3VJPA

Orthorhombic crystal structure of salmonella flga in closed form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
198
structure length
198
Chain Sequence
QDINAQLTTWFSQRLAGFSDEVVVTLRSSPNLLPSCEQPAFSMTGSAKLWGNVNVVARCANEKRYLQVNVQATGNYVAVAAPIARGGKLTPANVTLKRGRLDQLPPRTVLDIRQIQDAVSLRDLAPGQPVQLTMIRQAWRVKAGQRVQVIANGEGFSVNAEGQAMNNAAVAQNARVRMTSGQIVSGTVDSDGNILINL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Flagella basal body P-ring formation protein flgA
publication title Structural flexibility of the periplasmic protein, FlgA, regulates flagellar P-ring assembly in Salmonella enterica
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 36
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08666 SAF SAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.760 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vjpA02
3FRNA 3VJPA 3TEEA 3VKIA
chains in the Genus database with same CATH superfamily
2KY9A 2LQKA 1HXDA 6AT1B 1HYOA 5FU7C 2E10A 4ZN1A 2RD1A 3RNJA 1BBZA 3NFCA 1ZBJA 5FU7B 1UJYA 3UT1A 4IUVA 3EGDA 2OTLA 2L3SA 4X9DA 2HSEB 4J9HA 3N5BB 1N8RR 1YHQA 4C8QA 1WHJA 3BE3A 2YXYA 1Y0MA 2LMJA 1G2BA 1X01A 1D09B 2J6KA 3JB9I 4ANJA 2CZ0B 3H41A 1O75A 2J7IA 3UDCA 3GBQA 1M27C 4KULA 2JTMA 1YI2T 3FEOA 4MMLA 3X20B 2HQHA 2NUTA 1U5SA 5GAN8 3OBWA 3QO3A 2SRCA 3CCVA 1I81A 1ACMB 2JUFA 3M5AA 2GQIA 2A36A 3OYNA 1YHQQ 1WHKA 2EW3A 3BDLA 2A7YA 4FL6A 2CKKA 1I5OB 1LJOA 2M0OA 3QG1A 1J3TA 4RKUE 2Z0WA 3S6WA 2DNUA 2JMCA 5KYWB 3CC4A 3DLMA 2CUDA 4OB1B 2X9HA 1I4K1 2HCKA 2ZPGB 4XTXA 1RAEB 1WDXA 2BKDN 1BCMA 1K9AA 3L1AA 3URGA 1G3SA 5A2QE 1OZ3A 2QTVA 5M9OA 2BE9B 2E3IA 3BDUA 2RMOA 3OW2A 1NPRA 5LJ5d 2GBQA 4JRIA 2VXEA 1D3BA 3M59A 1JQQA 3G6EQ 1AHJB 1IRXA 3HRSA 3PGGA 1M3CA 2I2LA 2Y4YA 1BYMA 3JCMh 5A0DA 2DD4A 1M3AA 1VQNA 3CC4Q 5GAN4 3HTRA 1JJ2A 3OB9A 5A0LA 3CCSA 3OYDA 2VYTA 4AFZC 4KH1B 5CVIA 2W0ZA 5FWBA 1NJIC 3CD6T 3JCMW 2LX7A 3EAEA 3SHWA 2EQJA 3T9NA 4FSSA 1BIAA 1QP3A 2VXFA 4VUBA 4M75E 3HRUA 2KE9A 1AOJA 1Q82C 1GFCA 3QXEB 4OMLA 2DERA 2ED0A 1K1ZA 2DILA 4KGVB 2RQVA 4BD3A 2NUPA 4LUEA 1TUCA 4HVUA 3QYHB 1UGPB 1K73R 4JPBW 3CCSQ 3G1JA 1X75C 4E7SA 3J80E 3VRZA 4F7UA 2LCSA 5KCOA 3RESA 2LJ0A 1XNIA 5LJ5g 4RTUA 1Y96A 3C12A 4JRPA 2GNCA 1M4ZA 2RF0A 2B8AA 3SEMA 3VS0A 1U1SA 2MPXC 3M0RA 3OS1A 2ZPHB 2YRDA 4XU0A 3I9QA 1SKUB 2VWFA 2FO0A 1QWFA 2K5LA 1VYUA 5CO7A 5KYXB 1XJWB 2FPDA 2QA4A 1VQ5A 3MCAB 4O6JA 3LX7A 1YCSB 3O8VA 2K79A 3OYLA 4N0AC 1KC8U 3C0CA 3J81E 1QVGS 9ATCB 3CPWP 4PK4A 1D1BA 4CRIA 3CBPA 4FT2A 2VGMA 3F70A 2WACA 3CMAA 4M7AG 2YDLA 4EMHA 2JTFA 4CC7A 2J05A 1MMDA 3A8GB 1H641 1OZ2A 1M1KC 1E7OA 4LDUA 1VQ5Q 2DTOA 5GMKm 2XDBA 1PSEA 2RO0A 2QI2A 4X34A 2AIRB 3OYBA 3I55A 2J6FA 4MZPA 3I5RA 3QSUA 1EFNA 2VUBA 2Y90A 1YITA 4C5IA 4LUDA 1M1FA 3VS4A 4JUVA 4F04B 3CCET 1VQOA 1N8RC 4NS5A 1UE9A 3PMIA 2KNBB 1VQ4T 1KJWA 2MAMA 3RMSA 4M7AC 4B6MA 2KBTA 4R56A 1R8OB 4Y92A 4HCKA 2KYBA 1S72T 3BY7A 4M7AB 5L8RE 3OSVA 2DTIA 2QGFB 2CZ6B 5FW9A 1WPYA 3I55Q 1PD1A 3PVQA 5GMKj 3I56A 2OTJA 3QZ5B 2KXCA 4C92B 1QVFP 1K8AR 3DLLA 1YITQ 4ELZC 1PCXA 1WQWA 1TWBA 1VQ8T 4OB0B 1VQOQ 3G4SQ 2EQIA 4E7LA 3JV3A 2OX7A 2X4XA 3OYCA 2AK5A 2M51A 1X43A 1S1NA 5KYUB 3H6ZA 1VIFA 1YJNA 4M7AF 1SSFA 5L23A 4M78B 3CCRT 1VQ6A 1YJWQ 4RCCA 2EPDA 5I11A 3ER0A 3I56Q 3NTIA 4R55A 1FMKA 1OV3A 2G6FX 3RKYA 4C92D 1MHNA 3LGLA 1ZQ1A 4QKUA 2YSQA 2GF7A 1YIJT 3VYGA 2RHXA 5FWCA 4L6V5 1JB0E 3QKJA 4E7KA 2BUDA 2ZPEB 1H92A 2RJCA 2JM8A 3R6NA 2E41A 1KD1R 1G3WA 1YJNQ 2DKGA 3ZFJA 3M0SA 1TUDA 3L2ZA 2RHUA 1PC0A 3CCRQ 2BZYA 3M57A 4M78D 1SEMA 4BE2A 5GANe 1ZUUA 1BI0A 1ZSZA 2QK0A 4RUGA 1OOTA 1VUBA 4FT4A 2HZYA 4C8QG 4DBQA 2F2XA 1WIEA 3SB2A 3JB9H 1GCPA 2EQMA 2MMPA 1TH7A 5LJ3d 4OMNA 2YRCA 3OYHA 4M7DE 1K73C 1VOMA 1TG0A 1M2VA 1K76A 3CCJQ 2K3XA 2XU8A 1M90C 2EJGA 4Y91A 5IHIA 3MP1A 4PLIA 4JDSA 3META 1KG1A 1OPKA 1XOVA 2XICA 4N4HA 2EGCA 3EGDB 1UGQB 5LJ3f 1I0CA 1TOVA 2B86A 1RI0A 5CAIA 4C8QC 2ROLA 2EYXA 5IXBA 1RAAB 5GMKh 1HK9A 2BTTA 4C8QB 5HY6A 4DQ2A 4BE1A 5FLXE 1W70A 3CXCP 1MMNA 4FIBA 1QCFA 4JRQA 4NL3A 4FCYA 4Z02A 4F17A 1KFZA 1QKWA 4M75A 1WXUA 4PJOG 1BIBA 2PTKA 2LCCA 2RJEA 1DJ7B 3FC3A 3P8BB 5I2SA 4JZ3A 2K6DA 4RTTA 2RH2A 4B9WA 2L3QA 3MO8A 2LVMA 2NUTB 5CK9A 2PUKB 3A1PA 4IIOA 1X6OA 1QVGA 1AVZC 2OAUA 3SFMA 5LJ3g 4JJNK 2LNVA 4FYWB 1B07A 4C8QF 2HBPA 4MDWA 4M4ZA 4J9GA 2E1HA 1PNJA 1KQ2A 3VS1A 4LDYA 1RL2A 2FYKA 2F2WA 2XIDA 4F16A 4UC4A 4PJOC 5IHNA 2LT1A 4BI3A 4DBRA 2KK4A 2X4WA 4NL2A 1TTHB 4PNOA 5LL6S 5DLOA 2AZSA 3E9GA 2DFUA 2KRSA 3LWIA 2YLBA 1ZHIA 1P92A 2O4XA 1WHGA 5GMKl 1KHIA 2DZCA 2YT6A 2HQXA 1Q81U 2EYYA 3GIBA 5CKEA 1BU1A 3CCQT 1NPPA 3M0TA 1VQKT 1D3BB 1VQMT 3JCMP 2JXBA 1QVPA 2QDLA 3CCMQ 1T0HA 2V1RA 2HKNA 1ABQA 3A5ZB 3QDFA 3A98A 1Z9ZA 2KROA 2FHDA 3ZL7C 2EFIA 2CH4W 3ASKA 1Y07A 3QBYA 1K8AC 2KMTA 4KUDK 4RTYA 4PJOF 2KQWA 2YUNA 2H3EB 3RR6A 4EMKC 2DL4A 4FYYB 4Z89A 2XMFA 3OW2P 3I5SA 4A63B 1RUWA 4ZN3A 3WVDB 2IPOB 4J5YA 3VYHB 4C0GA 3UATA 3LH5A 1R77A 4DEXA 1VQ7A 1WJSA 2FZGB 2ED1A 1NJIU 1JJ2P 8AT1B 3PTAA 2KT8A 4PFZA 3OMGA 2EKOA 2GGRA 2QEXA 3VS3A 4F7UB 1WI7A 1RLPC 2EJ9A 2OTLT 2ESWA 1Y96B 3RBBB 3L2WA 2E4HA 5KE2A 3CCLQ 4FW2A 1UECA 2YWWA 1BI3A 1YHQT 4KGZB 5D6XA 1VQLA 1NLPC 1QQJA 3QYGB 5GAOm 1F1BB 1KD1C 4OB3B 2E70A 3WVEB 1QKXA 3DKMA 2YUQA 4JS4A 3UA7A 1VQ7Q 3JCMe 2RJDA 1M8MA 2RJFA 3GNFB 1SRLA 3V7CA 1ZLMA 4ZGDB 3MEWA 4A54A 5KE3A 2KRNA 2O9SA 1OX9A 3EFOA 4F7UF 4ME7A 3G71A 2X4YA 1TS9A 2A28A 3SWNC 2OTLQ 1JU5C 2GTOA 4M77E 1HD3A 1U3OA 2EIFA 3CC2A 3KBGA 3SWNB 4LDVA 1K4US 4HKEA 2DPPB 2V8IA 3QHSA 2MWPA 3G6ET 2ROTA 3CPFA 2E6NA 3QWXX 1WX6A 2FEIA 2OAWA 1YI2A 3QIIA 3OYKA 3CC4T 3UPUA 1GL5A 4CC4B 2HAXA 2F5KA 3EH2A 3P8DA 2L5QA 1V29B 2M16A 3SDZA 4ZGJB 2RHIA 3LWHA 2JOYA 2XG8D 1YN8A 1K9MU 3CCVQ 4KGXB 4A4HA 1Q86U 3NPFA 1WHHA 4IIMA 3TSWA 7AT1B 1VYTA 1RADB 1XTDA 4BI4A 4J7FA 4QVCA 3HFOA 3JCMc 3OA6A 4ZNXA 1H3ZA 3UF4A 3JCMQ 1FWZA 2HNIA 2DXBA 5CKBA 5LJ3j 4BDYA 2ZPIB 4IURA 1UTIA 3CCST 5C0MA 1ZX6A 2E3HA 3NHNA 5LJ5f 1M9SA 1KC8R 4Y28E 4C0ZA 1W2BP 3VS2A 3HL8A 4AFSC 4DBHA 2RN8A 4M7DA 2EYQA 2FZCB 2P0PA 1QLYA 4IUQA 2HMAA 1RAIB 1YWPA 2JS0A 3FDRA 3AT1B 2CP0A 4WCIA 4J6WA 4HXJA 1Q7YU 5GAMd 3PMTA 1NM7A 2EYWA 3L2VA 4IUUA 4IUPA 3CD6A 1LCKA 4J6YA 2CS7A 2MYSA 1AZGB 4XU2A 2CP6A 1U8RA 1VQNQ 5FU6C 