2RK2A

Dhfr r-67 complexed with nadp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
NATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a type II dihydrofolate reductase catalytic ternary complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Dihydrofolate reductase type 2
total genus 12
structure length 58
sequence length 58
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2007-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rk2A00
2VV5A 1VIFA 2RK2A 3UDCA 2P4TA 2GQVA 2RH2A 1VIEA 2RK1A 3SFMA 3T9NA 2OAUA
chains in the Genus database with same CATH superfamily
2D1XA 1ZSZB 2CP2A 1PNJA 1I81A 1BU1A 4C92F 1WLPB 3PE0A 2KBTA 1QVFP 5CCAA 4D6WA 1QVGA 4E47A 2FG0A 3R6OA 1B7TA 1D3BA 2RO0A 4EPCA 4M7AG 2MIOA 3CC7T 4ZN1A 3GF5A 2RI3A 5GAMg 3MEWA 2DJZA 2RH2A 3CPFA 4LN2A 4NL2A 2HKQB 1WPYA 3QJ6A 3EGXA 1YITT 3LWHA 3EH1A 3CCET 1SSFA 2RHYA 3E1SA 4Z88A 4FYWB 3H9NA 1VQMA 2RD1A 1NYGA 4F7UG 2FPDA 1PD0A 3OYMA 5CKFA 4M7DB 4FU6A 2Y4XA 4M78F 2LC4A 1YCYA 3PVLA 2IG0A 5GAOq 4OMNA 1ZSZC 3RKXA 1Q86R 1G3WA 3HTRA 3RDVA 3GPLA 1QW1A 3EG9A 3MJXA 2JW4A 3S3MA 1JU5C 4PJLA 1M90U 1MHNA 2RK2A 3AT1B 4M7DE 2QQ9A 4FSSA 2KXCA 3CCJQ 3SWNB 3SD4A 1QCNA 4DA4A 2NLUA 4PKCC 3QO3A 1WFWA 3HHTB 3VRYA 5HK0A 4PFPA 2E5KA 1Q95G 4KGVB 1TSFA 1Y71A 4F7UA 1AEYA 3CBMA 2AKLA 1N9SA 3OS0A 3JCMQ 5GAOn 2P4TA 2LRQA 1E6GA 2E3IA 3TU4K 4XU2A 3X28B 2MF2A 2LX9A 2H8HA 4HT8A 2R57A 4PJMA 2EAYA 1VQPA 2EW3A 3G6EA 2HBPA 1KHIA 2ESWA 5FU6C 3CD6A 2MYSA 4KT0E 3QZ5B 4M77D 3CCSQ 1QVGP 2JXBA 4JJCA 3KFVA 4JDSA 1AOJA 3PTAA 1WXUA 1YJNQ 2K2MA 2ZZDA 3CCMT 3CCLT 2RNAA 4HT9A 1Q86C 3V8LA 1TU0B 4DQ2A 2J05A 4M7AB 3JCMW 2R5AA 4C5GA 1UE9A 1TS9A 1M27C 1WIEA 2EGEA 3ULRB 2D6FA 4M75A 3CCRQ 1JJ2S 2DFUA 1VOMA 1UG1A 4FM4B 4MZMA 4KRTA 3CXCP 1KC8R 3HFOA 4A54A 1Q81U 1VQ9T 1YIJT 3CCRT 2ZGWA 1IREB 1BCOA 1MMAA 4RUGA 1BK2A 5GJVB 4C92G 3CCEQ 2QA4Q 5CR2A 2L89A 1D3BB 2QI2A 4LXCA 2YLBA 3OYKA 2KQWA 2XK0A 5FU7B 1R8OB 2CKKA 2QGGA 3LGFA 2RJFA 4PJNA 3EGDB 4M75E 3GOXA 2DO3A 4A53A 4M77G 2AIRB 4JZ3A 3OYLA 3M58A 2OTJT 2KXDA 2E1HA 4QQGA 2ZCFB 4TVRA 1ZX6A 2A28A 3M9QA 2DTHA 3MEVA 1PWTA 2I0NA 1U06A 3OYYA 4E7KA 3I9QA 4CC2A 1HSQA 1C0MA 3X20B 2E4HA 2COZA 3OBWA 2M51A 2ZPGB 1QMCA 3QKJA 1G3YA 2GTJA 5KYXA 1KC8C 3HRUA 3OYEA 1YJWA 3JCMV 2R5MA 4RTTA 2CDTA 2RQRA 2RN8A 5C6SA 3GP8A 3TVTA 4E2FB 2V1RA 3OYJA 2KRNA 2YRCA 2BZ8A 2DTOA 4J9EA 4IKFA 2FPEA 4M77F 2G3RA 3G4SA 3UT1A 1JO8A 3CCEA 1MGQA 2DXUA 1RAFB 1VQ7Q 1UGPB 2PZ1A 3E9FA 5FU6B 3CCLQ 3G71T 2V8JA 1YI2A 3H8ZA 3V7RA 1PRLC 5GAMd 2K7AA 1VQKA 3H0HA 2K6DA 1QLYA 2FZCB 5J39A 4KH0B 3JCMf 3M4YA 1SKUB 2RJEA 1KHCA 4J6WA 4Y92A 2D9TA 4B6MA 3SFMA 2CUBA 2AT1B 2BZYA 5L23A 2K5IA 1M5Q1 3CC2Q 1S1NA 4PLLA 5KYUA 4OB3B 2J7IA 2RJCA 3DLMA 5DY9A 2EJGA 3SWNC 4M7AC 4A4FA 2LQKA 1N8RC 1Q7YU 1N9RA 1UFFA 1KIKA 2LVMA 4IURA 4OMPA 3T9NA 1H3HA 2J06A 3CXCS 4E7ZA 1K73R 3NTKA 2P4RA 5GANj 2J6FA 1OI1A 2EYYA 1WJRA 3JCMh 1G3SA 3VYGA 2ZPBB 4QQ6A 1J3TA 3FJ5A 2V8KA 2KRSA 2V8IA 3HKSA 3JCMc 2KE9A 1Y07A 3HFNA 2ZAEA 4X9CA 2XDDA 3VS6A 4FSXA 4ZTFA 1WQWA 1E6HA 4JS5A 2O9VA 1OX8A 2HDAA 4M7AA 1JB0E 1R0CB 5LJ3e 4JRPA 1PD1A 4HXJA 5D6WA 1NLOC 1SRLA 1MMDA 2YRVA 2E41A 2CSQA 3TCJA 4PJOF 2HQEA 5FWBA 1TTHB 1VQLT 2HMAA 3L1AA 2RHXA 1Q86U 4PJOC 2DJQA 1RLQC 2OAUA 1ZHIA 1VQ7A 3G71Q 1D1BA 4OMOA 3NTIA 3D7SB 1X6GA 5CIUA 3OA6A 3S3NA 5A2QE 5FU7C 4M78G 3CC4A 1UGRB 2M0YA 1YITQ 1SEMA 4M7AE 3MO8A 4KUDK 4XQ3A 1ZBXA 4M78E 2W10A 2EQKA 3CMEA 3A8MB 2JS0A 4JJBA 1FX7A 4LUEA 3REBB 1W1FA 3EGDA 2D0NA 3OY9A 3QDRB 1LVKA 2A37A 1QCOA 5GAN5 3OS2A 3PMTA 2L3PA 2F5TX 4EMGA 4BE0A 1WHKA 3A8HB 2MWPA 3ZBDA 5GAN3 1KK7A 4QQDA 4C92C 3M0PA 4ZGJB 1GFDA 4KBMB 1O75A 1S72T 2MK5A 2CYZB 3PFSA 2LP5A 2D0QB 3C95A 4DOVA 2X3WD 2F1LA 3A1PA 2QA4T 4C92A 1M9SA 4MZTA 2C06A 1HYOA 5KYYA 3J80E 1MMGA 1X6BA 2JNGA 4L59A 1ZUKA 2W0ZA 5A0GA 1QVPA 4J7IA 1VQ4T 4RTWA 4VUBA 2RQUA 3OYAA 4HCKA 4BY6B 2KYBA 1AWXA 4PNOA 5KCOA 2AHJB 2QEXT 4B9WA 2EYXA 2OI3A 1WYXA 3BDUA 3OYNA 2VC8A 4AFSC 4O6JA 2FB7A 2JT4A 3M0TA 1UGVA 3QG1A 2L2PA 1VQ8A 4R56A 5LJ5f 1EFNA 1BIBA 2X35A 3CCST 4M78B 4J6XA 1VIEA 1YHQT 2XI9A 1PHTA 4FYYB 3QPHA 3GNGA 1T0HA 4HCCA 3JCMe 1AZGB 4E6RA 1AVZC 1YBYA 2VGNA 2LT4A 2E12A 2PU9B 3CCUT 3WVEB 4F04B 1UHCA 1XQHA 3LYIA 2SRCA 3JRZA 1VQMQ 4M7DF 2OAWA 1VQMT 1K8AR 4M75C 1QQJA 2YLCA 2QGFB 1VQLQ 4AT1B 3SHWA 5KYUB 2OJ2A 5CO7A 5LJ5e 2DA9A 1BI0A 5LJ5h 3HPWA 1FXXA 3I5RA 1IO6A 4QVZA 5HK3A 1VQLA 2L5QA 4IUUA 5CKBA 2KGTA 1JQQA 1X43A 2K57A 2QDYB 3BFMA 4F7UE 1N8RU 1VQNA 4J7FA 3M0QA 3HRTA 2KY9A 2EQUA 3CCRA 5CKHA 1U8RA 3MPUB 5IH2A 3EFRA 2PVDB 3EG1A 5GANf 1D1CA 4C0DC 5LJ3d 1WDXA 3JB9G 1K9MR 4BE2A 1WQ7A 1ZUYA 4N4IA 5LJ3f 3LWIA 3QIIA 2NYSA 5GANd 4OP0A 3RESA 2YHTA 2RI5A 3JV3A 4F7UB 4BDZA 3HL8A 1ZA1B 3TREA 3JB9H 2F2XA 3QYHB 1WZOA 2JTFA 4EMKB 1K8AU 2E70A 1YWOA 2KRMA 3LW5E 4O5VA 1JJ2A 1NPPA 3LX7A 4QVDA 3JCMJ 1FMKA 1AWWA 2K5LA 2QG9B 1KD1C 4EMKC 5D6XA 2FRYA 1I0CA 4XTUA 1M3CA 4RTUA 3QXEB 3R6NA 3BY7A 2C0TA 3OS5A 5KYYB 1OU9A 1V1CA 2A36A 3KBGA 2BIVA 1VQPQ 4PJJA 1WNLA 4WF2A 3ZL7C 4QW2A 4E7LA 1K0XA 4Y28E 1UECA 2EYZA 2L3RA 4MDWA 2DL7A 2RQWA 1OPKA 3P8HA 2PVGB 5IXFA 2DYBA 4XAXB 5LJ5j 4MMKA 3FIFA 2FZKB 2LDMA 4GBQA 1LPLA 1X75C 2F69A 3CCMQ 2DAQA 4C0DB 2PUKB 4OMMA 5DLOA 2EKHA 1YIJA 2O01E 5FRMA 3FB9A 3P8BB 5LJ5d 5AT1B 2KI7A 2LJ1A 3CCVT 1K76A 1WHMA 2JMAA 1LCKA 4J9HA 2M1HA 1SG5A 2RF0A 2IIMA 4FYVB 1WXBA 1O9SA 4J6YA 3CCUQ 1UB4A 3CCLA 5GAN7 3META 3GIBA 1ZSGA 1SF9A 5D6YA 1C6VX 4XTXA 3VS1A 4BI3A 2X51A 2DNUA 1QVGS 4PJOB 2VGMA 1QVFS 1SHFA 2ZPEB 2P0PA 2OTLQ 1WA7A 2C0IA 4PJOG 2EWNA 2BE9B 1HXDA 5GMKl 5CKDA 1VQNT 2ENMA 4M78C 2LMJA 2XD0A 1H641 3I56Q 1GBRA 4PFOA 2QQSA 2VUBA 4RMOA 3U23A 4II1A 1V76A 4OB2B 2OTJQ 3NHNA 2PVOB 4OB0B 2K5FA 4J9FA 3X26B 4M77E 1WGSA 2QK0A 5GAN6 3CMEQ 1VQ4A 5GANh 2HQXA 1D0YA 2RB6A 2YUNA 3M0SA 4X9DA 2OTLA 3TEEA 4BI4A 1RAGB 1OYXA 5FRNA 4AFZC 3E9GA 4RCCA 4C8QF 1NYFA 3VS7A 3MP6A 1UEBA 2VV5A 1NE8A 2HCKA 2P0QA 4RTZA 3CMET 2FRWA 4KGZB 3UATA 2ZPHB 1RAAB 1X69A 4IIMA 1NJIC 5C0MA 5GAOm 3TSWA 4GLMA 4DBQA 5LJ3j 2XICA 3L2WA 2K79A 3G4ST 1AWOA 4PJOD 1M1KU 4F17A 1EIFA 2DLPA 1VQKT 2EFIA 1Y0MA 2X4YA 4Q5WA 1WXTA 1VQ7T 3M56A 4N0AA 1RI0A 1M90R 1X01A 1X6OA 5GANe 2JOYA 2YWWA 2HAXA 1FWZA 2KROA 