4L59A

Crystal structure of the 3-mbt repeat domain of l3mbtl3 and unc2533 complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
313
structure length
307
Chain Sequence
b'WCWASYLEEEKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFEVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYNVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein 3
publication title The structure-activity relationships of L3MBTL3 inhibitors: flexibility of the dimer interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 80
structure length 307
sequence length 313
ec nomenclature
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l59A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l59A03
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l59A01
2RJCA 4HCZA 2EQMA 4A4EA 4QQGA 3OYHA 3MEUA 3DB3A 3MO8A 3MP8A 4ZTJA 1SSFA 2VYTA 3UWNA 3MEAA 1WJSA 2RO0A 3E9FA 3H8ZA 2RI3A 4BDYA 4N4GA 2XK0A 3E9GA 3OMCA 3S3MA 1XNIA 4C5HA 2O4XA 2R5AA 4X34A 2LCCA 3OY9A 3OYNA 2JZ2A 3GOXA 1G5VA 2EQJA 5D6WA 2X4XA 5CIUA 4OVAA 3UT1A 4Z02A 4C5IA 1MHNA 3MEVA 3PMIA 4BD3A 3OYAA 4BACA 4QW2A 2P0KA 3KUFA 5KE3A 1H3ZA 2HQEA 2L89A 3OYJA 5D6XA 2EKOA 4EDUA 3LGFA 3NTKA 3PFSA 5J26A 3FEOA 4B9WA 5FRMA 2QQSA 4BE2A 1KHCA 2EFIA 2RJDA 3L2UA 2LDMA 2RHXA 3QKJA 5IAYA 3S3OA 3LX7A 2CKKA 4PL6A 1WGSA 2E6NA 3ASKA 2JTFA 4IUVA 2O4XB 3ME9A 2X4YA 1WJRA 3LGLA 4E7KA 2MWOA 3QBYA 5D6YA 2L3RA 3PMTA 3P8DA 3CEYA 1RI0A 5IN1A 4C5GA 3FDRA 4A4FA 2RHUA 1N27A 2IG0A 2RJFA 4IUUA 4IUPA 2GFAA 3OYLA 3L2RA 3FC3A 1OZ2A 4A4HA 5KCHA 3OS0A 3META 3P8HA 3OYFA 3ZEHA 2K3XA 3OYGA 3OYKA 4B9XA 3OYCA 3MP1A 2M16A 2L8DA 3NTIA 4LD6A 3OYDA 4CRIA 4QQDA 2RI5A 5C6SA 2MWPA 3BDLA 2PQWA 3QIIA 4PLIA 3S6WA 2LTOA 4NS5A 4FU6A 3F70A 3OA6A 3S3NA 2RHIA 4BE1A 1OYXA 3SD4A 2HQXA 4QVZA 2R5MA 5FROA 3OYBA 2E5QA 3MP6A 3OS2A 4IURA 4N4HA 5C0MA 4E7HA 4L59A 2DAQA 3O8VA 5M9OA 3OS1A 3L2QA 4PLLA 3OYMA 3OMGA 2GFUA 3L2VA 5KH6A 2EQKA 2NLUA 4A4GA 2R57A 2F5KA 4II1A 5KCOA 3L2WA 2DIGA 3LYIA 2LRQA 2R58A 5J39A 4IUTA 3OQ5A 2GF7A 3OYIA 2QQRA 3MEWA 4UC4A 4FL6A 4GY5A 3OB9A 3L42A 3DLMA 3LLRA 3OYEA 2B8AA 4BDZA 2X4WA 2M0OA 4BE0A 3C4SA 4IUQA 2K3YA 3DB4A 2D9TA 3PNWC 3M9QA 4IKFA 2XDPA 2DIQA 3Q1JA 2X35A 4E7JA 1OI1A 3LH0A 4QQ6A 2WACA 2BUDA 4E7IA 2FHDA 4Q5WA 4RG2A 2RJEA 2G3RA 2RI2A 4E7LA 4C5EA 5KE2A 2RHZA 4ZTFA 2BIVA 2EQUA 3H6ZA 3QJ6A 2LVMA 5FRNA 1WJQA 2RHYA 2YRVA 1OZ3A 3FLGA 4N4IA 2BKDN 2M1HA 3NTHA 3EAEA
chains in the Genus database with same CATH superfamily
2P4TA 5KYXB 2BZ8A 3CMAA 2CP2A 1VIFA 1A0NB 4D8KA 5LL6S 1X01A 1G3SA 1SG5A 2RMOA 4AFUC 1BCOA 5GAN8 4M7DC 2AZVA 3EFRA 1AWXA 1UTIA 1M1KR 2QTXA 2P0KA 3DLLA 1HXDA 5GAN3 1Q86C 4M7AC 3VKIA 1IGUA 1QWFA 2A3LA 2QQ9A 2EFIA 1BIAA 2EW3A 2RQVA 4M78B 5FW9A 1B3QA 1GBQA 1VQNA 4CC2A 4ZGDB 4OMLA 1H3HA 1VQOQ 1IZ6A 2OX7A 4J9HA 2E3IA 2CH4W 1ZX6A 4LDVA 2E12A 2FVUA 2KYMA 2EVRA 1I8FA 1RAHB 4QQDA 3HHTB 1YWOA 2LNVA 4FIBA 5AYFA 2A28A 2LTOA 2DERA 3OW2P 1VQMT 2PUOB 1VQ7T 2DVEA 3JCMJ 1W2BP 1D3BB 3MP6A 2CH4A 3GP8A 3OS1A 1OV3A 1JU5C 4A53A 2LNHB 4OB2B 3L2WA 1MGQA 2DIGA 4JRQA 2KEAA 4LNPA 1YI2T 3G71T 2KE9A 4BY6C 2VC8A 3C4SA 2O31A 4XK8E 1R8OB 1TH7A 1O75A 3CC2T 2X35A 3CC4Q 5GMKl 3CCLA 1BI0A 1P92A 2JW4A 1VQ6Q 4HCZA 2QEXQ 5CO7A 3M56A 1ARKA 3PE0A 5I2SA 4J7FA 3MEAA 4XQ3A 3E9GA 3OMCA 5HKCA 3S3MA 4DA4A 3CCRA 2O4XA 2KNBB 2LCCA 3VS6A 4A63B 5AT1B 1QCOA 4FT2A 4EMKA 2LJ1A 1U1TA 3HFNA 1JXOA 1UGQB 2RA2A 4XTZA 1KC8C 1SRMA 1N8RU 1KFZA 2RHXA 1QKWA 5J3BA 5LJ3d 1VA7A 4NL3A 3OSVA 1QVGS 2QGFB 1K0SA 3EGDB 4M77F 1BI3A 3THKA 3ZFJA 1NM7A 3META 4C92G 2CREA 3UATA 4JRPA 2OAUA 4CRIA 4EMHA 1NYFA 4RUGA 2KSSA 1OPKA 2DVJA 1KQSS 4RTTA 1D0ZA 4PJNA 2K5IA 2M51A 2V8IA 1PNJA 5LJ5e 3H9NA 4WTOB 4KGXB 2QA4A 1YITA 2V1QA 4PLLA 3O5ZA 5DY9A 4PNOA 1WNLA 2HL3A 2FL7A 1QVPA 1FWZA 1GBRA 1UGVA 5I2MA 2FZCB 4LE9A 4FL6A 3M59A 2M02A 1VQ4Q 3OYEA 3QYGB 1Y7XA 1NJIU 3CCET 4XTYA 2QTVA 4QQ6A 2YHTA 5L8RE 4GLMA 1MUZA 4ZTFA 3JCMc 5CVIA 1GFCA 5GANg 1UGSB 2RD1A 1IHWA 4HT9A 1VUBA 1N5ZA 4OB3B 2F2XA 4AG2C 1ZSZA 2I2LA 3BE3A 1V1CA 2EYQA 1KD1C 5GAMe 1QP3A 2EKHA 2HBPA 3X25B 3T9NA 1M2OA 2A36A 2VKNA 2R5AA 4X34A 3OY9A 3CCJQ 2X4XA 4J6XA 1TSFA 4ZGEB 2KDSA 3VS5A 4QVDA 3JCMb 1RABB 1VQ9Q 4C8QE 5GANf 4PKCC 1BI2A 3SWNB 3PFSA 2RQWA 4JLGA 2QQSA 5LJ5d 4E7SA 1CSKA 4RKUE 1YJ9Q 3JCMV 3CCQQ 2YUNA 2HSPA 1VQOA 1RLQC 1RAGB 1WJRA 3A8GB 1WXTA 4M7DG 4JZ3A 3PMTA 3V7SA 1I81A 1QWEA 1KQ2A 3MJXA 2ZPGB 3CPWA 4DBFA 3OYLA 1AVZC 1ZSZC 2J05A 3P8HA 4HKEA 1K9MC 3OYFA 1V29B 3TVTA 4B9XA 3HRTA 3OBWA 1QVGP 3CXCA 3JB9G 1JXMA 1M3AA 1YFNA 4PJLA 3M58A 4F17A 3BFMA 5DM7R 3F70A 2L5QA 5GMKj 2FB7A 2JN0A 3EFOB 3OYBA 1TTHB 2E5QA 3ER0A 2DETA 3JCMP 5GAOr 2CSQA 2QGGA 1VQLQ 2R57A 4YTLA 4C0DC 2QQRA 2WSCE 2LJ0A 2XHCA 2X4WA 2K3YA 1AWJA 1AEYA 2RQRA 2JTMA 3CC4A 2DKGA 1RAEB 1M30A 2AK5A 1VQPT 2FHDA 1PC0A 2MCNA 1VQKQ 1MV0B 3QPHA 1MMGA 4F7UF 3HFOA 1BCMA 1VQ6A 5FRNA 4OMOA 3VRZA 1OZ3A 4Y91A 2QEXA 4F7UA 2LZ6B 4N4IA 2HMAA 3E1SA 3CC7Q 5GJWB 1LOJA 4Y28E 3GNFB 2YUOA 2DBMA 2LT1A 2XK0A 2HEQA 3SHWA 1G5VA 2EQJA 3CCLT 4PJOG 3TEEA 5CIUA 4C8QB 1G2BA 2QYZA 2FO0A 1NJIR 1H3ZA 4KH1B 2VWFA 4AFSC 2PZ1A 4F04B 1I4K1 4IIMA 1Q82C 1NZ9A 2OTLA 2DLPA 3QKJA 2CP7A 3CCRT 2CKKA 2DYIA 2VGMA 3M0QA 1BIBA 3M5AA 2O9SA 4HCCA 3X26B 2EJ9A 2DILA 4WF2A 3ME9A 1QKXA 2BE9B 1Q86R 5GJVB 2A7YA 1X6OA 3QUIA 4IUUA 4OP0A 2SRCA 4PK4A 4DEYA 1JRIA 3M0PA 5HK0A 2JUFA 2AIRB 2YRCA 1YJNQ 1NYGA 2HCKA 3GF5A 3OYCA 2RK2A 3MP1A 3FRNA 1WHGA 3OYDA 1PSEA 1KG1A 5C6SA 4V2SA 1VYTA 3TQ7P 3EH2A 4BI8B 2NUPB 3A5ZB 2R5MA 5KYWB 4M75F 3M4YA 3REAB 2M0YA 4L6V5 1YBYA 2JS2A 2GCXA 2GQVA 1D1CA 1VQ4A 2Y4XA 3I35A 2DM1A 1UGPB 1JQQA 1RAFB 4RCBA 4J9GA 3CCMQ 2WACA 4C5EA 2EGEA 2Z0WA 2EQUA 1OU9A 4A4EA 4C92A 4QQGA 2JM9A 1PM3A 2GNCA 3HSBA 3UWNA 2AHJB 2NYSA 1MMAA 3CCJA 4J9IA 2RM4A 1M1KU 1VOMA 2CSIA 3LW5E 2PTKA 3M53A 3EG9B 3UT1A 1VQ9A 4OMNA 3CCSQ 4J5YA 1YHQQ 4J9DA 3JB9I 2JVVA 2EKOA 9ATCB 4EPCA 1YJ9A 4GBQA 2HKNA 3CCQA 1UG1A 2I0NA 3H41A 4M78G 4PL6A 2LX9A 5FU7C 5L23A 2E6NA 5GANj 4LXCA 1FMVA 1KC8R 5LJ3h 2O9VA 3REBB 3GBQA 1SRLA 3BY7A 2COZA 2RJFA 5EG2A 4M7DD 1LVKA 4RCCA 2GFAA 2ZPEB 1TU0B 3G7ZA 4C92C 4JRKA 3ZBDA 1VQOT 2AKKA 2E65A 3I9QA 3RR6A 4PLIA 3S6WA 3U23A 4OB1B 4NS5A 4M7AD 3OA6A 4AG1C 3JB9D 1Y71A 3RMQA 3E19A 2KXCA 2FPDA 1VQLA 2QASA 1RI9A 2D1XA 2EQKA 4A4GA 2EAYA 5LJ3g 1GXIE 2PU9B 4XTVA 4E2FB 3CPWS 4M77E 3DB4A 2MMPA 1IGQA 2KRNA 1WA7A 4OMFB 5I22A 1VQKA 5A0LA 3CXCS 2DTHA 4IIOA 4M7DA 3J7AF 3QJ6A 3GNGA 5IHKA 1BK2A 3CC7A 4ATOA 3CCUQ 2H8HA 5KYNA 4M7AA 2RK1A 5LJ3f 2RO0A 2VB6A 1HK9A 3EG0A 2YT6A 1Q7YC 2OAWA 2RQUA 3VUZA 1VQ6T 3RKWA 2QEXT 3MEVA 4LD9K 4QW2A 3TCJA 4ESRA 2ROTA 2J7IA 2PUKB 4KT0E 3M0SA 1TWBA 4CC4B 2VUBA 2LDMA 5GAOp 1B07A 2CS7A 2YUPA 1LNXA 3V8LA 5LJ5h 4IUVA 5KYYB 1MNEA 1IREB 