1WGSA 3DB3A 3RKXA 3NMZC 5FU6B 1OEBA 2LRQA 3C95A 3JB9D 3EG3A 5GAMf 1K0XA 2QGGA 4RTWA 4E7ZA 1GBQA 1IXDA 3PT9A 1TUGB 1X6GA 4PJMA 1I07A 1PKTA 5I2MA 2D0NA 1FXXA 1M3BA 4XTVA 2E6ZA 2V1QA 2CYZB 2DYBA 2QXFA 4AT1B 3C4SA 4XTUA 4RTZA 2C06A 5DLQE 1KSWA 3OBYA 3Q1JA 1VQ5T 1ZUYA 1IGUA 2YRVA 3TCJA 3OMCA 3JB9J 1N9RA 1KK7A 2MI6A 4WF2A 4JLIA 2FRYA 2KXDA 1WQ7A 5GAMg 4JJCA 3QWYA 5J39A 4BY6C 2A3LA 3LLRA 4DOVA 2L2PA 5CKDA 2KI7A 2PVGB 1M5Q1 3M55A 4N4IA 4C5GA 2F1LA 4BY6B 3VRYA 3M9QA 3LYIA 4DEYA 2AZVA 4JZ4A 4II1A 4IKFA 2D9TA 1UHCA 3CMEA 2CZ1B 2DIQA 3S3MA 1HSQA 2QA4Q 4ATOA 3V8JA 3EG9A 1PRMC 2DXCA 4C92G 1SHGA 3I55T 4C0FA 4F14A 2K57A 1M2VB 1UG1A 2CP2A 4M77D 2IIMA 2EYZA 3GOXA 4LD9K 4L59A 1ZSGA 1YITT 1EIFA 2F2VA 5DY9A 2O88A 2I0NA 3V8KA 4XQ3A 1NBEB 2HDAA 3HKSA 3VUBA 1VQOT 3G4ST 2K5IA 4X1VA 4CC3A 1SPKA 1UGRB 8ATCB 1IZ6A 5CKHA 2C0IA 3CMAQ 3JCMb 4M78G 4C5EA 1PG5B 1G8XA 3CMEQ 3X26B 3JCMd 1YJWT 2D8HA 1YBYA 3G7ZA 3A8OB 1M90U 3V7SA 3I56T 1SHFA 4C92C 5J3BA 4QQ6A 4M75B 2GQVA 2LJ1A 3UA6A 2VVKA 5GAOl 5GAOq 1B34A 2QQ9A 1VQ4A 2OI3A 2DBMA 5CQYA 3JCMX 1Q95G 2AHJB 1VIEA 2MCNA 2JS2A 4J9DA 5IT9E 1I1JA 3VKIA 4NOYA 3RMQA 2LP5A 2JTEA 4J9BA 1D0XA 1WXTA 2E64A 3R6OA 3KFVA 4M78C 5CCAA 1YJNT 1FMVA 4AMCA 4OMQA 2WSEE 3QDRB 2C0OA 1VQ6T 2FL7A 1PHTA 3MPUB 1VQ9A 1MGQA 4OGEA 4E2FB 2EJFA 1JRIA 2E5KA 2OTJQ 5IH2A 4AG2C 3FIFA 3TEEA 4C92F 1K0SA 5FRNA 1UDLA 1IHVA 3MEUA 1FYNA 4M75D 3MP8A 1XQHA 1IB8A 5GJWB 1GCQC 1PWTA 3JCMV 2K3YA 4GLMA 3MKDA 3OQ5A 3JCMg 5GAOr 2QQRA 2FRWA 4LXCA 2A08A 3KUFA 5GMKe 3GP8A 1AWOA 4XTYA 2H3JA 2RQUA 4XU1A 2K5FA 4M77A 1WZOA 4M78F 3CCJT 2JJ9A 2O9VA 4RCBA 2DL8A 1VQ9Q 1VQ6Q 2KT1A 1AZEA 2JNGA 2QQAA 1KC8C 3J7AF 2L3RA 1W4SA 2LCLA 4KRTA 1YIJA 2LT4A 4OMPA 2ZCFB 1I8FA 4PJOE 4QVDA 2E12A 4OGCA 5LJ5j 2LNHB 2LQNA 4XU3A 1G83A 1IO6A 1MMAA 1MMGA 5DM7R 2KDSA 3RIRA 4EMGA 2D0QB 1KQ1A 1KQSP 4PFPA 1Y7XA 3ZBDA 4N0AA 1RAHB 2QQSA 2AT1B 1GFDA 3RKWA 1D0YA 4A4KA 1AWJA 1KHCA 1CKAA 2DIGA 2JT4A 2DEUA 3EHRA 4OMOA 5IN1A 4J7IA 1Q81R 1AT1B 2L0AA 2MWOA 2YUPA 2M1HA 1UB4A 3EHQA 4XTWA 2F5TX 3L2RA 2DL7A 3VS7A 1VQPA 2R58A 2Y4XA 1TSFA 4J83A 1QCNA 5GAMj 4JJBA 4R0KA 3JSCA 3CCUA 3PVLA 2YUOA 1X2QA 4BI8B 4QQGA 2JMAA 1D1CA 2VB6A 1OYXA 2E65A 2RI2A 5CKFA 2PNIA 5AYFA 2DRKA 4RTVA 4HT8A 4M7AA 2RPNA 2P4RA 4MDXA 4BB7A 1MNEA 1QWEA 1BB9A 3WXMB 4LDWA 3REAB 4BUGA 2ZGWA 1Y71A 2CH4A 2DM1A 3CCMT 5GMKi 1NJIR 1NYFA 4PJJA 5CR2A 2EKHA 2NUZA 2G3RA 3CCUQ 4FYVB 5KYYA 3FRNA 3P8HA 5GAOp 3D7SB 3E1SA 1C0MA 1NEBA 4Q5WA 1OU9A 3JRZA 4BE0A 3BFMA 1SSHA 4JLGA 3VJPA 2F69A 3CC7A 5IHKA 1IGQA 4HCZA 5D6YA 4KUIA 1YJ9A 3TREA 1RAFB 5EC7A 1UFFA 3V8LA 1MV3A 3FJPA 4F7UG 2HBWA 2X3WD 4FM4B 5LJ5h 4J9IA 1O9SA 3VV0A 2O01E 2DBKA 4OMMA 3CCLT 1VQKA 1G3YA 1VQMA 1UEBA 3M0UA 2JZ2A 3M54A 4RG2A 4M7DB 1RABB 3CC7Q 3VU3C 2EVRA 2FG0A 2DVJA 2D6FA 3BW1A 2X51A 1YWOA 1YJ9Q 3EGXA 3FLGA 3SD4A 3QJ6A 3V7RA 1VQ7T 3RDVA 3PFSA 3TQ7P 2NUPB 2EQUA 4E7HA 1SRMA 1EX4A 4O5VA 1K9MR 4PFOA 3E2UA 4OVAA 2QEXT 1Q86R 2FB7A 2X3XD 2LZ6B 3LH0A 5GAMh 1BI2A 1RI9A 3MHXA 1C1AA 1WHMA 3C94A 2CT3A 3CEYA 1OI1A 2KGTA 1UJ0A 2PQWA 4X9CA 1T0JA 4B9XA 2JM9A 3M0QA 5I22A 1Q82U 1PKSA 4M7DD 1V76A 1ARKA 3EFRA 1W2BS 1QP2A 2XI9A 1PD0A 4KH0B 2CT4A 4LDXA 3RERA 1AWWA 2XHCA 1TU0B 4A4FA 1PRLC 2O31A 2CREA 2KYMA 2DX1A 4QT7A 4A4GA 4E7IA 3DB4A 5GANd 4XAXB 1YNZA 3REBB 2QAZA 3G71T 2GCXA 1LNXA 5KH6A 2QEXQ 1N9SA 1B7TA 2LX9A 2PU9B 2RQTA 2KEAA 3M4GA 4ESRA 3CCVT 1W1FA 1Q7YR 3CC2T 4GBQA 2EWNA 1T3LA 2KSSA 3H9NA 4J8OA 3H0HA 1JEGA 2FVUA 1VQLQ 5FROA 2OJ2A 2JVVA 5GANf 4ZGEB 2A37A 3JB9G 1X69A 1NG2A 4P5NA 3EG9B 4QQDA 1WFWA 4OP0A 2BZ8A 3G71Q 3CBOA 4MZTA 2ZPFB 2KVQG 1R0BG 4PJNA 3G6EA 1Q81C 3E9FA 2RI3A 3OS5A 3FB9A 2MF2A 4N4GA 3CC2Q 2LQ8A 1PM3A 5I21A 1E6GA 5ECAA 1UGVA 3MEAA 1A0NB 3NTHA 4C0DC 2HL3A 3M58A 2DLPA 2QDYB 3TSZA 4MZMA 1QCOA 1M1KU 3X24B 5GANg 4PJOA 4C0DB 3CPWS 1YI2Q 2NLUA 1VQNT 1HJDA 2DVEA 3EH1A 2XDDA 1JO8A 2HSPA 2PUOB 3OYAA 3EG2A 2COWA 2CP3A 4RG8A 2QQBA 3A8MB 5D6WA 1B34B 2RB6A 1N8RU 3X25B 3M0PA 2CUBA 3EFSA 3GNGA 1MUZA 4D8KA 2VGNA 4TVRA 3PE0A 1M2OA 3OYIA 4M77G 2DZ9A 3VS5A 5GJVB 2YHTA 4AFQC 5CIUA 5CQXA 2V26A 3H8ZA 4M7AE 2XDPA 2RHYA 2GFUA 2DJZA 2KRMA 4J6XA 2WSFE 3JB9F 4EMKA 4A53A 2COYA 2RI5A 2D1XA 4C92E 3H0IA 4J9EA 2C0TA 1NZ9A 4HCBA 2RM4A 1LVKA 1ABOA 2DMOA 5LJ3e 3AHUA 3M4YA 3ULRB 2W10A 2DL5A 3O5ZA 2IVWA 4QVZA 2QASA 1QVFS 3HFNA 1D0ZA 2ZZDA 1M90R 1JXMA 5GAN6 2X4JA 1OULA 1M30A 1ZBXA 2HD0A 4M77C 3CD6Q 3ME9A 2QA4T 2DF6A 1I5LA 4E6RA 5IAYA 4M78E 3A8LB 4M77B 2DYIA 2EBPA 3HRTA 1ZSZC 2P0QA 1AWXA 1NEGA 3QUIA 5IXFA 2M02A 1WXBA 2FPEA 1Z9QA 4GY5A 1AEYA 2RA2A 1UUEA 4D6WA 1ZSZB 3QZ9B 3NTKA 4CI0C 2AKKA 1M8VA 1FX7A 2IG0A 2P0KA 4CC2A 3CMAT 2RNAA 2BE7D 2XD0A 2WSCE 1UGSB 1H3HA 2D8JA 1TXQA 2AKLA 3CMET 2EQKA 2GTJA 3LGFA 3KXTA 1NYGA 3PIPA 4M75G 3INZA 4M77F 3SWNA 1K9MC 5KCHA 3EG0A 1W6XA 3MEVA 1Q86C 5AT1B 2CZ7B 1WLPB 3TU4K 2K2VA 1NLOC 1SG5A 2L8DA 5LJ3h 5KYWA 3EG1A 1X27A 1OQKA 4EPCA 2EGEA 3OS0A 2FPFA 4JRKA 5GAN3 2QYZA 1IHWA 2K9GA 2NWMA 1W2BA 2P4TA 4ORZA 1K73U 4A4EA 2VV5A 4GLKA 1WA7A 2ATCB 2RQWA 4M75C 2OTJT 1OPLA 3G4SA 2J6OA 2ZAEA 3CCEA 1KIKA 4OMFB 2YLCA 2GFAA 2XK0A 1Q7YC 1KQSS 3PIOA 2MOXA 2RQRA 1RAGB 3JCMf 3JAME 1PSFA 2K3BA 4ZTFA 1S72A 2ABLA 1YJWA 2VASA 3H0FA 3VUZA 4C8QE 3U23A 1YP5A 3L42A 5HCKA 5GAN7 5J26A 4AFUC 4BDZA 4LE9A 1VQ9T 1H8KA 5KYNA 5KYYB 2V8JA 1V1CA 5GANj 1VQ8A 4FSXA 4M75F 3CCEQ 2LC4A 4MMKA 4XK8E 5GAN5 1ZA2B 2O2OA 4WTOB 1R0CB 3CXCS 3CBMA 1BI1A 2DRMA 4D8DA 4LN2A 2KR3A 1VQ4Q 3QPHA 3M56A 3OYYA 2PZ1A 4XTZA 1C6VX 1S72Q 2V8KA 4HA8A 2SEMA 2O4XB 1QVGP 4M7AD 3CCRA 3OYGA 3MP6A 2JN0A 4AG1C 5GAN2 2MK5A 2DD5A 1YFNA 2LQWA 2VC8A 3ZEHA 3OY9A 4JJDA 1WYXA 2FZKB 3CPWA 4Z88A 4FW1A 3L2UA 1ZA1B 3GF5A 4PLLA 1VQ8Q 2R5AA 2HQEA 4IUTA 2ECZA 2PVOB 5KYXA 5A0GA 4V2SA 1BCOA 4BACA 1RLQC 2EGAA 3THKA 2RHZA 3CCJA 2DO3A 2M0YA 4LD6A 2A0FB 3OYFA 1WJRA 3EGXB 2DA9A 3S3OA 4Z8AA 5HK3A 2E5QA 3GPLA 4E7JA 4RMOA 1X6BA 1E6HA 3CQTA 1GRIA 2DETA 2PVDB 2HEQA 1K8AU 3UWNA 3HSBA 1YIJQ 1CKBA 1U1TA 4PJLA 2XKOC 2DL3A 2K4YA 4OF1A 2K7AA 2ZPBB 4KBMB 1D1AA 1VQPT 3OYJA 2LTOA 3S3NA 2CSIA 5C6SA 5EG2A 4J9CA 2R5MA 1QVFA 2P84A 4EIKA 3CCUT 4YTLA 3OW2S 4HT9A 4RTXA 4J9FA 1BKBA 1LOJA 3A8HB 5LJ5e 2BIVA 1CSKA 1QMCA 1SF9A 3M53A 4E47A 4F7UE 4HVWA 3I35A 3EFOB 3MJXA 2DXTA 