1WXTA

Solution structure of the sh3 domain of human hypothetical protein flj21522
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
GSSGSSGLKMQVLYEFEARNPRELTVVQGEKLEVLDHSKRWWLVKNEAGRSGYIPSNILEPLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein FLJ21522
publication title Solution structure of the SH3 domain of human hypothetical protein FLJ21522
rcsb
source organism Homo sapiens
total genus 6
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wxtA00
2EPDA 4HXJA 3U23A 2VVKA 1V1CA 2GTOA 2O2OA 2AZVA 2CT3A 2ECZA 4AFQC 1ZUYA 2G6FX 2OI3A 3SHWA 2DF6A 1M30A 1T3LA 4DEYA 1I07A 1H92A 2EQIA 1SRLA 2LNHB 2RNAA 1PRMC 1VYUA 2K9GA 3NGPA 2X3WD 2GGRA 2DVJA 1JQQA 1MV3A 1OPLA 2SEMA 4AG2C 1X69A 1WYXA 2KROA 1QCFA 2L0AA 2KE9A 3VS2A 1PHTA 2DRMA 1U06A 2O9SA 3LH5A 2FPFA 2KT8A 3UA7A 3VRYA 3VS6A 4J9BA 1UUEA 4LN2A 2LJ1A 4HVVA 1UHCA 2E5KA 2FEIA 2JM9A 4OMMA 4AFZC 1WXUA 2GQIA 1VYTA 2DM1A 2FRYA 2ROTA 4GBQA 1G83A 1YP5A 2KBTA 1GCPA 4JZ3A 2YUNA 5IHKA 1UJ0A 3EGUA 1AWWA 2VWFA 4J9FA 2KYBA 4LUDA 1WFWA 1U3OA 3M0SA 3M0RA 1SPKA 1SSHA 3C0CA 1ZBJA 1N5ZA 1RI9A 3H0IA 2A08A 2DL4A 4ORZA 2KT1A 3H0HA 1YWOA 1J3TA 2NWMA 2W10A 2RF0A 2KXCA 3H0FA 4AG1C 2CUDA 2W0ZA 2DMOA 2ESWA 4R0KA 1E6GA 4K11A 5IXFA 2V1RA 2H8HA 1YWPA 4D8KA 4KRTA 3THKA 1PNJA 1PKTA 2DL8A 2RQUA 3EG3A 1AEYA 5L23A 2K2MA 1ZX6A 4JJDA 1K0SA 2JS0A 2CUBA 2DL7A 4J9GA 1OPKA 1M8MA 3EHRA 1WIEA 2C0OA 1NM7A 2DX1A 1WXBA 2B86A 2F2VA 1I1JA 1NYFA 1X6GA 1ZLMA 1UTIA 2A37A 2EYYA 4RTUA 1GFDA 5IHNA 2RQTA 4RTWA 1GBQA 1T3SA 5IHIA 3VS4A 4DEXA 2K79A 2HBWA 2O9VA 2KNBB 4F16A 1WX6A 2ED1A 2CDTA 2KRNA 1BK2A 1JU5C 1X27A 4J9DA 3VS5A 2OAWA 1UJYA 4JPBW 2YDLA 4HVWA 4E6RA 5GJWB 2L2PA 1NEGA 2CH4A 2FG0A 1YN8A 1NG2A 2HEQA 1AWJA 1T0HA 2C0IA 1E7OA 3I9QA 3NMZC 3SEMA 1S1NA 4CC4B 1KIKA 2JXBA 5FWBA 4A63B 1Y0MA 2JW4A 5ECAA 1B07A 4HVUA 4JJBA 2DL3A 2YUPA 2DJQA 3RBBB 1UDLA 2CSIA 1CKAA 4RTYA 1YNZA 1XOVA 3VRZA 2CREA 3KFVA 2LZ6B 2KR3A 2F2WA 2AKLA 1UG1A 4X1VA 2YSQA 4AFUC 3TVTA 1AZGB 2BTTA 4F14A 3GBQA 4RTXA 2L3QA 4M4ZA 5FW9A 1K4US 2D1XA 1FMKA 2YT6A 3A98A 1HJDA 1JO8A 2RQVA 4D8DA 2LQNA 1NEBA 1H8KA 1Z9ZA 1SHGA 2YUOA 3M0PA 2LX7A 3UF4A 1EFNA 2FO0A 2FPDA 4LE9A 1HSQA 2ABLA 2LJ3A 1GL5A 3JV3A 4Z8AA 1FYNA 2LMJA 3I35A 4WCIA 1GRIA 2DL5A 1AD5A 1OV3A 4RTVA 3M0QA 2IIMA 2X3XD 3EG2A 4LNPA 1SRMA 2I0NA 2ENMA 3REAB 1RUWA 2KRSA 3RNJA 3IQLA 1UHFA 2PTKA 2EGAA 2FPEA 1VYVA 2GNCA 2BZXA 1PKSA 1JEGA 2KGTA 4F17A 1WA7A 1PWTA 2F2XA 2JM8A 1M27C 1OEBA 1K76A 1QWFA 1WDXA 2A28A 3I5RA 1NYGA 2L3PA 2D8JA 1JXMA 3NPFA 2DYBA 4IIOA 4Z88A 5EC7A 2KRMA 4EIKA 2DE0X 5GJVB 4LUEA 2DRKA 1KJWA 2KEAA 3FJ5A 2MIOA 1G2BA 1WXTA 4CC7A 2EYZA 2K6DA 1ABQA 3NHNA 3VS0A 2GTJA 4OMOA 1T0JA 2RQWA 1AOJA 1VA7A 3ULRB 2EVRA 2DILA 2EBPA 1AZEA 4CC3A 1HD3A 1UECA 1MV0B 1AWXA 3M0UA 3UA6A 3VS7A 4AFSC 3REBB 5IXBA 2XMFA 1NLPC 4QT7A 4GLMA 2CT4A 1IO6A 2EGCA 1B3QA 2J05A 4RTZA 1M3CA 2C0TA 2DNUA 1SEMA 1QWEA 1KFZA 4JJCA 1M3BA 1TG0A 2JS2A 4J9IA 1Z9QA 2QDLA 2HDAA 4ESRA 3ZL7C 1AWOA 2EW3A 2CH4W 2NUZA 3TSZA 1RLQC 2DBKA 2HCKA 1CSKA 1W70A 2BZYA 3O5ZA 2LJ0A 1UFFA 2D8HA 3R6NA 1A0NB 2AKKA 2O88A 2ED0A 1TUDA 5IH2A 4J9EA 4RTTA 2CSQA 2K7AA 1W6XA 2EGEA 4HCKA 2FRWA 1I0CA 2AK5A 2LQWA 2KXDA 1RLPC 1X43A 1PRLC 4FSSA 1GCQA 1M3AA 1MUZA 2J6FA 2BZ8A 2EYWA 1NLOC 2RQRA 1AVZC 2J6KA 4Z89A 1TUCA 4Y92A 2M0YA 4OMPA 3M0TA 3H41A 3VS1A 1ARKA 2J6OA 1QLYA 4OMQA 2LCSA 1UGVA 3I5SA 2HSPA 5I11A 2DBMA 4J9CA 5FWCA 1GCQC 2GBQA 1Y57A 2MCNA 1E6HA 4J9HA 2AZSA 1BBZA 4JZ4A 1GBRA 2JMCA 2J06A 3VS3A 1YCSB 1UE9A 2RMOA 2P4RA 5I22A 1ZSGA 2JTEA 2OJ2A 2SRCA 1W1FA 1KSWA 1X2QA 3QWXX 3EG0A 3QWYA 1LCKA 1WLPB 2EYXA 3PVQA 1BU1A 2DLPA 3TSWA 2DA9A 2V1QA 1ABOA 2RPNA 2JMAA 4OMLA 1CKBA 1H3HA 2EKHA 2ROLA 1X2KA 1K0XA 1K1ZA 1U5SA 5HCKA 1ZUKA 1K9AA 3CQTA 2PNIA 2PZ1A 2YUQA 2RN8A 1WI7A 1SHFA 3EHQA 3PE0A 2JT4A 2VKNA 3PVLA 2M51A 1ZUUA 1JXOA 2KYMA 2MOXA 2L3SA 4ZNXA 2A36A 4OMNA 1QKXA 2D0NA 2O31A 1X6BA 4RUGA 4CC2A 3EG1A 2J7IA 2LP5A 2K3BA 1BB9A 1OOTA 1QKWA 3UATA 1GFCA 4IIMA
chains in the Genus database with same CATH superfamily
2M1HA 4NS5A 2JVVA 1V1CA 2GTOA 2EJ9A 3CCVT 3QZ5B 3S3MA 3C94A 4C92D 1I07A 1VOMA 1SRLA 2ZGWA 3GP8A 1PRMC 2X3WD 2Z0WA 1YI2T 1JQQA 2SEMA 1X69A 1NPPA 3CMEQ 1WJQA 2EQMA 3OY9A 3VUZA 1YJWQ 3LH5A 3OMCA 2FZKB 2HL3A 3UA7A 1Q81R 3VS6A 4PJOB 2DZCA 2X4WA 3C4SA 1IXDA 5GAOq 1VQ4T 2F1LA 5IHKA 1JRIA 4M7DE 4C5HA 2VWFA 3EGXB 2Y90A 4F7UB 1WFWA 2QEXA 4MZMA 2DPPB 3M0RA 1QQJA 1SSHA 1MMDA 3C0CA 4FW2A 1YIJT 1RI9A 3H0IA 2DL4A 2FHDA 1RAHB 1YWOA 4PLIA 2NWMA 2D6FA 2W10A 3CMAQ 4AG1C 2RH2A 3G4SQ 2CUDA 4M7AF 2W0ZA 4E7JA 2YRVA 4RCCA 1N9RA 1WHGA 4PJOA 1WGSA 2XG8D 1UEBA 3I56Q 2H8HA 3THKA 1C6VX 1PNJA 4M77D 3X24B 2RQUA 1VQ7T 1AEYA 1KC8U 4MDXA 1NJIC 4F7UA 2QGGA 5HK3A 5CK9A 2LCLA 2QAZA 1NM7A 3J7AF 1M90U 4M7AE 2K2VA 1NYFA 5GAOr 1UTIA 1OU8A 5KE2A 1GFDA 4RTWA 1GBQA 1T3SA 4R56A 5IAYA 5GAN7 3CMET 1Q82C 3CCRQ 2O9VA 2KNBB 2ZPGB 3UT1A 2DO3A 3FDRA 1YJWT 2ZPIB 3ME9A 1X27A 3HRTA 4CRIA 4JPBW 3G6EQ 3BDLA 5GJWB 6AT1B 5GAMj 1RAGB 3CCQQ 2NYSA 2XDDA 3OYEA 5EG2A 1T0HA 3OYDA 2QA4Q 3I9QA 4NOYA 1KIKA 5D6WA 4LDYA 4PKCC 5ECAA 1B07A 3OYHA 2DIQA 1BI0A 1JB0E 3S6WA 3HSBA 2RJFA 4OVAA 1D0YA 2PUOB 2DL3A 2RHZA 3META 2RI3A 1HK9A 2DJQA 3RBBB 4C8QG 1N8RU 1AHJB 2RJDA 5GANf 3G1JA 5GAN8 3CMAT 3G4ST 2LZ6B 2KR3A 4V2SA 3BE3A 4C92C 3URGA 3TVTA 5AYFA 2BTTA 3I56T 3GBQA 3SWNC 4XU1A 2RI5A 4M4ZA 3UDCA 1KC8R 1V76A 3LGLA 1YJ9Q 4M7DD 2DTOA 1FMKA 3A98A 1K9MC 2YLCA 3P8DA 4N4GA 3JCMb 3HKSA 1VQOQ 1H8KA 1Z9ZA 5GANd 2YUOA 5LL6S 4NL3A 1QP2A 1VQKQ 2HKQB 1M90R 4Y28E 1DJ7B 1FYNA 2KDSA 2O4XB 4WCIA 4ATOA 2DL5A 4PJOF 4MZPA 2QGFB 2D0QB 3M0QA 4FYVB 4LDVA 4LNPA 3CCRT 2I0NA 2VB6A 3IQLA 4JS5A 4QW2A 1IHWA 3OYKA 3CCVA 3OW2P 4F7UF 1PKSA 5FRMA 3PMTA 3L2RA 4NL2A 1WA7A 2F2XA 3G6ET 4J7IA 4OP0A 3V7RA 4XTZA 3OB9A 3I5RA 3CCQT 3V8LA 3LW5E 4M7AD 2X35A 1YI2A 2KRMA 5GJVB 4LUEA 2QA4T 2DRKA 3KBGA 2IPOB 1VQPA 4PJOE 2DAQA 5DM7R 2KEAA 3FJ5A 1OZ3A 3M55A 4DQ2A 3ER0A 4M77C 1ABQA 1VQ6A 4XU2A 3QPHA 1TH7A 1T0JA 4B9WA 3ULRB 5LJ3g 3CEYA 4F7UE 3OS5A 2CP7A 5KE3A 2BKDN 5GAN5 4OB3B 3OYJA 1NLPC 3CC2Q 3OYBA 1WHJA 5GAN6 2CT4A 1YJ9T 2J05A 3GPLA 4ZN1A 2DNUA 3JB9G 1QWEA 3H8ZA 2E4HA 4JJCA 3L42A 3LX7A 1VQOT 5KYYB 