1PG5B

Crystal structure of the unligated (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
148
Chain Sequence
MVSKIKNGTVIDHIPAGRAFAVLNVLGIKEGFRIALVINVDSKKMGKKDIVKIEDKEISDTEANLITLIAPTATINIVREYEVVKKTKLEVPKVVKGILKCPNPYCITSNDVEAIPTFKTLTEKPLKMRCEYCETIIDENEIMSQILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate carbamoyltransferase
publication title Crystal Structure of T State Aspartate Carbamoyltransferase of the Hyperthermophilic Archaeon Sulfolobus acidocaldarius.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase
total genus 32
structure length 148
sequence length 150
ec nomenclature
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
B PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 1pg5B02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 1pg5B01
1RADB 2ATCB 2HSEB 2IPOB 8AT1B 1TTHB 4AMCA 9ATCB 1TUGB 1RAFB 4KGVB 1SKUB 1D09B 1EZZB 1ACMB 1RABB 2FZKB 1RAEB 2AT1B 5AT1B 7AT1B 1RAIB 1XJWB 1RAHB 1ZA1B 1ZA2B 1R0CB 4FYVB 4F04B 4KH0B 1R0BG 4FYWB 2QG9B 2FZCB 6AT1B 2AIRB 2YWWA 4FYYB 4WTOB 2BE9B 4FYXB 3MPUB 3AT1B 1AT1B 1TU0B 8ATCB 1F1BB 1RAAB 4KGZB 1PG5B 4AT1B 1RAGB 1NBEB 2A0FB 1RACB 2H3EB 4KGXB 4KH1B 2QGFB 2FZGB 2BE7D 1Q95G 4E2FB 1I5OB 3D7SB
chains in the Genus database with same CATH superfamily
1WFWA 1MMGA 4DQSA 1ACMB 2COLA 4O0NA 3DLKB 1RWUA 1SQEA 1HHSA 4PUOB 5EDWA 1ZBXA 5IM0B 1UVJA 1X75C 2K1RB 5AJ3J 1AWXA 2ZPHB 1UGQB 1N5YB 2FLPA 1C0UB 1YCSB 4JV1A 4PL6A 1RT2A 2HZYA 3BO4A 1RB0A 2WW8A 5I11A 2B9XA 1GMVA 3HRTA 4UC4A 3IRXB 1RT5A 2K3KA 4O23A 1WHHA 4M75G 3HHTB 1FD8A 2W01A 4EMKA 5J26A 3QIDA 3NBPA 1T11A 3RYLA 2KXCA 3NGKA 2NWMA 1Y11A 4O3NA 1Y71A 2V0NA 2J76E 5J1EB 4FS1A 3ZXWA 1RSCA 3EFOA 2KYMA 5EC7A 4P73A 4AG2C 3EHRA 4C92B 2HG4A 3I56A 1MWZA 2LP4A 4RBTA 2HFZA 2RHSB 3E9GA 2HZAA 2IAJB 3VV0A 4AXJA 4NLSA 5ETTA 3JCMQ 2MQLA 5AXKA 3PNWC 3J80Y 2UUBF 1AFJA 1FXLA 3OBWA 3H42A 3QGHA 5C24A 4PLIA 1HBNA 3GJSB 1X4BA 3JTOA 2XEXA 4ECUA 2FRYA 2XSJA 1D0YA 4JZ4A 1RLPC 3GPLA 5D78A 4ZNXA 3MM5B 2E10A 1PNJA 3KNGA 3OSNA 1S1WB 5KFGA 4QQBA 3BBFA 4BBYA 5CQYA 3KOAA 3ER0A 1S1XA 3QT5A 3X20B 1HQUB 4DG1A 4KHPF 1TVRA 3OW2P 4LDXA 2DKOB 1J5EJ 2WSCC 1TV6B 3GFHA 1JX4A 2F5GA 2UUAJ 1LWEB 5AT1B 1XBWA 1FK9B 4M7DF 2ZBQA 3EGXA 4Q2MA 3GBQA 4OZ1A 2GHVC 1FRLA 4DR2F 4DPUA 3LYIA 2JC0A 1F60B 2QV6A 1DQ9A 2WVCA 1GXIE 3SSQA 3HVTB 5KYXB 1Y9OA 4ECRA 1CJKA 1N5TA 2L0AA 4J6YA 3OFFA 4MFBA 3W2VB 5ETNA 4LQ9A 3IBFB 1K44A 3H4BA 2MWOA 1G3WA 1RTHB 1PC4A 1TOVA 3CCLT 5IT9U 3CCLQ 2HD0A 2IYIA 5GMKj 2R8IA 3EZ5A 2ZZDA 1E6YA 5K8OA 4ZOSA 4C6AA 1D3WA 2V2KA 2MJNA 3D6TB 5GMDA 3RB6A 3Q83A 3V6DA 2C2ZB 3QWPA 1PKUA 4PJOE 2FL7A 1SH0A 2BJ3A 1VQLT 1N0VC 3GIBA 5LOQA 1SC3B 1VQLQ 4TY8A 1YZ6A 4MKAA 4TLRA 4A4HA 2EQIA 1WTFA 4IDKB 2XO6A 1M0SA 3K5OA 4Y91A 3CXCP 2AJ2A 3IGNA 3N6MA 2OEMA 4YHHJ 4PJOD 4ECSA 2F4VJ 2EW9A 2P6TA 1P8GA 4ZHRB 3R6LB 4KPYA 2HAIA 2E5QA 3H59A 2OSRA 1BCOA 3GP8A 1WXBA 1MG7A 1WDXA 2MZSA 4I68A 1LK7A 1RT7B 1UGRB 2R8KA 3TP2A 1UP1A 5M2PA 2FYXA 4QYZK 4C8ZA 3RW7A 4DQ2A 2BA9A 3OTEA 1VQLS 1IGQA 4M75F 3CD6A 3I0RA 3MMBB 2YNFB 1HBUA 1AT1B 5T41A 3BM7A 1TKZA 3PTAA 1XN9A 4GC6A 3AQPA 2KZZA 3SBMA 2D69A 3QIPB 4CRJA 2A36A 4DFKA 2CDQA 1B07A 3MCAB 4C92C 1YRTA 3VGUA 4BY6B 4N77A 1NM7A 4C8NA 3L2UA 5FWBA 2YY3A 3FZ2A 2LP5A 1N8RU 1YFNA 1NZAA 3JSBA 4F0HA 2Y1LB 1KP6A 2A1BA 2CA9A 3ADAC 1DY3A 3BO3A 5LMUF 2E1HA 3S3OA 1VQMA 4YS2A 1TG0A 4C0ZA 1ZSZB 5D3GB 3CD7A 5C42A 4D3GA 4OV6A 4OFZA 4DL7A 1NNDA 3M6XA 3N5BA 5KFUA 3U02A 4RG2A 1C1CA 4XTWA 3W5ZA 1H72C 2KVQG 1UAWA 3CBMA 2K3IA 5LSRA 2MKHA 4B3RJ 3L9ZA 2W9BA 5IT9E 2RRBA 2BX6A 2UUCF 1SPBP 2OFGX 4DJBA 5K8PA 1TK0A 4MIWA 3ZTPA 4XTYA 1B99A 2RKIA 2ESWA 4HEA9 4I6YA 5HP1A 5F8NA 1FERA 1PSEA 4ATOA 4BE0A 1KD1U 4GKKJ 4M7DD 1UEVA 1WF1A 3OYDA 2JHEA 4RTTA 4C3MA 1U1LA 2DXEA 3OSPA 5H9FK 2PVGB 3WZ0A 1TWBA 3NTHA 4DLGA 3A3OB 2ZZNA 5CQGA 3VS7A 3OA6A 3QJJA 4DFJA 5KYWA 1Q7LB 3T5LA 2IY5B 3D0IE 3MURP 2Q6BA 1K0XA 1GMUA 3HD1A 1N6AA 2YUNA 3AHPA 2RD5C 2C1EB 2UVVA 5BJRA 3PW7A 3N28A 4C97A 1HWUA 2YNIA 2QMXA 2K2VA 5J1PA 2K3BA 2ZDPA 3LW5E 3FNNA 5J2NB 3WX8A 1I94F 2PMHA 2JVVA 1M90C 2DXFA 2DF6A 3HPOA 2KT5A 4KB7A 4RNFA 2FQQB 4GKJF 1UGSB 3BDUA 1J5OB 4F67A 1YK9A 3DLLQ 1PBUA 3OSVA 3ILOA 3SFGA 2L2PA 3V4IA 4WYWA 2B0GA 4AG1C 4B3MJ 2CP6A 2RB7A 3TA0A 2ZM6F 4RW7B 5LXRA 1F3VA 1SVDA 2E1PA 1KQSS 3TQEA 2EJGA 1U1MA 3IR7B 2NQPA 2Q3PA 1UHFA 4KIAA 3IS9B 3DOKB 1NKEA 4HVWA 4DEYA 4PJOB 3VAHA 2NPFA 5IFMA 2CADA 4QWBA 5GAGU 1LCKA 3GIJA 1EJ7L 4TQSA 2M52A 1W1FA 3N4WA 1WUUA 3SDEA 5GAGI 1VQPA 2E7WA 2VA2A 2HFUA 1DLOA 2CYZB 5CAIA 4E0DA 4OB0B 1JRIA 2X4JA 1SF9A 4BDZA 3QAEA 4M75D 1FRIA 5CYMB 1YLXA 2AKLA 4NZ0A 1HNVA 1TKTB 4OYBA 4A53A 4LIRA 1WOPA 4K2JA 5FU6B 3PZPA 4DS5A 2HQEA 4Q8FA 2GMLA 1YJWS 4ZPBA 2R7TA 2EPDA 3TUJC 2HWHA 1VRQC 3DKMA 4CH0S 4LUDA 1IR0A 1C6VX 3MM8B 4KV8A 1JLGB 4KY3A 1OEBA 2BM0A 2J9DE 4MTPA 4CYUA 1TL1B 1IGUA 3EVWA 4HYKA 1CQNA 2PVOB 1VQ4T 1S0VA 3EDQB 3NAIA 3OTBA 1VQ4Q 1QSLA 3V8JA 4C8QG 3HJVA 2E6NA 4OJHA 1YJ7A 4OJ3A 2UUBJ 1X60A 3SCIE 5IT0A 2ZOFA 1GXTA 4HTJA 3JQKA 5RUBA 1KWMA 1FFWB 3VS2A 3NNHA 2M16A 3JCMg 3KUHA 2R2SA 2CQIA 3MMJA 3G71A 1RXOB 4H4KA 1VQ9T 1OI1A 3CMEA 3CCMT 