2M51A

Nmr structure of the sh3 domain of human ras p21 protein activator (gtpase activating protein) 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
62
structure length
62
Chain Sequence
GRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ras GTPase-activating protein 1
publication title NMR structure of the SH3 domain of human RAS p21 protein activator (GTPase activating protein) 1
rcsb
source organism Homo sapiens
total genus 7
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2m51A00
3ULRB 3JV3A 2ENMA 2HSPA 2OI3A 2A28A 1ZSGA 1OEBA 2CDTA 4ZNXA 2MCNA 1JU5C 4RTWA 2K9GA 5IHNA 1NYFA 1M3AA 2QDLA 1XOVA 3VS0A 1AD5A 2LQWA 2DVJA 1WIEA 2DL5A 1PNJA 2DRMA 4CC3A 4K11A 2J06A 2BZYA 1NYGA 4RTVA 1SHGA 2MIOA 3R6NA 2KT1A 1K4US 2FPFA 1WI7A 4D8DA 5GJWB 2ROTA 2C0TA 2HDAA 2K79A 4OMPA 2RF0A 1WLPB 2YUOA 2FO0A 2KXCA 1B3QA 3VRYA 1WFWA 2DJQA 2J6OA 4RTZA 3VS6A 3CQTA 3M0PA 3EG1A 2F2XA 1JQQA 5FWCA 5IXBA 1AWXA 1M3BA 1HJDA 1FYNA 1TUDA 3VS1A 3UA7A 1QLYA 1T3SA 4HVVA 4J9HA 2DE0X 2NUZA 2A37A 1M27C 2J6KA 4OMMA 1SEMA 2FPDA 3M0UA 1X6GA 1I1JA 2BTTA 1AZGB 1GBQA 2AZVA 2KROA 2W0ZA 1SRMA 1I0CA 3O5ZA 4Z88A 1PKTA 2FEIA 1K76A 1OPLA 2JMCA 2E5KA 4F16A 3QWYA 1SSHA 3FJ5A 4GLMA 1U3OA 1X2KA 1M30A 1PRLC 1UJYA 2CSQA 2KNBB 2KBTA 2A36A 2PNIA 2ED1A 2RQRA 2M51A 4ORZA 1LCKA 5IXFA 1RUWA 2DNUA 2AK5A 3PE0A 2LQNA 1GCPA 2FG0A 3EGUA 2KRNA 2L3SA 4LUDA 1V1CA 4R0KA 4AG2C 1UTIA 2KYBA 1MUZA 1ABOA 2C0OA 1ZUYA 1YP5A 3KFVA 3ZL7C 2V1RA 2AKLA 2LJ3A 2GGRA 2L0AA 1VYTA 4J9CA 4M4ZA 3U23A 2J05A 1K0XA 1A0NB 4RTXA 1YN8A 4DEYA 2VWFA 1Z9ZA 1NEBA 1H3HA 3UATA 2O9SA 2DM1A 4OMOA 2RQTA 1UFFA 1OV3A 2YUQA 4LN2A 4JZ4A 4RTTA 1KJWA 3NGPA 1ZBJA 3TSZA 4AFQC 4F17A 2RN8A 2BZ8A 4EIKA 2CT3A 4JPBW 2EGEA 4OMNA 2VVKA 4JZ3A 2DMOA 1ZLMA 2EGCA 2D0NA 4F14A 1W1FA 2HEQA 4RUGA 2LX7A 1JO8A 1BBZA 2JXBA 2J6FA 1NM7A 2D8HA 3TVTA 2X3WD 1G2BA 2EYXA 2K2MA 2EBPA 2RQUA 4RTUA 3EG3A 2YDLA 1NEGA 4Z89A 2DX1A 2P4RA 5FWBA 1UUEA 1BU1A 5IHIA 4IIMA 2K3BA 1T0JA 2AKKA 2GBQA 1UG1A 3I35A 2JTEA 2LNHB 1H8KA 1RLPC 3THKA 2KRMA 1U06A 5L23A 1MV3A 1WYXA 4A63B 2LJ0A 1AZEA 2L3QA 2DILA 1UHCA 1Y0MA 2LMJA 4IIOA 4LE9A 4J9FA 3NMZC 2RQWA 3REAB 1G83A 2EYWA 3RNJA 2EYYA 2EVRA 2ED0A 1ZUUA 2CUBA 2J7IA 4HXJA 2G6FX 4OMQA 3UA6A 1UGVA 1CKBA 2RMOA 2O31A 3H0FA 1GCQC 2FRYA 2PZ1A 4QT7A 2D1XA 2DBMA 3M0SA 1QWFA 2CREA 1KSWA 2D8JA 2DL3A 2VKNA 3H41A 2YUNA 4AFSC 2KRSA 5I22A 2C0IA 2FRWA 3VS3A 2KE9A 1BK2A 2CSIA 1Z9QA 1QKWA 1SRLA 4J9GA 2LZ6B 2GTJA 1QCFA 1J3TA 1SHFA 4HVWA 1BB9A 1JXMA 2GNCA 2DYBA 2KT8A 3VS4A 1FMKA 1UJ0A 1H92A 1X27A 1OOTA 1PKSA 5HCKA 2ROLA 2JMAA 2F2VA 2EQIA 4LNPA 1SPKA 1GL5A 2HCKA 5ECAA 3UF4A 1GRIA 2B86A 1S1NA 2JW4A 1E6HA 1MV0B 2DA9A 1WA7A 3LH5A 1WDXA 4J9EA 2JS2A 1YCSB 2A08A 3SHWA 1U5SA 1VYUA 1TG0A 3I9QA 1HD3A 1W6XA 2YUPA 4CC2A 1GCQA 1B07A 1M8MA 2O9VA 1KIKA 4KRTA 4Y92A 3VS7A 2JM9A 1JEGA 2I0NA 1PHTA 2W10A 2RPNA 1QKXA 1VYVA 2RNAA 3EHRA 1AWOA 1EFNA 2HBWA 1TUCA 2X3XD 2MOXA 4X1VA 2SEMA 4RTYA 3PVQA 3EG2A 1YWPA 5FW9A 2DBKA 1QWEA 2FPEA 3IQLA 1X2QA 2CH4W 4FSSA 2O88A 3VS2A 4HCKA 2KEAA 5I11A 4Z8AA 1AEYA 1K1ZA 2EW3A 1OPKA 1K0SA 2LJ1A 1X43A 3GBQA 4JJCA 1X6BA 1E7OA 4E6RA 3A98A 2M0YA 4ESRA 4D8KA 1Y57A 1UE9A 1ZUKA 1T0HA 2EGAA 1I07A 1IO6A 2ESWA 2DL7A 2EKHA 1UDLA 1ZX6A 4J9DA 3NHNA 2RQVA 1WXUA 2SRCA 2LCSA 2H8HA 4AG1C 1GFDA 2NWMA 2LP5A 1ARKA 2XMFA 1AWJA 2ECZA 2K6DA 5IH2A 1GFCA 1KFZA 3REBB 2DL8A 3VS5A 2PTKA 3TSWA 3H0HA 3EG0A 3EHQA 2KR3A 4HVUA 3VRZA 1JXOA 4DEXA 4AFZC 2BZXA 4WCIA 2CH4A 1T3LA 2KGTA 3M0QA 1GBRA 2ABLA 4GBQA 3M0RA 1N5ZA 1WX6A 2CT4A 2YT6A 5GJVB 4CC7A 3SEMA 1PRMC 1RLQC 3NPFA 1HSQA 1VA7A 3PVLA 1X69A 1AWWA 1UECA 2YSQA 2KXDA 1WXTA 1NG2A 4J9IA 1UHFA 5IHKA 1E6GA 2GQIA 4JJDA 2EPDA 2L2PA 1RI9A 4CC4B 2F2WA 1CKAA 3I5RA 3QWXX 2DF6A 2DLPA 2AZSA 4AFUC 2GTOA 2IIMA 2DRKA 1ABQA 1CSKA 2JS0A 5EC7A 2OAWA 2L3PA 3C0CA 3M0TA 3I5SA 1PWTA 2OJ2A 4JJBA 2DL4A 4LUEA 3H0IA 2KYMA 4OMLA 2V1QA 1M3CA 2JM8A 2CUDA 1YWOA 1K9AA 3RBBB 1YNZA 1AOJA 2EYZA 4J9BA 2K7AA 2JT4A 1NLOC 1W70A 1NLPC 1AVZC 1WXBA 2O2OA
chains in the Genus database with same CATH superfamily
5CKBA 4WF2A 2ENMA 3RKWA 2HSPA 3EFOB 2XIDA 4A4EA 5KYXA 1JU5C 3JB9G 3UT1A 4KH0B 5EG2A 1NYFA 1M3AA 4A4KA 4E7KA 1Q86C 3VS0A 1ZQ1A 3MEWA 4O6JA 1PNJA 2RI3A 3EFSA 2FVUA 3FEOA 1SHGA 2MAMA 4D8DA 4DBRA 3JB9J 2GFAA 2HDAA 2CKKA 1VUBA 3FB9A 2YUOA 2FO0A 5GAMe 1B3QA 3S6WA 4E7JA 2DJQA 4RTZA 2A7YA 3VS6A 3CQTA 2F2XA 2QXFA 1VQNA 5IXBA 4BY6C 1AWXA 4F7UE 1HJDA 4KH1B 3VS1A 3CCET 2IG0A 4HVVA 4N0AC 2KY9A 4FYWB 1VQ8T 4DBHA 3LYIA 2ZPHB 1SEMA 1X6GA 1XQHA 2E6NA 4C8QD 1GBQA 1HYOA 3QZ9B 5KYXB 1SRMA 4E2FB 1WJQA 4M7DD 3G71Q 4RG2A 3CD6Q 3PMTA 4C8QG 4F16A 2DJZA 1VQKT 2MMPA 4GLMA 1U3OA 1I81A 5I2SA 2PUKB 3EG9A 1PRLC 2KNBB 1JJ2S 3CCUT 1KD1U 1G3TA 5C6SA 2RQRA 2M51A 4ORZA 1KHIA 1LCKA 5IXFA 1RUWA 2AK5A 3OSSC 4M7AA 3ZBDA 4EMGA 2KRNA 3RIRA 3QBYA 5GAMh 1VQ8A 3OYIA 4ELZC 5IT9E 4BUGA 1UTIA 2C0OA 3M56A 3KFVA 3QG1A 4E7SA 3ZL7C 5DM7R 4JS5A 2CP5A 3CCJQ 3G7ZA 1VYTA 3JRZA 1G3YA 1M4ZA 1UGQB 3UATA 2DM1A 3GIBA 4PL6A 1MMDA 3CCRA 1UFFA 2YUQA 4LN2A 2RHUA 4QQDA 4RTTA 5HK3A 4PJOG 3CCVQ 1KJWA 4E47A 2HNIA 3URGA 2D0QB 4Q5WA 1TS9A 1VQ7A 2RN8A 2DTOA 5GAOn 2VVKA 4JZ3A 3TREA 4F04B 3KBGA 3EG9B 4R56A 2D0NA 2BKDN 4F14A 4RCBA 1VQLA 1Q86U 3L2ZA 4M77A 1G2BA 4RTUA 1G3SA 2EBPA 3KUFA 1V76A 2YDLA 1IZ6A 2DX1A 3GNFB 4N4IA 5FWBA 2GFUA 5IHIA 2K3BA 2AKKA 2E5QA 2RHXA 3PGGA 2HKNA 3OS1A 3V7CA 2MK5A 2LNHB 3THKA 2IVWA 2RI2A 2KRMA 4BD3A 1U06A 2E64A 1Q81R 2HKQB 1WYXA 3WVDB 1YJNQ 3CCSQ 2LJ0A 2L3QA 3M57A 2QASA 2QA4A 5CK9A 4LE9A 5GANd 4J9FA 1VOMA 4JRQA 1RAIB 1K73R 2EVRA 1ZUUA 4ZN3A 2FZKB 2M1HA 3LW5E 3M55A 5FRMA 3CC2T 4BDYA 3CBOA 1FXXA 3HRTA 2HBPA 3V7RA 2PZ1A 3I55A 1JBMA 3CC7T 2DXTA 2EQJA 4TVRA 2QQRA 3X24B 1OULA 5CKHA 1M90U 1I5OB 1YITT 1BK2A 1VQPT 3RUXA 4M78A 3HTRA 3G4SQ 2E10A 3HHTB 3PTAA 1OQKA 3NFCA 1SRLA 4RKUE 4J9GA 4PJOA 1J3TA 2PVOB 3OYKA 4C8QB 2DYBA 2KT8A 3EFRA 3CEYA 3OS5A 2QGFB 3M54A 4BI8B 4L5GA 2JMAA 4FL6A 2WSEE 2LT1A 1D1CA 4X9CA 3UF4A 1S1NA 3G6EA 2RJFA 2DA9A 4PKCC 4MZTA 2DEUA 2D6FA 1YITA 4HCCA 2JS2A 1WJSA 5KYYB 3CMAA 4FT4A 4CC2A 3ASKA 3VS7A 2JM9A 4AT1B 4F7UF 2FHDA 2CP3A 4QVDA 1AWOA 3JCMW 4NS5A 2MWPA 4OP0A 4X1VA 1VQ6T 4RTYA 