2M51A

Nmr structure of the sh3 domain of human ras p21 protein activator (gtpase activating protein) 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
62
structure length
62
Chain Sequence
GRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the SH3 domain of human RAS p21 protein activator (GTPase activating protein) 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ras GTPase-activating protein 1
total genus 7
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2m51A00
4LE9A 1WDXA 2DILA 2A28A 1CKBA 3PVLA 1M8MA 4ZNXA 2JMCA 2FPFA 2LZ6B 1GBRA 2OI3A 4J9BA 4JZ4A 3M0TA 2HDAA 2VWFA 2F2XA 1NYFA 2EGCA 2EW3A 1UJYA 1ZUYA 1XOVA 2DE0X 4CC7A 2W10A 2FPDA 2M51A 2KRNA 2CUDA 2L0AA 4JJCA 1WX6A 1PWTA 2PZ1A 1VYUA 1ZSGA 2I0NA 1K1ZA 2FRWA 2GNCA 5FWBA 1VA7A 1M3BA 1PKTA 2CH4A 4J9HA 1YWOA 4AFQC 2J05A 2J7IA 2L2PA 2NUZA 1H8KA 4AFSC 2VVKA 1QCFA 1KSWA 1NLOC 1SRLA 1K4US 1QWEA 1M30A 2NWMA 2J6OA 2KEAA 3UA7A 2DBMA 2LMJA 1VYVA 2EYWA 2HCKA 1HJDA 2LCSA 1M27C 2CSQA 2C0OA 1I1JA 1JQQA 2KT1A 4J9FA 1KFZA 1BK2A 4CC3A 2K2MA 1OPLA 4OMPA 1Y0MA 3EG0A 4J9EA 2RQRA 3UF4A 1YNZA 1GCPA 2A36A 1Y57A 2DBKA 1GBQA 1YP5A 2CT4A 1NM7A 2ROTA 2FRYA 1RLPC 3NPFA 2LP5A 2KXCA 1Z9ZA 1H92A 1BU1A 3H41A 3NGPA 4LNPA 2KT8A 1GRIA 1TUCA 4JJBA 3O5ZA 2OJ2A 2DL7A 2BZYA 3EGUA 3I5RA 3A98A 1X27A 4OMQA 1SHFA 1S1NA 2DNUA 4CC4B 3M0SA 4OMOA 2CDTA 5GJVB 5I11A 1AD5A 1OEBA 2J6FA 2ABLA 2KE9A 3IQLA 3VS4A 1UFFA 1AWOA 1OV3A 2AKKA 4F14A 1RLQC 1LCKA 1M3AA 1NG2A 1ZUKA 1WA7A 1W6XA 5I22A 2YUOA 2YUPA 1U5SA 1HSQA 2YUQA 1JXOA 3VS2A 1B07A 2ED0A 2EGEA 1A0NB 2MIOA 1X2KA 4OMMA 2FG0A 4LUDA 2EYZA 1X43A 4DEYA 1T3LA 2D8HA 3I9QA 4Y92A 1AWXA 2PNIA 2O88A 1T3SA 2E5KA 3JV3A 4J9CA 2FPEA 1OPKA 1YCSB 2RN8A 3VS0A 3M0QA 4HXJA 2BZ8A 3M0RA 1J3TA 4RTYA 1W1FA 2CSIA 2O31A 3I5SA 2M0YA 1UG1A 2ENMA 3EHQA 2GQIA 1G2BA 2AZSA 2DL4A 1ABQA 5IXBA 2EYYA 4R0KA 1I07A 2JW4A 3PVQA 1U06A 2DRMA 2DVJA 2KXDA 4J9IA 3PE0A 4D8DA 4QT7A 2GBQA 1CKAA 4HVWA 5HCKA 1UHCA 1MV3A 1PNJA 3VRZA 1V1CA 2CUBA 3M0UA 3EHRA 3VRYA 2L3SA 2YDLA 1AWJA 2HBWA 3QWXX 2GTOA 1GFDA 1E6GA 1E6HA 1WLPB 2YUNA 4K11A 1I0CA 5IXFA 3EG2A 2K9GA 4RUGA 3TSWA 4Z89A 2EGAA 4ORZA 2RQTA 2ECZA 5IHNA 5EC7A 2JXBA 2J6KA 5FWCA 1TUDA 4OMNA 1RUWA 1TG0A 1WYXA 1G83A 2EQIA 5IHIA 1SEMA 2XMFA 4DEXA 2DL5A 1BBZA 1WXBA 2KNBB 3ZL7C 1KJWA 5ECAA 1SHGA 2RNAA 2VKNA 1ARKA 2RQWA 2DJQA 4HVUA 1VYTA 2EKHA 4A63B 4LN2A 2JS2A 1K0SA 4RTXA 2JM8A 1YN8A 4GBQA 3EG3A 1GCQC 2D8JA 2DX1A 1K9AA 3KFVA 2HEQA 4IIMA 3VS3A 1EFNA 4J9DA 1JU5C 2F2VA 3TSZA 1W70A 5IH2A 1N5ZA 2HSPA 1AEYA 1GFCA 2RF0A 2B86A 2PTKA 1PRLC 3RBBB 4EIKA 1CSKA 1AZEA 1K0XA 3VS6A 2P4RA 1UHFA 1NEGA 3THKA 1ZUUA 3VS1A 3ULRB 2JT4A 4RTVA 2A08A 2KROA 5GJWB 3UATA 1UJ0A 3TVTA 4ESRA 1JO8A 4IIOA 4HCKA 2DL8A 3LH5A 1B3QA 1T0HA 1UGVA 3R6NA 1FYNA 2CT3A 2X3XD 4D8KA 2YT6A 4J9GA 2MOXA 1AVZC 3UA6A 1WI7A 2JM9A 2O9VA 2D1XA 2D0NA 2KRMA 1QKWA 4GLMA 2OAWA 2FO0A 2F2WA 2JS0A 3CQTA 2LQNA 1SRMA 4AG1C 1Z9QA 2KR3A 1AZGB 4AFZC 2K3BA 2IIMA 3NMZC 1PHTA 2EVRA 4RTUA 1M3CA 2K6DA 1X6GA 1X6BA 2AKLA 2LNHB 3RNJA 1WIEA 1NYGA 3U23A 2KGTA 2DYBA 2KYBA 3H0FA 2LJ3A 1JXMA 4F17A 3H0HA 2K7AA 2JMAA 1OOTA 2FEIA 4HVVA 1NEBA 4E6RA 1QWFA 3REBB 2EPDA 1HD3A 2H8HA 1ZX6A 1MUZA 2CH4W 2RMOA 2QDLA 1NLPC 2RQVA 1AOJA 1ABOA 4Z88A 2ED1A 2X3WD 3SHWA 1QLYA 2GTJA 5L23A 3M0PA 1T0JA 2LJ0A 1U3OA 2V1QA 1ZLMA 4M4ZA 2C0IA 2KBTA 2K79A 2DRKA 4JPBW 2V1RA 3I35A 3GBQA 2DLPA 5IHKA 1X69A 4OMLA 3VS7A 1ZBJA 3EG1A 1RI9A 2KYMA 1K76A 2GGRA 2C0TA 4X1VA 1FMKA 2RQUA 4AG2C 4RTZA 2DL3A 2AZVA 4CC2A 2W0ZA 1UUEA 2DMOA 2ESWA 2JTEA 1IO6A 1UTIA 2LX7A 2MCNA 3SEMA 1SSHA 2AK5A 4JZ3A 4AFUC 1WXTA 2G6FX 5FW9A 2SRCA 1UE9A 2CREA 2O9SA 1JEGA 1AWWA 3C0CA 1X2QA 2DA9A 1WFWA 2LQWA 2L3PA 1BB9A 3QWYA 1PKSA 1E7OA 3FJ5A 3REAB 1GL5A 4F16A 2L3QA 2BTTA 2BZXA 4LUEA 1UECA 4JJDA 2YSQA 1KIKA 2DF6A 1MV0B 2KRSA 1PRMC 2J06A 1UDLA 3NHNA 1SPKA 1WXUA 4KRTA 2A37A 2O2OA 2ROLA 2LJ1A 4FSSA 3H0IA 4RTWA 4Z8AA 2EYXA 1YWPA 2RPNA 4WCIA 1H3HA 3VS5A 1GCQA 2SEMA 4RTTA 2EBPA 2DM1A 1QKXA
chains in the Genus database with same CATH superfamily
1WHHA 4C5GA 1CKBA 3PVLA 3LW5E 1VQ4Q 3QYHB 5LJ5j 2QI2A 3V7RA 2OI3A 1M90R 2RO0A 5LL6S 2XU8A 3M0TA 2PUOB 4FIBA 2HDAA 4J7IA 4VUBA 1UJYA 4CC7A 5GAN4 4IUVA 2M51A 1QVGA 3HRTA 4PK4A 4PLIA 2L0AA 2O01E 1WX6A 4JLGA 2G3RA 1VQKA 1ZSGA 2I0NA 2Y4YA 3CCJQ 3CCST 3OW2A 1MMDA 5FWBA 1VA7A 5HK3A 1V76A 4UC4A 1M4ZA 2L2PA 1C0MA 3CBPA 1H8KA 1BI0A 2FZCB 1NLOC 1K4US 4OB2B 2NWMA 1TSFA 4L6V5 5D6YA 4N4HA 2DPPB 4ELYC 2CYZB 1VYVA 2LMJA 3T9NA 5KYWA 3MEAA 2KT1A 4C5IA 3FC3A 3HTRA 5FU6C 2E5QA 4OMPA 2QXFA 1G3TA 1Y0MA 3EFOB 4F04B 1M1GA 1N8RU 2A36A 4ATOA 1Y57A 2DBKA 5CVIA 1GBQA 4M78D 2ZAEA 3QHSA 2FZKB 1RLPC 1VQ9A 1UGSB 5GAOr 1BU1A 1IGUA 1M1FA 4HT9A 2P0KA 2K2VA 3JCMX 4X9CA 1GRIA 1VQ4A 3OYAA 4JJBA 3RIRA 5GAN5 4HCCA 1LVKA 1SHFA 3EFSA 2DNUA 1G3SA 1OU9A 2F5KA 2IG0A 1QVGS 1UB4A 4AT1B 2F69A 5GAMf 4EMKC 2QG9B 2KE9A 4BUGA 5GAOp 5GAOl 2KAFA 3ZBDA 4PFPA 1VQMA 1OQKA 2YUPA 4FM4B 3A5ZB 4M7DD 2ED0A 3ASKA 2ZPGB 2MIOA 3SWNB 1X2KA 1YHQQ 1YJWA 4M7AE 4MZTA 5L8RE 1D1AA 3M55A 4MZPA 3OYKA 4ELZC 4P5NA 2L3RA 4RG8A 4E7JA 1VQ8T 2PNIA 3OS2A 1Q86U 2X9HA 3CCMT 3FEOA 3SD4A 4PJJA 2HBPA 2GFAA 2HKNA 1J3TA 4RTYA 1W1FA 3D7SB 2CSIA 3EFOA 2HQXA 4A54A 3L2UA 5LJ5g 3GNFB 1G2BA 1O9SA 1ABQA 2EYYA 2CS7A 2X51A 3M59A 1Q81C 2JW4A 1KD1R 3PIOA 3NTHA 2EQUA 3CCJA 3R6OA 2JTFA 1CKAA 2DVEA 4HVWA 2LVMA 2VXEA 1MV3A 2YXYA 1KQSS 1V1CA 3CCUQ 3EHRA 2XICA 1WGSA 2P84A 1NJIC 1WJRA 4QQ6A 5D6XA 2D0QB 4Z89A 4C5HA 3P8HA 3CMAT 2OTJQ 1TUDA 4BDZA 4OMNA 1RUWA 1S72A 1TG0A 3GLXA 1SEMA 5C0MA 1M1KC 4M7DC 4DEXA 1BBZA 1BI1A 1PC0A 3ZL7C 2RNAA 1ARKA 1OYXA 4HVUA 4C92F 2DERA 1K8AR 4L5GA 2JS2A 4RTXA 2JM8A 4GBQA 3X20B 3E9GA 4ZN3A 1GCQC 4OB1B 3V7SA 1BCMA 2D8JA 2A7YA 4PFZA 4CI0C 2QEXA 1JU5C 2F2VA 3OSVA 3TSZA 5GANf 2EJFA 3JCMW 1AEYA 1GFCA 1I5OB 3JCMd 3RBBB 4EIKA 1AZEA 2PUKB 2LC4A 3OA6A 3TQ7P 4M78E 4C0DC 4ESRA 3CCQT 2DZCA 2HD0A 4LD9K 1ZA2B 5GAMd 1K73R 2FHDA 3CC2T 4E7HA 1JB0E 4FW2A 4J9GA 2OTJA 2MOXA 1WI7A 2JM9A 1KQSP 2E6NA 3CD6Q 4LDWA 1FMWA 3QXEB 2K4YA 2DD5A 2KSSA 4PJMA 3PFSA 2KVQG 2QGFB 1C1AA 2LQNA 5KYWB 4MZMA 1AZGB 1NJIR 3MHXA 4AFZC 4DBRA 5GAN8 2K3BA 4PJOB 1PHTA 4RTUA 4LD6A 