1PG5B

Crystal structure of the unligated (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
148
Chain Sequence
MVSKIKNGTVIDHIPAGRAFAVLNVLGIKEGFRIALVINVDSKKMGKKDIVKIEDKEISDTEANLITLIAPTATINIVREYEVVKKTKLEVPKVVKGILKCPNPYCITSNDVEAIPTFKTLTEKPLKMRCEYCETIIDENEIMSQILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of T State Aspartate Carbamoyltransferase of the Hyperthermophilic Archaeon Sulfolobus acidocaldarius.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase
molecule keywords Aspartate carbamoyltransferase
total genus 32
structure length 148
sequence length 150
ec nomenclature
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
B PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 1pg5B02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 1pg5B01
1RAEB 9ATCB 1ZA1B 1RABB 1I5OB 4FYVB 7AT1B 2FZCB 4FYYB 2YWWA 4AT1B 2A0FB 1R0BG 4E2FB 1RAGB 1PG5B 1D09B 1RAAB 2FZKB 1NBEB 1RAIB 1SKUB 2BE9B 8ATCB 3MPUB 3D7SB 4F04B 1RAFB 2H3EB 1XJWB 2AIRB 2ATCB 2BE7D 2FZGB 4KGZB 1RAHB 4KH0B 4KH1B 8AT1B 4FYWB 1ZA2B 2HSEB 1RACB 4KGVB 1EZZB 1ACMB 4FYXB 5AT1B 1F1BB 4AMCA 2AT1B 2IPOB 4KGXB 6AT1B 2QG9B 1TTHB 1Q95G 1TUGB 1AT1B 1R0CB 4WTOB 2QGFB 1TU0B 3AT1B 1RADB
chains in the Genus database with same CATH superfamily
1ZPWX 7AT1B 5IC6B 1XNIA 1S9EA 3LP1B 3G6VA 2CYYA 4OYXA 4K50A 3D1HA 4B9TA 4WBFA 4MMOA 3K2YA 4ZVRB 1K0SA 3CXCR 3T5HA 3ZFJA 2K7AA 4CC3A 2JVOA 3CCQQ 5A2QE 1LNQA 1BHNA 1JXEA 3QIPA 3AA8A 5D8HB 3T9NA 1RYSA 1O8BA 2AEMA 2IAJA 2CDRB 1OV3A 2EQKA 2B3TB 5KFGA 4Q7AA 5KT7A 4CLLA 2M3DA 2JLGA 1UFWA 5FU7B 2GF7A 2DO3A 1WHJA 5AE1A 1KVIA 1PYSB 3MM8A 2ASJA 4JJDA 5JVGQ 4JRKA 2CP5A 1RTDA 4M4ZA 3PIOA 3AXKA 5HMXA 2R7VA 2L9NA 4P73A 1RLDA 2RF0A 4LF9J 1VQMS 2P0PA 2KYZA 3Q2SC 2LEBA 1OYDA 2SEMA 2EJGA 2BDPA 2OO4A 2LMJA 3M1VA 2E3IA 2J06A 2L9DA 3KUEA 1J27A 4YB6A 2R7QA 5CZVA 1NDKA 1ZM4A 5C25B 5I3UB 4N0AA 4M7AE 3OW2S 2MKYA 4KY3A 3CC4A 2HHUA 4M77C 2YWHA 4C9DA 3JCMJ 3UCZP 3LTOA 5HVHA 2MY8A 1M1KU 2RH2A 4TY8B 2XQCA 3DC2A 1N32J 2EPDA 4EBCA 3HJFA 4JI2J 1RT1B 1RA6A 3MMCB 5KG5A 4WK3A 4DFPA 1MU2A 4EUVA 1WEZA 2KRBA 1N6QB 2RB7A 3SIPB 3QIDA 2GIFA 3T9ZA 2NUHA 4N4HA 4CNZA 1NK0A 3HM9A 1GMWA 2V9KA 2YVSA 1K9MU 2ZBRA 3F73A 2WSFC 2M02A 3UW1A 2JT4A 3T3FA 4P2XA 4G1IA 4B9SA 1S1TB 1KC8R 3FK4A 2ZJPQ 2MK5A 1ZA2B 4BWJA 3QYHB 3LWIA 2UXBJ 4NCBA 2EFVA 1OIAA 2DNLA 2D3UA 1KHVA 2I0NA 1CJKA 1VRQC 2ZH9A 2DR6A 2F69A 2ZBCA 5DS7A 1ZTTA 1VQKT 5I22A 5JVHQ 4BUGA 2FRYA 1X01A 2QEXA 4I56A 3CBOA 2QJ3A 4CLUA 3G4SQ 2CAJA 2R7XA 2L9WA 3HRSA 3LA0A 4C98A 3MURP 3EZOA 4DU8A 4YB1P 2XTJP 1IVZA 4JP8A 2YKPA 1PYOB 1W26A 1W2BP 2RUGA 3A3NB 2DJZA 3VGUA 3HHLA 4U9RA 1Q7YR 3V8KA 5ETRA 2CIMA 2R8GA 1Q82R 1TL3A 3OTDA 2BKOA 2X4XA 4AL7A 1N56A 1KD1U 1FEHA 3C19A 4X65J 2MQQA 2LA6A 5KG7A 1ARKA 3NMAA 3EWGA 4FSSA 3OA6A 4K4SA 4PYDA 1LVKA 4F04B 2BZXA 4A4FA 1V3ZA 3MAAA 3QNWB 5FLXU 5KT3A 2E44A 5LMNJ 1CBKA 2AKKA 1K9MT 2H48B 2CQ3A 2MPUA 4M75F 1YJTA 3MECB 2B5JA 4NZ6A 1GEHA 2VG6B 2FZKB 2VXEA 3RR8A 1GFWB 4PKCC 4AQYJ 1JQQA 5GAMe 3AA9A 4RW6B 3JCMe 3RW7A 4RPFA 4MK9A 2HQEA 3P8BB 2M52A 1UJ4A 2M0OA 1KOHA 5F0UA 3RYLA 4DSKA 4PJMA 2PFDA 1R8PA 1S72S 2GO9A 4J6XA 2WVDA 4HVVA 1F60B 4OV1A 2YY3A 3CMES 3IGNA 5B0BA 5GANj 2R4FA 4RBTA 2B6AA 1W2BA 1BY9A 1ZUYA 3HKSA 5GAN7 2JSXA 4I7FA 1RT6A 3C0CA 3I5BA 4DDFA 2E1AA 4E7ZA 3IBFB 3JAMU 5B0DA 5J26A 2J0XA 2VG7A 2ALZA 1RBOB 2Y1RI 2LQJA 1X0PA 4USMA 4C5IA 3GYGA 3W2WB 4PPZA 1H7XA 4PJOA 4BB7A 1RWVB 2X1AA 2XWXA 3F41A 2KYBA 2YHTA 1AWWA 1SC6A 2X4WA 2AX0A 1KFDA 2CPEA 1RAOA 1PKUA 4P5NA 1BI1A 2VOPA 2XYPB 2E5KA 3EGVA 3DRSB 3NY0A 2XY7A 4NYOA 2RMLA 3OW2A 1WGSA 2IIHA 2A3LA 4QVCA 1M3CA 2R57A 5HLFB 2DXBA 3SD4A 2YT6A 1KKHA 1YWXA 3CCST 4DV5J 4RW9A 1C6VX 1TKDA 3CDBA 3OYBA 2QL7B 4M75A 1JLFB 2E5LF 4Z89A 3L9ZA 4DA4A 3I0SA 1D1BA 5HSPA 1UL3A 3M8ZA 3HVAA 3HULA 1WTBA 3J7A1 1RT4B 1B0PA 1UWBB 2HQFA 2MF2A 4R55A 3QBCA 3BQ2A 2BZYA 3R5AA 1FNXH 1N0UA 1L5UA 3PT9A 3ASKA 1A7GE 3CCRT 4AL6A 3TAPA 1P9YA 4DBQA 1U7LA 4WJBA 1QSSA 3CJQA 4FPIA 3QZ9B 2VICA 3ZFVA 2VQEF 2DEUA 2E6NA 3VUBA 4I68A 2V4JB 3FNNA 2J6TA 4UUWA 3PMIA 2ZPIB 3TEHB 2X4JA 1RKIA 1R3NA 3HVRA 4KHPJ 2IYIA 4MK8A 2FC9A 2AWZA 4QCLA 1Y96B 1KEKA 1RTJA 3CWJA 2F2XA 1WACA 4CH7A 5KFUA 2D74B 2ADBA 3H41A 4C3KA 2XHCA 3UWTA 3H98A 4OMQA 1LW0A 5K14B 3KMQA 2BOAA 3M9MB 4Y92A 3DYAB 2KFNA 4DV0F 2ZJQQ 2EWNA 1NKEA 5CYJA 1NK7A 1VQSA 4QPTA 5KFOA 1RK8A 1DARA 4E8UA 3N79A 2GVZA 4R25A 3OYFA 3ZZYA 4OHWA 4XK8C 3LP0B 3OW2R 2C3OA 5E2QA 1AZEA 1YJWT 1HK9A 1J2VA 2CPHA 3H42A 4NCGA 2HWTA 2Y8YA 3D9BA 5D0RA 4CLPA 5DM7Q 1KLMB 4NZ7A 1XMQF 4HDHA 2VG5A 5LXRA 1ZBJA 2MEWA 1JLCA 3Q24A 4YDDB 3G6EA 3DRPB 1UVLA 1SJQA 5IHIA 1G1XA 4TQRA 4PK4A 5ETKA 5GAMh 4YR3A 4UOGA 8RUCA 3EHQA 4CM2A 3HVTB 3SCKE 3IR6B 2Y1IA 5AJ3F 2KXCA 1PNJA 1F0XA 4HTJA 2F5TX 4F26A 4F8RA 3CMAQ 3MR7A 1NKCA 1N5TA 4LRBA 3FUYA 1QW1A 4L75A 4KUIA 3R5JB 1AUSL 2OTJQ 2B9YA 4TVRA 1Y57A 4GBQA 2IJFA 4OF1A 3A8EA 1U47A 5H9EK 3VV0A 5A0LA 4F50A 1HNZJ 4Q0BB 1QVGA 3D68A 5A76A 2V8VA 1W2BS 2V0NA 1WEXA 3CDEA 4KTQA 2DY1A 1ZBXA 5KFPA 4N56A 2BUDA 2ZZMA 1BXNA 1WXTA 2MYSA 1H8KA 4EZ9A 1HNZF 3IC1A 4HT7A 2C2RA 5EX0A 3DXBA 1MN9A 3W2VB 2M8HA 5F8LA 