1PG5B

Crystal structure of the unligated (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
148
Chain Sequence
b'MVSKIKNGTVIDHIPAGRAFAVLNVLGIKEGFRIALVINVDSKKMGKKDIVKIEDKEISDTEANLITLIAPTATINIVREYEVVKKTKLEVPKVVKGILKCPNPYCITSNDVEAIPTFKTLTEKPLKMRCEYCETIIDENEIMSQILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate carbamoyltransferase
molecule tags Transferase
source organism Sulfolobus acidocaldarius
publication title Crystal Structure of T State Aspartate Carbamoyltransferase of the Hyperthermophilic Archaeon Sulfolobus acidocaldarius.
pubmed doi rcsb
total genus 32
structure length 148
sequence length 150
ec nomenclature
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
B PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 1pg5B02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 1pg5B01
1TTHB 1ACMB 2FZCB 2H3EB 4FYXB 4WTOB 1ZA2B 1EZZB 2BE9B 1PG5B 1SKUB 1F1BB 1R0BG 1RAIB 1AT1B 9ATCB 1TU0B 1RADB 2FZKB 1D09B 2A0FB 2QG9B 4KH1B 4KGVB 1RAAB 3D7SB 3AT1B 4KGXB 3MPUB 2BE7D 4FYWB 4F04B 8ATCB 1RAGB 4AMCA 2QGFB 1RAFB 2AIRB 1R0CB 7AT1B 1ZA1B 4KH0B 1NBEB 1TUGB 4AT1B 6AT1B 1RAHB 4E2FB 5AT1B 1RABB 2AT1B 2FZGB 4FYVB 4FYYB 1Q95G 1RAEB 2IPOB 2ATCB 1I5OB 2HSEB 2YWWA 4KGZB 1XJWB 8AT1B 1RACB
chains in the Genus database with same CATH superfamily
5KFZA 2KRMA 3KK2B 5D3GA 1U26A 3V6DA 1FX7A 4R25A 3W2WB 4XTTA 3DRRB 1UJ5A 3Q24A 1VQ4A 1YJUA 2YBVA 2JHEA 2ZVSA 3FNNA 4JI8F 2N3LA 5H9EJ 3DLMA 3FEYB 3R1LA 1M2OA 5C0MA 2QJ3A 2RUGA 1WHYA 1X2QA 1RT3A 4P73A 3GONA 2V4JA 3CB4A 4RUAA 3WVEB 1RB0A 5LL6d 4D8KA 3T1HF 5CYMA 3EXYA 3W63A 3HSZA 3BN4A 4ZCKA 4LF9F 2E5IA 2LNHB 3LUYA 3LF0A 3BH7B 2ZFHA 5G4DA 3H4BA 2V69A 4PKCC 1WACA 1Z9ZA 5B09A 3SQGA 1ZSGA 1MGQA 2RF2B 1C1BB 4GC6A 3IA0A 4EU0A 1KD1T 4WIQA 3HHLC 2QC3A 3DHXA 3M54A 2VXFA 4P2XA 1NZAA 8RUCA 2YXLA 1D09B 4NOYA 1RI9A 2K3BA 4XTYA 5LJ3h 3A4TA 4LD6A 4JI5J 1OU9A 1LNXA 5HLFB 4X9DA 4QR0A 1YLXA 2CNKB 5L1LA 2FY8A 1TQLA 3P5BP 2HZAA 4J6WA 1MG7A 3KG4A 2N4DA 2HHXA 5J2MA 1LWFB 5GAOr 4MZMA 3IO1A 5L1IA 2VQEF 5HBMB 3M0PA 2D41A 5LJ5g 3OW2R 1ZSZB 4FS1A 1KD1R 3CMAS 3BSCA 2KBTA 2ZBPA 1YHQS 3D68A 4KGKA 4X2BA 1Q82R 2LQ5A 4X4NA 3DKDA 3DCAA 1MN7A 2QFJA 2NUPB 2CJKA 2YQ0A 2QDLA 5GANj 2H5JB 2LEAA 2NXEA 4DL2A 1VQOA 1WI7A 3SIPB 1K1QA 5DZ6A 5CVIA 2EFIA 1SC6A 1VQOS 1UP1A 4OI4A 3EG2A 1CLFA 4GY5A 2DVEA 2YH1A 2ZWPA 2HWHA 3DOKA 4J9DA 1C0TB 2MHNA 3LP1B 1VQMT 1S1VA 3NFCA 2LA6A 3NGUA 2Q79A 2IRUA 5D6GA 1AUDA 1BIAA 3BR8A 3M6WA 4FYVB 4I64A 4B9UA 4DQPA 3HHKA 4IFVA 4ZPAA 4J9PA 2V94A 3RR7A 1RT7B 4X9CA 3D6MB 2DPJA 2VG7A 2KDSA 1M90R 1HKAA 4QU6A 1X4EA 4ED0A 1VQ5S 4OJHA 4BE0A 3JTOA 4DR6F 3IM9A 4XO0A 3HL8A 5AE3A 1Q8BA 2BUNA 4DX6A 3LANA 4DJBA 4KT0C 2OTLS 4M78D 4C8MA 2CT3A 2HRUA 3DOMA 1WGSA 2EFVA 1NHVA 1UA1A 1FTRA 1FJ7A 1RBLA 2DD5A 3EGDB 2FPFA 1UTAA 4KC5A 5IWAF 2P6TA 2RJEA 3INZA 3UWNA 1KFDA 5LMUF 2LMIA 3S3OA 1WELA 1RCOB 1EKSA 2WBMA 1W2BP 2UUCF 2VG6A 4M75D 3L2WA 2B56A 3IRWP 3LW5E 5U47A 2BKPA 3W8PA 1YIJS 2IAJA 3G6ES 4ANJA 1EHWA 1YI2S 4CH1A 1SIWB 2LRQA 3ZNJ1 3VUBA 4X4OA 4C0FA 4GLMA 2CYYA 2NUPA 2HNDB 2PFFB 4DR1F 2PT0A 1I6JA 4QWCA 2OELA 4RG2A 3PX4A 1BGXT 4DCPB 2RI3A 5HVFA 2QI2A 1RHMB 3LP2A 2EKNA 1VQNQ 3QZ8A 3W2VB 3EFOB 2E1HA 1SB6A 1KD1U 4UQTA 3GIRA 3NTKA 3G8SA 1NK5A 4M7AE 1LEOA 4ZLNA 4M78G 3KHHA 3ENQA 4Y2IA 1HARA 4JUVA 3RNJA 3I55A 2PVOB 4M7AF 4VUBA 2ZH3A 3FC9A 1UAWA 1IKWA 3D3CJ 4P2MA 2HAIA 4Z37A 4CLLA 1HNWJ 2NUUG 1HYOA 2DEIA 3JCMh 3JB9D 2VG5B 4ZDNA 1HSQA 3CMEA 1BI0A 1LK5A 1PRLC 3FRYA 4B3OB 1AFIA 3SEOA 1NK9A 3KK2A 4E7IA 3ZBDA 3K7RA 2N7YA 6FDRA 3VS6A 1RQ0A 2F63A 3VAGA 2MI6A 4NL2A 3W3SA 2D3UA 2IFXA 4HH1A 1KSPA 1Y9OA 2LQ8A 4PAAA 4XPCA 4YOEA 3KK1B 4MK7A 1Q81U 2OD6A 5GAGU 1SQFA 2XWYA 2YNIA 3MM8A 1RLCL 2OAUA 3SB2A 2EGCA 3NRBA 1OV3A 3JCMe 4RTTA 1NDPA 1UW9A 2WK4A 2Z0WA 2RI2A 2DNMA 3P4UB 4AQYF 1LW2B 3TAPA 1CULB 1Q1KA 2ZAEA 1OQKA 4F3OA 1X2KA 5KCOA 3H40A 1NH8A 3PHTA 2ZH4A 2RHIA 3FRNA 2EI5A 3E9GA 1YRXA 1JJCB 4DUYF 4C8QE 3TUZC 1SJQA 3PX0A 5GMKm 4PXEA 4M75G 3TANA 4C8QF 2H8HA 2X4WA 3PM9A 3OMCA 3OSSC 3GMGA 1S77D 1UB4A 2XMFA 2COYA 3GG1A 1H2UX 2WW8A 3FCWA 4TQSA 1JLQA 5DG9A 2FLLA 4OF1A 3P96A 5GAGI 2NR0A 5DY9A 1S97A 4NLXA 1GTEA 1RYSA 2MIOA 1S1WB 2DT9A 2R2SA 2BW7A 3SWNC 2KFNA 2VFVA 4EMKA 1WJRA 4A4FA 4HCZA 1WKLA 4BE2A 4OHZA 2F1FA 5FIIA 3SBMA 3QDRB 1RHUB 2G2OA 2VONA 3M30A 3G7ZA 3SEMA 1U0SA 2HMIA 4KY3A 2HQHA 1JNRB 2FJDB 3J7A1 4RNFA 3S8SA 4C92D 2XI3A 5CKHA 2OHDA 1U45A 3HJFA 3DMJB 1KJWA 3HRTA 3H25A 4LQ9A 2FGOA 4AE5A 2B51A 4PFOA 1OQ6A 1REVB 1BIBA 1YITT 3CMAT 2G0JA 3TZWA 2J9DA 1D0XA 1YIJQ 4WYLA 2I5JA 1K9MR 2XLIA 3KJVA 4Q44A 4DR4J 2RHQB 2OFHX 1HHSA 1KS2A 1KQSS 1UVKA 2KTQA 4CRIA 1FT8A 4E7LA 4RO0A 5D6YA 4OLOA 3TX0A 2OMLA 4JI7F 4PYDA 2DGVA 2QA1A 5L9XA 3TVYA 5IT9E 2V8VA 4B6MA 3TX8A 2J9EA 1NJZA 3OFGA 2V8IA 3EDRB 5J26A 4DZ6A 5IT0A 1RAGB 4WWSA 3UD5A 1CJUB 1E6YB 2DTHA 4XTVA 2E6ZA 4WF2A 4DQQA 5HQ8A 3MHYA 4K2JA 3FB9A 4QYRA 5IM0B 3T6BA 4JI4J 1A7GE 3ZL7C 2A7YA 1PIEA 3V8KA 2PNIA 4O4RA 4MKYA 2B8QA 3ZNUA 2VWFA 2BA9A 1E6VA 4JZ3A 2EKYA 3MEWA 4ZLPA 3VZIA 3EGZA 4C97A 2DEJA 5GADU 3FDSA 3MR6A 1WOOA 1SL1A 3IR7B 3JCMQ 3T6JA 1W2BS 1Q95G 4M5KA 2K9GA 