4AFQC

Human chymase - fynomer complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
VTLFVALYDYQADRWTDLSFHKGEKFQILDASPPGDWWEARSLTTGETGYIPSNYVAPVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 12
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4afqC00
2VWFA 2A36A 1RLQC 1ABOA 3VRZA 5ECAA 2LZ6B 4J9EA 1A0NB 2NUZA 2C0IA 1X6GA 1HD3A 2K2MA 1SEMA 4X1VA 4WCIA 2B86A 4RUGA 3U23A 4D8DA 1K4US 2PNIA 4J9GA 1OOTA 3JV3A 1YNZA 1GRIA 2FO0A 1SRMA 2JXBA 4RTWA 3H0FA 4CC4B 2DJQA 1AWXA 1X43A 4Z89A 1CKBA 2DRKA 2ABLA 3PVLA 2CSQA 3H0HA 3QWYA 4J9IA 2DBMA 1YN8A 2KT1A 5I11A 3REBB 2RN8A 1E6GA 2JS2A 2OAWA 3H0IA 2M0YA 1T3LA 1GCPA 2FPEA 2DMOA 1QWFA 1K0SA 3VS6A 3EG0A 2V1QA 1TUCA 4HXJA 1AWWA 4RTUA 2LX7A 4E6RA 1QCFA 3PE0A 4IIMA 1SPKA 1J3TA 1H8KA 2HEQA 4F17A 2AKLA 2FPDA 1WXUA 3VRYA 1T0JA 3VS0A 3THKA 3ZL7C 2KXCA 1G83A 4Y92A 1VYTA 1RI9A 3M0SA 2YUOA 3C0CA 3VS2A 1S1NA 1AZEA 2K9GA 2C0TA 2DLPA 1UJYA 4QT7A 4JJDA 4R0KA 2RQUA 2ENMA 2CUBA 3I35A 2DL5A 3SHWA 1K76A 2DF6A 3NPFA 2JW4A 2ED0A 1SHGA 1NEBA 1T0HA 1JO8A 2DVJA 1WX6A 1WI7A 1UECA 2YDLA 2CUDA 1UE9A 2JM9A 1GL5A 1E6HA 1M3CA 2MCNA 4HCKA 2D1XA 2JTEA 1AD5A 2HCKA 2SRCA 1UUEA 4RTXA 4F16A 4LUDA 1JXMA 1VYUA 1PWTA 1KFZA 4HVVA 3NHNA 4Z88A 4OMNA 1NEGA 3UATA 1BK2A 1AZGB 4J9BA 1SRLA 1ABQA 2QDLA 2W0ZA 2MOXA 1WLPB 2JM8A 4ORZA 1M27C 3FJ5A 3TVTA 1YWOA 5IXFA 1M3AA 2J6OA 2EQIA 2LP5A 1GBQA 2G6FX 1NLPC 1T3SA 1BB9A 1B3QA 2A08A 3REAB 1WXBA 1ZSGA 1UG1A 2GTJA 3EG2A 5IHIA 2YUPA 4DEYA 2MIOA 4LN2A 2KRMA 1K9AA 1AEYA 1K1ZA 2ROLA 2D8JA 1W6XA 2DX1A 4JZ3A 1OPKA 1RLPC 2GGRA 1JEGA 1UHFA 3H41A 2DBKA 2KYMA 2DNUA 4JZ4A 2L3PA 5EC7A 1GFCA 1Y0MA 2EYZA 2KYBA 2LCSA 1KIKA 2JMAA 2RQVA 2FRYA 3I5SA 1U06A 2K3BA 2EYXA 1PNJA 2DE0X 3UA7A 3ULRB 2CSIA 2M51A 4J9CA 2XMFA 4K11A 2V1RA 1H92A 1LCKA 3GBQA 1UDLA 2D0NA 1OV3A 2EKHA 1QWEA 2ED1A 2A37A 2PZ1A 2O31A 2FEIA 3EGUA 2EGAA 2JS0A 2KNBB 4IIOA 2ECZA 5FWBA 1WA7A 1JQQA 2GTOA 2RF0A 3R6NA 2AZVA 1KJWA 2KBTA 4CC2A 1AWOA 2L0AA 2K7AA 2YSQA 2O9VA 4GLMA 1X2QA 1RUWA 2CT3A 2LQNA 4LE9A 2JT4A 2W10A 5IHKA 2O2OA 4AG1C 4D8KA 4AG2C 2A28A 1YP5A 2O9SA 1ZUKA 4KRTA 1YCSB 2RMOA 1U5SA 2ESWA 1K0XA 2OJ2A 2DL7A 2LNHB 5FW9A 2F2XA 3NMZC 4AFUC 1JU5C 1GCQC 4FSSA 2F2WA 1JXOA 4HVWA 3UA6A 1N5ZA 3SEMA 4RTTA 4OMPA 1UGVA 3I9QA 1HSQA 2E5KA 1PRMC 4LNPA 2P4RA 3EHQA 1NLOC 2J05A 2LQWA 2L2PA 4CC7A 2J06A 3UF4A 1X27A 2FPFA 2X3WD 2LMJA 1MV0B 1CKAA 1ARKA 2EPDA 1WIEA 1E7OA 4DEXA 1H3HA 3M0QA 2GNCA 2CREA 2DM1A 4AFQC 4J9FA 1YWPA 1GBRA 1X6BA 1UFFA 1MUZA 1PHTA 1ZBJA 1X69A 2F2VA 1FYNA 3NGPA 1AOJA 2K79A 1BBZA 2YT6A 3LH5A 3M0PA 2RNAA 5IHNA 2NWMA 4RTYA 2HSPA 1Z9ZA 2EBPA 4OMMA 2J6KA 2BTTA 2CDTA 4Z8AA 4J9HA 4RTVA 1M8MA 1UJ0A 3TSZA 2KEAA 1FMKA 2BZXA 1I07A 1NM7A 2EW3A 2DA9A 2EGCA 2FG0A 2GBQA 2PTKA 1TG0A 3M0UA 5HCKA 2KXDA 1IO6A 2RQWA 2DYBA 1AWJA 2J7IA 2ROTA 3VS4A 2KGTA 1X2KA 1QKWA 2D8HA 3PVQA 1ZX6A 1ZUUA 5GJWB 4OMOA 2LJ1A 2LJ0A 3VS7A 2C0OA 5L23A 4ESRA 4EIKA 1ZLMA 2L3SA 1MV3A 2BZ8A 4CC3A 4GBQA 2DRMA 1B07A 1G2BA 2IIMA 2KROA 2DILA 2KRSA 4HVUA 1QLYA 2DL8A 1WDXA 1ZUYA 1GCQA 1UHCA 2H8HA 4AFZC 2CT4A 1M30A 3O5ZA 1UTIA 2DL3A 2I0NA 1NG2A 3EHRA 1VYVA 2VVKA 4AFSC 1KSWA 2KT8A 2HBWA 4ZNXA 2O88A 3M0TA 4F14A 1OPLA 1W1FA 2KE9A 1Y57A 2RQTA 1CSKA 1SSHA 2L3QA 3VS3A 2KRNA 1PKSA 2HDAA 2CH4W 4OMQA 3VS5A 3EG1A 1EFNA 1GFDA 2LJ3A 2OI3A 1PRLC 2AKKA 1VA7A 2EVRA 4J9DA 2RPNA 1V1CA 4A63B 2SEMA 2JMCA 4LUEA 2GQIA 1BU1A 1QKXA 1XOVA 2RQRA 3KFVA 2AK5A 1M3BA 3I5RA 4JJBA 1TUDA 3EG3A 1PKTA 1WXTA 3A98A 2EYYA 4OMLA 1HJDA 2FRWA 2YUNA 3IQLA 2J6FA 2EYWA 2K6DA 2BZYA 1WYXA 1NYGA 1OEBA 2DL4A 2CH4A 3M0RA 2KR3A 2EGEA 2VKNA 5IXBA 2YUQA 5I22A 1I0CA 1U3OA 5IH2A 5GJVB 1AVZC 5FWCA 3RNJA 1W70A 4JJCA 1I1JA 3QWXX 4RTZA 1Z9QA 3VS1A 4JPBW 1WFWA 2X3XD 4M4ZA 3TSWA 3CQTA 1NYFA 3RBBB 2AZSA 1SHFA
chains in the Genus database with same CATH superfamily
2QTXA 1VQPA 4DOVA 4A4HA 5FU6C 2LZ6B 5LL6S 1WNLA 4RG8A 2C0IA 2AT1B 1TTHB 4WCIA 2CGHA 2BE9B 1QCNA 3CXCP 2KY9A 3OYLA 3BW1A 2MK5A 4J9GA 3SFMA 3G1JA 3CMEQ 1KQ1A 1YNZA 1VQOT 3OYCA 1KD1C 1SRMA 1VQ7T 1RAFB 2JXBA 2IPOB 1WHMA 1X43A 5KH6A 3KXTA 3DKMA 5GMKh 3ME9A 1M90C 4KGVB 2RN8A 1G3WA 1VQ5Q 1QW1A 3H0IA 4M7AA 5FU7B 1W2BA 4OB0B 3EG0A 2LVMA 2LX7A 1QCFA 1B34A 4JS4A 5I2SA 1YHQQ 1H8KA 2DETA 4XTVA 2E10A 2RD1A 1Q82R 1WXUA 3VRYA 3FLGA 1M1FA 2HSEB 1OI1A 2G3RA 4Y92A 1C1AA 4J5YA 4DBFA 4Y28E 3VS2A 5DLOA 4M77C 2DLPA 1UJYA 2RHZA 4M78C 4QT7A 2LCLA 1RAEB 3I35A 2DL5A 3SHWA 3QO3A 2CP6A 1VQPT 2X4WA 4EDUA 1NEBA 1B34B 1WHHA 3X25B 4C92C 3P8HA 1JO8A 2DVJA 4JRQA 2QI2A 3EH1A 1BI1A 2QGFB 2JTEA 1SF9A 3CBOA 2HCKA 5KYWA 2K5LA 1UGPB 5FU6B 4AMCA 2M9UA 4L5GA 1PWTA 1KFZA 4HVVA 1PD1A 4OVAA 1ZQ1A 3FIFA 1YJWQ 3M58A 2P84A 1SRLA 2W0ZA 2MOXA 3OYMA 3LLRA 4PJLA 1M27C 4PJOC 2NUPA 3TVTA 3PMIA 3CCMA 1M3AA 2J6OA 2RI3A 3A8GB 2EQIA 1G8XA 1GBQA 1QVFA 1NLPC 1T3SA 1MMNA 3HKSA 3QG1A 4PLIA 2GTJA 2RO0A 5KYWB 3GPLA 2R57A 4F7UA 3GNGA 2YUPA 2EQKA 2EKOA 1KQSS 2L5QA 3OYEA 4E7JA 1K9AA 1XTDA 1VQ4Q 1K1ZA 5GAOn 3JSCA 4M77A 2DX1A 4M78A 1M8VA 2NUPB 1FXXA 2GGRA 1JEGA 4MZMA 2QQBA 1K8AC 2KYMA 3NTHA 4JZ4A 3L2QA 3E19A 2EYZA 1Y0MA 2E3IA 3E9FA 2LCSA 4BDZA 4XTUA 4C92A 4XU0A 1U06A 4B6MA 1PNJA 2P0QA 3UA7A 2BE7D 4F7UB 4J9CA 1AT1B 4K11A 5GMKi 5GAOr 1VQ5T 1WHGA 2WSEE 5LJ5g 1H641 3PT9A 3S3MA 2OTJA 5GANg 2D0NA 4M77B 4M78B 4C8QD 1PSFA 3P8BB 3OYHA 3OW2S 3EGUA 1ZSZC 2JS0A 4D6WA 1HXDA 4B9XA 2Z0WA 3RUXA 5FWBA 4PL6A 4C92B 4E2FB 4PJOA 3CD6Q 3CBMA 1OYXA 1M4ZA 1VQ4A 1HK9A 3VKIA 5GMKe 1WGSA 2JT4A 5IHKA 1TSFA 2GFAA 2O9SA 2QK0A 4JDSA 1YCSB 4FIBA 2ESWA 5CKHA 3WVDB 5GMKl 2DD5A 2HQEA 4F7UE 2LNHB 7AT1B 1BIBA 2KVQG 3NMZC 3CCJQ 4PJOB 1IRXA 3QSUA 2XKOC 3DLLA 4ELYC 2A0FB 3Q1JA 1JXOA 4M77E 3UA6A 4E7LA 4KGXB 4M78E 4RTTA 2QQ9A 1UGVA 2ZZDA 5CR2A 1HSQA 1KQSP 1PRMC 2K5FA 2LQWA 1YIJA 2HKQB 1FX7A 3FDRA 3TEEA 4CC7A 1X27A 2FPFA 1YJWT 4MMKA 1CKAA 4C92E 3GP8A 3CD6A 1H3HA 2GNCA 1W4SA 1YWPA 4RMOA 1MUZA 1NJIU 1X69A 2F2VA 2XIDA 2YT6A 3EG9A 2ZPEB 2HSPA 1ZSZA 2E4HA 3OYFA 4R55A 2DXUA 3OSSC 4OMMA 1X6OA 2J6KA 4IUQA 2IG0A 4Z8AA 4J9HA 4EMKC 1M8MA 5LJ3d 1UJ0A 2HKNA 1FMKA 4M77F 4Q5WA 1I07A 1NM7A 2EGCA 2GBQA 2PTKA 1P92A 1YJ9A 3HL8A 2X35A 1ZA1B 4C8QG 2DKGA 1IREB 4XU2A 2RQWA 