1PG5B

Crystal structure of the unligated (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
148
Chain Sequence
MVSKIKNGTVIDHIPAGRAFAVLNVLGIKEGFRIALVINVDSKKMGKKDIVKIEDKEISDTEANLITLIAPTATINIVREYEVVKKTKLEVPKVVKGILKCPNPYCITSNDVEAIPTFKTLTEKPLKMRCEYCETIIDENEIMSQILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of T State Aspartate Carbamoyltransferase of the Hyperthermophilic Archaeon Sulfolobus acidocaldarius.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase
molecule keywords Aspartate carbamoyltransferase
total genus 32
structure length 148
sequence length 150
ec nomenclature
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
B PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 1pg5B02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 1pg5B01
3AT1B 1ACMB 2A0FB 4E2FB 1EZZB 1RAHB 8ATCB 2IPOB 2QGFB 2AIRB 3MPUB 1D09B 1TUGB 1RAIB 4FYVB 1F1BB 1R0CB 1SKUB 4KGXB 1RAAB 4KGZB 1TU0B 4AMCA 2YWWA 1PG5B 2AT1B 3D7SB 1RADB 2FZCB 7AT1B 2BE7D 6AT1B 4KGVB 1TTHB 1XJWB 1ZA1B 1Q95G 4WTOB 1AT1B 2ATCB 2FZKB 1I5OB 4FYYB 2BE9B 2QG9B 4KH0B 1RABB 2FZGB 1RAEB 4AT1B 1RAGB 2H3EB 1R0BG 1RACB 1ZA2B 4FYWB 1RAFB 4F04B 8AT1B 2HSEB 1NBEB 4KH1B 9ATCB 4FYXB 5AT1B
chains in the Genus database with same CATH superfamily
4H4MB 3OLBA 1IKXB 2W9CA 2AEFA 4QYZJ 1K8AR 1FJ7A 3M2VA 4IFVB 1NZ8A 3DCAA 4DL7A 2YQ0A 1H92A 4CLKA 3VAFA 4TVAB 3OYBA 1B70B 3W62A 2IRUA 3OL8A 4FNHA 1W2BS 1IO6A 3CCLA 5LM7E 1T3NA 2F9JA 2NXNA 2MZRA 1WQWA 2LMJA 4K0KJ 1XQHA 1RTJA 4MH8A 3A4TA 1VRUB 1K0TA 1H6KX 3OY9A 1N5QA 3D28A 4KH1B 2HMIB 3OD2A 1Q5YA 1KVKA 3M4GA 1M90U 4NLXA 3ZTRA 3KLGA 1WHWA 3K89A 1QAIA 3MEUA 4E7SA 2H3JA 3KJVA 1AHJB 1YJWA 3M56A 3LP1B 4TKTA 1S1TA 1PKTA 1GCPA 2DXEA 3FMBA 1PC4A 4PWUA 3OSVA 3CNQP 4F14A 3V8LA 2LRQA 5KFWA 1TK8A 5AXKA 4QOTA 5KYXB 2K5FA 4JLGA 1J5OB 3C46A 3N5BB 5DDPC 5D4NA 1B7FA 2RHYA 2JM8A 2PVGB 1PYTA 3HJVA 1GFCA 4L74A 3HFOA 4NL2A 3MMCA 5KFMA 4DG1A 1P9YA 2OAUA 1MU2A 3MDFA 4JYAF 3QIDA 3CDBA 1K8AC 4BE2A 1WEXA 4M77D 2GIRA 2MTLA 1RYSA 2CP5A 3A8OB 4OMMA 4PFZA 1U2CA 2EWNA 4YDXA 1KC8U 1XMOF 3H9NA 1NJIR 2C0IA 4ZHRA 3NCPA 1UVLA 1N5TA 2GFAA 1YJTA 4DV2F 2IRYA 1RWKB 5K14A 1CSJA 1B34A 4LUDA 1Y3KA 3ZO7A 3TAQA 1TL3B 4M4ZA 4Z2XA 1IB8A 2A3JA 1JB0E 4DL5A 3H4BA 1J5OA 4ZJQA 2KJWA 5GANd 2FIUA 2NUTA 1SKUB 3S7RA 3ER0A 3JYTB 2CWKA 2P6SA 3AAWB 4J6XA 3ZZRA 4DPUA 2HAFA 1RU1A 2MSTA 5IT0A 5IC6B 3IO1A 5J2MB 3LP1A 2A0FB 5D0RA 4LN2A 4LD9K 4A54A 2LFVA 1GTEA 4K11A 2A3LA 5HSPA 2YNHA 1NRKA 2DIQA 3D0GE 3ME9A 3SV3A 2HZCA 2CGHA 2AX0A 2GHVC 3OR1A 4QW2A 5LJ5Y 4E7ZA 1VRUA 1ZS6A 1RACB 2ZE2B 4NLWA 3P3DA 2R58A 2FHOB 2DTHA 2EEYA 3SCKE 3WBZA 2C28A 2UUCJ 2VA2A 3LF0A 3CCRA 2DERA 2UXCJ 5A0DA 2GA7A 2HBWA 2J5AA 1RAAB 2L3SA 2OELA 4TLRA 3K7RA 3NWRA 4PCQA 1I8FA 1WG1A 5F8JA 4RZRA 2CSQA 4V1Ak 1IGUA 4ZGEB 2BJEA 4PFPA 2AV5A 2DD4A 4WFXA 1WELA 3BO4A 3AHPA 1M5KC 4N7TA 4DSFA 4BI4A 4JJCA 1OSCA 2NUPA 2Q1LA 1AW0A 4A8OA 2D9PA 2B9XA 1F9EB 2ZOGA 1N33F 3BR8A 1M5Q1 4CT8A 3JTNA 1Y7PA 1NE8A 2A08A 2COWA 4PABA 5CR2A 2CPXA 2P2CB 3I9V9 5HK0A 2GS8A 1U1SA 4B17A 4ZN3A 1M5HA 1PM3A 3RAMA 4CYUA 1YZ6A 4LRBA 3TUPA 1D8ZA 3CTRA 3FQKA 1JBMA 2DBBA 3O2IA 3NG8A 4P73A 3M0RA 1M5SA 2LQKA 3UQSA 2R7WA 3JCMf 3QZ8A 3RBZA 3K58A 1WX6A 3IAM9 4KO0B 2Y1IA 2KT2A 4WJBA 4PJOG 1UPMB 1VRTB 4Y34A 1VQMA 2L3PA 3GFXA 3C66A 4X62J 1Q82U 2DEIA 4Q5VA 4I4BA 5A8KB 1MNEA 2V8DA 2KFZA 1N8RU 5SZTA 1N8RC 4PFOA 1EP4A 1YK9A 3BPSP 1VR6A 4HT7A 4WFNQ 2Z2LA 3LGHA 3PFEA 4HTJA 3SSQA 4RW7B 4DQSA 5K8OA 4P75A 2AW0A 2K1RA 4J83A 3U1NA 4OYZA 3TRGA 2K5IA 4C3MA 3B4DA 2X3WD 4IUTA 1JJ4A 2PDAA 2DXFA 3LA0A 4I6WA 2C22A 2E5KA 4F4XA 1SJ1A 1D09B 1RLCL 3CC4A 1ARKA 1F2GA 1VDHA 4WBFA 3CMEQ 2PMHA 2ILZA 3GJSB 3ZNJ1 3IBWA 4ELYC 4RW4A 3TAMA 4J9OA 5IHIA 4J7CA 3GU0A 1S7IA 4CO4A 4IOCQ 3AXKA 2K57A 5HMYA 2C2OB 4DV1J 2BW7A 4FF1A 1H641 2MJUA 4DEXA 1SQFA 5KE2A 1Z4UA 2NYHA 3EPIA 3UCGA 2YKOA 1N9RA 3CJ5A 2GV1A 1S6UA 2VGMA 3PJXA 4WZMA 4K59A 1KN6A 5IM0A 4ECRA 4IUPA 4AL5A 1C0TA 2EQMA 5CH7B 1IXDA 1K1ZA 4J9MA 1A9NB 3OTOJ 2ZJRQ 3DLBA 4M7AF 3JXOA 2MGZA 4HT8A 1S6PA 4RW8B 4OI4A 1EETB 3IWLA 2Z4PA 1U1PA 4LVNP 3SV4A 1NK0A 2V9KA 1QVGA 1WNEA 1T0TV 4R8UA 1B99A 4CO1A 4UY8T 1N27A 2HGNA 4BS2A 2L3MA 5KFTA 4CI0C 1IHVA 1WOSA 2VBYA 3GMGA 2ALZA 4PK4A 2VG6B 3B8HA 3D0HE 2YKNB 1WEYA 2V4QA 2VDIA 4ZPAA 3A8JA 3HHEA 1HNWJ 2P4RA 4QT7A 3G6YA 3T41A 4PG8A 2EVZA 5KFQA 1PO6A 4ZTJA 5ETKA 3SWNA 1IGQA 3TVYA 1H2UX 2HAIA 2I0XA 4WIQA 2HKQB 2OPQB 1S99A 4DBQA 1VQKA 3R5BA 4J91A 4C0FA 4M7DD 2VG5A 3IR6B 2J0SD 4ALZA 4RTVA 1D1CA 1AFIA 2RD5C 1TUVA 3CCMT 2DD5A 1WJSA 3MEKA 3I82A 2YT6A 5KFYA 3R7NB 3VWSA 1Q1KA 5IT9E 2J6TA 4DL6A 3OYJA 3OFGA 4CWBA 1EKSA 1FT8A 4YP3A 2SEMA 5DDRC 3M1VA 4K4UA 2X51A 2UZAA 3NGSA 2LKZA 1FFSB 4OMOA 2QQBA 4L6V3 1HIYA 2YKMA 4CLWA 5GMKj 3I4PA 4HH0A 3REAB 1FO1A 1Q8IA 3NNHA 5ETSA 2J6FA 2DTJA 1UB4A 1PAUB 2IDEA 3QBCA 4J9UE 2NS1B 2V8VA 1S0VA 4USJC 3I5BA 3N79A 4OYXA 4XAXB 3MUMP 1MV0B 5HBMB 2IPOB 2ZH6A 1HWIA 4WP3A 2ZM6J 2YTCA 3C14B 1X6BA 1WHYA 4DQ2A 2JTMA 2VFRA 1CJTB 1L5UA 1S0MA 3VAJA 4Y2IA 3UI3A 4M77F 1OOTA 3OYAA 4EYHB 3G82A 4A4KA 1I3OB 2NSCA 2PEHA 4DSIA 2DT9A 3CC2A 3OJSA 2MYSA 1U1MA 1S0OA 