1QVPA 4PJOB 2X4JA 2B8AA 2COWA 5FW9A 4OB0B 5KH6A 1YIJQ 4RMOA 1ZA1B 3V7SA 3CC4T 1IB8A 1H3ZA 1OPKA 4C5HA 3CCLQ 4M7AC 3EH2A 4E6RA 1UE9A 1ZUKA 2QEXT 2EGAA 2ZCFB 3E9GA 3SD4A 1WXUA 3A5ZB 2X4WA 2KQWA 1XTDA 2H8HA 4MMKA 3OYDA 4AG1C 2A0FB 2NWMA 2OTJT 1JRIA 2VGMA 1QCOA 1G3WA 4JRKA 1YCYA 3J81E 2DIQA 2M9UA 5GAMj 3REBB 1WNLA 2PTKA 3TSWA 3VJPA 1N8RC 2XI9A 2KR3A 4HVUA 4X34A 4BE2A 3VRZA 4FW1A 2WSCE 4AFZC 4BDZA 1M8VA 3AT1B 2KGTA 3M0QA 1MMNA 2VYTA 1WHLA 1H641 3FJPA 1N5ZA 1WX6A 3FLGA 2YT6A 2XDBA 2X4XA 3S3OA 2XDDA 4C5GA 3RKXA 4O5VA 1S72T 1HSQA 4A4FA 1QVGP 1AWWA 2YSQA 2KXDA 4FYVB 4M77C 3RERA 1I8FA 1ZSZC 2OTJA 4CC4B 2E70A 1N8RR 2DF6A 4AFUC 3QSUA 1ABQA 1CSKA 3L1AA 4ZTFA 4E7LA 2QQAA 4JJBA 3H0IA 4PLLA 4OMLA 4IUUA 2V1QA 3CCUQ 4WTOB 2BIVA 2YRVA 2QGGA 1Q7YC 2V8IA 3N5BB 1YWOA 3CMEQ 4XTWA 1OX9A 3TEEA 1AOJA 2EYZA 5AT1B 4J9BA 4IKFA 4GY5A 1NLOC 4J83A 1NLPC 4BI3A 2PQWA 1WXBA 3CPWA 2F5TX 3ULRB 2A28A 5CR2A 1WHJA 2MCNA 3HRSA 4BI4A 2LT4A 2ZPFB 2K9GA 2K57A 1RACB 2QQBA 2ZAEA 1YFNA 2DVJA 3CCVA 1UGSB 5FU6C 2COYA 4PFPA 4M77F 4RTVA 1NJIC 4RCCA 1VQ9A 2MIOA 3R6NA 1TTHB 2K79A 4OMFB 4M75E 1YJWA 2RF0A 4M78C 3H6ZA 5CAIA 4DOVA 2KXCA 3QIIA 5L8RE 4C5IA 4C92G 2QK0A 3X20B 3M0PA 1JQQA 3QUIA 5CVIA 2JTMA 5FWCA 4KBMB 3TCJA 4ZGEB 3V8KA 2LCCA 1Q95G 5IN1A 4QQ6A 4KT0E 1M3BA 2R57A 2K5LA 2LVMA 3VYGA 4LDYA 4PJJA 2NUZA 1NJIR 2VV5A 1PM3A 1M27C 4OMMA 2K4YA 2RD1A 3M0UA 3VKIA 4NL3A 1YJNA 3CCSA 2OTLT 4OVAA 2F5KA 2W0ZA 2DZCA 2KSSA 2CS7A 2HAXA 1EIFA 3O5ZA 1N8RU 2V26A 2JMCA 2E5KA 2KMTA 3QWYA 3PT9A 1KC8C 1SSHA 1P92A 2A3LA 1JJ2P 1D1BA 1D0YA 1SKUB 1SSFA 4HT8A 3X25B 2PNIA 2ED1A 1M9SA 1FWZA 1MGQA 2EIFA 5GAN3 2CGHA 4KGVB 4M78F 2AHJB 2DNUA 3PE0A 1GCPA 2FG0A 5FLXE 3JCMg 4LUDA 3OYMA 1V1CA 3RMQA 1B7TA 4OB3B 3OA6A 4AG2C 1VQ4Q 3C95A 3CCQT 1ABOA 1RI0A 3HPWA 1YP5A 2OTLA 2AKLA 2LJ3A 3G4SA 2GGRA 3LGLA 1KC8R 2RO0A 4J9CA 4M4ZA 1A0NB 1B34B 4P5NA 1BI0A 2YRCA 2P84A 3EAEA 4DEYA 3L2QA 1QP3A 4OMOA 1OU9A 3SWNB 1Q7YU 1JB0E 1OV3A 2BE9B 2E12A 4JZ4A 2XICA 1VQNT 4LDXA 3NGPA 5LJ3g 1ZBJA 3OSVA 4F17A 4C92A 3LX7A 3DLLA 4NL2A 1ZA2B 2RB6A 3CCQA 2EGEA 3M5AA 3A8OB 5LJ5e 1R0CB 5DLOA 3LGFA 3H8ZA 3CXCA 1TWBA 1QMCA 4RUGA 2LX7A 3OYFA 1PSFA 1BBZA 1LJOA 2J6FA 3BE3A 3TVTA 5KCOA 4PJNA 2R58A 4OF1A 2EWNA 1NEGA 1Q82C 5LL6S 3PIPA 1M1GA 4PJLA 2P4RA 1UUEA 4EMKA 4IIMA 1T0JA 2GBQA 3M4YA 1RADB 1RLPC 1OU8A 3AHUA 2DD4A 3CPWS 4A63B 1AZEA 3BW1A 3QHSA 1YIJA 3OMCA 2DILA 5GAN4 2LRQA 1UHCA 5CKFA 1Y0MA 5D6WA 3VUZA 1R77A 2RHZA 3NMZC 1LPLA 3JCMf 3REAB 1VQ6Q 2KVQG 1RL2A 2EYWA 3RNJA 3JCMb 2AIRB 1Q82R 3QPHA 3CCLA 2CUBA 2PVGB 2DXCA 2J7IA 2XU8A 3A8MB 4M75C 4C92B 3CC4Q 3LLRA 1BIBA 2RMOA 2O31A 3H0FA 2WACA 1GCQC 3E9FA 5LJ5h 5KYWA 4M7DG 2ZPBB 4FYXB 2COZA 3CCRT 2CREA 2PUOB 1KSWA 2D8JA 2DL3A 2VKNA 3VV0A 1KC8U 4IUTA 2ATCB 2KRSA 3QDRB 3MEUA 3VS3A 3LWHA 1VQ7T 2GTJA 4EMKB 2E41A 1JXMA 1IREB 2P0QA 2YXYA 1VQ5Q 4XTYA 5KYUB 1VQLT 3VS4A 4DQ2A 1UJ0A 1H92A 1KQSA 1OI1A 3V8LA 1PKSA 2ROLA 2F2VA 3FDRA 5KYNA 2EQIA 1O9SA 3NTHA 2ZGWA 1SPKA 2HCKA 3MHXA 2MI6A 1GRIA 1WZOA 3V8JA 1E6HA 1PC0A 1WDXA 4J9EA 4M75F 5CIUA 3SB2A 3OQ5A 1YCSB 3SHWA 1LOJA 2EJ9A 1AHJB 1IGQA 1D1AA 3OBYA 2QA4T 4M7AE 1KIKA 4KRTA 5KYWB 1Q81C 2RJDA 5CKEA 4L6V5 1YI2Q 5J26A 2I0NA 4EDUA 2W10A 2E4HA 2P4TA 2RPNA 2LQKA 1VYVA 3EHRA 2DIGA 1K9MR 2DXBA 3H9NA 2YWWA 1U8RA 1K73C 3PIOA 2DBKA 4OGEA 4XAXB 4ZN1A 3I55T 5D7UA 2FZGB 4HCKA 2KEAA 5I11A 4C8QA 2F1LA 1MHNA 2BE7D 1K1ZA 3RR6A 3OYCA 1K0SA 3M9QA 4M7DA 2LJ1A 1NBEB 1E7OA 3A98A 3S3MA 4PNOA 1DJ7B 1I07A 1YJ9T 3JCMQ 4LDUA 3CCMA 1UDLA 1ZX6A 4J9DA 3CXCS 2RQVA 2SRCA 2LCSA 1BI1A 2DYIA 4M77E 5GAN5 5KYYA 1GFDA 2XMFA 1AWJA 4EMHA 2RI5A 3UDCA 4Y28E 3VS5A 2VXEA 1ZHIA 1UGPB 2OAUA 3BFMA 3I56Q 2FB7A 3G6ET 1Y7XA 4WCIA 4HKEA 1ACMB 2E3HA 1T3LA 2YLBA 4E7IA 3CMAT 3M0RA 5GANg 1C6VX 1Y71A 3JCMe 3CBPA 1YJ9A 1Y96B 1VA7A 1X69A 1NG2A 3RMSA 1E6GA 5GAOl 2GQIA 2DETA 2VB6A 1FMWA 1M1KR 1N6AA 2PU9B 4M7DB 1RI9A 1CKAA 2F69A 3QWXX 8ATCB 4BE0A 4FW2A 3M4GA 2JS0A 2RHIA 3JB9H 2HL5C 2JNGA 2L3PA 3OYYA 2CZ7B 2OJ2A 5A0LA 1TU0B 1M3CA 2CUDA 2E6ZA 5LJ3e 1K9AA 2CP7A 3OYEA 1YNZA 4M78E 4QQGA 3OYBA 4J6YA 4YTLA 3BDLA 2K7AA 4PJOE 1W2BA 1AVZC 4LDWA 2O2OA 2HQXA 1M2OA 1Q81U 3MKDA 1OX8A 1NPRA 2CDTA 4ZNXA 3OYHA 1KQSS 3MP6A 5IHNA 2QDLA 5GAMd 5LJ5g 3JCMh 2LQWA 1WIEA 1VQOQ 2DRMA 4CC3A 2J06A 1NPPA 2C06A 1K73U 3L2VA 1YHQQ 1WHHA 3WVEB 4M75D 2NLUA 2YRDA 1VQMQ 3R6OA 1K4US 1WI7A 5GJWB 4JRPA 3JAME 2ROTA 4IUPA 2M16A 2C0TA 1BI3A 4OMPA 1WLPB 2GCXA 1WFWA 4FSXA 5LJ5j 1W2BP 4XTUA 4ELYC 5I2MA 3G71T 2ZPEB 3CD6T 1N9RA 1FYNA 2HQHA 5LJ3h 3UA7A 1K8AR 4J9HA 2DE0X 1TSFA 5FU7B 1WHKA 1LNXA 4QVZA 4CI0C 2FPDA 4DBFA 1I1JA 2ZZDA 2MYSA 2XK0A 4ANJA 2L89A 4MDWA 2KROA 1TXQA 1XJWB 2LCLA 1I0CA 3OW2A 4Z88A 1PKTA 2FEIA 2R5MA 1RAEB 2JTFA 1I4K1 1PSEA 4C0DB 3FJ5A 5D6YA 3CCEQ 2NUPB 1M30A 1F1BB 2RK2A 2CSQA 4JUVA 1VQ8Q 3G71A 3JB9I 2CYZB 3CD6A 4OB2B 4C0FA 5GAN2 4M7AF 2MPXC 2EKOA 4R0KA 1N27A 1WQWA 2M0OA 3CCVT 2KDSA 1VQKQ 1WGSA 2LQ8A 5LJ5f 2V1RA 3JB9F 4IUQA 4QKUA 4C8QC 1KK7A 4XQ3A 1HK9A 1MMAA 3MEVA 2NUTA 2J05A 3U23A 4ZGDB 1VQ9T 2FZCB 1YN8A 2JJ9A 2I2LA 1Z9ZA 1YJWT 1NEBA 2O9SA 2LC4A 3EH1A 3QYHB 1PD0A 3CCJA 3JCMJ 2CP0A 1BIAA 2X51A 4MDXA 1QP2A 4J8OA 1WHGA 4AFQC 4EIKA 4UC4A 2CT3A 3X28B 3INZA 5C0MA 4FM4B 4QW2A 1D3BA 1ZLMA 2EGCA 3OS0A 2K5FA 2QTXA 3P8DA 2HEQA 2VASA 1YJNT 1FX7A 3CCST 4ZTJA 2JXBA 5HY6A 1NM7A 2D8HA 2K2MA 2CP2A 2P0KA 2XG8D 2VC8A 4Z89A 2DTIA 1NE8A 4MZPA 5CCAA 2PVDB 4IURA 4OGCA 4PJOC 1BU1A 3MPUB 2Z0WA 3CPWP 3I35A 4BY6B 4C8QF 1W2BS 2NUTB 4PFOA 5L23A 1MV3A 4F7UG 1PCXA 1B34A 3OYLA 3OY9A 4HCBA 4HCZA 2OX7A 3SWNA 1UB4A 5GMKl 2LNVA 2EYYA 2O01E 2ED0A 3G4ST 4FU6A 4OMQA 2K5IA 4JLGA 4AMCA 1CKBA 4B9XA 3ME9A 3JCMd 1PG5B 1IXDA 5GANe 1D3BB 2D1XA 3VUBA 1SF9A 4BB7A 2AT1B 3H41A 4R55A 5I22A 2C0IA 2FRWA 4J5YA 2H3EB 2QYZA 1G8XA 2IPOB 1Z9QA 4PJOF 3I56A 2LZ6B 3CC2Q 1RAGB 2Y4YA 5GMKe 4KGXB 2CP6A 2GNCA 3OYNA 1C1AA 3CC7Q 3J7AF 3PFSA 2DO3A 3OW2S 1YITQ 1VQPQ 2X9HA 1QQJA 1X6OA 1UGRB 5GMKi 5ECAA 2LDMA 2B86A 1KG1A 2JW4A 1VIEA 2JVVA 1WA7A 1KD1R 1R0BG 3E19A 2A08A 1WPYA 3FRNA 4M7AD 2E65A 1HD3A 5DLQE 1W6XA 3QJYA 1YIJT 5A0DA 1B07A 5GANh 2WSFE 1M8MA 4LDVA 2QDYB 1U1SA 1KHCA 4Y92A 4M7AG 1OYXA 2XDPA 1GXIE 4F7UA 5HK0A 