3VJPA

Orthorhombic crystal structure of salmonella flga in closed form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
198
structure length
198
Chain Sequence
b'QDINAQLTTWFSQRLAGFSDEVVVTLRSSPNLLPSCEQPAFSMTGSAKLWGNVNVVARCANEKRYLQVNVQATGNYVAVAAPIARGGKLTPANVTLKRGRLDQLPPRTVLDIRQIQDAVSLRDLAPGQPVQLTMIRQAWRVKAGQRVQVIANGEGFSVNAEGQAMNNAAVAQNARVRMTSGQIVSGTVDSDGNILINL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagella basal body P-ring formation protein flgA
publication title Structural flexibility of the periplasmic protein, FlgA, regulates flagellar P-ring assembly in Salmonella enterica
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Chaperone
total genus 36
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08666 SAF SAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.760 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vjpA02
3VJPA 3VKIA 3TEEA 3FRNA
chains in the Genus database with same CATH superfamily
1TWBA 1OZ2A 1K0SA 3M5AA 2DIQA 4M7AE 2RD1A 4EIKA 3REBB 4C0DC 8AT1B 3OYFA 1N9SA 1WHKA 3HP9A 2DBKA 4BI4A 3CCMQ 4PFZA 3RMSA 2CP7A 1KQSA 3QDFA 1AD5A 2AT1B 2JTMA 3INZA 1MV0B 2J05A 1M1KU 4M7AC 1YJNQ 3ASKA 1IGQA 2PVGB 2KXDA 2O2OA 1NM7A 3SWNB 1KHIA 1UFFA 2ZPEB 4DBFA 5KYWA 1XJWB 1VQMQ 2XDBA 2EW3A 1WQWA 5FU7C 4AFZC 1K76A 4J9BA 4PJOF 2EQIA 4J9IA 1KC8U 2LT1A 3OYKA 3C12A 3ZL7C 3VS1A 1QVGS 2KGTA 2VWFA 4GLKA 5LJ5d 4F7UA 1YP5A 5EG2A 1XNIA 3O8VA 5FROA 1HXDA 2ABLA 2DTIA 2YXYA 3EGUA 3VRYA 2LTOA 4M75B 4DOWA 1Y57A 3HRUA 3P8DA 4IUUA 1HK9A 1S1NA 3C0CA 3GNGA 1WLPB 1G5VA 3JV3A 3M53A 4RTXA 3THKA 3G71T 4HCBA 2GF7A 4EMKB 1OX8A 3V8JA 4RKUE 2QTXA 1JJ2P 3QWXX 4ZGDB 5GAOq 3PMTA 3SWNC 1VA7A 4C8QG 4XU3A 1ZBXA 1WPYA 2MOXA 4M75D 4X1VA 2RHIA 5LJ3f 2HKNA 3MP1A 3I56A 4E7LA 2QA4A 2YHTA 3HKSA 4OGCA 4C5EA 1UJ0A 2RQUA 2GQVA 3CMAA 2C0OA 3VYGA 2QTVA 1CKBA 2QK0A 2YLBA 4M77D 4C8QE 3CCJT 3QYHB 2ZPBB 1K0XA 2EJGA 4M7AF 3BDLA 3I5RA 2FRYA 2K5IA 3C94A 1Q86U 2HBWA 4JDSA 1D0YA 2AK5A 5FWCA 5KYYB 3WXMB 1B34B 4QQDA 1VIFA 4J6WA 1MMNA 2EKOA 2RHZA 1UB4A 1NLPC 1JEGA 1VQ5Q 4FIBA 4CI0C 2KAFA 2JJ9A 1X75C 3MEWA 1OULA 3VRZA 1M3AA 4RCCA 5KE3A 2E3HA 4XU2A 2V8KA 3CPWS 5GANe 1E6GA 4C0FA 1ARKA 2X4WA 4ESRA 3OYDA 3MPUB 1GBRA 5LJ3g 4QQGA 4FYWB 2R58A 2OX7A 5GAOr 1VQ7T 1HJDA 4AFSC 2CP0A 1LJOA 4OF1A 3OYYA 4AMCA 2OTJA 3D7SB 5GAMe 3CD6A 2HZYA 3TCJA 3JB9J 1OQKA 3N5BB 2EJFA 3G6ET 3FJ5A 4P5NA 3CCEA 2DVEA 2AHJB 2QI2A 4PKCC 2V8IA 1IB8A 1K4US 5LJ3j 3A8OB 5A0DA 3QPHA 4ZN3A 2RQTA 1NJIR 1XOVA 1M27C 1PCXA 2J6FA 4IIOA 3PFSA 4DBQA 1FMVA 3GP8A 4OMOA 2DRMA 2ED1A 2XU8A 3CMET 1G3TA 1I5OB 5LJ5f 1M2VB 1BIBA 3ZEHA 1G2BA 3BW1A 1U06A 1MHNA 1QVPA 2FZCB 1AWXA 2YSQA 1M8VA 2G6FX 2RHUA 5CKDA 2BKDN 3OYAA 2DERA 4F17A 2RN8A 3H9NA 1X2QA 2A7YA 1YHQT 1PRLC 4ZTJA 1VUBA 1AZEA 2DJZA 4OB3B 2VC8A 2L3PA 1ZSZC 3VJPA 2KK4A 2E65A 2LX7A 2A08A 3OYJA 2YDLA 3G4SQ 1U1TA 2Y4XA 5GAN5 2XDDA 2LJ0A 5FLXE 3CBOA 4DEYA 4RTUA 4JRQA 2CSQA 2RB6A 2LCCA 3UA6A 2D9TA 5KYXB 2BIVA 2OJ2A 1VQPA 5GANd 2DIGA 3UATA 1TS9A 2LNHB 4N4HA 3HHTB 3FLGA 1BCMA 2HQHA 4BE2A 2DXTA 2F5KA 1Z9ZA 2RQVA 3JCMh 4J9EA 2EQKA 3VS0A 4E7ZA 1S72Q 1VQ4Q 2LQWA 2J6OA 1I4K1 1SSHA 4C92D 5LJ5g 2HD0A 3FB9A 3S3NA 3H0HA 2EYXA 3ER0A 5GAMd 3DB4A 1W6XA 4PJMA 1I8FA 1VQ7Q 1NE8A 2YUNA 4CC2A 3GBQA 1BK2A 1GFCA 3FRNA 3A1PA 2GNCA 3OYHA 3MEAA 3P8HA 4J9CA 3NTHA 5I2MA 2C0TA 1OV3A 2HL5C 2EGEA 1X27A 2K5LA 3VUZA 1YI2T 5LJ5j 3CC4T 1YJWQ 1BU1A 2DYIA 2BUDA 2ZPHB 3G7ZA 2DFUA 4KH0B 3C4SA 3BFMA 2PUKB 5GMKj 1VOMA 4PJOA 2OTLA 3JRZA 1ZLMA 4XTXA 4D6WA 1D09B 4J7IA 5D6YA 2MWPA 1QVGP 2BE7D 3PNWC 1K9MU 2AKKA 3CCRT 3LGLA 3V8LA 3WVDB 3CCVT 2MAMA 3EH1A 1OU9A 3L2QA 4MMKA 5AT1B 1H3HA 4EMGA 4M7DB 1VQNQ 1Q81C 1ZUYA 2DTHA 2K2MA 4M78G 3VU3C 1NPRA 4E7JA 2XIDA 3JSCA 1EFNA 1M1KR 2A37A 1AHJB 5KYNA 1VQKT 4LDXA 1YHQQ 5FWBA 4QQ6A 3O5ZA 4A4FA 3H6ZA 2QQRA 5HCKA 3HFNA 2BZXA 2LJ3A 2FHDA 3CCQA 1PD0A 1Y07A 2FEIA 5D6XA 3RESA 4FYVB 1B3QA 2FYKA 4E7HA 5I22A 1WGSA 1TH7A 1KC8R 4M7DD 4AT1B 2X9HA 4BACA 5CKEA 3A8GB 1AWOA 1PHTA 2HKQB 2Z0WA 3X26B 3EGXB 2C0IA 1D3BB 4KRTA 2C06A 1OI1A 3JCMe 2NUTB 3CXCP 3OYEA 1N8RC 2IPOB 4LDYA 2MCNA 4HCZA 5KH6A 2LZ6B 3CC2A 4WCIA 1QQJA 2L0AA 3RDVA 3CEYA 1RI0A 2QEXQ 1K73R 2KT1A 4M7AA 2E12A 2XHCA 1WNLA 1SHGA 2ZAEA 3GNFB 1X69A 3M0UA 3RBBB 4C5GA 3MCAB 1YITQ 1U1SA 1IGUA 3JCMV 2DYBA 2EFIA 3VS5A 1YFNA 3CCSA 3OYBA 3VV0A 1YBYA 3EGDB 2MWOA 4EPCA 5DLQE 1QVGA 5GANf 2CZ7B 1KHCA 3M0QA 2EKHA 3TREA 2KRSA 2NUZA 2BZ8A 1YN8A 4E2FB 2KE9A 3CPWP 2KSSA 2LX9A 1KK7A 5IT9E 3OW2S 3M4GA 2DTOA 1O75A 5GAMf 1KD1U 2J6KA 1VQ9T 1Q86R 1QVFS 5LL6S 5GAOl 1G83A 2X4JA 4L6V5 1FMKA 1LOJA 4PFPA 4DEXA 1VQKQ 5FRNA 1UGPB 1B7TA 1PG5B 3QO3A 3KUFA 1LNXA 4HT9A 4OMLA 1VQLQ 2QGGA 2BZYA 2JNGA 2PZ1A 2YRCA 1VQOQ 1MV3A 1LVKA 2LCSA 1X6OA 3SWNA 2D6FA 1TSFA 4PK4A 3PE0A 3CC7Q 3M0SA 4LD9K 3M54A 3E19A 4LDWA 4OB1B 2LC4A 4OB0B 4AFQC 1O9SA 3JCMd 1PC0A 4MMLA 1YIJA 1WYXA 2PU9B 3FDRA 2LDMA 4XU0A 1Y0MA 1A0NB 1WDXA 1I0CA 3X28B 4AG2C 5GAN6 2KBTA 3QG1A 1Q7YC 1ZUUA 2GBQA 2V1QA 2OAUA 2ENMA 3I56T 2QA4T 4LNPA 1ZX6A 2YRDA 4EDUA 1X01A 4C8QA 1AWJA 5L8RE 3MKDA 3CMAT 5GAMg 4MZTA 1Y96B 4OMNA 1VQ6A 3QZ5B 4ATOA 1RAGB 4FU6A 1EZZB 1PD1A 5GAOp 3M58A 4HT8A 5GANj 1BKBA 4OMMA 3CCUQ 3RIRA 1R0CB 4II1A 4BY6B 3CCMA 1M1GA 1D1BA 5KYUB 3OB9A 1M9SA 1R0BG 3OSSC 1NG2A 1YJNA 3CPWA 1WXTA 5GAMj 2MPXC 2GTJA 1HSQA 1H3ZA 2L3RA 3JB9I 1BIAA 1VQMA 3PVLA 1WHJA 1RAAB 3I55Q 3L2UA 5GAOn 2DL7A 4OVAA 1VQ8Q 3VS2A 1IHWA 1WI7A 4LD6A 4F04B 1WQ7A 1YJ9Q 2PNIA 2DETA 1UGVA 4B9WA 1FYNA 1WHGA 2P0QA 1QKXA 1VQ9Q 2ED0A 5CCAA 3JCMP 4LUDA 2HCKA 3VS4A 1SSFA 2GCXA 2RI3A 4IUTA 1WZOA 5IHIA 1I1JA 2DVJA 3M56A 4OP0A 3SHWA 4FCYA 2OTJT 1GCPA 3CD6T 1RACB 3NTKA 2P0KA 2SRCA 4BY6C 2D8HA 4M77B 3KXTA 2XDPA 3CCET 1MMGA 4J8OA 3CBPA 3QKJA 1VYUA 2YRVA 2HL3A 4JRKA 5DLOA 4FYYB 4M75G 3OSVA 3M9QA 5GAN8 2JMCA 2LNVA 1YCYA 2DILA 1D1AA 1Y71A 2CZ1B 2DNUA 4DBHA 5D7UA 5CKFA 3JCMJ 1D1CA 1IREB 2ZZDA 3Q1JA 2D1XA 2KEAA 3A8HB 3EHQA 2VKNA 4M77G 2CP3A 1ABOA 1MMDA 4M75E 4J6XA 4RTYA 4D8DA 1ZSZA 2XD0A 2R5AA 2JTFA 3EG0A 4NOYA 1GCQC 1M90R 4M75C 2QQSA 3UDCA 2FPDA 4HXJA 3EAEA 4M77E 3VS6A 4QKUA 1K8AU 1I07A 1UECA 4EMKC 1M4ZA 1RUWA 4JJDA 3VUBA 2O31A 2H8HA 2RNAA 4F7UB 2MI6A 4MDXA 4M77C 2A36A 4IUPA 3MEUA 3KFVA 1K9MR 1U5SA 3JCMf 