4O44B 1C2PA 1N33J 3M8WA 2DXCA 3LH5A 4KTQA 4M78D 4DL2A 1RCOB 1RUWA 2CZ6B 3EICA 2DETA 5LSLA 2XLIA 2CS7A 4DHVA 3T1HJ 4A63B 3D1HA 1VQYA 3BKUA 2BZXA 2CP3A 3CD6S 3ICLA 3FRZA 5A8RA 3B82A 4N8OA 2V8GA 1SJ3P 5KT6A 2LECA 3R2CJ 1UFFA 3HVWA 1B4SA 3OVAA 2DTOA 5KG5A 2EK1A 2V8IA 3MJXA 3GP8A 1MN7A 3EVWA 4Y2KA 1KLMB 4RR5A 2NSBA 1GMWA 4RWXA 3MXHP 4DX8H 1S72Q 1FJGF 3QKJA 4E7IA 3MP6A 2Y4YA 1APSA 2BUDA 5LOQA 1J3TA 3RAQA 4Y00A 2ACMA 2LQ5A 4OMPA 5G4DA 1Q82R 5EX0A 3I55S 4CLZA 4CLPA 3AHUA 1RWWB 4WXOA 4QYRA 2XC9A 1RISA 4HHHA 4ETZA 2FJEB 2MHNA 2NUTB 1JJCB 5F8MA 3C8YA 1X75C 3QRPA 1AEYA 1DARA 2HQEA 3GLJA 2JLEA 3U27A 4FM4B 2HD0A 2QZ8A 3M30B 3MAHA 2JOQA 1AWOA 1GTHA 5L9XA 2B51A 2NXCA 5C25A 4OMQA 2ZPBB 4PJOE 3AD9C 1WHXA 1MGQA 1YDLA 4X4TA 2FVUA 2VB6A 4F3MA 4LF2A 4WCEQ 5B09A 2EQKA 5AXLA 2LT4A 4MDXA 2KDOA 4J9LA 2O88A 2IC3B 1QLYA 2JMCA 2LCLA 2L48A 4DR2J 1Y10A 1D3BA 4XTXA 4RW4B 4KV8B 1NHUA 1NDKA 1T9WA 2G3RA 1FX4A 2RQCA 4RX6A 4F2SA 1RHRB 2DR5A 4OL8A 2HBZB 4PRFA 4P7TA 2O2OA 2JX2A 5FW9A 2DO0A 1WKJA 4PZVA 4L59A 2EPDA 1YBAA 3CCUS 2AQ4A 3UNYA 2QMXA 3OSNA 3E2EA 3BGLA 4KHPF 1OPKA 4A8KA 4BWMA 3SFGA 2DIGA 5F8NA 3KUEA 5IS2A 3C95A 2LU1A 3FEZA 2NPFA 3UR0A 2L41A 2JUFA 3EAEA 1S97A 2LQJA 2YUNA 3MEGA 2CVIA 4E2FB 3A1YG 4BWJA 2MKSA 3PHEA 3LUYA 3DHXA 5AYFA 4ZITA 4A4FA 3VVTA 3DN9A 3GZ7A 1VQKT 4FYYB 1OJ4A 1JU5C 3OHAA 4LDUA 4OJHA 2C0OA 3TJ9A 1FNMA 4OB0B 3QT6A 4LT6A 5HQLA 1TH7A 3CCJQ 2J9DA 3TJ8A 1SPKA 5CQGA 3M6VA 2CUDA 4B3MJ 3G8QA 2HWHA 2IMOA 1U2FA 5IV4A 2DGWA 1GXUA 2RILA 3H0IA 3PCOB 4UOGA 2CZ9A 2GAGC 3QFHA 3MPWA 4QQ6A 1CSKA 1M0SA 2QTWA 5J2NA 2V63A 4TY8B 3TVZA 2OPPB 3KK1A 3DKMA 3PT9A 4LR9A 5FRMA 2DGQA 4DWIA 1RK8A 3WC2A 5ETLA 3J7YI 1Q78A 1UVNA 2B4VA 1FXXA 2GNCA 1HNIA 1YGYA 3THVA 3JCMP 1C1CA 4ZIWA 1LVKA 5L8RC 3RBXA 3M2UB 4KV8A 4E7KA 2HMAA 3VS5A 2XO7A 3GSIA 1V3ZA 1N88A 5IZHA 2DBMA 2A1BA 5KG1A 2IC3A 3JSRA 4P2XA 1QAJA 5EGYA 1R8AA 8AT1B 2DY1A 1HNWF 1TKZB 3G6XA 3OR1B 4X66J 3MMBA 2DJWA 5GAEU 3DRSB 2G0IA 3Q8PB 2C0TA 1MMGA 1CS4A 2AYMA 5KFFA 3IM8A 4PQUB 4O0IA 3C14A 1U0SA 3W60A 5HK3A 5KYUB 1BE4A 3TANA 2HHVA 2HHQA 2HEKA 3RR7A 4N4GA 3QBYA 3MEEB 2HVHA 3LWIA 1RJJA 1K9MC 1IN0A 4RBTA 3I6PA 1NM2A 4A47A 2OKQA 3ETMA 2DL5A 5E3AA 4X4UA 2QDLA 1S12A 4RW9B 3CE8A 3G8TA 4ZPDA 3C3LA 2DNHA 4KGXB 4NL3A 2N4CA 4ED3A 3OL9A 3KUFA 4O4GB 4Y92A 2H5IB 3A8LB 3ITHB 2EJ9A 2COYA 5KFJA 3JAME 3WVEB 5JJBA 3VGUA 4J9HA 3OW2S 3NAIA 2XGQA 2DFUA 3CJKB 4BC9A 4C11B 5AE1A 1Q16B 1X9MA 2J7IA 4U9RA 2ZZDA 4TYAA 2DYBA 3CCUQ 1FK9B 3HZGA 1WI6A 4ZVTB 5T7LB 1NDCA 2OLWA 4OYIA 3IP0A 2O01C 2IJFA 3N0VA 3V7SA 2WVBA 2D69A 2HGMA 2DR6A 1K1SA 3PTAA 3T5JA 4J7IA 1U6FA 3HFVA 3BN4A 4PYDA 4YY3F 3JCMg 4O6JA 2HZYA 1I51B 1ZAWA 1JLQA 1L3TA 5CKDA 5HJXA 3HJFA 2UXDJ 3JB9H 4F4AA 3EFOA 3JB9J 4PG4A 1X01A 5FU6C 3CCUA 1XERA 1FRMA 2IVYA 1OU8A 2KXHA 3OYDA 3TUZC 3EGXA 4BI3A 2B43A 2BJ1A 5HLFB 1P6TA 4C4WA 2QT7A 1HWUA 2VKRA 3QWUA 3TNVA 3E01A 4X84A 2JT4A 2WSFC 1VQ9S 4MK7A 3Q22A 1CS4B 4PR6A 2BE2B 4LIRA 4YTLA 1NSPA 3T3FA 3KWMA 3G4SS 4PKCC 1PJ7A 1QUPA 1KEKA 4J7FA 2FB0A 1DQ8A 1RBLA 3D6MB 1MN9A 3SD4A 3VUBA 1YLXA 4DS4A 2P0QA 2N4DA 2NQPA 4HVUA 3EXCX 3M30A 2F8MA 4ID8A 1ZUYA 3ISNC 4I7FB 2D74B 2Y4XA 2COLA 1KTVA 1UVIA 1VJQA 2AIRB 4M5HA 3GF5A 3G6ET 3OUYA 1C1BA 5A0YA 1JXOA 1PCXA 4DV3F 1S5ZA 3KBGA 2VZ9A 4DR4F 4I7FA 1GAOA 3V4IA 2UVUA 2XSFA 4YR0A 1OWXA 2CP7A 2B4UA 2CJAA 4OGCA 2VQFF 1VQOT 2EG1A 2CNOB 4EEYA 2FVRA 3OYLA 2XDDA 1G4CA 3D5MA 4OZ3A 2D9TA 1VOMA 2BOAA 2MQPA 5A8RB 4DV7J 1C0UA 1L3SA 3D68A 2HS0A 2COZA 1A0NB 4GKJJ 2QMUB 2YWEA 4ATNA 4KC5A 2V2ZA 1YFNA 2RKIB 4OHVA 2JEFA 1U25A 2P9GA 2Q66A 4DR6F 3LALA 1IBCB 1SSHA 2B9WA 1M90R 4EBDA 4DR2F 1FERA 4WWSA 1W2BR 2A6MA 2PUOB 3V8JA 1VJWA 2CG4A 4L3KA 3KUGA 2XNRA 1Y0HA 3JSBA 1YNZA 2K2PA 2QA4Q 1Z1ZA 3QT8A 1NK4A 1OU9A 2W8LA 1OY9A 1HL6A 2YKMB 1G8XA 1RP5A 3CJ2A 3V6DA 4ZVFA 2QIFA 2PVOB 2OSQA 4K5RA 3IC1A 1MWZA 1KQKA 3CD6T 1WXBA 2MZQA 1YJ9S 1SH2A 1OY6A 1UWBA 3H5SA 2PC6A 2KXNB 1PIEA 1OSDA 3SDZA 1AZSB 2O31A 2KTQA 4DS5A 2K4YA 2J05A 4OHWA 3GB0A 4RU9A 3VQTA 4EK2A 4F7VA 2JZ2A 4DV7F 1AYEA 2CNKB 2HHHJ 3JCMd 2PN6A 5B0AA 1PRMC 3PEHA 4LQ9A 2QYGA 2CYYA 1R8OB 2YKAA 1RUSA 2H65B 3MPDA 3CCZA 3CD0A 2ROLA 4NA2A 2F3JA 2B56A 3KK3B 4A8QA 1I6JA 2MMYA 1Q86U 3OS5A 1WSVA 1XEZA 2R2RA 5EHHA 2R7SA 4LJMA 5KFPA 4AYBD 1UEBA 3M2RA 5DLGA 1S6QB 2DVIA 4M77A 1AUSL 2BANA 5BYQA 3HMJG 4M78A 4R0KA 5CKBA 4O4RA 3HXMA 4RTWA 1VIOA 2RDDA 5CKFA 2JEGA 1XR5A 1ITPA 2KT3A 3T6BA 4TLQA 2R7UA 1OX9A 3Q83A 2NXJA 1VQ8S 3PFSA 1NXIA 5DETA 2B8QA 4ZGJB 2J9EA 3SIPB 2DH8A 4IURA 2YLBA 1ZM9A 4GO7X 1KHVA 2E5LJ 1M2VB 1Q81C 1G3SA 4PQUA 3EG1A 2CQ0A 2LEBA 3LANA 1OPZA 3UWNA 2JVOA 2MMPA 1Q8KA 4J9IA 4ZP8A 3LW5C 3SHWA 2RK2A 4DJBA 1UGRB 2F4VJ 4CO5A 2RT3A 3CJ4A 1T03B 2BABA 2ZHAA 4UOFA 1WYXA 2EK6A 5D3GB 4LF8J 4QBUA 2KO1A 1NAQA 5HQ8A 4HLBA 4FL6A 4A4HA 1SC4B 1VQOA 2DNRA 1Q81R 2FJXA 2E1HA 4CC7A 3BM7A 1SH0A 5EN1A 2ZBRA 2HFZA 4ES1A 5D4LA 1NEEA 3THKA 4PG7A 5D6GA 2HURA 3BGUA 4DUTA 2FB7A 1HR0J 2QYCA 4C8NA 1JLQB 3SQOP 2G2OA 4PEOA 4J5YA 5ECAA 4RNNA 3MFIA 5IN1A 3GYGA 4K4ZA 3FB9A 2K1RB 2CFXA 3OFEA 2R7OA 1D9DA 3PW4A 4WXWA 3ULRB 2Y3YA 2EQJA 1HHQA 2AEMA 3CC7A 2LP5A 3F41A 2DNPA 2JXBA 