2JUFA 2DBKA 5I22A 1GBQA 5KCHA 1M3BA 2R58A 1Q81C 4NL3A 3JCMX 2O9SA 5FLXE 2PQWA 2AKKA 3J81E 3RKWA 5I21A 1AZEA 4DEYA 1HK9A 1T3SA 3OW2S 1BBZA 4BACA 2M9UA 2DF6A 2VVKA 4RG8A 1U1SA 4PLIA 2CT3A 4FW2A 5GMKi 4Z02A 4A4HA 4J8OA 4KUIA 1T3LA 4LNPA 1VQ6Q 5KH6A 2BTTA 4C8QA 4N4HA 3RKYA 5GAOp 5A0DA 4CI0C 1NEBA 3G71A 3P8DA 2H3EB 2GBQA 4AFQC 1NLPC 3VS2A 1OQKA 2EGAA 2GF7A 2CS7A 4J9DA 4BE1A 3J7AF 3JSCA 2E6NA 3CD6T 2RPNA 4FT4A 4CC4B 2GQVA 1IHWA 2C0OA 4F16A 3JAME 3L2UA 4JS4A 5CQXA 3OYGA 2CP5A 1BI1A 1NG2A 5IAYA 3LH5A 1FMWA 1S72A 2NUTA 1KQ2A 3CC2A 4PJOA 3MHXA 1VYVA 2AK5A 2NUPB 3JCMd 4FCYA 2XMFA 2DKGA 3OYDA 1D0XA 5LJ3h 1YHQQ 1Q82C 1H92A 3VS4A 2L8DA 4X1VA 4J9GA 2QYZA 4C92D 1Q81R 1D09B 2E6ZA 4CRIA 4M7DA 2X9HA 1YJ9A 5GAMf 3N5BB 5LJ5g 3LH0A 4LE9A 2HNIA 1NEGA 2GFUA 2SEMA 3E19A 4XU3A 1JEGA 2CREA 1D1AA 3QYGB 8AT1B 2JMCA 1KSWA 3EG9B 3S6WA 4WCIA 5KE3A 5LL6S 2M0OA 1PG5B 1ZSZA 1WHHA 1SRMA 3EH2A 3CMAQ 2CUDA 4J9BA 1BB9A 4PFZA 4HA8A 4A4KA 2DPPB 2Y4YA 2LJ3A 1N8RR 1QP3A 2GCXA 2RHIA 1TXQA 3TQ7P 4QT7A 3CCUA 3H0FA 3MEUA 1YNZA 4R0KA 2WSFE 3SEMA 1K0SA 2DIQA 2HL3A 2X4WA 1MUZA 4NS5A 4OVAA 4BD3A 2CGHA 4FL6A 2YXYA 1YJWQ 5GAMe 2QQBA 2LQ8A 1UGQB 2IVWA 5EG2A 3OYIA 2VWFA 1X2QA 4ME7A 5FWCA 3CEYA 4E7IA 3FRNA 3OMCA 1TG0A 4C0ZA 3OYCA 1UUEA 3CCVQ 2QQAA 3M5AA 4AG2C 1Q82R 5HKCA 4EMHA 1VQ8Q 3EG0A 2YDLA 5I2MA 2EJFA 3CC2T 1CKBA 1Q7YC 4CC7A 2DVJA 2VB6A 5GANg 1K73U 2MAMA 2GNCA 4M4ZA 2ED0A 1Q82U 3QWYA 1B34A 5HY6A 2GGRA 1VQOA 2F2WA 2CZ6B 3OYHA 4C0FA 4RCBA 2JN0A 1Y7XA 2B8AA 5KYWA 3UPUA 4C5HA 2P0KA 4XU0A 1MNDA 1QP2A 4JJNK 3I55Q 2BKDN 4IUVA 3UA6A 5LJ3g 1KQSA 2KT1A 2KT8A 5IN1A 5IHNA 2DM1A 4MDXA 4M78A 3KUFA 4OMLA 3MCAB 2DZCA 4LDVA 4IUTA 3VS3A 3OMGA 3HSBA 1VQ4Q 3ASKA 4E7HA 2OTJA 1KFZA 4A63B 3OW2P 1GRIA 3OB9A 4Z8AA 1T0JA 4J5YA 4BY6C 1Z9ZA 4XK8E 3PNWC 4K11A 3UDCA 3H41A 2XKOC 2LTOA 4OGEA 1RAIB 3FLGA 2ATCB 2FZGB 4Y91A 1AWJA 4BUGA 4ORZA 1PSFA 2AZVA 3PT9A 1GFCA 2LZ6B 5GAN2 1XOVA 1B07A 2MPXC 2BZXA 3QWXX 2IPOB 1KQSP 2F5KA 2DL4A 2DILA 3G4SQ 2A08A 8ATCB 1RAHB 1M8MA 1XNIA 2XHCA 3RERA 3SDZA 4DBHA 2M16A 3M57A 4RKUE 5L8RE 3BE3A 5GAN8 2PUOB 1I5LA 3ME9A 5I2SA 2HKNA 2JJ9A 4E7SA 2L3QA 5A0LA 2X4JA 1NJIR 1YJ9Q 3JB9D 4LDWA 4JRKA 3MP8A 3G7ZA 1VQ9A 3Q1JA 2LQWA 2AZSA 2RA2A 1HJDA 2CZ1B 4KULA 4PK4A 2NUPA 4HVUA 1G83A 2FPFA 4D8DA 3VUBA 3RBBB 2DVEA 2DXTA 3JB9J 3CCJT 2XU8A 3V8KA 2VYTA 1SSHA 2JM9A 4QVCA 3G6EQ 1I8FA 4M7AF 1ZQ1A 1VQOQ 2ECZA 5IHKA 3OYBA 3L2QA 3DKMA 4HCZA 4M7DC 4L5GA 5CKEA 5KYXB 3G1JA 4N4GA 3CCMA 1B34B 4WTOB 1GCQA 1MMNA 2FEIA 2DD5A 3OS1A 1VQOT 4FYXB 2O88A 1P92A 3TSZA 2MMPA 1YP5A 4LD6A 4J83A 5KE2A 1G5VA 4ELZC 2V1QA 5KYWB 1K1ZA 3ZEHA 2QEXQ 4RTYA 3OSVA 4ZGEB 2DEUA 1N5ZA 3I56A 4MZPA 1PC0A 1VQKQ 1IB8A 1VA7A 3M53A 1SPKA 2DL5A 2KVQG 1ARKA 1LNXA 2EQIA 2B86A 3C0CA 4IUPA 1VIFA 5HCKA 4XU1A 2JTEA 2CZ7B 3KXTA 3QJYA 1IRXA 3QDFA 1NJIU 1RAEB 2DE0X 1FMVA 4C5EA 1RUWA 4XTWA 5GMKm 2HEQA 3LGLA 5DM7R 1YI2T 2O31A 1TWBA 2K9GA 2WSCE 1UGSB 1Y96A 1G3TA 1EX4A 1TUDA 3EFSA 3VYHB 3JB9I 1KD1R 2P84A 3GLXA 4KGXB 2KYMA 4LDYA 2KNBB 2ROTA 2VXFA 5CQYA 1WHGA 2E64A 1AT1B 4HVWA 2QQRA 2JVVA 2A7YA 2DYIA 1D0ZA 3CPWS 3L42A 4C8QG 1JJ2P 4JLGA 1UTIA 1LOJA 2FYKA 2XDBA 1IXDA 1WJQA 4Z89A 4LD9K 1OU8A 1VQ9Q 2VASA 3HRSA 4PL6A 2XDPA 1PRMC 4V2SA 2OTLT 5GAOr 4JRIA 1WHJA 1F1BB 1W2BS 2ZPFB 2HSPA 3CD6Q 2CP7A 3QHSA 4C8QC 3OW2A 1AD5A 1ACMB 3CC7A 4M7AD 1WJSA 2ROLA 1K9MU 2YUPA 2KSSA 4OMQA 4EIKA 1MNEA 4BDYA 3EHRA 4AFUC 2E10A 1QKXA 1QKWA 2V26A 4DBFA 4ELYC 3EGXB 2PNIA 3GBQA 5D7UA 2LX7A 2LNHB 3NMZC 3CXCA 2WSEE 1OZ2A 1UHFA 2FHDA 5FW9A 1TH7A 3G6ET 3GNFB 1GCQC 4M77B 2DRMA 1UDLA 4UC4A 3M0UA 4HKEA 1K8AC 2CSIA 3ZFJA 1K9MC 1TOVA 2DMOA 1EZZB 2QXFA 4N0AC 1MV3A 1G8XA 1E7OA 2DTIA 3CQTA 1OX9A 2NWMA 3DLLA 3A8GB 3FJPA 1CKAA 1PM3A 1X2KA 4HVVA 1U5SA 4NOYA 4M78D 1QVFA 2J6OA 5M9OA 1YJWT 4F7UF 1UJYA 5J26A 3O8VA 4A4EA 5IT9E 2RI2A 1NM7A 1M1KR 4OGCA 5CK9A 3VJPA 3QUIA 1CSKA 2LT1A 3RMQA 1KQ1A 5GAMh 3UWNA 5CAIA 2D8JA 4M7DG 1MV0B 4M75F 5IXBA 3A98A 5IHIA 4ZNXA 2O4XA 1M3AA 1VYUA 2DETA 4CC3A 4PJOE 2EQJA 2DEQA 2EVRA 2LJ0A 3M54A 4ZN3A 2ED1A 2K3BA 2HBWA 3PVQA 2COWA 1YJNT 1OULA 2DXBA 2FL7A 3JCMg 2A3LA 4IIOA 4C8QD 3EG3A 3MEAA 1OOTA 1M2OA 4BI8B 2RK1A 3LLRA 1VQ5T 3CC7Q 2NUZA 1VQ5Q 1Y96B 4BB7A 2KEAA 2X3XD 2NUTB 4DOWA 3A8OB 1OV3A 1S72Q 3M59A 3UA7A 4ANJA 3VV0A 2PTKA 3EFOB 3MP1A 3VS0A 4C0GA 2E3HA 5EC7A 1M90C 5GMKj 2DBMA 4YTLA 1I07A 1R77A 3S3OA 2EGCA 4C5IA 3I56T 1BI3A 2EQMA 2DD4A 3OBYA 1GCPA 1TUCA 1I4K1 3CC4Q 2DZ9A 2HQHA 3CC4T 1OEBA 1N27A 1N6AA 3URGA 3RNJA 2LNVA 4XTVA 3X24B 3CCSA 1A0NB 1NZ9A 1XTDA 3VRZA 2H3JA 1VQNQ 3CPWP 1DJ7B 3M4GA 4JRQA 4GLKA 2K3XA 2XIDA 3THKA 1ABQA 4FW1A 1WHLA 1IGQA 3A5ZB 2I2LA 2RQTA 1WX6A 4P5NA 2Z0WA 3I35A 4XTYA 1B3QA 3E2UA 9ATCB 2HZYA 3JCMb 1Q7YR 3AHUA 3DB3A 4EMKA 4OMFB 2A0FB 5GAN4 1RADB 1SHGA 2MCNA 4ATOA 4QKUA 4MMLA 3RR6A 1W2BP 2ABLA 2YUOA 2KAFA 2JS2A 2E5QA 4KH1B 3JCMP 2YSQA 1XJWB 1YJ9T 5J3BA 1IZ6A 1VUBA 2CP3A 3PIPA 1YJNA 1M2VA 2KK4A 4AG1C 3CCJA 4JLIA 5GAMj 2QDLA 3SB2A 1Z9QA 2E65A 2MWOA 2O2OA 2RHUA 2VKNA 4M75D 2EYWA 5DLQE 1YI2Q 2K3YA 4RTVA 2OX7A 3EGUA 4RTXA 3VU3C 1JBMA 1U1TA 4AMCA 4RG2A 2GTOA 2EBPA 2DX1A 1VQ8T 1QWEA 3HP9A 3CMAA 1KQSS 3UF4A 1V29B 2MOXA 1I1JA 2LCSA 1YWPA 3EHQA 2FO0A 2GQIA 3PIOA 2BE7D 1RABB 2LCLA 4M77A 2QTXA 5AYFA 4JUVA 1YIJQ 4LDXA 1YN8A 1BI2A 1PCXA 2K2VA 2CT4A 1M1GA 2EIFA 1VQ6T 4LDUA 1OZ3A 3WXMB 1NBEB 2EJ9A 3H6ZA 3FC3A 2KR3A 4X34A 1TUGB 1W70A 2COYA 4M75G 2QEXA 1UJ0A 3EFOA 1W6XA 2DL3A 4B9XA 3RUXA 3VUZA 1I5OB 4ZGDB 1YCSB 5I11A 2HD0A 3NGPA 3CMAT 4IUQA 1K9AA 2MI6A 3JB9F 3ER0A 1RACB 1VYTA 2M02A 1BYMA 3RMSA 2QASA 4ZTJA 3OYFA 2O4XB 1K4US 3PGGA 1HD3A 4R55A 2KMTA 4D8KA 3FDRA 1C1AA 3SWNA 3VS5A 5ECAA 2BUDA 1KJWA 1FYNA 1M1FA 2X4XA 2EYQA 3RIRA 1PKTA 1ABOA 4C8QE 2JZ2A 3I5SA 5KYNA 3CCQT 1G2BA 2VXEA 3V8JA 1WI7A 2K4YA 3L2ZA 1RLPC 4M77C 2F2VA 2GFAA 3EG2A 6AT1B 1M30A 1KG1A 1JXOA 3C12A 1KC8U 1JRIA 2HL5C 4JZ4A 1X27A 3EAEA 3V7SA 2RHZA 5FROA 2EPDA 3VKIA 3NTHA 1YFNA 1M2VB 1M8VA 1VQ6A 1IHVA 1OPLA 2QAZA 2RM4A 3L2VA 1QCFA 2DXCA 3DB4A 2QTVA 1RI9A 3MKDA 3NPFA 2JTMA 3QBYA 5GJWB 2EKOA 1H8KA 4FT2A 4XTZA 3BDLA 4J9CA 2ZPIB 2FVUA 1ZLMA 2XG8D 2YUQA 1IGUA 4GY5A 4FIBA 4J9IA 3NFCA 3X25B 2DIGA 3WVDB 4JJDA 4L6V5 2WACA 3OSSC 4DEXA 3C94A 4JPBW 5GMKe 4C92E 5GMKh 4M75B 2G6FX 1YHQA 4F14A 2CZ0B 1KD1U 2LCCA 1BCMA 2RMOA 4DBRA 2CH4A 2YT6A 3CCVA 2JM8A 2DRKA 3INZA 2RQVA 5GAOl 3I55T 3PMIA 7AT1B 3CBPA 2CP6A 3C4SA 1W4SA 4OB1B 4ESRA 3I55A 1W2BA 1M1KC 1VQPT 5CVIA 2J6KA 3CBOA 3IQLA 2RJDA 1PKSA 1VQ5A 2Y90A 2DL8A 3M55A 1H3ZA 2KDSA 1ZA2B 2DK3A 4C92B 3CCQA 3CPWA 2L0AA 3FEOA 1LJOA 1YITA 3F70A 2LQNA 1ZUUA 2HSEB 3M0RA 2YRDA 4E7JA 1BIAA 2CP0A 3V7CA 4OF1A 2QA4A 1M4ZA 3BW1A 3A8LB 2L3SA 1NPRA 1GXIE 3H0IA 3REAB 3CCQQ 1R0BG 4HCBA 3QZ9B 2DERA 1RL2A 1BKBA 4LUDA 3QSUA 1Y57A 1ZBJA 2CH4W 1U3OA 3O5ZA 1K73C 3L2RA 4EDUA 1AHJB 4A4GA 3OQ5A 4C8QB 1GL5A 1JXMA 4M7DD 1PSEA 1QWFA 2D8HA
