1WXTA

Solution structure of the sh3 domain of human hypothetical protein flj21522
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
GSSGSSGLKMQVLYEFEARNPRELTVVQGEKLEVLDHSKRWWLVKNEAGRSGYIPSNILEPLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of human hypothetical protein FLJ21522
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein FLJ21522
total genus 6
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wxtA00
2YUNA 1X43A 1MUZA 1U3OA 4JJDA 1QWEA 2KR3A 4F16A 2DL7A 4RTWA 1WXUA 1T3SA 4RTYA 3ULRB 4J9FA 1EFNA 3RBBB 1YWPA 1GCQC 4X1VA 3VS4A 3GBQA 1JO8A 4J9GA 4RTZA 2K3BA 2CSQA 2KYMA 2CT3A 2ROTA 2JM9A 5IHIA 4LNPA 3TVTA 1NEBA 1WFWA 2EVRA 3FJ5A 1ZUYA 4OMMA 4JJBA 3H41A 1RLQC 1JEGA 2YUOA 3VS0A 2EYXA 5EC7A 2AKLA 2KNBB 4F14A 1GRIA 4HVVA 1VA7A 2A37A 1ZUKA 1K9AA 2I0NA 2BZYA 1Y0MA 3THKA 2AZSA 2JT4A 1M3BA 2RQUA 3EHRA 4OMNA 2GNCA 2DBMA 1WDXA 5GJWB 4J9CA 1A0NB 1BB9A 2LZ6B 1TG0A 2LMJA 2EKHA 4E6RA 2DJQA 1AWXA 2RQRA 3UATA 2J05A 1T3LA 1RI9A 2X3WD 2YUQA 2FEIA 4CC2A 4AFSC 1B07A 1GCQA 1SRLA 2MOXA 1E6HA 2DBKA 1UJ0A 2CDTA 1WI7A 1SHFA 3A98A 4RTTA 1WLPB 2RNAA 1B3QA 3VS7A 4EIKA 1HSQA 3R6NA 4A63B 3M0QA 5IH2A 1X2KA 4Y92A 2HBWA 2DA9A 1NYGA 3M0UA 2ED1A 4K11A 2DILA 1GCPA 3TSWA 4HVUA 2LQNA 2KRNA 2L3SA 5L23A 2OJ2A 2HDAA 2AZVA 4JJCA 1UECA 2B86A 3EG3A 2A28A 1AOJA 2LJ3A 1HD3A 2VWFA 4OMQA 5IHKA 1UGVA 1M27C 1JQQA 2GGRA 2O2OA 2LNHB 3UA7A 1QCFA 1PKSA 1G83A 3M0RA 2VVKA 1J3TA 3LH5A 5I22A 3I35A 1MV0B 4AFUC 1X69A 3H0FA 3JV3A 2DLPA 1U5SA 2YT6A 3I5RA 2O9SA 1H92A 2NWMA 1X2QA 1TUCA 2JM8A 2P4RA 3O5ZA 4RTUA 1GFDA 2JTEA 3NMZC 1RLPC 2FPDA 4RTVA 2CUBA 2K79A 1QKWA 1M8MA 2EW3A 2JW4A 1K0SA 1BK2A 2PZ1A 1ZSGA 3PE0A 2W10A 2M0YA 1SEMA 4RTXA 2BZ8A 2RN8A 2EGEA 3NGPA 1I1JA 3SEMA 1M3AA 2BZXA 1X6BA 4D8DA 1VYVA 2HEQA 5FWCA 2KXDA 3IQLA 2A08A 2NUZA 2PNIA 3VS1A 4LUEA 4DEXA 1OEBA 2L2PA 1SHGA 1E6GA 1OPLA 2J6FA 1YWOA 2QDLA 4R0KA 3VRZA 3UF4A 2GQIA 2EBPA 1KJWA 2RQTA 2KROA 2ESWA 2XMFA 2CSIA 3VS5A 3U23A 2BTTA 2FO0A 3EG2A 4HVWA 4AFZC 2AK5A 4CC3A 3H0IA 1WXTA 2HCKA 3EGUA 1K76A 1FMKA 2DM1A 1PWTA 2YDLA 1OV3A 2ECZA 2KXCA 1LCKA 1BBZA 1BU1A 2KE9A 3QWXX 1W1FA 1TUDA 1KFZA 3KFVA 4D8KA 1MV3A 1YN8A 2KEAA 3SHWA 2YSQA 2F2WA 3I9QA 2YUPA 3EG1A 1KSWA 4CC4B 1I0CA 1W6XA 5IHNA 4OMLA 2DMOA 2DL4A 4DEYA 2O9VA 1UE9A 3VRYA 2RPNA 2RQVA 4J9IA 1VYUA 4Z89A 1UHFA 2RF0A 1AWJA 2LJ1A 2FRWA 2G6FX 3UA6A 2D8HA 1WIEA 2LJ0A 2GTOA 4JZ4A 1UG1A 1JXOA 1AWOA 2ROLA 2DYBA 1M3CA 1AZEA 4CC7A 2L3QA 1OOTA 4FSSA 3PVQA 2EGCA 4KRTA 1PNJA 2CREA 1PHTA 1YP5A 2O88A 1E7OA 1I07A 2F2VA 1IO6A 1PRLC 3EHQA 2SRCA 1PRMC 1YNZA 3RNJA 1UJYA 3ZL7C 2DVJA 2D8JA 2ENMA 2EQIA 4J9EA 4AG1C 2ED0A 1JU5C 1Z9QA 1ABQA 2OI3A 2FPEA 2DE0X 2EYYA 1AZGB 4GLMA 1H3HA 1UFFA 4LE9A 2KYBA 2GTJA 2DL3A 2KT8A 2M51A 4ESRA 2CT4A 4LN2A 2FPFA 1NLOC 1FYNA 2DRMA 2K9GA 4OMOA 1M30A 5HCKA 2IIMA 4JPBW 2CUDA 4IIMA 5FWBA 2A36A 3PVLA 4J9DA 2MCNA 1GBQA 2L0AA 1ZLMA 1H8KA 3TSZA 2LX7A 4LUDA 2W0ZA 2DX1A 1QLYA 1ARKA 2LCSA 1ABOA 2DL5A 2F2XA 1T0JA 4GBQA 4M4ZA 3C0CA 4Z8AA 2J06A 1JXMA 2V1RA 2C0OA 4JZ3A 2H8HA 2JMCA 2K2MA 1SSHA 1G2BA 2SEMA 3EG0A 2JS2A 2EYZA 4RUGA 2VKNA 1WA7A 3M0TA 2DNUA 1X27A 2KT1A 3NHNA 2AKKA 1QWFA 2ABLA 2HSPA 3I5SA 1K4US 3REAB 2DRKA 1V1CA 1GFCA 1YCSB 1KIKA 1AD5A 1NYFA 1WX6A 1WYXA 5IXBA 2D1XA 2EPDA 1CKAA 2L3PA 4Z88A 1QKXA 1Y57A 5I11A 1GL5A 1PKTA 1X6GA 4HCKA 3VS2A 1CSKA 1HJDA 4OMPA 1AWWA 2J6OA 3QWYA 1ZX6A 2KBTA 2J6KA 2LQWA 1Z9ZA 1T0HA 1XOVA 2RQWA 5IXFA 4ZNXA 1NEGA 2KGTA 1CKBA 2KRMA 3M0PA 4F17A 4J9BA 2FG0A 2DF6A 2EGAA 4AG2C 1UDLA 2JS0A 1NM7A 2O31A 1U06A 2LP5A 2OAWA 1K1ZA 4IIOA 2V1QA 5ECAA 2C0TA 2KRSA 2RMOA 1OPKA 1SPKA 1SRMA 1AVZC 1UTIA 2CH4W 2GBQA 1ZUUA 2JMAA 3H0HA 1GBRA 2X3XD 1W70A 2PTKA 3REBB 3CQTA 1UHCA 3NPFA 4AFQC 1NLPC 1K0XA 3VS3A 4QT7A 1RUWA 2E5KA 2J7IA 1NG2A 4WCIA 3M0SA 2EYWA 3VS6A 2D0NA 4HXJA 1ZBJA 2FRYA 2JXBA 2K6DA 1UUEA 2CH4A 1N5ZA 1S1NA 1WXBA 5FW9A 5GJVB 2DL8A 4J9HA 2MIOA 2K7AA 4ORZA 1AEYA 1VYTA 2C0IA
chains in the Genus database with same CATH superfamily
3G7ZA 2RHXA 1X43A 2YUNA 4PNOA 2HBPA 4JJDA 4PFPA 4ZN1A 2KR3A 2DL7A 3OYYA 3OYFA 2GF7A 4RTWA 4OMFB 1T3SA 3ULRB 1N9RA 4A4GA 1GCQC 4X1VA 5D6YA 3VS4A 3GBQA 1VQLT 4J9GA 4RTZA 2E1HA 2K3BA 3S3NA 1OX8A 5KYUB 3AHUA 2CSQA 2ROTA 3TVTA 3OYJA 1NEBA 2X51A 1N8RU 5FU6B 4JJBA 1KQSA 3HTRA 4J7IA 5KYWA 1BI2A 2E12A 2B8AA 5GAN8 4F14A 1VQNQ 4LDUA 3QUIA 2AZSA 3CCUA 1ZHIA 3WVDB 3E9FA 1A0NB 1RI0A 5LJ3e 5GANf 2EKHA 1K73U 1AWXA 2RQRA 3FLGA 2J05A 1P92A 2M16A 2X3WD 2YUQA 4MMKA 3CCLQ 2DPPB 1SRLA 4E7ZA 6AT1B 2MOXA 3A1PA 2DBKA 3OW2S 1WLPB 4IUVA 2IG0A 4UC4A 4FIBA 4DA4A 3CPWS 3GIBA 4BI3A 4Y92A 3UT1A 4EMKC 2DA9A 2HKNA 3QJYA 2QQAA 1NE8A 1YJ9A 4K11A 1ZBXA 1M4ZA 4PJMA 4TVRA 2O01E 1D0XA 3TSWA 1LNXA 1KG1A 3X25B 2DEQA 4IURA 2OTLA 2KRNA 2EQJA 3CMET 2L3SA 2OJ2A 2MF2A 4R55A 3RDVA 2HDAA 4JS5A 5KE3A 4M7DB 1HYOA 1V76A 1K9MU 2OTJA 2B86A 4BDZA 2A28A 1AOJA 3QDFA 4C8QG 2VWFA 1M27C 1EX4A 1VQMQ 1G83A 5I22A 2PVGB 3V8JA 2P4TA 1MV0B 4M78A 1X69A 2QQRA 3H0FA 1HK9A 2RM4A 1YITT 2YWWA 3I5RA 5I2MA 2NWMA 4JS4A 4C92A 5FROA 2QQBA 4M77E 2QASA 2DTIA 3L2VA 1OQKA 3MEVA 1I5OB 3PE0A 1W2BP 2W10A 3VV0A 2RN8A 3CC2T 5HK3A 4ZGDB 2BZXA 4XTYA 4O5VA 2O4XA 5GAOr 2XDBA 2LTOA 2YRVA 2KY9A 5FWCA 2HKQB 3SB2A 2D9TA 2KXDA 4JRIA 2CP3A 4M75E 4F7UB 4OB1B 5CKEA 3VS1A 1R0BG 3CCUT 4LDWA 4QKUA 4M78C 1E6GA 3JB9D 1YFNA 2E6NA 3UF4A 1YJWT 3M4GA 2EBPA 1KJWA 2GQIA 2LCCA 4Y28E 3LWIA 2JJ9A 4N4GA 4BY6B 2F5KA 2LT4A 3FEOA 3U23A 2BTTA 3G4SA 2ATCB 3CCJA 2K2VA 5LJ5e 1UB4A 4XU2A 2RO0A 2FZGB 1OZ2A 4LDVA 1QCOA 1PWTA 4PFZA 4MDWA 1LCKA 3M56A 2BE9B 4J5YA 3G71Q 2CP5A 1MGQA 3KFVA 4D8KA 3HPWA 2KEAA 2RJDA 2CYZB 3CBOA 3EG1A 1Q81R 4RG8A 3HL8A 5IHNA 4OMLA 2DK3A 4E47A 2DMOA 4E7KA 3H9NA 9ATCB 3C4SA 3EFSA 4C5GA 2RA2A 2FB7A 3VRYA 4M77D 1VQLA 4GLKA 5HK0A 4Z89A 1N8RC 1VQ6A 1RAFB 4IKFA 3CBPA 1M1KU 1KQ1A 4J8OA 1DJ7B 4BDYA 2XI9A 1FMVA 3URGA 3CC7T 3PTAA 1PD1A 2EJFA 2LJ0A 2GTOA 3HSBA 3S3MA 4E7IA 1JXOA 4J6WA 1M3CA 4M7DD 3CCMQ 2L3QA 1FXXA 3OY9A 4ZTFA 4M78B 3EGDA 2JNGA 1MMAA 3CXCS 4DBRA 1BCMA 2DTOA 2DXUA 2L8DA 3P8HA 1QP3A 1I07A 1Y7XA 1IO6A 5LJ3j 5DLQE 5KYWB 3F70A 1PRMC 1TU0B 5GAMj 2Y4YA 1UJYA 4KBMB 2KAFA 2ED0A 1TH7A 3RR6A 3CMAQ 5CKHA 