2X3WD

Structure of mouse syndapin i (crystal form 2)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
VRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN KINASE C AND CASEIN KINASE SUBSTRATE IN NEURONS PROT
publication title Molecular Basis for SH3 Domain Regulation of F-Bar-Mediated Membrane Deformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2x3wD00
2J6FA 3NMZC 1IO6A 3REAB 2HCKA 3M0TA 1UJ0A 3VRZA 4LE9A 2KNBB 4WCIA 1WLPB 1UTIA 1VYUA 2D8JA 1GCPA 1JXOA 2F2XA 4ESRA 1I07A 2K9GA 1E6HA 1M8MA 2RQUA 3VS1A 4LUEA 1W1FA 2KR3A 2PNIA 4HCKA 1YCSB 3RBBB 2EGAA 4DEXA 2YUNA 2I0NA 3ZL7C 4GLMA 1H3HA 2DJQA 1ZSGA 3ULRB 2RQWA 1Z9QA 4RTUA 1K0SA 3JV3A 1WXTA 3M0QA 3SHWA 1UUEA 1TUCA 1E7OA 2LCSA 1NEGA 4JJBA 3EG1A 1RLPC 1B07A 2A36A 2M51A 2RN8A 1WX6A 2EYWA 2V1RA 4JPBW 5FWBA 2J7IA 4ORZA 2KRNA 3CQTA 2XMFA 1PRLC 2YDLA 4K11A 1QWEA 5IH2A 1PWTA 1K0XA 4CC4B 5L23A 1AZEA 2DBKA 2SEMA 2IIMA 3VS0A 1AWJA 2DL7A 2KXCA 1HJDA 3H0HA 2GTJA 3M0PA 2EKHA 1X6BA 1QKXA 2FPDA 2JMAA 2V1QA 3VS6A 4J9DA 2RQRA 1UE9A 2DA9A 1PHTA 1RI9A 2DMOA 1NLPC 2DL3A 2VWFA 3FJ5A 2LX7A 1BB9A 1M3CA 2ESWA 1GBRA 3I35A 1GCQC 3I5RA 4J9GA 1N5ZA 3H41A 2CSIA 2RQTA 4CC2A 4AFQC 1NLOC 2RF0A 1AWWA 1UG1A 4AFSC 4D8DA 1WA7A 1VYTA 4HVWA 1K4US 1KSWA 1ZUYA 1Y57A 1H92A 1QCFA 2CT3A 4F16A 1GL5A 2EW3A 2OI3A 2MCNA 1U3OA 1AD5A 2K79A 2DRKA 1ABQA 3R6NA 3C0CA 1E6GA 2ED0A 1I0CA 1WXBA 2KRSA 1ZBJA 2JMCA 2O2OA 1Z9ZA 5HCKA 1PNJA 4RTZA 2LQWA 4Z88A 2K3BA 3PE0A 2MOXA 2GTOA 1SEMA 1X27A 1FMKA 4Y92A 2F2WA 1M3BA 2JM8A 1GFCA 1ZX6A 1YWOA 1W70A 2OAWA 1M27C 2D1XA 2CREA 1AOJA 2EGCA 2JXBA 2NUZA 3IQLA 1GCQA 3VS4A 3TSWA 1GFDA 2GBQA 1GRIA 3VS5A 2O9SA 2KE9A 4J9HA 2DL4A 2L2PA 1X69A 2E5KA 2KT1A 4GBQA 2EVRA 2K7AA 3NPFA 1AZGB 1X2QA 4AFZC 2ROLA 1SRLA 2FEIA 2RMOA 3TVTA 3QWXX 1T0HA 1MUZA 1PKSA 1HD3A 1KIKA 3GBQA 2KYBA 5IHKA 1HSQA 3NGPA 1TG0A 2J6KA 1W6XA 1J3TA 3EG0A 3LH5A 2DL8A 1OOTA 2JT4A 4J9CA 1B3QA 1PKTA 3EHQA 1ZUKA 5GJWB 2HDAA 2JS2A 1U5SA 4F14A 3UF4A 4J9FA 2HEQA 4OMNA 2JTEA 2J6OA 1WIEA 1BU1A 4A63B 2DRMA 1K1ZA 1Y0MA 2L0AA 2D8HA 1SPKA 4J9IA 2EPDA 2ABLA 5IXFA 4EIKA 4JZ4A 4IIMA 1RUWA 2VKNA 4DEYA 2C0IA 2DL5A 2QDLA 2A37A 4QT7A 1OPKA 3QWYA 2W10A 3NHNA 2EYZA 2ENMA 1X43A 3THKA 2A28A 3EHRA 4Z8AA 2AZSA 4KRTA 1BK2A 1G2BA 1NEBA 1YWPA 2JM9A 3RNJA 1AWOA 2C0TA 2ROTA 2KGTA 2CH4A 2OJ2A 3EG2A 3EGUA 2DNUA 2DF6A 2DLPA 1AVZC 1WDXA 2LZ6B 2DM1A 3PVLA 4HVUA 1MV3A 4R0KA 2K2MA 2SRCA 1EFNA 3VS2A 1YNZA 2LNHB 3H0IA 3VS7A 1JXMA 1NM7A 2BZXA 5EC7A 1MV0B 3UA6A 4D8KA 1A0NB 1CSKA 1FYNA 2AKLA 2AZVA 2PZ1A 4J9BA 1OV3A 1T3LA 4LN2A 3VRYA 3I5SA 2RPNA 3PVQA 1BBZA 2FO0A 1KFZA 2AK5A 2AKKA 2DVJA 3SEMA 2X3WD 1RLQC 2DYBA 2YSQA 4OMLA 4OMPA 1NYGA 1M30A 1UHFA 2FPEA 4HXJA 2F2VA 2MIOA 2DBMA 1UECA 4JZ3A 1ZLMA 1JQQA 1YP5A 2GNCA 1QKWA 1WI7A 2BZYA 1QWFA 2FRWA 2VVKA 1T3SA 1K9AA 3TSZA 4E6RA 2EYXA 1WFWA 2L3QA 2FPFA 5IHNA 2FG0A 2KT8A 1SSHA 2JS0A 2L3PA 2X3XD 2KRMA 3A98A 4AG1C 1UJYA 3O5ZA 2A08A 3VS3A 3M0SA 2ECZA 5I11A 2LP5A 2CSQA 1VYVA 2CUBA 4CC3A 1SHFA 2CUDA 2JW4A 4RTYA 2L3SA 1JU5C 2LJ1A 2YUPA 2LMJA 5IXBA 2HSPA 2O31A 4F17A 1XOVA 4OMQA 1AWXA 1NG2A 1ZUUA 3I9QA 1X2KA 2EYYA 2GGRA 1UFFA 4CC7A 2G6FX 1TUDA 5ECAA 1UHCA 1QLYA 1WYXA 5GJVB 2YUOA 2KXDA 3M0UA 4J9EA 1UDLA 3H0FA 1ABOA 2EBPA 3U23A 1KJWA 2BTTA 2W0ZA 4LUDA 1UGVA 1K76A 1X6GA 4OMMA 4M4ZA 3M0RA 4ZNXA 1VA7A 4OMOA 4RTWA 2YT6A 2KBTA 1NYFA 1I1JA 2YUQA 1M3AA 1JEGA 4JJDA 2J05A 4AFUC 4FSSA 4RTTA 1PRMC 1OEBA 2HBWA 2LQNA 1ARKA 2M0YA 2RNAA 1YN8A 4RTXA 1SRMA 2GQIA 4IIOA 2EGEA 2O88A 1T0JA 2CH4W 1AEYA 2DE0X 4HVVA 1H8KA 3KFVA 1OPLA 2H8HA 1V1CA 2NWMA 1JO8A 4RUGA 3REBB 1G83A 1SHGA 2CDTA 2DX1A 2KROA 4RTVA 3UA7A 2K6DA 2DILA 5FWCA 2ED1A 2LJ0A 5I22A 1CKAA 1WXUA 2EQIA 5IHIA 2KYMA 2C0OA 2D0NA 1LCKA 1GBQA 5FW9A 2PTKA 2FRYA 4LNPA 3EG3A 2O9VA 2RQVA 2KEAA 4X1VA 4JJCA 1U06A 4Z89A 2B86A 2CT4A 2J06A 4AG2C 3UATA 2LJ3A 1CKBA 2BZ8A 2P4RA 1S1NA
chains in the Genus database with same CATH superfamily
2J6FA 4UC4A 2HL5C 5KYWA 2CZ1B 3CC2Q 3JB9I 4IUPA 1M1KC 1X01A 2RHIA 1VYUA 2D8JA 3S3NA 1VQ4T 1E6HA 2DXUA 4RG2A 4MDXA 4C0FA 5GAN4 1B7TA 2CP6A 4F7UG 4J7FA 1D1CA 2DO3A 3QPHA 2QAZA 3JCMe 2DAQA 4OB0B 3CCQT 2MAMA 1H3HA 2DJQA 1FMWA 2XHCA 3JCMg 2RQWA 4A4EA 1C0MA 3JV3A 5GMKj 3R6OA 2E3HA 2XIDA 3HRUA 1BIBA 4JJBA 4BI8B 2M51A 2RN8A 4NOYA 5FWBA 4MDWA 4ORZA 1PRLC 1WQ7A 4K11A 4C92F 2LTOA 3CPWP 1PWTA 3QDRB 2OTLQ 1WHLA 1K73U 1K0XA 5GAOm 2HQHA 1AZEA 3CC7T 3QZ5B 3FRNA 2KXCA 3META 2ZPHB 1M2VB 2GTJA 1UEBA 2AHJB 1WZOA 2FPDA 2JMAA 1Q7YU 3J81E 3MEVA 3MEWA 2LCCA 3PGGA 4GLKA 2RQRA 5CQXA 4M77D 1RI9A 3FIFA 1IHVA 4E7JA 2Y4XA 1YI2Q 1QVFP 1QVPA 1V29B 2M02A 5GAN7 1GCQC 4NL3A 3MP8A 3H41A 2DETA 2DZ9A 2EWNA 2D6FA 4BDZA 2RJEA 1RAAB 2RF0A 3MPUB 4PKCC 5GAOr 1VQ6A 3L2RA 1S72A 1K8AR 1WA7A 3OYGA 1KSWA 1VQOA 3URGA 3G71T 5J26A 4F16A 1GL5A 2EW3A 2AT1B 1AD5A 2K79A 2E41A 5LJ3h 2L89A 4EMGA 1E6GA 2ED0A 2EJFA 3QSUA 4Y91A 1WXBA 2KRSA 1ZBJA 2EJ9A 4ELYC 4A4KA 2LQWA 1UB4A 2K3BA 4PJMA 3A8OB 4RG8A 3E1SA 4C5EA 1AHJB 3EFRA 4JRIA 4BACA 1YWOA 1OULA 1WHMA 1W70A 2OAWA 3QJYA 4O5VA 1AOJA 4IUVA 9ATCB 3OMGA 2OX7A 3JCMV 1O9SA 2DPPB 3CPFA 2F5TX 1IRXA 2M0OA 3TSWA 3CMEA 1N9RA 4ZGDB 1GRIA 5J3BA 3VS5A 1KK7A 4BD3A 2O9SA 2RI2A 1Q86U 3OYBA 1X69A 3GPLA 2EVRA 3TEEA 3SFMA 3PMTA 2ROLA 2FEIA 3QWXX 3TREA 1K73C 4EPCA 5LJ5f 1PKSA 1YHQA 5A0DA 3CPWS 1KIKA 2COZA 1LJOA 3CC4T 4OB1B 1NZ9A 1HSQA 2HQEA 3CPWA 1J3TA 1Q7YC 3NTHA 3CMAT 3LH5A 1OOTA 1SF9A 1D0XA 2NUPB 4C92D 1EZZB 1QW1A 4LD6A 2QG9B 2HAXA 3UF4A 2X35A 2JUFA 2HEQA 4QQGA 2JTEA 4OGEA 4IURA 2DRMA 2E10A 1Y0MA 4J9IA 1VQ4Q 2ZZDA 1YIJT 4M77G 3KXTA 1AT1B 2A37A 1IGQA 4FYWB 4QW2A 1OZ3A 3QWYA 3GLXA 3NHNA 2EYZA 2ENMA 4M78C 3QKJA 4XTWA 2A28A 2MWOA 1BK2A 1G2BA 1YWPA 1BI2A 4C8QE 3CCQQ 3RNJA 1WQWA 2KGTA 2OJ2A 2V8JA 4M78B 4FYXB 4M75A 3A8HB 2QI2A 4PJOB 4KH1B 1WDXA 2MPXC 3JB9F 4J6XA 3ME9A 4BY6C 3VS2A 5KYYA 1RAIB 3H0IA 4PFPA 1YJWA 3OYNA 1M1GA 1NM7A 2BZXA 4F7UE 1MV0B 3GF5A 2AKLA 2QK0A 1Y07A 3OYAA 4BY6B 3CC7Q 5D6WA 1K8AU 3A1PA 2HKNA 3CCRA 4E7IA 1T3LA 4LN2A 2IG0A 2PQWA 3MJXA 2QTVA 1EX4A 4B9XA 2FO0A 1WNLA 3OSVA 2AKKA 1VQ9T 1G3WA 3BW1A 2X3WD 1Q86C 1NYGA 5KH6A 2COYA 1MGQA 1VQLT 3OS2A 2FL7A 2MIOA 5A0LA 3RKYA 4MMLA 