1WXTA

Solution structure of the sh3 domain of human hypothetical protein flj21522
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
GSSGSSGLKMQVLYEFEARNPRELTVVQGEKLEVLDHSKRWWLVKNEAGRSGYIPSNILEPLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein FLJ21522
publication title Solution structure of the SH3 domain of human hypothetical protein FLJ21522
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 6
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wxtA00
1M30A 3NMZC 1GL5A 1UG1A 4K11A 4ESRA 2V1QA 1MV0B 1AZEA 2DNUA 3SEMA 2DL3A 4J9IA 1NLOC 2LJ3A 2MCNA 4AFUC 1PRLC 2K3BA 1ARKA 3M0RA 4RTWA 1B07A 1ABQA 1CSKA 3UF4A 1FMKA 1RUWA 1WXUA 4HXJA 2O31A 2LQNA 2KRMA 2L3QA 2W0ZA 4GBQA 1M3AA 1NYFA 2H8HA 5FW9A 1RI9A 1AWOA 3M0SA 2J06A 4J9CA 3ZL7C 2KYBA 1WFWA 1ZUYA 2OI3A 1MUZA 4GLMA 2CT3A 2K9GA 1JO8A 4JPBW 4AG1C 1GCQA 1Z9QA 1H8KA 3ULRB 2GNCA 2O88A 2DBMA 3O5ZA 2KROA 2RNAA 2EGCA 2EW3A 3NGPA 2RQUA 1AWWA 4A63B 1AWJA 2DLPA 1GBRA 3I5SA 1OPLA 2D8JA 5IH2A 4J9FA 2ESWA 2P4RA 1KJWA 3SHWA 2JS2A 1ZBJA 4RTVA 2YUPA 1M3BA 3VRZA 2GBQA 1W1FA 1SSHA 2SEMA 1YNZA 1X69A 2VKNA 1X6GA 2DILA 2DL4A 2HBWA 4JZ3A 1Y57A 1YN8A 2YUNA 2EYXA 1I07A 4AFSC 1WXBA 2CH4W 4RUGA 1W6XA 4DEYA 1G83A 2M0YA 4HVWA 1AOJA 1QWFA 1YP5A 2HCKA 3A98A 1X2QA 5FWBA 3TVTA 3IQLA 4OMNA 2LP5A 2LJ1A 2FRWA 1WDXA 4HVVA 4JJDA 1T3LA 4CC3A 4OMMA 2O9SA 2KT1A 1NYGA 1X6BA 1TG0A 2ED1A 3FJ5A 1BB9A 2DE0X 2RQVA 2KRSA 1ZSGA 2GGRA 1KFZA 1HD3A 2EKHA 2JS0A 5I11A 2OAWA 2L3SA 2RF0A 2FPEA 1JEGA 1K1ZA 1H3HA 4JJBA 3TSWA 2FPDA 1WX6A 1NEBA 1T0HA 2LJ0A 2W10A 1GCQC 2DA9A 1RLPC 2NUZA 4FSSA 2J7IA 3TSZA 1BU1A 4LUDA 1GFDA 2RQTA 2IIMA 2M51A 2DJQA 4J9GA 4ZNXA 1LCKA 2RQRA 3M0TA 3UA6A 1T3SA 3VS2A 2A37A 1PHTA 2KBTA 2G6FX 1J3TA 2HSPA 2JT4A 1JXOA 1T0JA 5L23A 1I1JA 1UUEA 2E5KA 2JW4A 1U5SA 4CC2A 2ROTA 1X43A 3QWYA 2FO0A 2I0NA 5EC7A 2DF6A 1UHCA 1YCSB 2BZ8A 2XMFA 1SPKA 2F2WA 4RTUA 2MIOA 2AKKA 1UFFA 2L0AA 4HVUA 1VA7A 4OMQA 1M3CA 2K79A 3VS1A 1JU5C 1ZX6A 3VRYA 3EG2A 3EHQA 1G2BA 2CH4A 2VWFA 5GJVB 2PNIA 1N5ZA 1AD5A 1M27C 4LE9A 4OMOA 1AVZC 2KE9A 1OOTA 2LZ6B 1PWTA 1SHFA 5HCKA 3QWXX 5IHIA 2B86A 3VS3A 4OMPA 2JM9A 2C0OA 2EGEA 1VYVA 2KRNA 1A0NB 3H0HA 2RPNA 2F2XA 1ABOA 1Z9ZA 3PVLA 1WYXA 2PZ1A 4Z89A 1ZLMA 2QDLA 4X1VA 4DEXA 1K9AA 4QT7A 5ECAA 1U3OA 5IXBA 3VS7A 4EIKA 3RNJA 2AZSA 2J6FA 1AZGB 3I9QA 5GJWB 5IXFA 2ROLA 2D1XA 2J6KA 2ECZA 1UTIA 2GTOA 4J9HA 2DL5A 2J6OA 1NM7A 3EHRA 1YWPA 5FWCA 2YDLA 2K2MA 1OV3A 1K76A 2A36A 2VVKA 4J9EA 4ORZA 3JV3A 3VS0A 2YSQA 4JZ4A 1VYUA 3NHNA 1NG2A 1PNJA 3UATA 4RTTA 1JQQA 1PKSA 2LX7A 2A28A 1MV3A 2CUBA 4LUEA 1I0CA 3M0PA 1U06A 2FRYA 3REAB 2EQIA 2C0IA 1HJDA 2DX1A 5IHNA 1XOVA 1KIKA 4RTZA 2KR3A 2LCSA 2DRMA 1V1CA 1QKWA 2V1RA 3PE0A 2DM1A 3U23A 1OPKA 2DYBA 1JXMA 1QLYA 2YUQA 1RLQC 1K0SA 3EGUA 4AG2C 1Y0MA 2RN8A 4Y92A 4Z88A 2DL7A 2CSQA 3UA7A 2LQWA 2JMCA 2LMJA 1AWXA 1SRMA 2JM8A 3EG3A 2KGTA 4AFZC 2J05A 1IO6A 1GBQA 1VYTA 1CKBA 1OEBA 1UJYA 2JXBA 2GQIA 1UECA 2BZYA 3THKA 4E6RA 4D8DA 1AEYA 2RQWA 1GRIA 1E7OA 1PRMC 2KNBB 2HEQA 1QKXA 1WXTA 4HCKA 2JTEA 1SEMA 2GTJA 2NWMA 1WI7A 2MOXA 2YT6A 1WA7A 2RMOA 1QWEA 3H41A 2X3XD 2L2PA 2ABLA 2FEIA 1UHFA 2EGAA 3M0QA 3I5RA 1WLPB 2LNHB 1YWOA 2EYWA 4F14A 4IIOA 2JMAA 3REBB 2SRCA 2A08A 2X3WD 2AZVA 2D8HA 2C0TA 1NEGA 1FYNA 3NPFA 2KT8A 1TUDA 1BBZA 5I22A 3VS6A 2ENMA 2CT4A 1UDLA 2K6DA 4KRTA 1GCPA 1PKTA 2CREA 2EVRA 1ZUKA 4CC7A 2DMOA 4IIMA 1H92A 2BZXA 1S1NA 2KXCA 1QCFA 3PVQA 1E6GA 4CC4B 2DL8A 1X2KA 1ZUUA 2CUDA 1NLPC 4J9DA 1UJ0A 1W70A 2DRKA 2EYYA 1SRLA 2FPFA 3C0CA 4F17A 1SHGA 1UE9A 1EFNA 2YUOA 1GFCA 2L3PA 2O9VA 2ED0A 2EYZA 2PTKA 4RTYA 1X27A 2HDAA 2AKLA 2KYMA 1CKAA 4JJCA 4AFQC 4J9BA 1E6HA 2OJ2A 3EG0A 4M4ZA 3R6NA 3GBQA 1K4US 1TUCA 4R0KA 2DBKA 1B3QA 1HSQA 4LNPA 2KEAA 2KXDA 5IHKA 3CQTA 3KFVA 2K7AA 3H0FA 3RBBB 2EBPA 2D0NA 1M8MA 4LN2A 2AK5A 3VS4A 4OMLA 2CSIA 4D8KA 1UGVA 3EG1A 3LH5A 1KSWA 3VS5A 2F2VA 2O2OA 1WIEA 4F16A 3H0IA 3M0UA 4WCIA 4Z8AA 4RTXA 2CDTA 2BTTA 2FG0A 1K0XA 3I35A 2EPDA 1BK2A 2DVJA
chains in the Genus database with same CATH superfamily
1BIAA 1M30A 1GL5A 1PCXA 1MV0B 3CC2A 1I5OB 3CCLQ 2DL3A 2LJ3A 3QO3A 4DOWA 4AFUC 3JB9G 2XKOC 1BKBA 1PRLC 4C5EA 3OBYA 2WSFE 3A1PA 3HPWA 1O75A 3SWNC 2CP6A 4M78D 1CSKA 2PUOB 3TQ7P 1RUWA 4EMKB 1X01A 2JN0A 4LD6A 5I2MA 3CMAQ 5D6XA 3G71A 3GLXA 1RI0A 1WJQA 3M4GA 4P5NA 4FYXB 4J9CA 1VOMA 2KYBA 2JJ9A 2EQJA 3A8HB 1K73U 1YBYA 1TU0B 1M1GA 3OW2P 1JO8A 1GCQA 2XIDA 3BY7A 3PTAA 3CCJT 3DB4A 2JNGA 3CCJA 1VQ8T 2KROA 2YRDA 2EGCA 3LGLA 2EW3A 5CKBA 4J6WA 3RDVA 3VJPA 3OS0A 1GBRA 1OPLA 4E7KA 4M75A 2D8JA 4A4HA 3M54A 5KYWA 4HT8A 4JJNK 1OI1A 3VRZA 3I56Q 1X69A 1VQOA 4O6JA 3JAME 1Q81U 2DL4A 2HBWA 2RB6A 2EYXA 3MCAB 2NYSA 1W6XA 2H3EB 3L2ZA 4RCCA 3A98A 3TVTA 4OMNA 2RK2A 1OX8A 3DLMA 1PSEA 3L2UA 2MYSA 4JJDA 4OMMA 3L2QA 5AYFA 1NYGA 1X6BA 4KGVB 2YHTA 3JCMV 1D1BA 1IGUA 4LDWA 1ZSGA 4DOVA 1KFZA 3EFSA 4JS4A 3HKSA 3WVDB 3ZFJA 3H6ZA 1H3HA 2Y4XA 4JJBA 3TSWA 4IKFA 4TVRA 2FPDA 4MZMA 1NEBA 3CCEQ 1BYMA 1GCQC 1G3WA 2OX7A 2NUZA 4CRIA 2QASA 1PM3A 2OTLQ 3QIIA 4J6YA 3X20B 3CBPA 4LUDA 2D9TA 3S3NA 3WXMB 5GAMf 1VQLQ 4ZNXA 4C8QA 2FHDA 1OULA 3QG1A 5GAN6 5FRMA 1YI2T 1MMGA 3VS2A 3LWHA 2A37A 4E2FB 3J81E 2KBTA 1D0ZA 1W2BP 3QKJA 4ZTJA 2ZAEA 2L5QA 2MI6A 4BB7A 4M7AE 2HZYA 1I81A 3S3MA 1UUEA 2F1LA 1U5SA 2L89A 3GIBA 2FO0A 2I0NA 2DF6A 4ELYC 1SPKA 2MIOA 3CCUT 2AKKA 3PIOA 2XDBA 2COYA 4OMQA 3QPHA 3M59A 5FLXE 4BY6B 5KCHA 1XQHA 3VRYA 2X35A 1G2BA 1M90C 5GAMd 2XDDA 3PIPA 5LJ5g 3CCQQ 1BIBA 2RJEA 1VIFA 1OOTA 4F7UB 5FU6B 2DJZA 1M9SA 3OBWA 2DTHA 3S3OA 1SHFA 5HCKA 2VXFA 1WHHA 1ZBXA 4J7FA 3QWXX 2B86A 3CPWA 1UGQB 2RJCA 4DBHA 2DXCA 2GF7A 2X4YA 3VU3C 2L3RA 4Q5WA 1RL2A 3H0HA 2RPNA 4IUUA 1WYXA 3OYHA 3QXEB 2M16A 5GAN2 3CD6Q 1KC8U 2QDLA 4O5VA 4JLGA 4ZGEB 5LJ3f 3HFNA 3EGDA 5IXBA 1PG5B 3QYGB 3Q1JA 3G7ZA 2AZSA 2YWWA 2HD0A 3JCMb 4FT4A 5GJWB 4C8QC 5IXFA 1VQPT 2D1XA 2J6KA 1UTIA 4M75F 2DL5A 4EDUA 4X34A 5DLQE 3E1SA 1Q95G 3J80E 2YDLA 1F1BB 1YHQQ 1MHNA 2A36A 2P0PA 2QQRA 1VQNA 3JV3A 3V8KA 3SFMA 4JZ4A 1NJIR 1NG2A 1PNJA 3UATA 4M7AA 1KD1C 1IXDA 5CKDA 4KUIA 4OGCA 1MMDA 2DX1A 2F5KA 1KIKA 1V1CA 2PVGB 2V1RA 2DM1A 3U23A 3CCVA 1VQKA 3SWNB 1NE8A 2XI9A 1JXMA 4NOYA 4BI4A 2MWOA 