chains in the Genus database with same CATH topology
4NOYA 3ZBDA 5GAN3 2DKGA 4M78D 3OYDA 1QVFA 5LJ3h 5M9OA 1YJWT 4QQDA 4C92C 4F7UF 1Q82C 2L8DA 1I81A 4ZGJB 4KBMB 4C92F 5J26A 1O75A 3O8VA 4C92D 4A4EA 5CCAA 4D6WA 1S72T 1QVGA 4E47A 5IT9E 2RI2A 2E6ZA 3R6OA 4CRIA 2CYZB 1YJ9A 5GAMf 4M7DA 1D3BA 2RO0A 3N5BB 3PFSA 4OGCA 4EPCA 4M7AG 5CK9A 5LJ5g 3LH0A 3CC7T 3C95A 2D0QB 4DOVA 4ZN1A 3GF5A 2HNIA 2RI3A 3VJPA 5GAMg 2GFUA 3QUIA 3MEWA 3E19A 2DJZA 2LT1A 4XU3A 2QA4T 2RH2A 3CPFA 4NL2A 4C92A 3RMQA 1M9SA 1KQ1A 3QYGB 4MZTA 2C06A 1WPYA 3UWNA 5GAMh 5CAIA 3S6WA 3J80E 5KE3A 2JNGA 5LL6S 4M7DG 3QJ6A 2M0OA 1YITT 4M75F 4L59A 3LWHA 3CCET 1SSFA 2O4XA 2RHYA 3E1SA 5A0GA 1QVPA 4J7IA 1VQ4T 4VUBA 4HA8A 4PJOE 1VQMA 2RD1A 4F7UG 2EQJA 2DEQA 2DPPB 4A4KA 3OYAA 3M54A 4ZN3A 5CKFA 3OYMA 2Y4YA 4BY6B 4M7DB 4PNOA 4FU6A 5KCOA 2AHJB 2Y4XA 4M78F 2LC4A 4B9WA 2QEXT 1YCYA 2IG0A 1QP3A 2GCXA 2RHIA 3BDUA 5GAOq 3OYNA 1YJNT 2VC8A 2DXBA 4O6JA 2FL7A 3JCMg 2A3LA 2FB7A 3RKXA 4C8QD 1G3WA 3QG1A 3CCUA 3MEAA 3MEUA 1VQ8A 4BI8B 4R56A 5LJ5f 2RK1A 1BIBA 2WSFE 3LLRA 3GPLA 1QW1A 1VQ5T 2X35A 2DIQA 3S3MA 1M90U 3CCST 4M78B 1MHNA 2RK2A 1Y96B 4BB7A 2QQ9A 2X4WA 4NS5A 4J6XA 4OVAA 2CGHA 4BD3A 3A8HB 4FL6A 1VIEA 1YHQT 2XI9A 2QQBA 4DOWA 2LQ8A 1UGQB 3A8OB 3QPHA 3M59A 5GAMe 2IVWA 3SWNB 3VV0A 5EG2A 3OYIA 3GNGA 3MP1A 3SD4A 4HCCA 4DA4A 4ME7A 4C0GA 3JCMe 2NLUA 1M90C 3CEYA 5GMKj 4PKCC 4E7IA 3FRNA 3OMCA 1YBYA 3QO3A 4YTLA 4C0ZA 3OYCA 2VGNA 2QQAA 3M5AA 3HHTB 2LT4A 5HK0A 4EMHA 5HKCA 3S3OA 1Y71A 4F7UA 2E12A 2PU9B 3CBMA 3CCUT 4C5IA 3I56T 1BI3A 1N9SA 5I2MA 3OS0A 3JCMQ 5GAOn 2EJFA 2DD4A 2EQMA 2P4TA 3OBYA 3WVEB 3CC2T 1I4K1 1Q7YC 2DZ9A 2LRQA 3CC4T 1N27A 1N6AA 3URGA 2LNVA 1XQHA 3LYIA 4XTVA 3X24B 3CCSA 3TU4K 4XU2A 3X28B 3JRZA 2MF2A 5GANg 1NZ9A 1XTDA 2LX9A 1K73U 4M7DF 2MAMA 1VQMT 2H3JA 1Q82U 4HT8A 2R57A 1B34A 4M75C 2YLCA 5HY6A 2EAYA 1VQOA 3OYHA 2CZ6B 1VQPA 1M1KC 4C0FA 1DJ7B 3M4GA 4RCBA 5CO7A 3G6EA 4JRQA 5LJ5e 1BI0A 4GLKA 2JN0A 1Y7XA 5LJ5h 3HPWA 1FXXA 2K3XA 2XIDA 4QVZA 5HK3A 1VQLA 2L5QA 4IUUA 5CKBA 2HBPA 1KHIA 2B8AA 3A5ZB 2I2LA 2K57A 2QDYB 3BFMA 5FU6C 4F7UE 3UPUA 1N8RU 4P5NA 4J7FA 1VQNA 4C5HA 2P0KA 4XU0A 3HRTA 3CD6A 1QP2A 4XTYA 4JJNK 4KT0E 2KY9A 3QZ5B 4M77D 2EQUA 2BKDN 4JDSA 4IUVA 5LJ3g 1KQSA 3PTAA 3CCRA 2ZZDA 5CKHA 3JCMb 3CCMT 1U8RA 5IN1A 3CCLT 3AHUA 3DB3A 4EMKA 4OMFB 4HT9A 5GAN4 3V8LA 1Q86C 4MDXA 4M78A 3KUFA 4DQ2A 3MCAB 2DZCA 3EFRA 4M7AB 4LDVA 2PVDB 4IUTA 2R5AA 3OMGA 4C5GA 3JCMW 3HSBA 4ATOA 4MMLA 5GANf 4C0DC 3ASKA 2KAFA 4E7HA 5LJ3d 2E5QA 3JB9G 3JCMP 4BE2A 2OTJA 1YJ9T 5J3BA 1WQ7A 1IZ6A 1VUBA 3LWIA 4N4IA 5LJ3f 2D6FA 3QIIA 3OB9A 4M75A 3PIPA 1YJNA 1JJ2S 5GANd 4OP0A 2KK4A 3RESA 4FM4B 4MZMA 3CCJA 2YHTA 2RI5A 4JLIA 5GAMj 4J5YA 4BY6C 4BDZA 4F7UB 4XK8E 3SB2A 3PNWC 3HL8A 3UDCA 2E65A 2MWOA 2XKOC 2LTOA 3TREA 3JB9H 3QYHB 3HFOA 2JTFA 4A54A 4OGEA 2RHUA 4EMKB 3FLGA 4M75D 2E70A 1Q81U 4Y91A 1K8AU 1VQ9T 3LW5E 4O5VA 5DLQE 1NPPA 3LX7A 4BUGA 1JJ2A 4QVDA 1YIJT 1PSFA 3JCMJ 3PT9A 2K3YA 3CCRT 2ZGWA 5GAN2 1IREB 1XOVA 2K5LA 3VU3C 1KD1C 4C92G 1JBMA 4EMKC 5D6XA 1U1TA 2F5KA 5CR2A 4RG2A 2L89A 1D3BB 2QI2A 2YLBA 3OYKA 2KQWA 2XK0A 5FU7B 1R8OB 1XNIA 2XHCA 4XTUA 2CKKA 1VQ8T 3SDZA 3HP9A 3LGFA 2M16A 2RJFA 3QXEB 3CMAA 3BY7A 3M57A 4RKUE 4M75E 5L8RE 1KQSS 3GOXA 2DO3A 3OS5A 4M77G 4A53A 5GAN8 1V29B 3OYLA 3M58A 3KBGA 2OTJT 2PUOB 2BIVA 1I5LA 3ME9A 5I2SA 2E1HA 4QQGA 1WNLA 2ZCFB 4WF2A 3PIOA 4TVRA 5A0LA 4QW2A 4E7LA 3M9QA 2DTHA 3MEVA 2X4JA 2LCLA 4M77A 4Y28E 2QTXA 3OYYA 2L3RA 4MDWA 5AYFA 4JUVA 4E7KA 4LDXA 3JB9D 4LDWA 4JRKA 3MP8A 3G7ZA 3X20B 1VQ9A 3P8HA 1BI2A 2K2VA 3Q1JA 2PVGB 1M1GA 2EIFA 4XAXB 5LJ5j 1VQ6T 4LDUA 4MMKA 3FIFA 2RA2A 1OZ3A 2LDMA 3WXMB 1X75C 2CZ1B 3OBWA 2F69A 4KULA 2DAQA 4C0DB 2PUKB 5DLOA 2EJ9A 2ZPGB 3H6ZA 3FC3A 1YIJA 4X34A 2O01E 5FRMA 3FB9A 3P8BB 3QKJA 4M75G 5LJ5d 1G3YA 3CCVT 2QEXA 1KC8C 4B9XA 3HRUA 3RUXA 3VUBA 3VUZA 3OYEA 1YJWA 2DVEA 3JCMV 4ZGDB 2R5MA 2DXTA 3JB9J 2M1HA 3CCJT 5C6SA 3GP8A 2XU8A 3V8KA 1O9SA 2VYTA 4J6YA 4QVCA 2HD0A 1UB4A 1I8FA 3CCLA 3RERA 4M7AF 5GAN7 1ZQ1A 3META 3CMAT 4IUQA 2MI6A 3OYJA 3GIBA 3JB9F 5D6YA 3ER0A 2DTOA 4XTXA 3OYBA 4IKFA 4M77F 2G3RA 1BYMA 3L2QA 3G4SA 4BI3A 3RMSA 3UT1A 3DKMA 4ZTJA 4M7DE 4HCZA 4M7DC 3CCEA 4L5GA 5CKEA 2VGMA 1QVGS 1QVFS 4PJOB 1MGQA 2O4XB 2P0PA 2ZPEB 3OYFA 2DXUA 3PGGA 4N4GA 4R55A 2KMTA 3CCMA 1B34B 1UGPB 4PJOG 3E9FA 5FU6B 3FDRA 2EWNA 3G71T 2V8JA 1YI2A 2DD5A 3OS1A 3H8ZA 3V7RA 1VQOT 1HXDA 3SWNA 5GMKl 5CKDA 5GAMd 2BUDA 1VQNT 1M1FA 1P92A 2X4XA 2EYQA 4M78C 1VQKA 2MMPA 4LD6A 4J83A 2XD0A 1H641 5KE2A 3RIRA 4C8QE 1G5VA 4ELZC 2JZ2A 3ZEHA 2QQSA 2VUBA 4RMOA 3CCQT 5J39A 2VXEA 3OSVA 3V8JA 2K4YA 3L2ZA 3JCMf 4II1A 4ZGEB 3I56A 4M77C 4OB2B 2PVOB 3M4YA 4MZPA 2K5FA 4OB0B 3X26B 4M77E 1WGSA 2RJEA 1KHCA 4J6WA 2GFAA 5GAN6 1VQ4A 2D9TA 3M53A 5GANh 2HQXA 2KVQG 1KG1A 3C12A 3SFMA 1KC8U 1LNXA 1JRIA 2RB6A 4X9DA 4IUPA 3EAEA 1VIFA 3V7SA 2OTLA 4XU1A 2CZ7B 3KXTA 2K5IA 1M5Q1 3QJYA 2RHZA 3TEEA 4BI4A 1OYXA 5FROA 1NJIU 4PLLA 5FRNA 3VKIA 3NTHA 3E9GA 4RCCA 4C5EA 4OB3B 4C8QF 1M8VA 2RJCA 3DLMA 1VQ6A 5DY9A 2EJGA 3MP6A 4XTWA 1UEBA 2VV5A 1NE8A 5GMKm 3LGLA 2P0QA 3SWNC 5DM7R 1YI2T 2RM4A 3CMET 4A4FA 3L2VA 4M7AC 2DXCA 2LQKA 3DB4A 2ZPHB 1N8RC 1Q7YU 1NJIC 1N9RA 5C0MA 5GAOm 1W2BA 2JTMA 3QBYA 5LJ3j 2EKOA 2WSCE 2XICA 3L2WA 2LVMA 1UGSB 4FT2A 4IURA 1Y96A 3T9NA 4XTZA 1G3TA 3BDLA 3VYHB 3EFSA 3G4ST 2ZPIB 3JB9I 2FVUA 3GLXA 4PJOD 1M1KU 2XG8D 3CXCS 4LDYA 1EIFA 3NTKA 1VQKT 2EFIA 2VXFA 4GY5A 5CQYA 2X4YA 5GANj 4FIBA 3NFCA 1OI1A 4Q5WA 3X25B 2DIGA 2E64A 1VQ7T 1WJRA 1G3SA 3M56A 3JCMh 4N0AA 