2M51A

Nmr structure of the sh3 domain of human ras p21 protein activator (gtpase activating protein) 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
62
structure length
62
Chain Sequence
b'GRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras GTPase-activating protein 1
molecule tags Protein binding
source organism Homo sapiens
publication title NMR structure of the SH3 domain of human RAS p21 protein activator (GTPase activating protein) 1
rcsb
total genus 7
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2m51A00
1KSWA 2GBQA 2EYXA 4J9FA 2DILA 2EGAA 4HVVA 2DYBA 1UTIA 4RUGA 4A63B 2O88A 2EYZA 2ED1A 2K2MA 1HD3A 1M3CA 1WFWA 2D8HA 3VS7A 4F17A 1UHFA 1M30A 2EGEA 2CUBA 1WIEA 2EVRA 4JJDA 1K0XA 4RTUA 4JJCA 5ECAA 1GCQA 2DBKA 2FRYA 1HSQA 1Y0MA 1YP5A 2JMCA 2YDLA 2GQIA 2MCNA 3NGPA 2JTEA 4X1VA 1RUWA 2AK5A 1KFZA 2JM8A 2RQWA 2JXBA 1X43A 2LP5A 1GFCA 2FEIA 1H3HA 2DL7A 4RTVA 4DEXA 5IHKA 2RQUA 3QWXX 1FYNA 1KIKA 1OEBA 2KRNA 1JQQA 3M0TA 3PVQA 4JZ3A 2O9SA 4AG1C 4D8DA 2DF6A 2X3XD 2LMJA 1YWOA 2KE9A 1SHFA 2L3QA 1NEBA 4HVWA 4IIOA 3TVTA 2IIMA 3H0IA 2D8JA 2FRWA 1X2KA 2A28A 4FSSA 4DEYA 2GNCA 3VS1A 1YNZA 4OMOA 1WXUA 3O5ZA 1IO6A 3I35A 3SHWA 1ZBJA 1AWOA 3H0HA 1YN8A 3FJ5A 2EPDA 2HSPA 2CT3A 2CDTA 3VS3A 1GCQC 2MIOA 4CC4B 3CQTA 1QLYA 2J05A 4OMQA 2K6DA 1T0JA 5FWCA 1QKXA 2G6FX 4GLMA 5L23A 5HCKA 2OAWA 2DL5A 4QT7A 2D0NA 1WXTA 3REBB 1ARKA 2CUDA 2DL3A 2LNHB 3UF4A 1Z9ZA 1G2BA 1M3BA 2DX1A 1OOTA 1X27A 3VS0A 1Z9QA 1GFDA 4Y92A 2HDAA 3UA6A 1SRMA 3VRZA 3THKA 2JW4A 2C0OA 2KNBB 2RN8A 1K0SA 5GJWB 2X3WD 1NLPC 4CC2A 1SEMA 4J9IA 3GBQA 1VYUA 1J3TA 2CH4A 2JMAA 1AWJA 4AFZC 1GL5A 2RPNA 2KYMA 4Z88A 4K11A 5GJVB 1WLPB 2J6OA 4LE9A 2LQNA 2C0TA 4OMLA 1LCKA 4F14A 1YCSB 4LUDA 1K1ZA 2KXCA 1I1JA 2RQTA 2AZSA 2B86A 1UDLA 5I11A 1UJYA 3ULRB 2RF0A 2I0NA 2LX7A 1V1CA 2KT8A 1AWXA 1BK2A 1GCPA 2K3BA 2LJ0A 2W0ZA 4GBQA 4ESRA 2JM9A 2E5KA 2XMFA 2K9GA 3C0CA 1U5SA 1B07A 1S1NA 5IHNA 3VS4A 1AD5A 2EBPA 1HJDA 1TUDA 1QWEA 1MUZA 1PKSA 1ZLMA 3UA7A 1K76A 2EKHA 2HBWA 1XOVA 4KRTA 1SPKA 1T3SA 2DL8A 3REAB 4JJBA 1PRMC 4AFQC 4J9EA 2DM1A 3VS5A 3EG2A 1UGVA 4AFUC 1CKBA 2KRMA 2EYYA 1JXOA 3I5RA 2PTKA 2FPFA 1BBZA 1WYXA 1X6GA 4RTZA 2J6KA 4HXJA 1UG1A 1W1FA 2V1RA 2EW3A 3LH5A 1A0NB 2YUOA 1NLOC 1GBRA 1E6HA 1K9AA 1JO8A 2DE0X 3U23A 2OI3A 1G83A 1MV3A 4OMPA 1ABQA 3EG1A 2KEAA 1NM7A 3EHRA 1M27C 1PNJA 3M0QA 1UECA 2FPEA 3I5SA 4LUEA 2DMOA 2O31A 2DJQA 1B3QA 1X2QA 4RTWA 1T3LA 4CC7A 2O2OA 1NG2A 2QDLA 2K79A 1BB9A 4JZ4A 1EFNA 3KFVA 1CKAA 1AZGB 2GTJA 2L3PA 2F2VA 4J9DA 2PZ1A 2BZ8A 4D8KA 1I0CA 2DLPA 1AEYA 5FWBA 1WXBA 3M0PA 1X6BA 1U06A 1UHCA 1MV0B 2C0IA 4CC3A 5EC7A 2A37A 1H8KA 3EG0A 2AZVA 4JPBW 1AOJA 1PWTA 1PRLC 2KYBA 1PKTA 2YT6A 3RNJA 2HCKA 2GTOA 1E6GA 3M0SA 1W70A 3ZL7C 2LJ3A 3QWYA 3VS2A 2F2XA 3PVLA 2ED0A 2F2WA 4LNPA 4Z8AA 2SEMA 2KROA 2JS0A 3M0UA 1TG0A 1YWPA 1M3AA 4RTTA 1T0HA 2YUNA 2RNAA 2J06A 3R6NA 2DBMA 2EYWA 2PNIA 3H0FA 1UE9A 1AVZC 2DRMA 2KR3A 2ENMA 4LN2A 2DVJA 1NYGA 1SSHA 1X69A 3NPFA 4J9BA 2L3SA 3JV3A 3NMZC 1UJ0A 4EIKA 2YSQA 3RBBB 1GBQA 4J9HA 1NYFA 3SEMA 4F16A 2KXDA 3VS6A 1ZUUA 2L2PA 2YUQA 1W6XA 1OPLA 1E7OA 5IXFA 1I07A 1NEGA 4HVUA 2L0AA 4RTYA 4ORZA 1PHTA 1SHGA 2RQRA 2D1XA 2AKKA 2RMOA 3A98A 3NHNA 2CREA 2BTTA 2NWMA 4E6RA 1M8MA 2VVKA 1RLPC 2A36A 2LJ1A 1FMKA 2FPDA 1AWWA 4AG2C 2DA9A 2NUZA 2RQVA 3EG3A 2VWFA 5IH2A 4R0KA 1H92A 1ZX6A 2GGRA 4OMNA 2JT4A 4Z89A 5FW9A 4J9CA 3H41A 3M0RA 3EHQA 1ABOA 2LQWA 1JXMA 2FO0A 2ABLA 2KRSA 2BZYA 2ROLA 1QCFA 1CSKA 1U3OA 3I9QA 3PE0A 2JS2A 2FG0A 1UUEA 4WCIA 1N5ZA 2HEQA 1KJWA 4RTXA 1SRLA 2KT1A 2BZXA 2ROTA 3TSWA 2K7AA 1VYVA 1QKWA 2AKLA 1GRIA 2ECZA 1JU5C 1BU1A 2OJ2A 2V1QA 2VKNA 2EGCA 4OMMA 2P4RA 1VYTA 1RLQC 1VA7A 1OPKA 2SRCA 1QWFA 2ESWA 2MOXA 5IHIA 3IQLA 4J9GA 1ZUKA 1WA7A 2CSIA 2J7IA 3UATA 1OV3A 1JEGA 2CSQA 1WI7A 2YUPA 1UFFA 4HCKA 4IIMA 2M0YA 1WX6A 2H8HA 2M51A 3TSZA 2W10A 2KBTA 5I22A 1K4US 3EGUA 1RI9A 2DRKA 2O9VA 1Y57A 1TUCA 2EQIA 4M4ZA 4AFSC 2CH4W 2LCSA 2DL4A 2J6FA 1WDXA 2LZ6B 1AZEA 3VRYA 4ZNXA 1ZSGA 2KGTA 1ZUYA 2A08A 5IXBA 2CT4A 2DNUA
chains in the Genus database with same CATH superfamily
4J9FA 4N4IA 2Y4YA 2DILA 4J5YA 3JAME 2EJGA 4LDYA 4C5EA 1JB0E 4BACA 1UTIA 3ER0A 5I21A 2ED1A 1KK7A 2GFAA 2DXUA 2VGMA 2XKOC 3OMGA 2D8HA 3JB9D 5KE3A 3OYLA 2M9UA 1S72A 2CGHA 4RTUA 4C8QG 4MZTA 2DYIA 2KQWA 2FRYA 3G4SQ 2YDLA 3OYMA 5FU6B 1D3BA 2JM8A 2RQWA 2ZPBB 5A0LA 4MZPA 1X43A 3G71Q 3QSUA 1S72T 2LCLA 2ZGWA 2ZPGB 3CD6A 4DEXA 1D3BB 5IHKA 3AHUA 1KHIA 4C8QE 2RQUA 1KIKA 1TUGB 4OB3B 3E1SA 3EG9B 3CPWP 2DF6A 2LMJA 3CC7Q 3JCMe 2L3QA 1NEBA 5GANf 2P0PA 1PD1A 1QP3A 3TVTA 2IIMA 2XD0A 4L5GA 2CP5A 3KBGA 4A54A 4LDWA 2RHUA 1ZBJA 3H0HA 5GAMg 3JCMV 5M9OA 2CDTA 4N4GA 1GCQC 2FL7A 2XHCA 1TU0B 5KYWA 1QLYA 3SD4A 2GCXA 4OMQA 1YJ9Q 2K6DA 1QKXA 2DTHA 3CCVT 5L23A 1X75C 1Q82C 1VUBA 1VQ7Q 2HQXA 2E41A 4RCCA 4PNOA 1G3SA 2CS7A 3G7ZA 1W2BS 3META 1ARKA 2DD5A 1M2OA 1G2BA 1UGSB 1K8AC 4C0GA 1YITA 3VS0A 2NYSA 2NUTB 1Z9QA 4X34A 3QZ9B 3UA6A 2GFUA 3THKA 3RIRA 4C5HA 4M78B 4HT9A 2GQVA 2XU8A 4MMKA 2C0OA 2MI6A 2RN8A 2NUTA 1SG5A 3V8LA 2X9HA 1D1CA 2H3EB 3UPUA 3OW2A 3GBQA 1VYUA 4IKFA 2CH4A 1AWJA 1B34B 1IRXA 1BIBA 4L59A 4NOYA 2KYMA 4M7AG 5GJVB 1WLPB 2J6OA 4LE9A 4E7KA 1LCKA 4LUDA 2KXCA 2PU9B 1I1JA 4KUIA 2RQTA 5DM7R 1UDLA 5I11A 1OU9A 2HKNA 3JB9H 2YLBA 4A4GA 3CPWA 4HCZA 2RF0A 1AWXA 4GBQA 2W0ZA 4OB0B 2QDYB 2P0QA 1B07A 1S1NA 1BYMA 3VS4A 4C8QA 2CYZB 2EBPA 3HP9A 1QWEA 2JUFA 5J39A 1MUZA 1VQPT 1ZA1B 1PKSA 2K3XA 5KYYA 2L89A 3UA7A 4ZN1A 5J26A 3CBOA 2DL8A 3REAB 4JRKA 4J9EA 4DBFA 3EFSA 3EG2A 1QCOA 4AFUC 1M2VB 1OX9A 2KRMA 3I5RA 3MPUB 2DZCA 1RAAB 3S3OA 1W1FA 3AT1B 3CMAQ 4IUVA 2EW3A 3S3NA 3EAEA 1NLOC 1GBRA 1K9AA 2DE0X 3QHSA 3BFMA 4AMCA 3I55Q 2OI3A 2RI2A 5CO7A 1KD1R 2YLCA 1I4K1 5GAN5 1KG1A 1R0CB 1NM7A 1M27C 1PNJA 1KC8R 2GF7A 2DD4A 2F5TX 2O31A 1B3QA 2CZ0B 1T3LA 2QTXA 5LJ5j 2DZ9A 2O2OA 2K79A 1UGRB 1BB9A 2BE7D 4JZ4A 5CCAA 1CKAA 3ME9A 1G3TA 1R0BG 4QQGA 4D8KA 2Y90A 1AEYA 3HPWA 4L6V5 1WXBA 2K57A 4PJOA 2C0IA 3HHTB 4ME7A 4CC3A 1Q7YR 1YJ9A 3GP8A 3CCMQ 1M8VA 4QKUA 2KI7A 2BIVA 4M77C 4JPBW 1AOJA 3GNGA 3VKIA 4ZN3A 1PRLC 3JCMc 3M0SA 1N9RA 3ZL7C 4M7DA 1I5OB 1U1TA 2HL3A 4KT0E 3M4YA 4Z8AA 4V2SA 1M1KC 