2X3WD

Structure of mouse syndapin i (crystal form 2)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
VRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis
molecule keywords PROTEIN KINASE C AND CASEIN KINASE SUBSTRATE IN NEURONS PROT
publication title Molecular Basis for SH3 Domain Regulation of F-Bar-Mediated Membrane Deformation.
pubmed doi rcsb
source organism Mus musculus
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2x3wD00
4RTVA 4OMOA 2F2WA 4AFSC 4X1VA 4JZ3A 1PWTA 1MV0B 1AWWA 5IXFA 1RLQC 4GLMA 1JXMA 2KE9A 1RLPC 2DM1A 2J6OA 2GTJA 2KXDA 2GQIA 3VRZA 1ZX6A 4LUEA 1NLPC 1UJYA 1XOVA 4AG2C 1I0CA 4J9DA 2FEIA 2MCNA 2LZ6B 2DRKA 1H8KA 1YWPA 5ECAA 2KXCA 2J05A 2V1QA 2YDLA 4JZ4A 1OPLA 1B07A 1AZGB 1FMKA 3KFVA 5GJWB 2A36A 2XMFA 2AZSA 4CC3A 2FG0A 4CC7A 1N5ZA 1UUEA 1HJDA 5I11A 2RQTA 2YT6A 2AZVA 1V1CA 4CC2A 3O5ZA 2JM9A 2DL5A 2KRNA 1IO6A 1SHFA 2NWMA 3UA6A 2EBPA 1WXBA 2CH4W 1T0HA 2C0TA 2FPDA 3JV3A 2K9GA 3I5SA 2M0YA 2DL3A 2A28A 2SEMA 2CUDA 1E7OA 1VYUA 3ZL7C 2OJ2A 1K0SA 2KRSA 4JJDA 1AZEA 1UHCA 1JU5C 1YWOA 2BTTA 1E6HA 1OEBA 1K1ZA 2J6KA 1QKWA 1ABQA 1ZUUA 2E5KA 1X6BA 2EYWA 1FYNA 2LQWA 1AOJA 1OV3A 2ROLA 4EIKA 1NG2A 2JMAA 1M27C 3RBBB 2VKNA 3EHQA 2LX7A 1GCPA 1QWFA 4OMMA 2BZYA 3SEMA 1AWJA 1U3OA 3VS3A 2KR3A 1U06A 2V1RA 1T3LA 2FPFA 3H0FA 1PKTA 1WXTA 2CDTA 2I0NA 2EKHA 1YCSB 4R0KA 3C0CA 3NHNA 3FJ5A 1T0JA 3SHWA 1VA7A 1X2QA 4D8KA 1OPKA 3VS6A 2EGEA 4Z89A 1M3CA 4AFUC 2KYMA 1WDXA 2C0OA 2KRMA 4OMLA 5HCKA 4IIOA 2LP5A 2K79A 3M0UA 5L23A 2OAWA 1QWEA 4F14A 4HCKA 2FRYA 4RTYA 1T3SA 2FO0A 4AFZC 5GJVB 2X3WD 1GCQC 2CSIA 4E6RA 1AD5A 1UTIA 1CSKA 4OMNA 4Z8AA 2ENMA 2HBWA 2DL7A 5IHKA 2ESWA 3EG3A 1ZSGA 1AWOA 2DRMA 1W1FA 3M0PA 1ZUYA 2ROTA 2YSQA 2DLPA 3H0HA 2DF6A 3UATA 2O31A 4Y92A 3TSWA 2JS0A 1G2BA 3I9QA 1ARKA 2JMCA 3VS0A 2RNAA 4ORZA 1RI9A 4J9EA 3VS5A 1WLPB 2PNIA 2DBMA 1Z9QA 4JPBW 1M3BA 2GGRA 3RNJA 4J9BA 1GL5A 4FSSA 3VS4A 4ZNXA 3U23A 2FRWA 1X69A 2J7IA 1W6XA 2MOXA 2DNUA 3A98A 1YN8A 3VS1A 1X43A 4WCIA 2RQRA 3H41A 2NUZA 1M3AA 2B86A 3EGUA 5IHNA 2L2PA 1NYFA 2JW4A 2KYBA 1K9AA 4LE9A 4OMQA 4HVUA 1U5SA 2DJQA 3M0RA 2QDLA 2CUBA 2JM8A 2LJ1A 3VS7A 1M30A 1ABOA 2YUPA 3VRYA 4J9IA 2K2MA 1AEYA 2L3QA 2PZ1A 1AVZC 1YP5A 2HEQA 2D0NA 4RTUA 1GFDA 1TUCA 3EG1A 1BK2A 2L3PA 2EGAA 1B3QA 1UECA 1UG1A 3I35A 1JQQA 2DBKA 2EYZA 2LCSA 2KT8A 2DA9A 1SRMA 1VYVA 1WA7A 1X6GA 4JJCA 4DEYA 4F16A 2H8HA 1MUZA 2M51A 4J9HA 3NPFA 3UA7A 2K3BA 2HCKA 5IHIA 2RF0A 2CREA 3REBB 2D1XA 3ULRB 1UGVA 2O2OA 2ED0A 3TSZA 2O9VA 1I1JA 4RTZA 2CH4A 2K6DA 3TVTA 1KIKA 5IXBA 2LNHB 2DYBA 2DVJA 2MIOA 5I22A 1ZLMA 2JT4A 5FWCA 2O9SA 4Z88A 1J3TA 1S1NA 2W10A 4DEXA 1K4US 4K11A 2YUOA 2KROA 2ED1A 1A0NB 1WIEA 1GBRA 2EGCA 4LN2A 1E6GA 1JEGA 2VWFA 1AWXA 2A08A 3R6NA 4HVWA 4JJBA 1GCQA 2BZ8A 4J9CA 4A63B 3EG0A 4GBQA 4RUGA 2GTOA 1WFWA 3THKA 3UF4A 1MV3A 1SRLA 4J9FA 1G83A 2HDAA 1VYTA 1KFZA 2HSPA 2RMOA 1WYXA 1ZBJA 4F17A 3NGPA 1K0XA 4D8DA 2RQVA 1Z9ZA 4HXJA 4RTWA 3M0TA 1GFCA 1SPKA 1KJWA 2A37A 1BBZA 1CKBA 2JTEA 4LUDA 2ECZA 2LQNA 1H3HA 1GBQA 1PHTA 2SRCA 2X3XD 4KRTA 2DMOA 2AKLA 2DL8A 2LJ3A 2VVKA 2AK5A 2DX1A 1NEBA 3I5RA 2KEAA 2FPEA 3IQLA 2D8HA 1SHGA 5FWBA 2CT3A 2RPNA 2G6FX 1HD3A 2AKKA 1NLOC 2F2VA 1JXOA 1TUDA 1Y57A 2IIMA 2C0IA 3CQTA 3M0QA 2J06A 2YUNA 2L0AA 1YNZA 1ZUKA 1NM7A 2EPDA 1OOTA 2EVRA 1KSWA 1WXUA 3PVQA 2BZXA 1UFFA 2EQIA 1TG0A 2CT4A 1PKSA 2RQWA 4M4ZA 1HSQA 3EHRA 2LMJA 3H0IA 5EC7A 2P4RA 1BB9A 1W70A 2RN8A 2KGTA 4OMPA 1UJ0A 4HVVA 2CSQA 4CC4B 1EFNA 1GRIA 1X2KA 1PRMC 2JS2A 1BU1A 4AFQC 4RTTA 1WX6A 1NEGA 1I07A 2DE0X 1H92A 1CKAA 1RUWA 4AG1C 2OI3A 1K76A 2JXBA 2KT1A 2YUQA 1JO8A 1UHFA 2K7AA 1QKXA 1SSHA 2J6FA 2O88A 2W0ZA 1UE9A 1NYGA 5IH2A 5FW9A 3EG2A 1LCKA 3M0SA 3PVLA 2KNBB 1UDLA 3QWYA 1QCFA 2EYYA 2GBQA 1PRLC 2PTKA 2L3SA 1Y0MA 2KBTA 3PE0A 1X27A 4ESRA 2D8JA 3QWXX 4QT7A 3NMZC 1SEMA 2ABLA 2DILA 2GNCA 3GBQA 1WI7A 4LNPA 2DL4A 3REAB 1PNJA 2EYXA 1QLYA 4IIMA 2EW3A 4J9GA 3VS2A 1M8MA 2F2XA 3LH5A 2RQUA 4RTXA 2LJ0A
chains in the Genus database with same CATH superfamily
5J3BA 2LVMA 1YBYA 2JJ9A 4AFSC 4M7AD 3CCUT 3JB9F 2RA2A 5GMKj 1RLQC 2PVDB 2FYKA 2K2VA 4LUEA 1R8OB 1LOJA 4DBRA 4DOWA 4P5NA 3NTIA 4X9DA 3KUFA 3PNWC 1WPYA 2QGGA 2KXCA 2J05A 2V1QA 2YDLA 4JZ4A 1OPLA 5GAN2 4XAXB 3KFVA 3JB9D 2XMFA 1Q7YC 2O01E 3SD4A 4IUTA 1N5ZA 5I11A 2RQTA 2YT6A 1V1CA 2RI2A 1QVGA 1WHMA 5GAOp 1BI1A 3TEEA 2ZGWA 3VYHB 2EQJA 3QBYA 3GOXA 1MMNA 2QA4T 2LQKA 3ZEHA 4C8QF 2CH4W 3M54A 1MMAA 2C0TA 2CZ7B 2KDSA 2NYSA 3E9FA 2OTJT 1QCOA 2A28A 2XIDA 1E7OA 2HD0A 3G71A 3OW2S 4C92F 2DJZA 2QTXA 2EQUA 3CCJT 1M90R 1VQ5Q 3JCMc 1E6HA 3MKDA 4EDUA 1K1ZA 5J26A 2J6KA 3CC2T 4C8QD 3M4GA 2LNVA 1X6BA 1AOJA 1OV3A 2V8JA 2JOYA 2HQHA 1G8XA 1NZ9A 2JMAA 1M27C 5HKCA 4C92D 4OMMA 1Y96B 1AWJA 1G3TA 1B7TA 3CC4Q 5CQYA 3MHXA 1Q82R 4QQ6A 3CC7A 3H0FA 1VIEA 2EKHA 2HZYA 2Z0WA 3C0CA 3FJ5A 2K3XA 3SHWA 2CP6A 1OPKA 1UGRB 2CP5A 2KYMA 2C0OA 3PTAA 1Q86C 4F14A 1NBEB 4HCKA 5D6XA 4RTYA 4BY6C 4E7KA 2FO0A 5KYXA 1I5LA 4AFZC 2CYZB 4EMKB 4OB0B 3CD6A 4E6RA 3BY7A 2ENMA 1VUBA 2HBWA 2KY9A 1Y7XA 4JRKA 4PJOB 4N0AA 2DL7A 5IHKA 3EG9B 2ESWA 1AWOA 3HSBA 2NUTB 5GANf 4R55A 1YI2A 2GFUA 3SB2A 4FYVB 2DLPA 1K73C 2O31A 3EFSA 4GY5A 5GAOn 4LDYA 1ARKA 2QEXT 4J9EA 2DBMA 2VXEA 4JPBW 3G1JA 1M3BA 2P4TA 4MMKA 2KK4A 2LC4A 1OQKA 2AT1B 1M1KU 1YJ9Q 3CCEQ 4BE1A 1VQLT 5DLQE 1VQ4T 1W6XA 2P0PA 4C5GA 5KYWB 1BIAA 4ELZC 4PJOG 3RR6A 2K5IA 3HP9A 3H41A 2JN0A 2EQMA 4FT2A 1FMVA 4BI3A 5AYFA 1F1BB 1U5SA 2DJQA 2QDLA 1P92A 2CUBA 2JM8A 2LJ1A 3I55Q 1M30A 3CCVQ 5CKDA 4FIBA 3CCMQ 2DERA 3JCMb 2FZKB 2MF2A 3QPHA 3QHSA 1V76A 2HEQA 2D0NA 1GFDA 1I5OB 4B9WA 3X26B 4MZTA 3V8LA 2QQ9A 3QDRB 1UG1A 1UECA 3J7AF 4Q5WA 2DBKA 1VQNA 1ZQ1A 2E6ZA 2DZCA 2M16A 4N4GA 2OTLA 1WA7A 4JJCA 1VOMA 1VQMQ 2EIFA 2GCXA 5GMKe 4XTVA 2K3BA 2RF0A 4M78F 4JJNK 2RHYA 2O9VA 1YIJT 1KD1R 2MI6A 3CMET 5D6YA 4M7DF 5GMKi 1VQKQ 3TVTA 2LNHB 2HL5C 1VIFA 2DZ9A 2CP3A 2O9SA 2AIRB 1KC8C 3QKJA 1J3TA 3T9NA 3L42A 5LJ5f 1D0XA 4EMKC 3CXCP 2CP7A 2YUOA 4K11A 4LDXA 3PIPA 4F7UF 2KROA 4PJJA 1JEGA 2F5KA 4M7DD 4RMOA 3JCMP 3FDRA 2BZ8A 4RUGA 2VC8A 3J81E 4NL3A 3CCSQ 1Q7YR 1ZBXA 1N9RA 4J9FA 1G83A 1VYTA 4NOYA 2HSPA 3V8JA 2DIGA 2QTVA 4JLIA 5GAN3 4D8DA 3CCUA 2RQVA 