1M2VA 2YT6A 3L2ZA 7AT1B 3EG2A 2VV5A 1VQ5A 1NLOC 5J26A 1RLQC 2RA2A 2OAWA 1VQPT 4Y91A 2DRKA 2M51A 4LDUA 4DBRA 2F5TX 4HVWA 2E4HA 5IHKA 2M0YA 3QSUA 2F69A 1NBEB 1N27A 4BDYA 2F2WA 2W10A 3TQ7P 2DL4A 3G1JA 4A54A 2DLPA 1ACMB 4Z88A 4F14A 1X6BA 2NUPA 1WHHA 1MUZA 2BTTA 5C6SA 2YUQA 4QVZA 4F7UE 4OB2B 2ROLA 3MEVA 3DLLA 1WJSA 2Y90A 3VKIA 3JCMb 2LQKA 2FVUA 3G71Q 1RAEB 4IUQA 1QP2A 2ROTA 2FPFA 4TVRA 5FW9A 1ZA1B 2CYZB 2KRNA 3PTAA 1NJIC 4PJJA 4AFUC 2CH4W 1BYMA 4XTVA 2QQAA 2SEMA 4ORZA 3VS7A 3EFOA 1TUGB 3SB2A 1I5LA 3OS1A 1WXUA 2JW4A 4N4IA 5ECAA 1UTIA 5GAN3 1C0MA 4M75F 3EHRA 2AIRB 1G3YA 2HDAA 5CO7A 4DQ2A 1K9AA 1QVFP 2JM8A 3EG3A 2COWA 5IHNA 1KSWA 3CCJQ 5GJWB 3UF4A 1MGQA 4NL2A 4JUVA 1T3LA 1HD3A 3RERA 1UDLA 4A4EA 4M77F 1Q82R 4OGEA 4MDWA 1SKUB 2HEQA 4RUGA 2RK2A 5LJ3h 2DKGA 4BD3A 4C92B 2M0OA 4M78A 4JRIA 4J83A 5GAN7 4B9XA 4FL6A 1QLYA 2LCLA 3NHNA 2JOYA 5EC7A 3CCQT 3TSZA 4ZGEB 3G4SA 3EG9A 2ZGWA 5L23A 1GL5A 4MZMA 3OBYA 2JN0A 3A5ZB 2X4XA 4GBQA 1KD1R 3R6OA 2LQ8A 4J9DA 3T9NA 1F1BB 3QBYA 3J81E 5IXBA 1ZSGA 1C1AA 3JB9H 2FZKB 2DK3A 3WVEB 3M0TA 1VQ4A 1S72A 4PJLA 2HNIA 3GIBA 1JU5C 2K6DA 4JZ4A 3VYHB 1VIEA 2M9UA 1Y7XA 3CC2T 3NFCA 4E47A 4C92E 4F7UF 3M0PA 1VQ7A 2JUFA 2JS2A 3G6EQ 4BB7A 4CC3A 2RJCA 3RNJA 2ZPIB 4HVVA 1NEBA 4C92C 3G6EA 4FT2A 1QWEA 3E2UA 4AG1C 4KULA 2GQIA 1W2BS 3UT1A 5IXFA 4LUEA 3H41A 4C5HA 1YJWA 2EQJA 4KGZB 2NUTA 4FSSA 2QXFA 5DM7R 3OW2A 1NYFA 3CCST 3TVTA 4Z8AA 3CMEQ 2J7IA 1PNJA 4BUGA 4JPBW 2RJEA 2PUOB 1JJ2S 3AHUA 2D8JA 2DD4A 1QVFA 2L89A 2KYBA 3S6WA 1M5Q1 2K7AA 2KR3A 1QMCA 2XK0A 2LRQA 5CIUA 1RADB 2GFAA 1EX4A 1AEYA 2E6ZA 1X43A 2LT4A 3QHSA 3U23A 1VQNA 1M1KC 5CKBA 1MNEA 1QP3A 1YWPA 2IIMA 4V2SA 2COZA 1GXIE 1HYOA 3OYCA 1XQHA 3QXEB 1TU0B 1K1ZA 3CCLT 3JB9D 1YHQA 5LJ5h 1PSFA 4M7DG 2RJDA 2YUPA 1M2OA 4ANJA 1EIFA 2DJQA 2L2PA 3P8BB 2I0NA 2QGFB 3IQLA 1KC8C 2HQEA 4M78D 3SFMA 1QCOA 5GMKh 4PNOA 3OA6A 3PVQA 1NZ9A 1WA7A 2CP5A 3HTRA 5A0GA 4FYXB 1BI2A 1TUDA 4VUBA 4M7DE 2WSEE 5HK0A 4J5YA 2ATCB 3GLXA 4EMHA 1OOTA 4XQ3A 4JZ3A 2J06A 4A53A 1PWTA 1YIJT 4RTWA 2NWMA 1PM3A 4R56A 3LWHA 4NS5A 1CKAA 1TXQA 3E9FA 4X9DA 1W1FA 2VASA 3OYMA 4M7DC 3JCMX 2LVMA 3M55A 3OYIA 1UE9A 3QJYA 1M3BA 3E1SA 2DX1A 1NJIU 5GJVB 4DA4A 1K73C 2R57A 2XMFA 4C92F 4FW2A 2DBMA 2QYZA 4E7KA 2QEXA 3L2VA 2E5QA 1VQ6T 1WHLA 2KQWA 4LN2A 2G3RA 1BB9A 4GY5A 2P0PA 9ATCB 1YI2Q 4J6YA 3CC4Q 4X34A 3J80E 3V7RA 5GAN2 3M0RA 4BE1A 2JZ2A 2L3QA 1YITA 3CCMT 4J9GA 4JRPA 4KUDK 1MMAA 2V1RA 3F70A 1YJNT 1QKWA 2E64A 5A2QE 4RTZA 4PJOD 2FRWA 2DXCA 3CCRQ 3CCVQ 3EG1A 2K3XA 1C6VX 4X9CA 2EQUA 2XKOC 3ME9A 3RMQA 2RI5A 2EAYA 1BI0A 1Q86C 3MJXA 1GRIA 5KE2A 1K8AR 1OU8A 4IKFA 3UWNA 2EYZA 1PKTA 2FO0A 3DLMA 2LMJA 1VYTA 2K3BA 4O6JA 3DB3A 2O9VA 3CCLQ 1VQKA 3NPFA 1UUEA 3KBGA 1X2KA 2XI9A 2RPNA 1VQLA 4DOVA 1KQ1A 1ZA2B 1VQOA 1U3OA 3JB9F 2NLUA 4OMFB 5I21A 4C5IA 2GFUA 2DF6A 3CC7A 3MHXA 4LDVA 3UA7A 2B8AA 4M7AB 3FJPA 1JB0E 1I81A 4M7DF 2K2VA 1YCSB 5GANg 2L3SA 3MP8A 4RTVA 3VS3A 4JJCA 1JBMA 2KT8A 3S3MA 1GCQA 5FU7B 1UHFA 4M75A 4ELYC 5J3BA 2KVQG 2K57A 1JXOA 4Z02A 4NL3A 3QDRB 2M02A 3SDZA 2PTKA 1E6HA 1PRMC 3V7SA 2RH2A 4EMKA 2QG9B 2E3IA 2VXEA 3ZBDA 2P4RA 4M77A 4M7AD 3BE3A 2JS0A 4O5VA 3MO8A 2H3JA 2F2XA 3OS0A 2E6NA 3OMGA 3UPUA 2DEQA 2KI7A 2DPPB 2VVKA 3PMIA 4N0AC 1SPKA 2AZVA 2AKLA 2EJ9A 3NTIA 1T0JA 2L5QA 2RJFA 4R0KA 4JS4A 2K9GA 3CCUA 2F1LA 1Q81U 2DL8A 4BE0A 1WIEA 1FWZA 4YTLA 3LW5E 2CUBA 3META 2X51A 1NPPA 2EVRA 3LLRA 4M4ZA 2GGRA 2I2LA 2CP2A 2CT3A 1VQ5T 3I55A 1OEBA 2O4XB 2ZPGB 8ATCB 2XICA 3SEMA 3A98A 1VQ8A 1RAHB 5IN1A 1RABB 3FC3A 1YJ9A 1M8MA 4J9HA 1H92A 3QUIA 1SG5A 3X24B 5KYYA 5GANh 1B34A 5KCOA 2NYSA 4JJNK 1VQ9A 1RI9A 4HVUA 3V7CA 2CZ0B 2D0NA 1UGRB 1M30A 2RF0A 4K11A 2YUOA 1UHCA 3A8LB 4FSXA 1N8RU 3QYGB 3OS5A 1G3SA 1JO8A 2DE0X 3OQ5A 2CS7A 2RI2A 1W2BP 1NYGA 1RAFB 5GAMh 1KJWA 4XTWA 4C8QB 2CDTA 4FM4B 4ELZC 1K73U 5CKHA 3ULRB 4IIMA 2MMPA 5FRMA 1OZ3A 1AOJA 2EGAA 3RKXA 2EBPA 2K3YA 1V76A 1NEGA 2RM4A 2JM9A 4CRIA 3CPFA 3LWIA 1KFZA 1CSKA 1WXBA 4A4KA 1WJRA 3I56Q 2QA4Q 2E5KA 1XTDA 2FB7A 2EGCA 1UJYA 5KYWB 2CP6A 1R77A 4PLLA 3CMAQ 2RO0A 5M9OA 3R6NA 4C8QD 2XG8D 3CQTA 3CXCS 1M90C 2A3LA 1WHMA 2DXUA 2JT4A 1Q95G 2X4YA 4J7FA 1IXDA 1FX7A 4Q5WA 4Z89A 2KRMA 4HCCA 2PVDB 5I11A 4KH1B 4KUIA 5C0MA 1ABQA 1FMWA 2ZPFB 2DMOA 3EH2A 5D6WA 4ME7A 4PL6A 3HPWA 2KDSA 2JTEA 1QW1A 3HL8A 1K9MC 4C8QC 2RHXA 1GFDA 2COYA 1N9RA 1ZUKA 3HRTA 3G4ST 4JS5A 4QW2A 1KG1A 1KQSS 1TTHB 2B86A 4XAXB 2P4TA 4F7UG 3LH0A 5GAN4 3C95A 1B07A 2OI3A 2K79A 2RQWA 1YNZA 4HCKA 2VB6A 2EYWA 4XTYA 4BI3A 4Y28E 3JCMQ 1M1FA 2EPDA 4ZNXA 1QCFA 2RQRA 3MP6A 2KYMA 1N5ZA 2HBPA 3CBMA 4KT0E 4C92A 1OYXA 1VQ4T 1S72T 4KGVB 4WTOB 1SEMA 2OTJQ 3URGA 1W2BA 3CD6Q 3BY7A 2DO3A 5KYXA 6AT1B 1Q7YU 3TEEA 4HA8A 3G71A 1SHFA 4OMPA 3CCEQ 4Y92A 1ZQ1A 4RCBA 2VXFA 1JQQA 5CQYA 2VYTA 2E1HA 1ZSZB 2WSCE 4JJBA 1V1CA 1JJ2A 4C0GA 2KMTA 5A0LA 3L1AA 3QJ6A 2DL3A 1YJWT 2QQBA 2JMAA 3JCMg 2ESWA 1RAIB 2DA9A 2X3WD 2OTLT 3OW2P 1BBZA 4HKEA 1UGSB 1IHVA 2K5FA 3S3OA 2DZ9A 2HSPA 2KY9A 1ZBJA 2ECZA 3REAB 2PQWA 1T3SA 3J7AF 3OS2A 3EFRA 3GF5A 1PSEA 1JXMA 3CCJA 1Q82C 5CK9A 1VQNT 2HAXA 4XK8E 2O9SA 4C8QF 2HSEB 3FIFA 3LYIA 1WJQA 1AWWA 1UEBA 1BCOA 1QWFA 5HKCA 2R5MA 2HQXA 2DAQA 2EYYA 3PIOA 2Y4YA 2WACA 2A0FB 2YLCA 1TUCA 2NUPB 4PLIA 3RKWA 3M4YA 3NMZC 4M7DA 1KD1C 2RMOA 1MNDA 1VQPQ 1J3TA 2FZGB 4C92G 3V8KA 4OMQA 1AZGB 1IRXA 4FT4A 4E6RA 1D0ZA 4E7IA 3A8MB 3FEOA 3LX7A 2CZ6B 4LE9A 1G8XA 3EFOB 3M57A 2EYQA 2EIFA 4RG2A 3DKMA 2CKKA 5CAIA 4CC4B 4ZN1A 2JVVA 2F2VA 2QEXT 4N4GA 2E41A 4LXCA 1OPKA 2CSIA 3EGXA 3QWYA 2QASA 3LH5A 1D3BA 4BDZA 1W70A 4PJNA 1H641 3OBWA 4RG8A 1OPLA 1AVZC 2DXBA 2QDYB 3E9GA 4BI8B 4QVDA 4IUVA 2D0QB 1M90U 4XU1A 5J39A 5FU6B 2EQMA 1YITT 2MIOA 1SRMA 2QAZA 2VGNA 3L2WA 2OTLQ 2W0ZA 1DJ7B 1AT1B 2KXCA 2O01E 3CMEA 4M78B 1BI3A 4RTTA 3EFSA 2MYSA 5CR2A 2FPEA 2YWWA 3I5SA 1D0XA 2LJ1A 4E7SA 2V26A 2M1HA 3EG9B 2LQNA 1W4SA 2PVOB 2IG0A 3JB9G 5CVIA 4QT7A 3TU4K 3BDUA 3JCMc 5LJ3e 2CT4A 1Q81R 3I35A 3EGDA 2CREA 1RL2A 1YWOA 1V29B 4F16A 4ZTFA 4A4HA 4KBMB 1IO6A 1WFWA 2FG0A 3CCQQ 2CH4A 2QQ9A 3PGGA 3H0FA 3OMCA 1LCKA 1UGQB 1VQLT 1VQOT 3PIPA 4QVCA 4M78E 4XTZA 3OYLA 5FU6C 1TOVA 5IH2A 2IVWA 2M16A 3TSWA 3CC7T 2KNBB 2WSFE 5CQXA 1M3CA 2DL5A 3L2RA 2VUBA 1JRIA 4M78C 3H8ZA 4CC7A 2CUDA 5GMKm 4IURA 