3M0UA 3CCLT 1M3AA 2YUNA 2YRVA 2CP0A 1KHCA 2X4XA 3VYHB 4JRQA 3CMEA 4B9XA 1AVZC 2DRMA 1RADB 3I56A 4BUGA 1UB4A 3HTRA 3C94A 1VQ9Q 4M77D 3X25B 1X69A 2XI9A 3NMZC 3CBMA 4MZMA 4F7UA 1GBQA 4M7AB 3L2UA 3SEMA 3CMET 3HSBA 3SWNC 3QJYA 2RK2A 3EGXB 1W6XA 4WF2A 1OPLA 2COYA 3GF5A 3OYBA 3P8HA 4FCYA 4CI0C 2DXTA 2RQRA 1SHGA 1QVPA 2D1XA 1M90R 3BY7A 5GANd 2K2VA 4XQ3A 3NHNA 4KGXB 2CREA 2NWMA 2VVKA 2QXFA 3OYIA 4JJNK 4DOWA 2RQVA 5IH2A 4JLGA 4R0KA 1H92A 1NPRA 4Z89A 1GXIE 4C8QF 2LQWA 1JXMA 2MK5A 2QEXT 3OA6A 3G4SA 3HRTA 4M77E 3PE0A 3EFOB 3MP1A 2FG0A 1UUEA 4HCCA 4KULA 1KJWA 4RTXA 2LQ8A 5LJ3g 1O9SA 2EAYA 2ROTA 2LCCA 2LNVA 1M1KR 2EFIA 4PKCC 1GRIA 1PSEA 1BU1A 3G4ST 1IXDA 3I55A 2QAZA 2C06A 2VKNA 5LJ5d 4A4EA 3SFMA 3CCRA 1KQSA 2P4RA 3V7SA 1QWFA 3FDRA 4N0AC 1WQWA 3L42A 3CCMT 1VQ5Q 1OV3A 1C0MA 3G6ET 1S72Q 4JRPA 4XU0A 4ZTFA 2M0YA 1ZQ1A 1VQ9A 3EGUA 1RI9A 2O9VA 3CC7T 5D6XA 2OTJT 3X20B 2X4WA 2RHXA 4M4ZA 2CH4W 4AFSC 2YWWA 2J6FA 3CCLQ 1AZEA 3CCMA 2QA4Q 2VUBA 4ZNXA 1V29B 2BKDN 2RA2A 4MDWA 2L3RA 2QQRA 1ZUYA 2EJ9A 3QZ5B 3TEEA 1KSWA 2GBQA 1VQ9T 4XTZA 3CXCA 2EGAA 2OTJA 4HVVA 2JTMA 2CZ1B 4M75A 3RESA 1FMVA 4RUGA 2FHDA 2EYZA 1KD1C 1PCXA 1YCYA 1OI1A 2D0QB 3NTKA 5LJ5f 2PVDB 3OY9A 2DERA 3L2VA 4ANJA 4DBHA 3LWIA 4F17A 4DA4A 1B34A 2EVRA 3JB9G 1D0YA 2CZ6B 4JJDA 3A8LB 1R8OB 2LTOA 1OZ2A 5GAMf 3CMAT 1YP5A 2JMCA 3MEUA 2MCNA 5A2QE 2D6FA 3OQ5A 1YI2A 1WHHA 2WACA 4BDYA 2LDMA 2JN0A 1Y71A 2RJFA 2DEQA 4ZTJA 2CP3A 3OSSC 3M57A 1WZOA 3E9GA 3CMAA 1W2BP 1FYNA 4BB7A 1VQ5T 1JJ2A 4M77B 2R58A 2QQAA 2E12A 4Y28E 3GIBA 3JB9I 2O9SA 4AG1C 3MP6A 1HYOA 1YWOA 5GAN6 1SHFA 3JCMQ 4M7DD 2DTOA 1F1BB 2JTFA 4HVWA 2MWPA 3L1AA 3H0IA 2D8JA 2FRWA 4DEYA 1Q82U 4FSSA 3ZBDA 3CEYA 2E64A 3VS1A 1PG5B 1YNZA 4Z02A 1VQ5A 4OMOA 1WXUA 2ZPHB 3E2UA 1IO6A 3I35A 5GANj 1N8RR 1YN8A 1K8AU 5GAMj 3FJ5A 4A4HA 3VS3A 4BE2A 2MIOA 3INZA 2WSEE 4CC4B 2KY9A 1VQKA 1MNEA 4FW2A 1YITT 1N6AA 4KH0B 5KYXB 4GLKA 4O5VA 4OB2B 4II1A 4XAXB 2D0NA 2CUDA 1Z9ZA 2E6NA 2JNGA 2ZCFB 1M3BA 3F70A 1OOTA 5J3BA 1IGUA 4M75D 3PTAA 2QA4T 4FT4A 5HK3A 3JCMg 5GAOl 2YXYA 1EX4A 1YJNT 3LX7A 1K0SA 5GAMh 2XICA 2X3WD 4OVAA 3L2WA 1SEMA 3BDUA 2QQBA 1X6OA 2DIGA 3HRSA 1Q81C 1G5VA 1Y96A 2KK4A 2QA4A 5D6YA 5GAMe 3SDZA 1D1BA 1VQKQ 1YCSB 2VB6A 5GAN8 1K1ZA 4KBMB 2B86A 1QVFP 3ULRB 1VQPA 5HY6A 5C0MA 2I0NA 2LX7A 4C92E 1BK2A 2LC4A 4KGVB 2JM9A 2E5KA 2I2LA 5AYFA 2XMFA 2K9GA 1G8XA 2COZA 5IHNA 4N4HA 3SWNA 1HJDA 2IG0A 1M9SA 5CKHA 1WHMA 3RR6A 2HNIA 4NS5A 3FIFA 3JCMb 4E7JA 2D9TA 4C92C 1C6VX 4EMKB 6AT1B 3EGDB 4M75E 2RHZA 5DY9A 2DXCA 4JJBA 3L2ZA 4AFQC 2AT1B 4XTXA 4M77F 4M78G 3JCMJ 4N0AA 1UGVA 2OTLA 3QYHB 2M16A 1PSFA 3FEOA 1LPLA 2J6KA 5LJ5e 1UG1A 3UT1A 3WXMB 1A0NB 1K73C 1JO8A 3MO8A 3CC2T 5LJ3j 1ACMB 1IHVA 2HBPA 3CC4T 5GAN7 3CCSA 2RHIA 4OMFB 2OTLT 4XTVA 1ABQA 2QG9B 4C5IA 1UEBA 3CCVQ 3EHRA 3TREA 2FPEA 3LLRA 2E1HA 4A4FA 2DJQA 1NZ9A 2B8AA 1X2QA 4RTWA 1VIEA 4CC7A 1Q82R 3VYGA 3CC2A 2O01E 2RO0A 3WVDB 3CC4A 4EDUA 3PIPA 4EMKA 3CCST 3QYGB 2P0KA 3LGFA 4C92D 3DB3A 2O4XB 4J9DA 8AT1B 2PZ1A 5GMKm 1N8RU 1K8AR 1I0CA 2RJDA 2DXBA 4P5NA 3M0PA 1X6BA 1U06A 3OS2A 3O8VA 5CAIA 1M2VA 4J6XA 1H8KA 3EG0A 2AZVA 4C0FA 4J6WA 3DKMA 4TVRA 1PWTA 1NBEB 1PKTA 2X4JA 2EKOA 3DLMA 2GTOA 4C92B 3NTIA 1YJWA 1ZSZB 3P8DA 4C0DC 4MDXA 1I81A 3QG1A 4BY6B 3S3MA 2LJ3A 3JCMW 5LJ5h 2AIRB 1OX8A 2DFUA 2JS0A 1Y96B 1TG0A 4PJMA 1YJWT 4M7AE 1JJ2P 3R6NA 2DBMA 2PNIA 1BI0A 3PNWC 2FZCB 4PFZA 4RKUE 5EG2A 1NYGA 1PM3A 3GOXA 3NPFA 1UJ0A 4EIKA 3OYHA 3N5BB 1Q81R 1LVKA 3OYKA 2EQKA 2R5MA 4J83A 1ZUUA 4R55A 2L2PA 1N9SA 1ZSZA 2MF2A 5CKBA 5IXFA 1HK9A 4FYYB 1NEGA 4HVUA 4LD6A 3ZEHA 1M90U 3CCJQ 2AKKA 2MMPA 5GMKe 2MYSA 3A98A 5GMKl 1ZHIA 4RG2A 3G1JA 2DIQA 3VJPA 3OS1A 2NUZA 2QGGA 3C95A 3C12A 2M02A 3PMTA 4M78A 4E47A 4BE1A 3EHQA 1ABOA 3PGGA 2ABLA 2BZYA 3MCAB 4HA8A 3QKJA 1U3OA 2COWA 3I9QA 1WHJA 4OB1B 4PLLA 4PJOG 1QVGP 5GAN3 3CCRT 5LJ5g 3RUXA 1SRLA 5IT9E 2KT1A 2BZXA 2F69A 3EGXA 1VYVA 5CIUA 2VYTA 2ECZA 1JU5C 2A0FB 2CZ7B 3G6EA 4M75B 2K3YA 4QQ6A 1NJIU 2V1QA 3R6OA 3SWNB 3DLLA 4M7DG 4OMMA 1KD1U 1VYTA 1RLQC 1VA7A 1OPKA 2RM4A 3CC7A 3UWNA 2RI5A 2ESWA 5IHIA 3DB4A 2CSIA 3M59A 4VUBA 1KC8U 3CMEQ 1WI7A 1TSFA 3MEWA 1UFFA 5I2MA 5GMKj 8ATCB 1BKBA 2M51A 2W10A 5I22A 1QMCA 4XU1A 3CBPA 1Y57A 4M7AC 1X01A 2LCSA 2RD1A 4IUPA 1XQHA 3CXCS 2KAFA 5FU6C 1WJSA 2NUPB 1G3WA 2A08A 3RDVA 2FYKA 4LUEA 2CT4A 3H6ZA 4C92A 1YJNQ 2EYXA 2LQKA 2HKQB 4PFPA 1XNIA 4O6JA 4RCBA 3TQ7P 4A63B 2O88A 4C92G 5KYNA 1PC0A 3KXTA 3LWHA 3CCUA 1YITQ 2YRDA 2LT1A 4OGEA 3BDLA 5GAN4 4BDZA 1M3CA 1WFWA 2QTVA 1YI2T 2BUDA 3VS7A 4X9CA 2EGEA 2CUBA 1WIEA 1WJRA 4XTYA 3RKYA 4E7IA 1VQ4Q 5IAYA 3QDFA 3RMSA 5ECAA 2DBKA 3CCUT 5KCHA 5KYUB 3NGPA 2F1LA 2JTEA 4FM4B 1RUWA 2AK5A 3GLXA 2VV5A 5KYWB 2LP5A 3OYYA 3V7CA 1RI0A 2A7YA 3ASKA 2AHJB 3WVEB 4FSXA 1WPYA 5GAOp 3UDCA 3JCMf 1JQQA 3M0TA 2F5KA 4JZ3A 4EPCA 2CP2A 4BD3A 1P92A 1Y07A 4EMGA 1Q7YC 2QYZA 2L5QA 2HQHA 4IIOA 3EFOA 2ZZDA 3EFRA 4KUDK 1X2KA 1VQKT 1BI2A 4IUQA 3SHWA 2EPDA 2CT3A 3OB9A 3J80E 1ZBXA 4M77G 4M78F 2XDDA 3X28B 2J05A 2ZAEA 1JBMA 1T0JA 5FWCA 4GLMA 2OAWA 1VQ8Q 3M58A 4EMKC 2QEXQ 2ZPFB 3REBB 1YJNA 2DL3A 2LNHB 3E9FA 5GANe 5FU7B 4M75G 2EQMA 5GAOr 1WJQA 2FVUA 3JSCA 2QGFB 1XTDA 1GFDA 4RG8A 1SRMA 3BE3A 1MMNA 3VRZA 1K73R 3M55A 1TTHB 2KNBB 2QQSA 1V76A 4LDVA 4B6MA 3QPHA 1O75A 1NLPC 1WHKA 2L8DA 4J9IA 2DVEA 3MEAA 3FRNA 1Y7XA 2JMAA 1WHGA 3QO3A 4F04B 4Z88A 3G71A 1VQOA 5KYUA 5C6SA 2LQNA 3CD6Q 2C0TA 3T9NA 3FB9A 2V8JA 4M7DB 5KE2A 4DOVA 5CKEA 2OTJQ 2WSFE 5DLQE 2QK0A 1VQ4T 3OW2S 1AT1B 1V1CA 2KT8A 1LJOA 3G71T 2LJ0A 4E2FB 1EIFA 3C0CA 5HK0A 1LNXA 1U5SA 4LD9K 1AD5A 2DK3A 1ZSZC 4ZGEB 1VQ4A 3I56Q 4J8OA 1K76A 1XOVA 5HKCA 1SPKA 3VUZA 3CPFA 4FYXB 2IPOB 3VUBA 4QVCA 1LOJA 2QASA 3Q1JA 1QQJA 1VQMA 1CKBA 1VQ8A 3C4SA 2PTKA 2XG8D 4PJOE 2KMTA 4HXJA 2V1RA 3LH5A 1EZZB 1E6HA 1IB8A 5GAN2 1NJIR 1KQSP 3OSVA 1MV3A 1KQ2A 4OMPA 2EIFA 1VQMT 3MEVA 4E7LA 1VQ8T 3EG1A 2ATCB 4JS4A 3M0QA 3QJ6A 5FLXE 3I5SA 2V8IA 2DMOA 3FJPA 1SKUB 1NG2A 1R77A 4FYWB 5LJ3h 1QVFS 4XK8E 3GPLA 4KGZB 1C1AA 1Q86R 3OYAA 1YFNA 2L3PA 2NLUA 3LYIA 5LJ3f 3JB9J 1TWBA 1MGQA 4RMOA 2DLPA 2HL5C 1UHCA 1MV0B 4XU3A 5KH6A 2CP6A 3OYNA 5FROA 5EC7A 1U8RA 1M5Q1 3MKDA 4BE0A 1VQOQ 3JCMX 4A53A 2KYBA 2HMAA 