3VJPA

Orthorhombic crystal structure of salmonella flga in closed form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
198
structure length
198
Chain Sequence
QDINAQLTTWFSQRLAGFSDEVVVTLRSSPNLLPSCEQPAFSMTGSAKLWGNVNVVARCANEKRYLQVNVQATGNYVAVAAPIARGGKLTPANVTLKRGRLDQLPPRTVLDIRQIQDAVSLRDLAPGQPVQLTMIRQAWRVKAGQRVQVIANGEGFSVNAEGQAMNNAAVAQNARVRMTSGQIVSGTVDSDGNILINL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural flexibility of the periplasmic protein, FlgA, regulates flagellar P-ring assembly in Salmonella enterica
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Chaperone
molecule keywords Flagella basal body P-ring formation protein flgA
total genus 36
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08666 SAF SAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.760 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vjpA02
3VKIA 3FRNA 3VJPA 3TEEA
chains in the Genus database with same CATH superfamily
1YJNQ 4AG1C 1FXXA 1UGRB 1ZA1B 2P4TA 3A8HB 1VA7A 2K3XA 4C8QF 1V76A 3C4SA 3QWYA 3RR6A 2HDAA 4M7AB 4DBRA 3GOXA 2CP5A 4OMOA 5GANj 2EGAA 1QVGA 2ATCB 5GAMf 1GFDA 2DRKA 3LWHA 4KT0E 1WQWA 3WVDB 3G6EQ 1R8OB 2I0NA 2FL7A 4OGCA 2M51A 3JCMX 2PUKB 2RB6A 3QDFA 2F5TX 3X25B 4KUDK 1ABOA 4X1VA 4QW2A 4M75D 3RKWA 2DF6A 4Y28E 2QA4T 4XK8E 1S72Q 2BE7D 5GMKe 1KQSP 3E9FA 4LE9A 3INZA 3SFMA 2K5FA 1JO8A 1WDXA 4C0DB 2F69A 4JDSA 3H6ZA 4XU3A 2EQJA 4JLIA 1WJSA 4E7SA 4GY5A 1K0SA 1YIJT 3LYIA 1VQLQ 2E70A 2DYBA 3X26B 2DERA 3CC2Q 2HCKA 2WACA 3BY7A 1SSFA 3EG9A 2YLCA 1LPLA 3CPWP 3C12A 1I8FA 3VRYA 2C0OA 3CCJT 3CCUQ 2RHYA 3SB2A 2KT8A 2QG9B 1VOMA 4Q5WA 8ATCB 1Y96A 1KC8U 4PJOC 4OB2B 1AWJA 2F2VA 3PTAA 1VQ9T 1WHLA 3OYKA 4EMGA 3JCMP 2JMAA 5CKBA 4PJOE 2B8AA 2YHTA 3EG1A 1M1KR 2CS7A 2X4XA 2A37A 2KR3A 3C94A 4D8KA 2A36A 3NTKA 2LJ0A 1M9SA 2EYYA 3OS1A 1NJIR 1MMNA 3ZL7C 2RH2A 4J6XA 3CC7A 3UA7A 1QLYA 2QQBA 2EKHA 4B9WA 2XI9A 2DZCA 4C0FA 1KIKA 2DPPB 2DKGA 2GTJA 2HEQA 4AFQC 4C8QE 2RJEA 3OYMA 2JS2A 4E2FB 2JUFA 2WSEE 4F14A 1V29B 4BDYA 2LRQA 4XU1A 5KYXA 1PNJA 3JCMc 1PD1A 3BFMA 3QBYA 3FB9A 3JB9G 4V2SA 2F2XA 4E7LA 2OJ2A 1YI2Q 2ZPEB 2RHXA 3CCEQ 3CCST 1JQQA 4DBFA 3RMQA 2JS0A 2QQ9A 1K8AC 1C0MA 2XK0A 5FLXE 3I56A 1M3CA 2MYSA 2V8IA 1MGQA 3OBYA 1BI2A 3LH0A 1WI7A 5KE2A 3U23A 4J9HA 3SDZA 5FRNA 2EQIA 3L42A 2VUBA 4N4IA 1WA7A 2OTLT 1D1AA 5IN1A 1K73R 4M7DF 2PVDB 1GXIE 2EBPA 4Z89A 4PJOF 3H0IA 5A0LA 5GAOl 3L2QA 2DIGA 1LJOA 2YXYA 4WCIA 3KXTA 1QVFP 3M54A 1QMCA 3QPHA 3WXMB 1VQOT 1OI1A 1S72T 4IKFA 5KYUA 1EZZB 5LJ3j 3I9QA 2GFAA 5GANe 1RABB 3EH2A 1N8RU 1QWFA 2HSPA 1VQMA 2DO3A 1WXUA 2XDDA 1EFNA 1PKSA 1WXBA 2FRYA 2HL3A 2LCLA 4DBHA 3EGUA 3P8DA 2SEMA 2ED1A 3PMIA 2PU9B 1ZSGA 3L2RA 1I0CA 5GJVB 3PVLA 2FVUA 5IHKA 2PNIA 4FT4A 4F17A 1QCNA 2ABLA 1N6AA 3PE0A 3QSUA 5KYYB 1KC8R 2KRMA 3ASKA 3CCQT 1B34B 5CKDA 4JJCA 2L89A 3CCET 2OTJA 1WNLA 3MHXA 1VQNQ 2QEXT 9ATCB 3TCJA 3BDUA 2X4JA 1FX7A 1SKUB 2QDLA 1VQLA 5CK9A 1RACB 4J5YA 1K8AU 2CKKA 4PJOG 1CKAA 3NGPA 4QVCA 1MHNA 1KSWA 3OA6A 4FL6A 2EKOA 3UDCA 1F1BB 3MKDA 4E7KA 1YJ9Q 2GCXA 4HVUA 4X9CA 1M8VA 1TXQA 1R77A 4A4KA 1VQLT 5GAMh 3CCLT 5LJ3f 3H9NA 2YRDA 1IRXA 3JB9H 2QASA 3RESA 3OYEA 4IUUA 4OVAA 4M7AG 4C8QA 3JCMW 3FRNA 3I55A 2ZGWA 1VQ4A 1U3OA 1IO6A 2QQSA 1FMKA 1QKXA 2VC8A 3JSCA 4D6WA 2JM8A 1YIJQ 2C0TA 2FPEA 3CC2A 2E41A 4M75G 4J6WA 2KEAA 1TU0B 2LCCA 5IXFA 3S3MA 2A3LA 1N8RC 2RHUA 2PVGB 2DEQA 2LP5A 1OX8A 2CUBA 4MDXA 3OYLA 2DX1A 3OYHA 2M0YA 1OX9A 2YLBA 2HAXA 2KVQG 2RMOA 3HRUA 4PJOA 1OOTA 4CC2A 1BBZA 4C0DC 1U1SA 1VQ5T 2H3JA 5D6YA 1YJWA 1VQ7Q 3PFSA 1HK9A 2P0PA 4XTXA 5D6XA 5GANh 1K76A 4DQ2A 3CCSA 1R0BG 5FW9A 1AT1B 1QVFS 2BZYA 2D0NA 4RTXA 2ECZA 2OTLQ 5EC7A 1RADB 3M0TA 4N4GA 2LT1A 5GANd 2NUTB 2YRCA 1U06A 4M78F 2YUOA 1NEBA 3FLGA 5IT9E 1RI0A 3S3NA 4ZTFA 1VQ8Q 1UHCA 5M9OA 1ZX6A 2DL7A 5HK3A 1YI2T 4J9DA 3A8LB 5I2SA 3MEAA 3WVEB 2V1RA 2LQWA 3CXCS 3SWNB 1WX6A 5LJ5j 1WIEA 3UWNA 1N27A 2D1XA 2HNIA 2NUPA 4EMHA 4M7DG 3UA6A 1Q82U 2GF7A 2KQWA 3KFVA 1VQPA 3PIOA 1JEGA 5GAMe 3AT1B 2CZ6B 2VGNA 3ER0A 4F7UE 1OV3A 4AMCA 2JTMA 3OS5A 1RAHB 5J26A 2DJZA 1HD3A 1XTDA 2EIFA 2E10A 2QEXA 1MMAA 3V8LA 3NPFA 1M2VB 3A1PA 4DOVA 2P0KA 4J9IA 2KMTA 4PK4A 5FU6C 2H3EB 3X20B 2E5KA 4JS5A 5GANf 3CD6A 3X24B 3M9QA 1RLQC 1WJRA 4C8QD 5IH2A 1SG5A 1WGSA 2P4RA 3ZFJA 1MNDA 3JB9I 2KNBB 1PG5B 3OYFA 4PNOA 2X3XD 4M7DC 2OTJT 1TTHB 3VYHB 2M1HA 4EMKB 1K1ZA 3HL8A 3V8KA 5C6SA 1VQ5A 1N8RR 2RJDA 3CMAA 2HSEB 1ZUKA 2HKQB 4C92D 2DXBA 1YHQT 4A4HA 2ROLA 4M78A 4MZMA 2G6FX 1AD5A 2VB6A 5CR2A 2OTJQ 4Y91A 2FZCB 1WPYA 1NJIC 3QDRB 2QDYB 4CI0C 4FW2A 2DTOA 2LVMA 4OMQA 4JJBA 1KK7A 2KT1A 3KUFA 4OMLA 2JNGA 2K7AA 4AG2C 1AHJB 2HL5C 1G83A 4M77B 4Z8AA 2FEIA 1YBYA 1RAIB 3QJ6A 2C06A 3G6ET 4OB0B 4Z88A 4Y92A 3M56A 1W6XA 4A54A 1AWOA 5GJWB 2I2LA 4II1A 3TU4K 3REBB 3CCSQ 3HTRA 1UGVA 1VQKQ 3GLXA 2QYZA 1H3HA 4IURA 2CP7A 1RAGB 1YNZA 2CGHA 5LJ3h 1BIAA 2LMJA 3I56T 2RD1A 1ZHIA 1VQ8T 2QQAA 4XTVA 1Q82R 2DD4A 2L0AA 1Y57A 4WTOB 4BACA 1ZBJA 3CCQQ 3CCVA 4M7AE 5GAMg 4EMKC 1RI9A 2L3SA 2EYWA 3DLMA 2X4WA 4CC7A 1I5OB 4JZ4A 3M55A 5I21A 2DL8A 2KYMA 3I56Q 2M0OA 2DILA 1W2BS 2KYBA 4PFOA 2RF0A 2IPOB 4JRQA 2KRNA 2RQVA 2DIQA 2YT6A 1M2OA 3M0QA 4OMFB 4IUQA 3VV0A 3EAEA 3M4YA 1R0CB 4E7JA 1RLPC 1Y0MA 2XU8A 4RKUE 2FYKA 4PJNA 2AZSA 4M7AA 4HCCA 3MEWA 4OB3B 1E6HA 1ZLMA 4J83A 1NLOC 1NPPA 1VQ8A 3H8ZA 3JCMe 4HT9A 1G3YA 1Q86C 2GFUA 2EAYA 3VYGA 3VRZA 1K73C 1WHMA 2A7YA 2K2VA 1QVGS 1GL5A 4M7DE 1VQ6A 1B07A 1YJWT 3OW2S 1I1JA 1AZGB 2HZYA 3UATA 1GBRA 1UDLA 4M7DD 2D8HA 1EIFA 1I07A 3CBPA 4PJJA 1UUEA 3I55Q 2ENMA 1KQ1A 4C5IA 4EPCA 2CP3A 4TVRA 3I35A 4JJNK 1YITA 3VKIA 1FMWA 1RUWA 2X4YA 1Q81R 1Q7YR 5CVIA 2LZ6B 1X27A 2XICA 5IHIA 4M78B 1VQNA 2K57A 1PM3A 3C95A 1QP3A 5A0GA 2VGMA 1UJYA 2KE9A 4L6V5 4PKCC 2DETA 1K9MU 1WHGA 3CCMQ 4EMKA 4MMKA 1TUGB 3EG9B 3MO8A 5KE3A 2DVEA 1OU9A 3EFSA 4R55A 1VQNT 4LD9K 1MNEA 2EVRA 3GIBA 2QAZA 3EG2A 3EHRA 1QP2A 1D3BB 1Y7XA 4GLMA 2DK3A 3QXEB 3OW2P 5KCOA 2RHZA 1CSKA 3I5SA 1N9SA 1NZ9A 5AYFA 1U8RA 1VQPT 4A53A 1X2QA 2DEUA 2MOXA 3OYYA 5GMKi 2QGGA 4KH0B 4IIOA 1GCPA 1YHQQ 1ZSZC 2JOYA 3HHTB 1UJ0A 4HA8A 2P0QA 4CRIA 4QQGA 1Z9ZA 5LJ5h 1JXMA 1UB4A 2FZGB 1UTIA 3EGDB 2LNVA 1OQKA 4XU0A 4PFZA 1N5ZA 3E19A 5CQXA 2JM9A 1YJWQ 1M90U 2SRCA 1ARKA 2K4YA 5GAN6 