3VYGA 2QQRA 2JVVA 4L6V5 3WVDB 1RI0A 2ZPBB 2WACA 3OSSC 4QQ6A 2V8KA 3HKSA 2V8IA 3C94A 3JCMc 1X01A 2A7YA 5GMKe 4C92E 3CPWS 3L42A 5GMKh 1X6OA 4M75B 4C8QG 5GANe 4JLGA 1YHQA 1Y07A 2CZ0B 2JOYA 1LOJA 2FYKA 3HFNA 2LCCA 4X9CA 1KD1U 1FWZA 2HAXA 2XDDA 2XDBA 4FSXA 4ZTFA 1WJQA 4LD9K 3CCVA 1WQWA 2JUFA 3HRSA 3INZA 5GAOl 3I55T 4JS5A 5KCHA 2R58A 4PL6A 4M7AA 1Q81C 2XDPA 1JB0E 3PMIA 4NL3A 5LJ3e 3JCMX 4JRPA 2OTLT 4V2SA 5D6WA 5GAOr 3CBPA 3C4SA 4JRIA 1W4SA 4OB1B 2YRVA 3I55A 5FLXE 2PQWA 2ZPFB 1W2BS 2E41A 3J81E 1VQPT 3RKWA 5CVIA 5I21A 3CBOA 3QHSA 4C8QC 1HK9A 3OW2A 3OW2S 3TCJA 4PJOF 2HQEA 2RJDA 4BACA 2M9UA 1VQ5A 3CC7A 2Y90A 1VQLT 4M7AD 1WJSA 3L1AA 2RHXA 3M55A 1K9MU 1H3ZA 2KDSA 4RG8A 1Q86U 1U1SA 4PJOC 4PLIA 2KSSA 2DK3A 2OAUA 4C92B 1ZHIA 3CPWA 3CCQA 4BDYA 3FEOA 2E10A 1LJOA 5GMKi 1YITA 3F70A 1VQ7A 3NTIA 4Z02A 4A4HA 4ELYC 4J8OA 4KUIA 5CIUA 5KH6A 3OA6A 3S3NA 4C8QA 4N4HA 1BIAA 4E7JA 3V7CA 4OF1A 5A2QE 3RKYA 2QA4A 1M4ZA 3BW1A 5GAOp 5A0DA 3A8LB 5FU7C 4M78G 4CI0C 1UGRB 3CC4A 1NPRA 3CXCA 1GXIE 3G71A 2WSEE 4M7AE 3P8DA 1OZ2A 3MO8A 2FHDA 4HCBA 4KUDK 4XQ3A 3QZ9B 1ZBXA 1TH7A 1RL2A 4M78E 3GNFB 3G6ET 2EQKA 3CMEA 1BKBA 3A8MB 2GF7A 2CS7A 4M77B 3QSUA 1FX7A 4BE1A 3J7AF 3JSCA 2E6NA 3CD6T 4UC4A 4FT4A 4HKEA 3OY9A 1K73C 1K8AC 2GQVA 3ZFJA 3QDRB 1K9MC 3JAME 3L2UA 4JS4A 5CQXA 3OYGA 1BI1A 5IAYA 2QXFA 3L2RA 4N0AC 5GAN5 4EDUA 3OS2A 1AHJB 3PMTA 2F5TX 3OQ5A 4A4GA 4C8QB 4EMGA 2DTIA 1S72A 3CC2A 1KQ2A 4BE0A 4PJOA 3DLLA 3A8GB 3MHXA 3FJPA 4M7DD 3JCMd 1PSEA 2MWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VV5 A;  1VIF A;  2RK2 A;  3UDC A;  2P4T A;  2GQV A;  2RH2 A;  1VIE A;  2RK1 A;  3SFM A;  3T9N A;  2OAU A; 
#chains in the Genus database with same CATH topology
 2D1X A;  1ZSZ B;  2CP2 A;  1PNJ A;  1I81 A;  1BU1 A;  4C92 F;  1WLP B;  3PE0 A;  2KBT A;  1QVF P;  5CCA A;  4D6W A;  1QVG A;  4E47 A;  2FG0 A;  3R6O A;  1B7T A;  1D3B A;  2RO0 A;  4EPC A;  4M7A G;  2MIO A;  3CC7 T;  4ZN1 A;  3GF5 A;  2RI3 A;  5GAM g;  3MEW A;  2DJZ A;  2RH2 A;  3CPF A;  4LN2 A;  4NL2 A;  2HKQ B;  1WPY A;  3QJ6 A;  3EGX A;  1YIT T;  3LWH A;  3EH1 A;  3CCE T;  1SSF A;  2RHY A;  3E1S A;  4Z88 A;  4FYW B;  3H9N A;  1VQM A;  2RD1 A;  1NYG A;  4F7U G;  2FPD A;  1PD0 A;  3OYM A;  5CKF A;  4M7D B;  4FU6 A;  2Y4X A;  4M78 F;  2LC4 A;  1YCY A;  3PVL A;  2IG0 A;  5GAO q;  4OMN A;  1ZSZ C;  3RKX A;  1Q86 R;  1G3W A;  3HTR A;  3RDV A;  3GPL A;  1QW1 A;  3EG9 A;  3MJX A;  2JW4 A;  3S3M A;  1JU5 C;  4PJL A;  1M90 U;  1MHN A;  2RK2 A;  3AT1 B;  4M7D E;  2QQ9 A;  4FSS A;  2KXC A;  3CCJ Q;  3SWN B;  3SD4 A;  1QCN A;  4DA4 A;  2NLU A;  4PKC C;  3QO3 A;  1WFW A;  3HHT B;  3VRY A;  5HK0 A;  4PFP A;  2E5K A;  1Q95 G;  4KGV B;  1TSF A;  1Y71 A;  4F7U A;  1AEY A;  3CBM A;  2AKL A;  1N9S A;  3OS0 A;  3JCM Q;  5GAO n;  2P4T A;  2LRQ A;  1E6G A;  2E3I A;  3TU4 K;  4XU2 A;  3X28 B;  2MF2 A;  2LX9 A;  2H8H A;  4HT8 A;  2R57 A;  4PJM A;  2EAY A;  1VQP A;  2EW3 A;  3G6E A;  2HBP A;  1KHI A;  2ESW A;  5FU6 C;  3CD6 A;  2MYS A;  4KT0 E;  3QZ5 B;  4M77 D;  3CCS Q;  1QVG P;  2JXB A;  4JJC A;  3KFV A;  4JDS A;  1AOJ A;  3PTA A;  1WXU A;  1YJN Q;  2K2M A;  2ZZD A;  3CCM T;  3CCL T;  2RNA A;  4HT9 A;  1Q86 C;  3V8L A;  1TU0 B;  4DQ2 A;  2J05 A;  4M7A B;  3JCM W;  2R5A A;  4C5G A;  1UE9 A;  1TS9 A;  1M27 C;  1WIE A;  2EGE A;  3ULR B;  2D6F A;  4M75 A;  3CCR Q;  1JJ2 S;  2DFU A;  1VOM A;  1UG1 A;  4FM4 B;  4MZM A;  4KRT A;  3CXC P;  1KC8 R;  3HFO A;  4A54 A;  1Q81 U;  1VQ9 T;  1YIJ T;  3CCR T;  2ZGW A;  1IRE B;  1BCO A;  1MMA A;  4RUG A;  1BK2 A;  5GJV B;  4C92 G;  3CCE Q;  2QA4 Q;  5CR2 A;  2L89 A;  1D3B B;  2QI2 A;  4LXC A;  2YLB A;  3OYK A;  2KQW A;  2XK0 A;  5FU7 B;  1R8O B;  2CKK A;  2QGG A;  3LGF A;  2RJF A;  4PJN A;  3EGD B;  4M75 E;  3GOX A;  2DO3 A;  4A53 A;  4M77 G;  2AIR B;  4JZ3 A;  3OYL A;  3M58 A;  2OTJ T;  2KXD A;  2E1H A;  4QQG A;  2ZCF B;  4TVR A;  1ZX6 A;  2A28 A;  3M9Q A;  2DTH A;  3MEV A;  1PWT A;  2I0N A;  1U06 A;  3OYY A;  4E7K A;  3I9Q A;  4CC2 A;  1HSQ A;  1C0M A;  3X20 B;  2E4H A;  2COZ A;  3OBW A;  2M51 A;  2ZPG B;  1QMC A;  3QKJ A;  1G3Y A;  2GTJ A;  5KYX A;  1KC8 C;  3HRU A;  3OYE A;  1YJW A;  3JCM V;  2R5M A;  4RTT A;  2CDT A;  2RQR A;  2RN8 A;  5C6S A;  3GP8 A;  3TVT A;  4E2F B;  2V1R A;  3OYJ A;  2KRN A;  2YRC A;  2BZ8 A;  2DTO A;  4J9E A;  4IKF A;  2FPE A;  4M77 F;  2G3R A;  3G4S A;  3UT1 A;  1JO8 A;  3CCE A;  1MGQ A;  2DXU A;  1RAF B;  1VQ7 Q;  1UGP B;  2PZ1 A;  3E9F A;  5FU6 B;  3CCL Q;  3G71 T;  2V8J A;  1YI2 A;  3H8Z A;  3V7R A;  1PRL C;  5GAM d;  2K7A A;  1VQK A;  3H0H A;  2K6D A;  1QLY A;  2FZC B;  5J39 A;  4KH0 B;  3JCM f;  3M4Y A;  1SKU B;  2RJE A;  1KHC A;  4J6W A;  4Y92 A;  2D9T A;  4B6M A;  3SFM A;  2CUB A;  2AT1 B;  2BZY A;  5L23 A;  2K5I A;  1M5Q 1;  3CC2 Q;  1S1N A;  4PLL A;  5KYU A;  4OB3 B;  2J7I A;  2RJC A;  3DLM A;  5DY9 A;  2EJG A;  3SWN C;  4M7A C;  4A4F A;  2LQK A;  1N8R C;  1Q7Y U;  1N9R A;  1UFF A;  1KIK A;  2LVM A;  4IUR A;  4OMP A;  3T9N A;  1H3H A;  2J06 A;  3CXC S;  4E7Z A;  1K73 R;  3NTK A;  2P4R A;  5GAN j;  2J6F A;  1OI1 A;  2EYY A;  1WJR A;  3JCM h;  1G3S A;  3VYG A;  2ZPB B;  4QQ6 A;  1J3T A;  3FJ5 A;  2V8K A;  2KRS A;  2V8I A;  3HKS A;  3JCM c;  2KE9 A;  1Y07 A;  3HFN A;  2ZAE A;  4X9C A;  2XDD A;  3VS6 A;  4FSX A;  4ZTF A;  1WQW A;  1E6H A;  4JS5 A;  2O9V A;  1OX8 A;  2HDA A;  4M7A A;  1JB0 E;  1R0C B;  5LJ3 e;  4JRP A;  1PD1 A;  4HXJ A;  5D6W A;  1NLO C;  1SRL A;  1MMD A;  2YRV A;  2E41 A;  2CSQ A;  3TCJ A;  4PJO F;  2HQE A;  5FWB A;  1TTH B;  1VQL T;  2HMA A;  3L1A A;  2RHX A;  1Q86 U;  4PJO C;  2DJQ A;  1RLQ C;  2OAU A;  1ZHI A;  1VQ7 A;  3G71 Q;  1D1B A;  4OMO A;  3NTI A;  3D7S B;  1X6G A;  5CIU A;  3OA6 A;  3S3N A;  5A2Q E;  5FU7 C;  4M78 G;  3CC4 A;  1UGR B;  2M0Y A;  1YIT Q;  1SEM A;  4M7A E;  3MO8 A;  4KUD K;  4XQ3 A;  1ZBX A;  4M78 E;  2W10 A;  2EQK A;  3CME A;  3A8M B;  2JS0 A;  4JJB A;  1FX7 A;  4LUE A;  3REB B;  1W1F A;  3EGD A;  2D0N A;  3OY9 A;  3QDR B;  1LVK A;  2A37 A;  1QCO A;  5GAN 5;  3OS2 A;  3PMT A;  2L3P A;  2F5T X;  4EMG A;  4BE0 A;  1WHK A;  3A8H B;  2MWP