3S3NA 1ZAWA 1VQ8Q 2U1AA 3ZTRA 1RT1A 1RAJA 2H3EB 3DU6A 5LJ5Y 1S48A 3M30B 3KOAA 5HATA 4KFBA 4LSZB 2YKOA 1G7CB 3SFMA 2ZC3A 3OBIA 2IMWP 3FSIA 2PVGB 2HS0A 4JI7J 4LF9F 4B9NA 2D9PA 2MLYA 2RVJA 1MMLA 3HSZA 4E2FB 1RAGB 2V9WA 5I11A 3FCVA 3E2EA 1Y9OA 1NEBA 2ZPBB 4DBFA 4RG8A 4Y3CA 4J9PA 2XYHB 2MWOA 1EETA 1Q4RA 2G1HA 4OI1A 4FF4A 2ZOFA 1ZX6A 1JNZB 4X66J 1YQHA 2CADA 2JTMA 1PIEA 1XQHA 3FB9A 4J9BA 3RKWA 2FZGB 2VGNA 1NJIR 1TUCA 3HPOA 3CXCA 2Z58B 3UR3C 2JZ5A 2ZH8A 3RGIA 2KJVA 2IDLA 5CAAA 3QO9B 4N8OA 3HHTB 1WSVA 1U5SA 3I55A 3OQ5A 1FO1A 1W70A 3LH5A 1YHQA 5KAKA 1X5SA 2LU1A 1D0XA 2DL4A 2A7YA 2GTOA 4DX7A 2FVUA 4U67Q 3DM2B 2IVFB 2E70A 3H6ZA 1N54B 3M05A 2ZOGA 5D4PA 3EYZA 1QVGS 5CA5A 2AGOA 2W2QP 5T41A 2W25A 4PNOA 5K8NA 1T9UA 4LSLA 1T9TA 4XTVA 2AGQA 4PJOF 4IUQA 1RZMA 3C8YA 2NXCA 2BQUA 4K5RA 1N33J 1VQPA 1HARA 3VS3A 1HBOA 4UTGA 4YY3F 3ZEHA 3CCRA 1NDPA 2VDHA 1N8RT 2LCCA 2Z4PA 3KFWX 3V4IB 4F0MA 3U1LA 3QJLA 1TUWA 3CIZA 3U02A 2LP4A 3OL8A 4DV6F 4E0DA 2FY1A 2PQWA 1TK8A 1K73T 2H5IB 3CPFA 3SMZA 3UNGC 4UT4A 1FKPB 1C4AA 4ORZA 3QWUA 1HYOA 2VC8A 2DXCA 3M0RA 4LNPA 3MOJB 4MTPA 1JMTA 3KJQB 2XSFA 1T05B 2H1YA 4AG1C 1PRMC 2HGLA 4MIBA 3AB4B 2IJRA 2UUCF 1SJ4P 1B3QA 1DFDA 1VQ5Q 2FB0A 4OB2B 3EDRB 4ECXA 4DPTA 2JXBA 4K4WA 3ER0A 1VQ6A 3L3CA 2QAZA 2BIVA 4IQMA 2O4XA 2I5JA 2OAWA 4VUBA 4PJOB 1VQLS 2GHPA 2BZ2A 2GHVC 3KWMA 4K4VA 3PW0A 4EZ6A 2DKGA 2CPXA 3BB5A 1VQ4T 3VZIA 3W5XA 3KHRA 2MKCA 1YKWA 4K4YA 4IFVB 2XG8A 5LM7E 3A8IA 4Y00A 3RB3A 2DCUB 2CH4W 2DL8A 3DHWC 2JUFA 2QA4G 4CC7A 2ZKUA 2RU9A 3VQSA 1U1SA 3S01A 3GQCA 3NOGA 4X1VA 3W7BA 2E1PA 3R97A 3ETMA 3PR5B 2IA6A 1KTVA 1K76A 5AJ3J 2OPSB 1FWLA 2A3JA 1PSEA 4JJCA 3I55Q 4DSLA 2PDAA 1U3OA 1QD1A 1Y5LB 5BJRA 3M8WA 3HD2A 5A2QY 2QQ9A 5D6YA 2CNKB 4NXMJ 3O1LA 3DRRA 2OGUA 4MZMA 2OTJS 2N7CA 3OT9A 2VV5A 4JS5A 1QUVA 1NDLA 2LEPA 1BQXA 5LJ5d 4JI3F 1DRZA 2M0GB 2OSQA 1G2EA 2OTJA 1N32F 3BGLA 2AHJB 3BDEA 5KYXB 5EN1A 4JS4A 5GAMg 2DPJA 3SQOP 2RA2A 1N9RA 1IGUA 2DR8A 4J9EA 3G6YA 1BIBA 3HSGA 5DRKA 4CLTA 1JLGB 1Q53A 4IRCA 3NAHA 2LZ6B 4QQBA 5CAIA 2RILA 2ROTA 4Y2IA 1P27B 1JKHA 4MKVA 1NNDA 4S0MA 5CH7B 2RJZA 3HK2A 1AROP 4PZVA 2DRAA 3TU4K 4USHA 4GLKA 4E7KA 4JI5J 1KC8T 3TZWA 3EGXB 2QEXT 3D6FB 5KFNA 4RW4A 1CJTA 5H9FK 1RBLA 2HBPA 2R7UA 4J7IA 2B8PA 1YJWQ 1KR4A 4O3NA 3E01B 1Q8KA 1VQ8S 4NYZA 2WACA 1AWJA 4DCOB 2A10A 5LL6S 3RBDA 1FX2A 4LIWA 2R5MA 5E41A 3MEKA 4GKKJ 2J0QD 1RHMB 3QLHB 2MCNA 2C28A 2V50A 2IHR1 3K57A 3NTIA 1KVKA 1KNZA 3NP5A 1NLPC 4F7UA 2RE1A 4M78D 3KYLA 1F6TA 3HFOA 2XKOC 4DPYA 4O0IA 2EFGA 4P2MA 1CSKA 2KSSA 3E51A 4CLKA 1MN7A 2M7SA 2KT5A 4KPCA 5GMKm 4ANDA 1RTZA 2PE8A 1RWPB 1KQ1A 3M8QA 1BCMA 4J6WA 2BM0A 2R58A 3UPFA 1IKYA 3SV3A 2LJ1A 2F2WA 1XWLA 4FVMA 3ENAA 2KRMA 1XIQA 3BGUA 3V81A 3CCJT 4Q0BA 1DTQA 2XYGB 4M7AD 3BF4A 1UPPA 5KFQA 2Y4XA 2YNIB 2OPRB 3EFOA 4OGEA 3A8KA 2Y8WA 2HNDA 2AK5A 1U2RA 3HKWA 4OJHA 1WHWA 5K8PA 1M9SA 1PILA 3OB9A 2IAJB 3OY9A 1Q82T 1LWEB 4WCIA 5GADI 2UUTA 1FJEB 1VQLA 4FKXA 4FL6A 1VQOS 3TANA 3DLLA 4X65F 3ET6B 2PD1A 2UV8G 2VQFF 4LJMA 2NXNA 4K7QA 3G4SA 2E9TA 3BN4A 2H54B 4Y65A 2HCKA 1D3BB 3RIRA 4CLZA 1T7PA 1P1TA 3LP2A 3M58A 3MCSA 2W9BA 2VPZB 1GAOA 4RTXA 4X62F 3CCSS 2VIHA 2UUCJ 2L5QA 2X3WD 2ROLA 3H0IA 3NKYA 1IHWA 4N8NA 2DYIA 1J5EJ 1SIZA 3MAHA 2PU9B 1S1UA 2QRRA 4IYQA 3QAEA 3EUNA 3N6MA 3UA7A 2KXDA 1JJ4A 4L73A 1URRA 4UZCA 2B4UA 2VJVA 1Q5VA 2DGUA 4ZVQB 4OX8A 1Q81T 1H92A 4P74A 2F4FA 4DL5A 3V2UC 2DRDA 1REVA 2RJDA 1LXJA 1RYRA 4OP0A 4EMKC 4J5YA 2NUTA 1U6ZA 2NR0A 5CYMB 1YJWA 2RSQA 4J9VA 4K8RA 5FU7C 4LN2A 2AGPA 4M95A 3TA0A 1B7TA 3BSOA 2LJ3A 3M57A 3QIPB 2HQHA 4V19J 1FCAA 2ZBQA 4QBUA 4Q44A 4LFAJ 5LMUF 1VIFA 1AFJA 3FGVA 3OBYA 3QDRB 4NLWA 5D0HA 5I2SA 3FRNA 2MQLA 3HT0A 2HD0A 2GIQA 2WB4A 4KYZA 2JJ4D 2YTCA 2ZJRQ 2CQDA 3IM8A 1IM6A 4IDKB 1EQ0A 2CPYA 1XJWB 1S1NA 3ZNJ1 4KGKA 3TZYA 1PSDA 4B3TF 2YLCA 4ECTA 1Y07A 2KZZA 3BREA 4IURA 4LDVA 1PHTA 2BJ3A 1IO6A 2EC2A 5J2MB 1U1QA 2DVJA 1N8RU 2KTQA 1SG5A 2DD8S 4JPBW 5E7OB 4AMCA 1EARA 2AKWB 2EQJA 3TJ9A 1YITS 3K59A 4EO8A 1UE9A 2E5QA 3C12A 3UDVA 3FDRA 2V2KA 1K73U 2Z2ZA 2XZWA 2KEAA 4C8QA 1K8AR 4UZBA 3EZUA 4RKUC 4NXMF 3DLLQ 1YBYA 2ZUGA 2CQHA 2OPQA 3K58A 5M2PA 5IXFA 2OFHX 4NA2A 1BU1A 1T3LA 4TYAA 2CPJA 1ZSZB 4B3SF 2K2MA 4ITSA 4CC2A 2I8EA 1U45A 3IWLA 4L76A 4DHVA 4WPAA 3QRRA 2K3YA 3I0RB 4O0NA 4CO5A 4PG5A 5KTQA 1VQ5S 2NLWA 2DRBA 5DGAA 3PKYA 4BS2A 2BX6A 3CCEQ 4AD6A 1G3SA 1RT2B 2Z0GA 2DNRA 1NHVA 1NU4A 2LVMA 2X1GA 2XZTB 4ZN3A 1SF9A 3NCPA 2HSPA 4MZPA 5D6WA 2OKQA 4QIFA 4DEYA 1VQ7A 4LDYA 1NMEB 4IO9Q 2O01E 1YHQS 3QWXX 4B3TJ 1MSWD 1KTQA 2PMWA 1VMBA 2XZDB 3EG9B 4YR2A 2DT9A 1QCFA 4L5GA 3Q2TC 1UECA 2COLA 5DQIA 2HRTA 2YX7A 3W60A 4CLSA 4KJIA 1LWCA 3DRYA 5L38A 3KUGA 5GANf 4O3PA 2AJ4A 1DTTB 1B7YB 2DY9A 1PC0A 2XDDA 3G6ES 4DXLA 4ZPWR 4CIOA 3X28B 1ZQ1A 2V94A 4G1PA 4M7DA 4NRUA 1JLAA 2WHOA 4ED4A 1GBRA 1J3TA 3DLHA 4NWBA 1BWEA 2UXDJ 4DPUA 3CDUA 1IWGA 3U7JA 3QSYB 1FMKA 3PZPA 1E6HA 4EWTA 1OS5A 2QSWA 1XMOF 2E66A 4C5GA 3JRZA 3C94A 3OYLA 2XS2A 1V5IB 2QI2A 3MECA 4M77B 4ZVEA 4LF7F 3ILJA 1QTMA 2DE0X 2E7WA 2QG9B 3BDUA 1R31A 2CZ4A 1BI2A 3SCJE 3CEDA 2HEKA 1VHFA 3N28A 1O9SA 2L2PA 3SB2A 1SH3A 5KFIA 4I6AA 2JEIA 2NS1B 