2OI3A 1ZQ1A 5HKCA 2FPEA 2DE0X 2QA4A 2KYBA 3CCJQ 2GFAA 5CK9A 4E7SA 1IXDA 2CP0A 5CAIA 4OMOA 5HCKA 4BI8B 5C0MA 5FWBA 5CKDA 4IIMA 3QDRB 2A36A 2K3YA 4PJOC 1ZLMA 4M75A 3OBWA 4DBHA 2DX1A 1ZSZC 4OB0B 4MDXA 3C0CA 2C0OA 4JZ3A 1WHHA 2HMAA 3CXCA 5GMKe 5M9OA 3X24B 4LD6A 4M7AD 1SSHA 3OMGA 2ZAEA 4C8QA 3G4ST 4FW1A 2SEMA 1KQSP 2JS2A 2EYZA 4Q5WA 4EMGA 3CCLA 1WA7A 4OVAA 4BUGA 3PGGA 3EGXA 3MEAA 4XTXA 1QWFA 2ABLA 3I5SA 3I56Q 1WPYA 3CCQA 1VQMT 5CKBA 1LVKA 2L3PA 3V8KA 1Y57A 3RERA 3G6EQ 1GL5A 1PKTA 1X6GA 1CSKA 3PFSA 3X26B 4P5NA 4A4KA 2K5FA 2DETA 2VGNA 3QWYA 2QEXT 2DYIA 1Q7YR 2KBTA 3L2ZA 1RAIB 1QVFP 3ZFJA 3OS1A 2RD1A 2VYTA 2RQWA 4N0AA 3GF5A 4M75C 2EJGA 3BE3A 2KGTA 1CKBA 3CCST 1PCXA 1WQ7A 5I2SA 1UDLA 4PJOD 3MHXA 4IIOA 1TTHB 1VQ4Q 5GAN7 5ECAA 3EAEA 5FU6C 2QQ9A 1SRMA 3OYAA 4VUBA 2CS7A 1ZUUA 1Q82R 2LRQA 4PLLA 3REBB 3CQTA 4F04B 3JCMQ 2V26A 3VS3A 4QT7A 4BY6C 4M7DA 2WSCE 4OP0A 4BB7A 4KH1B 5FU7C 1KC8C 5KH6A 1M90C 4WCIA 1G3YA 3V7SA 1M90U 1WJSA 4M75F 2D0NA 1YCYA 2FRYA 2JXBA 2LX9A 2K6DA 1UUEA 1D3BA 2CH4A 3MCAB 5FW9A 5AT1B 3RIRA 4M7AF 5GJVB 1QP2A 3A8HB 2MIOA 1B34A 4ORZA 1AEYA 1VYTA 4C8QC 4F16A 5GAMd 4FW2A 5I21A 1VQNT 1PSFA 3CCRA 4RTYA 4C8QE 3HFOA 1EFNA 3RBBB 1SSFA 1YWPA 1JO8A 2V8JA 2LNVA 2KYMA 5IHIA 4LNPA 2Y90A 4MZMA 1ZUYA 4OMMA 2M0OA 3H41A 1RLQC 1JEGA 2HZYA 3MJXA 3VS0A 5EC7A 3PIPA 3G6EA 1TSFA 2E3IA 2KSSA 4FM4B 4PJOF 1YJ9Q 1VA7A 3TCJA 1OZ3A 1KQ2A 1K9AA 2I0NA 2EFIA 1VQ5A 2X35A 3META 1M3BA 4NL2A 1QCNA 5GJWB 1BB9A 2RJFA 4XK8E 2VXFA 3VKIA 2ZCFB 1AT1B 4FSXA 2OTJQ 4CC2A 1YITQ 3RKXA 1VQ4A 4QVCA 1UJ0A 3OYCA 1VQMA 4RTTA 2VXEA 1Q81U 2DVEA 1OU8A 5GAN4 2RNAA 1Q7YC 4M7DG 1B3QA 2PVDB 3L2QA 1BIBA 4JLGA 3C12A 4II1A 2IPOB 2HBWA 1NYGA 3OW2A 3M0UA 1K8AC 2O4XB 1U1TA 2DILA 1BKBA 1IRXA 1GCPA 1VQKA 5GANj 2F1LA 5GAMh 4M7AC 3PMIA 3CC2A 3HFNA 1VQ4T 4YTLA 3CCJT 3OYGA 3JCMX 2AZVA 2FL7A 1UECA 3MP8A 1Q82C 2LJ3A 4OMQA 4EDUA 1UGVA 2K4YA 1YI2T 2DAQA 2MPXC 3UA7A 5GAOp 1PKSA 2M9UA 2CZ6B 4PLIA 3BY7A 2F5TX 2DLPA 1U5SA 3E2UA 1WJQA 1Q86C 2YT6A 2XDPA 5DY9A 3JCMc 1HXDA 4ZGJB 2XU8A 4NL3A 5GANh 4M7DE 2BUDA 4XTWA 5KYNA 1X2QA 3SDZA 3SWNC 4RTUA 2BIVA 3JCMe 2JTEA 2QA4Q 2COZA 1YIJT 3OBYA 3GNGA 5GAOn 1RLPC 4RTVA 3L1AA 1QKWA 1FX7A 4O6JA 1K0SA 2QK0A 2PZ1A 4HT9A 5CIUA 1TOVA 1SEMA 2JUFA 3VU3C 2BZ8A 2EGEA 3NGPA 3CC4A 1I1JA 1MNDA 4LXCA 1M3AA 1PSEA 5J26A 5D7UA 2P84A 1VYVA 2FHDA 5KYXB 2HEQA 3G71A 3DLLA 1W4SA 4OGCA 4PJLA 2HL5C 3IQLA 2A08A 2NUZA 2PNIA 1SG5A 4LUEA 2JTMA 4FYVB 2L2PA 3LGLA 1YWOA 5GAOq 3OS2A 2HAXA 3JCMh 2XMFA 3QKJA 4J6XA 2CSIA 1VQ9Q 2E6ZA 5GANe 4X9CA 1VIFA 3EG2A 4HVWA 5CQYA 3OYHA 4AFZC 4CC3A 1M8VA 4ELYC 1WXTA 1D09B 1VIEA 1K76A 2DM1A 3EFRA 2VGMA 2V8IA 2ECZA 1BU1A 2KE9A 1VQKQ 3S3OA 3KUFA 1I5LA 3A8OB 1YN8A 3N5BB 3OYMA 3FJPA 1YBYA 1D1AA 3SHWA 3I9QA 2YUPA 1M1KR 1Q82U 3J81E 2LQ8A 1I0CA 4FCYA 5GANd 5KYUA 3CCEQ 1JBMA 3QG1A 4ELZC 4MMLA 1WHMA 7AT1B 1M9SA 2O9VA 1UE9A 2HQEA 1WNLA 2RQVA 4J9IA 1VQ8Q 4C8QB 1BIAA 1LOJA 1JB0E 5AYFA 5GAN6 2E10A 2CGHA 5HY6A 2FRWA 1PC0A 3UA6A 2BKDN 1VQPT 4XTZA 1WIEA 2QAZA 1JJ2P 5GMKi 3EG9B 4JZ4A 1XNIA 1RAEB 4M75B 4F7UE 2DYBA 1W2BS 2YRDA 1AZEA 3CMAA 1IHVA 3PVQA 2XIDA 3OYIA 2EGCA 4DOWA 4KRTA 4M7AB 1IZ6A 1S72Q 4C0DB 2O88A 4DQ2A 1RACB 1NZ9A 2XKOC 3OYEA 1E7OA 2HSEB 3V7CA 3FC3A 3LYIA 2SRCA 3J7AF 3RNJA 2FZCB 2EQIA 1G5VA 2XICA 1MMNA 3RMSA 1Z9QA 2DD4A 2RHIA 1ABQA 1IHWA 3CD6T 3FIFA 1UFFA 3E9GA 2KT8A 2CT4A 3JRZA 3WVEB 1NLOC 1WHJA 3JCMJ 3O8VA 1WQWA 4PJOB 1Q86U 2DTHA 4FYWB 3CCQQ 2ZPIB 2VUBA 2D0QB 3M54A 2LX7A 1ARKA 1H3ZA 2LCSA 1M2OA 2DL5A 5C6SA 1T0JA 4PKCC 4LD9K 1QVFS 4PK4A 1VQ6T 2PVOB 3M5AA 3KXTA 1ACMB 5CO7A 4M78E 1PM3A 2DNUA 2RHYA 1X27A 2KT1A 1K9MR 2HSPA 3HRUA 3QSUA 2BE7D 2ZPFB 5GAMe 1GFCA 1M5Q1 1KIKA 1AD5A 1WYXA 2CKKA 2D1XA 2EPDA 1CKAA 4WF2A 1IREB 2QA4T 1YIJQ 1KD1U 5I11A 1KQSS 1R8OB 4C0DC 2H3EB 1Q7YU 2QYZA 2EYQA 2DXCA 1QVGS 2J6OA 3QHSA 1S72A 2J6KA 2LQWA 3SWNB 5KYYB 2KRMA 4F17A 3PT9A 4JRPA 2R57A 1XTDA 3A5ZB 1YJWQ 4L59A 3JCMW 2DKGA 1YHQQ 3QBYA 3EH1A 5CQXA 2K5LA 2OAWA 1M1GA 2V1QA 4XTVA 2C0TA 1D0ZA 2H3JA 2CH4W 5LJ3d 3GP8A 2E3HA 3VYHB 2GBQA 2JMAA 1W70A 2EKOA 2X4YA 2P0PA 3CMAT 3BDLA 1NLPC 1S72T 1K0XA 1R0CB 4KULA 5GMKl 2NLUA 1Q86R 2M02A 2CZ0B 5KCHA 4A4HA 4RKUE 1VQPQ 4A53A 1I8FA 4EMHA 2COYA 2PQWA 3CC4Q 2YLBA 4J9HA 1N6AA 3DB3A 3CMEQ 4M75G 2C0IA 1Q95G 1MUZA 2KMTA 3CCSA 1QWEA 3NTIA 1GXIE 3CCET 3EG9A 4IUPA 1WXUA 4C5HA 4KT0E 4RCBA 4J9FA 1FWZA 1FMWA 4Y91A 3JCMV 4KGZB 2LT1A 4IUTA 2QGFB 2QG9B 3TREA 2E64A 2JM9A 1WFWA 2K5IA 2EVRA 2RHUA 2X4XA 4AMCA 1NJIU 3LWHA 3FJ5A 5EG2A 1N27A 2YUOA 2EYXA 4C0FA 2AKLA 4FU6A 5FLXE 2A37A 1ZUKA 4FT2A 2BZYA 4DOVA 2RJCA 2RQUA 3EHRA 1YI2Q 4OMNA 4M77G 1WDXA 4E2FB 3I56T 3PNWC 4PFOA 1NBEB 2LZ6B 2LMJA 3A8GB 2YHTA 2FZKB 2DJQA 3UATA 4E6RA 2DIGA 3MP6A 1RAGB 1B07A 3T9NA 5CKFA 3CC4T 1E6HA 4E7HA 2CDTA 1WI7A 3A98A 3SWNA 2DIQA 3JB9H 4HCBA 1VQNA 4C5IA 4EIKA 1SF9A 4A63B 2DEUA 2AIRB 1YJNT 2ED1A 1BCOA 3MEWA 4MZTA 2KK4A 4F7UF 2ZGWA 2LQNA 1X75C 3P8BB 1QMCA 1SKUB 1VQPA 5L23A 3OYLA 3AT1B 4OB3B 5J39A 2WACA 3MPUB 4E7JA 3E19A 4PJOA 5IHKA 5KYYA 3CMEA 1JJ2A 1JQQA 2GGRA 2LNHB 1G8XA 4B6MA 3M0RA 5GAN5 3LH5A 2LQKA 4JDSA 1KK7A 1IGQA 4AFUC 2NUTB 3JV3A 3M58A 2DZ9A 3EH2A 2O9SA 4J6YA 5FRMA 3TU4K 1TUCA 2P4RA 3G6ET 2CZ1B 1QVPA 1GFDA 1ZSZA 2JZ2A 2MAMA 2HQHA 3QO3A 2E65A 2DJZA 2FPDA 2CUBA 2K79A 1ZSGA 1UGSB 2MYSA 4AT1B 5LJ5d 1U8RA 4RTXA 4ZN3A 2EAYA 3RUXA 1JJ2S 3KBGA 2QTVA 3HHTB 4D8DA 5LJ5g 1VQKT 4M7AG 3ASKA 1M1KC 4IUQA 2DXBA 3J80E 3QYHB 4DEXA 4JUVA 1ZA2B 1SHGA 1RAHB 5GAMf 1OPLA 2J6FA 2QDLA 4R0KA 5A0LA 1YJNQ 5DM7R 4C0GA 4M7DF 1MHNA 3LW5E 3X28B 3DKMA 3VS5A 4KGVB 4M78F 1WJRA 1VQ7Q 1VQ8A 3GOXA 2AK5A 3H0IA 2M1HA 1MMDA 3I55T 1UGRB 2L5QA 3OSVA 2ZPEB 2YDLA 1OV3A 2KXCA 1BBZA 4PJNA 3QWXX 1VQ6Q 1B7TA 4JJNK 2VASA 1MV3A 4PJOG 3OYKA 4ANJA 4C92G 3C95A 4KUDK 2F2WA 5GAMg 1KSWA 4CC4B 1I81A 2K57A 1K9MC 1W6XA 2DL4A 4N4HA 3UWNA 3MO8A 4BE1A 2P0QA 4M77C 2E5QA 4A4FA 2X9HA 5LJ3f 1B34B 2FYKA 3RMQA 2RF0A 2JN0A 1AWJA 2ZPBB 3CCVT 3QZ9B 1K8AU 4QQGA 1KHCA 2D8HA 3NFCA 2MK5A 3CC7Q 2FVUA 4GY5A 4CC7A 1OOTA 2GQVA 2P0KA 1AHJB 2Y4XA 2CREA 4M75D 3JB9F 1PHTA 4E7LA 5D6XA 2EJ9A 1YP5A 3Q1JA 3CEYA 1V29B 2GCXA 1D0YA 2F2VA 3TQ7P 5FRNA 4BD3A 4A54A 5GAOl 