4RTWA 1QQJA 2A37A 3OBWA 2RHIA 2X4JA 2X51A 3TREA 4LUDA 2EYQA 2LQNA 1PHTA 2X3XD 4KRTA 2AKLA 2AK5A 1RAEB 1BI2A 1UEBA 5IAYA 3IQLA 2D8HA 1SHGA 1YJWQ 5FWBA 3OYLA 2G6FX 3QJ6A 5C6SA 1TUDA 4XK8E 1LPLA 3HPWA 2J06A 2L0AA 2YRCA 2DYIA 3SWNA 2P84A 3TCJA 2LT1A 1IZ6A 3EFOA 1KSWA 3OW2P 2PVOB 2BZXA 1UFFA 2QA4A 1TG0A 1WZOA 2RQWA 4M75B 3FC3A 3RMQA 2LMJA 4M78C 2K4YA 4XU3A 5A0GA 2EJGA 1BB9A 1W70A 2RN8A 2KGTA 4II1A 2OTJA 2WSCE 4M77B 3PIOA 3WXMB 4CC4B 2QXFA 2DXCA 4ZTJA 4AFQC 3X25B 5LJ5j 3NTHA 4C5EA 4E7JA 4KH1B 1YFNA 1BI0A 4E47A 1H92A 4QQDA 3O8VA 1RUWA 1HYOA 3MEAA 5FU6B 2JXBA 2KT1A 5C0MA 3UPUA 1M90C 3CC2A 2YUQA 4A54A 3X20B 4HCBA 3D7SB 2J6FA 2O88A 3CCMA 1WNLA 3L2RA 4J6XA 3EG2A 1LCKA 3VUZA 2KNBB 3KXTA 2GF7A 1PRLC 3OYNA 4ZN3A 1VQOT 5LJ3f 1WQWA 5LJ3g 4M75G 4QT7A 2V8IA 2L5QA 3NMZC 3CCQQ 2ABLA 3MP8A 4M77G 1Q82C 1WHGA 1OYXA 1M8MA 3L2UA 2P0KA 2RQUA 5KYUB 4A4HA 3EH1A 4RTVA 2HL3A 1TH7A 1RL2A 4JZ3A 1MV0B 5IXFA 1PM3A 1XTDA 3EGXA 2LX9A 2LRQA 1WHLA 3JAME 1JXMA 1LJOA 4J7FA 1IHVA 1FMWA 4J83A 1ZX6A 3G6EQ 1I0CA 4J9DA 2MWPA 3LW5E 4AMCA 2LZ6B 1H8KA 4C5HA 1HK9A 1YWPA 2HSEB 1N8RC 5DLOA 2A3LA 2AZSA 1RAGB 2FG0A 4CC7A 1PD0A 3CCSA 1X6OA 2MPXC 4PNOA 4RCBA 2HNIA 4OB1B 4C92E 2QEXA 1AHJB 2KRNA 2P0QA 2O4XB 2NWMA 2EBPA 4OP0A 1WXBA 3ME9A 1ZSZB 3JV3A 4PLLA 2M0YA 4M77C 4MDXA 1M2OA 2CUDA 3EH2A 4J6WA 4BACA 1VQ4A 1VQLA 3OYGA 2MK5A 2OJ2A 2KRSA 2X9HA 3CCRQ 1AZEA 5LJ3j 3I56Q 1UHCA 2BIVA 4QKUA 3RUXA 5CCAA 1WGSA 1NJIC 1Q7YU 1HXDA 2ZZDA 4UC4A 5GANh 1BKBA 2WSEE 2E5KA 2RHUA 2VV5A 1FYNA 2ROLA 3QYGB 1VQ6Q 1QVFA 1NG2A 1M1GA 3EHQA 2LX7A 4A4KA 4KULA 4IUUA 3SEMA 1U3OA 4L59A 3DLLA 3E2UA 4E2FB 4OB3B 1XQHA 2V1RA 2XI9A 4JS4A 2VYTA 1PKTA 5KYNA 2DTHA 3CC4T 1VQPQ 4M7AB 2HBPA 2JTFA 1WHKA 4CRIA 5GANd 1RACB 4JS5A 1VA7A 2K3YA 2PQWA 2A0FB 2OX7A 3VS6A 5KH6A 1YIJA 4XU2A 1KD1C 1JRIA 2F5TX 2KRMA 2NUPA 3F70A 3CBPA 2DFUA 1N6AA 2CP0A 3ZBDA 3PT9A 2CKKA 1K8AR 2FRYA 3GNGA 2E4HA 1T3SA 1QVFS 2WACA 3URGA 1JBMA 5GJVB 3M55A 2XU8A 4JRQA 2JVVA 2B8AA 1AD5A 4R56A 2I2LA 1RABB 1U1SA 4MZMA 3JB9J 3LX7A 4FL6A 4M7AG 4E7ZA 4C8QA 3OYYA 3H0HA 2FB7A 2DF6A 4BE2A 4Y92A 3TSWA 2JMCA 2KAFA 3VS0A 1RI9A 4L5GA 5KE2A 2QDYB 4IUQA 4J8OA 2E5QA 4FYYB 3OYDA 4C92A 4WTOB 2GGRA 5LJ5e 3M9QA 1W2BA 1Q86U 1D1CA 3NTKA 4J9BA 5D7UA 1GL5A 2HKQB 3VS4A 4DBQA 1PG5B 5LJ5h 2E64A 4ELYC 1YITQ 3G6EA 1I4K1 3RESA 3P8HA 1EIFA 4JDSA 2YXYA 2DNUA 2E70A 4LXCA 4QVDA 3A98A 1YJ9T 3CCET 1R77A 4WCIA 4XU1A 4DQ2A 2NUZA 2RHZA 2DD4A 1M3AA 1I81A 3OS0A 3QZ9B 1TU0B 2B86A 2HQEA 5IHNA 1NYFA 2DVEA 2JW4A 1K9AA 4LE9A 5CVIA 2RI3A 2VASA 4Y28E 1K73U 1RI0A 3M0RA 2ZPIB 4J9IA 2K2MA 1AEYA 5LJ5d 2FVUA 4RTUA 3I55T 3CCVT 1Q81C 1LNXA 4QW2A 4M78E 3CCMT 1WJSA 1GXIE 1QVGS 1BK2A 2L3PA 1FX7A 1W2BS 4M7DE 1B3QA 2EYZA 2MAMA 5I21A 2KT8A 2DA9A 1SRMA 2QK0A 1X6GA 4KGXB 4F16A 5GAMf 3RDVA 3DLMA 3P8DA 2CS7A 4LDUA 2CREA 2D1XA 3ULRB 1UGVA 3I56A 3KBGA 1VQMT 1VQ8Q 5GMKm 3GF5A 2CH4A 3ZFJA 4F7UE 2PU9B 1ZLMA 1YJNQ 2X4YA 1JJ2A 2DKGA 2L89A 1VQKT 1VQOA 4FYWB 4EMGA 1K4US 1WHHA 2X35A 3RMSA 4ZGJB 3HL8A 1MMDA 2R5AA 2D9TA 1WIEA 1E6GA 2VWFA 1AWXA 2A08A 3X24B 4HVWA 3Q1JA 3VKIA 3M5AA 1GCQA 3OYFA 1N8RR 1TXQA 4GBQA 1VQ7Q 1WFWA 5KCOA 3CCLQ 1WJRA 2HDAA 4JLGA 3G4SQ 5GANg 1YHQQ 2XDDA 2OAUA 4F17A 3CCST 3BDUA 3MEVA 1N27A 2M0OA 1Z9ZA 5KYXB 4E7IA 1SPKA 1KJWA 1BBZA 1KC8U 5LJ3e 3OA6A 2ECZA 1H3HA 1JJ2S 3SFMA 2SRCA 1M8VA 2VVKA 5LJ3h 1W4SA 2RJFA 2MMPA 2KEAA 3RKWA 2CT3A 3BW1A 1HD3A 3UDCA 3NFCA 2F2VA 1Y57A 3UT1A 2C0IA 1YJWT 1NJIR 2DTOA 2M02A 3CBOA 4XU0A 7AT1B 5FU7B 1YNZA 3H8ZA 2LTOA 2F1LA 2EPDA 3L2VA 1G5VA 1ACMB 5GMKl 5GAMj 1M4ZA 1NPPA 2CT4A 2EJ9A 4CI0C 5LJ3d 2CGHA 4OB2B 3N5BB 3CEYA 1IREB 4M77E 4BDZA 4M78A 1TUGB 1I8FA 3HHTB 4M7DA 1EFNA 2L3RA 3L2WA 1MHNA 1PRMC 1BU1A 3LGLA 2D6FA 2COZA 2ATCB 1NEGA 3RKXA 4RG8A 1CKAA 1D0ZA 2ZPEB 1VQ9Q 2XD0A 2CZ6B 4IUPA 4LD6A 4OGEA 1VQ5A 3OYBA 2K7AA 2QI2A 4F7UA 4OVAA 2CZ1B 3E1SA 3MCAB 5IH2A 5FW9A 2LDMA 5IT9E 2DETA 5CKFA 1QCFA 2KBTA 1X27A 1U1TA 5GANj 2RB6A 3TU4K 2D8JA 3QWXX 4ATOA 5LJ5g 1C6VX 2DILA 2E6NA 3FLGA 2PUKB 3GBQA 1WI7A 4LNPA 3REAB 1PNJA 2EYXA 3DKMA 3CC4A 2COYA 4M78D 3CCQT 4PJOC 2EW3A 3VS2A 2F2XA 2AHJB 1QVFP 5FRNA 2ZPFB 1M90U 2LCCA 4X1VA 1PC0A 3RERA 1AWWA 1S72Q 4GLMA 4MDWA 1SKUB 1C1AA 1RLPC 2YRDA 2DM1A 2J6OA 2G3RA 2GTJA 1Y71A 1K8AC 1UJYA 5EG2A 4FT4A 2FEIA 2VGMA 2R58A 2DD5A 5CKHA 2DRKA 5ECAA 3G6ET 1OZ3A 3OYEA 1Q82U 1FMKA 1B34A 2DPPB 5GJWB 2A36A 4PJLA 4CC3A 3SDZA 2BE7D 2YLCA 4N4IA 3FIFA 5FU7C 2AZVA 4WF2A 4LDWA 4CC2A 3O5ZA 2DL5A 2HAXA 4Y91A 3OSVA 1SHFA 4ANJA 1RAHB 3OYJA 1UGQB 1Q81R 3I5SA 4HT8A 4PK4A 2DL3A 2SEMA 4DA4A 1UGSB 3QG1A 3BFMA 1IGQA 2YHTA 3ZL7C 3JCMQ 1EZZB 4JUVA 1M9SA 3CCEA 1YJ9A 4FYXB 4JJDA 1WHJA 1YWOA 1N8RU 2BTTA 3SWNB 4C5IA 4XQ3A 1OEBA 3EFOB 1QKWA 1ABQA 3CCRT 3I56T 1QVGP 1W2BP 4M77F 2LT4A 1OU9A 3LWIA 3RBBB 3MPUB 1RAAB 1UGPB 2DTIA 3I55A 3CCVA 2GFAA 1VQ6T 1FWZA 2BZYA 3S3NA 1KHCA 2KR3A 2E3HA 2FPFA 1K9MC 1NPRA 1M5Q1 2DIQA 4M77D 1YCSB 1AT1B 2M1HA 1X2QA 4D8KA 5KYYA 3OYIA 1VQPT 1VQMA 2EGEA 1D1AA 1NJIU 2IG0A 3A1PA 4Z89A 3JCMX 2NLUA 3CMAQ 4X9CA 1QCNA 4A4GA 5HCKA 4IIOA 2LP5A 3M53A 1RAFB 2K79A 3M0UA 1SG5A 2OAWA 1VQKA 5CQXA 5GAN7 1D09B 1OU8A 3WVDB 4E7SA 3GLXA 1EX4A 4Z8AA 3JB9H 4HA8A 3OSSC 2EWNA 5GAMe 4KUDK 3EG3A 1ZSGA 2FZGB 1W1FA 5M9OA 5GAMh 1ZUYA 1QP2A 2XG8D 1JJ2P 3EGXB 3EGDA 3I9QA 1N9SA 2E65A 1KD1U 5GAOr 1DJ7B 2Y4XA 3VS5A 1H3ZA 2ZPGB 1WLPB 3C4SA 3JCMW 2D0QB 2FHDA 1BCMA 3G71Q 4M75C 4FSSA 5FLXE 4ZNXA 3U23A 4B9XA 1X69A 2J7IA 3L2QA 1R0BG 2C06A 4X34A 5GAMd 1D3BA 3MP6A 2XDPA 5KCHA 3VS1A 1YITT 1X43A 3SWNC 2RQRA 1YJWA 4D6WA 3EGUA 2L2PA 5GANe 8AT1B 1OI1A 2KYBA 5FU6C 4ME7A 4C0ZA 4OMQA 4HVUA 3M56A 3VS7A 2DK3A 3JCMf 3JCMg 3VRYA 1MNDA 2VXFA 2CZ0B 1VQ5T 5CK9A 4NS5A 1AVZC 1YP5A 3CC7Q 2FL7A 3CPWA 2EKOA 3MP1A 4L6V5 3CXCA 5CKBA 2EGAA 1JQQA 2LQ8A 1MGQA 2BKDN 2LCLA 1RADB 2LCSA 4XTXA 1ZHIA 2MWOA 4J9HA 3NPFA 3UA7A 3HFNA 3REBB 2MYSA 2O2OA 3RIRA 2ED0A 3PFSA 3JRZA 4RTZA 3QUIA 2L8DA 3OY9A 2IPOB 2RK2A 5IXBA 2XKOC 2DYBA 2MIOA 5I22A 3QSUA 1VQ8T 1Q95G 5FWCA 5CAIA 4AT1B 2F69A 4ZN1A 3QJYA 1M1KR 3CD6Q 2RK1A 2W10A 4KGZB 4QVCA 1YJNT 3H6ZA 1Q81U 3HTRA 4C0FA 2K5LA 1WQ7A 2ED1A 3MEWA 1A0NB 3CPWS 2A7YA 2GQVA 1YI2Q 1IHWA 3R6NA 3CCQA 