2M51A

Nmr structure of the sh3 domain of human ras p21 protein activator (gtpase activating protein) 1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
62
structure length
62
Chain Sequence
GRRRVRAILPYTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras GTPase-activating protein 1
publication title NMR structure of the SH3 domain of human RAS p21 protein activator (GTPase activating protein) 1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 7
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2m51A00
2ENMA 2KROA 2K6DA 2DNUA 4J9EA 3ULRB 4LN2A 4M4ZA 4OMOA 2KBTA 2BZYA 1W1FA 1H92A 1HD3A 2ESWA 2EVRA 1QKWA 2JTEA 1GFDA 1WXBA 5IHNA 1G2BA 2FPEA 1PNJA 3EG2A 1ZUUA 1UE9A 1VYUA 2YDLA 1NEGA 2LMJA 1KSWA 4LE9A 1A0NB 1M3BA 4K11A 1X2QA 2JW4A 3VRZA 1SRMA 2K2MA 2L3SA 4RUGA 1RI9A 1NG2A 2LZ6B 1JQQA 2KRNA 3SEMA 4FSSA 2EPDA 1WFWA 5GJVB 1CSKA 2ABLA 2ED0A 2DVJA 4DEYA 2JMCA 2O31A 2X3XD 1I07A 1UUEA 4J9CA 4J9IA 2OAWA 1UJYA 2J6OA 2DL4A 4OMNA 1GBQA 4JJCA 3TVTA 4AFSC 2D8HA 1H8KA 5IHKA 2C0IA 2D8JA 2CH4A 3UA6A 4D8KA 5FWCA 2J7IA 4HXJA 1N5ZA 2DILA 1ZSGA 1GCPA 1AWXA 2X3WD 1HJDA 2A36A 2IIMA 2I0NA 2J05A 3I9QA 1M8MA 2XMFA 2G6FX 2KYMA 5L23A 2EKHA 2DMOA 4KRTA 1YWPA 3M0TA 3VS2A 2LQNA 2VWFA 2W10A 2VVKA 3EG0A 2F2VA 4EIKA 2M0YA 4JJBA 2JS0A 2P4RA 1SRLA 1AOJA 3SHWA 1WA7A 3I5RA 2DX1A 4E6RA 4AG1C 1PKSA 4OMQA 2KE9A 2K9GA 4F17A 1ABQA 1Y0MA 1I1JA 2KGTA 4LNPA 3PE0A 4Y92A 1BB9A 2RQUA 1S1NA 4AFQC 2CH4W 2JXBA 1M3CA 2KXCA 1GBRA 2DA9A 1YN8A 3EG1A 3IQLA 1U5SA 2CSQA 2M51A 2L3PA 2ED1A 1HSQA 1YNZA 2QDLA 2O9SA 1BK2A 1UG1A 1QCFA 1ABOA 1B3QA 2DL5A 2K79A 1NEBA 4RTZA 3R6NA 2RQRA 1MV0B 2J06A 1J3TA 1Z9ZA 1ZUKA 4AG2C 1T0HA 1X43A 1T0JA 2L3QA 3QWYA 2ROTA 1GL5A 1UFFA 2YUQA 2YT6A 3NHNA 1WXUA 3KFVA 1QLYA 2J6KA 5ECAA 1MV3A 1UTIA 2DLPA 1K0XA 3ZL7C 2CDTA 2L0AA 2HDAA 4RTXA 5IXBA 2RNAA 1W6XA 1PKTA 1NYFA 2KT8A 4CC4B 1K4US 5I11A 4GBQA 4JPBW 4ESRA 2KRMA 1JXMA 4LUEA 4DEXA 2EYYA 5EC7A 4OMMA 1QKXA 1VA7A 3M0QA 3RNJA 4CC3A 3QWXX 1BBZA 2EGAA 3VS7A 2DBMA 1ZUYA 1WDXA 3EHRA 3H41A 1GRIA 2LCSA 1X2KA 2BZXA 3THKA 2V1QA 5IHIA 1AZEA 1RLQC 