2M51A

Nmr structure of the sh3 domain of human ras p21 protein activator (gtpase activating protein) 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
62
structure length
62
Chain Sequence
GRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the SH3 domain of human RAS p21 protein activator (GTPase activating protein) 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ras GTPase-activating protein 1
total genus 7
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2m51A00
2GTOA 2RQVA 2KEAA 1YN8A 3H0IA 4J9DA 1GL5A 1NEGA 4F17A 1OEBA 1U5SA 1UJ0A 2JMCA 2G6FX 1UJYA 2GNCA 5FWBA 4CC3A 1SHGA 1W1FA 4E6RA 2CSQA 2KYBA 1X43A 2LNHB 1FYNA 1M8MA 1X6GA 3I5SA 1VYVA 3EHQA 5FW9A 1H8KA 2CSIA 1ZUKA 1G2BA 1T3LA 2ENMA 1PNJA 3VS4A 2A28A 2W10A 2EVRA 2LX7A 1JQQA 1B3QA 1K76A 3EG3A 2KRNA 2ECZA 2DMOA 3EG2A 2JW4A 2H8HA 2XMFA 1M3BA 2MOXA 2J6KA 3VS2A 2DL3A 1AD5A 1AVZC 2YUOA 1TUDA 2M51A 4JJDA 3NHNA 3VRYA 2A36A 1WI7A 3UA6A 2BZXA 4J9HA 1KIKA 2D1XA 1MV3A 4Z88A 1VYUA 2K79A 2K7AA 1GCQC 4HCKA 2ROTA 1NLPC 1X27A 2NWMA 5GJVB 2J05A 5IXFA 2LQWA 2DRMA 2RQTA 2L3SA 1UHFA 1LCKA 1W6XA 2YUQA 3H0FA 2VVKA 1OV3A 2A08A 1JEGA 2AZSA 3KFVA 3I9QA 1M30A 1E7OA 2EYWA 1AWOA 1BU1A 2FPFA 4AG1C 1QWFA 1HD3A 1X69A 4RTVA 2DVJA 2KE9A 2KR3A 1GFDA 2AK5A 2DJQA 2CDTA 2LMJA 2M0YA 5GJWB 1WA7A 1RI9A 2JXBA 4J9BA 2DF6A 1QCFA 3H0HA 2DBMA 4GBQA 2DILA 4Z8AA 2JM9A 2K3BA 1K4US 1ZUUA 1PRLC 2JS2A 3VS3A 4RTUA 1GCQA 3PE0A 1WXBA 2CUBA 1UDLA 2DL8A 2C0TA 1NYFA 1WX6A 2O31A 1AWWA 1UHCA 1CSKA 1U06A 2L2PA 1HJDA 2DYBA 4CC7A 2IIMA 2JTEA 1IO6A 1GRIA 1X2KA 3EHRA 5ECAA 1QLYA 3M0RA 2NUZA 1WFWA 1QWEA 2DE0X 2W0ZA 2HDAA 2SEMA 2X3XD 1A0NB 1U3OA 1NLOC 1AZGB 3TSWA 1BB9A 4LNPA 2FRYA 2RPNA 1ZBJA 1I1JA 3RNJA 2KT1A 1M3AA 1GBQA 5IHKA 1ZUYA 1G83A 2KRMA 4OMMA 1UFFA 3TSZA 2V1RA 1OPLA 1UECA 1GFCA 2J7IA 2RN8A 2BZ8A 4HXJA 2EGCA 3UF4A 4RTXA 1M27C 2GQIA 2RMOA 4Y92A 2O88A 2LJ3A 4CC4B 2F2VA 2QDLA 2RQRA 1Y0MA 4JZ4A 4D8KA 4FSSA 2CH4W 2AZVA 2YDLA 3ZL7C 2GBQA 1CKBA 1RLPC 2CUDA 1QKXA 1JXOA 1UTIA 3UA7A 1K0XA 1T0JA 2D0NA 2DA9A 1SSHA 1FMKA 1OPKA 2RQUA 2KRSA 2A37A 2J6FA 4J9CA 2E5KA 4AG2C 1JU5C 1JO8A 1SHFA 3I35A 3QWXX 2O9VA 2MIOA 4QT7A 2JMAA 4OMNA 2C0IA 2L3PA 2O9SA 1AWXA 2P4RA 2PTKA 3FJ5A 2LJ0A 2RQWA 1KFZA 1B07A 4WCIA 3R6NA 4IIMA 1UE9A 2ROLA 2J6OA 4A63B 2EPDA 1HSQA 4K11A 4F14A 2FPDA 1YWPA 2V1QA 1MV0B 1M3CA 2F2WA 2DX1A 2KROA 3PVQA 3SEMA 1NG2A 2AKLA 4J9GA 1BBZA 2DL5A 2J06A 2BZYA 3SHWA 4J9FA 2DLPA 2FPEA 2FO0A 4F16A 2HCKA 2OAWA 3VS0A 1GCPA 2OI3A 1PKTA 1EFNA 2KXCA 2YT6A 1S1NA 1YCSB 2ED1A 2B86A 2MCNA 3JV3A 2EYZA 1I07A 2EGAA 5IH2A 2X3WD 2CH4A 3REAB 4J9EA 4OMLA 1KSWA 2KT8A 1X6BA 2C0OA 4RTZA 4ZNXA 4HVWA 1NYGA 3M0PA 1WXUA 3THKA 2KNBB 2KGTA 4RUGA 2JM8A 1BK2A 2VWFA 1UG1A 2K9GA 4GLMA 2D8HA 1WLPB 5FWCA 1V1CA 2EBPA 1SPKA 3H41A 2BTTA 2YUNA 4DEYA 2DRKA 2DNUA 2GGRA 3VS6A 4RTYA 1ABQA 2EYYA 2SRCA 2YUPA 2LZ6B 4AFQC 2ESWA 3CQTA 3LH5A 3QWYA 1ZLMA 2LQNA 1T3SA 3EG1A 1ZSGA 2EYXA 1PKSA 2CT4A 2KBTA 4JJCA 3VS1A 4EIKA 1K9AA 1XOVA 3NGPA 1YNZA 2KXDA 2YSQA 1Y57A 2I0NA 3M0SA 3M0TA 3VS5A 3A98A 1NEBA 2K6DA 4AFUC 4OMPA 1CKAA 2FRWA 1QKWA 5EC7A 1AOJA 1AZEA 1AEYA 3M0QA 3M0UA 5IXBA 1PWTA 1YWOA 1I0CA 1WXTA 2GTJA 3NMZC 2D8JA 2L3QA 3TVTA 3C0CA 1TUCA 4M4ZA 1WYXA 2RNAA 1K1ZA 4ORZA 3NPFA 2ED0A 4X1VA 4JPBW 1T0HA 1J3TA 2KYMA 2HEQA 4D8DA 2EGEA 2LP5A 2HBWA 4LUDA 1TG0A 1ARKA 1KJWA 1SRMA 1SRLA 1X2QA 2JT4A 4R0KA 1PRMC 2L0AA 3I5RA 1WIEA 2FG0A 2JS0A 1YP5A 2DL7A 1AWJA 1JXMA 5I11A 4HVUA 2AKKA 4LUEA 1RUWA 3VS7A 1ZX6A 1H92A 2EKHA 3GBQA 2LJ1A 4JJBA 5IHIA 2CT3A 3IQLA 5IHNA 3VRZA 3PVLA 1WDXA 2FEIA 3O5ZA 4OMOA 4J9IA 1RLQC 4KRTA 4IIOA 1ABOA 2O2OA 4JZ3A 1OOTA 3U23A 4DEXA 4CC2A 2ABLA 4LN2A 4AFSC 1W70A 4ESRA 2EQIA 1NM7A 2PNIA 5HCKA 2LCSA 3EG0A 2CREA 1E6GA 2DM1A 4RTTA 2OJ2A 2K2MA 2VKNA 3ULRB 3REBB 1H3HA 4HVVA 1UUEA 1VA7A 1E6HA 1MUZA 2PZ1A 2F2XA 2EW3A 1PHTA 1VYTA 4AFZC 1Z9ZA 4Z89A 1Z9QA 2RF0A 2DBKA 3EGUA 1SEMA 4LE9A 4RTWA 5L23A 3RBBB 4OMQA 5I22A 1UGVA 2DL4A 1GBRA 2HSPA 1K0SA 1N5ZA 3UATA
chains in the Genus database with same CATH superfamily
4C92B 1SSFA 3LGFA 1U5SA 3NTHA 1VQ7A 3QZ9B 4HT9A 2KI7A 1SHGA 2A7YA 3G7ZA 3X26B 1X43A 2MK5A 5A0LA 2E6ZA 4N0AA 2RHXA 1VYVA 2IG0A 4OF1A 2VXEA 1D0XA 1H8KA 2Y4YA 3CCMT 1ZUKA 3FJPA 2F5KA 2PU9B 2DEUA 3S3MA 4EDUA 1BI0A 1OU8A 1T3LA 2HZYA 3E9GA 1F1BB 2F69A 2A28A 2QGFB 2V8KA 2EVRA 4F7UE 1FWZA 3OYDA 1D1BA 2GF7A 4BI8B 5LJ5h 1YI2T 3JB9D 3URGA 5D7UA 1ACMB 6AT1B 1K73C 2MOXA 2AHJB 5CKHA 1X75C 1R8OB 2PVOB 4C8QE 4LDXA 3RKWA 2DXBA 1V29B 2DL3A 3HFNA 2DZ9A 2K5FA 2KMTA 4M7DE 1TUDA 3JCMb 2BE7D 2M51A 3CC2Q 5LJ5j 1WI7A 1Q7YR 4J9HA 4C0DB 2D1XA 3I56T 1MV3A 3J7AF 2K79A 2K7AA 1Q95G 2M02A 1GCQC 4HKEA 1Y96A 2ROTA 2QEXQ 2NWMA 2RQTA 4LDWA 1RAAB 2YUQA 3A5ZB 2QYZA 3R6OA 2A08A 4E7LA 3WVDB 1VQ6A 3E9FA 3I9QA 1M30A 2L89A 2QK0A 3G71A 2PUKB 2RO0A 1ZSZC 1BU1A 5CQYA 1C1AA 4AG1C 2VXFA 4RTVA 4M7AF 3HPWA 2A0FB 2KR3A 2DIGA 3CC4Q 2DJQA 2CDTA 1WA7A 2L3RA 4PLIA 2RHUA 2NUPB 2JXBA 1LPLA 2DF6A 2DBMA 1D1AA 2YLBA 5CKBA 4JDSA 2CS7A 1ZUUA 2EQJA 1I8FA 4RTUA 2DKGA 4ELZC 4M78D 4BUGA 4A4HA 2MF2A 3SWNA 4PJOD 1Q81R 2ZPIB 2P84A 2GCXA 3EFSA 1M1KR 1YI2A 1WX6A 2CP2A 2NYSA 5LJ5e 3ASKA 4DBFA 1WNLA 1CSKA 1HJDA 2LCLA 2MYSA 1BCMA 2R58A 2JTEA 4PK4A 5J26A 1X2KA 3EHRA 5ECAA 4BY6C 5KYXA 3CCLT 2YXYA 1KHIA 2W0ZA 2HDAA 1M4ZA 1QCNA 1A0NB 2RJEA 3EAEA 5GAN7 1BB9A 4LNPA 2K4YA 4C8QC 3CD6T 3EGDB 3RNJA 4PFZA 2OTLA 1G83A 2LCCA 3L2ZA 2K3YA 1OPLA 2HQXA 1NZ9A 1UECA 1R0CB 4A53A 4HXJA 1TOVA 3CPWP 1M27C 2RMOA 2VYTA 2FL7A 2O88A 4HCCA 4J6WA 1X01A 3GLXA 1Y0MA 2KDSA 4B9XA 4BE0A 2EAYA 5GANe 4JZ4A 4J5YA 4D8KA 2Y90A 2ZPEB 2AZVA 4M77B 1CKBA 1RLPC 1YITQ 4EMKB 2CUDA 1QKXA 3MHXA 2CGHA 1UTIA 5IN1A 4E2FB 2AT1B 2D0NA 1SSHA 1FMKA 5KCHA 2Y4XA 2J6FA 3GPLA 4C5HA 1WZOA 2V8JA 3I35A 1BI2A 3QWXX 2MIOA 2RM4A 3V7CA 3C95A 4QT7A 3L2WA 4QKUA 5FRMA 4M7AD 2PTKA 5GANf 3CC7T 3ZEHA 3PIPA 3R6NA 1KQSS 3CC4A 3MO8A 4IIMA 1EZZB 4QVZA 2O4XB 1KD1C 3BDLA 4FU6A 4LDVA 2J6OA 1Q81C 3VKIA 3CD6A 1NPRA 3CMAT 2RK1A 1I5OB 3TCJA 4F14A 4Q5WA 1QVPA 2ZPFB 2CP3A 2EJGA 1NG2A 2AKLA 3TQ7P 4HCZA 1VQ5Q 1YJNT 4QQDA 1VQKT 2BZYA 1UGPB 2DLPA 2FO0A 2JOYA 1PKTA 1S1NA 1YCSB 2QQ9A 3EG9B 1WHLA 1GXIE 3RIRA 3P8HA 