4TVRA 4BUGA 4C5GA 4C8QF 4M7AC 1BCOA 2YLCA 4E6RA 3JRZA 5D6YA 2L3QA 5IHNA 3PIPA 3RKXA 1PD0A 2K57A 1SSHA 3CCJA 2JS0A 4GY5A 3C94A 1MNDA 3OYDA 1UJYA 3N5BB 2A08A 3VS3A 4M7AB 2ECZA 3CXCS 1VQOT 1PCXA 1OYXA 4CC3A 3L2QA 1SHFA 5LJ3d 5KE3A 3CCST 3CXCA 3EG9B 2L3SA 2LJ1A 2YUPA 1W2BP 3OYJA 2HSPA 2DK3A 1VQ7A 1ZA2B 4JLIA 2FZKB 3VUBA 1K9MR 4EMHA 1ZUUA 1X2KA 3CCLT 3DLMA 4CC7A 3G1JA 4C92G 2YUOA 1LNXA 3U23A 1KJWA 1SKUB 5KCOA 3OYHA 4RCBA 4LUDA 4FSXA 1IB8A 2QQSA 3CC2T 4BE0A 1OI1A 4AT1B 2YT6A 4CI0C 3CCMA 5LJ5h 3CMET 1G3YA 3OBWA 3SB2A 4DA4A 4FSSA 3SWNB 1OEBA 4M7DB 2QQRA 2M0YA 2RNAA 1YN8A 3PT9A 2K3XA 3VYHB 1KQSP 4IIOA 2OAUA 5GAN5 3WVEB 2DE0X 2ZPBB 3CCVA 2H8HA 3UDCA 1V1CA 3CC4Q 4RUGA 3JB9D 3S3OA 2CDTA 5GAMh 2DX1A 4DBQA 2MK5A 5FWCA 2ED1A 2LJ0A 5I22A 2YRVA 1N27A 2D0NA 2KY9A 1M90U 4LNPA 2VV5A 2QGFB 3EGDB 2OTLT 4AG2C 2P0KA 3UATA 2LJ3A 1ZSZC 1CKBA 2BZ8A 2P4RA 2LCLA 3G6EA 3E9GA 1WPYA 3ZBDA 2M1HA 3QDFA 2PUOB 2QDYB 1YCYA 3M59A 3REAB 5CAIA 3V8JA 1UJ0A 3VRZA 1TOVA 4ZGJB 1KG1A 2V8KA 2DIQA 4ESRA 1YI2T 3P8BB 1I07A 1M8MA 4KUIA 3VS1A 3L2UA 2F69A 4LUEA 5LJ5e 2VXEA 4PJOA 2RI5A 4HCKA 3L2WA 1YCSB 5LJ5g 4IUUA 2I0NA 3ZL7C 4DOVA 3OYLA 1Z9QA 3OY9A 1K0SA 4J6YA 1WXTA 3M0QA 2JZ2A 1TUCA 5FU7C 1E7OA 5LJ3j 2LCSA 3JCMJ 2RJDA 4N0AA 3EG1A 3C95A 1B07A 1Q81C 4KUDK 5GAMe 3CCRT 2EYWA 3MKDA 2J7IA 2KRNA 3CQTA 2YDLA 1QWEA 2QXFA 5GAMg 2H3EB 2DBKA 1RL2A 1VQPA 3VS0A 4RCCA 2DL7A 2GQVA 1RAGB 4LDXA 1HJDA 4E7HA 3ZEHA 1BCMA 3RERA 3H0HA 4X9DA 1K9MU 1X6BA 3LW5E 2Y4YA 2QGGA 2DL3A 5GAOq 3QYHB 4ZTJA 3FJ5A 1KQSS 1YJ9Q 1VQ6Q 1S72Q 1KQSA 3QBYA 2ZPEB 2CZ0B 3I5RA 4KGXB 4QVCA 1VQOQ 4J9GA 1NJIR 2CSIA 4CC2A 2GFAA 3OA6A 1M90C 3CD6A 2VASA 1UG1A 3DB4A 3VU3C 4HVWA 1K4US 3LYIA 4M78D 2YRDA 1HYOA 1G3TA 3EFOB 1VQ7T 1TWBA 5GANf 2WSCE 4KULA 1R0BG 1U3OA 4L6V5 2DRKA 3X28B 3BY7A 3UT1A 2RD1A 1I0CA 2JMCA 2O2OA 4M77A 2V8IA 1PNJA 4RTZA 1DJ7B 3TU4K 3PE0A 1SEMA 2DXBA 2E3IA 1UGPB 5EG2A 1M27C 3CMEQ 2DD5A 1BYMA 1R77A 2CREA 3OYFA 3GNGA 3RKWA 1XTDA 2HQXA 3CCMT 1Y96B 3OYIA 2L8DA 1YFNA 1C6VX 1WGSA 2QYZA 3HTRA 1XNIA 3OYEA 3VS4A 2M9UA 3CCEA 3E9FA 4DQ2A 4FT4A 2L2PA 1ZHIA 2KT1A 1YHQQ 1M4ZA 2K7AA 2RJFA 3CCVT 2XG8D 3RESA 4AFZC 2LC4A 2RMOA 1T0HA 4LDWA 3E19A 4M75C 1VUBA 3M4GA 4M7AD 1TXQA 1QCOA 2ZAEA 3GBQA 5D6XA 4EMKA 5CR2A 2WSEE 3X25B 2QEXA 1MMGA 4E7SA 2J6KA 1K9MC 3L2VA 1PD1A 3EGXB 2DL8A 3S6WA 4J9CA 1B3QA 1ZUKA 5GJWB 1WHKA 4F14A 2KAFA 2DXCA 1TSFA 5I2MA 4F04B 2L0AA 2D8HA 1SPKA 4EIKA 3HPWA 4FYYB 4DEYA 3JSCA 4E7ZA 2EAYA 4L5GA 2DVEA 2O4XB 2A7YA 3THKA 4N4HA 5KCHA 2QQBA 1YJ9A 2PVOB 5KYUB 3H8ZA 2C0TA 1YJWQ 4PFOA 3EGUA 3QO3A 2DF6A 3V7SA 4M7DD 2BE7D 3M53A 4C92A 1AVZC 1RABB 2LZ6B 1MV3A 4R0KA 1R0CB 4A54A 2GFUA 4M78G 1EFNA 4JDSA 3J7AF 1YNZA 2LNHB 4A4HA 3CCRQ 1H641 1NJIU 4LDUA 4PJOG 5FU6C 1JXMA 3OBYA 1Q82U 4N4GA 2X4JA 4J9BA 2CP2A 1UGQB 4C8QC 3MEAA 4CRIA 3VRYA 1NPRA 3I5SA 5FU6B 5AYFA 4FIBA 1OU9A 2ZPGB 1Y71A 3RDVA 2DVJA 5KYXB 4C8QB 2R5MA 4M75E 1Y7XA 2DYBA 3JCMd 3P8DA 4HXJA 2I2LA 1D3BB 4KGZB 1UECA 4JZ3A 3CCJQ 2GNCA 5CO7A 4D6WA 3L1AA 2VVKA 1D0ZA 2L5QA 1TH7A 2EYXA 3QHSA 2VGNA 4F7UB 2RI3A 2FG0A 3C4SA 3OYKA 3CD6T 2K5FA 3ASKA 1FWZA 2K4YA 2NUTB 2X3XD 3S3MA 3O5ZA 1BKBA 5GAOn 1VQ7Q 2PU9B 1VYVA 2QA4A 5GAMj 1SG5A 1JBMA 1IGUA 3RR6A 3CXCP 4II1A 4M7AG 3JCMc 2O31A 4XU0A 2VB6A 2D0QB 1IZ6A 3I9QA 4KH0B 3HRSA 1UFFA 5GMKl 2LT4A 1TUDA 3JB9J 4M75F 5GJVB 2KXDA 2EQMA 5A0GA 1UDLA 3ER0A 5HK3A 2HNIA 1I4K1 1KD1R 2BTTA 4MZMA 5HKCA 3CCMQ 2DTIA 2HMAA 1K76A 1ZA1B 1Y96A 2L3RA 1H3ZA 4OMOA 4BE1A 4RTWA 2ZGWA 1BIAA 4OF1A 3M57A 2DXTA 1I1JA 2E6ZA 2LNVA 1D09B 1JEGA 4JJDA 3CCET 2J05A 4JLGA 3T9NA 2VUBA 5GAOp 1LVKA 1PRMC 1UGSB 3MCAB 2HBWA 3CCVQ 1NJIC 1ARKA 1D1BA 1SRMA 5AT1B 5GAOl 1Q82C 4XTXA 1WJQA 5M9OA 2XICA 2O88A 3HFOA 4M7DG 3LGFA 1AEYA 3KFVA 4A53A 2ZPFB 3H9NA 3VJPA 5GANg 1VQKA 2PVDB 3REBB 2DD4A 1G83A 2F1LA 2P0QA 3QIIA 3UA7A 2MF2A 1CKAA 3EGXA 1LCKA 4C0GA 1KHCA 2PTKA 2R57A 3G6EQ 2KEAA 3D7SB 4N0AC 1IXDA 1M2VA 4X1VA 3V8LA 4ZTFA 4BE2A 4Z89A 2B86A 2EKOA 2J06A 2IPOB 3I55Q 2EQUA 4XQ3A 1IO6A 1YJNA 3INZA 3LH0A 1I5OB 2CYZB 3GNFB 4LE9A 4N4IA 3A8GB 2E12A 2KNBB 1PM3A 1WLPB 1UTIA 1M1KR 2XD0A 3DLLA 4HCBA 1JXOA 2F2XA 3PNWC 2K9GA 2RK1A 1YJ9T 1VQ6T 2EJGA 4PK4A 1S72T 4LDYA 3L42A 2KK4A 5CKBA 3AHUA 4ZN1A 3HRTA 4XTVA 1VQ5A 1OZ2A 2LX9A 2CZ6B 4F7UF 1YITQ 3RBBB 3HKSA 6AT1B 4GLMA 2CKKA 1QVGS 4DBFA 1ZSGA 4RTUA 3OS1A 1IREB 3M56A 1QVGA 8AT1B 3SHWA 1UUEA 2NLUA 4XAXB 2LT1A 3GP8A 1VQPQ 1PSFA 2A36A 3MO8A 4RKUE 2V1RA 2YWWA 2QQ9A 1MNEA 2BIVA 4B6MA 2XMFA 1G5VA 2HZYA 5IH2A 3I56A 4CC4B 2FYKA 1LPLA 2YLBA 2SEMA 4PJOE 3SD4A 3FB9A 4A4FA 8ATCB 4XU3A 2O01E 3M0PA 2A3LA 2V1QA 5CIUA 1OU8A 2YXYA 3OS0A 3O8VA 3CBMA 1PHTA 2VWFA 2XDDA 5KYWB 2LX7A 3CD6Q 1KD1U 1M3CA 4HCZA 4Z02A 3I35A 3OW2S 3NTIA 1K8AC 2RQTA 3MP1A 1NLOC 1HK9A 1YHQT 3OW2A 4D8DA 2QA4T 2WACA 1VYTA 4A4GA 1ZUYA 2COWA 1Y57A 2RHUA 1H92A 4ATOA 1QCFA 1G3SA 2YRCA 3WXMB 3PIOA 2NUPA 2OI3A 4HA8A 1JRIA 2MCNA 3R6NA 3C0CA 3CBPA 1M1FA 2K5LA 1R8OB 5KE2A 4Z88A 3JCMQ 1PC0A 1MMDA 1G8XA 1FMKA 4Y92A 1I8FA 4RMOA 2DEUA 1ZSZB 3LX7A 3I55A 3A5ZB 1M3BA 5IN1A 2JM8A 1GFCA 3A8LB 4L59A 3C12A 4MZPA 2XK0A 2D1XA 3JCMP 3HFNA 2JN0A 3CCEQ 4C8QD 3ZFJA 2NUZA 3IQLA 3P8HA 3JB9H 2ATCB 2JTMA 4M78A 1BI3A 3DKMA 1GFDA 1RADB 1V76A 2KE9A 3OSSC 4VUBA 2LQKA 4M77E 3AT1B 4E7KA 3EAEA 3NPFA 2CP5A 1X2QA 1YJWT 4PJNA 1SRLA 1M1KU 2QEXQ 3CEYA 1LOJA 1MUZA 1YITA 1M8VA 2WSFE 3FC3A 4ME7A 2Y90A 3OB9A 3G4SA 5D7UA 4AMCA 5GAN2 1K73R 5IHKA 2VGMA 2G3RA 2C06A 5FU7B 4DBRA 3EG0A 3OYYA 2CGHA 3PMIA 5LL6S 2DJZA 4EDUA 4E2FB 2DEQA 1U5SA 1WHGA 3BDLA 4J9FA 4OMNA 4PJJA 1OQKA 1KD1C 2RHXA 2YHTA 4XTZA 2RM4A 2EPDA 4P5NA 4JZ4A 2R58A 3GOXA 4IIMA 1RUWA 2C0IA 2Z0WA 2QDLA 4X34A 5LJ3f 4QT7A 1OPKA 1VQMA 2W10A 4M77F 3JCMb 3CCJT 1X43A 4M7AA 3HHTB 3EHRA 4Z8AA 2AZSA 5CKHA 1VQ5T 3FLGA 3NTKA 1NEBA 4C5IA 2RO0A 1BI1A 4OVAA 3EG9A 1QP3A 2ZCFB 2CH4A 3JB9G 4E47A 4E7LA 1TUGB 3WVDB 2DM1A 5A2QE 2SRCA 4DOWA 5DLOA 2E70A 2X4XA 4X9CA 5EC7A 3V8KA 3F70A 1CSKA 4KGVB 1FYNA 1MMAA 1RAEB 2PZ1A 3HP9A 1RAHB 3RMQA 1OV3A 2KVQG 1U8RA 5I21A 2JOYA 2EYQA 1RI0A 2JNGA 1BBZA 1I5LA 3CMAA 5LJ5d 2GF7A 2AK5A 3A8MB 2CS7A 3SEMA 1U1SA 2E65A 2XDPA 2YSQA 4C92E 4OMPA 4R56A 2FPEA 3SWNA 