1WXTA

Solution structure of the sh3 domain of human hypothetical protein flj21522
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
GSSGSSGLKMQVLYEFEARNPRELTVVQGEKLEVLDHSKRWWLVKNEAGRSGYIPSNILEPLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein FLJ21522
publication title Solution structure of the SH3 domain of human hypothetical protein FLJ21522
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 6
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1wxtA00
3NPFA 5ECAA 1T3LA 1QWFA 1UECA 2CH4W 1TUDA 3H41A 4Y92A 2JTEA 1WI7A 4RTXA 2ENMA 2ED1A 1UJYA 4LUDA 2HEQA 3U23A 2FPDA 3H0IA 1YP5A 1GRIA 1NYGA 2KXDA 1ZSGA 1YN8A 1BB9A 2F2VA 2KNBB 1M8MA 3M0TA 1GBQA 2K79A 2LNHB 4RTTA 1AZEA 1E7OA 2O9SA 2JT4A 1WIEA 1IO6A 2EQIA 2DL7A 3REBB 2OAWA 2QDLA 1K0SA 2DF6A 2L3PA 3UF4A 4X1VA 4CC2A 2DBMA 2DA9A 1U06A 4J9BA 1AOJA 1YNZA 2DL5A 2E5KA 2KROA 1K9AA 2W0ZA 1UHFA 3I5SA 1UHCA 2DL4A 3EG0A 2HCKA 1G2BA 2CUDA 4JZ4A 2FG0A 2RQRA 2DYBA 2V1QA 1QCFA 3VS1A 1RUWA 2OI3A 3H0HA 4J9FA 2LP5A 2GQIA 2O88A 1WX6A 1WXUA 1PRLC 3VS5A 2V1RA 1LCKA 2JMCA 1ZLMA 4AFQC 4RTYA 1Z9ZA 4OMMA 2XMFA 3H0FA 1JXOA 2O2OA 4AFSC 2KYBA 4ZNXA 2PNIA 3M0QA 4J9HA 1PKSA 2KRMA 2YSQA 3A98A 1Y0MA 1JO8A 1MV3A 2F2XA 2F2WA 2NWMA 1FMKA 2J6OA 2GBQA 2DJQA 1AWOA 1NYFA 3I35A 4J9EA 1M3BA 2LQNA 1ABOA 1S1NA 1W6XA 2MOXA 1WXBA 3IQLA 3VS0A 2EGAA 2X3WD 1QKWA 1RLPC 1VA7A 2LZ6B 2AKLA 1CKBA 1GBRA 2BZ8A 3I9QA 2LCSA 1KSWA 2FPFA 2YUNA 4FSSA 2J6KA 4JJDA 1X2KA 2C0OA 2JS2A 2KT8A 3EG1A 2M51A 2ESWA 1U5SA 1M3AA 1T3SA 1BU1A 2D8JA 4ORZA 1SRLA 4CC7A 2VWFA 2RQVA 1TUCA 1UGVA 1K0XA 1X27A 2KT1A 1Y57A 4LE9A 4D8KA 2GNCA 2FRWA 3PVLA 2KBTA 3M0PA 1JQQA 4HVVA 1NG2A 1AEYA 2DNUA 4RUGA 1N5ZA 4F17A 1MUZA 1M30A 2RNAA 4GLMA 4AFZC 2YT6A 3M0SA 1NLPC 1PHTA 1SEMA 2VKNA 1SSHA 1MV0B 3REAB 2ROTA 1GFDA 2SEMA 2MIOA 4HCKA 5IHKA 2EGCA 1UTIA 2KGTA 1GCQC 2G6FX 4RTZA 2CUBA 4LUEA 2A37A 2D1XA 1PKTA 3PE0A 3UA6A 3FJ5A 3O5ZA 3VRYA 2YUPA 1E6GA 2LMJA 1AWXA 3EHQA 2EYYA 1ZX6A 2DILA 4CC3A 2CSIA 1RI9A 1T0HA 2GGRA 2K9GA 1AD5A 4K11A 3TVTA 2ABLA 1G83A 1JXMA 2I0NA 1X43A 2KEAA 3QWXX 3SEMA 2HSPA 1UDLA 2MCNA 1RLQC 2LQWA 4AG1C 4Z89A 1UG1A 4LN2A 3NMZC 1X6BA 1H8KA 2C0TA 5FWBA 2DRKA 1GFCA 1GCPA 3TSWA 2P4RA 2RPNA 2RMOA 3THKA 5GJVB 2GTJA 5I22A 1UJ0A 3KFVA 2HDAA 2BZYA 3UATA 1SHGA 1SPKA 1HJDA 3ULRB 2K3BA 2EYWA 3SHWA 1QWEA 2DBKA 2AKKA 2IIMA 2J06A 2RQWA 4J9CA 2KRSA 2KR3A 1VYVA 3RBBB 3R6NA 1Z9QA 4JPBW 2B86A 2D0NA 3VS7A 1KJWA 1XOVA 2EYZA 2BTTA 4RTWA 1OPLA 4HXJA 3M0UA 4HVUA 2BZXA 2J6FA 3RNJA 1PRMC 2ED0A 1K4US 3PVQA 2PTKA 1X69A 2DLPA 2DL3A 2J05A 1ABQA 1ARKA 1EFNA 1NLOC 4OMQA 2A28A 3VRZA 1H3HA 2DM1A 2L3QA 2AZVA 1WXTA 2ROLA 3VS3A 4OMNA 1BBZA 1YCSB 2RF0A 1TG0A 3EHRA 3ZL7C 2VVKA 4D8DA 4Z88A 1JU5C 1AVZC 4AFUC 4HVWA 4RTVA 2X3XD 2A36A 2DVJA 5FW9A 4Z8AA 2KE9A 2JXBA 2RQTA 2CT3A 1UFFA 1ZBJA 2YUOA 4F14A 2D8HA 3QWYA 4E6RA 1NM7A 1NEBA 2DMOA 5L23A 2CT4A 4DEXA 1FYNA 4J9IA 4JZ3A 3EGUA 4F16A 2DX1A 2PZ1A 2SRCA 1U3OA 2JMAA 2FRYA 4R0KA 2EVRA 2RQUA 2W10A 3LH5A 2C0IA 4CC4B 3C0CA 4J9GA 2KXCA 1I0CA 4OMLA 2O31A 3VS2A 1WLPB 2L2PA 2AZSA 3VS6A 1AWWA 1AZGB 4KRTA 1WDXA 1WFWA 1I07A 5IXFA 1CKAA 1JEGA 1M3CA 2LJ0A 2CDTA 2L0AA 1WA7A 3I5RA 4OMOA 3M0RA 2YDLA 2CSQA 1B07A 2L3SA 1ZUYA 3VS4A 2YUQA 2FPEA 1KFZA 2LX7A 2CH4A 5HCKA 4A63B 2EBPA 1WYXA 2DL8A 3CQTA 1W1FA 4DEYA 2EKHA 5IH2A 1KIKA 3EG3A 4EIKA 1X2QA 3TSZA 2JM9A 5IHNA 2NUZA 1I1JA 1J3TA 1HD3A 2KRNA 3GBQA 1UUEA 1AWJA 4ESRA 4IIOA 1PWTA 4WCIA 2DE0X 5EC7A 2LJ1A 3JV3A 1QLYA 2DRMA 1SHFA 2K6DA 1H92A 2HBWA 2JW4A 5IXBA 1GL5A 4OMPA 3EG2A 1K76A 1OOTA 5FWCA 1CSKA 1SRMA 2H8HA 4JJBA 2K7AA 4QT7A 2EGEA 2JM8A 1B3QA 2FEIA 1OV3A 2K2MA 4GBQA 2OJ2A 2GTOA 1W70A 5I11A 1ZUUA 3UA7A 4AG2C 3NGPA 1K1ZA 2O9VA 1QKXA 1BK2A 2RN8A 2JS0A 2J7IA 2LJ3A 1YWOA 3NHNA 4IIMA 4JJCA 1VYUA 1M27C 2CREA 4RTUA 1T0JA 2FO0A 4J9DA 1A0NB 2ECZA 1OEBA 1VYTA 2KYMA 2EPDA 1GCQA 4M4ZA 2AK5A 2A08A 1UE9A 2EYXA 1OPKA 1HSQA 1E6HA 1ZUKA 2M0YA 1X6GA 5IHIA 1PNJA 1NEGA 2EW3A 1YWPA 5GJWB 4LNPA 1V1CA
chains in the Genus database with same CATH superfamily
3V8JA 3H41A 4Y92A 1WI7A 2XI9A 4EMHA 1JJ2A 4QQGA 4M77B 1YHQT 5GAMd 2AT1B 1UJYA 4LUDA 1OI1A 2HEQA 5AYFA 5CCAA 4XTWA 2DO3A 1ZSGA 1PG5B 1ZA1B 3CCLQ 2KNBB 5DLOA 5CKEA 1PD1A 2QTVA 3NTHA 4EMGA 1AZEA 1E7OA 2NLUA 1WJRA 1RAGB 2O9SA 2WSCE 2DL7A 3HHTB 2RD1A 2L3PA 2DBMA 7AT1B 2A7YA 5GANd 1D0YA 3A8MB 1U06A 3CCSA 3LX7A 1QMCA 3SFMA 3QBYA 2DL5A 4FT2A 4QQ6A 4NL3A 1IXDA 1K9AA 3ZEHA 4M7DB 4LDXA 2HBPA 2HCKA 3MEUA 4XTZA 3S6WA 4KUIA 1G2BA 1YJWA 2FG0A 4MDWA 2K2VA 1R0BG 2FHDA 2LP5A 2GQIA 3OYJA 2O88A 1WX6A 4C5GA 3V8KA 4XU3A 4IUPA 5GAOn 4BD3A 1Y96B 1YHQA 4GLKA 2H3JA 2QI2A 1ZLMA 1K9MR 3QKJA 3JAME 1EX4A 5CKFA 5GANj 4C92D 3NTIA 1JXOA 4LD9K 4AFSC 3C12A 3H6ZA 4J9HA 1Y0MA 4KGXB 2F2XA 2F2WA 3UPUA 4MMLA 3J7AF 1NYFA 2IG0A 2ZZDA 3I35A 1IHVA 4C8QE 2MI6A 4J9EA 2KAFA 2YWWA 1M3BA 1Y07A 1M5Q1 3OQ5A 4EPCA 4FCYA 3R6OA 2A0FB 1BIBA 2LDMA 2HAXA 2LCSA 5I2MA 2BUDA 2YUNA 3WVEB 4C0DC 2BIVA 3M57A 2X35A 2C0OA 2K3YA 2M51A 2X4XA 1M2VA 2YHTA 2VWFA 1VQNT 2HKQB 4JDSA 2FZGB 1D09B 3PVLA 4A4KA 5J3BA 3QYGB 1Q86R 1NG2A 2P0PA 1AEYA 4KGVB 4BDYA 3JRZA 2M02A 1TXQA 5EG2A 1W2BA 2MF2A 2K3XA 4C92G 1NLPC 1TSFA 1MV0B 3A8GB 2EAYA 2SEMA 5IHKA 5J39A 4DBHA 1UTIA 1K9MU 1TH7A 4LUEA 4PNOA 1M90R 4WTOB 2D1XA 3CMET 1PKTA 3OSVA 3O5ZA 3BDLA 4RMOA 2WSFE 2LC4A 1RI9A 2M0OA 1T0HA 2CZ0B 1K8AR 5DM7R 4K11A 2VC8A 3TVTA 5I21A 1G83A 5KYUA 3HKSA 3ER0A 1JXMA 1X43A 4E7SA 4E2FB 1M1KR 2YRDA 1VQNA 2HSPA 2KK4A 1UDLA 4O5VA 1RLQC 1LPLA 4AG1C 4N0AC 1H8KA 5FWBA 3UT1A 3KBGA 1GCPA 4IUVA 5HY6A 2RPNA 3G71T 5AT1B 2RK2A 5GJVB 5I22A 3A8HB 3KFVA 3PMTA 1WHKA 4C5IA 3UATA 1XJWB 2GCXA 3LW5E 2VV5A 2XG8D 1Q81C 1QWEA 3CMEQ 4M75B 3I55T 4HT8A 3JCMd 3X24B 1VIFA 1IZ6A 4EMKB 2XICA 2VUBA 3E19A 2QQBA 3E9GA 3R6NA 2ZPFB 1MHNA 1QVFP 3I56T 5LJ3f 2RJFA 3G4ST 2BTTA 1OPLA 5GMKe 4M78B 4B9XA 1Q86U 4HVUA 3M56A 3RNJA 1P92A 2D9TA 3A1PA 2Y4XA 1H3ZA 2O4XA 2PTKA 1VQPA 2E41A 1RI0A 4CI0C 1JBMA 1QQJA 2A28A 4C8QD 1S72Q 2L3QA 3S3NA 2AZVA 2AHJB 4XTUA 2EIFA 2L8DA 3VS3A 1VQOQ 1VQ7A 3ZL7C 3PTAA 3X25B 1OYXA 1M90U 1RABB 3I55Q 4J5YA 3G71A 2LX9A 2DVJA 2ZCFB 5FW9A 2KE9A 2XK0A 1QVFS 1IHWA 1K8AU 1ZSZA 1NEBA 4M7DC 2GQVA 