3CPWP 2K3YA 4ELZC 4AG2C 1I8FA 3JB9F 4M7DD 4DBQA 1M1KU 1VQ9T 4A4EA 1VQ9A 2LQWA 3X26B 5GANf 2JMCA 3R6OA 1WJSA 5LJ3e 2KGTA 2RD1A 5CKHA 2DZ9A 3EH2A 1C0MA 4LXCA 3KUFA 1TUGB 3JB9D 2Y90A 1UECA 2E70A 4F7UG 1OYXA 2KVQG 8AT1B 2JVVA 2BZYA 2BE7D 1VUBA 2QQAA 2RQWA 1Y96A 1E7OA 2EFIA 1U1TA 1X75C 2BIVA 2HEQA 3TEEA 1SEMA 5GAN4 1WA7A 1RAAB 1QWEA 2E4HA 2ABLA 4HCBA 5J39A 5C0MA 2FEIA 4XTWA 3BDUA 1MMNA 4KGXB 3CC4T 3CC4A 2EYWA 4EMHA 5HY6A 5GAOp 4PFOA 1IGQA 2C0TA 2ZGWA 2K5IA 2MK5A 4FW2A 5GAOr 1AT1B 1TUDA 2DKGA 1VQMT 3HP9A 4M7AC 2KAFA 3VS6A 5I2SA 2ENMA 2CT4A 2BE9B 4C0GA 2EQKA 5KYNA 1PKTA 4CI0C 2HQHA 3QSUA 1QVFA 4CC7A 2KMTA 2BZXA 2PQWA 5GANe 1E6GA 3FLGA 2E5QA 2DL8A 2EWNA 4A4FA 2VGNA 3I55T 1UJ0A 3I55A 3OYIA 1SHGA 5KH6A 4NL2A 1EFNA 2AHJB 2H3JA 4WF2A 1VQ7A 2EYZA 1E6HA 3R6NA 3GBQA 4B6MA 1QCNA 1K4US 1TUCA 2XICA 4R0KA 1B3QA 2QDYB 3JCMd 2KEAA 4ZTFA 1GXIE 2GQVA 1WNLA 2D0NA 2X4XA 3CCMA 2AK5A 3VS4A 1QCOA 3LW5E 3M53A 4IURA 3LH5A 4BE2A 3H0IA 3G4ST 2CDTA 2P4TA 4XU0A 4PJOG 4PJOE 5KYWB 3FEOA 3JB9J 3MEVA 1VQ8Q 4ESRA 1TS9A 1WJRA 2CKKA 2DNUA 1K8AU 3ME9A 2CP5A 2RJFA 1KQSS 1QVFP 2K3BA 4RTWA 4C0ZA 1ABQA 1R77A 4MMLA 3CPFA 5FU7C 2O31A 3P8DA 1PD0A 2LQNA 3ZEHA 2KRMA 4GBQA 1M3AA 1NYFA 1RI9A 3J7AF 1AWOA 2J06A 3MEWA 1Q82U 1OU9A 2FL7A 2IPOB 3E9FA 2XU8A 1K73R 1WFWA 1LNXA 2VASA 1G3TA 3X28B 2ZPIB 4X9DA 4E7HA 1YJ9T 2AIRB 2M1HA 1RAEB 2K9GA 3V8LA 1N8RC 2G3RA 2DIGA 2GNCA 4UC4A 3MP6A 2RI3A 2DBMA 2E41A 2X4JA 3HRSA 2RQUA 2K2VA 3AT1B 3I5SA 1D09B 3PGGA 2K4YA 2ESWA 3EG9A 2JS2A 1QVPA 2V8KA 5CCAA 2LX9A 1OX9A 2VKNA 2M9UA 1NZ9A 4C8QB 1MNDA 1YN8A 4OB2B 2CGHA 4J5YA 4PJOA 5LJ5h 4RUGA 3OYYA 1G83A 2GFAA 3MKDA 3HRUA 1AOJA 1QWFA 5DM7R 3M55A 2HCKA 5FWBA 2VXEA 2LJ1A 2QA4A 2E10A 2EIFA 4HVVA 1Q86U 1N9RA 1T3LA 4CC3A 1YI2Q 1D1CA 4M77E 4A54A 1TG0A 1LJOA 2ED1A 1BB9A 4LDVA 1WQ7A 3UPUA 2CZ6B 1Q7YC 1M1FA 2EKHA 2JS0A 2K57A 5I11A 5A2QE 2RF0A 4RG2A 1JEGA 1K1ZA 1SG5A 1NPPA 3OW2S 3EAEA 3NFCA 4BD3A 2LJ0A 3CC2T 2W10A 2FVUA 3C94A 3CCUQ 3OQ5A 1RLPC 4FCYA 5L8RE 3CMEA 4KGZB 3LWIA 3URGA 1YITA 3M57A 4OB0B 4M7DE 2RQTA 1JBMA 2ZPHB 2M51A 5GAOq 2Z0WA 1LCKA 2LNVA 3M0TA 3N5BB 3E9GA 1JJ2P 2JZ2A 2R57A 4E7IA 3G71T 3EGDB 2EYQA 3A8LB 1PHTA 4JRIA 2DVEA 1OZ3A 4J83A 4F7UF 2DD5A 2EJGA 4OB3B 3CEYA 3META 4PJOC 5HK0A 4C92E 4CC2A 3WVEB 3VUZA 1VQ6A 1FX7A 3OYLA 1QMCA 3RMQA 2FZKB 2HAXA 1YCSB 3MP1A 2F2WA 2M0OA 4HKEA 1VQPQ 4C8QG 1B7TA 4C8QE 1UFFA 4HVUA 2OTJA 4M7AB 1JU5C 1ZX6A 3EFOA 4ZGJB 3EHQA 5GJVB 2PNIA 1N5ZA 2E12A 3H8ZA 4FW1A 4OMOA 1AVZC 2KE9A 3EH1A 2NUPA 1FMVA 4M77A 3M5AA 1VQOT 1LVKA 3FB9A 2RM4A 4LDUA 2FB7A 3OYAA 2LT1A 3VS3A 1QVGS 4OMPA 4E7LA 2QEXT 4FIBA 2QEXA 1G3SA 2LC4A 2KDSA 1Z9ZA 2E6ZA 1KC8R 3GOXA 2X4WA 3JB9I 1Q7YU 1W2BA 4XU1A 4QT7A 1MGQA 3OYMA 3RNJA 4QVZA 2J6FA 4DBFA 3I9QA 2ROLA 1VQ9Q 4M7DA 1M2OA 2GTOA 3FJPA 3PMTA 1Y96B 2MWPA 1YWPA 3RUXA 5FWCA 3SD4A 1QQJA 1QP3A 1YFNA 2K2MA 1OV3A 5KYUB 4JRKA 3L2RA 1KG1A 1W4SA 3D7SB 1JQQA 3X24B 2A28A 1MV3A 1I0CA 3M0PA 4PJMA 2P0QA 2FYKA 4C92A 8ATCB 3QDFA 4RTZA 5LJ3g 1WPYA 2A7YA 3JCMW 3LYIA 4XTVA 5J3BA 2P84A 5FU7B 3CC4Q 2JUFA 4MZTA 4QKUA 1M1KR 4M77C 2RI5A 2DL7A 3BW1A 3UA7A 1FMWA 2LMJA 2R5AA 3QZ9B 1YIJT 4OVAA 1VQMQ 1N6AA 1YIJA 4M7AG 2LCCA 4Z02A 3LX7A 2E64A 2GQIA 1G8XA 2HMAA 1RAHB 1XNIA 1AEYA 4KBMB 2KNBB 2R5MA 5D6YA 3A8OB 3I55Q 1WHKA 2JTEA 1UEBA 2YT6A 3HHTB 5KYXA 4M7DC 2L2PA 2BUDA 1UHFA 3FDRA 4Y28E 1WLPB 2WSEE 2LNHB 2K3XA 5GANg 3EGXA 1Y07A 5GMKe 4XTUA 2X3WD 4C5IA 2O01E 1FYNA 4BDYA 4JLIA 2KT8A 5GAMe 5CR2A 1D1AA 2L8DA 2QQSA 5IAYA 5CQYA 1UDLA 2K6DA 5C6SA 4KRTA 1PD1A 3G4SQ 1ZSZA 2QQ9A 3X25B 4C92C 5D7UA 2RHZA 4PNOA 3HTRA 1S1NA 3MEAA 1K9MR 2CUDA 3QHSA 2DRKA 3C0CA 2FPFA 1B34A 2DD4A 4XU2A 2ED0A 1X27A 2AKLA 4PFZA 3EG0A 2LRQA 1VQNT 3OSVA 2HL5C 4LNPA 3RBBB 2K7AA 3H0FA 4KULA 4PLIA 4MMKA 3OYEA 2PVOB 4M75D 4MDWA 4PJJA 2MF2A 2E65A 1TXQA 4XTZA 1R0CB 2K5LA 2HSEB 2CSIA 4D8KA 3EG1A 2HQEA 4IUQA 4F16A 2O2OA 1WIEA 2QYZA 1YJ9Q 3M0UA 4WCIA 4C5GA 3CXCA 3CCVT 1VQKT 2FG0A 2EJFA 1K0XA 3I56A 2DVJA 3EG9B 4HA8A 1BCMA 2C06A 3HRTA 3NMZC 3E2UA 1UG1A 1K9MC 5A0LA 4K11A 1K8AR 1TOVA 3HL8A 1M8VA 4M78G 4M78E 2LQ8A 2XK0A 3JCMX 4PJOB 1M90U 3M0RA 1WXUA 4PKCC 5CVIA 4KH0B 3PNWC 1NJIC 1ZSZC 4BI3A 3ZL7C 2EQUA 1ZUYA 5CQXA 5KYUA 1S72T 1V29B 3PMIA 4GLMA 1S72A 3OYJA 2CT3A 4C8QF 4JPBW 1Z9QA 1OZ2A 1H8KA 2VYTA 3L2VA 4N4IA 2CP2A 3NGPA 5DY9A 3JCMf 1AWWA 4R56A 2DLPA 3OSSC 3CXCP 2NLUA 4LD9K 3OYFA 5IH2A 2PVDB 2WACA 2ZCFB 4J9FA 1P92A 1BI3A 2P4RA 1KJWA 1VQLT 1VQLA 5LJ5d 1ZBJA 2DXBA 2YUPA 4N4GA 2GBQA 1W1FA 1SSHA 2SEMA 1YNZA 2COWA 5LJ5j 2XDPA 3P8HA 2X51A 3CC2Q 4JZ3A 1IRXA 4AFSC 1KD1U 1N9SA 1WXBA 1VQ7T 2ZPBB 3L1AA 4BUGA 2CYZB 4RMOA 2XG8D 4MZPA 1X2QA 4XU3A 3IQLA 1QVFS 2LP5A 2EAYA 1Q86R 2JTFA 1U1SA 3T9NA 2KY9A 3S6WA 5CKFA 4M78A 3G71Q 2O9SA 2QGGA 2KT1A 3CCMT 5M9OA 3FJ5A 2VUBA 3UWNA 5A0GA 2KRSA 4E7ZA 5GAN7 2ZPEB 1Y71A 1TWBA 1HD3A 1TH7A 2CP7A 2VGMA 2RI2A 3CCQT 1EX4A 3CCQA 3MPUB 4VUBA 2RO0A 3EFOB 1WGSA 4IUTA 3JCMe 3CCJQ 1WX6A 2NUPB 1T0HA 3LH0A 4M77B 1MMAA 4B9WA 1D3BB 2DA9A 4FSSA 2M02A 4ATOA 3LGFA 3JSCA 3F70A 5CO7A 1X6OA 3TSZA 3NTKA 3CD6A 3CC7T 1GFDA 2CS7A 3CC7A 1NBEB 2IIMA 4J9GA 2DJQA 2XD0A 4FSXA 2DK3A 1YJNT 1VQOQ 3UA6A 4QVDA 3KXTA 1YJNA 5KYYA 1T3SA 4M7AF 4EPCA 5LJ3h 2PU9B 1HK9A 2QEXQ 2ZZDA 1J3TA 2HSPA 2HKNA 5HKCA 1JXOA 1T0JA 4FL6A 2WSCE 4M7DB 3FIFA 4NL3A 3JCMP 1U8RA 1YHQA 2E5KA 1HXDA 2ROTA 5GMKm 4M7AD 1DJ7B 5EC7A 1UHCA 2XMFA 1RAIB 4HCZA 2L0AA 2KK4A 3C95A 1TSFA 1M3CA 4M78C 1UB4A 2K79A 3VS1A 2DZCA 2CH4A 2O4XA 1R8OB 2VWFA 4PJLA 4DQ2A 1M27C 1IHWA 4C92B 1O9SA 2GCXA 2LZ6B 1PWTA 2DXTA 1Q81R 3G6ET 1BI2A 3G6EA 5IHIA 3MO8A 2C0OA 2EGEA 1JJ2A 2KRNA 3RKXA 2DXUA 3SDZA 1K73C 1ABOA 2HKQB 3OB9A 2A3LA 4Z89A 4FM4B 4ANJA 3RR6A 5GANh 5ECAA 4OB1B 2QA4T 2LTOA 3VS7A 4EIKA 2RHYA 1AZGB 2MMPA 1XTDA 3L2WA 4M77G 1M5Q1 4J9HA 1NM7A 3OYBA 2QTXA 1YIJQ 3JRZA 1M2VB 1NPRA 4E7JA 3OY9A 5KYXB 1C1AA 2VVKA 1Q81C 3VS0A 1VYUA 3NHNA 1PKSA 3REAB 2C0IA 1HJDA 3EGXB 5IHNA 3CMET 4XK8E 2LCSA 2DRMA 1YITT 3SB2A 4OP0A 1QKWA 2DTOA 2ATCB 2F69A 3A5ZB 4R55A 4M7DG 2YUQA 2V26A 1I5LA 4DBRA 1WHGA 1N8RU 2DPPB 4M78F 1ZSZB 2CZ0B 1WQWA 3ASKA 4Y92A 1IREB 2CSQA 1EIFA 3DB3A 3PT9A 2R58A 1D0YA 1SRMA 3QYHB 2JM8A 4N0AC 5CAIA 