4PFPA 1TSFA 2ZAEA 4M77C 2NYSA 1SSHA 3JAME 2ESWA 1K8AR 1DJ7B 2K5IA 4LUDA 4PJMA 2QTXA 3SHWA 3MJXA 3VS5A 3CC4Q 4KGZB 4PLIA 1NE8A 4J8OA 4C92E 1X2KA 2A28A 1NEGA 3V7CA 3FEOA 2KY9A 3OY9A 3EGDA 2BKDN 2GGRA 2GQVA 4J6YA 4A4GA 2NWMA 5CKHA 4BY6C 4E7ZA 2P84A 4IIMA 4A4FA 1G8XA 3OSSC 3CCLA 4DOWA 1SRMA 4LDVA 2Y90A 2RO0A 1X01A 5DLOA 1WHHA 2LNHB 4ZGEB 2BTTA 3JB9J 1JBMA 3CPFA 1YFNA 4FYXB 5I2MA 1WZOA 2DA9A 2M02A 4PL6A 2NLUA 2BUDA 4J9CA 4KGXB 4LD6A 1Q7YC 2W10A 1KD1C 2FPDA 3CMAQ 4K11A 3CXCP 1ACMB 1VUBA 4BB7A 1LVKA 5GAOr 3NHNA 3JB9D 3CD6T 1BK2A 3A5ZB 1VIFA 2KDSA 3UT1A 4J9EA 2RPNA 4QT7A 5KYYA 4WF2A 3LW5E 5KYUB 1YJ9T 5GAOq 2QI2A 3MEUA 1KHIA 2CSIA 1YITQ 5HK0A 2PVOB 4X9DA 2IG0A 2V1QA 3TEEA 2JMCA 1P92A 3H0HA 3MPUB 5C0MA 2K79A 1WQ7A 3P8HA 4IUPA 1D3BA 2E65A 4E47A 1UHFA 3J81E 3CCUT 5GAN8 1OZ2A 1V1CA 1FWZA 2PZ1A 1B34A 3OYJA 1YCSB 4O5VA 1U1TA 2Z0WA 5CQYA 3CCJQ 4M4ZA 2E3HA 3N5BB 2LX7A 3PGGA 3NMZC 3JCMJ 4C8QB 1VIEA 2O88A 1C1AA 1K4US 2OX7A 1MV3A 1YCYA 2DTIA 3REAB 1M1GA 3M0SA 1AOJA 4BE2A 2MIOA 3DB3A 2Y4YA 1M3BA 3G4SQ 1UGPB 2KAFA 1G5VA 2O31A 1BU1A 4NL2A 1WFWA 2VXFA 2DM1A 3OYCA 1WYXA 4C5HA 3S3OA 3CBOA 4C92C 2EYZA 4RTYA 3LX7A 2HKNA 3A8OB 3ME9A 3RKXA 5GMKm 4XTYA 4BI4A 2E3IA 2CP0A 2RI3A 2WSCE 2VV5A 2DBKA 1YJNA 3JCMV 1Q82C 4ELZC 3S6WA 4Z02A 1WHJA 1YITT 3M0UA 1YWPA 4L5GA 1AWWA 5AT1B 2QGFB 1IHWA 3CCEA 2VWFA 1YHQA 4JZ3A 2MPXC 2OI3A 1BIBA 4C8QC 2RQWA 2D9TA 1M8MA 1M1FA 1NPRA 1X69A 3TREA 1SHFA 3JCMh 4LDWA 4JJDA 2Y4XA 2O4XA 2CUDA 1QW1A 1XJWB 2LQ8A 5GAOm 4BI8B 3ULRB 2HQEA 1UG1A 1HYOA 1H3ZA 1YP5A 1Q86R 2CT3A 5GMKj 3CCLQ 1VQOQ 2YUQA 1Y96B 2R5MA 3OS0A 3CC4A 5J3BA 3G71A 2DZ9A 1ZA2B 3HP9A 1E7OA 1G2BA 1T3LA 4FSSA 4QKUA 3X28B 1KJWA 1I5LA 2DAQA 2PUOB 1ABQA 2IIMA 3CEYA 4EDUA 1M27C 4FT2A 2LCSA 1MV0B 2CYZB 2ZPHB 1M4ZA 1QVGP 4F04B 3CC7T 3GNFB 1B3QA 4OF1A 3CPWS 3ZBDA 1U5SA 1ZUUA 3EG3A 4HT8A 2CDTA 3E1SA 1RAEB 3OYDA 1TG0A 2O2OA 2LT4A 1YJNT 2RI5A 3LWIA 1VQKA 5KYXB 1VQ6T 2MWPA 4ESRA 1K73U 5GMKh 1BI3A 2LC4A 2CZ1B 3RERA 4M7DA 1XNIA 1GCQA 1M90R 3OMCA 2DL5A 2IVWA 4FIBA 5LJ3d 4PLLA 4UC4A 3OYGA 4J9FA 4J9BA 4XTUA 3CCQA 1PCXA 4AFSC 1VYUA 3PVQA 2FRWA 4RCCA 3EFRA 1G3WA 2LDMA 3UPUA 4FU6A 4QQ6A 4M7AC 1PSEA 1NYFA 1AEYA 2EW3A 2DE0X 4A63B 1VQ9Q 1ZQ1A 3TVTA 3KBGA 1TWBA 3OBWA 1I4K1 1D0XA 1PRMC 1N9RA 1NG2A 4BE0A 2L3QA 2EJFA 4XU2A 3OMGA 2X9HA 2BZXA 1GBQA 3QJYA 4BD3A 5LJ3g 1QKWA 3V7SA 1S1NA 2DMOA 4ANJA 1PSFA 2OAUA 2COZA 1IHVA 3CCVT 3PMTA 2K3BA 1YWOA 2FO0A 3GF5A 4JUVA 2AK5A 5ECAA 2KK4A 4HCZA 3A98A 3IQLA 1BCMA 5DLQE 1VQ7A 2V26A 5GANg 4VUBA 5DM7R 6AT1B 2NUZA 4RG2A 2L2PA 3C0CA 5HY6A 1D0YA 4LN2A 5IXBA 2MWOA 2XDBA 1A0NB 5LJ5f 1UEBA 4FM4B 3CC2T 5D7UA 3HFNA 3M57A 4C92F 1ZSZB 1E6GA 3QYHB 5CIUA 4HCKA 3OS2A 4M75C 1SEMA 1VQ6Q 2K9GA 2F5KA 3RUXA 2F2WA 2RI2A 4A4EA 4C5GA 1H8KA 2O4XB 2FPFA 2ED0A 1LNXA 4DBQA 1WXTA 2PTKA 3G4ST 4N0AC 3URGA 2JVVA 1IB8A 2VYTA 1KHCA 2GBQA 3QKJA 2K6DA 3UF4A 1CKBA 2V8KA 4JS4A 4JLGA 1TUDA 4RTTA 4XQ3A 2O9SA 5FROA 2RJFA 1M90C 1BKBA 2JW4A 4F7UB 2JJ9A 4KGVB 3FJPA 3RIRA 4C8QG 1SPKA 1TOVA 4B6MA 4R0KA 3L2VA 3RNJA 3CMET 2RN8A 4FW1A 4M78C 4FYYB 1JRIA 1FYNA 5GAOn 2L5QA 1KD1R 2RA2A 1M3AA 4BDZA 2DLPA 4C92B 2KXDA 4EIKA 4ELYC 1KG1A 2BZ8A 5FWBA 3L2WA 1Y71A 2BIVA 4OB1B 1GRIA 1W1FA 4QQDA 1AWXA 2YUNA 4LDYA 4MMLA 4C92G 3I55T 2W0ZA 1KQ2A 3FJ5A 3VS3A 2QXFA 2OAWA 3M0RA 2GNCA 2O01E 3THKA 1T0HA 4MZTA 3HPWA 2JXBA 3FIFA 2DTHA 1M1KC 2GQIA 2R57A 2DFUA 1XOVA 1QVPA 2QA4A 2JN0A 1PRLC 3TSWA 1UE9A 1VYTA 1BB9A 1PKTA 4X34A 4KUIA 3O5ZA 3OYIA 4QVDA 4C0GA 3RMSA 1VQOA 1AZEA 1K9AA 1T0JA 2HMAA 4RTVA 1NBEB 1ZUYA 3ZEHA 5KYWA 4F7UF 1Q7YU 5KYNA 3VS6A 4GLKA 4D8DA 4HVWA 3HSBA 4O6JA 5HCKA 2B86A 5CAIA 1YIJA 2LJ3A 1YJ9A 2XHCA 4BI3A 1ZBXA 2NUTA 4J7IA 1X6GA 1J3TA 3OSVA 2X35A 4FSXA 4NOYA 3FC3A 2LQKA 1JJ2A 2DL3A 2FG0A 1D1BA 1O75A 3DKMA 2QQRA 4ZN1A 5GAOp 2DNUA 2E5QA 2HD0A 2LJ1A 3VS7A 4M7DB 3F70A 1VQ9A 2YUPA 3LH5A 3VS4A 4RTZA 2XKOC 2E12A 2DL4A 5A0DA 2D6FA 4XAXB 4FYWB 5J39A 3GNGA 1KQSS 2E1HA 2MK5A 3EH1A 3OYNA 4J7FA 3NTHA 2RQUA 1JB0E 1PHTA 4OMPA 2G3RA 4PJLA 5CKEA 4BUGA 4M78D 3G71T 3MEVA 3VUBA 4DA4A 2X3WD 3RKYA 4PJOD 1VQ4T 2YRVA 2E6ZA 3JCMQ 3EHQA 1AVZC 4DEYA 1O9SA 1YN8A 3SWNC 4HKEA 1M5Q1 2KSSA 1W2BA 2J6OA 5GAMd 3GP8A 2J7IA 3D7SB 1OPKA 3CCMT 5L8RE 2XD0A 3QO3A 3E9GA 2L3PA 4KH1B 2DD5A 3OYAA 3JCMd 3Q1JA 3EGXA 2COYA 5FRMA 2K3YA 2CZ7B 2X51A 2E6NA 2KROA 1NM7A 4E6RA 4RG8A 4HXJA 1D09B 2JTEA 2M9UA 1RAAB 3CCVQ 5CO7A 2L8DA 3OQ5A 3BE3A 3R6NA 1RAFB 1VQPQ 1X6OA 3VS0A 3RDVA 2F1LA 7AT1B 4E7HA 5I22A 4ZGJB 4LUEA 4FCYA 5IHNA 1X75C 2ZZDA 2EJGA 2D0QB 1OPLA 2MAMA 4M77G 1M30A 4ORZA 3QWXX 1OEBA 3JCMg 4RTUA 3SD4A 2QEXQ 3EFOB 2EGCA 2C0IA 2FHDA 2MI6A 4DEXA 2EJ9A 4M7AD 3CCJA 1X43A 2EYXA 1NYGA 4E7IA 2MCNA 5GAN2 4C0ZA 1QQJA 3V7RA 4HCBA 5LJ5e 2QK0A 3CD6Q 3TSZA 5KCHA 2DYIA 2ZPIB 1JJ2P 1OYXA 4NL3A 4MDWA 3G71Q 2CP6A 2KI7A 4IUTA 2DRMA 3MP1A 3G4SA 3QZ5B 4JRIA 1H641 3JCMb 4M77E 5L23A 2VKNA 2XDPA 1BCOA 2BE9B 2E64A 4M75B 3CC4T 2J6FA 3MP6A 2ROTA 1G3TA 5I11A 3JB9F 5LL6S 1KC8C 2RQRA 4C92A 1TH7A 3HFOA 3EFOA 2ZPGB 5FU6B 3VUZA 3CPWA 2V8JA 1QWEA 1SRLA 1K0XA 3QUIA 3CCUA 3OW2A 2J06A 3J80E 2AKKA 2QTVA 1BYMA 1HSQA 2HQHA 3JCMf 4M7AF 1UGSB 1KFZA 3QG1A 2EQMA 1ZSZA 1VQ7T 3LLRA 1VQ5Q 2DBMA 3G1JA 4N4HA 3CCMA 3E2UA 4C5EA 1JU5C 4KBMB 1M2VA 3P8BB 3M4GA 1UFFA 3CMAT 4ZGDB 3O8VA 1S72A 5GAN5 3VU3C 3M58A 5FU7B 2EPDA 5GAN7 3HKSA 3GPLA 2FZKB 5GMKl 2CREA 4YTLA 1QVFA 2J05A 5GAN3 4L59A 3FDRA 1IGUA 2VXEA 1W70A 2K5LA 5FWCA 3AHUA 1IZ6A 1EX4A 4HVVA 4RMOA 4JPBW 3V8JA 4OMNA 3M53A 2KBTA 3PT9A 3EGXB 4OP0A 2LX9A 2JTFA 2E4HA 2CT4A 3CMEA 2YSQA 1Q86U 1VYVA 1Q81U 2K2MA 4M78G 2RNAA 1OU8A 1PWTA 1VQMT 2COWA 1LOJA 4LXCA 1WHKA 3VS2A 1PC0A 3NTIA 2D8JA 4ME7A 5CCAA 4MZPA 4QVZA 4M78E 1OZ3A 1PD0A 4KRTA 3L2ZA 2NUPB 1I81A 3LGLA 2RQTA 1TS9A 3OYBA 2ZPBB 5IAYA 1MMGA 3RBBB 3QYGB 2KRSA 4AFZC 2DVJA 1XQHA 3H41A 3CMEQ 2RK2A 1TUCA 1SHGA 1MUZA 1H92A 2M16A 3H0FA 1G3SA 1IXDA 2EFIA 3SEMA 1VQ4Q 2QA4Q 1SF9A 2CP2A 4M77F 3EG0A 1X6BA 2AIRB 2R5AA 1GCQC 3NFCA 5KYWB 4RCBA 2RK1A 1KQSA 1K9MC 5LJ5d 3A8GB 4AT1B 3LGFA 1GFCA 1K9MR 1QCOA 2DXUA 4M75F 4M77D 3BDLA 1UGQB 4BY6B 1W4SA 3QHSA 2VASA 4FYVB 3VS1A 2RJCA 2AZVA 3QIIA 3M59A 3OB9A 3R6OA 3MCAB 3QZ9B 2XIDA 2CZ0B 2J6KA 4B9XA 2O9VA 2GTOA 2RHIA 3J7AF 5D6WA 2HBWA 1D0ZA 