2RK2A

Dhfr r-67 complexed with nadp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
NATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydrofolate reductase type 2
publication title Crystal structure of a type II dihydrofolate reductase catalytic ternary complex.
pubmed doi rcsb
total genus 12
structure length 58
sequence length 58
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2007-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rk2A00
3T9NA 1VIFA 3SFMA 3UDCA 2RK2A 2RH2A 2RK1A 2OAUA 2P4TA 1VIEA 2VV5A 2GQVA
chains in the Genus database with same CATH superfamily
4BY6B 4L59A 1X27A 4IUPA 2RQRA 3CCEA 5GAN7 2DL5A 2QXFA 3HFNA 1WIEA 1M1FA 4JLIA 1Q82C 1NYGA 1M9SA 1UTIA 2MOXA 3UA7A 2RJCA 1RAFB 1JB0E 3H8ZA 1QW1A 2HAXA 1AOJA 4F14A 2RI3A 1VQMA 1PD0A 2CZ1B 4OGEA 2J6OA 2FL7A 1PD1A 4KBMB 2EPDA 3QYHB 3CCMQ 2HBWA 2LJ0A 5HK3A 4C8QC 4A4FA 1TU0B 4EMGA 1U06A 3G4ST 4V2SA 3D7SB 3INZA 3J80E 1SF9A 1Y07A 4M77B 1C6VX 2O4XA 1K0SA 2CH4W 1Q86C 2RJEA 4M77E 5GANf 3OYGA 4FSSA 3JCMc 4PJMA 4EIKA 4IIMA 4EPCA 5GAMg 3CC7A 1HJDA 5LJ5g 1WHKA 1I4K1 2EGCA 1TTHB 2BZ8A 1QLYA 4HVUA 4FW1A 2KDSA 3S6WA 2DTIA 4K11A 4BI3A 1PM3A 4JZ3A 3CBOA 1Q81R 3SWNC 1IGQA 4R56A 2RQUA 3MHXA 2VXFA 2K9GA 3EH1A 2JTMA 1GCQA 3OYNA 2DIQA 2LVMA 1H3ZA 2KQWA 3KFVA 3C94A 2K4YA 3JCMe 2R5AA 1UFFA 2O31A 1MNDA 1ZBXA 1ZSZC 1MMGA 2K2VA 2OTJQ 3LGLA 1UJYA 3CCJA 1H641 1JBMA 1KD1U 1SPKA 4C92D 2DERA 1VQMT 3RKXA 1VQ7T 3LX7A 4X9CA 4RTWA 4ZNXA 4D8DA 1VQNQ 3PGGA 2DZ9A 3H0IA 2D8JA 3CBPA 1IREB 4J6YA 4F7UG 3VJPA 1UEBA 1WHMA 3CC2T 4OB3B 2QQAA 3HRTA 2AIRB 4PK4A 4BDYA 1SHFA 3VKIA 2DD4A 5GAOp 1GXIE 2CDTA 1LJOA 2DIGA 5C6SA 4EMKA 1YNZA 2M9UA 1IRXA 2EQKA 4C0DB 2LT1A 2X4XA 1IZ6A 2XKOC 4FIBA 4F7UA 3CCVQ 1RI9A 2QQRA 1G3TA 1R0CB 3JCMh 2K7AA 1YI2T 3V8JA 3QJ6A 3JB9G 4AFUC 3OYDA 2EKOA 4C0ZA 2KEAA 3EG2A 2OTLT 3QDRB 4M77F 2VB6A 3CCMA 1EX4A 4EMHA 2XDPA 5FU7B 2RNAA 3L1AA 1I5OB 2K79A 4IUQA 4D8KA 2DKGA 2KRNA 3CCUQ 3WXMB 3C95A 4BE2A 1JO8A 3VS3A 4E7HA 2EWNA 2C0OA 3EG0A 5IXBA 1OEBA 4C92C 1WNLA 3QWXX 1D1CA 1WX6A 1K9MR 4NOYA 4HCCA 2XICA 1AVZC 2EYZA 1K8AC 3NHNA 1M90U 3RERA 4NL2A 1WHGA 2O01E 3VS1A 4ZTJA 3KUFA 1D1AA 2LCLA 5GAN2 3EH2A 3I55T 1P92A 3GF5A 5C0MA 3RMQA 2A36A 1R0BG 3V8KA 3OY9A 4A4HA 4XU1A 1H8KA 4BUGA 1SEMA 4J6XA 2QDYB 1OULA 1OU9A 3TSWA 2F1LA 4XK8E 2OTJA 8AT1B 4JZ4A 4JJCA 2GF7A 3CCRT 1VQPQ 3NTKA 2WSFE 2XG8D 5CKFA 3JCMW 3OMCA 1KD1C 2PNIA 3O5ZA 3MP1A 4QVZA 4JRKA 1UGVA 1J3TA 3HHTB 2JNGA 1ZSZA 2ZCFB 1R8OB 2RPNA 4JDSA 6AT1B 1WYXA 3CCVA 5CKHA 2COWA 4PJLA 3OYLA 2DL8A 2OX7A 2CP6A 1WHJA 5GAN8 2YRDA 4Z89A 1IO6A 1YIJT 3REAB 2YUOA 2EIFA 2VKNA 1MGQA 3QG1A 4M78D 3QHSA 1VQOQ 2R58A 3HRUA 3HPWA 1QCNA 2YUQA 5EG2A 3CCUA 2KI7A 3ZFJA 2FRYA 2CSQA 2R5MA 3VV0A 5HCKA 4E7IA 3SFMA 2RF0A 1YJ9T 5IHKA 3EGXA 2RI5A 2M0OA 1C1AA 3QJYA 4IURA 1K73R 2D8HA 2QI2A 4C92G 3OS2A 2HBPA 2FPFA 4QQDA 2LRQA 3EG1A 1ZHIA 4RTTA 3PIPA 1VQNT 1VQ5Q 1HK9A 1PSFA 4EMKB 2CGHA 2FB7A 3NTHA 3I56Q 4C92A 3GBQA 2ROLA 1NBEB 4F7UB 4JS5A 3PMIA 2YT6A 2E5KA 4F7UE 2AZSA 1VQ8Q 1KC8C 1QVFA 3O8VA 3OB9A 4Z8AA 2KXDA 3HSBA 4F04B 2K2MA 4WCIA 5GANg 1ZUYA 2MWOA 4NL3A 1KQSA 1KHCA 3CPFA 1VQPA 4DBFA 4B6MA 3M0RA 2E4HA 1T3SA 3EFOA 3RDVA 1VQ9T 1UG1A 2V8IA 1IHWA 2XK0A 3EFRA 4PKCC 4RTUA 5KYXA 4E7LA 2KRSA 2YHTA 3V7CA 3CC4T 4BE1A 1MV0B 3RKWA 1VQ4Q 3V7SA 5A0LA 2SEMA 2A0FB 3RBBB 2EYQA 2H3JA 3JRZA 4FM4B 2JMCA 1N6AA 2EJGA 4HKEA 2RK1A 2MPXC 4OMNA 1LNXA 2EQUA 1RUWA 1PWTA 5FROA 3S3MA 3A8MB 3TQ7P 2QQSA 4ZN1A 4RTZA 4Q5WA 2CZ0B 4PLLA 2WSCE 2P84A 1SRMA 1OPKA 2F2VA 3FLGA 3M53A 3SDZA 3BDLA 1UGRB 2GFAA 2GTJA 4F7UF 4KT0E 3VU3C 3G4SQ 5IT9E 1QVFP 1VQ5A 5IH2A 1NE8A 8ATCB 3EGDA 1KQSP 4KH0B 1ZLMA 4M7AD 1Y57A 1QP3A 5GAN3 1VQKT 3H0FA 5I2SA 2E3IA 2FPDA 1W70A 3ULRB 1VQ8A 2WACA 1E7OA 1WGSA 3JB9F 1QQJA 2DL4A 1O9SA 1OOTA 1ZQ1A 2DLPA 1N8RR 1VQ6Q 3C12A 1M2VA 2KY9A 3CD6Q 4DEXA 3E2UA 1K76A 4M78G 2J7IA 1Q82U 2XDBA 2HSPA 2EW3A 2DMOA 1VQOT 4LDXA 1M27C 2VASA 2QGGA 4X9DA 2DVJA 1K0XA 1RAIB 1QWFA 2HQXA 2L3RA 3EGXB 1TUGB 4AG2C 3UA6A 1VQ4A 3DKMA 4M78A 3OQ5A 2E6NA 5IHNA 4C5HA 1KG1A 2XHCA 2E1HA 2E64A 4M7DC 5KYNA 4J5YA 2PU9B 3NTIA 1AZGB 4O5VA 4OMPA 3PTAA 2XIDA 4PJJA 4RCBA 5FRNA 2QGFB 1MNEA 5DY9A 5KCHA 2HMAA 3G1JA 3LGFA 5HK0A 4ME7A 4XTZA 3I56T 1EZZB 1VYTA 1M30A 2ROTA 3PNWC 1YI2Q 1UHCA 2KBTA 1U8RA 2F2WA 4X1VA 1VQ8T 1SHGA 4XAXB 4D6WA 1WA7A 1W1FA 5CQYA 2V26A 2ZPBB 1RABB 2GQVA 3EFOB 4KGVB 1VOMA 1GFDA 3G71Q 1QCFA 1WXUA 3G4SA 5CIUA 2HEQA 2CREA 4JRIA 2RQWA 4OB0B 4JS4A 2I0NA 3NMZC 3JSCA 2GTOA 1G5VA 5IN1A 3CCLQ 4C8QD 2HZYA 3PT9A 4JUVA 5LJ3e 2L0AA 5CR2A 1E6GA 3LLRA 1D0ZA 2DXBA 3P8DA 1V29B 3OYKA 4FYWB 2JM8A 4CRIA 1BB9A 5FU6C 1B34B 1DJ7B 1NM7A 1WDXA 2NUZA 4OMQA 1ZSGA 5GAMd 3I55Q 5LJ5d 2YUPA 1KQ2A 1M3AA 4B9XA 3C0CA 4RG8A 2VGMA 2JT4A 4QQGA 2K57A 2ZZDA 4AMCA 1M1GA 1Y0MA 2LC4A 2OI3A 2ED0A 4GY5A 2R57A 2YWWA 1YWOA 2K3XA 5LJ3h 1Q7YR 3LH5A 1M1KR 3R6OA 1ABQA 4IIOA 2DZCA 2PUKB 2GGRA 3CCRQ 2JW4A 1MMAA 4XTYA 2L5QA 2DTOA 2FHDA 1VQ7A 2VV5A 2E6ZA 3HFOA 4MMKA 2YDLA 3EHRA 1RAGB 2ATCB 2DXCA 2M0YA 3CEYA 3Q1JA 4B9WA 3CCSQ 3AT1B 4FU6A 3EGDB 3CC2A 4C5IA 4PJOC 4LDWA 2P4RA 3U23A 5I11A 4Y28E 2LJ1A 4M7AG 2JN0A 4OMFB 2YLCA 2X3XD 1YI2A 2BIVA 1K8AU 4J9BA 1MHNA 3REBB 4AT1B 2K5LA 2KVQG 4E7SA 1ARKA 4M7AA 1Y7XA 3FJPA 1WXBA 1M2VB 2OTLA 4DBHA 5IAYA 1R77A 1YIJQ 1AWXA 2D0NA 4FSXA 1VQ6T 2YUNA 3OS0A 1N9SA 3CMEQ 4UC4A 2BE9B 3CD6T 3MP8A 2CSIA 4OVAA 4F16A 3EGUA 3OYYA 1OYXA 4E2FB 2FZKB 4OMOA 1NJIR 2RHUA 3QSUA 1YWPA 4M78B 3FEOA 1FWZA 3M0PA 2JXBA 1YJ9Q 4M78E 1Q86R 3E19A 3H6ZA 1M4ZA 2O9SA 3THKA 4RMOA 2DILA 1O75A 2DXTA 3I55A 4OP0A 2D0QB 2KR3A 2KRMA 2QYZA 5A2QE 2F69A 3VS4A 2BKDN 4JPBW 3HP9A 2FYKA 4ELZC 4BACA 4KUIA 1QMCA 2AKKA 1CKAA 3FC3A 3MKDA 5KYUA 1NYFA 2YRCA 2AK5A 3DB3A 2K5IA 3JCMJ 2QA4A 5GAN4 2ESWA 2XMFA 2Y4XA 4FYXB 3UPUA 1NPRA 4MZMA 2LX9A 2LNVA 4PJNA 3CCRA 1ZA1B 2LTOA 3OW2S 3L2QA 2NUPB 3JCMf 3FIFA 5CVIA 3EG9A 5L23A 1M3CA 1FMVA 2MMPA 2OJ2A 1G3YA 2E65A 1VQ9Q 3CCSA 2HQHA 1IGUA 3T9NA 3G71T 1QKWA 1G2BA 1M8VA 2HSEB 4M75C 1RAAB 1QVFS 3MO8A 2CP0A 1S72T 1KQSS 1X01A 1UUEA 3P8BB 1OU8A 3JCMX 3CC4Q 4C8QG 3CCLT 4WTOB 5GAOq 4YTLA 3MP6A 1YJWQ 3MEVA 3LYIA 4ELYC 3AHUA 4C8QA 2IVWA 3CPWS 2BTTA 4FT2A 1YIJA 2YRVA 3H41A 