4AFQC

Human chymase - fynomer complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
VTLFVALYDYQADRWTDLSFHKGEKFQILDASPPGDWWEARSLTTGETGYIPSNYVAPVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/de novo protein
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afqC00
4J9HA 1E6GA 1IO6A 1RLQC 1T3SA 2HCKA 4F17A 2FPDA 4CC3A 4OMQA 2KXCA 1B3QA 1YWOA 3JV3A 2RMOA 2IIMA 1Z9QA 4F16A 3PVQA 1KIKA 3VS0A 2DM1A 2MOXA 5I11A 4RUGA 2JT4A 4AG2C 1SSHA 4AFZC 2EVRA 1X2KA 2LJ1A 2RNAA 2JS2A 2KXDA 3RBBB 3KFVA 2EQIA 2DILA 4KRTA 3VS4A 1JEGA 1MV3A 1AOJA 4QT7A 2EYXA 2LQWA 3VS3A 2DLPA 1TUCA 2AZSA 1WA7A 1AVZC 1JO8A 1T0JA 3I35A 1KJWA 2RQUA 3I9QA 2B86A 1X6BA 2J7IA 4JZ4A 1PRMC 4RTZA 2D0NA 5FW9A 1T3LA 2AZVA 1X43A 2L3PA 2LJ3A 2FEIA 4CC7A 2BTTA 5EC7A 1GBQA 3VRZA 4D8KA 2GTOA 2LX7A 2EYWA 1QWFA 4DEYA 2LNHB 4J9BA 3UATA 1SHGA 2X3XD 1M8MA 4LUEA 4F14A 2ABLA 1FYNA 4OMPA 2OAWA 1UHCA 1GCQA 1BBZA 1WXTA 4OMNA 2DL4A 5IXBA 2C0IA 2F2XA 2PZ1A 2CT4A 4HXJA 2EGAA 1AWOA 1BB9A 1V1CA 1PKSA 1VYUA 3I5SA 1YP5A 4WCIA 4ORZA 2O9VA 2OI3A 2MIOA 5GJWB 1NLPC 2A08A 2JTEA 1NLOC 3M0QA 2DL8A 2D1XA 3TSZA 1UECA 2K2MA 1NEGA 2PNIA 3EG0A 1UGVA 1NM7A 2K6DA 4X1VA 2KNBB 1AEYA 2F2WA 3CQTA 1ZUKA 1OEBA 1W6XA 1SPKA 2CUBA 1QCFA 2CUDA 3M0SA 1ZUYA 2DRMA 4RTTA 2KYMA 3EG1A 1HD3A 1WIEA 1M3CA 1AD5A 4J9DA 1AWXA 1K0XA 2RQWA 3REBB 1PKTA 1U5SA 3VS6A 2BZYA 4CC2A 4HCKA 2RQRA 3ZL7C 1I07A 2AK5A 2ED1A 1A0NB 1UJYA 3VRYA 1JXOA 3LH5A 1X6GA 1ZUUA 2I0NA 3GBQA 4LUDA 1UTIA 2KE9A 2YUOA 2O31A 3NMZC 4RTYA 4Y92A 1PWTA 1K76A 1PNJA 1NG2A 3A98A 4OMMA 2K9GA 2DNUA 4OMLA 4J9IA 1H8KA 5FWBA 2KRSA 2KT8A 1AZEA 2KR3A 2LQNA 2EBPA 1PRLC 1WFWA 2AKKA 2FRYA 2GTJA 2K79A 2LZ6B 2L3QA 2BZ8A 3VS1A 1UFFA 3EHRA 1OPLA 2YUPA 1KFZA 2KT1A 4FSSA 2CSQA 4ZNXA 1PHTA 2JMAA 1VA7A 2RQVA 2DVJA 2ECZA 1UG1A 1ARKA 1VYVA 2JM8A 4JJBA 1LCKA 1WDXA 1CSKA 1X2QA 3PVLA 1G2BA 2LMJA 3M0TA 2DL5A 2X3WD 2K7AA 2J6KA 2JS0A 1J3TA 2KRNA 2FO0A 1YCSB 3QWXX 4J9FA 1E7OA 2G6FX 3QWYA 2J05A 3EG2A 4LE9A 2L0AA 1CKAA 1AZGB 1I0CA 3H41A 1RUWA 3M0UA 2A37A 2EYZA 4RTUA 1QKWA 3SEMA 4RTXA 3NHNA 2EGCA 1ABOA 1WX6A 1OV3A 1M30A 1UJ0A 2L3SA 2KGTA 1QLYA 1YNZA 3U23A 2KROA 3VS2A 2ROTA 3SHWA 2KYBA 1QKXA 1T0HA 2HEQA 4K11A 2CDTA 2YDLA 2JXBA 2EKHA 2CH4A 1MUZA 2YT6A 4CC4B 3O5ZA 1VYTA 4IIMA 2M51A 2YSQA 4HVWA 2NWMA 4HVUA 2J06A 1K0SA 2VKNA 3TVTA 1ZBJA 2V1QA 2GNCA 1I1JA 2ED0A 1JXMA 2EGEA 1W1FA 4J9GA 2VWFA 2JM9A 1XOVA 3THKA 1K4US 2FRWA 3REAB 1YN8A 1U06A 1K9AA 2JW4A 4EIKA 4DEXA 1S1NA 2DA9A 2L2PA 3H0IA 3TSWA 2ENMA 2DBMA 2W0ZA 2D8JA 1AWJA 5ECAA 2P4RA 1BK2A 1WLPB 2CREA 3R6NA 2GQIA 1H92A 2HSPA 3FJ5A 2DRKA 4HVVA 1TG0A 1JU5C 3VS5A 4AG1C 1X27A 1EFNA 1UDLA 3EHQA 2E5KA 4R0KA 2QDLA 2ROLA 3H0FA 4AFSC 2SRCA 1YWPA 1M27C 2HDAA 5FWCA 1Y57A 2DMOA 2O88A 2LCSA 2DJQA 3UA6A 1ZX6A 5IXFA 1U3OA 2K3BA 4GLMA 4OMOA 2EW3A 1JQQA 2BZXA 3PE0A 4E6RA 2J6FA 1X69A 1M3AA 1H3HA 1RLPC 3RNJA 2ESWA 2YUNA 2MCNA 1GBRA 2VVKA 1HJDA 1SRLA 1E6HA 5HCKA 1OOTA 4A63B 1WXBA 2YUQA 2J6OA 2F2VA 1TUDA 2KEAA 2V1RA 2GBQA 3C0CA 1CKBA 1GL5A 1N5ZA 2C0OA 2O9SA 5IHKA 4Z89A 2SEMA 2KBTA 5IH2A 2M0YA 2H8HA 3I5RA 1SRMA 4J9EA 2RPNA 1WYXA 4RTVA 3UA7A 3NPFA 1GRIA 2C0TA 1K1ZA 4JJDA 2A28A 2JMCA 1GCPA 2KRMA 2DL3A 2RQTA 1HSQA 1FMKA 2GGRA 4ESRA 2EPDA 5IHIA 5IHNA 1NEBA 2RN8A 1KSWA 2RF0A 2LP5A 1G83A 1GFDA 2D8HA 3ULRB 2CT3A 4M4ZA 1W70A 1SHFA 4IIOA 1BU1A 2O2OA 1MV0B 2DBKA 2EYYA 1ZLMA 2DL7A 2FG0A 1B07A 2AKLA 1NYGA 2DYBA 5GJVB 1RI9A 3NGPA 1WXUA 1UHFA 4AFQC 4Z8AA 2PTKA 3EGUA 1NYFA 2A36A 1QWEA 3M0RA 4GBQA 4LN2A 4RTWA 1Y0MA 2LJ0A 1AWWA 4LNPA 1ZSGA 1GFCA 1UUEA 2FPEA 3H0HA 1ABQA 2NUZA 3UF4A 3EG3A 1UE9A 1GCQC 1OPKA 5I22A 1WI7A 2W10A 5L23A 4JJCA 4J9CA 4JZ3A 4AFUC 3IQLA 4Z88A 2DX1A 2DE0X 2DF6A 2CSIA 4JPBW 3VS7A 2XMFA 1SEMA 2CH4W 3M0PA 2OJ2A 1Z9ZA 2HBWA 4D8DA 2FPFA 1M3BA
chains in the Genus database with same CATH superfamily
4J9HA 1Y96A 1YJWT 1B7TA 4FW1A 5GANh 2OTLQ 1T3SA 4F17A 1WZOA 2CP2A 4C8QG 3CCSA 4OMFB 2CZ7B 2YRCA 3PMTA 1D1AA 4C92A 3OYJA 2RA2A 1RAEB 4KH0B 3LLRA 1KIKA 4M77C 2QASA 8ATCB 3JCMP 2XIDA 4M78G 5I11A 2JT4A 2NUTB 1SSHA 2R5AA 3OYYA 1X2KA 2RNAA 2EIFA 1JB0E 3N5BB 1X75C 2COYA 2D0QB 1KC8C 3FIFA 4QT7A 1QCNA 2AZSA 1O9SA 1AVZC 2R57A 1KJWA 1OI1A 2RQUA 3I9QA 4JZ4A 4FL6A 2H3EB 4RTZA 1ZA1B 3UT1A 2D0NA 5FW9A 2AZVA 1K8AC 1X43A 1N27A 2FEIA 4FIBA 4L5GA 4ZTFA 1GBQA 4X9DA 3VRZA 1OU9A 1WQ7A 4NL2A 1YIJA 2LNHB 3EG9A 2QA4A 1YJ9Q 2LNVA 3BE3A 1BBZA 1WXTA 3OYGA 5LJ3f 1G3SA 2RH2A 3VYGA 2CT4A 1AWOA 2CS7A 1V1CA 3G6EQ 1VQPA 4BI3A 4LD6A 1W2BA 2XDPA 1IB8A 3I5SA 1OX9A 1YP5A 5GAN2 2LTOA 1XQHA 5FU7C 3V7CA 2A0FB 3JCMX 8AT1B 3OYHA 2RJCA 5GAOq 4A54A 2F5TX 3CMET 4RG2A 1S72T 3EG0A 3J7AF 3CBOA 3JAME 2RHYA 2KVQG 2ZGWA 2BE9B 1M90C 2HQHA 4FSXA 3EFSA 4E7JA 1U1TA 5CKBA 1W6XA 3CCST 3TU4K 5HK0A 1D0ZA 3J80E 3LW5E 1BKBA 5GAOl 2HMAA 2K3YA 2QEXQ 4PFPA 2YHTA 2HNIA 2QQ9A 3E1SA 1U1SA 2MWOA 2QDYB 1K0XA 2RQWA 2DERA 2V26A 3VS6A 1MMNA 4R55A 2WSEE 5DM7R 3ER0A 4HCKA 4M75C 2RQRA 2E3IA 1I07A 3NTIA 2LC4A 4XTZA 3M58A 3M9QA 1PSFA 1K8AR 2DFUA 4F04B 3M56A 1KQSP 1VQ6A 5CCAA 4RTYA 3RMSA 1PWTA 1K76A 3RIRA 2OTJT 3V7RA 1EIFA 4MZPA 2X4XA 2QGFB 1Q81R 3JB9I 3L42A 4N0AC 2ZPIB 3A8GB 3G71T 2XDDA 4EMGA 1H8KA 3A8HB 1YIJT 1TU0B 2QA4T 2EBPA 3SWNB 2YRDA 2XKOC 2BZ8A 1VQ7A 1QVFP 4C92E 2KT1A 4FSSA 4MDWA 4C8QC 2MK5A 1VQPT 3JCMf 4DOVA 1KD1C 1XJWB 1WDXA 2D9TA 1Q82R 1TUGB 1M2VA 3P8BB 1X2QA 3PVLA 1G2BA 2GFUA 3OSVA 4QKUA 2DL5A 2X3WD 2JS0A 1MMGA 1YCYA 3CCRQ 3HL8A 4PJOD 4J9FA 3GNGA 5GANg 1D1BA 1N8RR 1CKAA 3FRNA 1C6VX 5LJ3h 3SEMA 2GCXA 2EGCA 1WX6A 3TQ7P 1RADB 1KK7A 1UJ0A 2L3SA 4J8OA 2QTXA 4F7UF 2KROA 3SHWA 3FLGA 2KYBA 1T0HA 2HEQA 1H641 1VQMQ 2JXBA 4FW2A 4E7KA 2CH4A 3QKJA 2CP7A 2P0QA 1MUZA 4CC4B 5CKHA 1YBYA 2DIGA 4ELYC 1Y96B 4HVWA 2IG0A 3VKIA 2FZCB 4KULA 3TVTA 4KBMB 5CKEA 2V8IA 3CCVQ 4N0AA 2AIRB 4WTOB 4C92B 4FT2A 1OX8A 3REAB 3I55T 3OB9A 5GMKi 4IUPA 1K9AA 2GF7A 3M55A 4DEXA 4B9XA 1BI2A 3H0IA 2COWA 3HFNA 2JNGA 4C8QA 2DBMA 5GANj 4B6MA 2RI5A 3DLMA 1VQ7T 2P4RA 1BK2A 1WLPB 3OY9A 3R6NA 2E1HA 3HSBA 1TG0A 5GAMg 3EHQA 5GANd 2QDLA 4RCBA 4IKFA 2HKQB 1BCOA 1YWPA 1Y57A 5C0MA 2DJQA 1RL2A 1SF9A 1SG5A 2RM4A 3G6EA 4GLMA 2EW3A 3HTRA 3CCEQ 2CZ6B 3NFCA 