1PG5B

Crystal structure of the unligated (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
150
structure length
148
Chain Sequence
MVSKIKNGTVIDHIPAGRAFAVLNVLGIKEGFRIALVINVDSKKMGKKDIVKIEDKEISDTEANLITLIAPTATINIVREYEVVKKTKLEVPKVVKGILKCPNPYCITSNDVEAIPTFKTLTEKPLKMRCEYCETIIDENEIMSQILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate carbamoyltransferase
publication title Crystal Structure of T State Aspartate Carbamoyltransferase of the Hyperthermophilic Archaeon Sulfolobus acidocaldarius.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase
total genus 32
structure length 148
sequence length 150
ec nomenclature
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01948 PyrI Aspartate carbamoyltransferase regulatory chain, allosteric domain
B PF02748 PyrI_C Aspartate carbamoyltransferase regulatory chain, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.20 Mainly Beta Roll SH3 type barrels. Aspartate carbamoyltransferase regulatory subunit, C-terminal domain 1pg5B02
3.30.70.140 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Aspartate carbamoyltransferase regulatory subunit, N-terminal domain 1pg5B01
4WTOB 4FYVB 1RAHB 3MPUB 1RAGB 1RACB 2ATCB 9ATCB 2QGFB 1ZA1B 1AT1B 1RAAB 1ZA2B 2AIRB 2FZCB 2IPOB 2HSEB 1TUGB 1XJWB 2BE7D 2AT1B 2FZKB 4KGZB 1RAEB 2QG9B 3AT1B 8AT1B 1TTHB 4KH1B 1I5OB 3D7SB 1ACMB 4KH0B 1RABB 2A0FB 1RAFB 4E2FB 4AMCA 1SKUB 1R0CB 4FYXB 4F04B 7AT1B 1PG5B 1R0BG 8ATCB 4AT1B 1Q95G 1D09B 2H3EB 4KGVB 1F1BB 1RADB 5AT1B 2YWWA 6AT1B 4KGXB 1RAIB 1TU0B 1NBEB 4FYWB 4FYYB 1EZZB 2FZGB 2BE9B
chains in the Genus database with same CATH superfamily
4CC2A 5DDQC 2KXNB 4PQUB 4NWBA 4IRCA 2ZHBA 4EBCA 3M55A 2FGCA 4QWDA 3OFFA 2CZ6B 2LNHB 3ICLA 4GKKJ 4UF4A 4XTVA 1TL3A 3H0IA 4RTUA 5GAEU 2Z30B 4YB7A 4M75C 4QZVB 4KT0E 4OP0A 4ZGDB 3LGLA 5HCKA 4Q2MA 3JV3A 1UTAA 1VRUB 2ROGA 2EG2A 3AOCA 3RU0A 1R0CB 2ENMA 4Z88A 1WXBA 4FBUA 1GXIE 2F8MA 3DN9A 4AE5A 3VAIA 1IR1A 4KFBA 2ZITA 1C0UB 3GYGA 2J0WA 1UW9A 5GJVB 4RLEA 4BY6B 1CQMA 4ZP7A 2N4CA 2VQFF 1QVGA 1NK6A 4EMKA 1T9YA 2UXCJ 4WXOA 4RNMA 1WHLA 2BYCA 2WONB 1NSPA 3LUYA 4KO0B 2VDHA 4ZLLA 2OEMA 3QZ5B 2BM1A 1B07A 3W3SA 4M5DA 4WYLA 3RAXA 1IQTA 1K9AA 3EICA 3IAM9 1SKRA 1RWOB 2XY6A 2CPHA 2VB6A 2LJ0A 3EVMA 3CMAT 1FX4A 1ZZFA 2RMLA 4ECRA 2Q43A 2ZH8A 4DR3J 5A0GA 2HNZA 1FESA 4NRTA 3PHTA 1QKWA 2A6MA 5E41A 4X4PA 2E1RA 2CQ1A 1VQ4Q 1EKRA 2A0FB 2VPZB 2W7OA 2YKAA 3R7BB 2DZ9A 1UFKA 3PVLA 4C0DB 1YJ9T 2P6SA 4C92F 1QMCA 3ITHB 4KV8A 2BTTA 2Y90A 3ZBDA 2FIUA 3CMEQ 2A7YA 2DIVA 1BLUA 2CQ2A 2YKPA 4NL3A 3LW5E 1LXJA 3DOMA 4DL2A 3Q24A 2DGTA 5HK3A 2QLXA 1S72Q 1NJYA 1OJ4A 3IG1B 4ED6A 4IOCQ 1M1HA 1S1TB 2X3DA 3UO0A 1URNA 1O6XA 2XNRA 4A8SA 4M7DE 3CXCA 5D8HB 2DXTA 1F5AA 2Z2LA 3PW2A 4J9HA 1XNQJ 1UHCA 4LREA 4E2FB 1KHVA 4E7JA 5KG4A 2FG0A 1RHQB 3BO2A 5D0GA 3L2VA 2V2KA 1HD1A 3A1YG 1H74A 2J6SA 1NB7A 1XNRJ 2VC0A 4CQ1A 3UA7A 3H2LA 4I4BA 3DFEA 4X4UA 4WCEQ 3TVTA 5I3QA 1D3BA 2KNBB 5FLXY 1YITS 3C6TB 1YJ7A 2XMMA 1T05B 3CCLQ 4KTQA 4J9DA 1SXLA 1IR0A 2Z0GA 1GTHA 1MMAA 2GMLA 5KTQA 3C15A 3PM9A 1C1BB 8AT1B 1M5KC 3CCEA 5F8JA 3RBDA 4L5GA 3OYFA 1BY9A 3LWIA 2XMKA 2H5EA 2CT4A 3SFGA 2B4VA 1KD1R 1NM2A 4M75F 4CCHA 1VJQA 4ZTJA 1ZA1B 1LW0B 2EFVA 2XGQA 2PMHA 3TA0A 1AYEA 4JI4J 4BE0A 4Y00A 1UJYA 2HL3A 5DZ6A 2XYPB 4YMEA 3VGUA 3MPVA 2CZ7B 1YRTA 3OBIA 2EFNA 3MPWA 2AT1B 3CO0P 3RRHA 3HRTA 5C2GA 4G1QA 4RG8A 1VFJA 1RA7A 1VQ6Q 2R58A 1WACA 5LSLA 1G3WA 2YPZA 2DBKA 2IMOA 4MKBA 1PCXA 2AEJA 3NP5A 3SV4A 1QW1A 3ZTRA 2AHJB 5KOXA 5LJ5d 2QQ9A 1BMQB 2BA9A 3DM2B 5MLCV 2ZC4A 2JOQA 2NZ4A 4A4KA 3OXLA 2QMUB 2MYFA 4BC9A 3A5ZB 2V8HA 2XI2A 1YGYA 2H51B 1U1SA 1UEVA 4OI1A 4HI1A 3UCUP 1GAOA 3IAS9 5FRMA 1Y9OA 2YT6A 2VC1A 1KQGB 4MYTA 2NUHA 2V1RA 5KYWB 1IZ6A 3LGFA 2HRUA 5GAMd 4NA3A 3OS2A 3CD6S 3G6XA 3EHRA 3THKA 4A8WA 4JPBW 5M2UA 2RDDA 5C24B 3KDOA 3LP1B 2WCXA 2C42A 2MY8A 4N47A 1HNVA 2FVPA 2DXFA 4B9SA 1K1ZA 1NJIR 1KTVA 1VQKS 3J81Y 3HP6A 4USUA 3OLAA 2BQUA 5CD4A 4GC7A 3U23A 4RNFA 2EYXA 3F41A 3V7RA 1PC4A 3M0PA 3Q2TC 1CQNA 1MLAA 4DX8H 4TU7A 1CJVA 2DTIA 2I38A 2GCXA 2XWXA 2MOXA 2DNLA 1LXNA 1SB6A 3CCST 2VFUA 2VBYA 1YLXA 4ZN3A 1G2BA 3JCMW 3AOBA 3Q83A 1GCQC 1HNIA 1WDXA 5ETOA 1X9WA 1TL3B 2RDIA 4DBFA 2ZCFB 3MM7A 4WFNQ 3GZ7A 4M7DF 2QFJA 5D7UA 2DPIA 3CQTA 3KJFB 3HHEA 4QYZK 3ZTQA 4PJOC 2NSBA 3CJRA 1HWUA 2FYKA 5GAOn 2CGHA 1IKXA 2W10A 2HIQA 4WZQA 1E6YA 4CLKA 2NXJA 4WXWA 1Q1KA 5ADZA 2RHZA 3WDOA 2ROEA 2K5FA 2DIGA 4KFBB 4OB3B 2NXCA 1ZUUA 2YUOA 3K0JA 4ELYC 4U9RA 2ZJQQ 3SIPB 3G4SQ 1MMLA 4X65J 4OX9J 1I5OB 3RKXA 4OHYA 2BXJA 3ENQA 3T9NA 3PW4A 1HI0P 4FYXB 4EMKB 3D5MA 4DR7F 2FQQB 1WHYA 2CG8A 1LW2A 3EE3A 3KUGA 1KDNA 4BLGA 4DX7A 3DC2A 4Q45A 1VLOA 3QMQA 1I51B 4M5DB 2Z0WA 3T6JA 2W9BA 4QQBA 4DX5A 1H98A 2ZZTA 1HK9A 4LF8F 4OYIA 2FRWA 1H2VZ 3JB9F 3G71A 5J1EA 4ANEA 2AEMA 5HP1A 1KJWA 1N36J 1K44A 1UUEA 2FYXA 4LR9A 3M9NB 2CP5A 2AMCB 4F8RA 2HNZB 3FC9A 2VDIA 2GVDB 4FF4A 5HVGA 1WGSA 4HT5A 2KI2A 3IO1A 5L39A 2KXFA 3SWNC 4ZP9A 4OYWA 1SIWB 1CULA 3H0PA 2VVKA 5LOQA 3I56Q 3DB3A 1W7WA 4NXMJ 1R8HA 2A6OA 4KV8B 2HDAA 1X4AA 1EZZB 5U47A 1FXRA 1Q7LB 4GLKA 4NL2A 4EO6A 4ID8A 5ETKA 4Y2KA 4ZKAA 1UECA 1ZOTA 3S3MA 1WG4A 3DOMB 2J6KA 