2O4XB 3E2UA 2KAFA 4EMKB 2NWMA 3QBYA 1OULA 3A8LB 2K79A 2K6DA 1TOVA 1YJNA 2OTLT 3EFSA 3OS0A 2A37A 1M5Q1 1G8XA 3QZ5B 2MAMA 1WHMA 1UHCA 2DTIA 1OX8A 2L8DA 3NTIA 1WFWA 3MKDA 1YJWQ 3QJYA 4RG8A 4RMOA 5I21A 4FW2A 2HQXA 3AHUA 1TUCA 4PJOA 1K9MR 1D1BA 2OTJQ 3EG1A 2D8JA 3M55A 2E1HA 3M0RA 1M2VB 3OYMA 3OMGA 5CQXA 1U06A 1R77A 5LJ5g 4M77B 3QYHB 4HA8A 2RF0A 2KVQG 5GAMh 1AT1B 1NE8A 1PCXA 4IUQA 3CCMA 3MPUB 2V1RA 1U8RA 1X6GA 4KULA 3WVDB 2G3RA 4E7LA 2GGRA 2BZXA 5LJ3e 1YN8A 2LVMA 2DO3A 3CPWP 1HD3A 2KR3A 3I56Q 1ABQA 5LJ5f 1OOTA 3JB9H 4JJNK 3MP8A 1SSFA 2VYTA 3CXCP 1UJYA 1M90C 1WHHA 2EYXA 4N4GA 3MCAB 2F5TX 1NPPA 3QSUA 4JUVA 3GLXA 4JS4A 2LQ8A 1EZZB 3WXMB 3CCSA 2IIMA 4PJOC 2QDYB 5GAMg 1QW1A 1QCFA 1YHQA 1RAIB 2DL5A 2COWA 4ELZC 5CKHA 5D6XA 2P0PA 4LUDA 2RJDA 4F7UE 3J81E 3CCJT 3LX7A 1WXUA 3M54A 5A0DA 4Y92A 1VQ9T 2ZPBB 3R6NA 3JCMd 1Q82R 1AWWA 3PGGA 3CEYA 5GAMf 3BDUA 2BZYA 1K73R 4OF1A 1B34A 1YJ9T 2XDBA 2KT1A 3L2RA 3CCQT 5KCHA 2X3XD 3M0UA 1OX9A 1PHTA 3JB9J 3ZEHA 2DF6A 1U5SA 4J83A 1ZUUA 2CT3A 3NGPA 5GAOm 4FU6A 4D8DA 3VRYA 4BE1A 3VS1A 4E47A 3QWYA 1VYUA 2E64A 3NPFA 2DAQA 1AZGB 1Q81C 5HK3A 4K11A 2R58A 2RNAA 1S72Q 5CKEA 4J8OA 5FLXE 3AT1B 2L2PA 2K5LA 6AT1B 3OB9A 1ZA2B 4M78A 2M0OA 4KUDK 2D9TA 5I11A 3UA7A 5HY6A 4QKUA 4Q5WA 4RTVA 1K8AC 2ECZA 2XKOC 3CCUA 2M1HA 3EAEA 2XD0A 4M75E 4HVVA 1ZLMA 4N0AA 2ENMA 3CCVQ 2KROA 4LUEA 4FYVB 1M1GA 3J80E 1W70A 4C8QG 2K4YA 4FM4B 2NUTA 1D3BA 5D6WA 2WSFE 3RKYA 4AFQC 5LJ3j 3GIBA 1VQMQ 2FRYA 3CC7T 3VV0A 4BACA 4FYYB 2FRWA 2HSEB 5D7UA 4F7UB 2K7AA 3NTKA 5J26A 3A1PA 1TS9A 1RUWA 5IAYA 5FWBA 4M78C 4J6YA 2YXYA 3ASKA 4LDUA 1Q86U 2IPOB 1BI1A 3G6EQ 2X4YA 1M27C 1UECA 4EMGA 2C0TA 5IN1A 1M8MA 3ZL7C 4MDWA 3OYYA 3CC2Q 3JSCA 1W4SA 3EGXB 4AMCA 1B7TA 1YWPA 1M1FA 2EYZA 1Z9QA 3VUBA 3CMAT 1CKAA 3C94A 4N0AC 1YJWA 3PIPA 1TXQA 2FZGB 3C0CA 2C0OA 3QG1A 3EHRA 1QMCA 1WYXA 4NOYA 1LPLA 5A2QE 7AT1B 3EG3A 1X2KA 2DL7A 2OTJA 4QVZA 2ED0A 1M4ZA 2L3SA 4PFZA 2CP0A 2HL5C 1YJNT 1O9SA 3TU4K 1H92A 1WX6A 2E6ZA 4FYWB 2E4HA 5KH6A 1EX4A 1YP5A 2JJ9A 2GF7A 3OYIA 5IHIA 5GAN7 4ZNXA 1HJDA 2DD4A 1VQNT 2PNIA 4Z8AA 2DPPB 4JJDA 4TVRA 1BKBA 2CZ7B 1D0YA 3LH0A 2XU8A 5CKFA 4J9CA 2XDDA 5FU6B 2BIVA 3EGDA 4M75B 3SB2A 3I56A 2RHYA 2YRVA 3JCMQ 2NUZA 3NTHA 2QDLA 4BD3A 1KQSP 3HRUA 2MF2A 4ZTJA 2DZCA 3CCMT 3VS0A 2FPFA 4F16A 2VXEA 3OYNA 5LJ5j 3GOXA 5CCAA 2A0FB 3UA6A 1Y96A 1MHNA 1C0MA 2EWNA 1N6AA 2VV5A 4HVUA 1Q7YR 4EDUA 1Y0MA 2GQIA 1ZBJA 1YCSB 2DEUA 1MV3A 4HT8A 4XU2A 1PRMC 2LX7A 1KC8U 3RUXA 4CI0C 2MK5A 2DYBA 3CCST 1AZEA 5FWCA 4J9BA 4M7AE 1YHQT 3V8KA 1SPKA 2YLBA 2J06A 2DJZA 4IUPA 1VQ5Q 1PD1A 2HNIA 2PVOB 4ZGJB 2JOYA 4FSXA 2PVDB 1QP2A 5GAMj 4HCBA 1N9RA 4RTUA 1T3LA 2E3HA 1IRXA 2KT8A 3SD4A 1UE9A 2GBQA 2JMAA 1R0BG 5M9OA 2EIFA 3O8VA 1VYVA 2GFUA 3M57A 1S72A 1LJOA 1KSWA 3OQ5A 1ABOA 2J6FA 1OEBA 4LDWA 3A98A 4C92D 1WZOA 4MZTA 1OPLA 3Q1JA 4FW1A 2DL4A 3H0IA 2XI9A 4F14A 3CBMA 1BB9A 4KUIA 3CCVA 4C0ZA 2MYSA 3HKSA 2D8HA 3CBOA 4XU3A 4XAXB 4OB0B 1KD1U 1ZBXA 3NFCA 1VQMA 3TREA 4DBHA 3URGA 2QA4T 1YITT 2JNGA 2L0AA 2W0ZA 1Y07A 2C06A 2HQEA 2L89A 3SWNC 1M90R 1AWOA 5GANd 1PSFA 3VU3C 2YSQA 1IXDA 4C92F 1GCPA 1ACMB 2D0QB 3FEOA 1IB8A 2ROLA 4M7AB 3S3OA 3G6EA 2KK4A 3RIRA 1WLPB 1OU8A 3TSZA 2F2WA 1X2QA 1J3TA 1IO6A 1D1AA 3ULRB 2FPEA 4E6RA 3NMZC 2SEMA 1Y57A 3CC2A 1K0XA 4L5GA 4FT4A 5KYUA 3JCMh 1NBEB 1VQPQ 3LH5A 1FXXA 1WI7A 3RDVA 1ZA1B 3OYGA 2ESWA 2EGAA 3RMSA 3BDLA 3SFMA 1K9MU 1FMWA 1GL5A 3A8HB 4M4ZA 2MPXC 3S3NA 5GAOn 4DOWA 2DMOA 4JZ4A 4E7HA 5C0MA 2CDTA 3JCMW 3HRSA 1HSQA 1YJWT 4M77G 2NLUA 2JM8A 4II1A 5J39A 3V7CA 3PIOA 3UPUA 3RBBB 3R6OA 3WVEB 2DX1A 4BDZA 2QXFA 2AZSA 4DOVA 2OTJT 4BY6B 1WXBA 2LCLA 3JCMg 1H641 1Q81R 3VS3A 3CCRQ 2HQHA 2J6KA 1WJQA 4LN2A 3CPFA 2EBPA 3LWIA 2F69A 3G4SQ 1TUGB 2VVKA 3CBPA 1RACB 3H8ZA 1K8AR 2ZZDA 4GLKA 4BDYA 2KRMA 4J9EA 2W10A 1XNIA 2E10A 4A4KA 3JCMf 4C8QC 2K3BA 5KYWA 2X9HA 4M7DF 4OVAA 1H8KA 3I56T 1WQWA 2M9UA 2YRDA 1N8RC 1SKUB 3KUFA 1XTDA 3OYJA 1SEMA 3H0HA 2O2OA 4ANJA 3EHQA 4M7AF 2EGCA 3JB9F 1D0XA 3CC4T 1Q82U 2EPDA 2K2VA 2MOXA 2XIDA 1K73U 1QVFA 1C6VX 2E5KA 3FDRA 1VQ5A 4Z89A 3RESA 1KD1R 4PJOD 4KRTA 1OZ2A 1T0JA 2P4RA 1UHFA 2QG9B 3OYKA 3QDFA 4LD6A 5IXFA 1JJ2A 1RLPC 1BBZA 3FJPA 2CP6A 2DK3A 3QIIA 2DE0X 3X28B 1YIJQ 1AOJA 2HKQB 3EG9A 1W6XA 1NG2A 2K9GA 2F5KA 1NEBA 3VYHB 2LRQA 1NJIC 4ZN1A 3L42A 1TUDA 1VQ8Q 3HL8A 2CP5A 1PRLC 3M9QA 2XDPA 4DBRA 5GMKm 4PJOF 1OI1A 4XTUA 2ABLA 1E6HA 3CMEQ 1S72T 4RTWA 2ZPHB 2CZ0B 2F1LA 4JRIA 3JCMe 2DZ9A 1QCNA 1UGRB 3MO8A 2VASA 1KHIA 2QK0A 2JZ2A 4QT7A 2E70A 4PJJA 1K76A 2AT1B 4F7UG 1G3WA 3CCVT 3PT9A 1EFNA 3I5RA 1VQ4T 2HD0A 5HCKA 5FRMA 3L2UA 3JAME 2DRKA 2KBTA 3A8MB 1TG0A 2JTFA 5GAN4 1WHJA 4KBMB 1FMKA 5CKBA 2NUTB 2L3RA 1PG5B 2DTOA 3C12A 1VQPA 2CUBA 2RHUA 1YNZA 1U3OA 3CD6Q 1OQKA 3G6ET 4BUGA 1ZSZB 2DXBA 4X1VA 2MWPA 3RKXA 2FG0A 3OBYA 1T0HA 1UEBA 2LQWA 3N5BB 2DD5A 4M78D 2HDAA 4XTXA 4N4HA 2GTJA 4L59A 2OJ2A 1K4US 4FSSA 5KYXA 1M3CA 3LYIA 3I55Q 1R0CB 2P84A 4M77D 2O88A 3MEWA 4C0DB 2CZ1B 1UUEA 2CP3A 4X9DA 5KYYA 1SHFA 5CAIA 1FYNA 3V7RA 2K2MA 2K5FA 2C0IA 1WQ7A 4M75G 1E7OA 2RH2A 5DLOA 3G4SA 4J7IA 2RJCA 2HZYA 2QI2A 3MEUA 4KGVB 3P8BB 1SSHA 4M78F 2OTLQ 1WJSA 3PVLA 3L2ZA 1RL2A 2EJGA 2ZAEA 2P0QA 4C5HA 2DNUA 1VQLT 4CC3A 1XOVA 4C0GA 2ZPIB 4Z02A 2GTOA 4C5IA 5GMKe 3PMIA 1M2VA 4R56A 3X20B 2E41A 2YWWA 1Q7YU 1GRIA 2A08A 1WDXA 2X51A 4M77A 3OSSC 1UB4A 1M8VA 2FYKA 5GAN6 2LT4A 1SHGA 4MMKA 5GANh 4ME7A 5A0GA 2LP5A 5GAN2 1WPYA 1G3YA 4AFZC 1VQKT 2ATCB 4HVWA 1IHVA 4EMKC 2X4JA 2KY9A 3TSWA 2O01E 5D6YA 1Y96B 2DXUA 3QHSA 3GPLA 3DKMA 1I1JA 4ORZA 3X24B 1K1ZA 3INZA 3RERA 1T3SA 1VQ7Q 3QWXX 3FC3A 1Q95G 1NPRA 1XJWB 4FCYA 3PVQA 2JXBA 2M16A 5DLQE 4MDXA 1KQ1A 2EYWA 2VXFA 4DEXA 2FZKB 2L3QA 1G83A 1YIJA 4R55A 1BU1A 4WCIA 4C92E 1MMDA 2KGTA 3HTRA 1WHKA 1VQ5T 1YI2Q 5FROA 2KMTA 5GAOl 3G71Q 2LCSA 3CQTA 1DJ7B 4M77C 1QVFS 1D09B 1UDLA 4IUTA 2QAZA 2KQWA 3C95A 1VQ8A 4GY5A 3JV3A 1ZUKA 3DLMA 3FJ5A 3LLRA 3VS7A 2B8AA 1X27A 2DL3A 3CMEA 1GFDA 1JJ2S 2BUDA 5KE2A 2ZCFB 4OGEA 1G3TA 2BTTA 2BKDN 4PFPA 2EQMA 4R0KA 3OYHA 2DA9A 4OMPA 3DB3A 3VJPA 2CT4A 1M1KC 2H3EB 2G6FX 2KI7A 4ELYC 1VIEA 2RI3A 1YCYA 1ZHIA 1RADB 2Y90A 3QZ9B 3OW2A 1X75C 1W2BA 3KXTA 1M90U 1M3BA 1AHJB 1I07A 2COYA 3QXEB 4M7AG 2HAXA 2JT4A 4BB7A 4BE2A 1NEGA 2CUDA 1PWTA 1N8RR 1C1AA 5FU7B 3IQLA 2LC4A 1CKBA 3M4GA 4PFOA 3LGLA 1SF9A 2YLCA 2DJQA 3D7SB 3P8DA 1RI0A 3CD6A 5GAMd 2IG0A 4BI4A 4XTWA 4D6WA 1ZSGA 2XICA 2FEIA 4M7DE 3BW1A 3RNJA 4C92B 3QO3A 2RI5A 3JCMX 1OYXA 2JTEA 3JRZA 2F2VA 4IURA 4MZMA 3L2QA 5KYUB 5IHNA 4CC7A 3CCEQ 3I55A 5KCOA 1GCQA 3H0FA 4O5VA 1Q81U 1I5OB 4AT1B 2ZGWA 2QQBA 4X9CA 2DL8A 4BE0A 5CQYA 2LMJA 5GANe 5GAOq 2DXTA 1BYMA 3G1JA 2ZPFB 1QVFP 3QDRB 3EGXA 4M75D 2RPNA 4KGZB 3SWNA 1X6BA 2JMCA 2EJFA 1K8AU 1AD5A 2CZ6B 5CKDA 