5CKEA 3RKYA 5GAN5 1GBQA 1B34B 1VYTA 4C92G 1UJYA 4L59A 1VQ6T 1LPLA 1GRIA 1PRMC 3M58A 4ZGDB 4PLLA 2OTJT 1QKXA 4HCKA 4B9XA 2NUTA 2GTJA 2NWMA 4XTYA 5DLOA 5GAMg 2RA2A 4GLKA 1N27A 2RMOA 3H41A 2X3XD 2QXFA 2GFUA 4L5GA 2RK1A 3C4SA 2EGAA 3M0QA 3I5RA 3QJ6A 1YWOA 2DETA 1VQNQ 1D3BA 2LT4A 2JMAA 4IIOA 3REBB 1VQ8A 2E3IA 2SRCA 1QVGA 2A08A 2AZVA 2VB6A 4FT2A 5I21A 1IHVA 1NEGA 3M56A 1H3ZA 3NPFA 4J8OA 1BBZA 4PJNA 4J6XA 3V8JA 3CCVQ 1VQKQ 2CREA 1ZHIA 2EVRA 1ZUKA 3OMGA 1VQ5T 2DMOA 2F5TX 3GNFB 2HBPA 4IIMA 1VQ5A 1QCFA 2DYIA 3VYGA 1YJWT 3G1JA 3PVQA 3OYDA 4CC4B 1YJWA 3OS5A 1ZUUA 3OYKA 1NLPC 4J9DA 1W70A 2EYYA 4EMGA 4FU6A 1UE9A 1ZA1B 1GFCA 1ZQ1A 2O9VA 4RTYA 3A8MB 5IT9E 1W2BS 2HDAA 2KYMA 4AFQC 2OJ2A 4M4ZA 3OMCA 3E19A 2QI2A 2KXDA 1H641 3CQTA 3KFVA 5EG2A 3DLLA 2YXYA 2EBPA 2LDMA 3GPLA 6AT1B 4PJOF 4KUDK 4MDXA 5AT1B 1KSWA 1KC8C 2F2VA 2I2LA 1S72Q 3CCRT 3CCST 3CCRA 2RHUA 3CCSA 1OQKA 3JCMJ 4NS5A 2FZCB 4PK4A 1BK2A 1QVGP 1ACMB 2LCLA 3INZA 3JCMc 1MNEA 4PJOD 2V1QA 1AZEA 2KI7A 4QVCA 5HK3A 2COZA 3SEMA 4J9IA 1NLOC 3H9NA 1QW1A 2MCNA 1KK7A 5FRNA 1M90R 2MAMA 1ARKA 1KQ1A 4M75C 1B07A 3UF4A 2DIQA 1FMKA 4HXJA 4C0DC 4JRPA 1VQ4T 4XAXB 1PSFA 1VQ4A 2L3QA 3VV0A 2W0ZA 2HL3A 1YI2A 2H8HA 4YTLA 2LQKA 5FW9A 3M0SA 3ZBDA 2RH2A 3P8BB 3QBYA 4M78B 3RMSA 1M2VA 4N4HA 4LDXA 2IG0A 2OI3A 1VQ7Q 4L6V5 1MUZA 1G5VA 1WHJA 4AG1C 3MJXA 3JCMQ 4QQDA 4HT9A 3ULRB 2O88A 3O5ZA 2RNAA 2DERA 1JB0E 2EKOA 4PL6A 1IZ6A 1M1KC 3OYGA 1ZA2B 3CCLT 2EJ9A 3CCUA 3CCLA 3CCMQ 2JOYA 4A63B 1KHIA 1AWJA 4QQ6A 1BI1A 1WHLA 3RIRA 4BACA 5GMKj 1Y7XA 3DKMA 3SHWA 3UDCA 2DTIA 4RTVA 2HNIA 5GAMj 1M3BA 1V76A 3PFSA 1X6GA 4F04B 2DILA 2IVWA 3CMAT 3CMAA 4C5HA 1HYOA 2CP3A 3CPWS 2A0FB 1KD1R 1Y57A 2AT1B 2YUNA 2D6FA 1I07A 2CH4W 4DEYA 5KYYB 2M0YA 2V8JA 4HVWA 4JS5A 1JRIA 2KQWA 4EMKA 3QZ5B 1YP5A 5J26A 3CC7Q 4BE1A 2KSSA 4M77F 4OGEA 4JDSA 2FRWA 3JCMg 1WDXA 1YJNQ 4LDYA 1RAFB 1VQPA 3FRNA 3V7SA 2DE0X 3QDRB 1OU8A 2RQVA 2YRVA 5KE2A 2GGRA 4II1A 3OS1A 4M77D 4E47A 1UGRB 2OAWA 2L3SA 2B8AA 2FPEA 3I56T 2O4XB 4RCBA 4XTXA 5GAN8 4PFPA 1VIEA 4X9CA 3RKWA 2QG9B 3VYHB 4A53A 3V7CA 4M7DF 2ZPGB 2BKDN 1FWZA 2E1HA 3MHXA 5LL6S 2J7IA 3RESA 1BU1A 5LJ3d 3L42A 3CXCS 5CK9A 2CZ7B 2QAZA 2RJDA 1XJWB 4XQ3A 3HFOA 5LJ3j 2RQRA 1BCOA 5LJ5f 4KT0E 3G6EQ 3OS2A 2CP0A 5FROA 1Q82R 3A8GB 4Y91A 2PUKB 2G6FX 2X9HA 4C92F 2JT4A 3O8VA 4JUVA 5L23A 2QQBA 1I1JA 3M9QA 2JW4A 1X43A 3QWYA 2VC8A 4F7UE 2QA4Q 4EMKC 3VKIA 3NTIA 1AHJB 3RERA 2BZ8A 4BI8B 4C92D 3NTHA 4RTUA 1K8AC 3CCET 3CCEA 1RABB 3EFRA 4BDZA 5IN1A 5A0DA 1VA7A 3BDLA 4FYWB 2OTLT 2OTLA 3EG2A 4QQGA 4C8QD 1AD5A 4LE9A 3OYNA 3BE3A 3ER0A 5GMKh 4A4GA 3OYCA 1PC0A 4WTOB 4ZN1A 4HCCA 3TU4K 5GANd 1Q82C 2JM9A 5GAMh 2DEUA 2D0QB 1VYVA 3JB9H 1FXXA 2XHCA 1A0NB 2F2XA 3GP8A 7AT1B 5GANj 3CMEQ 1VQMA 5KCOA 3PVLA 2PZ1A 4V2SA 4RG8A 1YITQ 1ZLMA 3V7RA 5LJ5e 5GAOl 4QW2A 4X1VA 4DEXA 1K9AA 1U3OA 3OA6A 1WZOA 5GAOm 2JTMA 1SSFA 1K9MU 4A4KA 1R0BG 2RHXA 1M4ZA 3QUIA 1IB8A 2ECZA 2J6OA 3EHRA 1KHCA 4AMCA 2QGFB 5CIUA 4JRQA 2NUTB 4IUPA 2YLBA 1K76A 4J9EA 4ORZA 2DAQA 1VQ6Q 2K5FA 1RAGB 2YSQA 2V8IA 4RTTA 2LX7A 4LUEA 2CUBA 1NJIU 3CBOA 1KQ2A 1U06A 5GMKi 2FRYA 3M4YA 2OTJQ 2EQIA 3CBMA 3GNGA 2HQXA 1XOVA 3AHUA 2KR3A 4F7UA 2RHIA 1KQSA 1EZZB 1LOJA 3CD6T 3KBGA 3LLRA 3PE0A 1OPKA 3G4SA 4M75B 2DYBA 1QLYA 4C0DB 1N8RR 1RLQC 1Q86C 1K0SA 2DEQA 4J7IA 3EGUA 4ME7A 4GY5A 1Y0MA 4AT1B 2RN8A 1UGSB 2FZGB 1C6VX 4Z88A 4FYVB 3HSBA 2EQMA 1AWXA 3EG3A 1WHMA 5GMKl 4AFZC 2J05A 4FYYB 1IO6A 1UGPB 2CZ1B 1YHQT 1CKBA 1OEBA 3QJYA 2JXBA 1VQ5Q 3C12A 1RACB 4C0FA 3MP8A 1YJWQ 3THKA 4E6RA 4D8DA 1SF9A 3TREA 3GF5A 1WXTA 2DO3A 2ZPFB 1WI7A 2MOXA 2QK0A 1YJ9A 9ATCB 4E7SA 1TTHB 4F14A 5D6WA 2MPXC 4N0AA 2D8HA 1YCYA 2YRCA 4OMFB 2OAUA 1SKUB 1KQSP 3SWNA 3MEUA 4BY6C 5I22A 1Q7YR 2QTVA 3CCRQ 3CCSQ 2Y4YA 4BE0A 1GCPA 1G3YA 4KH1B 5FU6C 1H92A 1RADB 5GAOn 2KXCA 4OF1A 3TCJA 1X2KA 2E3HA 3FC3A 1JJ2S 1SRLA 4F17A 3BFMA 4D6WA 2YUOA 2L3PA 2P0KA 2PTKA 1D0XA 4ZN3A 1CKAA 4JJCA 4J9BA 4RKUE 4DA4A 4IUVA 4M75G 4M75E 2E6NA 1BI0A 2YLCA 2DBKA 1VQ4Q 1HSQA 3OW2A 1I4K1 2DFUA 5IHKA 3UT1A 1M8MA 4LN2A 5GAN3 1QP2A 4OMLA 1UGVA 3VS5A 5KE3A 2VV5A 4Z8AA 4RTXA 3JCMh 3VUBA 2BTTA 3I35A 2EPDA 2LVMA
chains in the Genus database with same CATH topology
1M30A 3NMZC 1GL5A 1UG1A 4K11A 4ESRA 2V1QA 1MV0B 1AZEA 2DNUA 3SEMA 2DL3A 4J9IA 1NLOC 2LJ3A 2MCNA 4AFUC 1PRLC 2K3BA 1ARKA 3M0RA 4RTWA 1B07A 1ABQA 1CSKA 3UF4A 1FMKA 1RUWA 1WXUA 4HXJA 2O31A 2LQNA 2KRMA 2L3QA 2W0ZA 4GBQA 1M3AA 1NYFA 2H8HA 5FW9A 1RI9A 1AWOA 3M0SA 2J06A 4J9CA 3ZL7C 2KYBA 1WFWA 1ZUYA 2OI3A 1MUZA 4GLMA 2CT3A 2K9GA 1JO8A 4JPBW 4AG1C 1GCQA 1Z9QA 1H8KA 3ULRB 2GNCA 2O88A 2DBMA 3O5ZA 2KROA 2RNAA 2EGCA 2EW3A 3NGPA 2RQUA 1AWWA 4A63B 1AWJA 2DLPA 1GBRA 3I5SA 1OPLA 2D8JA 5IH2A 4J9FA 2ESWA 2P4RA 1KJWA 3SHWA 2JS2A 1ZBJA 4RTVA 2YUPA 1M3BA 3VRZA 2GBQA 1W1FA 1SSHA 2SEMA 1YNZA 1X69A 2VKNA 1X6GA 2DILA 2DL4A 2HBWA 4JZ3A 1Y57A 1YN8A 2YUNA 2EYXA 1I07A 4AFSC 1WXBA 2CH4W 4RUGA 1W6XA 4DEYA 1G83A 2M0YA 4HVWA 1AOJA 1QWFA 1YP5A 2HCKA 3A98A 1X2QA 5FWBA 3TVTA 3IQLA 4OMNA 2LP5A 2LJ1A 2FRWA 1WDXA 4HVVA 4JJDA 1T3LA 4CC3A 4OMMA 2O9SA 2KT1A 1NYGA 1X6BA 1TG0A 2ED1A 3FJ5A 1BB9A 2DE0X 2RQVA 2KRSA 1ZSGA 2GGRA 1KFZA 1HD3A 2EKHA 2JS0A 5I11A 2OAWA 2L3SA 2RF0A 2FPEA 1JEGA 1K1ZA 1H3HA 4JJBA 3TSWA 2FPDA 1WX6A 1NEBA 1T0HA 2LJ0A 2W10A 1GCQC 2DA9A 1RLPC 2NUZA 4FSSA 2J7IA 3TSZA 1BU1A 4LUDA 1GFDA 2RQTA 2IIMA 2M51A 2DJQA 4J9GA 4ZNXA 1LCKA 2RQRA 3M0TA 3UA6A 1T3SA 3VS2A 2A37A 1PHTA 2KBTA 2G6FX 1J3TA 2HSPA 2JT4A 1JXOA 1T0JA 5L23A 1I1JA 1UUEA 2E5KA 2JW4A 1U5SA 4CC2A 2ROTA 1X43A 3QWYA 2FO0A 2I0NA 5EC7A 2DF6A 1UHCA 1YCSB 2BZ8A 2XMFA 1SPKA 2F2WA 4RTUA 2MIOA 2AKKA 1UFFA 2L0AA 4HVUA 1VA7A 4OMQA 1M3CA 2K79A 3VS1A 1JU5C 1ZX6A 3VRYA 3EG2A 3EHQA 1G2BA 2CH4A 2VWFA 5GJVB 2PNIA 1N5ZA 1AD5A 1M27C 4LE9A 4OMOA 1AVZC 2KE9A 1OOTA 2LZ6B 1PWTA 1SHFA 5HCKA 3QWXX 5IHIA 2B86A 3VS3A 4OMPA 2JM9A 2C0OA 2EGEA 1VYVA 2KRNA 1A0NB 3H0HA 2RPNA 2F2XA 1ABOA 1Z9ZA 3PVLA 1WYXA 2PZ1A 4Z89A 1ZLMA 2QDLA 4X1VA 4DEXA 1K9AA 4QT7A 5ECAA 1U3OA 5IXBA 3VS7A 4EIKA 3RNJA 2AZSA 2J6FA 1AZGB 3I9QA 5GJWB 5IXFA 2ROLA 2D1XA 2J6KA 2ECZA 1UTIA 2GTOA 4J9HA 2DL5A 2J6OA 1NM7A 3EHRA 1YWPA 5FWCA 2YDLA 2K2MA 1OV3A 1K76A 2A36A 