1VQ9Q 3CCMQ 3OYMA 1RHUB 4I0WA 3DLEB 1S6QB 2GVDB 4ZVOB 2CQBA 1B7TA 4II1A 4EMDA 1PIEA 1RWPB 1IKWB 1FWZA 4KHPJ 2HGLA 1M2VB 3ILIA 2UXBF 4P2SA 2V68A 1S9GA 2FB7A 3M8SA 2N4CA 1Y0HA 3FGVA 3OS5A 1VQ4S 3AXMA 1S0NA 2MJUA 5F8LA 1HBMA 4XU0A 1Q82T 1QVFA 1FMVA 3IAM9 3R2DJ 1KG1A 2E5GA 4F0KA 1FDAA 3OYJA 4DR2J 3HPWA 4C0FA 4HCKA 2UV8A 5L39A 2JEJA 4DR5F 2CT3A 2V8JA 2OJ3A 2BKOA 1GRIA 1U26A 4NCBA 4FM4B 1VQ9S 4HCCA 2B4VA 3CCMS 2DRKA 4TVAB 1RA6A 3MKDA 2OTLT 1D0XA 2A3LA 2OTLQ 4NLUA 3DM2A 2XCPA 1O75A 1OOTA 4IH5A 2XM3A 2C2KB 1U8RA 2MQNA 2B86A 1Y5NB 4ZGJB 4LF1A 1RZMA 5BR8J 1VQ6A 1LWCB 3BGOP 1ZUYA 1WC4A 1Z2ZA 5D6WA 2EKYA 5LJ5e 1JJ2S 1Z9ZA 2JLFA 5BYSA 5T7LB 5A8WA 1AUDA 5CO7A 3G6VA 2OH2A 3A8JA 3NEKA 4UT4A 1B7FA 5F3ZA 3TEHB 4KUDK 3DHXA 3R5GA 1HPZA 1OIAA 4F7UG 2E6ZA 2B4UA 4CTAB 2YKMB 1YZ7A 3HI9A 3ZO7A 3GP9A 4ZIWA 3MWBA 3NCQA 3OYHA 1L3TA 1RI0A 2DNUA 2MQOA 4G1PA 1V76A 5IOLA 3AJ1A 3A8HB 2RD1A 2ERRA 4GC7A 2OTLS 2HQIA 3W8PA 1T94A 4DL3A 2KBTA 2W7OA 4PJOC 4ED6A 2MSTA 2UXCF 1NLOC 2P9CA 2H54B 2KN4A 4ESRA 3KHGA 4CNYA 2LQ8A 1RT4B 2C2MB 2BJ9A 3AD8C 4X4RA 1X4EA 3THKA 1ZPVA 2QSWA 4F3QA 3DXSX 3AT1B 4OHWA 2KHDA 1KQFB 4CRIA 1N56A 4MKYA 4BDPA 1F0XA 3IM9A 1N36F 3PKYA 2Q43A 1ZOTA 4N8OA 3DMJA 2OTJA 2XMTA 1H3HA 1X0FA 2IVMA 1SJRA 1FFGB 1T0TV 1LQ9A 3MEVA 3M0SA 3D66A 4C11B 2FY8A 2VICA 2AYMA 3CCRT 3FVYA 1BYMA 4OI1A 3CCRQ 4LRBA 5IS2A 2X3WD 1YBYA 4PJMA 2FHMA 4M75B 1U1PA 1AZSA 5KFTA 5D4NA 3CPWS 2R3VA 3IM8A 5GANd 2C28A 1Q82U 5B08A 3R8YA 4M5KA 2KVQE 3WX4A 3PEHA 3L1AA 4LBHA 3WVEB 3DLBA 3NGDA 2G0CA 3JCMf 1JLQA 1NJZA 4QU7A 2D1CA 5LMUJ 1RHMB 2B3TB 4IUFA 5AE3A 3K8VA 1RWWB 2JT4A 1JLFB 2V26A 3I5AA 4ETXA 1GX6A 2ZH6A 1KC8T 2ZFHA 2E70A 2ENMA 4JI1F 2G3RA 3CCRS 2XS7A 1IBCB 4OI6A 4GLKA 3KK2A 3NNCA 1FVQA 1G3YA 2EQUA 3QRQA 1ZYQA 5I4MA 1RTIB 3NTIA 2UUCJ 4OI3A 3C19A 4IRCA 3Q2SC 3DRSB 3BEGB 4URSA 2OD6A 3OT9A 2ZKUA 2Z30B 3RG6A 1SIZA 1L3KA 2Q66A 3MR3A 1UTAA 2YKNB 2DRBA 2XB2D 1VRUB 5LJ3g 2BQUA 1A9NB 2J0XA 5CKEA 1RU2A 2W9CA 4NI2B 4OYMA 3M8PA 4NCAA 2HHSA 1XC9A 1DTTA 1BWEA 3SIPB 2XNQA 2YLCA 4EFAC 1IM6A 1T05B 1FESA 2GVZB 4WFZA 5CH7B 1WJRA 2R57A 2FPDA 1R43A 3SWNB 1X2KA 4A8YA 1DHMA 1B0VA 1G1XA 1KFZA 5J2QA 2DXBA 4FSSA 2XY5A 4FBTA 4LT6A 3NS6A 3H0IA 3RAXA 3O5ZA 1U48A 2DO3A 2FLOA 2ASLA 4RTZA 3EE3A 1T3SA 3DCAA 5IT4A 2ZHOA 3QFHA 1KJWA 4PG6A 2U2FA 1BXNA 2ZCFB 1W26A 3G96A 4G6VB 2OMOA 2G0JA 3HSDA 3C15B 4C98A 3CEYA 3PR5B 3UR0A 1I94J 1JNZB 2M7SA 4RG8A 4DV7F 3W62A 2AX1A 3OYFA 1SUQB 4GKJJ 3Q24A 2LA4A 2J6KA 1VQ7T 3Q86A 3NOGA 1VQ7Q 4X2BA 3CCJA 3B78A 3SI8A 2WOMB 2RK1A 4ER8A 4K59A 4CH7A 2F2WA 2RHZA 2ZM6J 2M9UA 2MEWA 2HL5C 4IR1A 2C2DA 5KFNA 3AXKA 3R5BA 3OY9A 4NXNF 5D15A 1URNA 3PX0A 2QA4A 5KG7A 4F8RA 3GE9A 3QZ5B 3ZZYA 5JUMA 1XERA 4DDFA 3IP0A 1Q7YR 2Y90A 2IMWP 1WHYA 4HL9A 1M4ZA 4OB3B 4MYTA 3UCZP 5F9NA 3JSMB 2EGAA 2MGZB 2CH4W 2RN8A 3PFSA 4PFPA 3QDFA 4GRSA 5KT2A 2E66A 1OMSA 3C14B 2QAZA 5GANe 3QO3A 5FRMA 2HHXA 4KBMB 2VU5A 1N8RC 1VQ7S 1SIWB 3UO0A 2M4MA 1QP2A 2HK3A 3OS2A 4C8QE 1D8ZA 1QE1A 2V8GA 4ZA1A 1RTJA 1Q8BA 2DH9A 1L3VA 4NL2A 2XGQA 1VOMA 1T7PA 4TNOA 1FRJA 4AL5A 4AE5A 2BVZA 2X4XA 3JCMh 5KFLA 4J9VA 4JI3F 1M1FA 2RQVA 3D7SB 3LF0A 2HNYA 1UKUA 4K8RA 2HEKA 4L74A 2EWHA 1GBQA 1S4FA 4C8QD 4KR0B 3C46A 1R0BG 4I56A 2K6DA 5F0WA 2XGPA 1M5PC 1F9HA 1TU0B 2K5IA 1ZZNA 2KT8A 3PIPA 4QWEA 2DJZA 4DOVA 5M9OA 2MKIA 3QZ8A 3E2UA 4MK7A 3PG9A 2BR0A 4DZDA 1EX8A 4IR9A 2JTFA 4HVZA 1WEZA 4R5PB 4LF6F 1KD1C 1BB9A 1B34B 1KSPA 2BE7D 2Y8YA 2HQ3A 2NXCA 1X8DA 1OZ3A 2YUOA 3W60A 2IPOB 3FFIB 3U7JA 1X69A 5LJ3f 1LWFB 7FDRA 2VDIA 1HYSA 2J5AA 4KKOB 2UXBJ 3A98A 3ME9A 4ID8A 4Z02A 1K8AC 3I55A 2MXYA 2RHQB 4CO5A 3CEDA 4FSXA 2A6OA 2AZVA 2XHCA 2DD8S 1YNZA 2HVEA 1YWOA 1H8KA 3HM9A 4C7QA 3RBDA 2DIUA 5KYUB 2JL9A 3CJ3A 2FHOB 4KTQA 4DR5J 1HI8A 3PR4A 3MEAA 1VRTB 3CCLA 3SWNC 2F65A 4EEYA 3MOZA 1LXNA 1IUJA 2PD1A 1JJ2R 2AT1B 2XMAA 3CULA 3S01A 4F7UE 1WHGA 2HVZA 2ED0A 4GBQA 3G4ST 4FF3A 1UEUA 4BLGA 3G4SQ 2ZPFB 5BYQA 3P96A 4CO4A 1BBZA 2KXHA 1M1KU 2OPRA 4R55A 1BI1A 1JLCA 2NZCA 2I2YA 2EJFA 1WXTA 5KFFA 1N6QA 3QLHA 4U9RA 1M3CA 1V9OA 1DJ0A 2O3DA 1URRA 6FD1A 2JX2A 1RI9A 2MLXA 2DFUA 4YDDB 3OR2A 2RK2A 3M4XA 4WZQA 1RCOB 4TKTA 1SKUB 2ZH4A 4HKQA 3V8KA 4LRFA 1UECA 4DN9A 1VC6A 1OPKA 1U09A 2H5JB 3FRNA 2UXCJ 2RJZA 3G4SS 1HWLA 3EGDB 4X4OA 2H3JA 1VQ5T 4DEZA 3OYGA 2CWXA 4C3KA 1VQ5Q 2EJ9A 4DU8A 4WZMA 1RBLA 4HDGA 2PZ1A 1K9AA 5HLFA 3F70A 1N36J 1IQTA 4DBRA 3EM1A 3SQGA 3CCET 1D8YA 3BPDA 5GAOp 3REAB 3M0QA 3CCEQ 2DNQA 1NK5A 2AJ0A 2KXFA 1JIHA 4DCOB 1WGSA 4UOFA 3ETMA 2G6FX 2DRDA 2CKWA 1TFWA 1QP3A 1UVIA 2DHGA 4UY85 2PA3A 3KUGA 2JZ5A 3I32A 4OYAA 3CE8A 2UVWA 2QEXA 1WF2A 4Y34A 3GNFB 4Y6IA 3WIUA 1C1BA 1PM3A 4M7AG 2FUG9 2HNZA 1WC5A 1E6VA 3ZZUA 3H5XA 1W70A 5J2PA 2M8HA 4OVAA 5GAOn 1HYOA 4NL3A 1VQ5S 1GT8A 1B3QA 4OJ1A 4V19J 3H5SA 4B3OB 4N4IA 4AFQC 2FJWA 1BQMA 1IB8A 2HYIB 1RAIB 5B0DA 4C8QB 3D0HE 3CCES 3GIRA 1WJQA 1FKOB 4BI3A 4B9MA 3EH1A 4PYDA 4JI1J 4RTYA 5LJ3h 3TEEA 3ZZZA 3VYGA 1IXDA 2W10A 4DV4F 4IFYB 4U95A 1RI7A 1N52B 1WPYA 1TUVA 2DR6A 4RW4B 4IKFA 1BHNA 3T9ZA 2ZAEA 1N27A 2F9JA 4PFOA 2OEJA 3ZNUA 5KT5A 1RJJA 4HR2A 3LANA 4WFYA 2XMWA 1KC8R 4ZIVA 4UOHA 2E41A 1RQ0A 2GO9A 