3L2VA 4RCBA 1X6GA 1X6BA 2LNHB 3RNJA 2PQWA 1WIEA 2KGTA 3G4ST 4BY6C 1YITQ 1W2BA 4J5YA 1D0XA 5IN1A 1N8RR 1H641 1K8AC 1DJ7B 2EPDA 2ZZDA 3OYGA 2H8HA 1ZX6A 4IURA 1KC8C 4C8QC 4B6MA 4Z88A 3UDCA 2X3WD 3OYCA 1UGQB 4M78C 1VQ7Q 1RI0A 2E12A 3M0PA 4C8QE 2JUFA 3OYFA 5LJ5e 3OYHA 5DLOA 2EQJA 3G71Q 4HCZA 4BI4A 2C0IA 4FSXA 1WJSA 4IUQA 2HAXA 2AIRB 2O4XA 2P4TA 2KI7A 4OMLA 2MYSA 3EG1A 2KYMA 1VIFA 2GGRA 4X1VA 1FMKA 4M7AC 3CCVA 2R5MA 4PNOA 4CC2A 3PNWC 2DMOA 4XTYA 2JTEA 4C92E 2RK1A 3SEMA 3DLMA 2AK5A 4AFUC 2DYIA 2IVWA 1IREB 1WXTA 2G6FX 3WVEB 5FW9A 1YIJA 1ZSZA 2E65A 2O9SA 1JEGA 2CP6A 2PVOB 2HKQB 2CKKA 3CCSA 5KYYB 4KBMB 2LQWA 3OB9A 1WHKA 4PL6A 1BB9A 4E7LA 4M77F 1XTDA 4F16A 2BTTA 4LUEA 1TH7A 9ATCB 4TVRA 2E4HA 4DQ2A 2DF6A 1MV0B 1OZ2A 1PRMC 2X4XA 2HL3A 2J06A 1IGQA 2NUTB 3A8HB 1TS9A 1KQ1A 4KRTA 3HL8A 5CAIA 2FB7A 5GMKi 1U1TA 2ROLA 4F7UF 4MMLA 2LJ1A 1WQWA 4OMFB 3CD6A 3CC2A 2RPNA 4WCIA 1N27A 4ZGEB 2RJCA 1VIEA 4N4GA 5FU7C 1QKXA 2E1HA 1WDXA 2DILA 1OULA 3SWNA 1VOMA 2A28A 4JUVA 3CCRA 2MMPA 4YTLA 4ZNXA 2JMCA 1D3BA 3CC7Q 1IRXA 5AYFA 3M57A 1I8FA 1YITA 1KD1U 5CK9A 1JJ2P 2EGCA 1ZUYA 2DE0X 1XOVA 4JRPA 1PD1A 1M9SA 3A8LB 1RL2A 5I21A 1I5LA 2PZ1A 1VYUA 3OBYA 2FRWA 2GNCA 2RHUA 4IUTA 4Q5WA 4AFQC 2J7IA 3VU3C 2EQKA 3ZFJA 1QW1A 1KSWA 5KYYA 2XG8D 1M30A 1S72Q 2J6OA 3P8BB 3X26B 2AHJB 2HCKA 3OS0A 1Q86C 5KE3A 1PSFA 1HJDA 2LCSA 2CSQA 1JQQA 5GAN6 2K2MA 4J9EA 3HSBA 5FU6B 2RQRA 3JB9J 1YNZA 3V8KA 1RAEB 3QZ5B 4BD3A 3OYIA 3CCRT 4RCCA 2DXTA 2HQEA 3M56A 1VQ6Q 2YRDA 3NPFA 3QO3A 1Z9ZA 4PKCC 1H92A 5GAOm 4A4KA 3H41A 2QQBA 4LNPA 3TCJA 3MP8A 4A4FA 3OYLA 2HL5C 1QP3A 2QQSA 1D3BB 2BE9B 1K9MC 2OX7A 1I81A 2M16A 3J81E 3A98A 1X27A 1RAHB 4BE1A 1S1NA 4XK8E 4CC4B 3M0SA 3JCMe 4GY5A 3C94A 1YJ9Q 2CDTA 5GJVB 1KG1A 2CP3A 4PJOF 2COWA 1AWOA 4EMKB 3EH1A 5KYNA 4F14A 4OGCA 1YHQA 1M3AA 3O8VA 1ZUKA 3CCEQ 1VQ6A 1W6XA 2DXBA 2RJEA 5I22A 4GLKA 2E6ZA 1SKUB 4LDUA 2YUQA 1JXOA 4M78G 1NPRA 5CIUA 3FRNA 4LDVA 4OMMA 1JBMA 2RM4A 3AHUA 3MEUA 2DO3A 1D1BA 1X43A 2M1HA 1UEBA 1T3LA 3JB9H 3E19A 2YRVA 2VB6A 1M90C 2O4XB 2O88A 5GMKe 1T3SA 2M02A 1PD0A 5A0GA 2DAQA 2E5KA 5LJ5f 4J9CA 3GOXA 5CKDA 3Q1JA 5LJ5h 1VQKT 1C6VX 2RK2A 4J6XA 4PJOA 3AT1B 3E9FA 1R0CB 3L2ZA 4FU6A 3I5SA 1UG1A 3EHQA 5CQXA 5DLQE 2GQIA 2AZSA 2DL4A 2LQ8A 4HKEA 2EKOA 2RHXA 4R0KA 3QJYA 1I07A 2DRMA 4J9IA 2D6FA 1O75A 3PE0A 4FYXB 2GBQA 2Y90A 4FYVB 1PNJA 1BCOA 3VRZA 2CUBA 3M0UA 3VRYA 2L3SA 3JAME 3G71A 2DZ9A 2OTJT 2HBWA 4C8QG 1E6HA 3E2UA 3LLRA 4DBQA 5KCHA 4K11A 1YIJQ 3TSWA 5KE2A 1P92A 5A0LA 2EGAA 2DD4A 2ECZA 1VQOT 2JXBA 3RKXA 2AT1B 3N5BB 2LQKA 2F5TX 1WYXA 2DL5A 4A53A 4ME7A 2KNBB 1MMAA 3INZA 3BE3A 5ECAA 3FB9A 2VKNA 3KXTA 1IXDA 2DJQA 1VYTA 1D09B 5CO7A 3CC4A 3QJ6A 2DXCA 1K9AA 4QW2A 3KFVA 1YJ9T 3OYNA 4IIMA 3VS3A 1VQ7T 1EFNA 4J9DA 2LCLA 5IH2A 1N5ZA 2HSPA 2JOYA 2RF0A 4ZGJB 2PTKA 4BACA 3VS6A 5LJ3g 8AT1B 3LGLA 2K57A 4E47A 4BE2A 2CGHA 4IUUA 1QVGP 3HFOA 2JT4A 1RADB 4RTVA 2A08A 2KROA 1X6OA 3CCMQ 1WHMA 4MMKA 3S6WA 3JB9I 2ZGWA 1YJ9A 2DL8A 2JN0A 1BI3A 3RKWA 1B3QA 1K73U 3PTAA 1UGVA 3QDFA 3VYHB 5GAMg 1FYNA 3F70A 3CC4T 2DXUA 4HA8A 4D8KA 3UPUA 1U1SA 2YT6A 3RESA 2O9VA 2D1XA 2E70A 3HP9A 3C12A 2RI5A 2V8KA 2YHTA 1BI2A 4GLMA 4C0ZA 2YRCA 3L1AA 2YLBA 3JB9D 4HCBA 3QBYA 4IUPA 4E7SA 2F2WA 2KQWA 3CQTA 1SRMA 4AG1C 4LDYA 4XU1A 4EMGA 3SFMA 2IIMA 5I2MA 2EVRA 4BDYA 1VQLA 3RMSA 1K9MU 3EH2A 3PIPA 5AT1B 1NYGA 2PVDB 3U23A 3CCLA 2JNGA 1NE8A 1FMVA 3H0HA 1W4SA 1OOTA 1RAFB 4E6RA 3KUFA 1QWFA 3PMTA 3REBB 2Z0WA 3EAEA 3G6EA 1YJWT 2QDLA 1NLPC 3CC7T 4M77E 2LT4A 3SHWA 4ZN1A 2E10A 5L23A 1T0JA 4M77C 3BDUA 3UT1A 1PG5B 4JPBW 3L2RA 3A1PA 5EG2A 2DKGA 3A8GB 3CCQQ 4EMKA 3FIFA 5CKEA 3OYJA 1M1KR 2L5QA 3VS7A 3JCMh 1BYMA 2YLCA 1Q86R 1AT1B 3MKDA 5GANe 1QVFA 4JJNK 2NUPA 2W0ZA 1LNXA 3GIBA 2DEQA 4B9XA 1QVFP 4M77D 5A2QE 2EFIA 4N0AA 2R58A 4QVDA 3CC2Q 4V2SA 1UE9A 2CREA 1B34A 1AWWA 2DA9A 1WFWA 1YFNA 1D0YA 2LRQA 1E7OA 3REAB 1GL5A 3J7AF 2L3QA 2BZXA 3RDVA 4C92B 4M78F 3META 4JJDA 2RJDA 2YSQA 2E41A 3DB4A 2XDBA 3TEEA 2V26A 1QMCA 1OX9A 5GAN3 2R57A 5KYXB 1VQ5T 1ZBXA 1SPKA 4E7KA 3VKIA 1VQMQ 2QEXQ 2HQHA 1X01A 4E7IA 1NZ9A 1VQ6T 4Z8AA 2EYXA 1H3HA 4M75C 3VUBA 4ANJA 5LJ3f 4Y91A 3JRZA 1HK9A 1M8MA 2VYTA 2FPFA 1GBRA 4PFOA 4E2FB 4PJNA 4JZ4A 3HRUA 2VWFA 1V29B 2E3HA 4M7DA 2EW3A 4FT2A 2BIVA 3CCUA 3RR6A 1VQLQ 2LT1A 2KRNA 2CUDA 1IZ6A 3GF5A 4JJCA 3I55A 3TREA 1PWTA 4XU2A 3EGXA 1K1ZA 2R5AA 1M3BA 2CH4A 2COZA 4J9HA 1KC8R 2H3EB 2J05A 2X35A 1EX4A 2E3IA 2NUZA 2P0QA 4AFSC 5GMKl 4FYYB 2B8AA 2VVKA 1QCFA 1EZZB 4X9DA 1WNLA 2RHZA 1AHJB 3ZEHA 1QWEA 2YWWA 3UA7A 5IT9E 1M90U 1VQ9T 3WXMB 4XU0A 1M27C 4C92A 4KH0B 4JS4A 3MPUB 4D6WA 3S3OA 3CCVQ 4CC3A 1FX7A 3CCMA 1Y71A 5HKCA 4LDXA 3UF4A 1GCPA 1QVPA 1ZHIA 2CT4A 5KCOA 2XDPA 2DK3A 2ROTA 4XTXA 2QQAA 4F7UG 3MP1A 3JB9F 2K5FA 2LP5A 2P0PA 3ME9A 2QA4Q 1R8OB 4M75F 3X25B 3NGPA 1VQ7A 1VQNQ 1YJNQ 2KT8A 3QYGB 1TUCA 3NFCA 3I56T 2KY9A 3CBOA 2PVGB 2JTMA 3EGDB 2DL7A 3EGUA 3G4SQ 1YITT 1YIJT 3I5RA 4KUIA 3LX7A 5CR2A 4HT8A 4OMOA 2HZYA 5I11A 2ABLA 3CXCA 3IQLA 4M77G 3EGXB 2AKKA 1VQKQ 8ATCB 1RLQC 1LCKA 1NG2A 1WA7A 5J26A 3VS2A 1B07A 2EGEA 3VV0A 1A0NB 3M53A 2FG0A 1KK7A 2ATCB 3EFRA 1VQPA 4LUDA 2RJFA 2ZPIB 1LJOA 1ZSZB 4DEYA 3L2WA 1UGRB 4C0DB 1S72T 4OB3B 4O5VA 2M9UA 3SDZA 2VXFA 4Y92A 1AWXA 3BY7A 3M4GA 2QASA 1M5Q1 3JCMg 4OB0B 2WSFE 4KGVB 1KC8U 2FPEA 1OPKA 2RN8A 2BZ8A 2WACA 4L59A 3HRSA 2NUTA 4X34A 2RD1A 1Q82R 2O31A 2E64A 2M0YA 1FXXA 1G8XA 2VASA 4MDWA 4C92D 4FL6A 5HK0A 3OSSC 4PJOD 1U06A 2KXDA 3UWNA 1F1BB 1RACB 1Y96B 4QT7A 3I55Q 1UHCA 3JCMV 2RHIA 1VQOQ 1TU0B 1N6AA 3X28B 1GFDA 2GTOA 1M2VB 1Q7YR 5CKBA 2YUNA 3OY9A 4BY6B 3EG2A 2K9GA 4RUGA 1YI2Q 2MPXC 1MMGA 2BKDN 3OMGA 2JJ9A 2J6KA 1Y7XA 1G83A 2EQIA 1YBYA 2RB6A 1W2BP 2FVUA 1KJWA 2RQWA 1KHCA 4LN2A 4OP0A 3JCMQ 4DBHA 1I4K1 2DTHA 1FWZA 2DTIA 4C92G 3M9QA 3PMIA 2DX1A 2K5LA 5GAN2 4PJOG 4FT4A 1VQOA 1W70A 5J39A 3SWNC 4JRQA 2CZ6B 1Q95G 2B86A 2PU9B 4M75E 2A3LA 2QQ9A 2XDDA 1Q81U 1JJ2A 1CSKA 4RG2A 1K0XA 2P4RA 3QUIA 4M75D 1UHFA 3JCMP 1ZUUA 3ULRB 1KHIA 4C0GA 5CKHA 5GJWB 5GAOq 1B34B 2RA2A 1UJ0A 3TVTA 1JO8A 3V7CA 3QDRB 4HCKA 3LH5A 3OW2P 3CCRQ 2QK0A 1PCXA 2X3XD 5KH6A 5DM7R 1YCYA 3UA6A 1H3ZA 5DY9A 1XQHA 2D0NA 4IKFA 3QSUA 4II1A 2OAWA 1IHWA 