4P5NA

Structure of cnag_02591 from cryptococcus neoformans
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
74
structure length
74
Chain Sequence
MSVQDKQGQNINVGDTVYTPYRGGKHEGQVADIVTTKEEAAEKGVKNPPKVLFTDQNNKDVAHNPGTLTDLDKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein CNAG_02591
publication title A Small Protein Associated with Fungal Energy Metabolism Affects the Virulence of Cryptococcus neoformans in Mammals.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Structural genomics
total genus 19
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11160 Hva1_TUDOR Hypervirulence associated proteins TUDOR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1060 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4p5nA00
4P5NA
chains in the Genus database with same CATH superfamily
2FEIA 3OYAA 2VGNA 5C6SA 2LQ8A 3REBB 1NZ9A 2X3WD 1YITA 5KCOA 1M4ZA 4GLKA 1UUEA 5HY6A 4JPBW 2IG0A 4AFQC 1PRMC 1K76A 3GPLA 3TSWA 1WQWA 5LJ3e 3CCLA 1K8AC 2VASA 3CCJT 2DTHA 5I11A 4ZGEB 1H641 4TVRA 2RQUA 2YUPA 1R0BG 5CKEA 3OYIA 3QPHA 4C8QG 2D0QB 1VQ6A 1Z9ZA 1QVFA 2LT4A 4VUBA 2B86A 1JQQA 2E4HA 3RKWA 1N5ZA 1VQ9T 1OQKA 4HXJA 2LQNA 1WJSA 4PJOD 3NGPA 2DM1A 3JCMQ 3OYCA 1U06A 3JCMe 2KSSA 2RHZA 2ZPIB 2BZ8A 4XTXA 3R6OA 4ZTFA 5I2SA 4IUVA 1M1FA 1MMDA 2KVQG 4ZGJB 4M77D 3UWNA 4WTOB 2GFUA 4E7HA 1WPYA 4OMNA 1H3HA 4KT0E 4M75D 3GOXA 2LZ6B 4MDXA 1NE8A 5GANh 2D1XA 3E2UA 4N4GA 1OU8A 1OX9A 1ZSGA 1ZBJA 1M30A 1QKWA 4XTUA 1UGPB 1WX6A 1MUZA 3BFMA 4MZTA 2DTOA 1ABQA 2GGRA 2QI2A 3AT1B 2MWOA 3META 4PFZA 1E6HA 4DOWA 2QQAA 2RQVA 3CCUQ 2XICA 1KD1U 1YJWT 3CC4T 2CT3A 2EYQA 4RTXA 2DJQA 3CCRQ 4X1VA 2FYKA 1AWWA 3BW1A 2DKGA 2WACA 5FWBA 3JAME 1OV3A 2EKHA 3HP9A 2JS0A 5GAN3 4WCIA 3X26B 2DVEA 3I35A 1IGUA 2GBQA 1I5OB 5CVIA 2CP2A 3UF4A 3C12A 1U3OA 2DEQA 2E10A 2CH4W 2CKKA 4RTVA 2BIVA 1N9RA 2P84A 3JCMV 4EMKA 5HK3A 3EG3A 1OPLA 5HCKA 3EG0A 3CPWA 2FRYA 1U1TA 2EWNA 4C0ZA 1KD1R 2LT1A 4RTZA 4JJNK 4CC2A 1WIEA 2XMFA 1KQ2A 4MDWA 1N8RU 4XTVA 4LD9K 2V8KA 1B34B 2LVMA 5D7UA 2O88A 2PUKB 4F7UG 1YJWQ 1UGQB 5DLQE 1YCSB 2O9SA 3QZ5B 3MEAA 4GY5A 2MF2A 4RTTA 3JCMJ 1PHTA 3VJPA 3CCUA 4OMQA 2O2OA 2AZSA 3OYEA 2EYXA 2JTMA 2WSFE 2HKQB 2KGTA 3CCRA 1PD1A 3QUIA 2C0IA 1H3ZA 1X6GA 1VQ8A 1W1FA 2DBMA 1RABB 4B9XA 2OX7A 3OW2A 1T3LA 5GANj 1KHIA 2DILA 2QA4T 2KMTA 1JEGA 3VRZA 2GTJA 2JTFA 2BUDA 4DOVA 6AT1B 4PLLA 3PFSA 3OYFA 4M78G 3LW5E 4J9EA 5GANg 3VS0A 2OTLT 2VYTA 3EFOA 3FB9A 4OVAA 3H6ZA 1P92A 4M75A 1WGSA 4KH0B 1BI3A 2LCLA 3JB9D 1KQSP 2KRNA 4GBQA 4KGVB 4CC7A 1PD0A 3UA7A 3JCMf 1Z9QA 3ME9A 3OA6A 2DFUA 4PL6A 2VUBA 8ATCB 2R5AA 4C8QD 1WHKA 2L5QA 1I8FA 3INZA 3GLXA 1QVGA 3T9NA 2R57A 4B9WA 1W2BA 1GFDA 2BKDN 2DIGA 4M4ZA 4Z8AA 5KH6A 2QK0A 4M7AG 2KBTA 2NWMA 1MNEA 3GNFB 3QJYA 4ANJA 2F1LA 1UJ0A 2AIRB 2QA4Q 1JJ2S 1HXDA 2COYA 2NUZA 2DEUA 3M53A 1YIJT 4PJOC 4KRTA 3AHUA 3EGUA 2OTLQ 2QGGA 3CD6T 4HCZA 4RTYA 5GAOn 4NS5A 3MKDA 5GMKm 3EG2A 3QDRB 2LJ1A 4D8DA 4M77C 4LN2A 2X51A 4F16A 1UEBA 3PT9A 4M7DD 2EYYA 3QHSA 2CP7A 1I81A 2YUOA 4M75C 1Q7YU 1TUDA 2HQXA 5GAOr 4J83A 2OJ2A 4M77B 3CXCS 2DD4A 3SB2A 3HRTA 5GAN6 1G8XA 3QG1A 3CCEA 2PVDB 2XDPA 3EFOB 4X9DA 4M75B 3VS1A 4Y28E 4JUVA 2LQKA 2F5TX 3KFVA 1M9SA 1VQ5T 2MAMA 3QWYA 1PSEA 1UFFA 5LJ3h 2LDMA 2SRCA 2VB6A 1QKXA 1YIJQ 5GAOm 1RAHB 2L2PA 4F14A 2RPNA 1Q82C 2QA4A 3M58A 1VQLT 2FO0A 2FZCB 5GANd 3UPUA 3CD6Q 2LQWA 2GCXA 1VQNT 1QCFA 1Q7YR 4F04B 4XU3A 4PFOA 1VQ7T 3EGXA 3PVQA 5IHKA 2X4WA 3RMQA 4OB0B 1BIAA 2OTLA 1TG0A 4JLGA 1K73U 1S72T 5CAIA 1SEMA 2ZPGB 4PJMA 1SKUB 1KC8U 2K57A 2RF0A 2KDSA 2K3XA 1YHQT 3JCMh 1M3AA 2J7IA 2E3HA 2OTJQ 4CC3A 2M1HA 2CP5A 3M57A 3M5AA 4C5IA 5D6XA 7AT1B 1K8AU 5LJ5e 1X2KA 2MK5A 1MMGA 3NPFA 2FPEA 4QQGA 2JM9A 2ZZDA 3FJ5A 3L42A 1K73R 1WNLA 1V29B 2K6DA 1KC8R 4FYYB 1VQLQ 4C0DC 4PLIA 3PIPA 1YIJA 3Q1JA 5A0DA 4BB7A 1VQ7Q 1QW1A 2RHXA 2LMJA 1JO8A 2QGFB 3CD6A 2DD5A 4ZGDB 2HZYA 3JB9J 4M78D 2FL7A 3EG1A 3HRUA 1JB0E 1K8AR 1AWOA 2GF7A 4QT7A 2VGMA 4MZMA 1SRLA 3SEMA 2X4XA 3PGGA 1T0JA 4F17A 1UGVA 1IXDA 1RADB 5FROA 2OTJA 4KUIA 3EGXB 2LNHB 4NOYA 4J7FA 4J9CA 1PWTA 3SDZA 1IHVA 4M75F 3V8LA 1D0ZA 4A4EA 4BACA 1RAEB 1FMWA 1M2VA 3G6ET 4JRPA 4EIKA 2JMCA 5A2QE 2NYSA 1KFZA 2HL5C 2EJ9A 1PCXA 4C8QC 1PKSA 4M7AD 2EQMA 2FB7A 2CZ0B 4OMMA 1FMVA 3X28B 3MCAB 3CCQT 1XJWB 2VC8A 1BB9A 2M02A 3PNWC 1MGQA 1NLOC 1VQLA 3CCST 2M0YA 4XQ3A 1YWOA 2ED1A 3CC7Q 2DO3A 3OS1A 3R6NA 5DLOA 3JCMg 1YI2T 2GFAA 3MEUA 4A54A 2DAQA 1PM3A 1VQ4Q 2HBPA 3LH0A 2LTOA 3C4SA 2HEQA 4V2SA 1ZA2B 3OS2A 4M7DC 2QAZA 1K0XA 4F7UA 3G6EQ 2A37A 3I55T 1K1ZA 4JJBA 3S3MA 3ULRB 4LD6A 2ROLA 1N27A 1T3SA 1XOVA 2X3XD 4IUPA 2QQ9A 1QLYA 3D7SB 2K2VA 5GMKi 2G3RA 2X9HA 3NTKA 2KT1A 3CCQQ 1QP3A 3NTIA 1QVFS 3CCSQ 2DYBA 2QQRA 5HK0A 1IO6A 2KRSA 1QP2A 2V8JA 4KBMB 3VS6A 3QYGB 5CKHA 2ENMA 4RG8A 4J9IA 1RAGB 5I22A 2ED0A 4BY6C 3CC7A 3V7RA 5IHNA 4M78A 1GBQA 5LJ5f 2E6ZA 4BE2A 4Y92A 5J3BA 2CP0A 2E5KA 3HL8A 4LNPA 2YUNA 1NYGA 1TXQA 4BY6B 2E5QA 4J5YA 2AT1B 1S1NA 3L2QA 4E7IA 2NUTA 2KYMA 1AT1B 1VQ4A 2GTOA 4KULA 2J06A 1WDXA 2A28A 1U8RA 1M5Q1 3L2RA 4DEXA 2PZ1A 2FZGB 1WHHA 3FC3A 2RO0A 1M27C 3I5SA 3ER0A 4JZ4A 3SD4A 1I1JA 2Z0WA 2EKOA 2CP6A 2EQJA 1HJDA 4N4IA 3CMAQ 1SSHA 2V8IA 4M7AA 1AWJA 1VQMQ 3CCQA 2Y4YA 2YSQA 4EMGA 3JB9G 2DXTA 3CCSA 4F7UB 2EFIA 4ZTJA 1KIKA 1J3TA 1K9AA 3JCMd 1M90C 4Z02A 1QWFA 2XI9A 3TSZA 3RDVA 1WYXA 2DXCA 4FYWB 3H0IA 1M1GA 1G3TA 1HK9A 3LYIA 2OAUA 2EYWA 1AD5A 3FLGA 2KXDA 3H41A 1OX8A 4M78C 1RL2A 4QVZA 2F2VA 1VQOQ 4QW2A 5L23A 3CPWS 1MMAA 4ELYC 2DL5A 1WQ7A 2QDYB 4M78B 3TEEA 3RBBB 3HRSA 1IREB 4D6WA 3J80E 1PNJA 2J05A 1KQ1A 1B34A 3OYBA 1ZLMA 2GQVA 4KUDK 4FSSA 3S6WA 4RG2A 2NUTB 1D0XA 3A8LB 4E7KA 2RI2A 3FEOA 1D1AA 3CMAA 3CCJQ 2KROA 5KE3A 4JLIA 1X6OA 1X43A 3OBYA 4M7DG 5L8RE 1VQMA 2IVWA 2B8AA 5GAMe 3QO3A 4DBQA 1JU5C 4M7AC 1RAAB 5LJ5h 4ATOA 4PJLA 3EFRA 2XK0A 3OW2S 1Q82U 3JCMb 1ZHIA 1BI0A 1JJ2P 5EG2A 3MP6A 2QASA 4M7AB 4BD3A 1YWPA 2VXFA 5LL6S 2EW3A 2K3YA 1VQ9Q 3OB9A 1E6GA 1WA7A 4C5HA 1I0CA 1R8OB 2LCCA 1VQOA 2L8DA 2HD0A 4II1A 1V1CA 2D8JA 4RUGA 3ASKA 1YBYA 4KGXB 2CDTA 1BU1A 4MMKA 2K79A 2RN8A 4R55A 2DTIA 3IQLA 2IIMA 5GAN4 2F2XA 3OS0A 3CXCP 2K9GA 1Q82R 1OI1A 1KHCA 2P4TA 2RI5A 1QVGS 4LXCA 1PG5B 4IIMA 4F7UF 1W2BS 3CCJA 4DEYA 3EGDA 4A4GA 