4DL0C 4RW9B 3KLGA 1Q16B 4GVBB 5IHNA 3JAME 3E3XA 3QWYA 1JQQA 2AWZA 5I42A 2VG5B 4Y2CA 1JLAA 1NSKL 2P6SA 2J7WA 2VUBA 2VIHA 4B17A 2JWNA 1QLNA 5HROA 4E47A 1MV0B 2PEHA 3M8RA 2GC8A 1RT3A 4IUVA 1CEZA 2ATCB 2B7CB 3M9QA 3L7UA 5FDLA 1FEEA 2XI9A 3JB9k 3VVTA 4TLQA 1K73T 2XCAA 5LT5A 5DDOC 1MV3A 3PJ9A 1LKZA 2KRSA 1A0NB 5AE2A 4F4AA 3H2LA 2W2NP 1RWOB 5C0MA 2BQRA 4OB2B 1GX5A 3TANA 1WDDA 4MIBA 3MUTP 1RK8A 2ZWPA 4DR4F 1BD6A 4P10A 2RM4A 4USKA 3DLLA 1SHFA 4KO0A 1Q81U 3OTOJ 3REBB 4IG3B 4BDYA 2ACYA 4PUOA 1CC8A 1RAOA 4CI0C 5IM0A 2AHJB 2AGPA 4DV7J 3T5KA 2K1RA 3HT0A 1N5YA 4WF2A 2IIHA 2FVRA 4ZP6A 3K58A 3UDLA 4FPRA 3NPFA 3M6WA 1Y0MA 1C0UA 3AFGA 2B5JB 4F7UB 2LLZA 2LXIA 1HIYA 4MT1A 2BUNA 4B9WA 2EFVA 1X9MA 2BACA 3IRXA 2C42A 3NS7B 1U4BA 4NXNJ 2I5JB 1K0VA 1WC6A 2QQAA 2LKZA 1UZHA 4A8KA 4DEXA 4M4ZA 4OZ3A 4J9LA 2KM8C 5D8HB 1VBKA 3ZTRA 4DSKA 2VDHA 2ZBRA 2LFVA 2JFKA 2XG8A 2WZ1A 3QBCA 4O4GB 5J1EA 2CKKA 2HEQA 5KTQA 2MZTA 4D8DA 4C92A 4L59A 4UY8T 2QTWA 4X1VA 3PFOA 1KBRA 3I4HX 2IAJA 4B08A 5LJ5j 4ILMA 1Q82C 2DPPB 4IH7A 5KG6A 3H8YA 2ZJRQ 3B4DA 1VIXA 1ZX6A 3W2WB 2NXJA 2DRAA 3MFHA 2V1RA 5E3RA 1AROP 1UWAA 2F1LA 3KFVA 1VGYA 4PZVA 3BH7B 4JI3J 4ZGDB 4GO7X 2CUBA 4ELUA 5JXSA 2B9WA 1WQWA 3MM5A 2SEMA 2DL3A 1S1WA 3FB9A 3G8QA 4WXWA 3VRZA 2BJ7A 2E5JA 2GIQA 4F25A 3LH5A 3H7HB 1U02A 2XMVA 2QGGA 3H5UA 4RNMA 1RWVB 4QW8A 3P5BP 5F8HA 3VQSA 2E3IA 4QR1A 1TV6A 3AB4B 2DB1A 1LWEA 1G3OA 1FK9A 4ECTA 2MK5A 3TJAA 2AKWB 4G1IA 2YXLA 2F5KA 2JNJA 5JVGQ 4L3KA 1VMBA 1YTYA 2K7KA 4LF6J 2IIMA 4HDHA 2KFYA 4IYQA 2ADBA 3HVTA 2IRXA 1MLAA 3VHQA 1KEKA 5KYXA 1RAAB 5A8KB 4ZITA 2CG8A 1WACA 2VPYB 3W2VA 2DEUA 2M5YA 4RTVA 2O4XB 2IJRA 3NRBA 5IXBA 3PEJA 3OYCA 3P8BB 1TQLA 4WP9A 1RTHA 3B82A 2NSCA 3GMGA 4U8VA 4FF1A 2C3UA 8ATCB 2HWTA 3OYNA 4TU9A 1H38A 3ISZA 3EG9B 2BZ8A 3CCTA 3G8TA 2FLNA 1BI3A 4Y28E 1A6LA 1XNQF 2A2DA 2LTOA 1VCTA 3DB4A 2HHUA 3ILLA 2QA2A 2EQJA 3ZC4A 1S77D 5KG2A 1V3ZA 4X9CA 1S0OA 1VQ8A 5D4LA 5GAMg 2Z56B 3DOLB 3GNGA 3U1LA 2D6FA 3UCUP 3TJ9A 2GNKA 3MCMA 4IDKA 2KYZA 4FZVA 4N4GA 5KH6A 3PFEA 1NK4A 2HIQA 1BUXA 3LP2B 3GJRB 2F3JA 3DU5A 1X4HA 4OI2A 4FXDA 3PX6A 4ZHRA 4KE5A 4FBUA 3P4UB 2VXEA 3EVOA 1WSVA 3UATA 2QO3A 3RKYA 1RT6B 2EG2A 4OP0A 2RA2A 1U45A 5G0RB 2RAQA 2DL4A 1N34F 1RT7A 5DZ6A 2KTQA 4WE1B 1YBUA 3I96A 6AT1B 1XR6A 4Z7YA 2YKQA 1FDDA 3MMBA 3P8DA 3MEEA 1NM2A 1LEOA 3PMTA 2X4WA 2V94A 2YX1A 5ETLA 4WFBQ 2YUQA 3FEOA 5E2QA 1X6BA 4OMMA 2CPXA 4FN5A 3QIPA 2QZ8A 1NAQA 3H25A 3OYYA 4BWMA 5KG0A 4RTUA 1RBAA 1ICEB 3CMAS 2BV3A 3VQTA 1T3LA 4WP3A 1X01A 4M7AE 4JI7F 1WX6A 1G8XA 1APSA 4IUPA 1UJ0A 2P8IA 1R31A 5FJ4A 2ILYA 2Y3YA 2GHPA 1HARA 2Y1IA 3TVZA 3KUFA 2M2BA 4DX7A 1ZSZA 3RRHA 3TR5A 3V6JA 3O8VA 2HMIB 5LMNF 2LZ6B 4M7AD 4MZTA 1OYEA 4OHVA 3HKSA 5M2RA 2W7AA 1NB7A 2RO0A 4F4ZA 1RAEB 1QTNB 3QAUA 3UW1A 3BSOA 4IUUA 3AQOA 2LX7A 3C6UB 2D3ZA 2HWIA 3MO8A 4P5NA 2QYCA 3EG3A 2GIFA 3MEDB 4P6QA 4OB1B 4J83A 2AK5A 2GBQA 2UVUA 3LAMA 2YKPA 2R7XA 5KFYA 2HHHF 2H5EA 2RHXA 1RACB 4DV4J 3X3UA 3V5RA 3OYIA 3KLVA 1D1UA 1R8CA 4OYZA 5C6SA 2JTEA 2VWFA 3MHYA 2YH0A 4E8UA 2A10A 2VQFF 3KDNA 4R0EA 1D0ZA 5KFKA 2EKOA 4USHA 2Y9HA 5SZTA 2V2QA 4J9IA 3ZTOA 4CLKA 3OUYB 2CAJA 4Z89A 4M5MA 2IVFB 1R8HA 5EN1A 3AOBA 3RR7A 2LMJA 3OFGA 1UWBB 1NK9A 4FNHA 3S8SA 1JWWA 2V8IA 1Z2LA 2X51A 3RGIA 5J2NA 1R0AB 1M1KC 5HMXA 3JB9F 2DHSA 1H73A 1J5OA 2E7VA 3BBBA 3GSIA 1LK5A 4ANDA 5CD4A 5D6YA 4CH1A 3G2XA 4X64F 1VJQA 1W25A 4P2XA 1HK9A 4FDFA 4ICLB 4URGA 2C3PA 2DYIA 2QXFA 4RWWA 2VKZG 4RW7A 2XWYA 2PVDB 4DR4J 1HI1A 3I9V9 1LFWA 3ZZOA 3I56T 4RCBA 3I56Q 3DOKA 1WNEA 4PJOA 3OL9A 1AZGB 2QQBA 5ETSA 5KYYB 3R7SB 2LJ0A 3C16B 3EICA 1IQZA 2E9ZA 3LPYA 2FPEA 1X5PA 2HZCA 4DWIA 1K73R 1UETA 3PW5A 5AXMA 1REVB 1U06A 2DKGA 3FQKA 4JDSA 1MUZA 2YKOA 4CM2A 3RW6A 3HXMA 2YX4A 4CT9A 1QAXA 5CYMA 1QVGP 2DEJA 5D6GA 4WFAQ 1TKTA 2AV5A 1DARA 4OYWA 1AOJA 2XS2A 1WC3A 1A0OB 3UA6A 1Y3JA 2E44A 3BGUA 4L6V5 1QKXA 1QWEA 2R7SA 3I56S 1FJEB 2FJVA 2BZXA 4CLZA 2ACMA 4ES2A 1SC4B 2RNAA 3MM8A 2W4CA 1JLGA 1MMAA 4CWBA 1G83A 4I64A 1TL1A 3JCMe 4HCBA 3JYTA 3EMTA 2CDTA 2F9DA 2BKPA 3D6FB 3DLGB 4ECZA 1SB6A 2DD4A 4XAXB 1P1LA 4DUYF 4DR7F 4EYIB 4HKEA 4ZPAA 1UB4A 4K5RA 1FYNA 4E7ZA 2OEKA 4KHMA 3MXHP 3QMQA 4QPXA 3HP6A 1GCQC 1WOOA 4A8MP 1SV5B 1RP5A 1CLFA 1ZTWA 3LP1B 3TX0A 3DLEA 2PN6A 2VGNA 1S6QA 2GVDA 4M7AB 2PI4A 2EYYA 4C3LA 4ELZC 3L09A 1OJ4A 1NBEB 2Z2ZA 3X28B 1IKWA 2CPHA 1M2VA 3J80U 3ZZRA 4RNOA 3R27A 5C25B 1KS2A 2AZ3A 4NXMF 4C8MA 3K59A 4LF9F 2VFRA 5K8MA 3TVKA 2XMMA 2HQCA 4NLVA 2W2OP 3TOQA 1TZ0A 3LH2S 4KRWA 4I1TA 3J81j 1FKAF 3H5YA 4HT8A 3CUNA 1AEYA 4M77G 1TUCA 4HI2A 4TY9A 3FDSA 2Z57B 3FZBA 1F5CA 1U6ZA 5HQMA 3PY8A 2KT3A 1YJNT 2VPWB 1D0EA 2DA9A 2V2ZA 1YJNQ 2EYQA 5GAMh 4QW9A 1OU8A 4IOAQ 4U6PA 1BLUA 3EAEA 5A0DA 2JTMA 1ABOA 3GTYX 1R3NA 2AEFA 3DC2A 1LWCA 2XTJP 2M70A 3L2ZA 1XR7A 3FK4A 3B4MA 4R56A 1XNQJ 4ANCA 2KE9A 3CMQA 5T7LA 2FLLA 2V4JB 3HP9A 3NGTA 4MKBA 2DGOA 3CDAA 4RO0A 2R8HA 1T9YA 4C0BA 1SEMA 1Q81C 1UTIA 3F73A 2D8JA 4CTAA 2YKMA 2K79A 5IT9Y 4MYUA 4ZTFA 3LWIA 1U6BA 3PO4A 3HVAA 4Y28C 2NYHA 2DO4A 2YX7A 2WW4A 3KLIB 5F8JA 3TX8A 5GAHI 2CPYA 2J6TA 2GHWA 1XMBA 1I4K1 2C2EA 4R0KA 2MOXA 1RT4A 3NGPA 1LWXA 4PQUB 3M2RB 1N34J 