4DBFA 2DJQA 1JJ2S 1WNLA 1LPLA 1UHFA 4HVVA 1OU8A 4FU6A 3NGPA 3LW5E 2K2MA 2COZA 1VQPQ 3GLXA 5GANh 4PKCC 1KD1U 4C92A 4ZTJA 4C5HA 2JW4A 5GAOn 2LDMA 2HKQB 1Y57A 2DE0X 1AD5A 2LJ3A 1U06A 2VKNA 1X2KA 2R57A 4M7DG 5KYUA 2CP7A 3E19A 4FYXB 3RUXA 5GAMe 3EGUA 4DA4A 1Q82R 5FRMA 2CGHA 2BZXA 1BK2A 1JBMA 1N5ZA 4C8QD 3CCMA 4M78A 1N27A 5HKCA 3IQLA 3CC7T 1VYVA 4EDUA 2DK3A 2NYSA 2QTXA 2RK1A 1YJ9T 1FMWA 1M1GA 1ZUKA 3HPWA 4HCCA 2CSQA 3VS6A 3L2QA 3X28B 2H8HA 4PJOB 1YCYA 2KAFA 2L3PA 1T3SA 2QG9B 2ENMA 3PNWC 3QJYA 1GCQA 2HL5C 4LNPA 1WHLA 1IREB 1VA7A 2RK2A 1B3QA 4K11A 1N6AA 2CP5A 4M7DC 3CCQA 3OYEA 1JXOA 3OSSC 1MV0B 1NE8A 5D7UA 5HK0A 1KQSA 3TVTA 1OX8A 4L5GA 2DTHA 4DOWA 2CDTA 2L89A 4KT0E 1WJQA 2X35A 3HP9A 1RACB 2DXUA 4JS5A 1EZZB 1MNDA 2MIOA 1G3TA 2EAYA 1G5VA 3CCLA 1GXIE 3OS2A 4PJOD 4PL6A 2DEQA 1QW1A 4OB2B 4EMKB 4ELYC 3OYMA 3FJ5A 3CCQQ 3JCMJ 3CXCA 1VQKQ 4QW2A 1VQMQ 2J06A 4M7DF 3HHTB 2DAQA 2M9UA 1GBRA 1VQLT 1M1KR
chains in the Genus database with same CATH topology
3H8ZA 5GAOl 4M7AE 2KY9A 2LQKA 5GMKh 2XDPA 1B34A 1HK9A 5GAOq 1HXDA 2QQ9A 2GFUA 2RHYA 2DJZA 4C8QB 5FU7C 5HY6A 4DQ2A 2E10A 5CQYA 4ZN1A 4J6XA 3JCMX 2WSFE 4BE1A 3JB9F 2RD1A 2AHJB 1VIEA 3NFCA 5FLXE 4EMKA 4A53A 4FIBA 5FU7B 4JRQA 4NL3A 3UT1A 2RI5A 4C92E 5IT9E 4IUVA 4NOYA 4Z02A 3RMQA 3VKIA 2OTLA 4X9DA 1NZ9A 4HCBA 2E64A 2RM4A 3R6OA 4M75A 4PJOG 1BIBA 4M78C 5CCAA 1YJNT 5LJ3e 2LCCA 2RJEA 1DJ7B 3M4YA 3N5BB 3FC3A 3AHUA 2WSEE 3P8BB 5I2SA 3QDRB 1YHQA 1VQ6T 4C8QA 2FL7A 2RH2A 2IVWA 4QVZA 4B9WA 1VQ9A 3MO8A 1QVFS 2LVMA 3HFNA 5CK9A 1MGQA 4OGEA 2PUKB 2EJFA 1JRIA 2ZZDA 5GAN6 2X4JA 1ZBXA 1X6OA 2HD0A 1QVGA 3FIFA 4M77C 3ME9A 3TEEA 2OAUA 3SFMA 4C92F 5LJ3g 2QA4T 1X01A 2LNVA 4JJNK 5IAYA 1VQ4A 1I5LA 5FRNA 3JB9I 3MEUA 4M78E 3A8LB 4M75D 4C8QF 2CZ0B 3MP8A 1O75A 1XQHA 4M77B 3UDCA 2HBPA 3HRTA 4KULA 4MDWA 2JTMA 1YI2T 2E1HA 3FEOA 4MMLA 3JCMV 1KQ2A 2P0QA 3QUIA 3X20B 2K3YA 4GY5A 4LDYA 1RL2A 2FYKA 3OQ5A 3OBWA 3JCMg 5GAN8 3QO3A 5GAOr 2QQRA 2RA2A 4D6WA 3CCVA 3JB9J 1I81A 3GP8A 3KUFA 5GMKe 3QZ9B 3NTKA 2JUFA 2XIDA 3M5AA 4XTYA 4UC4A 4CI0C 2H3JA 1M8VA 4PJOC 3OYNA 2LT1A 4BI3A 1FX7A 2IG0A 2P0KA 4XU1A 2KK4A 2K5FA 2X4WA 4M77A 4NL2A 4PNOA 4M78F 5LL6S 3CCJT 3BDLA 3CMAT 5DLOA 2A7YA 4FL6A 2CKKA 4RCBA 1LJOA 2JNGA 2QQAA 2M0OA 3QG1A 2XD0A 2WSCE 3E9GA 1KC8C 4RKUE 1UGSB 3J7AF 3LWIA 2L3RA 1W4SA 1P92A 1ZHIA 2LCLA 2O4XA 2YLBA 3S6WA 5GMKl 3CMET 1KHIA 2DZCA 2EQKA 1YIJA 2LT4A 3LGFA 3KXTA 3CC4A 3DLMA 3PIPA 2HQXA 4OB1B 4M75G 1Q81U 3GIBA 3INZA 1I4K1 4M77F 5CKEA 1NPPA 3SWNA 2ZCFB 1I8FA 3CCQT 1VQKT 4PJOE 4QVDA 1D3BB 1VQMT 2ZPGB 2E12A 4XTXA 3JCMP 1K9MC 4OGCA 1QVPA 5KCHA 3MEVA 2BKDN 1Q86C 5LJ5j 2CZ7B 4XU3A 3L1AA 3URGA 3A5ZB 1G3SA 5DM7R 5A2QE 1OZ3A 3TU4K 2KDSA 5M9OA 2K2VA 3BDUA 3OW2A 1NPRA 3RIRA 2L8DA 5LJ3h 5LJ5d 2FHDA 2EFIA 4JRIA 4EMGA 2D0QB 3ASKA 2VXEA 1Y07A 3QBYA 4EPCA 1K8AC 2KMTA 1KQ1A 4KUDK 1D3BA 4PJOF 3M59A 1Y7XA 3ZBDA 4JRKA 3OS0A 2KQWA 4N0AA 5GAN3 1AHJB 3PGGA 3HRSA 2QQSA 2I2LA 2Y4YA 4EMKC 1BYMA 1W2BA 2P4TA 3JCMh 3RKWA 5A0DA 1K73U 2DD4A 1VQNA 4A4EA 5GAN4 2VV5A 4GLKA 4A4KA 1JJ2A 1KHCA 3OB9A 2DIGA 5A0LA 5IN1A 3CCSA 3OYDA 4J7IA 4M75C 4ZN3A 2VYTA 3WVDB 4J5YA 3VYHB 2OTJT 5CVIA 3G4SA 2MWOA 4C0GA 1NJIC 3CD6T 2M1HA 3JCMW 3CCEA 1UB4A 4XTWA 3EAEA 2F5TX 4OMFB 1VQ7A 3L2RA 2EQJA 1VQPA 2R58A 2YLCA 3T9NA 2Y4XA 2GFAA 4J83A 2XK0A 1WJSA 5GAMj 1Q7YC 1NJIU 3PIOA 1KQSS 3PTAA 1BIAA 3OMGA 1QP3A 2VXFA 4VUBA 2EKOA 3JSCA 3JCMf 3JAME 1PSFA 2QEXA 4M75E 4ZTFA 1S72A 3HRUA 2EJ9A 4F7UB 1YJWA 2OTLT 3CCUA 1Y96B 1Q82C 3QXEB 3L2WA 3VUZA 4QQGA 4BI8B 4C8QE 5KE2A 3L42A 1YHQT 1BI3A 4BD3A 5GAN7 1OYXA 2E65A 2RI2A 5J26A 5CKFA 5D6XA 4BDZA 1VQLA 1VQ9T 3QYHB 1UGPB 5AYFA 3QYGB 4HT8A 5GAOm 1X75C 3J80E 4M7AA 2V8JA 1KD1C 4OB3B 2E70A 3WVEB 4F7UA 5KCOA 4FSXA 3RESA 5GANj 1VQ8A 1XNIA 3DKMA 4M75F 5LJ5g 2LC4A 4MMKA 4BB7A 4XK8E 1Y96A 4JS4A 5GAN5 3JCMe 2RJDA 3CXCS 3CBMA 1BI1A 3C12A 2RJFA 4JRPA 3GNFB 3V7CA 3WXMB 1M4ZA 3QPHA 4LDWA 4BUGA 2B8AA 2ZGWA 3MEWA 1Y71A 4A54A 4ZGDB 5KE3A 3M56A 3OYYA 3CCMT 5GMKi 1U1SA 5CR2A 4F7UF 4XTZA 4ME7A 3G71A 2V8KA 4HA8A 2O4XB 2G3RA 2X4YA 2ZPHB 3OS1A 3SWNC 3CCRA 4M7AD 4XU0A 3OYGA 3FRNA 2JN0A 3MP6A 5GAN2 3P8HA 4M77E 2EIFA 5GAOp 3E1SA 3CC2A 2DD5A 4Q5WA 2K5LA 3KBGA 5CO7A 3SWNB 2VC8A 4LDVA 3ZEHA 3OY9A 2QA4A 4HKEA 1VQ5A 3JRZA 2DPPB 4BE0A 2V8IA 3BFMA 3CPWA 3QHSA 2MWPA 3MCAB 3G6ET 3CPFA 2E6NA 4O6JA 3LX7A 3L2UA 4JLGA 3GF5A 4PLLA 2R5AA 3O8VA 3VJPA 3QIIA 3OYKA 2F69A 1YI2A 3CC4T 3CC7A 2HQEA 4IUTA 2PVOB 4HCZA 3UPUA 5D6YA 3OYLA 2F5KA 3P8DA 4N0AC 1KC8U 2HAXA 4KUIA 3J81E 1QVGS 5A0GA 2L5QA 1YJ9A 4V2SA 1V29B 2M16A 3SDZA 4ZGJB 3TREA 4CRIA 3CBPA 4BACA 4FT2A 2RHIA 2VGMA 3F70A 2WACA 2JOYA 2XG8D 3LWHA 2RHZA 3CCJA 3CMAA 4M7AG 2DO3A 4LD6A 3V8LA 3FJPA 4F7UG 1K9MU 4FM4B 4EMHA 2JTFA 5LJ5h 3OYFA 1WJRA 4A4HA 1Q86U 3A8GB 1O9SA 1H641 1OZ2A 3VV0A 5HK3A 3S3OA 2E5QA 2O01E 1XTDA 4LDUA 2DTOA 4J7FA 4BI4A 4QVCA 5GMKm 3GPLA 4E7JA 2XDBA 3HFOA 3JCMc 1PSEA 4RMOA 2RO0A 3OA6A 2QI2A 4X34A 3OYBA 1H3ZA 3CCLT 1VQKA 3JCMQ 1G3YA 3I55A 1VQMA 1FWZA 1UEBA 4MZPA 2JZ2A 3M54A 4RG2A 2HNIA 2DXBA 4M7DB 2PVDB 5CKBA 3QSUA 5LJ3j 1K8AU 4BDYA 3UWNA 3HSBA 1U1TA 2ZPIB 4IURA 2XKOC 2VUBA 3VU3C 2Y90A 5C0MA 3CCST 2K4YA 2D6FA 3BW1A 1YITA 4OF1A 4C5IA 1M1FA 5LJ5f 1M9SA 2ZPBB 4JUVA 3FLGA 3SD4A 4KBMB 3CCET 1VQOA 1N8RC 4NS5A 3QJ6A 3PMIA 3V7RA 1VQ7T 4Y28E 1VQPT 4C0ZA 3PFSA 3OYJA 3HL8A 1VQ4T 2LTOA 3S3NA 2MAMA 2EQUA 3RMSA 4M7DA 2EYQA 4M7AC 4E7HA 4R56A 2P0PA 5C6SA 1R8OB 4O5VA 5EG2A 2R5MA 4IUQA 1QVFA 4OVAA 2QEXT 1S72T 3BY7A 3FDRA 2FB7A 4M7AB 3LH0A 5GAMh 5L8RE 3CCUT 3OSVA 1BI2A 2DTIA 2CZ6B 4J6WA 4YTLA 3OW2S 3MHXA 1Q7YU 4HT9A 5GAMd 3PMTA 1BKBA 3C94A 1WPYA 3CEYA 5GMKj 3I56A 1LOJA 3A8HB 2OTJA 3L2VA 3QZ5B 1OI1A 4IUUA 4IUPA 1M1KC 3CD6A 5LJ5e 2BIVA 2CS7A 4J6YA 2PQWA 4C92B 4X9CA 4XU2A 4B9XA 1U8RA 3M53A 1Q82U 4M7DD 5FU6C 4E47A 1WGSA 4F7UE 3DLLA 3EFRA 4ELZC 1W2BS 3DB3A 3RKXA 1QP2A 1WQWA 2XI9A 2DXTA 1VQ8T 5FU6B 4OB0B 1JJ2S 1WNLA 4LDXA 2LRQA 3RERA 4E7LA 3C95A 2XHCA 4A4FA 4FU6A 3JB9D 5GAMf 2X4XA 3LW5E 3OYCA 3PT9A 3GLXA 5GANh 4PKCC 1KD1U 4A4GA 4E7IA 4C92A 3DB4A 3H6ZA 5I2MA 5GANd 4XAXB 1FXXA 1VIFA 1YJNA 4XTVA 3G71T 4M7AF 2E6ZA 2GCXA 2CYZB 1SSFA 1LNXA 4C5HA 4M78B 5KH6A 4ZTJA 1N9SA 3CCRT 5GAOn 1VQ6A 2LDMA 2LX9A 2QXFA 4RCCA 