1WXTA

Solution structure of the sh3 domain of human hypothetical protein flj21522
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
GSSGSSGLKMQVLYEFEARNPRELTVVQGEKLEVLDHSKRWWLVKNEAGRSGYIPSNILEPLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of human hypothetical protein FLJ21522
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein FLJ21522
total genus 6
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wxtA00
3VS1A 1CKAA 2L3SA 1YN8A 1H92A 1IO6A 5IXBA 1UG1A 2HCKA 4JZ4A 2EVRA 3H41A 1BB9A 1G83A 1TG0A 4HCKA 2ROTA 1LCKA 1PRLC 3EGUA 2CSQA 1X2KA 3REAB 2M0YA 1AZGB 2LJ1A 4KRTA 2NUZA 1AWXA 1OOTA 1SHGA 4J9BA 2FO0A 2BZXA 5GJWB 2YUOA 2D8HA 3EHRA 1SSHA 1AEYA 2J6OA 3TVTA 1ZUKA 3SEMA 2JT4A 2JS2A 2MOXA 3I35A 2I0NA 1K76A 2B86A 2FPFA 4RTYA 2HEQA 2C0TA 4CC2A 1X6BA 2DBKA 1FMKA 2JTEA 1YCSB 2DVJA 3M0TA 2DL7A 2K6DA 2LX7A 2KXCA 2QDLA 1ZSGA 1PKTA 2O88A 3R6NA 3VRYA 2O2OA 1HJDA 2D8JA 3QWXX 1CSKA 2CUBA 1ABQA 3UA6A 4D8KA 3M0SA 3CQTA 1X43A 4K11A 2FEIA 4AFZC 1H3HA 1FYNA 4OMOA 2CT3A 4LUEA 1YWOA 2KYMA 3LH5A 1GFDA 3VS4A 2L3QA 2K7AA 1ARKA 2GTJA 3QWYA 2EYXA 5FWCA 2DX1A 3I5RA 4F14A 1T3LA 4LNPA 5I22A 2EPDA 4OMQA 1QWFA 2A36A 3M0PA 2RQRA 1UE9A 1KSWA 2RPNA 2PZ1A 3ULRB 2VWFA 2K79A 1MUZA 2J6FA 1E6HA 1HD3A 1K1ZA 1NM7A 3U23A 1OV3A 1SHFA 4RTWA 3NHNA 1I07A 2F2XA 3FJ5A 4RTZA 3RBBB 1X69A 2GNCA 4RTXA 2DF6A 2KR3A 1UHCA 1WLPB 1ZUUA 3NMZC 2DL3A 1YWPA 1V1CA 2A08A 1WYXA 1TUCA 2CUDA 2KT1A 2K3BA 2NWMA 1OEBA 4Z8AA 1NEBA 2O9SA 2KRNA 4J9CA 2YUQA 1M27C 3VS0A 2ESWA 2P4RA 1MV3A 2KNBB 1SEMA 2HBWA 2KE9A 3PVQA 3THKA 1GL5A 2YSQA 2O31A 2SRCA 1GBQA 2F2VA 1QKWA 2LCSA 2AKLA 2DILA 3O5ZA 4GBQA 4X1VA 3ZL7C 2RQUA 1B3QA 2RQTA 3VRZA 3VS3A 4AG2C 4J9DA 4ORZA 4E6RA 1K0SA 4OMNA 1AD5A 1VYVA 4J9IA 4Z88A 1MV0B 1AWWA 3VS7A 1QCFA 2KXDA 2DA9A 2OJ2A 2EGEA 3EHQA 2JXBA 2J05A 1Z9QA 4HVUA 4ESRA 3EG2A 1NEGA 2VVKA 1TUDA 2YUNA 3M0QA 1WDXA 1JQQA 1G2BA 3H0IA 2MCNA 2BZ8A 3H0HA 2O9VA 2CH4W 1AZEA 1QLYA 3SHWA 1X6GA 4AFSC 2RQVA 2J7IA 2DL5A 2DRMA 2JMCA 1N5ZA 1AWOA 3UATA 3PE0A 1M30A 2OI3A 3VS2A 3I9QA 1X2QA 1UFFA 2CREA 1SPKA 1BBZA 1S1NA 2FRWA 3RNJA 2PNIA 5FWBA 1QWEA 1UGVA 1KIKA 1KFZA 1Y0MA 1T0JA 1GCQA 4IIMA 2KBTA 4CC7A 1E6GA 1W1FA 2JM8A 2EGCA 5IHNA 2W10A 2EYWA 2KGTA 2XMFA 1SRLA 2JS0A 1W6XA 2C0OA 2J6KA 3PVLA 4LE9A 2LMJA 2ABLA 1X27A 2W0ZA 2EQIA 2YDLA 1JXMA 2JM9A 1JO8A 4RTTA 2DE0X 1AVZC 1M3AA 2JW4A 3A98A 1K0XA 3NPFA 1Y57A 3EG3A 1WXUA 5FW9A 2D0NA 1NLOC 3NGPA 1H8KA 1YP5A 4Z89A 2EBPA 2KROA 2JMAA 2L0AA 2LZ6B 4WCIA 1M8MA 3VS5A 4CC3A 1J3TA 1KJWA 1RUWA 1UDLA 1UJ0A 2LJ0A 1JXOA 1T0HA 2RQWA 1U3OA 1WA7A 2L3PA 1WFWA 2DNUA 1GCQC 2EYYA 1VYUA 2V1RA 1UJYA 1BU1A 1VA7A 2GTOA 3IQLA 2CSIA 2SEMA 3I5SA 4LN2A 5I11A 2J06A 1WX6A 2DL8A 4M4ZA 4A63B 2M51A 1PWTA 1GCPA 1SRMA 1HSQA 2BTTA 2KEAA 3JV3A 2IIMA 4RUGA 4Y92A 2ED1A 4D8DA 4JZ3A 2X3WD 2FG0A 2LQWA 2AK5A 1WI7A 1AWJA 4GLMA 4AG1C 1UUEA 2FPDA 2OAWA 2EKHA 5EC7A 4OMMA 2KYBA 2RF0A 5IHIA 2RNAA 1E7OA 2G6FX 1GRIA 4J9FA 4J9GA 1OPKA 2HSPA 2X3XD 4FSSA 1ZUYA 2DMOA 1JU5C 2MIOA 2K9GA 1PNJA 2DYBA 2CDTA 5IH2A 4J9EA 3C0CA 4AFQC 3UA7A 2LNHB 4DEXA 2DLPA 2ROLA 4CC4B 1AOJA 2RN8A 4AFUC 5GJVB 4RTVA 1I1JA 3VS6A 2AKKA 2FRYA 1YNZA 1BK2A 2DBMA 4JJCA 2AZSA 1NYFA 1UECA 4R0KA 2GBQA 3REBB 2EW3A 4ZNXA 3UF4A 2EYZA 4J9HA 3EG0A 4RTUA 1NG2A 1W70A 2HDAA 1M3CA 1WXTA 2E5KA 2V1QA 2AZVA 1T3SA 5L23A 4HXJA 2LJ3A 5ECAA 3KFVA 1K4US 4DEYA 1A0NB 1VYTA 2C0IA 1RI9A 2DL4A 3TSWA 4HVVA 1RLPC 1I0CA 2FPEA 1PKSA 5HCKA 4LUDA 1CKBA 1ZBJA 2LQNA 3M0RA 1UTIA 2EGAA 1K9AA 2RMOA 3TSZA 2DM1A 1PHTA 1GFCA 1PRMC 1U5SA 2ECZA 5IXFA 4JJBA 2GQIA 1RLQC 1WXBA 1UHFA 2D1XA 1ZLMA 2K2MA 1OPLA 3H0FA 4OMPA 2A37A 1ABOA 2DJQA 1NYGA 2BZYA 1M3BA 2KT8A 1EFNA 2H8HA 2F2WA 2PTKA 1B07A 2ENMA 2L2PA 3GBQA 2LP5A 4F17A 1ZX6A 4JPBW 2KRMA 5IHKA 4F16A 1QKXA 1Z9ZA 1WIEA 2CT4A 1NLPC 2ED0A 3M0UA 2A28A 2GGRA 4IIOA 2YUPA 1GBRA 3EG1A 1JEGA 4EIKA 4QT7A 2KRSA 2DRKA 4OMLA 2YT6A 4HVWA 1U06A 4JJDA 2VKNA 2CH4A 1XOVA
chains in the Genus database with same CATH superfamily
3VS1A 3E9FA 8AT1B 4B9XA 1YN8A 1H92A 4M78B 2PVGB 1VIEA 1WHKA 2RHZA 5GANf 3L2RA 1QVFP 3H41A 4J83A 4HCKA 2XD0A 1LCKA 1KD1R 4IUTA 2CSQA 2DD5A 5FRMA 4KRTA 2NUZA 1VQ8A 1OOTA 3OB9A 2FO0A 2BZXA 2IVWA 3EHRA 4LDUA 1AEYA 4IKFA 2JT4A 2JS2A 3I35A 5DLOA 2B86A 2HEQA 2QA4T 3OS5A 2BKDN 3QZ9B 5A2QE 4ZN1A 1UEBA 4C92F 3QPHA 4E2FB 2QDLA 4IUQA 2O88A 2EQKA 1RADB 4MZTA 2BE9B 1YJWA 2CUBA 3CCUQ 1VQ5A 4EMKB 4D8KA 2RJCA 3PT9A 4AFZC 3G6EA 4OB0B 1RAIB 1V29B 4LDVA 2QQ9A 1QP2A 3H6ZA 4M7DB 3LH5A 3A8MB 4C8QE 4C5IA 2JTFA 3ZFJA 4M78E 1BI0A 1OZ3A 2GTJA 2EYXA 1JRIA 2DX1A 1T3LA 5FU7B 5FU6B 3JCMQ 4LNPA 2EPDA 1QWFA 1PSFA 4VUBA 4M7AA 5J3BA 2ZZDA 3PIOA 1X6OA 3EH1A 4M7AF 4II1A 5LJ3d 2DEUA 2QAZA 2RPNA 4OGCA 3CCVT 5FU6C 3LYIA 3L2QA 3CC4T 2J6FA 1E6HA 4E7IA 2RO0A 2JN0A 1OV3A 1R0CB 1NJIU 1SHFA 1W4SA 2OTLQ 3C4SA 4QKUA 3QJ6A 3MEWA 4C5EA 1WPYA 2KI7A 4IURA 4BE2A 2DF6A 2XU8A 4PJOA 1WLPB 2YXYA 2DL3A 1S72Q 2A08A 1K8AR 1TUCA 2CUDA 2KT1A 1KQSP 1VQNT 4M77G 2COYA 2NWMA 3I56A 4R56A 1D0XA 2C06A 2YUQA 3JCMb 1K8AC 3CD6T 3R6OA 5KYUA 1VQMT 1KHIA 3E2UA 1N8RR 1UGQB 4C8QD 2MPXC 4GBQA 1PM3A 4GY5A 3G4SA 1KC8U 1B3QA 1R0BG 2R5AA 1N8RC 1MNEA 4J9DA 1ZBXA 1EIFA 2DETA 4E6RA 3EGXB 1YBYA 2KMTA 4LDWA 5IT9E 4CRIA 1Q82C 2A3LA 3CMAA 2DA9A 3D7SB 2J05A 1Z9QA 2QTXA 3VUZA 3BDUA 4DOWA 3META 1SSFA 2VVKA 3CCVA 3AHUA 7AT1B 1JQQA 2ZPIB 3JCMc 3VYGA 3EFRA 3O8VA 1ZSZC 2BZ8A 3MEAA 4E47A 2KQWA 5HK0A 1YITA 3G71A 2DRMA 4FT4A 1AWOA 2OI3A 1JJ2A 5FRNA 4M77F 2DAQA 2CREA 1S1NA 3QIIA 1K9MC 5A0DA 5FWBA 4PJJA 5GMKj 3SB2A 1UGVA 3CCLQ 1KQSA 1Y0MA 1XJWB 1GCQA 3I55A 2CP5A 1S72T 2DYIA 5LJ5g 3JCMX 4M78D 2JS0A 4LE9A 4TVRA 4A54A 4O5VA 3RMSA 2LRQA 2W0ZA 2ZGWA 4OVAA 2YDLA 2JM9A 5GAMj 4OB1B 2RHYA 3A98A 1K0XA 1WXUA 2E12A 1AT1B 2O01E 2FVUA 4QW2A 3ZBDA 2JMAA 3CBPA 4WF2A 1M8MA 3SWNA 1RACB 2OTJA 1J3TA 1D1CA 1RUWA 2LJ0A 2DJZA 4M78A 1RAGB 3OW2A 1U3OA 2CZ0B 3EGXA 3OYCA 2EYYA 5HK3A 3CPWA 4A4HA 3CD6A 1UJYA 3JCMd 1BU1A 4M78C 1RAAB 3RERA 3M55A 2SEMA 5DY9A 5CQXA 3WVDB 4XTZA 2DZ9A 4R55A 2J06A 2CYZB 2DL8A 2XHCA 2M51A 1PWTA 1GCPA 4KH0B 5GAMe 1OX9A 1G3SA 2KEAA 4Y92A 2WSFE 4RUGA 4C0DC 5LL6S 1VQMA 5CQYA 1YIJQ 5GMKm 3WXMB 2AK5A 1VQPA 