2M51A

Nmr structure of the sh3 domain of human ras p21 protein activator (gtpase activating protein) 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
62
structure length
62
Chain Sequence
b'GRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras GTPase-activating protein 1
publication title NMR structure of the SH3 domain of human RAS p21 protein activator (GTPase activating protein) 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 7
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2m51A00
2LNHB 1U3OA 2JM9A 2FEIA 2EYWA 2AZSA 3IQLA 2A37A 2KEAA 1WI7A 4J9FA 2O9VA 1ABQA 1NYGA 4HVVA 4RTVA 2A08A 2BZXA 4RTZA 2VVKA 4JPBW 2J7IA 1YWPA 3VS7A 1NLPC 3REBB 2VKNA 1KJWA 1K0SA 2KROA 2AKKA 1WX6A 4J9DA 4OMQA 1QLYA 2GGRA 4LNPA 1GBQA 1N5ZA 1W1FA 2AK5A 2JMAA 2W0ZA 2YUQA 4OMNA 3RBBB 2BZ8A 3I5SA 2D0NA 2RPNA 2E5KA 4CC4B 4RUGA 3NHNA 4AG2C 1PRMC 1WXUA 4GBQA 4RTUA 1GBRA 1JXOA 1X69A 4IIMA 3NMZC 4F14A 4LE9A 1WXBA 4WCIA 2RMOA 2CSIA 3VS0A 4K11A 1HSQA 2DF6A 2DM1A 1GL5A 2K2MA 1UJYA 1B07A 1OEBA 2CH4A 2GQIA 2I0NA 3VS4A 2KRNA 3PVQA 2L3QA 3M0QA 2M0YA 2YSQA 4J9CA 1KIKA 4CC3A 1QWEA 1UECA 4HXJA 2LX7A 4RTXA 3H0IA 1T3LA 5FWBA 1OPKA 2V1QA 1PHTA 2ABLA 2AKLA 1QWFA 1J3TA 2CUDA 2KT1A 1K9AA 1TG0A 3M0SA 2F2VA 1H3HA 2DJQA 4J9HA 1AEYA 2DL3A 3VS6A 2DLPA 3A98A 2DYBA 2L2PA 4ORZA 1M3AA 2HSPA 2IIMA 3VS5A 2DBKA 2JXBA 3LH5A 1QCFA 2KBTA 1YN8A 4DEXA 1YP5A 1M8MA 2HEQA 1IO6A 4AFUC 1ZUKA 1TUCA 2EGAA 4RTTA 3EG0A 3R6NA 1UG1A 2JT4A 1RI9A 4A63B 1PRLC 2O9SA 2JS0A 4RTYA 2RQRA 1AWXA 1QKWA 1UHFA 2DILA 2J6OA 1Z9ZA 1NEBA 1UE9A 2JW4A 1AZEA 4JJCA 1BBZA 2DNUA 3QWXX 4QT7A 2RQTA 2QDLA 3ULRB 3M0TA 2K7AA 1U5SA 3VRYA 4J9BA 1M27C 1OOTA 1JQQA 2YUPA 1KSWA 1UJ0A 1GFDA 4JZ3A 2DVJA 1TUDA 1S1NA 2ESWA 4OMOA 2GBQA 4LUDA 1VYTA 2DL8A 1WLPB 2LJ1A 2MCNA 1PNJA 1CKAA 2DL5A 1UHCA 2YT6A 1X43A 2LP5A 2M51A 2JM8A 4HVUA 1QKXA 1AWWA 4JJBA 1JXMA 1SEMA 2A28A 2ROLA 2W10A 1ZLMA 1JO8A 4AFQC 3KFVA 1NYFA 1GRIA 3GBQA 2PTKA 1Y0MA 2DRKA 2GTOA 2EPDA 1K0XA 2K9GA 1NLOC 2J05A 1HJDA 1X6BA 4Z8AA 1UGVA 1PKTA 2VWFA 1SRLA 1BU1A 2K6DA 2JS2A 2MIOA 2YDLA 1GFCA 5L23A 1FMKA 2EKHA 1JU5C 4AFSC 2D8JA 5IXFA 2JTEA 2C0IA 3EHRA 3O5ZA 2FRYA 4OMMA 2K79A 1MUZA 2XMFA 2ED0A 2NUZA 2RF0A 2FRWA 4Z88A 1W70A 2RQVA 2RQWA 2FO0A 5GJVB 2KRSA 2LZ6B 5IHIA 2KGTA 5I11A 4IIOA 1T0HA 4Y92A 2PZ1A 1T3SA 3UF4A 5I22A 2P4RA 4AG1C 5FW9A 1BK2A 2F2WA 2FPEA 4M4ZA 1FYNA 1EFNA 2DRMA 2J6FA 2EVRA 2KXCA 4D8DA 1A0NB 1YNZA 2EW3A 1UDLA 2KYBA 3UA7A 2HCKA 5EC7A 2EGEA 1SHFA 2KE9A 2ENMA 2KNBB 1ZSGA 4X1VA 2CUBA 2KRMA 1U06A 2X3WD 1GCPA 1SSHA 1PWTA 4J9IA 4OMLA 1X27A 1ZBJA 2A36A 2GNCA 1CSKA 2ECZA 2B86A 3VRZA 1K1ZA 2EGCA 3UA6A 2DA9A 2FPDA 4JJDA 4LN2A 2SRCA 1E6GA 1GCQA 2DL4A 1OV3A 4ZNXA 3UATA 1VA7A 4LUEA 3PVLA 2J6KA 5IHNA 1AWJA 5FWCA 1M30A 3M0RA 1NM7A 2EBPA 3EG2A 2X3XD 2LQNA 3RNJA 1Z9QA 2O2OA 1RLQC 3QWYA 2OI3A 2MOXA 1LCKA 2LCSA 4D8KA 2YUNA 1KFZA 1AD5A 2HBWA 5ECAA 1SHGA 2RQUA 3TSWA 1WYXA 1JEGA 2PNIA 3I35A 2HDAA 4F17A 3U23A 2LJ0A 2RN8A 1WIEA 1ZUYA 2DMOA 1MV3A 3EHQA 2EYXA 1T0JA 2J06A 2AZVA 4R0KA 1VYVA 4CC7A 1HD3A 2SEMA 1K4US 2CH4W 2D8HA 4HVWA 2O88A 2KXDA 3CQTA 3H0FA 4HCKA 5IXBA 3EGUA 3REAB 1M3BA 1RLPC 1H8KA 2FG0A 1SPKA 2LJ3A 1X2QA 1NEGA 1BB9A 3SEMA 4GLMA 1ARKA 1YWOA 1XOVA 3TSZA 4F16A 2DL7A 1M3CA 4EIKA 2DX1A 1UTIA 1GCQC 1X6GA 1YCSB 2ROTA 3THKA 2RNAA 3H0HA 1UFFA 2DBMA 5GJWB 2NWMA 1NG2A 2KR3A 4KRTA 2L3SA 2F2XA 2BTTA 5IHKA 1V1CA 2JMCA 3SHWA 5IH2A 2G6FX 2FPFA 1I0CA 2GTJA 3I5RA 1OPLA 4JZ4A 2EQIA 4Z89A 1K76A 1ABOA 2EYZA 2O31A 1ZX6A 1I07A 1RUWA 3I9QA 1SRMA 2OJ2A 2D1XA 3EG3A 3M0UA 4FSSA 1I1JA 2K3BA 2ED1A 2DE0X 2H8HA 3VS3A 3VS2A 2CSQA 4AFZC 1AWOA 4J9EA 1X2KA 3C0CA 1PKSA 1VYUA 1H92A 2L0AA 1ZUUA 2LMJA 1MV0B 2C0TA 1G2BA 1AZGB 1AOJA 1UUEA 2CT4A 2LQWA 1WA7A 1WXTA 2CREA 3H41A 2BZYA 2KYMA 3VS1A 2YUOA 3M0PA 1B3QA 3JV3A 1G83A 2V1RA 4CC2A 5HCKA 3TVTA 3ZL7C 3NGPA 2L3PA 4J9GA 1E7OA 1CKBA 3PE0A 2CDTA 3FJ5A 1WDXA 1AVZC 1WFWA 3EG1A 4ESRA 2KT8A 1Y57A 1E6HA 2OAWA 4E6RA 1W6XA 4OMPA 4RTWA 4DEYA 3NPFA 2CT3A 2C0OA 2EYYA
chains in the Genus database with same CATH superfamily
2LNVA 2LNHB 4IUPA 1U3OA 2JM9A 2JJ9A 1OX9A 2CYZB 1WPYA 2AZSA 2QGGA 1OZ3A 3TEEA 3CCQT 3GLXA 1ABQA 1NPRA 1VQOT 5D7UA 3OYBA 2J7IA 2XDBA 4GLKA 5CKFA 3REBB 4Y28E 3SWNC 3OYAA 3HRUA 2COWA 2KROA 1NJIC 4E7JA 4OMQA 1QLYA 2JMAA 1N5ZA 2VGMA 2YUQA 5LJ5j 4WF2A 4JRKA 3I5SA 2D0NA 2RPNA 4CC4B 3JCMe 4GBQA 1JXOA 1X69A 4IIMA 2E6ZA 1UGSB 3TREA 2DK3A 4WCIA 4X34A 2RMOA 2ZPBB 2K5IA 1VQ5Q 3SFMA 1WJRA 2K2MA 4L6V5 2I0NA 2KRNA 3PVQA 1S72Q 2YLCA 4M75C 3EGXA 3RERA 3MKDA 1AT1B 1IB8A 4X9DA 4HXJA 2YWWA 3A8LB 1KD1C 1T3LA 5LJ5e 1OPKA 2KK4A 5DLOA 1XQHA 1MNEA 1NJIR 3SWNA 4XTZA 2CUDA 2KT1A 3M0SA 2DJQA 5C6SA 1YJWT 3FLGA 4ORZA 3CMEA 1BCOA 3NTKA 4M77G 3LH5A 2CZ1B 4DEXA 2O4XA 3VUZA 3L2QA 2WACA 4RTTA 3F70A 3A1PA 2P0KA 1UG1A 3JRZA 3Q1JA 1BI3A 3MP8A 3ASKA 3RESA 1AWXA 1QKWA 4LDXA 1X01A 4F7UG 1QCOA 1NEBA 3KUFA 3H6ZA 2BKDN 2Z0WA 1AZEA 1YJ9T 1KD1R 2DNUA 4JLGA 3QWXX 4DOVA 3EFOB 2RH2A 2QASA 4J9BA 3CCMA 4YTLA 1UJ0A 4PJOF 4M7DB 4OMOA 1S1NA 2X4YA 2HQEA 2VV5A 2L5QA 2DPPB 2LJ1A 1R8OB 4DBFA 2ZZDA 4BY6C 2KAFA 2LP5A 2M51A 4HVUA 1MMAA 2P0QA 1QKXA 1AWWA 1VQPQ 3MP6A 1JXMA 2DVEA 2VXEA 1IGQA 4E7ZA 3META 4AFQC 1UGRB 4Q5WA 1GRIA 1G3WA 4OF1A 2PTKA 5A2QE 1NJIU 2WSFE 1KQSS 1MGQA 1IGUA 5GAOp 1NLOC 1WZOA 2J05A 2XKOC 4Z8AA 4C0GA 1UGVA 2EQKA 1PKTA 2RJEA 2VWFA 2PU9B 2JS2A 2YDLA 3OYYA 1TXQA 1C6VX 1FMKA 2QQ9A 2EKHA 2OX7A 3V8LA 4AFSC 3G6EA 2D8JA 2JTEA 3QJ6A 1VQKT 3O5ZA 2FRYA 4OMMA 1OI1A 2M9UA 2NUPA 3CXCA 2R58A 5I21A 3JB9F 1JJ2S 2ED0A 2DTIA 4JLIA 3TCJA 4ZGEB 2RQVA 5IHIA 2RHXA 4KULA 3UF4A 4M7AA 4AG1C 1KD1U 4WTOB 2CZ6B 2FPEA 4M4ZA 1N9SA 6AT1B 2J6FA 2EVRA 2KXCA 3L1AA 2EW3A 4QVCA 2DXBA 2HKQB 1WHHA 3JCMP 4LXCA 3E9GA 4C5HA 5GAN8 1KC8R 8AT1B 2KRMA 1U06A 2JN0A 4B9XA 2X3WD 3P8HA 1PWTA 3GF5A 4BDZA 1X27A 1ZBJA 4XU1A 1B34B 2A36A 4RG8A 2GNCA 2X4JA 3LYIA 4D6WA 1CSKA 2ECZA 3VRZA 2E5QA 1K1ZA 2EGCA 2QDYB 3CMET 1VQ4A 4JJDA 4C5IA 2SRCA 4C8QC 4OB2B 4HT9A 4N4GA 4JRQA 2RD1A 3UATA 1VA7A 4LUEA 3I56A 4RMOA 3HHTB 1VQ4Q 2RI5A 3TU4K 1NM7A 3M55A 4RCCA 3BW1A 2WSCE 1PSEA 1U1SA 2X3XD 2E65A 1D0XA 1DJ7B 3UPUA 2LCSA 3CC2A 2RHIA 2DKGA 1SHGA 