1Z9QA 3OMGA 2XICA 1I5OB 5L8RE 4QVZA 3ZL7C 2EW3A 1VQKT 4C8QF 1VQLA 1RLQC 2JOYA 5FU7B 2RHYA 3V8JA 2BZYA 3ZBDA 1A0NB 1JJ2P 4WTOB 3ZEHA 2CZ6B 2KMTA 2O88A 4ELYC 4IUQA 1UGRB 1W6XA 4HCKA 1Y71A 1KK7A 3PNWC 2QEXQ 1O9SA 2COZA 4UC4A 2JJ9A 1RLPC 1PRLC 1W4SA 1PD1A 1GCQA 5KYYA 4PJNA 1M3AA 1MUZA 2RHUA 5DLOA 2RQRA 3CPWP 5KH6A 3EFOB 3DLLA 2KVQG 1N6AA 3M0TA 2LT4A 1LPLA 4OMQA 5CVIA 1UGVA 1VQNQ 2LX9A 5LJ5f 4J9CA 4M7DC 2MCNA 1E6HA 1YJWA 4OB2B 1OQKA 3JCMf 4JZ4A 4RCBA 3FLGA 1UE9A 2QQAA 3QWYA 1XQHA 1QVFS 1D1BA 5I2SA 1LCKA 3FJPA 3CC2T 1WLPB 2GF7A 2EYXA 3PVQA 4HCCA 4L5GA 1BU1A 5LJ5d 4PJOD 4C5EA 2V1QA 4PFOA 4FCYA 2ZCFB 3JCMd 2JMAA 5CKHA 3V7SA 1BI2A 2IVWA 1K0XA 3LWIA 1K1ZA 1U5SA 3CXCP 1ZUKA 2YUQA 1G3SA 1SHFA 1QVFA 2QK0A 2M51A 1ZUUA 3I56A 1K73C 3D7SB 4M7AC 2E6ZA 3X28B 4KH0B 5CO7A 1VQ9A 1UGQB 1OX9A 2QEXT 4MDWA 3M4GA 2RK1A 2NUPB 3GOXA 2RD1A 1QVGA 3JB9F 1Q95G 4J6WA 2QG9B 4CC2A 3PMIA 5GAMd 5HK0A 2WACA 4CI0C 4II1A 1K8AR 2O01E 4MMKA 1U8RA 5LJ5h 4DBQA 4MMLA 2BIVA 2E70A 4HXJA 2VVKA 1M1KR 2ECZA 1VQNT 2GFUA 4AFQC 1ZUYA 2G6FX 4Z02A 3SHWA 2DF6A 4DBRA 3J80E 1H92A 2ZPEB 2LNHB 2NUPA 1Q7YC 3CC7Q 1VYUA 4EMKC 4IURA 2XKOC 3G6EA 1Y07A 5J39A 1MV3A 5FU6C 1KD1R 3QDRB 3CCQA 4AG2C 2KROA 5FROA 2PVOB 1QCFA 2RI2A 4C0GA 2L0AA 2KE9A 3VS2A 3JCMJ 2KI7A 1U06A 4M78B 2KT8A 4J9BA 1UUEA 2LJ1A 2E5KA 2FEIA 4KGXB 3JB9I 4OMMA 4AFZC 4O5VA 3VUBA 4M75G 1VYTA 2DM1A 2FRYA 1FX7A 4M75A 4P5NA 4GBQA 2KBTA 2MI6A 1TS9A 1UJ0A 2KYBA 4LUDA 2HBPA 2XU8A 3QZ9B 3M0SA 3MEAA 4KGVB 2PVGB 2X4JA 1VQPQ 1ZBJA 3MEUA 1J3TA 4M78A 2RF0A 4ME7A 1VQOA 4N0AA 4PL6A 1VQ6Q 2DMOA 2JNGA 4R0KA 3GIBA 2A7YA 1WJSA 3N5BB 4LD6A 1E6GA 4K11A 2P84A 2V1RA 2XI9A 3L2UA 1IB8A 1PKTA 2DL8A 3EG3A 5CKDA 3TCJA 5L23A 2K2MA 4A4HA 1RABB 2IG0A 3J81E 2CZ7B 3JRZA 2CUBA 4J9GA 1M8MA 4PJOC 3I55A 3EHRA 1WIEA 1HXDA 2DZ9A 5CQYA 2DXCA 2L8DA 3CC7T 1I1JA 4A4EA 2QYZA 3QO3A 4GY5A 1VQLQ 2RQTA 4KBMB 3VS4A 4DEXA 1M1GA 1M2OA 4PJLA 3CBMA 4KT0E 2CS7A 1QVGP 2CDTA 1D3BB 3MP8A 2X4XA 1JU5C 1QVPA 4HVWA 4C0ZA 2M16A 1NEGA 3AT1B 4ANJA 3FIFA 2CZ1B 5CQXA 3AHUA 2E12A 4RKUE 5D7UA 1ZBXA 3QXEB 1BYMA 1Y0MA 2JW4A 1WJRA 2X4YA 3CBPA 3CC2A 4HVUA 4XTUA 3KXTA 2DERA 4QQDA 1VQPT 1D0ZA 1OX8A 1UDLA 2CSIA 1CKAA 3EGDB 4OGEA 3NTHA 4E2FB 4ZGJB 4ZGDB 3VRZA 2RO0A 1D3BA 1VQ6T 1PD0A 3KUFA 3L2QA 4F14A 3RKXA 1TSFA 4KH1B 4M75F 2E64A 4X9CA 3OW2S 2YRDA 3VJPA 3VYHB 2HQHA 5GAN4 2VYTA 1RAIB 4DOWA 3M0PA 3L2WA 1LJOA 2VXFA 1PC0A 2X51A 2FPDA 3EGDA 2COYA 4BE1A 1GL5A 4M78F 5D6XA 3OYLA 1GRIA 2XD0A 1OV3A 4RTVA 3S3NA 1VQLT 1VQMA 3RDVA 2DTIA 3EG2A 3OW2A 2JTMA 3REAB 3OYYA 4JLIA 4XTVA 1TU0B 5GMKh 1FMVA 4BI3A 1JEGA 2KGTA 3OSVA 1VQNA 3M9QA 1VQ9Q 1FXXA 1KQ1A 4FSXA 3RUXA 1K76A 2YXYA 2EAYA 2DJZA 2KSSA 4M78E 7AT1B 2L3PA 1JXMA 1MMNA 2OX7A 4IIOA 3X25B 8ATCB 2EYQA 1Q86U 2QXFA 4X34A 1VUBA 1G2BA 2E3HA 2EYZA 2K6DA 2JUFA 3NHNA 2E65A 4OMOA 2MAMA 4EMHA 3L1AA 1TXQA 2EVRA 5KYXB 2DILA 2CGHA 1JJ2S 4RMOA 4JRKA 4C8QB 5LJ3f 4DBFA 2HQEA 3M5AA 1AWXA 4HKEA 1U1TA 2XMFA 2GFAA 3H6ZA 2LC4A 1M1KC 3M4YA 4BI4A 1YCYA 4BB7A 3JSCA 4RTZA 5GANe 1SEMA 1TG0A 2RB6A 2HDAA 2Y4YA 1AWOA 5LJ3d 2NUZA 1JJ2A 2EQKA 2DD5A 1G3WA 2M9UA 4QVCA 5KYXA 2HCKA 1CSKA 2JN0A 4C8QA 4A4KA 2LJ0A 1UFFA 2FL7A 3R6NA 5GAOl 1C0MA 5IH2A 4J9EA 1RAAB 2K7AA 2AHJB 5CAIA 2MMPA 2AK5A 3OYMA 2LQWA 1X43A 2KXDA 3A8HB 3TQ7P 3CPWA 1G5VA 1VQ9T 4DOVA 4BY6B 2BZ8A 3JCMc 2EYWA 1NLOC 3X20B 2HSEB 1Q86R 3CC7A 2J6KA 3L2VA 2DTHA 2K5IA 2NUTB 1ARKA 3OYNA 3QHSA 1XJWB 3DLMA 5GMKm 3CXCS 2MPXC 2DBMA 5FWCA 1GCQC 2Y4XA 1Y57A 4BACA 2DIGA 4OB1B 1BBZA 3RKYA 2JMCA 3VS3A 2E6NA 4BDYA 1YCSB 4HCZA 2RMOA 5FU7C 4HT8A 3I55Q 2JTEA 2OJ2A 1W1FA 2MWOA 3EG0A 3QWXX 2EJGA 4M78D 1LVKA 2QDYB 1X75C 4D6WA 1KHIA 1D1AA 2NUTA 1LOJA 2LDMA 3CXCA 1ABOA 3BDUA 4LDWA 2F5KA 1CKBA 1H3HA 2EKHA 2RM4A 1X2KA 3EH1A 5GANh 2H3EB 1S72Q 1N8RR 2PZ1A 3QUIA 2PQWA 2XDPA 3OYGA 1WI7A 4XU0A 3PE0A 2CP5A 2PUKB 3QYGB 4IUTA 2VKNA 2ATCB 3RMSA 2OTLQ 1JXOA 4OF1A 3WVDB 4E7IA 2L3SA 4ZNXA 4OMNA 3HRSA 1QKXA 4JRPA 2D0NA 4E7LA 2O31A 2HAXA 4F04B 3M58A 3MKDA 5J26A 4JRQA 4IIMA 4C5IA 2EPDA 3NTIA 3U23A 3HFOA 1SF9A 2F69A 2O2OA 1R0CB 2AZVA 2CT3A 1RADB 2KQWA 1UB4A 4C92G 1T3LA 3OSSC 4DEYA 3JAME 2EQIA 4C92A 5CKBA 1Q81C 2DETA 4A4GA 2DEQA 2GGRA 3I55T 1OPLA 4XAXB 2RHXA 1WYXA 2DD4A 5FLXE 2CP6A 5LJ5e 4EMGA 1NJIU 1BCMA 2EWNA 1VQMQ 1PHTA 4C8QE 5A0DA 3JCMe 3VYGA 2VGMA 5KYUA 2FPFA 3VRYA 4LN2A 1IZ6A 2HNIA 3VKIA 1UHCA 1C1AA 1FWZA 1D09B 1WXUA 2GQIA 4FIBA 3CCLQ 2V8JA 1S72T 1N27A 5GAOn 2I2LA 2BUDA 1PG5B 1G83A 1YP5A 1GCPA 2PU9B 2BE7D 2YUNA 1Q82U 1AWWA 2A3LA 3WXMB 3BFMA 1ACMB 4BE0A 3Q1JA 2OTLT 1SPKA 1IRXA 9ATCB 1N5ZA 2A08A 2KT1A 3H0FA 4C0FA 1VIFA 2ESWA 2DXBA 1YJNA 1KQ2A 1KQSP 3MEWA 1MMGA 2L3RA 1PSEA 4FYXB 3CCEA 1QVGS 1YWPA 4D8KA 4KRTA 4QQ6A 4M77G 3VU3C 1ZX6A 3M54A 1UGPB 4M78C 4R55A 5GAMf 1K0SA 2ZAEA 2BE9B 4N0AC 3ZFJA 3HRUA 2RA2A 1OPKA 3JB9H 4KULA 1GXIE 2C0OA 1VQ5A 2B86A 1QMCA 2RJEA 1ZLMA 2CKKA 2A37A 2EYYA 4JDSA 5IHNA 1W2BA 1NJIR 4PJMA 1K9MU 2K79A 2HQXA 4A54A 2DKGA 2HBWA 3QIIA 1SSFA 2OTJA 1VQMT 4ELZC 1BI3A 3T9NA 1BK2A 2QI2A 4J9DA 1ZSZB 4GLKA 3JCMh 2HD0A 2YDLA 4E6RA 2L2PA 1EIFA 4FYYB 4XQ3A 4FM4B 3CCLT 4C92F 2FG0A 2C0IA 1E7OA 2QQSA 2K4YA 3NMZC 4M75B 3SEMA 4CC4B 2JXBA 5A0LA 4A63B 1F1BB 1R77A 3O8VA 4LDUA 1NPRA 1Y7XA 2KY9A 4XTWA 1KC8C 2YUPA 4L59A 4BE2A 1MGQA 4C8QD 2R57A 4RTYA 2VUBA 2MF2A 1UGSB 1XOVA 3A8OB 2DXUA 2CREA 1QCOA 1ZSZA 4J83A 2AKLA 2NLUA 3GNFB 1UG1A 4X1VA 2YSQA 1M90C 1AZGB 1M1FA 3H9NA 2E1HA 5GAMh 1IGUA 4C92E 1SKUB 4FYWB 8AT1B 3LYIA 3EAEA 2D1XA 4E7HA 2K3XA 4M7DG 4HCBA 2FYKA 2YT6A 1HJDA 1JO8A 4QQGA 5GAN2 4IKFA 4D8DA 4OB0B 1NEBA 1SHGA 3FC3A 3PT9A 3UF4A 1EFNA 2FO0A 5GAOp 2ABLA 2LJ3A 4Z8AA 2LMJA 4EPCA 3I35A 3CCUQ 3CPFA 1AD5A 2VC8A 1SG5A 5GANj 3ASKA 1I4K1 1K9MR 3JB9J 5AT1B 2IIMA 3SD4A 1SRMA 2ENMA 1RUWA 2CZ0B 2KRSA 2LNVA 2LVMA 2EKOA 1UHFA 1O75A 4OMFB 3INZA 1N8RC 1PWTA 4IUPA 2VGNA 3OS2A 1NBEB 3DB3A 4HT9A 1WDXA 2A28A 2CYZB 1WZOA 2QTVA 3G71A 1NYGA 2D8JA 4X9DA 1WNLA 4M7AG 3NPFA 1WQWA 3E19A 4Z88A 5EC7A 3M53A 1B7TA 4LDXA 3M56A 2E3IA 1P92A 3MP6A 5I21A 4J7FA 4CC7A 1I81A 3PFSA 3VS0A 2GTJA 2RQWA 3JCMW 5GMKe 2MYSA 2R5AA 1AZEA 4A4FA 1W2BP 1UECA 3VS7A 3M0UA 1S72A 2R5MA 3REBB 3MJXA 1NZ9A 3CCSQ 4QT7A 