1FYNA 2DX1A 2PZ1A 4PJOA 1NPPA 2DFUA 1TU0B 2H3EB 3CC4A 1M9SA 3LH5A 3I56A 2OTLQ 1RADB 3C0CA 3TQ7P 3G4SA 4OB1B 1I0CA 2EKOA 3VS2A 4XTVA 3EG9A 1G3TA 3EFRA 4A53A 1KQ2A 1QW1A 3M58A 1B7TA 4L59A 3L2VA 5IXFA 1FMVA 1UB4A 2ZPIB 1YJNT 2LJ0A 2L0AA 4ANJA 3NFCA 4D6WA 3I5RA 2KQWA 4QKUA 5FRMA 1B07A 1BI1A 2QEXQ 2DTOA 4JRPA 4C8QG 2FPEA 3CXCS 2CH4A 4NL2A 5HCKA 2F5TX 2O01E 3INZA 4KT0E 5CAIA 5GAN2 4DEYA 2EKHA 2COZA 1IRXA 1X2QA 3JSCA 2JM9A 5IHNA 2CP3A 2KRNA 4OB0B 2ZPHB 4WCIA 2HMAA 2ZPBB 3EFOA 1N6AA 1YJNQ 2DRMA 1VQ6T 3SDZA 3CCJT 2K6DA 4ZTFA 2JW4A 4DA4A 1KHIA 4M7AE 5HKCA 2E3HA 4JRIA 3BDUA 5LJ3g 4OMPA 1YJNA 1OOTA 3MPUB 4F7UB 2QDYB 3CCVQ 3JB9H 4JLGA 3JCMW 2FEIA 3AHUA 2MAMA 4EDUA 1VQ8T 1VQKQ 1JRIA 2GTOA 2RA2A 2QQAA 4KULA 1K1ZA 2DERA 1QKXA 2QTXA 3QSUA 2NUPA 3Q1JA 4XU2A 1RAIB 3CCJQ 3OYDA 1M1GA 4J9DA 4F04B 1A0NB 3M55A 3LH0A 4OGEA 2DVEA 1OX9A 4M77F 2AK5A 1KC8R 1OPKA 4M7DE 1HSQA 3L42A 2RI5A 5LJ5e 2R5MA 1ZUKA 1VQ6A 3BW1A 3CCJA 2LVMA 5GJWB 1V1CA 5FU7B 5CQXA 1HK9A 4RG8A 3E2UA 3EGDB 1VQ9T 5KYUB 3MEWA 4RTXA 1D3BB 1QP3A 5LJ5h 4JRQA 3QUIA 1XNIA 4FM4B 3L2ZA 3M9QA 1VQ4T 4M75C 3U23A 2FPDA 4BUGA 2CP2A 5GAOq 4EMKC 1GRIA 1NYGA 2KXDA 1VQ8A 1KG1A 3GPLA 2F2VA 2GFAA 1M8MA 3GNFB 2K79A 1N8RU 4M7DF 4RTTA 3AT1B 2VGNA 3GNGA 3OYKA 2JT4A 1IO6A 1D1AA 2IPOB 2QDLA 1LJOA 2DF6A 4JUVA 4X1VA 4CC2A 2E65A 1YITT 3OS2A 2JUFA 2JN0A 3L2WA 2KROA 2DK3A 1UHFA 5FRNA 2QQRA 4MZPA 5GMKm 2O4XB 2RQRA 2R5AA 3M4GA 2DYBA 3VS1A 3L2RA 3H0HA 1QCNA 1PSEA 1VQ9A 2MK5A 1VQ5A 1G5VA 2FB7A 3VS5A 1KC8U 1VQ4A 1M4ZA 3PFSA 4Z02A 4ZN3A 2MYSA 2XMFA 5GAOl 2O2OA 2KYBA 2CS7A 3JCMX 4ZNXA 4M7AD 3A98A 5LJ3h 2NWMA 2J6OA 5L8RE 1EZZB 4FIBA 4II1A 1Y7XA 1KQSS 1NZ9A 5KYXA 4Q5WA 1K73C 1S1NA 1W6XA 1YITA 4PJOB 5FLXE 1VQLQ 3QDFA 2EGAA 3CC2T 2RI3A 4BI3A 1YI2A 1OZ2A 4XTYA 5KE3A 2BZ8A 4QVZA 3RESA 3I9QA 3VV0A 3CCLT 2XU8A 3EG9B 1QP2A 2K5IA 3MJXA 1X01A 2JS2A 3EG1A 3J80E 3GIBA 4MZMA 1BU1A 3JCMQ 3RMQA 2ZPGB 2KSSA 1TUCA 1OZ3A 1UGVA 1X27A 2KT1A 4PL6A 1WJSA 1G3YA 1RAHB 1TUGB 2CZ7B 2KBTA 3E1SA 1W4SA 2JNGA 3QXEB 1VUBA 3MKDA 5D6XA 2FZCB 4PFZA 2DNUA 4R55A 1BI0A 3V7SA 4M75E 1N5ZA 4F17A 1MUZA 1QVGP 3CC2Q 4GLMA 3M0SA 2DEQA 2OTJQ 1SEMA 3META 1SSHA 3LYIA 1WNLA 3REAB 2ROTA 3SB2A 2MIOA 3V7CA 2KGTA 1GCQC 3CD6Q 4M7AG 8AT1B 2CUBA 3QO3A 4BDZA 1NJIC 2A37A 2DXCA 1N9RA 1G8XA 2BKDN 3PE0A 4XQ3A 5FROA 2DETA 1QVPA 2YUPA 3EFOB 3LGLA 4PLLA 1AWXA 2NUTA 3TREA 4CRIA 3EHQA 2EYYA 3CCLA 1AHJB 3FC3A 3DB4A 3M53A 2LTOA 3VU3C 4BI8B 2P4TA 2DEUA 1MNDA 3PNWC 2KEAA 4FYVB 4M75F 1QVGS 1UG1A 5KYYB 4ZGJB 1RAFB 2DRKA 2CP5A 3FJPA 2YXYA 3TSWA 2RMOA 3LWHA 3F70A 2VB6A 2BZYA 1SHGA 4FU6A 2CP7A 4M78F 5GAN4 3JB9F 2I2LA 4LXCA 4C8QA 3OYAA 2EYWA 5HK3A 1QVFA 2MWPA 1MNEA 2RQWA 1IGUA 3OYBA 2NUPB 1O75A 3PIPA 3M54A 1Z9QA 4QQDA 5KE2A 3QG1A 2R58A 2EYZA 2X51A 2EQMA 3N5BB 3M0UA 3ZFJA 1PRMC 2J05A 5IT9E 4BI4A 1BI3A 3VRZA 4BE1A 2DM1A 1WXTA 3VYHB 4E7ZA 1TG0A 3EHRA 1QCOA 4Z88A 1AVZC 1FWZA 4OB2B 3EGXA 3CCUT 2CP6A 2JXBA 4JS4A 3CBPA 3SD4A 2L5QA 1NPRA 1X75C 4F14A 2D8HA 2CT4A 2LT1A 4DEXA 4F16A 5LJ5f 1U3OA 2LRQA 2RQUA 2JVVA 4MZTA 4MMKA 4C92B 4PFOA 2W10A 1YJ9T 1ZQ1A 3LGFA 3JCMP 2K57A 2RJDA 1B34B 8ATCB 3BE3A 1WDXA 1I07A 2L89A 2DTIA 1WHGA 4F7UE 4B9WA 2CDTA 3CCUQ 4ATOA 4XU0A 2CSQA 1UGSB 2E3IA 2RHIA 2COYA 3URGA 2FYKA 3VYGA 4E7LA 2BE7D 4NS5A 3CBMA 2NYSA 4HT9A 2LX7A 3FIFA 4BE0A 2EBPA 3CQTA 1YJ9Q 1W1FA 3GOXA 3MO8A 5IH2A 4KGZB 2B8AA 3OYMA 1S72T 2PQWA 1VQOT 4Y28E 2LQ8A 3TSZA 5KYNA 2GF7A 5KYXB 1LOJA 5GAMe 1HD3A 4F7UF 3GBQA 2F69A 3CMAQ 4IIOA 1PWTA 3V7RA 1YJ9A 1I81A 3QHSA 1KQ1A 4PJMA 2XIDA 2KI7A 3L2QA 5CR2A 1PSFA 4NOYA 3CMEA 3UWNA 1NBEB 4M77C 2RI2A 2HNIA 2JOYA 3H8ZA 1SRMA 5GANe 2K7AA 4QT7A 2EGEA 2PU9B 3S3OA 2OTLT 3CPWP 2JM8A 1OX8A 4FSXA 4HKEA 3T9NA 2OJ2A 5GMKh 2RHYA 1K8AC 1W70A 3OW2A 4C0GA 2O9VA 2LJ3A 4ELYC 1YIJT 1G3WA 1BKBA 1S72A 4IURA 2FO0A 1VQOA 1DJ7B 1U1TA 1OEBA 1YCYA 2JZ2A 2KYMA 2MPXC 3M59A 4M4ZA 3I55A 1XTDA 5LJ5j 2QEXT 2EYXA 2ZAEA 1M1KU 1WHJA 3HL8A 4LDUA 1E6HA 1Y71A 2CGHA 4E7IA 2M0YA 3SWNA 1PNJA 3CPWS 1YBYA 2QG9B 3CXCP 1M1FA 3NPFA 5LJ5g 5ECAA 1VOMA 5C6SA 1T3LA 1UECA 1TUDA 2JTEA 2ENMA 4HCCA 1FXXA 2DXUA 2ED1A 4E7KA 4N0AA 1YIJQ 2OTLA 4KH0B 1PD0A 1YP5A 1R0CB 2DPPB 1YN8A 1BB9A 2E5QA 3M0TA 5LJ3d 4A4FA 1GBQA 1Q7YR 2LNHB 4C8QB 3RKXA 2F1LA 3CCQQ 3REBB 2OAWA 1K0SA 3UF4A 2XDDA 3CCVT 5A2QE 4JS5A 1H641 2DA9A 2QA4Q 4J9BA 1AOJA 4LDVA 4RCBA 2E5KA 3MCAB 2QEXA 2W0ZA 4M7AA 3I5SA 1VQKT 2RJEA 2DTHA 1HYOA 1YFNA 2CUDA 4JZ4A 2E10A 1QCFA 1RUWA 2OI3A 1O9SA 4J9FA 3NTKA 2E70A 4J6YA 2FL7A 1VQMT 5LJ3j 4KBMB 3OB9A 1PRLC 1OQKA 1W2BS 4BY6B 2JMCA 2EQKA 4RTYA 4PJNA 1RAEB 4PJOF 4M77E 5A0LA 1M2VB 3H0FA 2RO0A 4QW2A 5KCHA 3QDRB 2PNIA 4C92C 1PKSA 2YSQA 3OYNA 1JO8A 1MV3A 1IB8A 1FMKA 4PJJA 2ZGWA 3OS0A 2DJQA 1AWOA 1KD1R 1GXIE 4M7DA 2Z0WA 3X20B 3CCVA 1WGSA 3IQLA 3VS0A 3QIIA 2DAQA 3VKIA 2FZKB 1VQMQ 1QKWA 2ATCB 1VA7A 2LZ6B 5D6YA 2AKLA 1CKBA 1VQKA 2OAUA 4BE2A 3OYCA 1OU8A 1Q7YU 2VXEA 3L2UA 2P0KA 2J6KA 3CC7Q 4WF2A 5CO7A 4JJDA 3X26B 5GAOr 2KT8A 4A54A 2ESWA 1U5SA 1M3AA 4ORZA 3PT9A 3J81E 3TU4K 2RM4A 2GFUA 2M9UA 2DD5A 4VUBA 1Y57A 4LE9A 4D8KA 2GNCA 2FRWA 3RIRA 1QVGA 3M0PA 2X4WA 4HVVA 2X4YA 1EIFA 2RB6A 2RK1A 4OMFB 3JCMb 4ZN1A 1N8RC 2G3RA 1RL2A 2RNAA 4AFZC 1Q82R 3OYGA 5I2SA 2QASA 1I5OB 1PHTA 4HCKA 2EGCA 2G6FX 3JCMJ 4M78C 1MMAA 2HKNA 3FJ5A 3VRYA 1E6GA 2LMJA 4C0ZA 2DILA 4BB7A 2CSIA 2K9GA 3HP9A 4TVRA 1KHCA 1K73R 2ABLA 4J7IA 1KD1U 1OU9A 2I0NA 3QWXX 3CCMQ 2E64A 4BACA 3MHXA 3RERA 2MCNA 1KQSP 4Z89A 3PMIA 3OY9A 1VQLT 1ACMB 3NMZC 2C0TA 1TS9A 3MP1A 4ME7A 4YTLA 2V8JA 2DYIA 1UJ0A 1TOVA 3OYIA 2CYZB 4FYWB 3ULRB 5GAMf 3SHWA 2DBKA 2AKKA 2IIMA 5IN1A 5J26A 4J9CA 3CCRQ 2M1HA 3HRTA 2KR3A 1VYVA 2EWNA 4C92E 3RBBB 4JPBW 1ZSZB 2F5KA 3DLMA 2QAZA 4M77D 4HXJA 4ELZC 3TEEA 2BZXA 3D7SB 2HZYA 1D0ZA 2ED0A 4J83A 4A4GA 3G6EQ 3OBYA 5CIUA 5GAN7 5CQYA 1X69A 3SWNB 3CCEQ 2HQXA 5D7UA 5GANf 2DL3A 4XAXB 4Y91A 2RH2A 1EFNA 2QQ9A 1NLOC 1Q82U 2OTJT 2RHUA 2HL3A 3EH1A 2ROLA 1NJIR 4OMNA 1BBZA 3KXTA 2RF0A 4IUUA 3CD6T 4C8QC 1VQLA 4M75A 2X3XD 3QJ6A 2LCCA 4C92F 4EMKA 5CKBA 4Z8AA 1V29B 3EH2A 3P8BB 4XU1A 4M7DD 3CCST 1K73U 2XDPA 4E6RA 3UDCA 5L23A 3MP8A 4DBRA 3EGUA 3FRNA 2FRYA 1YJWT 4R0KA 2QXFA 1PCXA 2E6ZA 4OMLA 