4AFQC

Human chymase - fynomer complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
VTLFVALYDYQADRWTDLSFHKGEKFQILDASPPGDWWEARSLTTGETGYIPSNYVAPVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
molecule keywords CHYMASE
total genus 12
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afqC00
1B07A 2CH4W 1X2QA 2EYWA 1G2BA 1FMKA 1AOJA 2KE9A 2KR3A 2O9SA 2HSPA 4AFQC 1AD5A 4J9EA 4EIKA 2CSIA 3VS6A 2JTEA 2FPDA 4LUDA 1YWPA 1CSKA 1RUWA 2LQWA 1UECA 2EW3A 4RUGA 4CC4B 1U5SA 2K6DA 3EG2A 5FWBA 2EGCA 2MIOA 4IIOA 4LN2A 2A37A 4DEYA 3REBB 1ABQA 1ZBJA 4HCKA 2DM1A 1UJ0A 2RPNA 1S1NA 2OI3A 2GTOA 2DX1A 1U3OA 1KFZA 1NG2A 4LNPA 3H41A 2VWFA 2AZVA 1JEGA 2PTKA 5IXFA 1FYNA 1K1ZA 2DMOA 1BB9A 1G83A 2EGEA 2CDTA 3M0QA 3I5RA 1T3LA 2PZ1A 2KXCA 1GFDA 1NLOC 1ZUUA 1NYGA 1W70A 1T0HA 3QWXX 4R0KA 2YUOA 2RQWA 1K0XA 2DL8A 2YUNA 1SRLA 5IHIA 1T0JA 4Z89A 2LJ0A 2DBKA 3RBBB 2MOXA 1VYUA 1MV0B 4HVWA 1K76A 1MV3A 2DILA 3TSWA 3VRYA 2MCNA 1NLPC 2A08A 1KJWA 2EQIA 3VS4A 1JXMA 4RTXA 4JZ3A 1PNJA 2M51A 4J9CA 4J9BA 5EC7A 1X43A 2M0YA 2BZXA 1TG0A 2XMFA 2L3QA 1VYTA 1UE9A 1WYXA 3SHWA 1WIEA 3UA6A 2BZ8A 2QDLA 1QKXA 1LCKA 2YDLA 1GCPA 2AK5A 2F2VA 2P4RA 1KIKA 2VVKA 3EGUA 4CC7A 1I0CA 4F14A 2ROLA 1QCFA 2J6OA 2F2WA 3U23A 2W10A 2ED0A 2H8HA 4K11A 4GBQA 3NMZC 3VRZA 2FG0A 3TSZA 2DF6A 1GRIA 1I07A 4OMNA 1UDLA 2O9VA 2GTJA 1YCSB 1AWWA 2RQUA 1VYVA 4OMPA 4QT7A 1UGVA 4Z88A 1UG1A 3ZL7C 2JMAA 3KFVA 2LNHB 2JXBA 2KT1A 3VS0A 1MUZA 2JT4A 1KSWA 3PE0A 1UUEA 2ABLA 2DE0X 1A0NB 3NHNA 3M0TA 2I0NA 2F2XA 1M8MA 3RNJA 5FW9A 2ESWA 1X69A 3PVLA 5L23A 4JJDA 4F17A 1U06A 2FPFA 2GQIA 5GJVB 2ECZA 3REAB 1YN8A 4JZ4A 2VKNA 2LMJA 2EVRA 1YP5A 2O88A 2C0OA 4JJBA 2L2PA 2X3WD 1X27A 4IIMA 1WX6A 1W1FA 4ESRA 2RMOA 2FPEA 1V1CA 3UA7A 2D1XA 3UF4A 2HBWA 2YUPA 4AG1C 1NYFA 2GNCA 1BU1A 1GBRA 3SEMA 1M3BA 1QLYA 2SRCA 4JPBW 2LP5A 3VS5A 2IIMA 2O2OA 1WXTA 1RI9A 1IO6A 2AZSA 2DL5A 4WCIA 3H0IA 1ZLMA 4J9IA 4RTWA 1WI7A 2KXDA 2D0NA 2V1RA 3EG0A 1SHFA 1PHTA 4LUEA 1QKWA 2V1QA 2FO0A 2JW4A 1OV3A 1GL5A 1B3QA 5FWCA 1K9AA 1Z9QA 1XOVA 2AKKA 1H92A 1UHFA 4ORZA 4A63B 4RTTA 3JV3A 1AVZC 2G6FX 1UHCA 3UATA 3VS2A 1RLQC 1JU5C 4AG2C 1M27C 3EG3A 3LH5A 1WA7A 2RN8A 3C0CA 2FRYA 2X3XD 2DYBA 1RLPC 4OMLA 3THKA 2CT4A 2KRSA 2JM8A 4LE9A 3A98A 1X2KA 4DEXA 5HCKA 2DA9A 2CUDA 1SSHA 2YUQA 1WFWA 2OJ2A 1N5ZA 1HD3A 3M0PA 2LJ1A 4KRTA 2SEMA 2DVJA 2JS0A 1K0SA 1GFCA 2CT3A 5ECAA 4OMQA 2DL7A 2K9GA 2RNAA 3R6NA 4F16A 4AFSC 2KYMA 2B86A 4J9DA 1X6GA 5I11A 4OMOA 2CH4A 1QWEA 2JMCA 1PRLC 1OOTA 3QWYA 2K3BA 2O31A 2J7IA 2EYZA 1HJDA 2FRWA 2LCSA 2RQTA 1AEYA 2KT8A 1GBQA 2D8JA 2ED1A 2RQVA 4Z8AA 2KGTA 3GBQA 3O5ZA 3M0RA 1GCQC 1Y0MA 2ENMA 1K4US 1OPKA 4AFZC 2A36A 1OEBA 2YSQA 1YWOA 3ULRB 2C0TA 1SPKA 2GGRA 4J9GA 2DL4A 1AWXA 1AWJA 1SEMA 2OAWA 1EFNA 4CC3A 5IXBA 2KROA 5IHNA 1JXOA 1SHGA 1WDXA 2DJQA 1AWOA 3VS7A 1NEBA 5I22A 3CQTA 1T3SA 2DL3A 1CKAA 2DRMA 1H3HA 1JO8A 2K2MA 3FJ5A 3I35A 4RTZA 3VS1A 1ZSGA 2NWMA 1JQQA 2E5KA 2K7AA 3VS3A 2AKLA 4D8KA 5IH2A 4J9FA 1E6HA 1J3TA 4JJCA 2DRKA 2HCKA 1E7OA 1QWFA 4RTVA 4HVUA 4RTYA 1ZX6A 4GLMA 1VA7A 1Z9ZA 3I9QA 3NPFA 4AFUC 2YT6A 2J6FA 1ZUKA 2L3SA 1H8KA 2K79A 1UJYA 2D8HA 2HDAA 2J06A 1BBZA 2EKHA 1PKSA 4HXJA 1PRMC 3M0UA 2RQRA 1M3AA 2FEIA 1AZEA 4RTUA 3IQLA 2L0AA 2J05A 3TVTA 3EHQA 1TUDA 4ZNXA 1M30A 3NGPA 1UFFA 1CKBA 1GCQA 2J6KA 2KEAA 4CC2A 2DNUA 4E6RA 3I5SA 2DLPA 1UTIA 1E6GA 2JS2A 2GBQA 2LJ3A 1I1JA 5IHKA 3PVQA 2CSQA 2KNBB 2RF0A 4Y92A 1WLPB 2KBTA 2NUZA 1AZGB 4M4ZA 4FSSA 4OMMA 3H0HA 1SRMA 1NEGA 2DBMA 1PWTA 1X6BA 2C0IA 1YNZA 3EHRA 2W0ZA 2EYYA 2EGAA 1ARKA 2EPDA 1WXUA 2LQNA 1W6XA 1HSQA 1WXBA 1NM7A 2LX7A 2CREA 4J9HA 1Y57A 3H0FA 5GJWB 2PNIA 2A28A 2KYBA 2L3PA 1BK2A 1OPLA 1ABOA 1ZUYA 2CUBA 1PKTA 2EBPA 2LZ6B 2JM9A 2KRMA 3EG1A 1TUCA 2BZYA 4HVVA 2EYXA 4X1VA 2HEQA 2BTTA 2ROTA 2KRNA 4D8DA 3M0SA 1M3CA
chains in the Genus database with same CATH superfamily
1G2BA 1YIJA 5KCHA 3DLLA 3E1SA 2LCCA 2Z0WA 5C0MA 2CP0A 1NPPA 2EIFA 3META 1G8XA 4EIKA 2MF2A 4LUDA 1GXIE 2JOYA 4MDWA 3X25B 1KC8C 2XI9A 3JCMV 3S3OA 3FDRA 1F1BB 2ZPBB 2A37A 4L5GA 1W2BS 1K9MC 3JCMJ 4M75C 1VQ5A 3CC7A 5HK3A 1ABQA 1ZBJA 3CCLA 2DM1A 1KD1U 2DX1A 3OYGA 4N4HA 4ATOA 3BDLA 3NTKA 3LYIA 2VWFA 4IKFA 2PTKA 3V7CA 5IXFA 1YI2A 2DMOA 1BB9A 1Q82C 4WF2A 2A7YA 1G83A 1QVFA 2EGEA 3M5AA 3OA6A 3EG9A 4HKEA 3I5RA 1T3LA 2KXCA 4MMKA 1GFDA 1YJ9A 2IPOB 4IUVA 5J39A 4VUBA 3CPFA 4R0KA 2RQWA 1N8RC 1D1AA 2RHYA 4FT2A 3UWNA 4XTUA 5IHIA 1T0JA 4E2FB 2DBKA 4M75E 3OYFA 3TSWA 3EGXB 1JRIA 2BIVA 2MCNA 3OW2S 1NLPC 1G3TA 1YITA 1KJWA 2VUBA 4M77G 2CYZB 1PNJA 2BE7D 4XK8E 5EC7A 1X43A 3HRTA 2XMFA 3CCLQ 2K57A 1UE9A 2QQRA 1G5VA 3OSVA 3SHWA 4FYVB 1QQJA 3UA6A 1VQPA 1QKXA 1GCPA 1Q86R 2AK5A 4C5HA 2EQKA 4RG2A 5GANe 5DM7R 1KIKA 5GMKm 2VVKA 4CC7A 1I0CA 4FYYB 2ROLA 4IURA 3TQ7P 2J6OA 2F2WA 3HRUA 3BFMA 4B9WA 5HKCA 1QCNA 2FG0A 2X4XA 2DF6A 2RJFA 4OMNA 1UDLA 3H8ZA 1AWWA 4PJJA 3C4SA 1Q7YC 2GF7A 2E4HA 3OS2A 4Z88A 2CS7A 2Y4XA 3ZL7C 3KFVA 3L42A 4BDZA 2LNHB 5LJ5f 2JXBA 1M1KU 3CCJQ 1KSWA 3PT9A 2ABLA 1A0NB 3X24B 4QVCA 2OTJT 4E7IA 1RAEB 2VXFA 4PKCC 1UGRB 4DA4A 5C6SA 2BUDA 3REAB 5D7UA 2DFUA 5LJ3h 3CD6A 4KGXB 2WACA 1EX4A 2VB6A 2C0OA 2LTOA 4JJBA 3CCJT 1N27A 2NUPA 4DBQA 2RMOA 4M75F 4ME7A 4MZTA 3OYEA 2HKQB 2YUPA 4M78F 4N4IA 1MMAA 2SRCA 2P0KA 2FYKA 3HHTB 3DB4A 3VS5A 2O2OA 4E7LA 1M5Q1 1BI1A 1RI9A 3A8MB 4FL6A 3H0IA 2DO3A 4ZTFA 1TU0B 2V1RA 1PHTA 1QKWA 1RACB 3CMET 4ELZC 2FO0A 3CBPA 3OYMA 1GL5A 1S72Q 2RI3A 1S72A 1VQ8A 1H92A 3R6OA 4XAXB 3CC2A 3LLRA 4XTXA 2KMTA 1YHQA 2EAYA 4ORZA 1BI3A 3RR6A 3P8BB 1AVZC 1UHCA 2E64A 3UATA 2JTMA 1JU5C 2GFAA 2XD0A 3A8HB 4AG2C 2D0QB 3EG3A 1QVGA 4M7DA 2DYBA 1Q81C 3S3NA 2JM8A 1M1KC 3A98A 5HCKA 2IVWA 2JZ2A 1OQKA 3V8KA 3JCMc 2CUDA 1SSHA 3SDZA 5CK9A 2DETA 1WFWA 1Q81U 2DVJA 5DY9A 4JS4A 1GFCA 1M2VA 2KYMA 2B86A 2HMAA 2ZAEA 3A1PA 2Y4YA 2JMCA 3TEEA 1Q82U 5I21A 4Y91A 2EFIA 4JRKA 4V2SA 1OU9A 2LCSA 1AEYA 5GAOm 2D8JA 4Z8AA 2V8KA 3O5ZA 3V8JA 1K4US 3SWNA 1Y71A 5LJ3f 1OPKA 4AFZC 2QASA 4C92E 1OEBA 2E10A 1YWOA 3EFRA 3ULRB 1XJWB 2XK0A 4M7AC 1KHCA 2E6ZA 2DJQA 2K3XA 1TOVA 5A0DA 1AWOA 5D6YA 4M77C 5I22A 2EYQA 1WJSA 3G4SA 4RTZA 3I35A 3E9FA 2RK2A 3CCLT 2HNIA 2KAFA 1BKBA 3VS1A 2NWMA 