1PG5B

Crystal structure of the unligated (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
148
Chain Sequence
MVSKIKNGTVIDHIPAGRAFAVLNVLGIKEGFRIALVINVDSKKMGKKDIVKIEDKEISDTEANLITLIAPTATINIVREYEVVKKTKLEVPKVVKGILKCPNPYCITSNDVEAIPTFKTLTEKPLKMRCEYCETIIDENEIMSQILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aspartate carbamoyltransferase
publication title Crystal Structure of T State Aspartate Carbamoyltransferase of the Hyperthermophilic Archaeon Sulfolobus acidocaldarius.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 32
structure length 148
sequence length 150
ec nomenclature
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
B PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 1pg5B02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 1pg5B01
2BE7D 1RACB 7AT1B 4AMCA 4KGZB 4KGXB 1XJWB 1ZA2B 2H3EB 1TUGB 1R0CB 2AT1B 6AT1B 4FYWB 4FYYB 1ACMB 2QGFB 2IPOB 3D7SB 1F1BB 3MPUB 4FYXB 2AIRB 1RAHB 1TU0B 1RADB 1TTHB 2BE9B 4KH1B 4AT1B 1ZA1B 2YWWA 1D09B 2A0FB 2ATCB 1R0BG 2HSEB 1RAFB 1RAIB 4KGVB 9ATCB 8AT1B 1Q95G 1RAEB 4WTOB 2FZKB 1SKUB 2FZGB 1I5OB 1AT1B 3AT1B 1PG5B 4FYVB 4F04B 1NBEB 8ATCB 4KH0B 2FZCB 1EZZB 5AT1B 1RAGB 4E2FB 1RAAB 2QG9B 1RABB
chains in the Genus database with same CATH superfamily
3VS2A 2M8DB 3CSKA 1MN9A 1XMOF 4M5KA 4ZLPA 4DOWA 1K0SA 4J9DA 4HACB 4EBEA 3RTVA 2OIHA 1C1AA 1CSKA 1QVGR 3NOCA 2K3XA 1WC0A 2KSSA 4N7TA 4OJ3A 1R7IA 2ZWOA 5ITHA 2KHCA 1FXRA 3BS9A 2MY7A 4DX7A 2NREA 2MMYA 3J7AN 2OGUA 4LSNA 1G7CB 1BI2A 2FPEA 2XWXA 2ROLA 4LVOP 2HBQB 1IM4A 1HA1A 4CT9A 1GX6A 1B99A 4L3NA 1X4GA 3OTBA 4ZIVA 4IH5A 1XNQJ 3EMTA 3QPHA 5AE3A 2HBPA 4M75A 2E6ZA 1LNQA 2QC3A 3PJWA 3BGOP 2VDHA 4JI1J 1AROP 2VG5A 3IP0A 4RUBA 2M9KA 3C12A 4RNNA 2HFOA 2Y1JA 2IJRA 1VQ9Q 3U1LA 2MKKA 3A3NB 3G82B 3FJ2A 2DO4A 3NCPA 3B4DA 3ET6B 2HAXA 2JWNA 1RP5A 3E19A 1FRIA 1IKYB 2EYZA 2M0YA 1U48A 4JJNK 2K2VA 2B8PA 1AWWA 2GVDA 2OHDA 5A8RA 2I6WA 4MMLA 3U1MA 3GIIA 1W7WA 4PFZA 3CULA 2ECZA 3ZO7A 4M7AB 3CCEA 3I96A 1EJ7L 3RW6A 1X31C 3PGGA 1M5PC 4DR2J 4DEXA 2O5DA 3CF5Q 1RADB 3MWBA 1SJQA 1NEGA 2K5FA 2HNDB 3OY9A 2H4WB 3OYNA 5F3ZA 1HI1A 1WGSA 1QJHA 3T9ZA 1QWEA 4M94A 1YJTA 2O9SA 3UD3P 4HTIA 2XMFA 3R7SB 3SEOA 3H90A 1TSFA 2YT6A 4I7FB 4RW6B 1VQ8T 2C06A 1HI8A 3SCJE 5C2GA 5C6SA 2WBMA 3C95A 3ZL7C 1R6YA 1YHQA 2CQCA 1LK7A 3BKTA 3FKBA 2YTCA 3MM5A 4XAKA 2KT2A 4F0HA 3VR1A 1QSLA 2CQ2A 2CQ1A 1UTAA 4GBQA 3GJSB 2ZFHA 5B0EA 3ZZYA 3OSSC 4BS2A 4BE1A 3CD6T 5B0DA 5U47A 2XDDA 1S1TA 2NXEA 3JS9A 4GVBB 1KSPA 2BQRA 4Q44A 2D3ZA 3L42A 1TWBA 2HBYB 2LX7A 3Q8VA 4PRFA 4HTJA 3H20A 2JOYA 1Y00A 1AZSB 2FLNA 2B56A 3CMAA 1BIBA 3O5TB 2R7SA 4DR4J 2EAYA 2BQ3A 2UUCJ 2CG8A 2QA4A 1HBUA 4PPZA 2W9CA 4HT7A 3JSYA 4QU7A 4I4BA 2F2VA 4QWCA 4O3SA 3SCIE 1IBLF 4P74A 5L9XA 4BDZA 3A8HB 4ORZA 4A8MP 1S97A 4TLRA 4DV3J 4EDUA 1N5SA 1E6YA 3DNCA 4FW1A 1QE1A 3FB9A 2ZZMA 4WIQA 1SHFA 2AF6A 5A8WB 4I1TA 5F8NA 4RKUE 3FBEA 1XC9A 2IRUA 1WEZA 2AD9A 3BGRB 1DZ5A 2XMMA 3J80Y 3KUFA 3OVBA 3W9HA 1UJ6A 1KD1U 1NYGA 4KPCA 1Z2LA 3CCJS 3Q83A 3KXDA 5ETPA 5B0CA 4WP3A 4DG1A 4WZQA 5GAN6 2BZYA 1AWOA 3M8WA 2ZPBB 2HD0A 4MIBA 3TVZA 2O3DA 1FA0A 2QASA 5F9LA 1YJNS 1SG5A 4ID8A 3N5FA 3W7BA 3LGLA 5EDWA 1HHQA 3J7YU 4DF4A 3M4YA 3OVAA 4IG0A 1N5YB 2J0WA 1WEXA 4ICLB 4NZ7A 3DKDA 1YGYA 4LQ9A 4DR7F 3NMRA 1WIEA 2K1RA 2KYZA 3M2UA 4CNYA 3MURP 3H41A 2D8JA 1RXOB 5D4PA 4X4RA 1GRIA 2AZ1A 3QWYA 3MF5A 1S48A 2V5HG 3NNAA 3K7RA 2CZ7B 4LRFA 1X6BA 2OI2A 4ILLA 3US5A 3E51A 1NK5A 2BXJA 4A4JA 2PSZA 5CYJA 4XDCA 1O6XA 1VQMA 1NJIT 1K0VA 1D09B 1NLPC 2VUBA 3IRWP 4BC9A 2VQFJ 1T8EA 2PTKA 2CA9A 2WB1D 8RUCA 3EUNA 2BANB 2R8HA 4X62F 1N33J 3VCDA 5J1EB 1ELOA 4U96A 1HNXJ 1YZ6A 4WFBQ 4ZHRB 1YTYA 3JCMV 5DLOA 5DZ6A 1KEKA 1QKXA 3CJTA 2LCCA 2GF7A 1IXDA 1ZBJA 4EMKB 1NUEA 2R7XA 3IRXB 5CQGA 1YHQT 3SMZA 3IQLA 5FLXY 4YB1P 5FU7B 2FD2A 2QT7A 4PQUA 5F8JA 2XCAA 1RISA 3THVA 1YVFA 3TEHB 4QIVA 2EJ9A 3NNHA 2IBOA 3BREA 3ZNJ1 1VQ7A 5CYQB 2FVUA 2XB2D 2G6FX 1RUSA 2F40A 1RYSA 5ETQA 2FVQA 3HSJA 2F4VJ 3NAIA 4C8KA 4ECVA 5GAN4 5I4MA 2DR6A 3TNVA 1J5OA 2KE9A 1VQNQ 4PFOA 3CMAT 1OZ2A 3IGNA 4X65J 2CG4A 4C8MA 4HDHA 4CC2A 1M5SA 5HL7Q 4M78B 1S0NA 4LF7F 2QA4T 2J7WA 5HMWA 1O0PA 1QVGA 4ZGJB 3N6MA 4ED1A 1OQ3A 4AG2C 3CDAA 3KK3A 1I94F 3T1HF 1ITPA 3HI9A 3MEDB 3GIJA 3CCJT 3P49B 4NA2A 1AB8A 3G8QA 1U2CA 1S9EA 2DR9A 1OPKA 1FXDA 4DV5F 3FEOA 3V7SA 4RJVA 4FW2A 3GR0A 3PTAA 3CPWS 3OB9A 3LGFA 2EPIA 4IUQA 1Y3KA 5AXMA 2PMWA 1FHTA 4QWEA 1S6UA 3VUBA 5DY9A 2M8HA 2KJVA 1VQOS 1WF0A 2I0XA 2FGOA 2OD6A 2RD5C 4CLYA 2YNIB 2F8HA 1JNZB 4IOCQ 4I2PA 2DY9A 2K7JA 2VICA 2J8SA 2WONA 5DJBA 1NSPA 3DGPA 1M8VA 4M75F 2C2NA 2M0GB 2E44A 2ATCB 2PEHA 2HNZB 3GV7B 3QGPA 5KFQA 3FRNA 2DH8A 1RWNB 5AXNA 1R31A 1FVSA 4AT1B 2W8KA 2YKNA 1VRUB 4BLGA 2HIYA 3BW1A 5KFBA 3MP1A 2ERRA 3U7JA 2RQ4A 3D4JA 4ZVSB 4MK9A 2UUTA 1Y71A 5KT4A 1X5OA 3AH6A 4YMEA 1RI0A 2VB6A 5KFDA 2ZD1A 2F2XA 1IB8A 4HVUA 1GNKA 5GAN2 3LLRA 4DBHA 2GNCA 1VR6A 5D78A 1UDLA 3MR2A 1L3TA 3I32A 4X64F 1YIJQ 1ZM3A 1ZS6A 2KXFA 3JAMU 1Q86R 4NLUA 1JQGA 4F4KA 2R2RA 2YSQA 4RMOA 4M5LA 1QVFR 5KOXA 4U7CA 1TFYA 2FDNA 4WYLA 3Q0AA 3C3LA 4IQXA 1VQMT 3OSNA 4DUTA 1U1OA 4EO6A 3K57A 