4HT8A 3JCMW 3Q1JA 4M7DA 4C8QG 1Q86R 1N8RR 1KHIA 1ZLMA 1VQ8A 1QKWA 1WI7A 2BZYA 1QWFA 2FRWA 1YIJA 1T3SA 2EFIA 2OTJA 3JCMX 2QA4Q 5GAMd 3M54A 3BDUA 5GMKm 2L3PA 2DYIA 3A98A 4AG1C 2BUDA 1M2OA 3TQ7P 2RJCA 3M0SA 5J39A 5I11A 4FM4B 2CUBA 4J83A 2CUDA 4MMKA 2E4HA 3FJPA 4M75B 4NL2A 5IXBA 3EGDA 3FDRA 3X20B 4F17A 5CK9A 1XOVA 2CP0A 4OMQA 2B8AA 2H3JA 1AWXA 2P4TA 2DFUA 2GGRA 3G6ET 5KYYB 1WJSA 1X75C 2K2VA 4JJNK 1UHCA 1QLYA 3RUXA 2DKGA 3H0FA 1X6OA 1ZSZA 2EBPA 3I55T 4J8OA 2W0ZA 1X6GA 4M4ZA 3M0RA 1VA7A 2K3YA 4WTOB 3EH1A 3BFMA 2KBTA 4HKEA 1NYFA 2X4YA 1VQ9A 1VIEA 2YUQA 1M3AA 1O75A 3X24B 1TU0B 4AFUC 3OS5A 2MI6A 1VQLA 2A0FB 4PNOA 4RTTA 4WF2A 2KQWA 2LQNA 2MYSA 4RTXA 1VQKQ 2FHDA 4FW1A 5CVIA 3V7RA 2GQIA 4J7IA 1WHHA 2EGEA 2VC8A 1JB0E 1NPPA 1T0JA 3KBGA 1YITT 4HVVA 4HT9A 1OPLA 3CBOA 2NWMA 5HY6A 3G4ST 2KROA 1SHGA 2DZCA 3OQ5A 5C6SA 2V26A 3VYGA 3RIRA 2K6DA 5FRMA 5IHIA 3LWIA 2C0OA 2HL3A 5FW9A 1VQPT 2HSEB 3CCSA 2FRYA 2RQVA 2FZCB 1QP2A 2E64A 1U06A 5C0MA 4PFZA 3NFCA 1YJNQ 3M0UA 1S1NA 2RA2A 3CCLA 3L2ZA 4BI4A 3NMZC 5LJ5j 1U1TA 2HCKA 3M0TA 4OGCA 4O6JA 2JVVA 1VQMT 2QASA 4WCIA 3PTAA 2K5IA 2X4WA 5GANh 1PSEA 3M4YA 1VQ5Q 4LXCA 3CC2A 1GCPA 2RHYA 4ANJA 2RQUA 4JS5A 1JJ2P 2XDBA 2ZPIB 3CCUQ 1F1BB 1W1FA 4QQDA 2KR3A 4BI3A 3EFOA 2PNIA 1VQNQ 1FMVA 2EGAA 4DEXA 1N8RU 2YUNA 3QXEB 1QQJA 3ULRB 3I56Q 1QVGP 2PVGB 3EFSA 7AT1B 1NEGA 2P0PA 3LLRA 1RLPC 1WX6A 4JPBW 3DB3A 3TCJA 3RMSA 1Q81R 3EH2A 4R55A 5L23A 1VOMA 2JTFA 4XTYA 1N6AA 1ACMB 1SSFA 2IIMA 2FZGB 1AWJA 2IVWA 5LJ3e 3X26B 2OTLA 2EKHA 1QKXA 3V7CA 5GAMf 3VS6A 5LJ3g 4J9DA 1OX8A 1VQ8T 1QVFS 1UE9A 2DA9A 5GAN3 2DMOA 1NLPC 2VXFA 3M9QA 4XK8E 5IT9E 1BB9A 1QVFA 2OTJT 5CQYA 5IAYA 2ESWA 1GBRA 5GANe 1PG5B 1N5ZA 3MEUA 4XU2A 5L8RE 5FROA 3VKIA 4AFQC 4PJOC 3LWHA 1YI2A 3LGLA 4JRQA 3OW2P 2E5QA 4ELZC 1AWWA 5HK0A 4AFSC 2PUKB 2QEXT 1M90R 4FT2A 2CT3A 1BI0A 3MP6A 5GMKh 2X51A 1ABQA 4FW2A 3H6ZA 3QG1A 4J6WA 1KC8R 3UWNA 1B34B 2CP3A 1Z9ZA 2FVUA 5HCKA 2VYTA 3JAME 1QCNA 4DBHA 4PLLA 2MOXA 2GTOA 3J80E 1X27A 2EQKA 2F2WA 4YTLA 2EIFA 4Q5WA 4OB3B 2O4XA 1ZX6A 4XTUA 1EIFA 5FLXE 1NE8A 1TS9A 1JJ2S 2EGCA 2JXBA 1N8RC 5KYUA 1JJ2A 3SDZA 1GCQA 4LDVA 2MWPA 5FRNA 2GBQA 4J9HA 2DL4A 2R5AA 3FEOA 2E5KA 2AIRB 4GBQA 1KQ1A 3CCUA 1AZGB 4V2SA 3G4SQ 4LD9K 3TVTA 2E6NA 2HBPA 1VQNA 3G71Q 1HD3A 1GXIE 1WJRA 2KYBA 3JCMf 4QVZA 3M55A 3NGPA 1TG0A 5DM7R 1W6XA 1Q95G 3UPUA 2EQJA 3M5AA 2JT4A 4M75D 5KYXA 4C8QA 3OYCA 4M77C 4M78E 4IUTA 5GMKe 1PKTA 3EHQA 2RB6A 2HDAA 2JS2A 5DLQE 1D3BA 2J6OA 1WIEA 1BU1A 4A63B 4M77B 1VQMQ 1K1ZA 2FB7A 5GANd 1XJWB 2ABLA 5IXFA 1RACB 4F7UA 2VKNA 1Q81U 2DL5A 3SWNC 4PLIA 2LQ8A 2NUTA 4BDYA 4M7DC 5CKDA 4FL6A 1I81A 2NYSA 1VQ4A 4FYVB 1IHWA 4KRTA 2RH2A 2KMTA 2JM9A 3M58A 1AWOA 5KYNA 3MHXA 2ROTA 2M16A 3EG2A 4J5YA 4HCCA 2D9TA 2XU8A 2DNUA 1YBYA 2XKOC 2DLPA 2CZ7B 3PVLA 3CCQA 4HVUA 1WHJA 2K2MA 1XQHA 2E1HA 1D1AA 3VS7A 1UGRB 4EMKC 2BKDN 4OMFB 4M78F 4D8KA 3UA6A 3VV0A 1A0NB 4PJOF 2P84A 3CMAQ 2AZVA 2DIGA 4C0DC 2JJ9A 4M7AE 4QQ6A 4EMKB 3GIBA 2RPNA 3PVQA 1VIFA 1M5Q1 1FXXA 3PFSA 1KFZA 5I2SA 4NS5A 3CC7A 4IUQA 1VQ8Q 4C0DB 1RLQC 1KC8U 4OMLA 4JRPA 1YIJQ 1M30A 1UHFA 3BE3A 2OTJQ 2F2VA 4XU1A 2KI7A 2DBMA 3G7ZA 2KDSA 1KQ2A 1JQQA 1YP5A 4JRKA 4MZTA 5GMKi 4C0ZA 2HD0A 4JUVA 5DY9A 1K9AA 3TSZA 1QMCA 1WFWA 2FPFA 4FU6A 2KT8A 1D0YA 1ZQ1A 2LDMA 1VQKT 2KSSA 2KRMA 2QTXA 1OX9A 2QQAA 2LP5A 1P92A 2CSQA 2HKQB 2LRQA 4C92C 1W2BS 2X9HA 5GAN6 2JW4A 4OB2B 4QVDA 4RTYA 1JU5C 2LMJA 3G71A 1W2BA 2GCXA 5CKFA 4M7DE 3QJ6A 4M7AF 4C92B 1B34A 1N9SA 3OYMA 1NG2A 1ZBXA 1Q7YR 4FCYA 4M75G 2EYYA 4ZGEB 2G6FX 5ECAA 1WYXA 4QKUA 3OMCA 3QUIA 2BE9B 2LVMA 4PL6A 1TTHB 1YJNT 1MHNA 2MMPA 4J9EA 1ABOA 5GAN8 1VQ9Q 1HXDA 5CKEA 4B9WA 4BB7A 1UGVA 4Y28E 4OMMA 4ZNXA 1VQLQ 3HSBA 3E2UA 4ZN3A 4OP0A 4C5HA 3QYGB 5GANj 3VUZA 4KBMB 2XI9A 3HL8A 1C1AA 2DERA 4IKFA 3JCMh 2DTHA 4JS4A 3CCUT 1MMNA 4PJLA 1VQNT 2CH4W 2F5KA 2DTOA 1H8KA 3QZ9B 1FX7A 1W4SA 2CP7A 4M7DF 1Q82R 3CCSQ 1JO8A 4KT0E 4RTVA 1RAFB 2DILA 3KUFA 3I56T 1WXUA 2EQIA 2KYMA 1GBQA 1KC8C 4PJOD 3CC4A 3EG3A 2RHZA 5CCAA 3CCLQ 2O9VA 4JJCA 1NBEB 2RK2A 2CT4A 1M9SA
chains in the Genus database with same CATH topology
2J6FA 3NMZC 1IO6A 3REAB 2HCKA 3M0TA 1UJ0A 3VRZA 4LE9A 2KNBB 4WCIA 1WLPB 1UTIA 1VYUA 2D8JA 1GCPA 1JXOA 2F2XA 4ESRA 1I07A 2K9GA 1E6HA 1M8MA 2RQUA 3VS1A 4LUEA 1W1FA 2KR3A 2PNIA 4HCKA 1YCSB 3RBBB 2EGAA 4DEXA 2YUNA 2I0NA 3ZL7C 4GLMA 1H3HA 2DJQA 1ZSGA 3ULRB 2RQWA 1Z9QA 4RTUA 1K0SA 3JV3A 1WXTA 3M0QA 3SHWA 1UUEA 1TUCA 1E7OA 2LCSA 1NEGA 4JJBA 3EG1A 1RLPC 1B07A 2A36A 2M51A 2RN8A 1WX6A 2EYWA 2V1RA 4JPBW 5FWBA 2J7IA 4ORZA 2KRNA 3CQTA 2XMFA 1PRLC 2YDLA 4K11A 1QWEA 5IH2A 1PWTA 1K0XA 4CC4B 5L23A 1AZEA 2DBKA 2SEMA 2IIMA 3VS0A 1AWJA 2DL7A 2KXCA 1HJDA 3H0HA 2GTJA 3M0PA 2EKHA 1X6BA 1QKXA 2FPDA 2JMAA 2V1QA 3VS6A 4J9DA 2RQRA 1UE9A 2DA9A 1PHTA 1RI9A 2DMOA 1NLPC 2DL3A 2VWFA 3FJ5A 2LX7A 1BB9A 1M3CA 2ESWA 1GBRA 3I35A 1GCQC 3I5RA 4J9GA 1N5ZA 3H41A 2CSIA 2RQTA 4CC2A 4AFQC 1NLOC 2RF0A 1AWWA 1UG1A 4AFSC 4D8DA 1WA7A 1VYTA 4HVWA 1K4US 1KSWA 1ZUYA 1Y57A 1H92A 1QCFA 2CT3A 4F16A 1GL5A 2EW3A 2OI3A 2MCNA 1U3OA 1AD5A 2K79A 2DRKA 1ABQA 3R6NA 3C0CA 1E6GA 2ED0A 1I0CA 1WXBA 2KRSA 1ZBJA 2JMCA 2O2OA 1Z9ZA 5HCKA 1PNJA 4RTZA 2LQWA 4Z88A 2K3BA 3PE0A 2MOXA 2GTOA 1SEMA 1X27A 1FMKA 4Y92A 2F2WA 1M3BA 2JM8A 1GFCA 1ZX6A 1YWOA 1W70A 2OAWA 1M27C 2D1XA 2CREA 1AOJA 2EGCA 2JXBA 2NUZA 3IQLA 1GCQA 3VS4A 3TSWA 1GFDA 2GBQA 1GRIA 3VS5A 2O9SA 2KE9A 4J9HA 2DL4A 2L2PA 1X69A 2E5KA 2KT1A 4GBQA 2EVRA 2K7AA 3NPFA 1AZGB 1X2QA 4AFZC 2ROLA 1SRLA 2FEIA 2RMOA 3TVTA 3QWXX 1T0HA 1MUZA 1PKSA 1HD3A 1KIKA 3GBQA 2KYBA 5IHKA 1HSQA 3NGPA 1TG0A 2J6KA 1W6XA 1J3TA 3EG0A 3LH5A 2DL8A 1OOTA 2JT4A 4J9CA 1B3QA 1PKTA 3EHQA 1ZUKA 5GJWB 2HDAA 2JS2A 1U5SA 4F14A 3UF4A 4J9FA 2HEQA 4OMNA 2JTEA 2J6OA 1WIEA 1BU1A 4A63B 2DRMA 1K1ZA 1Y0MA 2L0AA 2D8HA 1SPKA 4J9IA 2EPDA 2ABLA 5IXFA 4EIKA 4JZ4A 4IIMA 1RUWA 2VKNA 4DEYA 2C0IA 2DL5A 2QDLA 2A37A 4QT7A 1OPKA 3QWYA 2W10A 3NHNA 2EYZA 2ENMA 1X43A 3THKA 2A28A 3EHRA 4Z8AA 2AZSA 4KRTA 1BK2A 1G2BA 1NEBA 1YWPA 2JM9A 3RNJA 1AWOA 2C0TA 2ROTA 2KGTA 2CH4A 2OJ2A 3EG2A 3EGUA 2DNUA 2DF6A 2DLPA 1AVZC 1WDXA 2LZ6B 2DM1A 3PVLA 4HVUA 1MV3A 4R0KA 2K2MA 2SRCA 1EFNA 