5CKFA 2YT6A 4AT1B 3J81E 2HCKA 1UGQB 2K4YA 4HT8A 1W70A 2YRCA 3QWYA 2DETA 2F2XA 3PVLA 1VQ6Q 2OAUA 3D7SB 5GAOm 2ED0A 3GNFB 4LNPA 5CKDA 1HXDA 4DBRA 2KROA 4R56A 3NTHA 3P8BB 2RB6A 2RH2A 4J7FA 1UE9A 2XDBA 2KR3A 2ENMA 3LW5E 4LN2A 4PJJA 1M90C 1IREB 4OGCA 1SSHA 4M78D 2L3SA 4FW1A 3JV3A 2BE9B 1IGQA 4J9HA 1FX7A 1NYFA 2K5LA 3MJXA 4JRIA 3VS6A 2Y4XA 1B7TA 4C5GA 4F7UF 3PMIA 2VASA 1WGSA 1E7OA 1I07A 4IUTA 2L0AA 2HZYA 3CCSQ 4ORZA 5CVIA 1KQSS 3BW1A 4BI3A 1YIJQ 1RAGB 3PT9A 1RLPC 2A36A 1FMKA 1AWWA 2DA9A 3EG3A 2VWFA 1ZX6A 2GGRA 5FRMA 1K9MR 4E7SA 4J9CA 3H41A 3M0RA 1K9MU 3M5AA 2ROLA 1RAHB 1VQMQ 3RKXA 2JS2A 4WCIA 2P84A 3OYDA 1SF9A 4J6YA 1WHLA 2HEQA 2OX7A 3TSWA 4PK4A 2K7AA 3EG9A 5KYYB 1M1KU 3JRZA 2FZKB 2OJ2A 2E70A 4C8QB 1OZ3A 1RABB 4QW2A 1TS9A 1DJ7B 2MOXA 3IQLA 1ZUKA 1WA7A 2J7IA 4JLIA 2DTIA 2X35A 3V8JA 2PVOB 3J7AF 2VXEA 1VOMA 1QVFA 3CC4Q 3HRUA 3LGLA 5CQYA 2M0OA 1FMWA 2YUPA 3SB2A 4IIMA 2VC8A 3TSZA 2E10A 4JUVA 2E4HA 2KBTA 4IUUA 2DRKA 4M78C 1TUCA 3PFSA 3PIOA 4PJOC 1TXQA 1W2BA 2KGTA 1BCMA 1OQKA 4BI8B 1XJWB 1KC8C 1I5LA 4PJNA 3QXEB 5IXBA 3JCMh 2DNUA 3A8GB 3X26B 1QVGA 4M7DC 2DYBA 5CQXA 1NJIC 1BI3A 5L8RE 1D0XA 3CCQA 2K2MA 3EH2A 3CCRQ 2PQWA 4PJLA 4ZGDB 1HD3A 2FB7A 2RJCA 4FT2A 1QP2A 4PL6A 2XK0A 1UHFA 1M30A 3A5ZB 4E7ZA 2KVQG 2R57A 4IURA 1K0XA 4JJCA 2X4YA 1GCQA 2LT4A 3QUIA 1HSQA 1Y0MA 3H9NA 2GQIA 1JRIA 4X1VA 3OS5A 1W4SA 1KFZA 3M9QA 2PVGB 5I2SA 1RAIB 4M7AA 3JCMP 2JXBA 2A3LA 2H3JA 1Q81U 1GFCA 2FEIA 3A8HB 1H3HA 5FU7C 2DL7A 4RTVA 2DKGA 3QIIA 4C92F 3M54A 2ZPIB 3EGDA 3QWXX 3S6WA 1OEBA 3X24B 2KRNA 2E3IA 3PVQA 3CCJA 2QI2A 4WTOB 1NPPA 2CKKA 4D8DA 4EMHA 2X3XD 2PUKB 2KE9A 4FIBA 3CD6T 2E65A 2RI3A 5FRNA 2XDPA 4CRIA 2A28A 4ELYC 2LVMA 2GNCA 4DBQA 1Q86U 3CCJT 3O5ZA 4Y91A 1AWOA 3OS0A 1RACB 5GAOn 2HSPA 1Q86C 1Q7YU 1PD0A 3CQTA 1H3ZA 1FXXA 3OBWA 1MMDA 2G6FX 4UC4A 5HCKA 5AT1B 2DL5A 4QT7A 3OYCA 3RKWA 1WXTA 1VQPQ 1M1FA 3UF4A 1ZA2B 4C0ZA 4Q5WA 4LDUA 2JOYA 1RAEB 3CCUQ 2DX1A 1X27A 3CCVA 1RL2A 3CCQQ 4Y92A 1K73U 2YHTA 2HDAA 3M4GA 4M7DE 3NFCA 2V8KA 2MAMA 2IVWA 4KH1B 2JW4A 3HFNA 1VQOT 5GJWB 4CC2A 2G3RA 2RJEA 1J3TA 4ELZC 2EQJA 4NL2A 4OF1A 4AFZC 1GL5A 4M78E 2RPNA 4QQDA 5LJ3e 1VQNQ 2X51A 2RHYA 3VU3C 4K11A 4OMLA 5LJ3d 4F14A 1VQ7A 2AZSA 2JJ9A 4M75C 1UJYA 3LH0A 4XU2A 4PLIA 1QCNA 3E19A 4M7DF 3H8ZA 1GCPA 4F7UB 2K3BA 1M1GA 5CK9A 4ESRA 1VQ6A 3URGA 1VQ7T 4MMLA 3ZFJA 1U1SA 1TUDA 5GANg 1VQLQ 2EQUA 2Z0WA 3OYFA 1ZLMA 2HD0A 4PJOF 2EKHA 2HBWA 4QVDA 4M7AF 4KRTA 4J7IA 1VQ6T 1T3SA 5D7UA 3CCEA 1I8FA 2M1HA 1PRMC 1YI2Q 2DM1A 5D6WA 3VS5A 1RAFB 2CP7A 4M77A 2EYYA 1JXOA 2FPFA 1BBZA 3MP8A 1WYXA 3HKSA 1X6GA 4RTZA 1BIAA 2QQ9A 2DO3A 4C8QD 4A4KA 2YUOA 4BY6C 3CCET 1N27A 2XIDA 3U23A 1JJ2S 4F7UE 1D0ZA 1G83A 4FL6A 4DQ2A 1Q95G 1IHWA 5IN1A 1MMAA 1VIFA 2KEAA 2E3HA 4ZGJB 2O4XA 5GAOq 2HAXA 1UECA 2V26A 3M53A 9ATCB 1N8RC 4B9WA 2QDLA 1EFNA 3KFVA 1AZGB 2GTJA 4D6WA 3EH1A 2F2VA 3MHXA 2BZ8A 5FWBA 1FWZA 2R5AA 3V8KA 3OYGA 5DLOA 1YHQQ 1QW1A 2A37A 3V7RA 5GANh 3RNJA 3OW2P 3M56A 3OYJA 3G6EQ 1E6GA 4C0DB 5A0DA 1OYXA 3VS2A 1YJ9T 1TOVA 1D1AA 3TCJA 1OULA 1BI1A 2EYQA 2F2WA 2MPXC 2LRQA 2SEMA 3HFOA 1VQNT 1G3YA 3VV0A 1YWPA 1VQLA 5GMKh 1OU8A 4RTTA 1T0HA 1UGPB 2RNAA 1MNDA 2KDSA 2J06A 2EYWA 3H0FA 3FLGA 2VGNA 2DVJA 1H641 5GMKi 1TH7A 3OBYA 4J9BA 1VQNA 4ATOA 4FU6A 5LL6S 1VQLT 3CCLA 1MHNA 2DAQA 2YSQA 3RBBB 4JDSA 2EWNA 2KXDA 4F16A 3I56T 4C8QC 2PUOB 4X9DA 2YUQA 3TU4K 1MMGA 1K9MC 5KCOA 1YJWQ 4RTYA 3A1PA 1PHTA 3OYEA 2RMOA 4BI4A 1IZ6A 2BTTA 1WNLA 4E6RA 1M8MA 2MWOA 3L2QA 3QBYA 2LJ1A 2E6ZA 2FPDA 3HL8A 2K5FA 4AG2C 3JCMd 3RERA 3CC2Q 1BCOA 1YHQT 5KYXA 4OMNA 2JT4A 3A8OB 5FW9A 7AT1B 3CCEQ 2FO0A 2KRSA 2P4TA 3RMQA 2JVVA 1QCFA 1CSKA 2KSSA 2RK1A 4XTUA 2OTLQ 2VXFA 4F7UG 4JS5A 3CXCP 1N5ZA 1YHQA 4M7AD 2HSEB 5GAMd 4PJOD 4M75F 2FZGB 4E7HA 1WQ7A 1QKWA 2QEXA 2AKLA 2DPPB 2JZ2A 1NE8A 3QDRB 3OMCA 4FYVB 3FC3A 1D09B 2HQEA 5CR2A 4LDXA 1YBYA 2EGCA 2SRCA 3CPWS 1YIJA 3A8MB 3L2RA 2DEUA 4PJOB 4J9GA 3UATA 4XTWA 4HCBA 3I55T 2WSCE 2LX9A 4PFOA 1JEGA 2DJZA 2CSQA 4OP0A 4HCKA 2K5IA 1WX6A 2H8HA 4YTLA 3KUFA 4QVZA 1K4US 4GY5A 2NUPA 4NL3A 1YIJT 1KQ1A 2EQIA 2DL4A 1WDXA 2LZ6B 2E5QA 1AHJB 3VRYA 3JB9F 1M4ZA 1QVGS 1ZSGA 2ZPEB 3CCQT 5A0GA 4LXCA 2EJFA 4HKEA 1SSFA
chains in the Genus database with same CATH topology
1KSWA 2GBQA 2EYXA 4J9FA 2DILA 2EGAA 4HVVA 2DYBA 1UTIA 4RUGA 4A63B 2O88A 2EYZA 2ED1A 2K2MA 1HD3A 1M3CA 1WFWA 2D8HA 3VS7A 4F17A 1UHFA 1M30A 2EGEA 2CUBA 1WIEA 2EVRA 4JJDA 1K0XA 4RTUA 4JJCA 5ECAA 1GCQA 2DBKA 2FRYA 1HSQA 1Y0MA 1YP5A 2JMCA 2YDLA 2GQIA 2MCNA 3NGPA 2JTEA 4X1VA 1RUWA 2AK5A 1KFZA 2JM8A 2RQWA 2JXBA 1X43A 2LP5A 1GFCA 2FEIA 1H3HA 2DL7A 4RTVA 4DEXA 5IHKA 2RQUA 3QWXX 1FYNA 1KIKA 1OEBA 2KRNA 1JQQA 3M0TA 3PVQA 4JZ3A 2O9SA 4AG1C 4D8DA 2DF6A 2X3XD 2LMJA 1YWOA 2KE9A 1SHFA 2L3QA 1NEBA 4HVWA 4IIOA 3TVTA 2IIMA 3H0IA 2D8JA 2FRWA 1X2KA 2A28A 4FSSA 4DEYA 2GNCA 3VS1A 1YNZA 4OMOA 1WXUA 3O5ZA 1IO6A 3I35A 3SHWA 1ZBJA 1AWOA 3H0HA 1YN8A 3FJ5A 2EPDA 2HSPA 2CT3A 2CDTA 3VS3A 1GCQC 2MIOA 4CC4B 3CQTA 1QLYA 2J05A 4OMQA 2K6DA 1T0JA 5FWCA 1QKXA 2G6FX 4GLMA 5L23A 5HCKA 2OAWA 2DL5A 4QT7A 2D0NA 1WXTA 3REBB 1ARKA 2CUDA 2DL3A 2LNHB 3UF4A 1Z9ZA 1G2BA 1M3BA 2DX1A 1OOTA 1X27A 3VS0A 1Z9QA 1GFDA 4Y92A 2HDAA 3UA6A 1SRMA 3VRZA 3THKA 2JW4A 2C0OA 2KNBB 2RN8A 1K0SA 5GJWB 2X3WD 1NLPC 4CC2A 1SEMA 4J9IA 3GBQA 1VYUA 1J3TA 2CH4A 2JMAA 1AWJA 4AFZC 1GL5A 2RPNA 2KYMA 4Z88A 4K11A 5GJVB 1WLPB 2J6OA 4LE9A 2LQNA 2C0TA 4OMLA 1LCKA 4F14A 1YCSB 4LUDA 1K1ZA 2KXCA 1I1JA 2RQTA 2AZSA 2B86A 1UDLA 5I11A 1UJYA 3ULRB 2RF0A 2I0NA 2LX7A 1V1CA 2KT8A 1AWXA 1BK2A 1GCPA 2K3BA 2LJ0A 2W0ZA 4GBQA 4ESRA 2JM9A 2E5KA 2XMFA 2K9GA 3C0CA 1U5SA 1B07A 1S1NA 5IHNA 3VS4A 1AD5A 2EBPA 1HJDA 1TUDA 1QWEA 1MUZA 1PKSA 1ZLMA 3UA7A 1K76A 2EKHA 2HBWA 1XOVA 4KRTA 1SPKA 1T3SA 2DL8A 3REAB 4JJBA 1PRMC 4AFQC 4J9EA 2DM1A 3VS5A 3EG2A 1UGVA 4AFUC 1CKBA 2KRMA 2EYYA 1JXOA 3I5RA 2PTKA 2FPFA 1BBZA 1WYXA 1X6GA 4RTZA 2J6KA 4HXJA 1UG1A 1W1FA 2V1RA 2EW3A 3LH5A 1A0NB 2YUOA 1NLOC 1GBRA 1E6HA 1K9AA 1JO8A 2DE0X 3U23A 2OI3A 1G83A 1MV3A 4OMPA 1ABQA 3EG1A 2KEAA 1NM7A 3EHRA 1M27C 1PNJA 3M0QA 1UECA 2FPEA 3I5SA 4LUEA 2DMOA 2O31A 2DJQA 1B3QA 1X2QA 4RTWA 1T3LA 4CC7A 2O2OA 1NG2A 2QDLA 2K79A 1BB9A 