1YJWT 3CCEQ 2E5KA 3RIRA 3PIOA 1VQOA 1YBYA 2LCLA 5IH2A 3I55T 1M1FA 1VQ7Q 4UC4A 4JJCA 2PUOB 4RTVA 1RAFB 1Z9ZA 2RB6A 3NPFA 3HPWA 2YT6A 3H6ZA 1ZBXA 2E1HA 3FC3A 2LVMA 4C0DC 2HDAA 3CCMQ 3CCMA 2LQKA 4HXJA 1QMCA 5IT9E 3HL8A 4M7AA 3KBGA 3VUZA 4PFZA 3EHQA 1M30A 1WPYA 1VQNT 3M9QA 2BKDN 1MMGA 4NOYA 2DNUA 2QAZA 1UTIA 4PJNA 2JS2A 1YI2Q 5IAYA 4F7UB 2KNBB 4E7ZA 4OF1A 1WLPB 3JB9D 3H0HA 1B7TA 1KQSS 1NEGA 1PWTA 1X6BA 2AT1B 3UT1A 2W0ZA 2MK5A 1RADB 1IHVA 2OTLA 3CCRT 2RI2A 1HSQA 5GAMf 1Y7XA 2LC4A 2QGGA 1FX7A 1LOJA 4A4HA 2NUPB 1VQKT 1ABOA 1Q82R 4MDXA 1U8RA 2LZ6B 5GAOp 1RL2A 1OX9A 4TVRA 4M78B 3RDVA 1YI2T 2BZYA 1IHWA 2RH2A 2EYXA 3QYGB 4PJOA 5FRNA 4OB1B 1WZOA 4P5NA 1V76A 4LDWA 1VQ9Q 4QQ6A 4XTWA 2LNVA 4F7UG 1H3ZA 4XU2A 3OY9A 1QVFS 4OB0B 4BB7A 5GMKe 4J9EA 2XU8A 3A5ZB 3MEAA 3WVDB 5GMKj 3MJXA 3SB2A 1YWPA 4LDUA 1RUWA 3QIIA 4RUGA 3M54A 4X34A 1U5SA 4CC4B 2K6DA 3JB9F 3EG2A 3GNFB 3E19A 4FT4A 2FVUA 5LJ5d 3CPWA 4XU3A 1WNLA 2CZ7B 2LDMA 1UJ0A 3FEOA 2RPNA 4FSXA 1KFZA 1NG2A 1R0CB 3ASKA 3L2QA 2AZVA 1JEGA 1K1ZA 2X4YA 4PJOG 2X51A 4OB3B 3QG1A 3FB9A 1NLOC 1VIFA 4J5YA 5CVIA 3DKMA 4DBFA 3QWXX 1FXXA 4BI3A 1K0XA 2DL8A 2YUNA 1OZ2A 1SRLA 4C8QD 1RABB 4BUGA 4HVWA 2FZGB 4C5EA 2DILA 2ZPEB 4B9XA 3CXCS 2FHDA 1JXMA 3F70A 2QEXA 5KYUA 3CC7T 2M51A 4J9CA 4BE1A 1C0MA 4M7AG 2BZXA 1VQ5Q 4M77E 4JRPA 5GANj 1WIEA 5KYXA 2X4JA 2BZ8A 1G3WA 1QW1A 3PIPA 1WJQA 3L2RA 3OS0A 1BCOA 3P8DA 3CCUT 4PL6A 3J80E 1QCFA 1NJIR 1D3BA 2H8HA 3CCQQ 3QYHB 4GBQA 2OTLQ 2ZCFB 3VRZA 4J7FA 3TSZA 1GRIA 1PSEA 5EG2A 4F7UF 3OMCA 1G3YA 2A0FB 3M59A 4N0AC 2QEXT 1UGVA 1UG1A 3MP8A 3SWNC 2K3YA 5GAN2 1SF9A 3VS0A 1MUZA 1M9SA 2JT4A 1UUEA 2DE0X 4M7AB 3MP6A 3G4SQ 2I0NA 2YRDA 3PMIA 3JCMh 1X69A 4JUVA 2V8IA 3G1JA 4QVDA 8ATCB 1YN8A 2EQMA 3CCUQ 1KG1A 3BY7A 3INZA 2DXBA 3MO8A 4KH0B 4C0ZA 4F7UA 1I5OB 2X3WD 1X27A 3C12A 1EZZB 1M1GA 4M78E 3LGFA 1QP3A 4WTOB 1R8OB 2RHUA 4JS5A 2D1XA 4FW1A 3OSSC 1D0XA 1NYFA 4AG1C 4BY6C 2WSEE 4L59A 2ZPFB 2MMPA 4JPBW 2OTJQ 1VQKQ 3X26B 1FWZA 2IIMA 2EQUA 1YJNT 1K73R 4WCIA 2RHXA 1TXQA 1ZLMA 4J9IA 2CP2A 4RTWA 3CPWP 3V7RA 1M1KR 5IN1A 3M56A 2KXDA 4M78A 2D0NA 2QYZA 2KQWA 4LUEA 1LJOA 2JW4A 5GAMg 3CD6Q 2K4YA 1Z9QA 5KYXB 2CP5A 2AKKA 3ME9A 3G71A 2FZCB 1WHMA 4Y28E 3L2UA 1VQNA 4A63B 1G3SA 2M16A 4Q5WA 3VS2A 2E70A 1W2BA 2KK4A 4LDYA 2MWPA 2M1HA 1WHJA 2FRYA 2X3XD 3SD4A 2XDPA 1RLPC 4OMLA 2HL3A 4OP0A 4XU1A 2CT4A 2YWWA 1X2KA 2QTVA 3VKIA 4PFPA 1RAHB 1VQKA 1M90C 4PLLA 5KE2A 1W4SA 3GIBA 3JCMb 4JRQA 1NPRA 1N5ZA 4IUUA 1LPLA 1HD3A 4C92B 1FMVA 2SEMA 2JS0A 1K0SA 2CT3A 4ZGJB 4OGEA 1NE8A 3TCJA 4OMQA 2DL7A 2K9GA 4PNOA 1R0BG 3CEYA 3EFOA 1KC8R 4J9DA 2YXYA 5CCAA 1S72T 3QPHA 4C92D 1UEBA 1PRLC 1LNXA 3JCMW 3GP8A 2XICA 4L6V5 1IGUA 1AT1B 1HJDA 4FM4B 3DB3A 3TREA 3ZBDA 2KT8A 3OYNA 4E7JA 2ED1A 2YRVA 1UGQB 1VQLA 2DIQA 3M0RA 4AMCA 1TWBA 4ANJA 3RKYA 2DK3A 4LDXA 1WGSA 1IB8A 1D0ZA 1YITQ 2DEUA 1AWXA 5IXBA 1IRXA 2KROA 2QQSA 5IHNA 1JXOA 3JCMf 3EGXA 5J26A 4FYWB 2DRMA 4M7DC 3OMGA 2K2MA 3PTAA 2JN0A 4ZN3A 4HT9A 1WJRA 1K8AR 3VS3A 5LJ5g 4M75B 4J9FA 3ER0A 3GF5A 4EMKB 2OTLT 4DQ2A 4RTYA 1VA7A 3I9QA 3X28B 1JJ2A 1PCXA 2J6FA 1M90U 1EIFA 2KSSA 1YITT 4F7UE 2K5FA 4ZTJA 1M3AA 2HZYA 1AZEA 4HCBA 3KUFA 4C0DB 2DKGA 2L0AA 4FCYA 1VUBA 1P92A 4XTZA 3V8LA 2LX9A 1UFFA 2E65A 5CKFA 2OX7A 2DTHA 3EH2A 4M7DB 4BI4A 4NL2A 1E6GA 5KH6A 2LJ3A 4PJMA 2DIGA 3PVQA 2JTFA 1O9SA 3G6EQ 1NZ9A 2E3IA 2NUZA 3URGA 4OMMA 4XTVA 3MPUB 1SRMA 3MKDA 5GAN5 4J6YA 1YNZA 5CIUA 1VQNQ 5A0LA 5L8RE 4HA8A 1M2VB 2EPDA 4QKUA 3H9NA 4HCZA 2LQNA 1MGQA 9ATCB 2CREA 2L3RA 4J9HA 1Y57A 3H0FA 3TU4K 2PNIA 2L3PA 1OPLA 4J6WA 1X01A 1ZUYA 4C5IA 2P4TA 1OI1A 4M78D 1O75A 3HP9A 2CGHA 2M02A 2HEQA 2KRNA 2JVVA 1TSFA 3OYJA 3CD6T 3M57A 1X2QA 2EYWA 3QZ9B 2AHJB 1TUGB 3OBYA 5D6XA 2KR3A 3NFCA 5GAMj 1PSFA 4QVZA 2HSPA 3VUBA 3CBMA 1AD5A 2M0OA 2CSIA 3VS6A 4C8QF 2VXEA 2JTEA 2FPDA 4IUTA 2XIDA 3M4YA 3I56A 1I4K1 2DD4A 1CSKA 4D6WA 4C0FA 4C8QB 1Q95G 1YJNA 4FU6A 3EH1A 1K8AU 5D6WA 5GANf 5FWBA 2XHCA 3UDCA 2EGCA 5DLQE 4IIOA 4LN2A 4DEYA 3REBB 4DOWA 5LJ3j 1VQOT 1JJ2P 1YIJT 3OS1A 4EMHA 5GAN4 2DTOA 5CQXA 3OYIA 3NTHA 1S1NA 1NJIC 1QCOA 3EFSA 4LNPA 3WXMB 2QA4T 4RCBA 2GFUA 4OMFB 4C92G 1NJIU 1N9RA 1IREB 3OYCA 3AHUA 5KYYA 2KI7A 1ZUUA 4M77B 3S3MA 3QHSA 2RJEA 4KGZB 4J7IA 4C8QC 1VQ6Q 2LJ0A 3GLXA 3RBBB 2JUFA 4M77D 2MOXA 2GQVA 1B34B 4PJOF 3JCMd 2EJ9A 4PK4A 3EGDB 4LD9K 3CC4T 3G7ZA 2EQIA 3ZFJA 3SWNB 2XDDA 2QQBA 4J9BA 4PFOA 2FZKB 2M0YA 1TG0A 1VYTA 5FU7B 3EG9B 3M55A 4E7KA 2QA4Q 3QSUA 2YHTA 1LCKA 2YDLA 3M53A 3G6EA 2XG8D 2P4RA 3CCMT 4M7DG 3EGUA 3QDRB 1YJ9Q 4GLKA 3CCSQ 1VQ8Q 1RAAB 2F1LA 2RJDA 3E2UA 3JCMe 1QVGP 2W10A 2ED0A 2B8AA 1VQ5T 4M75A 3MCAB 3I56Q 3PFSA 1Q7YU 1I07A 2V8JA 2HKNA 1VQ9T 4B6MA 2O9VA 2GTJA 1YCSB 2RQUA 1VYVA 4BD3A 4QT7A 4M7AD 2JMAA 4EPCA 4A4EA 1YJ9T 2D9TA 4ZGEB 4C0GA 3PE0A 3HRSA 2QXFA 2KY9A 4BI8B 3NHNA 2ZPHB 2O01E 3RNJA 1RAIB 2E5QA 5LJ5e 1Y96A 2RHIA 1N6AA 2L8DA 5FW9A 3GPLA 2ESWA 3PVLA 4DBRA 5L23A 4JJDA 4F17A 1U06A 2FPFA 3J81E 4MZMA 5GJVB 2ECZA 1SKUB 3JB9I 1QVPA 4JZ4A 3CCST 2VKNA 1VQ8T 2MI6A 1KD1R 2O88A 3GNGA 1VQ4Q 2P84A 2L2PA 2VGNA 4IIMA 1WX6A 2O4XB 2FPEA 4O6JA 4O5VA 3UF4A 1BU1A 3LH0A 2IG0A 3HTRA 1PD1A 4E7HA 1Y96B 2LP5A 4J6XA 2ZZDA 1ZHIA 1WXTA 1WQ7A 2AIRB 3EGDA 2DL5A 3RKWA 2L89A 3LX7A 1WI7A 1DJ7B 4DBHA 1K9MU 2K5IA 2V1QA 1OV3A 1B3QA 2RHZA 1Q86C 2EWNA 4EDUA 1K9AA 1QVGS 1XOVA 3N5BB 4M7DE 3BW1A 3EFOB 2HQXA 5FRMA 4JRIA 5GANh 2DAQA 1VQ6A 3M58A 1HYOA 1M27C 2COWA 1HXDA 4A53A 2VGMA 3THKA 2KRSA 1WHGA 3OYHA 1XTDA 5CKDA 4JLGA 2HBPA 3JSCA 4KRTA 4F04B 3OW2P 3VU3C 5ECAA 3CCEA 1PG5B 2VV5A 4F16A 2PVDB 5KYNA 1ZSZC 3CCVA 5I11A 4PJOC 4OMOA 4PLIA 1QWEA 1X75C 3QWYA 1OOTA 3MHXA 2K3BA 3G4ST 2O31A 2J7IA 2FB7A 3G71Q 2HAXA 2KDSA 1GBQA 1X6OA 3JB9J 2RQVA 4EMKA 3OBWA 3GBQA 5GMKi 2Y90A 1GCQC 1Y0MA 5DLOA 4EMGA 1QP2A 2VYTA 1VQMQ 2C0TA 1SPKA 2GCXA 2QQAA 4JDSA 2QI2A 1SEMA 2OAWA 1EFNA 4CC3A 4KUDK 4BDYA 1SHGA 5A0GA 2CZ6B 2CZ0B 3EAEA 3VS7A 4CI0C 1T3SA 2DL3A 3LGLA 1CKAA 4M7DD 1JO8A 3FJ5A 4LD6A 2PVGB 2X9HA 2LT1A 5GANg 2MPXC 1ZSGA 1JQQA 1NBEB 5GAN7 2K7AA 2AKLA 2RA2A 3LWIA 4RMOA 3QJ6A 3Q1JA 3CCSA 1KQSA 1J3TA 2HCKA 1E7OA 3OYDA 1QWFA 1MMNA 5GAMh 4HVUA 4OB2B 1M4ZA 1ZX6A 1K73U 4GLMA 