4L59A

Crystal structure of the 3-mbt repeat domain of l3mbtl3 and unc2533 complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
313
structure length
307
Chain Sequence
WCWASYLEEEKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFEVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYNVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein 3
publication title The structure-activity relationships of L3MBTL3 inhibitors: flexibility of the dimer interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 307
sequence length 313
ec nomenclature
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l59A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l59A03
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l59A01
2WACA 4N4HA 2PQWA 2X4WA 3DLMA 2RI2A 4QW2A 3MO8A 4A4EA 4C5EA 5J39A 2XDPA 4B9WA 4NS5A 2GF7A 4E7HA 2RJCA 4X34A 3NTIA 4GY5A 4LD6A 3OS0A 2HQEA 4IUQA 3MP6A 5M9OA 4IUPA 3OYFA 4BDZA 1H3ZA 2RJDA 3QBYA 5D6XA 2G3RA 4BACA 2QQSA 2JZ2A 3MP1A 5FRNA 1N27A 3DB4A 3O8VA 3MEWA 2E6NA 2B8AA 2O4XB 1OZ2A 3OYMA 5IAYA 1OZ3A 2X35A 2R5MA 3LH0A 2XK0A 2LRQA 4ZTJA 2MWOA 3OYHA 2RJFA 5KCOA 4IUUA 2MWPA 2JTFA 4IKFA 4E7JA 2DAQA 3ZEHA 2BKDN 2GFUA 2M0OA 4IUTA 4EDUA 3PFSA 3Q1JA 4ZTFA 2L8DA 2VYTA 4Z02A 4A4FA 3LGLA 2DIQA 1OI1A 2BUDA 3MEAA 2CKKA 2K3YA 2NLUA 5IN1A 4II1A 2RHUA 4UC4A 3S3MA 3L2QA 3META 2RI3A 4BE2A 4QQ6A 3ASKA 2RHXA 2DIGA 1WJRA 3OMGA 4FU6A 3MP8A 3LLRA 4IURA 3P8DA 5D6YA 1WGSA 2RO0A 5FRMA 3PMIA 3DB3A 2M16A 3QIIA 2EQJA 2LTOA 4A4GA 2RJEA 2LVMA 2QQRA 3PNWC 5KH6A 4N4GA 3OY9A 5FROA 3S3OA 5D6WA 4A4HA 5KE3A 3EAEA 3LX7A 3GOXA 3SD4A 3FC3A 1OYXA 4CRIA 2EQUA 3OA6A 1KHCA 4C5GA 2R58A 3H6ZA 3PMTA 4N4IA 1MHNA 3OYBA 4E7KA 5C6SA 4E7IA 3H8ZA 4C5HA 3S3NA 2D9TA 1RI0A 2F5KA 3OMCA 3KUFA 3OQ5A 2EKOA 2YRVA 3F70A 4Q5WA 3UWNA 2RI5A 2R57A 3L2WA 1SSFA 2HQXA 4PLLA 3OS1A 4QVZA 5KCHA 3C4SA 5J26A 4BD3A 2P0KA 4QQGA 3FLGA 2L89A 4QQDA 4B9XA 3OYNA 3OS2A 3OYIA 3OYJA 2L3RA 4E7LA 2EQKA 3LYIA 2RHIA 1WJSA 3OYKA 4BE0A 4L59A 5C0MA 3P8HA 1XNIA 3E9FA 3ME9A 4IUVA 4HCZA 3OYEA 3NTKA 4FL6A 5KE2A 3OYCA 5CIUA 3OYDA 3OYGA 3L2VA 2GFAA 4PL6A 4RG2A 3L2UA 4BDYA 3OB9A 1G5VA 2R5AA 2K3XA 3LGFA 3MEVA 3MEUA 2LDMA 3L42A 2LCCA 3OYAA 3OYLA 2RHZA 3L2RA 2EFIA 3QJ6A 2IG0A 4BE1A 4OVAA 3E9GA 3UT1A 2X4XA 3QKJA 2FHDA 2M1HA 2O4XA 2X4YA 2BIVA 2RHYA 2EQMA 3FDRA 3BDLA 4PLIA 2E5QA 4C5IA 3S6WA 3CEYA 3M9QA 1WJQA 3NTHA 3FEOA
chains in the Genus database with same CATH superfamily
1YFNA 2VV5A 3JB9D 4NL2A 3MO8A 1GXIE 4JJCA 1PCXA 5GAN7 1W70A 4M7AG 3WXMB 5GAN6 1B7TA 2KVQG 4ZGEB 2LNVA 3X28B 3QBYA 5D6XA 4DEYA 5FRNA 3GBQA 1M1GA 3VS6A 5HK3A 1YI2A 3G71A 1VQPA 2CZ1B 4ATOA 1TG0A 2QQAA 2AIRB 1OV3A 4C0DC 4A4FA 3WVDB 5GAOn 4DBRA 1ZX6A 3JCMW 5CQYA 4V2SA 1GCPA 1M1FA 2RHXA 3H41A 5D6YA 1YHQA 1U1TA 2GGRA 2LTOA 3S3OA 1OEBA 2O9SA 3I35A 2L2PA 2LQKA 2QI2A 3VS4A 1MV3A 4CC4B 1M1KC 1KIKA 4C5HA 1AOJA 1Y96A 2DE0X 2KBTA 1SSFA 4PLLA 3THKA 5KCHA 2PUOB 2XMFA 3NMZC 1GFCA 3VUZA 3LYIA 3OYKA 1MNDA 2G6FX 1PG5B 3JV3A 4OMMA 3ME9A 4HVWA 2E1HA 2YUQA 3X24B 1QW1A 2JTEA 3LW5E 1U8RA 1ZUYA 3OYLA 5KYXA 2A7YA 2H8HA 1VIFA 2Z0WA 4OVAA 3V7CA 4EMKC 2LT1A 5A0DA 1YI2Q 4OMOA 4DQ2A 3G71Q 1VQPQ 2O88A 5HY6A 5GANf 3M0PA 2B86A 1N8RU 3G1JA 5J39A 2XDPA 4KBMB 3JCMc 1UGVA 3M0RA 4GLKA 5GJVB 3M0TA 1QVGA 2V1QA 3CCUT 4HA8A 2F69A 4QT7A 5CK9A 4P5NA 1XTDA 4MDXA 4HT8A 1RUWA 4RUGA 4Z8AA 3U23A 4M7DF 1ZUUA 1AZEA 4IUUA 3I56A 3ZEHA 2HMAA 2LJ0A 2M51A 3SFMA 1AHJB 1LOJA 2MOXA 1K9AA 3HTRA 2QEXT 3V8JA 3A8OB 4ANJA 1WHMA 2AHJB 1T0HA 3RBBB 3QXEB 4J9IA 1RABB 3A98A 2QDYB 3LLRA 4O5VA 3RMSA 1M8MA 1QLYA 5KH6A 2GTJA 2M9UA 4XTUA 4LUEA 4BI3A 3LX7A 1VQ9T 2RQTA 2CH4W 5GAMh 5IHKA 3QDFA 2DEQA 5C6SA 1B34A 3HPWA 4LDYA 5FU7B 1OULA 4D6WA 2ATCB 3UWNA 1QKXA 1NYGA 2R57A 4L6V5 1YCYA 3A5ZB 4M7DG 2A36A 1IREB 3OYNA 4QQDA 4JRQA 2HKNA 3VYHB 3DKMA 4HVUA 2K5LA 1AWOA 4FL6A 3OYDA 2CP7A 2KI7A 3OYCA 1J3TA 2ZPHB 3EG2A 1Y96B 1I4K1 2CUBA 4BI4A 4F14A 3CMEA 3CC4T 3QKJA 1N5ZA 5LJ3g 9ATCB 3JCMe 4XTVA 3JCMP 2X51A 3G4SQ 3CBMA 2X4WA 2CSIA 3I56Q 2KDSA 5GMKh 1PRMC 1SG5A 2YUPA 5KYXB 2G3RA 4RTZA 2QXFA 4M77D 1OZ3A 2KYBA 1IHWA 2MWOA 2OTLA 1I5LA 4RTUA 2Y4YA 3M58A 1LJOA 1MV0B 1YITA 4II1A 2DL5A 3CMAA 1MMDA 4FYVB 2V8KA 2FPEA 3OMGA 3MP8A 1N8RC 3PTAA 1WGSA 3PMIA 3DB3A 4Z88A 3QIIA 2QQRA 5HCKA 3M0UA 5D6WA 2EYQA 3RMQA 1VQNT 1X01A 3SD4A 1YJNQ 3CCST 3C94A 1KD1U 1SEMA 2R58A 2MIOA 1VQOA 4RTVA 4OMFB 3JCMh 5LJ5f 3PVQA 1WHJA 4FT4A 1MMGA 2XIDA 3OQ5A 3HRTA 3CCMQ 3CMEQ 1WYXA 2KNBB 2LJ1A 4D8KA 2CDTA 2KQWA 1QVGS 1RAGB 2EGCA 2DL7A 1RAEB 2KRSA 2EPDA 3M57A 2XHCA 2HL3A 2QAZA 5KE2A 4PL6A 2SRCA 3L2UA 2E10A 4JRPA 2R5AA 1B34B 3JRZA 5FU7C 1X6BA 1G3YA 4M78G 2IG0A 1WIEA 1OU8A 3UATA 5FLXE 5I11A 1AWWA 2LQ8A 4F16A 2PQWA 3DLMA 4A4EA 2OJ2A 3VYGA 5GAN4 2KGTA 4EMHA 3EHQA 1SKUB 4J9BA 5FWCA 5M9OA 2DVJA 4FYYB 5GAN5 1YITQ 3JSCA 2FYKA 2GQIA 2LNHB 1KJWA 2KYMA 3BDUA 4XTXA 3I5SA 2DILA 2KSSA 4ZTFA 2A37A 2DIQA 3TU4K 3ULRB 1VQOQ 2YUOA 1MNEA 3EGXA 1G83A 3L2QA 1K9MU 2HEQA 1T3LA 4PJOF 3CCEA 2DIGA 4DEXA 5CKEA 5GANe 1UEBA 3JCMV 3A1PA 2DTIA 2PZ1A 4J7IA 1TU0B 2JUFA 1QVPA 1UE9A 2NUZA 2KK4A 1VQMT 2E3IA 2J6OA 2ESWA 1RI0A 1M30A 4KT0E 2EKOA 1D3BA 1BCOA 1WQ7A 1VQ4A 1CKAA 1RLQC 4PJMA 3PGGA 2DD4A 4J6XA 1ZSZA 1CKBA 1SRMA 4AG2C 1VYUA 3E9FA 3TEEA 7AT1B 3CBOA 4KGZB 2H3EB 4Y91A 3L2RA 4RTTA 4L5GA 4PJOG 2RHYA 1K0SA 4M77F 4X1VA 1KD1C 3MHXA 2QA4A 4JJBA 3CCLT 2VUBA 2MCNA 5L23A 4LE9A 1VQKA 4C8QF 1AWJA 2BE9B 3N5BB 4IUQA 1OOTA 5GANh 1YJ9T 3FB9A 2YRDA 3CC2T 4OB0B 3O8VA 4OMLA 1UGSB 3KXTA 3CCEQ 1Y71A 3CPWP 1NEGA 1RAFB 4OMPA 5KYYA 3JCMQ 4ZTJA 3L1AA 5LJ3j 2MPXC 2RQUA 4ORZA 1Q82R 2P0QA 2Y4XA 3G6EA 4IIOA 4M78A 4PK4A 2GBQA 2J6FA 2DKGA 4J6WA 5DY9A 1WPYA 1VQ4Q 1VQ8A 3P8DA 3TSWA 4M77G 4J9EA 4DBFA 1S1NA 4J7FA 4C8QG 1X2QA 4QVCA 1TS9A 2OTJA 1I0CA 4E7KA 4J83A 2VVKA 3S3NA 2C0OA 3BY7A 3EGXB 2QQ9A 3EHRA 2CH4A 4A4KA 2E65A 2I2LA 1JO8A 3EG0A 3PT9A 4M4ZA 3E1SA 2J7IA 2CYZB 2D0NA 4E2FB 2QA4Q 1MGQA 3JCMf 3M54A 2EYZA 3OYEA 3HKSA 1U3OA 2FZGB 1K9MC 1SPKA 1O75A 2GFAA 2K3BA 1S72A 3LGFA 4OMNA 5IXFA 3OYAA 2BZ8A 2C0IA 2RHZA 1D3BB 1N6AA 2ABLA 1B07A 5GJWB 1VQ5T 3EGUA 1BIBA 1NEBA 2HZYA 2VB6A 3ZL7C 1RACB 1ZSZB 1VOMA 3SHWA 1BI1A 2GF7A 3G6EQ 3AT1B 4GY5A 3SWNC 2PU9B 1NYFA 2EYWA 1YCSB 3HFOA 3VU3C 5DLOA 1OPKA 2JS0A 3NPFA 4CC7A 1Y07A 4J9GA 2B8AA 1BIAA 1PKTA 3HL8A 3C12A 1LVKA 2BE7D 2EIFA 2V26A 1VQ8Q 5GMKl 2OAWA 2DFUA 2QG9B 3IQLA 3GF5A 1D1CA 4E7JA 2DPPB 2M0OA 3QHSA 2CP3A 4Z02A 1KHIA 1NPRA 3PIPA 2V1RA 2OTJQ 1NBEB 2YLBA 4FCYA 1BK2A 2DA9A 2O01E 4BB7A 2VXEA 8AT1B 1QQJA 2HSPA 3QWYA 2DERA 5KYYB 1LPLA 5GMKi 2XG8D 4NOYA 4C92E 1FMVA 1ARKA 3RNJA 5KE3A 2JXBA 4MMLA 2IIMA 3SEMA 4M78B 3PMTA 1G3SA 3RESA 5LL6S 4F7UE 1S72Q 4OGCA 1JU5C 4ME7A 3CPWA 2A3LA 2YWWA 3G71T 