1PJ5A 1LK7A 2CAJA 2DNZA 2FQQB 3D3BJ 2C2ZB 2K3BA 4TNOA 3DOKB 1CJVB 3GR1A 1B07A 5I3PA 1F5BA 2R8KA 4GO5X 2GO9A 3M9NB 4RLEA 5F0WA 2H5EA 4D3GA 2N3OA 3QJJA 2DISA 5B08A 2C3MA 4AQYF 3M0PA 1NLOC 5D3GA 2ASLA 3PGGA 4EIKA 4C9DA 2VUGA 3HTRA 4NA3A 1ZSZB 4JLIA 5E3QA 3OXFA 1FMWA 4HI2A 5LJ3f 1CEZA 3MKDA 4LF4J 2UUWA 1K0XA 3MPYA 3BB5A 4GC7A 2VF3A 3SXLA 2GQQA 2OEMA 3CD5A 3JTPA 8RUCA 2ACYA 4ELVA 3CCRS 4B9TA 4CCHA 2QX0A 2K6DA 2MKHA 2Y8WA 3M0UA 1M2VA 3JCMe 2FZCB 2PQWA 3K57A 3C16A 3OBYA 4NYOA 5GVQA 2W2OP 1XK8A 4MT1A 2OTLA 3CULA 3SWNC 1TK0A 3C6TB 3TZZA 4UY85 2UP1A 2DJZA 3R5DA 3FNNA 1SL1A 5J26A 2YWHA 4ETXA 3DLKA 2RHIA 4NYZA 3BGRA 1UG1A 1TL1A 4DR3F 1RAHB 2AD9A 4NLUA 3FJPA 3M4YA 1X4BA 4LBHA 2QK0A 1GBRA 4NYPA 4LF9F 5LJ5j 2ZD1A 1Q7LB 2E41A 4B3SJ 1XIQA 3A8EA 3BQ2A 1MROB 1X43A 1FKPA 4PXBA 1VQ7T 2ZH5A 1HQEB 2AKLA 3QNWB 3PVQA 5DDOC 4WE1B 3GFHA 5DLFA 1IBLF 2XGPA 3V8KA 4BD3A 3FJ5A 5KG7A 1U1QA 5IAYA 2L8DA 2BZ8A 2YPYA 4GMKA 6FDRA 3UCUP 4I69A 3HD2A 1FVSA 3M8SA 5L1KA 4ES3A 4RUHA 4N0AA 3ULHA 3F73A 2RNEA 3ENQA 1EB0A 3PX0A 5LT5A 2HYIB 5I42A 4C92A 4DR1F 2JN0A 1LFPA 2A18A 5DJBA 2CDTA 2DBKA 4X9CA 2H4WB 2F2WA 3P8HA 3SCJE 3KNAA 3T1HF 3RTVA 1RT2A 2W1BA 4JS5A 2QE5A 3F70A 1FYNA 1P9QC 4EMDA 3CJ8A 1NB7A 1Q81T 2O5DA 4M78B 5K20B 2GJFA 4PLIA 4M8LA 4KH0B 4JB8B 4IG0A 1K8AU 3LP2A 2CSIA 2V69A 5HVGA 2GIQA 3HSJA 2J6KA 3SDEA 2RDJA 5E3CA 4C48A 2QQSA 3OXGA 1VQNQ 4ID5B 4M75D 2HHPA 1NSAA 1M1KT 2LQ9A 2EWHA 1JWWA 2RN8A 1LPLA 3ET6A 3J80E 3Q8SB 2KT5A 2RHXA 4JJBA 4OFZA 2OUGA 3JSMB 4LR7A 3MZIA 1KKHA 3FGVA 3OQ2A 1RAIB 1S4EA 1HBOA 3DGVA 3IS9A 5B0GA 4PJMA 2H8HA 3CMES 2LMIA 2FGOA 2KSSA 2ZH7A 5AXMA 4E7HA 2VQFJ 3EUNA 4CLSA 2FC9A 3EFRA 3CCET 4UQGA 2QLXA 2BYCA 1G3TA 4OI3A 3M6WA 4WF9Q 3KJNB 3EM1A 4WK3A 3OXLA 1UW9A 2PMZD 2M70A 2L0AA 2V2KA 4IQMA 3NL0A 1HNXF 4GKJF 3BS9A 3WQPA 1MWYA 1SUQA 4K4VA 4DEZA 4WFYA 4HEA9 1CJKB 4RTXA 2V8JA 1TXQA 5A76A 2G9OA 5EUHA 3V6JA 4X64F 3BSAA 4DX6A 1VS3A 2F5KA 1R27B 4LDYA 1FKPB 1JMTA 4IYQA 1FJGJ 1NJIU 4FT2A 5GAN2 2OTJQ 3CJ0A 4DV2J 3B4MA 1YI2Q 3OFFA 4ZLLA 3E2UA 4CC4B 1M1KC 4RCCA 5FIIA 2AZVA 1RT4A 5H9FJ 3VHQA 2VG5B 4QIEA 3CDUA 3W2WA 4ORZA 4YEAA 2VG6A 1D0ZA 1WNLA 3S3OA 3L9ZA 1HW9A 3MOJB 2V6AA 1XNIA 2IIHA 1K0SA 1HNXJ 4KPYA 3DHWC 1SIWB 2BA9A 2LDYA 1VRQC 1VQ5A 2HQHA 3OUYB 3M9OB 3EHQA 4NZ6A 4DPXA 5EX3A 3BR9A 4TU8A 3UD5A 5C5JA 3R8YA 3SFMA 4CC3A 3TWZA 3SBMA 1YBTA 5A2QU 1W4SA 1HWJA 5HQMA 1UE9A 4C97A 2VGNA 2CP2A 4M94A 2J6OA 5K14B 4ESRA 4KPCA 2X4WA 1NU4A 1F60B 5KT5A 5I2SA 3DLLQ 2WHOA 3H8YA 3DMJA 5J2PB 1PRLC 4J9KA 3IBFB 1E6VB 2VV5A 3GWCA 4F67A 5KFAA 2PD1A 3NGPA 5GMDA 1NK9A 1K9MT 3QGHA 1ZH5A 2DNLA 2AJFE 3FFIB 1U09A 1OMSA 5KH6A 2UXBF 4C92B 1U6ZA 1X0PA 3S01A 2FDNA 3PE0A 3IAS9 2WACA 2W10A 2KYMA 2LA4A 3CCTA 1JLCA 1BBZA 5L1JA 4IDKA 2X3DA 5THWA 5CQYA 1QE1A 4ES2A 3JCMb 3RDVA 4F3OA 2IJNA 4M7DC 3SSRA 2DEQA 3L2WA 2HZVA 4E7LA 4FYXB 2FVPA 3QFWA 1N48A 1SPBP 5GAN5 4NLGA 4DOZA 3E1SA 2XMUA 1TAUA 3R6LB 4KAIA 1N34J 3NEKA 2AT1B 4L3NA 5F8IA 1XR6A 5KG6A 4WTYA 3Q2TC 5LJ5d 4CT9A 1I94F 4EO6A 3BGRB 5KG4A 3T5KA 1FTCA 2NCKL 1FWPA 4NE9C 1N32J 2HWIA 3MI7X 1Q7YC 1LWEB 1HR0F 4JZ3A 2D8HA 1XJWB 2HS4A 2EFPA 2MIOA 1UW4A 3L7UA 2H5JB 2L3QA 5JUMA 4J9PA 2CPYA 3I5AA 4CRJA 2B7BB 1S9FA 2MDAA 3LP0A 1KS2A 3V4MA 4B3SF 3SYZA 3VZHA 3CB4A 2OFHX 1HLWA 4NS5A 4P10A 3I55Q 5HVFA 2DRBA 3TSZA 3BFMA 2XZTB 3OL7A 4FXDA 2EFNA 3W2WB 2K7KA 4JI4J 1X8DA 3FDRA 2W0ZA 3SMZA 3TCJA 2C2EA 2FLNA 1ZSZC 2XG8D 1BIBA 2ZZNA 4M7DF 1VQMS 2FHMA 2HVZA 5L9NA 1ZX6A 3WC0A 2CH4A 2Q3PA 3KFWX 4M7DG 4P74A 3A5ZB 2AKKA 4M5IA 2EBPA 4DZDA 2Y8YA 2R7QA 1QKXA 1DFDA 1X60A 2QAZA 4R25A 2V2VA 2BDPA 4MMOA 2IM2A 3H90A 3GV5B 3G7ZA 2IMWP 2BEFA 2C42A 3CEDA 4HVZA 1JJ2P 3WHIA 2CVEA 1XOVA 2PA3A 1LWEA 4O0NA 1HMVA 1EIFA 4M1KA 2WK4A 3TEEA 4Y2CA 2BRLA 4ZP6A 1X2QA 3Q86A 1S10A 1WEZA 3PTWA 4PJOA 1LKZA 2OAWA 1FD8A 4LDWA 2FJBB 3N5FA 1NSQA 1T95A 1N32F 4OV1A 4N41A 2NPIA 3Q8RB 4ZVPB 1E6HA 2I5JB 3TA2A 3EGZA 1NK7A 1UWBB 3M7VA 1G83A 2ZH9A 5GANj 2ROEA 2FHKA 5E3RA 3J81U 5KG0A 4EMKC 1VQLQ 3V6DB 3O3LA 1KTQA 2O9VA 2ZH2A 3MPVA 3LWLA 4B9LA 1K9MR 3QHSA 4F7UG 2EKHA 1TFYA 3HT3A 2M16A 2LU2A 4C3LA 4GLKA 1E6VA 3OVBA 3NFCA 2OPSA 1H0HB 1U1RA 1TUWA 1UJ4A 2F9DA 2ZHOA 2QRRA 3GIRA 4IG0B 4UQTA 1DRZA 3CCST 2WB4A 4DFJA 5FWCA 4MK9A 2W24A 3CUNA 2EYYA 2KT8A 3HULA 4DR7J 4DG1B 4EMKA 2YY3A 3DI6B 4P72A 2WSCC 1WDTA 1KQFB 4B9XA 2RQRA 3K5OA 2V1RA 4KHRA 1BU1A 3IRXA 4AL6A 2LJ1A 5LJ5g 4TN2A 4DX7A 2O67A 4K2XA 5T14A 1W7WA 2Z2MA 3CCJT 2DR8A 1FRHA 4ZVSB 1OO0B 4MZMA 1RWVB 2PNIA 2P8IA 2RF2A 2LQNA 3M8PB 4ILLA 2KVQE 4Z8AA 2MZJA 5G0RB 4ZJLA 2H54B 1AOJA 4RW6A 5H1SV 5DQGA 3HP6A 4DL0C 3LOUA 3VS2A 4DZ6A 1T02A 3MMAA 1VLYA 5A6PA 1UEVA 5GAMg 1QTMA 3VUZA 4OZ1A 4CNYA 4DV3J 1FDNA 1FMVA 1K73T 1D9FA 1SEMA 4Q45A 3L2QA 4DR6J 1V3SA 3AA9A 3QWPA 1Q95G 2FHDA 1G2BA 2VKNA 1FNOA 1D1BA 3L2ZA 1RTJB 3UDVA 4CLLA 1RTIA 2WONA 4KBIA 3VS4A 2E65A 1AD5A 3I96A 3MPUB 4ED0A 3RR8A 4PG5A 1JQGA 3H5YA 3NBPB 2OSRA 2J0WA 4GY5A 3O5TB 1Z9ZA 3OTDA 3M58A 4LFAF 4J9DA 4IRCA 4HACB 1E7OA 1A0OB 1VHIA 2VFUA 5KOXA 2DA9A 1SKRA 4HL9A 2EFOA 2IVMA 3W7BA 2XI9A 1LOUA 4Q0BB 3DI6A 3HK2A 2DL4A 3PR5B 2UVWA 1XNRF 1JLCB 4IKFA 4TU7A 2UUBF 1JXMA 