2RK2A

Dhfr r-67 complexed with nadp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
NATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrofolate reductase type 2
publication title Crystal structure of a type II dihydrofolate reductase catalytic ternary complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 12
structure length 58
sequence length 58
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2007-10-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rk2A00
2GQVA 2OAUA 2RK2A 3UDCA 2RH2A 2VV5A 1VIFA 3T9NA 2RK1A 3SFMA 2P4TA 1VIEA
chains in the Genus database with same CATH superfamily
1UGVA 1ZBXA 2F1LA 2QG9B 3OMGA 4N0AA 3CCQT 1AZEA 1NJIC 2KBTA 3CCMA 1TU0B 1YIJT 1D0XA 4M75C 3DLMA 1RUWA 1Y57A 3F70A 5GANg 3J81E 2GBQA 4IKFA 2L0AA 1KQ1A 1AOJA 1SF9A 3NFCA 4F7UB 1Y07A 1OZ2A 3X28B 3VS0A 3QDFA 5KYUA 5FU6B 1W2BS 1HK9A 4A4HA 2YLCA 2HQXA 1SSFA 1X69A 3EGXB 1JBMA 2CT3A 2K5LA 2DVJA 3JCMX 2L89A 3AHUA 2P0PA 4WF2A 1OU8A 5L23A 1PD1A 3QPHA 3WVEB 1GCQA 1WJQA 3SWNA 1KQ2A 3TVTA 1IGUA 2L8DA 2KXDA 3E9FA 3JCMe 2LQ8A 2YLBA 3I56Q 2B8AA 3CCRQ 3QWYA 2K2VA 2JS0A 3OS2A 4LDXA 2FPFA 2X4XA 2D8HA 5CQYA 3CXCS 3JCMV 5GAMj 3CC2T 1JEGA 4F16A 2FPEA 2HMAA 2W10A 3E2UA 1BI0A 4KGVB 1HXDA 4E7IA 2D0NA 3TSZA 1Z9QA 2GQIA 2NUTA 1RI0A 4KRTA 4LDVA 4QQGA 2PVDB 1Y96A 2QXFA 2DK3A 1R8OB 4A63B 2GFUA 2E5KA 1AVZC 3KFVA 4M75B 3V8KA 5FU7C 2L3PA 4JJCA 4QQ6A 2CKKA 3FLGA 3MEWA 1U3OA 1M1KR 4OMPA 2R5AA 1KHCA 5KYYB 1YFNA 4RCCA 2RB6A 1XOVA 4KBMB 1WZOA 3G4ST 1QKXA 4LUDA 4KT0E 1BI1A 2LCLA 1WJSA 1QVGS 3CC7T 1QCOA 4CC3A 2FYKA 2CZ0B 2F69A 1NYFA 1X75C 4M78B 3OYNA 1M2VA 4AG1C 1WLPB 2ATCB 1EIFA 4J83A 5LJ5d 3CCLQ 3V8JA 5GAOp 2M51A 2R57A 4J8OA 3L1AA 4C5GA 4OMMA 1VQLA 1YCYA 3GOXA 1F1BB 4AG2C 2X3WD 4KH1B 4A54A 5J3BA 2HDAA 1Q81C 2J7IA 1VA7A 3Q1JA 4M77B 4QKUA 2SEMA 1GFCA 2E6ZA 2MWOA 2K5IA 1U5SA 1H8KA 4PJLA 1FX7A 4M7AF 5GMKi 2DEUA 1VIEA 1BIBA 3RDVA 4MDWA 3G7ZA 2H8HA 4EMKC 2DPPB 4PJNA 1YJ9T 1Y7XA 4C8QD 4J9FA 5J39A 1Q7YU 3CCQQ 1UG1A 1Q7YR 2PVOB 4HVVA 1D3BA 4KGZB 2HSPA 1XQHA 2MF2A 1WX6A 2RJEA 1ZSGA 2EJFA 4X1VA 1RAFB 4R0KA 3PMTA 4O6JA 1VQOA 3S3MA 5CKDA 2AZVA 1TSFA 1AD5A 2PQWA 3OS0A 4JUVA 3VS3A 2MYSA 2RNAA 3AT1B 1I5OB 4M7DG 2F2XA 4C92G 1OZ3A 2A37A 2DX1A 4XTXA 1CKBA 1NPRA 1WIEA 1PCXA 1IREB 3C94A 2BZXA 2RF0A 4LDYA 4AFUC 1I8FA 5HY6A 2V8IA 1HJDA 2YUQA 2XD0A 4C8QE 1PHTA 4LE9A 5LJ5j 4J9GA 1T0HA 1YI2T 3UDCA 2XIDA 1VQ5A 2F5TX 3SFMA 5GANh 2QTVA 1WQWA 3G1JA 4PJOG 3IQLA 1OQKA 3SD4A 3PTAA 3G71A 3EG2A 1YJWQ 1MMGA 1NE8A 4CI0C 3UT1A 3META 1E6GA 3VYHB 4JRPA 2X4YA 2CREA 3PVQA 4KUDK 3P8BB 4PJMA 3MO8A 1BCOA 4KGXB 2DYBA 1YITA 4FCYA 4UC4A 2M0OA 5CR2A 3CCST 4GBQA 3M53A 4A4FA 3VYGA 3JB9D 4ZN3A 2V8JA 4FSXA 2RI5A 2MCNA 3ER0A 4JJDA 5LJ3f 2QQ9A 5GAN3 3LGFA 1T3LA 1JJ2P 4M7AA 2FPDA 2GF7A 4F7UF 4K11A 4VUBA 5KE3A 2BE9B 2C0TA 2FL7A 4ZTJA 4HCBA 2E10A 1VQ4A 4RTXA 6AT1B 3TEEA 2DTHA 2MIOA 4BI4A 3ZEHA 2J06A 4RG2A 4FYXB 2D8JA 2KSSA 2OI3A 3JCMd 2ABLA 3CBMA 4QVDA 3QBYA 3MHXA 2DE0X 1ABOA 1JXOA 4ANJA 1RAGB 2PU9B 2AZSA 1KC8C 4P5NA 1M27C 3HKSA 2HD0A 2XHCA 2DO3A 1D0ZA 3A8GB 1UECA 2EYYA 2P0KA 2RI2A 5GAOq 1MMDA 2F2VA 4MZMA 2XICA 2QEXQ 2ZAEA 4C0ZA 2GCXA 1R0BG 3MP8A 3CCVA 4XK8E 1YJ9Q 1I07A 2LX7A 3EFRA 4M75F 5IN1A 1MV0B 2EIFA 4AT1B 1U1SA 2EQUA 3OA6A 4JPBW 1QWFA 3EG0A 4OMNA 3T9NA 1K4US 1B3QA 1WHLA 3UWNA 2VB6A 4BI8B 4C8QC 1BIAA 2DXBA 3L2QA 2ZPEB 3RUXA 2OTLA 2FRWA 2KRMA 1VQ7A 4Y91A 1SG5A 1IGQA 1VQ6A 1I0CA 3EG3A 4M78F 1K9MU 4NL2A 1K73C 5GAOr 1K9MR 1NYGA 3M58A 1Q82C 4HT8A 2LVMA 2KT8A 1KQSP 2COWA 1FMVA 1AWJA 4L5GA 4QVCA 4JZ3A 1V76A 3OYIA 4X9DA 4OMLA 4FYVB 1LVKA 4OB3B 4LNPA 4F17A 1K9AA 3OSSC 1YI2Q 2LP5A 4EMGA 4F7UA 4OMQA 2RJCA 2QGGA 4FYYB 2LJ1A 4M77F 4E7ZA 3EGXA 3RKWA 5GAOn 3TCJA 1UHFA 5GAMh 1FYNA 2JOYA 2DILA 5GANj 3U23A 3I56T 3RKXA 3CCSQ 4E7SA 1YIJA 2FHDA 2DYIA 1KSWA 1N5ZA 5CAIA 1N8RC 5M9OA 3CMEA 1XTDA 3O8VA 3LLRA 3ZBDA 2A3LA 1X27A 4C8QB 3TQ7P 3HP9A 3OMCA 2ED0A 1MMNA 1M3BA 4F04B 1W2BP 3P8DA 1PNJA 4ME7A 1WGSA 1QKWA 5IXBA 3VV0A 2KT1A 1KD1U 3RBBB 1JJ2A 5CKEA 1KD1R 3M56A 2DJZA 2KYMA 1QVFS 2JM8A 4M75A 1B07A 3M0PA 2DA9A 4J6WA 1K1ZA 1KK7A 3H6ZA 1VQNA 3INZA 5KYYA 3THKA 4XU2A 1ABQA 3RNJA 3CXCP 2RN8A 1ZHIA 2X9HA 1CKAA 2QA4T 1GBRA 3CMAT 4LN2A 2VXEA 2A7YA 1IXDA 2O9VA 3OYKA 2NWMA 3CC2A 2GFAA 4M78A 2LQKA 3R6OA 2L3QA 2KQWA 2QTXA 3CCLT 2BZ8A 3DB4A 4Z02A 2O4XA 2HQEA 5HK0A 2HL5C 1VQ9A 2E5QA 3OYJA 2DL5A 1X01A 3PNWC 1QVGP 1TTHB 2FEIA 2BIVA 3G4SA 4M77A 3NPFA 4IUTA 2CSQA 3GBQA 4N4GA 3H9NA 3CC7A 2HBWA 1QCNA 5GMKe 1VQKT 3NMZC 4J7FA 4BDZA 1H92A 2J6FA 5CVIA 1NJIU 4RUGA 2KXCA 3C12A 1WXUA 3JAME 3EGDB 1JXMA 4J6XA 2DTOA 3RMQA 2EQMA 4C0FA 4HKEA 4JZ4A 4DBQA 1KQSA 5GAN6 3QDRB 3MCAB 4AFQC 3VKIA 4CC7A 3I55A 2VASA 4M7AG 5FLXE 1TS9A 4J7IA 4M7DC 2YUOA 4C92C 3JCMJ 1G3SA 2RQRA 4JS5A 1AWOA 4HCZA 4II1A 4MMKA 5LJ5h 2RHYA 1G3WA 1VQPQ 2OX7A 5AT1B 2DXUA 4E7KA 2X4JA 1ZSZC 4FM4B 3CEYA 3VU3C 2MWPA 2BTTA 2LNVA 5GAN5 2IG0A 4WCIA 4OB1B 2RQTA 1QP3A 1M90U 4RKUE 4PLLA 2HKNA 3PIPA 2J6OA 3OW2S 1M90R 2QASA 4PJOC 4FT4A 1TXQA 3CBOA 4EDUA 4ELYC 1UJYA 3JB9H 3JCMP 2LJ3A 1QWEA 4ESRA 1OULA 3X25B 4DEYA 4OB0B 1YJWT 4J9CA 7AT1B 2JNGA 3LWIA 1MNDA 2MAMA 3I9QA 3HSBA 3H41A 1N9SA 3EFOB 2W0ZA 5FWBA 1W4SA 2EJ9A 2E64A 2DAQA 1W2BA 1ZBJA 3OYYA 3CD6T 2OTJT 2GNCA 5IT9E 4RTYA 3BDLA 5GMKm 1YJNA 3SHWA 4JLGA 1UE9A 2COYA 2JW4A 2EJGA 1ZA2B 5GANf 1M1FA 2FZKB 1T3SA 4RMOA 3PT9A 4EIKA 3PE0A 2FO0A 2CGHA 1NZ9A 1WHJA 4ZN1A 1M1KC 1X2QA 3VS1A 1Z9ZA 1D1BA 3CXCA 1M1GA 1PD0A 2ED1A 2FB7A 2QA4Q 2K3BA 3CMAQ 1IO6A 3TREA 2RHIA 3L2WA 4BD3A 3VS6A 1RAIB 3G6ET 1MV3A 2RM4A 3CCJT 2EQJA 1PM3A 1R0CB 4N4HA 2CUBA 5GAN7 2DERA 2ZGWA 4LUEA 1VQMT 2RHZA 2DIGA 2WSEE 2NYSA 1E7OA 3HL8A 3OY9A 1UJ0A 5CKHA 2LCSA 3OYAA 4TVRA 5HCKA 2V8KA 2DL7A 3CCMT 3I5SA 4F7UG 1RL2A 1WDXA 1BKBA 3GP8A 3V8LA 4Y92A 1NG2A 4C8QF 1GCPA 4XTZA 3JB9J 1YHQA 1QVGA 1GCQC 3SWNC 4C5HA 2JMAA 1PKTA 2AKLA 2QEXT 3HRTA 4OVAA 5FU7B 3MJXA 1VQKQ 3E9GA 5J26A 2FVUA 2YRVA 4JJNK 2P84A 1SHGA 2DZCA 2CZ7B 1OI1A 1I81A 2V1QA 2NUPB 2OJ2A 2JTFA 5KYNA 1K8AU 2KDSA 1Q7YC 1K8AR 2EYQA 1QVPA 2KMTA 1VQ8A 2DM1A 2XDBA 2DBKA 4AMCA 2YT6A 3EAEA 4D8DA 4J9IA 5I11A 1M3AA 4BUGA 2I0NA 2LT1A 3JCMh 1KIKA 3CCEA 2HQHA 1D0YA 4AFZC 2KEAA 2XG8D 