1H8KA 3M59A 4L5GA 4A4GA 2E10A 3CC2Q 1TG0A 4PJOB 1N8RR 1E7OA 2KROA 4N0AA 2RHYA 3I9QA 1WX6A 1UG1A 5GAOm 3LGFA 1OX9A 2CGHA 1P92A 3QIIA 4KGXB 4GLMA 4R55A 1YI2A 3CC4A 2X35A 1RLPC 3QZ9B 1VYVA 2EWNA 4PJOG 3CCUT 2P84A 3CCSQ 2E70A 5AYFA 4B6MA 3OY9A 3GOXA 2DD5A 1G3WA 1Q82U 1N6AA 1X6GA 1KQSP 5IAYA 2V8JA 1ZHIA 1VQMT 1Y96A 2AZSA 4WF2A 4XTUA 3HSBA 2MK5A 2A28A 3CCRA 2GTOA 4PJOE 4UC4A 5HY6A 4C0ZA 3CCVA 5HK3A 5GMKl 3I55T 1SRLA 3L42A 1K8AC 4FW1A 3NGPA 5LJ3d 1VQ8T 4JLGA 1YJ9T 2MF2A 3X20B 4PJOC 1KIKA 4L59A 5KYUA 4J9FA 3GPLA 2O88A 5LJ5e 1U8RA 2ZCFB 4JLIA 3SD4A 2LP5A 2VGMA 2L8DA 1KQ2A 3OYNA 2HMAA 3H0IA 3CCLA 2X3XD 2DZCA 4C0DB 5GMKi 2DM1A 2DEUA 5GMKe 3OYGA 2FL7A 5KCHA 1IZ6A 4M78F 4A63B 1PKSA 2BE9B 2O4XA 1LPLA 3RKYA 3RR6A 4MZPA 1FXXA 3JAME 3PT9A 4PFOA 1YIJQ 1T0HA 4ZGJB 1R8OB 4D8KA 3HFOA 2QDLA 3CXCA 1SF9A 3HRSA 2K4YA 1GBQA 2RK1A 3X25B 1QCNA 1BI1A 4RMOA 4M7AG 2JXBA 5DY9A 5I2SA 3JCMW 3AT1B 1Q7YR 2H3EB 3RUXA 1Z9QA 1VQ6Q 3ZFJA
chains in the Genus database with same CATH topology
4ME7A 4PL6A 1N8RC 3HPWA 2JN0A 3A5ZB 2X4XA 2KDSA 4LDYA 1OZ2A 1QW1A 3HL8A 1K9MC 4HCZA 4C8QC 5KH6A 3R6OA 2LQ8A 2RHXA 3M5AA 2DIQA 3T9NA 3QBYA 3CC2A 4M7AE 2RD1A 3J81E 1N9RA 4C0DC 3OYFA 3CEYA 1N9SA 3HRTA 3G4ST 1RI0A 3HP9A 4JS5A 4BI4A 3JB9H 4QW2A 1KG1A 3RMSA 3CCSA 1KQSA 4M7AA 2DK3A 1KQSS 2E12A 2XHCA 2JTMA 3INZA 1WNLA 3WVEB 4XAXB 1VQ4A 1S72A 2HNIA 3GNFB 1M1KU 3GIBA 2P4TA 4F7UG 4M7AC 3LH0A 5GAN4 3ASKA 3C95A 3VYHB 1VIEA 2M9UA 2PVGB 1Y7XA 3CC2T 3NFCA 4E47A 4C92E 4F7UF 1VQ7A 4C5GA 4XTYA 3SWNB 1KHIA 2JUFA 2ZPEB 4Y28E 4BI3A 3MCAB 3JCMQ 1M1FA 2XDBA 1WQWA 1U1SA 5FU7C 4BB7A 2RJCA 3MP6A 3JCMV 4PJOF 2EFIA 2HBPA 3CBMA 4KT0E 4C92A 1OYXA 2ZPIB 1VQ4T 1S72T 4M7DC 1KC8U 4C92C 3OYBA 2LT1A 3VV0A 1YBYA 3OYKA 2MWOA 3C12A 5DLQE 4EPCA 1QVGS 1QVGA 5GANf 3G6EA 4FT2A 3URGA 1W2BA 4KULA 2CZ7B 1W2BS 1KHCA 4GLKA 3BY7A 5LJ5d 3UT1A 3TREA 4F7UA 2DO3A 5EG2A 1XNIA 3O8VA 4C5HA 1YJWA 5FROA 1Q7YU 3TEEA 2KSSA 1HXDA 2EQJA 2LX9A 4HA8A 5IT9E 3G71A 2QXFA 2DTIA 5DM7R 3OW2A 3OW2S 1ZQ1A 3M4GA 4RCBA 2VXFA 3CCST 2DTOA 5CQYA 2VYTA 2E1HA 2WSCE 1O75A 4BUGA 2LTOA 5GAMf 1KD1U 1JJ2A 2RJEA 2PUOB 4C0GA 1JJ2S 2KMTA 5A0LA 2DD4A 4M75B 3AHUA 3L1AA 4DOWA 1VQ9T 3HRUA 3P8DA 4IUUA 1QVFA 2L89A 3QJ6A 1QVFS 1HK9A 5LL6S 3S6WA 5GAOl 1M5Q1 3GNGA 1YJWT 2QQBA 3JCMg 1G5VA 3M53A 2XK0A 2LRQA 2X4JA 4L6V5 3G71T 4HCBA 1LOJA 5CIUA 2GFAA 2OTLT 2GF7A 5FRNA 1UGPB 4EMKB 2LT4A 2E6ZA 1UGSB 3KUFA 1LNXA 3QO3A 4HKEA 3QHSA 3V8JA 2K5FA 4RKUE 2QTXA 4HT9A 1VQNA 1M1KC 5CKBA 1QP3A 2JNGA 3S3OA 2DZ9A 4V2SA 1X6OA 3SWNA 4ZGDB 2D6FA 2KY9A 5GAOq 3PMTA 3SWNC 1GXIE 3OYCA 1XQHA 2PQWA 3QXEB 3J7AF 3CCLT 3JB9D 3OS2A 3EFRA 1YHQA 3GF5A 1PSEA 5LJ5h 1PSFA 4LD9K 4C8QG 3M54A 4XU3A 1ZBXA 3CCJA 1WPYA 4M7DG 2RJDA 4M75D 1EIFA 1Q82C 2RHIA 3E19A 4LDWA 2LC4A 3MP1A 3P8BB 4OB1B 5LJ3f 5CK9A 3I56A 4OB0B 2QA4A 2YHTA 3HKSA 4E7LA 1VQNT 4OGCA 1KC8C 2HAXA 1O9SA 4XK8E 2HQEA 4C5EA 4M78D 3JCMd 4C8QF 2GQVA 4MMLA 3FIFA 1YIJA 2PU9B 3FDRA 4XU0A 2LDMA 3SFMA 3LYIA 1WJQA 5GMKh 1UEBA 4PNOA 3X28B 3CMAA 5GAN6 3OA6A 1Q7YC 3VYGA 1NZ9A 5A0GA 2YLBA 5HKCA 2R5MA 4M77D 1BI2A 3QG1A 4C8QE 4VUBA 3QYHB 2HQXA 2DAQA 2WSEE 2ZPBB 3PIOA 2Y4YA 5HK0A 3CCJT 4J5YA 2WACA 3GLXA 4EMHA 2EJGA 2OAUA 3I56T 4M7AF 2QA4T 2YLCA 4XQ3A 4PLIA 3BDLA 3RKWA 3M4YA 2K5IA 4A53A 4EDUA 1X01A 1YIJT 4C8QA 4R56A 3C94A 3LWHA 5L8RE 4NS5A 4X9DA 1Q86U 3E9FA 1KD1C 4M7DA 3OYMA 3CMAT 5GAMg 3JCMX 2LVMA 1Y96B 3M55A 4MZTA 3OYIA 3QZ5B 4JDSA 1VQ6A 4ATOA 3QJYA 4FU6A 4C92G 5GAOp 3WXMB 3V8KA 1B34B 3E1SA 3M58A 4HT8A 4FT4A 5GANj 1NJIU 4QQDA 1VIFA 4DA4A 1BKBA 1K73C 2R57A 4J6WA 2EKOA 4C92F 2RHZA 4E7IA 1UB4A 3A8MB 4E7KA 3FEOA 3RIRA 4FIBA 4CI0C 2KAFA 4II1A 1X75C 2QEXA 4BY6B 3L2VA 3MEWA 3CCMA 1M1GA 2E5QA 1VQ6T 3LX7A 4PJOE 2KQWA 2CZ6B 3OB9A 2G3RA 1M9SA 4GY5A 4RCCA 4E7HA 2P0PA 3OSSC 5KE3A 4XU2A 1YJNA 3M57A 2EYQA 3CPWA 2EIFA 2V8KA 4RG2A 5GAMj 3CPWS 4J6YA 3DKMA 5GANe 2CKKA 4X34A 3J80E 3V7RA 5GAN2 5CAIA 4C0FA 4ZN1A 1H3ZA 4BE1A 2JVVA 2X4WA 3OYDA 2L3RA 3JB9I 2JZ2A 1BIAA 2QEXT 1VQMA 1YITA 3CCMT 4N4GA 2E41A 5LJ3g 3L2UA 4QQGA 4JRPA 5GAOn 4KUDK 2R58A 4OVAA 3F70A 5GAOr 1VQ7T 1YJNT 4LD6A 1WQ7A 1D3BA 4BDZA 2E64A 5A2QE 1H641 1LJOA 3OBWA 3OYYA 3E9GA 2DXBA 2QDYB 4OF1A 4RG8A 4B9WA 4PJOD 2OTJA 5GAMe 4BI8B 3CD6A 2DXCA 2P0QA 3TCJA 3JB9J 4QVDA 4IUVA 2D0QB 2K3XA 1M90U 4X9CA 2EQUA 2XKOC 4XU1A 5CCAA 3N5BB 5J39A 5FU6B 2EQMA 2EJFA 3G6ET 3JCMP 1YITT 3ME9A 3RMQA 4P5NA 1SSFA 2GCXA 2RI3A 3CCEA 2RI5A 4IUTA 2EAYA 2DVEA 2AHJB 2QI2A 2VGNA 3M56A 3L2WA 1BI0A 1Q86C 4OP0A 4PKCC 2V8IA 1DJ7B 5LJ3j 3CMEA 2O01E 3A8OB 4M78B 2OTJT 1BI3A 5KE2A 5A0DA 3QPHA 3EFSA 4ZN3A 3UWNA 4IKFA 3CD6T 5CR2A 3NTKA 1XOVA 2P0KA 4M7DF 3DLMA 4BY6C 3PFSA 4M77B 3KXTA 2XDPA 4O6JA 3DB3A 2M1HA 3CCET 3GP8A 1VQKA 4J8OA 1W4SA 3CBPA 2PVOB 2IG0A 3QKJA 2YRVA 3KBGA 3JB9G 5CVIA 2XU8A 3TU4K 3BDUA 2XI9A 3CMET 1G3TA 3JCMc 4JRKA 1VQLA 5DLOA 4DOVA 5LJ3e 5LJ5f 1KQ1A 4M75G 3OSVA 3M9QA 5GAN8 1VQOA 1BIBA 3ZEHA 2LNVA 3JB9F 1YCYA 2NLUA 1RL2A 1Y71A 2CZ1B 4OMFB 5I21A 3BW1A 4C5IA 2GFUA 1V29B 1MHNA 1QVPA 5CKFA 3CC7A 4ZTFA 4A4HA 3MHXA 4LDVA 4KBMB 2B8AA 4M7AB 3FJPA 3JCMJ 1M8VA 1IREB 1JB0E 1I81A 2RHUA 2ZZDA 2BKDN 2QQ9A 2K2VA 3PGGA 3Q1JA 5CKDA 3A8HB 3OMCA 5GANg 4M77G 1UGQB 1VQLT 4M75E 3MP8A 2A7YA 1VQOT 3PIPA 4QVCA 1YHQT 4ZTJA 1VUBA 4J6XA 2DJZA 1JBMA 4OB3B 2VC8A 4M78E 4XTZA 2XD0A 2R5AA 3OYLA 5FU6C 2JTFA 3S3MA 4NOYA 5FU7B 3VJPA 2IVWA 2KK4A 2M16A 3CC7T 4M75A 2E65A 4ELYC 2WSFE 5CQXA 4M75C 5J3BA 2KVQG 2QQSA 2K57A 3UDCA 3OYJA 3L2RA 2VUBA 4Z02A 4NL3A 3EAEA 1U1TA 1JRIA 2Y4XA 3QDRB 4M77E 3SDZA 4M78C 5GAN5 2XDDA 3H8ZA 3V7SA 2RH2A 5GMKm 1K8AU 5FLXE 4EMKA 3CBOA 4JRQA 4EMKC 1M4ZA 2VXEA 2RB6A 3ZBDA 2LCCA 4IURA 3VUBA 4F7UB 4M77A 2D9TA 3M59A 4M7AD 4L5GA 2MI6A 4MDXA 2BIVA 4M77C 2E10A 4O5VA 4A4GA 3MO8A 1VQPA 5GANd 2H3JA 4IUPA 2DIGA 3MEUA 4PJOB 3OS0A 4M7DE 4N4HA 2E6NA 3OMGA 3UPUA 2RHYA 2DEQA 3FLGA 3HHTB 2DPPB 4N0AA 3JCMf 2DXTA 3PMIA 3L2ZA 4BE2A 4N0AC 2F5KA 1M90C 2EJ9A 3NTIA 2L5QA 2RJFA 3JCMh 2VV5A 5GAOm 4JS4A 3CCUA 2EQKA 3LGFA 1Q81U 1VQ5A 2CGHA 1I4K1 1P92A 3QIIA 4BE0A 4C92D 5J26A 5LJ5g 1FWZA 2HD0A 2RA2A 3FB9A 4YTLA 3S3NA 4Y91A 1VQPT 4LDUA 3LW5E 2F5TX 5GAMd 3ER0A 4R55A 3DB4A 3META 1I8FA 1NE8A 1YI2A 1NPPA 3LLRA 3CC4A 2X35A 3QSUA 2F69A 3QZ9B 1N27A 