2NYSA 3OS0A 1YNZA 3GNFB 3ZL7C 2DVJA 3M55A 2ENMA 4J9EA 3HRSA 4AG1C 3QZ5B 1Y71A 1G3WA 4M77A 1JU5C 5A0GA 4F7UA 4C5EA 4GLMA 4LE9A 1NJIC 3EFOA 3CBMA 1RL2A 1RAAB 4HCZA 4C92B 4ESRA 3OYDA 4LN2A 2K3XA 1TS9A 3S6WA 2QDYB 2EQKA 2ZZDA 3ER0A 2L89A 1FYNA 2DRMA 2K9GA 1M30A 2IIMA 3L2WA 3MP1A 1C1AA 4J9DA 5CCAA 2L0AA 1MNEA 3I56A 3CPWP 4EMKB 4LUDA 2W0ZA 4NS5A 4QQ6A 3M9QA 1XJWB 2HL3A 1ABOA 4M4ZA 1R77A 4PL6A 4M7AA 2CP2A 1LPLA 3QXEB 2RK2A 4C0ZA 3OSSC 2J06A 5KYXA 2V1RA 5LJ3g 3JCMP 1F1BB 2K2MA 3FB9A 3VYGA 2AHJB 3EG0A 4RUGA 2F69A 1KD1C 2VKNA 5CVIA 2KI7A 1K4US 3REAB 3CCMT 1V1CA 2R5MA 1KC8U 1NYFA 2OX7A 5IXBA 1K73R 3GLXA 1VQOT 4X9DA 4Z88A 4XU0A 2LC4A 1QKXA 4XU3A 2QEXQ 4HCKA 5FU7B 3VS2A 4QVZA 3VUZA 8ATCB 2ZPGB 1M1FA 2E70A 1AWWA 5A0DA 2RB6A 1M90R 2QGGA 5J3BA 4HCCA 3V7RA 5CR2A 1Z9ZA 1O75A 1T0HA 1NEGA 2E41A 3M0PA 2FG0A 5GAOm 3OYBA 2EGAA 3E1SA 2JS0A 2O31A 4C92C 1U06A 5LJ3h 2LP5A 1K1ZA 3CD6A 1WHGA 1VOMA 2RMOA 1OPKA 1AVZC 1UTIA 2MI6A 3PMTA 4XAXB 2NUPA 2R58A 3H0HA 1QVGP 4R56A 1UHCA 2C06A 1N9SA 3ME9A 1RUWA 2OTLT 1VQOA 1VQ7T 4OB2B 2J7IA 5LJ5j 1NG2A 1C6VX 3LLRA 4ME7A 3M0SA 2EYWA 3CCRQ 3ZEHA 4HXJA 1ZBJA 2RHZA 2XHCA 4FYXB 2DL8A 4EPCA 2VB6A 4IUUA 2PUKB 1RABB 2YRCA 1MMGA 4CI0C 1D1CA 3V8LA 4M78D 3CXCP 1U3OA 4XU1A 4BI4A 4RMOA 1ZA1B 2RJEA 2R5AA 1W2BA 3SD4A 3HRTA 1Y07A 4J7FA 1KC8R 1WZOA 3CCQT 2YLCA 3EGDB 4M77B 3QJ6A 2CT3A 3JB9J 1UGQB 1K8AR 4HT8A 4XQ3A 4C92D 2EIFA 2HQXA 3HP9A 3GPLA 2KNBB 1NPPA 1GRIA 4HVVA 1QQJA 5GMKm 2XDDA 3JCMf 4WTOB 1Y0MA 3THKA 2JT4A 2GNCA 2DBMA 3G1JA 1NPRA 2NUTA 2A3LA 4J9CA 3CCVQ 1TG0A 3LGFA 2CZ7B 1G3SA 3I55A 5IAYA 2PU9B 4KH0B 1T3LA 1RI9A 2V8KA 2XD0A 4HKEA 3JCMb 2FEIA 4AFSC 4OGEA 3CD6Q 1GCQA 2PUOB 1WGSA 1SHFA 1YJWA 3JAME 3JSCA 3VS7A 1NJIR 1YHQA 1HSQA 4BE0A 1JRIA 3R6NA 3M0QA 2DFUA 5IH2A 1YJ9T 1X2KA 1IGUA 4JRKA 2E4HA 3A8LB 4F7UG 8AT1B 1BI0A 4N4IA 3CC7A 2DERA 2HD0A 3L42A 2KDSA 4HVUA 1H641 4FYYB 2OTJT 2VC8A 3OQ5A 4V2SA 5L8RE 3JCMg 4ZTJA 2DD5A 4JJCA 1X01A 3EG3A 3VUBA 1VUBA 1HD3A 1BI3A 5KE2A 3RKWA 2O2OA 4FL6A 4M7DC 1QCFA 4NOYA 2VVKA 1J3TA 2DO3A 3NTHA 1OYXA 3I35A 3UPUA 3PIOA 3A8MB 1VQ5T 1H92A 5IN1A 2MMPA 1LJOA 2JM8A 3O5ZA 4C92F 2QQSA 1BI1A 3NMZC 2JOYA 1PG5B 4DBQA 1M8MA 2EW3A 2JW4A 3JB9I 1BK2A 3INZA 2A7YA 4X34A 3FRNA 2M0YA 3BFMA 4JRQA 1VQ7A 3SEMA 2QEXA 3P8DA 3ZBDA 1X6BA 3QYGB 1D1BA 4B9XA 3C94A 3NTKA 4PJJA 1OEBA 3I55Q 2A0FB 2QI2A 3VRZA 2RI5A 2Z0WA 3M4YA 1QVFA 2RQTA 3TEEA 2KROA 2ESWA 1YI2A 2KQWA 3R6OA 2FO0A 1WHKA 3CPWA 1N8RR 4L6V5 1OX9A 2HCKA 3EGUA 3LH0A 2ZPHB 5GAN3 1FMKA 1TWBA 1VQ8T 4QQDA 2DXTA 3OS5A 4QW2A 2X4JA 1ZSZB 1VQOQ 3M59A 1W1FA 1TUDA 1KFZA 5LL6S 3CCRT 1K73C 3RKYA 2L3RA 1UGPB 3EGXB 2I2LA 3RESA 4XTUA 2YSQA 1KD1R 4FT4A 4OF1A 1OU9A 3UDCA 1X6OA 1XQHA 3G4SQ 1G3TA 4L5GA 3DB4A 3SFMA 4DEYA 4BACA 1RADB 1M2VB 2LCLA 2RPNA 1M2VA 3OYNA 2IVWA 1VYUA 4HA8A 1UHFA 2RK1A 2WSFE 2LJ1A 1VQ5Q 2G6FX 1KHIA 4ATOA 1UG1A 5DLOA 3CCSQ 1AWOA 2ROLA 1C0MA 4EMKA 3CCEA 4FSSA 4ZGEB 3FDRA 2WSEE 2AT1B 4BE2A 2OTLQ 1PNJA 1YITA 2RH2A 3CCUQ 4M78G 4J83A 1O9SA 2GFUA 1Y96A 3G71T 1OULA 1PRLC 1TUGB 1U1SA 3EHQA 1QW1A 1VQLQ 4LDXA 4M7AE 5IT9E 2LVMA 2D8JA 3CCVA 4B9WA 3MEUA 4C8QD 2JTFA 5A2QE 3HKSA 4M77F 3DLMA 3M53A 1UEBA 2CP6A 3BW1A 3CCMA 2EYYA 1AZGB 2D6FA 1H3HA 1PD0A 1YJNA 2GTJA 2YXYA 2DL3A 2M51A 3QPHA 2QTXA 2EQMA 2FPFA 4C8QF 3H6ZA 5LJ5f 5GMKj 2QXFA 4JPBW 2CUDA 3PVLA 5D6WA 1TXQA 2MCNA 1GBQA 1H8KA 3TSZA 4QVDA 1D3BB 3JCMd 1QLYA 4KGXB 2F2XA 4GBQA 3BDUA 4Z8AA 3OA6A 3OW2P 4RG2A 1WHLA 1JXMA 2X4WA 1YIJA 4PJOE 2H8HA 1Y96B 4DBFA 2JMCA 2NUPB 1G2BA 2RI2A 2RI3A 3M0TA 2JVVA 2XG8D 3NHNA 2AKKA 4JLIA 1YHQT 2DRKA 2EQUA 3L2UA 1YCSB 3JB9G 1VQ9T 1WX6A 2HNIA 3QIIA 5KCOA 1Q81C 1HJDA 1BYMA 4LDYA 4OMPA 4MZPA 2VV5A 2MWOA 1ZX6A 2COWA 1XOVA 5IXFA 4ZNXA 1VQ9A 3CPFA 3OMCA 4J9BA 2DF6A 4AG2C 1NM7A 3M57A 4Z02A 3VJPA 4KUIA 4CRIA 1EZZB 2KRSA 5LJ5h 3X20B 3D7SB 3OB9A 1SPKA 1QVGA 1IB8A 2LDMA 1GBRA 2X3XD 2PTKA 2EWNA 4D6WA 3NPFA 1EIFA 4AFQC 3CC2Q 1OI1A 5GAN2 2E5KA 2MWPA 4C92E 2KVQG 5GMKh 3LX7A 2XK0A 3VS6A 4RCCA 2DZCA 5GANg 2G3RA 3L2RA 1N5ZA 1S1NA 1WXBA 3CCLT 3MKDA 4A4EA 3EFOB 2K7AA 2OAUA 4N0AC 3H8ZA 1I4K1 2CP7A 3WXMB
chains in the Genus database with same CATH topology
2YUNA 1X43A 1MUZA 1U3OA 4JJDA 1QWEA 2KR3A 4F16A 2DL7A 4RTWA 1WXUA 1T3SA 4RTYA 3ULRB 4J9FA 1EFNA 3RBBB 1YWPA 1GCQC 4X1VA 3VS4A 3GBQA 1JO8A 4J9GA 4RTZA 2K3BA 2CSQA 2KYMA 2CT3A 2ROTA 2JM9A 5IHIA 4LNPA 3TVTA 1NEBA 1WFWA 2EVRA 3FJ5A 1ZUYA 4OMMA 4JJBA 3H41A 1RLQC 1JEGA 2YUOA 3VS0A 2EYXA 5EC7A 2AKLA 2KNBB 4F14A 1GRIA 4HVVA 1VA7A 2A37A 1ZUKA 1K9AA 2I0NA 2BZYA 1Y0MA 3THKA 2AZSA 2JT4A 1M3BA 2RQUA 3EHRA 4OMNA 2GNCA 2DBMA 1WDXA 5GJWB 4J9CA 1A0NB 1BB9A 2LZ6B 1TG0A 2LMJA 2EKHA 4E6RA 2DJQA 1AWXA 2RQRA 3UATA 2J05A 1T3LA 1RI9A 2X3WD 2YUQA 2FEIA 4CC2A 4AFSC 1B07A 1GCQA 1SRLA 2MOXA 1E6HA 2DBKA 1UJ0A 2CDTA 1WI7A 1SHFA 3A98A 4RTTA 1WLPB 2RNAA 1B3QA 3VS7A 4EIKA 1HSQA 3R6NA 4A63B 3M0QA 5IH2A 1X2KA 4Y92A 2HBWA 2DA9A 1NYGA 3M0UA 2ED1A 4K11A 2DILA 1GCPA 3TSWA 4HVUA 2LQNA 2KRNA 2L3SA 5L23A 2OJ2A 2HDAA 2AZVA 4JJCA 1UECA 2B86A 3EG3A 2A28A 1AOJA 2LJ3A 1HD3A 2VWFA 4OMQA 5IHKA 1UGVA 1M27C 1JQQA 2GGRA 2O2OA 2LNHB 3UA7A 1QCFA 1PKSA 1G83A 3M0RA 2VVKA 1J3TA 3LH5A 5I22A 3I35A 1MV0B 4AFUC 1X69A 3H0FA 3JV3A 2DLPA 1U5SA 2YT6A 3I5RA 2O9SA 1H92A 2NWMA 1X2QA 1TUCA 2JM8A 2P4RA 3O5ZA 4RTUA 1GFDA 2JTEA 3NMZC 1RLPC 2FPDA 4RTVA 2CUBA 2K79A 1QKWA 1M8MA 2EW3A 2JW4A 1K0SA 1BK2A 2PZ1A 1ZSGA 3PE0A 2W10A 2M0YA 1SEMA 4RTXA 2BZ8A 2RN8A 2EGEA 3NGPA 1I1JA 3SEMA 1M3AA 2BZXA 1X6BA 4D8DA 1VYVA 2HEQA 5FWCA 2KXDA 3IQLA 2A08A 2NUZA 2PNIA 3VS1A 4LUEA 4DEXA 1OEBA 2L2PA 1SHGA 1E6GA 1OPLA 2J6FA 1YWOA 2QDLA 4R0KA 3VRZA 3UF4A 2GQIA 2EBPA 1KJWA 2RQTA 2KROA 2ESWA 2XMFA 2CSIA 3VS5A 3U23A 2BTTA 2FO0A 3EG2A 4HVWA 4AFZC 2AK5A 4CC3A 3H0IA 1WXTA 2HCKA 3EGUA 1K76A 1FMKA 2DM1A 1PWTA 2YDLA 1OV3A 2ECZA 2KXCA 1LCKA 1BBZA 1BU1A 2KE9A 3QWXX 1W1FA 1TUDA 1KFZA 3KFVA 4D8KA 1MV3A 1YN8A 2KEAA 3SHWA 2YSQA 2F2WA 3I9QA 2YUPA 3EG1A 1KSWA 4CC4B 1I0CA 1W6XA 5IHNA 4OMLA 2DMOA 2DL4A 4DEYA 2O9VA 1UE9A 3VRYA 2RPNA 2RQVA 4J9IA 1VYUA 4Z89A 1UHFA 2RF0A 1AWJA 2LJ1A 2FRWA 2G6FX 3UA6A 2D8HA 1WIEA 2LJ0A 2GTOA 4JZ4A 1UG1A 1JXOA 1AWOA 2ROLA 2DYBA 1M3CA 