5IS2A 5HO4A 4DBQA 3M2RA 3PX4A 1JLCB 3OFFA 3SSSA 3PDNA 3NOGA 3MP6A 3JCMg 1LXJA 4F0KA 3GJTB 5CH7B 3R6LB 1VBKA 3LYIA 2RPNA 2M02A 5IQ6A 2KQWA 1WQ7A 1JJ2P 2ZKTA 3EDRB 1UA0A 3T19A 4O0IA 5IM0A 4D3GA 3WZ0A 2VV5A 2QDLA 2AJ4A 3NCRA 3MMCB 3N9UC 3DU6A 2NUTA 2FY8A 5DM7Q 4PWWA 2DNOA 3A8JA 2C2OB 4S0MA 5KFEA 4CCHA 2I1RA 4C0ZA 2EGCA 1VQ5A 4PZVA 3IWLA 4U8YA 3JTNA 2I38A 3IBFB 4JI8F 1WC1A 5M2UA 1AWXA 1RTZA 1N9RA 2OAWA 5D77A 3EDQB 4RNHA 4ZCKA 4IG3A 1X4FA 4DV2F 3PMTA 4IYQA 1SKSA 4ATNA 1J5EJ 3PX0A 5HMYA 2D7SA 3M59A 1YRXA 4CO2A 1OPZA 3MMBB 1S1VB 3D6MB 2AWZA 4N77A 1VQOT 3QHSA 5HROA 3BQ1A 4DSLA 4DSIA 1JLAB 1UCNA 3M9MB 4IFYA 2YNFA 4M7DE 1BI0A 2HNYB 2GAHC 2YBVA 4LDYA 3WIVA 3G86A 3Q24A 1F1BB 1Q8IA 1E6HA 2LEAA 3QJYA 1SV5B 2K7KA 5E5NA 2VG6A 4P2MA 4NS5A 1QUPA 4OHYA 1FKOA 4DV7F 3EVOA 1AYEA 4EMHA 3L2RA 4B3TF 1RBLA 2AMCB 4C8QC 1H0HB 2W2OP 2Z56B 4CLKA 2VFVA 1N52B 3NS5A 1M3AA 3LALA 2DEIA 5CO7A 4YY3F 5HI7A 2KAFA 5LL6S 2JZ2A 3UCUP 1U6ZA 2J7KA 4PNOA 4GKJJ 1NSKL 2MMPA 3CC2Q 4MAKA 4RTZA 3CCMS 3T3FA 4MIWA 4JRPA 3M8RA 3C6TB 2VXFA 4IO1A 2GZOA 1ZSGA 3CCZA 2DL8A 2Z30B 3L7OA 2HKQB 1IBMF 4FKYA 3OYEA 2ACMA 4O4RA 1R8OB 5RUBA 2ASLA 2N4DA 3MUMP 4E0DA 3HO1A 5I42B 3IG1B 3JB9J 3NG8A 4OLOA 4K59A 2P0KA 2H65B 4A46A 2DGSA 4C8YA 3HDSA 4F7UE 7AT1B 1F3FA 2DH7A 5I3UA 2X4XA 1H8KA 1BWEA 2XULA 2GMLA 1JLQA 1RT5B 2DKOB 3UW1A 3NMAA 2HMIB 3U02A 3J7A1 4KO0A 1ZUKA 4QWBA 2Y1RI 1U8RA 5AT1B 1YX2A 2OPRA 2DGOA 5HKCA 4YOEA 2RQRA 2A1BA 3A13A 2WSCE 3ZBDA 1WHMA 5F8IA 2R5AA 4OB1B 1Y96B 2MWOA 5FRNA 3FQLA 4QQBA 3OTEA 2RNEA 3M32B 2ZAEA 4QT7A 1Q86C 2JTFA 2J6SA 1DTQB 4LUEA 2EC2A 2A7YA 2X1FA 2NYSA 3X24B 4QQGA 4LSLA 2OMLA 4AFSC 1JLBB 4J9FA 3ER0A 3QZ9B 1RTJA 2E4HA 3O2IA 3UWTA 2FJAB 1KIKA 3A8KA 2D3UA 4YDDB 3EG9A 3HZEA 4V1Ak 2R8GA 2ZJQQ 1YI2Q 1BCMA 2UVUA 4LFBF 4IR1A 1WXUA 2X4JA 1FE4A 2AX0A 3DLLQ 3P3DA 4R5PA 5LJ3e 3C14A 5H9FK 3LF0A 2RAQA 3KHGA 4FZVA 2XS2A 2NUHA 3CC4S 2RRNA 4OZJA 4PABA 2BZXA 4URGA 1VQ9S 2ATLA 4RPFA 3E01B 4QVZA 3M0PA 3W62A 1JNRB 2UXCF 2BOAA 3LQVA 2B7BB 4X9DA 1Q7YT 3CCWA 2CUDA 5CIUA 3BN7A 1RT3B 4V19J 2W2NP 4PEOA 2CH4A 2NXNA 2WOMA 2KT1A 1ABQA 2ZH1A 2HQCA 5J26A 2JM9A 3CCMT 3ZFVA 2OJ3A 1RWVB 1VBYA 2CQHA 1TG0A 5HY6A 4FM4B 3TW0A 1ZTWA 2R2TA 2WCXA 3BDEA 1VQKA 5EG2A 4JZ4A 1CLFA 1SIZA 1J27A 1XQHA 3OYHA 2DZ9A 5KFPA 2KEAA 2HWHA 4DX5A 1S57A 5HAOA 4RU2A 2L9NA 3DDKA 3I35A 4C8OA 2CZ9A 1UJ5A 2DNUA 3AB4B 2OEKA 3MCMA 1O51A 3UR0A 4LFCJ 5IAYA 3EGWB 3X25B 1NJYA 5GAMe 2K5IA 1HYSB 5T7LB 3EGDA 4C9DA 4I56A 1U1NA 5E2QA 2PA8D 2RF2B 4KKOA 2W4DA 2ZPIB 1MWZA 1D9AA 4J9BA 3PW7A 1VRTA 1RYRA 2AEFA 1CJKB 5GAN7 1VQLA 1MMGA 1NKBA 3GOXA 5GAHI 4CTAB 1HBOA 4FF1A 1Q82T 3PVXA 1B0VA 4OYPA 1QCFA 3PNWC 1DRZA 3ETOA 4OB2B 2B4VA 3CCLQ 2KZZA 3ME9A 4HA8A 3HSZA 1JU5C 2G3RA 3FIFA 3RZAA 3THKA 3CBMA 4M5DA 4OZ1A 2DMOA 4M7AD 5KCHA 2XNQA 2KG1A 1U06A 2Y1IA 3OLBA 4K7QA 2NSCA 1KTVA 1U0HA 2GO8A 1UFLA 1C0TB 4JI6F 3CCSQ 3GP8A 3H8ZA 2VQEF 2O9VA 2EIFA 3AB2B 3DOLB 2RI5A 1G5VA 2FPFA 3GTYX 4PG6A 4DS4A 1TH7A 1DURA 4MMKA 2ZITA 2ROEA 5C42A 3LWHA 2E5LJ 4LF9J 3CC4T 3LP0B 1QTMA 3MM7A 2DTHA 1UWAA 3X26B 1JLEA 1ZAVA 3DYAB 4ECTA 4K4WA 4BUGA 2EFPA 1N36J 1VQ9T 4EK2A 4QW2A 2LNHB 4KSEB 4OX8A 1OY6A 4ZMMA 5I21A 2O2OA 2XSFA 4QQ6A 1FNXH 5GAGU 5D4LA 3GG0A 3MPDA 1FJCA 3GU0A 3G6VA 3KG0A 2P0PA 5C7PA 5KYNA 3CPWR 4LBIA 2JXBA 2QSFA 3SCLE 3H42A 3RBZA 2FHOB 2KR3A 3TEGA 1F6TA 5B0BA 3I56A 3EG0A 2ED0A 1Q86U 1RWXB 3OS5A 3BGUA 4DV0J 2VGNA 1BU1A 2MZ1A 2ABYA 4OYBA 2KZMA 3SWNC 5LL6d 2GJIA 2DL7A 4KHPF 5D0RA 3D66A 1UTIA 2GAGC 2IC3B 2UXBJ 1XN9A 4DI6A 5FLXU 3LGNA 1KWMA 1VK8A 4Z89A 1PHTA 2BQUA 2LEBA 2XG8D 2U1AA 3SV4A 3LOUA 4KPYA 4ZVGA 1JXOA 1HWKA 2V69A 2LXUA 4J8OA 2KDSA 3HT0A 1HWJA 3QGGA 4R55A 1WG4A 1LCKA 1SRMA 1VQ6A 1RTIB 1WKLA 2W01A 1M1KR 3P96A 1VYVA 2HRYA 2BA9A 4ZVHA 3VVUA 1UUEA 3JSMA 3G4SQ 1REVA 3RKWA 4P2XA 5L1JA 3VAGA 3I55Q 4M7AG 1IKWB 4M77B 2BTTA 3AQOA 4DV1J 3K8WA 1I07A 1M1HA 3GR1A 2MIOA 1Y7PA 2CREA 1FO1A 2MQNA 4KTQA 2CGHA 1VQNA 2Z2ZA 3N0VA 2RJEA 1RSCA 3RW7A 4DQSA 4OF1A 5E0OA 4PUOA 2L3SA 4K4SA 1BQNA 3QSIA 4RTUA 1W6XA 2XLIA 2JVOA 2VC0A 1Q8LA 2Y90A 4YB6A 4ELZC 1H92A 3FRYA 1UVNA 3C46A 2CP0A 2Z2LA 5HLFA 4B3RF 4WF9Q 2ENMA 3VS7A 4IO9Q 4LSNB 3OUYA 4HR2A 3ZZPA 3PFOA 5C25A 3UFCX 4F04B 4KHRA 4PJOE 3TZWA 3I9V9 3C4SA 3JCMX 2P5VA 1VFJA 3BBBA 4DV4J 1FXXA 4CWBA 2UP1A 5F9NA 2VBZA 4C7QA 1K4US 3IM8A 1WQWA 1WDTA 3POTA 4AL6A 2E9RX 3CDEA 3A1YG 4A4FA 5GANe 4RTWA 2MQQA 1JRIA 2JTMA 1N34F 1I51B 1XR5A 3OPKA 4UY85 3KKFA 2YXYA 3W5YA 2H4YB 1HXDA 3G1JA 2EKOA 1NK7A 4P7VA 1NSAA 4XO0A 2GVDB 5A8RB 4Q43A 2EQMA 3CMES 2G9OA 3RR7A 4B3SJ 4Q5VA 3GFHA 1YFNA 2AGOA 3E9GA 3HVWA 3GV5B 3CCTA 1JB0C 4J7IA 3DLJA 1K76A 1WI7A 2BIVA 2VOOA 1FTRA 2LU2A 4GKKF 4ED8A 4AFQC 2C1EB 3MAHA 1FRKA 3GMGA 3R8YA 2NPFA 3BY7A 3PACA 2ALZA 5KCOA 2H54B 2LP4A 1XWLA 4AXIA 2IM2A 2KRBA 4X4SA 1XQIA 2W24A 2ZJPQ 2RRAA 3LWLA 1YIJA 4B9VA 5ADZA 3MEVA 4QZVB 1C0UA 4TU7A 4JI2J 3G6EQ 5KTQA 3MEKA 5KE2A 2GGPA 2RSQA 3CJ2A 1IKVA 3QG1A 2OPQA 5B08A 3VVTA 1CJTB 4Y2AA 4M78D 4BE0A 4CI0C 3MM5B 2WAQD 1L5UA 3EICA 1FD2A 3QDFA 4J9SA 1CSJA 1X5TA 2PFDA 5JVHQ 1UKUA 4TXSA 1V5VA 4BY6C 2W10A 4QIEA 2W1BA 2QA1A 1HARA 2CT4A 1QQJA 3EFOA 2AJ2A 