4M75G 5KE2A 2DBMA 2ROLA 2COZA 1RLPC 2VUBA 2VVKA 2JUFA 3CCUA 4IUVA 1AHJB 5LJ3g 2MOXA 3L2RA 8AT1B 1S72Q 3OYCA 4BI3A 4LXCA 3GNFB 2JMCA 3FIFA 3MKDA 5A0LA 2GGRA 1M8MA 2GTJA 2E41A 3OYGA 1WHHA 2LQNA 5KH6A 4Z88A 3L2UA 3CC4A 2EGCA 2CP3A 5A0DA 5GAOm 2DL3A 4CC2A 4M78G 3CPWP 3M0UA 5IXFA 2K5FA 1UFFA 4Y28E 2KVQG 4EMKB 4FYWB 3JB9F 1G3YA 1FWZA 3REBB 4KH0B 1ZUYA 4DEXA 4D6WA 1AZGB 1VOMA 4QQDA 1KHIA 2M1HA 1WI7A 2DXCA 3CD6Q 2OTJQ 3A8LB 3OS1A 3H8ZA 2RHXA 2LQWA 2AT1B 2O01E 3PMIA 2ZZDA 2RA2A 4ZGJB 1IHVA 1TH7A 2EBPA 2P4RA 2YWWA 2MPXC 4B9WA 4C8QA 4M77G 1O75A 3SDZA 4M4ZA 1TG0A 2DJQA 1VQLT 5GAMf 4LDWA 4EPCA 5FROA 2XMFA 5LJ3e 2EQIA 3ZL7C 5I22A 3G6EQ 3LX7A 3CCJQ 1WA7A 4BY6C 3LW5E 5KCHA 4HA8A 5KYXB 2M0YA 4PFOA 1VQMQ 2CP5A 3ULRB 5I2SA 2VGMA 2CS7A 3CCRA 3I56A 1LOJA 3M54A 3CCMQ 4FW2A 1WNLA 3V7CA 2AKKA 3OYFA 3CQTA 5IHIA 1KC8U 1ZA1B 2AIRB 2VV5A 1UEBA 2DNUA 1RAEB 2LTOA 1ZUUA 1QVFP 2J6KA 1VQOT 4X9CA 1SPKA 5GMKj 1SEMA 2EYXA 2LNHB 5CCAA 1MUZA 3VUZA 1UDLA 5A0GA 4E47A 4B9XA 1IRXA 3M0RA 1M3CA 4XU0A 5HK3A 3BW1A 4OMOA 4PNOA 4YTLA 3JV3A 1KFZA 3CMAA 4V2SA 1W1FA 4GLKA 1OX8A 2D0QB 2HZYA 2X51A 1D1AA 3V7SA 1M5Q1 2X4WA 1TUGB 4IUUA 4BY6B 2H3EB 4O5VA 1FMWA 4ELZC 2EPDA 1WHKA 4M7DD 4C92D 2OAUA 4WTOB 2V1RA 3VRYA 2KAFA 4FL6A 2O88A 3REAB 3CCLA 1X2KA 2YRDA 2CP7A 3FDRA 1Q82U 2DTIA 3EGDA 2QAZA 4M7AC 3KXTA 2DLPA 3A1PA 2DRMA 2OAWA 1YITT 1K9MC 4XU3A 1UGRB 1K0XA 2AHJB 2M02A 4DOVA 1N6AA 2XDPA 1VQPT 1AWXA 4PJOD 1ZLMA 4HCCA 1OU9A 3QG1A 5IAYA 5GJWB 4E7JA 2NUZA 4MMLA 2ZPBB 3LWHA 4A53A 3CPWA 5CKBA 3OYDA 2ROTA 4PLIA 3CCQA 2YXYA 4X34A 2FRYA 4BACA 1VQ4T 4A4GA 2DIQA 4M7DE 1R77A 4C92E 4C5IA 3X20B 5LJ5f 2G6FX 2YSQA 1SRMA 3EGUA 2K57A 3LGLA 1RACB 1MMAA 2FZGB 4ZTFA 5L8RE 4MZTA 3RERA 3EFOA 1RLQC 2RPNA 2C0OA 1VQLQ 2K9GA 5FRMA 2R5MA 3SB2A 2AK5A 2K2MA 3VS2A 4PJOE 3X26B 1AEYA 4GLMA 1D09B 5FRNA 3OW2P 2EW3A 2X3XD 1PWTA 2PZ1A 2YUNA 2M16A 4E7LA 1KD1C 1LPLA 1WJRA 5GMKl 3OB9A 3C4SA 3QJYA 2RD1A 4BE0A 4HVUA 2VYTA 2DKGA 1W6XA 3J7AF 1YJWA 1BI3A 3QUIA 4JRQA 4OMFB 1LCKA 3CBPA 4A4KA 1QLYA 2DVEA 2BKDN 2CT4A 4ZGDB 1M8VA 2KY9A 3JCMc 3M59A 3LH0A 4JRIA 1VQOQ 2OTLT 1QVFA 3QHSA 3NTKA 2P4TA 4PFZA 2QI2A 2QGFB 1V29B 1WYXA 2LC4A 4PFPA 1YP5A 3E1SA 5GJVB 1PG5B 3PFSA 5IHNA 2LZ6B 2JN0A 4XTVA 3WXMB 2L3RA 2LMJA 2PTKA 1EFNA 3H0HA 4CRIA 2DF6A 3VJPA 4MDXA 2RQWA 5LJ3d 4RTVA 4JRKA 1Q86U 1ARKA 1Q86R 2HEQA 5IHKA 1VQ5Q 1LNXA 5GAN2 2L5QA 3BFMA 3G71Q 2KROA 3M5AA 4PKCC 8ATCB 4XU1A 1NJIR 1JQQA 2QQBA 3ZFJA 4C8QG 2IPOB 1N9RA 1PSFA 2NUPA 2JXBA 2ZPGB 4Q5WA 1YITQ 1EX4A 1NLPC 4J9EA 2EWNA 3QSUA 1Y0MA 1YBYA 5EC7A 2YHTA 3L42A 2RH2A 3CMET 3UF4A 3HRUA 3I5RA 1SRLA 3A8HB 3RESA 5I21A 1PC0A 2P0QA 2A28A 4KUIA 2QEXA 2CUDA 3BY7A 3L2VA 1S72T 2KR3A 4Z89A 1YJ9A 3ME9A 2WACA 1KG1A 3FRNA 1C1AA 1OEBA 1G3TA 3OS5A 1VQ4Q 3A8MB 4M78C 2O2OA 3EHQA 3JCMf 2DZ9A 4DBRA 3DKMA 3OBWA 2CZ6B 1M90C 4IURA 2QDLA 3QWXX 1WHMA 1VQNT 3TSWA 2VC8A 3OSVA 1G2BA 1VUBA 1X6BA 4QVZA 1NPPA 3RR6A 3OBYA 4OF1A 5GAOl 2HNIA 3EG1A 4EMKA 3O5ZA 1M9SA 3QYHB 5EG2A 5LJ3j 3VS5A 4BE1A 2DEQA 1QW1A 5GAN4 2E4HA 2HL3A 2K6DA 2RK1A 4M77C 2HBPA 3QYGB 5KYWB 3OW2A 1VIFA 3E19A 3L2ZA 1B34B 1RI9A 2D9TA 5IH2A 4HCKA 1X6OA 3UPUA 4A4EA 4M7DB 1YI2A 4C92B 3CCVQ 4AFSC 4N0AC 2B86A 5GANe 1J3TA 2QQRA 3JB9G 1M1KU 5A2QE 1VQ9T 2M9UA 4HVWA 1BK2A 3BDUA 2JM9A 2JS2A 3D7SB 1ZSZB 1YN8A 3J80E 4FW1A 2CH4W 2LDMA 3QIIA 2RJFA 3GLXA 1TUCA 1NEBA 2K7AA 1ZUKA 3VS7A 2CSIA 1G8XA 2EKHA 4DQ2A 3SEMA 2K4YA 5KYXA 3M0QA 4PJOB 3EH1A 4N4IA 2OTLQ 2ZPHB 1XNIA 3CCSA 2A36A 1VQ7Q 3QXEB 1WQ7A 4ATOA 4E6RA 1VQ6Q 5GMKh 2ZCFB 1OOTA 1AT1B 1XJWB 1GXIE 1YCSB 3QO3A 1Q81U 2VXFA 1IHWA 3EHRA 3UA6A 1Q81R 1FXXA 2O4XB 2ECZA 2Y4XA 4CC4B 2E3HA 2Y90A 5CIUA 1QP2A 1ACMB 3HFOA 2CH4A 3OYEA 3I55T 3PGGA 2HSEB 5D6XA 3A5ZB 5CKFA 1TUDA 1UTIA 2Z0WA 1UGPB 2PNIA 4DA4A 3EG9B 1K0SA 3URGA 2E65A 5KCOA 2RJDA 1YNZA 2EYWA 1YWPA 1JB0E 1OV3A 2LJ0A 5LL6S 1ZX6A 2PUKB 3HRSA 3NTHA 1H3ZA 2E70A 3I35A 4J9BA 4QT7A 1O9SA 2VWFA 3JCMW 2D6FA 4NL3A 2K79A 4JJBA 5I2MA 3CPFA 1K76A 4M7AD 1WPYA 5DY9A 4LD6A 3DB3A 1YIJQ 1C6VX 1GFDA 1K8AC 3JCMb 3CMEQ 1N27A 2MI6A 1GBQA 3TU4K 2EFIA 3EFSA 2E6NA 4BDYA 1WFWA 2A0FB 2QQAA 4IUPA 5KYUB 1ZQ1A 4C0DC 2CZ1B 4RTUA 2BUDA 1SKUB 3WVDB 5GAMg 3MEUA 2VKNA 3H0FA 4OP0A 2EQKA 3S3NA 2RMOA 2EYZA 4BB7A 1YJNT 2O31A 1WXTA 2LT4A 1HD3A 1D1CA 2XDDA 3KUFA 2GQVA 1JO8A 3SWNB 1Y71A 3N5BB 2FG0A 1VQNQ 3UATA 3HFNA 4GY5A 4RTTA 4NS5A 2FZCB 2PVGB 3GNGA 3X24B 1OYXA 4MZPA 4M7AE 1HSQA 1FMKA 2DL4A 1NM7A 4HT9A 2GTOA 3FJ5A 2XK0A 4Z8AA 4L59A 3CC2Q 2DMOA 5GAN8 4FU6A 1S1NA 2NUTB 2K3XA 5C0MA 1Y96B 4C5EA 3DLLA 1WHGA 3M57A 2SRCA 2KYBA 3FEOA 3GPLA 4PK4A 4JS4A 2EGAA 4B6MA 4OGEA 2ZPFB 1BCMA 2JTEA 3OYLA 1KJWA 4LDUA 4JLIA 1VQPA 2DXTA 3VRZA 3OYBA 3GF5A 4E2FB 1VQ9Q 3NGPA 5DLQE 1CSKA 4L6V5 1PKSA 5GAMe 2QK0A 5DM7R 2RK2A 4FIBA 1LJOA 2JZ2A 3G4SQ 4C0DB 1YHQT 3LH5A 2RI3A 3CC7Q 4IIMA 5ECAA 2DETA 1PRMC 1A0NB 3HHTB 1I5LA 4XQ3A 1X6GA 1U1TA 2WSFE 1G83A 2BZYA 1M2VB 3RMSA 2CP2A 2DRKA 3M4YA 2XKOC 1VYTA 1MGQA 1IB8A 2F2WA 3HPWA 1KC8R 1OPLA 3MP1A 9ATCB 2Y4YA 1EZZB 1BU1A 1H3HA 3QKJA 2DD5A 3PIOA 1VQ8T 2ZPIB 2QYZA 4BE2A 1M2OA 2YDLA 3OYHA 1T0JA 1Q95G 3I55Q 1UB4A 3M9QA 1VYVA 3CCET 1I4K1 1B7TA 4RCBA 3PVLA 2KK4A 2PUOB 3MEAA 4PJJA 3JSCA 1PSEA 2L3SA 1I1JA 5GANd 3CCUT 4R56A 2NLUA 2VGNA 5D6WA 2KGTA 3M55A 5DLOA 1W70A 2RQUA 1GRIA 2IIMA 4M7DF 4C92F 2QA4A 1D3BB 2JT4A 4E7HA 5AYFA 1VQ5T 4J5YA 1RADB 2CP0A 4DBFA 2E3IA 4J6YA 4F7UE 4HXJA 4D8KA 1YWOA 3JRZA 3CC4T 1SSHA 5FW9A 3G71T 3OQ5A 2CYZB 4IIOA 2ESWA 5LJ5g 1E6HA 2K3YA 4FSSA 4M75D 4PL6A 1UHCA 2JVVA 1K73U 2RHUA 3QJ6A 1K73R 4LD9K 1QCFA 1QMCA 1IZ6A 1Q82R 1G5VA 1M4ZA 2KRSA 4PJOF 1DJ7B 1BYMA 3CPWS 4ZGEB 1OX9A 3FB9A 2QDYB 2DFUA 3NHNA 1RAHB 2WSCE 3VUBA 3FC3A 1YJNQ 2HKQB 2EGEA 4XTWA 3HTRA 5CQXA 2F5KA 3RKYA 4KULA 1UUEA 2LX9A 3R6NA 1JRIA 4EMHA 4M78D 3M0SA 2KE9A 2EVRA 1U06A 3QZ9B 1VQKA 3C0CA 3A98A 4FT2A 2E1HA 3H0IA 1JJ2S 2XU8A 2JJ9A 1C0MA 1SHFA 1NBEB 5LJ3h 4M75E 1JU5C 2C0IA 1N8RU 3A8OB 2KI7A 2J05A 1N8RR 1RABB 3BE3A 5FWCA 1GL5A 4OB2B 2DL8A 2V26A 2QQSA 4M77D 4XAXB 3CCRT 4IUQA 5LJ5e 1OPKA 3MPUB 1AWWA 1PRLC 1M30A 3P8HA 3MP6A 4C0GA 2MMPA 4M78E 3V7RA 3MEVA 4J9DA 4M7AB 3M0TA 1NLOC 1YHQQ 1S72A 4F14A 5KYWA 2KRNA 3S6WA 2LRQA 4JDSA 3QZ5B 5D7UA 1X43A 3CCVT 1B34A 2CP6A 2DD4A 3OYMA 2E12A 4J9HA 4QW2A 2G3RA 2L2PA 3LYIA 4M7DA 4C92A 1HYOA 4DBHA 4DOWA 3M4GA 3EH2A 4ORZA 1P92A 1H641 2R58A 2HCKA 3NTIA 1ZSZA 3GIBA 2EKOA 4R55A 2RQVA 1QQJA 4M77E 1BB9A 2JTMA 1TOVA 2BE7D 2YRCA 2A08A 2H3JA 2RO0A 3C95A 1VQ8Q 3KBGA 3CD6A 2OTJA 4PJOA 1VQ7T 2MK5A 2IVWA 3UA7A 3ASKA 5D6YA 1VQ6T 1BBZA 4XTUA 1UGSB 4RTWA 3CCEQ 5FU6C 1U8RA 2EAYA 2ENMA 5C6SA 1UGQB 4RTZA 4RG8A 1RAAB 1VYUA 4NOYA 3CCUQ 2KNBB 3FJPA 2D1XA 3JB9I 4OGCA 2LCCA 1KQSS 4XTYA 3VS4A 5CO7A 5GAMd 1V1CA 4ZNXA 2HAXA 1NEGA 3G6EA 2YUPA 3S3OA 2CDTA 2O9SA 3CC4Q 3CCJA 1BI2A 3JCMg 3JCMQ 2X35A 2XI9A 2C06A 3EG9A 5HKCA 3RIRA 1Q86C 1VQMA 1MNEA 1TWBA 1WXBA 5CK9A 1MHNA 2I2LA
