4AFQC

Human chymase - fynomer complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
VTLFVALYDYQADRWTDLSFHKGEKFQILDASPPGDWWEARSLTTGETGYIPSNYVAPVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 12
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afqC00
4JZ4A 1U3OA 2F2VA 1MV3A 2KT8A 4CC7A 2ROLA 1K1ZA 2YUQA 3H0IA 5IHIA 2EYYA 2L2PA 3EGUA 2CREA 2LMJA 4JPBW 1AWXA 1EFNA 2GGRA 3UF4A 1W1FA 2CT4A 2FRWA 2PZ1A 3QWXX 1T3LA 2RQRA 2VVKA 3H0HA 2LX7A 1YP5A 4ORZA 2JS2A 2GTJA 1UECA 2EW3A 2RQUA 5FWBA 1OV3A 1RUWA 2V1RA 1QKXA 2GBQA 1TUCA 2LQNA 4OMNA 3VS6A 1WDXA 2RQTA 2HBWA 2JW4A 3C0CA 2ESWA 2OAWA 2SEMA 2EYZA 2OJ2A 5I11A 4RTTA 2M51A 4J9CA 2DM1A 4EIKA 1UHCA 2JT4A 1BU1A 1B07A 2BZXA 1PKTA 2ED0A 1G2BA 2L3QA 2YUNA 1AWOA 1W6XA 2JMCA 2KT1A 1NEBA 1NM7A 1GBQA 4J9FA 5HCKA 1WI7A 1M27C 1GCQC 2DILA 1NLPC 2OI3A 1QKWA 3H0FA 2BZ8A 2A37A 1FYNA 2L3SA 1E6HA 4K11A 3PE0A 3I35A 1SRLA 1QCFA 1WYXA 4HCKA 3SEMA 4Z89A 1KJWA 2EGAA 1MV0B 1X27A 1V1CA 2O9VA 4JZ3A 1OEBA 2JTEA 2DL5A 2P4RA 2FRYA 4RTZA 1AOJA 3RBBB 1B3QA 3VS4A 2VKNA 2CUDA 2FO0A 1X43A 1JEGA 2LJ3A 1G83A 1YCSB 5FWCA 1GRIA 1YNZA 2D8HA 1AZGB 1GBRA 5IXFA 1QWEA 1UFFA 1ZX6A 2K9GA 1ZUUA 2JM9A 4RTWA 1I07A 1SRMA 3TSWA 4DEYA 3TSZA 2LJ0A 1AD5A 2KNBB 3NMZC 2RQWA 2DRKA 1K0XA 2EGCA 1S1NA 1SPKA 2DVJA 3RNJA 2KXDA 1WXBA 1NYFA 3THKA 1RI9A 1UG1A 2GTOA 2EYXA 4Z88A 4D8KA 2FG0A 3M0RA 5GJWB 1Z9QA 4J9GA 2K6DA 1GFDA 3PVLA 2NUZA 2FPFA 3M0PA 1UHFA 1PRMC 4CC4B 1ZBJA 2EPDA 3SHWA 2EGEA 2O9SA 1NG2A 4JJBA 1T3SA 1PHTA 1YN8A 2AZVA 2YUPA 2KR3A 1PWTA 2E5KA 2CSQA 2IIMA 2KEAA 2RPNA 2D8JA 4E6RA 1T0HA 2ABLA 3I5RA 1CKAA 1SSHA 1BBZA 1ABQA 2DYBA 5IXBA 2DMOA 3LH5A 4HXJA 2DRMA 1WLPB 1K9AA 1YWOA 2JM8A 3U23A 1X6BA 1AEYA 2X3XD 1GCPA 1WXUA 3JV3A 3REBB 3EG1A 4F17A 2J7IA 1J3TA 3FJ5A 4M4ZA 2CH4W 2CUBA 2X3WD 2MOXA 3R6NA 2LCSA 4LN2A 2DA9A 2DBMA 4LUDA 1UUEA 3A98A 4ESRA 2KRMA 2QDLA 2K3BA 3EHQA 1JO8A 1WXTA 4HVWA 1I1JA 1AZEA 2C0OA 4Y92A 2V1QA 2FPDA 2ED1A 1K4US 1CSKA 1X6GA 2AZSA 1UE9A 4IIOA 4IIMA 3M0SA 4X1VA 2O88A 4AG1C 1Y57A 4OMOA 2D1XA 2LNHB 2J06A 2W0ZA 2XMFA 4GBQA 4LUEA 2HEQA 4HVVA 1X69A 1E6GA 2K7AA 1RLQC 1VYUA 2O2OA 2LQWA 2EKHA 1VA7A 2HCKA 2J6OA 1QLYA 2ROTA 2CDTA 5L23A 1FMKA 4CC2A 1Y0MA 1RLPC 1BB9A 2J6FA 2JXBA 1M3BA 2B86A 2O31A 3IQLA 4OMQA 4R0KA 2FPEA 4CC3A 2RN8A 1ZSGA 1SEMA 2GQIA 4J9HA 4AG2C 2YDLA 1T0JA 2KXCA 4J9DA 4RTUA 2K2MA 1M30A 1QWFA 1KFZA 2YT6A 2ECZA 3EG3A 1WFWA 3GBQA 1CKBA 1ARKA 2CT3A 5FW9A 1W70A 1M3CA 2DF6A 1JU5C 2RF0A 4RTYA 2KE9A 2YUOA 2JMAA 3M0UA 2DL4A 1GCQA 1X2KA 2KRSA 3KFVA 3M0TA 3UA7A 4OMMA 1I0CA 1NYGA 1K76A 3VRYA 2KROA 1XOVA 3NHNA 1YWPA 3EG0A 2NWMA 1GFCA 2KGTA 1SHFA 2A08A 2J05A 1PRLC 3O5ZA 1JXOA 1KIKA 3TVTA 2VWFA 1VYVA 2AKKA 2SRCA 1OPKA 1H8KA 4J9IA 1H3HA 2DE0X 1MUZA 3NPFA 1H92A 3ULRB 1UDLA 2DL7A 1M8MA 2EVRA 4J9EA 2LP5A 4D8DA 1PNJA 2RNAA 4ZNXA 4WCIA 4AFSC 1ZUKA 4OMPA 1OPLA 4AFUC 2G6FX 2J6KA 3I9QA 1E7OA 2MIOA 4LE9A 2A36A 4JJDA 3VS5A 4Z8AA 2GNCA 2KYMA 1U5SA 2BTTA 3QWYA 3EHRA 4AFZC 1ZUYA 2D0NA 3VS0A 4GLMA 3I5SA 1TUDA 2AKLA 2K79A 1NLOC 4JJCA 2HSPA 5ECAA 1GL5A 1HD3A 1AVZC 2DNUA 4FSSA 2F2XA 5EC7A 1N5ZA 1UTIA 3VS2A 2EBPA 2H8HA 2L3PA 2EYWA 3VRZA 2BZYA 2YSQA 1JXMA 2DJQA 4KRTA 3REAB 2JS0A 5GJVB 2DX1A 1ABOA 1ZLMA 2L0AA 2F2WA 2W10A 2KYBA 1UJYA 1WX6A 2EQIA 2HDAA 1AWWA 1NEGA 2PTKA 3M0QA 4J9BA 1WA7A 5IH2A 2DL8A 4AFQC 2LZ6B 1SHGA 1M3AA 2AK5A 4RUGA 3CQTA 4HVUA 4RTVA 1K0SA 1A0NB 1UJ0A 1IO6A 2RMOA 2LJ1A 2MCNA 1BK2A 4QT7A 2C0TA 4RTXA 1U06A 1AWJA 4LNPA 4DEXA 1PKSA 3NGPA 1HJDA 2I0NA 2CH4A 4F14A 1VYTA 2PNIA 3UATA 3PVQA 3H41A 1X2QA 2DL3A 2DLPA 3ZL7C 2KRNA 4OMLA 2FEIA 2M0YA 5IHKA 1HSQA 2A28A 3VS3A 2KBTA 5I22A 2RQVA 3EG2A 4A63B 4F16A 1LCKA 3UA6A 3VS7A 2ENMA 1KSWA 1UGVA 1TG0A 5IHNA 2CSIA 1WIEA 1OOTA 1JQQA 1Z9ZA 2DBKA 3VS1A 2C0IA
chains in the Genus database with same CATH superfamily
1U3OA 4JRKA 2F2VA 2KT8A 3OS2A 2ROLA 4KGZB 1HYOA 5IHIA 4BUGA 2JOYA 3EGUA 3HRSA 4PFPA 5CIUA 4MZMA 3SWNA 3A8GB 1M8VA 3UF4A 3QWXX 2QAZA 2VVKA 3CCRA 4F7UE 3H0HA 1VQ8A 2QQSA 3L42A 2LX7A 2NUPB 1YP5A 2XICA 2MYSA 1NJIC 2OX7A 4ANJA 1YJNA 3M55A 1MMGA 3G7ZA 3CC4T 1IGUA 2YLBA 2VB6A 3RDVA 3JCMb 2LQKA 2Z0WA 1G3YA 3OW2S 2QQBA 3F70A 3C0CA 4M78A 2OAWA 2SEMA 5LJ3j 1D0ZA 1EZZB 1MMDA 2DM1A 4LDYA 1UHCA 4M7AF 3NFCA 1UEBA 1JB0E 1B07A 2VXEA 4BI4A 2K57A 2X4WA 3VV0A 1G2BA 4JLIA 2XDDA 1DJ7B 2JMCA 3G6ET 4FW2A 1GBQA 3V8LA 4E7HA 4OB1B 3MP1A 1K9MC 4PFZA 2GQVA 2L3SA 3KUFA 2QEXA 3EGXA 4K11A 3CCJT 3EFOB 3SDZA 4PKCC 1X27A 2RHUA 4JZ3A 1VIEA 2Y90A 1YI2T 2HAXA 4C92G 4B9WA 4FYVB 2P4RA 3DB4A 5AYFA 1TS9A 1B3QA 3CCLQ 4KGXB 3MPUB 2CUDA 5FRMA 5KYXA 4J83A 1JEGA 1G83A 4C8QC 1YCSB 1R0CB 2MI6A 2VYTA 3OW2A 4HCCA 1GRIA 1NJIR 1D0XA 1UFFA 5IT9E 4C0DC 1NPRA 2GFUA 4RTWA 4JRIA 3TSWA 4EMHA 1M1GA 3DKMA 2KNBB 3CCUT 4OVAA 4NOYA 1WJQA 1K0XA 2DVJA 4IUTA 2XG8D 2V8KA 3EG9A 3VKIA 2KXDA 3J80E 2QI2A 3PNWC 2E3HA 1UG1A 2HMAA 2GTOA 5GAN6 1VQ6T 1PSFA 5FROA 4C92A 1Z9QA 3BY7A 3I56Q 4E7JA 4M78D 3Q1JA 2RHZA 2LRQA 5GAOm 2KVQG 1K9MR 5GMKe 2OTJQ 3SHWA 3OW2P 4IUVA 2EGEA 1NG2A 1PHTA 2CGHA 1N8RU 5CCAA 1PWTA 2Y4YA 2KEAA 2D8JA 2ATCB 1T0HA 3OQ5A 1CKAA 1FMVA 1BBZA 2NUPA 2DYBA 4FSXA 5IXBA 4JUVA 1YJ9T 2JM8A 2RHYA 3R6OA 1KQSA 3JV3A 3EG1A 3FIFA 2J7IA 4M77B 1M1FA 1J3TA 4M4ZA 1O75A 2CUBA 3CPFA 2PQWA 3BDUA 4AT1B 3OYAA 2DA9A 2DBMA 1BCMA 2QDLA 3EHQA 2DIGA 2FB7A 4II1A 1WJRA 1Q86U 3GNFB 4FU6A 1AZEA 2C0OA 1N9RA 2LC4A 4R55A 4XTZA 3CCEA 2ED1A 3CC7A 4Y91A 2C06A 3M58A 1K4US 1M1KR 1XQHA 4XTVA 2W0ZA 2J06A 4LUEA 3QPHA 3HP9A 4HVVA 4P5NA 4BDYA 2HSEB 1VYUA 2RH2A 3X25B 1K8AU 2LQWA 1XJWB 4M75B 3EFOA 2QTXA 3CC4Q 1KQSP 2J6OA 1M9SA 2CDTA 1Y0MA 4ZGEB 1QCNA 2MPXC 3CMEA 3BW1A 3FB9A 2O01E 3IQLA 2HNIA 5GANj 2R58A 3CBMA 4M78E 1SEMA 2HZYA 3JCMc 2DXCA 1T0JA 2JVVA 3CCVA 1M30A 3GNGA 4GLKA 2L8DA 2QQRA 4C92D 1QVGS 3EG3A 2RI2A 3GBQA 2DEQA 3MCAB 2WSCE 2CT3A 4DBQA 3RR6A 4O5VA 3EAEA 4Y28E 3OYEA 4N4HA 5D7UA 2DF6A 1OI1A 4J7IA 1JU5C 4RTYA 1K73C 3CD6A 2DL4A 3M0TA 2LVMA 3I55T 4OMMA 2K4YA 1WHKA 1WQ7A 4E7KA 3NHNA 3L2ZA 4PJLA 1YI2Q 4LDXA 3M5AA 1HK9A 2IPOB 4M7DB 1PRLC 2HL3A 3TVTA 3HKSA 5FU7C 2SRCA 1YJWA 1YHQA 3NPFA 1H92A 3ULRB 1M8MA 2P84A 2EVRA 2KDSA 2O4XB 3HHTB 3FC3A 4J9EA 