4QVZA 3VUZA 2JS0A 3G1JA 2CP0A 5D6WA 1Z9QA 2KR3A 3H9NA 1VQPQ 2MI6A 3GPLA 3JB9G 3TU4K 3OS1A 5I2SA 3QKJA 1NPPA 1XNIA 2EAYA 3NMZC 2K6DA 2AKLA 4XTZA 4Y28E 2EQMA 2A0FB 2DYBA 2XD0A 3CMEQ 2QDYB 3LWIA 3CPWP 4F17A 1VQ5Q 2RHYA 3LH0A 4QQGA 2JMAA 3CPWS 2HSEB 2FEIA 1D1CA 1SG5A 3FDRA 4OVAA 5GANj 2ZCFB 4Z02A 2M0OA 3CEYA 1MUZA 2CH4W 4OF1A 2GF7A 4QQDA 3JSCA 4C0FA 1AOJA 1ABOA 2QQRA 2V8JA 1QLYA 2GTJA 1TUGB 2LJ0A 3H8ZA 1YJWQ 4B9WA 2ZPBB 1MGQA 4KH1B 3M4YA 2DRKA 1YJNT 3I35A 3GBQA 1VQ8Q 1MMNA 4KGZB 5FROA 5IHKA 1X69A 1R77A 2EIFA 4M75G 1K76A 2C0TA 2VV5A 2RQUA 2X4JA 2CP7A 5GMKm 1R0BG 4A4HA 2D9TA 4RTZA 3CCJT 4KUDK 2DL3A 1WZOA 1UUEA 3NTIA 2ESWA 1IO6A 1VQMT 2LX7A 2MCNA 1MNEA 1SSHA 3HKSA 3CPFA 2DJZA 1M1KU 1UGPB 2SRCA 1VQNA 2WSCE 4J6YA 4PJLA 4EPCA 3G6ET 2L89A 4ZTJA 1VQ9Q 2L3PA 3QWYA 3FJ5A 3CD6T 3OS5A 4J7FA 2LTOA 2BUDA 3CCVT 3JCMb 4JRKA 4PJOC 4OGEA 1KIKA 3EGDA 1YI2T 1VQ4T 2KRSA 2VGNA 4MDXA 2MF2A 5CKFA 4M7AD 1UDLA 1ZQ1A 3OYBA 1WXUA 2A37A 2WSEE 5LJ3e 1Y96A 2O2OA 3P8DA 3WVDB 2CZ7B 3DKMA 3CXCS 1YWPA 1GCQA 5FRMA 2DIQA 2EBPA 2DM1A 4WF2A 4FYWB 1Y07A 4M75B 4C8QB 4N4IA 4LE9A 4KGXB 1OX8A 3EG9A 1Q82U 2LZ6B 1LPLA 2OTLQ 4R55A 3CCET 2Y4XA 3QG1A 4J83A 4J9BA 3M54A 5GMKj 2F2XA 5IAYA 1NYFA 4KT0E 1KQ2A 4M7DE 2W10A 2LDMA 2FPDA 3L2QA 3CMAQ 2XKOC 4JRIA 5GANd 1N9RA 3DB3A 3OQ5A 4FCYA 4M7AB 3JCMf 1PKTA 4NS5A 1Q81R 1YWOA 2EWNA 3M58A 3S3MA 4BI3A 3MO8A 1IB8A 3MJXA 1TTHB 3QPHA 4F7UE 1PSEA 1SRLA 4DOWA 2KEAA 2XK0A 2DBMA 2EYWA 3SB2A 1OZ3A 1M8VA 1VUBA 1VQLT 1YI2A 4EDUA 2C0OA 1I1JA 1M2VA 4J9FA 3CCLQ 1KFZA 1SF9A 1BK2A 2RI2A 4XTVA 5LJ3h 5GMKh 3QZ9B 1OPLA 3EG0A 7AT1B 2X4YA 3S3NA 3LWHA 5D7UA 5GAN7 1D0ZA 1M2OA 1YP5A 2NYSA 1VQNT 5GAMj 4ZTFA 5C6SA 1NM7A 2XI9A 2FZGB 2DTOA 3KBGA 2EJGA 1ACMB 2FRYA 2KXCA 1G3WA 1OI1A 3I56A 4C8QA 3C95A 4JDSA 2XIDA 5GAOn 1NJIU 3RERA 4M78A 2OTLA 2ZPFB 3BW1A 3VYGA 3CBMA 4F7UA 1YHQT 3O5ZA 2OJ2A 2BZYA 3ER0A 2GFUA 4OMQA 1N8RC 3A8OB 1JJ2S 6AT1B 3FJPA 4O6JA 1XJWB 1AD5A 3RKYA 1OEBA 2J6FA 3VS4A 4DOVA 1K73C 1UFFA 1OV3A 2MK5A 1NBEB 4M7AA 2NUPB 4LXCA 3MEVA 2YUOA 1U5SA 1HSQA 1HXDA 2RI3A 4C5EA 5GAMe 2VUBA 3L42A 2EYZA 3CC4Q 4M77A 3RMQA 1ZSZC 2D8HA 3I9QA 3OYEA 3CCSQ 2KDSA 4NL3A 1TXQA 3G6EQ 2K3XA 3JV3A 3LGFA 4M7AF 4XU3A 3V8JA 3VS0A 1HYOA 1YCSB 2QEXT 3M0QA 4HXJA 2QYZA 4A4EA 2X4WA 1BKBA 3M0RA 1WPYA 2VC8A 4PLLA 5A0DA 5KYXA 1YJNA 2EYQA 3MCAB 2ENMA 3HFNA 4EMHA 5IXBA 3CCUT 2DIGA 3PVQA 2LX9A 2DVJA 3QIIA 4D8DA 4N0AC 1RAAB 3CPWA 4J6WA 5GANg 4XTUA 5HCKA 3CMAA 1WHJA 1KD1C 4C8QF 2ZPHB 1K8AU 4NOYA 2YDLA 2HNIA 1AWJA 1RAGB 3QWXX 1E6GA 1JRIA 1WLPB 1I0CA 1LOJA 2H3JA 5IXFA 1ZA1B 4BB7A 4ORZA 2LCCA 2RQTA 5LJ3d 5IHNA 4C8QD 5EC7A 3CMET 5FWCA 2KK4A 4M7DB 5IHIA 2XMFA 4BE0A 1WXBA 4JS5A 1SHGA 3I55T 4A63B 2EKHA 5GAMh 4XTWA 2C06A 2GQVA 2QTXA 1K0SA 1VQ5A 1YN8A 3G71T 4JLIA 2CP2A 3OBWA 3EG3A 3CMEA 4M75A 3PGGA 3BFMA 2QA4A 2HEQA 3EG9B 4M77B 2DETA 1BIBA 2GCXA 4KULA 1PRLC 3OYMA 4M7DG 3G7ZA 1NEGA 3THKA 3VS1A 4QVCA 2F1LA 3UATA 2QAZA 4IIOA 3URGA 3RUXA 2CZ1B 1T0HA 3E1SA 3R6NA 2CT3A 2K5IA 4A4GA 2QA4T 1KQSA 5LJ3j 1G3YA 1AVZC 1X75C 4PJOE 5HY6A 4RMOA 2KRMA 5KYUA 1U8RA 2LNVA 1QKWA 3I56Q 3C4SA 5GANh 1TWBA 4QKUA 2MWOA 2FO0A 2EJ9A 3BDLA 1RAIB 2CP5A 3A8MB 2RH2A 1VQ8A 4RKUE 2HMAA 2QTVA 4M7AG 4C92C 1M3CA 2KMTA 4M7DF 5FLXE 2KYBA 3H0FA 2LJ3A 1JXMA 4FW1A 1Q82C 2QGGA 1W2BS 2K7AA 2MWPA 5CQYA 3CCLT 4HVVA 3X24B 1NEBA 1WJQA 4ZGDB 1HD3A 1MNDA 2RMOA 2BE7D 3GNGA 2ZPEB 3CXCP 5J3BA 2JVVA 2RQVA 4M78B 1K9MR 3FLGA 2ED1A 2JZ2A 3LYIA 1QQJA 1SSFA 1WQ7A 3HHTB 3HPWA 2XHCA 3MEWA 5M9OA 1U3OA 2V1QA 3OYYA 1PM3A 1Q7YC 3M5AA 2FL7A 3H6ZA 4AMCA 3CCQA 1ZLMA 4M4ZA 2KBTA 2K79A 1OU8A 3JCMJ 1WHLA 2V1RA 3CCEA 2CZ0B 2OAUA 2DLPA 3V8LA 3GP8A 1G5VA 5CCAA 1ZBJA 1RI9A 3VJPA 4DA4A 2L8DA 4AG2C 5KYUB 4BI8B 2AZVA 3J80E 1QP2A 1IHVA 1UTIA 4J8OA 4JZ3A 5LJ5d 3PT9A 5FRNA 4R56A 1QCNA 3C0CA 1B7TA 1VQPT 1X2QA 4NL2A 4XAXB 2DEUA 1MHNA 3DLLA 3MP6A 1PKSA 2VGMA 1UECA 4F7UB 2OTLT 4XQ3A 1Q7YU 3OMCA 1RABB 2MAMA 4E7ZA 3OYDA 3NHNA 3JCMc 4CRIA 2K3YA 1QVFS 2DFUA 1WHGA 1TOVA 2V8IA 2FYKA 3CC7A 4FSSA 1BIAA 3H0IA 4DBFA 1QCOA 4RTWA 2NLUA 5FU7B 3VS5A 2COYA 2I2LA 2SEMA 4RTTA 3OW2S 1N9SA 1GXIE 1EIFA 2IPOB 4WTOB 3G4SA 3NTKA
chains in the Genus database with same CATH topology
4LE9A 1WDXA 2DILA 2A28A 1CKBA 3PVLA 1M8MA 4ZNXA 2JMCA 2FPFA 2LZ6B 1GBRA 2OI3A 4J9BA 4JZ4A 3M0TA 2HDAA 2VWFA 2F2XA 1NYFA 2EGCA 2EW3A 1UJYA 1ZUYA 1XOVA 2DE0X 4CC7A 2W10A 2FPDA 2M51A 2KRNA 2CUDA 2L0AA 4JJCA 1WX6A 1PWTA 2PZ1A 1VYUA 1ZSGA 2I0NA 1K1ZA 2FRWA 2GNCA 5FWBA 1VA7A 1M3BA 1PKTA 2CH4A 4J9HA 1YWOA 4AFQC 2J05A 2J7IA 2L2PA 2NUZA 1H8KA 4AFSC 2VVKA 1QCFA 1KSWA 1NLOC 1SRLA 1K4US 1QWEA 1M30A 2NWMA 2J6OA 2KEAA 3UA7A 2DBMA 2LMJA 1VYVA 2EYWA 2HCKA 1HJDA 2LCSA 1M27C 2CSQA 2C0OA 1I1JA 1JQQA 2KT1A 4J9FA 1KFZA 1BK2A 4CC3A 2K2MA 1OPLA 4OMPA 1Y0MA 3EG0A 4J9EA 2RQRA 3UF4A 1YNZA 1GCPA 2A36A 1Y57A 2DBKA 1GBQA 1YP5A 2CT4A 1NM7A 2ROTA 2FRYA 1RLPC 3NPFA 2LP5A 2KXCA 1Z9ZA 1H92A 1BU1A 3H41A 3NGPA 4LNPA 2KT8A 1GRIA 1TUCA 4JJBA 3O5ZA 2OJ2A 2DL7A 2BZYA 3EGUA 3I5RA 3A98A 1X27A 4OMQA 1SHFA 1S1NA 2DNUA 4CC4B 3M0SA 4OMOA 2CDTA 5GJVB 5I11A 1AD5A 1OEBA 2J6FA 2ABLA 2KE9A 3IQLA 3VS4A 1UFFA 1AWOA 1OV3A 2AKKA 4F14A 1RLQC 1LCKA 1M3AA 1NG2A 1ZUKA 1WA7A 1W6XA 5I22A 2YUOA 2YUPA 1U5SA 1HSQA 2YUQA 1JXOA 3VS2A 1B07A 2ED0A 2EGEA 1A0NB 2MIOA 1X2KA 4OMMA 2FG0A 4LUDA 2EYZA 1X43A 4DEYA 1T3LA 2D8HA 3I9QA 4Y92A 1AWXA 2PNIA 2O88A 1T3SA 2E5KA 3JV3A 4J9CA 2FPEA 1OPKA 1YCSB 2RN8A 3VS0A 3M0QA 4HXJA 2BZ8A 3M0RA 1J3TA 4RTYA 1W1FA 2CSIA 2O31A 3I5SA 2M0YA 1UG1A 2ENMA 3EHQA 2GQIA 1G2BA 2AZSA 2DL4A 1ABQA 5IXBA 2EYYA 4R0KA 1I07A 2JW4A 3PVQA 1U06A 2DRMA 2DVJA 2KXDA 4J9IA 3PE0A 4D8DA 4QT7A 2GBQA 1CKAA 4HVWA 5HCKA 1UHCA 1MV3A 1PNJA 3VRZA 1V1CA 2CUBA 3M0UA 3EHRA 3VRYA 2L3SA 2YDLA 1AWJA 2HBWA 3QWXX 2GTOA 1GFDA 1E6GA 1E6HA 1WLPB 2YUNA 4K11A 1I0CA 5IXFA 3EG2A 2K9GA 4RUGA 3TSWA 4Z89A 2EGAA 4ORZA 2RQTA 2ECZA 5IHNA 5EC7A 2JXBA 2J6KA 5FWCA 1TUDA 4OMNA 1RUWA 1TG0A 1WYXA 1G83A 2EQIA 5IHIA 1SEMA 2XMFA 4DEXA 2DL5A 1BBZA 1WXBA 2KNBB 3ZL7C 1KJWA 5ECAA 1SHGA 2RNAA 2VKNA 1ARKA 2RQWA 2DJQA 4HVUA 1VYTA 2EKHA 4A63B 4LN2A 2JS2A 1K0SA 4RTXA 2JM8A 1YN8A 4GBQA 3EG3A 1GCQC 2D8JA 2DX1A 1K9AA 3KFVA 2HEQA 