2I2LA 4BDYA 2EWNA 4PJOG 3CCUT 3FRNA 1VQ5T 3OYHA 3MEAA 4A54A 2E70A 5AYFA 3GOXA 3OY9A 3I55A 2DD5A 2ZPGB 2O4XB 3NTHA 3P8HA 1G3WA 5I2MA 1Q82U 1N6AA 5C6SA 2XICA 2K5LA 1VQ8A 5IAYA 4QVZA 5IN1A 3FC3A 1YJ9A 3VUZA 2V8JA 4F7UE 1ZHIA 1VQMT 4OB2B 1YI2T 1Y96A 4WF2A 4XTUA 5LJ5j 3MEVA 3CC4T 3DLLA 3QUIA 3HSBA 1WJSA 2Y90A 3VKIA 3JCMb 3X24B 2LQKA 2FVUA 5GANh 3CCRA 1B34A 2BUDA 5KCOA 4UC4A 5HY6A 2ZPHB 4IUQA 3G7ZA 1QP2A 4C0ZA 3CCVA 4JJNK 1VQ9A 3V7CA 5HK3A 2CZ0B 3C4SA 5GMKl 3I55T 3BFMA 3L42A 2PUKB 1K8AC 4TVRA 1UGRB 5GMKj 2CYZB 5LJ3d 3PTAA 1NJIC 4JLGA 1VQ8T 4PJOA 2OTLA 3JRZA 1YJ9T 4XTXA 2MF2A 3X20B 4D6WA 5D6YA 4J7IA 4PJOC 1BYMA 2MWPA 3A8LB 4FSXA 4XTVA 4L59A 1N8RU 2QQAA 3QYGB 3OS5A 1G3SA 3PNWC 1K9MU 3OQ5A 3CCRT 3LGLA 2CS7A 2RI2A 3V8LA 3WVDB 5LJ5e 2ZCFB 3GPLA 3CCVT 2MAMA 5GAMh 1U8RA 3SB2A 3L2QA 4MMKA 4XTWA 1I5LA 4JLIA 3OS1A 4C8QB 3SD4A 2VGMA 1KQ2A 2L8DA 4EMGA 4M7DB 3OYNA 4FM4B 4ELZC 4N4IA 1K73U 5CKHA 1Q81C 3CCLA 2MMPA 2DZCA 4C0DB 5GAN3 2DTHA 5FRMA 1OZ3A 5GMKi 3RKXA 5GMKe 4M78G 3VU3C 1NPRA 4E7JA 2K3YA 4M75F 3OYGA 2XIDA 2RM4A 3JSCA 4CRIA 1AHJB 1G3YA 2FL7A 3CPFA 1VQKT 4LDXA 5KCHA 1IZ6A 3LWIA 5CO7A 4M78F 4DQ2A 4QQ6A 2O4XA 4A4FA 3H6ZA 3RKYA 2QQRA 4A4KA 1WJRA 1MGQA 4MZPA 1FXXA 3JAME 4NL2A 3HFNA 4JUVA 1XTDA 2FHDA 3CCQA 3RERA 1Y07A 2FB7A 3PT9A 4A4EA 4M77F 4ZGJB 1R8OB 5D6XA 3RESA 4PLLA 4OGEA 4MDWA 3HFOA 2RO0A 5M9OA 3CXCA 2FYKA 2RK2A 2XG8D 1WGSA 1TH7A 2DKGA 5LJ3h 4C8QD 3CXCS 2A3LA 2DXUA 3HRSA 2K4YA 4M7DD 4BD3A 4C92B 2M0OA 2RK1A 2X4YA 4M78A 4BACA 3OYAA 4JRIA 3X25B 4J7FA 5CKEA 3A8GB 4J83A 1FX7A 4B9XA 5GAN7 4Q5WA 4FL6A 1BI1A 4RMOA 2PVDB 2LCLA 4HCCA 4M7AG 5DY9A 2JOYA 3CCQT 5I2SA 3X26B 4KUIA 4ZGEB 3G4SA 3JCMW 5C0MA 1D3BB 2C06A 2ZPFB 1OI1A 3RUXA 2ZGWA 3JCMe 4MZMA 3ZFJA 5D6WA 3OYEA 3OBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VJP A;  3VKI A;  3TEE A;  3FRN A; 
#chains in the Genus database with same CATH topology
 1TWB A;  1OZ2 A;  1K0S A;  3M5A A;  2DIQ A;  4M7A E;  2RD1 A;  4EIK A;  3REB B;  4C0D C;  8AT1 B;  3OYF A;  1N9S A;  1WHK A;  3HP9 A;  2DBK A;  4BI4 A;  3CCM Q;  4PFZ A;  3RMS A;  2CP7 A;  1KQS A;  3QDF A;  1AD5 A;  2AT1 B;  2JTM A;  3INZ A;  1MV0 B;  2J05 A;  1M1K U;  4M7A C;  1YJN Q;  3ASK A;  1IGQ A;  2PVG B;  2KXD A;  2O2O A;  1NM7 A;  3SWN B;  1KHI A;  1UFF A;  2ZPE B;  4DBF A;  5KYW A;  1XJW B;  1VQM Q;  2XDB A;  2EW3 A;  1WQW A;  5FU7 C;  4AFZ C;  1K76 A;  4J9B A;  4PJO F;  2EQI A;  4J9I A;  1KC8 U;  2LT1 A;  3OYK A;  3C12 A;  3ZL7 C;  3VS1 A;  1QVG S;  2KGT A;  2VWF A;  4GLK A;  5LJ5 d;  4F7U A;  1YP5 A;  5EG2 A;  1XNI A;  3O8V A;  5FRO A;  1HXD A;  2ABL A;  2DTI A;  2YXY A;  3EGU A;  3VRY A;  2LTO A;  4M75 B;  4DOW A;  1Y57 A;  3HRU A;  3P8D A;  4IUU A;  1HK9 A;  1S1N A;  3C0C A;  3GNG A;  1WLP B;  1G5V A;  3JV3 A;  3M53 A;  4RTX A;  3THK A;  3G71 T;  4HCB A;  2GF7 A;  4EMK B;  1OX8 A;  3V8J A;  4RKU E;  2QTX A;  1JJ2 P;  3QWX X;  4ZGD B;  5GAO q;  3PMT A;  3SWN C;  1VA7 A;  4C8Q G;  4XU3 A;  1ZBX A;  1WPY A;  2MOX A;  4M75 D;  4X1V A;  2RHI A;  5LJ3 f;  2HKN A;  3MP1 A;  3I56 A;  4E7L A;  2QA4 A;  2YHT A;  3HKS A;  4OGC A;  4C5E A;  1UJ0 A;  2RQU A;  2GQV A;  3CMA A;  2C0O A;  3VYG A;  2QTV A;  1CKB A;  2QK0 A;  2YLB A;  4M77 D;  4C8Q E;  3CCJ T;  3QYH B;  2ZPB B;  1K0X A;  2EJG A;  4M7A F;  3BDL A;  3I5R A;  2FRY A;  2K5I A;  3C94 A;  1Q86 U;  2HBW A;  4JDS A;  1D0Y A;  2AK5 A;  5FWC A;  5KYY B;  3WXM B;  1B34 B;  4QQD A;  1VIF A;  4J6W A;  1MMN A;  2EKO A;  2RHZ A;  1UB4 A;  1NLP C;  1JEG A;  1VQ5 Q;  4FIB A;  4CI0 C;  2KAF A;  2JJ9 A;  1X75 C;  3MEW A;  1OUL A;  3VRZ A;  1M3A A;  4RCC A;  5KE3 A;  2E3H A;  4XU2 A;  2V8K A;  3CPW S;  5GAN e;  1E6G A;  4C0F A;  1ARK A;  2X4W A;  4ESR A;  3OYD A;  3MPU B;  1GBR A;  5LJ3 g;  4QQG A;  4FYW B;  2R58 A;  2OX7 A;  5GAO r;  1VQ7 T;  1HJD A;  4AFS C;  2CP0 A;  1LJO A;  4OF1 A;  3OYY A;  4AMC A;  2OTJ A;  3D7S B;  5GAM e;  3CD6 A;  2HZY A;  3TCJ A;  3JB9 J;  1OQK A;  3N5B B;  2EJF A;  3G6E T;  3FJ5 A;  4P5N A;  3CCE A;  2DVE A;  2AHJ B;  2QI2 A;  4PKC C;  2V8I A;  1IB8 A;  1K4U S;  5LJ3 j;  3A8O B;  5A0D A;  3QPH A;  4ZN3 A;  2RQT A;  1NJI R;  1XOV A;  1M27 C;  1PCX A;  2J6F A;  4IIO A;  3PFS A;  4DBQ A;  1FMV A;  3GP8 A;  4OMO A;  2DRM A;  2ED1 A;  2XU8 A;  3CME T;  1G3T A;  1I5O B;  5LJ5 f;  1M2V B;  1BIB A;  3ZEH A;  1G2B A;  3BW1 A;  1U06 A;  1MHN A;  1QVP A;  2FZC B;  1AWX A;  2YSQ A;  1M8V A;  2G6F X;  2RHU A;  5CKD A;  2BKD N;  3OYA A;  2DER A;  4F17 A;  2RN8 A;  3H9N A;  1X2Q A;  2A7Y A;  1YHQ T;  1PRL C;  4ZTJ A;  1VUB A;  1AZE A;  2DJZ A;  4OB3 B;  2VC8 A;  2L3P A;  1ZSZ C;  3VJP A;  2KK4 A;  2E65 A;  2LX7 A;  2A08 A;  3OYJ A;  2YDL A;  3G4S Q;  1U1T A;  2Y4X A;  5GAN 5;  2XDD A;  2LJ0 A;  5FLX E;  3CBO A;  4DEY A;  4RTU A;  4JRQ A;  2CSQ A;  2RB6 A;  2LCC A;  3UA6 A;  2D9T A;  5KYX B;  2BIV A;  2OJ2 A;  1VQP A;  5GAN d;  2DIG A;  3UAT A;  1TS9 A;  2LNH B;  4N4H A;  3HHT B;  3FLG A;  1BCM A;  2HQH A;  4BE2 A;  2DXT A;  2F5K A;  1Z9Z A;  2RQV A;  3JCM h;  4J9E A;  2EQK A;  3VS0 A;  4E7Z A;  1S72 Q;  1VQ4 Q;  2LQW A;  2J6O A;  1I4K 1;  1SSH A;  4C92 D;  5LJ5 g;  2HD0 A;  3FB9 A;  3S3N A;  3H0H A;  2EYX A;  3ER0 A;  5GAM d;  3DB4 A;  1W6X A;  4PJM A;  1I8F A;  1VQ7 Q;  1NE8 A;  2YUN A;  4CC2 A;  3GBQ A;  1BK2 A;  1GFC A;  3FRN A;  3A1P A;  2GNC A;  3OYH A;  3MEA A;  3P8H A;  4J9C A;  3NTH A;  5I2M A;  2C0T A;  1OV3 A;  2HL5 C;  2EGE A;  1X27 A;  2K5L A;  3VUZ A;  1YI2 T;  5LJ5 j;  3CC4 T;  1YJW Q;  1BU1 A;  2DYI A;  2BUD A;  2ZPH B;  3G7Z A;  2DFU A;  4KH0 B;  3C4S A;  3BFM A;  2PUK B;  5GMK j;  1VOM A;  4PJO A;  2OTL A;  3JRZ A;  1ZLM A;  4XTX A;  4D6W A;  1D09 B;  4J7I A;  5D6Y A;  2MWP A;  1QVG P;  2BE7 D;  3PNW C;  1K9M U;  2AKK A;  3CCR T;  3LGL A;  3V8L A;  3WVD B;  3CCV T;  2MAM A;  3EH1 A;  1OU9 A;  3L2Q A;  4MMK A;  5AT1 B;  1H3H A;  4EMG A;  4M7D B;  1VQN Q;  1Q81 C;  1ZUY A;  2DTH A;  2K2M A;  4M78 G;  3VU3 C;  1NPR A;  4E7J A;  2XID A;  3JSC A;  1EFN A;  1M1K R;  2A37 A;  1AHJ B;  5KYN A;  1VQK T;  4LDX A;  1YHQ Q;  5FWB A;  4QQ6 A;  3O5Z A;  4A4F A;  3H6Z A;  2QQR A;  5HCK A;  3HFN A;  2BZX A;  2LJ3 A;  2FHD A;  