1AZEA 4CC7A 2L3QA 1OOTA 4FSSA 3PVQA 2EGCA 4KRTA 1PNJA 2CREA 1PHTA 1YP5A 2O88A 1E7OA 1I07A 2F2VA 1IO6A 1PRLC 3EHQA 2SRCA 1PRMC 1YNZA 3RNJA 1UJYA 3ZL7C 2DVJA 2D8JA 2ENMA 2EQIA 4J9EA 4AG1C 2ED0A 1JU5C 1Z9QA 1ABQA 2OI3A 2FPEA 2DE0X 2EYYA 1AZGB 4GLMA 1H3HA 1UFFA 4LE9A 2KYBA 2GTJA 2DL3A 2KT8A 2M51A 4ESRA 2CT4A 4LN2A 2FPFA 1NLOC 1FYNA 2DRMA 2K9GA 4OMOA 1M30A 5HCKA 2IIMA 4JPBW 2CUDA 4IIMA 5FWBA 2A36A 3PVLA 4J9DA 2MCNA 1GBQA 2L0AA 1ZLMA 1H8KA 3TSZA 2LX7A 4LUDA 2W0ZA 2DX1A 1QLYA 1ARKA 2LCSA 1ABOA 2DL5A 2F2XA 1T0JA 4GBQA 4M4ZA 3C0CA 4Z8AA 2J06A 1JXMA 2V1RA 2C0OA 4JZ3A 2H8HA 2JMCA 2K2MA 1SSHA 1G2BA 2SEMA 3EG0A 2JS2A 2EYZA 4RUGA 2VKNA 1WA7A 3M0TA 2DNUA 1X27A 2KT1A 3NHNA 2AKKA 1QWFA 2ABLA 2HSPA 3I5SA 1K4US 3REAB 2DRKA 1V1CA 1GFCA 1YCSB 1KIKA 1AD5A 1NYFA 1WX6A 1WYXA 5IXBA 2D1XA 2EPDA 1CKAA 2L3PA 4Z88A 1QKXA 1Y57A 5I11A 1GL5A 1PKTA 1X6GA 4HCKA 3VS2A 1CSKA 1HJDA 4OMPA 1AWWA 2J6OA 3QWYA 1ZX6A 2KBTA 2J6KA 2LQWA 1Z9ZA 1T0HA 1XOVA 2RQWA 5IXFA 4ZNXA 1NEGA 2KGTA 1CKBA 2KRMA 3M0PA 4F17A 4J9BA 2FG0A 2DF6A 2EGAA 4AG2C 1UDLA 2JS0A 1NM7A 2O31A 1U06A 2LP5A 2OAWA 1K1ZA 4IIOA 2V1QA 5ECAA 2C0TA 2KRSA 2RMOA 1OPKA 1SPKA 1SRMA 1AVZC 1UTIA 2CH4W 2GBQA 1ZUUA 2JMAA 3H0HA 1GBRA 2X3XD 1W70A 2PTKA 3REBB 3CQTA 1UHCA 3NPFA 4AFQC 1NLPC 1K0XA 3VS3A 4QT7A 1RUWA 2E5KA 2J7IA 1NG2A 4WCIA 3M0SA 2EYWA 3VS6A 2D0NA 4HXJA 1ZBJA 2FRYA 2JXBA 2K6DA 1UUEA 2CH4A 1N5ZA 1S1NA 1WXBA 5FW9A 5GJVB 2DL8A 4J9HA 2MIOA 2K7AA 4ORZA 1AEYA 1VYTA 2C0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUN A;  1X43 A;  1MUZ A;  1U3O A;  4JJD A;  1QWE A;  2KR3 A;  4F16 A;  2DL7 A;  4RTW A;  1WXU A;  1T3S A;  4RTY A;  3ULR B;  4J9F A;  1EFN A;  3RBB B;  1YWP A;  1GCQ C;  4X1V A;  3VS4 A;  3GBQ A;  1JO8 A;  4J9G A;  4RTZ A;  2K3B A;  2CSQ A;  2KYM A;  2CT3 A;  2ROT A;  2JM9 A;  5IHI A;  4LNP A;  3TVT A;  1NEB A;  1WFW A;  2EVR A;  3FJ5 A;  1ZUY A;  4OMM A;  4JJB A;  3H41 A;  1RLQ C;  1JEG A;  2YUO A;  3VS0 A;  2EYX A;  5EC7 A;  2AKL A;  2KNB B;  4F14 A;  1GRI A;  4HVV A;  1VA7 A;  2A37 A;  1ZUK A;  1K9A A;  2I0N A;  2BZY A;  1Y0M A;  3THK A;  2AZS A;  2JT4 A;  1M3B A;  2RQU A;  3EHR A;  4OMN A;  2GNC A;  2DBM A;  1WDX A;  5GJW B;  4J9C A;  1A0N B;  1BB9 A;  2LZ6 B;  1TG0 A;  2LMJ A;  2EKH A;  4E6R A;  2DJQ A;  1AWX A;  2RQR A;  3UAT A;  2J05 A;  1T3L A;  1RI9 A;  2X3W D;  2YUQ A;  2FEI A;  4CC2 A;  4AFS C;  1B07 A;  1GCQ A;  1SRL A;  2MOX A;  1E6H A;  2DBK A;  1UJ0 A;  2CDT A;  1WI7 A;  1SHF A;  3A98 A;  4RTT A;  1WLP B;  2RNA A;  1B3Q A;  3VS7 A;  4EIK A;  1HSQ A;  3R6N A;  4A63 B;  3M0Q A;  5IH2 A;  1X2K A;  4Y92 A;  2HBW A;  2DA9 A;  1NYG A;  3M0U A;  2ED1 A;  4K11 A;  2DIL A;  1GCP A;  3TSW A;  4HVU A;  2LQN A;  2KRN A;  2L3S A;  5L23 A;  2OJ2 A;  2HDA A;  2AZV A;  4JJC A;  1UEC A;  2B86 A;  3EG3 A;  2A28 A;  1AOJ A;  2LJ3 A;  1HD3 A;  2VWF A;  4OMQ A;  5IHK A;  1UGV A;  1M27 C;  1JQQ A;  2GGR A;  2O2O A;  2LNH B;  3UA7 A;  1QCF A;  1PKS A;  1G83 A;  3M0R A;  2VVK A;  1J3T A;  3LH5 A;  5I22 A;  3I35 A;  1MV0 B;  4AFU C;  1X69 A;  3H0F A;  3JV3 A;  2DLP A;  1U5S A;  2YT6 A;  3I5R A;  2O9S A;  1H92 A;  2NWM A;  1X2Q A;  1TUC A;  2JM8 A;  2P4R A;  3O5Z A;  4RTU A;  1GFD A;  2JTE A;  3NMZ C;  1RLP C;  2FPD A;  4RTV A;  2CUB A;  2K79 A;  1QKW A;  1M8M A;  2EW3 A;  2JW4 A;  1K0S A;  1BK2 A;  2PZ1 A;  1ZSG A;  3PE0 A;  2W10 A;  2M0Y A;  1SEM A;  4RTX A;  2BZ8 A;  2RN8 A;  2EGE A;  3NGP A;  1I1J A;  3SEM A;  1M3A A;  2BZX A;  1X6B A;  4D8D A;  1VYV A;  2HEQ A;  5FWC A;  2KXD A;  3IQL A;  2A08 A;  2NUZ A;  2PNI A;  3VS1 A;  4LUE A;  4DEX A;  1OEB A;  2L2P A;  1SHG A;  1E6G A;  1OPL A;  2J6F A;  1YWO A;  2QDL A;  4R0K A;  3VRZ A;  3UF4 A;  2GQI A;  2EBP A;  1KJW A;  2RQT A;  2KRO A;  2ESW A;  2XMF A;  2CSI A;  3VS5 A;  3U23 A;  2BTT A;  2FO0 A;  3EG2 A;  4HVW A;  4AFZ C;  2AK5 A;  4CC3 A;  3H0I A;  1WXT A;  2HCK A;  3EGU A;  1K76 A;  1FMK A;  2DM1 A;  1PWT A;  2YDL A;  1OV3 A;  2ECZ A;  2KXC A;  1LCK A;  1BBZ A;  1BU1 A;  2KE9 A;  3QWX X;  1W1F A;  1TUD A;  1KFZ A;  3KFV A;  4D8K A;  1MV3 A;  1YN8 A;  2KEA A;  3SHW A;  2YSQ A;  2F2W A;  3I9Q A;  2YUP A;  3EG1 A;  1KSW A;  4CC4 B;  1I0C A;  1W6X A;  5IHN A;  4OML A;  2DMO A;  2DL4 A;  4DEY A;  2O9V A;  1UE9 A;  3VRY A;  2RPN A;  2RQV A;  4J9I A;  1VYU A;  4Z89 A;  1UHF A;  2RF0 A;  1AWJ A;  2LJ1 A;  2FRW A;  2G6F X;  3UA6 A;  2D8H A;  1WIE A;  2LJ0 A;  2GTO A;  4JZ4 A;  1UG1 A;  1JXO A;  1AWO A;  2ROL A;  2DYB A;  1M3C A;  1AZE A;  4CC7 A;  2L3Q A;  1OOT A;  4FSS A;  3PVQ A;  2EGC A;  4KRT A;  1PNJ A;  2CRE A;  1PHT A;  1YP5 A;  2O88 A;  1E7O A;  1I07 A;  2F2V A;  1IO6 A;  1PRL C;  3EHQ A;  2SRC A;  1PRM C;  1YNZ A;  3RNJ A;  1UJY A;  3ZL7 C;  2DVJ A;  2D8J A;  2ENM A;  2EQI A;  4J9E A;  4AG1 C;  2ED0 A;  1JU5 C;  1Z9Q A;  1ABQ A;  2OI3 A;  2FPE A;  2DE0 X;  2EYY A;  1AZG B;  4GLM A;  1H3H A;  1UFF A;  4LE9 A;  2KYB A;  2GTJ A;  2DL3 A;  2KT8 A;  2M51 A;  4ESR A;  2CT4 A;  4LN2 A;  2FPF A;  1NLO C;  1FYN A;  2DRM A;  2K9G A;  4OMO A;  1M30 A;  5HCK A;  2IIM A;  4JPB W;  2CUD A;  4IIM A;  5FWB A;  2A36 A;  3PVL A;  4J9D A;  2MCN A;  1GBQ A;  2L0A A;  1ZLM A;  1H8K A;  3TSZ A;  2LX7 A;  4LUD A;  2W0Z A;  2DX1 A;  1QLY A;  1ARK A;  2LCS A;  1ABO A;  2DL5 A;  2F2X A;  1T0J A;  4GBQ A;  4M4Z A;  3C0C A;  4Z8A A;  2J06 A;  1JXM A;  2V1R A;  2C0O A;  4JZ3 A;  2H8H A;  2JMC A;  2K2M A;  1SSH A;  1G2B A;  2SEM A;  3EG0 A;  2JS2 A;  2EYZ A;  4RUG A;  2VKN A;  1WA7 A;  3M0T A;  2DNU A;  1X27 A;  2KT1 A;  3NHN A;  2AKK A;  1QWF A;  2ABL A;  2HSP A;  3I5S A;  1K4U S;  3REA B;  2DRK A;  1V1C A;  1GFC A;  1YCS B;  1KIK A;  1AD5 A;  1NYF A;  1WX6 A;  1WYX A;  5IXB A;  2D1X A;  2EPD A;  1CKA A;  2L3P A;  4Z88 A;  1QKX A;  1Y57 A;  5I11 A;  1GL5 A;  1PKT A;  1X6G A;  4HCK A;  3VS2 A;  1CSK A;  1HJD A;  4OMP A;  1AWW A;  2J6O A;  3QWY A;  1ZX6 A;  2KBT A;  2J6K A;  2LQW A;  1Z9Z A;  1T0H A;  1XOV A;  2RQW A;  5IXF A;  4ZNX A;  1NEG A;  2KGT A;  1CKB A;  2KRM A;  3M0P A;  4F17 A;  4J9B A;  2FG0 A;  2DF6 A;  2EGA A;  4AG2 C;  1UDL A;  2JS0 A;  1NM7 A;  2O31 A;  1U06 A;  2LP5 A;  2OAW A;  1K1Z A;  4IIO A;  2V1Q A;  5ECA A;  2C0T A;  2KRS A;  2RMO A;  1OPK A;  1SPK A;  1SRM A;  1AVZ C;  1UTI A;  2CH4 W;  2GBQ A;  1ZUU A;  2JMA A;  3H0H A;  1GBR A;  2X3X D;  1W70 A;  2PTK A;  3REB B;  3CQT A;  1UHC A;  3NPF A;  4AFQ C;  1NLP C;  1K0X A;  3VS3 A;  4QT7 A;  1RUW A;  2E5K A;  2J7I A;  1NG2 A;  4WCI A;  3M0S A;  2EYW A;  3VS6 A;  2D0N A;  4HXJ A;  1ZBJ A;  2FRY A;  2JXB A;  2K6D A;  1UUE A;  2CH4 A;  1N5Z A;  1S1N A;  1WXB A;  5FW9 A;  5GJV B;  2DL8 A;  4J9H A;  2MIO A;  2K7A A;  4ORZ A;  1AEY A;  1VYT A;  2C0I A; 