3GLXA 2XMAA 3ZTPA 3CCRA 5BYQA 3G6VA 1K1SA 5A8RA 1S99A 4O0IA 3D0GE 4ECZA 2JN0A 1N56A 2A18A 1JJ2R 2F5GA 2C1EB 1QP2A 1K0VA 1OPLA 3FIFA 3WVEB 3TA2A 2EKOA 5A0LA 2BX6A 2GGRA 4EUVA 4M78G 3CC7Q 1NKCA 3J7ZT 1O9SA 3VF0B 3EPIA 1R8BA 5D3GA 2FY8A 3PX4A 3ZTSA 4XU0A 4CO1A 5KT5A 2RQKA 3E51A 4MIWA 2QLBB 3DRRA 2KY9A 4HEA9 4A47A 1D3BB 1U02A 3DLJA 1WI6A 3FDSA 4RNOA 4FU6A 1U49A 1HIYA 3URGA 2N4DA 5IQQA 1HJDA 1I6JA 4CO5A 4KPYA 1P8GA 3MM8A 2CT3A 1HNZF 3C15B 1FXDA 4HH0A 4DUYF 1QUPA 2JT4A 3D54A 2KT3A 1CJKA 3JQKA 1WHVA 2Y3YA 4NLUA 1SH2A 4C6AA 1FDDA 3QG1A 1TKZA 5DDRC 2HL5C 3C8YA 4D3HA 3CCUT 1G8XA 3OS1A 4WKYA 3GONA 4HDHA 2W1BA 1UZHA 2Z57B 4M95A 4ZPWR 4L76A 2D1XA 2XULA 1NK4A 2E1PA 2E1HA 3CCLT 4TYAA 2LC4A 2HBPA 2QJ3A 1B99A 3UD5A 1H38A 2CQHA 2CVIA 2JM8A 3UNYA 3DOLA 3QWPA 1N5SA 3E19A 4ILMA 4AG1C 4CLFA 2EIFA 2MZSA 1FWZA 3J80U 1PGZA 7FD1A 3T3FA 4KGZB 1N54B 4G1QB 2ZHOA 4XO0A 5IC4B 2VPYB 1S9GA 3DU5A 2RQWA 3H59A 2LQKA 4OGEA 3TEGA 3R8YA 3ME9A 4QVDA 2G13A 5B09A 2K79A 2XMTA 1QAIA 4PFOA 4QW2A 4ZPVR 4LDWA 2A10A 3LPEA 5H9FK 1RK8A 5KYUA 4K4ZA 4CC3A 4HTIA 5GAN8 3CCJT 3DRYA 3M2RA 3E01A 4LRFA 9RUBA 1HMVA 4UUXA 1VQ9Q 2LMJA 3R6LB 2E9ZA 4Z89A 3CJ0A 1X4BA 5LM7E 5KFYA 3KG1A 1A7GE 3TVKA 1N32F 1S6PA 5CO7A 2ZOFA 3OLBA 2DAQA 2HHUA 3M9QA 1GFCA 3KJVA 3EDRB 2HZCA 3PV8A 4DR2F 5GAGU 5GAN2 1X5SA 1QVFP 4UZCA 1SUQA 2I2YA 4PJJA 2I5JA 3OA6A 4DV3J 2BEFA 3AAWB 4F2SA 3TNVA 5IN1A 1HNVB 2KT2A 2L3SA 3M4XA 4X62F 2FO0A 2FPFA 4RTTA 2C2OB 4UQGA 1WHGA 1DQAA 2YSQA 3A8KA 4PYAA 3RAQA 1JJ2A 4KQZA 2AJQA 2CXEA 3KLIA 3EFOA 4DV5F 1CJVB 4JS5A 4OYPA 2DY1A 4URQU 5HMXA 4OMQA 2G9OA 1S0VA 2QA4A 3PZPA 2ZM6J 4HCKA 3JCMc 3Q8UA 5GAOm 4AXJA 3RESA 4OI4A 3UCGA 4GKJF 3GF5A 4XDDA 5JVGQ 5D4OA 1HNIB 1KHWA 4BC7A 4CM0A 3LP2A 2E12A 4NCGA 3GG0A 1MWQA 5LJ3g 3MM7B 3VVTA 2V4JA 1MN7A 2QQBA 4TXSA 1DLOA 3UPUA 4NYPA 2KFYA 3ASKA 1M90U 2HLUA 2V8GA 1X9SA 2K5IA 1VQOA 5GANf 2UUCF 1YK9A 2W2MP 3VS2A 1IKXB 2K7KA 3HHLA 1D1AA 2HQFA 4C3LA 2J6FA 4AFUC 1E6YB 3RBZA 3M4GA 2AJ2A 3Q0AA 1W2BA 3AH6A 4YR0A 3J7YI 4N8NA 2ZBQA 3Q8VA 4DU8A 2PEHA 4CH7A 1PHTA 2DXBA 1ACMB 4DCJB 2R5AA 7AT1B 1ZSZC 2R7UA 4Z7YA 1LW2B 3NTKA 4AL6A 3PJ9A 2IA6A 2IVYA 5HSPA 1W70A 4JV2A 2UVRA 2W9BB 3CD0A 3C6UA 5IT9E 1SPKA 1AROP 1D9DA 4HVVA 2M1HA 4JYAJ 4B02A 2RAQA 1V3SA 3J7AN 3D6TB 5J1EB 3IC1A 5KFQA 1WOSA 5HP1B 2CNKB 2RHXA 3SSSA 1KHCA 1GT8A 3OMGA 2YPYA 1X7VA 2R3VA 2KGTA 3QAEA 3H0HA 1S1WA 2FZCB 2MLYA 4CI0B 1CULB 1LWXA 1RCXB 4A4FA 2CRLA 3O2IA 4PKCC 3GYNA 1WA7A 1SRMA 2HKQB 3EGNA 2XCPA 1G7CB 1OPIA 2EWHA 1K73C 4WP8A 2AP6A 3LH5A 2VG6A 2B43A 3DLGA 3CCQA 1FTCA 1H72C 1WJ9A 1A0OB 3LPYA 2K2PA 3VGVA 1YIJA 4TQRA 3G96A 4A8YA 2QQRA 4AFQC 1T0HA 3CJ2A 5A8RB 3DKMA 5HK0A 3NWGA 2CP0A 2F69A 5KFGA 1ICEB 5A0YA 2E1MC 3NNAA 3WBZA 2RQ4A 2L9DA 4Z2XA 2YQ3A 3HZGA 1XWLA 4TU9A 1B7FA 2DVIA 4QYZJ 1JB0E 2OTLT 1RISA 1OV3A 2ASDA 1FCAA 3KMQA 1BQNA 5D3GB 5A8KA 3G9CA 2BM0A 2B5JA 2E4HA 2FC9A 4NZ7A 5D0RA 3V6JA 1BD6A 4N8OA 2KVIA 1H6KX 1TXQA 1HWLA 3QRPA 3HSJA 2KVQE 2OP5A 2HZVA 1BXNA 1YCYA 5D4NA 2COWA 1FJCA 3PXGa 2QXFA 2BOPA 2DL7A 4WU3A 2HWTA 4R0KA 2UUBJ 3A1PA 4M77A 3H20A 4NMXA 3CC7T 5KFOA 4LBIA 4LFCF 4F4XA 3P6YC 2HS4A 1CJKB 2W9CA 2HBYB 2XDBA 5KT7A 3LO3A 4WP9A 1FNXH 2I0NA 1TKZB 2QI2A 1UE9A 4A8MP 3KKFA 4DOWA 3NAIA 2CSIA 4M75G 4PRFA 2GJIA 1NHUA 3WQPA 4DV1F 1VQPT 2I0XA 4TY9A 5HL7Q 4M5KA 5HVFA 3DOLB 2BKDN 2XSFA 4JZ4A 3GG1A 1VQNS 2HPUA 4DR6F 2YUNA 5HLFA 2GQQA 2APOA 2J8AA 1LWFA 1L3VA 4KH0B 2B86A 1S9GB 4CLZA 1I81A 2XO7A 2QO3A 3VAMA 2CPFA 3GJSB 1PSDA 1U48A 4FW1A 2OI3A 3V81A 5BR8J 1LNXA 5CCAA 4Q2LA 4A8FA 3W2VA 1TL1A 1UB4A 1RJJA 4NRUA 3CCMA 3NOCA 3GIKA 2LMIA 2Q6BA 2OAUA 3E01B 4C0GA 1HWKA 3T1YF 4DFJA 1HMVB 3H5XA 2UXBJ 2V9KA 3RUBL 5J2PA 3IA0A 1T8EA 5JMNA 3N28A 1MV3A 2KJVA 1TFYA 1GCPA 2AGQA 3D67A 1QE1A 3QO9A 1KVIA 1S6PB 1XMQJ 4Q5WA 2OMOA 1N34J 2HD0A 1Y3KA 3OUYA 1FJEB 2J9DA 3NS7B 2O01C 2CDRB 5KT2A 2KE9A 2D3ZA 4CYUA 2VL1A 3KJVB 4IUFA 3MCAB 2WSCC 4V19J 1RHJB 1KS2A 1Q78A 1SUQB 3LQVA 5HI7A 3LGNA 4B3MF 1IB8A 1RHMB 2I5JB 4QT7A 1N33J 3AQPA 4P6QA 3FBBA 3FBCA 4ZGJB 3VZHA 1REGX 1RE1B 2ZZNA 1NAQA 3KOAA 1UGPB 5A6PA 4KGXB 1N52B 4LT6A 3FUYA 3N4WA 3OFHA 3M59A 1M90T 3CCVT 1R0AA 2G2ZA 2GX8A 3KLIB 3EFOB 1PCAA 3G6EA 1U8WA 1JLAA 4ZS6A 4OF1A 4WBFA 1U4BA 1NKEA 4B9TA 5GAOp 3UN5A 3KNAA 1YITQ 4ECYA 2NPIA 3FBEA 3M5AA 4C9DA 2NYHA 5KE3A 3M0TA 4NCGB 3MEKA 3W8PA 4BI3A 2QLWA 4OVAA 4ECXA 3OTOF 2V4JB 3QT8A 2EAYA 3CXCP 5SZTA 1DLOB 1OY6A 4DBHA 1RLCL 2PZ1A 2DVJA 4HCZA 2OUGA 4ZCLA 2RHUA 1RWWB 2HSEB 3HSGA 1T7PA 4LSZB 2FC8A 2E5LF 2HQEA 3HHLB 4TKTA 2AYEA 2EJGA 1YBUA 1B0PA 2HVIA 5BXIA 1FRJA 3META 3A8GB 1B0TA 2CIMA 1OU9A 1YZ6A 2VWFA 3OJUA 2R2TA 3PIOA 3CEDA 2LXFA 5E2QA 3MMJA 4BCAA 4C11A 2XLIA 3H5SA 4NEYA 2V6AA 4HCBA 2EKNA 2MZJA 4M7AC 4AQYF 4RW4A 2HHVA 4LIRA 3C6UB 2OFGX 2AZ3A 1LK7A 1WUUA 1NLOC 1KOOA 1LVKA 1S59A 1YRUA 4O3SA 2YNGA 4PCQA 4WTYA 2MKYA 4EI2A 4TYBA 2DR6A 4ED4A 3DI6A 3QRQA 2FVCA 3DLLQ 2BMBA 2VA2A 1S1WB 1F0XA 3IBWA 2DHXA 2A2CA 4J90A 4P73A 1RBOB 1CC8A 3ILOA 3LH0A 1SJFA 1PJ6A 3DLHA 2RN8A 2LKZA 2VG6B 2F8EX 2R7SA 1RT6A 3DLGB 4UT4A 3CMAA 2HHQA 1M1KC 1R8PA 2GQCA 2ZWPA 4MJKA 4DSEA 2JMCA 5CAIA 3MEAA 3T9ZA 3CD6Q 5EWFA 5EHHA 4B3TJ 4ZMMA 2PU9B 4Y91A 3QJPA 5A0YB 2QL7B 