1QP2A 2MQQA 5HK4A 4M78C 9ATCB 4P2SA 4ZCKA 1YJWT 1N56A 4U95A 3FBFA 3M4XA 2X1BA 1B3TA 2HVIA 5LMUJ 4RUCA 3I55A 2HNDA 4VUBA 3DB3A 2EJFA 3HVAA 2GVDB 2XY7A 1Q7YT 4IOBA 2GHWA 1TMMA 1I5OB 2K3IA 2ENMA 1I4K1 1M8VA 4B6MA 3CCLT 2KGTA 2QYZA 5GAOl 2Y0SD 2J6SA 3BDPA 1BUXA 1CJVA 5AJ3J 3QDFA 3LP2B 5KFZA 3ZBDA 1KONA 4C92E 3HPWA 4ED4A 2G1HA 3G82B 3CIZA 3JCMc 2NUUG 1B0PA 3I0RA 3HHLB 4GLMA 2R4FA 1TZ0A 1RHKB 2PSZA 1EKRA 4JI1F 1V5IB 2ROPA 1VQLS 5HVHA 1VIFA 4KJIA 1GMUA 1WOPA 3ITHA 3CC4Q 4DR3J 3PHTA 4FNIA 1W1FA 2DPPB 2OP5A 3V4IB 3CCUT 3JB9F 4ANJA 4LF5J 1NSKL 4ZPCA 2HHUA 3HHLD 2W9AA 2GMLA 3HKWA 1HNVB 1M4ZA 3VAKA 5FU6B 1H98A 3K8VA 2I2YA 1N8RR 2DRDA 4A48A 1DTQA 3QPHA 4OVAA 4QIWD 1Q82C 4B9NA 3JCMW 2DNOA 5EWGA 3WZ0A 4UUWA 1K44A 3PM9A 1VQ9Q 2DX1A 4LXCA 4OLOA 5KAKA 3Q2SC 3VVUA 4BCAA 2Z56B 1VHFA 5F41A 1C4AA 2EW9A 1PG5B 1HHSA 4C5GA 4OB2B 4Y2AA 3QXEB 2EC0A 4RBVA 1KC8T 2VFTA 3E9FA 2F40A 4OYPA 3ILJA 2IAJB 1GRIA 3MEAA 3CDEA 1PKSA 4ZOSA 2R8GA 1ZBXA 4Q7AA 4H4MA 2CT3A 3LX7A 3M32B 4DPOA 2W4DA 3I5RA 4YUDA 3KJFB 2AJ0A 2Z2YB 3FQLA 1S1UB 2K9GA 2IA0A 4LNPA 5CK9A 2AGQA 3K8WA 4P7VA 4ZIVA 2C2RA 2E9ZA 4RCBA 2ZBPA 2CZ7B 3DOMB 1DJ7B 2J7UA 2PGCA 1L3UA 4X66F 4NXMF 1KOHA 2J8SA 4DR5J 2Y1RI 3CCRT 4WU2A 2YH0A 3TAMB 5JVHQ 1EZZB 4IUFA 5FU7C 2E44A 2F2XA 2KJVA 5GMKa 1EJ7L 1TL1B 3VYGA 4F7UB 3ISND 2ZVSA 3GFYA 4JJNK 4OZJA 5CD4A 3CBOA 5KT2A 3FRYA 2JTEA 3DB4A 4XDDA 4M77B 2IYGA 3GIJA 2QSFA 1QAXA 1IZ6A 4DU7A 4OHZA 2RRAA 4DSKA 3GSDA 2O66A 3LQVA 1VQ5S 2X4XA 3KK3A 4LREA 2DXDA 4IG3A 2XWXA 5HP1B 2NUZA 3AXMA 1WC4A 1WDXA 2KAFA 3C94A 2V8PA 1G2EA 4EMKB 1D0YA 4FKXA 3F0NA 3AD7C 1T9TA 3EVOA 1JLBA 4PKDB 5K8MA 1MMNA 2BTTA 4A8YA 1UVMA 1QWEA 3J7AF 4FPRA 2UXBJ 1JJ2S 2LC4A 5ADZA 1SUQB 3DOKA 2GGPA 4NMXA 1IKVB 3EZUA 3H20A 3CJ3A 3FEOA 2QEXT 4WKRA 1RAOA 1XC9A 3DGPB 1KQGB 1UZDA 1SJFA 1CC7A 3EZOA 2HG4A 3CPFA 4EBEA 2BM1A 4PG6A 4DQPA 3GQCA 4AL7A 2DYAA 2FD2A 1YWPA 4G6VB 1VK3A 2ZC4A 3D2WA 1BWEA 4ZP9A 3OS0A 2JLFA 1RI9A 4UT4A 3A1PA 1JKHA 4M75G 3CXCA 3MHYA 4OLPA 4G1IA 4DSEA 3OSSC 5KCOA 4XU1A 2K7JA 1NK6A 4E6RA 4PJOB 1SKSA 4E7JA 3CD6Q 2K3YA 3NP5A 4NLRA 1MMLA 3Q8QB 1N34F 2V0NA 4B3RF 2HL3A 1VQMT 3REBB 1KSPA 2R2UA 2B7CB 3CC4S 2E7XA 5A8KA 3VF0B 2AJQA 2EKNA 5D78A 4QVZA 3HKZD 1PCAA 4DCOB 2R7TA 2ZPFB 1T05A 2EW3A 3LGFA 3BZQA 2DIUA 4KO0A 2JW4A 4RNHA 1R31A 1WUUA 4KKOB 1R0AB 4F50A 2C2DA 2UUCF 1NPPA 1ICEB 1S1VB 2RQWA 4EZ9A 1FRJA 2MQLA 1WF2A 3G6ES 4X4RA 4FBUA 1M1GA 1GT8A 1VUBA 4USHA 1D0XA 4YN3B 2JEJA 2VOOA 3QRQA 3JAMU 4QW9A 4EPCA 1YKWA 3GV8B 2OX7A 2MXYA 3V6HA 1YJWQ 4WF2A 1WHLA 1HBMB 2HBPA 2M3DA 2YH1A 4NCGB 1QJHA 2F4VF 4NEZA 2KDSA 3MF5A 2FJVA 3CPWP 2H51B 1U45A 2HLUA 5HL7Q 2WBMA 4I64A 4DOVA 4MMKA 3QYHB 4D3HA 2CH4W 3HRSA 3IM9A 3OYMA 2KZMA 1K73C 2P0KA 2VL1A 3ZTSA 3G87A 4K4TA 3QRRA 3IR5B 4PPZA 2IG0A 3MP8A 4YDDB 1AROP 4FS2A 1RKJA 1NNDA 2K06A 2QLBB 2MK5A 1EX4A 1NKEA 4L76A 3HFNA 3QDRB 2QV6A 1OV3A 2OFGX 1BYMA 2BANB 5HLFA 4DV5J 3IWNC 2MEWA 2IIMA 1VISA 1YQHA 4OI0A 4UTGA 3CBMA 2LX7A 1BI3A 3BDUA 1Q79A 1PHTA 1VYUA 1WC6A 3EFOB 3MTKA 4PPDA 2B4PA 1AZSA 1WKKA 1Q86R 2GTJA 1IBKF 4DBRA 2DE0X 1R0BG 4DLEA 4PXCA 3UPFA 1HJDA 4E47A 1DTTA 1CQMA 3JYTA 4OHYA 1J27A 5E2QA 4LF7F 1LEOA 4DR7F 1NJXA 3CO0P 2QDYB 4M5NA 1HQUA 3W8PA 3BKFA 4RU2A 3VALA 4M75A 2RMOA 5DY9A 4ECTA 5C0MA 4IDKB 4LFAJ 4XO0A 2EKOA 5KFBA 3PJWA 3QSYB 1D3BB 3RKWA 3CCJS 1WC0A 1FJEB 3W2VA 1SF9A 3QAUA 5LJ3h 2MJNA 4ZK7M 3VKIA 1UA0A 3M8QA 5D0HA 1UJ5A 1QP3A 3G9CA 2RKIA 3HFZB 2HQGA 4JRQA 2G0JA 5B0EA 3TYTA 3RZAA 4DBHA 4URGA 1KVIA 1T7PA 2EYZA 3CCRQ 4H4KA 3SSSA 2HAXA 3CCQQ 3T9NA 4X4SA 4TY9A 1RL2A 2I5JA 1UGVA 2SXLA 2RO0A 3GNFB 2DZCA 2I38A 4FVMA 3E8OA 1NHKL 3MHXA 2KRSA 2CZ4A 1KD1R 5KYXA 2C3OA 3D6HB 2F4FA 4QVCA 1WF0A 5HI7A 3MEEA 5ETVA 4RG2A 1AT1B 4NZ0A 2H3EB 2M9KA 3THPA 2BJ9A 4QWBA 2FJAB 5KYUA 4PQAA 3PIOA 4F0HA 3UVJA 2MLZA 4G1QB 4JUZA 4JI3F 4C98A 2XDPA 1B7TA 3DLLA 3M59A 4LF4F 2FYXA 5BR8F 3PKYA 2FHJD 3DFEA 2EI5A 3T5HA 4LSZB 2EFGA 4GRSA 1PD0A 4ELUA 1AVZC 1UTAA 2KFYA 1N5YB 2YRCA 3K5LA 5D4OA 3MR7A 3J7YU 2O1PA 1U0HB 2FRWA 3O44A 3ZZPA 2W2MP 2Z0WA 4UZBA 5C2CA 4DR4J 3CMQA 4C8QA 1TVRB 1Q86C 3UN5A 3GYNA 1YJWS 1SJ4P 5BYSA 4M7AE 1RA6A 2ROTA 4E98A 5LL6d 3R2DJ 2F69A 4M78F 2M5YA 1ABOA 3M2UA 2QN6B 1QWFA 1C0TB 3NGRA 1NJIC 2R8IA 1VQOQ 2V34A 1HNIB 4PJNA 2FRYA 3H0HA 3NMAA 4FF2A 2OPRA 2BQUA 2XIDA 5CAIA 4OYOA 2JS2A 3HVTA 4C5EA 1IM4A 3P6YC 2DRKA 4OX6A 3UATA 3X20B 2JC0A 2HHTA 1VQ4A 1M5PC 1GXLA 4QU7A 2DXUA 4XU0A 4DV0F 1VQ7Q 2Q6BA 2OJ3A 2ALYB 1YHQT 2I2LA 3CC2T 3GIKA 1QW1A 1HD3A 5L1IA 4F02A 4HR2A 2ZWOA 2HNZB 3W9IA 5GAN8 4J9SA 1LWFB 1ZBJA 4L6V5 1D8YA 2QA4T 4QZVB 3EG9B 2JMAA 2GGPB 1PYSB 2H4YB 2KR3A 5IT9U 2QEXA 3QSUA 5JVGQ 2X9HA 5B0DA 2GJIA 2MPXC 3KXDA 3QJLA 2ZC3A 1G3YA 1VQNS 3AD8C 5DM7Q 1KHIA 3EHRA 1M5OC 1FRKA 2JRSA 2LXIA 1LWCA 1URRA 4LIWA 2RI3A 1NDPA 5KYWB 1K4US 3KLIB 3BE3A 2CZ0B 4QR0A 4HTIA 2R7VA 2WSCE 4EWTA 1R0CB 4AFSC 5GAGU 5FLXY 3Q0AA 3POTA 2PI4A 4C3KA 3JSYA 4C8QF 4FS1A 2GCFA 4USMA 1LOJA 3BBBA 2VYTA 3ZTQA 5ETPA 2DNMA 1VBXA 4USTA 4J9EA 1GX6A 3OHBA 1U2RA 5LMNF 1VQNT 2A2DA 5FWBA 3GOXA 4BDYA 3QO3A 1BD6A 1BMQB 2B4OA 2M4MA 1Y5NB 4XTZA 2VWFA 1W2IA 3FUYA 5IOLA 1ZOTA 2P9CA 2GNKA 2ZZTA 