4E6RA 5CAIA 4Y92A 5CKHA 4M75F 3EH1A 3UPUA 4XU0A 5IT9E 4N0AA 5LJ5h 1G2BA 2ZPFB 3OYGA 1Q81R 4EPCA 3VUBA 3VV0A 2JVVA 3CCQA 3QZ9B 3SDZA 2KAFA 3JCMX 4FSXA 1YHQT 3M59A 2FHDA 2QK0A 2X4YA 4PKCC 2DMOA 4XU1A 3S6WA 4AFZC 3EGDA 3LWIA 2DXBA 4OB1B 5DLQE 4N4HA 2FZCB 2KRMA 1X27A 1LNXA 1SHGA 4B9WA 2DO3A 4M7AE 2HSEB 4IUPA 1H3HA 3MP1A 1KQ2A 2K5FA 3MEWA 3ER0A 4C92A 2AT1B 2RK2A 1E6GA 3LH0A 2RA2A 1ZSZC 4M75G 3QDRB 3VS0A 4E7ZA 2IVWA 4DBHA 4IKFA 3HHTB 5IHIA 4PNOA 5AYFA 4F7UA 1D1AA 1OI1A 2MYSA 2FO0A 1WI7A 3CCUA 1FMWA 1JXMA 2E5KA 3V8KA 2COWA 1BKBA 3G4SA 2K79A 2QGGA 4PJJA 2DZ9A 2EQUA 1KC8R 3CCQQ 1H92A 2E41A 1QP3A 2D9TA 3OMCA 3KUFA 3JAME 4LDXA 1FX7A 1D0ZA 4LDUA 4XTWA 5LJ3e 3C4SA 2DNUA 1GBRA 4B9XA 3OS2A 1G3WA 3AHUA 3EFOA 4OB2B 4M7AA 3P8HA 5GAOr 4M78C 1UTIA 2YT6A 5CIUA 1VQ9A 2D8JA 4QKUA 1IRXA 3QJ6A 4JZ3A 2HL5C 1PWTA 1MUZA 5GAMg 5GAN2 1GBQA 4OB3B 3CBPA 3GNGA 4LNPA 2GQVA 3M9QA 1ACMB 3M4YA 1GCQA 4O6JA 4ESRA 1QWFA 1JRIA 1M1KR 1YJNA 3JB9F 1M8VA 3HP9A 1H3ZA 3GIBA 2JZ2A 4XTZA 1I8FA 1Q82U 3CCMA 3GLXA 3CCUQ 2JN0A 3CC4A 1IO6A 1M90R 2F2VA 4DBQA 2GTOA 3EFRA 3EGDB 3VJPA 3CPWS 4LN2A 2JMCA 2LX7A 1NJIR 3M5AA 2K7AA 3M56A 4AFSC 2F2WA 3A8LB 2L8DA 2D0QB 3FIFA 3GP8A 1TUCA 2RHUA 3RUXA 3S3MA 1ZQ1A 5EG2A 2W10A 4C92B 2VASA 2M16A 1WHHA 5FROA 1E7OA 6AT1B 2DL8A 3JB9I 4F7UB 3JB9G 2QDLA 1UHFA 4CRIA 3OA6A 1KHCA 1UJ0A 1VQ9Q 4E47A 4XTYA 1PKSA 3H9NA 1BU1A 2YRVA 1D09B 1QMCA 2EJGA 4MZTA 1W1FA 4A54A 2OTLT 2FRWA 4M7DE 1ZBJA 2L89A 1X43A 1YIJT 4JLIA 1AZGB 1M3BA 4BE0A 1TSFA 2RHIA 2BZXA 2DF6A 1X2KA 2LP5A 3H0FA 1VQNA 5CKDA 2NWMA 2COYA 1YJWT 3CCSA 2HNIA 3CMAT 3MEVA 2E4HA 2COZA 3L42A 2ENMA 3VS3A 3FJPA 3O5ZA 4BE1A 1RL2A 3FDRA 4C92D 3CC4Q 1G3TA 1K1ZA 3JB9J 2AKLA 3JCMg 1UECA 2XU8A 2EKHA 1B3QA 1ZBXA 3EFOB 3NTHA 2LCLA 1PHTA 1PNJA 4JJDA 1GRIA 3HRSA 4KH1B 4M7AB 4C5EA 4LD9K 1O9SA 2LMJA 2RJCA 3OS0A 2FZKB 2V8JA 4HKEA 1ABQA 3D7SB 4AFUC 5KYNA 1VQLT 5LJ3d 2DXTA 3EH2A 1V29B 3CCJT 4XK8E 2X9HA 1OZ2A 2CT4A 2HD0A 5IAYA 2X35A 4JRKA 4XU3A 1NZ9A 2K9GA 2P4TA 1ZUKA 1JJ2S 4J9DA 2DTOA 1HYOA 4RCBA 2D8HA 5CKFA 2VYTA 3CCRT 2BUDA 2CKKA 2K3YA 2LX9A 2NLUA 3QG1A 1SRLA 3H0IA 2VWFA 2MK5A 1WA7A 3META 4M7DA 2DD5A 4X9CA 2JTMA 4MMKA 1RAHB 4PFOA 2RJEA 4RTXA 2BTTA 2VGMA 4M7AD 1W4SA 4EIKA 2KR3A 2RMOA 4RTWA 1Q82C 1VQNQ 3CC7A 3CCSQ 2L5QA 4CI0C 1M2OA 4FW2A 3F70A 2HAXA 2F1LA 4C92C 3M53A 2A0FB 8ATCB 1Q81U 1AWXA 1BCMA 3OYJA 4MZMA 4E7LA 1VQ6T 2DJZA 4L59A 1KFZA 1EFNA 1NLOC 4HCZA 3L2VA 2EJ9A 1TTHB 2K3XA 1HJDA 4JLGA 4DOWA 4C0GA 1OU9A 1VQMA 3VS2A 4M78E 1WFWA 1WDXA 2KXDA 3UT1A 4ZGDB 2E5QA 2RNAA 1KQ1A 2X3WD 1P92A 5L8RE 4JJNK 3PE0A 5I2SA 1FYNA 3I55T 4RMOA 2D6FA 4KH0B 4X34A 3URGA 5I21A 4ZN3A 3LWHA 1H641 5D7UA 1N27A 2YXYA 2E6NA 1ZHIA 2XKOC 1BB9A 1QP2A 1D0XA 1FXXA 2LRQA 2LCSA 1I1JA 5GAMj 2OAUA 3HRUA 1NPPA 4JS5A 5DM7R 4M7AC 3EG9A 1Q7YR 3CCLA 5CO7A 1UG1A 2EYXA 3L2ZA 2CP6A 2YUNA 5FW9A 3LGLA 3CC7Q 2LQWA 1AT1B 3C0CA 1YJ9A 3CXCS 3TQ7P 1NLPC 1KC8U 5GANg 5FRMA 5LJ3f 2EQJA 2M0YA 4LDVA 3OY9A 1VQKT 3RIRA 1VQ7A 3QSUA 4KUDK 3CPFA 4JUVA 1PSEA 1UJYA 2V8IA 4WF2A 4B6MA 4J9FA 3CD6T 2D1XA 1VQMQ 3OW2P 3QYHB 4M7DB 1OQKA 4RKUE 4QVZA 2CREA 5J26A 4BD3A 4J5YA 5GMKj 1R77A 2CP0A 1XNIA 1SF9A 2CZ6B 2FG0A 3TCJA 2DL4A 2HCKA 4BDYA 3OB9A 1G5VA 4JZ4A 1PD1A 1UHCA 3NFCA 1TUDA 3E9GA 1H8KA 2DBMA 4PJOE 5HK0A 2CP2A 1NE8A 1GL5A 3UA6A 1T0JA 3QO3A 1W2BP 1RI9A 1V1CA 3UF4A 1FMKA 2ZPBB 2QYZA 4OF1A 4CC2A 3CCLQ 2AK5A 4C0FA 1X69A 2DVEA 3TREA 4NS5A 4E7HA 3E19A 1M90U 2RQVA 5GAOq 2C06A 1YNZA 1Y0MA 2JS2A 5IH2A 1Q81C 1N9RA 2L3PA 4FM4B 2FEIA 1YJ9Q 1NJIU 4M7DD 1VA7A 1BBZA 1OPLA 3CQTA 3VRYA 2K2MA 2L3QA 2WSEE 3TSZA 2QQBA 2JM9A 2PVGB 2E6ZA 1VQ7Q 4EDUA 1WX6A 1K0XA 4JDSA 1A0NB 4XU2A 1X6GA 3LH5A 2OX7A 3WVEB 3MPUB 1UGQB 4BE2A 1MMAA 4KRTA 1WLPB 1JJ2P 2NUPA 4BI8B 2LQNA 2JM8A 3RR6A 4J6YA 3VS7A 2ZPGB 5EC7A 3EG9B 4F04B 3CCVA 2CP5A 2DLPA 3EAEA 3GOXA 4C8QE 3KFVA 1QKWA 1SHFA 4C5GA 2DRKA 1MHNA 4PJOA 3X26B 1NM7A 2P84A 2RM4A 2J05A 4KULA 2MF2A 2HQXA 3OYYA 1T3SA 1M3AA 4HCKA 1IB8A 2HQHA 2KMTA 3V8LA 3R6NA 1WJSA 4A53A 2PNIA 1M2VA 2QGFB 2WSCE 1WZOA 1HK9A 1K73R 1KC8C 2LDMA 1EIFA 2FB7A 4M7DC 3MJXA 3DLLA 2PVDB 3VRZA 2X4XA 3OSVA 1QWEA 2M1HA 1YI2T 2O4XA 1IGQA 1VQPT 1VQ5Q 4C5IA 1PRLC 1V76A 2RD1A 5GAOl 4KGXB 4BUGA 1YWPA 2WACA 1WHLA 4BY6B 1K8AR 2SEMA 2EYYA 2MAMA 5LJ5g 2JT4A 1ZA1B 4BDZA 1JB0E 2RJDA 3OW2A 1M5Q1 2RK1A 2LC4A 2QQSA 1Z9ZA 2QTXA 1X6OA 3M4GA 4M77A 2ZPEB 2YRCA 1HD3A 2R5MA 5HKCA 2KROA 5GMKm 2DX1A 4DA4A 2RJFA 4J8OA 4C8QA 1K9MR 3CCVQ 2GFUA 3PFSA 3CCQT 2CT3A 2K4YA 2L0AA 3P8BB 4JS4A 1M9SA 4M78D 3REBB 1IXDA 2E3HA 1WNLA 3ASKA 1WJRA 1W2BA 1AVZC 3I5RA 2HBPA 4PJNA 4TVRA 2FRYA 4C0ZA 1M90C 1GFDA 2XI9A 3INZA 4F17A 5AT1B 2Y90A 2NYSA 4AG1C 3EG1A 2RPNA 2JNGA 2FPDA 2CZ0B 3MKDA 2X4JA 4GBQA 1NJIC 3ZFJA 1JBMA 2F5TX 1UDLA 3CXCP 3VS5A 1M3CA 3J7AF 1Q86R 5GAMe 1QVFP 1AD5A 2NUPB 1JXOA 3MCAB 5GAOm 4AT1B 2MMPA 2KT1A 3BE3A 2EQKA 3RKYA 5GANj 4KUIA 5C0MA 1ZA2B 2BZYA 3OSSC 3M0SA 1OX9A 4RG2A 1UUEA 4PJOB 2LT4A 4R55A 1R0CB 4EMGA 2QEXA 2AZVA 1JJ2A 2FL7A 4Y28E 1N9SA 2KXCA 5ECAA 2VC8A 1I5OB 1YWOA 4PLIA 1YHQQ 2DL3A 3G4ST 3I56T 5IXBA 2RI2A 2MI6A 5LJ5d 2DM1A 2HQEA 4YTLA 1M2VB 4ZNXA 2DEUA 1Q7YU 1VIEA 4KGVB 2O4XB 5GMKe 3UA7A 2DK3A 4M75E 1KQSP 1PSFA 3REAB 2CSQA 4OP0A 2MWPA 3EFSA 5KYUA 1Y57A 2DXUA 1I07A 2JTFA 2WSFE 2DAQA 3TVTA 4BY6C 2ZGWA 4JPBW 4IUTA 5KYWA 1XJWB 1YN8A 2O31A 2YSQA 2J6KA 3RKXA 2HBWA 2A28A 2AZSA 5CKBA 4LUDA 4UC4A 4PJOD 1VYVA 2ROTA 2XDDA 1M4ZA 4M77B 3EG3A 2JJ9A 4IURA 3QYGB 4WCIA 2DETA 1WQWA 4C8QB 1C0MA 1YJNT 1IGUA 3GNFB 2KT8A 2K6DA 3FC3A 1OYXA 4N4IA 5LJ3h 4IIMA 4CC3A 2YHTA 3CCMT 3CMET 2ZPIB 2QEXQ 5GAOp 1Y7XA 2P4RA 3UDCA 4QVDA 1HSQA 2E70A 2C0TA 3OW2S 1HXDA 3J81E 4QQGA 2E64A 4MDWA 2EQIA 1BI2A 1TOVA 2H3JA 1TWBA 2DZCA 2XICA 2GCXA 4DOVA 2PVOB 5CQXA 4ZN1A 1ZSGA 4M75A 2EQMA 3H0HA 4NL3A 3FRNA 3A8MB 1WJQA 2F2XA 2DJQA 4C8QD 3FEOA 5I2MA 1YIJA 1PM3A 4QW2A 1W2BS 3QUIA 3V7SA 3OBYA 1PC0A 3CXCA 1YITT 3OYFA 2K5IA 4HCBA 4PJOC 1YJWA 1U5SA 4M78F 4XQ3A 1U1SA 4BACA 1QVFA 5GAMd 2ZCFB 3BW1A 2O2OA 3JCMJ 5GAN8 4RTYA 3ZBDA 4WTOB 4HT9A 1XQHA 1UGRB 4JRIA 1VYTA 2CGHA 2CUDA 2DRMA 2ECZA 4R0KA 4HCCA 2BKDN 2KY9A 5A0GA 2NUTA 1M27C 4FSSA 1VQOT 1IHVA 1D0YA 3SWNA 5IN1A 2LJ3A 5I22A 1Z9QA 5LJ5j 1VQLA 2EVRA 3CCJA 4FT2A 4AFQC 1ZLMA 4N0AC 4PJLA 2DXCA 2IPOB 3C95A 4N4GA 5KYUB 4LDWA 5KYWB 4ZGJB 1Q7YC 2E12A 2I0NA 1RADB 3A8HB 3JCMb 3OYBA 3CCRA 3H8ZA 1JEGA 1WXTA 4M77C 2RI5A 1LCKA 1KQSA 2EJFA 3OS1A 1YBYA 2DYIA 4C8QC 2OTLQ 4PFZA 1K73U 4ELYC 4J9HA 4D8DA 1SSHA 2JW4A 1YIJQ 1EZZB 1IZ6A 5FU6B 1MMNA 3MEUA 1YJWQ 1G8XA 2OI3A 2LCCA 1WXUA 3CMAQ 2L3SA 3X20B 1K8AU 3X25B 3CEYA 2W0ZA 3RKWA 2RF0A 3CC7T 1VQ6A 2JMAA 1RAIB 3JB9H 5IHNA 3MP6A 1KSWA 1W6XA 1R0BG 2ED0A 2FVUA 4FYXB 1F1BB 3CCET 3DB4A 1N8RR 1VQLQ 1BI3A 4M75B 