1WJSA 2L5QA 5KE2A 5HY6A 1KQ2A 2OAWA 4M7DE 1MHNA 2EKHA 4OMMA 4NS5A 2F5TX 2RF0A 3E19A 2ZPGB 1M1GA 3OSSC 2LT1A 2X3XD 4FSSA 4PFZA 2XKOC 2CP2A 2QK0A 5GAOr 2DYBA 2LCLA 4J9EA 3C0CA 2DIGA 2X4WA 4Q5WA 4DEXA 1VQ9A 2RN8A 4V2SA 4A4KA 1I1JA 3M59A 2FRYA 1YNZA 2RK2A 4M78F 1YITT 2AZSA 3A8GB 1NYFA 3HL8A 1UECA 4ZNXA 2XI9A 2EYZA 1XNIA 3CC7A 5D7UA 1NG2A 1W70A 1PD1A 4BDZA 2E5KA 2A7YA 5GANg 3RKXA 3V7SA 2AZVA 4HXJA 3TU4K 3KFVA 2XIDA 4F7UA 3OYFA 1LOJA 1VYTA 1RI9A 2DTHA 3CCMQ 2OTLA 2YHTA 2DL4A 2ZAEA 1Q81C 1RLPC 3BW1A 3EFOA 2FPEA 3J7AF 1CKBA 2LQNA 1K73C 3M0RA 2EGAA 1WHMA 4C8QC 1Y07A 2RMOA 2DM1A 3VJPA 1U5SA 5GMKe 4JJBA 2GQIA 1K73R 1RLQC 1M4ZA 1WXBA 4J6YA 1UHFA 1MMDA 2K4YA 3I55T 4XTUA 2Y4YA 1NE8A 4QQGA 2BZYA 4M78G 2KT8A 4FT2A 1B07A 2HBPA 2L2PA 2ZPHB 1UGPB 3M53A 2OTJT 5IHKA 1Z9ZA 2V8JA 2CT4A 2K2VA 1NLPC 3M0UA 3X28B 2XICA 4BI8B 2YUPA 3G4SQ 1VQ9T 5KYWB 3OYYA 2DRKA 4JJDA 1B7TA 2VGNA 1CKAA 3CMAT 1BIAA 2DTOA 1OULA 5IXBA 2JVVA 2EVRA 2GCXA 2KDSA 5GAN4 1M1KU 2YRCA 4HT8A 1I81A 1VIFA 4M7DC 4C0ZA 3QHSA 1X2KA 4OP0A 5LJ3h 1D1AA 3VV0A 1AZGB 2LJ1A 1AWXA 1SHGA 5GJWB 5GAOn 2GFUA 2YUOA 1QVGS 1SSHA 3X20B 5CKEA 4DBHA 1H641 1ZUKA 3SEMA 2MOXA 4C92G 3F70A 1K76A 5LJ5j 1D0YA 1FWZA 3S6WA 3FEOA 4F7UB 4CC2A 1YJ9A 3S3NA 3LW5E 1N9SA 3EAEA 5CCAA 4KULA 3LWIA 1RAFB 4N4HA 2EJFA 3OBWA 4MMKA 3R6NA 2O2OA 2I2LA 5FROA 5CIUA 3MEVA 1JB0E 2M1HA 2FEIA 1H3HA 1D09B 3CC4Q 2CZ7B 3CBMA 2GF7A 3M9QA 3RMQA 2LQ8A 2WSEE 3FIFA 4MDWA 2E3HA 3OBYA 4PJOG 4PLIA 2MMPA 3LWHA 1M1KC 4MDXA 1GFDA 1YI2T 3VS4A 3GPLA 3CC2Q 2L3QA 3OW2P 3JAME 3QWYA 4NL3A 1VQLA 2RHUA 5GANe 3I5RA 4F14A 4KGZB 1M1KR 4HCBA 1TWBA 3M56A 3M0PA 2FYKA 2RQRA 1I8FA 2EFIA 3HRUA 4M77C 3RKWA 1KSWA 2E3IA 1QW1A 3ULRB 1ZA1B 2P0QA 2DFUA 1MUZA 3CD6Q 4KGXB 2FL7A 3PIPA 1K1ZA 3U23A 4BACA 4ATOA 4J7IA 2VGMA 4GLKA 4RTWA 1WJQA 5FU7C 2QYZA 2EIFA 4N0AC 2KR3A 2NYSA 1KK7A 1UHCA 4A4GA 5LJ5f 3S3OA 1ZUUA 4JS4A 3OYLA 4C92E 3C95A 1LNXA 3NFCA 2DKGA 1FMWA 1WYXA 1YJNQ 3RDVA 2K3BA 1OEBA 1ZSZB 4Z8AA 1K73U 2O9SA 2FZKB 2RJDA 4LD9K 2NUPA 4E7SA 5GMKh 2P4RA 1C1AA 1MV3A 3L2WA 5LJ3f 2KNBB 4JUVA 1WQWA 1Q86C 2KE9A 3PVQA 3CCRQ 2YSQA 3OYHA 2SRCA 4EMGA 3CCEQ 4WTOB 1GBQA 2F2VA 5I21A 1U8RA 3O5ZA 1Q86R 2WACA 4C5GA 2V26A 2RQUA 1PCXA 3JRZA 3JCMJ 2NLUA 2E70A 3URGA 3OYJA 3RKYA 4Z88A 1MV0B 1AWWA 1IZ6A 4QVZA 1QCFA 2HQHA 2P0KA 3PNWC 2JXBA 4M75D 3GIBA 2O4XA 3VKIA 2X4XA 2V8IA 2E4HA 1NEGA 4QQ6A 3MCAB 3M0QA 2ATCB 3MP6A 5CAIA 1G2BA 3KXTA 2E1HA 3H0HA 4C8QA 1VQ5T 3MPUB 1M1FA 3CMEA 1AZEA 2KY9A 2BUDA 3UDCA 2V8KA 4E7ZA 3SHWA 1X6GA 1VQ4Q 3JB9F 1LPLA 4ANJA 1M30A 1X2QA 4JLGA 3FJPA 2F1LA 1N9RA 3E9GA 3RNJA 2PVDB 2PNIA 3G6ET 2XDBA 1QWEA 1Q7YR 3OS1A 2YLBA 2Y4XA 1M90C 1HYOA 3NTIA 1N8RU 1RI0A 4CC7A 1E6GA 2EGCA 5CKBA 1KC8R 3KUFA 4LDXA 2EWNA 1VQ7Q 4RKUE 2EYWA 1ZSZA 3CMAQ 2ZPEB 4KBMB 4FIBA 3ER0A 3PVLA 1KD1C 3JCMP 2LMJA 2MK5A 2HSEB 2CS7A 3JCMh 3RESA 1QQJA 2EQIA 5KYYA 5M9OA 1K8AU 2E41A 2JW4A 3GNGA 2CGHA 5FW9A 1BCOA 2YLCA 1NLOC 3NTHA 4XTWA 3NGPA 2EQMA 1YP5A 4Z89A 2KROA 2L0AA 4WCIA 3JSCA 3VS5A 1F1BB 5LJ3j 3C94A 1WHLA 1VYUA 4KGVB 2GTOA 2P4TA 3QG1A 4HCZA 4B9WA 2CSIA 3DB3A 1YIJA 3M58A 3OSVA 1VQPQ 1NJIR 1U1SA 5I11A 2HQXA 4C0GA 3I56Q 2KAFA 4E7KA 2RA2A 1HSQA 2P84A 2RHIA 2ED1A 4QVCA 4D8DA 2QQBA 5A0LA 3HSBA 1D0ZA 1WI7A 3V8KA 4MMLA 2RNAA 5GAMg 3J81E 3JB9I 4RMOA 3X24B 2CZ1B 4LDYA 2HSPA 1VQ6Q 3CCQT 1VQNQ 3CBOA 3OYIA 4C5HA 2DTIA 3M54A 4Y28E 2RJFA 5IH2A 4M75G 3CCMT 2QQRA 3EG9B 3OS0A 2DLPA 3NTKA 3MEUA 1AOJA 4J7FA 1IREB 1VUBA 5GJVB 1VQLT 4DQ2A 5IN1A 4ELYC 1SKUB 4ZTFA 1BK2A 2D9TA 1KHCA 4M75B 2Y90A 1C0MA 4XU0A 9ATCB 3A1PA 3FLGA 1YJWQ 3EG0A 4RTUA 1WXTA 1YFNA 2MI6A 2V1QA 4AMCA 4ZN3A 1VQ4T 5ECAA 1BI1A 2VB6A 1VQKT 2K5FA 3A8OB 3DLLA 1NPRA 4HVVA 2QGFB 1UGRB 2M9UA 2DVEA 5HCKA 4LUDA 5D6WA 3HRTA 3L2ZA 4Y91A 1ZBJA 1C6VX 2KSSA 1VQOA 3HP9A 3M4GA 3CCQQ 1I4K1 4XK8E 1M9SA 4EMHA 3EH2A 1Q7YU 1I5LA 2HNIA 2K2MA 1OPLA 3H0FA 4OMPA 4E7LA 2DXTA 4FYWB 2DJQA 1NYGA 2EJ9A 1M3BA 2QEXQ 4PJOE 2F2WA 3FDRA 4M75F 2ENMA 4MZPA 4M75A 4JPBW 5KH6A 2KRMA 3CCRA 1X01A 1U1TA 3OYGA 2DERA 4M7AG 5AT1B 2OTJQ 2A28A 4IIOA 4ZTJA 3JB9G 4EIKA 1YJWT 4OMLA 3OQ5A 2YT6A 3EG9A 5KYNA 2VKNA 3CMEQ 2CH4A 3JCMW 1OZ2A 1YIJT 1XOVA 2L3SA 4PNOA 4QQDA 1MMAA 4M7AB 5CKFA 1GXIE 3SFMA 1EX4A 5GAMd 1K9MR 1RAHB 1UG1A 2HCKA 4XAXB 1TTHB 1ACMB 1G83A 3OW2S 1PRLC 1JJ2P 3HRSA 4EDUA 3J80E 4F7UE 3CCUT 2M0YA 1MNDA 4J9BA 1QMCA 1NPPA 4BY6C 2J6OA 2RI2A 3HKSA 2PQWA 3OS2A 2I0NA 2FPFA 4RTYA 4KUIA 3QBYA 2C0TA 3H9NA 1X6BA 1FMKA 2JTEA 3GLXA 2DL7A 5GAN6 1G8XA 4UC4A 1OU8A 2LVMA 3EFSA 3HHTB 3VRYA 1HJDA 2CP3A 3QWXX 4C0FA 4X9DA 3UA6A 3QSUA 3P8DA 2PUOB 1R8OB 4OGEA 1TS9A 2LX9A 3CXCP 1VQ7A 2E65A 2QQAA 2HKQB 1FYNA 2CT3A 3N5BB 1AHJB 1M2VB 1YWOA 3OMGA 4NOYA 2OTLT 3DLMA 1JJ2S 4XTXA 2QEXT 1M2OA 2RB6A 5FWCA 4J5YA 3T9NA 2K57A 3L2UA 1VQ8T 1BKBA 4OMQA 2BE7D 4PFPA 3TQ7P 2LQKA 1MGQA 3CCLA 3CCMA 4C0DB 4B6MA 5GAN7 2JNGA 2HQEA 2VYTA 2VWFA 3I55Q 5FLXE 3OYDA 1WQ7A 4BI4A 2RK1A 2XK0A 3OY9A 2JTMA 2MAMA 2K3YA 4FCYA 2F2XA 3RBBB 1X69A 3CCET 1IHWA 2QDYB 5LJ5h 2RH2A 3CCSQ 1UGSB 3NMZC 2JUFA 1YWPA 3CC4A 1V1CA 5C0MA 2JOYA 1W2BP 4M7DA 2HKNA 1NEBA 2JZ2A 4IUUA 1PSEA 1G3YA 4JJNK 1M27C 3VS0A 2ESWA 2RHXA 1H3ZA 2AHJB 4PJMA 5J39A 3ZEHA 1VQLQ 4ZGEB 3CEYA 1KD1U 4N4IA 1SEMA 2HBWA 2HMAA 3C12A 1VQ8Q 3THKA 1GL5A 1X75C 2AIRB 1W2BA 2AKLA 3ZL7C 3MJXA 3VU3C 2RQTA 3VS3A 3PFSA 4AG2C 5GAOl 5GAMf 4ORZA 3CMET 2X4JA 2LT4A 1AD5A 1Q81R 2LDMA 2QQSA 4FL6A 4RG2A 5CVIA 3VS7A 3CCJQ 4EMKA 2KXDA 3CCJT 1VQ4A 3EHQA 4HVUA 3UT1A 2XG8D 3TEEA 1TUDA 4X9CA 2YUNA 1FXXA 2COWA 5KYXB 3CPFA 3H0IA 2MCNA 2CH4W 1VQOQ 2X51A 3QUIA 1PD0A 2RQVA 2J7IA 4PL6A 2OAUA 5KYWA 4ME7A 2LNVA 2M16A 2K3XA 2COZA 1BBZA 2QEXA 5CR2A 1OYXA 1V76A 1M2VA 4PFOA 2DPPB 3RIRA 4LXCA 5GMKl 2DIQA 3P8HA 4Z02A 2R58A 4JS5A 1T0JA 3BDLA 4PJOF 4IIMA 4DBFA 4M77B 1W1FA 5I2MA 2JM8A 3P8BB 2X4YA 2FZGB 1G3TA 5IHNA 2RJEA 1QVPA 3G1JA 3M5AA 5KYUB 4E7HA 2IG0A 1Q86U 1W6XA 2HL5C 2KK4A 5GMKi 2L8DA 1WJRA 2ABLA 1BYMA 5D6XA 4RCBA 3HTRA 3LGFA 1AVZC 3L42A 1Y57A 1JBMA 3EG3A 3GP8A 4ZGDB 4M7DF 5GAN5 2B8AA 2LZ6B 2EJGA 1IB8A 3A8HB 1P92A 1UJ0A 1T0HA 3HFOA 2RQWA 5GAOq 1WA7A 2L3PA 1WFWA 1IHVA 3V7RA 3AT1B 2H3EB 4JRQA 2DK3A 2QGGA 4LN2A 1WX6A 4M4ZA 4F7UF 