4L59A

Crystal structure of the 3-mbt repeat domain of l3mbtl3 and unc2533 complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
313
structure length
307
Chain Sequence
WCWASYLEEEKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFEVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYNVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein 3
publication title The structure-activity relationships of L3MBTL3 inhibitors: flexibility of the dimer interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 80
structure length 307
sequence length 313
ec nomenclature
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l59A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l59A03
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l59A01
2RHXA 3CEYA 3F70A 5D6WA 4E7JA 4A4HA 2L8DA 2G3RA 3PFSA 3PNWC 2EQKA 4BE1A 3NTKA 4PLLA 4Z02A 4EDUA 3SD4A 2RI5A 4IUUA 4B9WA 3LGFA 1OI1A 4C5HA 3OYBA 3OYIA 4FL6A 4PL6A 3NTIA 3OYAA 5KE3A 3LH0A 3L2QA 3M9QA 3FLGA 4BD3A 2EQUA 3FDRA 3Q1JA 4FU6A 2X35A 3ASKA 2R5AA 4QW2A 5IAYA 3FC3A 4BDZA 3S6WA 4C5GA 5C6SA 5KH6A 4X34A 3OMGA 3OYMA 3QBYA 4GY5A 2FHDA 3MP1A 4IUTA 2R58A 5KCOA 5J39A 3OYLA 5D6XA 3BDLA 3OS0A 3OA6A 3OYJA 4E7LA 3FEOA 3ME9A 4A4EA 4E7KA 4E7IA 3L2UA 2QQRA 3LLRA 3P8DA 4E7HA 3NTHA 5KE2A 1WGSA 2B8AA 4N4GA 2BKDN 3OMCA 3OYHA 3E9FA 4N4IA 2O4XB 2RJDA 2RJCA 4CRIA 3DLMA 3OYKA 2R5MA 4PLIA 3UWNA 3DB3A 2RHUA 4NS5A 1WJSA 5J26A 3PMTA 3OYGA 2LDMA 2K3YA 2RO0A 4BE0A 2RJFA 2DIGA 3OS1A 2RHIA 2E5QA 1OZ3A 2HQXA 3H6ZA 2LTOA 2MWOA 2XK0A 2X4WA 2M1HA 3MP6A 1RI0A 2XDPA 3OQ5A 2BUDA 2IG0A 2K3XA 1XNIA 1WJQA 2QQSA 3E9GA 3OY9A 2LCCA 3META 4QQDA 3OYNA 3OS2A 4ZTJA 3LGLA 1OYXA 2X4XA 3LYIA 2WACA 3MEVA 5D6YA 3EAEA 4N4HA 2R57A 2JZ2A 1N27A 4C5IA 3H8ZA 3MP8A 2BIVA 3L42A 2D9TA 2LVMA 4OVAA 4QQ6A 2RJEA 2EQMA 4HCZA 4IURA 4QVZA 2DAQA 2L3RA 4LD6A 4BE2A 3MO8A 1WJRA 2O4XA 4ZTFA 5CIUA 3S3MA 3PMIA 3KUFA 3GOXA 2CKKA 2F5KA 2DIQA 2GFAA 3MEUA 2M0OA 5KCHA 2VYTA 1MHNA 3L2RA 5C0MA 2RHZA 4QQGA 3OYFA 3S3NA 3OB9A 4B9XA 5FRNA 3DB4A 4Q5WA 3OYEA 2NLUA 4BACA 2EQJA 4IUPA 2L89A 5FROA 3ZEHA 2M16A 2RHYA 3QJ6A 3L2WA 4UC4A 4C5EA 2E6NA 1KHCA 2PQWA 4IKFA 3L2VA 4II1A 3C4SA 2EKOA 5M9OA 2RI3A 3UT1A 4IUQA 2YRVA 2P0KA 1SSFA 1OZ2A 2LRQA 4BDYA 2MWPA 2GF7A 3LX7A 2JTFA 1G5VA 3MEAA 4A4FA 3QKJA 3S3OA 3O8VA 4A4GA 3OYDA 1H3ZA 2GFUA 5FRMA 5IN1A 3OYCA 2EFIA 2X4YA 3QIIA 4IUVA 2RI2A 4RG2A 2HQEA 4L59A 3P8HA 3MEWA
chains in the Genus database with same CATH superfamily
1EFNA 3CCRA 3F70A 5D6WA 3PFSA 5GMKe 1VOMA 2FVUA 1GCQA 2PU9B 1VQOQ 2O9SA 2ATCB 5KCOA 4JRQA 1K8AU 3M54A 5LJ3g 4JS5A 1K73C 4E7HA 3CC4A 1MGQA 1QQJA 3OYHA 1YCYA 3QUIA 3QZ5B 3BW1A 2RHUA 1IREB 4PJOF 2HDAA 2P4TA 5CKHA 2KNBB 4AFQC 5CCAA 2BZYA 3I55Q 2E5KA 2O2OA 3H0FA 2Y4XA 1YITQ 2EJFA 5FWCA 3OY9A 2LCCA 3G71A 4JLIA 3CCSA 2EYYA 1E6GA 1NBEB 1M3AA 1OYXA 3LYIA 4KT0E 3QWXX 3N5BB 4N4HA 1VQKT 3G7ZA 1N27A 1ZBXA 3HTRA 4E6RA 2VKNA 2YUPA 3X24B 4C8QF 4D8KA 1YJWQ 4HT8A 2V8JA 2RF0A 2L3QA 2EKHA 2A3LA 1YP5A 5CQYA 4QQGA 1UB4A 1QVFA 5CK9A 3VUBA 1QP3A 2RHYA 2DTIA 2RH2A 1YJ9T 1PM3A 4X9DA 1KHCA 1VA7A 5GJVB 4DBQA 1N8RR 4M78E 2O88A 1D1BA 2EKOA 4C92C 3HPWA 1T0HA 5GAN6 4M7AB 3M5AA 3CMEQ 3RBBB 2ESWA 1VQ5Q 2C0TA 2XG8D 5GAMh 2RD1A 1T0JA 3OYMA 2QTXA 4ZNXA 4EDUA 3JCMQ 3RMSA 9ATCB 1M1FA 1N5ZA 5GANg 2KRSA 3QDFA 3FC3A 5IAYA 3GNFB 3JAME 1ZHIA 1WLPB 2K57A 3OYLA 4E7KA 1QCFA 4BUGA 2ZZDA 3M0RA 1X6BA 1W6XA 2JJ9A 2E12A 1K0XA 4KULA 1KQSP 3EFSA 2KT8A 1TUGB 2H3EB 4F17A 1QWFA 3OS1A 2E5QA 2RHIA 2XDBA 3H41A 4F16A 2L0AA 3JB9I 1FWZA 5EG2A 3JCMc 3OQ5A 2BUDA 2QGGA 1U06A 4M77G 2LNVA 1QCNA 4PFOA 2D1XA 3EG3A 1S1NA 3V7CA 4FYXB 5C0MA 4OVAA 3L42A 3QYGB 4RMOA 2FZGB 1W2BP 3HRSA 1I07A 3TVTA 1WJRA 4J6WA 1VQKQ 2E41A 2M0OA 4FYVB 3V8JA 3JCMg 1G2BA 3CCVT 2NLUA 1EX4A 5GAOp 3VU3C 3H0IA 3RESA 2JTEA 4RTTA 2J05A 4PJOB 1QVGP 2CZ7B 2PQWA 4BI8B 2QA4A 1W4SA 2C0OA 2KE9A 4M75D 1U1SA 2DERA 3GBQA 2LQNA 3CC7Q 4PFZA 1NG2A 1PKSA 1KQSS 1J3TA 2IPOB 4ZGDB 1O75A 1MUZA 3JB9H 2H3JA 1OOTA 1Z9ZA 2Y4YA 3A8LB 3UPUA 2VGNA 2GCXA 4QVCA 5LJ5h 3M0UA 3MEWA 4DQ2A 2AIRB 3URGA 3EFRA 4C8QB 1IXDA 1JRIA 2RQRA 5GAOn 3OYAA 1QVPA 8ATCB 1Q7YR 4EMGA 3FDRA 1N8RU 1V29B 4QW2A 1W2BS 4IUTA 5IHKA 2RNAA 1OPLA 3NGPA 3X20B 3QG1A 5FWBA 4LE9A 4AG2C 1KQ2A 3OS5A 2HBPA 1XTDA 2YHTA 3UWNA 2F1LA 1KC8C 1AD5A 3CPWS 1QVGS 4AMCA 4RTWA 1K9MR 1D1CA 5CKEA 2LTOA 4RG8A 1H3HA 2VGMA 1ACMB 1U5SA 1GBQA 4M78G 2JM8A 3OYNA 2LCLA 1QKXA 2JOYA 1KIKA 3CCRT 2D9TA 1M3CA 3A8OB 1UECA 4KRTA 2KRNA 1Y7XA 2L3RA 2IIMA 4FW1A 3S3MA 7AT1B 2HKNA 5KYUA 1WHGA 4OMOA 1MHNA 2NUTA 4B9XA 2DL3A 1AWJA 1I5OB 1Q82R 1M90U 3J7AF 3PIOA 2L89A 2PVDB 2GNCA 3CC4T 3CCJA 2OTLA 3CCVQ 1GL5A 2MMPA 2V26A 3TU4K 1ZUYA 2HL5C 2DK3A 2BZXA 2RK2A 3JCMW 5GAMg 3MEAA 3QKJA 5IN1A 2YUNA 3G71T 3CCST 2RHXA 3CEYA 1KQSA 2CP0A 2G3RA 2ZPGB 3OBWA 2ENMA 2CDTA 4JRIA 4XTWA 3OYIA 2RB6A 3QHSA 3UATA 1JJ2P 2NUPB 5LL6S 4BDZA 1AOJA 3I35A 4X34A 1G83A 3OMGA 3QBYA 4C0DB 5GAOm 1AWWA 1D0YA 1VQNQ 3M57A 2ZGWA 3P8DA 1S72Q 5KE2A 4XU3A 1D0ZA 3VS5A 1H641 4J9IA 1W2BA 1D3BA 4ESRA 2HCKA 4DBFA 1NEGA 1SEMA 3BY7A 4M7DE 1ZA2B 4BE0A 1YFNA 2YXYA 1BCOA 1V76A 2MWOA 2P4RA 2JS0A 1EZZB 5CKDA 1VIEA 1NJIC 1Q7YU 1M1GA 1WFWA 1TS9A 4M77F 2HNIA 4M7AD 2X3XD 3CPWA 1QVGA 2EW3A 2X4XA 3MHXA 4M78A 2V1RA 4OB1B 2JZ2A 2QTVA 2LVMA 4HCZA 3I5SA 2DPPB 3U23A 1HD3A 2I2LA 4E7ZA 5A2QE 1IB8A 4RCCA 2MIOA 3CD6Q 3PT9A 5FU7C 2CKKA 4GLKA 5IXBA 2GFAA 2CT4A 3INZA 3FIFA 1K9MU 2KT1A 4DOWA 1JJ2S 4PJLA 3ULRB 5L23A 3ZBDA 2E3HA 4IUPA 5I2MA 2BE7D 3QJ6A 2XD0A 3MKDA 1OV3A 2CGHA 4L6V5 4JJCA 3CC4Q 4TVRA 3CCEA 1T3SA 4OP0A 2K2VA 2JNGA 3RKXA 5LJ5g 1BYMA 3OSSC 3CMAA 3V8KA 1Y96A 1JU5C 3PNWC 3SD4A 5GAN7 5LJ3e 2KXCA 3WXMB 3G71Q 3PE0A 4DEXA 1K8AR 2EQUA 3FB9A 3M0TA 2R5AA 1XQHA 1VYUA 2OX7A 1KD1R 3FEOA 3PIPA 4M4ZA 1XJWB 2ABLA 3NFCA 3E9FA 3DLLA 1PRMC 2CS7A 2DX1A 2GTOA 1NLPC 3M0SA 2QA4T 1R77A 4MDWA 2RO0A 2K3YA 4FCYA 2A7YA 3G4SQ 4PJOD 1YI2Q 4HT9A 2GTJA 4CC7A 1VQ4A 1WQ7A 3SHWA 3HFNA 2LP5A 6AT1B 2XU8A 3OBYA 1Y57A 1ZUUA 3SFMA 4M78F 2MK5A 4KGZB 2HEQA 4C0FA 4C5IA 5AYFA 3FRNA 4JRPA 2KGTA 3EG1A 4KH1B 2EPDA 1K0SA 2COWA 2FPFA 1VQ9Q 3MO8A 4C8QD 5FW9A 1VIFA 1UJ0A 4ZGJB 1MV3A 3CC2A 2EQJA 1Q81C 3L2WA 4MZMA 1V1CA 4MMLA 4D6WA 4DBRA 1K1ZA 1KHIA 3UT1A 1JJ2A 1NE8A 2YRVA 4A53A 1M1KC 3JSCA 1HK9A 2IVWA 2JT4A 1G5VA 4M77B 1CKAA 1O9SA 1NPPA 2YT6A 1QW1A 5GANe 1VQ6Q 3DKMA 4XTYA 3AT1B 3V7SA 5GMKh 3VUZA 4M7DG 4QVDA 2KI7A 2E70A 5HKCA 4OGEA 3GIBA 4ZN1A 3VS1A 5KYUB 2DJQA 2ROLA 2SRCA 1N9RA 2NUTB 1SSHA 1M5Q1 2KR3A 1M3BA 3EGUA 4J8OA 4FU6A 4HVVA 3C94A 3EG2A 3THKA 4PJJA 2RQUA 4DA4A 2KRMA 3KXTA 2R58A 1HSQA 4HKEA 2FL7A 3M4GA 3ME9A 1Q86U 3FJPA 3NTHA 2RM4A 4M75C 3G1JA 2VXEA 2L3SA 4NL3A 4X1VA 1M2OA 4RTVA 1TUCA 3VRZA 3CCJT 2Z0WA 2OTLT 4VUBA 