3M5AA 1WHMA 1NO8A 1UWAA 3GG1A 2L08A 1ELOA 3B54A 2A28A 4K4YA 2HNYB 4C0ZA 5CABA 2HQFA 4Q5WA 3URGA 1S1UA 1O9SA 1B64A 4JV5F 1MWQA 2DD8S 3DMJB 2BRKA 2E66A 4CRIA 2G2YA 5KFHA 1KHCA 1Y3JA 2BE2A 4RKUC 2I1RA 1PJ6A 3LH0A 3FEYB 4QQDA 4IR1A 1UVKA 4QIVA 5B0CA 1HI1A 3FC3A 1TV6B 1HD0A 1KD1T 2DGUA 5GMKi 4W90B 2BJ8A 1VQ5T 2VG7A 1UGQB 1TELA 4CLFA 3I56S 4G1PA 1IWAA 3PACA 3MCSA 1KIKA 3PMIA 4NZ7A 2F63A 1P8GA 2FLLA 2XDBA 2YNGB 1S1WA 4MAKA 3GIMA 1CKAA 3EWGA 3WXMB 4CH7A 3MAQA 2QA4G 2EKYA 1K9AA 1PSDA 3M2RB 3C6TA 2CQ1A 3B6BA 1JLAA 4NLQA 1YI2T 4LRDA 3O8VA 3UA6A 4HVVA 3NTKA 4FSXA 1YJNQ 2BM0A 1XNQJ 4LRAA 2M02A 2HRUA 3DU5A 1SRLA 1JLGB 1UETA 3KLHA 5KTQA 1Y96A 4U7CA 5B7WA 2IBOA 3KK1B 3QMQA 3DOLB 4OZ2A 3U23A 2EBEA 5M9OA 3A8MB 3HPOA 2CQHA 4I68A 5F8LA 4O44A 3CCQT 1WG4A 2XBPA 5KT3A 1B34B 1VQ7S 4ECVA 4C0OC 4KULA 2KK4A 4F2RA 5I3UB 1QM9A 1OEBA 2PFDA 2WTFA 2BV3A 5ETQA 5M2PA 3ELHA 2KU7A 1XWLA 4I2QB 3RB0A 3MEDB 5DM6Q 2B86A 3M57A 1HK9A 3BDLA 1F0XA 4XTWA 2HSEB 3CXCP 2B6AB 4IIMA 3IR7B 1NLPC 1U4BA 2CWXA 2CQCA 3RKYA 2FJWA 1XMOJ 4Y2MA 3ASKA 4EUVA 2DNUA 1A6LA 2EGCA 4Q0BA 3Q8UA 3N6LA 2F7VA 5IV3A 5I3QA 5DQHA 1SG5A 1IBMF 2R42A 1OY8A 1KC8R 3IMQJ 2BUNA 4ICLB 3G4ST 1B0VA 3JQMA 3SZ2A 4C8ZA 1BI2A 3KLFB 3T19A 3KMQA 1S1TB 4OYBA 3MMBB 4ID5A 2O9SA 2HFNA 3QYGB 2RU9A 2FLPA 4DV4F 3KJQB 2KMTA 2QL9B 2YHTA 4NXNJ 4H54A 3HRUA 2RHUA 3LYIA 3OMCA 4ELTA 1JXVA 3D4JA 3OYYA 3CCLS 2HRTA 2VC0A 3CW2C 3J7A1 5D6YA 2ASDA 1MMAA 3P8DA 2CP6A 3FCWA 3QYYA 2IHR1 4LDXA 1T03A 5D6WA 5AXNA 2G0CA 3RYLA 1X5TA 2I0NA 2RM4A 4I67A 2UU9F 2MAMA 4ED1A 1YTYA 4IFVA 2DKOB 2D3OR 4EBCA 2DNYA 1OX8A 1TWBA 1EFNA 4C5IA 1VQOS 2BMBA 2FHJA 3ISZA 1Q0NA 3EZ5A 3TEGA 4J8OA 2DL7A 3KNGA 2DK2A 3CJQA 3NGUA 4S0MA 2QMWA 1RQ0A 1KQ1A 2ESWA 5D8HB 2OD6A 3CJRA 3BEGB 3H0PA 3PY8A 5GJWB 1YIJQ 4Z89A 4KFBB 3G6EA 2CQGA 3CJTA 4LF9J 3JCMV 2DH9A 3ENVA 1VQ6A 3JB9D 2JFDA 1MROA 3QZ9B 4CQ1A 2LQBA 4M7DB 2YWFA 2OEKA 2CUYA 2Q6CA 2RRNA 2ZPGB 2VXEA 2AKWB 2CPJA 3OMGA 3EJMA 1H7XA 3CQTA 1KP6A 2ZBIA 1VYVA 2DR9A 2AF6A 2E3HA 1UA1A 1QCOA 2EBGA 3BQ0A 2QFIA 3CMAT 4OX8A 2RQVA 3A3OB 2E9TA 1WFWA 4L5GA 4UOHA 1HQUB 5CO7A 3CPWR 4N4IA 3DRYA 4DLGA 3P5TL 4P2MA 1SKWA 3PVLA 2VJUA 1WG5A 1CJTA 1DTTB 1B3QA 3CJSA 3A98A 1R8BA 4ZVEA 5A8WB 3PYDA 2NXEA 1RA7A 4YR2A 1C1CB 4KUDK 4DUZF 4DR1J 2I9SA 2XG8A 5BJRA 3C15B 3TR5A 1EAYC 3MCNA 3MURP 3PW0A 1WZOA 4OZ5A 3MCMA 2WZ1A 2B6AA 4X4VA 2LXUA 2F1FA 1TU0B 2QXFA 2XNQA 2R2SA 2BE7D 2MF2A 1WTFA 4JI7J 3S8SA 1M3CA 3KJVB 4QR2A 2V4JA 3AQPA 2BVZA 3KLGB 3EPGA 5H9EK 1R43A 4ECXA 2FPEA 2B9EA 4IOAQ 2MKKA 2VVKA 3CXCS 3DLGB 4R5PB 1OQ3A 3PIPA 1RTDA 3IXQA 2E64A 2H9ZA 3PW2A 2XMVA 3JCMQ 3DGPA 4HH1A 1UP1A 4ZKAA 2E6NA 1RI0A 3JTOA 3QT5A 1WACA 2HLTA 1JLBB 2LCSA 1FRXA 3LAMA 2R57A 3VZIA 2AHJB 1B7YB 1RADB 1TKTA 4U7UK 1HNZJ 1RT1A 4B9SA 2V8KA 4ECZA 2BKOA 3RNJA 1PSEA 4IIOA 2BJ7A 3EX7B 2GQ2A 2YSQA 3AODA 2CPIA 4FSSA 1CBKA 3CT9A 4BHQA 3DRSA 1JXLA 4PJOC 3PIOQ 3LGMA 4B3MF 3OJUA 3D67A 5E3PA 4IUQA 4BLGA 4NCBA 2RAQA 2XMMA 5A0LA 2DRAA 3D3CJ 4CH0S 4LFBJ 2XB2D 2ZUAA 1KNZA 1TUDA 3R97A 4B3RJ 2K7AA 4U67Q 2BZYA 4DOWA 1YJNS 5M2RA 2BR0A 4NX9A 3HLUA 1SHFA 1QDUB 1BLUA 3V2UC 2WVFA 1QMCA 2L2PA 4MTPA 4MJKA 1WSRA 1WWHA 4JV5J 3MFHA 2MGZB 5GAOp 4UOCA 3RJMB 4LQ3A 1ZAVA 1VBZA 4M7AG 1UAWA 3TEHB 3PFOA 4C8QD 3UT1A 1S1XA 2LEAA 2F65A 1FDAA 1R6YA 4WYLA 3GILA 3E01B 2RB6A 4ZPWR 3ZTOA 2DAQA 1VQLA 3B78A 2JJ4D 4KT0E 3VS1A 1WJRA 1QVGS 3KDOA 4A8XA 4ED6A 2QG9B 2FZGB 3M8RA 4CC2A 1RAGB 5DLQE 2EGEA 1JJHA 4ZJOA 1SL2A 1NYFA 3TX8A 1DTQB 5L39A 2JC1A 2E5QA 3EVMA 5IWAJ 3NS5A 2WVEA 5IHNA 3VGSA 2XY6A 2OTJA 4Q2LA 2HVEA 4X1VA 4EO8A 3R5GA 4KR0B 2CIMA 1GNKA 1NPKA 1KLMA 1R3NA 3I5CA 2FVQA 2XKOC 1UZHA 1YWOA 4PUOA 3H59A 3D1QA 3DDNA 2ROGA 4MZTA 4C8LA 1WD6A 5FU7B 4QWEA 1JX4A 1FA0A 4LVOP 3WIVA 2X35A 4CNZA 5T7LA 4LSNA 1ZA1B 3LLRA 3R5CA 2ABYA 2V4RA 4XPCA 4M5MA 5I22A 4UF4A 1FE0A 4C0BA 1V3RA 2X1GA 3HP9A 2OMLA 3KG1A 2MY8A 1HPZB 4OX9J 4NLDA 1VQPS 2AJ2A 1X31C 4DSLA 4IQXA 4KE5A 2XMWA 1Q7YU 5L38A 2CQ4A 4NL5A 2NYIA 3CCLQ 5DZ7A 3CD6A 2BE9B 3ETOA 1JLFB 1BY9A 3DM2B 2VICA 4XU3A 1LK5A 2V26A 2VQEF 2ZKTA 1D0EA 1WF1A 1YIJT 3M55A 4FDFA 3N28A 2YUQA 3KLVA 4O3PA 2HFOA 4BI8B 1X4CA 4A8SA 4MKBA 4KGVB 4FVCA 2VIHA 2HL5C 1RT7A 2RPNA 1IUJA 3M8QB 5ETRA 5H9FK 4LFCJ 1EETA 2HK2A 1NJIT 1RU2A 1T9YA 3VV2B 1R6VA 4LUEA 1WLPB 1W2BP 2YNFB 1VCTA 2OTJS 4C92C 2RJDA 3I55T 1QVGR 1YI2S 4NXNF 2ED1A 3ZZOA 4JV1A 1YIJS 4HDGA 3RAXA 2CADA 2DL3A 1VGYA 2VPZB 3Q24A 3CF5Q 2VUBA 1WOOA 5GMKl 2GQCA 1TTHB 3NBPA 3VGVA 4XTYA 3C0CA 2NZCA 3EG2A 5GANe 2CZ1B 4CP5A 2XTJP 4FF4A 2HHHF 5BR8J 1U1NA 3VAHA 3HT0A 1FD2A 1RBOB 2WRMA 2LQ8A 1UMJA 4RG8A 1U0HA 1VYAA 5KYYA 2RUGA 2LYVA 4IH7A 5BXIA 1ZQ1A 3OS1A 2OTLS 2UVVA 2KRMA 2VKZG 1HARA 4USUA 1UUEA 2QLWA 4OYWA 2P5VA 1WHHA 3Q8YA 4JZ4A 3J81E 1WTBA 4K0KF 4GVBA 3CMAA 5I4MA 3VJPA 2BJ3A 2XM3A 5CYMB 2RH3A 4KT0C 1ZETA 7FDRA 1RZMA 4JBCA 4XDCA 1FFWB 2OD4A 1QVPA 3ZEHA 1FXDA 2V2QA 4R8UB 1FXRA 3OQ5A 1R8PA 2CQ3A 4BE0A 2QFJA 5E5NA 1GFWB 4DL3A 2CDQA 1CVJA 1NEGA 2RJZA 4JS4A 3R7SB 3U1MA 2VXFA 3T6JA 3KG0A 3RRKA 3N01A 2JTFA 3AJ1A 1JRIA 2RJEA 3SDEB 2RJFA 5GAOn 3W66A 2J0QD 4OB1B 1U8WA 1WXTA 2GQVA 3TQ7P 3CMET 2DF6A 1HBMA 4YMEA 