3CCQA 3S6WA 3D7SB 1ZUKA 4KBMB 1TS9A 2K79A 1VQMT 2D8HA 1WHHA 1BBZA 1D3BB 4E47A 2EKHA 2RI5A 3O8VA 4PJLA 2RD1A 2FEIA 4RTUA 4KH1B 1Y07A 5FROA 3X20B 2QG9B 3CCRA 3NGPA 3QUIA 4KUIA 1CKBA 2D6FA 1BCMA 1I8FA 2KEAA 3RKXA 4E7SA 3JCMP 4A54A 4A4KA 3PGGA 3I5SA 5CQYA 5KYWB 3JCMQ 2GBQA 4C8QE 1JB0E 1U1TA 3HKSA 1I1JA 1YJWA 3RUXA 5IHKA 2RF0A 5LL6S 2KBTA 3CC4A 1AZGB 4FSSA 4MMLA 2PQWA 4BE2A 3OS5A 3EHRA 1UB4A 4CRIA 2EGAA 2C06A 1VQ6T 1OULA 1Q81R 3CC2T 3A8OB 1WXBA 1YHQT 2LX7A 3M4GA 5FU6C 5GJWB 1D1BA 2KYBA 1MNDA 1Q86U 1MNEA 4KT0E 4R56A 5GAN8 3QKJA 2CUBA 2EBPA 1LVKA 2F5KA 1BI0A 4MZPA 2F5TX 4OVAA 3CCJA 5HK0A 5GAMd 5M9OA 2HQHA 1KD1C 2ROTA 4D8DA 4FW2A 2H3EB 5CR2A 1B07A 2X4WA 2CH4W 1FMKA 1YJWQ 3CCET 3CPWS 2OAUA 1AOJA 1ZSZA 2KE9A 2LT4A 1JBMA 2R5MA 2O9SA 4AFQC 1YCYA 4NL3A 3RERA 3VV0A 2QK0A 2I2LA 2CZ1B 2VASA 4ZGDB 2LQWA 1UECA 2EW3A 5KYYB 1KQ1A 3UPUA 4YTLA 1OYXA 2ZPIB 5GMKl 2MIOA 2CP6A 1N9SA 1B34A 4KULA 1VQ7T 3QBYA 4IUQA 1KK7A 2ZGWA 1BIAA 1VQ4T 4HCKA 2OI3A 2GTOA 1U3OA 2E3HA 3H41A 3MEUA 2RJCA 1FYNA 5LJ5j 1VQPQ 2P0PA 4N0AA 1U1SA 2CDTA 3M0QA 3CCUA 2PZ1A 3CXCP 1NYGA 3OYLA 1ZQ1A 4C8QG 1MHNA 1VQ4A 1W70A 4C5GA 1T0HA 3I55A 4M78C 2K2VA 2YUOA 2MWOA 2H3JA 4RCCA 1H641 3MEWA 4Z89A 3KXTA 1VYUA 1MV0B 1VIEA 1K76A 1YJNQ 1M2OA 4DOVA 1MV3A 3LW5E 2QGFB 3VRYA 2ATCB 2PU9B 4EMKC 2A08A 3VS4A 3OYYA 4RTXA 3JRZA 4JZ3A 2DJZA 1BYMA 5LJ3d 3OW2A 3VYGA 2CKKA 2QDYB 4M75D 2L3QA 1WYXA 2DTIA 5GAMe 3VJPA 2QDLA 4ELYC 3ZEHA 2JJ9A 3JAME 2F2VA 4J83A 5KE3A 4KGVB 4C92C 4F14A 2XDBA 3J7AF 2RM4A 2R58A 3U23A 4M7AE 3L2WA 3CCVT 4K11A 2HQEA 3NMZC 1ZSZB 2YLBA 4A4GA 2NUTA 3JB9H 2L5QA 3QDFA 4GY5A 1SSFA 3QXEB 4OMPA 5HY6A 1WHKA 2KVQG 2R5AA 5GMKh 3PMTA 2V26A 5GAOr 2KT1A 1KC8U 2WSFE 2EQJA 2YRCA 2JNGA 4FIBA 4C8QA 5GANd 5CKHA 2DEQA 3M0TA 2F2XA 1M8MA 4J8OA 3CBOA 3HFOA 1OX8A 4M7DF 2PUKB 3CCQT 2GQIA 4ZN1A 1C6VX 3FLGA 3CCVQ 1VQOQ 4M75G 3L2VA 2LMJA 3NTIA 1KQ2A 5I2SA 2EVRA 2LQ8A 3G71T 1YP5A 3CMEQ 1PM3A 3OYKA 2DZ9A 5FLXE 1YHQQ 1VQLQ 2WSCE 1W1FA 4ESRA 1I5LA 1V1CA 1IZ6A 3SFMA 4QW2A 1TTHB 2RO0A 3UA7A 1MMDA 1JJ2S 4N4GA 2HBWA 1SG5A 2CP7A 4M77A 1D0YA 2GNCA 1GBRA 3GOXA 3SEMA 1VQMA 1M3BA 1RI0A 1OZ3A 2X35A 5LJ3g 1QLYA 5GAOq 2DD5A 4A4FA 2COZA 2VC8A 4PJOB 2FL7A 4XTYA 1YFNA 4X9CA 1IO6A 1PC0A 2AZSA 3BDUA 1XQHA 4PJOD 2DXTA 4M77F 1K8AC 3FRNA 3CMAA 2P0QA 1KHIA 3V7SA 1ACMB 2ZPGB 3C94A 3EG0A 1SHFA 5AYFA 3CMAQ 3T9NA 2YLCA 3RESA 3MP1A 1AHJB 5FWCA 3MEVA 4C92A 2MAMA 1WQWA 1BI2A 2XKOC 1UHFA 2LRQA 1ZA1B 1UGPB 4RKUE 4RTTA 3JCMX 3JV3A 1VQLT 2G6FX 5GAOl 1RLQC 3PNWC 4RG8A 2PVOB 8AT1B 3JB9G 3LH5A 2DXUA 1WA7A 3RMSA 2RN8A 3C0CA 4C92F 1QVFP 4R55A 1XNIA 2DERA 4X9DA 3E9GA 2G3RA 4LE9A 3G6ET 4DEXA 2DVEA 5J3BA 2DA9A 1VQPT 2EKOA 1PD0A 3CMAT 1D09B 2DYIA 2HL5C 5GAN6 2YUQA 3RMQA 2OJ2A 3OQ5A 4QQDA 2E41A 3M0PA 1I81A 2LJ1A 3L1AA 3L2ZA 2M9UA 3A8GB 4AT1B 4II1A 3P8HA 3HSBA 1HK9A 2RNAA 3R6NA 4AFSC 1VQ9A 1M8VA 1X6GA 2A3LA 2QQ9A 2CH4A 1M90R 3CC4Q 3CMEA 1BIBA 3QO3A 4NS5A 3JCMg 2EYZA 2FRWA 1W2BP 2RQTA 2MYSA 4LXCA 3DLMA 2KGTA 3BE3A 2ENMA 4PJOE 2E6NA 4LDVA 3QZ5B 4BE0A 1N8RU 2A36A 5CKEA 2YSQA 4XU0A 1R77A 4Z02A 3CXCA 5AT1B 2NYSA 1TH7A 2GGRA 4J9GA 2DL4A 1AWJA 2OTJA 3WVEB 1WDXA 2DZCA 1NEBA 3CQTA 2NLUA 1H3HA 1ZA2B 2BE9B 4D8KA 3FIFA 2F69A 1YIJQ 3FJPA 5CO7A 1E6HA 5KYWA 1VQ7A 4BY6B 2DRKA 2K5LA 4M7AF 5GAOn 3CC2Q 4AFUC 1UGSB 2QTXA 2L3SA 1K9MR 1H8KA 1UJYA 4XQ3A 5FU7C 2J06A 1PKSA 2R57A 5KCOA 1PRMC 1C1AA 3M0UA 2RQRA 1VOMA 1KQSP 3IQLA 1K73C 3QJYA 2NUTB 2J05A 3CCRQ 2DPPB 3TVTA 3LWHA 1N8RR 1TUDA 4ZNXA 2QEXQ 4HCCA 1GCQA 3CC7Q 2DXCA 2J6KA 5CAIA 5CKBA 3OYAA 4CC2A 4E6RA 1IGQA 4IUPA 2DLPA 3VYHB 1D1CA 4M78G 1RAGB 2RK1A 1IXDA 1FMWA 1V29B 4BACA 2CSQA 2EJFA 2EJGA 5I2MA 4FYXB 4Y92A 4M4ZA 2CP3A 5A2QE 5GAN3 4HT8A 3I55Q 2DBMA 3AT1B 3C95A 3HFNA 2C0IA 5LJ5h 2EYYA 1ARKA 4QQGA 1WXUA 2E12A 3OB9A 1W6XA 3OYBA 5KYUB 4JJNK 1NM7A 5LJ3e 2A28A 1BK2A 2O4XA 1WHLA 4JLIA 1PKTA 2JM9A 2KRMA 3I56T 5FU6B 3EG1A 1TUCA 2HSEB 7AT1B 4OGCA 2HD0A 3A8LB 6AT1B 4HVVA 2COYA 4X1VA 2QA4A 2BTTA 1OU8A 1Q7YR 3M0SA 1M3CA
chains in the Genus database with same CATH topology
1B07A 2CH4W 1X2QA 2EYWA 1G2BA 1FMKA 1AOJA 2KE9A 2KR3A 2O9SA 2HSPA 4AFQC 1AD5A 4J9EA 4EIKA 2CSIA 3VS6A 2JTEA 2FPDA 4LUDA 1YWPA 1CSKA 1RUWA 2LQWA 1UECA 2EW3A 4RUGA 4CC4B 1U5SA 2K6DA 3EG2A 5FWBA 2EGCA 2MIOA 4IIOA 4LN2A 2A37A 4DEYA 3REBB 1ABQA 1ZBJA 4HCKA 2DM1A 1UJ0A 2RPNA 1S1NA 2OI3A 2GTOA 2DX1A 1U3OA 1KFZA 1NG2A 4LNPA 3H41A 2VWFA 2AZVA 1JEGA 2PTKA 5IXFA 1FYNA 1K1ZA 2DMOA 1BB9A 1G83A 2EGEA 2CDTA 3M0QA 3I5RA 1T3LA 2PZ1A 2KXCA 1GFDA 1NLOC 1ZUUA 1NYGA 1W70A 1T0HA 3QWXX 4R0KA 2YUOA 2RQWA 1K0XA 2DL8A 2YUNA 1SRLA 5IHIA 1T0JA 4Z89A 2LJ0A 2DBKA 3RBBB 2MOXA 1VYUA 1MV0B 4HVWA 1K76A 1MV3A 2DILA 3TSWA 3VRYA 2MCNA 1NLPC 2A08A 1KJWA 2EQIA 3VS4A 1JXMA 4RTXA 4JZ3A 1PNJA 2M51A 4J9CA 4J9BA 5EC7A 1X43A 2M0YA 2BZXA 1TG0A 2XMFA 2L3QA 1VYTA 1UE9A 1WYXA 3SHWA 1WIEA 3UA6A 2BZ8A 2QDLA 1QKXA 1LCKA 2YDLA 1GCPA 2AK5A 2F2VA 2P4RA 1KIKA 2VVKA 3EGUA 4CC7A 1I0CA 4F14A 2ROLA 1QCFA 2J6OA 2F2WA 3U23A 2W10A 2ED0A 2H8HA 4K11A 4GBQA 3NMZC 3VRZA 2FG0A 3TSZA 2DF6A 1GRIA 1I07A 4OMNA 1UDLA 2O9VA 2GTJA 1YCSB 1AWWA 2RQUA 1VYVA 4OMPA 4QT7A 1UGVA 4Z88A 1UG1A 3ZL7C 2JMAA 3KFVA 2LNHB 2JXBA 2KT1A 3VS0A 1MUZA 2JT4A 1KSWA 3PE0A 1UUEA 2ABLA 2DE0X 1A0NB 3NHNA 3M0TA 2I0NA 2F2XA 1M8MA 3RNJA 5FW9A 2ESWA 1X69A 3PVLA 5L23A 4JJDA 4F17A 1U06A 2FPFA 2GQIA 5GJVB 2ECZA 3REAB 1YN8A 4JZ4A 2VKNA 2LMJA 2EVRA 1YP5A 2O88A 2C0OA 4JJBA 2L2PA 2X3WD 1X27A 4IIMA 1WX6A 1W1FA 4ESRA 2RMOA 2FPEA 1V1CA 3UA7A 2D1XA 3UF4A 2HBWA 2YUPA 4AG1C 1NYFA 2GNCA 1BU1A 1GBRA 3SEMA 1M3BA 1QLYA 2SRCA 4JPBW 2LP5A 3VS5A 2IIMA 2O2OA 1WXTA 1RI9A 1IO6A 2AZSA 2DL5A 4WCIA 3H0IA 1ZLMA 4J9IA 4RTWA 1WI7A 2KXDA 2D0NA 2V1RA 3EG0A 1SHFA 1PHTA 4LUEA 1QKWA 2V1QA 2FO0A 2JW4A 1OV3A 1GL5A 1B3QA 5FWCA 1K9AA 1Z9QA 1XOVA 2AKKA 1H92A 1UHFA 4ORZA 4A63B 4RTTA 3JV3A 1AVZC 2G6FX 1UHCA 3UATA 3VS2A 1RLQC 1JU5C 4AG2C 1M27C 3EG3A 3LH5A 1WA7A 2RN8A 3C0CA 2FRYA 2X3XD 2DYBA 1RLPC 4OMLA 3THKA 2CT4A 2KRSA 2JM8A 4LE9A 3A98A 1X2KA 4DEXA 5HCKA 2DA9A 2CUDA 1SSHA 2YUQA 1WFWA 2OJ2A 1N5ZA 1HD3A 3M0PA 2LJ1A 4KRTA 2SEMA 2DVJA 2JS0A 1K0SA 1GFCA 2CT3A 5ECAA 4OMQA 2DL7A 