2QYCA 3I9ZA 3HPWA 2GJ2A 4R0KA 1Q7LB 3UA7A 1GXTA 2O01C 1B07A 1X8DA 1U1LA 2B0GA 3R5BA 1ZSZC 1RT6A 5I3QA 1YG0A 3NTHA 1ROFA 3CO0P 2HBRB 2VJVA 3FLGA 3DOMA 5LJ3d 4ZITA 1TKTA 3M0QA 1JJHA 3NGTA 3M57A 1HBUB 4L75A 3M05A 4NLWA 5GADI 3X1LB 1O8BA 3QZ5B 2XI3A 3Q2SC 3EFRA 2W9CB 1GX5A 3HHNB 4JYAF 2FJEB 2LCLA 1SL0A 2CPDA 4JI7F 1VQNT 1E6GA 4XK8E 5KFFA 2DL5A 1JXMA 2IAJA 2LRQA 5LJ5e 1E6YB 3HK2A 2JMAA 1M1KC 3FSIA 2ZH9A 5C24A 2HVDA 2HFNA 2ZNYA 2L41A 3L9ZA 1VK3A 2G0IA 4B3OB 4NZ0A 4Y28C 4PK4A 1C4AA 1TMMA 3KBGA 4RTVA 2ZH5A 4DXLA 5LMNJ 1LWEA 3RAQA 1W2IA 4EO8A 3EVMA 3EG1A 1SKUB 3EGXA 2PEBA 1WTBA 4X4VA 2L48A 1EB0A 3UA6A 2R2SA 1HBMA 2V8JA 1IJEB 2RS8A 4L5GA 2UUAJ 1WHJA 2YRVA 1VJWA 4ERDA 1SPKA 1Y10A 2AV5A 2M52A 4DUZJ 1MWYA 3KJVA 1R6VA 5D8HB 1LFWA 1F2HA 2RQMA 2YRDA 1XEZA 3J7Z5 3WDOA 1GFDA 4L76A 4X84A 3HFVA 1HL6A 1ZM9A 1WELA 3D3CJ 2DK2A 1YLXA 2LQKA 3OFHA 4XTXA 1XIQA 4F3MA 2LMJA 5T41A 1ACMB 4Y00A 4M78G 1FE0A 2K1RB 5A0YB 3TAMA 4CC3A 2BJ8A 1V76A 2HHXA 2L3RA 2QQBA 2V67A 2QAZA 1DLOA 4FF4A 1G2BA 3HFZB 4J9HA 2YUPA 2F8MA 2KFNA 3H40A 1HWUA 1CVJA 2LVWA 2M7SA 3QUIA 3WX4A 2DL3A 2XYHB 1P6TA 4FF2A 3LGHA 1EETA 3MR6A 4USJC 1K8AT 3CC2S 2YPYA 9RUBA 1AEYA 1OPLA 2AJ0A 4ZVPB 2E65A 5AE1A 3S3OA 1CBKA 2M16A 4B9LA 4F3QA 2RHUA 3AOBA 2VOPA 5CAAA 3Q8QB 4DLEA 3I6PA 2KMTA 3MCSA 2BEFA 4ZKAA 5KYYA 1URRA 4KT0C 5GAOm 4HACA 3QT5A 2FPDA 2ZZDA 4X4PA 1UA1A 1U6FA 1FXLA 1EAYC 3PEJA 4ZS6A 1XMQJ 2CJQA 4XTUA 3TVTA 2HDAA 4NXNF 1IHVA 1TU0B 4PQUB 4KGKA 1KP6A 1YBAA 4B9TA 4KFBA 1MN7A 1VHFA 3W2VA 1UGVA 4EUVA 4K4UA 3MJXA 4X4TA 1O75A 1JXVA 4ES2A 1JEGA 4PXBA 1PKSA 2LDYA 2WW4A 3QWPA 3UO0A 2B9XA 1KG1A 4HHUA 4X4UA 1J5OB 1I0CA 3P8HA 3LANA 4RG8A 3CXCP 3SD4A 2Q1LA 4JDSA 1K73T 1IQZA 1BHNA 1X43A 5DRKA 2WACA 1IM6A 2ZPFB 1WG5A 4Y2CA 2CKWA 1UETA 3KHRA 1T9TA 1UVIA 3DLLA 3CJSA 3KK3B 2L3QA 1M2OA 3L95X 3G87A 1EZZB 2W2MP 2QLWA 3NGUA 4RCCA 4PL6A 3J81E 3CJ3A 5DDQC 2W8LA 3ISNC 1GCQA 4DFJA 2D9TA 3PR5B 4YR0A 4M7AA 4Z02A 4O3QA 3SHWA 1YI2S 1FWLA 2BKOA 4FKXA 2AZVA 2J6UA 1KFSA 4GMKA 4ES3A 2DEJA 4DHVA 2W9AA 5ETVA 3VRYA 4TNOA 4I2PB 2HHQA 2GTJA 1KS2A 3KWMA 1CC7A 2L9DA 2WK4A 4PXCA 2WONB 3QATA 1N54B 3KLIA 4F4AA 4NLTA 2J6KA 2RQCA 3DGPB 3M1VA 2RMOA 3OYKA 4L74A 2DRAA 1H7WA 4DPUA 4I68A 5KFNA 1HW8A 1Y07A 3CCVQ 2IVYA 3ENWA 2EFQA 2CP2A 1IN0A 2JEJA 4RNOA 4OX7A 1EQMA 2JRSA 1G4CA 2YKNB 4LDXA 4RW6A 1M1KU 1AUDA 3RNJA 1R8CA 2GFAA 4MZPA 4QKUA 2OPSB 1EP4B 5B0GA 3UT1A 3CC2T 3RR8A 5MLCV 2GMHA 4ATOA 3ELHA 2YWKA 2IJFA 3HFNA 3LO3A 1K0TA 4PJLA 4DOZA 3EE3A 3L7PA 1WDXA 3LAKA 4UT4A 2R8IA 2N7CA 1QVGP 4OZ2A 3FMWA 2RJZA 1C1CB 3NXZA 1WJ9A 2DHGA 3E3XA 4M1KA 2B86A 1BQMB 3PCOB 4ZIWA 2SEMA 3B6BA 2DNNA 1M9SA 3JB9I 5L1IA 1T9UA 1W1FA 3M5AA 2LX9A 3M2RB 3V81B 4E8UA 1MMAA 1PRLC 4OLPA 4DL5A 2XMKA 3I82A 3KK2A 3ZZRA 2XG8A 5KFMA 4CP5A 4C92D 1H74A 4Z37A 1OULA 5FU6C 3W5XA 1S7HA 4J5OA 3BEGB 1A0NB 2AGPA 4IKFA 3BV8A 5A8WA 3GP9A 1C1BA 1S6PA 4KC5A 4LF5J 5IM0B 5GANd 1XOVA 3JYTB 3B8HA 4USWA 2G0CA 5KFCA 2NUTB 2RDJA 3VF0B 4BWJA 3CCLS 3CCSA 1U1TA 3I9QA 2CQPA 1A9NB 3NAHA 4F2SA 1R0AA 4DR6J 2IJNA 4X62J 5FJ4A 2K3YA 1RWWB 5M2RA 3CMQA 2X4WA 1TKXA 4CLLA 1SQEA 2E5IA 4FP9A 5G0RB 4OX9F 1B7YB 3M2VA 2MQOA 2RK2A 3FJ5A 1YP5A 1MMLA 3V6HA 2ASDA 1TUGB 4ZGEB 1S1NA 4RTYA 2AZSA 2DGXA 3H8YA 4IG3B 4LMZA 1F9HA 3F56A 4EU0A 1FESA 1NO8A 4JZ3A 1YI2T 3NHNA 1U1QA 4OHWA 3MHYA 2QMWA 2YXLA 2D1XA 1N5YA 4HVZA 3CQTA 3ITHA 5HROB 2OUGA 2QK0A 3SFMA 5BJRA 4MTPA 2YNFB 3PRDA 1MG7A 3OYAA 3BYPA 3H4BA 2DTIA 1B7TA 3V5RA 3D28A 1AOJA 4RW9B 3V7RA 2KN4A 1YJ9Q 2V4JB 4QWAA 2HLTA 4HKEA 2VG6B 2KRSA 5GVQA 5A0GA 3DRRA 4G65A 3RRHA 2KYBA 3A3PB 3ZZOA 5KT5A 2E5HA 4ZN3A 3R5DA 2IVWA 3BR8A 2ZH6A 2XMUA 3BM7A 3PJ9A 3R97A 2R3VA 1WFWA 4Q45A 4W4MA 4JV2A 4E6RA 4RKUC 4QU6A 1NK0A 3OVSA 3W2WB 2C3MA 4Q8EA 4A53A 2K06A 4ESRA 3SCKE 3DDNA 3UNYA 2G13A 1P1TA 4Z7YA 4CYUA 4ZHRA 2HFZA 4C3KA 1YWPA 4A4EA 2R42A 2NLWA 2F9DA 1GXLA 2HVZA 4C92G 4EMKA 1BI1A 4H4KC 3B78A 4CM0A 4N47A 3IRXA 2XZWA 3NRBA 4O44B 1T05A 2AGQA 2ZDPA 2DIVA 2ZEJA 5JVGQ 3P8BB 4F7UF 4KUDK 4K2JA 4FNIA 2EW3A 4A63B 3VAJA 3T9NA 5LJ5d 1DQAA 4HYKA 5HJXA 1FDBA 3FMBA 1MW7A 2HBZB 1ZZFA 3G4SS 4LBPA 3DCAA 1ZPWX 4PYDA 3J7YI 2E3HA 2FQQB 3OW2S 5ETKA 4JV5F 3SFUA 2LQ5A 2EBGA 1S5ZA 4KO0B 4USIA 4TQSA 4HVWA 4M78A 1PBUA 2HCKA 3DRXA 3CCLT 5CD4H 4OV6A 1MSWD 3M0RA 3W8PA 4ENOA 1KVKA 3J81j 4M77E 3VS0A 1W2BA 5CD4A 1WHYA 3FRZA 2JM8A 4C8NA 5AE2A 2AYBA 1RLQC 2ASJA 3HFKA 4CLTA 2HVIA 3AD7C 5A2QY 2VWFA 1RL2A 2LCWA 3TZXA 2BUDA 1FRMA 3CCST 2UU9F 1NDKA 2JLEA 5EWEA 2Q6BA 2YNIA 4WXOA 1N32F 1RTJB 4P7TA 1M5HA 1O5JA 1TR0A 3OHAA 3EG9B 3MEGB 1MU2B 1ZM4A 4C8QB 3AAWB 3MD3A 1YJVA 2JW4A 2GO9A 1TXQA 4R5PB 2LFVA 2GFFA 3JB9D 4FYYB 1BD6A 2HHHF 3I31A 2CQ0A 2HNZA 3DC2A 3G7ZA 2H8HA 3DI6B 2D6FA 1KRPA 1N5ZA 1JJ2S 2DH9A 1XMBA 4M75E 5HVHA 4LF4J 2EFGA 3CCEQ 2OTJA 2PQWA 4H4KA 1U7LA 1V3SA 2GGRA 2WOMB 4E98A 5EWFA 3JQMA 2ZBCA 3MFIA 2P84A 2EQJA 1H6KX 2EJGA 3RAMA 4DV2J 4LF8F 1G3SA 1I5OB 3MAAA 4M7AF 3CC7Q 1LWCB 5CKDA 1TL4A 1ZUYA 3JCMW 4ECYA 2DD8S 1NDPA 2RM4A 4UZCA 4Y3CA 2E5QA 3PW5A 3DM2A 4KGVB 4LFAF 5DDRC 1N88A 2ILYA 3TVYA 3QIPA 4EBDA 1TOVA 3L1AA 2JN0A 4OZ3A 1JLCA 2KVIA 2BBEA 1L3VA 3G6ES 3E1SA 1OSDA 