3CCQ A;  1PD0 A;  1Y07 A;  2FEI A;  5D6X A;  3RES A;  4FYV B;  1B3Q A;  2FYK A;  4E7H A;  5I22 A;  1WGS A;  1TH7 A;  1KC8 R;  4M7D D;  4AT1 B;  2X9H A;  4BAC A;  5CKE A;  3A8G B;  1AWO A;  1PHT A;  2HKQ B;  2Z0W A;  3X26 B;  3EGX B;  2C0I A;  1D3B B;  4KRT A;  2C06 A;  1OI1 A;  3JCM e;  2NUT B;  3CXC P;  3OYE A;  1N8R C;  2IPO B;  4LDY A;  2MCN A;  4HCZ A;  5KH6 A;  2LZ6 B;  3CC2 A;  4WCI A;  1QQJ A;  2L0A A;  3RDV A;  3CEY A;  1RI0 A;  2QEX Q;  1K73 R;  2KT1 A;  4M7A A;  2E12 A;  2XHC A;  1WNL A;  1SHG A;  2ZAE A;  3GNF B;  1X69 A;  3M0U A;  3RBB B;  4C5G A;  3MCA B;  1YIT Q;  1U1S A;  1IGU A;  3JCM V;  2DYB A;  2EFI A;  3VS5 A;  1YFN A;  3CCS A;  3OYB A;  3VV0 A;  1YBY A;  3EGD B;  2MWO A;  4EPC A;  5DLQ E;  1QVG A;  5GAN f;  2CZ7 B;  1KHC A;  3M0Q A;  2EKH A;  3TRE A;  2KRS A;  2NUZ A;  2BZ8 A;  1YN8 A;  4E2F B;  2KE9 A;  3CPW P;  2KSS A;  2LX9 A;  1KK7 A;  5IT9 E;  3OW2 S;  3M4G A;  2DTO A;  1O75 A;  5GAM f;  1KD1 U;  2J6K A;  1VQ9 T;  1Q86 R;  1QVF S;  5LL6 S;  5GAO l;  1G83 A;  2X4J A;  4L6V 5;  1FMK A;  1LOJ A;  4PFP A;  4DEX A;  1VQK Q;  5FRN A;  1UGP B;  1B7T A;  1PG5 B;  3QO3 A;  3KUF A;  1LNX A;  4HT9 A;  4OML A;  1VQL Q;  2QGG A;  2BZY A;  2JNG A;  2PZ1 A;  2YRC A;  1VQO Q;  1MV3 A;  1LVK A;  2LCS A;  1X6O A;  3SWN A;  2D6F A;  1TSF A;  4PK4 A;  3PE0 A;  3CC7 Q;  3M0S A;  4LD9 K;  3M54 A;  3E19 A;  4LDW A;  4OB1 B;  2LC4 A;  4OB0 B;  4AFQ C;  1O9S A;  3JCM d;  1PC0 A;  4MML A;  1YIJ A;  1WYX A;  2PU9 B;  3FDR A;  2LDM A;  4XU0 A;  1Y0M A;  1A0N B;  1WDX A;  1I0C A;  3X28 B;  4AG2 C;  5GAN 6;  2KBT A;  3QG1 A;  1Q7Y C;  1ZUU A;  2GBQ A;  2V1Q A;  2OAU A;  2ENM A;  3I56 T;  2QA4 T;  4LNP A;  1ZX6 A;  2YRD A;  4EDU A;  1X01 A;  4C8Q A;  1AWJ A;  5L8R E;  3MKD A;  3CMA T;  5GAM g;  4MZT A;  1Y96 B;  4OMN A;  1VQ6 A;  3QZ5 B;  4ATO A;  1RAG B;  4FU6 A;  1EZZ B;  1PD1 A;  5GAO p;  3M58 A;  4HT8 A;  5GAN j;  1BKB A;  4OMM A;  3CCU Q;  3RIR A;  1R0C B;  4II1 A;  4BY6 B;  3CCM A;  1M1G A;  1D1B A;  5KYU B;  3OB9 A;  1M9S A;  1R0B G;  3OSS C;  1NG2 A;  1YJN A;  3CPW A;  1WXT A;  5GAM j;  2MPX C;  2GTJ A;  1HSQ A;  1H3Z A;  2L3R A;  3JB9 I;  1BIA A;  1VQM A;  3PVL A;  1WHJ A;  1RAA B;  3I55 Q;  3L2U A;  5GAO n;  2DL7 A;  4OVA A;  1VQ8 Q;  3VS2 A;  1IHW A;  1WI7 A;  4LD6 A;  4F04 B;  1WQ7 A;  1YJ9 Q;  2PNI A;  2DET A;  1UGV A;  4B9W A;  1FYN A;  1WHG A;  2P0Q A;  1QKX A;  1VQ9 Q;  2ED0 A;  5CCA A;  3JCM P;  4LUD A;  2HCK A;  3VS4 A;  1SSF A;  2GCX A;  2RI3 A;  4IUT A;  1WZO A;  5IHI A;  1I1J A;  2DVJ A;  3M56 A;  4OP0 A;  3SHW A;  4FCY A;  2OTJ T;  1GCP A;  3CD6 T;  1RAC B;  3NTK A;  2P0K A;  2SRC A;  4BY6 C;  2D8H A;  4M77 B;  3KXT A;  2XDP A;  3CCE T;  1MMG A;  4J8O A;  3CBP A;  3QKJ A;  1VYU A;  2YRV A;  2HL3 A;  4JRK A;  5DLO A;  4FYY B;  4M75 G;  3OSV A;  3M9Q A;  5GAN 8;  2JMC A;  2LNV A;  1YCY A;  2DIL A;  1D1A A;  1Y71 A;  2CZ1 B;  2DNU A;  4DBH A;  5D7U A;  5CKF A;  3JCM J;  1D1C A;  1IRE B;  2ZZD A;  3Q1J A;  2D1X A;  2KEA A;  3A8H B;  3EHQ A;  2VKN A;  4M77 G;  2CP3 A;  1ABO A;  1MMD A;  4M75 E;  4J6X A;  4RTY A;  4D8D A;  1ZSZ A;  2XD0 A;  2R5A A;  2JTF A;  3EG0 A;  4NOY A;  1GCQ C;  1M90 R;  4M75 C;  2QQS A;  3UDC A;  2FPD A;  4HXJ A;  3EAE A;  4M77 E;  3VS6 A;  4QKU A;  1K8A U;  1I07 A;  1UEC A;  4EMK C;  1M4Z A;  1RUW A;  4JJD A;  3VUB A;  2O31 A;  2H8H A;  2RNA A;  4F7U B;  2MI6 A;  4MDX A;  4M77 C;  2A36 A;  4IUP A;  3MEU A;  3KFV A;  1K9M R;  1U5S A;  3JCM f;  1M2V A;  2YT6 A;  3L2Z A;  7AT1 B;  3EG2 A;  2VV5 A;  1VQ5 A;  1NLO C;  5J26 A;  1RLQ C;  2RA2 A;  2OAW A;  1VQP T;  4Y91 A;  2DRK A;  2M51 A;  4LDU A;  4DBR A;  2F5T X;  4HVW A;  2E4H A;  5IHK A;  2M0Y A;  3QSU A;  2F69 A;  1NBE B;  1N27 A;  4BDY A;  2F2W A;  2W10 A;  3TQ7 P;  2DL4 A;  3G1J A;  4A54 A;  2DLP A;  1ACM B;  4Z88 A;  4F14 A;  1X6B A;  2NUP A;  1WHH A;  1MUZ A;  2BTT A;  5C6S A;  2YUQ A;  4QVZ A;  4F7U E;  4OB2 B;  2ROL A;  3MEV A;  3DLL A;  1WJS A;  2Y90 A;  3VKI A;  3JCM b;  2LQK A;  2FVU A;  3G71 Q;  1RAE B;  4IUQ A;  1QP2 A;  2ROT A;  2FPF A;  4TVR A;  5FW9 A;  1ZA1 B;  2CYZ B;  2KRN A;  3PTA A;  1NJI C;  4PJJ A;  4AFU C;  2CH4 W;  1BYM A;  4XTV A;  2QQA A;  2SEM A;  4ORZ A;  3VS7 A;  3EFO A;  1TUG B;  3SB2 A;  1I5L A;  3OS1 A;  1WXU A;  2JW4 A;  4N4I A;  5ECA A;  1UTI A;  5GAN 3;  1C0M A;  4M75 F;  3EHR A;  2AIR B;  1G3Y A;  2HDA A;  5CO7 A;  4DQ2 A;  1K9A A;  1QVF P;  2JM8 A;  3EG3 A;  2COW A;  5IHN A;  1KSW A;  3CCJ Q;  5GJW B;  3UF4 A;  1MGQ A;  4NL2 A;  4JUV A;  1T3L A;  1HD3 A;  3RER A;  1UDL A;  4A4E A;  4M77 F;  1Q82 R;  4OGE A;  4MDW A;  1SKU B;  2HEQ A;  4RUG A;  2RK2 A;  5LJ3 h;  2DKG A;  4BD3 A;  4C92 B;  2M0O A;  4M78 A;  4JRI A;  4J83 A;  5GAN 7;  4B9X A;  4FL6 A;  1QLY A;  2LCL A;  3NHN A;  2JOY A;  5EC7 A;  3CCQ T;  3TSZ A;  4ZGE B;  3G4S A;  3EG9 A;  2ZGW A;  5L23 A;  1GL5 A;  4MZM A;  3OBY A;  2JN0 A;  3A5Z B;  2X4X A;  4GBQ A;  1KD1 R;  3R6O A;  2LQ8 A;  4J9D A;  3T9N A;  1F1B B;  3QBY A;  3J81 E;  5IXB A;  1ZSG A;  1C1A A;  3JB9 H;  2FZK B;  2DK3 A;  3WVE B;  3M0T A;  1VQ4 A;  1S72 A;  4PJL A;  2HNI A;  3GIB A;  1JU5 C;  2K6D A;  4JZ4 A;  3VYH B;  1VIE A;  2M9U A;  1Y7X A;  3CC2 T;  3NFC A;  4E47 A;  4C92 E;  4F7U F;  3M0P A;  1VQ7 A;  2JUF A;  2JS2 A;  3G6E Q;  4BB7 A;  4CC3 A;  2RJC A;  3RNJ A;  2ZPI B;  4HVV A;  1NEB A;  4C92 C;  3G6E A;  4FT2 A;  1QWE A;  3E2U A;  4AG1 C;  4KUL A;  2GQI A;  1W2B S;  3UT1 A;  5IXF A;  4LUE A;  3H41 A;  4C5H A;  1YJW A;  2EQJ A;  4KGZ B;  2NUT A;  4FSS A;  2QXF A;  5DM7 R;  3OW2 A;  1NYF A;  3CCS T;  3TVT A;  4Z8A A;  3CME Q;  2J7I A;  1PNJ A;  4BUG A;  4JPB W;  2RJE A;  2PUO B;  1JJ2 S;  3AHU A;  2D8J A;  2DD4 A;  1QVF A;  2L89 A;  2KYB A;  3S6W A;  1M5Q 1;  2K7A A;  2KR3 A;  1QMC A;  2XK0 A;  2LRQ A;  5CIU A;  1RAD B;  2GFA A;  1EX4 A;  1AEY A;  2E6Z A;  1X43 A;  2LT4 A;  3QHS A;  3U23 A;  1VQN A;  1M1K C;  5CKB A;  1MNE A;  1QP3 A;  1YWP A;  2IIM A;  4V2S A;  2COZ A;  1GXI E;  1HYO A;  3OYC A;  1XQH A;  3QXE B;  1TU0 B;  1K1Z A;  3CCL T;  3JB9 D;  1YHQ A;  5LJ5 h;  1PSF A;  4M7D G;  2RJD A;  2YUP A;  1M2O A;  4ANJ A;  1EIF A;  2DJQ A;  2L2P A;  3P8B B;  2I0N A;  2QGF B;  3IQL A;  1KC8 C;  2HQE A;  4M78 D;  3SFM A;  1QCO A;  5GMK h;  4PNO A;  3OA6 A;  3PVQ A;  1NZ9 A;  1WA7 A;  2CP5 A;  3HTR A;  5A0G A;  4FYX B;  1BI2 A;  1TUD A;  4VUB A;  4M7D E;  2WSE E;  5HK0 A;  4J5Y A;  2ATC B;  3GLX A;  4EMH A;  1OOT A;  4XQ3 A;  4JZ3 A;  2J06 A;  4A53 A;  1PWT A;  1YIJ T;  4RTW A;  2NWM A;  1PM3 A;  4R56 A;  3LWH A;  4NS5 A;  1CKA A;  1TXQ A;  3E9F A;  4X9D A;  1W1F A;  2VAS A;  3OYM A;  4M7D C;  3JCM X;  2LVM A;  3M55 A;  3OYI A;  1UE9 A;  3QJY A;  1M3B A;  3E1S A;  2DX1 A;  1NJI U;  5GJV B;  4DA4 A;  1K73 C;  2R57 A;  2XMF A;  4C92 F;  4FW2 A;  2DBM A;  2QYZ A;  4E7K A;  2QEX A;  3L2V A;  2E5Q A;  1VQ6 T;  1WHL A;  2KQW A;  4LN2 A;  2G3R A;  1BB9 A;  4GY5 A;  2P0P A;  9ATC B;  1YI2 Q;  4J6Y A;  3CC4 Q;  4X34 A;  3J80 E;  3V7R A;  5GAN 2;  3M0R A;  4BE1 A;  2JZ2 A;  2L3Q A;  1YIT A;  3CCM T;  4J9G A;  4JRP A;  4KUD K;  1MMA A;  2V1R A;  3F70 A;  1YJN T;  1QKW A;  2E64 A;  5A2Q E;  4RTZ A;  4PJO D;  2FRW A;  2DXC A;  3CCR Q;  3CCV Q;  3EG1 A;  2K3X A;  1C6V X;  4X9C A;  2EQU A;  2XKO C;  3ME9 A;  3RMQ A;  2RI5 A;  2EAY A;  1BI0 A;  1Q86 C;  3MJX A;  1GRI A;  5KE2 A;  1K8A R;  1OU8 A;  4IKF A;  3UWN A;  2EYZ A;  1PKT A;  2FO0 A;  3DLM A;  2LMJ A;  1VYT A;  2K3B A;  4O6J A;  3DB3 A;  2O9V A;  3CCL Q;  1VQK A;  3NPF A;  1UUE A;  3KBG A;  1X2K A;  2XI9 A;  2RPN A;  1VQL A;  4DOV A;  1KQ1 A;  1ZA2 B;  1VQO A;  1U3O A;  3JB9 F;  2NLU A;  4OMF B;  5I21 A;  4C5I A;  2GFU A;  2DF6 A;  3CC7 A;  3MHX A;  4LDV A;  3UA7 A;  2B8A A;  4M7A B;  3FJP A;  1JB0 E;  1I81 A;  4M7D F;  2K2V A;  1YCS B;  5GAN g;  2L3S A;  3MP8 A;  4RTV A;  3VS3 A;  4JJC A;  1JBM A;  2KT8 A;  3S3M A;  1GCQ A;  5FU7 B;  1UHF A;  4M75 A;  4ELY C;  5J3B A;  2KVQ G;  2K57 A;  1JXO A;  4Z02 A;  4NL3 A;  3QDR B;  2M02 A;  3SDZ A;  2PTK A;  1E6H A;  1PRM C;  3V7S A;  2RH2 A;  4EMK A;  2QG9 B;  2E3I A;  2VXE A;  3ZBD A;  2P4R A;  4M77 A;  4M7A D;  3BE3 A;  2JS0 A;  4O5V A;  3MO8 A;  2H3J A;  2F2X A;  3OS0 A;  2E6N A;  3OMG A;  3UPU A;  2DEQ A;  2KI7 A;  2DPP B;  2VVK A;  3PMI A;  4N0A C;  1SPK A;  2AZV A;  2AKL A;  2EJ9 A;  3NTI A;  1T0J A;  2L5Q A;  2RJF A;  4R0K A;  4JS4 A;  2K9G A;  3CCU A;  2F1L A;  1Q81 U;  2DL8 A;  4BE0 A;  1WIE A;  1FWZ A;  4YTL A;  3LW5 E;  2CUB A;  3MET A;  2X51 A;  1NPP A;  2EVR A;  3LLR A;  4M4Z A;  2GGR A;  2I2L A;  2CP2 A;  2CT3 A;  1VQ5 T;  3I55 A;  1OEB A;  2O4X B;  2ZPG B;  8ATC B;  2XIC A;  3SEM A;  3A98 A;  1VQ8 A;  1RAH B;  5IN1 A;  1RAB B;  3FC3 A;  1YJ9 A;  1M8M A;  4J9H A;  1H92 A;  3QUI A;  1SG5 A;  3X24 B;  5KYY A;  5GAN h;  1B34 A;  5KCO A;  2NYS A;  4JJN K;  1VQ9 A;  1RI9 A;  4HVU A;  3V7C A;  2CZ0 B;  2D0N A;  1UGR B;  1M30 A;  2RF0 A;  4K11 A;  2YUO A;  1UHC A;  3A8L B;  4FSX A;  1N8R U;  3QYG B;  3OS5 A;  1G3S A;  1JO8 A;  2DE0 X;  3OQ5 A;  2CS7 A;  2RI2 A;  1W2B P;  1NYG A;  1RAF B;  5GAM h;  1KJW A;  4XTW A;  4C8Q B;  2CDT A;  4FM4 B;  4ELZ C;  1K73 U;  5CKH A;  3ULR B;  4IIM A;  2MMP A;  5FRM A;  1OZ3 A;  1AOJ A;  2EGA A;  3RKX A;  2EBP A;  2K3Y A;  1V76 A;  1NEG A;  2RM4 A;  2JM9 A;  4CRI A;  3CPF A;  3LWI A;  1KFZ A;  1CSK A;  1WXB A;  4A4K A;  1WJR A;  3I56 Q;  2QA4 Q;  2E5K A;  1XTD A;  2FB7 A;  2EGC A;  1UJY A;  5KYW B;  2CP6 A;  1R77 A;  4PLL A;  3CMA Q;  2RO0 A;  5M9O A;  3R6N A;  4C8Q D;  2XG8 D;  3CQT A;  3CXC S;  1M90 C;  2A3L A;  1WHM A;  2DXU A;  2JT4 A;  1Q95 G;  2X4Y A;  4J7F A;  1IXD A;  1FX7 A;  4Q5W A;  4Z89 A;  2KRM A;  4HCC A;  2PVD B;  5I11 A;  4KH1 B;  4KUI A;  5C0M A;  1ABQ A;  1FMW A;  2ZPF B;  2DMO A;  3EH2 A;  5D6W A;  4ME7 A;  4PL6 A;  3HPW A;  2KDS A;  2JTE A;  1QW1 A;  3HL8 A;  1K9M C;  4C8Q C;  2RHX A;  1GFD A;  2COY A;  1N9R A;  1ZUK A;  3HRT A;  3G4S T;  4JS5 A;  4QW2 A;  1KG1 A;  1KQS S;  1TTH B;  2B86 A;  4XAX B;  2P4T A;  4F7U G;  3LH0 A;  5GAN 4;  3C95 A;  1B07 A;  2OI3 A;  2K79 A;  2RQW A;  1YNZ A;  4HCK A;  2VB6 A;  2EYW A;  4XTY A;  4BI3 A;  4Y28 E;  3JCM Q;  1M1F A;  2EPD A;  4ZNX A;  1QCF A;  2RQR A;  3MP6 A;  2KYM A;  1N5Z A;  2HBP A;  3CBM A;  4KT0 E;  4C92 A;  1OYX A;  1VQ4 T;  1S72 T;  4KGV B;  4WTO B;  1SEM A;  2OTJ Q;  3URG A;  1W2B A;  3CD6 Q;  3BY7 A;  2DO3 A;  5KYX A;  6AT1 B;  1Q7Y U;  3TEE A;  4HA8 A;  3G71 A;  1SHF A;  4OMP A;  3CCE Q;  4Y92 A;  1ZQ1 A;  4RCB A;  2VXF A;  1JQQ A;  5CQY A;  2VYT A;  2E1H A;  1ZSZ B;  2WSC E;  4JJB A;  1V1C A;  1JJ2 A;  4C0G A;  2KMT A;  5A0L A;  3L1A A;  3QJ6 A;  2DL3 A;  1YJW T;  2QQB A;  2JMA A;  3JCM g;  2ESW A;  1RAI B;  2DA9 A;  2X3W D;  2OTL T;  3OW2 P;  1BBZ A;  4HKE A;  1UGS B;  1IHV A;  2K5F A;  3S3O A;  2DZ9 A;  2HSP A;  2KY9 A;  1ZBJ A;  2ECZ A;  3REA B;  2PQW A;  1T3S A;  3J7A F;  3OS2 A;  3EFR A;  3GF5 A;  1PSE A;  1JXM A;  3CCJ A;  1Q82 C;  5CK9 A;  1VQN T;  2HAX A;  4XK8 E;  2O9S A;  4C8Q F;  2HSE B;  3FIF A;  3LYI A;  1WJQ A;  1AWW A;  1UEB A;  1BCO A;  1QWF A;  5HKC A;  2R5M A;  2HQX A;  2DAQ A;  2EYY A;  3PIO A;  2Y4Y A;  2WAC A;  2A0F B;  2YLC A;  1TUC A;  2NUP B;  4PLI A;  3RKW A;  3M4Y A;  3NMZ C;  4M7D A;  1KD1 C;  2RMO A;  1MND A;  1VQP Q;  1J3T A;  2FZG B;  4C92 G;  3V8K A;  4OMQ A;  1AZG B;  1IRX A;  4FT4 A;  4E6R A;  1D0Z A;  4E7I A;  3A8M B;  3FEO A;  3LX7 A;  2CZ6 B;  4LE9 A;  1G8X A;  3EFO B;  3M57 A;  2EYQ A;  2EIF A;  4RG2 A;  3DKM A;  2CKK A;  5CAI A;  4CC4 B;  4ZN1 A;  2JVV A;  2F2V A;  2QEX T;  4N4G A;  2E41 A;  4LXC A;  1OPK A;  2CSI A;  3EGX A;  3QWY A;  2QAS A;  3LH5 A;  1D3B A;  4BDZ A;  1W70 A;  4PJN A;  1H64 1;  3OBW A;  4RG8 A;  1OPL A;  1AVZ C;  2DXB A;  2QDY B;  3E9G A;  4BI8 B;  4QVD A;  4IUV A;  2D0Q B;  1M90 U;  4XU1 A;  5J39 A;  5FU6 B;  2EQM A;  1YIT T;  2MIO A;  1SRM A;  2QAZ A;  2VGN A;  3L2W A;  2OTL Q;  2W0Z A;  1DJ7 B;  1AT1 B;  2KXC A;  2O01 E;  3CME A;  4M78 B;  1BI3 A;  4RTT A;  3EFS A;  2MYS A;  5CR2 A;  2FPE A;  2YWW A;  3I5S A;  1D0X A;  2LJ1 A;  4E7S A;  2V26 A;  2M1H A;  3EG9 B;  2LQN A;  1W4S A;  2PVO B;  2IG0 A;  3JB9 G;  5CVI A;  4QT7 A;  3TU4 K;  3BDU A;  3JCM c;  5LJ3 e;  2CT4 A;  1Q81 R;  3I35 A;  3EGD A;  2CRE A;  1RL2 A;  1YWO A;  