2VVKA 4J9EA 4ORZA 3JV3A 3VS0A 2YSQA 4JZ4A 1VYUA 3NHNA 1NG2A 1PNJA 3UATA 4RTTA 1JQQA 1PKSA 2LX7A 2A28A 1MV3A 2CUBA 4LUEA 1I0CA 3M0PA 1U06A 2FRYA 3REAB 2EQIA 2C0IA 1HJDA 2DX1A 5IHNA 1XOVA 1KIKA 4RTZA 2KR3A 2LCSA 2DRMA 1V1CA 1QKWA 2V1RA 3PE0A 2DM1A 3U23A 1OPKA 2DYBA 1JXMA 1QLYA 2YUQA 1RLQC 1K0SA 3EGUA 4AG2C 1Y0MA 2RN8A 4Y92A 4Z88A 2DL7A 2CSQA 3UA7A 2LQWA 2JMCA 2LMJA 1AWXA 1SRMA 2JM8A 3EG3A 2KGTA 4AFZC 2J05A 1IO6A 1GBQA 1VYTA 1CKBA 1OEBA 1UJYA 2JXBA 2GQIA 1UECA 2BZYA 3THKA 4E6RA 4D8DA 1AEYA 2RQWA 1GRIA 1E7OA 1PRMC 2KNBB 2HEQA 1QKXA 1WXTA 4HCKA 2JTEA 1SEMA 2GTJA 2NWMA 1WI7A 2MOXA 2YT6A 1WA7A 2RMOA 1QWEA 3H41A 2X3XD 2L2PA 2ABLA 2FEIA 1UHFA 2EGAA 3M0QA 3I5RA 1WLPB 2LNHB 1YWOA 2EYWA 4F14A 4IIOA 2JMAA 3REBB 2SRCA 2A08A 2X3WD 2AZVA 2D8HA 2C0TA 1NEGA 1FYNA 3NPFA 2KT8A 1TUDA 1BBZA 5I22A 3VS6A 2ENMA 2CT4A 1UDLA 2K6DA 4KRTA 1GCPA 1PKTA 2CREA 2EVRA 1ZUKA 4CC7A 2DMOA 4IIMA 1H92A 2BZXA 1S1NA 2KXCA 1QCFA 3PVQA 1E6GA 4CC4B 2DL8A 1X2KA 1ZUUA 2CUDA 1NLPC 4J9DA 1UJ0A 1W70A 2DRKA 2EYYA 1SRLA 2FPFA 3C0CA 4F17A 1SHGA 1UE9A 1EFNA 2YUOA 1GFCA 2L3PA 2O9VA 2ED0A 2EYZA 2PTKA 4RTYA 1X27A 2HDAA 2AKLA 2KYMA 1CKAA 4JJCA 4AFQC 4J9BA 1E6HA 2OJ2A 3EG0A 4M4ZA 3R6NA 3GBQA 1K4US 1TUCA 4R0KA 2DBKA 1B3QA 1HSQA 4LNPA 2KEAA 2KXDA 5IHKA 3CQTA 3KFVA 2K7AA 3H0FA 3RBBB 2EBPA 2D0NA 1M8MA 4LN2A 2AK5A 3VS4A 4OMLA 2CSIA 4D8KA 1UGVA 3EG1A 3LH5A 1KSWA 3VS5A 2F2VA 2O2OA 1WIEA 4F16A 3H0IA 3M0UA 4WCIA 4Z8AA 4RTXA 2CDTA 2BTTA 2FG0A 1K0XA 3I35A 2EPDA 1BK2A 2DVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M30 A;  3NMZ C;  1GL5 A;  1UG1 A;  4K11 A;  4ESR A;  2V1Q A;  1MV0 B;  1AZE A;  2DNU A;  3SEM A;  2DL3 A;  4J9I A;  1NLO C;  2LJ3 A;  2MCN A;  4AFU C;  1PRL C;  2K3B A;  1ARK A;  3M0R A;  4RTW A;  1B07 A;  1ABQ A;  1CSK A;  3UF4 A;  1FMK A;  1RUW A;  1WXU A;  4HXJ A;  2O31 A;  2LQN A;  2KRM A;  2L3Q A;  2W0Z A;  4GBQ A;  1M3A A;  1NYF A;  2H8H A;  5FW9 A;  1RI9 A;  1AWO A;  3M0S A;  2J06 A;  4J9C A;  3ZL7 C;  2KYB A;  1WFW A;  1ZUY A;  2OI3 A;  1MUZ A;  4GLM A;  2CT3 A;  2K9G A;  1JO8 A;  4JPB W;  4AG1 C;  1GCQ A;  1Z9Q A;  1H8K A;  3ULR B;  2GNC A;  2O88 A;  2DBM A;  3O5Z A;  2KRO A;  2RNA A;  2EGC A;  2EW3 A;  3NGP A;  2RQU A;  1AWW A;  4A63 B;  1AWJ A;  2DLP A;  1GBR A;  3I5S A;  1OPL A;  2D8J A;  5IH2 A;  4J9F A;  2ESW A;  2P4R A;  1KJW A;  3SHW A;  2JS2 A;  1ZBJ A;  4RTV A;  2YUP A;  1M3B A;  3VRZ A;  2GBQ A;  1W1F A;  1SSH A;  2SEM A;  1YNZ A;  1X69 A;  2VKN A;  1X6G A;  2DIL A;  2DL4 A;  2HBW A;  4JZ3 A;  1Y57 A;  1YN8 A;  2YUN A;  2EYX A;  1I07 A;  4AFS C;  1WXB A;  2CH4 W;  4RUG A;  1W6X A;  4DEY A;  1G83 A;  2M0Y A;  4HVW A;  1AOJ A;  1QWF A;  1YP5 A;  2HCK A;  3A98 A;  1X2Q A;  5FWB A;  3TVT A;  3IQL A;  4OMN A;  2LP5 A;  2LJ1 A;  2FRW A;  1WDX A;  4HVV A;  4JJD A;  1T3L A;  4CC3 A;  4OMM A;  2O9S A;  2KT1 A;  1NYG A;  1X6B A;  1TG0 A;  2ED1 A;  3FJ5 A;  1BB9 A;  2DE0 X;  2RQV A;  2KRS A;  1ZSG A;  2GGR A;  1KFZ A;  1HD3 A;  2EKH A;  2JS0 A;  5I11 A;  2OAW A;  2L3S A;  2RF0 A;  2FPE A;  1JEG A;  1K1Z A;  1H3H A;  4JJB A;  3TSW A;  2FPD A;  1WX6 A;  1NEB A;  1T0H A;  2LJ0 A;  2W10 A;  1GCQ C;  2DA9 A;  1RLP C;  2NUZ A;  4FSS A;  2J7I A;  3TSZ A;  1BU1 A;  4LUD A;  1GFD A;  2RQT A;  2IIM A;  2M51 A;  2DJQ A;  4J9G A;  4ZNX A;  1LCK A;  2RQR A;  3M0T A;  3UA6 A;  1T3S A;  3VS2 A;  2A37 A;  1PHT A;  2KBT A;  2G6F X;  1J3T A;  2HSP A;  2JT4 A;  1JXO A;  1T0J A;  5L23 A;  1I1J A;  1UUE A;  2E5K A;  2JW4 A;  1U5S A;  4CC2 A;  2ROT A;  1X43 A;  3QWY A;  2FO0 A;  2I0N A;  5EC7 A;  2DF6 A;  1UHC A;  1YCS B;  2BZ8 A;  2XMF A;  1SPK A;  2F2W A;  4RTU A;  2MIO A;  2AKK A;  1UFF A;  2L0A A;  4HVU A;  1VA7 A;  4OMQ A;  1M3C A;  2K79 A;  3VS1 A;  1JU5 C;  1ZX6 A;  3VRY A;  3EG2 A;  3EHQ A;  1G2B A;  2CH4 A;  2VWF A;  5GJV B;  2PNI A;  1N5Z A;  1AD5 A;  1M27 C;  4LE9 A;  4OMO A;  1AVZ C;  2KE9 A;  1OOT A;  2LZ6 B;  1PWT A;  1SHF A;  5HCK A;  3QWX X;  5IHI A;  2B86 A;  3VS3 A;  4OMP A;  2JM9 A;  2C0O A;  2EGE A;  1VYV A;  2KRN A;  1A0N B;  3H0H A;  2RPN A;  2F2X A;  1ABO A;  1Z9Z A;  3PVL A;  1WYX A;  2PZ1 A;  4Z89 A;  1ZLM A;  2QDL A;  4X1V A;  4DEX A;  1K9A A;  4QT7 A;  5ECA A;  1U3O A;  5IXB A;  3VS7 A;  4EIK A;  3RNJ A;  2AZS A;  2J6F A;  1AZG B;  3I9Q A;  5GJW B;  5IXF A;  2ROL A;  2D1X A;  2J6K A;  2ECZ A;  1UTI A;  2GTO A;  4J9H A;  2DL5 A;  2J6O A;  1NM7 A;  3EHR A;  1YWP A;  5FWC A;  2YDL A;  2K2M A;  1OV3 A;  1K76 A;  2A36 A;  2VVK A;  4J9E A;  4ORZ A;  3JV3 A;  3VS0 A;  2YSQ A;  4JZ4 A;  1VYU A;  3NHN A;  1NG2 A;  1PNJ A;  3UAT A;  4RTT A;  1JQQ A;  1PKS A;  2LX7 A;  2A28 A;  1MV3 A;  2CUB A;  4LUE A;  1I0C A;  3M0P A;  1U06 A;  2FRY A;  3REA B;  2EQI A;  2C0I A;  1HJD A;  2DX1 A;  5IHN A;  1XOV A;  1KIK A;  4RTZ A;  2KR3 A;  2LCS A;  2DRM A;  1V1C A;  1QKW A;  2V1R A;  3PE0 A;  2DM1 A;  3U23 A;  1OPK A;  2DYB A;  1JXM A;  1QLY A;  2YUQ A;  1RLQ C;  1K0S A;  3EGU A;  4AG2 C;  1Y0M A;  2RN8 A;  4Y92 A;  4Z88 A;  2DL7 A;  2CSQ A;  3UA7 A;  2LQW A;  2JMC A;  2LMJ A;  1AWX A;  1SRM A;  2JM8 A;  3EG3 A;  2KGT A;  4AFZ C;  2J05 A;  1IO6 A;  1GBQ A;  1VYT A;  1CKB A;  1OEB A;  1UJY A;  2JXB A;  2GQI A;  1UEC A;  2BZY A;  3THK A;  4E6R A;  4D8D A;  1AEY A;  2RQW A;  1GRI A;  1E7O A;  1PRM C;  2KNB B;  2HEQ A;  1QKX A;  1WXT A;  4HCK A;  2JTE A;  1SEM A;  2GTJ A;  2NWM A;  1WI7 A;  2MOX A;  2YT6 A;  1WA7 A;  2RMO A;  1QWE A;  3H41 A;  2X3X D;  2L2P A;  2ABL A;  2FEI A;  1UHF A;  2EGA A;  3M0Q A;  3I5R A;  1WLP B;  2LNH B;  1YWO A;  2EYW A;  4F14 A;  4IIO A;  2JMA A;  3REB B;  2SRC A;  2A08 A;  2X3W D;  2AZV A;  2D8H A;  2C0T A;  1NEG A;  1FYN A;  3NPF A;  2KT8 A;  1TUD A;  1BBZ A;  5I22 A;  3VS6 A;  2ENM A;  2CT4 A;  1UDL A;  2K6D A;  4KRT A;  1GCP A;  1PKT A;  2CRE A;  2EVR A;  1ZUK A;  4CC7 A;  2DMO A;  4IIM A;  1H92 A;  2BZX A;  1S1N A;  2KXC A;  1QCF A;  3PVQ A;  1E6G A;  4CC4 B;  2DL8 A;  1X2K A;  1ZUU A;  2CUD A;  1NLP C;  4J9D A;  1UJ0 A;  1W70 A;  2DRK A;  2EYY A;  1SRL A;  2FPF A;  3C0C A;  4F17 A;  1SHG A;  1UE9 A;  1EFN A;  2YUO A;  1GFC A;  2L3P A;  2O9V A;  2ED0 A;  2EYZ A;  2PTK A;  4RTY A;  1X27 A;  2HDA A;  2AKL A;  2KYM A;  1CKA A;  4JJC A;  4AFQ C;  4J9B A;  1E6H A;  2OJ2 A;  3EG0 A;  4M4Z A;  3R6N A;  3GBQ A;  1K4U S;  1TUC A;  4R0K A;  2DBK A;  1B3Q A;  1HSQ A;  4LNP A;  2KEA A;  2KXD A;  5IHK A;  3CQT A;  3KFV A;  2K7A A;  3H0F A;  3RBB B;  2EBP A;  2D0N A;  1M8M A;  4LN2 A;  2AK5 A;  3VS4 A;  4OML A;  2CSI A;  4D8K A;  1UGV A;  3EG1 A;  3LH5 A;  1KSW A;  3VS5 A;  2F2V A;  2O2O A;  1WIE A;  4F16 A;  3H0I A;  3M0U A;  4WCI A;  4Z8A A;  4RTX A;  2CDT A;  2BTT A;  2FG0 A;  1K0X A;  3I35 A;  2EPD A;  1BK2 A;  2DVJ A; 