4J9CA 3VU3C 4PJOE 4JRIA 4A63B 2KSSA 2DXUA 3EG0A 3THKA 3UF4A 3EAEA 3C95A 3L2ZA 2NUPB 2DO3A 3HFOA 1X75C 1PD1A 1O9SA 1VQ7T 3CCLT 2FZCB 2RMOA 1ZBJA 3CMAA 3NGPA 1RAIB 1K0XA 3OYAA 4HCCA 4XTUA 1G3SA 3G4ST 1YHQT 3M0TA 3OW2A 4BY6B 2V26A 3A8OB 1CKBA 5A0LA 1QVPA 1GBQA 2Y90A 2DMOA 1ZSZC 4O6JA 3HRTA 2DX1A 3QO3A 5DY9A 4O5VA 3I5RA 2JUFA 2FPEA 2V8KA 3JB9G 1KQ2A 4C8QB 3OYCA 1YCYA 3M0QA 3LYIA 3L1AA 4BB7A 4E7LA 2DEUA 4C92B 2DAQA 2XDBA 1OOTA 2EVRA 2E10A 5I2MA 1WXUA 3PVQA 2EQIA 2RJDA 1BIBA 1HSQA 3OB9A 1VQNQ 3C94A 5EC7A 4FM4B 2OTLQ 4OMPA 4HCZA 4KH0B 1UJ0A 1JB0E 2E12A 4HVVA 2CP2A 3BDLA 1Y96A 4RKUE 5HK0A 1K9MR 1FXXA 2JS2A 4RTTA 1WX6A 3G7ZA 3MEUA 2ZPHB 3ER0A 1I07A 4KGVB 4BD3A 4M7AC 2OI3A 1K76A 4C8QG 5GAMg 1WJQA 1M1FA 3GIBA 3CCRA 1G3WA 1UHFA 3GNFB 1QKXA 1VQ9T 4C0DB 3A8HB 1XJWB 4C92G 2DXBA 2W0ZA 2EFIA 2QQBA 3OMCA 3M0SA 3PVLA 3QWYA 2GBQA 2EYYA 4PKCC 1VQ6A 4RG2A 2L3SA 5GAOm 2QG9B 4ESRA 1KQSA 1MNEA 1KG1A 2GNCA 5CKEA 3EFRA 3TQ7P 4EMKA 2RM4A 3ASKA 3INZA 1G3YA 1QLYA 4ZGDB 4IIMA 4KT0E 3E19A 4PJOA 3EG9A 3LH5A 5D6WA 4B6MA 5GAOq 1VQPA 3CCUQ 2LJ0A 2QGFB 1U8RA 2NUTA 2EJFA 4OMOA 2VB6A 2F2WA 3LLRA 1PWTA 1ZA2B 1R0CB 4PFPA 4QVZA 4PJNA 1SF9A 3JCMV 2X4XA 2RD1A 2KE9A 4GLKA 2KXDA 2GQIA 4PJOF 3VRZA 1S72T 1D0YA 2E3IA 2RJCA 1NLPC 3HRUA 1XOVA 2M9UA 4AG2C 4HKEA 3QIIA 2RJEA 2MCNA 4C8QC 2QAZA 4V2SA 1KQSS 1B07A 1AZGB 2YLBA 1C0MA 4EPCA 2HQXA 2XHCA 3OQ5A 5KYWA 1TSFA 2RI5A 3A8GB 1UUEA 1HJDA 4FW2A 4C92C 2QA4Q 4PJOD 2QYZA 4A4FA 4N4HA 2HMAA 2JM9A 2QQAA 2E1HA 3V8KA 1IO6A 5CR2A 1BI3A 3BE3A 4J7IA 3UA6A 2OTJQ 4PFOA 3HKSA 1IB8A 3LGFA 1OX9A 4OGCA 1T0HA 1TS9A 2FPDA 2K9GA 4M75E 4OMFB 4FCYA 2IVWA 2K57A 1K8AU 3E9GA 2RH2A 4TVRA 5GAOl 1VYUA 1NE8A 3CCJQ 4KBMB 3OS5A 5GAN8 3UWNA 1K0SA 1YITA 4Z02A 3CC2Q 4J6YA 2COWA 3GPLA 1JU5C 3CBMA 2Y4YA 4PJMA 5A0DA 3A8LB 4NL2A 2WSFE 1ZUUA 5GAN5 1TOVA 4VUBA 9ATCB 2EYWA 2LQWA 1OX8A 4EIKA 4C0DC 4A53A 1XNIA 1PCXA 1M2VA 4M78B 2VKNA 2H3JA 4ZGEB 1GCPA 3MJXA 1QWFA 3LWHA 4M7DB 2HKNA 3DB3A 3VS3A 3QXEB 1U06A 1T3LA 2E41A 1WXTA 2CDTA 2I0NA 4R0KA 3NHNA 5GMKh 2ZAEA 1T0JA 2DXTA 3VYGA 1M2VB 4F7UB 4LD9K 3VUBA 3AHUA 3HRSA 1M3CA 4AFUC 3JCMe 1WDXA 3JSCA 4PL6A 3PMIA 4OMLA 5AT1B 5IN1A 3CPWP 1VQ8A 4XTWA 4BI8B 5L23A 1QWEA 4RCCA 3OMGA 3JCMh 3CMAT 1D1BA 3META 3M4YA 1QP3A 1YJNA 2QQSA 2R57A 4M78G 3QZ5B 1M1KC 3C12A 2X3WD 1GCQC 2CSIA 4HT9A 4M7DG 1UTIA 1CSKA 4N0AC 4OMNA 4F04B 3GP8A 1QMCA 2YRVA 1K9MU 1KHIA 2DRMA 5LL6S 3M0PA 2ROTA 4DBFA 2YSQA 4IURA 2QEXQ 5FRMA 3UATA 1VQ7A 2JS0A 4F7UG 1G2BA 3JCMd 3CCLA 2DEQA 2YWWA 2RNAA 4ORZA 2KMTA 4PFZA 1MMGA 2BE9B 3OYMA 4QQGA 2PNIA 3G4SA 4BDYA 1Z9QA 1YHQA 3RNJA 1H641 5I2SA 2BUDA 3PGGA 1VQLQ 1VQ4Q 5A2QE 5HY6A 2FRWA 4DOVA 4M75A 6AT1B 1B34B 3G71T 2MOXA 4OF1A 4M77A 3VJPA 4FU6A 1IXDA 1YN8A 8ATCB 1PSFA 2KVQG 4E7HA 2ZPBB 1OZ2A 5CO7A 2VUBA 1KK7A 3S6WA 4XTZA 4M75F 3S3OA 1IRXA 2ZCFB 1ABOA 3PMTA 2YUPA 2L3QA 2PZ1A 4PLIA 4M7DC 1TUCA 3EG1A 2H3EB 5L8RE 1O75A 3A8MB 3I35A 4XTYA 3CC7T 1VYVA 3CCJA 3LH0A 4M75D 4DEYA 1YIJQ 2H8HA 1MUZA 3VV0A 3CMEQ 2M51A 5IHIA 2HCKA 4M7AE 3TSZA 1V29B 1I1JA 3V7CA 1PSEA 3QYHB 3OS2A 2K6DA 3M57A 3S3MA 1KIKA 1Q86R 2DVJA 1VQ9A 2JT4A 5KYUA 5FROA 4Z88A 3FRNA 3FJPA 1S1NA 2EQKA 3H9NA 3WVEB 3RKYA 4DEXA 1Y07A 3V7SA 3CD6T 1GBRA 2EGCA 4LN2A 4JJBA 5KYYB 3FB9A 2GTOA 1K73R 1YI2T 1MV3A 1SRLA 1KFZA 4MMLA 2EAYA 1IGUA 1WYXA 2JNGA 4FW1A 4J5YA 4HXJA 1GFCA 3X28B 1KQSP 2JTEA 3OBYA 2O4XA 1S72A 4LDVA 1BCOA 2RHXA 2DL8A 2LJ3A 4C0GA 1NEBA 1ZSZA 2K5FA 2R5MA 4KUIA 2RPNA 4C8QE 4BE0A 2AKKA 3OYKA 1NLOC 4BUGA 1JXOA 2IIMA 4BI4A 1TTHB 3JB9I 3EGDB 5KE3A 3CQTA 2YUNA 3J80E 4IUVA 1ZUKA 1NM7A 3M58A 4DBHA 1LVKA 3AT1B 2XICA 5CIUA 1QW1A 4YTLA 2PUOB 1PKSA 4M4ZA 3QDFA 3EHRA 3H0IA 1SSFA 2P4RA 4EMHA 1D3BB 3OS1A 2RO0A 1OULA 2CSQA 1VQNT 3CPFA 1GRIA 2OTLT 1X2KA 2KI7A 5GAN4 2QQRA 5DM7R 2JZ2A 2DE0X 3P8BB 1X01A 4AG1C 3A5ZB 4ZTFA 4M7AA 3M59A 1UB4A 4FSXA 1JO8A 2X4WA 2JTMA 4JRPA 1KC8R 4MZPA 1VQOQ 1SSHA 2QASA 1UE9A 1NYGA 2KQWA 1UDLA 3OYHA 4A4EA 3MO8A 5GAN6 2PTKA 3PE0A 1Y0MA 1BYMA 1TWBA 2VGNA 4M7AF 1SEMA 1KQ1A 2PVGB 2XK0A 3FEOA 2DL4A 4IKFA 3R6OA 5J39A 4J9GA 3CMEA 3DB4A 3CXCS 1ZA1B 3V7RA 4RTXA 3JCMJ 5HK3A
chains in the Genus database with same CATH topology
4RTVA 4OMOA 2F2WA 4AFSC 4X1VA 4JZ3A 1PWTA 1MV0B 1AWWA 5IXFA 1RLQC 4GLMA 1JXMA 2KE9A 1RLPC 2DM1A 2J6OA 2GTJA 2KXDA 2GQIA 3VRZA 1ZX6A 4LUEA 1NLPC 1UJYA 1XOVA 4AG2C 1I0CA 4J9DA 2FEIA 2MCNA 2LZ6B 2DRKA 1H8KA 1YWPA 5ECAA 2KXCA 2J05A 2V1QA 2YDLA 4JZ4A 1OPLA 1B07A 1AZGB 1FMKA 3KFVA 5GJWB 2A36A 2XMFA 2AZSA 4CC3A 2FG0A 4CC7A 1N5ZA 1UUEA 1HJDA 5I11A 2RQTA 2YT6A 2AZVA 1V1CA 4CC2A 3O5ZA 2JM9A 2DL5A 2KRNA 1IO6A 1SHFA 2NWMA 3UA6A 2EBPA 1WXBA 2CH4W 1T0HA 2C0TA 2FPDA 3JV3A 2K9GA 3I5SA 2M0YA 2DL3A 2A28A 2SEMA 2CUDA 1E7OA 1VYUA 3ZL7C 2OJ2A 1K0SA 2KRSA 4JJDA 1AZEA 1UHCA 1JU5C 1YWOA 2BTTA 1E6HA 1OEBA 1K1ZA 2J6KA 1QKWA 1ABQA 1ZUUA 2E5KA 1X6BA 2EYWA 1FYNA 2LQWA 1AOJA 1OV3A 2ROLA 4EIKA 1NG2A 2JMAA 1M27C 3RBBB 2VKNA 3EHQA 2LX7A 1GCPA 1QWFA 4OMMA 2BZYA 3SEMA 1AWJA 1U3OA 3VS3A 2KR3A 1U06A 2V1RA 1T3LA 2FPFA 3H0FA 1PKTA 1WXTA 2CDTA 2I0NA 2EKHA 1YCSB 4R0KA 3C0CA 3NHNA 3FJ5A 1T0JA 3SHWA 1VA7A 1X2QA 4D8KA 1OPKA 3VS6A 2EGEA 4Z89A 1M3CA 4AFUC 2KYMA 1WDXA 2C0OA 2KRMA 4OMLA 5HCKA 4IIOA 2LP5A 2K79A 3M0UA 5L23A 2OAWA 1QWEA 4F14A 4HCKA 2FRYA 4RTYA 1T3SA 2FO0A 4AFZC 5GJVB 2X3WD 1GCQC 2CSIA 4E6RA 1AD5A 1UTIA 1CSKA 4OMNA 4Z8AA 2ENMA 2HBWA 2DL7A 5IHKA 2ESWA 3EG3A 1ZSGA 1AWOA 2DRMA 1W1FA 3M0PA 1ZUYA 2ROTA 2YSQA 2DLPA 3H0HA 2DF6A 3UATA 2O31A 4Y92A 3TSWA 2JS0A 1G2BA 3I9QA 1ARKA 2JMCA 3VS0A 2RNAA 4ORZA 1RI9A 4J9EA 3VS5A 1WLPB 2PNIA 2DBMA 1Z9QA 4JPBW 1M3BA 2GGRA 3RNJA 4J9BA 1GL5A 4FSSA 3VS4A 4ZNXA 3U23A 2FRWA 1X69A 2J7IA 1W6XA 2MOXA 2DNUA 3A98A 1YN8A 3VS1A 1X43A 4WCIA 2RQRA 3H41A 2NUZA 1M3AA 2B86A 3EGUA 5IHNA 2L2PA 1NYFA 2JW4A 2KYBA 1K9AA 4LE9A 4OMQA 4HVUA 1U5SA 2DJQA 3M0RA 2QDLA 2CUBA 2JM8A 2LJ1A 3VS7A 1M30A 1ABOA 2YUPA 3VRYA 4J9IA 2K2MA 1AEYA 2L3QA 2PZ1A 1AVZC 1YP5A 2HEQA 2D0NA 4RTUA 1GFDA 1TUCA 3EG1A 1BK2A 2L3PA 2EGAA 1B3QA 1UECA 1UG1A 3I35A 1JQQA 2DBKA 2EYZA 2LCSA 2KT8A 2DA9A 1SRMA 1VYVA 1WA7A 1X6GA 4JJCA 4DEYA 4F16A 2H8HA 1MUZA 2M51A 4J9HA 3NPFA 3UA7A 2K3BA 2HCKA 5IHIA 2RF0A 