1K73C 2CYZB 4JS5A 1JJ2P 3CMAQ 2ED1A 1JO8A 5IH2A 2X3WD 2V8KA 4JPBW 1JB0E 1LCKA 3UF4A 1ZUYA 3G4ST 4MMLA 2DFUA 3HPWA 3VS2A 2CGHA 1MNDA 1GCQC 2V8JA 2LQKA 4PJOE 3LGFA 4O6JA 4NL2A 5EC7A 2XMFA 2DBKA 2MI6A 1WGSA 1PKSA 1KJWA 1HYOA 4BI3A 3M0TA 3FB9A 4E7KA 4XU0A 2MWOA 3EFOA 1VQNQ 4KH0B 4M75A 3CCUT 4C5GA 1XQHA 1VQ7A 2PVGB 3OS5A 4M7DB 4C8QD 4DQ2A 4J9FA 2EYYA 2YDLA 3EG2A 1MMNA 3LWHA 2K3XA 4E7ZA 4DBQA 2BE7D 1KK7A 1WHLA 1YI2A 4OMQA 8ATCB 3G71A 2RHIA 4B6MA 1W1FA 5IXBA 3NHNA 4RTYA 3OS2A 2H3JA 2LQNA 4MZPA 2DXCA 2LJ3A 5CK9A 1QQJA 3UDCA 4RTXA 1X69A 1YIJT 2V26A 1I0CA 3KBGA 2RN8A 4HCKA 3MHXA 4JLIA 4OMMA 4LDYA 4A54A 1E6GA 4C8QF 4C0FA 3PTAA 1KIKA 5IT9E 2DIQA 4E7JA 4C8QA 4E7IA 4OGCA 5FU6C 4RG2A 4M75C 2RJEA 4ZN3A 4JJCA 1UFFA 5ECAA 3V8JA 3CCLQ 1EIFA 1VQ8T 2YUQA 1PKTA 2RQTA 2Y4YA 1ZQ1A 1FX7A 3E9FA 1QVGA 4FYXB 3HP9A 3CMET 2OI3A 5GAN5 1JBMA 2KYBA 1F1BB 2B86A 2VGNA 1RAAB 4PJOB 2HBWA 3OYAA 1NLPC 5KE3A 4EIKA 1N9SA 1V76A 1M9SA 1S1NA 1KQSA 4B9WA 1KHCA 2WSEE 1PD0A 3SDZA 5GMKi 2AKLA 1I5LA 2NUPA 2JS0A 3EGUA 4M78E 2KRSA 8AT1B 3KFVA 3FIFA 3I5SA 4A4FA 1N27A 3OW2S 4HXJA 2D6FA 1X43A 3L1AA 4A4HA 1W2BS 2XG8D 2QQAA 1JEGA 4XU1A 1NLOC 4VUBA 4PJMA 4LDXA 3SEMA 5CR2A 2PQWA 3EH1A 2IVWA 1U1SA 3CD6T 4JJBA 3CCEA 1WIEA 4P5NA 4RTZA 3VYGA 3L2VA 2QA4Q 1YITQ 2DRMA 4J6WA 1K9AA 4UC4A 2L3PA 3A8OB 2RB6A 1UJ0A 1Z9ZA 2EQIA 3PNWC 2D0NA 1QLYA 4IKFA 2J6OA 5GMKh 2KXDA 4Z88A 2MIOA 2RI2A 4QVCA 3I55T 2RHZA 3VS4A 3H6ZA 2K57A 4JDSA 3FLGA 1B34B 2DEQA
chains in the Genus database with same CATH topology
2RJCA 2P4TA 4A4EA 2QI2A 4QQGA 3HRUA 4C92A 3MEUA 3CMAA 2MF2A 3P8BB 4ZTJA 3HSBA 1VIFA 2AHJB 2DZCA 1WJSA 4M78F 3UWNA 3CCMT 3L2ZA 1RL2A 5LL6S 2EJGA 1X01A 2P0QA 1G3SA 3CCJA 2VXEA 4C5HA 3OYNA 2RM4A 5LJ5j 1M1KU 4M7DB 3GOXA 1VQLT 3LW5E 1XOVA 3M53A 5CCAA 5GAN8 4M7DC 1Y96A 2ZPIB 3EFRA 4Z02A 3UT1A 1MHNA 4C0GA 4C5IA 3PMIA 5GMKe 4R56A 1VQ9A 3X20B 2E41A 1Q7YU 4J5YA 2EWNA 1N6AA 2QTXA 2VV5A 2P0KA 3DLLA 3JB9I 4M77A 3OSSC 2JVVA 1HXDA 1UB4A 1M8VA 2EKOA 2FYKA 4EDUA 4EPCA 5GAN3 1Q86C 5GAN6 1YJ9A 2LT4A 3VKIA 4M7AC 2A3LA 4MMKA 2QQ9A 2EFIA 3CCQA 4XU2A 5GANh 1BIAA 1KC8U 4HT8A 4ME7A 4M78G 5A0GA 3RUXA 4PL6A 4CI0C 2LX9A 5FU7C 5GANj 2E6NA 5GAN2 4M78B 3CCST 1WPYA 1G3YA 1VQKT 1VQNA 4ZGDB 4EMKC 2X4JA 2KY9A 4M7AE 1YHQT 3V8KA 2O01E 5LJ3h 1IZ6A 5D6YA 1VQ6T 1Y96B 2DXUA 3QHSA 3GPLA 3DKMA 3X24B 3BY7A 4LDVA 2YLBA 3INZA 2RJFA 2DJZA 3RERA 2E12A 4IUPA 5EG2A 2FVUA 4M7DD 2HNIA 4RCCA 2GFAA 2PVOB 1VQMA 2ZPEB 3FC3A 4ZGJB 2JOYA 3G7ZA 1NPRA 4FSXA 2PVDB 1I8FA 4C92C 4JRKA 1QP2A 3ZBDA 5GAMj 2M16A 5DLQE 4MDXA 1VQOT 1N9RA 4HCBA 2E65A 4QQDA 1KQ1A 3HHTB 2VXFA 1YIJA 2LNVA 4FIBA 4PLIA 5AYFA 3S6WA 4OB1B 2LTOA 4NS5A 4R55A 4M7AD 1VQMT 4C92E 2PUOB 3OA6A 3JB9D 1Y71A 3RMQA 3E19A 2DVEA 3SD4A 5FROA 3JCMJ 1VQ5T 1VQ7T 2KMTA 5GAOl 1D3BB 3MP6A 1VQLA 3GP8A 5M9OA 2EIFA 3O8VA 3OS1A 2GFUA 3M57A 4A53A 1DJ7B 4OB2B 1S72A 1LJOA 2EQKA 4M77C 4A4GA 1QVFS 3L2WA 1MGQA 2DIGA 4JRQA 2EAYA 4IUTA 3OQ5A 5LJ3g 2KQWA 3C95A 2PU9B 1YI2T 4GY5A 1VQ8A 1GXIE 3G71T 3DLMA 3LLRA 4XTVA 4LDWA 4M77E 2B8AA 4BY6C 3CPWS 2VC8A 4C92D 4HCCA 3C4SA 4XK8E 1R8OB 3DB4A 2MMPA 4MZTA 1TH7A 1O75A 4OMFB 3CMEA 3Q1JA 2X35A 1VQKA 5A0LA 3CC2T 3CXCS 2BUDA 1JJ2S 2DTHA 4M7DA 3J7AF 2XI9A 5KE2A 5GMKl 2ZCFB 3QJ6A 3CCLA 1BI0A 3GNGA 4OGEA 1G3TA 3CBMA 2BKDN 1P92A 4KUIA 3CC7A 4ATOA 4HCZA 5CO7A 2EQMA 3CCVA 3M56A 3OYHA 4C0ZA 3DB3A 3VJPA 5I2SA 1M1KC 2RK1A 3HKSA 4J7FA 3MEAA 2RO0A 5LJ3f 4M7AA 4XQ3A 4ELYC 1VIEA 2RI3A 3CBOA 4XU3A 1YCYA 1HK9A 1ZHIA 2Y90A 3E9GA 3OMCA 5HKCA 3S3MA 4DA4A 3QZ9B 4XAXB 1Q7YC 4OB0B 3CCRA 3OW2A 2O4XA 2LCCA 3VUZA 1KD1U 1ZBXA 3NFCA 1X75C 4FT2A 3TREA 4EMKA 3URGA 2QA4T 1YITT 3KXTA 2JNGA 3RKWA 1W2BA 1U1TA 1M90U 2QEXT 3HFNA 3MEVA 4BD3A 1Y07A 1UGQB 4QW2A 1AHJB 2RA2A 4XTZA 3TCJA 2C06A 4LD9K 2PUKB 2HQEA 2L89A 3SWNC 1KC8C 4KT0E 5GANd 1PSFA 3VU3C 4C92F 3QXEB 2VUBA 1N8RU 4M7AG 2D0QB 3FEOA 2HAXA 4BB7A 4BE2A 2LDMA 2RHXA 4M7AB 5J3BA 5GAOp 3S3OA 2CS7A 1LNXA 3G6EA 2KK4A 3RIRA 5LJ3d 3V8LA 5LJ5h 4IUVA 5FU7B 2LC4A 1IREB 2O4XB 4NL3A 3M4GA 3LGLA 2YLCA 2KAFA 3OSVA 4EMKB 1QVGS 3QBYA 3CC2A 3P8DA 1RI0A 3A8LB 3CD6A 4L5GA 4FT4A 5GAMd 2IG0A 3JCMh 4BI4A 4M77F 1YJNA 2OTLT 4XTWA 4D6WA 2XICA 1BI3A 3EFSA 3ZFJA 3OS0A 4M7DE 1FXXA 3BW1A 3META 1M5Q1 4C92G 3QZ5B 3OYGA 2MAMA 4JRPA 2DTIA 4C92B 2OAUA 3CCUT 2L8DA 3NTIA 3QO3A 4CRIA 4EMHA 2RI5A 2KSSA 3QJYA 3RMSA 3BDLA 3SFMA 4RG8A 1K9MU 1KQSS 3JCMX 4RMOA 3A8HB 3S3NA 1OYXA 2K5IA 2V8IA 5I21A 5GAOn 2HQXA 5LJ5e 3JRZA 3AHUA 4PJOA 4DOWA 4IURA 4E7HA 5C0MA 4MZMA 3M55A 3L2QA 2E1HA 2QA4A 1YITA 4PLLA 3OYMA 3OMGA 3JCMW 5DY9A 5CQXA 4PNOA 3HRSA 1WNLA 1YJWT 4M77G 3I55A 2NLUA 2FL7A 1QVPA 1FWZA 4II1A 5KCOA 5LJ5g 4M77B 5I2MA 3QYHB 4HA8A 3V7CA 5J39A 2KVQG 5GAMh 3PIOA 3UPUA 3R6OA 4O5VA 4FL6A 3WVEB 3M59A 1Q81U 1NE8A 2ZGWA 3OYEA 2QQBA 4X9CA 4BDZA 4BE0A 5CQYA 2QXFA 4IUQA 3QYGB 4DOVA 2OTJT 4BY6B 2LCLA 3JCMg 5GANe 3CCMA 1Y7XA 2DXTA 5GAOq 1H641 1NJIU 1BYMA 3CCET 2ZPFB 4XTYA 1U8RA 4KULA 4QQ6A 2YHTA 3WVDB 5L8RE 2G3RA 3QDRB 4E7LA 4ZTFA 3JCMc 5CVIA 5LJ3e 2LVMA 5GANg 1UGSB 2DO3A 1WJQA 2RD1A 4M75D 3CPFA 4HT9A 1VUBA 3SWNA 3LWIA 4OB3B 2EJFA 1K8AU 2CZ6B 2F69A 2I2LA 5CKDA 5LJ5f 3CBPA 1K73C 2CYZB 3JB9H 4JJNK 3MP8A 1SSFA 2EYQA 2VYTA 1KD1C 4JS5A 5GAMe 1QP3A 3H8ZA 2HBPA 3X25B 1M90C 2ZZDA 4GLKA 3T9NA 4BDYA 4N4GA 3MCAB 2F5TX 1NPPA 3QSUA 4JUVA 3GLXA 1XNIA 2E10A 4A4KA 2R5AA 4X34A 2LQ8A 4JS4A 3JCMf 4C8QC 3OY9A 2V8KA 3WXMB 3CCSA 2X4XA 1JB0E 4J6XA 4OVAA 4M7DF 4ZGEB 2QDYB 5GAMg 1QW1A 3I56T 2KDSA 3G4ST 1WQWA 2M9UA 1YHQA 4MMLA 1N8RC 4QVDA 3JCMb 3HPWA 4ELZC 5CKHA 3KUFA 4C8QE 1XTDA 5GANf 2CGHA 3OYJA 5D6XA 4PKCC 1BI2A 2V8JA 2LQKA 3SWNB 4PJOE 3LGFA 3PFSA 4O6JA 4NL2A 4JLGA 4M7AF 2P0PA 2QQSA 5LJ5d 2RJDA 4F7UE 3J81E 2MI6A 3CCJT 4RKUE 3LX7A 3JB9F 3M54A 1WGSA 3JCMV 3CC4T 1Q82U 1VQOA 5A0DA 1VQ9T 4BI3A 2K2VA 1WJRA 2XIDA 2ZPBB 3FB9A 1K73U 3A8GB 4E7KA 4XU0A 2MWOA 3JCMd 1QVFA 4M7DG 3PMTA 3PGGA 4M75A 1I81A 3CEYA 3V7SA 4C5GA 1XQHA 3FDRA 2PVGB 3OS5A 3BDUA 4C8QD 5GAMf 1VQ5A 1VQ7A 1KQ2A 4OF1A 3RESA 4DQ2A 2ZPGB 1B34A 4PJOD 3CPWA 1YJ9T 2XDBA 3OYLA 3L2RA 3CCQT 1OZ2A 5KCHA 3P8HA 4HKEA 3LWHA 1K9MC 3JB9J 3OYFA 1V29B 2K3XA 3ZEHA 3OYKA 4B9XA 3HRTA 4J83A 3OBWA 4LD6A 3CXCA 1JJ2A 3JB9G 3FJPA 3M58A 3BFMA 5GAOm 2DK3A 3QIIA 1YI2A 4FU6A 5DM7R 3F70A 2L5QA 3G71A 3X28B 2RHIA 4BE1A 4E47A 5GMKj 2FB7A 2JN0A 2E64A 3OYBA 2E5QA 3ER0A 3OS2A 2H3JA 2DAQA 4MZPA 3JCMP 2DXCA 5GAOr 1Q81C 5CK9A 5HK3A 3UDCA 2F5KA 2R57A 3VYHB 2LRQA 2R58A 4YTLA 4C0DC 5CKEA 4J8OA 5FLXE 2QQRA 2WSCE 3KBGA 4ZN1A 2XHCA 1YIJT 1NJIC 2K5LA 3OB9A 3L42A 4M78A 2X4WA 2M0OA 3MHXA 4JLIA 2K3YA 4LDYA 4A54A 2D9TA 4KUDK 3HL8A 5HY6A 4C8QF 2JTMA 3M9QA 2XDPA 2DKGA 4C0FA 5GMKm 3PTAA 3CC4A 5IT9E 2DIQA 4E7JA 4PJOF 1OI1A 4C8QA 4OGCA 5FU6C 