2DK3A 4FT4A 3CCMA 3OYFA 1M3CA 2C0TA 3JB9D 1BKBA 2OTLA 2FZGB 5CR2A 1VQ8A 3PIOA 1M3BA 1I5LA 4J9IA 2C06A 4ESRA 2ZPFB 4FT2A 2CH4W 1QW1A 3P8HA 2DBKA 2AIRB 1M2VA 2KK4A 3CCUT 1XTDA 5IN1A 3A8GB 3O5ZA 2DXTA 1TTHB 2D8HA 1TOVA 2AKKA 2ED0A 4PFPA 2ZPHB 1EZZB 2VASA 4RTTA 3LGFA 2EGEA 3UWNA 4M7DF 4C0DB 1OI1A 1M4ZA 4O6JA 2HMAA 1WPYA 4C8QC 2J6FA 4BUGA 3FEOA 2H3JA 1AVZC 2G3RA 1YJNQ 4Z89A 1D1CA 3S3OA 5IT9E 1KG1A 1K73U 3H41A 3NTKA 4Y91A 3VS1A 3E2UA 3A1PA 3CCEQ 1QLYA 1MNDA 3RESA 4FL6A 3I5SA 1D0XA 4MZTA 2HSPA 1JBMA 5I11A 2CP0A 3NFCA 2GBQA 5KYNA 2COWA 2EQUA 4N4HA 1U1SA 4M75E 1GBRA 2P4RA 5I22A 1ZSGA 2P0QA 1QP3A 2VXEA 2SRCA 2WSFE 3CCLA 4ZTFA 1VQ5Q 3HP9A 3LLRA 3CCST 4LD9K 4PJOG 2DA9A 5GMKi 3MP1A 1R0BG 2RPNA 3P8BB 4OMLA 2LQKA 2OTJQ 5LJ3e 3OYCA 3L2ZA 2QQBA 1Q7YU 2LT1A 3CD6Q 4BY6C 3CQTA 5LJ5j 2PNIA 4F7UG 1OULA 3EGXA 3A8LB 3FB9A 4HA8A 3QSUA 3PVLA 1K8AC 3C95A 3SB2A 1YHQA 2K5FA 4JUVA 3QBYA 3EFSA 3M57A 2MOXA 1M5Q1 2PVDB 2A36A 4YTLA 4XTYA 1WHMA 2DEUA 1X6BA 4RUGA 3EG1A 2EIFA 2J7IA 3FRNA 4QVDA 3VV0A 2GQVA 2K3BA 2YHTA 1K73R 3RKWA 1QKWA 1YJNT 4FW1A 3CPWS 1GFCA 4JS4A 2HKNA 1KD1C 1IHVA 4KUDK 1BCOA 3OBYA 4WF2A 3C12A 2E41A 3CCET 5GAN3 5CKFA 1MNEA 2OI3A 1M30A 1ZQ1A 4ZN3A 4RG8A 3EG9B 2RNAA 4PK4A 2K9GA 2P0PA 3NGPA 3QDFA 2DYIA 2DVJA 3PGGA 1H641 4PNOA 3OS1A 1VQ5T 1FMWA 3CCJA 1TWBA 2M0OA 3SFMA 2D9TA 2QTXA 3DB4A 1PSFA 2DRMA 2LRQA 2O9SA 4JJNK 1Q7YR 3OBWA 1KQSS 4HVVA 3HL8A 2OTJT 2JM9A 3BW1A 4KUIA 4LXCA 4M75D 5KCHA 3WVEB 3CD6T 3EG9A 2ROTA 4XTXA 5LJ3h 5HKCA 2EJFA 2VV5A 4JZ3A 4ZGEB 3G71Q 3EGUA 4J6XA 4J9FA 1MHNA 3TU4K 1NE8A 1RACB 1U3OA 3CC4Q 4N4IA 1YITA 4ORZA 2EQJA 3H0HA 1WHLA 3E9FA 1KQSA 3F70A 3GLXA 2KXCA 4J8OA 2DVEA 1R8OB 4IUVA 4KGZB 4B9XA 4QKUA 3RR6A 5IXFA 2KAFA 3QYHB 3CCUA 5DY9A 3DKMA 2JTFA 4JJDA 1H3ZA 2JS0A 4BDZA 2DL7A 3CCMQ 5C0MA 2O4XA 2FB7A 5FRNA 1VQ8Q 4JLGA 5J3BA 5CIUA 1LNXA 2DX1A 2E10A 1WXBA 4L6V5 2F2VA 3EH2A 3RIRA 4C92B 1X6GA 4TVRA 4EDUA 4RTUA 3SWNB 5IHIA 3OS0A 3JCMV 5C6SA 2XK0A 2EFIA 4F16A 1WX6A 2ED1A 5D6YA 2KRNA 3E1SA 2YRCA 3VS5A 1B34B 3E9GA 3OA6A 2OAWA 5KYUB 1VQ4A 1UJYA 2QASA 2A0FB 2QQRA 2CH4A 3X26B 1YN8A 1NG2A 2YWWA 4XK8E 2HEQA 3JCMX 1AWJA 3RMQA 2FVUA 1S1NA 3G71T 1YIJA 5FWBA 1HYOA 3MPUB 3SWNA 4JJBA 3CCSA 3CC4T 3QKJA 4J5YA 5GANg 4C5GA 1YNZA 1OZ2A 1PCXA 2WSCE 3EFRA 3KFVA 1B34A 1OU9A 3TREA 2P4TA 1I8FA 2F2WA 1VQ7A 4AFUC 2B8AA 1V29B 1ZA2B 4RTXA 2L3QA 5FW9A 1TUGB 3PTAA 2RK2A 1K4US 5GMKj 3PIPA 5I2MA 2RQVA 2LQNA 3MEVA 1G3TA 1IREB 4M77B 1AT1B 2LX7A 2AT1B 2MWPA 3CCMT 5CKEA 1ZSZC 4LE9A 1HSQA 1K8AU 3JV3A 1VQ8T 3A5ZB 3CMEA 3RERA 2RJCA 3QJYA 4XU3A 4JRIA 4M75C 1M1KU 5CCAA 1WHKA 1OYXA 5GAMe 2X3XD 1EX4A 3RNJA 4FU6A 2F5TX 2PTKA 2EGAA 2FPEA 1YHQQ 1VYVA 2GNCA 2BZXA 1W2BS 1PM3A 4F17A 4IUUA 1KD1U 4M77A 4J6YA 2OAUA 2JM8A 1M27C 1OEBA 3EFOA 4A53A 1QWFA 3HTRA 5DLQE 2DYBA 4EIKA 2DE0X 2E5QA 1KJWA 2HZYA 2MIOA 3OYIA 2K3YA 1WXTA 3GNGA 3JCMP 3CMAA 3G4SA 3MO8A 1X01A 3M59A 2LQ8A 3SDZA 1AOJA 1VA7A 4AMCA 2LCCA 2FZCB 2EBPA 3MHXA 4CC3A 1HD3A 2K5LA 5KCOA 1Y96B 1MV0B 3UA6A 2V8KA 3GF5A 1YFNA 1ZA1B 2P0KA 4AFSC 5KYWB 5IXBA 3CD6A 2ZZDA 1G8XA 1XNIA 4GLMA 2V26A 1BIBA 1IO6A 3R6OA 4PJJA 2EGCA 1B3QA 1Q82R 2RHIA 3CCJQ 1KFZA 2JS2A 1YBYA 1M9SA 4M7DB 2QDLA 2DFUA 3OYAA 2CP2A 1ZHIA 2R58A 4BI8B 3TSZA 5M9OA 1M8VA 2XDBA 3CCRA 1W70A 5GAOm 1Y96A 3HFNA 3HPWA 5KYWA 5A2QE 1TUDA 1Q86C 4E7SA 5LJ3j 2CSQA 3CBOA 2XHCA 2FRWA 2QQ9A 1I0CA 3V8KA 1YHQT 4FSSA 2JZ2A 1YITQ 1KHCA 1RAEB 4M7DA 1G3YA 2QA4A 2M02A 1QCNA 1VIEA 3TEEA 3LWHA 1TUCA 4Y92A 2M0YA 4OMPA 4RG2A 2L89A 2MK5A 1RL2A 4E7ZA 5LJ5g 2J6OA 2LCSA 4M7AB 3CCVQ 4DBHA 2CP3A 2HL5C 3JCMg 4BD3A 5GMKl 4J9HA 1MMAA 2AZSA 4VUBA 2J06A 4PFZA 4M77F 1RI0A 4Q5WA 1YI2Q 3JCMQ 1KSWA 1X2QA 3OQ5A 1YJ9A 4AT1B 4M78G 2K57A 4B6MA 3HHTB 4DA4A 2ZPBB 2X9HA 2DLPA 5A0GA 3TSWA 4PLLA 1VQKA 3CCJT 3CC4A 4M7AA 1BIAA 4C0DC 2ROLA 1Q81U 3V7CA 4ZTJA 5HCKA 2WSEE 3A8MB 2LTOA 3QG1A 4OGCA 5GAMg 1K9AA 1X6OA 2RN8A 1VQ4Q 1WHHA 2GCXA 4EMKB 3EHQA 5FU6B 4M77E 2V8IA 2JT4A 1M2VB 2L5QA 4E47A 5HY6A 3G7ZA 1IGQA 2KYMA 1YIJQ 1QVFP 3UPUA 3QJ6A 3MCAB 2YLBA 4E7KA 2XIDA 1WQ7A 1YITT 1RAFB 3BY7A 3LH0A 2LP5A 1BI1A 1N9SA 1BB9A 1OOTA 3UATA 4EMKA 1VQ7Q
chains in the Genus database with same CATH topology
2EPDA 4HXJA 3U23A 2VVKA 1V1CA 2GTOA 2O2OA 2AZVA 2CT3A 2ECZA 4AFQC 1ZUYA 2G6FX 2OI3A 3SHWA 2DF6A 1M30A 1T3LA 4DEYA 1I07A 1H92A 2EQIA 1SRLA 2LNHB 2RNAA 1PRMC 1VYUA 2K9GA 3NGPA 2X3WD 2GGRA 2DVJA 1JQQA 1MV3A 1OPLA 2SEMA 4AG2C 1X69A 1WYXA 2KROA 1QCFA 2L0AA 2KE9A 3VS2A 1PHTA 2DRMA 1U06A 2O9SA 3LH5A 2FPFA 2KT8A 3UA7A 3VRYA 3VS6A 4J9BA 1UUEA 4LN2A 2LJ1A 4HVVA 1UHCA 2E5KA 2FEIA 2JM9A 4OMMA 4AFZC 1WXUA 2GQIA 1VYTA 2DM1A 2FRYA 2ROTA 4GBQA 1G83A 1YP5A 2KBTA 1GCPA 4JZ3A 2YUNA 5IHKA 1UJ0A 3EGUA 1AWWA 2VWFA 4J9FA 2KYBA 4LUDA 1WFWA 1U3OA 3M0SA 3M0RA 1SPKA 1SSHA 3C0CA 1ZBJA 1N5ZA 1RI9A 3H0IA 2A08A 2DL4A 4ORZA 2KT1A 3H0HA 1YWOA 1J3TA 2NWMA 2W10A 2RF0A 2KXCA 3H0FA 4AG1C 2CUDA 2W0ZA 2DMOA 2ESWA 4R0KA 1E6GA 4K11A 5IXFA 2V1RA 2H8HA 1YWPA 4D8KA 4KRTA 3THKA 1PNJA 1PKTA 2DL8A 2RQUA 3EG3A 1AEYA 5L23A 2K2MA 1ZX6A 4JJDA 1K0SA 2JS0A 2CUBA 2DL7A 4J9GA 1OPKA 1M8MA 3EHRA 1WIEA 2C0OA 1NM7A 2DX1A 1WXBA 2B86A 2F2VA 1I1JA 1NYFA 1X6GA 1ZLMA 1UTIA 2A37A 2EYYA 4RTUA 1GFDA 5IHNA 2RQTA 4RTWA 1GBQA 1T3SA 5IHIA 3VS4A 4DEXA 2K79A 2HBWA 2O9VA 2KNBB 4F16A 1WX6A 2ED1A 2CDTA 2KRNA 1BK2A 1JU5C 1X27A 4J9DA 3VS5A 2OAWA 1UJYA 4JPBW 2YDLA 4HVWA 4E6RA 5GJWB 2L2PA 1NEGA 2CH4A 2FG0A 1YN8A 1NG2A 2HEQA 1AWJA 1T0HA 2C0IA 1E7OA 3I9QA 3NMZC 3SEMA 1S1NA 4CC4B 1KIKA 2JXBA 5FWBA 4A63B 1Y0MA 2JW4A 5ECAA 1B07A 4HVUA 4JJBA 2DL3A 2YUPA 2DJQA 3RBBB 1UDLA 2CSIA 1CKAA 4RTYA 1YNZA 1XOVA 3VRZA 2CREA 3KFVA 2LZ6B 2KR3A 2F2WA 2AKLA 1UG1A 4X1VA 2YSQA 4AFUC 3TVTA 1AZGB 2BTTA 4F14A 3GBQA 4RTXA 2L3QA 4M4ZA 5FW9A 1K4US 2D1XA 1FMKA 2YT6A 3A98A 1HJDA 1JO8A 2RQVA 4D8DA 2LQNA 1NEBA 1H8KA 1Z9ZA 1SHGA 2YUOA 3M0PA 2LX7A 3UF4A 1EFNA 2FO0A 2FPDA 4LE9A 1HSQA 2ABLA 2LJ3A 1GL5A 3JV3A 4Z8AA 1FYNA 2LMJA 3I35A 4WCIA 1GRIA 2DL5A 1AD5A 1OV3A 4RTVA 3M0QA 2IIMA 2X3XD 3EG2A 4LNPA 1SRMA 2I0NA 2ENMA 3REAB 1RUWA 2KRSA 3RNJA 3IQLA 1UHFA 2PTKA 2EGAA 2FPEA 1VYVA 2GNCA 2BZXA 1PKSA 1JEGA 2KGTA 4F17A 1WA7A 1PWTA 2F2XA 2JM8A 1M27C 1OEBA 