2PU9B 3CCVT 3M4GA 3C4SA 4XTUA 3CC2T 3ER0A 2C06A 5DLQE 3NTIA 3OBYA 2EWNA 2KSSA 3Q1JA 4J8OA 1VQ5T 4R55A 2FVUA 2R57A 4M7DG 5FROA 2YRVA 3TCJA 2JVVA 3E19A 3RKYA 3RUXA 4C92D 5GAMe 3OMCA 1MHNA 1N9RA 1ZQ1A 2CGHA 3LGLA 5GANf 4DA4A 1JBMA 4ZGEB 5FRMA 2MI6A 2GF7A 4JLIA 4WF2A 4M78A 1N27A 4C8QD 5HKCA 3CCMA 3CC7T 1YIJT 3VYGA 3JB9G 4EDUA 2RHXA 4MDXA 2DK3A 4L6V5 2QTXA 1JB0E 3QKJA 4E7KA 4P5NA 2RK1A 2BUDA 1YJ9T 1WQ7A 1M1GA 2ZPEB 2RJCA 5GAMg 3HPWA 4QQDA 5J39A 4BY6C 4HCCA 2E41A 2A3LA 1G3WA 3LLRA 4OP0A 4DOVA 2PVGB 5CKDA 1M5Q1 2DKGA 3M55A 4N4IA 3X28B 3ZFJA 4C5GA 3L2ZA 3CBOA 4BY6B 4MZTA 2ZPFB 4PJOB 1YCYA 2KAFA 2RHUA 3M9QA 2KVQG 3LYIA 3M57A 3G6EA 1Q81C 3E9FA 4M78D 2RI3A 4II1A 3OS5A 3FB9A 2MF2A 4N4GA 4BE2A 5GANe 4IKFA 3PNWC 2D9TA 3QJYA 2LQ8A 3CMEA 2CZ1B 2DIQA 5I21A 3S3MA 1BI0A 1IREB 4ATOA 2RK2A 1VUBA 1N6AA 3V8JA 4FT4A 2DXCA 4C92G 3MEAA 4M7DC 3NTHA 4C0DC 3I55T 3CCQA 3M58A 2QDYB 2K57A 4C0FA 3OYEA 4M77D 3OSSC 4MZMA 4C8QG 5HK0A 1NE8A 1M1KU 1KQSA 3X24B 3SB2A 5GANg 3GOXA 4C0DB 3CPWS 4LD9K 2NLUA 1VQNT 3JB9H 4L59A 4PJOA 4L5GA 1YITT 1EIFA 5DY9A 2DVEA 2DTHA 4DOWA 3V8KA 2L89A 2XDDA 4XQ3A 2EQMA 4KT0E 2PUOB 3HKSA 3VUBA 1WJQA 2MMPA 1TH7A 2X35A 3HP9A 3OYAA 3L2QA 3G4ST 1VQOT 5LJ3d 2DXUA 2K5IA 3OYHA 4RG8A 4JS5A 4M7DE 1UGRB 1IZ6A 1K73C 5CKHA 1G3TA 2EAYA 1G5VA 3JCMb 2QQBA 4M78G 2K3XA 3A8MB 5D6WA 4C5EA 3OS2A 3CCLA 1B34B 1GXIE 2RB6A 1N8RU 3X25B 2XU8A 4PJOD 1M90C 2EJGA 4PL6A 4Y91A 3MP1A 4PLIA 2DEQA 3EFSA 1QW1A 4JDSA 3GNGA 3X26B 3META 4OB2B 3JCMd 1KG1A 4EMKB 1YJWT 2VGNA 1YBYA 1XOVA 3G7ZA 4TVRA 4ELYC 3OYMA 2XICA 3A8OB 1M90U 4N4HA 3V7SA 3I56T 3JCMJ 4C92C 3CXCA 5LJ3f 1UGQB 4QW2A 3OYIA 4M77G 2DZ9A 5J3BA 4QQ6A 4M7DF 3HHTB 1RI0A 2YHTA 4M75B 4C8QC 5CAIA 2DAQA 2GQVA 2M9UA 5CIUA 1VQLT 5CQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FRN A;  3VJP A;  3TEE A;  3VKI A; 
#chains in the Genus database with same CATH topology
 2KY9 A;  2LQK A;  1HXD A;  6AT1 B;  1HYO A;  5FU7 C;  2E10 A;  4ZN1 A;  2RD1 A;  3RNJ A;  1BBZ A;  3NFC A;  1ZBJ A;  5FU7 B;  1UJY A;  3UT1 A;  4IUV A;  3EGD A;  2OTL A;  2L3S A;  4X9D A;  2HSE B;  4J9H A;  3N5B B;  1N8R R;  1YHQ A;  4C8Q A;  1WHJ A;  3BE3 A;  2YXY A;  1Y0M A;  2LMJ A;  1G2B A;  1X01 A;  1D09 B;  2J6K A;  3JB9 I;  4ANJ A;  2CZ0 B;  3H41 A;  1O75 A;  2J7I A;  3UDC A;  3GBQ A;  1M27 C;  4KUL A;  2JTM A;  1YI2 T;  3FEO A;  4MML A;  3X20 B;  2HQH A;  2NUT A;  1U5S A;  5GAN 8;  3OBW A;  3QO3 A;  2SRC A;  3CCV A;  1I81 A;  1ACM B;  2JUF A;  3M5A A;  2GQI A;  2A36 A;  3OYN A;  1YHQ Q;  1WHK A;  2EW3 A;  3BDL A;  2A7Y A;  4FL6 A;  2CKK A;  1I5O B;  1LJO A;  2M0O A;  3QG1 A;  1J3T A;  4RKU E;  2Z0W A;  3S6W A;  2DNU A;  2JMC A;  5KYW B;  3CC4 A;  3DLM A;  2CUD A;  4OB1 B;  2X9H A;  1I4K 1;  2HCK A;  2ZPG B;  4XTX A;  1RAE B;  1WDX A;  2BKD N;  1BCM A;  1K9A A;  3L1A A;  3URG A;  1G3S A;  5A2Q E;  1OZ3 A;  2QTV A;  5M9O A;  2BE9 B;  2E3I A;  3BDU A;  2RMO A;  3OW2 A;  1NPR A;  5LJ5 d;  2GBQ A;  4JRI A;  2VXE A;  1D3B A;  3M59 A;  1JQQ A;  3G6E Q;  1AHJ B;  1IRX A;  3HRS A;  3PGG A;  1M3C A;  2I2L A;  2Y4Y A;  1BYM A;  3JCM h;  5A0D A;  2DD4 A;  1M3A A;  1VQN A;  3CC4 Q;  5GAN 4;  3HTR A;  1JJ2 A;  3OB9 A;  5A0L A;  3CCS A;  3OYD A;  2VYT A;  4AFZ C;  4KH1 B;  5CVI A;  2W0Z A;  5FWB A;  1NJI C;  3CD6 T;  3JCM W;  2LX7 A;  3EAE A;  3SHW A;  2EQJ A;  3T9N A;  4FSS A;  1BIA A;  1QP3 A;  2VXF A;  4VUB A;  4M75 E;  3HRU A;  2KE9 A;  1AOJ A;  1Q82 C;  1GFC A;  3QXE B;  4OML A;  2DER A;  2ED0 A;  1K1Z A;  2DIL A;  4KGV B;  2RQV A;  4BD3 A;  2NUP A;  4LUE A;  1TUC A;  4HVU A;  3QYH B;  1UGP B;  1K73 R;  4JPB W;  3CCS Q;  3G1J A;  1X75 C;  4E7S A;  3J80 E;  3VRZ A;  4F7U A;  2LCS A;  5KCO A;  3RES A;  2LJ0 A;  1XNI A;  5LJ5 g;  4RTU A;  1Y96 A;  3C12 A;  4JRP A;  2GNC A;  1M4Z A;  2RF0 A;  2B8A A;  3SEM A;  3VS0 A;  1U1S A;  2MPX C;  3M0R A;  3OS1 A;  2ZPH B;  2YRD A;  4XU0 A;  3I9Q A;  1SKU B;  2VWF A;  2FO0 A;  1QWF A;  2K5L A;  1VYU A;  5CO7 A;  5KYX B;  1XJW B;  2FPD A;  2QA4 A;  1VQ5 A;  3MCA B;  4O6J A;  3LX7 A;  1YCS B;  3O8V A;  2K79 A;  3OYL A;  4N0A C;  1KC8 U;  3C0C A;  3J81 E;  1QVG S;  9ATC B;  3CPW P;  4PK4 A;  1D1B A;  4CRI A;  3CBP A;  4FT2 A;  2VGM A;  3F70 A;  2WAC A;  3CMA A;  4M7A G;  2YDL A;  4EMH A;  2JTF A;  4CC7 A;  2J05 A;  1MMD A;  3A8G B;  1H64 1;  1OZ2 A;  1M1K C;  1E7O A;  4LDU A;  1VQ5 Q;  2DTO A;  5GMK m;  2XDB A;  1PSE A;  2RO0 A;  2QI2 A;  4X34 A;  2AIR B;  3OYB A;  3I55 A;  2J6F A;  4MZP A;  3I5R A;  3QSU A;  1EFN A;  2VUB A;  2Y90 A;  1YIT A;  4C5I A;  4LUD A;  1M1F A;  3VS4 A;  4JUV A;  4F04 B;  3CCE T;  1VQO A;  1N8R C;  4NS5 A;  1UE9 A;  3PMI A;  2KNB B;  1VQ4 T;  1KJW A;  2MAM A;  3RMS A;  4M7A C;  4B6M A;  2KBT A;  4R56 A;  1R8O B;  4Y92 A;  4HCK A;  2KYB A;  1S72 T;  3BY7 A;  4M7A B;  5L8R E;  3OSV A;  2DTI A;  2QGF B;  2CZ6 B;  5FW9 A;  1WPY A;  3I55 Q;  1PD1 A;  3PVQ A;  5GMK j;  3I56 A;  2OTJ A;  3QZ5 B;  2KXC A;  4C92 B;  1QVF P;  1K8A R;  3DLL A;  1YIT Q;  4ELZ C;  1PCX A;  1WQW A;  1TWB A;  1VQ8 T;  4OB0 B;  1VQO Q;  3G4S Q;  2EQI A;  4E7L A;  3JV3 A;  2OX7 A;  2X4X A;  3OYC A;  2AK5 A;  2M51 A;  1X43 A;  1S1N A;  5KYU B;  3H6Z A;  1VIF A;  1YJN A;  4M7A F;  1SSF A;  5L23 A;  4M78 B;  3CCR T;  1VQ6 A;  1YJW Q;  4RCC A;  2EPD A;  5I11 A;  3ER0 A;  3I56 Q;  3NTI A;  4R55 A;  1FMK A;  1OV3 A;  2G6F X;  3RKY A;  4C92 D;  1MHN A;  3LGL A;  1ZQ1 A;  4QKU A;  2YSQ A;  2GF7 A;  1YIJ T;  3VYG A;  2RHX A;  5FWC A;  4L6V 5;  1JB0 E;  3QKJ A;  4E7K A;  2BUD A;  2ZPE B;  1H92 A;  2RJC A;  2JM8 A;  3R6N A;  2E41 A;  1KD1 R;  1G3W A;  1YJN Q;  2DKG A;  3ZFJ A;  3M0S A;  1TUD A;  3L2Z A;  2RHU A;  1PC0 A;  3CCR Q;  2BZY A;  3M57 A;  4M78 D;  1SEM A;  4BE2 A;  5GAN e;  1ZUU A;  1BI0 A;  1ZSZ A;  2QK0 A;  4RUG A;  1OOT A;  1VUB A;  4FT4 A;  2HZY A;  4C8Q G;  4DBQ A;  2F2X A;  1WIE A;  3SB2 A;  3JB9 H;  1GCP A;  2EQM A;  2MMP A;  1TH7 A;  5LJ3 d;  4OMN A;  2YRC A;  3OYH A;  4M7D E;  1K73 C;  1VOM A;  1TG0 A;  1M2V A;  1K76 A;  3CCJ Q;  2K3X A;  2XU8 A;  1M90 C;  2EJG A;  4Y91 A;  5IHI A;  3MP1 A;  4PLI A;  4JDS A;  3MET A;  1KG1 A;  1OPK A;  1XOV A;  2XIC A;  4N4H A;  