3HHTB 3M4YA 3RNJA 2L0AA 1YFNA 1EX4A 4FT2A 4PKCC 4L5GA 2I0NA 1VYTA 2JMAA 3DLMA 2DRMA 2EJGA 1QVPA 3CC4Q 1D1BA 1MHNA 3VV0A 3KBGA 3OSVA 4UC4A 2H8HA 2HSEB 2JN0A 2PVOB 1ZQ1A 2QDLA 3OY9A 3VUBA 1VQ9A 2QQBA 3PE0A 3VYGA 1D0YA 4PJOA 2FHDA 4EMHA 2LX9A 1D09B 4M78F 2ZAEA 2K3BA 1LVKA 5LJ3f 4DA4A 2JZ2A 3O5ZA 2BZYA 3G71T 3M54A 1VYVA 4N4HA 4MMLA 1BYMA 2RHIA 5LJ5j 4M77A 2LC4A 2X4JA 3M0SA 1JXOA 4OGCA 2DK3A 3MP1A 2E65A 1AVZC 4WF2A 3PTAA 2ABLA 4DBRA 3RESA 5LJ5g 1UJYA 3M0PA 2DF6A 4ELZC 1ZSZA 4XTYA 1G3YA 4C92G 1FWZA 2JW4A 2CGHA 4M7AF 3OYJA 3X25B 1BCOA 1YJWA 3CC4A 3A8OB 3MJXA 1HD3A 1XQHA 1GCQC 3GF5A 1JRIA 2BE9B 4FT4A 3EGDB 2P0QA 4EDUA 2A0FB 4JRIA 1X69A 3QZ9B 2AKLA 3G71Q 5FU7C 2KYBA 2RHUA 3RERA 1WXUA 5GAMf 2QEXT 5FW9A 2M51A 3QDFA 4XU1A 1AZEA 1LJOA 4X34A 2KNBB 1IGQA 1WJRA 1Y07A 5FU7B 1AEYA 1TUCA 4XTWA 1NJIC 1YCYA 3VRYA 4PJOB 2JJ9A 4IUTA 4JZ3A 3RKXA 1MNDA 1YP5A 4RCBA 2RM4A 4LUEA 3I56T 1QCNA 1RI0A 4OMLA 1UECA 1ZSZC 1M8VA 2HQEA 5CCAA 1F1BB 3HKSA 2YLBA 1Y71A 4ORZA 2K7AA 1GBRA 3OYGA 1TU0B 1ZSZB 2QEXQ 5GAN2 3G71A 3OYMA 3HTRA 2ECZA 4J6XA 2VVKA 2O9VA 2RK2A 4BI8B 1OPKA 2H3JA 1GL5A 3M0TA 1NG2A 1VYUA 3G1JA 2EGCA 1ZX6A 3A8GB 5LJ5d 2DLPA 1TH7A 5D6YA 1RLPC 3VS4A 1OU9A 3HFOA 3GNGA 5KYNA 1RACB 2PU9B 3DB3A 4OGEA 2XU8A 2GNCA 2JXBA 2MWPA 2YLCA 4JS4A 1PSFA 3JSCA 2LJ3A 3DB4A 3I56Q 2HL3A 1QVFP 4ZN3A 1DJ7B 2BTTA 4PJJA 1NEBA 2EQKA 3VS7A 3REAB 2DERA 4HCKA 4C8QA 1LOJA 1VQ5Q 1M90U 1YJ9T 2DA9A 5GANe 1I07A 5DY9A 3CMET 3NFCA 2ESWA 4E7ZA 5A0GA 2BZXA 2JM8A 5GAMh 1YN8A 3M4GA 2CSIA 1Q95G 4FU6A 2FVUA 3OYDA 1VQNQ 2DVJA 2QEXA 3JRZA 2PQWA 3ZBDA 2E12A 2RQWA 4OF1A 4E2FB 1S72Q 1M3BA 1OZ3A 4C0DB 5CKDA 3OMGA 4PJOF 2KI7A 4MZPA 5CR2A 9ATCB 1YHQQ 1CSKA 2K4YA 2CH4A 1OOTA 3KUFA 1M90R 1C1AA 4AMCA 1WI7A 4M7DA 8AT1B 3UATA 1Y96A 4M77F 5LJ3j 4C92D 2AZVA 3A8MB 4GLMA 4BI3A 3OYYA 3I56A 4BI4A 1AWXA 1Y57A 3L2WA 3TREA 1YJ9Q 1QCOA 3CMEQ 2KXCA 2XG8D 3O8VA 5LJ3g 2I2LA 4LUDA 2E6NA 4F7UE 1VQ5A 2CT4A 3JCMP 4DQ2A 2E64A 4AG2C 4QQ6A 2COWA 3EFSA 2QXFA 2CS7A 3I5RA 1NM7A 1VQNA 1SRMA 3V7CA 4C8QB 2L89A 2DZCA 1VQ7A 4PFPA 3VKIA 1YITT 2EJFA 4OMPA 3CPWP 2WSCE 4C0GA 2QG9B 3NMZC 2KQWA 5CO7A 2P4RA 1S72A 3M0UA 2PUOB 5GMKe 1B7TA 3H0FA 1QMCA 4A4HA 1G3SA 5GAN7 4AG1C 1TTHB 2D9TA 1A0NB 1KJWA 1YHQA 4K11A 2EBPA 2LNVA 4FW2A 1G83A 3ZL7C 3UDCA 1OYXA 1VQPT 1KQSA 3VYHB 1TUGB 3NHNA 1TWBA 1NPPA 5GAMj 4NL3A 2DPPB 1D3BA 1BKBA 2HCKA 3S3NA 5GAOq 1VQ6T 1AHJB 3M56A 1GFCA 1RAFB 1NPRA 2ZPFB 1UG1A 3MO8A 1YJ9A 5GAMg 4M7DB 3OW2P 4QQDA 4HT9A 1Q81C 1ACMB 1Y96B 2KEAA 4N0AC 3UA6A 3P8DA 1NYFA 5CKBA 3TQ7P 5FRNA 3A98A 2XDDA 1G3WA 4IURA 4CC4B 4BE1A 2J6KA 2FPFA 2EGEA 3CQTA 2HSPA 1YITQ 3P8BB 1HYOA 1GRIA 2DYIA 1EIFA 1FX7A 2KY9A 4XU2A 1SHFA 1YI2Q 4E7SA 2DE0X 2F5KA 1H8KA 2ZPEB 4BUGA 1FYNA 4HT8A 5ECAA 1BCMA 2XDBA 1VQPQ 1UB4A 2E41A 3G7ZA 5KE2A 1BI2A 1UGRB 4OMOA 1RLQC 1WHGA 3EH1A 3CBPA 2J6OA 4C92A 3I55Q 3BY7A 3L1AA 4E7LA 1QVGP 5LJ3d 1W2BP 3F70A 4LDUA 4PK4A 1PC0A 4J8OA 3G6EA 3E19A 1WHMA 2CUBA 2JTEA 3JB9F 3RR6A 3P8HA 2O4XA 3S3OA 2DETA 4FCYA 1YJNT 3GP8A 2L3QA 4JDSA 1LNXA 1D3BB 3MEVA 2V1RA 1K0SA 4FYVB 3TCJA 3RUXA 2CREA 2G6FX 2HAXA 4C8QF 2XD0A 2WSEE 3U23A 1KK7A 2LP5A 3HSBA 4PJNA 2ROTA 2QYZA 4QVDA 4ZNXA 1UDLA 4X9CA 4DBHA 2ZGWA 2RK1A 4J9FA 5IXFA 3H0HA 1YI2A 5GAOp 3GIBA 2HDAA 1Y7XA 4LDVA 4O6JA 2RJCA 4NL2A 1K9MC 3RKYA 4FSXA 1M1KC 4J6WA 1VQPA 1NJIU 3LGLA 1M8MA 3CCMT 4C5EA 5KYUA 1K4US 2E3IA 5GAMd 4AFZC 3I55A 2HBWA 3CCUT 2OI3A 1BK2A 2D8HA 3NTHA 4C92C 3C95A 2YXYA 3CC2T 4M7DF 2GQIA 3OBWA 1YJNQ 3CCRT 1VQKT 2EYZA 1N6AA 1VQ8T 3J81E 2OAWA 2L3PA 3C94A 4HVVA 5FU6C 5CQXA 4C92B 1TOVA 2CZ6B 2Y90A 2HMAA 1KG1A 2YWWA 3EH2A 1X27A 1NJIR 3A1PA 5KYYA 2E70A 4J7IA 3QBYA 5FU6B 5I21A 4ESRA 3TU4K 2EGAA 2O4XB 3M0QA 1MV0B 2CYZB 3M9QA 3EHRA 4C0FA 1D1CA 5EC7A 1OEBA 3MEWA 3EHQA 1M3CA 2RI3A 3CCMQ 2NLUA 4CRIA 2FPDA 3QWXX 2CZ7B 3LWIA 2KAFA 2VWFA 4HVUA 2JUFA 1XNIA 3L2UA 3LWHA 4RTWA 4Q5WA 4PJOE 1SSFA 2L3SA 2JVVA 3CC2Q 2C0OA 1VQKQ 1RUWA 3OYHA 2DL8A 2VKNA 5KYXA 2KK4A 1VQ8Q 3JB9I 1X01A 4LDYA 2KE9A 5IH2A 1CKAA 1YJNA 4L59A 4M77E 1C0MA 2LRQA 3V8KA 4PNOA 1AOJA 2JNGA 4RCCA 5KYUB 3L2ZA 2F2WA 2VXEA 4M75E 2MPXC 3FRNA 3QIIA 3RIRA 1E7OA 3CCVT 1WLPB 3MHXA 1IRXA 5CIUA 1OULA 1O9SA 1GCQA 1C6VX 2C0TA 3LH5A 2K5FA 1BIBA 4XU0A 1G5VA 4E6RA 2F69A 2MMPA 1G2BA 3OSSC 2DL7A 1QWEA 3URGA 3OYKA 2SEMA 3CCMA 3CBOA 5KYYB 2AHJB 3CCET 1B07A 2LJ0A 2LCSA 1Q86C 4HCBA 3E9GA 3PIOA 3FDRA 4KGZB 3L2VA 3H8ZA 1VIFA 1NLPC 1ZUYA 5FLXE 3CC2A 1ZBXA 5GMKh 2DX1A 1VQKA 4JJDA 3VS5A 3LGFA 3PMIA 1X75C 2CUDA 1UHFA 1SHGA 4C92F 1O75A 4XK8E 4OB1B 3V7SA 2YRDA 1BI1A 4JRKA 1N8RR 2YDLA 3CCVQ 1EZZB 2HKNA 3CEYA 3PMTA 2DXUA 1WXTA 5KYXB 3QXEB 2NUPA 2DRKA 2JS2A 4L6V5 4A4FA 1KSWA 4HCCA 3OQ5A 2RQRA 1CKBA 3E9FA 4A4KA 5KCHA 2PTKA 4EMKC 2XHCA 5J26A 1IZ6A 2X35A 1GCPA 4OB2B 4FL6A 1V76A 3CCEQ 2RH2A 1FMKA 1VIEA 3TVTA 4EMKB 2RHYA 2RD1A 3FJPA 2CP3A 3E1SA 2FRWA 2ZCFB 4IIOA 3X24B 2YRVA 1QQJA 3HFNA 2W0ZA 1LCKA 1WHJA 3ZFJA 4RMOA 2M0OA 4DBFA 2HNIA 5HKCA 1VUBA 2P0KA 4J9BA 5IHIA 1U5SA 3PVLA 3V8JA 2YHTA 2K5IA 4JJCA 5C0MA 4OB3B 1Y0MA 3KXTA 2K5LA 3EG9A 2EQUA 1W70A 1Q81U 3JV3A 4LE9A 2FZKB 3CCVA 2RNAA 1JBMA 3N5BB 2R5MA 3DLLA 2O01E 4HKEA 4QVCA 2MCNA 5GMKl 4IKFA 4B6MA 1ZA1B 2QTVA 1WXBA 5IN1A 5GMKj 3LLRA 1X6BA 2IPOB 4C8QE 2MOXA 3A8HB 4ZN1A 2OTJT 2QQSA 4FYXB 3VS3A 4E47A 4BDYA 2NUPB 4CI0C 2KT8A 2DBKA 1UTIA 2J6FA 1YNZA 4XAXB 3WXMB 1Q81R 5IT9E 3THKA 3OMCA 2RJDA 4LDWA 2DXBA 1W4SA 1R0CB 1I4K1 4IUUA 2EIFA 1W6XA 3VU3C 3WVEB 1KD1C 3QSUA 1LPLA 5GAOl 1TS9A 2YUQA 2ZPHB 4OMFB 4M7DE 1JJ2A 4FW1A 1N9SA 3BE3A 1UE9A 1EFNA 5DM7R 2X4YA 4BDZA 4J9DA 5GJWB 3EG9B 3RMSA 1ZUKA 1BBZA 4LDXA 5GAN8 1PRLC 3SFMA 1K9MU 5AT1B 1M1KU 5KYWA 2H3EB 2RJFA 3SWNA 5CK9A 1KQSS 1WFWA 4ME7A 3DKMA 3OYNA 4IUQA 1N8RC 2K2MA 2P0PA 3JCMc 4QKUA 2KRMA 3CXCA 1JXMA 4R56A 4R0KA 4KH1B 4RKUE 4BE0A 2AK5A 2JT4A 5M9OA 1FXXA 1WJQA 3LX7A 4FM4B 4JRQA 3CPFA 4E7JA 1RI9A 4A53A 3HPWA 3CC7T 2ATCB 2QTXA 2EQIA 3JCMW 1VA7A 4OP0A 2PNIA 2YRCA 1K9MR 2COZA 1M1KR 3G4ST 1B3QA 4N0AA 5I2MA 2FG0A 2DZ9A 2V1QA 4O5VA 4PJOG 1TSFA 2RJEA 2EAYA 2W10A 2DL4A 1IHWA 2A3LA 1NBEB 2A36A 4Z88A 1VQ4T 3JB9H 1OZ2A 3M0RA 4AFSC 3JCMX 2DJZA 5FWCA 2V26A 1ZUUA 5GAN5 4J9GA 3WVDB 1XTDA 4JS5A 3QYHB 4M77G 3OYLA 4M75G 2EVRA 3I9QA 4FIBA 4RTUA 2D0NA 3QKJA 3SWNC 2XIDA 2M16A 1HSQA 3H9NA 3BDUA 4HA8A 3OS5A 4M78E 3FIFA 3CCLT 2XKOC 1T0HA 4P5NA 5KYWB 2C06A 4Y91A 3SWNB 3X20B 3ZEHA 1ARKA 4AT1B 3GBQA 3VS2A 1M2OA 3M55A 2DNUA 1NEGA 1UHCA 1GXIE 4HVWA 3C0CA 4Z89A 5AYFA 3G4SQ 2MYSA 3UT1A 3M59A 2KR3A 2ZPBB 3BDLA 4C92E 2AKKA 5J39A 2DL3A 4XTZA 1PKTA 3SHWA 2CZ1B 3CMEA 2A08A 1U1SA 2DIQA 2VV5A 1SG5A 1MMNA 2BE7D 1ABOA 1VOMA 4D8KA 2JOYA 2A7YA 4M7AE 1X2QA 1R77A 2MIOA 1I5LA 4EPCA 2E1HA 2YT6A 1IB8A 1Q7YC 3J7AF 1Q86U 2RMOA 5D6WA 3CCLQ 3CMAT 1UGSB 1WHLA 2HQHA 1VQMT 2LX7A 1WZOA 2RB6A 5GANf 1SPKA 3MP8A 2M9UA 2L3RA 4YTLA 1M2VB 1SF9A 4J6YA 3A5ZB 1VQ6Q 2MI6A 4AFUC 1MV3A 3MPUB 1AZGB 3CBMA 3G4SA 3VUZA 2R58A 3EAEA 2CSQA 2PVGB 5CQYA 5FRMA 4A63B 2Y4XA 4C5GA 5GJVB 2DMOA 2EPDA 1H92A 5A0LA 3QJ6A 1Q86R 1VQOT 5IAYA 2O31A 2RA2A 2D6FA 1RAIB 4J9HA 1K73C 5CKFA 1KC8C 2RQTA 5IXBA