2LP5A 4D8DA 1VQKT 2OTLT 1PNJA 2RNAA 1IHVA 4WCIA 1ZUKA 4J6XA 4OMPA 2J6KA 4C0ZA 4JS5A 4M75G 3LLRA 1G3TA 1W4SA 3CCUQ 3VS5A 5KYUA 4PJOB 4X9CA 4NS5A 3EHRA 3GF5A 2D0NA 2ZPBB 2AKLA 1NLOC 4JJCA 1HD3A 1AVZC 3JCMh 2DNUA 3RMSA 2E6NA 1VQ6Q 5EC7A 3CMAA 4KT0E 5KCHA 3MEVA 4C92E 2A3LA 2EBPA 3ME9A 2EYWA 3V8JA 5IAYA 2YSQA 1RABB 2DJQA 1IREB 5GJVB 1UGPB 5LJ5g 3OYGA 1ZLMA 2MWPA 2BUDA 1K73R 1UJYA 4M7AC 1NEGA 1WA7A 3E2UA 5IH2A 1MMAA 2BE7D 3MEUA 4B6MA 4ELZC 4RUGA 2X51A 1YJ9Q 4RTVA 1K0SA 4M75A 1VQ7T 4MZPA 2LJ1A 4DOVA 4M7DG 1PC0A 4M78F 1KC8U 1SKUB 4RTXA 1AWJA 4BY6C 4CRIA 5D6YA 2I0NA 3CXCA 4EMKA 2EAYA 4XTYA 1VYTA 3QJYA 1SG5A 4EPCA 2QQ9A 3PVQA 1QW1A 4IUQA 2YWWA 4ME7A 5IHKA 3QZ5B 4C5EA 1VQOA 1SSFA 4A4FA 5I22A 2RQVA 2JTMA 2COYA 4D6WA 1LCKA 3OYMA 4NL2A 2I2LA 1KSWA 3JAME 1TG0A 1OX8A 4PJOG 5IHNA 2K5FA 1N6AA 4FYWB 4RG8A 5DLQE 1W2BS 3VS1A 3PFSA 1EX4A 2BIVA 3A8MB 4OB0B 1B34B 5CAIA 2R57A 2EYYA 2YHTA 3CXCP 3SD4A 4M7DA 2DXUA 1AWXA 1EFNA 2GGRA 3S3OA 2PZ1A 1LPLA 3VUZA 1T3LA 1Y7XA 2KAFA 1VQMT 2H3EB 3PTAA 4ORZA 2COZA 2O4XA 1UECA 2EW3A 3ASKA 1RUWA 2L89A 2V1RA 2HBPA 2GBQA 4LDUA 2GFAA 2LQNA 5AT1B 2QK0A 1OULA 4PFOA 4C5GA 2MK5A 2JW4A 4Z02A 1FMWA 2EYZA 5GAMf 4PJOA 3I56A 4J9CA 2JT4A 3JB9H 3ER0A 4ZTFA 4C92F 2ED0A 3QZ9B 4M75D 3QDRB 1AWOA 2E12A 2FVUA 5HCKA 1WI7A 4PLIA 1BI2A 2EFIA 2OI3A 1W2BA 3H0FA 2ZPEB 4E7IA 1FYNA 3C12A 1E6HA 1VQKQ 3I35A 1WYXA 1I81A 2DPPB 4FIBA 5GMKl 2RJEA 1N8RC 1KJWA 1UB4A 2L3RA 3UT1A 1OEBA 2JTEA 4BB7A 1RAHB 4XQ3A 2DL5A 2FRYA 2RK2A 1WHJA 1AOJA 3RBBB 2OTJT 3RUXA 3TEEA 3CCQQ 2LDMA 2R5AA 1LVKA 4C0GA 5LJ3f 3TQ7P 3VU3C 3CCMQ 2LJ3A 3FDRA 1IB8A 5J26A 5IXFA 2QASA 1W2BP 1ZX6A 4E7LA 1Q86C 4M7DD 2KMTA 4M78G 1QVPA 4DEYA 4BI8B 2CZ6B 3L2VA 3CC4A 3NMZC 1VQ9Q 2DRKA 2EGCA 1SPKA 2RD1A 1BYMA 2L5QA 4LXCA 4QVDA 3THKA 3FJPA 2EQUA 1G3SA 2MAMA 2JZ2A 1R8OB 4N4GA 2M1HA 1K8AC 3QJ6A 5GJWB 1VQ7Q 4M75E 2K6DA 1B34A 2F5TX 3JCMP 1UHFA 5GAMh 4PJOD 3G6EA 1PG5B 4MMKA 3G71A 2O9SA 1YN8A 2YUPA 4FT4A 1ZQ1A 1N8RR 2DVEA 1M90U 2M02A 3I5RA 3CCJA 3JCMJ 1ABQA 2DMOA 3GLXA 3LH5A 1WLPB 1YWOA 1AEYA 2X3XD 1WXUA 2EQJA 3REBB 4F17A 1YI2A 3CCSQ 1OU9A 3FJ5A 1VIFA 2FZKB 2CH4W 5A0LA 3R6NA 4E47A 2LCSA 3S3NA 3HTRA 1UUEA 3A98A 4XAXB 2X4YA 3M4GA 5CO7A 4KUDK 1BI0A 1WXTA 5FU6B 4HVWA 3EFRA 2RHIA 1VQPA 1Q86R 3VYGA 4KUIA 4M7DE 2O88A 3M0SA 3E9GA 5LJ3h 3RIRA 1VQMQ 3CCRT 2ZPGB 3MP6A 1VQ8T 3OY9A 1VQ4Q 4N0AA 3QO3A 2H3JA 3CCUA 1MMNA 3M57A 3CC2Q 2O2OA 3M56A 2E64A 2EKHA 1VA7A 3NTKA 5FLXE 3SWNC 5KYYB 1K8AR 4ZN3A 1BIBA 2J6FA 2O31A 3PT9A 4OMQA 4QW2A 4CC3A 2HQXA 1ZSGA 1ACMB 2GQIA 4J9HA 7AT1B 1KQSS 4AG2C 1OZ3A 4PJOE 2KXCA 4RTUA 5LJ5d 4MMLA 1I5OB 1M4ZA 4XTXA 2E10A 3JCMe 2RB6A 2RJCA 2IG0A 1VOMA 4LDWA 3X28B 1U1TA 5FW9A 2CZ0B 1M1KC 1YFNA 4M78C 1QMCA 1I5LA 3X26B 1SF9A 2QEXT 2LQ8A 2KE9A 2ZCFB 3M0UA 3INZA 2PU9B 1GCQA 4OF1A 2ZPFB 5GAOr 3UA7A 1MHNA 3QKJA 1K76A 3CBOA 4PK4A 1O9SA 3VRYA 1XOVA 1BI1A 2XIDA 3JCMg 3AT1B 1FX7A 3EG0A 4M75F 1GFCA 2KGTA 1SHFA 2CP5A 3OYKA 1JXOA 2RI3A 3KXTA 1OPKA 1HXDA 2EWNA 1QP2A 5CVIA 5GANf 5KCOA 2V8JA 1M5Q1 1UDLA 2AT1B 2F1LA 5CQXA 2ZZDA 5KYNA 1PSEA 3LH0A 4ZNXA 1VQ5A 1TWBA 4XK8E 4AFSC 1OPLA 4FW1A 1PD0A 2G6FX 1E7OA 2MIOA 3OYHA 3OS5A 4Z8AA 1ZUYA 4GLMA 4EDUA 4IKFA 3I5SA 3SFMA 1G8XA 1KD1U 1GL5A 4OMFB 1V76A 2RK1A 4KULA 2F2XA 4M7DF 2X4XA 3FEOA 3OBYA 5GMKi 1PM3A 2DX1A 2M9UA 2JN0A 2AIRB 4OGEA 3SB2A 2HDAA 3X20B 3MEAA 4IUPA 4C92C 2YRDA 2QXFA 3HRUA 2ZGWA 2DL8A 2LZ6B 3I55A 2AK5A 1FWZA 3G4SA 1KHCA 4WTOB 4HVUA 1A0NB 1UJ0A 2MCNA 1BK2A 2NUTB 5KYYA 4NL3A 2C0TA 2F5KA 4PJOF 4DEXA 3OYFA 1PKSA 3NGPA 1KC8R 1HJDA 3VYHB 1C1AA 4F14A 5GAOl 4F7UB 2P4TA 2XKOC 4FT2A 4ZGJB 3UATA 4WF2A 1S72A 2QDYB 3ZL7C 1VQKA 2OTLA 3CCET 3HSBA 1QP3A 1JRIA 3EGDB 1ZA1B 5KE2A 4M77G 4FL6A 2KBTA 5GANh 2QGFB 4XTUA 2HKNA 3TU4K 3CCRQ 4X34A 1VQ8Q 1VQNT 3E19A 4RKUE 1VQLT 2RHXA 2CSIA 3OMGA 1JQQA 1Z9ZA 2ZPHB 1YIJA 4A54A 1YITA 1QCFA 1MV3A 4CC7A 1K1ZA 2YUQA 3H0IA 3PGGA 1D3BB 3CMET 4A4HA 2L2PA 2HKQB 2E6ZA 4DBRA 3QUIA 4JPBW 1G5VA 3HRTA 1TU0B 2VC8A 4VUBA 2DXTA 2FRWA 4GY5A 5EG2A 4RMOA 3QBYA 2WSFE 2RQRA 3OA6A 2R5MA 4IURA 2RI5A 1D1AA 3CXCS 2K3XA 3TCJA 2JS2A 2GTJA 2RQUA 1OV3A 1QKXA 3DLLA 2QA4T 4OMNA 2COWA 4M77A 3CCQT 2VGMA 5LJ5e 1WDXA 1ZSZB 2RQTA 1IGQA 2QEXQ 2HBWA 5LL6S 1EIFA 1UGQB 3CCMT 1TH7A 4BE2A 2LCCA 5I11A 3META 2M51A 4RTTA 3RKXA 1C0MA 4DBFA 1BU1A 2BZXA 1PKTA 2L3QA 2YUNA 4ELYC 1W6XA 2CP2A 1XNIA 1BI3A 2KT1A 1NEBA 1NM7A 2GF7A 1YJWT 2DILA 1VQ9T 3OYLA 5FRNA 3RERA 1QKWA 1QVFA 5GMKj 2BZ8A 3CEYA 1RAGB 3A8OB 2D9TA 1RAIB 2VXFA 1SRLA 4Z89A 2XU8A 2O9VA 2VV5A 2P0KA 4L5GA 1M90C 1WPYA 2M16A 4RTZA 4L59A 1Q7YU 5GAMg 2VKNA 2NUTA 5GAN2 4LD9K 5FWCA 3CMAT 2D8HA 4F7UA 1KHIA 1WJSA 3V7RA 1RI0A 3M59A 1ZUUA 2JM9A 3M53A 4HCBA 1I07A 3MO8A 1QVFP 3CCST 1SRMA 3EGDA 3OB9A 4QVZA 2DXBA 5HKCA 3CCLA 3RNJA 3OYJA 3QXEB 4C5HA 4E7ZA 1WXBA 3G1JA 4OB2B 1RI9A 1UGSB 4KGVB 4E2FB 2EYXA 3M0RA 5HY6A 4M77D 3X24B 1X6OA 2CYZB 1GFDA 2NUZA 2FPFA 3M0PA 1Q95G 1D3BA 1I8FA 5LJ3g 1PRMC 3SWNB 4CC4B 1IZ6A 1ZBJA 3P8DA 2ZPIB 1VQ4T 1NPPA 1T3SA 2AZVA 2GCXA 2KR3A 3VJPA 3CC2T 2CSQA 2IIMA 2RPNA 4M75C 4C8QB 2E3IA 2RJFA 2EQMA 3CCEQ 3CC7Q 1M90R 3JCMd 4HXJA 4C0DB 4R56A 2DTOA 3U23A 2PUOB 4EMKC 2X35A 2FZGB 4UC4A 1VQNQ 2MOXA 1VQLQ 1ZSZA 5GAN5 4LUDA 2OTJA 4ESRA 2KRMA 3J81E 1JO8A 2KQWA 4XU2A 1QCOA 3CMEQ 2V1QA 4ATOA 4RCCA 1OX9A 1CSKA 4IIMA 1WHHA 4AG1C 3ZEHA 3JCMX 4OMOA 1N9SA 2QGGA 3UDCA 3AHUA 5GAOp 2XMFA 4GBQA 2HEQA 4O6JA 3LWIA 3WVEB 3OS1A 1E6GA 1RLQC 5GAN8 4M7DC 1QLYA 2QA4Q 2ROTA 5L23A 4CC2A 1UGRB 1RLPC 1BB9A 4AMCA 1Q81U 2DK3A 3V7CA 3C94A 2JUFA 3CPWS 3A8LB 2B86A 4M77E 2DKGA 3RKYA 3CD6Q 2LX9A 4HT9A 4R0KA 2RN8A 2CZ1B 3QDFA 5LJ5j 3QG1A 1WZOA 2K2MA 1WGSA 5KYWB 2DTHA 1AT1B 1CKBA 1ARKA 2D0QB 4C8QG 1Q82U 1YJWQ 1YHQQ 4PJOC 1M3CA 3MJXA 4XU0A 3E1SA 2YUOA 2JMAA 5KE3A 4X9DA 1NYGA 5C0MA 2KROA 2MMPA 3C95A 1GXIE 1RAFB 1YWPA 4FYXB 2E4HA 2A08A 3A8HB 3OSSC 4DA4A 1KIKA 3HPWA 4ZTJA 2E41A 3QSUA 1H8KA 4J9IA 2DE0X 2DD5A 2FL7A 1KQ1A 3T9NA 2DL7A 3JB9G 2QQAA 4KH1B 3CMAQ 3CPWA 2LT1A 1XTDA 5HK0A 1YCYA 4BE1A 2XD0A 1FXXA 4TVRA 3MKDA 4C8QA 1TUGB 3I9QA 1M2OA 4LE9A 3MP8A 2A36A 2DEUA 2HL5C 4A4EA 1U5SA 2BTTA 1RL2A 5GANe 4AFZC 3VS0A 4JRQA 3OYCA 