#chains in the Genus database with same CATH topology
 1BIA A;  1M30 A;  1GL5 A;  1PCX A;  1MV0 B;  3CC2 A;  1I5O B;  3CCL Q;  2DL3 A;  2LJ3 A;  3QO3 A;  4DOW A;  4AFU C;  3JB9 G;  2XKO C;  1BKB A;  1PRL C;  4C5E A;  3OBY A;  2WSF E;  3A1P A;  3HPW A;  1O75 A;  3SWN C;  2CP6 A;  4M78 D;  1CSK A;  2PUO B;  3TQ7 P;  1RUW A;  4EMK B;  1X01 A;  2JN0 A;  4LD6 A;  5I2M A;  3CMA Q;  5D6X A;  3G71 A;  3GLX A;  1RI0 A;  1WJQ A;  3M4G A;  4P5N A;  4FYX B;  4J9C A;  1VOM A;  2KYB A;  2JJ9 A;  2EQJ A;  3A8H B;  1K73 U;  1YBY A;  1TU0 B;  1M1G A;  3OW2 P;  1JO8 A;  1GCQ A;  2XID A;  3BY7 A;  3PTA A;  3CCJ T;  3DB4 A;  2JNG A;  3CCJ A;  1VQ8 T;  2KRO A;  2YRD A;  2EGC A;  3LGL A;  2EW3 A;  5CKB A;  4J6W A;  3RDV A;  3VJP A;  3OS0 A;  1GBR A;  1OPL A;  4E7K A;  4M75 A;  2D8J A;  4A4H A;  3M54 A;  5KYW A;  4HT8 A;  4JJN K;  1OI1 A;  3VRZ A;  3I56 Q;  1X69 A;  1VQO A;  4O6J A;  3JAM E;  1Q81 U;  2DL4 A;  2HBW A;  2RB6 A;  2EYX A;  3MCA B;  2NYS A;  1W6X A;  2H3E B;  3L2Z A;  4RCC A;  3A98 A;  3TVT A;  4OMN A;  2RK2 A;  1OX8 A;  3DLM A;  1PSE A;  3L2U A;  2MYS A;  4JJD A;  4OMM A;  3L2Q A;  5AYF A;  1NYG A;  1X6B A;  4KGV B;  2YHT A;  3JCM V;  1D1B A;  1IGU A;  4LDW A;  1ZSG A;  4DOV A;  1KFZ A;  3EFS A;  4JS4 A;  3HKS A;  3WVD B;  3ZFJ A;  3H6Z A;  1H3H A;  2Y4X A;  4JJB A;  3TSW A;  4IKF A;  4TVR A;  2FPD A;  4MZM A;  1NEB A;  3CCE Q;  1BYM A;  1GCQ C;  1G3W A;  2OX7 A;  2NUZ A;  4CRI A;  2QAS A;  1PM3 A;  2OTL Q;  3QII A;  4J6Y A;  3X20 B;  3CBP A;  4LUD A;  2D9T A;  3S3N A;  3WXM B;  5GAM f;  1VQL Q;  4ZNX A;  4C8Q A;  2FHD A;  1OUL A;  3QG1 A;  5GAN 6;  5FRM A;  1YI2 T;  1MMG A;  3VS2 A;  3LWH A;  2A37 A;  4E2F B;  3J81 E;  2KBT A;  1D0Z A;  1W2B P;  3QKJ A;  4ZTJ A;  2ZAE A;  2L5Q A;  2MI6 A;  4BB7 A;  4M7A E;  2HZY A;  1I81 A;  3S3M A;  1UUE A;  2F1L A;  1U5S A;  2L89 A;  3GIB A;  2FO0 A;  2I0N A;  2DF6 A;  4ELY C;  1SPK A;  2MIO A;  3CCU T;  2AKK A;  3PIO A;  2XDB A;  2COY A;  4OMQ A;  3QPH A;  3M59 A;  5FLX E;  4BY6 B;  5KCH A;  1XQH A;  3VRY A;  2X35 A;  1G2B A;  1M90 C;  5GAM d;  2XDD A;  3PIP A;  5LJ5 g;  3CCQ Q;  1BIB A;  2RJE A;  1VIF A;  1OOT A;  4F7U B;  5FU6 B;  2DJZ A;  1M9S A;  3OBW A;  2DTH A;  3S3O A;  1SHF A;  5HCK A;  2VXF A;  1WHH A;  1ZBX A;  4J7F A;  3QWX X;  2B86 A;  3CPW A;  1UGQ B;  2RJC A;  4DBH A;  2DXC A;  2GF7 A;  2X4Y A;  3VU3 C;  2L3R A;  4Q5W A;  1RL2 A;  3H0H A;  2RPN A;  4IUU A;  1WYX A;  3OYH A;  3QXE B;  2M16 A;  5GAN 2;  3CD6 Q;  1KC8 U;  2QDL A;  4O5V A;  4JLG A;  4ZGE B;  5LJ3 f;  3HFN A;  3EGD A;  5IXB A;  1PG5 B;  3QYG B;  3Q1J A;  3G7Z A;  2AZS A;  2YWW A;  2HD0 A;  3JCM b;  4FT4 A;  5GJW B;  4C8Q C;  5IXF A;  1VQP T;  2D1X A;  2J6K A;  1UTI A;  4M75 F;  2DL5 A;  4EDU A;  4X34 A;  5DLQ E;  3E1S A;  1Q95 G;  3J80 E;  2YDL A;  1F1B B;  1YHQ Q;  1MHN A;  2A36 A;  2P0P A;  2QQR A;  1VQN A;  3JV3 A;  3V8K A;  3SFM A;  4JZ4 A;  1NJI R;  1NG2 A;  1PNJ A;  3UAT A;  4M7A A;  1KD1 C;  1IXD A;  5CKD A;  4KUI A;  4OGC A;  1MMD A;  2DX1 A;  2F5K A;  1KIK A;  1V1C A;  2PVG B;  2V1R A;  2DM1 A;  3U23 A;  3CCV A;  1VQK A;  3SWN B;  1NE8 A;  2XI9 A;  1JXM A;  4NOY A;  4BI4 A;  2MWO A;  3CPW P;  2K3Y A;  4ELZ C;  4AG2 C;  1I8F A;  3JB9 F;  4M7D D;  4DBQ A;  1M1K U;  1VQ9 T;  4A4E A;  1VQ9 A;  2LQW A;  3X26 B;  5GAN f;  2JMC A;  3R6O A;  1WJS A;  5LJ3 e;  2KGT A;  2RD1 A;  5CKH A;  2DZ9 A;  3EH2 A;  1C0M A;  4LXC A;  3KUF A;  1TUG B;  3JB9 D;  2Y90 A;  1UEC A;  2E70 A;  4F7U G;  1OYX A;  2KVQ G;  8AT1 B;  2JVV A;  2BZY A;  2BE7 D;  1VUB A;  2QQA A;  2RQW A;  1Y96 A;  1E7O A;  2EFI A;  1U1T A;  1X75 C;  2BIV A;  2HEQ A;  3TEE A;  1SEM A;  5GAN 4;  1WA7 A;  1RAA B;  1QWE A;  2E4H A;  2ABL A;  4HCB A;  5J39 A;  5C0M A;  2FEI A;  4XTW A;  3BDU A;  1MMN A;  4KGX B;  3CC4 T;  3CC4 A;  2EYW A;  4EMH A;  5HY6 A;  5GAO p;  4PFO A;  1IGQ A;  2C0T A;  2ZGW A;  2K5I A;  2MK5 A;  4FW2 A;  5GAO r;  1AT1 B;  1TUD A;  2DKG A;  1VQM T;  3HP9 A;  4M7A C;  2KAF A;  3VS6 A;  5I2S A;  2ENM A;  2CT4 A;  2BE9 B;  4C0G A;  2EQK A;  5KYN A;  1PKT A;  4CI0 C;  2HQH A;  3QSU A;  1QVF A;  4CC7 A;  2KMT A;  2BZX A;  2PQW A;  5GAN e;  1E6G A;  3FLG A;  2E5Q A;  2DL8 A;  2EWN A;  4A4F A;  2VGN A;  3I55 T;  1UJ0 A;  3I55 A;  3OYI A;  1SHG A;  5KH6 A;  4NL2 A;  1EFN A;  2AHJ B;  2H3J A;  4WF2 A;  1VQ7 A;  2EYZ A;  1E6H A;  3R6N A;  3GBQ A;  4B6M A;  1QCN A;  1K4U S;  1TUC A;  2XIC A;  4R0K A;  1B3Q A;  2QDY B;  3JCM d;  2KEA A;  4ZTF A;  1GXI E;  2GQV A;  1WNL A;  2D0N A;  2X4X A;  3CCM A;  2AK5 A;  3VS4 A;  1QCO A;  3LW5 E;  3M53 A;  4IUR A;  3LH5 A;  4BE2 A;  3H0I A;  3G4S T;  2CDT A;  2P4T A;  4XU0 A;  4PJO G;  4PJO E;  5KYW B;  3FEO A;  3JB9 J;  3MEV A;  1VQ8 Q;  4ESR A;  1TS9 A;  1WJR A;  2CKK A;  2DNU A;  1K8A U;  3ME9 A;  2CP5 A;  2RJF A;  1KQS S;  1QVF P;  2K3B A;  4RTW A;  4C0Z A;  1ABQ A;  1R77 A;  4MML A;  3CPF A;  5FU7 C;  2O31 A;  3P8D A;  1PD0 A;  2LQN A;  3ZEH A;  2KRM A;  4GBQ A;  1M3A A;  1NYF A;  1RI9 A;  3J7A F;  1AWO A;  2J06 A;  3MEW A;  1Q82 U;  1OU9 A;  2FL7 A;  2IPO B;  3E9F A;  2XU8 A;  1K73 R;  1WFW A;  1LNX A;  2VAS A;  1G3T A;  3X28 B;  2ZPI B;  4X9D A;  4E7H A;  1YJ9 T;  2AIR B;  2M1H A;  1RAE B;  2K9G A;  3V8L A;  1N8R C;  2G3R A;  2DIG A;  2GNC A;  4UC4 A;  3MP6 A;  2RI3 A;  2DBM A;  2E41 A;  2X4J A;  3HRS A;  2RQU A;  2K2V A;  3AT1 B;  3I5S A;  1D09 B;  3PGG A;  2K4Y A;  2ESW A;  3EG9 A;  2JS2 A;  1QVP A;  2V8K A;  