2PU9B 3OMCA 4E6RA 2J6FA 4C0FA 1R8OB 5CIUA 1X69A 2L89A 2QGGA 1H3HA 3CXCS 2CZ0B 2ESWA 2DD4A 2NYSA 3PTAA 4ZGDB 2DD5A 5CR2A 3OYDA 4M7AC 4BDYA 3L2WA 4HT9A 5A0DA 1WXBA 3QZ9B 5FROA 1VQOQ 3OQ5A 2OTLT 2J6OA 4A4EA 2HQEA 3SB2A 3CC7Q 2EQUA 3C0CA 1GL5A 1AT1B 2F69A 5HK3A 1VOMA 1NJIR 2JTFA 5IH2A 4J9EA 3CMAQ 2BIVA 2E41A 3AHUA 3UA7A 4M77F 1K73C 4JS4A 2A28A 2JMCA 4AMCA 1K9MC 2KRMA 5CKFA 1HSQA 1WQWA 2XHCA 5IT9E 1KSWA 2RF0A 3M57A 1VIFA 3RMQA 1VQKQ 4IIOA 1VQ4Q 5GAMd 4C5HA 1M2OA 4J5YA 5GAN5 3CC2A 5FRMA 1B07A 4PJOF 3P8HA 2DYBA 2RI3A 1TWBA 1YJ9T 1WXUA 4ELZC 1UHFA 1RABB 4AFQC 4Z8AA 2PTKA 3H8ZA 2A36A 1QWEA 3VUBA 4GBQA 4LN2A 4ME7A 2E4HA 2VYTA 3BW1A 2L8DA 5LJ3g 1AWWA 3OS0A 3G6ET 5IAYA 1GFCA 4KUIA 5CK9A 3RKYA 2NUZA 4BDZA 3A8MB 1N9SA 2W10A 3T9NA 5HKCA 3HKSA 3IQLA 2EJFA 3A8OB 2CSIA 3VS7A 2HAXA 1M2VB 2CP3A 4LDYA 2NUPA 3C95A 1JJ2P 4V2SA 3OW2P 1Z9ZA 1JJ2S 4C8QE 3OW2S 3CC4Q 1OU8A 1E6GA 1RLQC 2HCKA 4XTWA 2KXCA 2QEXT 3SDZA 1YHQQ 2KSSA 1Z9QA 2E5QA 3M5AA 3QJ6A 2MMPA 1HK9A 1NBEB 3M4GA 1KQ1A 2LJ1A 1MMAA 2JS2A 4C0DC 3RBBB 2EQIA 2MI6A 7AT1B 3O8VA 2DILA 4KRTA 1NPRA 4M75F 1JEGA 1MV3A 2O4XA 4DBHA 3SD4A 2LQWA 3VS3A 2C06A 4ATOA 4BE0A 3EGDA 5LJ3j 4PJOG 4RMOA 3S3NA 1EZZB 1PRMC 2JOYA 4ZTJA 2L3PA 1UGPB 2LJ3A 4CC7A 3G7ZA 1OQKA 2LRQA 4QVZA 5LJ5g 4DEYA 4M7DF 3PNWC 5LJ3d 1SHGA 2VGMA 1M8MA 4LUEA 3BDLA 2MYSA 4OMPA 1W2BS 3TEEA 4A53A 4C8QB 1ACMB 4OMNA 2DL4A 5IXBA 3JCMg 4D6WA 2PZ1A 3L2ZA 1BB9A 1PKSA 1VYUA 4WCIA 1VQ5Q 4NOYA 5M9OA 2HL5C 4BI4A 4JRKA 3CCRT 2MIOA 1D09B 2E10A 2X4YA 4OF1A 1NLPC 2A08A 4EMHA 2QQRA 2JTEA 1NLOC 3M0QA 5GAMf 2Z0WA 2M0OA 1Q7YR 1UECA 1NEGA 3RUXA 4X9CA 2VASA 3X26B 3QHSA 3CCEA 1NM7A 2K6DA 1AEYA 1ZUKA 4BE1A 1M4ZA 4X34A 5GAOm 2CUBA 1QCFA 2CUDA 2IPOB 1M1KR 2FVUA 4RTTA 4LDWA 1Q86R 1UGRB 3PT9A 3RERA 3EG1A 1VQMT 1M3CA 1VQOA 3PIPA 4JS5A 1KHCA 1IGUA 1U5SA 3OYKA 2M02A 3CC7A 2BZYA 4Y91A 4CC2A 4IUUA 1R0CB 3ZL7C 3CMEA 4DA4A 1VQNQ 1WHMA 1S72A 2RK1A 1A0NB 2QI2A 1UJYA 2EQJA 3CCVT 1X6GA 1ZUUA 2I0NA 4M7AE 3OMGA 2HKNA 1WHGA 4O6JA 3V8LA 3QDRB 5LJ5d 3UWNA 2M16A 2M1HA 3CPWA 4XTVA 2DNUA 4JLIA 2LQKA 4JRIA 2KRSA 4KGVB 3CD6Q 3E2UA 2A7YA 1UB4A 1PRLC 1WFWA 2AKKA 3GP8A 2GTJA 3JCMd 4HA8A 2M9UA 2LZ6B 3VV0A 3VS1A 1MNEA 1KFZA 1IHWA 4ZNXA 5D6XA 1VA7A 2RQVA 2DVJA 2ECZA 1VYVA 3M59A 1LCKA 3NTKA 2OTJA 2JJ9A 3WVEB 3RR6A 3M0TA 2RHZA 4HCBA 3G71A 1TOVA 2E12A 3JSCA 2KRNA 2FO0A 1YCSB 2K5FA 3QWXX 1YITQ 1E7OA 1RI0A 2G6FX 3QWYA 3CCJQ 3EG2A 1TSFA 2GFAA 1KC8U 1Q81C 3M0UA 3H41A 3CCET 1UGSB 3OS5A 3UDCA 2ATCB 2A37A 1YI2Q 2EYZA 4RTXA 1ABOA 4FYWB 2DJZA 4FCYA 1QLYA 4PJLA 1YNZA 2LX9A 3U23A 4M7AB 3VS2A 1AHJB 1K8AU 2E6ZA 1WGSA 4KH1B 1PCXA 2DEQA 1VQOT 2KQWA 2YDLA 1SKUB 5GAMh 2DEUA 3PFSA 4XU2A 3CC7T 2NUPB 1VYTA 4PFOA 1Q82C 2FZKB 5CO7A 2X35A 3CCUA 1YHQA 1N6AA 1C0MA 3MCAB 3JB9D 3CBMA 2VKNA 1PC0A 3CMAT 2FHDA 2RHXA 1I1JA 1N8RC 4PLLA 5J3BA 1XOVA 2JVVA 2CGHA 3THKA 2LT1A 1YJNQ 1YN8A 1U06A 3V8JA 2JW4A 3GOXA 1D0YA 2QG9B 1IHVA 1I8FA 2RJFA 3QBYA 2ENMA 3L2RA 2FL7A 2EWNA 2O4XB 1VQ4T 1M90U 2YXYA 3LWIA 3OSSC 2RHUA 5GAN4 4QQGA 3EGDB 4N4GA 3FC3A 4A4KA 1VIEA 1XNIA 2GQIA 3RESA 1D0XA 2DRKA 4KT0E 3G4SQ 3V7SA 3CBPA 1EFNA 1JRIA 3I55A 2KY9A 2E5KA 2F1LA 5GAN6 2CZ1B 2QXFA 2L3RA 3OYLA 3H0FA 2PQWA 2XI9A 1TH7A 1M27C 2HDAA 5LJ5f 4M77D 4PJOA 1OULA 2RI2A 3PGGA 3PE0A 4MZTA 1XTDA 3QJYA 3HFOA 1M3AA 3RNJA 1MHNA 5KE2A 1WHLA 1MNDA 4N4IA 2Y90A 2KMTA 2YWWA 1HJDA 2QAZA 5HCKA 2XD0A 4M78C 3A1PA 3CC4T 1WJRA 2K57A 3CEYA 4BY6B 1KQ2A 2HBPA 2KEAA 5CKDA 1QVGP 3KUFA 3CCUT 1YHQT 1Q95G 1V29B 1QVGS 2C0OA 5LL6S 2SEMA 5DY9A 4E7LA 2H8HA 3I5RA 3BDUA 1KD1U 2MAMA 1WYXA 4JJDA 3ZEHA 4C0DB 1MMDA 1IZ6A 4J6WA 1GCPA 1FMKA 4ESRA 4OP0A 5FU6C 2EPDA 5IHNA 5I2SA 3CPFA 3LGFA 2OTLA 1NEBA 2CP0A 2DVEA 1D1CA 4XTXA 1GFDA 3R6OA 2CT3A 1W70A 1BU1A 2O2OA 3QYHB 4C5EA 3CCMQ 2EYYA 2EFIA 2YLCA 2DL7A 1ZSZA 5KYXA 2WSFE 3OYMA 3CD6A 1NYGA 4XU1A 2E6NA 5GMKh 1RI9A 1NJIC 4C92F 2RK2A 3VUZA 3JCMW 2X4WA 4FYXB 1NYFA 2HZYA 2LVMA 5GANe 3GLXA 3QUIA 3LWHA 4RTWA 1Y0MA 5J26A 4Y28E 1RACB 3OBYA 3D7SB 1VQ5T 2PVOB 3ASKA 4C0ZA 4RKUE 3C4SA 1UE9A 3QPHA 4M75D 3URGA 4AT1B 5L23A 4JJCA 4M78A 4AFUC 2DX1A 2AHJB 2DF6A 5KYYA 5GAOr 2BKDN 9ATCB 2CH4W 1YJ9A 4D8DA 4OB2B 2FPFA 3JB9F 5LJ5h 1M3BA 1YI2A 3OYAA 1OYXA 5J39A 1OZ2A 4C5IA 3QG1A 3EG9B 3VYHB 2PUOB 4CC3A 4M7DD 1B3QA 4F7UG 1YWOA 2OAUA 3JV3A 2RMOA 2RB6A 2IIMA 3JCMh 3CXCP 1I5LA 4F16A 2XDBA 3PVQA 4J7FA 3JB9H 3VS0A 2DM1A 4RUGA 1RAGB 4AG2C 1HYOA 1KQSA 3KFVA 3SFMA 4P5NA 2VB6A 3GPLA 1MGQA 3VS4A 1AOJA 2E65A 1DJ7B 4A4FA 4N4HA 3VJPA 1TUCA 1WA7A 4II1A 2YLBA 1G3TA 2RO0A 6AT1B 2B86A 1X6BA 2J7IA 5L8RE 3KXTA 2QEXA 4WF2A 2EJ9A 2ZPGB 4C92G 1YJNA 1W4SA 1BIAA 1T3LA 4J83A 2FZGB 1QVFA 3CD6T 2BTTA 1KG1A 2DETA 4XU0A 1QWFA 3UATA 5GAMj 2X3XD 4A4GA 3LGLA 2CP6A 1FYNA 3PIOA 2OAWA 1UHCA 2CP5A 4JLGA 4MDXA 4QVDA 2F2XA 2QK0A 4IUTA 2EGAA 1RAIB 3M53A 1D3BA 3QYGB 4JUVA 3DB3A 4ORZA 4J7IA 2O9VA 3JB9G 2OI3A 2COZA 5I2MA 5KCOA 2E64A 1YITT 3CCJT 1K73U 2E3HA 4O5VA 4XQ3A 2DL8A 1K9MU 3X28B 1YI2T 1QP2A 1UGVA 2KNBB 2ZAEA 1BIBA 2F2WA 2DO3A 4EDUA 3NTHA 2XICA 5KYUA 3M0SA 3E9FA 2ZZDA 2KYMA 4TVRA 2P4TA 2L5QA 1PG5B 4OGCA 5HY6A 1ZBXA 1AWXA 4BUGA 3CCRA 1PKTA 2RJDA 3JB9J 2V8JA 4QW2A 4ANJA 4JDSA 5GAN8 2AK5A 4QVCA 1JXOA 4BY6C 1VQLQ 4Q5WA 4ZN3A 3EFRA 4LUDA 2YUOA 2O31A 3CPWS 4M77G 3NMZC 1Q7YC 3OBWA 1YJNT 4M78E 4Y92A 1VQPQ 1NG2A 5CVIA 1VQMA 1YFNA 2KAFA 3A98A 2K9GA 4J9IA 1M1KC 5FWBA 1Q86C 1AZEA 3F70A 5GMKm 5LJ3e 2FRYA 4E7HA 2WSCE 4BE2A 2K79A 4HKEA 2EKOA 2L3QA 4M7AD 3MP6A 1UFFA 1OPLA 3CCVA 2CSQA 5GAN7 1EX4A 1M8VA 1ZA2B 3G4ST 1ARKA 4KUDK 4L6V5 1QP3A 1VQ8Q 1KHIA 1CSKA 1R0BG 5KYXB 1M1KU 4BB7A 2R5MA 1FX7A 3OYIA 3CCLQ 4VUBA 2FYKA 1I5OB 2J05A 2X51A 4LE9A 2L0AA 2RHIA 1AZGB 3JCMb 1RUWA 1W2BP 1QCOA 3HRTA 5GAN3 1BI1A 3C12A 2EJGA 4LDXA 3X24B 3NHNA 5KYWA 2XK0A 5GMKe 3P8DA 3TREA 4C8QF 2KGTA 3RDVA 1VQ6Q 1LJOA 4XAXB 4E7ZA 3MP1A 2QQAA 1O75A 3MHXA 4M78B 5GMKj 1PSEA 2EKHA 1PM3A 5KYYB 3O5ZA 3JRZA 4HCCA 2ZCFB 4DOWA 2YSQA 3UPUA 3S3MA 2QTVA 4XK8E 1JBMA 2EAYA 2J06A 1K0SA 1V76A 2V1QA 2GNCA 2DK3A 2XU8A 2ED0A 3DLLA 1W1FA 4JJNK 4J9GA 2DYIA 4FYYB 1K4US 3OYEA 5LJ5e 2R58A 4M75G 4EIKA 4J6YA 5FU6B 1S1NA 2DA9A 2L2PA 2F5KA 5FLXE 5LJ5j 4F7UA 