5A0DA 1TUDA 2K79A 4RG2A 1VUBA 2HSPA 1OQKA 3O8VA 4JDSA 4ZN1A 1KD1R 4XU1A 1N5ZA 1UTIA 3VS2A 2H8HA 3LX7A 3VRZA 2BZYA 3KBGA 3UWNA 3E9FA 5GANg 2JS0A 5CKHA 5FU7B 2EJ9A 1RAEB 3G71T 1WNLA 2P0PA 3CPWP 1YJNT 2W10A 2KYBA 1F1BB 3OS0A 1AWWA 2PTKA 3M0QA 4HA8A 2K2VA 8ATCB 4AFQC 1SHGA 1M3AA 1VQOQ 3CQTA 2PVGB 4M77F 4PNOA 1VQ6A 3M54A 2RM4A 2RMOA 4RCBA 2EJFA 3QIIA 1U06A 3OSVA 4EMGA 3J7AF 3RKWA 1MNEA 2CH4A 2G3RA 2XDBA 1IRXA 3OYYA 2NYSA 2EQKA 2EYQA 1X2QA 2KI7A 1VQPT 5KYWA 2DLPA 2KRNA 2FEIA 2CP0A 4L6V5 5GAN7 1U1SA 1HSQA 3VS3A 1YJ9A 1QQJA 2OAUA 1H641 3EFSA 1I4K1 1TTHB 3VS7A 5DM7R 4BI3A 4LD6A 5GAMd 2P0QA 2X4JA 1WIEA 4M7AB 1OOTA 4C8QD 2DBKA 3JRZA 2WSEE 4JZ4A 1JBMA 3JB9J 4QQDA 4KBMB 1P92A 3LYIA 2CREA 3P8HA 2LMJA 1KC8C 3HL8A 4IUUA 4N0AC 2DERA 3URGA 4B9XA 1W1FA 2CT4A 2M0OA 4BY6B 1Y96B 4BD3A 1Q7YC 2K3YA 4Q5WA 4C5IA 4F7UF 4A4GA 1D1CA 3LW5E 5GAOn 5FWBA 2E70A 3LGLA 5C6SA 3GOXA 2A7YA 2DJZA 3GIBA 1TUCA 3VS6A 5KYUB 2PUKB 3L2UA 3JB9D 1TXQA 3JSCA 2ESWA 4J8OA 3LGFA 2OJ2A 3BDLA 5LJ3d 3C4SA 4EIKA 3OYDA 1BKBA 2EJGA 1Y71A 2HD0A 2QYZA 4J5YA 2RA2A 3RMQA 3V7SA 4J9FA 1M27C 1GCQC 1PCXA 1NLPC 3JCMQ 2A37A 3WVDB 3PE0A 4HCKA 3SEMA 6AT1B 1VQ5T 3A1PA 2EGAA 3CBPA 1MV0B 2XK0A 3P8BB 1VQNA 1V1CA 4M7AG 1VQLA 4CI0C 1ZA2B 4C8QE 4PJMA 4N4IA 3NTIA 1LOJA 3JCMf 2B8AA 2CP7A 2A0FB 3L2QA 3V8KA 2K5LA 3DB3A 3VS4A 5M9OA 5HK3A 5CR2A 1Q7YR 2VUBA 2FO0A 1X43A 1D1BA 3L2RA 1NJIU 3MEWA 4EMKB 2QTVA 3CC7T 4PJJA 1YNZA 1AZGB 2YXYA 1GBRA 2YRCA 1QWEA 4JS4A 2K9GA 3A5ZB 3QYHB 1LNXA 1WHGA 3FRNA 3G6EQ 2DZ9A 5I2MA 4J6YA 3TSZA 1IXDA 3G71Q 2LJ0A 1AD5A 1YJNQ 2RQWA 2QA4A 1S1NA 4OP0A 1ZBXA 4J7FA 1MGQA 1WHLA 3CCQA 1QVFS 1NYFA 5FU6C 2DD4A 3HFNA 3CCJQ 3QHSA 3S6WA 3CCMA 4Z88A 4D8KA 5CQYA 5D6WA 3G4ST 4M7AA 2HQEA 2FG0A 4HT8A 1OYXA 2VGNA 2YRVA 4J9GA 1K9MU 3PVLA 3PIOA 1KG1A 1AHJB 4OB3B 3CCVT 1LJOA 9ATCB 3OYNA 1Q81C 3VUBA 2EPDA 3OBWA 4JJBA 3JCMV 4QQGA 2JTFA 1VQ9A 1Y96A 2E5KA 1WQWA 4E6RA 1VQPQ 1S72T 4C0FA 2CP3A 2RJDA 2ABLA 1SSHA 2DRMA 5D6XA 1K9AA 3CD6T 1X6BA 2XI9A 3ZBDA 1GCPA 1X01A 1VQ7A 1Q82C 3DLMA 2V26A 2X3WD 2XDPA 4LN2A 1D09B 4YTLA 4F7UG 1QVGA 2WACA 1KQ2A 1B7TA 1YIJT 2K3BA 8AT1B 5DY9A 1YITT 2E5QA 1I1JA 4MDXA 3M9QA 1YHQT 4Y92A 3PIPA 2FPDA 2KSSA 2DAQA 1M1KU 2X9HA 5GAMe 1X6GA 2AZSA 1UE9A 2RO0A 4IIOA 4X1VA 2D6FA 4V2SA 2DTIA 4A53A 1Y57A 3FLGA 2DO3A 2D1XA 2JJ9A 5A2QE 4J6WA 3CCSA 2LNHB 3BE3A 3OYIA 3QYGB 1X69A 1Y07A 1RAAB 2K7AA 1X75C 4PLLA 1OU8A 4C8QF 2FZCB 3GPLA 2HCKA 1BCOA 2EIFA 1FMKA 1G3WA 1C6VX 2JXBA 1M3BA 1QVGP 5GMKh 1R77A 1Q81R 1RADB 2FPEA 4BACA 5GANd 3OMCA 2YDLA 5I2SA 1NBEB 3EH2A 4FM4B 3EH1A 4J9DA 1VQMA 2PVOB 2DYIA 4M7AD 2Y4XA 1QWFA 1VQ4A 4PJNA 4QKUA 1KFZA 2YT6A 2ECZA 1WFWA 2DZCA 1WHMA 4F04B 4M77C 2KY9A 3CC2A 1PD1A 4JJNK 2BE9B 4DBHA 5KH6A 5DLOA 5GAOq 4HKEA 2ZAEA 1W70A 4BDZA 5LJ3e 1M2VB 1Q82R 1JJ2S 5GAN3 2DIQA 3JB9I 2VASA 5CKDA 5IN1A 3H9NA 5GMKm 3JB9F 2RF0A 2PVDB 2V8IA 5GAN4 4DQ2A 1X2KA 2KRSA 3KFVA 2MF2A 1VQ5Q 3LWHA 1I0CA 1KK7A 2FHDA 2AHJB 2BKDN 4FCYA 5A0GA 2NWMA 2J05A 1R0BG 3O5ZA 4KH0B 2VWFA 3S3MA 1VYVA 2AKKA 2EKOA 2CZ7B 1OZ2A 1H3HA 4A4KA 3BFMA 1MUZA 3PMIA 5LJ5f 3D7SB 4PL6A 4HCZA 1VQOT 4FYYB 4AFUC 1NZ9A 4QQ6A 3H6ZA 1V29B 2CP6A 4M78B 1YBYA 4JJDA 2GNCA 2KYMA 3QWYA 2DFUA 1ZHIA 3CCLT 3JCMW 1D0YA 2CKKA 1U8RA 4MDWA 5CKBA 1MNDA 5ECAA 3ZFJA 5J39A 3OYBA 3I55Q 1JJ2A 2E1HA 4FSSA 3G4SQ 2F69A 4M7AE 3UPUA 2L3PA 3CCVQ 1JXMA 4KRTA 3REAB 2CS7A 1K73U 3EGXB 3GP8A 4XTWA 5CKEA 1N27A 1ABOA 3M4YA 2L0AA 4ZGDB 2F2WA 1BIAA 1WX6A 2EQIA 1TOVA 4BE0A 1RACB 4J9BA 1S72Q 4OGCA 3L2WA 4E7SA 2OTLQ 2FYKA 4MZTA 3RESA 5I21A 2LTOA 2HQHA 2LT4A 3N5BB 1IO6A 3H8ZA 4XU3A 2JNGA 4QT7A 3I56T 3MHXA 1NE8A 5KYXB 2NLUA 4LNPA 4JLGA 1JJ2P 3WXMB 4QVCA 5L8RE 3TREA 5CK9A 5CKFA 1YIJQ 1IHWA 1KD1C 1YITQ 1TSFA 2XHCA 3PMTA 2PNIA 4JRPA 2E65A 2YLCA 1H3ZA 3H41A 2LCLA 2DL3A 2LNVA 2IVWA 4OMLA 2M0YA 2DETA 4DOWA 4LDVA 2A28A 1ZSZC 5J3BA 3L1AA 2K5IA 3EG2A 3EG9B 4A63B 4F16A 3UA6A 5LJ5h 2ENMA 1UGVA 1M2VA 5GAMj 2MWOA 3NTHA 2KK4A 2QG9B 4C92B 3HFOA 2C0IA
chains in the Genus database with same CATH topology
4JZ4A 1U3OA 2F2VA 1MV3A 2KT8A 4CC7A 2ROLA 1K1ZA 2YUQA 3H0IA 5IHIA 2EYYA 2L2PA 3EGUA 2CREA 2LMJA 4JPBW 1AWXA 1EFNA 2GGRA 3UF4A 1W1FA 2CT4A 2FRWA 2PZ1A 3QWXX 1T3LA 2RQRA 2VVKA 3H0HA 2LX7A 1YP5A 4ORZA 2JS2A 2GTJA 1UECA 2EW3A 2RQUA 5FWBA 1OV3A 1RUWA 2V1RA 1QKXA 2GBQA 1TUCA 2LQNA 4OMNA 3VS6A 1WDXA 2RQTA 2HBWA 2JW4A 3C0CA 2ESWA 2OAWA 2SEMA 2EYZA 2OJ2A 5I11A 4RTTA 2M51A 4J9CA 2DM1A 4EIKA 1UHCA 2JT4A 1BU1A 1B07A 2BZXA 1PKTA 2ED0A 1G2BA 2L3QA 2YUNA 1AWOA 1W6XA 2JMCA 2KT1A 1NEBA 1NM7A 1GBQA 4J9FA 5HCKA 1WI7A 1M27C 1GCQC 2DILA 1NLPC 2OI3A 1QKWA 3H0FA 2BZ8A 2A37A 1FYNA 2L3SA 1E6HA 4K11A 3PE0A 3I35A 1SRLA 1QCFA 1WYXA 4HCKA 3SEMA 4Z89A 1KJWA 2EGAA 1MV0B 1X27A 1V1CA 2O9VA 4JZ3A 1OEBA 2JTEA 2DL5A 2P4RA 2FRYA 4RTZA 1AOJA 3RBBB 1B3QA 3VS4A 2VKNA 2CUDA 2FO0A 1X43A 1JEGA 2LJ3A 1G83A 1YCSB 5FWCA 1GRIA 1YNZA 2D8HA 1AZGB 1GBRA 5IXFA 1QWEA 1UFFA 1ZX6A 2K9GA 1ZUUA 2JM9A 4RTWA 1I07A 1SRMA 3TSWA 4DEYA 3TSZA 2LJ0A 1AD5A 2KNBB 3NMZC 2RQWA 2DRKA 1K0XA 2EGCA 1S1NA 1SPKA 2DVJA 3RNJA 2KXDA 1WXBA 1NYFA 3THKA 1RI9A 1UG1A 2GTOA 2EYXA 4Z88A 4D8KA 2FG0A 3M0RA 5GJWB 1Z9QA 4J9GA 2K6DA 1GFDA 3PVLA 2NUZA 2FPFA 3M0PA 1UHFA 1PRMC 4CC4B 1ZBJA 2EPDA 3SHWA 2EGEA 2O9SA 1NG2A 4JJBA 1T3SA 1PHTA 1YN8A 2AZVA 2YUPA 2KR3A 1PWTA 2E5KA 2CSQA 2IIMA 2KEAA 2RPNA 2D8JA 4E6RA 1T0HA 2ABLA 3I5RA 1CKAA 1SSHA 1BBZA 1ABQA 2DYBA 5IXBA 2DMOA 3LH5A 4HXJA 2DRMA 1WLPB 1K9AA 1YWOA 2JM8A 3U23A 1X6BA 1AEYA 2X3XD 1GCPA 1WXUA 3JV3A 3REBB 3EG1A 4F17A 2J7IA 1J3TA 3FJ5A 4M4ZA 2CH4W 2CUBA 2X3WD 2MOXA 3R6NA 2LCSA 4LN2A 2DA9A 2DBMA 4LUDA 1UUEA 3A98A 4ESRA 2KRMA 2QDLA 2K3BA 3EHQA 1JO8A 1WXTA 4HVWA 1I1JA 1AZEA 2C0OA 4Y92A 2V1QA 2FPDA 2ED1A 1K4US 1CSKA 1X6GA 2AZSA 1UE9A 4IIOA 4IIMA 3M0SA 4X1VA 2O88A 4AG1C 1Y57A 4OMOA 2D1XA 2LNHB 2J06A 2W0ZA 2XMFA 4GBQA 4LUEA 2HEQA 4HVVA 1X69A 1E6GA 2K7AA 1RLQC 1VYUA 2O2OA 2LQWA 2EKHA 1VA7A 2HCKA 2J6OA 1QLYA 2ROTA 2CDTA 5L23A 1FMKA 4CC2A 1Y0MA 1RLPC 1BB9A 2J6FA 2JXBA 1M3BA 2B86A 2O31A 3IQLA 4OMQA 4R0KA 2FPEA 4CC3A 2RN8A 1ZSGA 1SEMA 2GQIA 4J9HA 4AG2C 2YDLA 1T0JA 2KXCA 4J9DA 4RTUA 2K2MA 1M30A 1QWFA 1KFZA 