5A76A 5F0WA 5E0OA 2KRRA 3IAS9 2DXUA 2C1EB 4OB3B 4A46A 5ECAA 1IRXA 3CIMA 4ES3A 1C1CA 3D5MA 3OYAA 2DYIA 2L0AA 2V8KA 2IG0A 3WQPA 2BEFA 4I7FA 3W1YC 1YI2Q 4WP3A 3BN7A 4F4YA 1S1XA 2D9PA 4HVUA 5BJRA 3EGVA 3CD6A 2I2LA 1RXOB 2PD1A 3QIPB 4D3HA 5IV4A 3CCVQ 1N32J 4BC9A 3HZEA 1R8OB 4DCJB 1QE1B 1VQ7T 2QLBB 2F4VJ 3AOAA 4C92G 2UVVA 4HTJA 3PEHA 3JAME 4Z8AA 5KFHA 2BZ2A 1WHGA 3QFWA 2RKIB 2MZ1A 1F0XA 3U7JA 3I35A 1VOMA 5DLFA 2MQ8A 1S1WA 1AWJA 3GFXA 4RU2A 3PVLA 2FD2A 4ZVQB 1RSCA 1WSRA 2DTOA 1S7IA 4PPDA 5D0HA 2GIFA 1AA1B 5KG6A 2KVQE 3VS3A 3UCZP 2XLKA 4KHRA 4DV1J 2JTEA 4RNHA 2YQ1A 1X6BA 2RA2A 1VUBA 1V76A 1NXIA 2IJFA 5KOWA 1WNLA 2R8HA 5H9FJ 2HL5C 3JSBA 3NS6A 4F0KA 3RW7A 5HSPA 1OY6A 3KLHA 2E44A 2DO4A 3D6TB 1TK5A 3CDAA 2YH0A 2C0TA 2X1BA 2B4VA 1BQNB 1N34F 1QLYA 4HCBA 4I69A 2AKKA 1R89A 4DBFA 4OZ3A 2VPYB 4U7CA 4HT7A 3HZGA 3JQMA 2EYYA 3MEGB 2GVDA 4UZCA 4USTA 2BR0A 3V7CA 4MDXA 1NEBA 4PFZA 3UT1A 2A2DA 1OX9A 1PM3A 1B0VA 1NHUA 1ICEB 2YNFA 5AYFA 3I87A 2NUTA 1UEUA 1S4FA 2R42A 4LF6F 3DGPB 2WZ1A 4GO5X 3PRDA 1S10A 3V8JA 4LD9K 2K2PA 2NXCA 1VQ7S 1FFSB 2ABLA 3CPWP 1LJOA 3THKA 2B6AB 4B9VA 4JRPA 5J3BA 5I4MA 4LFBJ 4IUFA 3NKYA 4ER8A 2XULA 4A4JA 3A8HB 3I5SA 2HK2A 1W25A 3WVDB 2CPDA 5AXMA 3ILOA 3QIIA 1LWFA 1R6VA 2HVIA 1FRJA 2G0IA 4J90A 1LWCB 2W9CA 2KMTA 2Y4XA 1X5OA 4F4WA 1SXLA 1FMVA 2KY9A 1YJNQ 4KGZB 1U0HA 3BDEA 3CMES 2HS3A 2FVCA 5GAN5 1SIZA 2H4WB 3LW5C 1TZ0A 1N5SA 2NSCA 4IG3B 4GKJF 3Q2SC 1NSAA 2D3OR 1VQPS 2CQDA 5LJ3Y 3CCWA 3VAHA 2RRAA 6AT1B 2W01A 1OPKA 3CCMT 4E8UA 1DFDA 2DFUA 3B6BA 3FK4A 1NK7A 4DV5F 2DAQA 3W60A 5CKBA 3MUTP 2XK0A 1RAAB 3TQ7P 3CXCS 1EIYB 1S57A 3A12A 1U09A 4WFYA 2H51B 2KNBB 1SJFA 2IVWA 3I56Q 5IQ6A 2J0SD 2XZTB 4FYDA 2BJ8A 3M2RB 4OYWA 4NLOA 3W2WA 1FXDA 2J7UA 4U9RA 1NM2A 3PR4A 4QYZK 1HI1A 3HX9A 3MHXA 2FGCA 2ZVIA 2ROLA 2FDNA 3G6EA 2KM8B 4ZIWA 3IGNA 3BKFA 4YTLA 2E29A 4XTZA 1N5QA 1Y71A 2V8PA 2DA9A 2DY9A 4ZVPB 3G71A 3OYFA 2J6OA 2G3RA 3M0TA 1X43A 4L6V3 1K4US 4P5NA 4M5DB 3SDZA 3VAMA 4M75F 3WC0A 2IYGA 1YP5A 5FU7B 2DNHA 3S01A 1QWFA 4FYWB 5EWFA 4DSKA 5F3TA 3CGIA 3I4PA 2R58A 5E3PA 3GPLA 3UE2A 2JEFA 1KWMA 2KHDA 3KMQA 2VFSA 4KPYA 3RBDA 2RN8A 3OSPA 1K73C 4RW7B 5HY6A 1RGVA 2GS8A 3LGFA 2CQCA 3UR3C 1S48A 2MJNA 3DN9A 3GR0A 5FLXY 1T0JA 1U1LA 2C3OA 4OX8A 2YKNA 3VAJA 4JI1J 3GIMA 1NSPA 3B78A 3VUZA 4NCBA 1AYEA 3C16A 1D1AA 1C0TA 3H6ZA 3OW2P 2QO3A 4R0JA 1NK4A 4DSLA 3V4MA 2DCUB 4IG3A 4LF7J 4RZRA 2GO9A 4LF4F 3EGXB 1G3SA 5D77A 1IBMJ 4DV6J 1UJYA 3EZ5A 3AD9C 2HBRB 2WVDA 3Q0AA 4BI3A 5EUHA 1C1AA 1JU5C 3KUGA 2ERRA 2IBOA 2M7SA 1O8BA 3FRZA 4DQIA 4OYOA 5LSLA 1N8RR 3CCMQ 4M5NA 4KH1B 2IIMA 2VG5A 1JQGA 3M57A 1KLMA 2J05A 2BUDA 3POTA 2DM1A 3I56S 1AWWA 1U6FA 5A8KB 4X34A 1Z2ZA 4ZHRB 3TA0A 4Z88A 1MNDA 3M1VB 3H98A 4KPCA 1IWGA 3PTWA 2LVWA 4N41A 4M77E 4F0HA 1JLBA 2VODA 3UD3P 1F60B 3TU4K 2AF6A 3GLJA 4KKOA 4RBUA 3HFNA 4NLGA 2EG1A 3ME9A 3ENWA 4QYZJ 4R55A 2KR3A 1OULA 1VQ4Q 2ZPEB 1B3TA 2OSQA 2I8EA 5A0LA 2K4YA 3OSVA 1RU1A 1D1BA 5I21A 2QDYB 4DI6A 4O5VA 3TR5A 1TL7A 4YR2A 2RVJA 5CKFA 4LSLB 4EK2A 4F7UB 2Q1LA 1FO1A 2PZ1A 5KE2A 3OTBA 4J7CA 1M1KU 2A3LA 4U95A 3VQSA 4CLKA 5IS2A 4K59A 1FRXA 5LJ5f 4P7VA 3OLAA 2DXCA 2ZPFB 4NLQA 1U2FA 2FVUA 4NOHA 1UDLA 4KT0E 4BWJA 1HWJA 3QJ6A 1MROB 1UGQB 1MV3A 1U5SA 3TEGA 1TS9A 3DGPA 1X9WA 3OVBA 2AYBA 1HNWF 4KULA 2HURA 5HKCA 4C8ZA 2X1AA 2YRVA 2A36A 4OL8A 4N8NA 4F7UF 4BC7A 2B6AA 3TEHB 2EIFA 3D3BJ 4FW1A 5GAMg 2PFDA 2WW4A 4PWDB 1ZS6A 1H3HA 2IAJB 1S76D 3IM8A 2ZM6F 1VQMA 1NPRA 2A0FB 4DR3F 2KT5A 2PA8D 1YCYA 2MTLA 2JMCA 4V19X 1QP3A 3DYAA 1K8AR 2KQWA 4RUBA 2IIHA 1SL0A 1FE4A 1R43A 3BGUA 4IH6A 1KVJA 4M78A 5LT5A 1OO0B 3TEEA 4O23A 3CCET 1UA0A 2WSFE 3R8YA 1VQNS 4PJOA 2E5LJ 3VZHA 4E7HA 2OEMA 1M2VB 5LJ5j 1ZBTA 4M1KA 3KUEA 3IN5A 3REBB 1U1PA 3BGRB 4CIOA 3G6VA 2LX9A 3RW6A 2CXEA 3ZC4A 3S7RA 1CQNA 3LOUA 3ZZ0A 2ZPHB 1CPZA 4BDPA 5B0DA 1DAXA 3JCMP 1YJWT 1VQKQ 1MMLA 2UV8A 3CJTA 3DKMA 2QYZA 2PTKA 3V2UC 3Q8RB 3J7ZT 2ASDA 1YIJT 2KXNB 3ER0A 2GO8A 4KSEB 1OOTA 3N5BB 1WNEA 4PJOF 1VRUB 2PO4A 3GFYA 5KFLA 3ILJA 1H7WA 1SBRA 3MDFA 1Q7LB 2UUBJ 1M3CA 4M78F 1WOPA 1NJXA 1FX4A 2VBXA 2H65B 1DTQA 3TCJA 4M7DE 3A8KA 3DNCA 4DU7A 3AJ2A 1QY7A 5LJ5e 3CCMA 3G82A 1HW9A 1FRLA 1UJ4A 2CP2A 4M77G 3CDUA 4M77F 1HQEA 2F3JA 2NLUA 1SKRA 2X1FA 1TUDA 2IA6A 2KJWA 2BJ3A 4ERDA 1PYSB 1VGYA 2RQ4A 3Q83A 2NPFA 4F7UA 4MKVA 2MQMA 2CQPA 4V1Ak 5HK4A 1FK9B 1Q7YU 4BDZA 4JI1F 2HBWA 2MMYA 2IMWP 4NL3A 4MK9A 4P74A 4M78B 1AB8A 4HVZA 2G9OA 3MM9B 5KYUB 1YHQT 5F8JA 2ZBIA 4HXJA 1Y96B 1MROA 1TMMA 1PJ6A 4J5YA 1V9OA 1C1CB 2XMVA 1UHCA 4FT2A 2RQRA 1GBQA 2DYAA 3CC2S 4OI6A 1TK0A 2IJNA 3KNGA 4ANDA 2ZZMA 4O3QA 4FIBA 3RIRA 3ILIA 2UUBF 2QLFB 3ILLA 3OHBA 5DGBA 1T9YA 2H3EB 5CH7B 2E9TA 4OB0B 2DJZA 1FI4A 2DRBA 1VRTB 1XTZA 4J9EA 3CJRA 5DQIA 3RKYA 3GYGA 4NLVA 1TL1A 4ETXA 1MMAA 1S9FA 5F8HA 2AIRB 3MM5B 4O3PA 3TI0A 3DGVA 1VHIA 4AQYJ 1RLDA 2R8JA 2DRDA 4EWTA 2X4JA 4B3MF 2OPQA 2RJCA 1U8RA 2LLZA 5J39A 3JCMc 3BQ1A 4KHPF 1YBUA 4N77A 1U6ZA 4MIAA 1B4SA 4ED1A 1WC1A 1GCPA 2MKHA 1X01A 1P92A 3MMAA 3R6GB 2XMUA 3B54A 3TSZA 3CW2C 1B34A 4WKRA 1EP4B 2L9NA 1RA6A 1YHQQ 3CC7A 4C11B 5T41A 4O4GA 2YUPA 2YX7A 1TR0A 5KYUA 2LP5A 3ZO7A 1IHVA 5CQGA 4AL7A 