4E7IA 1VQPT 2FHDA 4Q5WA 4M75C 2RJEA 4RG2A 4XTUA 1K8AC 4ZN3A 1S72T 3QPHA 4F7UF 3HFOA 1VQ6A 2XKOC 3CCUA 5FRNA 3V8JA 1OZ3A 4Y91A 2ZPHB 4F7UA 2CZ0B 4N4IA 2QEXA 2M1HA 1EIFA 3E1SA 3EAEA 4JRIA 1VQ8T 2XD0A 4M75E 2DZ9A 3JCMe 1UGRB 4N0AA 2Y4YA 1LOJA 1ZQ1A 3MO8A 4Y28E 3GNFB 1FX7A 3E9FA 1QVGA 1KHIA 3HP9A 3CMET 2LT1A 2XK0A 5GAN5 1M1GA 3J80E 4C8QG 1JBMA 2JZ2A 2K4YA 1G5VA 4FM4B 2EQJA 1D3BA 5D6WA 4PJOG 5CIUA 3TEEA 4C8QB 2WSFE 3RKYA 3CCLT 5LJ3j 2E70A 2VGNA 3GIBA 4PJOB 3OYAA 3CC7T 3VV0A 4BACA 4F7UG 1G3WA 5KE3A 1H3ZA 3CCVT 1N9SA 3PT9A 4F7UB 1VQ4T 2HD0A 1I4K1 3NTKA 1Q82C 1M9SA 5J26A 1KQSA 1NZ9A 2OTLA 4B9WA 5FRMA 1KHCA 3L2UA 5IAYA 3QKJA 3JAME 3CCRT 2CKKA 2VGMA 2WSEE 4M78C 3SDZA 5GMKi 1BIBA 4J6YA 3M5AA 3ASKA 1I5LA 3A8MB 4LDUA 2EJ9A 4WF2A 2JTFA 1BI1A 3X26B 1Q86U 5GAN4 3ME9A 2X4YA 4KBMB 5CKBA 4EMGA 2L3RA 4M78E 2DTOA 5IN1A 3C12A 4A4FA 3FIFA 2RHUA 1VQPA 1N27A 4PJOC 4MDWA 3OYYA 3OW2S 2A7YA 1X6OA 3QUIA 3JSCA 1W4SA 4IUUA 2D6FA 4OP0A 3L1AA 1M1FA 1JRIA 3VUBA 4A4HA 5HK0A 2JUFA 2XG8D 1W2BS 3CMAT 2QQAA 4XU1A 3C94A 4N0AC 3G6ET 4BUGA 3GF5A 4VUBA 3PIPA 1YJWA 3OYCA 2RK2A 3MP1A 4LDXA 3FRNA 2DXBA 3OYDA 5CR2A 1PSEA 1KG1A 5C6SA 3QG1A 2MWPA 4V2SA 2PQWA 3RKXA 4NOYA 2IVWA 3OBYA 5A2QE 4BI8B 1UEBA 3N5BB 1U1SA 2DD5A 3A5ZB 4M78D 3CD6T 2OTJA 4QVZA 2R5MA 4M75F 4XTXA 1M4ZA 3CCEA 4N4HA 1YJNT 3M4YA 4L59A 1O9SA 3TU4K 4P5NA 2E6ZA 3VYGA 4L6V5 3L2VA 1YBYA 5KH6A 2GCXA 2GQVA 3LYIA 1VQ4A 2GF7A 2Y4XA 4J6WA 4M77D 3OYIA 3MEWA 4UC4A 4C0DB 2CZ1B 5GAN7 3A8OB 2DD4A 4X9DA 2RB6A 1VQNT 2DPPB 4TVRA 1BKBA 1UGPB 5CAIA 3PNWC 2CZ7B 4IKFA 3V7RA 5GMKh 4RCBA 3LH0A 2K5FA 2WACA 1WQ7A 2XU8A 4M75G 2RI2A 5CKFA 4QVCA 3I55T 4C5EA 2XDDA 2RHZA 5FU6B 2BIVA 2EQUA 3H6ZA 4M75B 3SB2A 2K57A 3I56A 2RH2A 2RHYA 2YRVA 5DLOA 3G4SA 4JDSA 3FLGA 3JCMQ 4J7IA 1B34B 3NTHA 2DEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RJC A;  4HCZ A;  2EQM A;  4A4E A;  4QQG A;  3OYH A;  3MEU A;  3DB3 A;  3MO8 A;  3MP8 A;  4ZTJ A;  1SSF A;  2VYT A;  3UWN A;  3MEA A;  1WJS A;  2RO0 A;  3E9F A;  3H8Z A;  2RI3 A;  4BDY A;  4N4G A;  2XK0 A;  3E9G A;  3OMC A;  3S3M A;  1XNI A;  4C5H A;  2O4X A;  2R5A A;  4X34 A;  2LCC A;  3OY9 A;  3OYN A;  2JZ2 A;  3GOX A;  1G5V A;  2EQJ A;  5D6W A;  2X4X A;  5CIU A;  4OVA A;  3UT1 A;  4Z02 A;  4C5I A;  1MHN A;  3MEV A;  3PMI A;  4BD3 A;  3OYA A;  4BAC A;  4QW2 A;  2P0K A;  3KUF A;  5KE3 A;  1H3Z A;  2HQE A;  2L89 A;  3OYJ A;  5D6X A;  2EKO A;  4EDU A;  3LGF A;  3NTK A;  3PFS A;  5J26 A;  3FEO A;  4B9W A;  5FRM A;  2QQS A;  4BE2 A;  1KHC A;  2EFI A;  2RJD A;  3L2U A;  2LDM A;  2RHX A;  3QKJ A;  5IAY A;  3S3O A;  3LX7 A;  2CKK A;  4PL6 A;  1WGS A;  2E6N A;  3ASK A;  2JTF A;  4IUV A;  2O4X B;  3ME9 A;  2X4Y A;  1WJR A;  3LGL A;  4E7K A;  2MWO A;  3QBY A;  5D6Y A;  2L3R A;  3PMT A;  3P8D A;  3CEY A;  1RI0 A;  5IN1 A;  4C5G A;  3FDR A;  4A4F A;  2RHU A;  1N27 A;  2IG0 A;  2RJF A;  4IUU A;  4IUP A;  2GFA A;  3OYL A;  3L2R A;  3FC3 A;  1OZ2 A;  4A4H A;  5KCH A;  3OS0 A;  3MET A;  3P8H A;  3OYF A;  3ZEH A;  2K3X A;  3OYG A;  3OYK A;  4B9X A;  3OYC A;  3MP1 A;  2M16 A;  2L8D A;  3NTI A;  4LD6 A;  3OYD A;  4CRI A;  4QQD A;  2RI5 A;  5C6S A;  2MWP A;  3BDL A;  2PQW A;  3QII A;  4PLI A;  3S6W A;  2LTO A;  4NS5 A;  4FU6 A;  3F70 A;  3OA6 A;  3S3N A;  2RHI A;  4BE1 A;  1OYX A;  3SD4 A;  2HQX A;  4QVZ A;  2R5M A;  5FRO A;  3OYB A;  2E5Q A;  3MP6 A;  3OS2 A;  4IUR A;  4N4H A;  5C0M A;  4E7H A;  4L59 A;  2DAQ A;  3O8V A;  5M9O A;  3OS1 A;  3L2Q A;  4PLL A;  3OYM A;  3OMG A;  2GFU A;  3L2V A;  5KH6 A;  2EQK A;  2NLU A;  4A4G A;  2R57 A;  2F5K A;  4II1 A;  5KCO A;  3L2W A;  2DIG A;  3LYI A;  2LRQ A;  2R58 A;  5J39 A;  4IUT A;  3OQ5 A;  2GF7 A;  3OYI A;  2QQR A;  3MEW A;  4UC4 A;  4FL6 A;  4GY5 A;  3OB9 A;  3L42 A;  3DLM A;  3LLR A;  3OYE A;  2B8A A;  4BDZ A;  2X4W A;  2M0O A;  4BE0 A;  3C4S A;  4IUQ A;  2K3Y A;  3DB4 A;  2D9T A;  3PNW C;  3M9Q A;  4IKF A;  2XDP A;  2DIQ A;  3Q1J A;  2X35 A;  4E7J A;  1OI1 A;  3LH0 A;  4QQ6 A;  2WAC A;  2BUD A;  4E7I A;  2FHD A;  4Q5W A;  4RG2 A;  2RJE A;  2G3R A;  2RI2 A;  4E7L A;  4C5E A;  5KE2 A;  2RHZ A;  4ZTF A;  2BIV A;  2EQU A;  3H6Z A;  3QJ6 A;  2LVM A;  5FRN A;  1WJQ A;  2RHY A;  2YRV A;  1OZ3 A;  3FLG A;  4N4I A;  2BKD N;  2M1H A;  3NTH A;  3EAE A; 
#chains in the Genus database with same CATH topology
 2P4T A;  5KYX B;  2BZ8 A;  3CMA A;  2CP2 A;  1VIF A;  1A0N B;  4D8K A;  5LL6 S;  1X01 A;  1G3S A;  1SG5 A;  2RMO A;  4AFU C;  1BCO A;  5GAN 8;  4M7D C;  2AZV A;  3EFR A;  1AWX A;  1UTI A;  1M1K R;  2QTX A;  2P0K A;  3DLL A;  1HXD A;  5GAN 3;  1Q86 C;  4M7A C;  3VKI A;  1IGU A;  1QWF A;  2A3L A;  2QQ9 A;  2EFI A;  1BIA A;  2EW3 A;  2RQV A;  4M78 B;  5FW9 A;  1B3Q A;  1GBQ A;  1VQN A;  4CC2 A;  4ZGD B;  4OML A;  1H3H A;  1VQO Q;  1IZ6 A;  2OX7 A;  4J9H A;  2E3I A;  2CH4 W;  1ZX6 A;  4LDV A;  2E12 A;  2FVU A;  2KYM A;  2EVR A;  1I8F A;  1RAH B;  4QQD A;  3HHT B;  1YWO A;  2LNV A;  4FIB A;  5AYF A;  2A28 A;  2LTO A;  2DER A;  3OW2 P;  1VQM T;  2PUO B;  1VQ7 T;  2DVE A;  3JCM J;  1W2B P;  1D3B B;  3MP6 A;  2CH4 A;  3GP8 A;  3OS1 A;  1OV3 A;  1JU5 C;  4A53 A;  2LNH B;  4OB2 B;  3L2W A;  1MGQ A;  2DIG A;  4JRQ A;  2KEA A;  4LNP A;  1YI2 T;  3G71 T;  2KE9 A;  4BY6 C;  2VC8 A;  3C4S A;  2O31 A;  4XK8 E;  1R8O B;  1TH7 A;  1O75 A;  3CC2 T;  2X35 A;  3CC4 Q;  5GMK l;  3CCL A;  1BI0 A;  1P92 A;  2JW4 A;  1VQ6 Q;  4HCZ A;  2QEX Q;  5CO7 A;  3M56 A;  1ARK A;  3PE0 A;  5I2S A;  4J7F A;  3MEA A;  4XQ3 A;  3E9G A;  3OMC A;  5HKC A;  3S3M A;  4DA4 A;  3CCR A;  2O4X A;  2KNB B;  2LCC A;  3VS6 A;  4A63 B;  5AT1 B;  1QCO A;  4FT2 A;  4EMK A;  2LJ1 A;  1U1T A;  3HFN A;  1JXO A;  1UGQ B;  2RA2 A;  4XTZ A;  1KC8 C;  1SRM A;  1N8R U;  1KFZ A;  2RHX A;  1QKW A;  5J3B A;  5LJ3 d;  1VA7 A;  4NL3 A;  3OSV A;  1QVG S;  2QGF B;  1K0S A;  3EGD B;  4M77 F;  1BI3 A;  3THK A;  3ZFJ A;  1NM7 A;  3MET A;  4C92 G;  2CRE A;  3UAT A;  4JRP A;  2OAU A;  4CRI A;  4EMH A;  1NYF A;  4RUG A;  2KSS A;  1OPK A;  2DVJ A;  1KQS S;  4RTT A;  1D0Z A;  4PJN A;  2K5I A;  2M51 A;  2V8I A;  1PNJ A;  5LJ5 e;  3H9N A;  4WTO B;  4KGX B;  2QA4 A;  1YIT A;  2V1Q A;  4PLL A;  3O5Z A;  5DY9 A;  4PNO A;  1WNL A;  2HL3 A;  2FL7 A;  1QVP A;  1FWZ A;  1GBR A;  1UGV A;  5I2M A;  2FZC B;  4LE9 A;  4FL6 A;  3M59 A;  2M02 A;  1VQ4 Q;  3OYE A;  3QYG B;  1Y7X A;  1NJI U;  3CCE T;  4XTY A;  2QTV A;  4QQ6 A;  2YHT A;  5L8R E;  4GLM A;  1MUZ A;  4ZTF A;  3JCM c;  5CVI A;  1GFC A;  5GAN g;  1UGS B;  2RD1 A;  1IHW A;  4HT9 A;  1VUB A;  1N5Z A;  4OB3 B;  2F2X A;  4AG2 C;  1ZSZ A;  2I2L A;  3BE3 A;  1V1C A;  2EYQ A;  1KD1 C;  5GAM e;  1QP3 A;  2EKH A;  