4E7IA 3VS3A 1YWOA 2B86A 2HQXA 1X27A 3H6ZA 2XK0A 2QA4Q 3QSUA 2EQIA 3QZ9B 1U8RA 2RQVA 3EGXB 3LGLA 4LXCA 4CC3A 1KD1U 2R57A 3JCMe 3HP9A 2E64A 2EQMA 3RDVA 1SG5A 1WYXA 1OEBA 2O4XA 1PCXA 1K76A 5I21A 4FM4B 1Y07A 3JCMd 1SPKA 5A0DA 1WA7A 2ZPFB 4C92E 1D3BB 4ATOA 1K73U 2OI3A 1VQPA 1AZEA 3G6EA 2HZYA 3CBPA 2D0NA 3J80E 3GP8A 1I5LA 2M51A 4N0AC 1ZA1B 4HCKA 4JS4A 1VQ8A 3L2VA 2O01E 5GMKj 1MNEA 1KSWA 1MMGA 2ZCFB 1OZ2A 4J83A 2C0IA 4M78B 2QASA 4WF2A 2QYZA 3PTAA 1T3LA 1AVZC 2RN8A 2P0PA 3OYCA 2O9VA 1YHQA 3C95A 4IUVA 4RG2A 2HQEA 4OGCA 2XDDA 2DXBA 4M7DA 3CCUA 3A8GB 3TSWA 1B34B 2RI5A 2M9UA 4MZTA 5GMKi 2BTTA 2CZ1B 3ASKA 1BU1A 4JPBW 1UHFA 4GY5A 3MP1A 5IT9E 4PJNA 4J9FA 2DLPA 4JRKA 3L2UA 5I22A 3CBOA 2LNHB 1ZSZA 3EFOB 1G3TA 3CCMQ 2BKDN 4LNPA 1RAHB 1TG0A 2EJGA 1UHCA 1UGSB 3E19A 1UGPB 2LDMA 1MNDA 1I81A 2OAWA 2DBMA 1HJDA 2X3WD 2DILA 4R0KA 4J9CA 3CCET 3M59A 2A08A 2QQSA 3M56A 1PRLC 1WI7A 5GAN5 2EBPA 5HY6A 3OS2A 4XAXB 1M9SA 5D6YA 2EGCA 3CMAT 3MPUB 1VQMA 3A98A 5FLXE 1WPYA 1SHGA 4IURA 1H8KA 3CXCP 4Y91A 2M0YA 4LD9K 3M55A 4V2SA 1SHFA 1IHWA 2E10A 2K7AA 3GOXA 1M90R 2MF2A 1ZLMA 5KCHA 2MI6A 3JB9G 5GAN4 1M2VB 1RACB 5KYYA 2LMJA 5LJ3f 3DB4A 2BZ8A 2HBWA 5FROA 2J6KA 5GAN3 5GAMe 1DJ7B 4XTVA 1B3QA 2EYXA 1SF9A 2QEXA 4II1A 2GQIA 2KBTA 2EAYA 2K5LA 1FX7A 2YDLA 4HXJA 2EYZA 1BI0A 1FXXA 5GAMd 2QK0A 3LX7A 1TH7A 2W0ZA 4OMFB 4M7AC 1MMNA 1VQ4T 2PVOB 5FU6B 3J81E 2YWWA 1PSEA 5KYNA 4Y92A 2JMCA 1RL2A 4M7DF 2KYBA 1X43A 2A0FB 4E7JA 1P92A 2JM9A 4BE1A 3CPWP 2AKLA 4WTOB 4C5HA 3OW2S 3JCMb 4KUDK 1YJ9Q 2RQTA 1W1FA 3S6WA 3SWNA 3CXCS 2K6DA 2FRWA 2FHDA 4EMKA 1UTIA 1UUEA 2SEMA 2NWMA 1VQOA 1WHJA 2AHJB 2YUOA 1EIFA 4JJBA 2RJCA 2KXDA 3TEEA 4HA8A 2KVQG 4C92G 2ED1A 3JCMX 1VYVA 1N8RC 1PNJA 4E7SA 4A54A 3X25B 4QT7A 4BY6B 2CSIA 2X9HA 2AZVA 2K3XA 4ANJA 4A63B 3VYHB 4M77D 3CCEQ 2VXFA 3I55A 1KG1A 4B6MA 3NHNA 3MP8A 3A8MB 1QCOA 2RJEA 5GANf 1NJIR 1H92A 2CP2A 3CMAQ 1BIBA 1Z9QA 3VYGA 4MMKA 2KYMA 4ELYC 1Y0MA 4LDYA 3A8HB 2RHZA 4J6XA 3VS4A 2HL3A 3ZEHA 2FYKA 2E6NA 4PJOC 4XK8E 4OMQA 5LJ5e 4BB7A 2HSEB 5DY9A 5M9OA 3HFOA 5AT1B 4KUIA 5GAOl 1AWOA 1GFCA 3EG9A 3S3OA 5GAOq 1BI2A 5LJ5d 3AHUA 3OYDA 1H3ZA 3V7RA 4L59A 4JLGA 2CH4A 2L8DA 3CMEA 1AT1B 2EQKA 1BI1A 2VWFA 1VQ5A 2K4YA 4C8QC 2JTMA 4B9WA 1OI1A 3VS0A 4PL6A 2DF6A 4N0AA 3LH0A 1FYNA 4KH0B 4QKUA 2ROTA 1R8OB 2EJ9A 5C6SA 2CZ6B 4BY6C 2F2VA 3JCMf 3HSBA 4MDXA 4PNOA 1G3WA 3RNJA 3ZFJA 3OW2A 2B8AA 2RPNA 4N4GA 1VQPT 3G6ET 5J3BA 4FT2A 1BK2A 3CXCA 1OQKA 4PLIA 2LC4A 2JN0A 3DB3A 1VQ8T 2D0QB 1NLOC 1WQWA 1WNLA 1WHKA 4LUEA 4C92A 4M7DB 4C0GA 2IG0A 1OU8A 1U1TA 4ORZA 3R6OA 2F5TX 3O5ZA 3META 1X2KA 1YHQT 4M78D 5CAIA 3HHTB 3PVQA 4F7UE 1ZSGA 2DL4A 2LJ0A 3CCUT 3M58A 2G6FX 1VUBA 2V8KA 3X26B 4LD6A 3RMQA 4FYYB 4KGVB 1TOVA 3PMIA 1ZSZB 2DXTA 1PWTA 4J9EA 3JB9F 2K2MA 1QP2A 2RMOA 2JVVA 2VB6A 3OB9A 1NZ9A 3VS2A 1Q7YC 2DL7A 3OYEA 2PUKB 1VQKA 3EGDA 3VKIA 4A4KA 2K79A 1GRIA 4J9HA 2DYBA 3UDCA 1KQ1A 3IQLA 1Q81R 3CCRQ 1NJIU 2ZPHB 3NPFA 4A4GA 1ZBJA 4AG1C 3CCLA 3CC7A 3P8HA 3TCJA 5HK0A 1D0XA 4Z02A 1LOJA 1QKWA 1VQMT 4IUUA 4JJNK 4FL6A 3RR6A 5KYYB 3VRYA 1JBMA 2ZPIB 1YN8A 5IHIA 5GAN8 3L1AA 1BBZA 4JZ4A 1Q86R 1WX6A 2DZ9A 5J39A 3CPFA 4C0DC 2C06A 4RTXA 1PD1A 3QJYA 5CR2A 4M7AA 1A0NB 5HCKA 2PVGB 2DM1A 1X01A 2FB7A 1Q82C 2DO3A 3JCMV 2R5MA 2QEXT 4AT1B 1VQPQ 4BI4A 3CCSQ 4C92F 2CSQA 2X4WA 5GAMf 2OJ2A 1VQ8Q 4J9GA 2E3IA 4LUDA 1WHLA 2DE0X 5GAN2 2CT3A 4QQDA 4R55A 2BIVA 4XU1A 2DKGA 3SWNB 2DRKA 2DAQA 4EMKB 1YHQQ 1C1AA 4D8DA 3JB9J 3A1PA 2FPEA 3CCUQ 3SB2A 1K73R 2F5KA 5I2SA 1B7TA 2VYTA 3TSZA 3EG0A 1VQOT 2YLCA 3RKYA 1VQLA 5LJ3j 4BI3A 1JEGA 5GANh 4OMLA 5CVIA 3QPHA 1RAEB 2KEAA 1YJNA 2LQKA 2JTFA 2DVEA 1JXOA 2MPXC 1X75C 3CQTA 4L5GA 3QIIA 4XTXA 2NUZA 5ECAA 4YTLA 3LH5A 3RKWA 2ZAEA 3FJ5A 3I55T 1YNZA 4OB2B 1PD0A 2VUBA 2VV5A 2YRCA 2CUDA 3ER0A 3E1SA 4M75E 2RK1A 4C5GA 5CO7A 1GXIE 4BE2A 3M53A 5D6XA 3BDLA 4F7UG 4E7LA 1Q81U 1BCMA 2DD4A 4EPCA 2DVJA 3EG9B 1M1KU 3I5RA 1VQNA 1QLYA 1S72A 1AEYA 1YIJA 1YBYA 2QEXQ 3MP6A 1RI0A 2EGEA 4OB3B 2K9GA 5LJ5f 4ELZC 5DLOA 2EYQA 4PJMA 1M4ZA 2DA9A 3CMET 2MCNA 4LDWA 2BE9B 1VQ5T 2J7IA 4OB0B 1RI9A 1YCSB 2OAUA 2DEQA 2OTJA 1VQ7A 4ZTFA 2DBKA 3HRTA 2LJ3A 5GANj 3GLXA 3OYFA 1K8AC 1ZUKA 4GLMA 3CD6A 4Z89A 2EYWA 4EMHA 4XTUA 1CSKA 1KD1C 4C92B 4ME7A 5IXFA 1SSFA 1B07A 2D8HA 3TQ7P 1K4US 4A4FA 4RTYA 4M77C 5GMKm 4CC4B 4LDXA 2CYZB 3L2ZA 3M0PA 2FPDA 2X51A 2RI2A 1WHMA 4M7DD 3RUXA 1UGRB 1N6AA 3NTIA 2DTHA 3M9QA 3L2QA 8AT1B 4HVUA 2QDYB 3EGDB 3QXEB 1KJWA 5GAOr 1IZ6A 1GCPA 2QI2A 4RTZA 2DRMA 2H8HA 2QQRA 4F7UA 1F1BB 1RLQC 1JQQA 4N4IA 2PTKA 2E4HA 2RJDA 1X2QA 4O5VA 2MAMA 3I56A 3DLMA 3QO3A 4NS5A 2LJ1A 3OYYA 5KYWA 2LX7A 2KQWA 2DL8A 3EHRA 3LW5E 2DTOA 1OZ3A 2P84A 2CP6A 2M1HA 3H0HA 2YSQA 1W70A 1QMCA 3MJXA 1GFDA 2XDPA 1XNIA 1SRMA 2NUPA 4ZN3A 3G4SA 3CCLT 3CC7T 4AFZC 1YI2A 3MEVA 1TWBA 3SDZA 1NYGA 1IGQA 5DLQE 3H8ZA 4A4HA 4NL2A 1FMWA 2K5FA 3HKSA 3VS6A 3CCJQ 3MEUA 2OTLQ 1Y96B 3S3NA 3KBGA 2J6FA 1IGUA 3JCMP 1LCKA 1VQ9A 2V8IA 1RUWA 1KC8R 2E65A 1RAFB 3TREA 2K3BA 1CKBA 2FO0A 3OW2P 2AK5A 4DBHA 3REAB 4M7AE 1ABOA 4M75G 4DOVA 1RAIB 3H9NA 1N9SA 2KDSA 4FYWB 3EHQA 4RTUA 2EGAA 3SEMA 4E2FB 2YUQA 4M78C 3UF4A 2GFUA 4J6YA 4IIMA 1AZGB 1PG5B 1WHHA 3T9NA 2DD5A 2XMFA 2HMAA 1M30A 2QDLA 5J26A 1KK7A 2FRYA 2DXCA 1UE9A 2WSCE 1NEBA 1PC0A 3WVEB 1VQ6A 3WVDB 1LJOA 1AWXA 1UGQB 2P0QA 5CQXA 1JXMA 2DZCA 4JUVA 2DFUA 2DEUA 1X6GA 1TXQA 3I9QA 1R0CB 2WSEE 4F7UF 2FG0A 3EH2A 1D09B 1E6HA 1PKTA 3LLRA 4FSXA 3CCQA 2K5IA 3GF5A 2QXFA 4Y28E 3NMZC 3UA7A 1VQLT 1G8XA 1MMAA 4J9DA 2X4JA 5KYXA 2DMOA 4CI0C 2I0NA 2COYA 1M8VA 3HL8A 3QDRB 2DL5A 1YJNT 1G3SA 1FMKA 2NYSA 4R56A 4F14A 3E9GA 2PZ1A 1TTHB 2DXUA 1SKUB 1G3YA 1OPKA 3JRZA 3MCAB 3CC2T 4RKUE 4FIBA 2VVKA 5GAMj 3CBMA 3A5ZB 3CCLQ 2JUFA 2E6ZA 1RAGB 2AT1B 1X69A 2JMAA 4OMPA 3ZL7C 4MZPA 1IHVA 1OX8A 2M02A 2DIQA 4PJOE 1IO6A 3JV3A 2DETA 3JB9D 4FW2A 4Q5WA 1BB9A 1C0MA 2COZA 3VS7A 2RA2A 3KFVA 1C6VX 1YITA 3QYHB 4M75A 4IUQA 2P0KA 1VQNT 2XKOC 3P8BB 4XQ3A 4J7FA 1S72T 1YIJT 2MWPA 4GBQA 3M4YA 4C8QE 1HYOA 5FU6C 3HRUA 2YLBA 2EFIA 2CZ0B 2LQ8A 3E2UA 5IH2A 4J7IA 1YJWA 2DNUA 3RERA 2LZ6B 4RUGA 4PLLA 4HCCA 1NPRA 1SRLA 3QWYA 3OYBA 1KC8U 2LT4A 4Z88A 4BD3A 3FLGA 2LT1A 2ZPBB 2OTJT 3GPLA 1VQ7T 5KH6A 3OS0A 3PGGA 4AFUC 3OYJA 3D7SB 4IIOA 4A4EA 1M90C 4M77A 2V1QA 4JZ3A 2PNIA 1VQ4Q 3CD6T 2O4XB 2VC8A 3OYKA 4CC2A 1WZOA 5I11A 3PMTA 2EWNA 2RJFA 2DIGA 3CCMA 1M27C 2CUBA 2RQWA 2F69A 4C92D 1VQLQ 1LVKA 3BDUA 4JJDA 1R0BG 2KMTA 4M7AG 2HSPA 1LPLA 2CH4W 3VJPA 1YJNQ 4PK4A 4XU2A 2CP5A 2AZSA 5LJ5j 3CC2Q 5D7UA 1RAAB 2ED0A 1JO8A 1WXUA 3BE3A 2LCSA 5EC7A 1MMDA 2LX9A 4F7UB 3V8LA 5FU7B 4P5NA 3KUFA 1RABB 2XICA 2J06A 2QQAA 4EIKA 4LDVA 2CP7A 5KYWB 2KAFA 1X6OA 1I0CA 1GCQC 4UC4A 4XU0A 4C0ZA 4C5EA 2GGRA 2XI9A 2F2XA 4M75F 1LNXA 3EGXA 1WIEA 