3MP6A 2O31A 1OULA 4M7AB 3HPWA 4BY6C 1WHLA 4M78E 4DBQA 4M77G 1WFWA 3CC2A 2OTJA 1WA7A 1X6OA 2LT4A 2PVGB 3M0RA 1U1SA 3CCSQ 3CD6A 3C95A 2YDLA 4RKUE 3FEOA 2KVQG 2PUOB 5CVIA 3RR6A 3O8VA 4DOVA 1KFZA 1RACB 4HA8A 5GAN3 1WHMA 1YJWQ 5DY9A 2E1HA 2EQJA 2V26A 3RKWA 2E4HA 3ASKA 1NJIU 5GAMj 2EYQA 2NUZA 4JJNK 1J3TA 4IKFA 4AMCA 1YHQQ 1SG5A 4M7DG 1UEBA 1UUEA 1AWJA 3PGGA 3ME9A 4ESRA 2K5LA 3OYEA 2KDSA 2DE0X 4PFPA 2LJ1A 4J8OA 4QVCA 3JV3A 4LD6A 5GAMg 3EAEA 3CBOA 5FU7C 2HBWA 4LDWA 3JCMV 5GMKj 2L3RA 2X9HA 5IXBA 1C0MA 4XK8E 3CPWA 2DXTA 2D0QB 3MEVA 1FMWA 3EG2A 5FWCA 4JJBA 4QVDA 2HL5C 1N9SA 1IREB 2DIQA 3QZ5B 3QYHB 5GANg 5GAOp 4GBQA 2YRCA 4FYXB 3UA7A 3QJYA 1BYMA 2RN8A 2E12A 3ZBDA 4IIMA 1VYUA 1BIAA 2CREA 4RTUA 4PJLA 3CPFA 1T0JA 2IVWA 4KUDK 2ECZA 1VYTA 1GCQA 4N4GA 3JCMc 3CXCA 2A08A 3LWIA 1V76A 2CP0A 5D6WA 1K9MC 1X6GA 4F7UA 3JCMf 4LNPA 2D6FA 2HD0A 2CKKA 1QWFA 3TCJA 2CH4W 3OS5A 4L5GA 4C8QF 1Q81R 1WHHA 4M75D 3KUFA 1BCOA 2PUKB 2K5FA 2QYZA 3CMAT 1TTHB 3H0IA 1JJ2P 1SF9A 2AIRB 2DJZA 4M78D 4AT1B 3JB9D 3LLRA 1ZSZC 2C06A 2LNVA 4J6XA 4FT4A 1WIEA 2EQIA 3CCUA 1VQNQ 4PJOC 3SWNC 1VQPT 3C4SA 2BE9B 1YNZA 1M2OA 3EGDA 2DKGA 2DIGA 3S3MA 1UHCA 2XHCA 2DL4A 2EJFA 3EG0A 1D3BA 1R8OB 1VQ7T 5GMKl 3HRSA 3OMGA 1Q86C 1JJ2S 2V1QA 3MEAA 5CKHA 5KCOA 2X4JA 2DXBA 2KY9A 4N4IA 2CZ1B 5A0GA 1TWBA 1WXUA 2V1RA 1AT1B 1LCKA 5GAMh 3VUZA 3CMAA 4AFQC 4HCBA 4RCCA 2EFIA 1Z9ZA 4OMMA 5LJ5d 5CK9A 2VASA 1WZOA 4M75G 1M90C 5GAOm 5M9OA 3RUXA 3M5AA 3M0QA 3CC4T 1VQPQ 4OF1A 2KRMA 3E9FA 2XD0A 1SKUB 2OX7A 1Q81U 2GBQA 4M7AC 1BI2A 2QGGA 3RKYA 1VQ7Q 4M78G 2RHZA 3JB9G 2LQNA 3G7ZA 2E6NA 1ABOA 5GANh 2MOXA 1M1KC 1WXBA 4PKCC 5FU6B 3VJPA 2HQEA 3A5ZB 2X3WD 1RLPC 3G71Q 5KH6A 5KYWA 1GBRA 4N4HA 4UC4A 4V2SA 1KSWA 4C5HA 2K4YA 2FPFA 4FSSA 3PIOA 2V8IA 2CZ6B 2KMTA 3CCQT 3WXMB 1X2KA 1T3SA 2RJCA 2D8JA 4CC7A 1SRLA 2NUTB 2RQVA 2RHXA 5A0DA 1K0XA 2QA4T 3CC4Q 3JCMg 3I56Q 3OYHA 3G4SQ 1C1AA 1JQQA 3OSSC 1WQ7A 1I5LA 4RUGA 1JB0E 1WJQA 2WACA 4C5EA 5CKDA 3QPHA 4OP0A 1M30A 2YT6A 2V8KA 1NE8A 2VKNA 5C0MA 1GFDA 3RDVA 4RTZA 5GAN8 1W2BP 1YIJA 4E7HA 3UA6A 3OMCA 2MMPA 4PJOE 2HQHA 2YLCA 5GAN5 1ZX6A 2XDBA 4CC3A 3WVDB 1KQSA 2GGRA 1N27A 3BFMA 1AD5A 4B6MA 4OGCA 4X34A 4ZGEB 3CCQA 4P5NA 2JTFA 4R56A 3SEMA 2MWOA 4M77A 3RMSA 1BCMA 2LQWA 2QA4A 4LN2A 2JTMA 1X6BA 4RG2A 1GFCA 4E7JA 1ZBXA 2P4RA 4O6JA 3P8HA 4C0FA 2QGFB 1FX7A 3THKA 2GTJA 2HDAA 3L1AA 1VIEA 1SPKA 1HJDA 3CC7T 1MMDA 2K3BA 2YRVA 1M8VA 2J06A 3FB9A 2VYTA 4XTXA 1SSFA 3EGXB 2KRSA 3HRUA 1MMNA 2B86A 1LVKA 2D0NA 3VS7A 1WQWA 3M4YA 1KJWA 1XOVA 1N8RR 4RTWA 1HXDA 1MMGA 2JJ9A 4JRKA 3C94A 2J6FA 1Q7YC 3GLXA 1MGQA 1K4US 3PVQA 5KYYA 2VGMA 4F7UG 2DLPA 1R77A 1UGPB 1ABQA 2ZPEB 1ARKA 4OMQA 1H3HA 3FLGA 3H9NA 1Y96A 1YCSB 2DZCA 2VVKA 4D8DA 1JU5C 3GP8A 4AFUC 4ZGDB 4HVWA 2DD4A 3JCMe 4RTVA 1VQMA 1XQHA 3OA6A 2A36A 5DLQE 1VQ6Q 2VXFA 4IUQA 3OW2P 2LCLA 2RQTA 2CT3A 3CC7A 4M7AF 2Y4YA 1ZA2B 1UFFA 2FVUA 1ZBJA 2WSEE 2YUOA 3QWYA 1NM7A 4OB3B 3CCMT 2DMOA 4FW2A 4PK4A 4J9IA 4JZ3A 3JCMh 9ATCB 2SRCA 1IGQA 3CEYA 4X9DA 2JMAA 2EVRA 3HFOA 1I4K1 2LQKA 4HCZA 3OBWA 3HSBA 4A4HA 6AT1B 2EJ9A 2C0IA 4CC4B 2PVDB 4J9GA 2KXCA 1WLPB 2L2PA 3GF5A 1VQ8Q 2AZSA 3VS6A 1VQ5T 3P8DA 3VUBA 3JB9J 1AWWA 1AZGB 4KRTA 1KD1C 3DLLA 1CKAA 2A3LA 3CCRT 1JEGA 3EFSA 3OW2S 4ZTJA 1M3CA 2P84A 1KK7A 4L6V5 4DQ2A 3A8OB 4OMOA 3DKMA 4IUTA 4FYYB 2Y90A 2L3SA 4C0DB 1ZUYA 3VS4A 4PJOD 2YUQA 4MDXA 4E47A 3A8LB 3G6ET 2QQSA 4DBFA 2QK0A 4KH1B 1KC8C 1F1BB 4JLIA 3CCET 4A63B 5FU6C 4C92A 3V8LA 1WYXA 2P0QA 2DL8A 3JB9I 2YLBA 1KIKA 1VQ9Q 1G3SA 1YI2T 3CCMA 2PVOB 3EG3A 4EIKA 1VQ5Q 4X9CA 1B34A 1I1JA 3FDRA 3X28B 3DB3A 1VQ4Q 5EC7A 1QLYA 1SHFA 5KYWB 4GY5A 1H92A 5LJ3e 2EQUA 5GMKi 1Q82C 2XKOC 4J7FA 1UGRB 3OYLA 3G1JA 4OVAA 4FL6A 5HK0A 3CCRA 1GL5A 1D0XA 1K76A 1I8FA 1CSKA 2H8HA 1YITQ 3QZ9B 4LDYA 4FW1A 1B3QA 4A4EA 1YI2Q 1OV3A 2K2MA 3OYYA 1ZHIA 2COWA 3G6EA 5I11A 1UGQB 1ZUUA 4AG2C 5GAN6 3NGPA 3HFNA 3CCEA 1BK2A 4PLIA 2JS0A 2J7IA 1YWOA 2M16A 3OYFA 1PM3A 3NHNA 4PJOG 5LL6S 5IAYA 4JJCA 1M27C 2DZ9A 1D1BA 1LNXA 2EPDA 1C6VX 2EJGA 1WPYA 4M78A 1UE9A 3HTRA 1PC0A 2HSEB 3OS1A 1U8RA 2R57A 5IHIA 4J6WA 1RAAB 4DOWA 1NEGA 1Q95G 2EW3A 1YWPA 1D1CA 3BY7A
chains in the Genus database with same CATH topology
3NPFA 5ECAA 1T3LA 1QWFA 1UECA 2CH4W 1TUDA 3H41A 4Y92A 2JTEA 1WI7A 4RTXA 2ENMA 2ED1A 1UJYA 4LUDA 2HEQA 3U23A 2FPDA 3H0IA 1YP5A 1GRIA 1NYGA 2KXDA 1ZSGA 1YN8A 1BB9A 2F2VA 2KNBB 1M8MA 3M0TA 1GBQA 2K79A 2LNHB 4RTTA 1AZEA 1E7OA 2O9SA 2JT4A 1WIEA 1IO6A 2EQIA 2DL7A 3REBB 2OAWA 2QDLA 1K0SA 2DF6A 2L3PA 3UF4A 4X1VA 4CC2A 2DBMA 2DA9A 1U06A 4J9BA 1AOJA 1YNZA 2DL5A 2E5KA 2KROA 1K9AA 2W0ZA 1UHFA 3I5SA 1UHCA 2DL4A 3EG0A 2HCKA 1G2BA 2CUDA 4JZ4A 2FG0A 2RQRA 2DYBA 2V1QA 1QCFA 3VS1A 1RUWA 2OI3A 3H0HA 4J9FA 2LP5A 2GQIA 2O88A 1WX6A 1WXUA 1PRLC 3VS5A 2V1RA 1LCKA 2JMCA 1ZLMA 4AFQC 4RTYA 1Z9ZA 4OMMA 2XMFA 3H0FA 1JXOA 2O2OA 4AFSC 2KYBA 4ZNXA 2PNIA 3M0QA 4J9HA 1PKSA 2KRMA 2YSQA 3A98A 1Y0MA 1JO8A 1MV3A 2F2XA 2F2WA 2NWMA 1FMKA 2J6OA 2GBQA 2DJQA 1AWOA 1NYFA 3I35A 4J9EA 1M3BA 2LQNA 1ABOA 1S1NA 1W6XA 2MOXA 1WXBA 3IQLA 3VS0A 2EGAA 2X3WD 1QKWA 1RLPC 1VA7A 2LZ6B 2AKLA 1CKBA 1GBRA 2BZ8A 3I9QA 2LCSA 1KSWA 2FPFA 2YUNA 4FSSA 2J6KA 4JJDA 1X2KA 2C0OA 2JS2A 2KT8A 3EG1A 2M51A 2ESWA 1U5SA 1M3AA 1T3SA 1BU1A 2D8JA 4ORZA 1SRLA 4CC7A 2VWFA 2RQVA 1TUCA 1UGVA 1K0XA 1X27A 2KT1A 1Y57A 4LE9A 4D8KA 2GNCA 2FRWA 3PVLA 2KBTA 3M0PA 1JQQA 4HVVA 1NG2A 1AEYA 2DNUA 4RUGA 1N5ZA 4F17A 1MUZA 1M30A 2RNAA 4GLMA 4AFZC 2YT6A 3M0SA 1NLPC 1PHTA 1SEMA 2VKNA 1SSHA 1MV0B 3REAB 2ROTA 1GFDA 2SEMA 2MIOA 4HCKA 5IHKA 2EGCA 1UTIA 2KGTA 1GCQC 2G6FX 4RTZA 2CUBA 4LUEA 2A37A 2D1XA 1PKTA 3PE0A 3UA6A 3FJ5A 3O5ZA 3VRYA 2YUPA 1E6GA 2LMJA 1AWXA 3EHQA 2EYYA 1ZX6A 2DILA 4CC3A 2CSIA 1RI9A 1T0HA 2GGRA 2K9GA 1AD5A 4K11A 3TVTA 2ABLA 1G83A 1JXMA 2I0NA 1X43A 2KEAA 3QWXX 3SEMA 2HSPA 1UDLA 2MCNA 1RLQC 2LQWA 4AG1C 4Z89A 1UG1A 4LN2A 3NMZC 1X6BA 1H8KA 2C0TA 5FWBA 2DRKA 1GFCA 1GCPA 3TSWA 2P4RA 2RPNA 2RMOA 3THKA 5GJVB 2GTJA 5I22A 1UJ0A 3KFVA 2HDAA 2BZYA 3UATA 1SHGA 1SPKA 1HJDA 3ULRB 2K3BA 2EYWA 3SHWA 1QWEA 2DBKA 2AKKA 2IIMA 2J06A 2RQWA 4J9CA 2KRSA 2KR3A 1VYVA 3RBBB 3R6NA 1Z9QA 4JPBW 2B86A 2D0NA 3VS7A 1KJWA 1XOVA 2EYZA 2BTTA 