2EYQA 2OTLA 2JT4A 3L1AA 2ZPFB 1Q81C 2CH4A 2H8HA 4J9GA 4JRKA 4ZNXA 4KULA 2EWNA 2YWWA 3M5AA 3G7ZA 5HKCA 1FMVA 2AHJB 3T9NA 2YDLA 2HQXA 5GAN4 4JRPA 1Q95G 2DXTA 4M75E 5LJ3e 1HXDA 1IGQA 1WLPB 4M75A 3MP8A 2FB7A 4RUGA 1WJQA 1QCFA 4F16A 4F7UA 1NLPC 3CCRA 2EGEA 4GBQA 3PIPA 1LCKA 3JRZA 2CH4W 1D1CA 5KH6A 4M77A 1B7TA 4OGEA 3L2UA 1MMDA 2AT1B 2VVKA 3I5RA 4ZTJA 2XG8D 2RM4A 2LTOA 2A0FB 4CC4B 2CSQA 4LNPA 4XTZA 3HRTA 3TQ7P 1UECA 3CCRQ 2AKLA 1C6VX 3DB4A 1IREB 2A08A 1YI2A 2EQUA 2PQWA 1JJ2S 3VJPA 3CC7Q 2KXCA 2DJQA 4NS5A 5DY9A 3SWNA 3META 4AFUC 1Y07A 4LDXA 1BI0A 2R58A 5A2QE 3GBQA 5LJ5g 2HBPA 4ZN3A 4N0AA 4CC3A 3CCRT 3CBMA 3DLLA 4XTWA 2ZCFB 1T3SA 2JZ2A 1OULA 4BE1A 5GAMj 1KD1U 4ATOA 1JXOA 4F7UG 2LQNA 3HRSA 5CKFA 1RL2A 8AT1B 1NJIU 1BI1A 4RTWA 4R56A 4LDUA 3A8MB 2DXCA 1Z9QA 1W2BP 5FU7C 4P5NA 3BW1A 4IUVA 5EG2A 3CQTA 3CXCA 2WSFE 4OMMA 2L3RA 2XMFA 3M0PA 1VQMQ 1VQKT 3G6EA 3JV3A 2MF2A 2MMPA 4PJOB 1HJDA 2KGTA 3PNWC 2EQKA 1M1KU
chains in the Genus database with same CATH topology
3MEVA 5GAN8 2E10A 2QEXA 3VUBA 3V8LA 1FXXA 1OZ2A 3RKYA 1UGRB 2P4TA 3A8HB 4DA4A 1VQ4T 4PJOD 2YRVA 2E6ZA 3JCMQ 1FWZA 1B34A 2K3XA 3OYJA 4DOVA 2P0KA 4O5VA 1U1TA 5CQYA 3C4SA 4C8QF 1O9SA 4M7AB 3SWNC 3GOXA 3N5BB 1M5Q1 2KMTA 2KSSA 4HKEA 1W2BA 5FU6C 5GAMd 3GP8A 3PGGA 3X20B 5GANj 3JCMJ 4C8QB 1QVGA 3CCMT 5L8RE 1VIEA 3QO3A 3E9GA 2XD0A 4JS5A 5GAMf 2DD5A 3OYAA 5GANf 3CD6A 3JCMd 3X24B 3LWHA 3Q1JA 4KT0E 1WQWA 3M9QA 1WJRA 4C8QD 3WVDB 1YCYA 2DTIA 5FRMA 2K3YA 2CZ7B 2E6NA 1WGSA 3ZFJA 1M1GA 1R8OB 2FL7A 4BE2A 3DB3A 3JB9I 4RG8A 2Y4YA 4OGCA 1UGPB 2M9UA 3JCMX 3OYFA 5CO7A 2PUKB 4PNOA 2RB6A 2L8DA 2KAFA 4M7DC 2OTJT 3OQ5A 1G5VA 3VYHB 2F5TX 2M1HA 3X25B 4EMKB 4KUDK 3HL8A 4NL2A 2VXFA 3OYCA 1X6OA 4QW2A 4M75D 3V8KA 3RKWA 5C6SA 1VQ5A 4C5HA 3S3OA 2RJDA 3CMAA 3CBOA 4C92C 4E7HA 4ZGJB 4Y28E 2QA4T 1X75C 4XK8E 2ZZDA 3LX7A 4C92D 3A8OB 2DXBA 3ME9A 2EJGA 2D0QB 3RKXA 3E9FA 5GMKe 4XTYA 5GMKm 1YHQT 4A4HA 4BI4A 4MZMA 4M78A 2MAMA 3INZA 4M77G 3SFMA 2RI3A 2K5FA 2WSCE 2VV5A 3JCMg 5CR2A 4Y91A 3SD4A 1YJNA 3JCMV 1WPYA 4C0DB 4ELZC 2F69A 3QDRB 4JDSA 4Z02A 2QDYB 3S6WA 4CI0C 3H6ZA 4XU3A 2EQJA 2FHDA 2MI6A 4JLIA 1YITT 1WJSA 2EJ9A 4GY5A 4L5GA 4M7AD 1YIJT 3CCJA 3LYIA 2E70A 3X26B 3CCEA 2DTOA 1YHQA 4E7IA 2WACA 2LVMA 4C0ZA 5GAN2 3BY7A 1BIBA 1SSFA 4C8QC 3KUFA 3V7RA 2D9TA 2YLCA 4HCBA 2JNGA 5LJ5e 1M1FA 1NPRA 1AHJB 3TREA 5KCHA 4M77B 3C12A 3JCMh 1YBYA 2ZPIB 1I8FA 1OYXA 3QJ6A 4NL3A 2C06A 4LDWA 4MDWA 3G6ET 3CCJT 4OB0B 2RHYA 2Y4XA 2O4XA 4IUTA 3MP1A 3SB2A 3G4SA 1QW1A 3M56A 4A54A 2LQ8A 4Q5WA 5GAOm 1Y96A 3QZ5B 4JRIA 4BI8B 1KC8U 1H641 4PJOC 4OB2B 3PTAA 3JCMb 1M1KU 4M77E 1VQ9T 2I2LA 3OYKA 4II1A 2XDPA 4M75B 4EMGA 2HQEA 2E64A 3TU4K 3JCMP 5CKBA 3CC4T 4PJOE 2B8AA 2YHTA 3MP6A 1H3ZA 3GLXA 1G3TA 2CS7A 2X4XA 3JB9F 4IURA 5LL6S 1KC8C 5GMKj 4C92A 2CGHA 1XTDA 1TH7A 5LJ3h 1BIAA 3HFOA 3C94A 3NTKA 3I56T 2RD1A 1Y96B 1ZHIA 1VQ8T 2QQAA 2R5MA 4XTVA 2ZPGB 1M9SA 5FU6B 3VUZA 3CPWA 3OS1A 2DD4A 3OS0A 2V8JA 4BACA 2RH2A 3CC4A 5J3BA 3QUIA 4J6XA 3G71A 3CC7A 3CCUA 3OW2A 3J80E 2DZ9A 2QQBA 3HP9A 1BYMA 3CCVA 4B9WA 2XI9A 3JCMf 4M7AE 4M7AF 5GAMg 1UGSB 2DZCA 4C0FA 4EMKC 2DPPB 3X28B 2DKGA 4M7DG 3QG1A 1I5LA 2DAQA 2EQMA 2PUOB 4C8QE 1VQ7T 3DLMA 3CEYA 2X4WA 2RJEA 4EDUA 4FT2A 3OYMA 3LLRA 3M55A 5I21A 2CYZB 2ZPHB 2JUFA 4N4HA 1Q82C 3CCMA 2WSEE 1V29B 2M0OA 4C5EA 1M4ZA 1W2BS 4KBMB 3P8BB 4BDYA 3M4GA 4JRQA 3CC7T 3GNFB 2LRQA 4OF1A 3CPWS 3CMAT 3ZBDA 4XU1A 4ZGDB 3O8VA 1S72A 5GAN5 2DIQA 3JCMc 3VU3C 4HT8A 3M58A 3BFMA 4OMFB 3E1SA 5FU7B 5GAN7 4IUQA 3HKSA 3QBYA 3OYDA 3FB9A 3JB9G 4V2SA 3VV0A 3EAEA 3GPLA 2LT4A 3M4YA 4E7LA 1YJNT 5GMKl 4E7JA 2XU8A 4YTLA 2RI5A 4RKUE 3LWIA 2FYKA 2ZPEB 2RHXA 1VQKA 1QVFA 1VQ6T 4M7AA 3CCST 2MWPA 5GAN3 4L59A 3FDRA 3MEWA 3RMQA 4HCCA 4OB3B 1K73U 2VXEA 5GMKh 2QQ9A 1K8AC 1BI3A 4J83A 2XK0A 5FLXE 3I56A 2LC4A 1NPPA 2CZ1B 1VQ8A 3H8ZA 3RERA 4M7DA 2K5LA 1XNIA 1MGQA 2V8IA 3OBYA 1BI2A 1IZ6A 3JCMe 3LH0A 3AHUA 5KE2A 4RMOA 4HT9A 1G3YA 3OMCA 2IVWA 3SDZA 3V8JA 1Q86C 4FIBA 2GFUA 5LJ3d 2EAYA 3L42A 5FRNA 4PLLA 3VYGA 3M53A 2VUBA 4N4IA 4UC4A 3OYGA 1K73C 2OTLT 2A7YA 2K2VA 3PT9A 1QVGS 4XTUA 3CCQA 4OP0A 2LX9A 1VQ6A 4M7DE 1YJWT 2JTFA 5IN1A 3OW2S 4M7DF 2PVDB 1GXIE 3CMEA 4M7DD 1Q86U 1Q81U 4PJOF 3EFRA 4M78G 4RCCA 1EIFA 1G3WA 5A0LA 3CBPA 2LDMA 5GAOl 3L2QA 1VQMT 3UPUA 4FU6A 2DIGA 4QQ6A 1LJOA 1KQ1A 1LOJA 1PSEA 4C5IA 3KXTA 4M7AC 3M54A 3NTIA 4ME7A 4EPCA 5CCAA 4MZPA 4TVRA 4JJNK 4QVZA 4M78E 1YITA 3QPHA 3WXMB 1VQOT 1OI1A 1OZ3A 3VKIA 1ZQ1A 1S72T 4IKFA 3KBGA 3L2ZA 3OBWA 1I4K1 1I81A 1N9RA 2X4YA 5LJ3j 3LGLA 2GFAA 5CVIA 5GANe 2XICA 3OYBA 2ZPBB 4BE0A 5IAYA 1N8RU 2EJFA 1VQMA 4XU2A 2DO3A 3OMGA 4M78B 3QJYA 4BD3A 2XDDA 5LJ3g 3V7SA 3QYGB 1VQNA 1PSFA 2OAUA 1XQHA 2K57A 3C95A 3CCVT 2RK2A 1QP3A 2LCLA 3PMTA 3P8DA 3GF5A 5A0GA 2M16A 4JUVA 2VGMA 1G3SA 2KK4A 3PMIA 4HCZA 2PU9B 4L6V5 4PKCC 3L2RA 5DLQE 1K9MU 1VQ7A 5GANg 2EFIA 2FVUA 4VUBA 5DM7R 4RG2A 4EMKA 4FT4A 4MMKA 3MO8A 1N6AA 4M77F 5KE3A 5HY6A 2DVEA 3EFSA 4R55A 2MWOA 2XDBA 1VQNT 3QSUA 2R5AA 5LJ5f 1UEBA 3NFCA 4FM4B 4LD9K 3GIBA 3CC2T 3HFNA 3M57A 4RCBA 2RK1A 3ASKA 4C92F 5CIUA 3QYHB 3OS2A 1B34B 5CKDA 3CCQT 1KQSA 4M75C 1K9MC 1QP2A 1D3BB 1Y7XA 2L89A 5LJ5d 3CCET 3A8GB 2DK3A 2F5KA 3QXEB 3RUXA 2RI2A 3LGFA 2RHZA 4A4EA 1WNLA 4C5GA 5KCOA 2OTJA 3MHXA 2DXUA 2O4XB 1N9SA 1NZ9A 4M77D 4M75F 3BDLA 2QEXT 1LNXA 1UGQB 5AYFA 3TCJA 3BDUA 2X4JA 4BY6B 3G4ST 4N0AC 1U8RA 3URGA 1FX7A 1W4SA 3QHSA 4A53A 1VQPT 2JVVA 1VQLA 5CK9A 3OYYA 5GMKi 2VYTA 2RJCA 1KHCA 4J5YA 1K8AU 2CKKA 3QIIA 3QKJA 4PJOG 4QVCA 1MHNA 3M59A 3OB9A 3R6OA 2JOYA 3OA6A 4FL6A 3MCAB 3QZ9B 3HHTB 2EKOA 3UDCA 2V8KA 2CZ0B 2XIDA 4E7KA 4JS4A 4JLGA 2GCXA 4B9XA 4XQ3A 4HA8A 4X9CA 1M8VA 2P0QA 4CRIA 4QQGA 5FROA 5LJ5h 2RJFA 2RHIA 1UB4A 3J7AF 5D6WA 4A4KA 1M90C 1VQLT 5GAMh 1BKBA 2EYQA 2OTLA 4F7UB 3CCLT 3L1AA 5LJ3f 3FJPA 3RIRA 2LNVA 4C8QG 2ZPFB 1Q81C 4XU0A 3JB9H 3RESA 3OYEA 4IUUA 3L2VA 3E19A 4OVAA 4JRKA 3CMET 4M7AG 4C8QA 4M78C 5CQXA 4KULA 1M90U 3JCMW 2EWNA 3FRNA 3I55A 3M5AA 3G7ZA 2K4YA 1JRIA 5GAN6 2ZGWA 2L5QA 5GAOn 2RA2A 5HKCA 1VQ4A 4BDZA 2AHJB 2QQSA 3JSCA 2VC8A 3T9NA 4C92B 4D6WA 2HQXA 4M77C 3CC2A 2E41A 5GAN4 4M75G 4JRPA 3JAME 4ELYC 1KG1A 2DXTA 4M75E 4J6WA 3L2WA 2LCCA 5LJ3e 3S3MA 1DJ7B 1HXDA 2A3LA 1N8RC 1Y71A 2K5IA 2RHUA 