4L59A

Crystal structure of the 3-mbt repeat domain of l3mbtl3 and unc2533 complex
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
313
structure length
307
Chain Sequence
WCWASYLEEEKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFEVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYNVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein 3
publication title The structure-activity relationships of L3MBTL3 inhibitors: flexibility of the dimer interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 80
structure length 307
sequence length 313
ec nomenclature
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l59A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l59A03
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l59A01
3META 4N4IA 1KHCA 4UC4A 3S6WA 4ZTFA 3OQ5A 2K3YA 2M1HA 2RJEA 2YRVA 3FC3A 3OYFA 3L2QA 2X4XA 2R58A 3MEAA 1SSFA 2LTOA 3QIIA 2RI5A 2GFAA 5D6WA 5KE2A 5J26A 2JTFA 3QKJA 3E9GA 3OS0A 4E7KA 3S3OA 1MHNA 1WJSA 3ASKA 2BIVA 2RHYA 5KCHA 2F5KA 2WACA 2M16A 4IUTA 5IAYA 3OYDA 3GOXA 4BE0A 3LX7A 4LD6A 3Q1JA 2RJDA 2DIQA 3EAEA 3OYAA 2LDMA 4N4HA 2PQWA 3FLGA 2LRQA 4BDZA 2EFIA 2RO0A 3LGLA 2RHUA 2R5MA 4QQ6A 4QQGA 3OYGA 3M9QA 3MP6A 3OMGA 4PLLA 3F70A 4EDUA 2RHIA 2EQJA 4B9WA 2RI2A 2BUDA 2X35A 3L2WA 4ZTJA 4C5HA 5D6XA 3UT1A 4BACA 2R5AA 4X34A 3OYHA 2BKDN 2LCCA 3P8DA 5CIUA 4II1A 3MEWA 1N27A 2EKOA 4BDYA 2R57A 2K3XA 4L59A 3OYJA 2RJFA 2O4XB 3OB9A 3MP8A 2P0KA 2QQSA 2M0OA 3NTKA 1OI1A 4Z02A 2GF7A 4QVZA 4A4FA 1XNIA 3CEYA 4GY5A 4FL6A 3DLMA 4BE2A 1WGSA 3QBYA 4NS5A 3ME9A 4PL6A 4QW2A 3L2VA 3S3NA 4QQDA 2HQXA 1RI0A 3DB3A 1OYXA 3H6ZA 3LLRA 1G5VA 2E6NA 3O8VA 4FU6A 3OYNA 4RG2A 4E7HA 3OS2A 3MO8A 2GFUA 4PLIA 4A4EA 4C5GA 2EQUA 4C5EA 5C0MA 3PMTA 3BDLA 5KCOA 3L2RA 3PNWC 5FROA 2DAQA 4HCZA 4IUQA 1WJQA 3PMIA 2NLUA 2QQRA 2JZ2A 4IKFA 4A4HA 2CKKA 5M9OA 2FHDA 3MEVA 3MEUA 1OZ3A 3FEOA 3FDRA 3L2UA 4A4GA 4CRIA 5KH6A 4BD3A 4E7JA 2RHZA 3SD4A 3OYMA 2RJCA 2X4WA 3MP1A 3OMCA 4IURA 3ZEHA 5FRNA 2RHXA 2DIGA 2L3RA 5C6SA 3OYCA 3OA6A 3LH0A 3OYLA 2MWPA 2XDPA 3L42A 5J39A 2EQMA 3P8HA 3C4SA 3OYEA 2LVMA 2RI3A 3DB4A 5FRMA 1WJRA 3OY9A 2VYTA 4C5IA 2O4XA 1OZ2A 3LYIA 2E5QA 2L89A 3NTHA 4OVAA 4IUPA 2D9TA 4Q5WA 3UWNA 4BE1A 2L8DA 4E7IA 2HQEA 1H3ZA 3OYIA 3H8ZA 4E7LA 4IUVA 4IUUA 3KUFA 3OYBA 3E9FA 2G3RA 3QJ6A 5D6YA 5KE3A 3OS1A 4N4GA 2MWOA 2X4YA 2B8AA 3S3MA 4B9XA 3NTIA 3LGFA 2XK0A 3OYKA 5IN1A 2EQKA 2IG0A 3PFSA
chains in the Genus database with same CATH superfamily
1VIEA 4LDYA 1O75A 1D0ZA 2M1HA 4DEYA 1B34A 4F7UA 3MEAA 3M59A 4FT2A 3S3MA 5LJ3h 3RDVA 3EGDB 2DL4A 2JUFA 5CCAA 5KYYB 2DIQA 2LCLA 4N4HA 2E1HA 3LGLA 2RHUA 2R5MA 2J7IA 4ESRA 1OOTA 2AKKA 2BUDA 4J7FA 3LW5E 1BCMA 1S72A 1KC8U 5KYWB 2OTJT 3CCQT 4RCCA 3M0TA 4DOVA 2QDLA 1BK2A 3CCUQ 4M78B 4FSXA 3CCEQ 3EGUA 2RPNA 2MPXC 3OW2S 3MKDA 1VQ9Q 1YFNA 4MDXA 4O5VA 1AWXA 3CPWP 3EGDA 4ME7A 3EG0A 1X6OA 1YCYA 3QWYA 3FDRA 4BI8B 1YWOA 4GBQA 4E6RA 3ZEHA 2H3JA 2F69A 4AG2C 5A2QE 2P84A 4M7AE 1K76A 2DKGA 3H0FA 3PIOA 2DERA 4ZN1A 2LQNA 2DZ9A 3EFRA 5CAIA 2K79A 1OPLA 2E3HA 2YWWA 3M4GA 3CCRT 4C5IA 1J3TA 1KJWA 2YUNA 2JVVA 1PRMC 2QQBA 4IUVA 1X2QA 3OS1A 5D6YA 1CKAA 4ZNXA 3I35A 4J9CA 1N8RU 3CC7T 1D09B 4C8QD 2RK2A 3OYKA 1YCSB 5LJ3e 4FM4B 5GJWB 2DM1A 1YP5A 5LJ3d 3EG3A 2CSQA 4EIKA 2OAUA 1RUWA 1VQ5T 3FC3A 3UPUA 4BI4A 3A8MB 2RI5A 1KC8C 2KR3A 5GAN6 3M53A 3A8HB 3I55A 2WSFE 2JTEA 2JNGA 2C06A 3C12A 4HT9A 4EDUA 1UJYA 3EG9A 2XG8D 1BKBA 3L2WA 3VS4A 4X9CA 4XTYA 3CCMA 3I56A 2DRKA 3HFOA 3HTRA 1BI3A 5GAMg 1VQ4Q 3V7SA 4L59A 2F5TX 1NM7A 2P0PA 2HL3A 5LJ5j 1NJIR 3FIFA 1W4SA 4J5YA 5KYNA 1NLPC 2I0NA 2JM9A 1OYXA 4AFZC 1UGPB 2EJGA 1NE8A 2E10A 2F2XA 3I5SA 5GMKj 4CI0C 2DL3A 3QHSA 2L2PA 4IUQA 1G8XA 1N5ZA 1GCPA 1KHIA 4JJCA 1K0SA 2H3EB 4KRTA 4D8KA 4DOWA 2RN8A 1X75C 1WHLA 1QP2A 1S72T 2OTLQ 2MIOA 4LXCA 2IIMA 3OYCA 4HVWA 4KBMB 5A0GA 3LH0A 3FJ5A 1H92A 1K0XA 2DA9A 2LVMA 1ZX6A 2RI3A 3WXMB 1Q86U 3LYIA 4AT1B 1JU5C 2KAFA 1M5Q1 1VQLQ 8ATCB 2FB7A 2JMCA 2VGMA 3GBQA 4LUEA 2EGCA 5KYXB 3PTAA 1FMKA 4M77F 4DBFA 5KCHA 1UE9A 2WACA 3OYDA 5IXFA 1ZBXA 4FT4A 4DQ2A 2LDMA 3EHQA 2QA4A 1PSEA 2VUBA 4BDZA 3GPLA 2RO0A 3VS6A 2NUTB 1R77A 4J6WA 3F70A 1VQ6Q 6AT1B 1YI2T 4FYXB 2OX7A 3VS7A 1TUCA 4M77C 3ZL7C 2A3LA 2BKDN 1KD1U 1JJ2P 5LL6S 4BB7A 4PJOB 1YITT 1D1AA 1W70A 4GLKA 1WQ7A 2QQSA 2M0OA 3VUZA 4OMNA 5GAMf 4M4ZA 3MHXA 3JCMc 3BFMA 5KYXA 1VYVA 4PJOE 1K8AR 3H6ZA 3RNJA 3TEEA 4QKUA 1BI0A 2KSSA 1D0YA 1X6GA 1V29B 2OJ2A 3L2RA 3CC2Q 1PNJA 1QWFA 2JZ2A 4Z8AA 2CUDA 2CZ0B 2NUTA 1GCQA 2ZPBB 3CCMT 4CRIA 3HKSA 4OMMA 3RMSA 5I2SA 5GAOp 5A0DA 3QPHA 5KYUB 3CCEA 3M0RA 4RTZA 4DEXA 4M77G 3DB4A 1VQ9A 4RTTA 1M90U 4PJOA 2YSQA 3DKMA 2YUOA 1SRMA 5D7UA 2GGRA 2JS0A 2Y4YA 4E7LA 1YIJA 3NTIA 4AG1C 3QSUA 3LGFA 3QZ9B 1SRLA 4ZGEB 2VC8A 2F2VA 2CDTA 1VQMQ 2X3WD 5FU6B 2K5LA 2A08A 3OYFA 1ACMB 2QI2A 4OGCA 1G3YA 3CQTA 3JCMQ 2AKLA 3QIIA 2P4RA 3TREA 3JB9D 2GFAA 4N0AC 4E7KA 2RHYA 3GOXA 2FRWA 2RJDA 5GJVB 1OULA 2JN0A 5GMKl 1RAAB 3U23A 4A54A 1X01A 5KYUA 5CO7A 2DLPA 2KXCA 3MP6A 2QEXT 5CKEA 3V8JA 3RESA 3PGGA 3HL8A 2PU9B 2KE9A 2O88A 3JB9J 1KSWA 5LJ5g 2YDLA 3M0PA 3A8OB 2K6DA 3G4SQ 2DX1A 4CC3A 2RNAA 4GY5A 1I1JA 3PE0A 2DETA 4BE2A 2DD5A 4CC7A 1M27C 3ME9A 4M75E 3NHNA 3DB3A 1SF9A 3CCLA 4RG2A 5IHNA 1T0JA 2QA4T 3OSSC 2L3SA 1DJ7B 1WA7A 2QTXA 4OMFB 1OEBA 4E7SA 2W10A 2RQRA 1WJQA 2ZPGB 1W2BP 1D3BB 1H641 1ZUUA 4MMKA 3VYGA 3THKA 1RACB 2KMTA 3OBYA 3SD4A 2X4WA 2A36A 1VQ4A 2J6OA 3NMZC 2QTVA 1W6XA 2PVOB 1PG5B 1TUDA 4NL3A 2EQMA 3P8HA 3CC4Q 1NJIC 1WDXA 1WHGA 5GAMe 5GAMd 1WJRA 4M75A 4JDSA 3TVTA 4PJOD 1YJNA 2D9TA 4EMKB 4OF1A 5KE3A 3CBOA 3SWNB 3JSCA 1KFZA 4EMGA 4HKEA 3JCMP 1GRIA 1JXMA 3S6WA 1M1KC 2K3YA 3REAB 3SHWA 2RQTA 4KUDK 5HK0A 2ESWA 1NEGA 3V8KA 4J6XA 2O9SA 1G2BA 3H9NA 3GP8A 4M7DC 2AIRB 2LJ0A 2KYBA 2DVEA 1VQLA 4PFZA 2EW3A 2V1QA 1M4ZA 1YIJT 1B7TA 3PVQA 4EMKA 1M9SA 1AEYA 4Y28E 4F14A 2ED0A 3SWNA 2AHJB 2EVRA 3CCJT 1RI9A 2RQWA 5LJ5f 2HEQA 3FRNA 5CQXA 2EJFA 3J81E 3DLMA 1M1GA 2DTIA 5CVIA 2DXBA 2QASA 2QG9B 2EPDA 3O8VA 1PHTA 1YJWQ 2DNUA 1BI2A 4A4EA 4C5EA 1N8RR 1YWPA 3JRZA 4HCZA 4HCKA 2NLUA 1N9SA 2QQRA 2PNIA 4RTYA 3OW2P 2MAMA 2QQAA 4OGEA 2RA2A 4M7DB 3M54A 1E6HA 3CD6T 1QKXA 1WPYA 1W2BS 3JCMW 2A28A 1ZBJA 2PUKB 2MWPA 2XDPA 4ELYC 3LWIA 2M0YA 4L5GA 2ROTA 1VQOT 2C0IA 1K9MR 4M75D 2D0QB 1K8AC 4AMCA 4K11A 3CCLT 2IPOB 1ZHIA 4IUUA 2DBKA 3URGA 5GAOq 3OYBA 3CC2A 2ECZA 3CCVQ 2CP7A 1QVFP 3AT1B 4NOYA 3R6OA 1ZA2B 1Q7YU 2E3IA 1VQPT 3HRSA 1W2BA 1GFDA 4C0FA 1VQ4T 5HY6A 2LTOA 3M57A 1UGVA 1UUEA 2JTFA 1LNXA 4LDWA 2B86A 3EFOB 2NUZA 1GBQA 3CMEA 2GQVA 5GAN4 3EFSA 3UF4A 1YJNT 2VVKA 3CXCP 1NYGA 3OYYA 2FL7A 3KBGA 4MZPA 1VQMA 1VQ8Q 4II1A 5EG2A 4BUGA 4YTLA 1VQ7Q 4M7AF 1FMVA 2LT4A 2ED1A 3OS5A 1OI1A 1B07A 1ZSZC 4Z88A 1RAHB 