3G1JA 3CCMT 1HXDA 3JCMe 4DQ2A 1WHKA 3S6WA 4ZN1A 2VV5A 3DB4A 1X6OA 3CMAA 2HSPA 2BE7D 4M7DG 4AG1C 4LD9K 2JN0A 3QIIA 2FB7A 3VS5A 4LDVA 2HD0A 4R0KA 2ROLA 4MZMA 4NS5A 4PJMA 2SRCA 4DBQA 3CCQQ 2O88A 4PLIA 2LCSA 2DPPB 1QQJA 3JCMc 4BI8B 1ZX6A 4YTLA 5IXFA 4BD3A 1VQKA 1JJ2A 4JRQA 1U3OA 3OW2A 4OMOA 5GMKl 1VQ4A 1JQQA 4J6XA 2KK4A 1WNLA 3I56Q 1RLPC 2YUNA 2DXCA 1RAHB 1D3BB 2WACA 3ZFJA 3BFMA 1TXQA 1GBRA 2VVKA 5C6SA 1SRLA 3L2VA 1E6HA 3HP9A 1B34A 1OOTA 4QQDA 2YUQA 1UGQB 2K5LA 3Q1JA 2X9HA 3S3OA 1FMVA 4PJJA 2V1RA 2XG8D 3OYBA 4C92D 1N5ZA 2G3RA 3BY7A 1LNXA 4Z89A 2KBTA 4PFZA 4PJOC 5KYUB 3ME9A 2K5IA 1FWZA 1SRMA 3ZBDA 2RPNA 3LH0A 3NPFA 3X20B 1C1AA 5KH6A 4KGXB 5KYNA 1WHHA 4M7AF 5D6YA 1RAFB 2DL3A 3E9GA 2GGRA 3CC4A 2DTHA 3MJXA 5IHIA 1VQLA 4DBRA 3L2QA 2RN8A 3RKWA 1Q81U 1G83A 2ZPFB 3ULRB 3WXMB 4M4ZA 2PVDB 1MV0B 3OA6A 2DKGA 1ZLMA 3X25B 1BI3A 3GIBA 2FG0A 1G8XA 3HHTB 3A5ZB 3LYIA 5GJVB 4DBFA 3NGPA 3OS1A 1WPYA 1RAAB 4PJNA 1VQ9Q 1Q82U 1Y07A 4LNPA 1VQKT 3OS2A 3FDRA 1LPLA 4M77A 2LT4A 1SSFA 3H0HA 1VQ8A 3INZA 1GCQC 5I22A 2RD1A 1WI7A 2X4JA 2AT1B 1N8RU 1Y71A 1KC8R 5A0LA 3QSUA 3FJPA 4JZ3A 2K2VA 2K3XA 3A8LB 3META 3CCLA 5I21A 4GLKA 2DTOA 3EFOA 3M0PA 2OJ2A 1ZSZC 3H9NA 2LQ8A 3MEAA 4F7UE 1IO6A 4PKCC 3EH1A 2FPDA 4OMQA 2P84A 4FM4B 5FRNA 1LOJA 3M4YA 1VQ5A 5KYWB 1KQSS 3H6ZA 4M7AG 1IXDA 2VXFA 2MOXA 4M7DC 1M5Q1 3OYNA 3CC2Q 2DXBA 4AFZC 2EVRA 2KXDA 3QO3A 1QVPA 2DXTA 1WJSA 2MWPA 1WJQA 1VQLT 1ZHIA 2EYXA 2DLPA 2EQKA 4E2FB 3RKXA 1JO8A 1T0JA 1QVFS 3I35A 1I4K1 2HQXA 5EG2A 4Z02A 4LDUA 3C94A 3DKMA 3VU3C 3QZ5B 4B9WA 1OZ3A 1H3ZA 1FXXA 5EC7A 1M90R 4D8KA 2GTOA 2LX7A 2EYWA 4J9BA 1VQNA 4F14A 1BI0A 2ABLA 1M9SA 2Y4XA 1GCQA 2C0IA 4F7UB 1VQ8T 4HXJA 4JRPA 4EMKC 2P0PA 4M75A 4OB1B 2ZPHB 3OYFA 3TCJA 3EGXA 5GJWB 3CCLT 2JUFA 3CCQA 2D1XA 3HRUA 3TSZA 4MMLA 2K2MA 2PNIA 4X1VA 3MPUB 3CQTA 1OEBA 1IGQA 4IUQA 1YJWQ 3I56A 1SPKA 1VQ6T 4M7DA 1ZUYA 2Y4YA 2DRMA 4A4HA 3JCMV 2QQBA 1HD3A 1WIEA 2DTIA 2JZ2A 3AT1B 1AD5A 4J9DA 5A0GA 1NJIU 3REBB 2JTMA 1M1FA 1YITA 3CCJA 1B34B 1X01A 1KD1R 4M77E 2ED1A 3VRYA 3LH5A 3GBQA 1UTIA 2KE9A 5D7UA 4FU6A 2MPXC 3KBGA 2KDSA 4KGZB 2NLUA 1PNJA 3HPWA 5CQYA 4E7IA 4OMMA 4RCCA 4OMLA 2E70A 2KT8A 4OGEA 4C8QD 2KR3A 2LQNA 3J81E 1VQNT 2VUBA 1WHJA 4PJOE 2ZPEB 1I81A 3EHRA 3PMIA 2YUPA 4EMKA 4M78D 2B8AA 1PHTA 2JMAA 2K4YA 2ZPBB 1UG1A 2JM8A 4NL3A 4JJBA 1PD0A 5GAMe 2LMJA 4XTYA 2K7AA 3CCQT 2J6KA 1VQ9A 1J3TA 5AT1B 2VGNA 3L1AA 4EPCA 2VXEA 5KCHA 2DIQA 1I0CA 3CMEQ 4RTUA 1NZ9A 1QKWA 1S72Q 3I56T 1G3WA 3M54A 3MO8A 1VUBA 1OV3A 4M77B 1M30A 1ZQ1A 4E7SA 1QVGA 3CCSQ 3G4SA 2NUTA 2IVWA 2ROTA 1IREB 1QKXA 4K11A 1UEBA 2CDTA 2O01E 2QYZA 3MKDA 2YT6A 1BCMA 2DAQA 3EFOB 4IIMA 2M51A 2NWMA 4HVUA 2YRVA 1ZBJA 4PJOB 1G5VA 2OX7A 2EGEA 1JXMA 4ZGJB 2GQVA 4M75E 2KI7A 1QMCA 1M1GA 2VWFA 2JM9A 2FRWA 1R77A 1LVKA 3FEOA 2OTJQ 1QW1A 3G71Q 4ZGEB 3MEWA 3TSWA 1YIJQ 2HL3A 2W0ZA 3SWNC 4OB0B 2QA4Q 2CYZB 1BYMA 2D8JA 4CRIA 1AWJA 5ECAA 4M7DE 4PNOA 4M7AA 2RJEA 4FT4A 3CPWP 4OB3B 5DLOA 2CREA 1Y7XA 5FU7B 3FJ5A 4XTUA 3V8KA 1H92A 2BUDA 4HVVA 1JU5C 5A2QE 4IUVA 1X27A 1UDLA 3QXEB 4LXCA 1VQ9T 4AFSC 5FWCA 2EYQA 5CQXA 2DMOA 3UA6A 5GANf 4C0GA 2K3BA 3CCUQ 2CKKA 3CCMA 5D6WA 3HRSA 2BZXA 1K73R 1PD1A 2LDMA 2DZCA 4L59A 1K9MR 2PUKB 3GF5A 1Q7YU 2MCNA 4R56A 4MMKA 3MP8A 2LCCA 4M75B 1ZSZB 4GY5A 3CXCA 4A63B 3EGXB 2VC8A 3MEUA 3MEVA 1Q86U 2F2VA 1TS9A 1YJWA 1TUDA 2P0KA 2PVGB 4UC4A 2GBQA 1U8RA 1N9RA 1CKBA 2O9SA 5IHKA 4XU3A 1F1BB 2V8KA 3QDFA 2M0YA 3CC2T 3EH2A 2HSEB 5AYFA 4M7DB 4C92C 4RTVA 2H3JA 1GRIA 2C0TA 1K1ZA 3OYCA 4PK4A 3E19A 1NPPA 2DZ9A 3I55Q 3SWNA 2RQTA 4M78F 4HCZA 2LP5A 5CAIA 4C5GA 2D8HA 1SHFA 2DBKA 2D6FA 1VQ7Q 1IRXA 4QQ6A 3L2UA 2AKLA 2QQSA 3FB9A 1FMWA 2A3LA 4IURA 3EGUA 4BACA 3M0RA 4OVAA 3JCMQ 2LJ0A 5IN1A 3GNFB 4RG8A 1G3YA 1ZSGA 3LX7A 1UUEA 4CI0C 2FPEA 3JCMJ 2LCLA 1ABQA 3EAEA 5KE3A 3WVDB 1NE8A 3UF4A 2I2LA 2MF2A 3EG3A 4EMKB 5GAOp 1OPKA 5GAOn 1P92A 4E47A 4J9CA 1TTHB 1GXIE 4Z88A 2DE0X 4JPBW 5DLQE 4PL6A 2XMFA 1SEMA 2EQMA 4FYVB 2HBWA 2DXUA 4HT8A
chains in the Genus database with same CATH topology
4J9HA 1E6GA 1IO6A 1RLQC 1T3SA 2HCKA 4F17A 2FPDA 4CC3A 4OMQA 2KXCA 1B3QA 1YWOA 3JV3A 2RMOA 2IIMA 1Z9QA 4F16A 3PVQA 1KIKA 3VS0A 2DM1A 2MOXA 5I11A 4RUGA 2JT4A 4AG2C 1SSHA 4AFZC 2EVRA 1X2KA 2LJ1A 2RNAA 2JS2A 2KXDA 3RBBB 3KFVA 2EQIA 2DILA 4KRTA 3VS4A 1JEGA 1MV3A 1AOJA 4QT7A 2EYXA 2LQWA 3VS3A 2DLPA 1TUCA 2AZSA 1WA7A 1AVZC 1JO8A 1T0JA 3I35A 1KJWA 2RQUA 3I9QA 2B86A 1X6BA 2J7IA 4JZ4A 1PRMC 4RTZA 2D0NA 5FW9A 1T3LA 2AZVA 1X43A 2L3PA 2LJ3A 2FEIA 4CC7A 2BTTA 5EC7A 1GBQA 3VRZA 4D8KA 2GTOA 2LX7A 2EYWA 1QWFA 4DEYA 2LNHB 4J9BA 3UATA 1SHGA 2X3XD 1M8MA 4LUEA 4F14A 2ABLA 1FYNA 4OMPA 2OAWA 1UHCA 1GCQA 1BBZA 1WXTA 4OMNA 2DL4A 5IXBA 2C0IA 2F2XA 2PZ1A 2CT4A 4HXJA 2EGAA 1AWOA 1BB9A 1V1CA 1PKSA 1VYUA 3I5SA 1YP5A 4WCIA 4ORZA 2O9VA 2OI3A 2MIOA 5GJWB 1NLPC 2A08A 2JTEA 1NLOC 3M0QA 2DL8A 2D1XA 3TSZA 1UECA 2K2MA 1NEGA 2PNIA 3EG0A 1UGVA 1NM7A 2K6DA 4X1VA 2KNBB 1AEYA 2F2WA 3CQTA 1ZUKA 1OEBA 1W6XA 1SPKA 2CUBA 1QCFA 2CUDA 3M0SA 1ZUYA 2DRMA 4RTTA 2KYMA 3EG1A 1HD3A 1WIEA 1M3CA 1AD5A 4J9DA 1AWXA 1K0XA 2RQWA 3REBB 1PKTA 1U5SA 3VS6A 2BZYA 4CC2A 4HCKA 2RQRA 3ZL7C 1I07A 2AK5A 2ED1A 1A0NB 1UJYA 3VRYA 1JXOA 3LH5A 1X6GA 1ZUUA 2I0NA 3GBQA 4LUDA 1UTIA 2KE9A 2YUOA 2O31A 3NMZC 4RTYA 4Y92A 1PWTA 1K76A 1PNJA 1NG2A 3A98A 4OMMA 2K9GA 2DNUA 4OMLA 4J9IA 1H8KA 5FWBA 2KRSA 2KT8A 1AZEA 2KR3A 2LQNA 2EBPA 1PRLC 1WFWA 2AKKA 2FRYA 2GTJA 2K79A 2LZ6B 2L3QA 2BZ8A 3VS1A 1UFFA 3EHRA 1OPLA 2YUPA 1KFZA 2KT1A 4FSSA 2CSQA 4ZNXA 1PHTA 2JMAA 1VA7A 2RQVA 2DVJA 2ECZA 1UG1A 1ARKA 1VYVA 2JM8A 4JJBA 1LCKA 1WDXA 1CSKA 1X2QA 3PVLA 1G2BA 2LMJA 3M0TA 2DL5A 2X3WD 2K7AA 2J6KA 2JS0A 1J3TA 2KRNA 2FO0A 1YCSB 3QWXX 4J9FA 1E7OA 2G6FX 3QWYA 2J05A 3EG2A 4LE9A 2L0AA 1CKAA 1AZGB 1I0CA 3H41A 1RUWA 3M0UA 2A37A 2EYZA 4RTUA 1QKWA 3SEMA 4RTXA 3NHNA 2EGCA 1ABOA 1WX6A 1OV3A 1M30A 1UJ0A 2L3SA 2KGTA 1QLYA 1YNZA 3U23A 2KROA 3VS2A 2ROTA 3SHWA 2KYBA 1QKXA 1T0HA 2HEQA 4K11A 2CDTA 2YDLA 2JXBA 2EKHA 2CH4A 1MUZA 2YT6A 4CC4B 3O5ZA 1VYTA 4IIMA 2M51A 2YSQA 4HVWA 2NWMA 4HVUA 2J06A 1K0SA 2VKNA 3TVTA 1ZBJA 2V1QA 2GNCA 1I1JA 2ED0A 1JXMA 2EGEA 1W1FA 4J9GA 