3VS2A 1YNZA 2LNHB 3H0IA 3VS7A 1JXMA 1NM7A 2BZXA 5EC7A 1MV0B 3UA6A 4D8KA 1A0NB 1CSKA 1FYNA 2AKLA 2AZVA 2PZ1A 4J9BA 1OV3A 1T3LA 4LN2A 3VRYA 3I5SA 2RPNA 3PVQA 1BBZA 2FO0A 1KFZA 2AK5A 2AKKA 2DVJA 3SEMA 2X3WD 1RLQC 2DYBA 2YSQA 4OMLA 4OMPA 1NYGA 1M30A 1UHFA 2FPEA 4HXJA 2F2VA 2MIOA 2DBMA 1UECA 4JZ3A 1ZLMA 1JQQA 1YP5A 2GNCA 1QKWA 1WI7A 2BZYA 1QWFA 2FRWA 2VVKA 1T3SA 1K9AA 3TSZA 4E6RA 2EYXA 1WFWA 2L3QA 2FPFA 5IHNA 2FG0A 2KT8A 1SSHA 2JS0A 2L3PA 2X3XD 2KRMA 3A98A 4AG1C 1UJYA 3O5ZA 2A08A 3VS3A 3M0SA 2ECZA 5I11A 2LP5A 2CSQA 1VYVA 2CUBA 4CC3A 1SHFA 2CUDA 2JW4A 4RTYA 2L3SA 1JU5C 2LJ1A 2YUPA 2LMJA 5IXBA 2HSPA 2O31A 4F17A 1XOVA 4OMQA 1AWXA 1NG2A 1ZUUA 3I9QA 1X2KA 2EYYA 2GGRA 1UFFA 4CC7A 2G6FX 1TUDA 5ECAA 1UHCA 1QLYA 1WYXA 5GJVB 2YUOA 2KXDA 3M0UA 4J9EA 1UDLA 3H0FA 1ABOA 2EBPA 3U23A 1KJWA 2BTTA 2W0ZA 4LUDA 1UGVA 1K76A 1X6GA 4OMMA 4M4ZA 3M0RA 4ZNXA 1VA7A 4OMOA 4RTWA 2YT6A 2KBTA 1NYFA 1I1JA 2YUQA 1M3AA 1JEGA 4JJDA 2J05A 4AFUC 4FSSA 4RTTA 1PRMC 1OEBA 2HBWA 2LQNA 1ARKA 2M0YA 2RNAA 1YN8A 4RTXA 1SRMA 2GQIA 4IIOA 2EGEA 2O88A 1T0JA 2CH4W 1AEYA 2DE0X 4HVVA 1H8KA 3KFVA 1OPLA 2H8HA 1V1CA 2NWMA 1JO8A 4RUGA 3REBB 1G83A 1SHGA 2CDTA 2DX1A 2KROA 4RTVA 3UA7A 2K6DA 2DILA 5FWCA 2ED1A 2LJ0A 5I22A 1CKAA 1WXUA 2EQIA 5IHIA 2KYMA 2C0OA 2D0NA 1LCKA 1GBQA 5FW9A 2PTKA 2FRYA 4LNPA 3EG3A 2O9VA 2RQVA 2KEAA 4X1VA 4JJCA 1U06A 4Z89A 2B86A 2CT4A 2J06A 4AG2C 3UATA 2LJ3A 1CKBA 2BZ8A 2P4RA 1S1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J6F A;  3NMZ C;  1IO6 A;  3REA B;  2HCK A;  3M0T A;  1UJ0 A;  3VRZ A;  4LE9 A;  2KNB B;  4WCI A;  1WLP B;  1UTI A;  1VYU A;  2D8J A;  1GCP A;  1JXO A;  2F2X A;  4ESR A;  1I07 A;  2K9G A;  1E6H A;  1M8M A;  2RQU A;  3VS1 A;  4LUE A;  1W1F A;  2KR3 A;  2PNI A;  4HCK A;  1YCS B;  3RBB B;  2EGA A;  4DEX A;  2YUN A;  2I0N A;  3ZL7 C;  4GLM A;  1H3H A;  2DJQ A;  1ZSG A;  3ULR B;  2RQW A;  1Z9Q A;  4RTU A;  1K0S A;  3JV3 A;  1WXT A;  3M0Q A;  3SHW A;  1UUE A;  1TUC A;  1E7O A;  2LCS A;  1NEG A;  4JJB A;  3EG1 A;  1RLP C;  1B07 A;  2A36 A;  2M51 A;  2RN8 A;  1WX6 A;  2EYW A;  2V1R A;  4JPB W;  5FWB A;  2J7I A;  4ORZ A;  2KRN A;  3CQT A;  2XMF A;  1PRL C;  2YDL A;  4K11 A;  1QWE A;  5IH2 A;  1PWT A;  1K0X A;  4CC4 B;  5L23 A;  1AZE A;  2DBK A;  2SEM A;  2IIM A;  3VS0 A;  1AWJ A;  2DL7 A;  2KXC A;  1HJD A;  3H0H A;  2GTJ A;  3M0P A;  2EKH A;  1X6B A;  1QKX A;  2FPD A;  2JMA A;  2V1Q A;  3VS6 A;  4J9D A;  2RQR A;  1UE9 A;  2DA9 A;  1PHT A;  1RI9 A;  2DMO A;  1NLP C;  2DL3 A;  2VWF A;  3FJ5 A;  2LX7 A;  1BB9 A;  1M3C A;  2ESW A;  1GBR A;  3I35 A;  1GCQ C;  3I5R A;  4J9G A;  1N5Z A;  3H41 A;  2CSI A;  2RQT A;  4CC2 A;  4AFQ C;  1NLO C;  2RF0 A;  1AWW A;  1UG1 A;  4AFS C;  4D8D A;  1WA7 A;  1VYT A;  4HVW A;  1K4U S;  1KSW A;  1ZUY A;  1Y57 A;  1H92 A;  1QCF A;  2CT3 A;  4F16 A;  1GL5 A;  2EW3 A;  2OI3 A;  2MCN A;  1U3O A;  1AD5 A;  2K79 A;  2DRK A;  1ABQ A;  3R6N A;  3C0C A;  1E6G A;  2ED0 A;  1I0C A;  1WXB A;  2KRS A;  1ZBJ A;  2JMC A;  2O2O A;  1Z9Z A;  5HCK A;  1PNJ A;  4RTZ A;  2LQW A;  4Z88 A;  2K3B A;  3PE0 A;  2MOX A;  2GTO A;  1SEM A;  1X27 A;  1FMK A;  4Y92 A;  2F2W A;  1M3B A;  2JM8 A;  1GFC A;  1ZX6 A;  1YWO A;  1W70 A;  2OAW A;  1M27 C;  2D1X A;  2CRE A;  1AOJ A;  2EGC A;  2JXB A;  2NUZ A;  3IQL A;  1GCQ A;  3VS4 A;  3TSW A;  1GFD A;  2GBQ A;  1GRI A;  3VS5 A;  2O9S A;  2KE9 A;  4J9H A;  2DL4 A;  2L2P A;  1X69 A;  2E5K A;  2KT1 A;  4GBQ A;  2EVR A;  2K7A A;  3NPF A;  1AZG B;  1X2Q A;  4AFZ C;  2ROL A;  1SRL A;  2FEI A;  2RMO A;  3TVT A;  3QWX X;  1T0H A;  1MUZ A;  1PKS A;  1HD3 A;  1KIK A;  3GBQ A;  2KYB A;  5IHK A;  1HSQ A;  3NGP A;  1TG0 A;  2J6K A;  1W6X A;  1J3T A;  3EG0 A;  3LH5 A;  2DL8 A;  1OOT A;  2JT4 A;  4J9C A;  1B3Q A;  1PKT A;  3EHQ A;  1ZUK A;  5GJW B;  2HDA A;  2JS2 A;  1U5S A;  4F14 A;  3UF4 A;  4J9F A;  2HEQ A;  4OMN A;  2JTE A;  2J6O A;  1WIE A;  1BU1 A;  4A63 B;  2DRM A;  1K1Z A;  1Y0M A;  2L0A A;  2D8H A;  1SPK A;  4J9I A;  2EPD A;  2ABL A;  5IXF A;  4EIK A;  4JZ4 A;  4IIM A;  1RUW A;  2VKN A;  4DEY A;  2C0I A;  2DL5 A;  2QDL A;  2A37 A;  4QT7 A;  1OPK A;  3QWY A;  2W10 A;  3NHN A;  2EYZ A;  2ENM A;  1X43 A;  3THK A;  2A28 A;  3EHR A;  4Z8A A;  2AZS A;  4KRT A;  1BK2 A;  1G2B A;  1NEB A;  1YWP A;  2JM9 A;  3RNJ A;  1AWO A;  2C0T A;  2ROT A;  2KGT A;  2CH4 A;  2OJ2 A;  3EG2 A;  3EGU A;  2DNU A;  2DF6 A;  2DLP A;  1AVZ C;  1WDX A;  2LZ6 B;  2DM1 A;  3PVL A;  4HVU A;  1MV3 A;  4R0K A;  2K2M A;  2SRC A;  1EFN A;  3VS2 A;  1YNZ A;  2LNH B;  3H0I A;  3VS7 A;  1JXM A;  1NM7 A;  2BZX A;  5EC7 A;  1MV0 B;  3UA6 A;  4D8K A;  1A0N B;  1CSK A;  1FYN A;  2AKL A;  2AZV A;  2PZ1 A;  4J9B A;  1OV3 A;  1T3L A;  4LN2 A;  3VRY A;  3I5S A;  2RPN A;  3PVQ A;  1BBZ A;  2FO0 A;  1KFZ A;  2AK5 A;  2AKK A;  2DVJ A;  3SEM A;  2X3W D;  1RLQ C;  2DYB A;  2YSQ A;  4OML A;  4OMP A;  1NYG A;  1M30 A;  1UHF A;  2FPE A;  4HXJ A;  2F2V A;  2MIO A;  2DBM A;  1UEC A;  4JZ3 A;  1ZLM A;  1JQQ A;  1YP5 A;  2GNC A;  1QKW A;  1WI7 A;  2BZY A;  1QWF A;  2FRW A;  2VVK A;  1T3S A;  1K9A A;  3TSZ A;  4E6R A;  2EYX A;  1WFW A;  2L3Q A;  2FPF A;  5IHN A;  2FG0 A;  2KT8 A;  1SSH A;  2JS0 A;  2L3P A;  2X3X D;  2KRM A;  3A98 A;  4AG1 C;  1UJY A;  3O5Z A;  2A08 A;  3VS3 A;  3M0S A;  2ECZ A;  5I11 A;  2LP5 A;  2CSQ A;  1VYV A;  2CUB A;  4CC3 A;  1SHF A;  2CUD A;  2JW4 A;  4RTY A;  2L3S A;  1JU5 C;  2LJ1 A;  2YUP A;  2LMJ A;  5IXB A;  2HSP A;  2O31 A;  4F17 A;  1XOV A;  4OMQ A;  1AWX A;  1NG2 A;  1ZUU A;  3I9Q A;  1X2K A;  2EYY A;  2GGR A;  1UFF A;  4CC7 A;  2G6F X;  1TUD A;  5ECA A;  1UHC A;  1QLY A;  1WYX A;  5GJV B;  2YUO A;  2KXD A;  3M0U A;  4J9E A;  1UDL A;  3H0F A;  1ABO A;  2EBP A;  3U23 A;  1KJW A;  2BTT A;  2W0Z A;  4LUD A;  1UGV A;  1K76 A;  1X6G A;  4OMM A;  4M4Z A;  3M0R A;  4ZNX A;  1VA7 A;  4OMO A;  4RTW A;  2YT6 A;  2KBT A;  1NYF A;  1I1J A;  2YUQ A;  1M3A A;  1JEG A;  4JJD A;  2J05 A;  4AFU C;  4FSS A;  4RTT A;  1PRM C;  1OEB A;  2HBW A;  2LQN A;  1ARK A;  2M0Y A;  2RNA A;  1YN8 A;  4RTX A;  1SRM A;  2GQI A;  4IIO A;  2EGE A;  2O88 A;  1T0J A;  2CH4 W;  1AEY A;  2DE0 X;  4HVV A;  1H8K A;  3KFV A;  1OPL A;  2H8H A;  1V1C A;  2NWM A;  1JO8 A;  4RUG A;  3REB B;  1G83 A;  1SHG A;  2CDT A;  2DX1 A;  2KRO A;  4RTV A;  3UA7 A;  2K6D A;  2DIL A;  5FWC A;  2ED1 A;  2LJ0 A;  5I22 A;  1CKA A;  1WXU A;  2EQI A;  5IHI A;  2KYM A;  2C0O A;  2D0N A;  1LCK A;  1GBQ A;  5FW9 A;  2PTK A;  2FRY A;  4LNP A;  3EG3 A;  2O9V A;  2RQV A;  2KEA A;  4X1V A;  4JJC A;  1U06 A;  4Z89 A;  2B86 A;  2CT4 A;  2J06 A;  4AG2 C;  3UAT A;  2LJ3 A;  1CKB A;  2BZ8 A;  2P4R A;  1S1N A; 