2HKEA 4HDHA 3DLGB 5ETTA 3CEYA 4MFBA 1KSWA 2C3UA 1R31A 3OYIA 1H2TZ 2GA7A 3UF4A 2VZ9A 1S0OA 1JK9B 2X1GA 4CO4A 3MOJB 3GF5A 1VI7A 1RAHB 4EDUA 3GR1A 1VQ9S 2VPWB 3UVJB 3R2DJ 3CCUT 3PG9A 4IFYA 1K0XA 4B9SA 4BY6B 1XOVA 4RTXA 3M0UA 2LT4A 3VS0A 2LNVA 3EGDA 2A18A 2Y8YA 3Q1JA 4YB1P 3FBBA 5KH6A 2HHSA 1XN9A 4ECYA 1J2VA 3M59A 2ASLA 3CJQA 2Q6BA 1XJWB 2R7VA 1BWEA 3MTKA 2O88A 4DV7J 1RWMB 4OYMA 1SEMA 3CC7T 3CT9A 3Q8SB 3EG3A 1EX8A 2QTXA 4HA8A 5M9OA 3CC4S 1U49A 5IQQA 2E5HA 4UF4A 4J9NA 2OPQB 4BI4A 2IPOB 3ZTPA 3S3NA 1IUJA 2NUHA 4PLLA 3SMZA 1BQNA 1T02A 4Y34A 2HHTA 3FJ2A 2BDPA 4QIWD 2DKOB 2DXDA 2E9ZA 1T94A 2DCLA 1RI0A 1GNKA 4YMEA 4LVNP 3RB0A 4ZJOA 1Q86U 1I94F 1RU2A 1H3ZA 2V26A 2R7RA 1RWNB 1N5YA 2LCCA 1QUPA 3DDIA 3SWNA 4UOCA 3ZZZA 5FLXE 2XBPA 1RE1B 4O44A 1RT6B 1B7FA 1K9MC 1KN6A 3JSMA 2LU2A 3X3UA 2KXDA 2ZC4A 1GRIA 2DNRA 3KJQB 2HNDA 5C7PA 4OHWA 2KRNA 2GFAA 1BYMA 3PYGA 4PG6A 2EC2A 2QG9B 2EWNA 2VL1A 3OB9A 4NE9C 1QKWA 3NOGA 2K3IA 1BQMB 5KYXB 1IKXB 1S4EA 2AGQA 3V81A 1QVFA 3KK3B 1B70B 1M8MA 2UVUA 1MU2B 1IBMF 1U48A 3OSNA 3SCIE 4J83A 2OPPB 2WB1D 4X64J 1OZ2A 3SDEB 5IXBA 1JJ2P 1RHJB 1YVFA 1NRKA 2YLBA 1T0TV 3RJMB 4MTPA 2YNIB 3MM8B 1W2BR 1UG1A 1LFWA 4A47A 2LJ3A 3BY7A 4PJOG 1LWEB 2DNQA 3V6HA 4DBQA 2ZH1A 2MZSA 2HLUA 3MCNA 3O6QA 4AFUC 2DKGA 2O5DA 2MSTA 1G8XA 4LFBF 3I96A 3K59A 4DUZJ 4LF7F 1VISA 5KFWA 1K8AU 2KRBA 1IGUA 1VQ9Q 4CLYA 1FTCA 2CZ9A 4FCYA 3LAKA 4EGLA 1SHFA 2WB4A 3OS0A 3TJAA 2HSEB 3NP5A 5K8OA 3VVTA 2HBZB 2YWFA 5LSRA 2FJXA 1X4HA 2FYKA 4II1A 1IXDA 3RRGA 4CO5A 3E2EA 2NXNA 4PLIA 4UZBA 4LUEA 2M88A 3W9HA 2VQFF 3JQJA 4W98A 2FJAB 1RWUA 1ZSZC 4PXBA 4X1VA 1N34J 1Y5IB 1LXNA 2O2OA 3UDVA 1ZBJA 2CUDA 3O5TB 4WFBQ 3GV8B 4B3MJ 2WACA 4BBYA 1T9VA 3UO0A 4E0DA 4NLYA 3H4DA 3DOLA 4ENOA 5K20B 5EC7A 3BPDA 2XQCA 4C4WA 4DFKA 5D4LA 1CKBA 1EFNA 1QVGS 3CCLA 1HI8A 4U67Q 2FJWA 3M4GA 3EWGA 4AXIA 4RG8A 2HDAA 1XBWA 4TLRA 2AJ1A 2CQ0A 3VF0B 2XY6A 1R8HA 3CBMA 1KQSP 3LTOA 4FF2A 3V5RA 4NZ7A 3QPHA 3MGJA 2YWWA 5CD4H 2P4RA 2FHDA 2MQPA 1PSFA 4NYOA 3OR1B 2E3IA 2DTJA 1QAXA 1M90T 3A8MB 2DIVA 3AD8C 4Z02A 2J0QD 2ZPBB 3I9QA 3KJVB 3KLVA 1MHNA 2D9OA 5A8RB 4FN5A 2HW3A 2HFNA 2CPJA 5KTQA 5FU7C 1TUCA 4O3OA 1Q81C 2WBRA 4RWXA 3VGVA 4Q5VA 3M8WA 2Z57B 4A53A 4LF5J 1ABOA 3REAB 4XPEA 2OO4A 4FZVA 4IRDA 5J2PA 2MJUA 2RQVA 5ETNA 1SJRA 3QFHA 3V81B 1TAQA 1HWUA 3KLEA 2XO6A 1QVFS 4F4XA 2RS2A 4ETZA 4ZP7A 2OIHA 4J9BA 2CG8A 2OLWA 1VDHA 4DL6A 5A0DA 4CH7A 3HSJA 1RAIB 2GHPA 5KOXA 1IVZA 4K5SA 1S59A 4JJCA 1NJIU 5LOQA 1T03B 2XCPA 2A08A 3BGFA 2OEKA 1GMVA 1N9SA 1FDNA 1FCAA 2GIQA 1M1HA 5H9EK 4P6QA 3L9ZA 2ROEA 3DOLB 2ZH6A 4M78C 2MLZA 3MM7A 2HHVA 1I3OB 4BDYA 1VQLQ 2CJYB 1U06A 2AX0A 4P75A 1PC4A 3BGLA 2EPDA 1W4SA 2M51A 3EGNA 3HVAA 1RYRA 3OL7A 1WDTA 3E1SA 1WHWA 1W2BA 4JLIA 2G2YA 3S3MA 1UCNA 3QMQA 5IHNA 2BM1A 1K8AT 3GSIA 2GX8A 2RRNA 1BI1A 4NXNF 4RUHA 2B86A 3V8LA 1M0SA 4DFPA 1PAEX 1S1UB 4CO3A 3MR7A 4ZCIA 3G8QA 2HCKA 4B3TJ 4C0ZA 4CC3A 1WUUA 1NO8A 1K0TA 4P2SA 3HCXA 5KT3A 3GCXP 2WSCE 3NNHA 3RKWA 2DTIA 4IG0A 4RTYA 3GPAA 5EWGA 4ILMA 2O01C 3QGPA 2HWIA 3J7AN 3BSAA 1ZA2B 1RI7A 4WIIA 2M0GB 2DL4A 2ZBCA 1TV6A 4KE5A 3CWJA 4KO0A 5L23A 2C0IA 1NZ9A 3L4BC 1WXBA 3BQ2A 5GAOl 2QK0A 4A8FA 2RD1A 1ZM4A 2RRBA 2RKIA 3HT0A 4PFPA 1F1BB 2RQMA 4IKAA 4C8QA 3SFUA 2D9TA 2CSQA 1RLPC 1ROFA 3DLKB 3EZOA 2GV1A 1YJ9Q 4UOHA 1N0UA 2IM0A 1LWCA 4HHHA 4WK1A 3UNYA 3LH0A 1YJNS 4CLZA 3JSRA 3PACA 2FG0A 1VK8A 5D4NA 4F0MA 3KYLA 3OD2A 3M0SA 1JNZB 4AXJA 1P9YA 1GK8A 4NMXA 5ETQA 4UC4A 1KONA 1N52B 4FL6A 2G6FX 1IBKJ 1PBAA 2ASJA 1J3TA 4X65J 4IR9A 2XGPA 2W8KA 1Y57A 4WP9A 5E41A 2JTMA 3I0RA 3TSWA 2LP4A 1UETA 4LDVA 1M90C 1JO8A 2KT3A 1RP5A 3IWXA 3HD1A 2JMAA 2YHTA 3CXCP 4RW6A 2DRMA 2BXJA 3SZ2A 3KJNB 1WF2A 4QR1A 1JXLA 1AOJA 3GV7B 1J5OA 2ZH5A 1WXUA 3URGA 1V5IB 3NBPA 2R7WA 1U1RA 1NSKL 1CEZA 5GAN7 4IO1A 3CDWA 4DR2J 4FPRA 1JB0E 3TRGA 1IB8A 1X7VA 3V7RA 2WCXA 1Z9QA 4RUCA 1R8PA 1U0HB 4EO6A 3QUIA 4M77D 4E7KA 4I1TA 3QDFA 3CC2A 3DOKB 4OI0A 5IAYA 1L3VA 5E3AA 4X4UA 4DR6J 2JW4A 4ZN1A 1QVGP 4EYHB 4GVBA 4IUUA 3OYLA 2QTVA 4Y00A 1WC5A 2LX7A 4DLEA 3FJPA 4M7AA 3FEZA 1H92A 2XKOC 2C3MA 2HQIA 2VF3A 2F8MA 2YNFB 3O2IA 1S72A 1C6VX 1NK0A 4CLSA 1KQ1A 4OMPA 4LDWA 4HL9A 2G1HA 4DHVA 3OR1A 3P49B 4F26A 2JDJA 2Z0GA 1JXEA 1R0AA 2J6KA 2JM9A 1CS4A 1PCAA 1AHJB 2KDOA 1T0HA 3R2CJ 4ATOA 3EG0A 4KUDK 1WORA 4DLGA 3DOMB 1FMWA 1V1CA 3F41A 2YDLA 4B9WA 1Y3KA 2HVZA 2O67A 4CC4B 1OU8A 4JRIA 4LN2A 5HI7A 2PI4A 2E9RX 3MR3A 2J5AA 4F7UG 1PCXA 3VRYA 1VRTA 2K1RB 5CHCB 2IYIA 5BYQA 3SCJE 1F5BA 3CC4Q 4ELYC 5CQYA 3M6UA 3HSGA 4ZJQA 3MKDA 2WTFA 4DX5A 1Y07A 4RBTA 4LF9J 3PJ9A 1Q16B 3NBPB 1H8KA 1SKWA 4ZS6A 1FWPA 3E2UA 3QLHB 1IKWB 1WFWA 1D9AA 4DL5A 1TSFA 4L75A 2KN4A 4GLKA 3UD4P 4ESRA 5HMZA 4ZHRA 3NG8A 4EEYA 3DLJA 2B9WA 1H641 1BK2A 4ECUA 2MKIA 1F6TA 1ZYQA 3D7SB 1ZPVA 3BQ0A 1H0HB 2E5QA 3QO9B 1VQKA 1U2CA 2EFPA 1Q86C 2UU9J 3LLRA 4ELVA 2RK1A 3LP1A 2ADCA 3GU0A 1KQSR 2VUBA 3H2VE 2LQJA 2V6AA 1GCQA 3ZXWA 1FERA 1N5ZA 4A8QA 5ETRA 1OX8A 4HEA9 1UKUA 2AJ4A 2J6TA 4M77A 1P8GA 4DN0A 3NNCA 5F8NA 2CNOB 4O44B 4QW9A 1L3KA 5GAMe 3BPSP 1G1XA 1H3DA 1HL6A 3M8QA 3C46A 2U1AA 3J81U 1FRHA 1RK8A 3H7HB 2HHPA 4OMQA 2HAXA 2F4VF 3CCVA 4NASA 