3QYYA 2R7VA 4A48A 2PD1A 3DLKA 3PO5A 4HCBA 4L6V5 5E3PA 3LTOA 1T7PA 4KKOB 2SXLA 2RHXA 2QMUB 3BB5A 1MLAA 2AHJB 2ED1A 3G4ST 2R7OA 3O1LA 3CGIA 4DR1J 1PKUA 1HQ2A 4XTVA 1SH2A 3MMCA 3I55T 3GBQA 1M8MA 2A08A 3HLUA 4Y2KA 2EYQA 3MECA 1QDUB 3GSDA 4YY3J 1VQPQ 2YKQA 3HKWA 2ACYA 3BJYA 1HBOB 2ROPA 2ZPHB 2ZH7A 5KYXB 3NBPB 1WC5A 2B9WA 4FSXA 4CH7A 3P8DA 4UC4A 2XYPB 1UJ4A 3TJAA 2MWPA 2W7OA 4A54A 3PTWA 2KRMA 2KY9A 1FFWB 1NK9A 3TUZC 4QCLA 3N79A 3L2VA 1U45A 3G96A 2A10A 2DXFA 1OS5A 1KLNA 2ZZTA 2HQDA 3CCRS 1H2UX 4BC7A 1S72S 4M5DB 1KN6A 1R8BA 3TZYA 2RT3A 1RHQB 3VS5A 2JC1A 3JB9G 2YLBA 2UV8G 2DGQA 2ZCFB 4K50A 1S1VA 3KK1B 2GMJA 2MCNA 3EGUA 2E5GA 5CR2A 4NASA 3C8YA 1N9SA 2IVFB 2CKKA 1U5SA 3HSDA 1V1CA 4DN9A 1RAGB 1FDAA 1HNWF 5IT9U 1VIOA 1V5IB 1IR2A 1UJYA 2NQPA 2J9CA 4XU1A 3R9LA 1K8AC 3MM9B 4ZTJA 8AT1B 1JLEB 3BGFA 4ZVRB 2RH3A 1GBRA 3M0UA 5DLGA 1WJQA 1RWMB 5GAOp 2QEXQ 4EEYA 3R2CJ 2VF3A 2XDBA 4ECZA 4XIUA 1FT8A 1X69A 1ZBTA 5GJVB 2QGFB 4WK3A 3CVKA 5ECAA 4N5SA 4PXEA 2NXJA 4X9CA 1UAWA 3NGPA 1H3ZA 1IUJA 3OYCA 5HCKA 2RHSB 4OQJA 2QYGA 5H1SV 3ENVA 1I1GA 4EZ6A 4ZLNA 2IYGA 1HNIA 3MTJA 2F5GA 4ZOSA 1AT1B 3R6GB 1XNIA 2OP5A 1AFJA 1Q4RA 3N5BB 4MFBB 1KJWA 3MGJA 5I42A 3IG1A 1FYNA 1FFSB 3LUYA 1DHMA 5SZTA 4ZPCA 4L6V3 3G6ET 4M7DC 1HQEA 2J5AA 5A6WA 1K73C 2W25A 2X1BA 5JUMA 2ZHAA 1Q95G 1RT5A 1N8RT 3OBIA 3VV2B 2HMIA 2VKNA 4LXCA 4C4WA 1FVQA 2RQVA 2VH7A 2YKPA 1ZLMA 1R27B 1S1XB 5CQYA 4ELYC 4FN5A 2XO7A 2FC8A 2HNIA 1REVB 3PW0A 2UUBF 4CLZA 2LZ6B 4CDIA 3Q23A 2COYA 1B34B 4DV6F 5IV3A 1VBXA 4DL4A 2E1RA 2DGTA 1CQNA 2RUSA 2PGCA 4CQ1A 4J6XA 2K57A 4IDKA 1DTQA 2J0SD 2X51A 3VS4A 4ELTA 3CCRT 3FEXB 2J0XA 3UN5A 3E2UA 4WFAQ 3L2WA 1JLBA 1D0XA 2CXEA 1QAYA 3R1LA 3UWNA 5DO2A 4LREA 1OX8A 3HKSA 2XD0A 3OLAA 1FKPA 2RN8A 4USMA 4ZPWR 3HHTB 3BO2A 4EYHB 3NGKA 1G3TA 3NWRA 3MEEB 5GMEA 4K4ZA 5AXLA 4JS4A 2KJWA 3G71S 5EC7A 3PEHA 4C92A 5C25B 2DJZA 3BSOA 2YNGB 1XNQF 1JO8A 5GAEU 4ED2A 4I2QA 2G0JA 3NCQA 4M78F 2ZBQA 5KYWB 3E01A 4UW2A 4JI1F 3T5KA 5HQLA 5CKHA 1H98A 1LK5A 4ZGDB 1RHKB 4DX8H 3K17A 1WOPA 3WVEB 3SWNB 2HS4A 1Y11A 3GYXB 2K4YA 2Z57B 2XK0A 1HD1A 3AA8A 2DXUA 3RR6A 2O1PA 3VGUA 2FJXA 2FHKA 3V4MA 3DLBA 4ZCIA 5IWAJ 1RABB 3CCVA 1RWUA 3VS3A 5CCAA 1YJUA 2CQ4A 3KJQB 4JUZA 4EIKA 2BJEA 4YS2A 2MGZB 4PJJA 4ZP8A 4F17A 4BWMA 1LXNA 3H98A 1K1QA 1UVKA 4LIRA 4ZLLA 3PFSA 4JI6J 4DR2F 3SQGB 2VYTA 4ZPVR 4QWDA 1T3NA 3EZUA 4U7UD 2IDEA 3MR5A 4RUHA 4QQDA 3QJJA 1QP3A 2CVEA 1PJ5A 4U8VA 3O3LA 3AXMA 2BR0A 5HK0A 1SH0A 5T7LA 1FJ7A 4DPWA 3LW5E 2XSJB 1SB6A 2RF2A 1C0UB 3IM9A 5LJ3Y 1FFGB 3VAMA 4R0JA 1QSYA 1PSFA 1UFKA 2C2EA 3FBFA 5BYSA 2GGPB 2ZH8A 2P2CB 1R0BG 2V26A 2ESWA 2OPQB 2R5MA 3MTKA 3PE0A 1NM2A 4CTAA 4YB7A 3QRRA 2HGLA 2KO1A 4J9GA 5KOWA 3M58A 1EIFA 4F25A 1ULRA 2Y1LB 3U1NA 3D6HB 4X2BA 1IVZA 3EFOB 4HXJA 2QO3A 4OMMA 3HPOA 3H0HA 3VZIA 3I4HX 2FZCB 3JCMc 2CP6A 3OTCA 3UCZP 3I0RA 2DXTA 4JUVA 4OB0B 3GNFB 1VDHA 4DR4F 3CDUA 2DNZA 2HHTA 2UUCF 4RW7A 2MPUA 3I0SA 2ROTA 4E7HA 4DFPA 1D1AA 1C0TA 1TKTB 2CRLA 3IAS9 1X7VA 5GANf 3VV0A 5FROA 3DOLA 1OYDA 1B3TA 1NK6A 2R8KA 4QYZK 3G71T 5KAKA 3LWMA 5IQQA 4DV3F 2PDAA 1PGZA 4C5GA 2K8GA 4URQU 2ALYB 2IAJB 1EQ0A 2IRYA 3CJ4A 3LP1B 4N41A 2XHCA 1PSEA 2MY8A 5C24B 5CKEA 2DITA 4UUXA 5L8RE 1U1RA 2FJDB 4A8QA 2VBYA 4EMDA 5IXBA 2DXBA 2L8DA 3GB0A 4H4MA 4PJMA 1YJ9A 3EGXB 5EGYA 4JI3F 2V2KA 2EEYA 1HBMB 3VGTA 5DGBA 1GBQA 1LV5A 1KC8T 3E8OA 3O5ZA 3W9JA 3KYLA 1Q81T 1UZHA 1S6OA 2M70A 3W63A 1R8AA 1FMKA 5D0GA 4ECXA 3DKMA 3FBBA 4N0AA 3JB9H 2ZPGB 2ABLA 3BDUA 1A6LA 2RI2A 4DUYJ 2BW2A 5GMKl 1RA6A 1WI6A 2E5JA 2QV6A 3CCVT 4CI0B 1S6QB 1GQEA 2UV8A 1IBKJ 3IO1A 4UUWA 1UPMB 2B4OA 4DR3J 1NB7A 4BY6B 1T94A 5HK3A 2L3PA 1Q53A 4IIOA 4MKBA 4OJ1A 1SC3B 4QJVA 4GO7X 4YUDA 1WHWA 1RTIA 5THWA 3H59A 4IFVA 1QM9A 2JUFA 3HCXA 3W65A 3MHXA 2E9ZA 3EZ5A 1TFWA 4EGLA 2PUOB 1EETB 3CO9A 1ZSZB 1Q8KA 2R57A 2HIQA 2EFOA 2PU9B 3PYEA 3PIPQ 2VQFF 4A4KA 1IKWA 1TL1B 4DU7A 5DQGA 2WRMA 1RBOB 7FDRA 2CQIA 2C3OA 3VHQA 5K5MA 1AA1B 4X66J 1N33F 1PC0A 2A36A 1HNXF 1ZM2A 2XU8A 3HULA 4E2FB 1HNVB 2XMWA 5D4OA 5KYYB 3KHHA 5LJ5f 4GKKJ 5EHHA 3PT9A 2K3KA 1EIYB 3RRGA 3C94A 5GAGI 4TQRA 1TVRA 1D9FA 3A1PA 1IWGA 1NCLA 1P9QC 1KQSA 2GQQA 2V8KA 3T5HA 3OXGA 3KNGA 2LXIA 3A4TA 4KFBB 3W2VB 4OMQA 2CPIA 4USTA 2BE2A 4K8RA 4IRKA 3FVYA 3NS7B 2RU9A 2F4VF 1VIEA 1VQ4A 4H4OB 2KXDA 2OO4A 2YUQA 1L3KA 2E5KA 1X6OA 3W66A 5AYFA 3M4XA 5HANA 4TVRA 4YHHJ 1LW0A 2GIQA 3OR1B 1ZOTA 3M6XA 1RBAA 4KYZA 3JXOA 4V19X 2P0QA 4H54A 1M27C 2VL1A 3D0IE 3PYDA 2MXYA 3M8ZA 1PC4A 1Z4UA 2MQ8A 2W7AA 2P4RA 3J81Y 2AJ1A 3IR6B 3M9NB 3LWIA 2NUUG 3UD5A 4NCGA 2VPXB 1VIXA 2X3WD 3PVQA 3Q89A 5LSRA 4OI6A 4W92B 4LR7A 5K8OA 1S49A 4J9PA 4WIIA 1WC6A 4J7FA 2HPUA 2CZ1B 3IR7B 3W3SA 1G8XA 2R9LA 1YJ9T 1CKAA 1M5KC 2A3JA 2AJQA 1OZ3A 3KLIB 3CC7A 2CQGA 1S59A 2J9DA 2OPPB 3M1VB 4CM2A 1RAAB 5E3CA 3NEKA 2X3XD 3CCES 1OQKA 4DEZA 2K9GA 2LXFA 4E7IA 2HGNA 3ILIA 4LF2A 4ED4A 1VGYA 3ZZTA 1HBNA 3ZZ0A 1KHVA 4PJOC 2Y9HA 3FJPA 2OTLQ 4ZP6A 4A8XA 3VJPA 5H9FJ 3CCUA 3N4WA 1SJ4P 1BCOA 4JI0F 1WHHA 3IC1A 3ZTPA 1VQKQ 1CJTA 2F65A 1H3DA 1IZ6A 2KM8B 2ZM6J 6AT1B 2GS8A 4J90A 1F5BA 2IPOB 3M6VA 2NLUA 3BH7B 2VA3A 5M9OA 4EFAC 4USHA 4DR5F 1TL3A 5DZ7A 