2NS1B 4Y0FA 1TKDA 4N0AA 1OYDA 3M32A 1S10A 4JI4F 3RIRA 3S3NA 2K9GA 4E7JA 3WQPA 1IKYB 2V9KA 1ZA1B 2QL7B 3CD6S 1GFWB 4J9EA 3FCWA 2IYGA 1K9MT 4AFFA 3I6PA 5C2GA 1KLMB 2FIUA 1CJVB 1ZHIA 2BW7A 1WNLA 1SI9A 4RNHA 1SRMA 4C11A 3ZL7C 1IHWA 2X3DA 3HT3A 1GTHA 4M75A 3CCEA 5KFWA 4Y2MA 3PM9A 1TP7A 3AJDA 1WD6A 2P5VA 3I9QA 1M1HA 4MZPA 2HGMA 2LC4A 4PAAA 1H92A 4JS4A 4AL6A 4JI7J 1X9WA 5KT6A 1V3RA 5A8RB 4LUEA 1LFPA 1S9EB 1VQMS 2EFPA 4NL5A 2AZ1A 4LDUA 4FXVA 2F2XA 4X84A 1Q86U 4N76A 1FKPB 1JLFA 1ZAXA 4USWA 5LM7E 1JXLA 4TVRA 1SSHA 5LMNJ 3R1LA 4PEOA 2YSQA 4OZ5A 2O66A 3P8HA 2PUOB 4K4VA 3JCMX 2DBBA 4M7AC 1WDTA 1PCXA 1NJIT 3M8YA 1RAGB 3IAS9 3I5RA 5LJ3e 3KLFB 2QLXA 5AXLA 1Y00A 4J6WA 1RTIA 1TL5A 1EP4B 1MU2B 3LQVA 2E4HA 2FZKB 3TEGA 2RUSA 2FC9A 1FXDA 3DRSA 2D9OA 2DZCA 1N5ZA 3BQ2A 1K76A 3I35A 5A76A 1D9AA 1QM9A 1C0TB 2DVJA 3VS4A 3ZFVA 2YKNA 3RUXA 1VRUA 2ABYA 2CJYB 4Q45A 4RUAA 1SRLA 4KC5A 7FD1A 4OHXA 3N6NA 2X1FA 1MN7A 1E7OA 4K4YA 2O01C 2LXUA 4WKYA 1DFDA 2HHHJ 4ID5B 4NI2A 5LJ5f 2QFJA 3J81U 1WF0A 4RBUA 1XEZA 3OYBA 2CNKB 4ZVGA 1T05A 2RIJA 2GVZA 4HLBA 1R8BA 4OI0A 4OLOA 3RR8A 2J6UA 4C0HA 2L89A 4YTLA 3SWNA 4DOZA 2VQFJ 3BY7A 4EBDA 4ELTA 3I5CA 3I4PA 4LF4F 4OF1A 3KKFA 1YJVA 4ZLPA 1D9FA 4L75A 4QYRA 4I7FB 2CZ6B 4LQ3A 3OXFA 3HHLB 5F41A 2LQ5A 3CDEA 4A8WA 4ED2A 1ZM3A 4C92F 1VQPT 1UFLA 1HBOB 1VQPQ 2MHEA 3CJKB 1FI4A 3C15A 4I2PB 2AJFE 3HKZD 3RKWA 3GWCA 3D9BA 3M2VB 3JB9J 2HBYB 4DQPA 1SUQA 4CIOA 2JS0A 3A3PB 2DGQA 1RTDB 4HHHA 2G9OA 4X64J 2WOMA 3AOAA 4ZCKA 2GA7A 3OJSA 1PSFA 1M3BA 4EDUA 3CDUA 4DR1F 1WG4A 5D7UA 3OS1A 2WVDA 3ASKA 3RR6A 2YWEA 2WACA 4DX6A 2CP2A 2UP1A 4BHQA 4PPZA 3EZUA 3I87A 4G3IA 2HAFA 3KHHA 1VQPS 3KLHB 1Q4RA 3DDNA 2KDSA 3CCST 3JSMA 2MGZA 4M94A 3CCSQ 2HNDB 3GQCA 1GAOA 5E33A 2HHWA 1NJIU 3FEZA 3C14A 3G71T 2ASYA 3CMET 3G71Q 1C0MA 1PGZA 1N33F 2DGWA 3CMEQ 3S3MA 2Q79A 2M1HA 5K9FA 3C95A 2GQVA 1U0HB 1FWPA 1D1CA 4CLFA 3VAGA 1F1BB 1FWKA 3NOCA 2XSFA 1RADB 2IM2A 3IWNC 1S72A 1WXUA 1BY9A 1H98A 1YHQA 4A54A 2KVIA 5L9XA 3INZA 4K4ZA 3M55A 3FMWA 4NLGA 5HJXA 1SJQA 5CXTA 1XIQA 1BI0A 4MAKA 3T3FA 2W9AA 4KSEB 1CQMA 4DQIA 2LEAA 2CPJA 1LOJA 4DUYJ 4DR7J 3OSSC 3J81E 4M78G 2HFOA 4M5IA 2J6OA 1G4CA 3G71S 4DL4A 2KI2A 4LR9A 3CMES 1N9SA 2GJIA 3BQ0A 1H0HB 2K2PA 3JCMb 4QZVB 3K57A 1TL3A 4QQ6A 4R5PA 3TRGA 3SFUA 1U8WA 1NKCA 4ZPVR 4WF9Q 1HWIA 1B34A 1B3TA 4DUTA 5DM6Q 3FFIA 2PMWA 4GMKA 2FC8A 5KFAA 1LWFA 2VZ9A 1VQ6T 2RQMA 3ISNC 4NS5A 3OL7A 1VQ6Q 3J7YU 4CLYA 1S7HA 4M77E 2HQHA 2QI2A 3MTKA 3J7YI 4KKOA 3LWHA 2DR9A 1TTHB 4C8LA 1QVFS 4NXMJ 3TWZA 1GNKA 4CO3A 4QR2A 4RR5A 1XK8A 4LF9J 4YR0A 1YCYA 1W6XA 3EGZA 5HSPA 1CSKA 5KYUA 4FF2A 2J9CA 2ZD1B 4FXWA 2RHIA 3SYZA 2JS2A 5ADZA 1ZAVA 1DTQB 1VRTA 4AMCA 4I2QB 4M5DB 3RBEA 2V9WA 2B8AA 1EETB 3RMSA 1EIYB 4LMZA 3JCMV 3IG1B 2DNZA 2JEIA 1VS3A 3OW2A 5JVHQ 4NA3A 2YWWA 5B0FA 4ZGEB 3HHLC 1VQ6S 4NLQA 3FC9A 3UDCA 3IBWA 5A2QE 3QGGA 5ETPA 7AT1B 2XG8D 2K2MA 2V8KA 3QIIA 2DVEA 4LR7A 3HFNA 2OTJT 1NHVA 4L73A 4F3MA 2OTJQ 3HFVA 3C6TB 3VGSA 2ZGWA 1REGX 1G7CB 2N3OA 2IDLA 2XLIA 1UPMB 3CD0A 2QDYB 1KHWA 5D0GA 1DQ8A 3UF4A 4DR6F 2BJDA 3RMQA 1ZQ1A 3LAKA 4CC3A 2W4DA 1S12A 2C22A 2I0XA 2RE1A 4URQU 4QIEA 4ZMMA 3GFZA 3BYRA 5AYFA 2G2ZA 2CPEA 4XPCA 2O31A 4OMLA 1KFSA 3OFEA 1CBKA 5FD1A 1Q0NA 3TAMB 3EGDA 2ZEJA 3Q8QB 4JI4J 4ECQA 2A0FB 4Y00A 4QVCA 2ZKTA 5E5NA 2OTJS 1HQEB 5GAEI 1PBAA 5IHIA 1DBDA 5ETRA 2J7KA 1JJCB 3P45B 2DR7A 3CXCA 3TVYA 1YJUA 2W2QP 4USVA 2GCXA 2QRRA 3PDNA 4OI4A 1QD1A 3H20A 3R5AA 3KLEB 4YN3B 1Z9QA 1H6KX 2XIDA 3ZTSA 1R6VA 2LVMA 3H6ZA 4Z8AA 2EGCA 2OIHA 2DXUA 2CJAA 1MGQA 1K9MR 2XULA 4MMLA 2JOQA 2XYGB 4UZBA 3HX9A 4MIAA 1Q8IA 4UQTA 4B3OA 2QTVA 4A4FA 1E6GA 1RHRB 2LECA 4Z7CA 4ZCMA 4AUKA 1NK0A 3O3LA 4E7LA 2QT7A 2J6SA 4MH8A 3MM6B 4J6XA 4C8QA 2WONB 4DUZF 2ABLA 1NLPC 1G6BA 1N5QA 2HKEA 5J39A 1FKOA 1HJDA 3MMAB 3META 1HR0F 2QE5A 2DTOA 2H8HA 4PNOA 5KFOA 1EKSA 2J06A 4NYPA 4EUVA 4PPDA 4RTXA 1M8MA 2MF2A 1I07A 3PW2A 4IFYA 4Z37A 3H41A 1BQNB 3IFEA 4XAKA 4RW4A 3FLGA 1BKBA 4ZLLA 2CQ1A 3MM9B 3MM7B 1CPZA 3VYHB 4F36A 3I5BA 3K5PA 4HT7A 1XJWB 4CT8A 2VQEF 3W9IA 2R5MA 3H4DA 2E5IA 3GV8B 4PJOF 2R7WA 4RW9A 2FG0A 2C2OB 4GVBA 2ALYB 2L5QA 1U24A 5GAN5 2BE9B 3V81B 2W2PP 4UOGA 3EXCX 2DM1A 1RKJA 3Q8UA 4LFAF 2YH1A 3BZQA 5T14A 4N4HA 4MK8A 4DPXA 3M54A 1NJIR 3PVLA 3HHEA 2COZA 2ED1A 2HS4A 3DXBA 4AFZC 1M9SA 2FHJD 2P9EA 4EO8A 2DAQA 2XDPA 3CCJT 2RMOA 4U7UK 3CCJQ 3QYGB 4PG4A 2VOPA 2XYHB 4LR8A 1FT8A 2GJFA 3MPUB 4W92B 5L8RE 4DL6A 5E3AA 4M77B 4CM0A 1NZ9A 1SC1B 3J7ZT 2B6AB 4L72B 5CZXA 2QQSA 2EYWA 4RBVA 2QA4T 2RU9A 4LF4J 1AVZC 2QA4Q 1Q78A 1BIBA 4OV1A 3PMIA 1WKJA 1YJ9A 1KQSP 2X3GA 3DDIA 5KT4A 2E7XA 1MMNA 3HL8A 2PIIA 3J7AF 1UW9A 2BUDA 5EX0A 2NUTB 3VS6A 4IG3A 5U47A 2XICA 1T95A 4BE1A 1OWXA 1S99A 1UJYA 3HFZB 3SV4A 4OX6A 3CCJS 3HMJG 3R6GB 4JUVA 1NH7A 3B8HA 3NKYA 5DGAA 2B5JA 3PNIA 4F7UA 3BSCA 1PRMC 4MKVA 5CAAA 1U2FA 5KFSA 1WEXA 2CNOB 4DR1J 3ZTQA 3M53A 2BRLA 4LF5F 3UPUA 2QA4S 2I5JA 1ZZFA 3UVJB 4IG0B 2E3HA 4CDIA 1S1TB 5HL7Q 3BBCA 1Y57A 2PFDA 1X5SA 2RMLA 3WIVA 2KXNB 1RAFB 3H98A 4WKRA 3PYFA 1ZBJA 1FXXA 1KQKA 4O4GA 3J7AN 3K17A 1BK2A 3PIPQ 2C3OA 4FKXA 3Q1JA 1KSWA 5KG4A 4F50A 2AZSA 2LMIA 1WTBA 3JCMc 3MR5A 