4JDSA 3I56T 5A0LA 1WXBA 4BDYA 2L5QA 5CKBA 4FSSA 1KFZA 4PFPA 2PUOB 2VASA 2HD0A 1YIJQ 2YRDA 3G4ST 2A36A 1AHJB 1YI2T 2AKKA 4O6JA 1NM7A 3LGFA 1D1AA 3LWIA 2EVRA 4WCIA 3Q1JA 3R6NA 4LN2A 3OA6A 2QQBA 5GJWB 1K9MC 2Y90A 3OSVA 1QWEA 2OTJQ 3LWHA 1VQ7Q 1ZQ1A 1WGSA 2W10A 1YJ9A 5LJ3h 1VQ9T 1IRXA 3OMCA 1BKBA 1M1KR 1OULA 2QAZA 2ZPEB 1WJSA 4PJOG 1ARKA 5A0GA 2QG9B 2KROA 1TUDA 1B34A 1RADB 4J5YA 3X28B 4M7DC 1WJQA 2CP3A 2LQWA 2HKQB 2MOXA 2GQVA 4PKCC 4Z8AA 2WACA 1OX9A 3EAEA 4QQ6A 3C12A 5IHNA 3EFOA 1VQ6T 2HQHA 2D6FA 4C8QG 3G6EQ 5CIUA 1WDXA 2D8JA 1ZSZC 1NYFA 2JS2A 3L2RA 5KYXB 1K9AA 3CCQT 1Q82U 2ECZA 1GBRA 3C4SA 2JW4A 3M0QA 2DYIA 2QGFB 2A37A 1Q95G 2E1HA 2LRQA 1RLPC 2GF7A 1U3OA 4RCBA 3I56Q 1UGVA 5LJ3d 4AFSC 2CREA 2EIFA 1I1JA 1UG1A 2X4YA 1QVFP 4DEYA 1BIAA 1M2VA 1FMVA 4KGXB 2KSSA 3NTKA 4LDUA 4K11A 1TSFA 5KE3A 1Y71A 2XHCA 2F2WA 2X35A 1MV0B 1ABQA 5HK3A 1JB0E 3UA6A 3CCVA 1UFFA 2L2PA 2KK4A 4M75B 2HAXA 1UJYA 4CRIA 3EH1A 2FEIA 2QQ9A 3OYGA 1YITT 3JCMJ 1PSFA 4PJOA 4FT4A 2FZKB 4OMMA 4HCBA 5DM7R 3PVLA 1VQMQ 4OF1A 1HXDA 5L8RE 4M7AF 4ZTJA 1I4K1 2A28A 3GNGA 1YJWT 4HVWA 1XOVA 1M8MA 2J6OA 2FZCB 1QVFS 4QVZA 2O31A 3SWNC 2DJZA 4OMNA 4EMKC 2XIDA 5GMKl 1WXTA 2KY9A 4C8QA 4NOYA 2WSFE 1PHTA 1UEBA 1E7OA 5FRNA 3REBB 3VV0A 4BACA 3C0CA 3JCMh 1ZX6A 2M16A 1UDLA 1Q86C 4X9CA 1YWPA 1I8FA 4J9BA 1TU0B 5GANd 4IKFA 4M77E 4E47A 2RI3A 2GBQA 1BI3A 4F04B 3CCQQ 4KBMB 3BFMA 2MYSA 5CKFA 3CCMT 2L3PA 3RIRA 1VYTA 3O8VA 1OU9A 2JXBA 4XTZA 5FRMA 4ZGEB
chains in the Genus database with same CATH topology
1Y96A 3CCRA 2DXCA 3F70A 2WSCE 5D6WA 2L8DA 3CMEA 3PFSA 3PNWC 2EQKA 1BI1A 5GMKe 3WVEB 3SD4A 1VQ5A 2K4YA 4C8QC 5LJ3e 5GAN7 1VQ6A 2JTMA 1LJOA 3WVDB 3WXMB 1OI1A 4B9WA 2FVUA 4PL6A 2PU9B 4N0AA 3LH0A 1UGQB 2P0QA 5CQXA 2DZCA 4JUVA 2EQUA 3FB9A 1R8OB 2R5AA 2EJ9A 5C6SA 2CZ6B 1XQHA 4BY6C 2WSEE 5KCOA 4JRQA 1K8AU 3JCMf 3HSBA 4F7UF 4MDXA 4PNOA 3FEOA 3PIPA 3M54A 5LJ3g 4JS5A 3LLRA 1G3WA 4E7HA 1K73C 3ZFJA 4FSXA 3OW2A 3CC4A 3CCQA 2B8AA 4N4GA 1VQPT 1MGQA 3NFCA 2K5IA 4FT2A 3E9FA 3GF5A 5J3BA 1YCYA 2CS7A 2QXFA 3QUIA 3QZ5B 4Y28E 3DLLA 3OYHA 1VQLT 3CXCA 3BW1A 2X4JA 2LC4A 2JN0A 3DB3A 2RHUA 4MDWA 4PLIA 5J26A 2QA4T 1VQ8T 2RO0A 1IREB 2K3YA 4PJOF 5CKHA 2A7YA 2P4TA 4CI0C 4PJOD 2D0QB 1M8VA 5CCAA 3HL8A 1WQWA 1WNLA 4HT9A 3QDRB 4C92A 1VQ4A 1YJNT 1G3SA 2Y4XA 1WQ7A 4M7DB 3HFNA 4C0GA 2EJFA 2IG0A 4R56A 1U1TA 3E9GA 3R6OA 2XU8A 3OBYA 3OY9A 2F5TX 2LCCA 3META 2DXUA 1G3YA 3G71A 4JLIA 3JRZA 3MCAB 4M78F 3SFMA 3CCSA 4RKUE 1YHQT 3CC2T 4M78D 5CAIA 4FIBA 1OYXA 3HHTB 4F7UE 3LYIA 5GAMj 4KT0E 4C0FA 3CBMA 3N5BB 4N4HA 1VQKT 3G7ZA 1N27A 4C5IA 5AYFA 3A5ZB 3CCUT 3FRNA 3M58A 1ZBXA 4JRPA 1VUBA 2V8KA 2JUFA 2E6ZA 3X26B 3X24B 4LD6A 3RMQA 4C8QF 3MO8A 4HT8A 2V8JA 4MZPA 4C8QD 3PMIA 2A3LA 1VIFA 2DXTA 2DIQA 4PJOE 3JB9F 4ZGJB 1QP2A 5CQYA 4QQGA 3JB9D 2JVVA 3OB9A 3CC2A 1NZ9A 1UB4A 1Q7YC 1QVFA 4Q5WA 3OYEA 5CK9A 2PUKB 2EQJA 1Q81C 3VUBA 1VQKA 1QP3A 4M7AC 2RHYA 2DTIA 2RH2A 3VKIA 3L2WA 2RA2A 1YJ9T 4MZMA 4MMLA 4X9DA 4D6WA 1KHCA 4A4KA 4M7AE 4M78E 1YITA 1KHIA 2EKOA 4C92C 3QYHB 4M75A 3UT1A 1JJ2A 4IUQA 1NE8A 2YRVA 3HPWA 2P0KA 4A53A 1M1KC 1VQNT 2XKOC 3UDCA 1KQ1A 3P8BB 4XQ3A 3JSCA 4J7FA 1HK9A 2IVWA 1YIJT 1S72T 2MWPA 5GAN6 3M4YA 4M7AB 3M5AA 1G5VA 4M77B 1NJIU 1O9SA 1NPPA 5GANe 1QW1A 2XG8D 2ZPHB 4C8QE 3DKMA 4A4GA 5FU6C 5GAMh 3HRUA 4XTYA 3CCLA 5FRMA 2RD1A 2YLBA 2EFIA 2CZ0B 3V7SA 5GMKh 3CC7A 3VUZA 2LQ8A 4M7DG 4J7IA 3P8HA 3OYMA 1YJWA 4QVDA 3RERA 2E70A 2QTXA 5HKCA 3TCJA 4OGEA 5HK0A 3GIBA 4PLLA 4Z02A 1LOJA 4EDUA 4ZN1A 1NPRA 3RMSA 3JCMQ 1VQMT 4HCCA 4IUUA 3OYBA 4JJNK 1KC8U 1M1FA 2LT4A 4FL6A 5GANg 1N9RA 1JBMA 4BD3A 1M5Q1 2ZPIB 3FLGA 2LT1A 4J8OA 4FU6A 3FC3A 2ZPBB 3GNFB 3L1AA 5IAYA 3C94A 5GAN8 3JAME 3GPLA 1VQ7T 2OTJT 1ZHIA 5KH6A 4DA4A 2K57A 2DZ9A 3KXTA 2R58A 5J39A 3OYLA 3CPFA 4HKEA 2FL7A 3PGGA 4C0DC 3OS0A 3M4GA 3OYJA 3ME9A 4E7KA 4A4EA 4BUGA 2C06A 3QJYA 2ZZDA 5CR2A 3FJPA 1Q86U 3NTHA 1M90C 4M7AA 4M77A 2RM4A 4M75C 2E12A 2VXEA 2PVGB 4KULA 1X01A 4NL3A 3CD6T 2O4XB 2FB7A 1Q82C 2VC8A 3CCJT 3EFSA 2DO3A 3JCMV 2R5MA 4VUBA 3OYKA 4E7IA 2QEXT 2OTLT 3PMTA 4BI4A 2EWNA 2RJFA 2DIGA 3OS1A 2E5QA 2HQXA 2RHIA 3CCMA 4C92F 2XDBA 3H6ZA 2F69A 4C92D 2XK0A 2X4WA 5GAMf 3JB9I 1FWZA 3BDUA 5EG2A 3JCMc 3OQ5A 3QSUA 2BUDA 3QZ9B 2KMTA 1U8RA 5GAN2 4M7AG 4M77G 2LNVA 4QQDA 3LGLA 3VJPA 4XU2A 1KD1U 3V7CA 4R55A 2R57A 5C0MA 3JCMe 4OVAA 2BIVA 3L42A 3QYGB 3HP9A 4XU1A 2E64A 4RMOA 2DKGA 2EQMA 3SWNB 5LJ5j 2DAQA 4EMKB 3HRSA 3JB9J 1WJRA 2LX9A 2O4XA 4J6WA 2E41A 3V8LA 5FU7B 4F7UB 4P5NA 3KUFA 3SB2A 5I21A 2F5KA 5I2SA 4FM4B 1Y07A 2M0OA 3JCMd 2VYTA 2XICA 5A0DA 2QQAA 3V8JA 4C92E 2ZPFB 3JCMg 1D3BB 4ATOA 1K73U 3CCVT 2NLUA 1VQPA 5GAOp 4LDVA 3VU3C 3G6EA 3CBPA 1VQOT 2KAFA 1X6OA 3RESA 2YLCA 3J80E 3GP8A 1I5LA 4UC4A 4N0AC 3RKYA 4XU0A 4C0ZA 4C5EA 1VQLA 4PJOB 2CZ7B 2PQWA 2XI9A 4BI8B 1W4SA 2QA4A 3L2VA 2O01E 4JS4A 4M75F 5GMKj 1VQ8A 1LNXA 4M75D 5LJ3j 4JDSA 1U1SA 3I56T 4BI3A 5A0LA 5GANh 5CVIA 2ZCFB 1OZ2A 4J83A 4BDYA 3QPHA 1KQSS 4ZGDB 1O75A 2LQKA 1YJNA 3JB9H 2H3JA 2Y4YA 2JTFA 2L5QA 5CKBA 2DVEA 3A8LB 4M78B 4WF2A 3UPUA 3PTAA 2PUOB 2GCXA 1X75C 2VGNA 2P0PA 3OYCA 2HD0A 4L5GA 4QVCA 3C95A 4IUVA 3QIIA 1YHQA 4XTXA 4RG2A 2HQEA 4OGCA 5LJ5h 3G4ST 4YTLA 2XDDA 3MEWA 2DXBA 4DQ2A 1AHJB 4M7DA 3CCUA 3URGA 3RKWA 3EFRA 1YI2T 3A8GB 4C8QB 3I55T 1JRIA 1B34B 4OB2B 2RI5A 4O6JA 2M9UA 2VUBA 3LGFA 4MZTA 3V8KA 5GAOn 2VV5A 5GMKi 3LWIA 3OYAA 1QVPA 3ER0A 3E1SA 3FDRA 2CZ1B 3Q1JA 4M75E 1V29B 3ASKA 2RK1A 4QW2A 4EMGA 1N8RU 4C5GA 1W2BS 5CO7A 1GXIE 4BE2A 4GY5A 4IUTA 3MP1A 5IT9E 3M53A 5D6XA 3BDLA 4F7UG 3OA6A 4E7LA 2QQBA 1K9MC 4JRKA 3L2UA 2Y90A 1Q81U 2DD4A 3OSVA 3CBOA 3X20B 3LWHA 3QG1A 1ZQ1A 4EPCA 1WGSA 1YJ9A 1G3TA 2BKDN 5LJ3h 1VQ9T 1KQ2A 3OMCA 1BKBA 3OS5A 2EJGA 2HBPA 1XTDA 2YHTA 3UWNA 2ZPEB 1WJSA 1UGSB 3E19A 1UGPB 2LDMA 4PJOG 1M1KU 1KC8C 1VQNA 5A0GA 1I81A 1S72A 3CPWS 1QVGS 1YIJA 5CKEA 2LTOA 4RG8A 1B34A 1YBYA 3MP6A 4J5YA 3CCET 3M59A 1RI0A 3X28B 4OB3B 2VGMA 4M7DC 1WJQA 2QQSA 3M56A 5LJ5f 5GAN5 4ELZC 4M78G 5HY6A 3OS2A 5DLOA 3OYNA 2GQVA 4PKCC 2LCLA 2EYQA 4XAXB 1M4ZA 1M9SA 2WACA 5D6YA 2JOYA 3CMAT 3EAEA 1VQMA 3CCRT 2D9TA 3A8OB 1WPYA 4QQ6A 5FLXE 3CMET 4IURA 3C12A 4LDWA 1VQ5T 1VQ6T 1Y7XA 2L3RA 4Y91A 4OB0B 4LD9K 3M55A 4V2SA 2OAUA 2D6FA 2DEQA 4C8QG 2OTJA 2E10A 1VQ7A 4ZTFA 5CIUA 3S3MA 3GOXA 2MF2A 3HRTA 5KCHA 2MI6A 3JB9G 5GAN4 1MHNA 3L2RA 5GANj 3GLXA 3OYFA 4B9XA 5LJ3f 1K8AC 3DB4A 1M90U 3J7AF 3PIOA 2L89A 5FROA 2PVDB 5GAN3 5GAMe 1DJ7B 3CD6A 4XTVA 3CC4T 3CCQT 4EMHA 4XTUA 1Q82U 1KD1C 3CCJA 2OTLA 2QEXA 4II1A 4C92B 3C4SA 2EAYA 2K5LA 2MMPA 3TU4K 1FX7A 4ME7A 1BI0A 1SSFA 2E1HA 1FXXA 2DK3A 2LRQA 5GAMd 2GF7A 1TH7A 3LX7A 2RK2A 3JCMW 5GAMg 3MEAA 4OMFB 4RCBA 3QKJA 4M77C 5LJ3d 4A4FA 5GMKm 2PVOB 5FU6B 3J81E 2CYZB 1VQ4T 