1BBZA 2DBMA 2RHXA 5I21A 2M16A 3RUXA 1HXDA 4MMLA 2CS7A 4M78F 3WVEB 2JVVA 2EVRA 5GAOr 1XOVA 1BKBA 1OZ2A 5GMKe 3PVQA 1KC8U 1PCXA 1JJ2A 1TG0A 2JOYA 5CQXA 1YJ9A 2CUBA 5GMKi 1BI2A 1WZOA 2QG9B 3SWNA 5LJ3d 2G6FX 1BU1A 1RAHB 2J05A 1VQNA 2SRCA 1V1CA 4ZGEB 3CCST 2KK4A 3OYCA 3OSSC 3CQTA 1QVGA 2O4XB 4ZGDB 1SRLA 1VQKQ 2DYBA 5KCOA 1WI7A 3OYMA 4OGCA 2RMOA 5GMKh 3RIRA 3BY7A 3N5BB 4RUGA 3A1PA 4MZTA 4J9IA 3MEAA 4M7AB 4JLGA 1AWOA 4BDZA 2RM4A 3GNGA 1KQ1A 4M7AE 2O9VA 1WJRA 3PE0A 4PFPA 4JRPA 1G83A 4DOVA 1OX8A 2B86A 2DRMA 4LDVA 3E9FA 4GLKA 1VQ9A 4R0KA 1VYVA 2DVEA 4BY6C 1G3SA 1LVKA 5GANd 2DK3A 3CMET 3HTRA 1KD1R 1K73C 1N5ZA 1PHTA 5EC7A 3CC4A 1NG2A 1AT1B 4ESRA 4OB1B 4XU3A 4J7FA 2DFUA 3X26B 4CC2A 5FLXE 4RTYA 1GCPA 3VS2A 2QEXT 2RQTA 2DTHA 2KT1A 2MK5A 1VQLQ 4PFOA 1B3QA 5CKBA 3SB2A 1FYNA 1JJ2P 2DXUA 2CZ6B 3BW1A 3EHQA 2B8AA 3OW2A 1K1ZA 1WJQA 2HL5C 1TSFA 2KXCA 3MEUA 3F70A 4M77C 1RLPC 3M57A 3UATA 5CAIA 3JCMb 4J9FA 2QQBA 2J6KA 1HYOA 3JB9H 3RESA 5GAMe 5LJ5e 2EJ9A 1UGSB 2GNCA 1QVGP 3EG9B 4Z88A 2G3RA 3DB4A 2H3EB 3M9QA 3BDUA 2C06A 5KYWA 4E47A 2EYYA 3I5RA 2F5TX 3QO3A 1M90R 4M7AF 1VQKA 2J06A 3CPWA 1X6GA 2RHYA 1B7TA 2IPOB 5D7UA 2FO0A 2NUTA 2KSSA 3M56A 2F5KA 3G6ET 4J9DA 4N4HA 4C8QB 5GAMh 3L2RA 2V8KA 2Z0WA 5LJ5h 1YJWT 4C8QE 1B07A 3VS5A 1YFNA 1WFWA 3JCMQ 2MWPA 2V1RA 1RI0A 2HNIA 3I5SA 5GMKm 2LNHB 4LD6A 3X25B 1VQOA 1IB8A 3QZ5B 1X43A 3JB9J 3SD4A 4HVWA 1TH7A 2XU8A 2GCXA 1GL5A 3GP8A 4RTXA 4J9HA 2E5QA 2A37A 2AZVA 1W2BS 2CP5A 3SWNB 3OW2P 2DRKA 1WLPB 3R6NA 2RN8A 2M1HA 4M7DD 5FU7C 3FDRA 2NLUA 1ACMB 1T3LA 3JCMg 2ECZA 4CC4B 4FL6A 1YP5A 4HCBA 1ZSZB 3M4GA 4KRTA 4QW2A 3I56A 4OMLA 2EAYA 3CXCS 1N8RC 5M9OA 1AWJA 4IUTA 4JJBA 2RH2A 2JS2A 3UWNA 2DETA 1WHLA 3ZL7C 4ZTFA 2KE9A 3TCJA 3PFSA 2EQJA 2PTKA 3CPWP 1TOVA 1WPYA 1PC0A 1OZ3A 1WQ7A 3NFCA 3LW5E 1G8XA 3CCQQ 2XD0A 2DD5A 2ZPIB 5GAOm 1TWBA 2M02A 4C8QF 2KNBB 5I22A 3VYHB 4MDWA 2AHJB 5FWBA 2MIOA 3OYJA 1I81A 4MDXA 4HT8A 5LJ3j 5DM7R 1YITQ 1OQKA 2RI2A 1Q95G 1PKTA 2EYWA 2PZ1A 3LWHA 1TXQA 2RD1A 2MAMA 4MZPA 1BCMA 3CCEQ 4PL6A 4Y91A 2FEIA 2LT4A 1VQLT 1X6OA 4J9GA 3QXEB 5J3BA 2X51A 5GJVB 3P8HA 1EFNA 2AT1B 1YJNT 3QYGB 2DE0X 4C92B 2ZPGB 2EQIA 2F2XA 4C92E 1Q81U 2DJZA 2W10A 1TUDA 7AT1B 4HA8A 3MEWA 1NJIU 2CT3A 2YLBA 1JXOA 1GBRA 2O88A 3CMAT 1OPLA 1YBYA 3M0UA 2ZPHB 4N4GA 4QVCA 3V8LA 3PMTA 5KYWB 4DQ2A 4XTUA 3X24B 3QKJA 2DJQA 2Y4YA 1OI1A 1HSQA 2QK0A 4M4ZA 3QUIA 3RMSA 1GCQC 1TS9A 2VXEA 4FCYA 2VUBA 2DEUA 5KYXB 2KYMA 1S72Q 2AKLA 5GJWB 1VYUA 2VGNA 2NUTB 4EDUA 2DF6A 4PJOD 2K3BA 1YHQT 1I07A 1WXTA 1YCYA 2PQWA 2YSQA 3M0SA 4E7JA 1UHFA 4R55A 1MV3A 1NLOC 2KROA 4A4GA 1F1BB 1VQ6A 4KGZB 2MYSA 2CT4A 3ME9A 4HCKA 1W2BA 1M1KC 3CD6A 5GAN6 2FG0A 1I1JA 2O2OA 2JJ9A 1LCKA 4LN2A 1U1SA 3H0HA 4EMKC 3EFSA 2HDAA 1X2QA 5KE3A 3J7AF 3GLXA 4OB2B 2EGAA 3JCMP 5ECAA 4KULA 1UGPB 1AEYA 2BZYA 2MCNA 4WF2A 5GANe 3OYIA 5LJ3f 2CUDA 3CXCA 2FVUA 4C92F 4OF1A 1K9MU 1PG5B 2RJFA 3JV3A 1BI1A 1JJ2S 4ZN3A 2P0QA 1JRIA 4M7DG 1UE9A 1BCOA 3UDCA 4CI0C 3VS6A 1ZUKA 2LDMA 4LUDA 5D6XA 2LP5A 2EGEA 4M7DA 1Q81C 2JTEA 1WQWA 5IHIA 3VRYA 3L2ZA 1Q82R 2FZCB 2DL3A 1QVGS 1I5LA 2E41A 1NJIC 2E12A 5GANh 1M8MA 2P0KA 2I2LA 3UF4A 5IXFA 4OMMA 1I8FA 2FRWA 2L8DA 4JJNK 3E9GA 3G71A 2VYTA 4PLIA 2RHIA 2EYXA 1S72A 3CCQT 2QQ9A 4DOWA 1WJSA 3CCLA 2OAUA 3DLMA 4M75D 3TVTA 2EFIA 2PVDB 1ZX6A 1W2BP 2QEXQ 4FW2A 2CKKA 2JS0A 2JUFA 4QT7A 4QVDA 1YITT 5KE2A 3M58A 2QA4T 2FPEA 2LMJA 2HD0A 2JMAA 4F17A 2LCSA 3H9NA 3CCET 9ATCB 4LUEA 1CSKA 2COYA 4ATOA 4GLMA 3GOXA 2CP7A 1NLPC 1H92A 4C5GA 3GNFB 4RG2A 1SG5A 2QTXA 3KBGA 2ZAEA 2L3QA 4J6WA 1BYMA 3CXCP 3NGPA 2A08A 3BFMA 4O6JA 1BIAA 4E7KA 3VYGA 5GMKj 5J26A 3JAME 1PRLC 2D9TA 3I9QA 3X28B 1XTDA 2CP3A 3TREA 4HXJA 5DLOA 3FB9A 4BI4A 1IHVA 4IUVA 3PIOA 5A0GA 1X2KA 2M51A 3QZ9B 2V8JA 3V7RA 1K73U 2JTFA 1U5SA 1K9MC 4A53A 2ED1A 4XTXA 3CC7T 2RQVA 2HKNA 2E70A 2J6FA 3MJXA 4J8OA 2HCKA 4CC7A 4DEYA 1FX7A 3J81E 3G6EQ 4PJOG 2GQIA 1AHJB 4J9EA 2LQNA 1KSWA 4DA4A 1H3HA 1HD3A 3OBYA 1Y71A 2KAFA 3L2VA 2X35A 2KMTA 2W0ZA 5KYYA 1YN8A 3LH0A 4PJOA 3G7ZA 3QDFA 4Y92A 3M0QA 3DLLA 2X3WD 3CMEA 1D1BA 3QIIA 2MF2A 4KUDK 1XNIA 2EJFA 4XTWA 2HKQB 3TU4K 1LPLA 1D3BA 1WHHA 2CZ7B 3CCJT 2L2PA 3BE3A 3S3OA 5DLQE 2QEXA 4L5GA 4ZGJB 4LDYA 2HL3A 4AG1C 2LZ6B 1KJWA 4BB7A 2COZA 2OAWA 1X69A 3L2UA 1GBQA 4RKUE 3LWIA 1MUZA 2DM1A 1Y96A 1K8AR 4LXCA 1PSEA 5CCAA 2E10A 3PVLA 1QKXA 2PUOB 3ZEHA 4M7DB 1VUBA 1MMNA 1NZ9A 4J7IA 1UJ0A 4M7DE 2DPPB 2ENMA 4FT4A 4N0AC 1PKSA 3M4YA 2E3HA 4M77D 2CP2A 5GAMj 3CCMT 2RHZA 5LJ5j 2L3PA 1D09B 2LCCA 2QAZA 2CYZB 3X20B 1EIFA 5FW9A 5HY6A 3ER0A 2EBPA 2EKHA 4AFQC 1UB4A 3MPUB 3VUZA 3S3NA 1A0NB 1QCOA 4A4EA 4RTVA 4M75G 3E1SA 4N4IA 3G6EA 1FXXA 2DL7A 2X9HA 4JRQA 2VVKA 1YJWA 4NS5A 5AT1B 4X34A 3A8HB 3UT1A 1I0CA 3C4SA 5FRMA 5A0DA 4XTVA 4M75A 2V1QA 1RLQC 3SEMA 5LJ3g 1YJNQ 1SSHA 5CKEA 1KHIA 4RCCA 4GBQA 1N8RU 1VA7A 4LE9A 1AZEA 5AYFA 1ZA2B 5KYUB 2CH4A 1IXDA 4Z02A 5FU6B 4J9CA 2BZXA 2OTJT 1BK2A 2PVOB 3M59A 2Y90A 1JU5C 3RR6A 2YXYA 3CMAQ 4QQ6A 2KYBA 1M90C 1YCSB 4BD3A 2GBQA 1M2OA 4AFSC 1T0JA 1PRMC 4JJDA 2P4TA 5CKDA 4ORZA 4M7DF 1K9AA 1AWWA 2EQMA 2XI9A 2K3YA 3HKSA 3CCVT 4A54A 3GPLA 1YHQQ 2X4WA 4HCZA 1JXMA 4M78C 2K5FA 4XU2A 1QVPA 3WVDB 3JCMd 4LNPA 5GAOn 5L8RE 3OA6A 3ASKA 2DAQA 3A5ZB 1KC8R 5KYYB 4PJOB 3M0TA 3M55A 1X75C 4PJOE 5GAMf 4IUUA 4II1A 2ZGWA 4E6RA 1SSFA 5LJ5f 1BI3A 2LQ8A 1NPPA 3CCUT 1BIBA 1JQQA 2DO3A 3VS0A 3SHWA 2A3LA 1UDLA 1D3BB 3MCAB 2FZGB 3OS5A 2DBKA 4N0AA 1RL2A 5CK9A 1NEGA 4KGXB 1VIEA 4C0DC 4A63B 3JCMV 4E7ZA 5GMKl 1QP2A 1B34A 2D6FA 1UGQB 2L89A 2HQEA 5FWCA 1RADB 1VQLA 1UECA 2NWMA 1XQHA 1Y96B 2BE7D 2RB6A 4XQ3A 2JM9A 1YJNA 1FMWA 2RO0A 1GRIA 3OYBA 5D6WA 1KFZA 2MI6A 2DEQA 3JB9I 3QPHA 5KH6A 2QASA 1C0MA 1RAEB 4C0FA 1VQPT 3CMAA 1U1TA 4BE0A 2VWFA 2IG0A 1RACB 5I2MA 2DNUA 2D1XA 4J83A 2A28A 4M77G 1Q7YU 2LQWA 1M1KU 1KK7A 3QBYA 1FMKA 3OYFA 1OV3A 4FYYB 3IQLA 3OYAA 1M5Q1 2RJDA 4M77A 2BUDA 3HRSA 4TVRA 2P0PA 2DX1A 2IIMA 1ZBJA 3OYHA 4HT9A 3RNJA 1YHQA 4PJOF 3L2WA 2K6DA 1E6HA 4BI8B 1K4US 3M54A 2QTVA 2QA4Q 5D6YA 5GAOl 2X4JA 4M75B 1M3BA 2VC8A 5CO7A 4M75E 1KIKA 4P5NA 3QWYA 3OBWA 2GFUA 1W4SA 1QWEA 2ZPEB 2C0TA 1W6XA 3A8GB 4HVVA 4IKFA 4C0GA 4DBQA 3L42A 1Z9ZA 2KGTA 3OS1A 2LX7A 1CKBA 4C5EA 1NEBA 2DA9A 2X4YA 1VQMQ 2KT8A 1VQ7Q 3HL8A 1LOJA 1T0HA 3NPFA 1X6BA 3ZBDA 3M5AA 1S1NA 2H8HA 4PNOA 4M7AC 1ABOA 1OX9A 3CC2Q 1U3OA 1Q86U 3TEEA 3OYEA 4DBRA 1SKUB 1VQ5T 3FJ5A 5GANj 2JZ2A 1PNJA 4AFZC 1TUCA 2PVGB 3EG3A 2L3SA 3META 3KXTA 2QDLA 2C0IA 1GFCA 3VUBA 1JEGA 3CC7Q 4XU0A 4VUBA 1XJWB 3TSZA 1BI0A 2NYSA 1Z9QA 3JB9D 1N27A 1D0YA 2A7YA 3EAEA 2ABLA 4L6V5 3RKYA 4PFZA 2OTLQ 1MMDA 2LQKA 2NUPA 4FYVB 4QKUA 1V76A 3A8OB 1AD5A 2DYIA 2ZPFB 2WSEE 1VIFA 2RK2A 3I35A 3OSVA 3A98A 3VRZA 3GIBA 3FRNA 5HKCA 1Q7YC 4LD9K 5LL6S 4CC3A 3CCQA 1G3WA 4ANJA 4LDUA 1VQ4T 5J39A 3A8LB 3CCJQ 4M75F 5GAN5 2RA2A 2XDDA 3VS7A 1D0XA 1N9RA 3URGA 1YITA 1ZUUA 3OMGA 4A4KA 2LJ3A 3CBMA 4KH1B