#chains in the Genus database with same CATH topology
 3G7Z A;  2RHX A;  1X43 A;  2YUN A;  4PNO A;  2HBP A;  4JJD A;  4PFP A;  4ZN1 A;  2KR3 A;  2DL7 A;  3OYY A;  3OYF A;  2GF7 A;  4RTW A;  4OMF B;  1T3S A;  3ULR B;  1N9R A;  4A4G A;  1GCQ C;  4X1V A;  5D6Y A;  3VS4 A;  3GBQ A;  1VQL T;  4J9G A;  4RTZ A;  2E1H A;  2K3B A;  3S3N A;  1OX8 A;  5KYU B;  3AHU A;  2CSQ A;  2ROT A;  3TVT A;  3OYJ A;  1NEB A;  2X51 A;  1N8R U;  5FU6 B;  4JJB A;  1KQS A;  3HTR A;  4J7I A;  5KYW A;  1BI2 A;  2E12 A;  2B8A A;  5GAN 8;  4F14 A;  1VQN Q;  4LDU A;  3QUI A;  2AZS A;  3CCU A;  1ZHI A;  3WVD B;  3E9F A;  1A0N B;  1RI0 A;  5LJ3 e;  5GAN f;  2EKH A;  1K73 U;  1AWX A;  2RQR A;  3FLG A;  2J05 A;  1P92 A;  2M16 A;  2X3W D;  2YUQ A;  4MMK A;  3CCL Q;  2DPP B;  1SRL A;  4E7Z A;  6AT1 B;  2MOX A;  3A1P A;  2DBK A;  3OW2 S;  1WLP B;  4IUV A;  2IG0 A;  4UC4 A;  4FIB A;  4DA4 A;  3CPW S;  3GIB A;  4BI3 A;  4Y92 A;  3UT1 A;  4EMK C;  2DA9 A;  2HKN A;  3QJY A;  2QQA A;  1NE8 A;  1YJ9 A;  4K11 A;  1ZBX A;  1M4Z A;  4PJM A;  4TVR A;  2O01 E;  1D0X A;  3TSW A;  1LNX A;  1KG1 A;  3X25 B;  2DEQ A;  4IUR A;  2OTL A;  2KRN A;  2EQJ A;  3CME T;  2L3S A;  2OJ2 A;  2MF2 A;  4R55 A;  3RDV A;  2HDA A;  4JS5 A;  5KE3 A;  4M7D B;  1HYO A;  1V76 A;  1K9M U;  2OTJ A;  2B86 A;  4BDZ A;  2A28 A;  1AOJ A;  3QDF A;  4C8Q G;  2VWF A;  1M27 C;  1EX4 A;  1VQM Q;  1G83 A;  5I22 A;  2PVG B;  3V8J A;  2P4T A;  1MV0 B;  4M78 A;  1X69 A;  2QQR A;  3H0F A;  1HK9 A;  2RM4 A;  1YIT T;  2YWW A;  3I5R A;  5I2M A;  2NWM A;  4JS4 A;  4C92 A;  5FRO A;  2QQB A;  4M77 E;  2QAS A;  2DTI A;  3L2V A;  1OQK A;  3MEV A;  1I5O B;  3PE0 A;  1W2B P;  2W10 A;  3VV0 A;  2RN8 A;  3CC2 T;  5HK3 A;  4ZGD B;  2BZX A;  4XTY A;  4O5V A;  2O4X A;  5GAO r;  2XDB A;  2LTO A;  2YRV A;  2KY9 A;  5FWC A;  2HKQ B;  3SB2 A;  2D9T A;  2KXD A;  4JRI A;  2CP3 A;  4M75 E;  4F7U B;  4OB1 B;  5CKE A;  3VS1 A;  1R0B G;  3CCU T;  4LDW A;  4QKU A;  4M78 C;  1E6G A;  3JB9 D;  1YFN A;  2E6N A;  3UF4 A;  1YJW T;  3M4G A;  2EBP A;  1KJW A;  2GQI A;  2LCC A;  4Y28 E;  3LWI A;  2JJ9 A;  4N4G A;  4BY6 B;  2F5K A;  2LT4 A;  3FEO A;  3U23 A;  2BTT A;  3G4S A;  2ATC B;  3CCJ A;  2K2V A;  5LJ5 e;  1UB4 A;  4XU2 A;  2RO0 A;  2FZG B;  1OZ2 A;  4LDV A;  1QCO A;  1PWT A;  4PFZ A;  4MDW A;  1LCK A;  3M56 A;  2BE9 B;  4J5Y A;  3G71 Q;  2CP5 A;  1MGQ A;  3KFV A;  4D8K A;  3HPW A;  2KEA A;  2RJD A;  2CYZ B;  3CBO A;  3EG1 A;  1Q81 R;  4RG8 A;  3HL8 A;  5IHN A;  4OML A;  2DK3 A;  4E47 A;  2DMO A;  4E7K A;  3H9N A;  9ATC B;  3C4S A;  3EFS A;  4C5G A;  2RA2 A;  2FB7 A;  3VRY A;  4M77 D;  1VQL A;  4GLK A;  5HK0 A;  4Z89 A;  1N8R C;  1VQ6 A;  1RAF B;  4IKF A;  3CBP A;  1M1K U;  1KQ1 A;  4J8O A;  1DJ7 B;  4BDY A;  2XI9 A;  1FMV A;  3URG A;  3CC7 T;  3PTA A;  1PD1 A;  2EJF A;  2LJ0 A;  2GTO A;  3HSB A;  3S3M A;  4E7I A;  1JXO A;  4J6W A;  1M3C A;  4M7D D;  3CCM Q;  2L3Q A;  1FXX A;  3OY9 A;  4ZTF A;  4M78 B;  3EGD A;  2JNG A;  1MMA A;  3CXC S;  4DBR A;  1BCM A;  2DTO A;  2DXU A;  2L8D A;  3P8H A;  1QP3 A;  1I07 A;  1Y7X A;  1IO6 A;  5LJ3 j;  5DLQ E;  5KYW B;  3F70 A;  1PRM C;  1TU0 B;  5GAM j;  2Y4Y A;  1UJY A;  4KBM B;  2KAF A;  2ED0 A;  1TH7 A;  3RR6 A;  3CMA Q;  5CKH A;  2OI3 A;  1ZQ1 A;  5HKC A;  2FPE A;  2DE0 X;  2QA4 A;  2KYB A;  3CCJ Q;  2GFA A;  5CK9 A;  4E7S A;  1IXD A;  2CP0 A;  5CAI A;  4OMO A;  5HCK A;  4BI8 B;  5C0M A;  5FWB A;  5CKD A;  4IIM A;  3QDR B;  2A36 A;  2K3Y A;  4PJO C;  1ZLM A;  4M75 A;  3OBW A;  4DBH A;  2DX1 A;  1ZSZ C;  4OB0 B;  4MDX A;  3C0C A;  2C0O A;  4JZ3 A;  1WHH A;  2HMA A;  3CXC A;  5GMK e;  5M9O A;  3X24 B;  4LD6 A;  4M7A D;  1SSH A;  3OMG A;  2ZAE A;  4C8Q A;  3G4S T;  4FW1 A;  2SEM A;  1KQS P;  2JS2 A;  2EYZ A;  4Q5W A;  4EMG A;  3CCL A;  1WA7 A;  4OVA A;  4BUG A;  3PGG A;  3EGX A;  3MEA A;  4XTX A;  1QWF A;  2ABL A;  3I5S A;  3I56 Q;  1WPY A;  3CCQ A;  1VQM T;  5CKB A;  1LVK A;  2L3P A;  3V8K A;  1Y57 A;  3RER A;  3G6E Q;  1GL5 A;  1PKT A;  1X6G A;  1CSK A;  3PFS A;  3X26 B;  4P5N A;  4A4K A;  2K5F A;  2DET A;  2VGN A;  3QWY A;  2QEX T;  2DYI A;  1Q7Y R;  2KBT A;  3L2Z A;  1RAI B;  1QVF P;  3ZFJ A;  3OS1 A;  2RD1 A;  2VYT A;  2RQW A;  4N0A A;  3GF5 A;  4M75 C;  2EJG A;  3BE3 A;  2KGT A;  1CKB A;  3CCS T;  1PCX A;  1WQ7 A;  5I2S A;  1UDL A;  4PJO D;  3MHX A;  4IIO A;  1TTH B;  1VQ4 Q;  5GAN 7;  5ECA A;  3EAE A;  5FU6 C;  2QQ9 A;  1SRM A;  3OYA A;  4VUB A;  2CS7 A;  1ZUU A;  1Q82 R;  2LRQ A;  4PLL A;  3REB B;  3CQT A;  4F04 B;  3JCM Q;  2V26 A;  3VS3 A;  4QT7 A;  4BY6 C;  4M7D A;  2WSC E;  4OP0 A;  4BB7 A;  4KH1 B;  5FU7 C;  1KC8 C;  5KH6 A;  1M90 C;  4WCI A;  1G3Y A;  3V7S A;  1M90 U;  1WJS A;  4M75 F;  2D0N A;  1YCY A;  2FRY A;  2JXB A;  2LX9 A;  2K6D A;  1UUE A;  1D3B A;  2CH4 A;  3MCA B;  5FW9 A;  5AT1 B;  3RIR A;  4M7A F;  5GJV B;  1QP2 A;  3A8H B;  2MIO A;  1B34 A;  4ORZ A;  1AEY A;  1VYT A;  4C8Q C;  4F16 A;  5GAM d;  4FW2 A;  5I21 A;  1VQN T;  1PSF A;  3CCR A;  4RTY A;  4C8Q E;  3HFO A;  1EFN A;  3RBB B;  1SSF A;  1YWP A;  1JO8 A;  2V8J A;  2LNV A;  2KYM A;  5IHI A;  4LNP A;  2Y90 A;  4MZM A;  1ZUY A;  4OMM A;  2M0O A;  3H41 A;  1RLQ C;  1JEG A;  2HZY A;  3MJX A;  3VS0 A;  5EC7 A;  3PIP A;  3G6E A;  1TSF A;  2E3I A;  2KSS A;  4FM4 B;  4PJO F;  1YJ9 Q;  1VA7 A;  3TCJ A;  1OZ3 A;  1KQ2 A;  1K9A A;  2I0N A;  2EFI A;  1VQ5 A;  2X35 A;  3MET A;  1M3B A;  4NL2 A;  1QCN A;  5GJW B;  1BB9 A;  2RJF A;  4XK8 E;  2VXF A;  3VKI