4LDXA 3L2ZA 1PSEA 5IN1A 2EIFA 4ZGEB 2X4YA 2RI2A 1RL2A 1BIAA 4M7DF 3G71T 3CCST 4M7DD 3RUXA 2RHXA 3CEYA 4E7JA 1KQSA 1P92A 2G3RA 2KSSA 2ZPGB 4BE1A 3NTKA 4LDUA 1UGRB 3OBWA 4XTWA 4JRIA 1N6AA 3OYIA 4C5HA 3NTIA 3OW2S 5KE3A 2RB6A 3QHSA 2DTHA 3M9QA 3JCMb 3L2QA 4KUDK 1Y71A 2XHCA 5LL6S 2X35A 4BDZA 5HK3A 3S6WA 2QDYB 3SWNA 3CXCS 4X34A 1JB0E 3OMGA 3QBYA 2FHDA 4EMKA 4C0DB 5GAOm 3QXEB 3CCVA 5GAOr 1IZ6A 2QI2A 2QQRA 4F7UA 3M57A 2ZGWA 2KK4A 3P8DA 1VQOA 4M75B 5KE2A 2HAXA 4XU3A 2AHJB 4N4IA 1EIFA 2RJDA 1H641 2RJCA 1W2BA 1D3BA 4O5VA 2MAMA 3TEEA 4CRIA 3I56A 3DLMA 4HA8A 4M7DE 3BY7A 3QO3A 4NS5A 2KVQG 2QQ9A 3OYYA 3OYGA 4BE0A 1YITT 2KQWA 3JCMJ 3LW5E 2DTOA 1PSFA 4PJOA 1OZ3A 4C92G 4FT4A 2MWOA 3JCMX 1N8RC 5CKDA 4HCBA 5DM7R 2M1HA 4A54A 1VIEA 3X25B 4BY6B 1NJIC 2XDPA 2K3XA 1XNIA 1Q7YU 4OF1A 1HXDA 1M1GA 5L8RE 4ZN3A 4M7AF 3VYHB 3G4SA 4M77F 3CCLT 2HNIA 4ZTJA 4M7AD 4M77D 1I4K1 3CPWA 1QVGA 3CC7T 3G6ET 2X4XA 2VXFA 3MEVA 3MHXA 4M78A 3SDZA 3I55A 1YI2A 1KG1A 3GNGA 4OB1B 1YJWT 2JZ2A 5DLQE 1XOVA 3H8ZA 3A8MB 3MP8A 2LVMA 4NL2A 4A4HA 2RJEA 4HCZA 1QVFS 4QVZA 5GANf 3SWNC 2DJZA 4EMKC 2DPPB 2K5FA 2XIDA 5A2QE 2I2LA 5GMKl 1BIBA 2KY9A 4RCCA 3PT9A 3VYGA 4NOYA 4MMKA 3HKSA 2CKKA 2WSFE 4GLKA 5FU7C 4C8QA 1UEBA 2GFAA 3MEUA 4ELYC 4LDYA 1Y96B 3A8HB 3INZA 3FIFA 2RHZA 3S3NA 4DOWA 3KBGA 4J6XA 1K9MU 1JJ2S 5FRNA 3VV0A 4BACA 3ZBDA 3JCMP 1VQ9A 2V8IA 3JCMh 4IUPA 3ZEHA 2FYKA 5I2MA 2M16A 1Q86C 3QJ6A 2E65A 4X9CA 3TREA 2XD0A 1I8FA 2E6NA 4PJOC 2CGHA 4XK8E 5GANd 4IKFA 4M77E 4M75G 4DOVA 4BB7A 4E47A 4L6V5 5DY9A 5LJ5e 5M9OA 2RI3A 3HFOA 1N9SA 1BI3A 2KDSA 4KUIA 5GAOl 4KBMB 3BFMA 4TVRA 5CKFA 3CCEA 3CCMT 4OP0A 2K2VA 3RIRA 3S3OA 5GAOq 1BI2A 4M78C 2JNGA 5LJ5d 3O8VA 3OYDA 3AHUA 1H3ZA 3RKXA 2GFUA 4J6YA 3T9NA 5LJ5g 1BYMA 3V7RA 3OSSC 2DD5A 4XTZA 3CMAA 4L59A 4JLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHX A;  3CEY A;  3F70 A;  5D6W A;  4E7J A;  4A4H A;  2L8D A;  2G3R A;  3PFS A;  3PNW C;  2EQK A;  4BE1 A;  3NTK A;  4PLL A;  4Z02 A;  4EDU A;  3SD4 A;  2RI5 A;  4IUU A;  4B9W A;  3LGF A;  1OI1 A;  4C5H A;  3OYB A;  3OYI A;  4FL6 A;  4PL6 A;  3NTI A;  3OYA A;  5KE3 A;  3LH0 A;  3L2Q A;  3M9Q A;  3FLG A;  4BD3 A;  2EQU A;  3FDR A;  3Q1J A;  4FU6 A;  2X35 A;  3ASK A;  2R5A A;  4QW2 A;  5IAY A;  3FC3 A;  4BDZ A;  3S6W A;  4C5G A;  5C6S A;  5KH6 A;  4X34 A;  3OMG A;  3OYM A;  3QBY A;  4GY5 A;  2FHD A;  3MP1 A;  4IUT A;  2R58 A;  5KCO A;  5J39 A;  3OYL A;  5D6X A;  3BDL A;  3OS0 A;  3OA6 A;  3OYJ A;  4E7L A;  3FEO A;  3ME9 A;  4A4E A;  4E7K A;  4E7I A;  3L2U A;  2QQR A;  3LLR A;  3P8D A;  4E7H A;  3NTH A;  5KE2 A;  1WGS A;  2B8A A;  4N4G A;  2BKD N;  3OMC A;  3OYH A;  3E9F A;  4N4I A;  2O4X B;  2RJD A;  2RJC A;  4CRI A;  3DLM A;  3OYK A;  2R5M A;  4PLI A;  3UWN A;  3DB3 A;  2RHU A;  4NS5 A;  1WJS A;  5J26 A;  3PMT A;  3OYG A;  2LDM A;  2K3Y A;  2RO0 A;  4BE0 A;  2RJF A;  2DIG A;  3OS1 A;  2RHI A;  2E5Q A;  1OZ3 A;  2HQX A;  3H6Z A;  2LTO A;  2MWO A;  2XK0 A;  2X4W A;  2M1H A;  3MP6 A;  1RI0 A;  2XDP A;  3OQ5 A;  2BUD A;  2IG0 A;  2K3X A;  1XNI A;  1WJQ A;  2QQS A;  3E9G A;  3OY9 A;  2LCC A;  3MET A;  4QQD A;  3OYN A;  3OS2 A;  4ZTJ A;  3LGL A;  1OYX A;  2X4X A;  3LYI A;  2WAC A;  3MEV A;  5D6Y A;  3EAE A;  4N4H A;  2R57 A;  2JZ2 A;  1N27 A;  4C5I A;  3H8Z A;  3MP8 A;  2BIV A;  3L42 A;  2D9T A;  2LVM A;  4OVA A;  4QQ6 A;  2RJE A;  2EQM A;  4HCZ A;  4IUR A;  4QVZ A;  2DAQ A;  2L3R A;  4LD6 A;  4BE2 A;  3MO8 A;  1WJR A;  2O4X A;  4ZTF A;  5CIU A;  3S3M A;  3PMI A;  3KUF A;  3GOX A;  2CKK A;  2F5K A;  2DIQ A;  2GFA A;  3MEU A;  2M0O A;  5KCH A;  2VYT A;  1MHN A;  3L2R A;  5C0M A;  2RHZ A;  4QQG A;  3OYF A;  3S3N A;  3OB9 A;  4B9X A;  5FRN A;  3DB4 A;  4Q5W A;  3OYE A;  2NLU A;  4BAC A;  2EQJ A;  4IUP A;  2L89 A;  5FRO A;  3ZEH A;  2M16 A;  2RHY A;  3QJ6 A;  3L2W A;  4UC4 A;  4C5E A;  2E6N A;  1KHC A;  2PQW A;  4IKF A;  3L2V A;  4II1 A;  3C4S A;  2EKO A;  5M9O A;  2RI3 A;  3UT1 A;  4IUQ A;  2YRV A;  2P0K A;  1SSF A;  1OZ2 A;  2LRQ A;  4BDY A;  2MWP A;  2GF7 A;  3LX7 A;  2JTF A;  1G5V A;  3MEA A;  4A4F A;  3QKJ A;  3S3O A;  3O8V A;  4A4G A;  3OYD A;  1H3Z A;  2GFU A;  5FRM A;  5IN1 A;  3OYC A;  2EFI A;  2X4Y A;  3QII A;  4IUV A;  2RI2 A;  4RG2 A;  2HQE A;  4L59 A;  3P8H A;  3MEW A; 
#chains in the Genus database with same CATH topology
 1EFN A;  3CCR A;  3F70 A;  5D6W A;  3PFS A;  5GMK e;  1VOM A;  2FVU A;  1GCQ A;  2PU9 B;  1VQO Q;  2O9S A;  2ATC B;  5KCO A;  4JRQ A;  1K8A U;  3M54 A;  5LJ3 g;  4JS5 A;  1K73 C;  4E7H A;  3CC4 A;  1MGQ A;  1QQJ A;  3OYH A;  1YCY A;  3QUI A;  3QZ5 B;  3BW1 A;  2RHU A;  1IRE B;  4PJO F;  2HDA A;  2P4T A;  5CKH A;  2KNB B;  4AFQ C;  5CCA A;  2BZY A;  3I55 Q;  2E5K A;  2O2O A;  3H0F A;  2Y4X A;  1YIT Q;  2EJF A;  5FWC A;  3OY9 A;  2LCC A;  3G71 A;  4JLI A;  3CCS A;  2EYY A;  1E6G A;  1NBE B;  1M3A A;  1OYX A;  3LYI A;  4KT0 E;  3QWX X;  3N5B B;  4N4H A;  1VQK T;  3G7Z A;  1N27 A;  1ZBX A;  3HTR A;  4E6R A;  2VKN A;  2YUP A;  3X24 B;  4C8Q F;  4D8K A;  1YJW Q;  4HT8 A;  2V8J A;  2RF0 A;  2L3Q A;  2EKH A;  2A3L A;  1YP5 A;  5CQY A;  4QQG A;  1UB4 A;  1QVF A;  5CK9 A;  3VUB A;  1QP3 A;  2RHY A;  2DTI A;  2RH2 A;  1YJ9 T;  1PM3 A;  4X9D A;  1KHC A;  1VA7 A;  5GJV B;  4DBQ A;  1N8R R;  4M78 E;  2O88 A;  1D1B A;  2EKO A;  4C92 C;  3HPW A;  1T0H A;  5GAN 6;  4M7A B;  3M5A A;  3CME Q;  3RBB B;  2ESW A;  1VQ5 Q;  2C0T A;  2XG8 D;  5GAM h;  2RD1 A;  1T0J A;  3OYM A;  2QTX A;  4ZNX A;  4EDU A;  3JCM Q;  3RMS A;  9ATC B;  1M1F A;  1N5Z A;  5GAN g;  2KRS A;  3QDF A;  3FC3 A;  5IAY A;  3GNF B;  3JAM E;  1ZHI A;  1WLP B;  2K57 A;  3OYL A;  4E7K A;  1QCF A;  4BUG A;  2ZZD A;  3M0R A;  1X6B A;  1W6X A;  2JJ9 A;  2E12 A;  1K0X A;  4KUL A;  1KQS P;  3EFS A;  2KT8 A;  1TUG B;  2H3E B;  4F17 A;  1QWF A;  3OS1 A;  2E5Q A;  2RHI A;  2XDB A;  3H41 A;  4F16 A;  2L0A A;  3JB9 I;  1FWZ A;  5EG2 A;  3JCM c;  3OQ5 A;  2BUD A;  2QGG A;  1U06 A;  4M77 G;  2LNV A;  1QCN A;  4PFO A;  2D1X A;  3EG3 A;  1S1N A;  3V7C A;  4FYX B;  5C0M A;  4OVA A;  3L42 A;  3QYG B;  4RMO A;  2FZG B;  1W2B P;  3HRS A;  1I07 A;  3TVT A;  1WJR A;  4J6W A;  1VQK Q;  2E41 A;  2M0O A;  4FYV B;  3V8J A;  3JCM g;  1G2B A;  3CCV T;  2NLU A;  1EX4 A;  5GAO p;  3VU3 C;  3H0I A;  3RES A;  2JTE A;  4RTT A;  2J05 A;  4PJO B;  1QVG P;  2CZ7 B;  2PQW A;  4BI8 B;  2QA4 A;  1W4S A;  2C0O A;  2KE9 A;  4M75 D;  1U1S A;  2DER A;  3GBQ A;  2LQN A;  3CC7 Q;  4PFZ A;  1NG2 A;  1PKS A;  1KQS S;  1J3T A;  2IPO B;  4ZGD B;  1O75 A;  1MUZ A;  3JB9 H;  2H3J A;  1OOT A;  1Z9Z A;  2Y4Y A;  3A8L B;  3UPU A;  2VGN A;  2GCX A;  4QVC A;  5LJ5 h;  3M0U A;  3MEW A;  