2RK2A

Dhfr r-67 complexed with nadp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
b'NATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrofolate reductase type 2
molecule tags Oxidoreductase
publication title Crystal structure of a type II dihydrofolate reductase catalytic ternary complex.
pubmed doi rcsb
total genus 12
structure length 58
sequence length 58
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2007-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rk2A00
1VIEA 3T9NA 2RH2A 2RK2A 3SFMA 3UDCA 2OAUA 2P4TA 2RK1A 1VIFA 2VV5A 2GQVA
chains in the Genus database with same CATH superfamily
2AKLA 2XK0A 1VQOT 4CRIA 4IKFA 4PJOD 2XU8A 1UFFA 1OYXA 2EQUA 2ZZDA 4CC4B 4ZTFA 5DLQE 1M4ZA 3OBWA 3GNGA 1GBQA 2GTOA 1G2BA 1N8RR 2V8KA 3G7ZA 3CXCA 1SHGA 1M5Q1 1WQ7A 4M7AG 4VUBA 3S3NA 4BE0A 2LTOA 1FYNA 1S1NA 5EG2A 4Z88A 5HK3A 1XTDA 2AIRB 2XICA 3OYYA 3R6OA 4B9XA 2AT1B 4B9WA 2QDLA 1VYTA 4J9IA 3CCSQ 1I4K1 3G4ST 4HCCA 4L59A 4E2FB 2RMOA 2DEQA 2DYIA 2YUNA 1XNIA 4FM4B 1YBYA 2RHYA 2KYMA 4PK4A 2MCNA 1KC8C 1X01A 5GANf 2CP6A 4J9EA 2E1HA 1WHMA 5A0LA 1U06A 2E6NA 4C5IA 1QVGS 4Q5WA 1E7OA 4L5GA 5GMKj 3RKWA 4K11A 3VS0A 3PMTA 5LJ3h 3VRZA 4PJOF 5GAMf 1KC8R 1Y96A 4PFPA 3ASKA 5FRNA 2D0NA 3SEMA 2LMJA 2JXBA 2ROLA 4M7AD 3H9NA 3OSSC 3CEYA 1YJNQ 4HVWA 3CMET 3X24B 4XU2A 3E19A 5DLOA 1G3SA 1Y7XA 3OYMA 4HXJA 2MF2A 1OX9A 4JDSA 2RHXA 5D6XA 4BY6B 2E64A 2E6ZA 4A4HA 2O2OA 1VQLQ 1OEBA 1EIFA 1IGUA 1QCOA 4HT8A 5D7UA 2E10A 4M7DA 2P0PA 1CKAA 2CS7A 4PLIA 2E3HA 2E5QA 3JB9I 4XTWA 3CMAT 5GANj 2JMCA 2B86A 2EGAA 2DIGA 1VQKQ 2FZGB 1PCXA 1NEGA 3A98A 2C0TA 3MP8A 1VQ7A 1PG5B 2FZCB 4C92D 1NJIU 4YTLA 2K5LA 4OMFB 2OTLQ 1KQ1A 2HNIA 2L0AA 3QG1A 1KK7A 2A0FB 4XK8E 2RK1A 2QQBA 1K73R 2WSFE 1AHJB 2E65A 3HTRA 1VQOA 1VQ7Q 2E4HA 1KD1C 2NUTB 1OU9A 3A8MB 2DTIA 2L89A 4A54A 3BDUA 3CCEQ 2A7YA 3ME9A 2NUZA 3M0PA 2EQMA 3JCMh 5CVIA 1NE8A 1E6GA 2QK0A 1J3TA 4HCKA 3KUFA 1RABB 4KT0E 1B7TA 1K73U 3OY9A 4KH0B 4GLMA 3EG1A 3CCLT 3OW2S 2LQKA 1VQ6A 1UDLA 3QHSA 2O01E 1GFCA 2DMOA 1QQJA 3CXCS 1AWXA 1MHNA 2L3PA 2PU9B 4E7KA 4OB1B 3DLMA 4ZGJB 3G4SA 1QCFA 3QJ6A 3NHNA 1ZX6A 1TXQA 3A8LB 4J9HA 3C95A 2QQRA 5CKEA 4A4EA 4C8QE 2KI7A 3LH5A 3RESA 2QG9B 4EMGA 5FROA 5KYUB 4OMNA 2D0QB 4AMCA 3LWHA 3CCJQ 3O8VA 4EPCA 2RF0A 1PKTA 1VQ4Q 1VQPA 1ABOA 1AZGB 3FIFA 1TSFA 4TVRA 2OTLA 1OPKA 4II1A 1GBRA 1G3WA 5HCKA 5I2MA 2ZCFB 4PJMA 1BK2A 2E3IA 2DXTA 3CPWP 4BI3A 3LLRA 3E1SA 2CYZB 3OYIA 3ZEHA 3EG9B 1ACMB 3LW5E 3SFMA 3META 2BUDA 4IUTA 2DERA 3CD6T 2M51A 1VQ8T 1VQ9Q 2HBWA 1QVPA 3REBB 1B3QA 2VKNA 2YWWA 3J81E 2PZ1A 1X43A 1M1KC 4N4IA 5FU7B 3CCET 1Y07A 4FYVB 4OF1A 1C1AA 1MMNA 1ZSZC 2EYYA 2KXDA 3VS7A 1K73C 1Y57A 4M78E 2MWOA 1ZUYA 3HP9A 3OYCA 3SDZA 4IUQA 3G6ET 1K9MC 5C0MA 4KUIA 1WQWA 1WHKA 2ZPHB 2IIMA 1K0SA 1HJDA 2A28A 4ZN3A 2KXCA 2NWMA 5DM7R 3RERA 4OMPA 2EGCA 4DBRA 1RI0A 4F7UE 5LL6S 1SEMA 1XQHA 4JZ3A 1K9MU 4J6XA 1M2VB 4NS5A 3I55Q 1D3BB 2X4YA 5J26A 1RAGB 2LQWA 3VV0A 1UUEA 5I22A 3EFOB 2CUDA 4M7DE 4IUVA 3L2RA 2ROTA 2MI6A 2RQTA 2GBQA 2K2VA 4ELZC 2KY9A 2LX7A 1VQ8A 4J83A 4RCBA 3JCMc 3CMAA 3OA6A 3L2QA 3LWIA 3OS0A 4ZN1A 1HK9A 2RB6A 1YJWQ 3M4YA 2OTJT 3UA7A 3I56T 5KCOA 1OOTA 1KQ2A 2BE9B 3CD6Q 1K9MR 1IRXA 3CCUA 1JRIA 1M90R 1H641 4R55A 2MMPA 1MGQA 3ZBDA 1A0NB 1SKUB 2HL5C 4E7JA 2E5KA 1EX4A 1W4SA 1VQ8Q 1QMCA 3GOXA 1QCNA 2VWFA 4XAXB 1AVZC 1ZSZA 4OGCA 2ZPFB 1PNJA 4PL6A 4Z02A 2COZA 5J3BA 3EAEA 1GCQA 1WLPB 3JV3A 1N9RA 3M0RA 1Z9QA 3TU4K 1WPYA 3V8JA 4EDUA 4F17A 1K1ZA 4FW1A 4RCCA 3PMIA 3Q1JA 2QXFA 3QYHB 4BD3A 2XIDA 3CC2Q 1M1FA 3QJYA 1M90U 5KYXA 3MPUB 2XDDA 3FDRA 2D8HA 1N8RC 1BKBA 5FWBA 1NEBA 5FLXE 1I5LA 2CSQA 4HKEA 5KYUA 3JCMQ 2VASA 2MYSA 4Y91A 5GAMd 3L2ZA 1AWWA 3M59A 3NGPA 2P0QA 4J9BA 1ZUKA 1WA7A 1VQ6Q 3HFNA 1B34B 3HL8A 1PD1A 1QP3A 3HRUA 1XOVA 5D6YA 1JQQA 2XDPA 2M9UA 3EGXA 5GANg 2KDSA 2HL3A 5GANd 2KRNA 4J5YA 3BE3A 2OTLT 4DOVA 4M7AC 3BY7A 2YT6A 2SEMA 3PGGA 1K8AC 2KNBB 3FC3A 1YI2Q 1N9SA 5AT1B 2HSPA 1I1JA 4C5EA 4IIMA 2LVMA 3X25B 4O6JA 3GPLA 2FO0A 2CP0A 2AHJB 2CH4W 1VYUA 2DVJA 1WJRA 1ABQA 2K79A 3RDVA 4LDXA 3C12A 1JJ2P 4KGXB 2RI2A 4E7IA 1Y71A 4Z89A 3CCLQ 1UJ0A 1SSHA 2K3BA 2LQ8A 2OAUA 3URGA 4QVCA 1D0XA 5GMKl 2LRQA 3TVTA 2FB7A 5IN1A 5GAN2 3EG9A 2OX7A 3OYHA 4A4GA 1GXIE 1RLPC 3FEOA 2BZXA 3P8HA 1WZOA 3OQ5A 4JS5A 1VQMT 2XD0A 5CO7A 5KH6A 3CCUT 2JOYA 3C94A 4E7LA 4XU1A 1QVGP 2JM9A 5LJ3f 4BDYA 1NLOC 3DLLA 1YN8A 1PKSA 4OMLA 1G3YA 2I0NA 4KBMB 4RTXA 4DOWA 1U8RA 1QLYA 1U3OA 4J9CA 4RKUE 3MP1A 3O5ZA 4FU6A 1X2KA 3QDRB 3MP6A 4PNOA 2QA4Q 5KYWA 2RQWA 4JJCA 3X28B 1TG0A 1SPKA 3PVLA 3VJPA 4R56A 2DXCA 1HD3A 3HPWA 3VKIA 4PJNA 2C0OA 2ZPBB 2LC4A 5GANe 4L6V5 1Q81C 3KFVA 3M57A 1FMVA 3CC4Q 1IGQA 3VUBA 1KD1U 2KR3A 2F69A 4IUPA 2IG0A 5GAMe 2JS0A 3VS1A 1BBZA 2DIQA 2V1RA 1IZ6A 5FU6B 4QQ6A 3CCSA 2DO3A 3FJ5A 2QDYB 3UWNA 3TREA 1YITQ 3V8KA 2DD5A 2EYWA 1VQMA 1UE9A 2QEXA 1BU1A 2DEUA 8AT1B 4ATOA 1OZ2A 3TCJA 2GF7A 2RD1A 1MUZA 3WXMB 3VS3A 1D1BA 2CT3A 1PWTA 3GLXA 4M7DF 1VQ4T 1AWOA 1D1AA 3CCRA 5I11A 1X2QA 3JB9D 2FZKB 5GAOr 1ZSZB 4DEYA 4EMKB 4J7IA 2DL8A 3EGDB 2QQSA 4M78C 4QW2A 2GQVA 3RBBB 3S3MA 2RJFA 1D0ZA 4X9DA 4DBQA 4B6MA 4LE9A 1JU5C 4C5GA 4M7DB 2W10A 2RHIA 2EKHA 3TQ7P 4M7AF 2BTTA 3DKMA 3L2UA 1PM3A 1BIAA 3I35A 5IXBA 4OB2B 3I56Q 1Q81U 3FJPA 4MDWA 1Q86R 1UGPB 3QXEB 3INZA 2F5KA 3QZ5B 4P5NA 1BI2A 4M75E 4JUVA 3JCMd 1LJOA 1WX6A 4AFZC 3EFOA 2QI2A 3PE0A 2X35A 2C0IA 1VQLT 1JJ2A 1GCPA 3CCVT 3NTIA 1GCQC 3ER0A 1VQ9A 4FYWB 3L2VA 4PJOE 2LP5A 4C92B 4D6WA 3GNFB 3BFMA 1ZBJA 2VYTA 1W2BP 3REAB 1YIJT 2EQIA 2CZ1B 3CC2T 4A4FA 2BZYA 2EW3A 1O75A 3JAME 4R0KA 3EFSA 4JJNK 3OMGA 2OAWA 4BE1A 1KJWA 4GLKA 3CXCP 4FT4A 1YJ9Q 4RG2A 4M78G 3CCJT 3PTAA 1P92A 1NZ9A 2NUPA 4BB7A 3UDCA 1VQNQ 2LCSA 2XMFA 3CCJA 1TOVA 1SF9A 3A8HB 4JRPA 1YHQQ 3JB9F 2HKNA 3M0SA 2QA4A 3JCMX 4XTYA 1AEYA 4XTVA 1JBMA 2K57A 2GGRA 1R0CB 2PUKB 2RQVA 2QAZA 1Q86U 2D8JA 4J9GA 4IUUA 1YJ9T 3CCRQ 1ZA1B 4Z8AA 4MZMA 1IXDA 2DPPB 3OS2A 2DL4A 2MIOA 3OYKA 4OMQA 3CCQQ 1UTIA 3M54A 1VQ9T 1OQKA 3M4GA 1U5SA 3UPUA 4M75B 1VQOQ 2KSSA 3VU3C 2E70A 4F7UB 3J80E 1SHFA 2EJGA 2I2LA 4CI0C 4DA4A 5IH2A 1FX7A 2RQUA 3M53A 4ZGDB 3SB2A 3SD4A 3OYFA 4BACA 1GRIA 2JTMA 2OTJQ 1C0MA 2KRSA 4LNPA 4X9CA 2HAXA 1WHGA 1HXDA 4M7AE 