2DK3A 5LJ5f 3C4SA 1KSWA 2PVDB 4OB3B 2C0OA 4ZNXA 1NYGA 5GMKi 1FXXA 2ATCB 3QIIA 3RKYA 2VWFA 3JCMV 4B6MA 4MDXA 2L5QA 4BI4A 2K9GA 3H41A 1H641 1FMVA 3OYYA 2DNUA 2GGRA 4RTYA 2D9TA 3OYKA 1G5VA 4AFQC 2OX7A 3LH5A 4BE2A 2LQNA 3EG1A 2EYXA 4JJCA 4M7AA 4XTZA 5KYUB 1QVFP 1I81A 1K9AA 2YSQA 3P8BB 1KQ2A 2K6DA 1U1TA 1CKAA 2LTOA 4OMPA 5GANj 5EC7A 2LC4A 2FYKA 2X4XA 3H9NA 3SD4A 3CXCS 3CCRA 1AEYA 3M0UA 1D3BA 3KBGA 3HHTB 3OYAA 1Y7XA 2GFUA 2JN0A 1VQ5A 2MMPA 4M4ZA 4J6XA 1QCOA 1K1ZA 2QGGA 4C92A 2FZKB 2ZCFB 1OX8A 4X1VA 3UWNA 4MZMA 1YJNQ 4PJOF 4D8DA 2RD1A 2FZCB 2LQ8A 1ARKA 2EQKA 2RHYA 1X2QA 2JT4A 4R0KA 2L0AA 1WIEA 1OX9A 1YP5A 2CKKA 4HVUA 2XK0A 4HT8A 3VS7A 3CCEA 2QA4T 2DAQA 1H92A 4O6JA 5I2SA 2CT3A 1MNDA 4OVAA 1OU9A 4J9IA 1RLQC 3MEVA 1D0ZA 2CP6A 2C06A 1VQKQ 3U23A 1OOTA 4DEXA 2QTXA 4HCBA 4M7AC 4M78E 2LDMA 4LN2A 3CBPA 1K9MU 2EQIA 2V26A 1NM7A 3AT1B 5HCKA 2CREA 1WJQA 1N8RR 5GMKj 3REBB 1H3HA 5DY9A 1UUEA 1MMAA 2OTJA 1VQ8Q 4DQ2A 3G6EQ 1VQ9T 2F2XA 3LH0A 3N5BB 4PLLA 1VYTA 1X6OA 4AFZC 4Z89A 1W2BA 1Z9QA 2DIQA 3TREA 1KD1U 4M77E 3RBBB 4L5GA 2OTJT 1UGVA 1VQ5T 1N5ZA 3UATA 4PJOE 2GTOA 2ZGWA 2RQVA 1ZQ1A 3H0IA 4J9DA 2HQEA 1NEGA 4F17A 1VQNA 3QZ5B 1YBYA 4C5EA 1UJYA 1BI3A 5D6XA 4M75E 1VIFA 4CC3A 1W1FA 4E6RA 2KYBA 1SKUB 3CCMA 1M8MA 1R77A 1X6GA 3QJYA 1PCXA 4C8QD 3C94A 3EHQA 5AYFA 4E7ZA 2QXFA 1QQJA 4OB0B 4ZN3A 3OS2A 2F1LA 2ENMA 2KK4A 2LX7A 4A4GA 1TTHB 1B3QA 4JLGA 3GOXA 3LWIA 5GAMh 4L6V5 5FU7C 2ECZA 2DMOA 3RR6A 3MP6A 3SWNB 2O01E 5GANg 3LWHA 2QA4A 4PJOC 4N4GA 1AVZC 2BE9B 1YHQT 2BZXA 1UEBA 1TH7A 1VYUA 1M2VB 4MDWA 1PSEA 1NJIU 1X27A 3JCMQ 4A54A 4F7UA 5KYYB 5IXFA 3A8LB 2EJ9A 5FRNA 2VGNA 3CBMA 2HMAA 3M55A 1UGRB 4PKCC 3M53A 1OV3A 4M7DG 2AZSA 3QJ6A 3QXEB 1QWFA 5CO7A 4DA4A 5AT1B 2DFUA 2KE9A 1WHGA 3QBYA 4RG2A 5GJWB 2NUTB 1HYOA 1RI9A 3EGDA 1QCFA 4GBQA 4Z8AA 3X28B 2JM9A 4FSXA 1TWBA 3PTAA 1K4US 2KVQG 2JS2A 5GAMj 3JCMe 1GCQA 2CUBA 2DXCA 4AMCA 4E7HA 2JTMA 4EMGA 1UDLA 1V76A 1WJRA 2DL8A 2QI2A 5A0DA 4J7FA 1B34A 1G3YA 5D6YA 3FEOA 4F7UF 3FDRA 2H3JA 1AWWA 4IUUA 1U06A 3J81E 1VQPQ 1WHMA 1Q81U 5FU6C 3QHSA 4Z02A 3JCMc 1M1GA 2IIMA 2RA2A 1M5Q1 1GRIA 3BFMA 3M0RA 1FMWA 1NJIC 2QASA 1WFWA 1VQLQ 1NLOC 1AZGB 4P5NA 2NLUA 3JB9F 2EWNA 4DOWA 1YFNA 2FRYA 1N9SA 4UC4A 1ZBJA 1C0MA 3G6EA 4Y28E 5IHKA 5LJ3g 1ZUYA 4II1A 4OMMA 4JJNK 2V1RA 1QW1A 2J7IA 1NBEB 3DB4A 3E1SA 1YI2Q 3UF4A 1LVKA 3A8MB 4PL6A 3EGXA 4C92E 5CCAA 4LD9K 2RQRA 2RB6A 5KYUA 1QVFA 3LLRA 4FSSA 4WF2A 2CH4W 4M78F 5GAN8 3ZL7C 1Q82R 2LX9A 2GBQA 2EFIA 1YJ9Q 3GNFB 1KC8U 4E7SA 3UA7A 3CCEQ 1K0XA 2DA9A 4M75C 1OPKA 2RQUA 4FT2A 2V8IA 4CRIA 5GAOm 5IT9E 5CAIA 2HBPA 1JU5C 1UGSB 1WHHA 3PIOA 3KUFA 4OB2B 3C12A 2E65A 1K9MC 4ZN1A 2PUOB 2JMAA 2L3PA 1YJ9A 2CP5A 2GFAA 2P4RA 5CIUA 1RAEB 1WPYA 1IGQA 1LNXA 3PMIA 4XTWA 3QYGB 1VQMT 1Y71A 2X35A 1PC0A 3OYLA 1K8AC 3M4YA 1N6AA 4GLKA 4A4KA 1HSQA 5KYWB 1BYMA 2AIRB 2FPDA 1KHCA 2COYA 2RI2A 1MV0B 2V1QA 4JUVA 3OBYA 4M77A 5FROA 2KROA 2E64A 3PVQA 2VC8A 1RL2A 3CCVA 4M78B 1IREB 1BBZA 4IUVA 4JS4A 2J06A 2DPPB 3ME9A 4TVRA 4ME7A 5L8RE 8ATCB 1TXQA 3META 2Z0WA 4LD6A 2KXCA 4R55A 1WJSA 1D0YA 4EPCA 2FHDA 2B86A 3BY7A 1VQ8T 2MCNA 2EYZA 5KYYA 1I07A 2EGAA 4JRKA 3CMET 2X3WD 1AHJB 3REAB 5LJ5d 4N4IA 3CCET 2KT8A 3HL8A 4RTZA 2P0QA 4HVWA 5GAN6 3M0PA 2E70A 1O9SA 3ER0A 5A0GA 2KNBB 5GMKh 2JM8A 1K73U 1LJOA 5DLQE 3OYMA 1W2BS 4MZPA 2VUBA 1V1CA 2EBPA 1SPKA 5I2MA 2I2LA 2BTTA 2YUNA 5EG2A 2QA4Q 4DEYA 1WHKA 2ESWA 2QQSA 4WTOB 1YJ9T 1M1KC 3RERA 5LJ3j 1ZSGA 4ANJA 2HAXA 4DBRA 1PKSA 4M7DC 4EIKA 2XKOC 1KD1R 3A8OB 2CZ1B 1BCOA 2LQKA 1BIAA 1Y57A 3VS5A 2QG9B 1NEBA 3EGXB 3OW2P 2RH2A 4AFUC 4DBHA 2FRWA 1QKWA 1P92A 5IXBA 1PWTA 1I0CA 1WXTA 4A4FA 1WGSA 2GTJA 3CCQQ 1RABB 3CC4T 2D8JA 2HNIA 2L3QA 1VQMQ 1YIJA 4C8QA 1UGQB 3I56Q 3OA6A 4ORZA 3RMSA 3NPFA 2DJZA 3JB9J 3CBOA 3OYBA 2HBWA 1TG0A 4KH1B 2FB7A 3OYCA 1KJWA 3HRSA 1IHVA 1PRMC 3I5RA 2KQWA 2P4TA 5I11A 2AKKA 4LUEA 5GAMd 3CCQT 1ZX6A 5KE2A 3GBQA 4QW2A 5IHNA 1WDXA 3FLGA 3QPHA 4PFPA 3M54A 4IIOA 3AHUA 1IXDA 2O2OA 2KAFA 1RAGB 5IAYA 4FYYB 4ESRA 3EFOB 3MPUB 2LCSA 4BACA 3EG0A 1E6GA 5GAMf 2OJ2A 4NS5A 4D6WA 2K5LA 1NJIR 2DETA 1K9MR 7AT1B 2PZ1A 1MHNA 3GP8A 3OW2A 3DKMA 3PNWC 2WSCE 4KUIA 3HKSA 2COWA 1N8RU 3JRZA 1VQOT 3LW5E 3CCJQ 4BE1A 2DBKA 3EGUA 4C0ZA 2CP7A 2X4JA 2DL4A 3RMQA 1YHQA 2E3HA 1B7TA 1GBRA 9ATCB 2WACA 4C92C 3VUZA 1YN8A 1GL5A 3G71Q 3OS1A 1ZA2B 3HSBA 4C92F 3OB9A 4OB1B 5FWBA 3RKXA 3X20B 2QQBA 2EQMA 3T9NA 1M2VA 2LNHB 3I5SA 4MMKA 3HRUA 2DZCA 3OQ5A 1YHQQ 3V8KA 3CCMQ 1YIJT 2M0OA 2M9UA 2CSIA 3HTRA 5LJ3e 3JCMd 5KCOA 2R5AA 1VQNQ 3OW2S 3V7SA 4BDZA 1K76A 3EG3A 3VV0A 3OS0A 3JCMW 2KRNA 3H6ZA 1G3SA 2HSEB 3EG2A 2JW4A 1IHWA 5HY6A 4F7UB 2J6KA 1B34B 3CCQA 1YITT 4C5IA 4OGCA 5LJ3d 2ZPHB 4NL2A 3L42A 4FM4B 1AD5A 1MMNA 2QTVA 3X25B 4M7DD 1G8XA 1PD1A 4JJDA 2OTJQ 1TS9A 3A1PA 1C6VX 1QVFS 2A36A 4EMHA 1KIKA 3UA6A 4C0DC 4Z88A 2DYIA 3JSCA 2ZPGB 3CMEQ 3G6ET 4R56A 2YRDA 4O5VA 1YCYA 5GJVB 1AT1B 2LQWA 2L3SA 1UHFA 1W6XA 2QAZA 3V8LA 2NUTA 3H0FA 4ZGJB 2VVKA 3JCMJ 4JRIA 1M9SA 4A4EA 1MGQA 3A8HB 2FVUA 1E7OA 2EYWA 1AWOA 1ZSZB 4ZGEB 2FPFA 4GY5A 2XD0A 4KBMB 3CPWA 2HKQB 3D7SB 1X69A 3LYIA 3BDUA 4OP0A 1GFDA 4BB7A 2LMJA 4MZTA 1BIBA 2M0YA 3ZBDA 4ATOA 1RAHB 2KY9A 1Q86U 3H0HA 3WVEB 3L2VA 2VGMA 4IURA 1M90R 1PRLC 4M78A 3QG1A 3PGGA 2CP0A 2XHCA 2FZGB 1VOMA 4F04B 3UT1A 1RADB 4LDUA 2C0TA 3OYGA 1VQLT 4LXCA 3JB9H 3QDRB 2QEXA 2RI5A 3TU4K 3I55Q 2O31A 4C5GA 1UHCA 3J80E 1Y96B 2DYBA 4CC7A 1KC8C 2EIFA 2CZ7B 2HD0A 1IO6A 4BY6B 4M78G 1OYXA 3JCMg 5DLOA 2DE0X 1QWEA 2ZZDA 3PFSA 5CVIA 4C8QB 1YITA 2JVVA 5J39A 1Q86R 1S72Q 4RCBA 1I1JA 1OZ2A 5CKFA 3M59A 4M75F 1GBQA 3GNGA 2KRMA 1UFFA 3NFCA 3UPUA 2RN8A 3CCUQ 3QSUA 2EGCA 1WQ7A 4RTXA 1VQNT 4J7IA 4Y92A 1VQ7T 2LJ3A 5LJ3h 4PJOG 3L1AA 3CCVQ 1ZSZA 1WQWA 3ZFJA 2MI6A 3CC7A 4M77C 1DJ7B 3QUIA 4EMKC 1VQOQ 1Q7YU 4XU3A 1JXOA 1VQ7Q 1T0JA 4QQ6A 2KRSA 2A37A 3OYHA 2RHIA 2E5KA 3JAME 1JO8A 3EFOA 1SHFA 1QVGS 2EKOA 1JJ2A 5C0MA 2YWWA 2ZAEA 4OMNA 1AWXA 4C8QF 3FJ5A 3CCST 3WXMB 2LT4A 3QYHB 4XU1A 2ROLA 1XTDA 3CEYA 2DTHA 1VQLA 4A63B 1SF9A 3FC3A 4KGVB 4PJLA 1M3CA 4XAXB 1D09B 2CZ6B 3MEAA 3MEWA 4M7AE 3SEMA 3CC2T 5KE3A 3LGLA 2P0PA 3M4GA 2DL5A 1M8VA 3SHWA 1U8RA 4FW1A 4J9FA 4JRPA 4F16A 2HCKA 2OAWA 