5CCA A;  2LX9 A;  1OX9 A;  2VKN A;  2M9U A;  1NZ9 A;  4C8Q B;  1MND A;  1YN8 A;  4OB2 B;  2CGH A;  4J5Y A;  4PJO A;  5LJ5 h;  4RUG A;  3OYY A;  1G83 A;  2GFA A;  3MKD A;  3HRU A;  1AOJ A;  1QWF A;  5DM7 R;  3M55 A;  2HCK A;  5FWB A;  2VXE A;  2LJ1 A;  2QA4 A;  2E10 A;  2EIF A;  4HVV A;  1Q86 U;  1N9R A;  1T3L A;  4CC3 A;  1YI2 Q;  1D1C A;  4M77 E;  4A54 A;  1TG0 A;  1LJO A;  2ED1 A;  1BB9 A;  4LDV A;  1WQ7 A;  3UPU A;  2CZ6 B;  1Q7Y C;  1M1F A;  2EKH A;  2JS0 A;  2K57 A;  5I11 A;  5A2Q E;  2RF0 A;  4RG2 A;  1JEG A;  1K1Z A;  1SG5 A;  1NPP A;  3OW2 S;  3EAE A;  3NFC A;  4BD3 A;  2LJ0 A;  3CC2 T;  2W10 A;  2FVU A;  3C94 A;  3CCU Q;  3OQ5 A;  1RLP C;  4FCY A;  5L8R E;  3CME A;  4KGZ B;  3LWI A;  3URG A;  1YIT A;  3M57 A;  4OB0 B;  4M7D E;  2RQT A;  1JBM A;  2ZPH B;  2M51 A;  5GAO q;  2Z0W A;  1LCK A;  2LNV A;  3M0T A;  3N5B B;  3E9G A;  1JJ2 P;  2JZ2 A;  2R57 A;  4E7I A;  3G71 T;  3EGD B;  2EYQ A;  3A8L B;  1PHT A;  4JRI A;  2DVE A;  1OZ3 A;  4J83 A;  4F7U F;  2DD5 A;  2EJG A;  4OB3 B;  3CEY A;  3MET A;  4PJO C;  5HK0 A;  4C92 E;  4CC2 A;  3WVE B;  3VUZ A;  1VQ6 A;  1FX7 A;  3OYL A;  1QMC A;  3RMQ A;  2FZK B;  2HAX A;  1YCS B;  3MP1 A;  2F2W A;  2M0O A;  4HKE A;  1VQP Q;  4C8Q G;  1B7T A;  4C8Q E;  1UFF A;  4HVU A;  2OTJ A;  4M7A B;  1JU5 C;  1ZX6 A;  3EFO A;  4ZGJ B;  3EHQ A;  5GJV B;  2PNI A;  1N5Z A;  2E12 A;  3H8Z A;  4FW1 A;  4OMO A;  1AVZ C;  2KE9 A;  3EH1 A;  2NUP A;  1FMV A;  4M77 A;  3M5A A;  1VQO T;  1LVK A;  3FB9 A;  2RM4 A;  4LDU A;  2FB7 A;  3OYA A;  2LT1 A;  3VS3 A;  1QVG S;  4OMP A;  4E7L A;  2QEX T;  4FIB A;  2QEX A;  1G3S A;  2LC4 A;  2KDS A;  1Z9Z A;  2E6Z A;  1KC8 R;  3GOX A;  2X4W A;  3JB9 I;  1Q7Y U;  1W2B A;  4XU1 A;  4QT7 A;  1MGQ A;  3OYM A;  3RNJ A;  4QVZ A;  2J6F A;  4DBF A;  3I9Q A;  2ROL A;  1VQ9 Q;  4M7D A;  1M2O A;  2GTO A;  3FJP A;  3PMT A;  1Y96 B;  2MWP A;  1YWP A;  3RUX A;  5FWC A;  3SD4 A;  1QQJ A;  1QP3 A;  1YFN A;  2K2M A;  1OV3 A;  5KYU B;  4JRK A;  3L2R A;  1KG1 A;  1W4S A;  3D7S B;  1JQQ A;  3X24 B;  2A28 A;  1MV3 A;  1I0C A;  3M0P A;  4PJM A;  2P0Q A;  2FYK A;  4C92 A;  8ATC B;  3QDF A;  4RTZ A;  5LJ3 g;  1WPY A;  2A7Y A;  3JCM W;  3LYI A;  4XTV A;  5J3B A;  2P84 A;  5FU7 B;  3CC4 Q;  2JUF A;  4MZT A;  4QKU A;  1M1K R;  4M77 C;  2RI5 A;  2DL7 A;  3BW1 A;  3UA7 A;  1FMW A;  2LMJ A;  2R5A A;  3QZ9 B;  1YIJ T;  4OVA A;  1VQM Q;  1N6A A;  1YIJ A;  4M7A G;  2LCC A;  4Z02 A;  3LX7 A;  2E64 A;  2GQI A;  1G8X A;  2HMA A;  1RAH B;  1XNI A;  1AEY A;  4KBM B;  2KNB B;  2R5M A;  5D6Y A;  3A8O B;  3I55 Q;  1WHK A;  2JTE A;  1UEB A;  2YT6 A;  3HHT B;  5KYX A;  4M7D C;  2L2P A;  2BUD A;  1UHF A;  3FDR A;  4Y28 E;  1WLP B;  2WSE E;  2LNH B;  2K3X A;  5GAN g;  3EGX A;  1Y07 A;  5GMK e;  4XTU A;  2X3W D;  4C5I A;  2O01 E;  1FYN A;  4BDY A;  4JLI A;  2KT8 A;  5GAM e;  5CR2 A;  1D1A A;  2L8D A;  2QQS A;  5IAY A;  5CQY A;  1UDL A;  2K6D A;  5C6S A;  4KRT A;  1PD1 A;  3G4S Q;  1ZSZ A;  2QQ9 A;  3X25 B;  4C92 C;  5D7U A;  2RHZ A;  4PNO A;  3HTR A;  1S1N A;  3MEA A;  1K9M R;  2CUD A;  3QHS A;  2DRK A;  3C0C A;  2FPF A;  1B34 A;  2DD4 A;  4XU2 A;  2ED0 A;  1X27 A;  2AKL A;  4PFZ A;  3EG0 A;  2LRQ A;  1VQN T;  3OSV A;  2HL5 C;  4LNP A;  3RBB B;  2K7A A;  3H0F A;  4KUL A;  4PLI A;  4MMK A;  3OYE A;  2PVO B;  4M75 D;  4MDW A;  4PJJ A;  2MF2 A;  2E65 A;  1TXQ A;  4XTZ A;  1R0C B;  2K5L A;  2HSE B;  2CSI A;  4D8K A;  3EG1 A;  2HQE A;  4IUQ A;  4F16 A;  2O2O A;  1WIE A;  2QYZ A;  1YJ9 Q;  3M0U A;  4WCI A;  4C5G A;  3CXC A;  3CCV T;  1VQK T;  2FG0 A;  2EJF A;  1K0X A;  3I56 A;  2DVJ A;  3EG9 B;  4HA8 A;  1BCM A;  2C06 A;  3HRT A;  3NMZ C;  3E2U A;  1UG1 A;  1K9M C;  5A0L A;  4K11 A;  1K8A R;  1TOV A;  3HL8 A;  1M8V A;  4M78 G;  4M78 E;  2LQ8 A;  2XK0 A;  3JCM X;  4PJO B;  1M90 U;  3M0R A;  1WXU A;  4PKC C;  5CVI A;  4KH0 B;  3PNW C;  1NJI C;  1ZSZ C;  4BI3 A;  3ZL7 C;  2EQU A;  1ZUY A;  5CQX A;  5KYU A;  1S72 T;  1V29 B;  3PMI A;  4GLM A;  1S72 A;  3OYJ A;  2CT3 A;  4C8Q F;  4JPB W;  1Z9Q A;  1OZ2 A;  1H8K A;  2VYT A;  3L2V A;  4N4I A;  2CP2 A;  3NGP A;  5DY9 A;  3JCM f;  1AWW A;  4R56 A;  2DLP A;  3OSS C;  3CXC P;  2NLU A;  4LD9 K;  3OYF A;  5IH2 A;  2PVD B;  2WAC A;  2ZCF B;  4J9F A;  1P92 A;  1BI3 A;  2P4R A;  1KJW A;  1VQL T;  1VQL A;  5LJ5 d;  1ZBJ A;  2DXB A;  2YUP A;  4N4G A;  2GBQ A;  1W1F A;  1SSH A;  2SEM A;  1YNZ A;  2COW A;  5LJ5 j;  2XDP A;  3P8H A;  2X51 A;  3CC2 Q;  4JZ3 A;  1IRX A;  4AFS C;  1KD1 U;  1N9S A;  1WXB A;  1VQ7 T;  2ZPB B;  3L1A A;  4BUG A;  2CYZ B;  4RMO A;  2XG8 D;  4MZP A;  1X2Q A;  4XU3 A;  3IQL A;  1QVF S;  2LP5 A;  2EAY A;  1Q86 R;  2JTF A;  1U1S A;  3T9N A;  2KY9 A;  3S6W A;  5CKF A;  4M78 A;  3G71 Q;  2O9S A;  2QGG A;  2KT1 A;  3CCM T;  5M9O A;  3FJ5 A;  2VUB A;  3UWN A;  5A0G A;  2KRS A;  4E7Z A;  5GAN 7;  2ZPE B;  1Y71 A;  1TWB A;  1HD3 A;  1TH7 A;  2CP7 A;  2VGM A;  2RI2 A;  3CCQ T;  1EX4 A;  3CCQ A;  3MPU B;  4VUB A;  2RO0 A;  3EFO B;  1WGS A;  4IUT A;  3JCM e;  3CCJ Q;  1WX6 A;  2NUP B;  1T0H A;  3LH0 A;  4M77 B;  1MMA A;  4B9W A;  1D3B B;  2DA9 A;  4FSS A;  2M02 A;  4ATO A;  3LGF A;  3JSC A;  3F70 A;  5CO7 A;  1X6O A;  3TSZ A;  3NTK A;  3CD6 A;  3CC7 T;  1GFD A;  2CS7 A;  3CC7 A;  1NBE B;  2IIM A;  4J9G A;  2DJQ A;  2XD0 A;  4FSX A;  2DK3 A;  1YJN T;  1VQO Q;  3UA6 A;  4QVD A;  3KXT A;  1YJN A;  5KYY A;  1T3S A;  4M7A F;  4EPC A;  5LJ3 h;  2PU9 B;  1HK9 A;  2QEX Q;  2ZZD A;  1J3T A;  2HSP A;  2HKN A;  5HKC A;  1JXO A;  1T0J A;  4FL6 A;  2WSC E;  4M7D B;  3FIF A;  4NL3 A;  3JCM P;  1U8R A;  1YHQ A;  2E5K A;  1HXD A;  2ROT A;  5GMK m;  4M7A D;  1DJ7 B;  5EC7 A;  1UHC A;  2XMF A;  1RAI B;  4HCZ A;  2L0A A;  2KK4 A;  3C95 A;  1TSF A;  1M3C A;  4M78 C;  1UB4 A;  2K79 A;  3VS1 A;  2DZC A;  2CH4 A;  2O4X A;  1R8O B;  2VWF A;  4PJL A;  4DQ2 A;  1M27 C;  1IHW A;  4C92 B;  1O9S A;  2GCX A;  2LZ6 B;  1PWT A;  2DXT A;  1Q81 R;  3G6E T;  1BI2 A;  3G6E A;  5IHI A;  3MO8 A;  2C0O A;  2EGE A;  1JJ2 A;  2KRN A;  3RKX A;  2DXU A;  3SDZ A;  1K73 C;  1ABO A;  2HKQ B;  3OB9 