chains in the Genus database with same CATH topology
3OYAA 2VGNA 5C6SA 3CCVT 4A4EA 3I56T 1RI0A 4BACA 3MHXA 2LQ8A 5CIUA 1NZ9A 1O9SA 3G6ET 1YITA 4JRPA 1M8VA 5A2QE 5KCOA 2HQEA 1M4ZA 5CCAA 2EJ9A 2K5FA 4GLKA 1BIBA 5HY6A 4XU0A 4C8QC 4M7AD 1G5VA 2IG0A 2EQMA 2FB7A 3HKSA 3GPLA 2CZ0B 2YLBA 1Y71A 1WQWA 3X28B 5LJ3e 3MCAB 3CCLA 2F69A 2MMPA 3CCQT 1K8AC 3CCJT 2VC8A 3OSSC 3OYGA 3URGA 2DTHA 3OYKA 3PNWC 1MGQA 1VQLA 5GAN2 3CCST 4ZGEB 3CCMA 1H641 3CBOA 4TVRA 4XQ3A 3G71A 2AHJB 3CCET 3OYMA 2DO3A 5CKEA 3OS1A 3OYIA 4HCBA 1Q86C 4J6XA 3QPHA 3E9GA 4BI8B 2RK2A 3FDRA 4C8QG 2H3JA 2D0QB 5DLOA 3PIOA 3L2VA 3H8ZA 1VQ6A 1QVFA 1VIFA 2LT4A 4VUBA 5FLXE 3CC2A 1ZBXA 3A8GB 3JCMg 2GFAA 5GMKh 1YI2T 1VQKA 3MEUA 4A54A 5LJ5d 3RKWA 3LGFA 3PMIA 1TH7A 1VQ9T 5D6YA 1X75C 4PJOD 1WJSA 3HFOA 2DAQA 3GNGA 2PU9B 3DB3A 3JCMQ 4C92F 3OYCA 1O75A 4XK8E 2HBPA 4OB1B 3LH0A 2KSSA 4OGEA 3V7SA 2RHZA 3JCMe 2LTOA 3C4SA 2XU8A 2ZPIB 1BI1A 4XTXA 4V2SA 2MWPA 2YLCA 3OS2A 3R6OA 4JS4A 1PSFA 3JSCA 4ZTFA 4JRKA 4M7DC 5I2SA 4IUVA 3DB4A 1M1FA 4ZGJB 2KVQG 4F7UA 4M77D 3CEYA 1DJ7B 2DXUA 3PMTA 3UWNA 4ZN3A 3I55T 3QXEB 2EQKA 2GFUA 3S3MA 4L6V5 4LD6A 4E7HA 4A4FA 1WPYA 4HCCA 4C8QA 1N27A 3OQ5A 1LOJA 1XOVA 4IUPA 2QQ9A 4KT0E 4M75D 3E9FA 2K2VA 4A4KA 5GMKi 3GOXA 2G3RA 5KCHA 1M90U 4MDXA 4EMKC 1YJ9T 1NE8A 2XHCA 3NTKA 5GANh 5GANe 5DY9A 3CMET 4N4GA 5J26A 1QP3A 1IZ6A 2X35A 3NFCA 3NTIA 1QVFS 4OB2B 5A0GA 4FL6A 5GAMh 4XTUA 1UGPB 3M4GA 2QQRA 3BFMA 4MZTA 5HK0A 2DTOA 2RH2A 1QP2A 1VIEA 4FU6A 2V8JA 2QI2A 4KBMB 2FVUA 3OYDA 4EMKB 2MWOA 3QYGB 5CKHA 2RHYA 3META 2QEXA 4RG8A 2RD1A 3FJPA 3E1SA 4DOWA 3JRZA 2PQWA 2QQAA 2ZCFB 4BY6C 3ZBDA 3CC7A 2E12A 2XICA 4OF1A 3V7RA 1KD1U 4M78A 3X24B 2YRVA 1YJWT 3CC4T 5LJ5f 3HFNA 2EYQA 1OZ3A 2E6ZA 4C0DB 5CKDA 4BE2A 3OMGA 5J3BA 4PJOF 2FYKA 3ZFJA 3BW1A 2DKGA 2WACA 4MZPA 5CR2A 4RMOA 2M0OA 3HL8A 5HKCA 2HNIA 3JAME 1VUBA 2P0KA 3HP9A 4BY6B 2E5QA 4J5YA 5GAN3 2K4YA 3V8JA 3X26B 2DVEA 3L2QA 3KUFA 2YHTA 4E7IA 4M7DA 2K5IA 5C0MA 5CVIA 4OB3B 1VQ4A 3KXTA 1Y96A 2K5LA 4KULA 3C12A 4M77F 5LJ3j 2EQUA 4C92D 2DEQA 2E10A 1Q81U 3A8MB 1U8RA 1M5Q1 3L2RA 4BI3A 3OYYA 2CKKA 3CCVA 3I56A 4BI4A 1JBMA 2BIVA 3N5BB 2R5MA 1N9RA 3JCMV 3TREA 4EMKA 5HK3A 3L2WA 2RO0A 3FC3A 3DLLA 2O01E 3SD4A 3ER0A 4HKEA 4QVCA 2XG8D 3O8VA 3CPWA 5LJ3g 2EKOA 2I2LA 1U1TA 2EWNA 2E6NA 2EQJA 4C0ZA 4F7UE 5GMKl 2LT1A 4N4IA 1VQ5A 4IKFA 4JJNK 2V8IA 4M7AA 5IN1A 5GMKj 3LLRA 1KQ2A 3JCMP 3CCQA 2Y4YA 4C8QE 4MDWA 4DQ2A 4EMGA 2E64A 3A8HB 3JB9G 1N8RU 2DXTA 4QQ6A 4ZN1A 4XTVA 3CCSA 2QQSA 2OTJT 3EFSA 4E47A 4F7UB 4LD9K 2EFIA 4ZTJA 4BDYA 2V8KA 1B34B 2LVMA 2QXFA 2CS7A 2PUKB 4CI0C 4F7UG 1VQNA 4C8QB 1UGQB 4Z02A 3V7CA 5DLQE 3JCMd 1M90C 2XI9A 2L89A 2DZCA 1VQ7A 3VKIA 3QZ5B 3MEAA 4GY5A 4XAXB 2DXCA 1YITT 2EJFA 2MF2A 3WXMB 3JCMJ 3VJPA 2WSCE 4C0GA 3CCUA 1M1GA 2KQWA 5IT9E 1G3TA 5CO7A 1S72A 1HK9A 3LYIA 3OYEA 3OMCA 2JTMA 2PUOB 2OAUA 2WSFE 2RJDA 2DXBA 3FLGA 4LDWA 5GMKe 3CCRA 4A4HA 1G3SA 4M78C 1RL2A 1W4SA 3QUIA 4QVZA 5GAN7 2D9TA 1H3ZA 1VQ8A 1YHQA 1I4K1 4IUUA 2LNVA 4B9XA 4QW2A 2EIFA 3OW2A 5GANj 3UDCA 1OYXA 1KHIA 3VU3C 3WVEB 3CPWS 1VQPT 1KD1C 1KQSA 3VYHB 3QSUA 4ELYC 2QA4T 5GAOl 1NPPA 5GAMj 4NL3A 2KMTA 2DPPB 1D3BA 1BKBA 1WQ7A 2JTFA 2BUDA 2QDYB 4M78B 5GAOq 3S3NA 3TEEA 4DOVA 3HRSA 1IREB 2ZPHB 4D6WA 4OMFB 3PFSA 4PLLA 3J80E 3OYFA 1VQ6T 4M7DE 4M78G 1AHJB 3LW5E 1KQ1A 3M56A 1B34A 3OYBA 5GANg 2OTLT 1NPRA 2VYTA 3FB9A 4OVAA 1JJ2A 2ZPFB 3H6ZA 3MO8A 1P92A 2GQVA 1YJ9A 4KUDK 1N9SA 4M75A 5GAMg 3S6WA 4RG2A 4M7DB 5DM7R 1WGSA 2X4YA 3A8LB 4BDZA 4QQDA 4E7KA 2RI2A 1BI3A 2LCLA 1Y96B 3FEOA 3CMAA 3JB9D 1Q81C 4HT9A 5KE3A 4JLIA 3RMSA 1X6OA 3OBYA 4M7DG 4N0AC 5L8RE 3P8DA 5CKBA 1VQMA 5FRNA 2IVWA 2B8AA 5GAMe 3QO3A 2XDDA 1G3WA 4IURA 4M7AC 3JCMf 4BE1A 4LDXA 3ME9A 5GAN8 5LJ5h 4ATOA 3OA6A 3SFMA 1K9MU 4PL6A 2VUBA 3EFRA 3P8BB 2R5AA 2XK0A 4C8QD 3OW2S 1M1KU 2L5QA 1Q82U 3JCMb 1I8FA 1BI0A 1ZHIA 1EIFA 2RJFA 3GLXA 1FX7A 3INZA 5EG2A 3SWNA 2KY9A 3MP6A 2R57A 4XU2A 3T9NA 4B9WA 1KQSS 4ME7A 4M7AB 3DKMA 3OYNA 4BD3A 4IUQA 2VXFA 1W2BA 2F5KA 5LL6S 1N8RC 2K3YA 2BKDN 2DIGA 3OB9A 2P0PA 5KH6A 3JCMc 2ZPEB 4BUGA 4HT8A 4M7AG 3CXCA 4R56A 4C5HA 3GNFB 3QJYA 5CK9A 2XDBA 1UB4A 1R8OB 4RKUE 4BE0A 5M9OA 2E41A 2LCCA 3G7ZA 5KE2A 1JJ2S 1BI2A 1VQOA 1UGRB 1HXDA 1FXXA 1WJQA 2L8DA 2HD0A 3LX7A 4II1A 3M53A 1YIJT 3CBPA 4FM4B 4PJOC 3ASKA 4JRQA 4C92A 3CPFA 4E7JA 1YBYA 3AHUA 4A53A 3BY7A 3HPWA 3L1AA 4E7LA 3CC7T 5LJ3d 4MMKA 2QTXA 3CD6T 4HCZA 4R55A 3JCMW 4OP0A 4NS5A 5GAOn 2DTIA 3F70A 4LDUA 5GAN4 4J8OA 5GMKm 3G6EA 3E19A 3OS0A 3QDRB 3G4ST 3JB9F 4M77C 3P8HA 4N0AA 5I2MA 2DZ9A 1OI1A 2O4XA 1KHCA 3S3OA 4M7DD 1UEBA 3PT9A 2P4TA 2RI5A 4O5VA 4PJOG 3QHSA 1YJNT 1QVGS 2RJEA 3GP8A 2EAYA 4F7UF 1I81A 4JDSA 2A3LA 1VQ4T 1LNXA 4M75C 3CCJA 1D3BB 1OZ2A 1W2BS 3MEVA 1Q7YU 3JB9H 2HQXA 4A4GA 3TCJA 3HHTB 3M4YA 3RUXA 5GAOr 2HAXA 4J83A 4M77B 4C8QF 2DJZA 3JCMX 2XD0A 2WSEE 3CXCS 2DD4A 3SB2A 3HRTA 5GAN5 5GAN6 3CCEA 3QG1A 4FT2A 2PVDB 4PKCC 4L5GA 1XTDA 2XDPA 3QYHB 4M77G 3WVDB 4JS5A 3HSBA 3DLMA 2EJGA 1QVPA 4X9DA 4M75B 4QVDA 1MHNA 3VV0A 4Y28E 3OYLA 3KBGA 3OSVA 2LQKA 4JUVA 4UC4A 4X9CA 2F5TX 2JN0A 2ZGWA 2RK1A 2PVOB 4M75G 1M9SA 1ZQ1A 1YI2A 1VQ5T 2MAMA 4FIBA 5GAOp 3OY9A 3GIBA 1PSEA 1Y7XA 4LDVA 3QKJA 3SWNC 3VUBA 4O6JA 5LJ3h 2XIDA 2M16A 1VQ9A 2QQBA 2RJCA 2LDMA 4NL2A 3BDUA 3VYGA 4HA8A 1K9MC 3RKYA 3OS5A 4M78E 3FIFA 4FSXA 2FHDA 3CCLT 4J6WA 5GAOm 