3JCMd 3CCJQ 3PVLA 2PTKA 2XK0A 2GNCA 1UFFA 1EX4A 4HXJA 4OMQA 4AMCA 5CR2A 3R6OA 3A8GB 3Q1JA 3I55A 2ZZDA 2QTVA 2CS7A 2KE9A 3MEAA 4A63B 4ELZC 3GPLA 3SB2A 3CCRQ 1FWZA 4XAXB 1YP5A 1VQ4T 2RI3A 3VS1A 3FJ5A 2RN8A 3OS5A 4FU6A 2RO0A 5GAMf 4EMKA 1VUBA 1D1BA 2LVMA 3PNWC 1BYMA 4R56A 4A4HA 2P0PA 1BI0A 1PD0A 2NUTB 4GLMA 1Q86U 2A08A 1DJ7B 3QJYA 2EAYA 3SWNB 1WHKA 2PUKB 2DBKA 2X3XD 1C6VX 3L2WA 3J80E 2CZ7B 2XD0A 3BFMA 4M75D 3CC2A 1K76A 2QA4T 5A0LA 4MZPA 3E2UA 1GCQC 2K57A 3QZ5B 1QVFS 2RQWA 2HKQB 2K2VA 2FPFA 4RG8A 3NTKA 1VQ6Q 2ED1A 2JOYA 1R8OB 4Z89A 2KEAA 3V7RA 4X9DA 4FIBA 2RQRA 4FW1A 2EFIA 1QCNA 3CD6A 1AEYA 2VGNA 4HVVA 1U06A 2RH2A 4C92F 1VQ7T 2HDAA 3G6ET 1I81A 2LZ6B 1TUGB 2RB6A 4J9CA 2KRNA 2XDBA 3NTIA 4LD6A 4OGEA 5FU6C 3I55Q 4C0DB 2EW3A 4LXCA 4F7UF 1E6HA 5A2QE 1K73C 1VQ8T 3G7ZA 3OYMA 1C1AA 1M1KU 2DYBA 2EGAA 1RLPC 1WHGA 3OYHA 2VKNA 2O9VA 5KCOA 1ABOA 1KK7A 1KQSS 2OTJT 3OBWA 3RDVA 3NGPA 5GAN3 2YLCA 1K8AC 1JQQA 2EBPA 4RCCA 2DTHA 4K11A 4M75C 2ROLA 1WXBA 4QQ6A 1K4US 3CC2Q 1VQ5A 3HFNA 1UGPB 3T9NA 2VXFA 4A4GA 4C92G 1QCOA 3QWXX 5J3BA 1CSKA 3NHNA 2QASA 2J06A 3VKIA 3M0QA 1VQKQ 1S72T 1NG2A 2EGEA 4M7AF 3H6ZA 3M55A 2M02A 5CVIA 1QCFA 4F7UG 3RERA 4E7IA 1XOVA 2ZAEA 1OX8A 2F5KA 1QVGP 4Q5WA 3CD6Q 1UB4A 5CCAA 5GANd 3PIOA 1KD1R 2EWNA 4EMKB 1RAAB 2P0KA 3FLGA 1TXQA 4M77E 3OYIA 2L3RA 1X75C 4E7SA 1Q95G 5FWBA 3I9QA 2AKKA 4VUBA 2YDLA 4IUVA 4FYWB 5LJ5e 3HSBA 4PFPA 3QPHA 1TH7A 2BIVA 1Q86C 1KG1A 3BDLA 3CCVT 3KBGA
chains in the Genus database with same CATH topology
3JB9D 2VV5A 3HRSA 4C5EA 4M7AB 4NL2A 2RI2A 4LD9K 3MO8A 1O9SA 1GXIE 2MI6A 4C8QF 5LJ5d 1VQKA 2RJCA 5GAN7 3OS0A 2V8JA 2HQEA 4HKEA 3WXMB 4M7AG 3N5BB 4IUQA 4YTLA 5GAN6 2KVQG 4ZGEB 5GANh 2LNVA 3X28B 3QBYA 1YJ9T 1VQLT 3FB9A 5D6XA 1Q7YU 5LJ3d 2DXTA 4OB0B 3CC2T 1V29B 3O8VA 1VIEA 4XK8E 3CCJT 5FRNA 1UGSB 3KXTA 2O4XB 1OZ2A 5IAYA 2HD0A 1M1GA 1Y71A 2X35A 3NTHA 4JRKA 5HK3A 2DK3A 5GMKe 1YI2A 3G71A 4XU3A 1VQPA 3JCMQ 2CZ1B 4ZTJA 4M75E 1NZ9A 1PSFA 2P4TA 4ATOA 3L1AA 5LJ3j 1JJ2S 2DTOA 4OP0A 2MWPA 3EFSA 2JTFA 2DXUA 2QQAA 2WSFE 2DAQA 4RCBA 4BY6C 2ZGWA 2P0QA 2Y4XA 3G6EA 4IUTA 5CKFA 4C0DC 2VYTA 4A4FA 3RKXA 3WVDB 5GAOn 3CCRT 2BUDA 4M78A 2CKKA 2K3YA 2LX9A 2NLUA 3QG1A 2DKGA 3JCMW 4J6WA 5CKBA 4UC4A 4PJOD 2XDDA 5CQYA 5DY9A 4V2SA 1M4ZA 3META 4M77B 1WPYA 1M1FA 4M7DA 2DD5A 2RHXA 4X9CA 2JTMA 4MMKA 4IURA 3P8DA 1VQ8A 5D6YA 1YHQA 1U1TA 3QYGB 4M77G 2LTOA 2RJEA 3S3OA 1WQWA 4C8QB 2VGMA 1YJNT 3GNFB 2LQKA 4M7AD 4J7FA 1W4SA 2QI2A 4C8QG 4QVCA 3FC3A 1OYXA 1Q82C 3CC7A 4N4IA 5LJ3h 1M1KC 2OTJA 4E7KA 2L5QA 4J83A 4C5HA 2YHTA 4CI0C 3BY7A 3CMET 3CCMT 3S3NA 2QQ9A 1Y96A 3F70A 2HAXA 2ZPIB 4C92C 5GAOp 1Y7XA 1SSFA 2E65A 3M53A 3UDCA 4A4KA 2I2LA 2E70A 4PLLA 4QVDA 5KCHA 1Q81U 3PT9A 1HXDA 2PUOB 3J81E 3OW2S 3E1SA 4QQGA 2CYZB 2E64A 3OYJA 4MDWA 4MZMA 1MGQA 4E7LA 3VUZA 3JCMf 1VQ6T 3LYIA 2DJZA 3OYKA 1BI2A 4L59A 3M54A 3ME9A 3OYEA 4HCZA 3HKSA 2H3JA 3L2VA 1K9MC 1O75A 2GFAA 2E1HA 2EJ9A 2DZCA 2XICA 3X24B 2GCXA 1S72A 2K3XA 1QW1A 3LW5E 3LGFA 1U8RA 4DOVA 4JLGA 4DOWA 4C0GA 3OYAA 2PVOB 3OYLA 1VQMA 2RHZA 2A7YA 5CQXA 4M78E 1VIFA 1D3BB 1N6AA 4ZN1A 4OVAA 3UT1A 1VQ5T 3V7CA 4M75A 4EMKC 2LT1A 2EQMA 4ZGDB 5A0DA 4NL3A 2E5QA 1BIBA 4DQ2A 3FRNA 3A8MB 5HY6A 5GANf 1WJQA 1KQ1A 1P92A 4C8QD 3FEOA 5I2MA 5L8RE 4JJNK 1YIJA 5I2SA 4QW2A 1W2BS 5J39A 1BI1A 3QUIA 2XDPA 3V7SA 3I55T 1N8RU 2GF7A 4KBMB 3OBYA 4RMOA 3JCMc 2D6FA 4X34A 4GY5A 3URGA 3CXCA 1YITT 3SWNC 2K5IA 4GLKA 3OYFA 4HCBA 2PU9B 4PJOC 5I21A 1YJWA 4ZN3A 1QVGA 3HFOA 3VU3C 4M78F 4XQ3A 5DLOA 1U1SA 3LWHA 4BACA 1H641 2ZCFB 5GAMd 3BW1A 3CCUT 1QVFA 3JCMJ 1N27A 5GAN8 3ZBDA 1Y07A 2E6NA 1ZHIA 2B8AA 4HA8A 2F69A 2XKOC 4HT9A 1BIAA 1XQHA 4P5NA 1XTDA 5CK9A 4MDXA 1UGRB 4JRIA 4HT8A 1QP2A 1FXXA 2CGHA 2EIFA 2LRQA 3C12A 3HL8A 4M7DF 5GMKl 5GAMj 2OAUA 3HRUA 1NPPA 4JS5A 5DM7R 4M7AC 4IUUA 3GF5A 4HCCA 3CCLA 5CO7A 3I56A 4E7JA 3ZEHA 2BKDN 2DPPB 2KY9A 5A0GA 2M0OA 3QHSA 3L2ZA 3SFMA 4Z02A 1AHJB 1KHIA 1LOJA 1NPRA 1VQOT 3PIPA 3LGLA 2QEXT 3SWNA 5IN1A 3V8JA 2YLBA 3A8OB 2AHJB 2O01E 1YJ9A 5LJ5j 4BB7A 2VXEA 3CXCS 1VQLA 3QXEB 3CCJA 3LLRA 2QDYB 4FT2A 1KC8U 4O5VA 5GMKi 5GANg 2XG8D 5FRMA 4N0AC 5LJ3f 2EQJA 4NOYA 3RMSA 4C92E 2DXCA 5KH6A 3C95A 4LDVA 4N4GA 3OY9A 4LDWA 2M9UA 4XTUA 1VQKT 3RIRA 1VQ7A 5KE3A 3QSUA 4MMLA 3LX7A 4BI3A 1VQ9T 4ZGJB 1Q7YC 4KUDK 3CPFA 4JUVA 2E12A 1PSEA 3A8HB 5GAMh 4M78B 3JCMb 3PMTA 2V8IA 1G3SA 3RESA 5LL6S 4F7UE 4WF2A 2DEQA 5C6SA 1B34A 3OYBA 3CCRA 3H8ZA 3HPWA 4LDYA 4ME7A 4OGCA 3CD6T 4M77C 5FU7B 4D6WA 3CPWA 2A3LA 3UWNA 2RI5A 3QYHB 4RKUE 2R57A 4M7DB 4L6V5 3G71T 1KQSA 2EJFA 3OS1A 1YCYA 4QVZA 5CAIA 1YBYA 5J26A 3A5ZB 5CKHA 4M7DG 1IREB 4M75F 4BD3A 4C8QC 4XU0A 4QQDA 3OYNA 4N0AA 4JRQA 3UPUA 5IT9E 5LJ5h 1K73U 4ELYC 4J5YA 5GMKj 3VYHB 3DKMA 2ZPFB 1XNIA 2CZ6B 2K5LA 1IZ6A 4FL6A 3OYDA 3OYGA 3OYCA 3TCJA 4EPCA 4BDYA 3VUBA 3VV0A 2JVVA 3OB9A 1G5VA 3CCQA 5FU6B 3QZ9B 2ZPHB 3MEUA 1Y96B 1I4K1 2LCCA 3NFCA 3SDZA 4BI4A 2KAFA 3JCMX 3X20B 3CMEA 4FSXA 3E9GA 3CC4T 1YHQT 4PJOE 3M59A 3QKJA 2FHDA 5HK0A 1K8AU 2X4YA 1NE8A 5LJ3g 4PKCC 4XU1A 3X25B 3S6WA 3QO3A 3JCMe 3CEYA 4XTVA 2ZPBB 3LWIA 3JCMP 4OF1A 2DXBA 4OB1B 5DLQE 4N4HA 3CBMA 2X4WA 3RKWA 4C0FA 1LNXA 2DVEA 3TREA 4B9WA 4NS5A 3CC7T 1VQ6A 2KDSA 4E7HA 3E19A 3JB9H 2DO3A 1M90U 4M7AE 5GAOq 2C06A 3MP6A 4IUPA 1Q81C 1N9RA 5GMKh 4FM4B 2FVUA 2G3RA 3CCET 3MP1A 1KQ2A 3DB4A 2K5FA 3MEWA 1BI3A 1NJIU 4M75B 4M7DD 3ER0A 2QXFA 3JCMd 4M77D 4C92A 1OZ3A 2RK2A 3LH0A 2XK0A 2RA2A 2MWOA 4M75G 2OTLA 1I5LA 3QDRB 2WSEE 1VQ8T 2QQBA 2PVGB 2IVWA 2E6ZA 4IKFA 3HHTB 5CR2A 3R6OA 4PNOA 2Y4YA 5AYFA 4EDUA 3A8GB 3Q1JA 3M58A 4F7UA 3I55A 2ZZDA 1LJOA 2CS7A 1OI1A 3MEAA 4JDSA 4ELZC 3GPLA 3SB2A 1YITA 4II1A 4XU2A 1FWZA 4XAXB 3CMAA 1VQ4T 3WVEB 1UGQB 2RI3A 4BE2A 3CCUA 2V8KA 3OMGA 3OS5A 3MP8A 4FU6A 1N8RC 3PTAA 1WGSA 2RO0A 5GAMf 4BI8B 3PMIA 3DB3A 4EMKA 1VUBA 3QIIA 4J6YA 2LVMA 2QQRA 3PNWC 3V8KA 2ZPGB 1BYMA 1BKBA 4R56A 5D6WA 3G4SA 4A4HA 2EYQA 3CCVA 2P0PA 1BI0A 3RMQA 1VQNT 1Q86U 3EAEA 3GOXA 1X01A 3SD4A 4C8QE 3CCST 2DZ9A 3C94A 1KD1U 1DJ7B 2EQUA 3QJYA 4C5GA 2R58A 1MHNA 2EAYA 3SWNB 2PUKB 1VQOA 4OMFB 3JCMh 2E41A 4PJOA 5LJ5f 4FT4A 1QP3A 3X26B 2D9TA 2XIDA 3OMCA 3KUFA 3OQ5A 3JAME 2RM4A 4LDXA 1FX7A 4KULA 3HRTA 2MF2A 4LDUA 4XTWA 5LJ3e 3J80E 2CZ7B 2HQXA 3BFMA 4M75D 3L2WA 3CC2A 2XD0A 2KQWA 3C4SA 2QA4T 1QVGS 3OYYA 5A0LA 4MZPA 2K57A 3QZ5B 4B9XA 1QVFS 3OS2A 2KMTA 1G3WA 3AHUA 3V8LA 4OB2B 2K2VA 1WJSA 3M57A 2XHCA 4RG8A 4M7AA 3P8HA 5GAOr 3NTKA 4M78C 5KE2A 5CIUA 1VQ9A 4PL6A 3L2UA 4A53A 2JOYA 2E10A 1R8OB 4JRPA 2R5AA 1B34B 3JRZA 2WSCE 3V7RA 4X9DA 1HK9A 5FU7C 1KC8C 2LDMA 4FIBA 1EIFA 2FB7A 4M7DC 1G3YA 2EFIA 2IG0A 3QJ6A 4M78G 3CD6A 3DLLA 2PVDB 2VGNA 2X4XA 3OSVA 2M1HA 5GAMg 2O4XA 5GAN2 1YI2T 4OB3B 1VQPT 2RH2A 3CBPA 3GNGA 5FLXE 