2K9GA 2RNAA 3R6NA 4F16A 4AFSC 2KYMA 2B86A 4J9DA 1X6GA 5I11A 4OMOA 2CH4A 1QWEA 2JMCA 1PRLC 1OOTA 3QWYA 2K3BA 2O31A 2J7IA 2EYZA 1HJDA 2FRWA 2LCSA 2RQTA 1AEYA 2KT8A 1GBQA 2D8JA 2ED1A 2RQVA 4Z8AA 2KGTA 3GBQA 3O5ZA 3M0RA 1GCQC 1Y0MA 2ENMA 1K4US 1OPKA 4AFZC 2A36A 1OEBA 2YSQA 1YWOA 3ULRB 2C0TA 1SPKA 2GGRA 4J9GA 2DL4A 1AWXA 1AWJA 1SEMA 2OAWA 1EFNA 4CC3A 5IXBA 2KROA 5IHNA 1JXOA 1SHGA 1WDXA 2DJQA 1AWOA 3VS7A 1NEBA 5I22A 3CQTA 1T3SA 2DL3A 1CKAA 2DRMA 1H3HA 1JO8A 2K2MA 3FJ5A 3I35A 4RTZA 3VS1A 1ZSGA 2NWMA 1JQQA 2E5KA 2K7AA 3VS3A 2AKLA 4D8KA 5IH2A 4J9FA 1E6HA 1J3TA 4JJCA 2DRKA 2HCKA 1E7OA 1QWFA 4RTVA 4HVUA 4RTYA 1ZX6A 4GLMA 1VA7A 1Z9ZA 3I9QA 3NPFA 4AFUC 2YT6A 2J6FA 1ZUKA 2L3SA 1H8KA 2K79A 1UJYA 2D8HA 2HDAA 2J06A 1BBZA 2EKHA 1PKSA 4HXJA 1PRMC 3M0UA 2RQRA 1M3AA 2FEIA 1AZEA 4RTUA 3IQLA 2L0AA 2J05A 3TVTA 3EHQA 1TUDA 4ZNXA 1M30A 3NGPA 1UFFA 1CKBA 1GCQA 2J6KA 2KEAA 4CC2A 2DNUA 4E6RA 3I5SA 2DLPA 1UTIA 1E6GA 2JS2A 2GBQA 2LJ3A 1I1JA 5IHKA 3PVQA 2CSQA 2KNBB 2RF0A 4Y92A 1WLPB 2KBTA 2NUZA 1AZGB 4M4ZA 4FSSA 4OMMA 3H0HA 1SRMA 1NEGA 2DBMA 1PWTA 1X6BA 2C0IA 1YNZA 3EHRA 2W0ZA 2EYYA 2EGAA 1ARKA 2EPDA 1WXUA 2LQNA 1W6XA 1HSQA 1WXBA 1NM7A 2LX7A 2CREA 4J9HA 1Y57A 3H0FA 5GJWB 2PNIA 2A28A 2KYBA 2L3PA 1BK2A 1OPLA 1ABOA 1ZUYA 2CUBA 1PKTA 2EBPA 2LZ6B 2JM9A 2KRMA 3EG1A 1TUCA 2BZYA 4HVVA 2EYXA 4X1VA 2HEQA 2BTTA 2ROTA 2KRNA 4D8DA 3M0SA 1M3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B07 A;  2CH4 W;  1X2Q A;  2EYW A;  1G2B A;  1FMK A;  1AOJ A;  2KE9 A;  2KR3 A;  2O9S A;  2HSP A;  4AFQ C;  1AD5 A;  4J9E A;  4EIK A;  2CSI A;  3VS6 A;  2JTE A;  2FPD A;  4LUD A;  1YWP A;  1CSK A;  1RUW A;  2LQW A;  1UEC A;  2EW3 A;  4RUG A;  4CC4 B;  1U5S A;  2K6D A;  3EG2 A;  5FWB A;  2EGC A;  2MIO A;  4IIO A;  4LN2 A;  2A37 A;  4DEY A;  3REB B;  1ABQ A;  1ZBJ A;  4HCK A;  2DM1 A;  1UJ0 A;  2RPN A;  1S1N A;  2OI3 A;  2GTO A;  2DX1 A;  1U3O A;  1KFZ A;  1NG2 A;  4LNP A;  3H41 A;  2VWF A;  2AZV A;  1JEG A;  2PTK A;  5IXF A;  1FYN A;  1K1Z A;  2DMO A;  1BB9 A;  1G83 A;  2EGE A;  2CDT A;  3M0Q A;  3I5R A;  1T3L A;  2PZ1 A;  2KXC A;  1GFD A;  1NLO C;  1ZUU A;  1NYG A;  1W70 A;  1T0H A;  3QWX X;  4R0K A;  2YUO A;  2RQW A;  1K0X A;  2DL8 A;  2YUN A;  1SRL A;  5IHI A;  1T0J A;  4Z89 A;  2LJ0 A;  2DBK A;  3RBB B;  2MOX A;  1VYU A;  1MV0 B;  4HVW A;  1K76 A;  1MV3 A;  2DIL A;  3TSW A;  3VRY A;  2MCN A;  1NLP C;  2A08 A;  1KJW A;  2EQI A;  3VS4 A;  1JXM A;  4RTX A;  4JZ3 A;  1PNJ A;  2M51 A;  4J9C A;  4J9B A;  5EC7 A;  1X43 A;  2M0Y A;  2BZX A;  1TG0 A;  2XMF A;  2L3Q A;  1VYT A;  1UE9 A;  1WYX A;  3SHW A;  1WIE A;  3UA6 A;  2BZ8 A;  2QDL A;  1QKX A;  1LCK A;  2YDL A;  1GCP A;  2AK5 A;  2F2V A;  2P4R A;  1KIK A;  2VVK A;  3EGU A;  4CC7 A;  1I0C A;  4F14 A;  2ROL A;  1QCF A;  2J6O A;  2F2W A;  3U23 A;  2W10 A;  2ED0 A;  2H8H A;  4K11 A;  4GBQ A;  3NMZ C;  3VRZ A;  2FG0 A;  3TSZ A;  2DF6 A;  1GRI A;  1I07 A;  4OMN A;  1UDL A;  2O9V A;  2GTJ A;  1YCS B;  1AWW A;  2RQU A;  1VYV A;  4OMP A;  4QT7 A;  1UGV A;  4Z88 A;  1UG1 A;  3ZL7 C;  2JMA A;  3KFV A;  2LNH B;  2JXB A;  2KT1 A;  3VS0 A;  1MUZ A;  2JT4 A;  1KSW A;  3PE0 A;  1UUE A;  2ABL A;  2DE0 X;  1A0N B;  3NHN A;  3M0T A;  2I0N A;  2F2X A;  1M8M A;  3RNJ A;  5FW9 A;  2ESW A;  1X69 A;  3PVL A;  5L23 A;  4JJD A;  4F17 A;  1U06 A;  2FPF A;  2GQI A;  5GJV B;  2ECZ A;  3REA B;  1YN8 A;  4JZ4 A;  2VKN A;  2LMJ A;  2EVR A;  1YP5 A;  2O88 A;  2C0O A;  4JJB A;  2L2P A;  2X3W D;  1X27 A;  4IIM A;  1WX6 A;  1W1F A;  4ESR A;  2RMO A;  2FPE A;  1V1C A;  3UA7 A;  2D1X A;  3UF4 A;  2HBW A;  2YUP A;  4AG1 C;  1NYF A;  2GNC A;  1BU1 A;  1GBR A;  3SEM A;  1M3B A;  1QLY A;  2SRC A;  4JPB W;  2LP5 A;  3VS5 A;  2IIM A;  2O2O A;  1WXT A;  1RI9 A;  1IO6 A;  2AZS A;  2DL5 A;  4WCI A;  3H0I A;  1ZLM A;  4J9I A;  4RTW A;  1WI7 A;  2KXD A;  2D0N A;  2V1R A;  3EG0 A;  1SHF A;  1PHT A;  4LUE A;  1QKW A;  2V1Q A;  2FO0 A;  2JW4 A;  1OV3 A;  1GL5 A;  1B3Q A;  5FWC A;  1K9A A;  1Z9Q A;  1XOV A;  2AKK A;  1H92 A;  1UHF A;  4ORZ A;  4A63 B;  4RTT A;  3JV3 A;  1AVZ C;  2G6F X;  1UHC A;  3UAT A;  3VS2 A;  1RLQ C;  1JU5 C;  4AG2 C;  1M27 C;  3EG3 A;  3LH5 A;  1WA7 A;  2RN8 A;  3C0C A;  2FRY A;  2X3X D;  2DYB A;  1RLP C;  4OML A;  3THK A;  2CT4 A;  2KRS A;  2JM8 A;  4LE9 A;  3A98 A;  1X2K A;  4DEX A;  5HCK A;  2DA9 A;  2CUD A;  1SSH A;  2YUQ A;  1WFW A;  2OJ2 A;  1N5Z A;  1HD3 A;  3M0P A;  2LJ1 A;  4KRT A;  2SEM A;  2DVJ A;  2JS0 A;  1K0S A;  1GFC A;  2CT3 A;  5ECA A;  4OMQ A;  2DL7 A;  2K9G A;  2RNA A;  3R6N A;  4F16 A;  4AFS C;  2KYM A;  2B86 A;  4J9D A;  1X6G A;  5I11 A;  4OMO A;  2CH4 A;  1QWE A;  2JMC A;  1PRL C;  1OOT A;  3QWY A;  2K3B A;  2O31 A;  2J7I A;  2EYZ A;  1HJD A;  2FRW A;  2LCS A;  2RQT A;  1AEY A;  2KT8 A;  1GBQ A;  2D8J A;  2ED1 A;  2RQV A;  4Z8A A;  2KGT A;  3GBQ A;  3O5Z A;  3M0R A;  1GCQ C;  1Y0M A;  2ENM A;  1K4U S;  1OPK A;  4AFZ C;  2A36 A;  1OEB A;  2YSQ A;  1YWO A;  3ULR B;  2C0T A;  1SPK A;  2GGR A;  4J9G A;  2DL4 A;  1AWX A;  1AWJ A;  1SEM A;  2OAW A;  1EFN A;  4CC3 A;  5IXB A;  2KRO A;  5IHN A;  1JXO A;  1SHG A;  1WDX A;  2DJQ A;  1AWO A;  3VS7 A;  1NEB A;  5I22 A;  3CQT A;  1T3S A;  2DL3 A;  1CKA A;  2DRM A;  1H3H A;  1JO8 A;  2K2M A;  3FJ5 A;  3I35 A;  4RTZ A;  3VS1 A;  1ZSG A;  2NWM A;  1JQQ A;  2E5K A;  2K7A A;  3VS3 A;  2AKL A;  4D8K A;  5IH2 A;  4J9F A;  1E6H A;  1J3T A;  4JJC A;  2DRK A;  2HCK A;  1E7O A;  1QWF A;  4RTV A;  4HVU A;  4RTY A;  1ZX6 A;  4GLM A;  1VA7 A;  1Z9Z A;  3I9Q A;  3NPF A;  4AFU C;  2YT6 A;  2J6F A;  1ZUK A;  2L3S A;  1H8K A;  2K79 A;  1UJY A;  2D8H A;  2HDA A;  2J06 A;  1BBZ A;  2EKH A;  1PKS A;  4HXJ A;  1PRM C;  3M0U A;  2RQR A;  1M3A A;  2FEI A;  1AZE A;  4RTU A;  3IQL A;  2L0A A;  2J05 A;  3TVT A;  3EHQ A;  1TUD A;  4ZNX A;  1M30 A;  3NGP A;  1UFF A;  1CKB A;  1GCQ A;  2J6K A;  2KEA A;  4CC2 A;  2DNU A;  4E6R A;  3I5S A;  2DLP A;  1UTI A;  1E6G A;  2JS2 A;  2GBQ A;  2LJ3 A;  1I1J A;  5IHK A;  3PVQ A;  2CSQ A;  2KNB B;  2RF0 A;  4Y92 A;  1WLP B;  2KBT A;  2NUZ A;  1AZG B;  4M4Z A;  4FSS A;  4OMM A;  3H0H A;  1SRM A;  1NEG A;  2DBM A;  1PWT A;  1X6B A;  2C0I A;  1YNZ A;  3EHR A;  2W0Z A;  2EYY A;  2EGA A;  1ARK A;  2EPD A;  1WXU A;  2LQN A;  1W6X A;  1HSQ A;  1WXB A;  1NM7 A;  2LX7 A;  2CRE A;  4J9H A;  1Y57 A;  3H0F A;  5GJW B;  2PNI A;  2A28 A;  2KYB A;  2L3P A;  1BK2 A;  1OPL A;  1ABO A;  1ZUY A;  2CUB A;  1PKT A;  2EBP A;  2LZ6 B;  2JM9 A;  2KRM A;  3EG1 A;  1TUC A;  2BZY A;  4HVV A;  2EYX A;  4X1V A;  2HEQ A;  2BTT A;  2ROT A;  2KRN A;  4D8D A;  3M0S A;  1M3C A; 