4M75A 2QTXA 3MP8A 2PVGB 2BIVA 2DEQA 4OB1B 2FB7A 4QQDA 1WJQA 4MDXA 4LDYA 4MMLA 4C92G 3OYLA 4F7UA 3I55T 3CCRA 4PLIA 1NE8A 4J8OA 4C92E 3OYHA 1KQ2A 3PIPA 2QXFA 3JRZA 2YLBA 2O01E 2HAXA 2KVQG 4MZTA 3V7CA 3FEOA 3HRUA 3HPWA 2KY9A 3OY9A 4PJOA 2BKDN 4C0DC 1U1SA 1VQ5T 3FIFA 2DTHA 2H3JA 5D6YA 5KH6A 4M77A 1YJWA 2GQVA 1M1KC 2R57A 4J6YA 4OGEA 4A4GA 3PFSA 1HK9A 3L2UA 1XOVA 2P0PA 1QVPA 5CKHA 4XTXA 5D6XA 4BY6C 2JN0A 4DQ2A 5GANh 3CCSA 2QA4A 4ZTJA 2XG8D 2RM4A 2LTOA 1QVFS 4X34A 4KUIA 3OYIA 4QVDA 4C0GA 4A4FA 4XTZA 3HRTA 3OSSC 3RMSA 3CCLA 1VQOA 4N4GA 4DOWA 4LDVA 2Y90A 2RO0A 1X01A 5DLOA 2LT1A 3DB4A 1IREB 4ZGEB 5GANd 3JB9J 1YI2A 2EQUA 2PQWA 3ZEHA 3VJPA 1JJ2S 4NS5A 1JBMA 3CPFA 4F7UF 4M78F 1Q7YU 4GLKA 5DY9A 3SWNA 5I2MA 3META 3HSBA 1Y07A 3FLGA 4O6JA 5IT9E 5CAIA 4LDXA 1BI0A 1RI0A 3S3NA 1YIJA 2R58A 4ZTFA 5M9OA 4PL6A 5A2QE 2NLUA 5LJ5g 2BUDA 1YJ9A 4LD6A 2HBPA 2XHCA 1Q7YC 4BI3A 4ZN3A 1KD1C 4N0AA 5HK3A 1YI2T 1ZBXA 3A8LB 4J7IA 3MEAA 3WVEB 1VUBA 5I2SA 3OSVA 2X35A 3CBMA 3DLLA 4FSXA 3CCRT 3CXCS 4NOYA 4BB7A 3FC3A 2LQKA 4XTWA 2ZCFB 3SWNB 5LJ5j 2JZ2A 5GAOr 1JJ2A 3JB9D 3UWNA 4BE1A 1N27A 1O75A 5GAMj 3CD6T 3DKMA 3A5ZB 2QQRA 1VIFA 2KDSA 1KD1U 4ZN1A 4ATOA 3UT1A 4F7UG 3HRSA 5GAOp 1YJ9T 4WF2A 2HNIA 3LW5E 1NJIC 5GAOq 2HD0A 2E5QA 2QI2A 1RL2A 5CKFA 4EMHA 3MEUA 1BI1A 3CCUT 1Q82U 1NJIU 1KHIA 4M7DB 4R56A 4LDUA 3A8MB 3F70A 2DXCA 5HK0A 1VQ9A 2GF7A 2KQWA 5FU7C 1VQPA 3PIOA 4P5NA 2PVOB 2XKOC 3BW1A 2E12A 4IUVA 4X9DA 5EG2A 2IG0A 5GAMe 2CZ6B 2VGNA 3ER0A 5A0DA 3CXCA 2D6FA 3TEEA 4F7UE 4XAXB 2WSFE 1P92A 2L3RA 5J39A 3GNGA 1KQSS 2E1HA 2JTMA 4J7FA 3NTHA 3OYNA 5C0MA 1JB0E 3P8HA 1WQ7A 3OS5A 1VQKT 3G6EA 4IUPA 1D3BA 2E65A 2MF2A 2MMPA 5J26A 4E47A 4PJOB 2DJZA 2G3RA 3J81E 5CKEA 4BUGA 3PNWC 2EQKA 2EIFA 4M78D 3G71T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VKI A;  3FRN A;  3VJP A;  3TEE A; 
#chains in the Genus database with same CATH topology
 1YJN Q;  4AG1 C;  1FXX A;  1UGR B;  1ZA1 B;  2P4T A;  3A8H B;  1VA7 A;  2K3X A;  4C8Q F;  1V76 A;  3C4S A;  3QWY A;  3RR6 A;  2HDA A;  4M7A B;  4DBR A;  3GOX A;  2CP5 A;  4OMO A;  5GAN j;  2EGA A;  1QVG A;  2ATC B;  5GAM f;  1GFD A;  2DRK A;  3LWH A;  4KT0 E;  1WQW A;  3WVD B;  3G6E Q;  1R8O B;  2I0N A;  2FL7 A;  4OGC A;  2M51 A;  3JCM X;  2PUK B;  2RB6 A;  3QDF A;  2F5T X;  3X25 B;  4KUD K;  1ABO A;  4X1V A;  4QW2 A;  4M75 D;  3RKW A;  2DF6 A;  4Y28 E;  2QA4 T;  4XK8 E;  1S72 Q;  2BE7 D;  5GMK e;  1KQS P;  3E9F A;  4LE9 A;  3INZ A;  3SFM A;  2K5F A;  1JO8 A;  1WDX A;  4C0D B;  2F69 A;  4JDS A;  3H6Z A;  4XU3 A;  2EQJ A;  4JLI A;  1WJS A;  4E7S A;  4GY5 A;  1K0S A;  1YIJ T;  3LYI A;  1VQL Q;  2E70 A;  2DYB A;  3X26 B;  2DER A;  3CC2 Q;  2HCK A;  2WAC A;  3BY7 A;  1SSF A;  3EG9 A;  2YLC A;  1LPL A;  3CPW P;  3C12 A;  1I8F A;  3VRY A;  2C0O A;  3CCJ T;  3CCU Q;  2RHY A;  3SB2 A;  2KT8 A;  2QG9 B;  1VOM A;  4Q5W A;  8ATC B;  1Y96 A;  1KC8 U;  4PJO C;  4OB2 B;  1AWJ A;  2F2V A;  3PTA A;  1VQ9 T;  1WHL A;  3OYK A;  4EMG A;  3JCM P;  2JMA A;  5CKB A;  4PJO E;  2B8A A;  2YHT A;  3EG1 A;  1M1K R;  2CS7 A;  2X4X A;  2A37 A;  2KR3 A;  3C94 A;  4D8K A;  2A36 A;  3NTK A;  2LJ0 A;  1M9S A;  2EYY A;  3OS1 A;  1NJI R;  1MMN A;  3ZL7 C;  2RH2 A;  4J6X A;  3CC7 A;  3UA7 A;  1QLY A;  2QQB A;  2EKH A;  4B9W A;  2XI9 A;  2DZC A;  4C0F A;  1KIK A;  2DPP B;  2DKG A;  2GTJ A;  2HEQ A;  4AFQ C;  4C8Q E;  2RJE A;  3OYM A;  2JS2 A;  4E2F B;  2JUF A;  2WSE E;  4F14 A;  1V29 B;  4BDY A;  2LRQ A;  4XU1 A;  5KYX A;  1PNJ A;  3JCM c;  1PD1 A;  3BFM A;  3QBY A;  3FB9 A;  3JB9 G;  4V2S A;  2F2X A;  4E7L A;  2OJ2 A;  1YI2 Q;  2ZPE B;  2RHX A;  3CCE Q;  3CCS T;  1JQQ A;  4DBF A;  3RMQ A;  2JS0 A;  2QQ9 A;  1K8A C;  1C0M A;  2XK0 A;  5FLX E;  3I56 A;  1M3C A;  2MYS A;  2V8I A;  1MGQ A;  3OBY A;  1BI2 A;  3LH0 A;  1WI7 A;  5KE2 A;  3U23 A;  4J9H A;  3SDZ A;  5FRN A;  2EQI A;  3L42 A;  2VUB A;  4N4I A;  1WA7 A;  2OTL T;  1D1A A;  5IN1 A;  1K73 R;  4M7D F;  2PVD B;  1GXI E;  2EBP A;  4Z89 A;  4PJO F;  3H0I A;  5A0L A;  5GAO l;  3L2Q A;  2DIG A;  1LJO A;  2YXY A;  4WCI A;  3KXT A;  1QVF P;  3M54 A;  1QMC A;  3QPH A;  3WXM B;  1VQO T;  1OI1 A;  1S72 T;  4IKF A;  5KYU A;  1EZZ B;  5LJ3 j;  3I9Q A;  2GFA A;  5GAN e;  1RAB B;  3EH2 A;  1N8R U;  1QWF A;  2HSP A;  1VQM A;  2DO3 A;  1WXU A;  2XDD A;  1EFN A;  1PKS A;  1WXB A;  2FRY A;  2HL3 A;  2LCL A;  4DBH A;  3EGU A;  3P8D A;  2SEM A;  2ED1 A;  3PMI A;  2PU9 B;  1ZSG A;  3L2R A;  1I0C A;  5GJV B;  3PVL A;  2FVU A;  5IHK A;  2PNI A;  4FT4 A;  4F17 A;  1QCN A;  2ABL A;  1N6A A;  3PE0 A;  3QSU A;  5KYY B;  1KC8 R;  2KRM A;  3ASK A;  3CCQ T;  1B34 B;  5CKD A;  4JJC A;  2L89 A;  3CCE T;  2OTJ A;  1WNL A;  3MHX A;  1VQN Q;  2QEX T;  9ATC B;  3TCJ A;  3BDU A;  2X4J A;  1FX7 A;  1SKU B;  2QDL A;  1VQL A;  5CK9 A;  1RAC B;  4J5Y A;  1K8A U;  2CKK A;  4PJO G;  1CKA A;  3NGP A;  4QVC A;  1MHN A;  1KSW A;  3OA6 A;  4FL6 A;  2EKO A;  3UDC A;  1F1B B;  3MKD A;  4E7K A;  1YJ9 Q;  2GCX A;  4HVU A;  4X9C A;  1M8V A;  1TXQ A;  1R77 A;  4A4K A;  1VQL T;  5GAM h;  3CCL T;  5LJ3 f;  3H9N A;  2YRD A;  1IRX A;  3JB9 H;  2QAS A;  3RES A;  3OYE A;  4IUU A;  4OVA A;  4M7A G;  4C8Q A;  3JCM W;  3FRN A;  3I55 A;  2ZGW A;  1VQ4 A;  1U3O A;  1IO6 A;  2QQS A;  1FMK A;  1QKX A;  2VC8 A;  3JSC A;  4D6W A;  2JM8 A;  1YIJ Q;  2C0T A;  2FPE A;  3CC2 A;  2E41 A;  4M75 G;  4J6W A;  2KEA A;  1TU0 B;  2LCC A;  5IXF A;  3S3M A;  2A3L A;  1N8R C;  2RHU A;  2PVG B;  2DEQ A;  2LP5 A;  1OX8 A;  2CUB A;  4MDX A;  3OYL A;  2DX1 A;  3OYH A;  2M0Y A;  1OX9 A;  2YLB A;  2HAX A;  2KVQ G;  2RMO A;  3HRU A;  4PJO A;  1OOT A;  4CC2 A;  1BBZ A;  4C0D C;  1U1S A;  1VQ5 T;  2H3J A;  5D6Y A;  1YJW A;  1VQ7 Q;  3PFS A;  1HK9 A;  2P0P A;  4XTX A;  5D6X A;  5GAN h;  1K76 A;  4DQ2 A;  3CCS A;  1R0B G;  5FW9 A;  1AT1 B;  1QVF S;  2BZY A;  2D0N A;  4RTX A;  2ECZ A;  2OTL Q;  5EC7 A;  1RAD B;  3M0T A;  4N4G A;  2LT1 A;  5GAN d;  2NUT B;  2YRC A;  1U06 A;  4M78 F;  2YUO A;  1NEB A;  3FLG A;  5IT9 E;  1RI0 A;  3S3N A;  4ZTF A;  1VQ8 Q;  1UHC A;  5M9O A;  1ZX6 A;  2DL7 A;  5HK3 A;  1YI2 T;  4J9D A;  3A8L B;  5I2S A;  3MEA A;  3WVE B;  2V1R A;  2LQW