chains in the Genus database with same CATH topology
4BY6B 3CC7T 2E70A 5CKBA 4L59A 3SB2A 4IUPA 1VQ8A 2WACA 3CCEA 2DXUA 5GAN7 4J8OA 2CZ6B 3BW1A 1WGSA 3JB9F 2QXFA 3HFNA 1FX7A 3J81E 4PJOG 2B8AA 1AHJB 3OW2A 1WJQA 1M1FA 1O9SA 1ZQ1A 4JLIA 4DA4A 1Q82C 3MEUA 3OBYA 1Y71A 2KAFA 3F70A 1M9SA 4M77C 3M57A 3L2VA 3C12A 2X35A 5CAIA 3JCMb 2KMTA 2RJCA 2QQBA 2KY9A 3JB9H 1JB0E 3RESA 4PJOA 3LH0A 3H8ZA 5GAMe 1QW1A 3G7ZA 2HAXA 2RI3A 5LJ5e 1VQMA 2CZ1B 4M78G 4OGEA 3DLLA 2EJ9A 1Q82U 2XDBA 2FL7A 3CMEA 1UGSB 1VQOT 3QIIA 2MF2A 4KBMB 3QYHB 4LDXA 4KUDK 2G3RA 1XNIA 3DB4A 2EJFA 4X9DA 5HK3A 4XTWA 4C8QC 3M9QA 3BDUA 3TU4K 2L3RA 2HQXA 4A4FA 1D3BA 4EMGA 2C06A 3G4ST 1VQ4A 4V2SA 3DKMA 4M78A 2CZ7B 4E47A 3INZA 3OQ5A 2E6NA 4C5HA 3CCJT 1KG1A 3S3OA 2XHCA 5DLQE 3J80E 1Y07A 2E1HA 4M77B 2O4XA 4M7DC 2QEXA 1Q86C 2F5TX 2RJEA 3QO3A 4J5YA 4L5GA 4M77E 4ZGJB 4LDYA 5GANf 2PU9B 1N8RC 1VQKA 3NTIA 4M7AF 3OYGA 3CPWA 3JCMc 4EPCA 3CC7A 5GAMg 5LJ5g 4O5VA 4BB7A 2RHYA 4M7DA 3PTAA 2XIDA 1I4K1 4RCBA 3L2UA 5FRNA 4RKUE 2KSSA 3LWIA 3M56A 2F5KA 5DY9A 5KCHA 1Y96A 3G6ET 4N4HA 4C8QB 5GAMh 3L2RA 1PSEA 2V8KA 2KDSA 3LGFA 2DTIA 3S6WA 5CCAA 5HK0A 5LJ5h 1YJWT 2E10A 4C8QE 4ME7A 4XTZA 4BI3A 3I56T 2PUOB 3CBOA 3PNWC 3ZEHA 3SWNC 4R56A 4M7DB 1VUBA 1NZ9A 3JCMQ 3MHXA 4J7IA 2VXFA 2MWPA 1U8RA 1RI0A 1VQ8T 4M7DE 2DPPB 2HNIA 2JTMA 4FT4A 3OYNA 4XAXB 4D6WA 5GMKm 4LD6A 4N0AC 2DIQA 5CQYA 2LVMA 3X25B 1VQOA 3M4YA 4M77D 2ZPBB 3QZ5B 1H3ZA 2KQWA 3JB9J 3C94A 3SD4A 2GQVA 2K4YA 3JCMe 2R5AA 2RHZA 5GAMj 3CCMT 5LJ5j 1TH7A 2LCCA 1ZBXA 3X20B 2CYZB 2XU8A 1EIFA 2GCXA 3G4SA 3GP8A 2K2VA 5CIUA 3LGLA 3CCJA 2E5QA 4JRIA 4OB0B 4JS4A 1JBMA 1H641 5HY6A 1W2BS 3ER0A 3JSCA 1KD1U 4C92D 3SWNB 1G5VA 5IN1A 1VQMT 3RKXA 4C8QD 1VQ7T 3LX7A 4X9CA 1UB4A 4JUVA 3PT9A 5LJ3e 3VUZA 5I2SA 5CR2A 3PGGA 3S3NA 2DZ9A 3LLRA 3CBPA 2M1HA 1IREB 2DXBA 4J6YA 3P8DA 1V29B 4F7UG 3VJPA 1UEBA 3OYKA 4A4EA 3CC2T 4M7DD 4OB3B 2QQAA 3HRTA 4BDYA 5FU7C 3FDRA 2NLUA 3E1SA 4M75G 2DD4A 4N4IA 3JCMg 1FXXA 3VKIA 4CRIA 5GAOp 3G6EA 1GXIE 4FL6A 1LJOA 2DIGA 5FU6C 4EMKA 5C6SA 2M9UA 4JRQA 1YJWA 4HCBA 2EQKA 3M4GA 4QW2A 4C0DB 1B34B 1DJ7B 2LT1A 2X4XA 1IZ6A 4NS5A 3I56A 2XKOC 4X34A 2EAYA 3A8HB 4FIBA 4F7UA 5M9OA 3UT1A 3C4SA 5GAMd 2QQRA 1G3TA 3CXCS 4IUTA 3JCMh 5LJ5d 5FRMA 1YI2T 5A0DA 3V8JA 1KQ2A 4B9XA 2RH2A 4XTVA 4M75A 3UWNA 3QJ6A 3JB9G 4RG8A 5LJ3g 3OYDA 2EKOA 2VGMA 5CKEA 1KHIA 4QQGA 2K57A 4C0ZA 2ZZDA 4ZTFA 3TCJA 1M1GA 3PFSA 4RCCA 1N8RU 2LC4A 2EQJA 2OTLT 3QDRB 4M77F 4GY5A 3CCMA 5AYFA 2R57A 4EMHA 2XDPA 5FU7B 1WPYA 2K3XA 5LJ3h 3L1AA 4Z02A 5FU6B 2OTJT 1OZ3A 3R6OA 1WQ7A 4IUQA 2DKGA 3NFCA 3LW5E 2DZCA 2PVOB 3M59A 2PUKB 3C95A 2Y90A 3WXMB 4BE2A 2XD0A 2DD5A 2ZPIB 4XTYA 4QQ6A 4E7HA 2L5QA 2EWNA 2DTOA 2FHDA 5GAOm 2VV5A 1VQ7A 2E6ZA 3HFOA 4MMKA 4C8QF 1M90C 4BD3A 3VYHB 2DXCA 1WNLA 2AHJB 4MDWA 3CEYA 3Q1JA 4B9WA 4C92C 4FU6A 3OYJA 1I81A 4MDXA 4HT8A 3CC2A 4NOYA 4C5IA 2P4TA 5CKDA 5LJ3j 5DM7R 4HCCA 4M7DF 2XICA 4PJOC 2RI2A 4LDWA 1K8AC 1M90U 3RERA 4NL2A 2O01E 3LWHA 4ZTJA 4Y28E 2EQMA 2RD1A 3KUFA 2MAMA 4MZPA 4M7AG 2JN0A 2XI9A 4PL6A 4Y91A 2LT4A 1VQLT 2K3YA 2LCLA 3HKSA 3CCVT 5GAN2 1X6OA 3I55T 3QXEB 5J3BA 4OMFB 2YLCA 1P92A 4A54A 3GPLA 1YI2A 2BIVA 3GF5A 3P8HA 5C0MA 1K8AU 3RMQA 2X4WA 3V8KA 3OY9A 1MHNA 4HCZA 4M78C 1YJNT 2K5FA 3QYGB 2K5LA 1QVPA 2KVQG 4XU2A 3WVDB 4A4HA 3JCMd 4M7AA 1Y7XA 3FJPA 4C92B 2ZPGB 4XU1A 2OTLA 4BUGA 5L8RE 5GAOn 4C92E 1Q81U 5IAYA 4J6XA 3OA6A 3ASKA 2DAQA 3A5ZB 2QDYB 2DJZA 4PJOB 4FSXA 3M55A 1VQ6T 1X75C 4HA8A 1N9SA 4IUUA 3MEWA 4II1A 4XK8E 2ZGWA 4UC4A 1SSFA 5GAMf 5LJ5f 2OTJA 1BI3A 3CD6T 3MP8A 1NJIU 2GF7A 2LQ8A 1NPPA 2YLBA 4OVAA 1BIBA 3CCUT 2DO3A 3CCRT 3OYYA 1OYXA 3CMAT 1YBYA 2ZPHB 3NTKA 2WSFE 2XG8D 4N4GA 2A3LA 4QVCA 3V8LA 2RHUA 1D3BB 3MCAB 3PMTA 3QSUA 5CKFA 3OS5A 3JCMW 4M78B 3OMCA 3FEOA 1FWZA 1RL2A 4N0AA 4DQ2A 4XTUA 3X24B 5CK9A 3QKJA 1KD1C 4M78E 2Y4YA 3E19A 1OI1A 3MP1A 1VIEA 3H6ZA 4QVZA 1M4ZA 4JRKA 4C0DC 3HHTB 3QUIA 3JCMV 3RMSA 2VXEA 2JNGA 5GMKl 2VUBA 1QP2A 1B34A 2ZCFB 1R8OB 2D6FA 1UGQB 2L89A 2HQEA 4JDSA 4RMOA 1VQLA 1O75A 2VGNA 2DXTA 3CCVA 4EDUA 3I55A 4OP0A 5CKHA 2D0QB 1XQHA 1Y96B 4PJOD 5A2QE 3OYLA 1YHQT 2F69A 2BKDN 2RB6A 3HP9A 4XQ3A 1YJNA 2FYKA 1YCYA 2RO0A 4ELZC 2PQWA 4BACA 5GAN8 4E7JA 3OYBA 4KUIA 4R55A 5D6WA 4A4GA 3FC3A 1YIJT 2MI6A 2DEQA 2EIFA 3CBMA 3JB9I 3DB3A 2K5IA 3QPHA 3JCMJ 1VQ6A 5KH6A 4M78D 1MGQA 3QG1A 3QHSA 5GAN4 3ME9A 2R58A 3HRUA 2Y4XA 1W2BA 1M1KC 3CD6A 3UPUA 3HPWA 1NPRA 5EG2A 4MZMA 5GAN6 3CCUA 4C0FA 2LX9A 2LNVA 3CCRA 1VQPT 3CMAA 1U1TA 2LTOA 3ZFJA 4BE0A 3OW2S 2IG0A 3L2QA 5I2MA 1U1SA 3JCMf 4J83A 4EMKC 4M77G 2R5MA 3FIFA 5CVIA 3VV0A 3EFSA 4E7IA 1Q7YU 3SFMA 2MMPA 1G3YA 2E65A 1M1KU 3CCSA 5KE3A 1YJ9T 3J7AF 3GLXA 4OB2B 3T9NA 3QBYA 3G71T 2RI5A 2M0OA 3JCMP 1M8VA 4KULA 4M75C 1QVFS 1UGPB 3MO8A 3QJYA 4IURA 3OYFA 3OYAA 2QI2A 1M5Q1 2RJDA 4M77A 4WF2A 1S72T 5GANe 1KQSS 1X01A 3OYIA 4C92G 3P8BB 2BUDA 5LJ3f 3HRSA 4TVRA 3OS2A 2HBPA 3JCMX 2FVUA 2P0PA 4C8QG 3CXCA 4QQDA 2LRQA 4C92F 3CCLT 4OF1A 1K9MU 5GAOq 1ZHIA 2RJFA 3OYHA 3PIPA 4YTLA 1BI1A 3MP6A 4HT9A 1VQNT 1JJ2S 4ZN3A 1HK9A 1PSFA 4PJOE 2P0QA 1JRIA 1YHQA 4PJOF 3L2WA 4EMKB 2CGHA 2FB7A 3NTHA 4BI8B 3MEVA 3M54A 4M7DG 3LYIA 4ELYC 4C92A 3AHUA 4C8QA 4F7UB 4JS5A 3PMIA 3UDCA 5D6YA 2IVWA 4CI0C 3CPWS 5GAOl 4FT2A 1YIJA 4F7UE 2X4JA 4M75B 2YRVA 2VC8A 2LDMA 1KC8C 1QVFA 5CO7A 2RHXA 3O8VA 3OB9A 5D6XA 5I21A 4M75E 2M16A 3RUXA 4P5NA 3HSBA 1HXDA 3OBWA 2CS7A 4MMLA 4M78F 2GFUA 5GANg 1W4SA 4NL3A 2MWOA 1Q81C 2ZPEB 1KQSA 1WQWA 1KHCA 3WVEB 3CPFA 3L2ZA 2JVVA 1VQPA 5GAOr 1XOVA 1BKBA 3OS0A 3A8GB 