4RTWA 1OPLA 4HXJA 3M0UA 4HVUA 2BZXA 2J6FA 3RNJA 1PRMC 2ED0A 1K4US 3PVQA 2PTKA 1X69A 2DLPA 2DL3A 2J05A 1ABQA 1ARKA 1EFNA 1NLOC 4OMQA 2A28A 3VRZA 1H3HA 2DM1A 2L3QA 2AZVA 1WXTA 2ROLA 3VS3A 4OMNA 1BBZA 1YCSB 2RF0A 1TG0A 3EHRA 3ZL7C 2VVKA 4D8DA 4Z88A 1JU5C 1AVZC 4AFUC 4HVWA 4RTVA 2X3XD 2A36A 2DVJA 5FW9A 4Z8AA 2KE9A 2JXBA 2RQTA 2CT3A 1UFFA 1ZBJA 2YUOA 4F14A 2D8HA 3QWYA 4E6RA 1NM7A 1NEBA 2DMOA 5L23A 2CT4A 4DEXA 1FYNA 4J9IA 4JZ3A 3EGUA 4F16A 2DX1A 2PZ1A 2SRCA 1U3OA 2JMAA 2FRYA 4R0KA 2EVRA 2RQUA 2W10A 3LH5A 2C0IA 4CC4B 3C0CA 4J9GA 2KXCA 1I0CA 4OMLA 2O31A 3VS2A 1WLPB 2L2PA 2AZSA 3VS6A 1AWWA 1AZGB 4KRTA 1WDXA 1WFWA 1I07A 5IXFA 1CKAA 1JEGA 1M3CA 2LJ0A 2CDTA 2L0AA 1WA7A 3I5RA 4OMOA 3M0RA 2YDLA 2CSQA 1B07A 2L3SA 1ZUYA 3VS4A 2YUQA 2FPEA 1KFZA 2LX7A 2CH4A 5HCKA 4A63B 2EBPA 1WYXA 2DL8A 3CQTA 1W1FA 4DEYA 2EKHA 5IH2A 1KIKA 3EG3A 4EIKA 1X2QA 3TSZA 2JM9A 5IHNA 2NUZA 1I1JA 1J3TA 1HD3A 2KRNA 3GBQA 1UUEA 1AWJA 4ESRA 4IIOA 1PWTA 4WCIA 2DE0X 5EC7A 2LJ1A 3JV3A 1QLYA 2DRMA 1SHFA 2K6DA 1H92A 2HBWA 2JW4A 5IXBA 1GL5A 4OMPA 3EG2A 1K76A 1OOTA 5FWCA 1CSKA 1SRMA 2H8HA 4JJBA 2K7AA 4QT7A 2EGEA 2JM8A 1B3QA 2FEIA 1OV3A 2K2MA 4GBQA 2OJ2A 2GTOA 1W70A 5I11A 1ZUUA 3UA7A 4AG2C 3NGPA 1K1ZA 2O9VA 1QKXA 1BK2A 2RN8A 2JS0A 2J7IA 2LJ3A 1YWOA 3NHNA 4IIMA 4JJCA 1VYUA 1M27C 2CREA 4RTUA 1T0JA 2FO0A 4J9DA 1A0NB 2ECZA 1OEBA 1VYTA 2KYMA 2EPDA 1GCQA 4M4ZA 2AK5A 2A08A 1UE9A 2EYXA 1OPKA 1HSQA 1E6HA 1ZUKA 2M0YA 1X6GA 5IHIA 1PNJA 1NEGA 2EW3A 1YWPA 5GJWB 4LNPA 1V1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NPF A;  5ECA A;  1T3L A;  1QWF A;  1UEC A;  2CH4 W;  1TUD A;  3H41 A;  4Y92 A;  2JTE A;  1WI7 A;  4RTX A;  2ENM A;  2ED1 A;  1UJY A;  4LUD A;  2HEQ A;  3U23 A;  2FPD A;  3H0I A;  1YP5 A;  1GRI A;  1NYG A;  2KXD A;  1ZSG A;  1YN8 A;  1BB9 A;  2F2V A;  2KNB B;  1M8M A;  3M0T A;  1GBQ A;  2K79 A;  2LNH B;  4RTT A;  1AZE A;  1E7O A;  2O9S A;  2JT4 A;  1WIE A;  1IO6 A;  2EQI A;  2DL7 A;  3REB B;  2OAW A;  2QDL A;  1K0S A;  2DF6 A;  2L3P A;  3UF4 A;  4X1V A;  4CC2 A;  2DBM A;  2DA9 A;  1U06 A;  4J9B A;  1AOJ A;  1YNZ A;  2DL5 A;  2E5K A;  2KRO A;  1K9A A;  2W0Z A;  1UHF A;  3I5S A;  1UHC A;  2DL4 A;  3EG0 A;  2HCK A;  1G2B A;  2CUD A;  4JZ4 A;  2FG0 A;  2RQR A;  2DYB A;  2V1Q A;  1QCF A;  3VS1 A;  1RUW A;  2OI3 A;  3H0H A;  4J9F A;  2LP5 A;  2GQI A;  2O88 A;  1WX6 A;  1WXU A;  1PRL C;  3VS5 A;  2V1R A;  1LCK A;  2JMC A;  1ZLM A;  4AFQ C;  4RTY A;  1Z9Z A;  4OMM A;  2XMF A;  3H0F A;  1JXO A;  2O2O A;  4AFS C;  2KYB A;  4ZNX A;  2PNI A;  3M0Q A;  4J9H A;  1PKS A;  2KRM A;  2YSQ A;  3A98 A;  1Y0M A;  1JO8 A;  1MV3 A;  2F2X A;  2F2W A;  2NWM A;  1FMK A;  2J6O A;  2GBQ A;  2DJQ A;  1AWO A;  1NYF A;  3I35 A;  4J9E A;  1M3B A;  2LQN A;  1ABO A;  1S1N A;  1W6X A;  2MOX A;  1WXB A;  3IQL A;  3VS0 A;  2EGA A;  2X3W D;  1QKW A;  1RLP C;  1VA7 A;  2LZ6 B;  2AKL A;  1CKB A;  1GBR A;  2BZ8 A;  3I9Q A;  2LCS A;  1KSW A;  2FPF A;  2YUN A;  4FSS A;  2J6K A;  4JJD A;  1X2K A;  2C0O A;  2JS2 A;  2KT8 A;  3EG1 A;  2M51 A;  2ESW A;  1U5S A;  1M3A A;  1T3S A;  1BU1 A;  2D8J A;  4ORZ A;  1SRL A;  4CC7 A;  2VWF A;  2RQV A;  1TUC A;  1UGV A;  1K0X A;  1X27 A;  2KT1 A;  1Y57 A;  4LE9 A;  4D8K A;  2GNC A;  2FRW A;  3PVL A;  2KBT A;  3M0P A;  1JQQ A;  4HVV A;  1NG2 A;  1AEY A;  2DNU A;  4RUG A;  1N5Z A;  4F17 A;  1MUZ A;  1M30 A;  2RNA A;  4GLM A;  4AFZ C;  2YT6 A;  3M0S A;  1NLP C;  1PHT A;  1SEM A;  2VKN A;  1SSH A;  1MV0 B;  3REA B;  2ROT A;  1GFD A;  2SEM A;  2MIO A;  4HCK A;  5IHK A;  2EGC A;  1UTI A;  2KGT A;  1GCQ C;  2G6F X;  4RTZ A;  2CUB A;  4LUE A;  2A37 A;  2D1X A;  1PKT A;  3PE0 A;  3UA6 A;  3FJ5 A;  3O5Z A;  3VRY A;  2YUP A;  1E6G A;  2LMJ A;  1AWX A;  3EHQ A;  2EYY A;  1ZX6 A;  2DIL A;  4CC3 A;  2CSI A;  1RI9 A;  1T0H A;  2GGR A;  2K9G A;  1AD5 A;  4K11 A;  3TVT A;  2ABL A;  1G83 A;  1JXM A;  2I0N A;  1X43 A;  2KEA A;  3QWX X;  3SEM A;  2HSP A;  1UDL A;  2MCN A;  1RLQ C;  2LQW A;  4AG1 C;  4Z89 A;  1UG1 A;  4LN2 A;  3NMZ C;  1X6B A;  1H8K A;  2C0T A;  5FWB A;  2DRK A;  1GFC A;  1GCP A;  3TSW A;  2P4R A;  2RPN A;  2RMO A;  3THK A;  5GJV B;  2GTJ A;  5I22 A;  1UJ0 A;  3KFV A;  2HDA A;  2BZY A;  3UAT A;  1SHG A;  1SPK A;  1HJD A;  3ULR B;  2K3B A;  2EYW A;  3SHW A;  1QWE A;  2DBK A;  2AKK A;  2IIM A;  2J06 A;  2RQW A;  4J9C A;  2KRS A;  2KR3 A;  1VYV A;  3RBB B;  3R6N A;  1Z9Q A;  4JPB W;  2B86 A;  2D0N A;  3VS7 A;  1KJW A;  1XOV A;  2EYZ A;  2BTT A;  4RTW A;  1OPL A;  4HXJ A;  3M0U A;  4HVU A;  2BZX A;  2J6F A;  3RNJ A;  1PRM C;  2ED0 A;  1K4U S;  3PVQ A;  2PTK A;  1X69 A;  2DLP A;  2DL3 A;  2J05 A;  1ABQ A;  1ARK A;  1EFN A;  1NLO C;  4OMQ A;  2A28 A;  3VRZ A;  1H3H A;  2DM1 A;  2L3Q A;  2AZV A;  1WXT A;  2ROL A;  3VS3 A;  4OMN A;  1BBZ A;  1YCS B;  2RF0 A;  1TG0 A;  3EHR A;  3ZL7 C;  2VVK A;  4D8D A;  4Z88 A;  1JU5 C;  1AVZ C;  4AFU C;  4HVW A;  4RTV A;  2X3X D;  2A36 A;  2DVJ A;  5FW9 A;  4Z8A A;  2KE9 A;  2JXB A;  2RQT A;  2CT3 A;  1UFF A;  1ZBJ A;  2YUO A;  4F14 A;  2D8H A;  3QWY A;  4E6R A;  1NM7 A;  1NEB A;  2DMO A;  5L23 A;  2CT4 A;  4DEX A;  1FYN A;  4J9I A;  4JZ3 A;  3EGU A;  4F16 A;  2DX1 A;  2PZ1 A;  2SRC A;  1U3O A;  2JMA A;  2FRY A;  4R0K A;  2EVR A;  2RQU A;  2W10 A;  3LH5 A;  2C0I A;  4CC4 B;  3C0C A;  4J9G A;  2KXC A;  1I0C A;  4OML A;  2O31 A;  3VS2 A;  1WLP B;  2L2P A;  2AZS A;  3VS6 A;  1AWW A;  1AZG B;  4KRT A;  1WDX A;  1WFW A;  1I07 A;  5IXF A;  1CKA A;  1JEG A;  1M3C A;  2LJ0 A;  2CDT A;  2L0A A;  1WA7 A;  3I5R A;  4OMO A;  3M0R A;  2YDL A;  2CSQ A;  1B07 A;  2L3S A;  1ZUY A;  3VS4 A;  2YUQ A;  2FPE A;  1KFZ A;  2LX7 A;  2CH4 A;  5HCK A;  4A63 B;  2EBP A;  1WYX A;  2DL8 A;  3CQT A;  1W1F A;  4DEY A;  2EKH A;  5IH2 A;  1KIK A;  3EG3 A;  4EIK A;  1X2Q A;  3TSZ A;  2JM9 A;  5IHN A;  2NUZ A;  1I1J A;  1J3T A;  1HD3 A;  2KRN A;  3GBQ A;  1UUE A;  1AWJ A;  4ESR A;  4IIO A;  1PWT A;  4WCI A;  2DE0 X;  5EC7 A;  2LJ1 A;  3JV3 A;  1QLY A;  2DRM A;  1SHF A;  2K6D A;  1H92 A;  2HBW A;  2JW4 A;  5IXB A;  1GL5 A;  4OMP A;  3EG2 A;  1K76 A;  1OOT A;  5FWC A;  1CSK A;  1SRM A;  2H8H A;  4JJB A;  2K7A A;  4QT7 A;  2EGE A;  2JM8 A;  1B3Q A;  2FEI A;  1OV3 A;  2K2M A;  4GBQ A;  2OJ2 A;  2GTO A;  1W70 A;  5I11 A;  1ZUU A;  3UA7 A;  4AG2 C;  3NGP A;  1K1Z A;  2O9V A;  1QKX A;  1BK2 A;  2RN8 A;  2JS0 A;  2J7I A;  2LJ3 A;  1YWO A;  3NHN A;  4IIM A;  4JJC A;  1VYU A;  1M27 C;  2CRE A;  4RTU A;  1T0J A;  2FO0 A;  4J9D A;  1A0N B;  2ECZ A;  1OEB A;  1VYT A;  2KYM A;  2EPD A;  1GCQ A;  4M4Z A;  2AK5 A;  2A08 A;  1UE9 A;  2EYX A;  1OPK A;  1HSQ A;  1E6H A;  1ZUK A;  2M0Y A;  1X6G A;  5IHI A;  1PNJ A;  1NEG A;  2EW3 A;  1YWP A;  5GJW B;  4LNP A;  1V1C A; 