1GCPA 2OI3A 4V2SA 1EFNA 1IRXA 5D6WA 3QKJA 2DO3A 2ED1A 4DOVA 1Q86C 1G3TA 3JV3A 1VUBA 2RJCA 1MNEA 5IH2A 1EX4A 2CH4A 4F7UG 2DD4A 3A8GB 4XTUA 1X6BA 2K57A 4IUQA 5KYNA 2QQRA 1WXUA 5A2QE 4FYWB 3THKA 4KH0B 1BI1A 4C8QG 3M57A 1BK2A 4IUPA 4XU2A 5GAOr 4KULA 5CQXA 2JNGA 5FWCA 4RG8A 2DTIA 5GAN4 3CMAQ 1K8AR 2DRKA 4X34A 2LNVA 2H3EB 2EYYA 4RMOA 1VQ4Q 1RAIB 2K3XA 2VASA 4E7IA 4KUDK 2F5TX 3QWYA 4E47A 1T3SA 2K2VA 3L2QA 2COZA 3GIBA 1W4SA 2KBTA 3VJPA 3JCMP 1Q82C 2E10A 4RKUE 3M56A 1PG5B 4XTXA 1XOVA 1YJNA 1OULA 1YNZA 2KXDA 2I0NA 3M0SA 3M0TA 2IVWA 3A98A 1Q82U 2BIVA 2RJFA 4PFOA 3DLLA 3QDFA 5I21A 1AOJA 1AZEA 3M0QA 3F70A 1M1KU 2NUPA 2XDPA 1YWOA 4IUTA 3OSSC 1ZBXA 1QVGA 2JZ2A 1TUCA 2DEQA 4L59A 1OI1A 5CK9A 3CCJA 2E4HA 4PNOA 4XTVA 1J3TA 1T0HA 1RI0A 3M5AA 3CC7Q 2HEQA 2EGEA 4XK8E 2LP5A 4FCYA 2VV5A 1SRMA 4PJJA 1TUGB 1JJ2P 1JBMA 2DL7A 1QVGP 1JXMA 3PT9A 1TU0B 3S3NA 4C92G 1KC8R 2EKHA 2LJ1A 5IHIA 3IQLA 2HKNA 3VRZA 2FEIA 3O5ZA 2XICA 5CKEA 3M9QA 5LJ3f 2EYQA 4KRTA 1JJ2S 2QDYB 3CCSQ 4KGZB 4JZ3A 4M7AB 2R5MA 3EFRA 4CC2A 2KSSA 3E19A 4AFSC 1PM3A 2BUDA 1ZHIA 1N8RC 3INZA 2DM1A 4RTTA 1VQOA 2D0QB 3ULRB 1RAFB 2CZ0B 4HVVA 1VQPT 1VA7A 4PJNA 5GAOp 3G71T 3DLMA 3JCMX 2EW3A 1PHTA 3Q1JA 1XQHA 3I55A 1Q7YC 1K8AU 1ZA1B 2RF0A 3I56A 4LE9A 1SEMA 1FX7A 4RTWA 3TEEA 4M77D 4NL3A 5DM7R 1K0SA 1O75A 3L2RA 2KEAA 5GMKm 5GMKe 1OEBA 1R0BG 1UJ0A 3OMCA 1M2OA 2JMCA 2G6FX 2GNCA 5GAMe 2CSQA 1FYNA 4JRQA 3OMGA 1BKBA 5FW9A 3JCMf 4DBQA 3CCJT 1G2BA 3DB3A 1VIEA 3CXCP 1PNJA 4J6YA 3VS4A 2W10A 1OQKA 1JQQA 3CCUT 3SDZA 1K73R 5FU7B 2XDBA 2YHTA 1KQ1A 2H8HA 2XMFA 1M3BA 3JB9G 2DERA 3SWNC 3X24B 4AT1B 1TSFA 3VS2A 4XQ3A 2E3IA 2R57A 3GF5A 1LOJA 4PJOB 2YUOA 2DTOA 3NHNA 3VRYA 2ZPBB 1YJWA 1H3ZA 4PJOA 4JS5A 3BW1A 2WSEE 4HCKA 1NLPC 1KK7A 3RESA 2J05A 3NTKA 1M1FA 2DRMA 2X51A 4ZGDB 2M16A 1LCKA 3I55T 4CI0C 4BD3A 2XDDA 2OTLQ 3CPFA 1VQ6T 1VQPA 1JEGA 1N9RA 2E41A 3KFVA 4Y91A 1MMGA 3BE3A 1EIFA 3SB2A 1HD3A 3CMEA 4QVDA 2DVJA 1HK9A 2JTFA 2JJ9A 4YTLA 2AK5A 2IPOB 3S3OA 1U1SA 1VQ4T 5LJ5g 4FYXB 5GAN5 4ZTFA 3O8VA 3OBWA 4J9BA 2VB6A 2DILA 2K3BA 2QQAA 3CXCA 1MMDA 3VS3A 4IKFA 3MKDA 1WXBA 3PE0A 3M58A 4LDYA 2OAUA 4OMFB 1UB4A 1NYFA 3MJXA 1IZ6A 1YJWQ 2L2PA 2L8DA 4XU0A 5HK0A 1YJWT 2A3LA 5FU6B 3EH2A 3RDVA 5GAN3 1NPPA 1QLYA 3G1JA 4ELYC 2NUZA 3CD6Q 2X3XD 3HFOA 2SEMA 1U3OA 4OGEA 3TSWA 1KQSA 3OS5A 3CCRT 1KQSP 2MWOA 3EH1A 1W2BP 4JLIA 5KH6A 1VQ6Q 3CCLA 3OYNA 2RPNA 2KT1A 2OTLT 1M3AA 2JUFA 2MAMA 3TSZA 1XJWB 2GQVA 1OZ3A 1GFCA 2DXTA 2BZ8A 3S6WA 4B9WA 5GAOq 2GQIA 1G3WA 2MWPA 4CC4B 3JB9I 2F2VA 2QDLA 4C92D 2XI9A 1M90U 2YRCA 1Y07A 4E7KA 3G4SQ 4BDYA 3CCLQ 2YDLA 1SG5A 3MEUA 1KG1A 1PSFA 5GANh 2XIDA 5KYXB 4M75B 1VQMA 2HL3A 4J9CA 2DD5A 4AG2C 4HA8A 2CYZB 2MPXC 3CPWS 2O9VA 3EG9A 1VQ4A 2YLCA 3VUBA 2B8AA 2C0IA 1PD0A 1I5LA 2O9SA 1QP3A 4FT4A 2LJ0A 2RQWA 3NTIA 3CCVT 3FRNA 1KFZA 1B07A 4M7DA 5GMKl 2RI3A 4WCIA 1NE8A 2BKDN 1UE9A 5FLXE 4M7DF 4ZTJA 3FIFA 2EPDA 3L2UA 4X9DA 4K11A 2EQUA 1YWPA 4X9CA 2F2WA 4EMKA 4KGXB 4BI3A 2DX1A 4M75G 2PVGB 4PJMA 2HL5C 4J9GA 4M78C 4FW2A 3OSVA 1YIJQ 5HK3A 2FPEA 1JB0E 3V8JA 3VS0A 2E5QA 2YT6A 3MP1A 3P8DA 1HXDA 3OYFA 3CMAA 4J8OA 5M9OA 2RHZA 5C6SA 3G4SA 4J9EA 2XG8D 4M7AG 5GAN2 4OMLA 3OY9A 3UDCA 4XTYA 1D1CA 1D3BB 2D6FA 3OYJA 1QP2A 5GAOn 1I4K1 5CR2A 2KGTA 4RUGA 2LT1A 8AT1B 3LX7A 2M1HA 3JCMh 1UG1A 4GLMA 2D8HA 1VQ8A 1WLPB 3FB9A 5GAMg 3H8ZA 4QQGA 3VU3C 2RJDA 3VS6A 2QEXT 1ABQA 2SRCA 2YUPA 5KYWA 1QMCA 2LZ6B 3CQTA 2O4XA 1ZLMA 1S72T 5HKCA 4M77F 4M7DB 2CT4A 3VS1A 3CCRQ 3NGPA 1VQKA 4N0AC 3QO3A 2RK2A 3OYEA 2X4YA 3CC2A 5GANd 1JRIA 4QVCA 3HP9A 2E12A 3NMZC 5GAOl 3TVTA 2DXUA 4RCCA 3C0CA 1WYXA 2RNAA 2HQHA 3HRTA 2E6NA 2ED0A 3PMTA 4JPBW 2KYMA 3G4ST 3OYIA 3KXTA 2K5IA 4LUDA 4FYVB 3VYGA 1SRLA 1IGUA 3MP8A 2FG0A 2JS0A 5CKDA 1AWJA 1RUWA 2DVEA 4E7JA 1WHJA 4J83A 3VYHB 4JJBA 4C0GA 3PVLA 4VUBA 4C0FA 4MMLA 4OMOA 2X9HA 3MCAB 4FIBA 1ABOA 2WSFE 4M77G 1XNIA 2ABLA 2X4WA 4FL6A 5LL6S 1W70A 2LVMA 2G3RA 2PNIA 1N27A 3E2UA 3CCSA 3CCUA 1VQ9Q 5J3BA 1IB8A 2K2MA 3RUXA 2VKNA 2YRVA 4NOYA 4M75A 1E6HA 2PQWA 4N4HA 1MUZA 1S72A 4M75D 2LRQA 2XU8A 1Z9ZA 2E1HA 3SFMA 5L23A 4OMQA 5I22A 2P0KA 1VQ9A 1RACB 2EJFA 2HSPA 3V7RA 4KT0E 1M90C
chains in the Genus database with same CATH topology
2GTOA 2RQVA 2KEAA 1YN8A 3H0IA 4J9DA 1GL5A 1NEGA 4F17A 1OEBA 1U5SA 1UJ0A 2JMCA 2G6FX 1UJYA 2GNCA 5FWBA 4CC3A 1SHGA 1W1FA 4E6RA 2CSQA 2KYBA 1X43A 2LNHB 1FYNA 1M8MA 1X6GA 3I5SA 1VYVA 3EHQA 5FW9A 1H8KA 2CSIA 1ZUKA 1G2BA 1T3LA 2ENMA 1PNJA 3VS4A 2A28A 2W10A 2EVRA 2LX7A 1JQQA 1B3QA 1K76A 3EG3A 2KRNA 2ECZA 2DMOA 3EG2A 2JW4A 2H8HA 2XMFA 1M3BA 2MOXA 2J6KA 3VS2A 2DL3A 1AD5A 1AVZC 2YUOA 1TUDA 2M51A 4JJDA 3NHNA 3VRYA 2A36A 1WI7A 3UA6A 2BZXA 4J9HA 1KIKA 2D1XA 1MV3A 4Z88A 1VYUA 2K79A 2K7AA 1GCQC 4HCKA 2ROTA 1NLPC 1X27A 2NWMA 5GJVB 2J05A 5IXFA 2LQWA 2DRMA 2RQTA 2L3SA 1UHFA 1LCKA 1W6XA 2YUQA 3H0FA 2VVKA 1OV3A 2A08A 1JEGA 2AZSA 3KFVA 3I9QA 1M30A 1E7OA 2EYWA 1AWOA 1BU1A 2FPFA 4AG1C 1QWFA 1HD3A 1X69A 4RTVA 2DVJA 2KE9A 2KR3A 1GFDA 2AK5A 2DJQA 2CDTA 2LMJA 2M0YA 5GJWB 1WA7A 1RI9A 2JXBA 4J9BA 2DF6A 1QCFA 3H0HA 2DBMA 4GBQA 2DILA 4Z8AA 2JM9A 2K3BA 1K4US 1ZUUA 1PRLC 2JS2A 3VS3A 4RTUA 1GCQA 3PE0A 1WXBA 2CUBA 1UDLA 2DL8A 2C0TA 1NYFA 1WX6A 2O31A 1AWWA 1UHCA 1CSKA 1U06A 2L2PA 1HJDA 2DYBA 4CC7A 2IIMA 2JTEA 1IO6A 1GRIA 1X2KA 3EHRA 5ECAA 1QLYA 3M0RA 2NUZA 1WFWA 1QWEA 2DE0X 2W0ZA 2HDAA 2SEMA 2X3XD 1A0NB 1U3OA 1NLOC 1AZGB 3TSWA 1BB9A 4LNPA 2FRYA 2RPNA 1ZBJA 1I1JA 3RNJA 2KT1A 1M3AA 1GBQA 5IHKA 1ZUYA 1G83A 2KRMA 4OMMA 1UFFA 3TSZA 2V1RA 1OPLA 1UECA 1GFCA 2J7IA 2RN8A 2BZ8A 4HXJA 2EGCA 3UF4A 4RTXA 1M27C 2GQIA 2RMOA 4Y92A 2O88A 2LJ3A 4CC4B 2F2VA 2QDLA 2RQRA 1Y0MA 4JZ4A 4D8KA 4FSSA 2CH4W 2AZVA 2YDLA 3ZL7C 2GBQA 1CKBA 1RLPC 2CUDA 1QKXA 1JXOA 1UTIA 3UA7A 1K0XA 1T0JA 2D0NA 2DA9A 1SSHA 1FMKA 1OPKA 2RQUA 2KRSA 2A37A 2J6FA 4J9CA 2E5KA 4AG2C 1JU5C 1JO8A 1SHFA 3I35A 3QWXX 2O9VA 2MIOA 4QT7A 2JMAA 4OMNA 2C0IA 2L3PA 2O9SA 1AWXA 2P4RA 2PTKA 3FJ5A 2LJ0A 2RQWA 1KFZA 1B07A 4WCIA 3R6NA 4IIMA 1UE9A 2ROLA 2J6OA 4A63B 2EPDA 1HSQA 4K11A 4F14A 2FPDA 1YWPA 2V1QA 1MV0B 1M3CA 2F2WA 2DX1A 2KROA 3PVQA 3SEMA 1NG2A 2AKLA 4J9GA 1BBZA 2DL5A 2J06A 2BZYA 3SHWA 4J9FA 2DLPA 2FPEA 2FO0A 4F16A 