1K76A 1QWFA 1WDXA 2A28A 3I5RA 1NYGA 2L3PA 2D8JA 1JXMA 3NPFA 2DYBA 4IIOA 4Z88A 5EC7A 2KRMA 4EIKA 2DE0X 5GJVB 4LUEA 2DRKA 1KJWA 2KEAA 3FJ5A 2MIOA 1G2BA 1WXTA 4CC7A 2EYZA 2K6DA 1ABQA 3NHNA 3VS0A 2GTJA 4OMOA 1T0JA 2RQWA 1AOJA 1VA7A 3ULRB 2EVRA 2DILA 2EBPA 1AZEA 4CC3A 1HD3A 1UECA 1MV0B 1AWXA 3M0UA 3UA6A 3VS7A 4AFSC 3REBB 5IXBA 2XMFA 1NLPC 4QT7A 4GLMA 2CT4A 1IO6A 2EGCA 1B3QA 2J05A 4RTZA 1M3CA 2C0TA 2DNUA 1SEMA 1QWEA 1KFZA 4JJCA 1M3BA 1TG0A 2JS2A 4J9IA 1Z9QA 2QDLA 2HDAA 4ESRA 3ZL7C 1AWOA 2EW3A 2CH4W 2NUZA 3TSZA 1RLQC 2DBKA 2HCKA 1CSKA 1W70A 2BZYA 3O5ZA 2LJ0A 1UFFA 2D8HA 3R6NA 1A0NB 2AKKA 2O88A 2ED0A 1TUDA 5IH2A 4J9EA 4RTTA 2CSQA 2K7AA 1W6XA 2EGEA 4HCKA 2FRWA 1I0CA 2AK5A 2LQWA 2KXDA 1RLPC 1X43A 1PRLC 4FSSA 1GCQA 1M3AA 1MUZA 2J6FA 2BZ8A 2EYWA 1NLOC 2RQRA 1AVZC 2J6KA 4Z89A 1TUCA 4Y92A 2M0YA 4OMPA 3M0TA 3H41A 3VS1A 1ARKA 2J6OA 1QLYA 4OMQA 2LCSA 1UGVA 3I5SA 2HSPA 5I11A 2DBMA 4J9CA 5FWCA 1GCQC 2GBQA 1Y57A 2MCNA 1E6HA 4J9HA 2AZSA 1BBZA 4JZ4A 1GBRA 2JMCA 2J06A 3VS3A 1YCSB 1UE9A 2RMOA 2P4RA 5I22A 1ZSGA 2JTEA 2OJ2A 2SRCA 1W1FA 1KSWA 1X2QA 3QWXX 3EG0A 3QWYA 1LCKA 1WLPB 2EYXA 3PVQA 1BU1A 2DLPA 3TSWA 2DA9A 2V1QA 1ABOA 2RPNA 2JMAA 4OMLA 1CKBA 1H3HA 2EKHA 2ROLA 1X2KA 1K0XA 1K1ZA 1U5SA 5HCKA 1ZUKA 1K9AA 3CQTA 2PNIA 2PZ1A 2YUQA 2RN8A 1WI7A 1SHFA 3EHQA 3PE0A 2JT4A 2VKNA 3PVLA 2M51A 1ZUUA 1JXOA 2KYMA 2MOXA 2L3SA 4ZNXA 2A36A 4OMNA 1QKXA 2D0NA 2O31A 1X6BA 4RUGA 4CC2A 3EG1A 2J7IA 2LP5A 2K3BA 1BB9A 1OOTA 1QKWA 3UATA 1GFCA 4IIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPD A;  4HXJ A;  3U23 A;  2VVK A;  1V1C A;  2GTO A;  2O2O A;  2AZV A;  2CT3 A;  2ECZ A;  4AFQ C;  1ZUY A;  2G6F X;  2OI3 A;  3SHW A;  2DF6 A;  1M30 A;  1T3L A;  4DEY A;  1I07 A;  1H92 A;  2EQI A;  1SRL A;  2LNH B;  2RNA A;  1PRM C;  1VYU A;  2K9G A;  3NGP A;  2X3W D;  2GGR A;  2DVJ A;  1JQQ A;  1MV3 A;  1OPL A;  2SEM A;  4AG2 C;  1X69 A;  1WYX A;  2KRO A;  1QCF A;  2L0A A;  2KE9 A;  3VS2 A;  1PHT A;  2DRM A;  1U06 A;  2O9S A;  3LH5 A;  2FPF A;  2KT8 A;  3UA7 A;  3VRY A;  3VS6 A;  4J9B A;  1UUE A;  4LN2 A;  2LJ1 A;  4HVV A;  1UHC A;  2E5K A;  2FEI A;  2JM9 A;  4OMM A;  4AFZ C;  1WXU A;  2GQI A;  1VYT A;  2DM1 A;  2FRY A;  2ROT A;  4GBQ A;  1G83 A;  1YP5 A;  2KBT A;  1GCP A;  4JZ3 A;  2YUN A;  5IHK A;  1UJ0 A;  3EGU A;  1AWW A;  2VWF A;  4J9F A;  2KYB A;  4LUD A;  1WFW A;  1U3O A;  3M0S A;  3M0R A;  1SPK A;  1SSH A;  3C0C A;  1ZBJ A;  1N5Z A;  1RI9 A;  3H0I A;  2A08 A;  2DL4 A;  4ORZ A;  2KT1 A;  3H0H A;  1YWO A;  1J3T A;  2NWM A;  2W10 A;  2RF0 A;  2KXC A;  3H0F A;  4AG1 C;  2CUD A;  2W0Z A;  2DMO A;  2ESW A;  4R0K A;  1E6G A;  4K11 A;  5IXF A;  2V1R A;  2H8H A;  1YWP A;  4D8K A;  4KRT A;  3THK A;  1PNJ A;  1PKT A;  2DL8 A;  2RQU A;  3EG3 A;  1AEY A;  5L23 A;  2K2M A;  1ZX6 A;  4JJD A;  1K0S A;  2JS0 A;  2CUB A;  2DL7 A;  4J9G A;  1OPK A;  1M8M A;  3EHR A;  1WIE A;  2C0O A;  1NM7 A;  2DX1 A;  1WXB A;  2B86 A;  2F2V A;  1I1J A;  1NYF A;  1X6G A;  1ZLM A;  1UTI A;  2A37 A;  2EYY A;  4RTU A;  1GFD A;  5IHN A;  2RQT A;  4RTW A;  1GBQ A;  1T3S A;  5IHI A;  3VS4 A;  4DEX A;  2K79 A;  2HBW A;  2O9V A;  2KNB B;  4F16 A;  1WX6 A;  2ED1 A;  2CDT A;  2KRN A;  1BK2 A;  1JU5 C;  1X27 A;  4J9D A;  3VS5 A;  2OAW A;  1UJY A;  4JPB W;  2YDL A;  4HVW A;  4E6R A;  5GJW B;  2L2P A;  1NEG A;  2CH4 A;  2FG0 A;  1YN8 A;  1NG2 A;  2HEQ A;  1AWJ A;  1T0H A;  2C0I A;  1E7O A;  3I9Q A;  3NMZ C;  3SEM A;  1S1N A;  4CC4 B;  1KIK A;  2JXB A;  5FWB A;  4A63 B;  1Y0M A;  2JW4 A;  5ECA A;  1B07 A;  4HVU A;  4JJB A;  2DL3 A;  2YUP A;  2DJQ A;  3RBB B;  1UDL A;  2CSI A;  1CKA A;  4RTY A;  1YNZ A;  1XOV A;  3VRZ A;  2CRE A;  3KFV A;  2LZ6 B;  2KR3 A;  2F2W A;  2AKL A;  1UG1 A;  4X1V A;  2YSQ A;  4AFU C;  3TVT A;  1AZG B;  2BTT A;  4F14 A;  3GBQ A;  4RTX A;  2L3Q A;  4M4Z A;  5FW9 A;  1K4U S;  2D1X A;  1FMK A;  2YT6 A;  3A98 A;  1HJD A;  1JO8 A;  2RQV A;  4D8D A;  2LQN A;  1NEB A;  1H8K A;  1Z9Z A;  1SHG A;  2YUO A;  3M0P A;  2LX7 A;  3UF4 A;  1EFN A;  2FO0 A;  2FPD A;  4LE9 A;  1HSQ A;  2ABL A;  2LJ3 A;  1GL5 A;  3JV3 A;  4Z8A A;  1FYN A;  2LMJ A;  3I35 A;  4WCI A;  1GRI A;  2DL5 A;  1AD5 A;  1OV3 A;  4RTV A;  3M0Q A;  2IIM A;  2X3X D;  3EG2 A;  4LNP A;  1SRM A;  2I0N A;  2ENM A;  3REA B;  1RUW A;  2KRS A;  3RNJ A;  3IQL A;  1UHF A;  2PTK A;  2EGA A;  2FPE A;  1VYV A;  2GNC A;  2BZX A;  1PKS A;  1JEG A;  2KGT A;  4F17 A;  1WA7 A;  1PWT A;  2F2X A;  2JM8 A;  1M27 C;  1OEB A;  1K76 A;  1QWF A;  1WDX A;  2A28 A;  3I5R A;  1NYG A;  2L3P A;  2D8J A;  1JXM A;  3NPF A;  2DYB A;  4IIO A;  4Z88 A;  5EC7 A;  2KRM A;  4EIK A;  2DE0 X;  5GJV B;  4LUE A;  2DRK A;  1KJW A;  2KEA A;  3FJ5 A;  2MIO A;  1G2B A;  1WXT A;  4CC7 A;  2EYZ A;  2K6D A;  1ABQ A;  3NHN A;  3VS0 A;  2GTJ A;  4OMO A;  1T0J A;  2RQW A;  1AOJ A;  1VA7 A;  3ULR B;  2EVR A;  2DIL A;  2EBP A;  1AZE A;  4CC3 A;  1HD3 A;  1UEC A;  1MV0 B;  1AWX A;  3M0U A;  3UA6 A;  3VS7 A;  4AFS C;  3REB B;  5IXB A;  2XMF A;  1NLP C;  4QT7 A;  4GLM A;  2CT4 A;  1IO6 A;  2EGC A;  1B3Q A;  2J05 A;  4RTZ A;  1M3C A;  2C0T A;  2DNU A;  1SEM A;  1QWE A;  1KFZ A;  4JJC A;  1M3B A;  1TG0 A;  2JS2 A;  4J9I A;  1Z9Q A;  2QDL A;  2HDA A;  4ESR A;  3ZL7 C;  1AWO A;  2EW3 A;  2CH4 W;  2NUZ A;  3TSZ A;  1RLQ C;  2DBK A;  2HCK A;  1CSK A;  1W70 A;  2BZY A;  3O5Z A;  2LJ0 A;  1UFF A;  2D8H A;  3R6N A;  1A0N B;  2AKK A;  2O88 A;  2ED0 A;  1TUD A;  5IH2 A;  4J9E A;  4RTT A;  2CSQ A;  2K7A A;  1W6X A;  2EGE A;  4HCK A;  2FRW A;  1I0C A;  2AK5 A;  2LQW A;  2KXD A;  1RLP C;  1X43 A;  1PRL C;  4FSS A;  1GCQ A;  1M3A A;  1MUZ A;  2J6F A;  2BZ8 A;  2EYW A;  1NLO C;  2RQR A;  1AVZ C;  2J6K A;  4Z89 A;  1TUC A;  4Y92 A;  2M0Y A;  4OMP A;  3M0T A;  3H41 A;  3VS1 A;  1ARK A;  2J6O A;  1QLY A;  4OMQ A;  2LCS A;  1UGV A;  3I5S A;  2HSP A;  5I11 A;  2DBM A;  4J9C A;  5FWC A;  1GCQ C;  2GBQ A;  1Y57 A;  2MCN A;  1E6H A;  4J9H A;  2AZS A;  1BBZ A;  4JZ4 A;  1GBR A;  2JMC A;  2J06 A;  3VS3 A;  1YCS B;  1UE9 A;  2RMO A;  2P4R A;  5I22 A;  1ZSG A;  2JTE A;  2OJ2 A;  2SRC A;  1W1F A;  1KSW A;  1X2Q A;  3QWX X;  3EG0 A;  3QWY A;  1LCK A;  1WLP B;  2EYX A;  3PVQ A;  1BU1 A;  2DLP A;  3TSW A;  2DA9 A;  2V1Q A;  1ABO A;  2RPN A;  2JMA A;  4OML A;  1CKB A;  1H3H A;  2EKH A;  2ROL A;  1X2K A;  1K0X A;  1K1Z A;  1U5S A;  5HCK A;  1ZUK A;  1K9A A;  3CQT A;  2PNI A;  2PZ1 A;  2YUQ A;  2RN8 A;  1WI7 A;  1SHF A;  3EHQ A;  3PE0 A;  2JT4 A;  2VKN A;  3PVL A;  2M51 A;  1ZUU A;  1JXO A;  2KYM A;  2MOX A;  2L3S A;  4ZNX A;  2A36 A;  4OMN A;  1QKX A;  2D0N A;  2O31 A;  1X6B A;  4RUG A;  4CC2 A;  3EG1 A;  2J7I A;  2LP5 A;  2K3B A;  1BB9 A;  1OOT A;  1QKW A;  3UAT A;  1GFC A;  4IIM A; 