#chains in the Genus database with same CATH topology
 3V8J A;  3H41 A;  4Y92 A;  1WI7 A;  2XI9 A;  4EMH A;  1JJ2 A;  4QQG A;  4M77 B;  1YHQ T;  5GAM d;  2AT1 B;  1UJY A;  4LUD A;  1OI1 A;  2HEQ A;  5AYF A;  5CCA A;  4XTW A;  2DO3 A;  1ZSG A;  1PG5 B;  1ZA1 B;  3CCL Q;  2KNB B;  5DLO A;  5CKE A;  1PD1 A;  2QTV A;  3NTH A;  4EMG A;  1AZE A;  1E7O A;  2NLU A;  1WJR A;  1RAG B;  2O9S A;  2WSC E;  2DL7 A;  3HHT B;  2RD1 A;  2L3P A;  2DBM A;  7AT1 B;  2A7Y A;  5GAN d;  1D0Y A;  3A8M B;  1U06 A;  3CCS A;  3LX7 A;  1QMC A;  3SFM A;  3QBY A;  2DL5 A;  4FT2 A;  4QQ6 A;  4NL3 A;  1IXD A;  1K9A A;  3ZEH A;  4M7D B;  4LDX A;  2HBP A;  2HCK A;  3MEU A;  4XTZ A;  3S6W A;  4KUI A;  1G2B A;  1YJW A;  2FG0 A;  4MDW A;  2K2V A;  1R0B G;  2FHD A;  2LP5 A;  2GQI A;  3OYJ A;  2O88 A;  1WX6 A;  4C5G A;  3V8K A;  4XU3 A;  4IUP A;  5GAO n;  4BD3 A;  1Y96 B;  1YHQ A;  4GLK A;  2H3J A;  2QI2 A;  1ZLM A;  1K9M R;  3QKJ A;  3JAM E;  1EX4 A;  5CKF A;  5GAN j;  4C92 D;  3NTI A;  1JXO A;  4LD9 K;  4AFS C;  3C12 A;  3H6Z A;  4J9H A;  1Y0M A;  4KGX B;  2F2X A;  2F2W A;  3UPU A;  4MML A;  3J7A F;  1NYF A;  2IG0 A;  2ZZD A;  3I35 A;  1IHV A;  4C8Q E;  2MI6 A;  4J9E A;  2KAF A;  2YWW A;  1M3B A;  1Y07 A;  1M5Q 1;  3OQ5 A;  4EPC A;  4FCY A;  3R6O A;  2A0F B;  1BIB A;  2LDM A;  2HAX A;  2LCS A;  5I2M A;  2BUD A;  2YUN A;  3WVE B;  4C0D C;  2BIV A;  3M57 A;  2X35 A;  2C0O A;  2K3Y A;  2M51 A;  2X4X A;  1M2V A;  2YHT A;  2VWF A;  1VQN T;  2HKQ B;  4JDS A;  2FZG B;  1D09 B;  3PVL A;  4A4K A;  5J3B A;  3QYG B;  1Q86 R;  1NG2 A;  2P0P A;  1AEY A;  4KGV B;  4BDY A;  3JRZ A;  2M02 A;  1TXQ A;  5EG2 A;  1W2B A;  2MF2 A;  2K3X A;  4C92 G;  1NLP C;  1TSF A;  1MV0 B;  3A8G B;  2EAY A;  2SEM A;  5IHK A;  5J39 A;  4DBH A;  1UTI A;  1K9M U;  1TH7 A;  4LUE A;  4PNO A;  1M90 R;  4WTO B;  2D1X A;  3CME T;  1PKT A;  3OSV A;  3O5Z A;  3BDL A;  4RMO A;  2WSF E;  2LC4 A;  1RI9 A;  2M0O A;  1T0H A;  2CZ0 B;  1K8A R;  5DM7 R;  4K11 A;  2VC8 A;  3TVT A;  5I21 A;  1G83 A;  5KYU A;  3HKS A;  3ER0 A;  1JXM A;  1X43 A;  4E7S A;  4E2F B;  1M1K R;  2YRD A;  1VQN A;  2HSP A;  2KK4 A;  1UDL A;  4O5V A;  1RLQ C;  1LPL A;  4AG1 C;  4N0A C;  1H8K A;  5FWB A;  3UT1 A;  3KBG A;  1GCP A;  4IUV A;  5HY6 A;  2RPN A;  3G71 T;  5AT1 B;  2RK2 A;  5GJV B;  5I22 A;  3A8H B;  3KFV A;  3PMT A;  1WHK A;  4C5I A;  3UAT A;  1XJW B;  2GCX A;  3LW5 E;  2VV5 A;  2XG8 D;  1Q81 C;  1QWE A;  3CME Q;  4M75 B;  3I55 T;  4HT8 A;  3JCM d;  3X24 B;  1VIF A;  1IZ6 A;  4EMK B;  2XIC A;  2VUB A;  3E19 A;  2QQB A;  3E9G A;  3R6N A;  2ZPF B;  1MHN A;  1QVF P;  3I56 T;  5LJ3 f;  2RJF A;  3G4S T;  2BTT A;  1OPL A;  5GMK e;  4M78 B;  4B9X A;  1Q86 U;  4HVU A;  3M56 A;  3RNJ A;  1P92 A;  2D9T A;  3A1P A;  2Y4X A;  1H3Z A;  2O4X A;  2PTK A;  1VQP A;  2E41 A;  1RI0 A;  4CI0 C;  1JBM A;  1QQJ A;  2A28 A;  4C8Q D;  1S72 Q;  2L3Q A;  3S3N A;  2AZV A;  2AHJ B;  4XTU A;  2EIF A;  2L8D A;  3VS3 A;  1VQO Q;  1VQ7 A;  3ZL7 C;  3PTA A;  3X25 B;  1OYX A;  1M90 U;  1RAB B;  3I55 Q;  4J5Y A;  3G71 A;  2LX9 A;  2DVJ A;  2ZCF B;  5FW9 A;  2KE9 A;  2XK0 A;  1QVF S;  1IHW A;  1K8A U;  1ZSZ A;  1NEB A;  4M7D C;  2GQV A;  1FYN A;  2DX1 A;  2PZ1 A;  4PJO A;  1NPP A;  2DFU A;  1TU0 B;  2H3E B;  3CC4 A;  1M9S A;  3LH5 A;  3I56 A;  2OTL Q;  1RAD B;  3C0C A;  3TQ7 P;  3G4S A;  4OB1 B;  1I0C A;  2EKO A;  3VS2 A;  4XTV A;  3EG9 A;  1G3T A;  3EFR A;  4A53 A;  1KQ2 A;  1QW1 A;  3M58 A;  1B7T A;  4L59 A;  3L2V A;  5IXF A;  1FMV A;  1UB4 A;  2ZPI B;  1YJN T;  2LJ0 A;  2L0A A;  4ANJ A;  3NFC A;  4D6W A;  3I5R A;  2KQW A;  4QKU A;  5FRM A;  1B07 A;  1BI1 A;  2QEX Q;  2DTO A;  4JRP A;  4C8Q G;  2FPE A;  3CXC S;  2CH4 A;  4NL2 A;  5HCK A;  2F5T X;  2O01 E;  3INZ A;  4KT0 E;  5CAI A;  5GAN 2;  4DEY A;  2EKH A;  2COZ A;  1IRX A;  1X2Q A;  3JSC A;  2JM9 A;  5IHN A;  2CP3 A;  2KRN A;  4OB0 B;  2ZPH B;  4WCI A;  2HMA A;  2ZPB B;  3EFO A;  1N6A A;  1YJN Q;  2DRM A;  1VQ6 T;  3SDZ A;  3CCJ T;  2K6D A;  4ZTF A;  2JW4 A;  4DA4 A;  1KHI A;  4M7A E;  5HKC A;  2E3H A;  4JRI A;  3BDU A;  5LJ3 g;  4OMP A;  1YJN A;  1OOT A;  3MPU B;  4F7U B;  2QDY B;  3CCV Q;  3JB9 H;  4JLG A;  3JCM W;  2FEI A;  3AHU A;  2MAM A;  4EDU A;  1VQ8 T;  1VQK Q;  1JRI A;  2GTO A;  2RA2 A;  2QQA A;  4KUL A;  1K1Z A;  2DER A;  1QKX A;  2QTX A;  3QSU A;  2NUP A;  3Q1J A;  4XU2 A;  1RAI B;  3CCJ Q;  3OYD A;  1M1G A;  4J9D A;  4F04 B;  1A0N B;  3M55 A;  3LH0 A;  4OGE A;  2DVE A;  1OX9 A;  4M77 F;  2AK5 A;  1KC8 R;  1OPK A;  4M7D E;  1HSQ A;  3L42 A;  2RI5 A;  5LJ5 e;  2R5M A;  1ZUK A;  1VQ6 A;  3BW1 A;  3CCJ A;  2LVM A;  5GJW B;  1V1C A;  5FU7 B;  5CQX A;  1HK9 A;  4RG8 A;  3E2U A;  3EGD B;  1VQ9 T;  5KYU B;  3MEW A;  4RTX A;  1D3B B;  1QP3 A;  5LJ5 h;  4JRQ A;  3QUI A;  1XNI A;  4FM4 B;  3L2Z A;  3M9Q A;  1VQ4 T;  4M75 C;  3U23 A;  2FPD A;  4BUG A;  2CP2 A;  5GAO q;  4EMK C;  1GRI A;  1NYG A;  2KXD A;  1VQ8 A;  1KG1 A;  3GPL A;  2F2V A;  2GFA A;  1M8M A;  3GNF B;  2K79 A;  1N8R U;  4M7D F;  4RTT A;  3AT1 B;  2VGN A;  3GNG A;  3OYK A;  2JT4 A;  1IO6 A;  1D1A A;  2IPO B;  2QDL A;  1LJO A;  2DF6 A;  4JUV A;  4X1V A;  4CC2 A;  2E65 A;  1YIT T;  3OS2 A;  2JUF A;  2JN0 A;  3L2W A;  2KRO A;  2DK3 A;  1UHF A;  5FRN A;  2QQR A;  4MZP A;  5GMK m;  2O4X B;  2RQR A;  2R5A A;  3M4G A;  2DYB A;  3VS1 A;  3L2R A;  3H0H A;  1QCN A;  1PSE A;  1VQ9 A;  2MK5 A;  1VQ5 A;  1G5V A;  2FB7 A;  3VS5 A;  1KC8 U;  1VQ4 A;  1M4Z A;  