3HD2A 2VUGA 1LNQA 3RZAA 2ZBRA 4XU2A 4CWBA 4I6AA 1KOHA 4F4KA 5F41A 1K47A 1S49A 3PDNA 4J9QA 1UFFA 5FWCA 3SSSA 2QLWA 4IDKA 4RU9A 4OJGA 4I2QB 2APOA 3EXCX 1ZX6A 2Y4YA 5C42B 4BCAA 3TVZA 1GXTA 5KYWB 3TA1A 4J9GA 4WE1A 2I6WA 5G0RA 2D3O1 5CCAA 5H9FK 2C42A 4I2PA 2OP5A 2DRKA 1Q8LA 2X9HA 4DV4J 3IBFB 2VPZB 1AEYA 3FDRA 2F8EX 3PJXA 4X64F 5D8HB 2A37A 2MKYA 3TAQA 2QV6A 5JVGQ 4YS2A 2M16A 1Y5NB 4FT4A 5BYSA 3OYEA 2EJFA 4LUBA 2GNKA 1EKRA 1FXRA 2FPDA 5FU6C 1FJEB 1IREB 3TP2A 4R5PB 1KVKA 2DPIA 3G6YA 1D9FA 2ZEJA 4A48A 4A8YA 5D78A 2YNHB 3HTRA 3OYKA 3OL6A 3SV4A 2HQFA 4L72B 2LQWA 2F4FA 3KFWX 4EIKA 2YT6A 3BB5A 2CDRB 4U8VA 1HBMA 2Y3YA 3DI6A 3QAUA 2L3PA 2E1MC 3V6JA 3CCRT 3PYEA 2DD8S 4FSXA 3LH2S 4DR5F 1X31C 2NQPA 1R8CA 3H2UB 2E65A 2DIQA 4ANCA 4J7IA 5T7LB 5KFCA 2D3ZA 3PE0A 2CP6A 1PJ5A 4LFAJ 3DRYA 3BYRA 4UT4A 4QZVB 2QSWA 1VK3A 4C5EA 1OPZA 5EN1A 1GFDA 1SC1B 5D0GA 3LPYA 2OPPA 3CCEQ 1U7LA 3F0NA 2R9LA 3BV8A 2VKNA 3TW0A 4JI8J 1KP6A 1QSYA 4B3RJ 2P9GA 3KK3A 3R5JB 2WSCC 3C94A 2FC8A 1VQLA 1QSSA 2UXCF 4M77B 4B3SF 2DL3A 5EX0A 2KJVA 1AD5A 4XK8E 4CTAB 2CPYA 3PW4A 3MEUA 3MEAA 5HK0A 2VV5A 3VHQA 4DZDA 2ROPA 4MJKA 3C16B 2B0GA 3AAWB 2VD3A 3TWZA 2HFVA 2XG8A 1UEBA 3VV2B 3MEKA 5GAN3 2AMCB 3DC2A 4B9MA 2C3PA 2B5JB 1Q5YA 4BB7A 4N4IA 4J9UE 1RHQB 1AZSB 2UZAA 2IY5B 1L3UA 3CD7A 1HW8A 1MU2A 4EI2A 1WHVA 5DLOA 2QA4A 2O31A 3H8ZA 1TELA 2LFVA 1MWZA 2LDIA 3DYAB 1QSLA 2L2PA 2K06A 1SF9A 4DWIA 3CMEQ 3G71S 4L73A 5KFOA 2A10A 4OFZA 2IRXA 2RS8A 3CJ8A 2QZ8A 4RNOA 3SCKE 2VQEJ 2F5KA 1WA7A 2GQIA 4ICLA 3QLHA 1BI3A 3RAXA 3ZFVA 2R2RA 2VGNA 4HT8A 3JCMb 3M2VB 5ITHA 4ZPCA 5GAMj 4X66J 5LSOA 2MGZA 4CM0A 3M7VA 2HZCA 4DEYA 2MAMA 4ZPBA 2KO1A 3C15A 3CXCA 2CUBA 1KC8C 1YBYA 4V2SA 5HMXA 1QVPA 3H5SA 3CD6T 2ZD1A 3QRPA 5CCLA 5EWEA 1WXTA 2MSSA 1BD6A 4OLPA 1ZA1B 5LJ3g 3JSMB 4CO1A 1RJJA 1VQPA 4WFAQ 3J80U 1QM9A 1TL3A 4M75A 4NYZA 1XNRJ 4NZ6A 3HVTB 2DH8A 4HHUA 2JZ2A 1B34B 2WHOA 3D66A 1XMQF 3I5RA 4QCLA 1JIHA 2CFXA 3VGSA 3IP0A 3PW0A 3NXZA 1VYVA 1NYFA 4XU1A 1NH7A 1XC9A 5KYXA 4JV2A 5CD4A 5A8WA 1JLCA 2AX1A 3C19A 3K8WA 2HNYB 2AEJA 2R4FA 2M0YA 3M9NB 1I0CA 2MKJA 3VWSA 1GTHA 3I9ZA 1JEGA 5KFFA 2CQ3A 2OEJA 2QL7B 2B8PA 2PQWA 1DY3A 5IM0A 2RHUA 5CABA 5B0FA 1UPPA 3IG1B 2DXEA 3JRZA 3T5LA 2GCFA 2HVDA 2ZUGA 3MOZA 2FRWA 4M7AD 4DEXA 1HD0A 3PKYA 5KYYB 2GMLA 1M1KC 2ATCB 3IAM9 4KB7A 3CUNA 1TAUA 4F14A 4TU7A 2BE9B 3E01A 1VIEA 2KYXA 1OSCA 5AE2A 4C8QB 3QYGB 3AY0A 2L3MA 2DGQA 3C15B 3T19A 2AEFA 2QXFA 4A8KA 2W25A 3KHGA 4DN9A 4ECRA 1UGSB 3W5ZA 1GX5A 1KRPA 1VQ6T 1HBNA 2C0OA 4YY3F 1U4BA 4YP3A 4LXCA 1QKXA 3G2XA 1ZAXA 3RUXA 3SD4A 4DR5J 2I9SA 2HAFA 3SWNB 5CKEA 4TKTA 1BY9A 2H48B 3MM5A 2W7PA 1ZUKA 3GILA 4YEAA 1DTTA 4HLBA 2FJBB 3BBCA 2GW8A 3Q8PB 4PJJA 4PRFA 3RBZA 2NPIA 2MOXA 1HD3A 1IBCB 3M32A 1Y0HA 2O01E 3DB3A 4IURA 2VIHA 2F5GA 5LJ5Y 5CKDA 3I31A 2ATLA 2KVQG 2HBYB 3M0RA 2XZDB 1D1CA 3PRVA 4QVZA 5GMKh 2OGUA 3L42A 1Q82C 2VGMA 4QW2A 3LO3A 3JAMU 1FESA 3GWCA 5C25B 2N3OA 4RX6A 2KHCA 1R27B 4DBHA 2F1LA 4LRAA 2QMXA 2R7OA 3O3LA 4J9VA 1EP4A 1JX4A 3QZ5B 4NLDA 2L5QA 3CTRA 4X84A 3PFEA 3DLEA 4ZVFA 3H9NA 1RTJA 4ECZA 3RRHA 3MMAB 2OPRA 3VVUA 4N7TA 1MN9A 2IDLA 4JDSA 1X8DA 1U25A 4M7AC 4ZTJA 3NOCA 3M2UB 5GAN8 4CLWA 3DRSA 2VICA 2RNEA 1R0BG 5LM7E 3QHSA 2D6FA 3BS9A 3K58A 1Y5LB 3NY0A 1FXXA 4DR3J 2IA0A 2XYPB 4ELTA 4EPCA 3TYTA 4X4PA 2UUWA 3BH6B 1P9QC 2RDIA 4RW8A 1C0UA 1VLOA 3BDLA 4WXOA 4MFBB 2BJ7A 4QWAA 2RI5A 3GV5B 3U23A 4RL1A 2V9WA 1N6QA 4KGVB 4XDDA 1JQQA 3K89A 2E1AA 4HI1A 3EVWA 2L89A 1UZDA 2UUAF 2R2UA 2DNNA 1DQAA 2PA3A 1ZUUA 3IG1A 2DYBA 3UNGC 3CD0A 1HBOB 1QTNB 1TVRB 4GKKF 3PW5A 5DDQC 4C0DC 1S9GA 3BKUA 1G83A 1MLAA 2KXFA 1T95A 4ELUA 2L9DA 3DM2B 3OPKA 4NI2B 1NJYA 4H4OA 5CR2A 2OTLQ 2YNGB 3HKSA 3RMQA 1RTDB 4LQ3A 3TOQA 3V4IB 4Q8EA 4LF6J 3LP0A 3TZZA 2IM2A 3DB4A 3H8YA 1KEKA 3ZTSA 3VR1A 3C2PA 1M1KT 3HP6A 2LZ6B 4BD3A 1S1UA 3GP9A 1S6QB 3E8OA 3VS2A 5LJ3d 1YJ9T 1NK6A 3KLIB 3K5MA 2R5AA 4WP8A 1NZ8A 2IC3B 3SHWA 2K2VA 3ELHA 4O0IA 4HTIA 4NS5A 3TUJC 2P2CB 3WX4A 4IIMA 4B9NA 3K5OA 1ZHIA 3M1VA 2XM3A 1KKHA 3D1HA 2V2QA 1RT1A 4IUQA 2NCKL 2CJ9A 1Y7PA 2XD0A 2MPUA 4RW8B 3VTIA 3UCGA 5KT6A 3PVXA 3HT3A 1MNEA 2FB0A 4PYAA 3W66A 3OXLA 2PDAA 5CCMA 2VDIA 3BM7A 3I0SB 3KFVA 3NL0A 2KT1A 4G65A 4PJOD 5HROA 5LXYA 2ZITA 3H59A 4U7UK 3KOAA 4C0GA 2FVRA 2EVZA 1BI2A 2DGSA 2DNUA 4E7JA 4AMCA 2UXBF 1X4CA 1HMVB 3NAIA 1G3WA 2X35A 1RKJA 4TU9A 1HHTP 3OR2B 2ZH9A 1WHKA 2YKAA 1FRKA 2OD4A 2QMUB 2QEXA 2AV5A 3CCLS 1QVGA 2XCAA 5D15A 1Z4UA 3HFOA 2W1BA 2VBZA 1M2VA 4HCKA 3R5BA 2CPZA 3W64A 3KDOA 1U1SA 3WIVA 2RHZA 2ZOMA 2LECA 2A1BA 3BEGB 3D2WA 4O0NA 4X62J 5I3QA 4IIOA 1ZAWA 3CCSS 2K1RA 4TVRA 4OGCA 2AJ0A 2E5KA 3M8QB 3IS9B 3OYMA 1HYSA 4IQXA 5IXUA 4RUGA 2K57A 4ZN3A 3R6NA 4DG1B 4X4VA 4KHMA 4LVOP 1TUWA 2GMHA 5SZTA 1PRMC 2YX1A 3KLEB 3TAMB 5F8GA 2DK3A 1URNA 1M1GA 4K4WA 2O9SA 1KQ2A 2QEXS 4FF1A 3PXGa 4LF8J 4QIFA 3QJLA 2LQBA 1XNRF 1X4DA 2BE2A 3UN2A 2LCLA 5DG7A 4RWWA 3G4SS 2O9VA 1ZBXA 2FZGB 4KIAA 1QWEA 4NLUA 3ETOA 4A4GA 1AW0A 1HWLA 3TA2A 2KAFA 1N8RC 3JCMX 2QE5A 1VQPT 3PIOA 2RDDA 4H54A 1IHWA 2AK5A 5CYJA 1WEXA 2QYCA 1T3OA 3FQLA 1RABB 1M5KC 1CS4B 3W5YA 1U3OA 1FNOA 4QVDA 3DHWC 2HNZA 4BS2A 1OSDA 2VB6A 4AFZC 