3H8ZA 1M3CA 1VQ7T 5IHKA 3QDFA 1TU0B 4J7FA 1M8VA 2EKOA 5IT9E 2EVRA 3JCMJ 3JSCA 2DVEA 1RAHB 2DFUA 3HFOA 1YI2T 3EH1A 4GBQA 1D1CA 5I21A 2DKGA 2OI3A 1DJ7B 5GAOq 3CBMA 1RL2A 1YI2A 2X3XD 4EMHA 1OZ3A 1WJSA 3V7SA 4C8QF 1YHQT 3UT1A 1SSFA 1YCSB 5GMKi 5L23A 5ECAA 2CUBA 2K2MA 2R5MA 1WNLA 2COWA 3C4SA 1NYGA 4PFZA 2V1QA 2PVOB 4Y92A 5GAN4 2J7IA 2J06A 1OPLA 2FRYA 3G71A 1VYVA 5CAIA 2MK5A 1X6GA 4OMOA 2JJ9A 1R0BG 3ULRB 3PIOA 4RG8A 5IHIA 2JT4A 3MEVA 3RKXA 2ZAEA 1QWEA 3FB9A 1WJQA 3C0CA 1QKXA 1KQSS 4J6YA 1ZA2B 4KRTA 4M4ZA 2DILA 1BCMA 2FL7A 2BE7D 2PVGB 2CP5A 2FVUA 1WIEA 1UGSB 2KROA 5GMKe 4RTWA 2DTOA 2MPXC 5LJ5g 5LJ5d 2D1XA 3PT9A 3A8OB 1KQSA 5KE2A 5GAMj 1K0XA 1Q7YC 2D9TA 2GTJA 1H3HA 3VS5A 4M78B 4E7ZA 3CCLA 3M0QA 2R5AA 1I0CA 3QKJA 4BE2A 4M77G 1BIBA 4C8QD 2K5FA 1UGQB 1QP2A 1ARKA 2DJZA 1MV0B 4HVUA 4E7SA 2VVKA 2H8HA 2K7AA 2Y90A 1PRLC 2YDLA 1KHIA 1VQLA 4ME7A 1BCOA 4M7DD 1LOJA 2CKKA 4ZGEB 1VA7A 2X51A 4BI4A 1MV3A 2J6KA 1PSEA 3RKYA 1TH7A 3EGDA 1ZSGA 3DB3A 1VQ6T 1I5OB 3M0TA 4C92F 3OYBA 3CPWS 3JCMV 3AT1B 2F2WA 1YJNA 2HQEA 3FLGA 4FT2A 3WVDB 2CP7A 4Y28E 1PRMC 1UGVA 3EFRA 5CR2A 2W0ZA 4C92G 2L8DA 4M7AA 4C8QC 5D6WA 5GJVB 2AZSA 2EWNA 3QIIA 4UC4A 3CPWA 2ECZA 4N0AC 2EYXA 1TS9A 1NM7A 2JVVA 1BI0A 3MEUA 1QVFS 3UA6A 3OYEA 2IVWA 3PNWC 1KFZA 1FMKA 4C5HA 4F7UF 2V8JA 5A0GA 4DQ2A 3MO8A 2CZ0B 2AZVA 1W2BA 2HQXA 1WYXA 3CCVA 5L8RE 2BZ8A 1YJWT 1YFNA 1QVFA 1RACB 2KGTA 1D0YA 1Q82U 3OMCA 3QPHA 2EBPA 1H92A 1RAIB 2L3QA 2P84A 1QWFA 2HQHA 1Q7YU 2DLPA 4ZTJA 2DJQA 4M75F 3CD6A 4F04B 2JTEA 3JCMg 2YUQA 1T3LA 5KYYA 3EHRA 3I9QA 1Q86C 4D8KA 1YITA 1Z9ZA 1K9AA 4MMKA 1U1SA 2HKQB 1YWOA 4XQ3A 1TWBA 5GMKh 2LNHB 1KC8U 4LXCA 2EPDA 5CKBA 4JJBA 1I07A 2M0OA 1JO8A 1MMAA 1M1KU 2FYKA 4OMMA 2F2XA 2KT8A 4XU0A 4XTZA 3HRSA 2YLCA 3G1JA 1N6AA 2DD4A 2O4XA 1I81A 2KRMA 2A08A 1ZQ1A 2X4WA 3OYAA 3I55A 5KE3A 3RIRA 3NPFA 1KQSP 2G6FX 4LD6A 4V2SA 4AFQC 3G6EQ 3VS4A 2Y4YA 2DBMA 2O88A 4PLLA 2JN0A 4FYXB 5IXFA 3E9FA 2M16A 3N5BB 3I56A 1UHFA 4WTOB 4C0FA 1YJNT 3TSWA 4M7DC 1AZEA 4JRQA 5CIUA 3V7RA 1IHWA 1H8KA 5FWCA 3CCST 4M77E 3PIPA 3KXTA 2LQNA 3JCMP 4FSXA 2VV5A 5LJ5j 3RMQA 3BW1A 2QEXT 2DRMA 4M78F 1YITT 4XTUA 1X75C 2LJ0A 4ELYC 4A53A 2H3EB 2LT1A 4RTYA 4C0DB 4KUDK 2VXFA 1VQNT 4RTVA 3S6WA 3PVQA 1BI3A 3GIBA 3EG0A 1MNDA 1ZUUA 4OB0B 3H0IA 4ESRA 2CREA 2EIFA 3J7AF 1RI9A 2HSEB 2NUTA 2HD0A 1YNZA 3U23A 3X26B 2K5IA 2QEXQ 3JCMe 2VXEA 3EG3A 2R57A 1OULA 2KYBA 2WSEE 4M77C 1M2OA 4QVDA 1YCYA 1M9SA 1FWZA 1E6HA 2QTVA 4OB3B 5HK0A 3CMEQ 2HZYA 5J39A 1VIEA 2KVQG 1IB8A 4PJOG 2DBKA 2L3SA 2DF6A 2OTJA 2FPFA 2WACA 1RADB 3V8LA 3CBPA 2K9GA 1ZHIA 2X4JA 4AG1C 2PTKA 3VUZA 4DBHA 1X27A 2ESWA 2ZPEB 3SWNB 2ZPIB 2FG0A 1W2BS 1UHCA 5I2SA 2ED0A 5HY6A 4J9DA 1JEGA 4M75G 1W70A 2CP3A 4QKUA 2B8AA 5KCHA 3CCMA 5CKHA 4RUGA 3JB9J 4MMLA 3H6ZA 3CCMT 4E7HA 4NOYA 2LNVA 1Q95G 2RPNA 2FHDA 1WI7A 1UEBA 1NYFA 1V76A 3HRTA 2VB6A 4BUGA 4J8OA 3VRYA 3V7CA 2O31A 3CC7Q 3ZFJA 1YHQA 1IREB 5DY9A 3RUXA 4HT9A 4PKCC 3OBYA 3QUIA 1T0JA 3CMEA 3LGFA 1I8FA 1M3BA 1PC0A 3NTKA 2ED1A 2DXUA 3I5SA 4FL6A 2M1HA 1WXUA 1GFDA 5IAYA 3G71T 4LDUA 2ZGWA 3CC7T 1Y96B 1WXTA 2CGHA 2H3JA 4LDVA 3QWYA 1W1FA 3LX7A 2O9VA 2F2VA 2HMAA 2XKOC 1M30A 5FU6C 4KULA 3OS1A 2RI3A 1WXBA 3VYHB 4CC3A 3JCMb 4KH1B 2L2PA 4LDWA 1QVFP 1M1GA 1NG2A 4C92A 2RM4A 5A0DA 2FRWA 4X34A 2Y4XA 4CC7A 1VQPT 4JLGA 2YSQA 2VUBA 4M77F 4PJJA 1PD0A 1SRLA 4F7UG 1UB4A 4CC2A 3RMSA 5GAN3 3OYGA 4M77A 2EQKA 2E41A 4LUEA 3H41A 4ZNXA 1NJIC 1RUWA 1Q7YR 1WHHA 3CCMQ 4JZ4A 3CC2A 3UATA 4NL3A 1ZLMA 4RTZA 5FW9A 2L3RA 2AKKA 1MNEA 2K3XA 4C8QB 4M7DG 4BDZA 1QKWA 3M56A 2D6FA 3OYJA 3CPFA 2K6DA 6AT1B 4E6RA 1M90C 5GAOp 2YRDA 4BY6C 1VQNA 3HKSA 2QA4T 1D09B 2DL7A 3CCRT 4M75D 2DYBA 2PQWA 2IPOB 1Q81R 3NFCA 2CT4A 3HSBA 2ATCB 2MOXA 2P4TA 4XU3A 1NLPC 2GQIA 5GJWB 4WCIA 1RAAB 1YIJQ 4F7UA 1M27C 3F70A 3EG2A 4QQDA 2V8IA 1KSWA 2QQAA 2EJFA 5IHNA 4LDYA 4PJLA 2CSIA 1G3TA 1KHCA 5GAOm 4JPBW 4C0ZA 3CCUQ 2LDMA 4PJOB 1JXMA 3LGLA 2COYA 5GANh 1W6XA 4GY5A 1M2VA 1S72T 4PFOA 5GAN6 3NMZC 2YHTA 3P8DA 4HVVA 4MZPA 3OS5A 3CCQA 3GF5A 1S72A 3CC4A 2DL3A 4WF2A 3WVEB 1C6VX 2KMTA 4LD9K 8ATCB 1VUBA 5LJ5f 2DTHA 4J6WA 3EHQA 4JS4A 4C0GA 1LNXA 1VIFA 4EMKA 2CZ6B 5C6SA 3CMAQ 2XI9A 1JXOA 5GAMh 2MAMA 4N4HA 1TTHB 3OW2A 5GAN8 3MEAA 2A36A 1MMGA 3IQLA 2BIVA 4M77D 2DZCA 1T0HA 1AWJA 1WDXA 2BKDN 2PUOB 3CCVQ 2J6OA 4FIBA 2KBTA 4LUDA 3RNJA 5FRMA 3RR6A 3G6EA 3TEEA 1NJIR 4C92C 2YUOA 2KK4A 2JMAA 2KQWA 1EFNA 2ZPGB 4EIKA 3OB9A 4M75C 2EAYA 4FW2A 5LJ3j 2RI5A 2RHZA 3L1AA 4D8DA 1LVKA 1OX8A 2P4RA 2X3WD 3KBGA 4QT7A 2EGEA 1KIKA 4O5VA 2KEAA 4F14A 2QGGA 3JB9G 4HCZA 1VQMQ 2RN8A 1YP5A 4OGEA 2RHUA 2RH2A 2HCKA 1K8AR 3CQTA 2ABLA 2A37A 4J9FA 3QBYA 3CCEA 1LCKA 2RJCA 3OYLA 4ANJA 1YIJA 4C8QA 5KYWB 4C92E 4M78D 2DL5A 2DAQA 3H0FA 3M9QA 1FMWA 2KT1A 2LJ1A 2O4XB 5GMKm 2JS2A 2DX1A 1BB9A 2J6FA 3JCMW 2YLBA 4ORZA 3EGUA 2RJDA 5GAOl 2LCLA 1BI1A 3BDLA 1VQKA 3QSUA 2QTXA 4RTUA 3CC7A 4XTXA 2CH4A 3M5AA 2K4YA 3GP8A 1VQ5T 1R8OB 2DK3A 1AOJA 2QYZA 1JB0E 2YRVA 1VQ4A 2X9HA 1CSKA 2JNGA 1G5VA 2RO0A 3G4SQ 4RMOA 2DA9A 4EMKC 5GAOn 2YRCA 1OU8A 1V1CA 1OI1A 1ZBXA 1Y0MA 3PFSA 2RK2A 5CCAA 5M9OA 4AT1B 1UGRB 2QGFB 2Z0WA 1EZZB 3I5RA 1K76A 4M77B 1OV3A 1KD1R 4N4GA 3T9NA 2JTFA 4C8QG 3P8BB 5HKCA 1M8MA 4JJDA 1X6BA 1T3SA 3JRZA 3QWXX 2MWPA 4MDXA 4BI8B 1YWPA 1HYOA 3M0UA 3A8GB 1TUDA 1Q82R 1K4US 1GL5A 3EH2A 1O9SA 3E2UA 4AG2C 2RJEA 1M3AA 5FU7C 4LN2A 1AT1B 2G3RA 4NL2A 2HDAA 5EC7A 1KG1A 2CP2A 4IIOA 4IURA 2GNCA 3R6NA 4AFUC 4M7AB 1G8XA 3EGXB 2LCCA 2X4XA 4A4KA 1X6OA 3SHWA 2YXYA 3M58A 4DEXA 2DM1A 4N0AA 2K3YA 5LJ3g 2VGMA 1QW1A 3MHXA 5LJ5e 4OVAA 2E12A 2EYQA 3LH0A 2M02A 2FPDA 3H0HA 4QVZA 5CKFA 3NTHA 1IHVA 5GAN5 3L2WA 2CZ7B 3JCMf 4X1VA 4C0DC 2LZ6B 3GBQA 2M0YA 2DNUA 1IO6A 1BYMA 1U1TA 3X20B 3SWNA 4HA8A 2JW4A 2R58A 4F16A 1PSFA 2L5QA 2XDBA 2QQ9A 2FEIA 1RLQC 3HHTB 4MZTA 5KYNA 2RNAA 3DB4A 2JZ2A 1Q82C 2VGNA 3G71Q 4QQGA 1MMDA 1B07A 3CC4T 3VS2A 2CDTA 2RQRA 1RAEB 3QYGB 1AD5A 1SRMA 3MKDA 1M1KR 1WFWA 2GFAA 9ATCB 1WHLA 3MJXA 1YJ9A 2HEQA 2PVDB 3THKA 3FRNA 1N27A 1QVGA 4JLIA 3OSVA 2A3LA 1XJWB 2C06A 1B34A 2DRKA 4FSSA 3OYNA 5GAMg 1N8RU 4JRIA 2EJ9A 1D3BA 1RAFB 2F5TX 2KE9A 2PNIA 2JM8A 4RTTA 2EFIA 2ENMA 2SRCA 3OW2P 4DBFA 1NPRA 3D7SB 5KYXB 3TSZA 1K8AU 2F1LA 2QASA 1S72Q 2NUPB 1TUCA 7AT1B 1TUGB 5AYFA 1X69A 5CK9A 2XG8D 3QZ9B 2LT4A 1LPLA 2JUFA 1V29B 2AK5A 2DE0X 2OJ2A 2LX9A 3E9GA 2GCXA 3VYGA 2KAFA 4KGZB 5LJ3e 2V26A 2XHCA 1FXXA 2NYSA 1WHJA 3I55T 3MCAB 3VS6A 3QO3A 2EQJA 5A2QE 3OYDA 1YJWA 1NPPA 1VOMA 4PJOC 2GFUA 2DXBA 4E47A 3L42A 4FYYB 3SWNC 3ZL7C 1VQPQ 4HCBA 3MEWA 4KGVB 5CKDA 3AHUA 5CQXA 1G83A 1HSQA 4PJOA 4A63B 4FCYA 2J05A 1JJ2S 1VQKT 1NBEB 2DETA 2NLUA 2FPEA 3A1PA 1SG5A 2O9SA 5LJ5h 1UG1A 3A5ZB 1VQ5Q 2P0KA 1UECA 1WGSA 2VC8A 1VQ5A 3M55A 3CBOA 2YUPA 3LYIA 5LJ3d 5GAN7 5CQYA 1H3ZA 4M78A 2LJ3A 1PHTA 1F1BB 5KYYB 4JRKA 2HBPA 3S3OA 3UF4A 2RA2A 2WSCE 1UJYA 1CKBA 4M75A 2DZ9A 4AFSC 1N5ZA 3CCQT 1R77A 2EYZA 3JB9H 4OP0A