2HCKA 2OAWA 3VS0A 1GCPA 2OI3A 1PKTA 1EFNA 2KXCA 2YT6A 1S1NA 1YCSB 2ED1A 2B86A 2MCNA 3JV3A 2EYZA 1I07A 2EGAA 5IH2A 2X3WD 2CH4A 3REAB 4J9EA 4OMLA 1KSWA 2KT8A 1X6BA 2C0OA 4RTZA 4ZNXA 4HVWA 1NYGA 3M0PA 1WXUA 3THKA 2KNBB 2KGTA 4RUGA 2JM8A 1BK2A 2VWFA 1UG1A 2K9GA 4GLMA 2D8HA 1WLPB 5FWCA 1V1CA 2EBPA 1SPKA 3H41A 2BTTA 2YUNA 4DEYA 2DRKA 2DNUA 2GGRA 3VS6A 4RTYA 1ABQA 2EYYA 2SRCA 2YUPA 2LZ6B 4AFQC 2ESWA 3CQTA 3LH5A 3QWYA 1ZLMA 2LQNA 1T3SA 3EG1A 1ZSGA 2EYXA 1PKSA 2CT4A 2KBTA 4JJCA 3VS1A 4EIKA 1K9AA 1XOVA 3NGPA 1YNZA 2KXDA 2YSQA 1Y57A 2I0NA 3M0SA 3M0TA 3VS5A 3A98A 1NEBA 2K6DA 4AFUC 4OMPA 1CKAA 2FRWA 1QKWA 5EC7A 1AOJA 1AZEA 1AEYA 3M0QA 3M0UA 5IXBA 1PWTA 1YWOA 1I0CA 1WXTA 2GTJA 3NMZC 2D8JA 2L3QA 3TVTA 3C0CA 1TUCA 4M4ZA 1WYXA 2RNAA 1K1ZA 4ORZA 3NPFA 2ED0A 4X1VA 4JPBW 1T0HA 1J3TA 2KYMA 2HEQA 4D8DA 2EGEA 2LP5A 2HBWA 4LUDA 1TG0A 1ARKA 1KJWA 1SRMA 1SRLA 1X2QA 2JT4A 4R0KA 1PRMC 2L0AA 3I5RA 1WIEA 2FG0A 2JS0A 1YP5A 2DL7A 1AWJA 1JXMA 5I11A 4HVUA 2AKKA 4LUEA 1RUWA 3VS7A 1ZX6A 1H92A 2EKHA 3GBQA 2LJ1A 4JJBA 5IHIA 2CT3A 3IQLA 5IHNA 3VRZA 3PVLA 1WDXA 2FEIA 3O5ZA 4OMOA 4J9IA 1RLQC 4KRTA 4IIOA 1ABOA 2O2OA 4JZ3A 1OOTA 3U23A 4DEXA 4CC2A 2ABLA 4LN2A 4AFSC 1W70A 4ESRA 2EQIA 1NM7A 2PNIA 5HCKA 2LCSA 3EG0A 2CREA 1E6GA 2DM1A 4RTTA 2OJ2A 2K2MA 2VKNA 3ULRB 3REBB 1H3HA 4HVVA 1UUEA 1VA7A 1E6HA 1MUZA 2PZ1A 2F2XA 2EW3A 1PHTA 1VYTA 4AFZC 1Z9ZA 4Z89A 1Z9QA 2RF0A 2DBKA 3EGUA 1SEMA 4LE9A 4RTWA 5L23A 3RBBB 4OMQA 5I22A 1UGVA 2DL4A 1GBRA 2HSPA 1K0SA 1N5ZA 3UATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTO A;  2RQV A;  2KEA A;  1YN8 A;  3H0I A;  4J9D A;  1GL5 A;  1NEG A;  4F17 A;  1OEB A;  1U5S A;  1UJ0 A;  2JMC A;  2G6F X;  1UJY A;  2GNC A;  5FWB A;  4CC3 A;  1SHG A;  1W1F A;  4E6R A;  2CSQ A;  2KYB A;  1X43 A;  2LNH B;  1FYN A;  1M8M A;  1X6G A;  3I5S A;  1VYV A;  3EHQ A;  5FW9 A;  1H8K A;  2CSI A;  1ZUK A;  1G2B A;  1T3L A;  2ENM A;  1PNJ A;  3VS4 A;  2A28 A;  2W10 A;  2EVR A;  2LX7 A;  1JQQ A;  1B3Q A;  1K76 A;  3EG3 A;  2KRN A;  2ECZ A;  2DMO A;  3EG2 A;  2JW4 A;  2H8H A;  2XMF A;  1M3B A;  2MOX A;  2J6K A;  3VS2 A;  2DL3 A;  1AD5 A;  1AVZ C;  2YUO A;  1TUD A;  2M51 A;  4JJD A;  3NHN A;  3VRY A;  2A36 A;  1WI7 A;  3UA6 A;  2BZX A;  4J9H A;  1KIK A;  2D1X A;  1MV3 A;  4Z88 A;  1VYU A;  2K79 A;  2K7A A;  1GCQ C;  4HCK A;  2ROT A;  1NLP C;  1X27 A;  2NWM A;  5GJV B;  2J05 A;  5IXF A;  2LQW A;  2DRM A;  2RQT A;  2L3S A;  1UHF A;  1LCK A;  1W6X A;  2YUQ A;  3H0F A;  2VVK A;  1OV3 A;  2A08 A;  1JEG A;  2AZS A;  3KFV A;  3I9Q A;  1M30 A;  1E7O A;  2EYW A;  1AWO A;  1BU1 A;  2FPF A;  4AG1 C;  1QWF A;  1HD3 A;  1X69 A;  4RTV A;  2DVJ A;  2KE9 A;  2KR3 A;  1GFD A;  2AK5 A;  2DJQ A;  2CDT A;  2LMJ A;  2M0Y A;  5GJW B;  1WA7 A;  1RI9 A;  2JXB A;  4J9B A;  2DF6 A;  1QCF A;  3H0H A;  2DBM A;  4GBQ A;  2DIL A;  4Z8A A;  2JM9 A;  2K3B A;  1K4U S;  1ZUU A;  1PRL C;  2JS2 A;  3VS3 A;  4RTU A;  1GCQ A;  3PE0 A;  1WXB A;  2CUB A;  1UDL A;  2DL8 A;  2C0T A;  1NYF A;  1WX6 A;  2O31 A;  1AWW A;  1UHC A;  1CSK A;  1U06 A;  2L2P A;  1HJD A;  2DYB A;  4CC7 A;  2IIM A;  2JTE A;  1IO6 A;  1GRI A;  1X2K A;  3EHR A;  5ECA A;  1QLY A;  3M0R A;  2NUZ A;  1WFW A;  1QWE A;  2DE0 X;  2W0Z A;  2HDA A;  2SEM A;  2X3X D;  1A0N B;  1U3O A;  1NLO C;  1AZG B;  3TSW A;  1BB9 A;  4LNP A;  2FRY A;  2RPN A;  1ZBJ A;  1I1J A;  3RNJ A;  2KT1 A;  1M3A A;  1GBQ A;  5IHK A;  1ZUY A;  1G83 A;  2KRM A;  4OMM A;  1UFF A;  3TSZ A;  2V1R A;  1OPL A;  1UEC A;  1GFC A;  2J7I A;  2RN8 A;  2BZ8 A;  4HXJ A;  2EGC A;  3UF4 A;  4RTX A;  1M27 C;  2GQI A;  2RMO A;  4Y92 A;  2O88 A;  2LJ3 A;  4CC4 B;  2F2V A;  2QDL A;  2RQR A;  1Y0M A;  4JZ4 A;  4D8K A;  4FSS A;  2CH4 W;  2AZV A;  2YDL A;  3ZL7 C;  2GBQ A;  1CKB A;  1RLP C;  2CUD A;  1QKX A;  1JXO A;  1UTI A;  3UA7 A;  1K0X A;  1T0J A;  2D0N A;  2DA9 A;  1SSH A;  1FMK A;  1OPK A;  2RQU A;  2KRS A;  2A37 A;  2J6F A;  4J9C A;  2E5K A;  4AG2 C;  1JU5 C;  1JO8 A;  1SHF A;  3I35 A;  3QWX X;  2O9V A;  2MIO A;  4QT7 A;  2JMA A;  4OMN A;  2C0I A;  2L3P A;  2O9S A;  1AWX A;  2P4R A;  2PTK A;  3FJ5 A;  2LJ0 A;  2RQW A;  1KFZ A;  1B07 A;  4WCI A;  3R6N A;  4IIM A;  1UE9 A;  2ROL A;  2J6O A;  4A63 B;  2EPD A;  1HSQ A;  4K11 A;  4F14 A;  2FPD A;  1YWP A;  2V1Q A;  1MV0 B;  1M3C A;  2F2W A;  2DX1 A;  2KRO A;  3PVQ A;  3SEM A;  1NG2 A;  2AKL A;  4J9G A;  1BBZ A;  2DL5 A;  2J06 A;  2BZY A;  3SHW A;  4J9F A;  2DLP A;  2FPE A;  2FO0 A;  4F16 A;  2HCK A;  2OAW A;  3VS0 A;  1GCP A;  2OI3 A;  1PKT A;  1EFN A;  2KXC A;  2YT6 A;  1S1N A;  1YCS B;  2ED1 A;  2B86 A;  2MCN A;  3JV3 A;  2EYZ A;  1I07 A;  2EGA A;  5IH2 A;  2X3W D;  2CH4 A;  3REA B;  4J9E A;  4OML A;  1KSW A;  2KT8 A;  1X6B A;  2C0O A;  4RTZ A;  4ZNX A;  4HVW A;  1NYG A;  3M0P A;  1WXU A;  3THK A;  2KNB B;  2KGT A;  4RUG A;  2JM8 A;  1BK2 A;  2VWF A;  1UG1 A;  2K9G A;  4GLM A;  2D8H A;  1WLP B;  5FWC A;  1V1C A;  2EBP A;  1SPK A;  3H41 A;  2BTT A;  2YUN A;  4DEY A;  2DRK A;  2DNU A;  2GGR A;  3VS6 A;  4RTY A;  1ABQ A;  2EYY A;  2SRC A;  2YUP A;  2LZ6 B;  4AFQ C;  2ESW A;  3CQT A;  3LH5 A;  3QWY A;  1ZLM A;  2LQN A;  1T3S A;  3EG1 A;  1ZSG A;  2EYX A;  1PKS A;  2CT4 A;  2KBT A;  4JJC A;  3VS1 A;  4EIK A;  1K9A A;  1XOV A;  3NGP A;  1YNZ A;  2KXD A;  2YSQ A;  1Y57 A;  2I0N A;  3M0S A;  3M0T A;  3VS5 A;  3A98 A;  1NEB A;  2K6D A;  4AFU C;  4OMP A;  1CKA A;  2FRW A;  1QKW A;  5EC7 A;  1AOJ A;  1AZE A;  1AEY A;  3M0Q A;  3M0U A;  5IXB A;  1PWT A;  1YWO A;  1I0C A;  1WXT A;  2GTJ A;  3NMZ C;  2D8J A;  2L3Q A;  3TVT A;  3C0C A;  1TUC A;  4M4Z A;  1WYX A;  2RNA A;  1K1Z A;  4ORZ A;  3NPF A;  2ED0 A;  4X1V A;  4JPB W;  1T0H A;  1J3T A;  2KYM A;  2HEQ A;  4D8D A;  2EGE A;  2LP5 A;  2HBW A;  4LUD A;  1TG0 A;  1ARK A;  1KJW A;  1SRM A;  1SRL A;  1X2Q A;  2JT4 A;  4R0K A;  1PRM C;  2L0A A;  3I5R A;  1WIE A;  2FG0 A;  2JS0 A;  1YP5 A;  2DL7 A;  1AWJ A;  1JXM A;  5I11 A;  4HVU A;  2AKK A;  4LUE A;  1RUW A;  3VS7 A;  1ZX6 A;  1H92 A;  2EKH A;  3GBQ A;  2LJ1 A;  4JJB A;  5IHI A;  2CT3 A;  3IQL A;  5IHN A;  3VRZ A;  3PVL A;  1WDX A;  2FEI A;  3O5Z A;  4OMO A;  4J9I A;  1RLQ C;  4KRT A;  4IIO A;  1ABO A;  2O2O A;  4JZ3 A;  1OOT A;  3U23 A;  4DEX A;  4CC2 A;  2ABL A;  4LN2 A;  4AFS C;  1W70 A;  4ESR A;  2EQI A;  1NM7 A;  2PNI A;  5HCK A;  2LCS A;  3EG0 A;  2CRE A;  1E6G A;  2DM1 A;  4RTT A;  2OJ2 A;  2K2M A;  2VKN A;  3ULR B;  3REB B;  1H3H A;  4HVV A;  1UUE A;  1VA7 A;  1E6H A;  1MUZ A;  2PZ1 A;  2F2X A;  2EW3 A;  1PHT A;  1VYT A;  4AFZ C;  1Z9Z A;  4Z89 A;  1Z9Q A;  2RF0 A;  2DBK A;  3EGU A;  1SEM A;  4LE9 A;  4RTW A;  5L23 A;  3RBB B;  4OMQ A;  5I22 A;  1UGV A;  2DL4 A;  1GBR A;  2HSP A;  1K0S A;  1N5Z A;  3UAT A; 