2HBP A;  3X25 B;  3T9N A;  1M2O A;  2A36 A;  2VKN A;  2R5A A;  4X34 A;  3OY9 A;  3CCJ Q;  2X4X A;  4J6X A;  1TSF A;  4ZGE B;  2KDS A;  3VS5 A;  4QVD A;  3JCM b;  1RAB B;  1VQ9 Q;  4C8Q E;  5GAN f;  4PKC C;  1BI2 A;  3SWN B;  3PFS A;  2RQW A;  4JLG A;  2QQS A;  5LJ5 d;  4E7S A;  1CSK A;  4RKU E;  1YJ9 Q;  3JCM V;  3CCQ Q;  2YUN A;  2HSP A;  1VQO A;  1RLQ C;  1RAG B;  1WJR A;  3A8G B;  1WXT A;  4M7D G;  4JZ3 A;  3PMT A;  3V7S A;  1I81 A;  1QWE A;  1KQ2 A;  3MJX A;  2ZPG B;  3CPW A;  4DBF A;  3OYL A;  1AVZ C;  1ZSZ C;  2J05 A;  3P8H A;  4HKE A;  1K9M C;  3OYF A;  1V29 B;  3TVT A;  4B9X A;  3HRT A;  3OBW A;  1QVG P;  3CXC A;  3JB9 G;  1JXM A;  1M3A A;  1YFN A;  4PJL A;  3M58 A;  4F17 A;  3BFM A;  5DM7 R;  3F70 A;  2L5Q A;  5GMK j;  2FB7 A;  2JN0 A;  3EFO B;  3OYB A;  1TTH B;  2E5Q A;  3ER0 A;  2DET A;  3JCM P;  5GAO r;  2CSQ A;  2QGG A;  1VQL Q;  2R57 A;  4YTL A;  4C0D C;  2QQR A;  2WSC E;  2LJ0 A;  2XHC A;  2X4W A;  2K3Y A;  1AWJ A;  1AEY A;  2RQR A;  2JTM A;  3CC4 A;  2DKG A;  1RAE B;  1M30 A;  2AK5 A;  1VQP T;  2FHD A;  1PC0 A;  2MCN A;  1VQK Q;  1MV0 B;  3QPH A;  1MMG A;  4F7U F;  3HFO A;  1BCM A;  1VQ6 A;  5FRN A;  4OMO A;  3VRZ A;  1OZ3 A;  4Y91 A;  2QEX A;  4F7U A;  2LZ6 B;  4N4I A;  2HMA A;  3E1S A;  3CC7 Q;  5GJW B;  1LOJ A;  4Y28 E;  3GNF B;  2YUO A;  2DBM A;  2LT1 A;  2XK0 A;  2HEQ A;  3SHW A;  1G5V A;  2EQJ A;  3CCL T;  4PJO G;  3TEE A;  5CIU A;  4C8Q B;  1G2B A;  2QYZ A;  2FO0 A;  1NJI R;  1H3Z A;  4KH1 B;  2VWF A;  4AFS C;  2PZ1 A;  4F04 B;  1I4K 1;  4IIM A;  1Q82 C;  1NZ9 A;  2OTL A;  2DLP A;  3QKJ A;  2CP7 A;  3CCR T;  2CKK A;  2DYI A;  2VGM A;  3M0Q A;  1BIB A;  3M5A A;  2O9S A;  4HCC A;  3X26 B;  2EJ9 A;  2DIL A;  4WF2 A;  3ME9 A;  1QKX A;  2BE9 B;  1Q86 R;  5GJV B;  2A7Y A;  1X6O A;  3QUI A;  4IUU A;  4OP0 A;  2SRC A;  4PK4 A;  4DEY A;  1JRI A;  3M0P A;  5HK0 A;  2JUF A;  2AIR B;  2YRC A;  1YJN Q;  1NYG A;  2HCK A;  3GF5 A;  3OYC A;  2RK2 A;  3MP1 A;  3FRN A;  1WHG A;  3OYD A;  1PSE A;  1KG1 A;  5C6S A;  4V2S A;  1VYT A;  3TQ7 P;  3EH2 A;  4BI8 B;  2NUP B;  3A5Z B;  2R5M A;  5KYW B;  4M75 F;  3M4Y A;  3REA B;  2M0Y A;  4L6V 5;  1YBY A;  2JS2 A;  2GCX A;  2GQV A;  1D1C A;  1VQ4 A;  2Y4X A;  3I35 A;  2DM1 A;  1UGP B;  1JQQ A;  1RAF B;  4RCB A;  4J9G A;  3CCM Q;  2WAC A;  4C5E A;  2EGE A;  2Z0W A;  2EQU A;  1OU9 A;  4A4E A;  4C92 A;  4QQG A;  2JM9 A;  1PM3 A;  2GNC A;  3HSB A;  3UWN A;  2AHJ B;  2NYS A;  1MMA A;  3CCJ A;  4J9I A;  2RM4 A;  1M1K U;  1VOM A;  2CSI A;  3LW5 E;  2PTK A;  3M53 A;  3EG9 B;  3UT1 A;  1VQ9 A;  4OMN A;  3CCS Q;  4J5Y A;  1YHQ Q;  4J9D A;  3JB9 I;  2JVV A;  2EKO A;  9ATC B;  4EPC A;  1YJ9 A;  4GBQ A;  2HKN A;  3CCQ A;  1UG1 A;  2I0N A;  3H41 A;  4M78 G;  4PL6 A;  2LX9 A;  5FU7 C;  5L23 A;  2E6N A;  5GAN j;  4LXC A;  1FMV A;  1KC8 R;  5LJ3 h;  2O9V A;  3REB B;  3GBQ A;  1SRL A;  3BY7 A;  2COZ A;  2RJF A;  5EG2 A;  4M7D D;  1LVK A;  4RCC A;  2GFA A;  2ZPE B;  1TU0 B;  3G7Z A;  4C92 C;  4JRK A;  3ZBD A;  1VQO T;  2AKK A;  2E65 A;  3I9Q A;  3RR6 A;  4PLI A;  3S6W A;  3U23 A;  4OB1 B;  4NS5 A;  4M7A D;  3OA6 A;  4AG1 C;  3JB9 D;  1Y71 A;  3RMQ A;  3E19 A;  2KXC A;  2FPD A;  1VQL A;  2QAS A;  1RI9 A;  2D1X A;  2EQK A;  4A4G A;  2EAY A;  5LJ3 g;  1GXI E;  2PU9 B;  4XTV A;  4E2F B;  3CPW S;  4M77 E;  3DB4 A;  2MMP A;  1IGQ A;  2KRN A;  1WA7 A;  4OMF B;  5I22 A;  1VQK A;  5A0L A;  3CXC S;  2DTH A;  4IIO A;  4M7D A;  3J7A F;  3QJ6 A;  3GNG A;  5IHK A;  1BK2 A;  3CC7 A;  4ATO A;  3CCU Q;  2H8H A;  5KYN A;  4M7A A;  2RK1 A;  5LJ3 f;  2RO0 A;  2VB6 A;  1HK9 A;  3EG0 A;  2YT6 A;  1Q7Y C;  2OAW A;  2RQU A;  3VUZ A;  1VQ6 T;  3RKW A;  2QEX T;  3MEV A;  4LD9 K;  4QW2 A;  3TCJ A;  4ESR A;  2ROT A;  2J7I A;  2PUK B;  4KT0 E;  3M0S A;  1TWB A;  4CC4 B;  2VUB A;  2LDM A;  5GAO p;  1B07 A;  2CS7 A;  2YUP A;  1LNX A;  3V8L A;  5LJ5 h;  4IUV A;  5KYY B;  1MNE A;  1IRE B;  2O4X B;  3E2U A;  2KAF A;  4EMK B;  2NWM A;  3QBY A;  1OUL A;  3A8L B;  2K79 A;  2K6D A;  1TOV A;  1YJN A;  2OTL T;  3EFS A;  3OS0 A;  2A37 A;  1M5Q 1;  1G8X A;  3QZ5 B;  2MAM A;  1WHM A;  1UHC A;  2DTI A;  1OX8 A;  2L8D A;  3NTI A;  1WFW A;  3MKD A;  1YJW Q;  3QJY A;  4RG8 A;  4RMO A;  5I21 A;  4FW2 A;  2HQX A;  3AHU A;  1TUC A;  4PJO A;  1K9M R;  1D1B A;  2OTJ Q;  3EG1 A;  2D8J A;  3M55 A;  2E1H A;  3M0R A;  1M2V B;  3OYM A;  3OMG A;  5CQX A;  1U06 A;  1R77 A;  5LJ5 g;  4M77 B;  3QYH B;  4HA8 A;  2RF0 A;  2KVQ G;  5GAM h;  1AT1 B;  1NE8 A;  1PCX A;  4IUQ A;  3CCM A;  3MPU B;  2V1R A;  1U8R A;  1X6G A;  4KUL A;  3WVD B;  2G3R A;  4E7L A;  2GGR A;  2BZX A;  5LJ3 e;  1YN8 A;  2LVM A;  2DO3 A;  3CPW P;  1HD3 A;  2KR3 A;  3I56 Q;  1ABQ A;  5LJ5 f;  1OOT A;  3JB9 H;  4JJN K;  3MP8 A;  1SSF A;  2VYT A;  3CXC P;  1UJY A;  1M90 C;  1WHH A;  2EYX A;  4N4G A;  3MCA B;  2F5T X;  1NPP A;  3QSU A;  4JUV A;  3GLX A;  4JS4 A;  2LQ8 A;  1EZZ B;  3WXM B;  3CCS A;  2IIM A;  4PJO C;  2QDY B;  5GAM g;  1QW1 A;  1QCF A;  1YHQ A;  1RAI B;  2DL5 A;  2COW A;  4ELZ C;  5CKH A;  5D6X A;  2P0P A;  4LUD A;  2RJD A;  4F7U E;  3J81 E;  3CCJ T;  3LX7 A;  1WXU A;  3M54 A;  5A0D A;  4Y92 A;  1VQ9 T;  2ZPB B;  3R6N A;  3JCM d;  1Q82 R;  1AWW A;  3PGG A;  3CEY A;  5GAM f;  3BDU A;  2BZY A;  1K73 R;  4OF1 A;  1B34 A;  1YJ9 T;  2XDB A;  2KT1 A;  3L2R A;  3CCQ T;  5KCH A;  2X3X D;  3M0U A;  1OX9 A;  1PHT A;  3JB9 J;  3ZEH A;  2DF6 A;  1U5S A;  4J83 A;  1ZUU A;  2CT3 A;  3NGP A;  5GAO m;  4FU6 A;  4D8D A;  3VRY A;  4BE1 A;  3VS1 A;  4E47 A;  3QWY A;  1VYU A;  2E64 A;  3NPF A;  2DAQ A;  1AZG B;  1Q81 C;  5HK3 A;  4K11 A;  2R58 A;  2RNA A;  1S72 Q;  5CKE A;  4J8O A;  5FLX E;  3AT1 B;  2L2P A;  2K5L A;  6AT1 B;  3OB9 A;  1ZA2 B;  4M78 A;  2M0O A;  4KUD K;  2D9T A;  5I11 A;  3UA7 A;  5HY6 A;  4QKU A;  4Q5W A;  4RTV A;  1K8A C;  2ECZ A;  2XKO C;  3CCU A;  2M1H A;  3EAE A;  2XD0 A;  4M75 E;  4HVV A;  1ZLM A;  4N0A A;  2ENM A;  3CCV Q;  2KRO A;  4LUE A;  4FYV B;  1M1G A;  3J80 E;  1W70 A;  4C8Q G;  2K4Y A;  4FM4 B;  2NUT A;  1D3B A;  5D6W A;  2WSF E;  3RKY A;  4AFQ C;  5LJ3 j;  3GIB A;  1VQM Q;  2FRY A;  3CC7 T;  3VV0 A;  4BAC A;  4FYY B;  2FRW A;  2HSE B;  5D7U A;  4F7U B;  2K7A A;  3NTK A;  5J26 A;  3A1P A;  1TS9 A;  1RUW A;  5IAY A;  5FWB A;  4M78 C;  4J6Y A;  2YXY A;  3ASK A;  4LDU A;  1Q86 U;  2IPO B;  1BI1 A;  3G6E Q;  2X4Y A;  1M27 C;  1UEC A;  4EMG A;  2C0T A;  5IN1 A;  1M8M A;  3ZL7 C;  4MDW A;  3OYY A;  3CC2 Q;  3JSC A;  1W4S A;  3EGX B;  4AMC A;  1B7T A;  1YWP A;  1M1F A;  2EYZ A;  1Z9Q A;  3VUB A;  3CMA T;  1CKA A;  3C94 A;  4N0A C;  1YJW A;  3PIP A;  1TXQ A;  2FZG