3PFS A;  4Z02 A;  4ZN3 A;  2MYS A;  2XMF A;  5GAO l;  2O2O A;  2KYB A;  2CS7 A;  3JCM X;  4ZNX A;  4M7A D;  3A98 A;  5LJ3 h;  2NWM A;  2J6O A;  5L8R E;  1EZZ B;  4FIB A;  4II1 A;  1Y7X A;  1KQS S;  1NZ9 A;  5KYX A;  4Q5W A;  1K73 C;  1S1N A;  1W6X A;  1YIT A;  4PJO B;  5FLX E;  1VQL Q;  3QDF A;  2EGA A;  3CC2 T;  2RI3 A;  4BI3 A;  1YI2 A;  1OZ2 A;  4XTY A;  5KE3 A;  2BZ8 A;  4QVZ A;  3RES A;  3I9Q A;  3VV0 A;  3CCL T;  2XU8 A;  3EG9 B;  1QP2 A;  2K5I A;  3MJX A;  1X01 A;  2JS2 A;  3EG1 A;  3J80 E;  3GIB A;  4MZM A;  1BU1 A;  3JCM Q;  3RMQ A;  2ZPG B;  2KSS A;  1TUC A;  1OZ3 A;  1UGV A;  1X27 A;  2KT1 A;  4PL6 A;  1WJS A;  1G3Y A;  1RAH B;  1TUG B;  2CZ7 B;  2KBT A;  3E1S A;  1W4S A;  2JNG A;  3QXE B;  1VUB A;  3MKD A;  5D6X A;  2FZC B;  4PFZ A;  2DNU A;  4R55 A;  1BI0 A;  3V7S A;  4M75 E;  1N5Z A;  4F17 A;  1MUZ A;  1QVG P;  3CC2 Q;  4GLM A;  3M0S A;  2DEQ A;  2OTJ Q;  1SEM A;  3MET A;  1SSH A;  3LYI A;  1WNL A;  3REA B;  2ROT A;  3SB2 A;  2MIO A;  3V7C A;  2KGT A;  1GCQ C;  3CD6 Q;  4M7A G;  8AT1 B;  2CUB A;  3QO3 A;  4BDZ A;  1NJI C;  2A37 A;  2DXC A;  1N9R A;  1G8X A;  2BKD N;  3PE0 A;  4XQ3 A;  5FRO A;  2DET A;  1QVP A;  2YUP A;  3EFO B;  3LGL A;  4PLL A;  1AWX A;  2NUT A;  3TRE A;  4CRI A;  3EHQ A;  2EYY A;  3CCL A;  1AHJ B;  3FC3 A;  3DB4 A;  3M53 A;  2LTO A;  3VU3 C;  4BI8 B;  2P4T A;  2DEU A;  1MND A;  3PNW C;  2KEA A;  4FYV B;  4M75 F;  1QVG S;  1UG1 A;  5KYY B;  4ZGJ B;  1RAF B;  2DRK A;  2CP5 A;  3FJP A;  2YXY A;  3TSW A;  2RMO A;  3LWH A;  3F70 A;  2VB6 A;  2BZY A;  1SHG A;  4FU6 A;  2CP7 A;  4M78 F;  5GAN 4;  3JB9 F;  2I2L A;  4LXC A;  4C8Q A;  3OYA A;  2EYW A;  5HK3 A;  1QVF A;  2MWP A;  1MNE A;  2RQW A;  1IGU A;  3OYB A;  2NUP B;  1O75 A;  3PIP A;  3M54 A;  1Z9Q A;  4QQD A;  5KE2 A;  3QG1 A;  2R58 A;  2EYZ A;  2X51 A;  2EQM A;  3N5B B;  3M0U A;  3ZFJ A;  1PRM C;  2J05 A;  5IT9 E;  4BI4 A;  1BI3 A;  3VRZ A;  4BE1 A;  2DM1 A;  1WXT A;  3VYH B;  4E7Z A;  1TG0 A;  3EHR A;  1QCO A;  4Z88 A;  1AVZ C;  1FWZ A;  4OB2 B;  3EGX A;  3CCU T;  2CP6 A;  2JXB A;  4JS4 A;  3CBP A;  3SD4 A;  2L5Q A;  1NPR A;  1X75 C;  4F14 A;  2D8H A;  2CT4 A;  2LT1 A;  4DEX A;  4F16 A;  5LJ5 f;  1U3O A;  2LRQ A;  2RQU A;  2JVV A;  4MZT A;  4MMK A;  4C92 B;  4PFO A;  2W10 A;  1YJ9 T;  1ZQ1 A;  3LGF A;  3JCM P;  2K57 A;  2RJD A;  1B34 B;  8ATC B;  3BE3 A;  1WDX A;  1I07 A;  2L89 A;  2DTI A;  1WHG A;  4F7U E;  4B9W A;  2CDT A;  3CCU Q;  4ATO A;  4XU0 A;  2CSQ A;  1UGS B;  2E3I A;  2RHI A;  2COY A;  3URG A;  2FYK A;  3VYG A;  4E7L A;  2BE7 D;  4NS5 A;  3CBM A;  2NYS A;  4HT9 A;  2LX7 A;  3FIF A;  4BE0 A;  2EBP A;  3CQT A;  1YJ9 Q;  1W1F A;  3GOX A;  3MO8 A;  5IH2 A;  4KGZ B;  2B8A A;  3OYM A;  1S72 T;  2PQW A;  1VQO T;  4Y28 E;  2LQ8 A;  3TSZ A;  5KYN A;  2GF7 A;  5KYX B;  1LOJ A;  5GAM e;  1HD3 A;  4F7U F;  3GBQ A;  2F69 A;  3CMA Q;  4IIO A;  1PWT A;  3V7R A;  1YJ9 A;  1I81 A;  3QHS A;  1KQ1 A;  4PJM A;  2XID A;  2KI7 A;  3L2Q A;  5CR2 A;  1PSF A;  4NOY A;  3CME A;  3UWN A;  1NBE B;  4M77 C;  2RI2 A;  2HNI A;  2JOY A;  3H8Z A;  1SRM A;  5GAN e;  2K7A A;  4QT7 A;  2EGE A;  2PU9 B;  3S3O A;  2OTL T;  3CPW P;  2JM8 A;  1OX8 A;  4FSX A;  4HKE A;  3T9N A;  2OJ2 A;  5GMK h;  2RHY A;  1K8A C;  1W70 A;  3OW2 A;  4C0G A;  2O9V A;  2LJ3 A;  4ELY C;  1YIJ T;  1G3W A;  1BKB A;  1S72 A;  4IUR A;  2FO0 A;  1VQO A;  1DJ7 B;  1U1T A;  1OEB A;  1YCY A;  2JZ2 A;  2KYM A;  2MPX C;  3M59 A;  4M4Z A;  3I55 A;  1XTD A;  5LJ5 j;  2QEX T;  2EYX A;  2ZAE A;  1M1K U;  1WHJ A;  3HL8 A;  4LDU A;  1E6H A;  1Y71 A;  2CGH A;  4E7I A;  2M0Y A;  3SWN A;  1PNJ A;  3CPW S;  1YBY A;  2QG9 B;  3CXC P;  1M1F A;  3NPF A;  5LJ5 g;  5ECA A;  1VOM A;  5C6S A;  1T3L A;  1UEC A;  1TUD A;  2JTE A;  2ENM A;  4HCC A;  1FXX A;  2DXU A;  2ED1 A;  4E7K A;  4N0A A;  1YIJ Q;  2OTL A;  4KH0 B;  1PD0 A;  1YP5 A;  1R0C B;  2DPP B;  1YN8 A;  1BB9 A;  2E5Q A;  3M0T A;  5LJ3 d;  4A4F A;  1GBQ A;  1Q7Y R;  2LNH B;  4C8Q B;  3RKX A;  2F1L A;  3CCQ Q;  3REB B;  2OAW A;  1K0S A;  3UF4 A;  2XDD A;  3CCV T;  5A2Q E;  4JS5 A;  1H64 1;  2DA9 A;  2QA4 Q;  4J9B A;  1AOJ A;  4LDV A;  4RCB A;  2E5K A;  3MCA B;  2QEX A;  2W0Z A;  4M7A A;  3I5S A;  1VQK T;  2RJE A;  2DTH A;  1HYO A;  1YFN A;  2CUD A;  4JZ4 A;  2E10 A;  1QCF A;  1RUW A;  2OI3 A;  1O9S A;  4J9F A;  3NTK A;  2E70 A;  4J6Y A;  2FL7 A;  1VQM T;  5LJ3 j;  4KBM B;  3OB9 A;  1PRL C;  1OQK A;  1W2B S;  4BY6 B;  2JMC A;  2EQK A;  4RTY A;  4PJN A;  1RAE B;  4PJO F;  4M77 E;  5A0L A;  1M2V B;  3H0F A;  2RO0 A;  4QW2 A;  5KCH A;  3QDR B;  2PNI A;  4C92 C;  1PKS A;  2YSQ A;  3OYN A;  1JO8 A;  1MV3 A;  1IB8 A;  1FMK A;  4PJJ A;  2ZGW A;  3OS0 A;  2DJQ A;  1AWO A;  1KD1 R;  1GXI E;  4M7D A;  2Z0W A;  3X20 B;  3CCV A;  1WGS A;  3IQL A;  3VS0 A;  3QII A;  2DAQ A;  3VKI A;  2FZK B;  1VQM Q;  1QKW A;  2ATC B;  1VA7 A;  2LZ6 B;  5D6Y A;  2AKL A;  1CKB A;  1VQK A;  2OAU A;  4BE2 A;  3OYC A;  1OU8 A;  1Q7Y U;  2VXE A;  3L2U A;  2P0K A;  2J6K A;  3CC7 Q;  4WF2 A;  5CO7 A;  4JJD A;  3X26 B;  5GAO r;  2KT8 A;  4A54 A;  2ESW A;  1U5S A;  1M3A A;  4ORZ A;  3PT9 A;  3J81 E;  3TU4 K;  2RM4 A;  2GFU A;  2M9U A;  2DD5 A;  4VUB A;  1Y57 A;  4LE9 A;  4D8K A;  2GNC A;  2FRW A;  3RIR A;  1QVG A;  3M0P A;  2X4W A;  4HVV A;  2X4Y A;  1EIF A;  2RB6 A;  2RK1 A;  4OMF B;  3JCM b;  4ZN1 A;  1N8R C;  2G3R A;  1RL2 A;  2RNA A;  4AFZ C;  1Q82 R;  3OYG A;  5I2S A;  2QAS A;  1I5O B;  1PHT A;  4HCK A;  2EGC A;  2G6F X;  3JCM J;  4M78 C;  1MMA A;  2HKN A;  3FJ5 A;  3VRY A;  1E6G A;  2LMJ A;  4C0Z A;  2DIL A;  4BB7 A;  2CSI A;  2K9G A;  3HP9 A;  4TVR A;  1KHC A;  1K73 R;  2ABL A;  4J7I A;  1KD1 U;  1OU9 A;  2I0N A;  3QWX X;  3CCM Q;  2E64 A;  4BAC A;  3MHX A;  3RER A;  2MCN A;  1KQS P;  4Z89 A;  3PMI A;  3OY9 A;  1VQL T;  1ACM B;  3NMZ C;  2C0T A;  1TS9 A;  3MP1 A;  4ME7 A;  4YTL A;  2V8J A;  2DYI A;  1UJ0 A;  1TOV A;  3OYI A;  2CYZ B;  4FYW B;  3ULR B;  5GAM f;  3SHW A;  2DBK A;  2AKK A;  2IIM A;  5IN1 A;  5J26 A;  4J9C A;  3CCR Q;  2M1H A;  3HRT A;  2KR3 A;  1VYV A;  2EWN