#chains in the Genus database with same CATH topology
 2J6F A;  4UC4 A;  2HL5 C;  5KYW A;  2CZ1 B;  3CC2 Q;  3JB9 I;  4IUP A;  1M1K C;  1X01 A;  2RHI A;  1VYU A;  2D8J A;  3S3N A;  1VQ4 T;  1E6H A;  2DXU A;  4RG2 A;  4MDX A;  4C0F A;  5GAN 4;  1B7T A;  2CP6 A;  4F7U G;  4J7F A;  1D1C A;  2DO3 A;  3QPH A;  2QAZ A;  3JCM e;  2DAQ A;  4OB0 B;  3CCQ T;  2MAM A;  1H3H A;  2DJQ A;  1FMW A;  2XHC A;  3JCM g;  2RQW A;  4A4E A;  1C0M A;  3JV3 A;  5GMK j;  3R6O A;  2E3H A;  2XID A;  3HRU A;  1BIB A;  4JJB A;  4BI8 B;  2M51 A;  2RN8 A;  4NOY A;  5FWB A;  4MDW A;  4ORZ A;  1PRL C;  1WQ7 A;  4K11 A;  4C92 F;  2LTO A;  3CPW P;  1PWT A;  3QDR B;  2OTL Q;  1WHL A;  1K73 U;  1K0X A;  5GAO m;  2HQH A;  1AZE A;  3CC7 T;  3QZ5 B;  3FRN A;  2KXC A;  3MET A;  2ZPH B;  1M2V B;  2GTJ A;  1UEB A;  2AHJ B;  1WZO A;  2FPD A;  2JMA A;  1Q7Y U;  3J81 E;  3MEV A;  3MEW A;  2LCC A;  3PGG A;  4GLK A;  2RQR A;  5CQX A;  4M77 D;  1RI9 A;  3FIF A;  1IHV A;  4E7J A;  2Y4X A;  1YI2 Q;  1QVF P;  1QVP A;  1V29 B;  2M02 A;  5GAN 7;  1GCQ C;  4NL3 A;  3MP8 A;  3H41 A;  2DET A;  2DZ9 A;  2EWN A;  2D6F A;  4BDZ A;  2RJE A;  1RAA B;  2RF0 A;  3MPU B;  4PKC C;  5GAO r;  1VQ6 A;  3L2R A;  1S72 A;  1K8A R;  1WA7 A;  3OYG A;  1KSW A;  1VQO A;  3URG A;  3G71 T;  5J26 A;  4F16 A;  1GL5 A;  2EW3 A;  2AT1 B;  1AD5 A;  2K79 A;  2E41 A;  5LJ3 h;  2L89 A;  4EMG A;  1E6G A;  2ED0 A;  2EJF A;  3QSU A;  4Y91 A;  1WXB A;  2KRS A;  1ZBJ A;  2EJ9 A;  4ELY C;  4A4K A;  2LQW A;  1UB4 A;  2K3B A;  4PJM A;  3A8O B;  4RG8 A;  3E1S A;  4C5E A;  1AHJ B;  3EFR A;  4JRI A;  4BAC A;  1YWO A;  1OUL A;  1WHM A;  1W70 A;  2OAW A;  3QJY A;  4O5V A;  1AOJ A;  4IUV A;  9ATC B;  3OMG A;  2OX7 A;  3JCM V;  1O9S A;  2DPP B;  3CPF A;  2F5T X;  1IRX A;  2M0O A;  3TSW A;  3CME A;  1N9R A;  4ZGD B;  1GRI A;  5J3B A;  3VS5 A;  1KK7 A;  4BD3 A;  2O9S A;  2RI2 A;  1Q86 U;  3OYB A;  1X69 A;  3GPL A;  2EVR A;  3TEE A;  3SFM A;  3PMT A;  2ROL A;  2FEI A;  3QWX X;  3TRE A;  1K73 C;  4EPC A;  5LJ5 f;  1PKS A;  1YHQ A;  5A0D A;  3CPW S;  1KIK A;  2COZ A;  1LJO A;  3CC4 T;  4OB1 B;  1NZ9 A;  1HSQ A;  2HQE A;  3CPW A;  1J3T A;  1Q7Y C;  3NTH A;  3CMA T;  3LH5 A;  1OOT A;  1SF9 A;  1D0X A;  2NUP B;  4C92 D;  1EZZ B;  1QW1 A;  4LD6 A;  2QG9 B;  2HAX A;  3UF4 A;  2X35 A;  2JUF A;  2HEQ A;  4QQG A;  2JTE A;  4OGE A;  4IUR A;  2DRM A;  2E10 A;  1Y0M A;  4J9I A;  1VQ4 Q;  2ZZD A;  1YIJ T;  4M77 G;  3KXT A;  1AT1 B;  2A37 A;  1IGQ A;  4FYW B;  4QW2 A;  1OZ3 A;  3QWY A;  3GLX A;  3NHN A;  2EYZ A;  2ENM A;  4M78 C;  3QKJ A;  4XTW A;  2A28 A;  2MWO A;  1BK2 A;  1G2B A;  1YWP A;  1BI2 A;  4C8Q E;  3CCQ Q;  3RNJ A;  1WQW A;  2KGT A;  2OJ2 A;  2V8J A;  4M78 B;  4FYX B;  4M75 A;  3A8H B;  2QI2 A;  4PJO B;  4KH1 B;  1WDX A;  2MPX C;  3JB9 F;  4J6X A;  3ME9 A;  4BY6 C;  3VS2 A;  5KYY A;  1RAI B;  3H0I A;  4PFP A;  1YJW A;  3OYN A;  1M1G A;  1NM7 A;  2BZX A;  4F7U E;  1MV0 B;  3GF5 A;  2AKL A;  2QK0 A;  1Y07 A;  3OYA A;  4BY6 B;  3CC7 Q;  5D6W A;  1K8A U;  3A1P A;  2HKN A;  3CCR A;  4E7I A;  1T3L A;  4LN2 A;  2IG0 A;  2PQW A;  3MJX A;  2QTV A;  1EX4 A;  4B9X A;  2FO0 A;  1WNL A;  3OSV A;  2AKK A;  1VQ9 T;  1G3W A;  3BW1 A;  2X3W D;  1Q86 C;  1NYG A;  5KH6 A;  2COY A;  1MGQ A;  1VQL T;  3OS2 A;  2FL7 A;  2MIO A;  5A0L A;  3RKY A;  4MML A;  4TVR A;  4BUG A;  4C5G A;  4C8Q F;  4M7A C;  1BCO A;  2YLC A;  4E6R A;  3JRZ A;  5D6Y A;  2L3Q A;  5IHN A;  3PIP A;  3RKX A;  1PD0 A;  2K57 A;  1SSH A;  3CCJ A;  2JS0 A;  4GY5 A;  3C94 A;  1MND A;  3OYD A;  1UJY A;  3N5B B;  2A08 A;  3VS3 A;  4M7A B;  2ECZ A;  3CXC S;  1VQO T;  1PCX A;  1OYX A;  4CC3 A;  3L2Q A;  1SHF A;  5LJ3 d;  5KE3 A;  3CCS T;  3CXC A;  3EG9 B;  2L3S A;  2LJ1 A;  2YUP A;  1W2B P;  3OYJ A;  2HSP A;  2DK3 A;  1VQ7 A;  1ZA2 B;  4JLI A;  2FZK B;  3VUB A;  1K9M R;  4EMH A;  1ZUU A;  1X2K A;  3CCL T;  3DLM A;  4CC7 A;  3G1J A;  4C92 G;  2YUO A;  1LNX A;  3U23 A;  1KJW A;  1SKU B;  5KCO A;  3OYH A;  4RCB A;  4LUD A;  4FSX A;  1IB8 A;  2QQS A;  3CC2 T;  4BE0 A;  1OI1 A;  4AT1 B;  2YT6 A;  4CI0 C;  3CCM A;  5LJ5 h;  3CME T;  1G3Y A;  3OBW A;  3SB2 A;  4DA4 A;  4FSS A;  3SWN B;  1OEB A;  4M7D B;  2QQR A;  2M0Y A;  2RNA A;  1YN8 A;  3PT9 A;  2K3X A;  3VYH B;  1KQS P;  4IIO A;  2OAU A;  5GAN 5;  3WVE B;  2DE0 X;  2ZPB B;  3CCV A;  2H8H A;  3UDC A;  1V1C A;  3CC4 Q;  4RUG A;  3JB9 D;  3S3O A;  2CDT A;  5GAM h;  2DX1 A;  4DBQ A;  2MK5 A;  5FWC A;  2ED1 A;  2LJ0 A;  5I22 A;  2YRV A;  1N27 A;  2D0N A;  2KY9 A;  1M90 U;  4LNP A;  2VV5 A;  2QGF B;  3EGD B;  2OTL T;  4AG2 C;  2P0K A;  3UAT A;  2LJ3 A;  1ZSZ C;  1CKB A;  2BZ8 A;  2P4R A;  2LCL A;  3G6E A;  3E9G A;  1WPY A;  3ZBD A;  2M1H A;  3QDF A;  2PUO B;  2QDY B;  1YCY A;  3M59 A;  3REA B;  5CAI A;  3V8J A;  1UJ0 A;  3VRZ A;  1TOV A;  4ZGJ B;  1KG1 A;  2V8K A;  2DIQ A;  4ESR A;  1YI2 T;  3P8B B;  1I07 A;  1M8M A;  4KUI A;  3VS1 A;  3L2U A;  2F69 A;  4LUE A;  5LJ5 e;  2VXE A;  4PJO A;  2RI5 A;  4HCK A;  3L2W A;  1YCS B;  5LJ5 g;  4IUU A;  2I0N A;  3ZL7 C;  4DOV A;  3OYL A;  1Z9Q A;  3OY9 A;  1K0S A;  4J6Y A;  1WXT A;  3M0Q A;  2JZ2 A;  1TUC A;  5FU7 C;  1E7O A;  5LJ3 j;  2LCS A;  3JCM J;  2RJD A;  4N0A A;  3EG1 A;  3C95 A;  1B07 A;  1Q81 C;  4KUD K;  5GAM e;  3CCR T;  2EYW A;  3MKD A;  2J7I A;  2KRN A;  3CQT A;  2YDL A;  1QWE A;  2QXF A;  5GAM g;  2H3E B;  2DBK A;  1RL2 A;  1VQP A;  3VS0 A;  4RCC A;  2DL7 A;  2GQV A;  1RAG B;  4LDX A;  1HJD A;  4E7H A;  3ZEH A;  1BCM A;  3RER A;  