A;  2ZCF B;  1AT1 B;  4FSX A;  2OTJ Q;  4CC2 A;  1YIT Q;  3RKX A;  1VQ4 A;  4QVC A;  1UJ0 A;  3OYC A;  1VQM A;  4RTT A;  2VXE A;  1Q81 U;  2DVE A;  1OU8 A;  5GAN 4;  2RNA A;  1Q7Y C;  4M7D G;  1B3Q A;  2PVD B;  3L2Q A;  1BIB A;  4JLG A;  3C12 A;  4II1 A;  2IPO B;  2HBW A;  1NYG A;  3OW2 A;  3M0U A;  1K8A C;  2O4X B;  1U1T A;  2DIL A;  1BKB A;  1IRX A;  1GCP A;  1VQK A;  5GAN j;  2F1L A;  5GAM h;  4M7A C;  3PMI A;  3CC2 A;  3HFN A;  1VQ4 T;  4YTL A;  3CCJ T;  3OYG A;  3JCM X;  2AZV A;  2FL7 A;  1UEC A;  3MP8 A;  1Q82 C;  2LJ3 A;  4OMQ A;  4EDU A;  1UGV A;  2K4Y A;  1YI2 T;  2DAQ A;  2MPX C;  3UA7 A;  5GAO p;  1PKS A;  2M9U A;  2CZ6 B;  4PLI A;  3BY7 A;  2F5T X;  2DLP A;  1U5S A;  3E2U A;  1WJQ A;  1Q86 C;  2YT6 A;  2XDP A;  5DY9 A;  3JCM c;  1HXD A;  4ZGJ B;  2XU8 A;  4NL3 A;  5GAN h;  4M7D E;  2BUD A;  4XTW A;  5KYN A;  1X2Q A;  3SDZ A;  3SWN C;  4RTU A;  2BIV A;  3JCM e;  2JTE A;  2QA4 Q;  2COZ A;  1YIJ T;  3OBY A;  3GNG A;  5GAO n;  1RLP C;  4RTV A;  3L1A A;  1QKW A;  1FX7 A;  4O6J A;  1K0S A;  2QK0 A;  2PZ1 A;  4HT9 A;  5CIU A;  1TOV A;  1SEM A;  2JUF A;  3VU3 C;  2BZ8 A;  2EGE A;  3NGP A;  3CC4 A;  1I1J A;  1MND A;  4LXC A;  1M3A A;  1PSE A;  5J26 A;  5D7U A;  2P84 A;  1VYV A;  2FHD A;  5KYX B;  2HEQ A;  3G71 A;  3DLL A;  1W4S A;  4OGC A;  4PJL A;  2HL5 C;  3IQL A;  2A08 A;  2NUZ A;  2PNI A;  1SG5 A;  4LUE A;  2JTM A;  4FYV B;  2L2P A;  3LGL A;  1YWO A;  5GAO q;  3OS2 A;  2HAX A;  3JCM h;  2XMF A;  3QKJ A;  4J6X A;  2CSI A;  1VQ9 Q;  2E6Z A;  5GAN e;  4X9C A;  1VIF A;  3EG2 A;  4HVW A;  5CQY A;  3OYH A;  4AFZ C;  4CC3 A;  1M8V A;  4ELY C;  1WXT A;  1D09 B;  1VIE A;  1K76 A;  2DM1 A;  3EFR A;  2VGM A;  2V8I A;  2ECZ A;  1BU1 A;  2KE9 A;  1VQK Q;  3S3O A;  3KUF A;  1I5L A;  3A8O B;  1YN8 A;  3N5B B;  3OYM A;  3FJP A;  1YBY A;  1D1A A;  3SHW A;  3I9Q A;  2YUP A;  1M1K R;  1Q82 U;  3J81 E;  2LQ8 A;  1I0C A;  4FCY A;  5GAN d;  5KYU A;  3CCE Q;  1JBM A;  3QG1 A;  4ELZ C;  4MML A;  1WHM A;  7AT1 B;  1M9S A;  2O9V A;  1UE9 A;  2HQE A;  1WNL A;  2RQV A;  4J9I A;  1VQ8 Q;  4C8Q B;  1BIA A;  1LOJ A;  1JB0 E;  5AYF A;  5GAN 6;  2E10 A;  2CGH A;  5HY6 A;  2FRW A;  1PC0 A;  3UA6 A;  2BKD N;  1VQP T;  4XTZ A;  1WIE A;  2QAZ A;  1JJ2 P;  5GMK i;  3EG9 B;  4JZ4 A;  1XNI A;  1RAE B;  4M75 B;  4F7U E;  2DYB A;  1W2B S;  2YRD A;  1AZE A;  3CMA A;  1IHV A;  3PVQ A;  2XID A;  3OYI A;  2EGC A;  4DOW A;  4KRT A;  4M7A B;  1IZ6 A;  1S72 Q;  4C0D B;  2O88 A;  4DQ2 A;  1RAC B;  1NZ9 A;  2XKO C;  3OYE A;  1E7O A;  2HSE B;  3V7C A;  3FC3 A;  3LYI A;  2SRC A;  3J7A F;  3RNJ A;  2FZC B;  2EQI A;  1G5V A;  2XIC A;  1MMN A;  3RMS A;  1Z9Q A;  2DD4 A;  2RHI A;  1ABQ A;  1IHW A;  3CD6 T;  3FIF A;  1UFF A;  3E9G A;  2KT8 A;  2CT4 A;  3JRZ A;  3WVE B;  1NLO C;  1WHJ A;  3JCM J;  3O8V A;  1WQW A;  4PJO B;  1Q86 U;  2DTH A;  4FYW B;  3CCQ Q;  2ZPI B;  2VUB A;  2D0Q B;  3M54 A;  2LX7 A;  1ARK A;  1H3Z A;  2LCS A;  1M2O A;  2DL5 A;  5C6S A;  1T0J A;  4PKC C;  4LD9 K;  1QVF S;  4PK4 A;  1VQ6 T;  2PVO B;  3M5A A;  3KXT A;  1ACM B;  5CO7 A;  4M78 E;  1PM3 A;  2DNU A;  2RHY A;  1X27 A;  2KT1 A;  1K9M R;  2HSP A;  3HRU A;  3QSU A;  2BE7 D;  2ZPF B;  5GAM e;  1GFC A;  1M5Q 1;  1KIK A;  1AD5 A;  1WYX A;  2CKK A;  2D1X A;  2EPD A;  1CKA A;  4WF2 A;  1IRE B;  2QA4 T;  1YIJ Q;  1KD1 U;  5I11 A;  1KQS S;  1R8O B;  4C0D C;  2H3E B;  1Q7Y U;  2QYZ A;  2EYQ A;  2DXC A;  1QVG S;  2J6O A;  3QHS A;  1S72 A;  2J6K A;  2LQW A;  3SWN B;  5KYY B;  2KRM A;  4F17 A;  3PT9 A;  4JRP A;  2R57 A;  1XTD A;  3A5Z B;  1YJW Q;  4L59 A;  3JCM W;  2DKG A;  1YHQ Q;  3QBY A;  3EH1 A;  5CQX A;  2K5L A;  2OAW A;  1M1G A;  2V1Q A;  4XTV A;  2C0T A;  1D0Z A;  2H3J A;  2CH4 W;  5LJ3 d;  3GP8 A;  2E3H A;  3VYH B;  2GBQ A;  2JMA A;  1W70 A;  2EKO A;  2X4Y A;  2P0P A;  3CMA T;  3BDL A;  1NLP C;  1S72 T;  1K0X A;  1R0C B;  4KUL A;  5GMK l;  2NLU A;  1Q86 R;  2M02 A;  2CZ0 B;  5KCH A;  4A4H A;  4RKU E;  1VQP Q;  4A53 A;  1I8F A;  4EMH A;  2COY A;  2PQW A;  3CC4 Q;  2YLB A;  4J9H A;  1N6A A;  3DB3 A;  3CME Q;  4M75 G;  2C0I A;  1Q95 G;  1MUZ A;  2KMT A;  3CCS A;  1QWE A;  3NTI A;  1GXI E;  3CCE T;  3EG9 A;  4IUP A;  1WXU A;  4C5H A;  4KT0 E;  4RCB A;  4J9F A;  1FWZ A;  1FMW A;  4Y91 A;  3JCM V;  4KGZ B;  2LT1 A;  4IUT A;  2QGF B;  2QG9 B;  3TRE A;  2E64 A;  2JM9 A;  1WFW A;  2K5I A;  2EVR A;  2RHU A;  2X4X A;  4AMC A;  1NJI U;  3LWH A;  3FJ5 A;  5EG2 A;  1N27 A;  2YUO A;  2EYX A;  4C0F A;  2AKL A;  4FU6 A;  5FLX E;  2A37 A;  1ZUK A;  4FT2 A;  2BZY A;  4DOV A;  2RJC A;  2RQU A;  3EHR A;  1YI2 Q;  4OMN A;  4M77 G;  1WDX A;  4E2F B;  3I56 T;  3PNW C;  4PFO A;  1NBE B;  2LZ6 B;  2LMJ A;  3A8G B;  2YHT A;  2FZK B;  2DJQ A;  3UAT A;  4E6R A;  2DIG A;  3MP6 A;  1RAG B;  1B07 A;  3T9N A;  5CKF A;  3CC4 T;  1E6H A;  4E7H A;  2CDT A;  1WI7 A;  3A98 A;  3SWN A;  2DIQ A;  3JB9 H;  4HCB A;  1VQN A;  4C5I A;  4EIK A;  1SF9 A;  4A63 B;  2DEU A;  2AIR B;  1YJN T;  2ED1 A;  1BCO A;  3MEW A;  4MZT A;  2KK4 A;  4F7U F;  2ZGW A;  2LQN A;  1X75 C;  3P8B B;  1QMC A;  1SKU B;  1VQP A;  5L23 A;  3OYL A;  3AT1 B;  4OB3 B;  5J39 A;  2WAC A;  3MPU B;  4E7J A;  3E19 A;  4PJO A;  5IHK A;  5KYY A;  3CME A;  1JJ2 A;  1JQQ A;  2GGR A;  2LNH B;  1G8X A;  4B6M A;  3M0R A;  5GAN 5;  3LH5 A;  2LQK A;  4JDS A;  1KK7 A;  1IGQ A;  4AFU C;  2NUT B;  3JV3 A;  3M58 A;  2DZ9 A;  3EH2 A;  2O9S A;  4J6Y A;  5FRM A;  3TU4 K;  1TUC A;  2P4R A;  3G6E T;  2CZ1 B;  1QVP A;  1GFD A;  1ZSZ A;  2JZ2 A;  2MAM A;  2HQH A;  3QO3 A;  2E65 A;  2DJZ A;  2FPD A;  2CUB A;  2K79 A;  1ZSG A;  1UGS B;  2MYS A;  4AT1 B;  5LJ5 d;  1U8R A;  4RTX A;  4ZN3 A;  2EAY A;  3RUX A;  1JJ2 S;  3KBG A;  2QTV A;  3HHT B;  4D8D A;  5LJ5 g;  1VQK T;  4M7A G;  3ASK A;  1M1K C;  4IUQ A;  2DXB A;  3J80 E;  3QYH B;  4DEX A;  4JUV A;  1ZA2 B;  1SHG A;  1RAH B;  5GAM f;  1OPL A;  2J6F A;  2QDL A;  4R0K A;  5A0L A;  1YJN Q;  5DM7 R;  4C0G A;  4M7D F;  1MHN A;  3LW5 E;  3X28 B;  3DKM A;  3VS5 A;  4KGV B;  4M78 F;  1WJR A;  1VQ7 Q;  1VQ8 A;  3GOX A;  2AK5 A;  3H0I