2CREA 3REBB 2D1XA 3ULRB 1UGVA 2O2OA 2ED0A 3TSZA 2O9VA 1I1JA 4RTZA 2CH4A 2K6DA 3TVTA 1KIKA 5IXBA 2LNHB 2DYBA 2DVJA 2MIOA 5I22A 1ZLMA 2JT4A 5FWCA 2O9SA 4Z88A 1J3TA 1S1NA 2W10A 4DEXA 1K4US 4K11A 2YUOA 2KROA 2ED1A 1A0NB 1WIEA 1GBRA 2EGCA 4LN2A 1E6GA 1JEGA 2VWFA 1AWXA 2A08A 3R6NA 4HVWA 4JJBA 1GCQA 2BZ8A 4J9CA 4A63B 3EG0A 4GBQA 4RUGA 2GTOA 1WFWA 3THKA 3UF4A 1MV3A 1SRLA 4J9FA 1G83A 2HDAA 1VYTA 1KFZA 2HSPA 2RMOA 1WYXA 1ZBJA 4F17A 3NGPA 1K0XA 4D8DA 2RQVA 1Z9ZA 4HXJA 4RTWA 3M0TA 1GFCA 1SPKA 1KJWA 2A37A 1BBZA 1CKBA 2JTEA 4LUDA 2ECZA 2LQNA 1H3HA 1GBQA 1PHTA 2SRCA 2X3XD 4KRTA 2DMOA 2AKLA 2DL8A 2LJ3A 2VVKA 2AK5A 2DX1A 1NEBA 3I5RA 2KEAA 2FPEA 3IQLA 2D8HA 1SHGA 5FWBA 2CT3A 2RPNA 2G6FX 1HD3A 2AKKA 1NLOC 2F2VA 1JXOA 1TUDA 1Y57A 2IIMA 2C0IA 3CQTA 3M0QA 2J06A 2YUNA 2L0AA 1YNZA 1ZUKA 1NM7A 2EPDA 1OOTA 2EVRA 1KSWA 1WXUA 3PVQA 2BZXA 1UFFA 2EQIA 1TG0A 2CT4A 1PKSA 2RQWA 4M4ZA 1HSQA 3EHRA 2LMJA 3H0IA 5EC7A 2P4RA 1BB9A 1W70A 2RN8A 2KGTA 4OMPA 1UJ0A 4HVVA 2CSQA 4CC4B 1EFNA 1GRIA 1X2KA 1PRMC 2JS2A 1BU1A 4AFQC 4RTTA 1WX6A 1NEGA 1I07A 2DE0X 1H92A 1CKAA 1RUWA 4AG1C 2OI3A 1K76A 2JXBA 2KT1A 2YUQA 1JO8A 1UHFA 2K7AA 1QKXA 1SSHA 2J6FA 2O88A 2W0ZA 1UE9A 1NYGA 5IH2A 5FW9A 3EG2A 1LCKA 3M0SA 3PVLA 2KNBB 1UDLA 3QWYA 1QCFA 2EYYA 2GBQA 1PRLC 2PTKA 2L3SA 1Y0MA 2KBTA 3PE0A 1X27A 4ESRA 2D8JA 3QWXX 4QT7A 3NMZC 1SEMA 2ABLA 2DILA 2GNCA 3GBQA 1WI7A 4LNPA 2DL4A 3REAB 1PNJA 2EYXA 1QLYA 4IIMA 2EW3A 4J9GA 3VS2A 1M8MA 2F2XA 3LH5A 2RQUA 4RTXA 2LJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RTV A;  4OMO A;  2F2W A;  4AFS C;  4X1V A;  4JZ3 A;  1PWT A;  1MV0 B;  1AWW A;  5IXF A;  1RLQ C;  4GLM A;  1JXM A;  2KE9 A;  1RLP C;  2DM1 A;  2J6O A;  2GTJ A;  2KXD A;  2GQI A;  3VRZ A;  1ZX6 A;  4LUE A;  1NLP C;  1UJY A;  1XOV A;  4AG2 C;  1I0C A;  4J9D A;  2FEI A;  2MCN A;  2LZ6 B;  2DRK A;  1H8K A;  1YWP A;  5ECA A;  2KXC A;  2J05 A;  2V1Q A;  2YDL A;  4JZ4 A;  1OPL A;  1B07 A;  1AZG B;  1FMK A;  3KFV A;  5GJW B;  2A36 A;  2XMF A;  2AZS A;  4CC3 A;  2FG0 A;  4CC7 A;  1N5Z A;  1UUE A;  1HJD A;  5I11 A;  2RQT A;  2YT6 A;  2AZV A;  1V1C A;  4CC2 A;  3O5Z A;  2JM9 A;  2DL5 A;  2KRN A;  1IO6 A;  1SHF A;  2NWM A;  3UA6 A;  2EBP A;  1WXB A;  2CH4 W;  1T0H A;  2C0T A;  2FPD A;  3JV3 A;  2K9G A;  3I5S A;  2M0Y A;  2DL3 A;  2A28 A;  2SEM A;  2CUD A;  1E7O A;  1VYU A;  3ZL7 C;  2OJ2 A;  1K0S A;  2KRS A;  4JJD A;  1AZE A;  1UHC A;  1JU5 C;  1YWO A;  2BTT A;  1E6H A;  1OEB A;  1K1Z A;  2J6K A;  1QKW A;  1ABQ A;  1ZUU A;  2E5K A;  1X6B A;  2EYW A;  1FYN A;  2LQW A;  1AOJ A;  1OV3 A;  2ROL A;  4EIK A;  1NG2 A;  2JMA A;  1M27 C;  3RBB B;  2VKN A;  3EHQ A;  2LX7 A;  1GCP A;  1QWF A;  4OMM A;  2BZY A;  3SEM A;  1AWJ A;  1U3O A;  3VS3 A;  2KR3 A;  1U06 A;  2V1R A;  1T3L A;  2FPF A;  3H0F A;  1PKT A;  1WXT A;  2CDT A;  2I0N A;  2EKH A;  1YCS B;  4R0K A;  3C0C A;  3NHN A;  3FJ5 A;  1T0J A;  3SHW A;  1VA7 A;  1X2Q A;  4D8K A;  1OPK A;  3VS6 A;  2EGE A;  4Z89 A;  1M3C A;  4AFU C;  2KYM A;  1WDX A;  2C0O A;  2KRM A;  4OML A;  5HCK A;  4IIO A;  2LP5 A;  2K79 A;  3M0U A;  5L23 A;  2OAW A;  1QWE A;  4F14 A;  4HCK A;  2FRY A;  4RTY A;  1T3S A;  2FO0 A;  4AFZ C;  5GJV B;  2X3W D;  1GCQ C;  2CSI A;  4E6R A;  1AD5 A;  1UTI A;  1CSK A;  4OMN A;  4Z8A A;  2ENM A;  2HBW A;  2DL7 A;  5IHK A;  2ESW A;  3EG3 A;  1ZSG A;  1AWO A;  2DRM A;  1W1F A;  3M0P A;  1ZUY A;  2ROT A;  2YSQ A;  2DLP A;  3H0H A;  2DF6 A;  3UAT A;  2O31 A;  4Y92 A;  3TSW A;  2JS0 A;  1G2B A;  3I9Q A;  1ARK A;  2JMC A;  3VS0 A;  2RNA A;  4ORZ A;  1RI9 A;  4J9E A;  3VS5 A;  1WLP B;  2PNI A;  2DBM A;  1Z9Q A;  4JPB W;  1M3B A;  2GGR A;  3RNJ A;  4J9B A;  1GL5 A;  4FSS A;  3VS4 A;  4ZNX A;  3U23 A;  2FRW A;  1X69 A;  2J7I A;  1W6X A;  2MOX A;  2DNU A;  3A98 A;  1YN8 A;  3VS1 A;  1X43 A;  4WCI A;  2RQR A;  3H41 A;  2NUZ A;  1M3A A;  2B86 A;  3EGU A;  5IHN A;  2L2P A;  1NYF A;  2JW4 A;  2KYB A;  1K9A A;  4LE9 A;  4OMQ A;  4HVU A;  1U5S A;  2DJQ A;  3M0R A;  2QDL A;  2CUB A;  2JM8 A;  2LJ1 A;  3VS7 A;  1M30 A;  1ABO A;  2YUP A;  3VRY A;  4J9I A;  2K2M A;  1AEY A;  2L3Q A;  2PZ1 A;  1AVZ C;  1YP5 A;  2HEQ A;  2D0N A;  4RTU A;  1GFD A;  1TUC A;  3EG1 A;  1BK2 A;  2L3P A;  2EGA A;  1B3Q A;  1UEC A;  1UG1 A;  3I35 A;  1JQQ A;  2DBK A;  2EYZ A;  2LCS A;  2KT8 A;  2DA9 A;  1SRM A;  1VYV A;  1WA7 A;  1X6G A;  4JJC A;  4DEY A;  4F16 A;  2H8H A;  1MUZ A;  2M51 A;  4J9H A;  3NPF A;  3UA7 A;  2K3B A;  2HCK A;  5IHI A;  2RF0 A;  2CRE A;  3REB B;  2D1X A;  3ULR B;  1UGV A;  2O2O A;  2ED0 A;  3TSZ A;  2O9V A;  1I1J A;  4RTZ A;  2CH4 A;  2K6D A;  3TVT A;  1KIK A;  5IXB A;  2LNH B;  2DYB A;  2DVJ A;  2MIO A;  5I22 A;  1ZLM A;  2JT4 A;  5FWC A;  2O9S A;  4Z88 A;  1J3T A;  1S1N A;  2W10 A;  4DEX A;  1K4U S;  4K11 A;  2YUO A;  2KRO A;  2ED1 A;  1A0N B;  1WIE A;  1GBR A;  2EGC A;  4LN2 A;  1E6G A;  1JEG A;  2VWF A;  1AWX A;  2A08 A;  3R6N A;  4HVW A;  4JJB A;  1GCQ A;  2BZ8 A;  4J9C A;  4A63 B;  3EG0 A;  4GBQ A;  4RUG A;  2GTO A;  1WFW A;  3THK A;  3UF4 A;  1MV3 A;  1SRL A;  4J9F A;  1G83 A;  2HDA A;  1VYT A;  1KFZ A;  2HSP A;  2RMO A;  1WYX A;  1ZBJ A;  4F17 A;  3NGP A;  1K0X A;  4D8D A;  2RQV A;  1Z9Z A;  4HXJ A;  4RTW A;  3M0T A;  1GFC A;  1SPK A;  1KJW A;  2A37 A;  1BBZ A;  1CKB A;  2JTE A;  4LUD A;  2ECZ A;  2LQN A;  1H3H A;  1GBQ A;  1PHT A;  2SRC A;  2X3X D;  4KRT A;  2DMO A;  2AKL A;  2DL8 A;  2LJ3 A;  2VVK A;  2AK5 A;  2DX1 A;  1NEB A;  3I5R A;  2KEA A;  2FPE A;  3IQL A;  2D8H A;  1SHG A;  5FWB A;  2CT3 A;  2RPN A;  2G6F X;  1HD3 A;  2AKK A;  1NLO C;  2F2V A;  1JXO A;  1TUD A;  1Y57 A;  2IIM A;  2C0I A;  3CQT A;  3M0Q A;  2J06 A;  2YUN A;  2L0A A;  1YNZ A;  1ZUK A;  1NM7 A;  2EPD A;  1OOT A;  2EVR A;  1KSW A;  1WXU A;  3PVQ A;  2BZX A;  1UFF A;  2EQI A;  1TG0 A;  2CT4 A;  1PKS A;  2RQW A;  4M4Z A;  1HSQ A;  3EHR A;  2LMJ A;  3H0I A;  5EC7 A;  2P4R A;  1BB9 A;  1W70 A;  2RN8 A;  2KGT A;  4OMP A;  1UJ0 A;  4HVV A;  2CSQ A;  4CC4 B;  1EFN A;  1GRI A;  1X2K A;  1PRM C;  2JS2 A;  1BU1 A;  4AFQ C;  4RTT A;  1WX6 A;  1NEG A;  1I07 A;  2DE0 X;  1H92 A;  1CKA A;  1RUW A;  4AG1 C;  2OI3 A;  1K76 A;  2JXB A;  2KT1 A;  2YUQ A;  1JO8 A;  1UHF A;  2K7A A;  1QKX A;  1SSH A;  2J6F A;  2O88 A;  2W0Z A;  1UE9 A;  1NYG A;  5IH2 A;  5FW9 A;  3EG2 A;  1LCK A;  3M0S A;  3PVL A;  2KNB B;  1UDL A;  3QWY A;  1QCF A;  2EYY A;  2GBQ A;  1PRL C;  2PTK A;  2L3S A;  1Y0M A;  2KBT A;  3PE0 A;  1X27 A;  4ESR A;  2D8J A;  3QWX X;  4QT7 A;  3NMZ C;  1SEM A;  2ABL A;  2DIL A;  2GNC A;  3GBQ A;  1WI7 A;  4LNP A;  2DL4 A;  3REA B;  1PNJ A;  2EYX A;  1QLY A;  4IIM A;  2EW3 A;  4J9G A;  3VS2 A;  1M8M A;  2F2X A;  3LH5 A;  2RQU A;  4RTX A;  2LJ0 A; 