1V29 B;  4F16 A;  4ZTF A;  4A4H A;  4KBM B;  1IO6 A;  1WFW A;  2FG0 A;  3CCQ Q;  2CH4 A;  2QQ9 A;  3PGG A;  3H0F A;  3OMC A;  1LCK A;  1UGQ B;  1VQL T;  1VQO T;  3PIP A;  4QVC A;  4M78 E;  4XTZ A;  3OYL A;  5FU6 C;  1TOV A;  5IH2 A;  2IVW A;  2M16 A;  3TSW A;  3CC7 T;  2KNB B;  2WSF E;  5CQX A;  1M3C A;  2DL5 A;  3L2R A;  2VUB A;  1JRI A;  4M78 C;  3H8Z A;  4CC7 A;  2CUD A;  5GMK m;  4IUR A;  1H8K A;  3M59 A;  4L5G A;  4A4G A;  2E10 A;  3CC2 Q;  1TG0 A;  4PJO B;  1N8R R;  1E7O A;  2KRO A;  4N0A A;  2RHY A;  3I9Q A;  1WX6 A;  1UG1 A;  5GAO m;  3LGF A;  1OX9 A;  2CGH A;  1P92 A;  3QII A;  4KGX B;  4GLM A;  4R55 A;  1YI2 A;  3CC4 A;  2X35 A;  1RLP C;  3QZ9 B;  1VYV A;  2EWN A;  4PJO G;  3CCU T;  2P84 A;  3CCS Q;  2E70 A;  5AYF A;  4B6M A;  3OY9 A;  3GOX A;  2DD5 A;  1G3W A;  1Q82 U;  1N6A A;  1X6G A;  1KQS P;  5IAY A;  2V8J A;  1ZHI A;  1VQM T;  1Y96 A;  2AZS A;  4WF2 A;  4XTU A;  3HSB A;  2MK5 A;  2A28 A;  3CCR A;  2GTO A;  4PJO E;  4UC4 A;  5HY6 A;  4C0Z A;  3CCV A;  5HK3 A;  5GMK l;  3I55 T;  1SRL A;  3L42 A;  1K8A C;  4FW1 A;  3NGP A;  5LJ3 d;  1VQ8 T;  4JLG A;  1YJ9 T;  2MF2 A;  3X20 B;  4PJO C;  1KIK A;  4L59 A;  5KYU A;  4J9F A;  3GPL A;  2O88 A;  5LJ5 e;  1U8R A;  2ZCF B;  4JLI A;  3SD4 A;  2LP5 A;  2VGM A;  2L8D A;  1KQ2 A;  3OYN A;  2HMA A;  3H0I A;  3CCL A;  2X3X D;  2DZC A;  4C0D B;  5GMK i;  2DM1 A;  2DEU A;  5GMK e;  3OYG A;  2FL7 A;  5KCH A;  1IZ6 A;  4M78 F;  4A63 B;  1PKS A;  2BE9 B;  2O4X A;  1LPL A;  3RKY A;  3RR6 A;  4MZP A;  1FXX A;  3JAM E;  3PT9 A;  4PFO A;  1YIJ Q;  1T0H A;  4ZGJ B;  1R8O B;  4D8K A;  3HFO A;  2QDL A;  3CXC A;  1SF9 A;  3HRS A;  2K4Y A;  1GBQ A;  2RK1 A;  3X25 B;  1QCN A;  1BI1 A;  4RMO A;  4M7A G;  2JXB A;  5DY9 A;  5I2S A;  3JCM W;  3AT1 B;  1Q7Y R;  2H3E B;  3RUX A;  1Z9Q A;  1VQ6 Q;  3ZFJ A; 
#chains in the Genus database with same CATH homology
 4ME7 A;  4PL6 A;  1N8R C;  3HPW A;  2JN0 A;  3A5Z B;  2X4X A;  2KDS A;  4LDY A;  1OZ2 A;  1QW1 A;  3HL8 A;  1K9M C;  4HCZ A;  4C8Q C;  5KH6 A;  3R6O A;  2LQ8 A;  2RHX A;  3M5A A;  2DIQ A;  3T9N A;  3QBY A;  3CC2 A;  4M7A E;  2RD1 A;  3J81 E;  1N9R A;  4C0D C;  3OYF A;  3CEY A;  1N9S A;  3HRT A;  3G4S T;  1RI0 A;  3HP9 A;  4JS5 A;  4BI4 A;  3JB9 H;  4QW2 A;  1KG1 A;  3RMS A;  3CCS A;  1KQS A;  4M7A A;  2DK3 A;  1KQS S;  2E12 A;  2XHC A;  2JTM A;  3INZ A;  1WNL A;  3WVE B;  4XAX B;  1VQ4 A;  1S72 A;  2HNI A;  3GNF B;  1M1K U;  3GIB A;  2P4T A;  4F7U G;  4M7A C;  3LH0 A;  5GAN 4;  3ASK A;  3C95 A;  3VYH B;  1VIE A;  2M9U A;  2PVG B;  1Y7X A;  3CC2 T;  3NFC A;  4E47 A;  4C92 E;  4F7U F;  1VQ7 A;  4C5G A;  4XTY A;  3SWN B;  1KHI A;  2JUF A;  2ZPE B;  4Y28 E;  4BI3 A;  3MCA B;  3JCM Q;  1M1F A;  2XDB A;  1WQW A;  1U1S A;  5FU7 C;  4BB7 A;  2RJC A;  3MP6 A;  3JCM V;  4PJO F;  2EFI A;  2HBP A;  3CBM A;  4KT0 E;  4C92 A;  1OYX A;  2ZPI B;  1VQ4 T;  1S72 T;  4M7D C;  1KC8 U;  4C92 C;  3OYB A;  2LT1 A;  3VV0 A;  1YBY A;  3OYK A;  2MWO A;  3C12 A;  5DLQ E;  4EPC A;  1QVG S;  1QVG A;  5GAN f;  3G6E A;  4FT2 A;  3URG A;  1W2B A;  4KUL A;  2CZ7 B;  1W2B S;  1KHC A;  4GLK A;  3BY7 A;  5LJ5 d;  3UT1 A;  3TRE A;  4F7U A;  2DO3 A;  5EG2 A;  1XNI A;  3O8V A;  4C5H A;  1YJW A;  5FRO A;  1Q7Y U;  3TEE A;  2KSS A;  1HXD A;  2EQJ A;  2LX9 A;  4HA8 A;  5IT9 E;  3G71 A;  2QXF A;  2DTI A;  5DM7 R;  3OW2 A;  3OW2 S;  1ZQ1 A;  3M4G A;  4RCB A;  2VXF A;  3CCS T;  2DTO A;  5CQY A;  2VYT A;  2E1H A;  2WSC E;  1O75 A;  4BUG A;  2LTO A;  5GAM f;  1KD1 U;  1JJ2 A;  2RJE A;  2PUO B;  4C0G A;  1JJ2 S;  2KMT A;  5A0L A;  2DD4 A;  4M75 B;  3AHU A;  3L1A A;  4DOW A;  1VQ9 T;  3HRU A;  3P8D A;  4IUU A;  1QVF A;  2L89 A;  3QJ6 A;  1QVF S;  1HK9 A;  5LL6 S;  3S6W A;  5GAO l;  1M5Q 1;  3GNG A;  1YJW T;  2QQB A;  3JCM g;  1G5V A;  3M53 A;  2XK0 A;  2LRQ A;  2X4J A;  4L6V 5;  3G71 T;  4HCB A;  1LOJ A;  5CIU A;  2GFA A;  2OTL T;  2GF7 A;  5FRN A;  1UGP B;  4EMK B;  2LT4 A;  2E6Z A;  1UGS B;  3KUF A;  1LNX A;  3QO3 A;  4HKE A;  3QHS A;  3V8J A;  2K5F A;  4RKU E;  2QTX A;  4HT9 A;  1VQN A;  1M1K C;  5CKB A;  1QP3 A;  2JNG A;  3S3O A;  2DZ9 A;  4V2S A;  1X6O A;  3SWN A;  4ZGD B;  2D6F A;  2KY9 A;  5GAO q;  3PMT A;  3SWN C;  1GXI E;  3OYC A;  1XQH A;  2PQW A;  3QXE B;  3J7A F;  3CCL T;  3JB9 D;  3OS2 A;  3EFR A;  1YHQ A;  3GF5 A;  1PSE A;  5LJ5 h;  1PSF A;  4LD9 K;  4C8Q G;  3M54 A;  4XU3 A;  1ZBX A;  3CCJ A;  1WPY A;  4M7D G;  2RJD A;  4M75 D;  1EIF A;  1Q82 C;  2RHI A;  3E19 A;  4LDW A;  2LC4 A;  3MP1 A;  3P8B B;  4OB1 B;  5LJ3 f;  5CK9 A;  3I56 A;  4OB0 B;  2QA4 A;  2YHT A;  3HKS A;  4E7L A;  1VQN T;  4OGC A;  1KC8 C;  2HAX A;  1O9S A;  4XK8 E;  2HQE A;  4C5E A;  4M78 D;  3JCM d;  4C8Q F;  2GQV A;  4MML A;  3FIF A;  1YIJ A;  2PU9 B;  3FDR A;  4XU0 A;  2LDM A;  3SFM A;  3LYI A;  1WJQ A;  5GMK h;  1UEB A;  4PNO A;  3X28 B;  3CMA A;  5GAN 6;  3OA6 A;  1Q7Y C;  3VYG A;  1NZ9 A;  5A0G A;  2YLB A;  5HKC A;  2R5M A;  4M77 D;  1BI2 A;  3QG1 A;  4C8Q E;  4VUB A;  3QYH B;  2HQX A;  2DAQ A;  2WSE E;  2ZPB B;  3PIO A;  2Y4Y A;  5HK0 A;  3CCJ T;  4J5Y A;  2WAC A;  3GLX A;  4EMH A;  2EJG A;  2OAU A;  3I56 T;  4M7A F;  2QA4 T;  2YLC A;  4XQ3 A;  4PLI A;  3BDL A;  3RKW A;  3M4Y A;  2K5I A;  4A53 A;  4EDU A;  1X01 A;  1YIJ T;  4C8Q A;  4R56 A;  3C94 A;  3LWH A;  5L8R E;  4NS5 A;  4X9D A;  1Q86 U;  3E9F A;  1KD1 C;  4M7D A;  3OYM A;  3CMA T;  5GAM g;  3JCM X;  2LVM A;  1Y96 B;  3M55 A;  4MZT A;  3OYI A;  3QZ5 B;  4JDS A;  1VQ6 A;  4ATO A;  3QJY A;  4FU6 A;  4C92 G;  5GAO p;  3WXM B;  3V8K A;  1B34 B;  3E1S A;  3M58 A;  4HT8 A;  4FT4 A;  5GAN j;  1NJI U;  4QQD A;  1VIF A;  4DA4 A;  1BKB A;  1K73 C;  2R57 A;  4J6W A;  2EKO A;  4C92 F;  2RHZ A;  4E7I A;  1UB4 A;  3A8M B;  4E7K A;  3FEO A;  3RIR A;  4FIB A;  4CI0 C;  2KAF A;  4II1 A;  1X75 C;  2QEX A;  4BY6 B;  3L2V A;  3MEW A;  3CCM A;  1M1G A;  2E5Q A;  1VQ6 T;  3LX7 A;  4PJO E;  2KQW A;  2CZ6 B;  3OB9 A;  2G3R A;  1M9S A;  4GY5 A;  4RCC A;  4E7H A;  2P0P A;  3OSS C;  5KE3 A;  4XU2 A;  1YJN A;  3M57 A;  2EYQ A;  3CPW A;  2EIF A;  2V8K A;  4RG2 A;  5GAM j;  3CPW S;  4J6Y A;  3DKM A;  5GAN e;  