4PKC C;  5GAN f;  1KQS S;  1VQK A;  4JUV A;  4L5G A;  1OI1 A;  4M78 C;  4PLL A;  4C8Q E;  3OYM A;  3FC3 A;  3S3O A;  4M7A A;  2FHD A;  3JCM P;  2E1H A;  1Y7X A;  4JS4 A;  3OBW A;  3JAM E;  1Q82 U;  1UB4 A;  2RK1 A;  4ME7 A;  4BI4 A;  1WQW A;  4HCZ A;  5GAM f;  1G3T A;  3A8M B;  1QW1 A;  3GIB A;  3RER A;  3J7A F;  2DTO A;  5M9O A;  1K9M C;  3QJY A;  3GOX A;  5GAN 5;  3OYK A;  4X9C A;  3SFM A;  3MHX A;  2P0K A;  2GQV A;  4MZM A;  1QVF A;  2RI5 A;  3CBO A;  1OZ3 A;  4KUL A;  1XNI A;  2FB7 A;  4FT2 A;  3LX7 A;  2HD0 A;  4P5N A;  1KQ2 A;  3OW2 A;  4QQ6 A;  4HT9 A;  2HBP A;  4E7H A;  4N4G A;  3QXE B;  2A3L A;  3P8B B;  5GAM d;  1AHJ B;  2DTI A;  2RD1 A;  3V7S A;  5KCH A;  1R8O B;  2ZPE B;  3QO3 A;  3HSB A;  5FRM A;  2XKO C;  1YJW T;  1FX7 A;  2EAY A;  4J6Y A;  2DXC A;  3RMS A;  3V7R A;  2LX9 A;  3L2Z A;  2CZ7 B;  1VUB A;  3CCR T;  1YJW A;  2BKD N;  3M4G A;  5GAM j;  3BW1 A;  3CCR A;  4N4H A;  4B9X A;  5GMK h;  4C0D C;  2RM4 A;  3FLG A;  3AHU A;  3MP6 A;  4WF2 A;  1Y96 B;  3QYH B;  4C92 B;  3WVD B;  4C8Q A;  4M7D F;  2MWP A;  3SB2 A;  4JRQ A;  4C8Q B;  4OB0 B;  1BI3 A;  4V2S A;  4UC4 A;  3URG A;  4M77 E;  1D3B B;  2EQM A;  2K2V A;  2QQ9 A;  2XK0 A;  5CO7 A;  1NE8 A;  2E12 A;  2JUF A;  2PUK B;  3X28 B;  3CCU A;  2KVQ G;  3JCM f;  4LD9 K;  1BKB A;  4XAX B;  3CCE T;  2ZPF B;  4BDZ A;  3CCE A;  1WPY A;  2RH2 A;  3RKY A;  1VQ4 T;  5GMK m;  2CYZ B;  2LT1 A;  1VQ4 A;  1WJQ A;  2HNI A;  5GAN 8;  4EMG A;  3PTA A;  4DA4 A;  2IG0 A;  2FL7 A;  1JBM A;  3OS2 A;  2RI2 A;  3OY9 A;  1Q81 U;  4A4F A;  4LDU A;  1BI1 A;  4Q5W A;  2QQA A;  2VUB A;  1M1K U;  2GFA A;  3QBY A;  3JCM d;  4EDU A;  3ZEH A;  5GMK e;  3QSU A;  1O9S A;  1UGP B;  2DD4 A;  3JCM b;  5FRO A;  4FU6 A;  2L3R A;  4C92 D;  4KBM B;  5J26 A;  4A4G A;  1ZQ1 A;  3RIR A;  4C5H A;  4LDV A;  4C8Q D;  2RHX A;  4BY6 C;  2DXU A;  1M8V A;  3MEA A;  1VQM T;  3JB9 F;  3X26 B;  1VQM A;  4M77 A;  5A2Q E;  2OTJ T;  2E5Q A;  2RHY A;  1VQ9 T;  4M77 B;  3M9Q A;  2KSS A;  2LT4 A;  1KQS A;  4JRP A;  2RJF A;  2OTJ A;  4CI0 C;  4E7J A;  2D9T A;  4A53 A;  4C92 G;  1VQ9 A;  2E6Z A;  3DLM A;  5GAN g;  3OYC A;  3QYG B;  1KHI A;  5DY9 A;  4C8Q