4IIMA 3VS3A 1EFNA 4J9DA 1JU5C 2F2VA 3TSZA 1W70A 5IH2A 1N5ZA 2HSPA 1AEYA 1GFCA 2RF0A 2B86A 2PTKA 1PRLC 3RBBB 4EIKA 1CSKA 1AZEA 1K0XA 3VS6A 2P4RA 1UHFA 1NEGA 3THKA 1ZUUA 3VS1A 3ULRB 2JT4A 4RTVA 2A08A 2KROA 5GJWB 3UATA 1UJ0A 3TVTA 4ESRA 1JO8A 4IIOA 4HCKA 2DL8A 3LH5A 1B3QA 1T0HA 1UGVA 3R6NA 1FYNA 2CT3A 2X3XD 4D8KA 2YT6A 4J9GA 2MOXA 1AVZC 3UA6A 1WI7A 2JM9A 2O9VA 2D1XA 2D0NA 2KRMA 1QKWA 4GLMA 2OAWA 2FO0A 2F2WA 2JS0A 3CQTA 2LQNA 1SRMA 4AG1C 1Z9QA 2KR3A 1AZGB 4AFZC 2K3BA 2IIMA 3NMZC 1PHTA 2EVRA 4RTUA 1M3CA 2K6DA 1X6GA 1X6BA 2AKLA 2LNHB 3RNJA 1WIEA 1NYGA 3U23A 2KGTA 2DYBA 2KYBA 3H0FA 2LJ3A 1JXMA 4F17A 3H0HA 2K7AA 2JMAA 1OOTA 2FEIA 4HVVA 1NEBA 4E6RA 1QWFA 3REBB 2EPDA 1HD3A 2H8HA 1ZX6A 1MUZA 2CH4W 2RMOA 2QDLA 1NLPC 2RQVA 1AOJA 1ABOA 4Z88A 2ED1A 2X3WD 3SHWA 1QLYA 2GTJA 5L23A 3M0PA 1T0JA 2LJ0A 1U3OA 2V1QA 1ZLMA 4M4ZA 2C0IA 2KBTA 2K79A 2DRKA 4JPBW 2V1RA 3I35A 3GBQA 2DLPA 5IHKA 1X69A 4OMLA 3VS7A 1ZBJA 3EG1A 1RI9A 2KYMA 1K76A 2GGRA 2C0TA 4X1VA 1FMKA 2RQUA 4AG2C 4RTZA 2DL3A 2AZVA 4CC2A 2W0ZA 1UUEA 2DMOA 2ESWA 2JTEA 1IO6A 1UTIA 2LX7A 2MCNA 3SEMA 1SSHA 2AK5A 4JZ3A 4AFUC 1WXTA 2G6FX 5FW9A 2SRCA 1UE9A 2CREA 2O9SA 1JEGA 1AWWA 3C0CA 1X2QA 2DA9A 1WFWA 2LQWA 2L3PA 1BB9A 3QWYA 1PKSA 1E7OA 3FJ5A 3REAB 1GL5A 4F16A 2L3QA 2BTTA 2BZXA 4LUEA 1UECA 4JJDA 2YSQA 1KIKA 2DF6A 1MV0B 2KRSA 1PRMC 2J06A 1UDLA 3NHNA 1SPKA 1WXUA 4KRTA 2A37A 2O2OA 2ROLA 2LJ1A 4FSSA 3H0IA 4RTWA 4Z8AA 2EYXA 1YWPA 2RPNA 4WCIA 1H3HA 3VS5A 1GCQA 2SEMA 4RTTA 2EBPA 2DM1A 1QKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LE9 A;  1WDX A;  2DIL A;  2A28 A;  1CKB A;  3PVL A;  1M8M A;  4ZNX A;  2JMC A;  2FPF A;  2LZ6 B;  1GBR A;  2OI3 A;  4J9B A;  4JZ4 A;  3M0T A;  2HDA A;  2VWF A;  2F2X A;  1NYF A;  2EGC A;  2EW3 A;  1UJY A;  1ZUY A;  1XOV A;  2DE0 X;  4CC7 A;  2W10 A;  2FPD A;  2M51 A;  2KRN A;  2CUD A;  2L0A A;  4JJC A;  1WX6 A;  1PWT A;  2PZ1 A;  1VYU A;  1ZSG A;  2I0N A;  1K1Z A;  2FRW A;  2GNC A;  5FWB A;  1VA7 A;  1M3B A;  1PKT A;  2CH4 A;  4J9H A;  1YWO A;  4AFQ C;  2J05 A;  2J7I A;  2L2P A;  2NUZ A;  1H8K A;  4AFS C;  2VVK A;  1QCF A;  1KSW A;  1NLO C;  1SRL A;  1K4U S;  1QWE A;  1M30 A;  2NWM A;  2J6O A;  2KEA A;  3UA7 A;  2DBM A;  2LMJ A;  1VYV A;  2EYW A;  2HCK A;  1HJD A;  2LCS A;  1M27 C;  2CSQ A;  2C0O A;  1I1J A;  1JQQ A;  2KT1 A;  4J9F A;  1KFZ A;  1BK2 A;  4CC3 A;  2K2M A;  1OPL A;  4OMP A;  1Y0M A;  3EG0 A;  4J9E A;  2RQR A;  3UF4 A;  1YNZ A;  1GCP A;  2A36 A;  1Y57 A;  2DBK A;  1GBQ A;  1YP5 A;  2CT4 A;  1NM7 A;  2ROT A;  2FRY A;  1RLP C;  3NPF A;  2LP5 A;  2KXC A;  1Z9Z A;  1H92 A;  1BU1 A;  3H41 A;  3NGP A;  4LNP A;  2KT8 A;  1GRI A;  1TUC A;  4JJB A;  3O5Z A;  2OJ2 A;  2DL7 A;  2BZY A;  3EGU A;  3I5R A;  3A98 A;  1X27 A;  4OMQ A;  1SHF A;  1S1N A;  2DNU A;  4CC4 B;  3M0S A;  4OMO A;  2CDT A;  5GJV B;  5I11 A;  1AD5 A;  1OEB A;  2J6F A;  2ABL A;  2KE9 A;  3IQL A;  3VS4 A;  1UFF A;  1AWO A;  1OV3 A;  2AKK A;  4F14 A;  1RLQ C;  1LCK A;  1M3A A;  1NG2 A;  1ZUK A;  1WA7 A;  1W6X A;  5I22 A;  2YUO A;  2YUP A;  1U5S A;  1HSQ A;  2YUQ A;  1JXO A;  3VS2 A;  1B07 A;  2ED0 A;  2EGE A;  1A0N B;  2MIO A;  1X2K A;  4OMM A;  2FG0 A;  4LUD A;  2EYZ A;  1X43 A;  4DEY A;  1T3L A;  2D8H A;  3I9Q A;  4Y92 A;  1AWX A;  2PNI A;  2O88 A;  1T3S A;  2E5K A;  3JV3 A;  4J9C A;  2FPE A;  1OPK A;  1YCS B;  2RN8 A;  3VS0 A;  3M0Q A;  4HXJ A;  2BZ8 A;  3M0R A;  1J3T A;  4RTY A;  1W1F A;  2CSI A;  2O31 A;  3I5S A;  2M0Y A;  1UG1 A;  2ENM A;  3EHQ A;  2GQI A;  1G2B A;  2AZS A;  2DL4 A;  1ABQ A;  5IXB A;  2EYY A;  4R0K A;  1I07 A;  2JW4 A;  3PVQ A;  1U06 A;  2DRM A;  2DVJ A;  2KXD A;  4J9I A;  3PE0 A;  4D8D A;  4QT7 A;  2GBQ A;  1CKA A;  4HVW A;  5HCK A;  1UHC A;  1MV3 A;  1PNJ A;  3VRZ A;  1V1C A;  2CUB A;  3M0U A;  3EHR A;  3VRY A;  2L3S A;  2YDL A;  1AWJ A;  2HBW A;  3QWX X;  2GTO A;  1GFD A;  1E6G A;  1E6H A;  1WLP B;  2YUN A;  4K11 A;  1I0C A;  5IXF A;  3EG2 A;  2K9G A;  4RUG A;  3TSW A;  4Z89 A;  2EGA A;  4ORZ A;  2RQT A;  2ECZ A;  5IHN A;  5EC7 A;  2JXB A;  2J6K A;  5FWC A;  1TUD A;  4OMN A;  1RUW A;  1TG0 A;  1WYX A;  1G83 A;  2EQI A;  5IHI A;  1SEM A;  2XMF A;  4DEX A;  2DL5 A;  1BBZ A;  1WXB A;  2KNB B;  3ZL7 C;  1KJW A;  5ECA A;  1SHG A;  2RNA A;  2VKN A;  1ARK A;  2RQW A;  2DJQ A;  4HVU A;  1VYT A;  2EKH A;  4A63 B;  4LN2 A;  2JS2 A;  1K0S A;  4RTX A;  2JM8 A;  1YN8 A;  4GBQ A;  3EG3 A;  1GCQ C;  2D8J A;  2DX1 A;  1K9A A;  3KFV A;  2HEQ A;  4IIM A;  3VS3 A;  1EFN A;  4J9D A;  1JU5 C;  2F2V A;  3TSZ A;  1W70 A;  5IH2 A;  1N5Z A;  2HSP A;  1AEY A;  1GFC A;  2RF0 A;  2B86 A;  2PTK A;  1PRL C;  3RBB B;  4EIK A;  1CSK A;  1AZE A;  1K0X A;  3VS6 A;  2P4R A;  1UHF A;  1NEG A;  3THK A;  1ZUU A;  3VS1 A;  3ULR B;  2JT4 A;  4RTV A;  2A08 A;  2KRO A;  5GJW B;  3UAT A;  1UJ0 A;  3TVT A;  4ESR A;  1JO8 A;  4IIO A;  4HCK A;  2DL8 A;  3LH5 A;  1B3Q A;  1T0H A;  1UGV A;  3R6N A;  1FYN A;  2CT3 A;  2X3X D;  4D8K A;  2YT6 A;  4J9G A;  2MOX A;  1AVZ C;  3UA6 A;  1WI7 A;  2JM9 A;  2O9V A;  2D1X A;  2D0N A;  2KRM A;  1QKW A;  4GLM A;  2OAW A;  2FO0 A;  2F2W A;  2JS0 A;  3CQT A;  2LQN A;  1SRM A;  4AG1 C;  1Z9Q A;  2KR3 A;  1AZG B;  4AFZ C;  2K3B A;  2IIM A;  3NMZ C;  1PHT A;  2EVR A;  4RTU A;  1M3C A;  2K6D A;  1X6G A;  1X6B A;  2AKL A;  2LNH B;  3RNJ A;  1WIE A;  1NYG A;  3U23 A;  2KGT A;  2DYB A;  2KYB A;  3H0F A;  2LJ3 A;  1JXM A;  4F17 A;  3H0H A;  2K7A A;  2JMA A;  1OOT A;  2FEI A;  4HVV A;  1NEB A;  4E6R A;  1QWF A;  3REB B;  2EPD A;  1HD3 A;  2H8H A;  1ZX6 A;  1MUZ A;  2CH4 W;  2RMO A;  2QDL A;  1NLP C;  2RQV A;  1AOJ A;  1ABO A;  4Z88 A;  2ED1 A;  2X3W D;  3SHW A;  1QLY A;  2GTJ A;  5L23 A;  3M0P A;  1T0J A;  2LJ0 A;  1U3O A;  2V1Q A;  1ZLM A;  4M4Z A;  2C0I A;  2KBT A;  2K79 A;  2DRK A;  4JPB W;  2V1R A;  3I35 A;  3GBQ A;  2DLP A;  5IHK A;  1X69 A;  4OML A;  3VS7 A;  1ZBJ A;  3EG1 A;  1RI9 A;  2KYM A;  1K76 A;  2GGR A;  2C0T A;  4X1V A;  1FMK A;  2RQU A;  4AG2 C;  4RTZ A;  2DL3 A;  2AZV A;  4CC2 A;  2W0Z A;  1UUE A;  2DMO A;  2ESW A;  2JTE A;  1IO6 A;  1UTI A;  2LX7 A;  2MCN A;  3SEM A;  1SSH A;  2AK5 A;  4JZ3 A;  4AFU C;  1WXT A;  2G6F X;  5FW9 A;  2SRC A;  1UE9 A;  2CRE A;  2O9S A;  1JEG A;  1AWW A;  3C0C A;  1X2Q A;  2DA9 A;  1WFW A;  2LQW A;  2L3P A;  1BB9 A;  3QWY A;  1PKS A;  1E7O A;  3FJ5 A;  3REA B;  1GL5 A;  4F16 A;  2L3Q A;  2BTT A;  2BZX A;  4LUE A;  1UEC A;  4JJD A;  2YSQ A;  1KIK A;  2DF6 A;  1MV0 B;  2KRS A;  1PRM C;  2J06 A;  1UDL A;  3NHN A;  1SPK A;  1WXU A;  4KRT A;  2A37 A;  2O2O A;  2ROL A;  2LJ1 A;  4FSS A;  3H0I A;  4RTW A;  4Z8A A;  2EYX A;  1YWP A;  2RPN A;  4WCI A;  1H3H A;  3VS5 A;  1GCQ A;  2SEM A;  4RTT A;  2EBP A;  2DM1 A;  1QKX A; 