#chains in the Genus database with same CATH topology
 2M1H A;  4NS5 A;  2JVV A;  1V1C A;  2GTO A;  2EJ9 A;  3CCV T;  3QZ5 B;  3S3M A;  3C94 A;  4C92 D;  1I07 A;  1VOM A;  1SRL A;  2ZGW A;  3GP8 A;  1PRM C;  2X3W D;  2Z0W A;  1YI2 T;  1JQQ A;  2SEM A;  1X69 A;  1NPP A;  3CME Q;  1WJQ A;  2EQM A;  3OY9 A;  3VUZ A;  1YJW Q;  3LH5 A;  3OMC A;  2FZK B;  2HL3 A;  3UA7 A;  1Q81 R;  3VS6 A;  4PJO B;  2DZC A;  2X4W A;  3C4S A;  1IXD A;  5GAO q;  1VQ4 T;  2F1L A;  5IHK A;  1JRI A;  4M7D E;  4C5H A;  2VWF A;  3EGX B;  2Y90 A;  4F7U B;  1WFW A;  2QEX A;  4MZM A;  2DPP B;  3M0R A;  1QQJ A;  1SSH A;  1MMD A;  3C0C A;  4FW2 A;  1YIJ T;  1RI9 A;  3H0I A;  2DL4 A;  2FHD A;  1RAH B;  1YWO A;  4PLI A;  2NWM A;  2D6F A;  2W10 A;  3CMA Q;  4AG1 C;  2RH2 A;  3G4S Q;  2CUD A;  4M7A F;  2W0Z A;  4E7J A;  2YRV A;  4RCC A;  1N9R A;  1WHG A;  4PJO A;  1WGS A;  2XG8 D;  1UEB A;  3I56 Q;  2H8H A;  3THK A;  1C6V X;  1PNJ A;  4M77 D;  3X24 B;  2RQU A;  1VQ7 T;  1AEY A;  1KC8 U;  4MDX A;  1NJI C;  4F7U A;  2QGG A;  5HK3 A;  5CK9 A;  2LCL A;  2QAZ A;  1NM7 A;  3J7A F;  1M90 U;  4M7A E;  2K2V A;  1NYF A;  5GAO r;  1UTI A;  1OU8 A;  5KE2 A;  1GFD A;  4RTW A;  1GBQ A;  1T3S A;  4R56 A;  5IAY A;  5GAN 7;  3CME T;  1Q82 C;  3CCR Q;  2O9V A;  2KNB B;  2ZPG B;  3UT1 A;  2DO3 A;  3FDR A;  1YJW T;  2ZPI B;  3ME9 A;  1X27 A;  3HRT A;  4CRI A;  4JPB W;  3G6E Q;  3BDL A;  5GJW B;  6AT1 B;  5GAM j;  1RAG B;  3CCQ Q;  2NYS A;  2XDD A;  3OYE A;  5EG2 A;  1T0H A;  3OYD A;  2QA4 Q;  3I9Q A;  4NOY A;  1KIK A;  5D6W A;  4LDY A;  4PKC C;  5ECA A;  1B07 A;  3OYH A;  2DIQ A;  1BI0 A;  1JB0 E;  3S6W A;  3HSB A;  2RJF A;  4OVA A;  1D0Y A;  2PUO B;  2DL3 A;  2RHZ A;  3MET A;  2RI3 A;  1HK9 A;  2DJQ A;  3RBB B;  4C8Q G;  1N8R U;  1AHJ B;  2RJD A;  5GAN f;  3G1J A;  5GAN 8;  3CMA T;  3G4S T;  2LZ6 B;  2KR3 A;  4V2S A;  3BE3 A;  4C92 C;  3URG A;  3TVT A;  5AYF A;  2BTT A;  3I56 T;  3GBQ A;  3SWN C;  4XU1 A;  2RI5 A;  4M4Z A;  3UDC A;  1KC8 R;  1V76 A;  3LGL A;  1YJ9 Q;  4M7D D;  2DTO A;  1FMK A;  3A98 A;  1K9M C;  2YLC A;  3P8D A;  4N4G A;  3JCM b;  3HKS A;  1VQO Q;  1H8K A;  1Z9Z A;  5GAN d;  2YUO A;  5LL6 S;  4NL3 A;  1QP2 A;  1VQK Q;  2HKQ B;  1M90 R;  4Y28 E;  1DJ7 B;  1FYN A;  2KDS A;  2O4X B;  4WCI A;  4ATO A;  2DL5 A;  4PJO F;  4MZP A;  2QGF B;  2D0Q B;  3M0Q A;  4FYV B;  4LDV A;  4LNP A;  3CCR T;  2I0N A;  2VB6 A;  3IQL A;  4JS5 A;  4QW2 A;  1IHW A;  3OYK A;  3CCV A;  3OW2 P;  4F7U F;  1PKS A;  5FRM A;  3PMT A;  3L2R A;  4NL2 A;  1WA7 A;  2F2X A;  3G6E T;  4J7I A;  4OP0 A;  3V7R A;  4XTZ A;  3OB9 A;  3I5R A;  3CCQ T;  3V8L A;  3LW5 E;  4M7A D;  2X35 A;  1YI2 A;  2KRM A;  5GJV B;  4LUE A;  2QA4 T;  2DRK A;  3KBG A;  2IPO B;  1VQP A;  4PJO E;  2DAQ A;  5DM7 R;  2KEA A;  3FJ5 A;  1OZ3 A;  3M55 A;  4DQ2 A;  3ER0 A;  4M77 C;  1ABQ A;  1VQ6 A;  4XU2 A;  3QPH A;  1TH7 A;  1T0J A;  4B9W A;  3ULR B;  5LJ3 g;  3CEY A;  4F7U E;  3OS5 A;  2CP7 A;  5KE3 A;  2BKD N;  5GAN 5;  4OB3 B;  3OYJ A;  1NLP C;  3CC2 Q;  3OYB A;  1WHJ A;  5GAN 6;  2CT4 A;  1YJ9 T;  2J05 A;  3GPL A;  4ZN1 A;  2DNU A;  3JB9 G;  1QWE A;  3H8Z A;  2E4H A;  4JJC A;  3L42 A;  3LX7 A;  1VQO T;  5KYY B;  1Z9Q A;  3OMG A;  2XIC A;  1I5O B;  5L8R E;  4QVZ A;  3ZL7 C;  2EW3 A;  1VQK T;  4C8Q F;  1VQL A;  1RLQ C;  2JOY A;  5FU7 B;  2RHY A;  3V8J A;  2BZY A;  3ZBD A;  1A0N B;  1JJ2 P;  4WTO B;  3ZEH A;  2CZ6 B;  2KMT A;  2O88 A;  4ELY C;  4IUQ A;  1UGR B;  1W6X A;  4HCK A;  1Y71 A;  1KK7 A;  3PNW C;  2QEX Q;  1O9S A;  2COZ A;  4UC4 A;  2JJ9 A;  1RLP C;  1PRL C;  1W4S A;  1PD1 A;  1GCQ A;  5KYY A;  4PJN A;  1M3A A;  1MUZ A;  2RHU A;  5DLO A;  2RQR A;  3CPW P;  5KH6 A;  3EFO B;  3DLL A;  2KVQ G;  1N6A A;  3M0T A;  2LT4 A;  1LPL A;  4OMQ A;  5CVI A;  1UGV A;  1VQN Q;  2LX9 A;  5LJ5 f;  4J9C A;  4M7D C;  2MCN A;  1E6H A;  1YJW A;  4OB2 B;  1OQK A;  3JCM f;  4JZ4 A;  4RCB A;  3FLG A;  1UE9 A;  2QQA A;  3QWY A;  1XQH A;  1QVF S;  1D1B A;  5I2S A;  1LCK A;  3FJP A;  3CC2 T;  1WLP B;  2GF7 A;  2EYX A;  3PVQ A;  4HCC A;  4L5G A;  1BU1 A;  5LJ5 d;  4PJO D;  4C5E A;  2V1Q A;  4PFO A;  4FCY A;  2ZCF B;  3JCM d;  2JMA A;  5CKH A;  3V7S A;  1BI2 A;  2IVW A;  1K0X A;  3LWI A;  1K1Z A;  1U5S A;  3CXC P;  1ZUK A;  2YUQ A;  1G3S A;  1SHF A;  1QVF A;  2QK0 A;  2M51 A;  1ZUU A;  3I56 A;  1K73 C;  3D7S B;  4M7A C;  2E6Z A;  3X28 B;  4KH0 B;  5CO7 A;  1VQ9 A;  1UGQ B;  1OX9 A;  2QEX T;  4MDW A;  3M4G A;  2RK1 A;  2NUP B;  3GOX A;  2RD1 A;  1QVG A;  3JB9 F;  1Q95 G;  4J6W A;  2QG9 B;  4CC2 A;  3PMI A;  5GAM d;  5HK0 A;  2WAC A;  4CI0 C;  4II1 A;  1K8A R;  2O01 E;  4MMK A;  1U8R A;  5LJ5 h;  4DBQ A;  4MML A;  2BIV A;  2E70 A;  4HXJ A;  2VVK A;  1M1K R;  2ECZ A;  1VQN T;  2GFU A;  4AFQ C;  1ZUY A;  2G6F X;  4Z02 A;  3SHW A;  2DF6 A;  4DBR A;  3J80 E;  1H92 A;  2ZPE B;  2LNH B;  2NUP A;  1Q7Y C;  3CC7 Q;  1VYU A;  4EMK C;  4IUR A;  2XKO C;  3G6E A;  1Y07 A;  5J39 A;  1MV3 A;  5FU6 C;  1KD1 R;  3QDR B;  3CCQ A;  4AG2 C;  2KRO A;  5FRO A;  2PVO B;  1QCF A;  2RI2 A;  4C0G A;  2L0A A;  2KE9 A;  3VS2 A;  3JCM J;  2KI7 A;  1U06 A;  4M78 B;  2KT8 A;  4J9B A;  1UUE A;  2LJ1 A;  2E5K A;  2FEI A;  4KGX B;  3JB9 I;  4OMM A;  4AFZ C;  4O5V A;  3VUB A;  4M75 G;  1VYT A;  2DM1 A;  2FRY A;  1FX7 A;  4M75 A;  4P5N A;  4GBQ A;  2KBT A;  2MI6 A;  1TS9 A;  1UJ0 A;  2KYB A;  4LUD A;  2HBP A;  2XU8 A;  3QZ9 B;  3M0S A;  3MEA A;  4KGV B;  2PVG B;  2X4J A;  1VQP Q;  1ZBJ A;  