3TYTA 4CLPA 5E0OA 2I6WA 1S57A 3HVWA 1N33J 3FC3A 3PYGA 2XMFA 2C06A 2NXEA 1JLEB 3W2WA 2R7VA 4KH0B 3PV8A 1OULA 1TAUA 4M78E 1Q86C 1OPIA 3GYGA 4F4WA 4QOTA 5GAOq 1I81A 1X7VA 1NUEA 2O2OA 2E1CA 2PMZD 1WHLA 2QL9B 4ZP7A 2ZBCA 1FWLA 3MPDA 1OY9A 3ZZTA 1T0HA 3MUVP 3VUBA 2ZPIB 3I55T 2YNHB 4FT4A 3I55Q 1SJ3P 4O4RA 3EPIA 4X4NA 3U23A 2RJCA 4NCGB 2HVHA 5EWGA 3GZ7A 3EGUA 2ROTA 4J9NA 5D4OA 3KK3B 1CULB 2ZDOA 4DCJB 3MEKA 2DNRA 3L2QA 2OPQB 3CC2A 2IC3B 4OYXA 2RU3A 3CJ8A 2H65B 5BR8F 4C8YA 3CDWA 3KNAA 1O5JA 5GADU 3QSUA 1RISA 2O88A 2YNGB 3DGVA 5GADI 2LCLA 3RBBB 4G65A 3RAMA 3CCWA 2OI3A 3QGIA 4N41A 1OYXA 3L7PA 1QVFR 4WK1A 4UUWA 4Z2XA 4DZ6A 1VYUA 5A8KA 5FWCA 3R6NA 2VL1A 2BANA 3NGUA 3BH6B 3GF5A 3NMZC 1VLOA 5HATA 1V29B 2O4XA 4B9UA 2GGPB 2I8EA 4KHRA 4OJGA 3I55S 1GCPA 3D5MA 2HHTA 2LXFA 2QLJB 2XWXA 3T41A 5I2MA 3VS3A 1NPPA 3RNJA 1BQXA 4JRPA 3G6EA 3TZXA 1L3UA 3MF5A 2LQBA 2DX1A 3EG9A 1YJNA 2KHCA 4NLPA 1GXUA 3D3CJ 3O8WA 3T19A 3CCLS 3IWXA 3CQTA 2DEQA 2Z8QA 3W63A 1RBOB 1UL3A 2WHOA 1AA1B 2XNRA 4M77C 3I0SB 1EX4A 3G82B 4PXBA 2RI3A 2OX7A 4DOWA 2M02A 3C4SA 3DOLA 1HNXF 5DG8A 1B64A 4J9BA 3K89A 4AQYF 4BC7A 4PG7A 3R9LA 3TJ8A 3LP2A 4RW8B 2NXUA 2EC2A 2JDJA 1HD3A 3VS5A 1PWTA 2OMLA 2YWKA 3PHTA 2M0YA 2CQPA 3FJ2A 4KPCA 3IGVA 5LJ3j 2DILA 1L5UA 4X34A 1RUSA 1RT6A 4MDWA 5F9LA 5G0RA 2Y1JA 3CJ5A 2V2VA 2L41A 2EVZA 1R77A 3QNWB 1PG5B 2HHVA 4WE1A 3QFWA 3V6HA 2Y4YA 3SCKE 5JMNA 4R25A 2DHAA 4RNNA 4DR6J 5FIIA 1SXLA 5DETA 2WSFE 3B6BA 3NMAA 3EZOA 2QEXT 2DITA 2JEFA 2QEXQ 1KKHA 1R7IA 2OI2A 4OMNA 3FMBA 1H7XA 1VQOA 3QSIA 3CIMA 2MB0B 3JAMY 2NREA 3CPWP 2V5HG 3VVUA 2J8SA 1YSJA 3OYEA 1RWMB 4PWWA 3W64A 2HKQB 1WHMA 3F41A 3QGPA 4ATNA 1YBAA 1H3ZA 3TARA 3TQ1A 3HFKA 2DNYA 4IRKA 4LJMA 4ZVPB 2CP3A 4K4TA 1I5LA 2CWKA 2ASJA 3IWLA 2QEXS 5C2CA 1K1QA 3LGLA 2HMIA 1WHXA 1Y96B 1SJFA 4ZPCA 5I22A 3DGPB 4F2RA 2GAGC 1TXQA 1HD1A 1OX8A 2C2NA 2HKNA 3O1LA 3C8YA 4KAIA 3GONA 4WBFA 4O0IA 4QVDA 3OLBA 1HW9A 2C0OA 3H8ZA 1GK8A 3JRZA 2E5KA 3C6UA 4YEAA 1Y3KA 4DV2F 1NLKL 3MEDA 4ENOA 4DV6F 4DUZJ 2OAWA 4WXOA 3CT9A 2EXUA 1WWHA 4M78B 1S7IA 2N4DA 3CO9A 1HR0J 1WC0A 2HRUA 1KVIA 4L5GA 2A37A 3CBOA 2G1DA 1YVFA 2ECZA 4DPOA 1R8PA 5KG1A 4KGMA 3KJNB 2G4BA 4IIMA 1TKXB 3HZEA 5ETKA 1Q7YT 1ZM4A 5KFHA 3T6JA 3MP8A 2VBXA 3I31A 4JJBA 2V4RA 5LJ5d 2QIFA 1NB2A 2VQEJ 5IN1A 4ECVA 1WHWA 2CZ7B 2HDAA 4XQ3A 3OUYA 4FS2A 2DJQA 4LFAJ 2QYZA 3CJ2A 1QAJA 1QTMA 3RRKA 4DL5A 3BGFA 2N3LA 3QHSA 1UWBA 3ETOA 2EEYA 3G7ZA 4LRAA 2VKNA 3LP0B 1XTDA 3L2WA 1K1SA 1JQGA 3CNQP 2D74B 2JFDA 1U1OA 3U1NA 4H4KC 1C4AA 5ITHA 1PAEX 1HXDA 4X66F 3M56A 2DL8A 1MN9A 1SHGA 3FEYB 4ICLA 1FF2A 3M1VB 1SQGA 1KHCA 2EFGA 3IA0A 3FSYA 1VUBA 1XWLA 5DGBA 2R7OA 3CF5Q 3SDZA 2EYXA 1QSYA 2ZZMA 1KQ1A 2D0NA 5L8RC 5KYYA 8RUCA 3C16A 1FMKA 1WSRA 3KHLA 5L1JA 3EH2A 2FYKA 2OPSB 3S6EA 3N5FA 3GB0A 1C4CA 2A08A 2XMKA 1REVA 3DI6B 5D0EA 2UZAA 2C0IA 2CJXB 4NEZA 3MEUA 2MMPA 2IJNA 2M0GB 4HHUA 4N8NA 4O44B 3E2EA 4J9PA 4DF4A 4LF5J 1BU1A 3CCSA 2DNKA 5I3PA 3HK2A 4ED8A 4FKYA 1OPZA 5CA5A 4LD6A 3WXMB 5C5JA 1ZETA 1YIJA 1VFJA 3QWUA 3BGRB 4LSNA 2YTCA 5GAN7 2CJQA 4UZCA 2F63A 2LQWA 2DZ9A 1GFDA 1F2HA 2OJ2A 4BC9A 4M63A 3VAFA 3AD7C 4EBCA 1V6HA 3K0JA 4DHVA 2O67A 3CJRA 2Z58B 2F69A 4KGKA 4P72A 2HNIA 4HT5A 3THPA 1RHQB 3RKXA 3DLGA 2D9PA 5AE1A 3BE3A 1I8FA 1Q7YU 2V34A 3OXGA 5DS7A 5HMZA 1JXMA 3HZGA 3GJQB 3OR1B 2CPZA 1T9WA 2CZ1B 2WVEA 5CCMA 4QIFA 4M95A 3KDOA 1SV5A 3T6BA 3M8ZA 5IV4A 3LP1A 4KRTA 5L38A 4M7AA 2L3RA 4ZVUB 2QA1A 1ULRA 2R7UA 3QT7A 2EAYA 4ELVA 4EBEA 2CH4A 4QWDA 2DTIA 3MZIA 4F4XA 3EXYA 5FW9A 1V5IB 5C25A 2ADCA 4M78C 1YI2A 2DL7A 2G1HA 4IFVB 3MPVA 1IZ6A 4JI6F 4OMPA 1UFFA 3MHXA 3CTRA 1NPKA 1YJRA 3GIKA 2ZWOA 1VQ8T 1WG5A 4OX9F 4JV2A 2SXLA 1VQ8Q 2KK4A 2W0ZA 5BYRA 1M90T 4E7KA 4OHZA 2L8DA 2KG1A 2FVUA 1UA1A 2BYCA 1WC1A 2SRCA 5IC4B 5LL6d 4PABA 9RUBA 3EWGA 3PTWA 2KL8A 4ZLNA 5DQGA 2DXTA 3HSGA 5B0CA 2XZTB 1SJ4P 1H7WA 2MQMA 3MMCB 4CO0A 2YKAA 3OL8A 5GANg 3M0RA 3R7BB 4CLSA 3M4GA 4KBIA 1VQKA 2Z2YB 4DBHA 1Q5VA 4X9DA 2ROGA 3EPGA 2EBGA 2WK4A 1U2RA 1QQJA 1TMMA 2BOPA 2FD2A 2V4JA 1ITPA 3KK1B 4ES1A 3P3DA 1M1GA 1VQ8S 4ZCIA 4NLWA 3EG1A 4K50A 1M2OA 1FJ7A 2RB6A 2JM9A 1T03B 2KR3A 1HNXJ 2PE8A 3D1OA 2GQCA 4GVLA 4B9NA 4AQYJ 1LNQA 1PRLC 2VG6B 1W2BA 5HQ8A 4KJIA 3NWRA 4WK3A 4X4SA 3VAKA 1S6OA 3OJUA 2VXFA 3LGNA 4KQZA 3KLIA 2MKCA 4U7UD 2DO0A 3Q89A 4ZVEA 1SH3A 2DJWA 2NXNA 2VC1A 4PQUA 1AYEA 2W1BA 3M2RA 3SZ2A 1NCLA 3AY0A 4X4QA 1IN0A 1IKYA 1NZ8A 4CNZA 4VUBA 4C8QF 1U1KA 2I2LA 1SL1A 5KG3A 5KAKA 4DFMA 1JKHB 3BYPA 1KLMA 3KFWX 2MQQA 1CJVA 4EO6A 4G1QB 3RRGA 3KYLA 1N54B 1M27C 3MR6A 4FF4A 3BR8A 3HD2A 4UTGA 3PIOA 2H5IB 3O5TB 2QFIA 5B09A 3W61A 2MPXC 4USIA 2DHHA 1M5Q1 2RILA 4YMEA 2EK1A 4WYLA 3AB2B 5EGYA 2AHOB 3M8QB 3F0NA 2WSFC 4A8OA 2KROA 3FIFA 1VYAA 4J9UE 4J9DA 3C12A 1VA7A 1HNIB 4J9MA 5A8RA 3OHAA 1S9EA 1NHUA 2B56A 1BWVA 2ZHBA 4A8QA 4L3NA 1FKPA 3Q0AA 3QLHB 2CPIA 2HK2A 2DVIA 2V6AA 1M5SA 4PCQA 2OAUA 3FBFA 1V5VA 1PC0A 1MROB 2YWFA 3GG0A 2MKKA 3HTRA 2KDOA 3QWXX 5LJ5Y 3H2VE 1KTVA 2ZH1A 2VFSA 3IR5B 5KFXA 2GCFA 1MU2A 2DGVA 4F7VA 3GOXA 5K14B 1WI8A 5G4DA 1VYVA 4DV2J 5CABA 2UUTA 3MP6A 1I6JA 3L95X 3CJTA 2DNPA 1C0TA 4DV6J 2X1BA 5BXIA 2BM1A 3M9OB 