chains in the Genus database with same CATH topology
1ZBXA 3OMGA 4M77F 1VQLT 5GAMf 4N0AA 3CCQT 4LDWA 1GXIE 3QO3A 1Q81U 2VXFA 3RKWA 4EPCA 5GAOn 1NJIC 3TCJA 3CCMA 1FXXA 2O4XB 5FROA 2Y4XA 5GAMh 5LJ3e 1YIJT 2Y90A 4M75C 3DLMA 1QP2A 5CIUA 2JOYA 3HFOA 3LX7A 5GANj 3OYEA 3I55T 4BY6C 3PGGA 3LW5E 3F70A 3RKXA 5GANg 3J81E 5KCHA 4HA8A 3I56T 1YIJA 2FHDA 5D6XA 3A5ZB 5CKFA 4IKFA 5CAIA 5I2SA 1N8RC 2VGMA 1UGPB 4DA4A 1KQ1A 5M9OA 3NFCA 3CMEA 1XTDA 3O8VA 3URGA 3LLRA 2E65A 1Y07A 2A3LA 3ZBDA 1OZ2A 2CS7A 3X28B 2RJDA 4F7UB 5KCOA 3I56A 3CCRA 1JB0E 5LL6S 1LOJA 4C8QB 3HP9A 3OMCA 2PUKB 3HRSA 3NTHA 1H3ZA 2E70A 5FU6B 1W2BS 3M54A 1HK9A 4A4HA 1WNLA 2YLCA 2HQXA 3V7CA 3P8DA 1SSFA 4ME7A 1JBMA 3OYFA 1WGSA 2K5LA 1KC8U 1O9SA 3VV0A 3JCMW 3JCMX 2L89A 4NL3A 1KD1U 1JJ2A 2VV5A 2D6FA 3AHUA 5CKEA 5I2MA 2P0PA 1UEBA 4WF2A 3M56A 2DJZA 3CPFA 4M7AD 2LTOA 1WPYA 5DY9A 1QVFS 4LD6A 3DB3A 3QPHA 3WVEB 4M75A 1WJQA 3SWNA 1VQOT 1KQ2A 4X9CA 2L8DA 1K8AC 3E9FA 3JCMb 5GMKj 1N27A 4J6WA 3JCMe 2MI6A 3TU4K 2EFIA 3EFSA 2LQ8A 2YLBA 3H6ZA 2B8AA 2E6NA 1VQNA 2K2VA 4BDYA 3INZA 3OS2A 4LDXA 5CCAA 3VUZA 2X4XA 4XU2A 5A0GA 5CQYA 4E47A 3CXCS 2QQAA 4B9XA 4IUPA 1ZQ1A 3JCMV 4C0DC 2CZ1B 5GAMj 3CC2T 1ZHIA 2BUDA 3WVDB 5GAMg 2QA4T 3MEUA 1BI0A 3CMAT 1HXDA 4E7IA 4OP0A 4XU0A 5HK3A 3BW1A 2VXEA 2A7YA 2EQKA 1RI0A 4PNOA 4YTLA 3S3NA 4LDVA 4QQGA 4BB7A 3OYKA 2PVDB 1YJNT 1Y96A 3CC2A 2QXFA 2GFAA 4M78A 2LT4A 2DK3A 1R8OB 2XDDA 3CMAA 3KUFA 2GFUA 4V2SA 2GQVA 2LQKA 4GLKA 2D0QB 3R6OA 4M75B 1Y71A 3N5BB 3SWNB 3V8KA 2KQWA 2QTXA 5FU7C 1M5Q1 3V7SA 2X4WA 3HFNA 2CKKA 3FLGA 3MEWA 4GY5A 4QQ6A 4IUUA 4BY6B 4NS5A 2R5AA 3DB4A 4O5VA 1KHCA 4ELZC 2PVGB 3GNGA 4Z02A 3X24B 1OYXA 4M7DD 4MZPA 4C92D 2OAUA 2O4XA 4RCCA 4M7AE 2RB6A 2KAFA 4FL6A 1XOVA 2HQEA 5HK0A 3CCLA 4KBMB 4HT9A 1VQ9A 3FDRA 3G4ST 2DTIA 1Q82U 2XK0A 4KT0E 1BI1A 2E5QA 4M7AC 4L59A 2LCLA 1WJSA 3OYJA 3KXTA 1X01A 1QVGS 3CC7T 3PNWC 1YITT 5GAN8 4FU6A 1K9MC 2FYKA 2BIVA 2CZ0B 4XU3A 2F69A 2K3XA 5C0MA 3G4SA 1UGRB 1Y96B 4M77A 4C5EA 2AHJB 3DLLA 4DOVA 1N6AA 1X75C 2XDPA 4M78B 3M57A 4IUTA 3FEOA 4N4GA 3GPLA 1VQPT 3CC7A 4JS4A 4PJOD 3OYNA 4OGEA 2ZPFB 4HCCA 5GMKe 1VQKT 4J7FA 3QG1A 3OYLA 5IAYA 4E7JA 4LDUA 4BDZA 1EIFA 4MMLA 4J83A 4JLIA 5LJ5d 2ZPBB 1VQPA 3LWHA 2DXTA 3V8JA 3OYBA 5GAOp 3GF5A 5CVIA 4A53A 2R57A 4J8OA 5DLQE 5CKBA 3CPWA 3L1AA 4C5GA 1NJIU 3C12A 3OYDA 3JAME 1VQLA 1YCYA 4L6V5 4PLIA 3GOXA 3CCQA 4J6XA 5GAMe 2DTOA 3RMQA 2EQMA 5DM7R 4C0FA 2RK2A 4X34A 4FIBA 4HKEA 1LJOA 2JZ2A 4BACA 4C0DB 1YHQT 4A54A 4A4GA 1VQ4T 5J3BA 1KQSA 1Q81C 5GAN6 2DIQA 4M7DE 3QDRB 4C92E 3Q1JA 3MCAB 2RI3A 4M77B 4C5IA 2E6ZA 3X20B 3VKIA 5LJ5f 2MWOA 2K5IA 3I55A 4M7AG 5FLXE 4J7IA 3HHTB 1I5LA 4XQ3A 3JCMJ 4C92C 4M7DC 1G3SA 1U1TA 4JS5A 1FX7A 2WSFE 4M7AF 4HCZA 4II1A 3RMSA 4MMKA 1VIEA 5GMKi 5LJ5h 2RHYA 1BIBA 1G3WA 3M4YA 4MDWA 2K57A 3G7ZA 2XKOC 3LGLA 1MGQA 4ZTFA 2DXUA 2DPPB 4MZTA 2X4JA 5L8RE 4EMKC 4E7KA 1YJ9T 3RERA 1Y7XA 4FM4B 4C8QD 3CEYA 3HPWA 3VU3C 2MWPA 5J39A 1Q7YU 5FRMA 2LNVA 2R5MA 3MP1A 2Y4YA 3SB2A 2PVOB 5GAN5 2IG0A 4PJOE 1D3BA 4OB1B 3QKJA 2DD5A 3PIOA 1QP3A 3X26B 3CCLT 4RKUE 1M90U 4PLLA 3PIPA 1VQ8T 3OW2S 2ZPIB 1XQHA 4BE2A 5FRNA 2MF2A 3OYHA 4PJOC 2RJEA 4FT4A 3CBOA 4EDUA 1UB4A 2EJFA 2M16A 4ELYC 4E7LA 1KD1C 3M9QA 1WJRA 3JB9H 3PMTA 4O6JA 5GMKl 3JCMP 3CCET 1VQOA 3S3MA 1I4K1 4RCBA 3X25B 5CKDA 3OB9A 2KK4A 3C4SA 4OB0B 1YJWT 2PUOB 3QJYA 3MEAA 2RD1A 4BE0A 2VYTA 2JNGA 3JSCA 2PQWA 1PSEA 3LWIA 3OS0A 2MAMA 3HSBA 4JUVA 5GANd 1N9SA 3CCUT 2DKGA 1W4SA 2EJ9A 3J7AF 2E64A 2DAQA 1BI3A 1YJWA 4C92G 4R56A 4M7DG 2NLUA 2VGNA 3QUIA 5D6WA 4JRQA 1OZ3A 3M55A 4XTXA 1W2BA 5DLOA 1NPRA 4OMFB 4M7DF 1IREB 3C94A 1D3BB 4C92F 3OYYA 3CBPA 2QA4A 3CD6T 4E7HA 2OTJT 4A4KA 4LDYA 5AYFA 5IT9E 2DVEA 1VQ5T 1I8FA 2BKDN 4J5YA 5HY6A 2V8IA 3BDLA 4ZGDB 5GMKm 4F7UE 4J6YA 1YJNA 2KY9A 1M8VA 3JCMc 3JRZA 3LH0A 3M59A 4JLGA 4JRIA 4C8QE 3CC4T 2XD0A 5LJ5j 2OTLT 3G71T 1QVFA 2EJGA 3OQ5A 2CYZB 3NTKA 3QHSA 2P4TA 1M1FA 5GANf 1YI2T 5LJ5g 2QI2A 4RMOA 3PT9A 2XIDA 3UDCA 1VQ5A 2F5TX 2K3YA 1V29B 2LC4A 4M75D 4PL6A 2JVVA 3E1SA 1K73U 3SFMA 2RHUA 3QJ6A 3PFSA 4PJOG 1WQWA 5GANh 4LD9K 2CGHA 3SD4A 3PTAA 1NZ9A 3G71A 2JN0A 4ZN1A 1IZ6A 1G5VA 1M4ZA 1M1KC 4PJOF 1DJ7B 1NE8A 4XTVA 1BYMA 3WXMB 4CI0C 2L3RA 3CPWS 3UT1A 3CXCA 3META 1M1GA 4ZGEB 2FB7A 3FB9A 2QDYB 3VYHB 4JRPA 2X4YA 3TREA 2RHIA 3L2WA 4CRIA 4BD3A 3VJPA 4KUDK 3P8BB 2WSCE 3VUBA 3FC3A 4MDXA 3MO8A 3G6ET 5LJ3d 2RM4A 1YITA 4JRKA 3CCJT 1Q86U 2EQJA 4XTWA 4UC4A 4N4HA 5CQXA 2F5KA 2M0OA 5CR2A 3CCST 3RKYA 4KULA 2LX9A 3M53A 5GAN7 1JRIA 2ZGWA 3VYGA 4A4FA 4EMHA 1VQMT 1LNXA 2RHZA 4M78D 2DIGA 2WSEE 3JB9D 4ZN3A 5GAN2 2L5QA 3BFMA 3HL8A 2V8JA 3M5AA 2RI5A 4FSXA 4PKCC 3OY9A 4XU1A 3QZ9B 1VQKA 5CKHA 2QQBA 3ER0A 4TVRA 3OYAA 2V8KA 4FT2A 2E1HA 3CCMT 5LJ3f 2QQ9A 3ZFJA 1RL2A 4F7UG 3LGFA 2XU8A 5GAN3 1JJ2S 1BKBA 4C8QG 3GP8A 4M7AA 1N9RA 1PSFA 2ZPGB 2GF7A 4F7UF 5LJ3h 4M75E 4Q5WA 4VUBA 3V8LA 5KE3A 4C8QF 4ZTJA 2FL7A 4HCBA 2E10A 3A8OB 1N8RU 4XTZA 3JB9J 2EWNA 1YHQA 1VQ4A 1QVGA 3QSUA 3SWNC 1YBYA 4C5HA 3TEEA 2DTHA 2YHTA 2QEXT 4BI4A 4OB2B 3L42A 2RH2A 3CMET 3ZEHA 2QQSA 4M77D 3HRUA 4RG2A 3HRTA 4XAXB 4OVAA 3CCRT 4IUQA 3A8HB 3RESA 5LJ5e 2KSSA 5I21A 5FU7B 3JCMd 2P0QA 3CBMA 3E9GA 3QBYA 4KUIA 3MHXA 3BY7A 5J26A 4QVDA 3L2VA 2QEXA 2FVUA 1S72T 3P8HA 2YRVA 3MP6A 4C0GA 2MMPA 1YJ9A 3ME9A 2WACA 4JJNK 1KG1A 2PU9B 2DZCA 4M78E 3MEVA 3V7RA 2CZ7B 3FRNA 1OI1A 1I81A 4M7AB 2JTFA 1G3TA 1KC8C 1K8AU 4P5NA 3OS5A 2KDSA 1S72A 1Q7YC 2EYQA 1QVPA 3A8MB 3HKSA 4M78C 2HD0A 3S6WA 2KMTA 2XHCA 1VQ8A 2DO3A 2LRQA 4JDSA 2XDBA 