#chains in the Genus database with same CATH topology
 5J3B A;  2LVM A;  1YBY A;  2JJ9 A;  4AFS C;  4M7A D;  3CCU T;  3JB9 F;  2RA2 A;  5GMK j;  1RLQ C;  2PVD B;  2FYK A;  2K2V A;  4LUE A;  1R8O B;  1LOJ A;  4DBR A;  4DOW A;  4P5N A;  3NTI A;  4X9D A;  3KUF A;  3PNW C;  1WPY A;  2QGG A;  2KXC A;  2J05 A;  2V1Q A;  2YDL A;  4JZ4 A;  1OPL A;  5GAN 2;  4XAX B;  3KFV A;  3JB9 D;  2XMF A;  1Q7Y C;  2O01 E;  3SD4 A;  4IUT A;  1N5Z A;  5I11 A;  2RQT A;  2YT6 A;  1V1C A;  2RI2 A;  1QVG A;  1WHM A;  5GAO p;  1BI1 A;  3TEE A;  2ZGW A;  3VYH B;  2EQJ A;  3QBY A;  3GOX A;  1MMN A;  2QA4 T;  2LQK A;  3ZEH A;  4C8Q F;  2CH4 W;  3M54 A;  1MMA A;  2C0T A;  2CZ7 B;  2KDS A;  2NYS A;  3E9F A;  2OTJ T;  1QCO A;  2A28 A;  2XID A;  1E7O A;  2HD0 A;  3G71 A;  3OW2 S;  4C92 F;  2DJZ A;  2QTX A;  2EQU A;  3CCJ T;  1M90 R;  1VQ5 Q;  3JCM c;  1E6H A;  3MKD A;  4EDU A;  1K1Z A;  5J26 A;  2J6K A;  3CC2 T;  4C8Q D;  3M4G A;  2LNV A;  1X6B A;  1AOJ A;  1OV3 A;  2V8J A;  2JOY A;  2HQH A;  1G8X A;  1NZ9 A;  2JMA A;  1M27 C;  5HKC A;  4C92 D;  4OMM A;  1Y96 B;  1AWJ A;  1G3T A;  1B7T A;  3CC4 Q;  5CQY A;  3MHX A;  1Q82 R;  4QQ6 A;  3CC7 A;  3H0F A;  1VIE A;  2EKH A;  2HZY A;  2Z0W A;  3C0C A;  3FJ5 A;  2K3X A;  3SHW A;  2CP6 A;  1OPK A;  1UGR B;  2CP5 A;  2KYM A;  2C0O A;  3PTA A;  1Q86 C;  4F14 A;  1NBE B;  4HCK A;  5D6X A;  4RTY A;  4BY6 C;  4E7K A;  2FO0 A;  5KYX A;  1I5L A;  4AFZ C;  2CYZ B;  4EMK B;  4OB0 B;  3CD6 A;  4E6R A;  3BY7 A;  2ENM A;  1VUB A;  2HBW A;  2KY9 A;  1Y7X A;  4JRK A;  4PJO B;  4N0A A;  2DL7 A;  5IHK A;  3EG9 B;  2ESW A;  1AWO A;  3HSB A;  2NUT B;  5GAN f;  4R55 A;  1YI2 A;  2GFU A;  3SB2 A;  4FYV B;  2DLP A;  1K73 C;  2O31 A;  3EFS A;  4GY5 A;  5GAO n;  4LDY A;  1ARK A;  2QEX T;  4J9E A;  2DBM A;  2VXE A;  4JPB W;  3G1J A;  1M3B A;  2P4T A;  4MMK A;  2KK4 A;  2LC4 A;  1OQK A;  2AT1 B;  1M1K U;  1YJ9 Q;  3CCE Q;  4BE1 A;  1VQL T;  5DLQ E;  1VQ4 T;  1W6X A;  2P0P A;  4C5G A;  5KYW B;  1BIA A;  4ELZ C;  4PJO G;  3RR6 A;  2K5I A;  3HP9 A;  3H41 A;  2JN0 A;  2EQM A;  4FT2 A;  1FMV A;  4BI3 A;  5AYF A;  1F1B B;  1U5S A;  2DJQ A;  2QDL A;  1P92 A;  2CUB A;  2JM8 A;  2LJ1 A;  3I55 Q;  1M30 A;  3CCV Q;  5CKD A;  4FIB A;  3CCM Q;  2DER A;  3JCM b;  2FZK B;  2MF2 A;  3QPH A;  3QHS A;  1V76 A;  2HEQ A;  2D0N A;  1GFD A;  1I5O B;  4B9W A;  3X26 B;  4MZT A;  3V8L A;  2QQ9 A;  3QDR B;  1UG1 A;  1UEC A;  3J7A F;  4Q5W A;  2DBK A;  1VQN A;  1ZQ1 A;  2E6Z A;  2DZC A;  2M16 A;  4N4G A;  2OTL A;  1WA7 A;  4JJC A;  1VOM A;  1VQM Q;  2EIF A;  2GCX A;  5GMK e;  4XTV A;  2K3B A;  2RF0 A;  4M78 F;  4JJN K;  2RHY A;  2O9V A;  1YIJ T;  1KD1 R;  2MI6 A;  3CME T;  5D6Y A;  4M7D F;  5GMK i;  1VQK Q;  3TVT A;  2LNH B;  2HL5 C;  1VIF A;  2DZ9 A;  2CP3 A;  2O9S A;  2AIR B;  1KC8 C;  3QKJ A;  1J3T A;  3T9N A;  3L42 A;  5LJ5 f;  1D0X A;  4EMK C;  3CXC P;  2CP7 A;  2YUO A;  4K11 A;  4LDX A;  3PIP A;  4F7U F;  2KRO A;  4PJJ A;  1JEG A;  2F5K A;  4M7D D;  4RMO A;  3JCM P;  3FDR A;  2BZ8 A;  4RUG A;  2VC8 A;  3J81 E;  4NL3 A;  3CCS Q;  1Q7Y R;  1ZBX A;  1N9R A;  4J9F A;  1G83 A;  1VYT A;  4NOY A;  2HSP A;  3V8J A;  2DIG A;  2QTV A;  4JLI A;  5GAN 3;  4D8D A;  3CCU A;  2RQV A;  4RTW A;  1QQJ A;  2A37 A;  3OBW A;  2RHI A;  2X4J A;  2X51 A;  3TRE A;  4LUD A;  2EYQ A;  2LQN A;  1PHT A;  2X3X D;  4KRT A;  2AKL A;  2AK5 A;  1RAE B;  1BI2 A;  1UEB A;  5IAY A;  3IQL A;  2D8H A;  1SHG A;  1YJW Q;  5FWB A;  3OYL A;  2G6F X;  3QJ6 A;  5C6S A;  1TUD A;  4XK8 E;  1LPL A;  3HPW A;  2J06 A;  2L0A A;  2YRC A;  2DYI A;  3SWN A;  2P84 A;  3TCJ A;  2LT1 A;  1IZ6 A;  3EFO A;  1KSW A;  3OW2 P;  2PVO B;  2BZX A;  1UFF A;  2QA4 A;  1TG0 A;  1WZO A;  2RQW A;  4M75 B;  3FC3 A;  3RMQ A;  2LMJ A;  4M78 C;  2K4Y A;  4XU3 A;  5A0G A;  2EJG A;  1BB9 A;  1W70 A;  2RN8 A;  2KGT A;  4II1 A;  2OTJ A;  2WSC E;  4M77 B;  3PIO A;  3WXM B;  4CC4 B;  2QXF A;  2DXC A;  4ZTJ A;  4AFQ C;  3X25 B;  5LJ5 j;  3NTH A;  4C5E A;  4E7J A;  4KH1 B;  1YFN A;  1BI0 A;  4E47 A;  1H92 A;  4QQD A;  3O8V A;  1RUW A;  1HYO A;  3MEA A;  5FU6 B;  2JXB A;  2KT1 A;  5C0M A;  3UPU A;  1M90 C;  3CC2 A;  2YUQ A;  4A54 A;  3X20 B;  4HCB A;  3D7S B;  2J6F A;  2O88 A;  3CCM A;  1WNL A;  3L2R A;  4J6X A;  3EG2 A;  1LCK A;  3VUZ A;  2KNB B;  3KXT A;  2GF7 A;  1PRL C;  3OYN A;  4ZN3 A;  1VQO T;  5LJ3 f;  1WQW A;  5LJ3 g;  4M75 G;  4QT7 A;  2V8I A;  2L5Q A;  3NMZ C;  3CCQ Q;  2ABL A;  3MP8 A;  4M77 G;  1Q82 C;  1WHG A;  1OYX A;  1M8M A;  3L2U A;  2P0K A;  2RQU A;  5KYU B;  4A4H A;  3EH1 A;  4RTV A;  2HL3 A;  1TH7 A;  1RL2 A;  4JZ3 A;  1MV0 B;  5IXF A;  1PM3 A;  1XTD A;  3EGX A;  2LX9 A;  2LRQ A;  1WHL A;  3JAM E;  1JXM A;  1LJO A;  4J7F A;  1IHV A;  1FMW A;  4J83 A;  1ZX6 A;  3G6E Q;  1I0C A;  4J9D A;  2MWP A;  3LW5 E;  4AMC A;  2LZ6 B;  1H8K A;  4C5H A;  1HK9 A;  1YWP A;  2HSE B;  1N8R C;  5DLO A;  2A3L A;  2AZS A;  1RAG B;  2FG0 A;  4CC7 A;  1PD0 A;  3CCS A;  1X6O A;  2MPX C;  4PNO A;  4RCB A;  2HNI A;  4OB1 B;  4C92 E;  2QEX A;  1AHJ B;  2KRN A;  2P0Q A;  2O4X B;  2NWM A;  2EBP A;  4OP0 A;  1WXB A;  3ME9 A;  1ZSZ B;  3JV3 A;  4PLL A;  2M0Y A;  4M77 C;  4MDX A;  1M2O A;  2CUD A;  3EH2 A;  4J6W A;  4BAC A;  1VQ4 A;  1VQL A;  3OYG A;  2MK5 A;  2OJ2 A;  2KRS A;  2X9H A;  3CCR Q;  1AZE A;  5LJ3 j;  3I56 Q;  1UHC A;  2BIV A;  4QKU A;  3RUX A;  5CCA A;  1WGS A;  1NJI C;  1Q7Y U;  1HXD A;  2ZZD A;  4UC4 A;  5GAN h;  1BKB A;  2WSE E;  2E5K A;  2RHU A;  