#chains in the Genus database with same CATH topology
 1WHH A;  4C5G A;  1CKB A;  3PVL A;  3LW5 E;  1VQ4 Q;  3QYH B;  5LJ5 j;  2QI2 A;  3V7R A;  2OI3 A;  1M90 R;  2RO0 A;  5LL6 S;  2XU8 A;  3M0T A;  2PUO B;  4FIB A;  2HDA A;  4J7I A;  4VUB A;  1UJY A;  4CC7 A;  5GAN 4;  4IUV A;  2M51 A;  1QVG A;  3HRT A;  4PK4 A;  4PLI A;  2L0A A;  2O01 E;  1WX6 A;  4JLG A;  2G3R A;  1VQK A;  1ZSG A;  2I0N A;  2Y4Y A;  3CCJ Q;  3CCS T;  3OW2 A;  1MMD A;  5FWB A;  1VA7 A;  5HK3 A;  1V76 A;  4UC4 A;  1M4Z A;  2L2P A;  1C0M A;  3CBP A;  1H8K A;  1BI0 A;  2FZC B;  1NLO C;  1K4U S;  4OB2 B;  2NWM A;  1TSF A;  4L6V 5;  5D6Y A;  4N4H A;  2DPP B;  4ELY C;  2CYZ B;  1VYV A;  2LMJ A;  3T9N A;  5KYW A;  3MEA A;  2KT1 A;  4C5I A;  3FC3 A;  3HTR A;  5FU6 C;  2E5Q A;  4OMP A;  2QXF A;  1G3T A;  1Y0M A;  3EFO B;  4F04 B;  1M1G A;  1N8R U;  2A36 A;  4ATO A;  1Y57 A;  2DBK A;  5CVI A;  1GBQ A;  4M78 D;  2ZAE A;  3QHS A;  2FZK B;  1RLP C;  1VQ9 A;  1UGS B;  5GAO r;  1BU1 A;  1IGU A;  1M1F A;  4HT9 A;  2P0K A;  2K2V A;  3JCM X;  4X9C A;  1GRI A;  1VQ4 A;  3OYA A;  4JJB A;  3RIR A;  5GAN 5;  4HCC A;  1LVK A;  1SHF A;  3EFS A;  2DNU A;  1G3S A;  1OU9 A;  2F5K A;  2IG0 A;  1QVG S;  1UB4 A;  4AT1 B;  2F69 A;  5GAM f;  4EMK C;  2QG9 B;  2KE9 A;  4BUG A;  5GAO p;  5GAO l;  2KAF A;  3ZBD A;  4PFP A;  1VQM A;  1OQK A;  2YUP A;  4FM4 B;  3A5Z B;  4M7D D;  2ED0 A;  3ASK A;  2ZPG B;  2MIO A;  3SWN B;  1X2K A;  1YHQ Q;  1YJW A;  4M7A E;  4MZT A;  5L8R E;  1D1A A;  3M55 A;  4MZP A;  3OYK A;  4ELZ C;  4P5N A;  2L3R A;  4RG8 A;  4E7J A;  1VQ8 T;  2PNI A;  3OS2 A;  1Q86 U;  2X9H A;  3CCM T;  3FEO A;  3SD4 A;  4PJJ A;  2HBP A;  2GFA A;  2HKN A;  1J3T A;  4RTY A;  1W1F A;  3D7S B;  2CSI A;  3EFO A;  2HQX A;  4A54 A;  3L2U A;  5LJ5 g;  3GNF B;  1G2B A;  1O9S A;  1ABQ A;  2EYY A;  2CS7 A;  2X51 A;  3M59 A;  1Q81 C;  2JW4 A;  1KD1 R;  3PIO A;  3NTH A;  2EQU A;  3CCJ A;  3R6O A;  2JTF A;  1CKA A;  2DVE A;  4HVW A;  2LVM A;  2VXE A;  1MV3 A;  2YXY A;  1KQS S;  1V1C A;  3CCU Q;  3EHR A;  2XIC A;  1WGS A;  2P84 A;  1NJI C;  1WJR A;  4QQ6 A;  5D6X A;  2D0Q B;  4Z89 A;  4C5H A;  3P8H A;  3CMA T;  2OTJ Q;  1TUD A;  4BDZ A;  4OMN A;  1RUW A;  1S72 A;  1TG0 A;  3GLX A;  1SEM A;  5C0M A;  1M1K C;  4M7D C;  4DEX A;  1BBZ A;  1BI1 A;  1PC0 A;  3ZL7 C;  2RNA A;  1ARK A;  1OYX A;  4HVU A;  4C92 F;  2DER A;  1K8A R;  4L5G A;  2JS2 A;  4RTX A;  2JM8 A;  4GBQ A;  3X20 B;  3E9G A;  4ZN3 A;  1GCQ C;  4OB1 B;  3V7S A;  1BCM A;  2D8J A;  2A7Y A;  4PFZ A;  4CI0 C;  2QEX A;  1JU5 C;  2F2V A;  3OSV A;  3TSZ A;  5GAN f;  2EJF A;  3JCM W;  1AEY A;  1GFC A;  1I5O B;  3JCM d;  3RBB B;  4EIK A;  1AZE A;  2PUK B;  2LC4 A;  3OA6 A;  3TQ7 P;  4M78 E;  4C0D C;  4ESR A;  3CCQ T;  2DZC A;  2HD0 A;  4LD9 K;  1ZA2 B;  5GAM d;  1K73 R;  2FHD A;  3CC2 T;  4E7H A;  1JB0 E;  4FW2 A;  4J9G A;  2OTJ A;  2MOX A;  1WI7 A;  2JM9 A;  1KQS P;  2E6N A;  3CD6 Q;  4LDW A;  1FMW A;  3QXE B;  2K4Y A;  2DD5 A;  2KSS A;  4PJM A;  3PFS A;  2KVQ G;  2QGF B;  1C1A A;  2LQN A;  5KYW B;  4MZM A;  1AZG B;  1NJI R;  3MHX A;  4AFZ C;  4DBR A;  5GAN 8;  2K3B A;  4PJO B;  1PHT A;  4RTU A;  4LD6 A;  3L2V A;  4RCB A;  1X6G A;  1X6B A;  2LNH B;  3RNJ A;  2PQW A;  1WIE A;  2KGT A;  3G4S T;  4BY6 C;  1YIT Q;  1W2B A;  4J5Y A;  1D0X A;  5IN1 A;  1N8R R;  1H64 1;  1K8A C;  1DJ7 B;  2EPD A;  2ZZD A;  3OYG A;  2H8H A;  1ZX6 A;  4IUR A;  1KC8 C;  4C8Q C;  4B6M A;  4Z88 A;  3UDC A;  2X3W D;  3OYC A;  1UGQ B;  4M78 C;  1VQ7 Q;  1RI0 A;  2E12 A;  3M0P A;  4C8Q E;  2JUF A;  3OYF A;  5LJ5 e;  3OYH A;  5DLO A;  2EQJ A;  3G71 Q;  4HCZ A;  4BI4 A;  2C0I A;  4FSX A;  1WJS A;  4IUQ A;  2HAX A;  2AIR B;  2O4X A;  2P4T A;  2KI7 A;  4OML A;  2MYS A;  3EG1 A;  2KYM A;  1VIF A;  2GGR A;  4X1V A;  1FMK A;  4M7A C;  3CCV A;  2R5M A;  4PNO A;  4CC2 A;  3PNW C;  2DMO A;  4XTY A;  2JTE A;  4C92 E;  2RK1 A;  3SEM A;  3DLM A;  2AK5 A;  4AFU C;  2DYI A;  2IVW A;  1IRE B;  1WXT A;  2G6F X;  3WVE B;  5FW9 A;  1YIJ A;  1ZSZ A;  2E65 A;  2O9S A;  1JEG A;  2CP6 A;  2PVO B;  2HKQ B;  2CKK A;  3CCS A;  5KYY B;  4KBM B;  2LQW A;  3OB9 A;  1WHK A;  4PL6 A;  1BB9 A;  4E7L A;  4M77 F;  1XTD A;  4F16 A;  2BTT A;  4LUE A;  1TH7 A;  9ATC B;  4TVR A;  2E4H A;  4DQ2 A;  2DF6 A;  1MV0 B;  1OZ2 A;  1PRM C;  2X4X A;  2HL3 A;  2J06 A;  1IGQ A;  2NUT B;  3A8H B;  1TS9 A;  1KQ1 A;  4KRT A;  3HL8 A;  5CAI A;  2FB7 A;  5GMK i;  1U1T A;  2ROL A;  4F7U F;  4MML A;  2LJ1 A;  1WQW A;  4OMF B;  3CD6 A;  3CC2 A;  2RPN A;  4WCI A;  1N27 A;  4ZGE B;  2RJC A;  1VIE A;  4N4G A;  5FU7 C;  1QKX A;  2E1H A;  1WDX A;  2DIL A;  1OUL A;  3SWN A;  1VOM A;  2A28 A;  4JUV A;  3CCR A;  2MMP A;  4YTL A;  4ZNX A;  2JMC A;  1D3B A;  3CC7 Q;  1IRX A;  5AYF A;  3M57 A;  1I8F A;  1YIT A;  1KD1 U;  5CK9 A;  1JJ2 P;  2EGC A;  1ZUY A;  2DE0 X;  1XOV A;  4JRP A;  1PD1 A;  1M9S A;  3A8L B;  1RL2 A;  5I21 A;  1I5L A;  2PZ1 A;  1VYU A;  3OBY A;  2FRW A;  2GNC A;  2RHU A;  4IUT A;  4Q5W A;  4AFQ C;  2J7I A;  3VU3 C;  2EQK A;  3ZFJ A;  1QW1 A;  1KSW A;  5KYY A;  2XG8 D;  1M30 A;  1S72 Q;  2J6O A;  3P8B B;  3X26 B;  2AHJ B;  2HCK A;  3OS0 A;  1Q86 C;  5KE3 A;  1PSF A;  1HJD A;  2LCS A;  2CSQ A;  1JQQ A;  5GAN 6;  2K2M A;  4J9E A;  3HSB A;  5FU6 B;  2RQR A;  3JB9 J;  1YNZ A;  3V8K A;  1RAE B;  3QZ5 B;  4BD3 A;  3OYI A;  3CCR T;  4RCC A;  2DXT A;  2HQE A;  3M56 A;  1VQ6 Q;  2YRD A;  3NPF A;  3QO3 A;  1Z9Z A;  4PKC C;  1H92 A;  5GAO