4DQ2 A;  2AIR B;  3URG A;  3EFR A;  4C8Q B;  1IXD A;  1JRI A;  2RQR A;  5GAO n;  3OYA A;  1QVP A;  8ATC B;  1Q7Y R;  4EMG A;  3FDR A;  1N8R U;  1V29 B;  4QW2 A;  1W2B S;  4IUT A;  5IHK A;  2RNA A;  1OPL A;  3NGP A;  3X20 B;  3QG1 A;  5FWB A;  4LE9 A;  4AG2 C;  1KQ2 A;  3OS5 A;  2HBP A;  1XTD A;  2YHT A;  3UWN A;  2F1L A;  1KC8 C;  1AD5 A;  3CPW S;  1QVG S;  4AMC A;  4RTW A;  1K9M R;  1D1C A;  5CKE A;  2LTO A;  4RG8 A;  1H3H A;  2VGM A;  1ACM B;  1U5S A;  1GBQ A;  4M78 G;  2JM8 A;  3OYN A;  2LCL A;  1QKX A;  2JOY A;  1KIK A;  3CCR T;  2D9T A;  1M3C A;  3A8O B;  1UEC A;  4KRT A;  2KRN A;  1Y7X A;  2L3R A;  2IIM A;  4FW1 A;  3S3M A;  7AT1 B;  2HKN A;  5KYU A;  1WHG A;  4OMO A;  1MHN A;  2NUT A;  4B9X A;  2DL3 A;  1AWJ A;  1I5O B;  1Q82 R;  1M90 U;  3J7A F;  3PIO A;  2L89 A;  2PVD B;  2GNC A;  3CC4 T;  3CCJ A;  2OTL A;  3CCV Q;  1GL5 A;  2MMP A;  2V26 A;  3TU4 K;  1ZUY A;  2HL5 C;  2DK3 A;  2BZX A;  2RK2 A;  3JCM W;  5GAM g;  3MEA A;  3QKJ A;  5IN1 A;  2YUN A;  3G71 T;  3CCS T;  2RHX A;  3CEY A;  1KQS A;  2CP0 A;  2G3R A;  2ZPG B;  3OBW A;  2ENM A;  2CDT A;  4JRI A;  4XTW A;  3OYI A;  2RB6 A;  3QHS A;  3UAT A;  1JJ2 P;  2NUP B;  5LL6 S;  4BDZ A;  1AOJ A;  3I35 A;  4X34 A;  1G83 A;  3OMG A;  3QBY A;  4C0D B;  5GAO m;  1AWW A;  1D0Y A;  1VQN Q;  3M57 A;  2ZGW A;  3P8D A;  1S72 Q;  5KE2 A;  4XU3 A;  1D0Z A;  3VS5 A;  1H64 1;  4J9I A;  1W2B A;  1D3B A;  4ESR A;  2HCK A;  4DBF A;  1NEG A;  1SEM A;  3BY7 A;  4M7D E;  1ZA2 B;  4BE0 A;  1YFN A;  2YXY A;  1BCO A;  1V76 A;  2MWO A;  2P4R A;  2JS0 A;  1EZZ B;  5CKD A;  1VIE A;  1NJI C;  1Q7Y U;  1M1G A;  1WFW A;  1TS9 A;  4M77 F;  2HNI A;  4M7A D;  2X3X D;  3CPW A;  1QVG A;  2EW3 A;  2X4X A;  3MHX A;  4M78 A;  2V1R A;  4OB1 B;  2JZ2 A;  2QTV A;  2LVM A;  4HCZ A;  3I5S A;  2DPP B;  3U23 A;  1HD3 A;  2I2L A;  4E7Z A;  5A2Q E;  1IB8 A;  4RCC A;  2MIO A;  3CD6 Q;  3PT9 A;  5FU7 C;  2CKK A;  4GLK A;  5IXB A;  2GFA A;  2CT4 A;  3INZ A;  3FIF A;  1K9M U;  2KT1 A;  4DOW A;  1JJ2 S;  4PJL A;  3ULR B;  5L23 A;  3ZBD A;  2E3H A;  4IUP A;  5I2M A;  2BE7 D;  3QJ6 A;  2XD0 A;  3MKD A;  1OV3 A;  2CGH A;  4L6V 5;  4JJC A;  3CC4 Q;  4TVR A;  3CCE A;  1T3S A;  4OP0 A;  2K2V A;  2JNG A;  3RKX A;  5LJ5 g;  1BYM A;  3OSS C;  3CMA A;  3V8K A;  1Y96 A;  1JU5 C;  3PNW C;  3SD4 A;  5GAN 7;  5LJ3 e;  2KXC A;  3WXM B;  3G71 Q;  3PE0 A;  4DEX A;  1K8A R;  2EQU A;  3FB9 A;  3M0T A;  2R5A A;  1XQH A;  1VYU A;  2OX7 A;  1KD1 R;  3FEO A;  3PIP A;  4M4Z A;  1XJW B;  2ABL A;  3NFC A;  3E9F A;  3DLL A;  1PRM C;  2CS7 A;  2DX1 A;  2GTO A;  1NLP C;  3M0S A;  2QA4 T;  1R77 A;  4MDW A;  2RO0 A;  2K3Y A;  4FCY A;  2A7Y A;  3G4S Q;  4PJO D;  1YI2 Q;  4HT9 A;  2GTJ A;  4CC7 A;  1VQ4 A;  1WQ7 A;  3SHW A;  3HFN A;  2LP5 A;  6AT1 B;  2XU8 A;  3OBY A;  1Y57 A;  1ZUU A;  3SFM A;  4M78 F;  2MK5 A;  4KGZ B;  2HEQ A;  4C0F A;  4C5I A;  5AYF A;  3FRN A;  4JRP A;  2KGT A;  3EG1 A;  4KH1 B;  2EPD A;  1K0S A;  2COW A;  2FPF A;  1VQ9 Q;  3MO8 A;  4C8Q D;  5FW9 A;  1VIF A;  1UJ0 A;  4ZGJ B;  1MV3 A;  3CC2 A;  2EQJ A;  1Q81 C;  3L2W A;  4MZM A;  1V1C A;  4MML A;  4D6W A;  4DBR A;  1K1Z A;  1KHI A;  3UT1 A;  1JJ2 A;  1NE8 A;  2YRV A;  4A53 A;  1M1K C;  3JSC A;  1HK9 A;  2IVW A;  2JT4 A;  1G5V A;  4M77 B;  1CKA A;  1O9S A;  1NPP A;  2YT6 A;  1QW1 A;  5GAN e;  1VQ6 Q;  3DKM A;  4XTY A;  3AT1 B;  3V7S A;  5GMK h;  3VUZ A;  4M7D G;  4QVD A;  2KI7 A;  2E70 A;  5HKC A;  4OGE A;  3GIB A;  4ZN1 A;  3VS1 A;  5KYU B;  2DJQ A;  2ROL A;  2SRC A;  1N9R A;  2NUT B;  1SSH A;  1M5Q 1;  2KR3 A;  1M3B A;  3EGU A;  4J8O A;  4FU6 A;  4HVV A;  3C94 A;  3EG2 A;  3THK A;  4PJJ A;  2RQU A;  4DA4 A;  2KRM A;  3KXT A;  2R58 A;  1HSQ A;  4HKE A;  2FL7 A;  3M4G A;  3ME9 A;  1Q86 U;  3FJP A;  3NTH A;  2RM4 A;  4M75 C;  3G1J A;  2VXE A;  2L3S A;  4NL3 A;  4X1V A;  1M2O A;  4RTV A;  1TUC A;  3VRZ A;  3CCJ T;  2Z0W A;  2OTL T;  4VUB A;  4E7I A;  3VS3 A;  1YWO A;  2B86 A;  2HQX A;  1X27 A;  3H6Z A;  2XK0 A;  2QA4 Q;  3QSU A;  2EQI A;  3QZ9 B;  1U8R A;  2RQV A;  3EGX B;  3LGL A;  4LXC A;  4CC3 A;  1KD1 U;  2R57 A;  3JCM e;  3HP9 A;  2E64 A;  2EQM A;  3RDV A;  1SG5 A;  1WYX A;  1OEB A;  2O4X A;  1PCX A;  1K76 A;  5I21 A;  4FM4 B;  1Y07 A;  3JCM d;  1SPK A;  5A0D A;  1WA7 A;  2ZPF B;  4C92 E;  1D3B B;  4ATO A;  1K73 U;  2OI3 A;  1VQP A;  1AZE A;  3G6E A;  2HZY A;  3CBP A;  2D0N A;  3J80 E;  3GP8 A;  1I5L A;  2M51 A;  4N0A C;  1ZA1 B;  4HCK A;  4JS4 A;  1VQ8 A;  3L2V A;  2O01 E;  5GMK j;  1MNE A;  1KSW A;  1MMG A;  2ZCF B;  1OZ2 A;  4J83 A;  2C0I A;  4M78 B;  2QAS A;  4WF2 A;  2QYZ A;  3PTA A;  1T3L A;  1AVZ C;  2RN8 A;  2P0P A;  3OYC A;  2O9V A;  1YHQ A;  3C95 A;  4IUV A;  4RG2 A;  2HQE A;  4OGC A;  2XDD A;  2DXB A;  4M7D A;  3CCU A;  3A8G B;  3TSW A;  1B34 B;  2RI5 A;  2M9U A;  4MZT A;  5GMK i;  2BTT A;  2CZ1 B;  3ASK A;  1BU1 A;  4JPB W;  1UHF A;  4GY5 A;  3MP1 A;  5IT9 E;  4PJN A;  4J9F A;  2DLP A;  4JRK A;  3L2U A;  5I22 A;  3CBO A;  2LNH B;  1ZSZ A;  3EFO B;  1G3T A;  3CCM Q;  2BKD N;  4LNP A;  1RAH B;  1TG0 A;  2EJG A;  1UHC A;  1UGS B;  3E19 A;  1UGP B;  2LDM A;  1MND A;  1I81 A;  2OAW A;  2DBM A;  1HJD A;  2X3W D;  2DIL A;  4R0K A;  4J9C A;  3CCE T;  3M59 A;  2A08 A;  2QQS A;  3M56 A;  1PRL C;  1WI7 A;  5GAN 5;  2EBP A;  5HY6 A;  3OS2 A;  4XAX B;  1M9S A;  5D6Y A;  2EGC A;  3CMA T;  3MPU B;  1VQM A;  3A98 A;  5FLX E;  1WPY A;  1SHG A;  4IUR A;  1H8K A;  3CXC P;  4Y91 A;  2M0Y A;  4LD9 K;  3M55 A;  4V2S A;  1SHF A;  1IHW A;  2E10 A;  2K7A A;  3GOX A;  1M90 R;  2MF2 A;  1ZLM A;  5KCH A;  2MI6 A;  3JB9 G;  5GAN 4;  1M2V B;  1RAC B;  5KYY A;  2LMJ A;  5LJ3 f;  3DB4 A;  2BZ8 A;  2HBW A;  5FRO A;  2J6K A;  5GAN 3;  5GAM e;  1DJ7 B;  4XTV A;  1B3Q A;  2EYX A;  1SF9 A;  2QEX A;  4II1 A;  2GQI A;  2KBT A;  2EAY A;  2K5L A;  1FX7 A;  2YDL A;  4HXJ A;  2EYZ A;  1BI0 A;  1FXX A;  5GAM d;  2QK0 A;  3LX7 A;  1TH7 A;  2W0Z A;  4OMF B;  4M7A C;  1MMN A;  1VQ4 T;  2PVO B;  5FU6 B;  3J81 E;  2YWW A;  1PSE A;  5KYN A;  4Y92 A;  2JMC A;  1RL2 A;  4M7D F;  2KYB A;  1X43 A;  2A0F B;  4E7J A;  1P92 A;  2JM9 A;  4BE1 A;  3CPW P;  2AKL A;  4WTO B;  4C5H A;  3OW2 S;  3JCM b;  4KUD K;  1YJ9 Q;  2RQT A;  1W1F A;  3S6W A;  3SWN A;  3CXC S;  2K6D A;  2FRW A;  2FHD A;  4EMK A;  1UTI A;  1UUE A;  2SEM A;  2NWM A;  1VQO A;  1WHJ A;  2AHJ B;  2YUO A;  1EIF A;  4JJB A;  2RJC A;  2KXD A;  3TEE A;  4HA8 A;  2KVQ G;  4C92 G;  2ED1 A;  3JCM X;  1VYV A;  1N8R C;  1PNJ A;  4E7S A;  4A54 A;  3X25 B;  4QT7 A;  4BY6 B;  2CSI A;  2X9H A;  2AZV A;  2K3X A;  4ANJ A;  4A63 B;  3VYH B;  4M77 D;  3CCE Q;  2VXF