5JMNA 4DV6F 4IUVA 3UPUA 4MDWA 1IHWA 3BH7B 2UUBJ 1CG2A 3IA0A 4LE9A 2FUG9 4HCZA 3EGXB 1MMDA 2Z0GA 2DGOA 1TG0A 1WDDA 2XSJA 2LDMA 4J6WA 3MD1A 1SXLA 1FESA 1NK5A 2KY9A 1GXIE 1VQ9A 4LSLA 4FF3A 3RB4A 4TQSA 1NEBA 1BCMA 3SEMA 4KKOA 2D0QB 4ZCMA 4N76A 1FWLA 2W9BB 4OZ0A 2DO3A 2B5JA 3GPLA 2UUTA 3KG4A 5T41A 2XYGB 2DTIA 4M77G 1PKUA 2BKPA 4X64J 1FWZA 3EE3A 2A10A 3CCJA 1SCJB 2D41A 3CD7A 3BW1A 1VC0A 3TP2A 4C8OA 4JI2F 3N5BA 3MM6B 3G71S 4LFCF 3H2UB 2E1CA 1MSWD 4M63A 2UV8A 1VQ6Q 2EYQA 3CC7T 2CPFA 3BBFA 1YIJA 5DG7A 2VOPA 3MEVA 3CCMQ 1W2BA 3TVTA 1KFSA 4MIAA 4WZQA 4R55A 1HQEA 4O3OA 4U8YA 2PZ1A 2D6FA 2WOMA 1YI2A 4LUBA 1R8HA 4GVBB 4LR8A 3BGOP 4RMOA 3RB3A 1RYRA 1JKHB 2YWKA 2LQWA 1M90T 5HATA 3CCVQ 1RT3B 2VFVA 2ZM6F 3MAAB 4EFAC 2OHDA 2WW8A 2YNHB 4EDUA 2GZOA 5CYJA 1D3WA 4IFYA 1FE4A 3M0TA 3JCMh 5IXBA 4NLTA 3RU0A 5GMEA 3W5YA 3RKXA 2M8DB 4JV0A 1VQMQ 2CXEA 3H7HB 2PT0A 5D15A 4UC4A 1SHGA 1U6BA 2D9OA 4L72B 4IR9A 2RK1A 1N9SA 3PEJA 4O3RA 1FF2A 3OR2B 4RNMA 4CH1A 1HWKA 5I11A 1OULA 2AGOA 5LJ5e 1MW7A 1VBYA 4PXEA 4Y3CA 2ZVIA 1V6HA 4C6AA 3UNGC 3S3NA 3JV3A 4ZMMA 3H25A 1H3HA 4JP8A 1H73A 4TYBA 1F5AA 4IG3B 2JZ5A 1N54B 1ZBTA 2CKWA 5EWEA 1M1HA 4KRTA 2N3LA 4MKYA 3JB9I 4KUIA 2CJQA 3PX4A 2FGCA 4ANDA 5GMKm 2LVWA 2OI2A 1BQNA 2HHSA 3US5A 4M7DE 3HHKA 3GCWP 1EX8A 2FL7A 4QQBA 2DHAA 2DVEA 2OEJA 4P52A 4BE1A 2OJ2A 2C2KB 2J9CA 3PYEA 4DI6A 2EFQA 3MAAA 1KG1A 1JLFA 3DM2A 2IM1A 2LA6A 3G71A 1OQ6A 4M5DB 3FLGA 3D7SB 2ZE2A 3PX6A 3PZPA 4OMNA 1S72T 3FDSA 3O5ZA 2E1MC 1HKAA 1HPZA 1Q53A 2GO8A 2R3VA 5CVIA 4ED5A 2DGXA 1Q8BA 4ZLPA 4GVLA 4NLVA 1S9EB 2PEBA 3LPEA 1DQ9A 3OB9A 3RMQA 5FJ4A 5IT4A 4MIWA 4K4WA 1YITQ 4MYTA 1FX7A 1H72C 1DJ0A 1V76A 5C42A 1NJZA 4ZLJA 4ZS6A 2GW8A 5GMKe 1PAEX 1RWMB 3UN3A 1RTHA 4B9UA 5GANh 5FLXU 3PW7A 3AFGA 2DL8A 2B5JB 2F5TX 2QJ3A 1UPPA 2E12A 2IA6A 4Z02A 1ULRA 1MLAA 3CC4T 2RQMA 4NASA 2DH7A 3TI0A 2FVSA 1I1JA 3GE9A 1N5SA 3KKFA 4B9VA 2CJ9A 1X5SA 2EIFA 3FZBA 3C4SA 4C92F 3OS2A 1T0HA 3MM8B 1LJOA 3VAMA 3I9ZA 2J6UA 3J81j 2MQ8A 5IQQA 2UVRA 1HBNB 3D9BA 2C2MB 3I87A 4MMLA 4CIOA 3QPIA 2ASYA 4RUAA 1EQMA 2NUPB 4RUGA 3KLIA 2KRNA 5J2PA 1X4EA 2HNIA 3L2RA 2M0YA 1CC8A 1S77D 2A2CA 2DO4A 3K5MA 2GHPA 3S6EA 4ZN1A 2RH2A 2CUBA 1KD1C 1RWUA 3BBCA 1PSFA 2XS5A 2E70A 3DOMA 1TMJA 1Y07A 3MUVP 4WFAQ 4PYAA 4O23A 2CT4A 2DGVA 3KHHA 1Q86T 1REVA 4B3OA 1JLEB 3FKBA 3R1HA 2HEQA 3G8SA 1VQKQ 1M9SA 4RNFA 5A2QY 4JDSA 3QATA 1PILA 5J1EB 4M5JA 3BYRA 1SC3B 1UFLA 1FI4A 1JNRB 4IO1A 3PVXA 1XNRJ 2ZNYA 2QC3A 3DYAB 3MM8A 4FW2A 4KSEB 5CCLA 3MCOA 3L3CA 5LJ5f 4O5VA 1ZZFA 1CJKA 4M5KA 1O75A 1X6OA 3H5XA 3OYIA 4F4KA 4WP9A 2KRRA 2KRBA 2LX9A 1RTIB 2WONB 3QT7A 2WAQD 3AJ2A 2WW4A 3PYGA 3CC7Q 4QPTA 2KVQG 4P71A 4FPIA 1N5YA 4FBTA 1I07A 4ZHRB 2VPXB 2NR0A 3OA6A 1T8EA 2IBKA 2KNBB 3IFEA 4JI0F 5CCMA 3N6NA 1VQPA 4KYZA 3L95X 2QEXQ 1UGPB 5IXUA 4USKA 2E5JA 5C6SA 3CCVT 2YLCA 2OH2A 4B08A 4HDHA 1L3VA 1RTZA 4B02A 1IR1A 3GJTB 3BSNA 3C15A 2RF2B 4HHUA 4WYWA 1VQ6S 5F9NA 2KE9A 2KZZA 2YXLA 3MTJA 4R0EA 5LJ3j 3QZ5B 2E9RX 4HXJA 4JI0J 4MFBB 1C6VX 1K73R 5LMUF 3TZXA 4EZ6A 2RQUA 2CPEA 4BC7A 1LW2B 3OTBA 3M0QA 2LXFA 1BI1A 2XMFA 2HQCA 1NB2A 4A8MP 4D6WA 3NPFA 1NDLA 4DCPB 2VONA 5HMZA 3ENAA 3H4DA 2DR7A 1I5LA 3EG0A 5AT1B 1SV5A 3HM9A 2ZBCA 1ZLMA 2MHEA 2FLOA 4DV4J 5J1PA 5KFOA 4DSJA 1XMQJ 3HI9A 2Z58B 3TA1A 3TVKA 4DXLA 2DNGA 3NGKA 2PFFB 4LF7J 3CCSA 2N7CA 2ATCB 3GJRB 2VBWA 2OTLT 3RW6A 2MLYA 4ANCA 1XQIA 3EGVA 1G5VA 2DXBA 1UHFA 5DG9A 2HQDA 3KLEB 2B0GA 4BACA 3ZZZA 1ZTTA 1Y11A 1RWOB 5I42B 2APOA 2V94A 1UJYA 1S9EA 2GTOA 4LF1A 1KSWA 2D3ZA 5CIUA 2C06A 5KFKA 2JJ9A 1T3OA 1IQTA 3EYZA 3JAMY 3SWNB 2XD0A 1R89A 3IBCB 1JLEA 3HFKA 5EC7A 5HN0A 3P96A 1VQ7A 5CAAA 1IBLJ 1S1NA 2L9DA 4DPYA 5J39A 2DITA 2ZPHB 1HI0P 3CXCR 4RKUE 1M90C 1YITT 4JUVA 1XR7A 4C8QC 5KFSA 2PA8D 1YJVA 1GQEA 3MM5A 4RW6B 2AEJA 1HYSA 1Y00A 3R9LA 1VQ5Q 2K3KA 4G65A 4GKKF 1WPYA 1UECA 1I81A 1JO8A 3KOAA 1U26A 5I2MA 2X4JA 2AU0A 4J37A 3FIFA 2MKIA 1IKWB 1SVDA 2BW2A 3VU3C 1N36J 2YVSA 1VK8A 3EH2A 1IQZA 3MM7B 2ZGWA 1NG2A 3IGNA 2MI6A 1I1GA 1X4AA 1BC6A 3J81Y 2KHDA 4OIXA 1YJNT 3G71T 2Q43A 2Y1LB 3TSWA 4URQU 2E7VA 2VBXA 3HSZA 2DYIA 1FXLA 5DQIA 1AZGB 3CC7S 3W64A 3VRZA 1WIEA 2X1AA 3ZXWA 3QG1A 1REGX 1IM6A 1TL4A 1LNQA 2CQPA 1LCKA 2MZTA 4EU0A 2V67A 1NCLA 5FDLB 2CQBA 1AUDA 3KTQA 2G4BA 3BO3A 4JI8J 2OGUA 2P84A 2JFKA 3D1OA 4AG1C 3ILIA 1TR0A 4OQJA 1RT3A 3BF4A 2FYKA 2G2ZA 2M1HA 1JNZB 1KDNA 5DO2A 1ZZNA 3ZL7C 1TKXB 2KB2A 3E51A 2HHXA 5K8NA 2AZ1A 2VQEJ 4KGZB 2CPDA 4LBPA 4URSA 3H42A 3PDNA 1HSQA 3PRBA 4OJ3A 5KYNA 3EGDA 2PTKA 2XHWA 4LSNB 5GAOr 1SJQA 3HX9A 3KLHB 1V29B 2M52A 1NMEB 1WKLA 4J9VA 4UZCA 1QSLA 1AB8A 4YHHF 4M5DA 2MY7A 1VFJA 3G1JA 4KIAA 1VRTA 5KFCA 1CJUA 3G6EQ 4DUYF 1X69A 1LXJA 2C3PA 3DC2A 1XMBA 4R56A 4MKAA 4FZVA 4M75F 4OMFG 4ME7A 4FW1A 4ZCLA 8ATCB 3PYFA 3DLKB 4UUXA 2LLZA 3WIUA 1S1WB 2HWTA 2JWNA 2ZOMA 2RHQB 2LCCA 4ZVUB 3RUBL 3X25B 3P45B 3TUJC 2R7XA 3VRYA 2BACA 4CYUB 1S72A 1R8CA 4ED7A 1R7IA 1HNZF 1F5CA 5GAOq 1UEKA 2Z57B 3W8GA 5LJ5h 3FBBA 5FDLA 4USWA 2R7RA 4IKAA 5KFUA 1X7VA 2GX8A 3UDCA 2M0GB 3X28B 1BIAA 4W92B 4P9SA 2E29A 2O4XA 1B0TA 1YRTA 5KFEA 1LW0B 1U3OA 5HROB 3LP0B 5F3ZA 3VS7A 2ZPEB 3NHNA 1OYDA 2W2NP 