2JJ9A 4A4FA 4A63B 3KBGA 3JV3A 2IIMA 4M75C 2CP7A 1PC0A 3QZ5B 2M0OA 3OYMA 2LQWA 5KE3A 1XQHA 2RI5A 2ZPFB 1AWJA 6AT1B 4GLMA 4D6WA 3CCEA 1O9SA 4NL2A 3ASKA 5GAOm 5GANh 2G6FX 1GRIA 3GNFB 1BI3A 4M7DG 4J9FA 4J9GA 1OPKA 2CKKA 2E10A 1YJNT 1VQ6T 2DMOA 1IGUA 2VASA 5C6SA 3QDRB 1JU5C 2MIOA 3EGDB 2K9GA 2CDTA 1FMVA 4A4EA 2MWPA 4EPCA 4AFQC 3UA7A 2LNHB 4C92C 2E5QA 2ROLA 4CC4B 2QA4Q 1IGQA 4HKEA 5KCOA 5CKDA 2AKKA 1VQPT 3EGDA 3Q1JA 2ZPBB 3SWNC 4J8OA 3CCLT 4IUVA 2GBQA 3REBB 8ATCB 2EW3A 3MP8A 4FSXA 2FB7A 4PJOD 4QVDA 2H3JA 3CCQA 1EZZB 4BB7A 5CKHA 1WHHA 4F7UG 1Q82R 4O6JA 1QCNA 3VYHB 5LJ3e 4M77D 1KQ1A 3BY7A 3OYBA 1VQ9Q 1UTIA 2D0QB 3CCSA 4PJOB 3TSZA 4X34A 1PHTA 1GFCA 2PVOB 1PRMC 1SG5A 5J26A 2QI2A 2EQUA 2X35A 1KQSS 4OB3B 2D1XA 2LCCA 2DEQA 3QJYA 4MZMA 5AYFA 4DBRA 5DLQE 2GQVA 3CXCA 4KUDK 3CC7T 1ABOA 3CC7Q 5GANj 1O75A 3PGGA 4JDSA 1LVKA 2PTKA 4F17A 1ZX6A 4M7AE 1Y96A 1BCMA 2LC4A 3X25B 3A8LB 3OYNA 4F16A 1QKXA 2PU9B 1WIEA 2ED0A 3L1AA 3BE3A 3CXCS 3JCMe 4XQ3A 2EAYA 2HD0A 1GBRA 4HVWA 1U06A 3CCUA 1VQ5Q 5LJ5e 2RI3A 4C8QF 2BIVA 2QTVA 1Y96B 3DKMA 3OMCA 3CCJA 1VQKQ 2K5IA 1ZA2B 1IO6A 3LGLA 4JZ4A 1RAEB 1D1BA 1BB9A 1G3WA 1TG0A 2ROTA 4BE1A 3EGUA 3UWNA 1YJ9T 1M90R 3REAB 3S3MA 1IXDA 4F04B 3OYAA 4YTLA 2NUPB 5GAOp 4FW1A 1KC8C 2VV5A 1D3BB 4XTYA 2D8HA 3FC3A 4IUPA 3RUXA 1W2BS 4PJLA 3V7CA 3QDFA 4N0AA 3TVTA 3CC2A 3JCMf 1WHJA 5CO7A 4FM4B 4P5NA 2DBKA 1YCSB 2DVJA 3M0TA 5LJ5d 2CZ6B 3G71Q 2K6DA 1VQNA 2DXCA 2LX7A 3G71T 2KXCA 3EFOB 3ME9A 2D6FA 3SDZA 1ZSGA 3G7ZA 1PKTA 5KCHA 2D8JA 1NBEB 3FRNA 1CSKA 1YCYA 2IPOB 1ABQA 4BY6B 4M75E 3M0SA 3CQTA 2ZCFB 4L59A 3PMTA 4M7AD 1X43A 4K11A 1QVGP 4CI0C 4OMOA 3PTAA 2GFAA 4LUEA 4BUGA 2KYMA 4JRKA 3SD4A 4PJOC 1NJIC 1OU9A 2K7AA 1ARKA 2FZCB 3MO8A 4KH1B 4C8QG 3G6EQ 1YJNA 3H8ZA 5I22A 2EKOA 3BFMA 2A36A 3QKJA 2M02A 3I56T 1UE9A 2PZ1A 2VXFA 2K79A 2L3RA 4C8QB 1YI2A 2P0PA 4RCCA 2X9HA 1HD3A 2O4XB 5EG2A 2YRVA 1NM7A 1IRXA 4C92D 2MF2A 3NHNA 1B34B 1I07A 4HA8A 3FJ5A 3CCRT 4RTZA 2AT1B 3E1SA 2GNCA 3CC2T 2LTOA 1ZQ1A 1LJOA 4RTXA 5IAYA 2KVQG 1G5VA 4HCCA 3CCST 3CPWS 3OYEA 2E6ZA 2KRNA 4J9CA 3WVEB 4OF1A 2HAXA 5GAN2 1XTDA 1Q81U 4JRPA 1VQMQ 2VUBA 1YHQT 1S72A 4FYVB 3V8LA 5I2SA 2O31A 5HKCA 1QKWA 2LCSA 1KG1A 2DILA 4X1VA 4L5GA 4M7DD 3VRZA 5L8RE 1OQKA 4L6V5 1K0SA 2CP0A 4OMNA 1VYVA 4ELZC 4J9IA 4J6XA 2OJ2A 2EGEA 2L89A 1Q95G 3QO3A 4ESRA 4OMFB 1NZ9A 3EG2A 4M77A 2NUTB 2G3RA 1WDXA 3QYGB 1N6AA 3OA6A 2O9VA 3X26B 4N4GA 1I5OB 1RABB 1VQ7T 1QLYA 4AFSC 2QXFA 2E6NA 2A0FB 2DL5A 1QVFA 2JMCA 3HPWA 2MWOA 1N5ZA 3UATA 3LLRA 3CCVQ 3PE0A 3VS2A 3I9QA 4BI3A 1UFFA 1SPKA 1YHQQ 2OX7A 2FRWA 4A53A 1HXDA 2R57A 3MHXA 1HK9A 3JCMV 1YITQ 1KIKA 2HZYA 1MMNA 4PJNA 4EMKC 2YWWA 1KFZA 3DB4A 5KYXA 1FX7A 2KBTA 2FHDA 5LJ3g 5GANd 5DM7R 2W10A 1OX8A 2KGTA 4BDYA 2XMFA 1SRLA 4J6WA 2RD1A 2C0OA 4DA4A 2J6KA 1M8VA 5GAN8 2XDPA 4XU2A 1X27A 2VXEA 3A5ZB 1JXMA 1JO8A 1TUGB 4RTTA 2DE0X 4DBQA 1M3AA 1BI2A 4FYYB 3NPFA 1BIBA 1QCOA 1WNLA 4XU1A 2VC8A 4AT1B 1QVGA 2D0NA 1WGSA 1B34A 2QG9B 1H8KA 2F5KA 2EBPA 1M90U 5GAN3 4CC3A 3MP1A 2F69A 1KJWA 1UDLA 1JXOA 2DNUA 3UPUA 1GCQC 2V1RA 1VA7A 3IQLA 4PKCC 3LX7A 3I5SA 1TH7A 3PMIA 3M57A 1VOMA 4M7AC 2EYQA 1SRMA 3VUBA 1SF9A 1TU0B 3FB9A 2K5LA 3INZA 2BTTA 4PLLA 2YRDA 1YHQA 2DXBA 4JZ3A 2X3WD 2FG0A 1UB4A 1MMGA 4C92A 1K9MU 4E7JA 4AG1C 1UUEA 2FPDA 1M5Q1 1QP3A 3TCJA 5EC7A 2KYBA 5IHIA 4HT9A 2DO3A 1TOVA 1E7OA 2QA4A 5KYYB 3MKDA 3GOXA 3V8JA 3M4YA 2WSCE 3L2VA 1VQOT 4BE0A 4FU6A 3TREA 1ZUYA 2NUTA 3OYKA 1DJ7B 3JB9H 1N27A 1RL2A 1PNJA 1D3BA 2E64A 1YI2Q 2QASA 2R5MA 4AFUC 4RTVA 1OI1A 3VS6A 2PUKB 2DBMA 1Q82U 4JJCA 4PK4A 4R0KA 1WHGA 3UF4A 4JRIA 4J9HA 2HDAA 1M3CA 1T3SA 5L23A 4DOVA 2LJ3A 1TSFA 1VQ6A 4M77E 3RR6A 1K4US 4DEYA 1A0NB 2C0IA 2Z0WA 5A0GA 4FYXB 3TSWA 4BD3A 1I0CA 2CP6A 1WZOA 2DZCA 1PKSA 3JB9J 2XDDA 1Y71A 4OB2B 1K9AA 3JB9D 2EQJA 4ZGJB 2ECZA 5CK9A 5IXFA 4LD6A 5D6YA 3CPWP 1ZLMA 4FW2A 2A37A 1TXQA 4XU3A 1QVFS 2DXUA 2MYSA 1EFNA 4KT0E 3JCMg 2H8HA 4JLIA 1YJ9Q 3GBQA 2LP5A 1ZHIA 1Y7XA 3LH0A 3QXEB 3QYHB 3HFNA 1VQKA 4C92B 4XTVA 3GF5A 2RM4A 3G4ST 2GGRA 1R77A 2DD4A 3EG1A 1JEGA 1Q7YC 4QT7A 2KRSA 2HL3A 1PG5B 4RG8A 5GAMh 3SWNB
chains in the Genus database with same CATH topology
3VS1A 1CKAA 2L3SA 1YN8A 1H92A 1IO6A 5IXBA 1UG1A 2HCKA 4JZ4A 2EVRA 3H41A 1BB9A 1G83A 1TG0A 4HCKA 2ROTA 1LCKA 1PRLC 3EGUA 2CSQA 1X2KA 3REAB 2M0YA 1AZGB 2LJ1A 4KRTA 2NUZA 1AWXA 1OOTA 1SHGA 4J9BA 2FO0A 2BZXA 5GJWB 2YUOA 2D8HA 3EHRA 1SSHA 1AEYA 2J6OA 3TVTA 1ZUKA 3SEMA 2JT4A 2JS2A 2MOXA 3I35A 2I0NA 1K76A 2B86A 2FPFA 4RTYA 2HEQA 2C0TA 4CC2A 1X6BA 2DBKA 1FMKA 2JTEA 1YCSB 2DVJA 3M0TA 2DL7A 2K6DA 2LX7A 2KXCA 2QDLA 1ZSGA 1PKTA 2O88A 3R6NA 3VRYA 2O2OA 1HJDA 2D8JA 3QWXX 1CSKA 2CUBA 1ABQA 3UA6A 4D8KA 3M0SA 3CQTA 1X43A 4K11A 2FEIA 4AFZC 1H3HA 1FYNA 4OMOA 2CT3A 4LUEA 1YWOA 2KYMA 3LH5A 1GFDA 3VS4A 2L3QA 2K7AA 1ARKA 2GTJA 3QWYA 2EYXA 5FWCA 2DX1A 3I5RA 4F14A 1T3LA 4LNPA 5I22A 2EPDA 4OMQA 1QWFA 2A36A 3M0PA 2RQRA 1UE9A 1KSWA 2RPNA 2PZ1A 3ULRB 2VWFA 2K79A 1MUZA 2J6FA 1E6HA 1HD3A 1K1ZA 1NM7A 3U23A 1OV3A 1SHFA 4RTWA 3NHNA 1I07A 2F2XA 3FJ5A 4RTZA 3RBBB 1X69A 2GNCA 4RTXA 2DF6A 2KR3A 1UHCA 1WLPB 1ZUUA 3NMZC 2DL3A 1YWPA 1V1CA 2A08A 1WYXA 1TUCA 2CUDA 2KT1A 2K3BA 2NWMA 1OEBA 4Z8AA 1NEBA 2O9SA 2KRNA 4J9CA 2YUQA 1M27C 3VS0A 2ESWA 2P4RA 1MV3A 2KNBB 1SEMA 2HBWA 2KE9A 3PVQA 3THKA 1GL5A 2YSQA 2O31A 2SRCA 1GBQA 2F2VA 1QKWA 2LCSA 2AKLA 2DILA 3O5ZA 4GBQA 4X1VA 3ZL7C 2RQUA 1B3QA 2RQTA 3VRZA 3VS3A 4AG2C 4J9DA 4ORZA 4E6RA 1K0SA 4OMNA 1AD5A 1VYVA 4J9IA 4Z88A 1MV0B 1AWWA 3VS7A 1QCFA 2KXDA 2DA9A 2OJ2A 2EGEA 3EHQA 2JXBA 2J05A 1Z9QA 4HVUA 4ESRA 3EG2A 1NEGA 2VVKA 1TUDA 2YUNA 3M0QA 1WDXA 1JQQA 1G2BA 3H0IA 2MCNA 2BZ8A 3H0HA 2O9VA 2CH4W 1AZEA 1QLYA 3SHWA 1X6GA 4AFSC 2RQVA 2J7IA 2DL5A 2DRMA 2JMCA 1N5ZA 1AWOA 3UATA 3PE0A 1M30A 2OI3A 3VS2A 3I9QA 1X2QA 1UFFA 2CREA 1SPKA 1BBZA 1S1NA 2FRWA 3RNJA 2PNIA 5FWBA 1QWEA 1UGVA 1KIKA 1KFZA 1Y0MA 1T0JA 1GCQA 4IIMA 2KBTA 4CC7A 1E6GA 1W1FA 2JM8A 2EGCA 5IHNA 2W10A 2EYWA 2KGTA 2XMFA 1SRLA 2JS0A 1W6XA 2C0OA 2J6KA 3PVLA 4LE9A 2LMJA 2ABLA 1X27A 2W0ZA 2EQIA 2YDLA 1JXMA 2JM9A 1JO8A 4RTTA 2DE0X 1AVZC 1M3AA 2JW4A 3A98A 1K0XA 3NPFA 1Y57A 3EG3A 1WXUA 5FW9A 2D0NA 1NLOC 3NGPA 