A;  3CXC S;  3SWN B;  1WX6 A;  5LJ5 j;  1WIE A;  3UWN A;  1N27 A;  2D1X A;  2HNI A;  2NUP A;  4EMH A;  4M7D G;  3UA6 A;  1Q82 U;  2GF7 A;  2KQW A;  3KFV A;  1VQP A;  3PIO A;  1JEG A;  5GAM e;  3AT1 B;  2CZ6 B;  2VGN A;  3ER0 A;  4F7U E;  1OV3 A;  4AMC A;  2JTM A;  3OS5 A;  1RAH B;  5J26 A;  2DJZ A;  1HD3 A;  1XTD A;  2EIF A;  2E10 A;  2QEX A;  1MMA A;  3V8L A;  3NPF A;  1M2V B;  3A1P A;  4DOV A;  2P0K A;  4J9I A;  2KMT A;  4PK4 A;  5FU6 C;  2H3E B;  3X20 B;  2E5K A;  4JS5 A;  5GAN f;  3CD6 A;  3X24 B;  3M9Q A;  1RLQ C;  1WJR A;  4C8Q D;  5IH2 A;  1SG5 A;  1WGS A;  2P4R A;  3ZFJ A;  1MND A;  3JB9 I;  2KNB B;  1PG5 B;  3OYF A;  4PNO A;  2X3X D;  4M7D C;  2OTJ T;  1TTH B;  3VYH B;  2M1H A;  4EMK B;  1K1Z A;  3HL8 A;  3V8K A;  5C6S A;  1VQ5 A;  1N8R R;  2RJD A;  3CMA A;  2HSE B;  1ZUK A;  2HKQ B;  4C92 D;  2DXB A;  1YHQ T;  4A4H A;  2ROL A;  4M78 A;  4MZM A;  2G6F X;  1AD5 A;  2VB6 A;  5CR2 A;  2OTJ Q;  4Y91 A;  2FZC B;  1WPY A;  1NJI C;  3QDR B;  2QDY B;  4CI0 C;  4FW2 A;  2DTO A;  2LVM A;  4OMQ A;  4JJB A;  1KK7 A;  2KT1 A;  3KUF A;  4OML A;  2JNG A;  2K7A A;  4AG2 C;  1AHJ B;  2HL5 C;  1G83 A;  4M77 B;  4Z8A A;  2FEI A;  1YBY A;  1RAI B;  3QJ6 A;  2C06 A;  3G6E T;  4OB0 B;  4Z88 A;  4Y92 A;  3M56 A;  1W6X A;  4A54 A;  1AWO A;  5GJW B;  2I2L A;  4II1 A;  3TU4 K;  3REB B;  3CCS Q;  3HTR A;  1UGV A;  1VQK Q;  3GLX A;  2QYZ A;  1H3H A;  4IUR A;  2CP7 A;  1RAG B;  1YNZ A;  2CGH A;  5LJ3 h;  1BIA A;  2LMJ A;  3I56 T;  2RD1 A;  1ZHI A;  1VQ8 T;  2QQA A;  4XTV A;  1Q82 R;  2DD4 A;  2L0A A;  1Y57 A;  4WTO B;  4BAC A;  1ZBJ A;  3CCQ Q;  3CCV A;  4M7A E;  5GAM g;  4EMK C;  1RI9 A;  2L3S A;  2EYW A;  3DLM A;  2X4W A;  4CC7 A;  1I5O B;  4JZ4 A;  3M55 A;  5I21 A;  2DL8 A;  2KYM A;  3I56 Q;  2M0O A;  2DIL A;  1W2B S;  2KYB A;  4PFO A;  2RF0 A;  2IPO B;  4JRQ A;  2KRN A;  2RQV A;  2DIQ A;  2YT6 A;  1M2O A;  3M0Q A;  4OMF B;  4IUQ A;  3VV0 A;  3EAE A;  3M4Y A;  1R0C B;  4E7J A;  1RLP C;  1Y0M A;  2XU8 A;  4RKU E;  2FYK A;  4PJN A;  2AZS A;  4M7A A;  4HCC A;  3MEW A;  4OB3 B;  1E6H A;  1ZLM A;  4J83 A;  1NLO C;  1NPP A;  1VQ8 A;  3H8Z A;  3JCM e;  4HT9 A;  1G3Y A;  1Q86 C;  2GFU A;  2EAY A;  3VYG A;  3VRZ A;  1K73 C;  1WHM A;  2A7Y A;  2K2V A;  1QVG S;  1GL5 A;  4M7D E;  1VQ6 A;  1B07 A;  1YJW T;  3OW2 S;  1I1J A;  1AZG B;  2HZY A;  3UAT A;  1GBR A;  1UDL A;  4M7D D;  2D8H A;  1EIF A;  1I07 A;  3CBP A;  4PJJ A;  1UUE A;  3I55 Q;  2ENM A;  1KQ1 A;  4C5I A;  4EPC A;  2CP3 A;  4TVR A;  3I35 A;  4JJN K;  1YIT A;  3VKI A;  1FMW A;  1RUW A;  2X4Y A;  1Q81 R;  1Q7Y R;  5CVI A;  2LZ6 B;  1X27 A;  2XIC A;  5IHI A;  4M78 B;  1VQN A;  2K57 A;  1PM3 A;  3C95 A;  1QP3 A;  5A0G A;  2VGM A;  1UJY A;  2KE9 A;  4L6V 5;  4PKC C;  2DET A;  1K9M U;  1WHG A;  3CCM Q;  4EMK A;  4MMK A;  1TUG B;  3EG9 B;  3MO8 A;  5KE3 A;  2DVE A;  1OU9 A;  3EFS A;  4R55 A;  1VQN T;  4LD9 K;  1MNE A;  2EVR A;  3GIB A;  2QAZ A;  3EG2 A;  3EHR A;  1QP2 A;  1D3B B;  1Y7X A;  4GLM A;  2DK3 A;  3QXE B;  3OW2 P;  5KCO A;  2RHZ A;  1CSK A;  3I5S A;  1N9S A;  1NZ9 A;  5AYF A;  1U8R A;  1VQP T;  4A53 A;  1X2Q A;  2DEU A;  2MOX A;  3OYY A;  5GMK i;  2QGG A;  4KH0 B;  4IIO A;  1GCP A;  1YHQ Q;  1ZSZ C;  2JOY A;  3HHT B;  1UJ0 A;  4HA8 A;  2P0Q A;  4CRI A;  4QQG A;  1Z9Z A;  5LJ5 h;  1JXM A;  1UB4 A;  2FZG B;  1UTI A;  3EGD B;  2LNV A;  1OQK A;  4XU0 A;  4PFZ A;  1N5Z A;  3E19 A;  5CQX A;  2JM9 A;  1YJW Q;  1M90 U;  2SRC A;  1ARK A;  2K4Y A;  5GAN 6;  4PFP A;  1TSF A;  2ZAE A;  4M77 C;  2NYS A;  1SSH A;  3JAM E;  2ESW A;  1K8A R;  1DJ7 B;  2K5I A;  4LUD A;  4PJM A;  2QTX A;  3SHW A;  3MJX A;  3VS5 A;  3CC4 Q;  4KGZ B;  4PLI A;  1NE8 A;  4J8O A;  4C92 E;  1X2K A;  2A28 A;  1NEG A;  3V7C A;  3FEO A;  2KY9 A;  3OY9 A;  3EGD A;  2BKD N;  2GGR A;  2GQV A;  4J6Y A;  4A4G A;  2NWM A;  5CKH A;  4BY6 C;  4E7Z A;  2P84 A;  4IIM A;  4A4F A;  1G8X A;  3OSS C;  3CCL A;  4DOW A;  1SRM A;  4LDV A;  2Y90 A;  2RO0 A;  1X01 A;  5DLO A;  1WHH A;  2LNH B;  4ZGE B;  2BTT A;  3JB9 J;  1JBM A;  3CPF A;  1YFN A;  4FYX B;  5I2M A;  1WZO A;  2DA9 A;  2M02 A;  4PL6 A;  2NLU A;  2BUD A;  4J9C A;  4KGX B;  4LD6 A;  1Q7Y C;  2W10 A;  1KD1 C;  2FPD A;  3CMA Q;  4K11 A;  3CXC P;  1ACM B;  1VUB A;  4BB7 A;  1LVK A;  5GAO r;  3NHN A;  3JB9 D;  3CD6 T;  1BK2 A;  3A5Z B;  1VIF A;  2KDS A;  3UT1 A;  4J9E A;  2RPN A;  4QT7 A;  5KYY A;  4WF2 A;  3LW5 E;  5KYU B;  1YJ9 T;  5GAO q;  2QI2 A;  3MEU A;  1KHI A;  2CSI A;  1YIT Q;  5HK0 A;  2PVO B;  4X9D A;  2IG0 A;  2V1Q A;  3TEE A;  2JMC A;  1P92 A;  3H0H A;  3MPU B;  5C0M A;  2K79 A;  1WQ7 A;  3P8H A;  4IUP A;  1D3B A;  2E65 A;  4E47 A;  1UHF A;  3J81 E;  3CCU T;  5GAN 8;  1OZ2 A;  1V1C A;  1FWZ A;  2PZ1 A;  1B34 A;  3OYJ A;  1YCS B;  4O5V A;  1U1T A;  2Z0W A;  5CQY A;  3CCJ Q;  4M4Z A;  2E3H A;  3N5B B;  2LX7 A;  3PGG A;  3NMZ C;  3JCM J;  4C8Q B;  1VIE A;  2O88 A;  1C1A A;  1K4U S;  2OX7 A;  1MV3 A;  1YCY A;  2DTI A;  3REA B;  1M1G A;  3M0S A;  1AOJ A;  4BE2 A;  2MIO A;  3DB3 A;  2Y4Y A;  1M3B A;  3G4S Q;  1UGP B;  2KAF A;  1G5V A;  2O31 A;  1BU1 A;  4NL2 A;  1WFW A;  2VXF A;  2DM1 A;  3OYC A;  1WYX A;  4C5H A;  3S3O A;  3CBO A;  4C92 C;  2EYZ A;  4RTY A;  3LX7 A;  2HKN A;  3A8O B;  3ME9 A;  3RKX A;  5GMK m;  4XTY A;  4BI4 A;  2E3I A;  2CP0 A;  2RI3 A;  2WSC E;  2VV5 A;  2DBK A;  1YJN A;  3JCM V;  1Q82 C;  4ELZ C;  3S6W A;  4Z02 A;  1WHJ A;  1YIT T;  3M0U A;  1YWP A;  4L5G A;  1AWW A;  5AT1 B;  2QGF B;  1IHW A;  3CCE A;  2VWF A;  1YHQ A;  4JZ3 A;  2MPX C;  2OI3 A;  1BIB A;  4C8Q C;  2RQW A;  2D9T A;  1M8M A;  1M1F A;  1NPR A;  1X69 A;  3TRE A;  1SHF A;  3JCM h;  4LDW A;  4JJD A;  2Y4X A;  2O4X A;  2CUD A;  1QW1 A;  1XJW B;  2LQ8 A;  5GAO m;  4BI8 B;  3ULR B;  2HQE A;  1UG1 A;  1HYO A;  1H3Z A;  1YP5 A;  1Q86 R;  2CT3 A;  5GMK j;  3CCL Q;  1VQO Q;  2YUQ A;  1Y96 B;  2R5M A;  3OS0 A;  3CC4 A;  5J3B A;  3G71 A;  2DZ9 A;  1ZA2 B;  3HP9 A;  1E7O A;  1G2B A;  1T3L A;  4FSS A;  4QKU A;  3X28 B;  1KJW A;  1I5L A;  2DAQ A;  2PUO B;  1ABQ A;  2IIM A;  3CEY A;  4EDU A;  1M27 C;  4FT2 A;  2LCS A;  1MV0 B;  2CYZ B;  2ZPH B;  1M4Z