A;  4C92 E;  3RBB B;  4JPB W;  1ZSZ B;  2F5K A;  3DLM A;  2QAZ A;  4M77 D;  4HXJ A;  4ELZ C;  3TEE A;  2BZX A;  3D7S B;  2HZY A;  1D0Z A;  2ED0 A;  4J83 A;  4A4G A;  3G6E Q;  3OBY A;  5CIU A;  5GAN 7;  5CQY A;  1X69 A;  3SWN B;  3CCE Q;  2HQX A;  5D7U A;  5GAN f;  2DL3 A;  4XAX B;  4Y91 A;  2RH2 A;  1EFN A;  2QQ9 A;  1NLO C;  1Q82 U;  2OTJ T;  2RHU A;  2HL3 A;  3EH1 A;  2ROL A;  1NJI R;  4OMN A;  1BBZ A;  3KXT A;  2RF0 A;  4IUU A;  3CD6 T;  4C8Q C;  1VQL A;  4M75 A;  2X3X D;  3QJ6 A;  2LCC A;  4C92 F;  4EMK A;  5CKB A;  4Z8A A;  1V29 B;  3EH2 A;  3P8B B;  4XU1 A;  4M7D D;  3CCS T;  1K73 U;  2XDP A;  4E6R A;  3UDC A;  5L23 A;  3MP8 A;  4DBR A;  3EGU A;  3FRN A;  2FRY A;  1YJW T;  4R0K A;  2QXF A;  1PCX A;  2E6Z A;  4OML A;  3MP6 A;  2O31 A;  1OUL A;  4M7A B;  3HPW A;  4BY6 C;  1WHL A;  4M78 E;  4DBQ A;  4M77 G;  1WFW A;  3CC2 A;  2OTJ A;  1WA7 A;  1X6O A;  2LT4 A;  2PVG B;  3M0R A;  1U1S A;  3CCS Q;  3CD6 A;  3C95 A;  2YDL A;  4RKU E;  3FEO A;  2KVQ G;  2PUO B;  5CVI A;  3RR6 A;  3O8V A;  4DOV A;  1KFZ A;  1RAC B;  4HA8 A;  5GAN 3;  1WHM A;  1YJW Q;  5DY9 A;  2E1H A;  2EQJ A;  2V26 A;  3RKW A;  2E4H A;  3ASK A;  1NJI U;  5GAM j;  2EYQ A;  2NUZ A;  4JJN K;  1J3T A;  4IKF A;  4AMC A;  1YHQ Q;  1SG5 A;  4M7D G;  1UEB A;  1UUE A;  1AWJ A;  3PGG A;  3ME9 A;  4ESR A;  2K5L A;  3OYE A;  2KDS A;  2DE0 X;  4PFP A;  2LJ1 A;  4J8O A;  4QVC A;  3JV3 A;  4LD6 A;  5GAM g;  3EAE A;  3CBO A;  5FU7 C;  2HBW A;  4LDW A;  3JCM V;  5GMK j;  2L3R A;  2X9H A;  5IXB A;  1C0M A;  4XK8 E;  3CPW A;  2DXT A;  2D0Q B;  3MEV A;  1FMW A;  3EG2 A;  5FWC A;  4JJB A;  4QVD A;  2HL5 C;  1N9S A;  1IRE B;  2DIQ A;  3QZ5 B;  3QYH B;  5GAN g;  5GAO p;  4GBQ A;  2YRC A;  4FYX B;  3UA7 A;  3QJY A;  1BYM A;  2RN8 A;  2E12 A;  3ZBD A;  4IIM A;  1VYU A;  1BIA A;  2CRE A;  4RTU A;  4PJL A;  3CPF A;  1T0J A;  2IVW A;  4KUD K;  2ECZ A;  1VYT A;  1GCQ A;  4N4G A;  3JCM c;  3CXC A;  2A08 A;  3LWI A;  1V76 A;  2CP0 A;  5D6W A;  1K9M C;  1X6G A;  4F7U A;  3JCM f;  4LNP A;  2D6F A;  2HD0 A;  2CKK A;  1QWF A;  3TCJ A;  2CH4 W;  3OS5 A;  4L5G A;  4C8Q F;  1Q81 R;  1WHH A;  4M75 D;  3KUF A;  1BCO A;  2PUK B;  2K5F A;  2QYZ A;  3CMA T;  1TTH B;  3H0I A;  1JJ2 P;  1SF9 A;  2AIR B;  2DJZ A;  4M78 D;  4AT1 B;  3JB9 D;  3LLR A;  1ZSZ C;  2C06 A;  2LNV A;  4J6X A;  4FT4 A;  1WIE A;  2EQI A;  3CCU A;  1VQN Q;  4PJO C;  3SWN C;  1VQP T;  3C4S A;  2BE9 B;  1YNZ A;  1M2O A;  3EGD A;  2DKG A;  2DIG A;  3S3M A;  1UHC A;  2XHC A;  2DL4 A;  2EJF A;  3EG0 A;  1D3B A;  1R8O B;  1VQ7 T;  5GMK l;  3HRS A;  3OMG A;  1Q86 C;  1JJ2 S;  2V1Q A;  3MEA A;  5CKH A;  5KCO A;  2X4J A;  2DXB A;  2KY9 A;  4N4I A;  2CZ1 B;  5A0G A;  1TWB A;  1WXU A;  2V1R A;  1AT1 B;  1LCK A;  5GAM h;  3VUZ A;  3CMA A;  4AFQ C;  4HCB A;  4RCC A;  2EFI A;  1Z9Z A;  4OMM A;  5LJ5 d;  5CK9 A;  2VAS A;  1WZO A;  4M75 G;  1M90 C;  5GAO m;  5M9O A;  3RUX A;  3M5A A;  3M0Q A;  3CC4 T;  1VQP Q;  4OF1 A;  2KRM A;  3E9F A;  2XD0 A;  1SKU B;  2OX7 A;  1Q81 U;  2GBQ A;  4M7A C;  1BI2 A;  2QGG A;  3RKY A;  1VQ7 Q;  4M78 G;  2RHZ A;  3JB9 G;  2LQN A;  3G7Z A;  2E6N A;  1ABO A;  5GAN h;  2MOX A;  1M1K C;  1WXB A;  4PKC C;  5FU6 B;  3VJP A;  2HQE A;  3A5Z B;  2X3W D;  1RLP C;  3G71 Q;  5KH6 A;  5KYW A;  1GBR A;  4N4H A;  4UC4 A;  4V2S A;  1KSW A;  4C5H A;  2K4Y A;  2FPF A;  4FSS A;  3PIO A;  2V8I A;  2CZ6 B;  2KMT A;  3CCQ T;  3WXM B;  1X2K A;  1T3S A;  2RJC A;  2D8J A;  4CC7 A;  1SRL A;  2NUT B;  2RQV A;  2RHX A;  5A0D A;  1K0X A;  2QA4 T;  3CC4 Q;  3JCM g;  3I56 Q;  3OYH A;  3G4S Q;  1C1A A;  1JQQ A;  3OSS C;  1WQ7 A;  1I5L A;  4RUG A;  1JB0 E;  1WJQ A;  2WAC A;  4C5E A;  5CKD A;  3QPH A;  4OP0 A;  1M30 A;  2YT6 A;  2V8K A;  1NE8 A;  2VKN A;  5C0M A;  1GFD A;  3RDV A;  4RTZ A;  5GAN 8;  1W2B P;  1YIJ A;  4E7H A;  3UA6 A;  3OMC A;  2MMP A;  4PJO E;  2HQH A;  2YLC A;  5GAN 5;  1ZX6 A;  2XDB A;  4CC3 A;  3WVD B;  1KQS A;  2GGR A;  1N27 A;  3BFM A;  1AD5 A;  4B6M A;  4OGC A;  4X34 A;  4ZGE B;  3CCQ A;  4P5N A;  2JTF A;  4R56 A;  3SEM A;  2MWO A;  4M77 A;  3RMS A;  1BCM A;  2LQW A;  2QA4 A;  4LN2 A;  2JTM A;  1X6B A;  4RG2 A;  1GFC A;  4E7J A;  1ZBX A;  2P4R A;  4O6J A;  3P8H A;  4C0F A;  2QGF B;  1FX7 A;  3THK A;  2GTJ A;  2HDA A;  3L1A A;  1VIE A;  1SPK A;  1HJD A;  3CC7 T;  1MMD A;  2K3B A;  2YRV A;  1M8V A;  2J06 A;  3FB9 A;  2VYT A;  4XTX A;  1SSF A;  3EGX B;  2KRS A;  3HRU A;  1MMN A;  2B86 A;  1LVK A;  2D0N A;  3VS7 A;  1WQW A;  3M4Y A;  1KJW A;  1XOV A;  1N8R R;  4RTW A;  1HXD A;  1MMG A;  2JJ9 A;  4JRK A;  3C94 A;  2J6F A;  1Q7Y C;  3GLX A;  1MGQ A;  1K4U S;  3PVQ A;  5KYY A;  2VGM A;  4F7U G;  2DLP A;  1R77 A;  1UGP B;  1ABQ A;  2ZPE B;  1ARK A;  4OMQ A;  1H3H A;  3FLG A;  3H9N A;  1Y96 A;  1YCS B;  2DZC A;  2VVK A;  4D8D A;  1JU5 C;  3GP8 A;  4AFU C;  4ZGD B;  4HVW A;  2DD4 A;  3JCM e;  4RTV A;  1VQM A;  1XQH A;  3OA6 A;  2A36 A;  5DLQ E;  1VQ6 Q;  2VXF A;  4IUQ A;  3OW2 P;  2LCL A;  2RQT A;  2CT3 A;  3CC7 A;  4M7A F;  2Y4Y A;  1ZA2 B;  1UFF A;  2FVU A;  1ZBJ A;  2WSE E;  2YUO A;  3QWY A;  1NM7 A;  4OB3 B;  3CCM T;  2DMO A;  4FW2 A;  4PK4 A;  4J9I A;  4JZ3 A;  3JCM h;  9ATC B;  2SRC A;  1IGQ A;  3CEY A;  4X9D A;  2JMA A;  2EVR A;  3HFO A;  1I4K 1;  2LQK A;  4HCZ A;  3OBW A;  3HSB A;  4A4H A;  6AT1 B;  2EJ9 A;  2C0I A;  4CC4 B;  2PVD B;  4J9G A;  2KXC A;  1WLP B;  2L2P A;  3GF5 A;  1VQ8 Q;  2AZS A;  3VS6 A;  1VQ5 T;  3P8D A;  3VUB A;  3JB9 J;  1AWW A;  1AZG B;  4KRT A;  1KD1 C;  3DLL A;  1CKA A;  2A3L A;  3CCR T;  1JEG A;  3EFS A;  3OW2 S;  4ZTJ A;  1M3C A;  2P84 A;  1KK7 A;  4L6V 5;  4DQ2 A;  3A8O B;  4OMO A;  3DKM A;  4IUT A;  4FYY B;  2Y90 A;  2L3S A;  4C0D B;  1ZUY A;  3VS4 A;  4PJO D;  2YUQ A;  4MDX A;  4E47 A;  3A8L B;  3G6E T;  2QQS A;  4DBF A;  2QK0 A;  4KH1 B;  1KC8 C;  1F1B B;  4JLI A;  3CCE T;  4A63 B;  5FU6 C;  4C92 A;  3V8L A;  1WYX A;  2P0Q A;  2DL8 A;  3JB9 I;  2YLB A;  1KIK A;  1VQ9 Q;  1G3S A;  1YI2 T;  3CCM A;  2PVO B;  3EG3 A;  4EIK A;  1VQ5 Q;  4X9C A;  1B34 A;  1I1J A;  3FDR A;  3X28 B;  3DB3 A;  1VQ4 Q;  5EC7 A;  1QLY A;  1SHF A;  5KYW B;  4GY5 A;  1H92 A;  5LJ3 e;  2EQU A;  5GMK i;  1Q82 C;  2XKO C;  4J7F A;  1UGR B;  3OYL A;  3G1J A;  4OVA A;  4FL6 A;  5HK0 A;  3CCR A;  1GL5 A;  1D0X A;  1K76 A;  1I8F A;  1CSK A;  2H8H A;  1YIT Q;  3QZ9 B;  4LDY A;  4FW1 A;  1B3Q A;  4A4E A;  1YI2 Q;  1OV3 A;  2K2M A;  3OYY A;  1ZHI A;  2COW A;  3G6E A;  5I11 A;  1UGQ B;  1ZUU A;  4AG2 C;  5GAN 6;  3NGP A;  3HFN A;  3CCE A;  1BK2 A;  4PLI A;  2JS0 A;  2J7I A;  1YWO A;  2M16 A;  3OYF A;  1PM3 A;  3NHN A;  4PJO G;  5LL6 S;  5IAY A;  4JJC A;  1M27 C;  2DZ9 A;  1D1B A;  1LNX A;  2EPD A;  1C6V X;  2EJG A;  1WPY A;  4M78 A;  1UE9 A;  3HTR A;  1PC0 A;  2HSE B;  3OS1 A;  1U8R A;  2R57 A;  5IHI A;  4J6W A;  1RAA B;  4DOW A;  1NEG A;  1Q95 G;  2EW3 A;  1YWP A;  1D1C A;  3BY7 A; 