1OZ2A 5GMKe 4IKFA 1KC8U 4C0GA 1JJ2A 3L42A 1QVGS 1I5LA 2E41A 1NJIC 2E12A 5GANh 3OS1A 2JOYA 2P0KA 2I2LA 1VQ9T 5CQXA 1YJ9A 1I8FA 4C5EA 4JJNK 2L8DA 2V8IA 3E9GA 2X4YA 2VYTA 3G71A 2XK0A 4PLIA 3HL8A 5GMKi 1BI2A 1LOJA 2RHIA 3EFRA 4PKCC 4E7LA 3ZBDA 3M5AA 1S72A 2YHTA 3V7CA 4PNOA 3SWNA 3CCQT 4M7AC 5LJ3d 3CC4T 2QQ9A 4DOWA 1WJSA 3CCLA 4BE1A 1Q86U 2OAUA 3DLMA 3TEEA 3OYEA 3RKWA 3V7SA 4M75D 5A0LA 1VQNA 2EFIA 1VQ5T 5GANj 2JZ2A 4ZGEB 2PVDB 3CCST 2PVGB 3META 2EYQA 2KK4A 3OYCA 3KXTA 3OSSC 1QVGA 2O4XB 2CKKA 2H3JA 2JUFA 3JRZA 4FM4B 4ZGDB 4QVDA 1YITT 3VUBA 5KE2A 5KCOA 3M58A 2QA4T 3OYMA 4OGCA 2HD0A 4VUBA 4XU0A 1N6AA 5GMKh 2EJGA 3RIRA 3BY7A 1BI0A 3N5BB 4HKEA 2RK1A 3JB9D 3CCET 1N27A 2A7YA 3EAEA 4MZTA 1LNXA 4L6V5 3RKYA 3MEAA 2EQUA 4M7AB 4JLGA 4ATOA 4BDZA 2RM4A 3GOXA 2LQKA 1KQ1A 3GNGA 5FROA 3S3MA 4M7AE 1WJRA 4C5GA 3GNFB 4RG2A 4JRPA 3A8MB 4DOVA 3A8OB 2QTXA 2QQSA 2ZPFB 3KBGA 4ZN1A 4J6WA 1BYMA 2WSEE 4LDVA 1VIFA 3E9FA 4GLKA 1VQ9A 2RK2A 3BFMA 4O6JA 2DVEA 4Q5WA 1BIAA 4E7KA 2CZ0B 3VYGA 3OSVA 4PLLA 4BY6C 2WSCE 1G3SA 5GMKj 5J26A 3GIBA 3FRNA 5GANd 3JAME 2D9TA 2DK3A 5HKCA 3CMET 1Q7YC 3X28B 4LD9K 1XTDA 3TREA 3FLGA 1K73C 3M53A 5LL6S 5DLOA 3FB9A 3SDZA 1G3WA 3BDLA 4BI4A 3CCQA 3CC4A 1UGRB 2GFAA 4IUVA 3PIOA 5A0GA 4F7UF 4LDUA 1VQ4T 4OB1B 4KT0E 4XU3A 3VU3C 5J39A 3A8LB 4J7FA 5IT9E 3QZ9B 1VQ5A 2V8JA 3V7RA 4M75F 3X26B 5GAN5 1NE8A 1K73U 5FLXE 2JTFA 2RA2A 2XDDA 2QEXT 4M7AD 1K9MC 2DTHA 1N9RA 4A53A 1QP3A 3URGA 5GAN3 1YITA 3OMGA 4A4KA 1VQKT 2E64A 4XTXA 2QA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9N A;  1VIF A;  3SFM A;  3UDC A;  2RK2 A;  2RH2 A;  2RK1 A;  2OAU A;  2P4T A;  1VIE A;  2VV5 A;  2GQV A; 
#chains in the Genus database with same CATH topology
 4BY6 B;  4L59 A;  1X27 A;  4IUP A;  2RQR A;  3CCE A;  5GAN 7;  2DL5 A;  2QXF A;  3HFN A;  1WIE A;  1M1F A;  4JLI A;  1Q82 C;  1NYG A;  1M9S A;  1UTI A;  2MOX A;  3UA7 A;  2RJC A;  1RAF B;  1JB0 E;  3H8Z A;  1QW1 A;  2HAX A;  1AOJ A;  4F14 A;  2RI3 A;  1VQM A;  1PD0 A;  2CZ1 B;  4OGE A;  2J6O A;  2FL7 A;  1PD1 A;  4KBM B;  2EPD A;  3QYH B;  3CCM Q;  2HBW A;  2LJ0 A;  5HK3 A;  4C8Q C;  4A4F A;  1TU0 B;  4EMG A;  1U06 A;  3G4S T;  4V2S A;  3D7S B;  3INZ A;  3J80 E;  1SF9 A;  1Y07 A;  4M77 B;  1C6V X;  2O4X A;  1K0S A;  2CH4 W;  1Q86 C;  2RJE A;  4M77 E;  5GAN f;  3OYG A;  4FSS A;  3JCM c;  4PJM A;  4EIK A;  4IIM A;  4EPC A;  5GAM g;  3CC7 A;  1HJD A;  5LJ5 g;  1WHK A;  1I4K 1;  2EGC A;  1TTH B;  2BZ8 A;  1QLY A;  4HVU A;  4FW1 A;  2KDS A;  3S6W A;  2DTI A;  4K11 A;  4BI3 A;  1PM3 A;  4JZ3 A;  3CBO A;  1Q81 R;  3SWN C;  1IGQ A;  4R56 A;  2RQU A;  3MHX A;  2VXF A;  2K9G A;  3EH1 A;  2JTM A;  1GCQ A;  3OYN A;  2DIQ A;  2LVM A;  1H3Z A;  2KQW A;  3KFV A;  3C94 A;  2K4Y A;  3JCM e;  2R5A A;  1UFF A;  2O31 A;  1MND A;  1ZBX A;  1ZSZ C;  1MMG A;  2K2V A;  2OTJ Q;  3LGL A;  1UJY A;  3CCJ A;  1H64 1;  1JBM A;  1KD1 U;  1SPK A;  4C92 D;  2DER A;  1VQM T;  3RKX A;  1VQ7 T;  3LX7 A;  4X9C A;  4RTW A;  4ZNX A;  4D8D A;  1VQN Q;  3PGG A;  2DZ9 A;  3H0I A;  2D8J A;  3CBP A;  1IRE B;  4J6Y A;  4F7U G;  3VJP A;  1UEB A;  1WHM A;  3CC2 T;  4OB3 B;  2QQA A;  3HRT A;  2AIR B;  4PK4 A;  4BDY A;  1SHF A;  3VKI A;  2DD4 A;  5GAO p;  1GXI E;  2CDT A;  1LJO A;  2DIG A;  5C6S A;  4EMK A;  1YNZ A;  2M9U A;  1IRX A;  2EQK A;  4C0D B;  2LT1 A;  2X4X A;  1IZ6 A;  2XKO C;  4FIB A;  4F7U A;  3CCV Q;  1RI9 A;  2QQR A;  1G3T A;  1R0C B;  3JCM h;  2K7A A;  1YI2 T;  3V8J A;  3QJ6 A;  3JB9 G;  4AFU C;  3OYD A;  2EKO A;  4C0Z A;  2KEA A;  3EG2 A;  2OTL T;  3QDR B;  4M77 F;  2VB6 A;  3CCM A;  1EX4 A;  4EMH A;  2XDP A;  5FU7 B;  2RNA A;  3L1A A;  1I5O B;  2K79 A;  4IUQ A;  4D8K A;  2DKG A;  2KRN A;  3CCU Q;  3WXM B;  3C95 A;  4BE2 A;  1JO8 A;  3VS3 A;  4E7H A;  2EWN A;  2C0O A;  3EG0 A;  5IXB A;  1OEB A;  4C92 C;  1WNL A;  3QWX X;  1D1C A;  1WX6 A;  1K9M R;  4NOY A;  4HCC A;  2XIC A;  1AVZ C;  2EYZ A;  1K8A C;  3NHN A;  1M90 U;  3RER A;  4NL2 A;  1WHG A;  2O01 E;  3VS1 A;  4ZTJ A;  3KUF A;  1D1A A;  2LCL A;  5GAN 2;  3EH2 A;  3I55 T;  1P92 A;  3GF5 A;  5C0M A;  3RMQ A;  2A36 A;  1R0B G;  3V8K A;  3OY9 A;  4A4H A;  4XU1 A;  1H8K A;  4BUG A;  1SEM A;  4J6X A;  2QDY B;  1OUL A;  1OU9 A;  3TSW A;  2F1L A;  4XK8 E;  2OTJ A;  8AT1 B;  4JZ4 A;  4JJC A;  2GF7 A;  3CCR T;  1VQP Q;  3NTK A;  2WSF E;  2XG8 D;  5CKF A;  3JCM W;  3OMC A;  1KD1 C;  2PNI A;  3O5Z A;  3MP1 A;  4QVZ A;  4JRK A;  1UGV A;  1J3T A;  3HHT B;  2JNG A;  1ZSZ A;  2ZCF B;  1R8O B;  2RPN A;  4JDS A;  6AT1 B;  1WYX A;  3CCV A;  5CKH A;  2COW A;  4PJL A;  3OYL A;  2DL8 A;  2OX7 A;  2CP6 A;  1WHJ A;  5GAN 8;  2YRD A;  4Z89 A;  1IO6 A;  1YIJ T;  3REA B;  2YUO A;  2EIF A;  2VKN A;  1MGQ A;  3QG1 A;  4M78 D;  3QHS A;  1VQO Q;  2R58 A;  3HRU A;  3HPW A;  1QCN A;  2YUQ A;  5EG2 A;  3CCU A;  2KI7 A;  3ZFJ A;  2FRY A;  2CSQ A;  2R5M A;  3VV0 A;  5HCK A;  4E7I A;  3SFM A;  2RF0 A;  1YJ9 T;  5IHK A;  3EGX A;  2RI5 A;  2M0O A;  1C1A A;  3QJY A;  4IUR A;  1K73 R;  2D8H A;  2QI2 A;  4C92 G;  3OS2 A;  2HBP A;  2FPF A;  4QQD A;  2LRQ A;  3EG1 A;  1ZHI A;  4RTT A;  3PIP A;  1VQN T;  1VQ5 Q;  1HK9 A;  1PSF A;  4EMK B;  2CGH A;  2FB7 A;  3NTH A;  3I56 Q;  4C92 A;  3GBQ A;  2ROL A;  1NBE B;  4F7U B;  4JS5 A;  3PMI A;  2YT6 A;  2E5K A;  4F7U E;  2AZS A;  1VQ8 Q;  1KC8 C;  1QVF A;  3O8V A;  3OB9 A;  4Z8A A;  2KXD A;  3HSB A;  4F04 B;  2K2M A;  4WCI A;  5GAN g;  1ZUY A;  2MWO A;  4NL3 A;  1KQS A;  1KHC A;  3CPF A;  1VQP A;  4DBF A;  4B6M A;  3M0R A;  2E4H A;  1T3S A;  3EFO A;  3RDV A;  1VQ9 T;  1UG1 A;  2V8I A;  1IHW A;  2XK0 A;  3EFR A;  4PKC C;  4RTU A;  5KYX A;  4E7L A;  2KRS A;  2YHT A;  3V7C A;  3CC4 T;  4BE1 A;  1MV0 B;  3RKW A;  1VQ4 Q;  3V7S A;  5A0L A;  2SEM A;  2A0F B;  3RBB B;  2EYQ A;  2H3J A;  3JRZ A;  4FM4 B;  2JMC A;  1N6A A;  2EJG A;  4HKE A;  2RK1 A;  2MPX C;  4OMN A;  1LNX A;  2EQU A;  1RUW A;  1PWT A;  5FRO A;  3S3M A;  3A8M B;  3TQ7 P;  2QQS A;  4ZN1 A;  4RTZ A;  4Q5W A;  2CZ0 B;  4PLL A;  2WSC E;  2P84 A;  1SRM A;  1OPK A;  2F2V A;  3FLG A;  3M53 A;  3SDZ A;  3BDL A;  1UGR B;  2GFA A;  2GTJ A;  4F7U F;  4KT0 