3D3BJ 1D0YA 1M1FA 1NEBA 2JH3A 4XTZA 2VPZB 4J7CA 4C0BA 2M0OA 1RWOB 2RIJA 2DFUA 2HFVA 1C6VX 4GLMA 5D6XA 1YHQS 5IXFA 5C2CA 2EVZA 3ENQA 5GAN5 3A3OB 1VQPA 2YLCA 3PYFA 2PO4A 2KFYA 1M2VA 2XI2A 3MO8A 1D1UA 5LJ3h 1N0UA 3VQSA 3P4UB 1VQLQ 4QIFA 4PWDA 5DETA 2RH2A 4OMFB 4C8QD 2JVRA 3KK2B 1N48A 2RB6A 3V6DA 4C8LA 2MK5A 2FC9A 3EHRA 1T9XA 3D67A 4ILMA 3BH6B 3OL6A 2H48B 4A4HA 2CDTA 2GHPA 3CMAS 3TA2A 3JSCA 2MLYA 2V68A 1C1BB 1S6PB 4BCAA 1NPKA 2QFJA 3EHQA 2QA4S 2AKWB 4D3HA 4OZ5A 3KUHA 1CEZA 4EPCA 3QGHA 4C5EA 5SUHA 1XERA 2IYIA 3OJSA 4B3OA 1RLPC 4QW8A 1R0AB 2DZCA 3RBBB 4C5IA 2XS7A 2E1MC 3CD6Q 2CADA 4C2MA 1FNOA 1WHLA 1WC3A 1PD1A 3CCQA 1TKXB 2K3BA 2MOXA 2RD1A 3M2VB 1UP1A 5KG1A 4ELVA 2DGVA 1VLYA 2DEUA 3NS6A 5KT3A 3Q2TC 1J5EF 2EFNA 1A0OB 5J2NB 5GAOl 8ATCB 5IV4A 4NXNJ 4KJIA 2QEXA 3UVJA 4RWWA 3OXLA 3V7CA 3BO3A 3R1HA 2NCKL 3M6UA 4OZNA 2UVWA 3SI8A 2Q3PA 2DRBA 3IMQJ 1N0VC 3ITHB 4TY9A 5BYRA 2FEIA 4LQ3A 5GAMh 4F67A 4RW8B 2PT0A 2CPHA 4GVLA 2V8PA 1C2PA 3KNAA 5CZVA 5ETSA 1NPRA 1M5Q1 3FSYA 3LH2S 5A0YA 4URSA 2L9WA 4Q0BA 2MSTA 5KE3A 2IIMA 2DL4A 4ECRA 2AIRB 3CCET 2XZDB 5J2MA 2IM1A 1FK9B 3DRRB 2ZUGA 2O67A 4IURA 1D9DA 2JTEA 2DIQA 3VALA 3I56Q 4ECSA 2RKIA 1LKZA 1FWKA 1V9OA 3PFEA 1OU9A 2J6OA 2VDIA 3CXCS 1FDNA 3MM6A 3RB4A 2XM3A 2N82B 3TRGA 2PUKB 2LT1A 4HT8A 2CJYB 1Z9QA 4WWSA 4OMNA 3VUZA 3MEWA 3FFIA 4LRBA 4GKJF 2LDMA 1S4EA 1TP7A 2WSEE 2DB1A 2KROA 2XCPA 3HHEA 4CYUB 5GAN3 4C8QG 2GV1A 3TSWA 1PAUB 3A5ZB 3LAMA 5IXUA 4U95A 5FU6B 3I5AA 3TI0A 1SF9A 2CNNB 2DHHA 1VQMS 3HD1A 3MZIA 1T05B 3UQSA 1MROB 1VQ6Q 2IY5B 3NL0A 1V29B 2VBWA 4WKYA 4DCJB 1UEVA 3JB9F 2L89A 3JCMJ 3Q8YA 2EBPA 1VMBA 1Y5LB 2IHR1 4F4ZA 1WJRA 2KT5A 3HRUA 2COWA 1AVZC 4FF3A 1QD1A 1QUVA 3WVDB 2W0ZA 3TR5A 1N6AA 3AHPA 4FCYA 1U8WA 2K7AA 4C3MA 2DISA 2GHVC 3OYDA 3PX6A 5CKFA 1GAOA 1WKKA 1SEMA 3GQCA 1SBRA 1OSCA 4M77F 3NTKA 1WACA 1VQ7S 2X35A 1VC0A 3HZGA 3P5TL 4OYWA 5KT6A 3MD1A 4KGZB 3EZOA 4C8ZA 3D1OA 4QR2A 2OX7A 3DRYA 2V50A 3PKMA 3IR5B 3D6TB 1HNZJ 4DU8A 2CYZB 3U27A 1ZPVA 2DM1A 3UATA 1QVGS 4E7SA 3NFCA 3DLGB 3KOAA 1VQYA 1DY3A 2I8EA 3JTOA 2V8IA 1Q16B 5LMUJ 4M95A 1M0SA 3PR4A 1EX4A 5CYMA 4A8FA 2ZZNA 1YWOA 3DB3A 3AJDA 1JIHA 2DHSA 4B9XA 2JC0A 1SRLA 3M8PA 3AD8C 2YQ0A 4OHVA 3OW2P 1I4K1 1T9YA 1SKWA 3EXYA 4ANEA 1JXLA 1SSHA 4LN2A 3N6LA 3CB4A 2G2YA 3B82A 4JJDA 1YJWA 1RT7A 4OHZA 2HSPA 1RI9A 1H2VZ 4ID5A 2GX8A 2PE8A 2OPSA 1NKEA 1NKCA 4M5NA 1EP4A 1SQFA 2UXDJ 2KRNA 5KFHA 2KNBB 3EG3A 2BRLA 2YWEA 2MKIA 2EQIA 2YPZA 3FNNA 4VUBA 3AOAA 2CVIA 4P10A 4LR8A 3GNGA 1X9WA 1VQSA 3MAAB 2NYHA 4FPIA 3WBZA 4CLUA 4L3KA 2V4RA 5HN0A 2EXUA 3KMSA 3G8SA 4FT4A 2KL8A 1C1CA 2XBPA 1YJNQ 4HI2A 4LRCA 2M1HA 1BQMA 2VC8A 2JS2A 3EG2A 2FJBB 3DM2B 1W2BP 4J9UE 3ENAA 3QIPB 5DLQE 2LMIA 1B64A 3MM8B 1FCAA 1F9EB 4N4IA 2K6DA 4MKAA 3V81A 4IUTA 3TAQA 2Y8WA 1RUWA 1PYOB 4USKA 2C2RA 3OYIA 1QVPA 4LFCF 3H2LA 4ED0A 4OI1A 2XYGB 2LU1A 2EKHA 2LCSA 1FI4A 3BKFA 2GIRA 3QYGB 1NYFA 4M8LA 2Z0WA 3DLKB 3Q22A 4FXVA 4FVMA 5IFMA 1YITA 4WP8A 4X4NA 3WHIA 4QBUA 4C0FA 1DARA 3JYTA 5GANh 1U26A 5D0EA 2DVJA 1IQTA 4GC7A 2J8AA 3MECB 5I11A 3PM9A 3VQTA 4DPXA 3QAUA 2V63A 2DAQA 2OSRA 1VQ7T 1S0MA 1AZGB 1KC8C 1DQ9A 4N8OA 4OYOA 3GLJA 3HTRA 4B6MA 5FIIA 1RJJA 4IIMA 3L2QA 2LQJA 4YB5A 5G0RA 1UVMA 2FYKA 4BHQA 3BZQA 4PKDB 2VKRA 4RCBA 3FUYA 4TU8A 2KT8A 4WFYA 1I1JA 3TU4K 1VQ5S 2CS7A 3TUJC 4FXDA 3CJ8A 4F4XA 1OIAA 2V2VA 2ZHBA 1W25A 2YQ1A 5K8MA 3JQJA 1HIYA 4I69A 3QLHA 4R8UB 4MYTA 2OELA 3ZNUA 3O8WA 3KTQA 3OBYA 3RGIA 4KHMA 4J9NA 1S1UA 2BJDA 4RW9A 1YZ7A 3K59A 2E5LF 4LF9F 2J6TA 2V4JA 1G6BA 2BX6A 1VYTA 2PMHA 3D54A 3S1TA 3FZ2A 3K5PA 2KYXA 1JKHA 1SC4B 4O3PA 3P6YC 3M9OB 1N36F 1NBEB 4U67Q 1JLGB 4LF6F 3OQ2A 2AX1A 1HQUB 3AXKA 1B70B 2YH1A 2DD5A 4XPCA 4FS2A 3MAQA 1X2KA 3W2WA 3SDEB 1R43A 5CKBA 3VAFA 4NXMJ 2HLUA 2EG2A 2FLOA 4J9VA 1GXUA 3H0FA 2BW7A 4KY3A 2ZOMA 4JBCA 2CWXA 3PYGA 2XDPA 5KFRA 1X75C 1HPZB 4Z8AA 2C42A 2MAMA 3W64A 1WSVA 2CQ3A 4I67A 4DV0F 2DR7A 3SFGA 1Y57A 1UW9A 3OS2A 1WWHA 2O31A 2RHIA 5G4DA 5KFIA 2EGEA 1HNIB 2MHEA 4O44A 1VQOQ 3LH0A 2DF6A 3PIPA 1JK9B 4U6PA 2RRBA 2CPZA 4MK7A 2F69A 2YNHB 4LVNP 1TK0A 3R6NA 2VKZG 1C0MA 2RQKA 4ANJA 2IA6A 3CJ0A 1BK2A 5LJ5h 5ETLA 4KBMB 1HQEB 1R3NA 1OEBA 2HW3A 3FK4A 1RTHB 1V3ZA 2MEWA 4DPOA 4HI1A 9ATCB 4Y2IA 4G1IA 3CT9A 1NJIR 2NR0A 4RUAA 2HFSA 4NLRA 4WXWA 1YKWA 3MP8A 2MJNA 3GJRB 4YEAA 3TP2A 1MHNA 5KFVA 5JJBA 1FDDA 3CNQP 5EUHA 1D3BA 2YHTA 3PMIA 2LJ3A 1DFDA 3H25A 4DV1F 1EARA 2QFIA 2FHJD 5L39A 1F3VA 5BR8J 5E3AA 3VAIA 4HVVA 5KFGA 1FX2A 2MJUA 2KXHA 2GVZB 4IDKB 2HVHA 5AJ3J 5A2QE 2QI2A 4Q2MA 4KV8B 3TZZA 4DLGA 3RKXA 5GMKh 1VQ5T 1TMJA 4GC6A 1FKPB 4O6JA 2OEMA 2QMXA 1MU2A 3I5CA 4FIBA 4C8QA 3MEGA 3CJKB 5HATA 3IFEA 2R7RA 4C92B 3OTDA 4UF4A 5DGAA 1YDLA 3X3UA 1QLYA 1K1ZA 1QAXA 2FZGB 4I6YA 2DILA 2HK3A 4DV4F 1LWXA 1NAQA 4I2QB 3DI6A 4N8NA 3FQKA 4HH0A 1Y0HA 1RHMB 1C4CA 1PCXA 2PI4A 1KQKA 4WTOB 3UPFA 2DRKA 4F36A 1QMCA 4KUIA 2QE5A 2ZH4A 3BE3A 2N7YA 1PKTA 2XMVA 3UR3C 4L59A 3NGDA 2RNAA 3W8GA 1E6VA 1WXTA 2QN6B 1MNEA 5KFTA 5H9EK 2D0NA 3OR2B 3D0GE 2F4FA 5C5JA 4RTXA 1X4AA 1LWCA 1RZMA 4ILRA 2OTLA 3HSGA 4M7DB 4OVAA 4NL5A 1SIWB 2QLBB 3NNCA 4W98A 4XTYA 3JTPA 2I2YA 4IR9A 4M7AE 4MK8A 3PJXA 