3CCLT 3RKYA 2DD5A 1UEBA 5LJ3j 1VIFA 2HBWA 4LD6A 2Y4XA 2X3XD 1NJIU 2MOXA 2RHYA 5GAN7 3EGDA 1Y07A 3PVQA 4XTXA 1YWPA 4ME7A 3D7SB 5GMKh 1X2QA 4FSSA 2O88A 3VS2A 1D0ZA 3CBMA 3JSCA 4C5EA 1AEYA 2HD0A 5KYUA 2EW3A 3C94A 1VQOA 5GAN8 1X6BA 1BCMA 4C92E 2JN0A 2M0YA 4ESRA 4D8KA 1YHQA 1Y57A 4J7FA 1T0HA 1VQMA 3CXCP 2E3IA 2YHTA 3TU4K 1IO6A 4M77D 3NHNA 4RG8A 1Q86R 2KK4A 3UPUA 3HFNA 2DPPB 4BACA 1X75C 2RA2A 2XKOC 1MNDA 2LP5A 1ARKA 2ECZA 4B9WA 4M77G 4LXCA 1KFZA 3MEAA 3H0HA 3EG0A 4F7UB 2DKGA 5KE3A 4KUIA 4DA4A 1IRXA 2L3RA 2QEXQ 4HT9A 2VUBA 4DEXA 1MMGA 2BZXA 2CH4A 4N4HA 3QXEB 4KGZB 2ABLA 3G1JA 2HZYA 1G5VA 2Y90A 3EGDB 5LJ3f 2BUDA 1HXDA 5GJVB 2OTJQ 3SEMA 4A53A 3NPFA 1M90C 5DY9A 1KQ2A 3KXTA 4JJNK 4JRIA 3PVLA 3A8GB 4PLIA 1WXTA 1UHFA 5IHKA 4E7HA 4PJMA 3CMET 4GLKA 2DEQA 2EPDA 2L2PA 3C4SA 3CCEA 2EQMA 1X01A 3META 2QQ9A 2IIMA 2DRKA 5EC7A 2OAWA 3GF5A 1K9MC 2CZ6B 3M0TA 3E1SA 1S72Q 2DL4A 4LUEA 5GAOq 4Y91A 3HSBA 1WJRA 1M90R 4M78D 4C0ZA 2JM8A 4KUDK 2DAQA 1VQKA 3E2UA 3RBBB 4PJOD 4M78G 2JT4A 3CCUA 3SWNC 1W70A 2SEMA 3CMEA 3JV3A 3CCMT 2OI3A 1KQSP 1IHWA 1ZSGA 1EX4A 4N4GA 1OEBA 2O4XA 4RTWA 4HA8A 2KAFA 1VQ9Q 1XOVA 1AD5A 5FRNA 3GPLA 2DL5A 3HRUA 1YJWQ 1Y96A 4K11A 1Q82U 2BZYA 3ER0A 1NYGA 2XD0A 1RABB 3OB9A 2LTOA 1ZSZA 3JCMX 2KT1A 2FPFA 1IGUA 4IUVA 4M7AB 4J6WA 3VRYA 2P0PA 2QTVA 3MP1A 2ZPGB 2J6OA 3EG1A 2EQKA 2VXFA 3P8HA 1M5Q1 1C0MA 3A8LB 1TUDA 4QVCA 1QLYA 1T3SA 2EFIA 4MMLA 4XU1A 1U1TA 1M1KC 2A37A 2J6KA 3QO3A 3CPFA 2BTTA 1O75A 3DKMA 1AZGB 2AZVA 4DBQA 3WXMB 1WQ7A 2O4XB 4PFZA 4C8QE 4L59A 1VQ4T 1K76A 2YLCA 4C92C 1OPLA 4M7DE 2QQSA 4B6MA 1X2KA 1UJYA 4XU3A 2KBTA 2A36A 4M77B 1BCOA 1ZSZB 5CO7A 4A54A 5A2QE 2V8KA 2EJFA 3GOXA 2OTLQ 3QJ6A 4FCYA 2LQNA 4BE1A 2M02A 3EGUA 2L3SA 2MF2A 3HL8A 3DB3A 5GANj 2KYBA 1MUZA 1ZUYA 4EMKC 1M2VA 3LWIA 2DZ9A 1V29B 2RH2A 2L0AA 4LD9K 3NTIA 1FMVA 1MNEA 2E1HA 1VQ4A 3QZ5B 3CC2A 3M59A 3OBWA 1K0XA 3QDFA 4RTXA 1K9MU 2VWFA 2EAYA 1H3HA 5LJ5d 2RQTA 3CC7A 6AT1B 4OB1B 2DFUA 3VYHB 5GMKj 2DK3A 3M53A 3CCQQ 3A8HB 1VQPA 1W4SA 4C92F 3TSZA 1SG5A 3MO8A 2BZ8A 4JPBW 2K3XA 2HMAA 4OMNA 2VGNA 3L2UA 5FU6B 3MCAB 8AT1B 2DMOA 2NUPA 3HP9A 2CZ0B 1K8AC 1W1FA 3JCMV 3PMIA 1JO8A 3GNGA 2X3WD 2EYXA 4XU2A 2RQUA 4M78B 3EG3A 1VQNQ 5IAYA 2DERA 2QI2A 3QKJA 4M75G 2NYSA 3BY7A 5GANf 1M2VB 1UG1A 5J3BA 2JTEA 5GAOm 1H8KA 4V2SA 2RJEA 5I21A 4FYYB 2FYKA 4Z02A 3FC3A 2X4YA 3OYAA 3L42A 5GAMg 3J80E 4JLIA 3L2WA 2LMJA 4IIOA 2CZ1B 2QG9B 3L2RA 2RQWA 1G83A 3HFOA 4XK8E 1QVGA 1M1KU 4II1A 4HXJA 1QVFA 2G6FX 1VQ6A 3UA6A 1UGVA 3Q1JA 4JDSA 4ZGJB 3FIFA 2DVEA 1LVKA 3OYGA 2FRYA 4MZMA 3DB4A 1VQ5T 2R5AA 4VUBA 3PNWC 4QT7A 4DOWA 3CCJT 2DBMA 3M0SA 4X9DA 1QWFA 3CC4A 5GAN6 1I5LA 3X26B 2YUNA 4AFSC 4PK4A 3GP8A 2KE9A 2X35A 2CSIA 2L5QA 1QKWA 1RAAB 3S3NA 2QEXA 1QCFA 2ZPIB 3BDUA 1SHFA 4HVWA 1IHVA 1BB9A 2FL7A 4XTZA 3OW2P 3CCRQ 1QVFP 1FMKA 1X27A 1ZBXA 1OOTA 5HCKA 3RDVA 4N0AA 4M7DC 1TOVA 3O8VA 1EZZB 1VQ5A 3SDZA 1YI2T 1VQ7Q 4LNPA 1GL5A 5KE2A 1MV0B 4XTVA 3LH5A 1D09B 4M75A 3JCMc 1U5SA 1VYUA 3ZEHA 4A4GA 1TG0A 3I9QA 1VQLQ 1BYMA 2YUPA 3P8BB 4C0GA 1GCQA 1S72A 2O9VA 1NZ9A 5A0GA 5GAMf 3MJXA 3VU3C 1BI2A 3C12A 1OZ2A 1D0XA 1JEGA 1M1FA 1PHTA 2DXUA 5GAOr 2K3YA 1QKXA 2JOYA 2RNAA 2RJCA 1EFNA 1K8AU 1TUCA 1YI2A 3EG2A 4KULA 1QWEA 3TQ7P 5CQYA 1PD1A 2EYQA 2QA4Q 2FPEA 1Q7YR 3IQLA 2GF7A 4CRIA 2CH4W 3LH0A 2LX9A 4Z8AA 2H3JA 1RAHB 4C92D 5AYFA 4M7DF 3CCMQ 3SFMA 1X43A 3GBQA 4JJCA 2XHCA 4XU0A 1KQ1A 3I56T 1YBYA 1JJ2A 2ESWA 5HKCA 1RAFB 2DL7A 2V8JA 2EKHA 2D9TA 4ATOA 3I55Q 1WHMA 4M75B 4NOYA 1BKBA 4EPCA 1TUGB 5KCHA 3ZFJA 2K6DA 5IH2A 5D6XA 1GFCA 3T9NA 4A4HA 2HQEA 3F70A 2DL8A 1N9SA 2L8DA 5FU7C 4FT2A 3UWNA 5GAOp 3EHQA 3EGXA 4FIBA 3GLXA 3OS2A 1JXOA 2HL3A 3OYJA 1YJ9Q 1R8OB 2JZ2A 3EFOA 3QYGB 1GBRA 4GBQA 1AT1B 2CT4A 3M58A 3HKSA 1KD1C 2KI7A 2RK1A 4CC7A 4C0DC 1PRMC 1RLQC 2JUFA 2G3RA 1UECA 4J9IA 1QVGS 4JJDA 4J7IA 2GQVA 2HSEB 3OMGA 4D6WA 1QCNA 2EQUA 2MWOA 5CQXA 3G6EQ 5FROA 5LJ3d 3A1PA 2F2WA 3JCMP 3I5RA 1XNIA 5CKDA 1QVFS 2DLPA 2AZSA 3CMAQ 2GTOA 3NTKA 9ATCB 3MP8A 2QAZA 3C0CA 3I5SA 1PWTA 2K2VA 4J6XA 2RM4A 2KYMA 4E7ZA 4JS4A 3DLMA 5J39A 1VQOT 1QW1A 3RESA 2EJGA 1OZ3A 5M9OA 1YHQT 5GMKm 3EGXB 1TH7A 1VQMT 3JB9D 7AT1B 2DTHA
chains in the Genus database with same CATH topology
3ULRB 3JV3A 2ENMA 2HSPA 2OI3A 2A28A 1ZSGA 1OEBA 2CDTA 4ZNXA 2MCNA 1JU5C 4RTWA 2K9GA 5IHNA 1NYFA 1M3AA 2QDLA 1XOVA 3VS0A 1AD5A 2LQWA 2DVJA 1WIEA 2DL5A 1PNJA 2DRMA 4CC3A 4K11A 2J06A 2BZYA 1NYGA 4RTVA 1SHGA 2MIOA 3R6NA 2KT1A 1K4US 2FPFA 1WI7A 4D8DA 5GJWB 2ROTA 2C0TA 2HDAA 2K79A 4OMPA 2RF0A 1WLPB 2YUOA 2FO0A 2KXCA 1B3QA 3VRYA 1WFWA 2DJQA 2J6OA 4RTZA 3VS6A 3CQTA 3M0PA 3EG1A 2F2XA 1JQQA 5FWCA 5IXBA 1AWXA 1M3BA 1HJDA 1FYNA 1TUDA 3VS1A 3UA7A 1QLYA 1T3SA 4HVVA 4J9HA 2DE0X 2NUZA 2A37A 1M27C 2J6KA 4OMMA 1SEMA 2FPDA 3M0UA 1X6GA 1I1JA 2BTTA 1AZGB 1GBQA 2AZVA 2KROA 2W0ZA 1SRMA 1I0CA 3O5ZA 4Z88A 1PKTA 2FEIA 1K76A 1OPLA 2JMCA 2E5KA 4F16A 3QWYA 1SSHA 3FJ5A 4GLMA 1U3OA 1X2KA 1M30A 1PRLC 1UJYA 2CSQA 2KNBB 2KBTA 2A36A 2PNIA 2ED1A 2RQRA 2M51A 4ORZA 1LCKA 5IXFA 1RUWA 2DNUA 2AK5A 3PE0A 2LQNA 1GCPA 2FG0A 3EGUA 2KRNA 2L3SA 4LUDA 1V1CA 4R0KA 4AG2C 1UTIA 2KYBA 1MUZA 1ABOA 2C0OA 1ZUYA 1YP5A 3KFVA 3ZL7C 2V1RA 2AKLA 2LJ3A 2GGRA 2L0AA 1VYTA 4J9CA 4M4ZA 3U23A 2J05A 1K0XA 1A0NB 4RTXA 1YN8A 4DEYA 2VWFA 1Z9ZA 1NEBA 1H3HA 3UATA 2O9SA 2DM1A 4OMOA 2RQTA 1UFFA 1OV3A 2YUQA 4LN2A 4JZ4A 4RTTA 1KJWA 3NGPA 1ZBJA 3TSZA 4AFQC 4F17A 2RN8A 2BZ8A 4EIKA 2CT3A 4JPBW 2EGEA 4OMNA 2VVKA 4JZ3A 2DMOA 1ZLMA 2EGCA 2D0NA 4F14A 1W1FA 2HEQA 4RUGA 2LX7A 1JO8A 1BBZA 2JXBA 2J6FA 1NM7A 2D8HA 3TVTA 2X3WD 1G2BA 2EYXA 2K2MA 2EBPA 2RQUA 4RTUA 3EG3A 2YDLA 1NEGA 4Z89A 2DX1A 2P4RA 5FWBA 1UUEA 1BU1A 5IHIA 4IIMA 2K3BA 1T0JA 2AKKA 2GBQA 1UG1A 3I35A 2JTEA 2LNHB 1H8KA 1RLPC 3THKA 2KRMA 1U06A 5L23A 1MV3A 1WYXA 4A63B 2LJ0A 1AZEA 2L3QA 2DILA 1UHCA 1Y0MA 2LMJA 4IIOA 4LE9A 4J9FA 3NMZC 2RQWA 3REAB 1G83A 2EYWA 3RNJA 2EYYA 2EVRA 2ED0A 1ZUUA 2CUBA 2J7IA 4HXJA 2G6FX 4OMQA 3UA6A 1UGVA 1CKBA 2RMOA 2O31A 3H0FA 1GCQC 2FRYA 2PZ1A 4QT7A 2D1XA 2DBMA 3M0SA 1QWFA 2CREA 1KSWA 2D8JA 2DL3A 2VKNA 3H41A 2YUNA 4AFSC 2KRSA 5I22A 2C0IA 2FRWA 3VS3A 2KE9A 1BK2A 2CSIA 1Z9QA 1QKWA 1SRLA 4J9GA 2LZ6B 2GTJA 1QCFA 