A;  2A3L A;  4Z89 A;  4FM4 B;  4ANJ A;  3RR6 A;  5GAN h;  5ECA A;  4OB1 B;  2QA4 T;  2LTO A;  3VS7 A;  4EIK A;  2RHY A;  1AZG B;  2MMP A;  1XTD A;  3L2W A;  4M77 G;  1M5Q 1;  4J9H A;  1NM7 A;  3OYB A;  2QTX A;  1YIJ Q;  3JRZ A;  1M2V B;  1NPR A;  4E7J A;  3OY9 A;  5KYX B;  1C1A A;  2VVK A;  1Q81 C;  3VS0 A;  1VYU A;  3NHN A;  1PKS A;  3REA B;  2C0I A;  1HJD A;  3EGX B;  5IHN A;  3CME T;  4XK8 E;  2LCS A;  2DRM A;  1YIT T;  3SB2 A;  4OP0 A;  1QKW A;  2DTO A;  2ATC B;  2F69 A;  3A5Z B;  4R55 A;  4M7D G;  2YUQ A;  2V26 A;  1I5L A;  4DBR A;  1WHG A;  1N8R U;  2DPP B;  4M78 F;  1ZSZ B;  2CZ0 B;  1WQW A;  3ASK A;  4Y92 A;  1IRE B;  2CSQ A;  1EIF A;  3DB3 A;  3PT9 A;  2R58 A;  1D0Y A;  1SRM A;  3QYH B;  2JM8 A;  4N0A C;  5CAI A;  5CKE A;  3RKY A;  5GAN 5;  1GBQ A;  1B34 B;  1VYT A;  4C92 G;  1UJY A;  4L59 A;  1VQ6 T;  1LPL A;  1GRI A;  1PRM C;  3M58 A;  4ZGD B;  4PLL A;  2OTJ T;  1QKX A;  4HCK A;  4B9X A;  2NUT A;  2GTJ A;  2NWM A;  4XTY A;  5DLO A;  5GAM g;  2RA2 A;  4GLK A;  1N27 A;  2RMO A;  3H41 A;  2X3X D;  2QXF A;  2GFU A;  4L5G A;  2RK1 A;  3C4S A;  2EGA A;  3M0Q A;  3I5R A;  3QJ6 A;  1YWO A;  2DET A;  1VQN Q;  1D3B A;  2LT4 A;  2JMA A;  4IIO A;  3REB B;  1VQ8 A;  2E3I A;  2SRC A;  1QVG A;  2A08 A;  2AZV A;  2VB6 A;  4FT2 A;  5I21 A;  1IHV A;  1NEG A;  3M56 A;  1H3Z A;  3NPF A;  4J8O A;  1BBZ A;  4PJN A;  4J6X A;  3V8J A;  3CCV Q;  1VQK Q;  2CRE A;  1ZHI A;  2EVR A;  1ZUK A;  3OMG A;  1VQ5 T;  2DMO A;  2F5T X;  3GNF B;  2HBP A;  4IIM A;  1VQ5 A;  1QCF A;  2DYI A;  3VYG A;  1YJW T;  3G1J A;  3PVQ A;  3OYD A;  4CC4 B;  1YJW A;  3OS5 A;  1ZUU A;  3OYK A;  1NLP C;  4J9D A;  1W70 A;  2EYY A;  4EMG A;  4FU6 A;  1UE9 A;  1ZA1 B;  1GFC A;  1ZQ1 A;  2O9V A;  4RTY A;  3A8M B;  5IT9 E;  1W2B S;  2HDA A;  2KYM A;  4AFQ C;  2OJ2 A;  4M4Z A;  3OMC A;  3E19 A;  2QI2 A;  2KXD A;  1H64 1;  3CQT A;  3KFV A;  5EG2 A;  3DLL A;  2YXY A;  2EBP A;  2LDM A;  3GPL A;  6AT1 B;  4PJO F;  4KUD K;  4MDX A;  5AT1 B;  1KSW A;  1KC8 C;  2F2V A;  2I2L A;  1S72 Q;  3CCR T;  3CCS T;  3CCR A;  2RHU A;  3CCS A;  1OQK A;  3JCM J;  4NS5 A;  2FZC B;  4PK4 A;  1BK2 A;  1QVG P;  1ACM B;  2LCL A;  3INZ A;  3JCM c;  1MNE A;  4PJO D;  2V1Q A;  1AZE A;  2KI7 A;  4QVC A;  5HK3 A;  2COZ A;  3SEM A;  4J9I A;  1NLO C;  3H9N A;  1QW1 A;  2MCN A;  1KK7 A;  5FRN A;  1M90 R;  2MAM A;  1ARK A;  1KQ1 A;  4M75 C;  1B07 A;  3UF4 A;  2DIQ A;  1FMK A;  4HXJ A;  4C0D C;  4JRP A;  1VQ4 T;  4XAX B;  1PSF A;  1VQ4 A;  2L3Q A;  3VV0 A;  2W0Z A;  2HL3 A;  1YI2 A;  2H8H A;  4YTL A;  2LQK A;  5FW9 A;  3M0S A;  3ZBD A;  2RH2 A;  3P8B B;  3QBY A;  4M78 B;  3RMS A;  1M2V A;  4N4H A;  4LDX A;  2IG0 A;  2OI3 A;  1VQ7 Q;  4L6V 5;  1MUZ A;  1G5V A;  1WHJ A;  4AG1 C;  3MJX A;  3JCM Q;  4QQD A;  4HT9 A;  3ULR B;  2O88 A;  3O5Z A;  2RNA A;  2DER A;  1JB0 E;  2EKO A;  4PL6 A;  1IZ6 A;  1M1K C;  3OYG A;  1ZA2 B;  3CCL T;  2EJ9 A;  3CCU A;  3CCL A;  3CCM Q;  2JOY A;  4A63 B;  1KHI A;  1AWJ A;  4QQ6 A;  1BI1 A;  1WHL A;  3RIR A;  4BAC A;  5GMK j;  1Y7X A;  3DKM A;  3SHW A;  3UDC A;  2DTI A;  4RTV A;  2HNI A;  5GAM j;  1M3B A;  1V76 A;  3PFS A;  1X6G A;  4F04 B;  2DIL A;  2IVW A;  3CMA T;  3CMA A;  4C5H A;  1HYO A;  2CP3 A;  3CPW S;  2A0F B;  1KD1 R;  1Y57 A;  2AT1 B;  2YUN A;  2D6F A;  1I07 A;  2CH4 W;  4DEY A;  5KYY B;  2M0Y A;  2V8J A;  4HVW A;  4JS5 A;  1JRI A;  2KQW A;  4EMK A;  3QZ5 B;  1YP5 A;  5J26 A;  3CC7 Q;  4BE1 A;  2KSS A;  4M77 F;  4OGE A;  4JDS A;  2FRW A;  3JCM g;  1WDX A;  1YJN Q;  4LDY A;  1RAF B;  1VQP A;  3FRN A;  3V7S A;  2DE0 X;  3QDR B;  1OU8 A;  2RQV A;  2YRV A;  5KE2 A;  2GGR A;  4II1 A;  3OS1 A;  4M77 D;  4E47 A;  1UGR B;  2OAW A;  2L3S A;  2B8A A;  2FPE A;  3I56 T;  2O4X B;  4RCB A;  4XTX A;  5GAN 8;  4PFP A;  1VIE A;  4X9C A;  3RKW A;  2QG9 B;  3VYH B;  4A53 A;  3V7C A;  4M7D F;  2ZPG B;  2BKD N;  1FWZ A;  2E1H A;  3MHX A;  5LL6 S;  2J7I A;  3RES A;  1BU1 A;  5LJ3 d;  3L42 A;  3CXC S;  5CK9 A;  2CZ7 B;  2QAZ A;  2RJD A;  1XJW B;  4XQ3 A;  3HFO A;  5LJ3 j;  2RQR A;  1BCO A;  5LJ5 f;  4KT0 E;  3G6E Q;  3OS2 A;  2CP0 A;  5FRO A;  1Q82 R;  3A8G B;  4Y91 A;  2PUK B;  2G6F X;  2X9H A;  4C92 F;  2JT4 A;  3O8V A;  4JUV A;  5L23 A;  2QQB A;  1I1J A;  3M9Q A;  2JW4 A;  1X43 A;  3QWY A;  2VC8 A;  4F7U E;  2QA4 Q;  4EMK C;  3VKI A;  3NTI A;  1AHJ B;  3RER A;  2BZ8 A;  4BI8 B;  4C92 D;  3NTH A;  4RTU A;  1K8A C;  3CCE T;  3CCE A;  1RAB B;  3EFR A;  4BDZ A;  5IN1 A;  5A0D A;  1VA7 A;  3BDL A;  4FYW B;  2OTL T;  2OTL A;  3EG2 A;  4QQG A;  4C8Q D;  1AD5 A;  4LE9 A;  3OYN A;  3BE3 A;  3ER0 A;  5GMK h;  4A4G A;  3OYC A;  1PC0 A;  4WTO B;  4ZN1 A;  4HCC A;  3TU4 K;  5GAN d;  1Q82 C;  2JM9 A;  5GAM h;  2DEU A;  2D0Q B;  1VYV A;  3JB9 H;  1FXX A;  2XHC A;  1A0N B;  2F2X A;  3GP8 A;  7AT1 B;  5GAN j;  3CME Q;  1VQM A;  5KCO A;  3PVL A;  2PZ1 A;  4V2S A;  4RG8 A;  1YIT Q;  1ZLM A;  3V7R A;  5LJ5 e;  5GAO l;  4QW2 A;  4X1V A;  4DEX A;  1K9A A;  1U3O A;  3OA6 A;  1WZO A;  5GAO m;  2JTM A;  1SSF A;  1K9M U;  4A4K A;  1R0B G;  2RHX A;  1M4Z A;  3QUI A;  1IB8 A;  2ECZ A;  2J6O A;  3EHR A;  1KHC A;  4AMC A;  2QGF B;  5CIU A;  4JRQ A;  2NUT B;  4IUP A;  2YLB A;  1K76 A;  4J9E A;  4ORZ A;  2DAQ A;  1VQ6 Q;  2K5F A;  1RAG B;  2YSQ A;  2V8I A;  4RTT A;  2LX7 A;  4LUE A;  2CUB A;  1NJI U;  3CBO A;  1KQ2 A;  1U06 A;  5GMK i;  2FRY A;  3M4Y A;  2OTJ Q;  2EQI A;  3CBM A;  3GNG A;  2HQX A;  1XOV A;  3AHU A;  2KR3 A;  4F7U A;  2RHI A;  1KQS A;  1EZZ B;  1LOJ A;  3CD6 T;  3KBG A;  3LLR A;  3PE0 A;  1OPK A;  3G4S A;  4M75 B;  2DYB A;  1QLY A;  4C0D B;  1N8R R;  1RLQ C;  1Q86 C;  1K0S A;  2DEQ A;  4J7I A;  3EGU A;  4ME7 A;  4GY5 A;  1Y0M A;  4AT1 B;  2RN8 A;  1UGS B;  2FZG B;  1C6V X;  4Z88 A;  4FYV B;  3HSB A;  2EQM A;  1AWX A;  3EG3 A;  1WHM A;  5GMK l;  4AFZ C;  2J05 A;  4FYY B;  1IO6 A;  1UGP B;  2CZ1 B;  1YHQ T;  1CKB A;  1OEB A;  3QJY A;  2JXB A;  1VQ5 Q;  3C12 A;  1RAC B;  4C0F A;  3MP8 A;  1YJW Q;  3THK A;  4E6R A;  4D8D A;  1SF9 A;  3TRE A;  3GF5 A;  1WXT A;  2DO3 A;  2ZPF B;  1WI7 A;  2MOX A;  2QK0 A;  1YJ9 A;  9ATC B;  4E7S A;  1TTH B;  4F14 A;  5D6W A;  2MPX C;  4N0A A;  2D8H A;  1YCY A;  2YRC A;  4OMF B;  2OAU A;  1SKU B;  1KQS P;  3SWN A;  3MEU A;  4BY6 C;  5I22 A;  1Q7Y R;  2QTV A;  3CCR Q;  3CCS Q;  2Y4Y A;  4BE0 A;  1GCP A;  1G3Y A;  4KH1 B;  5FU6 C;  1H92 A;  1RAD B;  5GAO n;  2KXC A;  4OF1 A;  3TCJ A;  1X2K A;  2E3H A;  3FC3 A;  1JJ2 S;  1SRL A;  4F17 A;  3BFM A;  4D6W A;  2YUO A;  2L3P A;  2P0K A;  2PTK A;  1D0X A;  4ZN3 A;  1CKA A;  4JJC A;  4J9B A;  4RKU E;  4DA4 A;  4IUV A;  4M75 G;  4M75 E;  2E6N A;  1BI0 A;  2YLC A;  2DBK A;  1VQ4 Q;  1HSQ A;  3OW2 A;  1I4K 1;  2DFU A;  5IHK A;  3UT1 A;  1M8M A;  4LN2 A;  5GAN 3;  1QP2 A;  4OML A;  1UGV A;  3VS5 A;  5KE3 A;  2VV5 A;  4Z8A A;  4RTX A;  3JCM h;  3VUB A;  2BTT A;  3I35 A;  2EPD A;  2LVM A; 