B;  3C0C A;  2C0O A;  3QG1 A;  3EHR A;  1QMC A;  1WYX A;  4NOY A;  1LPL A;  5A2Q E;  7AT1 B;  3EG3 A;  1X2K A;  2DL7 A;  2OTJ A;  4QVZ A;  2ED0 A;  1M4Z A;  2L3S A;  4PFZ A;  2CP0 A;  2HL5 C;  1YJN T;  1O9S A;  3TU4 K;  1H92 A;  1WX6 A;  2E6Z A;  4FYW B;  2E4H A;  5KH6 A;  1EX4 A;  1YP5 A;  2JJ9 A;  2GF7 A;  3OYI A;  5IHI A;  5GAN 7;  4ZNX A;  1HJD A;  2DD4 A;  1VQN T;  2PNI A;  4Z8A A;  2DPP B;  4JJD A;  4TVR A;  1BKB A;  2CZ7 B;  1D0Y A;  3LH0 A;  2XU8 A;  5CKF A;  4J9C A;  2XDD A;  5FU6 B;  2BIV A;  3EGD A;  4M75 B;  3SB2 A;  3I56 A;  2RHY A;  2YRV A;  3JCM Q;  2NUZ A;  3NTH A;  2QDL A;  4BD3 A;  1KQS P;  3HRU A;  2MF2 A;  4ZTJ A;  2DZC A;  3CCM T;  3VS0 A;  2FPF A;  4F16 A;  2VXE A;  3OYN A;  5LJ5 j;  3GOX A;  5CCA A;  2A0F B;  3UA6 A;  1Y96 A;  1MHN A;  1C0M A;  2EWN A;  1N6A A;  2VV5 A;  4HVU A;  1Q7Y R;  4EDU A;  1Y0M A;  2GQI A;  1ZBJ A;  1YCS B;  2DEU A;  1MV3 A;  4HT8 A;  4XU2 A;  1PRM C;  2LX7 A;  1KC8 U;  3RUX A;  4CI0 C;  2MK5 A;  2DYB A;  3CCS T;  1AZE A;  5FWC A;  4J9B A;  4M7A E;  1YHQ T;  3V8K A;  1SPK A;  2YLB A;  2J06 A;  2DJZ A;  4IUP A;  1VQ5 Q;  1PD1 A;  2HNI A;  2PVO B;  4ZGJ B;  2JOY A;  4FSX A;  2PVD B;  1QP2 A;  5GAM j;  4HCB A;  1N9R A;  4RTU A;  1T3L A;  2E3H A;  1IRX A;  2KT8 A;  3SD4 A;  1UE9 A;  2GBQ A;  2JMA A;  1R0B G;  5M9O A;  2EIF A;  3O8V A;  1VYV A;  2GFU A;  3M57 A;  1S72 A;  1LJO A;  1KSW A;  3OQ5 A;  1ABO A;  2J6F A;  1OEB A;  4LDW A;  3A98 A;  4C92 D;  1WZO A;  4MZT A;  1OPL A;  3Q1J A;  4FW1 A;  2DL4 A;  3H0I A;  2XI9 A;  4F14 A;  3CBM A;  1BB9 A;  4KUI A;  3CCV A;  4C0Z A;  2MYS A;  3HKS A;  2D8H A;  3CBO A;  4XU3 A;  4XAX B;  4OB0 B;  1KD1 U;  1ZBX A;  3NFC A;  1VQM A;  3TRE A;  4DBH A;  3URG A;  2QA4 T;  1YIT T;  2JNG A;  2L0A A;  2W0Z A;  1Y07 A;  2C06 A;  2HQE A;  2L89 A;  3SWN C;  1M90 R;  1AWO A;  5GAN d;  1PSF A;  3VU3 C;  2YSQ A;  1IXD A;  4C92 F;  1GCP A;  1ACM B;  2D0Q B;  3FEO A;  1IB8 A;  2ROL A;  4M7A B;  3S3O A;  3G6E A;  2KK4 A;  3RIR A;  1WLP B;  1OU8 A;  3TSZ A;  2F2W A;  1X2Q A;  1J3T A;  1IO6 A;  1D1A A;  3ULR B;  2FPE A;  4E6R A;  3NMZ C;  2SEM A;  1Y57 A;  3CC2 A;  1K0X A;  4L5G A;  4FT4 A;  5KYU A;  3JCM h;  1NBE B;  1VQP Q;  3LH5 A;  1FXX A;  1WI7 A;  3RDV A;  1ZA1 B;  3OYG A;  2ESW A;  2EGA A;  3RMS A;  3BDL A;  3SFM A;  1K9M U;  1FMW A;  1GL5 A;  3A8H B;  4M4Z A;  2MPX C;  3S3N A;  5GAO n;  4DOW A;  2DMO A;  4JZ4 A;  4E7H A;  5C0M A;  2CDT A;  3JCM W;  3HRS A;  1HSQ A;  1YJW T;  4M77 G;  2NLU A;  2JM8 A;  4II1 A;  5J39 A;  3V7C A;  3PIO A;  3UPU A;  3RBB B;  3R6O A;  3WVE B;  2DX1 A;  4BDZ A;  2QXF A;  2AZS A;  4DOV A;  2OTJ T;  4BY6 B;  1WXB A;  2LCL A;  3JCM g;  1H64 1;  1Q81 R;  3VS3 A;  3CCR Q;  2HQH A;  2J6K A;  1WJQ A;  4LN2 A;  3CPF A;  2EBP A;  3LWI A;  2F69 A;  3G4S Q;  1TUG B;  2VVK A;  3CBP A;  1RAC B;  3H8Z A;  1K8A R;  2ZZD A;  4GLK A;  4BDY A;  2KRM A;  4J9E A;  2W10 A;  1XNI A;  2E10 A;  4A4K A;  3JCM f;  4C8Q C;  2K3B A;  5KYW A;  2X9H A;  4M7D F;  4OVA A;  1H8K A;  3I56 T;  1WQW A;  2M9U A;  2YRD A;  1N8R C;  1SKU B;  3KUF A;  1XTD A;  3OYJ A;  1SEM A;  3H0H A;  2O2O A;  4ANJ A;  3EHQ A;  4M7A F;  2EGC A;  3JB9 F;  1D0X A;  3CC4 T;  1Q82 U;  2EPD A;  2K2V A;  2MOX A;  2XID A;  1K73 U;  1QVF A;  1C6V X;  2E5K A;  3FDR A;  1VQ5 A;  4Z89 A;  3RES A;  1KD1 R;  4PJO D;  4KRT A;  1OZ2 A;  1T0J A;  2P4R A;  1UHF A;  2QG9 B;  3OYK A;  3QDF A;  4LD6 A;  5IXF A;  1JJ2 A;  1RLP C;  1BBZ A;  3FJP A;  2CP6 A;  2DK3 A;  3QII A;  2DE0 X;  3X28 B;  1YIJ Q;  1AOJ A;  2HKQ B;  3EG9 A;  1W6X A;  1NG2 A;  2K9G A;  2F5K A;  1NEB A;  3VYH B;  2LRQ A;  1NJI C;  4ZN1 A;  3L42 A;  1TUD A;  1VQ8 Q;  3HL8 A;  2CP5 A;  1PRL C;  3M9Q A;  2XDP A;  4DBR A;  5GMK m;  4PJO F;  1OI1 A;  4XTU A;  2ABL A;  1E6H A;  3CME Q;  1S72 T;  4RTW A;  2ZPH B;  2CZ0 B;  2F1L A;  4JRI A;  3JCM e;  2DZ9 A;  1QCN A;  1UGR B;  3MO8 A;  2VAS A;  1KHI A;  2QK0 A;  2JZ2 A;  4QT7 A;  2E70 A;  4PJJ A;  1K76 A;  2AT1 B;  4F7U G;  1G3W A;  3CCV T;  3PT9 A;  1EFN A;  3I5R A;  1VQ4 T;  2HD0 A;  5HCK A;  5FRM A;  3L2U A;  3JAM E;  2DRK A;  2KBT A;  3A8M B;  1TG0 A;  2JTF A;  5GAN 4;  1WHJ A;  4KBM B;  1FMK A;  5CKB A;  2NUT B;  2L3R A;  1PG5 B;  2DTO A;  3C12 A;  1VQP A;  2CUB A;  2RHU A;  1YNZ A;  1U3O A;  3CD6 Q;  1OQK A;  3G6E T;  4BUG A;  1ZSZ B;  2DXB A;  4X1V A;  2MWP A;  3RKX A;  2FG0 A;  3OBY A;  1T0H A;  1UEB A;  2LQW A;  3N5B B;  2DD5 A;  4M78 D;  2HDA A;  4XTX A;  4N4H A;  2GTJ A;  4L59 A;  2OJ2 A;  1K4U S;  4FSS A;  5KYX A;  1M3C A;  3LYI A;  3I55 Q;  1R0C B;  2P84 A;  4M77 D;  2O88 A;  3MEW A;  4C0D B;  2CZ1 B;  1UUE A;  2CP3 A;  4X9D A;  5KYY A;  1SHF A;  5CAI A;  1FYN A;  3V7R A;  2K2M A;  2K5F A;  2C0I A;  1WQ7 A;  4M75 G;  1E7O A;  2RH2 A;  5DLO A;  3G4S A;  4J7I A;  2RJC A;  2HZY A;  2QI2 A;  3MEU A;  4KGV B;  3P8B B;  1SSH A;  4M78 F;  2OTL Q;  1WJS A;  3PVL A;  3L2Z A;  1RL2 A;  2EJG A;  2ZAE A;  2P0Q A;  4C5H A;  2DNU A;  1VQL T;  4CC3 A;  1XOV A;  4C0G A;  2ZPI B;  4Z02 A;  2GTO A;  4C5I A;  5GMK e;  3PMI A;  1M2V A;  4R56 A;  3X20 B;  2E41 A;  2YWW A;  1Q7Y U;  1GRI A;  2A08 A;  1WDX A;  2X51 A;  4M77 A;  3OSS C;  1UB4 A;  1M8V A;  2FYK A;  5GAN 6;  2LT4 A;  1SHG A;  4MMK A;  5GAN h;  4ME7 A;  5A0G A;  2LP5 A;  5GAN 2;  1WPY A;  1G3Y A;  4AFZ C;  1VQK T;  2ATC B;  4HVW A;  1IHV A;  4EMK C;  2X4J A;  2KY9 A;  3TSW A;  2O01 E;  5D6Y A;  1Y96 B;  2DXU A;  3QHS A;  3GPL A;  3DKM A;  1I1J A;  4ORZ A;  3X24 B;  1K1Z A;  3INZ A;  3RER A;  1T3S A;  1VQ7 Q;  3QWX X;  3FC3 A;  1Q95 G;  1NPR A;  1XJW B;  4FCY A;  3PVQ A;  2JXB A;  2M16 A;  5DLQ E;  4MDX A;  1KQ1 A;  2EYW A;  2VXF A;  4DEX A;  2FZK B;  2L3Q A;  1G83 A;  1YIJ A;  4R55 A;  1BU1 A;  4WCI A;  4C92 E;  1MMD A;  2KGT A;  3HTR A;  1WHK A;  1VQ5 T;  1YI2 Q;  5FRO A;  2KMT A;  5GAO l;  3G71 Q;  2LCS A;  3CQT A;  1DJ7 B;  4M77 C;  1QVF S;  1D09 B;  1UDL A;  4IUT A;  2QAZ A;  2KQW A;  3C95 A;  1VQ8 A;  4GY5 A;  3JV3 A;  1ZUK A;  3DLM A;  3FJ5 A;  3LLR A;  3VS7 A;  2B8A A;  1X27 A;  2DL3 A;  3CME A;  1GFD A;  1JJ2 S;  2BUD A;  5KE2 A;  2ZCF B;  4OGE A;  1G3T A;  2BTT A;  2BKD N;  4PFP A;  2EQM A;  4R0K A;  3OYH A;  2DA9 A;  4OMP A;  3DB3 A;  3VJP A;  2CT4 A;  1M1K C;  2H3E B;  2G6F X;  2KI7 A;  4ELY C;  1VIE A;  2RI3 A;  1YCY A;  1ZHI A;  1RAD B;  2Y90 A;  3QZ9 B;  3OW2 A;  1X75 C;  1W2B A;  3KXT A;  1M90 U;  1M3B A;  1AHJ B;  1I07 A;  2COY A;  3QXE B;  4M7A G;  2HAX A;  2JT4 A;  4BB7 A;  4BE2 A;  1NEG A;  2CUD A;  1PWT A;  1N8R R;  1C1A A;  5FU7 B;  3IQL A;  2LC4 A;  1CKB A;  3M4G A;  4PFO A;  3LGL A;  1SF9 A;  2YLC A;  2DJQ A;  3D7S B;  3P8D A;  1RI0 A;  3CD6 A;  5GAM d;  2IG0 A;  4BI4 A;  4XTW A;  4D6W A;  1ZSG A;  2XIC A;  2FEI A;  4M7D E;  3BW1 A;  3RNJ A;  4C92 B;  3QO3 A;  2RI5 A;  3JCM X;  1OYX A;  2JTE A;  3JRZ A;  2F2V A;  4IUR A;  4MZM A;  3L2Q A;  5KYU B;  5IHN A;  4CC7 A;  3CCE Q;  3I55 A;  5KCO A;  1GCQ A;  3H0F A;  4O5V A;  1Q81 U;  1I5O B;  4AT1 B;  2ZGW A;  2QQB A;  4X9C A;  2DL8 A;  4BE0 A;  5CQY A;  2LMJ A;  5GAN e;  5GAO q;  2DXT A;  1BYM A;  3G1J A;  2ZPF B;  1QVF P;  3QDR B;  3EGX A;  4M75 D;  2RPN A;  4KGZ B;  3SWN A;  1X6B A;  2JMC A;  2EJF A;  1K8A U;  1AD5 A;  2CZ6 B;  5CKD A;  1K73 C;  2CYZ B;  4JS5 A;  1JJ2 P;  3CMA Q;  2ED1 A;  1JO8 A;  5IH2 A;  2X3W D;  2V8K A;  4JPB W;  1JB0 E;  1LCK A;  3UF4 A;  1ZUY A;  3G4S T;  4MML A;  2DFU A;  3HPW A;  3VS2 A;  2CGH A;  1MND A;  1GCQ C;  2V8J A;  2LQK A;  4PJO E;  3LGF A;  4O6J A;  4NL2 A;  5EC7 A;  2XMF A;  2DBK A;  2MI6 A;  1WGS A;  1PKS A;  1KJW A;  1HYO A;  4BI3 A;  3M0T A;  3FB9 A;  4E7K A;  4XU0 A;  2MWO A;  3EFO A;  1VQN Q;  4KH0 B;  4M75 A;  3CCU T;  4C5G A;  1XQH A;  1VQ7 A;  2PVG B;  3OS5 A;  4M7D B;  4C8Q D;  4DQ2 A;  4J9F A;  2EYY A;  2YDL A;  3EG2 A;  1MMN A;  3LWH A;  2K3X A;  4E7Z A;  4DBQ A;  2BE7 D;  1KK7 A;  1WHL A;  1YI2 A;  4OMQ A;  8ATC B;  3G71 A;  2RHI A;  4B6M A;  1W1F A;  5IXB A;  3NHN A;  4RTY A;  3OS2 A;  2H3J A;  2LQN A;  4MZP A;  2DXC A;  2LJ3 A;  5CK9 A;  1QQJ A;  3UDC A;  4RTX A;  1X69 A;  1YIJ T;  2V26 A;  1I0C A;  3KBG A;  2RN8 A;  4HCK A;  3MHX A;  4JLI A;  4OMM A;  4LDY A;  4A54 A;  1E6G A;  4C8Q F;  4C0F A;  3PTA A;  1KIK A;  5IT9 E;  2DIQ A;  4E7J A;  4C8Q A;  4E7I A;  4OGC A;  5FU6 C;  4RG2 A;  4M75 C;  2RJE A;  4ZN3 A;  4JJC A;  1UFF A;  5ECA A;  3V8J A;  3CCL Q;  1EIF A;  1VQ8 T;  2YUQ A;  1PKT A;  2RQT A;  2Y4Y A;  1ZQ1 A;  1FX7 A;  3E9F A;  1QVG A;  4FYX B;  3HP9 A;  3CME T;  2OI3 A;  5GAN 5;  1JBM A;  2KYB A;  1F1B B;  2B86 A;  2VGN A;  1RAA B;  4PJO B;  2HBW A;  3OYA A;  1NLP C;  5KE3 A;  4EIK A;  1N9S A;  1V76 A;  1M9S A;  1S1N A;  1KQS A;  4B9W A;  1KHC A;  2WSE E;  1PD0 A;  3SDZ A;  5GMK i;  2AKL A;  1I5L A;  2NUP A;  2JS0 A;  3EGU A;  4M78 E;  2KRS A;  8AT1 B;  3KFV A;  3FIF A;  3I5S A;  4A4F A;  1N27 A;  3OW2 S;  4HXJ A;  2D6F A;  1X43 A;  3L1A A;  4A4H A;  1W2B S;  2XG8 D;  2QQA A;  1JEG A;  4XU1 A;  1NLO C;  4VUB A;  4PJM A;  4LDX A;  3SEM A;  5CR2 A;  2PQW A;  3EH1 A;  2IVW A;  1U1S A;  3CD6 T;  4JJB A;  3CCE A;  1WIE A;  4P5N A;  4RTZ A;  3VYG A;  3L2V A;  2QA4 Q;  1YIT Q;  2DRM A;  4J6W A;  1K9A A;  4UC4 A;  2L3P A;  3A8O B;  2RB6 A;  1UJ0 A;  1Z9Z A;  2EQI A;  3PNW C;  2D0N A;  1QLY A;  4IKF A;  2J6O A;  5GMK h;  2KXD A;  4Z88 A;  2MIO A;  2RI2 A;  4QVC A;  3I55 T;  2RHZ A;  3VS4 A;  3H6Z A;  2K57 A;  4JDS A;  3FLG A;  1B34 B;  2DEQ A; 
#chains in the Genus database with same CATH homology
 2RJC A;  2P4T A;  4A4E A;  2QI2 A;  4QQG A;  3HRU A;  4C92 A;  3MEU A;  3CMA A;  2MF2 A;  3P8B B;  4ZTJ A;  3HSB A;  1VIF A;  2AHJ B;  2DZC A;  1WJS A;  4M78 F;  3UWN A;  3CCM T;  3L2Z A;  1RL2 A;  5LL6 S;  2EJG A;  1X01 A;  2P0Q A;  1G3S A;  3CCJ A;  2VXE A;  4C5H A;  3OYN A;  2RM4 A;  5LJ5 j;  1M1K U;  4M7D B;  3GOX A;  1VQL T;  3LW5 E;  1XOV A;  3M53 A;  5CCA A;  5GAN 8;  4M7D C;  1Y96 A;  2ZPI B;  3EFR A;  4Z02 A;  3UT1 A;  1MHN A;  4C0G A;  4C5I A;  3PMI A;  5GMK e;  4R56 A;  1VQ9 A;  3X20 B;  2E41 A;  1Q7Y U;  4J5Y A;  2EWN A;  1N6A A;  2QTX A;  2VV5 A;  2P0K A;  3DLL A;  3JB9 I;  4M77 A;  3OSS C;  2JVV A;  1HXD A;  1UB4 A;  1M8V A;  2EKO A;  2FYK A;  4EDU A;  4EPC A;  5GAN 3;  1Q86 C;  5GAN 6;  1YJ9 A;  2LT4 A;  3VKI A;  4M7A C;  2A3L A;  4MMK A;  2QQ9 A;  2EFI A;  3CCQ A;  4XU2 A;  5GAN h;  1BIA A;  1KC8 U;  4HT8 A;  4ME7 A;  4M78 G;  5A0G A;  3RUX A;  4PL6 A;  4CI0 C;  2LX9 A;  5FU7 C;  5GAN j;  2E6N A;  5GAN 2;  4M78 B;  3CCS T;  1WPY A;  1G3Y A;  1VQK T;  1VQN A;  4ZGD B;  4EMK C;  2X4J A;  2KY9 A;  4M7A E;  1YHQ T;  3V8K A;  2O01 E;  5LJ3 h;  1IZ6 A;  5D6Y A;  1VQ6 T;  1Y96 B;  2DXU A;  3QHS A;  3GPL A;  3DKM A;  3X24 B;  3BY7 A;  4LDV A;  2YLB A;  3INZ A;  2RJF A;  2DJZ A;  3RER A;  2E12 A;  4IUP A;  5EG2 A;  2FVU A;  4M7D D;  2HNI A;  4RCC A;  2GFA A;  2PVO B;  1VQM A;  2ZPE B;  3FC3 A;  4ZGJ B;  2JOY A;  3G7Z A;  1NPR A;  4FSX A;  2PVD B;  1I8F A;  4C92 C;  4JRK A;  1QP2 A;  3ZBD A;  5GAM j;  2M16 A;  5DLQ E;  4MDX A;  1VQO T;  1N9R A;  4HCB A;  2E65 A;  4QQD A;  1KQ1 A;  3HHT B;  2VXF A;  1YIJ A;  2LNV A;  4FIB A;  4PLI A;  5AYF A;  3S6W A;  4OB1 B;  2LTO A;  4NS5 A;  4R55 A;  4M7A D;  1VQM T;  4C92 E;  2PUO B;  3OA6 A;  3JB9 D;  1Y71 A;  3RMQ A;  3E19 A;  2DVE A;  3SD4 A;  5FRO A;  3JCM J;  1VQ5 T;  1VQ7 T;  2KMT A;  5GAO l;  1D3B B;  3MP6 A;  1VQL A;  3GP8 A;  5M9O A;  2EIF A;  3O8V A;  3OS1 A;  2GFU A;  3M57 A;  4A53 A;  1DJ7 B;  4OB2 B;  1S72 A;  1LJO A;  2EQK A;  4M77 C;  4A4G A;  1QVF S;  3L2W A;  1MGQ A;  2DIG A;  4JRQ A;  2EAY A;  4IUT A;  3OQ5 A;  5LJ3 g;  2KQW A;  3C95 A;  2PU9 B;  1YI2 T;  4GY5 A;  1VQ8 A;  1GXI E;  3G71 T;  3DLM A;  3LLR A;  4XTV A;  4LDW A;  4M77 E;  2B8A A;  4BY6 C;  3CPW S;  2VC8 A;  4C92 D;  4HCC A;  3C4S A;  4XK8 E;  1R8O B;  3DB4 A;  2MMP A;  4MZT A;  1TH7 A;  1O75 A;  4OMF B;  3CME A;  3Q1J A;  2X35 A;  1VQK A;  5A0L A;  3CC2 T;  3CXC S;  2BUD A;  1JJ2 S;  2DTH A;  4M7D A;  3J7A F;  2XI9 A;  5KE2 A;  5GMK l;  2ZCF B;  3QJ6 A;  3CCL A;  1BI0 A;  3GNG A;  4OGE A;  1G3T A;  3CBM A;  2BKD N;  1P92 A;  4KUI A;  3CC7 A;  4ATO A;  4HCZ A;  5CO7 A;  2EQM A;  3CCV A;  3M56 A;  3OYH A;  4C0Z A;  3DB3 A;  3VJP A;  5I2S A;  1M1K C;  2RK1 A;  3HKS A;  4J7F A;  3MEA A;  2RO0 A;  5LJ3 f;  4M7A A;  4XQ3 A;  4ELY C;  1VIE A;  2RI3 A;  3CBO A;  4XU3 A;  1YCY A;  1HK9 A;  1ZHI A;  2Y90 A;  3E9G A;  3OMC A;  5HKC A;  3S3M A;  4DA4 A;  3QZ9 B;  4XAX B;  1Q7Y C;  4OB0 B;  3CCR A;  3OW2 A;  2O4X A;  2LCC A;  3VUZ A;  1KD1 U;  1ZBX A;  3NFC A;  1X75 C;  4FT2 A;  3TRE A;  4EMK A;  3URG A;  2QA4 T;  1YIT T;  3KXT A;  2JNG A;  3RKW A;  1W2B A;  1U1T A;  1M90 U;  2QEX T;  3HFN A;  3MEV A;  4BD3 A;  1Y07 A;  1UGQ B;  4QW2 A;  1AHJ B;  2RA2 A;  4XTZ A;  3TCJ A;  2C06 A;  4LD9 K;  2PUK B;  2HQE A;  2L89 A;  3SWN C;  1KC8 C;  4KT0 E;  5GAN d;  1PSF A;  3VU3 C;  4C92 F;  3QXE B;  2VUB A;  1N8R U;  4M7A G;  2D0Q B;  3FEO A;  2HAX A;  4BB7 A;  4BE2 A;  2LDM A;  2RHX A;  4M7A B;  5J3B A;  5GAO p;  3S3O A;  2CS7 A;  1LNX A;  3G6E A;  2KK4 A;  3RIR A;  5LJ3 d;  3V8L A;  5LJ5 h;  4IUV A;  5FU7 B;  2LC4 A;  1IRE B;  2O4X B;  4NL3 A;  3M4G A;  3LGL A;  2YLC A;  2KAF A;  3OSV A;  4EMK B;  1QVG S;  3QBY A;  3CC2 A;  