#chains in the Genus database with same CATH homology
 3NPF A;  5ECA A;  1T3L A;  1QWF A;  1UEC A;  2CH4 W;  1TUD A;  3H41 A;  4Y92 A;  2JTE A;  1WI7 A;  4RTX A;  2ENM A;  2ED1 A;  1UJY A;  4LUD A;  2HEQ A;  3U23 A;  2FPD A;  3H0I A;  1YP5 A;  1GRI A;  1NYG A;  2KXD A;  1ZSG A;  1YN8 A;  1BB9 A;  2F2V A;  2KNB B;  1M8M A;  3M0T A;  1GBQ A;  2K79 A;  2LNH B;  4RTT A;  1AZE A;  1E7O A;  2O9S A;  2JT4 A;  1WIE A;  1IO6 A;  2EQI A;  2DL7 A;  3REB B;  2OAW A;  2QDL A;  1K0S A;  2DF6 A;  2L3P A;  3UF4 A;  4X1V A;  4CC2 A;  2DBM A;  2DA9 A;  1U06 A;  4J9B A;  1AOJ A;  1YNZ A;  2DL5 A;  2E5K A;  2KRO A;  1K9A A;  2W0Z A;  1UHF A;  3I5S A;  1UHC A;  2DL4 A;  3EG0 A;  2HCK A;  1G2B A;  2CUD A;  4JZ4 A;  2FG0 A;  2RQR A;  2DYB A;  2V1Q A;  1QCF A;  3VS1 A;  1RUW A;  2OI3 A;  3H0H A;  4J9F A;  2LP5 A;  2GQI A;  2O88 A;  1WX6 A;  1WXU A;  1PRL C;  3VS5 A;  2V1R A;  1LCK A;  2JMC A;  1ZLM A;  4AFQ C;  4RTY A;  1Z9Z A;  4OMM A;  2XMF A;  3H0F A;  1JXO A;  2O2O A;  4AFS C;  2KYB A;  4ZNX A;  2PNI A;  3M0Q A;  4J9H A;  1PKS A;  2KRM A;  2YSQ A;  3A98 A;  1Y0M A;  1JO8 A;  1MV3 A;  2F2X A;  2F2W A;  2NWM A;  1FMK A;  2J6O A;  2GBQ A;  2DJQ A;  1AWO A;  1NYF A;  3I35 A;  4J9E A;  1M3B A;  2LQN A;  1ABO A;  1S1N A;  1W6X A;  2MOX A;  1WXB A;  3IQL A;  3VS0 A;  2EGA A;  2X3W D;  1QKW A;  1RLP C;  1VA7 A;  2LZ6 B;  2AKL A;  1CKB A;  1GBR A;  2BZ8 A;  3I9Q A;  2LCS A;  1KSW A;  2FPF A;  2YUN A;  4FSS A;  2J6K A;  4JJD A;  1X2K A;  2C0O A;  2JS2 A;  2KT8 A;  3EG1 A;  2M51 A;  2ESW A;  1U5S A;  1M3A A;  1T3S A;  1BU1 A;  2D8J A;  4ORZ A;  1SRL A;  4CC7 A;  2VWF A;  2RQV A;  1TUC A;  1UGV A;  1K0X A;  1X27 A;  2KT1 A;  1Y57 A;  4LE9 A;  4D8K A;  2GNC A;  2FRW A;  3PVL A;  2KBT A;  3M0P A;  1JQQ A;  4HVV A;  1NG2 A;  1AEY A;  2DNU A;  4RUG A;  1N5Z A;  4F17 A;  1MUZ A;  1M30 A;  2RNA A;  4GLM A;  4AFZ C;  2YT6 A;  3M0S A;  1NLP C;  1PHT A;  1SEM A;  2VKN A;  1SSH A;  1MV0 B;  3REA B;  2ROT A;  1GFD A;  2SEM A;  2MIO A;  4HCK A;  5IHK A;  2EGC A;  1UTI A;  2KGT A;  1GCQ C;  2G6F X;  4RTZ A;  2CUB A;  4LUE A;  2A37 A;  2D1X A;  1PKT A;  3PE0 A;  3UA6 A;  3FJ5 A;  3O5Z A;  3VRY A;  2YUP A;  1E6G A;  2LMJ A;  1AWX A;  3EHQ A;  2EYY A;  1ZX6 A;  2DIL A;  4CC3 A;  2CSI A;  1RI9 A;  1T0H A;  2GGR A;  2K9G A;  1AD5 A;  4K11 A;  3TVT A;  2ABL A;  1G83 A;  1JXM A;  2I0N A;  1X43 A;  2KEA A;  3QWX X;  3SEM A;  2HSP A;  1UDL A;  2MCN A;  1RLQ C;  2LQW A;  4AG1 C;  4Z89 A;  1UG1 A;  4LN2 A;  3NMZ C;  1X6B A;  1H8K A;  2C0T A;  5FWB A;  2DRK A;  1GFC A;  1GCP A;  3TSW A;  2P4R A;  2RPN A;  2RMO A;  3THK A;  5GJV B;  2GTJ A;  5I22 A;  1UJ0 A;  3KFV A;  2HDA A;  2BZY A;  3UAT A;  1SHG A;  1SPK A;  1HJD A;  3ULR B;  2K3B A;  2EYW A;  3SHW A;  1QWE A;  2DBK A;  2AKK A;  2IIM A;  2J06 A;  2RQW A;  4J9C A;  2KRS A;  2KR3 A;  1VYV A;  3RBB B;  3R6N A;  1Z9Q A;  4JPB W;  2B86 A;  2D0N A;  3VS7 A;  1KJW A;  1XOV A;  2EYZ A;  2BTT A;  4RTW A;  1OPL A;  4HXJ A;  3M0U A;  4HVU A;  2BZX A;  2J6F A;  3RNJ A;  1PRM C;  2ED0 A;  1K4U S;  3PVQ A;  2PTK A;  1X69 A;  2DLP A;  2DL3 A;  2J05 A;  1ABQ A;  1ARK A;  1EFN A;  1NLO C;  4OMQ A;  2A28 A;  3VRZ A;  1H3H A;  2DM1 A;  2L3Q A;  2AZV A;  1WXT A;  2ROL A;  3VS3 A;  4OMN A;  1BBZ A;  1YCS B;  2RF0 A;  1TG0 A;  3EHR A;  3ZL7 C;  2VVK A;  4D8D A;  4Z88 A;  1JU5 C;  1AVZ C;  4AFU C;  4HVW A;  4RTV A;  2X3X D;  2A36 A;  2DVJ A;  5FW9 A;  4Z8A A;  2KE9 A;  2JXB A;  2RQT A;  2CT3 A;  1UFF A;  1ZBJ A;  2YUO A;  4F14 A;  2D8H A;  3QWY A;  4E6R A;  1NM7 A;  1NEB A;  2DMO A;  5L23 A;  2CT4 A;  4DEX A;  1FYN A;  4J9I A;  4JZ3 A;  3EGU A;  4F16 A;  2DX1 A;  2PZ1 A;  2SRC A;  1U3O A;  2JMA A;  2FRY A;  4R0K A;  2EVR A;  2RQU A;  2W10 A;  3LH5 A;  2C0I A;  4CC4 B;  3C0C A;  4J9G A;  2KXC A;  1I0C A;  4OML A;  2O31 A;  3VS2 A;  1WLP B;  2L2P A;  2AZS A;  3VS6 A;  1AWW A;  1AZG B;  4KRT A;  1WDX A;  1WFW A;  1I07 A;  5IXF A;  1CKA A;  1JEG A;  1M3C A;  2LJ0 A;  2CDT A;  2L0A A;  1WA7 A;  3I5R A;  4OMO A;  3M0R A;  2YDL A;  2CSQ A;  1B07 A;  2L3S A;  1ZUY A;  3VS4 A;  2YUQ A;  2FPE A;  1KFZ A;  2LX7 A;  2CH4 A;  5HCK A;  4A63 B;  2EBP A;  1WYX A;  2DL8 A;  3CQT A;  1W1F A;  4DEY A;  2EKH A;  5IH2 A;  1KIK A;  3EG3 A;  4EIK A;  1X2Q A;  3TSZ A;  2JM9 A;  5IHN A;  2NUZ A;  1I1J A;  1J3T A;  1HD3 A;  2KRN A;  3GBQ A;  1UUE A;  1AWJ A;  4ESR A;  4IIO A;  1PWT A;  4WCI A;  2DE0 X;  5EC7 A;  2LJ1 A;  3JV3 A;  1QLY A;  2DRM A;  1SHF A;  2K6D A;  1H92 A;  2HBW A;  2JW4 A;  5IXB A;  1GL5 A;  4OMP A;  3EG2 A;  1K76 A;  1OOT A;  5FWC A;  1CSK A;  1SRM A;  2H8H A;  4JJB A;  2K7A A;  4QT7 A;  2EGE A;  2JM8 A;  1B3Q A;  2FEI A;  1OV3 A;  2K2M A;  4GBQ A;  2OJ2 A;  2GTO A;  1W70 A;  5I11 A;  1ZUU A;  3UA7 A;  4AG2 C;  3NGP A;  1K1Z A;  2O9V A;  1QKX A;  1BK2 A;  2RN8 A;  2JS0 A;  2J7I A;  2LJ3 A;  1YWO A;  3NHN A;  4IIM A;  4JJC A;  1VYU A;  1M27 C;  2CRE A;  4RTU A;  1T0J A;  2FO0 A;  4J9D A;  1A0N B;  2ECZ A;  1OEB A;  1VYT A;  2KYM A;  2EPD A;  1GCQ A;  4M4Z A;  2AK5 A;  2A08 A;  1UE9 A;  2EYX A;  1OPK A;  1HSQ A;  1E6H A;  1ZUK A;  2M0Y A;  1X6G A;  5IHI A;  1PNJ A;  1NEG A;  2EW3 A;  1YWP A;  5GJW B;  4LNP A;  1V1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...