#chains in the Genus database with same CATH topology
 1G2B A;  1YIJ A;  5KCH A;  3DLL A;  3E1S A;  2LCC A;  2Z0W A;  5C0M A;  2CP0 A;  1NPP A;  2EIF A;  3MET A;  1G8X A;  4EIK A;  2MF2 A;  4LUD A;  1GXI E;  2JOY A;  4MDW A;  3X25 B;  1KC8 C;  2XI9 A;  3JCM V;  3S3O A;  3FDR A;  1F1B B;  2ZPB B;  2A37 A;  4L5G A;  1W2B S;  1K9M C;  3JCM J;  4M75 C;  1VQ5 A;  3CC7 A;  5HK3 A;  1ABQ A;  1ZBJ A;  3CCL A;  2DM1 A;  1KD1 U;  2DX1 A;  3OYG A;  4N4H A;  4ATO A;  3BDL A;  3NTK A;  3LYI A;  2VWF A;  4IKF A;  2PTK A;  3V7C A;  5IXF A;  1YI2 A;  2DMO A;  1BB9 A;  1Q82 C;  4WF2 A;  2A7Y A;  1G83 A;  1QVF A;  2EGE A;  3M5A A;  3OA6 A;  3EG9 A;  4HKE A;  3I5R A;  1T3L A;  2KXC A;  4MMK A;  1GFD A;  1YJ9 A;  2IPO B;  4IUV A;  5J39 A;  4VUB A;  3CPF A;  4R0K A;  2RQW A;  1N8R C;  1D1A A;  2RHY A;  4FT2 A;  3UWN A;  4XTU A;  5IHI A;  1T0J A;  4E2F B;  2DBK A;  4M75 E;  3OYF A;  3TSW A;  3EGX B;  1JRI A;  2BIV A;  2MCN A;  3OW2 S;  1NLP C;  1G3T A;  1YIT A;  1KJW A;  2VUB A;  4M77 G;  2CYZ B;  1PNJ A;  2BE7 D;  4XK8 E;  5EC7 A;  1X43 A;  3HRT A;  2XMF A;  3CCL Q;  2K57 A;  1UE9 A;  2QQR A;  1G5V A;  3OSV A;  3SHW A;  4FYV B;  1QQJ A;  3UA6 A;  1VQP A;  1QKX A;  1GCP A;  1Q86 R;  2AK5 A;  4C5H A;  2EQK A;  4RG2 A;  5GAN e;  5DM7 R;  1KIK A;  5GMK m;  2VVK A;  4CC7 A;  1I0C A;  4FYY B;  2ROL A;  4IUR A;  3TQ7 P;  2J6O A;  2F2W A;  3HRU A;  3BFM A;  4B9W A;  5HKC A;  1QCN A;  2FG0 A;  2X4X A;  2DF6 A;  2RJF A;  4OMN A;  1UDL A;  3H8Z A;  1AWW A;  4PJJ A;  3C4S A;  1Q7Y C;  2GF7 A;  2E4H A;  3OS2 A;  4Z88 A;  2CS7 A;  2Y4X A;  3ZL7 C;  3KFV A;  3L42 A;  4BDZ A;  2LNH B;  5LJ5 f;  2JXB A;  1M1K U;  3CCJ Q;  1KSW A;  3PT9 A;  2ABL A;  1A0N B;  3X24 B;  4QVC A;  2OTJ T;  4E7I A;  1RAE B;  2VXF A;  4PKC C;  1UGR B;  4DA4 A;  5C6S A;  2BUD A;  3REA B;  5D7U A;  2DFU A;  5LJ3 h;  3CD6 A;  4KGX B;  2WAC A;  1EX4 A;  2VB6 A;  2C0O A;  2LTO A;  4JJB A;  3CCJ T;  1N27 A;  2NUP A;  4DBQ A;  2RMO A;  4M75 F;  4ME7 A;  4MZT A;  3OYE A;  2HKQ B;  2YUP A;  4M78 F;  4N4I A;  1MMA A;  2SRC A;  2P0K A;  2FYK A;  3HHT B;  3DB4 A;  3VS5 A;  2O2O A;  4E7L A;  1M5Q 1;  1BI1 A;  1RI9 A;  3A8M B;  4FL6 A;  3H0I A;  2DO3 A;  4ZTF A;  1TU0 B;  2V1R A;  1PHT A;  1QKW A;  1RAC B;  3CME T;  4ELZ C;  2FO0 A;  3CBP A;  3OYM A;  1GL5 A;  1S72 Q;  2RI3 A;  1S72 A;  1VQ8 A;  1H92 A;  3R6O A;  4XAX B;  3CC2 A;  3LLR A;  4XTX A;  2KMT A;  1YHQ A;  2EAY A;  4ORZ A;  1BI3 A;  3RR6 A;  3P8B B;  1AVZ C;  1UHC A;  2E64 A;  3UAT A;  2JTM A;  1JU5 C;  2GFA A;  2XD0 A;  3A8H B;  4AG2 C;  2D0Q B;  3EG3 A;  1QVG A;  4M7D A;  2DYB A;  1Q81 C;  3S3N A;  2JM8 A;  1M1K C;  3A98 A;  5HCK A;  2IVW A;  2JZ2 A;  1OQK A;  3V8K A;  3JCM c;  2CUD A;  1SSH A;  3SDZ A;  5CK9 A;  2DET A;  1WFW A;  1Q81 U;  2DVJ A;  5DY9 A;  4JS4 A;  1GFC A;  1M2V A;  2KYM A;  2B86 A;  2HMA A;  2ZAE A;  3A1P A;  2Y4Y A;  2JMC A;  3TEE A;  1Q82 U;  5I21 A;  4Y91 A;  2EFI A;  4JRK A;  4V2S A;  1OU9 A;  2LCS A;  1AEY A;  5GAO m;  2D8J A;  4Z8A A;  2V8K A;  3O5Z A;  3V8J A;  1K4U S;  3SWN A;  1Y71 A;  5LJ3 f;  1OPK A;  4AFZ C;  2QAS A;  4C92 E;  1OEB A;  2E10 A;  1YWO A;  3EFR A;  3ULR B;  1XJW B;  2XK0 A;  4M7A C;  1KHC A;  2E6Z A;  2DJQ A;  2K3X A;  1TOV A;  5A0D A;  1AWO A;  5D6Y A;  4M77 C;  5I22 A;  2EYQ A;  1WJS A;  3G4S A;  4RTZ A;  3I35 A;  3E9F A;  2RK2 A;  3CCL T;  2HNI A;  2KAF A;  1BKB A;  3VS1 A;  2NWM A;  1YJW T;  3CCE Q;  2E5K A;  3RIR A;  3PIO A;  1VQO A;  1YBY A;  2LCL A;  5IH2 A;  3I55 T;  1M1F A;  1VQ7 Q;  4UC4 A;  4JJC A;  2PUO B;  4RTV A;  1RAF B;  1Z9Z A;  2RB6 A;  3NPF A;  3HPW A;  2YT6 A;  3H6Z A;  1ZBX A;  2E1H A;  3FC3 A;  2LVM A;  4C0D C;  2HDA A;  3CCM Q;  3CCM A;  2LQK A;  4HXJ A;  1QMC A;  5IT9 E;  3HL8 A;  4M7A A;  3KBG A;  3VUZ A;  4PFZ A;  3EHQ A;  1M30 A;  1WPY A;  1VQN T;  3M9Q A;  2BKD N;  1MMG A;  4NOY A;  2DNU A;  2QAZ A;  1UTI A;  4PJN A;  2JS2 A;  1YI2 Q;  5IAY A;  4F7U B;  2KNB B;  4E7Z A;  4OF1 A;  1WLP B;  3JB9 D;  3H0H A;  1B7T A;  1KQS S;  1NEG A;  1PWT A;  1X6B A;  2AT1 B;  3UT1 A;  2W0Z A;  2MK5 A;  1RAD B;  1IHV A;  2OTL A;  3CCR T;  2RI2 A;  1HSQ A;  5GAM f;  1Y7X A;  2LC4 A;  2QGG A;  1FX7 A;  1LOJ A;  4A4H A;  2NUP B;  1VQK T;  1ABO A;  1Q82 R;  4MDX A;  1U8R A;  2LZ6 B;  5GAO p;  1RL2 A;  1OX9 A;  4TVR A;  4M78 B;  3RDV A;  1YI2 T;  2BZY A;  1IHW A;  2RH2 A;  2EYX A;  3QYG B;  4PJO A;  5FRN A;  4OB1 B;  1WZO A;  4P5N A;  1V76 A;  4LDW A;  1VQ9 Q;  4QQ6 A;  4XTW A;  2LNV A;  4F7U G;  1H3Z A;  4XU2 A;  3OY9 A;  1QVF S;  4OB0 B;  4BB7 A;  5GMK e;  4J9E A;  2XU8 A;  3A5Z B;  3MEA A;  3WVD B;  5GMK j;  3MJX A;  3SB2 A;  1YWP A;  4LDU A;  1RUW A;  3QII A;  4RUG A;  3M54 A;  4X34 A;  1U5S A;  4CC4 B;  2K6D A;  3JB9 F;  3EG2 A;  3GNF B;  3E19 A;  4FT4 A;  2FVU A;  5LJ5 d;  3CPW A;  4XU3 A;  1WNL A;  2CZ7 B;  2LDM A;  1UJ0 A;  3FEO A;  2RPN A;  4FSX A;  1KFZ A;  1NG2 A;  1R0C B;  3ASK A;  3L2Q A;  2AZV A;  1JEG A;  1K1Z A;  2X4Y A;  4PJO G;  2X51 A;  4OB3 B;  3QG1 A;  3FB9 A;  1NLO C;  1VIF A;  4J5Y A;  5CVI A;  3DKM A;  4DBF A;  3QWX X;  1FXX A;  4BI3 A;  1K0X A;  2DL8 A;  2YUN A;  1OZ2 A;  1SRL A;  4C8Q D;  1RAB B;  4BUG A;  4HVW A;  2FZG B;  4C5E A;  2DIL A;  2ZPE B;  4B9X A;  3CXC S;  2FHD A;  1JXM A;  3F70 A;  2QEX A;  5KYU A;  3CC7 T;  2M51 A;  4J9C A;  4BE1 A;  1C0M A;  4M7A G;  2BZX A;  1VQ5 Q;  4M77 E;  4JRP A;  5GAN j;  1WIE A;  5KYX A;  2X4J A;  2BZ8 A;  1G3W A;  1QW1 A;  3PIP A;  1WJQ A;  3L2R A;  3OS0 A;  1BCO A;  3P8D A;  3CCU T;  