4HT8A 3VJPA 1VQ4T 3EFRA 4II1A 1O9SA 4PJOE 2ROTA 1X2KA 2ZPIB 2NUTB 2D8HA 3HPWA 1VIFA 1QCOA 4BI4A 2GFUA 3AHUA 3EG9B 1WJRA 2L3SA 2BZ8A 3EFOB 1BI2A 4CC3A 1OZ2A 2DRMA 1B07A 1C6VX 4KGZB 3SWNC 2COYA 2DZCA 4CRIA 2KRSA 4HVUA 1H3ZA 2RK1A 1N6AA 1QVGS 2RK2A 4KUIA 4A4FA 5LJ5h 1M30A 3O5ZA 1UTIA 5GANh 3EGDA 4NOYA 1NG2A 3E9GA 1VQMA 1M9SA 1KSWA 1Q7YU 3QYHB 1KK7A 4PJOF 1OPLA 3MCAB 3WXMB 1CSKA 4M75D 4DBRA 3CD6T 2HDAA 3EG1A 4JUVA 2OI3A 2HBPA 2X51A 3EGDB 4EMKA 4N0AC 2AKKA 1RL2A 4A54A 2EVRA 2HAXA 1TXQA 2RPNA 2SEMA 3OYGA 1BU1A 1YJ9T 3KFVA 2CP7A 1W2BS 2AK5A 2CP3A 2JNGA 1PSEA 1TUDA 3EG3A 5KYNA 1S72Q 4ELZC 1YITQ 3M4YA 2YUNA 2J6FA 2K6DA 4FT4A 2BZYA 1WYXA 1OEBA 1WQWA 3NFCA 4EMKB 3E2UA 4Y91A 1VQ8A 3SWNA 5CQYA 5I22A 1YJNA 2PQWA 5GJVB 1AVZC 4P5NA 3PFSA 3RNJA 1W70A 3QWXX 2DIQA 1MMDA 1VQMT 1WFWA 1WHJA 2X3XD 1IB8A 3FEOA 2RA2A 4M4ZA 3CQTA 1NYFA 4HCCA 3TU4K 4HA8A 2OTLQ 1Q95G 2A36A 4LDVA 2DXBA 2OAUA 1QVGP 5CIUA 5GAMd 3CCVQ 1NPPA 3C95A 5GAN3 3SWNB 1X6GA 5HK3A 1HD3A 1SEMA 5CK9A 2O4XA 4D8DA 3CCRQ 4NL3A 1K4US 2ZAEA 3L2WA 4N0AA 1OOTA 2RHIA 1YITA 3JCMX 1GRIA 1QP3A 3ER0A 1NE8A 1MNEA 2PU9B 4M75G 3H0FA 2DJQA 1AWXA 1CKBA 2DRKA 1Q7YR 2ABLA 2EIFA 1ZBXA 1IGUA 1R0CB 2HQHA 1RAHB 4HCZA 1YN8A 2KT1A 5I11A 3REBB 3L2ZA 2JS2A 2OAWA 1ZA2B 3HRUA 2O4XB 1QVFS 2EJGA 2FPEA 3MEAA 3M55A 2DMOA 3CPFA 1Y07A 2V1QA 5HK0A 3MKDA 3G6EQ 3V8LA 3VYHB 4ZN1A 1VQ8T 3HSBA 3PE0A 4XU3A 1K8AR 1SPKA 1YJNT 1VUBA 3CC4Q 1MGQA 4RKUE 2FL7A 4F17A 1C0MA 5CCAA 1G3YA 2FPDA 1T0JA 3JCMd 1VQ6Q 3ZL7C 4BE0A 4OB2B 1VQ7A 3LWHA 1ZHIA 3BFMA 2ENMA 3V7CA 4M7DD 3NPFA 5LJ5e 4XTZA 2ED0A 4ME7A 4FYWB 3M54A 5GANe 2CZ0B 2PUKB 2YLBA 4IUVA 5GAOm 2V8JA 1T0HA 2JZ2A 1WZOA 2ZGWA 3OSVA 1O75A 4JLGA 1S72T 2COWA 1BKBA 4QQGA 4E7SA 2CP5A 1YITT 1GL5A 5FRMA 5FLXE 2MCNA 2RI2A 4C8QC 1AD5A 2YHTA 4F16A 1UUEA 1RACB 4DOWA 4DA4A 3JCMJ 1JXMA 1VYUA 3NHNA 4O6JA 4ZN3A 3CC4A 1NEGA 3JCMP 1BK2A 1AZGB 3HFNA 1OULA 2JM8A 5CVIA 3S3NA 5HY6A 1PD0A 3VV0A 3M9QA 5IAYA 1YWOA 2DYIA 3TCJA 5IXFA 1VQNQ 2VYTA 2EQJA 2GQVA 2LP5A 1BB9A 2LCCA 1UG1A 1IXDA 1UGSB 2D6FA 3A8HB 4C0DB 4FW1A 1AEYA 3OS1A 2RJFA 4IKFA 4PKCC 4EMHA 2B8AA 2BKDN 1RLPC 5CQXA 5IN1A 6AT1B 2DNUA 2KSSA 1RI0A 4LDWA 2QEXQ 1KIKA 3X28B 2VXEA 2V26A 3KBGA 3RESA 2K3BA 2DE0X 1D1BA 3ULRB 2M51A 2HL3A 3HHTB 4N4GA 3HP9A 1H92A 1VOMA 5KCOA 3G4SQ 4M7DG 3INZA 4C8QA 5GAN4 4XQ3A 3OB9A 4IURA 2EJ9A 1VQNA 2O31A 2HL5C 2O01E 2EGAA 1VQKQ 3M5AA 4IIOA 3CC4T 2JTFA 1WA7A 4PJNA 3P8DA 3ASKA 4M7AB 3R6NA 1NJIC 1VQ6T 3TQ7P 2KBTA 3CMEA 2X4XA 2L0AA 4PJJA 5A0DA 2K7AA 3GIBA 4JRIA 1K73U 2MAMA 4GLMA 2V8KA 4JLIA 1PCXA 1I5LA 1Y96A 2CT3A 3A5ZB 4LE9A 4C8QB 2QG9B 4Z02A 3LX7A 5C6SA 2L8DA 4DQ2A 4D8KA 4C0ZA 1ZUKA 4KRTA 2QEXA 3RIRA 5GAOp 1I5OB 3QZ5B 1U5SA 1VQ5A 2RHXA 3QDRB 3RMQA 2DL7A 4AFUC 3O8VA 1IGQA 1GCQC 1FWZA 3JB9J 4OGEA 2F2WA 3G4SA 2QDYB 4MMLA 3TREA 3SEMA 2LX9A 4X34A 3JAME 1Y96B 4OMPA 1YHQA 3X26B 3PMTA 2JN0A 5LJ3f 1N9SA 3V8JA 4E7IA 1KQ2A 3OMGA 2L2PA 1VQKA 3VUBA 2LMJA 4TVRA 1MV0B 2COZA 4MZTA 2EPDA 4M75C 4C5HA 2XDPA 4A4GA 2DM1A 2F5KA 5GAN6 4M7AE 4J9FA 2PUOB 1GBRA 2HQXA 1Q7YC 1UFFA 1ZBJA 3R6OA 2CP0A 3M0PA 3G71Q 3VU3C 1VQNT 1YI2Q 4KULA 4C8QE 1UGRB 4OGCA 3FRNA 5KYYA 1G3TA 2F1LA 4BD3A 2M0OA 5L8RE 1NZ9A 2EW3A 4BE1A 2C06A 1JB0E 1TG0A 2MI6A 3OYIA 3QJYA 3CXCA 3CMET 2DYBA 4OMFB 3WVEB 3L2RA 4QQDA 2R5AA 3QXEB 3H8ZA 2R58A 4M7AF 1ZX6A 2DFUA 2P0KA 4OMOA 2VB6A 4KBMB 3CCQQ 2X4YA 2QEXT 1YJWA 5KYYB 1UEBA 1VIEA 1R8OB 2DL8A 1WDXA 1GCQA 1UHCA 2H8HA 3MO8A 1KC8C 2CT4A 2YRCA 1M1KU 3I56Q 2DAQA 3G4ST 5A2QE 2F5TX 4AFSC 5LJ3j 3CCEQ 5GMKm 1YHQT 1PC0A 4ZNXA 3JCMc 2CS7A 3GF5A 4MZPA 4L6V5 2KE9A 1VQKT 1LPLA 1SSHA 4M75A 3VS3A 5AT1B 1PKSA 3NTIA 4FCYA 2CH4W 3BDUA 4N4IA 2EFIA 4BUGA 3VS5A 1EFNA 1Y71A 1GFDA 1PRLC 2ZCFB 3LH0A 1VQLQ 2HZYA 2HMAA 3META 1WHLA 1V1CA 5EG2A 5J3BA 2GQIA 2RQRA 3OA6A 5KCHA 2PVDB 3BDLA 1MMGA 2JTMA 4DBQA 1M3BA 3I5RA 4M75B 4JJBA 2QTVA 1WXTA 2M1HA 2EYYA 3EGXA 4OMLA 3JB9I 4LDYA 3OYNA 1NYGA 4RCBA 3QZ9B 1OX9A 2CH4A 3VYGA 2KR3A 2EGEA 3CCEA 2P0PA 5D6YA 2E3HA 5GAMf 1QP2A 5IH2A 1EIFA 3FB9A 2VC8A 2WACA 2IVWA 1BI0A 5FWCA 4HT9A 4JJCA 2XU8A 4F7UF 2PVGB 3EGXB 3F70A 5CAIA 3TSWA 4M78F 1KG1A 1BCOA 5AYFA 1RLQC 3M53A 2MPXC 1ABOA 5C0MA 4GLKA 4M7DC 4FYVB 1A0NB 4J9EA 1OX8A 1BYMA 3HRSA 2A7YA 4ATOA 4XTXA 3CEYA 3CCJA 3DLMA 3OW2P 3C94A 4RUGA 4C92F 4M75E 3FJPA 1RAIB 2PNIA 5CKEA 4XK8E 3JV3A 1ZSZB 2FO0A 1TWBA 4M77D 4CC4B 3E1SA 2FZCB 3BY7A 4PFZA 2KDSA 4Z89A 4FSXA 3PVLA 1D09B 1V29B 3QWYA 3UWNA 2LDMA 4J83A 1OU9A 3JCMf 3EAEA 1E6GA 1K9MU 4C0FA 1QQJA 1JBMA 3RKYA 3M56A 3I56T 1GCPA 3LGFA 1QWFA 1K0SA 5GAMj 2E5QA 3CMAQ 3CCET 4HXJA 4IUUA 4E6RA 1B7TA 3JCMb 2CYZB 4JRKA 4XTYA 4FYYB 2KAFA 1Q81U 3THKA 1M2VA 1VYTA 1RI9A 3M0SA 2YUOA 3SB2A 1AZEA 2K9GA 4PJOD 2C0TA 3CC7Q 3AT1B 4JJDA 4WTOB 1D0YA 2RQUA 2JVVA 4OF1A 4QVDA 3JB9F 2CUBA 4M7DA 2Y4XA 3QUIA 3NTKA 2GF7A 1U1SA 3PIPA 2YWWA 3CCJT 2QA4Q 1KC8U 3LYIA 1UECA 1NJIR 1V76A 2Y4YA 1M2VB 4L59A 1E6HA 5I21A 4HCKA 2LQKA 1RAAB 2SRCA 4RTXA 2LT4A 3BE3A 1PG5B 2HNIA 3OMCA 3QHSA 4C5GA 4M7DB 4Z88A 1SSFA 2DK3A 4OMNA 1BIAA 3FC3A 3M59A 4J9BA 2AIRB 2L3RA 3FJ5A 2V8IA 1NBEB 3ZFJA 2ZPBB 5IT9E 2FHDA 2E6NA 3A8OB 3OYBA 2NYSA 2K5IA 3J7AF 4RG2A 1B3QA 3REAB 1WXBA 3JB9H 3CCSQ 3CCLQ 5IHIA 3RMSA 4DEYA 2MIOA 5CO7A 2MWPA 1S72A 3RR6A 2ZPFB 1K73C 3MHXA 1W6XA 1K9MR 1AHJB 1OPKA 4HCBA 1SKUB 1UHFA 2VASA 4C0GA 2XD0A 2DBKA 4IUTA 2RJEA 2L3PA 1GFCA 2KYBA 1D3BA 2DPPB 2RQVA 1VQOQ 4WF2A 3I5SA 3OBYA 4OB1B 4M7DE 5M9OA 2EYXA 2YXYA 4A53A 1Q81R 1JRIA 1UDLA 1W2BP 5CKDA 4EMGA 2EKHA 3LGLA 4C5IA 2OTLA 3CMAT 2A37A 3MJXA 5A0LA 3CCVA 1TH7A 1R0BG 2FEIA 3QKJA 2DXTA 2KNBB 2E70A 4O5VA 2ECZA 1JQQA 4BE2A 2GTOA 2RF0A 4AT1B 2RJCA 2QASA 5DLQE 3CCRA 2AZVA 1KJWA 4CC2A 3UPUA 8AT1B 3H9NA 4ANJA 1KC8R 2ZPHB 4BB7A 2YSQA 2XDBA 1FMWA 1RUWA 3M4GA 3C4SA 2W10A 3QIIA 2O2OA 3PIOA 4AG1C 2A28A 2DTHA 1U1TA 5LJ5d 3QPHA 1D1CA 5GANd 1VQPQ 3JRZA 2EYQA 2XG8D 1Q82U 1K0XA 2X4JA 2QA4T 2OJ2A 2CZ6B 4V2SA 5FW9A 5LJ3g 2LC4A 1JJ2A 2LNVA 3EH2A 2MMPA 2F69A 3G6EA 4HVWA 4PK4A 2FVUA 5GAN5 2P4TA 2P4RA 3EHQA 1NLOC 1VQ6A 2J06A 4J7FA 3UF4A 3CPWA 1M1KC 1ARKA 1WIEA 1E7OA 1YCYA 4DEXA 2QQRA 3ZEHA 1HYOA 1N9RA 1X6BA 2VXFA 3NGPA 4J6YA 1BBZA 