1J3TA 1SHFA 4HVWA 1BB9A 1JXMA 2GNCA 2DYBA 2KT8A 3VS4A 1FMKA 1UJ0A 1H92A 1X27A 1OOTA 1PKSA 5HCKA 2ROLA 2JMAA 2F2VA 2EQIA 4LNPA 1SPKA 1GL5A 2HCKA 5ECAA 3UF4A 1GRIA 2B86A 1S1NA 2JW4A 1E6HA 1MV0B 2DA9A 1WA7A 3LH5A 1WDXA 4J9EA 2JS2A 1YCSB 2A08A 3SHWA 1U5SA 1VYUA 1TG0A 3I9QA 1HD3A 1W6XA 2YUPA 4CC2A 1GCQA 1B07A 1M8MA 2O9VA 1KIKA 4KRTA 4Y92A 3VS7A 2JM9A 1JEGA 2I0NA 1PHTA 2W10A 2RPNA 1QKXA 1VYVA 2RNAA 3EHRA 1AWOA 1EFNA 2HBWA 1TUCA 2X3XD 2MOXA 4X1VA 2SEMA 4RTYA 3PVQA 3EG2A 1YWPA 5FW9A 2DBKA 1QWEA 2FPEA 3IQLA 1X2QA 2CH4W 4FSSA 2O88A 3VS2A 4HCKA 2KEAA 5I11A 4Z8AA 1AEYA 1K1ZA 2EW3A 1OPKA 1K0SA 2LJ1A 1X43A 3GBQA 4JJCA 1X6BA 1E7OA 4E6RA 3A98A 2M0YA 4ESRA 4D8KA 1Y57A 1UE9A 1ZUKA 1T0HA 2EGAA 1I07A 1IO6A 2ESWA 2DL7A 2EKHA 1UDLA 1ZX6A 4J9DA 3NHNA 2RQVA 1WXUA 2SRCA 2LCSA 2H8HA 4AG1C 1GFDA 2NWMA 2LP5A 1ARKA 2XMFA 1AWJA 2ECZA 2K6DA 5IH2A 1GFCA 1KFZA 3REBB 2DL8A 3VS5A 2PTKA 3TSWA 3H0HA 3EG0A 3EHQA 2KR3A 4HVUA 3VRZA 1JXOA 4DEXA 4AFZC 2BZXA 4WCIA 2CH4A 1T3LA 2KGTA 3M0QA 1GBRA 2ABLA 4GBQA 3M0RA 1N5ZA 1WX6A 2CT4A 2YT6A 5GJVB 4CC7A 3SEMA 1PRMC 1RLQC 3NPFA 1HSQA 1VA7A 3PVLA 1X69A 1AWWA 1UECA 2YSQA 2KXDA 1WXTA 1NG2A 4J9IA 1UHFA 5IHKA 1E6GA 2GQIA 4JJDA 2EPDA 2L2PA 1RI9A 4CC4B 2F2WA 1CKAA 3I5RA 3QWXX 2DF6A 2DLPA 2AZSA 4AFUC 2GTOA 2IIMA 2DRKA 1ABQA 1CSKA 2JS0A 5EC7A 2OAWA 2L3PA 3C0CA 3M0TA 3I5SA 1PWTA 2OJ2A 4JJBA 2DL4A 4LUEA 3H0IA 2KYMA 4OMLA 2V1QA 1M3CA 2JM8A 2CUDA 1YWOA 1K9AA 3RBBB 1YNZA 1AOJA 2EYZA 4J9BA 2K7AA 2JT4A 1NLOC 1W70A 1NLPC 1AVZC 1WXBA 2O2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULR B;  3JV3 A;  2ENM A;  2HSP A;  2OI3 A;  2A28 A;  1ZSG A;  1OEB A;  2CDT A;  4ZNX A;  2MCN A;  1JU5 C;  4RTW A;  2K9G A;  5IHN A;  1NYF A;  1M3A A;  2QDL A;  1XOV A;  3VS0 A;  1AD5 A;  2LQW A;  2DVJ A;  1WIE A;  2DL5 A;  1PNJ A;  2DRM A;  4CC3 A;  4K11 A;  2J06 A;  2BZY A;  1NYG A;  4RTV A;  1SHG A;  2MIO A;  3R6N A;  2KT1 A;  1K4U S;  2FPF A;  1WI7 A;  4D8D A;  5GJW B;  2ROT A;  2C0T A;  2HDA A;  2K79 A;  4OMP A;  2RF0 A;  1WLP B;  2YUO A;  2FO0 A;  2KXC A;  1B3Q A;  3VRY A;  1WFW A;  2DJQ A;  2J6O A;  4RTZ A;  3VS6 A;  3CQT A;  3M0P A;  3EG1 A;  2F2X A;  1JQQ A;  5FWC A;  5IXB A;  1AWX A;  1M3B A;  1HJD A;  1FYN A;  1TUD A;  3VS1 A;  3UA7 A;  1QLY A;  1T3S A;  4HVV A;  4J9H A;  2DE0 X;  2NUZ A;  2A37 A;  1M27 C;  2J6K A;  4OMM A;  1SEM A;  2FPD A;  3M0U A;  1X6G A;  1I1J A;  2BTT A;  1AZG B;  1GBQ A;  2AZV A;  2KRO A;  2W0Z A;  1SRM A;  1I0C A;  3O5Z A;  4Z88 A;  1PKT A;  2FEI A;  1K76 A;  1OPL A;  2JMC A;  2E5K A;  4F16 A;  3QWY A;  1SSH A;  3FJ5 A;  4GLM A;  1U3O A;  1X2K A;  1M30 A;  1PRL C;  1UJY A;  2CSQ A;  2KNB B;  2KBT A;  2A36 A;  2PNI A;  2ED1 A;  2RQR A;  2M51 A;  4ORZ A;  1LCK A;  5IXF A;  1RUW A;  2DNU A;  2AK5 A;  3PE0 A;  2LQN A;  1GCP A;  2FG0 A;  3EGU A;  2KRN A;  2L3S A;  4LUD A;  1V1C A;  4R0K A;  4AG2 C;  1UTI A;  2KYB A;  1MUZ A;  1ABO A;  2C0O A;  1ZUY A;  1YP5 A;  3KFV A;  3ZL7 C;  2V1R A;  2AKL A;  2LJ3 A;  2GGR A;  2L0A A;  1VYT A;  4J9C A;  4M4Z A;  3U23 A;  2J05 A;  1K0X A;  1A0N B;  4RTX A;  1YN8 A;  4DEY A;  2VWF A;  1Z9Z A;  1NEB A;  1H3H A;  3UAT A;  2O9S A;  2DM1 A;  4OMO A;  2RQT A;  1UFF A;  1OV3 A;  2YUQ A;  4LN2 A;  4JZ4 A;  4RTT A;  1KJW A;  3NGP A;  1ZBJ A;  3TSZ A;  4AFQ C;  4F17 A;  2RN8 A;  2BZ8 A;  4EIK A;  2CT3 A;  4JPB W;  2EGE A;  4OMN A;  2VVK A;  4JZ3 A;  2DMO A;  1ZLM A;  2EGC A;  2D0N A;  4F14 A;  1W1F A;  2HEQ A;  4RUG A;  2LX7 A;  1JO8 A;  1BBZ A;  2JXB A;  2J6F A;  1NM7 A;  2D8H A;  3TVT A;  2X3W D;  1G2B A;  2EYX A;  2K2M A;  2EBP A;  2RQU A;  4RTU A;  3EG3 A;  2YDL A;  1NEG A;  4Z89 A;  2DX1 A;  2P4R A;  5FWB A;  1UUE A;  1BU1 A;  5IHI A;  4IIM A;  2K3B A;  1T0J A;  2AKK A;  2GBQ A;  1UG1 A;  3I35 A;  2JTE A;  2LNH B;  1H8K A;  1RLP C;  3THK A;  2KRM A;  1U06 A;  5L23 A;  1MV3 A;  1WYX A;  4A63 B;  2LJ0 A;  1AZE A;  2L3Q A;  2DIL A;  1UHC A;  1Y0M A;  2LMJ A;  4IIO A;  4LE9 A;  4J9F A;  3NMZ C;  2RQW A;  3REA B;  1G83 A;  2EYW A;  3RNJ A;  2EYY A;  2EVR A;  2ED0 A;  1ZUU A;  2CUB A;  2J7I A;  4HXJ A;  2G6F X;  4OMQ A;  3UA6 A;  1UGV A;  1CKB A;  2RMO A;  2O31 A;  3H0F A;  1GCQ C;  2FRY A;  2PZ1 A;  4QT7 A;  2D1X A;  2DBM A;  3M0S A;  1QWF A;  2CRE A;  1KSW A;  2D8J A;  2DL3 A;  2VKN A;  3H41 A;  2YUN A;  4AFS C;  2KRS A;  5I22 A;  2C0I A;  2FRW A;  3VS3 A;  2KE9 A;  1BK2 A;  2CSI A;  1Z9Q A;  1QKW A;  1SRL A;  4J9G A;  2LZ6 B;  2GTJ A;  1QCF A;  1J3T A;  1SHF A;  4HVW A;  1BB9 A;  1JXM A;  2GNC A;  2DYB A;  2KT8 A;  3VS4 A;  1FMK A;  1UJ0 A;  1H92 A;  1X27 A;  1OOT A;  1PKS A;  5HCK A;  2ROL A;  2JMA A;  2F2V A;  2EQI A;  4LNP A;  1SPK A;  1GL5 A;  2HCK A;  5ECA A;  3UF4 A;  1GRI A;  2B86 A;  1S1N A;  2JW4 A;  1E6H A;  1MV0 B;  2DA9 A;  1WA7 A;  3LH5 A;  1WDX A;  4J9E A;  2JS2 A;  1YCS B;  2A08 A;  3SHW A;  1U5S A;  1VYU A;  1TG0 A;  3I9Q A;  1HD3 A;  1W6X A;  2YUP A;  4CC2 A;  1GCQ A;  1B07 A;  1M8M A;  2O9V A;  1KIK A;  4KRT A;  4Y92 A;  3VS7 A;  2JM9 A;  1JEG A;  2I0N A;  1PHT A;  2W10 A;  2RPN A;  1QKX A;  1VYV A;  2RNA A;  3EHR A;  1AWO A;  1EFN A;  2HBW A;  1TUC A;  2X3X D;  2MOX A;  4X1V A;  2SEM A;  4RTY A;  3PVQ A;  3EG2 A;  1YWP A;  5FW9 A;  2DBK A;  1QWE A;  2FPE A;  3IQL A;  1X2Q A;  2CH4 W;  4FSS A;  2O88 A;  3VS2 A;  4HCK A;  2KEA A;  5I11 A;  4Z8A A;  1AEY A;  1K1Z A;  2EW3 A;  1OPK A;  1K0S A;  2LJ1 A;  1X43 A;  3GBQ A;  4JJC A;  1X6B A;  1E7O A;  4E6R A;  3A98 A;  2M0Y A;  4ESR A;  4D8K A;  1Y57 A;  1UE9 A;  1ZUK A;  1T0H A;  2EGA A;  1I07 A;  1IO6 A;  2ESW A;  2DL7 A;  2EKH A;  1UDL A;  1ZX6 A;  4J9D A;  3NHN A;  2RQV A;  1WXU A;  2SRC A;  2LCS A;  2H8H A;  4AG1 C;  1GFD A;  2NWM A;  2LP5 A;  1ARK A;  2XMF A;  1AWJ A;  2ECZ A;  2K6D A;  5IH2 A;  1GFC A;  1KFZ A;  3REB B;  2DL8 A;  3VS5 A;  2PTK A;  3TSW A;  3H0H A;  3EG0 A;  3EHQ A;  2KR3 A;  4HVU A;  3VRZ A;  1JXO A;  4DEX A;  4AFZ C;  2BZX A;  4WCI A;  2CH4 A;  1T3L A;  2KGT A;  3M0Q A;  1GBR A;  2ABL A;  4GBQ A;  3M0R A;  1N5Z A;  1WX6 A;  2CT4 A;  2YT6 A;  5GJV B;  4CC7 A;  3SEM A;  1PRM C;  1RLQ C;  3NPF A;  1HSQ A;  1VA7 A;  3PVL A;  1X69 A;  1AWW A;  1UEC A;  2YSQ A;  2KXD A;  1WXT A;  1NG2 A;  4J9I A;  1UHF A;  5IHK A;  1E6G A;  2GQI A;  4JJD A;  2EPD A;  2L2P A;  1RI9 A;  4CC4 B;  2F2W A;  1CKA A;  3I5R A;  3QWX X;  2DF6 A;  2DLP A;  2AZS A;  4AFU C;  2GTO A;  2IIM A;  2DRK A;  1ABQ A;  1CSK A;  2JS0 A;  5EC7 A;  2OAW A;  2L3P A;  3C0C A;  3M0T A;  3I5S A;  1PWT A;  2OJ2 A;  4JJB A;  2DL4 A;  4LUE A;  3H0I A;  2KYM A;  4OML A;  2V1Q A;  1M3C A;  2JM8 A;  2CUD A;  1YWO A;  1K9A A;  3RBB B;  1YNZ A;  1AOJ A;  2EYZ A;  4J9B A;  2K7A A;  2JT4 A;  1NLO C;  1W70 A;  1NLP C;  1AVZ C;  1WXB A;  2O2O A; 