1M1KC 4PJOA 1VQPA 4EMHA 1NJIU 2XKOC 2LX9A 3LGLA 1Q82C 1QVGA 2QA4A 4M78F 3M58A 1VQLT 4P5NA 5LJ3f 3CCMT 5GANd 3UPUA 4Y91A 4DA4A 4C5EA 2C06A 2GCXA 3SWNB 2JZ2A 1VQNT 3G71T 3M54A 3X20B 3ZEHA 4XU3A 1VQ7T 4N4HA 4MMLA 5GAMd 1BYMA 2RHIA 3M55A 3I55A 2X4WA 3RMQA 5LJ5j 1BIAA 4OB0B 4M77A 3CCUT 2OTLA 1GXIE 2LC4A 2X4JA 4JLGA 5AYFA 1K73U 3UT1A 1S72T 4OGCA 5CAIA 3M59A 3NTHA 4C92C 2DK3A 2ZPBB 3BDLA 2ZPGB 3C95A 3CC2T 3OBWA 4C92E 1KC8U 4M7DF 5J39A 3CCRT 1VQKT 2K57A 4XTZA 3MP1A 2KDSA 2E65A 2K3XA 1N6AA 1VQ8T 2CZ1B 3CMEA 1YHQT 3J81E 4WF2A 3JCMh 1U1SA 3PTAA 3C94A 2DIQA 3RESA 5LJ5g 2VV5A 5FU6C 5CQXA 4C92B 2CZ6B 2Y90A 2M1HA 1KG1A 4ELZC 3M57A 3M5AA 4C5IA 4XTYA 5D6XA 1G3YA 2JOYA 4C92G 1FWZA 2A7YA 1K8AU 4M7AE 5LJ5e 2CGHA 2E70A 4J7IA 3QBYA 4M7AF 5FU6B 5I21A 3OYJA 3X25B 4EPCA 1I5LA 3TU4K 4QQGA 1YJWA 3CC4A 2ZZDA 3L42A 2O4XB 3A8OB 2E1HA 1Q7YC 2CYZB 1XQHA 3M9QA 1Q86U 4C0FA 3J7AF 5D6WA 3GF5A 1JRIA 1WNLA 1UGSB 3CMAT 3MEWA 1V29B 4FT4A 2P0QA 4EDUA 1VQMT 2RI3A 4C0DC 2RB6A 4JRIA 2NLUA 4CRIA 5GANf 4PLIA 3QZ9B 3PIPA 2CZ7B 3MP8A 3LWIA 2M9UA 2KAFA 3Q1JA 5A0DA 2L3RA 4BB7A 5FU7C 1YIJA 1QW1A 2RHXA 4YTLA 2RHUA 3RERA 2JUFA 4J6YA 5GAMf 2QEXT 1XNIA 3A5ZB 3L2UA 2MI6A 3LWHA 4Q5WA 3CD6A 2DD5A 4ZGDB 4PJOE 1SSFA 3JB9J 4M78D 4XU1A 2FL7A 2JVVA 1LJOA 4X34A 1WJRA 1Y07A 3CBMA 3HRUA 1JB0E 3OYHA 5FU7B 2KK4A 3G4SA 2GF7A 3VUZA 2R58A 3JB9I 4XTWA 1NJIC 2VGMA 1X01A 2PVGB 3EAEA 4LDYA 4MZMA 5CQYA 5FRMA 1YCYA 2Y4XA 4PJOB 4IUTA 1YJNA 4C5GA 4L59A 2X4XA 3PGGA 4M77E 2LRQA 5A0LA 3QJ6A 3V8KA 1VQOT 5IAYA 4PNOA 3RKXA 2JNGA 4RCCA 3L2ZA 2RA2A 5FROA 2OTJA 4KUIA 2D6FA 2VXEA 4M75E 1K73C 4NOYA 4J7FA 4RCBA 2RM4A 3SDZA 5CKFA 1KC8C 4M75F 3V8LA 3FRNA 3QIIA 3RIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5N A; 
#chains in the Genus database with same CATH topology
 2FEI A;  3OYA A;  2VGN A;  5C6S A;  2LQ8 A;  3REB B;  1NZ9 A;  2X3W D;  1YIT A;  5KCO A;  1M4Z A;  4GLK A;  1UUE A;  5HY6 A;  4JPB W;  2IG0 A;  4AFQ C;  1PRM C;  1K76 A;  3GPL A;  3TSW A;  1WQW A;  5LJ3 e;  3CCL A;  1K8A C;  2VAS A;  3CCJ T;  2DTH A;  5I11 A;  4ZGE B;  1H64 1;  4TVR A;  2RQU A;  2YUP A;  1R0B G;  5CKE A;  3OYI A;  3QPH A;  4C8Q G;  2D0Q B;  1VQ6 A;  1Z9Z A;  1QVF A;  2LT4 A;  4VUB A;  2B86 A;  1JQQ A;  2E4H A;  3RKW A;  1N5Z A;  1VQ9 T;  1OQK A;  4HXJ A;  2LQN A;  1WJS A;  4PJO D;  3NGP A;  2DM1 A;  3JCM Q;  3OYC A;  1U06 A;  3JCM e;  2KSS A;  2RHZ A;  2ZPI B;  2BZ8 A;  4XTX A;  3R6O A;  4ZTF A;  5I2S A;  4IUV A;  1M1F A;  1MMD A;  2KVQ G;  4ZGJ B;  4M77 D;  3UWN A;  4WTO B;  2GFU A;  4E7H A;  1WPY A;  4OMN A;  1H3H A;  4KT0 E;  4M75 D;  3GOX A;  2LZ6 B;  4MDX A;  1NE8 A;  5GAN h;  2D1X A;  3E2U A;  4N4G A;  1OU8 A;  1OX9 A;  1ZSG A;  1ZBJ A;  1M30 A;  1QKW A;  4XTU A;  1UGP B;  1WX6 A;  1MUZ A;  3BFM A;  4MZT A;  2DTO A;  1ABQ A;  2GGR A;  2QI2 A;  3AT1 B;  2MWO A;  3MET A;  4PFZ A;  1E6H A;  4DOW A;  2QQA A;  2RQV A;  3CCU Q;  2XIC A;  1KD1 U;  1YJW T;  3CC4 T;  2CT3 A;  2EYQ A;  4RTX A;  2DJQ A;  3CCR Q;  4X1V A;  2FYK A;  1AWW A;  3BW1 A;  2DKG A;  2WAC A;  5FWB A;  3JAM E;  1OV3 A;  2EKH A;  3HP9 A;  2JS0 A;  5GAN 3;  4WCI A;  3X26 B;  2DVE A;  3I35 A;  1IGU A;  2GBQ A;  1I5O B;  5CVI A;  2CP2 A;  3UF4 A;  3C12 A;  1U3O A;  2DEQ A;  2E10 A;  2CH4 W;  2CKK A;  4RTV A;  2BIV A;  1N9R A;  2P84 A;  3JCM V;  4EMK A;  5HK3 A;  3EG3 A;  1OPL A;  5HCK A;  3EG0 A;  3CPW A;  2FRY A;  1U1T A;  2EWN A;  4C0Z A;  1KD1 R;  2LT1 A;  4RTZ A;  4JJN K;  4CC2 A;  1WIE A;  2XMF A;  1KQ2 A;  4MDW A;  1N8R U;  4XTV A;  4LD9 K;  2V8K A;  1B34 B;  2LVM A;  5D7U A;  2O88 A;  2PUK B;  4F7U G;  1YJW Q;  1UGQ B;  5DLQ E;  1YCS B;  2O9S A;  3QZ5 B;  3MEA A;  4GY5 A;  2MF2 A;  4RTT A;  3JCM J;  1PHT A;  3VJP A;  3CCU A;  4OMQ A;  2O2O A;  2AZS A;  3OYE A;  2EYX A;  2JTM A;  2WSF E;  2HKQ B;  2KGT A;  3CCR A;  1PD1 A;  3QUI A;  2C0I A;  1H3Z A;  1X6G A;  1VQ8 A;  1W1F A;  2DBM A;  1RAB B;  4B9X A;  2OX7 A;  3OW2 A;  1T3L A;  5GAN j;  1KHI A;  2DIL A;  2QA4 T;  2KMT A;  1JEG A;  3VRZ A;  2GTJ A;  2JTF A;  2BUD A;  4DOV A;  6AT1 B;  4PLL A;  3PFS A;  3OYF A;  4M78 G;  3LW5 E;  4J9E A;  5GAN g;  3VS0 A;  2OTL T;  2VYT A;  3EFO A;  3FB9 A;  4OVA A;  3H6Z A;  1P92 A;  4M75 A;  1WGS A;  4KH0 B;  1BI3 A;  2LCL A;  3JB9 D;  1KQS P;  2KRN A;  4GBQ A;  4KGV B;  4CC7 A;  1PD0 A;  3UA7 A;  3JCM f;  1Z9Q A;  3ME9 A;  3OA6 A;  2DFU A;  4PL6 A;  2VUB A;  8ATC B;  2R5A A;  4C8Q D;  1WHK A;  2L5Q A;  1I8F A;  3INZ A;  3GLX A;  1QVG A;  3T9N A;  2R57 A;  4B9W A;  1W2B A;  1GFD A;  2BKD N;  2DIG A;  4M4Z A;  4Z8A A;  5KH6 A;  2QK0 A;  4M7A G;  2KBT A;  2NWM A;  1MNE A;  3GNF B;  3QJY A;  4ANJ A;  2F1L A;  1UJ0 A;  2AIR B;  2QA4 Q;  1JJ2 S;  1HXD A;  2COY A;  2NUZ A;  2DEU A;  3M53 A;  1YIJ T;  4PJO C;  4KRT A;  3AHU A;  3EGU A;  2OTL Q;  2QGG A;  3CD6 T;  4HCZ A;  4RTY A;  5GAO n;  4NS5 A;  3MKD A;  5GMK m;  3EG2 A;  3QDR B;  2LJ1 A;  4D8D A;  4M77 C;  4LN2 A;  2X51 A;  4F16 A;  1UEB A;  3PT9 A;  4M7D D;  2EYY A;  3QHS A;  2CP7 A;  1I81 A;  2YUO A;  4M75 C;  1Q7Y U;  1TUD A;  2HQX A;  5GAO r;  4J83 A;  2OJ2 A;  4M77 B;  3CXC S;  2DD4 A;  3SB2 A;  3HRT A;  5GAN 6;  1G8X A;  3QG1 A;  3CCE A;  2PVD B;  2XDP A;  3EFO B;  4X9D A;  4M75 B;  3VS1 A;  4Y28 E;  4JUV A;  2LQK A;  2F5T X;  3KFV A;  1M9S A;  1VQ5 T;  2MAM A;  3QWY A;  1PSE A;  1UFF A;  5LJ3 h;  2LDM A;  2SRC A;  2VB6 A;  1QKX A;  1YIJ Q;  5GAO m;  1RAH B;  2L2P A;  4F14 A;  2RPN A;  1Q82 C;  2QA4 A;  3M58 A;  1VQL T;  2FO0 A;  2FZC B;  5GAN d;  3UPU A;  3CD6 Q;  2LQW A;  2GCX A;  1VQN T;  1QCF A;  1Q7Y R;  4F04 B;  4XU3 A;  4PFO A;  1VQ7 T;  3EGX A;  3PVQ A;  5IHK A;  2X4W A;  3RMQ A;  4OB0 B;  1BIA A;  2OTL A;  1TG0 A;  4JLG A;  1K73 U;  1S72 T;  5CAI A;  1SEM A;  2ZPG B;  4PJM A;  1SKU B;  1KC8 U;  2K57 A;  2RF0 A;  2KDS A;  2K3X A;  1YHQ T;  3JCM h;  1M3A A;  2J7I A;  2E3H A;  2OTJ Q;  4CC3 A;  2M1H A;  2CP5 A;  3M57 A;  3M5A A;  4C5I A;  5D6X A;  7AT1 B;  1K8A U;  5LJ5 e;  1X2K A;  2MK5 A;  1MMG A;  3NPF A;  2FPE A;  4QQG A;  2JM9 A;  2ZZD A;  3FJ5 A;  3L42 A;  1K73 R;  1WNL A;  1V29 B;  2K6D A;  1KC8 R;  4FYY B;  1VQL Q;  4C0D C;  