3P8D A;  1RI0 A;  3A8L B;  3CD6 A;  4L5G A;  4FT4 A;  5GAM d;  2IG0 A;  3JCM h;  4BI4 A;  4M77 F;  1YJN A;  2OTL T;  4XTW A;  4D6W A;  2XIC A;  1BI3 A;  3EFS A;  3ZFJ A;  3OS0 A;  4M7D E;  1FXX A;  3BW1 A;  3MET A;  1M5Q 1;  4C92 G;  3QZ5 B;  3OYG A;  2MAM A;  4JRP A;  2DTI A;  4C92 B;  2OAU A;  3CCU T;  2L8D A;  3NTI A;  3QO3 A;  4CRI A;  4EMH A;  2RI5 A;  2KSS A;  3QJY A;  3RMS A;  3BDL A;  3SFM A;  4RG8 A;  1K9M U;  1KQS S;  3JCM X;  4RMO A;  3A8H B;  3S3N A;  1OYX A;  2K5I A;  2V8I A;  5I21 A;  5GAO n;  2HQX A;  5LJ5 e;  3JRZ A;  3AHU A;  4PJO A;  4DOW A;  4IUR A;  4E7H A;  5C0M A;  4MZM A;  3M55 A;  3L2Q A;  2E1H A;  2QA4 A;  1YIT A;  4PLL A;  3OYM A;  3OMG A;  3JCM W;  5DY9 A;  5CQX A;  4PNO A;  3HRS A;  1WNL A;  1YJW T;  4M77 G;  3I55 A;  2NLU A;  2FL7 A;  1QVP A;  1FWZ A;  4II1 A;  5KCO A;  5LJ5 g;  4M77 B;  5I2M A;  3QYH B;  4HA8 A;  3V7C A;  5J39 A;  2KVQ G;  5GAM h;  3PIO A;  3UPU A;  3R6O A;  4O5V A;  4FL6 A;  3WVE B;  3M59 A;  1Q81 U;  1NE8 A;  2ZGW A;  3OYE A;  2QQB A;  4X9C A;  4BDZ A;  4BE0 A;  5CQY A;  2QXF A;  4IUQ A;  3QYG B;  4DOV A;  2OTJ T;  4BY6 B;  2LCL A;  3JCM g;  5GAN e;  3CCM A;  1Y7X A;  2DXT A;  5GAO q;  1H64 1;  1NJI U;  1BYM A;  3CCE T;  2ZPF B;  4XTY A;  1U8R A;  4KUL A;  4QQ6 A;  2YHT A;  3WVD B;  5L8R E;  2G3R A;  3QDR B;  4E7L A;  4ZTF A;  3JCM c;  5CVI A;  5LJ3 e;  2LVM A;  5GAN g;  1UGS B;  2DO3 A;  1WJQ A;  2RD1 A;  4M75 D;  3CPF A;  4HT9 A;  1VUB A;  3SWN A;  3LWI A;  4OB3 B;  2EJF A;  1K8A U;  2CZ6 B;  2F69 A;  2I2L A;  5CKD A;  5LJ5 f;  3CBP A;  1K73 C;  2CYZ B;  3JB9 H;  4JJN K;  3MP8 A;  1SSF A;  2EYQ A;  2VYT A;  1KD1 C;  4JS5 A;  5GAM e;  1QP3 A;  3H8Z A;  2HBP A;  3X25 B;  1M90 C;  2ZZD A;  4GLK A;  3T9N A;  4BDY A;  4N4G A;  3MCA B;  2F5T X;  1NPP A;  3QSU A;  4JUV A;  3GLX A;  1XNI A;  2E10 A;  4A4K A;  2R5A A;  4X34 A;  2LQ8 A;  4JS4 A;  3JCM f;  4C8Q C;  3OY9 A;  2V8K A;  3WXM B;  3CCS A;  2X4X A;  1JB0 E;  4J6X A;  4OVA A;  4M7D F;  4ZGE B;  2QDY B;  5GAM g;  1QW1 A;  3I56 T;  2KDS A;  3G4S T;  1WQW A;  2M9U A;  1YHQ A;  4MML A;  1N8R C;  4QVD A;  3JCM b;  3HPW A;  4ELZ C;  5CKH A;  3KUF A;  4C8Q E;  1XTD A;  5GAN f;  2CGH A;  3OYJ A;  5D6X A;  4PKC C;  1BI2 A;  2V8J A;  2LQK A;  3SWN B;  4PJO E;  3LGF A;  3PFS A;  4O6J A;  4NL2 A;  4JLG A;  4M7A F;  2P0P A;  2QQS A;  5LJ5 d;  2RJD A;  4F7U E;  3J81 E;  2MI6 A;  3CCJ T;  4RKU E;  3LX7 A;  3JB9 F;  3M54 A;  1WGS A;  3JCM V;  3CC4 T;  1Q82 U;  1VQO A;  5A0D A;  1VQ9 T;  4BI3 A;  2K2V A;  1WJR A;  2XID A;  2ZPB B;  3FB9 A;  1K73 U;  3A8G B;  4E7K A;  4XU0 A;  2MWO A;  3JCM d;  1QVF A;  4M7D G;  3PMT A;  3PGG A;  4M75 A;  1I81 A;  3CEY A;  3V7S A;  4C5G A;  1XQH A;  3FDR A;  2PVG B;  3OS5 A;  3BDU A;  4C8Q D;  5GAM f;  1VQ5 A;  1VQ7 A;  1KQ2 A;  4OF1 A;  3RES A;  4DQ2 A;  2ZPG B;  1B34 A;  4PJO D;  3CPW A;  1YJ9 T;  2XDB A;  3OYL A;  3L2R A;  3CCQ T;  1OZ2 A;  5KCH A;  3P8H A;  4HKE A;  3LWH A;  1K9M C;  3JB9 J;  3OYF A;  1V29 B;  2K3X A;  3ZEH A;  3OYK A;  4B9X A;  3HRT A;  4J83 A;  3OBW A;  4LD6 A;  3CXC A;  1JJ2 A;  3JB9 G;  3FJP A;  3M58 A;  3BFM A;  5GAO m;  2DK3 A;  3QII A;  1YI2 A;  4FU6 A;  5DM7 R;  3F70 A;  2L5Q A;  3G71 A;  3X28 B;  2RHI A;  4BE1 A;  4E47 A;  5GMK j;  2FB7 A;  2JN0 A;  2E64 A;  3OYB A;  2E5Q A;  3ER0 A;  3OS2 A;  2H3J A;  2DAQ A;  4MZP A;  3JCM P;  2DXC A;  5GAO r;  1Q81 C;  5CK9 A;  5HK3 A;  3UDC A;  2F5K A;  2R57 A;  3VYH B;  2LRQ A;  2R58 A;  4YTL A;  4C0D C;  5CKE A;  4J8O A;  5FLX E;  2QQR A;  2WSC E;  3KBG A;  4ZN1 A;  2XHC A;  1YIJ T;  1NJI C;  2K5L A;  3OB9 A;  3L42 A;  4M78 A;  2X4W A;  2M0O A;  3MHX A;  4JLI A;  2K3Y A;  4LDY A;  4A54 A;  2D9T A;  4KUD K;  3HL8 A;  5HY6 A;  4C8Q F;  2JTM A;  3M9Q A;  2XDP A;  2DKG A;  4C0F A;  5GMK m;  3PTA A;  3CC4 A;  5IT9 E;  2DIQ A;  4E7J A;  4PJO F;  1OI1 A;  4C8Q A;  4OGC A;  5FU6 C;  4E7I A;  1VQP T;  2FHD A;  4Q5W A;  4M75 C;  2RJE A;  4RG2 A;  4XTU A;  1K8A C;  4ZN3 A;  1S72 T;  3QPH A;  4F7U F;  3HFO A;  1VQ6 A;  2XKO C;  3CCU A;  5FRN A;  3V8J A;  1OZ3 A;  4Y91 A;  2ZPH B;  4F7U A;  2CZ0 B;  4N4I A;  2QEX A;  2M1H A;  1EIF A;  3E1S A;  3EAE A;  4JRI A;  1VQ8 T;  2XD0 A;  4M75 E;  2DZ9 A;  3JCM e;  1UGR B;  4N0A A;  2Y4Y A;  1LOJ A;  1ZQ1 A;  3MO8 A;  4Y28 E;  3GNF B;  1FX7 A;  3E9F A;  1QVG A;  1KHI A;  3HP9 A;  3CME T;  2LT1 A;  2XK0 A;  5GAN 5;  1M1G A;  3J80 E;  4C8Q G;  1JBM A;  2JZ2 A;  2K4Y A;  1G5V A;  4FM4 B;  2EQJ A;  1D3B A;  5D6W A;  4PJO G;  5CIU A;  3TEE A;  4C8Q B;  2WSF E;  3RKY A;  3CCL T;  5LJ3 j;  2E70 A;  2VGN A;  3GIB A;  4PJO B;  3OYA A;  3CC7 T;  3VV0 A;  4BAC A;  4F7U G;  1G3W A;  5KE3 A;  1H3Z A;  3CCV T;  1N9S A;  3PT9 A;  4F7U B;  1VQ4 T;  2HD0 A;  1I4K 1;  3NTK A;  1Q82 C;  1M9S A;  5J26 A;  1KQS A;  1NZ9 A;  2OTL A;  4B9W A;  5FRM A;  1KHC A;  3L2U A;  5IAY A;  3QKJ A;  3JAM E;  3CCR T;  2CKK A;  2VGM A;  2WSE E;  4M78 C;  3SDZ A;  5GMK i;  1BIB A;  4J6Y A;  3M5A A;  3ASK A;  1I5L A;  3A8M B;  4LDU A;  2EJ9 A;  4WF2 A;  2JTF A;  1BI1 A;  3X26 B;  1Q86 U;  5GAN 4;  3ME9 A;  2X4Y A;  4KBM B;  5CKB A;  4EMG A;  2L3R A;  4M78 E;  2DTO A;  5IN1 A;  3C12 A;  4A4F A;  3FIF A;  2RHU A;  1VQP A;  1N27 A;  4PJO C;  4MDW A;  3OYY A;  3OW2 S;  2A7Y A;  1X6O A;  3QUI A;  3JSC A;  1W4S A;  4IUU A;  2D6F A;  4OP0 A;  3L1A A;  1M1F A;  1JRI A;  3VUB A;  4A4H A;  5HK0 A;  2JUF A;  2XG8 D;  1W2B S;  3CMA T;  2QQA A;  4XU1 A;  3C94 A;  4N0A C;  3G6E T;  4BUG A;  3GF5 A;  4VUB A;  3PIP A;  1YJW A;  3OYC A;  2RK2 A;  3MP1 A;  4LDX A;  3FRN A;  2DXB A;  3OYD A;  5CR2 A;  1PSE A;  1KG1 A;  5C6S A;  3QG1 A;  2MWP A;  4V2S A;  2PQW A;  3RKX A;  4NOY A;  2IVW A;  3OBY A;  5A2Q E;  4BI8 B;  1UEB A;  3N5B B;  1U1S A;  2DD5 A;  3A5Z B;  4M78 D;  3CD6 T;  2OTJ A;  4QVZ A;  2R5M A;  4M75 F;  4XTX A;  1M4Z A;  3CCE A;  4N4H A;  1YJN T;  3M4Y A;  4L59 A;  1O9S A;  3TU4 K;  4P5N A;  2E6Z A;  3VYG A;  4L6V 5;  3L2V A;  1YBY A;  5KH6 A;  2GCX A;  2GQV A;  3LYI A;  1VQ4 A;  2GF7 A;  2Y4X A;  4J6W A;  4M77 D;  3OYI A;  3MEW A;  4UC4 A;  4C0D B;  2CZ1 B;  5GAN 7;  3A8O B;  2DD4 A;  4X9D A;  2RB6 A;  1VQN T;  2DPP B;  4TVR A;  1BKB A;  1UGP B;  5CAI A;  3PNW C;  2CZ7 B;  4IKF A;  3V7R A;  5GMK h;  4RCB A;  3LH0 A;  2K5F A;  2WAC A;  1WQ7 A;  2XU8 A;  4M75 G;  2RI2 A;  5CKF A;  4QVC A;  3I55 T;  4C5E A;  2XDD A;  2RHZ A;  5FU6 B;  2BIV A;  2EQU A;  3H6Z A;  4M75 B;  3SB2 A;  2K57 A;  3I56 A;  2RH2 A;  2RHY A;  2YRV A;  5DLO A;  3G4S A;  4JDS A;  3FLG A;  3JCM Q;  4J7I A;  1B34 B;  3NTH A;  2DEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...