2J8AA 1QUVA 2YQ1A 1RHQB 3PO5A 2NZ4A 5AJ3F 1BCOA 3I35A 2GFUA 1QVGP 2DVJA 4DR5F 4ECYA 1FKOB 3MEWA 4EI2A 4JI7F 4Z7CA 4ILRA 4IH6A 5CYMA 1U1OA 3UDEA 3VGTA 3OVSA 4X4NA 4X62F 2QQAA 5D0EA 4PLLA 2E6ZA 2YX7A 2DIVA 2QEXS 1VMBA 3VR1A 2R8HA 1X5OA 2VD3A 5DZ6A 4FT4A 2RMLA 4X4OA 4XPEA 2RU3A 1VQ8A 2GVZB 1AZEA 3L7OA 1HA1A 4H4OA 1GXTA 4XK8C 2IDLA 3MM5B 1U47A 2KHCA 1LQ9A 1VQNA 4AXIA 2M51A 2GAHC 2RNAA 5KOWA 4WK1A 1RCXB 2PO4A 5GAOm 2CNLB 3NMZC 3HZEA 5KFIA 1WHJA 1QTNB 3R5AA 1R77A 4CLYA 1UEUA 1UDLA 3SB2A 2L5QA 3I5SA 4I1TA 2HFVA 3KK2B 2IY5B 2KXDA 2XQCA 3QSIA 4M7AC 2DLPA 4UW2A 2N7YA 4FYWB 3T1AA 1SI9A 3T1YJ 5GAMd 4LF8F 1RBAA 3HSDA 2XULA 2R9LA 2YNIA 4PJJA 3HHTB 4J6YA 3H6ZA 3CCQS 4J9QA 1SH3A 1UL3A 1RLQC 2UXCF 3FFIA 3QIPA 2XEXA 4W98A 5F8HA 1GK8A 1TQLA 3FCHA 4NI2A 3F56A 3G2XA 2IM3A 3IGVA 4RBUA 3CCEA 1EHWA 3M6XA 2XICA 4JI6J 1U5SA 1DAXA 1U8SA 1RDRA 3GLXA 1IWGA 3OBIA 1W70A 2RB7A 1WHKA 2VU5A 1GCQC 2XMKA 1U48A 1OPLA 2XK0A 4ER8A 1EQ0A 4RJVA 5D4PA 5MAOA 4LBIA 3OV7A 5A6WA 4YB5A 1QSYA 3HL8A 2MYFA 2A36A 3C2PA 4AG2C 4I6AA 1JLGA 3VTIA 2GVDA 4WKYA 2HNDB 3LWMA 4B3TJ 5IH2A 3D0IE 4WPAA 1BI0A 1KRPA 1WI8A 4JJDA 4Y0FA 1VYTA 3OYNA 1BQMB 3V81B 3L7PA 3A3PB 1RABB 2V1QA 4QU6A 2EFIA 2SRCA 4E8UA 3V6KA 4ZPVR 4G1QA 3QJYA 3RR6A 3BJYA 3V7CA 3DRRB 2M0OA 4WP8A 4ELZC 4NRTA 2FY8A 1J5EF 3UF4A 1IBMJ 1GFDA 3EH1A 1TKTB 2J7WA 2EVRA 4F0MA 4MK8A 1VC6A 4IRKA 1AXQA 5KT7A 3J80U 1RE1B 2EG2A 4TXSA 3ZFVA 2WSEE 3PIPQ 3EGUA 2HIQA 5LSOA 5KG2A 5J1EA 1D1AA 2DY9A 1QLNA 2MQMA 4OJ1A 5F9LA 4NOYA 4AMCA 4F4YA 1O51A 1M5VC 1FRLA 2K79A 4LF6J 1ZHIA 1W25A 5GAMf 1YP5A 4X4QA 2W2PP 3G4SA 2BZ2A 2HNYA 4USVA 3ZC4A 4NOHA 3KUHA 2ZH3A 4CM2A 2IJRA 4II1A 3MP1A 2GCXA 2IVWA 5GAMj 3L2UA 1YJUA 1SV5B 1Y9OA 1YZ7A 4QW8A 2HVDA 2MQNA 2PVDB 4N5SA 4HCCA 4Z7YA 4M75B 2Y1JA 2DCLA 3GTYX 3K0JA 4RTYA 3LO3A 1SC6A 2A37A 2VPYB 3RMSA 3H5UA 3KMSA 1LW2A 4DDFA 2QL7B 3OBWA 3ET6B 4RPFA 2E5GA 2KG0A 5LJ3d 4J9CA 3N6MA 2J06A 1QVFR 5GMKh 3QO9B 4F7UF 4Q8EA 2RHZA 2IYIA 3C6UB 1F9HA 5GJVB 1VA7A 4J90A 1UKUA 3UE2A 4C0DC 2HSPA 2YQ3A 4OJGA 2L89A 2DHXA 2KBTA 4C0DB 4IH5A 1TFWA 3INZA 3CMEA 1IR0A 3M8ZA 1C1BB 5A0YB 4JV2A 1MV3A 2KQWA 4C11A 2KM8B 5IHKA 4PL6A 1GMWD 2KM8C 2VBZA 5K8PA 4ANEA 2AWZA 5GAHU 2E4HA 2HBQB 1ZSZA 1RTHB 3BV8A 1YJ9T 1QKWA 2RF0A 4Y28E 2DB1A 4J9BA 3GYXB 4L73A 1WQ7A 2DJQA 4C5HA 4Q43A 3GBQA 4XK8E 1NYGA 1TL7A 4ILMA 3CDAA 4NMLA 3MR2A 2CQDA 5L8RE 2PUKB 3OW2P 1OS5A 4HKQA 3I56Q 1Q7YR 3FSIA 2MSSA 4J9FA 1T94A 1U1LA 1BHNA 3OYFA 4PJLA 4QWCA 5A2QE 5ITHA 4Q8FA 2DEUA 5C42B 3WX8A 4OX9F 2JEIA 2GMJA 4V2SA 5GAN7 1VQ4T 3MM9B 3EXYA 4WE1A 2JS0A 3NCQA 4V19J 1WC3A 2DRMA 1QVFP 2YWGA 2OMOA 5A8WA 5C24B 5ETNA 2D7SA 1GBQA 1E6YA 1HBUB 4WTOB 3UDLA 4XAKA 4C8QB 1TVRA 2V50A 2HCKA 1OPIA 3CCEQ 2KG1A 1VLOA 4YB7A 1DY3A 2FTRA 1T05B 4OX7A 4F16A 3GONA 3F44A 1OI1A 3LH2S 1GX5A 2IRXA 3MO8A 3CMAQ 1VQ8T 2ABLA 3HCXA 2AMCB 5IWAF 3I0SB 3HVRA 1F2HA 4ECWA 2X4YA 1FK9A 3HSGA 2G6FX 2YNFA 1NKCA 1MNDA 5FROA 3BY7A 4KB7A 3LWHA 1TK5A 4D8DA 1LFWA 2J76E 1U1KA 3P8BB 3NXZA 3AY0A 1T11A 2FC8A 5KFVA 2N82B 1YWXA 2GIFA 4A46A 1YCYA 5K9FA 5J2NB 1BQXA 2Q79A 2MZSA 1TAQA 2XO6A 3U02A 2JVRA 4GC6A 1X0FA 3RBDA 1RTDB 3LGNA 5AE2A 2HFSA 2J7KA 1OYEA 1Q4RA 3G96A 1WHVA 1ZPVA 4J5OA 5F0UA 4M75E 4KRWA 3M53A 3DRXA 1X2KA 4GBQA 1X4DA 2ZBQA 3R27A 1QAYA 1SQGA 4JI8F 2YUOA 1NM7A 3HKSA 1JIHA 4CDIA 2RDIA 4O3QA 1CJUB 3JB9k 2RI5A 3M6UA 2GC8A 1SBRA 1YG0A 5LXYA 4ERDA 3QQCD 4MZPA 1G3WA 2GQIA 1QD1A 2YKPA 1IKWA 4CLTA 5KYWA 3CCMS 4CO0A 3Q89A 1LWCB 1M1KR 2X3XD 3OYEA 4M77C 2OTJT 2KYBA 2JLGA 1Z2LA 2LEPA 1DURA 2WSFE 3TJAA 3M05A 2GMHA 4QVDA 2DNQA 3OLAA 4K2JA 3H0FA 2HQ3A 3CCVS 5J2QB 3QGPA 4LSLB 2YPZA 1NH7A 4F25A 4XTVA 4F7UA 2OI3A 5IC4B 3RW7A 2ADBA 2J9DE 2QO3A 1YRXA 2XS7A 1KFDA 2W7PA 1J2VA 2DZ9A 3OYGA 1VQPT 2CZVC 1KQSR 2RQTA 3QUIA 1VQ6T 4I0WA 4Q44A 2VG7B 2NLWA 4QKUA 4HT9A 2D3O1 1PC0A 5KFRA 3DDIA 5HKCA 1RB0A 2L3RA 1UFWA 4IRDA 2YBVA 4DPTA 2RRBA 1NUEA 3DRPA 4F26A 1IJFB 1RHUB 1FKAF 4BY6C 4HHJA 3GJQB 2M88A 2UUAJ 1X4GA 3SFUA 5E7OB 4C8QE 1AFJA 2VHGA 1FWKA 1XBWA 4WFZA 3A8HB 2IFXA 3FCVA 3M8YA 3EFSA 4M7AA 2ZZMA 3CVKA 5DGAA 3W1YC 3I9QA 3UN2A 1QCFA 2XLJA 3OR2A 2DHHA 4CO2A 5GAN6 3PG9A 2JDJA 1TS9A 2MZ1A 1Y7XA 3DDKA 2YUPA 1ZTWA 4DL4A 3S6WA 5RUBA 3DNCA 1IKYA 2HK3A 4Q2MA 1J5EJ 1CULA 1ZAXA 1YX2A 2QA1A 3A8IA 5IT9Y 2JSXA 1SJRA 3MR3A 5D77A 2ZPIB 3JB9G 5L46A 1YBYA 3QWXX 4C92D 4HKEA 2RHSB 1XMQF 4BB7A 3W5ZA 3FK4A 3AA8A 2NUHA 2YNGA 3EGWB 1S4FA 2ERRA 2BKNA 4QR1A 2DNKA 1S49A 3NY0A 3R6OA 3M9MB 4NCAA 4DF4A 2F8EX 2JOYA 2XS2A 2ZOFA 2DK3A 1D9AA 2NLUA 5KYYB 4OP0A 1O6XA 3O1LA 3GR0A 3UD3P 3ILOA 2QSWA 1U24A 2ZDOA 2K5LA 1TKDA 3SI8A 4PJOD 2E5HA 3TO8A 1YITS 1HYOA 4DN9A 2JHEA 4HI1A 4YQWA 3PNIA 5FLXE 4AFUC 4FYVB 2HPUA 2ZNZA 1GL5A 3JQJA 3RBBB 5M2UA 2HNZA 3JCMJ 4ICLA 5KFDA 2V4JB 4QPXA 1PBUA 1SIZA 2MPUA 1S9GA 1VQ4Q 3VS0A 2CJKA 1UCNA 3SQGB 3L09A 4C2MA 3FJ2A 3HDSA 3HHDA 4NLSA 2A7YA 2W01A 2AYGA 3BSOA 3IQLA 1S6OA 3SQGA 2W2QP 5I21A 2HBRB 4OB3B 3DLHA 1UJ0A 1SRMA 3G6VA 1IR2A 2UXDF 2MOXA 1K47A 1VI7A 4NPOA 1NZAA 4RWWA 3FBEA 1UFKA 3H2LA 1H7WA 3OYHA 3X26B 4X34A 2D3UA 4CI0B 1TL5A 1IKXA 2W9CB 1NKBA 1RXOB 3QJPA 4I2PA 3DLEB 1NPRA 3POTB 3A8GB 3X3UA 3OYKA 