2VV5 A;  1FYN A;  2ROL A;  3QYG B;  1VQ6 Q;  1QVF A;  1NG2 A;  1M1G A;  3EHQ A;  2LX7 A;  4A4K A;  4KUL A;  4IUU A;  3SEM A;  1U3O A;  4L59 A;  3DLL A;  3E2U A;  4E2F B;  4OB3 B;  1XQH A;  2V1R A;  2XI9 A;  4JS4 A;  2VYT A;  1PKT A;  5KYN A;  2DTH A;  3CC4 T;  1VQP Q;  4M7A B;  2HBP A;  2JTF A;  1WHK A;  4CRI A;  5GAN d;  1RAC B;  4JS5 A;  1VA7 A;  2K3Y A;  2PQW A;  2A0F B;  2OX7 A;  3VS6 A;  5KH6 A;  1YIJ A;  4XU2 A;  1KD1 C;  1JRI A;  2F5T X;  2KRM A;  2NUP A;  3F70 A;  3CBP A;  2DFU A;  1N6A A;  2CP0 A;  3ZBD A;  3PT9 A;  2CKK A;  1K8A R;  2FRY A;  3GNG A;  2E4H A;  1T3S A;  1QVF S;  2WAC A;  3URG A;  1JBM A;  5GJV B;  3M55 A;  2XU8 A;  4JRQ A;  2JVV A;  2B8A A;  1AD5 A;  4R56 A;  2I2L A;  1RAB B;  1U1S A;  4MZM A;  3JB9 J;  3LX7 A;  4FL6 A;  4M7A G;  4E7Z A;  4C8Q A;  3OYY A;  3H0H A;  2FB7 A;  2DF6 A;  4BE2 A;  4Y92 A;  3TSW A;  2JMC A;  2KAF A;  3VS0 A;  1RI9 A;  4L5G A;  5KE2 A;  2QDY B;  4IUQ A;  4J8O A;  2E5Q A;  4FYY B;  3OYD A;  4C92 A;  4WTO B;  2GGR A;  5LJ5 e;  3M9Q A;  1W2B A;  1Q86 U;  1D1C A;  3NTK A;  4J9B A;  5D7U A;  1GL5 A;  2HKQ B;  3VS4 A;  4DBQ A;  1PG5 B;  5LJ5 h;  2E64 A;  4ELY C;  1YIT Q;  3G6E A;  1I4K 1;  3RES A;  3P8H A;  1EIF A;  4JDS A;  2YXY A;  2DNU A;  2E70 A;  4LXC A;  4QVD A;  3A98 A;  1YJ9 T;  3CCE T;  1R77 A;  4WCI A;  4XU1 A;  4DQ2 A;  2NUZ A;  2RHZ A;  2DD4 A;  1M3A A;  1I81 A;  3OS0 A;  3QZ9 B;  1TU0 B;  2B86 A;  2HQE A;  5IHN A;  1NYF A;  2DVE A;  2JW4 A;  1K9A A;  4LE9 A;  5CVI A;  2RI3 A;  2VAS A;  4Y28 E;  1K73 U;  1RI0 A;  3M0R A;  2ZPI B;  4J9I A;  2K2M A;  1AEY A;  5LJ5 d;  2FVU A;  4RTU A;  3I55 T;  3CCV T;  1Q81 C;  1LNX A;  4QW2 A;  4M78 E;  3CCM T;  1WJS A;  1GXI E;  1QVG S;  1BK2 A;  2L3P A;  1FX7 A;  1W2B S;  4M7D E;  1B3Q A;  2EYZ A;  2MAM A;  5I21 A;  2KT8 A;  2DA9 A;  1SRM A;  2QK0 A;  1X6G A;  4KGX B;  4F16 A;  5GAM f;  3RDV A;  3DLM A;  3P8D A;  2CS7 A;  4LDU A;  2CRE A;  2D1X A;  3ULR B;  1UGV A;  3I56 A;  3KBG A;  1VQM T;  1VQ8 Q;  5GMK m;  3GF5 A;  2CH4 A;  3ZFJ A;  4F7U E;  2PU9 B;  1ZLM A;  1YJN Q;  2X4Y A;  1JJ2 A;  2DKG A;  2L89 A;  1VQK T;  1VQO A;  4FYW B;  4EMG A;  1K4U S;  1WHH A;  2X35 A;  3RMS A;  4ZGJ B;  3HL8 A;  1MMD A;  2R5A A;  2D9T A;  1WIE A;  1E6G A;  2VWF A;  1AWX A;  2A08 A;  3X24 B;  4HVW A;  3Q1J A;  3VKI A;  3M5A A;  1GCQ A;  3OYF A;  1N8R R;  1TXQ A;  4GBQ A;  1VQ7 Q;  1WFW A;  5KCO A;  3CCL Q;  1WJR A;  2HDA A;  4JLG A;  3G4S Q;  5GAN g;  1YHQ Q;  2XDD A;  2OAU A;  4F17 A;  3CCS T;  3BDU A;  3MEV A;  1N27 A;  2M0O A;  1Z9Z A;  5KYX B;  4E7I A;  1SPK A;  1KJW A;  1BBZ A;  1KC8 U;  5LJ3 e;  3OA6 A;  2ECZ A;  1H3H A;  1JJ2 S;  3SFM A;  2SRC A;  1M8V A;  2VVK A;  5LJ3 h;  1W4S A;  2RJF A;  2MMP A;  2KEA A;  3RKW A;  2CT3 A;  3BW1 A;  1HD3 A;  3UDC A;  3NFC A;  2F2V A;  1Y57 A;  3UT1 A;  2C0I A;  1YJW T;  1NJI R;  2DTO A;  2M02 A;  3CBO A;  4XU0 A;  7AT1 B;  5FU7 B;  1YNZ A;  3H8Z A;  2LTO A;  2F1L A;  2EPD A;  3L2V A;  1G5V A;  1ACM B;  5GMK l;  5GAM j;  1M4Z A;  1NPP A;  2CT4 A;  2EJ9 A;  4CI0 C;  5LJ3 d;  2CGH A;  4OB2 B;  3N5B B;  3CEY A;  1IRE B;  4M77 E;  4BDZ A;  4M78 A;  1TUG B;  1I8F A;  3HHT B;  4M7D A;  1EFN A;  2L3R A;  3L2W A;  1MHN A;  1PRM C;  1BU1 A;  3LGL A;  2D6F A;  2COZ A;  2ATC B;  1NEG A;  3RKX A;  4RG8 A;  1CKA A;  1D0Z A;  2ZPE B;  1VQ9 Q;  2XD0 A;  2CZ6 B;  4IUP A;  4LD6 A;  4OGE A;  1VQ5 A;  3OYB A;  2K7A A;  2QI2 A;  4F7U A;  4OVA A;  2CZ1 B;  3E1S A;  3MCA B;  5IH2 A;  5FW9 A;  2LDM A;  5IT9 E;  2DET A;  5CKF A;  1QCF A;  2KBT A;  1X27 A;  1U1T A;  5GAN j;  2RB6 A;  3TU4 K;  2D8J A;  3QWX X;  4ATO A;  5LJ5 g;  1C6V X;  2DIL A;  2E6N A;  3FLG A;  2PUK B;  3GBQ A;  1WI7 A;  4LNP A;  3REA B;  1PNJ A;  2EYX A;  3DKM A;  3CC4 A;  2COY A;  4M78 D;  3CCQ T;  4PJO C;  2EW3 A;  3VS2 A;  2F2X A;  2AHJ B;  1QVF P;  5FRN A;  2ZPF B;  1M90 U;  2LCC A;  4X1V A;  1PC0 A;  3RER A;  1AWW A;  1S72 Q;  4GLM A;  4MDW A;  1SKU B;  1C1A A;  1RLP C;  2YRD A;  2DM1 A;  2J6O A;  2G3R A;  2GTJ A;  1Y71 A;  1K8A C;  1UJY A;  5EG2 A;  4FT4 A;  2FEI A;  2VGM A;  2R58 A;  2DD5 A;  5CKH A;  2DRK A;  5ECA A;  3G6E T;  1OZ3 A;  3OYE A;  1Q82 U;  1FMK A;  1B34 A;  2DPP B;  5GJW B;  2A36 A;  4PJL A;  4CC3 A;  3SDZ A;  2BE7 D;  2YLC A;  4N4I A;  3FIF A;  5FU7 C;  2AZV A;  4WF2 A;  4LDW A;  4CC2 A;  3O5Z A;  2DL5 A;  2HAX A;  4Y91 A;  3OSV A;  1SHF A;  4ANJ A;  1RAH B;  3OYJ A;  1UGQ B;  1Q81 R;  3I5S A;  4HT8 A;  4PK4 A;  2DL3 A;  2SEM A;  4DA4 A;  1UGS B;  3QG1 A;  3BFM A;  1IGQ A;  2YHT A;  3ZL7 C;  3JCM Q;  1EZZ B;  4JUV A;  1M9S A;  3CCE A;  1YJ9 A;  4FYX B;  4JJD A;  1WHJ A;  1YWO A;  1N8R U;  2BTT A;  3SWN B;  4C5I A;  4XQ3 A;  1OEB A;  3EFO B;  1QKW A;  1ABQ A;  3CCR T;  3I56 T;  1QVG P;  1W2B P;  4M77 F;  2LT4 A;  1OU9 A;  3LWI A;  3RBB B;  3MPU B;  1RAA B;  1UGP B;  2DTI A;  3I55 A;  3CCV A;  2GFA A;  1VQ6 T;  1FWZ A;  2BZY A;  3S3N A;  1KHC A;  2KR3 A;  2E3H A;  2FPF A;  1K9M C;  1NPR A;  1M5Q 1;  2DIQ A;  4M77 D;  1YCS B;  1AT1 B;  2M1H A;  1X2Q A;  4D8K A;  5KYY A;  3OYI A;  1VQP T;  1VQM A;  2EGE A;  1D1A A;  1NJI U;  2IG0 A;  3A1P A;  4Z89 A;  3JCM X;  2NLU A;  3CMA Q;  4X9C A;  1QCN A;  4A4G A;  5HCK A;  4IIO A;  2LP5 A;  3M53 A;  1RAF B;  2K79 A;  3M0U A;  1SG5 A;  2OAW A;  1VQK A;  5CQX A;  5GAN 7;  1D09 B;  1OU8 A;  3WVD B;  4E7S A;  3GLX A;  1EX4 A;  4Z8A A;  3JB9 H;  4HA8 A;  3OSS C;  2EWN A;  5GAM e;  4KUD K;  3EG3 A;  1ZSG A;  2FZG B;  1W1F A;  5M9O A;  5GAM h;  1ZUY A;  1QP2 A;  2XG8 D;  1JJ2 P;  3EGX B;  3EGD A;  3I9Q A;  1N9S A;  2E65 A;  1KD1 U;  5GAO r;  1DJ7 B;  2Y4X A;  3VS5 A;  1H3Z A;  2ZPG B;  1WLP B;  3C4S A;  3JCM W;  2D0Q B;  2FHD A;  1BCM A;  3G71 Q;  4M75 C;  4FSS A;  5FLX E;  4ZNX A;  3U23 A;  4B9X A;  1X69 A;  2J7I A;  3L2Q A;  1R0B G;  2C06 A;  4X34 A;  5GAM d;  1D3B A;  3MP6 A;  2XDP A;  5KCH A;  3VS1 A;  1YIT T;  1X43 A;  3SWN C;  2RQR A;  1YJW A;  4D6W A;  3EGU A;  2L2P A;  5GAN e;  8AT1 B;  1OI1 A;  2KYB A;  5FU6 C;  4ME7 A;  4C0Z A;  4OMQ A;  4HVU A;  3M56 A;  3VS7 A;  2DK3 A;  