#chains in the Genus database with same CATH homology
 1M30 A;  3NMZ C;  1GL5 A;  1UG1 A;  4K11 A;  4ESR A;  2V1Q A;  1MV0 B;  1AZE A;  2DNU A;  3SEM A;  2DL3 A;  4J9I A;  1NLO C;  2LJ3 A;  2MCN A;  4AFU C;  1PRL C;  2K3B A;  1ARK A;  3M0R A;  4RTW A;  1B07 A;  1ABQ A;  1CSK A;  3UF4 A;  1FMK A;  1RUW A;  1WXU A;  4HXJ A;  2O31 A;  2LQN A;  2KRM A;  2L3Q A;  2W0Z A;  4GBQ A;  1M3A A;  1NYF A;  2H8H A;  5FW9 A;  1RI9 A;  1AWO A;  3M0S A;  2J06 A;  4J9C A;  3ZL7 C;  2KYB A;  1WFW A;  1ZUY A;  2OI3 A;  1MUZ A;  4GLM A;  2CT3 A;  2K9G A;  1JO8 A;  4JPB W;  4AG1 C;  1GCQ A;  1Z9Q A;  1H8K A;  3ULR B;  2GNC A;  2O88 A;  2DBM A;  3O5Z A;  2KRO A;  2RNA A;  2EGC A;  2EW3 A;  3NGP A;  2RQU A;  1AWW A;  4A63 B;  1AWJ A;  2DLP A;  1GBR A;  3I5S A;  1OPL A;  2D8J A;  5IH2 A;  4J9F A;  2ESW A;  2P4R A;  1KJW A;  3SHW A;  2JS2 A;  1ZBJ A;  4RTV A;  2YUP A;  1M3B A;  3VRZ A;  2GBQ A;  1W1F A;  1SSH A;  2SEM A;  1YNZ A;  1X69 A;  2VKN A;  1X6G A;  2DIL A;  2DL4 A;  2HBW A;  4JZ3 A;  1Y57 A;  1YN8 A;  2YUN A;  2EYX A;  1I07 A;  4AFS C;  1WXB A;  2CH4 W;  4RUG A;  1W6X A;  4DEY A;  1G83 A;  2M0Y A;  4HVW A;  1AOJ A;  1QWF A;  1YP5 A;  2HCK A;  3A98 A;  1X2Q A;  5FWB A;  3TVT A;  3IQL A;  4OMN A;  2LP5 A;  2LJ1 A;  2FRW A;  1WDX A;  4HVV A;  4JJD A;  1T3L A;  4CC3 A;  4OMM A;  2O9S A;  2KT1 A;  1NYG A;  1X6B A;  1TG0 A;  2ED1 A;  3FJ5 A;  1BB9 A;  2DE0 X;  2RQV A;  2KRS A;  1ZSG A;  2GGR A;  1KFZ A;  1HD3 A;  2EKH A;  2JS0 A;  5I11 A;  2OAW A;  2L3S A;  2RF0 A;  2FPE A;  1JEG A;  1K1Z A;  1H3H A;  4JJB A;  3TSW A;  2FPD A;  1WX6 A;  1NEB A;  1T0H A;  2LJ0 A;  2W10 A;  1GCQ C;  2DA9 A;  1RLP C;  2NUZ A;  4FSS A;  2J7I A;  3TSZ A;  1BU1 A;  4LUD A;  1GFD A;  2RQT A;  2IIM A;  2M51 A;  2DJQ A;  4J9G A;  4ZNX A;  1LCK A;  2RQR A;  3M0T A;  3UA6 A;  1T3S A;  3VS2 A;  2A37 A;  1PHT A;  2KBT A;  2G6F X;  1J3T A;  2HSP A;  2JT4 A;  1JXO A;  1T0J A;  5L23 A;  1I1J A;  1UUE A;  2E5K A;  2JW4 A;  1U5S A;  4CC2 A;  2ROT A;  1X43 A;  3QWY A;  2FO0 A;  2I0N A;  5EC7 A;  2DF6 A;  1UHC A;  1YCS B;  2BZ8 A;  2XMF A;  1SPK A;  2F2W A;  4RTU A;  2MIO A;  2AKK A;  1UFF A;  2L0A A;  4HVU A;  1VA7 A;  4OMQ A;  1M3C A;  2K79 A;  3VS1 A;  1JU5 C;  1ZX6 A;  3VRY A;  3EG2 A;  3EHQ A;  1G2B A;  2CH4 A;  2VWF A;  5GJV B;  2PNI A;  1N5Z A;  1AD5 A;  1M27 C;  4LE9 A;  4OMO A;  1AVZ C;  2KE9 A;  1OOT A;  2LZ6 B;  1PWT A;  1SHF A;  5HCK A;  3QWX X;  5IHI A;  2B86 A;  3VS3 A;  4OMP A;  2JM9 A;  2C0O A;  2EGE A;  1VYV A;  2KRN A;  1A0N B;  3H0H A;  2RPN A;  2F2X A;  1ABO A;  1Z9Z A;  3PVL A;  1WYX A;  2PZ1 A;  4Z89 A;  1ZLM A;  2QDL A;  4X1V A;  4DEX A;  1K9A A;  4QT7 A;  5ECA A;  1U3O A;  5IXB A;  3VS7 A;  4EIK A;  3RNJ A;  2AZS A;  2J6F A;  1AZG B;  3I9Q A;  5GJW B;  5IXF A;  2ROL A;  2D1X A;  2J6K A;  2ECZ A;  1UTI A;  2GTO A;  4J9H A;  2DL5 A;  2J6O A;  1NM7 A;  3EHR A;  1YWP A;  5FWC A;  2YDL A;  2K2M A;  1OV3 A;  1K76 A;  2A36 A;  2VVK A;  4J9E A;  4ORZ A;  3JV3 A;  3VS0 A;  2YSQ A;  4JZ4 A;  1VYU A;  3NHN A;  1NG2 A;  1PNJ A;  3UAT A;  4RTT A;  1JQQ A;  1PKS A;  2LX7 A;  2A28 A;  1MV3 A;  2CUB A;  4LUE A;  1I0C A;  3M0P A;  1U06 A;  2FRY A;  3REA B;  2EQI A;  2C0I A;  1HJD A;  2DX1 A;  5IHN A;  1XOV A;  1KIK A;  4RTZ A;  2KR3 A;  2LCS A;  2DRM A;  1V1C A;  1QKW A;  2V1R A;  3PE0 A;  2DM1 A;  3U23 A;  1OPK A;  2DYB A;  1JXM A;  1QLY A;  2YUQ A;  1RLQ C;  1K0S A;  3EGU A;  4AG2 C;  1Y0M A;  2RN8 A;  4Y92 A;  4Z88 A;  2DL7 A;  2CSQ A;  3UA7 A;  2LQW A;  2JMC A;  2LMJ A;  1AWX A;  1SRM A;  2JM8 A;  3EG3 A;  2KGT A;  4AFZ C;  2J05 A;  1IO6 A;  1GBQ A;  1VYT A;  1CKB A;  1OEB A;  1UJY A;  2JXB A;  2GQI A;  1UEC A;  2BZY A;  3THK A;  4E6R A;  4D8D A;  1AEY A;  2RQW A;  1GRI A;  1E7O A;  1PRM C;  2KNB B;  2HEQ A;  1QKX A;  1WXT A;  4HCK A;  2JTE A;  1SEM A;  2GTJ A;  2NWM A;  1WI7 A;  2MOX A;  2YT6 A;  1WA7 A;  2RMO A;  1QWE A;  3H41 A;  2X3X D;  2L2P A;  2ABL A;  2FEI A;  1UHF A;  2EGA A;  3M0Q A;  3I5R A;  1WLP B;  2LNH B;  1YWO A;  2EYW A;  4F14 A;  4IIO A;  2JMA A;  3REB B;  2SRC A;  2A08 A;  2X3W D;  2AZV A;  2D8H A;  2C0T A;  1NEG A;  1FYN A;  3NPF A;  2KT8 A;  1TUD A;  1BBZ A;  5I22 A;  3VS6 A;  2ENM A;  2CT4 A;  1UDL A;  2K6D A;  4KRT A;  1GCP A;  1PKT A;  2CRE A;  2EVR A;  1ZUK A;  4CC7 A;  2DMO A;  4IIM A;  1H92 A;  2BZX A;  1S1N A;  2KXC A;  1QCF A;  3PVQ A;  1E6G A;  4CC4 B;  2DL8 A;  1X2K A;  1ZUU A;  2CUD A;  1NLP C;  4J9D A;  1UJ0 A;  1W70 A;  2DRK A;  2EYY A;  1SRL A;  2FPF A;  3C0C A;  4F17 A;  1SHG A;  1UE9 A;  1EFN A;  2YUO A;  1GFC A;  2L3P A;  2O9V A;  2ED0 A;  2EYZ A;  2PTK A;  4RTY A;  1X27 A;  2HDA A;  2AKL A;  2KYM A;  1CKA A;  4JJC A;  4AFQ C;  4J9B A;  1E6H A;  2OJ2 A;  3EG0 A;  4M4Z A;  3R6N A;  3GBQ A;  1K4U S;  1TUC A;  4R0K A;  2DBK A;  1B3Q A;  1HSQ A;  4LNP A;  2KEA A;  2KXD A;  5IHK A;  3CQT A;  3KFV A;  2K7A A;  3H0F A;  3RBB B;  2EBP A;  2D0N A;  1M8M A;  4LN2 A;  2AK5 A;  3VS4 A;  4OML A;  2CSI A;  4D8K A;  1UGV A;  3EG1 A;  3LH5 A;  1KSW A;  3VS5 A;  2F2V A;  2O2O A;  1WIE A;  4F16 A;  3H0I A;  3M0U A;  4WCI A;  4Z8A A;  4RTX A;  2CDT A;  2BTT A;  2FG0 A;  1K0X A;  3I35 A;  2EPD A;  1BK2 A;  2DVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...