2RQUA 3CCJT 3CD6Q 1I4K1 3I35A 4PJOG 3CCMT 2F1LA 1HYOA 1QVGS 2RN8A 1WIEA 1ZUYA 4DOWA 1T0JA 3M9QA 3MEWA 2DTHA 4CC7A 5CKEA 1K4US 4HVWA 2D8HA 1OYXA 1YFNA 4C8QA 2BE7D 2EJGA 3JCMb 3REAB 2RO0A 5KCOA 1H8KA 2FG0A 4OMFB 1KG1A 2A3LA 1LVKA 4BE1A 5J3BA 3S3OA 3CPFA 3JAME 2ZPEB 3QKJA 2DL7A 3CXCP 2EKOA 2DX1A 4DQ2A 1UTIA 2QEXA 1Q82R 1GCQC 4HCCA 3H0HA 3ZBDA 2DTOA 1BI1A 2JTMA 3PMIA 5GJWB 2F5KA 2KI7A 3QSUA 2DXUA 1BCMA 4O5VA 3L42A 5IHKA 2RA2A 4J5YA 4M75D 3G6ET 2JMCA 1V29B 2OTJQ 2G6FX 3JCMJ 1OPLA 4F7UB 5J39A 3JB9G 2P84A 1WJSA 1K76A 2YXYA 3I9QA 1RUWA 2CP5A 3PFSA 5GANg 4N4IA 5CVIA 2D1XA 4M7DC 3M0UA 1O75A 1VQLQ 1RACB 2CSQA 2QTXA 1PD1A 1AWOA 4J9EA 2FHDA 4JS5A 1D3BB 2K2VA 2L0AA 1P92A 1OQKA 2C0TA 1G2BA 2JZ2A 2VC8A 4XTXA 2CT4A 2LQWA 1WA7A 1VIEA 2RHUA 2BIVA 1YJNA 1YI2A 2BZYA 3VS1A 3M0PA 1G83A 2VASA 3PIOA 4LDUA 1ACMB 2HL3A 3G4SQ 1YJNQ 1VQ4T 3NGPA 2M1HA 3PE0A 4PJOE 3I56T 3EG1A 3EFOA 1VQNT 4IURA 1Y57A 1E6HA 5KYWB 2V8JA 3CCQQ 3HTRA 1VQOQ 3JB9I 3C12A 4M78F 1Q82U 2XDDA 4M7DA 3BFMA 4C92F 3LLRA 2ZPIB 5GAOn 4JJNK 1G8XA 2KEAA 1X75C 1Q86C 2O9VA 5DM7R 1NYGA 3OYKA 3LGFA 3T9NA 5LL6S 3LWHA 2L8DA 4RTVA 2A08A 4JPBW 3CC2T 4O6JA 3VV0A 1K0SA 2COZA 2AKKA 4M7AD 4J9DA 2GGRA 3OMGA 1W1FA 3P8DA 4OMNA 2BZ8A 4E2FB 4RUGA 4AG2C 1PRMC 1WXUA 2ZPGB 2E4HA 4RTUA 1G5VA 3ZFJA 2ATCB 3RMSA 1WXBA 2CSIA 5DLQE 3DKMA 4RKUE 3VS0A 2DM1A 4BDYA 1UJYA 1B07A 1OEBA 5LJ3g 2GQIA 1BKBA 3HP9A 3CCRA 3VS4A 1Q86R 2QGFB 1XNIA 3G1JA 1ZA2B 2YSQA 5GAMh 2QEXT 4HCBA 2LX7A 4RTXA 3H0IA 1YJWQ 2IPOB 2V1QA 2ABLA 1UGPB 1K9AA 2F2VA 2KQWA 4J9HA 2NUTB 5FROA 1BIBA 2L2PA 2H3JA 2HSPA 1SSFA 1TSFA 3VS5A 5GAMd 2LT4A 2KBTA 2DD5A 1M8MA 2HEQA 2QQAA 1IO6A 5A0DA 1C0MA 2EGAA 3N5BB 2H3EB 3R6NA 3X24B 1YJ9Q 2JT4A 4PJOB 4A63B 1PRLC 1WHKA 1B34A 3A8OB 1XJWB 4BE2A 1GXIE 1UHFA 3JCMd 4C8QD 1Z9ZA 1C1AA 4OVAA 2EWNA 5LJ5h 2M0OA 2PVDB 2K7AA 1U5SA 2HZYA 1D09B 1VQ8A 1JQQA 1YI2T 1Y7XA 2DVJA 1IHVA 2RJFA 4TVRA 2GBQA 4LUDA 3LW5E 4M75F 1ZSZB 1WLPB 4XK8E 5GAMe 1QVFS 2CKKA 4M77C 2V26A 2RM4A 2KVQG 2JM8A 5LJ5d 4DBQA 5AYFA 1Q86U 1SEMA 3MEAA 4M78G 2A28A 2FYKA 2ROLA 3JB9J 3QO3A 2QQRA 1NYFA 4C92G 3PTAA 3CEYA 3GBQA 4PFZA 3HKSA 2M16A 3QIIA 1VQKA 1Y0MA 3UDCA 3A8MB 2GFAA 2CS7A 1WHMA 2EPDA 2E41A 2ZGWA 5GAN3 1KHIA 3KXTA 1HJDA 1VQKQ 3FRNA 1LOJA 4PNOA 4KGXB 4ELYC 5M9OA 4LD6A 1RAHB 5IXFA 3EAEA 2C0IA 2L3RA 2BUDA 3CBOA 4M77A 3OYNA 3GIBA 2RQWA 2BE9B 3MEUA 5GJVB 1KK7A 2KRSA 4IIOA 1T0HA 3OW2S 3L2ZA 3ME9A 5GANf 5I22A 2P4RA 3VYGA 2AHJB 1M1GA 3CCRT 5A0GA 2RI3A 1M90C 4PK4A 1EFNA 4F7UA 3JCMc 4PJJA 2DZ9A 4D8DA 1UDLA 2QI2A 2HCKA 5EC7A 1SHFA 2ENMA 3CMEQ 1TU0B 1RAAB 1IZ6A 2NLUA 2ZAEA 3S3MA 4M7DD 1LJOA 3JB9H 3S6WA 3I55A 1I8FA 2E3HA 2JOYA 4OMLA 3HRTA 3URGA 1IRXA 3C95A 3JCMQ 1W2BS 2XK0A 2GF7A 4PFPA 1D3BA 3ZEHA 3I55Q 1VQ6A 2EQMA 1EIFA 5CKBA 1OV3A 4FSXA 1Y96B 4ZNXA 1FX7A 3PVLA 2Y90A 5FWCA 1M30A 1QVPA 4KBMB 3QG1A 4C0FA 3GOXA 3CCJA 5IAYA 3R6OA 5FRNA 4HCZA 2ZPFB 4XAXB 2FB7A 4C5GA 3VYHB 4EMKB 9ATCB 1D1BA 3RNJA 2O2OA 4FL6A 3CCJQ 1N8RC 1M90R 1U1TA 1ZA1B 3CCEA 3CCMQ 3QWYA 2OI3A 1LCKA 1NZ9A 4M78E 1M1FA 3CCSA 3EH2A 5KYWA 1D0YA 4C92E 5HY6A 1VQ8T 2X51A 1WYXA 3C4SA 4F17A 2PUOB 2QQSA 3CCSQ 1Y71A 4M7AC 5I2SA 3OYFA 5GMKj 3MHXA 1JBMA 3EHQA 2V8KA 2RHZA 3TQ7P 4M75G 4KUDK 2J06A 5KYUB 4C0DB 2O88A 2KXDA 3EGUA 4L59A 1M3BA 1Q7YC 4A4KA 1G3SA 3CMAA 2F5TX 3PMTA 2K3XA 1SPKA 2LJ3A 5FU6C 3CC4A 3HL8A 1OU9A 3OB9A 3SEMA 4NL3A 4LD9K 3LGLA 1ARKA 1PCXA 1N8RR 3NTIA 4BE0A 4F16A 2MK5A 1W4SA 3OS0A 1O9SA 2K3YA 2OTLA 5LJ3f 5GAN4 3CC7A 1G3TA 4C8QF 3G6EQ 1JRIA 2X9HA 1UFFA 3QZ5B 5KYYB 3QZ9B 1SKUB 1NG2A 5A0LA 5CAIA 2HQHA 2BTTA 2HNIA 4B9WA 2RHYA 4DBRA 4OB0B 5IH2A 2A7YA 3OS1A 2JUFA 3RKWA 1Q7YR 2O31A 3VKIA 4J6XA 3INZA 1M90U 3OYLA 1IHWA 3BE3A 4DA4A 2QG9B 4Y91A 3HPWA 3EG3A 1F1BB 2K3BA 2NUTA 1RAEB 4R55A 2GFUA 3VS2A 4KGVB 5KYXB 4QVZA 1PKSA 1H92A 2CP0A 2EFIA 3OYEA 2DAQA 1JB0E 3GP8A 5GAOr 3E2UA 1VQNA 1IREB 3FB9A 3VUBA 2XDPA 5GAN5 4PJOA 3H41A 4M78B 3I55T 5CO7A 2COYA 2VGNA 3I56Q 5GAN2 4C92B 1VQNQ 2FZCB 4OGCA 5FU7B 2XHCA 4J9GA 1VQ6T 5FRMA 3BDUA 1KQSA 3FJ5A 4J8OA 1WDXA 2E1HA 1X6OA 4ESRA 1N8RU 4E6RA 1HK9A 3NFCA 4OMPA 4MDWA 3NPFA 4HT8A 1UEBA 2C0OA 2EYYA 4M75E 3OA6A 3CC2Q 5CQYA 1RAFB 4MZTA 2EYWA 3X20B 4BACA 2A37A 4M77D 3CCET 1ZSZA 4IUQA 2E10A 2GQVA 1R0CB 2EQUA 3UT1A 2BZXA 4RTZA 3CCST 3OSVA 4NL2A 1D1AA 1WX6A 3CPWS 4LNPA 2W0ZA 2AK5A 3OS5A 2DEUA 3RBBB 5GANh 4IKFA 2E5KA 1Q7YU 2DFUA 2LX9A 2XD0A 1GBRA 3NMZC 4KH1B 4F14A 1K9MC 2EAYA 4A4HA 2LQ8A 3CMAT 1PD0A 5D6XA 4LDYA 2QEXQ 3CC4T 4AT1B 4K11A 1HSQA 2DIQA 1BIAA 2CH4A 3JCMW 3CBMA 1OU8A 4AMCA 1VQ7A 2LVMA 4PJNA 2OTLT 4P5NA 4CC3A 1YITA 3CC7T 2KSSA 1YCYA 5FWBA 5GANj 2AKLA 3HRSA 2P4TA 2XG8D 3DB4A 4UC4A 2MPXC 1TG0A 4J7IA 1M1KC 1BI2A 3V7RA 2QK0A 3A98A 1Q81C 2RK1A 3M56A 3M58A 2IIMA 2JXBA 1QCFA 1YN8A 1YP5A 2MI6A 4AFUC 4QQ6A 5HK3A 1D1CA 3V7CA 5GMKl 1QVGA 3M59A 5GANe 2FZKB 2LC4A 2DILA 3E9FA 4M75B 3OS2A 3A8HB 1YI2Q 4C0DC 2RB6A 1KQSP 3EH1A 3FIFA 1Y96A 4QT7A 1WHJA 2QDLA 3ULRB 3M0TA 1UGQB 4FM4B 1OOTA 5GAN7 2QQBA 2YUPA 2A0FB 2Y4YA 1KSWA 1EX4A 3PNWC 2QAZA 4EMKA 1M8VA 4FW2A 2IVWA 1KQ2A 5GAOm 4Z02A 2DL8A 1I5OB 2XICA 3MPUB 3VU3C 4BD3A 4QW2A 2MCNA 4E7KA 4V2SA 4OB1B 2DL5A 1JJ2P 3H9NA 5KCHA 1X43A 2XU8A 2X4WA 3BY7A 1VIFA 3A5ZB 1QMCA 2M02A 3CCLA 4HKEA 2W10A 3KFVA 3S3NA 1I81A 4RG2A 1QP2A 3RR6A 3OY9A 5KYUA 1YHQA 2GTOA 1K0XA 2K9GA 1H641 5D6WA 2CP3A 1BI0A 2HQXA 1SRLA 2FVUA 3MCAB 3D7SB 1GFCA 5LJ3j 2B8AA 4IUUA 2QYZA 1JU5C 3E1SA 4C8QE 1RABB 3FJPA 3EHRA 3A8GB 4E7HA 1AHJB 1MUZA 4JDSA 4BY6B 4EMHA 3OYMA 1MMDA 4Z88A 1W70A 2PUKB 3CCRQ 5KYYA 4PJOD 2K4YA 3DB3A 4XTWA 2K57A 1VQ9A 2LZ6B 2MWPA 2KGTA 4Y92A 2PZ1A 1T3SA 1ZHIA 3CCVA 1BK2A 2F2WA 4KUIA 4N4HA 1VQ7T 2JVVA 3M5AA 1YITT 1YNZA 5LJ3e 1M1KU 3V8KA 4M77F 2KYBA 4RCBA 4ZTFA 3OYIA 2E12A 5GMKi 1Q81U 4X1VA 1Y07A 3PT9A 1QQJA 1GCPA 1SSHA 1QVGP 4QQDA 4A4GA 3CBPA 4PFOA 2B86A 5KYXA 2DA9A 3MJXA 2D0QB 2DD4A 2D9TA 5GAOl 1E6GA 4ZGJB 1M9SA 2DL4A 3M4YA 3QDRB 1AWJA 2HAXA 3M0RA 2EBPA 4M78A 5GAMg 4FU6A 1YIJA 4C92A 2DIGA 5C0MA 2MF2A 3WVEB 4DBHA 1WHLA 2LQNA 1Z9QA 3JB9D 1VQ8Q 3FEOA 2R5AA 4N0AA 4FT4A 2MOXA 3O8VA 3L2RA 3RKYA 2MMPA 2MYSA 2CP2A 2HBWA 1WNLA 2PQWA 5ECAA 5CCAA 3TSWA 4LDVA 3JCMg 4A4FA 1VQMA 2PNIA 