#chains in the Genus database with same CATH topology
 4C92 B;  1SSF A;  3LGF A;  1U5S A;  3NTH A;  1VQ7 A;  3QZ9 B;  4HT9 A;  2KI7 A;  1SHG A;  2A7Y A;  3G7Z A;  3X26 B;  1X43 A;  2MK5 A;  5A0L A;  2E6Z A;  4N0A A;  2RHX A;  1VYV A;  2IG0 A;  4OF1 A;  2VXE A;  1D0X A;  1H8K A;  2Y4Y A;  3CCM T;  1ZUK A;  3FJP A;  2F5K A;  2PU9 B;  2DEU A;  3S3M A;  4EDU A;  1BI0 A;  1OU8 A;  1T3L A;  2HZY A;  3E9G A;  1F1B B;  2F69 A;  2A28 A;  2QGF B;  2V8K A;  2EVR A;  4F7U E;  1FWZ A;  3OYD A;  1D1B A;  2GF7 A;  4BI8 B;  5LJ5 h;  1YI2 T;  3JB9 D;  3URG A;  5D7U A;  1ACM B;  6AT1 B;  1K73 C;  2MOX A;  2AHJ B;  5CKH A;  1X75 C;  1R8O B;  2PVO B;  4C8Q E;  4LDX A;  3RKW A;  2DXB A;  1V29 B;  2DL3 A;  3HFN A;  2DZ9 A;  2K5F A;  2KMT A;  4M7D E;  1TUD A;  3JCM b;  2BE7 D;  2M51 A;  3CC2 Q;  5LJ5 j;  1WI7 A;  1Q7Y R;  4J9H A;  4C0D B;  2D1X A;  3I56 T;  1MV3 A;  3J7A F;  2K79 A;  2K7A A;  1Q95 G;  2M02 A;  1GCQ C;  4HKE A;  1Y96 A;  2ROT A;  2QEX Q;  2NWM A;  2RQT A;  4LDW A;  1RAA B;  2YUQ A;  3A5Z B;  2QYZ A;  3R6O A;  2A08 A;  4E7L A;  3WVD B;  1VQ6 A;  3E9F A;  3I9Q A;  1M30 A;  2L89 A;  2QK0 A;  3G71 A;  2PUK B;  2RO0 A;  1ZSZ C;  1BU1 A;  5CQY A;  1C1A A;  4AG1 C;  2VXF A;  4RTV A;  4M7A F;  3HPW A;  2A0F B;  2KR3 A;  2DIG A;  3CC4 Q;  2DJQ A;  2CDT A;  1WA7 A;  2L3R A;  4PLI A;  2RHU A;  2NUP B;  2JXB A;  1LPL A;  2DF6 A;  2DBM A;  1D1A A;  2YLB A;  5CKB A;  4JDS A;  2CS7 A;  1ZUU A;  2EQJ A;  1I8F A;  4RTU A;  2DKG A;  4ELZ C;  4M78 D;  4BUG A;  4A4H A;  2MF2 A;  3SWN A;  4PJO D;  1Q81 R;  2ZPI B;  2P84 A;  2GCX A;  3EFS A;  1M1K R;  1YI2 A;  1WX6 A;  2CP2 A;  2NYS A;  5LJ5 e;  3ASK A;  4DBF A;  1WNL A;  1CSK A;  1HJD A;  2LCL A;  2MYS A;  1BCM A;  2R58 A;  2JTE A;  4PK4 A;  5J26 A;  1X2K A;  3EHR A;  5ECA A;  4BY6 C;  5KYX A;  3CCL T;  2YXY A;  1KHI A;  2W0Z A;  2HDA A;  1M4Z A;  1QCN A;  1A0N B;  2RJE A;  3EAE A;  5GAN 7;  1BB9 A;  4LNP A;  2K4Y A;  4C8Q C;  3CD6 T;  3EGD B;  3RNJ A;  4PFZ A;  2OTL A;  1G83 A;  2LCC A;  3L2Z A;  2K3Y A;  1OPL A;  2HQX A;  1NZ9 A;  1UEC A;  1R0C B;  4A53 A;  4HXJ A;  1TOV A;  3CPW P;  1M27 C;  2RMO A;  2VYT A;  2FL7 A;  2O88 A;  4HCC A;  4J6W A;  1X01 A;  3GLX A;  1Y0M A;  2KDS A;  4B9X A;  4BE0 A;  2EAY A;  5GAN e;  4JZ4 A;  4J5Y A;  4D8K A;  2Y90 A;  2ZPE B;  2AZV A;  4M77 B;  1CKB A;  1RLP C;  1YIT Q;  4EMK B;  2CUD A;  1QKX A;  3MHX A;  2CGH A;  1UTI A;  5IN1 A;  4E2F B;  2AT1 B;  2D0N A;  1SSH A;  1FMK A;  5KCH A;  2Y4X A;  2J6F A;  3GPL A;  4C5H A;  1WZO A;  2V8J A;  3I35 A;  1BI2 A;  3QWX X;  2MIO A;  2RM4 A;  3V7C A;  3C95 A;  4QT7 A;  3L2W A;  4QKU A;  5FRM A;  4M7A D;  2PTK A;  5GAN f;  3CC7 T;  3ZEH A;  3PIP A;  3R6N A;  1KQS S;  3CC4 A;  3MO8 A;  4IIM A;  1EZZ B;  4QVZ A;  2O4X B;  1KD1 C;  3BDL A;  4FU6 A;  4LDV A;  2J6O A;  1Q81 C;  3VKI A;  3CD6 A;  1NPR A;  3CMA T;  2RK1 A;  1I5O B;  3TCJ A;  4F14 A;  4Q5W A;  1QVP A;  2ZPF B;  2CP3 A;  2EJG A;  1NG2 A;  2AKL A;  3TQ7 P;  4HCZ A;  1VQ5 Q;  1YJN T;  4QQD A;  1VQK T;  2BZY A;  1UGP B;  2DLP A;  2FO0 A;  2JOY A;  1PKT A;  1S1N A;  1YCS B;  2QQ9 A;  3EG9 B;  1WHL A;  1GXI E;  3RIR A;  3P8H A;  2DK3 A;  5LJ5 f;  3C4S A;  1KSW A;  2PVD B;  4OB3 B;  2C0O A;  4ZNX A;  1NYG A;  5GMK i;  1FXX A;  2ATC B;  3QII A;  3RKY A;  2VWF A;  3JCM V;  4B6M A;  4MDX A;  2L5Q A;  4BI4 A;  2K9G A;  3H41 A;  1H64 1;  1FMV A;  3OYY A;  2DNU A;  2GGR A;  4RTY A;  2D9T A;  3OYK A;  1G5V A;  4AFQ C;  2OX7 A;  3LH5 A;  4BE2 A;  2LQN A;  3EG1 A;  2EYX A;  4JJC A;  4M7A A;  4XTZ A;  5KYU B;  1QVF P;  1I81 A;  1K9A A;  2YSQ A;  3P8B B;  1KQ2 A;  2K6D A;  1U1T A;  1CKA A;  2LTO A;  4OMP A;  5GAN j;  5EC7 A;  2LC4 A;  2FYK A;  2X4X A;  3H9N A;  3SD4 A;  3CXC S;  3CCR A;  1AEY A;  3M0U A;  1D3B A;  3KBG A;  3HHT B;  3OYA A;  1Y7X A;  2GFU A;  2JN0 A;  1VQ5 A;  2MMP A;  4M4Z A;  4J6X A;  1QCO A;  1K1Z A;  2QGG A;  4C92 A;  2FZK B;  2ZCF B;  1OX8 A;  4X1V A;  3UWN A;  4MZM A;  1YJN Q;  4PJO F;  4D8D A;  2RD1 A;  2FZC B;  2LQ8 A;  1ARK A;  2EQK A;  2RHY A;  1X2Q A;  2JT4 A;  4R0K A;  2L0A A;  1WIE A;  1OX9 A;  1YP5 A;  2CKK A;  4HVU A;  2XK0 A;  4HT8 A;  3VS7 A;  3CCE A;  2QA4 T;  2DAQ A;  1H92 A;  4O6J A;  5I2S A;  2CT3 A;  1MND A;  4OVA A;  1OU9 A;  4J9I A;  1RLQ C;  3MEV A;  1D0Z A;  2CP6 A;  2C06 A;  1VQK Q;  3U23 A;  1OOT A;  4DEX A;  2QTX A;  4HCB A;  4M7A C;  4M78 E;  2LDM A;  4LN2 A;  3CBP A;  1K9M U;  2EQI A;  2V26 A;  1NM7 A;  3AT1 B;  5HCK A;  2CRE A;  1WJQ A;  1N8R R;  5GMK j;  3REB B;  1H3H A;  5DY9 A;  1UUE A;  1MMA A;  2OTJ A;  1VQ8 Q;  4DQ2 A;  3G6E Q;  1VQ9 T;  2F2X A;  3LH0 A;  3N5B B;  4PLL A;  1VYT A;  1X6O A;  4AFZ C;  4Z89 A;  1W2B A;  1Z9Q A;  2DIQ A;  3TRE A;  1KD1 U;  4M77 E;  3RBB B;  4L5G A;  2OTJ T;  1UGV A;  1VQ5 T;  1N5Z A;  3UAT A;  4PJO E;  2GTO A;  2ZGW A;  2RQV A;  1ZQ1 A;  3H0I A;  4J9D A;  2HQE A;  1NEG A;  4F17 A;  1VQN A;  3QZ5 B;  1YBY A;  4C5E A;  1UJY A;  1BI3 A;  5D6X A;  4M75 E;  1VIF A;  4CC3 A;  1W1F A;  4E6R A;  2KYB A;  1SKU B;  3CCM A;  1M8M A;  1R77 A;  1X6G A;  3QJY A;  1PCX A;  4C8Q D;  3C94 A;  3EHQ A;  5AYF A;  4E7Z A;  2QXF A;  1QQJ A;  4OB0 B;  4ZN3 A;  3OS2 A;  2F1L A;  2ENM A;  2KK4 A;  2LX7 A;  4A4G A;  1TTH B;  1B3Q A;  4JLG A;  3GOX A;  3LWI A;  5GAM h;  4L6V 5;  5FU7 C;  2ECZ A;  2DMO A;  3RR6 A;  3MP6 A;  3SWN B;  2O01 E;  5GAN g;  3LWH A;  2QA4 A;  4PJO C;  4N4G A;  1AVZ C;  2BE9 B;  1YHQ T;  2BZX A;  1UEB