A;  3ZBD A;  5GAN 3;  1KK7 A;  4QQD A;  4C92 C;  3M0P A;  4ZGJ B;  1GFD A;  4KBM B;  1O75 A;  1S72 T;  2MK5 A;  2CYZ B;  3PFS A;  2LP5 A;  2D0Q B;  3C95 A;  4DOV A;  2X3W D;  2F1L A;  3A1P A;  2QA4 T;  4C92 A;  1M9S A;  4MZT A;  2C06 A;  1HYO A;  5KYY A;  3J80 E;  1MMG A;  1X6B A;  2JNG A;  4L59 A;  1ZUK A;  2W0Z A;  5A0G A;  1QVP A;  4J7I A;  1VQ4 T;  4RTW A;  4VUB A;  2RQU A;  3OYA A;  4HCK A;  4BY6 B;  2KYB A;  1AWX A;  4PNO A;  5KCO A;  2AHJ B;  2QEX T;  4B9W A;  2EYX A;  2OI3 A;  1WYX A;  3BDU A;  3OYN A;  2VC8 A;  4AFS C;  4O6J A;  2FB7 A;  2JT4 A;  3M0T A;  1UGV A;  3QG1 A;  2L2P A;  1VQ8 A;  4R56 A;  5LJ5 f;  1EFN A;  1BIB A;  2X35 A;  3CCS T;  4M78 B;  4J6X A;  1VIE A;  1YHQ T;  2XI9 A;  1PHT A;  4FYY B;  3QPH A;  3GNG A;  1T0H A;  4HCC A;  3JCM e;  1AZG B;  4E6R A;  1AVZ C;  1YBY A;  2VGN A;  2LT4 A;  2E12 A;  2PU9 B;  3CCU T;  3WVE B;  4F04 B;  1UHC A;  1XQH A;  3LYI A;  2SRC A;  3JRZ A;  1VQM Q;  4M7D F;  2OAW A;  1VQM T;  1K8A R;  4M75 C;  1QQJ A;  2YLC A;  2QGF B;  1VQL Q;  4AT1 B;  3SHW A;  5KYU B;  2OJ2 A;  5CO7 A;  5LJ5 e;  2DA9 A;  1BI0 A;  5LJ5 h;  3HPW A;  1FXX A;  3I5R A;  1IO6 A;  4QVZ A;  5HK3 A;  1VQL A;  2L5Q A;  4IUU A;  5CKB A;  2KGT A;  1JQQ A;  1X43 A;  2K57 A;  2QDY B;  3BFM A;  4F7U E;  1N8R U;  1VQN A;  4J7F A;  3M0Q A;  3HRT A;  2KY9 A;  2EQU A;  3CCR A;  5CKH A;  1U8R A;  3MPU B;  5IH2 A;  3EFR A;  2PVD B;  3EG1 A;  5GAN f;  1D1C A;  4C0D C;  5LJ3 d;  1WDX A;  3JB9 G;  1K9M R;  4BE2 A;  1WQ7 A;  1ZUY A;  4N4I A;  5LJ3 f;  3LWI A;  3QII A;  2NYS A;  5GAN d;  4OP0 A;  3RES A;  2YHT A;  2RI5 A;  3JV3 A;  4F7U B;  4BDZ A;  3HL8 A;  1ZA1 B;  3TRE A;  3JB9 H;  2F2X A;  3QYH B;  1WZO A;  2JTF A;  4EMK B;  1K8A U;  2E70 A;  1YWO A;  2KRM A;  3LW5 E;  4O5V A;  1JJ2 A;  1NPP A;  3LX7 A;  4QVD A;  3JCM J;  1FMK A;  1AWW A;  2K5L A;  2QG9 B;  1KD1 C;  4EMK C;  5D6X A;  2FRY A;  1I0C A;  4XTU A;  1M3C A;  4RTU A;  3QXE B;  3R6N A;  3BY7 A;  2C0T A;  3OS5 A;  5KYY B;  1OU9 A;  1V1C A;  2A36 A;  3KBG A;  2BIV A;  1VQP Q;  4PJJ A;  1WNL A;  4WF2 A;  3ZL7 C;  4QW2 A;  4E7L A;  1K0X A;  4Y28 E;  1UEC A;  2EYZ A;  2L3R A;  4MDW A;  2DL7 A;  2RQW A;  1OPK A;  3P8H A;  2PVG B;  5IXF A;  2DYB A;  4XAX B;  5LJ5 j;  4MMK A;  3FIF A;  2FZK B;  2LDM A;  4GBQ A;  1LPL A;  1X75 C;  2F69 A;  3CCM Q;  2DAQ A;  4C0D B;  2PUK B;  4OMM A;  5DLO A;  2EKH A;  1YIJ A;  2O01 E;  5FRM A;  3FB9 A;  3P8B B;  5LJ5 d;  5AT1 B;  2KI7 A;  2LJ1 A;  3CCV T;  1K76 A;  1WHM A;  2JMA A;  1LCK A;  4J9H A;  2M1H A;  1SG5 A;  2RF0 A;  2IIM A;  4FYV B;  1WXB A;  1O9S A;  4J6Y A;  3CCU Q;  1UB4 A;  3CCL A;  5GAN 7;  3MET A;  3GIB A;  1ZSG A;  1SF9 A;  5D6Y A;  1C6V X;  4XTX A;  3VS1 A;  4BI3 A;  2X51 A;  2DNU A;  1QVG S;  4PJO B;  2VGM A;  1QVF S;  1SHF A;  2ZPE B;  2P0P A;  2OTL Q;  1WA7 A;  2C0I A;  4PJO G;  2EWN A;  2BE9 B;  1HXD A;  5GMK l;  5CKD A;  1VQN T;  2ENM A;  4M78 C;  2LMJ A;  2XD0 A;  1H64 1;  3I56 Q;  1GBR A;  4PFO A;  2QQS A;  2VUB A;  4RMO A;  3U23 A;  4II1 A;  1V76 A;  4OB2 B;  2OTJ Q;  3NHN A;  2PVO B;  4OB0 B;  2K5F A;  4J9F A;  3X26 B;  4M77 E;  1WGS A;  2QK0 A;  5GAN 6;  3CME Q;  1VQ4 A;  5GAN h;  2HQX A;  1D0Y A;  2RB6 A;  2YUN A;  3M0S A;  4X9D A;  2OTL A;  3TEE A;  4BI4 A;  1RAG B;  1OYX A;  5FRN A;  4AFZ C;  3E9G A;  4RCC A;  4C8Q F;  1NYF A;  3VS7 A;  3MP6 A;  1UEB A;  2VV5 A;  1NE8 A;  2HCK A;  2P0Q A;  4RTZ A;  3CME T;  2FRW A;  4KGZ B;  3UAT A;  2ZPH B;  1RAA B;  1X69 A;  4IIM A;  1NJI C;  5C0M A;  5GAO m;  3TSW A;  4GLM A;  4DBQ A;  5LJ3 j;  2XIC A;  3L2W A;  2K79 A;  3G4S T;  1AWO A;  4PJO D;  1M1K U;  4F17 A;  1EIF A;  2DLP A;  1VQK T;  2EFI A;  1Y0M A;  2X4Y A;  4Q5W A;  1WXT A;  1VQ7 T;  3M56 A;  4N0A A;  1RI0 A;  1M90 R;  1X01 A;  1X6O A;  5GAN e;  2JOY A;  2YWW A;  2HAX A;  1FWZ A;  2KRO A;  2JUF A;  2DBK A;  5I22 A;  1GBQ A;  5KCH A;  1M3B A;  2R58 A;  1Q81 C;  4NL3 A;  3JCM X;  2O9S A;  5FLX E;  2PQW A;  2AKK A;  3J81 E;  3RKW A;  5I21 A;  1AZE A;  4DEY A;  1HK9 A;  1T3S A;  3OW2 S;  1BBZ A;  4BAC A;  2M9U A;  2DF6 A;  2VVK A;  4RG8 A;  1U1S A;  4PLI A;  2CT3 A;  4FW2 A;  5GMK i;  4Z02 A;  4A4H A;  4J8O A;  4KUI A;  1T3L A;  4LNP A;  1VQ6 Q;  5KH6 A;  2BTT A;  4C8Q A;  4N4H A;  3RKY A;  5GAO p;  5A0D A;  4CI0 C;  1NEB A;  3G71 A;  3P8D A;  2H3E B;  2GBQ A;  4AFQ C;  1NLP C;  3VS2 A;  1OQK A;  2EGA A;  2GF7 A;  2CS7 A;  4J9D A;  4BE1 A;  3J7A F;  3JSC A;  2E6N A;  3CD6 T;  2RPN A;  4FT4 A;  4CC4 B;  2GQV A;  1IHW A;  2C0O A;  4F16 A;  3JAM E;  3L2U A;  4JS4 A;  5CQX A;  3OYG A;  2CP5 A;  1BI1 A;  1NG2 A;  5IAY A;  3LH5 A;  1FMW A;  1S72 A;  2NUT A;  1KQ2 A;  3CC2 A;  4PJO A;  3MHX A;  1VYV A;  2AK5 A;  2NUP B;  3JCM d;  4FCY A;  2XMF A;  2DKG A;  3OYD A;  1D0X A;  5LJ3 h;  1YHQ Q;  1Q82 C;  1H92 A;  3VS4 A;  2L8D A;  4X1V A;  4J9G A;  2QYZ A;  4C92 D;  1Q81 R;  1D09 B;  2E6Z A;  4CRI A;  4M7D A;  2X9H A;  1YJ9 A;  5GAM f;  3N5B B;  5LJ5 g;  3LH0 A;  4LE9 A;  2HNI A;  1NEG A;  2GFU A;  2SEM A;  3E19 A;  4XU3 A;  1JEG A;  2CRE A;  1D1A A;  3QYG B;  8AT1 B;  2JMC A;  1KSW A;  3EG9 B;  3S6W A;  4WCI A;  5KE3 A;  5LL6 S;  2M0O A;  1PG5 B;  1ZSZ A;  1WHH A;  1SRM A;  3EH2 A;  3CMA Q;  2CUD A;  4J9B A;  1BB9 A;  4PFZ A;  4HA8 A;  4A4K A;  2DPP B;  2Y4Y A;  2LJ3 A;  1N8R R;  1QP3 A;  2GCX A;  2RHI A;  1TXQ A;  3TQ7 P;  4QT7 A;  3CCU A;  3H0F A;  3MEU A;  1YNZ A;  4R0K A;  2WSF E;  3SEM A;  1K0S A;  2DIQ A;  2HL3 A;  2X4W A;  1MUZ A;  4NS5 A;  4OVA A;  4BD3 A;  2CGH A;  4FL6 A;  2YXY A;  1YJW Q;  5GAM e;  2QQB A;  2LQ8 A;  1UGQ B;  2IVW A;  5EG2 A;  3OYI A;  2VWF A;  1X2Q A;  4ME7 A;  5FWC A;  3CEY A;  4E7I A;  3FRN A;  3OMC A;  1TG0 A;  4C0Z A;  3OYC A;  1UUE A;  3CCV Q;  2QQA A;  3M5A A;  4AG2 C;  1Q82 R;  5HKC A;  4EMH A;  1VQ8 Q;  3EG0 A;  2YDL A;  5I2M A;  2EJF A;  3CC2 T;  1CKB A;  1Q7Y C;  4CC7 A;  2DVJ A;  2VB6 A;  5GAN g;  1K73 U;  2MAM A;  2GNC A;  4M4Z A;  2ED0 A;  1Q82 U;  3QWY A;  1B34 A;  5HY6 A;  2GGR A;  1VQO A;  2F2W A;  2CZ6 B;  3OYH A;  4C0F A;  4RCB A;  2JN0 A;  1Y7X A;  2B8A A;  5KYW A;  3UPU A;  4C5H A;  2P0K A;  4XU0 A;  1MND A;  1QP2 A;  4JJN K;  3I55 Q;  2BKD N;  4IUV A;  3UA6 A;  5LJ3 g;  1KQS A;  2KT1 A;  2KT8 A;  5IN1 A;  5IHN A;  2DM1 A;  4MDX A;  4M78 A;  3KUF A;  4OML A;  3MCA B;  2DZC A;  4LDV A;  4IUT A;  3VS3 A;  3OMG A;  3HSB A;  1VQ4 Q;  3ASK A;  4E7H A;  2OTJ A;  1KFZ A;  4A63 B;  3OW2 P;  1GRI A;  3OB9 A;  4Z8A A;  1T0J A;  4J5Y A;  4BY6 C;  1Z9Z A;  4XK8 E;  3PNW C;  4K11 A;  3UDC A;  3H41 A;  2XKO C;  2LTO A;  4OGE A;  1RAI B;  3FLG A;  2ATC B;  2FZG B;  4Y91 A;  1AWJ A;  4BUG A;  4ORZ A;  1PSF A;  2AZV A;  3PT9 A;  1GFC A;  2LZ6 B;  5GAN 2;  1XOV A;  1B07 A;  2MPX C;  2BZX A;  3QWX X;  2IPO B;  1KQS P;  2F5K A;  2DL4 A;  2DIL A;  3G4S Q;  2A08 A;  8ATC B;  1RAH B;  1M8M A;  1XNI A;  2XHC A;  3RER A;  3SDZ A;  4DBH A;  2M16 A;  3M57 A;  4RKU E;  5L8R E;  3BE3 A;  5GAN 8;  2PUO B;  1I5L A;  3ME9 A;  5I2S A;  2HKN A;  2JJ9 A;  4E7S A;  2L3Q A;  5A0L A;  2X4J A;  1NJI R;  1YJ9 Q;  3JB9 D;  4LDW A;  4JRK A;  3MP8 A;  3G7Z A;  1VQ9 A;  3Q1J A;  2LQW A;  2AZS A;  2RA2 A;  1HJD A;  2CZ1 B;  4KUL A;  4PK4 A;  2NUP A;  4HVU A;  1G83 A;  2FPF A;  4D8D A;  3VUB A;  3RBB B;  2DVE A;  2DXT A;  3JB9 J;  3CCJ T;  2XU8 A;  3V8K A;  2VYT A;  1SSH A;  2JM9 A;  4QVC A;  3G6E Q;  1I8F A;  4M7A F;  1ZQ1 A;  1VQO Q;  2ECZ A;  5IHK A;  3OYB A;  3L2Q A;  3DKM A;  4HCZ A;  4M7D C;  4L5G A;  5CKE A;  5KYX B;  3G1J A;  4N4G A;  3CCM A;  1B34 B;  4WTO B;  1GCQ A;  1MMN A;  2FEI A;  2DD5 A;  3OS1 A;  1VQO T;  4FYX B;  2O88 A;  1P92 A;  3TSZ A;  2MMP A;  1YP5 A;  4LD6 A;  4J83 A;  5KE2 A;  1G5V A;  4ELZ C;  2V1Q A;  5KYW B;  1K1Z A;  3ZEH A;  2QEX Q;  4RTY A;  3OSV A;  4ZGE B;  2DEU A;  1N5Z A;  3I56 A;  4MZP A;  1PC0 A;  1VQK Q;  1IB8 A;  1VA7 A;  3M53 A;  1SPK A;  2DL5 A;  2KVQ G;  1ARK A;  1LNX A;  2EQI A;  2B86 A;  3C0C A;  4IUP A;  1VIF A;  5HCK A;  4XU1 A;  2JTE A;  2CZ7 B;  3KXT A;  3QJY A;  1IRX A;  3QDF A;  1NJI U;  1RAE B;  2DE0 X;  1FMV A;  4C5E A;  1RUW A;  4XTW A;  5GMK m;  2HEQ A;  3LGL A;  5DM7 R;  1YI2 T;  2O31 A;  1TWB A;  2K9G A;  2WSC E;  1UGS B;  1Y96 A;  1G3T A;  1EX4 A;  1TUD A;  3EFS A;  3VYH B;  3JB9 I;  1KD1 R;  2P84 A;  3GLX A;  4KGX B;  2KYM A;  4LDY A;  2KNB B;  2ROT A;  2VXF A;  5CQY A;  1WHG A;  2E64 A;  1AT1 B;  4HVW A;  2QQR A;  2JVV A;  2A7Y A;  2DYI A;  1D0Z A;  3CPW S;  3L42 A;  4C8Q G;  1JJ2 P;  4JLG A;  1UTI A;  1LOJ A;  2FYK A;  2XDB A;  1IXD A;  1WJQ A;  4Z89 A;  4LD9 K;  1OU8 A;  1VQ9 Q;  2VAS A;  3HRS A;  4PL6 A;  2XDP A;  1PRM C;  4V2S A;  2OTL T;  5GAO r;  4JRI A;  1WHJ A;  1F1B B;  1W2B S;  2ZPF B;  2HSP A;  3CD6 Q;  2CP7 A;  3QHS A;  4C8Q C;  3OW2 A;  1AD5 A;  1ACM B;  3CC7 A;  4M7A D;  1WJS A;  2ROL A;  1K9M U;  2YUP A;  2KSS A;  4OMQ A;  4EIK A;  1MNE A;  4BDY A;  3EHR A;  4AFU C;  2E10 A;  1QKX A;  1QKW A;  2V26 A;  4DBF A;  4ELY C;  3EGX B;  2PNI A;  3GBQ A;  5D7U A;  2LX7 A;  2LNH B;  3NMZ C;  3CXC A;  2WSE E;  1OZ2 A;  1UHF A;  2FHD A;  5FW9 A;  1TH7 A;  3G6E T;  3GNF B;  1GCQ C;  4M77 B;  2DRM A;  1UDL A;  4UC4 A;  3M0U A;  4HKE A;  1K8A C;  2CSI A;  3ZFJ A;  1K9M C;  1TOV A;  2DMO A;  1EZZ B;  2QXF A;  4N0A C;  1MV3 A;  1G8X A;  1E7O A;  2DTI A;  3CQT A;  1OX9 A;  2NWM A;  3DLL A;  3A8G B;  3FJP A;  1CKA A;  1PM3 A;  1X2K A;  4HVV A;  1U5S A;  4NOY A;  4M78 D;  1QVF A;  2J6O A;  5M9O A;  1YJW T;  4F7U F;  1UJY A;  5J26 A;  3O8V A;  4A4E A;  5IT9 E;  2RI2 A;  1NM7 A;  1M1K R;  4OGC A;  5CK9 A;  3VJP A;  3QUI A;  1CSK A;  2LT1 A;  3RMQ A;  1KQ1 A;  5GAM h;  3UWN A;  5CAI A;  2D8J A;  4M7D G;  1MV0 B;  4M75 F;  5IXB A;  3A98 A;  5IHI A;  4ZNX A;  2O4X A;  1M3A A;  1VYU A;  2DET A;  4CC3 A;  4PJO E;  2EQJ A;  2DEQ A;  2EVR A;  2LJ0 A;  3M54 A;  4ZN3 A;  2ED1 A;  2K3B A;  2HBW A;  3PVQ A;  2COW A;  1YJN T;  1OUL A;  2DXB A;  2FL7 A;  3JCM g;  2A3L A;  4IIO A;  4C8Q D;  3EG3 A;  3MEA A;  1OOT A;  1M2O A;  4BI8 B;  2RK1 A;  3LLR A;  1VQ5 T;  3CC7 Q;  2NUZ A;  1VQ5 Q;  1Y96 B;  4BB7 A;  2KEA A;  2X3X D;  2NUT B;  4DOW A;  3A8O B;  1OV3 A;  1S72 Q;  3M59 A;  3UA7 A;  4ANJ A;  3VV0 A;  2PTK A;  3EFO B;  3MP1 A;  3VS0 A;  4C0G A;  2E3H A;  5EC7 A;  1M90 C;  5GMK j;  2DBM A;  4YTL A;  1I07 A;  1R77 A;  3S3O A;  2EGC A;  4C5I A;  3I56 T;  1BI3 A;  2EQM A;  2DD4 A;  3OBY A;  1GCP A;  1TUC A;  1I4K 1;  3CC4 Q;  2DZ9 A;  2HQH A;  3CC4 T;  1OEB A;  1N27 A;  1N6A A;  3URG A;  3RNJ A;  2LNV A;  4XTV A;  3X24 B;  3CCS A;  1A0N B;  1NZ9 A;  1XTD A;  3VRZ A;  2H3J A;  1VQN Q;  3CPW P;  1DJ7 B;  3M4G A;  4JRQ A;  4GLK A;  2K3X A;  2XID A;  3THK A;  1ABQ A;  4FW1 A;  1WHL A;  1IGQ A;  3A5Z B;  2I2L A;  2RQT A;  1WX6 A;  4P5N A;  2Z0W A;  3I35 A;  4XTY A;  1B3Q A;  3E2U A;  9ATC B;  2HZY A;  3JCM b;  1Q7Y R;  3AHU A;  3DB3 A;  4EMK A;  4OMF B;  2A0F B;  5GAN 4;  1RAD B;  1SHG A;  2MCN A;  4ATO A;  4QKU A;  4MML A;  3RR6 A;  1W2B P;  2ABL A;  2YUO A;  2KAF A;  2JS2 A;  2E5Q A;  4KH1 B;  3JCM P;  2YSQ A;  1XJW B;  1YJ9 T;  5J3B A;  1IZ6 A;  1VUB A;  2CP3 A;  3PIP A;  1YJN A;  1M2V A;  2KK4 A;  4AG1 C;  3CCJ A;  4JLI A;  5GAM j;  2QDL A;  3SB2 A;  1Z9Q A;  2E65 A;  2MWO A;  2O2O A;  2RHU A;  2VKN A;  4M75 D;  2EYW A;  5DLQ E;  1YI2 Q;  2K3Y A;  4RTV A;  2OX7 A;  3EGU A;  4RTX A;  3VU3 C;  1JBM A;  1U1T A;  4AMC A;  4RG2 A;  2GTO A;  2EBP A;  2DX1 A;  1VQ8 T;  1QWE A;  3HP9 A;  3CMA A;  1KQS S;  3UF4 A;  1V29 B;  2MOX A;  1I1J A;  2LCS A;  1YWP A;  3EHQ A;  2FO0 A;  2GQI A;  3PIO A;  2BE7 D;  1RAB B;  2LCL A;  4M77 A;  2QTX A;  5AYF A;  4JUV A;  1YIJ Q;  4LDX A;  1YN8 A;  1BI2 A;  1PCX A;  2K2V A;  2CT4 A;  1M1G A;  2EIF A;  1VQ6 T;  4LDU A;  1OZ3 A;  3WXM B;  1NBE B;  2EJ9 A;  3H6Z A;  3FC3 A;  2KR3 A;  4X34 A;  1TUG B;  1W70 A;  2COY A;  4M75 G;  2QEX A;  1UJ0 A;  3EFO A;  1W6X A;  2DL3 A;  4B9X A;  3RUX A;  3VUZ A;  1I5O B;  4ZGD B;  1YCS B;  5I11 A;  2HD0 A;  3NGP A;  3CMA T;  4IUQ A;  1K9A A;  2MI6 A;  3JB9 F;  3ER0 A;  1RAC B;  1VYT A;  2M02 A;  1BYM A;  3RMS A;  2QAS A;  4ZTJ A;  3OYF A;  2O4X B;  1K4U S;  3PGG A;  1HD3 A;  4R55 A;  2KMT A;  4D8K A;  3FDR A;  1C1A A;  3SWN A;  3VS5 A;  5ECA A;  2BUD