2YT6A 2ECZA 3EG3A 1WFWA 3GBQA 1CKBA 1ARKA 2CT3A 5FW9A 1W70A 1M3CA 2DF6A 1JU5C 2RF0A 4RTYA 2KE9A 2YUOA 2JMAA 3M0UA 2DL4A 1GCQA 1X2KA 2KRSA 3KFVA 3M0TA 3UA7A 4OMMA 1I0CA 1NYGA 1K76A 3VRYA 2KROA 1XOVA 3NHNA 1YWPA 3EG0A 2NWMA 1GFCA 2KGTA 1SHFA 2A08A 2J05A 1PRLC 3O5ZA 1JXOA 1KIKA 3TVTA 2VWFA 1VYVA 2AKKA 2SRCA 1OPKA 1H8KA 4J9IA 1H3HA 2DE0X 1MUZA 3NPFA 1H92A 3ULRB 1UDLA 2DL7A 1M8MA 2EVRA 4J9EA 2LP5A 4D8DA 1PNJA 2RNAA 4ZNXA 4WCIA 4AFSC 1ZUKA 4OMPA 1OPLA 4AFUC 2G6FX 2J6KA 3I9QA 1E7OA 2MIOA 4LE9A 2A36A 4JJDA 3VS5A 4Z8AA 2GNCA 2KYMA 1U5SA 2BTTA 3QWYA 3EHRA 4AFZC 1ZUYA 2D0NA 3VS0A 4GLMA 3I5SA 1TUDA 2AKLA 2K79A 1NLOC 4JJCA 2HSPA 5ECAA 1GL5A 1HD3A 1AVZC 2DNUA 4FSSA 2F2XA 5EC7A 1N5ZA 1UTIA 3VS2A 2EBPA 2H8HA 2L3PA 2EYWA 3VRZA 2BZYA 2YSQA 1JXMA 2DJQA 4KRTA 3REAB 2JS0A 5GJVB 2DX1A 1ABOA 1ZLMA 2L0AA 2F2WA 2W10A 2KYBA 1UJYA 1WX6A 2EQIA 2HDAA 1AWWA 1NEGA 2PTKA 3M0QA 4J9BA 1WA7A 5IH2A 2DL8A 4AFQC 2LZ6B 1SHGA 1M3AA 2AK5A 4RUGA 3CQTA 4HVUA 4RTVA 1K0SA 1A0NB 1UJ0A 1IO6A 2RMOA 2LJ1A 2MCNA 1BK2A 4QT7A 2C0TA 4RTXA 1U06A 1AWJA 4LNPA 4DEXA 1PKSA 3NGPA 1HJDA 2I0NA 2CH4A 4F14A 1VYTA 2PNIA 3UATA 3PVQA 3H41A 1X2QA 2DL3A 2DLPA 3ZL7C 2KRNA 4OMLA 2FEIA 2M0YA 5IHKA 1HSQA 2A28A 3VS3A 2KBTA 5I22A 2RQVA 3EG2A 4A63B 4F16A 1LCKA 3UA6A 3VS7A 2ENMA 1KSWA 1UGVA 1TG0A 5IHNA 2CSIA 1WIEA 1OOTA 1JQQA 1Z9ZA 2DBKA 3VS1A 2C0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZ4 A;  1U3O A;  2F2V A;  1MV3 A;  2KT8 A;  4CC7 A;  2ROL A;  1K1Z A;  2YUQ A;  3H0I A;  5IHI A;  2EYY A;  2L2P A;  3EGU A;  2CRE A;  2LMJ A;  4JPB W;  1AWX A;  1EFN A;  2GGR A;  3UF4 A;  1W1F A;  2CT4 A;  2FRW A;  2PZ1 A;  3QWX X;  1T3L A;  2RQR A;  2VVK A;  3H0H A;  2LX7 A;  1YP5 A;  4ORZ A;  2JS2 A;  2GTJ A;  1UEC A;  2EW3 A;  2RQU A;  5FWB A;  1OV3 A;  1RUW A;  2V1R A;  1QKX A;  2GBQ A;  1TUC A;  2LQN A;  4OMN A;  3VS6 A;  1WDX A;  2RQT A;  2HBW A;  2JW4 A;  3C0C A;  2ESW A;  2OAW A;  2SEM A;  2EYZ A;  2OJ2 A;  5I11 A;  4RTT A;  2M51 A;  4J9C A;  2DM1 A;  4EIK A;  1UHC A;  2JT4 A;  1BU1 A;  1B07 A;  2BZX A;  1PKT A;  2ED0 A;  1G2B A;  2L3Q A;  2YUN A;  1AWO A;  1W6X A;  2JMC A;  2KT1 A;  1NEB A;  1NM7 A;  1GBQ A;  4J9F A;  5HCK A;  1WI7 A;  1M27 C;  1GCQ C;  2DIL A;  1NLP C;  2OI3 A;  1QKW A;  3H0F A;  2BZ8 A;  2A37 A;  1FYN A;  2L3S A;  1E6H A;  4K11 A;  3PE0 A;  3I35 A;  1SRL A;  1QCF A;  1WYX A;  4HCK A;  3SEM A;  4Z89 A;  1KJW A;  2EGA A;  1MV0 B;  1X27 A;  1V1C A;  2O9V A;  4JZ3 A;  1OEB A;  2JTE A;  2DL5 A;  2P4R A;  2FRY A;  4RTZ A;  1AOJ A;  3RBB B;  1B3Q A;  3VS4 A;  2VKN A;  2CUD A;  2FO0 A;  1X43 A;  1JEG A;  2LJ3 A;  1G83 A;  1YCS B;  5FWC A;  1GRI A;  1YNZ A;  2D8H A;  1AZG B;  1GBR A;  5IXF A;  1QWE A;  1UFF A;  1ZX6 A;  2K9G A;  1ZUU A;  2JM9 A;  4RTW A;  1I07 A;  1SRM A;  3TSW A;  4DEY A;  3TSZ A;  2LJ0 A;  1AD5 A;  2KNB B;  3NMZ C;  2RQW A;  2DRK A;  1K0X A;  2EGC A;  1S1N A;  1SPK A;  2DVJ A;  3RNJ A;  2KXD A;  1WXB A;  1NYF A;  3THK A;  1RI9 A;  1UG1 A;  2GTO A;  2EYX A;  4Z88 A;  4D8K A;  2FG0 A;  3M0R A;  5GJW B;  1Z9Q A;  4J9G A;  2K6D A;  1GFD A;  3PVL A;  2NUZ A;  2FPF A;  3M0P A;  1UHF A;  1PRM C;  4CC4 B;  1ZBJ A;  2EPD A;  3SHW A;  2EGE A;  2O9S A;  1NG2 A;  4JJB A;  1T3S A;  1PHT A;  1YN8 A;  2AZV A;  2YUP A;  2KR3 A;  1PWT A;  2E5K A;  2CSQ A;  2IIM A;  2KEA A;  2RPN A;  2D8J A;  4E6R A;  1T0H A;  2ABL A;  3I5R A;  1CKA A;  1SSH A;  1BBZ A;  1ABQ A;  2DYB A;  5IXB A;  2DMO A;  3LH5 A;  4HXJ A;  2DRM A;  1WLP B;  1K9A A;  1YWO A;  2JM8 A;  3U23 A;  1X6B A;  1AEY A;  2X3X D;  1GCP A;  1WXU A;  3JV3 A;  3REB B;  3EG1 A;  4F17 A;  2J7I A;  1J3T A;  3FJ5 A;  4M4Z A;  2CH4 W;  2CUB A;  2X3W D;  2MOX A;  3R6N A;  2LCS A;  4LN2 A;  2DA9 A;  2DBM A;  4LUD A;  1UUE A;  3A98 A;  4ESR A;  2KRM A;  2QDL A;  2K3B A;  3EHQ A;  1JO8 A;  1WXT A;  4HVW A;  1I1J A;  1AZE A;  2C0O A;  4Y92 A;  2V1Q A;  2FPD A;  2ED1 A;  1K4U S;  1CSK A;  1X6G A;  2AZS A;  1UE9 A;  4IIO A;  4IIM A;  3M0S A;  4X1V A;  2O88 A;  4AG1 C;  1Y57 A;  4OMO A;  2D1X A;  2LNH B;  2J06 A;  2W0Z A;  2XMF A;  4GBQ A;  4LUE A;  2HEQ A;  4HVV A;  1X69 A;  1E6G A;  2K7A A;  1RLQ C;  1VYU A;  2O2O A;  2LQW A;  2EKH A;  1VA7 A;  2HCK A;  2J6O A;  1QLY A;  2ROT A;  2CDT A;  5L23 A;  1FMK A;  4CC2 A;  1Y0M A;  1RLP C;  1BB9 A;  2J6F A;  2JXB A;  1M3B A;  2B86 A;  2O31 A;  3IQL A;  4OMQ A;  4R0K A;  2FPE A;  4CC3 A;  2RN8 A;  1ZSG A;  1SEM A;  2GQI A;  4J9H A;  4AG2 C;  2YDL A;  1T0J A;  2KXC A;  4J9D A;  4RTU A;  2K2M A;  1M30 A;  1QWF A;  1KFZ A;  2YT6 A;  2ECZ A;  3EG3 A;  1WFW A;  3GBQ A;  1CKB A;  1ARK A;  2CT3 A;  5FW9 A;  1W70 A;  1M3C A;  2DF6 A;  1JU5 C;  2RF0 A;  4RTY A;  2KE9 A;  2YUO A;  2JMA A;  3M0U A;  2DL4 A;  1GCQ A;  1X2K A;  2KRS A;  3KFV A;  3M0T A;  3UA7 A;  4OMM A;  1I0C A;  1NYG A;  1K76 A;  3VRY A;  2KRO A;  1XOV A;  3NHN A;  1YWP A;  3EG0 A;  2NWM A;  1GFC A;  2KGT A;  1SHF A;  2A08 A;  2J05 A;  1PRL C;  3O5Z A;  1JXO A;  1KIK A;  3TVT A;  2VWF A;  1VYV A;  2AKK A;  2SRC A;  1OPK A;  1H8K A;  4J9I A;  1H3H A;  2DE0 X;  1MUZ A;  3NPF A;  1H92 A;  3ULR B;  1UDL A;  2DL7 A;  1M8M A;  2EVR A;  4J9E A;  2LP5 A;  4D8D A;  1PNJ A;  2RNA A;  4ZNX A;  4WCI A;  4AFS C;  1ZUK A;  4OMP A;  1OPL A;  4AFU C;  2G6F X;  2J6K A;  3I9Q A;  1E7O A;  2MIO A;  4LE9 A;  2A36 A;  4JJD A;  3VS5 A;  4Z8A A;  2GNC A;  2KYM A;  1U5S A;  2BTT A;  3QWY A;  3EHR A;  4AFZ C;  1ZUY A;  2D0N A;  3VS0 A;  4GLM A;  3I5S A;  1TUD A;  2AKL A;  2K79 A;  1NLO C;  4JJC A;  2HSP A;  5ECA A;  1GL5 A;  1HD3 A;  1AVZ C;  2DNU A;  4FSS A;  2F2X A;  5EC7 A;  1N5Z A;  1UTI A;  3VS2 A;  2EBP A;  2H8H A;  2L3P A;  2EYW A;  3VRZ A;  2BZY A;  2YSQ A;  1JXM A;  2DJQ A;  4KRT A;  3REA B;  2JS0 A;  5GJV B;  2DX1 A;  1ABO A;  1ZLM A;  2L0A A;  2F2W A;  2W10 A;  2KYB A;  1UJY A;  1WX6 A;  2EQI A;  2HDA A;  1AWW A;  1NEG A;  2PTK A;  3M0Q A;  4J9B A;  1WA7 A;  5IH2 A;  2DL8 A;  4AFQ C;  2LZ6 B;  1SHG A;  1M3A A;  2AK5 A;  4RUG A;  3CQT A;  4HVU A;  4RTV A;  1K0S A;  1A0N B;  1UJ0 A;  1IO6 A;  2RMO A;  2LJ1 A;  2MCN A;  1BK2 A;  4QT7 A;  2C0T A;  4RTX A;  1U06 A;  1AWJ A;  4LNP A;  4DEX A;  1PKS A;  3NGP A;  1HJD A;  2I0N A;  2CH4 A;  4F14 A;  1VYT A;  2PNI A;  3UAT A;  3PVQ A;  3H41 A;  1X2Q A;  2DL3 A;  2DLP A;  3ZL7 C;  2KRN A;  4OML A;  2FEI A;  2M0Y A;  5IHK A;  1HSQ A;  2A28 A;  3VS3 A;  2KBT A;  5I22 A;  2RQV A;  3EG2 A;  4A63 B;  4F16 A;  1LCK A;  3UA6 A;  3VS7 A;  2ENM A;  1KSW A;  1UGV A;  1TG0 A;  5IHN A;  2CSI A;  1WIE A;  1OOT A;  1JQQ A;  1Z9Z A;  2DBK A;  3VS1 A;  2C0I A; 