4PL6 A;  3J80 E;  1QCF A;  1NJI R;  1D3B A;  2H8H A;  3CCQ Q;  3QYH B;  4GBQ A;  2OTL Q;  2ZCF B;  3VRZ A;  4J7F A;  3TSZ A;  1GRI A;  1PSE A;  5EG2 A;  4F7U F;  3OMC A;  1G3Y A;  2A0F B;  3M59 A;  4N0A C;  2QEX T;  1UGV A;  1UG1 A;  3MP8 A;  3SWN C;  2K3Y A;  5GAN 2;  1SF9 A;  3VS0 A;  1MUZ A;  1M9S A;  2JT4 A;  1UUE A;  2DE0 X;  4M7A B;  3MP6 A;  3G4S Q;  2I0N A;  2YRD A;  3PMI A;  3JCM h;  1X69 A;  4JUV A;  2V8I A;  3G1J A;  4QVD A;  8ATC B;  1YN8 A;  2EQM A;  3CCU Q;  1KG1 A;  3BY7 A;  3INZ A;  2DXB A;  3MO8 A;  4KH0 B;  4C0Z A;  4F7U A;  1I5O B;  2X3W D;  1X27 A;  3C12 A;  1EZZ B;  1M1G A;  4M78 E;  3LGF A;  1QP3 A;  4WTO B;  1R8O B;  2RHU A;  4JS5 A;  2D1X A;  4FW1 A;  3OSS C;  1D0X A;  1NYF A;  4AG1 C;  4BY6 C;  2WSE E;  4L59 A;  2ZPF B;  2MMP A;  4JPB W;  2OTJ Q;  1VQK Q;  3X26 B;  1FWZ A;  2IIM A;  2EQU A;  1YJN T;  1K73 R;  4WCI A;  2RHX A;  1TXQ A;  1ZLM A;  4J9I A;  2CP2 A;  4RTW A;  3CPW P;  3V7R A;  1M1K R;  5IN1 A;  3M56 A;  2KXD A;  4M78 A;  2D0N A;  2QYZ A;  2KQW A;  4LUE A;  1LJO A;  2JW4 A;  5GAM g;  3CD6 Q;  2K4Y A;  1Z9Q A;  5KYX B;  2CP5 A;  2AKK A;  3ME9 A;  3G71 A;  2FZC B;  1WHM A;  4Y28 E;  3L2U A;  1VQN A;  4A63 B;  1G3S A;  2M16 A;  4Q5W A;  3VS2 A;  2E70 A;  1W2B A;  2KK4 A;  4LDY A;  2MWP A;  2M1H A;  1WHJ A;  2FRY A;  2X3X D;  3SD4 A;  2XDP A;  1RLP C;  4OML A;  2HL3 A;  4OP0 A;  4XU1 A;  2CT4 A;  2YWW A;  1X2K A;  2QTV A;  3VKI A;  4PFP A;  1RAH B;  1VQK A;  1M90 C;  4PLL A;  5KE2 A;  1W4S A;  3GIB A;  3JCM b;  4JRQ A;  1NPR A;  1N5Z A;  4IUU A;  1LPL A;  1HD3 A;  4C92 B;  1FMV A;  2SEM A;  2JS0 A;  1K0S A;  2CT3 A;  4ZGJ B;  4OGE A;  1NE8 A;  3TCJ A;  4OMQ A;  2DL7 A;  2K9G A;  4PNO A;  1R0B G;  3CEY A;  3EFO A;  1KC8 R;  4J9D A;  2YXY A;  5CCA A;  1S72 T;  3QPH A;  4C92 D;  1UEB A;  1PRL C;  1LNX A;  3JCM W;  3GP8 A;  2XIC A;  4L6V 5;  1IGU A;  1AT1 B;  1HJD A;  4FM4 B;  3DB3 A;  3TRE A;  3ZBD A;  2KT8 A;  3OYN A;  4E7J A;  2ED1 A;  2YRV A;  1UGQ B;  1VQL A;  2DIQ A;  3M0R A;  4AMC A;  1TWB A;  4ANJ A;  3RKY A;  2DK3 A;  4LDX A;  1WGS A;  1IB8 A;  1D0Z A;  1YIT Q;  2DEU A;  1AWX A;  5IXB A;  1IRX A;  2KRO A;  2QQS A;  5IHN A;  1JXO A;  3JCM f;  3EGX A;  5J26 A;  4FYW B;  2DRM A;  4M7D C;  3OMG A;  2K2M A;  3PTA A;  2JN0 A;  4ZN3 A;  4HT9 A;  1WJR A;  1K8A R;  3VS3 A;  5LJ5 g;  4M75 B;  4J9F A;  3ER0 A;  3GF5 A;  4EMK B;  2OTL T;  4DQ2 A;  4RTY A;  1VA7 A;  3I9Q A;  3X28 B;  1JJ2 A;  1PCX A;  2J6F A;  1M90 U;  1EIF A;  2KSS A;  1YIT T;  4F7U E;  2K5F A;  4ZTJ A;  1M3A A;  2HZY A;  1AZE A;  4HCB A;  3KUF A;  4C0D B;  2DKG A;  2L0A A;  4FCY A;  1VUB A;  1P92 A;  4XTZ A;  3V8L A;  2LX9 A;  1UFF A;  2E65 A;  5CKF A;  2OX7 A;  2DTH A;  3EH2 A;  4M7D B;  4BI4 A;  4NL2 A;  1E6G A;  5KH6 A;  2LJ3 A;  4PJM A;  2DIG A;  3PVQ A;  2JTF A;  1O9S A;  3G6E Q;  1NZ9 A;  2E3I A;  2NUZ A;  3URG A;  4OMM A;  4XTV A;  3MPU B;  1SRM A;  3MKD A;  5GAN 5;  4J6Y A;  1YNZ A;  5CIU A;  1VQN Q;  5A0L A;  5L8R E;  4HA8 A;  1M2V B;  2EPD A;  4QKU A;  3H9N A;  4HCZ A;  2LQN A;  1MGQ A;  9ATC B;  2CRE A;  2L3R A;  4J9H A;  1Y57 A;  3H0F A;  3TU4 K;  2PNI A;  2L3P A;  1OPL A;  4J6W A;  1X01 A;  1ZUY A;  4C5I A;  2P4T A;  1OI1 A;  4M78 D;  1O75 A;  3HP9 A;  2CGH A;  2M02 A;  2HEQ A;  2KRN A;  2JVV A;  1TSF A;  3OYJ A;  3CD6 T;  3M57 A;  1X2Q A;  2EYW A;  3QZ9 B;  2AHJ B;  1TUG B;  3OBY A;  5D6X A;  2KR3 A;  3NFC A;  5GAM j;  1PSF A;  4QVZ A;  2HSP A;  3VUB A;  3CBM A;  1AD5 A;  2M0O A;  2CSI A;  3VS6 A;  4C8Q F;  2VXE A;  2JTE A;  2FPD A;  4IUT A;  2XID A;  3M4Y A;  3I56 A;  1I4K 1;  2DD4 A;  1CSK A;  4D6W A;  4C0F A;  4C8Q B;  1Q95 G;  1YJN A;  4FU6 A;  3EH1 A;  1K8A U;  5D6W A;  5GAN f;  5FWB A;  2XHC A;  3UDC A;  2EGC A;  5DLQ E;  4IIO A;  4LN2 A;  4DEY A;  3REB B;  4DOW A;  5LJ3 j;  1VQO T;  1JJ2 P;  1YIJ T;  3OS1 A;  4EMH A;  5GAN 4;  2DTO A;  5CQX A;  3OYI A;  3NTH A;  1S1N A;  1NJI C;  1QCO A;  3EFS A;  4LNP A;  3WXM B;  2QA4 T;  4RCB A;  2GFU A;  4OMF B;  4C92 G;  1NJI U;  1N9R A;  1IRE B;  3OYC A;  3AHU A;  5KYY A;  2KI7 A;  1ZUU A;  4M77 B;  3S3M A;  3QHS A;  2RJE A;  4KGZ B;  4J7I A;  4C8Q C;  1VQ6 Q;  2LJ0 A;  3GLX A;  3RBB B;  2JUF A;  4M77 D;  2MOX A;  2GQV A;  1B34 B;  4PJO F;  3JCM d;  2EJ9 A;  4PK4 A;  3EGD B;  4LD9 K;  3CC4 T;  3G7Z A;  2EQI A;  3ZFJ A;  3SWN B;  2XDD A;  2QQB A;  4J9B A;  4PFO A;  2FZK B;  2M0Y A;  1TG0 A;  1VYT A;  5FU7 B;  3EG9 B;  3M55 A;  4E7K A;  2QA4 Q;  3QSU A;  2YHT A;  1LCK A;  2YDL A;  3M53 A;  3G6E A;  2XG8 D;  2P4R A;  3CCM T;  4M7D G;  3EGU A;  3QDR B;  1YJ9 Q;  4GLK A;  3CCS Q;  1VQ8 Q;  1RAA B;  2F1L A;  2RJD A;  3E2U A;  3JCM e;  1QVG P;  2W10 A;  2ED0 A;  2B8A A;  1VQ5 T;  4M75 A;  3MCA B;  3I56 Q;  3PFS A;  1Q7Y U;  1I07 A;  2V8J A;  2HKN A;  1VQ9 T;  4B6M A;  2O9V A;  2GTJ A;  1YCS B;  2RQU A;  1VYV A;  4BD3 A;  4QT7 A;  4M7A D;  2JMA A;  4EPC A;  4A4E A;  1YJ9 T;  2D9T A;  4ZGE B;  4C0G A;  3PE0 A;  3HRS A;  2QXF A;  2KY9 A;  4BI8 B;  3NHN A;  2ZPH B;  2O01 E;  3RNJ A;  1RAI B;  2E5Q A;  5LJ5 e;  1Y96 A;  2RHI A;  1N6A A;  2L8D A;  5FW9 A;  3GPL A;  2ESW A;  3PVL A;  4DBR A;  5L23 A;  4JJD A;  4F17 A;  1U06 A;  2FPF A;  3J81 E;  4MZM A;  5GJV B;  2ECZ A;  1SKU B;  3JB9 I;  1QVP A;  4JZ4 A;  3CCS T;  2VKN A;  1VQ8 T;  2MI6 A;  1KD1 R;  2O88 A;  3GNG A;  1VQ4 Q;  2P84 A;  2L2P A;  2VGN A;  4IIM A;  1WX6 A;  2O4X B;  2FPE A;  4O6J A;  4O5V A;  3UF4 A;  1BU1 A;  3LH0 A;  2IG0 A;  3HTR A;  1PD1 A;  4E7H A;  1Y96 B;  2LP5 A;  4J6X A;  2ZZD A;  1ZHI A;  1WXT A;  1WQ7 A;  2AIR B;  3EGD A;  2DL5 A;  3RKW A;  2L89 A;  3LX7 A;  1WI7 A;  1DJ7 B;  4DBH A;  1K9M U;  2K5I A;  2V1Q A;  1OV3 A;  1B3Q A;  2RHZ A;  1Q86 C;  2EWN A;  4EDU A;  1K9A A;  1QVG S;  1XOV A;  3N5B B;  4M7D E;  3BW1 A;  3EFO B;  2HQX A;  5FRM A;  4JRI A;  5GAN h;  2DAQ A;  1VQ6 A;  3M58 A;  1HYO A;  1M27 C;  2COW A;  1HXD A;  4A53 A;  2VGM A;  3THK A;  2KRS A;  1WHG A;  3OYH A;  1XTD A;  5CKD A;  4JLG A;  2HBP A;  3JSC A;  4KRT A;  4F04 B;  3OW2 P;  3VU3 C;  5ECA A;  