1H8KA 1YP5A 4Z89A 2EBPA 2KROA 2JMAA 2L0AA 2LZ6B 4WCIA 1M8MA 3VS5A 4CC3A 1J3TA 1KJWA 1RUWA 1UDLA 1UJ0A 2LJ0A 1JXOA 1T0HA 2RQWA 1U3OA 1WA7A 2L3PA 1WFWA 2DNUA 1GCQC 2EYYA 1VYUA 2V1RA 1UJYA 1BU1A 1VA7A 2GTOA 3IQLA 2CSIA 2SEMA 3I5SA 4LN2A 5I11A 2J06A 1WX6A 2DL8A 4M4ZA 4A63B 2M51A 1PWTA 1GCPA 1SRMA 1HSQA 2BTTA 2KEAA 3JV3A 2IIMA 4RUGA 4Y92A 2ED1A 4D8DA 4JZ3A 2X3WD 2FG0A 2LQWA 2AK5A 1WI7A 1AWJA 4GLMA 4AG1C 1UUEA 2FPDA 2OAWA 2EKHA 5EC7A 4OMMA 2KYBA 2RF0A 5IHIA 2RNAA 1E7OA 2G6FX 1GRIA 4J9FA 4J9GA 1OPKA 2HSPA 2X3XD 4FSSA 1ZUYA 2DMOA 1JU5C 2MIOA 2K9GA 1PNJA 2DYBA 2CDTA 5IH2A 4J9EA 3C0CA 4AFQC 3UA7A 2LNHB 4DEXA 2DLPA 2ROLA 4CC4B 1AOJA 2RN8A 4AFUC 5GJVB 4RTVA 1I1JA 3VS6A 2AKKA 2FRYA 1YNZA 1BK2A 2DBMA 4JJCA 2AZSA 1NYFA 1UECA 4R0KA 2GBQA 3REBB 2EW3A 4ZNXA 3UF4A 2EYZA 4J9HA 3EG0A 4RTUA 1NG2A 1W70A 2HDAA 1M3CA 1WXTA 2E5KA 2V1QA 2AZVA 1T3SA 5L23A 4HXJA 2LJ3A 5ECAA 3KFVA 1K4US 4DEYA 1A0NB 1VYTA 2C0IA 1RI9A 2DL4A 3TSWA 4HVVA 1RLPC 1I0CA 2FPEA 1PKSA 5HCKA 4LUDA 1CKBA 1ZBJA 2LQNA 3M0RA 1UTIA 2EGAA 1K9AA 2RMOA 3TSZA 2DM1A 1PHTA 1GFCA 1PRMC 1U5SA 2ECZA 5IXFA 4JJBA 2GQIA 1RLQC 1WXBA 1UHFA 2D1XA 1ZLMA 2K2MA 1OPLA 3H0FA 4OMPA 2A37A 1ABOA 2DJQA 1NYGA 2BZYA 1M3BA 2KT8A 1EFNA 2H8HA 2F2WA 2PTKA 1B07A 2ENMA 2L2PA 3GBQA 2LP5A 4F17A 1ZX6A 4JPBW 2KRMA 5IHKA 4F16A 1QKXA 1Z9ZA 1WIEA 2CT4A 1NLPC 2ED0A 3M0UA 2A28A 2GGRA 4IIOA 2YUPA 1GBRA 3EG1A 1JEGA 4EIKA 4QT7A 2KRSA 2DRKA 4OMLA 2YT6A 4HVWA 1U06A 4JJDA 2VKNA 2CH4A 1XOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS1 A;  1CKA A;  2L3S A;  1YN8 A;  1H92 A;  1IO6 A;  5IXB A;  1UG1 A;  2HCK A;  4JZ4 A;  2EVR A;  3H41 A;  1BB9 A;  1G83 A;  1TG0 A;  4HCK A;  2ROT A;  1LCK A;  1PRL C;  3EGU A;  2CSQ A;  1X2K A;  3REA B;  2M0Y A;  1AZG B;  2LJ1 A;  4KRT A;  2NUZ A;  1AWX A;  1OOT A;  1SHG A;  4J9B A;  2FO0 A;  2BZX A;  5GJW B;  2YUO A;  2D8H A;  3EHR A;  1SSH A;  1AEY A;  2J6O A;  3TVT A;  1ZUK A;  3SEM A;  2JT4 A;  2JS2 A;  2MOX A;  3I35 A;  2I0N A;  1K76 A;  2B86 A;  2FPF A;  4RTY A;  2HEQ A;  2C0T A;  4CC2 A;  1X6B A;  2DBK A;  1FMK A;  2JTE A;  1YCS B;  2DVJ A;  3M0T A;  2DL7 A;  2K6D A;  2LX7 A;  2KXC A;  2QDL A;  1ZSG A;  1PKT A;  2O88 A;  3R6N A;  3VRY A;  2O2O A;  1HJD A;  2D8J A;  3QWX X;  1CSK A;  2CUB A;  1ABQ A;  3UA6 A;  4D8K A;  3M0S A;  3CQT A;  1X43 A;  4K11 A;  2FEI A;  4AFZ C;  1H3H A;  1FYN A;  4OMO A;  2CT3 A;  4LUE A;  1YWO A;  2KYM A;  3LH5 A;  1GFD A;  3VS4 A;  2L3Q A;  2K7A A;  1ARK A;  2GTJ A;  3QWY A;  2EYX A;  5FWC A;  2DX1 A;  3I5R A;  4F14 A;  1T3L A;  4LNP A;  5I22 A;  2EPD A;  4OMQ A;  1QWF A;  2A36 A;  3M0P A;  2RQR A;  1UE9 A;  1KSW A;  2RPN A;  2PZ1 A;  3ULR B;  2VWF A;  2K79 A;  1MUZ A;  2J6F A;  1E6H A;  1HD3 A;  1K1Z A;  1NM7 A;  3U23 A;  1OV3 A;  1SHF A;  4RTW A;  3NHN A;  1I07 A;  2F2X A;  3FJ5 A;  4RTZ A;  3RBB B;  1X69 A;  2GNC A;  4RTX A;  2DF6 A;  2KR3 A;  1UHC A;  1WLP B;  1ZUU A;  3NMZ C;  2DL3 A;  1YWP A;  1V1C A;  2A08 A;  1WYX A;  1TUC A;  2CUD A;  2KT1 A;  2K3B A;  2NWM A;  1OEB A;  4Z8A A;  1NEB A;  2O9S A;  2KRN A;  4J9C A;  2YUQ A;  1M27 C;  3VS0 A;  2ESW A;  2P4R A;  1MV3 A;  2KNB B;  1SEM A;  2HBW A;  2KE9 A;  3PVQ A;  3THK A;  1GL5 A;  2YSQ A;  2O31 A;  2SRC A;  1GBQ A;  2F2V A;  1QKW A;  2LCS A;  2AKL A;  2DIL A;  3O5Z A;  4GBQ A;  4X1V A;  3ZL7 C;  2RQU A;  1B3Q A;  2RQT A;  3VRZ A;  3VS3 A;  4AG2 C;  4J9D A;  4ORZ A;  4E6R A;  1K0S A;  4OMN A;  1AD5 A;  1VYV A;  4J9I A;  4Z88 A;  1MV0 B;  1AWW A;  3VS7 A;  1QCF A;  2KXD A;  2DA9 A;  2OJ2 A;  2EGE A;  3EHQ A;  2JXB A;  2J05 A;  1Z9Q A;  4HVU A;  4ESR A;  3EG2 A;  1NEG A;  2VVK A;  1TUD A;  2YUN A;  3M0Q A;  1WDX A;  1JQQ A;  1G2B A;  3H0I A;  2MCN A;  2BZ8 A;  3H0H A;  2O9V A;  2CH4 W;  1AZE A;  1QLY A;  3SHW A;  1X6G A;  4AFS C;  2RQV A;  2J7I A;  2DL5 A;  2DRM A;  2JMC A;  1N5Z A;  1AWO A;  3UAT A;  3PE0 A;  1M30 A;  2OI3 A;  3VS2 A;  3I9Q A;  1X2Q A;  1UFF A;  2CRE A;  1SPK A;  1BBZ A;  1S1N A;  2FRW A;  3RNJ A;  2PNI A;  5FWB A;  1QWE A;  1UGV A;  1KIK A;  1KFZ A;  1Y0M A;  1T0J A;  1GCQ A;  4IIM A;  2KBT A;  4CC7 A;  1E6G A;  1W1F A;  2JM8 A;  2EGC A;  5IHN A;  2W10 A;  2EYW A;  2KGT A;  2XMF A;  1SRL A;  2JS0 A;  1W6X A;  2C0O A;  2J6K A;  3PVL A;  4LE9 A;  2LMJ A;  2ABL A;  1X27 A;  2W0Z A;  2EQI A;  2YDL A;  1JXM A;  2JM9 A;  1JO8 A;  4RTT A;  2DE0 X;  1AVZ C;  1M3A A;  2JW4 A;  3A98 A;  1K0X A;  3NPF A;  1Y57 A;  3EG3 A;  1WXU A;  5FW9 A;  2D0N A;  1NLO C;  3NGP A;  1H8K A;  1YP5 A;  4Z89 A;  2EBP A;  2KRO A;  2JMA A;  2L0A A;  2LZ6 B;  4WCI A;  1M8M A;  3VS5 A;  4CC3 A;  1J3T A;  1KJW A;  1RUW A;  1UDL A;  1UJ0 A;  2LJ0 A;  1JXO A;  1T0H A;  2RQW A;  1U3O A;  1WA7 A;  2L3P A;  1WFW A;  2DNU A;  1GCQ C;  2EYY A;  1VYU A;  2V1R A;  1UJY A;  1BU1 A;  1VA7 A;  2GTO A;  3IQL A;  2CSI A;  2SEM A;  3I5S A;  4LN2 A;  5I11 A;  2J06 A;  1WX6 A;  2DL8 A;  4M4Z A;  4A63 B;  2M51 A;  1PWT A;  1GCP A;  1SRM A;  1HSQ A;  2BTT A;  2KEA A;  3JV3 A;  2IIM A;  4RUG A;  4Y92 A;  2ED1 A;  4D8D A;  4JZ3 A;  2X3W D;  2FG0 A;  2LQW A;  2AK5 A;  1WI7 A;  1AWJ A;  4GLM A;  4AG1 C;  1UUE A;  2FPD A;  2OAW A;  2EKH A;  5EC7 A;  4OMM A;  2KYB A;  2RF0 A;  5IHI A;  2RNA A;  1E7O A;  2G6F X;  1GRI A;  4J9F A;  4J9G A;  1OPK A;  2HSP A;  2X3X D;  4FSS A;  1ZUY A;  2DMO A;  1JU5 C;  2MIO A;  2K9G A;  1PNJ A;  2DYB A;  2CDT A;  5IH2 A;  4J9E A;  3C0C A;  4AFQ C;  3UA7 A;  2LNH B;  4DEX A;  2DLP A;  2ROL A;  4CC4 B;  1AOJ A;  2RN8 A;  4AFU C;  5GJV B;  4RTV A;  1I1J A;  3VS6 A;  2AKK A;  2FRY A;  1YNZ A;  1BK2 A;  2DBM A;  4JJC A;  2AZS A;  1NYF A;  1UEC A;  4R0K A;  2GBQ A;  3REB B;  2EW3 A;  4ZNX A;  3UF4 A;  2EYZ A;  4J9H A;  3EG0 A;  4RTU A;  1NG2 A;  1W70 A;  2HDA A;  1M3C A;  1WXT A;  2E5K A;  2V1Q A;  2AZV A;  1T3S A;  5L23 A;  4HXJ A;  2LJ3 A;  5ECA A;  3KFV A;  1K4U S;  4DEY A;  1A0N B;  1VYT A;  2C0I A;  1RI9 A;  2DL4 A;  3TSW A;  4HVV A;  1RLP C;  1I0C A;  2FPE A;  1PKS A;  5HCK A;  4LUD A;  1CKB A;  1ZBJ A;  2LQN A;  3M0R A;  1UTI A;  2EGA A;  1K9A A;  2RMO A;  3TSZ A;  2DM1 A;  1PHT A;  1GFC A;  1PRM C;  1U5S A;  2ECZ A;  5IXF A;  4JJB A;  2GQI A;  1RLQ C;  1WXB A;  1UHF A;  2D1X A;  1ZLM A;  2K2M A;  1OPL A;  3H0F A;  4OMP A;  2A37 A;  1ABO A;  2DJQ A;  1NYG A;  2BZY A;  1M3B A;  2KT8 A;  1EFN A;  2H8H A;  2F2W A;  2PTK A;  1B07 A;  2ENM A;  2L2P A;  3GBQ A;  2LP5 A;  4F17 A;  1ZX6 A;  4JPB W;  2KRM A;  5IHK A;  4F16 A;  1QKX A;  1Z9Z A;  1WIE A;  2CT4 A;  1NLP C;  2ED0 A;  3M0U A;  2A28 A;  2GGR A;  4IIO A;  2YUP A;  1GBR A;  3EG1 A;  1JEG A;  4EIK A;  4QT7 A;  2KRS A;  2DRK A;  4OML A;  2YT6 A;  4HVW A;  1U06 A;  4JJD A;  2VKN A;  2CH4 A;  1XOV A; 