m;  4A4K A;  3H41 A;  2QQB A;  4LNP A;  3TCJ A;  3MP8 A;  4A4F A;  3OYL A;  2HL5 C;  1QP3 A;  2QQS A;  1D3B B;  2BE9 B;  1K9M C;  2OX7 A;  1I81 A;  2M16 A;  3J81 E;  3A98 A;  1X27 A;  1RAH B;  4BE1 A;  1S1N A;  4XK8 E;  4CC4 B;  3M0S A;  3JCM e;  4GY5 A;  3C94 A;  1YJ9 Q;  2CDT A;  5GJV B;  1KG1 A;  2CP3 A;  4PJO F;  2COW A;  1AWO A;  4EMK B;  3EH1 A;  5KYN A;  4F14 A;  4OGC A;  1YHQ A;  1M3A A;  3O8V A;  1ZUK A;  3CCE Q;  1VQ6 A;  1W6X A;  2DXB A;  2RJE A;  5I22 A;  4GLK A;  2E6Z A;  1SKU B;  4LDU A;  2YUQ A;  1JXO A;  4M78 G;  1NPR A;  5CIU A;  3FRN A;  4LDV A;  4OMM A;  1JBM A;  2RM4 A;  3AHU A;  3MEU A;  2DO3 A;  1D1B A;  1X43 A;  2M1H A;  1UEB A;  1T3L A;  3JB9 H;  3E19 A;  2YRV A;  2VB6 A;  1M90 C;  2O4X B;  2O88 A;  5GMK e;  1T3S A;  2M02 A;  1PD0 A;  5A0G A;  2DAQ A;  2E5K A;  5LJ5 f;  4J9C A;  3GOX A;  5CKD A;  3Q1J A;  5LJ5 h;  1VQK T;  1C6V X;  2RK2 A;  4J6X A;  4PJO A;  3AT1 B;  3E9F A;  1R0C B;  3L2Z A;  4FU6 A;  3I5S A;  1UG1 A;  3EHQ A;  5CQX A;  5DLQ E;  2GQI A;  2AZS A;  2DL4 A;  2LQ8 A;  4HKE A;  2EKO A;  2RHX A;  4R0K A;  3QJY A;  1I07 A;  2DRM A;  4J9I A;  2D6F A;  1O75 A;  3PE0 A;  4FYX B;  2GBQ A;  2Y90 A;  4FYV B;  1PNJ A;  1BCO A;  3VRZ A;  2CUB A;  3M0U A;  3VRY A;  2L3S A;  3JAM E;  3G71 A;  2DZ9 A;  2OTJ T;  2HBW A;  4C8Q G;  1E6H A;  3E2U A;  3LLR A;  4DBQ A;  5KCH A;  4K11 A;  1YIJ Q;  3TSW A;  5KE2 A;  1P92 A;  5A0L A;  2EGA A;  2DD4 A;  2ECZ A;  1VQO T;  2JXB A;  3RKX A;  2AT1 B;  3N5B B;  2LQK A;  2F5T X;  1WYX A;  2DL5 A;  4A53 A;  4ME7 A;  2KNB B;  1MMA A;  3INZ A;  3BE3 A;  5ECA A;  3FB9 A;  2VKN A;  3KXT A;  1IXD A;  2DJQ A;  1VYT A;  1D09 B;  5CO7 A;  3CC4 A;  3QJ6 A;  2DXC A;  1K9A A;  4QW2 A;  3KFV A;  1YJ9 T;  3OYN A;  4IIM A;  3VS3 A;  1VQ7 T;  1EFN A;  4J9D A;  2LCL A;  5IH2 A;  1N5Z A;  2HSP A;  2JOY A;  2RF0 A;  4ZGJ B;  2PTK A;  4BAC A;  3VS6 A;  5LJ3 g;  8AT1 B;  3LGL A;  2K57 A;  4E47 A;  4BE2 A;  2CGH A;  4IUU A;  1QVG P;  3HFO A;  2JT4 A;  1RAD B;  4RTV A;  2A08 A;  2KRO A;  1X6O A;  3CCM Q;  1WHM A;  4MMK A;  3S6W A;  3JB9 I;  2ZGW A;  1YJ9 A;  2DL8 A;  2JN0 A;  1BI3 A;  3RKW A;  1B3Q A;  1K73 U;  3PTA A;  1UGV A;  3QDF A;  3VYH B;  5GAM g;  1FYN A;  3F70 A;  3CC4 T;  2DXU A;  4HA8 A;  4D8K A;  3UPU A;  1U1S A;  2YT6 A;  3RES A;  2O9V A;  2D1X A;  2E70 A;  3HP9 A;  3C12 A;  2RI5 A;  2V8K A;  2YHT A;  1BI2 A;  4GLM A;  4C0Z A;  2YRC A;  3L1A A;  2YLB A;  3JB9 D;  4HCB A;  3QBY A;  4IUP A;  4E7S A;  2F2W A;  2KQW A;  3CQT A;  1SRM A;  4AG1 C;  4LDY A;  4XU1 A;  4EMG A;  3SFM A;  2IIM A;  5I2M A;  2EVR A;  4BDY A;  1VQL A;  3RMS A;  1K9M U;  3EH2 A;  3PIP A;  5AT1 B;  1NYG A;  2PVD B;  3U23 A;  3CCL A;  2JNG A;  1NE8 A;  1FMV A;  3H0H A;  1W4S A;  1OOT A;  1RAF B;  4E6R A;  3KUF A;  1QWF A;  3PMT A;  3REB B;  2Z0W A;  3EAE A;  3G6E A;  1YJW T;  2QDL A;  1NLP C;  3CC7 T;  4M77 E;  2LT4 A;  3SHW A;  4ZN1 A;  2E10 A;  5L23 A;  1T0J A;  4M77 C;  3BDU A;  3UT1 A;  1PG5 B;  4JPB W;  3L2R A;  3A1P A;  5EG2 A;  2DKG A;  3A8G B;  3CCQ Q;  4EMK A;  3FIF A;  5CKE A;  3OYJ A;  1M1K R;  2L5Q A;  3VS7 A;  3JCM h;  1BYM A;  2YLC A;  1Q86 R;  1AT1 B;  3MKD A;  5GAN e;  1QVF A;  4JJN K;  2NUP A;  2W0Z A;  1LNX A;  3GIB A;  2DEQ A;  4B9X A;  1QVF P;  4M77 D;  5A2Q E;  2EFI A;  4N0A A;  2R58 A;  4QVD A;  3CC2 Q;  4V2S A;  1UE9 A;  2CRE A;  1B34 A;  1AWW A;  2DA9 A;  1WFW A;  1YFN A;  1D0Y A;  2LRQ A;  1E7O A;  3REA B;  1GL5 A;  3J7A F;  2L3Q A;  2BZX A;  3RDV A;  4C92 B;  4M78 F;  3MET A;  4JJD A;  2RJD A;  2YSQ A;  2E41 A;  3DB4 A;  2XDB A;  3TEE A;  2V26 A;  1QMC A;  1OX9 A;  5GAN 3;  2R57 A;  5KYX B;  1VQ5 T;  1ZBX A;  1SPK A;  4E7K A;  3VKI A;  1VQM Q;  2QEX Q;  2HQH A;  1X01 A;  4E7I A;  1NZ9 A;  1VQ6 T;  4Z8A A;  2EYX A;  1H3H A;  4M75 C;  3VUB A;  4ANJ A;  5LJ3 f;  4Y91 A;  3JRZ A;  1HK9 A;  1M8M A;  2VYT A;  2FPF A;  1GBR A;  4PFO A;  4E2F B;  4PJN A;  4JZ4 A;  3HRU A;  2VWF A;  1V29 B;  2E3H A;  4M7D A;  2EW3 A;  4FT2 A;  2BIV A;  3CCU A;  3RR6 A;  1VQL Q;  2LT1 A;  2KRN A;  2CUD A;  1IZ6 A;  3GF5 A;  4JJC A;  3I55 A;  3TRE A;  1PWT A;  4XU2 A;  3EGX A;  1K1Z A;  2R5A A;  1M3B A;  2CH4 A;  2COZ A;  4J9H A;  1KC8 R;  2H3E B;  2J05 A;  2X35 A;  1EX4 A;  2E3I A;  2NUZ A;  2P0Q A;  4AFS C;  5GMK l;  4FYY B;  2B8A A;  2VVK A;  1QCF A;  1EZZ B;  4X9D A;  1WNL A;  2RHZ A;  1AHJ B;  3ZEH A;  1QWE A;  2YWW A;  3UA7 A;  5IT9 E;  1M90 U;  1VQ9 T;  3WXM B;  4XU0 A;  1M27 C;  4C92 A;  4KH0 B;  4JS4 A;  3MPU B;  4D6W A;  3S3O A;  3CCV Q;  4CC3 A;  1FX7 A;  3CCM A;  1Y71 A;  5HKC A;  4LDX A;  3UF4 A;  1GCP A;  1QVP A;  1ZHI A;  2CT4 A;  5KCO A;  2XDP A;  2DK3 A;  2ROT A;  4XTX A;  2QQA A;  4F7U G;  3MP1 A;  3JB9 F;  2K5F A;  2LP5 A;  2P0P A;  3ME9 A;  2QA4 Q;  1R8O B;  4M75 F;  3X25 B;  3NGP A;  1VQ7 A;  1VQN Q;  1YJN Q;  2KT8 A;  3QYG B;  1TUC A;  3NFC A;  3I56 T;  2KY9 A;  3CBO A;  2PVG B;  2JTM A;  3EGD B;  2DL7 A;  3EGU A;  3G4S Q;  1YIT T;  1YIJ T;  3I5R A;  4KUI A;  3LX7 A;  5CR2 A;  4HT8 A;  4OMO A;  2HZY A;  5I11 A;  2ABL A;  3CXC A;  3IQL A;  4M77 G;  3EGX B;  2AKK A;  1VQK Q;  8ATC B;  1RLQ C;  1LCK A;  1NG2 A;  1WA7 A;  5J26 A;  3VS2 A;  1B07 A;  2EGE A;  3VV0 A;  1A0N B;  3M53 A;  2FG0 A;  1KK7 A;  2ATC B;  3EFR A;  1VQP A;  4LUD A;  2RJF A;  2ZPI B;  1LJO A;  1ZSZ B;  4DEY A;  3L2W A;  1UGR B;  4C0D B;  1S72 T;  4OB3 B;  4O5V A;  2M9U A;  3SDZ A;  2VXF A;  4Y92 A;  1AWX A;  3BY7 A;  3M4G A;  2QAS A;  1M5Q 1;  3JCM g;  4OB0 B;  2WSF E;  4KGV B;  1KC8 U;  2FPE A;  1OPK A;  2RN8 A;  2BZ8 A;  2WAC A;  4L59 A;  3HRS A;  2NUT A;  4X34 A;  2RD1 A;  1Q82 R;  2O31 A;  2E64 A;  2M0Y A;  1FXX A;  1G8X A;  2VAS A;  4MDW A;  4C92 D;  4FL6 A;  5HK0 A;  3OSS C;  4PJO D;  1U06 A;  2KXD A;  3UWN A;  1F1B B;  1RAC B;  1Y96 B;  4QT7 A;  3I55 Q;  1UHC A;  3JCM V;  2RHI A;  1VQO Q;  1TU0 B;  1N6A A;  3X28 B;  1GFD A;  2GTO A;  1M2V B;  1Q7Y R;  5CKB A;  2YUN A;  3OY9 A;  4BY6 B;  3EG2 A;  2K9G A;  4RUG A;  1YI2 Q;  2MPX C;  1MMG A;  2BKD N;  3OMG A;  2JJ9 A;  2J6K A;  1Y7X A;  1G83 A;  