2HDAA 1RADB 4EDUA 3CCUA 2LJ0A 3QXEB 3L2VA 1MV3A 2VYTA 3EGDB 1VQMQ 4R0KA 3CCUQ 2CH4W 3QHSA 4C8QB 3CQTA 3H0FA 4HCKA 5IXBA 1VUBA 4M7DE 2LRQA 1BYMA 3CCLT 1X2QA 1NEGA 1BB9A 2IG0A 4GLMA 2DYIA 3SDZA 5LJ5g 3AT1B 3OMCA 4PKCC 4II1A 1OZ2A 1YHQT 3QJYA 1YCSB 3THKA 1VQ5A 2RNAA 1TWBA 4L5GA 2DJZA 4MMLA 2NWMA 1S72A 4PLIA 1K8AC 3NTHA 2KR3A 3J81E 2CP7A 2L3SA 3M53A 2XIDA 1M5Q1 2FZGB 1U8RA 1TUGB 4LDWA 3SHWA 4MDXA 4A53A 2FPFA 1V76A 1NE8A 4QVDA 2EQIA 3RMQA 3OYCA 2I2LA 2EYZA 1ZX6A 4C5EA 1MMNA 1VQ9T 5GAN6 2QA4A 1I1JA 3CCVT 2H8HA 3VS3A 4M7AF 2YLBA 4BI3A 4AFZC 2HSEB 4FYWB 4FYVB 3CXCS 2QA4Q 1QVFA 3OYHA 2LMJA 1MV0B 4OB3B 3WXMB 5GMKh 1K8AR 1H3ZA 3QDFA 5IT9E 1VQ6Q 1WXTA 5GAOq 2CREA 2KYMA 1RL2A 5CR2A 4ELZC 5HCKA 1WJQA 3TVTA 3ZL7C 4M75A 5FLXE 4ZGDB 2EQJA 1E7OA 1QCNA 1CKBA 3J7AF 3J80E 3HFOA 4ZN3A 3G71A 1WFWA 4E7LA 4XTYA 3RKXA 4FW1A 2EIFA 3CCEQ 3JCMX 4JS4A 1W6XA 3WVDB 1PM3A 2R5MA 4EMGA 4ANJA 2DETA 3G71Q 1YIJT 1MNDA 2FEIA 2DEQA 2G3RA 4IUTA 2LT1A 1VQPA 3OQ5A 3IQLA 4JUVA 1WI7A 4J9FA 2LTOA 4HVVA 4BB7A 2RK2A 2VVKA 1YWPA 3VS7A 2X35A 5HKCA 2O01E 1NLPC 3LWIA 2VKNA 1KJWA 2EJFA 3H8ZA 1VQMT 3OW2A 3CCUT 1GBQA 1LPLA 1TS9A 3GNFB 3CMAQ 1FMVA 4XTVA 3X26B 3NHNA 2HL5C 3CC4Q 3X28B 2HBPA 2LDMA 3QYHB 2E6NA 3V8JA 3FC3A 4LE9A 5GMKe 4XQ3A 3BDLA 2OTLQ 3OBYA 4FIBA 1KC8C 3CC7Q 2DZCA 3SD4A 2CZ0B 2AT1B 2ZPHB 4PJOC 5KYNA 2DF6A 2K5LA 3P8BB 1GL5A 4F04B 1W2BA 3GPLA 7AT1B 1K8AU 2L3QA 3M0QA 2M0YA 4J9CA 1KIKA 1QWEA 5KH6A 1UECA 3EG9B 1VQ5T 4PJMA 1PHTA 4M78D 1QWFA 3DLLA 1J3TA 1S72T 3FDRA 4C92D 1H3HA 1N6AA 1FXXA 2JTFA 1AEYA 2DL3A 4M77E 1NBEB 3VS6A 2DLPA 5DY9A 4FCYA 2DYBA 1M2VB 2KDSA 1M3AA 1QVFP 1ZSZC 5AT1B 4NOYA 2DBKA 1B7TA 3QUIA 1K73C 2WSEE 1ZUKA 1TUCA 1OULA 3EG0A 1FWZA 1RI9A 4C0ZA 4F7UE 4M7AG 3L2UA 4MZPA 2QA4T 3DLMA 2O9SA 2JS0A 4RTYA 1QW1A 2RQRA 3OSSC 5GAMf 1YBYA 3VJPA 2J6OA 1UE9A 2JW4A 4JJCA 1BBZA 2RQTA 3GNGA 3SB2A 3VRYA 5GMKm 1M27C 3RDVA 1GFDA 4E7IA 3JCMf 3M4GA 4JZ3A 5HK0A 1TUDA 3EFRA 2ESWA 3JCMV 1VYTA 4ATOA 3CD6A 3RIRA 1PNJA 1CKAA 1LNXA 1Q82C 1UHCA 1K73R 2C06A 2D6FA 2YT6A 1WQWA 1VOMA 1TTHB 1ZQ1A 1JJ2A 2P0PA 3OBWA 3G71T 4JJBA 1M2OA 3OW2P 3E19A 4XTUA 4KGZB 1ZLMA 1JO8A 1NPPA 1R0BG 4MMKA 3MP1A 4M7DF 3EGDA 2RJDA 1VQPT 4JRIA 4QQGA 2FL7A 2DRKA 2E64A 2YRDA 5LJ5f 2XI9A 2K5FA 1Q95G 1X6BA 2Y4XA 4FYXB 1BU1A 2K6DA 2MIOA 1QP3A 5IN1A 5L23A 1N9RA 2V8IA 1PC0A 1W2BP 4MZMA 4FT2A 5GANd 4PLLA 4B6MA 2K79A 2VB6A 3EGXB 1KC8U 4J6YA 4M77B 2XMFA 4C8QG 5L8RE 2NUZA 2RF0A 3KBGA 3OYGA 3QBYA 2FRWA 1VQ7Q 1EZZB 2FO0A 3SWNB 2OTJA 4IUVA 1YITQ 3AHUA 5I11A 2EJ9A 1IXDA 1KQ1A 1RAGB 5FW9A 4EMKC 1SG5A 3PGGA 5CKHA 2F69A 1FYNA 4ZN1A 2DRMA 1UB4A 2DXCA 4HA8A 1A0NB 5CIUA 2PVOB 3UA7A 2O4XB 1K9MR 4E7SA 1VQLA 2EGEA 4M7AE 2KE9A 3RUXA 8ATCB 2QXFA 2KNBB 1ZSGA 3C94A 2CUBA 4VUBA 5D6YA 3LH0A 1FMWA 2MAMA 1KHCA 2LQKA 4KH0B 3ER0A 4J9IA 2CZ7B 1M4ZA 1K73U 1RAIB 4KT0E 4E47A 5KE2A 4QKUA 2YHTA 3UA6A 3HSBA 2FPDA 4LN2A 1GCQA 1SF9A 2YRCA 4A54A 2J6KA 5IHNA 3MO8A 1N27A 3G4SA 1PSFA 2JNGA 3EFSA 3EG2A 1D0ZA 1M1KR 3CPWA 2DO3A 1ZBXA 2HMAA 3LX7A 1Q81R 3OYJA 2RI2A 1RLQC 3CCQA 1VQOA 2NYSA 2HKNA 5LJ3h 4D8KA 2YUNA 3OYDA 4PL6A 1KFZA 1AD5A 1JEGA 1XTDA 4GY5A 1G3YA 1TOVA 3QYGB 3U23A 1WQ7A 2DMOA 2LCCA 2E3IA 2EYXA 2E70A 1RI0A 2AZVA 4CRIA 3CCLQ 3CD6T 1VYVA 1HD3A 2SEMA 2QTVA 5KE3A 4BI8B 4XU0A 1WGSA 5LJ3d 1MMGA 4A4EA 1RLPC 1YHQQ 3HFNA 4J83A 4M7DG 2CP6A 2LCLA 2HD0A 1YWOA 1XOVA 3TSZA 1K9MU 1MHNA 4X9CA 1M3CA 4J7FA 4EIKA 2NUPB 2ZCFB 1X6GA 1HXDA 2ROTA 1TH7A 4NS5A 2L89A 2DBMA 2CGHA 1I5LA 5I2MA 2DXTA 4M78C 4KRTA 2F2XA 2X4XA 4M7AB 4CI0C 3QPHA 4C92C 1YJWA 1V1CA 3JSCA 2VXFA 5FU7C 2RJCA 1VQ9Q 4PJLA 2GTJA 1I0CA 3I5RA 4N0AC 4JZ4A 3EG9A 4Z89A 5J26A 3CCVQ 1OX8A 3MEVA 3V7SA 1ABOA 1I07A 2VUBA 4JRPA 2OTJT 3X25B 3PIPA 5FU6B 1SRMA 2OJ2A 4FSSA 4BI4A 1WHGA 2ED1A 2DE0X 4ZTJA 3JCMh 4BUGA 1M2VA 1X2KA 2MWOA 3C0CA 1VYUA 4EPCA 2PVGB 4FYYB 4F7UF 1YJ9A 1ZUUA 4R56A 2EYQA 1PG5B 1VQLT 4OP0A 4XU2A 1AZGB 1AOJA 1UUEA 5CKDA 5EG2A 5GAMj 3M54A 3CPWP 2R57A 2DERA 2YUOA 1B3QA 2OAUA 3JV3A 2YRVA 2V1RA 4ME7A 2KMTA 4CC2A 3UWNA 2GCXA 5CQXA 3G7ZA 2L3PA 4OGEA 3L2WA 4XU3A 1R77A 2AIRB 2CDTA 1YIJQ 1AVZC 3M57A 2KT8A 2OAWA 3G4ST 4RTWA 4DEYA 1YJNT 2CT3A 2KY9A 5CK9A 4J6WA
chains in the Genus database with same CATH topology
2LNHB 1U3OA 2JM9A 2FEIA 2EYWA 2AZSA 3IQLA 2A37A 2KEAA 1WI7A 4J9FA 2O9VA 1ABQA 1NYGA 4HVVA 4RTVA 2A08A 2BZXA 4RTZA 2VVKA 4JPBW 2J7IA 1YWPA 3VS7A 1NLPC 3REBB 2VKNA 1KJWA 1K0SA 2KROA 2AKKA 1WX6A 4J9DA 4OMQA 1QLYA 2GGRA 4LNPA 1GBQA 1N5ZA 1W1FA 2AK5A 2JMAA 2W0ZA 2YUQA 4OMNA 3RBBB 2BZ8A 3I5SA 2D0NA 2RPNA 2E5KA 4CC4B 4RUGA 3NHNA 4AG2C 1PRMC 1WXUA 4GBQA 4RTUA 1GBRA 1JXOA 1X69A 4IIMA 3NMZC 4F14A 4LE9A 1WXBA 4WCIA 2RMOA 2CSIA 3VS0A 4K11A 1HSQA 2DF6A 2DM1A 1GL5A 2K2MA 1UJYA 1B07A 1OEBA 2CH4A 2GQIA 2I0NA 3VS4A 2KRNA 3PVQA 2L3QA 3M0QA 2M0YA 2YSQA 4J9CA 1KIKA 4CC3A 1QWEA 1UECA 4HXJA 2LX7A 4RTXA 3H0IA 1T3LA 5FWBA 1OPKA 2V1QA 1PHTA 2ABLA 2AKLA 1QWFA 1J3TA 2CUDA 2KT1A 1K9AA 1TG0A 3M0SA 2F2VA 1H3HA 2DJQA 4J9HA 1AEYA 2DL3A 3VS6A 2DLPA 3A98A 2DYBA 2L2PA 4ORZA 1M3AA 2HSPA 2IIMA 3VS5A 2DBKA 2JXBA 3LH5A 1QCFA 2KBTA 1YN8A 4DEXA 1YP5A 1M8MA 2HEQA 1IO6A 4AFUC 1ZUKA 1TUCA 2EGAA 4RTTA 3EG0A 3R6NA 1UG1A 2JT4A 1RI9A 4A63B 1PRLC 2O9SA 2JS0A 4RTYA 2RQRA 1AWXA 1QKWA 1UHFA 2DILA 2J6OA 1Z9ZA 1NEBA 1UE9A 2JW4A 1AZEA 4JJCA 1BBZA 2DNUA 3QWXX 4QT7A 2RQTA 2QDLA 3ULRB 3M0TA 2K7AA 1U5SA 3VRYA 4J9BA 1M27C 1OOTA 1JQQA 2YUPA 1KSWA 1UJ0A 1GFDA 4JZ3A 2DVJA 1TUDA 1S1NA 2ESWA 4OMOA 2GBQA 4LUDA 1VYTA 2DL8A 1WLPB 2LJ1A 2MCNA 1PNJA 1CKAA 2DL5A 1UHCA 2YT6A 1X43A 2LP5A 2M51A 2JM8A 4HVUA 1QKXA 1AWWA 4JJBA 1JXMA 1SEMA 2A28A 2ROLA 2W10A 1ZLMA 1JO8A 4AFQC 3KFVA 1NYFA 1GRIA 3GBQA 2PTKA 1Y0MA 2DRKA 2GTOA 2EPDA 1K0XA 2K9GA 1NLOC 2J05A 1HJDA 1X6BA 4Z8AA 1UGVA 1PKTA 2VWFA 1SRLA 1BU1A 2K6DA 2JS2A 2MIOA 2YDLA 1GFCA 5L23A 1FMKA 2EKHA 1JU5C 4AFSC 2D8JA 5IXFA 2JTEA 2C0IA 3EHRA 3O5ZA 2FRYA 4OMMA 2K79A 1MUZA 2XMFA 2ED0A 2NUZA 2RF0A 2FRWA 4Z88A 1W70A 2RQVA 2RQWA 2FO0A 5GJVB 2KRSA 2LZ6B 5IHIA 2KGTA 5I11A 4IIOA 1T0HA 4Y92A 2PZ1A 1T3SA 3UF4A 5I22A 2P4RA 4AG1C 5FW9A 1BK2A 2F2WA 2FPEA 4M4ZA 1FYNA 1EFNA 2DRMA 2J6FA 2EVRA 2KXCA 4D8DA 1A0NB 1YNZA 2EW3A 1UDLA 2KYBA 3UA7A 2HCKA 