4JZ4A 1EFNA 3KFVA 1CKAA 1AZGB 2GTJA 2L3PA 2F2VA 4J9DA 2PZ1A 2BZ8A 4D8KA 1I0CA 2DLPA 1AEYA 5FWBA 1WXBA 3M0PA 1X6BA 1U06A 1UHCA 1MV0B 2C0IA 4CC3A 5EC7A 2A37A 1H8KA 3EG0A 2AZVA 4JPBW 1AOJA 1PWTA 1PRLC 2KYBA 1PKTA 2YT6A 3RNJA 2HCKA 2GTOA 1E6GA 3M0SA 1W70A 3ZL7C 2LJ3A 3QWYA 3VS2A 2F2XA 3PVLA 2ED0A 2F2WA 4LNPA 4Z8AA 2SEMA 2KROA 2JS0A 3M0UA 1TG0A 1YWPA 1M3AA 4RTTA 1T0HA 2YUNA 2RNAA 2J06A 3R6NA 2DBMA 2EYWA 2PNIA 3H0FA 1UE9A 1AVZC 2DRMA 2KR3A 2ENMA 4LN2A 2DVJA 1NYGA 1SSHA 1X69A 3NPFA 4J9BA 2L3SA 3JV3A 3NMZC 1UJ0A 4EIKA 2YSQA 3RBBB 1GBQA 4J9HA 1NYFA 3SEMA 4F16A 2KXDA 3VS6A 1ZUUA 2L2PA 2YUQA 1W6XA 1OPLA 1E7OA 5IXFA 1I07A 1NEGA 4HVUA 2L0AA 4RTYA 4ORZA 1PHTA 1SHGA 2RQRA 2D1XA 2AKKA 2RMOA 3A98A 3NHNA 2CREA 2BTTA 2NWMA 4E6RA 1M8MA 2VVKA 1RLPC 2A36A 2LJ1A 1FMKA 2FPDA 1AWWA 4AG2C 2DA9A 2NUZA 2RQVA 3EG3A 2VWFA 5IH2A 4R0KA 1H92A 1ZX6A 2GGRA 4OMNA 2JT4A 4Z89A 5FW9A 4J9CA 3H41A 3M0RA 3EHQA 1ABOA 2LQWA 1JXMA 2FO0A 2ABLA 2KRSA 2BZYA 2ROLA 1QCFA 1CSKA 1U3OA 3I9QA 3PE0A 2JS2A 2FG0A 1UUEA 4WCIA 1N5ZA 2HEQA 1KJWA 4RTXA 1SRLA 2KT1A 2BZXA 2ROTA 3TSWA 2K7AA 1VYVA 1QKWA 2AKLA 1GRIA 2ECZA 1JU5C 1BU1A 2OJ2A 2V1QA 2VKNA 2EGCA 4OMMA 2P4RA 1VYTA 1RLQC 1VA7A 1OPKA 2SRCA 1QWFA 2ESWA 2MOXA 5IHIA 3IQLA 4J9GA 1ZUKA 1WA7A 2CSIA 2J7IA 3UATA 1OV3A 1JEGA 2CSQA 1WI7A 2YUPA 1UFFA 4HCKA 4IIMA 2M0YA 1WX6A 2H8HA 2M51A 3TSZA 2W10A 2KBTA 5I22A 1K4US 3EGUA 1RI9A 2DRKA 2O9VA 1Y57A 1TUCA 2EQIA 4M4ZA 4AFSC 2CH4W 2LCSA 2DL4A 2J6FA 1WDXA 2LZ6B 1AZEA 3VRYA 4ZNXA 1ZSGA 2KGTA 1ZUYA 2A08A 5IXBA 2CT4A 2DNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KSW A;  2GBQ A;  2EYX A;  4J9F A;  2DIL A;  2EGA A;  4HVV A;  2DYB A;  1UTI A;  4RUG A;  4A63 B;  2O88 A;  2EYZ A;  2ED1 A;  2K2M A;  1HD3 A;  1M3C A;  1WFW A;  2D8H A;  3VS7 A;  4F17 A;  1UHF A;  1M30 A;  2EGE A;  2CUB A;  1WIE A;  2EVR A;  4JJD A;  1K0X A;  4RTU A;  4JJC A;  5ECA A;  1GCQ A;  2DBK A;  2FRY A;  1HSQ A;  1Y0M A;  1YP5 A;  2JMC A;  2YDL A;  2GQI A;  2MCN A;  3NGP A;  2JTE A;  4X1V A;  1RUW A;  2AK5 A;  1KFZ A;  2JM8 A;  2RQW A;  2JXB A;  1X43 A;  2LP5 A;  1GFC A;  2FEI A;  1H3H A;  2DL7 A;  4RTV A;  4DEX A;  5IHK A;  2RQU A;  3QWX X;  1FYN A;  1KIK A;  1OEB A;  2KRN A;  1JQQ A;  3M0T A;  3PVQ A;  4JZ3 A;  2O9S A;  4AG1 C;  4D8D A;  2DF6 A;  2X3X D;  2LMJ A;  1YWO A;  2KE9 A;  1SHF A;  2L3Q A;  1NEB A;  4HVW A;  4IIO A;  3TVT A;  2IIM A;  3H0I A;  2D8J A;  2FRW A;  1X2K A;  2A28 A;  4FSS A;  4DEY A;  2GNC A;  3VS1 A;  1YNZ A;  4OMO A;  1WXU A;  3O5Z A;  1IO6 A;  3I35 A;  3SHW A;  1ZBJ A;  1AWO A;  3H0H A;  1YN8 A;  3FJ5 A;  2EPD A;  2HSP A;  2CT3 A;  2CDT A;  3VS3 A;  1GCQ C;  2MIO A;  4CC4 B;  3CQT A;  1QLY A;  2J05 A;  4OMQ A;  2K6D A;  1T0J A;  5FWC A;  1QKX A;  2G6F X;  4GLM A;  5L23 A;  5HCK A;  2OAW A;  2DL5 A;  4QT7 A;  2D0N A;  1WXT A;  3REB B;  1ARK A;  2CUD A;  2DL3 A;  2LNH B;  3UF4 A;  1Z9Z A;  1G2B A;  1M3B A;  2DX1 A;  1OOT A;  1X27 A;  3VS0 A;  1Z9Q A;  1GFD A;  4Y92 A;  2HDA A;  3UA6 A;  1SRM A;  3VRZ A;  3THK A;  2JW4 A;  2C0O A;  2KNB B;  2RN8 A;  1K0S A;  5GJW B;  2X3W D;  1NLP C;  4CC2 A;  1SEM A;  4J9I A;  3GBQ A;  1VYU A;  1J3T A;  2CH4 A;  2JMA A;  1AWJ A;  4AFZ C;  1GL5 A;  2RPN A;  2KYM A;  4Z88 A;  4K11 A;  5GJV B;  1WLP B;  2J6O A;  4LE9 A;  2LQN A;  2C0T A;  4OML A;  1LCK A;  4F14 A;  1YCS B;  4LUD A;  1K1Z A;  2KXC A;  1I1J A;  2RQT A;  2AZS A;  2B86 A;  1UDL A;  5I11 A;  1UJY A;  3ULR B;  2RF0 A;  2I0N A;  2LX7 A;  1V1C A;  2KT8 A;  1AWX A;  1BK2 A;  1GCP A;  2K3B A;  2LJ0 A;  2W0Z A;  4GBQ A;  4ESR A;  2JM9 A;  2E5K A;  2XMF A;  2K9G A;  3C0C A;  1U5S A;  1B07 A;  1S1N A;  5IHN A;  3VS4 A;  1AD5 A;  2EBP A;  1HJD A;  1TUD A;  1QWE A;  1MUZ A;  1PKS A;  1ZLM A;  3UA7 A;  1K76 A;  2EKH A;  2HBW A;  1XOV A;  4KRT A;  1SPK A;  1T3S A;  2DL8 A;  3REA B;  4JJB A;  1PRM C;  4AFQ C;  4J9E A;  2DM1 A;  3VS5 A;  3EG2 A;  1UGV A;  4AFU C;  1CKB A;  2KRM A;  2EYY A;  1JXO A;  3I5R A;  2PTK A;  2FPF A;  1BBZ A;  1WYX A;  1X6G A;  4RTZ A;  2J6K A;  4HXJ A;  1UG1 A;  1W1F A;  2V1R A;  2EW3 A;  3LH5 A;  1A0N B;  2YUO A;  1NLO C;  1GBR A;  1E6H A;  1K9A A;  1JO8 A;  2DE0 X;  3U23 A;  2OI3 A;  1G83 A;  1MV3 A;  4OMP A;  1ABQ A;  3EG1 A;  2KEA A;  1NM7 A;  3EHR A;  1M27 C;  1PNJ A;  3M0Q A;  1UEC A;  2FPE A;  3I5S A;  4LUE A;  2DMO A;  2O31 A;  2DJQ A;  1B3Q A;  1X2Q A;  4RTW A;  1T3L A;  4CC7 A;  2O2O A;  1NG2 A;  2QDL A;  2K79 A;  1BB9 A;  4JZ4 A;  1EFN A;  3KFV A;  1CKA A;  1AZG B;  2GTJ A;  2L3P A;  2F2V A;  4J9D A;  2PZ1 A;  2BZ8 A;  4D8K A;  1I0C A;  2DLP A;  1AEY A;  5FWB A;  1WXB A;  3M0P A;  1X6B A;  1U06 A;  1UHC A;  1MV0 B;  2C0I A;  4CC3 A;  5EC7 A;  2A37 A;  1H8K A;  3EG0 A;  2AZV A;  4JPB W;  1AOJ A;  1PWT A;  1PRL C;  2KYB A;  1PKT A;  2YT6 A;  3RNJ A;  2HCK A;  2GTO A;  1E6G A;  3M0S A;  1W70 A;  3ZL7 C;  2LJ3 A;  3QWY A;  3VS2 A;  2F2X A;  3PVL A;  2ED0 A;  2F2W A;  4LNP A;  4Z8A A;  2SEM A;  2KRO A;  2JS0 A;  3M0U A;  1TG0 A;  1YWP A;  1M3A A;  4RTT A;  1T0H A;  2YUN A;  2RNA A;  2J06 A;  3R6N A;  2DBM A;  2EYW A;  2PNI A;  3H0F A;  1UE9 A;  1AVZ C;  2DRM A;  2KR3 A;  2ENM A;  4LN2 A;  2DVJ A;  1NYG A;  1SSH A;  1X69 A;  3NPF A;  4J9B A;  2L3S A;  3JV3 A;  3NMZ C;  1UJ0 A;  4EIK A;  2YSQ A;  3RBB B;  1GBQ A;  4J9H A;  1NYF A;  3SEM A;  4F16 A;  2KXD A;  3VS6 A;  1ZUU A;  2L2P A;  2YUQ A;  1W6X A;  1OPL A;  1E7O A;  5IXF A;  1I07 A;  1NEG A;  4HVU A;  2L0A A;  4RTY A;  4ORZ A;  1PHT A;  1SHG A;  2RQR A;  2D1X A;  2AKK A;  2RMO A;  3A98 A;  3NHN A;  2CRE A;  2BTT A;  2NWM A;  4E6R A;  1M8M A;  2VVK A;  1RLP C;  2A36 A;  2LJ1 A;  1FMK A;  2FPD A;  1AWW A;  4AG2 C;  2DA9 A;  2NUZ A;  2RQV A;  3EG3 A;  2VWF A;  5IH2 A;  4R0K A;  1H92 A;  1ZX6 A;  2GGR A;  4OMN A;  2JT4 A;  4Z89 A;  5FW9 A;  4J9C A;  3H41 A;  3M0R A;  3EHQ A;  1ABO A;  2LQW A;  1JXM A;  2FO0 A;  2ABL A;  2KRS A;  2BZY A;  2ROL A;  1QCF A;  1CSK A;  1U3O A;  3I9Q A;  3PE0 A;  2JS2 A;  2FG0 A;  1UUE A;  4WCI A;  1N5Z A;  2HEQ A;  1KJW A;  4RTX A;  1SRL A;  2KT1 A;  2BZX A;  2ROT A;  3TSW A;  2K7A A;  1VYV A;  1QKW A;  2AKL A;  1GRI A;  2ECZ A;  1JU5 C;  1BU1 A;  2OJ2 A;  2V1Q A;  2VKN A;  2EGC A;  4OMM A;  2P4R A;  1VYT A;  1RLQ C;  1VA7 A;  1OPK A;  2SRC A;  1QWF A;  2ESW A;  2MOX A;  5IHI A;  3IQL A;  4J9G A;  1ZUK A;  1WA7 A;  2CSI A;  2J7I A;  3UAT A;  1OV3 A;  1JEG A;  2CSQ A;  1WI7 A;  2YUP A;  1UFF A;  4HCK A;  4IIM A;  2M0Y A;  1WX6 A;  2H8H A;  2M51 A;  3TSZ A;  2W10 A;  2KBT A;  5I22 A;  1K4U S;  3EGU A;  1RI9 A;  2DRK A;  2O9V A;  1Y57 A;  1TUC A;  2EQI A;  4M4Z A;  4AFS C;  2CH4 W;  2LCS A;  2DL4 A;  2J6F A;  1WDX A;  2LZ6 B;  1AZE A;  3VRY A;  4ZNX A;  1ZSG A;  2KGT A;  1ZUY A;  2A08 A;  5IXB A;  2CT4 A;  2DNU A; 