4GC6A 5H9EJ 1VRTB 2YRVA 1LQ9A 2R7TA 4ELYC 3EGXA 4HT5A 3CC2T 3TEGA 4V1Ak 1IKXA 4NA3A 3GBQA 4ETZA 1OEBA 1JB0C 2VGMA 4DS4A 1PC4A 1RCOB 2FUG9 3E01A 3N6LA 1WHLA 1VQNS 2DGOA 3H5YA 2BOPA 3UVJA 2BE2B 2ZVIA 3ILLA 3RUBL 3OVSA 3ITHB 5AXNA 2QZ8A 3VAHA 3NBPA 1U4BA 5AT1B 1SEMA 2XMVA 3CCRQ 5HMZA 2RNEA 4ID5A 4OMNA 1S0MA 3E3XA 2RU3A 2EYQA 2XHWA 4FW2A 1HXDA 4C8OA 2HHSA 4F7UB 4ICLA 2HKNA 2XY6A 5KCOA 1Q79A 2AJ2A 3EVMA 3RAMA 2RKIA 2J9CA 1Y00A 1VFJA 1RJJA 2DL5A 4F4YA 4DR1J 1UJYA 2IBOA 1K8AC 3B4DA 2M5YA 2J05A 2XMUA 4TU7A 3TAQA 3MXHP 3OSSC 4KH0B 2E5HA 2WAQD 2EYYA 4CTAA 4QIEA 1WLPB 3ZO7A 3CPWP 2ZH5A 3TVYA 2NYHA 1JLQB 3OR1A 2A28A 4DQPA 1JXLA 4RG2A 1F9EB 1VQ7Q 4IRKA 1HD0A 1RWKB 3I56S 4DV6J 2VA2A 4WXWA 2XNQA 1WOPA 5HVGA 3TUPA 4CO1A 3J7ZT 4TY9A 3OSPA 3C15A 3L2UA 1O5JA 5IXUA 1VQ6Q 3T1YJ 1QVFR 3P4UB 3CJTA 3DOLA 2WSEE 1UWBA 1C1AA 4YS2A 5H1SV 1WC4A 4QWCA 2R8IA 4C8QG 1U0HB 4OYMA 1QVPA 2KM8C 4GKJF 4WK1A 4BD3A 1TKXB 4WF9Q 3KUHA 2XGPA 4OB3B 4NRTA 4X84A 3MKDA 5HMWA 3UATA 1ZAXA 4G1QA 1X9MA 3ETOA 2GV1A 4DR7F 4DX5A 3IG1B 2KYXA 5LJ5h 4ZLPA 1HLWA 2XNRA 2Z8QA 1M5KC 1IBMF 2XEXA 2ZEJA 3JSRA 1Y96A 1SQEA 1APSA 1CQMA 5KFWA 4FSXA 4A54A 2CGHA 4C0GA 2E5GA 1RCXB 1YFNA 1YBAA 1G5VA 2O88A 1IKWA 1SC4B 1U6FA 2ECZA 4Y91A 5KFFA 5CKFA 4LFCJ 3CC2S 3VAJA 1T94A 3OR2A 4JJNK 4USTA 4FNIA 1CVJA 1WWHA 4LT6A 5ETMA 2UZAA 4AQYF 3BN7A 2OEMA 4PXCA 2OSRA 2PZ1A 1DURA 2DERA 3WC0A 2OX7A 2YWFA 1OI1A 2EFIA 3HO1A 4R5PB 2KT8A 5HJYA 4JI4J 3CCMA 4UOCA 2RK2A 1LFPA 2KH9A 1VQ9S 4WTYA 4ZMMA 2DZCA 2P0KA 4RCCA 1IBLF 2QV6A 4ZA1A 5AE3A 1KBRA 5GMKh 2GJ2A 5KFHA 4RUHA 5CD4A 3MDFA 4K0KJ 4JRQA 1UA1A 3CD7A 3KDNA 4BE2A 1AZSB 2ZFHA 4DV0J 1BLUA 4EMKA 3JTPA 1U06A 3IP0A 3EZ5A 3LGHA 4C0DB 1Q7YT 3CCVQ 1HHQA 3CCVT 2CZ6B 4FIBA 1S1XA 2Y90A 1T0HA 5HQLA 4LE9A 1WF2A 2RJFA 6FDRA 3NTHA 1ZH5A 2C2KB 3G8QA 3OTEA 1SH0A 1OU9A 1PRLC 2GQQA 5GAN6 4DL4A 2QMXA 1QP2A 3Q8SB 3IS9A 4ED1A 4DG1B 2R8JA 3NGKA 2LQ5A 2MKIA 2LX7A 4Z37A 1WI7A 5LMUJ 2EGAA 4I2QB 3FMWA 3HXMA 2AYGA 2G3RA 4USVA 3I9QA 2ZHBA 3CSKA 2RQCA 3M0SA 4ILRA 3LOUA 1LPLA 2DK2A 2DTOA 2MIOA 5CIUA 4F4XA 4BCAA 4I1TA 3MP8A 3WX8A 4O3OA 4H4MA 3FVYA 1PCXA 3PO5A 3L2ZA 3HSDA 1RU1A 4DR1F 3OHAA 2CQ1A 4CLYA 1KSPA 4EGLA 4ZVFA 3LANA 5I21A 4A8OA 2VBWA 3VR1A 4KBMB 4OYAA 4IUTA 1T3OA 4ZS6A 2QL9B 3QPHA 4LRFA 3D1OA 4GVLA 5IM0A 1KJWA 1JXMA 4CNYA 3CCMS 3I5SA 3LAMA 1T05A 3QT8A 3M6WA 3JSBA 4WYWA 1GH8A 3PFSA 4ZJQA 3R27A 1VQLQ 3S6EA 3NAIA 2DNQA 4CRJA 5DETA 2D3ZA 2DO0A 4MT1A 3HL8A 2UXCF 2C0OA 2G4BA 1U25A 2K1RB 5IQQA 2D8JA 5D15A 1YJ7A 1YCYA 2CP6A 5H9FJ 1VR6A 2N7YA 1LWCB 2HFUA 3HCXA 2C2NA 3DLJA 3BM7A 1Q16B 2IRUA 2PI4A 3H2UB 2HZVA 3C14A 4PJJA 2OAUA 3I5RA 4PJOC 2QFJA 4FCYA 4ZCLA 3N01A 4LSLB 2C0TA 3QGPA 2RDDA 4YY3J 1HPZA 1S9EB 3F56A 3REAB 4L3KA 3CIMA 2ZHAA 1HQ2A 3NS6A 4A8QA 3VV2B 1FXDA 1L3VA 1Z9QA 3EGUA 3CJ3A 1CJVA 5A0YA 1QMCA 4NA1A 3DOKA 2J9DA 2YUOA 1YN8A 5HKCA 2GTJA 3AJ2A 1O75A 4FYVB 2V8GA 3HVWA 3IMQJ 3GB0A 3UO0A 1TELA 3NNAA 3NFCA 4M7DD 3HHLB 3I96A 3EDQB 1Z4UA 4NLDA 1WJ9A 3O3LA 1CLFA 4ANJA 2ZVSA 1TL1B 3CD6T 1GX5A 1DLOB 3MR6A 1RLQC 4DL6A 4C92B 2DISA 2HZCA 5DM6Q 3OYMA 1IKXB 3UF4A 5SUHA 4I64A 3CD5A 2YQ1A 2F8HA 1RAHB 3BPDA 5LJ3f 3RBZA 2CT4A 3HRTA 3DDKA 1Q82C 1P8GA 2B0GA 4EDUA 2XG8D 2PIIA 3ZZPA 2JNGA 5KYUB 3M2RB 4K4ZA 1UJ6A 3D67A 4CI0B 2RJEA 1Q86U 1V5VA 4ZIWA 2YQ0A 4JJBA 3D0GE 4WE1A 3M6UA 3HTRA 3RKXA 1NK9A 4Y2CA 4P10A 4E7JA 1AHJB 4DV2F 1IBCB 3M2VB 3OYCA 1C2PA 1SL2A 2CQ0A 2A0FB 2RQUA 4IFVA 2DJQA 1K1QA 5L46A 3IA0A 2BE7D 2HWHA 3IFEA 1SV5A 5KE2A 1WC1A 4I7FB 3EGDB 3PYEA 2W8LA 1ZS6A 3CXCS 2FEIA 2W4CA 5B0CA 1LNXA 2MQMA 2DIVA 1FKOB 1HQUB 4N76A 3EGNA 3O2IA 5FWCA 1T03A 3V8JA 3CDWA 4IOBA 1PWTA 4BE1A 1HBMB 2FQQB 1Q1KA 2MPXC 2DJWA 1S1WB 4LUEA 1S7IA 5GAOp 3UCUP 4FF3A 1VQ5T 3OL6A 1C0UA 1KD1C 1KS2A 2FPDA 3AXMA 4DEZA 3W66A 2ZCFB 1QDUB 1UWAA 1KD1R 2DGVA 3TYTA 3V6DA 2KMTA 4ZJLA 5EHHA 3GJSB 2YKQA 2UXCJ 2IVMA 1VYVA 4C6AA 4M7AG 2Z2YB 4RUAA 1Q7YU 1ZAVA 3L7OA 2IM3A 5JUMA 3THVA 1L3TA 1R0AA 4EIKA 4URGA 1U8RA 1L3SA 1MG7A 1T95A 2A6OA 4M5HA 1O6XA 2M4MA 5GAOl 4OYOA 4X4QA 5GAN8 1OPLA 5G4DA 4HT9A 3CTRA 4J9RA 3N4WA 1N5YA 4C8QF 4M78E 1GMWD 4IH7A 1BQNB 4NMLA 2I6WA 1RSCA 2NXUA 3MEEA 1B3TA 4YMEA 2BANB 1RT3B 3NWRA 4J9LA 1YJNA 1JJ2S 4QYRA 2G13A 4PFOA 4DJBA 2HS3A 4LIRA 1NK8A 4G6VB 5ETVA 4LF5J 2FB7A 5CQXA 4PCQA 1YIJT 3K5MA 2LQWA 1RTJB 4PG6A 3D2WA 1SBRA 1C0TA 1RADB 4A4KA 2D3O1 4JI1J 3GTYX 4IUPA 4C8QC 1P92A 2CJQA 2VPXB 3VZHA 4WFZA 1UFLA 3BY7A 3K5OA 2POKA 1XNQJ 2CNOB 2MKSA 2BQRA 3VAGA 1R77A 2KRSA 2BXJA 3NXZA 2P4RA 4NLTA 3CCEA 3W8PA 3IBCB 3R7NB 1RHRB 5F8HA 1D9FA 2OI2A 4RTWA 2MZ1A 3W2WA 5F8GA 3NWGA 4LVNP 1X6GA 1YWOA 1S72A 2MDAA 1EAYC 4HLBA 2EYWA 1UETA 3LWLA 2DVIA 3NGTA 4C4WA 4NCGB 4B3MJ 3IS9B 4M78G 1KONA 5G0RB 4OYPA 1NZ9A 2CQ4A 2OPRA 4QJVA 4DR5J 2EXUA 2VG5B 5KG4A 2GVDA 2CQCA 1H641 1RI9A 2O9VA 2V8KA 1YIJQ 1YBTA 2CPZA 3TCJA 2W2MP 2L3QA 3K0JA 2XLKA 3PIPQ 1CC8A 1W2BR 3ICLA 2AEJA 2KNBB 1UEUA 1UAWA 4RW8B 1ROFA 3SQGA 3TI0A 1PO6A 3MCOA 2V8PA 4GC7A 5F8IA 1D1AA 3OS5A 2HPUA 2YQ3A 4KQZA 3M6XA 4TKTA 1NPPA 4EMHA 3AHUA 4H4MB 5J2PB 2DBKA 5F41A 3QFWA 1YITQ 3JB9G 2HKEA 5L1KA 2BA9A 5DQGA 3AFGA 4ANCA 4ZCIA 4RMOA 2YLBA 