3L2VA 1Q86R 3G6EQ 3X26B 1K73C 2KVQG 1AWJA 2PTKA 3OBWA 3PNWC 4R56A 2F2WA 1XTDA 3EFOA 2SEMA 2E12A 1D1BA 2KRMA 2YLBA 3L2UA 1KQSS 1RAEB 1I0CA 2RJCA 3OMCA 1KQ2A 2YUPA 1M2OA 3G4SA 4JLIA 2FYKA 2XMFA 4JRPA 3H0IA 1QCFA 2RM4A 4M78E 5LJ5e 5LJ5d 3OY9A 2D0NA 1ZQ1A 2YRCA 5KYYA 4OVAA 2L89A 4BE1A 4FW2A 3JB9I 3OYIA 2GQIA 2LNVA 2A0FB 2KEAA 4KH1B 4DA4A 3AHUA 5IN1A 4PK4A 2YXYA 1KQSA 1KD1R 2HAXA 4UC4A 4N4IA 1QVFS 3OW2A 4RTVA 1K1ZA 1IZ6A 5KYWA 4M7AG 1YHQQ 3CC4A 4M78A 4LD6A 4JPBW 1EIFA 1CKBA 1O9SA 1JO8A 1MNEA 3PT9A 2YT6A 1X27A 3JCMb 4J9HA 1U06A 2K9GA 2X9HA 3OMGA 1WI7A 3HRTA 1MV3A 1RAIB 4J9DA 1I5OB 1QVFA 4J9FA 2K2VA 1FX7A 3CXCS 2O9VA 1LJOA 2PZ1A 3X24B 1VQKA 4JUVA 1N27A 2FG0A 2R57A 2K3XA 1H8KA 2DTHA 2EQIA 2M9UA 5DM7R 1KQ1A 1M30A 3CEYA 3NGPA 1K9MU 4FL6A 1M90R 2QK0A 2D1XA 4NS5A 4WTOB 1SHGA 3LLRA 2FZKB 2VGNA 2VWFA 1EZZB 4E7HA 4KUIA 1E6GA 1U5SA 4KH0B 2GFUA 1UFFA 2E5KA 1XJWB 4XU0A 3CMET 4XTXA 1R0CB 1IGUA 4HA8A 2EYYA 2CP6A 1H3HA 1YJ9Q 2K3BA 3CXCA 1VQNQ 3JCMJ 4JLGA 1X2KA 5GANj 1D0XA 3WVDB 2DIGA 2Y90A 2P4TA 4RMOA 2VYTA 4LE9A 1YJWA 1EFNA 2BTTA 2BZYA 2PVGB 1QCOA 2YHTA 2RB6A 1MMAA 2DEUA 3CCSA 5FU7C 2G3RA 2BE7D 1N8RC 1RAGB 3G71Q 2XK0A 3G7ZA 3M4YA 2CYZB 4C0ZA 1QVGS 2GTOA 5IT9E 2KT1A 3QG1A 1JB0E 3E9GA 4MZTA 1M2VB 3G4ST 4LN2A 3TCJA 4M78D 4R55A 3BDUA 3RIRA 4V2SA 2LRQA 4X1VA 1Y07A 1BI1A 2VXEA 3M0SA 3CCVA 1M3AA 3UA6A 1SPKA 3M58A 2EAYA 2X35A 4OP0A 3OYHA 1PKTA 5LJ3j 1UJ0A 1QVGA 1Y57A 1WXUA 3O5ZA 4XU2A 1ARKA 2RF0A 1AHJB 2RJFA 3OB9A 2OTJQ 3CCQQ 5FU7B 3M5AA 1VA7A 1UGQB 2E41A 3QBYA 1RI0A 1WQWA 1I5LA 4KGVB 2E6NA 3VKIA 1SKUB 2V8JA 4J9IA 3NPFA 1M2VA 4XU3A 1UGSB 1QW1A 2FZGB 2QQ9A 4RUGA 3VUBA 1TUGB 5A0LA 2CKKA 2JTMA 1BU1A 3H0HA 4QT7A 2FO0A 1VQ7A 1SG5A 1OX9A 2K2MA 3A8LB 3QUIA 2KGTA 1VQKT 5AYFA 3L42A 1PM3A 1Y71A 2HCKA 5J39A 2GNCA 3I55T 1QQJA 2DJQA 4BI3A 3G6EA 3IQLA 2LNHB 1Q86C 2MF2A 3E2UA 2HBWA 2LJ3A 5CKFA 3CCRQ 2J05A 2HQEA 2M02A 2CSIA 2VXFA 1FMWA 2LMJA 2MWOA 3I56T 4A53A 1TU0B 3CC7Q 3CCUA 3TU4K 3JCMV 8AT1B 2NWMA 2EGAA 1M8VA 2CREA 1VQ5Q 4BY6C 2DPPB 3FJPA 4M77B 3VRZA 4IUTA 1HK9A 3ZBDA 2VASA 5GAMh 1OV3A 1UG1A 4JZ4A 5FWBA 1SSHA 4QQGA 4PLLA 2EGEA 1NZ9A 3CCST 4JRQA 2ZCFB 1BIBA 4C5HA 4C92F 4FYWB 2QGGA 1BYMA 3LWHA 3A1PA 2CS7A 2HL5C 1KD1C 2F1LA 3QDRB 2JMAA 2D8HA 3KFVA 3VRYA 3H41A 3MP8A 4X9DA 3VV0A 3NTKA 2HNIA 4OB0B 1YHQA 5I2MA 2K4YA 2YRDA 2W0ZA 3L2ZA 2KNBB 1OPKA 2EYZA 4C92C 2RH2A 2KY9A 1B3QA 4M77A 4J83A 1UECA 2GTJA 4WF2A 3BDLA 1FYNA 2L0AA 1C6VX 3QDFA 1Q7YR 4XK8E 4IKFA 5GANg 2JS2A 2EJ9A 4R0KA 1JQQA 4L6V5 2DD4A 3J7AF 3JCMf 2YUQA 2D6FA 1TS9A 1S72Q 3OYLA 3VJPA 2VV5A 4KT0E 4M75G 1M90C 2J06A 2K57A 1QMCA 2ATCB 3TSZA 1VOMA 1Q81U 1PC0A 2J6FA 3QO3A 1YJ9A 4HCCA 1C0MA 2CZ1B 1OX8A 4FYVB 4J6YA 4JZ3A 1VQNA 4C92G 2K7AA 1KHCA 1TH7A 1IREB 3OQ5A 2YRVA 2OI3A 1QP3A 2P0QA 5DY9A 2DK3A 1GFCA 1GBRA 1Q82U 4GLMA 2F5KA 1WX6A 5CR2A 3Q1JA 5L23A 1UTIA 4CC4B 1HD3A 4IIOA 3G6ET 1MMDA 2FZCB 3DLLA 2RHIA 3SDZA 2DL7A 4B9WA 2PVDB 3SEMA 3G71A 3CMAQ 5EC7A 2SRCA 2OTLA 2X4JA 4ATOA 4N0AA 1YI2Q 1D3BA 2R5AA 1MMNA 2LCCA 1UB4A 2GCXA 5CKBA 3CCUT 3I5RA 3MEWA 3R6NA 3CCET 2LCSA 2XKOC 4BDYA 4A4FA 1YITQ 2ZAEA 1VQ9T 2MOXA 1BIAA 1WGSA 2CZ6B 2OAWA 3S3NA 2DRMA 4XTZA 2HQXA 4C8QF 1UGRB 4A63B 3OS2A 3JB9H 2DJZA 4RTXA 5GAOn 4M77D 2L3PA 5KCOA 3JAME 4F7UF 4HCBA 2QAZA 1JXOA 3VS3A 5GANf 4XTUA 2XIDA 3SB2A 1T3SA 3CCMQ 4C8QC 2OTJA 2IVWA 3FB9A 4PJLA 2L3RA 3CCQA 5CKHA 3EHRA 4PFPA 1HYOA 2COYA 1WZOA 2LT1A 3OYEA 4HVUA 2HMAA 2ZZDA 2XHCA 1VQ6A 3HRUA 5I22A 2E64A 1KQSP 4HXJA 3EG1A 3CBMA 3UWNA 3QYHB 3KXTA 3EH1A 3KUFA 2FPEA 1OQKA 2E65A 1NLOC 3RUXA 1PKSA 2ABLA 3HPWA 1I07A 3GNFB 4JRIA 1Y0MA 4M7DE 1MUZA 1RADB 2XU8A 1WJSA 1QCNA 1E7OA 4RCBA 3LX7A 1AZGB 1G83A 2FEIA 3C95A 5LJ5h 4C0DC 3CCRA 2DL5A 4C8QG 4PJJA 2V26A 5DLOA 3QJYA 1Y7XA 1N9RA 3VU3C 2HBPA 4F7UG 1AZEA 2FVUA 1M3BA 3UT1A 2QEXQ 3CC7A 1PSFA 5GMKh 1B34B 5LJ3f 2COZA 4EPCA 5CKDA 2HSEB 5CK9A 4M7DA 1TOVA 1NEBA 1VQ5A 1M1FA 4OMLA 2P0KA 1D1CA 1RLPC 4D8DA 5IHKA 2D8JA 4QQDA 2DILA 2KDSA 1IHWA 2KI7A 5C0MA 1PRLC 1C1AA 2QA4Q 1V1CA 2HKQB 2LC4A 2ZPFB 1AWOA 2FHDA 2DXTA 2OTLT 4ZN3A 4BD3A 4J9BA 2L5QA 3UA7A 4PNOA 1BB9A 2C0OA 1QVPA 1XOVA 1A0NB 2DFUA 3VS1A 1X43A 1WHKA 5FW9A 1I4K1 2KBTA 1VQLT 1QWEA 4AFSC 4M7AC 1WHHA 4FCYA 4IUPA 1H3ZA 3ZFJA 3N5BB 1KG1A 4MDWA 1M3CA 2CP2A 1TWBA 5I11A 1Q7YC 3VS0A 3BY7A 3HFNA 3RMQA 3BE3A 5FRMA 2E4HA 1K4US 2KK4A 2KYMA 2JM8A 5GANe 5GANd 3REBB 2GBQA 4M78G 2AZSA 2XI9A 3INZA 3V7RA 1NPRA 5IAYA 5IXBA 1IO6A 1X6BA 4IIMA 1XQHA 3L1AA 1VQ6T 1QVGP 1LCKA 2LP5A 5GMKe 3M9QA 1JEGA 1ZSZB 1LPLA 1TTHB 4FSSA 4A4KA 2YLCA 2LQKA 1NYFA 4F04B 1AVZC 4FW1A 2ZPIB 1YIJQ 4M7AB 1Y96B 4M7DD 2MCNA 2QXFA 1RAFB 3CCJQ 2KT8A 1Z9ZA 1TXQA 2COWA 2HKNA 3GF5A 3GLXA 2HDAA 2DEQA 2V8KA 2JW4A 3EG9B 3J80E 3CC2T 4PLIA 4C5GA 5GMKm 3PMTA 1MV0B 5GAN7 1U1SA 2CGHA 3CMAA 2O01E 3JB9F 1YI2A 2JXBA 4ZGDB 2BE9B 5GMKi 4E7JA 4A4GA 1ZSZA 4HVVA 2FPDA 4IURA 3JCMX 4J8OA 4OB3B 2MMPA 5C6SA 1YITA 3TQ7P 3CD6Q 4PKCC 5IHIA 4RTWA 4LD9K 2O2OA 4FIBA 4M7AA 2LQ8A 1SEMA 2DXUA 4ZGJB 1OZ2A 2V1RA 1Y96A 1VQOQ 2DXCA 1PD0A 4E7ZA 2X4YA 2A7YA 3RKXA 2B8AA 2DE0X 5GAN2 3CCLQ 1I8FA 3A98A 1VQMT 1P92A 2V8IA 2MK5A 3PFSA 2EBPA 2E6ZA 1WHMA 1VQPQ 3CPFA 4LDXA 2RJEA 2XD0A 3EGXB 2CT4A 1YNZA 2JJ9A 2QYZA 1W1FA 2XDBA 1YBYA 3JV3A 3OS0A 2BIVA 1WXBA 1SHFA 2M16A 3OYAA 3M0UA 1NBEB 3BW1A 3OSVA 4QQ6A 3VYHB 4PJNA 1ABOA 2EQJA 2MYSA 4ZTJA 1YJNQ 3JB9G 4PFOA 4MZMA 5IH2A 1X69A 2E70A 3P8DA 2ROLA 3X20B 1PCXA 4PJOF 3CPWS 1M1KR 4FYYB 2O4XB 4Z02A 2GF7A 4QVZA 1GCQC 2PUOB 2EYQA 2DVJA 1K9MC 2KXDA 3EGXA 1TSFA 4QW2A 4LUDA 2AZVA 3OYNA 1Q81R 4NL2A 4XAXB 1WLPB 4LDUA 2ENMA 4XQ3A 1KIKA 4P5NA 4F17A 1OU9A 4PJOC 5J3BA 3PMIA 2DZCA 5GAOl 2QEXA 3HSBA 1VIFA 2RD1A 2EKHA 3MEVA 4CC2A 1OZ3A 3FEOA 3CPWA 2RHZA 5DLQE 3MP1A 2LQWA 5GAN5 4Y92A 1ZLMA 3CC4T 5GAN8 1Q82R 1U8RA 5FWCA 3X25B 5I21A 4M7AD 2O4XA 4E7IA 1LOJA 2LZ6B 4J7IA 1VQ8A 5FLXE 3JCMg 4OMPA 4JS5A 1AOJA 4B9XA 3D7SB 2Y4XA 3CMAT 4JJBA 4XTVA 4KGZB 3LH5A 1BBZA 1PWTA 4ZTFA 2WSCE 3MCAB 3GNGA 2EWNA 2X51A 2CT3A 4PJOG 3C94A 2O31A 2ZPEB 4C0GA 5J26A 3QKJA 3S3OA 3ASKA 3ULRB 1UDLA 1IHVA 2C0TA 1AD5A 3T9NA 1N6AA 1QLYA 5ECAA 3E19A 4Y91A 1G3TA 3OYGA 3EG2A 5FU6C 2BZXA 2RI2A 2XICA 4OMQA 1UHCA 1VYUA 3A5ZB 3CBPA 2M51A 1ABQA 4JS4A 1QKWA 1GXIE 4M75F 3OYJA 1HJDA 4RG8A 4XTWA 1ZSGA 2VKNA 2ZGWA 5HCKA 1YJWT 4M77E 1G5VA 3SFMA 4FU6A 4J9EA 1WFWA 1MNDA 1U3OA 2NYSA 4PJMA 4JJNK 1PD1A 3QYGB 4M75C 1IB8A 3CMEQ 3WVEB 2DYIA 2L3QA 4AFQC 1MGQA 1UHFA 5KH6A 4DBQA 3VS5A 2FPFA 4AFUC 1OU8A 2DYBA 3CCJA 1NJIU 2QGFB 1K9AA 3NTHA 4WCIA 1RLQC 4BY6B 2L8DA 3NFCA 3CCVT 3UATA 3H8ZA 4DBRA 2WSEE 2VB6A 4N4GA 1V76A 1K73R 2CH4W 4RTUA 1Z9QA 1HXDA 3G1JA 2CZ7B 4B6MA 1M1KU 3META 1WNLA 4OB1B 4QVCA 3RBBB 4RKUE 4F16A 3L2QA 3CD6A 5D6WA 5KE2A 1VYTA 4EMKC 4M75B 