3MEU A;  1J3T A;  4M78 A;  2RF0 A;  4ME7 A;  1VQO A;  4N0A A;  4PL6 A;  1VQ6 Q;  2DMO A;  2JNG A;  4R0K A;  3GIB A;  2A7Y A;  1WJS A;  3N5B B;  4LD6 A;  1E6G A;  4K11 A;  2P84 A;  2V1R A;  2XI9 A;  3L2U A;  1IB8 A;  1PKT A;  2DL8 A;  3EG3 A;  5CKD A;  3TCJ A;  5L23 A;  2K2M A;  4A4H A;  1RAB B;  2IG0 A;  3J81 E;  2CZ7 B;  3JRZ A;  2CUB A;  4J9G A;  1M8M A;  4PJO C;  3I55 A;  3EHR A;  1WIE A;  1HXD A;  2DZ9 A;  5CQY A;  2DXC A;  2L8D A;  3CC7 T;  1I1J A;  4A4E A;  2QYZ A;  3QO3 A;  4GY5 A;  1VQL Q;  2RQT A;  4KBM B;  3VS4 A;  4DEX A;  1M1G A;  1M2O A;  4PJL A;  3CBM A;  4KT0 E;  2CS7 A;  1QVG P;  2CDT A;  1D3B B;  3MP8 A;  2X4X A;  1JU5 C;  1QVP A;  4HVW A;  4C0Z A;  2M16 A;  1NEG A;  3AT1 B;  4ANJ A;  3FIF A;  2CZ1 B;  5CQX A;  3AHU A;  2E12 A;  4RKU E;  5D7U A;  1ZBX A;  3QXE B;  1BYM A;  1Y0M A;  2JW4 A;  1WJR A;  2X4Y A;  3CBP A;  3CC2 A;  4HVU A;  4XTU A;  3KXT A;  2DER A;  4QQD A;  1VQP T;  1D0Z A;  1OX8 A;  1UDL A;  2CSI A;  1CKA A;  3EGD B;  4OGE A;  3NTH A;  4E2F B;  4ZGJ B;  4ZGD B;  3VRZ A;  2RO0 A;  1D3B A;  1VQ6 T;  1PD0 A;  3KUF A;  3L2Q A;  4F14 A;  3RKX A;  1TSF A;  4KH1 B;  4M75 F;  2E64 A;  4X9C A;  3OW2 S;  2YRD A;  3VJP A;  3VYH B;  2HQH A;  5GAN 4;  2VYT A;  1RAI B;  4DOW A;  3M0P A;  3L2W A;  1LJO A;  2VXF A;  1PC0 A;  2X51 A;  2FPD A;  3EGD A;  2COY A;  4BE1 A;  1GL5 A;  4M78 F;  5D6X A;  3OYL A;  1GRI A;  2XD0 A;  1OV3 A;  4RTV A;  3S3N A;  1VQL T;  1VQM A;  3RDV A;  2DTI A;  3EG2 A;  3OW2 A;  2JTM A;  3REA B;  3OYY A;  4JLI A;  4XTV A;  1TU0 B;  5GMK h;  1FMV A;  4BI3 A;  1JEG A;  2KGT A;  3OSV A;  1VQN A;  3M9Q A;  1VQ9 Q;  1FXX A;  1KQ1 A;  4FSX A;  3RUX A;  1K76 A;  2YXY A;  2EAY A;  2DJZ A;  2KSS A;  4M78 E;  7AT1 B;  2L3P A;  1JXM A;  1MMN A;  2OX7 A;  4IIO A;  3X25 B;  8ATC B;  2EYQ A;  1Q86 U;  2QXF A;  4X34 A;  1VUB A;  1G2B A;  2E3H A;  2EYZ A;  2K6D A;  2JUF A;  3NHN A;  2E65 A;  4OMO A;  2MAM A;  4EMH A;  3L1A A;  1TXQ A;  2EVR A;  5KYX B;  2DIL A;  2CGH A;  1JJ2 S;  4RMO A;  4JRK A;  4C8Q B;  5LJ3 f;  4DBF A;  2HQE A;  3M5A A;  1AWX A;  4HKE A;  1U1T A;  2XMF A;  2GFA A;  3H6Z A;  2LC4 A;  1M1K C;  3M4Y A;  4BI4 A;  1YCY A;  4BB7 A;  3JSC A;  4RTZ A;  5GAN e;  1SEM A;  1TG0 A;  2RB6 A;  2HDA A;  2Y4Y A;  1AWO A;  5LJ3 d;  2NUZ A;  1JJ2 A;  2EQK A;  2DD5 A;  1G3W A;  2M9U A;  4QVC A;  5KYX A;  2HCK A;  1CSK A;  2JN0 A;  4C8Q A;  4A4K A;  2LJ0 A;  1UFF A;  2FL7 A;  3R6N A;  5GAO l;  1C0M A;  5IH2 A;  4J9E A;  1RAA B;  2K7A A;  2AHJ B;  5CAI A;  2MMP A;  2AK5 A;  3OYM A;  2LQW A;  1X43 A;  2KXD A;  3A8H B;  3TQ7 P;  3CPW A;  1G5V A;  1VQ9 T;  4DOV A;  4BY6 B;  2BZ8 A;  3JCM c;  2EYW A;  1NLO C;  3X20 B;  2HSE B;  1Q86 R;  3CC7 A;  2J6K A;  3L2V A;  2DTH A;  2K5I A;  2NUT B;  1ARK A;  3OYN A;  3QHS A;  1XJW B;  3DLM A;  5GMK m;  3CXC S;  2MPX C;  2DBM A;  5FWC A;  1GCQ C;  2Y4X A;  1Y57 A;  4BAC A;  2DIG A;  4OB1 B;  1BBZ A;  3RKY A;  2JMC A;  3VS3 A;  2E6N A;  4BDY A;  1YCS B;  4HCZ A;  2RMO A;  5FU7 C;  4HT8 A;  3I55 Q;  2JTE A;  2OJ2 A;  1W1F A;  2MWO A;  3EG0 A;  3QWX X;  2EJG A;  4M78 D;  1LVK A;  2QDY B;  1X75 C;  4D6W A;  1KHI A;  1D1A A;  2NUT A;  1LOJ A;  2LDM A;  3CXC A;  1ABO A;  3BDU A;  4LDW A;  2F5K A;  1CKB A;  1H3H A;  2EKH A;  2RM4 A;  1X2K A;  3EH1 A;  5GAN h;  2H3E B;  1S72 Q;  1N8R R;  2PZ1 A;  3QUI A;  2PQW A;  2XDP A;  3OYG A;  1WI7 A;  4XU0 A;  3PE0 A;  2CP5 A;  2PUK B;  3QYG B;  4IUT A;  2VKN A;  2ATC B;  3RMS A;  2OTL Q;  1JXO A;  4OF1 A;  3WVD B;  4E7I A;  2L3S A;  4ZNX A;  4OMN A;  3HRS A;  1QKX A;  4JRP A;  2D0N A;  4E7L A;  2O31 A;  2HAX A;  4F04 B;  3M58 A;  3MKD A;  5J26 A;  4JRQ A;  4IIM A;  4C5I A;  2EPD A;  3NTI A;  3U23 A;  3HFO A;  1SF9 A;  2F69 A;  2O2O A;  1R0C B;  2AZV A;  2CT3 A;  1RAD B;  2KQW A;  1UB4 A;  4C92 G;  1T3L A;  3OSS C;  4DEY A;  3JAM E;  2EQI A;  4C92 A;  5CKB A;  1Q81 C;  2DET A;  4A4G A;  2DEQ A;  2GGR A;  3I55 T;  1OPL A;  4XAX B;  2RHX A;  1WYX A;  2DD4 A;  5FLX E;  2CP6 A;  5LJ5 e;  4EMG A;  1NJI U;  1BCM A;  2EWN A;  1VQM Q;  1PHT A;  4C8Q E;  5A0D A;  3JCM e;  3VYG A;  2VGM A;  5KYU A;  2FPF A;  3VRY A;  4LN2 A;  1IZ6 A;  2HNI A;  3VKI A;  1UHC A;  1C1A A;  1FWZ A;  1D09 B;  1WXU A;  2GQI A;  4FIB A;  3CCL Q;  2V8J A;  1S72 T;  1N27 A;  5GAO n;  2I2L A;  2BUD A;  1PG5 B;  1G83 A;  1YP5 A;  1GCP A;  2PU9 B;  2BE7 D;  2YUN A;  1Q82 U;  1AWW A;  2A3L A;  3WXM B;  3BFM A;  1ACM B;  4BE0 A;  3Q1J A;  2OTL T;  1SPK A;  1IRX A;  9ATC B;  1N5Z A;  2A08 A;  2KT1 A;  3H0F A;  4C0F A;  1VIF A;  2ESW A;  2DXB A;  1YJN A;  1KQ2 A;  1KQS P;  3MEW A;  1MMG A;  2L3R A;  1PSE A;  4FYX B;  3CCE A;  1QVG S;  1YWP A;  4D8K A;  4KRT A;  4QQ6 A;  4M77 G;  3VU3 C;  1ZX6 A;  3M54 A;  1UGP B;  4M78 C;  4R55 A;  5GAM f;  1K0S A;  2ZAE A;  2BE9 B;  4N0A C;  3ZFJ A;  3HRU A;  2RA2 A;  1OPK A;  3JB9 H;  4KUL A;  1GXI E;  2C0O A;  1VQ5 A;  2B86 A;  1QMC A;  2RJE A;  1ZLM A;  2CKK A;  2A37 A;  2EYY A;  4JDS A;  5IHN A;  1W2B A;  1NJI R;  4PJM A;  1K9M U;  2K79 A;  2HQX A;  4A54 A;  2DKG A;  2HBW A;  3QII A;  1SSF A;  2OTJ A;  1VQM T;  4ELZ C;  1BI3 A;  3T9N A;  1BK2 A;  2QI2 A;  4J9D A;  1ZSZ B;  4GLK A;  3JCM h;  2HD0 A;  2YDL A;  4E6R A;  2L2P A;  1EIF A;  4FYY B;  4XQ3 A;  4FM4 B;  3CCL T;  4C92 F;  2FG0 A;  2C0I A;  1E7O A;  2QQS A;  2K4Y A;  3NMZ C;  4M75 B;  3SEM A;  4CC4 B;  2JXB A;  5A0L A;  4A63 B;  1F1B B;  1R77 A;  3O8V A;  4LDU A;  1NPR A;  1Y7X A;  2KY9 A;  4XTW A;  1KC8 C;  2YUP A;  4L59 A;  4BE2 A;  1MGQ A;  4C8Q D;  2R57 A;  4RTY A;  2VUB A;  2MF2 A;  1UGS B;  1XOV A;  3A8O B;  2DXU A;  2CRE A;  1QCO A;  1ZSZ A;  4J83 A;  2AKL A;  2NLU A;  3GNF B;  1UG1 A;  4X1V A;  2YSQ A;  1M90 C;  1AZG B;  1M1F A;  3H9N A;  2E1H A;  5GAM h;  1IGU A;  4C92 E;  1SKU B;  4FYW B;  8AT1 B;  3LYI A;  3EAE A;  2D1X A;  4E7H A;  2K3X A;  4M7D G;  4HCB A;  2FYK A;  2YT6 A;  1HJD A;  1JO8 A;  4QQG A;  5GAN 2;  4IKF A;  4D8D A;  4OB0 B;  1NEB A;  1SHG A;  3FC3 A;  3PT9 A;  3UF4 A;  1EFN A;  2FO0 A;  5GAO p;  2ABL A;  2LJ3 A;  4Z8A A;  2LMJ A;  4EPC