1S0VA 3GZ7A 3FZ2A 3MUVP 1G4CA 4UC4A 2GFFA 1CEZA 4CYUB 2LQ9A 4L74A 3V8LA 4X64J 4G65A 3CPWR 1XNRJ 5IFMA 3MO8A 4BI4A 2QA4A 2DGQA 4NLOA 5KH6A 3MM6A 2GZOA 3HT3A 2N4CA 2HHQA 1WDDA 2DCLA 3Q89A 3EE3A 4FXVA 4OYBA 2QQRA 1B70B 4C97A 4XU0A 3DLGB 4U8YA 3PW5A 3CD6S 1YVFA 1TAUA 1ZSZA 1OY6A 2LQKA 1BCOA 1M1FA 2QDYB 2EKHA 4JRPA 1BI3A 1YI2T 2AJ1A 5B0AA 1HBUA 4X4UA 5IHKA 5CK9A 3MR2A 1F5CA 3SWNA 3ISND 3LGMA 4NPOA 4BY6B 4N41A 1SC3B 2AJQA 1U1KA 1OO0B 4NI2B 3US5A 2X1BA 3VGTA 4NLYA 4K11A 4YDXA 1QKXA 3GNGA 4F7UF 1T02A 1V3SA 3M5AA 2OMOA 4X4NA 1RGVA 1NB7A 4DR4F 2UU9J 4CWBA 3KXTA 1ZOTA 1WFWA 4RX6A 4QU7A 4DFMA 4LR9A 3R5DA 1VC0A 1JEGA 1WHYA 5M9OA 4CI0C 4KO0B 1WJSA 4NOHA 3CGIA 1S77D 2COWA 1T11A 1RWMB 1OJ4A 1OX9A 3L1AA 2FZCB 1ZUUA 5FDLB 4MDXA 2M1HA 3TNVA 5THWA 1DLOA 4USWA 1BE4A 4WFYA 4OB0B 5HROB 3OV7A 1N5QA 3RR7A 3DGPB 1UPMB 3C6UA 3FEYB 2M88A 5E3AA 3L7UA 3M4YA 2UVUA 4QW9A 3RMQA 2L41A 2FVQA 3CE8A 1N48A 2YUNA 5EWEA 3HLUA 1PM3A 2HZYA 2Q79A 3PVQA 2V34A 2F9DA 4IFYA 4OYIA 4W90B 2DEQA 3WBZA 1YJ9S 2QDLA 2GGRA 1JBMA 4HXJA 4C8YA 8ATCB 3CCTA 2RB6A 3GIIA 4JI0J 2HW3A 2HNIA 3M30A 3EVWA 3QJPA 3SHWA 1WHGA 4KGVB 3LALA 3VAFA 3G8SA 5D6XA 1NK6A 2HHWA 4HVUA 4C0BA 3PX4A 1X4DA 2BJ1A 3D5MA 1C1BA 1FWKA 3HHDA 4JOUA 3VAMA 5KFBA 2RQVA 4P2SA 1UG1A 4DR7J 4DLGA 4RKUE 3KLIA 1WOSA 3HFNA 4ZPTR 5J1EA 2OIHA 2OPPB 2B56A 2QASA 2M9UA 2KZMA 4O4RA 5L1IA 2IPOB 3UN2A 2YPYA 4DWIA 1KWMA 3CC2Q 1S72Q 2CWKA 3RB4A 4PL6A 5K9FA 2IC3A 5F3ZA 2CVEA 3L7PA 2LA4A 3GSIA 1TWBA 3C4SA 3T6JA 1RDRA 4LFBF 3MEUA 1N9SA 4V19X 3H5XA 4X4TA 1EKRA 1JLAB 1A6LA 1TL4A 3D54A 1V1CA 4CTAB 2HAFA 1W6XA 2IM1A 2QQAA 2OTLQ 4LRDA 5E3CA 1JXOA 2AF6A 1IZ6A 1UA0A 4ZK7M 4M7DG 1WKJA 2CG8A 4FBTA 4ZLJA 3Q23A 2DXEA 3JCMg 3VRYA 1XNQF 1IQTA 3H5UA 3NEKA 2K2PA 3A3PB 3IQLA 5KYNA 3I9V9 4J9FA 2W7PA 1OY8A 1W7WA 5LJ3g 3POTA 4D6WA 3BQ1A 4Y28E 1IRXA 1BWVA 2CP2A 3ZTQA 1SKRA 2K5FA 2MLZA 2DKOB 4HA8A 2ZGWA 3LGFA 2F8MA 2MQ8A 1TKXA 4FDFA 2YWWA 2YNHB 3REBB 4M7DF 2IRXA 1SQFA 4L72B 3MEDB 2LJ0A 5C24A 4ZGJB 1GMVA 4W92B 3NRBA 1NDCA 5CO7A 3V6KA 4M7AF 3L95X 2HAIA 1HNVA 1AB8A 4A63B 2G0CA 2PEBA 1AXQA 2VVKA 4MJKA 1IXKA 3FFIB 3FQKA 2K5IA 2R7SA 3ZZZA 4PYAA 3AOAA 3G82A 2KVIA 4F0KA 1TU0B 2KGTA 3H0HA 4KKOA 5HCKA 2ED0A 2LT4A 1VLYA 3KG1A 3A8GB 4F14A 2NXJA 3DRXA 2DETA 1ZTWA 2MKHA 4DSJA 3M8PB 1U2FA 2EJFA 2WW8A 3EPGA 4FT2A 4QW8A 3URGA 2LFVA 1U1LA 2DR9A 3QZ5B 2F63A 1JLQA 3OR1B 1M8VA 1D09B 1HD1A 4AG2C 1URNA 3JCMb 3RRKA 2P0QA 1LCKA 2RQWA 2DL7A 4U7CA 4TLRA 2X3DA 2H9ZA 1I81A 4HCZA 1K1ZA 3MFHA 3PMTA 4J9QA 2XDBA 2EPIA 3EXYA 1AZSA 1U0HA 1HFEL 3BSNA 2B4VA 4YTLA 4DV7J 2IVWA 5IT0A 4N47A 3GU0A 2N82B 3D3BJ 4TU9A 2DM1A 4L59A 2OEJA 4OHXA 3K8WA 3IG1A 2AU0A 4MKBA 1NZ8A 5J2PA 1TUDA 3U23A 4FNHA 4M7AC 3BEGB 3OBWA 4E47A 5E3QA 4ENOA 1MHNA 1TL7A 4HHJA 4Q43A 4O23A 3W3SA 2IM0A 4XPCA 4AFUC 1VQ8A 4B3MF 5IHNA 1UGVA 5GMKj 4BE0A 2G1DA 1HKAA 3LWHA 5IWAF 2IM2A 3KJVB 2BW2A 2PEHA 4N4GA 2P8IA 4CYUA 3SXLA 3CMAS 4ECUA 1PG5B 2DIQA 2HNZA 2E1RA 4JI3J 3AOCA 3L2QA 1WHKA 2QT7A 5D0EA 3D6HB 4ESRA 5HLFA 3FQLA 4RUCA 4QYZJ 4Y34A 3ZC4A 1VQNA 4DL0C 2B8QA 1ABOA 3CDAA 4UQGA 3X24B 2VG6A 4KC5A 4A8WA 3JB9D 1ELOA 4LSNA 2JJ9A 3BGRB 4H4OB 4WIQA 3LP2B 2CXEA 4TYBA 3R6LB 1K9MC 1VIXA 1QAJA 1ITPA 1T0TV 1KFSA 1H0HB 1RT4A 4G3IA 3LF0A 3A8OB 1VJWA 3PX6A 2L3PA 3TSZA 1V29B 4M78F 1KRPA 2CPDA 2SXLA 2ROGA 1SJRA 4WP3A 2R42A 3IGVA 4RR5A 1OPKA 2V4RA 3MTJA 3TQ7P 3G86A 3QYYA 3EG0A 2QTXA 3UDLA 2LCLA 3HFZB 4IUUA 2UUBJ 4HT8A 2FJDB 2K06A 4M78C 2EG2A 1Y0MA 1S1XB 2Y1JA 2VG7B 1GXTA 1FFGB 1KK7A 1XC9A 4U96A 3MUMP 1YJWS 1WC5A 3WIUA 3CC2A 5HBMB 4ZPVR 5K8MA 1NHKL 2KT1A 1YNZA 4KO0A 2EC0A 3EGZA 1FI4A 3G71T 2XBPA 2VC0A 2V2VA 2ZH1A 4MIWA 1KLNA 3JCMf 1SHGA 4WCEQ 4N77A 3ZNUA 5KE3A 1RWOB 4A53A 4C8LA 3UD5A 3LH0A 1UZHA 3VWSA 4JLGA 2RS8A 3FEXB 3DGPA 4FYYB 1RT7B 1RTIB 3MHXA 4IH5A 4O3QA 5IT9U 2AZVA 3PFEA 3VGVA 4IDKA 4ATNA 4QQDA 2MLXA 1IN0A 4DR6F 2CQGA 2MOXA 1S7HA 4C7QA 2P6TA 3DOKB 4R8UB 1ZSGA 1VOMA 2W0ZA 2UXBF 3VS1A 2YKNA 1N36J 2XB2D 4PQAA 3TREA 2ZE2A 4J9NA 1RAAB 4B9XA 2QX0A 2LLZA 1ICEB 4ELZC 2YWKA 3C16A 3HRUA 4DPXA 2XC9A 4LR7A 2XDPA 4DSFA 2ATLA 4QZVB 5IM0B 3M2UA 5D6GA 2V4QA 1UEBA 2V4JA 4DV1J 1D3BA 5GMDA 1NE8A 4I2PA 3VS7A 1RT5B 3I31A 4EFAC 2RRNA 4NS5A 1WHXA 2SRCA 1FEEA 4ELUA 3CC7S 2KFZA 2COZA 4RNMA 3T19A 2LDYA 1F3VA 1Q81R 2BKNA 1S1UB 5T7LA 5HQMA 5K14A 4DV7F 4UY8T 4XTWA 1H2UX 3GIRA 1B4SA 4LD9K 4FZVA 2BKDN 2WVEA 3JQJA 2RD1A 3U1MA 2CZ9A 4CQ1A 3SEMA 2QYCA 2EFPA 3MTKA 2E29A 3H25A 2I1RA 1Q7LB 2VDIA 5GMKe 2OTLT 3PJXA 2IMOA 4M78B 5A0YB 4F4AA 5GMKl 3CCWA 4IIMA 2KRNA 4A4HA 1RABB 5E33A 1V6HA 2AZSA 3CPWA 2PN6A 1IWAA 4Y2KA 2DHAA 4Y0FA 1M4ZA 1PGZA 1WI8A 2PI5A 1WDTA 3J7AF 4MYUA 3OTCA 4DMZA 1CJUB 1NSAA 2DBMA 3VS6A 5DDOC 2J5AA 3PW7A 3L2VA 3LW5C 5DQHA 2CNNB 1WF1A 2JHEA 5DZ7A 2DGTA 4JV1A 3H0FA 3R7BB 2EAYA 1QLNA 2V1QA 1I6JA 5HN0A 4RO0A 2YKMB 1X69A 3GIMA 3W9JA 2ZC4A 4B9UA 4O3SA 4NEZA 3AB2B 3QJJA 4YB5A 1TMMA 3Q0AA 3QWYA 4BDZA 3IBWA 2BTTA 3IRXA 4II1A 3KK3B 2E5IA 1PJ5A 3N5BB 3BKFA 5BYRA 5FU6B 1K1SA 1UVIA 3P49B 5GAN4 2ZD1B 3R6GB 1JLBB 4F7VA 3HHEA 3GCWP 2KK4A 2Y0SD 1R0BG 2HHXA 4RNNA 1ZLMA 2FPEA 1VQNQ 1X9WA 4X4OA 3M2VA 2RT3A 2BJ7A 3U27A 3RUXA 