4BE0A 1WHJA 1S1NA 3M0QA 1I81A 3EAEA 3SWNC 3P8BB 2RQVA 2PQWA 5HKCA 1JJ2S 1VQOA 2AT1B 2EFIA 1FWZA 2RK1A 4XU1A 3ER0A 4JRKA 2FRYA 1VQ8T 3E1SA 1R0BG 2BZ8A 4C92B 1VQ7T 4KGXB 2DBMA 4X34A 1VQPA 3QZ5B 7AT1B 1WIEA 2EKOA 4C92E 2KRNA 2LX9A 4E47A 1M8MA 2DO3A 3JCMh 2KQWA 3QWXX 1JJ2A 4O6JA 1LVKA 4ELZC 1WYXA 2LX7A 2RMOA 5LJ3g 2KRSA 2EQUA 2QDYB 5FROA 1AT1B 1GL5A 2CH4A 1CSKA 5M9OA 1IGQA 4ANJA 3MEUA 1NPPA 1F1BB 4M7DF 2JOYA 4E2FB 2EIFA 4TVRA 1KK7A 5FRNA 2RHXA 1KC8R 1HSQA 4C92A 1VQKQ 3I55Q 3C0CA 1K8AU 2E5QA 1BCOA 2EYXA 3RR6A 3QXEB 2LJ1A 1Q81C 3HP9A 3E9FA 2KROA 1T3LA 2X3XD 3EH2A 3MJXA 1T0HA 4D6WA 1ZUKA 3I56Q 3X28B 1VUBA 3VS2A 2HZYA 2Z0WA 2HD0A 4OB2B 2X4XA 1YHQT 2R58A 1SSFA 4Z89A 1MHNA 1TG0A 1Q82C 3GIBA 2K5FA 5HK3A 2NUPB 3FLGA 1NG2A 3M56A 4KULA 2CP0A 3M55A 2HSPA 3RKWA 1MMGA 2EYWA 3PVLA 9ATCB 5D6XA 3CCSQ 4J9GA 4BACA 2I2LA 3UDCA 2ZPHB 4MMLA 3RKYA 5GAOr 5CIUA 3JCMe 3JCMd 5AT1B 5L8RE 3RERA 3HHTB 3TSWA 4OMOA 1RABB 4M7DG 2DL8A 1IXDA 2CP3A 1UEBA 2J6KA 5GAMj 1XNIA 5GANh 2DF6A 2DTOA 1ZA1B 2K5IA 3MPUB 1YN8A 1JRIA 1G3WA 2RQUA 4PL6A 2MI6A 4C8QB 4VUBA 4LDVA 2DMOA 3MO8A 1ZUYA 1K73U 1WXTA 2A37A 1YJ9T 1U1TA 5GAN3 1AWWA 1Q95G 1EX4A 2DAQA 4F7UB 3A8GB 4C8QE 2NUPA 1IRXA 1VQNT 1R8OB 4A4HA 1JBMA 4HT8A 4M78F 3OYMA 2CUBA 4F7UE 4DBHA 5GAOm 1G3SA 3OA6A 2AK5A 4QVDA 4ORZA 2JT4A 2CP5A 1FXXA 4C92D 4JJDA 3V7CA 3PIPA 3C4SA 3I9QA 1RL2A 2G6FX 2HQHA 3V8LA 4EMHA 4Q5WA 2XDDA 3G71T 3QJ6A 4LNPA 4M78C 5CQYA 4C8QA 4C0DB 2H8HA 2EQKA 2IG0A
chains in the Genus database with same CATH topology
1VIEA 3S6WA 1M1KC 3JCMV 4LDYA 1O75A 2K3YA 2M1HA 2RJEA 3CPFA 4LDXA 1B34A 4F7UA 2XD0A 1M8VA 4KUDK 3MEAA 3M59A 4FT2A 3S3MA 2XDBA 5LJ3h 4BY6C 1YBYA 2DPPB 5HK0A 3OS0A 3FJPA 2BIVA 4M77B 2M16A 4IUTA 2JUFA 1HK9A 5CCAA 3V8KA 4J6XA 2DIQA 3ZBDA 3OYAA 2LCLA 4N4HA 5GAMh 3GP8A 4M7DC 2E1HA 2DVEA 1VQLA 3BW1A 3LGLA 3OSVA 2RHUA 2R5MA 4QQ6A 4QQGA 3VYHB 4PLLA 2EQJA 1NZ9A 3CCST 4JRQA 2BUDA 2ZCFB 4ZTJA 1M4ZA 1BIBA 4C5HA 1YIJT 4C92F 3JB9G 4J7FA 3LW5E 4MZMA 1BYMA 4EMKA 3LWHA 1S72A 1M9SA 2CS7A 2E70A 3P8DA 1KC8U 1KD1C 3X20B 4Y28E 2OTJT 3QDRB 3CCQT 4RCCA 4PJOF 3CPWS 3SWNA 2AHJB 4DOVA 2O4XB 3MP8A 4X9DA 4Z02A 3NTKA 3VV0A 3CCJT 2HNIA 2GF7A 4M78B 4OB0B 4QVZA 5LJ5f 2PUOB 3FRNA 4FSXA 1YHQA 5CQXA 5I2MA 2EJFA 2K4YA 2EYQA 3J81E 3DLMA 1K9MC 1M1GA 2DTIA 3L2ZA 5CVIA 3OW2S 2DXBA 4QW2A 4MDXA 3O8VA 4O5VA 3OYNA 4C92C 2RH2A 1BI2A 2KY9A 4NL2A 4M77A 4A4EA 4J83A 4XAXB 4LDUA 4XQ3A 4C5EA 4WF2A 3BDLA 4P5NA 4ME7A 3JRZA 4HCZA 5J3BA 4PJOC 3PMIA 2DZCA 2NLUA 4XK8E 5GAOl 1N9SA 2QQRA 2QEXA 4IKFA 5GANg 3HSBA 1VIFA 2RD1A 3MEVA 1X6OA 1YCYA 2EJ9A 2MAMA 2QQAA 1OZ3A 3FEOA 3FDRA 4OGEA 3CPWA 4L6V5 2RA2A 4BI8B 2DD4A 3J7AF 2RHZA 4M7DB 3M54A 3CD6T 5DLQE 3JCMf 1WPYA 3MP1A 3ZEHA 2H3JA 3JCMW 1W2BS 2F69A 5A2QE 3TU4K 2D6FA 5GAN5 4M7AE 3OYLA 3CC4T 5GAN8 2PUKB 2MWPA 2XDPA 1U8RA 3VJPA 4ELYC 3LWIA 2DKGA 3PIOA 2VV5A 3EFRA 2DZ9A 4L5GA 4KT0E 4ZN1A 5CAIA 4M75G 3M4GA 3X25B 5I21A 4C5IA 3CCRT 1VQOT 1M90C 4M7AD 2O4XA 4M75D 2D0QB 1K8AC 2K57A 2JVVA 4E7IA 2QQBA 1LOJA 4J7IA 3CCLT 4IUVA 1Q81U 1ZHIA 4IUUA 3URGA 5GAOq 5FLXE 3OYBA 3OS1A 1VQ8A 5D6YA 3JCMg 3CC2A 1N8RU 3QO3A 1YJ9A 4NOYA 4JS5A 4B9XA 3CC7T 2Y4XA 3R6OA 1Q7YU 4HCCA 4C8QD 2CZ1B 1VQPT 3CMAT 2RK2A 4J6YA 3OYKA 4XTVA 3HRSA 5LJ3e 4FM4B 5LJ3d 1VQNA 4C92G 4ZTFA 1KHCA 1W2BA 1TH7A 1IREB 3OQ5A 2WSCE 3MCAB 3GNGA 2OAUA 2EWNA 1VQ5T 2YRVA 3FC3A 4C0FA 3UPUA 4PJOG 4BI4A 1VQ4T 3A8MB 1QP3A 2ZPEB 2LTOA 3C94A 2P0QA 2RI5A 3M57A 5DY9A 2DK3A 2JTFA 3QKJA 5J26A 4C0GA 5GAN6 1LNXA 3ASKA 3M53A 3S3OA 1Q82U 4LDWA 2F5KA 5CR2A 3A8HB 3I55A 3Q1JA 2WSFE 3T9NA 1N6AA 3E19A 4Y91A 3G6ET 2JNGA 3CMEA 1G3TA 2C06A 2GQVA 5GAN4 3C12A 3EFSA 3OYGA 4HT9A 4EDUA 1YJNT 5FU6C 3DLLA 2XG8D 2RHIA 3SDZA 4B9WA 1BKBA 2PVDB 2RI2A 2XICA 3G71A 3A5ZB 3CBPA 3L2WA 4X9CA 4XTYA 3OYYA 2FL7A 2X4JA 3KBGA 3CCMA 2OTLA 3I56A 4ATOA 4N0AA 1D3BA 2R5AA 4MZPA 3HFOA 1VQMA 4JS4A 2LCCA 1UB4A 2GCXA 1BI3A 4II1A 5EG2A 4BUGA 4YTLA 5CKBA 3CCUT 4M7AF 3MEWA 4M75F 5GAMg 1GXIE 3V7SA 2LT4A 2F5TX 4L59A 3OYJA 3CCET 2P0PA 2XKOC 4BDYA 4RG8A 4XTWA 4A4FA 3OS5A 1OI1A 5LJ5j 1VQ9T 2ZGWA 3FIFA 1BIAA 1WGSA 1W4SA 2CZ6B 4J5YA 3L2VA 4M77E 4XTZA 3S3NA 1YJWT 2HQXA 4C8QF 1OYXA 1G5VA 3SFMA 4FU6A 3X26B 1UGRB 1UGPB 2EJGA 3OS2A 3JB9H 1NE8A 2DJZA 2E10A 5GAOn 4JJNK 1K73C 5GMKj 2KVQG 4M77D 4CI0C 3QYGB 5KCOA 3JAME 3OBWA 3PNWC 4F7UF 4R56A 4M75C 3QHSA 1XTDA 4IUQA 3WVEB 2E12A 4HCBA 1KHIA 1MGQA 2YLBA 4DOWA 3L2UA 5KH6A 5GANf 1X75C 1KQSS 2RJCA 1QP2A 1S72T 4XTUA 2XIDA 3OMCA 3SB2A 4C8QC 1KQ2A 2OTJA 2IVWA 3FB9A 3CCQA 2L3RA 3OYCA 5A0GA 4KBMB 3G4SA 3LH0A 4JLIA 5CKHA 2FYKA 4JRPA 3CCJA 2LT1A 3OYEA 2LVMA 2RM4A 1NJIU 2RI3A 4M78E 3WXMB 5LJ5e 5LJ5d 2ZZDA 3OY9A 2XHCA 1Q86U 1ZQ1A 3HRUA 1VQ6A 2E64A 3LYIA 3CBMA 2KAFA 2L89A 3NTHA 1M5Q1 4OVAA 3QYHB 3UWNA 4BY6B 2L8DA 3NFCA 3JB9I 3CCVT 4BE1A 3OYIA 3H8ZA 3KXTA 3KUFA 2LNVA 2WSEE 4N4GA 2E65A 4DA4A 3RUXA 1HXDA 3AHUA 5IN1A 2CZ7B 1KQSA 2FB7A 2HAXA 1M1KU 3META 4N4IA 4UC4A 2VGMA 1WNLA 1QVFS 3OW2A 4OB1B 3HPWA 4QVCA 1IZ6A 3GNFB 4JRIA 4RKUE 3PTAA 3L2QA 4M7AG 4M7DE 3CD6A 5D6WA 5KE2A 2XU8A 1WJSA 4M77F 4EMKC 4M75B 5KCHA 3CC4A 2WACA 4RCBA 3OYDA 1ZBXA 4FT4A 4M78A 4BE0A 3LX7A 4DQ2A 4LD6A 1EIFA 1I81A 3EAEA 1O9SA 3SWNC 2LDMA 3C95A 3P8BB 2QA4A 1PSEA 2PQWA 2VUBA 4C0DC 5HKCA 5LJ5h 3PT9A 4C8QG 3CCRA 3GPLA 2EFIA 4BDZA 2RO0A 1VQOA 1FWZA 3JCMb 5DLOA 3QJYA 4J6WA 1Y7XA 2RK1A 4XU1A 1N9RA 3OMGA 3F70A 3ER0A 4JRKA 3VU3C 2HBPA 1YI2T 3HRTA 1VQ8T 3E1SA 4F7UG 2FVUA 3UT1A 4C92B 3CC7A 1VQ7T 1PSFA 1QVFA 4X34A 1B34B 5GMKh 1VQPA 4M77C 3QZ5B 2K2VA 2A3LA 2BKDN 1FX7A 5LJ3f 4EPCA 3CXCS 1KD1U 5CKDA 5LL6S 3X24B 1LJOA 4BB7A 1VQKA 4JUVA 1N27A 2EKOA 5CK9A 2R57A 1YITT 2K3XA 4PJOB 4M7DA 4GLKA 2DTHA 1VQ5A 1M1FA 2M9UA 2QQSA 1WQ7A 2LX9A 2M0OA 2P0KA 1KQ1A 3VUZA 4C92E 5GAMf 5DM7R 4E47A 3MHXA 3CEYA 3JCMc 2DO3A 3BFMA 4FL6A 3JCMh 1K9MU 2KQWA 1JJ2A 4NS5A 4PJOE 4O6JA 4QQDA 2KDSA 3H6ZA 3LLRA 2VGNA 3TEEA 1BI0A 1KC8C 4E7HA 4KUIA 4ELZC 2KSSA 5LJ3g 2GFUA 2EQUA 2QDYB 4XU0A 5C0MA 3CMET 1V29B 4XTXA 4HA8A 3L2RA 5FROA 2JZ2A 2LC4A 2ZPFB 5M9OA 2FHDA 2CZ0B 3MEUA 2DXTA 3CXCA 2ZPBB 2OTLT 3CCMT 1NPPA 4ZN3A 4CRIA 3HKSA 4BD3A 4JLGA 3JCMJ 5GANj 4M7DF 2JOYA 3RMSA 5I2SA 3WVDB 2L5QA 2EIFA 5A0DA 5GAOp 3QPHA 4TVRA 4PNOA 5FRNA 2RHXA 2DIGA 1QVPA 1XOVA 2Y90A 4C92A 3CCEA 2P4TA 4M77G 3DB4A 1VQ9A 4RMOA 1M90U 1I4K1 4PJOA 2VYTA 3DKMA 1VQLT 1K8AU 1YJWA 2E5QA 2PVGB 4M7AC 4IUPA 1H3ZA 2YHTA 3QXEB 2RB6A 2Y4YA 3CCSA 4E7LA 3ZFJA 3N5BB 1Q81C 3HP9A 5FU7C 3E9FA 2G3RA 1KG1A 4MDWA 1YIJA 1N8RC 3NTIA 3QSUA 3LGFA 3QZ9B 2XK0A 4D6WA 4ZGEB 2VC8A 3G7ZA 3BY7A 3HFNA 3RMQA 1Q7YC 5FRMA 3X28B 3M4YA 1VUBA 5FU6B 2KK4A 2K5LA 2CYZB 2HD0A 4C0ZA 1QVGS 4OB2B 3OYFA 2X4XA 5IT9E 2QI2A 1YHQT 1G3YA 2R58A 4OGCA 5GANe 3JCMQ 5GANd 1SSFA 