3TA0A 2BJ1A 1YK9A 5CQXA 3VU3C 4KQZA 3OL9A 1UVJA 4M5HA 1RAEB 3WIUA 4NLXA 1RK8A 1WZOA 1K1SA 5BYQA 3TSZA 1LEOA 4J9QA 3HMJG 2NZCA 4NL2A 1U2RA 4DWIA 4JI2F 1VQKS 3KG4A 1GMVA 2E10A 2VFRA 2IM0A 5KT7A 5FD1A 1JWWA 1E7OA 3OYYA 3CXCR 1TK5A 5FWCA 3PRVA 4ED6A 4OYZA 4QIGA 1WXBA 1QVFA 1BKBA 3GYNA 1T3SA 3SQOP 1Z1ZA 4PLLA 1CC8A 4M75C 4FYWB 3S6WA 1PD0A 4KT0E 3N28A 3LP2A 4F7VA 5KYXA 3NBPA 4RNMA 2DETA 4Q5WA 3J80U 3KLEA 2EVRA 4K4YA 5L1KA 3QZ7A 2R2UA 4UY8T 3C15A 4PXDA 2F1LA 1X0PA 3CPFA 2HL5C 1O9SA 3CCMQ 1HHTP 3G2XA 1TKZB 3CJRA 1RE1B 2MZSA 5L9NA 2AHOB 1VQ8A 1LOJA 3PHEA 1VQLS 3I0RB 3EVWA 3BBCA 2Z2MA 1FJEB 2G1HA 2DPPB 3W9IA 4M5GA 3BSCA 4RW7B 2X1AA 3KK1A 4LNPA 3I0SB 5J3BA 2QXFA 1R77A 4IH6A 1GH8A 2IG0A 1HJDA 2PVGB 4X4OA 3CD6A 2GFUA 3TA1A 1B0TA 2HQXA 5FW9A 3DMJB 1DBDA 2JL9A 5J1PA 5D0HA 2QL5B 4UTGA 1D8ZA 3SBMA 1WPYA 3H9NA 2FY1A 3ZXWA 3MEAA 2LA6A 3MM9A 2ZBIA 4F4WA 2LQBA 3RMSA 3QT7A 2DRDA 1NJIC 3I5SA 1HW9A 5HK4A 2EPDA 3H5SA 2UUBJ 4WFZA 3JSBA 5HMXA 5F3TA 4XTTA 1M4ZA 2YQ3A 1Y4ZB 1OX9A 1T9WA 5LMNF 3GG1A 2VFUA 3DU5A 4CLPA 4P75A 2HZVA 2VGMA 4P6QA 4AE5A 4WYWA 1BXNA 1MWQA 4D6WA 5GMKi 2BM0A 2JNJA 4H4MB 2DEQA 2FB0A 1NG2A 1MMDA 2UUAF 1AZEA 2EWHA 3O44A 1RAFB 3OSPA 1SVDA 2DA9A 4DUZF 2V6AA 4AG1C 3QO3A 5CK9A 3B54A 3THTA 2BYCA 2EFVA 4AQYJ 2CZ0B 3T41A 2CNLB 3EX7B 1TQLA 5KFUA 2D1CA 3PHTA 1RGVA 2X4YA 1SJ1A 3OHBA 2LQ9A 5KG3A 2I2LA 2QL9B 3N5BA 4MFBA 4CLSA 3JCMe 1DTTA 1X9MA 4C0GA 2W2QP 4ER8A 3TARA 2C28A 2VIHA 2D8HA 3I56S 4HCCA 4BBYA 2KK4A 5L38A 3VS6A 2OTLT 2XMAA 4E47A 3CC4Q 3GFXA 2JEGA 5EX0A 3K5NA 4Y0FA 1VQKT 1OOTA 4XU3A 2QX0A 1ZHIA 1BGXT 4MMOA 4MKYA 2Q66A 1YWXA 4IFVB 1CULB 3QJLA 3ISND 4J9MA 3J7AF 1HLWA 1S1XA 1MV3A 4ETXA 2KG0A 2WVDA 3QRPA 2HL3A 3QO9B 3OV7A 2D9OA 1N6QA 4BE2A 1ZH5A 4UQGA 3WC0A 1HK9A 1B34A 3BDLA 1OY8A 3OL8A 1HR0J 3FEZA 3I5BA 2BABA 4LBHA 2PFFB 3MCAB 2MZJA 2QGGA 2CP5A 3HHLD 2MLXA 3TCJA 1VQ6S 3VAHA 5LSLA 4JLIA 1Q86T 2CDQA 4QPTA 1U02A 1EHWA 1CJUB 4UZBA 1VQLT 4FL6A 1XMQF 3RB3A 1TKDA 4HL9A 1TVRB 3GLXA 3J7ZT 2GCFA 4UOCA 3CD5A 2PVDB 3MEEA 5GMKm 1NZ8A 3K58A 1VQNS 3CBPA 1ZX6A 4RX6A 4RNFA 2BE2B 3QJPA 3CJQA 1VOMA 1F5CA 2DR8A 2YNGA 4U9RA 1FNMA 4C3LA 2VBXA 2CJKA 2V1RA 3BSAA 1KQGB 3MPWA 1WTFA 4CNZA 5KYWA 2DNLA 2L2PA 1TAQA 1VI7A 1RT4B 3AODA 4F26A 2QQSA 1HI0P 1LW0B 4QIWD 1NH8A 3QT8A 3SWNA 4M78E 1WSRA 2BKPA 2HZAA 1TUWA 4CH0S 2KT3A 1X60A 5IH2A 4WZMA 2V8GA 3UCGA 3TYTA 2HHWA 2HEQA 3RUXA 2C0IA 4LD9K 3R27A 3KUEA 1W26A 2M2BA 1SJFA 2APOA 3MEUA 4WK1A 2Q79A 5LOQA 1X4EA 1AW0A 4NCGB 5F0UA 4OMFG 5CCMA 2MGZA 2JMCA 4DN0A 5DG7A 2E70A 2H3JA 1QAJA 3MUTP 4C8QF 2J9EA 3SQGA 4J9EA 2KVQG 1I8FA 3BPDA 1IXKA 3CCJA 1FEEA 2OTJQ 1F2GA 2ZH2A 2R7WA 1X9SA 2PZ1A 1ZA2B 1U1PA 5HBMB 3A8LB 2CSQA 3M4GA 3I56T 4ZJLA 3M55A 1YJNA 2XSJA 1XNRF 4M4ZA 1HBNB 1Q7YR 1KQSP 4KH0B 3IBWA 3OFGA 1PBAA 1NJIU 1DJ7B 4JI5F 2D41A 2HQEA 4E7ZA 2K2PA 4YQWA 4P5NA 3CDBA 4OIXA 3UDLA 1VLOA 3DFEA 3EH2A 1N4LA 2BRKA 4K4TA 1YIJS 3R5AA 1NEEA 5A8KB 2CJAA 4JI3J 1OMSA 3PRBA 1S9FA 1S4FA 4CO1A 1J3TA 5GAEI 3QAEA 5IT0A 5KG0A 4A8OA 1KOOA 1TL3B 1KOHA 1RLCL 4NMXA 1UGPB 2F5TX 2E29A 3NGSA 4RW4A 3KLFA 2WVBA 1VQ6T 2GCXA 5IT9E 3NY0A 1RQ0A 5K14B 4CO5A 3GIKA 3CXCA 1U24A 3S6EA 1T11A 2R7QA 1M2VB 3CBOA 4MIAA 5LJ3g 3T5LA 1YQHA 1LW2A 1BI3A 2PN6A 3K5LA 3IAM9 4PWDB 4JI4J 4JB8B 3D1HA 3IWXA 3DRPA 2VVKA 3V6DB 4NLSA 2E1AA 4AFZC 4HH1A 2IM3A 4L72B 3BYRA 1KLMA 1MNDA 1RAJA 4K4XA 4CC7A 1MGQA 1I3OB 2RF0A 4LF5F 1UJ0A 3LW5C 2JZ5A 3LP1A 2ZVIA 2LEPA 2DT9A 3L09A 3IS9A 1UW4A 1Q82R 4K0KJ 3RERA 1D0ZA 1D1CA 3QIIA 5GAOn 2AW0A 1WA7A 1IHWA 1KONA 3TJ9A 4DR6F 5ETTA 4A47A 2FHJA 3M8YA 3PIOQ 4HCKA 5J39A 4CRJA 1FRJA 1BB9A 3HT3A 1QP2A 4EBCA 4PG5A 4J9CA 3ADAC 3TX0A 1XMOJ 3ULRB 4WKRA 3SYZA 3JQKA 3D0HE 4NLYA 1PWTA 4O3OA 2CUYA 1TK8A 2KBTA 1UEUA 3IBCB 3UVJB 3Q8PB 1T0HA 4PJOB 2IVMA 2C3PA 1WUUA 2BACA 3ZFJA 2EG1A 1PYTA 4NWBA 3HRTA 5GAMg 3R7BB 3T1YF 5GMKe 3NPFA 1P8GA 1S6QA 2RHYA 4JRQA 5A6PA 3E2EA 4ZPTR 5J2PB 3M7VA 3CPWA 4Q0BB 2AYGA 5I2SA 4ZLJA 5J2MB 2YKAA 3OS1A 4XPEA 2KU7A 2GC8A 3MR7A 1VQOA 2RKIB 3P5BP 4I6AA 3TVKA 3UD4P 3PKYA 3X20B 1ZSZA 4P73A 2RI3A 2X9HA 3MM6B 1TL1A 1J2VA 2WZ1A 5L8RC 2FLLA 1YIJT 3UDVA 1M90T 3GJQB 3FFIB 1IRXA 1U3OA 3JCMQ 1YJNT 4B9MA 2XMJA 3EGNA 2EGAA 1IKXA 1R8HA 3EM1A 3S8SA 3R5GA 1HNVA 2RDIA 2X3GA 3CMEQ 1PYSB 2VD3A 3S7RA 1Q8BA 1S79A 2MQLA 5HMZA 5K20B 4DQIA 2BUNA 2WSFE 2LP5A 2QA2A 2YUOA 2XNRA 3CTRA 1LOUA 3FZBA 4L73A 3GIBA 1Q0NA 1RWPB 2D3OR 4Q7AA 2CP7A 4J6YA 1EKSA 3D1QA 3MPYA 4IUFA 3KJFB 4WFNQ 5D6YA 4Z88A 4K2XA 2QZ8A 4H4OA 2M9UA 4NEZA 4OB3B 1Q7YC 3FDRA 5LM7E 3OTOF 4JI0J 3OL7A 3PV8A 2J7UA 2CJ9A 4RBUA 5HP1A 1WORA 2XY5A 2CNKB 2A2CA 4DPYA 2CPEA 2A2DA 5CABA 3FDSA 4XDDA 2HQIA 2LDIA 4WE1B 3RJMB 1KQFB 2QLFB 3OR1A 2ILZA 3H0PA 1N5TA 2MPXC 4OMLA 4FNHA 3D9BA 4DR5J 2JVVA 1IJFB 3C19A 2A3LA 3QFHA 2ZGWA 2QTVA 2EKNA 4RBVA 4QPXA 2H9ZA 3HP6A 2HQ3A 2IDLA 2B3TB 1F9FA 4X1VA 1GMUA 2DBMA 3RUBL 3JCMd 1WDDA 3R5CA 4FPRA 3KFVA 1Q78A 4YN3B 2Z4PA 4O4GA 1Y0MA 4M63A 3MFHA 3TX8A 5CYMB 1IBLJ 3HHLC 1P92A 2K79A 2OPPA 5LJ3j 3QT6A 3M8PB 1RAOA 2CFXA 3D2WA 4C92E 1F60B 1PAEX 4Y2MA 5L1LA 1RA7A 2HK2A 1GCPA 1LNXA 2CDRB 1Q82C 3K5MA 4LF4F 2MKHA 4ZTFA 4HT9A 4F14A 1TZ0A 