E;  3VU3 C;  3G4S Q;  5IT9 E;  1QVF P;  1VQ5 A;  5IH2 A;  1NE8 A;  8ATC B;  3EGD A;  1KQS P;  4KH0 B;  1ZLM A;  4M7A D;  1Y57 A;  1QP3 A;  5GAN 3;  1VQK T;  3H0F A;  5I2S A;  2E3I A;  2FPD A;  1W70 A;  3ULR B;  1VQ8 A;  2WAC A;  1E7O A;  1WGS A;  3JB9 F;  1QQJ A;  2DL4 A;  1O9S A;  1OOT A;  1ZQ1 A;  2DLP A;  1N8R R;  1VQ6 Q;  3C12 A;  1M2V A;  2KY9 A;  3CD6 Q;  4DEX A;  3E2U A;  1K76 A;  4M78 G;  2J7I A;  1Q82 U;  2XDB A;  2HSP A;  2EW3 A;  2DMO A;  1VQO T;  4LDX A;  1M27 C;  2VAS A;  2QGG A;  4X9D A;  2DVJ A;  1K0X A;  1RAI B;  1QWF A;  2HQX A;  2L3R A;  3EGX B;  1TUG B;  4AG2 C;  3UA6 A;  1VQ4 A;  3DKM A;  4M78 A;  3OQ5 A;  2E6N A;  5IHN A;  4C5H A;  1KG1 A;  2XHC A;  2E1H A;  2E64 A;  4M7D C;  5KYN A;  4J5Y A;  2PU9 B;  3NTI A;  1AZG B;  4O5V A;  4OMP A;  3PTA A;  2XID A;  4PJJ A;  4RCB A;  5FRN A;  2QGF B;  1MNE A;  5DY9 A;  5KCH A;  2HMA A;  3G1J A;  3LGF A;  5HK0 A;  4ME7 A;  4XTZ A;  3I56 T;  1EZZ B;  1VYT A;  1M30 A;  2ROT A;  3PNW C;  1YI2 Q;  1UHC A;  2KBT A;  1U8R A;  2F2W A;  4X1V A;  1VQ8 T;  1SHG A;  4XAX B;  4D6W A;  1WA7 A;  1W1F A;  5CQY A;  2V26 A;  2ZPB B;  1RAB B;  2GQV A;  3EFO B;  4KGV B;  1VOM A;  1GFD A;  3G71 Q;  1QCF A;  1WXU A;  3G4S A;  5CIU A;  2HEQ A;  2CRE A;  4JRI A;  2RQW A;  4OB0 B;  4JS4 A;  2I0N A;  3NMZ C;  3JSC A;  2GTO A;  1G5V A;  5IN1 A;  3CCL Q;  4C8Q D;  2HZY A;  3PT9 A;  4JUV A;  5LJ3 e;  2L0A A;  5CR2 A;  1E6G A;  3LLR A;  1D0Z A;  2DXB A;  3P8D A;  1V29 B;  3OYK A;  4FYW B;  2JM8 A;  4CRI A;  1BB9 A;  5FU6 C;  1B34 B;  1DJ7 B;  1NM7 A;  1WDX A;  2NUZ A;  4OMQ A;  1ZSG A;  5GAM d;  3I55 Q;  5LJ5 d;  2YUP A;  1KQ2 A;  1M3A A;  4B9X A;  3C0C A;  4RG8 A;  2VGM A;  2JT4 A;  4QQG A;  2K57 A;  2ZZD A;  4AMC A;  1M1G A;  1Y0M A;  2LC4 A;  2OI3 A;  2ED0 A;  4GY5 A;  2R57 A;  2YWW A;  1YWO A;  2K3X A;  5LJ3 h;  1Q7Y R;  3LH5 A;  1M1K R;  3R6O A;  1ABQ A;  4IIO A;  2DZC A;  2PUK B;  2GGR A;  3CCR Q;  2JW4 A;  1MMA A;  4XTY A;  2L5Q A;  2DTO A;  2FHD A;  1VQ7 A;  2VV5 A;  2E6Z A;  3HFO A;  4MMK A;  2YDL A;  3EHR A;  1RAG B;  2ATC B;  2DXC A;  2M0Y A;  3CEY A;  3Q1J A;  4B9W A;  3CCS Q;  3AT1 B;  4FU6 A;  3EGD B;  3CC2 A;  4C5I A;  4PJO C;  4LDW A;  2P4R A;  3U23 A;  5I11 A;  4Y28 E;  2LJ1 A;  4M7A G;  2JN0 A;  4OMF B;  2YLC A;  2X3X D;  1YI2 A;  2BIV A;  1K8A U;  4J9B A;  1MHN A;  3REB B;  4AT1 B;  2K5L A;  2KVQ G;  4E7S A;  1ARK A;  4M7A A;  1Y7X A;  3FJP A;  1WXB A;  1M2V B;  2OTL A;  4DBH A;  5IAY A;  1R77 A;  1YIJ Q;  1AWX A;  2D0N A;  4FSX A;  1VQ6 T;  2YUN A;  3OS0 A;  1N9S A;  3CME Q;  4UC4 A;  2BE9 B;  3CD6 T;  3MP8 A;  2CSI A;  4OVA A;  4F16 A;  3EGU A;  3OYY A;  1OYX A;  4E2F B;  2FZK B;  4OMO A;  1NJI R;  2RHU A;  3QSU A;  1YWP A;  4M78 B;  3FEO A;  1FWZ A;  3M0P A;  2JXB A;  1YJ9 Q;  4M78 E;  1Q86 R;  3E19 A;  3H6Z A;  1M4Z A;  2O9S A;  3THK A;  4RMO A;  2DIL A;  1O75 A;  2DXT A;  3I55 A;  4OP0 A;  2D0Q B;  2KR3 A;  2KRM A;  2QYZ A;  5A2Q E;  2F69 A;  3VS4 A;  2BKD N;  4JPB W;  3HP9 A;  2FYK A;  4ELZ C;  4BAC A;  4KUI A;  1QMC A;  2AKK A;  1CKA A;  3FC3 A;  3MKD A;  5KYU A;  1NYF A;  2YRC A;  2AK5 A;  3DB3 A;  2K5I A;  3JCM J;  2QA4 A;  5GAN 4;  2ESW A;  2XMF A;  2Y4X A;  4FYX B;  3UPU A;  1NPR A;  4MZM A;  2LX9 A;  2LNV A;  4PJN A;  3CCR A;  1ZA1 B;  2LTO A;  3OW2 S;  3L2Q A;  2NUP B;  3JCM f;  3FIF A;  5CVI A;  3EG9 A;  5L23 A;  1M3C A;  1FMV A;  2MMP A;  2OJ2 A;  1G3Y A;  2E65 A;  1VQ9 Q;  3CCS A;  2HQH A;  1IGU A;  3T9N A;  3G71 T;  1QKW A;  1G2B A;  1M8V A;  2HSE B;  4M75 C;  1RAA B;  1QVF S;  3MO8 A;  2CP0 A;  1S72 T;  1KQS S;  1X01 A;  1UUE A;  3P8B B;  1OU8 A;  3JCM X;  3CC4 Q;  4C8Q G;  3CCL T;  4WTO B;  5GAO q;  4YTL A;  3MP6 A;  1YJW Q;  3MEV A;  3LYI A;  4ELY C;  3AHU A;  4C8Q A;  2IVW A;  3CPW S;  2BTT A;  4FT2 A;  1YIJ A;  2YRV A;  3H41 A;  1BBZ A;  2DBM A;  2RHX A;  5I21 A;  2M16 A;  3RUX A;  1HXD A;  4MML A;  2CS7 A;  4M78 F;  3WVE B;  2JVV A;  2EVR A;  5GAO r;  1XOV A;  1BKB A;  1OZ2 A;  5GMK e;  3PVQ A;  1KC8 U;  1PCX A;  1JJ2 A;  1TG0 A;  2JOY A;  5CQX A;  1YJ9 A;  2CUB A;  5GMK i;  1BI2 A;  1WZO A;  2QG9 B;  3SWN A;  5LJ3 d;  2G6F X;  1BU1 A;  1RAH B;  2J05 A;  1VQN A;  2SRC A;  1V1C A;  4ZGE B;  3CCS T;  2KK4 A;  3OYC A;  3OSS C;  3CQT A;  1QVG A;  2O4X B;  4ZGD B;  1SRL A;  1VQK Q;  2DYB A;  5KCO A;  1WI7 A;  3OYM A;  4OGC A;  2RMO A;  5GMK h;  3RIR A;  3BY7 A;  3N5B B;  4RUG A;  3A1P A;  4MZT A;  4J9I A;  3MEA A;  4M7A B;  4JLG A;  1AWO A;  4BDZ A;  2RM4 A;  3GNG A;  1KQ1 A;  4M7A E;  2O9V A;  1WJR A;  3PE0 A;  4PFP A;  4JRP A;  1G83 A;  4DOV A;  1OX8 A;  2B86 A;  2DRM A;  4LDV A;  3E9F A;  4GLK A;  1VQ9 A;  4R0K A;  1VYV A;  2DVE A;  4BY6 C;  1G3S A;  1LVK A;  5GAN d;  2DK3 A;  3CME T;  3HTR A;  1KD1 R;  1K73 C;  1N5Z A;  1PHT A;  5EC7 A;  3CC4 A;  1NG2 A;  1AT1 B;  4ESR A;  4OB1 B;  4XU3 A;  4J7F A;  2DFU A;  3X26 B;  4CC2 A;  5FLX E;  4RTY A;  1GCP A;  3VS2 A;  2QEX T;  2RQT A;  2DTH A;  2KT1 A;  2MK5 A;  1VQL Q;  4PFO A;  1B3Q A;  5CKB A;  3SB2 A;  1FYN A;  1JJ2 P;  2DXU A;  2CZ6 B;  3BW1 A;  3EHQ A;  2B8A A;  3OW2 A;  1K1Z A;  1WJQ A;  2HL5 C;  1TSF A;  2KXC A;  3MEU A;  3F70 A;  4M77 C;  1RLP C;  3M57 A;  3UAT A;  5CAI A;  3JCM b;  4J9F A;  2QQB A;  2J6K A;  1HYO A;  3JB9 H;  3RES A;  5GAM e;  5LJ5 e;  2EJ9 A;  1UGS B;  2GNC A;  1QVG P;  3EG9 B;  4Z88 A;  2G3R A;  3DB4 A;  2H3E B;  3M9Q A;  3BDU A;  2C06 A;  5KYW A;  4E47 A;  2EYY A;  3I5R A;  2F5T X;  3QO3 A;  1M90 R;  4M7A F;  1VQK A;  2J06 A;  3CPW A;  1X6G A;  2RHY A;  1B7T A;  2IPO B;  5D7U A;  2FO0 A;  2NUT A;  2KSS A;  3M56 A;  2F5K A;  3G6E T;  4J9D A;  4N4H A;  4C8Q B;  5GAM h;  3L2R A;  2V8K A;  2Z0W A;  5LJ5 h;  1YJW T;  4C8Q E;  1B07 A;  3VS5 A;  1YFN A;  1WFW A;  3JCM Q;  2MWP A;  2V1R A;  1RI0 A;  2HNI A;  3I5S A;  5GMK m;  2LNH B;  4LD6 A;  3X25 B;  1VQO A;  1IB8 A;  3QZ5 B;  1X43 A;  3JB9 J;  3SD4 A;  4HVW A;  1TH7 A;  2XU8 A;  2GCX A;  1GL5 A;  3GP8 A;  4RTX A;  4J9H A;  2E5Q A;  2A37 A;  2AZV A;  1W2B S;  2CP5 A;  3SWN B;  3OW2 P;  2DRK A;  1WLP B;  3R6N A;  2RN8 A;  2M1H A;  4M7D D;  