3JCMf 2DZ9A 3QZ5B 3DKMA 3A8GB 3EAEA 3OBWA 2CZ6B 3CCVT 1B34A 1M90C 4IURA 2P0KA 2DD4A 2RI2A 5GAOq 2E12A 3OYMA 4MZMA 4QW2A 2VC8A 2XICA 4BUGA 1VQNT 2LT1A 3OSVA 2G3RA 3LYIA 3JCMh 4M7DA 4C92A 1VUBA 4DOWA 3CCEA 3M4GA 4QVZA 1NPPA 4C0ZA 1P92A 2GCXA 1H641 3MP8A 2XG8D 3CCVA 3OBYA 2R58A 4M75G 4OF1A 4XK8E 5KE2A 2HNIA 5GAOl 4EMKA 1M9SA 3NTIA 2VUBA 3QYHB 5EG2A 3EFRA 2JUFA 3GIBA 5LJ3j 4M75F 3CCUA 4IUVA 2EKOA 5IN1A 2EIFA 4R55A 4BE1A 1U1SA 2DEQA 1AHJB 5LJ3g 4M77E 3L2RA 1QW1A 2EQUA 5GAN4 3OA6A 3OYCA 2JTMA 4BI3A 3T9NA 3GNFB 2H3JA 2RO0A 3C95A 3FIFA 2RK1A 3KBGA 3UWNA 4M77C 5A0LA 2HBPA 2E41A 3QYGB 3CD6A 2OTJA 3OYGA 4PJOA 4BI8B 1VQ7T 3OW2A 1VIFA 2IVWA 3E19A 3ASKA 4C8QC 3L2ZA 5KH6A 5D6YA 3L2UA 1BIAA 2DXBA 4XTUA 1VQ6T 1B34B 1UGSB 2D9TA 2ZPEB 3RUXA 3L2QA 3CC4A 5FU6C 5A0DA 1X6OA 3UPUA 2OTLA 1U8RA 5GAOm 4A4EA 4M7DB 1YI2A 4C92B 2EAYA 5C6SA 4N0AC 1UGQB 4Y91A 5GANe 1VQ7A 4M78G 2QQRA 4RG8A 3JB9G 1M1KU 1VQ6A 5A2QE 4NOYA 1VQ9T 2K5FA 2M9UA 4M78F 4Y28E 3BDUA 2KVQG 4EMKB 1K9MU 4NL2A 3JB9F 1G3YA 1FWZA 3J80E 3FJPA 1K73C 5GAOr 3M58A 1Q82C 2LDMA 4HT8A 2LVMA 3QIIA 4D6WA 2RJFA 3JB9I 4OGCA 2LCCA 3GLXA 1KQSS 4QQDA 1KHIA 4XTYA 2M1HA 2DXCA 5CO7A 3A8LB 3OS1A 5GAMd 4QVCA 4L5GA 2HAXA 4DQ2A 4X9DA 3OYIA 2K4YA 3H8ZA 3G6EA 2RHXA 4PJOB 3S3OA 3CCJA 4N4IA 1BI2A 3JCMg 2O01E 3PMIA 4OB3B 2ZPHB 2ZZDA 2RA2A 4ZGJB 3JCMQ 1XNIA 2X35A 1TH7A 2XI9A 3OSSC 3CCSA 4EMGA 2C06A 5HKCA 3RIRA 3QXEB 4F7UA 1Q86C 1VQMA 1WQ7A 4B9WA 4C8QA 5CK9A 4ATOA 1MHNA 2RJCA 4M77G 2ZCFB 1O75A 5GMKh 3SDZA 2I2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQV A;  2OAU A;  2RK2 A;  3UDC A;  2RH2 A;  2VV5 A;  1VIF A;  3T9N A;  2RK1 A;  3SFM A;  2P4T A;  1VIE A; 
#chains in the Genus database with same CATH topology
 1UGV A;  1ZBX A;  2F1L A;  2QG9 B;  3OMG A;  4N0A A;  3CCQ T;  1AZE A;  1NJI C;  2KBT A;  3CCM A;  1TU0 B;  1YIJ T;  1D0X A;  4M75 C;  3DLM A;  1RUW A;  1Y57 A;  3F70 A;  5GAN g;  3J81 E;  2GBQ A;  4IKF A;  2L0A A;  1KQ1 A;  1AOJ A;  1SF9 A;  3NFC A;  4F7U B;  1Y07 A;  1OZ2 A;  3X28 B;  3VS0 A;  3QDF A;  5KYU A;  5FU6 B;  1W2B S;  1HK9 A;  4A4H A;  2YLC A;  2HQX A;  1SSF A;  1X69 A;  3EGX B;  1JBM A;  2CT3 A;  2K5L A;  2DVJ A;  3JCM X;  2L89 A;  3AHU A;  2P0P A;  4WF2 A;  1OU8 A;  5L23 A;  1PD1 A;  3QPH A;  3WVE B;  1GCQ A;  1WJQ A;  3SWN A;  1KQ2 A;  3TVT A;  1IGU A;  2L8D A;  2KXD A;  3E9F A;  3JCM e;  2LQ8 A;  2YLB A;  3I56 Q;  2B8A A;  3CCR Q;  3QWY A;  2K2V A;  2JS0 A;  3OS2 A;  4LDX A;  2FPF A;  2X4X A;  2D8H A;  5CQY A;  3CXC S;  3JCM V;  5GAM j;  3CC2 T;  1JEG A;  4F16 A;  2FPE A;  2HMA A;  2W10 A;  3E2U A;  1BI0 A;  4KGV B;  1HXD A;  4E7I A;  2D0N A;  3TSZ A;  1Z9Q A;  2GQI A;  2NUT A;  1RI0 A;  4KRT A;  4LDV A;  4QQG A;  2PVD B;  1Y96 A;  2QXF A;  2DK3 A;  1R8O B;  4A63 B;  2GFU A;  2E5K A;  1AVZ C;  3KFV A;  4M75 B;  3V8K A;  5FU7 C;  2L3P A;  4JJC A;  4QQ6 A;  2CKK A;  3FLG A;  3MEW A;  1U3O A;  1M1K R;  4OMP A;  2R5A A;  1KHC A;  5KYY B;  1YFN A;  4RCC A;  2RB6 A;  1XOV A;  4KBM B;  1WZO A;  3G4S T;  1QKX A;  4LUD A;  4KT0 E;  1BI1 A;  2LCL A;  1WJS A;  1QVG S;  3CC7 T;  1QCO A;  4CC3 A;  2FYK A;  2CZ0 B;  2F69 A;  1NYF A;  1X75 C;  4M78 B;  3OYN A;  1M2V A;  4AG1 C;  1WLP B;  2ATC B;  1EIF A;  4J83 A;  5LJ5 d;  3CCL Q;  3V8J A;  5GAO p;  2M51 A;  2R57 A;  4J8O A;  3L1A A;  4C5G A;  4OMM A;  1VQL A;  1YCY A;  3GOX A;  1F1B B;  4AG2 C;  2X3W D;  4KH1 B;  4A54 A;  5J3B A;  2HDA A;  1Q81 C;  2J7I A;  1VA7 A;  3Q1J A;  4M77 B;  4QKU A;  2SEM A;  1GFC A;  2E6Z A;  2MWO A;  2K5I A;  1U5S A;  1H8K A;  4PJL A;  1FX7 A;  4M7A F;  5GMK i;  2DEU A;  1VIE A;  1BIB A;  3RDV A;  4MDW A;  3G7Z A;  2H8H A;  4EMK C;  2DPP B;  4PJN A;  1YJ9 T;  1Y7X A;  4C8Q D;  4J9F A;  5J39 A;  1Q7Y U;  3CCQ Q;  1UG1 A;  1Q7Y R;  2PVO B;  4HVV A;  1D3B A;  4KGZ B;  2HSP A;  1XQH A;  2MF2 A;  1WX6 A;  2RJE A;  1ZSG A;  2EJF A;  4X1V A;  1RAF B;  4R0K A;  3PMT A;  4O6J A;  1VQO A;  3S3M A;  5CKD A;  2AZV A;  1TSF A;  1AD5 A;  2PQW A;  3OS0 A;  4JUV A;  3VS3 A;  2MYS A;  2RNA A;  3AT1 B;  1I5O B;  4M7D G;  2F2X A;  4C92 G;  1OZ3 A;  2A37 A;  2DX1 A;  4XTX A;  1CKB A;  1NPR A;  1WIE A;  1PCX A;  1IRE B;  3C94 A;  2BZX A;  2RF0 A;  4LDY A;  4AFU C;  1I8F A;  5HY6 A;  2V8I A;  1HJD A;  2YUQ A;  2XD0 A;  4C8Q E;  1PHT A;  4LE9 A;  5LJ5 j;  4J9G A;  1T0H A;  1YI2 T;  3UDC A;  2XID A;  1VQ5 A;  2F5T X;  3SFM A;  5GAN h;  2QTV A;  1WQW A;  3G1J A;  4PJO G;  3IQL A;  1OQK A;  3SD4 A;  3PTA A;  3G71 A;  3EG2 A;  1YJW Q;  1MMG A;  1NE8 A;  4CI0 C;  3UT1 A;  3MET A;  1E6G A;  3VYH B;  4JRP A;  2X4Y A;  2CRE A;  3PVQ A;  4KUD K;  3P8B B;  4PJM A;  3MO8 A;  1BCO A;  4KGX B;  2DYB A;  1YIT A;  4FCY A;  4UC4 A;  2M0O A;  5CR2 A;  3CCS T;  4GBQ A;  3M53 A;  4A4F A;  3VYG A;  3JB9 D;  4ZN3 A;  2V8J A;  4FSX A;  2RI5 A;  2MCN A;  3ER0 A;  4JJD A;  5LJ3 f;  2QQ9 A;  5GAN 3;  3LGF A;  1T3L A;  1JJ2 P;  4M7A A;  2FPD A;  2GF7 A;  4F7U F;  4K11 A;  4VUB A;  5KE3 A;  2BE9 B;  2C0T A;  2FL7 A;  4ZTJ A;  4HCB A;  2E10 A;  1VQ4 A;  4RTX A;  6AT1 B;  3TEE A;  2DTH A;  2MIO A;  4BI4 A;  3ZEH A;  2J06 A;  4RG2 A;  4FYX B;  2D8J A;  2KSS A;  2OI3 A;  3JCM d;  2ABL A;  3CBM A;  4QVD A;  3QBY A;  3MHX A;  2DE0 X;  1ABO A;  1JXO A;  4ANJ A;  1RAG B;  2PU9 B;  2AZS A;  1KC8 C;  4P5N A;  1M27 C;  3HKS A;  2HD0 A;  2XHC A;  2DO3 A;  1D0Z A;  3A8G B;  1UEC A;  2EYY A;  2P0K A;  2RI2 A;  5GAO q;  1MMD A;  2F2V A;  4MZM A;  2XIC A;  2QEX Q;  2ZAE A;  4C0Z A;  2GCX A;  1R0B G;  3MP8 A;  3CCV A;  4XK8 E;  1YJ9 Q;  1I07 A;  2LX7 A;  3EFR A;  4M75 F;  5IN1 A;  1MV0 B;  2EIF A;  4AT1 B;  1U1S A;  2EQU A;  3OA6 A;  4JPB W;  1QWF A;  3EG0 A;  4OMN A;  3T9N A;  1K4U S;  1B3Q A;  1WHL A;  3UWN A;  2VB6 A;  4BI8 B;  4C8Q C;  1BIA A;  2DXB A;  3L2Q A;  2ZPE B;  3RUX A;  2OTL A;  2FRW A;  2KRM A;  1VQ7 A;  4Y91 A;  1SG5 A;  1IGQ A;  1VQ6 A;  1I0C A;  3EG3 A;  4M78 F;  1K9M U;  4NL2 A;  1K73 C;  5GAO r;  1K9M R;  1NYG A;  3M58 A;  1Q82 C;  4HT8 A;  2LVM A;  2KT8 A;  1KQS P;  2COW A;  1FMV A;  1AWJ A;  4L5G A;  4QVC A;  4JZ3 A;  1V76 A;  3OYI A;  4X9D A;  4OML A;  4FYV B;  1LVK A;  