#chains in the Genus database with same CATH topology
 4J9F A;  4N4I A;  2Y4Y A;  2DIL A;  4J5Y A;  3JAM E;  2EJG A;  4LDY A;  4C5E A;  1JB0 E;  4BAC A;  1UTI A;  3ER0 A;  5I21 A;  2ED1 A;  1KK7 A;  2GFA A;  2DXU A;  2VGM A;  2XKO C;  3OMG A;  2D8H A;  3JB9 D;  5KE3 A;  3OYL A;  2M9U A;  1S72 A;  2CGH A;  4RTU A;  4C8Q G;  4MZT A;  2DYI A;  2KQW A;  2FRY A;  3G4S Q;  2YDL A;  3OYM A;  5FU6 B;  1D3B A;  2JM8 A;  2RQW A;  2ZPB B;  5A0L A;  4MZP A;  1X43 A;  3G71 Q;  3QSU A;  1S72 T;  2LCL A;  2ZGW A;  2ZPG B;  3CD6 A;  4DEX A;  1D3B B;  5IHK A;  3AHU A;  1KHI A;  4C8Q E;  2RQU A;  1KIK A;  1TUG B;  4OB3 B;  3E1S A;  3EG9 B;  3CPW P;  2DF6 A;  2LMJ A;  3CC7 Q;  3JCM e;  2L3Q A;  1NEB A;  5GAN f;  2P0P A;  1PD1 A;  1QP3 A;  3TVT A;  2IIM A;  2XD0 A;  4L5G A;  2CP5 A;  3KBG A;  4A54 A;  4LDW A;  2RHU A;  1ZBJ A;  3H0H A;  5GAM g;  3JCM V;  5M9O A;  2CDT A;  4N4G A;  1GCQ C;  2FL7 A;  2XHC A;  1TU0 B;  5KYW A;  1QLY A;  3SD4 A;  2GCX A;  4OMQ A;  1YJ9 Q;  2K6D A;  1QKX A;  2DTH A;  3CCV T;  5L23 A;  1X75 C;  1Q82 C;  1VUB A;  1VQ7 Q;  2HQX A;  2E41 A;  4RCC A;  4PNO A;  1G3S A;  2CS7 A;  3G7Z A;  1W2B S;  3MET A;  1ARK A;  2DD5 A;  1M2O A;  1G2B A;  1UGS B;  1K8A C;  4C0G A;  1YIT A;  3VS0 A;  2NYS A;  2NUT B;  1Z9Q A;  4X34 A;  3QZ9 B;  3UA6 A;  2GFU A;  3THK A;  3RIR A;  4C5H A;  4M78 B;  4HT9 A;  2GQV A;  2XU8 A;  4MMK A;  2C0O A;  2MI6 A;  2RN8 A;  2NUT A;  1SG5 A;  3V8L A;  2X9H A;  1D1C A;  2H3E B;  3UPU A;  3OW2 A;  3GBQ A;  1VYU A;  4IKF A;  2CH4 A;  1AWJ A;  1B34 B;  1IRX A;  1BIB A;  4L59 A;  4NOY A;  2KYM A;  4M7A G;  5GJV B;  1WLP B;  2J6O A;  4LE9 A;  4E7K A;  1LCK A;  4LUD A;  2KXC A;  2PU9 B;  1I1J A;  4KUI A;  2RQT A;  5DM7 R;  1UDL A;  5I11 A;  1OU9 A;  2HKN A;  3JB9 H;  2YLB A;  4A4G A;  3CPW A;  4HCZ A;  2RF0 A;  1AWX A;  4GBQ A;  2W0Z A;  4OB0 B;  2QDY B;  2P0Q A;  1B07 A;  1S1N A;  1BYM A;  3VS4 A;  4C8Q A;  2CYZ B;  2EBP A;  3HP9 A;  1QWE A;  2JUF A;  5J39 A;  1MUZ A;  1VQP T;  1ZA1 B;  1PKS A;  2K3X A;  5KYY A;  2L89 A;  3UA7 A;  4ZN1 A;  5J26 A;  3CBO A;  2DL8 A;  3REA B;  4JRK A;  4J9E A;  4DBF A;  3EFS A;  3EG2 A;  1QCO A;  4AFU C;  1M2V B;  1OX9 A;  2KRM A;  3I5R A;  3MPU B;  2DZC A;  1RAA B;  3S3O A;  1W1F A;  3AT1 B;  3CMA Q;  4IUV A;  2EW3 A;  3S3N A;  3EAE A;  1NLO C;  1GBR A;  1K9A A;  2DE0 X;  3QHS A;  3BFM A;  4AMC A;  3I55 Q;  2OI3 A;  2RI2 A;  5CO7 A;  1KD1 R;  2YLC A;  1I4K 1;  5GAN 5;  1KG1 A;  1R0C B;  1NM7 A;  1M27 C;  1PNJ A;  1KC8 R;  2GF7 A;  2DD4 A;  2F5T X;  2O31 A;  1B3Q A;  2CZ0 B;  1T3L A;  2QTX A;  5LJ5 j;  2DZ9 A;  2O2O A;  2K79 A;  1UGR B;  1BB9 A;  2BE7 D;  4JZ4 A;  5CCA A;  1CKA A;  3ME9 A;  1G3T A;  1R0B G;  4QQG A;  4D8K A;  2Y90 A;  1AEY A;  3HPW A;  4L6V 5;  1WXB A;  2K57 A;  4PJO A;  2C0I A;  3HHT B;  4ME7 A;  4CC3 A;  1Q7Y R;  1YJ9 A;  3GP8 A;  3CCM Q;  1M8V A;  4QKU A;  2KI7 A;  2BIV A;  4M77 C;  4JPB W;  1AOJ A;  3GNG A;  3VKI A;  4ZN3 A;  1PRL C;  3JCM c;  3M0S A;  1N9R A;  3ZL7 C;  4M7D A;  1I5O B;  1U1T A;  2HL3 A;  4KT0 E;  3M4Y A;  4Z8A A;  4V2S A;  1M1K C;  3M0U A;  3CCL T;  1M3A A;  2YUN A;  2YRV A;  2CP0 A;  1KHC A;  2X4X A;  3VYH B;  4JRQ A;  3CME A;  4B9X A;  1AVZ C;  2DRM A;  1RAD B;  3I56 A;  4BUG A;  1UB4 A;  3HTR A;  3C94 A;  1VQ9 Q;  4M77 D;  3X25 B;  1X69 A;  2XI9 A;  3NMZ C;  3CBM A;  4MZM A;  4F7U A;  1GBQ A;  4M7A B;  3L2U A;  3SEM A;  3CME T;  3HSB A;  3SWN C;  3QJY A;  2RK2 A;  3EGX B;  1W6X A;  4WF2 A;  1OPL A;  2COY A;  3GF5 A;  3OYB A;  3P8H A;  4FCY A;  4CI0 C;  2DXT A;  2RQR A;  1SHG A;  1QVP A;  2D1X A;  1M90 R;  3BY7 A;  5GAN d;  2K2V A;  4XQ3 A;  3NHN A;  4KGX B;  2CRE A;  2NWM A;  2VVK A;  2QXF A;  3OYI A;  4JJN K;  4DOW A;  2RQV A;  5IH2 A;  4JLG A;  4R0K A;  1H92 A;  1NPR A;  4Z89 A;  1GXI E;  4C8Q F;  2LQW A;  1JXM A;  2MK5 A;  2QEX T;  3OA6 A;  3G4S A;  3HRT A;  4M77 E;  3PE0 A;  3EFO B;  3MP1 A;  2FG0 A;  1UUE A;  4HCC A;  4KUL A;  1KJW A;  4RTX A;  2LQ8 A;  5LJ3 g;  1O9S A;  2EAY A;  2ROT A;  2LCC A;  2LNV A;  1M1K R;  2EFI A;  4PKC C;  1GRI A;  1PSE A;  1BU1 A;  3G4S T;  1IXD A;  3I55 A;  2QAZ A;  2C06 A;  2VKN A;  5LJ5 d;  4A4E A;  3SFM A;  3CCR A;  1KQS A;  2P4R A;  3V7S A;  1QWF A;  3FDR A;  4N0A C;  1WQW A;  3L42 A;  3CCM T;  1VQ5 Q;  1OV3 A;  1C0M A;  3G6E T;  1S72 Q;  4JRP A;  4XU0 A;  4ZTF A;  2M0Y A;  1ZQ1 A;  1VQ9 A;  3EGU A;  1RI9 A;  2O9V A;  3CC7 T;  5D6X A;  2OTJ T;  3X20 B;  2X4W A;  2RHX A;  4M4Z A;  2CH4 W;  4AFS C;  2YWW A;  2J6F A;  3CCL Q;  1AZE A;  3CCM A;  2QA4 Q;  2VUB A;  4ZNX A;  1V29 B;  2BKD N;  2RA2 A;  4MDW A;  2L3R A;  2QQR A;  1ZUY A;  2EJ9 A;  3QZ5 B;  3TEE A;  1KSW A;  2GBQ A;  1VQ9 T;  4XTZ A;  3CXC A;  2EGA A;  2OTJ A;  4HVV A;  2JTM A;  2CZ1 B;  4M75 A;  3RES A;  1FMV A;  4RUG A;  2FHD A;  2EYZ A;  1KD1 C;  1PCX A;  1YCY A;  1OI1 A;  2D0Q B;  3NTK A;  5LJ5 f;  2PVD B;  3OY9 A;  2DER A;  3L2V A;  4ANJ A;  4DBH A;  3LWI A;  4F17 A;  4DA4 A;  1B34 A;  2EVR A;  3JB9 G;  1D0Y A;  2CZ6 B;  4JJD A;  3A8L B;  1R8O B;  2LTO A;  1OZ2 A;  5GAM f;  3CMA T;  1YP5 A;  2JMC A;  3MEU A;  2MCN A;  5A2Q E;  2D6F A;  3OQ5 A;  1YI2 A;  1WHH A;  2WAC A;  4BDY A;  2LDM A;  2JN0 A;  1Y71 A;  2RJF A;  2DEQ A;  4ZTJ A;  2CP3 A;  3OSS C;  3M57 A;  1WZO A;  3E9G A;  3CMA A;  1W2B P;  1FYN A;  4BB7 A;  1VQ5 T;  1JJ2 A;  4M77 B;  2R58 A;  2QQA A;  2E12 A;  4Y28 E;  3GIB A;  3JB9 I;  2O9S A;  4AG1 C;  3MP6 