A;  1TH7 A;  1VYU A;  1M2V B;  4MDW A;  1PSE A;  1NJI U;  1X27 A;  3JCM Q;  4A54 A;  4F7U A;  5KYY B;  5IXF A;  3A8L B;  2EJ9 A;  5FRN A;  2VGN A;  3CBM A;  2HMA A;  3M55 A;  1UGR B;  4PKC C;  3M53 A;  1OV3 A;  4M7D G;  2AZS A;  3QJ6 A;  3QXE B;  1QWF A;  5CO7 A;  4DA4 A;  5AT1 B;  2DFU A;  2KE9 A;  1WHG A;  3QBY A;  4RG2 A;  5GJW B;  2NUT B;  1HYO A;  1RI9 A;  3EGD A;  1QCF A;  4GBQ A;  4Z8A A;  3X28 B;  2JM9 A;  4FSX A;  1TWB A;  3PTA A;  1K4U S;  2KVQ G;  2JS2 A;  5GAM j;  3JCM e;  1GCQ A;  2CUB A;  2DXC A;  4AMC A;  4E7H A;  2JTM A;  4EMG A;  1UDL A;  1V76 A;  1WJR A;  2DL8 A;  2QI2 A;  5A0D A;  4J7F A;  1B34 A;  1G3Y A;  5D6Y A;  3FEO A;  4F7U F;  3FDR A;  2H3J A;  1AWW A;  4IUU A;  1U06 A;  3J81 E;  1VQP Q;  1WHM A;  1Q81 U;  5FU6 C;  3QHS A;  4Z02 A;  3JCM c;  1M1G A;  2IIM A;  2RA2 A;  1M5Q 1;  1GRI A;  3BFM A;  3M0R A;  1FMW A;  1NJI C;  2QAS A;  1WFW A;  1VQL Q;  1NLO C;  1AZG B;  4P5N A;  2NLU A;  3JB9 F;  2EWN A;  4DOW A;  1YFN A;  2FRY A;  1N9S A;  4UC4 A;  1ZBJ A;  1C0M A;  3G6E A;  4Y28 E;  5IHK A;  5LJ3 g;  1ZUY A;  4II1 A;  4OMM A;  4JJN K;  2V1R A;  1QW1 A;  2J7I A;  1NBE B;  3DB4 A;  3E1S A;  1YI2 Q;  3UF4 A;  1LVK A;  3A8M B;  4PL6 A;  3EGX A;  4C92 E;  5CCA A;  4LD9 K;  2RQR A;  2RB6 A;  5KYU A;  1QVF A;  3LLR A;  4FSS A;  4WF2 A;  2CH4 W;  4M78 F;  5GAN 8;  3ZL7 C;  1Q82 R;  2LX9 A;  2GBQ A;  2EFI A;  1YJ9 Q;  3GNF B;  1KC8 U;  4E7S A;  3UA7 A;  3CCE Q;  1K0X A;  2DA9 A;  4M75 C;  1OPK A;  2RQU A;  4FT2 A;  2V8I A;  4CRI A;  5GAO m;  5IT9 E;  5CAI A;  2HBP A;  1JU5 C;  1UGS B;  1WHH A;  3PIO A;  3KUF A;  4OB2 B;  3C12 A;  2E65 A;  1K9M C;  4ZN1 A;  2PUO B;  2JMA A;  2L3P A;  1YJ9 A;  2CP5 A;  2GFA A;  2P4R A;  5CIU A;  1RAE B;  1WPY A;  1IGQ A;  1LNX A;  3PMI A;  4XTW A;  3QYG B;  1VQM T;  1Y71 A;  2X35 A;  1PC0 A;  3OYL A;  1K8A C;  3M4Y A;  1N6A A;  4GLK A;  4A4K A;  1HSQ A;  5KYW B;  1BYM A;  2AIR B;  2FPD A;  1KHC A;  2COY A;  2RI2 A;  1MV0 B;  2V1Q A;  4JUV A;  3OBY A;  4M77 A;  5FRO A;  2KRO A;  2E64 A;  3PVQ A;  2VC8 A;  1RL2 A;  3CCV A;  4M78 B;  1IRE B;  1BBZ A;  4IUV A;  4JS4 A;  2J06 A;  2DPP B;  3ME9 A;  4TVR A;  4ME7 A;  5L8R E;  8ATC B;  1TXQ A;  3MET A;  2Z0W A;  4LD6 A;  2KXC A;  4R55 A;  1WJS A;  1D0Y A;  4EPC A;  2FHD A;  2B86 A;  3BY7 A;  1VQ8 T;  2MCN A;  2EYZ A;  5KYY A;  1I07 A;  2EGA A;  4JRK A;  3CME T;  2X3W D;  1AHJ B;  3REA B;  5LJ5 d;  4N4I A;  3CCE T;  2KT8 A;  3HL8 A;  4RTZ A;  2P0Q A;  4HVW A;  5GAN 6;  3M0P A;  2E70 A;  1O9S A;  3ER0 A;  5A0G A;  2KNB B;  5GMK h;  2JM8 A;  1K73 U;  1LJO A;  5DLQ E;  3OYM A;  1W2B S;  4MZP A;  2VUB A;  1V1C A;  2EBP A;  1SPK A;  5I2M A;  2I2L A;  2BTT A;  2YUN A;  5EG2 A;  2QA4 Q;  4DEY A;  1WHK A;  2ESW A;  2QQS A;  4WTO B;  1YJ9 T;  1M1K C;  3RER A;  5LJ3 j;  1ZSG A;  4ANJ A;  2HAX A;  4DBR A;  1PKS A;  4M7D C;  4EIK A;  2XKO C;  1KD1 R;  3A8O B;  2CZ1 B;  1BCO A;  2LQK A;  1BIA A;  1Y57 A;  3VS5 A;  2QG9 B;  1NEB A;  3EGX B;  3OW2 P;  2RH2 A;  4AFU C;  4DBH A;  2FRW A;  1QKW A;  1P92 A;  5IXB A;  1PWT A;  1I0C A;  1WXT A;  4A4F A;  1WGS A;  2GTJ A;  3CCQ Q;  1RAB B;  3CC4 T;  2D8J A;  2HNI A;  2L3Q A;  1VQM Q;  1YIJ A;  4C8Q A;  1UGQ B;  3I56 Q;  3OA6 A;  4ORZ A;  3RMS A;  3NPF A;  2DJZ A;  3JB9 J;  3CBO A;  3OYB A;  2HBW A;  1TG0 A;  4KH1 B;  2FB7 A;  3OYC A;  1KJW A;  3HRS A;  1IHV A;  1PRM C;  3I5R A;  2KQW A;  2P4T A;  5I11 A;  2AKK A;  4LUE A;  5GAM d;  3CCQ T;  1ZX6 A;  5KE2 A;  3GBQ A;  4QW2 A;  5IHN A;  1WDX A;  3FLG A;  3QPH A;  4PFP A;  3M54 A;  4IIO A;  3AHU A;  1IXD A;  2O2O A;  2KAF A;  1RAG B;  5IAY A;  4FYY B;  4ESR A;  3EFO B;  3MPU B;  2LCS A;  4BAC A;  3EG0 A;  1E6G A;  5GAM f;  2OJ2 A;  4NS5 A;  4D6W A;  2K5L A;  1NJI R;  2DET A;  1K9M R;  7AT1 B;  2PZ1 A;  1MHN A;  3GP8 A;  3OW2 A;  3DKM A;  3PNW C;  2WSC E;  4KUI A;  3HKS A;  2COW A;  1N8R U;  3JRZ A;  1VQO T;  3LW5 E;  3CCJ Q;  4BE1 A;  2DBK A;  3EGU A;  4C0Z A;  2CP7 A;  2X4J A;  2DL4 A;  3RMQ A;  1YHQ A;  2E3H A;  1B7T A;  1GBR A;  9ATC B;  2WAC A;  4C92 C;  3VUZ A;  1YN8 A;  1GL5 A;  3G71 Q;  3OS1 A;  1ZA2 B;  3HSB A;  4C92 F;  3OB9 A;  4OB1 B;  5FWB A;  3RKX A;  3X20 B;  2QQB A;  2EQM A;  3T9N A;  1M2V A;  2LNH B;  3I5S A;  4MMK A;  3HRU A;  2DZC A;  3OQ5 A;  1YHQ Q;  3V8K A;  3CCM Q;  1YIJ T;  2M0O A;  2M9U A;  2CSI A;  3HTR A;  5LJ3 e;  3JCM d;  5KCO A;  2R5A A;  1VQN Q;  3OW2 S;  3V7S A;  4BDZ A;  1K76 A;  3EG3 A;  3VV0 A;  3OS0 A;  3JCM W;  2KRN A;  3H6Z A;  1G3S A;  2HSE B;  3EG2 A;  2JW4 A;  1IHW A;  5HY6 A;  4F7U B;  2J6K A;  1B34 B;  3CCQ A;  1YIT T;  4C5I A;  4OGC A;  5LJ3 d;  2ZPH B;  4NL2 A;  3L42 A;  4FM4 B;  1AD5 A;  1MMN A;  2QTV A;  3X25 B;  4M7D D;  1G8X A;  1PD1 A;  4JJD A;  2OTJ Q;  1TS9 A;  3A1P A;  1C6V X;  1QVF S;  2A36 A;  4EMH A;  1KIK A;  3UA6 A;  4C0D C;  4Z88 A;  2DYI A;  3JSC A;  2ZPG B;  3CME Q;  3G6E T;  4R56 A;  2YRD A;  4O5V A;  1YCY A;  5GJV B;  1AT1 B;  2LQW A;  2L3S A;  1UHF A;  1W6X A;  2QAZ A;  3V8L A;  2NUT A;  3H0F A;  4ZGJ B;  2VVK A;  3JCM J;  4JRI A;  1M9S A;  4A4E A;  1MGQ A;  3A8H B;  2FVU A;  1E7O A;  2EYW A;  1AWO A;  1ZSZ B;  4ZGE B;  2FPF A;  4GY5 A;  2XD0 A;  4KBM B;  3CPW A;  2HKQ B;  3D7S B;  1X69 A;  3LYI A;  3BDU A;  4OP0 A;  1GFD A;  4BB7 A;  2LMJ A;  4MZT A;  1BIB A;  2M0Y A;  3ZBD A;  4ATO A;  1RAH B;  2KY9 A;  1Q86 U;  3H0H A;  3WVE B;  3L2V A;  2VGM A;  4IUR A;  1M90 R;  1PRL C;  4M78 A;  3QG1 A;  3PGG A;  2CP0 A;  2XHC A;  2FZG B;  1VOM A;  4F04 B;  3UT1 A;  1RAD B;  4LDU A;  2C0T A;  3OYG A;  1VQL T;  4LXC A;  3JB9 H;  3QDR B;  2QEX A;  2RI5 A;  3TU4 K;  3I55 Q;  2O31 A;  4C5G A;  1UHC A;  3J80 E;  1Y96 B;  2DYB A;  4CC7 A;  1KC8 C;  2EIF A;  2CZ7 B;  2HD0 A;  1IO6 A;  4BY6 B;  4M78 G;  1OYX A;  3JCM g;  5DLO A;  2DE0 X;  1QWE A;  2ZZD A;  3PFS A;  5CVI A;  4C8Q B;  1YIT A;  2JVV A;  5J39 A;  1Q86 R;  1S72 Q;  4RCB A;  1I1J A;  1OZ2 A;  5CKF A;  3M59 A;  4M75 F;  1GBQ A;  3GNG A;  2KRM A;  1UFF A;  3NFC A;  3UPU A;  2RN8 A;  3CCU Q;  3QSU A;  2EGC A;  1WQ7 A;  4RTX A;  1VQN T;  