5EC7A 2EGEA 1SHFA 2KE9A 2ENMA 2KNBB 1ZSGA 4X1VA 2CUBA 2KRMA 1U06A 2X3WD 1GCPA 1SSHA 1PWTA 4J9IA 4OMLA 1X27A 1ZBJA 2A36A 2GNCA 1CSKA 2ECZA 2B86A 3VRZA 1K1ZA 2EGCA 3UA6A 2DA9A 2FPDA 4JJDA 4LN2A 2SRCA 1E6GA 1GCQA 2DL4A 1OV3A 4ZNXA 3UATA 1VA7A 4LUEA 3PVLA 2J6KA 5IHNA 1AWJA 5FWCA 1M30A 3M0RA 1NM7A 2EBPA 3EG2A 2X3XD 2LQNA 3RNJA 1Z9QA 2O2OA 1RLQC 3QWYA 2OI3A 2MOXA 1LCKA 2LCSA 4D8KA 2YUNA 1KFZA 1AD5A 2HBWA 5ECAA 1SHGA 2RQUA 3TSWA 1WYXA 1JEGA 2PNIA 3I35A 2HDAA 4F17A 3U23A 2LJ0A 2RN8A 1WIEA 1ZUYA 2DMOA 1MV3A 3EHQA 2EYXA 1T0JA 2J06A 2AZVA 4R0KA 1VYVA 4CC7A 1HD3A 2SEMA 1K4US 2CH4W 2D8HA 4HVWA 2O88A 2KXDA 3CQTA 3H0FA 4HCKA 5IXBA 3EGUA 3REAB 1M3BA 1RLPC 1H8KA 2FG0A 1SPKA 2LJ3A 1X2QA 1NEGA 1BB9A 3SEMA 4GLMA 1ARKA 1YWOA 1XOVA 3TSZA 4F16A 2DL7A 1M3CA 4EIKA 2DX1A 1UTIA 1GCQC 1X6GA 1YCSB 2ROTA 3THKA 2RNAA 3H0HA 1UFFA 2DBMA 5GJWB 2NWMA 1NG2A 2KR3A 4KRTA 2L3SA 2F2XA 2BTTA 5IHKA 1V1CA 2JMCA 3SHWA 5IH2A 2G6FX 2FPFA 1I0CA 2GTJA 3I5RA 1OPLA 4JZ4A 2EQIA 4Z89A 1K76A 1ABOA 2EYZA 2O31A 1ZX6A 1I07A 1RUWA 3I9QA 1SRMA 2OJ2A 2D1XA 3EG3A 3M0UA 4FSSA 1I1JA 2K3BA 2ED1A 2DE0X 2H8HA 3VS3A 3VS2A 2CSQA 4AFZC 1AWOA 4J9EA 1X2KA 3C0CA 1PKSA 1VYUA 1H92A 2L0AA 1ZUUA 2LMJA 1MV0B 2C0TA 1G2BA 1AZGB 1AOJA 1UUEA 2CT4A 2LQWA 1WA7A 1WXTA 2CREA 3H41A 2BZYA 2KYMA 3VS1A 2YUOA 3M0PA 1B3QA 3JV3A 1G83A 2V1RA 4CC2A 5HCKA 3TVTA 3ZL7C 3NGPA 2L3PA 4J9GA 1E7OA 1CKBA 3PE0A 2CDTA 3FJ5A 1WDXA 1AVZC 1WFWA 3EG1A 4ESRA 2KT8A 1Y57A 1E6HA 2OAWA 4E6RA 1W6XA 4OMPA 4RTWA 4DEYA 3NPFA 2CT3A 2C0OA 2EYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNH B;  1U3O A;  2JM9 A;  2FEI A;  2EYW A;  2AZS A;  3IQL A;  2A37 A;  2KEA A;  1WI7 A;  4J9F A;  2O9V A;  1ABQ A;  1NYG A;  4HVV A;  4RTV A;  2A08 A;  2BZX A;  4RTZ A;  2VVK A;  4JPB W;  2J7I A;  1YWP A;  3VS7 A;  1NLP C;  3REB B;  2VKN A;  1KJW A;  1K0S A;  2KRO A;  2AKK A;  1WX6 A;  4J9D A;  4OMQ A;  1QLY A;  2GGR A;  4LNP A;  1GBQ A;  1N5Z A;  1W1F A;  2AK5 A;  2JMA A;  2W0Z A;  2YUQ A;  4OMN A;  3RBB B;  2BZ8 A;  3I5S A;  2D0N A;  2RPN A;  2E5K A;  4CC4 B;  4RUG A;  3NHN A;  4AG2 C;  1PRM C;  1WXU A;  4GBQ A;  4RTU A;  1GBR A;  1JXO A;  1X69 A;  4IIM A;  3NMZ C;  4F14 A;  4LE9 A;  1WXB A;  4WCI A;  2RMO A;  2CSI A;  3VS0 A;  4K11 A;  1HSQ A;  2DF6 A;  2DM1 A;  1GL5 A;  2K2M A;  1UJY A;  1B07 A;  1OEB A;  2CH4 A;  2GQI A;  2I0N A;  3VS4 A;  2KRN A;  3PVQ A;  2L3Q A;  3M0Q A;  2M0Y A;  2YSQ A;  4J9C A;  1KIK A;  4CC3 A;  1QWE A;  1UEC A;  4HXJ A;  2LX7 A;  4RTX A;  3H0I A;  1T3L A;  5FWB A;  1OPK A;  2V1Q A;  1PHT A;  2ABL A;  2AKL A;  1QWF A;  1J3T A;  2CUD A;  2KT1 A;  1K9A A;  1TG0 A;  3M0S A;  2F2V A;  1H3H A;  2DJQ A;  4J9H A;  1AEY A;  2DL3 A;  3VS6 A;  2DLP A;  3A98 A;  2DYB A;  2L2P A;  4ORZ A;  1M3A A;  2HSP A;  2IIM A;  3VS5 A;  2DBK A;  2JXB A;  3LH5 A;  1QCF A;  2KBT A;  1YN8 A;  4DEX A;  1YP5 A;  1M8M A;  2HEQ A;  1IO6 A;  4AFU C;  1ZUK A;  1TUC A;  2EGA A;  4RTT A;  3EG0 A;  3R6N A;  1UG1 A;  2JT4 A;  1RI9 A;  4A63 B;  1PRL C;  2O9S A;  2JS0 A;  4RTY A;  2RQR A;  1AWX A;  1QKW A;  1UHF A;  2DIL A;  2J6O A;  1Z9Z A;  1NEB A;  1UE9 A;  2JW4 A;  1AZE A;  4JJC A;  1BBZ A;  2DNU A;  3QWX X;  4QT7 A;  2RQT A;  2QDL A;  3ULR B;  3M0T A;  2K7A A;  1U5S A;  3VRY A;  4J9B A;  1M27 C;  1OOT A;  1JQQ A;  2YUP A;  1KSW A;  1UJ0 A;  1GFD A;  4JZ3 A;  2DVJ A;  1TUD A;  1S1N A;  2ESW A;  4OMO A;  2GBQ A;  4LUD A;  1VYT A;  2DL8 A;  1WLP B;  2LJ1 A;  2MCN A;  1PNJ A;  1CKA A;  2DL5 A;  1UHC A;  2YT6 A;  1X43 A;  2LP5 A;  2M51 A;  2JM8 A;  4HVU A;  1QKX A;  1AWW A;  4JJB A;  1JXM A;  1SEM A;  2A28 A;  2ROL A;  2W10 A;  1ZLM A;  1JO8 A;  4AFQ C;  3KFV A;  1NYF A;  1GRI A;  3GBQ A;  2PTK A;  1Y0M A;  2DRK A;  2GTO A;  2EPD A;  1K0X A;  2K9G A;  1NLO C;  2J05 A;  1HJD A;  1X6B A;  4Z8A A;  1UGV A;  1PKT A;  2VWF A;  1SRL A;  1BU1 A;  2K6D A;  2JS2 A;  2MIO A;  2YDL A;  1GFC A;  5L23 A;  1FMK A;  2EKH A;  1JU5 C;  4AFS C;  2D8J A;  5IXF A;  2JTE A;  2C0I A;  3EHR A;  3O5Z A;  2FRY A;  4OMM A;  2K79 A;  1MUZ A;  2XMF A;  2ED0 A;  2NUZ A;  2RF0 A;  2FRW A;  4Z88 A;  1W70 A;  2RQV A;  2RQW A;  2FO0 A;  5GJV B;  2KRS A;  2LZ6 B;  5IHI A;  2KGT A;  5I11 A;  4IIO A;  1T0H A;  4Y92 A;  2PZ1 A;  1T3S A;  3UF4 A;  5I22 A;  2P4R A;  4AG1 C;  5FW9 A;  1BK2 A;  2F2W A;  2FPE A;  4M4Z A;  1FYN A;  1EFN A;  2DRM A;  2J6F A;  2EVR A;  2KXC A;  4D8D A;  1A0N B;  1YNZ A;  2EW3 A;  1UDL A;  2KYB A;  3UA7 A;  2HCK A;  5EC7 A;  2EGE A;  1SHF A;  2KE9 A;  2ENM A;  2KNB B;  1ZSG A;  4X1V A;  2CUB A;  2KRM A;  1U06 A;  2X3W D;  1GCP A;  1SSH A;  1PWT A;  4J9I A;  4OML A;  1X27 A;  1ZBJ A;  2A36 A;  2GNC A;  1CSK A;  2ECZ A;  2B86 A;  3VRZ A;  1K1Z A;  2EGC A;  3UA6 A;  2DA9 A;  2FPD A;  4JJD A;  4LN2 A;  2SRC A;  1E6G A;  1GCQ A;  2DL4 A;  1OV3 A;  4ZNX A;  3UAT A;  1VA7 A;  4LUE A;  3PVL A;  2J6K A;  5IHN A;  1AWJ A;  5FWC A;  1M30 A;  3M0R A;  1NM7 A;  2EBP A;  3EG2 A;  2X3X D;  2LQN A;  3RNJ A;  1Z9Q A;  2O2O A;  1RLQ C;  3QWY A;  2OI3 A;  2MOX A;  1LCK A;  2LCS A;  4D8K A;  2YUN A;  1KFZ A;  1AD5 A;  2HBW A;  5ECA A;  1SHG A;  2RQU A;  3TSW A;  1WYX A;  1JEG A;  2PNI A;  3I35 A;  2HDA A;  4F17 A;  3U23 A;  2LJ0 A;  2RN8 A;  1WIE A;  1ZUY A;  2DMO A;  1MV3 A;  3EHQ A;  2EYX A;  1T0J A;  2J06 A;  2AZV A;  4R0K A;  1VYV A;  4CC7 A;  1HD3 A;  2SEM A;  1K4U S;  2CH4 W;  2D8H A;  4HVW A;  2O88 A;  2KXD A;  3CQT A;  3H0F A;  4HCK A;  5IXB A;  3EGU A;  3REA B;  1M3B A;  1RLP C;  1H8K A;  2FG0 A;  1SPK A;  2LJ3 A;  1X2Q A;  1NEG A;  1BB9 A;  3SEM A;  4GLM A;  1ARK A;  1YWO A;  1XOV A;  3TSZ A;  4F16 A;  2DL7 A;  1M3C A;  4EIK A;  2DX1 A;  1UTI A;  1GCQ C;  1X6G A;  1YCS B;  2ROT A;  3THK A;  2RNA A;  3H0H A;  1UFF A;  2DBM A;  5GJW B;  2NWM A;  1NG2 A;  2KR3 A;  4KRT A;  2L3S A;  2F2X A;  2BTT A;  5IHK A;  1V1C A;  2JMC A;  3SHW A;  5IH2 A;  2G6F X;  2FPF A;  1I0C A;  2GTJ A;  3I5R A;  1OPL A;  4JZ4 A;  2EQI A;  4Z89 A;  1K76 A;  1ABO A;  2EYZ A;  2O31 A;  1ZX6 A;  1I07 A;  1RUW A;  3I9Q A;  1SRM A;  2OJ2 A;  2D1X A;  3EG3 A;  3M0U A;  4FSS A;  1I1J A;  2K3B A;  2ED1 A;  2DE0 X;  2H8H A;  3VS3 A;  3VS2 A;  2CSQ A;  4AFZ C;  1AWO A;  4J9E A;  1X2K A;  3C0C A;  1PKS A;  1VYU A;  1H92 A;  2L0A A;  1ZUU A;  2LMJ A;  1MV0 B;  2C0T A;  1G2B A;  1AZG B;  1AOJ A;  1UUE A;  2CT4 A;  2LQW A;  1WA7 A;  1WXT A;  2CRE A;  3H41 A;  2BZY A;  2KYM A;  3VS1 A;  2YUO A;  3M0P A;  1B3Q A;  3JV3 A;  1G83 A;  2V1R A;  4CC2 A;  5HCK A;  3TVT A;  3ZL7 C;  3NGP A;  2L3P A;  4J9G A;  1E7O A;  1CKB A;  3PE0 A;  2CDT A;  3FJ5 A;  1WDX A;  1AVZ C;  1WFW A;  3EG1 A;  4ESR A;  2KT8 A;  1Y57 A;  1E6H A;  2OAW A;  4E6R A;  1W6X A;  4OMP A;  4RTW A;  4DEY A;  3NPF A;  2CT3 A;  2C0O A;  2EYY A; 