A;  1HYO A;  1YWO A;  5GAN 6;  1SHF A;  3JCM Q;  4M7D D;  2DTO A;  1F1B B;  2JTF A;  4HVW A;  2MWP A;  3L1A A;  3H0I A;  2D8J A;  2FRW A;  4DEY A;  1Q82 U;  4FSS A;  3ZBD A;  3CEY A;  2E64 A;  3VS1 A;  1PG5 B;  1YNZ A;  4Z02 A;  1VQ5 A;  4OMO A;  1WXU A;  2ZPH B;  3E2U A;  1IO6 A;  3I35 A;  5GAN j;  1N8R R;  1YN8 A;  1K8A U;  5GAM j;  3FJ5 A;  4A4H A;  3VS3 A;  4BE2 A;  2MIO A;  3INZ A;  2WSE E;  4CC4 B;  2KY9 A;  1VQK A;  1MNE A;  4FW2 A;  1YIT T;  1N6A A;  4KH0 B;  5KYX B;  4GLK A;  4O5V A;  4OB2 B;  4II1 A;  4XAX B;  2D0N A;  2CUD A;  1Z9Z A;  2E6N A;  2JNG A;  2ZCF B;  1M3B A;  3F70 A;  1OOT A;  5J3B A;  1IGU A;  4M75 D;  3PTA A;  2QA4 T;  4FT4 A;  5HK3 A;  3JCM g;  5GAO l;  2YXY A;  1EX4 A;  1YJN T;  3LX7 A;  1K0S A;  5GAM h;  2XIC A;  2X3W D;  4OVA A;  3L2W A;  1SEM A;  3BDU A;  2QQB A;  1X6O A;  2DIG A;  3HRS A;  1Q81 C;  1G5V A;  1Y96 A;  2KK4 A;  2QA4 A;  5D6Y A;  5GAM e;  3SDZ A;  1D1B A;  1VQK Q;  1YCS B;  2VB6 A;  5GAN 8;  1K1Z A;  4KBM B;  2B86 A;  1QVF P;  3ULR B;  1VQP A;  5HY6 A;  5C0M A;  2I0N A;  2LX7 A;  4C92 E;  1BK2 A;  2LC4 A;  4KGV B;  2JM9 A;  2E5K A;  2I2L A;  5AYF A;  2XMF A;  2K9G A;  1G8X A;  2COZ A;  5IHN A;  4N4H A;  3SWN A;  1HJD A;  2IG0 A;  1M9S A;  5CKH A;  1WHM A;  3RR6 A;  2HNI A;  4NS5 A;  3FIF A;  3JCM b;  4E7J A;  2D9T A;  4C92 C;  1C6V X;  4EMK B;  6AT1 B;  3EGD B;  4M75 E;  2RHZ A;  5DY9 A;  2DXC A;  4JJB A;  3L2Z A;  4AFQ C;  2AT1 B;  4XTX A;  4M77 F;  4M78 G;  3JCM J;  4N0A A;  1UGV A;  2OTL A;  3QYH B;  2M16 A;  1PSF A;  3FEO A;  1LPL A;  2J6K A;  5LJ5 e;  1UG1 A;  3UT1 A;  3WXM B;  1A0N B;  1K73 C;  1JO8 A;  3MO8 A;  3CC2 T;  5LJ3 j;  1ACM B;  1IHV A;  2HBP A;  3CC4 T;  5GAN 7;  3CCS A;  2RHI A;  4OMF B;  2OTL T;  4XTV A;  1ABQ A;  2QG9 B;  4C5I A;  1UEB A;  3CCV Q;  3EHR A;  3TRE A;  2FPE A;  3LLR A;  2E1H A;  4A4F A;  2DJQ A;  1NZ9 A;  2B8A A;  1X2Q A;  4RTW A;  1VIE A;  4CC7 A;  1Q82 R;  3VYG A;  3CC2 A;  2O01 E;  2RO0 A;  3WVD B;  3CC4 A;  4EDU A;  3PIP A;  4EMK A;  3CCS T;  3QYG B;  2P0K A;  3LGF A;  4C92 D;  3DB3 A;  2O4X B;  4J9D A;  8AT1 B;  2PZ1 A;  5GMK m;  1N8R U;  1K8A R;  1I0C A;  2RJD A;  2DXB A;  4P5N A;  3M0P A;  1X6B A;  1U06 A;  3OS2 A;  3O8V A;  5CAI A;  1M2V A;  4J6X A;  1H8K A;  3EG0 A;  2AZV A;  4C0F A;  4J6W A;  3DKM A;  4TVR A;  1PWT A;  1NBE B;  1PKT A;  2X4J A;  2EKO A;  3DLM A;  2GTO A;  4C92 B;  3NTI A;  1YJW A;  1ZSZ B;  3P8D A;  4C0D C;  4MDX A;  1I81 A;  3QG1 A;  4BY6 B;  3S3M A;  2LJ3 A;  3JCM W;  5LJ5 h;  2AIR B;  1OX8 A;  2DFU A;  2JS0 A;  1Y96 B;  1TG0 A;  4PJM A;  1YJW T;  4M7A E;  1JJ2 P;  3R6N A;  2DBM A;  2PNI A;  1BI0 A;  3PNW C;  2FZC B;  4PFZ A;  4RKU E;  5EG2 A;  1NYG A;  1PM3 A;  3GOX A;  3NPF A;  1UJ0 A;  4EIK A;  3OYH A;  3N5B B;  1Q81 R;  1LVK A;  3OYK A;  2EQK A;  2R5M A;  4J83 A;  1ZUU A;  4R55 A;  2L2P A;  1N9S A;  1ZSZ A;  2MF2 A;  5CKB A;  5IXF A;  1HK9 A;  4FYY B;  1NEG A;  4HVU A;  4LD6 A;  3ZEH A;  1M90 U;  3CCJ Q;  2AKK A;  2MMP A;  5GMK e;  2MYS A;  3A98 A;  5GMK l;  1ZHI A;  4RG2 A;  3G1J A;  2DIQ A;  3VJP A;  3OS1 A;  2NUZ A;  2QGG A;  3C95 A;  3C12 A;  2M02 A;  3PMT A;  4M78 A;  4E47 A;  4BE1 A;  3EHQ A;  1ABO A;  3PGG A;  2ABL A;  2BZY A;  3MCA B;  4HA8 A;  3QKJ A;  1U3O A;  2COW A;  3I9Q A;  1WHJ A;  4OB1 B;  4PLL A;  4PJO G;  1QVG P;  5GAN 3;  3CCR T;  5LJ5 g;  3RUX A;  1SRL A;  5IT9 E;  2KT1 A;  2BZX A;  2F69 A;  3EGX A;  1VYV A;  5CIU A;  2VYT A;  2ECZ A;  1JU5 C;  2A0F B;  2CZ7 B;  3G6E A;  4M75 B;  2K3Y A;  4QQ6 A;  1NJI U;  2V1Q A;  3R6O A;  3SWN B;  3DLL A;  4M7D G;  4OMM A;  1KD1 U;  1VYT A;  1RLQ C;  1VA7 A;  1OPK A;  2RM4 A;  3CC7 A;  3UWN A;  2RI5 A;  2ESW A;  5IHI A;  3DB4 A;  2CSI A;  3M59 A;  4VUB A;  1KC8 U;  3CME Q;  1WI7 A;  1TSF A;  3MEW A;  1UFF A;  5I2M A;  5GMK j;  8ATC B;  1BKB A;  2M51 A;  2W10 A;  5I22 A;  1QMC A;  4XU1 A;  3CBP A;  1Y57 A;  4M7A C;  1X01 A;  2LCS A;  2RD1 A;  4IUP A;  1XQH A;  3CXC S;  2KAF A;  5FU6 C;  1WJS A;  2NUP B;  1G3W A;  2A08 A;  3RDV A;  2FYK A;  4LUE A;  2CT4 A;  3H6Z A;  4C92 A;  1YJN Q;  2EYX A;  2LQK A;  2HKQ B;  4PFP A;  1XNI A;  4O6J A;  4RCB A;  3TQ7 P;  4A63 B;  2O88 A;  4C92 G;  5KYN A;  1PC0 A;  3KXT A;  3LWH A;  3CCU A;  1YIT Q;  2YRD A;  2LT1 A;  4OGE A;  3BDL A;  5GAN 4;  4BDZ A;  1M3C A;  1WFW A;  2QTV A;  1YI2 T;  2BUD A;  3VS7 A;  4X9C A;  2EGE A;  2CUB A;  1WIE A;  1WJR A;  4XTY A;  3RKY A;  4E7I A;  1VQ4 Q;  5IAY A;  3QDF A;  3RMS A;  5ECA A;  2DBK A;  3CCU T;  5KCH A;  5KYU B;  3NGP A;  2F1L A;  2JTE A;  4FM4 B;  1RUW A;  2AK5 A;  3GLX A;  2VV5 A;  5KYW B;  2LP5 A;  3OYY A;  3V7C A;  1RI0 A;  2A7Y A;  3ASK A;  2AHJ B;  3WVE B;  4FSX A;  1WPY A;  5GAO p;  3UDC A;  3JCM f;  1JQQ A;  3M0T A;  2F5K A;  4JZ3 A;  4EPC A;  2CP2 A;  4BD3 A;  1P92 A;  1Y07 A;  4EMG A;  1Q7Y C;  2QYZ A;  2L5Q A;  2HQH A;  4IIO A;  3EFO A;  2ZZD A;  3EFR A;  4KUD K;  1X2K A;  1VQK T;  1BI2 A;  4IUQ A;  3SHW A;  2EPD A;  2CT3 A;  3OB9 A;  3J80 E;  1ZBX A;  4M77 G;  4M78 F;  2XDD A;  3X28 B;  2J05 A;  2ZAE A;  1JBM A;  1T0J A;  5FWC A;  4GLM A;  2OAW A;  1VQ8 Q;  3M58 A;  4EMK C;  2QEX Q;  2ZPF B;  3REB B;  1YJN A;  2DL3 A;  2LNH B;  3E9F A;  5GAN e;  5FU7 B;  4M75 G;  2EQM A;  5GAO r;  1WJQ A;  2FVU A;  3JSC A;  2QGF B;  1XTD A;  1GFD A;  4RG8 A;  1SRM A;  3BE3 A;  1MMN A;  3VRZ A;  1K73 R;  3M55 A;  1TTH B;  2KNB B;  2QQS A;  1V76 A;  4LDV A;  4B6M A;  3QPH A;  1O75 A;  1NLP C;  1WHK A;  2L8D A;  4J9I A;  2DVE A;  3MEA A;  3FRN A;  1Y7X A;  2JMA A;  1WHG A;  3QO3 A;  4F04 B;  4Z88 A;  3G71 A;  1VQO A;  5KYU A;  5C6S A;  2LQN A;  3CD6 Q;  2C0T A;  3T9N A;  3FB9 A;  2V8J A;  4M7D B;  5KE2 A;  4DOV A;  5CKE A;  2OTJ Q;  2WSF E;  5DLQ E;  2QK0 A;  1VQ4 T;  3OW2 S;  1AT1 B;  1V1C A;  2KT8 A;  1LJO A;  3G71 T;  2LJ0 A;  4E2F B;  1EIF A;  3C0C A;  5HK0 A;  1LNX A;  1U5S A;  4LD9 K;  1AD5 A;  2DK3 A;  1ZSZ C;  4ZGE B;  1VQ4 A;  3I56 Q;  4J8O A;  1K76 A;  1XOV A;  5HKC A;  1SPK A;  3VUZ A;  3CPF A;  4FYX B;  2IPO B;  3VUB A;  4QVC A;  1LOJ A;  2QAS A;  3Q1J A;  1QQJ A;  1VQM A;  1CKB A;  1VQ8 A;  3C4S A;  2PTK A;  2XG8 D;  4PJO E;  2KMT A;  4HXJ A;  2V1R A;  3LH5 A;  1EZZ B;  1E6H A;  1IB8 A;  5GAN 2;  1NJI R;  1KQS P;  3OSV A;  1MV3 A;  1KQ2 A;  4OMP A;  2EIF A;  1VQM T;  3MEV A;  4E7L A;  1VQ8 T;  3EG1 A;  2ATC B;  4JS4 A;  3M0Q A;  3QJ6 A;  5FLX E;  3I5S A;  2V8I A;  2DMO A;  3FJP A;  1SKU B;  1NG2 A;  1R77 A;  4FYW B;  5LJ3 h;  1QVF S;  4XK8 E;  3GPL A;  4KGZ B;  1C1A A;  1Q86 R;  3OYA A;  1YFN A;  2L3P A;  2NLU A;  3LYI A;  5LJ3 f;  3JB9 J;  1TWB A;  1MGQ A;  4RMO A;  2DLP A;  2HL5 C;  1UHC A;  1MV0 B;  4XU3 A;  5KH6 A;  2CP6 A;  3OYN A;  5FRO A;  5EC7 A;  1U8R A;  1M5Q 1;  3MKD A;  4BE0 A;  1VQO Q;  3JCM X;  4A53 A;  2KYB A;  2HMA A;  5CKF A;  2YT6 A;  4AT1 B;  3J81 E;  2HCK A;  1UGQ B;  2K4Y A;  4HT8 A;  1W70 A;  2YRC A;  3QWY A;  2DET A;  2F2X A;  3PVL A;  1VQ6 Q;  2OAU A;  3D7S B;  5GAO m;  2ED0 A;  3GNF B;  4LNP A;  5CKD A;  1HXD A;  4DBR A;  2KRO A;  4R56 A;  3NTH A;  3P8B B;  2RB6 A;  2RH2 A;  4J7F A;  1UE9 A;  2XDB A;  2KR3 A;  2ENM A;  3LW5 E;  4LN2 A;  4PJJ A;  1M90 C;  1IRE B;  4OGC A;  1SSH A;  4M78 D;  2L3S A;  4FW1 A;  3JV3 A;  2BE9 B;  1IGQ A;  4J9H A;  1FX7 A;  1NYF A;  2K5L A;  3MJX A;  4JRI A;  3VS6 A;  2Y4X A;  1B7T A;  4C5G A;  4F7U F;  3PMI A;  2VAS A;  1WGS A;  1E7O A;  1I07 A;  4IUT A;  2L0A A;  2HZY A;  3CCS Q;  4ORZ A;  5CVI A;  1KQS S;  3BW1 A;  4BI3 A;  1YIJ Q;  1RAG B;  3PT9 A;  1RLP C;  2A36 A;  1FMK A;  1AWW A;  2DA9 A;  3EG3 A;  2VWF A;  1ZX6 A;  2GGR A;  5FRM A;  1K9M R;  4E7S A;  4J9C A;  3H41 A;  3M0R A;  1K9M U;  3M5A A;  2ROL A;  1RAH B;  1VQM Q;  3RKX A;  2JS2 A;  4WCI A;  2P84 A;  3OYD A;  1SF9 A;  4J6Y A;  1WHL A;  2HEQ A;  2OX7 A;  3TSW A;  4PK4 A;  2K7A A;  3EG9 A;  5KYY B;  1M1K U;  3JRZ A;  2FZK B;  2OJ2 A;  2E70 A;  4C8Q B;  1OZ3 A;  1RAB B;  4QW2 A;  1TS9 A;  1DJ7 B;  2MOX A;  3IQL A;  1ZUK A;  1WA7 A;  2J7I A;  4JLI A;  2DTI A;  2X35 A;  3V8J A;  2PVO B;  3J7A F;  2VXE A;  1VOM A;  1QVF A;  3CC4 Q;  3HRU A;  3LGL A;  5CQY A;  2M0O A;  1FMW A;  2YUP A;  3SB2 A;  4IIM A;  2VC8 A;  3TSZ A;  2E10 A;  4JUV A;  2E4H A;  2KBT A;  4IUU A;  2DRK A;  4M78 C;  1TUC A;  3PFS A;  3PIO A;  4PJO C;  1TXQ A;  1W2B A;  2KGT A;  1BCM A;  1OQK A;  4BI8 B;  1XJW B;  1KC8 C;  1I5L A;  4PJN A;  3QXE B;  5IXB A;  3JCM h;  2DNU A;  3A8G B;  3X26 B;  1QVG A;  4M7D C;  2DYB A;  5CQX A;  1NJI C;  1BI3 A;  5L8R E;  1D0X A;  3CCQ A;  2K2M A;  3EH2 A;  3CCR Q;  2PQW A;  4PJL A;  4ZGD B;  1HD3 A;  2FB7 A;  2RJC A;  4FT2 A;  1QP2 A;  4PL6 A;  2XK0 A;  1UHF A;  1M30 A;  3A5Z B;  4E7Z A;  2KVQ G;  2R57 A;  4IUR A;  1K0X A;  4JJC A;  2X4Y A;  1GCQ A;  2LT4 A;  3QUI A;  1HSQ A;  1Y0M A;  3H9N A;  2GQI A;  1JRI A;  4X1V A;  3OS5 A;  1W4S A;  1KFZ A;  3M9Q A;  2PVG B;  5I2S A;  1RAI B;  4M7A A;  3JCM P;  2JXB A;  2A3L A;  2H3J A;  1Q81 U;  1GFC A;  2FEI A;  3A8H B;  1H3H A;  5FU7 C;  2DL7 A;  4RTV A;  2DKG A;  3QII A;  4C92 F;  3M54 A;  2ZPI B;  3EGD A;  3QWX X;  3S6W A;  1OEB A;  3X24 B;  2KRN A;  2E3I A;  3PVQ A;  3CCJ A;  2QI2 A;  4WTO B;  1NPP A;  2CKK A;  4D8D A;  4EMH A;  2X3X D;  2PUK B;  2KE9 A;  4FIB A;  3CD6 T;  2E65 A;  2RI3 A;  5FRN A;  2XDP A;  4CRI A;  2A28 A;  4ELY C;  2LVM A;  2GNC A;  4DBQ A;  1Q86 U;  3CCJ T;  3O5Z A;  4Y91 A;  1AWO A;  3OS0 A;  1RAC B;  5GAO n;  2HSP A;  1Q86 C;  1Q7Y U;  1PD0 A;  3CQT A;  1H3Z A;  1FXX A;  3OBW A;  1MMD A;  2G6F X;  4UC4 A;  5HCK A;  5AT1 B;  2DL5 A;  4QT7 A;  3OYC A;  3RKW A;  1WXT A;  1VQP Q;  1M1F A;  3UF4 A;  1ZA2 B;  4C0Z A;  4Q5W A;  4LDU A;  2JOY A;  1RAE B;  3CCU Q;  2DX1 A;  1X27 A;  3CCV A;  1RL2 A;  3CCQ Q;  4Y92 A;  1K73 U;  2YHT A;  2HDA A;  3M4G A;  4M7D E;  3NFC A;  2V8K A;  2MAM A;  2IVW A;  4KH1 B;  2JW4 A;  3HFN A;  1VQO T;  5GJW B;  4CC2 A;  2G3R A;  2RJE A;  1J3T A;  4ELZ C;  2EQJ A;  4NL2 A;  4OF1 A;  4AFZ C;  1GL5 A;  4M78 E;  2RPN A;  4QQD A;  5LJ3 e;  1VQN Q;  2X51 A;  2RHY A;  3VU3 C;  4K11 A;  4OML A;  5LJ3 d;  4F14 A;  1VQ7 A;  2AZS A;  2JJ9 A;  4M75 C;  1UJY A;  3LH0 A;  4XU2 A;  4PLI A;  1QCN A;  3E19 A;  4M7D F;  3H8Z A;  1GCP A;  4F7U B;  2K3B A;  1M1G A;  5CK9 A;  4ESR A;  1VQ6 A;  3URG A;  1VQ7 T;  4MML A;  3ZFJ A;  1U1S A;  1TUD A;  5GAN g;  1VQL Q;  2EQU A;  2Z0W A;  3OYF A;  1ZLM A;  2HD0 A;  4PJO F;  2EKH A;  2HBW A;  4QVD A;  4M7A F;  4KRT A;  4J7I A;  1VQ6 T;  1T3S A;  5D7U A;  3CCE A;  1I8F A;  2M1H A;  1PRM C;  1YI2 Q;  2DM1 A;  5D6W A;  3VS5 A;  1RAF B;  2CP7 A;  4M77 A;  2EYY A;  1JXO A;  2FPF A;  1BBZ A;  3MP8 A;  1WYX A;  3HKS A;  1X6G A;  4RTZ A;  1BIA A;  2QQ9 A;  2DO3 A;  4C8Q D;  4A4K A;  2YUO A;  4BY6 C;  3CCE T;  1N27 A;  2XID A;  3U23 A;  1JJ2 S;  4F7U E;  1D0Z A;  1G83 A;  4FL6 A;  4DQ2 A;  1Q95 G;  1IHW A;  5IN1 A;  1MMA A;  1VIF A;  2KEA A;  2E3H A;  4ZGJ B;  2O4X A;  5GAO q;  2HAX A;  1UEC A;  2V26 A;  3M53 A;  9ATC B;  1N8R C;  4B9W A;  2QDL A;  1EFN A;  3KFV A;  1AZG B;  2GTJ A;  4D6W A;  3EH1 A;  2F2V A;  3MHX A;  2BZ8 A;  5FWB A;  1FWZ A;  2R5A A;  3V8K A;  3OYG A;  5DLO A;  1YHQ Q;  1QW1 A;  2A37 A;  3V7R A;  5GAN h;  3RNJ A;  3OW2 P;  3M56 A;  3OYJ A;  3G6E Q;  1E6G A;  4C0D B;  5A0D A;  1OYX A;  3VS2 A;  1YJ9 T;  1TOV A;  1D1A A;  3TCJ A;  1OUL A;  1BI1 A;  2EYQ A;  2F2W A;  2MPX C;  2LRQ A;  2SEM A;  3HFO A;  1VQN T;  1G3Y A;  3VV0 A;  1YWP A;  1VQL A;  5GMK h;  1OU8 A;  4RTT A;  1T0H A;  1UGP B;  2RNA A;  1MND A;  2KDS A;  2J06 A;  2EYW A;  3H0F A;  3FLG A;  2VGN A;  2DVJ A;  1H64 1;  5GMK i;  1TH7 A;  3OBY A;  4J9B A;  1VQN A;  4ATO A;  4FU6 A;  5LL6 S;  1VQL T;  3CCL A;  1MHN A;  2DAQ A;  2YSQ A;  3RBB B;  4JDS A;  2EWN A;  2KXD A;  4F16 A;  3I56 T;  4C8Q C;  2PUO B;  4X9D A;  2YUQ A;  3TU4 K;  1MMG A;  1K9M C;  5KCO A;  1YJW Q;  4RTY A;  3A1P A;  1PHT A;  3OYE A;  2RMO A;  4BI4 A;  1IZ6 A;  2BTT A;  1WNL A;  4E6R A;  1M8M A;  2MWO A;  3L2Q A;  3QBY A;  2LJ1 A;  2E6Z A;  2FPD A;  3HL8 A;  2K5F A;  4AG2 C;  3JCM d;  3RER A;  3CC2 Q;  1BCO A;  1YHQ T;  5KYX A;  4OMN A;  2JT4 A;  3A8O B;  5FW9 A;  7AT1 B;  3CCE Q;  2FO0 A;  2KRS A;  2P4T A;  3RMQ A;  2JVV A;  1QCF A;  1CSK A;  2KSS A;  2RK1 A;  4XTU A;  2OTL Q;  2VXF A;  4F7U G;  4JS5 A;  3CXC P;  1N5Z A;  1YHQ A;  4M7A D;  2HSE B;  5GAM d;  4PJO D;  4M75 F;  2FZG B;  4E7H A;  1WQ7 A;  1QKW A;  2QEX A;  2AKL A;  2DPP B;  2JZ2 A;  1NE8 A;  3QDR B;  3OMC A;  4FYV B;  3FC3 A;  1D09 B;  2HQE A;  5CR2 A;  4LDX A;  1YBY A;  2EGC A;  2SRC A;  3CPW S;  1YIJ A;  3A8M B;  3L2R A;  2DEU A;  4PJO B;  4J9G A;  3UAT A;  4XTW A;  4HCB A;  3I55 T;  2WSC E;  2LX9 A;  4PFO A;  1JEG A;  2DJZ A;  2CSQ A;  4OP0 A;  4HCK A;  2K5I A;  1WX6 A;  2H8H A;  4YTL A;  3KUF A;  4QVZ A;  1K4U S;  4GY5 A;  2NUP A;  4NL3 A;  1YIJ T;  1KQ1 A;  2EQI A;  2DL4 A;  1WDX A;  2LZ6 B;  2E5Q A;  1AHJ B;  3VRY A;  3JB9 F;  1M4Z A;  1QVG S;  1ZSG A;  2ZPE B;  3CCQ T;  5A0G A;  4LXC A;  2EJF A;  4HKE A;  1SSF A; 