G;  2DVE A;  5FLX E;  2F5K A;  3ME9 A;  3CCS T;  1YIJ T;  1M90 U;  1VQ6 A;  3VYH B;  3CCS A;  5EG2 A;  3CPW S;  1YIJ A;  2EKO A;  4OB3 B;  3HL8 A;  3MEV A;  5KE3 A;  2DZC A;  2QI2 A;  2PVD B;  5J39 A;  5GAM g;  4M7A C;  2ZPB B;  4OGC A;  4TVR A;  3VU3 C;  4BAC A;  4CRI A;  2DZ9 A;  2K5L A;  1N9R A;  5DM7 R;  2JTF A;  1M9S A;  4ZGE B;  3FJP A;  2DEQ A;  2DXT A;  3L2R A;  3OYY A;  3MEW A;  4XTY A;  1K9M U;  1G5V A;  5HK3 A;  3C4S A;  3OQ5 A;  5LL6 S;  5A0D A;  4J83 A;  5FU6 C;  5LJ5 h;  3GNG A;  5A0L A;  3QDR B;  2VGM A;  1VQ7 T;  5LJ3 g;  5GAN 4;  2K57 A;  4BE2 A;  3KXT A;  1HXD A;  1ZBX A;  3GLX A;  5FU7 B;  3JCM W;  1VQ7 A;  2GF7 A;  3BDU A;  4XU1 A;  3RKW A;  3CC4 T;  4HCB A;  3QII A;  2JNG A;  3HFO A;  1U1S A;  1ZHI A;  4KT0 E;  1M1G A;  3WVE B;  1TH7 A;  2K3Y A;  3M59 A;  3OBY A;  3VUB A;  2QA4 T;  2X4X A;  5D6W A;  3HHT B;  4GY5 A;  4PJO E;  2QA4 A;  3G7Z A;  5CKH A;  5KE2 A;  4M78 F;  2LTO A;  1QVP A;  4F7U F;  3NTK A;  4BE1 A;  3HFN A;  4ZGD B;  1YI2 T;  3OSS C;  1QVG S;  2O4X B;  4C92 E;  2QQB A;  2XHC A;  4RKU E;  1JB0 E;  1BIA A;  2LCL A;  3OSV A;  4M77 G;  3OYD A;  1YI2 A;  4C8Q C;  2NLU A;  2XU8 A;  2ZZD A;  1DJ7 B;  3JCM g;  3TU4 K;  3OYG A;  3OS5 A;  2VC8 A;  1H64 1;  2AHJ B;  1N9S A;  2QQS A;  1I81 A;  4C0F A;  3C94 A;  4QQG A;  1LJO A;  5LJ5 e;  3JB9 H;  2VV5 A;  2X4Y A;  4HA8 A;  3A5Z B;  4RG8 A;  1WQ7 A;  3E9F A;  3FRN A;  3OYF A;  2DIG A;  3RKX A;  1G3S A;  5GAN d;  1IZ6 A;  3KUF A;  2R58 A;  3LH0 A;  4RCB A;  5I21 A;  3JSC A;  1YIT T;  2XIC A;  2L5Q A;  3CBM A;  1U1T A;  4A4H A;  1YIT A;  2WSC E;  3DB4 A;  4JJN K;  5GAN j;  5LJ3 f;  1X75 C;  1UGQ B;  4R56 A;  2XDD A;  3L2Q A;  1OYX A;  3S6W A;  4RG2 A;  3CCQ T;  4XU0 A;  4PJO A;  5J3B A;  3OYJ A;  4PJO B;  2X4W A;  3G71 T;  3CCQ A;  2DD5 A;  2WSE E;  4RCC A;  3RUX A;  3G71 A;  3BFM A;  4EMH A;  4QVD A;  3LGL A;  2JVV A;  3C95 A;  1Y96 A;  4C92 A;  4ZN1 A;  2PVG B;  3VUZ A;  5LJ5 f;  3S3N A;  1WNL A;  4FIB A;  4M75 B;  3GNF B;  2LC4 A;  2ZPI B;  5LJ3 d;  3LWI A;  3CCU T;  3DB3 A;  2M0O A;  4XU3 A;  1JJ2 S;  1D3B A;  2JN0 A;  4J7F A;  5GMK l;  2RI3 A;  4M77 C;  4NL3 A;  4IUV A;  5DLO A;  