chains in the Genus database with same CATH topology
3HFNA 2XK0A 1B34B 3HL8A 1VQOT 1M90C 4CRIA 4IKFA 4PJOD 2XU8A 5GAOp 2FL7A 1QP3A 3HRUA 1OYXA 2PVGB 1XOVA 2EQUA 5D6YA 2FVUA 4BY6C 1UGSB 2ZZDA 2XDPA 2M9UA 1VQNA 3HKSA 2QA4T 5DLQE 1M4ZA 2DTOA 5GMKe 3OBWA 5GANg 4ZTFA 2KDSA 3GNGA 5GANd 4J5YA 5LJ5g 1W2BA 5LJ5d 2OTLT 4DOVA 4M7AC 2V8KA 3BY7A 3G7ZA 3PT9A 4M75D 3CXCA 3CCRT 3A8OB 1KQSA 5KE2A 2PQWA 1M5Q1 5GAMj 1WQ7A 3PGGA 1K8AC 3NFCA 4VUBA 4M7AG 3S3NA 3HSBA 3FC3A 1Q7YC 2D9TA 4BE0A 2P4TA 2LTOA 4XU3A 1N9SA 4M78B 5EG2A 4F7UA 4C5EA 3F70A 3CCLA 2R5AA 5HK3A 3QKJA 1XTDA 4BE2A 4M77G 2XICA 1BIBA 3OYYA 2LVMA 4QQDA 2V8IA 4O6JA 3X25B 3R6OA 4B9XA 4C8QD 3GPLA 2QQAA 2EJFA 4B9WA 2AHJB 4LDYA 2K5FA 1WJRA 1UGQB 1QP2A 4LDXA 2DJZA 1G3TA 3C12A 1I4K1 3G4ST 4HCCA 2RI2A 1KHCA 4E7IA 5GAOm 4L59A 1Y71A 4C0ZA 2DEQA 2LDMA 2Y90A 4PJOB 1KHIA 3LGLA 5GANh 1VQLA 4ME7A 4GY5A 4M7DD 1S72T 1LOJA 1XNIA 2CKKA 4FM4B 1YBYA 5GAN6 2YHTA 2LQ8A 3P8DA 2OAUA 4MZPA 3OS5A 3URGA 2RHYA 3GF5A 4BI4A 3CCQA 1S72A 3CC4A 4WF2A 3WVEB 4QVCA 2KMTA 1PSEA 4LD9K 3RKYA 1TH7A 1VUBA 1KC8C 1X01A 5LJ5f 5GMKl 2DTHA 4J6WA 5GANf 4JS4A 3DB3A 4C0GA 1LNXA 1VIFA 2LRQA 2CZ6B 4C92F 4EMKA 2XI9A 5C6SA 3OYBA 3CPWS 2FB7A 2E1HA 5IN1A 5A0LA 2E6NA 5GAMh 4C5IA 2MAMA 4Q5WA 3JCMV 5GAN2 4N4HA 1YI2A 3OYHA 1YJNA 2HQEA 3FLGA 3OW2A 5GAN8 4FT2A 3MEAA 3WVDB 4A4GA 4L5GA 5GMKj 1GXIE 3RKWA 3FEOA 4Y28E 3P8HA 3PMTA 5LJ3h 3EFRA 5CR2A 3OQ5A 2BIVA 4M77D 4PJOF 2DZCA 4JS5A 1VQMT 2XD0A 5GAMf 4C92G 5CO7A 5KH6A 2BKDN 2L8DA 2PUOB 4M7AA 1Y96A 4C8QC 5D6WA 3CCUT 2EWNA 2JOYA 3ASKA 3QIIA 4UC4A 3C94A 4FIBA 3CPWA 5FRNA 1VQ6T 4E7LA 4N0AC 5FRMA 4XU1A 4M7AD 3G6EA 5LJ3f 4BDYA 3OSSC 3DLLA 2JVVA 1BI0A 3CEYA 3MEUA 1G3YA 3TEEA 1QVFS 3OYEA 4C92C 2IVWA 4KBMB 4DOWA 3CMET 3X24B 3PNWC 4XU2A 1U8RA 2KK4A 4RKUE 2KQWA 3E19A 4C5HA 2V8JA 1G3SA 4F7UF 1Y7XA 2ZPGB 2CZ0B 3MO8A 3MP1A 3OB9A 4M75C 2HQXA 4DQ2A 4FU6A 2EAYA 3QDRB 5LJ3j 3CCVA 5L8RE 2RI5A 2RHZA 2MF2A 3L1AA 3MP6A 4JDSA 4PNOA 1YJWT 2RHXA 5D6XA 3KBGA 4BY6B 2E64A 3X28B 1QVFA 2E6ZA 4O5VA 4A4HA 3VJPA 3JB9G 4HCZA 1EIFA 4R56A 2DXCA 1Q82U 3HPWA 4M7DF 4HT8A 3VKIA 4OGEA 3OMCA 2RHUA 3QPHA 2E10A 2RH2A 4M7DA 2P0PA 2ZPBB 2LC4A 5GANe 4L6V5 1Q81C 3M57A 2CS7A 1Q7YU 4PLIA 2E5QA 4ZTJA 3JB9I 4XTWA 1QVGS 3QBYA 3CCEA 3CMAT 2RJCA 5GANj 4M75F 3CD6A 3OYLA 3JCMg 3VUBA 1KD1U 2DIGA 2F69A 1YIJA 4IUPA 4C8QA 2IG0A 3MP8A 1VQ7A 1Q86C 5GAMe 4C92E 4M78D 4C92D 1NJIU 2DAQA 2DIQA 1YITA 3OYMA 1IZ6A 2K5LA 4MMKA 1U1SA 3M9QA 4OMFB 4QQ6A 4YTLA 5FU6B 3CCSA 1KQ1A 2DO3A 2HNIA 4XQ3A 2O4XB 3QG1A 2QDYB 5GMKm 5GMKh 4XK8E 3UWNA 2RK1A 2QQBA 1KC8U 2WSFE 1AHJB 2E65A 3TREA 3JCMW 3OYGA 5CKBA 2YLBA 3V8KA 2RJDA 5GAOl 2DD5A 1VQMA 2QEXA 1VQOA 2LCLA 1BI1A 3BDLA 1KD1C 4ATOA 1VQKA 1OZ2A 3TCJA 2GF7A 2RD1A 2M0OA 2DTIA 2QTXA 3A8MB 3CC7A 1M1KU 2L89A 3QSUA 3WXMB 2FYKA 4XTXA 4A54A 3BDUA 2A7YA 4XU0A 3GLXA 3M5AA 2K4YA 3ME9A 4XTZA 3HRSA 3GP8A 2YLCA 1R8OB 2DK3A 1VQ4T 1VQ5T 3CCRA 2EQMA 1N6AA 2DD4A 2O4XA 2YRVA 1JB0E 1I81A 1VQ4A 3JB9D 3JCMh 1ZQ1A 2X4WA 2JNGA 1NE8A 5CVIA 5KE3A 3OYAA 3I55A 2RO0A 3RIRA 5GAOr 1G5VA 4RMOA 4LD6A 4V2SA 3KUFA 4EMKB 4J7IA 4KT0E 2Y4YA 4EMKC 5GAOn 1K73U 3OY9A 4PLLA 2JN0A 3CCLT 1OI1A 2QQSA 1ZBXA 3E9FA 3PFSA 3OW2S 2RK2A 5CCAA 5M9OA 4M78C 2M16A 4QW2A 2LQKA 1VQ6A 1UGRB 3N5BB 3I56A 3QHSA 2GQVA 2O01E 3S3MA 2RJFA 3CXCS 4X9DA 1MHNA 4C0FA 2PU9B 4E7KA 1YJNT 4M7DC 4M77B 4OB1B 4C5GA 3DLMA 4ZGJB 3G4SA 4N4GA 4M7DB 3T9NA 4JRQA 2RHIA 2JTFA 3QJ6A 5CIUA 4C8QG 3P8BB 5HKCA 3A8LB 3V7RA 3CCST 4M7AF 3C95A 3DKMA 4M77E 3L2UA 2QQRA 3JRZA 5CKEA 3PIPA 1BIAA 4A4EA 2MWPA 4MDXA 3KXTA 3JCMP 4C8QE 4FSXA 4OB2B 2VV5A 4BI8B 1Q81U 5LJ5j 3FJPA 3A8GB 3BW1A 4MDWA 3RESA 3RMQA 4EMGA 5FROA 2QEXT 4M78F 2D0QB 1YITT 3LWHA 1UGPB 4XTUA 1X75C 4ELYC 3QXEB 3O8VA 3INZA 4EPCA 1O9SA 2F5KA 4A53A 3QZ5B 4P5NA 2LT1A 2RJEA 5FU7C 4C0DB 2G3RA 2VXFA 4KUDK 1VQNT 1BI2A 1VQPA 4NL2A 4M75E 3FIFA 3S6WA 4JUVA 1BI3A 4TVRA 3JCMd 1LJOA 2OTLA 3GIBA 1KG1A 4II1A 4IURA 4OB0B 2QI2A 4M7AB 1G3WA 2EIFA 2X35A 2LCCA 5I2MA 2X4XA 3J7AF 4A4KA 1VQLT 2ZCFB 2HD0A 1X6OA 1JJ2A 2DXTA 3M58A 3X26B 4BI3A 3CCVT 3LLRA 2K5IA 3NTIA 4N0AA 3E1SA 3JCMe 2CYZB 2K3YA 3ER0A 2VXEA 5LJ3g 1VQ9A 3OYIA 2R57A 3ZEHA 3LW5E 2VGMA 2WSEE 3L2VA 4M77C 1QW1A 3MHXA 4PJOE 4QVDA 3SFMA 3META 2BUDA 1YCYA 4C92B 5LJ5e 1M9SA 1FWZA 2E12A 4IUTA 3GNFB 4OVAA 2EYQA 4OB3B 3BFMA 3LH0A 4D6WA 3CD6T 1VQ8T 5HK0A 5J39A 1VIEA 2KVQG 1QVPA 2VYTA 4PJOG 4QVZA 1YIJT 5CKFA 3J81E 3NTHA 2CZ1B 5GAN5 3CC2T 3L2WA 4A4FA 1M1KC 2CZ7B 4N4IA 5FU7B 3JCMf 2OTJA 4C0DC 3CCET 1Y07A 2WACA 3V8LA 1O75A 4OF1A 3CBPA 3JAME 1BYMA 1U1TA 3X20B 3SWNA 1ZHIA 2X4JA 4HA8A 1K73C 4M78E 2MWOA 3VUZA 2R58A 3EFSA 3HP9A 4JJNK 3OMGA 2ZPEB 1PSFA 3SDZA 3OYCA 3SWNB 2ZPIB 2L5QA 4GLKA 4IUQA 4BE1A 3G6ET 2XDBA 1W2BS 2QQ9A 4FT4A 5I2SA 5C0MA 1K9MC 4KUIA 4MZTA 3HHTB 4RG2A 4M78G 1WQWA 2ZPHB 5HY6A 3CCJT 3PTAA 3DB4A 1P92A 2JZ2A 1NZ9A 1Q82C 4BB7A 3UDCA 2VGNA 4M75G 4QQGA 3CCJA 3A8HB 4ZN3A 4JRPA 2B8AA 5DM7R 3JB9F 3CC4T 5KCHA 3CCMA 2QA4A 5CKHA 3RERA 3JCMX 4XTYA 1RI0A 3JB9J 4F7UE 5LL6S 4MMLA 3H6ZA 4XTVA 1JBMA 3QYGB 3CCMT 5DLOA 4E7HA 2K57A 4NOYA 1XQHA 2LNVA 2PUKB 2GFAA 1K9MU 4J6XA 2FHDA 4NS5A 1D3BB 1YJ9A 1Q86U 1UEBA 2PVDB 2X4YA 5J26A 3HRTA 4IUUA 1YJ9T 3FRNA 1N27A 3VV0A 1QVGA 4JLIA 4BUGA 4MZMA 3OSVA 2A3LA 2DPPB 3OS2A 4J8OA 2C06A 1B34A 3V7CA 3OYKA 3OYNA 5GAMg 1N8RU 4JRIA 3ZFJA 2EJ9A 3M54A 1YHQA 4M7DE 1D3BA 1VQ9T 2F5TX 4IUVA 3L2RA 1IREB 3M4GA 3UPUA 4M75B 5DY9A 2KSSA 2EFIA 2MI6A 3RUXA 2E70A 3VU3C 4HT9A 2K2VA 4PKCC 3OBYA 3QUIA 4F7UB 3J80E 4ELZC 3CMEA 2KY9A 1I8FA 2EJGA 3LGFA 1VQ8A 4J83A 4RCBA 3JCMc 2I2LA 4CI0C 3CMAA 3NTKA 3OA6A 4DA4A 3L2QA 3LWIA 1NPRA 2DXUA 1FX7A 4FL6A 3M53A 4ZN1A 2M1HA 4ZGDB 3OS0A 1K8AU 1HK9A 2RB6A 3SB2A 3M4YA 2OTJT 3SD4A 3OYFA 4BACA 3I56T 2JTMA 5KCOA 5IAYA 3G71T 4X9CA 2HAXA 1HXDA 4LDUA 2ZGWA 1KQ2A 4M7AE 5AYFA 5CK9A 2XG8D 3H8ZA 3CC7T 3QZ9B 3CCUA 2LT4A 1Y96B 1JRIA 2CGHA 1H641 2H3JA 2JUFA 2MMPA 4R55A 1V29B 1MGQA 1VQ7T 3ZBDA 2LX9A 4LDVA 3E9GA 2GCXA 4E7JA 3VYGA 4ZGEB 2KAFA 3LX7A 5LJ3e 1W4SA 4J7FA 2XHCA 1M8VA 1FXXA 3GOXA 2EKOA 5IT9E 3I55T 3MCAB 3JCMJ 2XKOC 5FU6C 4KULA 3JSCA 2DVEA 3OS1A 2RI3A 3VYHB 3QO3A 3JCMb 4XAXB 3HFOA 2EQJA 4OGCA 2ZPFB 4LDWA 4PL6A 4Z02A 1YI2T 1M1GA 4C92A 5A0DA 2RM4A 5I21A 2DKGA 5A2QE 3OYDA 1YJWA 5GAOq 1DJ7B 1NPPA 4PJOC 5J3BA 3CBMA 1RL2A 3EAEA 4X34A 2GFUA 4EMHA 2Y4XA 2DXBA 4E47A 5A0GA 1OZ3A 1WJSA 3L42A 1VQPT 3V7SA 3SWNC 4C8QF 3UT1A 4JLGA 1YHQT 1N9RA 1SSFA 4HCBA 3MEWA 3TU4K 1WPYA 2VUBA 4M77F 5CKDA 3V8JA 4EDUA 3AHUA 5CQXA 4F7UG 1UB4A 4PJOA 5GMKi 3RMSA 1JJ2S 1VQKT 4RCCA 2R5MA 1WNLA 4M77A 3C4SA 2NLUA 5LJ5h 2EQKA 5GAN3 2E41A 3PMIA 3Q1JA 2QXFA 3QYHB 1NJIC 3A5ZB 4BD3A 2XIDA 1M1FA 2P0KA 2PVOB 1WGSA 3QJYA 1M90U 2VC8A 5GAN4 1VQ5A 3CC2A 4NL3A 3M55A 2XDDA 3FDRA 3CBOA 3G71A 3LYIA 5LJ3d 5GAN7 1N8RC 1BKBA 2L3RA 5CQYA 1H3ZA 4M78A 5CAIA 2K3XA 5FLXE 1I5LA 4C8QB 4JRKA 2HBPA 4HKEA 3S3OA 2RA2A 2WSCE 3JCMQ 4M7DG 4M75A 2DZ9A 4BDZA 3PIOA 4Y91A 5GAMd 3L2ZA 3M56A 4RG8A 3MEVA 2D6FA 3M59A 3RKXA 3CCQT 3FB9A 1WJQA 2P0QA 3OYJA 3JB9H 3CPFA 4OP0A 1KQSS 4J6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIE A;  3T9N A;  2RH2 A;  2RK2 A;  3SFM A;  3UDC A;  2OAU A;  2P4T A;  2RK1 A;  1VIF A;  2VV5 A;  2GQV A; 
#chains in the Genus database with same CATH topology
 2AKL A;  2XK0 A;  1VQO T;  4CRI A;  4IKF A;  4PJO D;  2XU8 A;  1UFF A;  1OYX A;  2EQU A;  2ZZD A;  4CC4 B;  4ZTF A;  5DLQ E;  1M4Z A;  3OBW A;  3GNG A;  1GBQ A;  2GTO A;  1G2B A;  1N8R R;  2V8K A;  3G7Z A;  3CXC A;  1SHG A;  1M5Q 1;  1WQ7 A;  4M7A G;  4VUB A;  3S3N A;  4BE0 A;  2LTO A;  1FYN A;  1S1N A;  5EG2 A;  4Z88 A;  5HK3 A;  1XTD A;  2AIR B;  2XIC A;  3OYY A;  3R6O A;  4B9X A;  2AT1 B;  4B9W A;  2QDL A;  1VYT A;  4J9I A;  3CCS Q;  1I4K 1;  3G4S T;  4HCC A;  4L59 A;  4E2F B;  2RMO A;  2DEQ A;  2DYI A;  2YUN A;  1XNI A;  4FM4 B;  1YBY A;  2RHY A;  2KYM A;  4PK4 A;  2MCN A;  1KC8 C;  1X01 A;  5GAN f;  2CP6 A;  4J9E A;  2E1H A;  1WHM A;  5A0L A;  1U06 A;  2E6N A;  4C5I A;  1QVG S;  4Q5W A;  1E7O A;  4L5G A;  5GMK j;  3RKW A;  4K11 A;  3VS0 A;  3PMT A;  5LJ3 h;  3VRZ A;  4PJO F;  5GAM f;  1KC8 R;  1Y96 A;  4PFP A;  3ASK A;  5FRN A;  2D0N A;  3SEM A;  2LMJ A;  2JXB A;  2ROL A;  4M7A D;  3H9N A;  3OSS C;  3CEY A;  1YJN Q;  4HVW A;  3CME T;  3X24 B;  4XU2 A;  3E19 A;  5DLO A;  1G3S A;  1Y7X A;  3OYM A;  4HXJ A;  2MF2 A;  1OX9 A;  4JDS A;  2RHX A;  5D6X A;  4BY6 B;  2E64 A;  2E6Z A;  4A4H A;  2O2O A;  1VQL Q;  1OEB A;  1EIF A;  1IGU A;  1QCO A;  4HT8 A;  5D7U A;  2E10 A;  4M7D A;  2P0P A;  1CKA A;  2CS7 A;  4PLI A;  2E3H A;  2E5Q A;  3JB9 I;  4XTW A;  3CMA T;  5GAN j;  2JMC A;  2B86 A;  2EGA A;  2DIG A;  1VQK Q;  2FZG B;  1PCX A;  1NEG A;  3A98 A;  2C0T A;  3MP8 A;  1VQ7 A;  1PG5 B;  2FZC B;  4C92 D;  1NJI U;  4YTL A;  2K5L A;  4OMF B;  2OTL Q;  1KQ1 A;  2HNI A;  2L0A A;  3QG1 A;  1KK7 A;  2A0F B;  4XK8 E;  2RK1 A;  2QQB A;  1K73 R;  2WSF E;  1AHJ B;  2E65 A;  3HTR A;  1VQO A;  1VQ7 Q;  2E4H A;  1KD1 C;  2NUT B;  1OU9 A;  3A8M B;  2DTI A;  2L89 A;  4A54 A;  3BDU A;  3CCE Q;  2A7Y A;  3ME9 A;  2NUZ A;  3M0P A;  2EQM A;  3JCM h;  5CVI A;  1NE8 A;  1E6G A;  2QK0 A;  1J3T A;  4HCK A;  3KUF A;  1RAB B;  4KT0 E;  1B7T A;  1K73 U;  3OY9 A;  4KH0 B;  4GLM A;  3EG1 A;  3CCL T;  3OW2 S;  2LQK A;  1VQ6 A;  1UDL A;  3QHS A;  2O01 E;  1GFC A;  2DMO A;  1QQJ A;  3CXC S;  1AWX A;  1MHN A;  2L3P A;  2PU9 B;  4E7K A;  4OB1 B;  3DLM A;  4ZGJ B;  3G4S A;  1QCF A;  3QJ6 A;  3NHN A;  1ZX6 A;  1TXQ A;  3A8L B;  4J9H A;  3C95 A;  2QQR A;  5CKE A;  4A4E A;  4C8Q E;  2KI7 A;  3LH5 A;  3RES A;  2QG9 B;  4EMG A;  5FRO A;  5KYU B;  4OMN A;  2D0Q B;  4AMC A;  3LWH A;  3CCJ Q;  3O8V A;  4EPC A;  2RF0 A;  1PKT A;  1VQ4 Q;  1VQP A;  1ABO A;  1AZG B;  3FIF A;  1TSF A;  4TVR A;  2OTL A;  1OPK A;  4II1 A;  1GBR A;  1G3W A;  5HCK A;  5I2M A;  2ZCF B;  4PJM A;  1BK2 A;  2E3I A;  2DXT A;  3CPW P;  4BI3 A;  3LLR A;  3E1S A;  2CYZ B;  3OYI A;  3ZEH A;  3EG9 B;  1ACM B;  3LW5 E;  3SFM A;  3MET A;  2BUD A;  4IUT A;  2DER A;  3CD6 T;  2M51 A;  1VQ8 T;  1VQ9 Q;  2HBW A;  1QVP A;  3REB B;  1B3Q A;  2VKN A;  2YWW A;  3J81 E;  2PZ1 A;  1X43 A;  1M1K C;  4N4I A;  5FU7 B;  3CCE T;  1Y07 A;  4FYV B;  4OF1 A;  1C1A A;  1MMN A;  1ZSZ C;  2EYY A;  2KXD A;  3VS7 A;  1K73 C;  1Y57 A;  4M78 E;  2MWO A;  1ZUY A;  3HP9 A;  3OYC A;  3SDZ A;  4IUQ A;  3G6E T;  1K9M C;  5C0M A;  4KUI A;  1WQW A;  1WHK A;  2ZPH B;  2IIM A;  1K0S A;  1HJD A;  2A28 A;  4ZN3 A;  2KXC A;  2NWM A;  5DM7 R;  3RER A;  4OMP A;  2EGC A;  4DBR A;  1RI0 A;  4F7U E;  5LL6 S;  1SEM A;  1XQH A;  4JZ3 A;  1K9M U;  4J6X A;  1M2V B;  4NS5 A;  3I55 Q;  1D3B B;  2X4Y A;  5J26 A;  1RAG B;  2LQW A;  3VV0 A;  1UUE A;  5I22 A;  3EFO B;  2CUD A;  4M7D E;  4IUV A;  3L2R A;  2ROT A;  2MI6 A;  2RQT A;  2GBQ A;  2K2V A;  4ELZ C;  2KY9 A;  2LX7 A;  1VQ8 A;  4J83 A;  4RCB A;  3JCM c;  3CMA A;  3OA6 A;  3L2Q A;  3LWI A;  3OS0 A;  4ZN1 A;  1HK9 A;  2RB6 A;  1YJW Q;  3M4Y A;  2OTJ T;  3UA7 A;  3I56 T;  5KCO A;  1OOT A;  1KQ2 A;  2BE9 B;  3CD6 Q;  1K9M R;  1IRX A;  3CCU A;  1JRI A;  1M90 R;  1H64 1;  4R55 A;  2MMP A;  1MGQ A;  3ZBD A;  1A0N B;  1SKU B;  2HL5 C;  4E7J A;  2E5K A;  1EX4 A;  1W4S A;  1VQ8 Q;  1QMC A;  3GOX A;  1QCN A;  2VWF A;  4XAX B;  1AVZ C;  1ZSZ A;  4OGC A;  2ZPF B;  1PNJ A;  4PL6 A;  4Z02 A;  2COZ A;  5J3B A;  3EAE A;  1GCQ A;  1WLP B;  3JV3 A;  1N9R A;  3M0R A;  1Z9Q A;  3TU4 K;  1WPY A;  3V8J A;  4EDU A;  4F17 A;  1K1Z A;  4FW1 A;  4RCC A;  3PMI A;  3Q1J A;  2QXF A;  3QYH B;  4BD3 A;  2XID A;  3CC2 Q;  1M1F A;  3QJY A;  1M90 U;  5KYX A;  3MPU B;  2XDD A;  3FDR A;  2D8H A;  1N8R C;  1BKB A;  5FWB A;  