2VWFA 2JM9A 1XOVA 3THKA 1K4US 2FRWA 3REAB 1YN8A 1U06A 1K9AA 2JW4A 4EIKA 4DEXA 1S1NA 2DA9A 2L2PA 3H0IA 3TSWA 2ENMA 2DBMA 2W0ZA 2D8JA 1AWJA 5ECAA 2P4RA 1BK2A 1WLPB 2CREA 3R6NA 2GQIA 1H92A 2HSPA 3FJ5A 2DRKA 4HVVA 1TG0A 1JU5C 3VS5A 4AG1C 1X27A 1EFNA 1UDLA 3EHQA 2E5KA 4R0KA 2QDLA 2ROLA 3H0FA 4AFSC 2SRCA 1YWPA 1M27C 2HDAA 5FWCA 1Y57A 2DMOA 2O88A 2LCSA 2DJQA 3UA6A 1ZX6A 5IXFA 1U3OA 2K3BA 4GLMA 4OMOA 2EW3A 1JQQA 2BZXA 3PE0A 4E6RA 2J6FA 1X69A 1M3AA 1H3HA 1RLPC 3RNJA 2ESWA 2YUNA 2MCNA 1GBRA 2VVKA 1HJDA 1SRLA 1E6HA 5HCKA 1OOTA 4A63B 1WXBA 2YUQA 2J6OA 2F2VA 1TUDA 2KEAA 2V1RA 2GBQA 3C0CA 1CKBA 1GL5A 1N5ZA 2C0OA 2O9SA 5IHKA 4Z89A 2SEMA 2KBTA 5IH2A 2M0YA 2H8HA 3I5RA 1SRMA 4J9EA 2RPNA 1WYXA 4RTVA 3UA7A 3NPFA 1GRIA 2C0TA 1K1ZA 4JJDA 2A28A 2JMCA 1GCPA 2KRMA 2DL3A 2RQTA 1HSQA 1FMKA 2GGRA 4ESRA 2EPDA 5IHIA 5IHNA 1NEBA 2RN8A 1KSWA 2RF0A 2LP5A 1G83A 1GFDA 2D8HA 3ULRB 2CT3A 4M4ZA 1W70A 1SHFA 4IIOA 1BU1A 2O2OA 1MV0B 2DBKA 2EYYA 1ZLMA 2DL7A 2FG0A 1B07A 2AKLA 1NYGA 2DYBA 5GJVB 1RI9A 3NGPA 1WXUA 1UHFA 4AFQC 4Z8AA 2PTKA 3EGUA 1NYFA 2A36A 1QWEA 3M0RA 4GBQA 4LN2A 4RTWA 1Y0MA 2LJ0A 1AWWA 4LNPA 1ZSGA 1GFCA 1UUEA 2FPEA 3H0HA 1ABQA 2NUZA 3UF4A 3EG3A 1UE9A 1GCQC 1OPKA 5I22A 1WI7A 2W10A 5L23A 4JJCA 4J9CA 4JZ3A 4AFUC 3IQLA 4Z88A 2DX1A 2DE0X 2DF6A 2CSIA 4JPBW 3VS7A 2XMFA 1SEMA 2CH4W 3M0PA 2OJ2A 1Z9ZA 2HBWA 4D8DA 2FPFA 1M3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9H A;  1E6G A;  1IO6 A;  1RLQ C;  1T3S A;  2HCK A;  4F17 A;  2FPD A;  4CC3 A;  4OMQ A;  2KXC A;  1B3Q A;  1YWO A;  3JV3 A;  2RMO A;  2IIM A;  1Z9Q A;  4F16 A;  3PVQ A;  1KIK A;  3VS0 A;  2DM1 A;  2MOX A;  5I11 A;  4RUG A;  2JT4 A;  4AG2 C;  1SSH A;  4AFZ C;  2EVR A;  1X2K A;  2LJ1 A;  2RNA A;  2JS2 A;  2KXD A;  3RBB B;  3KFV A;  2EQI A;  2DIL A;  4KRT A;  3VS4 A;  1JEG A;  1MV3 A;  1AOJ A;  4QT7 A;  2EYX A;  2LQW A;  3VS3 A;  2DLP A;  1TUC A;  2AZS A;  1WA7 A;  1AVZ C;  1JO8 A;  1T0J A;  3I35 A;  1KJW A;  2RQU A;  3I9Q A;  2B86 A;  1X6B A;  2J7I A;  4JZ4 A;  1PRM C;  4RTZ A;  2D0N A;  5FW9 A;  1T3L A;  2AZV A;  1X43 A;  2L3P A;  2LJ3 A;  2FEI A;  4CC7 A;  2BTT A;  5EC7 A;  1GBQ A;  3VRZ A;  4D8K A;  2GTO A;  2LX7 A;  2EYW A;  1QWF A;  4DEY A;  2LNH B;  4J9B A;  3UAT A;  1SHG A;  2X3X D;  1M8M A;  4LUE A;  4F14 A;  2ABL A;  1FYN A;  4OMP A;  2OAW A;  1UHC A;  1GCQ A;  1BBZ A;  1WXT A;  4OMN A;  2DL4 A;  5IXB A;  2C0I A;  2F2X A;  2PZ1 A;  2CT4 A;  4HXJ A;  2EGA A;  1AWO A;  1BB9 A;  1V1C A;  1PKS A;  1VYU A;  3I5S A;  1YP5 A;  4WCI A;  4ORZ A;  2O9V A;  2OI3 A;  2MIO A;  5GJW B;  1NLP C;  2A08 A;  2JTE A;  1NLO C;  3M0Q A;  2DL8 A;  2D1X A;  3TSZ A;  1UEC A;  2K2M A;  1NEG A;  2PNI A;  3EG0 A;  1UGV A;  1NM7 A;  2K6D A;  4X1V A;  2KNB B;  1AEY A;  2F2W A;  3CQT A;  1ZUK A;  1OEB A;  1W6X A;  1SPK A;  2CUB A;  1QCF A;  2CUD A;  3M0S A;  1ZUY A;  2DRM A;  4RTT A;  2KYM A;  3EG1 A;  1HD3 A;  1WIE A;  1M3C A;  1AD5 A;  4J9D A;  1AWX A;  1K0X A;  2RQW A;  3REB B;  1PKT A;  1U5S A;  3VS6 A;  2BZY A;  4CC2 A;  4HCK A;  2RQR A;  3ZL7 C;  1I07 A;  2AK5 A;  2ED1 A;  1A0N B;  1UJY A;  3VRY A;  1JXO A;  3LH5 A;  1X6G A;  1ZUU A;  2I0N A;  3GBQ A;  4LUD A;  1UTI A;  2KE9 A;  2YUO A;  2O31 A;  3NMZ C;  4RTY A;  4Y92 A;  1PWT A;  1K76 A;  1PNJ A;  1NG2 A;  3A98 A;  4OMM A;  2K9G A;  2DNU A;  4OML A;  4J9I A;  1H8K A;  5FWB A;  2KRS A;  2KT8 A;  1AZE A;  2KR3 A;  2LQN A;  2EBP A;  1PRL C;  1WFW A;  2AKK A;  2FRY A;  2GTJ A;  2K79 A;  2LZ6 B;  2L3Q A;  2BZ8 A;  3VS1 A;  1UFF A;  3EHR A;  1OPL A;  2YUP A;  1KFZ A;  2KT1 A;  4FSS A;  2CSQ A;  4ZNX A;  1PHT A;  2JMA A;  1VA7 A;  2RQV A;  2DVJ A;  2ECZ A;  1UG1 A;  1ARK A;  1VYV A;  2JM8 A;  4JJB A;  1LCK A;  1WDX A;  1CSK A;  1X2Q A;  3PVL A;  1G2B A;  2LMJ A;  3M0T A;  2DL5 A;  2X3W D;  2K7A A;  2J6K A;  2JS0 A;  1J3T A;  2KRN A;  2FO0 A;  1YCS B;  3QWX X;  4J9F A;  1E7O A;  2G6F X;  3QWY A;  2J05 A;  3EG2 A;  4LE9 A;  2L0A A;  1CKA A;  1AZG B;  1I0C A;  3H41 A;  1RUW A;  3M0U A;  2A37 A;  2EYZ A;  4RTU A;  1QKW A;  3SEM A;  4RTX A;  3NHN A;  2EGC A;  1ABO A;  1WX6 A;  1OV3 A;  1M30 A;  1UJ0 A;  2L3S A;  2KGT A;  1QLY A;  1YNZ A;  3U23 A;  2KRO A;  3VS2 A;  2ROT A;  3SHW A;  2KYB A;  1QKX A;  1T0H A;  2HEQ A;  4K11 A;  2CDT A;  2YDL A;  2JXB A;  2EKH A;  2CH4 A;  1MUZ A;  2YT6 A;  4CC4 B;  3O5Z A;  1VYT A;  4IIM A;  2M51 A;  2YSQ A;  4HVW A;  2NWM A;  4HVU A;  2J06 A;  1K0S A;  2VKN A;  3TVT A;  1ZBJ A;  2V1Q A;  2GNC A;  1I1J A;  2ED0 A;  1JXM A;  2EGE A;  1W1F A;  4J9G A;  2VWF A;  2JM9 A;  1XOV A;  3THK A;  1K4U S;  2FRW A;  3REA B;  1YN8 A;  1U06 A;  1K9A A;  2JW4 A;  4EIK A;  4DEX A;  1S1N A;  2DA9 A;  2L2P A;  3H0I A;  3TSW A;  2ENM A;  2DBM A;  2W0Z A;  2D8J A;  1AWJ A;  5ECA A;  2P4R A;  1BK2 A;  1WLP B;  2CRE A;  3R6N A;  2GQI A;  1H92 A;  2HSP A;  3FJ5 A;  2DRK A;  4HVV A;  1TG0 A;  1JU5 C;  3VS5 A;  4AG1 C;  1X27 A;  1EFN A;  1UDL A;  3EHQ A;  2E5K A;  4R0K A;  2QDL A;  2ROL A;  3H0F A;  4AFS C;  2SRC A;  1YWP A;  1M27 C;  2HDA A;  5FWC A;  1Y57 A;  2DMO A;  2O88 A;  2LCS A;  2DJQ A;  3UA6 A;  1ZX6 A;  5IXF A;  1U3O A;  2K3B A;  4GLM A;  4OMO A;  2EW3 A;  1JQQ A;  2BZX A;  3PE0 A;  4E6R A;  2J6F A;  1X69 A;  1M3A A;  1H3H A;  1RLP C;  3RNJ A;  2ESW A;  2YUN A;  2MCN A;  1GBR A;  2VVK A;  1HJD A;  1SRL A;  1E6H A;  5HCK A;  1OOT A;  4A63 B;  1WXB A;  2YUQ A;  2J6O A;  2F2V A;  1TUD A;  2KEA A;  2V1R A;  2GBQ A;  3C0C A;  1CKB A;  1GL5 A;  1N5Z A;  2C0O A;  2O9S A;  5IHK A;  4Z89 A;  2SEM A;  2KBT A;  5IH2 A;  2M0Y A;  2H8H A;  3I5R A;  1SRM A;  4J9E A;  2RPN A;  1WYX A;  4RTV A;  3UA7 A;  3NPF A;  1GRI A;  2C0T A;  1K1Z A;  4JJD A;  2A28 A;  2JMC A;  1GCP A;  2KRM A;  2DL3 A;  2RQT A;  1HSQ A;  1FMK A;  2GGR A;  4ESR A;  2EPD A;  5IHI A;  5IHN A;  1NEB A;  2RN8 A;  1KSW A;  2RF0 A;  2LP5 A;  1G83 A;  1GFD A;  2D8H A;  3ULR B;  2CT3 A;  4M4Z A;  1W70 A;  1SHF A;  4IIO A;  1BU1 A;  2O2O A;  1MV0 B;  2DBK A;  2EYY A;  1ZLM A;  2DL7 A;  2FG0 A;  1B07 A;  2AKL A;  1NYG A;  2DYB A;  5GJV B;  1RI9 A;  3NGP A;  1WXU A;  1UHF A;  4AFQ C;  4Z8A A;  2PTK A;  3EGU A;  1NYF A;  2A36 A;  1QWE A;  3M0R A;  4GBQ A;  4LN2 A;  4RTW A;  1Y0M A;  2LJ0 A;  1AWW A;  4LNP A;  1ZSG A;  1GFC A;  1UUE A;  2FPE A;  3H0H A;  1ABQ A;  2NUZ A;  3UF4 A;  3EG3 A;  1UE9 A;  1GCQ C;  1OPK A;  5I22 A;  1WI7 A;  2W10 A;  5L23 A;  4JJC A;  4J9C A;  4JZ3 A;  4AFU C;  3IQL A;  4Z88 A;  2DX1 A;  2DE0 X;  2DF6 A;  2CSI A;  4JPB W;  3VS7 A;  2XMF A;  1SEM A;  2CH4 W;  3M0P A;  2OJ2 A;  1Z9Z A;  2HBW A;  4D8D A;  2FPF A;  1M3B A; 