4OB3 B;  4LNP A;  4F17 A;  1K9A A;  3OSS C;  1YI2 Q;  2LP5 A;  4EMG A;  4F7U A;  4OMQ A;  2RJC A;  2QGG A;  4FYY B;  2LJ1 A;  4M77 F;  4E7Z A;  3EGX A;  3RKW A;  5GAO n;  3TCJ A;  1UHF A;  5GAM h;  1FYN A;  2JOY A;  2DIL A;  5GAN j;  3U23 A;  3I56 T;  3RKX A;  3CCS Q;  4E7S A;  1YIJ A;  2FHD A;  2DYI A;  1KSW A;  1N5Z A;  5CAI A;  1N8R C;  5M9O A;  3CME A;  1XTD A;  3O8V A;  3LLR A;  3ZBD A;  2A3L A;  1X27 A;  4C8Q B;  3TQ7 P;  3HP9 A;  3OMC A;  2ED0 A;  1MMN A;  1M3B A;  4F04 B;  1W2B P;  3P8D A;  1PNJ A;  4ME7 A;  1WGS A;  1QKW A;  5IXB A;  3VV0 A;  2KT1 A;  1KD1 U;  3RBB B;  1JJ2 A;  5CKE A;  1KD1 R;  3M56 A;  2DJZ A;  2KYM A;  1QVF S;  2JM8 A;  4M75 A;  1B07 A;  3M0P A;  2DA9 A;  4J6W A;  1K1Z A;  1KK7 A;  3H6Z A;  1VQN A;  3INZ A;  5KYY A;  3THK A;  4XU2 A;  1ABQ A;  3RNJ A;  3CXC P;  2RN8 A;  1ZHI A;  2X9H A;  1CKA A;  2QA4 T;  1GBR A;  3CMA T;  4LN2 A;  2VXE A;  2A7Y A;  1IXD A;  2O9V A;  3OYK A;  2NWM A;  3CC2 A;  2GFA A;  4M78 A;  2LQK A;  3R6O A;  2L3Q A;  2KQW A;  2QTX A;  3CCL T;  2BZ8 A;  3DB4 A;  4Z02 A;  2O4X A;  2HQE A;  5HK0 A;  2HL5 C;  1VQ9 A;  2E5Q A;  3OYJ A;  2DL5 A;  1X01 A;  3PNW C;  1QVG P;  1TTH B;  2FEI A;  2BIV A;  3G4S A;  4M77 A;  3NPF A;  4IUT A;  2CSQ A;  3GBQ A;  4N4G A;  3H9N A;  3CC7 A;  2HBW A;  1QCN A;  5GMK e;  1VQK T;  3NMZ C;  4J7F A;  4BDZ A;  1H92 A;  2J6F A;  5CVI A;  1NJI U;  4RUG A;  2KXC A;  3C12 A;  1WXU A;  3JAM E;  3EGD B;  1JXM A;  4J6X A;  2DTO A;  3RMQ A;  2EQM A;  4C0F A;  4HKE A;  4JZ4 A;  4DBQ A;  1KQS A;  5GAN 6;  3QDR B;  3MCA B;  4AFQ C;  3VKI A;  4CC7 A;  3I55 A;  2VAS A;  4M7A G;  5FLX E;  1TS9 A;  4J7I A;  4M7D C;  2YUO A;  4C92 C;  3JCM J;  1G3S A;  2RQR A;  4JS5 A;  1AWO A;  4HCZ A;  4II1 A;  4MMK A;  5LJ5 h;  2RHY A;  1G3W A;  1VQP Q;  2OX7 A;  5AT1 B;  2DXU A;  4E7K A;  2X4J A;  1ZSZ C;  4FM4 B;  3CEY A;  3VU3 C;  2MWP A;  2BTT A;  2LNV A;  5GAN 5;  2IG0 A;  4WCI A;  4OB1 B;  2RQT A;  1QP3 A;  1M90 U;  4RKU E;  4PLL A;  2HKN A;  3PIP A;  2J6O A;  3OW2 S;  1M90 R;  2QAS A;  4PJO C;  4FT4 A;  1TXQ A;  3CBO A;  4EDU A;  4ELY C;  1UJY A;  3JB9 H;  3JCM P;  2LJ3 A;  1QWE A;  4ESR A;  1OUL A;  3X25 B;  4DEY A;  4OB0 B;  1YJW T;  4J9C A;  7AT1 B;  2JNG A;  3LWI A;  1MND A;  2MAM A;  3I9Q A;  3HSB A;  3H41 A;  1N9S A;  3EFO B;  2W0Z A;  5FWB A;  1W4S A;  2EJ9 A;  2E64 A;  2DAQ A;  1W2B A;  1ZBJ A;  3OYY A;  3CD6 T;  2OTJ T;  2GNC A;  5IT9 E;  4RTY A;  3BDL A;  5GMK m;  1YJN A;  3SHW A;  4JLG A;  1UE9 A;  2COY A;  2JW4 A;  2EJG A;  1ZA2 B;  5GAN f;  1M1F A;  2FZK B;  1T3S A;  4RMO A;  3PT9 A;  4EIK A;  3PE0 A;  2FO0 A;  2CGH A;  1NZ9 A;  1WHJ A;  4ZN1 A;  1M1K C;  1X2Q A;  3VS1 A;  1Z9Z A;  1D1B A;  3CXC A;  1M1G A;  1PD0 A;  2ED1 A;  2FB7 A;  2QA4 Q;  2K3B A;  3CMA Q;  1IO6 A;  3TRE A;  2RHI A;  3L2W A;  4BD3 A;  3VS6 A;  1RAI B;  3G6E T;  1MV3 A;  2RM4 A;  3CCJ T;  2EQJ A;  1PM3 A;  1R0C B;  4N4H A;  2CUB A;  5GAN 7;  2DER A;  2ZGW A;  4LUE A;  1VQM T;  2RHZ A;  2DIG A;  2WSE E;  2NYS A;  1E7O A;  3HL8 A;  3OY9 A;  1UJ0 A;  5CKH A;  2LCS A;  3OYA A;  4TVR A;  5HCK A;  2V8K A;  2DL7 A;  3CCM T;  3I5S A;  4F7U G;  1RL2 A;  1WDX A;  1BKB A;  3GP8 A;  3V8L A;  4Y92 A;  1NG2 A;  4C8Q F;  1GCP A;  4XTZ A;  3JB9 J;  1YHQ A;  1QVG A;  1GCQ C;  3SWN C;  4C5H A;  2JMA A;  1PKT A;  2AKL A;  2QEX T;  3HRT A;  4OVA A;  5FU7 B;  3MJX A;  1VQK Q;  3E9G A;  5J26 A;  2FVU A;  2YRV A;  4JJN K;  2P84 A;  1SHG A;  2DZC A;  2CZ7 B;  1OI1 A;  1I81 A;  2V1Q A;  2NUP B;  2OJ2 A;  2JTF A;  5KYN A;  1K8A U;  2KDS A;  1Q7Y C;  1K8A R;  2EYQ A;  1QVP A;  2KMT A;  1VQ8 A;  2DM1 A;  2XDB A;  2DBK A;  4AMC A;  2YT6 A;  3EAE A;  4D8D A;  4J9I A;  5I11 A;  1M3A A;  4BUG A;  2I0N A;  2LT1 A;  3JCM h;  1KIK A;  3CCE A;  2HQH A;  1D0Y A;  4AFZ C;  2KEA A;  2XG8 D;  4M75 G;  5KE2 A;  2DBM A;  2ROL A;  2COZ A;  1RLP C;  2VUB A;  2VVK A;  2JUF A;  3CCU A;  4IUV A;  1AHJ B;  5LJ3 g;  2MOX A;  3L2R A;  8AT1 B;  1S72 Q;  3OYC A;  4BI3 A;  4LXC A;  3GNF B;  2JMC A;  3FIF A;  3MKD A;  5A0L A;  2GGR A;  1M8M A;  2GTJ A;  2E41 A;  3OYG A;  1WHH A;  2LQN A;  5KH6 A;  4Z88 A;  3L2U A;  3CC4 A;  2EGC A;  2CP3 A;  5A0D A;  5GAO m;  2DL3 A;  4CC2 A;  4M78 G;  3CPW P;  3M0U A;  5IXF A;  2K5F A;  1UFF A;  4Y28 E;  2KVQ G;  4EMK B;  4FYW B;  3JB9 F;  1G3Y A;  1FWZ A;  3REB B;  4KH0 B;  1ZUY A;  4DEX A;  4D6W A;  1AZG B;  1VOM A;  4QQD A;  1KHI A;  2M1H A;  1WI7 A;  2DXC A;  3CD6 Q;  2OTJ Q;  3A8L B;  3OS1 A;  3H8Z A;  2RHX A;  2LQW A;  2AT1 B;  2O01 E;  3PMI A;  2ZZD A;  2RA2 A;  4ZGJ B;  1IHV A;  1TH7 A;  2EBP A;  2P4R A;  2YWW A;  2MPX C;  4B9W A;  4C8Q A;  4M77 G;  1O75 A;  3SDZ A;  4M4Z A;  1TG0 A;  2DJQ A;  1VQL T;  5GAM f;  4LDW A;  4EPC A;  5FRO A;  2XMF A;  5LJ3 e;  2EQI A;  3ZL7 C;  5I22 A;  3G6E Q;  3LX7 A;  3CCJ Q;  1WA7 A;  4BY6 C;  3LW5 E;  5KCH A;  4HA8 A;  5KYX B;  2M0Y A;  4PFO A;  1VQM Q;  2CP5 A;  3ULR B;  5I2S A;  2VGM A;  2CS7 A;  3CCR A;  3I56 A;  1LOJ A;  3M54 A;  3CCM Q;  4FW2 A;  1WNL A;  3V7C A;  2AKK A;  3OYF A;  3CQT A;  5IHI A;  1KC8 U;  1ZA1 B;  2AIR B;  2VV5 A;  1UEB A;  2DNU A;  1RAE B;  2LTO A;  1ZUU A;  1QVF P;  2J6K A;  1VQO T;  4X9C A;  1SPK A;  5GMK j;  1SEM A;  2EYX A;  2LNH B;  5CCA A;  1MUZ A;  3VUZ A;  1UDL A;  5A0G A;  4E47 A;  4B9X A;  1IRX A;  3M0R A;  1M3C A;  4XU0 A;  5HK3 A;  3BW1 A;  4OMO A;  4PNO A;  4YTL A;  3JV3 A;  1KFZ A;  3CMA A;  4V2S A;  1W1F A;  4GLK A;  1OX8 A;  2D0Q B;  2HZY A;  2X51 A;  1D1A A;  3V7S A;  1M5Q 1;  2X4W A;  1TUG B;  4IUU A;  4BY6 B;  2H3E B;  4O5V A;  1FMW A;  4ELZ C;  2EPD A;  1WHK A;  4M7D D;  4C92 D;  2OAU A;  4WTO B;  2V1R A;  3VRY A;  2KAF A;  4FL6 A;  2O88 A;  3REA B;  3CCL A;  1X2K A;  2YRD A;  2CP7 A;  3FDR A;  1Q82 U;  2DTI A;  3EGD A;  2QAZ A;  4M7A C;  3KXT A;  2DLP A;  3A1P A;  2DRM A;  2OAW A;  1YIT T;  1K9M C;  4XU3 A;  1UGR B;  1K0X A;  2AHJ B;  2M02 A;  4DOV A;  1N6A A;  2XDP A;  1VQP T;  1AWX A;  4PJO D;  1ZLM A;  4HCC A;  1OU9 A;  3QG1 A;  5IAY A;  5GJW B;  4E7J A;  2NUZ A;  4MML A;  2ZPB B;  3LWH A;  4A53 A;  3CPW A;  5CKB A;  3OYD A;  