3JCM f;  3JCM g;  3VRY A;  1MND A;  2VXF A;  2CZ0 B;  1VQ5 T;  5CK9 A;  4NS5 A;  1AVZ C;  1YP5 A;  3CC7 Q;  2FL7 A;  3CPW A;  2EKO A;  3MP1 A;  4L6V 5;  3CXC A;  5CKB A;  2EGA A;  1JQQ A;  2LQ8 A;  1MGQ A;  2BKD N;  2LCL A;  1RAD B;  2LCS A;  4XTX A;  1ZHI A;  2MWO A;  4J9H A;  3NPF A;  3UA7 A;  3HFN A;  3REB B;  2MYS A;  2O2O A;  3RIR A;  2ED0 A;  3PFS A;  3JRZ A;  4RTZ A;  3QUI A;  2L8D A;  3OY9 A;  2IPO B;  2RK2 A;  5IXB A;  2XKO C;  2DYB A;  2MIO A;  5I22 A;  3QSU A;  1VQ8 T;  1Q95 G;  5FWC A;  5CAI A;  4AT1 B;  2F69 A;  4ZN1 A;  3QJY A;  1M1K R;  3CD6 Q;  2RK1 A;  2W10 A;  4KGZ B;  4QVC A;  1YJN T;  3H6Z A;  1Q81 U;  3HTR A;  4C0F A;  2K5L A;  1WQ7 A;  2ED1 A;  3MEW A;  1A0N B;  3CPW S;  2A7Y A;  2GQV A;  1YI2 Q;  1IHW A;  3R6N A;  3CCQ A;  4J9C A;  3VU3 C;  4PJO E;  4JRI A;  4A63 B;  2KSS A;  2DXU A;  3EG0 A;  3THK A;  3UF4 A;  3EAE A;  3C95 A;  3L2Z A;  2NUP B;  2DO3 A;  3HFO A;  1X75 C;  1PD1 A;  1O9S A;  1VQ7 T;  3CCL T;  2FZC B;  2RMO A;  1ZBJ A;  3CMA A;  3NGP A;  1RAI B;  1K0X A;  3OYA A;  4HCC A;  4XTU A;  1G3S A;  3G4S T;  1YHQ T;  3M0T A;  3OW2 A;  4BY6 B;  2V26 A;  3A8O B;  1CKB A;  5A0L A;  1QVP A;  1GBQ A;  2Y90 A;  2DMO A;  1ZSZ C;  4O6J A;  3HRT A;  2DX1 A;  3QO3 A;  5DY9 A;  4O5V A;  3I5R A;  2JUF A;  2FPE A;  2V8K A;  3JB9 G;  1KQ2 A;  4C8Q B;  3OYC A;  1YCY A;  3M0Q A;  3LYI A;  3L1A A;  4BB7 A;  4E7L A;  2DEU A;  4C92 B;  2DAQ A;  2XDB A;  1OOT A;  2EVR A;  2E10 A;  5I2M A;  1WXU A;  3PVQ A;  2EQI A;  2RJD A;  1BIB A;  1HSQ A;  3OB9 A;  1VQN Q;  3C94 A;  5EC7 A;  4FM4 B;  2OTL Q;  4OMP A;  4HCZ A;  4KH0 B;  1UJ0 A;  1JB0 E;  2E12 A;  4HVV A;  2CP2 A;  3BDL A;  1Y96 A;  4RKU E;  5HK0 A;  1K9M R;  1FXX A;  2JS2 A;  4RTT A;  1WX6 A;  3G7Z A;  3MEU A;  2ZPH B;  3ER0 A;  1I07 A;  4KGV B;  4BD3 A;  4M7A C;  2OI3 A;  1K76 A;  4C8Q G;  5GAM g;  1WJQ A;  1M1F A;  3GIB A;  3CCR A;  1G3W A;  1UHF A;  3GNF B;  1QKX A;  1VQ9 T;  4C0D B;  3A8H B;  1XJW B;  4C92 G;  2DXB A;  2W0Z A;  2EFI A;  2QQB A;  3OMC A;  3M0S A;  3PVL A;  3QWY A;  2GBQ A;  2EYY A;  4PKC C;  1VQ6 A;  4RG2 A;  2L3S A;  5GAO m;  2QG9 B;  4ESR A;  1KQS A;  1MNE A;  1KG1 A;  2GNC A;  5CKE A;  3EFR A;  3TQ7 P;  4EMK A;  2RM4 A;  3ASK A;  3INZ A;  1G3Y A;  1QLY A;  4ZGD B;  4IIM A;  4KT0 E;  3E19 A;  4PJO A;  3EG9 A;  3LH5 A;  5D6W A;  4B6M A;  5GAO q;  1VQP A;  3CCU Q;  2LJ0 A;  2QGF B;  1U8R A;  2NUT A;  2EJF A;  4OMO A;  2VB6 A;  2F2W A;  3LLR A;  1PWT A;  1ZA2 B;  1R0C B;  4PFP A;  4QVZ A;  4PJN A;  1SF9 A;  3JCM V;  2X4X A;  2RD1 A;  2KE9 A;  4GLK A;  2KXD A;  2GQI A;  4PJO F;  3VRZ A;  1S72 T;  1D0Y A;  2E3I A;  2RJC A;  1NLP C;  3HRU A;  1XOV A;  2M9U A;  4AG2 C;  4HKE A;  3QII A;  2RJE A;  2MCN A;  4C8Q C;  2QAZ A;  4V2S A;  1KQS S;  1B07 A;  1AZG B;  2YLB A;  1C0M A;  4EPC A;  2HQX A;  2XHC A;  3OQ5 A;  5KYW A;  1TSF A;  2RI5 A;  3A8G B;  1UUE A;  1HJD A;  4FW2 A;  4C92 C;  2QA4 Q;  4PJO D;  2QYZ A;  4A4F A;  4N4H A;  2HMA A;  2JM9 A;  2QQA A;  2E1H A;  3V8K A;  1IO6 A;  5CR2 A;  1BI3 A;  3BE3 A;  4J7I A;  3UA6 A;  2OTJ Q;  4PFO A;  3HKS A;  1IB8 A;  3LGF A;  1OX9 A;  4OGC A;  1T0H A;  1TS9 A;  2FPD A;  2K9G A;  4M75 E;  4OMF B;  4FCY A;  2IVW A;  2K57 A;  1K8A U;  3E9G A;  2RH2 A;  4TVR A;  5GAO l;  1VYU A;  1NE8 A;  3CCJ Q;  4KBM B;  3OS5 A;  5GAN 8;  3UWN A;  1K0S A;  1YIT A;  4Z02 A;  3CC2 Q;  4J6Y A;  2COW A;  3GPL A;  1JU5 C;  3CBM A;  2Y4Y A;  4PJM A;  5A0D A;  3A8L B;  4NL2 A;  2WSF E;  1ZUU A;  5GAN 5;  1TOV A;  4VUB A;  9ATC B;  2EYW A;  2LQW A;  1OX8 A;  4EIK A;  4C0D C;  4A53 A;  1XNI A;  1PCX A;  1M2V A;  4M78 B;  2VKN A;  2H3J A;  4ZGE B;  1GCP A;  3MJX A;  1QWF A;  3LWH A;  4M7D B;  2HKN A;  3DB3 A;  3VS3 A;  3QXE B;  1U06 A;  1T3L A;  2E41 A;  1WXT A;  2CDT A;  2I0N A;  4R0K A;  3NHN A;  5GMK h;  2ZAE A;  1T0J A;  2DXT A;  3VYG A;  1M2V B;  4F7U B;  4LD9 K;  3VUB A;  3AHU A;  3HRS A;  1M3C A;  4AFU C;  3JCM e;  1WDX A;  3JSC A;  4PL6 A;  3PMI A;  4OML A;  5AT1 B;  5IN1 A;  3CPW P;  1VQ8 A;  4XTW A;  4BI8 B;  5L23 A;  1QWE A;  4RCC A;  3OMG A;  3JCM h;  3CMA T;  1D1B A;  3MET A;  3M4Y A;  1QP3 A;  1YJN A;  2QQS A;  2R57 A;  4M78 G;  3QZ5 B;  1M1K C;  3C12 A;  2X3W D;  1GCQ C;  2CSI A;  4HT9 A;  4M7D G;  1UTI A;  1CSK A;  4N0A C;  4OMN A;  4F04 B;  3GP8 A;  1QMC A;  2YRV A;  1K9M U;  1KHI A;  2DRM A;  5LL6 S;  3M0P A;  2ROT A;  4DBF A;  2YSQ A;  4IUR A;  2QEX Q;  5FRM A;  3UAT A;  1VQ7 A;  2JS0 A;  4F7U G;  1G2B A;  3JCM d;  3CCL A;  2DEQ A;  2YWW A;  2RNA A;  4ORZ A;  2KMT A;  4PFZ A;  1MMG A;  2BE9 B;  3OYM A;  4QQG A;  2PNI A;  3G4S A;  4BDY A;  1Z9Q A;  1YHQ A;  3RNJ A;  1H64 1;  5I2S A;  2BUD A;  3PGG A;  1VQL Q;  1VQ4 Q;  5A2Q E;  5HY6 A;  2FRW A;  4DOV A;  4M75 A;  6AT1 B;  1B34 B;  3G71 T;  2MOX A;  4OF1 A;  4M77 A;  3VJP A;  4FU6 A;  1IXD A;  1YN8 A;  8ATC B;  1PSF A;  2KVQ G;  4E7H A;  2ZPB B;  1OZ2 A;  5CO7 A;  2VUB A;  1KK7 A;  3S6W A;  4XTZ A;  4M75 F;  3S3O A;  1IRX A;  2ZCF B;  1ABO A;  3PMT A;  2YUP A;  2L3Q A;  2PZ1 A;  4PLI A;  4M7D C;  1TUC A;  3EG1 A;  2H3E B;  5L8R E;  1O75 A;  3A8M B;  3I35 A;  4XTY A;  3CC7 T;  1VYV A;  3CCJ A;  3LH0 A;  4M75 D;  4DEY A;  1YIJ Q;  2H8H A;  1MUZ A;  3VV0 A;  3CME Q;  2M51 A;  5IHI A;  2HCK A;  4M7A E;  3TSZ A;  1V29 B;  1I1J A;  3V7C A;  1PSE A;  3QYH B;  3OS2 A;  2K6D A;  3M57 A;  3S3M A;  1KIK A;  1Q86 R;  2DVJ A;  1VQ9 A;  2JT4 A;  5KYU A;  5FRO A;  4Z88 A;  3FRN A;  3FJP A;  1S1N A;  2EQK A;  3H9N A;  3WVE B;  3RKY A;  4DEX A;  1Y07 A;  3V7S A;  3CD6 T;  1GBR A;  2EGC A;  4LN2 A;  4JJB A;  5KYY B;  3FB9 A;  2GTO A;  1K73 R;  1YI2 T;  1MV3 A;  1SRL A;  1KFZ A;  4MML A;  2EAY A;  1IGU A;  1WYX A;  2JNG A;  4FW1 A;  4J5Y A;  4HXJ A;  1GFC A;  3X28 B;  1KQS P;  2JTE A;  3OBY A;  2O4X A;  1S72 A;  4LDV A;  1BCO A;  2RHX A;  2DL8 A;  2LJ3 A;  4C0G A;  1NEB A;  1ZSZ A;  2K5F A;  2R5M A;  4KUI A;  2RPN A;  4C8Q E;  4BE0 A;  2AKK A;  3OYK A;  1NLO C;  4BUG A;  1JXO A;  2IIM A;  4BI4 A;  1TTH B;  3JB9 I;  3EGD B;  5KE3 A;  3CQT A;  2YUN A;  3J80 E;  4IUV A;  1ZUK A;  1NM7 A;  3M58 A;  4DBH A;  1LVK A;  3AT1 B;  2XIC A;  5CIU A;  1QW1 A;  4YTL A;  2PUO B;  1PKS A;  4M4Z A;  3QDF A;  3EHR A;  3H0I A;  1SSF A;  2P4R A;  4EMH A;  1D3B B;  3OS1 A;  2RO0 A;  1OUL A;  2CSQ A;  1VQN T;  3CPF A;  1GRI A;  2OTL T;  1X2K A;  2KI7 A;  5GAN 4;  2QQR A;  5DM7 R;  2JZ2 A;  2DE0 X;  3P8B B;  1X01 A;  4AG1 C;  3A5Z B;  4ZTF A;  4M7A A;  3M59 A;  1UB4 A;  4FSX A;  1JO8 A;  2X4W A;  2JTM A;  4JRP A;  1KC8 R;  4MZP A;  1VQO Q;  1SSH A;  2QAS A;  1UE9 A;  1NYG A;  2KQW A;  1UDL A;  3OYH A;  4A4E A;  3MO8 A;  5GAN 6;  2PTK A;  3PE0 A;  1Y0M A;  1BYM A;  1TWB A;  2VGN A;  4M7A F;  1SEM A;  1KQ1 A;  2PVG B;  2XK0 A;  3FEO A;  2DL4 A;  4IKF A;  3R6O A;  5J39 A;  4J9G A;  3CME A;  3DB4 A;  3CXC S;  1ZA1 B;  3V7R A;  4RTX A;  3JCM J;  5HK3 A; 