4PLI A;  3PIP A;  1YIJ A;  3Q1J A;  5A0D A;  4BB7 A;  1VQ7 Q;  1QW1 A;  2RHX A;  2LMJ A;  1JO8 A;  2QGF B;  3CD6 A;  2DD5 A;  4ZGD B;  2HZY A;  3JB9 J;  4M78 D;  2FL7 A;  3EG1 A;  3HRU A;  1JB0 E;  1K8A R;  1AWO A;  2GF7 A;  4QT7 A;  2VGM A;  4MZM A;  1SRL A;  3SEM A;  2X4X A;  3PGG A;  1T0J A;  4F17 A;  1UGV A;  1IXD A;  1RAD B;  5FRO A;  2OTJ A;  4KUI A;  3EGX B;  2LNH B;  4NOY A;  4J7F A;  4J9C A;  1PWT A;  3SDZ A;  1IHV A;  4M75 F;  3V8L A;  1D0Z A;  4A4E A;  4BAC A;  1RAE B;  1FMW A;  1M2V A;  3G6E T;  4JRP A;  4EIK A;  2JMC A;  5A2Q E;  2NYS A;  1KFZ A;  2HL5 C;  2EJ9 A;  1PCX A;  4C8Q C;  1PKS A;  4M7A D;  2EQM A;  2FB7 A;  2CZ0 B;  4OMM A;  1FMV A;  3X28 B;  3MCA B;  3CCQ T;  1XJW B;  2VC8 A;  1BB9 A;  2M02 A;  3PNW C;  1MGQ A;  1NLO C;  1VQL A;  3CCS T;  2M0Y A;  4XQ3 A;  1YWO A;  2ED1 A;  3CC7 Q;  2DO3 A;  3OS1 A;  3R6N A;  5DLO A;  3JCM g;  1YI2 T;  2GFA A;  3MEU A;  4A54 A;  2DAQ A;  1PM3 A;  1VQ4 Q;  2HBP A;  3LH0 A;  2LTO A;  3C4S A;  2HEQ A;  4V2S A;  1ZA2 B;  3OS2 A;  4M7D C;  2QAZ A;  1K0X A;  4F7U A;  3G6E Q;  2A37 A;  3I55 T;  1K1Z A;  4JJB A;  3S3M A;  3ULR B;  4LD6 A;  2ROL A;  1N27 A;  1T3S A;  1XOV A;  2X3X D;  4IUP A;  2QQ9 A;  1QLY A;  3D7S B;  2K2V A;  5GMK i;  2G3R A;  2X9H A;  3NTK A;  2KT1 A;  3CCQ Q;  1QP3 A;  3NTI A;  1QVF S;  3CCS Q;  2DYB A;  2QQR A;  5HK0 A;  1IO6 A;  2KRS A;  1QP2 A;  2V8J A;  4KBM B;  3VS6 A;  3QYG B;  5CKH A;  2ENM A;  4RG8 A;  4J9I A;  1RAG B;  5I22 A;  2ED0 A;  4BY6 C;  3CC7 A;  3V7R A;  5IHN A;  4M78 A;  1GBQ A;  5LJ5 f;  2E6Z A;  4BE2 A;  4Y92 A;  5J3B A;  2CP0 A;  2E5K A;  3HL8 A;  4LNP A;  2YUN A;  1NYG A;  1TXQ A;  4BY6 B;  2E5Q A;  4J5Y A;  2AT1 B;  1S1N A;  3L2Q A;  4E7I A;  2NUT A;  2KYM A;  1AT1 B;  1VQ4 A;  2GTO A;  4KUL A;  2J06 A;  1WDX A;  2A28 A;  1U8R A;  1M5Q 1;  3L2R A;  4DEX A;  2PZ1 A;  2FZG B;  1WHH A;  3FC3 A;  2RO0 A;  1M27 C;  3I5S A;  3ER0 A;  4JZ4 A;  3SD4 A;  1I1J A;  2Z0W A;  2EKO A;  2CP6 A;  2EQJ A;  1HJD A;  4N4I A;  3CMA Q;  1SSH A;  2V8I A;  4M7A A;  1AWJ A;  1VQM Q;  3CCQ A;  2Y4Y A;  2YSQ A;  4EMG A;  3JB9 G;  2DXT A;  3CCS A;  4F7U B;  2EFI A;  4ZTJ A;  1KIK A;  1J3T A;  1K9A A;  3JCM d;  1M90 C;  4Z02 A;  1QWF A;  2XI9 A;  3TSZ A;  3RDV A;  1WYX A;  2DXC A;  4FYW B;  3H0I A;  1M1G A;  1G3T A;  1HK9 A;  3LYI A;  2OAU A;  2EYW A;  1AD5 A;  3FLG A;  2KXD A;  3H41 A;  1OX8 A;  4M78 C;  1RL2 A;  4QVZ A;  2F2V A;  1VQO Q;  4QW2 A;  5L23 A;  3CPW S;  1MMA A;  4ELY C;  2DL5 A;  1WQ7 A;  2QDY B;  4M78 B;  3TEE A;  3RBB B;  3HRS A;  1IRE B;  4D6W A;  3J80 E;  1PNJ A;  2J05 A;  1KQ1 A;  1B34 A;  3OYB A;  1ZLM A;  2GQV A;  4KUD K;  4FSS A;  3S6W A;  4RG2 A;  2NUT B;  1D0X A;  3A8L B;  4E7K A;  2RI2 A;  3FEO A;  1D1A A;  3CMA A;  3CCJ Q;  2KRO A;  5KE3 A;  4JLI A;  1X6O A;  1X43 A;  3OBY A;  4M7D G;  5L8R E;  1VQM A;  2IVW A;  2B8A A;  5GAM e;  3QO3 A;  4DBQ A;  1JU5 C;  4M7A C;  1RAA B;  5LJ5 h;  4ATO A;  4PJL A;  3EFR A;  2XK0 A;  3OW2 S;  1Q82 U;  3JCM b;  1ZHI A;  1BI0 A;  1JJ2 P;  5EG2 A;  3MP6 A;  2QAS A;  4M7A B;  4BD3 A;  1YWP A;  2VXF A;  5LL6 S;  2EW3 A;  2K3Y A;  1VQ9 Q;  3OB9 A;  1E6G A;  1WA7 A;  4C5H A;  1I0C A;  1R8O B;  2LCC A;  1VQO A;  2L8D A;  2HD0 A;  4II1 A;  1V1C A;  2D8J A;  4RUG A;  3ASK A;  1YBY A;  4KGX B;  2CDT A;  1BU1 A;  4MMK A;  2K79 A;  2RN8 A;  4R55 A;  2DTI A;  3IQL A;  2IIM A;  5GAN 4;  2F2X A;  3OS0 A;  3CXC P;  2K9G A;  1Q82 R;  1OI1 A;  1KHC A;  2P4T A;  2RI5 A;  1QVG S;  4LXC A;  1PG5 B;  4IIM A;  4F7U F;  1W2B S;  3CCJ A;  4DEY A;  3EGD A;  4A4G A;  3HHT B;  3M4Y A;  3RNJ A;  2L0A A;  1YFN A;  1EX4 A;  4FT2 A;  4PKC C;  4L5G A;  2I0N A;  1VYT A;  2JMA A;  3DLM A;  2DRM A;  2EJG A;  1QVP A;  3CC4 Q;  1D1B A;  1MHN A;  3VV0 A;  3KBG A;  3OSV A;  4UC4 A;  2H8H A;  2HSE B;  2JN0 A;  2PVO B;  1ZQ1 A;  2QDL A;  3OY9 A;  3VUB A;  1VQ9 A;  2QQB A;  3PE0 A;  3VYG A;  1D0Y A;  4PJO A;  2FHD A;  4EMH A;  2LX9 A;  1D09 B;  4M78 F;  2ZAE A;  2K3B A;  1LVK A;  5LJ3 f;  4DA4 A;  2JZ2 A;  3O5Z A;  2BZY A;  3G71 T;  3M54 A;  1VYV A;  4N4H A;  4MML A;  1BYM A;  2RHI A;  5LJ5 j;  4M77 A;  2LC4 A;  2X4J A;  3M0S A;  1JXO A;  4OGC A;  2DK3 A;  3MP1 A;  2E65 A;  1AVZ C;  4WF2 A;  3PTA A;  2ABL A;  4DBR A;  3RES A;  5LJ5 g;  1UJY A;  3M0P A;  2DF6 A;  4ELZ C;  1ZSZ A;  4XTY A;  1G3Y A;  4C92 G;  1FWZ A;  2JW4 A;  2CGH A;  4M7A F;  3OYJ A;  3X25 B;  1BCO A;  1YJW A;  3CC4 A;  3A8O B;  3MJX A;  1HD3 A;  1XQH A;  1GCQ C;  3GF5 A;  1JRI A;  2BE9 B;  4FT4 A;  3EGD B;  2P0Q A;  4EDU A;  2A0F B;  4JRI A;  1X69 A;  3QZ9 B;  2AKL A;  3G71 Q;  5FU7 C;  2KYB A;  2RHU A;  3RER A;  1WXU A;  5GAM f;  2QEX T;  5FW9 A;  2M51 A;  3QDF A;  4XU1 A;  1AZE A;  1LJO A;  4X34 A;  2KNB B;  1IGQ A;  1WJR A;  1Y07 A;  5FU7 B;  1AEY A;  1TUC A;  4XTW A;  1NJI C;  1YCY A;  3VRY A;  4PJO B;  2JJ9 A;  4IUT A;  4JZ3 A;  3RKX A;  1MND A;  1YP5 A;  4RCB A;  2RM4 A;  4LUE A;  3I56 T;  1QCN A;  1RI0 A;  4OML A;  1UEC A;  1ZSZ C;  1M8V A;  2HQE A;  5CCA A;  1F1B B;  3HKS A;  2YLB A;  1Y71 A;  4ORZ A;  2K7A A;  1GBR A;  3OYG A;  1TU0 B;  1ZSZ B;  2QEX Q;  5GAN 2;  3G71 A;  3OYM A;  3HTR A;  2ECZ A;  4J6X A;  2VVK A;  2O9V A;  2RK2 A;  4BI8 B;  1OPK A;  2H3J A;  1GL5 A;  3M0T A;  1NG2 A;  1VYU A;  3G1J A;  2EGC A;  1ZX6 A;  3A8G B;  5LJ5 d;  2DLP A;  1TH7 A;  5D6Y A;  1RLP C;  3VS4 A;  1OU9 A;  3HFO A;  3GNG A;  5KYN A;  1RAC B;  2PU9 B;  3DB3 A;  4OGE A;  2XU8 A;  2GNC A;  2JXB A;  2MWP A;  2YLC A;  4JS4 A;  1PSF A;  3JSC A;  2LJ3 A;  3DB4 A;  3I56 Q;  2HL3 A;  1QVF P;  4ZN3 A;  1DJ7 B;  2BTT A;  4PJJ A;  1NEB A;  2EQK A;  3VS7 A;  3REA B;  2DER A;  4HCK A;  4C8Q A;  1LOJ A;  1VQ5 Q;  1M90 U;  1YJ9 T;  2DA9 A;  5GAN e;  1I07 A;  5DY9 A;  3CME T;  3NFC A;  2ESW A;  4E7Z A;  5A0G A;  2BZX A;  2JM8 A;  5GAM h;  1YN8 A;  3M4G A;  2CSI A;  1Q95 G;  4FU6 A;  2FVU A;  3OYD A;  1VQN Q;  2DVJ A;  2QEX A;  3JRZ A;  2PQW A;  3ZBD A;  2E12 A;  2RQW A;  4OF1 A;  4E2F B;  1S72 Q;  1M3B A;  1OZ3 A;  4C0D B;  5CKD A;  3OMG A;  4PJO F;  2KI7 A;  4MZP A;  5CR2 A;  9ATC B;  1YHQ Q;  1CSK A;  2K4Y A;  