5FU7 C;  3FDR A;  2NLU A;  1ACM B;  1T3L A;  3JCM g;  2ECZ A;  4CC4 B;  4FL6 A;  1YP5 A;  4HCB A;  1ZSZ B;  3M4G A;  4KRT A;  4QW2 A;  3I56 A;  4OML A;  2EAY A;  3CXC S;  1N8R C;  5M9O A;  1AWJ A;  4IUT A;  4JJB A;  2RH2 A;  2JS2 A;  3UWN A;  2DET A;  1WHL A;  3ZL7 C;  4ZTF A;  2KE9 A;  3TCJ A;  3PFS A;  2EQJ A;  2PTK A;  3CPW P;  1TOV A;  1WPY A;  1PC0 A;  1OZ3 A;  1WQ7 A;  3NFC A;  3LW5 E;  1G8X A;  3CCQ Q;  2XD0 A;  2DD5 A;  2ZPI B;  5GAO m;  1TWB A;  2M02 A;  4C8Q F;  2KNB B;  5I22 A;  3VYH B;  4MDW A;  2AHJ B;  5FWB A;  2MIO A;  3OYJ A;  1I81 A;  4MDX A;  4HT8 A;  5LJ3 j;  5DM7 R;  1YIT Q;  1OQK A;  2RI2 A;  1Q95 G;  1PKT A;  2EYW A;  2PZ1 A;  3LWH A;  1TXQ A;  2RD1 A;  2MAM A;  4MZP A;  1BCM A;  3CCE Q;  4PL6 A;  4Y91 A;  2FEI A;  2LT4 A;  1VQL T;  1X6O A;  4J9G A;  3QXE B;  5J3B A;  2X51 A;  5GJV B;  3P8H A;  1EFN A;  2AT1 B;  1YJN T;  3QYG B;  2DE0 X;  4C92 B;  2ZPG B;  2EQI A;  2F2X A;  4C92 E;  1Q81 U;  2DJZ A;  2W10 A;  1TUD A;  7AT1 B;  4HA8 A;  3MEW A;  1NJI U;  2CT3 A;  2YLB A;  1JXO A;  1GBR A;  2O88 A;  3CMA T;  1OPL A;  1YBY A;  3M0U A;  2ZPH B;  4N4G A;  4QVC A;  3V8L A;  3PMT A;  5KYW B;  4DQ2 A;  4XTU A;  3X24 B;  3QKJ A;  2DJQ A;  2Y4Y A;  1OI1 A;  1HSQ A;  2QK0 A;  4M4Z A;  3QUI A;  3RMS A;  1GCQ C;  1TS9 A;  2VXE A;  4FCY A;  2VUB A;  2DEU A;  5KYX B;  2KYM A;  1S72 Q;  2AKL A;  5GJW B;  1VYU A;  2VGN A;  2NUT B;  4EDU A;  2DF6 A;  4PJO D;  2K3B A;  1YHQ T;  1I07 A;  1WXT A;  1YCY A;  2PQW A;  2YSQ A;  3M0S A;  4E7J A;  1UHF A;  4R55 A;  1MV3 A;  1NLO C;  2KRO A;  4A4G A;  1F1B B;  1VQ6 A;  4KGZ B;  2MYS A;  2CT4 A;  3ME9 A;  4HCK A;  1W2B A;  1M1K C;  3CD6 A;  5GAN 6;  2FG0 A;  1I1J A;  2O2O A;  2JJ9 A;  1LCK A;  4LN2 A;  1U1S A;  3H0H A;  4EMK C;  3EFS A;  2HDA A;  1X2Q A;  5KE3 A;  3J7A F;  3GLX A;  4OB2 B;  2EGA A;  3JCM P;  5ECA A;  4KUL A;  1UGP B;  1AEY A;  2BZY A;  2MCN A;  4WF2 A;  5GAN e;  3OYI A;  5LJ3 f;  2CUD A;  3CXC A;  2FVU A;  4C92 F;  4OF1 A;  1K9M U;  1PG5 B;  2RJF A;  3JV3 A;  1BI1 A;  1JJ2 S;  4ZN3 A;  2P0Q A;  1JRI A;  4M7D G;  1UE9 A;  1BCO A;  3UDC A;  4CI0 C;  3VS6 A;  1ZUK A;  2LDM A;  4LUD A;  5D6X A;  2LP5 A;  2EGE A;  4M7D A;  1Q81 C;  2JTE A;  1WQW A;  5IHI A;  3VRY A;  3L2Z A;  1Q82 R;  2FZC B;  2DL3 A;  1QVG S;  1I5L A;  2E41 A;  1NJI C;  2E12 A;  5GAN h;  1M8M A;  2P0K A;  2I2L A;  3UF4 A;  5IXF A;  4OMM A;  1I8F A;  2FRW A;  2L8D A;  4JJN K;  3E9G A;  3G71 A;  2VYT A;  4PLI A;  2RHI A;  2EYX A;  1S72 A;  3CCQ T;  2QQ9 A;  4DOW A;  1WJS A;  3CCL A;  2OAU A;  3DLM A;  4M75 D;  3TVT A;  2EFI A;  2PVD B;  1ZX6 A;  1W2B P;  2QEX Q;  4FW2 A;  2CKK A;  2JS0 A;  2JUF A;  4QT7 A;  4QVD A;  1YIT T;  5KE2 A;  3M58 A;  2QA4 T;  2FPE A;  2LMJ A;  2HD0 A;  2JMA A;  4F17 A;  2LCS A;  3H9N A;  3CCE T;  9ATC B;  4LUE A;  1CSK A;  2COY A;  4ATO A;  4GLM A;  3GOX A;  2CP7 A;  1NLP C;  1H92 A;  4C5G A;  3GNF B;  4RG2 A;  1SG5 A;  2QTX A;  3KBG A;  2ZAE A;  2L3Q A;  4J6W A;  1BYM A;  3CXC P;  3NGP A;  2A08 A;  3BFM A;  4O6J A;  1BIA A;  4E7K A;  3VYG A;  5GMK j;  5J26 A;  3JAM E;  1PRL C;  2D9T A;  3I9Q A;  3X28 B;  1XTD A;  2CP3 A;  3TRE A;  4HXJ A;  5DLO A;  3FB9 A;  4BI4 A;  1IHV A;  4IUV A;  3PIO A;  5A0G A;  1X2K A;  2M51 A;  3QZ9 B;  2V8J A;  3V7R A;  1K73 U;  2JTF A;  1U5S A;  1K9M C;  4A53 A;  2ED1 A;  4XTX A;  3CC7 T;  2RQV A;  2HKN A;  2E70 A;  2J6F A;  3MJX A;  4J8O A;  2HCK A;  4CC7 A;  4DEY A;  1FX7 A;  3J81 E;  3G6E Q;  4PJO G;  2GQI A;  1AHJ B;  4J9E A;  2LQN A;  1KSW A;  4DA4 A;  1H3H A;  1HD3 A;  3OBY A;  1Y71 A;  2KAF A;  3L2V A;  2X35 A;  2KMT A;  2W0Z A;  5KYY A;  1YN8 A;  3LH0 A;  4PJO A;  3G7Z A;  3QDF A;  4Y92 A;  3M0Q A;  3DLL A;  2X3W D;  3CME A;  1D1B A;  3QII A;  2MF2 A;  4KUD K;  1XNI A;  2EJF A;  4XTW A;  2HKQ B;  3TU4 K;  1LPL A;  1D3B A;  1WHH A;  2CZ7 B;  3CCJ T;  2L2P A;  3BE3 A;  3S3O A;  5DLQ E;  2QEX A;  4L5G A;  4ZGJ B;  4LDY A;  2HL3 A;  4AG1 C;  2LZ6 B;  1KJW A;  4BB7 A;  2COZ A;  2OAW A;  1X69 A;  3L2U A;  1GBQ A;  4RKU E;  3LWI A;  1MUZ A;  2DM1 A;  1Y96 A;  1K8A R;  4LXC A;  1PSE A;  5CCA A;  2E10 A;  3PVL A;  1QKX A;  2PUO B;  3ZEH A;  4M7D B;  1VUB A;  1MMN A;  1NZ9 A;  4J7I A;  1UJ0 A;  4M7D E;  2DPP B;  2ENM A;  4FT4 A;  4N0A C;  1PKS A;  3M4Y A;  2E3H A;  4M77 D;  2CP2 A;  5GAM j;  3CCM T;  2RHZ A;  5LJ5 j;  2L3P A;  1D09 B;  2LCC A;  2QAZ A;  2CYZ B;  3X20 B;  1EIF A;  5FW9 A;  5HY6 A;  3ER0 A;  2EBP A;  2EKH A;  4AFQ C;  1UB4 A;  3MPU B;  3VUZ A;  3S3N A;  1A0N B;  1QCO A;  4A4E A;  4RTV A;  4M75 G;  3E1S A;  4N4I A;  3G6E A;  1FXX A;  2DL7 A;  2X9H A;  4JRQ A;  2VVK A;  1YJW A;  4NS5 A;  5AT1 B;  4X34 A;  3A8H B;  3UT1 A;  1I0C A;  3C4S A;  5FRM A;  5A0D A;  4XTV A;  4M75 A;  2V1Q A;  1RLQ C;  3SEM A;  5LJ3 g;  1YJN Q;  1SSH A;  5CKE A;  1KHI A;  4RCC A;  4GBQ A;  1N8R U;  1VA7 A;  4LE9 A;  1AZE A;  5AYF A;  1ZA2 B;  5KYU B;  2CH4 A;  1IXD A;  4Z02 A;  5FU6 B;  4J9C A;  2BZX A;  2OTJ T;  1BK2 A;  2PVO B;  3M59 A;  2Y90 A;  1JU5 C;  3RR6 A;  2YXY A;  3CMA Q;  4QQ6 A;  2KYB A;  1M90 C;  1YCS B;  4BD3 A;  2GBQ A;  1M2O A;  4AFS C;  1T0J A;  1PRM C;  4JJD A;  2P4T A;  5CKD A;  4ORZ A;  4M7D F;  1K9A A;  1AWW A;  2EQM A;  2XI9 A;  2K3Y A;  3HKS A;  3CCV T;  4A54 A;  3GPL A;  1YHQ Q;  2X4W A;  4HCZ A;  1JXM A;  4M78 C;  2K5F A;  4XU2 A;  1QVP A;  3WVD B;  3JCM d;  4LNP A;  5GAO n;  5L8R E;  3OA6 A;  3ASK A;  2DAQ A;  3A5Z B;  1KC8 R;  5KYY B;  4PJO B;  3M0T A;  3M55 A;  1X75 C;  4PJO E;  5GAM f;  4IUU A;  4II1 A;  2ZGW A;  4E6R A;  1SSF A;  5LJ5 f;  1BI3 A;  2LQ8 A;  1NPP A;  3CCU T;  1BIB A;  1JQQ A;  2DO3 A;  3VS0 A;  3SHW A;  2A3L A;  1UDL A;  1D3B B;  3MCA B;  2FZG B;  3OS5 A;  2DBK A;  4N0A A;  1RL2 A;  5CK9 A;  1NEG A;  4KGX B;  1VIE A;  4C0D C;  4A63 B;  3JCM V;  4E7Z A;  5GMK l;  1QP2 A;  1B34 A;  2D6F A;  1UGQ B;  2L89 A;  2HQE A;  5FWC A;  1RAD B;  1VQL A;  1UEC A;  2NWM A;  1XQH A;  1Y96 B;  2BE7 D;  2RB6 A;  4XQ3 A;  2JM9 A;  1YJN A;  1FMW A;  2RO0 A;  1GRI A;  3OYB A;  5D6W A;  1KFZ A;  2MI6 A;  2DEQ A;  3JB9 I;  3QPH A;  5KH6 A;  2QAS