3QIIA 3QG1A 1JB0E 2GFAA 4N0AC 3TREA 4E7KA 3JB9D 3E9GA 1MHNA 2RHYA 4MZTA 4M78G 3G4ST 3GOXA 2XI9A 3INZA 3V7RA 1NPRA 5IAYA 1Q82C 3TCJA 3GIBA 2K5FA 2RJDA 4M78D 4R55A 5HK3A 3BDUA 3RIRA 2JN0A 1XQHA 5GMKl 4V2SA 3FLGA 2LRQA 1Y07A 3L1AA 4A54A 1X01A 1VQ6T 5CO7A 1BI1A 5GMKe 3M9QA 2VXEA 3MP6A 3M56A 4KULA 3CCVA 3M55A 2QEXT 5CKEA 5HY6A 3M58A 2EAYA 2X35A 3RKWA 3V8JA 3RESA 3PGGA 4A4KA 2YLCA 3HL8A 5D6XA 2LQKA 2PU9B 4BACA 4OP0A 2I2LA 3OYHA 3UDCA 2ZPHB 4MMLA 5LJ3j 1QVGA 2ZPIB 3RKYA 5CIUA 5GAOr 3JB9J 3JCMe 3JCMd 4XU2A 5L8RE 4M7AB 5LJ5g 3RERA 3HHTB 4M7DG 1AHJB 2RJFA 3OB9A 1Y96B 5FU7B 1UEBA 5GAMj 4M7DD 3A8OB 1XNIA 5GANh 3M5AA 2QXFA 2DTOA 4GY5A 2K5IA 1UGQB 2E41A 4BE2A 2DD5A 1JRIA 1G3WA 3QBYA 4PL6A 3ME9A 4M75E 3GLXA 2MI6A 3GF5A 1RI0A 1WQWA 3DB3A 4C8QB 1I5LA 2E6NA 3VKIA 4VUBA 3CCLA 4RG2A 4LDVA 2DEQA 2V8KA 2V8JA 3MO8A 3J80E 2QA4T 3CC2T 3OSSC 4PLIA 1K73U 1DJ7B 4XU3A 1UGSB 4C5GA 5GMKm 2QTXA 1YJ9T 4OMFB 3PMTA 1QW1A 1U1TA 2QQ9A 5GAN7 1U1SA 5GAN3 2CGHA 4F7UB 2DAQA 3CMAA 3VUBA 1WJQA 2ZPGB 3A8GB 4C8QE 1D3BB 1H641 2O01E 3JB9F 5A0LA 1VQNT 1YI2A 1R8OB 4MMKA 2CKKA 4A4HA 3VYGA 4ZGDB 2JTMA 5GMKi 4E7JA 1JBMA 4A4GA 1VQ7A 4HT8A 2KMTA 4M78F 3OBYA 3SD4A 3OYMA 2X4WA 1VQ4A 4F7UE 4IURA 3JCMX 4J8OA 4OB3B 2MMPA 3CCUA 3A8LB 5GAOm 3QUIA 2PVOB 1G3SA 5C6SA 3OA6A 5AYFA 1YITA 1VQKT 4PKCC 3L42A 1Y71A 5J39A 4QVDA 4NL3A 4C92D 1FXXA 2EQMA 3P8HA 3V7CA 3PIPA 3I55T 3C4SA 4LD9K 4BI3A 1NJIC 4FIBA 1RL2A 5GAMe 1WJRA 2LQ8A 4M75A 5GAMd 4M7AA 3G6EA 2DXUA 4JDSA 4ZGJB 1Q86C 1OZ2A 3V8LA 2MF2A 4PJOD 1Y96A 4EMHA 1YJNA 2D9TA 4Q5WA 5CKFA 2HQEA 1JJ2S 2DXCA 2XDDA 4EMKB 4OF1A 3G71T 5KE3A 3QJ6A 4M78C 2VXFA 2MWOA 2A7YA 2X4YA 3CBOA 2B8AA 3RKXA 5GAN2 5CQYA 3SWNB 4C8QA 1I8FA 3I56T 3JSCA 4A53A 4C0DB 1VQMT 1P92A 4EMGA 2V8IA 4HKEA 2EQKA 2IG0A 3PFSA 2E6ZA 3JCMP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MET A;  4N4I A;  1KHC A;  4UC4 A;  3S6W A;  4ZTF A;  3OQ5 A;  2K3Y A;  2M1H A;  2RJE A;  2YRV A;  3FC3 A;  3OYF A;  3L2Q A;  2X4X A;  2R58 A;  3MEA A;  1SSF A;  2LTO A;  3QII A;  2RI5 A;  2GFA A;  5D6W A;  5KE2 A;  5J26 A;  2JTF A;  3QKJ A;  3E9G A;  3OS0 A;  4E7K A;  3S3O A;  1MHN A;  1WJS A;  3ASK A;  2BIV A;  2RHY A;  5KCH A;  2F5K A;  2WAC A;  2M16 A;  4IUT A;  5IAY A;  3OYD A;  3GOX A;  4BE0 A;  3LX7 A;  4LD6 A;  3Q1J A;  2RJD A;  2DIQ A;  3EAE A;  3OYA A;  2LDM A;  4N4H A;  2PQW A;  3FLG A;  2LRQ A;  4BDZ A;  2EFI A;  2RO0 A;  3LGL A;  2RHU A;  2R5M A;  4QQ6 A;  4QQG A;  3OYG A;  3M9Q A;  3MP6 A;  3OMG A;  4PLL A;  3F70 A;  4EDU A;  2RHI A;  2EQJ A;  4B9W A;  2RI2 A;  2BUD A;  2X35 A;  3L2W A;  4ZTJ A;  4C5H A;  5D6X A;  3UT1 A;  4BAC A;  2R5A A;  4X34 A;  3OYH A;  2BKD N;  2LCC A;  3P8D A;  5CIU A;  4II1 A;  3MEW A;  1N27 A;  2EKO A;  4BDY A;  2R57 A;  2K3X A;  4L59 A;  3OYJ A;  2RJF A;  2O4X B;  3OB9 A;  3MP8 A;  2P0K A;  2QQS A;  2M0O A;  3NTK A;  1OI1 A;  4Z02 A;  2GF7 A;  4QVZ A;  4A4F A;  1XNI A;  3CEY A;  4GY5 A;  4FL6 A;  3DLM A;  4BE2 A;  1WGS A;  3QBY A;  4NS5 A;  3ME9 A;  4PL6 A;  4QW2 A;  3L2V A;  3S3N A;  4QQD A;  2HQX A;  1RI0 A;  3DB3 A;  1OYX A;  3H6Z A;  3LLR A;  1G5V A;  2E6N A;  3O8V A;  4FU6 A;  3OYN A;  4RG2 A;  4E7H A;  3OS2 A;  3MO8 A;  2GFU A;  4PLI A;  4A4E A;  4C5G A;  2EQU A;  4C5E A;  5C0M A;  3PMT A;  3BDL A;  5KCO A;  3L2R A;  3PNW C;  5FRO A;  2DAQ A;  4HCZ A;  4IUQ A;  1WJQ A;  3PMI A;  2NLU A;  2QQR A;  2JZ2 A;  4IKF A;  4A4H A;  2CKK A;  5M9O A;  2FHD A;  3MEV A;  3MEU A;  1OZ3 A;  3FEO A;  3FDR A;  3L2U A;  4A4G A;  4CRI A;  5KH6 A;  4BD3 A;  4E7J A;  2RHZ A;  3SD4 A;  3OYM A;  2RJC A;  2X4W A;  3MP1 A;  3OMC A;  4IUR A;  3ZEH A;  5FRN A;  2RHX A;  2DIG A;  2L3R A;  5C6S A;  3OYC A;  3OA6 A;  3LH0 A;  3OYL A;  2MWP A;  2XDP A;  3L42 A;  5J39 A;  2EQM A;  3P8H A;  3C4S A;  3OYE A;  2LVM A;  2RI3 A;  3DB4 A;  5FRM A;  1WJR A;  3OY9 A;  2VYT A;  4C5I A;  2O4X A;  1OZ2 A;  3LYI A;  2E5Q A;  2L89 A;  3NTH A;  4OVA A;  4IUP A;  2D9T A;  4Q5W A;  3UWN A;  4BE1 A;  2L8D A;  4E7I A;  2HQE A;  1H3Z A;  3OYI A;  3H8Z A;  4E7L A;  4IUV A;  4IUU A;  3KUF A;  3OYB A;  3E9F A;  2G3R A;  3QJ6 A;  5D6Y A;  5KE3 A;  3OS1 A;  4N4G A;  2MWO A;  2X4Y A;  2B8A A;  3S3M A;  4B9X A;  3NTI A;  3LGF A;  2XK0 A;  3OYK A;  5IN1 A;  2EQK A;  2IG0 A;  3PFS A; 
#chains in the Genus database with same CATH topology
 1VIE A;  4LDY A;  1O75 A;  1D0Z A;  2M1H A;  4DEY A;  1B34 A;  4F7U A;  3MEA A;  3M59 A;  4FT2 A;  3S3M A;  5LJ3 h;  3RDV A;  3EGD B;  2DL4 A;  2JUF A;  5CCA A;  5KYY B;  2DIQ A;  2LCL A;  4N4H A;  2E1H A;  3LGL A;  2RHU A;  2R5M A;  2J7I A;  4ESR A;  1OOT A;  2AKK A;  2BUD A;  4J7F A;  3LW5 E;  1BCM A;  1S72 A;  1KC8 U;  5KYW B;  2OTJ T;  3CCQ T;  4RCC A;  3M0T A;  4DOV A;  2QDL A;  1BK2 A;  3CCU Q;  4M78 B;  4FSX A;  3CCE Q;  3EGU A;  2RPN A;  2MPX C;  3OW2 S;  3MKD A;  1VQ9 Q;  1YFN A;  4MDX A;  4O5V A;  1AWX A;  3CPW P;  3EGD A;  4ME7 A;  3EG0 A;  1X6O A;  1YCY A;  3QWY A;  3FDR A;  4BI8 B;  1YWO A;  4GBQ A;  4E6R A;  3ZEH A;  2H3J A;  2F69 A;  4AG2 C;  5A2Q E;  2P84 A;  4M7A E;  1K76 A;  2DKG A;  3H0F A;  3PIO A;  2DER A;  4ZN1 A;  2LQN A;  2DZ9 A;  3EFR A;  5CAI A;  2K79 A;  1OPL A;  2E3H A;  2YWW A;  3M4G A;  3CCR T;  4C5I A;  1J3T A;  1KJW A;  2YUN A;  2JVV A;  1PRM C;  2QQB A;  4IUV A;  1X2Q A;  3OS1 A;  5D6Y A;  1CKA A;  4ZNX A;  3I35 A;  4J9C A;  1N8R U;  3CC7 T;  1D09 B;  4C8Q D;  2RK2 A;  3OYK A;  1YCS B;  5LJ3 e;  4FM4 B;  5GJW B;  2DM1 A;  1YP5 A;  5LJ3 d;  3EG3 A;  2CSQ A;  4EIK A;  2OAU A;  1RUW A;  1VQ5 T;  3FC3 A;  3UPU A;  4BI4 A;  3A8M B;  2RI5 A;  1KC8 C;  2KR3 A;  5GAN 6;  3M53 A;  3A8H B;  3I55 A;  2WSF E;  2JTE A;  2JNG A;  2C06 A;  3C12 A;  4HT9 A;  4EDU A;  1UJY A;  3EG9 A;  2XG8 D;  1BKB A;  3L2W A;  3VS4 A;  4X9C A;  4XTY A;  3CCM A;  3I56 A;  2DRK A;  3HFO A;  3HTR A;  1BI3 A;  5GAM g;  1VQ4 Q;  3V7S A;  4L59 A;  2F5T X;  1NM7 A;  2P0P A;  2HL3 A;  5LJ5 j;  1NJI R;  3FIF A;  1W4S A;  4J5Y A;  5KYN A;  1NLP C;  2I0N A;  2JM9 A;  1OYX A;  4AFZ C;  1UGP B;  2EJG A;  1NE8 A;  2E10 A;  2F2X A;  3I5S A;  5GMK j;  4CI0 C;  2DL3 A;  3QHS A;  2L2P A;  4IUQ A;  1G8X A;  1N5Z A;  1GCP A;  1KHI A;  4JJC A;  1K0S A;  2H3E B;  4KRT A;  4D8K A;  4DOW A;  2RN8 A;  1X75 C;  1WHL A;  1QP2 A;  1S72 T;  2OTL Q;  2MIO A;  4LXC A;  2IIM A;  3OYC A;  4HVW A;  4KBM B;  5A0G A;  3LH0 A;  3FJ5 A;  1H92 A;  1K0X A;  2DA9 A;  2LVM A;  1ZX6 A;  2RI3 A;  3WXM B;  1Q86 U;  3LYI A;  4AT1 B;  1JU5 C;  2KAF A;  1M5Q 1;  1VQL Q;  8ATC B;  2FB7 A;  2JMC A;  2VGM A;  3GBQ A;  4LUE A;  2EGC A;  5KYX B;  3PTA A;  1FMK A;  4M77 F;  4DBF A;  5KCH A;  1UE9 A;  2WAC A;  3OYD A;  5IXF A;  