#chains in the Genus database with same CATH topology
 4J9H A;  1Y96 A;  1YJW T;  1B7T A;  4FW1 A;  5GAN h;  2OTL Q;  1T3S A;  4F17 A;  1WZO A;  2CP2 A;  4C8Q G;  3CCS A;  4OMF B;  2CZ7 B;  2YRC A;  3PMT A;  1D1A A;  4C92 A;  3OYJ A;  2RA2 A;  1RAE B;  4KH0 B;  3LLR A;  1KIK A;  4M77 C;  2QAS A;  8ATC B;  3JCM P;  2XID A;  4M78 G;  5I11 A;  2JT4 A;  2NUT B;  1SSH A;  2R5A A;  3OYY A;  1X2K A;  2RNA A;  2EIF A;  1JB0 E;  3N5B B;  1X75 C;  2COY A;  2D0Q B;  1KC8 C;  3FIF A;  4QT7 A;  1QCN A;  2AZS A;  1O9S A;  1AVZ C;  2R57 A;  1KJW A;  1OI1 A;  2RQU A;  3I9Q A;  4JZ4 A;  4FL6 A;  2H3E B;  4RTZ A;  1ZA1 B;  3UT1 A;  2D0N A;  5FW9 A;  2AZV A;  1K8A C;  1X43 A;  1N27 A;  2FEI A;  4FIB A;  4L5G A;  4ZTF A;  1GBQ A;  4X9D A;  3VRZ A;  1OU9 A;  1WQ7 A;  4NL2 A;  1YIJ A;  2LNH B;  3EG9 A;  2QA4 A;  1YJ9 Q;  2LNV A;  3BE3 A;  1BBZ A;  1WXT A;  3OYG A;  5LJ3 f;  1G3S A;  2RH2 A;  3VYG A;  2CT4 A;  1AWO A;  2CS7 A;  1V1C A;  3G6E Q;  1VQP A;  4BI3 A;  4LD6 A;  1W2B A;  2XDP A;  1IB8 A;  3I5S A;  1OX9 A;  1YP5 A;  5GAN 2;  2LTO A;  1XQH A;  5FU7 C;  3V7C A;  2A0F B;  3JCM X;  8AT1 B;  3OYH A;  2RJC A;  5GAO q;  4A54 A;  2F5T X;  3CME T;  4RG2 A;  1S72 T;  3EG0 A;  3J7A F;  3CBO A;  3JAM E;  2RHY A;  2KVQ G;  2ZGW A;  2BE9 B;  1M90 C;  2HQH A;  4FSX A;  3EFS A;  4E7J A;  1U1T A;  5CKB A;  1W6X A;  3CCS T;  3TU4 K;  5HK0 A;  1D0Z A;  3J80 E;  3LW5 E;  1BKB A;  5GAO l;  2HMA A;  2K3Y A;  2QEX Q;  4PFP A;  2YHT A;  2HNI A;  2QQ9 A;  3E1S A;  1U1S A;  2MWO A;  2QDY B;  1K0X A;  2RQW A;  2DER A;  2V26 A;  3VS6 A;  1MMN A;  4R55 A;  2WSE E;  5DM7 R;  3ER0 A;  4HCK A;  4M75 C;  2RQR A;  2E3I A;  1I07 A;  3NTI A;  2LC4 A;  4XTZ A;  3M58 A;  3M9Q A;  1PSF A;  1K8A R;  2DFU A;  4F04 B;  3M56 A;  1KQS P;  1VQ6 A;  5CCA A;  4RTY A;  3RMS A;  1PWT A;  1K76 A;  3RIR A;  2OTJ T;  3V7R A;  1EIF A;  4MZP A;  2X4X A;  2QGF B;  1Q81 R;  3JB9 I;  3L42 A;  4N0A C;  2ZPI B;  3A8G B;  3G71 T;  2XDD A;  4EMG A;  1H8K A;  3A8H B;  1YIJ T;  1TU0 B;  2QA4 T;  2EBP A;  3SWN B;  2YRD A;  2XKO C;  2BZ8 A;  1VQ7 A;  1QVF P;  4C92 E;  2KT1 A;  4FSS A;  4MDW A;  4C8Q C;  2MK5 A;  1VQP T;  3JCM f;  4DOV A;  1KD1 C;  1XJW B;  1WDX A;  2D9T A;  1Q82 R;  1TUG B;  1M2V A;  3P8B B;  1X2Q A;  3PVL A;  1G2B A;  2GFU A;  3OSV A;  4QKU A;  2DL5 A;  2X3W D;  2JS0 A;  1MMG A;  1YCY A;  3CCR Q;  3HL8 A;  4PJO D;  4J9F A;  3GNG A;  5GAN g;  1D1B A;  1N8R R;  1CKA A;  3FRN A;  1C6V X;  5LJ3 h;  3SEM A;  2GCX A;  2EGC A;  1WX6 A;  3TQ7 P;  1RAD B;  1KK7 A;  1UJ0 A;  2L3S A;  4J8O A;  2QTX A;  4F7U F;  2KRO A;  3SHW A;  3FLG A;  2KYB A;  1T0H A;  2HEQ A;  1H64 1;  1VQM Q;  2JXB A;  4FW2 A;  4E7K A;  2CH4 A;  3QKJ A;  2CP7 A;  2P0Q A;  1MUZ A;  4CC4 B;  5CKH A;  1YBY A;  2DIG A;  4ELY C;  1Y96 B;  4HVW A;  2IG0 A;  3VKI A;  2FZC B;  4KUL A;  3TVT A;  4KBM B;  5CKE A;  2V8I A;  3CCV Q;  4N0A A;  2AIR B;  4WTO B;  4C92 B;  4FT2 A;  1OX8 A;  3REA B;  3I55 T;  3OB9 A;  5GMK i;  4IUP A;  1K9A A;  2GF7 A;  3M55 A;  4DEX A;  4B9X A;  1BI2 A;  3H0I A;  2COW A;  3HFN A;  2JNG A;  4C8Q A;  2DBM A;  5GAN j;  4B6M A;  2RI5 A;  3DLM A;  1VQ7 T;  2P4R A;  1BK2 A;  1WLP B;  3OY9 A;  3R6N A;  2E1H A;  3HSB A;  1TG0 A;  5GAM g;  3EHQ A;  5GAN d;  2QDL A;  4RCB A;  4IKF A;  2HKQ B;  1BCO A;  1YWP A;  1Y57 A;  5C0M A;  2DJQ A;  1RL2 A;  1SF9 A;  1SG5 A;  2RM4 A;  3G6E A;  4GLM A;  2EW3 A;  3HTR A;  3CCE Q;  2CZ6 B;  3NFC A;  2PU9 B;  3OMC A;  4E6R A;  2J6F A;  4C0F A;  1R8O B;  5CIU A;  1X69 A;  2L89 A;  2QGG A;  1H3H A;  3CXC S;  2CZ0 B;  2ESW A;  2DD4 A;  2NYS A;  3PTA A;  4ZGD B;  2DD5 A;  5CR2 A;  3OYD A;  4M7A C;  4BDY A;  3L2W A;  4HT9 A;  5A0D A;  1WXB A;  3QZ9 B;  5FRO A;  1VQO Q;  3OQ5 A;  2OTL T;  2J6O A;  4A4E A;  2HQE A;  3SB2 A;  3CC7 Q;  2EQU A;  3C0C A;  1GL5 A;  1AT1 B;  2F69 A;  5HK3 A;  1VOM A;  1NJI R;  2JTF A;  5IH2 A;  4J9E A;  3CMA Q;  2BIV A;  2E41 A;  3AHU A;  3UA7 A;  4M77 F;  1K73 C;  4JS4 A;  2A28 A;  2JMC A;  4AMC A;  1K9M C;  2KRM A;  5CKF A;  1HSQ A;  1WQW A;  2XHC A;  5IT9 E;  1KSW A;  2RF0 A;  3M57 A;  1VIF A;  3RMQ A;  1VQK Q;  4IIO A;  1VQ4 Q;  5GAM d;  4C5H A;  1M2O A;  4J5Y A;  5GAN 5;  3CC2 A;  5FRM A;  1B07 A;  4PJO F;  3P8H A;  2DYB A;  2RI3 A;  1TWB A;  1YJ9 T;  1WXU A;  4ELZ C;  1UHF A;  1RAB B;  4AFQ C;  4Z8A A;  2PTK A;  3H8Z A;  2A36 A;  1QWE A;  3VUB A;  4GBQ A;  4LN2 A;  4ME7 A;  2E4H A;  2VYT A;  3BW1 A;  2L8D A;  5LJ3 g;  1AWW A;  3OS0 A;  3G6E T;  5IAY A;  1GFC A;  4KUI A;  5CK9 A;  3RKY A;  2NUZ A;  4BDZ A;  3A8M B;  1N9S A;  2W10 A;  3T9N A;  5HKC A;  3HKS A;  3IQL A;  2EJF A;  3A8O B;  2CSI A;  3VS7 A;  2HAX A;  1M2V B;  2CP3 A;  4LDY A;  2NUP A;  3C95 A;  1JJ2 P;  4V2S A;  3OW2 P;  1Z9Z A;  1JJ2 S;  4C8Q E;  3OW2 S;  3CC4 Q;  1OU8 A;  1E6G A;  1RLQ C;  2HCK A;  4XTW A;  2KXC A;  2QEX T;  3SDZ A;  1YHQ Q;  2KSS A;  1Z9Q A;  2E5Q A;  3M5A A;  3QJ6 A;  2MMP A;  1HK9 A;  1NBE B;  3M4G A;  1KQ1 A;  2LJ1 A;  1MMA A;  2JS2 A;  4C0D C;  3RBB B;  2EQI A;  2MI6 A;  7AT1 B;  3O8V A;  2DIL A;  4KRT A;  1NPR A;  4M75 F;  1JEG A;  1MV3 A;  2O4X A;  4DBH A;  3SD4 A;  2LQW A;  3VS3 A;  2C06 A;  4ATO A;  4BE0 A;  3EGD A;  5LJ3 j;  4PJO G;  4RMO A;  3S3N A;  1EZZ B;  1PRM C;  2JOY A;  4ZTJ A;  2L3P A;  1UGP B;  2LJ3 A;  4CC7 A;  3G7Z A;  1OQK A;  2LRQ A;  4QVZ A;  5LJ5 g;  4DEY A;  4M7D F;  3PNW C;  5LJ3 d;  1SHG A;  2VGM A;  1M8M A;  4LUE A;  3BDL A;  2MYS A;  4OMP A;  1W2B S;  3TEE A;  4A53 A;  4C8Q B;  1ACM B;  4OMN A;  2DL4 A;  5IXB A;  