2EGC A;  3EGD B;  1UGQ B;  5LJ3 f;  1I0C A;  1TOV A;  2B86 A;  1RI0 A;  5CAI A;  4C8Q C;  2ROL A;  2EYX A;  5IXB A;  1RAA B;  5GMK h;  1HK9 A;  2BTT A;  4C8Q B;  5HY6 A;  4DQ2 A;  4BE1 A;  5FLX E;  1W70 A;  3CXC P;  1MMN A;  4FIB A;  1QCF A;  4JRQ A;  4NL3 A;  4FCY A;  4Z02 A;  4F17 A;  1KFZ A;  1QKW A;  4M75 A;  1WXU A;  4PJO G;  1BIB A;  2PTK A;  2LCC A;  2RJE A;  1DJ7 B;  3FC3 A;  3P8B B;  5I2S A;  4JZ3 A;  2K6D A;  4RTT A;  2RH2 A;  4B9W A;  2L3Q A;  3MO8 A;  2LVM A;  2NUT B;  5CK9 A;  2PUK B;  3A1P A;  4IIO A;  1X6O A;  1QVG A;  1AVZ C;  2OAU A;  3SFM A;  5LJ3 g;  4JJN K;  2LNV A;  4FYW B;  1B07 A;  4C8Q F;  2HBP A;  4MDW A;  4M4Z A;  4J9G A;  2E1H A;  1PNJ A;  1KQ2 A;  3VS1 A;  4LDY A;  1RL2 A;  2FYK A;  2F2W A;  2XID A;  4F16 A;  4UC4 A;  4PJO C;  5IHN A;  2LT1 A;  4BI3 A;  4DBR A;  2KK4 A;  2X4W A;  4NL2 A;  1TTH B;  4PNO A;  5LL6 S;  5DLO A;  2AZS A;  3E9G A;  2DFU A;  2KRS A;  3LWI A;  2YLB A;  1ZHI A;  1P92 A;  2O4X A;  1WHG A;  5GMK l;  1KHI A;  2DZC A;  2YT6 A;  2HQX A;  1Q81 U;  2EYY A;  3GIB A;  5CKE A;  1BU1 A;  3CCQ T;  1NPP A;  3M0T A;  1VQK T;  1D3B B;  1VQM T;  3JCM P;  2JXB A;  1QVP A;  2QDL A;  3CCM Q;  1T0H A;  2V1R A;  2HKN A;  1ABQ A;  3A5Z B;  3QDF A;  3A98 A;  1Z9Z A;  2KRO A;  2FHD A;  3ZL7 C;  2EFI A;  2CH4 W;  3ASK A;  1Y07 A;  3QBY A;  1K8A C;  2KMT A;  4KUD K;  4RTY A;  4PJO F;  2KQW A;  2YUN A;  2H3E B;  3RR6 A;  4EMK C;  2DL4 A;  4FYY B;  4Z89 A;  2XMF A;  3OW2 P;  3I5S A;  4A63 B;  1RUW A;  4ZN3 A;  3WVD B;  2IPO B;  4J5Y A;  3VYH B;  4C0G A;  3UAT A;  3LH5 A;  1R77 A;  4DEX A;  1VQ7 A;  1WJS A;  2FZG B;  2ED1 A;  1NJI U;  1JJ2 P;  8AT1 B;  3PTA A;  2KT8 A;  4PFZ A;  3OMG A;  2EKO A;  2GGR A;  2QEX A;  3VS3 A;  4F7U B;  1WI7 A;  1RLP C;  2EJ9 A;  2OTL T;  2ESW A;  1Y96 B;  3RBB B;  3L2W A;  2E4H A;  5KE2 A;  3CCL Q;  4FW2 A;  1UEC A;  2YWW A;  1BI3 A;  1YHQ T;  4KGZ B;  5D6X A;  1VQL A;  1NLP C;  1QQJ A;  3QYG B;  5GAO m;  1F1B B;  1KD1 C;  4OB3 B;  2E70 A;  3WVE B;  1QKX A;  3DKM A;  2YUQ A;  4JS4 A;  3UA7 A;  1VQ7 Q;  3JCM e;  2RJD A;  1M8M A;  2RJF A;  3GNF B;  1SRL A;  3V7C A;  1ZLM A;  4ZGD B;  3MEW A;  4A54 A;  5KE3 A;  2KRN A;  2O9S A;  1OX9 A;  3EFO A;  4F7U F;  4ME7 A;  3G71 A;  2X4Y A;  1TS9 A;  2A28 A;  3SWN C;  2OTL Q;  1JU5 C;  2GTO A;  4M77 E;  1HD3 A;  1U3O A;  2EIF A;  3CC2 A;  3KBG A;  3SWN B;  4LDV A;  1K4U S;  4HKE A;  2DPP B;  2V8I A;  3QHS A;  2MWP A;  3G6E T;  2ROT A;  3CPF A;  2E6N A;  3QWX X;  1WX6 A;  2FEI A;  2OAW A;  1YI2 A;  3QII A;  3OYK A;  3CC4 T;  3UPU A;  1GL5 A;  4CC4 B;  2HAX A;  2F5K A;  3EH2 A;  3P8D A;  2L5Q A;  1V29 B;  2M16 A;  3SDZ A;  4ZGJ B;  2RHI A;  3LWH A;  2JOY A;  2XG8 D;  1YN8 A;  1K9M U;  3CCV Q;  4KGX B;  4A4H A;  1Q86 U;  3NPF A;  1WHH A;  4IIM A;  3TSW A;  7AT1 B;  1VYT A;  1RAD B;  1XTD A;  4BI4 A;  4J7F A;  4QVC A;  3HFO A;  3JCM c;  3OA6 A;  4ZNX A;  1H3Z A;  3UF4 A;  3JCM Q;  1FWZ A;  2HNI A;  2DXB A;  5CKB A;  5LJ3 j;  4BDY A;  2ZPI B;  4IUR A;  1UTI A;  3CCS T;  5C0M A;  1ZX6 A;  2E3H A;  3NHN A;  5LJ5 f;  1M9S A;  1KC8 R;  4Y28 E;  4C0Z A;  1W2B P;  3VS2 A;  3HL8 A;  4AFS C;  4DBH A;  2RN8 A;  4M7D A;  2EYQ A;  2FZC B;  2P0P A;  1QLY A;  4IUQ A;  2HMA A;  1RAI B;  1YWP A;  2JS0 A;  3FDR A;  3AT1 B;  2CP0 A;  4WCI A;  4J6W A;  4HXJ A;  1Q7Y U;  5GAM d;  3PMT A;  1NM7 A;  2EYW A;  3L2V A;  4IUU A;  4IUP A;  3CD6 A;  1LCK A;  4J6Y A;  2CS7 A;  2MYS A;  1AZG B;  4XU2 A;  2CP6 A;  1U8R A;  1VQN Q;  5FU6 C;  1WGS A;  3DB3 A;  3RKX A;  3NMZ C;  5FU6 B;  1OEB A;  2LRQ A;  3C95 A;  3JB9 D;  3EG3 A;  5GAM f;  1K0X A;  2QGG A;  4RTW A;  4E7Z A;  1GBQ A;  1IXD A;  3PT9 A;  1TUG B;  1X6G A;  4PJM A;  1I07 A;  1PKT A;  5I2M A;  2D0N A;  1FXX A;  1M3B A;  4XTV A;  2E6Z A;  2V1Q A;  2CYZ B;  2DYB A;  2QXF A;  4AT1 B;  3C4S A;  4XTU A;  4RTZ A;  2C06 A;  5DLQ E;  1KSW A;  3OBY A;  3Q1J A;  1VQ5 T;  1ZUY A;  1IGU A;  2YRV A;  3TCJ A;  3OMC A;  3JB9 J;  1N9R A;  1KK7 A;  2MI6 A;  4WF2 A;  4JLI A;  2FRY A;  2KXD A;  1WQ7 A;  5GAM g;  4JJC A;  3QWY A;  5J39 A;  4BY6 C;  2A3L A;  3LLR A;  4DOV A;  2L2P A;  5CKD A;  2KI7 A;  2PVG B;  1M5Q 1;  3M55 A;  4N4I A;  4C5G A;  2F1L A;  4BY6 B;  3VRY A;  3M9Q A;  3LYI A;  4DEY A;  2AZV A;  4JZ4 A;  4II1 A;  4IKF A;  2D9T A;  1UHC A;  3CME A;  2CZ1 B;  2DIQ A;  3S3M A;  1HSQ A;  2QA4 Q;  4ATO A;  3V8J A;  3EG9 A;  1PRM C;  2DXC A;  4C92 G;  1SHG A;  3I55 T;  4C0F A;  4F14 A;  2K57 A;  1M2V B;  1UG1 A;  2CP2 A;  4M77 D;  2IIM A;  2EYZ A;  3GOX A;  4LD9 K;  4L59 A;  1ZSG A;  1YIT T;  1EIF A;  2F2V A;  5DY9 A;  2O88 A;  2I0N A;  3V8K A;  4XQ3 A;  1NBE B;  2HDA A;  3HKS A;  3VUB A;  1VQO T;  3G4S T;  2K5I A;  4X1V A;  4CC3 A;  1SPK A;  1UGR B;  8ATC B;  1IZ6 A;  5CKH A;  2C0I A;  3CMA Q;  3JCM b;  4M78 G;  4C5E A;  1PG5 B;  1G8X A;  3CME Q;  3X26 B;  3JCM d;  1YJW T;  2D8H A;  1YBY A;  3G7Z A;  3A8O B;  1M90 U;  3V7S A;  3I56 T;  1SHF A;  4C92 C;  5J3B A;  4QQ6 A;  4M75 B;  2GQV A;  2LJ1 A;  3UA6 A;  2VVK A;  5GAO l;  5GAO q;  1B34 A;  2QQ9 A;  1VQ4 A;  2OI3 A;  2DBM A;  5CQY A;  3JCM X;  1Q95 G;  2AHJ B;  1VIE A;  2MCN A;  2JS2 A;  4J9D A;  5IT9 E;  1I1J A;  3VKI A;  4NOY A;  3RMQ A;  2LP5 A;  2JTE A;  4J9B A;  1D0X A;  1WXT A;  2E64 A;  3R6O A;  3KFV A;  4M78 C;  5CCA A;  1YJN T;  1FMV A;  4AMC A;  4OMQ A;  2WSE E;  3QDR B;  2C0O A;  1VQ6 T;  2FL7 A;  1PHT A;  3MPU B;  1VQ9 A;  1MGQ A;  4OGE A;  4E2F B;  2EJF A;  1JRI A;  2E5K A;  2OTJ Q;  5IH2 A;  4AG2 C;  3FIF A;  3TEE A;  4C92 F;  1K0S A;  5FRN A;  1UDL A;  1IHV A;  3MEU A;  1FYN A;  4M75 D;  3MP8 A;  1XQH A;  1IB8 A;  5GJW B;  1GCQ C;  1PWT A;  3JCM V;  2K3Y A;  4GLM A;  3MKD A;  3OQ5 A;  3JCM g;  5GAO r;  2QQR A;  2FRW A;  4LXC A;  2A08 A;  3KUF A;  5GMK e;  3GP8 A;  1AWO A;  4XTY A;  2H3J A;  2RQU A;  4XU1 A;  2K5F A;  4M77 A;  1WZO A;  4M78 F;  3CCJ T;  2JJ9 A;  2O9V A;  4RCB A;  2DL8 A;  1VQ9 Q;  1VQ6 Q;  2KT1 A;  1AZE A;  2JNG A;  2QQA A;  1KC8 C;  3J7A F;  2L3R A;  1W4S A;  2LCL A;  4KRT A;  1YIJ A;  2LT4 A;  4OMP A;  2ZCF B;  1I8F A;  4PJO E;  4QVD A;  2E12 A;  4OGC A;  5LJ5 j;  2LNH B;  2LQN