A;  3I35 A;  3CCU Q;  3CPF A;  1AD5 A;  2VC8 A;  1SG5 A;  5GAN j;  3ASK A;  1I4K 1;  1K9M R;  3JB9 J;  5AT1 B;  2IIM A;  3SD4 A;  1SRM A;  2ENM A;  1RUW A;  2CZ0 B;  2KRS A;  2LNV A;  2LVM A;  2EKO A;  1UHF A;  1O75 A;  4OMF B;  3INZ A;  1N8R C;  1PWT A;  4IUP A;  2VGN A;  3OS2 A;  1NBE B;  3DB3 A;  4HT9 A;  1WDX A;  2A28 A;  2CYZ B;  1WZO A;  2QTV A;  3G71 A;  1NYG A;  2D8J A;  4X9D A;  1WNL A;  4M7A G;  3NPF A;  1WQW A;  3E19 A;  4Z88 A;  5EC7 A;  3M53 A;  1B7T A;  4LDX A;  3M56 A;  2E3I A;  1P92 A;  3MP6 A;  5I21 A;  4J7F A;  4CC7 A;  1I81 A;  3PFS A;  3VS0 A;  2GTJ A;  2RQW A;  3JCM W;  5GMK e;  2MYS A;  2R5A A;  1AZE A;  4A4F A;  1W2B P;  1UEC A;  3VS7 A;  3M0U A;  1S72 A;  2R5M A;  3REB B;  3MJX A;  1NZ9 A;  3CCS Q;  4QT7 A;  2DK3 A;  4FT4 A;  3CCM A;  3OYF A;  1M3C A;  2C0T A;  3JB9 D;  1BKB A;  2OTL A;  2FZG B;  5CR2 A;  1VQ8 A;  3PIO A;  1M3B A;  1I5L A;  4J9I A;  2C06 A;  4ESR A;  2ZPF B;  4FT2 A;  2CH4 W;  1QW1 A;  3P8H A;  2DBK A;  2AIR B;  1M2V A;  2KK4 A;  3CCU T;  1XTD A;  5IN1 A;  3A8G B;  3O5Z A;  2DXT A;  1TTH B;  2D8H A;  1TOV A;  2AKK A;  2ED0 A;  4PFP A;  2ZPH B;  1EZZ B;  2VAS A;  4RTT A;  3LGF A;  2EGE A;  3UWN A;  4M7D F;  4C0D B;  1OI1 A;  1M4Z A;  4O6J A;  2HMA A;  1WPY A;  4C8Q C;  2J6F A;  4BUG A;  3FEO A;  2H3J A;  1AVZ C;  2G3R A;  1YJN Q;  4Z89 A;  1D1C A;  3S3O A;  5IT9 E;  1KG1 A;  1K73 U;  3H41 A;  3NTK A;  4Y91 A;  3VS1 A;  3E2U A;  3A1P A;  3CCE Q;  1QLY A;  1MND A;  3RES A;  4FL6 A;  3I5S A;  1D0X A;  4MZT A;  2HSP A;  1JBM A;  5I11 A;  2CP0 A;  3NFC A;  2GBQ A;  5KYN A;  2COW A;  2EQU A;  4N4H A;  1U1S A;  4M75 E;  1GBR A;  2P4R A;  5I22 A;  1ZSG A;  2P0Q A;  1QP3 A;  2VXE A;  2SRC A;  2WSF E;  3CCL A;  4ZTF A;  1VQ5 Q;  3HP9 A;  3LLR A;  3CCS T;  4LD9 K;  4PJO G;  2DA9 A;  5GMK i;  3MP1 A;  1R0B G;  2RPN A;  3P8B B;  4OML A;  2LQK A;  2OTJ Q;  5LJ3 e;  3OYC A;  3L2Z A;  2QQB A;  1Q7Y U;  2LT1 A;  3CD6 Q;  4BY6 C;  3CQT A;  5LJ5 j;  2PNI A;  4F7U G;  1OUL A;  3EGX A;  3A8L B;  3FB9 A;  4HA8 A;  3QSU A;  3PVL A;  1K8A C;  3C95 A;  3SB2 A;  1YHQ A;  2K5F A;  4JUV A;  3QBY A;  3EFS A;  3M57 A;  2MOX A;  1M5Q 1;  2PVD B;  2A36 A;  4YTL A;  4XTY A;  1WHM A;  2DEU A;  1X6B A;  4RUG A;  3EG1 A;  2EIF A;  2J7I A;  3FRN A;  4QVD A;  3VV0 A;  2GQV A;  2K3B A;  2YHT A;  1K73 R;  3RKW A;  1QKW A;  1YJN T;  4FW1 A;  3CPW S;  1GFC A;  4JS4 A;  2HKN A;  1KD1 C;  1IHV A;  4KUD K;  1BCO A;  3OBY A;  4WF2 A;  3C12 A;  2E41 A;  3CCE T;  5GAN 3;  5CKF A;  1MNE A;  2OI3 A;  1M30 A;  1ZQ1 A;  4ZN3 A;  4RG8 A;  3EG9 B;  2RNA A;  4PK4 A;  2K9G A;  2P0P A;  3NGP A;  3QDF A;  2DYI A;  2DVJ A;  3PGG A;  1H64 1;  4PNO A;  3OS1 A;  1VQ5 T;  1FMW A;  3CCJ A;  1TWB A;  2M0O A;  3SFM A;  2D9T A;  2QTX A;  3DB4 A;  1PSF A;  2DRM A;  2LRQ A;  2O9S A;  4JJN K;  1Q7Y R;  3OBW A;  1KQS S;  4HVV A;  3HL8 A;  2OTJ T;  2JM9 A;  3BW1 A;  4KUI A;  4LXC A;  4M75 D;  5KCH A;  3WVE B;  3CD6 T;  3EG9 A;  2ROT A;  4XTX A;  5LJ3 h;  5HKC A;  2EJF A;  2VV5 A;  4JZ3 A;  4ZGE B;  3G71 Q;  3EGU A;  4J6X A;  4J9F A;  1MHN A;  3TU4 K;  1NE8 A;  1RAC B;  1U3O A;  3CC4 Q;  4N4I A;  1YIT A;  4ORZ A;  2EQJ A;  3H0H A;  1WHL A;  3E9F A;  1KQS A;  3F70 A;  3GLX A;  2KXC A;  4J8O A;  2DVE A;  1R8O B;  4IUV A;  4KGZ B;  4B9X A;  4QKU A;  3RR6 A;  5IXF A;  2KAF A;  3QYH B;  3CCU A;  5DY9 A;  3DKM A;  2JTF A;  4JJD A;  1H3Z A;  2JS0 A;  4BDZ A;  2DL7 A;  3CCM Q;  5C0M A;  2O4X A;  2FB7 A;  5FRN A;  1VQ8 Q;  4JLG A;  5J3B A;  5CIU A;  1LNX A;  2DX1 A;  2E10 A;  1WXB A;  4L6V 5;  2F2V A;  3EH2 A;  3RIR A;  4C92 B;  1X6G A;  4TVR A;  4EDU A;  4RTU A;  3SWN B;  5IHI A;  3OS0 A;  3JCM V;  5C6S A;  2XK0 A;  2EFI A;  4F16 A;  1WX6 A;  2ED1 A;  5D6Y A;  2KRN A;  3E1S A;  2YRC A;  3VS5 A;  1B34 B;  3E9G A;  3OA6 A;  2OAW A;  5KYU B;  1VQ4 A;  1UJY A;  2QAS A;  2A0F B;  2QQR A;  2CH4 A;  3X26 B;  1YN8 A;  1NG2 A;  2YWW A;  4XK8 E;  2HEQ A;  3JCM X;  1AWJ A;  3RMQ A;  2FVU A;  1S1N A;  3G71 T;  1YIJ A;  5FWB A;  1HYO A;  3MPU B;  3SWN A;  4JJB A;  3CCS A;  3CC4 T;  3QKJ A;  4J5Y A;  5GAN g;  4C5G A;  1YNZ A;  1OZ2 A;  1PCX A;  2WSC E;  3EFR A;  3KFV A;  1B34 A;  1OU9 A;  3TRE A;  2P4T A;  1I8F A;  2F2W A;  1VQ7 A;  4AFU C;  2B8A A;  1V29 B;  1ZA2 B;  4RTX A;  2L3Q A;  5FW9 A;  1TUG B;  3PTA A;  2RK2 A;  1K4U S;  5GMK j;  3PIP A;  5I2M A;  2RQV A;  2LQN A;  3MEV A;  1G3T A;  1IRE B;  4M77 B;  1AT1 B;  2LX7 A;  2AT1 B;  2MWP A;  3CCM T;  5CKE A;  1ZSZ C;  4LE9 A;  1HSQ A;  1K8A U;  3JV3 A;  1VQ8 T;  3A5Z B;  3CME A;  3RER A;  2RJC A;  3QJY A;  4XU3 A;  4JRI A;  4M75 C;  1M1K U;  5CCA A;  1WHK A;  1OYX A;  5GAM e;  2X3X D;  1EX4 A;  3RNJ A;  4FU6 A;  2F5T X;  2PTK A;  2EGA A;  2FPE A;  1YHQ Q;  1VYV A;  2GNC A;  2BZX A;  1W2B S;  1PM3 A;  4F17 A;  4IUU A;  1KD1 U;  4M77 A;  4J6Y A;  2OAU A;  2JM8 A;  1M27 C;  1OEB A;  3EFO A;  4A53 A;  1QWF A;  3HTR A;  5DLQ E;  2DYB A;  4EIK A;  2DE0 X;  2E5Q A;  1KJW A;  2HZY A;  2MIO A;  3OYI A;  2K3Y A;  1WXT A;  3GNG A;  3JCM P;  3CMA A;  3G4S A;  3MO8 A;  1X01 A;  3M59 A;  2LQ8 A;  3SDZ A;  1AOJ A;  1VA7 A;  4AMC A;  2LCC A;  2FZC B;  2EBP A;  3MHX A;  4CC3 A;  1HD3 A;  2K5L A;  5KCO A;  1Y96 B;  1MV0 B;  3UA6 A;  2V8K A;  3GF5 A;  1YFN A;  1ZA1 B;  2P0K A;  4AFS C;  5KYW B;  5IXB A;  3CD6 A;  2ZZD A;  1G8X A;  1XNI A;  4GLM A;  2V26 A;  1BIB A;  1IO6 A;  3R6O A;  4PJJ A;  2EGC A;  1B3Q A;  1Q82 R;  2RHI A;  3CCJ Q;  1KFZ A;  2JS2 A;  1YBY A;  1M9S A;  4M7D B;  2QDL A;  2DFU A;  3OYA A;  2CP2 A;  1ZHI A;  2R58 A;  4BI8 B;  3TSZ A;  5M9O A;  1M8V A;  2XDB A;  3CCR A;  1W70 A;  5GAO m;  1Y96 A;  3HFN A;  3HPW A;  5KYW A;  5A2Q E;  1TUD A;  1Q86 C;  4E7S A;  5LJ3 j;  2CSQ A;  3CBO A;  2XHC A;  2FRW A;  2QQ9 A;  1I0C A;  3V8K A;  1YHQ T;  4FSS A;  2JZ2 A;  1YIT Q;  1KHC A;  1RAE B;  4M7D A;  1G3Y A;  2QA4 A;  2M02 A;  1QCN A;  1VIE A;  3TEE A;  3LWH A;  1TUC A;  4Y92 A;  2M0Y A;  4OMP A;  4RG2 A;  2L89 A;  2MK5 A;  1RL2 A;  4E7Z A;  5LJ5 g;  2J6O A;  2LCS A;  4M7A B;  3CCV Q;  4DBH A;  2CP3 A;  2HL5 C;  3JCM g;  4BD3 A;  5GMK l;  4J9H A;  1MMA A;  2AZS A;  4VUB A;  2J06 A;  4PFZ A;  4M77 F;  1RI0 A;  4Q5W A;  1YI2 Q;  3JCM Q;  1KSW A;  1X2Q A;  3OQ5 A;  1YJ9 A;  4AT1 B;  4M78 G;  2K57 A;  4B6M A;  3HHT B;  4DA4 A;  2ZPB B;  2X9H A;  2DLP A;  5A0G A;  3TSW A;  4PLL A;  1VQK A;  3CCJ T;  3CC4 A;  4M7A A;  1BIA A;  4C0D C;  2ROL A;  1Q81 U;  3V7C A;  4ZTJ A;  5HCK A;  2WSE E;  3A8M B;  2LTO A;  3QG1 A;  4OGC A;  5GAM g;  1K9A A;  1X6O A;  2RN8 A;  1VQ4 Q;  1WHH A;  2GCX A;  4EMK B;  3EHQ A;  5FU6 B;  4M77 E;  2V8I A;  2JT4 A;  1M2V B;  2L5Q A;  4E47 A;  5HY6 A;  3G7Z A;  1IGQ A;  2KYM A;  1YIJ Q;  1QVF P;  3UPU A;  3QJ6 A;  3MCA B;  2YLB A;  4E7K A;  2XID A;  1WQ7 A;  1YIT T;  1RAF B;  3BY7 A;  3LH0 A;  2LP5 A;  1BI1 A;  1N9S A;  1BB9 A;  1OOT A;  3UAT A;  4EMK A;  1VQ7 Q; 