A;  2M1H A;  1MMD A;  3I55 T;  1UGR B;  2L5Q A;  3OSV A;  2ZPE B;  2YDL A;  1OV3 A;  2KXC A;  1BBZ A;  4PJN A;  3QWX X;  1VQ6 Q;  1B7T A;  4JJN K;  2VAS A;  1MV3 A;  4PJO G;  3OYK A;  4ANJ A;  4C92 G;  3C95 A;  4KUD K;  2F2W A;  5GAM g;  1KSW A;  4CC4 B;  1I81 A;  2K57 A;  1K9M C;  1W6X A;  2DL4 A;  4N4H A;  3UWN A;  3MO8 A;  4BE1 A;  2P0Q A;  4M77 C;  2E5Q A;  4A4F A;  2X9H A;  5LJ3 f;  1B34 B;  2FYK A;  3RMQ A;  2RF0 A;  2JN0 A;  1AWJ A;  2ZPB B;  3CCV T;  3QZ9 B;  1K8A U;  4QQG A;  1KHC A;  2D8H A;  3NFC A;  2MK5 A;  3CC7 Q;  2FVU A;  4GY5 A;  4CC7 A;  1OOT A;  2GQV A;  2P0K A;  1AHJ B;  2Y4X A;  2CRE A;  4M75 D;  3JB9 F;  1PHT A;  4E7L A;  5D6X A;  2EJ9 A;  1YP5 A;  3Q1J A;  3CEY A;  1V29 B;  2GCX A;  1D0Y A;  2F2V A;  3TQ7 P;  5FRN A;  4BD3 A;  4A54 A;  5GAO l;  2NYS A;  3OS0 A;  1YNZ A;  3GNF B;  3ZL7 C;  2DVJ A;  3M55 A;  2ENM A;  4J9E A;  3HRS A;  4AG1 C;  3QZ5 B;  1Y71 A;  1G3W A;  4M77 A;  1JU5 C;  5A0G A;  4F7U A;  4C5E A;  4GLM A;  4LE9 A;  1NJI C;  3EFO A;  3CBM A;  1RL2 A;  1RAA B;  4HCZ A;  4C92 B;  4ESR A;  3OYD A;  4LN2 A;  2K3X A;  1TS9 A;  3S6W A;  2QDY B;  2EQK A;  2ZZD A;  3ER0 A;  2L89 A;  1FYN A;  2DRM A;  2K9G A;  1M30 A;  2IIM A;  3L2W A;  3MP1 A;  1C1A A;  4J9D A;  5CCA A;  2L0A A;  1MNE A;  3I56 A;  3CPW P;  4EMK B;  4LUD A;  2W0Z A;  4NS5 A;  4QQ6 A;  3M9Q A;  1XJW B;  2HL3 A;  1ABO A;  4M4Z A;  1R77 A;  4PL6 A;  4M7A A;  2CP2 A;  1LPL A;  3QXE B;  2RK2 A;  4C0Z A;  3OSS C;  2J06 A;  5KYX A;  2V1R A;  5LJ3 g;  3JCM P;  1F1B B;  2K2M A;  3FB9 A;  3VYG A;  2AHJ B;  3EG0 A;  4RUG A;  2F69 A;  1KD1 C;  2VKN A;  5CVI A;  2KI7 A;  1K4U S;  3REA B;  3CCM T;  1V1C A;  2R5M A;  1KC8 U;  1NYF A;  2OX7 A;  5IXB A;  1K73 R;  3GLX A;  1VQO T;  4X9D A;  4Z88 A;  4XU0 A;  2LC4 A;  1QKX A;  4XU3 A;  2QEX Q;  4HCK A;  5FU7 B;  3VS2 A;  4QVZ A;  3VUZ A;  8ATC B;  2ZPG B;  1M1F A;  2E70 A;  1AWW A;  5A0D A;  2RB6 A;  1M90 R;  2QGG A;  5J3B A;  4HCC A;  3V7R A;  5CR2 A;  1Z9Z A;  1O75 A;  1T0H A;  1NEG A;  2E41 A;  3M0P A;  2FG0 A;  5GAO m;  3OYB A;  2EGA A;  3E1S A;  2JS0 A;  2O31 A;  4C92 C;  1U06 A;  5LJ3 h;  2LP5 A;  1K1Z A;  3CD6 A;  1WHG A;  1VOM A;  2RMO A;  1OPK A;  1AVZ C;  1UTI A;  2MI6 A;  3PMT A;  4XAX B;  2NUP A;  2R58 A;  3H0H A;  1QVG P;  4R56 A;  1UHC A;  2C06 A;  1N9S A;  3ME9 A;  1RUW A;  2OTL T;  1VQO A;  1VQ7 T;  4OB2 B;  2J7I A;  5LJ5 j;  1NG2 A;  1C6V X;  3LLR A;  4ME7 A;  3M0S A;  2EYW A;  3CCR Q;  3ZEH A;  4HXJ A;  1ZBJ A;  2RHZ A;  2XHC A;  4FYX B;  2DL8 A;  4EPC A;  2VB6 A;  4IUU A;  2PUK B;  1RAB B;  2YRC A;  1MMG A;  4CI0 C;  1D1C A;  3V8L A;  4M78 D;  3CXC P;  1U3O A;  4XU1 A;  4BI4 A;  4RMO A;  1ZA1 B;  2RJE A;  2R5A A;  1W2B A;  3SD4 A;  3HRT A;  1Y07 A;  4J7F A;  1KC8 R;  1WZO A;  3CCQ T;  2YLC A;  3EGD B;  4M77 B;  3QJ6 A;  2CT3 A;  3JB9 J;  1UGQ B;  1K8A R;  4HT8 A;  4XQ3 A;  4C92 D;  2EIF A;  2HQX A;  3HP9 A;  3GPL A;  2KNB B;  1NPP A;  1GRI A;  4HVV A;  1QQJ A;  5GMK m;  2XDD A;  3JCM f;  4WTO B;  1Y0M A;  3THK A;  2JT4 A;  2GNC A;  2DBM A;  3G1J A;  1NPR A;  2NUT A;  2A3L A;  4J9C A;  3CCV Q;  1TG0 A;  3LGF A;  2CZ7 B;  1G3S A;  3I55 A;  5IAY A;  2PU9 B;  4KH0 B;  1T3L A;  1RI9 A;  2V8K A;  2XD0 A;  4HKE A;  3JCM b;  2FEI A;  4AFS C;  4OGE A;  3CD6 Q;  1GCQ A;  2PUO B;  1WGS A;  1SHF A;  1YJW A;  3JAM E;  3JSC A;  3VS7 A;  1NJI R;  1YHQ A;  1HSQ A;  4BE0 A;  1JRI A;  3R6N A;  3M0Q A;  2DFU A;  5IH2 A;  1YJ9 T;  1X2K A;  1IGU A;  4JRK A;  2E4H A;  3A8L B;  4F7U G;  8AT1 B;  1BI0 A;  4N4I A;  3CC7 A;  2DER A;  2HD0 A;  3L42 A;  2KDS A;  4HVU A;  1H64 1;  4FYY B;  2OTJ T;  2VC8 A;  3OQ5 A;  4V2S A;  5L8R E;  3JCM g;  4ZTJ A;  2DD5 A;  4JJC A;  1X01 A;  3EG3 A;  3VUB A;  1VUB A;  1HD3 A;  1BI3 A;  5KE2 A;  3RKW A;  2O2O A;  4FL6 A;  4M7D C;  1QCF A;  4NOY A;  2VVK A;  1J3T A;  2DO3 A;  3NTH A;  1OYX A;  3I35 A;  3UPU A;  3PIO A;  3A8M B;  1VQ5 T;  1H92 A;  5IN1 A;  2MMP A;  1LJO A;  2JM8 A;  3O5Z A;  4C92 F;  2QQS A;  1BI1 A;  3NMZ C;  2JOY A;  1PG5 B;  4DBQ A;  1M8M A;  2EW3 A;  2JW4 A;  3JB9 I;  1BK2 A;  3INZ A;  2A7Y A;  4X34 A;  3FRN A;  2M0Y A;  3BFM A;  4JRQ A;  1VQ7 A;  3SEM A;  2QEX A;  3P8D A;  3ZBD A;  1X6B A;  3QYG B;  1D1B A;  4B9X A;  3C94 A;  3NTK A;  4PJJ A;  1OEB A;  3I55 Q;  2A0F B;  2QI2 A;  3VRZ A;  2RI5 A;  2Z0W A;  3M4Y A;  1QVF A;  2RQT A;  3TEE A;  2KRO A;  2ESW A;  1YI2 A;  2KQW A;  3R6O A;  2FO0 A;  1WHK A;  3CPW A;  1N8R R;  4L6V 5;  1OX9 A;  2HCK A;  3EGU A;  3LH0 A;  2ZPH B;  5GAN 3;  1FMK A;  1TWB A;  1VQ8 T;  4QQD A;  2DXT A;  3OS5 A;  4QW2 A;  2X4J A;  1ZSZ B;  1VQO Q;  3M59 A;  1W1F A;  1TUD A;  1KFZ A;  5LL6 S;  3CCR T;  1K73 C;  3RKY A;  2L3R A;  1UGP B;  3EGX B;  2I2L A;  3RES A;  4XTU A;  2YSQ A;  1KD1 R;  4FT4 A;  4OF1 A;  1OU9 A;  3UDC A;  1X6O A;  1XQH A;  3G4S Q;  1G3T A;  4L5G A;  3DB4 A;  3SFM A;  4DEY A;  4BAC A;  1RAD B;  1M2V B;  2LCL A;  2RPN A;  1M2V A;  3OYN A;  2IVW A;  1VYU A;  4HA8 A;  1UHF A;  2RK1 A;  2WSF E;  2LJ1 A;  1VQ5 Q;  2G6F X;  1KHI A;  4ATO A;  1UG1 A;  5DLO A;  3CCS Q;  1AWO A;  2ROL A;  1C0M A;  4EMK A;  3CCE A;  4FSS A;  4ZGE B;  3FDR A;  2WSE E;  2AT1 B;  4BE2 A;  2OTL Q;  1PNJ A;  1YIT A;  2RH2 A;  3CCU Q;  4M78 G;  4J83 A;  1O9S A;  2GFU A;  1Y96 A;  3G71 T;  1OUL A;  1PRL C;  1TUG B;  1U1S A;  3EHQ A;  1QW1 A;  1VQL Q;  4LDX A;  4M7A E;  5IT9 E;  2LVM A;  2D8J A;  3CCV A;  4B9W A;  3MEU A;  4C8Q D;  2JTF A;  5A2Q E;  3HKS A;  4M77 F;  3DLM A;  3M53 A;  1UEB A;  2CP6 A;  3BW1 A;  3CCM A;  2EYY A;  1AZG B;  2D6F A;  1H3H A;  1PD0 A;  1YJN A;  2GTJ A;  2YXY A;  2DL3 A;  2M51 A;  3QPH A;  2QTX A;  2EQM A;  2FPF A;  4C8Q F;  3H6Z A;  5LJ5 f;  5GMK j;  2QXF A;  4JPB W;  2CUD A;  3PVL A;  5D6W A;  1TXQ A;  2MCN A;  1GBQ A;  1H8K A;  3TSZ A;  4QVD A;  1D3B B;  3JCM d;  1QLY A;  4KGX B;  2F2X A;  4GBQ A;  3BDU A;  4Z8A A;  3OA6 A;  3OW2 P;  4RG2 A;  1WHL A;  1JXM A;  2X4W A;  1YIJ A;  4PJO E;  2H8H A;  1Y96 B;  4DBF A;  2JMC A;  2NUP B;  1G2B A;  2RI2 A;  2RI3 A;  3M0T A;  2JVV A;  2XG8 D;  3NHN A;  2AKK A;  4JLI A;  1YHQ T;  2DRK A;  2EQU A;  3L2U A;  1YCS B;  3JB9 G;  1VQ9 T;  1WX6 A;  2HNI A;  3QII A;  5KCO A;  1Q81 C;  1HJD A;  1BYM A;  4LDY A;  4OMP A;  4MZP A;  2VV5 A;  2MWO A;  1ZX6 A;  2COW A;  1XOV A;  5IXF A;  4ZNX A;  1VQ9 A;  3CPF A;  3OMC A;  4J9B A;  2DF6 A;  4AG2 C;  1NM7 A;  3M57 A;  4Z02 A;  3VJP A;  4KUI A;  4CRI A;  1EZZ B;  2KRS A;  5LJ5 h;  3X20 B;  3D7S B;  3OB9 A;  1SPK A;  1QVG A;  1IB8 A;  2LDM A;  1GBR A;  2X3X D;  2PTK A;  2EWN A;  4D6W A;  3NPF A;  1EIF A;  4AFQ C;  3CC2 Q;  1OI1 A;  5GAN 2;  2E5K A;  2MWP A;  4C92 E;  2KVQ G;  5GMK h;  3LX7 A;  2XK0 A;  3VS6 A;  4RCC A;  2DZC A;  5GAN g;  2G3R A;  3L2R A;  1N5Z A;  1S1N A;  1WXB A;  3CCL T;  3MKD A;  4A4E A;  3EFO B;  2K7A A;  2OAU A;  4N0A C;  3H8Z A;  1I4K 1;  2CP7 A;  3WXM B; 