2EQI A;  1YBY A;  2RB6 A;  1W2B P;  2FVU A;  1KJW A;  2RQW A;  1KHC A;  4LN2 A;  4OP0 A;  3JCM Q;  4DBH A;  1I4K 1;  2DTH A;  1FWZ A;  2DTI A;  4C92 G;  3M9Q A;  3PMI A;  2DX1 A;  2K5L A;  5GAN 2;  4PJO G;  4FT4 A;  1VQO A;  1W70 A;  5J39 A;  3SWN C;  4JRQ A;  2CZ6 B;  1Q95 G;  2B86 A;  2PU9 B;  4M75 E;  2A3L A;  2QQ9 A;  2XDD A;  1Q81 U;  1JJ2 A;  1CSK A;  4RG2 A;  1K0X A;  2P4R A;  3QUI A;  4M75 D;  1UHF A;  3JCM P;  1ZUU A;  3ULR B;  1KHI A;  4C0G A;  5CKH A;  5GJW B;  5GAO q;  1B34 B;  2RA2 A;  1UJ0 A;  3TVT A;  1JO8 A;  3V7C A;  3QDR B;  4HCK A;  3LH5 A;  3OW2 P;  3CCR Q;  2QK0 A;  1PCX A;  2X3X D;  5KH6 A;  5DM7 R;  1YCY A;  3UA6 A;  1H3Z A;  5DY9 A;  1XQH A;  2D0N A;  4IKF A;  3QSU A;  4II1 A;  2OAW A;  1IHW A;  4QVZ A;  3VUZ A;  2JS0 A;  3G1J A;  2CP0 A;  5D6W A;  1Z9Q A;  2KR3 A;  3H9N A;  1VQP Q;  2MI6 A;  3GPL A;  3JB9 G;  3TU4 K;  3OS1 A;  5I2S A;  3QKJ A;  1NPP A;  1XNI A;  2EAY A;  3NMZ C;  2K6D A;  2AKL A;  4XTZ A;  4Y28 E;  2EQM A;  2A0F B;  2DYB A;  2XD0 A;  3CME Q;  2QDY B;  3LWI A;  3CPW P;  4F17 A;  1VQ5 Q;  2RHY A;  3LH0 A;  4QQG A;  2JMA A;  3CPW S;  2HSE B;  2FEI A;  1D1C A;  1SG5 A;  3FDR A;  4OVA A;  5GAN j;  2ZCF B;  4Z02 A;  2M0O A;  3CEY A;  1MUZ A;  2CH4 W;  4OF1 A;  2GF7 A;  4QQD A;  3JSC A;  4C0F A;  1AOJ A;  1ABO A;  2QQR A;  2V8J A;  1QLY A;  2GTJ A;  1TUG B;  2LJ0 A;  3H8Z A;  1YJW Q;  4B9W A;  2ZPB B;  1MGQ A;  4KH1 B;  3M4Y A;  2DRK A;  1YJN T;  3I35 A;  3GBQ A;  1VQ8 Q;  1MMN A;  4KGZ B;  5FRO A;  5IHK A;  1X69 A;  1R77 A;  2EIF A;  4M75 G;  1K76 A;  2C0T A;  2VV5 A;  2RQU A;  2X4J A;  2CP7 A;  5GMK m;  1R0B G;  4A4H A;  2D9T A;  4RTZ A;  3CCJ T;  4KUD K;  2DL3 A;  1WZO A;  1UUE A;  3NTI A;  2ESW A;  1IO6 A;  1VQM T;  2LX7 A;  2MCN A;  1MNE A;  1SSH A;  3HKS A;  3CPF A;  2DJZ A;  1M1K U;  1UGP B;  2SRC A;  1VQN A;  2WSC E;  4J6Y A;  4PJL A;  4EPC A;  3G6E T;  2L89 A;  4ZTJ A;  1VQ9 Q;  2L3P A;  3QWY A;  3FJ5 A;  3CD6 T;  3OS5 A;  4J7F A;  2LTO A;  2BUD A;  3CCV T;  3JCM b;  4JRK A;  4PJO C;  4OGE A;  1KIK A;  3EGD A;  1YI2 T;  1VQ4 T;  2KRS A;  2VGN A;  4MDX A;  2MF2 A;  5CKF A;  4M7A D;  1UDL A;  1ZQ1 A;  3OYB A;  1WXU A;  2A37 A;  2WSE E;  5LJ3 e;  1Y96 A;  2O2O A;  3P8D A;  3WVD B;  2CZ7 B;  3DKM A;  3CXC S;  1YWP A;  1GCQ A;  5FRM A;  2DIQ A;  2EBP A;  2DM1 A;  4WF2 A;  4FYW B;  1Y07 A;  4M75 B;  4C8Q B;  4N4I A;  4LE9 A;  4KGX B;  1OX8 A;  3EG9 A;  1Q82 U;  2LZ6 B;  1LPL A;  2OTL Q;  4R55 A;  3CCE T;  2Y4X A;  3QG1 A;  4J83 A;  4J9B A;  3M54 A;  5GMK j;  2F2X A;  5IAY A;  1NYF A;  4KT0 E;  1KQ2 A;  4M7D E;  2W10 A;  2LDM A;  2FPD A;  3L2Q A;  3CMA Q;  2XKO C;  4JRI A;  5GAN d;  1N9R A;  3DB3 A;  3OQ5 A;  4FCY A;  4M7A B;  3JCM f;  1PKT A;  4NS5 A;  1Q81 R;  1YWO A;  2EWN A;  3M58 A;  3S3M A;  4BI3 A;  3MO8 A;  1IB8 A;  3MJX A;  1TTH B;  3QPH A;  4F7U E;  1PSE A;  1SRL A;  4DOW A;  2KEA A;  2XK0 A;  2DBM A;  2EYW A;  3SB2 A;  1OZ3 A;  1M8V A;  1VUB A;  1VQL T;  1YI2 A;  4EDU A;  2C0O A;  1I1J A;  1M2V A;  4J9F A;  3CCL Q;  1KFZ A;  1SF9 A;  1BK2 A;  2RI2 A;  4XTV A;  5LJ3 h;  5GMK h;  3QZ9 B;  1OPL A;  3EG0 A;  7AT1 B;  2X4Y A;  3S3N A;  3LWH A;  5D7U A;  5GAN 7;  1D0Z A;  1M2O A;  1YP5 A;  2NYS A;  1VQN T;  5GAM j;  4ZTF A;  5C6S A;  1NM7 A;  2XI9 A;  2FZG B;  2DTO A;  3KBG A;  2EJG A;  1ACM B;  2FRY A;  2KXC A;  1G3W A;  1OI1 A;  3I56 A;  4C8Q A;  3C95 A;  4JDS A;  2XID A;  5GAO n;  1NJI U;  3RER A;  4M78 A;  2OTL A;  2ZPF B;  3BW1 A;  3VYG A;  3CBM A;  4F7U A;  1YHQ T;  3O5Z A;  2OJ2 A;  2BZY A;  3ER0 A;  2GFU A;  4OMQ A;  1N8R C;  3A8O B;  1JJ2 S;  6AT1 B;  3FJP A;  4O6J A;  1XJW B;  1AD5 A;  3RKY A;  1OEB A;  2J6F A;  3VS4 A;  4DOV A;  1K73 C;  1UFF A;  1OV3 A;  2MK5 A;  1NBE B;  4M7A A;  2NUP B;  4LXC A;  3MEV A;  2YUO A;  1U5S A;  1HSQ A;  1HXD A;  2RI3 A;  4C5E A;  5GAM e;  2VUB A;  3L42 A;  2EYZ A;  3CC4 Q;  4M77 A;  3RMQ A;  1ZSZ C;  2D8H A;  3I9Q A;  3OYE A;  3CCS Q;  2KDS A;  4NL3 A;  1TXQ A;  3G6E Q;  2K3X A;  3JV3 A;  3LGF A;  4M7A F;  4XU3 A;  3V8J A;  3VS0 A;  1HYO A;  1YCS B;  2QEX T;  3M0Q A;  4HXJ A;  2QYZ A;  4A4E A;  2X4W A;  1BKB A;  3M0R A;  1WPY A;  2VC8 A;  4PLL A;  5A0D A;  5KYX A;  1YJN A;  2EYQ A;  3MCA B;  2ENM A;  3HFN A;  4EMH A;  5IXB A;  3CCU T;  2DIG A;  3PVQ A;  2LX9 A;  2DVJ A;  3QII A;  4D8D A;  4N0A C;  1RAA B;  3CPW A;  4J6W A;  5GAN g;  4XTU A;  5HCK A;  3CMA A;  1WHJ A;  1KD1 C;  4C8Q F;  2ZPH B;  1K8A U;  4NOY A;  2YDL A;  2HNI A;  1AWJ A;  1RAG B;  3QWX X;  1E6G A;  1JRI A;  1WLP B;  1I0C A;  1LOJ A;  2H3J A;  5IXF A;  1ZA1 B;  4BB7 A;  4ORZ A;  2LCC A;  2RQT A;  5LJ3 d;  5IHN A;  4C8Q D;  5EC7 A;  3CME T;  5FWC A;  2KK4 A;  4M7D B;  5IHI A;  2XMF A;  4BE0 A;  1WXB A;  4JS5 A;  1SHG A;  3I55 T;  4A63 B;  2EKH A;  5GAM h;  4XTW A;  2C06 A;  2GQV A;  2QTX A;  1K0S A;  1VQ5 A;  1YN8 A;  3G71 T;  4JLI A;  2CP2 A;  3OBW A;  3EG3 A;  3CME A;  4M75 A;  3PGG A;  3BFM A;  2QA4 A;  2HEQ A;  3EG9 B;  4M77 B;  2DET A;  1BIB A;  2GCX A;  4KUL A;  1PRL C;  3OYM A;  4M7D G;  3G7Z A;  1NEG A;  3THK A;  3VS1 A;  4QVC A;  2F1L A;  3UAT A;  2QAZ A;  4IIO A;  3URG A;  3RUX A;  2CZ1 B;  1T0H A;  3E1S A;  3R6N A;  2CT3 A;  2K5I A;  4A4G A;  2QA4 T;  1KQS A;  5LJ3 j;  1G3Y A;  1AVZ C;  1X75 C;  4PJO E;  5HY6 A;  4RMO A;  2KRM A;  5KYU A;  1U8R A;  2LNV A;  1QKW A;  3I56 Q;  3C4S A;  5GAN h;  1TWB A;  4QKU A;  2MWO A;  2FO0 A;  2EJ9 A;  3BDL A;  1RAI B;  2CP5 A;  3A8M B;  2RH2 A;  1VQ8 A;  4RKU E;  2HMA A;  2QTV A;  4M7A G;  4C92 C;  1M3C A;  2KMT A;  4M7D F;  5FLX E;  2KYB A;  3H0F A;  2LJ3 A;  1JXM A;  4FW1 A;  1Q82 C;  2QGG A;  1W2B S;  2K7A A;  2MWP A;  5CQY A;  3CCL T;  4HVV A;  3X24 B;  1NEB A;  1WJQ A;  4ZGD B;  1HD3 A;  1MND A;  2RMO A;  2BE7 D;  3GNG A;  2ZPE B;  3CXC P;  5J3B A;  2JVV A;  2RQV A;  4M78 B;  1K9M R;  3FLG A;  2ED1 A;  2JZ2 A;  3LYI A;  1QQJ A;  1SSF A;  1WQ7 A;  3HHT B;  3HPW A;  2XHC A;  3MEW A;  5M9O A;  1U3O A;  2V1Q A;  3OYY A;  1PM3 A;  1Q7Y C;  3M5A A;  2FL7 A;  3H6Z A;  4AMC A;  3CCQ A;  1ZLM A;  4M4Z A;  2KBT A;  2K79 A;  1OU8 A;  3JCM J;  1WHL A;  2V1R A;  3CCE A;  2CZ0 B;  2OAU A;  2DLP A;  3V8L A;  3GP8 A;  1G5V A;  5CCA A;  1ZBJ A;  1RI9 A;  3VJP A;  4DA4 A;  2L8D A;  4AG2 C;  5KYU B;  4BI8 B;  2AZV A;  3J80 E;  1QP2 A;  1IHV A;  1UTI A;  4J8O A;  4JZ3 A;  5LJ5 d;  3PT9 A;  5FRN A;  4R56 A;  1QCN A;  3C0C A;  1B7T A;  1VQP T;  1X2Q A;  4NL2 A;  4XAX B;  2DEU A;  1MHN A;  3DLL A;  3MP6 A;  1PKS A;  2VGM A;  1UEC A;  4F7U B;  2OTL T;  4XQ3 A;  1Q7Y U;  3OMC A;  1RAB B;  2MAM A;  4E7Z A;  3OYD A;  3NHN A;  3JCM c;  4CRI A;  2K3Y A;  1QVF S;  2DFU A;  1WHG A;  1TOV A;  2V8I A;  2FYK A;  3CC7 A;  4FSS A;  1BIA A;  3H0I A;  4DBF A;  1QCO A;  4RTW A;  2NLU A;  5FU7 B;  3VS5 A;  2COY A;  2I2L A;  2SEM A;  4RTT A;  3OW2 S;  1N9S A;  1GXI E;  1EIF A;  2IPO B;  4WTO B;  3G4S A;  3NTK A; 