3SHWA 1KVKA 2HFNA 2AYGA 5HN0A 5HLFB 1ROFA 4EMGA 1OY6A 1QAIA 1PO6A 4ID5A 3ZNJ1 4F7UF 1FNOA 3OTOF 2JVOA 4ED7A 1H2VZ 1FE0A 4H54A 1EHWA 1LXJA 2UUWA 1X5OA 1UJ5A 4XU2A 2IRUA 2IVYA 1WJ9A 3BFMA 3OYKA 2KQWA 3ENAA 3K5MA 2EYZA 1VQNA 3KXDA 2VVKA 4I7FA 2VV5A 3DRRB 2HNZB 4YDXA 3SEOA 4JI2F 2R8JA 3HHLA 3EG2A 1BI2A 1E6VB 4C0GA 2W24A 4A46A 4U7CA 2LEBA 5GMEA 1NJYA 2V50A 3GIMA 3Q8RB 1HBOA 1O0PA 3CJKA 2NUZA 3PO5A 2K3XA 3PRVA 1IKVB 2PNIA 3CCZA 4I2PA 1BGXT 4AT1B 4RLEA 1IBLF 5KT3A 3CCVA 2H4YB 1KC8U 3M2VA 3CCQA 2YUPA 2JJ4D 1S9FA 4RJVA 2ZPEB 2C2RA 1F2GA 4X66J 2K7AA 3US5A 4P7VA 3D1HA 1RTDA 4M7DG 3RDVA 4C5EA 3GJTB 2BDPA 2HPUA 1ZLMA 2VG7B 3VGVA 3OTCA 2DHXA 2HBPA 1WHJA 4NLYA 4B3SF 4MJKA 4ZP8A 4XK8E 3KUEA 2BE2B 2RS2A 3VZHA 3HDSA 3JQMA 3JSYA 3LO3A 2WVFA 2M0OA 1RT1B 3HRSA 4OIXA 3POTB 3KLGB 3KLHA 2HHPA 4K0KF 2BTTA 3AOCA 3GILA 2HNDA 4NOYA 5GAMj 5I42B 3PJWA 2M8DB 3RB0A 1BMQB 4JJDA 4J7CA 4WU3A 1UZDA 2ZNYA 1S4EA 3R7NB 3UA7A 1U0HA 2CQ2A 4YUDA 4QJVA 2PDAA 2DTHA 2OPPB 2NR0A 1DQAA 1Q1KA 3EGWB 1NK8A 2ASDA 4O3RA 4GO5X 3A8GB 1BIAA 2PUKB 1TUWA 3BDPA 4F2SA 4PKCC 1AWWA 4JRQA 3DRPB 2QDLA 4ELYC 4HVUA 1UPPA 2FVCA 1TUGB 1UG1A 1UHCA 4BACA 4KO0B 2M51A 1IHVA 1ABQA 1IVZA 4DS4A 2NSBA 5CZVA 2XKOC 4DR3F 4PQAA 2FZCB 2YQ1A 4B9LA 1L3SA 2MKSA 3OBIA 2IVWA 2FGCA 3M58A 1W2BP 4NYOA 1WI6A 1M30A 2GMHA 4W90B 2XQCA 3T5JA 2JOYA 2V69A 4MK9A 4HH1A 4Q0BB 2QMWA 1U5SA 3HSZA 2FHDA 4LVNP 5GMKa 4CQ1A 2QC3A 3LUYA 2DXDA 2DPJA 3MPWA 4UUXA 4YB7A 1C1AA 3UN3A 4TN2A 1D1AA 2HURA 4FL6A 1X27A 1PCAA 3SSSA 2DETA 4F4KA 1JLBB 4BE2A 3NCPA 3EGVA 4JI6J 2CZVC 2HFVA 5GANh 1QCFA 1QKWA 4OX9J 2GFAA 1QVGR 2RJEA 2HSPA 4PWUA 4V19X 1IBMF 2GV1A 2ZD1A 3R1HA 2OFHX 2HRYA 1PJ5A 3NLCA 5FLXU 1DTQA 4I2QA 3BN4A 4M5DA 4ZN1A 2DNMA 3GU0A 1NG2A 1EETA 4I6AA 3IG1A 4LSLB 2XK0A 1P9YA 4ANJA 2EVRA 4B02A 4CI0B 1RUWA 2LQKA 3W3SA 3AJ2A 2XDDA 5DLGA 3OYLA 1NKBA 3M4YA 1KFDA 2AJ1A 1S1NA 4KUIA 1M90R 4RU9A 3HCXA 2JC1A 2DYBA 1YWXA 4A4JA 2LQJA 2DIGA 1SQFA 1NU4A 3WC2A 1H3DA 2AF6A 3C6TA 3EUNA 2GS8A 5DRKA 3TQ7P 5KFZA 2KM8B 4LN2A 2LYVA 1CC7A 1NK6A 1P1TA 1YWPA 1NDPA 1N8RT 5CQXA 2KB2A 1M3AA 2RRAA 5F0UA 2VBWA 3N6LA 2YQ3A 5KFMA 1RABB 2BIVA 5GJWB 3QKJA 3UPFA 1QY7A 1Y5LB 2A18A 3QJPA 4K5SA 4Y2IA 3KHRA 4OLPA 2MMYA 4V2SA 4QYZJ 3BV8A 4QCLA 1PD1A 4EZ6A 3V4MA 3W9JA 3LTOA 3TAMA 3A5ZB 4HXJA 5KG5A 2V8VA 2FB0A 4I69A 4DA4A 2F7VA 4IQMA 3UR3C 1GQEA 2J8AA 2QSFA 1RLDA 4NLDA 1NJXA 4NYZA 1HQEA 2F5TX 4LD9K 5KCOA 1QVPA 2CYYA 1TFYA 1SH2A 2JJ9A 5CK9A 1Q8LA 1V3SA 3BQ1A 3SV3A 4TYAA 2CUYA 4LRCA 2ZVIA 2OUGA 3KLEA 1KD1T 2IG0A 3THTA 1TL7B 5EUHA 5I3QA 1TK8A 1RAJA 3DN9A 1Q7YC 1FMWA 2CQCA 4PG8A 2DL5A 3P49B 4JB8B 5IH2A 2XO7A 4IIOA 3M0UA 3DLJA 2ATLA 4F0MA 1J3TA 3OMCA 3GCWP 1LW0B 4USJC 1K8AT 2JLEA 4A4KA 3JB9H 4C5IA 3E01B 1HNZF 3MM6A 1UDLA 2KSSA 2BKDN 3VTIA 5FLXE 2WONA 3QPIA 1X0PA 2CT4A 5L23A 3PW0A 3TVTA 3G1JA 1M8VA 2CDRB 4ZVTB 3MMAA 3PXGa 3CC7A 1ZUKA 2O9SA 2GW8A 1SBRA 1QWFA 3MEEB 4LBPA 1QAYA 1SKRA 2G13A 1IWGA 1BQNA 3DB3A 3RZAA 4Q8EA 3MM9A 3M57A 3MM7A 3RBZA 4RTWA 1N88A 3E1SA 1NSQA 2CQ3A 5H9FJ 4LFCJ 4EPCA 4LRDA 3ET6B 3V81A 4CLUA 1EAYC 1AB8A 2B8PA 3BSAA 4QU6A 3QSYB 2ZOGA 1PYTA 2VBYA 4ZVSB 2B9EA 3DLKA 4DXLA 4XDCA 3BREA 5I2SA 4K11A 3NHNA 3J7A1 2VJUA 2CZ0B 2ZJPQ 3GYXB 2W25A 4X62F 4AFSC 2HSEB 1FDBA 2QQRA 1LW2B 1LPLA 2VPZB 4M77A 3Q8YA 2BMBA 1RCXB 2B6AA 3QATA 1IO6A 1U7LA 3MR7A 4EI2A 2CIMA 4JI2J 3E8OA 4OYIA 2Y0SD 1GXLA 4DV0F 4KH1B 3AHUA 1PKSA 1I1JA 4M7DE 3J81Y 2Y4XA 4PG5A 4J37A 1VR6A 3AA8A 4C4WA 3PGGA 2N7YA 2DERA 2D1XA 4KT0E 2NUTA 2XZDB 4J91A 2AIRB 1IBLJ 1XOVA 1XR5A 2CQHA 3OQ5A 2X9HA 2B51A 3JQJA 3CC4A 2KKHA 2KRNA 1TH7A 1UFKA 2EI5A 3NXZA 2RQCA 4E7SA 3V7SA 3HF5A 3ITHB 2LCSA 3BS9A 3IR6B 4FW2A 2D3UA 1S72T 4BI8B 3MJXA 2AEMA 1YHQT 1S72Q 1H2TZ 1YHQQ 2ZH9A 1NEEA 1X4DA 4ZCLA 4B3SJ 4DMZA 5CCLA 3UNYA 1F6TA 3UVJA 1K8AU 4M7AF 4IG0A 1XMOF 1YITA 1GMWD 1M5HA 1S1TA 1WOSA 5KFVA 1X6GA 3M7VA 4ZPDA 4HI1A 1T9UA 3LGFA 3F56A 5GJVB 5DM7Q 5HCKA 3URGA 4DSEA 4K0KJ 1KIKA 1JMTA 1MWQA 2XC9A 2K5FA 1IRXA 1RE1B 1OX9A 2HBZB 3A1PA 2BQ3A 3HSBA 1S1UB 1VK3A 1R8AA 2MPUA 4XK8C 1HQUA 3QJYA 4K4SA 1WQ7A 3CBPA 4FPIA 4CC7A 2E64A 1JLEA 3DNCA 4LDVA 2DBKA 1NO8A 5A2QY 4P71A 4OX8A 2R58A 1S72S 1K73U 4FU6A 1FEHA 1YHQS 4A8FA 1J2VA 4QWCA 3KMSA 2VC0A 3KJVB 1Y5IB 1F9EB 5F8GA 2LU1A 2ZE2B 1K0SA 3UQSA 2HLUA 2YNHA 1YJWT 2DGUA 1YJWQ 4R0JA 2IA0A 3EFSA 4NCGA 2JM8A 4KFBB 1VDHA 3UD3P 4PJJA 3RB3A 4DR3J 4M75E 1QVGA 4J5YA 2BJ1A 3MD3A 3KK3A 1CULA 3T9NA 2MLZA 2O5DA 3M8WA 2K5LA 3CIZA 2R8GA 2OPQA 3L42A 2IC3A 5GAN4 3LGHA 3RAQA 2ZPBB 4NLTA 3KG0A 4E2FB 2YNGA 4FCYA 4WU2A 1FNXH 3TW0A 2PFFB 3PRBA 5D0RA 1JNRB 2D7SA 5GMKi 4ZVFA 1M5OC 2AEJA 1U2CA 3MEGB 1QJHA 4XTVA 4WP8A 2GGPA 4P7TA 3KG4A 2UU9F 4BY6C 5HY6A 5IQ6A 1I1GA 3PVXA 1VIEA 2DH7A 3FKBA 1FO1A 4TXSA 2HMAA 2W8KA 2V1QA 4X4PA 3TNVA 4LF7F 4PK4A 3D6MB 3MECB 2DNNA 1VK8A 2YRDA 1FTCA 1FX2A 1IBMJ 3JYTB 5DZ7A 4ITSA 2RH2A 3NS5A 4OZNA 3HFOA 1ZSZC 1HFEL 2LDYA 3I0SA 1FRXA 4H4MB 3OW2S 4CLLA 5IXFA 3G82A 2UVRA 1AUSL 1DURA 1QLYA 2FHJA 1B0PA 3GCXP 4JOUA 4K4WA 3NNAA 4FYYB 4PRFA 3M05A 4Y3CA 3PVQA 1KC8C 3N9UC 4ZJQA 2YNFA 4QQDA 1CKBA 5F8MA 4HCZA 4RW8A 2KFNA 3M59A 1Z1ZA 4PWDB 2Y1RI 3TCJA 2BW2A 