5C2CA 2XNRA 1BXNA 3M4XA 3ZZYA 5KFAA 3UPFA 2LU1A 2DF6A 2DHGA 3QWPA 2RJZA 4K7QA 4I7FB 3M9OB 2JFDA 1YIJA 3GIJA 1VQLS 3MM7B 4P2FA 2CP7A 4DPWA 1V29B 2HG4A 1NLPC 3G9CA 1NPPA 3TUPA 1X5PA 5DDPC 1Q82T 3CCSQ 4BACA 1TWBA 2YSQA 4A8SA 3FMWA 2QN6B 1MMGA 2HFSA 4Q5WA 3MD1A 2GQVA 2YKPA 2WAQD 4QPTA 1U1NA 2YKMB 2MZJA 1S1TA 4KV8B 4TN2A 1NDCA 2EW9A 2EQJA 4NA3A 2L08A 1HBMB 3BJYA 1HMVA 4C8QD 1RTHB 1KK7A 1YJNT 3BBBA 1CJTB 2VASA 4IO9Q 3C14B 3NCRA 5DJBA 2AYMA 3FQKA 1RACB 3DU5A 1R8BA 2AGPA 3U02A 4RCCA 4HH0A 3OXGA 3ICLA 1GCQC 3KJFB 3CC7Q 1SH3A 3QBYA 2QA4T 1FEEA 2HYIB 4OYPA 2XB2D 4LMZA 5DETA 1NUEA 4O6JA 1PYTA 2HQCA 1YWXA 4H4KC 1SUQA 1ZM2A 1P6TA 4QIEA 3OYBA 3KLFA 1WC3A 1ITPA 3L7OA 4O3NA 5AXKA 2VG7B 5J1PA 2IVYA 5CQXA 3D4JA 2DR9A 1NBEB 1QVGR 2JTFA 5KFDA 2EYZA 4ECVA 4DPTA 3FGVA 2AYGA 5IV3A 3OW2S 3L7PA 2DEQA 3HK2A 1CBKA 4LNPA 4M5GA 2OJ3A 2HEQA 3K57A 4F17A 5GAN4 1XMQJ 1N32F 1YFNA 2MMPA 4U6PA 1N9RA 3PO4A 1YHQA 4K8RA 4F8RA 4Y65A 1VQ5T 1RT2A 2J76E 1C2PA 2EK1A 2NWMA 3QYHB 4IG0B 2R8GA 2G0CA 1OMSA 4FSSA 1G2EA 3CJKB 1HR0F 4M77C 2GJ2A 3G6XA 1P1TA 1RWXB 1UFKA 3A8GB 4CYUA 1KQGB 5GAHI 2BJEA 5EG2A 3QT8A 5HMYA 4QQBA 1D0YA 1UPMB 4MYUA 2RF0A 3QYYA 2KG0A 2CAJA 1OY9A 4MZPA 4G1PA 2V4RA 2LQKA 2DR5A 2JFKA 3PY8A 4U8YA 3UI3A 3CCRS 2FUG9 3HI9A 5FWBA 1YBTA 2L48A 2DNKA 4HCCA 2B4OA 3AJDA 2XICA 2JS0A 1SKUB 4BI8B 3CCEA 3TJ8A 4J9FA 2W2OP 1X6GA 3QT6A 1YG0A 4Q7AA 1TL3B 4HHJA 3S6WA 3H0FA 2O1PA 1N56A 5L9NA 1YX2A 3PGGA 3CCJS 1VQ5Q 1QTMA 3NGTA 3UVJA 1W70A 4AG2C 1YI2T 1TMJA 2EFNA 2HEKA 2FVQA 4C3KA 1LW0A 4F4ZA 4M5HA 4OMFG 1A0NB 2FHJD 5A8WB 4M7AB 4KRTA 4B02A 4C48A 2XDPA 3CMAQ 2QA4G 4LF8F 1Q7YC 4DMZA 2RK2A 4TYAA 4F16A 1HA1A 3DXBA 1X5TA 1TL4A 1RT2B 4Y6IA 4JYAJ 2CPHA 1X4GA 5HQLA 3NGDA 2XEXA 3M8RA 3EPGA 3GYNA 3DRRA 1UWBB 3FMBA 2VOOA 3D6HB 4JUZA 1W6XA 2ZDPA 3OS1A 2W8LA 2CJBA 2PSZA 1UE9A 5F9NA 2K7JA 1QAIA 1VC0A 3FVYA 1H2VZ 2KXHA 4DV0F 1U1TA 3HVTA 2HHUA 1CQMA 4YDDB 2KT8A 4EMKC 2EKOA 3FSXA 3MMJA 2DGXA 3CCJT 3G71T 3NTIA 2LJ1A 1WKKA 1XR5A 4HYKA 4J9OA 2HS0A 4ZP6A 3M0QA 2UXDF 4DFJA 1N27A 2FHOB 1M30A 4DSEA 4OX6A 3VU3C 2X51A 4YDXA 1IR0A 2B3TB 1CULA 1PG5B 2DHHA 2QL9B 3PR5B 2PI5A 3A8OB 1HNVB 4K0KF 5IC6B 1JLQB 2I38A 3BO2A 1TFYA 3MZIA 1TXQA 3NTHA 1B07A 3X20B 2VDHA 2IJRA 5D0EA 4JRQA 5IT9Y 1FDBA 1T7PA 4CP5A 1WJ9A 3GFZA 2R5MA 1Q8IA 1FVQA 3RR8A 2CT4A 3MUVP 4IDKB 3P3DA 1UWAA 1LV5A 4QIVA 5HO4A 4LT6A 2YY3A 2P9EA 2RAQA 5LJ3f 3HVRA 1GBRA 2SEMA 4QKUA 3UATA 2DZ9A 4A63B 2V8GA 1Q79A 1HIYA 4UUXA 2ZM6J 1VCTA 4QQGA 2WONB 3T1YJ 1M3AA 3CCJA 2GVZA 3QNWB 2QAZA 2J9CA 3C14A 4DSFA 4ED4A 3CCRQ 4BUGA 2V8DA 2FLPA 1N5VA 2AJ2A 2UVRA 4C9DA 1TVRA 4JV5J 4RTZA 1DRZA 4USMA 5J1EA 3W9JA 1XMOF 2QQSA 1XR7A 3JB9G 1IO6A 2DNOA 4USKA 2X4YA 2D8JA 4B3RF 1U47A 3X28B 2FLNA 2B8AA 2YNGA 2AHOB 1HBNB 2CQIA 2JOQA 2CNLB 2ZBQA 4DOVA 4NLWA 3C6UA 2VKZG 1IBLF 2GJFA 2EG2A 1VR6A 1N6AA 4K2XA 1YJVA 1S12A 2KFZA 4DFMA 3T5HA 1HPZB 4HI2A 1UZHA 2JVRA 4GKJJ 2FIUA 2VVKA 2DBMA 2ZJRQ 5GANd 4JI6F 1YN8A 2P0KA 1M90U 4G3IA 4DV7F 4OX9F 3ZZTA 4NPOA 3LA0A 3JB9I 1C1BA 5DDRC 3ENAA 2JT4A 2B7BB 3AQOA 4YN3B 1JLAB 1WHLA 3WZ0A 4DCOB 4C2MA 1KC8T 2JS2A 2BABA 1QCNA 2DEUA 2HPUA 3THPA 3G8TA 3F73A 3W2VA 4DUYJ 4X4QA 2XYHB 3HDSA 4L74A 1MUZA 2W9AA 1VQOT 2HBQB 4WU3A 4URQU 2GHWA 5HROB 2KGTA 5B7WA 5CXTA 1S0VA 2YTCA 5HMWA 5FROA 4QQDA 1OQ3A 3M56A 3GG0A 2DJQA 3I5CA 5KG3A 3KKFA 1WPYA 2IVFB 5CK9A 2E64A 1V6HA 3GNFB 3P5TL 3SDEA 1IM6A 4RJVA 5J2NB 2DXTA 2ZH2A 3UFCX 1S9EA 1MW7A 4RW9A 5KE3A 1KHWA 2W9CB 3X1LB 1TKZB 5L38A 4C0OC 1U02A 4I6YA 3G6ET 1N0VC 1RT3B 3A8JA 5AXNA 2BTTA 2KRSA 4BY6C 2HLTA 1WHHA 5LJ3j 4IH7A 4IOCQ 1SSHA 5L8RE 1URRA 1Q78A 4WFNQ 5L39A 3ULRB 4A4HA 1V5VA 2ZE2B 4ECXA 2ZUAA 4QOTA 4FBUA 2EQKA 1XNQJ 4PKDB 3QSYB 1LW0B 4JZ4A 5LXRA 3CD5A 2H3JA 4M7DC 2JLFA 1JXOA 3RBBB 3K8VA 1NMEB 1D1UA 2HS4A 3OFFA 4J8OA 2XHWA 3I0SA 1YSJA 2K3XA 5FLXU 3T1HJ 4ED7A 1IXKA 5IN1A 1JLCB 1KQKA 2ALZA 1HNIB 1GXLA 1PJ7A 3AT1B 2AEMA 2AGOA 4KO0B 2MEWA 4MDWA 1JLEB 2GIRA 1VFJA 4KTQA 1YJWQ 1VQKT 1KHIA 3TVTA 2KYBA 4M7DF 3LWMA 3VQTA 2RB7A 4F50A 2HIYA 3KK1A 2NSBA 4LDUA 1KFZA 4HACA 4OZ5A 4OX7A 1D3BA 4W4MA 1Q86T 4C0HA 4ZIVA 3EH1A 2Y1JA 3AHUA 2VQFJ 2FQQB 4DX7A 3R97A 3BREA 1M5OC 4C7QA 5LL6S 3BDUA 3QIPA 1JMTA 1Y3JA 5IWAJ 3O5ZA 4OV1A 3EGWB 3HHEA 1Q53A 3ISND 4NXMF 4M7DB 1X4AA 4N0AA 1OJ4A 1VBKA 1VIXA 4NA2A 3QGHA 4ECQA 1CJKB 1HBUA 3NS5A 3O8WA 3N6MA 2F2VA 2AZSA 4OB1B 3L2QA 5GAN2 1XNIA 2E1CA 1YITA 1TV6B 3S6EA 1FE0A 3HHTB 4USVA 2AKLA 4F36A 3I9V9 1VQKS 3VJPA 2POKA 4ZVRB 1X9MA 5KFIA 3Q8QB 3DDNA 3CCZA 3NGPA 2YKMA 4ZOSA 3K5NA 4AUKA 2VJVA 5GMKi 1WEZA 3MPUB 1AXQA 5F9LA 4KJIA 5LMUJ 1DBDA 4FXDA 2R7TA 1KTVA 2MQQA 4K4TA 2AZVA 2W4DA 2D0QB 4LR8A 2XMAA 4C8KA 2N4CA 3CPWR 3I82A 2EQUA 4OVAA 2CQBA 5EHHA 4Y28C 1EQ0A 3PV8A 3BKTA 3M30B 1KG1A 3PYFA 4CT9A 4USUA 1O6XA 4OZLA 2DBKA 3NGRA 3ZTRA 1RTIA 1OIAA 5K5MA 5KFMA 2MZTA 3IGVA 2ZHBA 2BQRA 4TNOA 2B43A 2COWA 2PMHA 4Q0BB 1FYNA 4UOGA 2XY5A 2VYTA 3QGGA 5DO2A 3OYGA 4M75B 4UOFA 1P1LA 1NU4A 4C5IA 3CCVT 1MMNA 3G6EQ 1XERA 4ID5A 7AT1B 4D8DA 1W26A 4C6AA 4DL7A 3OS5A 2BW2A 3W8GA 3HRUA 1NDLA 4Y2MA 1FNXH 2HVEA 2GCXA 1J5OB 4YB7A 1AWOA 3M2RA 3ULHA 2B4PA 2ED0A 1AZSA 2K2MA 2YUOA 2V4QA 