2OTLT 2R5MA 2DD4A 5IHNA 4LXCA 2NWMA 4FW2A 3CCVT 4BY6C 4QVZA 2VGMA 1QVFP 2BTTA 4OP0A 3RERA 3CCST 2FZKB 3MP1A 4LDXA 2YRDA 3M0UA 5HCKA 3CCRT 3D7SB 2I2LA 1TUGB 3MP8A 2XK0A 3MEVA 1AWJA 1MMAA 3L42A 5KYUA 4KT0E 2HD0A 1IHWA 2LQ8A 3VS4A 1D0ZA 4PJMA 9ATCB 3OYJA 3DB4A 1ZUUA 2XDDA 2JJ9A 5GJWB 2LJ1A 1SG5A 2DO3A 2E1HA 2C0OA 5L23A 5D6XA 4EIKA 3QDFA 1ZLMA 4KH1B 2FYKA 1MV3A 4UC4A 5KYXA 2DTIA 4BACA 2FZGB 2JOYA 3HTRA 2DTOA 4MDWA 2KMTA 1XQHA 5KYUB 2I0NA 3G6ET 3EHRA 4QQ6A 3VUZA 1VYVA 2NLUA 2VGNA 2VVKA 4LDUA 3MPUB 2KT8A 1BCMA 5GAN2 2O88A 3M0TA 4LD6A 4KUDK 1W1FA 3JCMQ 1PM3A 2RQTA 2L3QA 5KYXB 3I55Q 2KRNA 5D7UA 3CCUQ 4BI3A 2EQUA 4R56A 2GCXA 4NS5A 2BIVA 1D0XA 5DM7R 2LRQA 2LJ3A 2QAZA 2OX7A 1VA7A 3CCMQ 3JCMW 3QJ6A 2X9HA 1OU8A 4J9DA 3A1PA 4A63B 3RDVA 2JMCA 4LUEA 4IUPA 5A0GA 2PVOB 1WHKA 4B9WA 4ZGEB 4EPCA 1MHNA 1G5VA 4PFPA 5LJ3h 5GAMg 3A8MB 1LJOA 3N5BB 4KH0B 4BY6B 3M0RA 2VKNA 3V7RA 5IXBA 3C12A 4FM4B 1I0CA 2MYSA 1K9MC 2RJDA 1LOJA 3UT1A 1M2OA 5CKFA 1N8RU 3I55A 2KK4A 5GMKj 3CCUA 1I1JA 4RTZA 1WJSA 4PFOA 3OYAA 2M02A 2OTJQ 3SDZA 3RBBB 2AZSA 1SHFA 1LVKA 1UGQB 3PGGA 2E12A 2VWFA 4QW2A 2AHJB 3VRZA 5J39A 1Q81C 5ECAA 2NUZA 2K2MA 4X1VA 3CC2Q 2B86A 4J6XA 3U23A 3EFSA 4X9CA 2K2VA 2A3LA 3JCMg 1XNIA 2LTOA 1Y7XA 4RTWA 3PTAA 4C8QF 2DEUA 2CSQA 3H0HA 4J9IA 3DB3A 2DBMA 2RM4A 3MEWA 4XU1A 2EAYA 2M0YA 4M7AD 1T3LA 1K73R 3G71A 2MWOA 2ATCB 1YI2A 2RI5A 3VS6A 3L2VA 1TUCA 1AWWA 2E64A 1DJ7B 4RTUA 2BUDA 4IIMA 1D1AA 4QKUA 1Q86C 1J3TA 2HEQA 4OB3B 2AKLA 1M5Q1 2E6ZA 1YIJQ 4E7HA 3I55T 3VS0A 3CCUT 3CC2A 3HRTA 2KXCA 1G83A 1MNDA 3C0CA 1S1NA 3OYKA 2QQSA 3OYYA 4R0KA 3CCQA 3CCMT 2CZ1B 1K76A 5CKBA 2E65A 2DF6A 2JW4A 1KD1U 2RHYA 1SHGA 4PNOA 1FMVA 4FL6A 3I56A 1YJ9Q 5KE2A 1WX6A 1WI7A 1M90U 2YDLA 2CUDA 5GAMh 2QQAA 3QBYA 1UE9A 2JM9A 1N8RR 3L2UA 3KUFA 1M3CA 1VQ9Q 5I2MA 2D1XA 2XICA 1TS9A 4JJNK 1RADB 4FU6A 3OY9A 3OS0A 5KE3A 4JS5A 2DIGA 3HFOA 4LUDA 4VUBA 4DBHA 3UATA 2H3JA 1ABQA 2QDLA 1M1GA 1WLPB 4ZGDB 1IZ6A 4ORZA 2YLCA 3G71T 2E41A 1YI2T 1VQLA 4A4EA 2OTJT 1VQMQ 2NUTA 1LNXA 2G6FX 1OZ3A 2A08A 5GAN7 4XTWA 1ZSGA 2ZPGB 5LJ3e 4F04B 4M7AG 3EG2A 4N4HA 1JJ2S 3EFOA 3CC2T 4LN2A 2KRMA 2LT1A 1M1KR 2ROLA 2D8JA 4ZTFA 1WQ7A 4JZ3A 2JUFA 4M78D 1RABB 1NPRA 3JCMh 3CCQT 3H41A 4A4KA 1VQ9A 4MDXA 1IHVA 5EC7A 3CPWS 2JMAA 2FRYA 2Y90A 5GAOq 1Q82C 1BI3A 4C92D 2K3YA 4CI0C 2CSIA 3SD4A 2XMFA 2V1RA 4JRPA 2YRVA 2CZ7B 1LCKA 4M75F 3GBQA 2L89A 1OV3A 3S6WA 1QWEA 2ED1A 1RAGB 1I8FA 1YBYA 2PZ1A 2KQWA 3GLXA 1KHIA 2EWNA 5LJ5f 5GANf 1VQ8Q 2XHCA 1YJNQ 1KD1R 1YIJT 4LD9K 2DZ9A 4XAXB 4ZGJB 4E7KA 1AWOA 1I81A 3H6ZA 1VQLT 2O9VA 1M90R 3GOXA 1X2QA 3OBWA 2LQNA 4ZTJA 2K4YA 2EJFA 1OQKA 3V7SA 4BI8B 4AG2C 1YP5A 4HKEA 5D6WA 1K8AU 1G3SA 2DXCA 4J8OA 2RMOA 2F2XA 5J26A 1JU5C 4NL2A 3CMAA 4FSSA 3JB9D 1KQSA 3X24B 1N5ZA 1VQ9T 3ZBDA 4F7UG 4J6WA 1JJ2P 3I9QA 2EQMA 3URGA 2E5KA 4LNPA 1Q86U 3RKWA 2J05A 4M77G 3MEUA 2MF2A 4M78G 2X3WD 4J7IA 1ACMB 2RH2A 3PNWC 3S3OA 3M0QA 2CREA 4AFQC 3CC7A 2FB7A 1PHTA 3CPWP 1FYNA 1AOJA 2K79A 3LH5A 5LJ5j 4C92G 3QYGB 2RNAA 5GANj 4RTYA 2RB6A 1Z9ZA 2EBPA 2KI7A 2CDTA 3RKXA 4RTVA 3TSZA 2KEAA 5GAMe 2BZXA 4QVCA 1YFNA 2K57A 2QA4A 2FG0A 2DA9A 3G7ZA 2RHUA 5DY9A 3OQ5A 3OW2A 1WJQA 2DEQA 2KXDA 1IO6A 2H3EB 2CKKA 2D0QB 2J7IA 1N27A 4C5EA 2KGTA 4E47A 5HKCA 1EX4A 1QKWA 3PVQA 1VQ7Q 1UB4A 1X01A 1X75C 2LJ0A 3VS7A 3J81E 4PJOG 3OS2A 4ESRA 3UDCA 1QMCA 2VV5A 4GBQA 1G2BA 2IIMA 2KROA 2DILA 1QLYA 1ZUYA 4AFZC 3OS5A 1XJWB 2QGGA 3OYDA 2DL3A 4C0DC 3CXCS 2CP2A 1D3BB 2HBWA 4RCCA 1GXIE 3CCSA 4F14A 3CCLA 2QXFA 3J80E 4BDYA 1N8RC 1Y57A 2DJZA 3JB9G 4M7DF 4GY5A 4PLLA 1KHCA 2D9TA 1I4K1 2M16A 4E7ZA 3JCMe 1R77A 3JCMV 5GAN8 8ATCB 3A8LB 4OMQA 3CC7T 4YTLA 5FU7C 3L1AA 5FROA 3LWIA 2K3XA 3V8KA 1VQOA 1TOVA 3M57A 5FRNA 1QKXA 1XOVA 1Q86R 2VUBA 4FT2A 4X9DA 1F1BB 1PKTA 3A98A 3X20B 1HJDA 2FRWA 2QYZA 2DERA 4M7AC 3IQLA 1WPYA 2EYWA 3CBPA 2DL4A 1EZZB 2YUQA 1U3OA 2WSFE 3LW5E 1QVPA 1U8RA 3T9NA 3GNFB 1TU0B 4FYXB 5GAOl 1Z9QA 3VS1A 4JPBW 2DVEA 3MP6A 1QVGA 2XI9A 2WSCE 3CCLT
chains in the Genus database with same CATH topology
2VWFA 2A36A 1RLQC 1ABOA 3VRZA 5ECAA 2LZ6B 4J9EA 1A0NB 2NUZA 2C0IA 1X6GA 1HD3A 2K2MA 1SEMA 4X1VA 4WCIA 2B86A 4RUGA 3U23A 4D8DA 1K4US 2PNIA 4J9GA 1OOTA 3JV3A 1YNZA 1GRIA 2FO0A 1SRMA 2JXBA 4RTWA 3H0FA 4CC4B 2DJQA 1AWXA 1X43A 4Z89A 1CKBA 2DRKA 2ABLA 3PVLA 2CSQA 3H0HA 3QWYA 4J9IA 2DBMA 1YN8A 2KT1A 5I11A 3REBB 2RN8A 1E6GA 2JS2A 2OAWA 3H0IA 2M0YA 1T3LA 1GCPA 2FPEA 2DMOA 1QWFA 1K0SA 3VS6A 3EG0A 2V1QA 1TUCA 4HXJA 1AWWA 4RTUA 2LX7A 4E6RA 1QCFA 3PE0A 4IIMA 1SPKA 1J3TA 1H8KA 2HEQA 4F17A 2AKLA 2FPDA 1WXUA 3VRYA 1T0JA 3VS0A 3THKA 3ZL7C 2KXCA 1G83A 4Y92A 1VYTA 1RI9A 3M0SA 2YUOA 3C0CA 3VS2A 1S1NA 1AZEA 2K9GA 2C0TA 2DLPA 1UJYA 4QT7A 4JJDA 4R0KA 2RQUA 2ENMA 2CUBA 3I35A 2DL5A 3SHWA 1K76A 2DF6A 3NPFA 2JW4A 2ED0A 1SHGA 1NEBA 1T0HA 1JO8A 2DVJA 1WX6A 1WI7A 1UECA 2YDLA 2CUDA 1UE9A 2JM9A 1GL5A 1E6HA 1M3CA 2MCNA 4HCKA 2D1XA 2JTEA 1AD5A 2HCKA 2SRCA 1UUEA 4RTXA 4F16A 4LUDA 1JXMA 1VYUA 1PWTA 1KFZA 4HVVA 3NHNA 4Z88A 4OMNA 1NEGA 3UATA 1BK2A 1AZGB 4J9BA 1SRLA 1ABQA 2QDLA 2W0ZA 2MOXA 1WLPB 2JM8A 4ORZA 1M27C 3FJ5A 3TVTA 1YWOA 5IXFA 1M3AA 2J6OA 2EQIA 2LP5A 1GBQA 2G6FX 1NLPC 1T3SA 1BB9A 1B3QA 2A08A 3REAB 1WXBA 1ZSGA 1UG1A 2GTJA 3EG2A 5IHIA 2YUPA 4DEYA 2MIOA 4LN2A 2KRMA 1K9AA 1AEYA 1K1ZA 2ROLA 2D8JA 1W6XA 2DX1A 4JZ3A 1OPKA 1RLPC 2GGRA 1JEGA 1UHFA 3H41A 2DBKA 2KYMA 2DNUA 4JZ4A 2L3PA 5EC7A 1GFCA 1Y0MA 2EYZA 2KYBA 2LCSA 1KIKA 2JMAA 2RQVA 2FRYA 3I5SA 1U06A 2K3BA 2EYXA 1PNJA 2DE0X 3UA7A 3ULRB 2CSIA 2M51A 4J9CA 2XMFA 4K11A 2V1RA 1H92A 1LCKA 3GBQA 1UDLA 2D0NA 1OV3A 2EKHA 1QWEA 2ED1A 2A37A 2PZ1A 2O31A 2FEIA 3EGUA 2EGAA 2JS0A 2KNBB 4IIOA 2ECZA 5FWBA 1WA7A 1JQQA 2GTOA 2RF0A 3R6NA 2AZVA 1KJWA 2KBTA 4CC2A 1AWOA 2L0AA 2K7AA 2YSQA 2O9VA 4GLMA 1X2QA 1RUWA 2CT3A 2LQNA 4LE9A 2JT4A 2W10A 5IHKA 2O2OA 4AG1C 4D8KA 4AG2C 2A28A 1YP5A 2O9SA 1ZUKA 4KRTA 1YCSB 2RMOA 1U5SA 2ESWA 1K0XA 2OJ2A 2DL7A 2LNHB 5FW9A 2F2XA 3NMZC 4AFUC 1JU5C 1GCQC 4FSSA 2F2WA 1JXOA 4HVWA 3UA6A 1N5ZA 3SEMA 4RTTA 4OMPA 1UGVA 3I9QA 1HSQA 2E5KA 1PRMC 4LNPA 2P4RA 3EHQA 1NLOC 2J05A 2LQWA 2L2PA 4CC7A 2J06A 3UF4A 1X27A 2FPFA 2X3WD 2LMJA 1MV0B 1CKAA 