A;  1QVG P;  4F04 B;  3CC7 T;  3GNF B;  1B3Q A;  4OF1 A;  3CPW S;  3ZBD A;  1U5S A;  1ZUU A;  3EG3 A;  4HT8 A;  2CDT A;  3E1S A;  1RAE B;  3OYD A;  1TG0 A;  2O2O A;  2LT4 A;  1YJN T;  2RI5 A;  3LWI A;  1VQK A;  5KYX B;  1VQ6 T;  2MWP A;  4ESR A;  1K73 U;  5GMK h;  1BI3 A;  2LC4 A;  2CZ1 B;  3RER A;  4M7D A;  1XNI A;  1GCQ A;  1M90 R;  3OMC A;  2DL5 A;  2IVW A;  4FIB A;  5LJ3 d;  4PLL A;  4UC4 A;  3OYG A;  4J9F A;  4J9B A;  4XTU A;  3CCQ A;  1PCX A;  4AFS C;  1VYU A;  3PVQ A;  2FRW A;  4RCC A;  3EFR A;  1G3W A;  2LDM A;  3UPU A;  4FU6 A;  4QQ6 A;  4M7A C;  1PSE A;  1NYF A;  1AEY A;  2EW3 A;  2DE0 X;  4A63 B;  1VQ9 Q;  1ZQ1 A;  3TVT A;  3KBG A;  1TWB A;  3OBW A;  1I4K 1;  1D0X A;  1PRM C;  1N9R A;  1NG2 A;  4BE0 A;  2L3Q A;  2EJF A;  4XU2 A;  3OMG A;  2X9H A;  2BZX A;  1GBQ A;  3QJY A;  4BD3 A;  5LJ3 g;  1QKW A;  3V7S A;  1S1N A;  2DMO A;  4ANJ A;  1PSF A;  2OAU A;  2COZ A;  1IHV A;  3CCV T;  3PMT A;  2K3B A;  1YWO A;  2FO0 A;  3GF5 A;  4JUV A;  2AK5 A;  5ECA A;  2KK4 A;  4HCZ A;  3A98 A;  3IQL A;  1BCM A;  5DLQ E;  1VQ7 A;  2V26 A;  5GAN g;  4VUB A;  5DM7 R;  6AT1 B;  2NUZ A;  4RG2 A;  2L2P A;  3C0C A;  5HY6 A;  1D0Y A;  4LN2 A;  5IXB A;  2MWO A;  2XDB A;  1A0N B;  5LJ5 f;  1UEB A;  4FM4 B;  3CC2 T;  5D7U A;  3HFN A;  3M57 A;  4C92 F;  1ZSZ B;  1E6G A;  3QYH B;  5CIU A;  4HCK A;  3OS2 A;  4M75 C;  1SEM A;  1VQ6 Q;  2K9G A;  2F5K A;  3RUX A;  2F2W A;  2RI2 A;  4A4E A;  4C5G A;  1H8K A;  2O4X B;  2FPF A;  2ED0 A;  1LNX A;  4DBQ A;  1WXT A;  2PTK A;  3G4S T;  4N0A C;  3URG A;  2JVV A;  1IB8 A;  2VYT A;  1KHC A;  2GBQ A;  3QKJ A;  2K6D A;  3UF4 A;  1CKB A;  2V8K A;  4JS4 A;  4JLG A;  1TUD A;  4RTT A;  4XQ3 A;  2O9S A;  5FRO A;  2RJF A;  1M90 C;  1BKB A;  2JW4 A;  4F7U B;  2JJ9 A;  4KGV B;  3FJP A;  3RIR A;  4C8Q G;  1SPK A;  1TOV A;  4B6M A;  4R0K A;  3L2V A;  3RNJ A;  3CME T;  2RN8 A;  4FW1 A;  4M78 C;  4FYY B;  1JRI A;  1FYN A;  5GAO n;  2L5Q A;  1KD1 R;  2RA2 A;  1M3A A;  4BDZ A;  2DLP A;  4C92 B;  2KXD A;  4EIK A;  4ELY C;  1KG1 A;  2BZ8 A;  5FWB A;  3L2W A;  1Y71 A;  2BIV A;  4OB1 B;  1GRI A;  1W1F A;  4QQD A;  1AWX A;  2YUN A;  4LDY A;  4MML A;  4C92 G;  3I55 T;  2W0Z A;  1KQ2 A;  3FJ5 A;  3VS3 A;  2QXF A;  2OAW A;  3M0R A;  2GNC A;  2O01 E;  3THK A;  1T0H A;  4MZT A;  3HPW A;  2JXB A;  3FIF A;  2DTH A;  1M1K C;  2GQI A;  2R57 A;  2DFU A;  1XOV A;  1QVP A;  2QA4 A;  2JN0 A;  1PRL C;  3TSW A;  1UE9 A;  1VYT A;  1BB9 A;  1PKT A;  4X34 A;  4KUI A;  3O5Z A;  3OYI A;  4QVD A;  4C0G A;  3RMS A;  1VQO A;  1AZE A;  1K9A A;  1T0J A;  2HMA A;  4RTV A;  1NBE B;  1ZUY A;  3ZEH A;  5KYW A;  4F7U F;  1Q7Y U;  5KYN A;  3VS6 A;  4GLK A;  4D8D A;  4HVW A;  3HSB A;  4O6J A;  5HCK A;  2B86 A;  5CAI A;  1YIJ A;  2LJ3 A;  1YJ9 A;  2XHC A;  4BI3 A;  1ZBX A;  2NUT A;  4J7I A;  1X6G A;  1J3T A;  3OSV A;  2X35 A;  4FSX A;  4NOY A;  3FC3 A;  2LQK A;  1JJ2 A;  2DL3 A;  2FG0 A;  1D1B A;  1O75 A;  3DKM A;  2QQR A;  4ZN1 A;  5GAO p;  2DNU A;  2E5Q A;  2HD0 A;  2LJ1 A;  3VS7 A;  4M7D B;  3F70 A;  1VQ9 A;  2YUP A;  3LH5 A;  3VS4 A;  4RTZ A;  2XKO C;  2E12 A;  2DL4 A;  5A0D A;  2D6F A;  4XAX B;  4FYW B;  5J39 A;  3GNG A;  1KQS S;  2E1H A;  2MK5 A;  3EH1 A;  3OYN A;  4J7F A;  3NTH A;  2RQU A;  1JB0 E;  1PHT A;  4OMP A;  2G3R A;  4PJL A;  5CKE A;  4BUG A;  4M78 D;  3G71 T;  3MEV A;  3VUB A;  4DA4 A;  2X3W D;  3RKY A;  4PJO D;  1VQ4 T;  2YRV A;  2E6Z A;  3JCM Q;  3EHQ A;  1AVZ C;  4DEY A;  1O9S A;  1YN8 A;  3SWN C;  4HKE A;  1M5Q 1;  2KSS A;  1W2B A;  2J6O A;  5GAM d;  3GP8 A;  2J7I A;  3D7S B;  1OPK A;  3CCM T;  5L8R E;  2XD0 A;  3QO3 A;  3E9G A;  2L3P A;  4KH1 B;  2DD5 A;  3OYA A;  3JCM d;  3Q1J A;  3EGX A;  2COY A;  5FRM A;  2K3Y A;  2CZ7 B;  2X51 A;  2E6N A;  2KRO A;  1NM7 A;  4E6R A;  4RG8 A;  4HXJ A;  1D09 B;  2JTE A;  2M9U A;  1RAA B;  3CCV Q;  5CO7 A;  2L8D A;  3OQ5 A;  3BE3 A;  3R6N A;  1RAF B;  1VQP Q;  1X6O A;  3VS0 A;  3RDV A;  2F1L A;  7AT1 B;  4E7H A;  5I22 A;  4ZGJ B;  4LUE A;  4FCY A;  5IHN A;  1X75 C;  2ZZD A;  2EJG A;  2D0Q B;  1OPL A;  2MAM A;  4M77 G;  1M30 A;  4ORZ A;  3QWX X;  1OEB A;  3JCM g;  4RTU A;  3SD4 A;  2QEX Q;  3EFO B;  2EGC A;  2C0I A;  2FHD A;  2MI6 A;  4DEX A;  2EJ9 A;  4M7A D;  3CCJ A;  1X43 A;  2EYX A;  1NYG A;  4E7I A;  2MCN A;  5GAN 2;  4C0Z A;  1QQJ A;  3V7R A;  4HCB A;  5LJ5 e;  2QK0 A;  3CD6 Q;  3TSZ A;  5KCH A;  2DYI A;  2ZPI B;  1JJ2 P;  1OYX A;  4NL3 A;  4MDW A;  3G71 Q;  2CP6 A;  2KI7 A;  4IUT A;  2DRM A;  3MP1 A;  3G4S A;  3QZ5 B;  4JRI A;  1H64 1;  3JCM b;  4M77 E;  5L23 A;  2VKN A;  2XDP A;  1BCO A;  2BE9 B;  2E64 A;  4M75 B;  3CC4 T;  2J6F A;  3MP6 A;  2ROT A;  1G3T A;  5I11 A;  3JB9 F;  5LL6 S;  1KC8 C;  2RQR A;  4C92 A;  1TH7 A;  3HFO A;  3EFO A;  2ZPG B;  5FU6 B;  3VUZ A;  3CPW A;  2V8J A;  1QWE A;  1SRL A;  1K0X A;  3QUI A;  3CCU A;  3OW2 A;  2J06 A;  3J80 E;  2AKK A;  2QTV A;  1BYM A;  1HSQ A;  2HQH A;  3JCM f;  4M7A F;  1UGS B;  1KFZ A;  3QG1 A;  2EQM A;  1ZSZ A;  1VQ7 T;  3LLR A;  1VQ5 Q;  2DBM A;  3G1J A;  4N4H A;  3CCM A;  3E2U A;  4C5E A;  1JU5 C;  4KBM B;  1M2V A;  3P8B B;  3M4G A;  1UFF A;  3CMA T;  4ZGD B;  3O8V A;  1S72 A;  5GAN 5;  3VU3 C;  3M58 A;  5FU7 B;  2EPD A;  5GAN 7;  3HKS A;  3GPL A;  2FZK B;  5GMK l;  2CRE A;  4YTL A;  1QVF A;  2J05 A;  5GAN 3;  4L59 A;  3FDR A;  1IGU A;  2VXE A;  1W70 A;  2K5L A;  5FWC A;  3AHU A;  1IZ6 A;  1EX4 A;  4HVV A;  4RMO A;  4JPB W;  3V8J A;  4OMN A;  3M53 A;  2KBT A;  3PT9 A;  3EGX B;  4OP0 A;  2LX9 A;  2JTF A;  2E4H A;  2CT4 A;  3CME A;  2YSQ A;  1Q86 U;  1VYV A;  1Q81 U;  2K2M A;  4M78 G;  2RNA A;  1OU8 A;  1PWT A;  1VQM T;  2COW A;  1LOJ A;  4LXC A;  1WHK A;  3VS2 A;  1PC0 A;  3NTI A;  2D8J A;  4ME7 A;  5CCA A;  4MZP A;  4QVZ A;  4M78 E;  1OZ3 A;  1PD0 A;  4KRT A;  3L2Z A;  2NUP B;  1I81 A;  3LGL A;  2RQT A;  1TS9 A;  3OYB A;  2ZPB B;  5IAY A;  1MMG A;  3RBB B;  3QYG B;  2KRS A;  4AFZ C;  2DVJ A;  1XQH A;  3H41 A;  3CME Q;  2RK2 A;  1TUC A;  1SHG A;  1MUZ A;  1H92 A;  2M16 A;  3H0F A;  1G3S A;  1IXD A;  2EFI A;  3SEM A;  1VQ4 Q;  2QA4 Q;  1SF9 A;  2CP2 A;  4M77 F;  3EG0 A;  1X6B A;  2AIR B;  