#chains in the Genus database with same CATH homology
 2EPD A;  4HXJ A;  3U23 A;  2VVK A;  1V1C A;  2GTO A;  2O2O A;  2AZV A;  2CT3 A;  2ECZ A;  4AFQ C;  1ZUY A;  2G6F X;  2OI3 A;  3SHW A;  2DF6 A;  1M30 A;  1T3L A;  4DEY A;  1I07 A;  1H92 A;  2EQI A;  1SRL A;  2LNH B;  2RNA A;  1PRM C;  1VYU A;  2K9G A;  3NGP A;  2X3W D;  2GGR A;  2DVJ A;  1JQQ A;  1MV3 A;  1OPL A;  2SEM A;  4AG2 C;  1X69 A;  1WYX A;  2KRO A;  1QCF A;  2L0A A;  2KE9 A;  3VS2 A;  1PHT A;  2DRM A;  1U06 A;  2O9S A;  3LH5 A;  2FPF A;  2KT8 A;  3UA7 A;  3VRY A;  3VS6 A;  4J9B A;  1UUE A;  4LN2 A;  2LJ1 A;  4HVV A;  1UHC A;  2E5K A;  2FEI A;  2JM9 A;  4OMM A;  4AFZ C;  1WXU A;  2GQI A;  1VYT A;  2DM1 A;  2FRY A;  2ROT A;  4GBQ A;  1G83 A;  1YP5 A;  2KBT A;  1GCP A;  4JZ3 A;  2YUN A;  5IHK A;  1UJ0 A;  3EGU A;  1AWW A;  2VWF A;  4J9F A;  2KYB A;  4LUD A;  1WFW A;  1U3O A;  3M0S A;  3M0R A;  1SPK A;  1SSH A;  3C0C A;  1ZBJ A;  1N5Z A;  1RI9 A;  3H0I A;  2A08 A;  2DL4 A;  4ORZ A;  2KT1 A;  3H0H A;  1YWO A;  1J3T A;  2NWM A;  2W10 A;  2RF0 A;  2KXC A;  3H0F A;  4AG1 C;  2CUD A;  2W0Z A;  2DMO A;  2ESW A;  4R0K A;  1E6G A;  4K11 A;  5IXF A;  2V1R A;  2H8H A;  1YWP A;  4D8K A;  4KRT A;  3THK A;  1PNJ A;  1PKT A;  2DL8 A;  2RQU A;  3EG3 A;  1AEY A;  5L23 A;  2K2M A;  1ZX6 A;  4JJD A;  1K0S A;  2JS0 A;  2CUB A;  2DL7 A;  4J9G A;  1OPK A;  1M8M A;  3EHR A;  1WIE A;  2C0O A;  1NM7 A;  2DX1 A;  1WXB A;  2B86 A;  2F2V A;  1I1J A;  1NYF A;  1X6G A;  1ZLM A;  1UTI A;  2A37 A;  2EYY A;  4RTU A;  1GFD A;  5IHN A;  2RQT A;  4RTW A;  1GBQ A;  1T3S A;  5IHI A;  3VS4 A;  4DEX A;  2K79 A;  2HBW A;  2O9V A;  2KNB B;  4F16 A;  1WX6 A;  2ED1 A;  2CDT A;  2KRN A;  1BK2 A;  1JU5 C;  1X27 A;  4J9D A;  3VS5 A;  2OAW A;  1UJY A;  4JPB W;  2YDL A;  4HVW A;  4E6R A;  5GJW B;  2L2P A;  1NEG A;  2CH4 A;  2FG0 A;  1YN8 A;  1NG2 A;  2HEQ A;  1AWJ A;  1T0H A;  2C0I A;  1E7O A;  3I9Q A;  3NMZ C;  3SEM A;  1S1N A;  4CC4 B;  1KIK A;  2JXB A;  5FWB A;  4A63 B;  1Y0M A;  2JW4 A;  5ECA A;  1B07 A;  4HVU A;  4JJB A;  2DL3 A;  2YUP A;  2DJQ A;  3RBB B;  1UDL A;  2CSI A;  1CKA A;  4RTY A;  1YNZ A;  1XOV A;  3VRZ A;  2CRE A;  3KFV A;  2LZ6 B;  2KR3 A;  2F2W A;  2AKL A;  1UG1 A;  4X1V A;  2YSQ A;  4AFU C;  3TVT A;  1AZG B;  2BTT A;  4F14 A;  3GBQ A;  4RTX A;  2L3Q A;  4M4Z A;  5FW9 A;  1K4U S;  2D1X A;  1FMK A;  2YT6 A;  3A98 A;  1HJD A;  1JO8 A;  2RQV A;  4D8D A;  2LQN A;  1NEB A;  1H8K A;  1Z9Z A;  1SHG A;  2YUO A;  3M0P A;  2LX7 A;  3UF4 A;  1EFN A;  2FO0 A;  2FPD A;  4LE9 A;  1HSQ A;  2ABL A;  2LJ3 A;  1GL5 A;  3JV3 A;  4Z8A A;  1FYN A;  2LMJ A;  3I35 A;  4WCI A;  1GRI A;  2DL5 A;  1AD5 A;  1OV3 A;  4RTV A;  3M0Q A;  2IIM A;  2X3X D;  3EG2 A;  4LNP A;  1SRM A;  2I0N A;  2ENM A;  3REA B;  1RUW A;  2KRS A;  3RNJ A;  3IQL A;  1UHF A;  2PTK A;  2EGA A;  2FPE A;  1VYV A;  2GNC A;  2BZX A;  1PKS A;  1JEG A;  2KGT A;  4F17 A;  1WA7 A;  1PWT A;  2F2X A;  2JM8 A;  1M27 C;  1OEB A;  1K76 A;  1QWF A;  1WDX A;  2A28 A;  3I5R A;  1NYG A;  2L3P A;  2D8J A;  1JXM A;  3NPF A;  2DYB A;  4IIO A;  4Z88 A;  5EC7 A;  2KRM A;  4EIK A;  2DE0 X;  5GJV B;  4LUE A;  2DRK A;  1KJW A;  2KEA A;  3FJ5 A;  2MIO A;  1G2B A;  1WXT A;  4CC7 A;  2EYZ A;  2K6D A;  1ABQ A;  3NHN A;  3VS0 A;  2GTJ A;  4OMO A;  1T0J A;  2RQW A;  1AOJ A;  1VA7 A;  3ULR B;  2EVR A;  2DIL A;  2EBP A;  1AZE A;  4CC3 A;  1HD3 A;  1UEC A;  1MV0 B;  1AWX A;  3M0U A;  3UA6 A;  3VS7 A;  4AFS C;  3REB B;  5IXB A;  2XMF A;  1NLP C;  4QT7 A;  4GLM A;  2CT4 A;  1IO6 A;  2EGC A;  1B3Q A;  2J05 A;  4RTZ A;  1M3C A;  2C0T A;  2DNU A;  1SEM A;  1QWE A;  1KFZ A;  4JJC A;  1M3B A;  1TG0 A;  2JS2 A;  4J9I A;  1Z9Q A;  2QDL A;  2HDA A;  4ESR A;  3ZL7 C;  1AWO A;  2EW3 A;  2CH4 W;  2NUZ A;  3TSZ A;  1RLQ C;  2DBK A;  2HCK A;  1CSK A;  1W70 A;  2BZY A;  3O5Z A;  2LJ0 A;  1UFF A;  2D8H A;  3R6N A;  1A0N B;  2AKK A;  2O88 A;  2ED0 A;  1TUD A;  5IH2 A;  4J9E A;  4RTT A;  2CSQ A;  2K7A A;  1W6X A;  2EGE A;  4HCK A;  2FRW A;  1I0C A;  2AK5 A;  2LQW A;  2KXD A;  1RLP C;  1X43 A;  1PRL C;  4FSS A;  1GCQ A;  1M3A A;  1MUZ A;  2J6F A;  2BZ8 A;  2EYW A;  1NLO C;  2RQR A;  1AVZ C;  2J6K A;  4Z89 A;  1TUC A;  4Y92 A;  2M0Y A;  4OMP A;  3M0T A;  3H41 A;  3VS1 A;  1ARK A;  2J6O A;  1QLY A;  4OMQ A;  2LCS A;  1UGV A;  3I5S A;  2HSP A;  5I11 A;  2DBM A;  4J9C A;  5FWC A;  1GCQ C;  2GBQ A;  1Y57 A;  2MCN A;  1E6H A;  4J9H A;  2AZS A;  1BBZ A;  4JZ4 A;  1GBR A;  2JMC A;  2J06 A;  3VS3 A;  1YCS B;  1UE9 A;  2RMO A;  2P4R A;  5I22 A;  1ZSG A;  2JTE A;  2OJ2 A;  2SRC A;  1W1F A;  1KSW A;  1X2Q A;  3QWX X;  3EG0 A;  3QWY A;  1LCK A;  1WLP B;  2EYX A;  3PVQ A;  1BU1 A;  2DLP A;  3TSW A;  2DA9 A;  2V1Q A;  1ABO A;  2RPN A;  2JMA A;  4OML A;  1CKB A;  1H3H A;  2EKH A;  2ROL A;  1X2K A;  1K0X A;  1K1Z A;  1U5S A;  5HCK A;  1ZUK A;  1K9A A;  3CQT A;  2PNI A;  2PZ1 A;  2YUQ A;  2RN8 A;  1WI7 A;  1SHF A;  3EHQ A;  3PE0 A;  2JT4 A;  2VKN A;  3PVL A;  2M51 A;  1ZUU A;  1JXO A;  2KYM A;  2MOX A;  2L3S A;  4ZNX A;  2A36 A;  4OMN A;  1QKX A;  2D0N A;  2O31 A;  1X6B A;  4RUG A;  4CC2 A;  3EG1 A;  2J7I A;  2LP5 A;  2K3B A;  1BB9 A;  1OOT A;  1QKW A;  3UAT A;  1GFC A;  4IIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...