A;  1C0M A;  1RAE B;  4C0F A;  1VQP T;  3CMA A;  1U1T A;  4BE0 A;  2VWF A;  2IG0 A;  1RAC B;  5I2M A;  2DNU A;  2D1X A;  4J83 A;  2A28 A;  4M77 G;  1Q7Y U;  2LQW A;  1M1K U;  1KK7 A;  3QBY A;  1FMK A;  3OYF A;  1OV3 A;  4FYY B;  3IQL A;  3OYA A;  1M5Q 1;  2RJD A;  4M77 A;  2BUD A;  3HRS A;  4TVR A;  2P0P A;  2DX1 A;  2IIM A;  1ZBJ A;  3OYH A;  4HT9 A;  3RNJ A;  1YHQ A;  4PJO F;  3L2W A;  2K6D A;  1E6H A;  4BI8 B;  1K4U S;  3M54 A;  2QTV A;  2QA4 Q;  5D6Y A;  5GAO l;  2X4J A;  4M75 B;  1M3B A;  2VC8 A;  5CO7 A;  4M75 E;  1KIK A;  4P5N A;  3QWY A;  3OBW A;  2GFU A;  1W4S A;  1QWE A;  2ZPE B;  2C0T A;  1W6X A;  3A8G B;  4HVV A;  4IKF A;  4C0G A;  4DBQ A;  3L42 A;  1Z9Z A;  2KGT A;  3OS1 A;  2LX7 A;  1CKB A;  4C5E A;  1NEB A;  2DA9 A;  2X4Y A;  1VQM Q;  2KT8 A;  1VQ7 Q;  3HL8 A;  1LOJ A;  1T0H A;  3NPF A;  1X6B A;  3ZBD A;  3M5A A;  1S1N A;  2H8H A;  4PNO A;  4M7A C;  1ABO A;  1OX9 A;  3CC2 Q;  1U3O A;  1Q86 U;  3TEE A;  3OYE A;  4DBR A;  1SKU B;  1VQ5 T;  3FJ5 A;  5GAN j;  2JZ2 A;  1PNJ A;  4AFZ C;  1TUC A;  2PVG B;  3EG3 A;  2L3S A;  3MET A;  3KXT A;  2QDL A;  2C0I A;  1GFC A;  3VUB A;  1JEG A;  3CC7 Q;  4XU0 A;  4VUB A;  1XJW B;  3TSZ A;  1BI0 A;  2NYS A;  1Z9Q A;  3JB9 D;  1N27 A;  1D0Y A;  2A7Y A;  3EAE A;  2ABL A;  4L6V 5;  3RKY A;  4PFZ A;  2OTL Q;  1MMD A;  2LQK A;  2NUP A;  4FYV B;  4QKU A;  1V76 A;  3A8O B;  1AD5 A;  2DYI A;  2ZPF B;  2WSE E;  1VIF A;  2RK2 A;  3I35 A;  3OSV A;  3A98 A;  3VRZ A;  3GIB A;  3FRN A;  5HKC A;  1Q7Y C;  4LD9 K;  5LL6 S;  4CC3 A;  3CCQ A;  1G3W A;  4ANJ A;  4LDU A;  1VQ4 T;  5J39 A;  3A8L B;  3CCJ Q;  4M75 F;  5GAN 5;  2RA2 A;  2XDD A;  3VS7 A;  1D0X A;  1N9R A;  3URG A;  1YIT A;  1ZUU A;  3OMG A;  4A4K A;  2LJ3 A;  3CBM A;  4KH1 B; 
#chains in the Genus database with same CATH homology
 4BY6 B;  3CC7 T;  2E70 A;  5CKB A;  4L59 A;  3SB2 A;  4IUP A;  1VQ8 A;  2WAC A;  3CCE A;  2DXU A;  5GAN 7;  4J8O A;  2CZ6 B;  3BW1 A;  1WGS A;  3JB9 F;  2QXF A;  3HFN A;  1FX7 A;  3J81 E;  4PJO G;  2B8A A;  1AHJ B;  3OW2 A;  1WJQ A;  1M1F A;  1O9S A;  1ZQ1 A;  4JLI A;  4DA4 A;  1Q82 C;  3MEU A;  3OBY A;  1Y71 A;  2KAF A;  3F70 A;  1M9S A;  4M77 C;  3M57 A;  3L2V A;  3C12 A;  2X35 A;  5CAI A;  3JCM b;  2KMT A;  2RJC A;  2QQB A;  2KY9 A;  3JB9 H;  1JB0 E;  3RES A;  4PJO A;  3LH0 A;  3H8Z A;  5GAM e;  1QW1 A;  3G7Z A;  2HAX A;  2RI3 A;  5LJ5 e;  1VQM A;  2CZ1 B;  4M78 G;  4OGE A;  3DLL A;  2EJ9 A;  1Q82 U;  2XDB A;  2FL7 A;  3CME A;  1UGS B;  1VQO T;  3QII A;  2MF2 A;  4KBM B;  3QYH B;  4LDX A;  4KUD K;  2G3R A;  1XNI A;  3DB4 A;  2EJF A;  4X9D A;  5HK3 A;  4XTW A;  4C8Q C;  3M9Q A;  3BDU A;  3TU4 K;  2L3R A;  2HQX A;  4A4F A;  1D3B A;  4EMG A;  2C06 A;  3G4S T;  1VQ4 A;  4V2S A;  3DKM A;  4M78 A;  2CZ7 B;  4E47 A;  3INZ A;  3OQ5 A;  2E6N A;  4C5H A;  3CCJ T;  1KG1 A;  3S3O A;  2XHC A;  5DLQ E;  3J80 E;  1Y07 A;  2E1H A;  4M77 B;  2O4X A;  4M7D C;  2QEX A;  1Q86 C;  2F5T X;  2RJE A;  3QO3 A;  4J5Y A;  4L5G A;  4M77 E;  4ZGJ B;  4LDY A;  5GAN f;  2PU9 B;  1N8R C;  1VQK A;  3NTI A;  4M7A F;  3OYG A;  3CPW A;  3JCM c;  4EPC A;  3CC7 A;  5GAM g;  5LJ5 g;  4O5V A;  4BB7 A;  2RHY A;  4M7D A;  3PTA A;  2XID A;  1I4K 1;  4RCB A;  3L2U A;  5FRN A;  4RKU E;  2KSS A;  3LWI A;  3M56 A;  2F5K A;  5DY9 A;  5KCH A;  1Y96 A;  3G6E T;  4N4H A;  4C8Q B;  5GAM h;  3L2R A;  1PSE A;  2V8K A;  2KDS A;  3LGF A;  2DTI A;  3S6W A;  5CCA A;  5HK0 A;  5LJ5 h;  1YJW T;  2E10 A;  4C8Q E;  4ME7 A;  4XTZ A;  4BI3 A;  3I56 T;  2PUO B;  3CBO A;  3PNW C;  3ZEH A;  3SWN C;  4R56 A;  4M7D B;  1VUB A;  1NZ9 A;  3JCM Q;  3MHX A;  4J7I A;  2VXF A;  2MWP A;  1U8R A;  1RI0 A;  1VQ8 T;  4M7D E;  2DPP B;  2HNI A;  2JTM A;  4FT4 A;  3OYN A;  4XAX B;  4D6W A;  5GMK m;  4LD6 A;  4N0A C;  2DIQ A;  5CQY A;  2LVM A;  3X25 B;  1VQO A;  3M4Y A;  4M77 D;  2ZPB B;  3QZ5 B;  1H3Z A;  2KQW A;  3JB9 J;  3C94 A;  3SD4 A;  2GQV A;  2K4Y A;  3JCM e;  2R5A A;  2RHZ A;  5GAM j;  3CCM T;  5LJ5 j;  1TH7 A;  2LCC A;  1ZBX A;  3X20 B;  2CYZ B;  2XU8 A;  1EIF A;  2GCX A;  3G4S A;  3GP8 A;  2K2V A;  5CIU A;  3LGL A;  3CCJ A;  2E5Q A;  4JRI A;  4OB0 B;  4JS4 A;  1JBM A;  1H64 1;  5HY6 A;  1W2B S;  3ER0 A;  3JSC A;  1KD1 U;  4C92 D;  3SWN B;  1G5V A;  5IN1 A;  1VQM T;  3RKX A;  4C8Q D;  1VQ7 T;  3LX7 A;  4X9C A;  1UB4 A;  4JUV A;  3PT9 A;  5LJ3 e;  3VUZ A;  5I2S A;  5CR2 A;  3PGG A;  3S3N A;  2DZ9 A;  3LLR A;  3CBP A;  2M1H A;  1IRE B;  2DXB A;  4J6Y A;  3P8D A;  1V29 B;  4F7U G;  3VJP A;  1UEB A;  3OYK A;  4A4E A;  3CC2 T;  4M7D D;  4OB3 B;  2QQA A;  3HRT A;  4BDY A;  5FU7 C;  3FDR A;  2NLU A;  3E1S A;  4M75 G;  2DD4 A;  4N4I A;  3JCM g;  1FXX A;  3VKI A;  4CRI A;  5GAO p;  3G6E A;  1GXI E;  4FL6 A;  1LJO A;  2DIG A;  5FU6 C;  4EMK A;  5C6S A;  2M9U A;  4JRQ A;  1YJW A;  4HCB A;  2EQK A;  3M4G A;  4QW2 A;  4C0D B;  1B34 B;  1DJ7 B;  2LT1 A;  2X4X A;  1IZ6 A;  4NS5 A;  3I56 A;  2XKO C;  4X34 A;  2EAY A;  3A8H B;  4FIB A;  4F7U A;  5M9O A;  3UT1 A;  3C4S A;  5GAM d;  2QQR A;  1G3T A;  3CXC S;  4IUT A;  3JCM h;  5LJ5 d;  5FRM A;  1YI2 T;  5A0D A;  3V8J A;  1KQ2 A;  4B9X A;  2RH2 A;  4XTV A;  4M75 A;  3UWN A;  3QJ6 A;  3JB9 G;  4RG8 A;  5LJ3 g;  3OYD A;  2EKO A;  2VGM A;  5CKE A;  1KHI A;  4QQG A;  2K57 A;  4C0Z A;  2ZZD A;  4ZTF A;  3TCJ A;  1M1G A;  3PFS A;  4RCC A;  1N8R U;  2LC4 A;  2EQJ A;  2OTL T;  3QDR B;  4M77 F;  4GY5 A;  3CCM A;  5AYF A;  2R57 A;  4EMH A;  2XDP A;  5FU7 B;  1WPY A;  2K3X A;  5LJ3 h;  3L1A A;  4Z02 A;  5FU6 B;  2OTJ T;  1OZ3 A;  3R6O A;  1WQ7 A;  4IUQ A;  2DKG A;  3NFC A;  3LW5 E;  2DZC A;  2PVO B;  3M59 A;  2PUK B;  3C95 A;  2Y90 A;  3WXM B;  4BE2 A;  2XD0 A;  2DD5 A;  2ZPI B;  4XTY A;  4QQ6 A;  4E7H A;  2L5Q A;  2EWN A;  2DTO A;  2FHD A;  5GAO m;  2VV5 A;  1VQ7 A;  2E6Z A;  3HFO A;  4MMK A;  4C8Q F;  1M90 C;  4BD3 A;  3VYH B;  2DXC A;  1WNL A;  2AHJ B;  4MDW A;  3CEY A;  3Q1J A;  4B9W A;  4C92 C;  4FU6 A;  3OYJ A;  1I81 A;  4MDX A;  4HT8 A;  3CC2 A;  4NOY A;  4C5I A;  2P4T A;  5CKD A;  5LJ3 j;  5DM7 R;  4HCC A;  4M7D F;  2XIC A;  4PJO C;  2RI2 A;  4LDW A;  