2CH4 A;  1OOT A;  3KUF A;  1M90 R;  1C1A A;  4AMC A;  1WI7 A;  4M7D A;  8AT1 B;  3UAT A;  1Y96 A;  4M77 F;  5LJ3 j;  4C92 D;  2AZV A;  3A8M B;  4GLM A;  4BI3 A;  3OYY A;  3I56 A;  4BI4 A;  1AWX A;  1Y57 A;  3L2W A;  3TRE A;  1YJ9 Q;  1QCO A;  3CME Q;  2KXC A;  2XG8 D;  3O8V A;  5LJ3 g;  2I2L A;  4LUD A;  2E6N A;  4F7U E;  1VQ5 A;  2CT4 A;  3JCM P;  4DQ2 A;  2E64 A;  4AG2 C;  4QQ6 A;  2COW A;  3EFS A;  2QXF A;  2CS7 A;  3I5R A;  1NM7 A;  1VQN A;  1SRM A;  3V7C A;  4C8Q B;  2L89 A;  2DZC A;  1VQ7 A;  4PFP A;  3VKI A;  1YIT T;  2EJF A;  4OMP A;  3CPW P;  2WSC E;  4C0G A;  2QG9 B;  3NMZ C;  2KQW A;  5CO7 A;  2P4R A;  1S72 A;  3M0U A;  2PUO B;  5GMK e;  1B7T A;  3H0F A;  1QMC A;  4A4H A;  1G3S A;  5GAN 7;  4AG1 C;  1TTH B;  2D9T A;  1A0N B;  1KJW A;  1YHQ A;  4K11 A;  2EBP A;  2LNV A;  4FW2 A;  1G83 A;  3ZL7 C;  3UDC A;  1OYX A;  1VQP T;  1KQS A;  3VYH B;  1TUG B;  3NHN A;  1TWB A;  1NPP A;  5GAM j;  4NL3 A;  2DPP B;  1D3B A;  1BKB A;  2HCK A;  3S3N A;  5GAO q;  1VQ6 T;  1AHJ B;  3M56 A;  1GFC A;  1RAF B;  1NPR A;  2ZPF B;  1UG1 A;  3MO8 A;  1YJ9 A;  5GAM g;  4M7D B;  3OW2 P;  4QQD A;  4HT9 A;  1Q81 C;  1ACM B;  1Y96 B;  2KEA A;  4N0A C;  3UA6 A;  3P8D A;  1NYF A;  5CKB A;  3TQ7 P;  5FRN A;  3A98 A;  2XDD A;  1G3W A;  4IUR A;  4CC4 B;  4BE1 A;  2J6K A;  2FPF A;  2EGE A;  3CQT A;  2HSP A;  1YIT Q;  3P8B B;  1HYO A;  1GRI A;  2DYI A;  1EIF A;  1FX7 A;  2KY9 A;  4XU2 A;  1SHF A;  1YI2 Q;  4E7S A;  2DE0 X;  2F5K A;  1H8K A;  2ZPE B;  4BUG A;  1FYN A;  4HT8 A;  5ECA A;  1BCM A;  2XDB A;  1VQP Q;  1UB4 A;  2E41 A;  3G7Z A;  5KE2 A;  1BI2 A;  1UGR B;  4OMO A;  1RLQ C;  1WHG A;  3EH1 A;  3CBP A;  2J6O A;  4C92 A;  3I55 Q;  3BY7 A;  3L1A A;  4E7L A;  1QVG P;  5LJ3 d;  1W2B P;  3F70 A;  4LDU A;  4PK4 A;  1PC0 A;  4J8O A;  3G6E A;  3E19 A;  1WHM A;  2CUB A;  2JTE A;  3JB9 F;  3RR6 A;  3P8H A;  2O4X A;  3S3O A;  2DET A;  4FCY A;  1YJN T;  3GP8 A;  2L3Q A;  4JDS A;  1LNX A;  1D3B B;  3MEV A;  2V1R A;  1K0S A;  4FYV B;  3TCJ A;  3RUX A;  2CRE A;  2G6F X;  2HAX A;  4C8Q F;  2XD0 A;  2WSE E;  3U23 A;  1KK7 A;  2LP5 A;  3HSB A;  4PJN A;  2ROT A;  2QYZ A;  4QVD A;  4ZNX A;  1UDL A;  4X9C A;  4DBH A;  2ZGW A;  2RK1 A;  4J9F A;  5IXF A;  3H0H A;  1YI2 A;  5GAO p;  3GIB A;  2HDA A;  1Y7X A;  4LDV A;  4O6J A;  2RJC A;  4NL2 A;  1K9M C;  3RKY A;  4FSX A;  1M1K C;  4J6W A;  1VQP A;  1NJI U;  3LGL A;  1M8M A;  3CCM T;  4C5E A;  5KYU A;  1K4U S;  2E3I A;  5GAM d;  4AFZ C;  3I55 A;  2HBW A;  3CCU T;  2OI3 A;  1BK2 A;  2D8H A;  3NTH A;  4C92 C;  3C95 A;  2YXY A;  3CC2 T;  4M7D F;  2GQI A;  3OBW A;  1YJN Q;  3CCR T;  1VQK T;  2EYZ A;  1N6A A;  1VQ8 T;  3J81 E;  2OAW A;  2L3P A;  3C94 A;  4HVV A;  5FU6 C;  5CQX A;  4C92 B;  1TOV A;  2CZ6 B;  2Y90 A;  2HMA A;  1KG1 A;  2YWW A;  3EH2 A;  1X27 A;  1NJI R;  3A1P A;  5KYY A;  2E70 A;  4J7I A;  3QBY A;  5FU6 B;  5I21 A;  4ESR A;  3TU4 K;  2EGA A;  2O4X B;  3M0Q A;  1MV0 B;  2CYZ B;  3M9Q A;  3EHR A;  4C0F A;  1D1C A;  5EC7 A;  1OEB A;  3MEW A;  3EHQ A;  1M3C A;  2RI3 A;  3CCM Q;  2NLU A;  4CRI A;  2FPD A;  3QWX X;  2CZ7 B;  3LWI A;  2KAF A;  2VWF A;  4HVU A;  2JUF A;  1XNI A;  3L2U A;  3LWH A;  4RTW A;  4Q5W A;  4PJO E;  1SSF A;  2L3S A;  2JVV A;  3CC2 Q;  2C0O A;  1VQK Q;  1RUW A;  3OYH A;  2DL8 A;  2VKN A;  5KYX A;  2KK4 A;  1VQ8 Q;  3JB9 I;  1X01 A;  4LDY A;  2KE9 A;  5IH2 A;  1CKA A;  1YJN A;  4L59 A;  4M77 E;  1C0M A;  2LRQ A;  3V8K A;  4PNO A;  1AOJ A;  2JNG A;  4RCC A;  5KYU B;  3L2Z A;  2F2W A;  2VXE A;  4M75 E;  2MPX C;  3FRN A;  3QII A;  3RIR A;  1E7O A;  3CCV T;  1WLP B;  3MHX A;  1IRX A;  5CIU A;  1OUL A;  1O9S A;  1GCQ A;  1C6V X;  2C0T A;  3LH5 A;  2K5F A;  1BIB A;  4XU0 A;  1G5V A;  4E6R A;  2F69 A;  2MMP A;  1G2B A;  3OSS C;  2DL7 A;  1QWE A;  3URG A;  3OYK A;  2SEM A;  3CCM A;  3CBO A;  5KYY B;  2AHJ B;  3CCE T;  1B07 A;  2LJ0 A;  2LCS A;  1Q86 C;  4HCB A;  3E9G A;  3PIO A;  3FDR A;  4KGZ B;  3L2V A;  3H8Z A;  1VIF A;  1NLP C;  1ZUY A;  5FLX E;  3CC2 A;  1ZBX A;  5GMK h;  2DX1 A;  1VQK A;  4JJD A;  3VS5 A;  3LGF A;  3PMI A;  1X75 C;  2CUD A;  1UHF A;  1SHG A;  4C92 F;  1O75 A;  4XK8 E;  4OB1 B;  3V7S A;  2YRD A;  1BI1 A;  4JRK A;  1N8R R;  2YDL A;  3CCV Q;  1EZZ B;  2HKN A;  3CEY A;  3PMT A;  2DXU A;  1WXT A;  5KYX B;  3QXE B;  2NUP A;  2DRK A;  2JS2 A;  4L6V 5;  4A4F A;  1KSW A;  4HCC A;  3OQ5 A;  2RQR A;  1CKB A;  3E9F A;  4A4K A;  5KCH A;  2PTK A;  4EMK C;  2XHC A;  5J26 A;  1IZ6 A;  2X35 A;  1GCP A;  4OB2 B;  4FL6 A;  1V76 A;  3CCE Q;  2RH2 A;  1FMK A;  1VIE A;  3TVT A;  4EMK B;  2RHY A;  2RD1 A;  3FJP A;  2CP3 A;  3E1S A;  2FRW A;  2ZCF B;  4IIO A;  3X24 B;  2YRV A;  1QQJ A;  3HFN A;  2W0Z A;  1LCK A;  1WHJ A;  3ZFJ A;  4RMO A;  2M0O A;  4DBF A;  2HNI A;  5HKC A;  1VUB A;  2P0K A;  4J9B A;  5IHI A;  1U5S A;  3PVL A;  3V8J A;  2YHT A;  2K5I A;  4JJC A;  5C0M A;  4OB3 B;  1Y0M A;  3KXT A;  2K5L A;  3EG9 A;  2EQU A;  1W70 A;  1Q81 U;  3JV3 A;  4LE9 A;  2FZK B;  3CCV A;  2RNA A;  1JBM A;  3N5B B;  2R5M A;  3DLL A;  2O01 E;  4HKE A;  4QVC A;  2MCN A;  5GMK l;  4IKF A;  4B6M A;  1ZA1 B;  2QTV A;  1WXB A;  5IN1 A;  5GMK j;  3LLR A;  1X6B A;  2IPO B;  4C8Q E;  2MOX A;  3A8H B;  4ZN1 A;  2OTJ T;  2QQS A;  4FYX B;  3VS3 A;  4E47 A;  4BDY A;  2NUP B;  4CI0 C;  2KT8 A;  2DBK A;  1UTI A;  2J6F A;  1YNZ A;  4XAX B;  3WXM B;  1Q81 R;  5IT9 E;  3THK A;  3OMC A;  2RJD A;  4LDW A;  2DXB A;  1W4S A;  1R0C B;  1I4K 1;  4IUU A;  2EIF A;  1W6X A;  3VU3 C;  3WVE B;  1KD1 C;  3QSU A;  1LPL A;  5GAO l;  1TS9 A;  2YUQ A;  2ZPH B;  4OMF B;  4M7D E;  1JJ2 A;  4FW1 A;  1N9S A;  3BE3 A;  1UE9 A;  1EFN A;  5DM7 R;  2X4Y A;  4BDZ A;  4J9D A;  5GJW B;  3EG9 B;  3RMS A;  1ZUK A;  1BBZ A;  4LDX A;  5GAN 8;  1PRL C;  3SFM A;  1K9M U;  5AT1 B;  1M1K U;  5KYW A;  2H3E B;  2RJF A;  3SWN A;  5CK9 A;  1KQS S;  1WFW A;  4ME7 A;  3DKM A;  3OYN A;  4IUQ A;  1N8R C;  2K2M A;  2P0P A;  3JCM c;  4QKU A;  2KRM A;  3CXC A;  1JXM A;  4R56 A;  4R0K A;  4KH1 B;  4RKU E;  4BE0 A;  2AK5 A;  2JT4 A;  5M9O A;  1FXX A;  1WJQ A;  3LX7 A;  4FM4 B;  4JRQ A;  3CPF A;  4E7J