3JCM g;  4D6W A;  2PZ1 A;  3L2Z A;  1BB9 A;  1PKS A;  1VYU A;  4WCI A;  1VQ5 Q;  4NOY A;  5M9O A;  2HL5 C;  4BI4 A;  4JRK A;  3CCR T;  2MIO A;  1D09 B;  2E10 A;  2X4Y A;  4OF1 A;  1NLP C;  2A08 A;  4EMH A;  2QQR A;  2JTE A;  1NLO C;  3M0Q A;  5GAM f;  2Z0W A;  2M0O A;  1Q7Y R;  1UEC A;  1NEG A;  3RUX A;  4X9C A;  2VAS A;  3X26 B;  3QHS A;  3CCE A;  1NM7 A;  2K6D A;  1AEY A;  1ZUK A;  4BE1 A;  1M4Z A;  4X34 A;  5GAO m;  2CUB A;  1QCF A;  2CUD A;  2IPO B;  1M1K R;  2FVU A;  4RTT A;  4LDW A;  1Q86 R;  1UGR B;  3PT9 A;  3RER A;  3EG1 A;  1VQM T;  1M3C A;  1VQO A;  3PIP A;  4JS5 A;  1KHC A;  1IGU A;  1U5S A;  3OYK A;  2M02 A;  3CC7 A;  2BZY A;  4Y91 A;  4CC2 A;  4IUU A;  1R0C B;  3ZL7 C;  3CME A;  4DA4 A;  1VQN Q;  1WHM A;  1S72 A;  2RK1 A;  1A0N B;  2QI2 A;  1UJY A;  2EQJ A;  3CCV T;  1X6G A;  1ZUU A;  2I0N A;  4M7A E;  3OMG A;  2HKN A;  1WHG A;  4O6J A;  3V8L A;  3QDR B;  5LJ5 d;  3UWN A;  2M16 A;  2M1H A;  3CPW A;  4XTV A;  2DNU A;  4JLI A;  2LQK A;  4JRI A;  2KRS A;  4KGV B;  3CD6 Q;  3E2U A;  2A7Y A;  1UB4 A;  1PRL C;  1WFW A;  2AKK A;  3GP8 A;  2GTJ A;  3JCM d;  4HA8 A;  2M9U A;  2LZ6 B;  3VV0 A;  3VS1 A;  1MNE A;  1KFZ A;  1IHW A;  4ZNX A;  5D6X A;  1VA7 A;  2RQV A;  2DVJ A;  2ECZ A;  1VYV A;  3M59 A;  1LCK A;  3NTK A;  2OTJ A;  2JJ9 A;  3WVE B;  3RR6 A;  3M0T A;  2RHZ A;  4HCB A;  3G71 A;  1TOV A;  2E12 A;  3JSC A;  2KRN A;  2FO0 A;  1YCS B;  2K5F A;  3QWX X;  1YIT Q;  1E7O A;  1RI0 A;  2G6F X;  3QWY A;  3CCJ Q;  3EG2 A;  1TSF A;  2GFA A;  1KC8 U;  1Q81 C;  3M0U A;  3H41 A;  3CCE T;  1UGS B;  3OS5 A;  3UDC A;  2ATC B;  2A37 A;  1YI2 Q;  2EYZ A;  4RTX A;  1ABO A;  4FYW B;  2DJZ A;  4FCY A;  1QLY A;  4PJL A;  1YNZ A;  2LX9 A;  3U23 A;  4M7A B;  3VS2 A;  1AHJ B;  1K8A U;  2E6Z A;  1WGS A;  4KH1 B;  1PCX A;  2DEQ A;  1VQO T;  2KQW A;  2YDL A;  1SKU B;  5GAM h;  2DEU A;  3PFS A;  4XU2 A;  3CC7 T;  2NUP B;  1VYT A;  4PFO A;  1Q82 C;  2FZK B;  5CO7 A;  2X35 A;  3CCU A;  1YHQ A;  1N6A A;  1C0M A;  3MCA B;  3JB9 D;  3CBM A;  2VKN A;  1PC0 A;  3CMA T;  2FHD A;  2RHX A;  1I1J A;  1N8R C;  4PLL A;  5J3B A;  1XOV A;  2JVV A;  2CGH A;  3THK A;  2LT1 A;  1YJN Q;  1YN8 A;  1U06 A;  3V8J A;  2JW4 A;  3GOX A;  1D0Y A;  2QG9 B;  1IHV A;  1I8F A;  2RJF A;  3QBY A;  2ENM A;  3L2R A;  2FL7 A;  2EWN A;  2O4X B;  1VQ4 T;  1M90 U;  2YXY A;  3LWI A;  3OSS C;  2RHU A;  5GAN 4;  4QQG A;  3EGD B;  4N4G A;  3FC3 A;  4A4K A;  1VIE A;  1XNI A;  2GQI A;  3RES A;  1D0X A;  2DRK A;  4KT0 E;  3G4S Q;  3V7S A;  3CBP A;  1EFN A;  1JRI A;  3I55 A;  2KY9 A;  2E5K A;  2F1L A;  5GAN 6;  2CZ1 B;  2QXF A;  2L3R A;  3OYL A;  3H0F A;  2PQW A;  2XI9 A;  1TH7 A;  1M27 C;  2HDA A;  5LJ5 f;  4M77 D;  4PJO A;  1OUL A;  2RI2 A;  3PGG A;  3PE0 A;  4MZT A;  1XTD A;  3QJY A;  3HFO A;  1M3A A;  3RNJ A;  1MHN A;  5KE2 A;  1WHL A;  1MND A;  4N4I A;  2Y90 A;  2KMT A;  2YWW A;  1HJD A;  2QAZ A;  5HCK A;  2XD0 A;  4M78 C;  3A1P A;  3CC4 T;  1WJR A;  2K57 A;  3CEY A;  4BY6 B;  1KQ2 A;  2HBP A;  2KEA A;  5CKD A;  1QVG P;  3KUF A;  3CCU T;  1YHQ T;  1Q95 G;  1V29 B;  1QVG S;  2C0O A;  5LL6 S;  2SEM A;  5DY9 A;  4E7L A;  2H8H A;  3I5R A;  3BDU A;  1KD1 U;  2MAM A;  1WYX A;  4JJD A;  3ZEH A;  4C0D B;  1MMD A;  1IZ6 A;  4J6W A;  1GCP A;  1FMK A;  4ESR A;  4OP0 A;  5FU6 C;  2EPD A;  5IHN A;  5I2S A;  3CPF A;  3LGF A;  2OTL A;  1NEB A;  2CP0 A;  2DVE A;  1D1C A;  4XTX A;  1GFD A;  3R6O A;  2CT3 A;  1W70 A;  1BU1 A;  2O2O A;  3QYH B;  4C5E A;  3CCM Q;  2EYY A;  2EFI A;  2YLC A;  2DL7 A;  1ZSZ A;  5KYX A;  2WSF E;  3OYM A;  3CD6 A;  1NYG A;  4XU1 A;  2E6N A;  5GMK h;  1RI9 A;  1NJI C;  4C92 F;  2RK2 A;  3VUZ A;  3JCM W;  2X4W A;  4FYX B;  1NYF A;  2HZY A;  2LVM A;  5GAN e;  3GLX A;  3QUI A;  3LWH A;  4RTW A;  1Y0M A;  5J26 A;  4Y28 E;  1RAC B;  3OBY A;  3D7S B;  1VQ5 T;  2PVO B;  3ASK A;  4C0Z A;  4RKU E;  3C4S A;  1UE9 A;  3QPH A;  4M75 D;  3URG A;  4AT1 B;  5L23 A;  4JJC A;  4M78 A;  4AFU C;  2DX1 A;  2AHJ B;  2DF6 A;  5KYY A;  5GAO r;  2BKD N;  9ATC B;  2CH4 W;  1YJ9 A;  4D8D A;  4OB2 B;  2FPF A;  3JB9 F;  5LJ5 h;  1M3B A;  1YI2 A;  3OYA A;  1OYX A;  5J39 A;  1OZ2 A;  4C5I A;  3QG1 A;  3EG9 B;  3VYH B;  2PUO B;  4CC3 A;  4M7D D;  1B3Q A;  4F7U G;  1YWO A;  2OAU A;  3JV3 A;  2RMO A;  2RB6 A;  2IIM A;  3JCM h;  3CXC P;  1I5L A;  4F16 A;  2XDB A;  3PVQ A;  4J7F A;  3JB9 H;  3VS0 A;  2DM1 A;  4RUG A;  1RAG B;  4AG2 C;  1HYO A;  1KQS A;  3KFV A;  3SFM A;  4P5N A;  2VB6 A;  3GPL A;  1MGQ A;  3VS4 A;  1AOJ A;  2E65 A;  1DJ7 B;  4A4F A;  4N4H A;  3VJP A;  1TUC A;  1WA7 A;  4II1 A;  2YLB A;  1G3T A;  2RO0 A;  6AT1 B;  2B86 A;  1X6B A;  2J7I A;  5L8R E;  3KXT A;  2QEX A;  4WF2 A;  2EJ9 A;  2ZPG B;  4C92 G;  1YJN A;  1W4S A;  1BIA A;  1T3L A;  4J83 A;  2FZG B;  1QVF A;  3CD6 T;  2BTT A;  1KG1 A;  2DET A;  4XU0 A;  1QWF A;  3UAT A;  5GAM j;  2X3X D;  4A4G A;  3LGL A;  2CP6 A;  1FYN A;  3PIO A;  2OAW A;  1UHC A;  2CP5 A;  4JLG A;  4MDX A;  4QVD A;  2F2X A;  2QK0 A;  4IUT A;  2EGA A;  1RAI B;  3M53 A;  1D3B A;  3QYG B;  4JUV A;  3DB3 A;  4ORZ A;  4J7I A;  2O9V A;  3JB9 G;  2OI3 A;  2COZ A;  5I2M A;  5KCO A;  2E64 A;  1YIT T;  3CCJ T;  1K73 U;  2E3H A;  4O5V A;  4XQ3 A;  2DL8 A;  1K9M U;  3X28 B;  1YI2 T;  1QP2 A;  1UGV A;  2KNB B;  2ZAE A;  1BIB A;  2F2W A;  2DO3 A;  4EDU A;  3NTH A;  2XIC A;  5KYU A;  3M0S A;  3E9F A;  2ZZD A;  2KYM A;  4TVR A;  2P4T A;  2L5Q A;  1PG5 B;  4OGC A;  5HY6 A;  1ZBX A;  1AWX A;  4BUG A;  3CCR A;  1PKT A;  2RJD A;  3JB9 J;  2V8J A;  4QW2 A;  4ANJ A;  4JDS A;  5GAN 8;  2AK5 A;  4QVC A;  1JXO A;  4BY6 C;  1VQL Q;  4Q5W A;  4ZN3 A;  3EFR A;  4LUD A;  2YUO A;  2O31 A;  3CPW S;  4M77 G;  3NMZ C;  1Q7Y C;  3OBW A;  1YJN T;  4M78 E;  4Y92 A;  1VQP Q;  1NG2 A;  5CVI A;  1VQM A;  1YFN A;  2KAF A;  3A98 A;  2K9G A;  4J9I A;  1M1K C;  5FWB A;  1Q86 C;  1AZE A;  3F70 A;  5GMK m;  5LJ3 e;  2FRY A;  4E7H A;  2WSC E;  4BE2 A;  2K79 A;  4HKE A;  2EKO A;  2L3Q A;  4M7A D;  3MP6 A;  1UFF A;  1OPL A;  3CCV A;  2CSQ A;  5GAN 7;  1EX4 A;  1M8V A;  