1ZBX A;  4FT4 A;  4DQ2 A;  2LDM A;  3EHQ A;  2QA4 A;  1PSE A;  2VUB A;  4BDZ A;  3GPL A;  2RO0 A;  3VS6 A;  2NUT B;  1R77 A;  4J6W A;  3F70 A;  1VQ6 Q;  6AT1 B;  1YI2 T;  4FYX B;  2OX7 A;  3VS7 A;  1TUC A;  4M77 C;  3ZL7 C;  2A3L A;  2BKD N;  1KD1 U;  1JJ2 P;  5LL6 S;  4BB7 A;  4PJO B;  1YIT T;  1D1A A;  1W70 A;  4GLK A;  1WQ7 A;  2QQS A;  2M0O A;  3VUZ A;  4OMN A;  5GAM f;  4M4Z A;  3MHX A;  3JCM c;  3BFM A;  5KYX A;  1VYV A;  4PJO E;  1K8A R;  3H6Z A;  3RNJ A;  3TEE A;  4QKU A;  1BI0 A;  2KSS A;  1D0Y A;  1X6G A;  1V29 B;  2OJ2 A;  3L2R A;  3CC2 Q;  1PNJ A;  1QWF A;  2JZ2 A;  4Z8A A;  2CUD A;  2CZ0 B;  2NUT A;  1GCQ A;  2ZPB B;  3CCM T;  4CRI A;  3HKS A;  4OMM A;  3RMS A;  5I2S A;  5GAO p;  5A0D A;  3QPH A;  5KYU B;  3CCE A;  3M0R A;  4RTZ A;  4DEX A;  4M77 G;  3DB4 A;  1VQ9 A;  4RTT A;  1M90 U;  4PJO A;  2YSQ A;  3DKM A;  2YUO A;  1SRM A;  5D7U A;  2GGR A;  2JS0 A;  2Y4Y A;  4E7L A;  1YIJ A;  3NTI A;  4AG1 C;  3QSU A;  3LGF A;  3QZ9 B;  1SRL A;  4ZGE B;  2VC8 A;  2F2V A;  2CDT A;  1VQM Q;  2X3W D;  5FU6 B;  2K5L A;  2A08 A;  3OYF A;  1ACM B;  2QI2 A;  4OGC A;  1G3Y A;  3CQT A;  3JCM Q;  2AKL A;  3QII A;  2P4R A;  3TRE A;  3JB9 D;  2GFA A;  4N0A C;  4E7K A;  2RHY A;  3GOX A;  2FRW A;  2RJD A;  5GJV B;  1OUL A;  2JN0 A;  5GMK l;  1RAA B;  3U23 A;  4A54 A;  1X01 A;  5KYU A;  5CO7 A;  2DLP A;  2KXC A;  3MP6 A;  2QEX T;  5CKE A;  3V8J A;  3RES A;  3PGG A;  3HL8 A;  2PU9 B;  2KE9 A;  2O88 A;  3JB9 J;  1KSW A;  5LJ5 g;  2YDL A;  3M0P A;  3A8O B;  2K6D A;  3G4S Q;  2DX1 A;  4CC3 A;  2RNA A;  4GY5 A;  1I1J A;  3PE0 A;  2DET A;  4BE2 A;  2DD5 A;  4CC7 A;  1M27 C;  3ME9 A;  4M75 E;  3NHN A;  3DB3 A;  1SF9 A;  3CCL A;  4RG2 A;  5IHN A;  1T0J A;  2QA4 T;  3OSS C;  2L3S A;  1DJ7 B;  1WA7 A;  2QTX A;  4OMF B;  1OEB A;  4E7S A;  2W10 A;  2RQR A;  1WJQ A;  2ZPG B;  1W2B P;  1D3B B;  1H64 1;  1ZUU A;  4MMK A;  3VYG A;  3THK A;  1RAC B;  2KMT A;  3OBY A;  3SD4 A;  2X4W A;  2A36 A;  1VQ4 A;  2J6O A;  3NMZ C;  2QTV A;  1W6X A;  2PVO B;  1PG5 B;  1TUD A;  4NL3 A;  2EQM A;  3P8H A;  3CC4 Q;  1NJI C;  1WDX A;  1WHG A;  5GAM e;  5GAM d;  1WJR A;  4M75 A;  4JDS A;  3TVT A;  4PJO D;  1YJN A;  2D9T A;  4EMK B;  4OF1 A;  5KE3 A;  3CBO A;  3SWN B;  3JSC A;  1KFZ A;  4EMG A;  4HKE A;  3JCM P;  1GRI A;  1JXM A;  3S6W A;  1M1K C;  2K3Y A;  3REA B;  3SHW A;  2RQT A;  4KUD K;  5HK0 A;  2ESW A;  1NEG A;  3V8K A;  4J6X A;  2O9S A;  1G2B A;  3H9N A;  3GP8 A;  4M7D C;  2AIR B;  2LJ0 A;  2KYB A;  2DVE A;  1VQL A;  4PFZ A;  2EW3 A;  2V1Q A;  1M4Z A;  1YIJ T;  1B7T A;  3PVQ A;  4EMK A;  1M9S A;  1AEY A;  4Y28 E;  4F14 A;  2ED0 A;  3SWN A;  2AHJ B;  2EVR A;  3CCJ T;  1RI9 A;  2RQW A;  5LJ5 f;  2HEQ A;  3FRN A;  5CQX A;  2EJF A;  3J81 E;  3DLM A;  1M1G A;  2DTI A;  5CVI A;  2DXB A;  2QAS A;  2QG9 B;  2EPD A;  3O8V A;  1PHT A;  1YJW Q;  2DNU A;  1BI2 A;  4A4E A;  4C5E A;  1N8R R;  1YWP A;  3JRZ A;  4HCZ A;  4HCK A;  2NLU A;  1N9S A;  2QQR A;  2PNI A;  4RTY A;  3OW2 P;  2MAM A;  2QQA A;  4OGE A;  2RA2 A;  4M7D B;  3M54 A;  1E6H A;  3CD6 T;  1QKX A;  1WPY A;  1W2B S;  3JCM W;  2A28 A;  1ZBJ A;  2PUK B;  2MWP A;  2XDP A;  4ELY C;  3LWI A;  2M0Y A;  4L5G A;  2ROT A;  1VQO T;  2C0I A;  1K9M R;  4M75 D;  2D0Q B;  1K8A C;  4AMC A;  4K11 A;  3CCL T;  2IPO B;  1ZHI A;  4IUU A;  2DBK A;  3URG A;  5GAO q;  3OYB A;  3CC2 A;  2ECZ A;  3CCV Q;  2CP7 A;  1QVF P;  3AT1 B;  4NOY A;  3R6O A;  1ZA2 B;  1Q7Y U;  2E3I A;  1VQP T;  3HRS A;  1W2B A;  1GFD A;  4C0F A;  1VQ4 T;  5HY6 A;  2LTO A;  3M57 A;  1UGV A;  1UUE A;  2JTF A;  1LNX A;  4LDW A;  2B86 A;  3EFO B;  2NUZ A;  1GBQ A;  3CME A;  2GQV A;  5GAN 4;  3EFS A;  3UF4 A;  1YJN T;  2VVK A;  3CXC P;  1NYG A;  3OYY A;  2FL7 A;  3KBG A;  4MZP A;  1VQM A;  1VQ8 Q;  4II1 A;  5EG2 A;  4BUG A;  4YTL A;  1VQ7 Q;  4M7A F;  1FMV A;  2LT4 A;  2ED1 A;  3OS5 A;  1OI1 A;  1B07 A;  1ZSZ C;  4Z88 A;  1RAH B;  3L2V A;  1Q86 R;  3G6E Q;  3X26 B;  1K73 C;  2KVQ G;  1AWJ A;  2PTK A;  3OBW A;  3PNW C;  4R56 A;  2F2W A;  1XTD A;  3EFO A;  2SEM A;  2E12 A;  1D1B A;  2KRM A;  2YLB A;  3L2U A;  1KQS S;  1RAE B;  1I0C A;  2RJC A;  3OMC A;  1KQ2 A;  2YUP A;  1M2O A;  3G4S A;  4JLI A;  2FYK A;  2XMF A;  4JRP A;  3H0I A;  1QCF A;  2RM4 A;  4M78 E;  5LJ5 e;  5LJ5 d;  3OY9 A;  2D0N A;  1ZQ1 A;  2YRC A;  5KYY A;  4OVA A;  2L89 A;  4BE1 A;  4FW2 A;  3JB9 I;  3OYI A;  2GQI A;  2LNV A;  2A0F B;  2KEA A;  4KH1 B;  4DA4 A;  3AHU A;  5IN1 A;  4PK4 A;  2YXY A;  1KQS A;  1KD1 R;  2HAX A;  4UC4 A;  4N4I A;  1QVF S;  3OW2 A;  4RTV A;  1K1Z A;  1IZ6 A;  5KYW A;  4M7A G;  1YHQ Q;  3CC4 A;  4M78 A;  4LD6 A;  4JPB W;  1EIF A;  1CKB A;  1O9S A;  1JO8 A;  1MNE A;  3PT9 A;  2YT6 A;  1X27 A;  3JCM b;  4J9H A;  1U06 A;  2K9G A;  2X9H A;  3OMG A;  1WI7 A;  3HRT A;  1MV3 A;  1RAI B;  4J9D A;  1I5O B;  1QVF A;  4J9F A;  2K2V A;  1FX7 A;  3CXC S;  2O9V A;  1LJO A;  2PZ1 A;  3X24 B;  1VQK A;  4JUV A;  1N27 A;  2FG0 A;  2R57 A;  2K3X A;  1H8K A;  2DTH A;  2EQI A;  2M9U A;  5DM7 R;  1KQ1 A;  1M30 A;  3CEY A;  3NGP A;  1K9M U;  4FL6 A;  1M90 R;  2QK0 A;  2D1X A;  4NS5 A;  4WTO B;  1SHG A;  3LLR A;  2FZK B;  2VGN A;  2VWF A;  1EZZ B;  4E7H A;  4KUI A;  1E6G A;  1U5S A;  4KH0 B;  2GFU A;  1UFF A;  2E5K A;  1XJW B;  4XU0 A;  3CME T;  4XTX A;  1R0C B;  1IGU A;  4HA8 A;  2EYY A;  2CP6 A;  1H3H A;  1YJ9 Q;  2K3B A;  3CXC A;  1VQN Q;  3JCM J;  4JLG A;  1X2K A;  5GAN j;  1D0X A;  3WVD B;  2DIG A;  2Y90 A;  2P4T A;  4RMO A;  2VYT A;  4LE9 A;  1YJW A;  1EFN A;  2BTT A;  2BZY A;  2PVG B;  1QCO A;  2YHT A;  2RB6 A;  1MMA A;  2DEU A;  3CCS A;  5FU7 C;  2G3R A;  2BE7 D;  1N8R C;  1RAG B;  3G71 Q;  2XK0 A;  3G7Z A;  3M4Y A;  2CYZ B;  4C0Z A;  1QVG S;  2GTO A;  5IT9 E;  2KT1 A;  3QG1 A;  1JB0 E;  3E9G A;  4MZT A;  1M2V B;  3G4S T;  4LN2 A;  3TCJ A;  4M78 D;  4R55 A;  3BDU A;  3RIR A;  4V2S A;  2LRQ A;  4X1V A;  1Y07 A;  1BI1 A;  2VXE A;  3M0S A;  3CCV A;  1M3A A;  3UA6 A;  1SPK A;  3M58 A;  2EAY A;  2X35 A;  4OP0 A;  3OYH A;  1PKT A;  5LJ3 j;  1UJ0 A;  1QVG A;  1Y57 A;  1WXU A;  3O5Z A;  4XU2 A;  1ARK A;  2RF0 A;  1AHJ B;  2RJF A;  3OB9 A;  2OTJ Q;  3CCQ Q;  5FU7 B;  3M5A A;  1VA7 A;  1UGQ B;  2E41 A;  3QBY A;  1RI0 A;  1WQW A;  1I5L A;  4KGV B;  2E6N A;  3VKI A;  1SKU B;  2V8J A;  4J9I A;  3NPF A;  1M2V A;  4XU3 A;  1UGS B;  1QW1 A;  2FZG B;  2QQ9 A;  4RUG A;  3VUB A;  1TUG B;  5A0L A;  2CKK A;  2JTM A;  1BU1 A;  3H0H A;  4QT7 A;  2FO0 A;  1VQ7 A;  1SG5 A;  1OX9 A;  2K2M A;  3A8L B;  3QUI A;  2KGT A;  1VQK T;  5AYF A;  3L42 A;  1PM3 A;  1Y71 A;  2HCK A;  5J39 A;  2GNC A;  3I55 T;  1QQJ A;  2DJQ A;  4BI3 A;  3G6E A;  3IQL A;  2LNH B;  1Q86 C;  2MF2 A;  3E2U A;  2HBW A;  2LJ3 A;  5CKF A;  3CCR Q;  2J05 A;  2HQE A;  2M02 A;  2CSI A;  2VXF A;  1FMW A;  2LMJ A;  2MWO A;  3I56 T;  4A53 A;  1TU0 B;  3CC7 Q;  3CCU A;  3TU4 K;  3JCM V;  8AT1 B;  2NWM A;  2EGA A;  1M8V A;  2CRE A;  1VQ5 Q;  4BY6 C;  2DPP B;  3FJP A;  4M77 B;  3VRZ A;  4IUT A;  1HK9 A;  3ZBD A;  2VAS A;  5GAM h;  1OV3 A;  1UG1 A;  4JZ4 A;  5FWB A;  1SSH A;  4QQG A;  4PLL A;  2EGE A;  1NZ9 A;  3CCS T;  4JRQ A;  2ZCF B;  1BIB A;  4C5H A;  4C92 F;  4FYW B;  2QGG A;  1BYM A;  3LWH A;  3A1P A;  2CS7 A;  2HL5 C;  1KD1 C;  2F1L A;  3QDR B;  2JMA A;  2D8H A;  3KFV A;  3VRY A;  3H41 A;  3MP8 A;  4X9D A;  3VV0 A;  3NTK A;  2HNI A;  4OB0 B;  1YHQ A;  5I2M A;  2K4Y A;  2YRD A;  2W0Z A;  3L2Z A;  2KNB B;  1OPK A;  2EYZ A;  4C92 C;  2RH2 A;  2KY9 A;  1B3Q A;  4M77 A;  4J83 A;  1UEC A;  2GTJ A;  4WF2 A;  3BDL A;  1FYN A;  2L0A A;  1C6V X;  3QDF A;  1Q7Y R;  4XK8 E;  4IKF A;  5GAN g;  2JS2 A;  2EJ9 A;  4R0K A;  1JQQ A;  4L6V 5;  2DD4 A;  3J7A F;  3JCM f;  2YUQ A;  2D6F A;  1TS9 A;  1S72 Q;  3OYL A;  3VJP A;  2VV5 A;  4KT0 E;  4M75 G;  1M90 C;  2J06 A;  2K57 A;  1QMC A;  2ATC B;  3TSZ A;  1VOM A;  1Q81 U;  1PC0 A;  2J6F A;  3QO3 A;  1YJ9 A;  4HCC A;  1C0M A;  2CZ1 B;  1OX8 A;  4FYV B;  4J6Y A;  4JZ3 A;  1VQN A;  4C92 G;  2K7A A;  1KHC A;  1TH7 A;  1IRE B;  3OQ5 A;  2YRV A;  2OI3 A;  1QP3 A;  2P0Q A;  5DY9 A;  2DK3 A;  1GFC A;  1GBR A;  1Q82 U;  4GLM A;  2F5K A;  1WX6 A;  5CR2 A;  3Q1J A;  5L23 A;  1UTI A;  4CC4 B;  1HD3 A;  4IIO A;  3G6E T;  1MMD A;  2FZC B;  3DLL A;  2RHI A;  3SDZ A;  2DL7 A;  4B9W A;  2PVD B;  3SEM A;  3G71 A;  3CMA Q;  5EC7 A;  2SRC A;  2OTL A;  2X4J A;  4ATO A;  4N0A A;  1YI2 Q;  1D3B A;  2R5A A;  1MMN A;  2LCC A;  1UB4 A;  2GCX A;  5CKB A;  3CCU T;  3I5R A;  3MEW A;  3R6N A;  3CCE T;  2LCS A;  2XKO C;  4BDY A;  4A4F A;  1YIT Q;  2ZAE A;  1VQ9 T;  2MOX A;  1BIA A;  1WGS A;  2CZ6 B;  2OAW A;  3S3N A;  2DRM A;  4XTZ A;  2HQX A;  4C8Q F;  1UGR B;  4A63 B;  3OS2 A;  3JB9 H;  2DJZ A;  4RTX A;  5GAO n;  4M77 D;  2L3P A;  5KCO A;  3JAM E;  4F7U F;  4HCB A;  2QAZ A;  1JXO A;  3VS3 A;  5GAN f;  4XTU A;  2XID A;  3SB2 A;  1T3S A;  3CCM Q;  4C8Q C;  2OTJ A;  2IVW A;  3FB9 A;  4PJL A;  2L3R A;  3CCQ A;  5CKH A;  3EHR A;  4PFP A;  1HYO A;  2COY A;  1WZO A;  2LT1 A;  3OYE A;  4HVU A;  2HMA A;  2ZZD A;  2XHC A;  1VQ6 A;  3HRU A;  5I22 A;  2E64 A;  1KQS P;  4HXJ A;  3EG1 A;  3CBM A;  3UWN A;  3QYH B;  3KXT A;  3EH1 A;  3KUF A;  2FPE A;  1OQK A;  2E65 A;  1NLO C;  3RUX A;  1PKS A;  2ABL A;  3HPW A;  1I07 A;  3GNF B;  4JRI A;  1Y0M A;  4M7D E;  1MUZ A;  1RAD B;  2XU8 A;  1WJS A;  1QCN A;  1E7O A;  4RCB A;  3LX7 A;  1AZG B;  1G83 A;  2FEI A;  3C95 A;  5LJ5 h;  4C0D C;  3CCR A;  2DL5 A;  4C8Q G;  4PJJ A;  2V26 A;  5DLO A;  3QJY A;  1Y7X A;  1N9R A;  3VU3 C;  2HBP A;  4F7U G;  1AZE A;  2FVU A;  1M3B A;  3UT1 A;  2QEX Q;  3CC7 A;  1PSF A;  5GMK h;  1B34 B;  5LJ3 f;  2COZ A;  4EPC A;  5CKD A;  2HSE B;  5CK9 A;  4M7D A;  1TOV A;  1NEB A;  1VQ5 A;  1M1F A;  4OML A;  2P0K A;  1D1C A;  1RLP C;  4D8D A;  5IHK A;  2D8J A;  4QQD A;  2DIL A;  2KDS A;  1IHW A;  2KI7 A;  5C0M A;  1PRL C;  1C1A A;  2QA4 Q;  1V1C A;  2HKQ B;  2LC4 A;  2ZPF B;  1AWO A;  2FHD A;  2DXT A;  2OTL T;  4ZN3 A;  4BD3 A;  4J9B A;  2L5Q A;  3UA7 A;  4PNO A;  1BB9 A;  2C0O A;  1QVP A;  1XOV A;  1A0N B;  2DFU A;  3VS1 A;  1X43 A;  1WHK A;  5FW9 A;  1I4K 1;  2KBT A;  1VQL T;  1QWE A;  4AFS C;  4M7A C;  1WHH A;  4FCY A;  4IUP A;  1H3Z A;  3ZFJ A;  3N5B B;  1KG1 A;  4MDW A;  1M3C A;  2CP2 A;  1TWB A;  5I11 A;  1Q7Y C;  3VS0 A;  3BY7 A;  3HFN A;  3RMQ A;  3BE3 A;  5FRM A;  2E4H A;  1K4U S;  2KK4 A;  2KYM A;  2JM8 A;  5GAN e;  5GAN d;  3REB B;  2GBQ A;  4M78 G;  2AZS A;  2XI9 A;  3INZ A;  3V7R A;  1NPR A;  5IAY A;  5IXB A;  1IO6 A;  1X6B A;  4IIM A;  1XQH A;  3L1A A;  1VQ6 T;  1QVG P;  1LCK A;  2LP5 A;  5GMK e;  3M9Q A;  1JEG A;  1ZSZ B;  1LPL A;  1TTH B;  4FSS A;  4A4K A;  2YLC A;  2LQK A;  1NYF A;  4F04 B;  1AVZ C;  4FW1 A;  2ZPI B;  1YIJ Q;  4M7A B;  1Y96 B;  4M7D D;  2MCN A;  2QXF A;  1RAF B;  3CCJ Q;  2KT8 A;  1Z9Z A;  1TXQ A;  2COW A;  2HKN A;  3GF5 A;  3GLX A;  2HDA A;  2DEQ A;  2V8K A;  2JW4 A;  3EG9 B;  3J80 E;  3CC2 T;  4PLI A;  4C5G A;  5GMK m;  3PMT A;  1MV0 B;  5GAN 7;  1U1S A;  2CGH A;  3CMA A;  2O01 E;  3JB9 F;  1YI2 A;  2JXB A;  4ZGD B;  2BE9 B;  5GMK i;  4E7J A;  4A4G A;  1ZSZ A;  4HVV A;  2FPD A;  4IUR A;  3JCM X;  4J8O A;  4OB3 B;  2MMP A;  5C6S A;  1YIT A;  3TQ7 P;  3CD6 Q;  4PKC C;  5IHI A;  4RTW A;  4LD9 K;  2O2O A;  4FIB A;  4M7A A;  2LQ8 A;  1SEM A;  2DXU A;  4ZGJ B;  1OZ2 A;  2V1R A;  1Y96 A;  1VQO Q;  2DXC A;  1PD0 A;  4E7Z A;  2X4Y A;  2A7Y A;  3RKX A;  2B8A A;  2DE0 X;  5GAN 2;  3CCL Q;  1I8F A;  3A98 A;  1VQM T;  1P92 A;  2V8I A;  2MK5 A;  3PFS A;  2EBP A;  2E6Z A;  1WHM A;  1VQP Q;  3CPF A;  4LDX A;  2RJE A;  2XD0 A;  3EGX B;  2CT4 A;  1YNZ A;  2JJ9 A;  2QYZ A;  1W1F A;  2XDB A;  1YBY A;  3JV3 A;  3OS0 A;  2BIV A;  1WXB A;  1SHF A;  2M16 A;  3OYA A;  3M0U A;  1NBE B;  3BW1 A;  3OSV A;  4QQ6 A;  3VYH B;  4PJN A;  1ABO A;  2EQJ A;  2MYS A;  4ZTJ A;  1YJN Q;  3JB9 G;  4PFO A;  4MZM A;  5IH2 A;  1X69 A;  2E70 A;  3P8D A;  2ROL A;  3X20 B;  1PCX A;  4PJO F;  3CPW S;  1M1K R;  4FYY B;  2O4X B;  4Z02 A;  2GF7 A;  4QVZ A;  1GCQ C;  2PUO B;  2EYQ A;  2DVJ A;  1K9M C;  2KXD A;  3EGX A;  1TSF A;  4QW2 A;  4LUD A;  2AZV A;  3OYN A;  1Q81 R;  4NL2 A;  4XAX B;  1WLP B;  4LDU A;  2ENM A;  4XQ3 A;  1KIK A;  4P5N A;  4F17 A;  1OU9 A;  4PJO C;  5J3B A;  3PMI A;  2DZC A;  5GAO l;  2QEX A;  3HSB A;  1VIF A;  2RD1 A;  2EKH A;  3MEV A;  4CC2 A;  1OZ3 A;  3FEO A;  3CPW A;  2RHZ A;  5DLQ E;  3MP1 A;  2LQW A;  5GAN 5;  4Y92 A;  1ZLM A;  3CC4 T;  5GAN 8;  1Q82 R;  1U8R A;  5FWC A;  3X25 B;  5I21 A;  4M7A D;  2O4X A;  4E7I A;  1LOJ A;  2LZ6 B;  4J7I A;  1VQ8 A;  5FLX E;  3JCM g;  4OMP A;  4JS5 A;  1AOJ A;  4B9X A;  3D7S B;  2Y4X A;  3CMA T;  4JJB A;  4XTV A;  4KGZ B;  3LH5 A;  1BBZ A;  1PWT A;  4ZTF A;  2WSC E;  3MCA B;  3GNG A;  2EWN A;  2X51 A;  2CT3 A;  4PJO G;  3C94 A;  2O31 A;  2ZPE B;  4C0G A;  5J26 A;  3QKJ A;  3S3O A;  3ASK A;  3ULR B;  1UDL A;  1IHV A;  2C0T A;  1AD5 A;  3T9N A;  1N6A A;  1QLY A;  5ECA A;  3E19 A;  4Y91 A;  1G3T A;  3OYG A;  3EG2 A;  5FU6 C;  2BZX A;  2RI2 A;  2XIC A;  4OMQ A;  1UHC A;  1VYU A;  3A5Z B;  3CBP A;  2M51 A;  1ABQ A;  4JS4 A;  1QKW A;  1GXI E;  4M75 F;  3OYJ A;  1HJD A;  4RG8 A;  4XTW A;  1ZSG A;  2VKN A;  2ZGW A;  5HCK A;  1YJW T;  4M77 E;  1G5V A;  3SFM A;  4FU6 A;  4J9E