2C3UA 1UL3A 1IBCB 1RT7B 5J2QA 2JS0A 4LRAA 4ID5B 4RO0A 3RU0A 2AKKA 3HX9A 5IHIA 4UOFA 1U2FA 5KFWA 4CH1A 3RESA 4N56A 4C0DC 1FJGF 4HT5A 3N01A 4CIOA 3GFYA 2RJFA 5B09A 3NKYA 4LDWA 2OJ2A 2P6TA 2WBRA 2B4UA 2AEMA 5D6GA 2DERA 1LWFB 1NK4A 2XY6A 3OA6A 4J83A 2H5JB 5F0WA 2ZHOA 2G2ZA 1OQ6A 3CD7A 3KG1A 4FVCA 4HHHA 4DR7J 3L2ZA 4DX6A 4AUKA 3RAXA 3TQEA 4XAXB 2LLZA 2F63A 2DIUA 5DG9A 1NJZA 1LJOA 4NLDA 2EBEA 3KJNB 2CH4W 2I5JB 4PLIA 3FSXA 2K2MA 1UECA 3CCMA 2QTWA 2QLXA 5GAMj 4KRWA 3HVTB 4ZVTB 2IMOA 2KXCA 5HSPA 1QLNA 4PWUA 4JRIA 1WHXA 5GJWB 4DR1F 2HG4A 4FT2A 2WW8A 1FKAF 1M1KT 5GANg 5B0AA 3A8IA 4YP3A 2D74B 2AYEA 1W4SA 4Y6IA 1HFEL 3AY0A 1ZAXA 4ZJQA 4CC4B 4KBIA 2RK1A 1OYEA 5CZXA 3KLVA 3F0NA 2KXNB 3O8VA 4ME7A 1RB0A 1RKJA 2QDYB 2OSQA 4ED5A 3HHLA 1XR6A 3QQCD 2YH0A 2Z2YB 4OI0A 4M5MA 2COZA 1JXEA 2GIFA 2W9BB 2KDOA 3HXMA 3JCMb 5J2NA 4A8KA 4G1QA 2J05A 4M7DD 1BIAA 1FRXA 1X5PA 1HHSA 2CIMA 4D8KA 3CCSS 2QQ9A 1MMNA 4I0WA 4ZPBA 1S99A 5AXKA 3EWGA 4FBTA 1CJVA 3UDCA 4CRIA 2QIFA 2CZ6B 3QLHB 4RW8A 2NXCA 1IO6A 1REGX 1A7GE 2BOPA 3MMAB 2BZ2A 1S1UB 4FXWA 1I6JA 4WFXA 5D4NA 4WU3A 3EPGA 1HMVA 3S3MA 2B5JA 3L7UA 4QVCA 4KGXB 1FK9A 2DBBA 1JKHB 2VA2A 1Q7YU 4LF7J 4CO0A 4QYZJ 5EX3A 3REAB 1I94J 4C98A 3T1HJ 4HDGA 2DK3A 4NI2A 5DG8A 5IHKA 4DV5J 4ZVFA 5ETNA 3G9CA 4Q2LA 3BSNA 1BYMA 2DXEA 3PNIA 3CC4A 3EPIA 3TANA 4F50A 4B3MF 4MYUA 1UWBA 1VQ9A 5KG7A 2DR5A 2OAUA 4C11A 4IOAQ 2ZOGA 4ED7A 1LQ9A 1KSWA 1MROA 2CSIA 2XKOC 3BO4A 2MI6A 4LJMA 2EW9A 4LUDA 4RUCA 2BJ7A 4B9SA 1S0OA 2E64A 4C5HA 5BXIA 4HHJA 4NLQA 3LPEA 4OMPA 4PJNA 5LJ5g 2VZ9A 4HEA9 4NOHA 5GAOq 3KUGA 1OV3A 5KFLA 5KH6A 5E3QA 3BF4A 3I55S 1K8AR 2RE1A 2ZPEB 3VYGA 4YFUA 2VASA 1Q82U 3M30A 4OYMA 2P6SA 2Z58B 4F8RA 1KHIA 2HAFA 1M90R 1S9GA 1KQ1A 2P8IA 4M7DG 1VYUA 4ANDA 1D3BB 1TL7B 1JMTA 3H5YA 4X64J 2DD4A 4Y65A 3X28B 3IN5A 4USVA 3OYMA 4O0NA 3EFSA 1TV6B 2FJVA 2XMTA 5F8LA 4J37A 5DLFA 3I87A 5B0FA 2WSEC 1VQ4Q 1ZA1B 2FZKB 3DLGA 1HSQA 1OPIA 1T95A 2BE9B 5D3GB 4J9OA 2YKMB 2Q43A 3VAKA 5EWGA 1BUXA 1W2BS 2RUGA 4BI4A 4K11A 2LT4A 3N6NA 3A8MB 1X4HA 2E7VA 1TUDA 1DJ0A 1AWJA 2J0QD 2A28A 5DM7R 2WTFA 1QSSA 2DXCA 2QG9B 2ZBPA 4DQQA 3C6UA 1K73R 2DYAA 2M5YA 3BDPA 3VWSA 2GBQA 4A8WA 1CPZA 2YX7A 2FRYA 3A8OB 1KFZA 3ZTQA 2B9EA 1FMWA 1RT1A 2XHWA 1PG5B 2ZWPA 2D3O1 4JI8J 2B51A 1APSA 5IT4A 5GANj 2VG7A 3HP9A 2V0NA 1KNZA 3JSRA 2XO6A 3O6QA 5IWAF 1E6VB 3WQPA 4F7UG 1VJQA 3M54A 2COLA 3QBCA 3Q1JA 1Z9ZA 5A0LA 4Y91A 3QPIA 3L3CA 2DHAA 4C48A 5KYUA 2NSBA 2R4FA 2VHGA 4BDYA 2QQAA 2OTJS 4J9LA 2MQMA 2RVJA 1NZAA 1YBYA 3OYJA 1SUQB 1QCNA 2ZKUA 2UZAA 3GSIA 2VU5A 1BE4A 3KLGA 3CCUQ 3M8QA 3DOKB 3MM8A 3SV3A 1JJ4A 3CD0A 2MZTA 4BDPA 2V2QA 2C0OA 1CS4A 5KFAA 4P71A 4DV7J 1N56A 4V2SA 4LF6J 2J9DE 1T03A 4B3TJ 3GPLA 2N3OA 2YY3A 4NRUA 2N3LA 4F16A 1VA7A 4A8SA 1JLFA 2QL7B 2NZ4A 2YWWA 2G4BA 2FTRA 3IA0A 5DM6Q 1H73A 3LP2B 4DL0C 2X1GA 3TWZA 3V4IA 3KLEB 2NPIA 2EK1A 2DIGA 2O4XB 2P9GA 4CLWA 4II1A 3C15B 1CG2A 4DL7A 2CPJA 2XI9A 3MPUB 4AFFA 2V8DA 2MF2A 1RTDB 3ILLA 1IBMJ 2OKQA 3RBXA 2AQ4A 3TAPA 2MTLA 2FVRA 2XY7A 2ZNZA 4RU9A 1U6BA 1KVJA 2H3EB 1G1XA 1RI7A 3PIOA 4DS5A 1K47A 4R8UA 1U1MA 3ZC4A 3SSRA 4B02A 2A6OA 3NLCA 3JRZA 3TUIC 5EN1A 1V6HA 3L2UA 2W4PA 2OEJA 2Y3YA 1OU8A 3CCQQ 2JOQA 5B7WA 3MR3A 2ZC4A 5LJ5j 3M9QA 5MAOA 4OYXA 2E9TA 1JLGA 3VTIA 2CNOB 1HQUA 2UVVA 1ZAWA 1M90C 3DLEA 2EC0A 1VBZA 3UI3A 1NXIA 2LQWA 4MKVA 3SDEA 1T3LA 2FL7A 4TYBA 2ZDOA 2PA3A 2K5LA 4RL1A 2AKLA 1PILA 3IXQA 2VJUA 1I81A 1ARKA 2CUBA 1S1WA 2VFSA 1HPZA 2BM1A 2M88A 2HHPA 1VIFA 2EQKA 1QVFP 4P2SA 4F2RA 4USUA 2H1YA 2BZ8A 2PC6A 3C2PA 3QIDA 1UGRB 4MH8A 3HFOA 2YX4A 3SDZA 1OJ4A 2OTJT 1GFWB 1NK8A 1YN8A 2OD4A 2PIIA 1NSQA 3MXHP 2XLKA 2OFHX 4X4QA 4LFBJ 3AT1B 3ASKA 1YBTA 3TOQA 2Y0BB 4DUYF 2AU0A 1BY9A 1JBMA 2LC4A 1YJ7A 2YNHA 1DTTB 2B6AA 3K89A 4WU2A 3L4BC 2KI2A 5GMKj 1IBKF 4HLBA 4M75B 2FRWA 1PJ6A 1YRTA 1WYXA 4CZCA 1ZYQA 4DR3F 4AFUC 2BVZA 2DO0A 2VG5B 1M30A 3CMEA 3PZPA 2UXCJ 1RTHA 3G6YA 2W7PA 1SCJB 1D1BA 5KG2A 1T02A 1UG1A 3V6JA 1G83A 2HBWA 3ZZUA 2BKNA 2GJFA 4FBUA 3K5OA 2PMZD 5CA5A 3F44A 4EWTA 1NDLA 3M56A 1U09A 1UPPA 1N6QB 3QRQA 3T6JA 2DNKA 3NGRA 3WXMB 3LPYA 4X66F 4M5IA 3Q8RB 1EX8A 2B4PA 4C6AA 4OFZA 1NE8A 1RT2A 2F7VA 3CEDA 3QBYA 2GVZA 1L3UA 3M6WA 3SSQA 1X6GA 2HRUA 5FDLA 4J9RA 4KV8A 1F0XA 2WVFA 4PPDA 1X5SA 3GV8B 1T0JA 4KB7A 4PJOD 5IHNA 2CWKA 5CXTA 3TUPA 1F5AA 4PAAA 1XTDA 4XQ3A 3V8KA 5CAIA 3CJKA 2F3JA 4PFPA 1S7IA 4AXJA 4MDWA 2V8VA 4OJGA 1H38A 3ZEHA 4IUVA 4IKAA 4Q8FA 2HHUA 2AT1B 3PVLA 2VODA 3U23A 3CW2C 4NL3A 4BB7A 3LX7A 1YJRA 2CAJA 3K8VA 4TY8A 4E7LA 3MI7X 4YHHF 4IQMA 2YVSA 3JAME 1K0XA 3H2VE 4IH7A 2MSSA 3DRSA 1S1TB 2DPIA 4O5VA 2DGWA 1Q1KA 1VS3A 4NLVA 3JCMf 1UEKA 2KRRA 2EYXA 1W70A 2WSCC 3OR2A 2ADCA 4PG7A 2RA2A 2L3MA 1GTHA 2V8HA 4ZCMA 4M7DA 3CCRQ 1S72Q 2VPYB 2LNVA 1IR1A 5CCLA 4KRTA 4OL8A 3BN4A 5F8MA 3SXLA 5K8PA 1RCOB 3H2UB 2VQEJ 2DX1A 3M53A 1IGUA 2E6NA 1YJWQ 4LT6A 2CT3A 3GFZA 2NUPA 4NE9C 1UB4A 3GILA 4IOBA 3META 3CCVS 3ZZZA 2IBKA 2CQDA 2JFDA 2V94A 1QE1B 4JLGA 3MKDA 1WOOA 3AD9C 2L5QA 1OO0B 2I9SA 2MZRA 4QR1A 3KLHA 3GZ7A 3A98A 1KR4A 2BJ3A 1K8AU 3S01A 4LD6A 2QSWA 2ZVSA 2XQCA 3VYHB 5I3PA 4WTYA 1M90U 2VONA 1NPPA 2FYXA 2ZM6F 5HQ8A 