A;  1RI9 A;  4A53 A;  3HPW A;  3CC7 T;  2ATC B;  2QTX A;  2EQI A;  3JCM W;  1VA7 A;  4OP0 A;  2PNI A;  2YRC A;  1K9M R;  2COZ A;  1M1K R;  3G4S T;  1B3Q A;  4N0A A;  5I2M A;  2FG0 A;  2DZ9 A;  2V1Q A;  4O5V A;  4PJO G;  1TSF A;  2RJE A;  2EAY A;  2W10 A;  2DL4 A;  1IHW A;  2A3L A;  1NBE B;  2A36 A;  4Z88 A;  1VQ4 T;  3JB9 H;  1OZ2 A;  3M0R A;  4AFS C;  3JCM X;  2DJZ A;  5FWC A;  2V26 A;  1ZUU A;  5GAN 5;  4J9G A;  3WVD B;  1XTD A;  4JS5 A;  3QYH B;  4M77 G;  3OYL A;  4M75 G;  2EVR A;  3I9Q A;  4FIB A;  4RTU A;  2D0N A;  3QKJ A;  3SWN C;  2XID A;  2M16 A;  1HSQ A;  3H9N A;  3BDU A;  4HA8 A;  3OS5 A;  4M78 E;  3FIF A;  3CCL T;  2XKO C;  1T0H A;  4P5N A;  5KYW B;  2C06 A;  4Y91 A;  3SWN B;  3X20 B;  3ZEH A;  1ARK A;  4AT1 B;  3GBQ A;  3VS2 A;  1M2O A;  3M55 A;  2DNU A;  1NEG A;  1UHC A;  1GXI E;  4HVW A;  3C0C A;  4Z89 A;  5AYF A;  3G4S Q;  2MYS A;  3UT1 A;  3M59 A;  2KR3 A;  2ZPB B;  3BDL A;  4C92 E;  2AKK A;  5J39 A;  2DL3 A;  4XTZ A;  1PKT A;  3SHW A;  2CZ1 B;  3CME A;  2A08 A;  1U1S A;  2DIQ A;  2VV5 A;  1SG5 A;  1MMN A;  2BE7 D;  1ABO A;  1VOM A;  4D8K A;  2JOY A;  2A7Y A;  4M7A E;  1X2Q A;  1R77 A;  2MIO A;  1I5L A;  4EPC A;  2E1H A;  2YT6 A;  1IB8 A;  1Q7Y C;  3J7A F;  1Q86 U;  2RMO A;  5D6W A;  3CCL Q;  3CMA T;  1UGS B;  1WHL A;  2HQH A;  1VQM T;  2LX7 A;  1WZO A;  2RB6 A;  5GAN f;  1SPK A;  3MP8 A;  2M9U A;  2L3R A;  4YTL A;  1M2V B;  1SF9 A;  4J6Y A;  3A5Z B;  1VQ6 Q;  2MI6 A;  4AFU C;  1MV3 A;  3MPU B;  1AZG B;  3CBM A;  3G4S A;  3VUZ A;  2R58 A;  3EAE A;  2CSQ A;  2PVG B;  5CQY A;  5FRM A;  4A63 B;  2Y4X A;  4C5G A;  5GJV B;  2DMO A;  2EPD A;  1H92 A;  5A0L A;  3QJ6 A;  1Q86 R;  1VQO T;  5IAY A;  2O31 A;  2RA2 A;  2D6F A;  1RAI B;  4J9H A;  1K73 C;  5CKF A;  1KC8 C;  2RQT A;  5IXB A; 
#chains in the Genus database with same CATH homology
 3OYA A;  2VGN A;  5C6S A;  3CCV T;  4A4E A;  3I56 T;  1RI0 A;  4BAC A;  3MHX A;  2LQ8 A;  5CIU A;  1NZ9 A;  1O9S A;  3G6E T;  1YIT A;  4JRP A;  1M8V A;  5A2Q E;  5KCO A;  2HQE A;  1M4Z A;  5CCA A;  2EJ9 A;  2K5F A;  4GLK A;  1BIB A;  5HY6 A;  4XU0 A;  4C8Q C;  4M7A D;  1G5V A;  2IG0 A;  2EQM A;  2FB7 A;  3HKS A;  3GPL A;  2CZ0 B;  2YLB A;  1Y71 A;  1WQW A;  3X28 B;  5LJ3 e;  3MCA B;  3CCL A;  2F69 A;  2MMP A;  3CCQ T;  1K8A C;  3CCJ T;  2VC8 A;  3OSS C;  3OYG A;  3URG A;  2DTH A;  3OYK A;  3PNW C;  1MGQ A;  1VQL A;  5GAN 2;  3CCS T;  4ZGE B;  3CCM A;  1H64 1;  3CBO A;  4TVR A;  4XQ3 A;  3G71 A;  2AHJ B;  3CCE T;  3OYM A;  2DO3 A;  5CKE A;  3OS1 A;  3OYI A;  4HCB A;  1Q86 C;  4J6X A;  3QPH A;  3E9G A;  4BI8 B;  2RK2 A;  3FDR A;  4C8Q G;  2H3J A;  2D0Q B;  5DLO A;  3PIO A;  3L2V A;  3H8Z A;  1VQ6 A;  1QVF A;  1VIF A;  2LT4 A;  4VUB A;  5FLX E;  3CC2 A;  1ZBX A;  3A8G B;  3JCM g;  2GFA A;  5GMK h;  1YI2 T;  1VQK A;  3MEU A;  4A54 A;  5LJ5 d;  3RKW A;  3LGF A;  3PMI A;  1TH7 A;  1VQ9 T;  5D6Y A;  1X75 C;  4PJO D;  1WJS A;  3HFO A;  2DAQ A;  3GNG A;  2PU9 B;  3DB3 A;  3JCM Q;  4C92 F;  3OYC A;  1O75 A;  4XK8 E;  2HBP A;  4OB1 B;  3LH0 A;  2KSS A;  4OGE A;  3V7S A;  2RHZ A;  3JCM e;  2LTO A;  3C4S A;  2XU8 A;  2ZPI B;  1BI1 A;  4XTX A;  4V2S A;  2MWP A;  2YLC A;  3OS2 A;  3R6O A;  4JS4 A;  1PSF A;  3JSC A;  4ZTF A;  4JRK A;  4M7D C;  5I2S A;  4IUV A;  3DB4 A;  1M1F A;  4ZGJ B;  2KVQ G;  4F7U A;  4M77 D;  3CEY A;  1DJ7 B;  2DXU A;  3PMT A;  3UWN A;  4ZN3 A;  3I55 T;  3QXE B;  2EQK A;  2GFU A;  3S3M A;  4L6V 5;  4LD6 A;  4E7H A;  4A4F A;  1WPY A;  4HCC A;  4C8Q A;  1N27 A;  3OQ5 A;  1LOJ A;  1XOV A;  4IUP A;  2QQ9 A;  4KT0 E;  4M75 D;  3E9F A;  2K2V A;  4A4K A;  5GMK i;  3GOX A;  2G3R A;  5KCH A;  1M90 U;  4MDX A;  4EMK C;  1YJ9 T;  1NE8 A;  2XHC A;  3NTK A;  5GAN h;  5GAN e;  5DY9 A;  3CME T;  4N4G A;  5J26 A;  1QP3 A;  1IZ6 A;  2X35 A;  3NFC A;  3NTI A;  1QVF S;  4OB2 B;  5A0G A;  4FL6 A;  5GAM h;  4XTU A;  1UGP B;  3M4G A;  2QQR A;  3BFM A;  4MZT A;  5HK0 A;  2DTO A;  2RH2 A;  1QP2 A;  1VIE A;  4FU6 A;  2V8J A;  2QI2 A;  4KBM B;  2FVU A;  3OYD A;  4EMK B;  2MWO A;  3QYG B;  5CKH A;  2RHY A;  3MET A;  2QEX A;  4RG8 A;  2RD1 A;  3FJP A;  3E1S A;  4DOW A;  3JRZ A;  2PQW A;  2QQA A;  2ZCF B;  4BY6 C;  3ZBD A;  3CC7 A;  2E12 A;  2XIC A;  4OF1 A;  3V7R A;  1KD1 U;  4M78 A;  3X24 B;  2YRV A;  1YJW T;  3CC4 T;  5LJ5 f;  3HFN A;  2EYQ A;  1OZ3 A;  2E6Z A;  4C0D B;  5CKD A;  4BE2 A;  3OMG A;  5J3B A;  4PJO F;  2FYK A;  3ZFJ A;  3BW1 A;  2DKG A;  2WAC A;  4MZP A;  5CR2 A;  4RMO A;  2M0O A;  3HL8 A;  5HKC A;  2HNI A;  3JAM E;  1VUB A;  2P0K A;  3HP9 A;  4BY6 B;  2E5Q A;  4J5Y A;  5GAN 3;  2K4Y A;  3V8J A;  3X26 B;  2DVE A;  3L2Q A;  3KUF A;  2YHT A;  4E7I A;  4M7D A;  2K5I A;  5C0M A;  5CVI A;  4OB3 B;  1VQ4 A;  3KXT A;  1Y96 A;  2K5L A;  4KUL A;  3C12 A;  4M77 F;  5LJ3 j;  2EQU A;  4C92 D;  2DEQ A;  2E10 A;  1Q81 U;  3A8M B;  1U8R A;  1M5Q 1;  3L2R A;  4BI3 A;  3OYY A;  2CKK A;  3CCV A;  3I56 A;  4BI4 A;  1JBM A;  2BIV A;  3N5B B;  2R5M A;  1N9R A;  3JCM V;  3TRE A;  4EMK A;  5HK3 A;  3L2W A;  2RO0 A;  3FC3 A;  3DLL A;  2O01 E;  3SD4 A;  3ER0 A;  4HKE A;  4QVC A;  2XG8 D;  3O8V A;  3CPW A;  5LJ3 g;  2EKO A;  2I2L A;  1U1T A;  2EWN A;  2E6N A;  2EQJ A;  4C0Z A;  4F7U E;  5GMK l;  2LT1 A;  4N4I A;  1VQ5 A;  4IKF A;  4JJN K;  2V8I A;  4M7A A;  5IN1 A;  5GMK j;  3LLR A;  1KQ2 A;  3JCM P;  3CCQ A;  2Y4Y A;  4C8Q E;  4MDW A;  4DQ2 A;  4EMG A;  2E64 A;  3A8H B;  3JB9 G;  1N8R U;  2DXT A;  4QQ6 A;  4ZN1 A;  4XTV A;  3CCS A;  2QQS A;  2OTJ T;  3EFS A;  4E47 A;  4F7U B;  4LD9 K;  2EFI A;  4ZTJ A;  4BDY A;  2V8K A;  1B34 B;  2LVM A;  2QXF A;  2CS7 A;  2PUK B;  4CI0 C;  4F7U G;  1VQN A;  4C8Q B;  1UGQ B;  4Z02 A;  3V7C A;  5DLQ E;  3JCM d;  1M90 C;  2XI9 A;  2L89 A;  2DZC A;  1VQ7 A;  3VKI A;  3QZ5 B;  3MEA A;  4GY5 A;  4XAX B;  2DXC A;  1YIT T;  2EJF A;  2MF2 A;  3WXM B;  3JCM J;  3VJP A;  2WSC E;  4C0G A;  3CCU A;  1M1G A;  2KQW A;  5IT9 E;  1G3T A;  5CO7 A;  1S72 A;  1HK9 A;  3LYI A;  3OYE A;  3OMC A;  2JTM A;  2PUO B;  2OAU A;  2WSF E;  2RJD A;  2DXB A;  3FLG A;  4LDW A;  5GMK e;  3CCR A;  4A4H A;  1G3S A;  4M78 C;  1RL2 