A;  1WFW A;  1MND A;  1U3O A;  2NYS A;  4PJM A;  4JJN K;  1PD1 A;  3QYG B;  4M75 C;  1IB8 A;  3CME Q;  3WVE B;  2DYI A;  2L3Q A;  4AFQ C;  1MGQ A;  1UHF A;  5KH6 A;  4DBQ A;  3VS5 A;  2FPF A;  4AFU C;  1OU8 A;  2DYB A;  3CCJ A;  1NJI U;  2QGF B;  1K9A A;  3NTH A;  4WCI A;  1RLQ C;  4BY6 B;  2L8D A;  3NFC A;  3CCV T;  3UAT A;  3H8Z A;  4DBR A;  2WSE E;  2VB6 A;  4N4G A;  1V76 A;  1K73 R;  2CH4 W;  4RTU A;  1Z9Q A;  1HXD A;  3G1J A;  2CZ7 B;  4B6M A;  1M1K U;  3MET A;  1WNL A;  4OB1 B;  4QVC A;  3RBB B;  4RKU E;  4F16 A;  3L2Q A;  3CD6 A;  5D6W A;  5KE2 A;  1VYT A;  4EMK C;  4M75 B;  4BE0 A;  1WHJ A;  1S1N A;  3M0Q A;  1I81 A;  3EAE A;  3SWN C;  3P8B B;  2RQV A;  2PQW A;  5HKC A;  1JJ2 S;  1VQO A;  2AT1 B;  2EFI A;  1FWZ A;  2RK1 A;  4XU1 A;  3ER0 A;  4JRK A;  2FRY A;  1VQ8 T;  3E1S A;  1R0B G;  2BZ8 A;  4C92 B;  1VQ7 T;  4KGX B;  2DBM A;  4X34 A;  1VQP A;  3QZ5 B;  7AT1 B;  1WIE A;  2EKO A;  4C92 E;  2KRN A;  2LX9 A;  4E47 A;  1M8M A;  2DO3 A;  3JCM h;  2KQW A;  3QWX X;  1JJ2 A;  4O6J A;  1LVK A;  4ELZ C;  1WYX A;  2LX7 A;  2RMO A;  5LJ3 g;  2KRS A;  2EQU A;  2QDY B;  5FRO A;  1AT1 B;  1GL5 A;  2CH4 A;  1CSK A;  5M9O A;  1IGQ A;  4ANJ A;  3MEU A;  1NPP A;  1F1B B;  4M7D F;  2JOY A;  4E2F B;  2EIF A;  4TVR A;  1KK7 A;  5FRN A;  2RHX A;  1KC8 R;  1HSQ A;  4C92 A;  1VQK Q;  3I55 Q;  3C0C A;  1K8A U;  2E5Q A;  1BCO A;  2EYX A;  3RR6 A;  3QXE B;  2LJ1 A;  1Q81 C;  3HP9 A;  3E9F A;  2KRO A;  1T3L A;  2X3X D;  3EH2 A;  3MJX A;  1T0H A;  4D6W A;  1ZUK A;  3I56 Q;  3X28 B;  1VUB A;  3VS2 A;  2HZY A;  2Z0W A;  2HD0 A;  4OB2 B;  2X4X A;  1YHQ T;  2R58 A;  1SSF A;  4Z89 A;  1MHN A;  1TG0 A;  1Q82 C;  3GIB A;  2K5F A;  5HK3 A;  2NUP B;  3FLG A;  1NG2 A;  3M56 A;  4KUL A;  2CP0 A;  3M55 A;  2HSP A;  3RKW A;  1MMG A;  2EYW A;  3PVL A;  9ATC B;  5D6X A;  3CCS Q;  4J9G A;  4BAC A;  2I2L A;  3UDC A;  2ZPH B;  4MML A;  3RKY A;  5GAO r;  5CIU A;  3JCM e;  3JCM d;  5AT1 B;  5L8R E;  3RER A;  3HHT B;  3TSW A;  4OMO A;  1RAB B;  4M7D G;  2DL8 A;  1IXD A;  2CP3 A;  1UEB A;  2J6K A;  5GAM j;  1XNI A;  5GAN h;  2DF6 A;  2DTO A;  1ZA1 B;  2K5I A;  3MPU B;  1YN8 A;  1JRI A;  1G3W A;  2RQU A;  4PL6 A;  2MI6 A;  4C8Q B;  4VUB A;  4LDV A;  2DMO A;  3MO8 A;  1ZUY A;  1K73 U;  1WXT A;  2A37 A;  1YJ9 T;  1U1T A;  5GAN 3;  1AWW A;  1Q95 G;  1EX4 A;  2DAQ A;  4F7U B;  3A8G B;  4C8Q E;  2NUP A;  1IRX A;  1VQN T;  1R8O B;  4A4H A;  1JBM A;  4HT8 A;  4M78 F;  3OYM A;  2CUB A;  4F7U E;  4DBH A;  5GAO m;  1G3S A;  3OA6 A;  2AK5 A;  4QVD A;  4ORZ A;  2JT4 A;  2CP5 A;  1FXX A;  4C92 D;  4JJD A;  3V7C A;  3PIP A;  3C4S A;  3I9Q A;  1RL2 A;  2G6F X;  2HQH A;  3V8L A;  4EMH A;  4Q5W A;  2XDD A;  3G71 T;  3QJ6 A;  4LNP A;  4M78 C;  5CQY A;  4C8Q A;  4C0D B;  2H8H A;  2EQK A;  2IG0 A; 
#chains in the Genus database with same CATH homology
 1VIE A;  3S6W A;  1M1K C;  3JCM V;  4LDY A;  1O75 A;  2K3Y A;  2M1H A;  2RJE A;  3CPF A;  4LDX A;  1B34 A;  4F7U A;  2XD0 A;  1M8V A;  4KUD K;  3MEA A;  3M59 A;  4FT2 A;  3S3M A;  2XDB A;  5LJ3 h;  4BY6 C;  1YBY A;  2DPP B;  5HK0 A;  3OS0 A;  3FJP A;  2BIV A;  4M77 B;  2M16 A;  4IUT A;  2JUF A;  1HK9 A;  5CCA A;  3V8K A;  4J6X A;  2DIQ A;  3ZBD A;  3OYA A;  2LCL A;  4N4H A;  5GAM h;  3GP8 A;  4M7D C;  2E1H A;  2DVE A;  1VQL A;  3BW1 A;  3LGL A;  3OSV A;  2RHU A;  2R5M A;  4QQ6 A;  4QQG A;  3VYH B;  4PLL A;  2EQJ A;  1NZ9 A;  3CCS T;  4JRQ A;  2BUD A;  2ZCF B;  4ZTJ A;  1M4Z A;  1BIB A;  4C5H A;  1YIJ T;  4C92 F;  3JB9 G;  4J7F A;  3LW5 E;  4MZM A;  1BYM A;  4EMK A;  3LWH A;  1S72 A;  1M9S A;  2CS7 A;  2E70 A;  3P8D A;  1KC8 U;  1KD1 C;  3X20 B;  4Y28 E;  2OTJ T;  3QDR B;  3CCQ T;  4RCC A;  4PJO F;  3CPW S;  3SWN A;  2AHJ B;  4DOV A;  2O4X B;  3MP8 A;  4X9D A;  4Z02 A;  3NTK A;  3VV0 A;  3CCJ T;  2HNI A;  2GF7 A;  4M78 B;  4OB0 B;  4QVZ A;  5LJ5 f;  2PUO B;  3FRN A;  4FSX A;  1YHQ A;  5CQX A;  5I2M A;  2EJF A;  2K4Y A;  2EYQ A;  3J81 E;  3DLM A;  1K9M C;  1M1G A;  2DTI A;  3L2Z A;  5CVI A;  3OW2 S;  2DXB A;  4QW2 A;  4MDX A;  3O8V A;  4O5V A;  3OYN A;  4C92 C;  2RH2 A;  1BI2 A;  2KY9 A;  4NL2 A;  4M77 A;  4A4E A;  4J83 A;  4XAX B;  4LDU A;  4XQ3 A;  4C5E A;  4WF2 A;  3BDL A;  4P5N A;  4ME7 A;  3JRZ A;  4HCZ A;  5J3B A;  4PJO C;  3PMI A;  2DZC A;  2NLU A;  4XK8 E;  5GAO l;  1N9S A;  2QQR A;  2QEX A;  4IKF A;  5GAN g;  3HSB A;  1VIF A;  2RD1 A;  3MEV A;  1X6O A;  1YCY A;  2EJ9 A;  2MAM A;  2QQA A;  1OZ3 A;  3FEO A;  3FDR A;  4OGE A;  3CPW A;  4L6V 5;  2RA2 A;  4BI8 B;  2DD4 A;  3J7A F;  2RHZ A;  4M7D B;  3M54 A;  3CD6 T;  5DLQ E;  3JCM f;  1WPY A;  3MP1 A;  3ZEH A;  2H3J A;  3JCM W;  1W2B S;  2F69 A;  5A2Q E;  3TU4 K;  2D6F A;  5GAN 5;  4M7A E;  3OYL A;  3CC4 T;  5GAN 8;  2PUK B;  2MWP A;  2XDP A;  1U8R A;  3VJP A;  4ELY C;  3LWI A;  2DKG A;  3PIO A;  2VV5 A;  3EFR A;  2DZ9 A;  4L5G A;  4KT0 E;  4ZN1 A;  5CAI A;  4M75 G;  3M4G A;  3X25 B;  5I21 A;  4C5I A;  3CCR T;  1VQO T;  1M90 C;  4M7A D;  2O4X A;  4M75 D;  2D0Q B;  1K8A C;  2K57 A;  2JVV A;  4E7I A;  2QQB A;  1LOJ A;  4J7I A;  3CCL T;  4IUV A;  1Q81 U;  1ZHI A;  4IUU A;  3URG A;  5GAO q;  5FLX E;  3OYB A;  3OS1 A;  1VQ8 A;  5D6Y A;  3JCM g;  3CC2 A;  1N8R U;  3QO3 A;  1YJ9 A;  4NOY A;  4JS5 A;  4B9X A;  3CC7 T;  2Y4X A;  3R6O A;  1Q7Y U;  4HCC A;  4C8Q D;  2CZ1 B;  1VQP T;  3CMA T;  2RK2 A;  4J6Y A;  3OYK A;  4XTV A;  3HRS A;  5LJ3 e;  4FM4 B;  5LJ3 d;  1VQN A;  4C92 G;  4ZTF A;  1KHC A;  1W2B A;  1TH7 A;  1IRE B;  3OQ5 A;  2WSC E;  3MCA B;  3GNG A;  2OAU A;  2EWN A;  1VQ5 T;  2YRV A;  3FC3 A;  4C0F A;  3UPU A;  4PJO G;  4BI4 A;  1VQ4 T;  3A8M B;  1QP3 A;  2ZPE B;  2LTO A;  3C94 A;  2P0Q A;  2RI5 A;  3M57 A;  5DY9 A;  2DK3 A;  2JTF A;  3QKJ A;  5J26 A;  4C0G A;  5GAN 6;  1LNX A;  3ASK A;  3M53 A;  3S3O A;  1Q82 U;  4LDW A;  2F5K A;  5CR2 A;  3A8H B;  3I55 A;  3Q1J A;  2WSF E;  3T9N A;  1N6A A;  3E19 A;  4Y91 A;  3G6E T;  2JNG A;  3CME A;  1G3T A;  2C06 A;  2GQV A;  5GAN 4;  3C12 A;  3EFS A;  3OYG A;  4HT9 A;  4EDU A;  1YJN T;  5FU6 C;  3DLL A;  2XG8 D;  2RHI A;  3SDZ A;  4B9W A;  1BKB A;  2PVD B;  2RI2 A;  2XIC A;  3G71 A;  3A5Z B;  3CBP A;  3L2W A;  4X9C A;  4XTY A;  3OYY A;  2FL7 A;  2X4J A;  3KBG A;  3CCM A;  2OTL A;  3I56 A;  4ATO A;  4N0A A;  1D3B A;  2R5A A;  4MZP A;  3HFO A;  1VQM A;  4JS4 A;  2LCC A;  1UB4 A;  2GCX A;  1BI3 A;  4II1 A;  5EG2 A;  4BUG A;  4YTL A;  5CKB A;  3CCU T;  4M7A F;  3MEW A;  4M75 F;  5GAM g;  1GXI E;  3V7S A;  2LT4 A;  2F5T X;  4L59 A;  3OYJ A;  3CCE T;  2P0P A;  2XKO C;  4BDY A;  4RG8 A;  4XTW A;  4A4F A;  3OS5 A;  1OI1 A;  5LJ5 j;  1VQ9 T;  