2ROEA 2FJEB 2MLYA 2ILZA 2EKHA 5KFEA 5HQLA 4ORZA 1G3SA 2HL3A 4Q44A 4I67A 1CJUB 2FPFA 1UGPB 1FX7A 3GG1A 5LSOA 5MAOA 1DZ5A 1GTEA 2GGRA 2P0PA 1MMLA 3BR9A 3QDRB 3FJPA 1VIOA 3CPFA 3MCOA 4M7DB 4A4EA 2EQMA 4NLRA 1I51B 1N9RA 4B9XA 2DCLA 3MCSA 1NDKA 5D3GA 2WBMA 2GFUA 3BGLA 2WCXA 1NXIA 3ULHA 3BO2A 4WCIA 2R5AA 4DX8H 3JCMd 3I5SA 2PI5A 1BC6A 2IDEA 3PACA 1NSAA 3DRYA 4LDYA 1EB0A 1N8RR 5K5MA 3GSDA 2O01E 3ULRB 1U8SA 3CXCS 2OGUA 4M5HA 1OU9A 3FDRA 1UMJA 1UJ6A 4M1KA 4QW2A 2RDIA 2VUGA 2XY6A 2XHWA 3D0GE 2FJAB 1S6UA 3GPAA 1PJ6A 4NLXA 1B4SA 4K2XA 1Y96A 1WKKA 3DGPA 1CJTB 3UWTA 2ZH5A 1B7YB 2QQ9A 4YOEA 2QGFB 4IUQA 1YP5A 3QQCD 1AZEA 2OSQA 4WFXA 1QDUB 4F3OA 4RW6B 4HH0A 4W4MA 4P75A 3M32B 4DSIA 1HNZJ 4DSJA 1KD1R 2GMJA 4KGXB 3NAHA 2PEBA 2EG1A 4L76A 4M78A 4RL1A 3RB4A 4P52A 4F4YA 5CKHA 5GAMf 4M8LA 4BWJA 3QJ6A 2VOOA 4J9FA 2QG9B 2J7UA 5A0YB 1FFSB 4ALZA 2D0QB 2W4PA 4NEYA 1MW7A 3UN2A 5FU6C 1YJ9T 1K8AR 2LDIA 1QSSA 1TKXA 1YJ9Q 1YGYA 5CCAA 3TSZA 1JXOA 3VU3C 3SEMA 2F1FA 4F26A 5EG2A 4YR3A 1PJ7A 2DEIA 5EHHA 1SKSA 2PQWA 1S6PB 3NCRA 1UEBA 4IO9Q 4HACB 1CS4B 2MYFA 1YKWA 3JSRA 2JZ2A 5KFIA 3IS9A 1H74A 2AGOA 3LP0A 1AWJA 3A3NB 3UFCX 2X1AA 4ANEA 2D8HA 4X62J 4LF2A 5DQHA 4LSZB 2E5HA 1T0JA 3EJMA 3SQOP 4Y2KA 2KI7A 1YJ9S 3HHDA 3V8LA 3VJPA 4JI0F 5ETOA 2QMUB 1EKRA 4DV0J 3M1VA 3GLXA 2AKKA 1WI7A 1RGVA 3LLRA 1SJ1A 2AU0A 2XLKA 2K57A 3ZBDA 2DNLA 2RHUA 2DK2A 4QIGA 4KYZA 1WYXA 1TL4A 3PYEA 1U1QA 3LA0A 2ZH2A 2OPSA 5KE2A 3AA9A 3DI6A 5KFJA 4OZ0A 5DDPC 3MGJA 2L9WA 4UQGA 4M7DC 5DLFA 1KOHA 4OQJA 1BE4A 6FDRA 3D2WA 3P5TL 4O44A 1N4LA 3MAAB 3NFCA 2POKA 1NH8A 1DJ7B 4IKAA 4P2MA 4KT0C 1XMOJ 1N0UA 2W8LA 5FRNA 4ECYA 3NP5A 1I3OB 5LSLA 2DRMA 3FQLA 1ZAWA 2BXJA 4CC4B 2LA6A 3BGRA 3EDRB 5GVQA 3KJFB 3ISND 3FRZA 3CC2T 2M3DA 1JK9B 4WFNQ 2LJ3A 3CC2Q 4YY3F 4LBIA 1UE9A 1I0CA 3BKTA 1PILA 3T1YF 1ELOA 3QYHB 1C2PA 2KYXA 5L1KA 1YBTA 4DFPA 2R4FA 5IQQA 1JBMA 2A6MA 4GLMA 3CB4A 3IRWP 4FW1A 5LJ3d 5DM7R 2AMCB 1KQSR 3HJFA 2GX8A 3OR1A 2AGQA 3R5DA 1T9XA 3L3CA 1KLNA 4AD6A 3F44A 1OSDA 3HLUA 1HHTP 2IRYA 2FY1A 2WSEE 1X4AA 3MEWA 4IH6A 1W4SA 3G6ET 3LW5C 5B0AA 3ENQA 3G6EQ 4N0AC 3HHLD 2PGCA 3O6QA 4ECWA 4UW2A 4CC2A 2XMUA 2BABA 1QVFP 3CC2S 2EW3A 4NRTA 1OS5A 2WBRA 4IFVA 2MY7A 2BZ2A 2PC6A 4R8UB 2R2RA 3DOMB 2APOA 4C48A 3QPHA 2GQIA 2DR5A 4JI8F 4WJBA 1FHTA 2HCKA 1PYSB 4C0DB 2H1YA 3CJSA 5DG9A 3S1TA 5J2MB 1M1KT 4ZVHA 2EFOA 1RU1A 3VV2B 5LXYA 1Q95G 2P2CB 4KGVB 3GR0A 5D4PA 1TK5A 4D3HA 2BKNA 3TU4K 4HA8A 4M75C 4NMXA 2KG0A 3UT1A 2CSQA 5I21A 4E7HA 3OTDA 5MLCV 2LT4A 3CCUT 3QBYA 4U67Q 2IBKA 2UU9J 3CCUQ 3Q23A 1XMQF 1HA1A 2GAHC 3MMCA 2RPNA 2VGMA 3FCVA 2NUPB 3G6ES 1WA7A 2AQ4A 2DE0X 3TREA 1YJNS 5CKFA 4XTZA 4LREA 4LF7J 3OW2R 3D4JA 1QMCA 4YR2A 1N32F 1M5VC 4XPEA 5HI7A 1NK7A 3P6YC 2XS5A 1ZPWX 3KK1A 2VFVA 3L4BC 3MFIA 3W9HA 3X25B 3T1HF 3NTKA 1T03A 1VQOT 2E5LF 2KJWA 1S0MA 3EFRA 1VQOQ 5KCHA 5F3TA 1DRZA 2MQ8A 2DR8A 2XU8A 1HSQA 2VG6A 2JN0A 2EPIA 1TL3B 2KJVA 3C94A 3E9FA 3DLMA 4OMFG 3CCUS 2MKYA 3DYAB 1F9FA 4ED4A 4O5VA 1U1RA 3AAWB 1ARKA 2A28A 5CKBA 4XTUA 4M5LA 2WB4A 4ES3A 1PHTA 5HBMB 3C2PA 3QO9B 3B54A 3V7RA 5HVGA 2CZ9A 4K4XA 1FRKA 3G86A 4H4OB 1HD0A 4RZRA 2MYSA 2HQFA 2OLWA 4ZJLA 2F2VA 3J80E 2UXDF 2YQ0A 4OYOA 3VALA 4YB1P 5CD4H 3MCNA 3OPKA 1EZZB 5AXNA 2FRWA 2YBVA 3D28A 4OL8A 2CP7A 1JKHA 1VBYA 1S5ZA 1X5TA 3LWLA 3LOUA 1VQOS 3IXQA 3OHBA 5CYQB 3K5LA 3W8GA 1SPKA 2ZZTA 4B9VA 2XYPB 1WKLA 4G1QA 2LRQA 1OO0B 1P27B 4P74A 3CXCR 4QKUA 2P84A 2HHQA 2AJ4A 3NGSA 4JV0A 2L3QA 2EQKA 1FRHA 1EFNA 5F8IA 1OZ2A 4N5SA 2EKNA 1GL5A 1Q82R 2QTXA 3M8QA 2PSZA 2IM0A 2RF2B 3FSIA 1VHIA 3RERA 3BSNA 1LNXA 1K73C 2KYBA 5SUHA 1VQLA 3BJYA 2YRCA 1X4GA 5K8NA 2J9DA 1OQ3A 1JB0E 2HVIA 1HNIA 2DT9A 2HRTA 2VF3A 2V8HA 3VWSA 2LU2A 4K4UA 1NPRA 4IQXA 2YPZA 1X9SA 3MOJB 3JAMU 1IM4A 4NWBA 1HQ2A 2ALZA 3O2IA 3TUZC 5THWA 1AD5A 4OGEA 2XI2A 5I3UB 4JP8A 1HMVB 1MROA 4M77F 1F5BA 2KMTA 4MDXA 5D77A 4NA1A 3V2UC 5CIUA 3M0TA 2L48A 2VFUA 2EFNA 3LH0A 2VONA 4DPTA 5K14A 5GMKh 1WG1A 2B8QA 1IJFB 4LF8F 3GLJA 2YRVA 4J8OA 2OP5A 2HBWA 4J90A 2JNGA 5CHCB 3VAMA 2IJFA 4AYBD 4C0DC 4DN0A 2J05A 3G87A 2ROLA 1K9MU 3R5CA 4WWSA 3VAJA 3PYDA 1FJCA 2DNHA 2FJXA 1Q81T 2IBOA 3A4TA 2ZUAA 5KT7A 3CPWR 2VODA 4RX6A 4JUZA 3M2UB 1D3BB 3VKIA 2QJ3A 2F40A 3SCJE 4OZLA 3G8SA 1X43A 4C5GA 4NZ6A 5KFBA 1UW4A 2UV8G 3D1QA 2B9YA 1NHKL 3DRRA 2K06A 1VBXA 2DIVA 2J7IA 5A6PA 2AYEA 4JJCA 4MMOA 2MCNA 5A6WA 1FCAA 1U3OA 3K8WA 2MZRA 3RUBL 1S1VB 1QUVA 1NEGA 1IKVA 3M30B 1YDLA 2C0TA 4Q43A 4DQRA 2CG4A 4X4VA 2JH3A 1TSFA 3UCGA 4A48A 5CYJA 5E7OB 3VCDA 1O6XA 2MI6A 5HK0A 2Z4PA 2V63A 2G0IA 4JI0J 1YIJT 4ZP9A 2F8EX 2VG7A 1YIJQ 1WORA 5CR2A 1UVLA 1IKXB 1EQMA 1UUEA 1NDLA 1HNWF 2DGXA 2F4FA 5DDRC 2BE2A 4J9OA 2MWPA 1IXKA 3Q22A 2YPYA 3D54A 1XNIA 3R2CJ 2I38A 1H2UX 1S59A 3N0VA 1RT1A 2H48B 1XTZA 3A12A 3POTA 5DJBA 2CVIA 4JLIA 5IC6B 1G3TA 4DF8A 3JCMW 2CP0A 3SMZA 2RUGA 5LJ3Y 4F16A 2RF0A 2GNCA 1KQSA 3CCSS 4DSLA 3LPEA 3HRUA 2ZBPA 1Y7PA 3S6WA 3LGMA 3JCMP 2HBQB 2EWNA 3OD2A 2Z2LA 2OPPA 1YIJS 2IM1A 3VF0B 3A8MB 1UEKA 4Q7AA 3QT6A 2ZH7A 3S7RA 1UJ4A 3L2RA 1RYSA 4BI4A 1RT2B 3VUZA 2KFZA 2Z0WA 2CFXA 3DRPA 1YI2T 4X4TA 1CVJA 3UD5A 2CQ4A 3ICLA 2LQNA 1YI2Q 4BS2A 4PXCA 