1ZA2 B;  3G4S T;  1ARK A;  4KUD K;  4L6V 5;  1QP3 A;  1VQ8 Q;  1KHI A;  1CSK A;  1R0B G;  5KYX B;  1M1K U;  4BB7 A;  2R5M A;  1FX7 A;  3OYI A;  3CCL Q;  4VUB A;  2FYK A;  1I5O B;  2J05 A;  2X51 A;  4LE9 A;  2L0A A;  2RHI A;  1AZG B;  3JCM b;  1RUW A;  1W2B P;  1QCO A;  3HRT A;  5GAN 3;  1BI1 A;  3C12 A;  2EJG A;  4LDX A;  3X24 B;  3NHN A;  5KYW A;  2XK0 A;  5GMK e;  3P8D A;  3TRE A;  4C8Q F;  2KGT A;  3RDV A;  1VQ6 Q;  1LJO A;  4XAX B;  4E7Z A;  3MP1 A;  2QQA A;  1O75 A;  3MHX A;  4M78 B;  5GMK j;  1PSE A;  2EKH A;  1PM3 A;  5KYY B;  3O5Z A;  3JRZ A;  4HCC A;  2ZCF B;  4DOW A;  2YSQ A;  3UPU A;  3S3M A;  2QTV A;  4XK8 E;  1JBM A;  2EAY A;  2J06 A;  1K0S A;  1V76 A;  2V1Q A;  2GNC A;  2DK3 A;  2XU8 A;  2ED0 A;  3DLL A;  1W1F A;  4JJN K;  4J9G A;  2DYI A;  4FYY B;  1K4U S;  3OYE A;  5LJ5 e;  2R58 A;  4M75 G;  4EIK A;  4J6Y A;  5FU6 B;  1S1N A;  2DA9 A;  2L2P A;  2F5K A;  5FLX E;  5LJ5 j;  4F7U A;  3G1J A;  3CCM T;  1HXD A;  3JCM e;  4DQ2 A;  1WHK A;  3S6W A;  4ZN1 A;  2VV5 A;  3DB4 A;  1X6O A;  3CMA A;  2HSP A;  2BE7 D;  4M7D G;  4AG1 C;  4LD9 K;  2JN0 A;  3QII A;  2FB7 A;  3VS5 A;  4LDV A;  2HD0 A;  4R0K A;  2ROL A;  4MZM A;  4NS5 A;  4PJM A;  2SRC A;  4DBQ A;  3CCQ Q;  2O88 A;  4PLI A;  2LCS A;  2DPP B;  1QQJ A;  3JCM c;  4BI8 B;  1ZX6 A;  4YTL A;  5IXF A;  4BD3 A;  1VQK A;  1JJ2 A;  4JRQ A;  1U3O A;  3OW2 A;  4OMO A;  5GMK l;  1VQ4 A;  1JQQ A;  4J6X A;  2KK4 A;  1WNL A;  3I56 Q;  1RLP C;  2YUN A;  2DXC A;  1RAH B;  1D3B B;  2WAC A;  3ZFJ A;  3BFM A;  1TXQ A;  1GBR A;  2VVK A;  5C6S A;  1SRL A;  3L2V A;  1E6H A;  3HP9 A;  1B34 A;  1OOT A;  4QQD A;  2YUQ A;  1UGQ B;  2K5L A;  3Q1J A;  2X9H A;  3S3O A;  1FMV A;  4PJJ A;  2V1R A;  2XG8 D;  3OYB A;  4C92 D;  1N5Z A;  2G3R A;  3BY7 A;  1LNX A;  4Z89 A;  2KBT A;  4PFZ A;  4PJO C;  5KYU B;  3ME9 A;  2K5I A;  1FWZ A;  1SRM A;  3ZBD A;  2RPN A;  3LH0 A;  3NPF A;  3X20 B;  1C1A A;  5KH6 A;  4KGX B;  5KYN A;  1WHH A;  4M7A F;  5D6Y A;  1RAF B;  2DL3 A;  3E9G A;  2GGR A;  3CC4 A;  2DTH A;  3MJX A;  5IHI A;  1VQL A;  4DBR A;  3L2Q A;  2RN8 A;  3RKW A;  1Q81 U;  1G83 A;  2ZPF B;  3ULR B;  3WXM B;  4M4Z A;  2PVD B;  1MV0 B;  3OA6 A;  2DKG A;  1ZLM A;  3X25 B;  1BI3 A;  3GIB A;  2FG0 A;  1G8X A;  3HHT B;  3A5Z B;  3LYI A;  5GJV B;  4DBF A;  3NGP A;  3OS1 A;  1WPY A;  1RAA B;  4PJN A;  1VQ9 Q;  1Q82 U;  1Y07 A;  4LNP A;  1VQK T;  3OS2 A;  3FDR A;  1LPL A;  4M77 A;  2LT4 A;  1SSF A;  3H0H A;  1VQ8 A;  3INZ A;  1GCQ C;  5I22 A;  2RD1 A;  1WI7 A;  2X4J A;  2AT1 B;  1N8R U;  1Y71 A;  1KC8 R;  5A0L A;  3QSU A;  3FJP A;  4JZ3 A;  2K2V A;  2K3X A;  3A8L B;  3MET A;  3CCL A;  5I21 A;  4GLK A;  2DTO A;  3EFO A;  3M0P A;  2OJ2 A;  1ZSZ C;  3H9N A;  2LQ8 A;  3MEA A;  4F7U E;  1IO6 A;  4PKC C;  3EH1 A;  2FPD A;  4OMQ A;  2P84 A;  4FM4 B;  5FRN A;  1LOJ A;  3M4Y A;  1VQ5 A;  5KYW B;  1KQS S;  3H6Z A;  4M7A G;  1IXD A;  2VXF A;  2MOX A;  4M7D C;  1M5Q 1;  3OYN A;  3CC2 Q;  2DXB A;  4AFZ C;  2EVR A;  2KXD A;  3QO3 A;  1QVP A;  2DXT A;  1WJS A;  2MWP A;  1WJQ A;  1VQL T;  1ZHI A;  2EYX A;  2DLP A;  2EQK A;  4E2F B;  3RKX A;  1JO8 A;  1T0J A;  1QVF S;  3I35 A;  1I4K 1;  2HQX A;  5EG2 A;  4Z02 A;  4LDU A;  3C94 A;  3DKM A;  3VU3 C;  3QZ5 B;  4B9W A;  1OZ3 A;  1H3Z A;  1FXX A;  5EC7 A;  1M90 R;  4D8K A;  2GTO A;  2LX7 A;  2EYW A;  4J9B A;  1VQN A;  4F14 A;  1BI0 A;  2ABL A;  1M9S A;  2Y4X A;  1GCQ A;  2C0I A;  4F7U B;  1VQ8 T;  4HXJ A;  4JRP A;  4EMK C;  2P0P A;  4M75 A;  4OB1 B;  2ZPH B;  3OYF A;  3TCJ A;  3EGX A;  5GJW B;  3CCL T;  2JUF A;  3CCQ A;  2D1X A;  3HRU A;  3TSZ A;  4MML A;  2K2M A;  2PNI A;  4X1V A;  3MPU B;  3CQT A;  1OEB A;  1IGQ A;  4IUQ A;  1YJW Q;  3I56 A;  1SPK A;  1VQ6 T;  4M7D A;  1ZUY A;  2Y4Y A;  2DRM A;  4A4H A;  3JCM V;  2QQB A;  1HD3 A;  1WIE A;  2DTI A;  2JZ2 A;  3AT1 B;  1AD5 A;  4J9D A;  5A0G A;  1NJI U;  3REB B;  2JTM A;  1M1F A;  1YIT A;  3CCJ A;  1B34 B;  1X01 A;  1KD1 R;  4M77 E;  2ED1 A;  3VRY A;  3LH5 A;  3GBQ A;  1UTI A;  2KE9 A;  5D7U A;  4FU6 A;  2MPX C;  3KBG A;  2KDS A;  4KGZ B;  2NLU A;  1PNJ A;  3HPW A;  5CQY A;  4E7I A;  4OMM A;  4RCC A;  4OML A;  2E70 A;  2KT8 A;  4OGE A;  4C8Q D;  2KR3 A;  2LQN A;  3J81 E;  1VQN T;  2VUB A;  1WHJ A;  4PJO E;  2ZPE B;  1I81 A;  3EHR A;  3PMI A;  2YUP A;  4EMK A;  4M78 D;  2B8A A;  1PHT A;  2JMA A;  2K4Y A;  2ZPB B;  1UG1 A;  2JM8 A;  4NL3 A;  4JJB A;  1PD0 A;  5GAM e;  2LMJ A;  4XTY A;  2K7A A;  3CCQ T;  2J6K A;  1VQ9 A;  1J3T A;  5AT1 B;  2VGN A;  3L1A A;  4EPC A;  2VXE A;  5KCH A;  2DIQ A;  1I0C A;  3CME Q;  4RTU A;  1NZ9 A;  1QKW A;  1S72 Q;  3I56 T;  1G3W A;  3M54 A;  3MO8 A;  1VUB A;  1OV3 A;  4M77 B;  1M30 A;  1ZQ1 A;  4E7S A;  1QVG A;  3CCS Q;  3G4S A;  2NUT A;  2IVW A;  2ROT A;  1IRE B;  1QKX A;  4K11 A;  1UEB A;  2CDT A;  2O01 E;  2QYZ A;  3MKD A;  2YT6 A;  1BCM A;  2DAQ A;  3EFO B;  4IIM A;  2M51 A;  2NWM A;  4HVU A;  2YRV A;  1ZBJ A;  4PJO B;  1G5V A;  2OX7 A;  2EGE A;  1JXM A;  4ZGJ B;  2GQV A;  4M75 E;  2KI7 A;  1QMC A;  1M1G A;  2VWF A;  2JM9 A;  2FRW A;  1R77 A;  1LVK A;  3FEO A;  2OTJ Q;  1QW1 A;  3G71 Q;  4ZGE B;  3MEW A;  3TSW A;  1YIJ Q;  2HL3 A;  2W0Z A;  3SWN C;  4OB0 B;  2QA4 Q;  2CYZ B;  1BYM A;  2D8J A;  4CRI A;  1AWJ A;  5ECA A;  4M7D E;  4PNO A;  4M7A A;  2RJE A;  4FT4 A;  3CPW P;  4OB3 B;  5DLO A;  2CRE A;  1Y7X A;  5FU7 B;  3FJ5 A;  4XTU A;  3V8K A;  1H92 A;  2BUD A;  4HVV A;  1JU5 C;  5A2Q E;  4IUV A;  1X27 A;  1UDL A;  3QXE B;  4LXC A;  1VQ9 T;  4AFS C;  5FWC A;  2EYQ A;  5CQX A;  2DMO A;  3UA6 A;  5GAN f;  4C0G A;  2K3B A;  3CCU Q;  2CKK A;  3CCM A;  5D6W A;  3HRS A;  2BZX A;  1K73 R;  1PD1 A;  2LDM A;  2DZC A;  4L59 A;  1K9M R;  2PUK B;  3GF5 A;  1Q7Y U;  2MCN A;  4R56 A;  4MMK A;  3MP8 A;  2LCC A;  4M75 B;  1ZSZ B;  4GY5 A;  3CXC A;  4A63 B;  3EGX B;  2VC8 A;  3MEU A;  3MEV A;  1Q86 U;  2F2V A;  1TS9 A;  1YJW A;  1TUD A;  2P0K A;  2PVG B;  4UC4 A;  2GBQ A;  1U8R A;  1N9R A;  1CKB A;  2O9S A;  5IHK A;  4XU3 A;  1F1B B;  2V8K A;  3QDF A;  2M0Y A;  3CC2 T;  3EH2 A;  2HSE B;  5AYF A;  4M7D B;  4C92 C;  4RTV A;  2H3J A;  1GRI A;  2C0T A;  1K1Z A;  3OYC A;  4PK4 A;  3E19 A;  1NPP A;  2DZ9 A;  3I55 Q;  3SWN A;  2RQT A;  4M78 F;  4HCZ A;  2LP5 A;  5CAI A;  4C5G A;  2D8H A;  1SHF A;  2DBK A;  2D6F A;  1VQ7 Q;  1IRX A;  4QQ6 A;  3L2U A;  2AKL A;  2QQS A;  3FB9 A;  1FMW A;  2A3L A;  4IUR A;  3EGU A;  4BAC A;  3M0R A;  4OVA A;  3JCM Q;  2LJ0 A;  5IN1 A;  3GNF B;  4RG8 A;  1G3Y A;  1ZSG A;  3LX7 A;  1UUE A;  4CI0 C;  2FPE A;  3JCM J;  2LCL A;  1ABQ A;  3EAE A;  5KE3 A;  3WVD B;  1NE8 A;  3UF4 A;  2I2L A;  2MF2 A;  3EG3 A;  4EMK B;  5GAO p;  1OPK A;  5GAO n;  1P92 A;  4E47 A;  4J9C A;  1TTH B;  1GXI E;  4Z88 A;  2DE0 X;  4JPB W;  5DLQ E;  4PL6 A;  2XMF A;  1SEM A;  2EQM A;  4FYV B;  2HBW A;  2DXU A;  4HT8 A; 