5GAHU 1NZ9A 2SRCA 5FWCA 5CH7B 1L5UA 3S3NA 2F63A 1B4SA 5CK9A 1YJ9A 1ZM9A 2VFVA 2VIHA 4ECQA 3N79A 2DBMA 2PGCA 4J9VA 2FHJD 3EFRA 1VQKQ 4JI6J 1AXQA 1F9HA 4J9PA 2P0QA 2BZ2A 1I07A 1DTTA 2RT3A 4KRWA 5DG7A 2DNNA 1Q81U 2CREA 4XQ3A 1BQNB 5A8KB 1VUBA 2B5JB 2DL5A 4A4JA 2CSQA 3W5ZA 3G87A 1HNXF 3FCVA 2R7XA 5CQXA 1UEKA 2FLNA 4IYQA 3BBFA 4RX6A 1HQEA 2BUDA 4M4ZA 2P9GA 4M77B 3FEOA 4WTOB 3ER0A 3M8QA 2BKNA 2W9CB 2JTEA 2IVMA 2QG9B 1FNOA 2WOMA 5A8WA 3CWJA 1JXEA 2G2OA 2E9TA 2VBWA 4WCIA 2E3IA 2V68A 2DGSA 1Q82C 3JCMf 3M2VA 4PJOG 3R97A 2M9KA 2KG0A 1RWUA 3G8SA 5LJ3h 2X35A 1HXDA 4BY6C 3HHTB 1P27B 3GFZA 5CA5A 4PAAA 1H3DA 2CG4A 4RW6A 1Z2LA 2J5AA 1D3WA 3CXCS 4GMKA 5HLFB 1RAAB 2XHCA 5KFWA 3OW2A 3BS9A 2H4YB 1LWFB 5L8RC 4HHJA 2VGMA 4UY85 4NEZA 4PG7A 3H2VE 4G65A 2CP6A 4B9WA 4KGVB 2ZBRA 3EGZA 2DX1A 2VQFJ 3V81B 4IKAA 2D0NA 2Z2YB 3W2VB 2CADA 5IFMA 2HNIA 1VHFA 3HO1A 3RW7A 2OIHA 1TL1B 5JXSA 3TO8A 3EG9A 4M5GA 4XTXA 2UXCF 3D0HE 4EO8A 1IQZA 4W98A 5FIIA 2M51A 2L3MA 5J2PB 2DYBA 1NSKL 4YEAA 2CFXA 3CCES 1QE1B 1K73U 5IT9U 4FSSA 3OUYB 5GMKm 1X5TA 4CYUB 4FIBA 1AB8A 3BDPA 2W2QP 2DYAA 4JRPA 4DR3F 5I3UA 1FA0A 5G4DA 2VZ9A 4DV2F 3REAB 1BC6A 2I9SA 2HQCA 2YUQA 5KFTA 3M6VA 2JW4A 1OY8A 1RLPC 2IDLA 2X4YA 1FE4A 1WXTA 3KDNA 2ZJRQ 4ZVHA 4ELZC 2GIFA 1OU8A 4X66F 1DURA 2LFVA 1UVIA 3LAKA 3M6WA 4XIUA 3HLUA 5HY6A 3T1HF 3A8EA 3ZZUA 4C8NA 1WG5A 1XBWA 3GIBA 1R0AB 5KYNA 4R0EA 1AWXA 2H65B 4ECUA 3JAMU 2YUPA 4L74A 2KL8A 5L23A 2OTJT 1S6UA 2JDJA 2LDMA 1PRMC 1TUDA 1T3LA 3IWNC 2VV5A 3I55T 2JS2A 1RUWA 4NLOA 5KFLA 2YXYA 1XJWB 2X51A 3T5KA 1JXVA 1TKTA 1N8RC 4MIAA 2D9TA 4OI0A 2P8IA 2N3OA 2MCNA 1H7WA 5GMKi 5IV3A 4C5GA 3OYMA 5D4PA 1AEYA 5DLQE 1XNRF 1DBDA 4LMZA 4YTLA 1YSJA 3OB9A 4J9MA 1KQ2A 4EBDA 3Q86A 5AYFA 3CCSA 4URGA 4TU8A 4M77E 2H48B 4PFZA 1LFPA 2CP2A 1Q8BA 4Z7CA 4FM4B 5IWAF 1BK2A 3KHGA 3BR8A 1W6XA 4C11B 3BYRA 3W5YA 3W9JA 4NL5A 1OYEA 4XTYA 2ZHAA 1OSDA 3RBEA 3MP1A 4RW4B 3QDRB 1X4GA 1FRMA 1RQ0A 5CVIA 3HK2A 3HKWA 1TV6A 2AKKA 2AJFE 2AKLA 4D8DA 4DUZJ 2EFPA 1EQMA 2MZRA 4DL4A 4C8OA 2YNGB 2R7QA 1T03A 3DI6B 2EEYA 3X1LB 4MDXA 4CRJA 1D0ZA 1NEBA 3AFGA 1JXOA 4JI7F 1D0EA 3L09A 4QWBA 3VGSA 2HWHA 4IG0A 4DR1J 3C46A 4A54A 4HL9A 5E5NA 3QSUA 4JZ3A 1RI9A 4NZ0A 2L9NA 1Q81T 4RMOA 1O5JA 4DA4A 4ZJOA 4LUDA 5J26A 1RT6B 1VYVA 2W2NP 3TX8A 5C42A 4ED8A 1VRQC 5KFDA 3Q1JA 2EWNA 1VQ8T 5CQGA 3OBWA 3H25A 3JQMA 1Q95G 1NE8A 5KCHA 4PWWA 1S48A 1XEZA 4YY3J 3R7SB 4F7UF 1G6BA 2EVRA 4CWBA 2QQSA 5KOWA 4DCOB 2RB6A 1NPPA 3M53A 2FGOA 4FVMA 3HT0A 1DTTB 3M8ZA 8ATCB 3C14A 2V4RA 3CO9A 2KJWA 3BKFA 4RTZA 1C4AA 3L2WA 3JXOA 3THTA 2IRXA 2OJ2A 2PI4A 4TVRA 1D8ZA 4ME7A 5LJ5f 1YVFA 3VZIA 2RIJA 3VS1A 3J7A1 1HQEB 3KLGA 1YJVA 4B08A 3D1OA 2YRVA 2UVUA 3OPKA 3P45B 2MLXA 1RAIB 2DJWA 1LV5A 2KEAA 3R6GB 3M8QB 4Y2AA 2ATCB 5DLFA 4Y2CA 3BM7A 4MKYA 2WOMB 5A8WB 1N6AA 1PKUA 1K1QA 3SDEA 2A1BA 2DNUA 1Q86C 3HMJG 2LCLA 4CH1A 1JJ2P 1IKWA 2MJNA 3M0RA 3M2VB 2VQEF 2BE9B 3I5BA 5C6SA 4KIAA 3CCRS 5GAMf 4C3MA 1WI7A 4DHVA 2XS2A 3R6OA 2BZYA 2IYIA 3H2UB 3Q8PB 5E3PA 2O2OA 4RW6B 2EGAA 2H1YA 5CHCB 1RU2A 1DQ8A 3CCUA 3LYIA 1RWMB 4FW2A 4CO2A 1K73T 3OSVA 1B34A 5D78A 2BZXA 5LMUJ 2RA2A 3CCLA 4X4SA 1RU1A 2CPIA 3I96A 4LRBA 2FTRA 4DR7J 4E7SA 3GBQA 1GXUA 4A53A 1T9UA 4X65F 4J5YA 1E6VB 3PE0A 3PYEA 1TMMA 1N5QA 3EG9B 5GAGI 3BDLA 3VKIA 4LF8J 1AZSA 1BI1A 2JLFA 2NUTA 3M32A 4YOEA 4QIFA 2EBGA 4R56A 3X20B 1ZH5A 3VYHB 1NLPC 1UCNA 4QIGA 4RR5A 1ZBJA 4C3KA 3ZZ0A 1ULRA 2ZOGA 2HFVA 2COYA 5EUHA 1NYGA 2VASA 1SC6A 3HPOA 1N36F 3RRKA 2MHEA 1M1KU 2RD1A 2CS7A 3NXZA 1PAUB 1D8YA 5I3UB 3JCMQ 3CCJA 2MSSA 1P1TA 2GFFA 1WDTA 1WJQA 1UG1A 3ZZYA 3BDEA 2VPWB 1KTQA 2ATLA 3GR0A 3PYDA 3KK2A 3DLKA 5FJ4A 5FU6C 4RL1A 3HVRA 4JRQA 2RHQB 3PKMA 2CZ9A 1NKBA 1QVPA 3O3LA 5GMKe 2MQPA 4HT8A 4M78D 1S9FA 3BV8A 1P1LA 4IR1A 3RKYA 4C0ZA 1U25A 1KC8C 2QTWA 2E64A 2HVZA 2LT1A 1KOHA 3PO4A 2ZNYA 4GVLA 1KN6A 1XQHA 4OYOA 2HHHF 4WU2A 4C8QG 1TKTB 3QIDA 7FDRA 1GMUA 1K8AU 2GIRA 3HTRA 3H90A 3K89A 2RJEA 2HS0A 1B64A 5ETNA 2MMYA 1UGSB 2DD5A 2UU9J 2B56A 1F1BB 3GJQB 2CQIA 2ILYA 1EX4A 4I1TA 4USTA 4J5OA 1WXUA 4A46A 3B4DA 3JB9I 1VYAA 2W01A 3EZUA 5ETPA 1MNDA 5K5MA 3K7RA 2PDAA 1RAOA 2XK0A 1X2QA 4JS4A 3MP6A 4OMLA 1RAJA 4R5PA 1VQNQ 3DGVA 5K8NA 1B7TA 3MFIA 5C0MA 3U1LA 2RE1A 2QYZA 4KHPJ 3TREA 1JJ2S 5LMNJ 1RAGB 1TV6B 4OMFG 2HEQA 3QWYA 3CJ8A 4OJGA 2YTCA 5HO4A 1H2TZ 2CQBA 3MUMP 1T03B 3PMIA 4C92A 4PR6A 1FVQA 2QN6B 2QA4S 1YJTA 3M54A 2BJ1A 6AT1B 3KK3A 2FJXA 3K59A 4J9GA 3UNGC 4I69A 3QPHA 1YCSB 2ASJA 4ZGEB 1PKSA 2FHOB 5EWEA 1IN0A 3D6HB 3MPYA 1J3TA 3NPFA 3ENAA 2ZD1A 3LH2S 4IG0B 3UI3A 4RBUA 3TR5A 3FQKA 3X3UA 4ZHRA 2FL7A 1VQOS 3N6LA 2DM1A 4PG8A 5GAN4 4JLGA 2Y1LB 1NG2A 5C42B 4RUAA 1RHRB 3HCXA 4DWIA 3I9ZA 4M78B 4JB8B 1RKIA 5F9LA 1JX4A 1JQQA 2HFOA 3UF4A 2HK3A 1W2BS 1YBTA 5EC7A 4DN0A 5GVQA 1UGRB 3FGVA 3M8SA 5DZ7A 4P2FA 2LDYA 2JHEA 5KFCA 2DTJA 1PSEA 4DR2J 2OD4A 5E7OB 3MGJA 1T3OA 1Q79A 2HFSA 2CPYA 3O44A 1WF0A 1E6HA 4OLOA 2MPXC 1HI1A 3C14B 4MK9A 2KMTA 5GANd 2EKYA 5LJ3e 3W66A 4DSIA 5HATA 3QGGA 4PG6A 1M90R 3M9OB 1AWOA 4R8UA 2OSQA 1IBKJ 1RI0A 3KWMA 3TUIC 3KLGB 4KYZA 2G4BA 4FT4A 4M75A 2A3JA 4DV5J 2FLLA 1N8RU 2XG8A 3ISND 2OTLA 2H54B 3OTDA 3OR1A 5L38A 1XR5A 3GLJA 3DLMA 4ID5A 2VGNA 5HQ8A 