4C5IA 4C92F 2GQVA 1VQ7T 3M9QA 2RD1A 3M4YA 2LQ8A 4O6JA 5GAOl 4BUGA 3G6ET 1I81A 2WACA 2PQWA 3DLMA 4A4EA 1JRIA 3VYGA 2RB6A 5GAN4 2XDBA 1YJNA 4BY6B 3JB9F 3HP9A 1M8VA 3NTIA 4LD6A 4EMHA 4OGEA 5FU6C 2MAMA 4C0DB 5M9OA 5LJ5g 4F7UF 4BDZA 1H3ZA 1JB0E 2RJDA 3OW2A 5GAN5 3JSCA 1M5Q1 2RK1A 3GIBA 2LC4A 2QQSA 2JZ2A 5A2QE 4XTZA 1K73C 1I8FA 1Q82U 3CCMA 2QTXA 1X6OA 3G7ZA 3GLXA 2FYKA 2ZPEB 3M4GA 4M77A 3OYMA 1M1KU 2JN0A 3CC4A 2R5MA 5HKCA 5GMKm 4DA4A 3EFRA 2RJFA 3VJPA 3OYHA 3CPWS 3BDUA 4J8OA 4XTXA 5KCOA 4C8QA 1KQSS 2KSSA 2GFUA 3M5AA 3M56A 3PFSA 2OTJT 3A8LB 3CCQT 2L8DA 3OBWA 4ZTFA 5GAN3 2D0QB 2YLCA 2K4YA 4JS4A 3P8BB 2DIQA 1M9SA 3TU4K 3FIFA 3GP8A 1K8AC 4M78D 4RCCA 2DTHA 2RHUA 3RUXA 3S3MA 1ZQ1A 4M75C 5EG2A 3L2QA 1K9MU 3CCEA 4PJOF 4QQ6A 1WNLA 3ASKA 2DIGA 1WJRA 4C92B 1W2BA 2HBPA 4TVRA 5CKEA 5GANe 3HFNA 1VQ5A 1UGPB 1UEBA 2M16A 2VXFA 3T9NA 3JCMV 4C0ZA 4A4GA 4C92G 1M90C 2XI9A 3INZA 5FROA 2DTIA 5J3BA 2Y90A 3VKIA 4J7IA 3JB9I 2JNGA 2JUFA 4F7UB 3JB9G 1QVPA 2CZ0B 1S72T 2X4JA 4CRIA 3OA6A 1KHCA 1NJIC 3ZFJA 3H6ZA 4M7AF 2KK4A 1JBMA 3M55A 5CVIA 4E47A 2F5TX 1VQMT 4F7UG 3RERA 4E7IA 4XTYA 1XOVA 1RI0A 2F5KA 4KT0E 2EKOA 2YRVA 3J7AF 4Q5WA 1D3BA 5GAMe 1UB4A 5CCAA 5GANd 1WQ7A 1VQ4A 2EJGA 4MZTA 4A54A 2OTLT 3PIOA 2EWNA 3MCAB 4EMKB 3PGGA 4M7DE 2P0KA 4M77E 3FLGA 2L89A 5GAOm 1YIJT 3OYIA 2DD4A 4J6XA 2L3RA 2MMPA 4JLIA 1X75C 2EQKA 3RKYA 4BE0A 2RHIA 5GANj 4KUIA 5C0MA 4VUBA 3E9FA 4IUVA 3TEEA 1VQNA 5CKDA 3OSSC 4RG2A 1YJWT 3CBOA 3CCSA 5LJ5e 2HNIA 3CMAT 3MEVA 2LT4A 4Y91A 4PJOB 4R55A 3L42A 3L2RA 3HSBA 4EMGA 2QEXA 3FJPA 4BE1A 1JJ2A 2FL7A 3QPHA 4L5GA 4Y28E 4PJOG 1N9SA 1TH7A 2BIVA 1RL2A 2RHYA 3FDRA 4C92D 1Q86C 1KG1A 2VC8A 3BDLA 1G3TA 4PLIA 4M77F 3JB9J 3JCMg 3G4ST 3MHXA 3CCVT 2XU8A 2QA4A 3CCLT 1KD1C 1ZBXA 2VUBA 3I56T 2LCLA 3KBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAC A;  4N4H A;  2PQW A;  2X4W A;  3DLM A;  2RI2 A;  4QW2 A;  3MO8 A;  4A4E A;  4C5E A;  5J39 A;  2XDP A;  4B9W A;  4NS5 A;  2GF7 A;  4E7H A;  2RJC A;  4X34 A;  3NTI A;  4GY5 A;  4LD6 A;  3OS0 A;  2HQE A;  4IUQ A;  3MP6 A;  5M9O A;  4IUP A;  3OYF A;  4BDZ A;  1H3Z A;  2RJD A;  3QBY A;  5D6X A;  2G3R A;  4BAC A;  2QQS A;  2JZ2 A;  3MP1 A;  5FRN A;  1N27 A;  3DB4 A;  3O8V A;  3MEW A;  2E6N A;  2B8A A;  2O4X B;  1OZ2 A;  3OYM A;  5IAY A;  1OZ3 A;  2X35 A;  2R5M A;  3LH0 A;  2XK0 A;  2LRQ A;  4ZTJ A;  2MWO A;  3OYH A;  2RJF A;  5KCO A;  4IUU A;  2MWP A;  2JTF A;  4IKF A;  4E7J A;  2DAQ A;  3ZEH A;  2BKD N;  2GFU A;  2M0O A;  4IUT A;  4EDU A;  3PFS A;  3Q1J A;  4ZTF A;  2L8D A;  2VYT A;  4Z02 A;  4A4F A;  3LGL A;  2DIQ A;  1OI1 A;  2BUD A;  3MEA A;  2CKK A;  2K3Y A;  2NLU A;  5IN1 A;  4II1 A;  2RHU A;  4UC4 A;  3S3M A;  3L2Q A;  3MET A;  2RI3 A;  4BE2 A;  4QQ6 A;  3ASK A;  2RHX A;  2DIG A;  1WJR A;  3OMG A;  4FU6 A;  3MP8 A;  3LLR A;  4IUR A;  3P8D A;  5D6Y A;  1WGS A;  2RO0 A;  5FRM A;  3PMI A;  3DB3 A;  2M16 A;  3QII A;  2EQJ A;  2LTO A;  4A4G A;  2RJE A;  2LVM A;  2QQR A;  3PNW C;  5KH6 A;  4N4G A;  3OY9 A;  5FRO A;  3S3O A;  5D6W A;  4A4H A;  5KE3 A;  3EAE A;  3LX7 A;  3GOX A;  3SD4 A;  3FC3 A;  1OYX A;  4CRI A;  2EQU A;  3OA6 A;  1KHC A;  4C5G A;  2R58 A;  3H6Z A;  3PMT A;  4N4I A;  1MHN A;  3OYB A;  4E7K A;  5C6S A;  4E7I A;  3H8Z A;  4C5H A;  3S3N A;  2D9T A;  1RI0 A;  2F5K A;  3OMC A;  3KUF A;  3OQ5 A;  2EKO A;  2YRV A;  3F70 A;  4Q5W A;  3UWN A;  2RI5 A;  2R57 A;  3L2W A;  1SSF A;  2HQX A;  4PLL A;  3OS1 A;  4QVZ A;  5KCH A;  3C4S A;  5J26 A;  4BD3 A;  2P0K A;  4QQG A;  3FLG A;  2L89 A;  4QQD A;  4B9X A;  3OYN A;  3OS2 A;  3OYI A;  3OYJ A;  2L3R A;  4E7L A;  2EQK A;  3LYI A;  2RHI A;  1WJS A;  3OYK A;  4BE0 A;  4L59 A;  5C0M A;  3P8H A;  1XNI A;  3E9F A;  3ME9 A;  4IUV A;  4HCZ A;  3OYE A;  3NTK A;  4FL6 A;  5KE2 A;  3OYC A;  5CIU A;  3OYD A;  3OYG A;  3L2V A;  2GFA A;  4PL6 A;  4RG2 A;  3L2U A;  4BDY A;  3OB9 A;  1G5V A;  2R5A A;  2K3X A;  3LGF A;  3MEV A;  3MEU A;  2LDM A;  3L42 A;  2LCC A;  3OYA A;  3OYL A;  2RHZ A;  3L2R A;  2EFI A;  3QJ6 A;  2IG0 A;  4BE1 A;  4OVA A;  3E9G A;  3UT1 A;  2X4X A;  3QKJ A;  2FHD A;  2M1H A;  2O4X A;  2X4Y A;  2BIV A;  2RHY A;  2EQM A;  3FDR A;  3BDL A;  4PLI A;  2E5Q A;  4C5I A;  3S6W A;  3CEY A;  3M9Q A;  1WJQ A;  3NTH A;  3FEO A; 
#chains in the Genus database with same CATH topology
 1YFN A;  2VV5 A;  3JB9 D;  4NL2 A;  3MO8 A;  1GXI E;  4JJC A;  1PCX A;  5GAN 7;  1W70 A;  4M7A G;  3WXM B;  5GAN 6;  1B7T A;  2KVQ G;  4ZGE B;  2LNV A;  3X28 B;  3QBY A;  5D6X A;  4DEY A;  5FRN A;  3GBQ A;  1M1G A;  3VS6 A;  5HK3 A;  1YI2 A;  3G71 A;  1VQP A;  2CZ1 B;  4ATO A;  1TG0 A;  2QQA A;  2AIR B;  1OV3 A;  4C0D C;  4A4F A;  3WVD B;  5GAO n;  4DBR A;  1ZX6 A;  3JCM W;  5CQY A;  4V2S A;  1GCP A;  1M1F A;  2RHX A;  3H41 A;  5D6Y A;  1YHQ A;  1U1T A;  2GGR A;  2LTO A;  3S3O A;  1OEB A;  2O9S A;  3I35 A;  2L2P A;  2LQK A;  2QI2 A;  3VS4 A;  1MV3 A;  4CC4 B;  1M1K C;  1KIK A;  4C5H A;  1AOJ A;  1Y96 A;  2DE0 X;  2KBT A;  1SSF A;  4PLL A;  3THK A;  5KCH A;  2PUO B;  2XMF A;  3NMZ C;  1GFC A;  3VUZ A;  3LYI A;  3OYK A;  1MND A;  2G6F X;  1PG5 B;  3JV3 A;  4OMM A;  3ME9 A;  4HVW A;  2E1H A;  2YUQ A;  3X24 B;  1QW1 A;  2JTE A;  3LW5 E;  1U8R A;  1ZUY A;  3OYL A;  5KYX A;  2A7Y A;  2H8H A;  1VIF A;  2Z0W A;  4OVA A;  3V7C A;  4EMK C;  2LT1 A;  5A0D A;  1YI2 Q;  4OMO A;  4DQ2 A;  3G71 Q;  1VQP Q;  2O88 A;  5HY6 A;  5GAN f;  3M0P A;  2B86 A;  1N8R U;  3G1J A;  5J39 A;  2XDP A;  4KBM B;  3JCM c;  1UGV A;  3M0R A;  4GLK A;  5GJV B;  3M0T A;  1QVG A;  2V1Q A;  3CCU T;  4HA8 A;  2F69 A;  4QT7 A;  5CK9 A;  4P5N A;  1XTD A;  4MDX A;  4HT8 A;  1RUW A;  4RUG A;  4Z8A A;  3U23 A;  4M7D F;  1ZUU A;  1AZE A;  4IUU A;  3I56 A;  3ZEH A;  2HMA A;  2LJ0 A;  2M51 A;  3SFM A;  1AHJ B;  1LOJ A;  2MOX A;  1K9A A;  3HTR A;  2QEX T;  3V8J A;  3A8O B;  4ANJ A;  1WHM A;  2AHJ B;  1T0H A;  3RBB B;  3QXE B;  4J9I A;  1RAB B;  3A98 A;  2QDY B;  3LLR A;  4O5V A;  3RMS A;  1M8M A;  1QLY A;  5KH6 A;  2GTJ A;  2M9U A;  4XTU A;  4LUE A;  4BI3 A;  3LX7 A;  1VQ9 T;  2RQT A;  2CH4 W;  5GAM h;  5IHK A;  3QDF A;  2DEQ A;  5C6S A;  1B34 A;  3HPW A;  4LDY A;  5FU7 B;  1OUL A;  4D6W A;  2ATC B;  3UWN A;  1QKX A;  1NYG A;  2R57 A;  4L6V 5;  1YCY A;  3A5Z B;  4M7D G;  2A36 A;  1IRE B;  3OYN A;  4QQD A;  4JRQ A;  2HKN A;  3VYH B;  3DKM A;  4HVU A;  2K5L A;  1AWO A;  4FL6 A;  3OYD A;  2CP7 A;  2KI7 A;  3OYC A;  1J3T A;  2ZPH B;  3EG2 A;  1Y96 B;  1I4K 1;  2CUB A;  4BI4 A;  4F14 A;  3CME A;  3CC4 T;  3QKJ A;  1N5Z A;  5LJ3 g;  9ATC B;  3JCM e;  4XTV A;  3JCM P;  2X51 A;  3G4S Q;  3CBM A;  2X4W A;  2CSI A;  3I56 Q;  2KDS A;  5GMK h;  