#chains in the Genus database with same CATH topology
 3VS1 A;  3E9F A;  8AT1 B;  4B9X A;  1YN8 A;  1H92 A;  4M78 B;  2PVG B;  1VIE A;  1WHK A;  2RHZ A;  5GAN f;  3L2R A;  1QVF P;  3H41 A;  4J83 A;  4HCK A;  2XD0 A;  1LCK A;  1KD1 R;  4IUT A;  2CSQ A;  2DD5 A;  5FRM A;  4KRT A;  2NUZ A;  1VQ8 A;  1OOT A;  3OB9 A;  2FO0 A;  2BZX A;  2IVW A;  3EHR A;  4LDU A;  1AEY A;  4IKF A;  2JT4 A;  2JS2 A;  3I35 A;  5DLO A;  2B86 A;  2HEQ A;  2QA4 T;  3OS5 A;  2BKD N;  3QZ9 B;  5A2Q E;  4ZN1 A;  1UEB A;  4C92 F;  3QPH A;  4E2F B;  2QDL A;  4IUQ A;  2O88 A;  2EQK A;  1RAD B;  4MZT A;  2BE9 B;  1YJW A;  2CUB A;  3CCU Q;  1VQ5 A;  4EMK B;  4D8K A;  2RJC A;  3PT9 A;  4AFZ C;  3G6E A;  4OB0 B;  1RAI B;  1V29 B;  4LDV A;  2QQ9 A;  1QP2 A;  3H6Z A;  4M7D B;  3LH5 A;  3A8M B;  4C8Q E;  4C5I A;  2JTF A;  3ZFJ A;  4M78 E;  1BI0 A;  1OZ3 A;  2GTJ A;  2EYX A;  1JRI A;  2DX1 A;  1T3L A;  5FU7 B;  5FU6 B;  3JCM Q;  4LNP A;  2EPD A;  1QWF A;  1PSF A;  4VUB A;  4M7A A;  5J3B A;  2ZZD A;  3PIO A;  1X6O A;  3EH1 A;  4M7A F;  4II1 A;  5LJ3 d;  2DEU A;  2QAZ A;  2RPN A;  4OGC A;  3CCV T;  5FU6 C;  3LYI A;  3L2Q A;  3CC4 T;  2J6F A;  1E6H A;  4E7I A;  2RO0 A;  2JN0 A;  1OV3 A;  1R0C B;  1NJI U;  1SHF A;  1W4S A;  2OTL Q;  3C4S A;  4QKU A;  3QJ6 A;  3MEW A;  4C5E A;  1WPY A;  2KI7 A;  4IUR A;  4BE2 A;  2DF6 A;  2XU8 A;  4PJO A;  1WLP B;  2YXY A;  2DL3 A;  1S72 Q;  2A08 A;  1K8A R;  1TUC A;  2CUD A;  2KT1 A;  1KQS P;  1VQN T;  4M77 G;  2COY A;  2NWM A;  3I56 A;  4R56 A;  1D0X A;  2C06 A;  2YUQ A;  3JCM b;  1K8A C;  3CD6 T;  3R6O A;  5KYU A;  1VQM T;  1KHI A;  3E2U A;  1N8R R;  1UGQ B;  4C8Q D;  2MPX C;  4GBQ A;  1PM3 A;  4GY5 A;  3G4S A;  1KC8 U;  1B3Q A;  1R0B G;  2R5A A;  1N8R C;  1MNE A;  4J9D A;  1ZBX A;  1EIF A;  2DET A;  4E6R A;  3EGX B;  1YBY A;  2KMT A;  4LDW A;  5IT9 E;  4CRI A;  1Q82 C;  2A3L A;  3CMA A;  2DA9 A;  3D7S B;  2J05 A;  1Z9Q A;  2QTX A;  3VUZ A;  3BDU A;  4DOW A;  3MET A;  1SSF A;  2VVK A;  3CCV A;  3AHU A;  7AT1 B;  1JQQ A;  2ZPI B;  3JCM c;  3VYG A;  3EFR A;  3O8V A;  1ZSZ C;  2BZ8 A;  3MEA A;  4E47 A;  2KQW A;  5HK0 A;  1YIT A;  3G71 A;  2DRM A;  4FT4 A;  1AWO A;  2OI3 A;  1JJ2 A;  5FRN A;  4M77 F;  2DAQ A;  2CRE A;  1S1N A;  3QII A;  1K9M C;  5A0D A;  5FWB A;  4PJJ A;  5GMK j;  3SB2 A;  1UGV A;  3CCL Q;  1KQS A;  1Y0M A;  1XJW B;  1GCQ A;  3I55 A;  2CP5 A;  1S72 T;  2DYI A;  5LJ5 g;  3JCM X;  4M78 D;  2JS0 A;  4LE9 A;  4TVR A;  4A54 A;  4O5V A;  3RMS A;  2LRQ A;  2W0Z A;  2ZGW A;  4OVA A;  2YDL A;  2JM9 A;  5GAM j;  4OB1 B;  2RHY A;  3A98 A;  1K0X A;  1WXU A;  2E12 A;  1AT1 B;  2O01 E;  2FVU A;  4QW2 A;  3ZBD A;  2JMA A;  3CBP A;  4WF2 A;  1M8M A;  3SWN A;  1RAC B;  2OTJ A;  1J3T A;  1D1C A;  1RUW A;  2LJ0 A;  2DJZ A;  4M78 A;  1RAG B;  3OW2 A;  1U3O A;  2CZ0 B;  3EGX A;  3OYC A;  2EYY A;  5HK3 A;  3CPW A;  4A4H A;  3CD6 A;  1UJY A;  3JCM d;  1BU1 A;  4M78 C;  1RAA B;  3RER A;  3M55 A;  2SEM A;  5DY9 A;  5CQX A;  3WVD B;  4XTZ A;  2DZ9 A;  4R55 A;  2J06 A;  2CYZ B;  2DL8 A;  2XHC A;  2M51 A;  1PWT A;  1GCP A;  4KH0 B;  5GAM e;  1OX9 A;  1G3S A;  2KEA A;  4Y92 A;  2WSF E;  4RUG A;  4C0D C;  5LL6 S;  1VQM A;  5CQY A;  1YIJ Q;  5GMK m;  3WXM B;  2AK5 A;  1VQP A;  1WJS A;  2L5Q A;  5KE2 A;  5HY6 A;  1KQ2 A;  2OAW A;  4M7D E;  1MHN A;  2EKH A;  4OMM A;  4NS5 A;  2F5T X;  2RF0 A;  3E19 A;  2ZPG B;  1M1G A;  3OSS C;  2LT1 A;  2X3X D;  4FSS A;  4PFZ A;  2XKO C;  2CP2 A;  2QK0 A;  5GAO r;  2DYB A;  2LCL A;  4J9E A;  3C0C A;  2DIG A;  2X4W A;  4Q5W A;  4DEX A;  1VQ9 A;  2RN8 A;  4V2S A;  4A4K A;  1I1J A;  3M59 A;  2FRY A;  1YNZ A;  2RK2 A;  4M78 F;  1YIT T;  2AZS A;  3A8G B;  1NYF A;  3HL8 A;  1UEC A;  4ZNX A;  2XI9 A;  2EYZ A;  1XNI A;  3CC7 A;  5D7U A;  1NG2 A;  1W70 A;  1PD1 A;  4BDZ A;  2E5K A;  2A7Y A;  5GAN g;  3RKX A;  3V7S A;  2AZV A;  4HXJ A;  3TU4 K;  3KFV A;  2XID A;  4F7U A;  3OYF A;  1LOJ A;  1VYT A;  1RI9 A;  2DTH A;  3CCM Q;  2OTL A;  2YHT A;  2DL4 A;  2ZAE A;  1Q81 C;  1RLP C;  3BW1 A;  3EFO A;  2FPE A;  3J7A F;  1CKB A;  2LQN A;  1K73 C;  3M0R A;  2EGA A;  1WHM A;  4C8Q C;  1Y07 A;  2RMO A;  2DM1 A;  3VJP A;  1U5S A;  5GMK e;  4JJB A;  2GQI A;  1K73 R;  1RLQ C;  1M4Z A;  1WXB A;  4J6Y A;  1UHF A;  1MMD A;  2K4Y A;  3I55 T;  4XTU A;  2Y4Y A;  1NE8 A;  4QQG A;  2BZY A;  4M78 G;  2KT8 A;  4FT2 A;  1B07 A;  2HBP A;  2L2P A;  2ZPH B;  1UGP B;  3M53 A;  2OTJ T;  5IHK A;  1Z9Z A;  2V8J A;  2CT4 A;  2K2V A;  1NLP C;  3M0U A;  3X28 B;  2XIC A;  4BI8 B;  2YUP A;  3G4S Q;  1VQ9 T;  5KYW B;  3OYY A;  2DRK A;  4JJD A;  1B7T A;  2VGN A;  1CKA A;  3CMA T;  1BIA A;  2DTO A;  1OUL A;  5IXB A;  2JVV A;  2EVR A;  2GCX A;  2KDS A;  5GAN 4;  1M1K U;  2YRC A;  4HT8 A;  1I81 A;  1VIF A;  4M7D C;  4C0Z A;  3QHS A;  1X2K A;  4OP0 A;  5LJ3 h;  1D1A A;  3VV0 A;  1AZG B;  2LJ1 A;  1AWX A;  1SHG A;  5GJW B;  5GAO n;  2GFU A;  2YUO A;  1QVG S;  1SSH A;  3X20 B;  5CKE A;  4DBH A;  1H64 1;  1ZUK A;  3SEM A;  2MOX A;  4C92 G;  3F70 A;  1K76 A;  5LJ5 j;  1D0Y A;  1FWZ A;  3S6W A;  3FEO A;  4F7U B;  4CC2 A;  1YJ9 A;  3S3N A;  3LW5 E;  1N9S A;  3EAE A;  5CCA A;  4KUL A;  3LWI A;  1RAF B;  4N4H A;  2EJF A;  3OBW A;  4MMK A;  3R6N A;  2O2O A;  2I2L A;  5FRO A;  5CIU A;  3MEV A;  1JB0 E;  2M1H A;  2FEI A;  1H3H A;  1D09 B;  3CC4 Q;  2CZ7 B;  3CBM A;  2GF7 A;  3M9Q A;  3RMQ A;  2LQ8 A;  2WSE E;  3FIF A;  4MDW A;  2E3H A;  3OBY A;  4PJO G;  4PLI A;  2MMP A;  3LWH A;  1M1K C;  4MDX