A;  4XU3 A;  1G83 A;  1IO6 A;  1MMA A;  1MMG A;  5DM7 R;  2KDS A;  3RIR A;  4EMG A;  2D0Q B;  1KQ1 A;  1KQS P;  4PFP A;  1Y7X A;  3ZBD A;  4N0A A;  1RAH B;  2QQS A;  2AT1 B;  1GFD A;  3RKW A;  1D0Y A;  4A4K A;  1AWJ A;  1KHC A;  1CKA A;  2DIG A;  2JT4 A;  2DEU A;  3EHR A;  4OMO A;  5IN1 A;  4J7I A;  1Q81 R;  1AT1 B;  2L0A A;  2MWO A;  2YUP A;  2M1H A;  1UB4 A;  3EHQ A;  4XTW A;  2F5T X;  3L2R A;  2DL7 A;  3VS7 A;  1VQP A;  2R58 A;  2Y4X A;  1TSF A;  4J83 A;  1QCN A;  5GAM j;  4JJB A;  4R0K A;  3JSC A;  3CCU A;  3PVL A;  2YUO A;  1X2Q A;  4BI8 B;  4QQG A;  2JMA A;  1D1C A;  2VB6 A;  1OYX A;  2E65 A;  2RI2 A;  5CKF A;  2PNI A;  5AYF A;  2DRK A;  4RTV A;  4HT8 A;  4M7A A;  2RPN A;  2P4R A;  4MDX A;  4BB7 A;  1MNE A;  1QWE A;  1BB9 A;  3WXM B;  4LDW A;  3REA B;  4BUG A;  2ZGW A;  1Y71 A;  2CH4 A;  2DM1 A;  3CCM T;  5GMK i;  1NJI R;  1NYF A;  4PJJ A;  5CR2 A;  2EKH A;  2NUZ A;  2G3R A;  3CCU Q;  4FYV B;  5KYY A;  3FRN A;  3P8H A;  5GAO p;  3D7S B;  3E1S A;  1C0M A;  1NEB A;  4Q5W A;  1OU9 A;  3JRZ A;  4BE0 A;  3BFM A;  1SSH A;  4JLG A;  3VJP A;  2F69 A;  3CC7 A;  5IHK A;  1IGQ A;  4HCZ A;  5D6Y A;  4KUI A;  1YJ9 A;  3TRE A;  1RAF B;  5EC7 A;  1UFF A;  3V8L A;  1MV3 A;  3FJP A;  4F7U G;  2HBW A;  2X3W D;  4FM4 B;  5LJ5 h;  4J9I A;  1O9S A;  3VV0 A;  2O01 E;  2DBK A;  4OMM A;  3CCL T;  1VQK A;  1G3Y A;  1VQM A;  1UEB A;  3M0U A;  2JZ2 A;  3M54 A;  4RG2 A;  4M7D B;  1RAB B;  3CC7 Q;  3VU3 C;  2EVR A;  2FG0 A;  2DVJ A;  2D6F A;  3BW1 A;  2X51 A;  1YWO A;  1YJ9 Q;  3EGX A;  3FLG A;  3SD4 A;  3QJ6 A;  3V7R A;  1VQ7 T;  3RDV A;  3PFS A;  3TQ7 P;  2NUP B;  2EQU A;  4E7H A;  1SRM A;  1EX4 A;  4O5V A;  1K9M R;  4PFO A;  3E2U A;  4OVA A;  2QEX T;  1Q86 R;  2FB7 A;  2X3X D;  2LZ6 B;  3LH0 A;  5GAM h;  1BI2 A;  1RI9 A;  3MHX A;  1C1A A;  1WHM A;  3C94 A;  2CT3 A;  3CEY A;  1OI1 A;  2KGT A;  1UJ0 A;  2PQW A;  4X9C A;  1T0J A;  4B9X A;  2JM9 A;  3M0Q A;  5I22 A;  1Q82 U;  1PKS A;  4M7D D;  1V76 A;  1ARK A;  3EFR A;  1W2B S;  1QP2 A;  2XI9 A;  1PD0 A;  4KH0 B;  2CT4 A;  4LDX A;  3RER A;  1AWW A;  2XHC A;  1TU0 B;  4A4F A;  1PRL C;  2O31 A;  2CRE A;  2KYM A;  2DX1 A;  4QT7 A;  4A4G A;  4E7I A;  3DB4 A;  5GAN d;  4XAX B;  1YNZ A;  3REB B;  2QAZ A;  3G71 T;  2GCX A;  1LNX A;  5KH6 A;  2QEX Q;  1N9S A;  1B7T A;  2LX9 A;  2PU9 B;  2RQT A;  2KEA A;  3M4G A;  4ESR A;  3CCV T;  1W1F A;  1Q7Y R;  3CC2 T;  4GBQ A;  2EWN A;  1T3L A;  2KSS A;  3H9N A;  4J8O A;  3H0H A;  1JEG A;  2FVU A;  1VQL Q;  5FRO A;  2OJ2 A;  2JVV A;  5GAN f;  4ZGE B;  2A37 A;  3JB9 G;  1X69 A;  1NG2 A;  4P5N A;  3EG9 B;  4QQD A;  1WFW A;  4OP0 A;  2BZ8 A;  3G71 Q;  3CBO A;  4MZT A;  2ZPF B;  2KVQ G;  1R0B G;  4PJN A;  3G6E A;  1Q81 C;  3E9F A;  2RI3 A;  3OS5 A;  3FB9 A;  2MF2 A;  4N4G A;  3CC2 Q;  2LQ8 A;  1PM3 A;  5I21 A;  1E6G A;  5ECA A;  1UGV A;  3MEA A;  1A0N B;  3NTH A;  4C0D C;  2HL3 A;  3M58 A;  2DLP A;  2QDY B;  3TSZ A;  4MZM A;  1QCO A;  1M1K U;  3X24 B;  5GAN g;  4PJO A;  4C0D B;  3CPW S;  1YI2 Q;  2NLU A;  1VQN T;  1HJD A;  2DVE A;  3EH1 A;  2XDD A;  1JO8 A;  2HSP A;  2PUO B;  3OYA A;  3EG2 A;  2COW A;  2CP3 A;  4RG8 A;  2QQB A;  3A8M B;  5D6W A;  1B34 B;  2RB6 A;  1N8R U;  3X25 B;  3M0P A;  2CUB A;  3EFS A;  3GNG A;  1MUZ A;  4D8K A;  2VGN A;  4TVR A;  3PE0 A;  1M2O A;  3OYI A;  4M77 G;  2DZ9 A;  3VS5 A;  5GJV B;  2YHT A;  4AFQ C;  5CIU A;  5CQX A;  2V26 A;  3H8Z A;  4M7A E;  2XDP A;  2RHY A;  2GFU A;  2DJZ A;  2KRM A;  4J6X A;  2WSF E;  3JB9 F;  4EMK A;  4A53 A;  2COY A;  2RI5 A;  2D1X A;  4C92 E;  3H0I A;  4J9E A;  2C0T A;  1NZ9 A;  4HCB A;  2RM4 A;  1LVK A;  1ABO A;  2DMO A;  5LJ3 e;  3AHU A;  3M4Y A;  3ULR B;  2W10 A;  2DL5 A;  3O5Z A;  2IVW A;  4QVZ A;  2QAS A;  1QVF S;  3HFN A;  1D0Z A;  2ZZD A;  1M90 R;  1JXM A;  5GAN 6;  2X4J A;  1OUL A;  1M30 A;  1ZBX A;  2HD0 A;  4M77 C;  3CD6 Q;  3ME9 A;  2QA4 T;  2DF6 A;  1I5L A;  4E6R A;  5IAY A;  4M78 E;  3A8L B;  4M77 B;  2DYI A;  2EBP A;  3HRT A;  1ZSZ C;  2P0Q A;  1AWX A;  1NEG A;  3QUI A;  5IXF A;  2M02 A;  1WXB A;  2FPE A;  1Z9Q A;  4GY5 A;  1AEY A;  2RA2 A;  1UUE A;  4D6W A;  1ZSZ B;  3QZ9 B;  3NTK A;  4CI0 C;  2AKK A;  1M8V A;  1FX7 A;  2IG0 A;  2P0K A;  4CC2 A;  3CMA T;  2RNA A;  2BE7 D;  2XD0 A;  2WSC E;  1UGS B;  1H3H A;  2D8J A;  1TXQ A;  2AKL A;  3CME T;  2EQK A;  2GTJ A;  3LGF A;  3KXT A;  1NYG A;  3PIP A;  4M75 G;  3INZ A;  4M77 F;  3SWN A;  1K9M C;  5KCH A;  3EG0 A;  1W6X A;  3MEV A;  1Q86 C;  5AT1 B;  2CZ7 B;  1WLP B;  3TU4 K;  2K2V A;  1NLO C;  1SG5 A;  2L8D A;  5LJ3 h;  5KYW A;  3EG1 A;  1X27 A;  1OQK A;  4EPC A;  2EGE A;  3OS0 A;  2FPF A;  4JRK A;  5GAN 3;  2QYZ A;  1IHW A;  2K9G A;  2NWM A;  1W2B A;  2P4T A;  4ORZ A;  1K73 U;  4A4E A;  2VV5 A;  4GLK A;  1WA7 A;  2ATC B;  2RQW A;  4M75 C;  2OTJ T;  1OPL A;  3G4S A;  2J6O A;  2ZAE A;  3CCE A;  1KIK A;  4OMF B;  2YLC A;  2GFA A;  2XK0 A;  1Q7Y C;  1KQS S;  3PIO A;  2MOX A;  2RQR A;  1RAG B;  3JCM f;  3JAM E;  1PSF A;  2K3B A;  4ZTF A;  1S72 A;  2ABL A;  1YJW A;  2VAS A;  3H0F A;  3VUZ A;  4C8Q E;  3U23 A;  1YP5 A;  3L42 A;  5HCK A;  5GAN 7;  5J26 A;  4AFU C;  4BDZ A;  4LE9 A;  1VQ9 T;  1H8K A;  5KYN A;  5KYY B;  2V8J A;  1V1C A;  5GAN j;  1VQ8 A;  4FSX A;  4M75 F;  3CCE Q;  2LC4 A;  4MMK A;  4XK8 E;  5GAN 5;  1ZA2 B;  2O2O A;  4WTO B;  1R0C B;  3CXC S;  3CBM A;  1BI1 A;  2DRM A;  4D8D A;  4LN2 A;  2KR3 A;  1VQ4 Q;  3QPH A;  3M56 A;  3OYY A;  2PZ1 A;  4XTZ A;  1C6V X;  1S72 Q;  2V8K A;  4HA8 A;  2SEM A;  2O4X B;  1QVG P;  4M7A D;  3CCR A;  3OYG A;  3MP6 A;  2JN0 A;  4AG1 C;  5GAN 2;  2MK5 A;  2DD5 A;  1YFN A;  2LQW A;  2VC8 A;  3ZEH A;  3OY9 A;  4JJD A;  1WYX A;  2FZK B;  3CPW A;  4Z88 A;  4FW1 A;  3L2U A;  1ZA1 B;  3GF5 A;  4PLL A;  1VQ8 Q;  2R5A A;  2HQE A;  4IUT A;  2ECZ A;  2PVO B;  5KYX A;  5A0G A;  4V2S A;  1BCO A;  4BAC A;  1RLQ C;  2EGA A;  3THK A;  2RHZ A;  3CCJ A;  2DO3 A;  2M0Y A;  4LD6 A;  2A0F B;  3OYF A;  1WJR A;  3EGX B;  2DA9 A;  3S3O A;  4Z8A A;  5HK3 A;  2E5Q A;  3GPL A;  4E7J A;  4RMO A;  1X6B A;  1E6H A;  3CQT A;  1GRI A;  2DET A;  2PVD B;  2HEQ A;  1K8A U;  3UWN A;  3HSB