#chains in the Genus database with same CATH topology
 1U3O A;  4JRK A;  2F2V A;  2KT8 A;  3OS2 A;  2ROL A;  4KGZ B;  1HYO A;  5IHI A;  4BUG A;  2JOY A;  3EGU A;  3HRS A;  4PFP A;  5CIU A;  4MZM A;  3SWN A;  3A8G B;  1M8V A;  3UF4 A;  3QWX X;  2QAZ A;  2VVK A;  3CCR A;  4F7U E;  3H0H A;  1VQ8 A;  2QQS A;  3L42 A;  2LX7 A;  2NUP B;  1YP5 A;  2XIC A;  2MYS A;  1NJI C;  2OX7 A;  4ANJ A;  1YJN A;  3M55 A;  1MMG A;  3G7Z A;  3CC4 T;  1IGU A;  2YLB A;  2VB6 A;  3RDV A;  3JCM b;  2LQK A;  2Z0W A;  1G3Y A;  3OW2 S;  2QQB A;  3F70 A;  3C0C A;  4M78 A;  2OAW A;  2SEM A;  5LJ3 j;  1D0Z A;  1EZZ B;  1MMD A;  2DM1 A;  4LDY A;  1UHC A;  4M7A F;  3NFC A;  1UEB A;  1JB0 E;  1B07 A;  2VXE A;  4BI4 A;  2K57 A;  2X4W A;  3VV0 A;  1G2B A;  4JLI A;  2XDD A;  1DJ7 B;  2JMC A;  3G6E T;  4FW2 A;  1GBQ A;  3V8L A;  4E7H A;  4OB1 B;  3MP1 A;  1K9M C;  4PFZ A;  2GQV A;  2L3S A;  3KUF A;  2QEX A;  3EGX A;  4K11 A;  3CCJ T;  3EFO B;  3SDZ A;  4PKC C;  1X27 A;  2RHU A;  4JZ3 A;  1VIE A;  2Y90 A;  1YI2 T;  2HAX A;  4C92 G;  4B9W A;  4FYV B;  2P4R A;  3DB4 A;  5AYF A;  1TS9 A;  1B3Q A;  3CCL Q;  4KGX B;  3MPU B;  2CUD A;  5FRM A;  5KYX A;  4J83 A;  1JEG A;  1G83 A;  4C8Q C;  1YCS B;  1R0C B;  2MI6 A;  2VYT A;  3OW2 A;  4HCC A;  1GRI A;  1NJI R;  1D0X A;  1UFF A;  5IT9 E;  4C0D C;  1NPR A;  2GFU A;  4RTW A;  4JRI A;  3TSW A;  4EMH A;  1M1G A;  3DKM A;  2KNB B;  3CCU T;  4OVA A;  4NOY A;  1WJQ A;  1K0X A;  2DVJ A;  4IUT A;  2XG8 D;  2V8K A;  3EG9 A;  3VKI A;  2KXD A;  3J80 E;  2QI2 A;  3PNW C;  2E3H A;  1UG1 A;  2HMA A;  2GTO A;  5GAN 6;  1VQ6 T;  1PSF A;  5FRO A;  4C92 A;  1Z9Q A;  3BY7 A;  3I56 Q;  4E7J A;  4M78 D;  3Q1J A;  2RHZ A;  2LRQ A;  5GAO m;  2KVQ G;  1K9M R;  5GMK e;  2OTJ Q;  3SHW A;  3OW2 P;  4IUV A;  2EGE A;  1NG2 A;  1PHT A;  2CGH A;  1N8R U;  5CCA A;  1PWT A;  2Y4Y A;  2KEA A;  2D8J A;  2ATC B;  1T0H A;  3OQ5 A;  1CKA A;  1FMV A;  1BBZ A;  2NUP A;  2DYB A;  4FSX A;  5IXB A;  4JUV A;  1YJ9 T;  2JM8 A;  2RHY A;  3R6O A;  1KQS A;  3JV3 A;  3EG1 A;  3FIF A;  2J7I A;  4M77 B;  1M1F A;  1J3T A;  4M4Z A;  1O75 A;  2CUB A;  3CPF A;  2PQW A;  3BDU A;  4AT1 B;  3OYA A;  2DA9 A;  2DBM A;  1BCM A;  2QDL A;  3EHQ A;  2DIG A;  2FB7 A;  4II1 A;  1WJR A;  1Q86 U;  3GNF B;  4FU6 A;  1AZE A;  2C0O A;  1N9R A;  2LC4 A;  4R55 A;  4XTZ A;  3CCE A;  2ED1 A;  3CC7 A;  4Y91 A;  2C06 A;  3M58 A;  1K4U S;  1M1K R;  1XQH A;  4XTV A;  2W0Z A;  2J06 A;  4LUE A;  3QPH A;  3HP9 A;  4HVV A;  4P5N A;  4BDY A;  2HSE B;  1VYU A;  2RH2 A;  3X25 B;  1K8A U;  2LQW A;  1XJW B;  4M75 B;  3EFO A;  2QTX A;  3CC4 Q;  1KQS P;  2J6O A;  1M9S A;  2CDT A;  1Y0M A;  4ZGE B;  1QCN A;  2MPX C;  3CME A;  3BW1 A;  3FB9 A;  2O01 E;  3IQL A;  2HNI A;  5GAN j;  2R58 A;  3CBM A;  4M78 E;  1SEM A;  2HZY A;  3JCM c;  2DXC A;  1T0J A;  2JVV A;  3CCV A;  1M30 A;  3GNG A;  4GLK A;  2L8D A;  2QQR A;  4C92 D;  1QVG S;  3EG3 A;  2RI2 A;  3GBQ A;  2DEQ A;  3MCA B;  2WSC E;  2CT3 A;  4DBQ A;  3RR6 A;  4O5V A;  3EAE A;  4Y28 E;  3OYE A;  4N4H A;  5D7U A;  2DF6 A;  1OI1 A;  4J7I A;  1JU5 C;  4RTY A;  1K73 C;  3CD6 A;  2DL4 A;  3M0T A;  2LVM A;  3I55 T;  4OMM A;  2K4Y A;  1WHK A;  1WQ7 A;  4E7K A;  3NHN A;  3L2Z A;  4PJL A;  1YI2 Q;  4LDX A;  3M5A A;  1HK9 A;  2IPO B;  4M7D B;  1PRL C;  2HL3 A;  3TVT A;  3HKS A;  5FU7 C;  2SRC A;  1YJW A;  1YHQ A;  3NPF A;  1H92 A;  3ULR B;  1M8M A;  2P84 A;  2EVR A;  2KDS A;  2O4X B;  3HHT B;  3FC3 A;  4J9E A;  2LP5 A;  4D8D A;  1VQK T;  2OTL T;  1PNJ A;  2RNA A;  1IHV A;  4WCI A;  1ZUK A;  4J6X A;  4OMP A;  2J6K A;  4C0Z A;  4JS5 A;  4M75 G;  3LLR A;  1G3T A;  1W4S A;  3CCU Q;  3VS5 A;  5KYU A;  4PJO B;  4X9C A;  4NS5 A;  3EHR A;  3GF5 A;  2D0N A;  2ZPB B;  2AKL A;  1NLO C;  4JJC A;  1HD3 A;  1AVZ C;  3JCM h;  2DNU A;  3RMS A;  2E6N A;  1VQ6 Q;  5EC7 A;  3CMA A;  4KT0 E;  5KCH A;  3MEV A;  4C92 E;  2A3L A;  2EBP A;  3ME9 A;  2EYW A;  3V8J A;  5IAY A;  2YSQ A;  1RAB B;  2DJQ A;  1IRE B;  5GJV B;  1UGP B;  5LJ5 g;  3OYG A;  1ZLM A;  2MWP A;  2BUD A;  1K73 R;  1UJY A;  4M7A C;  1NEG A;  1WA7 A;  3E2U A;  5IH2 A;  1MMA A;  2BE7 D;  3MEU A;  4B6M A;  4ELZ C;  4RUG A;  2X51 A;  1YJ9 Q;  4RTV A;  1K0S A;  4M75 A;  1VQ7 T;  4MZP A;  2LJ1 A;  4DOV A;  4M7D G;  1PC0 A;  4M78 F;  1KC8 U;  1SKU B;  4RTX A;  1AWJ A;  4BY6 C;  4CRI A;  5D6Y A;  2I0N A;  3CXC A;  4EMK A;  2EAY A;  4XTY A;  1VYT A;  3QJY A;  1SG5 A;  4EPC A;  2QQ9 A;  3PVQ A;  1QW1 A;  4IUQ A;  2YWW A;  4ME7 A;  5IHK A;  3QZ5 B;  4C5E A;  1VQO A;  1SSF A;  4A4F A;  5I22 A;  2RQV A;  2JTM A;  2COY A;  4D6W A;  1LCK A;  3OYM A;  4NL2 A;  2I2L A;  1KSW A;  3JAM E;  1TG0 A;  1OX8 A;  4PJO G;  5IHN A;  2K5F A;  1N6A A;  4FYW B;  4RG8 A;  5DLQ E;  1W2B S;  3VS1 A;  3PFS A;  1EX4 A;  2BIV A;  3A8M B;  4OB0 B;  1B34 B;  5CAI A;  2R57 A;  2EYY A;  2YHT A;  3CXC P;  3SD4 A;  4M7D A;  2DXU A;  1AWX A;  1EFN A;  2GGR A;  3S3O A;  2PZ1 A;  1LPL A;  3VUZ A;  1T3L A;  1Y7X A;  2KAF A;  1VQM T;  2H3E B;  3PTA A;  4ORZ A;  2COZ A;  2O4X A;  1UEC A;  2EW3 A;  3ASK A;  1RUW A;  2L89 A;  2V1R A;  2HBP A;  2GBQ A;  4LDU A;  2GFA A;  2LQN A;  5AT1 B;  2QK0 A;  1OUL A;  4PFO A;  4C5G A;  2MK5 A;  2JW4 A;  4Z02 A;  1FMW A;  2EYZ A;  5GAM f;  4PJO A;  3I56 A;  4J9C A;  2JT4 A;  3JB9 H;  3ER0 A;  4ZTF A;  4C92 F;  2ED0 A;  3QZ9 B;  4M75 D;  3QDR B;  1AWO A;  2E12 A;  2FVU A;  5HCK A;  1WI7 A;  4PLI A;  1BI2 A;  2EFI A;  2OI3 A;  1W2B A;  3H0F A;  2ZPE B;  4E7I A;  1FYN A;  3C12 A;  1E6H A;  1VQK Q;  3I35 A;  1WYX A;  1I81 