3SDEB 2YWHA 2EPIA 3TU4K 2AF6A 1VBKA 2FUG9 4J91A 4LD9K 2UUTA 2FJEB 1IKWB 1HR0J 4NS5A 3QT6A 1RT7A 3CCQS 2RH2A 2MYSA 4IO1A 1BI2A 3GIIA 5EWGA 2C0TA 2DH9A 1YIJS 1SF9A 1BIBA 3CC7A 3FZBA 2QASA 3P8DA 4F0HA 1KD1C 4OZ5A 4JJBA 4MT1A 2UUCJ 1TMJA 4NXNJ 4IOBA 3MCNA 2V8IA 3OL7A 4USHA 4DSFA 1VA7A 4F2RA 3OS5A 1FK9A 1WNLA 1U3OA 2D8HA 2E5HA 1JLFB 2BANA 4NLTA 3RBXA 4B3OA 3ILJA 2DNGA 3KJNB 4HXJA 2ZVSA 1B34B 2WVDA 1KVJA 2R9LA 1Z4UA 1M1KT 1VQPA 4M7AG 3R9LA 3OYBA 2JEFA 4ZPAA 1XTDA 1JU5C 2GBQA 5KFBA 3ZZOA 1RUSA 3RYLA 4LUEA 1JNZB 3K8WA 2C0OA 4OX7A 3L2RA 3GJRB 3DXBA 2VJUA 1KKHA 1AZSB 2WAQD 4QPXA 5GAOq 3K58A 2NUTB 2E5JA 3M32B 4PEOA 4MMLA 5THWA 3IBFB 2LQJA 1M2VA 3W2WA 1KHIA 3MM9A 5AE1A 1LFWA 4JYAF 2YLCA 1YJWT 3IRWP 3IFEA 4NYOA 4B3RJ 1DARA 2VXEA 5HK4A 4EK2A 2F9DA 2RQTA 2U2FA 3IR5B 4OMNA 4FYDA 2K7AA 4RCBA 2C3UA 2KXCA 2EQUA 4C5EA 4TNOA 2HFZA 1U1LA 2RQVA 4X64F 2DK3A 1HHSA 1OQKA 2GV1A 3KK2B 2OPSA 2DHHA 1K8AT 2QGGA 3RMSA 4H4OA 1SCJB 3AHPA 2YVSA 1OX9A 4MTPA 4WJBA 4M78E 1U6FA 3X26B 1IR2A 4BACA 1BCOA 2CYYA 2DO0A 1VQ5T 3FFIA 5K9FA 1YG0A 1NJIC 1WDDA 4CM2A 1MN9A 1Q82T 1KRPA 1IGQA 3OHBA 4OHVA 3DCAA 3QNWB 1BI0A 3VS3A 2Y1RI 2QTXA 1S79A 3PFEA 3MR7A 3I0RA 4E7LA 5DG9A 1WI8A 1Q53A 1YJUA 3CCMS 2MQLA 2FB7A 5IXUA 3CCVA 3W63A 1WD6A 4Y34A 2LEAA 1OS5A 2M8HA 2W7PA 3KLVA 1HQUA 3GCWP 3SCLE 4CH0S 2WSEE 2DNKA 1OQ6A 3BQ1A 1XMOF 1N9SA 2B4UA 4RWWA 2G1HA 2RQCA 2MIOA 3CTRA 1RAHB 2IM0A 5HQLA 3A12A 3LX7A 2LU2A 5IHNA 4NA1A 4B17A 2K57A 4LR8A 1O8BA 2CPEA 2UUBF 3MZIA 1DAXA 3WZ0A 4M75D 2XG8D 3PNIA 3T6BA 2E5QA 5I4MA 4OI2A 4DR5F 1NPKA 3V6KA 4R5PB 1S7HA 3MD1A 4HVWA 1U2FA 3SEOA 1AW0A 1BWVA 1MWYA 1QAYA 1UAWA 1KQSP 4DV1J 3MM6B 1VISA 3EAEA 5GANe 2V0NA 4ZLJA 2XLJA 5LXRA 1PBAA 5D4LA 2O67A 3EG3A 3K5PA 1S10A 3G6ES 4K5SA 3EVOA 4J9NA 3TWZA 4DBQA 3MD3A 2NREA 3QT5A 2J9EA 1VDHA 2FLPA 3DRPA 2U1AA 2GJ2A 4C92B 1BWEA 2DISA 3BGOP 3CDUA 3KK3B 2PA3A 2EK6A 3S1TA 2ZPBB 3QFWA 1WC1A 4EWTA 1S6QA 2YWFA 2JMAA 5GAHI 2HVHA 2QA2A 1QUVA 1Y00A 5CKBA 2ZD1B 2AD9A 3LAMA 1DJ7B 2DXEA 2JS0A 5J2QA 1MG7A 5DDOC 2D69A 3KXDA 2RM4A 4LN2A 4EBEA 3CCEQ 4ZHRB 3V8KA 1WHHA 3I6PA 2HIYA 3T1YJ 2L89A 4EMGA 3MOZA 4DV6F 1H2UX 2BJDA 1NRKA 4PXCA 3P49B 2RVJA 1V3RA 3OFGA 2JTMA 2DXUA 2O3DA 2E6NA 5GMEA 3FCHA 1K47A 3HPWA 4IR9A 2M16A 1VQMT 1N8RT 2XMWA 3BN4A 3GFHA 4F7UG 2HVDA 3NGUA 5CKDA 2DMOA 2JNGA 3EM1A 4B3MJ 4DL3A 1C0MA 3JSCA 3BW1A 5FROA 2OX7A 1JLQA 5F8LA 1M1GA 3UQSA 1KC8U 2CZ1B 4ZVQB 4LXCA 1N33F 4XTTA 3NWRA 4HTJA 2QTVA 1GCQA 1F2HA 3CJTA 1U0SA 3QSIA 2GFUA 4R8UB 4M5IA 2VKNA 3SB2A 3HKSA 1IGUA 3SXLA 1HW8A 1WYXA 2NYSA 4DN9A 1UKUA 4CNZA 4M75B 3QAUA 4DEZA 2J0QD 3W5XA 3OR1B 1B3QA 1QSLA 3A8OB 2LQBA 4J9SA 4CC7A 3RTVA 4ID5B 4MIBA 5DS7A 4PYDA 2MQQA 1M5HA 3AQOA 1NZAA 1VBZA 5IXFA 2CH4A 1HNWF 4M78F 1LK5A 2YH0A 3GNGA 5CCLA 4Q8FA 4LNPA 1RT7B 4LVNP 3CMAS 1OWXA 4BD3A 3OTOJ 4E8UA 2G0JA 2C3OA 3SCJE 2BQRA 3B54A 1IO6A 2DITA 4KBIA 2P6TA 3G2XA 4CZCA 1PBUA 5KFVA 3UDLA 2BW7A 4DQPA 1VS3A 4U8VA 2ZUAA 2HQIA 5AT1B 1YJ9S 1VBYA 1F60B 2BANB 2HNDA 1JRIA 3GIMA 4B3OB 2BV3A 4DPUA 1WEXA 4FKXA 3BB5A 2YWGA 3PW5A 4OMPA 3RDVA 2JNJA 4CT9A 3MP8A 4DPOA 2QSWA 2XBPA 4N4GA 2FJWA 3HT3A 4OQJA 1J5EF 2AZSA 3QXEB 2POKA 1WTFA 1F6TA 1SJQA 4EMDA 5L1IA 3SWNA 1Q8IA 4AQYJ 3VAFA 3HZEA 4ZVTB 2EC0A 3JTOA 2DCUB 1QVGR 2MEWA 5IHIA 5D0HA 2QV6A 3UN2A 1V29B 3BGLA 5HAOA 2LCCA 1JEGA 2V34A 3MR3A 1M2VB 2HVEA 3W2WB 2ZH4A 3MM9B 1U8SA 5HROA 5GAOr 2FEIA 4QOTA 3CJKA 4ED3A 1FJ7A 3HSBA 4C92E 2GW8A 2J06A 4H4MA 4DZ6A 2MWPA 2JLEA 2RUGA 1Z9QA 3NMZC 2GHPA 4Y65A 4OYMA 4NLPA 2WK4A 4CLUA 4DSLA 1NDKA 2HCKA 3A13A 3OBYA 3CDBA 4I2PA 2CUDA 4FYWB 4NOYA 4E7HA 3QZ8A 1M3AA 3QQCD 4CNYA 3SQGA 2OPSB 4FVCA 2E29A 2L8DA 4OZNA 4K2JA 3B4MA 4J9QA 3H42A 4P10A 4H4OB 1FMWA 1AUSL 1Z1ZA 3REBB 4IURA 1FXLA 1YBAA 4U67Q 1TVRA 1UW4A 1WEZA 2YRDA 4DEYA 1H92A 3FFIB 3QWUA 1G4CA 2ACMA 2W2PP 2VF3A 2MK5A 1MU2A 1Y4ZB 4B3TF 2GJFA 4ECTA 1LWEB 5E3RA 1FKOA 4P71A 3JCMd 4WK1A 2X4XA 1AWJA 4IQMA 5B08A 3I0RB 4BS2A 2XYGB 5KT6A 2UUAJ 4DF4A 1SJ1A 4RJVA 4JI6F 2V2QA 2JVVA 2GS8A 4MYUA 2LXUA 4EYIB 3JCMV 2CZ4A 3M57A 2JJ4D 1HQUB 2RS2A 1ZAWA 2GTJA 1NXIA 3BDUA 2OTJA 2RS8A 4KE5A 2MKCA 2RQMA 4M75E 3I55A 1FEHA 3DDIA 5E33A 3RW6A 1VQ7T 3OL8A 3QYYA 2NQPA 3NLCA 3Q8QB 4Q0BA 2IIHA 3GIRA 2PE8A 1WEYA 3CCRQ 4PJOD 3RRGA 1HBOA 5KFAA 1SL2A 1RBLA 1AT1B 3CF5Q 5KFIA 1WWHA 1UJ6A 3EZOA 1ARKA 4P7TA 3GJTB 4FL6A 4A8XA 4P52A 2O5DA 1R6VA 2DNYA 4E7ZA 2IYGA 4DOVA 1FFGB 4R0JA 2B9WA 1SL0A 3UD3P 2EKHA 3VS7A 1TL4A 3J80E 4ZP8A 3DHWC 2CP7A 2NYIA 3NCRA 3O6QA 4AFSC 3DRPB 2GQIA 1S7IA 3FNNA 4JJDA 3N6MA 1IJFB 2F3JA 4Y92A 5K14B 2ZKUA 4C48A 5DQGA 1O75A 1S6QB 3PT9A 5GAN5 2WSFC 2E10A 3MAHA 4DQQA 2ZH1A 5J2QB 3CW2C 2CZVC 4K4TA 1SJ3P 3WIUA 1YFNA 2EYWA 3OTEA 2KQWA 3OL6A 3T5HA 1HFEL 3I0SA 2DETA 4H4KA 1KC8T 3OYIA 4O4RA 1X69A 1T0TV 2RMOA 1TAQA 3CCSS 5I42A 5KFSA 1H3ZA 5T14A 1Q7YR 3CGIA 4FKYA 1U6ZA 2XHWA 3TX0A 4RUGA 1RAFB 2R7OA 2DYIA 2QDLA 2R7WA 4WFBQ 3H5UA 1K9MU 4QW9A 3C3LA 3V6DA 4GY5A 1VBXA 4NMLA 2QX0A 5KAKA 2GVDA 2YX4A 2GVZA 4IUQA 4DV2J 2X1FA 3ENVA 1FWLA 3BN7A 4JV1A 1MNEA 1CJTA 2ZDOA 2EFQA 3EFSA 4Y0FA 2O1PA 1JLQB 2GHVC 2XI9A 1VQ8A 2Y1JA 4PLIA 1EETA 4X66J 3T1HJ 3BKUA 4BDPA 2DRBA 3X28B 3ZNJ1 1HQ2A 1IJEB 2M9UA 2X1BA 1OZ2A 