3M6VA 1VHIA 3TEEA 3H8ZA 4W4MA 2BZ8A 2FVRA 4X2BA 3MEEB 5GAOn 2WSCE 1VK3A 3THTA 4JYAF 1F5AA 2I2LA 2CDTA 3FBCA 2YNFA 4KE5A 3WX4A 1LFWA 4WWSA 3LUYA 2YWEA 4Z7CA 4M5LA 2V69A 2FVPA 1S6PA 2CA9A 1MWQA 3DLMA 2ABYA 4CZCA 2LP5A 1IGQA 1UKUA 3O5TB 2F2VA 4KSEB 3A3OB 1YJRA 2VD3A 3V5RA 4TY8A 3P3DA 1LW2A 3UN5A 1U8WA 4ICLB 1R6VA 3JCMV 1SSFA 2RRBA 3UFCX 2KG1A 4C8KA 2FLPA 3RR6A 3J7YI 2RKIB 4OX9J 5CKEA 1LK7A 3M32B 1HNXF 2YXLA 1BQMB 3CMAA 3LH2S 4F0HA 5F8MA 3PE0A 3OYJA 2VKRA 2VPYB 2KT3A 1Q86C 5EG2A 4RWXA 4IR9A 3TZXA 2AKLA 2DXDA 2EW3A 2C2MB 1FE4A 4DOWA 3DM2A 1WJRA 3M8YA 1WNLA 2QE5A 4AE5A 2G6FX 5GJWB 1DTTA 2JL9A 1WXBA 4A8MP 4ECZA 5F8JA 1SHFA 1IR2A 3G71Q 2QSFA 1SJ3P 4JV0A 4ZCKA 2HIYA 2HFVA 3C46A 1KQSS 1S0OA 4OX6A 3K7RA 3BR9A 2WOMA 4JZ3A 3MPYA 4M77E 2FGOA 2XWYA 3KMSA 4IOCQ 1FK9B 5SZTA 3NTKA 3D3CJ 2CRLA 2OUGA 2OPSA 4XAKA 1JQGA 1IXDA 1T9VA 3C2PA 1AVZC 1M1HA 4P75A 4H4OA 5FW9A 4LSNB 2DNPA 3UWNA 1GCQA 1TUVA 2RHXA 2HQCA 4DV1F 4IKFA 4OHYA 2FDNA 4IIOA 1D1CA 5C2GA 3TUIC 1H3HA 2FJXA 2FJWA 1EX8A 4LF1A 1OSDA 5KFVA 3Q8VA 2BMBA 2ZDOA 3W64A 1HHTP 3MAAB 5FD1A 1HA1A 3UVJB 2KB2A 4C92E 2FHJD 3ITHA 2APOA 1FWPA 1LKZA 3QFHA 4IR1A 4KHPF 1A9NB 1PKTA 3TP2A 4WZQA 3DHXA 2FJBB 1BYMA 1T8EA 4DR2J 2I5JB 3KFVA 1HIYA 2PC6A 2CUBA 1TKTA 3E2UA 4C5EA 2EVZA 2DHXA 1NJYA 3RAXA 3RRGA 2HVDA 3I4HX 3DDIA 3PACA 4NLGA 2ZDPA 3CC7T 2UP1A 2BUNA 4ZP8A 5GMEA 3K8VA 4LF8J 2CUDA 5GAN3 1NK4A 4BHQA 5HI7A 1ZUKA 1MWZA 2GJFA 5LJ3h 3A8JA 2HK2A 3AHPA 1VC5A 2QN6B 3VHQA 4ZP9A 4UY85 2O67A 3MM7B 3M54A 3FBFA 5CCAA 4R8UA 2DRKA 2C3UA 4HEA9 4PJLA 3DRRB 3EJMA 4U6PA 3NOCA 3GMGA 2XGQA 1SXLA 2EVRA 2LKZA 4LDWA 2VASA 1ZSZC 2XMJA 3UD3P 3W8GA 1HNWJ 3DXSX 3QHSA 1K44A 2HNYA 1IBKF 1DQ9A 3QMQA 4G1QB 1FRXA 1R89A 3DDNA 4PPDA 2OH2A 2DNHA 3EVOA 3CO9A 1M0SA 1RUWA 2KU7A 3GP9A 4PUOB 3IRWP 2VWFA 2DNYA 2CZ7B 2HBZB 4JI2F 4LXCA 3I0SB 2W9CA 2RD5C 1DHMA 1IBMJ 1HMVA 4J7FA 3BFMA 1KHIA 1EQMA 1WDXA 3CJKA 1VQ4A 4HL9A 3BBBA 3HDSA 2LYVA 2P84A 2C42A 3K5LA 1YZ7A 2UUBF 3X26B 2HBRB 3MEWA 3BS9A 2RHIA 2CKWA 1I0CA 1VDHA 3PW2A 1RKJA 3JCMW 2E1MC 2OP5A 1SRMA 2FPHX 2J0WA 2Q1LA 3NL0A 4ZVGA 2HK3A 2R9LA 1MNDA 2KL8A 4E7HA 3CMEA 4KBIA 2W01A 2NWMA 1LWFB 1I07A 3FSYA 4M5KA 3DOMA 1FDNA 3MM5B 3Q8QB 4NXNJ 5DDQC 2GX8A 1A0OB 4ZIVA 4DL3A 3RTVA 1KC8U 4M78A 3QLHA 2NQPA 1X4CA 2QEXQ 2RK1A 1TFWA 1U1MA 5DLOA 3KUFA 3KLGB 2IJNA 3OQ2A 1ZETA 3PY8A 2PFFB 5M2RA 1S57A 1X6BA 2K1RA 4C0DC 3CVKA 3CEYA 3LPEA 1AA1B 3J81E 3PO4A 4HKQA 1FJ7A 2QXFA 3P8HA 5GJVB 3BKTA 3G8TA 4ZGDB 3PYDA 4K4XA 2NUZA 4PFZA 1DQ8A 2HWIA 3TARA 2XD0A 1ZM9A 4DUZF 2X51A 4PWDB 1M1KR 3OLBA 2BE9B 2YH1A 1VQPT 2E5JA 3DFEA 1F3FA 3GNFB 4RNFA 1KLMA 3EFOB 1TK5A 2ZWPA 3QRQA 2VKNA 4BDPA 2PTKA 3N5BA 4HVZA 4PJOE 2D3OR 3FC3A 1PJ6A 4M7AB 4ES1A 3EFRA 3CO0P 4ECSA 2A08A 2DGXA 1XEZA 2GCXA 2CPIA 4ILMA 2D41A 3HVTA 1OX8A 3C6TB 3K5PA 1RAFB 1RLCL 3S8SA 2CREA 2DAQA 2Z2LA 1YK9A 2DTHA 2Y3YA 1B7FA 4QR2A 1JXVA 1AT1B 4Q5WA 4DQ2A 1KFZA 1TH7A 2D7SA 2MQNA 2QMUB 1OWXA 3I9ZA 3SBMA 4Q8FA 3B78A 4KRWA 3SV4A 3CC7A 1XTZA 3FJPA 1C1BB 3GFYA 3OYGA 2EWHA 3RB0A 2O9SA 1GFCA 2JX2A 2FHOB 1Y5IB 3VS0A 2YNFB 4ZPCA 3NCRA 1D8ZA 5J1EB 3H90A 2PA8D 3EG3A 1T3SA 1SH2A 1NCLA 1YG0A 4D8DA 4R0EA 1S6UA 3CW2C 2P9GA 2EQUA 2D0NA 3TO8A 3NNCA 4WE1B 1QAYA 4FVCA 1QJHA 2AX1A 3R2CJ 1FD2A 4QVDA 7FD1A 2VBYA 3GIKA 3G82B 3FEOA 1U6BA 4ERDA 1AW0A 2ZH2A 5KFRA 2H5EA 3MJXA 5ADZA 3IN5A 2KHCA 1BQMA 2B51A 1R27B 2WZ1A 2RJCA 4A48A 2B86A 5JMNA 5D78A 3M8PA 4NE9C 5LJ5f 1M90R 4RCBA 1Q81U 1N5VA 4OB1B 3HPWA 2FJAB 3GOXA 1UP1A 4C3MA 2RHQB 1NM2A 4C8QD 3Q86A 4MZTA 1YJUA 2HGNA 3CCLS 4OI4A 3HP6A 2YRCA 3P45B 3G71S 3OS0A 1E6VB 4JRIA 1U24A 4WFBQ 3PR4A 4CM0A 4C92G 1OSCA 3EGWB 2FIUA 3TX0A 2W2OP 2C2DA 1WPYA 2G2ZA 3BBCA 5D7UA 1VBYA 1VQYA 3UT1A 3H59A 3MEDA 1TKZB 3W65A 3V6DB 1OZ2A 3P5BP 3HD1A 2XMFA 3Q83A 2COYA 2RHUA 3X25B 1E6YA 4LBHA 1UGQB 4RWWA 5DZ6A 2ZPHB 3GILA 2XLJA 2V6AA 2XICA 1X2QA 5F0WA 2ZZNA 4PG4A 1MV3A 2QA4S 2VPWB 1M3BA 4J37A 2L3RA 1TL1A 4DV2J 4KHRA 3BH6B 1FDDA 1K8AU 4WTOB 1X8DA 2CZVC 4I69A 2JWNA 1M1KC 2KG0A 2HHHF 3KJFB 3L4BC 4X9CA 4M75E 2MZTA 2ERRA 3Q22A 1YRTA 2OPQB 4M63A 2RHSB 2DLPA 2XMTA 6FD1A 3CCUA 1OY9A 4DR3F 2KY9A 5KYUA 3M2RA 2JTFA 2HAXA 1IR1A 1P6TA 2E1CA 3LX7A 5GAHI 1B34B 1RT3A 1HQEA 1NLOC 2DB1A 2RRAA 2DK3A 3BGRA 1WEYA 2AIRB 5KG2A 2M9KA 2R2TA 1FDAA 2KVQE 1YLXA 1TUGB 2ZH3A 1NJXA 3RNJA 1EB0A 1IB8A 2LMIA 2VFSA 5DG7A 2KQWA 2MYFA 2PSZA 4F4ZA 3CMQA 2GQ2A 1SKWA 3GIBA 3W9HA 1U26A 3CMEQ 4JV5J 5D4NA 1S76D 2LQNA 4OHZA 2LNVA 2XU8A 5D0GA 4Z2XA 4OI3A 5A2QU 4ZPDA 4PWUA 4R56A 2BE2A 3E19A 2D0QB 1Y0HA 3EG9A 4ZVOB 2HG4A 3PV8A 1QVFS 5FWBA 3G1JA 5BR8F 4DSIA 5KFYA 3MM7A 4PLIA 2QMWA 5GMKa 2V8HA 4CO3A 5MAOA 3LLRA 3D6TB 5HBMA 1S72T 2D69A 4O5VA 3JB9F 4OLOA 1TL7B 2DPPB 3KHLA 4MDWA 2XIDA 1N27A 2DH8A 5GAN5 3OTBA 5IS2A 2YKAA 3I55S 3F0NA 1S49A 3O6QA 2MTLA 4M8LA 5GAOq 3FIFA 5GANd 3A1PA 5DG9A 4NOYA 2ZH4A 5A8WA 5HK3A 1UCNA 1RT7A 1PCAA 2ROEA 3D0IE 2ACMA 1WZOA 5CQYA 3BE3A 1VQPQ 1F9FA 4GVBA 4A4GA 4TQSA 1PBAA 3OL9A 4DEXA 3JQMA 3MEGA 4X34A 3VUZA 4TNOA 2VXFA 3MR3A 3C15B 1OYEA 3IR7B 2M0YA 2VZ9A 4XU2A 3LGLA 1UW4A 2ZE2B 3QYGB 2BJDA 1FD8A 4DCPB 4K2XA 2JEFA 3QSUA 3QIIA 1UFKA 4EYIB 1WHMA 4C92F 4BY6C 5IWAJ 2KXHA 4UOFA 2Q6BA 3A8HB 3OTOJ 1PYTA 2NUPB 3G2XA 3BGOP 3P8DA 3V4MA 5HL7Q 4DN9A 1VIOA 2HQ3A 2FJEB 1NBEB 3AD8C 3PDNA 3DOMB 5F8NA 3OYEA 5LJ5j 1S4FA 4ALZA 3M0QA 1O51A 4LF6J 1S5ZA 1RP5A 1JX4A 1XTDA 1CQNA 2HDAA 4MFBA 1WXUA 1UVNA 2R7RA 4F2SA 1WNEA 4ZTFA 2W24A 2A1BA 2P9EA 5KYWA 1JJ2R 1I8FA 1MNEA 2O3DA 4PXEA 2ZPGB 2FD2A 4YB7A 5L9NA 3J7Z5 1KQSA 5D3GB 3G6XA 2JNJA 5IXBA 4LQ9A 4AT1B 1ABQA 3CBPA 3OVBA 3PEHA 4USUA 1YHQQ 4J9KA 2PNIA 2GO8A 5LJ5g 2MZQA 4FF1A 3JB9k 2EFQA 3KK1B 1T9WA 1RUSA 3OYAA 1QQJA 1XMQJ 2HHHJ 3MMAB 4K59A 2GVDB 4NMXA 3CCQS 3UD4P 2DR5A 1CG2A 3OFHA 1S99A 1GFDA 5KT2A 1UEVA 2F7VA 1C1CA 5B0FA 2BJ9A 5HMYA 4XTYA 4P52A 2X3GA 4J7CA 4IG0B 3RKYA 1M90T 4DI6A 4Z8AA 3C16B 4OX7A 4RTYA 1UB4A 5EGYA 4ZLNA 1BMQB 2EGCA 1W1FA 2AP6A 3M0TA 1IKYB 4OJ3A 2BEFA 1N6AA 1VQOT 4RBUA 3C6UB 3R5BA 1RHKB 1NK5A 4FS1A 1JRIA 1QE1B 4CP5A 4ATOA 2VL1A 2NLUA 3KK3A 2RQMA 1IQZA 1YHQT 1FDBA 2DHGA 1JLEA 3FBBA 5CD4H 3DB3A 1XR5A 1R7IA 3W9IA 1XMOJ 4AFQC 1LWEA 2KN4A 4Y2MA 1XNRF 2KBTA 4UF4A 2VFRA 3TUJC 2R5AA 1VQOA 1FESA 1X5PA 2EYZA 1FFWB 2E5LJ 2I0XA 3T41A 3FLGA 3AD7C 3LAKA 3D66A 3R3TA 2BR0A 1F1BB 2HFOA 1M2OA 4W98A 1J5OB 2W4DA 5B7WA 5KG6A 4RU9A 1FF2A 3IXQA 3CJSA 1IBKJ 4NL5A 3MFIA 2OPPA 1Y3KA 3OXGA 1TV6A 2YX1A 4B02A 4Q5VA 4PXBA 4NZ0A 1CPZA 4NLXA 1VYUA 3OVAA 2IC3B 4EMGA 2RO0A 2E9ZA 1Y7XA 3TQ1A 2ZM6F 1HYSB 3RZAA 1NZAA 3PW4A 3SSQA 2Z56B 1N33F 2EW9A 4I6WA 1N52B 3RERA 4DL2A 5I3PA 2QLWA 2K79A 5ETOA 4C8MA 1NHUA 2ALYB 5CXTA 2EFOA 5L8RC 3BO2A 2WVCA 3SDZA 3W63A 3C3LA 1NSQA 3QRPA 4DOVA 3OMGA 5CYQB 2Q43A 4B17A 2OD4A 4QR1A 5HY6A 4YHHJ 1NPKA 1DQAA 4M5GA 2W1BA 5CQGA 1FRHA 1VQ6S 4OLPA 3KK2A 3L09A 2CQBA 2P6SA 4LUBA 4M5NA 2K7KA 4J5OA 2V63A 3E9GA 1I4K1 4I2QA 1JB0E 1JLBA 5CZXA 2GQVA 4PJOG 5KG0A 3OS1A 2FTRA 3UI3A 3CCUS 5GAMj 3P6YC 4BWMA 5HO4A 2G2YA 3CULA 5IV3A 3QT6A 2BRKA 1RLPC 3P5TL 1K8AT 2KI7A 3RB6A 2KFYA 2A37A 1AWXA 2JEGA 2GQIA 3HHNB 3J81U 1B34A 4HI2A 2M70A 1K0VA 2EIFA 3PNWC 1TL5A 3OUYB 2DZ9A 5DLFA 5ECAA 2BRLA 3GV5B 1HWKA 4E98A 4QWDA 1CSJA 2QQBA 1R43A 3DNCA 3FFIA 1S6QA 2F40A 2DTIA 2QEXS 1I5OB 4F3OA 5C0MA 1BUXA 4WP8A 1NJIU 3M0PA 4YR0A 4HI1A 1UGRB 3DLKB 3SFGA 2AD9A 5KFSA 4Y6IA 2AZ1A 1SSHA 2L0AA 1RISA 1S9GB 2J7WA 2EG1A 1EHWA 2YUPA 3H20A 1HI8A 2JVVA 2ED1A 3EM1A 3QBYA 4TU8A 3DI6A 3ZZUA 5F3TA 4C92D 1VA7A 3ENVA 2JS2A 1FMVA 3C14B 2K3IA 1WG1A 5DM7R 1BD6A 3CNQP 3OD2A 2PUOB 1HWUA 4CO2A 1S1VB 4M1KA 1JJ2P 1VBKA 3CC4Q 2WSCC 4ZTJA 5KOWA 4OYWA 3SCIE 1H73A 2XMKA 2XCPA 3BDPA 1NG2A 3Q8PB 3NGRA 1HWLA 4ZVUB 1NYFA 1WC0A 4FBUA 1XR6A 4F3QA 3QWPA 2O1PA 2BKPA 4QWAA 4WKRA 1FRMA 3HF5A 2M2BA 2Y0BB 2ABLA 2DA9A 3LGNA 4NLPA 4DBRA 4UUXA 2V67A 2QQSA 3J80Y 4M5DA 2X7IA 4D8KA 1XN9A 1UFFA 3CCUT 4PJOD 2VOOA 2DNOA 1UTAA 2YNHA 4C8QE 4XIUA 2H65B 2C2OB 2HNZB 5HP1A 1U1PA 1YJNT 3GR1A 4ELVA 2QLBB 2JDJA 2C1EB 3JCMd 3W62A 2HSEB 4RUGA 1G83A 3B8HA 2HBQB 1WA7A 4TXSA 1X4AA 4KV8A 2V8DA 1X4HA 3GE9A 5EWFA 4PUOA 2LECA 3M9OB 2E9RX 3Q8UA 2NZ4A 4MFBB 1N0VC 5A8RB 3EG2A 4ZPBA 2CNLB 4EYHB 1U0SA 1M5PC 3ZL7C 1TKTB 2ZHOA 2WVFA 2HKQB 5GAMd 2AJFE 3N5FA 2OFGX 3OXLA 2X4YA 1GCQC 4M5MA 3PIOQ 1LWXA 1WIEA 1QTNB 3INZA 3V6JA 5IAYA 3TZZA 3PYGA 1MLAA 2I9SA 4HH1A 3T1YF 2GMJA 5LJ5e 3JB9J 4V2SA 2D9TA 3M8RA 2I38A 4IUFA 3KLEA 1OPIA 5GAN2 2K3BA 4DFKA 4C92C 3OS2A 3CCES 3J81j 1Q8BA 1JU5C 3RBBB 3PCOB 1VQ5A 2ZH7A 3IWXA 5AXLA 3HMJG 3CCJQ 5B08A 2MY7A 1I5LA 5ETTA 1ZBTA 3PHEA 3U1NA 2OI3A 4EBDA 1E7OA 5DJBA 4ZKAA 4EI2A 3LYIA 4WFXA 1KD1T 4C8ZA 4IG0A 3PKMA 4JYAJ 1HR0F 2ZPFB 3SFUA 3HFVA 4DZDA 2R8KA 4F7UG 1RTHB 4WFNQ 2Z2MA 5A6PA 8AT1B 1H7WA 3A8LB 5GMKi 3OPKA 3OMCA 2YXYA 3VJPA 3MEVA 4ZVPB 2GFAA 1KVJA 1LOUA 2DXUA 1G8XA 3CJ0A 2ILZA 3BPSP 3UPUA 3UE2A 2A2DA 1NKBA 2GMHA 2KXNB 2GC8A 2RDIA 4OZ2A 4XU1A 4C8NA 2W9CB 4UOHA 4TVAB 3HZEA 2E10A 1WQWA 4M7AA 4WKYA 4X66F 4O44A 3BKUA 4C11A 2C22A 3KNAA 1KQSP 2I2YA 2J6UA 2UV8A 2N4DA 2EBPA 4Y28C 1FRIA 1GX6A 2F1LA 2HQXA 2XMWA 1IM4A 3H2VE 4ILLA 1FNOA 3NLCA 4MIAA 3RJMB 2EGEA 2EFNA 1RT5A 1LWFA 1SPKA 3ELHA 2VUGA 2QTVA 3X1LB 2ZUAA 3MM5A 4OYZA 3RAQA 1T0JA 3QATA 3QXEB 1ACMB 1Q5YA 3B6BA 1KG1A 3CD6A 1VISA 4XQ3A 2F5KA 9ATCB 1EETB 3BDLA 3E8OA 2UU9F 4DF8A 1DBDA 3I6PA 4YN3B 5HANA 1I94F 1C0MA 3WIVA 2DH7A 2V8JA 4OFZA 2Z30B 3OR2B 4LF6F 1CC7A 1QCOA 4C3LA 3V6HA 3OL7A 4LQ3A 4HTIA 2BABA 2QLFB 4QWEA 2O31A 4LBIA 4F7UE 4DLEA 1G2BA 5FRNA 2OHDA 3QO3A 3NS5A 3G96A 3DLGA 5L39A 3G7ZA 1VK8A 3S6WA 4HHUA 1EX4A 2Q6CA 3W5ZA 1NJIT 4CO0A 2DITA 3KLVA 2IA0A 5KFJA 1Q86T 1YRUA 5J2NB 5J39A 5HAOA 3RMSA 5C42B 4ZP6A 1WHVA 2GNKA 2LNHB 1VQ7T 4YQWA 3N6NA 1BB9A 1GXUA 1VUBA 1CJUA 2CQ2A 2KYMA 2VHGA 1GNKA 1N34F 2K9GA 4A8YA 3I5AA 3S3MA 1U1TA 3DMJA 1RI0A 3GFHA 2MJNA 2HL3A 3PGGA 4ZOSA 4K4UA 2BV3A 2PGCA 2MQOA 2C0IA 3B4MA 1XQIA 3CBMA 3PRDA 3V4IA 1TFYA 2YKNB 2VJUA 3NGSA 2OJ3A 4B3SJ 3N0VA 4OMOA 2W10A 1LJOA 2CJBA 3OLAA 2IVYA 3CJ5A 3GSDA 2XI9A 4C0FA 3E9FA 3I5CA 1UJ5A 1N36F 4A8KA 2PA3A 1FKPA 4DR3J 3HSJA 4FP9A 4LDUA 2QLJB 1IBLJ 4C0ZA 2DEJA 4NLSA 3M2UB 4H4KC 1TOVA 1RI7A 1SCJB 1I94J 2JEJA 1Y4ZB 2V8IA 3CCET 1XR7A 1SUQB 2DFUA 1WJQA 3TUZC 2YSQA 3MMCA 3HP9A 1FERA 3CCMT 3FCWA 4FKYA 1UUEA 4XTXA 5LT5A 2WCXA 2QA2A 3BSCA 1G3OA 2YUQA 4IKAA 1HNIA 