A;  2DPP B;  4FIB A;  5GMK l;  2RJE A;  1N8R C;  1KJW A;  1UB4 A;  2L3R A;  3UT1 A;  1OEB A;  2JTE A;  4BB7 A;  1RAH B;  4XQ3 A;  2DL5 A;  2FRY A;  2RK2 A;  1WHJ A;  1AOJ A;  3RBB B;  2OTJ T;  3RUX A;  3TEE A;  3CCQ Q;  2LDM A;  2R5A A;  1LVK A;  4C0G A;  5LJ3 f;  3TQ7 P;  3VU3 C;  3CCM Q;  2LJ3 A;  3FDR A;  1IB8 A;  5J26 A;  5IXF A;  2QAS A;  1W2B P;  1ZX6 A;  4E7L A;  1Q86 C;  4M7D D;  2KMT A;  4M78 G;  1QVP A;  4DEY A;  4BI8 B;  2CZ6 B;  3L2V A;  3CC4 A;  3NMZ C;  1VQ9 Q;  2DRK A;  2EGC A;  1SPK A;  2RD1 A;  1BYM A;  2L5Q A;  4LXC A;  4QVD A;  3THK A;  3FJP A;  2EQU A;  1G3S A;  2MAM A;  2JZ2 A;  1R8O B;  4N4G A;  2M1H A;  1K8A C;  3QJ6 A;  5GJW B;  1VQ7 Q;  4M75 E;  2K6D A;  1B34 A;  2F5T X;  3JCM P;  1UHF A;  5GAM h;  4PJO D;  3G6E A;  1PG5 B;  4MMK A;  3G71 A;  2O9S A;  1YN8 A;  2YUP A;  4FT4 A;  1ZQ1 A;  1N8R R;  2DVE A;  1M90 U;  2M02 A;  3I5R A;  3CCJ A;  3JCM J;  1ABQ A;  2DMO A;  3GLX A;  3LH5 A;  1WLP B;  1YWO A;  1AEY A;  2X3X D;  1WXU A;  2EQJ A;  3REB B;  4F17 A;  1YI2 A;  3CCS Q;  1OU9 A;  3FJ5 A;  1VIF A;  2FZK B;  2CH4 W;  5A0L A;  3R6N A;  4E47 A;  2LCS A;  3S3N A;  3HTR A;  1UUE A;  3A98 A;  4XAX B;  2X4Y A;  3M4G A;  5CO7 A;  4KUD K;  1BI0 A;  1WXT A;  5FU6 B;  4HVW A;  3EFR A;  2RHI A;  1VQP A;  1Q86 R;  3VYG A;  4KUI A;  4M7D E;  2O88 A;  3M0S A;  3E9G A;  5LJ3 h;  3RIR A;  1VQM Q;  3CCR T;  2ZPG B;  3MP6 A;  1VQ8 T;  3OY9 A;  1VQ4 Q;  4N0A A;  3QO3 A;  2H3J A;  3CCU A;  1MMN A;  3M57 A;  3CC2 Q;  2O2O A;  3M56 A;  2E64 A;  2EKH A;  1VA7 A;  3NTK A;  5FLX E;  3SWN C;  5KYY B;  1K8A R;  4ZN3 A;  1BIB A;  2J6F A;  2O31 A;  3PT9 A;  4OMQ A;  4QW2 A;  4CC3 A;  2HQX A;  1ZSG A;  1ACM B;  2GQI A;  4J9H A;  7AT1 B;  1KQS S;  4AG2 C;  1OZ3 A;  4PJO E;  2KXC A;  4RTU A;  5LJ5 d;  4MML A;  1I5O B;  1M4Z A;  4XTX A;  2E10 A;  3JCM e;  2RB6 A;  2RJC A;  2IG0 A;  1VOM A;  4LDW A;  3X28 B;  1U1T A;  5FW9 A;  2CZ0 B;  1M1K C;  1YFN A;  4M78 C;  1QMC A;  1I5L A;  3X26 B;  1SF9 A;  2QEX T;  2LQ8 A;  2KE9 A;  2ZCF B;  3M0U A;  3INZ A;  2PU9 B;  1GCQ A;  4OF1 A;  2ZPF B;  5GAO r;  3UA7 A;  1MHN A;  3QKJ A;  1K76 A;  3CBO A;  4PK4 A;  1O9S A;  3VRY A;  1XOV A;  1BI1 A;  2XID A;  3JCM g;  3AT1 B;  1FX7 A;  3EG0 A;  4M75 F;  1GFC A;  2KGT A;  1SHF A;  2CP5 A;  3OYK A;  1JXO A;  2RI3 A;  3KXT A;  1OPK A;  1HXD A;  2EWN A;  1QP2 A;  5CVI A;  5GAN f;  5KCO A;  2V8J A;  1M5Q 1;  1UDL A;  2AT1 B;  2F1L A;  5CQX A;  2ZZD A;  5KYN A;  1PSE A;  3LH0 A;  4ZNX A;  1VQ5 A;  1TWB A;  4XK8 E;  4AFS C;  1OPL A;  4FW1 A;  1PD0 A;  2G6F X;  1E7O A;  2MIO A;  3OYH A;  3OS5 A;  4Z8A A;  1ZUY A;  4GLM A;  4EDU A;  4IKF A;  3I5S A;  3SFM A;  1G8X A;  1KD1 U;  1GL5 A;  4OMF B;  1V76 A;  2RK1 A;  4KUL A;  2F2X A;  4M7D F;  2X4X A;  3FEO A;  3OBY A;  5GMK i;  1PM3 A;  2DX1 A;  2M9U A;  2JN0 A;  2AIR B;  4OGE A;  3SB2 A;  2HDA A;  3X20 B;  3MEA A;  4IUP A;  4C92 C;  2YRD A;  2QXF A;  3HRU A;  2ZGW A;  2DL8 A;  2LZ6 B;  3I55 A;  2AK5 A;  1FWZ A;  3G4S A;  1KHC A;  4WTO B;  4HVU A;  1A0N B;  1UJ0 A;  2MCN A;  1BK2 A;  2NUT B;  5KYY A;  4NL3 A;  2C0T A;  2F5K A;  4PJO F;  4DEX A;  3OYF A;  1PKS A;  3NGP A;  1KC8 R;  1HJD A;  3VYH B;  1C1A A;  4F14 A;  5GAO l;  4F7U B;  2P4T A;  2XKO C;  4FT2 A;  4ZGJ B;  3UAT A;  4WF2 A;  1S72 A;  2QDY B;  3ZL7 C;  1VQK A;  2OTL A;  3CCE T;  3HSB A;  1QP3 A;  1JRI A;  3EGD B;  1ZA1 B;  5KE2 A;  4M77 G;  4FL6 A;  2KBT A;  5GAN h;  2QGF B;  4XTU A;  2HKN A;  3TU4 K;  3CCR Q;  4X34 A;  1VQ8 Q;  1VQN T;  3E19 A;  4RKU E;  1VQL T;  2RHX A;  2CSI A;  3OMG A;  1JQQ A;  1Z9Z A;  2ZPH B;  1YIJ A;  4A54 A;  1YIT A;  1QCF A;  1MV3 A;  4CC7 A;  1K1Z A;  2YUQ A;  3H0I A;  3PGG A;  1D3B B;  3CME T;  4A4H A;  2L2P A;  2HKQ B;  2E6Z A;  4DBR A;  3QUI A;  4JPB W;  1G5V A;  3HRT A;  1TU0 B;  2VC8 A;  4VUB A;  2DXT A;  2FRW A;  4GY5 A;  5EG2 A;  4RMO A;  3QBY A;  2WSF E;  2RQR A;  3OA6 A;  2R5M A;  4IUR A;  2RI5 A;  1D1A A;  3CXC S;  2K3X A;  3TCJ A;  2JS2 A;  2GTJ A;  2RQU A;  1OV3 A;  1QKX A;  3DLL A;  2QA4 T;  4OMN A;  2COW A;  4M77 A;  3CCQ T;  2VGM A;  5LJ5 e;  1WDX A;  1ZSZ B;  2RQT A;  1IGQ A;  2QEX Q;  2HBW A;  5LL6 S;  1EIF A;  1UGQ B;  3CCM T;  1TH7 A;  4BE2 A;  2LCC A;  5I11 A;  3MET A;  2M51 A;  4RTT A;  3RKX A;  1C0M A;  4DBF A;  1BU1 A;  2BZX A;  1PKT A;  2L3Q A;  2YUN A;  4ELY C;  1W6X A;  2CP2 A;  1XNI A;  1BI3 A;  2KT1 A;  1NEB A;  1NM7 A;  2GF7 A;  1YJW T;  2DIL A;  1VQ9 T;  3OYL A;  5FRN A;  3RER A;  1QKW A;  1QVF A;  5GMK j;  2BZ8 A;  3CEY A;  1RAG B;  3A8O B;  2D9T A;  1RAI B;  2VXF A;  1SRL A;  4Z89 A;  2XU8 A;  2O9V A;  2VV5 A;  2P0K A;  4L5G A;  1M90 C;  1WPY A;  2M16 A;  4RTZ A;  4L59 A;  1Q7Y U;  5GAM g;  2VKN A;  2NUT A;  5GAN 2;  4LD9 K;  5FWC A;  3CMA T;  2D8H A;  4F7U A;  1KHI A;  1WJS A;  3V7R A;  1RI0 A;  3M59 A;  1ZUU A;  2JM9 A;  3M53 A;  4HCB A;  1I07 A;  3MO8 A;  1QVF P;  3CCS T;  1SRM A;  3EGD A;  3OB9 A;  4QVZ A;  2DXB A;  5HKC A;  3CCL A;  3RNJ A;  3OYJ A;  3QXE B;  4C5H A;  4E7Z A;  1WXB A;  3G1J A;  4OB2 B;  1RI9 A;  1UGS B;  4KGV B;  4E2F B;  2EYX A;  3M0R A;  5HY6 A;  4M77 D;  3X24 B;  1X6O A;  2CYZ B;  1GFD A;  2NUZ A;  2FPF A;  3M0P A;  1Q95 G;  1D3B A;  1I8F A;  5LJ3 g;  1PRM C;  3SWN B;  4CC4 B;  1IZ6 A;  1ZBJ A;  3P8D A;  2ZPI B;  1VQ4 T;  1NPP A;  1T3S A;  2AZV A;  2GCX A;  2KR3 A;  3VJP A;  3CC2 T;  2CSQ A;  2IIM A;  2RPN A;  4M75 C;  4C8Q B;  2E3I A;  2RJF A;  2EQM A;  3CCE Q;  3CC7 Q;  1M90 R;  3JCM d;  4HXJ A;  4C0D B;  4R56 A;  2DTO A;  3U23 A;  2PUO B;  4EMK C;  2X35 A;  2FZG B;  4UC4 A;  1VQN Q;  2MOX A;  1VQL Q;  1ZSZ A;  5GAN 5;  4LUD A;  2OTJ A;  4ESR A;  2KRM A;  3J81 E;  1JO8 A;  2KQW A;  4XU2 A;  1QCO A;  3CME Q;  2V1Q A;  4ATO A;  4RCC A;  1OX9 A;  1CSK A;  4IIM A;  1WHH A;  4AG1 C;  3ZEH A;  3JCM X;  4OMO A;  1N9S A;  2QGG A;  3UDC A;  3AHU A;  5GAO p;  2XMF A;  4GBQ A;  2HEQ A;  4O6J A;  3LWI A;  3WVE B;  3OS1 A;  1E6G A;  1RLQ C;  5GAN 8;  4M7D C;  1QLY A;  2QA4 Q;  2ROT A;  5L23 A;  4CC2 A;  1UGR B;  1RLP C;  1BB9 A;  4AMC