2ROT A;  4PLI A;  3CCQ A;  2YXY A;  4X34 A;  2FRY A;  4BAC A;  1VQ4 T;  4A4G A;  2DIQ A;  4M7D E;  1R77 A;  4C92 E;  4C5I A;  3X20 B;  5LJ5 f;  2G6F X;  2YSQ A;  1SRM A;  3EGU A;  2K57 A;  3LGL A;  1RAC B;  1MMA A;  2FZG B;  4ZTF A;  5L8R E;  4MZT A;  3RER A;  3EFO A;  1RLQ C;  2RPN A;  2C0O A;  1VQL Q;  2K9G A;  5FRM A;  2R5M A;  3SB2 A;  2AK5 A;  2K2M A;  3VS2 A;  4PJO E;  3X26 B;  1AEY A;  4GLM A;  1D09 B;  5FRN A;  3OW2 P;  2EW3 A;  2X3X D;  1PWT A;  2PZ1 A;  2YUN A;  2M16 A;  4E7L A;  1KD1 C;  1LPL A;  1WJR A;  5GMK l;  3OB9 A;  3C4S A;  3QJY A;  2RD1 A;  4BE0 A;  4HVU A;  2VYT A;  2DKG A;  1W6X A;  3J7A F;  1YJW A;  1BI3 A;  3QUI A;  4JRQ A;  4OMF B;  1LCK A;  3CBP A;  4A4K A;  1QLY A;  2DVE A;  2BKD N;  2CT4 A;  4ZGD B;  1M8V A;  2KY9 A;  3JCM c;  3M59 A;  3LH0 A;  4JRI A;  1VQO Q;  2OTL T;  1QVF A;  3QHS A;  3NTK A;  2P4T A;  4PFZ A;  2QI2 A;  2QGF B;  1V29 B;  1WYX A;  2LC4 A;  4PFP A;  1YP5 A;  3E1S A;  5GJV B;  1PG5 B;  3PFS A;  5IHN A;  2LZ6 B;  2JN0 A;  4XTV A;  3WXM B;  2L3R A;  2LMJ A;  2PTK A;  1EFN A;  3H0H A;  4CRI A;  2DF6 A;  3VJP A;  4MDX A;  2RQW A;  5LJ3 d;  4RTV A;  4JRK A;  1Q86 U;  1ARK A;  1Q86 R;  2HEQ A;  5IHK A;  1VQ5 Q;  1LNX A;  5GAN 2;  2L5Q A;  3BFM A;  3G71 Q;  2KRO A;  3M5A A;  4PKC C;  8ATC B;  4XU1 A;  1NJI R;  1JQQ A;  2QQB A;  3ZFJ A;  4C8Q G;  2IPO B;  1N9R A;  1PSF A;  2NUP A;  2JXB A;  2ZPG B;  4Q5W A;  1YIT Q;  1EX4 A;  1NLP C;  4J9E A;  2EWN A;  3QSU A;  1Y0M A;  1YBY A;  5EC7 A;  2YHT A;  3L42 A;  2RH2 A;  3CME T;  3UF4 A;  3HRU A;  3I5R A;  1SRL A;  3A8H B;  3RES A;  5I21 A;  1PC0 A;  2P0Q A;  2A28 A;  4KUI A;  2QEX A;  2CUD A;  3BY7 A;  3L2V A;  1S72 T;  2KR3 A;  4Z89 A;  1YJ9 A;  3ME9 A;  2WAC A;  1KG1 A;  3FRN A;  1C1A A;  1OEB A;  1G3T A;  3OS5 A;  1VQ4 Q;  3A8M B;  4M78 C;  2O2O A;  3EHQ A;  3JCM f;  2DZ9 A;  4DBR A;  3DKM A;  3OBW A;  2CZ6 B;  1M90 C;  4IUR A;  2QDL A;  3QWX X;  1WHM A;  1VQN T;  3TSW A;  2VC8 A;  3OSV A;  1G2B A;  1VUB A;  1X6B A;  4QVZ A;  1NPP A;  3RR6 A;  3OBY A;  4OF1 A;  5GAO l;  2HNI A;  3EG1 A;  4EMK A;  3O5Z A;  1M9S A;  3QYH B;  5EG2 A;  5LJ3 j;  3VS5 A;  4BE1 A;  2DEQ A;  1QW1 A;  5GAN 4;  2E4H A;  2HL3 A;  2K6D A;  2RK1 A;  4M77 C;  2HBP A;  3QYG B;  5KYW B;  3OW2 A;  1VIF A;  3E19 A;  3L2Z A;  1B34 B;  1RI9 A;  2D9T A;  5IH2 A;  4HCK A;  1X6O A;  3UPU A;  4A4E A;  4M7D B;  1YI2 A;  4C92 B;  3CCV Q;  4AFS C;  4N0A C;  2B86 A;  5GAN e;  1J3T A;  2QQR A;  3JB9 G;  1M1K U;  5A2Q E;  1VQ9 T;  2M9U A;  4HVW A;  1BK2 A;  3BDU A;  2JM9 A;  2JS2 A;  3D7S B;  1ZSZ B;  1YN8 A;  3J80 E;  4FW1 A;  2CH4 W;  2LDM A;  3QII A;  2RJF A;  3GLX A;  1TUC A;  1NEB A;  2K7A A;  1ZUK A;  3VS7 A;  2CSI A;  1G8X A;  2EKH A;  4DQ2 A;  3SEM A;  2K4Y A;  5KYX A;  3M0Q A;  4PJO B;  3EH1 A;  4N4I A;  2OTL Q;  2ZPH B;  1XNI A;  3CCS A;  2A36 A;  1VQ7 Q;  3QXE B;  1WQ7 A;  4ATO A;  4E6R A;  1VQ6 Q;  5GMK h;  2ZCF B;  1OOT A;  1AT1 B;  1XJW B;  1GXI E;  1YCS B;  3QO3 A;  1Q81 U;  2VXF A;  1IHW A;  3EHR A;  3UA6 A;  1Q81 R;  1FXX A;  2O4X B;  2ECZ A;  2Y4X A;  4CC4 B;  2E3H A;  2Y90 A;  5CIU A;  1QP2 A;  1ACM B;  3HFO A;  2CH4 A;  3OYE A;  3I55 T;  3PGG A;  2HSE B;  5D6X A;  3A5Z B;  5CKF A;  1TUD A;  1UTI A;  2Z0W A;  1UGP B;  2PNI A;  4DA4 A;  3EG9 B;  1K0S A;  3URG A;  2E65 A;  5KCO A;  2RJD A;  1YNZ A;  2EYW A;  1YWP A;  1JB0 E;  1OV3 A;  2LJ0 A;  5LL6 S;  1ZX6 A;  2PUK B;  3HRS A;  3NTH A;  1H3Z A;  2E70 A;  3I35 A;  4J9B A;  4QT7 A;  1O9S A;  2VWF A;  3JCM W;  2D6F A;  4NL3 A;  2K79 A;  4JJB A;  5I2M A;  3CPF A;  1K76 A;  4M7A D;  1WPY A;  5DY9 A;  4LD6 A;  3DB3 A;  1YIJ Q;  1C6V X;  1GFD A;  1K8A C;  3JCM b;  3CME Q;  1N27 A;  2MI6 A;  1GBQ A;  3TU4 K;  2EFI A;  3EFS A;  2E6N A;  4BDY A;  1WFW A;  2A0F B;  2QQA A;  4IUP A;  5KYU B;  1ZQ1 A;  4C0D C;  2CZ1 B;  4RTU A;  2BUD A;  1SKU B;  3WVD B;  5GAM g;  3MEU A;  2VKN A;  3H0F A;  4OP0 A;  2EQK A;  3S3N A;  2RMO A;  2EYZ A;  4BB7 A;  1YJN T;  2O31 A;  1WXT A;  2LT4 A;  1HD3 A;  1D1C A;  2XDD A;  3KUF A;  2GQV A;  1JO8 A;  3SWN B;  1Y71 A;  3N5B B;  2FG0 A;  1VQN Q;  3UAT A;  3HFN A;  4GY5 A;  4RTT A;  4NS5 A;  2FZC B;  2PVG B;  3GNG A;  3X24 B;  1OYX A;  4MZP A;  4M7A E;  1HSQ A;  1FMK A;  2DL4 A;  1NM7 A;  4HT9 A;  2GTO A;  3FJ5 A;  2XK0 A;  4Z8A A;  4L59 A;  3CC2 Q;  2DMO A;  5GAN 8;  4FU6 A;  1S1N A;  2NUT B;  2K3X A;  5C0M A;  1Y96 B;  4C5E A;  3DLL A;  1WHG A;  3M57 A;  2SRC A;  2KYB A;  3FEO A;  3GPL A;  4PK4 A;  4JS4 A;  2EGA A;  4B6M A;  4OGE A;  2ZPF B;  1BCM A;  2JTE A;  3OYL A;  1KJW A;  4LDU A;  4JLI A;  1VQP A;  2DXT A;  3VRZ A;  3OYB A;  3GF5 A;  4E2F B;  1VQ9 Q;  3NGP A;  5DLQ E;  1CSK A;  4L6V 5;  1PKS A;  5GAM e;  2QK0 A;  5DM7 R;  2RK2 A;  4FIB A;  1LJO A;  2JZ2 A;  3G4S Q;  4C0D B;  1YHQ T;  3LH5 A;  2RI3 A;  3CC7 Q;  4IIM A;  5ECA A;  2DET A;  1PRM C;  1A0N B;  3HHT B;  1I5L A;  4XQ3 A;  1X6G A;  1U1T A;  2WSF E;  1G83 A;  2BZY A;  1M2V B;  3RMS A;  2CP2 A;  2DRK A;  3M4Y A;  2XKO C;  1VYT A;  1MGQ A;  1IB8 A;  2F2W A;  3HPW A;  1KC8 R;  1OPL A;  3MP1 A;  9ATC B;  2Y4Y A;  1EZZ B;  1BU1 A;  1H3H A;  3QKJ A;  2DD5 A;  3PIO A;  1VQ8 T;  2ZPI B;  2QYZ A;  4BE2 A;  1M2O A;  2YDL A;  3OYH A;  1T0J A;  1Q95 G;  3I55 Q;  1UB4 A;  3M9Q A;  1VYV A;  3CCE T;  1I4K 1;  1B7T A;  4RCB A;  3PVL A;  2KK4 A;  2PUO B;  3MEA A;  4PJJ A;  3JSC A;  1PSE A;  2L3S A;  1I1J A;  5GAN d;  3CCU T;  4R56 A;  2NLU A;  2VGN A;  5D6W A;  2KGT A;  3M55 A;  5DLO A;  1W70 A;  2RQU A;  1GRI A;  2IIM A;  4M7D F;  4C92 F;  2QA4 A;  1D3B B;  2JT4 A;  4E7H A;  5AYF A;  1VQ5 T;  4J5Y A;  1RAD B;  2CP0 A;  4DBF A;  2E3I A;  4J6Y A;  4F7U E;  4HXJ A;  4D8K A;  1YWO A;  3JRZ A;  3CC4 T;  1SSH A;  5FW9 A;  3G71 T;  3OQ5 A;  2CYZ B;  4IIO A;  2ESW A;  5LJ5 g;  1E6H A;  2K3Y A;  4FSS A;  4M75 D;  4PL6 A;  1UHC A;  2JVV A;  1K73 U;  2RHU A;  3QJ6 A;  1K73 R;  4LD9 K;  1QCF A;  1QMC A;  1IZ6 A;  1Q82 R;  1G5V A;  1M4Z A;  2KRS A;  4PJO F;  1DJ7 B;  1BYM A;  3CPW S;  4ZGE B;  1OX9 A;  3FB9 A;  2QDY B;  2DFU A;  3NHN A;  1RAH B;  2WSC E;  3VUB A;  3FC3 A;  