A;  1KJW A;  1FYN A;  1M1F A;  2X4X A;  2EYQ A;  3RIR A;  1PKT A;  1ABO A;  4C8Q E;  2JZ2 A;  3I5S A;  5KYN A;  3CCQ T;  1G2B A;  2VXE A;  3V8J A;  1WI7 A;  2K4Y A;  3L2Z A;  1RLP C;  4M77 C;  2F2V A;  2GFA A;  3EG2 A;  6AT1 B;  1M30 A;  1KG1 A;  1JXO A;  3C12 A;  1KC8 U;  1JRI A;  2HL5 C;  4JZ4 A;  1X27 A;  3EAE A;  3V7S A;  2RHZ A;  5FRO A;  2EPD A;  3VKI A;  3NTH A;  1YFN A;  1M2V B;  1M8V A;  1VQ6 A;  1IHV A;  1OPL A;  2QAZ A;  2RM4 A;  3L2V A;  1QCF A;  2DXC A;  3DB4 A;  2QTV A;  1RI9 A;  3MKD A;  3NPF A;  2JTM A;  3QBY A;  5GJW B;  2EKO A;  1H8K A;  4FT2 A;  4XTZ A;  3BDL A;  4J9C A;  2ZPI B;  2FVU A;  1ZLM A;  2XG8 D;  2YUQ A;  1IGU A;  4GY5 A;  4FIB A;  4J9I A;  3NFC A;  3X25 B;  2DIG A;  3WVD B;  4JJD A;  4L6V 5;  2WAC A;  3OSS C;  4DEX A;  3C94 A;  4JPB W;  5GMK e;  4C92 E;  5GMK h;  4M75 B;  2G6F X;  1YHQ A;  4F14 A;  2CZ0 B;  1KD1 U;  2LCC A;  1BCM A;  2RMO A;  4DBR A;  2CH4 A;  2YT6 A;  3CCV A;  2JM8 A;  2DRK A;  3INZ A;  2RQV A;  5GAO l;  3I55 T;  3PMI A;  7AT1 B;  3CBP A;  2CP6 A;  3C4S A;  1W4S A;  4OB1 B;  4ESR A;  3I55 A;  1W2B A;  1M1K C;  1VQP T;  5CVI A;  2J6K A;  3CBO A;  3IQL A;  2RJD A;  1PKS A;  1VQ5 A;  2Y90 A;  2DL8 A;  3M55 A;  1H3Z A;  2KDS A;  1ZA2 B;  2DK3 A;  4C92 B;  3CCQ A;  3CPW A;  2L0A A;  3FEO A;  1LJO A;  1YIT A;  3F70 A;  2LQN A;  1ZUU A;  2HSE B;  3M0R A;  2YRD A;  4E7J A;  1BIA A;  2CP0 A;  3V7C A;  4OF1 A;  2QA4 A;  1M4Z A;  3BW1 A;  3A8L B;  2L3S A;  1NPR A;  1GXI E;  3H0I A;  3REA B;  3CCQ Q;  1R0B G;  4HCB A;  3QZ9 B;  2DER A;  1RL2 A;  1BKB A;  4LUD A;  3QSU A;  1Y57 A;  1ZBJ A;  2CH4 W;  1U3O A;  3O5Z A;  1K73 C;  3L2R A;  4EDU A;  1AHJ B;  4A4G A;  3OQ5 A;  4C8Q B;  1GL5 A;  1JXM A;  4M7D D;  1PSE A;  1QWF A;  2D8H A; 
#chains in the Genus database with same CATH homology
 4NOY A;  3ZBD A;  5GAN 3;  2DKG A;  4M78 D;  3OYD A;  1QVF A;  5LJ3 h;  5M9O A;  1YJW T;  4QQD A;  4C92 C;  4F7U F;  1Q82 C;  2L8D A;  1I81 A;  4ZGJ B;  4KBM B;  4C92 F;  5J26 A;  1O75 A;  3O8V A;  4C92 D;  4A4E A;  5CCA A;  4D6W A;  1S72 T;  1QVG A;  4E47 A;  5IT9 E;  2RI2 A;  2E6Z A;  3R6O A;  4CRI A;  2CYZ B;  1YJ9 A;  5GAM f;  4M7D A;  1D3B A;  2RO0 A;  3N5B B;  3PFS A;  4OGC A;  4EPC A;  4M7A G;  5CK9 A;  5LJ5 g;  3LH0 A;  3CC7 T;  3C95 A;  2D0Q B;  4DOV A;  4ZN1 A;  3GF5 A;  2HNI A;  2RI3 A;  3VJP A;  5GAM g;  2GFU A;  3QUI A;  3MEW A;  3E19 A;  2DJZ A;  2LT1 A;  4XU3 A;  2QA4 T;  2RH2 A;  3CPF A;  4NL2 A;  4C92 A;  3RMQ A;  1M9S A;  1KQ1 A;  3QYG B;  4MZT A;  2C06 A;  1WPY A;  3UWN A;  5GAM h;  5CAI A;  3S6W A;  3J80 E;  5KE3 A;  2JNG A;  5LL6 S;  4M7D G;  3QJ6 A;  2M0O A;  1YIT T;  4M75 F;  4L59 A;  3LWH A;  3CCE T;  1SSF A;  2O4X A;  2RHY A;  3E1S A;  5A0G A;  1QVP A;  4J7I A;  1VQ4 T;  4VUB A;  4HA8 A;  4PJO E;  1VQM A;  2RD1 A;  4F7U G;  2EQJ A;  2DEQ A;  2DPP B;  4A4K A;  3OYA A;  3M54 A;  4ZN3 A;  5CKF A;  3OYM A;  2Y4Y A;  4BY6 B;  4M7D B;  4PNO A;  4FU6 A;  5KCO A;  2AHJ B;  2Y4X A;  4M78 F;  2LC4 A;  4B9W A;  2QEX T;  1YCY A;  2IG0 A;  1QP3 A;  2GCX A;  2RHI A;  3BDU A;  5GAO q;  3OYN A;  1YJN T;  2VC8 A;  2DXB A;  4O6J A;  2FL7 A;  3JCM g;  2A3L A;  2FB7 A;  3RKX A;  4C8Q D;  1G3W A;  3QG1 A;  3CCU A;  3MEA A;  3MEU A;  1VQ8 A;  4BI8 B;  4R56 A;  5LJ5 f;  2RK1 A;  1BIB A;  2WSF E;  3LLR A;  3GPL A;  1QW1 A;  1VQ5 T;  2X35 A;  2DIQ A;  3S3M A;  1M90 U;  3CCS T;  4M78 B;  1MHN A;  2RK2 A;  1Y96 B;  4BB7 A;  2QQ9 A;  2X4W A;  4NS5 A;  4J6X A;  4OVA A;  2CGH A;  4BD3 A;  3A8H B;  4FL6 A;  1VIE A;  1YHQ T;  2XI9 A;  2QQB A;  4DOW A;  2LQ8 A;  1UGQ B;  3A8O B;  3QPH A;  3M59 A;  5GAM e;  2IVW A;  3SWN B;  3VV0 A;  5EG2 A;  3OYI A;  3GNG A;  3MP1 A;  3SD4 A;  4HCC A;  4DA4 A;  4ME7 A;  4C0G A;  3JCM e;  2NLU A;  1M90 C;  3CEY A;  5GMK j;  4PKC C;  4E7I A;  3FRN A;  3OMC A;  1YBY A;  3QO3 A;  4YTL A;  4C0Z A;  3OYC A;  2VGN A;  2QQA A;  3M5A A;  3HHT B;  2LT4 A;  5HK0 A;  4EMH A;  5HKC A;  3S3O A;  1Y71 A;  4F7U A;  2E12 A;  2PU9 B;  3CBM A;  3CCU T;  4C5I A;  3I56 T;  1BI3 A;  1N9S A;  5I2M A;  3OS0 A;  3JCM Q;  5GAO n;  2EJF A;  2DD4 A;  2EQM A;  2P4T A;  3OBY A;  3WVE B;  3CC2 T;  1I4K 1;  1Q7Y C;  2DZ9 A;  2LRQ A;  3CC4 T;  1N27 A;  1N6A A;  3URG A;  2LNV A;  1XQH A;  3LYI A;  4XTV A;  3X24 B;  3CCS A;  3TU4 K;  4XU2 A;  3X28 B;  3JRZ A;  2MF2 A;  5GAN g;  1NZ9 A;  1XTD A;  2LX9 A;  1K73 U;  4M7D F;  2MAM A;  1VQM T;  2H3J A;  1Q82 U;  4HT8 A;  2R57 A;  1B34 A;  4M75 C;  2YLC A;  5HY6 A;  2EAY A;  1VQO A;  3OYH A;  2CZ6 B;  1VQP A;  1M1K C;  4C0F A;  1DJ7 B;  3M4G A;  4RCB A;  5CO7 A;  3G6E A;  4JRQ A;  5LJ5 e;  1BI0 A;  4GLK A;  2JN0 A;  1Y7X A;  5LJ5 h;  3HPW A;  1FXX A;  2K3X A;  2XID A;  4QVZ A;  5HK3 A;  1VQL A;  2L5Q A;  4IUU A;  5CKB A;  2HBP A;  1KHI A;  2B8A A;  3A5Z B;  2I2L A;  2K57 A;  2QDY B;  3BFM A;  5FU6 C;  4F7U E;  3UPU A;  1N8R U;  4P5N A;  4J7F A;  1VQN A;  4C5H A;  2P0K A;  4XU0 A;  3HRT A;  3CD6 A;  1QP2 A;  4XTY A;  4JJN K;  4KT0 E;  2KY9 A;  3QZ5 B;  4M77 D;  2EQU A;  2BKD N;  4JDS A;  4IUV A;  5LJ3 g;  1KQS A;  3PTA A;  3CCR A;  2ZZD A;  5CKH A;  3JCM b;  3CCM T;  1U8R A;  5IN1 A;  3CCL T;  3AHU A;  3DB3 A;  4EMK A;  4OMF B;  4HT9 A;  5GAN 4;  3V8L A;  1Q86 C;  4MDX A;  4M78 A;  3KUF A;  4DQ2 A;  3MCA B;  2DZC A;  3EFR A;  4M7A B;  4LDV A;  2PVD B;  4IUT A;  2R5A A;  3OMG A;  4C5G A;  3JCM W;  3HSB A;  4ATO A;  4MML A;  5GAN f;  4C0D C;  3ASK A;  2KAF A;  4E7H A;  5LJ3 d;  2E5Q A;  3JB9 G;  3JCM P;  4BE2 A;  2OTJ A;  1YJ9 T;  5J3B A;  1WQ7 A;  1IZ6 A;  1VUB A;  3LWI A;  4N4I A;  5LJ3 f;  2D6F A;  3QII A;  3OB9 A;  4M75 A;  3PIP A;  1YJN A;  1JJ2 S;  5GAN d;  4OP0 A;  2KK4 A;  3RES A;  4FM4 B;  4MZM A;  3CCJ A;  2YHT A;  2RI5 A;  4JLI A;  5GAM j;  4J5Y A;  4BY6 C;  4BDZ A;  4F7U B;  4XK8 E;  3SB2 A;  3PNW C;  3HL8 A;  3UDC A;  2E65 A;  2MWO A;  2XKO C;  2LTO A;  3TRE A;  3JB9 H;  3QYH B;  3HFO A;  2JTF A;  4A54 A;  4OGE A;  2RHU A;  4EMK B;  3FLG A;  4M75 D;  2E70 A;  1Q81 U;  4Y91 A;  1K8A U;  1VQ9 T;  3LW5 E;  4O5V A;  5DLQ E;  1NPP A;  3LX7 A;  4BUG A;  1JJ2 A;  4QVD A;  