A;  1Q81 U;  2DK3 A;  3V7C A;  3C94 A;  2JUF A;  3CPW S;  3A8L B;  2B86 A;  4M77 E;  2DKG A;  3RKY A;  3CD6 Q;  2LX9 A;  4HT9 A;  4R0K A;  2RN8 A;  2CZ1 B;  3QDF A;  5LJ5 j;  3QG1 A;  1WZO A;  2K2M A;  1WGS A;  5KYW B;  2DTH A;  1AT1 B;  1CKB A;  1ARK A;  2D0Q B;  4C8Q G;  1Q82 U;  1YJW Q;  1YHQ Q;  4PJO C;  1M3C A;  3MJX A;  4XU0 A;  3E1S A;  2YUO A;  2JMA A;  5KE3 A;  4X9D A;  1NYG A;  5C0M A;  2KRO A;  2MMP A;  3C95 A;  1GXI E;  1RAF B;  1YWP A;  4FYX B;  2E4H A;  2A08 A;  3A8H B;  3OSS C;  4DA4 A;  1KIK A;  3HPW A;  4ZTJ A;  2E41 A;  3QSU A;  1H8K A;  4J9I A;  2DE0 X;  2DD5 A;  2FL7 A;  1KQ1 A;  3T9N A;  2DL7 A;  3JB9 G;  2QQA A;  4KH1 B;  3CMA Q;  3CPW A;  2LT1 A;  1XTD A;  5HK0 A;  1YCY A;  4BE1 A;  2XD0 A;  1FXX A;  4TVR A;  3MKD A;  4C8Q A;  1TUG B;  3I9Q A;  1M2O A;  4LE9 A;  3MP8 A;  2A36 A;  2DEU A;  2HL5 C;  4A4E A;  1U5S A;  2BTT A;  1RL2 A;  5GAN e;  4AFZ C;  3VS0 A;  4JRQ A;  3OYC A;  5A0D A;  1TUD A;  2K79 A;  4RG2 A;  1VUB A;  2HSP A;  1OQK A;  3O8V A;  4JDS A;  4ZN1 A;  1KD1 R;  4XU1 A;  1N5Z A;  1UTI A;  3VS2 A;  2H8H A;  3LX7 A;  3VRZ A;  2BZY A;  3KBG A;  3UWN A;  3E9F A;  5GAN g;  2JS0 A;  5CKH A;  5FU7 B;  2EJ9 A;  1RAE B;  3G71 T;  1WNL A;  2P0P A;  3CPW P;  1YJN T;  2W10 A;  2KYB A;  1F1B B;  3OS0 A;  1AWW A;  2PTK A;  3M0Q A;  4HA8 A;  2K2V A;  8ATC B;  4AFQ C;  1SHG A;  1M3A A;  1VQO Q;  3CQT A;  2PVG B;  4M77 F;  4PNO A;  1VQ6 A;  3M54 A;  2RM4 A;  2RMO A;  4RCB A;  2EJF A;  3QII A;  1U06 A;  3OSV A;  4EMG A;  3J7A F;  3RKW A;  1MNE A;  2CH4 A;  2G3R A;  2XDB A;  1IRX A;  3OYY A;  2NYS A;  2EQK A;  2EYQ A;  1X2Q A;  2KI7 A;  1VQP T;  5KYW A;  2DLP A;  2KRN A;  2FEI A;  2CP0 A;  4L6V 5;  5GAN 7;  1U1S A;  1HSQ A;  3VS3 A;  1YJ9 A;  1QQJ A;  2OAU A;  1H64 1;  3EFS A;  1I4K 1;  1TTH B;  3VS7 A;  5DM7 R;  4BI3 A;  4LD6 A;  5GAM d;  2P0Q A;  2X4J A;  1WIE A;  4M7A B;  1OOT A;  4C8Q D;  2DBK A;  3JRZ A;  2WSE E;  4JZ4 A;  1JBM A;  3JB9 J;  4QQD A;  4KBM B;  1P92 A;  3LYI A;  2CRE A;  3P8H A;  2LMJ A;  1KC8 C;  3HL8 A;  4IUU A;  4N0A C;  2DER A;  3URG A;  4B9X A;  1W1F A;  2CT4 A;  2M0O A;  4BY6 B;  1Y96 B;  4BD3 A;  1Q7Y C;  2K3Y A;  4Q5W A;  4C5I A;  4F7U F;  4A4G A;  1D1C A;  3LW5 E;  5GAO n;  5FWB A;  2E70 A;  3LGL A;  5C6S A;  3GOX A;  2A7Y A;  2DJZ A;  3GIB A;  1TUC A;  3VS6 A;  5KYU B;  2PUK B;  3L2U A;  3JB9 D;  1TXQ A;  3JSC A;  2ESW A;  4J8O A;  3LGF A;  2OJ2 A;  3BDL A;  5LJ3 d;  3C4S A;  4EIK A;  3OYD A;  1BKB A;  2EJG A;  1Y71 A;  2HD0 A;  2QYZ A;  4J5Y A;  2RA2 A;  3RMQ A;  3V7S A;  4J9F A;  1M27 C;  1GCQ C;  1PCX A;  1NLP C;  3JCM Q;  2A37 A;  3WVD B;  3PE0 A;  4HCK A;  3SEM A;  6AT1 B;  1VQ5 T;  3A1P A;  2EGA A;  3CBP A;  1MV0 B;  2XK0 A;  3P8B B;  1VQN A;  1V1C A;  4M7A G;  1VQL A;  4CI0 C;  1ZA2 B;  4C8Q E;  4PJM A;  4N4I A;  3NTI A;  1LOJ A;  3JCM f;  2B8A A;  2CP7 A;  2A0F B;  3L2Q A;  3V8K A;  2K5L A;  3DB3 A;  3VS4 A;  5M9O A;  5HK3 A;  5CR2 A;  1Q7Y R;  2VUB A;  2FO0 A;  1X43 A;  1D1B A;  3L2R A;  1NJI U;  3MEW A;  4EMK B;  2QTV A;  3CC7 T;  4PJJ A;  1YNZ A;  1AZG B;  2YXY A;  1GBR A;  2YRC A;  1QWE A;  4JS4 A;  2K9G A;  3A5Z B;  3QYH B;  1LNX A;  1WHG A;  3FRN A;  3G6E Q;  2DZ9 A;  5I2M A;  4J6Y A;  3TSZ A;  1IXD A;  3G71 Q;  2LJ0 A;  1AD5 A;  1YJN Q;  2RQW A;  2QA4 A;  1S1N A;  4OP0 A;  1ZBX A;  4J7F A;  1MGQ A;  1WHL A;  3CCQ A;  1QVF S;  1NYF A;  5FU6 C;  2DD4 A;  3HFN A;  3CCJ Q;  3QHS A;  3S6W A;  3CCM A;  4Z88 A;  4D8K A;  5CQY A;  5D6W A;  3G4S T;  4M7A A;  2HQE A;  2FG0 A;  4HT8 A;  1OYX A;  2VGN A;  2YRV A;  4J9G A;  1K9M U;  3PVL A;  3PIO A;  1KG1 A;  1AHJ B;  4OB3 B;  3CCV T;  1LJO A;  9ATC B;  3OYN A;  1Q81 C;  3VUB A;  2EPD A;  3OBW A;  4JJB A;  3JCM V;  4QQG A;  2JTF A;  1VQ9 A;  1Y96 A;  2E5K A;  1WQW A;  4E6R A;  1VQP Q;  1S72 T;  4C0F A;  2CP3 A;  2RJD A;  2ABL A;  1SSH A;  2DRM A;  5D6X A;  1K9A A;  3CD6 T;  1X6B A;  2XI9 A;  3ZBD A;  1GCP A;  1X01 A;  1VQ7 A;  1Q82 C;  3DLM A;  2V26 A;  2X3W D;  2XDP A;  4LN2 A;  1D09 B;  4YTL A;  4F7U G;  1QVG A;  2WAC A;  1KQ2 A;  1B7T A;  1YIJ T;  2K3B A;  8AT1 B;  5DY9 A;  1YIT T;  2E5Q A;  1I1J A;  4MDX A;  3M9Q A;  1YHQ T;  4Y92 A;  3PIP A;  2FPD A;  2KSS A;  2DAQ A;  1M1K U;  2X9H A;  5GAM e;  1X6G A;  2AZS A;  1UE9 A;  2RO0 A;  4IIO A;  4X1V A;  2D6F A;  4V2S A;  2DTI A;  4A53 A;  1Y57 A;  3FLG A;  2DO3 A;  2D1X A;  2JJ9 A;  5A2Q E;  4J6W A;  3CCS A;  2LNH B;  3BE3 A;  3OYI A;  3QYG B;  1X69 A;  1Y07 A;  1RAA B;  2K7A A;  1X75 C;  4PLL A;  1OU8 A;  4C8Q F;  2FZC B;  3GPL A;  2HCK A;  1BCO A;  2EIF A;  1FMK A;  1G3W A;  1C6V X;  2JXB A;  1M3B A;  1QVG P;  5GMK h;  1R77 A;  1Q81 R;  1RAD B;  2FPE A;  4BAC A;  5GAN d;  3OMC A;  2YDL A;  5I2S A;  1NBE B;  3EH2 A;  4FM4 B;  3EH1 A;  4J9D A;  1VQM A;  2PVO B;  2DYI A;  4M7A D;  2Y4X A;  1QWF A;  1VQ4 A;  4PJN A;  4QKU A;  1KFZ A;  2YT6 A;  2ECZ A;  1WFW A;  2DZC A;  1WHM A;  4F04 B;  4M77 C;  2KY9 A;  3CC2 A;  1PD1 A;  4JJN K;  2BE9 B;  4DBH A;  5KH6 A;  5DLO A;  5GAO q;  4HKE A;  2ZAE A;  1W70 A;  4BDZ A;  5LJ3 e;  1M2V B;  1Q82 R;  1JJ2 S;  5GAN 3;  2DIQ A;  3JB9 I;  2VAS A;  5CKD A;  5IN1 A;  3H9N A;  5GMK m;  3JB9 F;  2RF0 A;  2PVD B;  2V8I A;  5GAN 4;  4DQ2 A;  1X2K A;  2KRS A;  3KFV A;  2MF2 A;  1VQ5 Q;  3LWH A;  1I0C A;  1KK7 A;  2FHD A;  2AHJ B;  2BKD N;  4FCY A;  5A0G A;  2NWM A;  2J05 A;  1R0B G;  3O5Z A;  4KH0 B;  2VWF A;  3S3M A;  1VYV A;  2AKK A;  2EKO A;  2CZ7 B;  1OZ2 A;  1H3H A;  4A4K A;  3BFM A;  1MUZ A;  3PMI A;  5LJ5 f;  3D7S B;  4PL6 A;  4HCZ A;  1VQO T;  4FYY B;  4AFU C;  1NZ9 A;  4QQ6 A;  3H6Z A;  1V29 B;  2CP6 A;  4M78 B;  1YBY A;  4JJD A;  2GNC A;  2KYM A;  3QWY A;  2DFU A;  1ZHI A;  3CCL T;  3JCM W;  1D0Y A;  2CKK A;  1U8R A;  4MDW A;  5CKB A;  1MND A;  5ECA A;  3ZFJ A;  5J39 A;  3OYB A;  3I55 Q;  1JJ2 A;  2E1H A;  4FSS A;  3G4S Q;  2F69 A;  4M7A E;  3UPU A;  2L3P A;  3CCV Q;  1JXM A;  4KRT A;  3REA B;  2CS7 A;  1K73 U;  3EGX B;  3GP8 A;  4XTW A;  5CKE A;  1N27 A;  1ABO A;  3M4Y A;  2L0A A;  4ZGD B;  2F2W A;  1BIA A;  1WX6 A;  2EQI A;  1TOV A;  4BE0 A;  1RAC B;  4J9B A;  1S72 Q;  4OGC A;  3L2W A;  4E7S A;  2OTL Q;  2FYK A;  4MZT A;  3RES A;  5I21 A;  2LTO A;  2HQH A;  2LT4 A;  3N5B B;  1IO6 A;  3H8Z A;  4XU3 A;  2JNG A;  4QT7 A;  3I56 T;  3MHX A;  1NE8 A;  5KYX B;  2NLU A;  4LNP A;  4JLG A;  1JJ2 P;  3WXM B;  4QVC A;  5L8R E;  3TRE A;  5CK9 A;  5CKF A;  1YIJ Q;  1IHW A;  1KD1 C;  1YIT Q;  1TSF A;  2XHC A;  3PMT A;  2PNI A;  4JRP A;  2E65 A;  2YLC A;  1H3Z A;  3H41 A;  2LCL A;  2DL3 A;  2LNV A;  2IVW A;  4OML A;  2M0Y A;  2DET A;  4DOW A;  4LDV A;  2A28 A;  1ZSZ C;  5J3B A;  3L1A A;  2K5I A;  3EG2 A;  3EG9 B;  4A63 B;  4F16 A;  3UA6 A;  5LJ5 h;  2ENM A;  1UGV A;  1M2V A;  5GAM j;  2MWO A;  3NTH A;  2KK4 A;  2QG9 B;  4C92 B;  3HFO A;  2C0I A; 