1VMBA 3OYNA 1JKHB 4EZ6A 1WJSA 1IQTA 3RRKA 1VQMQ 3M5AA 2KVIA 3DLBA 1KTQA 1U8WA 1A9NB 4NLPA 3BFMA 4TQRA 1EQMA 2DY1A 2K6DA 1FHTA 4PG5A 1E6HA 1VRQC 1CJTA 3CF5Q 3OR2A 1LPLA 4C5GA 4OYBA 3ENVA 2HQ3A 3MM6B 2XSFA 1Y4ZB 4TXSA 1OYDA 1QVFR 2WSEC 4ZA1A 2RUSA 4J9LA 1BC6A 2BZXA 4A4EA 2VFUA 3ZZPA 1WF0A 4Y3CA 2GFFA 2Y1LB 1S0MA 1T3NA 4CO2A 1X60A 4M75E 1BB9A 1RTJB 1CG2A 2M4MA 3Q8YA 4USWA 4C8QG 2DGWA 2RQKA 2M3DA 3D0IE 1HFEL 3M32B 4PJOB 1O5JA 4FVMA 4OHXA 3CCES 5CYMB 2HFUA 3R1HA 2YRDA 3DRPB 1FX2A 3TO8A 2MF2A 1TUGB 3QPIA 5DQHA 2MLXA 2L3SA 1D0EA 4PWWA 1PO6A 1NKBA 2V1RA 2N7CA 3MECA 2XMMA 7FDRA 2XI2A 2R8KA 2Q66A 4M5IA 3CC4A 3FJ5A 1QDUB 5DG8A 1ULRA 2DD4A 1C0MA 5MAOA 4Q2MA 4A8MP 1YJNA 4F7UE 1W1FA 1S72T 2P0PA 1RWWB 2KI7A 1BWVA 2FL7A 3DRSB 4QWBA 3LH5A 4ZLLA 2J8AA 2W24A 4JJBA 4FW2A 3I4HX 3RUBL 4J9KA 1I94J 1RUSA 2J7IA 1WYXA 4NL5A 4G1QB 2JWNA 3MO8A 3MCSA 1RT5A 4M5MA 4BLGA 1R3NA 1JB0C 4CI0B 4ZVTB 1FVSA 5J2MB 3FIFA 2CIMA 2LCSA 1E6VB 2XMWA 1NNDA 3M58A 1KHVA 3QJJA 3IWNC 1N6QB 3RBXA 3RESA 2DHXA 3OW2A 5IXFA 2XY7A 3WHIA 2YWGA 3OTEA 3V4IA 3SQOP 4WTYA 3QSUA 4JI7J 1U8SA 2VC1A 4IUPA 2M2BA 2YKOA 4LSLA 1RISA 3MCOA 3CCTA 2EPIA 5AJ3F 2X3GA 1ZLMA 3H0HA 2ZNZA 2PU9B 2DZCA 1Y0MA 3I32A 3CDBA 4N0AC 4ZJLA 3OMGA 1S0NA 4CQ1A 3QKJA 4KH0B 5FRNA 4ZVUB 1PKSA 1PYOB 3GOXA 3CBOA 2JSXA 5JVHQ 4I68A 1QE1A 2Z2ZA 1VBXA 3T41A 4CYUB 3K5LA 2J6FA 5IT9U 4OQJA 1WIEA 4LRFA 1OZ3A 4J91A 1C4CA 3C6TB 3G1JA 1KQSA 1NKEA 3O44A 3A8EA 1QCFA 2CWXA 2DJWA 1UECA 3V6KA 2O66A 3R5DA 2DNLA 3A3OB 1UVNA 3PCOB 1Y00A 1SHGA 4JB8B 4G1IA 4DV5J 1UVJA 2FPHX 3IWLA 4NYPA 1RWKB 4ZGJB 2MQOA 3NS7B 3RB3A 3TREA 2WONA 3RERA 1TH7A 1HNXF 2GC8A 1Q81T 2ZGWA 5KYNA 3AB4B 4CDIA 2FPEA 2XG8D 2H5IB 4J7FA 3PHEA 2Y8WA 4CC2A 4QBUA 1S1VB 8AT1B 2WVFA 4ED2A 1ACMB 4Q8FA 1GAOA 2PEHA 3BO4A 4Y91A 2ACYA 2IVMA 1LVKA 2ESWA 1NSQA 3MP1A 5HJXA 3KG1A 1QW1A 2HQDA 3MEEA 4RBVA 3DI6B 5HVGA 3MECB 2COZA 5B08A 1HPZA 2GFUA 2MQLA 1O75A 3IS9A 1QAYA 4NX9A 4K4XA 2DERA 4YY3J 2AKWB 2MKKA 1DLOA 1VJQA 1RBOB 3UA7A 1VQ4T 1TP7A 2V8JA 2IC3A 3MI7X 1RAFB 1VYUA 3IMQJ 4H4KA 2YUQA 5LJ5d 2RHXA 2CH4W 3P8BB 5K8NA 2BANB 4MZTA 1D3WA 5A8RA 5I42B 3J7Z5 2FZCB 3MCAB 3M6XA 4LRCA 4HT5A 1HXDA 2Z2MA 2F8HA 3CCMS 5B0BA 1REGX 2W10A 3D9BA 1Y10A 2V63A 3OXFA 1UL3A 2BKNA 3FZBA 1VYAA 4CO0A 4JBCA 2NZCA 4JOUA 1I1JA 1NM7A 1XMBA 2MLYA 2FJEB 2EQIA 5HQMA 1U1MA 3QG1A 2XLJA 2W0ZA 2MWPA 1NLOC 4RW9B 4P9SA 3TUIC 1S7HA 1T8EA 1SV5A 4WF9Q 1H98A 3HVWA 4R0EA 3PW7A 5D4PA 2W2NP 1K0SA 1AT1B 2ECZA 4KKOB 3WBZA 3GIBA 4R0KA 3OFHA 4QW8A 2DISA 2EXUA 4EBEA 2BYCA 1YITS 5KFRA 3PT9A 1X9SA 4RPFA 3JB9F 1X0PA 3G4ST 5GAOn 1WC4A 2DL5A 4NCAA 1I5OB 4RTUA 4JJDA 2R57A 1EAYC 4LIWA 1FXLA 1RT7A 2R7XA 3J80E 3CBPA 3AA8A 2FEIA 3SV3A 3OVSA 3UR0A 2XS5A 3JCMJ 3IC1A 1REVA 3H5YA 2GGPB 1WHMA 1SJ1A 1YJWS 3RDVA 4AG1C 3HRSA 3AHPA 4JV0A 1T05A 3E3XA 5A8KA 3Q22A 2OAWA 4LIRA 7FD1A 4PWUA 2MCNA 1C4AA 3OQ5A 2RPNA 4K4YA 5I42A 3EG9A 2R7QA 1OPLA 1NCLA 4DR2F 3UW1A 2CPXA 2QA2A 4KRWA 1D9DA 2EEYA 2W2MP 2F2WA 1NLKL 3QBCA 2MKCA 1RT4B 3W5XA 1PILA 4F04B 5T14A 3QGIA 4LBPA 4ED6A 4NXMJ 2ZOFA 2H1YA 3H5UA 2ROTA 2OTJA 4IYQA 2DIUA 1X75C 2V1QA 1UEVA 1M1KR 5E7OB 3MPVA 4DS4A 1F9HA 1Y11A 3M2VA 4XK8C 5GAHU 5LMNJ 1PC5A 2CVIA 3DU6A 1VS3A 4J5OA 2XC9A 1S79A 4PQUA 1HQ2A 5IC4B 1V3ZA 1Q7YT 3OTCA 3EPIA 1WD6A 2ZOGA 4DV6F 3EHRA 1K73U 1H7XA 2FHKA 3EZUA 4UTGA 2VBWA 5KG4A 2FZKB 4WXWA 1FF2A 4IUTA 2BM0A 4YFUA 3ITHB 4PCQA 3DLGA 4JI3J 2Y9HA 3FBEA 1WX6A 2E6NA 3ZZOA 4DOZA 1KQFB 3K5PA 1JJ4A 5FJ4A 3CCJQ 4JI3F 5IT4A 3K17A 3MWBA 2R2TA 3P45B 2MY8A 4YQWA 3FC3A 2KI2A 2YRCA 3HFVA 4C92E 5A6WA 1Q86R 1SJ3P 2EFQA 3JXOA 3B4DA 3CJ3A 2W4CA 2A6MA 1N8RU 1HWKA 5GAEI 1JJ2R 3L1AA 1B99A 3M55A 5K14A 2BKDN 3IBWA 2CZVC 3EVOA 1VBYA 5A2QE 2QEXT 2JEJA 4OZJA 4DV0J 4CCHA 1R6YA 3GTYX 1DZ5A 2K3KA 3P6YC 4KFBB 4O3SA 1RTIB 2DITA 2JL9A 3MTJA 4W90B 2DNPA 2IDEA 1VQNT 4Y2KA 3FEOA 3T9ZA 3VV0A 3EFRA 4IH5A 2MXYA 1AVZC 2HHWA 1Z2LA 1QCOA 3DFEA 4LR7A 1NB7A 3NMRA 4PQAA 1TKXA 1SCJB 1XK8A 5HK3A 2Y0SD 1T9XA 2PVGB 2BOAA 1YDLA 2Q3PA 2RHYA 1VQLT 2RIJA 2XYGB 2E12A 1HBUB 1ZZFA 1HHQA 3U1MA 2D69A 1AFJA 5A6PA 4KYZA 1MMDA 4MKBA 3R5AA 2WOMB 2ZZDA 1PWTA 5E3RA 2AU0A 1MWYA 3GJQB 5RUBA 2LA4A 4AL5A 2LDMA 3BSOA 1WF1A 5DM7Q 4ZGEB 2BOPA 5C42A 2RMLA 3Q89A 3KNAA 4N76A 1CJKA 4N8OA 3VS7A 3QWUA 4DDFA 2CDQA 3G82B 2QSFA 1UWBA 5B0CA 1C0UB 4ZGDB 2XMJA 5D7UA 4H4MB 5HBMA 2IRYA 1EIFA 4E47A 1OWXA 4WJBA 5KFTA 3ONQA 4IOBA 2KKHA 2V2VA 2O4XB 3FBFA 4WZQA 1W2IA 3I55Q 1NJIC 3G86A 1JWWA 1T03A 3V6DB 2DGUA 4LF1A 3GCWP 2CNNB 2WVCA 3PO5A 4ED3A 2YQ3A 1ZETA 3QJPA 2OTJT 3QZ9B 4ED5A 1HBOA 1JLFA 4QQ6A 2F9JA 2RD5C 1YWOA 1UVIA 1NHKL 2QX0A 1SC4B 4PUOB 2C2ZB 3NPFA 1S6OA 4NCGA 5C25A 3FSIA 1RKIA 3CSKA 2ZCFB 2ZE2A 4KR0B 1VQ4S 1K73T 4GC7A 1D8ZA 2N82B 2P5VA 2V4JB 4KGMA 4LREA 4C3LA 4FF4A 4C92F 3JB9H 2D1XA 3MAQA 2XDBA 2OPRB 1Z1ZA 3TVKA 3VAKA 5M2PA 3JCMd 3CO0P 2BZYA 3SSRA 1PHTA 4M7DD 3E19A 2E4HA 4C92C 2M5YA 1T11A 2QIFA 2Y1RI 1BCOA 5CZVA 2AHJB 3QATA 1N36F 1MWQA 3VS1A 4ORZA 2E41A 4MH8A 1IR1A 3A3PB 1HNZJ 5D6WA 5F8LA 4F67A 1WOSA 3W9IA 1E6YA 4YUDA 1RZMA 4JRKA 1MSWD 2E5GA 2K7KA 1H73A 3VS5A 4Z2XA 2C2EA 4UY8T 4DA4A 1EB0A 1LOUA 2RJDA 2OUGA 2L3QA 1UGRB 