#chains in the Genus database with same CATH homology
 4RTV A;  4OMO A;  2F2W A;  4AFS C;  4X1V A;  4JZ3 A;  1PWT A;  1MV0 B;  1AWW A;  5IXF A;  1RLQ C;  4GLM A;  1JXM A;  2KE9 A;  1RLP C;  2DM1 A;  2J6O A;  2GTJ A;  2KXD A;  2GQI A;  3VRZ A;  1ZX6 A;  4LUE A;  1NLP C;  1UJY A;  1XOV A;  4AG2 C;  1I0C A;  4J9D A;  2FEI A;  2MCN A;  2LZ6 B;  2DRK A;  1H8K A;  1YWP A;  5ECA A;  2KXC A;  2J05 A;  2V1Q A;  2YDL A;  4JZ4 A;  1OPL A;  1B07 A;  1AZG B;  1FMK A;  3KFV A;  5GJW B;  2A36 A;  2XMF A;  2AZS A;  4CC3 A;  2FG0 A;  4CC7 A;  1N5Z A;  1UUE A;  1HJD A;  5I11 A;  2RQT A;  2YT6 A;  2AZV A;  1V1C A;  4CC2 A;  3O5Z A;  2JM9 A;  2DL5 A;  2KRN A;  1IO6 A;  1SHF A;  2NWM A;  3UA6 A;  2EBP A;  1WXB A;  2CH4 W;  1T0H A;  2C0T A;  2FPD A;  3JV3 A;  2K9G A;  3I5S A;  2M0Y A;  2DL3 A;  2A28 A;  2SEM A;  2CUD A;  1E7O A;  1VYU A;  3ZL7 C;  2OJ2 A;  1K0S A;  2KRS A;  4JJD A;  1AZE A;  1UHC A;  1JU5 C;  1YWO A;  2BTT A;  1E6H A;  1OEB A;  1K1Z A;  2J6K A;  1QKW A;  1ABQ A;  1ZUU A;  2E5K A;  1X6B A;  2EYW A;  1FYN A;  2LQW A;  1AOJ A;  1OV3 A;  2ROL A;  4EIK A;  1NG2 A;  2JMA A;  1M27 C;  3RBB B;  2VKN A;  3EHQ A;  2LX7 A;  1GCP A;  1QWF A;  4OMM A;  2BZY A;  3SEM A;  1AWJ A;  1U3O A;  3VS3 A;  2KR3 A;  1U06 A;  2V1R A;  1T3L A;  2FPF A;  3H0F A;  1PKT A;  1WXT A;  2CDT A;  2I0N A;  2EKH A;  1YCS B;  4R0K A;  3C0C A;  3NHN A;  3FJ5 A;  1T0J A;  3SHW A;  1VA7 A;  1X2Q A;  4D8K A;  1OPK A;  3VS6 A;  2EGE A;  4Z89 A;  1M3C A;  4AFU C;  2KYM A;  1WDX A;  2C0O A;  2KRM A;  4OML A;  5HCK A;  4IIO A;  2LP5 A;  2K79 A;  3M0U A;  5L23 A;  2OAW A;  1QWE A;  4F14 A;  4HCK A;  2FRY A;  4RTY A;  1T3S A;  2FO0 A;  4AFZ C;  5GJV B;  2X3W D;  1GCQ C;  2CSI A;  4E6R A;  1AD5 A;  1UTI A;  1CSK A;  4OMN A;  4Z8A A;  2ENM A;  2HBW A;  2DL7 A;  5IHK A;  2ESW A;  3EG3 A;  1ZSG A;  1AWO A;  2DRM A;  1W1F A;  3M0P A;  1ZUY A;  2ROT A;  2YSQ A;  2DLP A;  3H0H A;  2DF6 A;  3UAT A;  2O31 A;  4Y92 A;  3TSW A;  2JS0 A;  1G2B A;  3I9Q A;  1ARK A;  2JMC A;  3VS0 A;  2RNA A;  4ORZ A;  1RI9 A;  4J9E A;  3VS5 A;  1WLP B;  2PNI A;  2DBM A;  1Z9Q A;  4JPB W;  1M3B A;  2GGR A;  3RNJ A;  4J9B A;  1GL5 A;  4FSS A;  3VS4 A;  4ZNX A;  3U23 A;  2FRW A;  1X69 A;  2J7I A;  1W6X A;  2MOX A;  2DNU A;  3A98 A;  1YN8 A;  3VS1 A;  1X43 A;  4WCI A;  2RQR A;  3H41 A;  2NUZ A;  1M3A A;  2B86 A;  3EGU A;  5IHN A;  2L2P A;  1NYF A;  2JW4 A;  2KYB A;  1K9A A;  4LE9 A;  4OMQ A;  4HVU A;  1U5S A;  2DJQ A;  3M0R A;  2QDL A;  2CUB A;  2JM8 A;  2LJ1 A;  3VS7 A;  1M30 A;  1ABO A;  2YUP A;  3VRY A;  4J9I A;  2K2M A;  1AEY A;  2L3Q A;  2PZ1 A;  1AVZ C;  1YP5 A;  2HEQ A;  2D0N A;  4RTU A;  1GFD A;  1TUC A;  3EG1 A;  1BK2 A;  2L3P A;  2EGA A;  1B3Q A;  1UEC A;  1UG1 A;  3I35 A;  1JQQ A;  2DBK A;  2EYZ A;  2LCS A;  2KT8 A;  2DA9 A;  1SRM A;  1VYV A;  1WA7 A;  1X6G A;  4JJC A;  4DEY A;  4F16 A;  2H8H A;  1MUZ A;  2M51 A;  4J9H A;  3NPF A;  3UA7 A;  2K3B A;  2HCK A;  5IHI A;  2RF0 A;  2CRE A;  3REB B;  2D1X A;  3ULR B;  1UGV A;  2O2O A;  2ED0 A;  3TSZ A;  2O9V A;  1I1J A;  4RTZ A;  2CH4 A;  2K6D A;  3TVT A;  1KIK A;  5IXB A;  2LNH B;  2DYB A;  2DVJ A;  2MIO A;  5I22 A;  1ZLM A;  2JT4 A;  5FWC A;  2O9S A;  4Z88 A;  1J3T A;  1S1N A;  2W10 A;  4DEX A;  1K4U S;  4K11 A;  2YUO A;  2KRO A;  2ED1 A;  1A0N B;  1WIE A;  1GBR A;  2EGC A;  4LN2 A;  1E6G A;  1JEG A;  2VWF A;  1AWX A;  2A08 A;  3R6N A;  4HVW A;  4JJB A;  1GCQ A;  2BZ8 A;  4J9C A;  4A63 B;  3EG0 A;  4GBQ A;  4RUG A;  2GTO A;  1WFW A;  3THK A;  3UF4 A;  1MV3 A;  1SRL A;  4J9F A;  1G83 A;  2HDA A;  1VYT A;  1KFZ A;  2HSP A;  2RMO A;  1WYX A;  1ZBJ A;  4F17 A;  3NGP A;  1K0X A;  4D8D A;  2RQV A;  1Z9Z A;  4HXJ A;  4RTW A;  3M0T A;  1GFC A;  1SPK A;  1KJW A;  2A37 A;  1BBZ A;  1CKB A;  2JTE A;  4LUD A;  2ECZ A;  2LQN A;  1H3H A;  1GBQ A;  1PHT A;  2SRC A;  2X3X D;  4KRT A;  2DMO A;  2AKL A;  2DL8 A;  2LJ3 A;  2VVK A;  2AK5 A;  2DX1 A;  1NEB A;  3I5R A;  2KEA A;  2FPE A;  3IQL A;  2D8H A;  1SHG A;  5FWB A;  2CT3 A;  2RPN A;  2G6F X;  1HD3 A;  2AKK A;  1NLO C;  2F2V A;  1JXO A;  1TUD A;  1Y57 A;  2IIM A;  2C0I A;  3CQT A;  3M0Q A;  2J06 A;  2YUN A;  2L0A A;  1YNZ A;  1ZUK A;  1NM7 A;  2EPD A;  1OOT A;  2EVR A;  1KSW A;  1WXU A;  3PVQ A;  2BZX A;  1UFF A;  2EQI A;  1TG0 A;  2CT4 A;  1PKS A;  2RQW A;  4M4Z A;  1HSQ A;  3EHR A;  2LMJ A;  3H0I A;  5EC7 A;  2P4R A;  1BB9 A;  1W70 A;  2RN8 A;  2KGT A;  4OMP A;  1UJ0 A;  4HVV A;  2CSQ A;  4CC4 B;  1EFN A;  1GRI A;  1X2K A;  1PRM C;  2JS2 A;  1BU1 A;  4AFQ C;  4RTT A;  1WX6 A;  1NEG A;  1I07 A;  2DE0 X;  1H92 A;  1CKA A;  1RUW A;  4AG1 C;  2OI3 A;  1K76 A;  2JXB A;  2KT1 A;  2YUQ A;  1JO8 A;  1UHF A;  2K7A A;  1QKX A;  1SSH A;  2J6F A;  2O88 A;  2W0Z A;  1UE9 A;  1NYG A;  5IH2 A;  5FW9 A;  3EG2 A;  1LCK A;  3M0S A;  3PVL A;  2KNB B;  1UDL A;  3QWY A;  1QCF A;  2EYY A;  2GBQ A;  1PRL C;  2PTK A;  2L3S A;  1Y0M A;  2KBT A;  3PE0 A;  1X27 A;  4ESR A;  2D8J A;  3QWX X;  4QT7 A;  3NMZ C;  1SEM A;  2ABL A;  2DIL A;  2GNC A;  3GBQ A;  1WI7 A;  4LNP A;  2DL4 A;  3REA B;  1PNJ A;  2EYX A;  1QLY A;  4IIM A;  2EW3 A;  4J9G A;  3VS2 A;  1M8M A;  2F2X A;  3LH5 A;  2RQU A;  4RTX A;  2LJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...