#chains in the Genus database with same CATH homology
 4JZ4 A;  1U3O A;  2F2V A;  1MV3 A;  2KT8 A;  4CC7 A;  2ROL A;  1K1Z A;  2YUQ A;  3H0I A;  5IHI A;  2EYY A;  2L2P A;  3EGU A;  2CRE A;  2LMJ A;  4JPB W;  1AWX A;  1EFN A;  2GGR A;  3UF4 A;  1W1F A;  2CT4 A;  2FRW A;  2PZ1 A;  3QWX X;  1T3L A;  2RQR A;  2VVK A;  3H0H A;  2LX7 A;  1YP5 A;  4ORZ A;  2JS2 A;  2GTJ A;  1UEC A;  2EW3 A;  2RQU A;  5FWB A;  1OV3 A;  1RUW A;  2V1R A;  1QKX A;  2GBQ A;  1TUC A;  2LQN A;  4OMN A;  3VS6 A;  1WDX A;  2RQT A;  2HBW A;  2JW4 A;  3C0C A;  2ESW A;  2OAW A;  2SEM A;  2EYZ A;  2OJ2 A;  5I11 A;  4RTT A;  2M51 A;  4J9C A;  2DM1 A;  4EIK A;  1UHC A;  2JT4 A;  1BU1 A;  1B07 A;  2BZX A;  1PKT A;  2ED0 A;  1G2B A;  2L3Q A;  2YUN A;  1AWO A;  1W6X A;  2JMC A;  2KT1 A;  1NEB A;  1NM7 A;  1GBQ A;  4J9F A;  5HCK A;  1WI7 A;  1M27 C;  1GCQ C;  2DIL A;  1NLP C;  2OI3 A;  1QKW A;  3H0F A;  2BZ8 A;  2A37 A;  1FYN A;  2L3S A;  1E6H A;  4K11 A;  3PE0 A;  3I35 A;  1SRL A;  1QCF A;  1WYX A;  4HCK A;  3SEM A;  4Z89 A;  1KJW A;  2EGA A;  1MV0 B;  1X27 A;  1V1C A;  2O9V A;  4JZ3 A;  1OEB A;  2JTE A;  2DL5 A;  2P4R A;  2FRY A;  4RTZ A;  1AOJ A;  3RBB B;  1B3Q A;  3VS4 A;  2VKN A;  2CUD A;  2FO0 A;  1X43 A;  1JEG A;  2LJ3 A;  1G83 A;  1YCS B;  5FWC A;  1GRI A;  1YNZ A;  2D8H A;  1AZG B;  1GBR A;  5IXF A;  1QWE A;  1UFF A;  1ZX6 A;  2K9G A;  1ZUU A;  2JM9 A;  4RTW A;  1I07 A;  1SRM A;  3TSW A;  4DEY A;  3TSZ A;  2LJ0 A;  1AD5 A;  2KNB B;  3NMZ C;  2RQW A;  2DRK A;  1K0X A;  2EGC A;  1S1N A;  1SPK A;  2DVJ A;  3RNJ A;  2KXD A;  1WXB A;  1NYF A;  3THK A;  1RI9 A;  1UG1 A;  2GTO A;  2EYX A;  4Z88 A;  4D8K A;  2FG0 A;  3M0R A;  5GJW B;  1Z9Q A;  4J9G A;  2K6D A;  1GFD A;  3PVL A;  2NUZ A;  2FPF A;  3M0P A;  1UHF A;  1PRM C;  4CC4 B;  1ZBJ A;  2EPD A;  3SHW A;  2EGE A;  2O9S A;  1NG2 A;  4JJB A;  1T3S A;  1PHT A;  1YN8 A;  2AZV A;  2YUP A;  2KR3 A;  1PWT A;  2E5K A;  2CSQ A;  2IIM A;  2KEA A;  2RPN A;  2D8J A;  4E6R A;  1T0H A;  2ABL A;  3I5R A;  1CKA A;  1SSH A;  1BBZ A;  1ABQ A;  2DYB A;  5IXB A;  2DMO A;  3LH5 A;  4HXJ A;  2DRM A;  1WLP B;  1K9A A;  1YWO A;  2JM8 A;  3U23 A;  1X6B A;  1AEY A;  2X3X D;  1GCP A;  1WXU A;  3JV3 A;  3REB B;  3EG1 A;  4F17 A;  2J7I A;  1J3T A;  3FJ5 A;  4M4Z A;  2CH4 W;  2CUB A;  2X3W D;  2MOX A;  3R6N A;  2LCS A;  4LN2 A;  2DA9 A;  2DBM A;  4LUD A;  1UUE A;  3A98 A;  4ESR A;  2KRM A;  2QDL A;  2K3B A;  3EHQ A;  1JO8 A;  1WXT A;  4HVW A;  1I1J A;  1AZE A;  2C0O A;  4Y92 A;  2V1Q A;  2FPD A;  2ED1 A;  1K4U S;  1CSK A;  1X6G A;  2AZS A;  1UE9 A;  4IIO A;  4IIM A;  3M0S A;  4X1V A;  2O88 A;  4AG1 C;  1Y57 A;  4OMO A;  2D1X A;  2LNH B;  2J06 A;  2W0Z A;  2XMF A;  4GBQ A;  4LUE A;  2HEQ A;  4HVV A;  1X69 A;  1E6G A;  2K7A A;  1RLQ C;  1VYU A;  2O2O A;  2LQW A;  2EKH A;  1VA7 A;  2HCK A;  2J6O A;  1QLY A;  2ROT A;  2CDT A;  5L23 A;  1FMK A;  4CC2 A;  1Y0M A;  1RLP C;  1BB9 A;  2J6F A;  2JXB A;  1M3B A;  2B86 A;  2O31 A;  3IQL A;  4OMQ A;  4R0K A;  2FPE A;  4CC3 A;  2RN8 A;  1ZSG A;  1SEM A;  2GQI A;  4J9H A;  4AG2 C;  2YDL A;  1T0J A;  2KXC A;  4J9D A;  4RTU A;  2K2M A;  1M30 A;  1QWF A;  1KFZ A;  2YT6 A;  2ECZ A;  3EG3 A;  1WFW A;  3GBQ A;  1CKB A;  1ARK A;  2CT3 A;  5FW9 A;  1W70 A;  1M3C A;  2DF6 A;  1JU5 C;  2RF0 A;  4RTY A;  2KE9 A;  2YUO A;  2JMA A;  3M0U A;  2DL4 A;  1GCQ A;  1X2K A;  2KRS A;  3KFV A;  3M0T A;  3UA7 A;  4OMM A;  1I0C A;  1NYG A;  1K76 A;  3VRY A;  2KRO A;  1XOV A;  3NHN A;  1YWP A;  3EG0 A;  2NWM A;  1GFC A;  2KGT A;  1SHF A;  2A08 A;  2J05 A;  1PRL C;  3O5Z A;  1JXO A;  1KIK A;  3TVT A;  2VWF A;  1VYV A;  2AKK A;  2SRC A;  1OPK A;  1H8K A;  4J9I A;  1H3H A;  2DE0 X;  1MUZ A;  3NPF A;  1H92 A;  3ULR B;  1UDL A;  2DL7 A;  1M8M A;  2EVR A;  4J9E A;  2LP5 A;  4D8D A;  1PNJ A;  2RNA A;  4ZNX A;  4WCI A;  4AFS C;  1ZUK A;  4OMP A;  1OPL A;  4AFU C;  2G6F X;  2J6K A;  3I9Q A;  1E7O A;  2MIO A;  4LE9 A;  2A36 A;  4JJD A;  3VS5 A;  4Z8A A;  2GNC A;  2KYM A;  1U5S A;  2BTT A;  3QWY A;  3EHR A;  4AFZ C;  1ZUY A;  2D0N A;  3VS0 A;  4GLM A;  3I5S A;  1TUD A;  2AKL A;  2K79 A;  1NLO C;  4JJC A;  2HSP A;  5ECA A;  1GL5 A;  1HD3 A;  1AVZ C;  2DNU A;  4FSS A;  2F2X A;  5EC7 A;  1N5Z A;  1UTI A;  3VS2 A;  2EBP A;  2H8H A;  2L3P A;  2EYW A;  3VRZ A;  2BZY A;  2YSQ A;  1JXM A;  2DJQ A;  4KRT A;  3REA B;  2JS0 A;  5GJV B;  2DX1 A;  1ABO A;  1ZLM A;  2L0A A;  2F2W A;  2W10 A;  2KYB A;  1UJY A;  1WX6 A;  2EQI A;  2HDA A;  1AWW A;  1NEG A;  2PTK A;  3M0Q A;  4J9B A;  1WA7 A;  5IH2 A;  2DL8 A;  4AFQ C;  2LZ6 B;  1SHG A;  1M3A A;  2AK5 A;  4RUG A;  3CQT A;  4HVU A;  4RTV A;  1K0S A;  1A0N B;  1UJ0 A;  1IO6 A;  2RMO A;  2LJ1 A;  2MCN A;  1BK2 A;  4QT7 A;  2C0T A;  4RTX A;  1U06 A;  1AWJ A;  4LNP A;  4DEX A;  1PKS A;  3NGP A;  1HJD A;  2I0N A;  2CH4 A;  4F14 A;  1VYT A;  2PNI A;  3UAT A;  3PVQ A;  3H41 A;  1X2Q A;  2DL3 A;  2DLP A;  3ZL7 C;  2KRN A;  4OML A;  2FEI A;  2M0Y A;  5IHK A;  1HSQ A;  2A28 A;  3VS3 A;  2KBT A;  5I22 A;  2RQV A;  3EG2 A;  4A63 B;  4F16 A;  1LCK A;  3UA6 A;  3VS7 A;  2ENM A;  1KSW A;  1UGV A;  1TG0 A;  5IHN A;  2CSI A;  1WIE A;  1OOT A;  1JQQ A;  1Z9Z A;  2DBK A;  3VS1 A;  2C0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...