1ARKA 2EPDA 1WIEA 1E7OA 4DEXA 1H3HA 3M0QA 2GNCA 2CREA 2DM1A 4AFQC 4J9FA 1YWPA 1GBRA 1X6BA 1UFFA 1MUZA 1PHTA 1ZBJA 1X69A 2F2VA 1FYNA 3NGPA 1AOJA 2K79A 1BBZA 2YT6A 3LH5A 3M0PA 2RNAA 5IHNA 2NWMA 4RTYA 2HSPA 1Z9ZA 2EBPA 4OMMA 2J6KA 2BTTA 2CDTA 4Z8AA 4J9HA 4RTVA 1M8MA 1UJ0A 3TSZA 2KEAA 1FMKA 2BZXA 1I07A 1NM7A 2EW3A 2DA9A 2EGCA 2FG0A 2GBQA 2PTKA 1TG0A 3M0UA 5HCKA 2KXDA 1IO6A 2RQWA 2DYBA 1AWJA 2J7IA 2ROTA 3VS4A 2KGTA 1X2KA 1QKWA 2D8HA 3PVQA 1ZX6A 1ZUUA 5GJWB 4OMOA 2LJ1A 2LJ0A 3VS7A 2C0OA 5L23A 4ESRA 4EIKA 1ZLMA 2L3SA 1MV3A 2BZ8A 4CC3A 4GBQA 2DRMA 1B07A 1G2BA 2IIMA 2KROA 2DILA 2KRSA 4HVUA 1QLYA 2DL8A 1WDXA 1ZUYA 1GCQA 1UHCA 2H8HA 4AFZC 2CT4A 1M30A 3O5ZA 1UTIA 2DL3A 2I0NA 1NG2A 3EHRA 1VYVA 2VVKA 4AFSC 1KSWA 2KT8A 2HBWA 4ZNXA 2O88A 3M0TA 4F14A 1OPLA 1W1FA 2KE9A 1Y57A 2RQTA 1CSKA 1SSHA 2L3QA 3VS3A 2KRNA 1PKSA 2HDAA 2CH4W 4OMQA 3VS5A 3EG1A 1EFNA 1GFDA 2LJ3A 2OI3A 1PRLC 2AKKA 1VA7A 2EVRA 4J9DA 2RPNA 1V1CA 4A63B 2SEMA 2JMCA 4LUEA 2GQIA 1BU1A 1QKXA 1XOVA 2RQRA 3KFVA 2AK5A 1M3BA 3I5RA 4JJBA 1TUDA 3EG3A 1PKTA 1WXTA 3A98A 2EYYA 4OMLA 1HJDA 2FRWA 2YUNA 3IQLA 2J6FA 2EYWA 2K6DA 2BZYA 1WYXA 1NYGA 1OEBA 2DL4A 2CH4A 3M0RA 2KR3A 2EGEA 2VKNA 5IXBA 2YUQA 5I22A 1I0CA 1U3OA 5IH2A 5GJVB 1AVZC 5FWCA 3RNJA 1W70A 4JJCA 1I1JA 3QWXX 4RTZA 1Z9QA 3VS1A 4JPBW 1WFWA 2X3XD 4M4ZA 3TSWA 3CQTA 1NYFA 3RBBB 2AZSA 1SHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VWF A;  2A36 A;  1RLQ C;  1ABO A;  3VRZ A;  5ECA A;  2LZ6 B;  4J9E A;  1A0N B;  2NUZ A;  2C0I A;  1X6G A;  1HD3 A;  2K2M A;  1SEM A;  4X1V A;  4WCI A;  2B86 A;  4RUG A;  3U23 A;  4D8D A;  1K4U S;  2PNI A;  4J9G A;  1OOT A;  3JV3 A;  1YNZ A;  1GRI A;  2FO0 A;  1SRM A;  2JXB A;  4RTW A;  3H0F A;  4CC4 B;  2DJQ A;  1AWX A;  1X43 A;  4Z89 A;  1CKB A;  2DRK A;  2ABL A;  3PVL A;  2CSQ A;  3H0H A;  3QWY A;  4J9I A;  2DBM A;  1YN8 A;  2KT1 A;  5I11 A;  3REB B;  2RN8 A;  1E6G A;  2JS2 A;  2OAW A;  3H0I A;  2M0Y A;  1T3L A;  1GCP A;  2FPE A;  2DMO A;  1QWF A;  1K0S A;  3VS6 A;  3EG0 A;  2V1Q A;  1TUC A;  4HXJ A;  1AWW A;  4RTU A;  2LX7 A;  4E6R A;  1QCF A;  3PE0 A;  4IIM A;  1SPK A;  1J3T A;  1H8K A;  2HEQ A;  4F17 A;  2AKL A;  2FPD A;  1WXU A;  3VRY A;  1T0J A;  3VS0 A;  3THK A;  3ZL7 C;  2KXC A;  1G83 A;  4Y92 A;  1VYT A;  1RI9 A;  3M0S A;  2YUO A;  3C0C A;  3VS2 A;  1S1N A;  1AZE A;  2K9G A;  2C0T A;  2DLP A;  1UJY A;  4QT7 A;  4JJD A;  4R0K A;  2RQU A;  2ENM A;  2CUB A;  3I35 A;  2DL5 A;  3SHW A;  1K76 A;  2DF6 A;  3NPF A;  2JW4 A;  2ED0 A;  1SHG A;  1NEB A;  1T0H A;  1JO8 A;  2DVJ A;  1WX6 A;  1WI7 A;  1UEC A;  2YDL A;  2CUD A;  1UE9 A;  2JM9 A;  1GL5 A;  1E6H A;  1M3C A;  2MCN A;  4HCK A;  2D1X A;  2JTE A;  1AD5 A;  2HCK A;  2SRC A;  1UUE A;  4RTX A;  4F16 A;  4LUD A;  1JXM A;  1VYU A;  1PWT A;  1KFZ A;  4HVV A;  3NHN A;  4Z88 A;  4OMN A;  1NEG A;  3UAT A;  1BK2 A;  1AZG B;  4J9B A;  1SRL A;  1ABQ A;  2QDL A;  2W0Z A;  2MOX A;  1WLP B;  2JM8 A;  4ORZ A;  1M27 C;  3FJ5 A;  3TVT A;  1YWO A;  5IXF A;  1M3A A;  2J6O A;  2EQI A;  2LP5 A;  1GBQ A;  2G6F X;  1NLP C;  1T3S A;  1BB9 A;  1B3Q A;  2A08 A;  3REA B;  1WXB A;  1ZSG A;  1UG1 A;  2GTJ A;  3EG2 A;  5IHI A;  2YUP A;  4DEY A;  2MIO A;  4LN2 A;  2KRM A;  1K9A A;  1AEY A;  1K1Z A;  2ROL A;  2D8J A;  1W6X A;  2DX1 A;  4JZ3 A;  1OPK A;  1RLP C;  2GGR A;  1JEG A;  1UHF A;  3H41 A;  2DBK A;  2KYM A;  2DNU A;  4JZ4 A;  2L3P A;  5EC7 A;  1GFC A;  1Y0M A;  2EYZ A;  2KYB A;  2LCS A;  1KIK A;  2JMA A;  2RQV A;  2FRY A;  3I5S A;  1U06 A;  2K3B A;  2EYX A;  1PNJ A;  2DE0 X;  3UA7 A;  3ULR B;  2CSI A;  2M51 A;  4J9C A;  2XMF A;  4K11 A;  2V1R A;  1H92 A;  1LCK A;  3GBQ A;  1UDL A;  2D0N A;  1OV3 A;  2EKH A;  1QWE A;  2ED1 A;  2A37 A;  2PZ1 A;  2O31 A;  2FEI A;  3EGU A;  2EGA A;  2JS0 A;  2KNB B;  4IIO A;  2ECZ A;  5FWB A;  1WA7 A;  1JQQ A;  2GTO A;  2RF0 A;  3R6N A;  2AZV A;  1KJW A;  2KBT A;  4CC2 A;  1AWO A;  2L0A A;  2K7A A;  2YSQ A;  2O9V A;  4GLM A;  1X2Q A;  1RUW A;  2CT3 A;  2LQN A;  4LE9 A;  2JT4 A;  2W10 A;  5IHK A;  2O2O A;  4AG1 C;  4D8K A;  4AG2 C;  2A28 A;  1YP5 A;  2O9S A;  1ZUK A;  4KRT A;  1YCS B;  2RMO A;  1U5S A;  2ESW A;  1K0X A;  2OJ2 A;  2DL7 A;  2LNH B;  5FW9 A;  2F2X A;  3NMZ C;  4AFU C;  1JU5 C;  1GCQ C;  4FSS A;  2F2W A;  1JXO A;  4HVW A;  3UA6 A;  1N5Z A;  3SEM A;  4RTT A;  4OMP A;  1UGV A;  3I9Q A;  1HSQ A;  2E5K A;  1PRM C;  4LNP A;  2P4R A;  3EHQ A;  1NLO C;  2J05 A;  2LQW A;  2L2P A;  4CC7 A;  2J06 A;  3UF4 A;  1X27 A;  2FPF A;  2X3W D;  2LMJ A;  1MV0 B;  1CKA A;  1ARK A;  2EPD A;  1WIE A;  1E7O A;  4DEX A;  1H3H A;  3M0Q A;  2GNC A;  2CRE A;  2DM1 A;  4AFQ C;  4J9F A;  1YWP A;  1GBR A;  1X6B A;  1UFF A;  1MUZ A;  1PHT A;  1ZBJ A;  1X69 A;  2F2V A;  1FYN A;  3NGP A;  1AOJ A;  2K79 A;  1BBZ A;  2YT6 A;  3LH5 A;  3M0P A;  2RNA A;  5IHN A;  2NWM A;  4RTY A;  2HSP A;  1Z9Z A;  2EBP A;  4OMM A;  2J6K A;  2BTT A;  2CDT A;  4Z8A A;  4J9H A;  4RTV A;  1M8M A;  1UJ0 A;  3TSZ A;  2KEA A;  1FMK A;  2BZX A;  1I07 A;  1NM7 A;  2EW3 A;  2DA9 A;  2EGC A;  2FG0 A;  2GBQ A;  2PTK A;  1TG0 A;  3M0U A;  5HCK A;  2KXD A;  1IO6 A;  2RQW A;  2DYB A;  1AWJ A;  2J7I A;  2ROT A;  3VS4 A;  2KGT A;  1X2K A;  1QKW A;  2D8H A;  3PVQ A;  1ZX6 A;  1ZUU A;  5GJW B;  4OMO A;  2LJ1 A;  2LJ0 A;  3VS7 A;  2C0O A;  5L23 A;  4ESR A;  4EIK A;  1ZLM A;  2L3S A;  1MV3 A;  2BZ8 A;  4CC3 A;  4GBQ A;  2DRM A;  1B07 A;  1G2B A;  2IIM A;  2KRO A;  2DIL A;  2KRS A;  4HVU A;  1QLY A;  2DL8 A;  1WDX A;  1ZUY A;  1GCQ A;  1UHC A;  2H8H A;  4AFZ C;  2CT4 A;  1M30 A;  3O5Z A;  1UTI A;  2DL3 A;  2I0N A;  1NG2 A;  3EHR A;  1VYV A;  2VVK A;  4AFS C;  1KSW A;  2KT8 A;  2HBW A;  4ZNX A;  2O88 A;  3M0T A;  4F14 A;  1OPL A;  1W1F A;  2KE9 A;  1Y57 A;  2RQT A;  1CSK A;  1SSH A;  2L3Q A;  3VS3 A;  2KRN A;  1PKS A;  2HDA A;  2CH4 W;  4OMQ A;  3VS5 A;  3EG1 A;  1EFN A;  1GFD A;  2LJ3 A;  2OI3 A;  1PRL C;  2AKK A;  1VA7 A;  2EVR A;  4J9D A;  2RPN A;  1V1C A;  4A63 B;  2SEM A;  2JMC A;  4LUE A;  2GQI A;  1BU1 A;  1QKX A;  1XOV A;  2RQR A;  3KFV A;  2AK5 A;  1M3B A;  3I5R A;  4JJB A;  1TUD A;  3EG3 A;  1PKT A;  1WXT A;  3A98 A;  2EYY A;  4OML A;  1HJD A;  2FRW A;  2YUN A;  3IQL A;  2J6F A;  2EYW A;  2K6D A;  2BZY A;  1WYX A;  1NYG A;  1OEB A;  2DL4 A;  2CH4 A;  3M0R A;  2KR3 A;  2EGE A;  2VKN A;  5IXB A;  2YUQ A;  5I22 A;  1I0C A;  1U3O A;  5IH2 A;  5GJV B;  1AVZ C;  5FWC A;  3RNJ A;  1W70 A;  4JJC A;  1I1J A;  3QWX X;  4RTZ A;  1Z9Q A;  3VS1 A;  4JPB W;  1WFW A;  2X3X D;  4M4Z A;  3TSW A;  3CQT A;  1NYF A;  3RBB B;  2AZS A;  1SHF A; 