1NEB A;  5FLX E;  1I5L A;  2CSQ A;  4HKE A;  5KYU A;  3JCM Q;  2VAS A;  2MYS A;  4Y91 A;  5GAM d;  3L2Z A;  1AWW A;  3M59 A;  3NGP A;  2P0Q A;  4J9B A;  1ZUK A;  1WA7 A;  1VQ6 Q;  3HFN A;  1B34 B;  3HL8 A;  1PD1 A;  1QP3 A;  3HRU A;  1XOV A;  5D6Y A;  1JQQ A;  2XDP A;  2M9U A;  3EGX A;  5GAN g;  2KDS A;  2HL3 A;  5GAN d;  2KRN A;  4J5Y A;  3BE3 A;  2OTL T;  4DOV A;  4M7A C;  3BY7 A;  2YT6 A;  2SEM A;  3PGG A;  1K8A C;  2KNB B;  3FC3 A;  1YI2 Q;  1N9S A;  5AT1 B;  2HSP A;  1I1J A;  4C5E A;  4IIM A;  2LVM A;  3X25 B;  4O6J A;  3GPL A;  2FO0 A;  2CP0 A;  2AHJ B;  2CH4 W;  1VYU A;  2DVJ A;  1WJR A;  1ABQ A;  2K79 A;  3RDV A;  4LDX A;  3C12 A;  1JJ2 P;  4KGX B;  2RI2 A;  4E7I A;  1Y71 A;  4Z89 A;  3CCL Q;  1UJ0 A;  1SSH A;  2K3B A;  2LQ8 A;  2OAU A;  3URG A;  4QVC A;  1D0X A;  5GMK l;  2LRQ A;  3TVT A;  2FB7 A;  5IN1 A;  5GAN 2;  3EG9 A;  2OX7 A;  3OYH A;  4A4G A;  1GXI E;  1RLP C;  3FEO A;  2BZX A;  3P8H A;  1WZO A;  3OQ5 A;  4JS5 A;  1VQM T;  2XD0 A;  5CO7 A;  5KH6 A;  3CCU T;  2JOY A;  3C94 A;  4E7L A;  4XU1 A;  1QVG P;  2JM9 A;  5LJ3 f;  4BDY A;  1NLO C;  3DLL A;  1YN8 A;  1PKS A;  4OML A;  1G3Y A;  2I0N A;  4KBM B;  4RTX A;  4DOW A;  1U8R A;  1QLY A;  1U3O A;  4J9C A;  4RKU E;  3MP1 A;  3O5Z A;  4FU6 A;  1X2K A;  3QDR B;  3MP6 A;  4PNO A;  2QA4 Q;  5KYW A;  2RQW A;  4JJC A;  3X28 B;  1TG0 A;  1SPK A;  3PVL A;  3VJP A;  4R56 A;  2DXC A;  1HD3 A;  3HPW A;  3VKI A;  4PJN A;  2C0O A;  2ZPB B;  2LC4 A;  5GAN e;  4L6V 5;  1Q81 C;  3KFV A;  3M57 A;  1FMV A;  3CC4 Q;  1IGQ A;  3VUB A;  1KD1 U;  2KR3 A;  2F69 A;  4IUP A;  2IG0 A;  5GAM e;  2JS0 A;  3VS1 A;  1BBZ A;  2DIQ A;  2V1R A;  1IZ6 A;  5FU6 B;  4QQ6 A;  3CCS A;  2DO3 A;  3FJ5 A;  2QDY B;  3UWN A;  3TRE A;  1YIT Q;  3V8K A;  2DD5 A;  2EYW A;  1VQM A;  1UE9 A;  2QEX A;  1BU1 A;  2DEU A;  8AT1 B;  4ATO A;  1OZ2 A;  3TCJ A;  2GF7 A;  2RD1 A;  1MUZ A;  3WXM B;  3VS3 A;  1D1B A;  2CT3 A;  1PWT A;  3GLX A;  4M7D F;  1VQ4 T;  1AWO A;  1D1A A;  3CCR A;  5I11 A;  1X2Q A;  3JB9 D;  2FZK B;  5GAO r;  1ZSZ B;  4DEY A;  4EMK B;  4J7I A;  2DL8 A;  3EGD B;  2QQS A;  4M78 C;  4QW2 A;  2GQV A;  3RBB B;  3S3M A;  2RJF A;  1D0Z A;  4X9D A;  4DBQ A;  4B6M A;  4LE9 A;  1JU5 C;  4C5G A;  4M7D B;  2W10 A;  2RHI A;  2EKH A;  3TQ7 P;  4M7A F;  2BTT A;  3DKM A;  3L2U A;  1PM3 A;  1BIA A;  3I35 A;  5IXB A;  4OB2 B;  3I56 Q;  1Q81 U;  3FJP A;  4MDW A;  1Q86 R;  1UGP B;  3QXE B;  3INZ A;  2F5K A;  3QZ5 B;  4P5N A;  1BI2 A;  4M75 E;  4JUV A;  3JCM d;  1LJO A;  1WX6 A;  4AFZ C;  3EFO A;  2QI2 A;  3PE0 A;  2X35 A;  2C0I A;  1VQL T;  1JJ2 A;  1GCP A;  3CCV T;  3NTI A;  1GCQ C;  3ER0 A;  1VQ9 A;  4FYW B;  3L2V A;  4PJO E;  2LP5 A;  4C92 B;  4D6W A;  3GNF B;  3BFM A;  1ZBJ A;  2VYT A;  1W2B P;  3REA B;  1YIJ T;  2EQI A;  2CZ1 B;  3CC2 T;  4A4F A;  2BZY A;  2EW3 A;  1O75 A;  3JAM E;  4R0K A;  3EFS A;  4JJN K;  3OMG A;  2OAW A;  4BE1 A;  1KJW A;  4GLK A;  3CXC P;  4FT4 A;  1YJ9 Q;  4RG2 A;  4M78 G;  3CCJ T;  3PTA A;  1P92 A;  1NZ9 A;  2NUP A;  4BB7 A;  3UDC A;  1VQN Q;  2LCS A;  2XMF A;  3CCJ A;  1TOV A;  1SF9 A;  3A8H B;  4JRP A;  1YHQ Q;  3JB9 F;  2HKN A;  3M0S A;  2QA4 A;  3JCM X;  4XTY A;  1AEY A;  4XTV A;  1JBM A;  2K57 A;  2GGR A;  1R0C B;  2PUK B;  2RQV A;  2QAZ A;  1Q86 U;  2D8J A;  4J9G A;  4IUU A;  1YJ9 T;  3CCR Q;  1ZA1 B;  4Z8A A;  4MZM A;  1IXD A;  2DPP B;  3OS2 A;  2DL4 A;  2MIO A;  3OYK A;  4OMQ A;  3CCQ Q;  1UTI A;  3M54 A;  1VQ9 T;  1OQK A;  3M4G A;  1U5S A;  3UPU A;  4M75 B;  1VQO Q;  2KSS A;  3VU3 C;  2E70 A;  4F7U B;  3J80 E;  1SHF A;  2EJG A;  2I2L A;  4CI0 C;  4DA4 A;  5IH2 A;  1FX7 A;  2RQU A;  3M53 A;  4ZGD B;  3SB2 A;  3SD4 A;  3OYF A;  4BAC A;  1GRI A;  2JTM A;  2OTJ Q;  1C0M A;  2KRS A;  4LNP A;  4X9C A;  2HAX A;  1WHG A;  1HXD A;  4M7A E;  3H8Z A;  1M3C A;  1VQ7 T;  5IHK A;  3QDF A;  1TU0 B;  4J7F A;  1M8V A;  2EKO A;  5IT9 E;  2EVR A;  3JCM J;  3JSC A;  2DVE A;  1RAH B;  2DFU A;  3HFO A;  1YI2 T;  3EH1 A;  4GBQ A;  1D1C A;  5I21 A;  2DKG A;  2OI3 A;  1DJ7 B;  5GAO q;  3CBM A;  1RL2 A;  1YI2 A;  2X3X D;  4EMH A;  1OZ3 A;  1WJS A;  3V7S A;  4C8Q F;  1YHQ T;  3UT1 A;  1SSF A;  1YCS B;  5GMK i;  5L23 A;  5ECA A;  2CUB A;  2K2M A;  2R5M A;  1WNL A;  2COW A;  3C4S A;  1NYG A;  4PFZ A;  2V1Q A;  2PVO B;  4Y92 A;  5GAN 4;  2J7I A;  2J06 A;  1OPL A;  2FRY A;  3G71 A;  1VYV A;  5CAI A;  2MK5 A;  1X6G A;  4OMO A;  2JJ9 A;  1R0B G;  3ULR B;  3PIO A;  4RG8 A;  5IHI A;  2JT4 A;  3MEV A;  3RKX A;  2ZAE A;  1QWE A;  3FB9 A;  1WJQ A;  3C0C A;  1QKX A;  1KQS S;  4J6Y A;  1ZA2 B;  4KRT A;  4M4Z A;  2DIL A;  1BCM A;  2FL7 A;  2BE7 D;  2PVG B;  2CP5 A;  2FVU A;  1WIE A;  1UGS B;  2KRO A;  5GMK e;  4RTW A;  2DTO A;  2MPX C;  5LJ5 g;  5LJ5 d;  2D1X A;  3PT9 A;  3A8O B;  1KQS A;  5KE2 A;  5GAM j;  1K0X A;  1Q7Y C;  2D9T A;  2GTJ A;  1H3H A;  3VS5 A;  4M78 B;  4E7Z A;  3CCL A;  3M0Q A;  2R5A A;  1I0C A;  3QKJ A;  4BE2 A;  4M77 G;  1BIB A;  4C8Q D;  2K5F A;  1UGQ B;  1QP2 A;  1ARK A;  2DJZ A;  1MV0 B;  4HVU A;  4E7S A;  2VVK A;  2H8H A;  2K7A A;  2Y90 A;  1PRL C;  2YDL A;  1KHI A;  1VQL A;  4ME7 A;  1BCO A;  4M7D D;  1LOJ A;  2CKK A;  4ZGE B;  1VA7 A;  2X51 A;  4BI4 A;  1MV3 A;  2J6K A;  1PSE A;  3RKY A;  1TH7 A;  3EGD A;  1ZSG A;  3DB3 A;  1VQ6 T;  1I5O B;  3M0T A;  4C92 F;  3OYB A;  3CPW S;  3JCM V;  3AT1 B;  2F2W A;  1YJN A;  2HQE A;  3FLG A;  4FT2 A;  3WVD B;  2CP7 A;  4Y28 E;  1PRM C;  1UGV A;  3EFR A;  5CR2 A;  2W0Z A;  4C92 G;  2L8D A;  4M7A A;  4C8Q C;  5D6W A;  5GJV B;  2AZS A;  2EWN A;  3QII A;  4UC4 A;  3CPW A;  2ECZ A;  4N0A C;  2EYX A;  1TS9 A;  1NM7 A;  2JVV A;  1BI0 A;  3MEU A;  1QVF S;  3UA6 A;  3OYE A;  2IVW A;  3PNW C;  1KFZ A;  1FMK A;  4C5H A;  4F7U F;  2V8J A;  5A0G A;  4DQ2 A;  3MO8 A;  2CZ0 B;  2AZV A;  1W2B A;  2HQX A;  1WYX A;  3CCV A;  5L8R E;  2BZ8 A;  1YJW T;  1YFN A;  1QVF A;  1RAC B;  2KGT A;  1D0Y A;  1Q82 U;  3OMC A;  3QPH A;  2EBP A;  1H92 A;  1RAI B;  2L3Q A;  2P84 A;  1QWF A;  2HQH A;  1Q7Y U;  2DLP A;  4ZTJ A;  2DJQ A;  4M75 F;  3CD6 A;  4F04 B;  2JTE A;  3JCM g;  2YUQ A;  1T3L A;  