4JV1A 4DG1B 1WF1A 4NEYA 4YR3A 3HJFA 5F41A 2E3IA 4D8DA 3W5ZA 1KKHA 4LUBA 5E41A 2CZVC 2IIHA 1AUSL 1FERA 2H5IB 2FJWA 4DFMA 4JOUA 1PRMC 4NA1A 2H5EA 3GCXP 3NP5A 4PJOG 1H641 5LXYA 3CMET 1AHJB 1LFPA 4NYZA 2HYIB 2OH2A 2BV3A 3OBWA 2DPJA 1TKZA 4RW4B 4IG0B 3KLFB 4DA4A 5IT9Y 4KHPJ 5FRMA 1YITQ 1NH7A 2WVEA 5GAMd 4WJBA 1FX4A 2H51B 4F7UA 3C16A 3MOZA 4NYPA 3CC2A 3PW4A 4FYDA 1JQQA 1TTHB 1GCQC 1ZZNA 3M2UB 2ZE2A 1LW2B 4M7AC 5K8NA 3EGZA 4YR2A 4N4GA 3DMJA 2WB4A 1JX4A 2V1QA 3DRPB 5KFZA 3OJUA 1HWIA 3D68A 1R0CB 3AOCA 1KLMB 2ZBRA 3OW2R 1MUZA 1YSJA 3LGMA 4TU9A 1K73U 1KHWA 1X2QA 3R6OA 1EKRA 3EYZA 2E7XA 2W2PP 4NLPA 3MCOA 1K9MT 1P1LA 5IC4B 3T5JA 1NB2A 3IS9B 4P9SA 3T1AA 2RHQB 3ICLA 4BI3A 2RS2A 2DNRA 1UVLA 2XZTB 2V34A 3K0JA 4IUPA 5D7UA 4ZPDA 2R7TA 4G3IA 2ZH3A 2KM8C 1WKJA 2HMAA 1NZ9A 4MZTA 3DHXA 2RMLA 5KFSA 3D7SB 2P9CA 2RQWA 3QMQA 1UEBA 2R8JA 4ECWA 1UHCA 2XGPA 1QAIA 1UMJA 5KFKA 1W2BR 2F1FA 4B3RJ 2M3DA 1XJWB 2DTJA 5D15A 2HZCA 1Z2ZA 3Q8SB 4MJKA 1YJ9S 2WVCA 1U4BA 2F5KA 4DOVA 4NCBA 1PJ7A 4P72A 2AJFE 3G71Q 1OWXA 1AXQA 2HGMA 2LVMA 3RKYA 1SHGA 2FGCA 1JJ2R 4EMGA 4AMCA 4FS1A 2YDLA 1NLKL 4AL5A 4W90B 1LVKA 4NYOA 2FVPA 3LA0A 5CHCB 1YI2A 2POKA 4OGEA 3QJ6A 2CPFA 2XTJP 3G82A 3F70A 2M51A 2BJ9A 1CULA 2XICA 2NXUA 3ET6A 4DJBA 1N34J 1WG1A 2XLJA 2J06A 4ZVUB 3QO9A 1S9EB 1IKYA 2N4CA 3KFWX 1NJWA 2LQNA 3D5MA 4ZDNA 4LIWA 2HSEB 5I2MA 1IKXB 1TUVA 2RO0A 1OY9A 1QWFA 3D6FB 1D0EA 2MKSA 4OI4A 1CJUA 2A18A 1YBUA 3H6ZA 3QWUA 2HNDA 4PCQA 3CE8A 1S0VA 1NLOC 1ZUUA 3VZHA 4NRTA 5A2QU 2CJXB 2LYVA 3OS0A 2FHDA 4OP0A 3OXFA 1H3HA 1N8RR 3ZTOA 2JEIA 1S12A 4OI2A 3HSBA 1XNRJ 4KE5A 3F73A 4ZP7A 4ZVQB 1RKIA 4I7FA 1S76D 4MZMA 1NNDA 1Y9OA 1FWZA 4PG8A 1KQ2A 4JI5J 4TN2A 3I4PA 3QKJA 4X34A 1PSDA 1M5VC 1FRLA 3A8EA 3BBFA 4P2FA 4X65F 3QWXX 4N76A 5HP1B 3H4DA 2MYFA 1KBRA 1ICEB 2HWIA 2DCUB 1KQSS 2HS0A 3CUNA 3OYBA 1Q5VA 1RT4A 2ZD1B 1RU1A 2ZC3A 1RWKB 1CKBA 5E7OB 2QJ3A 1D8YA 2HAIA 3CPWP 5KFOA 4GVBA 2NYIA 4JPBW 1B0PA 4C0HA 2FHMA 2EKYA 3CWJA 1VQ4S 4OYIA 5HVFA 1FD8A 1FWPA 3INZA 1N5QA 1HNZF 4DEYA 2HWTA 1G3WA 1AZSA 2EYYA 2K3IA 2MKYA 3FCHA 2XGQA 1JJCB 3C0CA 5FWBA 3QDRB 1H72C 3MUVP 3CCLA 1PO6A 2E1CA 5LMUF 3R7NB 2I0NA 2J76E 4O4GB 4JYAJ 4K5RA 4QR0A 1U0SA 4C92F 4JI7J 4FYXB 2DNHA 4KR0B 3CJ5A 4EMKC 1SL1A 3RBDA 2JJ9A 4LE9A 4C8QE 1FX7A 4RR5A 5HBMA 1NHVA 5FU7C 2GQVA 3OFEA 5GAN8 3V6KA 3BGRA 1GEHA 3J80E 3QSUA 2R7UA 2Y4YA 1RAHB 2HVEA 2GQCA 2MYSA 2C0TA 1BQXA 3EH1A 3EJMA 4R25A 1NU4A 3JB9k 4DSFA 2F2WA 3ISZA 1U25A 1GL5A 2WHOA 1GXIE 5J2QB 2UXDF 3DHWC 3CC7S 2CZ4A 1YRUA 5DQIA 5A8KA 5KG5A 2QQRA 1VHIA 4EYIB 1X4CA 2JLGA 4M78C 4OV1A 3RB0A 1X27A 1FTCA 1GMWD 4M7DF 2DJQA 1VUBA 1HD0A 2V9KA 4AL7A 4DQ2A 2RQTA 2FB7A 2JSXA 3CCUS 4LDUA 3LH5A 5K14A 4ICLA 4F4YA 4DL3A 4J91A 2DTOA 5H9EJ 4IFYB 2MKCA 5KFJA 2DNYA 5GMKa 4P52A 3T1YJ 3DDIA 1P27B 2YX1A 2DE0X 2J7IA 3K2YA 2PVOB 2DYIA 1H7XA 5DDPC 1I5LA 1DAXA 5J1NA 2FLPA 1FKOB 4PG4A 4R56A 3HHDA 3KMQA 2DXDA 1G3YA 1ZETA 2EWNA 4TLQA 4RZRA 3V8JA 1VQPS 4RTTA 4IUUA 4UOHA 3Q86A 4DSJA 2NS1B 1VQ8Q 2B7CB 1TS9A 1RHRB 2BANA 2RB7A 2KB2A 5CVIA 5HQMA 3FCWA 2DNPA 2DJWA 4FU6A 3AHUA 4U7UK 3I5RA 2F8EX 5J1EA 2DNMA 3PG9A 4OX6A 2FVCA 2RQUA 7FD1A 4Y92A 1VQ4T 3HHLB 2JNGA 1QY7A 4M5JA 5FLXE 3G4SA 1SC1B 2AEJA 3AFGA 2QLJB 3I55A 3OW2A 1UHFA 4EI2A 4G1QB 4JRKA 3OYLA 1NHUA 4PJOA 4DZDA 5T14A 4ECUA 5CYQA 3V2UC 1WEYA 2DY1A 1CJVB 2FVSA 3DB4A 2HKNA 2PNIA 2HQGA 2U2FA 3CCQS 5I3UB 1N8RC 6FD1A 1JLQB 1MV0B 3UE2A 5J2PA 3OTOJ 1TL5A 2VC1A 1K9MR 2B43A 1HMVB 4WCIA 4C0DB 2B5JB 5KG4A 2QEXS 4PR6A 3S3NA 4C97A 2DKGA 3VGVA 2DO3A 1WOSA 2OPRB 3G6XA 1WNEA 2EI5A 1BLUA 4J9KA 4XK8C 4DDFA 2DHXA 2UUWA 3MEDA 1WD6A 3GIMA 3RIRA 5LJ5Y 2B9YA 1SSFA 1YNZA 2M4MA 1VYAA 4JS5A 2VPWB 4NXMF 1KD1T 1KVIA 2D9PA 1SH3A 4NI2B 1K9AA 1RHJB 2LKZA 2GNKA 5IC6B 3CC7T 1UE9A 2L0AA 2GW8A 1KC8R 2AP6A 2P9EA 4QYRA 4DF8A 2MQPA 2B8QA 5DS7A 2DLPA 2Q6CA 4KGMA 4LSLB 4J9IA 1Q81R 1UWBB 3UNGC 4ECQA 3NWGA 1JJ2A 1URNA 3DXSX 3CCUT 3ILOA 4PQAA 2IMWP 4ZP9A 4OI3A 3KDNA 4C11B 5GAHU 4NZ6A 2IRXA 3BR9A 3BPSP 3C14B 1HWLA 3P45B 1BC6A 4O3NA 2Z0GA 5ETOA 4DL2A 4UQTA 3EGVA 1GT8A 2A6MA 2E41A 4E7JA 5L23A 2MHNA 3ULHA 2B8AA 2CQBA 4G6VB 1VRUA 2KI7A 3GWCA 4FYVB 4ED3A 2DVEA 3IWNC 1PNJA 3H0IA 3HVRA 1VQPT 4E7KA 4DFKA 4ELUA 1SI9A 4YTLA 4M77D 3M30B 4WE1A 4CT8A 4ZNXA 1S9GB 3OMCA 5LXRA 4XU0A 1FJGJ 2JT4A 4ZK7M 3HJVA 3OQ5A 3G6EA 4O3RA 4BACA 2KFZA 4ZVEA 3RG6A 4LR9A 5BR8F 1EFNA 2XIDA 1PC5A 2HURA 2A0FB 4HKQA 5AJ3F 2J6FA 3URGA 1WHKA 3OSVA 1M5OC 1YHQQ 2L08A 4N4HA 3JCMh 3EXCX 2FIUA 1SJ3P 4DPTA 2Y4XA 2SRCA 2LA4A 3H7HB 3EGDB 4LRDA 2WSFC 3BFMA 4ITSA 3C66A 3CCQT 3UPUA 4OHXA 3BKUA 2HKEA 3VGSA 1X0FA 1SPBP 4M75D 1VRTB 2EQUA 1N5VA 5F8GA 4DSEA 1Q79A 3A12A 4OZ0A 3CCRA 3AJ1A 1S72A 3C6UB 6FDRA 3QSYB 1IGQA 4ZA1A 2V2ZA 3RDVA 2QEXT 4DQPA 3G8TA 3CMAQ 3BGLA 1KTQA 1AFIA 5JMNA 3HL8A 3KDOA 5I22A 2BE7D 1T3OA 1WC4A 3MCNA 2QA4Q 2XC9A 2D69A 3PO4A 1RT1B 4DL6A 2Y0SD 4IRDA 5LT5A 5LJ3f 1UFWA 2OFGX 2RILA 3PXGa 5D6WA 5KFYA 4OX9J 2C2DA 2VG7B 3CCJQ 1QCOA 4BD3A 4DBRA 3MOJB 3GE9A 4ANCA 1VC5A 3SEMA 3HHKA 3UN2A 4J6WA 1VISA 1R89A 3FBCA 4ZN1A 2EFIA 3MMBA 3GCWP 1LWFA 5KYUB 4DMZA 1U0HB 1YJWS 4KH1B 3CIMA 1JLAA 1V3RA 1FMVA 2HNYA 1TAUA