1PRM C;  1SG5 A;  2YUP A;  5KYX B;  2G3R A;  4RTZ A;  2QXF A;  4M77 D;  1OZ3 A;  2KYB A;  1IHW A;  2MWO A;  2OTL A;  1I5L A;  4RTU A;  2Y4Y A;  3M58 A;  1LJO A;  1MV0 B;  1YIT A;  4II1 A;  2DL5 A;  3CMA A;  1MMD A;  4FYV B;  2V8K A;  2FPE A;  3OMG A;  3MP8 A;  1N8R C;  3PTA A;  1WGS A;  3PMI A;  3DB3 A;  4Z88 A;  3QII A;  2QQR A;  5HCK A;  3M0U A;  5D6W A;  2EYQ A;  3RMQ A;  1VQN T;  1X01 A;  3SD4 A;  1YJN Q;  3CCS T;  3C94 A;  1KD1 U;  1SEM A;  2R58 A;  2MIO A;  1VQO A;  4RTV A;  4OMF B;  3JCM h;  5LJ5 f;  3PVQ A;  1WHJ A;  4FT4 A;  1MMG A;  2XID A;  3OQ5 A;  3HRT A;  3CCM Q;  3CME Q;  1WYX A;  2KNB B;  2LJ1 A;  4D8K A;  2CDT A;  2KQW A;  1QVG S;  1RAG B;  2EGC A;  2DL7 A;  1RAE B;  2KRS A;  2EPD A;  3M57 A;  2XHC A;  2HL3 A;  2QAZ A;  5KE2 A;  4PL6 A;  2SRC A;  3L2U A;  2E10 A;  4JRP A;  2R5A A;  1B34 B;  3JRZ A;  5FU7 C;  1X6B A;  1G3Y A;  4M78 G;  2IG0 A;  1WIE A;  1OU8 A;  3UAT A;  5FLX E;  5I11 A;  1AWW A;  2LQ8 A;  4F16 A;  2PQW A;  3DLM A;  4A4E A;  2OJ2 A;  3VYG A;  5GAN 4;  2KGT A;  4EMH A;  3EHQ A;  1SKU B;  4J9B A;  5FWC A;  5M9O A;  2DVJ A;  4FYY B;  5GAN 5;  1YIT Q;  3JSC A;  2FYK A;  2GQI A;  2LNH B;  1KJW A;  2KYM A;  3BDU A;  4XTX A;  3I5S A;  2DIL A;  2KSS A;  4ZTF A;  2A37 A;  2DIQ A;  3TU4 K;  3ULR B;  1VQO Q;  2YUO A;  1MNE A;  3EGX A;  1G83 A;  3L2Q A;  1K9M U;  2HEQ A;  1T3L A;  4PJO F;  3CCE A;  2DIG A;  4DEX A;  5CKE A;  5GAN e;  1UEB A;  3JCM V;  3A1P A;  2DTI A;  2PZ1 A;  4J7I A;  1TU0 B;  2JUF A;  1QVP A;  1UE9 A;  2NUZ A;  2KK4 A;  1VQM T;  2E3I A;  2J6O A;  2ESW A;  1RI0 A;  1M30 A;  4KT0 E;  2EKO A;  1D3B A;  1BCO A;  1WQ7 A;  1VQ4 A;  1CKA A;  1RLQ C;  4PJM A;  3PGG A;  2DD4 A;  4J6X A;  1ZSZ A;  1CKB A;  1SRM A;  4AG2 C;  1VYU A;  3E9F A;  3TEE A;  7AT1 B;  3CBO A;  4KGZ B;  2H3E B;  4Y91 A;  3L2R A;  4RTT A;  4L5G A;  4PJO G;  2RHY A;  1K0S A;  4M77 F;  4X1V A;  1KD1 C;  3MHX A;  2QA4 A;  4JJB A;  3CCL T;  2VUB A;  2MCN A;  5L23 A;  4LE9 A;  1VQK A;  4C8Q F;  1AWJ A;  2BE9 B;  3N5B B;  4IUQ A;  1OOT A;  5GAN h;  1YJ9 T;  3FB9 A;  2YRD A;  3CC2 T;  4OB0 B;  3O8V A;  4OML A;  1UGS B;  3KXT A;  3CCE Q;  1Y71 A;  3CPW P;  1NEG A;  1RAF B;  4OMP A;  5KYY A;  3JCM Q;  4ZTJ A;  3L1A A;  5LJ3 j;  2MPX C;  2RQU A;  4ORZ A;  1Q82 R;  2P0Q A;  2Y4X A;  3G6E A;  4IIO A;  4M78 A;  4PK4 A;  2GBQ A;  2J6F A;  2DKG A;  4J6W A;  5DY9 A;  1WPY A;  1VQ4 Q;  1VQ8 A;  3P8D A;  3TSW A;  4M77 G;  4J9E A;  4DBF A;  1S1N A;  4J7F A;  4C8Q G;  1X2Q A;  4QVC A;  1TS9 A;  2OTJ A;  1I0C A;  4E7K A;  4J83 A;  2VVK A;  3S3N A;  2C0O A;  3BY7 A;  3EGX B;  2QQ9 A;  3EHR A;  2CH4 A;  4A4K A;  2E65 A;  2I2L A;  1JO8 A;  3EG0 A;  3PT9 A;  4M4Z A;  3E1S A;  2J7I A;  2CYZ B;  2D0N A;  4E2F B;  2QA4 Q;  1MGQ A;  3JCM f;  3M54 A;  2EYZ A;  3OYE A;  3HKS A;  1U3O A;  2FZG B;  1K9M C;  1SPK A;  1O75 A;  2GFA A;  2K3B A;  1S72 A;  3LGF A;  4OMN A;  5IXF A;  3OYA A;  2BZ8 A;  2C0I A;  2RHZ A;  1D3B B;  1N6A A;  2ABL A;  1B07 A;  5GJW B;  1VQ5 T;  3EGU A;  1BIB A;  1NEB A;  2HZY A;  2VB6 A;  3ZL7 C;  1RAC B;  1ZSZ B;  1VOM A;  3SHW A;  1BI1 A;  2GF7 A;  3G6E Q;  3AT1 B;  4GY5 A;  3SWN C;  2PU9 B;  1NYF A;  2EYW A;  1YCS B;  3HFO A;  3VU3 C;  5DLO A;  1OPK A;  2JS0 A;  3NPF A;  4CC7 A;  1Y07 A;  4J9G A;  2B8A A;  1BIA A;  1PKT A;  3HL8 A;  3C12 A;  1LVK A;  2BE7 D;  2EIF A;  2V26 A;  1VQ8 Q;  5GMK l;  2OAW A;  2DFU A;  2QG9 B;  3IQL A;  3GF5 A;  1D1C A;  4E7J A;  2DPP B;  2M0O A;  3QHS A;  2CP3 A;  4Z02 A;  1KHI A;  1NPR A;  3PIP A;  2V1R A;  2OTJ Q;  1NBE B;  2YLB A;  4FCY A;  1BK2 A;  2DA9 A;  2O01 E;  4BB7 A;  2VXE A;  8AT1 B;  1QQJ A;  2HSP A;  3QWY A;  2DER A;  5KYY B;  1LPL A;  5GMK i;  2XG8 D;  4NOY A;  4C92 E;  1FMV A;  1ARK A;  3RNJ A;  5KE3 A;  2JXB A;  4MML A;  2IIM A;  3SEM A;  4M78 B;  3PMT A;  1G3S A;  3RES A;  5LL6 S;  4F7U E;  1S72 Q;  4OGC A;  1JU5 C;  4ME7 A;  3CPW A;  2A3L A;  2YWW A;  3G71 T;  4E6R A;  5CAI A;  4Y92 A;  5CKH A;  4M75 F;  3EH1 A;  3UPU A;  4XU0 A;  5IT9 E;  4N0A A;  5LJ5 h;  1G2B A;  2ZPF B;  3OYG A;  1Q81 R;  4EPC A;  3VUB A;  3VV0 A;  2JVV A;  3CCQ A;  3QZ9 B;  3SDZ A;  2KAF A;  3JCM X;  4FSX A;  1YHQ T;  3M59 A;  2FHD A;  2QK0 A;  2X4Y A;  4PKC C;  2DMO A;  4XU1 A;  3S6W A;  4AFZ C;  3EGD A;  3LWI A;  2DXB A;  4OB1 B;  5DLQ E;  4N4H A;  2FZC B;  2KRM A;  1X27 A;  1LNX A;  1SHG A;  4B9W A;  2DO3 A;  4M7A E;  2HSE B;  4IUP A;  1H3H A;  3MP1 A;  1KQ2 A;  2K5F A;  3MEW A;  3ER0 A;  4C92 A;  2AT1 B;  2RK2 A;  1E6G A;  3LH0 A;  2RA2 A;  1ZSZ C;  4M75 G;  3QDR B;  3VS0 A;  4E7Z A;  2IVW A;  4DBH A;  4IKF A;  3HHT B;  5IHI A;  4PNO A;  5AYF A;  4F7U A;  1D1A A;  1OI1 A;  2MYS A;  2FO0 A;  1WI7 A;  3CCU A;  1FMW A;  1JXM A;  2E5K A;  3V8K A;  2COW A;  1BKB A;  3G4S A;  2K79 A;  2QGG A;  4PJJ A;  2DZ9 A;  2EQU A;  1KC8 R;  3CCQ Q;  1H92 A;  2E41 A;  1QP3 A;  2D9T A;  3OMC A;  3KUF A;  3JAM E;  4LDX A;  1FX7 A;  1D0Z A;  4LDU A;  4XTW A;  5LJ3 e;  3C4S A;  2DNU A;  1GBR A;  4B9X A;  3OS2 A;  1G3W A;  3AHU A;  3EFO A;  4OB2 B;  4M7A A;  3P8H A;  5GAO r;  4M78 C;  1UTI A;  2YT6 A;  5CIU A;  1VQ9 A;  2D8J A;  4QKU A;  1IRX A;  3QJ6 A;  4JZ3 A;  2HL5 C;  1PWT A;  1MUZ A;  5GAM g;  5GAN 2;  1GBQ A;  4OB3 B;  3CBP A;  3GNG A;  4LNP A;  2GQV A;  3M9Q A;  1ACM B;  3M4Y A;  1GCQ A;  4O6J A;  4ESR A;  1QWF A;  1JRI A;  1M1K R;  1YJN A;  3JB9 F;  1M8V A;  3HP9 A;  1H3Z A;  3GIB A;  2JZ2 A;  4XTZ A;  1I8F A;  1Q82 U;  3CCM A;  3GLX A;  3CCU Q;  2JN0 A;  3CC4 A;  1IO6 A;  1M90 R;  2F2V A;  4DBQ A;  2GTO A;  3EFR A;  3EGD B;  3VJP A;  3CPW S;  4LN2 A;  2JMC A;  2LX7 A;  1NJI R;  3M5A A;  2K7A A;  3M56 A;  4AFS C;  2F2W A;  3A8L B;  2L8D A;  2D0Q B;  3FIF A;  3GP8 A;  1TUC A;  2RHU A;  3RUX A;  3S3M A;  1ZQ1 A;  5EG2 A;  2W10 A;  4C92 B;  2VAS A;  2M16 A;  1WHH A;  5FRO A;  1E7O A;  6AT1 B;  2DL8 A;  3JB9 I;  4F7U B;  3JB9 G;  2QDL A;  1UHF A;  4CRI A;  3OA6 A;  1KHC A;  1UJ0 A;  1VQ9 Q;  4E47 A;  4XTY A;  1PKS A;  3H9N A;  1BU1 A;  2YRV A;  1D09 B;  1QMC A;  2EJG A;  4MZT A;  1W1F A;  4A54 A;  2OTL T;  2FRW A;  4M7D E;  1ZBJ A;  2L89 A;  1X43 A;  1YIJ T;  4JLI A;  1AZG B;  1M3B A;  4BE0 A;  1TSF A;  2RHI A;  2BZX A;  2DF6 A;  1X2K A;  2LP5 A;  3H0F A;  1VQN A;  5CKD A;  2NWM A;  2COY A;  1YJW T;  3CCS A;  2HNI A;  3CMA T;  3MEV A;  2E4H A;  2COZ A;  3L42 A;  2ENM A;  3VS3 A;  3FJP A;  3O5Z A;  4BE1 A;  1RL2 A;  3FDR A;  4C92 D;  3CC4 Q;  1G3T A;  1K1Z A;  3JB9 J;  2AKL A;  3JCM g;  1UEC A;  2XU8 A;  2EKH A;  1B3Q A;  1ZBX A;  3EFO B;  3NTH A;  2LCL A;  1PHT A;  1PNJ A;  4JJD A;  1GRI A;  3HRS A;  4KH1 B;  4M7A