5FJ4A 1XK8A 4GRSA 3QGIA 4CH0S 3CJRA 3D7SB 2UUAF 3MOZA 1M5HA 1TG0A 1HBUB 4CH1A 2JVRA 1F2GA 4X4PA 1SRLA 5EDWA 2HGMA 4DQQA 1BBZA 3SZ2A 1X5TA 1ULRA 3A13A 2E7VA 2GFUA 1E6VA 2XI3A 3HHLD 1VC6A 3Q1JA 2E4HA 1Y11A 3D1QA 4ELTA 3JTOA 4NL3A 3O8WA 2WVBA 1WG4A 2B6AB 1RWNB 3ZZTA 2HHVA 2LC4A 5IN1A 3KLIB 3SEOA 2ZZDA 3R2DJ 4KAIA 3CCVA 3WVEB 3MMBA 3A98A 1D3WA 1TKZA 3KNGA 2F4VJ 4PLLA 4EPCA 3MEAA 2E7XA 2QC3A 3ME9A 1M2VA 2RQTA 3MD3A 2WONA 1B0VA 4XO0A 3TA1A 1N8RC 1PKSA 5U47A 1M5SA 2HZAA 3H40A 1SJ1A 2NYSA 5JJBA 2D9OA 3G6EQ 1L3UA 2KE9A 3UNYA 1PAUB 1RL2A 1AD5A 2B4PA 1U1RA 5GAMf 4ETXA 1NYGA 4NL2A 1K73C 3O44A 1UVJA 4KT0E 1YITA 3UQSA 2LXFA 4GMKA 1SKSA 4I67A 2MMPA 2DNNA 1FK9A 2DH9A 2W2PP 4DN0A 4JZ4A 1SL0A 2R3VA 4OZ0A 1H74A 4KV8B 3BZQA 1SJFA 3JSYA 2RQ4A 2VA3A 3IM9A 1NM7A 4IFYB 2OLWA 5KG3A 1MV0B 3CCMQ 4RTZA 4RW6A 2BACA 3CUNA 2FLNA 1R8CA 4J83A 4K4TA 3G4ST 1AYEA 2YX4A 4AXIA 3HHLC 4ECYA 4HCKA 1S59A 5AXMA 1FT8A 1GBQA 2RPNA 3WHIA 1D8YA 2EBGA 3FDSA 2CS7A 1VQLT 2D1XA 4H4KA 1QKWA 1W2IA 2E6ZA 1REGX 1X4FA 1N4LA 3KLEB 2ZNZA 1RT6B 1OU8A 1T9XA 2MQPA 2C3PA 3CD6Q 3OSNA 1S0NA 4P9SA 4FF2A 3JB9I 1WG5A 1LXNA 2V26A 3PTWA 2DGWA 3OTOF 1YI2Q 3ZZOA 1ZM2A 4FS2A 3I87A 4DPOA 1FYNA 4JI7F 3MCMA 3SDEB 2EKYA 3DRSA 1CS4A 1SV5B 1TSFA 4XTUA 1DZ5A 5AE2A 2KROA 2CDQA 3AOBA 4KH1B 3H0PA 4QVZA 1QVGR 2L89A 1UMJA 1WORA 1DTQB 3W5YA 5DLGA 4ED8A 2DNGA 2HMIA 1OULA 4A46A 4B08A 3VYHB 1X4GA 4IG3B 5J2QB 3CCLQ 3IO1A 3QQCD 1QVFP 1FVQA 1MROB 4WF2A 2HNDB 4LVOP 2DILA 2K8GA 1NB2A 1KQ2A 5IV4A 5FROA 3CJ4A 1MW7A 5FIIA 3VVTA 2JOYA 2QA4Q 4U8VA 4O3RA 2JFKA 1PBUA 3PG9A 2WOMB 3KLFB 5K20B 3MPWA 3JSCA 1S10A 3TQEA 3ULRB 3D4JA 3MM9B 2MZJA 4RTVA 5KFEA 4BDYA 4QT7A 3LW5E 5K5MA 1KP6A 3NGUA 5C24B 3PJWA 4WU3A 2FLOA 5RUBA 1Y71A 4E7LA 2JN0A 3J7AN 2B7CB 5T14A 5BYQA 2YPZA 1HNVB 2CPFA 1QE1A 2KO1A 1R0AB 4UQTA 3O8VA 1FNMA 2L3SA 3AAWB 2VQFJ 4HR2A 2ASYA 2DMOA 4NASA 4X64F 3TJAA 4ED5A 2MKJA 1EKSA 1F5BA 4ECQA 1MMNA 4J9UE 4NX9A 2JLFA 4KKOB 1V3RA 4DUYJ 4XU3A 1WHHA 3CXCP 5I3QA 1ZHIA 5B0GA 2OTJT 1BQNA 2L3MA 2RF2A 3PM9A 4JB8B 4PR6A 4ECRA 3MR5A 3WVDB 3ULHA 2B8AA 2J8AA 5A8KB 4OMFG 4X4RA 1QWEA 2HQGA 2O5DA 2X3XD 2E3HA 3FBEA 4AUKA 5KFZA 3MMJA 2BM1A 2WSFE 3CCVS 5CKDA 1RAIB 1BI0A 3NS7B 1WQ7A 2XMAA 3PHTA 3MMAA 3JSMB 1JLCB 5ITHA 4ECVA 2FL7A 1JK9B 3MP1A 1U1NA 1G3WA 2ZH6A 3OYDA 5C42A 2ZOMA 4GO5X 2M8DB 1OQKA 4YOEA 4F3MA 3ZTOA 2R2RA 3D0HE 3WC2A 1TS9A 2JMAA 1H6KX 1RBAA 2VU5A 2F4VF 1F2HA 5LOQA 2NYIA 4DR5F 4L3NA 4LF2A 3SYZA 4YHHF 3OXFA 2IRYA 3EMTA 4WFAQ 2UUWA 4WU2A 1UDLA 4PWDA 3UDCA 2KJWA 3ENQA 4ZHRB 4JI4F 3GYXB 3H5SA 1X5OA 3I4PA 4GKJJ 3CMET 3CD0A 2W2NP 4PXDA 1IR0A 4OI0A 2AV5A 5J2MA 2QL5B 1JLEB 3KK2B 3MP6A 2MHNA 4ZVHA 2XI2A 3V7SA 3OJSA 1GT8A 3QT7A 4DUYF 2ZBIA 2VODA 5A0GA 4OVAA 4OI2A 5DG8A 4RW8A 5DO2A 1SUQA 1RTIA 1M30A 3TW0A 3RU0A 4M7DE 3MZIA 4KGXB 4QOTA 1TTHB 2DO4A 1BGXT 1HW9A 5C5JA 1NJWA 1X7VA 2KAFA 2FYXA 3V7RA 4KFBB 4J90A 2X1FA 4L6V5 1J5OA 4KUDK 1QAIA 4KGZB 3T1HF 4PQUB 4B6MA 2BVZA 4FM4B 1FJGF 2J7IA 4LF7J 3WXMB 4OZNA 5LSLA 5KCHA 4DUTA 2R2SA 1KOOA 1K4US 2RAQA 4WZMA 5A6WA 1M27C 1AWOA 2JH3A 3VGSA 2IY5B 2DNKA 1VRUB 1RWWB 2HVEA 1UJ0A 1RACB 2AYMA 3NCQA 4ZP7A 2RHYA 1S6QB 5KG1A 4ID8A 4OQJA 2ROPA 3AJ1A 5HQ8A 2CWXA 5AYFA 4RU2A 1FXXA 2CSIA 1U02A 1KN6A 1H38A 1UEKA 4LFCF 4JBCA 2HHTA 1VS3A 3DLKA 3AODA 2ZITA 3G71A 1WTFA 2JMCA 4OZ5A 4FW1A 2V2QA 4MYTA 5CR2A 2QGFB 2DTJA 4J9GA 4X62J 1X4BA 3VS4A 2KXFA 1FE0A 3SWNB 1P9QC 2WONB 3CT9A 2CT3A 1I1JA 3NGPA 1IKVA 3CCLA 4QR0A 1R8AA 2OMLA 4NI2A 2KDOA 5IT4A 2RH3A 1HD3A 5GAHU 5GADU 2GCFA 4B3RJ 3HSBA 1OYXA 5GAOr 1QY7A 1GQEA 3HI9A 4A4JA 4QYZK 5CABA 5IC4B 4OGCA 2CQIA 2Z0WA 3CCJA 1Q78A 5B0EA 1YJNS 1G6BA 2JOQA 4J9CA 3KG0A 2CP0A 2QIFA 3GG1A 3CPWS 4AYBD 4PJNA 1VQ9A 1HW8A 4CDIA 4M94A 2YWGA 2PVOB 3TX8A 2OEKA 5LJ3j 2DL3A 4ZNXA 3C66A 1NJZA 3PNIA 3M9NB 3TA2A 4KB7A 1TL3B 4LR8A 4QQGA 5GANe 4LMZA 3K89A 4PWWA 2B7BB 3THPA 4LF5F 5J3BA 1OMSA 1NSKL 1TK0A 1YJNQ 1D1UA 4JI1F 3GV7B 1IREB 2XCAA 4HACA 3ZTSA 3DU5A 1JJ2A 2OJ2A 2XK0A 2D1CA 2R7OA 2K4YA 2DEIA 3B54A 3FRZA 2K57A 3PYFA 2GGPB 3R5GA 4AL5A 3NGDA 1VQ8T 1N88A 2B5JB 1NEEA 2AMCB 3GWCA 2ZD1A 2DYAA 3CCRS 2KI2A 5ETPA 2VQEJ 2CG4A 1U09A 3JAME 3PEJA 2RUSA 3AJDA 1T9YA 3D28A 2C2EA 2HVIA 1B07A 2FG0A 4J9DA 4Z88A 3MHYA 3FCHA 3R1LA 1N5SA 5L23A 2C06A 4F36A 2AQ4A 3NNHA 1LOJA 1CJTB 4KR0B 2VKZG 4A8FA 3UDEA 2HLUA 3VYGA 1WKLA 4ZCMA 1TXQA 2EKNA 3FMBA 1WELA 1OPZA 3CCZA 1XOVA 2QGGA 1U48A 3G6ET 1GTEA 1M3AA 3R7SB 3MGJA 4OMMA 2QLXA 3QSIA 3TAMA 3CMAT 1ZPVA 3KTQA 1ZZNA 3GONA 4ZDNA 4DQRA 5KFXA 1K0XA 2AT1B 3PIPA 2E1HA 2GNCA 4USJC 4F2RA 1CJKB 2CJYB 1WYXA 1FTRA 1BIAA 3QJYA 1HL6A 3M32A 4ECWA 1LV5A 2H51B 3LWMA 1H3DA 3KLHB 1RTHA 5IT9E 4EK2A 4B9MA 1D0ZA 2MGZB 5GAOm 3IAM9 3PJ9A 2UXDF 3H9NA 3QAUA 3M8QB 4ZGEB 3L2RA 3KHGA 3J80U 1Q82U 3IRXB 1E6YB 3OYKA 4OHVA 5LJ3Y 2O01C 4OX9F 2LT1A 4NCAA 3A4TA 2PUKB 4O6JA 4M75B 1JLFA 3AQPA 3DLEB 1ZYQA 4BC7A 3EICA 3MEGB 3OYIA 1Q95G 1HI0P 2K6DA 1TVRB 5DLQE 1DJ7B 4DR2F 4YFUA 1A0NB 2CFXA 1YZ6A 3GIJA 1HWJA 3JB9H 3T5JA 1X0FA 1Z1ZA 4RTTA 2RNAA 5GANh 3DKMA 1MUZA 2QYGA 2HVHA 3VKIA 4RW4B 4CC4B 3BO4A 1FJCA 1VQ6T 4Z7YA 2VC1A 3GG0A 5ETNA 2LEAA 4URQU 2AW0A 2JRSA 1YDLA 