#chains in the Genus database with same CATH topology
 2QTX A;  1VQP A;  4DOV A;  4A4H A;  5FU6 C;  2LZ6 B;  5LL6 S;  1WNL A;  4RG8 A;  2C0I A;  2AT1 B;  1TTH B;  4WCI A;  2CGH A;  2BE9 B;  1QCN A;  3CXC P;  2KY9 A;  3OYL A;  3BW1 A;  2MK5 A;  4J9G A;  3SFM A;  3G1J A;  3CME Q;  1KQ1 A;  1YNZ A;  1VQO T;  3OYC A;  1KD1 C;  1SRM A;  1VQ7 T;  1RAF B;  2JXB A;  2IPO B;  1WHM A;  1X43 A;  5KH6 A;  3KXT A;  3DKM A;  5GMK h;  3ME9 A;  1M90 C;  4KGV B;  2RN8 A;  1G3W A;  1VQ5 Q;  1QW1 A;  3H0I A;  4M7A A;  5FU7 B;  1W2B A;  4OB0 B;  3EG0 A;  2LVM A;  2LX7 A;  1QCF A;  1B34 A;  4JS4 A;  5I2S A;  1YHQ Q;  1H8K A;  2DET A;  4XTV A;  2E10 A;  2RD1 A;  1Q82 R;  1WXU A;  3VRY A;  3FLG A;  1M1F A;  2HSE B;  1OI1 A;  2G3R A;  4Y92 A;  1C1A A;  4J5Y A;  4DBF A;  4Y28 E;  3VS2 A;  5DLO A;  4M77 C;  2DLP A;  1UJY A;  2RHZ A;  4M78 C;  4QT7 A;  2LCL A;  1RAE B;  3I35 A;  2DL5 A;  3SHW A;  3QO3 A;  2CP6 A;  1VQP T;  2X4W A;  4EDU A;  1NEB A;  1B34 B;  1WHH A;  3X25 B;  4C92 C;  3P8H A;  1JO8 A;  2DVJ A;  4JRQ A;  2QI2 A;  3EH1 A;  1BI1 A;  2QGF B;  2JTE A;  1SF9 A;  3CBO A;  2HCK A;  5KYW A;  2K5L A;  1UGP B;  5FU6 B;  4AMC A;  2M9U A;  4L5G A;  1PWT A;  1KFZ A;  4HVV A;  1PD1 A;  4OVA A;  1ZQ1 A;  3FIF A;  1YJW Q;  3M58 A;  2P84 A;  1SRL A;  2W0Z A;  2MOX A;  3OYM A;  3LLR A;  4PJL A;  1M27 C;  4PJO C;  2NUP A;  3TVT A;  3PMI A;  3CCM A;  1M3A A;  2J6O A;  2RI3 A;  3A8G B;  2EQI A;  1G8X A;  1GBQ A;  1QVF A;  1NLP C;  1T3S A;  1MMN A;  3HKS A;  3QG1 A;  4PLI A;  2GTJ A;  2RO0 A;  5KYW B;  3GPL A;  2R57 A;  4F7U A;  3GNG A;  2YUP A;  2EQK A;  2EKO A;  1KQS S;  2L5Q A;  3OYE A;  4E7J A;  1K9A A;  1XTD A;  1VQ4 Q;  1K1Z A;  5GAO n;  3JSC A;  4M77 A;  2DX1 A;  4M78 A;  1M8V A;  2NUP B;  1FXX A;  2GGR A;  1JEG A;  4MZM A;  2QQB A;  1K8A C;  2KYM A;  3NTH A;  4JZ4 A;  3L2Q A;  3E19 A;  2EYZ A;  1Y0M A;  2E3I A;  3E9F A;  2LCS A;  4BDZ A;  4XTU A;  4C92 A;  4XU0 A;  1U06 A;  4B6M A;  1PNJ A;  2P0Q A;  3UA7 A;  2BE7 D;  4F7U B;  4J9C A;  1AT1 B;  4K11 A;  5GMK i;  5GAO r;  1VQ5 T;  1WHG A;  2WSE E;  5LJ5 g;  1H64 1;  3PT9 A;  3S3M A;  2OTJ A;  5GAN g;  2D0N A;  4M77 B;  4M78 B;  4C8Q D;  1PSF A;  3P8B B;  3OYH A;  3OW2 S;  3EGU A;  1ZSZ C;  2JS0 A;  4D6W A;  1HXD A;  4B9X A;  2Z0W A;  3RUX A;  5FWB A;  4PL6 A;  4C92 B;  4E2F B;  4PJO A;  3CD6 Q;  3CBM A;  1OYX A;  1M4Z A;  1VQ4 A;  1HK9 A;  3VKI A;  5GMK e;  1WGS A;  2JT4 A;  5IHK A;  1TSF A;  2GFA A;  2O9S A;  2QK0 A;  4JDS A;  1YCS B;  4FIB A;  2ESW A;  5CKH A;  3WVD B;  5GMK l;  2DD5 A;  2HQE A;  4F7U E;  2LNH B;  7AT1 B;  1BIB A;  2KVQ G;  3NMZ C;  3CCJ Q;  4PJO B;  1IRX A;  3QSU A;  2XKO C;  3DLL A;  4ELY C;  2A0F B;  3Q1J A;  1JXO A;  4M77 E;  3UA6 A;  4E7L A;  4KGX B;  4M78 E;  4RTT A;  2QQ9 A;  1UGV A;  2ZZD A;  5CR2 A;  1HSQ A;  1KQS P;  1PRM C;  2K5F A;  2LQW A;  1YIJ A;  2HKQ B;  1FX7 A;  3FDR A;  3TEE A;  4CC7 A;  1X27 A;  2FPF A;  1YJW T;  4MMK A;  1CKA A;  4C92 E;  3GP8 A;  3CD6 A;  1H3H A;  2GNC A;  1W4S A;  1YWP A;  4RMO A;  1MUZ A;  1NJI U;  1X69 A;  2F2V A;  2XID A;  2YT6 A;  3EG9 A;  2ZPE B;  2HSP A;  1ZSZ A;  2E4H A;  3OYF A;  4R55 A;  2DXU A;  3OSS C;  4OMM A;  1X6O A;  2J6K A;  4IUQ A;  2IG0 A;  4Z8A A;  4J9H A;  4EMK C;  1M8M A;  5LJ3 d;  1UJ0 A;  2HKN A;  1FMK A;  4M77 F;  4Q5W A;  1I07 A;  1NM7 A;  2EGC A;  2GBQ A;  2PTK A;  1P92 A;  1YJ9 A;  3HL8 A;  2X35 A;  1ZA1 B;  4C8Q G;  2DKG A;  1IRE B;  4XU2 A;  2RQW A;  4HT8 A;  3VJP A;  1VQ4 T;  3EFR A;  4II1 A;  1O9S A;  4PJO E;  2ROT A;  1X2K A;  2ZPI B;  2NUT B;  2D8H A;  3HPW A;  1VIF A;  1QCO A;  4BI4 A;  2GFU A;  3AHU A;  3EG9 B;  1WJR A;  2L3S A;  2BZ8 A;  3EFO B;  1BI2 A;  4CC3 A;  1OZ2 A;  2DRM A;  1B07 A;  1C6V X;  4KGZ B;  3SWN C;  2COY A;  2DZC A;  4CRI A;  2KRS A;  4HVU A;  1H3Z A;  2RK1 A;  1N6A A;  1QVG S;  2RK2 A;  4KUI A;  4A4F A;  5LJ5 h;  1M30 A;  3O5Z A;  1UTI A;  5GAN h;  3EGD A;  4NOY A;  1NG2 A;  3E9G A;  1VQM A;  1M9S A;  1KSW A;  1Q7Y U;  3QYH B;  1KK7 A;  4PJO F;  1OPL A;  3MCA B;  3WXM B;  1CSK A;  4M75 D;  4DBR A;  3CD6 T;  2HDA A;  3EG1 A;  4JUV A;  2OI3 A;  2HBP A;  2X51 A;  3EGD B;  4EMK A;  4N0A C;  2AKK A;  1RL2 A;  4A54 A;  2EVR A;  2HAX A;  1TXQ A;  2RPN A;  2SEM A;  3OYG A;  1BU1 A;  1YJ9 T;  3KFV A;  2CP7 A;  1W2B S;  2AK5 A;  2CP3 A;  2JNG A;  1PSE A;  1TUD A;  3EG3 A;  5KYN A;  1S72 Q;  4ELZ C;  1YIT Q;  3M4Y A;  2YUN A;  2J6F A;  2K6D A;  4FT4 A;  2BZY A;  1WYX A;  1OEB A;  1WQW A;  3NFC A;  4EMK B;  3E2U A;  4Y91 A;  1VQ8 A;  3SWN A;  5CQY A;  5I22 A;  1YJN A;  2PQW A;  5GJV B;  1AVZ C;  4P5N A;  3PFS A;  3RNJ A;  1W70 A;  3QWX X;  2DIQ A;  1MMD A;  1VQM T;  1WFW A;  1WHJ A;  2X3X D;  1IB8 A;  3FEO A;  2RA2 A;  4M4Z A;  3CQT A;  1NYF A;  4HCC A;  3TU4 K;  4HA8 A;  2OTL Q;  1Q95 G;  2A36 A;  4LDV A;  2DXB A;  2OAU A;  1QVG P;  5CIU A;  5GAM d;  3CCV Q;  1NPP A;  3C95 A;  5GAN 3;  3SWN B;  1X6G A;  5HK3 A;  1HD3 A;  1SEM A;  5CK9 A;  2O4X A;  4D8D A;  3CCR Q;  4NL3 A;  1K4U S;  2ZAE A;  3L2W A;  4N0A A;  1OOT A;  2RHI A;  1YIT A;  3JCM X;  1GRI A;  1QP3 A;  3ER0 A;  1NE8 A;  1MNE A;  2PU9 B;  4M75 G;  3H0F A;  2DJQ A;  1AWX A;  1CKB A;  2DRK A;  1Q7Y R;  2ABL A;  2EIF A;  1ZBX A;  1IGU A;  1R0C B;  2HQH A;  1RAH B;  4HCZ A;  1YN8 A;  2KT1 A;  5I11 A;  3REB B;  3L2Z A;  2JS2 A;  2OAW A;  1ZA2 B;  3HRU A;  2O4X B;  1QVF S;  2EJG A;  2FPE A;  3MEA A;  3M55 A;  2DMO A;  3CPF A;  1Y07 A;  2V1Q A;  5HK0 A;  3MKD A;  3G6E Q;  3V8L A;  3VYH B;  4ZN1 A;  1VQ8 T;  3HSB A;  3PE0 