B;  4C5E A;  4LD9 K;  1O9S A;  2LMJ A;  2RJC A;  3OS0 A;  2FZK B;  2V8J A;  4HKE A;  1ABQ A;  3D7S B;  4AFU C;  5KYN A;  1VQL T;  5LJ3 d;  2DXT A;  3EH2 A;  1V29 B;  3CCJ T;  4XK8 E;  2X9H A;  1OZ2 A;  2CT4 A;  2HD0 A;  5IAY A;  2X35 A;  4JRK A;  4XU3 A;  1NZ9 A;  2K9G A;  2P4T A;  1ZUK A;  1JJ2 S;  4J9D A;  2DTO A;  1HYO A;  4RCB A;  2D8H A;  5CKF A;  2VYT A;  3CCR T;  2BUD A;  2CKK A;  2K3Y A;  2LX9 A;  2NLU A;  3QG1 A;  1SRL A;  3H0I A;  2VWF A;  2MK5 A;  1WA7 A;  3MET A;  4M7D A;  2DD5 A;  4X9C A;  2JTM A;  4MMK A;  1RAH B;  4PFO A;  2RJE A;  4RTX A;  2BTT A;  2VGM A;  4M7A D;  1W4S A;  4EIK A;  2KR3 A;  2RMO A;  4RTW A;  1Q82 C;  1VQN Q;  3CC7 A;  3CCS Q;  2L5Q A;  4CI0 C;  1M2O A;  4FW2 A;  3F70 A;  2HAX A;  2F1L A;  4C92 C;  3M53 A;  2A0F B;  8ATC B;  1Q81 U;  1AWX A;  1BCM A;  3OYJ A;  4MZM A;  4E7L A;  1VQ6 T;  2DJZ A;  4L59 A;  1KFZ A;  1EFN A;  1NLO C;  4HCZ A;  3L2V A;  2EJ9 A;  1TTH B;  2K3X A;  1HJD A;  4JLG A;  4DOW A;  4C0G A;  1OU9 A;  1VQM A;  3VS2 A;  4M78 E;  1WFW A;  1WDX A;  2KXD A;  3UT1 A;  4ZGD B;  2E5Q A;  2RNA A;  1KQ1 A;  2X3W D;  1P92 A;  5L8R E;  4JJN K;  3PE0 A;  5I2S A;  1FYN A;  3I55 T;  4RMO A;  2D6F A;  4KH0 B;  4X34 A;  3URG A;  5I21 A;  4ZN3 A;  3LWH A;  1H64 1;  5D7U A;  1N27 A;  2YXY A;  2E6N A;  1ZHI A;  2XKO C;  1BB9 A;  1QP2 A;  1D0X A;  1FXX A;  2LRQ A;  2LCS A;  1I1J A;  5GAM j;  2OAU A;  3HRU A;  1NPP A;  4JS5 A;  5DM7 R;  4M7A C;  3EG9 A;  1Q7Y R;  3CCL A;  5CO7 A;  1UG1 A;  2EYX A;  3L2Z A;  2CP6 A;  2YUN A;  5FW9 A;  3LGL A;  3CC7 Q;  2LQW A;  1AT1 B;  3C0C A;  1YJ9 A;  3CXC S;  3TQ7 P;  1NLP C;  1KC8 U;  5GAN g;  5FRM A;  5LJ3 f;  2EQJ A;  2M0Y A;  4LDV A;  3OY9 A;  1VQK T;  3RIR A;  1VQ7 A;  3QSU A;  4KUD K;  3CPF A;  4JUV A;  1PSE A;  1UJY A;  2V8I A;  4WF2 A;  4B6M A;  4J9F A;  3CD6 T;  2D1X A;  1VQM Q;  3OW2 P;  3QYH B;  4M7D B;  1OQK A;  4RKU E;  4QVZ A;  2CRE A;  5J26 A;  4BD3 A;  4J5Y A;  5GMK j;  1R77 A;  2CP0 A;  1XNI A;  1SF9 A;  2CZ6 B;  2FG0 A;  3TCJ A;  2DL4 A;  2HCK A;  4BDY A;  3OB9 A;  1G5V A;  4JZ4 A;  1PD1 A;  1UHC A;  3NFC A;  1TUD A;  3E9G A;  1H8K A;  2DBM A;  4PJO E;  5HK0 A;  2CP2 A;  1NE8 A;  1GL5 A;  3UA6 A;  1T0J A;  3QO3 A;  1W2B P;  1RI9 A;  1V1C A;  3UF4 A;  1FMK A;  2ZPB B;  2QYZ A;  4OF1 A;  4CC2 A;  3CCL Q;  2AK5 A;  4C0F A;  1X69 A;  2DVE A;  3TRE A;  4NS5 A;  4E7H A;  3E19 A;  1M90 U;  2RQV A;  5GAO q;  2C06 A;  1YNZ A;  1Y0M A;  2JS2 A;  5IH2 A;  1Q81 C;  1N9R A;  2L3P A;  4FM4 B;  2FEI A;  1YJ9 Q;  1NJI U;  4M7D D;  1VA7 A;  1BBZ A;  1OPL A;  3CQT A;  3VRY A;  2K2M A;  2L3Q A;  2WSE E;  3TSZ A;  2QQB A;  2JM9 A;  2PVG B;  2E6Z A;  1VQ7 Q;  4EDU A;  1WX6 A;  1K0X A;  4JDS A;  1A0N B;  4XU2 A;  1X6G A;  3LH5 A;  2OX7 A;  3WVE B;  3MPU B;  1UGQ B;  4BE2 A;  1MMA A;  4KRT A;  1WLP B;  1JJ2 P;  2NUP A;  4BI8 B;  2LQN A;  2JM8 A;  3RR6 A;  4J6Y A;  3VS7 A;  2ZPG B;  5EC7 A;  3EG9 B;  4F04 B;  3CCV A;  2CP5 A;  2DLP A;  3EAE A;  3GOX A;  4C8Q E;  3KFV A;  1QKW A;  1SHF A;  4C5G A;  2DRK A;  1MHN A;  4PJO A;  3X26 B;  1NM7 A;  2P84 A;  2RM4 A;  2J05 A;  4KUL A;  2MF2 A;  2HQX A;  3OYY A;  1T3S A;  1M3A A;  4HCK A;  1IB8 A;  2HQH A;  2KMT A;  3V8L A;  3R6N A;  1WJS A;  4A53 A;  2PNI A;  1M2V A;  2QGF B;  2WSC E;  1WZO A;  1HK9 A;  1K73 R;  1KC8 C;  2LDM A;  1EIF A;  2FB7 A;  4M7D C;  3MJX A;  3DLL A;  2PVD B;  3VRZ A;  2X4X A;  3OSV A;  1QWE A;  2M1H A;  1YI2 T;  2O4X A;  1IGQ A;  1VQP T;  1VQ5 Q;  4C5I A;  1PRL C;  1V76 A;  2RD1 A;  5GAO l;  4KGX B;  4BUG A;  1YWP A;  2WAC A;  1WHL A;  4BY6 B;  1K8A R;  2SEM A;  2EYY A;  2MAM A;  5LJ5 g;  2JT4 A;  1ZA1 B;  4BDZ A;  1JB0 E;  2RJD A;  3OW2 A;  1M5Q 1;  2RK1 A;  2LC4 A;  2QQS A;  1Z9Z A;  2QTX A;  1X6O A;  3M4G A;  4M77 A;  2ZPE B;  2YRC A;  1HD3 A;  2R5M A;  5HKC A;  2KRO A;  5GMK m;  2DX1 A;  4DA4 A;  2RJF A;  4J8O A;  4C8Q A;  1K9M R;  3CCV Q;  2GFU A;  3PFS A;  3CCQ T;  2CT3 A;  2K4Y A;  2L0A A;  3P8B B;  4JS4 A;  1M9S A;  4M78 D;  3REB B;  1IXD A;  2E3H A;  1WNL A;  3ASK A;  1WJR A;  1W2B A;  1AVZ C;  3I5R A;  2HBP A;  4PJN A;  4TVR A;  2FRY A;  4C0Z A;  1M90 C;  1GFD A;  2XI9 A;  3INZ A;  4F17 A;  5AT1 B;  2Y90 A;  2NYS A;  4AG1 C;  3EG1 A;  2RPN A;  2JNG A;  2FPD A;  2CZ0 B;  3MKD A;  2X4J A;  4GBQ A;  1NJI C;  3ZFJ A;  1JBM A;  2F5T X;  1UDL A;  3CXC P;  3VS5 A;  1M3C A;  3J7A F;  1Q86 R;  5GAM e;  1QVF P;  1AD5 A;  2NUP B;  1JXO A;  3MCA B;  5GAO m;  4AT1 B;  2MMP A;  2KT1 A;  3BE3 A;  2EQK A;  3RKY A;  5GAN j;  4KUI A;  5C0M A;  1ZA2 B;  2BZY A;  3OSS C;  3M0S A;  1OX9 A;  4RG2 A;  1UUE A;  4PJO B;  2LT4 A;  4R55 A;  1R0C B;  4EMG A;  2QEX A;  2AZV A;  1JJ2 A;  2FL7 A;  4Y28 E;  1N9S A;  2KXC A;  5ECA A;  2VC8 A;  1I5O B;  1YWO A;  4PLI A;  1YHQ Q;  2DL3 A;  3G4S T;  3I56 T;  5IXB A;  2RI2 A;  2MI6 A;  5LJ5 d;  2DM1 A;  2HQE A;  4YTL A;  1M2V B;  4ZNX A;  2DEU A;  1Q7Y U;  1VIE A;  4KGV B;  2O4X B;  5GMK e;  3UA7 A;  2DK3 A;  4M75 E;  1KQS P;  1PSF A;  3REA B;  2CSQ A;  4OP0 A;  2MWP A;  3EFS A;  5KYU A;  1Y57 A;  2DXU A;  1I07 A;  2JTF A;  2WSF E;  2DAQ A;  3TVT A;  4BY6 C;  2ZGW A;  4JPB W;  4IUT A;  5KYW A;  1XJW B;  1YN8 A;  2O31 A;  2YSQ A;  2J6K A;  3RKX A;  2HBW A;  2A28 A;  2AZS A;  5CKB A;  4LUD A;  4UC4 A;  4PJO D;  1VYV A;  2ROT A;  2XDD A;  1M4Z A;  4M77 B;  3EG3 A;  2JJ9 A;  4IUR A;  3QYG B;  4WCI A;  2DET A;  1WQW A;  4C8Q B;  1C0M A;  1YJN T;  1IGU A;  3GNF B;  2KT8 A;  2K6D A;  3FC3 A;  1OYX A;  4N4I A;  5LJ3 h;  4IIM A;  4CC3 A;  2YHT A;  3CCM T;  3CME T;  2ZPI B;  2QEX Q;  5GAO p;  1Y7X A;  2P4R A;  3UDC A;  4QVD A;  1HSQ A;  2E70 A;  2C0T A;  3OW2 S;  1HXD A;  3J81 E;  4QQG A;  2E64 A;  4MDW A;  2EQI A;  1BI2 A;  1TOV A;  2H3J A;  1TWB A;  2DZC A;  2XIC A;  2GCX A;  4DOV A;  2PVO B;  5CQX A;  4ZN1 A;  1ZSG A;  4M75 A;  2EQM A;  3H0H A;  4NL3 A;  3FRN A;  3A8M B;  1WJQ A;  2F2X A;  2DJQ A;  4C8Q D;  3FEO A;  5I2M A;  1YIJ A;  1PM3 A;  4QW2 A;  1W2B S;  3QUI A;  3V7S A;  3OBY A;  1PC0 A;  3CXC A;  1YIT T;  3OYF A;  2K5I A;  4HCB A;  4PJO C;  1YJW A;  1U5S A;  4M78 F;  4XQ3 A;  1U1S A;  4BAC A;  1QVF A;  5GAM d;  2ZCF B;  3BW1 A;  2O2O A;  3JCM J;  5GAN 8;  4RTY A;  3ZBD A;  4WTO B;  4HT9 A;  1XQH A;  1UGR B;  4JRI A;  1VYT A;  2CGH A;  2CUD A;  2DRM A;  2ECZ A;  4R0K A;  4HCC A;  2BKD N;  2KY9 A;  5A0G A;  2NUT A;  1M27 C;  4FSS A;  1VQO T;  1IHV A;  1D0Y A;  3SWN A;  5IN1 A;  2LJ3 A;  5I22 A;  1Z9Q A;  5LJ5 j;  1VQL A;  2EVR A;  3CCJ A;  4FT2 A;  4AFQ C;  1ZLM A;  4N0A C;  4PJL A;  2DXC A;  2IPO B;  3C95 A;  4N4G A;  5KYU B;  4LDW A;  5KYW B;  4ZGJ B;  1Q7Y C;  