4UQGA 3OYHA 2KZMA 4X62F 5HLFA 2HQXA 1VQ7A 3RTVA 1PSEA 2HK3A 1L3TA 4BE1A 2V2KA 1H72C 4HR2A 3TNVA 3IFEA 3CJ5A 4OZ2A 4M5JA 1FWKA 3BW1A 4B3SJ 4DV3F 5GJWB 3RU0A 2BJDA 2KROA 1KNZA 5C2GA 2GQCA 1X0FA 2LQNA 2QQBA 2HGLA 1LWXA 1WKJA 1S72Q 1FD8A 3ISNC 3IRXA 1FKPA 4TY8B 4NCGB 3OYCA 5MLCV 2F69A 2YWEA 4OI1A 1M1FA 1FJGJ 1GMUA 3M8PB 5KFBA 4AL6A 3CJ4A 2G1DA 4LSZB 4J9RA 3BZQA 1NG2A 3EICA 3FCVA 1ELOA 3CCLQ 2NS1B 2Z2LA 2DB1A 4DV3J 3D0HE 3EUNA 5KFKA 4W92B 3LPEA 3C6TA 4J6YA 2E7XA 4FNIA 3FKBA 4NMLA 3F56A 2KEAA 2G13A 3PJWA 3GJTB 3ET6B 4RMOA 3LGHA 4QWDA 2BE7D 1NAQA 2QA4S 3O1LA 2GJIA 2M9UA 1GFWB 2HHHJ 1KLMB 2XZWA 4DBRA 2K5LA 4Z89A 1QQJA 3GBQA 3CNQP 5KG1A 1JLFB 4G1QA 1NB2A 4C5HA 4DF4A 4USJC 1VQ6Q 2ZD1B 3M8SA 4KFBA 3UDCA 3X24B 4PG4A 3MR2A 3NGSA 4F4AA 3CD6S 5F3ZA 1BBZA 2KT2A 9RUBA 5HP1B 1RDRA 4PK4A 4ID5B 2P6SA 1G2BA 4CC7A 1HI0P 3KTQA 4C8NA 3H0PA 3ISZA 3E9FA 2XMKA 1U24A 1F5AA 4C92B 4F25A 5C24A 1SG5A 4YHHF 3TJ9A 1B64A 2IHR1 2E7WA 3IR5B 3FSYA 2GAHC 3EDQB 1GH8A 2C28A 2DGOA 1K9AA 4M75C 1EX4A 1ZPWX 5FU6B 3C12A 2DETA 2FVPA 4Y2AA 1SC3B 5GJVB 2J9DE 2CP3A 2JZ5A 2CWKA 2W9BB 1EETA 3HFZB 3RKXA 2EK6A 4HKQA 3BBFA 1VIFA 2GQ2A 3W62A 3A3NB 4ED8A 3OY9A 2K5FA 1TG0A 4EBCA 2ZKTA 4OJ1A 4DPUA 2LYVA 5DM6Q 1WJQA 4M94A 3POTB 4ZPVR 1IKXA 4C8LA 2C06A 5HANA 2HNIA 1B7TA 3CVKA 4EO8A 2WVEA 2OFGX 4RW7A 2K79A 2V5HG 1YITQ 1U1KA 3OBYA 2P9CA 4WCEQ 3MEDA 1SVDA 2CSIA 3OFEA 5C5JA 4ICLB 3HKZD 2HMIB 3I56A 1RTHA 3OUYB 1YJ7A 2UU9F 1S6UA 3V7SA 1DURA 4WTOB 3IRXB 4TLQA 1QAJA 2J0WA 2V50A 3CE8A 3N28A 5E5NA 2GMJA 1IQZA 3D1QA 5ETKA 1GEHA 2K8GA 2NYSA 4OMFB 4CLPA 3BGOP 1TKTA 1HQUA 3PIPQ 4K4ZA 4FBTA 4DR7J 2DILA 2JJ4D 1G3TA 4O4GB 4ZP9A 4LJMA 4LSNA 4DG1A 3QSIA 2ROGA 5CAAA 2EBEA 2HGMA 4DQSA 2DHAA 2QMWA 2RILA 2HQEA 5D4OA 1ZUYA 3JYTA 1WG4A 3MURP 4HVVA 1PSDA 2BJ1A 5DM7R 1Q5VA 1WWHA 1YJRA 2GGPA 2DRAA 1LCKA 1TL1B 3HMJG 2HSPA 4PJOE 2RF2A 4JP8A 5KG0A 1M27C 3BYPA 2BX6A 2V8HA 5I22A 3BF4A 1GT8A 5KFSA 1HD1A 2BQ3A 2PGCA 3KUHA 5GMKl 3PX6A 3CMET 1FWLA 4GBQA 3PIOQ 1SRLA 1I81A 5E3CA 2Q43A 1NJIR 4WU2A 3FFIB 4RR5A 3MAAA 3KXTA 2M8HA 4KUIA 2C2OB 2MPXC 4OZNA 3KG0A 2FJVA 1FD2A 3N6LA 1U1OA 1AZEA 1XR6A 5J2NA 2VPXB 4DL0C 3DLLQ 3JQKA 1CSJA 3QRQA 3WIUA 2CH4A 3OBIA 3QT5A 1VJWA 4PWDA 2HRTA 2B9XA 2BMBA 3CEDA 4Q0BA 1LXJA 2QA4Q 4Q2LA 3RMSA 5ETVA 3TARA 3D0GE 5BYRA 4ZKAA 2OSRA 2FHMA 1WTFA 3HHDA 3EM1A 2E5JA 1KVIA 4F3QA 3CC2T 2FTRA 5HCKA 3OV7A 4J9SA 3I0RB 2CJAA 4MIBA 1N5YB 4FM4B 5IFMA 3CPWA 2GNCA 2HVHA 1R8AA 2JXBA 3IBCB 2XDDA 2CQ1A 1BE4A 4M4ZA 1YCSB 1PAUB 3I56T 3SI8A 2K7AA 3OQ2A 1S99A 3NHNA 2EKHA 5DS7A 2KE9A 2I5JB 2CKKA 4WK3A 3JCMW 3G4SQ 3QIDA 3HPOA 1I51B 4DXLA 2C2MB 5IHKA 1YTYA 3CC2Q 4XU0A 5EDWA 4CRJA 2VC0A 2AT1B 5HJYA 2OPSA 3KLGB 3H42A 4NLTA 4Y0FA 4QT7A 3ZZUA 2ASYA 3H41A 3VAFA 4JI6J 2IBKA 2DR8A 2HWTA 2QLXA 2HL3A 2J0XA 1FDAA 3ZEHA 2EYXA 4C0BA 1FMKA 4L59A 5ETMA 4YR0A 2ZJPQ 3HKWA 4X66F 2B4UA 4FPIA 3CPWS 1BU1A 1CKAA 3QXEB 1AUSL 1TKXB 5C6SA 3EHQA 4E98A 2DXBA 4DPOA 3QQCD 2F2XA 2E1PA 3L09A 1WTBA 4XTXA 2EFOA 3F44A 1RA7A 5E3QA 4JI0F 3WC2A 3JYTB 5BR8F 5GANe 4FXWA 2ZJQQ 3T1YF 3A1YG 2RU9A 1FK9A 3F70A 2SRCA 2HMAA 4C11A 3N0VA 1I1GA 3AOCA 1LQ9A 3B8HA 2D7SA 3PRBA 3GQCA 4B08A 1APSA 4WYWA 4LBHA 3VGUA 3OTDA 2B5JA 5AT1B 1KR4A 1VC6A 1F2HA 4USHA 2QRRA 2WOMA 3MR5A 2M52A 2ZH7A 4JLGA 3GLXA 2A28A 3CJKA 2ZC3A 2XI9A 2E5LF 5JMNA 5IZHA 1GXUA 2F65A 5KFPA 5ETOA 2M0OA 1OY8A 4D3GA 5FDLB 5DDOC 4ZNXA 2QLJB 3UDLA 3L2VA 3C66A 5DRKA 4WE1B 3IR6B 1KDNA 1NDKA 3LWIA 2OPSB 3KLGA 2ZHAA 1VQ5A 3DM2A 1LWEA 4GO7X 2ZZNA 2UUCJ 3VGTA 3S1TA 1E6GA 4F2SA 4DSJA 1VQ8T 4DV4F 2L9WA 2O4XA 4WPAA 2W2PP 2X3DA 1K73R 1QJHA 2CJQA 3NLCA 2BJ9A 4PXCA 3SYZA 3US5A 3ASKA 3RYLA 1HK9A 4ECTA 3LP2B 1HNZF 1K1ZA 2KFYA 2KG1A 1FKAF 4FU6A 2CPIA 2ENMA 2P4TA 3CXCR 1JBMA 2LMJA 2AJQA 5T7LA 9ATCB 2LXIA 2EJ9A 3W61A 1N33F 4Y28E 4WFZA 2Y1IA 2OKQA 1S6QA 4PPZA 2P8IA 3FZ2A 3AB2B 4QR2A 3GIKA 4ZPWR 2NUZA 1VRUA 2BV3A 1VQ9A 4ZITA 2LQ9A 2VHGA 2WSFC 3CMAA 2ED1A 2GTOA 4J9CA 4ECSA 4LF2A 2VOPA 4C0DB 3RAQA 1S1NA 5CYQA 3CC4T 5DLGA 2FYXA 1D0ZA 4I2PB 3C8YA 3OBWA 4N56A 3LYIA 3AOBA 3C3LA 3VYGA 2Z8QA 4DPYA 2IMOA 2V34A 3M4YA 2JRSA 3PEJA 3NWRA 1BUXA 1U2RA 4M7DG 4YR3A 2C22A 1X6OA 2NZ4A 3EJMA 1K9MT 1ZAVA 1UW4A 3EVMA 3MM9A 4PJNA 4FNHA 1NJWA 2KK4A 1NEEA 1Q7YR 3PVQA 3UWTA 5B0GA 4CNYA 2YKNB 4ES1A 2YNHA 1Q8KA 4ANEA 3ITHA 2DMOA 4F02A 2JJ9A 2VA2A 3CCQA 3D6FB 2CZ1B 1FRIA 1B0PA 1J5EJ 1T3LA 2I0NA 5KFJA 3QZ7A 4USIA 5AE1A 1R0AB 5JJBA 3PKMA 5B0AA 1FNMA 1DLOB 2JEGA 4K4VA 4X4TA 4IFYB 3MMBA 4ZCMA 3BO3A 5ETSA 2YWKA 2KSSA 4L6V5 3VS4A 1MV0B 1TU0B 4PL6A 5I2SA 1WDDA 4WBFA 1YZ6A 4OI2A 3JCMg 3FUYA 5A2QU 4P10A 2FB7A 5KFXA 1DARA 2UXDJ 2KZZA 2FY1A 3MXHP 4I4BA 2LT1A 1GL5A 4ZVEA 1V3SA 1DHMA 4LUDA 1B0TA 1ZH5A 1M5VC 1BQMA 2G2ZA 5GANf 1RTZA 1XIQA 4L76A 3A5ZB 1TOVA 1G5VA 2HNYA 4CLFA 1F9EB 2YPYA 3KDNA 5A0YB 5GAMh 1NPKA 4XU3A 1LOJA 4CT8A 2RMOA 4GVLA 4QU7A 1UJ0A 1VQ8Q 4J6XA 1YWPA 1M9SA 1RCXB 3EMTA 2HHQA 1ZTTA 4MIWA 3OL9A 1RHKB 1N36J 5FRMA 1GXIE 4AT1B 2ZWOA 3MEEB 5FD1A 4XTUA 3OVAA 4A8OA 1FKPB 4TY8A 5K8PA 2RU3A 3HFKA 4MAKA 1TKZA 5SUHA 2JVVA 2DNYA 3G87A 4URSA 3QAEA 4CZCA 3R27A 3CQTA 3R7SB 3M2UA 4AFQC 1BQXA 2F9DA 2HNZB 1G3YA 4Q45A 4ZLJA 2CREA 3CDEA 4HT9A 3CJSA 1OEBA 4IRCA 1IJEB 4DS5A 3Q8VA 1ZTWA 4QPXA 1F3FA 3CCUS 1EETB 1GQEA 4PR6A 2KXCA 3R6LB 1VQSA 4N4HA 2GZOA 1P27B 2UUAJ 2QGGA 2RSQA 1GX6A 4GMKA 1FJCA 2DNGA 4DV2J 4CI0C 2V0NA 1RWOB 5FW9A 2KL8A 2Q6CA 3N9UC 4M7DA 4EMHA 2AWZA 3FBCA 4C8QC 4I0WA 2MK5A 2CZ6B 4HACB 2ILZA 1S1TB 4KV8A 2BACA 2CGHA 1DQ8A 3R7BB 2X3WD 3AJ1A 2RQTA 3N4WA 4V19J 1UUEA 1IGQA 1GMWD 5CO7A 1DTTB 4ES2A 4PJMA 1K9MU 3OYDA 3HULA 4K4SA 2JOYA 1CJUA 2FRYA 5HL7Q 3OUYA 3EG9B 3META 3OL8A 2ZDOA 1KIKA 1YK9A 3MJXA 2B7CB 3JTPA 2L8DA 2QQRA 1TK8A 5A0GA 3PYDA 1YJ9A 2L41A 4CM2A 2DIGA 3KLHB 1PD1A 1VQ8A 2PN6A 5GAMf 2XGQA 2RNAA 3QJYA 1WC0A 4N47A 5KT5A 1M4ZA 1VQMS 2RH2A 4LSNB 2HHHF 2MQNA 2DX1A 3OT9A 1ZZNA 4B9TA 4ME7A 3UCUP 2HKNA 5CIUA 3N01A 2AYEA 3CCLT 5K8MA 1JRIA 3AXKA 4OIXA 5D3GB 3SQGB 1RBAA 2COLA 5E2QA 4OZ1A 5KG7A 4ZTFA 3SSQA 6FD1A 3H0IA 2AZ3A 4OHYA 1M5Q1 1WQ7A 1YI2A 2HZYA 4ZVSB 2WSEE 3HM9A 4QWEA 2XSJB 2EC0A 1DTQB 4XAXB 4WFXA 1VQ6S 2KM8C 2I1RA 2Y90A 4NA1A 2W7OA 1G4CA 2D1CA 2BQUA 1WI8A 2GQQA 2JNGA 2DK2A 2W2QP 3EX7B 3GE9A 1HNXJ 4C92A 3MPDA 2HFZA 3FEXB 3KMSA 2LEBA 3HHLB 2R7UA 1WQWA 3W65A 3JB9k 2KU7A 2CPFA 2E66A 4B9XA 4ZP8A 4NEYA 1K0VA 2VH7A 3ZTOA 4E7ZA 4OYXA 3GP8A 1SKSA 3MP6A 1AZGB 4K5RA 3MEGA 5KFUA 3HSDA 2CDTA 3OS2A 4R5PA 2Z4PA 3HHLD 1Y96A 2J7KA 1LFPA 1SH0A 3J7AF 2MGZB 2JH3A 2GTJA 3OHAA 2NUTB 1K8AC 4RTVA 1QLNA 2QEXQ 5J2QB 4JYAF 2LXUA 4EZ9A 2DNZA 2D8HA 1WHJA 1UGVA 5KFGA 3EYZA 1FRMA 5F8IA 1ABQA 4J9HA 2C3YA 2LXFA 2M70A 1R0CB 2LTOA 1KHCA 3ZZRA 1SH2A 1J27A 4B3TF 4ZK7M 3RR6A 4RW4B 4H4OB 3LGNA 2DE0X 4RCBA 3J7YI 3N79A 3OLBA 1O51A 5KFQA 4DQRA 4EUVA 1T9UA 4PABA 2O3DA 4PJOC 3FFIA 4UUWA 3EE3A 2RM4A 1IKYA 4QVCA 4KAIA 4I2QA 2XSJA 3A13A 1TUVA 4M5LA 4OYIA 4DR7F 3RBEA 5DQGA 4P52A 2Z30B 1FFGB 1M5PC 3CIZA 2W7AA 4MK8A 5GMKj 2J7WA 4CLUA 5G0RB 2KYZA 2VU5A 2P0QA 3LQVA 2MY7A 1XWLA 2JVOA 3MAAB 3GNGA 4DL3A 1RT5B 1FDDA 1CC7A 4ELZC 4YB5A 2EGEA 3PFOA 3CC7S 4JS5A 2DPPB 3Q23A 2VG6B 3EAEA 2PIIA 3JSYA 3QRRA 1N88A 3CCVS 2DGTA 1WHXA 4PQUB 4ALZA 2DBBA 2GVDB 2DVIA 3THVA 2V68A 2WRMA 2VJUA 4I6WA 1WLPB 4XTWA 1Q0NA 2Z2YB 4DOWA 1X69A 2F5TX 4JPBW 2UP1A 2GBQA 5J1NA 4B9LA 4K4UA 3EGXA 3CPFA 3HLUA 8ATCB 1N4LA 2ADBA 4E7SA 2OTJS 4X65F 2H9ZA 1KBRA 1YKWA 1X4BA 3NGKA 2CG4A 4OYZA 2CZ7B 2EQMA 4MMOA 5M2RA 2J6UA 4RW6B 1QUVA 1L3SA 3X25B 1KFSA 2CQGA 5I3UB 4DX8H 2CJXB 2F7VA 3RGIA 2UVWA 4Y92A 2ZKUA 4H4MA 2PE8A 1GFCA 1W7WA 2YVSA 3MP8A 1UGPB 1YBAA 2V67A 1T9WA 3J80Y 3MD3A 1H74A 1S9EB 3R3TA 4B3OA 3GFHA 2YWHA 3T1AA 2JEIA 4OX9J 3LP0B 1YJWA 2B9YA 2QQAA 3D1OA 5KFEA 3CCQT 3QWXX 1I07A 1WG5A 2VFRA 3HP9A 1HLWA 5DGAA 3ADAC 4RKUE 4PUOA 4J37A 2FVSA 1JJHA 2OTLT 1HQUB 1UMJA 1FKOA 4OB2B 4ILRA 5I2MA 1IKVA 2XO7A 3LWLA 3T9NA 4BHQA 1PNJA 3UN5A 3D28A 3MFHA 3MMCA 2U2FA 2MDAA 1WEYA 4CTAA 3TQ1A 1NYGA 3M8PA 1JJ2S 4A54A 3GSDA 1UEKA 3M8YA 5JUMA 1UFLA 3PIPA 2G4BA 3Q8UA 2FLOA 1L5UA 3KXDA 5KFVA 1JLAA 3G96A 1N33J 5GAOm 1G6BA 5GAN6 2X4XA 1XNQF 1S72S 1RHRB 2BKOA 4UW2A 3PTAA 1OYEA 4LR9A 3DLLA 4NZ0A 1VQ9T 3BE3A 4OGEA 4P7TA 2CZ0B 1QVFP 4G6VB 2RQCA 3OTOF 4FYYB 4C8OA 1TL5A 5KG5A 4M95A 4AYBD 1J5EF 1R77A 1YNZA 4EFAC 2CA9A 2EVRA 1IN0A 2JC1A 4OV6A 4JV5F 3W7BA 5FDLA 4O3RA 1TL7B 4LRBA 4OMLA 5KYWA 1S6PB 1CJVB 1SV5B 2CP0A 2OX7A 5M2UA 4EMDA 4QIGA 3THTA 5H1SV 1IJFB 1RTDA 1QP2A 3ETMA 4DL4A 4LFCF 3WDOA 3J81E 2NREA 4R8UB 2BRKA 1BMQB 5I11A 3MMCB 1F9FA 3CCRA 3KLFB 1WC6A 3CJ0A 2QQ9A 3U1LA 2PEBA 4RLEA 5GADI 3EG1A 1PKUA 1HWIA 4OYAA 1EZZB 4YB6A 3H20A 2BE2B 2CVEA 4LFAF 2LEPA 1PBUA 5GVQA 1ZOTA 3DDKA 4ID8A 4MKAA 1E7OA 3AXMA 2BIVA 1SUQB 1F2GA 5ETLA 1UFWA 2RH3A 3D67A 2H5EA 2M9KA 3CCQS 2OH2A 5ADZA 1RLQC 3E51A 4ZVHA 1T05B 5CAIA 2RHSB 2CPEA 5HVHA 1IR2A 5DZ7A 3NCQA 4FKXA 5D6XA 1SPBP 3C95A 3GJSB 3NCPA 2V2ZA 1WDXA 4RTWA 3MFIA 2P84A 4I67A 4MMLA 1NEGA 1D3BB 2DVJA 1CC8A 2LC4A 3AD7C 1G7CB 3P8DA 1VHFA 4EYIB 2YPZA 2I0XA 1FEHA 3DXSX 3J7YU 2CYZB 2A2CA 2V9KA 4PNOA 2ACMA 5KT7A 3G71Q 3KLIA 3L3CA 4OI3A 1OYXA 3PMTA 3RG6A 2QASA 3X26B 4PG7A 3KHLA 3M6VA 2BANA 4X4RA 1YRTA 3NNAA 4LDYA 4A8WA 3KWMA 2RQWA 3Q86A 1WI6A 1VLYA 4A8XA 2QTWA 1YRUA 2GHVC 3RAMA 5J2PB 1SRMA 4DF8A 1BCMA 3JCMf 3BR9A 1ZSZA 2NYIA 2AW0A 5GAOp 1N8RT 3H2LA 1TTHB 4C8YA 2OTJQ 1QMCA 2VXEA 2RO0A 4D6WA 2J8SA 4PG8A 3MF5A 3BSNA 4KQZA 1IM4A 3ZTQA 3T5JA 1I4K1 4YHHJ 1WZOA 4PEOA 1S9GB 3OYYA 4E2FB 3PZPA 3T3FA 2AJFE 1M5SA 3I5BA 1KLNA 4Q43A 5KCHA 4FS2A 4BWMA 4MMKA 1M3BA 4Z7CA 3C0CA 3PNIA 2HQGA 1RUWA 1VC5A 1TKTB 5L46A 4NEZA 4PXDA 2HD0A 1AWXA 2YXYA 5K14B 2CQHA 2K3YA 2XWXA 1HQEB 2GAGC 2JX2A 2MWOA 1QD1A 3MEVA 1RWPB 2BBEA 2DR7A 3BGRA 2EJGA 2E70A 4IR1A 4M78E 3T5KA 2MYSA 4M7AG 2W4PA 3P8HA 1RADB 2QL5B 4NLRA 5K9FA 4ZCLA 2CQ4A 2JM8A 5GMKa 3VALA 3CCST 3EH2A 2OJ2A 4U96A 1DJ7B 1SL2A 1N5TA 3UQSA 3M53A 3LAMA 3JSCA 3CMQA 5GMKe 1S5ZA 3JCMV 1VBZA 4DR4F 2GF7A 4WKYA 1PGZA 3M05A 4CLTA 2DXFA 4ITSA 3KBGA 1RWVB 3TAMA 1VYTA 3G4SA 5ETPA 3M9MB 4KGXB 1Q4RA 2NLWA 4LF5F 5IHIA 4AFFA 5GAMd 1NKCA 1IBLJ 3CO9A 4UY85 2PMZD 1KC8R 3TZXA 4HDGA 2AZ1A 1D8YA 2CP5A 1RT4A 4OMMA 3MUMP 2HKQB 4LE9A 3NMZC 4AFSC 4IUVA 3LALA 3JB9J 4M5DA 1PD0A 3L7UA 3DRXA 2NYHA 2EWHA 1DQ9A 4S0MA 3N5FA 1T9TA 1VQYA 1VQOQ 3MM6A 3HHLA 2YLCA 4NI2A 4OZ0A 2RQUA