1K8A C;  1M90 U;  3RER A;  4NL2 A;  2O01 E;  3LWH A;  4ZTJ A;  4Y28 E;  2EQM A;  2RD1 A;  3KUF A;  2MAM A;  4MZP A;  4M7A G;  2JN0 A;  2XI9 A;  4PL6 A;  4Y91 A;  2LT4 A;  1VQL T;  2K3Y A;  2LCL A;  3HKS A;  3CCV T;  5GAN 2;  1X6O A;  3I55 T;  3QXE B;  5J3B A;  4OMF B;  2YLC A;  1P92 A;  4A54 A;  3GPL A;  1YI2 A;  2BIV A;  3GF5 A;  3P8H A;  5C0M A;  1K8A U;  3RMQ A;  2X4W A;  3V8K A;  3OY9 A;  1MHN A;  4HCZ A;  4M78 C;  1YJN T;  2K5F A;  3QYG B;  2K5L A;  1QVP A;  2KVQ G;  4XU2 A;  3WVD B;  4A4H A;  3JCM d;  4M7A A;  1Y7X A;  3FJP A;  4C92 B;  2ZPG B;  4XU1 A;  2OTL A;  4BUG A;  5L8R E;  5GAO n;  4C92 E;  1Q81 U;  5IAY A;  4J6X A;  3OA6 A;  3ASK A;  2DAQ A;  3A5Z B;  2QDY B;  2DJZ A;  4PJO B;  4FSX A;  3M55 A;  1VQ6 T;  1X75 C;  4HA8 A;  1N9S A;  4IUU A;  3MEW A;  4II1 A;  4XK8 E;  2ZGW A;  4UC4 A;  1SSF A;  5GAM f;  5LJ5 f;  2OTJ A;  1BI3 A;  3CD6 T;  3MP8 A;  1NJI U;  2GF7 A;  2LQ8 A;  1NPP A;  2YLB A;  4OVA A;  1BIB A;  3CCU T;  2DO3 A;  3CCR T;  3OYY A;  1OYX A;  3CMA T;  1YBY A;  2ZPH B;  3NTK A;  2WSF E;  2XG8 D;  4N4G A;  2A3L A;  4QVC A;  3V8L A;  2RHU A;  1D3B B;  3MCA B;  3PMT A;  3QSU A;  5CKF A;  3OS5 A;  3JCM W;  4M78 B;  3OMC A;  3FEO A;  1FWZ A;  1RL2 A;  4N0A A;  4DQ2 A;  4XTU A;  3X24 B;  5CK9 A;  3QKJ A;  1KD1 C;  4M78 E;  2Y4Y A;  3E19 A;  1OI1 A;  3MP1 A;  1VIE A;  3H6Z A;  4QVZ A;  1M4Z A;  4JRK A;  4C0D C;  3HHT B;  3QUI A;  3JCM V;  3RMS A;  2VXE A;  2JNG A;  5GMK l;  2VUB A;  1QP2 A;  1B34 A;  2ZCF B;  1R8O B;  2D6F A;  1UGQ B;  2L89 A;  2HQE A;  4JDS A;  4RMO A;  1VQL A;  1O75 A;  2VGN A;  2DXT A;  3CCV A;  4EDU A;  3I55 A;  4OP0 A;  5CKH A;  2D0Q B;  1XQH A;  1Y96 B;  4PJO D;  5A2Q E;  3OYL A;  1YHQ T;  2F69 A;  2BKD N;  2RB6 A;  3HP9 A;  4XQ3 A;  1YJN A;  2FYK A;  1YCY A;  2RO0 A;  4ELZ C;  2PQW A;  4BAC A;  5GAN 8;  4E7J A;  3OYB A;  4KUI A;  4R55 A;  5D6W A;  4A4G A;  3FC3 A;  1YIJ T;  2MI6 A;  2DEQ A;  2EIF A;  3CBM A;  3JB9 I;  3DB3 A;  2K5I A;  3QPH A;  3JCM J;  1VQ6 A;  5KH6 A;  4M78 D;  1MGQ A;  3QG1 A;  3QHS A;  5GAN 4;  3ME9 A;  2R58 A;  3HRU A;  2Y4X A;  1W2B A;  1M1K C;  3CD6 A;  3UPU A;  3HPW A;  1NPR A;  5EG2 A;  4MZM A;  5GAN 6;  3CCU A;  4C0F A;  2LX9 A;  2LNV A;  3CCR A;  1VQP T;  3CMA A;  1U1T A;  2LTO A;  3ZFJ A;  4BE0 A;  3OW2 S;  2IG0 A;  3L2Q A;  5I2M A;  1U1S A;  3JCM f;  4J83 A;  4EMK C;  4M77 G;  2R5M A;  3FIF A;  5CVI A;  3VV0 A;  3EFS A;  4E7I A;  1Q7Y U;  3SFM A;  2MMP A;  1G3Y A;  2E65 A;  1M1K U;  3CCS A;  5KE3 A;  1YJ9 T;  3J7A F;  3GLX A;  4OB2 B;  3T9N A;  3QBY A;  3G71 T;  2RI5 A;  2M0O A;  3JCM P;  1M8V A;  4KUL A;  4M75 C;  1QVF S;  1UGP B;  3MO8 A;  3QJY A;  4IUR A;  3OYF A;  3OYA A;  2QI2 A;  1M5Q 1;  2RJD A;  4M77 A;  4WF2 A;  1S72 T;  5GAN e;  1KQS S;  1X01 A;  3OYI A;  4C92 G;  3P8B B;  2BUD A;  5LJ3 f;  3HRS A;  4TVR A;  3OS2 A;  2HBP A;  3JCM X;  2FVU A;  2P0P A;  4C8Q G;  3CXC A;  4QQD A;  2LRQ A;  4C92 F;  3CCL T;  4OF1 A;  1K9M U;  5GAO q;  1ZHI A;  2RJF A;  3OYH A;  3PIP A;  4YTL A;  1BI1 A;  3MP6 A;  4HT9 A;  1VQN T;  1JJ2 S;  4ZN3 A;  1HK9 A;  1PSF A;  4PJO E;  2P0Q A;  1JRI A;  1YHQ A;  4PJO F;  3L2W A;  4EMK B;  2CGH A;  2FB7 A;  3NTH A;  4BI8 B;  3MEV A;  3M54 A;  4M7D G;  3LYI A;  4ELY C;  4C92 A;  3AHU A;  4C8Q A;  4F7U B;  4JS5 A;  3PMI A;  3UDC A;  5D6Y A;  2IVW A;  4CI0 C;  3CPW S;  5GAO l;  4FT2 A;  1YIJ A;  4F7U E;  2X4J A;  4M75 B;  2YRV A;  2VC8 A;  2LDM A;  1KC8 C;  1QVF A;  5CO7 A;  2RHX A;  3O8V A;  3OB9 A;  5D6X A;  5I21 A;  4M75 E;  2M16 A;  3RUX A;  4P5N A;  3HSB A;  1HXD A;  3OBW A;  2CS7 A;  4MML A;  4M78 F;  2GFU A;  5GAN g;  1W4S A;  4NL3 A;  2MWO A;  1Q81 C;  2ZPE B;  1KQS A;  1WQW A;  1KHC A;  3WVE B;  3CPF A;  3L2Z A;  2JVV A;  1VQP A;  5GAO r;  1XOV A;  1BKB A;  3OS0 A;  3A8G B;  1OZ2 A;  5GMK e;  4IKF A;  1KC8 U;  4C0G A;  1JJ2 A;  3L42 A;  1QVG S;  1I5L A;  2E41 A;  1NJI C;  2E12 A;  5GAN h;  3OS1 A;  2JOY A;  2P0K A;  2I2L A;  1VQ9 T;  5CQX A;  1YJ9 A;  1I8F A;  4C5E A;  4JJN K;  2L8D A;  2V8I A;  3E9G A;  2X4Y A;  2VYT A;  3G71 A;  2XK0 A;  4PLI A;  3HL8 A;  5GMK i;  1BI2 A;  1LOJ A;  2RHI A;  3EFR A;  4PKC C;  4E7L A;  3ZBD A;  3M5A A;  1S72 A;  2YHT A;  3V7C A;  4PNO A;  3SWN A;  3CCQ T;  4M7A C;  5LJ3 d;  3CC4 T;  2QQ9 A;  4DOW A;  1WJS A;  3CCL A;  4BE1 A;  1Q86 U;  2OAU A;  3DLM A;  3TEE A;  3OYE A;  3RKW A;  3V7S A;  4M75 D;  5A0L A;  1VQN A;  2EFI A;  1VQ5 T;  5GAN j;  2JZ2 A;  4ZGE B;  2PVD B;  3CCS T;  2PVG B;  3MET A;  2EYQ A;  2KK4 A;  3OYC A;  3KXT A;  3OSS C;  1QVG A;  2O4X B;  2CKK A;  2H3J A;  2JUF A;  3JRZ A;  4FM4 B;  4ZGD B;  4QVD A;  1YIT T;  3VUB A;  5KE2 A;  5KCO A;  3M58 A;  2QA4 T;  3OYM A;  4OGC A;  2HD0 A;  4VUB A;  4XU0 A;  1N6A A;  5GMK h;  2EJG A;  3RIR A;  3BY7 A;  1BI0 A;  3N5B B;  4HKE A;  2RK1 A;  3JB9 D;  3CCE T;  1N27 A;  2A7Y A;  3EAE A;  4MZT A;  1LNX A;  4L6V 5;  3RKY A;  3MEA A;  2EQU A;  4M7A B;  4JLG A;  4ATO A;  4BDZ A;  2RM4 A;  3GOX A;  2LQK A;  1KQ1 A;  3GNG A;  5FRO A;  3S3M A;  4M7A E;  1WJR A;  4C5G A;  3GNF B;  4RG2 A;  4JRP A;  3A8M B;  4DOV A;  3A8O B;  2QTX A;  2QQS A;  2ZPF B;  3KBG A;  4ZN1 A;  4J6W A;  1BYM A;  2WSE E;  4LDV A;  1VIF A;  3E9F A;  4GLK A;  1VQ9 A;  2RK2 A;  3BFM A;  4O6J A;  2DVE A;  4Q5W A;  1BIA A;  4E7K A;  2CZ0 B;  3VYG A;  3OSV A;  4PLL A;  4BY6 C;  2WSC E;  1G3S A;  5GMK j;  5J26 A;  3GIB A;  3FRN A;  5GAN d;  3JAM E;  2D9T A;  2DK3 A;  5HKC A;  3CME T;  1Q7Y C;  3X28 B;  4LD9 K;  1XTD A;  3TRE A;  3FLG A;  1K73 C;  3M53 A;  5LL6 S;  5DLO A;  3FB9 A;  3SDZ A;  1G3W A;  3BDL A;  4BI4 A;  3CCQ A;  3CC4 A;  1UGR B;  2GFA A;  4IUV A;  3PIO A;  5A0G A;  4F7U F;  4LDU A;  1VQ4 T;  4OB1 B;  4KT0 E;  4XU3 A;  3VU3 C;  5J39 A;  3A8L B;  4J7F A;  5IT9 E;  3QZ9 B;  1VQ5 A;  2V8J A;  3V7R A;  4M75 F;  3X26 B;  5GAN 5;  1NE8 A;  1K73 U;  5FLX E;  2JTF A;  2RA2 A;  2XDD A;  2QEX T;  4M7A D;  1K9M C;  2DTH A;  1N9R A;  4A53 A;  1QP3 A;  3URG A;  5GAN 3;  1YIT A;  3OMG A;  4A4K A;  1VQK T;  2E64 A;  4XTX A;  2QA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...