3WXMB 1C1CA 3N5BA 4YR3A 3PGGA 3SSQA 1MHNA 4IIMA 4BBYA 5CR2A 1RB0A 1NHVA 1N4LA 2NLWA 3NS5A 1JLBA 4OIXA 4KY3A 4K2XA 2M0GB 2GQ2A 3HFOA 4ICLA 1MW7A 4NYZA 3FDRA 2QLJB 4O3PA 1Y0HA 2BKPA 2L3RA 2EQMA 4I6WA 2NR0A 1S1UA 1GEHA 2V94A 3R5BA 2XO6A 4K59A 4LRAA 5GADU 5CYJA 3NNCA 4X4VA 2XYHB 3R5DA 1Y7PA 4DLGA 3UR0A 2HNDB 5A2QE 3K5MA 3MEGA 1Q8LA 3F44A 5IWAJ 4J9UE 1CEZA 1KIKA 4IO9Q 2NXNA 4ELVA 4UW2A 3UA6A 3IXQA 4MMOA 1KSWA 3SWNB 4G1PA 4HKQA 2XS7A 1N9RA 1PAEX 2ZNZA 3AXKA 1RWNB 2QA4Q 2HHPA 2DR5A 2PT0A 1EFNA 1FVSA 4J6WA 1YI2T 1MUZA 1D9FA 2X1GA 2ZBPA 4DX6A 2HZAA 1S9EA 3RZAA 1ZPWX 3E3XA 2ILZA 3WC0A 5J2NA 5HROB 3ZXWA 3CJKB 4JBCA 1WJSA 1WF2A 4DUZF 1T9VA 3RGIA 5LL6S 3TOQA 4HLBA 2BE7D 1KFDA 4H4MB 1V3ZA 1VQOQ 1KSPA 1YBYA 4JI7J 3BGFA 3BH7B 3FSIA 1IREB 1Y57A 4I2PB 3J80Y 2EFGA 3LGMA 5HJXA 1RHKB 2J7WA 4B9VA 3HM9A 2JWNA 1S4EA 4WWSA 1NDPA 3JSBA 3SQGB 4DR1F 4IRKA 2A08A 5GMKl 2CPJA 2MQMA 3FRZA 3SFMA 2J7UA 4HI2A 3ZTOA 1E7OA 2A2DA 5KFZA 2E5GA 1TZ0A 1WTBA 2FLOA 3CCUS 1TVRB 3KG0A 3QRRA 4ITSA 1WHMA 5KT4A 2ZBCA 3VCDA 4RTYA 1FMVA 3TZZA 3DDKA 2QEXT 3OYEA 3KYLA 4RW8A 3G86A 3RG6A 2LJ3A 3QZ7A 1YWOA 1MU2B 3KTQA 4KC5A 2SXLA 1FKOB 2BBEA 2ALYB 4LF2A 2DK2A 3BF4A 2KYZA 4YY3F 4PXEA 4UY8T 1I1JA 2JL9A 5GMDA 1FXXA 4FNIA 1YWXA 4F4AA 1WKLA 2W25A 3NCQA 4RW9A 2GF7A 1M3BA 4B9UA 4X9DA 1Q4RA 1EKSA 4AFFA 2RJFA 5C5JA 4USIA 4X84A 1UFLA 3MKDA 1S1XA 1X8DA 4KB7A 3I4HX 3EG1A 1HBMA 4F3QA 2FVSA 1UVJA 4WFAQ 3QWXX 1CS4A 3X24B 5B0BA 1S0NA 5ETTA 2H9ZA 4PJOE 1VQSA 2MHNA 3CCQQ 1HKAA 3CCJS 3OV7A 4M94A 4Q0BB 3BGRA 1FO1A 1HW9A 1YIJQ 4WIIA 3UATA 3HDSA 1HBOB 2CQ3A 1U1MA 2FJDB 4K11A 4DEXA 4QKUA 2VQEJ 2PO4A 2W4CA 4C0FA 2VA3A 3NKYA 4J9LA 1BB9A 2OO4A 4UQTA 2EC2A 2N7YA 1ZTTA 4WFYA 4ZPCA 1ZLMA 1WFWA 4YB6A 2RK1A 4QU6A 1UPMB 3Q8YA 1RAEB 1GXTA 5T7LA 3CC4T 3CEYA 3TJ8A 3RB3A 3GMGA 4G1IA 2KH9A 2KYBA 1K9MT 3BEGB 1NPRA 2HMAA 2DIUA 1OZ3A 2XDPA 2LQ9A 4LFAJ 5DO2A 2QGFB 5LMUF 3S6WA 5IH2A 3QIPA 4O3NA 4ILRA 2ZBIA 2HBZB 4O44B 2D3O1 1P92A 3QIIA 2XY5A 3I0SB 2F5KA 1NJIT 2OSRA 4F4WA 2V2VA 1CSJA 1D1CA 4X1VA 4F50A 4TLRA 1VI7A 4DJBA 4U95A 1I3OB 5I42B 1I5LA 1PC0A 2COLA 1B7YB 1JIHA 2HK2A 4RKUC 4EPCA 2Y8YA 3KLFA 3D3CJ 4Y28C 1GXLA 3UDVA 2V67A 3EGUA 4BI8B 3QBCA 3V6DB 2GVZB 1IKYA 1FRHA 2DHSA 4QU7A 4PNOA 1Y96A 4ES3A 2CKWA 1CJTB 3M0UA 2E3HA 1VCTA 1UVMA 4DL0C 3UW1A 1K8AR 3L9ZA 4DQSA 2C2RA 4PLLA 4ESRA 3K5LA 2OH2A 1R27B 2M8DB 1EETB 4E7IA 2YKNA 3OR2A 3FEZA 4B9MA 1OQ3A 4PG4A 2C06A 2CH4W 3M8PA 2MZQA 1TR0A 2PEBA 3EGXA 1LJOA 1C1CB 3N5BB 4XAKA 4F7VA 2HFUA 3CCMQ 1SIZA 3G8QA 5IM0A 4RNNA 1YX2A 2NUUG 3NG8A 2LA4A 1R77A 1QM9A 3ENWA 4GO5X 1JXMA 4R25A 1VQ4T 1NH7A 3QFHA 3TJ9A 4C8QD 2G6FX 3DGPA 1JLBB 4F67A 3SHWA 1X4CA 4N0AA 2LVWA 5SUHA 2K2VA 2HHHJ 1SC4B 4ICLB 4AFZC 3CMET 2NWMA 3GPLA 2PVOB 3EJMA 5LJ5e 2BR0A 2C2ZB 1HWJA 1S72T 1S1UB 3CIZA 2R8HA 1SSHA 3N5FA 1SKSA 1ZSZB 3MAAA 2UU9F 2O9SA 3M2UA 4M7AA 4JI2F 1SSFA 4LDVA 3L2UA 1C1AA 2LJ1A 4I2QA 4C0BA 1M27C 4J6YA 3MEGB 1RTJA 1NSAA 3OJSA 4PWUA 1GRIA 4Y2IA 1TKXA 2V8KA 1OIAA 2ERRA 4LQ3A 1PD1A 1AWWA 4KHMA 5DLGA 1CJUA 1W2BR 4P5NA 1SKUB 3G6EQ 2B6AA 5GAMe 2HAFA 2YWWA 2IM1A 4PJOF 4FS2A 1NUEA 3LP0A 2QL9B 2XQCA 3CJ3A 2OTLS 2MLZA 2E6ZA 1S9EB 4KHPF 4NLXA 2RU3A 2EFIA 2AX1A 5J2NB 5KH6A 5LMNF 3BO4A 1RT2A 5CAAA 4K4UA 2RNAA 1T02A 1YHQS 3HFKA 4ZVOB 3FRYA 4YDXA 4CP5A 4H54A 4AL5A 1APSA 1IKVA 2OD6A 2ZH6A 2COZA 5KG7A 3QPIA 1YJNA 3KFWX 4ZVPB 3NGDA 4RO0A 2RRAA 2J0XA 4JI8F 5D15A 2M4MA 3CC7S 2V1QA 3JCMP 3MMAA 1HL6A 4QQGA 1XMBA 2DJZA 1R8OB 3O1LA 5ITHA 3PIOQ 4I6YA 3UT1A 2L2PA 1YJWA 2VH7A 4LFBJ 2JFDA 3OY9A 4CLSA 2DXCA 3JTPA 4DL7A 5F41A 4ZVFA 1U1TA 2DE0X 2G0IA 1G3TA 2E9RX 3U7JA 4ED1A 1VQ6T 2XSJA 4RW8B 2MKHA 4N4IA 3H8ZA 5K20B 1R8AA 2OMLA 3TAMA 4ED7A 1IWAA 1VQPS 4O4GA 2CUYA 1XOVA 5A76A 3P5TL 4DPTA 2C2EA 3NTIA 5AXMA 2R2SA 3FJ5A 3PJXA 2UV8A 1VRTA 2O9VA 4HKEA 3RMQA 4YFUA 2ZPHB 1S1VA 4RW9B 1D1UA 2ASLA 1EHWA 2ROPA 4EZ6A 4BI4A 1JBMA 1M9SA 2HAIA 3SEMA 5LJ3Y 1VQ5A 5IAYA 2B0GA 4DL6A 1R6YA 1S1XB 3OFEA 5G0RA 3BO3A 4ATOA 1HBMB 5IT0A 1IXKA 1RWPB 2KDSA 4TVAB 3MPUB 3PEHA 1CS4B 1WQ7A 2LT4A 3EMTA 2VFRA 3MHYA 2E7WA 4FS1A 2GC8A 1IBKF 1WOOA 3CMAQ 1MROA 4ERDA 3BGRB 2JVRA 4MZMA 1RTIA 3R3TA 2DERA 3ETMA 2PMWA 2DXDA 3U1MA 2KB2A 2LA6A 4OHWA 2L3PA 2LP4A 3OYJA 5M2PA 2D3OR 1U2RA 1YJ9Q 3W9HA 1HR0F 2W9AA 1QVFA 4ZA1A 2OKQA 2HNYA 3V5RA 3OYAA 3FC3A 1RT1A 1YDLA 1GMWD 1SL1A 4Q8EA 4IUPA 4UTGA 1EX8A 3M8RA 2NXUA 1M8MA 4NXNF 3SZ2A 5T7LB 1OPKA 1JWWA 4DPXA 3T5LA 4M7AD 2P0KA 4JOUA 5B0CA 4A48A 1FEEA 3IR6B 3V6HA 4ETXA 3ZFJA 2PSZA 5EDWA 4ZTFA 5A2QU 2OI2A 2XI3A 3CCVS 3FBFA 3QIPB 1ZETA 3RB4A 4JUVA 2W4DA 2MWOA 4I0WA 1EARA 4U7UD 1SV5A 2CAJA 2K6DA 4F7UA 1X0FA 5I22A 4ED5A 2CNNB 5KG2A 2V26A 1T9WA 4C8ZA 3L42A 2ROTA 1RYRA 5EGYA 3M1VB 3S3OA 3HF5A 3KLFB 4CIOA 4DBRA 3L7PA 1UWAA 1VQLS 3GNFB 4KUIA 2FDNA 3KXTA 3M6XA 3MF5A 3G4ST 2D9OA 3HRSA 3PTAA 2ZH7A 2KHDA 3VHQA 1IKYB 3L3CA 2J05A 2F4FA 1Y96B 3M58A 4B3RF 4ELTA 1IBCB 1IBMJ 3FJPA 1S97A 1BIAA 4X64J 3I87A 2NPFA 2VFSA 3MMBA 4LF1A 4RNHA 1ZAVA 2YKNB 3NEKA 3OR2B 3HVTA 3M8PB 1VQMA 5KG6A 2KXDA 5BJRA 3EGXB 3JAME 4ZPBA 5KFJA 3KHRA 5IM0B 2XGPA 3GTYX 2O66A 4J9CA 1H73A 2KSSA 1DRZA 3RERA 3I5SA 4KH1B 3AJDA 1SQFA 3DGPB 2YKOA 4W90B 2P0PA 3I56T 2VC8A 