#chains in the Genus database with same CATH homology
 4LE9 A;  1WDX A;  2DIL A;  2A28 A;  1CKB A;  3PVL A;  1M8M A;  4ZNX A;  2JMC A;  2FPF A;  2LZ6 B;  1GBR A;  2OI3 A;  4J9B A;  4JZ4 A;  3M0T A;  2HDA A;  2VWF A;  2F2X A;  1NYF A;  2EGC A;  2EW3 A;  1UJY A;  1ZUY A;  1XOV A;  2DE0 X;  4CC7 A;  2W10 A;  2FPD A;  2M51 A;  2KRN A;  2CUD A;  2L0A A;  4JJC A;  1WX6 A;  1PWT A;  2PZ1 A;  1VYU A;  1ZSG A;  2I0N A;  1K1Z A;  2FRW A;  2GNC A;  5FWB A;  1VA7 A;  1M3B A;  1PKT A;  2CH4 A;  4J9H A;  1YWO A;  4AFQ C;  2J05 A;  2J7I A;  2L2P A;  2NUZ A;  1H8K A;  4AFS C;  2VVK A;  1QCF A;  1KSW A;  1NLO C;  1SRL A;  1K4U S;  1QWE A;  1M30 A;  2NWM A;  2J6O A;  2KEA A;  3UA7 A;  2DBM A;  2LMJ A;  1VYV A;  2EYW A;  2HCK A;  1HJD A;  2LCS A;  1M27 C;  2CSQ A;  2C0O A;  1I1J A;  1JQQ A;  2KT1 A;  4J9F A;  1KFZ A;  1BK2 A;  4CC3 A;  2K2M A;  1OPL A;  4OMP A;  1Y0M A;  3EG0 A;  4J9E A;  2RQR A;  3UF4 A;  1YNZ A;  1GCP A;  2A36 A;  1Y57 A;  2DBK A;  1GBQ A;  1YP5 A;  2CT4 A;  1NM7 A;  2ROT A;  2FRY A;  1RLP C;  3NPF A;  2LP5 A;  2KXC A;  1Z9Z A;  1H92 A;  1BU1 A;  3H41 A;  3NGP A;  4LNP A;  2KT8 A;  1GRI A;  1TUC A;  4JJB A;  3O5Z A;  2OJ2 A;  2DL7 A;  2BZY A;  3EGU A;  3I5R A;  3A98 A;  1X27 A;  4OMQ A;  1SHF A;  1S1N A;  2DNU A;  4CC4 B;  3M0S A;  4OMO A;  2CDT A;  5GJV B;  5I11 A;  1AD5 A;  1OEB A;  2J6F A;  2ABL A;  2KE9 A;  3IQL A;  3VS4 A;  1UFF A;  1AWO A;  1OV3 A;  2AKK A;  4F14 A;  1RLQ C;  1LCK A;  1M3A A;  1NG2 A;  1ZUK A;  1WA7 A;  1W6X A;  5I22 A;  2YUO A;  2YUP A;  1U5S A;  1HSQ A;  2YUQ A;  1JXO A;  3VS2 A;  1B07 A;  2ED0 A;  2EGE A;  1A0N B;  2MIO A;  1X2K A;  4OMM A;  2FG0 A;  4LUD A;  2EYZ A;  1X43 A;  4DEY A;  1T3L A;  2D8H A;  3I9Q A;  4Y92 A;  1AWX A;  2PNI A;  2O88 A;  1T3S A;  2E5K A;  3JV3 A;  4J9C A;  2FPE A;  1OPK A;  1YCS B;  2RN8 A;  3VS0 A;  3M0Q A;  4HXJ A;  2BZ8 A;  3M0R A;  1J3T A;  4RTY A;  1W1F A;  2CSI A;  2O31 A;  3I5S A;  2M0Y A;  1UG1 A;  2ENM A;  3EHQ A;  2GQI A;  1G2B A;  2AZS A;  2DL4 A;  1ABQ A;  5IXB A;  2EYY A;  4R0K A;  1I07 A;  2JW4 A;  3PVQ A;  1U06 A;  2DRM A;  2DVJ A;  2KXD A;  4J9I A;  3PE0 A;  4D8D A;  4QT7 A;  2GBQ A;  1CKA A;  4HVW A;  5HCK A;  1UHC A;  1MV3 A;  1PNJ A;  3VRZ A;  1V1C A;  2CUB A;  3M0U A;  3EHR A;  3VRY A;  2L3S A;  2YDL A;  1AWJ A;  2HBW A;  3QWX X;  2GTO A;  1GFD A;  1E6G A;  1E6H A;  1WLP B;  2YUN A;  4K11 A;  1I0C A;  5IXF A;  3EG2 A;  2K9G A;  4RUG A;  3TSW A;  4Z89 A;  2EGA A;  4ORZ A;  2RQT A;  2ECZ A;  5IHN A;  5EC7 A;  2JXB A;  2J6K A;  5FWC A;  1TUD A;  4OMN A;  1RUW A;  1TG0 A;  1WYX A;  1G83 A;  2EQI A;  5IHI A;  1SEM A;  2XMF A;  4DEX A;  2DL5 A;  1BBZ A;  1WXB A;  2KNB B;  3ZL7 C;  1KJW A;  5ECA A;  1SHG A;  2RNA A;  2VKN A;  1ARK A;  2RQW A;  2DJQ A;  4HVU A;  1VYT A;  2EKH A;  4A63 B;  4LN2 A;  2JS2 A;  1K0S A;  4RTX A;  2JM8 A;  1YN8 A;  4GBQ A;  3EG3 A;  1GCQ C;  2D8J A;  2DX1 A;  1K9A A;  3KFV A;  2HEQ A;  4IIM A;  3VS3 A;  1EFN A;  4J9D A;  1JU5 C;  2F2V A;  3TSZ A;  1W70 A;  5IH2 A;  1N5Z A;  2HSP A;  1AEY A;  1GFC A;  2RF0 A;  2B86 A;  2PTK A;  1PRL C;  3RBB B;  4EIK A;  1CSK A;  1AZE A;  1K0X A;  3VS6 A;  2P4R A;  1UHF A;  1NEG A;  3THK A;  1ZUU A;  3VS1 A;  3ULR B;  2JT4 A;  4RTV A;  2A08 A;  2KRO A;  5GJW B;  3UAT A;  1UJ0 A;  3TVT A;  4ESR A;  1JO8 A;  4IIO A;  4HCK A;  2DL8 A;  3LH5 A;  1B3Q A;  1T0H A;  1UGV A;  3R6N A;  1FYN A;  2CT3 A;  2X3X D;  4D8K A;  2YT6 A;  4J9G A;  2MOX A;  1AVZ C;  3UA6 A;  1WI7 A;  2JM9 A;  2O9V A;  2D1X A;  2D0N A;  2KRM A;  1QKW A;  4GLM A;  2OAW A;  2FO0 A;  2F2W A;  2JS0 A;  3CQT A;  2LQN A;  1SRM A;  4AG1 C;  1Z9Q A;  2KR3 A;  1AZG B;  4AFZ C;  2K3B A;  2IIM A;  3NMZ C;  1PHT A;  2EVR A;  4RTU A;  1M3C A;  2K6D A;  1X6G A;  1X6B A;  2AKL A;  2LNH B;  3RNJ A;  1WIE A;  1NYG A;  3U23 A;  2KGT A;  2DYB A;  2KYB A;  3H0F A;  2LJ3 A;  1JXM A;  4F17 A;  3H0H A;  2K7A A;  2JMA A;  1OOT A;  2FEI A;  4HVV A;  1NEB A;  4E6R A;  1QWF A;  3REB B;  2EPD A;  1HD3 A;  2H8H A;  1ZX6 A;  1MUZ A;  2CH4 W;  2RMO A;  2QDL A;  1NLP C;  2RQV A;  1AOJ A;  1ABO A;  4Z88 A;  2ED1 A;  2X3W D;  3SHW A;  1QLY A;  2GTJ A;  5L23 A;  3M0P A;  1T0J A;  2LJ0 A;  1U3O A;  2V1Q A;  1ZLM A;  4M4Z A;  2C0I A;  2KBT A;  2K79 A;  2DRK A;  4JPB W;  2V1R A;  3I35 A;  3GBQ A;  2DLP A;  5IHK A;  1X69 A;  4OML A;  3VS7 A;  1ZBJ A;  3EG1 A;  1RI9 A;  2KYM A;  1K76 A;  2GGR A;  2C0T A;  4X1V A;  1FMK A;  2RQU A;  4AG2 C;  4RTZ A;  2DL3 A;  2AZV A;  4CC2 A;  2W0Z A;  1UUE A;  2DMO A;  2ESW A;  2JTE A;  1IO6 A;  1UTI A;  2LX7 A;  2MCN A;  3SEM A;  1SSH A;  2AK5 A;  4JZ3 A;  4AFU C;  1WXT A;  2G6F X;  5FW9 A;  2SRC A;  1UE9 A;  2CRE A;  2O9S A;  1JEG A;  1AWW A;  3C0C A;  1X2Q A;  2DA9 A;  1WFW A;  2LQW A;  2L3P A;  1BB9 A;  3QWY A;  1PKS A;  1E7O A;  3FJ5 A;  3REA B;  1GL5 A;  4F16 A;  2L3Q A;  2BTT A;  2BZX A;  4LUE A;  1UEC A;  4JJD A;  2YSQ A;  1KIK A;  2DF6 A;  1MV0 B;  2KRS A;  1PRM C;  2J06 A;  1UDL A;  3NHN A;  1SPK A;  1WXU A;  4KRT A;  2A37 A;  2O2O A;  2ROL A;  2LJ1 A;  4FSS A;  3H0I A;  4RTW A;  4Z8A A;  2EYX A;  1YWP A;  2RPN A;  4WCI A;  1H3H A;  3VS5 A;  1GCQ A;  2SEM A;  4RTT A;  2EBP A;  2DM1 A;  1QKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...