#chains in the Genus database with same CATH topology
 5CKB A;  4WF2 A;  2ENM A;  3RKW A;  2HSP A;  3EFO B;  2XID A;  4A4E A;  5KYX A;  1JU5 C;  3JB9 G;  3UT1 A;  4KH0 B;  5EG2 A;  1NYF A;  1M3A A;  4A4K A;  4E7K A;  1Q86 C;  3VS0 A;  1ZQ1 A;  3MEW A;  4O6J A;  1PNJ A;  2RI3 A;  3EFS A;  2FVU A;  3FEO A;  1SHG A;  2MAM A;  4D8D A;  4DBR A;  3JB9 J;  2GFA A;  2HDA A;  2CKK A;  1VUB A;  3FB9 A;  2YUO A;  2FO0 A;  5GAM e;  1B3Q A;  3S6W A;  4E7J A;  2DJQ A;  4RTZ A;  2A7Y A;  3VS6 A;  3CQT A;  2F2X A;  2QXF A;  1VQN A;  5IXB A;  4BY6 C;  1AWX A;  4F7U E;  1HJD A;  4KH1 B;  3VS1 A;  3CCE T;  2IG0 A;  4HVV A;  4N0A C;  2KY9 A;  4FYW B;  1VQ8 T;  4DBH A;  3LYI A;  2ZPH B;  1SEM A;  1X6G A;  1XQH A;  2E6N A;  4C8Q D;  1GBQ A;  1HYO A;  3QZ9 B;  5KYX B;  1SRM A;  4E2F B;  1WJQ A;  4M7D D;  3G71 Q;  4RG2 A;  3CD6 Q;  3PMT A;  4C8Q G;  4F16 A;  2DJZ A;  1VQK T;  2MMP A;  4GLM A;  1U3O A;  1I81 A;  5I2S A;  2PUK B;  3EG9 A;  1PRL C;  2KNB B;  1JJ2 S;  3CCU T;  1KD1 U;  1G3T A;  5C6S A;  2RQR A;  2M51 A;  4ORZ A;  1KHI A;  1LCK A;  5IXF A;  1RUW A;  2AK5 A;  3OSS C;  4M7A A;  3ZBD A;  4EMG A;  2KRN A;  3RIR A;  3QBY A;  5GAM h;  1VQ8 A;  3OYI A;  4ELZ C;  5IT9 E;  4BUG A;  1UTI A;  2C0O A;  3M56 A;  3KFV A;  3QG1 A;  4E7S A;  3ZL7 C;  5DM7 R;  4JS5 A;  2CP5 A;  3CCJ Q;  3G7Z A;  1VYT A;  3JRZ A;  1G3Y A;  1M4Z A;  1UGQ B;  3UAT A;  2DM1 A;  3GIB A;  4PL6 A;  1MMD A;  3CCR A;  1UFF A;  2YUQ A;  4LN2 A;  2RHU A;  4QQD A;  4RTT A;  5HK3 A;  4PJO G;  3CCV Q;  1KJW A;  4E47 A;  2HNI A;  3URG A;  2D0Q B;  4Q5W A;  1TS9 A;  1VQ7 A;  2RN8 A;  2DTO A;  5GAO n;  2VVK A;  4JZ3 A;  3TRE A;  4F04 B;  3KBG A;  3EG9 B;  4R56 A;  2D0N A;  2BKD N;  4F14 A;  4RCB A;  1VQL A;  1Q86 U;  3L2Z A;  4M77 A;  1G2B A;  4RTU A;  1G3S A;  2EBP A;  3KUF A;  1V76 A;  2YDL A;  1IZ6 A;  2DX1 A;  3GNF B;  4N4I A;  5FWB A;  2GFU A;  5IHI A;  2K3B A;  2AKK A;  2E5Q A;  2RHX A;  3PGG A;  2HKN A;  3OS1 A;  3V7C A;  2MK5 A;  2LNH B;  3THK A;  2IVW A;  2RI2 A;  2KRM A;  4BD3 A;  1U06 A;  2E64 A;  1Q81 R;  2HKQ B;  1WYX A;  3WVD B;  1YJN Q;  3CCS Q;  2LJ0 A;  2L3Q A;  3M57 A;  2QAS A;  2QA4 A;  5CK9 A;  4LE9 A;  5GAN d;  4J9F A;  1VOM A;  4JRQ A;  1RAI B;  1K73 R;  2EVR A;  1ZUU A;  4ZN3 A;  2FZK B;  2M1H A;  3LW5 E;  3M55 A;  5FRM A;  3CC2 T;  4BDY A;  3CBO A;  1FXX A;  3HRT A;  2HBP A;  3V7R A;  2PZ1 A;  3I55 A;  1JBM A;  3CC7 T;  2DXT A;  2EQJ A;  4TVR A;  2QQR A;  3X24 B;  1OUL A;  5CKH A;  1M90 U;  1I5O B;  1YIT T;  1BK2 A;  1VQP T;  3RUX A;  4M78 A;  3HTR A;  3G4S Q;  2E10 A;  3HHT B;  3PTA A;  1OQK A;  3NFC A;  1SRL A;  4RKU E;  4J9G A;  4PJO A;  1J3T A;  2PVO B;  3OYK A;  4C8Q B;  2DYB A;  2KT8 A;  3EFR A;  3CEY A;  3OS5 A;  2QGF B;  3M54 A;  4BI8 B;  4L5G A;  2JMA A;  4FL6 A;  2WSE E;  2LT1 A;  1D1C A;  4X9C A;  3UF4 A;  1S1N A;  3G6E A;  2RJF A;  2DA9 A;  4PKC C;  4MZT A;  2DEU A;  2D6F A;  1YIT A;  4HCC A;  2JS2 A;  1WJS A;  5KYY B;  3CMA A;  4FT4 A;  4CC2 A;  3ASK A;  3VS7 A;  2JM9 A;  4AT1 B;  4F7U F;  2FHD A;  2CP3 A;  4QVD A;  1AWO A;  3JCM W;  4NS5 A;  2MWP A;  4OP0 A;  4X1V A;  1VQ6 T;  4RTY A;  1QVP A;  4PJO B;  2X4J A;  2B8A A;  2COW A;  5FW9 A;  4OB0 B;  5KH6 A;  1YIJ Q;  4RMO A;  1ZA1 B;  3V7S A;  3CC4 T;  1IB8 A;  1H3Z A;  1OPK A;  4C5H A;  3CCL Q;  4M7A C;  3EH2 A;  4E6R A;  1UE9 A;  1ZUK A;  2QEX T;  2EGA A;  2ZCF B;  3E9G A;  3SD4 A;  1WXU A;  3A5Z B;  2X4W A;  2KQW A;  1XTD A;  2H8H A;  4MMK A;  3OYD A;  4AG1 C;  2A0F B;  2NWM A;  2OTJ T;  1JRI A;  2VGM A;  1QCO A;  1G3W A;  4JRK A;  1YCY A;  3J81 E;  2DIQ A;  2M9U A;  5GAM j;  3REB B;  1WNL A;  2PTK A;  3TSW A;  3VJP A;  1N8R C;  2XI9 A;  2KR3 A;  4HVU A;  4X34 A;  4BE2 A;  3VRZ A;  4FW1 A;  2WSC E;  4AFZ C;  4BDZ A;  1M8V A;  3AT1 B;  2KGT A;  3M0Q A;  1MMN A;  2VYT A;  1WHL A;  1H64 1;  3FJP A;  1N5Z A;  1WX6 A;  3FLG A;  2YT6 A;  2XDB A;  2X4X A;  3S3O A;  2XDD A;  4C5G A;  3RKX A;  4O5V A;  1S72 T;  1HSQ A;  4A4F A;  1QVG P;  1AWW A;  2YSQ A;  2KXD A;  4FYV B;  4M77 C;  3RER A;  1I8F A;  1ZSZ C;  2OTJ A;  4CC4 B;  2E70 A;  1N8R R;  2DF6 A;  4AFU C;  3QSU A;  1ABQ A;  1CSK A;  3L1A A;  4ZTF A;  4E7L A;  2QQA A;  4JJB A;  3H0I A;  4PLL A;  4OML A;  4IUU A;  2V1Q A;  3CCU Q;  4WTO B;  2BIV A;  2YRV A;  2QGG A;  1Q7Y C;  2V8I A;  3N5B B;  1YWO A;  3CME Q;  4XTW A;  1OX9 A;  3TEE A;  1AOJ A;  2EYZ A;  5AT1 B;  4J9B A;  4IKF A;  4GY5 A;  1NLO C;  4J83 A;  1NLP C;  4BI3 A;  2PQW A;  1WXB A;  3CPW A;  2F5T X;  3ULR B;  2A28 A;  5CR2 A;  1WHJ A;  2MCN A;  3HRS A;  4BI4 A;  2LT4 A;  2ZPF B;  2K9G A;  2K57 A;  1RAC B;  2QQB A;  2ZAE A;  1YFN A;  2DVJ A;  3CCV A;  1UGS B;  5FU6 C;  2COY A;  4PFP A;  4M77 F;  4RTV A;  1NJI C;  4RCC A;  1VQ9 A;  2MIO A;  3R6N A;  1TTH B;  2K79 A;  4OMF B;  4M75 E;  1YJW A;  2RF0 A;  4M78 C;  3H6Z A;  5CAI A;  4DOV A;  2KXC A;  3QII A;  5L8R E;  4C5I A;  4C92 G;  2QK0 A;  3X20 B;  3M0P A;  1JQQ A;  3QUI A;  5CVI A;  2JTM A;  5FWC A;  4KBM B;  3TCJ A;  4ZGE B;  3V8K A;  2LCC A;  1Q95 G;  5IN1 A;  4QQ6 A;  4KT0 E;  1M3B A;  2R57 A;  2K5L A;  2LVM A;  3VYG A;  4LDY A;  4PJJ A;  2NUZ A;  1NJI R;  2VV5 A;  1PM3 A;  1M27 C;  4OMM A;  2K4Y A;  2RD1 A;  3M0U A;  3VKI A;  4NL3 A;  1YJN A;  3CCS A;  2OTL T;  4OVA A;  2F5K A;  2W0Z A;  2DZC A;  2KSS A;  2CS7 A;  2HAX A;  1EIF A;  3O5Z A;  1N8R U;  2V26 A;  2JMC A;  2E5K A;  2KMT A;  3QWY A;  3PT9 A;  1KC8 C;  1SSH A;  1P92 