2R5A A;  1GCQ C;  3NFC A;  5KYW B;  4RCB A;  2RK1 A;  1KQS A;  1K9M C;  5LJ5 d;  3A8G B;  4AT1 B;  3LGF A;  1GFC A;  1K9M R;  1QCO A;  2DXU A;  4M75 F;  4M77 D;  3BDL A;  1UGQ B;  4BY6 B;  1W4S A;  3QHS A;  2VAS A;  4FYV B;  3VS1 A;  2RJC A;  2AZV A;  3QII A;  3M59 A;  3OB9 A;  3R6O A;  3MCA B;  3QZ9 B;  2XID A;  2CZ0 B;  2J6K A;  4B9X A;  2O9V A;  2GTO A;  2RHI A;  3J7A F;  5D6W A;  2HBW A;  1D0Z A;  2EYQ A;  2OTL A;  2JT4 A;  3L1A A;  2ZPF B;  1Q81 C;  2CH4 A;  2H8H A;  4J9G A;  4JRK A;  4ZNX A;  4KUL A;  2EWN A;  2YWW A;  3M5A A;  3G7Z A;  5HKC A;  1FMV A;  2AHJ B;  3T9N A;  2YDL A;  2HQX A;  5GAN 4;  4JRP A;  1Q95 G;  2DXT A;  4M75 E;  5LJ3 e;  1HXD A;  1IGQ A;  1WLP B;  4M75 A;  3MP8 A;  2FB7 A;  4RUG A;  1WJQ A;  1QCF A;  4F16 A;  4F7U A;  1NLP C;  3CCR A;  2EGE A;  4GBQ A;  3PIP A;  1LCK A;  3JRZ A;  2CH4 W;  1D1C A;  5KH6 A;  4M77 A;  1B7T A;  4OGE A;  3L2U A;  1MMD A;  2AT1 B;  2VVK A;  3I5R A;  4ZTJ A;  2XG8 D;  2RM4 A;  2LTO A;  2A0F B;  4CC4 B;  2CSQ A;  4LNP A;  4XTZ A;  3HRT A;  3TQ7 P;  1UEC A;  3CCR Q;  2AKL A;  1C6V X;  3DB4 A;  1IRE B;  2A08 A;  1YI2 A;  2EQU A;  2PQW A;  1JJ2 S;  3VJP A;  3CC7 Q;  2KXC A;  2DJQ A;  4NS5 A;  5DY9 A;  3SWN A;  3MET A;  4AFU C;  1Y07 A;  4LDX A;  1BI0 A;  2R58 A;  5A2Q E;  3GBQ A;  5LJ5 g;  2HBP A;  4ZN3 A;  4N0A A;  4CC3 A;  3CCR T;  3CBM A;  3DLL A;  4XTW A;  2ZCF B;  1T3S A;  2JZ2 A;  1OUL A;  4BE1 A;  5GAM j;  1KD1 U;  4ATO A;  1JXO A;  4F7U G;  2LQN A;  3HRS A;  5CKF A;  1RL2 A;  8AT1 B;  1NJI U;  1BI1 A;  4RTW A;  4R56 A;  4LDU A;  3A8M B;  2DXC A;  1Z9Q A;  1W2B P;  5FU7 C;  4P5N A;  3BW1 A;  4IUV A;  5EG2 A;  3CQT A;  3CXC A;  2WSF E;  4OMM A;  2L3R A;  2XMF A;  3M0P A;  1VQM Q;  1VQK T;  3G6E A;  3JV3 A;  2MF2 A;  2MMP A;  4PJO B;  1HJD A;  2KGT A;  3PNW C;  2EQK A;  1M1K U; 
#chains in the Genus database with same CATH homology
 3MEV A;  5GAN 8;  2E10 A;  2QEX A;  3VUB A;  3V8L A;  1FXX A;  1OZ2 A;  3RKY A;  1UGR B;  2P4T A;  3A8H B;  4DA4 A;  1VQ4 T;  4PJO D;  2YRV A;  2E6Z A;  3JCM Q;  1FWZ A;  1B34 A;  2K3X A;  3OYJ A;  4DOV A;  2P0K A;  4O5V A;  1U1T A;  5CQY A;  3C4S A;  4C8Q F;  1O9S A;  4M7A B;  3SWN C;  3GOX A;  3N5B B;  1M5Q 1;  2KMT A;  2KSS A;  4HKE A;  1W2B A;  5FU6 C;  5GAM d;  3GP8 A;  3PGG A;  3X20 B;  5GAN j;  3JCM J;  4C8Q B;  1QVG A;  3CCM T;  5L8R E;  1VIE A;  3QO3 A;  3E9G A;  2XD0 A;  4JS5 A;  5GAM f;  2DD5 A;  3OYA A;  5GAN f;  3CD6 A;  3JCM d;  3X24 B;  3LWH A;  3Q1J A;  4KT0 E;  1WQW A;  3M9Q A;  1WJR A;  4C8Q D;  3WVD B;  1YCY A;  2DTI A;  5FRM A;  2K3Y A;  2CZ7 B;  2E6N A;  1WGS A;  3ZFJ A;  1M1G A;  1R8O B;  2FL7 A;  4BE2 A;  3DB3 A;  3JB9 I;  4RG8 A;  2Y4Y A;  4OGC A;  1UGP B;  2M9U A;  3JCM X;  3OYF A;  5CO7 A;  2PUK B;  4PNO A;  2RB6 A;  2L8D A;  2KAF A;  4M7D C;  2OTJ T;  3OQ5 A;  1G5V A;  3VYH B;  2F5T X;  2M1H A;  3X25 B;  4EMK B;  4KUD K;  3HL8 A;  4NL2 A;  2VXF A;  3OYC A;  1X6O A;  4QW2 A;  4M75 D;  3V8K A;  3RKW A;  5C6S A;  1VQ5 A;  4C5H A;  3S3O A;  2RJD A;  3CMA A;  3CBO A;  4C92 C;  4E7H A;  4ZGJ B;  4Y28 E;  2QA4 T;  1X75 C;  4XK8 E;  2ZZD A;  3LX7 A;  4C92 D;  3A8O B;  2DXB A;  3ME9 A;  2EJG A;  2D0Q B;  3RKX A;  3E9F A;  5GMK e;  4XTY A;  5GMK m;  1YHQ T;  4A4H A;  4BI4 A;  4MZM A;  4M78 A;  2MAM A;  3INZ A;  4M77 G;  3SFM A;  2RI3 A;  2K5F A;  2WSC E;  2VV5 A;  3JCM g;  5CR2 A;  4Y91 A;  3SD4 A;  1YJN A;  3JCM V;  1WPY A;  4C0D B;  4ELZ C;  2F69 A;  3QDR B;  4JDS A;  4Z02 A;  2QDY B;  3S6W A;  4CI0 C;  3H6Z A;  4XU3 A;  2EQJ A;  2FHD A;  2MI6 A;  4JLI A;  1YIT T;  1WJS A;  2EJ9 A;  4GY5 A;  4L5G A;  4M7A D;  1YIJ T;  3CCJ A;  3LYI A;  2E70 A;  3X26 B;  3CCE A;  2DTO A;  1YHQ A;  4E7I A;  2WAC A;  2LVM A;  4C0Z A;  5GAN 2;  3BY7 A;  1BIB A;  1SSF A;  4C8Q C;  3KUF A;  3V7R A;  2D9T A;  2YLC A;  4HCB A;  2JNG A;  5LJ5 e;  1M1F A;  1NPR A;  1AHJ B;  3TRE A;  5KCH A;  4M77 B;  3C12 A;  3JCM h;  1YBY A;  2ZPI B;  1I8F A;  1OYX A;  3QJ6 A;  4NL3 A;  2C06 A;  4LDW A;  4MDW A;  3G6E T;  3CCJ T;  4OB0 B;  2RHY A;  2Y4X A;  2O4X A;  4IUT A;  3MP1 A;  3SB2 A;  3G4S A;  1QW1 A;  3M56 A;  4A54 A;  2LQ8 A;  4Q5W A;  5GAO m;  1Y96 A;  3QZ5 B;  4JRI A;  4BI8 B;  1KC8 U;  1H64 1;  4PJO C;  4OB2 B;  3PTA A;  3JCM b;  1M1K U;  4M77 E;  1VQ9 T;  2I2L A;  3OYK A;  4II1 A;  2XDP A;  4M75 B;  4EMG A;  2HQE A;  2E64 A;  3TU4 K;  3JCM P;  5CKB A;  3CC4 T;  4PJO E;  2B8A A;  2YHT A;  3MP6 A;  1H3Z A;  3GLX A;  1G3T A;  2CS7 A;  2X4X A;  3JB9 F;  4IUR A;  5LL6 S;  1KC8 C;  5GMK j;  4C92 A;  2CGH A;  1XTD A;  1TH7 A;  5LJ3 h;  1BIA A;  3HFO A;  3C94 A;  3NTK A;  3I56 T;  2RD1 A;  1Y96 B;  1ZHI A;  1VQ8 T;  2QQA A;  2R5M A;  4XTV A;  2ZPG B;  1M9S A;  5FU6 B;  3VUZ A;  3CPW A;  3OS1 A;  2DD4 A;  3OS0 A;  2V8J A;  4BAC A;  2RH2 A;  3CC4 A;  5J3B A;  3QUI A;  4J6X A;  3G71 A;  3CC7 A;  3CCU A;  3OW2 A;  3J80 E;  2DZ9 A;  2QQB A;  3HP9 A;  1BYM A;  3CCV A;  4B9W A;  2XI9 A;  3JCM f;  4M7A E;  4M7A F;  5GAM g;  1UGS B;  2DZC A;  4C0F A;  4EMK C;  2DPP B;  3X28 B;  2DKG A;  4M7D G;  3QG1 A;  1I5L A;  2DAQ A;  2EQM A;  2PUO B;  4C8Q E;  1VQ7 T;  3DLM A;  3CEY A;  2X4W A;  2RJE A;  4EDU A;  4FT2 A;  3OYM A;  3LLR A;  3M55 A;  5I21 A;  2CYZ B;  2ZPH B;  2JUF A;  4N4H A;  1Q82 C;  3CCM A;  2WSE E;  1V29 B;  2M0O A;  4C5E A;  1M4Z A;  1W2B S;  4KBM B;  3P8B B;  4BDY A;  3M4G A;  4JRQ A;  3CC7 T;  3GNF B;  2LRQ A;  4OF1 A;  3CPW S;  3CMA T;  3ZBD A;  4XU1 A;  4ZGD B;  3O8V A;  1S72 A;  5GAN 5;  2DIQ A;  3JCM c;  3VU3 C;  4HT8 A;  3M58 A;  3BFM A;  4OMF B;  3E1S A;  5FU7 B;  5GAN 7;  4IUQ A;  3HKS A;  3QBY A;  3OYD A;  3FB9 A;  3JB9 G;  4V2S A;  3VV0 A;  3EAE A;  3GPL A;  2LT4 A;  3M4Y A;  4E7L A;  1YJN T;  5GMK l;  4E7J A;  2XU8 A;  4YTL A;  2RI5 A;  4RKU E;  3LWI A;  2FYK A;  2ZPE B;  2RHX A;  1VQK A;  1QVF A;  1VQ6 T;  4M7A A;  3CCS T;  2MWP A;  5GAN 3;  4L59 A;  3FDR A;  3MEW A;  3RMQ A;  4HCC A;  4OB3 B;  1K73 U;  2VXE A;  5GMK h;  2QQ9 A;  1K8A C;  1BI3 A;  4J83 A;  2XK0 A;  5FLX E;  3I56 A;  2LC4 A;  1NPP A;  2CZ1 B;  1VQ8 A;  3H8Z A;  3RER A;  4M7D A;  2K5L A;  1XNI A;  1MGQ A;  2V8I A;  3OBY