3RNJA 1X4FA 4LDYA 4OGCA 3A98A 3MR5A 1DFDA 2WB4A 3AODA 3Q8SB 3D9BA 4N5SA 3HHNB 4WFZA 5F3ZA 2UVVA 1JLEA 2WZ1A 1FDBA 1XMOJ 3M0QA 5B0AA 2FY1A 4IQXA 3DU6A 3SI8A 1MGQA 2BQ3A 3PG9A 2QZ8A 4C8QC 4ALZA 3SMZA 3ZZTA 2DJQA 3MAAB 1T0JA 2DL3A 4FPRA 5A6WA 3SBMA 2ZH5A 4ZCIA 3M2UB 2DNMA 4M7AB 4K0KJ 2DH8A 3QSYB 1NH8A 3ETOA 4CT8A 1QCFA 4I2QB 2KAFA 1F5CA 4PFPA 4ECSA 3FEXB 1RTJB 3VS0A 1HBNA 4U6PA 4EEYA 1Q5VA 4L3KA 4M5JA 1JMTA 4DR5J 1TKXB 3CDEA 1T9TA 1VIFA 5CCMA 4M1KA 1CJUB 3NRBA 5KFXA 1SPBP 1KP6A 3V2UC 3WIVA 2V8VA 2XM3A 3E2EA 1ZUKA 5GJWB 2B6AB 4F04B 3EGVA 1KEKA 4LF5J 4ENOA 4C92C 2RRNA 1M5SA 4GC6A 2R5MA 4J9BA 3ZFVA 1OOTA 4ILLA 3DRSA 3LP0B 2B4OA 4OZ2A 2M52A 4DR4J 2N3LA 3K17A 3JCMX 1BQXA 3MXHP 1TQLA 2AWZA 4TLQA 1RT2B 2XS5A 1M2OA 3AOAA 1VK3A 3RR6A 3H4BA 2CJKA 3UWTA 1IKVB 4A4HA 2AHOB 1SHGA 1A9NB 2HGLA 3INZA 3OMCA 4ETZA 3VQTA 2DGVA 3CCSQ 1WJRA 3CT9A 2O01E 1HI8A 3QJJA 4F4KA 3MMAB 2RJDA 3AD8C 1QLYA 2WSCE 4RW7A 4DV6J 2V8JA 2F2VA 3A4TA 4M63A 4NX9A 1I94F 2D0QB 1HA1A 5GANg 2J6UA 4IDKA 4WFXA 3NL0A 5ETMA 2EW3A 2IVWA 2LX7A 3E1SA 1AFJA 1EQ0A 1HSQA 2AKWB 3AA9A 4P74A 4CLLA 4CLYA 4EYHB 2DPJA 4XK8C 2XSJB 3BREA 3PRBA 2LCSA 2B9YA 1AUDA 1QVGP 3EGWB 2ZGWA 2Y9HA 3TAMB 4O4GB 2FHJA 2HLTA 3OHAA 1FMKA 4AMCA 3WX8A 1VRTB 2VOOA 4J37A 5IT9Y 4ZJQA 1S1VB 3W65A 2GIQA 3D1HA 3KNGA 1X31C 5H9EJ 1VQ9T 4V2SA 3CJSA 3FCWA 2WBMA 2FJAB 4FXWA 1N88A 5KFKA 1VLYA 3HSZA 5G0RB 2UXDF 4J6XA 1UHFA 3S01A 3ULHA 2XEXA 4PL6A 3CCWA 4MK7A 5GAEI 1U09A 2LYVA 3TQ1A 1MROB 2MI6A 1N48A 1SQGA 2DB1A 1Y0MA 3W62A 2D41A 1HNWJ 1YTYA 1RTIB 1H3HA 1KQ1A 1RBAA 2RB7A 4KT0C 5EX3A 5KFRA 2J7KA 1HHTP 3IM8A 3JAMY 2YNHA 1RACB 2R57A 1UWBA 2YNFA 4RUCA 1BBZA 4MZPA 2DNOA 3G82A 3DMJA 1NEGA 4C8QF 2KR3A 1HLWA 3GCXP 2VOPA 4JI3F 5CZVA 1XNIA 1EIYB 1FD8A 3R5AA 4XTUA 2HNYB 1IHVA 4YR2A 1VQ7A 1RT1B 2R2RA 2V9WA 4M7AE 3J81E 3EUNA 4LIWA 1R43A 2F2WA 2GQVA 1N5VA 4OJ3A 3CC2S 1UVLA 2JZ5A 4JV0A 2ZC3A 1VC5A 2J9CA 5GMKh 4DSKA 2FRYA 2LEBA 5F3TA 1J5EJ 3OSSC 2XMVA 3I4PA 1ZM2A 3OW2R 4V1Ak 5KG0A 2ZFHA 2AIRB 1PIEA 3QZ9B 3RB6A 2C3MA 1XN9A 5ETQA 2X9HA 4OZ3A 1SV5B 2OTJS 3P8BB 4F7UB 3NTHA 1FT8A 3W1YC 5C2CA 3L2QA 2ZDPA 3I55S 1Y5IB 3S7RA 3EG0A 4NLRA 1GQEA 5GAN3 3UDEA 4FDFA 3OQ2A 1G5VA 1SH3A 3W64A 3ULRB 5F8IA 4JJNK 2ADCA 1LKZA 4MFBA 1G1XA 2C3YA 2XCAA 2I1RA 2EYQA 3BQ0A 3LWMA 2R2UA 3HJVA 1RYSA 2JXBA 4LQ9A 3KJQB 3LW5C 4F26A 3FK4A 3SFUA 3CCUQ 1WNEA 1U1KA 1HYSA 3MMBB 3MHXA 1WC4A 3RBBB 3CNQP 2DH7A 2DO3A 3IP0A 3HVTB 3D6FB 4M7DC 3K2YA 1S0MA 4PJNA 5FD1A 3QT7A 4QCLA 2MZ1A 1DQ9A 1QSSA 4IH7A 3GV8B 4PQAA 2B3TB 2DGWA 3KMSA 1N0VC 1U06A 1SI9A 1M90C 1FERA 3ISZA 1O51A 5GADI 1TL5A 1N0UA 2C2KB 4DFPA 2I6WA 1WLPB 1M3CA 2BIVA 1QVGS 4U7CA 3L2ZA 3MUTP 5F0WA 5CIUA 4K4WA 4OZ0A 4ELUA 3M4YA 2K4YA 2MJUA 2QC3A 3MCSA 1JLEB 2UUAF 1FWKA 4WF9Q 1XR6A 4UC4A 1X5PA 1FNMA 3CCJQ 1FHTA 3VAGA 3VGTA 4XU1A 4ATNA 3DOKB 1VIEA 5B0GA 2ZH9A 3QJYA 1M5OC 4KBMB 1H8KA 4NCBA 4KUDK 4YHHJ 3VAKA 4CTAA 2DL8A 4PG5A 3MECA 1S49A 1HBNB 1I4K1 2M02A 3THVA 4ECWA 4CC4B 3KUFA 3VWSA 1VQ8S 1X43A 3VS5A 4DPWA 4J9KA 3BY7A 5L8RE 4C2MA 5KFMA 3CJ4A 4OI6A 3TEHB 2DCLA 3SSRA 4BB7A 1PYTA 3BBBA 2CWKA 1EP4A 3DRSB 1Y10A 1K0XA 2JFKA 1AD5A 2M0OA 3TP2A 2RDJA 1NHKL 4C8MA 5F8MA 2IM3A 2O4XA 4RTXA 5I2MA 1RLDA 3JYTA 4P75A 1KK7A 1C4CA 2VG5A 1I1GA 3UWNA 3FRNA 2CZ0B 5IHKA 1K9MR 5ETVA 4EDUA 2GMJA 3TEEA 4P7VA 1VIOA 4OHZA 2Y4YA 5DGBA 2ROLA 3FB9A 4RUBA 2QK0A 4QW8A 2VKRA 2IRUA 3WVDB 1YI2A 4Y2MA 4M7AF 4DCPB 2LXIA 4RW7B 3NGTA 1E6VA 4OZLA 4DSJA 1E6GA 2DGUA 1KG1A 4F7UE 2V5HG 5CD4H 2KYMA 1IUJA 4IDKB 4HT7A 4WK3A 1FFWB 2DEJA 1GBQA 2KI7A 1S5ZA 4J9IA 3J7AF 4C0DC 4IUTA 2P9CA 4A63B 3PJWA 2OPQA 3P8HA 4F0KA 3K5OA 3BR9A 3QYHB 1UZDA 3TYTA 2BDPA 1FJGJ 2HBQB 2P4TA 2E44A 3FSXA 2DF6A 4DV7F 4ZCKA 1F5BA 2HS3A 2DGQA 4WYWA 1X2KA 2QEXA 4PWDA 2NXEA 3HD1A 4Y3CA 3SQOP 2FPDA 1NJXA 1DZ5A 4NLWA 3TUZC 1RT5A 2QMWA 3QKJA 2VG7A 4B3SF 1ZM3A 2Q79A 2AEFA 1IXDA 1DJ0A 2W0ZA 1ROFA 3W7BA 2FHDA 2EI5A 2OPRA 4L6V3 1D9AA 3G7ZA 3L7OA 4EU0A 1RWVB 2FZGB 2YNHB 1UWBB 2YNFB 5L1LA 3GYXB 1PJ5A 3G82B 3DMJB 2YNIA 2Y4XA 1ZBTA 3M05A 3TW0A 4J9RA 2P2CB 4NCAA 3H4DA 2GO8A 3C12A 4DQRA 4XU2A 1SBRA 2W24A 2L5QA 4M5MA 2XU8A 4ZOSA 2L3QA 1YITT 2CJBA 1KLNA 5F8HA 4OZ1A 3L95X 2DILA 4AL7A 3BH6B 3PIPA 1WSRA 2MKIA 2AJ0A 1AVZC 1Q5YA 4F14A 5CQYA 4ZIVA 2B7BB 2OTLQ 5DQIA 2JEJA 2B4PA 1W25A 2AGOA 1EJ7L 4RUHA 4MKVA 4LF7F 1A6LA 2JC0A 2J6TA 4YS2A 2P5VA 5LJ3f 4O6JA 1SQEA 1YHQQ 4Q43A 3EZ5A 4CO4A 3CC4A 1T3SA 3NAHA 4UOFA 2D8JA 2AW0A 2OLWA 2OJ3A 2BOAA 4ED0A 2R7TA 5FU6B 3MDFA 1Z2ZA 2PMZD 3W9IA 2CQ0A 2LU1A 2BRKA 2HQ3A 2LDIA 3MURP 4MFBB 1M0SA 1QKXA 3GV5B 3HJFA 2RQRA 1S4FA 4ZITA 4KR0B 2JEIA 2EK1A 5FLXU 1TG0A 3QBYA 1NBEB 2YWEA 2H5JB 3FJ2A 1BU1A 3JCMg 3UN3A 3HULA 2J7IA 3EWGA 1TTHB 3PX6A 2Y8WA 4FSXA 1HYSB 2Q6CA 4NA2A 2RSQA 1BYMA 2HMIA 2BW2A 2QA1A 3QGHA 1QTMA 3QGPA 2IHR1 3E2UA 4XPEA 2I8EA 4WP3A 3EG2A 1NLKL 4DG1A 1VQPQ 1AZEA 1XQIA 2XKOC 1X6OA 2X3XD 3C2PA 4M78A 5GANh 2KBTA 4FNHA 3M6UA 4N7TA 3SCIE 2CA9A 3D0IE 4MH8A 4OX8A 2VYTA 2OELA 3OYGA 1HD3A 5GAN7 3TQ7P 2IRYA 3NMAA 4LSNA 2PFFB 2XY7A 4BE1A 1LOUA 1WKJA 4EMHA 2KN4A 2XZWA 4RPFA 1K0SA 1NB2A 4JI1J 4LVOP 4EIKA 1S12A 3G8TA 5DY9A 4X34A 2VXFA 1CG2A 4YN3B 1VOMA 4RG2A 3CD6T 3G71S 3WHIA 1NK7A 