A;  3I55 A;  1KG1 A;  4B6M A;  3NHN A;  3MP8 A;  3A8M B;  1QCO A;  2RJE A;  5GAN f;  1NJI R;  1H92 A;  2CP2 A;  3CMA Q;  1BIB A;  1Z9Q A;  3VYG A;  4MMK A;  2KYM A;  4ELY C;  1Y0M A;  4LDY A;  3A8H B;  2RHZ A;  4J6X A;  3VS4 A;  2HL3 A;  3ZEH A;  2FYK A;  2E6N A;  4PJO C;  4XK8 E;  4OMQ A;  5LJ5 e;  4BB7 A;  2HSE B;  5DY9 A;  5M9O A;  3HFO A;  5AT1 B;  4KUI A;  5GAO l;  1AWO A;  1GFC A;  3EG9 A;  3S3O A;  5GAO q;  1BI2 A;  5LJ5 d;  3AHU A;  3OYD A;  1H3Z A;  3V7R A;  4L59 A;  4JLG A;  2CH4 A;  2L8D A;  3CME A;  1AT1 B;  2EQK A;  1BI1 A;  2VWF A;  1VQ5 A;  2K4Y A;  4C8Q C;  2JTM A;  4B9W A;  1OI1 A;  3VS0 A;  4PL6 A;  2DF6 A;  4N0A A;  3LH0 A;  1FYN A;  4KH0 B;  4QKU A;  2ROT A;  1R8O B;  2EJ9 A;  5C6S A;  2CZ6 B;  4BY6 C;  2F2V A;  3JCM f;  3HSB A;  4MDX A;  4PNO A;  1G3W A;  3RNJ A;  3ZFJ A;  3OW2 A;  2B8A A;  2RPN A;  4N4G A;  1VQP T;  3G6E T;  5J3B A;  4FT2 A;  1BK2 A;  3CXC A;  1OQK A;  4PLI A;  2LC4 A;  2JN0 A;  3DB3 A;  1VQ8 T;  2D0Q B;  1NLO C;  1WQW A;  1WNL A;  1WHK A;  4LUE A;  4C92 A;  4M7D B;  4C0G A;  2IG0 A;  1OU8 A;  1U1T A;  4ORZ A;  3R6O A;  2F5T X;  3O5Z A;  3MET A;  1X2K A;  1YHQ T;  4M78 D;  5CAI A;  3HHT B;  3PVQ A;  4F7U E;  1ZSG A;  2DL4 A;  2LJ0 A;  3CCU T;  3M58 A;  2G6F X;  1VUB A;  2V8K A;  3X26 B;  4LD6 A;  3RMQ A;  4FYY B;  4KGV B;  1TOV A;  3PMI A;  1ZSZ B;  2DXT A;  1PWT A;  4J9E A;  3JB9 F;  2K2M A;  1QP2 A;  2RMO A;  2JVV A;  2VB6 A;  3OB9 A;  1NZ9 A;  3VS2 A;  1Q7Y C;  2DL7 A;  3OYE A;  2PUK B;  1VQK A;  3EGD A;  3VKI A;  4A4K A;  2K79 A;  1GRI A;  4J9H A;  2DYB A;  3UDC A;  1KQ1 A;  3IQL A;  1Q81 R;  3CCR Q;  1NJI U;  2ZPH B;  3NPF A;  4A4G A;  1ZBJ A;  4AG1 C;  3CCL A;  3CC7 A;  3P8H A;  3TCJ A;  5HK0 A;  1D0X A;  4Z02 A;  1LOJ A;  1QKW A;  1VQM T;  4IUU A;  4JJN K;  4FL6 A;  3RR6 A;  5KYY B;  3VRY A;  1JBM A;  2ZPI B;  1YN8 A;  5IHI A;  5GAN 8;  3L1A A;  1BBZ A;  4JZ4 A;  1Q86 R;  1WX6 A;  2DZ9 A;  5J39 A;  3CPF A;  4C0D C;  2C06 A;  4RTX A;  1PD1 A;  3QJY A;  5CR2 A;  4M7A A;  1A0N B;  5HCK A;  2PVG B;  2DM1 A;  1X01 A;  2FB7 A;  1Q82 C;  2DO3 A;  3JCM V;  2R5M A;  2QEX T;  4AT1 B;  1VQP Q;  4BI4 A;  3CCS Q;  4C92 F;  2CSQ A;  2X4W A;  5GAM f;  2OJ2 A;  1VQ8 Q;  4J9G A;  2E3I A;  4LUD A;  1WHL A;  2DE0 X;  5GAN 2;  2CT3 A;  4QQD A;  4R55 A;  2BIV A;  4XU1 A;  2DKG A;  3SWN B;  2DRK A;  2DAQ A;  4EMK B;  1YHQ Q;  1C1A A;  4D8D A;  3JB9 J;  3A1P A;  2FPE A;  3CCU Q;  3SB2 A;  1K73 R;  2F5K A;  5I2S A;  1B7T A;  2VYT A;  3TSZ A;  3EG0 A;  1VQO T;  2YLC A;  3RKY A;  1VQL A;  5LJ3 j;  4BI3 A;  1JEG A;  5GAN h;  4OML A;  5CVI A;  3QPH A;  1RAE B;  2KEA A;  1YJN A;  2LQK A;  2JTF A;  2DVE A;  1JXO A;  2MPX C;  1X75 C;  3CQT A;  4L5G A;  3QII A;  4XTX A;  2NUZ A;  5ECA A;  4YTL A;  3LH5 A;  3RKW A;  2ZAE A;  3FJ5 A;  3I55 T;  1YNZ A;  4OB2 B;  1PD0 A;  2VUB A;  2VV5 A;  2YRC A;  2CUD A;  3ER0 A;  3E1S A;  4M75 E;  2RK1 A;  4C5G A;  5CO7 A;  1GXI E;  4BE2 A;  3M53 A;  5D6X A;  3BDL A;  4F7U G;  4E7L A;  1Q81 U;  1BCM A;  2DD4 A;  4EPC A;  2DVJ A;  3EG9 B;  1M1K U;  3I5R A;  1VQN A;  1QLY A;  1S72 A;  1AEY A;  1YIJ A;  1YBY A;  2QEX Q;  3MP6 A;  1RI0 A;  2EGE A;  4OB3 B;  2K9G A;  5LJ5 f;  4ELZ C;  5DLO A;  2EYQ A;  4PJM A;  1M4Z A;  2DA9 A;  3CME T;  2MCN A;  4LDW A;  2BE9 B;  1VQ5 T;  2J7I A;  4OB0 B;  1RI9 A;  1YCS B;  2OAU A;  2DEQ A;  2OTJ A;  1VQ7 A;  4ZTF A;  2DBK A;  3HRT A;  2LJ3 A;  5GAN j;  3GLX A;  3OYF A;  1K8A C;  1ZUK A;  4GLM A;  3CD6 A;  4Z89 A;  2EYW A;  4EMH A;  4XTU A;  1CSK A;  1KD1 C;  4C92 B;  4ME7 A;  5IXF A;  1SSF A;  1B07 A;  2D8H A;  3TQ7 P;  1K4U S;  4A4F A;  4RTY A;  4M77 C;  5GMK m;  4CC4 B;  4LDX A;  2CYZ B;  3L2Z A;  3M0P A;  2FPD A;  2X51 A;  2RI2 A;  1WHM A;  4M7D D;  3RUX A;  1UGR B;  1N6A A;  3NTI A;  2DTH A;  3M9Q A;  3L2Q A;  8AT1 B;  4HVU A;  2QDY B;  3EGD B;  3QXE B;  1KJW A;  5GAO r;  1IZ6 A;  1GCP A;  2QI2 A;  4RTZ A;  2DRM A;  2H8H A;  2QQR A;  4F7U A;  1F1B B;  1RLQ C;  1JQQ A;  4N4I A;  2PTK A;  2E4H A;  2RJD A;  1X2Q A;  4O5V A;  2MAM A;  3I56 A;  3DLM A;  3QO3 A;  4NS5 A;  2LJ1 A;  3OYY A;  5KYW A;  2LX7 A;  2KQW A;  2DL8 A;  3EHR A;  3LW5 E;  2DTO A;  1OZ3 A;  2P84 A;  2CP6 A;  2M1H A;  3H0H A;  2YSQ A;  1W70 A;  1QMC A;  3MJX A;  1GFD A;  2XDP A;  1XNI A;  1SRM A;  2NUP A;  4ZN3 A;  3G4S A;  3CCL T;  3CC7 T;  4AFZ C;  1YI2 A;  3MEV A;  1TWB A;  3SDZ A;  1NYG A;  1IGQ A;  5DLQ E;  3H8Z A;  4A4H A;  4NL2 A;  1FMW A;  2K5F A;  3HKS A;  3VS6 A;  3CCJ Q;  3MEU A;  2OTL Q;  1Y96 B;  3S3N A;  3KBG A;  2J6F A;  1IGU A;  3JCM P;  1LCK A;  1VQ9 A;  2V8I A;  1RUW A;  1KC8 R;  2E65 A;  1RAF B;  3TRE A;  2K3B A;  1CKB A;  2FO0 A;  3OW2 P;  2AK5 A;  4DBH A;  3REA B;  4M7A E;  1ABO A;  4M75 G;  4DOV A;  1RAI B;  3H9N A;  1N9S A;  2KDS A;  4FYW B;  3EHQ A;  4RTU A;  2EGA A;  3SEM A;  4E2F B;  2YUQ A;  4M78 C;  3UF4 A;  2GFU A;  4J6Y A;  4IIM A;  1AZG B;  1PG5 B;  1WHH A;  3T9N A;  2DD5 A;  2XMF A;  2HMA A;  1M30 A;  2QDL A;  5J26 A;  1KK7 A;  2FRY A;  2DXC A;  1UE9 A;  2WSC E;  1NEB A;  1PC0 A;  3WVE B;  1VQ6 A;  3WVD B;  1LJO A;  1AWX A;  1UGQ B;  2P0Q A;  5CQX A;  1JXM A;  2DZC A;  4JUV A;  2DFU A;  2DEU A;  1X6G A;  1TXQ A;  3I9Q A;  1R0C B;  2WSE E;  4F7U F;  2FG0 A;  3EH2 A;  1D09 B;  1E6H A;  1PKT A;  3LLR A;  4FSX A;  3CCQ A;  2K5I A;  3GF5 A;  2QXF A;  4Y28 E;  3NMZ C;  3UA7 A;  1VQL T;  1G8X A;  1MMA A;  4J9D A;  2X4J A;  5KYX A;  2DMO A;  4CI0 C;  2I0N A;  2COY A;  1M8V A;  3HL8 A;  3QDR B;  2DL5 A;  1YJN T;  1G3S A;  1FMK A;  2NYS A;  4R56 A;  4F14 A;  3E9G A;  2PZ1 A;  1TTH B;  2DXU A;  1SKU B;  1G3Y A;  1OPK A;  3JRZ A;  3MCA B;  3CC2 T;  4RKU E;  4FIB A;  2VVK A;  5GAM j;  3CBM A;  3A5Z B;  3CCL Q;  2JUF A;  2E6Z A;  1RAG B;  2AT1 B;  1X69 A;  2JMA A;  4OMP A;  3ZL7 C;  4MZP A;  1IHV A;  1OX8 A;  2M02 A;  2DIQ A;  4PJO E;  1IO6 A;  3JV3 A;  2DET A;  3JB9 D;  4FW2 A;  4Q5W A;  1BB9 A;  1C0M A;  2COZ A;  3VS7 A;  2RA2 A;  3KFV A;  1C6V X;  1YIT A;  3QYH B;  4M75 A;  4IUQ A;  2P0K A;  1VQN T;  2XKO C;  3P8B B;  4XQ3 A;  4J7F A;  1S72 T;  1YIJ T;  2MWP A;  4GBQ A;  3M4Y A;  4C8Q E;  1HYO A;  5FU6 C;  3HRU A;  2YLB A;  2EFI A;  2CZ0 B;  2LQ8 A;  3E2U A;  5IH2 A;  4J7I A;  1YJW A;  2DNU A;  3RER A;  2LZ6 B;  4RUG A;  4PLL A;  4HCC A;  1NPR A;  1SRL A;  3QWY A;  3OYB A;  1KC8 U;  2LT4 A;  4Z88 A;  4BD3 A;  3FLG A;  2LT1 A;  2ZPB B;  2OTJ T;  3GPL A;  1VQ7 T;  5KH6 A;  3OS0 A;  3PGG A;  4AFU C;  3OYJ A;  3D7S B;  4IIO A;  4A4E A;  1M90 C;  4M77 A;  2V1Q A;  4JZ3 A;  2PNI A;  1VQ4 Q;  3CD6 T;  2O4X B;  2VC8 A;  3OYK A;  4CC2 A;  1WZO A;  5I11 A;  3PMT