5KYY A;  3EHR A;  3I9Q A;  1Q86 C;  4D8K A;  1YIT A;  1Z9Z A;  1K9A A;  4MMK A;  1U1S A;  2HKQ B;  1YWO A;  4XQ3 A;  1TWB A;  5GMK h;  2LNH B;  1KC8 U;  4LXC A;  2EPD A;  5CKB A;  4JJB A;  1I07 A;  2M0O A;  1JO8 A;  1MMA A;  1M1K U;  2FYK A;  4OMM A;  2F2X A;  2KT8 A;  4XU0 A;  4XTZ A;  3HRS A;  2YLC A;  3G1J A;  1N6A A;  2DD4 A;  2O4X A;  1I81 A;  2KRM A;  2A08 A;  1ZQ1 A;  2X4W A;  3OYA A;  3I55 A;  5KE3 A;  3RIR A;  3NPF A;  1KQS P;  2G6F X;  4LD6 A;  4V2S A;  4AFQ C;  3G6E Q;  3VS4 A;  2Y4Y A;  2DBM A;  2O88 A;  4PLL A;  2JN0 A;  4FYX B;  5IXF A;  3E9F A;  2M16 A;  3N5B B;  3I56 A;  1UHF A;  4WTO B;  4C0F A;  1YJN T;  3TSW A;  4M7D C;  1AZE A;  4JRQ A;  5CIU A;  3V7R A;  1IHW A;  1H8K A;  5FWC A;  3CCS T;  4M77 E;  3PIP A;  3KXT A;  2LQN A;  3JCM P;  4FSX A;  2VV5 A;  5LJ5 j;  3RMQ A;  3BW1 A;  2QEX T;  2DRM A;  4M78 F;  1YIT T;  4XTU A;  1X75 C;  2LJ0 A;  4ELY C;  4A53 A;  2H3E B;  2LT1 A;  4RTY A;  4C0D B;  4KUD K;  2VXF A;  1VQN T;  4RTV A;  3S6W A;  3PVQ A;  1BI3 A;  3GIB A;  3EG0 A;  1MND A;  1ZUU A;  4OB0 B;  3H0I A;  4ESR A;  2CRE A;  2EIF A;  3J7A F;  1RI9 A;  2HSE B;  2NUT A;  2HD0 A;  1YNZ A;  3U23 A;  3X26 B;  2K5I A;  2QEX Q;  3JCM e;  2VXE A;  3EG3 A;  2R57 A;  1OUL A;  2KYB A;  2WSE E;  4M77 C;  1M2O A;  4QVD A;  1YCY A;  1M9S A;  1FWZ A;  1E6H A;  2QTV A;  4OB3 B;  5HK0 A;  3CME Q;  2HZY A;  5J39 A;  1VIE A;  2KVQ G;  1IB8 A;  4PJO G;  2DBK A;  2L3S A;  2DF6 A;  2OTJ A;  2FPF A;  2WAC A;  1RAD B;  3V8L A;  3CBP A;  2K9G A;  1ZHI A;  2X4J A;  4AG1 C;  2PTK A;  3VUZ A;  4DBH A;  1X27 A;  2ESW A;  2ZPE B;  3SWN B;  2ZPI B;  2FG0 A;  1W2B S;  1UHC A;  5I2S A;  2ED0 A;  5HY6 A;  4J9D A;  1JEG A;  4M75 G;  1W70 A;  2CP3 A;  4QKU A;  2B8A A;  5KCH A;  3CCM A;  5CKH A;  4RUG A;  3JB9 J;  4MML A;  3H6Z A;  3CCM T;  4E7H A;  4NOY A;  2LNV A;  1Q95 G;  2RPN A;  2FHD A;  1WI7 A;  1UEB A;  1NYF A;  1V76 A;  3HRT A;  2VB6 A;  4BUG A;  4J8O A;  3VRY A;  3V7C A;  2O31 A;  3CC7 Q;  3ZFJ A;  1YHQ A;  1IRE B;  5DY9 A;  3RUX A;  4HT9 A;  4PKC C;  3OBY A;  3QUI A;  1T0J A;  3CME A;  3LGF A;  1I8F A;  1M3B A;  1PC0 A;  3NTK A;  2ED1 A;  2DXU A;  3I5S A;  4FL6 A;  2M1H A;  1WXU A;  1GFD A;  5IAY A;  3G71 T;  4LDU A;  2ZGW A;  3CC7 T;  1Y96 B;  1WXT A;  2CGH A;  2H3J A;  4LDV A;  3QWY A;  1W1F A;  3LX7 A;  2O9V A;  2F2V A;  2HMA A;  2XKO C;  1M30 A;  5FU6 C;  4KUL A;  3OS1 A;  2RI3 A;  1WXB A;  3VYH B;  4CC3 A;  3JCM b;  4KH1 B;  2L2P A;  4LDW A;  1QVF P;  1M1G A;  1NG2 A;  4C92 A;  2RM4 A;  5A0D A;  2FRW A;  4X34 A;  2Y4X A;  4CC7 A;  1VQP T;  4JLG A;  2YSQ A;  2VUB A;  4M77 F;  4PJJ A;  1PD0 A;  1SRL A;  4F7U G;  1UB4 A;  4CC2 A;  3RMS A;  5GAN 3;  3OYG A;  4M77 A;  2EQK A;  2E41 A;  4LUE A;  3H41 A;  4ZNX A;  1NJI C;  1RUW A;  1Q7Y R;  1WHH A;  3CCM Q;  4JZ4 A;  3CC2 A;  3UAT A;  4NL3 A;  1ZLM A;  4RTZ A;  5FW9 A;  2L3R A;  2AKK A;  1MNE A;  2K3X A;  4C8Q B;  4M7D G;  4BDZ A;  1QKW A;  3M56 A;  2D6F A;  3OYJ A;  3CPF A;  2K6D A;  6AT1 B;  4E6R A;  1M90 C;  5GAO p;  2YRD A;  4BY6 C;  1VQN A;  3HKS A;  2QA4 T;  1D09 B;  2DL7 A;  3CCR T;  4M75 D;  2DYB A;  2PQW A;  2IPO B;  1Q81 R;  3NFC A;  2CT4 A;  3HSB A;  2ATC B;  2MOX A;  2P4T A;  4XU3 A;  1NLP C;  2GQI A;  5GJW B;  4WCI A;  1RAA B;  1YIJ Q;  4F7U A;  1M27 C;  3F70 A;  3EG2 A;  4QQD A;  2V8I A;  1KSW A;  2QQA A;  2EJF A;  5IHN A;  4LDY A;  4PJL A;  2CSI A;  1G3T A;  1KHC A;  5GAO m;  4JPB W;  4C0Z A;  3CCU Q;  2LDM A;  4PJO B;  1JXM A;  3LGL A;  2COY A;  5GAN h;  1W6X A;  4GY5 A;  1M2V A;  1S72 T;  4PFO A;  5GAN 6;  3NMZ C;  2YHT A;  3P8D A;  4HVV A;  4MZP A;  3OS5 A;  3CCQ A;  3GF5 A;  1S72 A;  3CC4 A;  2DL3 A;  4WF2 A;  3WVE B;  1C6V X;  2KMT A;  4LD9 K;  8ATC B;  1VUB A;  5LJ5 f;  2DTH A;  4J6W A;  3EHQ A;  4JS4 A;  4C0G A;  1LNX A;  1VIF A;  4EMK A;  2CZ6 B;  5C6S A;  3CMA Q;  2XI9 A;  1JXO A;  5GAM h;  2MAM A;  4N4H A;  1TTH B;  3OW2 A;  5GAN 8;  3MEA A;  2A36 A;  1MMG A;  3IQL A;  2BIV A;  4M77 D;  2DZC A;  1T0H A;  1AWJ A;  1WDX A;  2BKD N;  2PUO B;  3CCV Q;  2J6O A;  4FIB A;  2KBT A;  4LUD A;  3RNJ A;  5FRM A;  3RR6 A;  3G6E A;  3TEE A;  1NJI R;  4C92 C;  2YUO A;  2KK4 A;  2JMA A;  2KQW A;  1EFN A;  2ZPG B;  4EIK A;  3OB9 A;  4M75 C;  2EAY A;  4FW2 A;  5LJ3 j;  2RI5 A;  2RHZ A;  3L1A A;  4D8D A;  1LVK A;  1OX8 A;  2P4R A;  2X3W D;  3KBG A;  4QT7 A;  2EGE A;  1KIK A;  4O5V A;  2KEA A;  4F14 A;  2QGG A;  3JB9 G;  4HCZ A;  1VQM Q;  2RN8 A;  1YP5 A;  4OGE A;  2RHU A;  2RH2 A;  2HCK A;  1K8A R;  3CQT A;  2ABL A;  2A37 A;  4J9F A;  3QBY A;  3CCE A;  1LCK A;  2RJC A;  3OYL A;  4ANJ A;  1YIJ A;  4C8Q A;  5KYW B;  4C92 E;  4M78 D;  2DL5 A;  2DAQ A;  3H0F A;  3M9Q A;  1FMW A;  2KT1 A;  2LJ1 A;  2O4X B;  5GMK m;  2JS2 A;  2DX1 A;  1BB9 A;  2J6F A;  3JCM W;  2YLB A;  4ORZ A;  3EGU A;  2RJD A;  5GAO l;  2LCL A;  1BI1 A;  3BDL A;  1VQK A;  3QSU A;  2QTX A;  4RTU A;  3CC7 A;  4XTX A;  2CH4 A;  3M5A A;  2K4Y A;  3GP8 A;  1VQ5 T;  1R8O B;  2DK3 A;  1AOJ A;  2QYZ A;  1JB0 E;  2YRV A;  1VQ4 A;  2X9H A;  1CSK A;  2JNG A;  1G5V A;  2RO0 A;  3G4S Q;  4RMO A;  2DA9 A;  4EMK C;  5GAO n;  2YRC A;  1OU8 A;  1V1C A;  1OI1 A;  1ZBX A;  1Y0M A;  3PFS A;  2RK2 A;  5CCA A;  5M9O A;  4AT1 B;  1UGR B;  2QGF B;  2Z0W A;  1EZZ B;  3I5R A;  1K76 A;  4M77 B;  1OV3 A;  1KD1 R;  4N4G A;  3T9N A;  2JTF A;  4C8Q G;  3P8B B;  5HKC A;  1M8M A;  4JJD A;  1X6B A;  1T3S A;  3JRZ A;  3QWX X;  2MWP A;  4MDX A;  4BI8 B;  1YWP A;  1HYO A;  3M0U A;  3A8G B;  1TUD A;  1Q82 R;  1K4U S;  1GL5 A;  3EH2 A;  1O9S A;  3E2U A;  4AG2 C;  2RJE A;  1M3A A;  5FU7 C;  4LN2 A;  1AT1 B;  2G3R A;  4NL2 A;  2HDA A;  5EC7 A;  1KG1 A;  2CP2 A;  4IIO A;  4IUR A;  2GNC A;  3R6N A;  4AFU C;  4M7A B;  1G8X A;  3EGX B;  2LCC A;  2X4X A;  4A4K A;  1X6O A;  3SHW A;  2YXY A;  3M58 A;  4DEX A;  2DM1 A;  4N0A A;  2K3Y A;  5LJ3 g;  2VGM A;  1QW1 A;  3MHX A;  5LJ5 e;  4OVA A;  2E12 A;  2EYQ A;  3LH0 A;  2M02 A;  2FPD A;  3H0H A;  4QVZ A;  5CKF A;  3NTH A;  1IHV A;  5GAN 5;  3L2W A;  2CZ7 B;  3JCM f;  4X1V A;  4C0D C;  2LZ6 B;  3GBQ A;  2M0Y A;  2DNU A;  