#chains in the Genus database with same CATH homology
 2YUN A;  1X43 A;  1MUZ A;  1U3O A;  4JJD A;  1QWE A;  2KR3 A;  4F16 A;  2DL7 A;  4RTW A;  1WXU A;  1T3S A;  4RTY A;  3ULR B;  4J9F A;  1EFN A;  3RBB B;  1YWP A;  1GCQ C;  4X1V A;  3VS4 A;  3GBQ A;  1JO8 A;  4J9G A;  4RTZ A;  2K3B A;  2CSQ A;  2KYM A;  2CT3 A;  2ROT A;  2JM9 A;  5IHI A;  4LNP A;  3TVT A;  1NEB A;  1WFW A;  2EVR A;  3FJ5 A;  1ZUY A;  4OMM A;  4JJB A;  3H41 A;  1RLQ C;  1JEG A;  2YUO A;  3VS0 A;  2EYX A;  5EC7 A;  2AKL A;  2KNB B;  4F14 A;  1GRI A;  4HVV A;  1VA7 A;  2A37 A;  1ZUK A;  1K9A A;  2I0N A;  2BZY A;  1Y0M A;  3THK A;  2AZS A;  2JT4 A;  1M3B A;  2RQU A;  3EHR A;  4OMN A;  2GNC A;  2DBM A;  1WDX A;  5GJW B;  4J9C A;  1A0N B;  1BB9 A;  2LZ6 B;  1TG0 A;  2LMJ A;  2EKH A;  4E6R A;  2DJQ A;  1AWX A;  2RQR A;  3UAT A;  2J05 A;  1T3L A;  1RI9 A;  2X3W D;  2YUQ A;  2FEI A;  4CC2 A;  4AFS C;  1B07 A;  1GCQ A;  1SRL A;  2MOX A;  1E6H A;  2DBK A;  1UJ0 A;  2CDT A;  1WI7 A;  1SHF A;  3A98 A;  4RTT A;  1WLP B;  2RNA A;  1B3Q A;  3VS7 A;  4EIK A;  1HSQ A;  3R6N A;  4A63 B;  3M0Q A;  5IH2 A;  1X2K A;  4Y92 A;  2HBW A;  2DA9 A;  1NYG A;  3M0U A;  2ED1 A;  4K11 A;  2DIL A;  1GCP A;  3TSW A;  4HVU A;  2LQN A;  2KRN A;  2L3S A;  5L23 A;  2OJ2 A;  2HDA A;  2AZV A;  4JJC A;  1UEC A;  2B86 A;  3EG3 A;  2A28 A;  1AOJ A;  2LJ3 A;  1HD3 A;  2VWF A;  4OMQ A;  5IHK A;  1UGV A;  1M27 C;  1JQQ A;  2GGR A;  2O2O A;  2LNH B;  3UA7 A;  1QCF A;  1PKS A;  1G83 A;  3M0R A;  2VVK A;  1J3T A;  3LH5 A;  5I22 A;  3I35 A;  1MV0 B;  4AFU C;  1X69 A;  3H0F A;  3JV3 A;  2DLP A;  1U5S A;  2YT6 A;  3I5R A;  2O9S A;  1H92 A;  2NWM A;  1X2Q A;  1TUC A;  2JM8 A;  2P4R A;  3O5Z A;  4RTU A;  1GFD A;  2JTE A;  3NMZ C;  1RLP C;  2FPD A;  4RTV A;  2CUB A;  2K79 A;  1QKW A;  1M8M A;  2EW3 A;  2JW4 A;  1K0S A;  1BK2 A;  2PZ1 A;  1ZSG A;  3PE0 A;  2W10 A;  2M0Y A;  1SEM A;  4RTX A;  2BZ8 A;  2RN8 A;  2EGE A;  3NGP A;  1I1J A;  3SEM A;  1M3A A;  2BZX A;  1X6B A;  4D8D A;  1VYV A;  2HEQ A;  5FWC A;  2KXD A;  3IQL A;  2A08 A;  2NUZ A;  2PNI A;  3VS1 A;  4LUE A;  4DEX A;  1OEB A;  2L2P A;  1SHG A;  1E6G A;  1OPL A;  2J6F A;  1YWO A;  2QDL A;  4R0K A;  3VRZ A;  3UF4 A;  2GQI A;  2EBP A;  1KJW A;  2RQT A;  2KRO A;  2ESW A;  2XMF A;  2CSI A;  3VS5 A;  3U23 A;  2BTT A;  2FO0 A;  3EG2 A;  4HVW A;  4AFZ C;  2AK5 A;  4CC3 A;  3H0I A;  1WXT A;  2HCK A;  3EGU A;  1K76 A;  1FMK A;  2DM1 A;  1PWT A;  2YDL A;  1OV3 A;  2ECZ A;  2KXC A;  1LCK A;  1BBZ A;  1BU1 A;  2KE9 A;  3QWX X;  1W1F A;  1TUD A;  1KFZ A;  3KFV A;  4D8K A;  1MV3 A;  1YN8 A;  2KEA A;  3SHW A;  2YSQ A;  2F2W A;  3I9Q A;  2YUP A;  3EG1 A;  1KSW A;  4CC4 B;  1I0C A;  1W6X A;  5IHN A;  4OML A;  2DMO A;  2DL4 A;  4DEY A;  2O9V A;  1UE9 A;  3VRY A;  2RPN A;  2RQV A;  4J9I A;  1VYU A;  4Z89 A;  1UHF A;  2RF0 A;  1AWJ A;  2LJ1 A;  2FRW A;  2G6F X;  3UA6 A;  2D8H A;  1WIE A;  2LJ0 A;  2GTO A;  4JZ4 A;  1UG1 A;  1JXO A;  1AWO A;  2ROL A;  2DYB A;  1M3C A;  1AZE A;  4CC7 A;  2L3Q A;  1OOT A;  4FSS A;  3PVQ A;  2EGC A;  4KRT A;  1PNJ A;  2CRE A;  1PHT A;  1YP5 A;  2O88 A;  1E7O A;  1I07 A;  2F2V A;  1IO6 A;  1PRL C;  3EHQ A;  2SRC A;  1PRM C;  1YNZ A;  3RNJ A;  1UJY A;  3ZL7 C;  2DVJ A;  2D8J A;  2ENM A;  2EQI A;  4J9E A;  4AG1 C;  2ED0 A;  1JU5 C;  1Z9Q A;  1ABQ A;  2OI3 A;  2FPE A;  2DE0 X;  2EYY A;  1AZG B;  4GLM A;  1H3H A;  1UFF A;  4LE9 A;  2KYB A;  2GTJ A;  2DL3 A;  2KT8 A;  2M51 A;  4ESR A;  2CT4 A;  4LN2 A;  2FPF A;  1NLO C;  1FYN A;  2DRM A;  2K9G A;  4OMO A;  1M30 A;  5HCK A;  2IIM A;  4JPB W;  2CUD A;  4IIM A;  5FWB A;  2A36 A;  3PVL A;  4J9D A;  2MCN A;  1GBQ A;  2L0A A;  1ZLM A;  1H8K A;  3TSZ A;  2LX7 A;  4LUD A;  2W0Z A;  2DX1 A;  1QLY A;  1ARK A;  2LCS A;  1ABO A;  2DL5 A;  2F2X A;  1T0J A;  4GBQ A;  4M4Z A;  3C0C A;  4Z8A A;  2J06 A;  1JXM A;  2V1R A;  2C0O A;  4JZ3 A;  2H8H A;  2JMC A;  2K2M A;  1SSH A;  1G2B A;  2SEM A;  3EG0 A;  2JS2 A;  2EYZ A;  4RUG A;  2VKN A;  1WA7 A;  3M0T A;  2DNU A;  1X27 A;  2KT1 A;  3NHN A;  2AKK A;  1QWF A;  2ABL A;  2HSP A;  3I5S A;  1K4U S;  3REA B;  2DRK A;  1V1C A;  1GFC A;  1YCS B;  1KIK A;  1AD5 A;  1NYF A;  1WX6 A;  1WYX A;  5IXB A;  2D1X A;  2EPD A;  1CKA A;  2L3P A;  4Z88 A;  1QKX A;  1Y57 A;  5I11 A;  1GL5 A;  1PKT A;  1X6G A;  4HCK A;  3VS2 A;  1CSK A;  1HJD A;  4OMP A;  1AWW A;  2J6O A;  3QWY A;  1ZX6 A;  2KBT A;  2J6K A;  2LQW A;  1Z9Z A;  1T0H A;  1XOV A;  2RQW A;  5IXF A;  4ZNX A;  1NEG A;  2KGT A;  1CKB A;  2KRM A;  3M0P A;  4F17 A;  4J9B A;  2FG0 A;  2DF6 A;  2EGA A;  4AG2 C;  1UDL A;  2JS0 A;  1NM7 A;  2O31 A;  1U06 A;  2LP5 A;  2OAW A;  1K1Z A;  4IIO A;  2V1Q A;  5ECA A;  2C0T A;  2KRS A;  2RMO A;  1OPK A;  1SPK A;  1SRM A;  1AVZ C;  1UTI A;  2CH4 W;  2GBQ A;  1ZUU A;  2JMA A;  3H0H A;  1GBR A;  2X3X D;  1W70 A;  2PTK A;  3REB B;  3CQT A;  1UHC A;  3NPF A;  4AFQ C;  1NLP C;  1K0X A;  3VS3 A;  4QT7 A;  1RUW A;  2E5K A;  2J7I A;  1NG2 A;  4WCI A;  3M0S A;  2EYW A;  3VS6 A;  2D0N A;  4HXJ A;  1ZBJ A;  2FRY A;  2JXB A;  2K6D A;  1UUE A;  2CH4 A;  1N5Z A;  1S1N A;  1WXB A;  5FW9 A;  5GJV B;  2DL8 A;  4J9H A;  2MIO A;  2K7A A;  4ORZ A;  1AEY A;  1VYT A;  2C0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...