A;  2EWN A;  2RJF A;  2DIG A;  3CCM A;  1M27 C;  2CUB A;  2RQW A;  2F69 A;  4C92 D;  1VQL Q;  1LVK A;  3BDU A;  4JJD A;  1R0B G;  2KMT A;  4M7A G;  2HSP A;  1LPL A;  2CH4 W;  3VJP A;  1YJN Q;  4PK4 A;  4XU2 A;  2CP5 A;  2AZS A;  5LJ5 j;  3CC2 Q;  5D7U A;  1RAA B;  2ED0 A;  1JO8 A;  1WXU A;  3BE3 A;  2LCS A;  5EC7 A;  1MMD A;  2LX9 A;  4F7U B;  3V8L A;  5FU7 B;  4P5N A;  3KUF A;  1RAB B;  2XIC A;  2J06 A;  2QQA A;  4EIK A;  4LDV A;  2CP7 A;  5KYW B;  2KAF A;  1X6O A;  1I0C A;  1GCQ C;  4UC4 A;  4XU0 A;  4C0Z A;  4C5E A;  2GGR A;  2XI9 A;  2F2X A;  4M75 F;  1LNX A;  3EGX A;  1WIE A;  4JDS A;  3I56 T;  5A0L A;  1WXB A;  4BDY A;  2L5Q A;  5CKB A;  4FSS A;  1KFZ A;  4PFP A;  2PUO B;  2VAS A;  2HD0 A;  1YIJ Q;  2YRD A;  3G4S T;  2A36 A;  1AHJ B;  1YI2 T;  2AKK A;  4O6J A;  1NM7 A;  3LGF A;  1D1A A;  3LWI A;  2EVR A;  4WCI A;  3Q1J A;  3R6N A;  4LN2 A;  3OA6 A;  2QQB A;  5GJW B;  1K9M C;  2Y90 A;  3OSV A;  1QWE A;  2OTJ Q;  3LWH A;  1VQ7 Q;  1ZQ1 A;  1WGS A;  2W10 A;  1YJ9 A;  5LJ3 h;  1VQ9 T;  1IRX A;  3OMC A;  1BKB A;  1M1K R;  1OUL A;  2QAZ A;  2ZPE B;  1WJS A;  4PJO G;  1ARK A;  5A0G A;  2QG9 B;  2KRO A;  1TUD A;  1B34 A;  1RAD B;  4J5Y A;  3X28 B;  4M7D C;  1WJQ A;  2CP3 A;  2LQW A;  2HKQ B;  2MOX A;  2GQV A;  4PKC C;  4Z8A A;  2WAC A;  1OX9 A;  3EAE A;  4QQ6 A;  3C12 A;  5IHN A;  3EFO A;  1VQ6 T;  2HQH A;  2D6F A;  4C8Q G;  3G6E Q;  5CIU A;  1WDX A;  2D8J A;  1ZSZ C;  1NYF A;  2JS2 A;  3L2R A;  5KYX B;  1K9A A;  3CCQ T;  1Q82 U;  2ECZ A;  1GBR A;  3C4S A;  2JW4 A;  3M0Q A;  2DYI A;  2QGF B;  2A37 A;  1Q95 G;  2E1H A;  2LRQ A;  1RLP C;  2GF7 A;  1U3O A;  4RCB A;  3I56 Q;  1UGV A;  5LJ3 d;  4AFS C;  2CRE A;  2EIF A;  1I1J A;  1UG1 A;  2X4Y A;  1QVF P;  4DEY A;  1BIA A;  1M2V A;  1FMV A;  4KGX B;  2KSS A;  3NTK A;  4LDU A;  4K11 A;  1TSF A;  5KE3 A;  1Y71 A;  2XHC A;  2F2W A;  2X35 A;  1MV0 B;  1ABQ A;  5HK3 A;  1JB0 E;  3UA6 A;  3CCV A;  1UFF A;  2L2P A;  2KK4 A;  4M75 B;  2HAX A;  1UJY A;  4CRI A;  3EH1 A;  2FEI A;  2QQ9 A;  3OYG A;  1YIT T;  3JCM J;  1PSF A;  4PJO A;  4FT4 A;  2FZK B;  4OMM A;  4HCB A;  5DM7 R;  3PVL A;  1VQM Q;  4OF1 A;  1HXD A;  5L8R E;  4M7A F;  4ZTJ A;  1I4K 1;  2A28 A;  3GNG A;  1YJW T;  4HVW A;  1XOV A;  1M8M A;  2J6O A;  2FZC B;  1QVF S;  4QVZ A;  2O31 A;  3SWN C;  2DJZ A;  4OMN A;  4EMK C;  2XID A;  5GMK l;  1WXT A;  2KY9 A;  4C8Q A;  4NOY A;  2WSF E;  1PHT A;  1UEB A;  1E7O A;  5FRN A;  3REB B;  3VV0 A;  4BAC A;  3C0C A;  3JCM h;  1ZX6 A;  2M16 A;  1UDL A;  1Q86 C;  4X9C A;  1YWP A;  1I8F A;  4J9B A;  1TU0 B;  5GAN d;  4IKF A;  4M77 E;  4E47 A;  2RI3 A;  2GBQ A;  1BI3 A;  4F04 B;  3CCQ Q;  4KBM B;  3BFM A;  2MYS A;  5CKF A;  3CCM T;  2L3P A;  3RIR A;  1VYT A;  3O8V A;  1OU9 A;  2JXB A;  4XTZ A;  5FRM A;  4ZGE B; 
#chains in the Genus database with same CATH homology
 1Y96 A;  3CCR A;  2DXC A;  3F70 A;  2WSC E;  5D6W A;  2L8D A;  3CME A;  3PFS A;  3PNW C;  2EQK A;  1BI1 A;  5GMK e;  3WVE B;  3SD4 A;  1VQ5 A;  2K4Y A;  4C8Q C;  5LJ3 e;  5GAN 7;  1VQ6 A;  2JTM A;  1LJO A;  3WVD B;  3WXM B;  1OI1 A;  4B9W A;  2FVU A;  4PL6 A;  2PU9 B;  4N0A A;  3LH0 A;  1UGQ B;  2P0Q A;  5CQX A;  2DZC A;  4JUV A;  2EQU A;  3FB9 A;  1R8O B;  2R5A A;  2EJ9 A;  5C6S A;  2CZ6 B;  1XQH A;  4BY6 C;  2WSE E;  5KCO A;  4JRQ A;  1K8A U;  3JCM f;  3HSB A;  4F7U F;  4MDX A;  4PNO A;  3FEO A;  3PIP A;  3M54 A;  5LJ3 g;  4JS5 A;  3LLR A;  1G3W A;  4E7H A;  1K73 C;  3ZFJ A;  4FSX A;  3OW2 A;  3CC4 A;  3CCQ A;  2B8A A;  4N4G A;  1VQP T;  1MGQ A;  3NFC A;  2K5I A;  4FT2 A;  3E9F A;  3GF5 A;  5J3B A;  1YCY A;  2CS7 A;  2QXF A;  3QUI A;  3QZ5 B;  4Y28 E;  3DLL A;  3OYH A;  1VQL T;  3CXC A;  3BW1 A;  2X4J A;  2LC4 A;  2JN0 A;  3DB3 A;  2RHU A;  4MDW A;  4PLI A;  5J26 A;  2QA4 T;  1VQ8 T;  2RO0 A;  1IRE B;  2K3Y A;  4PJO F;  5CKH A;  2A7Y A;  2P4T A;  4CI0 C;  4PJO D;  2D0Q B;  1M8V A;  5CCA A;  3HL8 A;  1WQW A;  1WNL A;  4HT9 A;  3QDR B;  4C92 A;  1VQ4 A;  1YJN T;  1G3S A;  2Y4X A;  1WQ7 A;  4M7D B;  3HFN A;  4C0G A;  2EJF A;  2IG0 A;  4R56 A;  1U1T A;  3E9G A;  3R6O A;  2XU8 A;  3OBY A;  3OY9 A;  2F5T X;  2LCC A;  3MET A;  2DXU A;  1G3Y A;  3G71 A;  4JLI A;  3JRZ A;  3MCA B;  4M78 F;  3SFM A;  3CCS A;  4RKU E;  1YHQ T;  3CC2 T;  4M78 D;  5CAI A;  4FIB A;  1OYX A;  3HHT B;  4F7U E;  3LYI A;  5GAM j;  4KT0 E;  4C0F A;  3CBM A;  3N5B B;  4N4H A;  1VQK T;  3G7Z A;  1N27 A;  4C5I A;  5AYF A;  3A5Z B;  3CCU T;  3FRN A;  3M58 A;  1ZBX A;  4JRP A;  1VUB A;  2V8K A;  2JUF A;  2E6Z A;  3X26 B;  3X24 B;  4LD6 A;  3RMQ A;  4C8Q F;  3MO8 A;  4HT8 A;  2V8J A;  4MZP A;  4C8Q D;  3PMI A;  2A3L A;  1VIF A;  2DXT A;  2DIQ A;  4PJO E;  3JB9 F;  4ZGJ B;  1QP2 A;  5CQY A;  4QQG A;  3JB9 D;  2JVV A;  3OB9 A;  3CC2 A;  1NZ9 A;  1UB4 A;  1Q7Y C;  1QVF A;  4Q5W A;  3OYE A;  5CK9 A;  2PUK B;  2EQJ A;  1Q81 C;  3VUB A;  1VQK A;  1QP3 A;  4M7A C;  2RHY A;  2DTI A;  2RH2 A;  3VKI A;  3L2W A;  2RA2 A;  1YJ9 T;  4MZM A;  4MML A;  4X9D A;  4D6W A;  1KHC A;  4A4K A;  4M7A E;  4M78 E;  1YIT A;  1KHI A;  2EKO A;  4C92 C;  3QYH B;  4M75 A;  3UT1 A;  1JJ2 A;  4IUQ A;  1NE8 A;  2YRV A;  3HPW A;  2P0K A;  4A53 A;  1M1K C;  1VQN T;  2XKO C;  3UDC A;  1KQ1 A;  3P8B B;  4XQ3 A;  3JSC A;  4J7F A;  1HK9 A;  2IVW A;  1YIJ T;  1S72 T;  2MWP A;  5GAN 6;  3M4Y A;  4M7A B;  3M5A A;  1G5V A;  4M77 B;  1NJI U;  1O9S A;  1NPP A;  5GAN e;  1QW1 A;  2XG8 D;  2ZPH B;  4C8Q E;  3DKM A;  4A4G A;  5FU6 C;  5GAM h;  3HRU A;  4XTY A;  3CCL A;  5FRM A;  2RD1 A;  2YLB A;  2EFI A;  2CZ0 B;  3V7S A;  5GMK h;  3CC7 A;  3VUZ A;  2LQ8 A;  4M7D G;  4J7I A;  3P8H A;  3OYM A;  1YJW A;  4QVD A;  3RER A;  2E70 A;  2QTX A;  5HKC A;  3TCJ A;  4OGE A;  5HK0 A;  3GIB A;  4PLL A;  4Z02 A;  1LOJ A;  4EDU A;  4ZN1 A;  1NPR A;  3RMS A;  3JCM Q;  1VQM T;  4HCC A;  4IUU A;  3OYB A;  4JJN K;  1KC8 U;  1M1F A;  2LT4 A;  4FL6 A;  5GAN g;  1N9R A;  1JBM A;  4BD3 A;  1M5Q 1;  2ZPI B;  3FLG A;  2LT1 A;  4J8O A;  4FU6 A;  3FC3 A;  2ZPB B;  3GNF B;  3L1A A;  5IAY A;  3C94 A;  5GAN 8;  3JAM E;  3GPL A;  1VQ7 T;  2OTJ T;  1ZHI A;  5KH6 A;  4DA4 A;  2K57 A;  2DZ9 A;  3KXT A;  2R58 A;  5J39 A;  3OYL A;  3CPF A;  4HKE A;  2FL7 A;  3PGG A;  4C0D C;  3OS0 A;  3M4G A;  3OYJ A;  3ME9 A;  4E7K A;  4A4E A;  4BUG A;  2C06 A;  3QJY A;  2ZZD A;  5CR2 A;  3FJP A;  1Q86 U;  3NTH A;  1M90 C;  4M7A A;  4M77 A;  2RM4 A;  4M75 C;  2E12 A;  2VXE A;  2PVG B;  4KUL A;  1X01 A;  4NL3 A;  3CD6 T;  2O4X B;  2FB7 A;  1Q82 C;  2VC8 A;  3CCJ T;  3EFS A;  2DO3 A;  3JCM V;  2R5M A;  4VUB A;  3OYK A;  4E7I A;  2QEX T;  2OTL T;  3PMT A;  4BI4 A;  