A;  2A3L A;  1JJ2 P;  1D1B A;  1D0Y A;  1SKU B;  1SSF A;  4HT8 A;  3X25 B;  2PNI A;  2ED1 A;  1M9S A;  1FWZ A;  1MGQ A;  2EIF A;  5GAN 3;  2CGH A;  4KGV B;  4M78 F;  2AHJ B;  2DNU A;  3PE0 A;  1GCP A;  2FG0 A;  5FLX E;  3JCM g;  4LUD A;  3OYM A;  1V1C A;  3RMQ A;  1B7T A;  4OB3 B;  3OA6 A;  4AG2 C;  1VQ4 Q;  3C95 A;  3CCQ T;  1ABO A;  1RI0 A;  3HPW A;  1YP5 A;  2OTL A;  2AKL A;  2LJ3 A;  3G4S A;  2GGR A;  3LGL A;  1KC8 R;  2RO0 A;  4J9C A;  4M4Z A;  1A0N B;  1B34 B;  4P5N A;  1BI0 A;  2YRC A;  2P84 A;  3EAE A;  4DEY A;  3L2Q A;  1QP3 A;  4OMO A;  1OU9 A;  3SWN B;  1Q7Y U;  1JB0 E;  1OV3 A;  2BE9 B;  2E12 A;  4JZ4 A;  2XIC A;  1VQN T;  4LDX A;  3NGP A;  5LJ3 g;  1ZBJ A;  3OSV A;  4F17 A;  4C92 A;  3LX7 A;  3DLL A;  4NL2 A;  1ZA2 B;  2RB6 A;  3CCQ A;  2EGE A;  3M5A A;  3A8O B;  5LJ5 e;  1R0C B;  5DLO A;  3LGF A;  3H8Z A;  3CXC A;  1TWB A;  1QMC A;  4RUG A;  2LX7 A;  3OYF A;  1PSF A;  1BBZ A;  1LJO A;  2J6F A;  3BE3 A;  3TVT A;  5KCO A;  4PJN A;  2R58 A;  4OF1 A;  2EWN A;  1NEG A;  1Q82 C;  5LL6 S;  3PIP A;  1M1G A;  4PJL A;  2P4R A;  1UUE A;  4EMK A;  4IIM A;  1T0J A;  2GBQ A;  3M4Y A;  1RAD B;  1RLP C;  1OU8 A;  3AHU A;  2DD4 A;  3CPW S;  4A63 B;  1AZE A;  3BW1 A;  3QHS A;  1YIJ A;  3OMC A;  2DIL A;  5GAN 4;  2LRQ A;  1UHC A;  5CKF A;  1Y0M A;  5D6W A;  3VUZ A;  1R77 A;  2RHZ A;  3NMZ C;  1LPL A;  3JCM f;  3REA B;  1VQ6 Q;  2KVQ G;  1RL2 A;  2EYW A;  3RNJ A;  3JCM b;  2AIR B;  1Q82 R;  3QPH A;  3CCL A;  2CUB A;  2PVG B;  2DXC A;  2J7I A;  2XU8 A;  3A8M B;  4M75 C;  4C92 B;  3CC4 Q;  3LLR A;  1BIB A;  2RMO A;  2O31 A;  3H0F A;  2WAC A;  1GCQ C;  3E9F A;  5LJ5 h;  5KYW A;  4M7D G;  2ZPB B;  4FYX B;  2COZ A;  3CCR T;  2CRE A;  2PUO B;  1KSW A;  2D8J A;  2DL3 A;  2VKN A;  3VV0 A;  1KC8 U;  4IUT A;  2ATC B;  2KRS A;  3QDR B;  3MEU A;  3VS3 A;  3LWH A;  1VQ7 T;  2GTJ A;  4EMK B;  2E41 A;  1JXM A;  1IRE B;  2P0Q A;  2YXY A;  1VQ5 Q;  4XTY A;  5KYU B;  1VQL T;  3VS4 A;  4DQ2 A;  1UJ0 A;  1H92 A;  1KQS A;  1OI1 A;  3V8L A;  1PKS A;  2ROL A;  2F2V A;  3FDR A;  5KYN A;  2EQI A;  1O9S A;  3NTH A;  2ZGW A;  1SPK A;  2HCK A;  3MHX A;  2MI6 A;  1GRI A;  1WZO A;  3V8J A;  1E6H A;  1PC0 A;  1WDX A;  4J9E A;  4M75 F;  5CIU A;  3SB2 A;  3OQ5 A;  1YCS B;  3SHW A;  1LOJ A;  2EJ9 A;  1AHJ B;  1IGQ A;  1D1A A;  3OBY A;  2QA4 T;  4M7A E;  1KIK A;  4KRT A;  5KYW B;  1Q81 C;  2RJD A;  5CKE A;  4L6V 5;  1YI2 Q;  5J26 A;  2I0N A;  4EDU A;  2W10 A;  2E4H A;  2P4T A;  2RPN A;  2LQK A;  1VYV A;  3EHR A;  2DIG A;  1K9M R;  2DXB A;  3H9N A;  2YWW A;  1U8R A;  1K73 C;  3PIO A;  2DBK A;  4OGE A;  4XAX B;  4ZN1 A;  3I55 T;  5D7U A;  2FZG B;  4HCK A;  2KEA A;  5I11 A;  4C8Q A;  2F1L A;  1MHN A;  2BE7 D;  1K1Z A;  3RR6 A;  3OYC A;  1K0S A;  3M9Q A;  4M7D A;  2LJ1 A;  1NBE B;  1E7O A;  3A98 A;  3S3M A;  4PNO A;  1DJ7 B;  1I07 A;  1YJ9 T;  3JCM Q;  4LDU A;  3CCM A;  1UDL A;  1ZX6 A;  4J9D A;  3CXC S;  2RQV A;  2SRC A;  2LCS A;  1BI1 A;  2DYI A;  4M77 E;  5GAN 5;  5KYY A;  1GFD A;  2XMF A;  1AWJ A;  4EMH A;  2RI5 A;  3UDC A;  4Y28 E;  3VS5 A;  2VXE A;  1ZHI A;  1UGP B;  2OAU A;  3BFM A;  3I56 Q;  2FB7 A;  3G6E T;  1Y7X A;  4WCI A;  4HKE A;  1ACM B;  2E3H A;  1T3L A;  2YLB A;  4E7I A;  3CMA T;  3M0R A;  5GAN g;  1C6V X;  1Y71 A;  3JCM e;  3CBP A;  1YJ9 A;  1Y96 B;  1VA7 A;  1X69 A;  1NG2 A;  3RMS A;  1E6G A;  5GAO l;  2GQI A;  2DET A;  2VB6 A;  1FMW A;  1M1K R;  1N6A A;  2PU9 B;  4M7D B;  1RI9 A;  1CKA A;  2F69 A;  3QWX X;  8ATC B;  4BE0 A;  4FW2 A;  3M4G A;  2JS0 A;  2RHI A;  3JB9 H;  2HL5 C;  2JNG A;  2L3P A;  3OYY A;  2CZ7 B;  2OJ2 A;  5A0L A;  1TU0 B;  1M3C A;  2CUD A;  2E6Z A;  5LJ3 e;  1K9A A;  2CP7 A;  3OYE A;  1YNZ A;  4M78 E;  4QQG A;  3OYB A;  4J6Y A;  4YTL A;  3BDL A;  2K7A A;  4PJO E;  1W2B A;  1AVZ C;  4LDW A;  2O2O A;  2HQX A;  1M2O A;  1Q81 U;  3MKD A;  1OX8 A;  1NPR A;  2CDT A;  4ZNX A;  3OYH A;  1KQS S;  3MP6 A;  5IHN A;  2QDL A;  5GAM d;  5LJ5 g;  3JCM h;  2LQW A;  1WIE A;  1VQO Q;  2DRM A;  4CC3 A;  2J06 A;  1NPP A;  2C06 A;  1K73 U;  3L2V A;  1YHQ Q;  1WHH A;  3WVE B;  4M75 D;  2NLU A;  2YRD A;  1VQM Q;  3R6O A;  1K4U S;  1WI7 A;  5GJW B;  4JRP A;  3JAM E;  2ROT A;  4IUP A;  2M16 A;  2C0T A;  1BI3 A;  4OMP A;  1WLP B;  2GCX A;  1WFW A;  4FSX A;  5LJ5 j;  1W2B P;  4XTU A;  4ELY C;  5I2M A;  3G71 T;  2ZPE B;  3CD6 T;  1N9R A;  1FYN A;  2HQH A;  5LJ3 h;  3UA7 A;  1K8A R;  4J9H A;  2DE0 X;  1TSF A;  5FU7 B;  1WHK A;  1LNX A;  4QVZ A;  4CI0 C;  2FPD A;  4DBF A;  1I1J A;  2ZZD A;  2MYS A;  2XK0 A;  4ANJ A;  2L89 A;  4MDW A;  2KRO A;  1TXQ A;  1XJW B;  2LCL A;  1I0C A;  3OW2 A;  4Z88 A;  1PKT A;  2FEI A;  2R5M A;  1RAE B;  2JTF A;  1I4K 1;  1PSE A;  4C0D B;  3FJ5 A;  5D6Y A;  3CCE Q;  2NUP B;  1M30 A;  1F1B B;  2RK2 A;  2CSQ A;  4JUV A;  1VQ8 Q;  3G71 A;  3JB9 I;  2CYZ B;  3CD6 A;  4OB2 B;  4C0F A;  5GAN 2;  4M7A F;  2MPX C;  2EKO A;  4R0K A;  1N27 A;  1WQW A;  2M0O A;  3CCV T;  2KDS A;  1VQK Q;  1WGS A;  2LQ8 A;  5LJ5 f;  2V1R A;  3JB9 F;  4IUQ A;  4QKU A;  4C8Q C;  1KK7 A;  4XQ3 A;  1HK9 A;  1MMA A;  3MEV A;  2NUT A;  2J05 A;  3U23 A;  4ZGD B;  1VQ9 T;  2FZC B;  1YN8 A;  2JJ9 A;  2I2L A;  1Z9Z A;  1YJW T;  1NEB A;  2O9S A;  2LC4 A;  3EH1 A;  3QYH B;  1PD0 A;  3CCJ A;  3JCM J;  2CP0 A;  1BIA A;  2X51 A;  4MDX A;  1QP2 A;  4J8O A;  1WHG A;  4AFQ C;  4EIK A;  4UC4 A;  2CT3 A;  3X28 B;  3INZ A;  5C0M A;  4FM4 B;  4QW2 A;  1D3B A;  1ZLM A;  2EGC A;  3OS0 A;  2K5F A;  2QTX A;  3P8D A;  2HEQ A;  2VAS A;  1YJN T;  1FX7 A;  3CCS T;  4ZTJ A;  2JXB A;  5HY6 A;  1NM7 A;  2D8H A;  2K2M A;  2CP2 A;  2P0K A;  2XG8 D;  2VC8 A;  4Z89 A;  2DTI A;  1NE8 A;  4MZP A;  5CCA A;  2PVD B;  4IUR A;  4OGC A;  4PJO C;  1BU1 A;  3MPU B;  2Z0W A;  3CPW P;  3I35 A;  4BY6 B;  4C8Q F;  1W2B S;  2NUT B;  4PFO A;  5L23 A;  1MV3 A;  4F7U G;  1PCX A;  1B34 A;  3OYL A;  3OY9 A;  4HCB A;  4HCZ A;  2OX7 A;  3SWN A;  1UB4 A;  5GMK l;  2LNV A;  2EYY A;  2O01 E;  2ED0 A;  3G4S T;  4FU6 A;  4OMQ A;  2K5I A;  4JLG A;  4AMC A;  1CKB A;  4B9X A;  3ME9 A;  3JCM d;  1PG5 B;  1IXD