#chains in the Genus database with same CATH topology
 2LNV A;  2LNH B;  4IUP A;  1U3O A;  2JM9 A;  2JJ9 A;  1OX9 A;  2CYZ B;  1WPY A;  2AZS A;  2QGG A;  1OZ3 A;  3TEE A;  3CCQ T;  3GLX A;  1ABQ A;  1NPR A;  1VQO T;  5D7U A;  3OYB A;  2J7I A;  2XDB A;  4GLK A;  5CKF A;  3REB B;  4Y28 E;  3SWN C;  3OYA A;  3HRU A;  2COW A;  2KRO A;  1NJI C;  4E7J A;  4OMQ A;  1QLY A;  2JMA A;  1N5Z A;  2VGM A;  2YUQ A;  5LJ5 j;  4WF2 A;  4JRK A;  3I5S A;  2D0N A;  2RPN A;  4CC4 B;  3JCM e;  4GBQ A;  1JXO A;  1X69 A;  4IIM A;  2E6Z A;  1UGS B;  3TRE A;  2DK3 A;  4WCI A;  4X34 A;  2RMO A;  2ZPB B;  2K5I A;  1VQ5 Q;  3SFM A;  1WJR A;  2K2M A;  4L6V 5;  2I0N A;  2KRN A;  3PVQ A;  1S72 Q;  2YLC A;  4M75 C;  3EGX A;  3RER A;  3MKD A;  1AT1 B;  1IB8 A;  4X9D A;  4HXJ A;  2YWW A;  3A8L B;  1KD1 C;  1T3L A;  5LJ5 e;  1OPK A;  2KK4 A;  5DLO A;  1XQH A;  1MNE A;  1NJI R;  3SWN A;  4XTZ A;  2CUD A;  2KT1 A;  3M0S A;  2DJQ A;  5C6S A;  1YJW T;  3FLG A;  4ORZ A;  3CME A;  1BCO A;  3NTK A;  4M77 G;  3LH5 A;  2CZ1 B;  4DEX A;  2O4X A;  3VUZ A;  3L2Q A;  2WAC A;  4RTT A;  3F70 A;  3A1P A;  2P0K A;  1UG1 A;  3JRZ A;  3Q1J A;  1BI3 A;  3MP8 A;  3ASK A;  3RES A;  1AWX A;  1QKW A;  4LDX A;  1X01 A;  4F7U G;  1QCO A;  1NEB A;  3KUF A;  3H6Z A;  2BKD N;  2Z0W A;  1AZE A;  1YJ9 T;  1KD1 R;  2DNU A;  4JLG A;  3QWX X;  4DOV A;  3EFO B;  2RH2 A;  2QAS A;  4J9B A;  3CCM A;  4YTL A;  1UJ0 A;  4PJO F;  4M7D B;  4OMO A;  1S1N A;  2X4Y A;  2HQE A;  2VV5 A;  2L5Q A;  2DPP B;  2LJ1 A;  1R8O B;  4DBF A;  2ZZD A;  4BY6 C;  2KAF A;  2LP5 A;  2M51 A;  4HVU A;  1MMA A;  2P0Q A;  1QKX A;  1AWW A;  1VQP Q;  3MP6 A;  1JXM A;  2DVE A;  2VXE A;  1IGQ A;  4E7Z A;  3MET A;  4AFQ C;  1UGR B;  4Q5W A;  1GRI A;  1G3W A;  4OF1 A;  2PTK A;  5A2Q E;  1NJI U;  2WSF E;  1KQS S;  1MGQ A;  1IGU A;  5GAO p;  1NLO C;  1WZO A;  2J05 A;  2XKO C;  4Z8A A;  4C0G A;  1UGV A;  2EQK A;  1PKT A;  2RJE A;  2VWF A;  2PU9 B;  2JS2 A;  2YDL A;  3OYY A;  1TXQ A;  1C6V X;  1FMK A;  2QQ9 A;  2EKH A;  2OX7 A;  3V8L A;  4AFS C;  3G6E A;  2D8J A;  2JTE A;  3QJ6 A;  1VQK T;  3O5Z A;  2FRY A;  4OMM A;  1OI1 A;  2M9U A;  2NUP A;  3CXC A;  2R58 A;  5I21 A;  3JB9 F;  1JJ2 S;  2ED0 A;  2DTI A;  4JLI A;  3TCJ A;  4ZGE B;  2RQV A;  5IHI A;  2RHX A;  4KUL A;  3UF4 A;  4M7A A;  4AG1 C;  1KD1 U;  4WTO B;  2CZ6 B;  2FPE A;  4M4Z A;  1N9S A;  6AT1 B;  2J6F A;  2EVR A;  2KXC A;  3L1A A;  2EW3 A;  4QVC A;  2DXB A;  2HKQ B;  1WHH A;  3JCM P;  4LXC A;  3E9G A;  4C5H A;  5GAN 8;  1KC8 R;  8AT1 B;  2KRM A;  1U06 A;  2JN0 A;  4B9X A;  2X3W D;  3P8H A;  1PWT A;  3GF5 A;  4BDZ A;  1X27 A;  1ZBJ A;  4XU1 A;  1B34 B;  2A36 A;  4RG8 A;  2GNC A;  2X4J A;  3LYI A;  4D6W A;  1CSK A;  2ECZ A;  3VRZ A;  2E5Q A;  1K1Z A;  2EGC A;  2QDY B;  3CME T;  1VQ4 A;  4JJD A;  4C5I A;  2SRC A;  4C8Q C;  4OB2 B;  4HT9 A;  4N4G A;  4JRQ A;  2RD1 A;  3UAT A;  1VA7 A;  4LUE A;  3I56 A;  4RMO A;  3HHT B;  1VQ4 Q;  2RI5 A;  3TU4 K;  1NM7 A;  3M55 A;  4RCC A;  3BW1 A;  2WSC E;  1PSE A;  1U1S A;  2X3X D;  2E65 A;  1D0X A;  1DJ7 B;  3UPU A;  2LCS A;  3CC2 A;  2RHI A;  2DKG A;  1SHG A;  2RQU A;  3CCJ T;  3CD6 Q;  1I4K 1;  3I35 A;  4PJO G;  3CCM T;  2F1L A;  1HYO A;  1QVG S;  2RN8 A;  1WIE A;  1ZUY A;  4DOW A;  1T0J A;  3M9Q A;  3MEW A;  2DTH A;  4CC7 A;  5CKE A;  1K4U S;  4HVW A;  2D8H A;  1OYX A;  1YFN A;  4C8Q A;  2BE7 D;  2EJG A;  3JCM b;  3REA B;  2RO0 A;  5KCO A;  1H8K A;  2FG0 A;  4OMF B;  1KG1 A;  2A3L A;  1LVK A;  4BE1 A;  5J3B A;  3S3O A;  3CPF A;  3JAM E;  2ZPE B;  3QKJ A;  2DL7 A;  3CXC P;  2EKO A;  2DX1 A;  4DQ2 A;  1UTI A;  2QEX A;  1Q82 R;  1GCQ C;  4HCC A;  3H0H A;  3ZBD A;  2DTO A;  1BI1 A;  2JTM A;  3PMI A;  5GJW B;  2F5K A;  2KI7 A;  3QSU A;  2DXU A;  1BCM A;  4O5V A;  3L42 A;  5IHK A;  2RA2 A;  4J5Y A;  4M75 D;  3G6E T;  2JMC A;  1V29 B;  2OTJ Q;  2G6F X;  3JCM J;  1OPL A;  4F7U B;  5J39 A;  3JB9 G;  2P84 A;  1WJS A;  1K76 A;  2YXY A;  3I9Q A;  1RUW A;  2CP5 A;  3PFS A;  5GAN g;  4N4I A;  5CVI A;  2D1X A;  4M7D C;  3M0U A;  1O75 A;  1VQL Q;  1RAC B;  2CSQ A;  2QTX A;  1PD1 A;  1AWO A;  4J9E A;  2FHD A;  4JS5 A;  1D3B B;  2K2V A;  2L0A A;  1P92 A;  1OQK A;  2C0T A;  1G2B A;  2JZ2 A;  2VC8 A;  4XTX A;  2CT4 A;  2LQW A;  1WA7 A;  1VIE A;  2RHU A;  2BIV A;  1YJN A;  1YI2 A;  2BZY A;  3VS1 A;  3M0P A;  1G83 A;  2VAS A;  3PIO A;  4LDU A;  1ACM B;  2HL3 A;  3G4S Q;  1YJN Q;  1VQ4 T;  3NGP A;  2M1H A;  3PE0 A;  4PJO E;  3I56 T;  3EG1 A;  3EFO A;  1VQN T;  4IUR A;  1Y57 A;  1E6H A;  5KYW B;  2V8J A;  3CCQ Q;  3HTR A;  1VQO Q;  3JB9 I;  3C12 A;  4M78 F;  1Q82 U;  2XDD A;  4M7D A;  3BFM A;  4C92 F;  3LLR A;  2ZPI B;  5GAO n;  4JJN K;  1G8X A;  2KEA A;  1X75 C;  1Q86 C;  2O9V A;  5DM7 R;  1NYG A;  3OYK A;  3LGF A;  3T9N A;  5LL6 S;  3LWH A;  2L8D A;  4RTV A;  2A08 A;  4JPB W;  3CC2 T;  4O6J A;  3VV0 A;  1K0S A;  2COZ A;  2AKK A;  4M7A D;  4J9D A;  2GGR A;  3OMG A;  1W1F A;  3P8D A;  4OMN A;  2BZ8 A;  4E2F B;  4RUG A;  4AG2 C;  1PRM C;  1WXU A;  2ZPG B;  2E4H A;  4RTU A;  1G5V A;  3ZFJ A;  2ATC B;  3RMS A;  1WXB A;  2CSI A;  5DLQ E;  3DKM A;  4RKU E;  3VS0 A;  2DM1 A;  4BDY A;  1UJY A;  1B07 A;  1OEB A;  5LJ3 g;  2GQI A;  1BKB A;  3HP9 A;  3CCR A;  3VS4 A;  1Q86 R;  2QGF B;  1XNI A;  3G1J A;  1ZA2 B;  2YSQ A;  5GAM h;  2QEX T;  4HCB A;  2LX7 A;  4RTX A;  3H0I A;  1YJW Q;  2IPO B;  2V1Q A;  2ABL A;  1UGP B;  1K9A A;  2F2V A;  2KQW A;  4J9H A;  2NUT