1IO6 A;  1BYM A;  1U1T A;  3X20 B;  3SWN A;  4HA8 A;  2JW4 A;  2R58 A;  4F16 A;  1PSF A;  2L5Q A;  2XDB A;  2QQ9 A;  2FEI A;  1RLQ C;  3HHT B;  4MZT A;  5KYN A;  2RNA A;  3DB4 A;  2JZ2 A;  1Q82 C;  2VGN A;  3G71 Q;  4QQG A;  1MMD A;  1B07 A;  3CC4 T;  3VS2 A;  2CDT A;  2RQR A;  1RAE B;  3QYG B;  1AD5 A;  1SRM A;  3MKD A;  1M1K R;  1WFW A;  2GFA A;  9ATC B;  1WHL A;  3MJX A;  1YJ9 A;  2HEQ A;  2PVD B;  3THK A;  3FRN A;  1N27 A;  1QVG A;  4JLI A;  3OSV A;  2A3L A;  1XJW B;  2C06 A;  1B34 A;  2DRK A;  4FSS A;  3OYN A;  5GAM g;  1N8R U;  4JRI A;  2EJ9 A;  1D3B A;  1RAF B;  2F5T X;  2KE9 A;  2PNI A;  2JM8 A;  4RTT A;  2EFI A;  2ENM A;  2SRC A;  3OW2 P;  4DBF A;  1NPR A;  3D7S B;  5KYX B;  3TSZ A;  1K8A U;  2F1L A;  2QAS A;  1S72 Q;  2NUP B;  1TUC A;  7AT1 B;  1TUG B;  5AYF A;  1X69 A;  5CK9 A;  2XG8 D;  3QZ9 B;  2LT4 A;  1LPL A;  2JUF A;  1V29 B;  2AK5 A;  2DE0 X;  2OJ2 A;  2LX9 A;  3E9G A;  2GCX A;  3VYG A;  2KAF A;  4KGZ B;  5LJ3 e;  2V26 A;  2XHC A;  1FXX A;  2NYS A;  1WHJ A;  3I55 T;  3MCA B;  3VS6 A;  3QO3 A;  2EQJ A;  5A2Q E;  3OYD A;  1YJW A;  1NPP A;  1VOM A;  4PJO C;  2GFU A;  2DXB A;  4E47 A;  3L42 A;  4FYY B;  3SWN C;  3ZL7 C;  1VQP Q;  4HCB A;  3MEW A;  4KGV B;  5CKD A;  3AHU A;  5CQX A;  1G83 A;  1HSQ A;  4PJO A;  4A63 B;  4FCY A;  2J05 A;  1JJ2 S;  1VQK T;  1NBE B;  2DET A;  2NLU A;  2FPE A;  3A1P A;  1SG5 A;  2O9S A;  5LJ5 h;  1UG1 A;  3A5Z B;  1VQ5 Q;  2P0K A;  1UEC A;  1WGS A;  2VC8 A;  1VQ5 A;  3M55 A;  3CBO A;  2YUP A;  3LYI A;  5LJ3 d;  5GAN 7;  5CQY A;  1H3Z A;  4M78 A;  2LJ3 A;  1PHT A;  1F1B B;  5KYY B;  4JRK A;  2HBP A;  3S3O A;  3UF4 A;  2RA2 A;  2WSC E;  1UJY A;  1CKB A;  4M75 A;  2DZ9 A;  4AFS C;  1N5Z A;  3CCQ T;  1R77 A;  2EYZ A;  3JB9 H;  4OP0 A; 
#chains in the Genus database with same CATH homology
 3HFN A;  2XK0 A;  1B34 B;  3HL8 A;  1VQO T;  1M90 C;  4CRI A;  4IKF A;  4PJO D;  2XU8 A;  5GAO p;  2FL7 A;  1QP3 A;  3HRU A;  1OYX A;  2PVG B;  1XOV A;  2EQU A;  5D6Y A;  2FVU A;  4BY6 C;  1UGS B;  2ZZD A;  2XDP A;  2M9U A;  1VQN A;  3HKS A;  2QA4 T;  5DLQ E;  1M4Z A;  2DTO A;  5GMK e;  3OBW A;  5GAN g;  4ZTF A;  2KDS A;  3GNG A;  5GAN d;  4J5Y A;  5LJ5 g;  1W2B A;  5LJ5 d;  2OTL T;  4DOV A;  4M7A C;  2V8K A;  3BY7 A;  3G7Z A;  3PT9 A;  4M75 D;  3CXC A;  3CCR T;  3A8O B;  1KQS A;  5KE2 A;  2PQW A;  1M5Q 1;  5GAM j;  1WQ7 A;  3PGG A;  1K8A C;  3NFC A;  4VUB A;  4M7A G;  3S3N A;  3HSB A;  3FC3 A;  1Q7Y C;  2D9T A;  4BE0 A;  2P4T A;  2LTO A;  4XU3 A;  1N9S A;  4M78 B;  5EG2 A;  4F7U A;  4C5E A;  3F70 A;  3CCL A;  2R5A A;  5HK3 A;  3QKJ A;  1XTD A;  4BE2 A;  4M77 G;  2XIC A;  1BIB A;  3OYY A;  2LVM A;  4QQD A;  2V8I A;  4O6J A;  3X25 B;  3R6O A;  4B9X A;  4C8Q D;  3GPL A;  2QQA A;  2EJF A;  4B9W A;  2AHJ B;  4LDY A;  2K5F A;  1WJR A;  1UGQ B;  1QP2 A;  4LDX A;  2DJZ A;  1G3T A;  3C12 A;  1I4K 1;  3G4S T;  4HCC A;  2RI2 A;  1KHC A;  4E7I A;  5GAO m;  4L59 A;  1Y71 A;  4C0Z A;  2DEQ A;  2LDM A;  2Y90 A;  4PJO B;  1KHI A;  3LGL A;  5GAN h;  1VQL A;  4ME7 A;  4GY5 A;  4M7D D;  1S72 T;  1LOJ A;  1XNI A;  2CKK A;  4FM4 B;  1YBY A;  5GAN 6;  2YHT A;  2LQ8 A;  3P8D A;  2OAU A;  4MZP A;  3OS5 A;  3URG A;  2RHY A;  3GF5 A;  4BI4 A;  3CCQ A;  1S72 A;  3CC4 A;  4WF2 A;  3WVE B;  4QVC A;  2KMT A;  1PSE A;  4LD9 K;  3RKY A;  1TH7 A;  1VUB A;  1KC8 C;  1X01 A;  5LJ5 f;  5GMK l;  2DTH A;  4J6W A;  5GAN f;  4JS4 A;  3DB3 A;  4C0G A;  1LNX A;  1VIF A;  2LRQ A;  2CZ6 B;  4C92 F;  4EMK A;  2XI9 A;  5C6S A;  3OYB A;  3CPW S;  2FB7 A;  2E1H A;  5IN1 A;  5A0L A;  2E6N A;  5GAM h;  4C5I A;  2MAM A;  4Q5W A;  3JCM V;  5GAN 2;  4N4H A;  1YI2 A;  3OYH A;  1YJN A;  2HQE A;  3FLG A;  3OW2 A;  5GAN 8;  4FT2 A;  3MEA A;  3WVD B;  4A4G A;  4L5G A;  5GMK j;  1GXI E;  3RKW A;  3FEO A;  4Y28 E;  3P8H A;  3PMT A;  5LJ3 h;  3EFR A;  5CR2 A;  3OQ5 A;  2BIV A;  4M77 D;  4PJO F;  2DZC A;  4JS5 A;  1VQM T;  2XD0 A;  5GAM f;  4C92 G;  5CO7 A;  5KH6 A;  2BKD N;  2L8D A;  2PUO B;  4M7A A;  1Y96 A;  4C8Q C;  5D6W A;  3CCU T;  2EWN A;  2JOY A;  3ASK A;  3QII A;  4UC4 A;  3C94 A;  4FIB A;  3CPW A;  5FRN A;  1VQ6 T;  4E7L A;  4N0A C;  5FRM A;  4XU1 A;  4M7A D;  3G6E A;  5LJ3 f;  4BDY A;  3OSS C;  3DLL A;  2JVV A;  1BI0 A;  3CEY A;  3MEU A;  1G3Y A;  3TEE A;  1QVF S;  3OYE A;  4C92 C;  2IVW A;  4KBM B;  4DOW A;  3CME T;  3X24 B;  3PNW C;  4XU2 A;  1U8R A;  2KK4 A;  4RKU E;  2KQW A;  3E19 A;  4C5H A;  2V8J A;  1G3S A;  4F7U F;  1Y7X A;  2ZPG B;  2CZ0 B;  3MO8 A;  3MP1 A;  3OB9 A;  4M75 C;  2HQX A;  4DQ2 A;  4FU6 A;  2EAY A;  3QDR B;  5LJ3 j;  3CCV A;  5L8R E;  2RI5 A;  2RHZ A;  2MF2 A;  3L1A A;  3MP6 A;  4JDS A;  4PNO A;  1YJW T;  2RHX A;  5D6X A;  3KBG A;  4BY6 B;  2E64 A;  3X28 B;  1QVF A;  2E6Z A;  4O5V A;  4A4H A;  3VJP A;  3JB9 G;  4HCZ A;  1EIF A;  4R56 A;  2DXC A;  1Q82 U;  3HPW A;  4M7D F;  4HT8 A;  3VKI A;  4OGE A;  3OMC A;  2RHU A;  3QPH A;  2E10 A;  2RH2 A;  4M7D A;  2P0P A;  2ZPB B;  2LC4 A;  5GAN e;  4L6V 5;  1Q81 C;  3M57 A;  2CS7 A;  1Q7Y U;  4PLI A;  2E5Q A;  4ZTJ A;  3JB9 I;  4XTW A;  1QVG S;  3QBY A;  3CCE A;  3CMA T;  2RJC A;  5GAN j;  4M75 F;  3CD6 A;  3OYL A;  3JCM g;  3VUB A;  1KD1 U;  2DIG A;  2F69 A;  1YIJ A;  4IUP A;  4C8Q A;  2IG0 A;  3MP8 A;  1VQ7 A;  1Q86 C;  5GAM e;  4C92 E;  4M78 D;  4C92 D;  1NJI U;  2DAQ A;  2DIQ A;  1YIT A;  3OYM A;  1IZ6 A;  2K5L A;  4MMK A;  1U1S A;  3M9Q A;  4OMF B;  4QQ6 A;  4YTL A;  5FU6 B;  3CCS A;  1KQ1 A;  2DO3 A;  2HNI A;  4XQ3 A;  2O4X B;  3QG1 A;  2QDY B;  5GMK m;  5GMK h;  4XK8 E;  3UWN A;  2RK1 A;  2QQB A;  1KC8 U;  2WSF E;  1AHJ B;  2E65 A;  3TRE A;  3JCM W;  3OYG A;  5CKB A;  2YLB A;  3V8K A;  2RJD A;  5GAO l;  2DD5 A;  1VQM A;  2QEX A;  1VQO A;  2LCL A;  1BI1 A;  3BDL A;  1KD1 C;  4ATO A;  1VQK A;  1OZ2 A;  3TCJ A;  2GF7 A;  2RD1 A;  2M0O A;  2DTI A;  2QTX A;  3A8M B;  3CC7 A;  1M1K U;  2L89 A;  3QSU A;  3WXM B;  2FYK A;  4XTX A;  4A54 A;  3BDU A;  2A7Y A;  4XU0 A;  3GLX A;  3M5A A;  2K4Y A;  3ME9 A;  4XTZ A;  3HRS A;  3GP8 A;  2YLC A;  1R8O B;  2DK3 A;  1VQ4 T;  1VQ5 T;  3CCR A;  2EQM A;  1N6A