A;  1YIJ Q;  1CKB A;  1U1T A;  4PJL A;  2XKO C;  2DL3 A;  2K4Y A;  4OF1 A;  2K7A A;  2ZPB B;  4KBM B;  1D1A A;  1VQP T;  3OYJ A;  2LTO A;  3S3N A;  2CSI A;  5C6S A;  5EG2 A;  4J9C A;  2R5M A;  1QVF A;  2P84 A;  4EIK A;  3CCU T;  4YTL A;  3OW2 S;  4HT9 A;  4RTX A;  4J9F A;  1BKB A;  1LOJ A;  3A8H B;  5LJ5 e;  2BIV A;  1CSK A;  1QMC A;  1SF9 A;  3M53 A;  4E47 A;  4F7U E;  4HVW A;  3I35 A;  3EFO B;  3MJX A;  2DXT A;  4DBF A;  2DJQ A;  1JJ2 S;  1WNL A;  1LPL A;  1UHF A;  4HVV A;  1OU8 A;  4FU6 A;  3NGP A;  3LW5 E;  2K2M A;  2COZ A;  1VQP Q;  3GLX A;  5GAN h;  4PKC C;  1KD1 U;  4C92 A;  4ZTJ A;  4C5H A;  2JW4 A;  5GAO n;  2LDM A;  2HKQ B;  1Y57 A;  2DE0 X;  1AD5 A;  2LJ3 A;  1U06 A;  2VKN A;  1X2K A;  2R57 A;  4M7D G;  5KYU A;  2CP7 A;  3E19 A;  4FYX B;  3RUX A;  5GAM e;  3EGU A;  4DA4 A;  1Q82 R;  5FRM A;  2CGH A;  2BZX A;  1BK2 A;  1JBM A;  1N5Z A;  4C8Q D;  3CCM A;  4M78 A;  1N27 A;  5HKC A;  3IQL A;  3CC7 T;  1VYV A;  4EDU A;  2DK3 A;  2NYS A;  2QTX A;  2RK1 A;  1YJ9 T;  1FMW A;  1M1G A;  1ZUK A;  3HPW A;  4HCC A;  2CSQ A;  3VS6 A;  3L2Q A;  3X28 B;  2H8H A;  4PJO B;  1YCY A;  2KAF A;  2L3P A;  1T3S A;  2QG9 B;  2ENM A;  3PNW C;  3QJY A;  1GCQ A;  2HL5 C;  4LNP A;  1WHL A;  1IRE B;  1VA7 A;  2RK2 A;  1B3Q A;  4K11 A;  1N6A A;  2CP5 A;  4M7D C;  3CCQ A;  3OYE A;  1JXO A;  3OSS C;  1MV0 B;  1NE8 A;  5D7U A;  5HK0 A;  1KQS A;  3TVT A;  1OX8 A;  4L5G A;  2DTH A;  4DOW A;  2CDT A;  2L89 A;  4KT0 E;  1WJQ A;  2X35 A;  3HP9 A;  1RAC B;  2DXU A;  4JS5 A;  1EZZ B;  1MND A;  2MIO A;  1G3T A;  2EAY A;  1G5V A;  3CCL A;  1GXI E;  3OS2 A;  4PJO D;  4PL6 A;  2DEQ A;  1QW1 A;  4OB2 B;  4EMK B;  4ELY C;  3OYM A;  3FJ5 A;  3CCQ Q;  3JCM J;  3CXC A;  1VQK Q;  4QW2 A;  1VQM Q;  2J06 A;  4M7D F;  3HHT B;  2DAQ A;  2M9U A;  1GBR A;  1VQL T;  1M1K R; 
#chains in the Genus database with same CATH homology
 3H8Z A;  5GAO l;  4M7A E;  2KY9 A;  2LQK A;  5GMK h;  2XDP A;  1B34 A;  1HK9 A;  5GAO q;  1HXD A;  2QQ9 A;  2GFU A;  2RHY A;  2DJZ A;  4C8Q B;  5FU7 C;  5HY6 A;  4DQ2 A;  2E10 A;  5CQY A;  4ZN1 A;  4J6X A;  3JCM X;  2WSF E;  4BE1 A;  3JB9 F;  2RD1 A;  2AHJ B;  1VIE A;  3NFC A;  5FLX E;  4EMK A;  4A53 A;  4FIB A;  5FU7 B;  4JRQ A;  4NL3 A;  3UT1 A;  2RI5 A;  4C92 E;  5IT9 E;  4IUV A;  4NOY A;  4Z02 A;  3RMQ A;  3VKI A;  2OTL A;  4X9D A;  1NZ9 A;  4HCB A;  2E64 A;  2RM4 A;  3R6O A;  4M75 A;  4PJO G;  1BIB A;  4M78 C;  5CCA A;  1YJN T;  5LJ3 e;  2LCC A;  2RJE A;  1DJ7 B;  3M4Y A;  3N5B B;  3FC3 A;  3AHU A;  2WSE E;  3P8B B;  5I2S A;  3QDR B;  1YHQ A;  1VQ6 T;  4C8Q A;  2FL7 A;  2RH2 A;  2IVW A;  4QVZ A;  4B9W A;  1VQ9 A;  3MO8 A;  1QVF S;  2LVM A;  3HFN A;  5CK9 A;  1MGQ A;  4OGE A;  2PUK B;  2EJF A;  1JRI A;  2ZZD A;  5GAN 6;  2X4J A;  1ZBX A;  1X6O A;  2HD0 A;  1QVG A;  3FIF A;  4M77 C;  3ME9 A;  3TEE A;  2OAU A;  3SFM A;  4C92 F;  5LJ3 g;  2QA4 T;  1X01 A;  2LNV A;  4JJN K;  5IAY A;  1VQ4 A;  1I5L A;  5FRN A;  3JB9 I;  3MEU A;  4M78 E;  3A8L B;  4M75 D;  4C8Q F;  2CZ0 B;  3MP8 A;  1O75 A;  1XQH A;  4M77 B;  3UDC A;  2HBP A;  3HRT A;  4KUL A;  4MDW A;  2JTM A;  1YI2 T;  2E1H A;  3FEO A;  4MML A;  3JCM V;  1KQ2 A;  2P0Q A;  3QUI A;  3X20 B;  2K3Y A;  4GY5 A;  4LDY A;  1RL2 A;  2FYK A;  3OQ5 A;  3OBW A;  3JCM g;  5GAN 8;  3QO3 A;  5GAO r;  2QQR A;  2RA2 A;  4D6W A;  3CCV A;  3JB9 J;  1I81 A;  3GP8 A;  3KUF A;  5GMK e;  3QZ9 B;  3NTK A;  2JUF A;  2XID A;  3M5A A;  4XTY A;  4UC4 A;  4CI0 C;  2H3J A;  1M8V A;  4PJO C;  3OYN A;  2LT1 A;  4BI3 A;  1FX7 A;  2IG0 A;  2P0K A;  4XU1 A;  2KK4 A;  2K5F A;  2X4W A;  4M77 A;  4NL2 A;  4PNO A;  4M78 F;  5LL6 S;  3CCJ T;  3BDL A;  3CMA T;  5DLO A;  2A7Y A;  4FL6 A;  2CKK A;  4RCB A;  1LJO A;  2JNG A;  2QQA A;  2M0O A;  3QG1 A;  2XD0 A;  2WSC E;  3E9G A;  1KC8 C;  4RKU E;  1UGS B;  3J7A F;  3LWI A;  2L3R A;  1W4S A;  1P92 A;  1ZHI A;  2LCL A;  2O4X A;  2YLB A;  3S6W A;  5GMK l;  3CME T;  1KHI A;  2DZC A;  2EQK A;  1YIJ A;  2LT4 A;  3LGF A;  3KXT A;  3CC4 A;  3DLM A;  3PIP A;  2HQX A;  4OB1 B;  4M75 G;  1Q81 U;  3GIB A;  3INZ A;  1I4K 1;  4M77 F;  5CKE A;  1NPP A;  3SWN A;  2ZCF B;  1I8F A;  3CCQ T;  1VQK T;  4PJO E;  4QVD A;  1D3B B;  1VQM T;  2ZPG B;  2E12 A;  4XTX A;  3JCM P;  1K9M C;  4OGC A;  1QVP A;  5KCH A;  3MEV A;  2BKD N;  1Q86 C;  5LJ5 j;  2CZ7 B;  4XU3 A;  3L1A A;  3URG A;  3A5Z B;  1G3S A;  5DM7 R;  5A2Q E;  1OZ3 A;  3TU4 K;  2KDS A;  5M9O A;  2K2V A;  3BDU A;  3OW2 A;  1NPR A;  3RIR A;  2L8D A;  5LJ3 h;  5LJ5 d;  2FHD A;  2EFI A;  4JRI A;  4EMG A;  2D0Q B;  3ASK A;  2VXE A;  1Y07 A;  3QBY A;  4EPC A;  1K8A C;  2KMT A;  1KQ1 A;  4KUD K;  1D3B A;  4PJO F;  3M59 A;  1Y7X A;  3ZBD A;  4JRK A;  3OS0 A;  2KQW A;  4N0A A;  5GAN 3;  1AHJ B;  3PGG A;  3HRS A;  2QQS A;  2I2L A;  2Y4Y A;  4EMK C;  1BYM A;  1W2B A;  2P4T A;  3JCM h;  3RKW A;  5A0D A;  1K73 U;  2DD4 A;  1VQN A;  4A4E A;  5GAN 4;  2VV5 A;  4GLK A;  4A4K A;  1JJ2 A;  1KHC A;  3OB9 A;  2DIG A;  5A0L A;  5IN1 A;  3CCS A;  3OYD A;  4J7I A;  4M75 C;  4ZN3 A;  2VYT A;  3WVD B;  4J5Y A;  3VYH B;  2OTJ T;  5CVI A;  3G4S A;  2MWO A;  4C0G A;  1NJI C;  3CD6 T;  2M1H A;  3JCM W;  3CCE A;  1UB4 A;  4XTW A;  3EAE A;  2F5T X;  4OMF B;  1VQ7 A;  3L2R A;  2EQJ A;  1VQP A;  2R58 A;  2YLC A;  3T9N A;  2Y4X A;  2GFA A;  4J83 A;  2XK0 A;  1WJS A;  5GAM j;  1Q7Y C;  1NJI U;  3PIO A;  1KQS S;  3PTA A;  1BIA A;  3OMG A;  1QP3 A;  2VXF A;  4VUB A;  2EKO A;  3JSC A;  3JCM f;  3JAM E;  1PSF A;  2QEX A;  4M75 E;  4ZTF A;  1S72 A;  3HRU A;  2EJ9 A;  4F7U B;  1YJW A;  2OTL T;  3CCU A;  1Y96 B;  1Q82 C;  3QXE B;  3L2W A;  3VUZ A;  4QQG A;  4BI8 B;  4C8Q E;  5KE2 A;  3L42 A;  1YHQ T;  1BI3 A;  4BD3 A;  5GAN 7;  1OYX A;  2E65 A;  2RI2 A;  5J26 A;  5CKF A;  5D6X A;  4BDZ A;  1VQL A;  1VQ9 T;  3QYH B;  1UGP B;  5AYF A;  3QYG B;  4HT8 A;  5GAO m;  1X75 C;  3J80 E;  4M7A A;  2V8J A;  1KD1 C;  4OB3 B;  2E70 A;  3WVE B;  4F7U A;  5KCO A;  4FSX A;  3RES A;  5GAN j;  1VQ8 A;  1XNI A;  3DKM A;  4M75 F;  5LJ5 g;  2LC4 A;  4MMK A;  4BB7 A;  4XK8 E;  1Y96 A;  4JS4 A;  5GAN 5;  3JCM e;  2RJD A;  3CXC S;  3CBM A;  1BI1 A;  3C12 