2E12 A;  2I0N A;  1RAD B;  3A8H B;  3JCM b;  3OYB A;  3CCR A;  3H8Z A;  1JEG A;  1WXT A;  4M77 C;  2RI5 A;  1LCK A;  1KQS A;  2EJF A;  3OS1 A;  1YBY A;  2DYI A;  4C8Q C;  2OTL Q;  4PFZ A;  1K73 U;  4ELY C;  4J9H A;  4D8D A;  1SSH A;  2JW4 A;  1YIJ Q;  1EZZ B;  1IZ6 A;  5FU6 B;  1MMN A;  3MEU A;  1YJW Q;  1G8X A;  2OI3 A;  2LCC A;  1WXU A;  3CMA Q;  2L3S A;  3X20 B;  1K8A U;  3X25 B;  3CEY A;  2W0Z A;  3RKW A;  2RF0 A;  3CC7 T;  1VQ6 A;  2JMA A;  1RAI B;  3JB9 H;  5IHN A;  3MP6 A;  1KSW A;  1W6X A;  1R0B G;  2ED0 A;  2FVU A;  4FYX B;  1F1B B;  3CCE T;  3DB4 A;  1N8R R;  1VQL Q;  1BI3 A;  4M75 B;  3JCM d;  3CCJ Q;  3PVL A;  2PTK A;  2XK0 A;  2GNC A;  1UFF A;  1EX4 A;  4HXJ A;  4OMQ A;  4AMC A;  5CR2 A;  3R6O A;  3A8G B;  3Q1J A;  3I55 A;  2ZZD A;  2QTV A;  2CS7 A;  2KE9 A;  3MEA A;  4A63 B;  4ELZ C;  3GPL A;  3SB2 A;  3CCR Q;  1FWZ A;  4XAX B;  1YP5 A;  1VQ4 T;  2RI3 A;  3VS1 A;  3FJ5 A;  2RN8 A;  3OS5 A;  4FU6 A;  2RO0 A;  5GAM f;  4EMK A;  1VUB A;  1D1B A;  2LVM A;  3PNW C;  1BYM A;  4R56 A;  4A4H A;  2P0P A;  1BI0 A;  1PD0 A;  2NUT B;  4GLM A;  1Q86 U;  2A08 A;  1DJ7 B;  3QJY A;  2EAY A;  3SWN B;  1WHK A;  2PUK B;  2DBK A;  2X3X D;  1C6V X;  3L2W A;  3J80 E;  2CZ7 B;  2XD0 A;  3BFM A;  4M75 D;  3CC2 A;  1K76 A;  2QA4 T;  5A0L A;  4MZP A;  3E2U A;  1GCQ C;  2K57 A;  3QZ5 B;  1QVF S;  2RQW A;  2HKQ B;  2K2V A;  2FPF A;  4RG8 A;  3NTK A;  1VQ6 Q;  2ED1 A;  2JOY A;  1R8O B;  4Z89 A;  2KEA A;  3V7R A;  4X9D A;  4FIB A;  2RQR A;  4FW1 A;  2EFI A;  1QCN A;  3CD6 A;  1AEY A;  2VGN A;  4HVV A;  1U06 A;  2RH2 A;  4C92 F;  1VQ7 T;  2HDA A;  3G6E T;  1I81 A;  2LZ6 B;  1TUG B;  2RB6 A;  4J9C A;  2KRN A;  2XDB A;  3NTI A;  4LD6 A;  4OGE A;  5FU6 C;  3I55 Q;  4C0D B;  2EW3 A;  4LXC A;  4F7U F;  1E6H A;  5A2Q E;  1K73 C;  1VQ8 T;  3G7Z A;  3OYM A;  1C1A A;  1M1K U;  2DYB A;  2EGA A;  1RLP C;  1WHG A;  3OYH A;  2VKN A;  2O9V A;  5KCO A;  1ABO A;  1KK7 A;  1KQS S;  2OTJ T;  3OBW A;  3RDV A;  3NGP A;  5GAN 3;  2YLC A;  1K8A C;  1JQQ A;  2EBP A;  4RCC A;  2DTH A;  4K11 A;  4M75 C;  2ROL A;  1WXB A;  4QQ6 A;  1K4U S;  3CC2 Q;  1VQ5 A;  3HFN A;  1UGP B;  3T9N A;  2VXF A;  4A4G A;  4C92 G;  1QCO A;  3QWX X;  5J3B A;  1CSK A;  3NHN A;  2QAS A;  2J06 A;  3VKI A;  3M0Q A;  1VQK Q;  1S72 T;  1NG2 A;  2EGE A;  4M7A F;  3H6Z A;  3M55 A;  2M02 A;  5CVI A;  1QCF A;  4F7U G;  3RER A;  4E7I A;  1XOV A;  2ZAE A;  1OX8 A;  2F5K A;  1QVG P;  4Q5W A;  3CD6 Q;  1UB4 A;  5CCA A;  5GAN d;  3PIO A;  1KD1 R;  2EWN A;  4EMK B;  1RAA B;  2P0K A;  3FLG A;  1TXQ A;  4M77 E;  3OYI A;  2L3R A;  1X75 C;  4E7S A;  1Q95 G;  5FWB A;  3I9Q A;  2AKK A;  4VUB A;  2YDL A;  4IUV A;  4FYW B;  5LJ5 e;  3HSB A;  4PFP A;  3QPH A;  1TH7 A;  2BIV A;  1Q86 C;  1KG1 A;  3BDL A;  3CCV T;  3KBG A; 
#chains in the Genus database with same CATH homology
 3JB9 D;  2VV5 A;  3HRS A;  4C5E A;  4M7A B;  4NL2 A;  2RI2 A;  4LD9 K;  3MO8 A;  1O9S A;  1GXI E;  2MI6 A;  4C8Q F;  5LJ5 d;  1VQK A;  2RJC A;  5GAN 7;  3OS0 A;  2V8J A;  2HQE A;  4HKE A;  3WXM B;  4M7A G;  3N5B B;  4IUQ A;  4YTL A;  5GAN 6;  2KVQ G;  4ZGE B;  5GAN h;  2LNV A;  3X28 B;  3QBY A;  1YJ9 T;  1VQL T;  3FB9 A;  5D6X A;  1Q7Y U;  5LJ3 d;  2DXT A;  4OB0 B;  3CC2 T;  1V29 B;  3O8V A;  1VIE A;  4XK8 E;  3CCJ T;  5FRN A;  1UGS B;  3KXT A;  2O4X B;  1OZ2 A;  5IAY A;  2HD0 A;  1M1G A;  1Y71 A;  2X35 A;  3NTH A;  4JRK A;  5HK3 A;  2DK3 A;  5GMK e;  1YI2 A;  3G71 A;  4XU3 A;  1VQP A;  3JCM Q;  2CZ1 B;  4ZTJ A;  4M75 E;  1NZ9 A;  1PSF A;  2P4T A;  4ATO A;  3L1A A;  5LJ3 j;  1JJ2 S;  2DTO A;  4OP0 A;  2MWP A;  3EFS A;  2JTF A;  2DXU A;  2QQA A;  2WSF E;  2DAQ A;  4RCB A;  4BY6 C;  2ZGW A;  2P0Q A;  2Y4X A;  3G6E A;  4IUT A;  5CKF A;  4C0D C;  2VYT A;  4A4F A;  3RKX A;  3WVD B;  5GAO n;  3CCR T;  2BUD A;  4M78 A;  2CKK A;  2K3Y A;  2LX9 A;  2NLU A;  3QG1 A;  2DKG A;  3JCM W;  4J6W A;  5CKB A;  4UC4 A;  4PJO D;  2XDD A;  5CQY A;  5DY9 A;  4V2S A;  1M4Z A;  3MET A;  4M77 B;  1WPY A;  1M1F A;  4M7D A;  2DD5 A;  2RHX A;  4X9C A;  2JTM A;  4MMK A;  4IUR A;  3P8D A;  1VQ8 A;  5D6Y A;  1YHQ A;  1U1T A;  3QYG B;  4M77 G;  2LTO A;  2RJE A;  3S3O A;  1WQW A;  4C8Q B;  2VGM A;  1YJN T;  3GNF B;  2LQK A;  4M7A D;  4J7F A;  1W4S A;  2QI2 A;  4C8Q G;  4QVC A;  3FC3 A;  1OYX A;  1Q82 C;  3CC7 A;  4N4I A;  5LJ3 h;  1M1K C;  2OTJ A;  4E7K A;  2L5Q A;  4J83 A;  4C5H A;  2YHT A;  4CI0 C;  3BY7 A;  3CME T;  3CCM T;  3S3N A;  2QQ9 A;  1Y96 A;  3F70 A;  2HAX A;  2ZPI B;  4C92 C;  5GAO p;  1Y7X A;  1SSF A;  2E65 A;  3M53 A;  3UDC A;  4A4K A;  2I2L A;  2E70 A;  4PLL A;  4QVD A;  5KCH A;  1Q81 U;  3PT9 A;  1HXD A;  2PUO B;  3J81 E;  3OW2 S;  3E1S A;  4QQG A;  2CYZ B;  2E64 A;  3OYJ A;  4MDW A;  4MZM A;  1MGQ A;  4E7L A;  3VUZ A;  3JCM f;  1VQ6 T;  3LYI A;  2DJZ A;  3OYK A;  1BI2 A;  4L59 A;  3M54 A;  3ME9 A;  3OYE A;  4HCZ A;  3HKS A;  2H3J A;  3L2V A;  1K9M C;  1O75 A;  2GFA A;  2E1H A;  2EJ9 A;  2DZC A;  2XIC A;  3X24 B;  2GCX A;  1S72 A;  2K3X A;  1QW1 A;  3LW5 E;  3LGF A;  1U8R A;  4DOV A;  4JLG A;  4DOW A;  4C0G A;  3OYA A;  2PVO B;  3OYL A;  1VQM A;  2RHZ A;  2A7Y A;  5CQX A;  4M78 E;  1VIF A;  1D3B B;  1N6A A;  4ZN1 A;  4OVA A;  3UT1 A;  1VQ5 T;  3V7C A;  4M75 A;  4EMK C;  2LT1 A;  2EQM A;  4ZGD B;  5A0D A;  4NL3 A;  2E5Q A;  1BIB A;  4DQ2 A;  3FRN A;  3A8M B;  5HY6 A;  5GAN f;  1WJQ A;  1KQ1 A;  1P92 A;  4C8Q D;  3FEO A;  5I2M A;  5L8R E;  4JJN K;  1YIJ A;  5I2S A;  4QW2 A;  1W2B S;  5J39 A;  1BI1 A;  3QUI A;  2XDP A;  3V7S A;  3I55 T;  1N8R U;  2GF7 A;  4KBM B;  3OBY A;  4RMO A;  3JCM c;  2D6F A;  4X34 A;  4GY5 A;  3URG A;  3CXC A;  1YIT T;  3SWN C;  2K5I A;  4GLK A;  3OYF A;  4HCB A;  2PU9 B;  4PJO C;  5I21 A;  1YJW A;  4ZN3 A;  1QVG A;  3HFO A;  3VU3 C;  4M78 F;  4XQ3 A;  5DLO A;  1U1S A;  3LWH A;  4BAC A;  1H64 1;  2ZCF B;  5GAM d;  3BW1 A;  3CCU T;  1QVF A;  3JCM J;  1N27 A;  5GAN 8;  3ZBD A;  1Y07 A;  2E6N A;  1ZHI A;  2B8A A;  4HA8 A;  2F69 A;  2XKO C;  4HT9 A;  1BIA A;  1XQH A;  4P5N A;  1XTD A;  5CK9 A;  4MDX A;  1UGR B;  4JRI A;  4HT8 A;  1QP2 A;  1FXX A;  2CGH A;  2EIF A;  2LRQ A;  3C12 A;  3HL8 A;  4M7D F;  5GMK l;  5GAM j;  2OAU A;  3HRU A;  1NPP A;  4JS5 A;  5DM7 R;  4M7A C;  4IUU A;  3GF5 A;  4HCC A;  3CCL A;  5CO7 A;  3I56 A;  4E7J A;  3ZEH A;  2BKD N;  2DPP B;  2KY9 A;  5A0G A;  2M0O A;  3QHS A;  3L2Z A;  3SFM A;  4Z02 A;  1AHJ B;  1KHI A;  1LOJ A;  1NPR A;  1VQO T;  3PIP A;  3LGL A;  2QEX T;  3SWN A;  5IN1 A;  3V8J A;  2YLB A;  3A8O B;  2AHJ B;  2O01 E;  1YJ9 A;  5LJ5 j;  4BB7 A;  2VXE A;  3CXC S;  1VQL A;  3QXE B;  3CCJ A;  