2RDJA 1RT5B 5E3PA 3KXTA 2DYAA 2BZYA 4QWAA 3RU0A 4YY3J 1KVJA 5CVIA 5HVFA 3UD4P 4EMKB 4C9DA 4JBCA 3T1YJ 4OHYA 3NBPB 1NE8A 4FT2A 2EFQA 3DRXA 4PFZA 2YVSA 1FJGF 4W98A 3E19A 2DMOA 1YJWA 3EFOB 3D67A 5H1SV 4ETZA 5B0EA 2RQUA 4E7IA 4FYVB 3Q8SB 2DNGA 1KDNA 3X26B 1NMEB 1RWNB 5KFRA 4BUGA 4Q0BA 3A8KA 1JXVA 5KOXA 4M77D 2OKQA 4IOBA 2DIQA 4ED3A 5J3BA 1ZSGA 1ZUUA 2F8MA 1VQKT 4EWTA 2K4YA 2HBRB 1VQKQ 4NMLA 5IXUA 5C24B 1YI2S 1HBNB 3K5NA 1VIFA 1HL6A 3JTPA 3HO1A 2CPDA 1JLBA 2R42A 3H2UB 2VASA 5A0GA 3OVAA 2XSJB 1PYOB 4O3QA 2MY8A 4RKUE 1D1BA 4M5NA 1U25A 3Q8PB 2P0KA 2RQKA 4JI8J 2FPHX 2FGOA 2YLBA 4WPAA 4JS5A 2WSEC 1S1XB 4DG1B 1TVRB 2E1MC 4DV1F 2K7JA 4QIWD 4RU2A 4LSLA 3EGXB 4F14A 1LOUA 1VQ4A 2CQGA 1XMQJ 2Q1LA 4PLLA 2L3SA 3UDEA 1VQKS 1AFIA 2CS7A 1PC5A 1WELA 1X4CA 3M6VA 3NL0A 2AX0A 1N32J 1K47A 1HKAA 1S48A 2HQDA 2RJDA 2MIOA 8AT1B 1G5VA 1M1KR 1FRMA 1CJKB 4E6RA 2K3YA 4EIKA 4MFBB 2MZJA 3R6OA 1OY8A 2KO1A 1VQ9A 3HULA 4C8QC 1EQ0A 3CCMA 1WJSA 3IBCB 5L1IA 5L1LA 3T1HJ 1T8EA 3KG1A 3MI7X 1W2IA 2E5LJ 5HK3A 1OPLA 2ZH3A 4LFBF 1W2BS 1XQHA 1IBKF 1E6YB 4PKDB 2ZPGB 1U6FA 3PIOQ 4DV3F 3EVMA 2PU9B 1U1TA 4N56A 3V6DB 4Y92A 4Q2LA 5IV3A 1JJ2A 1KTQA 1VJWA 2MZ1A 3EYZA 4EYHB 3WC0A 2BANB 4TY8B 1HWKA 1D09B 2P4RA 1JJ4A 3FSXA 2GF7A 3W5XA 1B0TA 2VHGA 1P92A 1Q53A 2UXDJ 3A8LB 3GFXA 1FTRA 1SSFA 2QLWA 4PJLA 2VPXB 3C0CA 2R7QA 3T1AA 2JUFA 4OGCA 2QA4G 5KE3A 1NDCA 3UI3A 2OTLA 4M78F 3D3BJ 1R8OB 5D0HA 2VA3A 1O51A 1Q79A 2DTJA 2QASA 4NE9C 2MHNA 4ME7A 1RKIA 2YHTA 3PRDA 4OX7A 2HLTA 2QX0A 5GAN6 3EG0A 2BBEA 2U1AA 3GR1A 1KR4A 1S79A 3I9ZA 1TL7A 2JW4A 2DPIA 4ED5A 1TS9A 2HGNA 3I0RB 1HBUB 3JB9G 3TAPA 2CUDA 3T5HA 1TKZB 2IHR1 4EMKC 2X4YA 2MKJA 2ZC3A 1K0TA 5ECAA 2Z2MA 2R2UA 3SFMA 3ENVA 2OD4A 2XDBA 3C3LA 3CMAT 1LW0A 3CMAQ 4J7FA 4PJNA 1VI7A 3PW4A 1RTZA 1ZS6A 3IC1A 4IRDA 3E01A 1RAHB 2EGEA 4QBUA 3SCLE 4OZ2A 5KFCA 5HO4A 1FDNA 1PSDA 3MR2A 3CPWA 1FXRA 3OFHA 2R9LA 5IHKA 1RDRA 2RI2A 2VG5A 1SKWA 2RQWA 3K7RA 3TA2A 2CRLA 4O3PA 4X65F 4J9KA 2KEAA 1JB0C 2LCCA 2C3MA 2E12A 1R27B 4L6V3 1VQNT 5FU7B 2AJQA 2FDNA 3FBBA 1VQNQ 2BJEA 4LIWA 2K8GA 4F04B 3HHNB 5DLOA 2QLBB 5C42B 2LNHB 5GAMd 4JYAF 2NUUG 2NLUA 1XQIA 3N5BB 4LF8J 1H641 2P4TA 1C1CB 3H90A 4C2MA 2MDAA 2G2OA 4NOHA 3DLHA 4C5HA 5L9NA 4UF4A 2DH8A 3ET6A 3CCRA 4CZCA 3CCVT 3CCQT 2DCUB 3KWMA 3CCVQ 1LJOA 3IN5A 3CCQQ 1K1ZA 2W9BB 3RBXA 1RWKB 2DD5A 3JS9A 3DFEA 1CKAA 4Y2AA 2RKIB 3LALA 3N01A 1QCNA 2B4PA 4A8XA 5HP1B 3QT8A 3TZYA 1LW2A 1VQNS 2HS0A 4FNIA 4ZPTR 4IO1A 2VBZA 4HT9A 1UVKA 2COWA 2L08A 2Y8WA 1Y07A 2H9ZA 3LWMA 2I9SA 2KY9A 5HANA 1VHFA 3L7OA 5GAN8 3TA1A 5A0LA 2HW3A 3BB5A 4J5OA 3X24B 4CP5A 2IA6A 2D9TA 5HVHA 1N5SA 2KRMA 1HLWA 1SL0A 3QRRA 2FJBB 4B6MA 2VFTA 3PT9A 1Q81R 4CLTA 3MPYA 1YX2A 2KT2A 5KYWB 5B0GA 1RWXB 3JV3A 2CP5A 4P2FA 4GY5A 3CW2C 3CCVS 4U96A 3CCQS 1U0SA 2AW0A 1KNZA 1KONA 4ILRA 4X4UA 4ZTJA 4F17A 1ZM9A 3H0PA 3ITHA 1FNMA 1WHVA 2YNIB 1NRKA 2L3PA 5GANj 2FJDB 4D6WA 4DI6A 1T3NA 1K4US 4OMFB 1RHJB 1HNWJ 4XO0A 3R97A 2YXYA 1ZM2A 4B3TF 3H0FA 2VC8A 1UCNA 2F8HA 3V4IB 1V1CA 2G2YA 3UWNA 4EK2A 2M9KA 1KK7A 1S1UA 4K7QA 5LL6S 3L2VA 4M78D 3OL6A 2WTFA 2L3MA 2J0SD 1NYGA 1OQ6A 5EX3A 3V6KA 2ZBIA 2M88A 4HTIA 3KTQA 2VB6A 4EGLA 1NJWA 3A8EA 2RDDA 3SDEB 2GQQA 2ZNZA 2XY7A 3C66A 1VC5A 5HJYA 3A13A 1DLOB 3OV7A 2FVPA 2RI5A 3KJVA 2RJFA 4ZS6A 2EBPA 2HVDA 2QL5B 3W66A 2KH9A 2RVJA 1AWOA 2ZE2A 2CJBA 3O44A 3VS1A 4PYAA 4WTYA 1TELA 1HNVB 2A7YA 2KAFA 3A8OB 1VQ7A 1VYTA 1UA0A 1OV3A 4XTXA 3HKWA 3FUYA 1G2EA 4KFBA 4ZDNA 2LQ9A 1HW8A 2DLPA 3SD4A 5HMWA 1FJGJ 3W7BA 1IR1A 2Y0BB 1X4FA 3VZIA 5B0BA 4KV8B 3JB9I 3JSCA 2LX9A 1S76D 5GAMe 1JJ2P 2E1AA 4P9SA 4CYUB 5FU7C 1WLPB 4BD3A 4XDDA 3RJMB 3ONQA 3AODA 2HQGA 2DNOA 3CGIA 3PJXA 4ZVQB 3IO1A 1SL2A 2L9NA 3H0HA 1K9MC 2N82B 2IMOA 5IWAF 3MEGA 2V8PA 1GEHA 4EMHA 3EHQA 3THVA 1UVMA 5HKCA 2W2MP 2NYSA 1FD2A 4LSNB 5KFQA 3EGNA 2H3EB 3MECA 3CCUA 1ZTTA 2LDMA 1RHKB 4FP9A 2KXDA 4KULA 4LUBA 5KYNA 4FYDA 3U27A 3FRYA 5EWEA 3PE0A 3CJ0A 4ZKAA 4ZPWR 1S9GB 4H4MA 1VLYA 2B43A 3UDVA 4DV1J 4JI5F 2P0QA 2NUHA 4NASA 1QUPA 3BKUA 1HBMB 2J9EA 1D9DA 5ETQA 2CJ9A 2FEIA 2RNEA 4TU7A 3TUPA 4RKUC 3GIIA 3CVKA 3QZ9B 2EIFA 4JRKA 4ERDA 4Q5VA 1TUDA 3E51A 3KBGA 5FLXY 4PWDA 1Y10A 1W2BR 1NJIC 3DU6A 2HZVA 3M9NB 4QQGA 3DM2B 2EK6A 1SCJB 4PXEA 2J0QD 2LT1A 2MSSA 1S49A 3WDOA 1CJUA 4LFBJ 1IBKJ 3HVRA 4A8SA 2QLFB 4QVZA 4D8KA 1KOOA 4DV3J 3VRYA 5A8WB 1LVKA 3VR1A 2KRBA 3CJ4A 2FVSA 4M7DA 1VQSA 4Q5WA 4RPFA 1SG5A 1Q86T 1U47A 4FYWB 2A3JA 2CQDA 1Z4UA 1HPZB 2RQTA 1A7GE 4M5GA 1N48A 2VH7A 5LJ5g 2LVWA 1BCMA 2HAXA 1EARA 4OMOA 2YDLA 4IURA 2CXEA 3MAHA 4RUHA 1GCQA 1GMWA 1SC6A 4WIIA 2GQ2A 2OHDA 3RTVA 5ETVA 3PX4A 3WBZA 3W1YC 3OYAA 2C3YA 4RCCA 5K20B 3CC7T 3CO0P 2BEFA 3A8IA 3CC7Q 3CD6T 1AHJB 4TU8A 3G4SA 3CD6Q 2RSQA 2WB1D 4C92G 1ZA2B 4OMQA 2VYTA 2LCWA 2KRRA 2KT1A 3JB9D 3V7CA 2RQ4A 4ED0A 1OSCA 3DMJB 2HQXA 1CJTA 2ZH8A 1VQYA 5HAOA 1MWYA 2E29A 1NYFA 5ETMA 5GAHU 3NWGA 3ZEHA 2CREA 4YFUA 4WCEQ 2V8DA 4N7TA 4RWXA 3M9MB 2B4OA 3PCOB 1FVSA 4RW6A 1AZSB 2EC0A 3ZZPA 4USMA 3KMQA 1VQMT 2E9RX 5GMKe 1W7WA 4AL7A 3CC7S 4YB5A 1VQMQ 4ZVRB 1WHKA 2LEPA 1IJEB 2OO4A 4FVMA 4B9SA 2ZOMA 4ZN3A 3HSJA 4X65J 3IMQJ 4CLWA 1JLQB 2JMAA 3TZWA 1ZH5A