3H0H A;  4X9D A;  1K9M U;  1X6B A;  3LW5 E;  2Y4Y A;  2QGG A;  2DL3 A;  5GAO q;  3QYH B;  4ZTJ A;  3FJ5 A;  1KQS S;  1YJ9 Q;  1VQ6 Q;  1S72 Q;  1KQS A;  3QBY A;  2ZPE B;  2CZ0 B;  3I5R A;  4KGX B;  4QVC A;  1VQO Q;  4J9G A;  1NJI R;  2CSI A;  4CC2 A;  2GFA A;  3OA6 A;  1M90 C;  3CD6 A;  2VAS A;  1UG1 A;  3DB4 A;  3VU3 C;  4HVW A;  1K4U S;  3LYI A;  4M78 D;  2YRD A;  1HYO A;  1G3T A;  3EFO B;  1VQ7 T;  1TWB A;  5GAN f;  2WSC E;  4KUL A;  1R0B G;  1U3O A;  4L6V 5;  2DRK A;  3X28 B;  3BY7 A;  3UT1 A;  2RD1 A;  1I0C A;  2JMC A;  2O2O A;  4M77 A;  2V8I A;  1PNJ A;  4RTZ A;  1DJ7 B;  3TU4 K;  3PE0 A;  1SEM A;  2DXB A;  2E3I A;  1UGP B;  5EG2 A;  1M27 C;  3CME Q;  2DD5 A;  1BYM A;  1R77 A;  2CRE A;  3OYF A;  3GNG A;  3RKW A;  1XTD A;  2HQX A;  3CCM T;  1Y96 B;  3OYI A;  2L8D A;  1YFN A;  1C6V X;  1WGS A;  2QYZ A;  3HTR A;  1XNI A;  3OYE A;  3VS4 A;  2M9U A;  3CCE A;  3E9F A;  4DQ2 A;  4FT4 A;  2L2P A;  1ZHI A;  2KT1 A;  1YHQ Q;  1M4Z A;  2K7A A;  2RJF A;  3CCV T;  2XG8 D;  3RES A;  4AFZ C;  2LC4 A;  2RMO A;  1T0H A;  4LDW A;  3E19 A;  4M75 C;  1VUB A;  3M4G A;  4M7A D;  1TXQ A;  1QCO A;  2ZAE A;  3GBQ A;  5D6X A;  4EMK A;  5CR2 A;  2WSE E;  3X25 B;  2QEX A;  1MMG A;  4E7S A;  2J6K A;  1K9M C;  3L2V A;  1PD1 A;  3EGX B;  2DL8 A;  3S6W A;  4J9C A;  1B3Q A;  1ZUK A;  5GJW B;  1WHK A;  4F14 A;  2KAF A;  2DXC A;  1TSF A;  5I2M A;  4F04 B;  2L0A A;  2D8H A;  1SPK A;  4EIK A;  3HPW A;  4FYY B;  4DEY A;  3JSC A;  4E7Z A;  2EAY A;  4L5G A;  2DVE A;  2O4X B;  2A7Y A;  3THK A;  4N4H A;  5KCH A;  2QQB A;  1YJ9 A;  2PVO B;  5KYU B;  3H8Z A;  2C0T A;  1YJW Q;  4PFO A;  3EGU A;  3QO3 A;  2DF6 A;  3V7S A;  4M7D D;  2BE7 D;  3M53 A;  4C92 A;  1AVZ C;  1RAB B;  2LZ6 B;  1MV3 A;  4R0K A;  1R0C B;  4A54 A;  2GFU A;  4M78 G;  1EFN A;  4JDS A;  3J7A F;  1YNZ A;  2LNH B;  4A4H A;  3CCR Q;  1H64 1;  1NJI U;  4LDU A;  4PJO G;  5FU6 C;  1JXM A;  3OBY A;  1Q82 U;  4N4G A;  2X4J A;  4J9B A;  2CP2 A;  1UGQ B;  4C8Q C;  3MEA A;  4CRI A;  3VRY A;  1NPR A;  3I5S A;  5FU6 B;  5AYF A;  4FIB A;  1OU9 A;  2ZPG B;  1Y71 A;  3RDV A;  2DVJ A;  5KYX B;  4C8Q B;  2R5M A;  4M75 E;  1Y7X A;  2DYB A;  3JCM d;  3P8D A;  4HXJ A;  2I2L A;  1D3B B;  4KGZ B;  1UEC A;  4JZ3 A;  3CCJ Q;  2GNC A;  5CO7 A;  4D6W A;  3L1A A;  2VVK A;  1D0Z A;  2L5Q A;  1TH7 A;  2EYX A;  3QHS A;  2VGN A;  4F7U B;  2RI3 A;  2FG0 A;  3C4S A;  3OYK A;  3CD6 T;  2K5F A;  3ASK A;  1FWZ A;  2K4Y A;  2NUT B;  2X3X D;  3S3M A;  3O5Z A;  1BKB A;  5GAO n;  1VQ7 Q;  2PU9 B;  1VYV A;  2QA4 A;  5GAM j;  1SG5 A;  1JBM A;  1IGU A;  3RR6 A;  3CXC P;  4II1 A;  4M7A G;  3JCM c;  2O31 A;  4XU0 A;  2VB6 A;  2D0Q B;  1IZ6 A;  3I9Q A;  4KH0 B;  3HRS A;  1UFF A;  5GMK l;  2LT4 A;  1TUD A;  3JB9 J;  4M75 F;  5GJV B;  2KXD A;  2EQM A;  5A0G A;  1UDL A;  3ER0 A;  5HK3 A;  2HNI A;  1I4K 1;  1KD1 R;  2BTT A;  4MZM A;  5HKC A;  3CCM Q;  2DTI A;  2HMA A;  1K76 A;  1ZA1 B;  1Y96 A;  2L3R A;  1H3Z A;  4OMO A;  4BE1 A;  4RTW A;  2ZGW A;  1BIA A;  4OF1 A;  3M57 A;  2DXT A;  1I1J A;  2E6Z A;  2LNV A;  1D09 B;  1JEG A;  4JJD A;  3CCE T;  2J05 A;  4JLG A;  3T9N A;  2VUB A;  5GAO p;  1LVK A;  1PRM C;  1UGS B;  3MCA B;  2HBW A;  3CCV Q;  1NJI C;  1ARK A;  1D1B A;  1SRM A;  5AT1 B;  5GAO l;  1Q82 C;  4XTX A;  1WJQ A;  5M9O A;  2XIC A;  2O88 A;  3HFO A;  4M7D G;  3LGF A;  1AEY A;  3KFV A;  4A53 A;  2ZPF B;  3H9N A;  3VJP A;  5GAN g;  1VQK A;  2PVD B;  3REB B;  2DD4 A;  1G83 A;  2F1L A;  2P0Q A;  3QII A;  3UA7 A;  2MF2 A;  1CKA A;  3EGX A;  1LCK A;  4C0G A;  1KHC A;  2PTK A;  2R57 A;  3G6E Q;  2KEA A;  3D7S B;  4N0A C;  1IXD A;  1M2V A;  4X1V A;  3V8L A;  4ZTF A;  4BE2 A;  4Z89 A;  2B86 A;  2EKO A;  2J06 A;  2IPO B;  3I55 Q;  2EQU A;  4XQ3 A;  1IO6 A;  1YJN A;  3INZ A;  3LH0 A;  1I5O B;  2CYZ B;  3GNF B;  4LE9 A;  4N4I A;  3A8G B;  2E12 A;  2KNB B;  1PM3 A;  1WLP B;  1UTI A;  1M1K R;  2XD0 A;  3DLL A;  4HCB A;  1JXO A;  2F2X A;  3PNW C;  2K9G A;  2RK1 A;  1YJ9 T;  1VQ6 T;  2EJG A;  4PK4 A;  1S72 T;  4LDY A;  3L42 A;  2KK4 A;  5CKB A;  3AHU A;  4ZN1 A;  3HRT A;  4XTV A;  1VQ5 A;  1OZ2 A;  2LX9 A;  2CZ6 B;  4F7U F;  1YIT Q;  3RBB B;  3HKS A;  6AT1 B;  4GLM A;  2CKK A;  1QVG S;  4DBF A;  1ZSG A;  4RTU A;  3OS1 A;  1IRE B;  3M56 A;  1QVG A;  8AT1 B;  3SHW A;  1UUE A;  2NLU A;  4XAX B;  2LT1 A;  3GP8 A;  1VQP Q;  1PSF A;  2A36 A;  3MO8 A;  4RKU E;  2V1R A;  2YWW A;  2QQ9 A;  1MNE A;  2BIV A;  4B6M A;  2XMF A;  1G5V A;  2HZY A;  5IH2 A;  3I56 A;  4CC4 B;  2FYK A;  1LPL A;  2YLB A;  2SEM A;  4PJO E;  3SD4 A;  3FB9 A;  4A4F A;  8ATC B;  4XU3 A;  2O01 E;  3M0P A;  2A3L A;  2V1Q A;  5CIU A;  1OU8 A;  2YXY A;  3OS0 A;  3O8V A;  3CBM A;  1PHT A;  2VWF A;  2XDD A;  5KYW B;  2LX7 A;  3CD6 Q;  1KD1 U;  1M3C A;  4HCZ A;  4Z02 A;  3I35 A;  3OW2 S;  3NTI A;  1K8A C;  2RQT A;  3MP1 A;  1NLO C;  1HK9 A;  1YHQ T;  3OW2 A;  4D8D A;  2QA4 T;  2WAC A;  1VYT A;  4A4G A;  1ZUY A;  2COW A;  1Y57 A;  2RHU A;  1H92 A;  4ATO A;  1QCF A;  1G3S A;  2YRC A;  3WXM B;  3PIO A;  2NUP A;  2OI3 A;  4HA8 A;  1JRI A;  2MCN A;  3R6N A;  3C0C A;  3CBP A;  1M1F A;  2K5L A;  1R8O B;  5KE2 A;  4Z88 A;  3JCM Q;  1PC0 A;  1MMD A;  1G8X A;  1FMK A;  4Y92 A;  1I8F A;  4RMO A;  2DEU A;  1ZSZ B;  3LX7 A;  3I55 A;  3A5Z B;  1M3B A;  5IN1 A;  2JM8 A;  1GFC A;  3A8L B;  4L59 A;  3C12 A;  4MZP A;  2XK0 A;  2D1X A;  3JCM P;  3HFN A;  2JN0 A;  3CCE Q;  4C8Q D;  3ZFJ A;  2NUZ A;  3IQL A;  3P8H A;  3JB9 H;  2ATC B;  2JTM A;  4M78 A;  1BI3 A;  3DKM A;  1GFD A;  1RAD B;  1V76 A;  2KE9 A;  3OSS C;  4VUB A;  2LQK A;  4M77 E;  3AT1 B;  4E7K A;  3EAE A;  3NPF A;  2CP5 A;  1X2Q A;  1YJW T;  4PJN A;  1SRL A;  1M1K U;  2QEX Q;  3CEY A;  1LOJ A;  1MUZ A;  1YIT A;  1M8V A;  2WSF E;  3FC3 A;  4ME7 A;  2Y90 A;  3OB9 A;  3G4S A;  5D7U A;  4AMC A;  5GAN 2;  1K73 R;  5IHK A;  2VGM A;  2G3R A;  2C06 A;  5FU7 B;  4DBR A;  3EG0 A;  3OYY A;  2CGH A;  3PMI A;  5LL6 S;  2DJZ A;  4EDU A;  4E2F B;  2DEQ A;  1U5S A;  1WHG A;  3BDL A;  4J9F A;  4OMN A;  4PJJ A;  1OQK A;  1KD1 C;  2RHX A;  2YHT