2ZGW A;  3FIF A;  1BIA A;  1WGS A;  1W4S A;  2CZ6 B;  4J5Y A;  3L2V A;  4M77 E;  4XTZ A;  3S3N A;  1YJW T;  2HQX A;  4C8Q F;  1OYX A;  1G5V A;  3SFM A;  4FU6 A;  3X26 B;  1UGR B;  1UGP B;  2EJG A;  3OS2 A;  3JB9 H;  1NE8 A;  2DJZ A;  2E10 A;  5GAO n;  4JJN K;  1K73 C;  5GMK j;  2KVQ G;  4M77 D;  4CI0 C;  3QYG B;  5KCO A;  3JAM E;  3OBW A;  3PNW C;  4F7U F;  4R56 A;  4M75 C;  3QHS A;  1XTD A;  4IUQ A;  3WVE B;  2E12 A;  4HCB A;  1KHI A;  1MGQ A;  2YLB A;  4DOW A;  3L2U A;  5KH6 A;  5GAN f;  1X75 C;  1KQS S;  2RJC A;  1QP2 A;  1S72 T;  4XTU A;  2XID A;  3OMC A;  3SB2 A;  4C8Q C;  1KQ2 A;  2OTJ A;  2IVW A;  3FB9 A;  3CCQ A;  2L3R A;  3OYC A;  5A0G A;  4KBM B;  3G4S A;  3LH0 A;  4JLI A;  5CKH A;  2FYK A;  4JRP A;  3CCJ A;  2LT1 A;  3OYE A;  2LVM A;  2RM4 A;  1NJI U;  2RI3 A;  4M78 E;  3WXM B;  5LJ5 e;  5LJ5 d;  2ZZD A;  3OY9 A;  2XHC A;  1Q86 U;  1ZQ1 A;  3HRU A;  1VQ6 A;  2E64 A;  3LYI A;  3CBM A;  2KAF A;  2L89 A;  3NTH A;  1M5Q 1;  4OVA A;  3QYH B;  3UWN A;  4BY6 B;  2L8D A;  3NFC A;  3JB9 I;  3CCV T;  4BE1 A;  3OYI A;  3H8Z A;  3KXT A;  3KUF A;  2LNV A;  2WSE E;  4N4G A;  2E65 A;  4DA4 A;  3RUX A;  1HXD A;  3AHU A;  5IN1 A;  2CZ7 B;  1KQS A;  2FB7 A;  2HAX A;  1M1K U;  3MET A;  4N4I A;  4UC4 A;  2VGM A;  1WNL A;  1QVF S;  3OW2 A;  4OB1 B;  3HPW A;  4QVC A;  1IZ6 A;  3GNF B;  4JRI A;  4RKU E;  3PTA A;  3L2Q A;  4M7A G;  4M7D E;  3CD6 A;  5D6W A;  5KE2 A;  2XU8 A;  1WJS A;  4M77 F;  4EMK C;  4M75 B;  5KCH A;  3CC4 A;  2WAC A;  4RCB A;  3OYD A;  1ZBX A;  4FT4 A;  4M78 A;  4BE0 A;  3LX7 A;  4DQ2 A;  4LD6 A;  1EIF A;  1I81 A;  3EAE A;  1O9S A;  3SWN C;  2LDM A;  3C95 A;  3P8B B;  2QA4 A;  1PSE A;  2PQW A;  2VUB A;  4C0D C;  5HKC A;  5LJ5 h;  3PT9 A;  4C8Q G;  3CCR A;  3GPL A;  2EFI A;  4BDZ A;  2RO0 A;  1VQO A;  1FWZ A;  3JCM b;  5DLO A;  3QJY A;  4J6W A;  1Y7X A;  2RK1 A;  4XU1 A;  1N9R A;  3OMG A;  3F70 A;  3ER0 A;  4JRK A;  3VU3 C;  2HBP A;  1YI2 T;  3HRT A;  1VQ8 T;  3E1S A;  4F7U G;  2FVU A;  3UT1 A;  4C92 B;  3CC7 A;  1VQ7 T;  1PSF A;  1QVF A;  4X34 A;  1B34 B;  5GMK h;  1VQP A;  4M77 C;  3QZ5 B;  2K2V A;  2A3L A;  2BKD N;  1FX7 A;  5LJ3 f;  4EPC A;  3CXC S;  1KD1 U;  5CKD A;  5LL6 S;  3X24 B;  1LJO A;  4BB7 A;  1VQK A;  4JUV A;  1N27 A;  2EKO A;  5CK9 A;  2R57 A;  1YIT T;  2K3X A;  4PJO B;  4M7D A;  4GLK A;  2DTH A;  1VQ5 A;  1M1F A;  2M9U A;  2QQS A;  1WQ7 A;  2LX9 A;  2M0O A;  2P0K A;  1KQ1 A;  3VUZ A;  4C92 E;  5GAM f;  5DM7 R;  4E47 A;  3MHX A;  3CEY A;  3JCM c;  2DO3 A;  3BFM A;  4FL6 A;  3JCM h;  1K9M U;  2KQW A;  1JJ2 A;  4NS5 A;  4PJO E;  4O6J A;  4QQD A;  2KDS A;  3H6Z A;  3LLR A;  2VGN A;  3TEE A;  1BI0 A;  1KC8 C;  4E7H A;  4KUI A;  4ELZ C;  2KSS A;  5LJ3 g;  2GFU A;  2EQU A;  2QDY B;  4XU0 A;  5C0M A;  3CME T;  1V29 B;  4XTX A;  4HA8 A;  3L2R A;  5FRO A;  2JZ2 A;  2LC4 A;  2ZPF B;  5M9O A;  2FHD A;  2CZ0 B;  3MEU A;  2DXT A;  3CXC A;  2ZPB B;  2OTL T;  3CCM T;  1NPP A;  4ZN3 A;  4CRI A;  3HKS A;  4BD3 A;  4JLG A;  3JCM J;  5GAN j;  4M7D F;  2JOY A;  3RMS A;  5I2S A;  3WVD B;  2L5Q A;  2EIF A;  5A0D A;  5GAO p;  3QPH A;  4TVR A;  4PNO A;  5FRN A;  2RHX A;  2DIG A;  1QVP A;  1XOV A;  2Y90 A;  4C92 A;  3CCE A;  2P4T A;  4M77 G;  3DB4 A;  1VQ9 A;  4RMO A;  1M90 U;  1I4K 1;  4PJO A;  2VYT A;  3DKM A;  1VQL T;  1K8A U;  1YJW A;  2E5Q A;  2PVG B;  4M7A C;  4IUP A;  1H3Z A;  2YHT A;  3QXE B;  2RB6 A;  2Y4Y A;  3CCS A;  4E7L A;  3ZFJ A;  3N5B B;  1Q81 C;  3HP9 A;  5FU7 C;  3E9F A;  2G3R A;  1KG1 A;  4MDW A;  1YIJ A;  1N8R C;  3NTI A;  3QSU A;  3LGF A;  3QZ9 B;  2XK0 A;  4D6W A;  4ZGE B;  2VC8 A;  3G7Z A;  3BY7 A;  3HFN A;  3RMQ A;  1Q7Y C;  5FRM A;  3X28 B;  3M4Y A;  1VUB A;  5FU6 B;  2KK4 A;  2K5L A;  2CYZ B;  2HD0 A;  4C0Z A;  1QVG S;  4OB2 B;  3OYF A;  2X4X A;  5IT9 E;  2QI2 A;  1YHQ T;  1G3Y A;  2R58 A;  4OGC A;  5GAN e;  3JCM Q;  5GAN d;  1SSF A;  3QII A;  3QG1 A;  1JB0 E;  2GFA A;  4N0A C;  3TRE A;  4E7K A;  3JB9 D;  3E9G A;  1MHN A;  2RHY A;  4MZT A;  4M78 G;  3G4S T;  3GOX A;  2XI9 A;  3INZ A;  3V7R A;  1NPR A;  5IAY A;  1Q82 C;  3TCJ A;  3GIB A;  2K5F A;  2RJD A;  4M78 D;  4R55 A;  5HK3 A;  3BDU A;  3RIR A;  2JN0 A;  1XQH A;  5GMK l;  4V2S A;  3FLG A;  2LRQ A;  1Y07 A;  3L1A A;  4A54 A;  1X01 A;  1VQ6 T;  5CO7 A;  1BI1 A;  5GMK e;  3M9Q A;  2VXE A;  3MP6 A;  3M56 A;  4KUL A;  3CCV A;  3M55 A;  2QEX T;  5CKE A;  5HY6 A;  3M58 A;  2EAY A;  2X35 A;  3RKW A;  3V8J A;  3RES A;  3PGG A;  4A4K A;  2YLC A;  3HL8 A;  5D6X A;  2LQK A;  2PU9 B;  4BAC A;  4OP0 A;  2I2L A;  3OYH A;  3UDC A;  2ZPH B;  4MML A;  5LJ3 j;  1QVG A;  2ZPI B;  3RKY A;  5CIU A;  5GAO r;  3JB9 J;  3JCM e;  3JCM d;  4XU2 A;  5L8R E;  4M7A B;  5LJ5 g;  3RER A;  3HHT B;  4M7D G;  1AHJ B;  2RJF A;  3OB9 A;  1Y96 B;  5FU7 B;  1UEB A;  5GAM j;  4M7D D;  3A8O B;  1XNI A;  5GAN h;  3M5A A;  2QXF A;  2DTO A;  4GY5 A;  2K5I A;  1UGQ B;  2E41 A;  4BE2 A;  2DD5 A;  1JRI A;  1G3W A;  3QBY A;  4PL6 A;  3ME9 A;  4M75 E;  3GLX A;  2MI6 A;  3GF5 A;  1RI0 A;  1WQW A;  3DB3 A;  4C8Q B;  1I5L A;  2E6N A;  3VKI A;  4VUB A;  3CCL A;  4RG2 A;  4LDV A;  2DEQ A;  2V8K A;  2V8J A;  3MO8 A;  3J80 E;  2QA4 T;  3CC2 T;  3OSS C;  4PLI A;  1K73 U;  1DJ7 B;  4XU3 A;  1UGS B;  4C5G A;  5GMK m;  2QTX A;  1YJ9 T;  4OMF B;  3PMT A;  1QW1 A;  1U1T A;  2QQ9 A;  5GAN 7;  1U1S A;  5GAN 3;  2CGH A;  4F7U B;  2DAQ A;  3CMA A;  3VUB A;  1WJQ A;  2ZPG B;  3A8G B;  4C8Q E;  1D3B B;  1H64 1;  2O01 E;  3JB9 F;  5A0L A;  1VQN T;  1YI2 A;  1R8O B;  4MMK A;  2CKK A;  4A4H A;  3VYG A;  4ZGD B;  2JTM A;  5GMK i;  4E7J A;  1JBM A;  4A4G A;  1VQ7 A;  4HT8 A;  2KMT A;  4M78 F;  3OBY A;  3SD4 A;  3OYM A;  2X4W A;  1VQ4 A;  4F7U E;  4IUR A;  3JCM X;  4J8O A;  4OB3 B;  2MMP A;  3CCU A;  3A8L B;  5GAO m;  3QUI A;  2PVO B;  1G3S A;  5C6S A;  3OA6 A;  5AYF A;  1YIT A;  1VQK T;  4PKC C;  3L42 A;  1Y71 A;  5J39 A;  4QVD A;  4NL3 A;  4C92 D;  1FXX A;  2EQM A;  3P8H A;  3V7C A;  3PIP A;  3I55 T;  3C4S A;  4LD9 K;  4BI3 A;  1NJI C;  4FIB A;  1RL2 A;  5GAM e;  1WJR A;  2LQ8 A;  4M75 A;  5GAM d;  4M7A A;  3G6E A;  2DXU A;  4JDS A;  4ZGJ B;  1Q86 C;  1OZ2 A;  3V8L A;  2MF2 A;  4PJO D;  1Y96 A;  4EMH A;  1YJN A;  2D9T A;  4Q5W A;  5CKF A;  2HQE A;  1JJ2 S;  2DXC A;  2XDD A;  4EMK B;  4OF1 A;  3G71 T;  5KE3 A;  3QJ6 A;  4M78 C;  2VXF A;  2MWO A;  2A7Y A;  2X4Y A;  3CBO A;  2B8A A;  3RKX A;  5GAN 2;  5CQY A;  3SWN B;  4C8Q A;  1I8F A;  3I56 T;  3JSC A;  4A53 A;  4C0D B;  1VQM T;  1P92 A;  4EMG A;  2V8I A;  4HKE A;  2EQK A;  2IG0 A;  3PFS A;  2E6Z A;  3JCM P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...