3CCE A;  1PG5 B;  2VV5 A;  4F16 A;  2PVD B;  5KYN A;  1ZSZ C;  3CCV A;  5I11 A;  4PJO C;  4OMO A;  4PLI A;  1QWE A;  1X75 C;  3QWY A;  1OOT A;  3MHX A;  2K3B A;  3G4S T;  2O31 A;  2J7I A;  2FB7 A;  3G71 Q;  2HAX A;  2KDS A;  1GBQ A;  1X6O A;  3JB9 J;  2RQV A;  4EMK A;  3OBW A;  3GBQ A;  5GMK i;  2Y90 A;  1GCQ C;  1Y0M A;  5DLO A;  4EMG A;  1QP2 A;  2VYT A;  1VQM Q;  2C0T A;  1SPK A;  2GCX A;  2QQA A;  4JDS A;  2QI2 A;  1SEM A;  2OAW A;  1EFN A;  4CC3 A;  4KUD K;  4BDY A;  1SHG A;  5A0G A;  2CZ6 B;  2CZ0 B;  3EAE A;  3VS7 A;  4CI0 C;  1T3S A;  2DL3 A;  3LGL A;  1CKA A;  4M7D D;  1JO8 A;  3FJ5 A;  4LD6 A;  2PVG B;  2X9H A;  2LT1 A;  5GAN g;  2MPX C;  1ZSG A;  1JQQ A;  1NBE B;  5GAN 7;  2K7A A;  2AKL A;  2RA2 A;  3LWI A;  4RMO A;  3QJ6 A;  3Q1J A;  3CCS A;  1KQS A;  1J3T A;  2HCK A;  1E7O A;  3OYD A;  1QWF A;  1MMN A;  5GAM h;  4HVU A;  4OB2 B;  1M4Z A;  1ZX6 A;  1K73 U;  4GLM A;  3CCQ A;  3S6W A;  3D7S B;  1ZUK A;  4KBM B;  1TS9 A;  2K79 A;  1VQM T;  2D8H A;  1WHH A;  1BBZ A;  1D3B B;  4E47 A;  2EKH A;  2RI5 A;  3O8V A;  4PJL A;  2RD1 A;  2FEI A;  4RTU A;  4KH1 B;  1Y07 A;  5FRO A;  3X20 B;  2QG9 B;  3CCR A;  3NGP A;  3QUI A;  4KUI A;  1CKB A;  2D6F A;  1BCM A;  1I8F A;  2KEA A;  3RKX A;  4E7S A;  3JCM P;  4A54 A;  4A4K A;  3PGG A;  3I5S A;  5CQY A;  5KYW B;  3JCM Q;  2GBQ A;  4C8Q E;  1JB0 E;  1U1T A;  3HKS A;  1I1J A;  1YJW A;  3RUX A;  5IHK A;  2RF0 A;  5LL6 S;  2KBT A;  3CC4 A;  1AZG B;  4FSS A;  4MML A;  2PQW A;  4BE2 A;  3OS5 A;  3EHR A;  1UB4 A;  4CRI A;  2EGA A;  2C06 A;  1VQ6 T;  1OUL A;  1Q81 R;  3CC2 T;  3A8O B;  1WXB A;  1YHQ T;  2LX7 A;  3M4G A;  5FU6 C;  5GJW B;  1D1B A;  2KYB A;  1MND A;  1Q86 U;  1MNE A;  4KT0 E;  4R56 A;  5GAN 8;  3QKJ A;  2CUB A;  2EBP A;  1LVK A;  2F5K A;  1BI0 A;  4MZP A;  2F5T X;  4OVA A;  3CCJ A;  5HK0 A;  5GAM d;  5M9O A;  2HQH A;  1KD1 C;  2ROT A;  4D8D A;  4FW2 A;  2H3E B;  5CR2 A;  1B07 A;  2X4W A;  2CH4 W;  1FMK A;  1YJW Q;  3CCE T;  3CPW S;  2OAU A;  1AOJ A;  1ZSZ A;  2KE9 A;  2LT4 A;  1JBM A;  2R5M A;  2O9S A;  4AFQ C;  1YCY A;  4NL3 A;  3RER A;  3VV0 A;  2QK0 A;  2I2L A;  2CZ1 B;  2VAS A;  4ZGD B;  2LQW A;  1UEC A;  2EW3 A;  5KYY B;  1KQ1 A;  3UPU A;  4YTL A;  1OYX A;  2ZPI B;  5GMK l;  2MIO A;  2CP6 A;  1N9S A;  1B34 A;  4KUL A;  1VQ7 T;  3QBY A;  4IUQ A;  1KK7 A;  2ZGW A;  1BIA A;  1VQ4 T;  4HCK A;  2OI3 A;  2GTO A;  1U3O A;  2E3H A;  3H41 A;  3MEU A;  2RJC A;  1FYN A;  5LJ5 j;  1VQP Q;  2P0P A;  4N0A A;  1U1S A;  2CDT A;  3M0Q A;  3CCU A;  2PZ1 A;  3CXC P;  1NYG A;  3OYL A;  1ZQ1 A;  4C8Q G;  1MHN A;  1VQ4 A;  1W70 A;  4C5G A;  1T0H A;  3I55 A;  4M78 C;  2K2V A;  2YUO A;  2MWO A;  2H3J A;  4RCC A;  1H64 1;  3MEW A;  4Z89 A;  3KXT A;  1VYU A;  1MV0 B;  1VIE A;  1K76 A;  1YJN Q;  1M2O A;  4DOV A;  1MV3 A;  3LW5 E;  2QGF B;  3VRY A;  2ATC B;  2PU9 B;  4EMK C;  2A08 A;  3VS4 A;  3OYY A;  4RTX A;  3JRZ A;  4JZ3 A;  2DJZ A;  1BYM A;  5LJ3 d;  3OW2 A;  3VYG A;  2CKK A;  2QDY B;  4M75 D;  2L3Q A;  1WYX A;  2DTI A;  5GAM e;  3VJP A;  2QDL A;  4ELY C;  3ZEH A;  2JJ9 A;  3JAM E;  2F2V A;  4J83 A;  5KE3 A;  4KGV B;  4C92 C;  4F14 A;  2XDB A;  3J7A F;  2RM4 A;  2R58 A;  3U23 A;  4M7A E;  3L2W A;  3CCV T;  4K11 A;  2HQE A;  3NMZ C;  1ZSZ B;  2YLB A;  4A4G A;  2NUT A;  3JB9 H;  2L5Q A;  3QDF A;  4GY5 A;  1SSF A;  3QXE B;  4OMP A;  5HY6 A;  1WHK A;  2KVQ G;  2R5A A;  5GMK h;  3PMT A;  2V26 A;  5GAO r;  2KT1 A;  1KC8 U;  2WSF E;  2EQJ A;  2YRC A;  2JNG A;  4FIB A;  4C8Q A;  5GAN d;  5CKH A;  2DEQ A;  3M0T A;  2F2X A;  1M8M A;  4J8O A;  3CBO A;  3HFO A;  1OX8 A;  4M7D F;  2PUK B;  3CCQ T;  2GQI A;  4ZN1 A;  1C6V X;  3FLG A;  3CCV Q;  1VQO Q;  4M75 G;  3L2V A;  2LMJ A;  3NTI A;  1KQ2 A;  5I2S A;  2EVR A;  2LQ8 A;  3G71 T;  1YP5 A;  3CME Q;  1PM3 A;  3OYK A;  2DZ9 A;  5FLX E;  1YHQ Q;  1VQL Q;  2WSC E;  1W1F A;  4ESR A;  1I5L A;  1V1C A;  1IZ6 A;  3SFM A;  4QW2 A;  1TTH B;  2RO0 A;  3UA7 A;  1MMD A;  1JJ2 S;  4N4G A;  2HBW A;  1SG5 A;  2CP7 A;  4M77 A;  1D0Y A;  2GNC A;  1GBR A;  3GOX A;  3SEM A;  1VQM A;  1M3B A;  1RI0 A;  1OZ3 A;  2X35 A;  5LJ3 g;  1QLY A;  5GAO q;  2DD5 A;  4A4F A;  2COZ A;  2VC8 A;  4PJO B;  2FL7 A;  4XTY A;  1YFN A;  4X9C A;  1IO6 A;  1PC0 A;  2AZS A;  3BDU A;  1XQH A;  4PJO D;  2DXT A;  4M77 F;  1K8A C;  3FRN A;  3CMA A;  2P0Q A;  1KHI A;  3V7S A;  1ACM B;  2ZPG B;  3C94 A;  3EG0 A;  1SHF A;  5AYF A;  3CMA Q;  3T9N A;  2YLC A;  3RES A;  3MP1 A;  1AHJ B;  5FWC A;  3MEV A;  4C92 A;  2MAM A;  1WQW A;  1BI2 A;  2XKO C;  1UHF A;  2LRQ A;  1ZA1 B;  1UGP B;  4RKU E;  4RTT A;  3JCM X;  3JV3 A;  1VQL T;  2G6F X;  5GAO l;  1RLQ C;  3PNW C;  4RG8 A;  2PVO B;  8AT1 B;  3JB9 G;  3LH5 A;  2DXU A;  1WA7 A;  3RMS A;  2RN8 A;  3C0C A;  4C92 F;  1QVF P;  4R55 A;  1XNI A;  2DER A;  4X9D A;  3E9G A;  2G3R A;  4LE9 A;  3G6E T;  4DEX A;  2DVE A;  5J3B A;  2DA9 A;  1VQP T;  2EKO A;  1PD0 A;  3CMA T;  1D09 B;  2DYI A;  2HL5 C;  5GAN 6;  2YUQ A;  3RMQ A;  2OJ2 A;  3OQ5 A;  4QQD A;  2E41 A;  3M0P A;  1I81 A;  2LJ1 A;  3L1A A;  3L2Z A;  2M9U A;  3A8G B;  4AT1 B;  4II1 A;  3P8H A;  3HSB A;  1HK9 A;  2RNA A;  3R6N A;  4AFS C;  1VQ9 A;  1M8V A;  1X6G A;  2A3L A;  2QQ9 A;  2CH4 A;  1M90 R;  3CC4 Q;  3CME A;  1BIB A;  3QO3 A;  4NS5 A;  3JCM g;  2EYZ A;  2FRW A;  1W2B P;  2RQT A;  2MYS A;  4LXC A;  3DLM A;  2KGT A;  3BE3 A;  2ENM A;  4PJO E;  2E6N A;  4LDV A;  3QZ5 B;  4BE0 A;  1N8R U;  2A36 A;  5CKE A;  2YSQ A;  4XU0 A;  1R77 A;  4Z02 A;  3CXC A;  5AT1 B;  2NYS A;  1TH7 A;  2GGR A;  4J9G A;  2DL4 A;  1AWJ A;  2OTJ A;  3WVE B;  1WDX A;  2DZC A;  1NEB A;  3CQT A;  2NLU A;  1H3H A;  1ZA2 B;  2BE9 B;  4D8K A;  3FIF A;  2F69 A;  1YIJ Q;  3FJP A;  5CO7 A;  1E6H A;  5KYW A;  1VQ7 A;  4BY6 B;  2DRK A;  2K5L A;  4M7A F;  5GAO n;  3CC2 Q;  4AFU C;  1UGS B;  2QTX A;  2L3S A;  1K9M R;  1H8K A;  1UJY A;  4XQ3 A;  5FU7 C;  2J06 A;  1PKS A;  2R57 A;  5KCO A;  1PRM C;  1C1A A;  3M0U A;  2RQR A;  1VOM A;  1KQS P;  3IQL A;  1K73 C;  3QJY A;  2NUT B;  2J05 A;  3CCR Q;  2DPP B;  3TVT A;  3LWH A;  1N8R R;  1TUD A;  4ZNX A;  2QEX Q;  4HCC A;  1GCQ A;  3CC7 Q;  2DXC A;  2J6K A;  5CAI A;  5CKB A;  3OYA A;  4CC2 A;  4E6R A;  1IGQ A;  4IUP A;  2DLP A;  3VYH B;  1D1C A;  4M78 G;  1RAG B;  2RK1 A;  1IXD A;  1FMW A;  1V29 B;  4BAC A;  2CSQ A;  2EJF A;  2EJG A;  5I2M A;  4FYX B;  4Y92 A;  4M4Z A;  2CP3 A;  5A2Q E;  5GAN 3;  4HT8 A;  3I55 Q;  2DBM A;  3AT1 B;  3C95 A;  3HFN A;  2C0I A;  5LJ5 h;  2EYY A;  1ARK A;  4QQG A;  1WXU A;  2E12 A;  3OB9 A;  1W6X A;  3OYB A;  5KYU B;  4JJN K;  1NM7 A;  5LJ3 e;  2A28 A;  1BK2 A;  2O4X A;  1WHL A;  4JLI A;  1PKT A;  2JM9 A;  2KRM A;  3I56 T;  5FU6 B;  3EG1 A;  1TUC A;  2HSE B;  7AT1 B;  4OGC A;  2HD0 A;  3A8L B;  6AT1 B;  4HVV A;  2COY A;  4X1V A;  2QA4 A;  2BTT A;  1OU8 A;  1Q7Y R;  3M0S A;  1M3C A; 