2FJBB 1VQ4A 2KXHA 3HVWA 5B0DA 1V5VA 1BCMA 3FVYA 1PD0A 3CD5A 4CTAB 4CLTA 4KSEB 3MECB 1YZ7A 2LP5A 4HHHA 3V4MA 3RKWA 4QBUA 4OYBA 1C0TA 3CMEA 1VQKT 2YH1A 3IM9A 4RWXA 1S1NA 1OSCA 1ZTWA 2CQCA 1S72A 2ZOMA 2V50A 2MKJA 3C94A 2RHIA 2B8PA 4C8YA 2L9WA 4OYZA 2KTQA 4O5VA 2HRTA 1LQ9A 2PNIA 1AOJA 2IG0A 2DEIA 1EP4B 4OZJA 3DLBA 2C22A 3DXSX 2EGEA 2MGZA 2PFDA 1JKHA 3POTA 1M5VC 2O4XB 2WW4A 4DV4J 2AGPA 1F3FA 3CCVQ 3JYTB 4BDZA 4L75A 3KLEA 2DEQA 2PC6A 2VG5B 2MQOA 2D9PA 1IBLF 4EMKC 1JLFA 4TY8A 3OS0A 4D3GA 3CBPA 2DRKA 4H4KC 1VHIA 5F8NA 2DA9A 3J81U 4MKAA 1ZQ1A 4X4NA 2LLZA 5EG2A 4AXIA 1UETA 3JTNA 3EYZA 2SEMA 2BZ8A 4E6RA 4AG2C 4LE9A 4LFAF 3US5A 2BABA 1VQLQ 1QLNA 2RI3A 2IPOB 1W2BP 2VHGA 1KVKA 3OVBA 4Z02A 4NI2A 4LF9F 1Q81C 1ELOA 2C28A 3N01A 2A28A 2CVEA 2DD8S 2K3YA 5HN0A 4DPYA 2DLPA 1MV0B 2KK4A 3TZXA 1TL7A 2AJ4A 1WKKA 2V2ZA 2OPQB 2KU7A 4USVA 1TS9A 3TUPA 3QLHA 5J1PA 5C25A 4C8KA 4C8LA 3THPA 1L3UA 1GX6A 4F36A 2N7CA 2DKOB 2JRSA 1XR7A 2RD5C 1OX8A 1LNQA 1VQ6A 4PWDB 2YKQA 4JRIA 2CDTA 5F8GA 1RT5B 1G83A 4L73A 3V8LA 3R1HA 2VG7B 1IVZA 1UFFA 2JX2A 1YJNS 1TELA 2VBXA 2J76E 4XTZA 3T1AA 2K3IA 4F4ZA 2DTHA 2OPRB 3PMTA 3GOXA 3FZ2A 3IMQJ 1WIEA 2ZVIA 2FHKA 3D28A 5FDLA 1M5PC 4N4HA 3I9V9 4L72B 2YQ1A 2IJFA 1QDUB 1YJWS 3TVYA 1ZA2B 1RA6A 2YNIB 2D1CA 5LJ5Y 3PVXA 2VU5A 5CKFA 1W26A 2E7XA 2K8GA 3HFVA 2H3JA 3BSOA 2HQXA 2KT1A 3BZQA 3GILA 3PYGA 4I68A 2QE5A 4JI2J 3MWBA 2M5YA 4ZVUB 1NK5A 3P3DA 1Q82U 3CVKA 3KLHA 4J83A 5B0EA 3Q2SC 4KHRA 2GGPA 5KG5A 2RO0A 3TJAA 2DL4A 1I0CA 3W8GA 2M0YA 2F2XA 3PX0A 2CNLB 4C92G 3K5NA 4ZNXA 3WC2A 3CDWA 4MDWA 2VODA 1VQ5S 2EYYA 3OVAA 1R89A 2RHYA 1BI3A 2JH3A 2XZDB 2ZEJA 2D6FA 2CP3A 3MM6A 5LJ5g 1KNZA 4N56A 3OYYA 5JVHQ 5KFNA 4ZLNA 5CYQA 5GAN6 2ZE2A 3FLGA 1W1FA 4I67A 2HHTA 1R3NA 5DLOA 3MEDA 1PSFA 3M0SA 1KQKA 3NGRA 5D0EA 1Q7YC 2HURA 2C2MB 2KT5A 4U8YA 3ONQA 1SJ4P 2AJ1A 3M8WA 1AA1B 2X7IA 3HRUA 1YHQT 4JI8J 1RLQC 2KRSA 3DRRB 1QVFS 4OJ1A 4F4YA 3A8LB 5LL6d 4F25A 2KZZA 2BRLA 4OJHA 2HMIB 5GAMg 3MO8A 3V7SA 3BGUA 1RGVA 2GA7A 3UPFA 1UA0A 4HCCA 1KONA 3C66A 2RUSA 1SJRA 1B0VA 1RKJA 3HFNA 3H98A 3JSYA 4DG1B 3E8OA 5E3QA 5E3AA 1RWKB 3MM8B 4FYYB 4BUGA 2MDAA 3G4SA 1SG5A 2LRQA 5J2MA 3CCZA 4OB0B 1PNJA 1JB0C 3QATA 1B70B 4LFBF 5D6GA 3OTBA 3H0FA 2HEKA 2R8IA 1TUCA 2VBZA 2OGUA 2E70A 4LSNB 1W4SA 1FF2A 3L1AA 4ZPTR 5IV4A 2GNKA 1UGQB 1F3VA 2HW3A 4AUKA 3VUZA 3GFYA 1UPPA 2YDLA 2Y0SD 4FXVA 1TKDA 2ZPIB 1O0PA 4OB2B 4E47A 4ZK7M 2RQUA 1SH0A 2Z58B 1T94A 3MEUA 3EH1A 1QD1A 3N0VA 5FU7B 1PYSB 2OHDA 4QIVA 1FKPA 2XC9A 2F9JA 3I31A 2E7VA 2KDOA 5DETA 5HVHA 2GTOA 1RT4A 1URRA 3WX4A 3HHLD 3I56A 1CKBA 4JI0J 3BJYA 4P72A 1HYOA 1C0TB 4U96A 1MWZA 4NLDA 4LF6J 4ORZA 4HYKA 5DM7Q 3MUVP 4XTWA 1KFSA 2QAZA 4JV5J 5LSRA 2ADBA 2L0AA 3I5CA 1FE0A 1U1RA 4ZVGA 4UOCA 3D68A 3LALA 5KYUB 2DRDA 3D7SB 3UVJA 3ZZZA 3M2RB 5RUBA 4PPZA 1QJHA 1Y7XA 2LNVA 3D3BJ 4LRCA 3H40A 1VQMS 4K4YA 3CPWR 2NLUA 4B9LA 2G0CA 3CC2Q 2MGZB 3GSDA 4M5HA 2PQWA 2AZVA 3PW0A 4YB5A 3FQLA 4NZ6A 3AD7C 1JKHB 1KR4A 3POTB 3AY0A 3PO5A 3NGKA 3TA1A 3O8WA 3KLEB 2DGOA 3MJXA 5ETRA 4JI5J 5F0UA 4C0HA 1V9OA 3EXCX 4TY8B 1FTRA 4J7IA 1HBUA 4B9XA 2OTJQ 2N82B 3P5BP 2FZKB 1QQJA 4IIOA 3SDZA 5AE2A 1HWIA 5A0DA 3PYFA 1GBRA 2HQHA 3I55Q 3MM5A 3Q89A 3GP8A 4WPAA 1R0BG 5F9NA 2CUBA 2I2LA 4MAKA 3MEWA 2RH3A 3SYZA 2GFAA 3VS6A 2AX0A 2F8HA 1M30A 1T3NA 2LQ8A 3OTCA 4Q5VA 2ABYA 2NUPA 1OY9A 2BE2A 4NI2B 3HXMA 3I35A 3VR1A 4ANDA 4QR1A 5CKEA 3PRVA 4CI0C 2F4VF 3KG4A 3PACA 5H1SV 4QQDA 3HI9A 4P9SA 1J5OA 1KQSR 2HKNA 4DUTA 1TL7B 5CYMA 4VUBA 1P9YA 4WKRA 4OB1B 3R5GA 1SC3B 3CSKA 1VQLT 1SRLA 2CPZA 3LP2B 3QLHB 4CO3A 5C25B 3ZZPA 2JJ9A 2CNOB 2VD3A 2H8HA 1QCOA 4RU9A 4X9CA 6FD1A 3UD4P 2KYXA 4M7DG 1IBMF 4LDXA 1NO8A 3JCMh 1U6BA 4YUDA 1GFDA 1PILA 2BJ8A 4LF4F 5GMKj 3BSCA 1UVNA 3CBMA 3FMWA 2KM8B 2ZZMA 5H9FJ 4W92B 4N0AC 2VICA 2NCKL 1FWPA 1U7LA 4IOAQ 1YWPA 4OMMA 4M77D 1V1CA 3PVQA 4O3OA 1MMGA 3I32A 5BYSA 1BQMA 3A3NB 1WHKA 4AD6A 1UJ4A 4OYAA 1LWEA 1VQ9A 3QJLA 4ZIWA 1XERA 4CDIA 2W2OP 1LPLA 5FDLB 1Y07A 2B8AA 4U7UK 4OL8A 2XZTB 4M5NA 5DM6Q 1X4DA 3HP9A 3MTJA 3T5JA 3IBCB 5AXLA 4PXDA 3UFCX 3IGNA 4CRIA 1WC6A 3JB9G 3F0NA 2PUKB 3H7HB 3OD2A 4OX6A 4DXLA 4DV0F 1NK0A 1UL3A 3HHKA 2V69A 2EFOA 4I7FA 1PM3A 1Q86U 1VQ8Q 4IH5A 2XICA 5CXTA 4CO0A 2EQJA 2LQWA 5IZHA 3KLHB 4FF3A 4K0KF 1TUWA 4II1A 4PUOA 3VUBA 1P6TA 2GGPB 1S76D 4ZVSB 2LVMA 4JRKA 3CD7A 1VYUA 1RADB 5FRNA 3IQLA 5KG1A 2QRRA 3CPWA 1GFWB 3I5RA 4DS4A 2CWXA 1YP5A 3S6EA 3AJ2A 5J1NA 1B3TA 4KKOA 3A8JA 3QHSA 4HACA 2FPHX 3QYGB 2HHSA 6FDRA 4LF5F 1VK8A 1F9FA 2LQNA 2GCFA 3RR7A 1I8FA 1W2IA 3PR5B 2G1DA 2BVZA 2A36A 3TANA 5EN1A 3BQ2A 1R7IA 2KROA 5CYQB 2CQPA 2ZE2B 1FDAA 5AJ3F 4DR4F 3MR2A 3MEDB 4XPCA 5IS2A 8RUCA 2OEKA 2E65A 1HD0A 3RUXA 3AXMA 4A8OA 3ZC4A 3H9NA 1D09B 3VS4A 3CE8A 5K14A 1WX6A 1U26A 1VQNT 1UJ5A 5DDPC 3U1NA 2DBBA 1X27A 4PPDA 1ZBXA 4KGMA 2C3PA 1L3TA 3TZYA 2V8PA 1VQ7S 2DD4A 2JZ2A 1I94J 3Q23A 4QVZA 3IS9A 5I21A 3O5ZA 1UGVA 3AHUA 2YY3A 3OW2P 5I11A 3ZL7C 2MQNA 2ZPGB 2NZCA 2UVWA 4DL5A 2VPXB 5J2MB 1KQSA 1K8AC 2AYBA 3I5AA 2VONA 3KFVA 3HX9A 4FXDA 1EAYC 3GFXA 2QL5B 3R7NB 5DM7R 3CB4A 4WF2A 2V4QA 1Y11A 1FDNA 4XDCA 3AD9C 4NASA 3V7CA 2IJNA 4GVBA 4JDSA 4ER8A 1FYNA 1BGXT 4ZVEA 5LT5A 1TAUA 1VC0A 1H0HB 3OYLA 