A;  4XU3 A;  1K8A R;  1SPK A;  1YJN T;  1VUB A;  3CC4 Q;  1MGQ A;  4RKU E;  2FL7 A;  4F17 A;  1C0M A;  5CCA A;  1G3Y A;  2FPD A;  1T0J A;  3JCM d;  1VQ6 Q;  3ZL7 C;  4BE0 A;  4OB2 B;  1VQ7 A;  3LWH A;  1ZHI A;  3BFM A;  2ENM A;  3V7C A;  4M7D D;  3NPF A;  5LJ5 e;  4XTZ A;  2ED0 A;  4ME7 A;  4FYW B;  3M54 A;  5GAN e;  2CZ0 B;  2PUK B;  2YLB A;  4IUV A;  5GAO m;  2V8J A;  1T0H A;  2JZ2 A;  1WZO A;  2ZGW A;  3OSV A;  1O75 A;  4JLG A;  1S72 T;  2COW A;  1BKB A;  4QQG A;  4E7S A;  2CP5 A;  1YIT T;  1GL5 A;  5FRM A;  5FLX E;  2MCN A;  2RI2 A;  4C8Q C;  1AD5 A;  2YHT A;  4F16 A;  1UUE A;  1RAC B;  4DOW A;  4DA4 A;  3JCM J;  1JXM A;  1VYU A;  3NHN A;  4O6J A;  4ZN3 A;  3CC4 A;  1NEG A;  3JCM P;  1BK2 A;  1AZG B;  3HFN A;  1OUL A;  2JM8 A;  5CVI A;  3S3N A;  5HY6 A;  1PD0 A;  3VV0 A;  3M9Q A;  5IAY A;  1YWO A;  2DYI A;  3TCJ A;  5IXF A;  1VQN Q;  2VYT A;  2EQJ A;  2GQV A;  2LP5 A;  1BB9 A;  2LCC A;  1UG1 A;  1IXD A;  1UGS B;  2D6F A;  3A8H B;  4C0D B;  4FW1 A;  1AEY A;  3OS1 A;  2RJF A;  4IKF A;  4PKC C;  4EMH A;  2B8A A;  2BKD N;  1RLP C;  5CQX A;  5IN1 A;  6AT1 B;  2DNU A;  2KSS A;  1RI0 A;  4LDW A;  2QEX Q;  1KIK A;  3X28 B;  2VXE A;  2V26 A;  3KBG A;  3RES A;  2K3B A;  2DE0 X;  1D1B A;  3ULR B;  2M51 A;  2HL3 A;  3HHT B;  4N4G A;  3HP9 A;  1H92 A;  1VOM A;  5KCO A;  3G4S Q;  4M7D G;  3INZ A;  4C8Q A;  5GAN 4;  4XQ3 A;  3OB9 A;  4IUR A;  2EJ9 A;  1VQN A;  2O31 A;  2HL5 C;  2O01 E;  2EGA A;  1VQK Q;  3M5A A;  4IIO A;  3CC4 T;  2JTF A;  1WA7 A;  4PJN A;  3P8D A;  3ASK A;  4M7A B;  3R6N A;  1NJI C;  1VQ6 T;  3TQ7 P;  2KBT A;  3CME A;  2X4X A;  2L0A A;  4PJJ A;  5A0D A;  2K7A A;  3GIB A;  4JRI A;  1K73 U;  2MAM A;  4GLM A;  2V8K A;  4JLI A;  1PCX A;  1I5L A;  1Y96 A;  2CT3 A;  3A5Z B;  4LE9 A;  4C8Q B;  2QG9 B;  4Z02 A;  3LX7 A;  5C6S A;  2L8D A;  4DQ2 A;  4D8K A;  4C0Z A;  1ZUK A;  4KRT A;  2QEX A;  3RIR A;  5GAO p;  1I5O B;  3QZ5 B;  1U5S A;  1VQ5 A;  2RHX A;  3QDR B;  3RMQ A;  2DL7 A;  4AFU C;  3O8V A;  1IGQ A;  1GCQ C;  1FWZ A;  3JB9 J;  4OGE A;  2F2W A;  3G4S A;  2QDY B;  4MML A;  3TRE A;  3SEM A;  2LX9 A;  4X34 A;  3JAM E;  1Y96 B;  4OMP A;  1YHQ A;  3X26 B;  3PMT A;  2JN0 A;  5LJ3 f;  1N9S A;  3V8J A;  4E7I A;  1KQ2 A;  3OMG A;  2L2P A;  1VQK A;  3VUB A;  2LMJ A;  4TVR A;  1MV0 B;  2COZ A;  4MZT A;  2EPD A;  4M75 C;  4C5H A;  2XDP A;  4A4G A;  2DM1 A;  2F5K A;  5GAN 6;  4M7A E;  4J9F A;  2PUO B;  1GBR A;  2HQX A;  1Q7Y C;  1UFF A;  1ZBJ A;  3R6O A;  2CP0 A;  3M0P A;  3G71 Q;  3VU3 C;  1VQN T;  1YI2 Q;  4KUL A;  4C8Q E;  1UGR B;  4OGC A;  3FRN A;  5KYY A;  1G3T A;  2F1L A;  4BD3 A;  2M0O A;  5L8R E;  1NZ9 A;  2EW3 A;  4BE1 A;  2C06 A;  1JB0 E;  1TG0 A;  2MI6 A;  3OYI A;  3QJY A;  3CXC A;  3CME T;  2DYB A;  4OMF B;  3WVE B;  3L2R A;  4QQD A;  2R5A A;  3QXE B;  3H8Z A;  2R58 A;  4M7A F;  1ZX6 A;  2DFU A;  2P0K A;  4OMO A;  2VB6 A;  4KBM B;  3CCQ Q;  2X4Y A;  2QEX T;  1YJW A;  5KYY B;  1UEB A;  1VIE A;  1R8O B;  2DL8 A;  1WDX A;  1GCQ A;  1UHC A;  2H8H A;  3MO8 A;  1KC8 C;  2CT4 A;  2YRC A;  1M1K U;  3I56 Q;  2DAQ A;  3G4S T;  5A2Q E;  2F5T X;  4AFS C;  5LJ3 j;  3CCE Q;  5GMK m;  1YHQ T;  1PC0 A;  4ZNX A;  3JCM c;  2CS7 A;  3GF5 A;  4MZP A;  4L6V 5;  2KE9 A;  1VQK T;  1LPL A;  1SSH A;  4M75 A;  3VS3 A;  5AT1 B;  1PKS A;  3NTI A;  4FCY A;  2CH4 W;  3BDU A;  4N4I A;  2EFI A;  4BUG A;  3VS5 A;  1EFN A;  1Y71 A;  1GFD A;  1PRL C;  2ZCF B;  3LH0 A;  1VQL Q;  2HZY A;  2HMA A;  3MET A;  1WHL A;  1V1C A;  5EG2 A;  5J3B A;  2GQI A;  2RQR A;  3OA6 A;  5KCH A;  2PVD B;  3BDL A;  1MMG A;  2JTM A;  4DBQ A;  1M3B A;  3I5R A;  4M75 B;  4JJB A;  2QTV A;  1WXT A;  2M1H A;  2EYY A;  3EGX A;  4OML A;  3JB9 I;  4LDY A;  3OYN A;  1NYG A;  4RCB A;  3QZ9 B;  1OX9 A;  2CH4 A;  3VYG A;  2KR3 A;  2EGE A;  3CCE A;  2P0P A;  5D6Y A;  2E3H A;  5GAM f;  1QP2 A;  5IH2 A;  1EIF A;  3FB9 A;  2VC8 A;  2WAC A;  2IVW A;  1BI0 A;  5FWC A;  4HT9 A;  4JJC A;  2XU8 A;  4F7U F;  2PVG B;  3EGX B;  3F70 A;  5CAI A;  3TSW A;  4M78 F;  1KG1 A;  1BCO A;  5AYF A;  1RLQ C;  3M53 A;  2MPX C;  1ABO A;  5C0M A;  4GLK A;  4M7D C;  4FYV B;  1A0N B;  4J9E A;  1OX8 A;  1BYM A;  3HRS A;  2A7Y A;  4ATO A;  4XTX A;  3CEY A;  3CCJ A;  3DLM A;  3OW2 P;  3C94 A;  4RUG A;  4C92 F;  4M75 E;  3FJP A;  1RAI B;  2PNI A;  5CKE A;  4XK8 E;  3JV3 A;  1ZSZ B;  2FO0 A;  1TWB A;  4M77 D;  4CC4 B;  3E1S A;  2FZC B;  3BY7 A;  4PFZ A;  2KDS A;  4Z89 A;  4FSX A;  3PVL A;  1D09 B;  1V29 B;  3QWY A;  3UWN A;  2LDM A;  4J83 A;  1OU9 A;  3JCM f;  3EAE A;  1E6G A;  1K9M U;  4C0F A;  1QQJ A;  1JBM A;  3RKY A;  3M56 A;  3I56 T;  1GCP A;  3LGF A;  1QWF A;  1K0S A;  5GAM j;  2E5Q A;  3CMA Q;  3CCE T;  4HXJ A;  4IUU A;  4E6R A;  1B7T A;  3JCM b;  2CYZ B;  4JRK A;  4XTY A;  4FYY B;  2KAF A;  1Q81 U;  3THK A;  1M2V A;  1VYT A;  1RI9 A;  3M0S A;  2YUO A;  3SB2 A;  1AZE A;  2K9G A;  4PJO D;  2C0T A;  3CC7 Q;  3AT1 B;  4JJD A;  4WTO B;  1D0Y A;  2RQU A;  2JVV A;  4OF1 A;  4QVD A;  3JB9 F;  2CUB A;  4M7D A;  2Y4X A;  3QUI A;  3NTK A;  2GF7 A;  1U1S A;  3PIP A;  2YWW A;  3CCJ T;  2QA4 Q;  1KC8 U;  3LYI A;  1UEC A;  1NJI R;  1V76 A;  2Y4Y A;  1M2V B;  4L59 A;  1E6H A;  5I21 A;  4HCK A;  2LQK A;  1RAA B;  2SRC A;  4RTX A;  2LT4 A;  3BE3 A;  1PG5 B;  2HNI A;  3OMC A;  3QHS A;  4C5G A;  4M7D B;  4Z88 A;  1SSF A;  2DK3 A;  4OMN A;  1BIA A;  3FC3 A;  3M59 A;  4J9B A;  2AIR B;  2L3R A;  3FJ5 A;  2V8I A;  1NBE B;  3ZFJ A;  2ZPB B;  5IT9 E;  2FHD A;  2E6N A;  3A8O B;  3OYB A;  2NYS A;  2K5I A;  3J7A F;  4RG2 A;  1B3Q A;  3REA B;  1WXB A;  3JB9 H;  3CCS Q;  3CCL Q;  5IHI A;  3RMS A;  4DEY A;  2MIO A;  5CO7 A;  2MWP A;  1S72 A;  3RR6 A;  2ZPF B;  1K73 C;  3MHX A;  1W6X A;  1K9M R;  1AHJ B;  1OPK A;  4HCB A;  1SKU B;  1UHF A;  2VAS A;  4C0G A;  2XD0 A;  2DBK A;  4IUT A;  2RJE A;  2L3P A;  1GFC A;  2KYB A;  1D3B A;  2DPP B;  2RQV A;  1VQO Q;  4WF2 A;  3I5S A;  3OBY A;  4OB1 B;  4M7D E;  5M9O A;  2EYX A;  2YXY A;  4A53 A;  1Q81 R;  1JRI A;  1UDL A;  1W2B P;  5CKD A;  4EMG A;  2EKH A;  