#chains in the Genus database with same CATH homology
 1B07 A;  2CH4 W;  1X2Q A;  2EYW A;  1G2B A;  1FMK A;  1AOJ A;  2KE9 A;  2KR3 A;  2O9S A;  2HSP A;  4AFQ C;  1AD5 A;  4J9E A;  4EIK A;  2CSI A;  3VS6 A;  2JTE A;  2FPD A;  4LUD A;  1YWP A;  1CSK A;  1RUW A;  2LQW A;  1UEC A;  2EW3 A;  4RUG A;  4CC4 B;  1U5S A;  2K6D A;  3EG2 A;  5FWB A;  2EGC A;  2MIO A;  4IIO A;  4LN2 A;  2A37 A;  4DEY A;  3REB B;  1ABQ A;  1ZBJ A;  4HCK A;  2DM1 A;  1UJ0 A;  2RPN A;  1S1N A;  2OI3 A;  2GTO A;  2DX1 A;  1U3O A;  1KFZ A;  1NG2 A;  4LNP A;  3H41 A;  2VWF A;  2AZV A;  1JEG A;  2PTK A;  5IXF A;  1FYN A;  1K1Z A;  2DMO A;  1BB9 A;  1G83 A;  2EGE A;  2CDT A;  3M0Q A;  3I5R A;  1T3L A;  2PZ1 A;  2KXC A;  1GFD A;  1NLO C;  1ZUU A;  1NYG A;  1W70 A;  1T0H A;  3QWX X;  4R0K A;  2YUO A;  2RQW A;  1K0X A;  2DL8 A;  2YUN A;  1SRL A;  5IHI A;  1T0J A;  4Z89 A;  2LJ0 A;  2DBK A;  3RBB B;  2MOX A;  1VYU A;  1MV0 B;  4HVW A;  1K76 A;  1MV3 A;  2DIL A;  3TSW A;  3VRY A;  2MCN A;  1NLP C;  2A08 A;  1KJW A;  2EQI A;  3VS4 A;  1JXM A;  4RTX A;  4JZ3 A;  1PNJ A;  2M51 A;  4J9C A;  4J9B A;  5EC7 A;  1X43 A;  2M0Y A;  2BZX A;  1TG0 A;  2XMF A;  2L3Q A;  1VYT A;  1UE9 A;  1WYX A;  3SHW A;  1WIE A;  3UA6 A;  2BZ8 A;  2QDL A;  1QKX A;  1LCK A;  2YDL A;  1GCP A;  2AK5 A;  2F2V A;  2P4R A;  1KIK A;  2VVK A;  3EGU A;  4CC7 A;  1I0C A;  4F14 A;  2ROL A;  1QCF A;  2J6O A;  2F2W A;  3U23 A;  2W10 A;  2ED0 A;  2H8H A;  4K11 A;  4GBQ A;  3NMZ C;  3VRZ A;  2FG0 A;  3TSZ A;  2DF6 A;  1GRI A;  1I07 A;  4OMN A;  1UDL A;  2O9V A;  2GTJ A;  1YCS B;  1AWW A;  2RQU A;  1VYV A;  4OMP A;  4QT7 A;  1UGV A;  4Z88 A;  1UG1 A;  3ZL7 C;  2JMA A;  3KFV A;  2LNH B;  2JXB A;  2KT1 A;  3VS0 A;  1MUZ A;  2JT4 A;  1KSW A;  3PE0 A;  1UUE A;  2ABL A;  2DE0 X;  1A0N B;  3NHN A;  3M0T A;  2I0N A;  2F2X A;  1M8M A;  3RNJ A;  5FW9 A;  2ESW A;  1X69 A;  3PVL A;  5L23 A;  4JJD A;  4F17 A;  1U06 A;  2FPF A;  2GQI A;  5GJV B;  2ECZ A;  3REA B;  1YN8 A;  4JZ4 A;  2VKN A;  2LMJ A;  2EVR A;  1YP5 A;  2O88 A;  2C0O A;  4JJB A;  2L2P A;  2X3W D;  1X27 A;  4IIM A;  1WX6 A;  1W1F A;  4ESR A;  2RMO A;  2FPE A;  1V1C A;  3UA7 A;  2D1X A;  3UF4 A;  2HBW A;  2YUP A;  4AG1 C;  1NYF A;  2GNC A;  1BU1 A;  1GBR A;  3SEM A;  1M3B A;  1QLY A;  2SRC A;  4JPB W;  2LP5 A;  3VS5 A;  2IIM A;  2O2O A;  1WXT A;  1RI9 A;  1IO6 A;  2AZS A;  2DL5 A;  4WCI A;  3H0I A;  1ZLM A;  4J9I A;  4RTW A;  1WI7 A;  2KXD A;  2D0N A;  2V1R A;  3EG0 A;  1SHF A;  1PHT A;  4LUE A;  1QKW A;  2V1Q A;  2FO0 A;  2JW4 A;  1OV3 A;  1GL5 A;  1B3Q A;  5FWC A;  1K9A A;  1Z9Q A;  1XOV A;  2AKK A;  1H92 A;  1UHF A;  4ORZ A;  4A63 B;  4RTT A;  3JV3 A;  1AVZ C;  2G6F X;  1UHC A;  3UAT A;  3VS2 A;  1RLQ C;  1JU5 C;  4AG2 C;  1M27 C;  3EG3 A;  3LH5 A;  1WA7 A;  2RN8 A;  3C0C A;  2FRY A;  2X3X D;  2DYB A;  1RLP C;  4OML A;  3THK A;  2CT4 A;  2KRS A;  2JM8 A;  4LE9 A;  3A98 A;  1X2K A;  4DEX A;  5HCK A;  2DA9 A;  2CUD A;  1SSH A;  2YUQ A;  1WFW A;  2OJ2 A;  1N5Z A;  1HD3 A;  3M0P A;  2LJ1 A;  4KRT A;  2SEM A;  2DVJ A;  2JS0 A;  1K0S A;  1GFC A;  2CT3 A;  5ECA A;  4OMQ A;  2DL7 A;  2K9G A;  2RNA A;  3R6N A;  4F16 A;  4AFS C;  2KYM A;  2B86 A;  4J9D A;  1X6G A;  5I11 A;  4OMO A;  2CH4 A;  1QWE A;  2JMC A;  1PRL C;  1OOT A;  3QWY A;  2K3B A;  2O31 A;  2J7I A;  2EYZ A;  1HJD A;  2FRW A;  2LCS A;  2RQT A;  1AEY A;  2KT8 A;  1GBQ A;  2D8J A;  2ED1 A;  2RQV A;  4Z8A A;  2KGT A;  3GBQ A;  3O5Z A;  3M0R A;  1GCQ C;  1Y0M A;  2ENM A;  1K4U S;  1OPK A;  4AFZ C;  2A36 A;  1OEB A;  2YSQ A;  1YWO A;  3ULR B;  2C0T A;  1SPK A;  2GGR A;  4J9G A;  2DL4 A;  1AWX A;  1AWJ A;  1SEM A;  2OAW A;  1EFN A;  4CC3 A;  5IXB A;  2KRO A;  5IHN A;  1JXO A;  1SHG A;  1WDX A;  2DJQ A;  1AWO A;  3VS7 A;  1NEB A;  5I22 A;  3CQT A;  1T3S A;  2DL3 A;  1CKA A;  2DRM A;  1H3H A;  1JO8 A;  2K2M A;  3FJ5 A;  3I35 A;  4RTZ A;  3VS1 A;  1ZSG A;  2NWM A;  1JQQ A;  2E5K A;  2K7A A;  3VS3 A;  2AKL A;  4D8K A;  5IH2 A;  4J9F A;  1E6H A;  1J3T A;  4JJC A;  2DRK A;  2HCK A;  1E7O A;  1QWF A;  4RTV A;  4HVU A;  4RTY A;  1ZX6 A;  4GLM A;  1VA7 A;  1Z9Z A;  3I9Q A;  3NPF A;  4AFU C;  2YT6 A;  2J6F A;  1ZUK A;  2L3S A;  1H8K A;  2K79 A;  1UJY A;  2D8H A;  2HDA A;  2J06 A;  1BBZ A;  2EKH A;  1PKS A;  4HXJ A;  1PRM C;  3M0U A;  2RQR A;  1M3A A;  2FEI A;  1AZE A;  4RTU A;  3IQL A;  2L0A A;  2J05 A;  3TVT A;  3EHQ A;  1TUD A;  4ZNX A;  1M30 A;  3NGP A;  1UFF A;  1CKB A;  1GCQ A;  2J6K A;  2KEA A;  4CC2 A;  2DNU A;  4E6R A;  3I5S A;  2DLP A;  1UTI A;  1E6G A;  2JS2 A;  2GBQ A;  2LJ3 A;  1I1J A;  5IHK A;  3PVQ A;  2CSQ A;  2KNB B;  2RF0 A;  4Y92 A;  1WLP B;  2KBT A;  2NUZ A;  1AZG B;  4M4Z A;  4FSS A;  4OMM A;  3H0H A;  1SRM A;  1NEG A;  2DBM A;  1PWT A;  1X6B A;  2C0I A;  1YNZ A;  3EHR A;  2W0Z A;  2EYY A;  2EGA A;  1ARK A;  2EPD A;  1WXU A;  2LQN A;  1W6X A;  1HSQ A;  1WXB A;  1NM7 A;  2LX7 A;  2CRE A;  4J9H A;  1Y57 A;  3H0F A;  5GJW B;  2PNI A;  2A28 A;  2KYB A;  2L3P A;  1BK2 A;  1OPL A;  1ABO A;  1ZUY A;  2CUB A;  1PKT A;  2EBP A;  2LZ6 B;  2JM9 A;  2KRM A;  3EG1 A;  1TUC A;  2BZY A;  4HVV A;  2EYX A;  4X1V A;  2HEQ A;  2BTT A;  2ROT A;  2KRN A;  4D8D A;  3M0S A;  1M3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...