#chains in the Genus database with same CATH homology
 1KSW A;  2GBQ A;  2EYX A;  4J9F A;  2DIL A;  2EGA A;  4HVV A;  2DYB A;  1UTI A;  4RUG A;  4A63 B;  2O88 A;  2EYZ A;  2ED1 A;  2K2M A;  1HD3 A;  1M3C A;  1WFW A;  2D8H A;  3VS7 A;  4F17 A;  1UHF A;  1M30 A;  2EGE A;  2CUB A;  1WIE A;  2EVR A;  4JJD A;  1K0X A;  4RTU A;  4JJC A;  5ECA A;  1GCQ A;  2DBK A;  2FRY A;  1HSQ A;  1Y0M A;  1YP5 A;  2JMC A;  2YDL A;  2GQI A;  2MCN A;  3NGP A;  2JTE A;  4X1V A;  1RUW A;  2AK5 A;  1KFZ A;  2JM8 A;  2RQW A;  2JXB A;  1X43 A;  2LP5 A;  1GFC A;  2FEI A;  1H3H A;  2DL7 A;  4RTV A;  4DEX A;  5IHK A;  2RQU A;  3QWX X;  1FYN A;  1KIK A;  1OEB A;  2KRN A;  1JQQ A;  3M0T A;  3PVQ A;  4JZ3 A;  2O9S A;  4AG1 C;  4D8D A;  2DF6 A;  2X3X D;  2LMJ A;  1YWO A;  2KE9 A;  1SHF A;  2L3Q A;  1NEB A;  4HVW A;  4IIO A;  3TVT A;  2IIM A;  3H0I A;  2D8J A;  2FRW A;  1X2K A;  2A28 A;  4FSS A;  4DEY A;  2GNC A;  3VS1 A;  1YNZ A;  4OMO A;  1WXU A;  3O5Z A;  1IO6 A;  3I35 A;  3SHW A;  1ZBJ A;  1AWO A;  3H0H A;  1YN8 A;  3FJ5 A;  2EPD A;  2HSP A;  2CT3 A;  2CDT A;  3VS3 A;  1GCQ C;  2MIO A;  4CC4 B;  3CQT A;  1QLY A;  2J05 A;  4OMQ A;  2K6D A;  1T0J A;  5FWC A;  1QKX A;  2G6F X;  4GLM A;  5L23 A;  5HCK A;  2OAW A;  2DL5 A;  4QT7 A;  2D0N A;  1WXT A;  3REB B;  1ARK A;  2CUD A;  2DL3 A;  2LNH B;  3UF4 A;  1Z9Z A;  1G2B A;  1M3B A;  2DX1 A;  1OOT A;  1X27 A;  3VS0 A;  1Z9Q A;  1GFD A;  4Y92 A;  2HDA A;  3UA6 A;  1SRM A;  3VRZ A;  3THK A;  2JW4 A;  2C0O A;  2KNB B;  2RN8 A;  1K0S A;  5GJW B;  2X3W D;  1NLP C;  4CC2 A;  1SEM A;  4J9I A;  3GBQ A;  1VYU A;  1J3T A;  2CH4 A;  2JMA A;  1AWJ A;  4AFZ C;  1GL5 A;  2RPN A;  2KYM A;  4Z88 A;  4K11 A;  5GJV B;  1WLP B;  2J6O A;  4LE9 A;  2LQN A;  2C0T A;  4OML A;  1LCK A;  4F14 A;  1YCS B;  4LUD A;  1K1Z A;  2KXC A;  1I1J A;  2RQT A;  2AZS A;  2B86 A;  1UDL A;  5I11 A;  1UJY A;  3ULR B;  2RF0 A;  2I0N A;  2LX7 A;  1V1C A;  2KT8 A;  1AWX A;  1BK2 A;  1GCP A;  2K3B A;  2LJ0 A;  2W0Z A;  4GBQ A;  4ESR A;  2JM9 A;  2E5K A;  2XMF A;  2K9G A;  3C0C A;  1U5S A;  1B07 A;  1S1N A;  5IHN A;  3VS4 A;  1AD5 A;  2EBP A;  1HJD A;  1TUD A;  1QWE A;  1MUZ A;  1PKS A;  1ZLM A;  3UA7 A;  1K76 A;  2EKH A;  2HBW A;  1XOV A;  4KRT A;  1SPK A;  1T3S A;  2DL8 A;  3REA B;  4JJB A;  1PRM C;  4AFQ C;  4J9E A;  2DM1 A;  3VS5 A;  3EG2 A;  1UGV A;  4AFU C;  1CKB A;  2KRM A;  2EYY A;  1JXO A;  3I5R A;  2PTK A;  2FPF A;  1BBZ A;  1WYX A;  1X6G A;  4RTZ A;  2J6K A;  4HXJ A;  1UG1 A;  1W1F A;  2V1R A;  2EW3 A;  3LH5 A;  1A0N B;  2YUO A;  1NLO C;  1GBR A;  1E6H A;  1K9A A;  1JO8 A;  2DE0 X;  3U23 A;  2OI3 A;  1G83 A;  1MV3 A;  4OMP A;  1ABQ A;  3EG1 A;  2KEA A;  1NM7 A;  3EHR A;  1M27 C;  1PNJ A;  3M0Q A;  1UEC A;  2FPE A;  3I5S A;  4LUE A;  2DMO A;  2O31 A;  2DJQ A;  1B3Q A;  1X2Q A;  4RTW A;  1T3L A;  4CC7 A;  2O2O A;  1NG2 A;  2QDL A;  2K79 A;  1BB9 A;  4JZ4 A;  1EFN A;  3KFV A;  1CKA A;  1AZG B;  2GTJ A;  2L3P A;  2F2V A;  4J9D A;  2PZ1 A;  2BZ8 A;  4D8K A;  1I0C A;  2DLP A;  1AEY A;  5FWB A;  1WXB A;  3M0P A;  1X6B A;  1U06 A;  1UHC A;  1MV0 B;  2C0I A;  4CC3 A;  5EC7 A;  2A37 A;  1H8K A;  3EG0 A;  2AZV A;  4JPB W;  1AOJ A;  1PWT A;  1PRL C;  2KYB A;  1PKT A;  2YT6 A;  3RNJ A;  2HCK A;  2GTO A;  1E6G A;  3M0S A;  1W70 A;  3ZL7 C;  2LJ3 A;  3QWY A;  3VS2 A;  2F2X A;  3PVL A;  2ED0 A;  2F2W A;  4LNP A;  4Z8A A;  2SEM A;  2KRO A;  2JS0 A;  3M0U A;  1TG0 A;  1YWP A;  1M3A A;  4RTT A;  1T0H A;  2YUN A;  2RNA A;  2J06 A;  3R6N A;  2DBM A;  2EYW A;  2PNI A;  3H0F A;  1UE9 A;  1AVZ C;  2DRM A;  2KR3 A;  2ENM A;  4LN2 A;  2DVJ A;  1NYG A;  1SSH A;  1X69 A;  3NPF A;  4J9B A;  2L3S A;  3JV3 A;  3NMZ C;  1UJ0 A;  4EIK A;  2YSQ A;  3RBB B;  1GBQ A;  4J9H A;  1NYF A;  3SEM A;  4F16 A;  2KXD A;  3VS6 A;  1ZUU A;  2L2P A;  2YUQ A;  1W6X A;  1OPL A;  1E7O A;  5IXF A;  1I07 A;  1NEG A;  4HVU A;  2L0A A;  4RTY A;  4ORZ A;  1PHT A;  1SHG A;  2RQR A;  2D1X A;  2AKK A;  2RMO A;  3A98 A;  3NHN A;  2CRE A;  2BTT A;  2NWM A;  4E6R A;  1M8M A;  2VVK A;  1RLP C;  2A36 A;  2LJ1 A;  1FMK A;  2FPD A;  1AWW A;  4AG2 C;  2DA9 A;  2NUZ A;  2RQV A;  3EG3 A;  2VWF A;  5IH2 A;  4R0K A;  1H92 A;  1ZX6 A;  2GGR A;  4OMN A;  2JT4 A;  4Z89 A;  5FW9 A;  4J9C A;  3H41 A;  3M0R A;  3EHQ A;  1ABO A;  2LQW A;  1JXM A;  2FO0 A;  2ABL A;  2KRS A;  2BZY A;  2ROL A;  1QCF A;  1CSK A;  1U3O A;  3I9Q A;  3PE0 A;  2JS2 A;  2FG0 A;  1UUE A;  4WCI A;  1N5Z A;  2HEQ A;  1KJW A;  4RTX A;  1SRL A;  2KT1 A;  2BZX A;  2ROT A;  3TSW A;  2K7A A;  1VYV A;  1QKW A;  2AKL A;  1GRI A;  2ECZ A;  1JU5 C;  1BU1 A;  2OJ2 A;  2V1Q A;  2VKN A;  2EGC A;  4OMM A;  2P4R A;  1VYT A;  1RLQ C;  1VA7 A;  1OPK A;  2SRC A;  1QWF A;  2ESW A;  2MOX A;  5IHI A;  3IQL A;  4J9G A;  1ZUK A;  1WA7 A;  2CSI A;  2J7I A;  3UAT A;  1OV3 A;  1JEG A;  2CSQ A;  1WI7 A;  2YUP A;  1UFF A;  4HCK A;  4IIM A;  2M0Y A;  1WX6 A;  2H8H A;  2M51 A;  3TSZ A;  2W10 A;  2KBT A;  5I22 A;  1K4U S;  3EGU A;  1RI9 A;  2DRK A;  2O9V A;  1Y57 A;  1TUC A;  2EQI A;  4M4Z A;  4AFS C;  2CH4 W;  2LCS A;  2DL4 A;  2J6F A;  1WDX A;  2LZ6 B;  1AZE A;  3VRY A;  4ZNX A;  1ZSG A;  2KGT A;  1ZUY A;  2A08 A;  5IXB A;  2CT4 A;  2DNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...