B;  5FRO A;  1BIB A;  2L2P A;  2H3J A;  2HSP A;  1SSF A;  1TSF A;  3VS5 A;  5GAM d;  2LT4 A;  2KBT A;  2DD5 A;  1M8M A;  2HEQ A;  2QQA A;  1IO6 A;  5A0D A;  1C0M A;  2EGA A;  3N5B B;  2H3E B;  3R6N A;  3X24 B;  1YJ9 Q;  2JT4 A;  4PJO B;  4A63 B;  1PRL C;  1WHK A;  1B34 A;  3A8O B;  1XJW B;  4BE2 A;  1GXI E;  1UHF A;  3JCM d;  4C8Q D;  1Z9Z A;  1C1A A;  4OVA A;  2EWN A;  5LJ5 h;  2M0O A;  2PVD B;  2K7A A;  1U5S A;  2HZY A;  1D09 B;  1VQ8 A;  1JQQ A;  1YI2 T;  1Y7X A;  2DVJ A;  1IHV A;  2RJF A;  4TVR A;  2GBQ A;  4LUD A;  3LW5 E;  4M75 F;  1ZSZ B;  1WLP B;  4XK8 E;  5GAM e;  1QVF S;  2CKK A;  4M77 C;  2V26 A;  2RM4 A;  2KVQ G;  2JM8 A;  5LJ5 d;  4DBQ A;  5AYF A;  1Q86 U;  1SEM A;  3MEA A;  4M78 G;  2A28 A;  2FYK A;  2ROL A;  3JB9 J;  3QO3 A;  2QQR A;  1NYF A;  4C92 G;  3PTA A;  3CEY A;  3GBQ A;  4PFZ A;  3HKS A;  2M16 A;  3QII A;  1VQK A;  1Y0M A;  3UDC A;  3A8M B;  2GFA A;  2CS7 A;  1WHM A;  2EPD A;  2E41 A;  2ZGW A;  5GAN 3;  1KHI A;  3KXT A;  1HJD A;  1VQK Q;  3FRN A;  1LOJ A;  4PNO A;  4KGX B;  4ELY C;  5M9O A;  4LD6 A;  1RAH B;  5IXF A;  3EAE A;  2C0I A;  2L3R A;  2BUD A;  3CBO A;  4M77 A;  3OYN A;  3GIB A;  2RQW A;  2BE9 B;  3MEU A;  5GJV B;  1KK7 A;  2KRS A;  4IIO A;  1T0H A;  3OW2 S;  3L2Z A;  3ME9 A;  5GAN f;  5I22 A;  2P4R A;  3VYG A;  2AHJ B;  1M1G A;  3CCR T;  5A0G A;  2RI3 A;  1M90 C;  4PK4 A;  1EFN A;  4F7U A;  3JCM c;  4PJJ A;  2DZ9 A;  4D8D A;  1UDL A;  2QI2 A;  2HCK A;  5EC7 A;  1SHF A;  2ENM A;  3CME Q;  1TU0 B;  1RAA B;  1IZ6 A;  2NLU A;  2ZAE A;  3S3M A;  4M7D D;  1LJO A;  3JB9 H;  3S6W A;  3I55 A;  1I8F A;  2E3H A;  2JOY A;  4OML A;  3HRT A;  3URG A;  1IRX A;  3C95 A;  3JCM Q;  1W2B S;  2XK0 A;  2GF7 A;  4PFP A;  1D3B A;  3ZEH A;  3I55 Q;  1VQ6 A;  2EQM A;  1EIF A;  5CKB A;  1OV3 A;  4FSX A;  1Y96 B;  4ZNX A;  1FX7 A;  3PVL A;  2Y90 A;  5FWC A;  1M30 A;  1QVP A;  4KBM B;  3QG1 A;  4C0F A;  3GOX A;  3CCJ A;  5IAY A;  3R6O A;  5FRN A;  4HCZ A;  2ZPF B;  4XAX B;  2FB7 A;  4C5G A;  3VYH B;  4EMK B;  9ATC B;  1D1B A;  3RNJ A;  2O2O A;  4FL6 A;  3CCJ Q;  1N8R C;  1M90 R;  1U1T A;  1ZA1 B;  3CCE A;  3CCM Q;  3QWY A;  2OI3 A;  1LCK A;  1NZ9 A;  4M78 E;  1M1F A;  3CCS A;  3EH2 A;  5KYW A;  1D0Y A;  4C92 E;  5HY6 A;  1VQ8 T;  2X51 A;  1WYX A;  3C4S A;  4F17 A;  2PUO B;  2QQS A;  3CCS Q;  1Y71 A;  4M7A C;  5I2S A;  3OYF A;  5GMK j;  3MHX A;  1JBM A;  3EHQ A;  2V8K A;  2RHZ A;  3TQ7 P;  4M75 G;  4KUD K;  2J06 A;  5KYU B;  4C0D B;  2O88 A;  2KXD A;  3EGU A;  4L59 A;  1M3B A;  1Q7Y C;  4A4K A;  1G3S A;  3CMA A;  2F5T X;  3PMT A;  2K3X A;  1SPK A;  2LJ3 A;  5FU6 C;  3CC4 A;  3HL8 A;  1OU9 A;  3OB9 A;  3SEM A;  4NL3 A;  4LD9 K;  3LGL A;  1ARK A;  1PCX A;  1N8R R;  3NTI A;  4BE0 A;  4F16 A;  2MK5 A;  1W4S A;  3OS0 A;  1O9S A;  2K3Y A;  2OTL A;  5LJ3 f;  5GAN 4;  3CC7 A;  1G3T A;  4C8Q F;  3G6E Q;  1JRI A;  2X9H A;  1UFF A;  3QZ5 B;  5KYY B;  3QZ9 B;  1SKU B;  1NG2 A;  5A0L A;  5CAI A;  2HQH A;  2BTT A;  2HNI A;  4B9W A;  2RHY A;  4DBR A;  4OB0 B;  5IH2 A;  2A7Y A;  3OS1 A;  2JUF A;  3RKW A;  1Q7Y R;  2O31 A;  3VKI A;  4J6X A;  3INZ A;  1M90 U;  3OYL A;  1IHW A;  3BE3 A;  4DA4 A;  2QG9 B;  4Y91 A;  3HPW A;  3EG3 A;  1F1B B;  2K3B A;  2NUT A;  1RAE B;  4R55 A;  2GFU A;  3VS2 A;  4KGV B;  5KYX B;  4QVZ A;  1PKS A;  1H92 A;  2CP0 A;  2EFI A;  3OYE A;  2DAQ A;  1JB0 E;  3GP8 A;  5GAO r;  3E2U A;  1VQN A;  1IRE B;  3FB9 A;  3VUB A;  2XDP A;  5GAN 5;  4PJO A;  3H41 A;  4M78 B;  3I55 T;  5CO7 A;  2COY A;  2VGN A;  3I56 Q;  5GAN 2;  4C92 B;  1VQN Q;  2FZC B;  4OGC A;  5FU7 B;  2XHC A;  4J9G A;  1VQ6 T;  5FRM A;  3BDU A;  1KQS A;  3FJ5 A;  4J8O A;  1WDX A;  2E1H A;  1X6O A;  4ESR A;  1N8R U;  4E6R A;  1HK9 A;  3NFC A;  4OMP A;  4MDW A;  3NPF A;  4HT8 A;  1UEB A;  2C0O A;  2EYY A;  4M75 E;  3OA6 A;  3CC2 Q;  5CQY A;  1RAF B;  4MZT A;  2EYW A;  3X20 B;  4BAC A;  2A37 A;  4M77 D;  3CCE T;  1ZSZ A;  4IUQ A;  2E10 A;  2GQV A;  1R0C B;  2EQU A;  3UT1 A;  2BZX A;  4RTZ A;  3CCS T;  3OSV A;  4NL2 A;  1D1A A;  1WX6 A;  3CPW S;  4LNP A;  2W0Z A;  2AK5 A;  3OS5 A;  2DEU A;  3RBB B;  5GAN h;  4IKF A;  2E5K A;  1Q7Y U;  2DFU A;  2LX9 A;  2XD0 A;  1GBR A;  3NMZ C;  4KH1 B;  4F14 A;  1K9M C;  2EAY A;  4A4H A;  2LQ8 A;  3CMA T;  1PD0 A;  5D6X A;  4LDY A;  2QEX Q;  3CC4 T;  4AT1 B;  4K11 A;  1HSQ A;  2DIQ A;  1BIA A;  2CH4 A;  3JCM W;  3CBM A;  1OU8 A;  4AMC A;  1VQ7 A;  2LVM A;  4PJN A;  2OTL T;  4P5N A;  4CC3 A;  1YIT A;  3CC7 T;  2KSS A;  1YCY A;  5FWB A;  5GAN j;  2AKL A;  3HRS A;  2P4T A;  2XG8 D;  3DB4 A;  4UC4 A;  2MPX C;  1TG0 A;  4J7I A;  1M1K C;  1BI2 A;  3V7R A;  2QK0 A;  3A98 A;  1Q81 C;  2RK1 A;  3M56 A;  3M58 A;  2IIM A;  2JXB A;  1QCF A;  1YN8 A;  1YP5 A;  2MI6 A;  4AFU C;  4QQ6 A;  5HK3 A;  1D1C A;  3V7C A;  5GMK l;  1QVG A;  3M59 A;  5GAN e;  2FZK B;  2LC4 A;  2DIL A;  3E9F A;  4M75 B;  3OS2 A;  3A8H B;  1YI2 Q;  4C0D C;  2RB6 A;  1KQS P;  3EH1 A;  3FIF A;  1Y96 A;  4QT7 A;  1WHJ A;  2QDL A;  3ULR B;  3M0T A;  1UGQ B;  4FM4 B;  1OOT A;  5GAN 7;  2QQB A;  2YUP A;  2A0F B;  2Y4Y A;  1KSW A;  1EX4 A;  3PNW C;  2QAZ A;  4EMK A;  1M8V A;  4FW2 A;  2IVW A;  1KQ2 A;  5GAO m;  4Z02 A;  2DL8 A;  1I5O B;  2XIC A;  3MPU B;  3VU3 C;  4BD3 A;  4QW2 A;  2MCN A;  4E7K A;  4V2S A;  4OB1 B;  2DL5 A;  1JJ2 P;  3H9N A;  5KCH A;  1X43 A;  2XU8 A;  2X4W A;  3BY7 A;  1VIF A;  3A5Z B;  1QMC A;  2M02 A;  3CCL A;  4HKE A;  2W10 A;  3KFV A;  3S3N A;  1I81 A;  4RG2 A;  1QP2 A;  3RR6 A;  3OY9 A;  5KYU A;  1YHQ A;  2GTO A;  1K0X A;  2K9G A;  1H64 1;  5D6W A;  2CP3 A;  1BI0 A;  2HQX A;  1SRL A;  2FVU A;  3MCA B;  3D7S B;  1GFC A;  5LJ3 j;  2B8A A;  4IUU A;  2QYZ A;  1JU5 C;  3E1S A;  4C8Q E;  1RAB B;  3FJP A;  3EHR A;  3A8G B;  4E7H A;  1AHJ B;  1MUZ A;  4JDS A;  4BY6 B;  4EMH A;  3OYM A;  1MMD A;  4Z88 A;  1W70 A;  2PUK B;  3CCR Q;  5KYY A;  4PJO D;  2K4Y A;  3DB3 A;  4XTW A;  2K57 A;  1VQ9 A;  2LZ6 B;  2MWP A;  2KGT A;  4Y92 A;  2PZ1 A;  1T3S A;  1ZHI A;  3CCV A;  1BK2 A;  2F2W A;  4KUI A;  4N4H A;  1VQ7 T;  2JVV A;  3M5A A;  1YIT T;  1YNZ A;  5LJ3 e;  1M1K U;  3V8K A;  4M77 F;  2KYB A;  4RCB A;  4ZTF A;  3OYI A;  2E12 A;  5GMK i;  1Q81 U;  4X1V A;  1Y07 A;  3PT9 A;  1QQJ A;  1GCP A;  1SSH A;  1QVG P;  4QQD A;  4A4G A;  3CBP A;  4PFO A;  2B86 A;  5KYX A;  2DA9 A;  3MJX A;  2D0Q B;  2DD4 A;  2D9T A;  5GAO l;  1E6G A;  4ZGJ B;  1M9S A;  2DL4 A;  3M4Y A;  3QDR B;  1AWJ A;  2HAX A;  3M0R A;  2EBP A;  4M78 A;  5GAM g;  4FU6 A;  1YIJ A;  4C92 A;  2DIG A;  5C0M A;  2MF2 A;  3WVE B;  4DBH A;  1WHL A;  2LQN A;  1Z9Q A;  3JB9 D;  1VQ8 Q;  3FEO A;  2R5A A;  4N0A A;  4FT4 A;  2MOX A;  3O8V A;  3L2R A;  3RKY A;  2MMP A;  2MYS A;  2CP2 A;  2HBW A;  1WNL A;  2PQW A;  5ECA A;  5CCA A;  3TSW A;  4LDV A;  3JCM g;  4A4F A;  1VQM A;  2PNI A;  2HDA A;  1RAD B;  4EDU A;  3CCU A;  2LJ0 A;  3QXE B;  3L2V A;  1MV3 A;  2VYT A;  3EGD B;  1VQM Q;  4R0K A;  3CCU Q;  2CH4 W;  3QHS A;  4C8Q B;  3CQT A;  3H0F A;  4HCK A;  5IXB A;  1VUB A;  4M7D E;  2LRQ A;  1BYM A;  3CCL T;  1X2Q A;  1NEG A;  1BB9 A;  2IG0 A;  4GLM A;  2DYI A;  3SDZ A;  5LJ5 g;  3AT1 B;  3OMC A;  4PKC C;  4II1 A;  1OZ2 A;  1YHQ T;  3QJY A;  1YCS B;  3THK A;  1VQ5 A;  2RNA A;  1TWB A;  4L5G A;  2DJZ A;  4MML A;  2NWM A;  1S72 A;  4PLI A;  1K8A C;  3NTH A;  2KR3 A;  3J81 E;  2CP7 A;  2L3S A;  3M53 A;  2XID A;  1M5Q 1;  2FZG B;  1U8R A;  1TUG B;  4LDW A;  3SHW A;  4MDX A;  4A53 A;  2FPF A;  1V76 A;  1NE8 A;  4QVD A;  2EQI A;  3RMQ A;  3OYC A;  2I2L A;  2EYZ A;  1ZX6 A;  4C5E A;  1MMN A;  1VQ9 T;  5GAN 6;  2QA4 A;  1I1J A;  3CCV T;  2H8H A;  3VS3 A;  4M7A F;  2YLB A;  4BI3 A;  4AFZ C;  2HSE B;  4FYW B;  4FYV B;  3CXC S;  2QA4 Q;  1QVF A;  3OYH A;  2LMJ A;  1MV0 B;  4OB3 B;  3WXM B;  5GMK h;  1K8A R;  1H3Z A;  3QDF A;  5IT9 E;  1VQ6 Q;  1WXT A;  5GAO q;  2CRE A;  2KYM A;  1RL2 A;  5CR2 A;  4ELZ C;  5HCK A;  1WJQ A;  3TVT A;  3ZL7 C;  4M75 A;  5FLX E;  4ZGD B;  2EQJ A;  1E7O A;  1QCN A;  1CKB A;  3J7A F;  3J80 E;  3HFO A;  4ZN3 A;  3G71 A;  1WFW A;  4E7L A;  4XTY A;  3RKX A;  4FW1 A;  2EIF A;  3CCE Q;  3JCM X;  4JS4 A;  1W6X A;  3WVD B;  1PM3 A;  2R5M A;  4EMG A;  4ANJ A;  2DET A;  3G71 Q;  1YIJ T;  1MND A;  2FEI A;  2DEQ A;  2G3R A;  4IUT A;  2LT1 A;  1VQP A;  3OQ5 A;  3IQL A;  4JUV A;  1WI7 A;  4J9F A;  2LTO A;  4HVV A;  4BB7 A;  2RK2 A;  2VVK A;  1YWP A;  3VS7 A;  2X35 A;  5HKC A;  2O01 E;  1NLP C;  3LWI A;  2VKN A;  1KJW A;  2EJF A;  3H8Z A;  1VQM T;  3OW2 A;  3CCU T;  1GBQ A;  1LPL A;  1TS9 A;  3GNF B;  3CMA Q;  1FMV A;  4XTV A;  3X26 B;  3NHN A;  2HL5 C;  3CC4 Q;  3X28 B;  2HBP A;  2LDM A;  3QYH B;  2E6N A;  3V8J A;  3FC3 A;  4LE9 A;  5GMK e;  4XQ3 A;  3BDL A;  2OTL Q;  3OBY A;  4FIB A;  1KC8 C;  3CC7 Q;  2DZC A;  3SD4 A;  2CZ0 B;  2AT1 B;  2ZPH B;  4PJO C;  5KYN A;  2DF6 A;  2K5L A;  3P8B B;  1GL5 A;  4F04 B;  1W2B A;  3GPL A;  7AT1 B;  1K8A U;  2L3Q A;  3M0Q A;  2M0Y A;  4J9C A;  1KIK A;  1QWE A;  5KH6 A;  1UEC A;  3EG9 B;  1VQ5 T;  4PJM A;  1PHT A;  4M78 D;  1QWF A;  3DLL A;  1J3T A;  1S72 T;  3FDR A;  4C92 D;  1H3H A;  1N6A A;  1FXX A;  2JTF A;  1AEY A;  2DL3 A;  4M77 E;  1NBE B;  3VS6 A;  2DLP A;  5DY9 A;  4FCY A;  2DYB A;  1M2V B;  2KDS A;  1M3A A;  1QVF P;  1ZSZ C;  5AT1 B;  4NOY A;  2DBK A;  1B7T A;  3QUI A;  1K73 C;  2WSE E;  1ZUK A;  1TUC A;  1OUL A;  3EG0 A;  1FWZ A;  1RI9 A;  4C0Z A;  4F7U E;  4M7A G;  3L2U A;  4MZP A;  2QA4 T;  3DLM A;  2O9S A;  2JS0 A;  4RTY A;  1QW1 A;  2RQR A;  3OSS C;  5GAM f;  1YBY A;  3VJP A;  2J6O A;  1UE9 A;  2JW4 A;  4JJC A;  1BBZ A;  2RQT A;  3GNG A;  3SB2 A;  3VRY A;  5GMK m;  1M27 C;  3RDV A;  1GFD A;  4E7I A;  3JCM f;  3M4G A;  4JZ3 A;  5HK0 A;  1TUD A;  3EFR A;  2ESW A;  3JCM V;  1VYT A;  4ATO A;  3CD6 A;  3RIR A;  1PNJ A;  1CKA A;  1LNX A;  1Q82 C;  1UHC A;  1K73 R;  2C06 A;  2D6F A;  2YT6 A;  1WQW A;  1VOM A;  1TTH B;  1ZQ1 A;  1JJ2 A;  2P0P A;  3OBW A;  3G71 T;  4JJB A;  1M2O A;  3OW2 P;  3E19 A;  4XTU A;  4KGZ B;  1ZLM A;  1JO8 A;  1NPP A;  1R0B G;  4MMK A;  3MP1 A;  4M7D F;  3EGD A;  2RJD A;  1VQP T;  4JRI A;  4QQG A;  2FL7 A;  2DRK A;  2E64 A;  2YRD A;  5LJ5 f;  2XI9 A;  2K5F A;  1Q95 G;  1X6B A;  2Y4X A;  4FYX B;  1BU1 A;  2K6D A;  2MIO A;  1QP3 A;  5IN1 A;  5L23 A;  1N9R A;  2V8I A;  1PC0 A;  1W2B P;  4MZM A;  4FT2 A;  5GAN d;  4PLL A;  4B6M A;  2K79 A;  2VB6 A;  3EGX B;  1KC8 U;  4J6Y A;  4M77 B;  2XMF A;  4C8Q G;  5L8R E;  2NUZ A;  2RF0 A;  3KBG A;  3OYG A;  3QBY A;  2FRW A;  1VQ7 Q;  1EZZ B;  2FO0 A;  3SWN B;  2OTJ A;  4IUV A;  1YIT Q;  3AHU A;  5I11 A;  2EJ9 A;  1IXD A;  1KQ1 A;  1RAG B;  5FW9 A;  4EMK C;  1SG5 A;  3PGG A;  5CKH A;  2F69 A;  1FYN A;  4ZN1 A;  2DRM A;  1UB4 A;  2DXC A;  4HA8 A;  1A0N B;  5CIU A;  2PVO B;  3UA7 A;  2O4X B;  1K9M R;  4E7S A;  1VQL A;  2EGE A;  4M7A E;  2KE9 A;  3RUX A;  8ATC B;  2QXF A;  2KNB B;  1ZSG A;  3C94 A;  2CUB A;  4VUB A;  5D6Y A;  3LH0 A;  1FMW A;  2MAM A;  1KHC A;  2LQK A;  4KH0 B;  3ER0 A;  4J9I A;  2CZ7 B;  1M4Z A;  1K73 U;  1RAI B;  4KT0 E;  4E47 A;  5KE2 A;  4QKU A;  2YHT A;  3UA6 A;  3HSB A;  2FPD A;  4LN2 A;  1GCQ A;  1SF9 A;  2YRC A;  4A54 A;  2J6K A;  5IHN A;  3MO8 A;  1N27 A;  3G4S A;  1PSF A;  2JNG A;  3EFS A;  3EG2 A;  1D0Z A;  1M1K R;  3CPW A;  2DO3 A;  1ZBX A;  2HMA A;  3LX7 A;  1Q81 R;  3OYJ A;  2RI2 A;  1RLQ C;  3CCQ A;  1VQO A;  2NYS A;  2HKN A;  5LJ3 h;  4D8K A;  2YUN A;  3OYD A;  4PL6 A;  1KFZ A;  1AD5 A;  1JEG A;  1XTD A;  4GY5 A;  1G3Y A;  1TOV A;  3QYG B;  3U23 A;  1WQ7 A;  2DMO A;  2LCC A;  2E3I A;  2EYX A;  2E70 A;  1RI0 A;  2AZV A;  4CRI A;  3CCL Q;  3CD6 T;  1VYV A;  1HD3 A;  2SEM A;  2QTV A;  5KE3 A;  4BI8 B;  4XU0 A;  1WGS A;  5LJ3 d;  1MMG A;  4A4E A;  1RLP C;  1YHQ Q;  3HFN A;  4J83 A;  4M7D G;  2CP6 A;  2LCL A;  2HD0 A;  1YWO A;  1XOV A;  3TSZ A;  1K9M U;  1MHN A;  4X9C A;  1M3C A;  4J7F A;  4EIK A;  2NUP B;  2ZCF B;  1X6G A;  1HXD A;  2ROT A;  1TH7 A;  4NS5 A;  2L89 A;  2DBM A;  2CGH A;  1I5L A;  5I2M A;  2DXT A;  4M78 C;  4KRT A;  2F2X A;  2X4X A;  4M7A B;  4CI0 C;  3QPH A;  4C92 C;  1YJW A;  1V1C A;  3JSC A;  2VXF A;  5FU7 C;  2RJC A;  1VQ9 Q;  4PJL A;  2GTJ A;  1I0C A;  3I5R A;  4N0A C;  4JZ4 A;  3EG9 A;  4Z89 A;  5J26 A;  3CCV Q;  1OX8 A;  3MEV A;  3V7S A;  1ABO A;  1I07 A;  2VUB A;  4JRP A;  2OTJ T;  3X25 B;  3PIP A;  5FU6 B;  1SRM A;  2OJ2 A;  4FSS A;  4BI4 A;  1WHG A;  2ED1 A;  2DE0 X;  4ZTJ A;  3JCM h;  4BUG A;  1M2V A;  1X2K A;  2MWO A;  3C0C A;  1VYU A;  4EPC A;  2PVG B;  4FYY B;  4F7U F;  1YJ9 A;  1ZUU A;  4R56 A;  2EYQ A;  1PG5 B;  1VQL T;  4OP0 A;  4XU2 A;  1AZG B;  1AOJ A;  1UUE A;  5CKD A;  5EG2 A;  5GAM j;  3M54 A;  3CPW P;  2R57 A;  2DER A;  2YUO A;  1B3Q A;  2OAU A;  3JV3 A;  2YRV A;  2V1R A;  4ME7 A;  2KMT A;  4CC2 A;  3UWN A;  2GCX A;  5CQX A;  3G7Z A;  2L3P A;  4OGE A;  3L2W A;  4XU3 A;  1R77 A;  2AIR B;  2CDT A;  1YIJ Q;  1AVZ C;  3M57 A;  2KT8 A;  2OAW A;  3G4S T;  4RTW A;  4DEY A;  1YJN T;  2CT3 A;  2KY9 A;  5CK9 A;  4J6W A; 