A;  1GFD A;  1YI2 T;  3VS4 A;  3GPL A;  3CC2 Q;  2L3Q A;  3OW2 P;  3JAM E;  3QWY A;  4NL3 A;  1VQL A;  2RHU A;  5GAN e;  3I5R A;  4F14 A;  4KGZ B;  1M1K R;  4HCB A;  1TWB A;  3M56 A;  3M0P A;  2FYK A;  2RQR A;  1I8F A;  2EFI A;  3HRU A;  4M77 C;  3RKW A;  1KSW A;  2E3I A;  1QW1 A;  3ULR B;  1ZA1 B;  2P0Q A;  2DFU A;  1MUZ A;  3CD6 Q;  4KGX B;  2FL7 A;  3PIP A;  1K1Z A;  3U23 A;  4BAC A;  4ATO A;  4J7I A;  2VGM A;  4GLK A;  4RTW A;  1WJQ A;  5FU7 C;  2QYZ A;  2EIF A;  4N0A C;  2KR3 A;  2NYS A;  1KK7 A;  1UHC A;  4A4G A;  5LJ5 f;  3S3O A;  1ZUU A;  4JS4 A;  3OYL A;  4C92 E;  3C95 A;  1LNX A;  3NFC A;  2DKG A;  1FMW A;  1WYX A;  1YJN Q;  3RDV A;  2K3B A;  1OEB A;  1ZSZ B;  4Z8A A;  1K73 U;  2O9S A;  2FZK B;  2RJD A;  4LD9 K;  2NUP A;  4E7S A;  5GMK h;  2P4R A;  1C1A A;  1MV3 A;  3L2W A;  5LJ3 f;  2KNB B;  4JUV A;  1WQW A;  1Q86 C;  2KE9 A;  3PVQ A;  3CCR Q;  2YSQ A;  3OYH A;  2SRC A;  4EMG A;  3CCE Q;  4WTO B;  1GBQ A;  2F2V A;  5I21 A;  1U8R A;  3O5Z A;  1Q86 R;  2WAC A;  4C5G A;  2V26 A;  2RQU A;  1PCX A;  3JRZ A;  3JCM J;  2NLU A;  2E70 A;  3URG A;  3OYJ A;  3RKY A;  4Z88 A;  1MV0 B;  1AWW A;  1IZ6 A;  4QVZ A;  1QCF A;  2HQH A;  2P0K A;  3PNW C;  2JXB A;  4M75 D;  3GIB A;  2O4X A;  3VKI A;  2X4X A;  2V8I A;  2E4H A;  1NEG A;  4QQ6 A;  3MCA B;  3M0Q A;  2ATC B;  3MP6 A;  5CAI A;  1G2B A;  3KXT A;  2E1H A;  3H0H A;  4C8Q A;  1VQ5 T;  3MPU B;  1M1F A;  3CME A;  1AZE A;  2KY9 A;  2BUD A;  3UDC A;  2V8K A;  4E7Z A;  3SHW A;  1X6G A;  1VQ4 Q;  3JB9 F;  1LPL A;  4ANJ A;  1M30 A;  1X2Q A;  4JLG A;  3FJP A;  2F1L A;  1N9R A;  3E9G A;  3RNJ A;  2PVD B;  2PNI A;  3G6E T;  2XDB A;  1QWE A;  1Q7Y R;  3OS1 A;  2YLB A;  2Y4X A;  1M90 C;  1HYO A;  3NTI A;  1N8R U;  1RI0 A;  4CC7 A;  1E6G A;  2EGC A;  5CKB A;  1KC8 R;  3KUF A;  4LDX A;  2EWN A;  1VQ7 Q;  4RKU E;  2EYW A;  1ZSZ A;  3CMA Q;  2ZPE B;  4KBM B;  4FIB A;  3ER0 A;  3PVL A;  1KD1 C;  3JCM P;  2LMJ A;  2MK5 A;  2HSE B;  2CS7 A;  3JCM h;  3RES A;  1QQJ A;  2EQI A;  5KYY A;  5M9O A;  1K8A U;  2E41 A;  2JW4 A;  3GNG A;  2CGH A;  5FW9 A;  1BCO A;  2YLC A;  1NLO C;  3NTH A;  4XTW A;  3NGP A;  2EQM A;  1YP5 A;  4Z89 A;  2KRO A;  2L0A A;  4WCI A;  3JSC A;  3VS5 A;  1F1B B;  5LJ3 j;  3C94 A;  1WHL A;  1VYU A;  4KGV B;  2GTO A;  2P4T A;  3QG1 A;  4HCZ A;  4B9W A;  2CSI A;  3DB3 A;  1YIJ A;  3M58 A;  3OSV A;  1VQP Q;  1NJI R;  1U1S A;  5I11 A;  2HQX A;  4C0G A;  3I56 Q;  2KAF A;  4E7K A;  2RA2 A;  1HSQ A;  2P84 A;  2RHI A;  2ED1 A;  4QVC A;  4D8D A;  2QQB A;  5A0L A;  3HSB A;  1D0Z A;  1WI7 A;  3V8K A;  4MML A;  2RNA A;  5GAM g;  3J81 E;  3JB9 I;  4RMO A;  3X24 B;  2CZ1 B;  4LDY A;  2HSP A;  1VQ6 Q;  3CCQ T;  1VQN Q;  3CBO A;  3OYI A;  4C5H A;  2DTI A;  3M54 A;  4Y28 E;  2RJF A;  5IH2 A;  4M75 G;  3CCM T;  2QQR A;  3EG9 B;  3OS0 A;  2DLP A;  3NTK A;  3MEU A;  1AOJ A;  4J7F A;  1IRE B;  1VUB A;  5GJV B;  1VQL T;  4DQ2 A;  5IN1 A;  4ELY C;  1SKU B;  4ZTF A;  1BK2 A;  2D9T A;  1KHC A;  4M75 B;  2Y90 A;  1C0M A;  4XU0 A;  9ATC B;  3A1P A;  3FLG A;  1YJW Q;  3EG0 A;  4RTU A;  1WXT A;  1YFN A;  2MI6 A;  2V1Q A;  4AMC A;  4ZN3 A;  1VQ4 T;  5ECA A;  1BI1 A;  2VB6 A;  1VQK T;  2K5F A;  3A8O B;  3DLL A;  1NPR A;  4HVV A;  2QGF B;  1UGR B;  2M9U A;  2DVE A;  5HCK A;  4LUD A;  5D6W A;  3HRT A;  3L2Z A;  4Y91 A;  1ZBJ A;  1C6V X;  2KSS A;  1VQO A;  3HP9 A;  3M4G A;  3CCQ Q;  1I4K 1;  4XK8 E;  1M9S A;  4EMH A;  3EH2 A;  1Q7Y U;  1I5L A;  2HNI A;  2K2M A;  1OPL A;  3H0F A;  4OMP A;  4E7L A;  2DXT A;  4FYW B;  2DJQ A;  1NYG A;  2EJ9 A;  1M3B A;  2QEX Q;  4PJO E;  2F2W A;  3FDR A;  4M75 F;  2ENM A;  4MZP A;  4M75 A;  4JPB W;  5KH6 A;  2KRM A;  3CCR A;  1X01 A;  1U1T A;  3OYG A;  2DER A;  4M7A G;  5AT1 B;  2OTJ Q;  2A28 A;  4IIO A;  4ZTJ A;  3JB9 G;  4EIK A;  1YJW T;  4OML A;  3OQ5 A;  2YT6 A;  3EG9 A;  5KYN A;  2VKN A;  3CME Q;  2CH4 A;  3JCM W;  1OZ2 A;  1YIJ T;  1XOV A;  2L3S A;  4PNO A;  4QQD A;  1MMA A;  4M7A B;  5CKF A;  1GXI E;  3SFM A;  1EX4 A;  5GAM d;  1K9M R;  1RAH B;  1UG1 A;  2HCK A;  4XAX B;  1TTH B;  1ACM B;  1G83 A;  3OW2 S;  1PRL C;  1JJ2 P;  3HRS A;  4EDU A;  3J80 E;  4F7U E;  3CCU T;  2M0Y A;  1MND A;  4J9B A;  1QMC A;  1NPP A;  4BY6 C;  2J6O A;  2RI2 A;  3HKS A;  2PQW A;  3OS2 A;  2I0N A;  2FPF A;  4RTY A;  4KUI A;  3QBY A;  2C0T A;  3H9N A;  1X6B A;  1FMK A;  2JTE A;  3GLX A;  2DL7 A;  5GAN 6;  1G8X A;  4UC4 A;  1OU8 A;  2LVM A;  3EFS A;  3HHT B;  3VRY A;  1HJD A;  2CP3 A;  3QWX X;  4C0F A;  4X9D A;  3UA6 A;  3QSU A;  3P8D A;  2PUO B;  1R8O B;  4OGE A;  1TS9 A;  2LX9 A;  3CXC P;  1VQ7 A;  2E65 A;  2QQA A;  2HKQ B;  1FYN A;  2CT3 A;  3N5B B;  1AHJ B;  1M2V B;  1YWO A;  3OMG A;  4NOY A;  2OTL T;  3DLM A;  1JJ2 S;  4XTX A;  2QEX T;  1M2O A;  2RB6 A;  5FWC A;  4J5Y A;  3T9N A;  2K57 A;  3L2U A;  1VQ8 T;  1BKB A;  4OMQ A;  2BE7 D;  4PFP A;  3TQ7 P;  2LQK A;  1MGQ A;  3CCL A;  3CCM A;  4C0D B;  4B6M A;  5GAN 7;  2JNG A;  2HQE A;  2VYT A;  2VWF A;  3I55 Q;  5FLX E;  3OYD A;  1WQ7 A;  4BI4 A;  2RK1 A;  2XK0 A;  3OY9 A;  2JTM A;  2MAM A;  2K3Y A;  4FCY A;  2F2X A;  3RBB B;  1X69 A;  3CCE T;  1IHW A;  2QDY B;  5LJ5 h;  2RH2 A;  3CCS Q;  1UGS B;  3NMZ C;  2JUF A;  1YWP A;  3CC4 A;  1V1C A;  5C0M A;  2JOY A;  1W2B P;  4M7D A;  2HKN A;  1NEB A;  2JZ2 A;  4IUU A;  1PSE A;  1G3Y A;  4JJN K;  1M27 C;  3VS0 A;  2ESW A;  2RHX A;  1H3Z A;  2AHJ B;  4PJM A;  5J39 A;  3ZEH A;  1VQL Q;  4ZGE B;  3CEY A;  1KD1 U;  4N4I A;  1SEM A;  2HBW A;  2HMA A;  3C12 A;  1VQ8 Q;  3THK A;  1GL5 A;  1X75 C;  2AIR B;  1W2B A;  2AKL A;  3ZL7 C;  3MJX A;  3VU3 C;  2RQT A;  3VS3 A;  3PFS A;  4AG2 C;  5GAO l;  5GAM f;  4ORZ A;  3CME T;  2X4J A;  2LT4 A;  1AD5 A;  1Q81 R;  2LDM A;  2QQS A;  4FL6 A;  4RG2 A;  5CVI A;  3VS7 A;  3CCJ Q;  4EMK A;  2KXD A;  3CCJ T;  1VQ4 A;  3EHQ A;  4HVU A;  3UT1 A;  2XG8 D;  3TEE A;  1TUD A;  4X9C A;  2YUN A;  1FXX A;  2COW A;  5KYX B;  3CPF A;  3H0I A;  2MCN A;  2CH4 W;  1VQO Q;  2X51 A;  3QUI A;  1PD0 A;  2RQV A;  2J7I A;  4PL6 A;  2OAU A;  5KYW A;  4ME7 A;  2LNV A;  2M16 