1NH8A 5HY6A 3W61A 4FU6A 2R5MA 3OL6A 2HIYA 4DQRA 4DX5A 1F3FA 3TQEA 3QJ6A 3E19A 2CRLA 3R7BB 3P49B 1YITA 3CCES 3DRRA 5L1LA 3AT1B 1VQLT 1HI8A 3THTA 3OTEA 2LCWA 4CTAB 3M0SA 3I31A 1BQMA 4OI6A 3V81A 4CLUA 3CMAS 4DV5F 3BREA 4NWBA 2WBRA 1K0VA 2LDIA 2QLFB 2VPWB 2QA2A 2YX1A 3CCSQ 2W7AA 3CCQA 2NWMA 4OI2A 1E6GA 3PNWC 5E41A 2ZH8A 3VCDA 1T3LA 3DLEA 5DM7R 4RW9A 4K8RA 2O4XB 1PNJA 4C92G 3AJDA 2LT1A 1PGZA 2X1FA 1QVFS 4ZPTR 2HDAA 1OIAA 2V8HA 1YRUA 1S72S 1HBNA 5AE3A 1P92A 4ECUA 3W63A 1S6PB 4RW8A 3MM9A 5IM0B 3HSBA 2BJDA 1BB9A 2CPHA 4FYDA 3V5RA 4H4KC 2LTOA 2BOPA 1FDDA 2O3DA 3UCZP 5A0GA 5B0BA 1O0PA 2DXTA 3TREA 4NI2B 4KY3A 2I8EA 5J2QA 3RG6A 1M3BA 3ADAC 3PJ9A 2ZH4A 4OF1A 4PWWA 3G86A 1GH8A 5DRKA 5E0OA 1SC1B 4I6YA 1SL0A 2JM9A 1HNVA 4OGEA 2ZCFB 4P2FA 4DV1F 2K3XA 4CTAA 3MR5A 1T9UA 1SB6A 1VQPQ 1JB0C 2XCAA 2KL8A 3GPAA 3NTIA 5IQ6A 3NGTA 2P4TA 2XCPA 1T9XA 2VH7A 3CJKA 4K4SA 2Y0BB 2P6TA 3HHLA 3K5PA 2P9EA 3HHLC 2GVZA 2P0PA 3C6UA 4Y91A 3QO9A 2QI2A 4Y28C 3UO0A 3CCVA 4OZNA 1FVQA 2YRVA 2QGGA 4O4GA 4BUGA 3GNGA 2E5LF 1BXNA 1PBAA 2F2VA 2IVFB 1RT1B 5FD1A 3MWBA 1G6BA 5E33A 1VQ4S 4R5PA 1G7CB 2BQ3A 2CJXB 3HF5A 4I2QA 1HFEL 2HKNA 1RAJA 2G1DA 1DZ5A 1KJWA 1WJ9A 3OYCA 1HXDA 1MUZA 2J0XA 3BN7A 4ZGDB 3UA7A 5GAN4 2YKQA 3IG1B 5GANg 4ZLNA 1PYOB 3DOLA 4NCGA 2ATLA 1O8BA 3VYHB 3MECA 2MWOA 2E1PA 3MEGB 3FSXA 2B8AA 3MM7A 3RESA 4EMGA 1WC5A 1PD1A 1JK9B 1KR4A 1LNXA 3K17A 2FPHX 1H3DA 3NWGA 1S1XB 3IWXA 2NXUA 1Z9QA 2OTLQ 3NAHA 5GAN3 4C8MA 1S59A 1RLPC 2K2MA 3SCLE 5JXSA 4M78E 5LJ3g 1X9WA 5KE3A 4N77A 4MYUA 4Z37A 2MWPA 4N47A 1TKZA 4TU9A 4F4ZA 4JI4F 3J7AN 1IVZA 4X9DA 1BK2A 2PI5A 4M75C 4LRCA 4ZVGA 3NOGA 2F8HA 4NA1A 2W4PA 2XYHB 3EDRB 5LMNJ 2EQIA 2IM0A 2GBQA 2M8HA 4CZCA 2LNVA 2PE8A 3MMJA 2VDHA 3MMAB 4FXWA 4DQIA 3IN5A 2F1LA 4B9WA 4Y65A 2RE1A 2M9UA 2X7IA 3FMWA 3M8PA 2LVMA 3E3XA 6AT1B 1VQ9T 4WIIA 2IAJA 3KHGA 4JRKA 2OPPA 4I56A 3EMTA 2BKDN 5C25B 2FEIA 4LMZA 3TAPA 4I2PB 3L2VA 3QGIA 3C12A 5HMXA 1BKBA 5LSRA 4KFBA 4XTTA 4ZTFA 2KROA 2JH3A 1ZPWX 2AJ1A 4JI2J 1KK7A 6FD1A 3MD3A 2CJYB 4MIBA 4A8WA 5DG8A 2RD1A 2Z30B 1W6XA 2RQKA 1RGVA 2U1AA 2GFFA 3R5JB 2XSJB 5CA5A 1AWXA 4C7QA 2AP6A 2JNJA 4K50A 3GV7B 1H2TZ 1U1TA 3DLMA 2QLJB 1ZUUA 1S9GB 1R0AA 1NLKL 4DV0J 2FVCA 2H48B 1PWTA 2RSQA 3G71Q 1VQSA 4ZVQB 3ZFJA 4C0GA 3PMTA 1ZM3A 5EDWA 2EXUA 4M78G 3HD1A 1Y71A 4ZNXA 2AZ3A 4JI3J 4DFMA 4O3NA 1DHMA 2B3TB 1T9VA 4JYAJ 3VQSA 5EWFA 2DGTA 3MMCB 2KEAA 3M54A 1H3ZA 3EG3A 2ZWPA 2KH9A 1S79A 1WI7A 1XTDA 4JI5F 2CJBA 4F17A 2BQRA 2DPIA 3TARA 5H9EJ 3L1AA 1H8KA 1DBDA 1X4FA 1GCQA 2V68A 3TZWA 3W65A 2YDLA 2ZKUA 1WXUA 2YXYA 5HBMA 2B8PA 5GAHI 2W7OA 1E6YB 1HBUA 1Q8LA 2XU8A 4RUBA 3Q1JA 1V5VA 1ABQA 1HYSB 4CO3A 1ZYQA 5GAEI 3FRNA 1YBUA 2ZEJA 3MEDA 2LJ3A 5DGBA 3CCSS 4ZVHA 3N9UC 5KG3A 1N52B 1Y0MA 3VAIA 2OPRB 2FJDB 4IO9Q 1TSFA 4EYIB 2DNNA 4AE5A 2CP0A 2DPJA 4M7DA 1BGXT 3AH6A 4J9GA 2FZKB 1P1LA 4M95A 2A6OA 4BY6B 3GP9A 2UUAF 3M1VB 3O6QA 2EPIA 2XMTA 3M2VB 3SCIE 1MG7A 1XNQF 4RTZA 2EC2A 4ZPBA 1KHWA 4LF6F 1KQ2A 2ZH1A 4E0DA 1Y5LB 4YY3J 3LTOA 2XZWA 4HVWA 1XN9A 3CIMA 2AZSA 3LAKA 2AJ4A 3KLEA 4DCJB 2D1CA 1N6AA 3LPYA 2DGSA 5B0FA 5LL6S 2MCNA 3OW2R 1QVFA 2KN4A 2XZDB 3OFHA 3PO4A 2KYZA 1S1VA 2OPQA 4LRFA 3HRTA 2YWWA 1JEGA 3BYPA 4R0JA 4DPWA 1U06A 2E3IA 1X27A 4C0HA 4AT1B 4ZVRB 7FD1A 2XWYA 1FDBA 3AOCA 4HT5A 4KGMA 2EGAA 1Q5VA 3BQ1A 3KFVA 2LZ6B 5DS7A 2QASA 3FVYA 1X6GA 3PW5A 1X4HA 3LGLA 5ETMA 3L42A 1N0UA 2ZUGA 5MLCV 3AOBA 3NTHA 2POKA 2FO0A 2RJCA 1HBOB 3RIRA 4N56A 3ZZ0A 1NHVA 5GAGI 2CG8A 3FZ2A 3MGJA 3META 5C24A 3ZNUA 2QA4A 4YS2A 5CXTA 4YOEA 3CBPA 4P5NA 1N0VC 1ZM2A 4AFZC 3KLFA 2KT1A 2HQXA 2HBYB 5C7PA 4ZDNA 1HQ2A 3JRZA 2RA2A 3KDNA 1C0MA 2K2VA 3MECB 1N5VA 3PXGa 4YR3A 3I4HX 1IXKA 3EGDB 3A8KA 1N6QA 2ECZA 1S57A 3D6FB 3NOCA 3E9GA 2Z8QA 3IG1A 1M30A 2C3YA 3HO1A 4WFBQ 3I56A 1RAEB 1TKXA 4ZA1A 2FPFA 2EAYA 3CC2S 5F8GA 1RSCA 5KFGA 4J9NA 1ACMB 2YX4A 4RTTA 5DLOA 3R6GB 2KFNA 3GG0A 2CREA 1F1BB 4K7QA 4NLOA 4KQZA 1KWMA 4F3QA 1FEHA 5I3UA 1VC5A 4DUYJ 3QLHA 3TU4K 1WA7A 2DCUB 2XMJA 3KK2A 4BDPA 1YCSB 4AFQC 2RS8A 4MKVA 1IREB 3OT9A 2W25A 2EFVA 1NZ9A 3CO9A 1X5PA 4OZLA 9RUBA 4RNOA 2XY5A 2VC8A 3I0RB 3RRGA 4ZP7A 1DLOB 2FPDA 2MLXA 4PXDA 1JJ2A 1FEEA 1T3SA 4AQYJ 1Y96B 1HW8A 2CDRB 2E1AA 5HP1A 2KI7A 4XU2A 1VQKS 1F3VA 2I6WA 3A12A 2AYEA 3VAGA 3MCAB 1KQSP 3BO2A 4PUOB 1P1TA 1M1FA 5D6XA 1IKYB 2Z2ZA 1Y4ZB 4X2BA 3CDWA 2PMWA 4DA4A 4QIGA 2RI2A 1D1UA 3S3MA 3CPWS 2G13A 4ENOA 2QL5B 3H8ZA 3OTOF 2QQ9A 1H38A 3KXTA 4PJOF 5GADI 1S7HA 4M7AB 4HCKA 3GCXP 4NEYA 3W5XA 3IRWP 4K4XA 2GF7A 4B9MA 1ROFA 1DLOA 2FY1A 3C16B 4NLYA 3DRPB 1M27C 3PKMA 2GJ2A 1C1AA 4AD6A 4M5LA 4FCYA 2Y9HA 2XHCA 2MQOA 2KYXA 1FTRA 1N36F 2WVDA 4ECQA 2BIVA 1FFGB 1NK8A 4DMZA 4M5GA 4LF5F 1VIEA 2PU9B 4QWAA 3DLJA 5EG2A 3DLGA 2E7WA 2D1XA 3U1LA 2L9NA 3VV0A 2YNIB 2Y90A 4JI1J 3UW1A 1RHMB 1LV5A 2C2NA 4YFUA 4AXJA 2MKJA 2B9YA 3WX4A 3JSCA 5C2GA 3ZZTA 5HANA 3K2YA 3DXBA 5D0GA 2CQ2A 1KLNA 3VS6A 1QQJA 2RUSA 5CYQB 4RW7A 2AX1A 2WB1D 5CKHA 2DHSA 3UWTA 3O8WA 4A8FA 4Z88A 2WCXA 1DQAA 1F9FA 3CPWA 3UVJB 4TY8A 3IS9B 3J7Z5 2C3UA 7AT1B 2ADCA 1RWNB 1I94J 4YB6A 4DBFA 4QJVA 4DFPA 4U8VA 4GKKJ 5CD4H 4H4OB 2W9BA 3MR6A 3MOZA 1RWXB 3W3SA 3K5NA