3LGL A;  4C5I A;  2OTL A;  3CMA T;  2A37 A;  3MJX A;  5A0L A;  3CCV A;  1TH7 A;  1R0B G;  2FEI A;  3QKJ A;  2DXT A;  2KNB B;  2E70 A;  4O5V A;  2ECZ A;  1JQQ A;  4BE2 A;  2GTO A;  2RF0 A;  4AT1 B;  2RJC A;  2QAS A;  5DLQ E;  3CCR A;  2AZV A;  1KJW A;  4CC2 A;  3UPU A;  8AT1 B;  3H9N A;  4ANJ A;  1KC8 R;  2ZPH B;  4BB7 A;  2YSQ A;  2XDB A;  1FMW A;  1RUW A;  3M4G A;  3C4S A;  2W10 A;  3QII A;  2O2O A;  3PIO A;  4AG1 C;  2A28 A;  2DTH A;  1U1T A;  5LJ5 d;  3QPH A;  1D1C A;  5GAN d;  1VQP Q;  3JRZ A;  2EYQ A;  2XG8 D;  1Q82 U;  1K0X A;  2X4J A;  2QA4 T;  2OJ2 A;  2CZ6 B;  4V2S A;  5FW9 A;  5LJ3 g;  2LC4 A;  1JJ2 A;  2LNV A;  3EH2 A;  2MMP A;  2F69 A;  3G6E A;  4HVW A;  4PK4 A;  2FVU A;  5GAN 5;  2P4T A;  2P4R A;  3EHQ A;  1NLO C;  1VQ6 A;  2J06 A;  4J7F A;  3UF4 A;  3CPW A;  1M1K C;  1ARK A;  1WIE A;  1E7O A;  1YCY A;  4DEX A;  2QQR A;  3ZEH A;  1HYO A;  1N9R A;  1X6B A;  2VXF A;  3NGP A;  4J6Y A;  1BBZ A;  2OTL T;  2R5M A;  2DD4 A;  5IHN A;  4LXC A;  2NWM A;  4FW2 A;  3CCV T;  4BY6 C;  4QVZ A;  2VGM A;  1QVF P;  2BTT A;  4OP0 A;  3RER A;  3CCS T;  2FZK B;  3MP1 A;  4LDX A;  2YRD A;  3M0U A;  5HCK A;  3CCR T;  3D7S B;  2I2L A;  1TUG B;  3MP8 A;  2XK0 A;  3MEV A;  1AWJ A;  1MMA A;  3L42 A;  5KYU A;  4KT0 E;  2HD0 A;  1IHW A;  2LQ8 A;  3VS4 A;  1D0Z A;  4PJM A;  9ATC B;  3OYJ A;  3DB4 A;  1ZUU A;  2XDD A;  2JJ9 A;  5GJW B;  2LJ1 A;  1SG5 A;  2DO3 A;  2E1H A;  2C0O A;  5L23 A;  5D6X A;  4EIK A;  3QDF A;  1ZLM A;  4KH1 B;  2FYK A;  1MV3 A;  4UC4 A;  5KYX A;  2DTI A;  4BAC A;  2FZG B;  2JOY A;  3HTR A;  2DTO A;  4MDW A;  2KMT A;  1XQH A;  5KYU B;  2I0N A;  3G6E T;  3EHR A;  4QQ6 A;  3VUZ A;  1VYV A;  2NLU A;  2VGN A;  2VVK A;  4LDU A;  3MPU B;  2KT8 A;  1BCM A;  5GAN 2;  2O88 A;  3M0T A;  4LD6 A;  4KUD K;  1W1F A;  3JCM Q;  1PM3 A;  2RQT A;  2L3Q A;  5KYX B;  3I55 Q;  2KRN A;  5D7U A;  3CCU Q;  4BI3 A;  2EQU A;  4R56 A;  2GCX A;  4NS5 A;  2BIV A;  1D0X A;  5DM7 R;  2LRQ A;  2LJ3 A;  2QAZ A;  2OX7 A;  1VA7 A;  3CCM Q;  3JCM W;  3QJ6 A;  2X9H A;  1OU8 A;  4J9D A;  3A1P A;  4A63 B;  3RDV A;  2JMC A;  4LUE A;  4IUP A;  5A0G A;  2PVO B;  1WHK A;  4B9W A;  4ZGE B;  4EPC A;  1MHN A;  1G5V A;  4PFP A;  5LJ3 h;  5GAM g;  3A8M B;  1LJO A;  3N5B B;  4KH0 B;  4BY6 B;  3M0R A;  2VKN A;  3V7R A;  5IXB A;  3C12 A;  4FM4 B;  1I0C A;  2MYS A;  1K9M C;  2RJD A;  1LOJ A;  3UT1 A;  1M2O A;  5CKF A;  1N8R U;  3I55 A;  2KK4 A;  5GMK j;  3CCU A;  1I1J A;  4RTZ A;  1WJS A;  4PFO A;  3OYA A;  2M02 A;  2OTJ Q;  3SDZ A;  3RBB B;  2AZS A;  1SHF A;  1LVK A;  1UGQ B;  3PGG A;  2E12 A;  2VWF A;  4QW2 A;  2AHJ B;  3VRZ A;  5J39 A;  1Q81 C;  5ECA A;  2NUZ A;  2K2M A;  4X1V A;  3CC2 Q;  2B86 A;  4J6X A;  3U23 A;  3EFS A;  4X9C A;  2K2V A;  2A3L A;  3JCM g;  1XNI A;  2LTO A;  1Y7X A;  4RTW A;  3PTA A;  4C8Q F;  2DEU A;  2CSQ A;  3H0H A;  4J9I A;  3DB3 A;  2DBM A;  2RM4 A;  3MEW A;  4XU1 A;  2EAY A;  2M0Y A;  4M7A D;  1T3L A;  1K73 R;  3G71 A;  2MWO A;  2ATC B;  1YI2 A;  2RI5 A;  3VS6 A;  3L2V A;  1TUC A;  1AWW A;  2E64 A;  1DJ7 B;  4RTU A;  2BUD A;  4IIM A;  1D1A A;  4QKU A;  1Q86 C;  1J3T A;  2HEQ A;  4OB3 B;  2AKL A;  1M5Q 1;  2E6Z A;  1YIJ Q;  4E7H A;  3I55 T;  3VS0 A;  3CCU T;  3CC2 A;  3HRT A;  2KXC A;  1G83 A;  1MND A;  3C0C A;  1S1N A;  3OYK A;  2QQS A;  3OYY A;  4R0K A;  3CCQ A;  3CCM T;  2CZ1 B;  1K76 A;  5CKB A;  2E65 A;  2DF6 A;  2JW4 A;  1KD1 U;  2RHY A;  1SHG A;  4PNO A;  1FMV A;  4FL6 A;  3I56 A;  1YJ9 Q;  5KE2 A;  1WX6 A;  1WI7 A;  1M90 U;  2YDL A;  2CUD A;  5GAM h;  2QQA A;  3QBY A;  1UE9 A;  2JM9 A;  1N8R R;  3L2U A;  3KUF A;  1M3C A;  1VQ9 Q;  5I2M A;  2D1X A;  2XIC A;  1TS9 A;  4JJN K;  1RAD B;  4FU6 A;  3OY9 A;  3OS0 A;  5KE3 A;  4JS5 A;  2DIG A;  3HFO A;  4LUD A;  4VUB A;  4DBH A;  3UAT A;  2H3J A;  1ABQ A;  2QDL A;  1M1G A;  1WLP B;  4ZGD B;  1IZ6 A;  4ORZ A;  2YLC A;  3G71 T;  2E41 A;  1YI2 T;  1VQL A;  4A4E A;  2OTJ T;  1VQM Q;  2NUT A;  1LNX A;  2G6F X;  1OZ3 A;  2A08 A;  5GAN 7;  4XTW A;  1ZSG A;  2ZPG B;  5LJ3 e;  4F04 B;  4M7A G;  3EG2 A;  4N4H A;  1JJ2 S;  3EFO A;  3CC2 T;  4LN2 A;  2KRM A;  2LT1 A;  1M1K R;  2ROL A;  2D8J A;  4ZTF A;  1WQ7 A;  4JZ3 A;  2JUF A;  4M78 D;  1RAB B;  1NPR A;  3JCM h;  3CCQ T;  3H41 A;  4A4K A;  1VQ9 A;  4MDX A;  1IHV A;  5EC7 A;  3CPW S;  2JMA A;  2FRY A;  2Y90 A;  5GAO q;  1Q82 C;  1BI3 A;  4C92 D;  2K3Y A;  4CI0 C;  2CSI A;  3SD4 A;  2XMF A;  2V1R A;  4JRP A;  2YRV A;  2CZ7 B;  1LCK A;  4M75 F;  3GBQ A;  2L89 A;  1OV3 A;  3S6W A;  1QWE A;  2ED1 A;  1RAG B;  1I8F A;  1YBY A;  2PZ1 A;  2KQW A;  3GLX A;  1KHI A;  2EWN A;  5LJ5 f;  5GAN f;  1VQ8 Q;  2XHC A;  1YJN Q;  1KD1 R;  1YIJ T;  4LD9 K;  2DZ9 A;  4XAX B;  4ZGJ B;  4E7K A;  1AWO A;  1I81 A;  3H6Z A;  1VQL T;  2O9V A;  1M90 R;  3GOX A;  1X2Q A;  3OBW A;  2LQN A;  4ZTJ A;  2K4Y A;  2EJF A;  1OQK A;  3V7S A;  4BI8 B;  4AG2 C;  1YP5 A;  4HKE A;  5D6W A;  1K8A U;  1G3S A;  2DXC A;  4J8O A;  2RMO A;  2F2X A;  5J26 A;  1JU5 C;  4NL2 A;  3CMA A;  4FSS A;  3JB9 D;  1KQS A;  3X24 B;  1N5Z A;  1VQ9 T;  3ZBD A;  4F7U G;  4J6W A;  1JJ2 P;  3I9Q A;  2EQM A;  3URG A;  2E5K A;  4LNP A;  1Q86 U;  3RKW A;  2J05 A;  4M77 G;  3MEU A;  2MF2 A;  4M78 G;  2X3W D;  4J7I A;  1ACM B;  2RH2 A;  3PNW C;  3S3O A;  3M0Q A;  2CRE A;  4AFQ C;  3CC7 A;  2FB7 A;  1PHT A;  3CPW P;  1FYN A;  1AOJ A;  2K79 A;  3LH5 A;  5LJ5 j;  4C92 G;  3QYG B;  2RNA A;  5GAN j;  4RTY A;  2RB6 A;  1Z9Z A;  2EBP A;  2KI7 A;  2CDT A;  3RKX A;  4RTV A;  3TSZ A;  2KEA A;  5GAM e;  2BZX A;  4QVC A;  1YFN A;  2K57 A;  2QA4 A;  2FG0 A;  2DA9 A;  3G7Z A;  2RHU A;  5DY9 A;  3OQ5 A;  3OW2 A;  1WJQ A;  2DEQ A;  2KXD A;  1IO6 A;  2H3E B;  2CKK A;  2D0Q B;  2J7I A;  1N27 A;  4C5E A;  2KGT A;  4E47 A;  5HKC A;  1EX4 A;  1QKW A;  3PVQ A;  1VQ7 Q;  1UB4 A;  1X01 A;  1X75 C;  2LJ0 A;  3VS7 A;  3J81 E;  4PJO G;  3OS2 A;  4ESR A;  3UDC A;  1QMC A;  2VV5 A;  4GBQ A;  1G2B A;  2IIM A;  2KRO A;  2DIL A;  1QLY A;  1ZUY A;  4AFZ C;  3OS5 A;  1XJW B;  2QGG A;  3OYD A;  2DL3 A;  4C0D C;  3CXC S;  2CP2 A;  1D3B B;  2HBW A;  4RCC A;  1GXI E;  3CCS A;  4F14 A;  3CCL A;  2QXF A;  3J80 E;  4BDY A;  1N8R C;  1Y57 A;  2DJZ A;  3JB9 G;  4M7D F;  4GY5 A;  4PLL A;  1KHC A;  2D9T A;  1I4K 1;  2M16 A;  4E7Z A;  3JCM e;  1R77 A;  3JCM V;  5GAN 8;  8ATC B;  3A8L B;  4OMQ A;  3CC7 T;  4YTL A;  5FU7 C;  3L1A A;  5FRO A;  3LWI A;  2K3X A;  3V8K A;  1VQO A;  1TOV A;  3M57 A;  5FRN A;  1QKX A;  1XOV A;  1Q86 R;  2VUB A;  4FT2 A;  4X9D A;  1F1B B;  1PKT A;  3A98 A;  3X20 B;  1HJD A;  2FRW A;  2QYZ A;  2DER A;  4M7A C;  3IQL A;  1WPY A;  2EYW A;  3CBP A;  2DL4 A;  1EZZ B;  2YUQ A;  1U3O A;  2WSF E;  3LW5 E;  1QVP A;  1U8R A;  3T9N A;  3GNF B;  1TU0 B;  4FYX B;  5GAO l;  1Z9Q A;  3VS1 A;  4JPB W;  2DVE A;  3MP6 A;  1QVG A;  2XI9 A;  2WSC E;  3CCL T; 