2CKK A;  4X34 A;  3J80 E;  3V7R A;  5GAN 2;  5CAI A;  4C0F A;  4ZN1 A;  1H3Z A;  4BE1 A;  2JVV A;  2X4W A;  3OYD A;  2L3R A;  3JB9 I;  2JZ2 A;  1BIA A;  2QEX T;  1VQM A;  1YIT A;  3CCM T;  4N4G A;  2E41 A;  5LJ3 g;  3L2U A;  4QQG A;  4JRP A;  5GAO n;  4KUD K;  2R58 A;  4OVA A;  3F70 A;  5GAO r;  1VQ7 T;  1YJN T;  4LD6 A;  1WQ7 A;  1D3B A;  4BDZ A;  2E64 A;  5A2Q E;  1H64 1;  1LJO A;  3OBW A;  3OYY A;  3E9G A;  2DXB A;  2QDY B;  4OF1 A;  4RG8 A;  4B9W A;  4PJO D;  2OTJ A;  5GAM e;  4BI8 B;  3CD6 A;  2DXC A;  2P0Q A;  3TCJ A;  3JB9 J;  4QVD A;  4IUV A;  2D0Q B;  2K3X A;  1M90 U;  4X9C A;  2EQU A;  2XKO C;  4XU1 A;  5CCA A;  3N5B B;  5J39 A;  5FU6 B;  2EQM A;  2EJF A;  3G6E T;  3JCM P;  1YIT T;  3ME9 A;  3RMQ A;  4P5N A;  1SSF A;  2GCX A;  2RI3 A;  3CCE A;  2RI5 A;  4IUT A;  2EAY A;  2DVE A;  2AHJ B;  2QI2 A;  2VGN A;  3M56 A;  3L2W A;  1BI0 A;  1Q86 C;  4OP0 A;  4PKC C;  2V8I A;  1DJ7 B;  5LJ3 j;  3CME A;  2O01 E;  3A8O B;  4M78 B;  2OTJ T;  1BI3 A;  5KE2 A;  5A0D A;  3QPH A;  3EFS A;  4ZN3 A;  3UWN A;  4IKF A;  3CD6 T;  5CR2 A;  3NTK A;  1XOV A;  2P0K A;  4M7D F;  3DLM A;  4BY6 C;  3PFS A;  4M77 B;  3KXT A;  2XDP A;  4O6J A;  3DB3 A;  2M1H A;  3CCE T;  3GP8 A;  1VQK A;  4J8O A;  1W4S A;  3CBP A;  2PVO B;  2IG0 A;  3QKJ A;  2YRV A;  3KBG A;  3JB9 G;  5CVI A;  2XU8 A;  3TU4 K;  3BDU A;  2XI9 A;  3CME T;  1G3T A;  3JCM c;  4JRK A;  1VQL A;  5DLO A;  4DOV A;  5LJ3 e;  5LJ5 f;  1KQ1 A;  4M75 G;  3OSV A;  3M9Q A;  5GAN 8;  1VQO A;  1BIB A;  3ZEH A;  2LNV A;  3JB9 F;  1YCY A;  2NLU A;  1RL2 A;  1Y71 A;  2CZ1 B;  4OMF B;  5I21 A;  3BW1 A;  4C5I A;  2GFU A;  1V29 B;  1MHN A;  1QVP A;  5CKF A;  3CC7 A;  4ZTF A;  4A4H A;  3MHX A;  4LDV A;  4KBM B;  2B8A A;  4M7A B;  3FJP A;  3JCM J;  1M8V A;  1IRE B;  1JB0 E;  1I81 A;  2RHU A;  2ZZD A;  2BKD N;  2QQ9 A;  2K2V A;  3PGG A;  3Q1J A;  5CKD A;  3A8H B;  3OMC A;  5GAN g;  4M77 G;  1UGQ B;  1VQL T;  4M75 E;  3MP8 A;  2A7Y A;  1VQO T;  3PIP A;  4QVC A;  1YHQ T;  4ZTJ A;  1VUB A;  4J6X A;  2DJZ A;  1JBM A;  4OB3 B;  2VC8 A;  4M78 E;  4XTZ A;  2XD0 A;  2R5A A;  3OYL A;  5FU6 C;  2JTF A;  3S3M A;  4NOY A;  5FU7 B;  3VJP A;  2IVW A;  2KK4 A;  2M16 A;  3CC7 T;  4M75 A;  2E65 A;  4ELY C;  2WSF E;  5CQX A;  4M75 C;  5J3B A;  2KVQ G;  2QQS A;  2K57 A;  3UDC A;  3OYJ A;  3L2R A;  2VUB A;  4Z02 A;  4NL3 A;  3EAE A;  1U1T A;  1JRI A;  2Y4X A;  3QDR B;  4M77 E;  3SDZ A;  4M78 C;  5GAN 5;  2XDD A;  3H8Z A;  3V7S A;  2RH2 A;  5GMK m;  1K8A U;  5FLX E;  4EMK A;  3CBO A;  4JRQ A;  4EMK C;  1M4Z A;  2VXE A;  2RB6 A;  3ZBD A;  2LCC A;  4IUR A;  3VUB A;  4F7U B;  4M77 A;  2D9T A;  3M59 A;  4M7A D;  4L5G A;  2MI6 A;  4MDX A;  2BIV A;  4M77 C;  2E10 A;  4O5V A;  4A4G A;  3MO8 A;  1VQP A;  5GAN d;  2H3J A;  4IUP A;  2DIG A;  3MEU A;  4PJO B;  3OS0 A;  4M7D E;  4N4H A;  2E6N A;  3OMG A;  3UPU A;  2RHY A;  2DEQ A;  3FLG A;  3HHT B;  2DPP B;  4N0A A;  3JCM f;  2DXT A;  3PMI A;  3L2Z A;  4BE2 A;  4N0A C;  2F5K A;  1M90 C;  2EJ9 A;  3NTI A;  2L5Q A;  2RJF A;  3JCM h;  2VV5 A;  5GAO m;  4JS4 A;  3CCU A;  2EQK A;  3LGF A;  1Q81 U;  1VQ5 A;  2CGH A;  1I4K 1;  1P92 A;  3QII A;  4BE0 A;  4C92 D;  5J26 A;  5LJ5 g;  1FWZ A;  2HD0 A;  2RA2 A;  3FB9 A;  4YTL A;  3S3N A;  4Y91 A;  1VQP T;  4LDU A;  3LW5 E;  2F5T X;  5GAM d;  3ER0 A;  4R55 A;  3DB4 A;  3MET A;  1I8F A;  1NE8 A;  1YI2 A;  1NPP A;  3LLR A;  3CC4 A;  2X35 A;  3QSU A;  2F69 A;  3QZ9 B;  1N27 A;  2I2L A;  4BDY A;  2EWN A;  4PJO G;  3CCU T;  3FRN A;  1VQ5 T;  3OYH A;  3MEA A;  4A54 A;  2E70 A;  5AYF A;  3GOX A;  3OY9 A;  3I55 A;  2DD5 A;  2ZPG B;  2O4X B;  3NTH A;  3P8H A;  1G3W A;  5I2M A;  1Q82 U;  1N6A A;  5C6S A;  2XIC A;  2K5L A;  1VQ8 A;  5IAY A;  4QVZ A;  5IN1 A;  3FC3 A;  1YJ9 A;  3VUZ A;  2V8J A;  4F7U E;  1ZHI A;  1VQM T;  4OB2 B;  1YI2 T;  1Y96 A;  4WF2 A;  4XTU A;  5LJ5 j;  3MEV A;  3CC4 T;  3DLL A;  3QUI A;  3HSB A;  1WJS A;  2Y90 A;  3VKI A;  3JCM b;  3X24 B;  2LQK A;  2FVU A;  5GAN h;  3CCR A;  1B34 A;  2BUD A;  5KCO A;  4UC4 A;  5HY6 A;  2ZPH B;  4IUQ A;  3G7Z A;  1QP2 A;  4C0Z A;  3CCV A;  4JJN K;  1VQ9 A;  3V7C A;  5HK3 A;  2CZ0 B;  3C4S A;  5GMK l;  3I55 T;  3BFM A;  3L42 A;  2PUK B;  1K8A C;  4TVR A;  1UGR B;  5GMK j;  2CYZ B;  5LJ3 d;  3PTA A;  1NJI C;  4JLG A;  1VQ8 T;  4PJO A;  2OTL A;  3JRZ A;  1YJ9 T;  4XTX A;  2MF2 A;  3X20 B;  4D6W A;  5D6Y A;  4J7I A;  4PJO C;  1BYM A;  2MWP A;  3A8L B;  4FSX A;  4XTV A;  4L59 A;  1N8R U;  2QQA A;  3QYG B;  3OS5 A;  1G3S A;  3PNW C;  1K9M U;  3OQ5 A;  3CCR T;  3LGL A;  2CS7 A;  2RI2 A;  3V8L A;  3WVD B;  5LJ5 e;  2ZCF B;  3GPL A;  3CCV T;  2MAM A;  5GAM h;  1U8R A;  3SB2 A;  3L2Q A;  4MMK A;  4XTW A;  1I5L A;  4JLI A;  3OS1 A;  4C8Q B;  3SD4 A;  2VGM A;  1KQ2 A;  2L8D A;  4EMG A;  4M7D B;  3OYN A;  4FM4 B;  4ELZ C;  4N4I A;  1K73 U;  5CKH A;  1Q81 C;  3CCL A;  2MMP A;  2DZC A;  4C0D B;  5GAN 3;  2DTH A;  5FRM A;  1OZ3 A;  5GMK i;  3RKX A;  5GMK e;  4M78 G;  3VU3 C;  1NPR A;  4E7J A;  2K3Y A;  4M75 F;  3OYG A;  2XID A;  2RM4 A;  3JSC A;  4CRI A;  1AHJ B;  1G3Y A;  2FL7 A;  3CPF A;  1VQK T;  4LDX A;  5KCH A;  1IZ6 A;  3LWI A;  5CO7 A;  4M78 F;  4DQ2 A;  4QQ6 A;  2O4X A;  4A4F A;  3H6Z A;  3RKY A;  2QQR A;  4A4K A;  1WJR A;  1MGQ A;  4MZP A;  1FXX A;  3JAM E;  4NL2 A;  3HFN A;  4JUV A;  1XTD A;  2FHD A;  3CCQ A;  3RER A;  1Y07 A;  2FB7 A;  3PT9 A;  4A4E A;  4M77 F;  4ZGJ B;  1R8O B;  5D6X A;  3RES A;  4PLL A;  4OGE A;  4MDW A;  3HFO A;  2RO0 A;  5M9O A;  3CXC A;  2FYK A;  2RK2 A;  2XG8 D;  1WGS A;  1TH7 A;  2DKG A;  5LJ3 h;  4C8Q D;  3CXC S;  2A3L A;  2DXU A;  3HRS A;  2K4Y A;  4M7D D;  4BD3 A;  4C92 B;  2M0O A;  2RK1 A;  2X4Y A;  4M78 A;  4BAC A;  3OYA A;  4JRI A;  3X25 B;  4J7F A;  5CKE A;  3A8G B;  4J83 A;  1FX7 A;  4B9X A;  5GAN 7;  4Q5W A;  4FL6 A;  1BI1 A;  4RMO A;  2PVD B;  2LCL A;  4HCC A;  4M7A G;  5DY9 A;  2JOY A;  3CCQ T;  5I2S A;  3X26 B;  4KUI A;  4ZGE B;  3G4S A;  3JCM W;  5C0M A;  1D3B B;  2C06 A;  2ZPF B;  1OI1 A;  3RUX A;  2ZGW A;  3JCM e;  4MZM A;  3ZFJ A;  5D6W A;  3OYE A;  3OBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...