1S72 T;  1Y07 A;  1VQL T;  4XTU A;  2E70 A;  5KH6 A;  4PNO A;  1VQL A;  1S72 A;  4KUD K;  3M57 A;  1I4K 1;  5LJ3 j;  3GPL A;  2KMT A;  4BI8 B;  2QDY B;  2DPP B;  2M16 A;  1Q86 C;  2V8K A;  4IUU A;  3SWN B;  1K73 C;  3HRT A;  5D6X A;  2VXE A;  2LNV A;  3JB9 J;  1N8R U;  5LJ5 d;  1UEB A;  4BUG A;  3JCM X;  3I56 T;  3HRS A;  2KY9 A;  3OYE A;  4E7I A;  3M58 A;  1M1F A;  2CS7 A;  3I56 A;  3L42 A;  3OS1 A;  4QVZ A;  2E6N A;  4BE0 A;  2F69 A;  2PUO B;  1W2B S;  2MAM A;  2P0Q A;  4F7U B;  5LJ5 j;  1W4S A;  4PJO D;  2YLB A;  3HPW A;  2LDM A;  2WAC A;  1I8F A;  1UGS B;  4LDW A;  4BI3 A;  3CXC S;  4M7D E;  4E7L A;  2JZ2 A;  3P8H A;  4M75 D;  4JRI A;  2K5F A;  3A8L B;  3FIF A;  3CC2 T;  3KBG A;  5CIU A;  1XOV A;  1N27 A;  3MP1 A;  3CC2 A;  4PJO G;  4ELZ C;  3L2V A;  3E9G A;  2I2L A;  2EQK A;  1QVG A;  2DAQ A;  2LVM A;  4JS5 A;  1I5L A;  1KG1 A;  2YHT A;  4XTZ A;  1Q7Y U;  3X25 B;  2E41 A;  1QVF S;  2K3X A;  1BI0 A;  5GAO m;  4M75 G;  4M7A F;  3G4S T;  2R5A A;  2VXF A;  1G3Y A;  3ZBD A;  4MDX A;  2JTM A;  4L59 A;  3CCL T;  2O01 E;  1BIB A;  3JRZ A;  3G4S A;  1EIF A;  2DXB A;  3HRU A;  5CKD A;  5GAN 3;  3OMG A;  4M78 D;  3CCL A;  3CBP A;  4FL6 A;  1QP2 A;  4J7I A;  2D0Q B;  4OB2 B;  3DKM A;  4J6W A;  3SDZ A;  4E47 A;  3G6E T;  4MZP A;  3CC7 T;  3OA6 A;  1BI2 A;  1KD1 C;  3J80 E;  3G6E A;  3CC4 A;  3CC7 A;  5C6S A;  4M7D A;  2EIF A;  4R55 A;  3EFR A;  3QJ6 A;  3CMA T;  4M7D B;  4X9D A;  5FRN A;  3CMA A;  1VQ8 T;  3JCM J;  4F7U G;  1U8R A;  1KC8 U;  1VQ8 A;  2P4T A;  2EYQ A;  4HT8 A;  1NPR A;  4C0Z A;  1WJR A;  4JRK A;  2ZGW A;  5L8R E;  1O75 A;  4EMK A;  4ZTJ A;  5GMK j;  1NJI C;  2FVU A;  2K4Y A;  3C12 A;  3T9N A;  4EMK B;  4LDX A;  3ER0 A;  1KQ1 A;  4II1 A;  1RI0 A;  4IUR A;  4PJO C;  2RJE A;  5CKB A;  2HAX A;  2QQR A;  2P0P A;  3PNW C;  5LJ5 g;  3V8J A;  3BDL A;  4XTX A;  4C8Q F;  2Y4X A;  2OTL T;  4N0A A;  4JLI A;  2O4X A;  1BYM A;  4A4K A;  2OTL A;  2XI9 A;  4C92 C;  4RMO A;  3UPU A;  3PFS A;  5GAM e;  3Q1J A;  2CZ1 B;  4M75 E;  3NTI A;  4M75 C;  2DTH A;  4L6V 5;  3V8L A;  1VQ5 T;  2KQW A;  3TCJ A;  5GAN 2;  2XD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...