1YJN Q;  2HKQ B;  2EGE A;  4XTW A;  3HTR A;  5CQX A;  2F5K A;  3RKY A;  4KUL A;  1UUE A;  2LX9 A;  3R6N A;  1JRI A;  4EMH A;  4M78 D;  3M0S A;  2KE9 A;  2EVR A;  1U06 A;  3QZ9 B;  1VQK A;  3C0C A;  3A98 A;  4FT2 A;  2E1H A;  3H0I A;  1JJ2 S;  2XU8 A;  2JJ9 A;  1C0M A;  1SHF A;  1NBE B;  5LJ3 h;  4M75 E;  1JU5 C;  2C0I A;  1N8R U;  3A8O B;  2KI7 A;  2J05 A;  1N8R R;  1RAB B;  3BE3 A;  5FWC A;  1GL5 A;  4OB2 B;  2DL8 A;  2V26 A;  2QQS A;  4M77 D;  4XAX B;  3CCR T;  4IUQ A;  5LJ5 e;  1OPK A;  3MPU B;  1AWW A;  1PRL C;  1M30 A;  3P8H A;  3MP6 A;  4C0G A;  2MMP A;  4M78 E;  3V7R A;  3MEV A;  4J9D A;  4M7A B;  3M0T A;  1NLO C;  1YHQ Q;  1S72 A;  4F14 A;  5KYW A;  2KRN A;  3S6W A;  2LRQ A;  4JDS A;  3QZ5 B;  5D7U A;  1X43 A;  3CCV T;  1B34 A;  2CP6 A;  2DD4 A;  3OYM A;  2E12 A;  4J9H A;  4QW2 A;  2G3R A;  2L2P A;  3LYI A;  4M7D A;  4C92 A;  1HYO A;  4DBH A;  4DOW A;  3M4G A;  3EH2 A;  4ORZ A;  1P92 A;  1H64 1;  2R58 A;  2HCK A;  3NTI A;  1ZSZ A;  3GIB A;  2EKO A;  4R55 A;  2RQV A;  1QQJ A;  4M77 E;  1BB9 A;  2JTM A;  1TOV A;  2BE7 D;  2YRC A;  2A08 A;  2H3J A;  2RO0 A;  3C95 A;  1VQ8 Q;  3KBG A;  3CD6 A;  2OTJ A;  4PJO A;  1VQ7 T;  2MK5 A;  2IVW A;  3UA7 A;  3ASK A;  5D6Y A;  1VQ6 T;  1BBZ A;  4XTU A;  1UGS B;  4RTW A;  3CCE Q;  5FU6 C;  1U8R A;  2EAY A;  2ENM A;  5C6S A;  1UGQ B;  4RTZ A;  4RG8 A;  1RAA B;  1VYU A;  4NOY A;  3CCU Q;  2KNB B;  3FJP A;  2D1X A;  3JB9 I;  4OGC A;  2LCC A;  1KQS S;  4XTY A;  3VS4 A;  5CO7 A;  5GAM d;  1V1C A;  4ZNX A;  2HAX A;  1NEG A;  3G6E A;  2YUP A;  3S3O A;  2CDT A;  2O9S A;  3CC4 Q;  3CCJ A;  1BI2 A;  3JCM g;  3JCM Q;  2X35 A;  2XI9 A;  2C06 A;  3EG9 A;  5HKC A;  3RIR A;  1Q86 C;  1VQM A;  1MNE A;  1TWB A;  1WXB A;  5CK9 A;  1MHN A;  2I2L A; 
#chains in the Genus database with same CATH homology
 1ZBX A;  3OMG A;  4M77 F;  1VQL T;  5GAM f;  4N0A A;  3CCQ T;  4LDW A;  1GXI E;  3QO3 A;  1Q81 U;  2VXF A;  3RKW A;  4EPC A;  5GAO n;  1NJI C;  3TCJ A;  3CCM A;  1FXX A;  2O4X B;  5FRO A;  2Y4X A;  5GAM h;  5LJ3 e;  1YIJ T;  2Y90 A;  4M75 C;  3DLM A;  1QP2 A;  5CIU A;  2JOY A;  3HFO A;  3LX7 A;  5GAN j;  3OYE A;  3I55 T;  4BY6 C;  3PGG A;  3LW5 E;  3F70 A;  3RKX A;  5GAN g;  3J81 E;  5KCH A;  4HA8 A;  3I56 T;  1YIJ A;  2FHD A;  5D6X A;  3A5Z B;  5CKF A;  4IKF A;  5CAI A;  5I2S A;  1N8R C;  2VGM A;  1UGP B;  4DA4 A;  1KQ1 A;  5M9O A;  3NFC A;  3CME A;  1XTD A;  3O8V A;  3URG A;  3LLR A;  2E65 A;  1Y07 A;  2A3L A;  3ZBD A;  1OZ2 A;  2CS7 A;  3X28 B;  2RJD A;  4F7U B;  5KCO A;  3I56 A;  3CCR A;  1JB0 E;  5LL6 S;  1LOJ A;  4C8Q B;  3HP9 A;  3OMC A;  2PUK B;  3HRS A;  3NTH A;  1H3Z A;  2E70 A;  5FU6 B;  1W2B S;  3M54 A;  1HK9 A;  4A4H A;  1WNL A;  2YLC A;  2HQX A;  3V7C A;  3P8D A;  1SSF A;  4ME7 A;  1JBM A;  3OYF A;  1WGS A;  2K5L A;  1KC8 U;  1O9S A;  3VV0 A;  3JCM W;  3JCM X;  2L89 A;  4NL3 A;  1KD1 U;  1JJ2 A;  2VV5 A;  2D6F A;  3AHU A;  5CKE A;  5I2M A;  2P0P A;  1UEB A;  4WF2 A;  3M56 A;  2DJZ A;  3CPF A;  4M7A D;  2LTO A;  1WPY A;  5DY9 A;  1QVF S;  4LD6 A;  3DB3 A;  3QPH A;  3WVE B;  4M75 A;  1WJQ A;  3SWN A;  1VQO T;  1KQ2 A;  4X9C A;  2L8D A;  1K8A C;  3E9F A;  3JCM b;  5GMK j;  1N27 A;  4J6W A;  3JCM e;  2MI6 A;  3TU4 K;  2EFI A;  3EFS A;  2LQ8 A;  2YLB A;  3H6Z A;  2B8A A;  2E6N A;  1VQN A;  2K2V A;  4BDY A;  3INZ A;  3OS2 A;  4LDX A;  5CCA A;  3VUZ A;  2X4X A;  4XU2 A;  5A0G A;  5CQY A;  4E47 A;  3CXC S;  2QQA A;  4B9X A;  4IUP A;  1ZQ1 A;  3JCM V;  4C0D C;  2CZ1 B;  5GAM j;  3CC2 T;  1ZHI A;  2BUD A;  3WVD B;  5GAM g;  2QA4 T;  3MEU A;  1BI0 A;  3CMA T;  1HXD A;  4E7I A;  4OP0 A;  4XU0 A;  5HK3 A;  3BW1 A;  2VXE A;  2A7Y A;  2EQK A;  1RI0 A;  4PNO A;  4YTL A;  3S3N A;  4LDV A;  4QQG A;  4BB7 A;  3OYK A;  2PVD B;  1YJN T;  1Y96 A;  3CC2 A;  2QXF A;  2GFA A;  4M78 A;  2LT4 A;  2DK3 A;  1R8O B;  2XDD A;  3CMA A;  3KUF A;  2GFU A;  4V2S A;  2GQV A;  2LQK A;  4GLK A;  2D0Q B;  3R6O A;  4M75 B;  1Y71 A;  3N5B B;  3SWN B;  3V8K A;  2KQW A;  2QTX A;  5FU7 C;  1M5Q 1;  3V7S A;  2X4W A;  3HFN A;  2CKK A;  3FLG A;  3MEW A;  4GY5 A;  4QQ6 A;  4IUU A;  4BY6 B;  4NS5 A;  2R5A A;  3DB4 A;  4O5V A;  1KHC A;  4ELZ C;  2PVG B;  3GNG A;  4Z02 A;  3X24 B;  1OYX A;  4M7D D;  4MZP A;  4C92 D;  2OAU A;  2O4X A;  4RCC A;  4M7A E;  2RB6 A;  2KAF A;  4FL6 A;  1XOV A;  2HQE A;  5HK0 A;  3CCL A;  4KBM B;  4HT9 A;  1VQ9 A;  3FDR A;  3G4S T;  2DTI A;  1Q82 U;  2XK0 A;  4KT0 E;  1BI1 A;  2E5Q A;  4M7A C;  4L59 A;  2LCL A;  1WJS A;  3OYJ A;  3KXT A;  1X01 A;  1QVG S;  3CC7 T;  3PNW C;  1YIT T;  5GAN 8;  4FU6 A;  1K9M C;  2FYK A;  2BIV A;  2CZ0 B;  4XU3 A;  2F69 A;  2K3X A;  5C0M A;  3G4S A;  1UGR B;  1Y96 B;  4M77 A;  4C5E A;  2AHJ B;  3DLL A;  4DOV A;  1N6A A;  1X75 C;  2XDP A;  4M78 B;  3M57 A;  4IUT A;  3FEO A;  4N4G A;  3GPL A;  1VQP T;  3CC7 A;  4JS4 A;  4PJO D;  3OYN A;  4OGE A;  2ZPF B;  4HCC A;  5GMK e;  1VQK T;  4J7F A;  3QG1 A;  3OYL A;  5IAY A;  4E7J A;  4LDU A;  4BDZ A;  1EIF A;  4MML A;  4J83 A;  4JLI A;  5LJ5 d;  2ZPB B;  1VQP A;  3LWH A;  2DXT A;  3V8J A;  3OYB A;  5GAO p;  3GF5 A;  5CVI A;  4A53 A;  2R57 A;  4J8O A;  5DLQ E;  5CKB A;  3CPW A;  3L1A A;  4C5G A;  1NJI U;  3C12 A;  3OYD A;  3JAM E;  1VQL A;  1YCY A;  4L6V 5;  4PLI A;  3GOX A;  3CCQ A;  4J6X A;  5GAM e;  2DTO A;  3RMQ A;  2EQM A;  5DM7 R;  4C0F A;  2RK2 A;  4X34 A;  4FIB A;  4HKE A;  1LJO A;  2JZ2 A;  4BAC A;  4C0D B;  1YHQ T;  4A54 A;  4A4G A;  1VQ4 T;  5J3B A;  1KQS A;  1Q81 C;  5GAN 6;  2DIQ A;  4M7D E;  3QDR B;  4C92 E;  3Q1J A;  3MCA B;  2RI3 A;  4M77 B;  4C5I A;  2E6Z A;  3X20 B;  3VKI A;  5LJ5 f;  2MWO A;  2K5I A;  3I55 A;  4M7A G;  5FLX E;  4J7I A;  3HHT B;  1I5L A;  4XQ3 A;  3JCM J;  4C92 C;  4M7D C;  1G3S A;  1U1T A;  4JS5 A;  1FX7 A;  2WSF E;  4M7A F;  4HCZ A;  4II1 A;  3RMS A;  4MMK A;  1VIE A;  5GMK i;  5LJ5 h;  2RHY A;  1BIB A;  1G3W A;  3M4Y A;  4MDW A;  2K57 A;  3G7Z A;  2XKO C;  3LGL A;  1MGQ A;  4ZTF A;  2DXU A;  2DPP B;  4MZT A;  2X4J A;  5L8R E;  4EMK C;  4E7K A;  1YJ9 T;  3RER A;  1Y7X A;  4FM4 B;  4C8Q D;  3CEY A;  3HPW A;  3VU3 