2EWN A;  2RJF A;  2DIG A;  3OS1 A;  2E5Q A;  2HQX A;  2RHI A;  3CCM A;  4C92 F;  2XDB A;  3H6Z A;  2F69 A;  4C92 D;  2XK0 A;  2X4W A;  5GAM f;  3JB9 I;  1FWZ A;  3BDU A;  5EG2 A;  3JCM c;  3OQ5 A;  3QSU A;  2BUD A;  3QZ9 B;  2KMT A;  1U8R A;  5GAN 2;  4M7A G;  4M77 G;  2LNV A;  4QQD A;  3LGL A;  3VJP A;  4XU2 A;  1KD1 U;  3V7C A;  4R55 A;  2R57 A;  5C0M A;  3JCM e;  4OVA A;  2BIV A;  3L42 A;  3QYG B;  3HP9 A;  4XU1 A;  2E64 A;  4RMO A;  2DKG A;  2EQM A;  3SWN B;  5LJ5 j;  2DAQ A;  4EMK B;  3HRS A;  3JB9 J;  1WJR A;  2LX9 A;  2O4X A;  4J6W A;  2E41 A;  3V8L A;  5FU7 B;  4F7U B;  4P5N A;  3KUF A;  3SB2 A;  5I21 A;  2F5K A;  5I2S A;  4FM4 B;  1Y07 A;  2M0O A;  3JCM d;  2VYT A;  2XIC A;  5A0D A;  2QQA A;  3V8J A;  4C92 E;  2ZPF B;  3JCM g;  1D3B B;  4ATO A;  1K73 U;  3CCV T;  2NLU A;  1VQP A;  5GAO p;  4LDV A;  3VU3 C;  3G6E A;  3CBP A;  1VQO T;  2KAF A;  1X6O A;  3RES A;  2YLC A;  3J80 E;  3GP8 A;  1I5L A;  4UC4 A;  4N0A C;  3RKY A;  4XU0 A;  4C0Z A;  4C5E A;  1VQL A;  4PJO B;  2CZ7 B;  2PQW A;  2XI9 A;  4BI8 B;  1W4S A;  2QA4 A;  3L2V A;  2O01 E;  4JS4 A;  4M75 F;  5GMK j;  1VQ8 A;  1LNX A;  4M75 D;  5LJ3 j;  4JDS A;  1U1S A;  3I56 T;  4BI3 A;  5A0L A;  5GAN h;  5CVI A;  2ZCF B;  1OZ2 A;  4J83 A;  4BDY A;  3QPH A;  1KQS S;  4ZGD B;  1O75 A;  2LQK A;  1YJN A;  3JB9 H;  2H3J A;  2Y4Y A;  2JTF A;  2L5Q A;  5CKB A;  2DVE A;  3A8L B;  4M78 B;  4WF2 A;  3UPU A;  3PTA A;  2PUO B;  2GCX A;  1X75 C;  2VGN A;  2P0P A;  3OYC A;  2HD0 A;  4L5G A;  4QVC A;  3C95 A;  4IUV A;  3QII A;  1YHQ A;  4XTX A;  4RG2 A;  2HQE A;  4OGC A;  5LJ5 h;  3G4S T;  4YTL A;  2XDD A;  3MEW A;  2DXB A;  4DQ2 A;  1AHJ B;  4M7D A;  3CCU A;  3URG A;  3RKW A;  3EFR A;  1YI2 T;  3A8G B;  4C8Q B;  3I55 T;  1JRI A;  1B34 B;  4OB2 B;  2RI5 A;  4O6J A;  2M9U A;  2VUB A;  3LGF A;  4MZT A;  3V8K A;  5GAO n;  2VV5 A;  5GMK i;  3LWI A;  3OYA A;  1QVP A;  3ER0 A;  3E1S A;  3FDR A;  2CZ1 B;  3Q1J A;  4M75 E;  1V29 B;  3ASK A;  2RK1 A;  4QW2 A;  4EMG A;  1N8R U;  4C5G A;  1W2B S;  5CO7 A;  1GXI E;  4BE2 A;  4GY5 A;  4IUT A;  3MP1 A;  5IT9 E;  3M53 A;  5D6X A;  3BDL A;  4F7U G;  3OA6 A;  4E7L A;  2QQB A;  1K9M C;  4JRK A;  3L2U A;  2Y90 A;  1Q81 U;  2DD4 A;  3OSV A;  3CBO A;  3X20 B;  3LWH A;  3QG1 A;  1ZQ1 A;  4EPC A;  1WGS A;  1YJ9 A;  1G3T A;  2BKD N;  5LJ3 h;  1VQ9 T;  1KQ2 A;  3OMC A;  1BKB A;  3OS5 A;  2EJG A;  2HBP A;  1XTD A;  2YHT A;  3UWN A;  2ZPE B;  1WJS A;  1UGS B;  3E19 A;  1UGP B;  2LDM A;  4PJO G;  1M1K U;  1KC8 C;  1VQN A;  5A0G A;  1I81 A;  1S72 A;  3CPW S;  1QVG S;  1YIJ A;  5CKE A;  2LTO A;  4RG8 A;  1B34 A;  1YBY A;  3MP6 A;  4J5Y A;  3CCE T;  3M59 A;  1RI0 A;  3X28 B;  4OB3 B;  2VGM A;  4M7D C;  1WJQ A;  2QQS A;  3M56 A;  5LJ5 f;  5GAN 5;  4ELZ C;  4M78 G;  5HY6 A;  3OS2 A;  5DLO A;  3OYN A;  2GQV A;  4PKC C;  2LCL A;  2EYQ A;  4XAX B;  1M4Z A;  1M9S A;  2WAC A;  5D6Y A;  2JOY A;  3CMA T;  3EAE A;  1VQM A;  3CCR T;  2D9T A;  3A8O B;  1WPY A;  4QQ6 A;  5FLX E;  3CME T;  4IUR A;  3C12 A;  4LDW A;  1VQ5 T;  1VQ6 T;  1Y7X A;  2L3R A;  4Y91 A;  4OB0 B;  4LD9 K;  3M55 A;  4V2S A;  2OAU A;  2D6F A;  2DEQ A;  4C8Q G;  2OTJ A;  2E10 A;  1VQ7 A;  4ZTF A;  5CIU A;  3S3M A;  3GOX A;  2MF2 A;  3HRT A;  5KCH A;  2MI6 A;  3JB9 G;  5GAN 4;  1MHN A;  3L2R A;  5GAN j;  3GLX A;  3OYF A;  4B9X A;  5LJ3 f;  1K8A C;  3DB4 A;  1M90 U;  3J7A F;  3PIO A;  2L89 A;  5FRO A;  2PVD B;  5GAN 3;  5GAM e;  1DJ7 B;  3CD6 A;  4XTV A;  3CC4 T;  3CCQ T;  4EMH A;  4XTU A;  1Q82 U;  1KD1 C;  3CCJ A;  2OTL A;  2QEX A;  4II1 A;  4C92 B;  3C4S A;  2EAY A;  2K5L A;  2MMP A;  3TU4 K;  1FX7 A;  4ME7 A;  1BI0 A;  1SSF A;  2E1H A;  1FXX A;  2DK3 A;  2LRQ A;  5GAM d;  2GF7 A;  1TH7 A;  3LX7 A;  2RK2 A;  3JCM W;  5GAM g;  3MEA A;  4OMF B;  4RCB A;  3QKJ A;  4M77 C;  5LJ3 d;  4A4F A;  5GMK m;  2PVO B;  5FU6 B;  3J81 E;  2CYZ B;  1VQ4 T;  4LDX A;  3L2Z A;  1PSE A;  5IN1 A;  2EIF A;  4ZGE B;  2X4Y A;  2RI2 A;  1RL2 A;  1BIA A;  4M7D F;  3G71 T;  3CCS T;  4M7D D;  3RUX A;  2RHX A;  3CEY A;  4E7J A;  1KQS A;  1P92 A;  2G3R A;  2KSS A;  2ZPG B;  4BE1 A;  3NTK A;  4LDU A;  1UGR B;  3OBW A;  4XTW A;  4JRI A;  1N6A A;  3OYI A;  4C5H A;  3NTI A;  3OW2 S;  5KE3 A;  2RB6 A;  3QHS A;  2DTH A;  3M9Q A;  3JCM b;  3L2Q A;  4KUD K;  1Y71 A;  2XHC A;  5LL6 S;  2X35 A;  4BDZ A;  5HK3 A;  3S6W A;  2QDY B;  3SWN A;  3CXC S;  4X34 A;  1JB0 E;  3OMG A;  3QBY A;  2FHD A;  4EMK A;  4C0D B;  5GAO m;  3QXE B;  3CCV A;  5GAO r;  1IZ6 A;  2QI2 A;  2QQR A;  4F7U A;  3M57 A;  2ZGW A;  2KK4 A;  3P8D A;  1VQO A;  4M75 B;  5KE2 A;  2HAX A;  4XU3 A;  2AHJ B;  4N4I A;  1EIF A;  2RJD A;  1H64 1;  2RJC A;  1W2B A;  1D3B A;  4O5V A;  2MAM A;  3TEE A;  4CRI A;  3I56 A;  3DLM A;  4HA8 A;  4M7D E;  3BY7 A;  3QO3 A;  4NS5 A;  2KVQ G;  2QQ9 A;  3OYY A;  3OYG A;  4BE0 A;  1YIT T;  2KQW A;  3JCM J;  3LW5 E;  2DTO A;  1PSF A;  4PJO A;  1OZ3 A;  4C92 G;  4FT4 A;  2MWO A;  3JCM X;  1N8R C;  5CKD A;  4HCB A;  5DM7 R;  2M1H A;  4A54 A;  1VIE A;  3X25 B;  4BY6 B;  1NJI C;  2XDP A;  2K3X A;  1XNI A;  1Q7Y U;  4OF1 A;  1HXD A;  1M1G A;  5L8R E;  4ZN3 A;  4M7A F;  3VYH B;  3G4S A;  4M77 F;  3CCL T;  2HNI A;  4ZTJ A;  4M7A D;  4M77 D;  1I4K 1;  3CPW A;  1QVG A;  3CC7 T;  3G6E T;  2X4X A;  2VXF A;  3MEV A;  3MHX A;  4M78 A;  3SDZ A;  3I55 A;  1YI2 A;  1KG1 A;  3GNG A;  4OB1 B;  1YJW T;  2JZ2 A;  5DLQ E;  1XOV A;  3H8Z A;  3A8M B;  3MP8 A;  2LVM A;  4NL2 A;  4A4H A;  2RJE A;  4HCZ A;  1QVF S;  4QVZ A;  5GAN f;  3SWN C;  2DJZ A;  4EMK C;  2DPP B;  2K5F A;  2XID A;  5A2Q E;  2I2L A;  5GMK l;  1BIB A;  2KY9 A;  4RCC A;  3PT9 A;  3VYG A;  4NOY A;  4MMK A;  3HKS A;  2CKK A;  2WSF E;  4GLK A;  5FU7 C;  4C8Q A;  1UEB A;  2GFA A;  3MEU A;  4ELY C;  4LDY A;  1Y96 B;  3A8H B;  3INZ A;  3FIF A;  2RHZ A;  3S3N A;  4DOW A;  3KBG A;  4J6X A;  1K9M U;  1JJ2 S;  5FRN A;  3VV0 A;  4BAC A;  3ZBD A;  3JCM P;  1VQ9 A;  2V8I A;  3JCM h;  4IUP A;  3ZEH A;  2FYK A;  5I2M A;  2M16 A;  1Q86 C;  3QJ6 A;  2E65 A;  4X9C A;  3TRE A;  2XD0 A;  1I8F A;  2E6N A;  4PJO C;  2CGH A;  4XK8 E;  5GAN d;  4IKF A;  4M77 E;  4M75 G;  4DOV A;  4BB7 A;  4E47 A;  4L6V 5;  5DY9 A;  5LJ5 e;  5M9O A;  2RI3 A;  3HFO A;  1N9S A;  1BI3 A;  2KDS A;  4KUI A;  5GAO l;  4KBM B;  3BFM A;  4TVR A;  5CKF A;  3CCE A;  3CCM T;  4OP0 A;  2K2V A;  3RIR A;  3S3O A;  5GAO q;  1BI2 A;  4M78 C;  2JNG A;  5LJ5 d;  3O8V A;  3OYD A;  3AHU A;  1H3Z A;  3RKX A;  2GFU A;  4J6Y A;  3T9N A;  5LJ5 g;  1BYM A;  3V7R A;  3OSS C;  2DD5 A;  4XTZ A;  3CMA A;  4L59 A;  4JLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...