A;  2RJF A;  4JRP A;  3GNF B;  3V7C A;  3WXM B;  1M4Z A;  3QPH A;  4LDW A;  4BUG A;  2B8A A;  2ZGW A;  3MEW A;  1Y71 A;  4A54 A;  4ZGD B;  5KE3 A;  3M56 A;  3OYY A;  3CCM T;  5GMK i;  1U1S A;  5CR2 A;  4F7U F;  4XTZ A;  4ME7 A;  3G71 A;  2V8K A;  4HA8 A;  2O4X B;  2G3R A;  2X4Y A;  2ZPH B;  3OS1 A;  3SWN C;  3CCR A;  4M7A D;  4XU0 A;  3OYG A;  3FRN A;  2JN0 A;  3MP6 A;  5GAN 2;  3P8H A;  4M77 E;  2EIF A;  5GAO p;  3E1S A;  3CC2 A;  2DD5 A;  4Q5W A;  2K5L A;  3KBG A;  5CO7 A;  3SWN B;  2VC8 A;  4LDV A;  3ZEH A;  3OY9 A;  2QA4 A;  4HKE A;  1VQ5 A;  3JRZ A;  2DPP B;  4BE0 A;  2V8I A;  3BFM A;  3CPW A;  3QHS A;  2MWP A;  3MCA B;  3G6E T;  3CPF A;  2E6N A;  4O6J A;  3LX7 A;  3L2U A;  4JLG A;  3GF5 A;  4PLL A;  2R5A A;  3O8V A;  3VJP A;  3QII A;  3OYK A;  2F69 A;  1YI2 A;  3CC4 T;  3CC7 A;  2HQE A;  4IUT A;  2PVO B;  4HCZ A;  3UPU A;  5D6Y A;  3OYL A;  2F5K A;  3P8D A;  4N0A C;  1KC8 U;  2HAX A;  4KUI A;  3J81 E;  1QVG S;  5A0G A;  2L5Q A;  1YJ9 A;  4V2S A;  1V29 B;  2M16 A;  3SDZ A;  4ZGJ B;  3TRE A;  4CRI A;  3CBP A;  4BAC A;  4FT2 A;  2RHI A;  2VGM A;  3F70 A;  2WAC A;  2JOY A;  2XG8 D;  3LWH A;  2RHZ A;  3CCJ A;  3CMA A;  4M7A G;  2DO3 A;  4LD6 A;  3V8L A;  3FJP A;  4F7U G;  1K9M U;  4FM4 B;  4EMH A;  2JTF A;  5LJ5 h;  3OYF A;  1WJR A;  4A4H A;  1Q86 U;  3A8G B;  1O9S A;  1H64 1;  1OZ2 A;  3VV0 A;  5HK3 A;  3S3O A;  2E5Q A;  2O01 E;  1XTD A;  4LDU A;  2DTO A;  4J7F A;  4BI4 A;  4QVC A;  5GMK m;  3GPL A;  4E7J A;  2XDB A;  3HFO A;  3JCM c;  1PSE A;  4RMO A;  2RO0 A;  3OA6 A;  2QI2 A;  4X34 A;  3OYB A;  1H3Z A;  3CCL T;  1VQK A;  3JCM Q;  1G3Y A;  3I55 A;  1VQM A;  1FWZ A;  1UEB A;  4MZP A;  2JZ2 A;  3M54 A;  4RG2 A;  2HNI A;  2DXB A;  4M7D B;  2PVD B;  5CKB A;  3QSU A;  5LJ3 j;  1K8A U;  4BDY A;  3UWN A;  3HSB A;  1U1T A;  2ZPI B;  4IUR A;  2XKO C;  2VUB A;  3VU3 C;  2Y90 A;  5C0M A;  3CCS T;  2K4Y A;  2D6F A;  3BW1 A;  1YIT A;  4OF1 A;  4C5I A;  1M1F A;  5LJ5 f;  1M9S A;  2ZPB B;  4JUV A;  3FLG A;  3SD4 A;  4KBM B;  3CCE T;  1VQO A;  1N8R C;  4NS5 A;  3QJ6 A;  3PMI A;  3V7R A;  1VQ7 T;  4Y28 E;  1VQP T;  4C0Z A;  3PFS A;  3OYJ A;  3HL8 A;  1VQ4 T;  2LTO A;  3S3N A;  2MAM A;  2EQU A;  3RMS A;  4M7D A;  2EYQ A;  4M7A C;  4E7H A;  4R56 A;  2P0P A;  5C6S A;  1R8O B;  4O5V A;  5EG2 A;  2R5M A;  4IUQ A;  1QVF A;  4OVA A;  2QEX T;  1S72 T;  3BY7 A;  3FDR A;  2FB7 A;  4M7A B;  3LH0 A;  5GAM h;  5L8R E;  3CCU T;  3OSV A;  1BI2 A;  2DTI A;  2CZ6 B;  4J6W A;  4YTL A;  3OW2 S;  3MHX A;  1Q7Y U;  4HT9 A;  5GAM d;  3PMT A;  1BKB A;  3C94 A;  1WPY A;  3CEY A;  5GMK j;  3I56 A;  1LOJ A;  3A8H B;  2OTJ A;  3L2V A;  3QZ5 B;  1OI1 A;  4IUU A;  4IUP A;  1M1K C;  3CD6 A;  5LJ5 e;  2BIV A;  2CS7 A;  4J6Y A;  2PQW A;  4C92 B;  4X9C A;  4XU2 A;  4B9X A;  1U8R A;  3M53 A;  1Q82 U;  4M7D D;  5FU6 C;  4E47 A;  1WGS A;  4F7U E;  3DLL A;  3EFR A;  4ELZ C;  1W2B S;  3DB3 A;  3RKX A;  1QP2 A;  1WQW A;  2XI9 A;  2DXT A;  1VQ8 T;  5FU6 B;  4OB0 B;  1JJ2 S;  1WNL A;  4LDX A;  2LRQ A;  3RER A;  4E7L A;  3C95 A;  2XHC A;  4A4F A;  4FU6 A;  3JB9 D;  5GAM f;  2X4X A;  3LW5 E;  3OYC A;  3PT9 A;  3GLX A;  5GAN h;  4PKC C;  1KD1 U;  4A4G A;  4E7I A;  4C92 A;  3DB4 A;  3H6Z A;  5I2M A;  5GAN d;  4XAX B;  1FXX A;  1VIF A;  1YJN A;  4XTV A;  3G71 T;  4M7A F;  2E6Z A;  2GCX A;  2CYZ B;  1SSF A;  1LNX A;  4C5H A;  4M78 B;  5KH6 A;  4ZTJ A;  1N9S A;  3CCR T;  5GAO n;  1VQ6 A;  2LDM A;  2LX9 A;  2QXF A;  4RCC A;  2PU9 B;  3CCV T;  3M4G A;  3C4S A;  4XTU A;  3CC2 T;  3ER0 A;  2C06 A;  5DLQ E;  3NTI A;  3OBY A;  2EWN A;  2KSS A;  3Q1J A;  4J8O A;  1VQ5 T;  4R55 A;  2FVU A;  2R57 A;  4M7D G;  5FRO A;  2YRV A;  3TCJ A;  2JVV A;  3E19 A;  3RKY A;  3RUX A;  4C92 D;  5GAM e;  3OMC A;  1MHN A;  1N9R A;  1ZQ1 A;  2CGH A;  3LGL A;  5GAN f;  4DA4 A;  1JBM A;  4ZGE B;  5FRM A;  2MI6 A;  2GF7 A;  4JLI A;  4WF2 A;  4M78 A;  1N27 A;  4C8Q D;  5HKC A;  3CCM A;  3CC7 T;  1YIJ T;  3VYG A;  3JB9 G;  4EDU A;  2RHX A;  4MDX A;  2DK3 A;  4L6V 5;  2QTX A;  1JB0 E;  3QKJ A;  4E7K A;  4P5N A;  2RK1 A;  2BUD A;  1YJ9 T;  1WQ7 A;  1M1G A;  2ZPE B;  2RJC A;  5GAM g;  3HPW A;  4QQD A;  5J39 A;  4BY6 C;  4HCC A;  2E41 A;  2A3L A;  1G3W A;  3LLR A;  4OP0 A;  4DOV A;  2PVG B;  5CKD A;  1M5Q 1;  2DKG A;  3M55 A;  4N4I A;  3X28 B;  3ZFJ A;  4C5G A;  3L2Z A;  3CBO A;  4BY6 B;  4MZT A;  2ZPF B;  4PJO B;  1YCY A;  2KAF A;  2RHU A;  3M9Q A;  2KVQ G;  3LYI A;  3M57 A;  3G6E A;  1Q81 C;  3E9F A;  4M78 D;  2RI3 A;  4II1 A;  3OS5 A;  3FB9 A;  2MF2 A;  4N4G A;  4BE2 A;  5GAN e;  4IKF A;  3PNW C;  2D9T A;  3QJY A;  2LQ8 A;  3CME A;  2CZ1 B;  2DIQ A;  5I21 A;  3S3M A;  1BI0 A;  1IRE B;  4ATO A;  2RK2 A;  1VUB A;  1N6A A;  3V8J A;  4FT4 A;  2DXC A;  4C92 G;  3MEA A;  4M7D C;  3NTH A;  4C0D C;  3I55 T;  3CCQ A;  3M58 A;  2QDY B;  2K57 A;  4C0F A;  3OYE A;  4M77 D;  3OSS C;  4MZM A;  4C8Q G;  5HK0 A;  1NE8 A;  1M1K U;  1KQS A;  3X24 B;  3SB2 A;  5GAN g;  3GOX A;  4C0D B;  3CPW S;  4LD9 K;  2NLU A;  1VQN T;  3JB9 H;  4L59 A;  4PJO A;  4L5G A;  1YIT T;  1EIF A;  5DY9 A;  2DVE A;  2DTH A;  4DOW A;  3V8K A;  2L89 A;  2XDD A;  4XQ3 A;  2EQM A;  4KT0 E;  2PUO B;  3HKS A;  3VUB A;  1WJQ A;  2MMP A;  1TH7 A;  2X35 A;  3HP9 A;  3OYA A;  3L2Q A;  3G4S T;  1VQO T;  5LJ3 d;  2DXU A;  2K5I A;  3OYH A;  4RG8 A;  4JS5 A;  4M7D E;  1UGR B;  1IZ6 A;  1K73 C;  5CKH A;  1G3T A;  2EAY A;  1G5V A;  3JCM b;  2QQB A;  4M78 G;  2K3X A;  3A8M B;  5D6W A;  4C5E A;  3OS2 A;  3CCL A;  1B34 B;  1GXI E;  2RB6 A;  1N8R U;  3X25 B;  2XU8 A;  4PJO D;  1M90 C;  2EJG A;  4PL6 A;  4Y91 A;  3MP1 A;  4PLI A;  2DEQ A;  3EFS A;  1QW1 A;  4JDS A;  3GNG A;  3X26 B;  3MET A;  4OB2 B;  3JCM d;  1KG1 A;  4EMK B;  1YJW T;  2VGN A;  1YBY A;  1XOV A;  3G7Z A;  4TVR A;  4ELY C;  3OYM A;  2XIC A;  3A8O B;  1M90 U;  4N4H A;  3V7S A;  3I56 T;  3JCM J;  4C92 C;  3CXC A;  5LJ3 f;  1UGQ B;  4QW2 A;  3OYI A;  4M77 G;  2DZ9 A;  5J3B A;  4QQ6 A;  4M7D F;  3HHT B;  1RI0 A;  2YHT A;  4M75 B;  4C8Q C;  5CAI A;  2DAQ A;  2GQV A;  2M9U A;  5CIU A;  1VQL T;  5CQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...