#chains in the Genus database with same CATH homology
 4J9H A;  1E6G A;  1IO6 A;  1RLQ C;  1T3S A;  2HCK A;  4F17 A;  2FPD A;  4CC3 A;  4OMQ A;  2KXC A;  1B3Q A;  1YWO A;  3JV3 A;  2RMO A;  2IIM A;  1Z9Q A;  4F16 A;  3PVQ A;  1KIK A;  3VS0 A;  2DM1 A;  2MOX A;  5I11 A;  4RUG A;  2JT4 A;  4AG2 C;  1SSH A;  4AFZ C;  2EVR A;  1X2K A;  2LJ1 A;  2RNA A;  2JS2 A;  2KXD A;  3RBB B;  3KFV A;  2EQI A;  2DIL A;  4KRT A;  3VS4 A;  1JEG A;  1MV3 A;  1AOJ A;  4QT7 A;  2EYX A;  2LQW A;  3VS3 A;  2DLP A;  1TUC A;  2AZS A;  1WA7 A;  1AVZ C;  1JO8 A;  1T0J A;  3I35 A;  1KJW A;  2RQU A;  3I9Q A;  2B86 A;  1X6B A;  2J7I A;  4JZ4 A;  1PRM C;  4RTZ A;  2D0N A;  5FW9 A;  1T3L A;  2AZV A;  1X43 A;  2L3P A;  2LJ3 A;  2FEI A;  4CC7 A;  2BTT A;  5EC7 A;  1GBQ A;  3VRZ A;  4D8K A;  2GTO A;  2LX7 A;  2EYW A;  1QWF A;  4DEY A;  2LNH B;  4J9B A;  3UAT A;  1SHG A;  2X3X D;  1M8M A;  4LUE A;  4F14 A;  2ABL A;  1FYN A;  4OMP A;  2OAW A;  1UHC A;  1GCQ A;  1BBZ A;  1WXT A;  4OMN A;  2DL4 A;  5IXB A;  2C0I A;  2F2X A;  2PZ1 A;  2CT4 A;  4HXJ A;  2EGA A;  1AWO A;  1BB9 A;  1V1C A;  1PKS A;  1VYU A;  3I5S A;  1YP5 A;  4WCI A;  4ORZ A;  2O9V A;  2OI3 A;  2MIO A;  5GJW B;  1NLP C;  2A08 A;  2JTE A;  1NLO C;  3M0Q A;  2DL8 A;  2D1X A;  3TSZ A;  1UEC A;  2K2M A;  1NEG A;  2PNI A;  3EG0 A;  1UGV A;  1NM7 A;  2K6D A;  4X1V A;  2KNB B;  1AEY A;  2F2W A;  3CQT A;  1ZUK A;  1OEB A;  1W6X A;  1SPK A;  2CUB A;  1QCF A;  2CUD A;  3M0S A;  1ZUY A;  2DRM A;  4RTT A;  2KYM A;  3EG1 A;  1HD3 A;  1WIE A;  1M3C A;  1AD5 A;  4J9D A;  1AWX A;  1K0X A;  2RQW A;  3REB B;  1PKT A;  1U5S A;  3VS6 A;  2BZY A;  4CC2 A;  4HCK A;  2RQR A;  3ZL7 C;  1I07 A;  2AK5 A;  2ED1 A;  1A0N B;  1UJY A;  3VRY A;  1JXO A;  3LH5 A;  1X6G A;  1ZUU A;  2I0N A;  3GBQ A;  4LUD A;  1UTI A;  2KE9 A;  2YUO A;  2O31 A;  3NMZ C;  4RTY A;  4Y92 A;  1PWT A;  1K76 A;  1PNJ A;  1NG2 A;  3A98 A;  4OMM A;  2K9G A;  2DNU A;  4OML A;  4J9I A;  1H8K A;  5FWB A;  2KRS A;  2KT8 A;  1AZE A;  2KR3 A;  2LQN A;  2EBP A;  1PRL C;  1WFW A;  2AKK A;  2FRY A;  2GTJ A;  2K79 A;  2LZ6 B;  2L3Q A;  2BZ8 A;  3VS1 A;  1UFF A;  3EHR A;  1OPL A;  2YUP A;  1KFZ A;  2KT1 A;  4FSS A;  2CSQ A;  4ZNX A;  1PHT A;  2JMA A;  1VA7 A;  2RQV A;  2DVJ A;  2ECZ A;  1UG1 A;  1ARK A;  1VYV A;  2JM8 A;  4JJB A;  1LCK A;  1WDX A;  1CSK A;  1X2Q A;  3PVL A;  1G2B A;  2LMJ A;  3M0T A;  2DL5 A;  2X3W D;  2K7A A;  2J6K A;  2JS0 A;  1J3T A;  2KRN A;  2FO0 A;  1YCS B;  3QWX X;  4J9F A;  1E7O A;  2G6F X;  3QWY A;  2J05 A;  3EG2 A;  4LE9 A;  2L0A A;  1CKA A;  1AZG B;  1I0C A;  3H41 A;  1RUW A;  3M0U A;  2A37 A;  2EYZ A;  4RTU A;  1QKW A;  3SEM A;  4RTX A;  3NHN A;  2EGC A;  1ABO A;  1WX6 A;  1OV3 A;  1M30 A;  1UJ0 A;  2L3S A;  2KGT A;  1QLY A;  1YNZ A;  3U23 A;  2KRO A;  3VS2 A;  2ROT A;  3SHW A;  2KYB A;  1QKX A;  1T0H A;  2HEQ A;  4K11 A;  2CDT A;  2YDL A;  2JXB A;  2EKH A;  2CH4 A;  1MUZ A;  2YT6 A;  4CC4 B;  3O5Z A;  1VYT A;  4IIM A;  2M51 A;  2YSQ A;  4HVW A;  2NWM A;  4HVU A;  2J06 A;  1K0S A;  2VKN A;  3TVT A;  1ZBJ A;  2V1Q A;  2GNC A;  1I1J A;  2ED0 A;  1JXM A;  2EGE A;  1W1F A;  4J9G A;  2VWF A;  2JM9 A;  1XOV A;  3THK A;  1K4U S;  2FRW A;  3REA B;  1YN8 A;  1U06 A;  1K9A A;  2JW4 A;  4EIK A;  4DEX A;  1S1N A;  2DA9 A;  2L2P A;  3H0I A;  3TSW A;  2ENM A;  2DBM A;  2W0Z A;  2D8J A;  1AWJ A;  5ECA A;  2P4R A;  1BK2 A;  1WLP B;  2CRE A;  3R6N A;  2GQI A;  1H92 A;  2HSP A;  3FJ5 A;  2DRK A;  4HVV A;  1TG0 A;  1JU5 C;  3VS5 A;  4AG1 C;  1X27 A;  1EFN A;  1UDL A;  3EHQ A;  2E5K A;  4R0K A;  2QDL A;  2ROL A;  3H0F A;  4AFS C;  2SRC A;  1YWP A;  1M27 C;  2HDA A;  5FWC A;  1Y57 A;  2DMO A;  2O88 A;  2LCS A;  2DJQ A;  3UA6 A;  1ZX6 A;  5IXF A;  1U3O A;  2K3B A;  4GLM A;  4OMO A;  2EW3 A;  1JQQ A;  2BZX A;  3PE0 A;  4E6R A;  2J6F A;  1X69 A;  1M3A A;  1H3H A;  1RLP C;  3RNJ A;  2ESW A;  2YUN A;  2MCN A;  1GBR A;  2VVK A;  1HJD A;  1SRL A;  1E6H A;  5HCK A;  1OOT A;  4A63 B;  1WXB A;  2YUQ A;  2J6O A;  2F2V A;  1TUD A;  2KEA A;  2V1R A;  2GBQ A;  3C0C A;  1CKB A;  1GL5 A;  1N5Z A;  2C0O A;  2O9S A;  5IHK A;  4Z89 A;  2SEM A;  2KBT A;  5IH2 A;  2M0Y A;  2H8H A;  3I5R A;  1SRM A;  4J9E A;  2RPN A;  1WYX A;  4RTV A;  3UA7 A;  3NPF A;  1GRI A;  2C0T A;  1K1Z A;  4JJD A;  2A28 A;  2JMC A;  1GCP A;  2KRM A;  2DL3 A;  2RQT A;  1HSQ A;  1FMK A;  2GGR A;  4ESR A;  2EPD A;  5IHI A;  5IHN A;  1NEB A;  2RN8 A;  1KSW A;  2RF0 A;  2LP5 A;  1G83 A;  1GFD A;  2D8H A;  3ULR B;  2CT3 A;  4M4Z A;  1W70 A;  1SHF A;  4IIO A;  1BU1 A;  2O2O A;  1MV0 B;  2DBK A;  2EYY A;  1ZLM A;  2DL7 A;  2FG0 A;  1B07 A;  2AKL A;  1NYG A;  2DYB A;  5GJV B;  1RI9 A;  3NGP A;  1WXU A;  1UHF A;  4AFQ C;  4Z8A A;  2PTK A;  3EGU A;  1NYF A;  2A36 A;  1QWE A;  3M0R A;  4GBQ A;  4LN2 A;  4RTW A;  1Y0M A;  2LJ0 A;  1AWW A;  4LNP A;  1ZSG A;  1GFC A;  1UUE A;  2FPE A;  3H0H A;  1ABQ A;  2NUZ A;  3UF4 A;  3EG3 A;  1UE9 A;  1GCQ C;  1OPK A;  5I22 A;  1WI7 A;  2W10 A;  5L23 A;  4JJC A;  4J9C A;  4JZ3 A;  4AFU C;  3IQL A;  4Z88 A;  2DX1 A;  2DE0 X;  2DF6 A;  2CSI A;  4JPB W;  3VS7 A;  2XMF A;  1SEM A;  2CH4 W;  3M0P A;  2OJ2 A;  1Z9Z A;  2HBW A;  4D8D A;  2FPF A;  1M3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...