A;  5GAN e;  1D3B B;  2D1X A;  3VUB A;  1SF9 A;  4BB7 A;  2AT1 B;  3H41 A;  4R55 A;  5I22 A;  2C0I A;  2FRW A;  4J5Y A;  2H3E B;  2QYZ A;  1G8X A;  2IPO B;  1Z9Q A;  4PJO F;  3I56 A;  2LZ6 B;  3CC2 Q;  1RAG B;  2Y4Y A;  5GMK e;  4KGX B;  2CP6 A;  2GNC A;  3OYN A;  1C1A A;  3CC7 Q;  3J7A F;  3PFS A;  2DO3 A;  3OW2 S;  1YIT Q;  1VQP Q;  2X9H A;  1QQJ A;  1X6O A;  1UGR B;  5GMK i;  5ECA A;  2LDM A;  2B86 A;  1KG1 A;  2JW4 A;  1VIE A;  2JVV A;  1WA7 A;  1KD1 R;  1R0B G;  3E19 A;  2A08 A;  1WPY A;  3FRN A;  4M7A D;  2E65 A;  1HD3 A;  5DLQ E;  1W6X A;  3QJY A;  1YIJ T;  5A0D A;  1B07 A;  5GAN h;  2WSF E;  1M8M A;  4LDV A;  2QDY B;  1U1S A;  1KHC A;  4Y92 A;  4M7A G;  1OYX A;  2XDP A;  1GXI E;  4F7U A;  5HK0 A;  3CCL T;  3RKY A;  2DD5 A;  1UEB A;  5LJ3 j;  1VIF A;  2HBW A;  4LD6 A;  2Y4X A;  2X3X D;  1NJI U;  2MOX A;  2RHY A;  5GAN 7;  3EGD A;  1Y07 A;  3PVQ A;  4XTX A;  1YWP A;  4ME7 A;  3D7S B;  5GMK h;  1X2Q A;  4FSS A;  2O88 A;  3VS2 A;  1D0Z A;  3CBM A;  3JSC A;  4C5E A;  1AEY A;  2HD0 A;  5KYU A;  2EW3 A;  3C94 A;  1VQO A;  5GAN 8;  1X6B A;  1BCM A;  4C92 E;  2JN0 A;  2M0Y A;  4ESR A;  4D8K A;  1YHQ A;  1Y57 A;  4J7F A;  1T0H A;  1VQM A;  3CXC P;  2E3I A;  2YHT A;  3TU4 K;  1IO6 A;  4M77 D;  3NHN A;  4RG8 A;  1Q86 R;  2KK4 A;  3UPU A;  3HFN A;  2DPP B;  4BAC A;  1X75 C;  2RA2 A;  2XKO C;  1MND A;  2LP5 A;  1ARK A;  2ECZ A;  4B9W A;  4M77 G;  4LXC A;  1KFZ A;  3MEA A;  3H0H A;  3EG0 A;  4F7U B;  2DKG A;  5KE3 A;  4KUI A;  4DA4 A;  1IRX A;  2L3R A;  2QEX Q;  4HT9 A;  2VUB A;  4DEX A;  1MMG A;  2BZX A;  2CH4 A;  4N4H A;  3QXE B;  4KGZ B;  2ABL A;  3G1J A;  2HZY A;  1G5V A;  2Y90 A;  3EGD B;  5LJ3 f;  2BUD A;  1HXD A;  5GJV B;  2OTJ Q;  3SEM A;  4A53 A;  3NPF A;  1M90 C;  5DY9 A;  1KQ2 A;  3KXT A;  4JJN K;  4JRI A;  3PVL A;  3A8G B;  4PLI A;  1WXT A;  1UHF A;  5IHK A;  4E7H A;  4PJM A;  3CME T;  4GLK A;  2DEQ A;  2EPD A;  2L2P A;  3C4S A;  3CCE A;  2EQM A;  1X01 A;  3MET A;  2QQ9 A;  2IIM A;  2DRK A;  5EC7 A;  2OAW A;  3GF5 A;  1K9M C;  2CZ6 B;  3M0T A;  3E1S A;  1S72 Q;  2DL4 A;  4LUE A;  5GAO q;  4Y91 A;  3HSB A;  1WJR A;  1M90 R;  4M78 D;  4C0Z A;  2JM8 A;  4KUD K;  2DAQ A;  1VQK A;  3E2U A;  3RBB B;  4PJO D;  4M78 G;  2JT4 A;  3CCU A;  3SWN C;  1W70 A;  2SEM A;  3CME A;  3JV3 A;  3CCM T;  2OI3 A;  1KQS P;  1IHW A;  1ZSG A;  1EX4 A;  4N4G A;  1OEB A;  2O4X A;  4RTW A;  4HA8 A;  2KAF A;  1VQ9 Q;  1XOV A;  1AD5 A;  5FRN A;  3GPL A;  2DL5 A;  3HRU A;  1YJW Q;  1Y96 A;  4K11 A;  1Q82 U;  2BZY A;  3ER0 A;  1NYG A;  2XD0 A;  1RAB B;  3OB9 A;  2LTO A;  1ZSZ A;  3JCM X;  2KT1 A;  2FPF A;  1IGU A;  4IUV A;  4M7A B;  4J6W A;  3VRY A;  2P0P A;  2QTV A;  3MP1 A;  2ZPG B;  2J6O A;  3EG1 A;  2EQK A;  2VXF A;  3P8H A;  1M5Q 1;  1C0M A;  3A8L B;  1TUD A;  4QVC A;  1QLY A;  1T3S A;  2EFI A;  4MML A;  4XU1 A;  1U1T A;  1M1K C;  2A37 A;  2J6K A;  3QO3 A;  3CPF A;  2BTT A;  1O75 A;  3DKM A;  1AZG B;  2AZV A;  4DBQ A;  3WXM B;  1WQ7 A;  2O4X B;  4PFZ A;  4C8Q E;  4L59 A;  1VQ4 T;  1K76 A;  2YLC A;  4C92 C;  1OPL A;  4M7D E;  2QQS A;  4B6M A;  1X2K A;  1UJY A;  4XU3 A;  2KBT A;  2A36 A;  4M77 B;  1BCO A;  1ZSZ B;  5CO7 A;  4A54 A;  5A2Q E;  2V8K A;  2EJF A;  3GOX A;  2OTL Q;  3QJ6 A;  4FCY A;  2LQN A;  4BE1 A;  2M02 A;  3EGU A;  2L3S A;  2MF2 A;  3HL8 A;  3DB3 A;  5GAN j;  2KYB A;  1MUZ A;  1ZUY A;  4EMK C;  1M2V A;  3LWI A;  2DZ9 A;  1V29 B;  2RH2 A;  2L0A A;  4LD9 K;  3NTI A;  1FMV A;  1MNE A;  2E1H A;  1VQ4 A;  3QZ5 B;  3CC2 A;  3M59 A;  3OBW A;  1K0X A;  3QDF A;  4RTX A;  1K9M U;  2VWF A;  2EAY A;  1H3H A;  5LJ5 d;  2RQT A;  3CC7 A;  6AT1 B;  4OB1 B;  2DFU A;  3VYH B;  5GMK j;  2DK3 A;  3M53 A;  3CCQ Q;  3A8H B;  1VQP A;  1W4S A;  4C92 F;  3TSZ A;  1SG5 A;  3MO8 A;  2BZ8 A;  4JPB W;  2K3X A;  2HMA A;  4OMN A;  2VGN A;  3L2U A;  5FU6 B;  3MCA B;  8AT1 B;  2DMO A;  2NUP A;  3HP9 A;  2CZ0 B;  1K8A C;  1W1F A;  3JCM V;  3PMI A;  1JO8 A;  3GNG A;  2X3W D;  2EYX A;  4XU2 A;  2RQU A;  4M78 B;  3EG3 A;  1VQN Q;  5IAY A;  2DER A;  2QI2 A;  3QKJ A;  4M75 G;  2NYS A;  3BY7 A;  5GAN f;  1M2V B;  1UG1 A;  5J3B A;  2JTE A;  5GAO m;  1H8K A;  4V2S A;  2RJE A;  5I21 A;  4FYY B;  2FYK A;  4Z02 A;  3FC3 A;  2X4Y A;  3OYA A;  3L42 A;  5GAM g;  3J80 E;  4JLI A;  3L2W A;  2LMJ A;  4IIO A;  2CZ1 B;  2QG9 B;  3L2R A;  2RQW A;  1G83 A;  3HFO A;  4XK8 E;  1QVG A;  1M1K U;  4II1 A;  4HXJ A;  1QVF A;  2G6F X;  1VQ6 A;  3UA6 A;  1UGV A;  3Q1J A;  4JDS A;  4ZGJ B;  3FIF A;  2DVE A;  1LVK A;  3OYG A;  2FRY A;  4MZM A;  3DB4 A;  1VQ5 T;  2R5A A;  4VUB A;  3PNW C;  4QT7 A;  4DOW A;  3CCJ T;  2DBM A;  3M0S A;  4X9D A;  1QWF A;  3CC4 A;  5GAN 6;  1I5L A;  3X26 B;  2YUN A;  4AFS C;  4PK4 A;  3GP8 A;  2KE9 A;  2X35 A;  2CSI A;  2L5Q A;  1QKW A;  1RAA B;  3S3N A;  2QEX A;  1QCF A;  2ZPI B;  3BDU A;  1SHF A;  4HVW A;  1IHV A;  1BB9 A;  2FL7 A;  4XTZ A;  3OW2 P;  3CCR Q;  1QVF P;  1FMK A;  1X27 A;  1ZBX A;  1OOT A;  5HCK A;  3RDV A;  4N0A A;  4M7D C;  1TOV A;  3O8V A;  1EZZ B;  1VQ5 A;  3SDZ A;  1YI2 T;  1VQ7 Q;  4LNP A;  1GL5 A;  5KE2 A;  1MV0 B;  4XTV A;  3LH5 A;  1D09 B;  4M75 A;  3JCM c;  1U5S A;  1VYU A;  3ZEH A;  4A4G A;  1TG0 A;  3I9Q A;  1VQL Q;  1BYM A;  2YUP A;  3P8B B;  4C0G A;  1GCQ A;  1S72 A;  2O9V A;  1NZ9 A;  5A0G A;  5GAM f;  3MJX A;  3VU3 C;  1BI2 A;  3C12 A;  1OZ2 A;  1D0X A;  1JEG A;  1M1F A;  1PHT A;  2DXU A;  5GAO r;  2K3Y A;  1QKX A;  2JOY A;  2RNA A;  2RJC A;  1EFN A;  1K8A U;  1TUC A;  1YI2 A;  3EG2 A;  4KUL A;  1QWE A;  3TQ7 P;  5CQY A;  1PD1 A;  2EYQ A;  2QA4 Q;  2FPE A;  1Q7Y R;  3IQL A;  2GF7 A;  4CRI A;  2CH4 W;  3LH0 A;  2LX9 A;  4Z8A A;  2H3J A;  1RAH B;  4C92 D;  5AYF A;  4M7D F;  3CCM Q;  3SFM A;  1X43 A;  3GBQ A;  4JJC A;  2XHC A;  4XU0 A;  1KQ1 A;  3I56 T;  1YBY A;  1JJ2 A;  2ESW A;  5HKC A;  1RAF B;  2DL7 A;  2V8J A;  2EKH A;  2D9T A;  4ATO A;  3I55 Q;  1WHM A;  4M75 B;  4NOY A;  1BKB A;  4EPC A;  1TUG B;  5KCH A;  3ZFJ A;  2K6D A;  5IH2 A;  5D6X A;  1GFC A;  3T9N A;  4A4H A;  2HQE A;  3F70 A;  2DL8 A;  1N9S A;  2L8D A;  5FU7 C;  4FT2 A;  3UWN A;  5GAO p;  3EHQ A;  3EGX A;  4FIB A;  3GLX A;  3OS2 A;  1JXO A;  2HL3 A;  3OYJ A;  1YJ9 Q;  1R8O B;  2JZ2 A;  3EFO A;  3QYG B;  1GBR A;  4GBQ A;  1AT1 B;  2CT4 A;  3M58 A;  3HKS A;  1KD1 C;  2KI7 A;  2RK1 A;  4CC7 A;  4C0D C;  1PRM C;  1RLQ C;  2JUF A;  2G3R A;  1UEC A;  4J9I A;  1QVG S;  4JJD A;  4J7I A;  2GQV A;  2HSE B;  3OMG A;  4D6W A;  1QCN A;  2EQU A;  2MWO A;  5CQX A;  3G6E Q;  5FRO A;  5LJ3 d;  3A1P A;  2F2W A;  3JCM P;  3I5R A;  1XNI A;  5CKD A;  1QVF S;  2DLP A;  2AZS A;  3CMA Q;  2GTO A;  3NTK A;  9ATC B;  3MP8 A;  2QAZ A;  3C0C A;  3I5S A;  1PWT A;  2K2V A;  4J6X A;  2RM4 A;  2KYM A;  4E7Z A;  4JS4 A;  3DLM A;  5J39 A;  1VQO T;  1QW1 A;  3RES A;  2EJG A;  1OZ3 A;  5M9O A;  1YHQ T;  5GMK m;  3EGX B;  1TH7 A;  1VQM T;  3JB9 D;  7AT1 B;  2DTH A; 