A;  4XTZ A;  2RM4 A;  2EPD A;  4P5N A;  4JZ4 A;  2R58 A;  3GOX A;  4IIM A;  1RUW A;  2C0I A;  2Z0W A;  2QDL A;  4X34 A;  5LJ3 f;  4QT7 A;  1OPK A;  1VQM A;  2W10 A;  4M77 F;  3JCM b;  3CCJ T;  1X43 A;  4M7A A;  3HHT B;  3EHR A;  4Z8A A;  2AZS A;  5CKH A;  1VQ5 T;  3FLG A;  3NTK A;  1NEB A;  4C5I A;  2RO0 A;  1BI1 A;  4OVA A;  3EG9 A;  1QP3 A;  2ZCF B;  2CH4 A;  3JB9 G;  4E47 A;  4E7L A;  1TUG B;  3WVD B;  2DM1 A;  5A2Q E;  2SRC A;  4DOW A;  5DLO A;  2E70 A;  2X4X A;  4X9C A;  5EC7 A;  3V8K A;  3F70 A;  1CSK A;  4KGV B;  1FYN A;  1MMA A;  1RAE B;  2PZ1 A;  3HP9 A;  1RAH B;  3RMQ A;  1OV3 A;  2KVQ G;  1U8R A;  5I21 A;  2JOY A;  2EYQ A;  1RI0 A;  2JNG A;  1BBZ A;  1I5L A;  3CMA A;  5LJ5 d;  2GF7 A;  2AK5 A;  3A8M B;  2CS7 A;  3SEM A;  1U1S A;  2E65 A;  2XDP A;  2YSQ A;  4C92 E;  4OMP A;  4R56 A;  2FPE A;  3SWN A;  4HT8 A;  3JCM W;  3Q1J A;  4M7D A;  4C8Q G;  1Q86 R;  1N8R R;  1KHI A;  1ZLM A;  1VQ8 A;  1QKW A;  1WI7 A;  2BZY A;  1QWF A;  2FRW A;  1YIJ A;  1T3S A;  2EFI A;  2OTJ A;  3JCM X;  2QA4 Q;  5GAM d;  3M54 A;  3BDU A;  5GMK m;  2L3P A;  2DYI A;  3A98 A;  4AG1 C;  2BUD A;  1M2O A;  3TQ7 P;  2RJC A;  3M0S A;  5J39 A;  5I11 A;  4FM4 B;  2CUB A;  4J83 A;  2CUD A;  4MMK A;  2E4H A;  3FJP A;  4M75 B;  4NL2 A;  5IXB A;  3EGD A;  3FDR A;  3X20 B;  4F17 A;  5CK9 A;  1XOV A;  2CP0 A;  4OMQ A;  2B8A A;  2H3J A;  1AWX A;  2P4T A;  2DFU A;  2GGR A;  3G6E T;  5KYY B;  1WJS A;  1X75 C;  2K2V A;  4JJN K;  1UHC A;  1QLY A;  3RUX A;  2DKG A;  3H0F A;  1X6O A;  1ZSZ A;  2EBP A;  3I55 T;  4J8O A;  2W0Z A;  1X6G A;  4M4Z A;  3M0R A;  1VA7 A;  2K3Y A;  4WTO B;  3EH1 A;  3BFM A;  2KBT A;  4HKE A;  1NYF A;  2X4Y A;  1VQ9 A;  1VIE A;  2YUQ A;  1M3A A;  1O75 A;  3X24 B;  1TU0 B;  4AFU C;  3OS5 A;  2MI6 A;  1VQL A;  2A0F B;  4PNO A;  4RTT A;  4WF2 A;  2KQW A;  2LQN A;  2MYS A;  4RTX A;  1VQK Q;  2FHD A;  4FW1 A;  5CVI A;  3V7R A;  2GQI A;  4J7I A;  1WHH A;  2EGE A;  2VC8 A;  1JB0 E;  1NPP A;  1T0J A;  3KBG A;  1YIT T;  4HVV A;  4HT9 A;  1OPL A;  3CBO A;  2NWM A;  5HY6 A;  3G4S T;  2KRO A;  1SHG A;  2DZC A;  3OQ5 A;  5C6S A;  2V26 A;  3VYG A;  3RIR A;  2K6D A;  5FRM A;  5IHI A;  3LWI A;  2C0O A;  2HL3 A;  5FW9 A;  1VQP T;  2HSE B;  3CCS A;  2FRY A;  2RQV A;  2FZC B;  1QP2 A;  2E64 A;  1U06 A;  5C0M A;  4PFZ A;  3NFC A;  1YJN Q;  3M0U A;  1S1N A;  2RA2 A;  3CCL A;  3L2Z A;  4BI4 A;  3NMZ C;  5LJ5 j;  1U1T A;  2HCK A;  3M0T A;  4OGC A;  4O6J A;  2JVV A;  1VQM T;  2QAS A;  4WCI A;  3PTA A;  2K5I A;  2X4W A;  5GAN h;  1PSE A;  3M4Y A;  1VQ5 Q;  4LXC A;  3CC2 A;  1GCP A;  2RHY A;  4ANJ A;  2RQU A;  4JS5 A;  1JJ2 P;  2XDB A;  2ZPI B;  3CCU Q;  1F1B B;  1W1F A;  4QQD A;  2KR3 A;  4BI3 A;  3EFO A;  2PNI A;  1VQN Q;  1FMV A;  2EGA A;  4DEX A;  1N8R U;  2YUN A;  3QXE B;  1QQJ A;  3ULR B;  3I56 Q;  1QVG P;  2PVG B;  3EFS A;  7AT1 B;  1NEG A;  2P0P A;  3LLR A;  1RLP C;  1WX6 A;  4JPB W;  3DB3 A;  3TCJ A;  3RMS A;  1Q81 R;  3EH2 A;  4R55 A;  5L23 A;  1VOM A;  2JTF A;  4XTY A;  1N6A A;  1ACM B;  1SSF A;  2IIM A;  2FZG B;  1AWJ A;  2IVW A;  5LJ3 e;  3X26 B;  2OTL A;  2EKH A;  1QKX A;  3V7C A;  5GAM f;  3VS6 A;  5LJ3 g;  4J9D A;  1OX8 A;  1VQ8 T;  1QVF S;  1UE9 A;  2DA9 A;  5GAN 3;  2DMO A;  1NLP C;  2VXF A;  3M9Q A;  4XK8 E;  5IT9 E;  1BB9 A;  1QVF A;  2OTJ T;  5CQY A;  5IAY A;  2ESW A;  1GBR A;  5GAN e;  1PG5 B;  1N5Z A;  3MEU A;  4XU2 A;  5L8R E;  5FRO A;  3VKI A;  4AFQ C;  4PJO C;  3LWH A;  1YI2 A;  3LGL A;  4JRQ A;  3OW2 P;  2E5Q A;  4ELZ C;  1AWW A;  5HK0 A;  4AFS C;  2PUK B;  2QEX T;  1M90 R;  4FT2 A;  2CT3 A;  1BI0 A;  3MP6 A;  5GMK h;  2X51 A;  1ABQ A;  4FW2 A;  3H6Z A;  3QG1 A;  4J6W A;  1KC8 R;  3UWN A;  1B34 B;  2CP3 A;  1Z9Z A;  2FVU A;  5HCK A;  2VYT A;  3JAM E;  1QCN A;  4DBH A;  4PLL A;  2MOX A;  2GTO A;  3J80 E;  1X27 A;  2EQK A;  2F2W A;  4YTL A;  2EIF A;  4Q5W A;  4OB3 B;  2O4X A;  1ZX6 A;  4XTU A;  1EIF A;  5FLX E;  1NE8 A;  1TS9 A;  1JJ2 S;  2EGC A;  2JXB A;  1N8R C;  5KYU A;  1JJ2 A;  3SDZ A;  1GCQ A;  4LDV A;  2MWP A;  5FRN A;  2GBQ A;  4J9H A;  2DL4 A;  2R5A A;  3FEO A;  2E5K A;  2AIR B;  4GBQ A;  1KQ1 A;  3CCU A;  1AZG B;  4V2S A;  3G4S Q;  4LD9 K;  3TVT A;  2E6N A;  2HBP A;  1VQN A;  3G71 Q;  1HD3 A;  1GXI E;  1WJR A;  2KYB A;  3JCM f;  4QVZ A;  3M55 A;  3NGP A;  1TG0 A;  5DM7 R;  1W6X A;  1Q95 G;  3UPU A;  2EQJ A;  3M5A A;  2JT4 A;  4M75 D;  5KYX A;  4C8Q A;  3OYC A;  4M77 C;  4M78 E;  4IUT A;  5GMK e;  1PKT A;  3EHQ A;  2RB6 A;  2HDA A;  2JS2 A;  5DLQ E;  1D3B A;  2J6O A;  1WIE A;  1BU1 A;  4A63 B;  4M77 B;  1VQM Q;  1K1Z A;  2FB7 A;  5GAN d;  1XJW B;  2ABL A;  5IXF A;  1RAC B;  4F7U A;  2VKN A;  1Q81 U;  2DL5 A;  3SWN C;  4PLI A;  2LQ8 A;  2NUT A;  4BDY A;  4M7D C;  5CKD A;  4FL6 A;  1I81 A;  2NYS A;  1VQ4 A;  4FYV B;  1IHW A;  4KRT A;  2RH2 A;  2KMT A;  2JM9 A;  3M58 A;  1AWO A;  5KYN A;  3MHX A;  2ROT A;  2M16 A;  3EG2 A;  4J5Y A;  4HCC A;  2D9T A;  2XU8 A;  2DNU A;  1YBY A;  2XKO C;  2DLP A;  2CZ7 B;  3PVL A;  3CCQ A;  4HVU A;  1WHJ A;  2K2M A;  1XQH A;  2E1H A;  1D1A A;  3VS7 A;  1UGR B;  4EMK C;  2BKD N;  4OMF B;  4M78 F;  4D8K A;  3UA6 A;  3VV0 A;  1A0N B;  4PJO F;  2P84 A;  3CMA Q;  2AZV A;  2DIG A;  4C0D C;  2JJ9 A;  4M7A E;  4QQ6 A;  4EMK B;  3GIB A;  2RPN A;  3PVQ A;  1VIF A;  1M5Q 1;  1FXX A;  3PFS A;  1KFZ A;  5I2S A;  4NS5 A;  3CC7 A;  4IUQ A;  1VQ8 Q;  4C0D B;  1RLQ C;  1KC8 U;  4OML A;  4JRP A;  1YIJ Q;  1M30 A;  1UHF A;  3BE3 A;  2OTJ Q;  2F2V A;  4XU1 A;  2KI7 A;  2DBM A;  3G7Z A;  2KDS A;  1KQ2 A;  1JQQ A;  1YP5 A;  4JRK A;  4MZT A;  5GMK i;  4C0Z A;  2HD0 A;  4JUV A;  5DY9 A;  1K9A A;  3TSZ A;  1QMC A;  1WFW A;  2FPF A;  4FU6 A;  2KT8 A;  1D0Y A;  1ZQ1 A;  2LDM A;  1VQK T;  2KSS A;  2KRM A;  2QTX A;  1OX9 A;  2QQA A;  2LP5 A;  1P92 A;  2CSQ A;  2HKQ B;  2LRQ A;  4C92 C;  1W2B S;  2X9H A;  5GAN 6;  2JW4 A;  4OB2 B;  4QVD A;  4RTY A;  1JU5 C;  2LMJ A;  3G71 A;  1W2B A;  2GCX A;  5CKF A;  4M7D E;  3QJ6 A;  4M7A F;  4C92 B;  1B34 A;  1N9S A;  3OYM A;  1NG2 A;  1ZBX A;  1Q7Y R;  4FCY A;  4M75 G;  2EYY A;  4ZGE B;  2G6F X;  5ECA A;  1WYX A;  4QKU A;  3OMC A;  3QUI A;  2BE9 B;  2LVM A;  4PL6 A;  1TTH B;  1YJN T;  1MHN A;  2MMP A;  4J9E A;  1ABO A;  5GAN 8;  1VQ9 Q;  1HXD A;  5CKE A;  4B9W A;  4BB7 A;  1UGV A;  4Y28 E;  4OMM A;  4ZNX A;  1VQL Q;  3HSB A;  3E2U A;  4ZN3 A;  4OP0 A;  4C5H A;  3QYG B;  5GAN j;  3VUZ A;  4KBM B;  2XI9 A;  3HL8 A;  1C1A A;  2DER A;  4IKF A;  3JCM h;  2DTH A;  4JS4 A;  3CCU T;  1MMN A;  4PJL A;  1VQN T;  2CH4 W;  2F5K A;  2DTO A;  1H8K A;  3QZ9 B;  1FX7 A;  1W4S A;  2CP7 A;  4M7D F;  1Q82 R;  3CCS Q;  1JO8 A;  4KT0 E;  4RTV A;  1RAF B;  2DIL A;  3KUF A;  3I56 T;  1WXU A;  2EQI A;  2KYM A;  1GBQ A;  1KC8 C;  4PJO D;  3CC4 A;  3EG3 A;  2RHZ A;  5CCA A;  3CCL Q;  2O9V A;  4JJC A;  1NBE B;  2RK2 A;  2CT4 A;  1M9S A; 