C;  2MWP A;  5J39 A;  1Q7Y U;  5FRM A;  2LNV A;  2R5M A;  3MP1 A;  2Y4Y A;  3SB2 A;  2PVO B;  5GAN 5;  2IG0 A;  4PJO E;  1D3B A;  4OB1 B;  3QKJ A;  2DD5 A;  3PIO A;  1QP3 A;  3X26 B;  3CCL T;  4RKU E;  1M90 U;  4PLL A;  3PIP A;  1VQ8 T;  3OW2 S;  2ZPI B;  1XQH A;  4BE2 A;  5FRN A;  2MF2 A;  3OYH A;  4PJO C;  2RJE A;  4FT4 A;  3CBO A;  4EDU A;  1UB4 A;  2EJF A;  2M16 A;  4ELY C;  4E7L A;  1KD1 C;  3M9Q A;  1WJR A;  3JB9 H;  3PMT A;  4O6J A;  5GMK l;  3JCM P;  3CCE T;  1VQO A;  3S3M A;  1I4K 1;  4RCB A;  3X25 B;  5CKD A;  3OB9 A;  2KK4 A;  3C4S A;  4OB0 B;  1YJW T;  2PUO B;  3QJY A;  3MEA A;  2RD1 A;  4BE0 A;  2VYT A;  2JNG A;  3JSC A;  2PQW A;  1PSE A;  3LWI A;  3OS0 A;  2MAM A;  3HSB A;  4JUV A;  5GAN d;  1N9S A;  3CCU T;  2DKG A;  1W4S A;  2EJ9 A;  3J7A F;  2E64 A;  2DAQ A;  1BI3 A;  1YJW A;  4C92 G;  4R56 A;  4M7D G;  2NLU A;  2VGN A;  3QUI A;  5D6W A;  4JRQ A;  1OZ3 A;  3M55 A;  4XTX A;  1W2B A;  5DLO A;  1NPR A;  4OMF B;  4M7D F;  1IRE B;  3C94 A;  1D3B B;  4C92 F;  3OYY A;  3CBP A;  2QA4 A;  3CD6 T;  4E7H A;  2OTJ T;  4A4K A;  4LDY A;  5AYF A;  5IT9 E;  2DVE A;  1VQ5 T;  1I8F A;  2BKD N;  4J5Y A;  5HY6 A;  2V8I A;  3BDL A;  4ZGD B;  5GMK m;  4F7U E;  4J6Y A;  1YJN A;  2KY9 A;  1M8V A;  3JCM c;  3JRZ A;  3LH0 A;  3M59 A;  4JLG A;  4JRI A;  4C8Q E;  3CC4 T;  2XD0 A;  5LJ5 j;  2OTL T;  3G71 T;  1QVF A;  2EJG A;  3OQ5 A;  2CYZ B;  3NTK A;  3QHS A;  2P4T A;  1M1F A;  5GAN f;  1YI2 T;  5LJ5 g;  2QI2 A;  4RMO A;  3PT9 A;  2XID A;  3UDC A;  1VQ5 A;  2F5T X;  2K3Y A;  1V29 B;  2LC4 A;  4M75 D;  4PL6 A;  2JVV A;  3E1S A;  1K73 U;  3SFM A;  2RHU A;  3QJ6 A;  3PFS A;  4PJO G;  1WQW A;  5GAN h;  4LD9 K;  2CGH A;  3SD4 A;  3PTA A;  1NZ9 A;  3G71 A;  2JN0 A;  4ZN1 A;  1IZ6 A;  1G5V A;  1M4Z A;  1M1K C;  4PJO F;  1DJ7 B;  1NE8 A;  4XTV A;  1BYM A;  3WXM B;  4CI0 C;  2L3R A;  3CPW S;  3UT1 A;  3CXC A;  3MET A;  1M1G A;  4ZGE B;  2FB7 A;  3FB9 A;  2QDY B;  3VYH B;  4JRP A;  2X4Y A;  3TRE A;  2RHI A;  3L2W A;  4CRI A;  4BD3 A;  3VJP A;  4KUD K;  3P8B B;  2WSC E;  3VUB A;  3FC3 A;  4MDX A;  3MO8 A;  3G6E T;  5LJ3 d;  2RM4 A;  1YIT A;  4JRK A;  3CCJ T;  1Q86 U;  2EQJ A;  4XTW A;  4UC4 A;  4N4H A;  5CQX A;  2F5K A;  2M0O A;  5CR2 A;  3CCS T;  3RKY A;  4KUL A;  2LX9 A;  3M53 A;  5GAN 7;  1JRI A;  2ZGW A;  3VYG A;  4A4F A;  4EMH A;  1VQM T;  1LNX A;  2RHZ A;  4M78 D;  2DIG A;  2WSE E;  3JB9 D;  4ZN3 A;  5GAN 2;  2L5Q A;  3BFM A;  3HL8 A;  2V8J A;  3M5A A;  2RI5 A;  4FSX A;  4PKC C;  3OY9 A;  4XU1 A;  3QZ9 B;  1VQK A;  5CKH A;  2QQB A;  3ER0 A;  4TVR A;  3OYA A;  2V8K A;  4FT2 A;  2E1H A;  3CCM T;  5LJ3 f;  2QQ9 A;  3ZFJ A;  1RL2 A;  4F7U G;  3LGF A;  2XU8 A;  5GAN 3;  1JJ2 S;  1BKB A;  4C8Q G;  3GP8 A;  4M7A A;  1N9R A;  1PSF A;  2ZPG B;  2GF7 A;  4F7U F;  5LJ3 h;  4M75 E;  4Q5W A;  4VUB A;  3V8L A;  5KE3 A;  4C8Q F;  4ZTJ A;  2FL7 A;  4HCB A;  2E10 A;  3A8O B;  1N8R U;  4XTZ A;  3JB9 J;  2EWN A;  1YHQ A;  1VQ4 A;  1QVG A;  3QSU A;  3SWN C;  1YBY A;  4C5H A;  3TEE A;  2DTH A;  2YHT A;  2QEX T;  4BI4 A;  4OB2 B;  3L42 A;  2RH2 A;  3CME T;  3ZEH A;  2QQS A;  4M77 D;  3HRU A;  4RG2 A;  3HRT A;  4XAX B;  4OVA A;  3CCR T;  4IUQ A;  3A8H B;  3RES A;  5LJ5 e;  2KSS A;  5I21 A;  5FU7 B;  3JCM d;  2P0Q A;  3CBM A;  3E9G A;  3QBY A;  4KUI A;  3MHX A;  3BY7 A;  5J26 A;  4QVD A;  3L2V A;  2QEX A;  2FVU A;  1S72 T;  3P8H A;  2YRV A;  3MP6 A;  4C0G A;  2MMP A;  1YJ9 A;  3ME9 A;  2WAC A;  4JJN K;  1KG1 A;  2PU9 B;  2DZC A;  4M78 E;  3MEV A;  3V7R A;  2CZ7 B;  3FRN A;  1OI1 A;  1I81 A;  4M7A B;  2JTF A;  1G3T A;  1KC8 C;  1K8A U;  4P5N A;  3OS5 A;  2KDS A;  1S72 A;  1Q7Y C;  2EYQ A;  1QVP A;  3A8M B;  3HKS A;  4M78 C;  2HD0 A;  3S6W A;  2KMT A;  2XHC A;  1VQ8 A;  2DO3 A;  2LRQ A;  4JDS A;  2XDB A;  3JCM f;  2DZ9 A;  3QZ5 B;  3DKM A;  3A8G B;  3EAE A;  3OBW A;  2CZ6 B;  3CCV T;  1B34 A;  1M90 C;  4IUR A;  2P0K A;  2DD4 A;  2RI2 A;  5GAO q;  2E12 A;  3OYM A;  4MZM A;  4QW2 A;  2VC8 A;  2XIC A;  4BUG A;  1VQN T;  2LT1 A;  3OSV A;  2G3R A;  3LYI A;  3JCM h;  4M7D A;  4C92 A;  1VUB A;  4DOW A;  3CCE A;  3M4G A;  4QVZ A;  1NPP A;  4C0Z A;  1P92 A;  2GCX A;  1H64 1;  3MP8 A;  2XG8 D;  3CCV A;  3OBY A;  2R58 A;  4M75 G;  4OF1 A;  4XK8 E;  5KE2 A;  2HNI A;  5GAO l;  4EMK A;  1M9S A;  3NTI A;  2VUB A;  3QYH B;  5EG2 A;  3EFR A;  2JUF A;  3GIB A;  5LJ3 j;  4M75 F;  3CCU A;  4IUV A;  2EKO A;  5IN1 A;  2EIF A;  4R55 A;  4BE1 A;  1U1S A;  2DEQ A;  1AHJ B;  5LJ3 g;  4M77 E;  3L2R A;  1QW1 A;  2EQU A;  5GAN 4;  3OA6 A;  3OYC A;  2JTM A;  4BI3 A;  3T9N A;  3GNF B;  2H3J A;  2RO0 A;  3C95 A;  3FIF A;  2RK1 A;  3KBG A;  3UWN A;  4M77 C;  5A0L A;  2HBP A;  2E41 A;  3QYG B;  3CD6 A;  2OTJ A;  3OYG A;  4PJO A;  4BI8 B;  1VQ7 T;  3OW2 A;  1VIF A;  2IVW A;  3E19 A;  3ASK A;  4C8Q C;  3L2Z A;  5KH6 A;  5D6Y A;  3L2U A;  1BIA A;  2DXB A;  4XTU A;  1VQ6 T;  1B34 B;  1UGS B;  2D9T A;  2ZPE B;  3RUX A;  3L2Q A;  3CC4 A;  5FU6 C;  5A0D A;  1X6O A;  3UPU A;  2OTL A;  1U8R A;  5GAO m;  4A4E A;  4M7D B;  1YI2 A;  4C92 B;  2EAY A;  5C6S A;  4N0A C;  1UGQ B;  4Y91 A;  5GAN e;  1VQ7 A;  4M78 G;  2QQR A;  4RG8 A;  3JB9 G;  1M1K U;  1VQ6 A;  5A2Q E;  4NOY A;  1VQ9 T;  2K5F A;  2M9U A;  4M78 F;  4Y28 E;  3BDU A;  2KVQ G;  4EMK B;  1K9M U;  4NL2 A;  3JB9 F;  1G3Y A;  1FWZ A;  3J80 E;  3FJP A;  1K73 C;  5GAO r;  3M58 A;  1Q82 C;  2LDM A;  4HT8 A;  2LVM A;  3QII A;  4D6W A;  2RJF A;  3JB9 I;  4OGC A;  2LCC A;  3GLX A;  1KQS S;  4QQD A;  1KHI A;  4XTY A;  2M1H A;  2DXC A;  5CO7 A;  3A8L B;  3OS1 A;  5GAM d;  4QVC A;  4L5G A;  2HAX A;  4DQ2 A;  4X9D A;  3OYI A;  2K4Y A;  3H8Z A;  3G6E A;  2RHX A;  4PJO B;  3S3O A;  3CCJ A;  4N4I A;  1BI2 A;  3JCM g;  2O01 E;  3PMI A;  4OB3 B;  2ZPH B;  2ZZD A;  2RA2 A;  4ZGJ B;  3JCM Q;  1XNI A;  2X35 A;  1TH7 A;  2XI9 A;  3OSS C;  3CCS A;  4EMG A;  2C06 A;  5HKC A;  3RIR A;  3QXE B;  4F7U A;  1Q86 C;  1VQM A;  1WQ7 A;  4B9W A;  4C8Q A;  5CK9 A;  4ATO A;  1MHN A;  2RJC A;  4M77 G;  2ZCF B;  1O75 A;  5GMK h;  3SDZ A;  2I2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...