#chains in the Genus database with same CATH homology
 2VWF A;  2A36 A;  1RLQ C;  1ABO A;  3VRZ A;  5ECA A;  2LZ6 B;  4J9E A;  1A0N B;  2NUZ A;  2C0I A;  1X6G A;  1HD3 A;  2K2M A;  1SEM A;  4X1V A;  4WCI A;  2B86 A;  4RUG A;  3U23 A;  4D8D A;  1K4U S;  2PNI A;  4J9G A;  1OOT A;  3JV3 A;  1YNZ A;  1GRI A;  2FO0 A;  1SRM A;  2JXB A;  4RTW A;  3H0F A;  4CC4 B;  2DJQ A;  1AWX A;  1X43 A;  4Z89 A;  1CKB A;  2DRK A;  2ABL A;  3PVL A;  2CSQ A;  3H0H A;  3QWY A;  4J9I A;  2DBM A;  1YN8 A;  2KT1 A;  5I11 A;  3REB B;  2RN8 A;  1E6G A;  2JS2 A;  2OAW A;  3H0I A;  2M0Y A;  1T3L A;  1GCP A;  2FPE A;  2DMO A;  1QWF A;  1K0S A;  3VS6 A;  3EG0 A;  2V1Q A;  1TUC A;  4HXJ A;  1AWW A;  4RTU A;  2LX7 A;  4E6R A;  1QCF A;  3PE0 A;  4IIM A;  1SPK A;  1J3T A;  1H8K A;  2HEQ A;  4F17 A;  2AKL A;  2FPD A;  1WXU A;  3VRY A;  1T0J A;  3VS0 A;  3THK A;  3ZL7 C;  2KXC A;  1G83 A;  4Y92 A;  1VYT A;  1RI9 A;  3M0S A;  2YUO A;  3C0C A;  3VS2 A;  1S1N A;  1AZE A;  2K9G A;  2C0T A;  2DLP A;  1UJY A;  4QT7 A;  4JJD A;  4R0K A;  2RQU A;  2ENM A;  2CUB A;  3I35 A;  2DL5 A;  3SHW A;  1K76 A;  2DF6 A;  3NPF A;  2JW4 A;  2ED0 A;  1SHG A;  1NEB A;  1T0H A;  1JO8 A;  2DVJ A;  1WX6 A;  1WI7 A;  1UEC A;  2YDL A;  2CUD A;  1UE9 A;  2JM9 A;  1GL5 A;  1E6H A;  1M3C A;  2MCN A;  4HCK A;  2D1X A;  2JTE A;  1AD5 A;  2HCK A;  2SRC A;  1UUE A;  4RTX A;  4F16 A;  4LUD A;  1JXM A;  1VYU A;  1PWT A;  1KFZ A;  4HVV A;  3NHN A;  4Z88 A;  4OMN A;  1NEG A;  3UAT A;  1BK2 A;  1AZG B;  4J9B A;  1SRL A;  1ABQ A;  2QDL A;  2W0Z A;  2MOX A;  1WLP B;  2JM8 A;  4ORZ A;  1M27 C;  3FJ5 A;  3TVT A;  1YWO A;  5IXF A;  1M3A A;  2J6O A;  2EQI A;  2LP5 A;  1GBQ A;  2G6F X;  1NLP C;  1T3S A;  1BB9 A;  1B3Q A;  2A08 A;  3REA B;  1WXB A;  1ZSG A;  1UG1 A;  2GTJ A;  3EG2 A;  5IHI A;  2YUP A;  4DEY A;  2MIO A;  4LN2 A;  2KRM A;  1K9A A;  1AEY A;  1K1Z A;  2ROL A;  2D8J A;  1W6X A;  2DX1 A;  4JZ3 A;  1OPK A;  1RLP C;  2GGR A;  1JEG A;  1UHF A;  3H41 A;  2DBK A;  2KYM A;  2DNU A;  4JZ4 A;  2L3P A;  5EC7 A;  1GFC A;  1Y0M A;  2EYZ A;  2KYB A;  2LCS A;  1KIK A;  2JMA A;  2RQV A;  2FRY A;  3I5S A;  1U06 A;  2K3B A;  2EYX A;  1PNJ A;  2DE0 X;  3UA7 A;  3ULR B;  2CSI A;  2M51 A;  4J9C A;  2XMF A;  4K11 A;  2V1R A;  1H92 A;  1LCK A;  3GBQ A;  1UDL A;  2D0N A;  1OV3 A;  2EKH A;  1QWE A;  2ED1 A;  2A37 A;  2PZ1 A;  2O31 A;  2FEI A;  3EGU A;  2EGA A;  2JS0 A;  2KNB B;  4IIO A;  2ECZ A;  5FWB A;  1WA7 A;  1JQQ A;  2GTO A;  2RF0 A;  3R6N A;  2AZV A;  1KJW A;  2KBT A;  4CC2 A;  1AWO A;  2L0A A;  2K7A A;  2YSQ A;  2O9V A;  4GLM A;  1X2Q A;  1RUW A;  2CT3 A;  2LQN A;  4LE9 A;  2JT4 A;  2W10 A;  5IHK A;  2O2O A;  4AG1 C;  4D8K A;  4AG2 C;  2A28 A;  1YP5 A;  2O9S A;  1ZUK A;  4KRT A;  1YCS B;  2RMO A;  1U5S A;  2ESW A;  1K0X A;  2OJ2 A;  2DL7 A;  2LNH B;  5FW9 A;  2F2X A;  3NMZ C;  4AFU C;  1JU5 C;  1GCQ C;  4FSS A;  2F2W A;  1JXO A;  4HVW A;  3UA6 A;  1N5Z A;  3SEM A;  4RTT A;  4OMP A;  1UGV A;  3I9Q A;  1HSQ A;  2E5K A;  1PRM C;  4LNP A;  2P4R A;  3EHQ A;  1NLO C;  2J05 A;  2LQW A;  2L2P A;  4CC7 A;  2J06 A;  3UF4 A;  1X27 A;  2FPF A;  2X3W D;  2LMJ A;  1MV0 B;  1CKA A;  1ARK A;  2EPD A;  1WIE A;  1E7O A;  4DEX A;  1H3H A;  3M0Q A;  2GNC A;  2CRE A;  2DM1 A;  4AFQ C;  4J9F A;  1YWP A;  1GBR A;  1X6B A;  1UFF A;  1MUZ A;  1PHT A;  1ZBJ A;  1X69 A;  2F2V A;  1FYN A;  3NGP A;  1AOJ A;  2K79 A;  1BBZ A;  2YT6 A;  3LH5 A;  3M0P A;  2RNA A;  5IHN A;  2NWM A;  4RTY A;  2HSP A;  1Z9Z A;  2EBP A;  4OMM A;  2J6K A;  2BTT A;  2CDT A;  4Z8A A;  4J9H A;  4RTV A;  1M8M A;  1UJ0 A;  3TSZ A;  2KEA A;  1FMK A;  2BZX A;  1I07 A;  1NM7 A;  2EW3 A;  2DA9 A;  2EGC A;  2FG0 A;  2GBQ A;  2PTK A;  1TG0 A;  3M0U A;  5HCK A;  2KXD A;  1IO6 A;  2RQW A;  2DYB A;  1AWJ A;  2J7I A;  2ROT A;  3VS4 A;  2KGT A;  1X2K A;  1QKW A;  2D8H A;  3PVQ A;  1ZX6 A;  1ZUU A;  5GJW B;  4OMO A;  2LJ1 A;  2LJ0 A;  3VS7 A;  2C0O A;  5L23 A;  4ESR A;  4EIK A;  1ZLM A;  2L3S A;  1MV3 A;  2BZ8 A;  4CC3 A;  4GBQ A;  2DRM A;  1B07 A;  1G2B A;  2IIM A;  2KRO A;  2DIL A;  2KRS A;  4HVU A;  1QLY A;  2DL8 A;  1WDX A;  1ZUY A;  1GCQ A;  1UHC A;  2H8H A;  4AFZ C;  2CT4 A;  1M30 A;  3O5Z A;  1UTI A;  2DL3 A;  2I0N A;  1NG2 A;  3EHR A;  1VYV A;  2VVK A;  4AFS C;  1KSW A;  2KT8 A;  2HBW A;  4ZNX A;  2O88 A;  3M0T A;  4F14 A;  1OPL A;  1W1F A;  2KE9 A;  1Y57 A;  2RQT A;  1CSK A;  1SSH A;  2L3Q A;  3VS3 A;  2KRN A;  1PKS A;  2HDA A;  2CH4 W;  4OMQ A;  3VS5 A;  3EG1 A;  1EFN A;  1GFD A;  2LJ3 A;  2OI3 A;  1PRL C;  2AKK A;  1VA7 A;  2EVR A;  4J9D A;  2RPN A;  1V1C A;  4A63 B;  2SEM A;  2JMC A;  4LUE A;  2GQI A;  1BU1 A;  1QKX A;  1XOV A;  2RQR A;  3KFV A;  2AK5 A;  1M3B A;  3I5R A;  4JJB A;  1TUD A;  3EG3 A;  1PKT A;  1WXT A;  3A98 A;  2EYY A;  4OML A;  1HJD A;  2FRW A;  2YUN A;  3IQL A;  2J6F A;  2EYW A;  2K6D A;  2BZY A;  1WYX A;  1NYG A;  1OEB A;  2DL4 A;  2CH4 A;  3M0R A;  2KR3 A;  2EGE A;  2VKN A;  5IXB A;  2YUQ A;  5I22 A;  1I0C A;  1U3O A;  5IH2 A;  5GJV B;  1AVZ C;  5FWC A;  3RNJ A;  1W70 A;  4JJC A;  1I1J A;  3QWX X;  4RTZ A;  1Z9Q A;  3VS1 A;  4JPB W;  1WFW A;  2X3X D;  4M4Z A;  3TSW A;  3CQT A;  1NYF A;  3RBB B;  2AZS A;  1SHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...