A;  2DD4 A;  2O4X A;  2YRV A;  1JB0 E;  1I81 A;  1VQ4 A;  3JB9 D;  3JCM h;  1ZQ1 A;  2X4W A;  2JNG A;  1NE8 A;  5CVI A;  5KE3 A;  3OYA A;  3I55 A;  2RO0 A;  3RIR A;  5GAO r;  1G5V A;  4RMO A;  4LD6 A;  4V2S A;  3KUF A;  4EMK B;  4J7I A;  4KT0 E;  2Y4Y A;  4EMK C;  5GAO n;  1K73 U;  3OY9 A;  4PLL A;  2JN0 A;  3CCL T;  1OI1 A;  2QQS A;  1ZBX A;  3E9F A;  3PFS A;  3OW2 S;  2RK2 A;  5CCA A;  5M9O A;  4M78 C;  2M16 A;  4QW2 A;  2LQK A;  1VQ6 A;  1UGR B;  3N5B B;  3I56 A;  3QHS A;  2GQV A;  2O01 E;  3S3M A;  2RJF A;  3CXC S;  4X9D A;  1MHN A;  4C0F A;  2PU9 B;  4E7K A;  1YJN T;  4M7D C;  4M77 B;  4OB1 B;  4C5G A;  3DLM A;  4ZGJ B;  3G4S A;  4N4G A;  4M7D B;  3T9N A;  4JRQ A;  2RHI A;  2JTF A;  3QJ6 A;  5CIU A;  4C8Q G;  3P8B B;  5HKC A;  3A8L B;  3V7R A;  3CCS T;  4M7A F;  3C95 A;  3DKM A;  4M77 E;  3L2U A;  2QQR A;  3JRZ A;  5CKE A;  3PIP A;  1BIA A;  4A4E A;  2MWP A;  4MDX A;  3KXT A;  3JCM P;  4C8Q E;  4FSX A;  4OB2 B;  2VV5 A;  4BI8 B;  1Q81 U;  5LJ5 j;  3FJP A;  3A8G B;  3BW1 A;  4MDW A;  3RES A;  3RMQ A;  4EMG A;  5FRO A;  2QEX T;  4M78 F;  2D0Q B;  1YIT T;  3LWH A;  1UGP B;  4XTU A;  1X75 C;  4ELY C;  3QXE B;  3O8V A;  3INZ A;  4EPC A;  1O9S A;  2F5K A;  4A53 A;  3QZ5 B;  4P5N A;  2LT1 A;  2RJE A;  5FU7 C;  4C0D B;  2G3R A;  2VXF A;  4KUD K;  1VQN T;  1BI2 A;  1VQP A;  4NL2 A;  4M75 E;  3FIF A;  3S6W A;  4JUV A;  1BI3 A;  4TVR A;  3JCM d;  1LJO A;  2OTL A;  3GIB A;  1KG1 A;  4II1 A;  4IUR A;  4OB0 B;  2QI2 A;  4M7A B;  1G3W A;  2EIF A;  2X35 A;  2LCC A;  5I2M A;  2X4X A;  3J7A F;  4A4K A;  1VQL T;  2ZCF B;  2HD0 A;  1X6O A;  1JJ2 A;  2DXT A;  3M58 A;  3X26 B;  4BI3 A;  3CCV T;  3LLR A;  2K5I A;  3NTI A;  4N0A A;  3E1S A;  3JCM e;  2CYZ B;  2K3Y A;  3ER0 A;  2VXE A;  5LJ3 g;  1VQ9 A;  3OYI A;  2R57 A;  3ZEH A;  3LW5 E;  2VGM A;  2WSE E;  3L2V A;  4M77 C;  1QW1 A;  3MHX A;  4PJO E;  4QVD A;  3SFM A;  3MET A;  2BUD A;  1YCY A;  4C92 B;  5LJ5 e;  1M9S A;  1FWZ A;  2E12 A;  4IUT A;  3GNF B;  4OVA A;  2EYQ A;  4OB3 B;  3BFM A;  3LH0 A;  4D6W A;  3CD6 T;  1VQ8 T;  5HK0 A;  5J39 A;  1VIE A;  2KVQ G;  1QVP A;  2VYT A;  4PJO G;  4QVZ A;  1YIJ T;  5CKF A;  3J81 E;  3NTH A;  2CZ1 B;  5GAN 5;  3CC2 T;  3L2W A;  4A4F A;  1M1K C;  2CZ7 B;  4N4I A;  5FU7 B;  3JCM f;  2OTJ A;  4C0D C;  3CCE T;  1Y07 A;  2WAC A;  3V8L A;  1O75 A;  4OF1 A;  3CBP A;  3JAM E;  1BYM A;  1U1T A;  3X20 B;  3SWN A;  1ZHI A;  2X4J A;  4HA8 A;  1K73 C;  4M78 E;  2MWO A;  3VUZ A;  2R58 A;  3EFS A;  3HP9 A;  4JJN K;  3OMG A;  2ZPE B;  1PSF A;  3SDZ A;  3OYC A;  3SWN B;  2ZPI B;  2L5Q A;  4GLK A;  4IUQ A;  4BE1 A;  3G6E T;  2XDB A;  1W2B S;  2QQ9 A;  4FT4 A;  5I2S A;  5C0M A;  1K9M C;  4KUI A;  4MZT A;  3HHT B;  4RG2 A;  4M78 G;  1WQW A;  2ZPH B;  5HY6 A;  3CCJ T;  3PTA A;  3DB4 A;  1P92 A;  2JZ2 A;  1NZ9 A;  1Q82 C;  4BB7 A;  3UDC A;  2VGN A;  4M75 G;  4QQG A;  3CCJ A;  3A8H B;  4ZN3 A;  4JRP A;  2B8A A;  5DM7 R;  3JB9 F;  3CC4 T;  5KCH A;  3CCM A;  2QA4 A;  5CKH A;  3RER A;  3JCM X;  4XTY A;  1RI0 A;  3JB9 J;  4F7U E;  5LL6 S;  4MML A;  3H6Z A;  4XTV A;  1JBM A;  3QYG B;  3CCM T;  5DLO A;  4E7H A;  2K57 A;  4NOY A;  1XQH A;  2LNV A;  2PUK B;  2GFA A;  1K9M U;  4J6X A;  2FHD A;  4NS5 A;  1D3B B;  1YJ9 A;  1Q86 U;  1UEB A;  2PVD B;  2X4Y A;  5J26 A;  3HRT A;  4IUU A;  1YJ9 T;  3FRN A;  1N27 A;  3VV0 A;  1QVG A;  4JLI A;  4BUG A;  4MZM A;  3OSV A;  2A3L A;  2DPP B;  3OS2 A;  4J8O A;  2C06 A;  1B34 A;  3V7C A;  3OYK A;  3OYN A;  5GAM g;  1N8R U;  4JRI A;  3ZFJ A;  2EJ9 A;  3M54 A;  1YHQ A;  4M7D E;  1D3B A;  1VQ9 T;  2F5T X;  4IUV A;  3L2R A;  1IRE B;  3M4G A;  3UPU A;  4M75 B;  5DY9 A;  2KSS A;  2EFI A;  2MI6 A;  3RUX A;  2E70 A;  3VU3 C;  4HT9 A;  2K2V A;  4PKC C;  3OBY A;  3QUI A;  4F7U B;  3J80 E;  4ELZ C;  3CME A;  2KY9 A;  1I8F A;  2EJG A;  3LGF A;  1VQ8 A;  4J83 A;  4RCB A;  3JCM c;  2I2L A;  4CI0 C;  3CMA A;  3NTK A;  3OA6 A;  4DA4 A;  3L2Q A;  3LWI A;  1NPR A;  2DXU A;  1FX7 A;  4FL6 A;  3M53 A;  4ZN1 A;  2M1H A;  4ZGD B;  3OS0 A;  1K8A U;  1HK9 A;  2RB6 A;  3SB2 A;  3M4Y A;  2OTJ T;  3SD4 A;  3OYF A;  4BAC A;  3I56 T;  2JTM A;  5KCO A;  5IAY A;  3G71 T;  4X9C A;  2HAX A;  1HXD A;  4LDU A;  2ZGW A;  1KQ2 A;  4M7A E;  5AYF A;  5CK9 A;  2XG8 D;  3H8Z A;  3CC7 T;  3QZ9 B;  3CCU A;  2LT4 A;  1Y96 B;  1JRI A;  2CGH A;  1H64 1;  2H3J A;  2JUF A;  2MMP A;  4R55 A;  1V29 B;  1MGQ A;  1VQ7 T;  3ZBD A;  2LX9 A;  4LDV A;  3E9G A;  2GCX A;  4E7J A;  3VYG A;  4ZGE B;  2KAF A;  3LX7 A;  5LJ3 e;  1W4S A;  4J7F A;  2XHC A;  1M8V A;  1FXX A;  3GOX A;  2EKO A;  5IT9 E;  3I55 T;  3MCA B;  3JCM J;  2XKO C;  5FU6 C;  4KUL A;  3JSC A;  2DVE A;  3OS1 A;  2RI3 A;  3VYH B;  3QO3 A;  3JCM b;  4XAX B;  3HFO A;  2EQJ A;  4OGC A;  2ZPF B;  4LDW A;  4PL6 A;  4Z02 A;  1YI2 T;  1M1G A;  4C92 A;  5A0D A;  2RM4 A;  5I21 A;  2DKG A;  5A2Q E;  3OYD A;  1YJW A;  5GAO q;  1DJ7 B;  1NPP A;  4PJO C;  5J3B A;  3CBM A;  1RL2 A;  3EAE A;  4X34 A;  2GFU A;  4EMH A;  2Y4X A;  2DXB A;  4E47 A;  5A0G A;  1OZ3 A;  1WJS A;  3L42 A;  1VQP T;  3V7S A;  3SWN C;  4C8Q F;  3UT1 A;  4JLG A;  1YHQ T;  1N9R A;  1SSF A;  4HCB A;  3MEW A;  3TU4 K;  1WPY A;  2VUB A;  4M77 F;  5CKD A;  3V8J A;  4EDU A;  3AHU A;  5CQX A;  4F7U G;  1UB4 A;  4PJO A;  5GMK i;  3RMS A;  1JJ2 S;  1VQK T;  4RCC A;  2R5M A;  1WNL A;  4M77 A;  3C4S A;  2NLU A;  5LJ5 h;  2EQK A;  5GAN 3;  2E41 A;  3PMI A;  3Q1J A;  2QXF A;  3QYH B;  1NJI C;  3A5Z B;  4BD3 A;  2XID A;  1M1F A;  2P0K A;  2PVO B;  1WGS A;  3QJY A;  1M90 U;  2VC8 A;  5GAN 4;  1VQ5 A;  3CC2 A;  4NL3 A;  3M55 A;  2XDD A;  3FDR A;  3CBO A;  3G71 A;  3LYI A;  5LJ3 d;  5GAN 7;  1N8R C;  1BKB A;  2L3R A;  5CQY A;  1H3Z A;  4M78 A;  5CAI A;  2K3X A;  5FLX E;  1I5L A;  4C8Q B;  4JRK A;  2HBP A;  4HKE A;  3S3O A;  2RA2 A;  2WSC E;  3JCM Q;  4M7D G;  4M75 A;  2DZ9 A;  4BDZ A;  3PIO A;  4Y91 A;  5GAM d;  3L2Z A;  3M56 A;  4RG8 A;  3MEV A;  2D6F A;  3M59 A;  3RKX A;  3CCQ T;  3FB9 A;  1WJQ A;  2P0Q A;  3OYJ A;  3JB9 H;  3CPF A;  4OP0 A;  1KQS S;  4J6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...