4J7I A;  4Y92 A;  1VQ7 T;  2LJ3 A;  5LJ3 h;  4PJO G;  3L1A A;  3CCV Q;  1ZSZ A;  1WQW A;  3ZFJ A;  2MI6 A;  3CC7 A;  4M77 C;  1DJ7 B;  3QUI A;  4EMK C;  1VQO Q;  1Q7Y U;  4XU3 A;  1JXO A;  1VQ7 Q;  1T0J A;  4QQ6 A;  2KRS A;  2A37 A;  3OYH A;  2RHI A;  2E5K A;  3JAM E;  1JO8 A;  3EFO A;  1SHF A;  1QVG S;  2EKO A;  1JJ2 A;  5C0M A;  2YWW A;  2ZAE A;  4OMN A;  1AWX A;  4C8Q F;  3FJ5 A;  3CCS T;  3WXM B;  2LT4 A;  3QYH B;  4XU1 A;  2ROL A;  1XTD A;  3CEY A;  2DTH A;  1VQL A;  4A63 B;  1SF9 A;  3FC3 A;  4KGV B;  4PJL A;  1M3C A;  4XAX B;  1D09 B;  2CZ6 B;  3MEA A;  3MEW A;  4M7A E;  3SEM A;  3CC2 T;  5KE3 A;  3LGL A;  2P0P A;  3M4G A;  2DL5 A;  1M8V A;  3SHW A;  1U8R A;  4FW1 A;  4J9F A;  4JRP A;  4F16 A;  2HCK A;  2OAW A;  1GCP A;  2OI3 A;  4V2S A;  1EFN A;  1IRX A;  5D6W A;  3QKJ A;  2DO3 A;  2ED1 A;  4DOV A;  1Q86 C;  1G3T A;  3JV3 A;  1VUB A;  2RJC A;  1MNE A;  5IH2 A;  1EX4 A;  2CH4 A;  4F7U G;  2DD4 A;  3A8G B;  4XTU A;  1X6B A;  2K57 A;  4IUQ A;  5KYN A;  2QQR A;  1WXU A;  5A2Q E;  4FYW B;  3THK A;  4KH0 B;  1BI1 A;  4C8Q G;  3M57 A;  1BK2 A;  4IUP A;  4XU2 A;  5GAO r;  4KUL A;  5CQX A;  2JNG A;  5FWC A;  4RG8 A;  2DTI A;  5GAN 4;  3CMA Q;  1K8A R;  2DRK A;  4X34 A;  2LNV A;  2H3E B;  2EYY A;  4RMO A;  1VQ4 Q;  1RAI B;  2K3X A;  2VAS A;  4E7I A;  4KUD K;  2F5T X;  3QWY A;  4E47 A;  1T3S A;  2K2V A;  3L2Q A;  2COZ A;  3GIB A;  1W4S A;  2KBT A;  3VJP A;  3JCM P;  1Q82 C;  2E10 A;  4RKU E;  3M56 A;  1PG5 B;  4XTX A;  1XOV A;  1YJN A;  1OUL A;  1YNZ A;  2KXD A;  2I0N A;  3M0S A;  3M0T A;  2IVW A;  3A98 A;  1Q82 U;  2BIV A;  2RJF A;  4PFO A;  3DLL A;  3QDF A;  5I21 A;  1AOJ A;  1AZE A;  3M0Q A;  3F70 A;  1M1K U;  2NUP A;  2XDP A;  1YWO A;  4IUT A;  3OSS C;  1ZBX A;  1QVG A;  2JZ2 A;  1TUC A;  2DEQ A;  4L59 A;  1OI1 A;  5CK9 A;  3CCJ A;  2E4H A;  4PNO A;  4XTV A;  1J3T A;  1T0H A;  1RI0 A;  3M5A A;  3CC7 Q;  2HEQ A;  2EGE A;  4XK8 E;  2LP5 A;  4FCY A;  2VV5 A;  1SRM A;  4PJJ A;  1TUG B;  1JJ2 P;  1JBM A;  2DL7 A;  1QVG P;  1JXM A;  3PT9 A;  1TU0 B;  3S3N A;  4C92 G;  1KC8 R;  2EKH A;  2LJ1 A;  5IHI A;  3IQL A;  2HKN A;  3VRZ A;  2FEI A;  3O5Z A;  2XIC A;  5CKE A;  3M9Q A;  5LJ3 f;  2EYQ A;  4KRT A;  1JJ2 S;  2QDY B;  3CCS Q;  4KGZ B;  4JZ3 A;  4M7A B;  2R5M A;  3EFR A;  4CC2 A;  2KSS A;  3E19 A;  4AFS C;  1PM3 A;  2BUD A;  1ZHI A;  1N8R C;  3INZ A;  2DM1 A;  4RTT A;  1VQO A;  2D0Q B;  3ULR B;  1RAF B;  2CZ0 B;  4HVV A;  1VQP T;  1VA7 A;  4PJN A;  5GAO p;  3G71 T;  3DLM A;  3JCM X;  2EW3 A;  1PHT A;  3Q1J A;  1XQH A;  3I55 A;  1Q7Y C;  1K8A U;  1ZA1 B;  2RF0 A;  3I56 A;  4LE9 A;  1SEM A;  1FX7 A;  4RTW A;  3TEE A;  4M77 D;  4NL3 A;  5DM7 R;  1K0S A;  1O75 A;  3L2R A;  2KEA A;  5GMK m;  5GMK e;  1OEB A;  1R0B G;  1UJ0 A;  3OMC A;  1M2O A;  2JMC A;  2G6F X;  2GNC A;  5GAM e;  2CSQ A;  1FYN A;  4JRQ A;  3OMG A;  1BKB A;  5FW9 A;  3JCM f;  4DBQ A;  3CCJ T;  1G2B A;  3DB3 A;  1VIE A;  3CXC P;  1PNJ A;  4J6Y A;  3VS4 A;  2W10 A;  1OQK A;  1JQQ A;  3CCU T;  3SDZ A;  1K73 R;  5FU7 B;  2XDB A;  2YHT A;  1KQ1 A;  2H8H A;  2XMF A;  1M3B A;  3JB9 G;  2DER A;  3SWN C;  3X24 B;  4AT1 B;  1TSF A;  3VS2 A;  4XQ3 A;  2E3I A;  2R57 A;  3GF5 A;  1LOJ A;  4PJO B;  2YUO A;  2DTO A;  3NHN A;  3VRY A;  2ZPB B;  1YJW A;  1H3Z A;  4PJO A;  4JS5 A;  3BW1 A;  2WSE E;  4HCK A;  1NLP C;  1KK7 A;  3RES A;  2J05 A;  3NTK A;  1M1F A;  2DRM A;  2X51 A;  4ZGD B;  2M16 A;  1LCK A;  3I55 T;  4CI0 C;  4BD3 A;  2XDD A;  2OTL Q;  3CPF A;  1VQ6 T;  1VQP A;  1JEG A;  1N9R A;  2E41 A;  3KFV A;  4Y91 A;  1MMG A;  3BE3 A;  1EIF A;  3SB2 A;  1HD3 A;  3CME A;  4QVD A;  2DVJ A;  1HK9 A;  2JTF A;  2JJ9 A;  4YTL A;  2AK5 A;  2IPO B;  3S3O A;  1U1S A;  1VQ4 T;  5LJ5 g;  4FYX B;  5GAN 5;  4ZTF A;  3O8V A;  3OBW A;  4J9B A;  2VB6 A;  2DIL A;  2K3B A;  2QQA A;  3CXC A;  1MMD A;  3VS3 A;  4IKF A;  3MKD A;  1WXB A;  3PE0 A;  3M58 A;  4LDY A;  2OAU A;  4OMF B;  1UB4 A;  1NYF A;  3MJX A;  1IZ6 A;  1YJW Q;  2L2P A;  2L8D A;  4XU0 A;  5HK0 A;  1YJW T;  2A3L A;  5FU6 B;  3EH2 A;  3RDV A;  5GAN 3;  1NPP A;  1QLY A;  3G1J A;  4ELY C;  2NUZ A;  3CD6 Q;  2X3X D;  3HFO A;  2SEM A;  1U3O A;  4OGE A;  3TSW A;  1KQS A;  3OS5 A;  3CCR T;  1KQS P;  2MWO A;  3EH1 A;  1W2B P;  4JLI A;  5KH6 A;  1VQ6 Q;  3CCL A;  3OYN A;  2RPN A;  2KT1 A;  2OTL T;  1M3A A;  2JUF A;  2MAM A;  3TSZ A;  1XJW B;  2GQV A;  1OZ3 A;  1GFC A;  2DXT A;  2BZ8 A;  3S6W A;  4B9W A;  5GAO q;  2GQI A;  1G3W A;  2MWP A;  4CC4 B;  3JB9 I;  2F2V A;  2QDL A;  4C92 D;  2XI9 A;  1M90 U;  2YRC A;  1Y07 A;  4E7K A;  3G4S Q;  4BDY A;  3CCL Q;  2YDL A;  1SG5 A;  3MEU A;  1KG1 A;  1PSF A;  5GAN h;  2XID A;  5KYX B;  4M75 B;  1VQM A;  2HL3 A;  4J9C A;  2DD5 A;  4AG2 C;  4HA8 A;  2CYZ B;  2MPX C;  3CPW S;  2O9V A;  3EG9 A;  1VQ4 A;  2YLC A;  3VUB A;  2B8A A;  2C0I A;  1PD0 A;  1I5L A;  2O9S A;  1QP3 A;  4FT4 A;  2LJ0 A;  2RQW A;  3NTI A;  3CCV T;  3FRN A;  1KFZ A;  1B07 A;  4M7D A;  5GMK l;  2RI3 A;  4WCI A;  1NE8 A;  2BKD N;  1UE9 A;  5FLX E;  4M7D F;  4ZTJ A;  3FIF A;  2EPD A;  3L2U A;  4X9D A;  4K11 A;  2EQU A;  1YWP A;  4X9C A;  2F2W A;  4EMK A;  4KGX B;  4BI3 A;  2DX1 A;  4M75 G;  2PVG B;  4PJM A;  2HL5 C;  4J9G A;  4M78 C;  4FW2 A;  3OSV A;  1YIJ Q;  5HK3 A;  2FPE A;  1JB0 E;  3V8J A;  3VS0 A;  2E5Q A;  2YT6 A;  3MP1 A;  3P8D A;  1HXD A;  3OYF A;  3CMA A;  4J8O A;  5M9O A;  2RHZ A;  5C6S A;  3G4S A;  4J9E A;  2XG8 D;  4M7A G;  5GAN 2;  4OML A;  3OY9 A;  3UDC A;  4XTY A;  1D1C A;  1D3B B;  2D6F A;  3OYJ A;  1QP2 A;  5GAO n;  1I4K 1;  5CR2 A;  2KGT A;  4RUG A;  2LT1 A;  8AT1 B;  3LX7 A;  2M1H A;  3JCM h;  1UG1 A;  4GLM A;  2D8H A;  1VQ8 A;  1WLP B;  3FB9 A;  5GAM g;  3H8Z A;  4QQG A;  3VU3 C;  2RJD A;  3VS6 A;  2QEX T;  1ABQ A;  2SRC A;  2YUP A;  5KYW A;  1QMC A;  2LZ6 B;  3CQT A;  2O4X A;  1ZLM A;  1S72 T;  5HKC A;  4M77 F;  4M7D B;  2CT4 A;  3VS1 A;  3CCR Q;  3NGP A;  1VQK A;  4N0A C;  3QO3 A;  2RK2 A;  3OYE A;  2X4Y A;  3CC2 A;  5GAN d;  1JRI A;  4QVC A;  3HP9 A;  2E12 A;  3NMZ C;  5GAO l;  3TVT A;  2DXU A;  4RCC A;  3C0C A;  1WYX A;  2RNA A;  2HQH A;  3HRT A;  2E6N A;  2ED0 A;  3PMT A;  4JPB W;  2KYM A;  3G4S T;  3OYI A;  3KXT A;  2K5I A;  4LUD A;  4FYV B;  3VYG A;  1SRL A;  1IGU A;  3MP8 A;  2FG0 A;  2JS0 A;  5CKD A;  1AWJ A;  1RUW A;  2DVE A;  4E7J A;  1WHJ A;  4J83 A;  3VYH B;  4JJB A;  4C0G A;  3PVL A;  4VUB A;  4C0F A;  4MML A;  4OMO A;  2X9H A;  3MCA B;  4FIB A;  1ABO A;  2WSF E;  4M77 G;  1XNI A;  2ABL A;  2X4W A;  4FL6 A;  5LL6 S;  1W70 A;  2LVM A;  2G3R A;  2PNI A;  1N27 A;  3E2U A;  3CCS A;  3CCU A;  1VQ9 Q;  5J3B A;  1IB8 A;  2K2M A;  3RUX A;  2VKN A;  2YRV A;  4NOY A;  4M75 A;  1E6H A;  2PQW A;  4N4H A;  1MUZ A;  1S72 A;  4M75 D;  2LRQ A;  2XU8 A;  1Z9Z A;  2E1H A;  3SFM A;  5L23 A;  4OMQ A;  5I22 A;  2P0K A;  1VQ9 A;  1RAC B;  2EJF A;  2HSP A;  3V7R A;  4KT0 E;  1M90 C; 