A;  1W4S A;  3QUI A;  4QVZ A;  5GAN 7;  2D9T A;  1H3Z A;  1VQ8 A;  1YHQ A;  1I4K 1;  4IUU A;  2LNV A;  4B9X A;  4QW2 A;  2EIF A;  3OW2 A;  5GAN j;  3UDC A;  1OYX A;  1KHI A;  3VU3 C;  3WVE B;  3CPW S;  1VQP T;  1KD1 C;  1KQS A;  3VYH B;  3QSU A;  4ELY C;  2QA4 T;  5GAO l;  1NPP A;  5GAM j;  4NL3 A;  2KMT A;  2DPP B;  1D3B A;  1BKB A;  1WQ7 A;  2JTF A;  2BUD A;  2QDY B;  4M78 B;  5GAO q;  3S3N A;  3TEE A;  4DOV A;  3HRS A;  1IRE B;  2ZPH B;  4D6W A;  4OMF B;  3PFS A;  4PLL A;  3J80 E;  3OYF A;  1VQ6 T;  4M7D E;  4M78 G;  1AHJ B;  3LW5 E;  1KQ1 A;  3M56 A;  1B34 A;  3OYB A;  5GAN g;  2OTL T;  1NPR A;  2VYT A;  3FB9 A;  4OVA A;  1JJ2 A;  2ZPF B;  3H6Z A;  3MO8 A;  1P92 A;  2GQV A;  1YJ9 A;  4KUD K;  1N9S A;  4M75 A;  5GAM g;  3S6W A;  4RG2 A;  4M7D B;  5DM7 R;  1WGS A;  2X4Y A;  3A8L B;  4BDZ A;  4QQD A;  4E7K A;  2RI2 A;  1BI3 A;  2LCL A;  1Y96 B;  3FEO A;  3CMA A;  3JB9 D;  1Q81 C;  4HT9 A;  5KE3 A;  4JLI A;  3RMS A;  1X6O A;  3OBY A;  4M7D G;  4N0A C;  5L8R E;  3P8D A;  5CKB A;  1VQM A;  5FRN A;  2IVW A;  2B8A A;  5GAM e;  3QO3 A;  2XDD A;  1G3W A;  4IUR A;  4M7A C;  3JCM f;  4BE1 A;  4LDX A;  3ME9 A;  5GAN 8;  5LJ5 h;  4ATO A;  3OA6 A;  3SFM A;  1K9M U;  4PL6 A;  2VUB A;  3EFR A;  3P8B B;  2R5A A;  2XK0 A;  4C8Q D;  3OW2 S;  1M1K U;  2L5Q A;  1Q82 U;  3JCM b;  1I8F A;  1BI0 A;  1ZHI A;  1EIF A;  2RJF A;  3GLX A;  1FX7 A;  3INZ A;  5EG2 A;  3SWN A;  2KY9 A;  3MP6 A;  2R57 A;  4XU2 A;  3T9N A;  4B9W A;  1KQS S;  4ME7 A;  4M7A B;  3DKM A;  3OYN A;  4BD3 A;  4IUQ A;  2VXF A;  1W2B A;  2F5K A;  5LL6 S;  1N8R C;  2K3Y A;  2BKD N;  2DIG A;  3OB9 A;  2P0P A;  5KH6 A;  3JCM c;  2ZPE B;  4BUG A;  4HT8 A;  4M7A G;  3CXC A;  4R56 A;  4C5H A;  3GNF B;  3QJY A;  5CK9 A;  2XDB A;  1UB4 A;  1R8O B;  4RKU E;  4BE0 A;  5M9O A;  2E41 A;  2LCC A;  3G7Z A;  5KE2 A;  1JJ2 S;  1BI2 A;  1VQO A;  1UGR B;  1HXD A;  1FXX A;  1WJQ A;  2L8D A;  2HD0 A;  3LX7 A;  4II1 A;  3M53 A;  1YIJ T;  3CBP A;  4FM4 B;  4PJO C;  3ASK A;  4JRQ A;  4C92 A;  3CPF A;  4E7J A;  1YBY A;  3AHU A;  4A53 A;  3BY7 A;  3HPW A;  3L1A A;  4E7L A;  3CC7 T;  5LJ3 d;  4MMK A;  2QTX A;  3CD6 T;  4HCZ A;  4R55 A;  3JCM W;  4OP0 A;  4NS5 A;  5GAO n;  2DTI A;  3F70 A;  4LDU A;  5GAN 4;  4J8O A;  5GMK m;  3G6E A;  3E19 A;  3OS0 A;  3QDR B;  3G4S T;  3JB9 F;  4M77 C;  3P8H A;  4N0A A;  5I2M A;  2DZ9 A;  1OI1 A;  2O4X A;  1KHC A;  3S3O A;  4M7D D;  1UEB A;  3PT9 A;  2P4T A;  2RI5 A;  4O5V A;  4PJO G;  3QHS A;  1YJN T;  1QVG S;  2RJE A;  3GP8 A;  2EAY A;  4F7U F;  1I81 A;  4JDS A;  2A3L A;  1VQ4 T;  1LNX A;  4M75 C;  3CCJ A;  1D3B B;  1OZ2 A;  1W2B S;  3MEV A;  1Q7Y U;  3JB9 H;  2HQX A;  4A4G A;  3TCJ A;  3HHT B;  3M4Y A;  3RUX A;  5GAO r;  2HAX A;  4J83 A;  4M77 B;  4C8Q F;  2DJZ A;  3JCM X;  2XD0 A;  2WSE E;  3CXC S;  2DD4 A;  3SB2 A;  3HRT A;  5GAN 5;  5GAN 6;  3CCE A;  3QG1 A;  4FT2 A;  2PVD B;  4PKC C;  4L5G A;  1XTD A;  2XDP A;  3QYH B;  4M77 G;  3WVD B;  4JS5 A;  3HSB A;  3DLM A;  2EJG A;  1QVP A;  4X9D A;  4M75 B;  4QVD A;  1MHN A;  3VV0 A;  4Y28 E;  3OYL A;  3KBG A;  3OSV A;  2LQK A;  4JUV A;  4UC4 A;  4X9C A;  2F5T X;  2JN0 A;  2ZGW A;  2RK1 A;  2PVO B;  4M75 G;  1M9S A;  1ZQ1 A;  1YI2 A;  1VQ5 T;  2MAM A;  4FIB A;  5GAO p;  3OY9 A;  3GIB A;  1PSE A;  1Y7X A;  4LDV A;  3QKJ A;  3SWN C;  3VUB A;  4O6J A;  5LJ3 h;  2XID A;  2M16 A;  1VQ9 A;  2QQB A;  2RJC A;  2LDM A;  4NL2 A;  3BDU A;  3VYG A;  4HA8 A;  1K9M C;  3RKY A;  3OS5 A;  4M78 E;  3FIF A;  4FSX A;  2FHD A;  3CCL T;  4J6W A;  5GAO m;  1M1K C;  4PJO A;  1VQP A;  4EMH A;  1NJI U;  2XKO C;  2LX9 A;  3LGL A;  1Q82 C;  1QVG A;  2QA4 A;  4M78 F;  3M58 A;  1VQL T;  4P5N A;  5LJ3 f;  3CCM T;  5GAN d;  3UPU A;  4Y91 A;  4DA4 A;  4C5E A;  2C06 A;  2GCX A;  3SWN B;  2JZ2 A;  1VQN T;  3G71 T;  3M54 A;  3X20 B;  3ZEH A;  4XU3 A;  1VQ7 T;  4N4H A;  4MML A;  5GAM d;  1BYM A;  2RHI A;  3M55 A;  3I55 A;  2X4W A;  3RMQ A;  5LJ5 j;  1BIA A;  4OB0 B;  4M77 A;  3CCU T;  2OTL A;  1GXI E;  2LC4 A;  2X4J A;  4JLG A;  5AYF A;  1K73 U;  3UT1 A;  1S72 T;  4OGC A;  5CAI A;  3M59 A;  3NTH A;  4C92 C;  2DK3 A;  2ZPB B;  3BDL A;  2ZPG B;  3C95 A;  3CC2 T;  3OBW A;  4C92 E;  1KC8 U;  4M7D F;  5J39 A;  3CCR T;  1VQK T;  2K57 A;  4XTZ A;  3MP1 A;  2KDS A;  2E65 A;  2K3X A;  1N6A A;  1VQ8 T;  2CZ1 B;  3CME A;  1YHQ T;  3J81 E;  4WF2 A;  3JCM h;  1U1S A;  3PTA A;  3C94 A;  2DIQ A;  3RES A;  5LJ5 g;  2VV5 A;  5FU6 C;  5CQX A;  4C92 B;  2CZ6 B;  2Y90 A;  2M1H A;  1KG1 A;  4ELZ C;  3M57 A;  3M5A A;  4C5I A;  4XTY A;  5D6X A;  1G3Y A;  2JOY A;  4C92 G;  1FWZ A;  2A7Y A;  1K8A U;  4M7A E;  5LJ5 e;  2CGH A;  2E70 A;  4J7I A;  3QBY A;  4M7A F;  5FU6 B;  5I21 A;  3OYJ A;  3X25 B;  4EPC A;  1I5L A;  3TU4 K;  4QQG A;  1YJW A;  3CC4 A;  2ZZD A;  3L42 A;  2O4X B;  3A8O B;  2E1H A;  1Q7Y C;  2CYZ B;  1XQH A;  3M9Q A;  1Q86 U;  4C0F A;  3J7A F;  5D6W A;  3GF5 A;  1JRI A;  1WNL A;  1UGS B;  3CMA T;  3MEW A;  1V29 B;  4FT4 A;  2P0Q A;  4EDU A;  1VQM T;  2RI3 A;  4C0D C;  2RB6 A;  4JRI A;  2NLU A;  4CRI A;  5GAN f;  4PLI A;  3QZ9 B;  3PIP A;  2CZ7 B;  3MP8 A;  3LWI A;  2M9U A;  2KAF A;  3Q1J A;  5A0D A;  2L3R A;  4BB7 A;  5FU7 C;  1YIJ A;  1QW1 A;  2RHX A;  4YTL A;  2RHU A;  3RER A;  2JUF A;  4J6Y A;  5GAM f;  2QEX T;  1XNI A;  3A5Z B;  3L2U A;  2MI6 A;  3LWH A;  4Q5W A;  3CD6 A;  2DD5 A;  4ZGD B;  4PJO E;  1SSF A;  3JB9 J;  4M78 D;  4XU1 A;  2FL7 A;  2JVV A;  1LJO A;  4X34 A;  1WJR A;  1Y07 A;  3CBM A;  3HRU A;  1JB0 E;  3OYH A;  5FU7 B;  2KK4 A;  3G4S A;  2GF7 A;  3VUZ A;  2R58 A;  3JB9 I;  4XTW A;  1NJI C;  2VGM A;  1X01 A;  2PVG B;  3EAE A;  4LDY A;  4MZM A;  5CQY A;  5FRM A;  1YCY A;  2Y4X A;  4PJO B;  4IUT A;  1YJN A;  4C5G A;  4L59 A;  2X4X A;  3PGG A;  4M77 E;  2LRQ A;  5A0L A;  3QJ6 A;  3V8K A;  1VQO T;  5IAY A;  4PNO A;  3RKX A;  2JNG A;  4RCC A;  3L2Z A;  2RA2 A;  5FRO A;  2OTJ A;  4KUI A;  2D6F A;  2VXE A;  4M75 E;  1K73 C;  4NOY A;  4J7F A;  4RCB A;  2RM4 A;  3SDZ A;  5CKF A;  1KC8 C;  4M75 F;  3V8L A;  3FRN A;  3QII A;  3RIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...