A;  1BI2 A;  1IZ6 A;  3JCM e;  3LH0 A;  3AHU A;  5KE2 A;  4RMO A;  4HT9 A;  1G3Y A;  3OMC A;  2IVW A;  3SDZ A;  3V8J A;  1Q86 C;  4FIB A;  2GFU A;  5LJ3 d;  2EAY A;  3L42 A;  5FRN A;  4PLL A;  3VYG A;  3M53 A;  2VUB A;  4N4I A;  4UC4 A;  3OYG A;  1K73 C;  2OTL T;  2A7Y A;  2K2V A;  3PT9 A;  1QVG S;  4XTU A;  3CCQ A;  4OP0 A;  2LX9 A;  1VQ6 A;  4M7D E;  1YJW T;  2JTF A;  5IN1 A;  3OW2 S;  4M7D F;  2PVD B;  1GXI E;  3CME A;  4M7D D;  1Q86 U;  1Q81 U;  4PJO F;  3EFR A;  4M78 G;  4RCC A;  1EIF A;  1G3W A;  5A0L A;  3CBP A;  2LDM A;  5GAO l;  3L2Q A;  1VQM T;  3UPU A;  4FU6 A;  2DIG A;  4QQ6 A;  1LJO A;  1KQ1 A;  1LOJ A;  1PSE A;  4C5I A;  3KXT A;  4M7A C;  3M54 A;  3NTI A;  4ME7 A;  4EPC A;  5CCA A;  4MZP A;  4TVR A;  4JJN K;  4QVZ A;  4M78 E;  1YIT A;  3QPH A;  3WXM B;  1VQO T;  1OI1 A;  1OZ3 A;  3VKI A;  1ZQ1 A;  1S72 T;  4IKF A;  3KBG A;  3L2Z A;  3OBW A;  1I4K 1;  1I81 A;  1N9R A;  2X4Y A;  5LJ3 j;  3LGL A;  2GFA A;  5CVI A;  5GAN e;  2XIC A;  3OYB A;  2ZPB B;  4BE0 A;  5IAY A;  1N8R U;  2EJF A;  1VQM A;  4XU2 A;  2DO3 A;  3OMG A;  4M78 B;  3QJY A;  4BD3 A;  2XDD A;  5LJ3 g;  3V7S A;  3QYG B;  1VQN A;  1PSF A;  2OAU A;  1XQH A;  2K57 A;  3C95 A;  3CCV T;  2RK2 A;  1QP3 A;  2LCL A;  3PMT A;  3P8D A;  3GF5 A;  5A0G A;  2M16 A;  4JUV A;  2VGM A;  1G3S A;  2KK4 A;  3PMI A;  4HCZ A;  2PU9 B;  4L6V 5;  4PKC C;  3L2R A;  5DLQ E;  1K9M U;  1VQ7 A;  5GAN g;  2EFI A;  2FVU A;  4VUB A;  5DM7 R;  4RG2 A;  4EMK A;  4FT4 A;  4MMK A;  3MO8 A;  1N6A A;  4M77 F;  5KE3 A;  5HY6 A;  2DVE A;  3EFS A;  4R55 A;  2MWO A;  2XDB A;  1VQN T;  3QSU A;  2R5A A;  5LJ5 f;  1UEB A;  3NFC A;  4FM4 B;  4LD9 K;  3GIB A;  3CC2 T;  3HFN A;  3M57 A;  4RCB A;  2RK1 A;  3ASK A;  4C92 F;  5CIU A;  3QYH B;  3OS2 A;  1B34 B;  5CKD A;  3CCQ T;  1KQS A;  4M75 C;  1K9M C;  1QP2 A;  1D3B B;  1Y7X A;  2L89 A;  5LJ5 d;  3CCE T;  3A8G B;  2DK3 A;  2F5K A;  3QXE B;  3RUX A;  2RI2 A;  3LGF A;  2RHZ A;  4A4E A;  1WNL A;  4C5G A;  5KCO A;  2OTJ A;  3MHX A;  2DXU A;  2O4X B;  1N9S A;  1NZ9 A;  4M77 D;  4M75 F;  3BDL A;  2QEX T;  1LNX A;  1UGQ B;  5AYF A;  3TCJ A;  3BDU A;  2X4J A;  4BY6 B;  3G4S T;  4N0A C;  1U8R A;  3URG A;  1FX7 A;  1W4S A;  3QHS A;  4A53 A;  1VQP T;  2JVV A;  1VQL A;  5CK9 A;  3OYY A;  5GMK i;  2VYT A;  2RJC A;  1KHC A;  4J5Y A;  1K8A U;  2CKK A;  3QII A;  3QKJ A;  4PJO G;  4QVC A;  1MHN A;  3M59 A;  3OB9 A;  3R6O A;  2JOY A;  3OA6 A;  4FL6 A;  3MCA B;  3QZ9 B;  3HHT B;  2EKO A;  3UDC A;  2V8K A;  2CZ0 B;  2XID A;  4E7K A;  4JS4 A;  4JLG A;  2GCX A;  4B9X A;  4XQ3 A;  4HA8 A;  4X9C A;  1M8V A;  2P0Q A;  4CRI A;  4QQG A;  5FRO A;  5LJ5 h;  2RJF A;  2RHI A;  1UB4 A;  3J7A F;  5D6W A;  4A4K A;  1M90 C;  1VQL T;  5GAM h;  1BKB A;  2EYQ A;  2OTL A;  4F7U B;  3CCL T;  3L1A A;  5LJ3 f;  3FJP A;  3RIR A;  2LNV A;  4C8Q G;  2ZPF B;  1Q81 C;  4XU0 A;  3JB9 H;  3RES A;  3OYE A;  4IUU A;  3L2V A;  3E19 A;  4OVA A;  4JRK A;  3CME T;  4M7A G;  4C8Q A;  4M78 C;  5CQX A;  4KUL A;  1M90 U;  3JCM W;  2EWN A;  3FRN A;  3I55 A;  3M5A A;  3G7Z A;  2K4Y A;  1JRI A;  5GAN 6;  2ZGW A;  2L5Q A;  5GAO n;  2RA2 A;  5HKC A;  1VQ4 A;  4BDZ A;  2AHJ B;  2QQS A;  3JSC A;  2VC8 A;  3T9N A;  4C92 B;  4D6W A;  2HQX A;  4M77 C;  3CC2 A;  2E41 A;  5GAN 4;  4M75 G;  4JRP A;  3JAM E;  4ELY C;  1KG1 A;  2DXT A;  4M75 E;  4J6W A;  3L2W A;  2LCC A;  5LJ3 e;  3S3M A;  1DJ7 B;  1HXD A;  2A3L A;  1N8R C;  1Y71 A;  2K5I A;  2RHU A;  4M75 A;  2QTX A;  3MP8 A;  2PVG B;  2BIV A;  2DEQ A;  4OB1 B;  2FB7 A;  4QQD A;  1WJQ A;  4MDX A;  4LDY A;  4MML A;  4C92 G;  3OYL A;  4F7U A;  3I55 T;  3CCR A;  4PLI A;  1NE8 A;  4J8O A;  4C92 E;  3OYH A;  1KQ2 A;  3PIP A;  2QXF A;  3JRZ A;  2YLB A;  2O01 E;  2HAX A;  2KVQ G;  4MZT A;  3V7C A;  3FEO A;  3HRU A;  3HPW A;  2KY9 A;  3OY9 A;  4PJO A;  2BKD N;  4C0D C;  1U1S A;  1VQ5 T;  3FIF A;  2DTH A;  2H3J A;  5D6Y A;  5KH6 A;  4M77 A;  1YJW A;  2GQV A;  1M1K C;  2R57 A;  4J6Y A;  4OGE A;  4A4G A;  3PFS A;  1HK9 A;  3L2U A;  1XOV A;  2P0P A;  1QVP A;  5CKH A;  4XTX A;  5D6X A;  4BY6 C;  2JN0 A;  4DQ2 A;  5GAN h;  3CCS A;  2QA4 A;  4ZTJ A;  2XG8 D;  2RM4 A;  2LTO A;  1QVF S;  4X34 A;  4KUI A;  3OYI A;  4QVD A;  4C0G A;  4A4F A;  4XTZ A;  3HRT A;  3OSS C;  3RMS A;  3CCL A;  1VQO A;  4N4G A;  4DOW A;  4LDV A;  2Y90 A;  2RO0 A;  1X01 A;  5DLO A;  2LT1 A;  3DB4 A;  1IRE B;  4ZGE B;  5GAN d;  3JB9 J;  1YI2 A;  2EQU A;  2PQW A;  3ZEH A;  3VJP A;  1JJ2 S;  4NS5 A;  1JBM A;  3CPF A;  4F7U F;  4M78 F;  1Q7Y U;  4GLK A;  5DY9 A;  3SWN A;  5I2M A;  3MET A;  3HSB A;  1Y07 A;  3FLG A;  4O6J A;  5IT9 E;  5CAI A;  4LDX A;  1BI0 A;  1RI0 A;  3S3N A;  1YIJ A;  2R58 A;  4ZTF A;  5M9O A;  4PL6 A;  5A2Q E;  2NLU A;  5LJ5 g;  2BUD A;  1YJ9 A;  4LD6 A;  2HBP A;  2XHC A;  1Q7Y C;  4BI3 A;  4ZN3 A;  1KD1 C;  4N0A A;  5HK3 A;  1YI2 T;  1ZBX A;  3A8L B;  4J7I A;  3MEA A;  3WVE B;  1VUB A;  5I2S A;  3OSV A;  2X35 A;  3CBM A;  3DLL A;  4FSX A;  3CCR T;  3CXC S;  4NOY A;  4BB7 A;  3FC3 A;  2LQK A;  4XTW A;  2ZCF B;  3SWN B;  5LJ5 j;  2JZ2 A;  5GAO r;  1JJ2 A;  3JB9 D;  3UWN A;  4BE1 A;  1N27 A;  1O75 A;  5GAM j;  3CD6 T;  3DKM A;  3A5Z B;  2QQR A;  1VIF A;  2KDS A;  1KD1 U;  4ZN1 A;  4ATO A;  3UT1 A;  4F7U G;  3HRS A;  5GAO p;  1YJ9 T;  4WF2 A;  2HNI A;  3LW5 E;  1NJI C;  5GAO q;  2HD0 A;  2E5Q A;  2QI2 A;  1RL2 A;  5CKF A;  4EMH A;  3MEU A;  1BI1 A;  3CCU T;  1Q82 U;  1NJI U;  1KHI A;  4M7D B;  4R56 A;  4LDU A;  3A8M B;  3F70 A;  2DXC A;  5HK0 A;  1VQ9 A;  2GF7 A;  2KQW A;  5FU7 C;  1VQP A;  3PIO A;  4P5N A;  2PVO B;  2XKO C;  3BW1 A;  2E12 A;  4IUV A;  4X9D A;  5EG2 A;  2IG0 A;  5GAM e;  2CZ6 B;  2VGN A;  3ER0 A;  5A0D A;  3CXC A;  2D6F A;  3TEE A;  4F7U E;  4XAX B;  2WSF E;  1P92 A;  2L3R A;  5J39 A;  3GNG A;  1KQS S;  2E1H A;  2JTM A;  4J7F A;  3NTH A;  3OYN A;  5C0M A;  1JB0 E;  3P8H A;  1WQ7 A;  3OS5 A;  1VQK T;  3G6E A;  4IUP A;  1D3B A;  2E65 A;  2MF2 A;  2MMP A;  5J26 A;  4E47 A;  4PJO B;  2DJZ A;  2G3R A;  3J81 E;  5CKE A;  4BUG A;  3PNW C;  2EQK A;  2EIF A;  4M78 D;  3G71 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...