#chains in the Genus database with same CATH homology
 2GTO A;  2RQV A;  2KEA A;  1YN8 A;  3H0I A;  4J9D A;  1GL5 A;  1NEG A;  4F17 A;  1OEB A;  1U5S A;  1UJ0 A;  2JMC A;  2G6F X;  1UJY A;  2GNC A;  5FWB A;  4CC3 A;  1SHG A;  1W1F A;  4E6R A;  2CSQ A;  2KYB A;  1X43 A;  2LNH B;  1FYN A;  1M8M A;  1X6G A;  3I5S A;  1VYV A;  3EHQ A;  5FW9 A;  1H8K A;  2CSI A;  1ZUK A;  1G2B A;  1T3L A;  2ENM A;  1PNJ A;  3VS4 A;  2A28 A;  2W10 A;  2EVR A;  2LX7 A;  1JQQ A;  1B3Q A;  1K76 A;  3EG3 A;  2KRN A;  2ECZ A;  2DMO A;  3EG2 A;  2JW4 A;  2H8H A;  2XMF A;  1M3B A;  2MOX A;  2J6K A;  3VS2 A;  2DL3 A;  1AD5 A;  1AVZ C;  2YUO A;  1TUD A;  2M51 A;  4JJD A;  3NHN A;  3VRY A;  2A36 A;  1WI7 A;  3UA6 A;  2BZX A;  4J9H A;  1KIK A;  2D1X A;  1MV3 A;  4Z88 A;  1VYU A;  2K79 A;  2K7A A;  1GCQ C;  4HCK A;  2ROT A;  1NLP C;  1X27 A;  2NWM A;  5GJV B;  2J05 A;  5IXF A;  2LQW A;  2DRM A;  2RQT A;  2L3S A;  1UHF A;  1LCK A;  1W6X A;  2YUQ A;  3H0F A;  2VVK A;  1OV3 A;  2A08 A;  1JEG A;  2AZS A;  3KFV A;  3I9Q A;  1M30 A;  1E7O A;  2EYW A;  1AWO A;  1BU1 A;  2FPF A;  4AG1 C;  1QWF A;  1HD3 A;  1X69 A;  4RTV A;  2DVJ A;  2KE9 A;  2KR3 A;  1GFD A;  2AK5 A;  2DJQ A;  2CDT A;  2LMJ A;  2M0Y A;  5GJW B;  1WA7 A;  1RI9 A;  2JXB A;  4J9B A;  2DF6 A;  1QCF A;  3H0H A;  2DBM A;  4GBQ A;  2DIL A;  4Z8A A;  2JM9 A;  2K3B A;  1K4U S;  1ZUU A;  1PRL C;  2JS2 A;  3VS3 A;  4RTU A;  1GCQ A;  3PE0 A;  1WXB A;  2CUB A;  1UDL A;  2DL8 A;  2C0T A;  1NYF A;  1WX6 A;  2O31 A;  1AWW A;  1UHC A;  1CSK A;  1U06 A;  2L2P A;  1HJD A;  2DYB A;  4CC7 A;  2IIM A;  2JTE A;  1IO6 A;  1GRI A;  1X2K A;  3EHR A;  5ECA A;  1QLY A;  3M0R A;  2NUZ A;  1WFW A;  1QWE A;  2DE0 X;  2W0Z A;  2HDA A;  2SEM A;  2X3X D;  1A0N B;  1U3O A;  1NLO C;  1AZG B;  3TSW A;  1BB9 A;  4LNP A;  2FRY A;  2RPN A;  1ZBJ A;  1I1J A;  3RNJ A;  2KT1 A;  1M3A A;  1GBQ A;  5IHK A;  1ZUY A;  1G83 A;  2KRM A;  4OMM A;  1UFF A;  3TSZ A;  2V1R A;  1OPL A;  1UEC A;  1GFC A;  2J7I A;  2RN8 A;  2BZ8 A;  4HXJ A;  2EGC A;  3UF4 A;  4RTX A;  1M27 C;  2GQI A;  2RMO A;  4Y92 A;  2O88 A;  2LJ3 A;  4CC4 B;  2F2V A;  2QDL A;  2RQR A;  1Y0M A;  4JZ4 A;  4D8K A;  4FSS A;  2CH4 W;  2AZV A;  2YDL A;  3ZL7 C;  2GBQ A;  1CKB A;  1RLP C;  2CUD A;  1QKX A;  1JXO A;  1UTI A;  3UA7 A;  1K0X A;  1T0J A;  2D0N A;  2DA9 A;  1SSH A;  1FMK A;  1OPK A;  2RQU A;  2KRS A;  2A37 A;  2J6F A;  4J9C A;  2E5K A;  4AG2 C;  1JU5 C;  1JO8 A;  1SHF A;  3I35 A;  3QWX X;  2O9V A;  2MIO A;  4QT7 A;  2JMA A;  4OMN A;  2C0I A;  2L3P A;  2O9S A;  1AWX A;  2P4R A;  2PTK A;  3FJ5 A;  2LJ0 A;  2RQW A;  1KFZ A;  1B07 A;  4WCI A;  3R6N A;  4IIM A;  1UE9 A;  2ROL A;  2J6O A;  4A63 B;  2EPD A;  1HSQ A;  4K11 A;  4F14 A;  2FPD A;  1YWP A;  2V1Q A;  1MV0 B;  1M3C A;  2F2W A;  2DX1 A;  2KRO A;  3PVQ A;  3SEM A;  1NG2 A;  2AKL A;  4J9G A;  1BBZ A;  2DL5 A;  2J06 A;  2BZY A;  3SHW A;  4J9F A;  2DLP A;  2FPE A;  2FO0 A;  4F16 A;  2HCK A;  2OAW A;  3VS0 A;  1GCP A;  2OI3 A;  1PKT A;  1EFN A;  2KXC A;  2YT6 A;  1S1N A;  1YCS B;  2ED1 A;  2B86 A;  2MCN A;  3JV3 A;  2EYZ A;  1I07 A;  2EGA A;  5IH2 A;  2X3W D;  2CH4 A;  3REA B;  4J9E A;  4OML A;  1KSW A;  2KT8 A;  1X6B A;  2C0O A;  4RTZ A;  4ZNX A;  4HVW A;  1NYG A;  3M0P A;  1WXU A;  3THK A;  2KNB B;  2KGT A;  4RUG A;  2JM8 A;  1BK2 A;  2VWF A;  1UG1 A;  2K9G A;  4GLM A;  2D8H A;  1WLP B;  5FWC A;  1V1C A;  2EBP A;  1SPK A;  3H41 A;  2BTT A;  2YUN A;  4DEY A;  2DRK A;  2DNU A;  2GGR A;  3VS6 A;  4RTY A;  1ABQ A;  2EYY A;  2SRC A;  2YUP A;  2LZ6 B;  4AFQ C;  2ESW A;  3CQT A;  3LH5 A;  3QWY A;  1ZLM A;  2LQN A;  1T3S A;  3EG1 A;  1ZSG A;  2EYX A;  1PKS A;  2CT4 A;  2KBT A;  4JJC A;  3VS1 A;  4EIK A;  1K9A A;  1XOV A;  3NGP A;  1YNZ A;  2KXD A;  2YSQ A;  1Y57 A;  2I0N A;  3M0S A;  3M0T A;  3VS5 A;  3A98 A;  1NEB A;  2K6D A;  4AFU C;  4OMP A;  1CKA A;  2FRW A;  1QKW A;  5EC7 A;  1AOJ A;  1AZE A;  1AEY A;  3M0Q A;  3M0U A;  5IXB A;  1PWT A;  1YWO A;  1I0C A;  1WXT A;  2GTJ A;  3NMZ C;  2D8J A;  2L3Q A;  3TVT A;  3C0C A;  1TUC A;  4M4Z A;  1WYX A;  2RNA A;  1K1Z A;  4ORZ A;  3NPF A;  2ED0 A;  4X1V A;  4JPB W;  1T0H A;  1J3T A;  2KYM A;  2HEQ A;  4D8D A;  2EGE A;  2LP5 A;  2HBW A;  4LUD A;  1TG0 A;  1ARK A;  1KJW A;  1SRM A;  1SRL A;  1X2Q A;  2JT4 A;  4R0K A;  1PRM C;  2L0A A;  3I5R A;  1WIE A;  2FG0 A;  2JS0 A;  1YP5 A;  2DL7 A;  1AWJ A;  1JXM A;  5I11 A;  4HVU A;  2AKK A;  4LUE A;  1RUW A;  3VS7 A;  1ZX6 A;  1H92 A;  2EKH A;  3GBQ A;  2LJ1 A;  4JJB A;  5IHI A;  2CT3 A;  3IQL A;  5IHN A;  3VRZ A;  3PVL A;  1WDX A;  2FEI A;  3O5Z A;  4OMO A;  4J9I A;  1RLQ C;  4KRT A;  4IIO A;  1ABO A;  2O2O A;  4JZ3 A;  1OOT A;  3U23 A;  4DEX A;  4CC2 A;  2ABL A;  4LN2 A;  4AFS C;  1W70 A;  4ESR A;  2EQI A;  1NM7 A;  2PNI A;  5HCK A;  2LCS A;  3EG0 A;  2CRE A;  1E6G A;  2DM1 A;  4RTT A;  2OJ2 A;  2K2M A;  2VKN A;  3ULR B;  3REB B;  1H3H A;  4HVV A;  1UUE A;  1VA7 A;  1E6H A;  1MUZ A;  2PZ1 A;  2F2X A;  2EW3 A;  1PHT A;  1VYT A;  4AFZ C;  1Z9Z A;  4Z89 A;  1Z9Q A;  2RF0 A;  2DBK A;  3EGU A;  1SEM A;  4LE9 A;  4RTW A;  5L23 A;  3RBB B;  4OMQ A;  5I22 A;  1UGV A;  2DL4 A;  1GBR A;  2HSP A;  1K0S A;  1N5Z A;  3UAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...