1YIJ T;  1PSF A;  3JCM J;  3PT9 A;  2K3Y A;  3CCR T;  2ZGW A;  5GAN 2;  1IRE B;  1XOV A;  2K5L A;  3VU3 C;  1KD1 C;  4C92 G;  1JBM A;  4EMK C;  5D6X A;  1U1T A;  2F5K A;  5CR2 A;  4RG2 A;  2L89 A;  1D3B B;  2QI2 A;  2YLB A;  3OYK A;  2KQW A;  2XK0 A;  5FU7 B;  1R8O B;  1XNI A;  2XHC A;  4XTU A;  2CKK A;  1VQ8 T;  3SDZ A;  3HP9 A;  3LGF A;  2M16 A;  2RJF A;  3QXE B;  3CMA A;  3BY7 A;  3M57 A;  4RKU E;  4M75 E;  5L8R E;  1KQS S;  3GOX A;  2DO3 A;  3OS5 A;  4M77 G;  4A53 A;  5GAN 8;  1V29 B;  3OYL A;  3M58 A;  3KBG A;  2OTJ T;  2PUO B;  2BIV A;  1I5L A;  3ME9 A;  5I2S A;  2E1H A;  4QQG A;  1WNL A;  2ZCF B;  4WF2 A;  3PIO A;  4TVR A;  5A0L A;  4QW2 A;  4E7L A;  3M9Q A;  2DTH A;  3MEV A;  2X4J A;  2LCL A;  4M77 A;  4Y28 E;  2QTX A;  3OYY A;  2L3R A;  4MDW A;  5AYF A;  4JUV A;  4E7K A;  4LDX A;  3JB9 D;  4LDW A;  4JRK A;  3MP8 A;  3G7Z A;  3X20 B;  1VQ9 A;  3P8H A;  1BI2 A;  2K2V A;  3Q1J A;  2PVG B;  1M1G A;  2EIF A;  4XAX B;  5LJ5 j;  1VQ6 T;  4LDU A;  4MMK A;  3FIF A;  2RA2 A;  1OZ3 A;  2LDM A;  3WXM B;  1X75 C;  2CZ1 B;  3OBW A;  2F69 A;  4KUL A;  2DAQ A;  4C0D B;  2PUK B;  5DLO A;  2EJ9 A;  2ZPG B;  3H6Z A;  3FC3 A;  1YIJ A;  4X34 A;  2O01 E;  5FRM A;  3FB9 A;  3P8B B;  3QKJ A;  4M75 G;  5LJ5 d;  1G3Y A;  3CCV T;  2QEX A;  1KC8 C;  4B9X A;  3HRU A;  3RUX A;  3VUB A;  3VUZ A;  3OYE A;  1YJW A;  2DVE A;  3JCM V;  4ZGD B;  2R5M A;  2DXT A;  3JB9 J;  2M1H A;  3CCJ T;  5C6S A;  3GP8 A;  2XU8 A;  3V8K A;  1O9S A;  2VYT A;  4J6Y A;  4QVC A;  2HD0 A;  1UB4 A;  1I8F A;  3CCL A;  3RER A;  4M7A F;  5GAN 7;  1ZQ1 A;  3MET A;  3CMA T;  4IUQ A;  2MI6 A;  3OYJ A;  3GIB A;  3JB9 F;  5D6Y A;  3ER0 A;  2DTO A;  4XTX A;  3OYB A;  4IKF A;  4M77 F;  2G3R A;  1BYM A;  3L2Q A;  3G4S A;  4BI3 A;  3RMS A;  3UT1 A;  3DKM A;  4ZTJ A;  4M7D E;  4HCZ A;  4M7D C;  3CCE A;  4L5G A;  5CKE A;  2VGM A;  1QVG S;  1QVF S;  4PJO B;  1MGQ A;  2O4X B;  2P0P A;  2ZPE B;  3OYF A;  2DXU A;  3PGG A;  4N4G A;  4R55 A;  2KMT A;  3CCM A;  1B34 B;  1UGP B;  4PJO G;  3E9F A;  5FU6 B;  3FDR A;  2EWN A;  3G71 T;  2V8J A;  1YI2 A;  2DD5 A;  3OS1 A;  3H8Z A;  3V7R A;  1VQO T;  1HXD A;  3SWN A;  5GMK l;  5CKD A;  5GAM d;  2BUD A;  1VQN T;  1M1F A;  1P92 A;  2X4X A;  2EYQ A;  4M78 C;  1VQK A;  2MMP A;  4LD6 A;  4J83 A;  2XD0 A;  1H64 1;  5KE2 A;  3RIR A;  4C8Q E;  1G5V A;  4ELZ C;  2JZ2 A;  3ZEH A;  2QQS A;  2VUB A;  4RMO A;  3CCQ T;  5J39 A;  2VXE A;  3OSV A;  3V8J A;  2K4Y A;  3L2Z A;  3JCM f;  4II1 A;  4ZGE B;  3I56 A;  4M77 C;  4OB2 B;  2PVO B;  3M4Y A;  4MZP A;  2K5F A;  4OB0 B;  3X26 B;  4M77 E;  1WGS A;  2RJE A;  1KHC A;  4J6W A;  2GFA A;  5GAN 6;  1VQ4 A;  2D9T A;  3M53 A;  5GAN h;  2HQX A;  2KVQ G;  1KG1 A;  3C12 A;  3SFM A;  1KC8 U;  1LNX A;  1JRI A;  2RB6 A;  4X9D A;  4IUP A;  3EAE A;  1VIF A;  3V7S A;  2OTL A;  4XU1 A;  2CZ7 B;  3KXT A;  2K5I A;  1M5Q 1;  3QJY A;  2RHZ A;  3TEE A;  4BI4 A;  1OYX A;  5FRO A;  1NJI U;  4PLL A;  5FRN A;  3VKI A;  3NTH A;  3E9G A;  4RCC A;  4C5E A;  4OB3 B;  4C8Q F;  1M8V A;  2RJC A;  3DLM A;  1VQ6 A;  5DY9 A;  2EJG A;  3MP6 A;  4XTW A;  1UEB A;  2VV5 A;  1NE8 A;  5GMK m;  3LGL A;  2P0Q A;  3SWN C;  5DM7 R;  1YI2 T;  2RM4 A;  3CME T;  4A4F A;  3L2V A;  4M7A C;  2DXC A;  2LQK A;  3DB4 A;  2ZPH B;  1N8R C;  1Q7Y U;  1NJI C;  1N9R A;  5C0M A;  5GAO m;  1W2B A;  2JTM A;  3QBY A;  5LJ3 j;  2EKO A;  2WSC E;  2XIC A;  3L2W A;  2LVM A;  1UGS B;  4FT2 A;  4IUR A;  1Y96 A;  3T9N A;  4XTZ A;  1G3T A;  3BDL A;  3VYH B;  3EFS A;  3G4S T;  2ZPI B;  3JB9 I;  2FVU A;  3GLX A;  4PJO D;  1M1K U;  2XG8 D;  3CXC S;  4LDY A;  1EIF A;  3NTK A;  1VQK T;  2EFI A;  2VXF A;  4GY5 A;  5CQY A;  2X4Y A;  5GAN j;  4FIB A;  3NFC A;  1OI1 A;  4Q5W A;  3X25 B;  2DIG A;  2E64 A;  1VQ7 T;  1WJR A;  1G3S A;  3M56 A;  3JCM h;  4N0A A;  3VYG A;  2QQR A;  2JVV A;  4L6V 5;  3WVD B;  1RI0 A;  2ZPB B;  2WAC A;  3OSS C;  4QQ6 A;  2V8K A;  3HKS A;  2V8I A;  3C94 A;  3JCM c;  1X01 A;  2A7Y A;  5GMK e;  4C92 E;  3CPW S;  3L42 A;  5GMK h;  1X6O A;  4M75 B;  4C8Q G;  5GAN e;  4JLG A;  1YHQ A;  1Y07 A;  2CZ0 B;  2JOY A;  1LOJ A;  2FYK A;  3HFN A;  2LCC A;  4X9C A;  1KD1 U;  1FWZ A;  2HAX A;  2XDD A;  2XDB A;  4FSX A;  4ZTF A;  1WJQ A;  4LD9 K;  3CCV A;  1WQW A;  2JUF A;  3HRS A;  3INZ A;  5GAO l;  3I55 T;  4JS5 A;  5KCH A;  2R58 A;  4PL6 A;  4M7A A;  1Q81 C;  2XDP A;  1JB0 E;  3PMI A;  4NL3 A;  5LJ3 e;  3JCM X;  4JRP A;  2OTL T;  4V2S A;  5D6W A;  5GAO r;  3CBP A;  3C4S A;  4JRI A;  1W4S A;  4OB1 B;  2YRV A;  3I55 A;  5FLX E;  2PQW A;  2ZPF B;  1W2B S;  2E41 A;  3J81 E;  1VQP T;  3RKW A;  5CVI A;  5I21 A;  3CBO A;  3QHS A;  4C8Q C;  1HK9 A;  3OW2 A;  3OW2 S;  3TCJ A;  4PJO F;  2HQE A;  2RJD A;  4BAC A;  2M9U A;  1VQ5 A;  3CC7 A;  2Y90 A;  1VQL T;  4M7A D;  1WJS A;  3L1A A;  2RHX A;  3M55 A;  1K9M U;  1H3Z A;  2KDS A;  4RG8 A;  1Q86 U;  1U1S A;  4PJO C;  4PLI A;  2KSS A;  2DK3 A;  2OAU A;  4C92 B;  1ZHI A;  3CPW A;  3CCQ A;  4BDY A;  3FEO A;  2E10 A;  1LJO A;  5GMK i;  1YIT A;  3F70 A;  1VQ7 A;  3NTI A;  4Z02 A;  4A4H A;  4ELY C;  4J8O A;  4KUI A;  5CIU A;  5KH6 A;  3OA6 A;  3S3N A;  4C8Q A;  4N4H A;  1BIA A;  4E7J A;  3V7C A;  4OF1 A;  5A2Q E;  3RKY A;  2QA4 A;  1M4Z A;  3BW1 A;  5GAO p;  5A0D A;  3A8L B;  5FU7 C;  4M78 G;  4CI0 C;  1UGR B;  3CC4 A;  1NPR A;  3CXC A;  1GXI E;  3G71 A;  2WSE E;  4M7A E;  3P8D A;  1OZ2 A;  3MO8 A;  2FHD A;  4HCB A;  4KUD K;  4XQ3 A;  3QZ9 B;  1ZBX A;  1TH7 A;  1RL2 A;  4M78 E;  3GNF B;  3G6E T;  2EQK A;  3CME A;  1BKB A;  3A8M B;  2GF7 A;  2CS7 A;  4M77 B;  3QSU A;  1FX7 A;  4BE1 A;  3J7A F;  3JSC A;  2E6N A;  3CD6 T;  4UC4 A;  4FT4 A;  4HKE A;  3OY9 A;  1K73 C;  1K8A C;  2GQV A;  3ZFJ A;  3QDR B;  1K9M C;  3JAM E;  3L2U A;  4JS4 A;  5CQX A;  3OYG A;  1BI1 A;  5IAY A;  2QXF A;  3L2R A;  4N0A C;  5GAN 5;  4EDU A;  3OS2 A;  1AHJ B;  3PMT A;  2F5T X;  3OQ5 A;  4A4G A;  4C8Q B;  4EMG A;  2DTI A;  1S72 A;  3CC2 A;  1KQ2 A;  4BE0 A;  4PJO A;  3DLL A;  3A8G B;  3MHX A;  3FJP A;  4M7D D;  3JCM d;  1PSE A;  2MWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...