#chains in the Genus database with same CATH homology
 3ULR B;  3JV3 A;  2ENM A;  2HSP A;  2OI3 A;  2A28 A;  1ZSG A;  1OEB A;  2CDT A;  4ZNX A;  2MCN A;  1JU5 C;  4RTW A;  2K9G A;  5IHN A;  1NYF A;  1M3A A;  2QDL A;  1XOV A;  3VS0 A;  1AD5 A;  2LQW A;  2DVJ A;  1WIE A;  2DL5 A;  1PNJ A;  2DRM A;  4CC3 A;  4K11 A;  2J06 A;  2BZY A;  1NYG A;  4RTV A;  1SHG A;  2MIO A;  3R6N A;  2KT1 A;  1K4U S;  2FPF A;  1WI7 A;  4D8D A;  5GJW B;  2ROT A;  2C0T A;  2HDA A;  2K79 A;  4OMP A;  2RF0 A;  1WLP B;  2YUO A;  2FO0 A;  2KXC A;  1B3Q A;  3VRY A;  1WFW A;  2DJQ A;  2J6O A;  4RTZ A;  3VS6 A;  3CQT A;  3M0P A;  3EG1 A;  2F2X A;  1JQQ A;  5FWC A;  5IXB A;  1AWX A;  1M3B A;  1HJD A;  1FYN A;  1TUD A;  3VS1 A;  3UA7 A;  1QLY A;  1T3S A;  4HVV A;  4J9H A;  2DE0 X;  2NUZ A;  2A37 A;  1M27 C;  2J6K A;  4OMM A;  1SEM A;  2FPD A;  3M0U A;  1X6G A;  1I1J A;  2BTT A;  1AZG B;  1GBQ A;  2AZV A;  2KRO A;  2W0Z A;  1SRM A;  1I0C A;  3O5Z A;  4Z88 A;  1PKT A;  2FEI A;  1K76 A;  1OPL A;  2JMC A;  2E5K A;  4F16 A;  3QWY A;  1SSH A;  3FJ5 A;  4GLM A;  1U3O A;  1X2K A;  1M30 A;  1PRL C;  1UJY A;  2CSQ A;  2KNB B;  2KBT A;  2A36 A;  2PNI A;  2ED1 A;  2RQR A;  2M51 A;  4ORZ A;  1LCK A;  5IXF A;  1RUW A;  2DNU A;  2AK5 A;  3PE0 A;  2LQN A;  1GCP A;  2FG0 A;  3EGU A;  2KRN A;  2L3S A;  4LUD A;  1V1C A;  4R0K A;  4AG2 C;  1UTI A;  2KYB A;  1MUZ A;  1ABO A;  2C0O A;  1ZUY A;  1YP5 A;  3KFV A;  3ZL7 C;  2V1R A;  2AKL A;  2LJ3 A;  2GGR A;  2L0A A;  1VYT A;  4J9C A;  4M4Z A;  3U23 A;  2J05 A;  1K0X A;  1A0N B;  4RTX A;  1YN8 A;  4DEY A;  2VWF A;  1Z9Z A;  1NEB A;  1H3H A;  3UAT A;  2O9S A;  2DM1 A;  4OMO A;  2RQT A;  1UFF A;  1OV3 A;  2YUQ A;  4LN2 A;  4JZ4 A;  4RTT A;  1KJW A;  3NGP A;  1ZBJ A;  3TSZ A;  4AFQ C;  4F17 A;  2RN8 A;  2BZ8 A;  4EIK A;  2CT3 A;  4JPB W;  2EGE A;  4OMN A;  2VVK A;  4JZ3 A;  2DMO A;  1ZLM A;  2EGC A;  2D0N A;  4F14 A;  1W1F A;  2HEQ A;  4RUG A;  2LX7 A;  1JO8 A;  1BBZ A;  2JXB A;  2J6F A;  1NM7 A;  2D8H A;  3TVT A;  2X3W D;  1G2B A;  2EYX A;  2K2M A;  2EBP A;  2RQU A;  4RTU A;  3EG3 A;  2YDL A;  1NEG A;  4Z89 A;  2DX1 A;  2P4R A;  5FWB A;  1UUE A;  1BU1 A;  5IHI A;  4IIM A;  2K3B A;  1T0J A;  2AKK A;  2GBQ A;  1UG1 A;  3I35 A;  2JTE A;  2LNH B;  1H8K A;  1RLP C;  3THK A;  2KRM A;  1U06 A;  5L23 A;  1MV3 A;  1WYX A;  4A63 B;  2LJ0 A;  1AZE A;  2L3Q A;  2DIL A;  1UHC A;  1Y0M A;  2LMJ A;  4IIO A;  4LE9 A;  4J9F A;  3NMZ C;  2RQW A;  3REA B;  1G83 A;  2EYW A;  3RNJ A;  2EYY A;  2EVR A;  2ED0 A;  1ZUU A;  2CUB A;  2J7I A;  4HXJ A;  2G6F X;  4OMQ A;  3UA6 A;  1UGV A;  1CKB A;  2RMO A;  2O31 A;  3H0F A;  1GCQ C;  2FRY A;  2PZ1 A;  4QT7 A;  2D1X A;  2DBM A;  3M0S A;  1QWF A;  2CRE A;  1KSW A;  2D8J A;  2DL3 A;  2VKN A;  3H41 A;  2YUN A;  4AFS C;  2KRS A;  5I22 A;  2C0I A;  2FRW A;  3VS3 A;  2KE9 A;  1BK2 A;  2CSI A;  1Z9Q A;  1QKW A;  1SRL A;  4J9G A;  2LZ6 B;  2GTJ A;  1QCF A;  1J3T A;  1SHF A;  4HVW A;  1BB9 A;  1JXM A;  2GNC A;  2DYB A;  2KT8 A;  3VS4 A;  1FMK A;  1UJ0 A;  1H92 A;  1X27 A;  1OOT A;  1PKS A;  5HCK A;  2ROL A;  2JMA A;  2F2V A;  2EQI A;  4LNP A;  1SPK A;  1GL5 A;  2HCK A;  5ECA A;  3UF4 A;  1GRI A;  2B86 A;  1S1N A;  2JW4 A;  1E6H A;  1MV0 B;  2DA9 A;  1WA7 A;  3LH5 A;  1WDX A;  4J9E A;  2JS2 A;  1YCS B;  2A08 A;  3SHW A;  1U5S A;  1VYU A;  1TG0 A;  3I9Q A;  1HD3 A;  1W6X A;  2YUP A;  4CC2 A;  1GCQ A;  1B07 A;  1M8M A;  2O9V A;  1KIK A;  4KRT A;  4Y92 A;  3VS7 A;  2JM9 A;  1JEG A;  2I0N A;  1PHT A;  2W10 A;  2RPN A;  1QKX A;  1VYV A;  2RNA A;  3EHR A;  1AWO A;  1EFN A;  2HBW A;  1TUC A;  2X3X D;  2MOX A;  4X1V A;  2SEM A;  4RTY A;  3PVQ A;  3EG2 A;  1YWP A;  5FW9 A;  2DBK A;  1QWE A;  2FPE A;  3IQL A;  1X2Q A;  2CH4 W;  4FSS A;  2O88 A;  3VS2 A;  4HCK A;  2KEA A;  5I11 A;  4Z8A A;  1AEY A;  1K1Z A;  2EW3 A;  1OPK A;  1K0S A;  2LJ1 A;  1X43 A;  3GBQ A;  4JJC A;  1X6B A;  1E7O A;  4E6R A;  3A98 A;  2M0Y A;  4ESR A;  4D8K A;  1Y57 A;  1UE9 A;  1ZUK A;  1T0H A;  2EGA A;  1I07 A;  1IO6 A;  2ESW A;  2DL7 A;  2EKH A;  1UDL A;  1ZX6 A;  4J9D A;  3NHN A;  2RQV A;  1WXU A;  2SRC A;  2LCS A;  2H8H A;  4AG1 C;  1GFD A;  2NWM A;  2LP5 A;  1ARK A;  2XMF A;  1AWJ A;  2ECZ A;  2K6D A;  5IH2 A;  1GFC A;  1KFZ A;  3REB B;  2DL8 A;  3VS5 A;  2PTK A;  3TSW A;  3H0H A;  3EG0 A;  3EHQ A;  2KR3 A;  4HVU A;  3VRZ A;  1JXO A;  4DEX A;  4AFZ C;  2BZX A;  4WCI A;  2CH4 A;  1T3L A;  2KGT A;  3M0Q A;  1GBR A;  2ABL A;  4GBQ A;  3M0R A;  1N5Z A;  1WX6 A;  2CT4 A;  2YT6 A;  5GJV B;  4CC7 A;  3SEM A;  1PRM C;  1RLQ C;  3NPF A;  1HSQ A;  1VA7 A;  3PVL A;  1X69 A;  1AWW A;  1UEC A;  2YSQ A;  2KXD A;  1WXT A;  1NG2 A;  4J9I A;  1UHF A;  5IHK A;  1E6G A;  2GQI A;  4JJD A;  2EPD A;  2L2P A;  1RI9 A;  4CC4 B;  2F2W A;  1CKA A;  3I5R A;  3QWX X;  2DF6 A;  2DLP A;  2AZS A;  4AFU C;  2GTO A;  2IIM A;  2DRK A;  1ABQ A;  1CSK A;  2JS0 A;  5EC7 A;  2OAW A;  2L3P A;  3C0C A;  3M0T A;  3I5S A;  1PWT A;  2OJ2 A;  4JJB A;  2DL4 A;  4LUE A;  3H0I A;  2KYM A;  4OML A;  2V1Q A;  1M3C A;  2JM8 A;  2CUD A;  1YWO A;  1K9A A;  3RBB B;  1YNZ A;  1AOJ A;  2EYZ A;  4J9B A;  2K7A A;  2JT4 A;  1NLO C;  1W70 A;  1NLP C;  1AVZ C;  1WXB A;  2O2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...