#chains in the Genus database with same CATH homology
 2J6F A;  3NMZ C;  1IO6 A;  3REA B;  2HCK A;  3M0T A;  1UJ0 A;  3VRZ A;  4LE9 A;  2KNB B;  4WCI A;  1WLP B;  1UTI A;  1VYU A;  2D8J A;  1GCP A;  1JXO A;  2F2X A;  4ESR A;  1I07 A;  2K9G A;  1E6H A;  1M8M A;  2RQU A;  3VS1 A;  4LUE A;  1W1F A;  2KR3 A;  2PNI A;  4HCK A;  1YCS B;  3RBB B;  2EGA A;  4DEX A;  2YUN A;  2I0N A;  3ZL7 C;  4GLM A;  1H3H A;  2DJQ A;  1ZSG A;  3ULR B;  2RQW A;  1Z9Q A;  4RTU A;  1K0S A;  3JV3 A;  1WXT A;  3M0Q A;  3SHW A;  1UUE A;  1TUC A;  1E7O A;  2LCS A;  1NEG A;  4JJB A;  3EG1 A;  1RLP C;  1B07 A;  2A36 A;  2M51 A;  2RN8 A;  1WX6 A;  2EYW A;  2V1R A;  4JPB W;  5FWB A;  2J7I A;  4ORZ A;  2KRN A;  3CQT A;  2XMF A;  1PRL C;  2YDL A;  4K11 A;  1QWE A;  5IH2 A;  1PWT A;  1K0X A;  4CC4 B;  5L23 A;  1AZE A;  2DBK A;  2SEM A;  2IIM A;  3VS0 A;  1AWJ A;  2DL7 A;  2KXC A;  1HJD A;  3H0H A;  2GTJ A;  3M0P A;  2EKH A;  1X6B A;  1QKX A;  2FPD A;  2JMA A;  2V1Q A;  3VS6 A;  4J9D A;  2RQR A;  1UE9 A;  2DA9 A;  1PHT A;  1RI9 A;  2DMO A;  1NLP C;  2DL3 A;  2VWF A;  3FJ5 A;  2LX7 A;  1BB9 A;  1M3C A;  2ESW A;  1GBR A;  3I35 A;  1GCQ C;  3I5R A;  4J9G A;  1N5Z A;  3H41 A;  2CSI A;  2RQT A;  4CC2 A;  4AFQ C;  1NLO C;  2RF0 A;  1AWW A;  1UG1 A;  4AFS C;  4D8D A;  1WA7 A;  1VYT A;  4HVW A;  1K4U S;  1KSW A;  1ZUY A;  1Y57 A;  1H92 A;  1QCF A;  2CT3 A;  4F16 A;  1GL5 A;  2EW3 A;  2OI3 A;  2MCN A;  1U3O A;  1AD5 A;  2K79 A;  2DRK A;  1ABQ A;  3R6N A;  3C0C A;  1E6G A;  2ED0 A;  1I0C A;  1WXB A;  2KRS A;  1ZBJ A;  2JMC A;  2O2O A;  1Z9Z A;  5HCK A;  1PNJ A;  4RTZ A;  2LQW A;  4Z88 A;  2K3B A;  3PE0 A;  2MOX A;  2GTO A;  1SEM A;  1X27 A;  1FMK A;  4Y92 A;  2F2W A;  1M3B A;  2JM8 A;  1GFC A;  1ZX6 A;  1YWO A;  1W70 A;  2OAW A;  1M27 C;  2D1X A;  2CRE A;  1AOJ A;  2EGC A;  2JXB A;  2NUZ A;  3IQL A;  1GCQ A;  3VS4 A;  3TSW A;  1GFD A;  2GBQ A;  1GRI A;  3VS5 A;  2O9S A;  2KE9 A;  4J9H A;  2DL4 A;  2L2P A;  1X69 A;  2E5K A;  2KT1 A;  4GBQ A;  2EVR A;  2K7A A;  3NPF A;  1AZG B;  1X2Q A;  4AFZ C;  2ROL A;  1SRL A;  2FEI A;  2RMO A;  3TVT A;  3QWX X;  1T0H A;  1MUZ A;  1PKS A;  1HD3 A;  1KIK A;  3GBQ A;  2KYB A;  5IHK A;  1HSQ A;  3NGP A;  1TG0 A;  2J6K A;  1W6X A;  1J3T A;  3EG0 A;  3LH5 A;  2DL8 A;  1OOT A;  2JT4 A;  4J9C A;  1B3Q A;  1PKT A;  3EHQ A;  1ZUK A;  5GJW B;  2HDA A;  2JS2 A;  1U5S A;  4F14 A;  3UF4 A;  4J9F A;  2HEQ A;  4OMN A;  2JTE A;  2J6O A;  1WIE A;  1BU1 A;  4A63 B;  2DRM A;  1K1Z A;  1Y0M A;  2L0A A;  2D8H A;  1SPK A;  4J9I A;  2EPD A;  2ABL A;  5IXF A;  4EIK A;  4JZ4 A;  4IIM A;  1RUW A;  2VKN A;  4DEY A;  2C0I A;  2DL5 A;  2QDL A;  2A37 A;  4QT7 A;  1OPK A;  3QWY A;  2W10 A;  3NHN A;  2EYZ A;  2ENM A;  1X43 A;  3THK A;  2A28 A;  3EHR A;  4Z8A A;  2AZS A;  4KRT A;  1BK2 A;  1G2B A;  1NEB A;  1YWP A;  2JM9 A;  3RNJ A;  1AWO A;  2C0T A;  2ROT A;  2KGT A;  2CH4 A;  2OJ2 A;  3EG2 A;  3EGU A;  2DNU A;  2DF6 A;  2DLP A;  1AVZ C;  1WDX A;  2LZ6 B;  2DM1 A;  3PVL A;  4HVU A;  1MV3 A;  4R0K A;  2K2M A;  2SRC A;  1EFN A;  3VS2 A;  1YNZ A;  2LNH B;  3H0I A;  3VS7 A;  1JXM A;  1NM7 A;  2BZX A;  5EC7 A;  1MV0 B;  3UA6 A;  4D8K A;  1A0N B;  1CSK A;  1FYN A;  2AKL A;  2AZV A;  2PZ1 A;  4J9B A;  1OV3 A;  1T3L A;  4LN2 A;  3VRY A;  3I5S A;  2RPN A;  3PVQ A;  1BBZ A;  2FO0 A;  1KFZ A;  2AK5 A;  2AKK A;  2DVJ A;  3SEM A;  2X3W D;  1RLQ C;  2DYB A;  2YSQ A;  4OML A;  4OMP A;  1NYG A;  1M30 A;  1UHF A;  2FPE A;  4HXJ A;  2F2V A;  2MIO A;  2DBM A;  1UEC A;  4JZ3 A;  1ZLM A;  1JQQ A;  1YP5 A;  2GNC A;  1QKW A;  1WI7 A;  2BZY A;  1QWF A;  2FRW A;  2VVK A;  1T3S A;  1K9A A;  3TSZ A;  4E6R A;  2EYX A;  1WFW A;  2L3Q A;  2FPF A;  5IHN A;  2FG0 A;  2KT8 A;  1SSH A;  2JS0 A;  2L3P A;  2X3X D;  2KRM A;  3A98 A;  4AG1 C;  1UJY A;  3O5Z A;  2A08 A;  3VS3 A;  3M0S A;  2ECZ A;  5I11 A;  2LP5 A;  2CSQ A;  1VYV A;  2CUB A;  4CC3 A;  1SHF A;  2CUD A;  2JW4 A;  4RTY A;  2L3S A;  1JU5 C;  2LJ1 A;  2YUP A;  2LMJ A;  5IXB A;  2HSP A;  2O31 A;  4F17 A;  1XOV A;  4OMQ A;  1AWX A;  1NG2 A;  1ZUU A;  3I9Q A;  1X2K A;  2EYY A;  2GGR A;  1UFF A;  4CC7 A;  2G6F X;  1TUD A;  5ECA A;  1UHC A;  1QLY A;  1WYX A;  5GJV B;  2YUO A;  2KXD A;  3M0U A;  4J9E A;  1UDL A;  3H0F A;  1ABO A;  2EBP A;  3U23 A;  1KJW A;  2BTT A;  2W0Z A;  4LUD A;  1UGV A;  1K76 A;  1X6G A;  4OMM A;  4M4Z A;  3M0R A;  4ZNX A;  1VA7 A;  4OMO A;  4RTW A;  2YT6 A;  2KBT A;  1NYF A;  1I1J A;  2YUQ A;  1M3A A;  1JEG A;  4JJD A;  2J05 A;  4AFU C;  4FSS A;  4RTT A;  1PRM C;  1OEB A;  2HBW A;  2LQN A;  1ARK A;  2M0Y A;  2RNA A;  1YN8 A;  4RTX A;  1SRM A;  2GQI A;  4IIO A;  2EGE A;  2O88 A;  1T0J A;  2CH4 W;  1AEY A;  2DE0 X;  4HVV A;  1H8K A;  3KFV A;  1OPL A;  2H8H A;  1V1C A;  2NWM A;  1JO8 A;  4RUG A;  3REB B;  1G83 A;  1SHG A;  2CDT A;  2DX1 A;  2KRO A;  4RTV A;  3UA7 A;  2K6D A;  2DIL A;  5FWC A;  2ED1 A;  2LJ0 A;  5I22 A;  1CKA A;  1WXU A;  2EQI A;  5IHI A;  2KYM A;  2C0O A;  2D0N A;  1LCK A;  1GBQ A;  5FW9 A;  2PTK A;  2FRY A;  4LNP A;  3EG3 A;  2O9V A;  2RQV A;  2KEA A;  4X1V A;  4JJC A;  1U06 A;  4Z89 A;  2B86 A;  2CT4 A;  2J06 A;  4AG2 C;  3UAT A;  2LJ3 A;  1CKB A;  2BZ8 A;  2P4R A;  1S1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...