#chains in the Genus database with same CATH homology
 2LNH B;  1U3O A;  2JM9 A;  2FEI A;  2EYW A;  2AZS A;  3IQL A;  2A37 A;  2KEA A;  1WI7 A;  4J9F A;  2O9V A;  1ABQ A;  1NYG A;  4HVV A;  4RTV A;  2A08 A;  2BZX A;  4RTZ A;  2VVK A;  4JPB W;  2J7I A;  1YWP A;  3VS7 A;  1NLP C;  3REB B;  2VKN A;  1KJW A;  1K0S A;  2KRO A;  2AKK A;  1WX6 A;  4J9D A;  4OMQ A;  1QLY A;  2GGR A;  4LNP A;  1GBQ A;  1N5Z A;  1W1F A;  2AK5 A;  2JMA A;  2W0Z A;  2YUQ A;  4OMN A;  3RBB B;  2BZ8 A;  3I5S A;  2D0N A;  2RPN A;  2E5K A;  4CC4 B;  4RUG A;  3NHN A;  4AG2 C;  1PRM C;  1WXU A;  4GBQ A;  4RTU A;  1GBR A;  1JXO A;  1X69 A;  4IIM A;  3NMZ C;  4F14 A;  4LE9 A;  1WXB A;  4WCI A;  2RMO A;  2CSI A;  3VS0 A;  4K11 A;  1HSQ A;  2DF6 A;  2DM1 A;  1GL5 A;  2K2M A;  1UJY A;  1B07 A;  1OEB A;  2CH4 A;  2GQI A;  2I0N A;  3VS4 A;  2KRN A;  3PVQ A;  2L3Q A;  3M0Q A;  2M0Y A;  2YSQ A;  4J9C A;  1KIK A;  4CC3 A;  1QWE A;  1UEC A;  4HXJ A;  2LX7 A;  4RTX A;  3H0I A;  1T3L A;  5FWB A;  1OPK A;  2V1Q A;  1PHT A;  2ABL A;  2AKL A;  1QWF A;  1J3T A;  2CUD A;  2KT1 A;  1K9A A;  1TG0 A;  3M0S A;  2F2V A;  1H3H A;  2DJQ A;  4J9H A;  1AEY A;  2DL3 A;  3VS6 A;  2DLP A;  3A98 A;  2DYB A;  2L2P A;  4ORZ A;  1M3A A;  2HSP A;  2IIM A;  3VS5 A;  2DBK A;  2JXB A;  3LH5 A;  1QCF A;  2KBT A;  1YN8 A;  4DEX A;  1YP5 A;  1M8M A;  2HEQ A;  1IO6 A;  4AFU C;  1ZUK A;  1TUC A;  2EGA A;  4RTT A;  3EG0 A;  3R6N A;  1UG1 A;  2JT4 A;  1RI9 A;  4A63 B;  1PRL C;  2O9S A;  2JS0 A;  4RTY A;  2RQR A;  1AWX A;  1QKW A;  1UHF A;  2DIL A;  2J6O A;  1Z9Z A;  1NEB A;  1UE9 A;  2JW4 A;  1AZE A;  4JJC A;  1BBZ A;  2DNU A;  3QWX X;  4QT7 A;  2RQT A;  2QDL A;  3ULR B;  3M0T A;  2K7A A;  1U5S A;  3VRY A;  4J9B A;  1M27 C;  1OOT A;  1JQQ A;  2YUP A;  1KSW A;  1UJ0 A;  1GFD A;  4JZ3 A;  2DVJ A;  1TUD A;  1S1N A;  2ESW A;  4OMO A;  2GBQ A;  4LUD A;  1VYT A;  2DL8 A;  1WLP B;  2LJ1 A;  2MCN A;  1PNJ A;  1CKA A;  2DL5 A;  1UHC A;  2YT6 A;  1X43 A;  2LP5 A;  2M51 A;  2JM8 A;  4HVU A;  1QKX A;  1AWW A;  4JJB A;  1JXM A;  1SEM A;  2A28 A;  2ROL A;  2W10 A;  1ZLM A;  1JO8 A;  4AFQ C;  3KFV A;  1NYF A;  1GRI A;  3GBQ A;  2PTK A;  1Y0M A;  2DRK A;  2GTO A;  2EPD A;  1K0X A;  2K9G A;  1NLO C;  2J05 A;  1HJD A;  1X6B A;  4Z8A A;  1UGV A;  1PKT A;  2VWF A;  1SRL A;  1BU1 A;  2K6D A;  2JS2 A;  2MIO A;  2YDL A;  1GFC A;  5L23 A;  1FMK A;  2EKH A;  1JU5 C;  4AFS C;  2D8J A;  5IXF A;  2JTE A;  2C0I A;  3EHR A;  3O5Z A;  2FRY A;  4OMM A;  2K79 A;  1MUZ A;  2XMF A;  2ED0 A;  2NUZ A;  2RF0 A;  2FRW A;  4Z88 A;  1W70 A;  2RQV A;  2RQW A;  2FO0 A;  5GJV B;  2KRS A;  2LZ6 B;  5IHI A;  2KGT A;  5I11 A;  4IIO A;  1T0H A;  4Y92 A;  2PZ1 A;  1T3S A;  3UF4 A;  5I22 A;  2P4R A;  4AG1 C;  5FW9 A;  1BK2 A;  2F2W A;  2FPE A;  4M4Z A;  1FYN A;  1EFN A;  2DRM A;  2J6F A;  2EVR A;  2KXC A;  4D8D A;  1A0N B;  1YNZ A;  2EW3 A;  1UDL A;  2KYB A;  3UA7 A;  2HCK A;  5EC7 A;  2EGE A;  1SHF A;  2KE9 A;  2ENM A;  2KNB B;  1ZSG A;  4X1V A;  2CUB A;  2KRM A;  1U06 A;  2X3W D;  1GCP A;  1SSH A;  1PWT A;  4J9I A;  4OML A;  1X27 A;  1ZBJ A;  2A36 A;  2GNC A;  1CSK A;  2ECZ A;  2B86 A;  3VRZ A;  1K1Z A;  2EGC A;  3UA6 A;  2DA9 A;  2FPD A;  4JJD A;  4LN2 A;  2SRC A;  1E6G A;  1GCQ A;  2DL4 A;  1OV3 A;  4ZNX A;  3UAT A;  1VA7 A;  4LUE A;  3PVL A;  2J6K A;  5IHN A;  1AWJ A;  5FWC A;  1M30 A;  3M0R A;  1NM7 A;  2EBP A;  3EG2 A;  2X3X D;  2LQN A;  3RNJ A;  1Z9Q A;  2O2O A;  1RLQ C;  3QWY A;  2OI3 A;  2MOX A;  1LCK A;  2LCS A;  4D8K A;  2YUN A;  1KFZ A;  1AD5 A;  2HBW A;  5ECA A;  1SHG A;  2RQU A;  3TSW A;  1WYX A;  1JEG A;  2PNI A;  3I35 A;  2HDA A;  4F17 A;  3U23 A;  2LJ0 A;  2RN8 A;  1WIE A;  1ZUY A;  2DMO A;  1MV3 A;  3EHQ A;  2EYX A;  1T0J A;  2J06 A;  2AZV A;  4R0K A;  1VYV A;  4CC7 A;  1HD3 A;  2SEM A;  1K4U S;  2CH4 W;  2D8H A;  4HVW A;  2O88 A;  2KXD A;  3CQT A;  3H0F A;  4HCK A;  5IXB A;  3EGU A;  3REA B;  1M3B A;  1RLP C;  1H8K A;  2FG0 A;  1SPK A;  2LJ3 A;  1X2Q A;  1NEG A;  1BB9 A;  3SEM A;  4GLM A;  1ARK A;  1YWO A;  1XOV A;  3TSZ A;  4F16 A;  2DL7 A;  1M3C A;  4EIK A;  2DX1 A;  1UTI A;  1GCQ C;  1X6G A;  1YCS B;  2ROT A;  3THK A;  2RNA A;  3H0H A;  1UFF A;  2DBM A;  5GJW B;  2NWM A;  1NG2 A;  2KR3 A;  4KRT A;  2L3S A;  2F2X A;  2BTT A;  5IHK A;  1V1C A;  2JMC A;  3SHW A;  5IH2 A;  2G6F X;  2FPF A;  1I0C A;  2GTJ A;  3I5R A;  1OPL A;  4JZ4 A;  2EQI A;  4Z89 A;  1K76 A;  1ABO A;  2EYZ A;  2O31 A;  1ZX6 A;  1I07 A;  1RUW A;  3I9Q A;  1SRM A;  2OJ2 A;  2D1X A;  3EG3 A;  3M0U A;  4FSS A;  1I1J A;  2K3B A;  2ED1 A;  2DE0 X;  2H8H A;  3VS3 A;  3VS2 A;  2CSQ A;  4AFZ C;  1AWO A;  4J9E A;  1X2K A;  3C0C A;  1PKS A;  1VYU A;  1H92 A;  2L0A A;  1ZUU A;  2LMJ A;  1MV0 B;  2C0T A;  1G2B A;  1AZG B;  1AOJ A;  1UUE A;  2CT4 A;  2LQW A;  1WA7 A;  1WXT A;  2CRE A;  3H41 A;  2BZY A;  2KYM A;  3VS1 A;  2YUO A;  3M0P A;  1B3Q A;  3JV3 A;  1G83 A;  2V1R A;  4CC2 A;  5HCK A;  3TVT A;  3ZL7 C;  3NGP A;  2L3P A;  4J9G A;  1E7O A;  1CKB A;  3PE0 A;  2CDT A;  3FJ5 A;  1WDX A;  1AVZ C;  1WFW A;  3EG1 A;  4ESR A;  2KT8 A;  1Y57 A;  1E6H A;  2OAW A;  4E6R A;  1W6X A;  4OMP A;  4RTW A;  4DEY A;  3NPF A;  2CT3 A;  2C0O A;  2EYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...