3LLR A;  2QDY B;  4FT2 A;  1KC8 U;  4O5V A;  5GMK i;  5GAN g;  2XG8 D;  5FRM A;  4N0A C;  5LJ3 f;  2EQJ A;  4NOY A;  3RMS A;  4C92 E;  2DXC A;  5KH6 A;  3C95 A;  4LDV A;  4N4G A;  3OY9 A;  4LDW A;  2M9U A;  4XTU A;  1VQK T;  3RIR A;  1VQ7 A;  5KE3 A;  3QSU A;  4MML A;  3LX7 A;  4BI3 A;  1VQ9 T;  4ZGJ B;  1Q7Y C;  4KUD K;  3CPF A;  4JUV A;  2E12 A;  1PSE A;  3A8H B;  5GAM h;  4M78 B;  3JCM b;  3PMT A;  2V8I A;  1G3S A;  3RES A;  5LL6 S;  4F7U E;  4WF2 A;  2DEQ A;  5C6S A;  1B34 A;  3OYB A;  3CCR A;  3H8Z A;  3HPW A;  4LDY A;  4ME7 A;  4OGC A;  3CD6 T;  4M77 C;  5FU7 B;  4D6W A;  3CPW A;  2A3L A;  3UWN A;  2RI5 A;  3QYH B;  4RKU E;  2R57 A;  4M7D B;  4L6V 5;  3G71 T;  1KQS A;  2EJF A;  3OS1 A;  1YCY A;  4QVZ A;  5CAI A;  1YBY A;  5J26 A;  3A5Z B;  5CKH A;  4M7D G;  1IRE B;  4M75 F;  4BD3 A;  4C8Q C;  4XU0 A;  4QQD A;  3OYN A;  4N0A A;  4JRQ A;  3UPU A;  5IT9 E;  5LJ5 h;  1K73 U;  4ELY C;  4J5Y A;  5GMK j;  3VYH B;  3DKM A;  2ZPF B;  1XNI A;  2CZ6 B;  2K5L A;  1IZ6 A;  4FL6 A;  3OYD A;  3OYG A;  3OYC A;  3TCJ A;  4EPC A;  4BDY A;  3VUB A;  3VV0 A;  2JVV A;  3OB9 A;  1G5V A;  3CCQ A;  5FU6 B;  3QZ9 B;  2ZPH B;  3MEU A;  1Y96 B;  1I4K 1;  2LCC A;  3NFC A;  3SDZ A;  4BI4 A;  2KAF A;  3JCM X;  3X20 B;  3CME A;  4FSX A;  3E9G A;  3CC4 T;  1YHQ T;  4PJO E;  3M59 A;  3QKJ A;  2FHD A;  5HK0 A;  1K8A U;  2X4Y A;  1NE8 A;  5LJ3 g;  4PKC C;  4XU1 A;  3X25 B;  3S6W A;  3QO3 A;  3JCM e;  3CEY A;  4XTV A;  2ZPB B;  3LWI A;  3JCM P;  4OF1 A;  2DXB A;  4OB1 B;  5DLQ E;  4N4H A;  3CBM A;  2X4W A;  3RKW A;  4C0F A;  1LNX A;  2DVE A;  3TRE A;  4B9W A;  4NS5 A;  3CC7 T;  1VQ6 A;  2KDS A;  4E7H A;  3E19 A;  3JB9 H;  2DO3 A;  1M90 U;  4M7A E;  5GAO q;  2C06 A;  3MP6 A;  4IUP A;  1Q81 C;  1N9R A;  5GMK h;  4FM4 B;  2FVU A;  2G3R A;  3CCE T;  3MP1 A;  1KQ2 A;  3DB4 A;  2K5F A;  3MEW A;  1BI3 A;  1NJI U;  4M75 B;  4M7D D;  3ER0 A;  2QXF A;  3JCM d;  4M77 D;  4C92 A;  1OZ3 A;  2RK2 A;  3LH0 A;  2XK0 A;  2RA2 A;  2MWO A;  4M75 G;  2OTL A;  1I5L A;  3QDR B;  2WSE E;  1VQ8 T;  2QQB A;  2PVG B;  2IVW A;  2E6Z A;  4IKF A;  3HHT B;  5CR2 A;  3R6O A;  4PNO A;  2Y4Y A;  5AYF A;  4EDU A;  3A8G B;  3Q1J A;  3M58 A;  4F7U A;  3I55 A;  2ZZD A;  1LJO A;  2CS7 A;  1OI1 A;  3MEA A;  4JDS A;  4ELZ C;  3GPL A;  3SB2 A;  1YIT A;  4II1 A;  4XU2 A;  1FWZ A;  4XAX B;  3CMA A;  1VQ4 T;  3WVE B;  1UGQ B;  2RI3 A;  4BE2 A;  3CCU A;  2V8K A;  3OMG A;  3OS5 A;  3MP8 A;  4FU6 A;  1N8R C;  3PTA A;  1WGS A;  2RO0 A;  5GAM f;  4BI8 B;  3PMI A;  3DB3 A;  4EMK A;  1VUB A;  3QII A;  4J6Y A;  2LVM A;  2QQR A;  3PNW C;  3V8K A;  2ZPG B;  1BYM A;  1BKB A;  4R56 A;  5D6W A;  3G4S A;  4A4H A;  2EYQ A;  3CCV A;  2P0P A;  1BI0 A;  3RMQ A;  1VQN T;  1Q86 U;  3EAE A;  3GOX A;  1X01 A;  3SD4 A;  4C8Q E;  3CCS T;  2DZ9 A;  3C94 A;  1KD1 U;  1DJ7 B;  2EQU A;  3QJY A;  4C5G A;  2R58 A;  1MHN A;  2EAY A;  3SWN B;  2PUK B;  1VQO A;  4OMF B;  3JCM h;  2E41 A;  4PJO A;  5LJ5 f;  4FT4 A;  1QP3 A;  3X26 B;  2D9T A;  2XID A;  3OMC A;  3KUF A;  3OQ5 A;  3JAM E;  2RM4 A;  4LDX A;  1FX7 A;  4KUL A;  3HRT A;  2MF2 A;  4LDU A;  4XTW A;  5LJ3 e;  3J80 E;  2CZ7 B;  2HQX A;  3BFM A;  4M75 D;  3L2W A;  3CC2 A;  2XD0 A;  2KQW A;  3C4S A;  2QA4 T;  1QVG S;  3OYY A;  5A0L A;  4MZP A;  2K57 A;  3QZ5 B;  4B9X A;  1QVF S;  3OS2 A;  2KMT A;  1G3W A;  3AHU A;  3V8L A;  4OB2 B;  2K2V A;  1WJS A;  3M57 A;  2XHC A;  4RG8 A;  4M7A A;  3P8H A;  5GAO r;  3NTK A;  4M78 C;  5KE2 A;  5CIU A;  1VQ9 A;  4PL6 A;  3L2U A;  4A53 A;  2JOY A;  2E10 A;  1R8O B;  4JRP A;  2R5A A;  1B34 B;  3JRZ A;  2WSC E;  3V7R A;  4X9D A;  1HK9 A;  5FU7 C;  1KC8 C;  2LDM A;  4FIB A;  1EIF A;  2FB7 A;  4M7D C;  1G3Y A;  2EFI A;  2IG0 A;  3QJ6 A;  4M78 G;  3CD6 A;  3DLL A;  2PVD B;  2VGN A;  2X4X A;  3OSV A;  2M1H A;  5GAM g;  2O4X A;  5GAN 2;  1YI2 T;  4OB3 B;  1VQP T;  2RH2 A;  3CBP A;  3GNG A;  5FLX E;  4C5I A;  4C92 F;  2GQV A;  1VQ7 T;  3M9Q A;  2RD1 A;  3M4Y A;  2LQ8 A;  4O6J A;  5GAO l;  4BUG A;  3G6E T;  1I81 A;  2WAC A;  2PQW A;  3DLM A;  4A4E A;  1JRI A;  3VYG A;  2RB6 A;  5GAN 4;  2XDB A;  1YJN A;  4BY6 B;  3JB9 F;  3HP9 A;  1M8V A;  3NTI A;  4LD6 A;  4EMH A;  4OGE A;  5FU6 C;  2MAM A;  4C0D B;  5M9O A;  5LJ5 g;  4F7U F;  4BDZ A;  1H3Z A;  1JB0 E;  2RJD A;  3OW2 A;  5GAN 5;  3JSC A;  1M5Q 1;  2RK1 A;  3GIB A;  2LC4 A;  2QQS A;  2JZ2 A;  5A2Q E;  4XTZ A;  1K73 C;  1I8F A;  1Q82 U;  3CCM A;  2QTX A;  1X6O A;  3G7Z A;  3GLX A;  2FYK A;  2ZPE B;  3M4G A;  4M77 A;  3OYM A;  1M1K U;  2JN0 A;  3CC4 A;  2R5M A;  5HKC A;  5GMK m;  4DA4 A;  3EFR A;  2RJF A;  3VJP A;  3OYH A;  3CPW S;  3BDU A;  4J8O A;  4XTX A;  5KCO A;  4C8Q A;  1KQS S;  2KSS A;  2GFU A;  3M5A A;  3M56 A;  3PFS A;  2OTJ T;  3A8L B;  3CCQ T;  2L8D A;  3OBW A;  4ZTF A;  5GAN 3;  2D0Q B;  2YLC A;  2K4Y A;  4JS4 A;  3P8B B;  2DIQ A;  1M9S A;  3TU4 K;  3FIF A;  3GP8 A;  1K8A C;  4M78 D;  4RCC A;  2DTH A;  2RHU A;  3RUX A;  3S3M A;  1ZQ1 A;  4M75 C;  5EG2 A;  3L2Q A;  1K9M U;  3CCE A;  4PJO F;  4QQ6 A;  1WNL A;  3ASK A;  2DIG A;  1WJR A;  4C92 B;  1W2B A;  2HBP A;  4TVR A;  5CKE A;  5GAN e;  3HFN A;  1VQ5 A;  1UGP B;  1UEB A;  2M16 A;  2VXF A;  3T9N A;  3JCM V;  4C0Z A;  4A4G A;  4C92 G;  1M90 C;  2XI9 A;  3INZ A;  5FRO A;  2DTI A;  5J3B A;  2Y90 A;  3VKI A;  4J7I A;  3JB9 I;  2JNG A;  2JUF A;  4F7U B;  3JB9 G;  1QVP A;  2CZ0 B;  1S72 T;  2X4J A;  4CRI A;  3OA6 A;  1KHC A;  1NJI C;  3ZFJ A;  3H6Z A;  4M7A F;  2KK4 A;  1JBM A;  3M55 A;  5CVI A;  4E47 A;  2F5T X;  1VQM T;  4F7U G;  3RER A;  4E7I A;  4XTY A;  1XOV A;  1RI0 A;  2F5K A;  4KT0 E;  2EKO A;  2YRV A;  3J7A F;  4Q5W A;  1D3B A;  5GAM e;  1UB4 A;  5CCA A;  5GAN d;  1WQ7 A;  1VQ4 A;  2EJG A;  4MZT A;  4A54 A;  2OTL T;  3PIO A;  2EWN A;  3MCA B;  4EMK B;  3PGG A;  4M7D E;  2P0K A;  4M77 E;  3FLG A;  2L89 A;  5GAO m;  1YIJ T;  3OYI A;  2DD4 A;  4J6X A;  2L3R A;  2MMP A;  4JLI A;  1X75 C;  2EQK A;  3RKY A;  4BE0 A;  2RHI A;  5GAN j;  4KUI A;  5C0M A;  4VUB A;  3E9F A;  4IUV A;  3TEE A;  1VQN A;  5CKD A;  3OSS C;  4RG2 A;  1YJW T;  3CBO A;  3CCS A;  5LJ5 e;  2HNI A;  3CMA T;  3MEV A;  2LT4 A;  4Y91 A;  4PJO B;  4R55 A;  3L42 A;  3L2R A;  3HSB A;  4EMG A;  2QEX A;  3FJP A;  4BE1 A;  1JJ2 A;  2FL7 A;  3QPH A;  4L5G A;  4Y28 E;  4PJO G;  1N9S A;  1TH7 A;  2BIV A;  1RL2 A;  2RHY A;  3FDR A;  4C92 D;  1Q86 C;  1KG1 A;  2VC8 A;  3BDL A;  1G3T A;  4PLI A;  4M77 F;  3JB9 J;  3JCM g;  3G4S T;  3MHX A;  3CCV T;  2XU8 A;  2QA4 A;  3CCL T;  1KD1 C;  1ZBX A;  2VUB A;  3I56 T;  2LCL A;  3KBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...