A;  2K3X A;  2COZ A;  1BBZ A;  2QEX A;  5CR2 A;  1OYX A;  1V76 A;  1M2V A;  4PFO A;  2DPP B;  3RIR A;  4LXC A;  5GMK l;  2DIQ A;  3P8H A;  4Z02 A;  2R58 A;  4JS5 A;  1T0J A;  3BDL A;  4PJO F;  4IIM A;  4DBF A;  4M77 B;  1W1F A;  5I2M A;  2JM8 A;  3P8B B;  2X4Y A;  2FZG B;  1G3T A;  5IHN A;  2RJE A;  1QVP A;  3G1J A;  3M5A A;  5KYU B;  4E7H A;  2IG0 A;  1Q86 U;  1W6X A;  2HL5 C;  2KK4 A;  5GMK i;  2L8D A;  1WJR A;  2ABL A;  1BYM A;  5D6X A;  4RCB A;  3HTR A;  3LGF A;  1AVZ C;  3L42 A;  1Y57 A;  1JBM A;  3EG3 A;  3GP8 A;  4ZGD B;  4M7D F;  5GAN 5;  2B8A A;  2LZ6 B;  2EJG A;  1IB8 A;  3A8H B;  1P92 A;  1UJ0 A;  1T0H A;  3HFO A;  2RQW A;  5GAO q;  1WA7 A;  2L3P A;  1WFW A;  1IHV A;  3V7R A;  3AT1 B;  2H3E B;  4JRQ A;  2DK3 A;  2QGG A;  4LN2 A;  1WX6 A;  4M4Z A;  4F7U F;  2JJ9 A;  4A4F A;  4A63 B;  3KBG A;  3JV3 A;  2IIM A;  4M75 C;  2CP7 A;  1PC0 A;  3QZ5 B;  2M0O A;  3OYM A;  2LQW A;  5KE3 A;  1XQH A;  2RI5 A;  2ZPF B;  1AWJ A;  6AT1 B;  4GLM A;  4D6W A;  3CCE A;  1O9S A;  4NL2 A;  3ASK A;  5GAO m;  5GAN h;  2G6F X;  1GRI A;  3GNF B;  1BI3 A;  4M7D G;  4J9F A;  4J9G A;  1OPK A;  2CKK A;  2E10 A;  1YJN T;  1VQ6 T;  2DMO A;  1IGU A;  2VAS A;  5C6S A;  3QDR B;  1JU5 C;  2MIO A;  3EGD B;  2K9G A;  2CDT A;  1FMV A;  4A4E A;  2MWP A;  4EPC A;  4AFQ C;  3UA7 A;  2LNH B;  4C92 C;  2E5Q A;  2ROL A;  4CC4 B;  2QA4 Q;  1IGQ A;  4HKE A;  5KCO A;  5CKD A;  2AKK A;  1VQP T;  3EGD A;  3Q1J A;  2ZPB B;  3SWN C;  4J8O A;  3CCL T;  4IUV A;  2GBQ A;  3REB B;  8ATC B;  2EW3 A;  3MP8 A;  4FSX A;  2FB7 A;  4PJO D;  4QVD A;  2H3J A;  3CCQ A;  1EZZ B;  4BB7 A;  5CKH A;  1WHH A;  4F7U G;  1Q82 R;  4O6J A;  1QCN A;  3VYH B;  5LJ3 e;  4M77 D;  1KQ1 A;  3BY7 A;  3OYB A;  1VQ9 Q;  1UTI A;  2D0Q B;  3CCS A;  4PJO B;  3TSZ A;  4X34 A;  1PHT A;  1GFC A;  2PVO B;  1PRM C;  1SG5 A;  5J26 A;  2QI2 A;  2EQU A;  2X35 A;  1KQS S;  4OB3 B;  2D1X A;  2LCC A;  2DEQ A;  3QJY A;  4MZM A;  5AYF A;  4DBR A;  5DLQ E;  2GQV A;  3CXC A;  4KUD K;  3CC7 T;  1ABO A;  3CC7 Q;  5GAN j;  1O75 A;  3PGG A;  4JDS A;  1LVK A;  2PTK A;  4F17 A;  1ZX6 A;  4M7A E;  1Y96 A;  1BCM A;  2LC4 A;  3X25 B;  3A8L B;  3OYN A;  4F16 A;  1QKX A;  2PU9 B;  1WIE A;  2ED0 A;  3L1A A;  3BE3 A;  3CXC S;  3JCM e;  4XQ3 A;  2EAY A;  2HD0 A;  1GBR A;  4HVW A;  1U06 A;  3CCU A;  1VQ5 Q;  5LJ5 e;  2RI3 A;  4C8Q F;  2BIV A;  2QTV A;  1Y96 B;  3DKM A;  3OMC A;  3CCJ A;  1VQK Q;  2K5I A;  1ZA2 B;  1IO6 A;  3LGL A;  4JZ4 A;  1RAE B;  1D1B A;  1BB9 A;  1G3W A;  1TG0 A;  2ROT A;  4BE1 A;  3EGU A;  3UWN A;  1YJ9 T;  1M90 R;  3REA B;  3S3M A;  1IXD A;  4F04 B;  3OYA A;  4YTL A;  2NUP B;  5GAO p;  4FW1 A;  1KC8 C;  2VV5 A;  1D3B B;  4XTY A;  2D8H A;  3FC3 A;  4IUP A;  3RUX A;  1W2B S;  4PJL A;  3V7C A;  3QDF A;  4N0A A;  3TVT A;  3CC2 A;  3JCM f;  1WHJ A;  5CO7 A;  4FM4 B;  4P5N A;  2DBK A;  1YCS B;  2DVJ A;  3M0T A;  5LJ5 d;  2CZ6 B;  3G71 Q;  2K6D A;  1VQN A;  2DXC A;  2LX7 A;  3G71 T;  2KXC A;  3EFO B;  3ME9 A;  2D6F A;  3SDZ A;  1ZSG A;  3G7Z A;  1PKT A;  5KCH A;  2D8J A;  1NBE B;  3FRN A;  1CSK A;  1YCY A;  2IPO B;  1ABQ A;  4BY6 B;  4M75 E;  3M0S A;  3CQT A;  2ZCF B;  4L59 A;  3PMT A;  4M7A D;  1X43 A;  4K11 A;  1QVG P;  4CI0 C;  4OMO A;  3PTA A;  2GFA A;  4LUE A;  4BUG A;  2KYM A;  4JRK A;  3SD4 A;  4PJO C;  1NJI C;  1OU9 A;  2K7A A;  1ARK A;  2FZC B;  3MO8 A;  4KH1 B;  4C8Q G;  3G6E Q;  1YJN A;  3H8Z A;  5I22 A;  2EKO A;  3BFM A;  2A36 A;  3QKJ A;  2M02 A;  3I56 T;  1UE9 A;  2PZ1 A;  2VXF A;  2K79 A;  2L3R A;  4C8Q B;  1YI2 A;  2P0P A;  4RCC A;  2X9H A;  1HD3 A;  2O4X B;  5EG2 A;  2YRV A;  1NM7 A;  1IRX A;  4C92 D;  2MF2 A;  3NHN A;  1B34 B;  1I07 A;  4HA8 A;  3FJ5 A;  3CCR T;  4RTZ A;  2AT1 B;  3E1S A;  2GNC A;  3CC2 T;  2LTO A;  1ZQ1 A;  1LJO A;  4RTX A;  5IAY A;  2KVQ G;  1G5V A;  4HCC A;  3CCS T;  3CPW S;  3OYE A;  2E6Z A;  2KRN A;  4J9C A;  3WVE B;  4OF1 A;  2HAX A;  5GAN 2;  1XTD A;  1Q81 U;  4JRP A;  1VQM Q;  2VUB A;  1YHQ T;  1S72 A;  4FYV B;  3V8L A;  5I2S A;  2O31 A;  5HKC A;  1QKW A;  2LCS A;  1KG1 A;  2DIL A;  4X1V A;  4L5G A;  4M7D D;  3VRZ A;  5L8R E;  1OQK A;  4L6V 5;  1K0S A;  2CP0 A;  4OMN A;  1VYV A;  4ELZ C;  4J9I A;  4J6X A;  2OJ2 A;  2EGE A;  2L89 A;  1Q95 G;  3QO3 A;  4ESR A;  4OMF B;  1NZ9 A;  3EG2 A;  4M77 A;  2NUT B;  2G3R A;  1WDX A;  3QYG B;  1N6A A;  3OA6 A;  2O9V A;  3X26 B;  4N4G A;  1I5O B;  1RAB B;  1VQ7 T;  1QLY A;  4AFS C;  2QXF A;  2E6N A;  2A0F B;  2DL5 A;  1QVF A;  2JMC A;  3HPW A;  2MWO A;  1N5Z A;  3UAT A;  3LLR A;  3CCV Q;  3PE0 A;  3VS2 A;  3I9Q A;  4BI3 A;  1UFF A;  1SPK A;  1YHQ Q;  2OX7 A;  2FRW A;  4A53 A;  1HXD A;  2R57 A;  3MHX A;  1HK9 A;  3JCM V;  1YIT Q;  1KIK A;  2HZY A;  1MMN A;  4PJN A;  4EMK C;  2YWW A;  1KFZ A;  3DB4 A;  5KYX A;  1FX7 A;  2KBT A;  2FHD A;  5LJ3 g;  5GAN d;  5DM7 R;  2W10 A;  1OX8 A;  2KGT A;  4BDY A;  2XMF A;  1SRL A;  4J6W A;  2RD1 A;  2C0O A;  4DA4 A;  2J6K A;  1M8V A;  5GAN 8;  2XDP A;  4XU2 A;  1X27 A;  2VXE A;  3A5Z B;  1JXM A;  1JO8 A;  1TUG B;  4RTT A;  2DE0 X;  4DBQ A;  1M3A A;  1BI2 A;  4FYY B;  3NPF A;  1BIB A;  1QCO A;  1WNL A;  4XU1 A;  2VC8 A;  4AT1 B;  1QVG A;  2D0N A;  1WGS A;  1B34 A;  2QG9 B;  1H8K A;  2F5K A;  2EBP A;  1M90 U;  5GAN 3;  4CC3 A;  3MP1 A;  2F69 A;  1KJW A;  1UDL A;  1JXO A;  2DNU A;  3UPU A;  1GCQ C;  2V1R A;  1VA7 A;  3IQL A;  4PKC C;  3LX7 A;  3I5S A;  1TH7 A;  3PMI A;  3M57 A;  1VOM A;  4M7A C;  2EYQ A;  1SRM A;  3VUB A;  1SF9 A;  1TU0 B;  3FB9 A;  2K5L A;  3INZ A;  2BTT A;  4PLL A;  2YRD A;  1YHQ A;  2DXB A;  4JZ3 A;  2X3W D;  2FG0 A;  1UB4 A;  1MMG A;  4C92 A;  1K9M U;  4E7J A;  4AG1 C;  1UUE A;  2FPD A;  1M5Q 1;  1QP3 A;  3TCJ A;  5EC7 A;  2KYB A;  5IHI A;  4HT9 A;  2DO3 A;  1TOV A;  1E7O A;  2QA4 A;  5KYY B;  3MKD A;  3GOX A;  3V8J A;  3M4Y A;  2WSC E;  3L2V A;  1VQO T;  4BE0 A;  4FU6 A;  3TRE A;  1ZUY A;  2NUT A;  3OYK A;  1DJ7 B;  3JB9 H;  1N27 A;  1RL2 A;  1PNJ A;  1D3B A;  2E64 A;  1YI2 Q;  2QAS A;  2R5M A;  4AFU C;  4RTV A;  1OI1 A;  3VS6 A;  2PUK B;  2DBM A;  1Q82 U;  4JJC A;  4PK4 A;  4R0K A;  1WHG A;  3UF4 A;  4JRI A;  4J9H A;  2HDA A;  1M3C A;  1T3S A;  5L23 A;  4DOV A;  2LJ3 A;  1TSF A;  1VQ6 A;  4M77 E;  3RR6 A;  1K4U S;  4DEY A;  1A0N B;  2C0I A;  2Z0W A;  5A0G A;  4FYX B;  3TSW A;  4BD3 A;  1I0C A;  2CP6 A;  1WZO A;  2DZC A;  1PKS A;  3JB9 J;  2XDD A;  1Y71 A;  4OB2 B;  1K9A A;  3JB9 D;  2EQJ A;  4ZGJ B;  2ECZ A;  5CK9 A;  5IXF A;  4LD6 A;  5D6Y A;  3CPW P;  1ZLM A;  4FW2 A;  2A37 A;  1TXQ A;  4XU3 A;  1QVF S;  2DXU A;  2MYS A;  1EFN A;  4KT0 E;  3JCM g;  2H8H A;  4JLI A;  1YJ9 Q;  3GBQ A;  2LP5 A;  1ZHI A;  1Y7X A;  3LH0 A;  3QXE B;  3QYH B;  3HFN A;  1VQK A;  4C92 B;  4XTV A;  3GF5 A;  2RM4 A;  3G4S T;  2GGR A;  1R77 A;  2DD4 A;  3EG1 A;  1JEG A;  1Q7Y C;  4QT7 A;  2KRS A;  2HL3 A;  1PG5 B;  4RG8 A;  5GAM h;  3SWN B; 