5LJ3j 1M4ZA 4LBHA 2ECZA 1JLGA 3UR3C 4GKKF 2QYCA 2WVFA 2Z56B 3CJQA 2ESWA 5T41A 4DOZA 2IFXA 3HL8A 2MF2A 2HBWA 4DLEA 1H641 3VAJA 4ZP6A 4D6WA 3VAHA 1FKPB 2UXDJ 4I56A 2PN6A 3V4IA 2K9GA 3ZZRA 1T9XA 4IH6A 4QR0A 1RXOB 1FX2A 1RT4B 4IFVA 1PJ7A 1PRLC 4USMA 4LRDA 1GL5A 4NLGA 2Y1IA 1G2EA 4PJOA 1QP3A 5HQMA 2GNCA 1AZGB 3ADAC 2MZTA 3OXFA 1BHNA 1KQFB 1OI1A 1NJWA 3JSRA 2PD1A 1DTQA 2C2DA 2DY9A 3UVJB 1HHQA 3ELHA 3LWLA 4KJIA 1DHMA 4J9OA 4HH1A 4JI3J 5IXBA 3HHLC 1T11A 2J0SD 4ES1A 3NY0A 2JLGA 1PO6A 2K06A 4NLYA 3Q8RB 2X4JA 2QFIA 1WHJA 1IRXA 2CKKA 1IWGA 2XWYA 4C97A 3LWHA 4A8KA 3QO9B 5DQHA 1WELA 2PUOB 1RABB 2ZH3A 3DLEA 4ZVRB 3OYCA 3OXGA 2DVEA 1LEOA 2PI5A 1LWCA 4RTWA 2DNPA 4X2BA 2R4FA 1HBUB 2IDEA 5ETLA 2LQ5A 2V8DA 2F1LA 4USJC 5K8PA 1XK8A 4B9NA 2JTFA 4Q44A 2QSFA 2EVZA 3MM5B 3UCZP 3CC2T 3R27A 1QSYA 3GSIA 4BDYA 2X1AA 2FHMA 2EPDA 1Q7YU 3B78A 2NUPB 4N41A 2BKOA 3I9QA 1X5OA 2BE2B 1QAXA 5LJ5h 1JLAB 3TVZA 2ZH2A 4W4MA 3PCOB 5HANA 4FF1A 5KYXA 5HMZA 3DNCA 2HHXA 1VJWA 2JSXA 2CJ9A 1J5OB 5JUMA 1WZOA 2ACYA 1FD2A 1UMJA 5CYMB 3PFSA 2BJ9A 3M56A 2CJYB 3O5TB 2GAGC 1XNQF 2B8QA 2W7AA 2IMWP 1TK0A 3MCOA 3P96A 2RI5A 5C7PA 3R5CA 5DRKA 2EQKA 1RTZA 2YBVA 3D6MB 2MB0B 1U8RA 2F7VA 3N9UC 5DG8A 3M7VA 1LCKA 1Q81R 2QLFB 1OEBA 3H8YA 1WOPA 2DHGA 4ZN1A 4G6VB 5GAMh 3IRXA 3CDAA 4QIWD 3ZEHA 1CBKA 3AB2B 2EG1A 3TAQA 1EB0A 3BKTA 2DFUA 4TN2A 1S0OA 3OW2S 1D0YA 1Q86T 1UEUA 2W8LA 2BACA 1N6QA 1YI2S 1BQMB 1Q0NA 4DS5A 2O31A 3G71Q 4ZDNA 2HQGA 2XMFA 1WSVA 3UE2A 3EVWA 3OYDA 3BE3A 1HARA 4M77C 4JI4F 4Y6IA 1KBRA 1CPZA 1CSKA 5DGAA 3OSNA 1PWTA 1U0HA 3D4JA 5KFUA 5GMKa 4I7FB 1RTDA 2WHOA 2ZPEB 4C0OC 2K5LA 4F3MA 4FPIA 1G3SA 2CPDA 3J7Z5 4JLIA 2XIDA 4YHHF 4PUOB 1SEMA 3ILLA 2ZAEA 4ECVA 1CKAA 3EHQA 1KD1U 3OQ5A 5FW9A 5GANj 4DF8A 2EW9A 3L7UA 3JCMb 4K4SA 1U2CA 2QEXS 1U1OA 2LTOA 4JJCA 1VGYA 2EBEA 4KKOB 1X75C 3BSAA 2J8SA 4WIQA 1JJHA 4HACB 2A37A 2F65A 3V8JA 3EPGA 5KT3A 5IQ6A 2WSFE 1S57A 2EJFA 2QIFA 3IGVA 4IUUA 3EGDA 1IM4A 1YITA 2DR8A 2DNQA 3HVAA 3QDFA 2J9DE 2Q3PA 5DJBA 1HPZA 2M7SA 5I2SA 2XTJP 1K73R 3P4UB 2VUGA 4USKA 2Y0BB 5HBMA 4M8LA 4QJVA 4X4RA 1L3KA 1NNDA 3NGSA 2GHWA 5D6WA 4WE1A 4ZCMA 3M8YA 5I3PA 3C19A 2J6OA 5KYYA 3G6YA 4E0DA 4O44A 1Y3JA 1Z9ZA 3IS9B 4QWAA 2DEUA 4B6MA 2QDYB 3ET6A 3NGPA 3BBCA 2YRCA 1WPYA 3VVUA 1RZMA 1U1PA 1FRXA 2OPPA 3CIMA 5D6XA 2IAJA 2RJZA 3PHEA 3RIRA 3LF0A 2KT8A 1OULA 4LJMA 2LX9A 3KBGA 3MPDA 1X6BA 4GVBB 3K8VA 2PVGB 3W60A 1OMSA 4DDFA 4YDDB 1TK8A 3B8HA 4I6AA 3CCET 3ILIA 1JLGB 5KFEA 2L41A 3CC4S 4DV7J 4OLPA 1K4US 2R8KA 2HG4A 2DTOA 1UDLA 1FJGF 1FFSB 3DLLA 1NJIU 1YJNQ 4PJMA 3JRZA 4IRDA 3V4IB 3MMCA 3MEEA 3S8SA 4KAIA 3M9MB 3PFOA 4IFVB 3NNHA 4GLMA 4B3SJ 2HKEA 1REVA 4K5RA 3K57A 3VTIA 1WC5A 1VYTA 3MI7X 3N6NA 2Q66A 1VC6A 4L59A 4PJOB 1YJWQ 2OFHX 3TSWA 1R8CA 3OT9A 2F5TX 1OYXA 1G3YA 4MMKA 2X3GA 2RNEA 5LJ3d 4OX9F 2R8GA 1DTQB 2DHAA 4M77F 4LD6A 1TOVA 2ALZA 2IC3A 2QQAA 1WORA 3CD6A 4MK8A 2D7SA 3VQSA 3JB9J 1X9MA 2WB1D 1JLCA 1GH8A 4I64A 3FSYA 2HAXA 4QPTA 4QYRA 4OFZA 1Q7YT 3GIJA 1VQKA 1OO0B 2RILA 2QYGA 1ZSZA 5ETSA 4PK4A 3DLEB 3QO3A 2KRNA 5M2RA 3EDQB 1VQ5Q 1NYFA 2FPEA 3RB0A 1LWCB 2DR9A 1X01A 2KG1A 3JCMJ 3GE9A 1TP7A 3B82A 3JCMe 5CABA 1ABQA 1RSCA 3NOGA 3OSPA 3D2WA 1T95A 3CPFA 2KFNA 4PJLA 4LF7J 2JM9A 4XU3A 3E9GA 4NXMF 1H7XA 5IT4A 2C0IA 2RHSB 2W8KA 2HRYA 1PYOB 4J7FA 1NK9A 2KRMA 1VQ4S 1SC1B 3OVSA 2OEJA 5L1JA 4CLWA 2EQIA 3D1QA 3HKZD 2F40A 2XMUA 3CUNA 4V19X 2B9XA 1MMNA 4IFYA 2FB0A 3UDCA 2M3DA 3CMES 3GU0A 3R2DJ 5KYXB 1RHUB 2BJEA 4AT1B 3PKYA 2WVCA 1ZX6A 2P4RA 2MKSA 2C2NA 4DFMA 4PXBA 2G3RA 1S72S 5E3CA 1YRXA 1UTIA 2DRMA 2HGNA 4FP9A 2KO1A 1D1BA 1V76A 4KULA 3KUHA 2MXYA 2CQ4A 1ITPA 4YB1P 1MMDA 3R5JB 1UA1A 3IWLA 4ZPDA 2B51A 4F3OA 3PRDA 1HNZJ 4G3IA 4DUYJ 3IRXB 3BSNA 1V6HA 1L3SA 2G2YA 1BE4A 3KHHA 4C8QA 1WHXA 2ABLA 2K3BA 2UP1A 3CCLS 1N6QB 2KVQG 4P2SA 3QUIA 4M5LA 5E0OA 1FRLA 1UJ0A 4UOHA 4K50A 2D74B 2WBRA 2HQDA 2IJRA 1KD1T 2VFTA 3E9FA 2CJQA 4E98A 3NBPA 2P84A 4JI1F 4L6V5 4QWCA 2EXUA 2DT9A 2ZWOA 4X4QA 4GO7X 3VJPA 3MR6A 2HYIB 1U0HB 1RTDB 2YX7A 2PA8D 1TU0B 1Q8KA 2EJ9A 2QMXA 1RL2A 3G71T 4DU7A 4ZLPA 1VQMQ 3FMBA 2XMJA 4MZTA 2DNHA 3M30A 4F0MA 1IHWA 3HD2A 4P2MA 2JEGA 2M2BA 2GAHC 4J7CA 2FVRA 4GRSA 2YKMA 2RF0A 2AYMA 1VQ6S 3GV7B 1BKBA 4HA8A 1KFZA 1RCOB 2P9EA 3TSZA 3VYGA 4TQSA 3LTOA 1ZPVA 2VUBA 2MPUA 2BJ7A 1N32J 2Z2MA 2PVDB 3EGDB 1QWFA 2E5IA 2HHWA 4UOGA 3DYAA 2GZOA 4F17A 2VKZG 1PC5A 3DKDA 1HPZB 3SD4A 2RPNA 4KPCA 3R1LA 1N5TA 4FN5A 1IBLJ 4DV4F 3H6ZA 3MFHA 1FRIA 4OV6A 3CCRT 1FKAF 3OYNA 2A3LA 2HWIA 2Z4PA 1P9QC 1CLFA 1Y5LB 2Z8QA 4UZBA 2WACA 3FKBA 3HFZB 5AXNA 2L48A 4RKUE 5HBMB 2X3WD 1M1KR 1YJRA 3PTWA 3J81j 2MKKA 4WZMA 4Y28E 4N76A 4WE1B 3HSDA 5B0FA 4X62J 4DV3F 5KYYB 4NOHA 5HKCA 4J8OA 4C5IA 4Z37A 3JSMA 2YWKA 1ZYQA 4RCCA 2XB2D 4F02A 4LF9J 4FCYA 5A2QY 2WTFA 2HBRB 5JJBA 3ET6B 1RT3A 3GP9A 3EXYA 1X4EA 5ECAA 4LSLA 1XTZA 2BUNA 1M5Q1 4PZVA 4X4TA 3F56A 2ZKTA 2OPPB 4O3RA 2F1FA 2IAJB 3M1VA 2MTLA 1YHQA 4GKJJ 4RBTA 5K8MA 2PIIA 5L1KA 2MAMA 4A4EA 3MTKA 1M8VA 3GB0A 3F70A 3G1JA 5HMYA 3ZO7A 3VRZA 3R6NA 2JUFA 2ZM6F 1YKWA 2H5IB 2IBKA 4QQ6A 3LOUA 4USWA 2XLKA 2E41A 3AB4B 3KK1A 3LGHA 2OAWA 4A8QA 2WW8A 2MY7A 2AQ4A 1PKTA 3A3OB 2FVUA 1KWMA 3DRXA 3H41A 4X4OA 3MMCB 3MEEB