1YJ9A 1RHJB 2NPFA 3OYNA 2W9BB 5KFAA 1BK2A 4CLWA 1UVMA 5E3PA 7FDRA 2D6FA 2ZWOA 1LK5A 4XTZA 3QKJA 3R9LA 4C0OC 3MI7X 4J9OA 1UHCA 2BJEA 2YNGA 1J5EF 2F8EX 4EBEA 4XDCA 4DV3J 1JWWA 1QAXA 1M8MA 3ILIA 2XM3A 3CF5Q 2N3LA 1YJ9T 4P7TA 4AFZC 1L3KA 3KHHA 2BW7A 2J9DE 3MWBA 3MUTP 4KRTA 1VQKS 4RL1A 4HCCA 5FRMA 1QVFA 2DVEA 5KFCA 3OSVA 1G3TA 2OTLA 3DN9A 5BR8J 4NXNF 3GCXP 2WK4A 1QUPA 4WP9A 4ZPAA 4AFFA 1FRJA 3ISZA 2LQ8A 3EHRA 2AYBA 3T1AA 4DG1A 5J2NA 4JI8J 2DNUA 3PRBA 3M8SA 3DRPA 2XSJB 5F9NA 2V5HG 1VQ9Q 3I82A 2JFDA 2DYBA 3HKZD 5J1NA 1NPRA 1AFIA 2RIJA 2FHKA 2GAHC 3GJTB 3TRGA 5LSOA 2UVVA 4CRIA 3ONQA 1NRKA 3VF0B 2J6FA 2LRQA 3NMZC 3DMJB 2VBZA 4J8OA 3VS5A 4GVBB 4QQ6A 1VQ4S 1K47A 4B9LA 1GL5A 3JQKA 5CVIA 2J6OA 1FWZA 3I55T 3L2WA 3C95A 2AYEA 4PQUA 4NEYA 4ED6A 4PKDB 2FJVA 4E7SA 1SL1A 2MSSA 2JTEA 3QJ6A 4ZN1A 3QGGA 2OELA 1BKBA 2DBBA 4NYPA 4P72A 2HQDA 3UCGA 4WXOA 3KJVA 3IWNC 1EP4A 1Y3JA 2FHJA 4D3HA 2HNYB 4WIIA 2QK0A 1QVGP 4QW2A 4M5IA 3T5KA 2GAGC 3EXCX 2ADCA 2DHHA 2QO3A 4DBHA 2ESWA 4GO7X 1R6YA 2LXUA 4YP3A 3VCDA 2ZPEB 1VBXA 4DR6J 3GLJA 1RWXB 3BYRA 2RMOA 4B9WA 1CULB 5CYMA 4O4GB 1NLKL 4RW7A 1XBWA 4USIA 2DGSA 3OFGA 1LW0B 4DL7A 4CCHA 4LDXA 3DYAA 2U2FA 1YGYA 2YRDA 5D3GA 2HS4A 1VQKA 4R0KA 2Q66A 1S12A 3VS2A 1FMWA 4LD6A 2WTFA 5FLXY 2BQ3A 3I35A 4FU6A 3LP0A 2KT2A 2PVDB 1HBNB 2ASLA 4DOZA 1OQ6A 2E64A 1HYSA 4ANEA 2MWPA 2B9EA 4FYXB 2FO0A 1KHCA 5D4OA 2CSQA 2MAMA 5CCMA 3BJYA 2VFUA 2L48A 4N4IA 4QKUA 5HJXA 2DHSA 1YI2S 3THKA 3LPYA 5KFTA 2J9EA 1VCTA 4CT9A 1SPBP 3MPVA 5CYQA 1R8OB 1QWFA 1XMBA 1M2VB 4BI3A 4URSA 1ZZFA 4KPYA 3H2LA 4RNHA 3TSWA 2C3MA 3SSSA 4B3OB 4JI0F 4DZ6A 1VQ9T 1U8SA 2EK6A 3PX0A 4YEAA 1K73R 4QPXA 3META 5ETSA 4CT8A 5IT9Y 1YSJA 5K8OA 3G4SS 1Z9ZA 2CKKA 3CC4T 3A8MB 2PMZD 4HACB 1Q81C 5D77A 5HVFA 1N8RR 1H72C 2LVWA 1YJVA 1P1LA 2HEQA 4DPWA 4MAKA 5ETLA 1HNIB 1VQNT 4QWBA 1TZ0A 3CJKB 3JS9A 4AXJA 3J80E 2DNMA 3JYTA 3GPLA 1YJ9Q 1QCNA 2HHPA 3LQVA 3BGFA 3NG8A 5KT6A 4NLRA 1FRLA 2LQBA 2DD5A 4C5HA 3N9UC 3BSAA 2NSBA 1HSQA 4QU6A 2A6MA 1SB6A 4RUBA 5GAEU 1OQ3A 3MM8B 9RUBA 4DV4F 2FRWA 3PFOA 4DCJB 4I2PB 5C7PA 4E7IA 3A1YG 3QZ7A 2MZSA 2CJXB 1RHUB 5A0DA 3GF5A 5MLCV 4RZRA 4Q45A 2MHEA 2AJ0A 2GIRA 5JXSA 3KBGA 4F4KA 1K0TA 4OI6A 2HFZA 5AXKA 1K9AA 3VALA 4I0WA 2X9HA 2B43A 3KLGA 1TV6B 3QGHA 4OJ1A 5KFDA 4ZLLA 2WBRA 2B9XA 2P5VA 3PRVA 4N7TA 2BYCA 2F5GA 2VFVA 2RQRA 5BXIA 5T7LB 4DF4A 1Q86R 2O4XB 4HVWA 3GFXA 4A47A 1MMGA 2XLIA 4J9MA 3F70A 5KT5A 3WDOA 2RI2A 1JO8A 1KQSR 2J7UA 2W7AA 3T1HJ 2G2OA 5DDRC 3H8YA 4LFBJ 3QO9A 4IH6A 1S1WA 3F44A 3KLHA 1S97A 1WI6A 1FFSB 2ZM6J 4YUDA 1S1VA 5HK4A 5I42B 3LP1A 4BI8B 4ER8A 1UVKA 1RE1B 4J6YA 4IUVA 2YDLA 4N0AC 3BR8A 3TJ8A 5HK0A 3E1SA 3ENWA 1TR0A 2HFNA 3ZZ0A 3CCSA 4IO1A 1R8HA 2HMIB 3QT5A 4OZJA 4KULA 1S1TA 4IG3A 4PRFA 4JDSA 4PFPA 3D6MB 2NUUG 3GYNA 4XPEA 1WUUA 4JLIA 1TVRA 4EEYA 1TMJA 4RTUA 2LXIA 4QIVA 3AQOA 4M77D 1PD1A 3TR5A 3V7CA 3KLFA 1VRTA 2C3YA 1RTDB 4RNOA 5CCLA 2A2CA 1GRIA 2YKMA 3MM9A 3QDFA 4HYKA 1VIEA 3BW1A 2V68A 2CP3A 3R1HA 4Y2AA 5I2MA 3T5LA 2HFSA 1KC8C 2HURA 1Z2LA 4L6V3 3NBPB 1AEYA 4PEOA 3LO3A 5C25A 4FXWA 1JLGA 5I3UA 1M5Q1 1XERA 3BQ0A 3TOQA 4KHMA 5C6SA 4USKA 5I4MA 4R0JA 3JCMQ 3DKDA 1EIFA 2MMYA 3VTIA 3EFSA 2GBQA 1TAQA 3MF5A 2FGCA 2ENMA 3VAKA 2KRRA 1MU2B 4RJVA 3BV8A 2HBYB 4HDGA 2MI6A 1N6QA 1NH8A 2CQPA 3M55A 2F3JA 2RF2B 5E5NA 2UVWA 1FXRA 1HR0J 3JXOA 3S3OA 1VLOA 4CLFA 3DGVA 2FLLA 1H98A 3MAQA 5LMNF 3SI8A 1VI7A 4C48A 2L8DA 4R5PA 1DY3A 2VBXA 1GTHA 1S6PB 1UW9A 1X60A 2J7KA 2DRMA 3GR0A 2AHOB 1M90U 4OMPA 4XAXB 3VRZA 3SSRA 5L8RE 3UN3A 3R8YA 1HHSA 3CCJS 2X35A 1LW2B 5IOLA 3DOLB 5L1JA 3R6NA 4OZLA 1I3OB 2JLEA 2EK1A 4P7VA 4ZVSB 1S9FA 5FLXE 2L08A 5GVQA 2RHZA 4X9DA 2Y1LB 4ED7A 2JM9A 4DV5F 1OOTA 2DD4A 4TLQA 1FX4A 3X20B 1TP7A 5LJ3e 4ED2A 4MK7A 1UGPB 4ME7A 2HRYA 5IQ6A 2O2OA 4OZ3A 1C4CA 1H2TZ 4BLGA 2W9AA 2Q3PA 1PJ7A 4M75G 2EQMA 2NZCA 2VB6A 5C2CA 1UHFA 3B82A 2ZNYA 2G0JA 1NO8A 1EP4B 2DXFA 5KYXA 2GMLA 1YIJS 2O66A 3OHBA 3KKFA 1FJGJ 2H4WB 1N34J 3ET6A 2LDIA 1SQGA 1IJEB 1M5VC 5LXYA 3MM6B 3QPIA 2NCKL 1ZA1B 1HQEB 4XK8E 3KJNB 4DX8H 5A8KA 2CZ0B 3RDVA 4PAAA 1PAEX 4WYLA 1EJ7L 3FJ2A 1KQKA 4RW7B 1U2CA 3FSXA 1MGQA 1NSPA 1Q0NA 4LBPA 3GLXA 3X3UA 3OJUA 4ES3A 5GANg 4XDDA 3R5CA 1X9SA 1JJCB 1X4EA 3JCMh 4TN2A 5IH2A 3EH2A 1VRUA 1FTCA 2MKKA 3M4XA 2FY8A 2VONA 2VFTA 4PABA 2B4OA 4NLUA 1FX7A 4Z02A 2G9OA 4K2JA 4P6QA 4A8SA 3FJ5A 5KFMA 2E65A 3H4DA 3VU3C 2MXYA 2QYZA 2XMMA 4ZHRA 2J0SD 2A18A 3I56T 3SWNC 3I56Q 1HI1A 3M4GA 2EI5A 1S4EA 4QIWD 3PXGa 2UUAJ 3GJQB 4LFAF 5KYYB 2NXEA 3CB4A 2CJ9A 3IR5B 2A36A 2RI5A 4B3OA 1H3ZA 5CHCB 1RXOB 2RDJA 2GVZB 1YI2A 5IZHA 1B0TA 1NAQA 1RWUA 5A8WB 4ES2A 5F9LA 4F4WA 1HJDA 2MB0B 3JCMX 1HPZB 1YP5A 1Y7PA 3V81B 1D9AA 1MMDA 1D0YA 1JIHA 2GW8A 5GAGU 1YITT 2EQIA 4F67A 3AD9C 3FKBA 3M0UA 5DDPC 2VUBA 2QA4T 1C1CB 3HHKA 4O44B 1YBUA 2JW4A 3G87A 2HYIB 2H3JA 2FVSA 3JYTB 2JZ2A 2JC1A 1NUEA 4RBVA 2QFIA 2F1FA 4LUDA 3PVLA 2B9WA 1QLYA 1CKBA 4OZ1A 1FVSA 2K2VA 2Z57B 2EJ9A 1NH7A 3OYHA 1SI9A 4J91A 2HL5C 4PG7A 2LCWA 4ZJOA 3RESA 1SVDA 4C92A 2DPIA 2EBEA 3CCLT 1JJHA 1IHVA 3DCAA 4MMLA 3HJVA 2W7OA 2IIMA 3J7YU 1M1GA 1EFNA 1GXLA 1MMAA 4XTTA 2CVIA 4A8XA 5BYSA 1HWIA 2XS5A