#chains in the Genus database with same CATH homology
 3VS1 A;  1CKA A;  2L3S A;  1YN8 A;  1H92 A;  1IO6 A;  5IXB A;  1UG1 A;  2HCK A;  4JZ4 A;  2EVR A;  3H41 A;  1BB9 A;  1G83 A;  1TG0 A;  4HCK A;  2ROT A;  1LCK A;  1PRL C;  3EGU A;  2CSQ A;  1X2K A;  3REA B;  2M0Y A;  1AZG B;  2LJ1 A;  4KRT A;  2NUZ A;  1AWX A;  1OOT A;  1SHG A;  4J9B A;  2FO0 A;  2BZX A;  5GJW B;  2YUO A;  2D8H A;  3EHR A;  1SSH A;  1AEY A;  2J6O A;  3TVT A;  1ZUK A;  3SEM A;  2JT4 A;  2JS2 A;  2MOX A;  3I35 A;  2I0N A;  1K76 A;  2B86 A;  2FPF A;  4RTY A;  2HEQ A;  2C0T A;  4CC2 A;  1X6B A;  2DBK A;  1FMK A;  2JTE A;  1YCS B;  2DVJ A;  3M0T A;  2DL7 A;  2K6D A;  2LX7 A;  2KXC A;  2QDL A;  1ZSG A;  1PKT A;  2O88 A;  3R6N A;  3VRY A;  2O2O A;  1HJD A;  2D8J A;  3QWX X;  1CSK A;  2CUB A;  1ABQ A;  3UA6 A;  4D8K A;  3M0S A;  3CQT A;  1X43 A;  4K11 A;  2FEI A;  4AFZ C;  1H3H A;  1FYN A;  4OMO A;  2CT3 A;  4LUE A;  1YWO A;  2KYM A;  3LH5 A;  1GFD A;  3VS4 A;  2L3Q A;  2K7A A;  1ARK A;  2GTJ A;  3QWY A;  2EYX A;  5FWC A;  2DX1 A;  3I5R A;  4F14 A;  1T3L A;  4LNP A;  5I22 A;  2EPD A;  4OMQ A;  1QWF A;  2A36 A;  3M0P A;  2RQR A;  1UE9 A;  1KSW A;  2RPN A;  2PZ1 A;  3ULR B;  2VWF A;  2K79 A;  1MUZ A;  2J6F A;  1E6H A;  1HD3 A;  1K1Z A;  1NM7 A;  3U23 A;  1OV3 A;  1SHF A;  4RTW A;  3NHN A;  1I07 A;  2F2X A;  3FJ5 A;  4RTZ A;  3RBB B;  1X69 A;  2GNC A;  4RTX A;  2DF6 A;  2KR3 A;  1UHC A;  1WLP B;  1ZUU A;  3NMZ C;  2DL3 A;  1YWP A;  1V1C A;  2A08 A;  1WYX A;  1TUC A;  2CUD A;  2KT1 A;  2K3B A;  2NWM A;  1OEB A;  4Z8A A;  1NEB A;  2O9S A;  2KRN A;  4J9C A;  2YUQ A;  1M27 C;  3VS0 A;  2ESW A;  2P4R A;  1MV3 A;  2KNB B;  1SEM A;  2HBW A;  2KE9 A;  3PVQ A;  3THK A;  1GL5 A;  2YSQ A;  2O31 A;  2SRC A;  1GBQ A;  2F2V A;  1QKW A;  2LCS A;  2AKL A;  2DIL A;  3O5Z A;  4GBQ A;  4X1V A;  3ZL7 C;  2RQU A;  1B3Q A;  2RQT A;  3VRZ A;  3VS3 A;  4AG2 C;  4J9D A;  4ORZ A;  4E6R A;  1K0S A;  4OMN A;  1AD5 A;  1VYV A;  4J9I A;  4Z88 A;  1MV0 B;  1AWW A;  3VS7 A;  1QCF A;  2KXD A;  2DA9 A;  2OJ2 A;  2EGE A;  3EHQ A;  2JXB A;  2J05 A;  1Z9Q A;  4HVU A;  4ESR A;  3EG2 A;  1NEG A;  2VVK A;  1TUD A;  2YUN A;  3M0Q A;  1WDX A;  1JQQ A;  1G2B A;  3H0I A;  2MCN A;  2BZ8 A;  3H0H A;  2O9V A;  2CH4 W;  1AZE A;  1QLY A;  3SHW A;  1X6G A;  4AFS C;  2RQV A;  2J7I A;  2DL5 A;  2DRM A;  2JMC A;  1N5Z A;  1AWO A;  3UAT A;  3PE0 A;  1M30 A;  2OI3 A;  3VS2 A;  3I9Q A;  1X2Q A;  1UFF A;  2CRE A;  1SPK A;  1BBZ A;  1S1N A;  2FRW A;  3RNJ A;  2PNI A;  5FWB A;  1QWE A;  1UGV A;  1KIK A;  1KFZ A;  1Y0M A;  1T0J A;  1GCQ A;  4IIM A;  2KBT A;  4CC7 A;  1E6G A;  1W1F A;  2JM8 A;  2EGC A;  5IHN A;  2W10 A;  2EYW A;  2KGT A;  2XMF A;  1SRL A;  2JS0 A;  1W6X A;  2C0O A;  2J6K A;  3PVL A;  4LE9 A;  2LMJ A;  2ABL A;  1X27 A;  2W0Z A;  2EQI A;  2YDL A;  1JXM A;  2JM9 A;  1JO8 A;  4RTT A;  2DE0 X;  1AVZ C;  1M3A A;  2JW4 A;  3A98 A;  1K0X A;  3NPF A;  1Y57 A;  3EG3 A;  1WXU A;  5FW9 A;  2D0N A;  1NLO C;  3NGP A;  1H8K A;  1YP5 A;  4Z89 A;  2EBP A;  2KRO A;  2JMA A;  2L0A A;  2LZ6 B;  4WCI A;  1M8M A;  3VS5 A;  4CC3 A;  1J3T A;  1KJW A;  1RUW A;  1UDL A;  1UJ0 A;  2LJ0 A;  1JXO A;  1T0H A;  2RQW A;  1U3O A;  1WA7 A;  2L3P A;  1WFW A;  2DNU A;  1GCQ C;  2EYY A;  1VYU A;  2V1R A;  1UJY A;  1BU1 A;  1VA7 A;  2GTO A;  3IQL A;  2CSI A;  2SEM A;  3I5S A;  4LN2 A;  5I11 A;  2J06 A;  1WX6 A;  2DL8 A;  4M4Z A;  4A63 B;  2M51 A;  1PWT A;  1GCP A;  1SRM A;  1HSQ A;  2BTT A;  2KEA A;  3JV3 A;  2IIM A;  4RUG A;  4Y92 A;  2ED1 A;  4D8D A;  4JZ3 A;  2X3W D;  2FG0 A;  2LQW A;  2AK5 A;  1WI7 A;  1AWJ A;  4GLM A;  4AG1 C;  1UUE A;  2FPD A;  2OAW A;  2EKH A;  5EC7 A;  4OMM A;  2KYB A;  2RF0 A;  5IHI A;  2RNA A;  1E7O A;  2G6F X;  1GRI A;  4J9F A;  4J9G A;  1OPK A;  2HSP A;  2X3X D;  4FSS A;  1ZUY A;  2DMO A;  1JU5 C;  2MIO A;  2K9G A;  1PNJ A;  2DYB A;  2CDT A;  5IH2 A;  4J9E A;  3C0C A;  4AFQ C;  3UA7 A;  2LNH B;  4DEX A;  2DLP A;  2ROL A;  4CC4 B;  1AOJ A;  2RN8 A;  4AFU C;  5GJV B;  4RTV A;  1I1J A;  3VS6 A;  2AKK A;  2FRY A;  1YNZ A;  1BK2 A;  2DBM A;  4JJC A;  2AZS A;  1NYF A;  1UEC A;  4R0K A;  2GBQ A;  3REB B;  2EW3 A;  4ZNX A;  3UF4 A;  2EYZ A;  4J9H A;  3EG0 A;  4RTU A;  1NG2 A;  1W70 A;  2HDA A;  1M3C A;  1WXT A;  2E5K A;  2V1Q A;  2AZV A;  1T3S A;  5L23 A;  4HXJ A;  2LJ3 A;  5ECA A;  3KFV A;  1K4U S;  4DEY A;  1A0N B;  1VYT A;  2C0I A;  1RI9 A;  2DL4 A;  3TSW A;  4HVV A;  1RLP C;  1I0C A;  2FPE A;  1PKS A;  5HCK A;  4LUD A;  1CKB A;  1ZBJ A;  2LQN A;  3M0R A;  1UTI A;  2EGA A;  1K9A A;  2RMO A;  3TSZ A;  2DM1 A;  1PHT A;  1GFC A;  1PRM C;  1U5S A;  2ECZ A;  5IXF A;  4JJB A;  2GQI A;  1RLQ C;  1WXB A;  1UHF A;  2D1X A;  1ZLM A;  2K2M A;  1OPL A;  3H0F A;  4OMP A;  2A37 A;  1ABO A;  2DJQ A;  1NYG A;  2BZY A;  1M3B A;  2KT8 A;  1EFN A;  2H8H A;  2F2W A;  2PTK A;  1B07 A;  2ENM A;  2L2P A;  3GBQ A;  2LP5 A;  4F17 A;  1ZX6 A;  4JPB W;  2KRM A;  5IHK A;  4F16 A;  1QKX A;  1Z9Z A;  1WIE A;  2CT4 A;  1NLP C;  2ED0 A;  3M0U A;  2A28 A;  2GGR A;  4IIO A;  2YUP A;  1GBR A;  3EG1 A;  1JEG A;  4EIK A;  4QT7 A;  2KRS A;  2DRK A;  4OML A;  2YT6 A;  4HVW A;  1U06 A;  4JJD A;  2VKN A;  2CH4 A;  1XOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...