1ARKA 3VS5A 3M0UA 1X6GA 1SEMA 1KIKA 4Z89A 2EYXA 1SPKA 1JU5C 2HCKA 5GJWB 2F2XA 1UECA 1JEGA 2SEMA 3UA7A 1MUZA 2NUZA 1M30A 1PHTA 2CT4A 1ZX6A 2RN8A 2W0ZA 3REAB 2LJ1A 1ZBJA 2J6FA 1GCQC 3NPFA 1TUDA 3JV3A 4AFZC 2LJ0A 3EG3A 3VS4A 1VYTA 2RQWA 1K76A 3PVQA 2DE0X 3M0PA 1NLOC 2AZSA 1EFNA 2YSQA 4F14A 2JM9A 2HSPA 3UF4A 2BTTA 2HEQA 3H0IA 2LP5A 1WLPB 1I0CA 1OV3A 2RQVA 3FJ5A 3GBQA 1TG0A 2KXDA 4WCIA 1E7OA 1NM7A 2RMOA 2CUDA 2K7AA 2YUOA 1IO6A 2D0NA 4D8DA 2JT4A 4QT7A 2FRYA 1W70A 1K9AA 2FG0A 5FW9A 1OPLA 1M3AA 2CSIA 1KJWA 2B86A 1OPKA 3O5ZA 1V1CA 5FWBA 1Z9QA 2LNHB 2MOXA 1G83A 4OMPA 3EHQA 1XOVA 3VRYA 2CUBA 1RLPC 1AVZC 1T3SA 3I5SA 1CKBA 2DRMA 2GGRA 2FO0A 4Z88A 4HVWA 5I22A 2DL8A 2AKKA 1AD5A 2A08A 1NLPC 1Y57A 1YCSB 4JZ4A 3A98A 2OJ2A 4RTYA 3NMZC 3VS3A 2FPFA 2RQTA 2AZVA 1SSHA 1PRMC 2EYZA 2KYBA 2GTOA 1RUWA 2KT1A 2GNCA 3C0CA 1FYNA 2EYWA 2DL7A 1LCKA 4J9GA 2RF0A 3VS1A 1X27A 4ZNXA 1YWOA 2KRSA 2GTJA 4J9DA 3H0FA 3TSZA 3M0RA 5HCKA 2EBPA 2O9VA 2H8HA 3RBBB 2JMAA 1AZGB 2A37A 1AWWA 1UHFA 1WYXA 1KFZA 4HVVA 1AEYA 2FEIA 1E6GA 2CT3A 2EGCA 2YUNA 3I35A 1BU1A 4J9BA 2FRWA 2C0TA 2CREA 2L2PA 2PTKA 2PZ1A 2LX7A 3H0HA 4IIOA 1B07A 1YP5A 2LJ3A 4R0KA 3CQTA 1UDLA 2DM1A 4HVUA 3VS0A 1WI7A 4ORZA 4GLMA 2E5KA 1K1ZA 3REBB 2DJQA 2ROLA 2O88A 3VS6A 1ZLMA 2KEAA 2C0OA 2ECZA 1QWEA 1UHCA 2D1XA 2HBWA 1WIEA 1NYGA 4JJDA 1U06A 4IIMA 1WX6A 4RTVA 3UATA 2KNBB 2DYBA 4RTWA 2RPNA 1AWOA 1AWJA 2DL3A 1SHGA 2DF6A 1U3OA 1WXTA 4Z8AA 2NWMA 4RTUA 4RTTA 3M0SA 1FMKA 1JXOA 1H3HA 2EW3A 1JO8A 1PRLC 1UGVA 1X69A 5IXFA 1GFCA 1SHFA 2AK5A 3NGPA 2MCNA 1UJ0A 2SRCA 2KR3A 1CKAA 1OEBA 4AFUC 2O2OA 4A63B 4X1VA 2EQIA 3U23A 1GCQA 2PNIA 4F16A 2AKLA 4J9FA 2YUPA 4OMLA 2A28A 3TSWA 4LUDA 2MIOA 1PWTA 2DBKA 4HCKA 2F2WA 1E6HA 2GQIA 2LQWA 2JM8A 4JZ3A 1M27C 1T3LA 2EGEA 1QWFA 2BZ8A 2GBQA 4CC7A 1TUCA 3PVLA 2V1RA 3EGUA 2DRKA 2OI3A 5IH2A 2VKNA 2JS2A 2FPDA 1X6BA 1OOTA 1VYVA 1K0SA 3LH5A 2K3BA 4CC2A 4J9HA
chains in the Genus database with same CATH superfamily
2ENMA 2KROA 4M78A 2NUTA 4J9EA 4QQ6A 3EGXA 3M59A 4OMOA 3OYMA 1SG5A 2KBTA 1HD3A 2O4XA 2BKDN 2ESWA 2BE9B 4JJNK 1QKWA 1GFDA 1OU9A 1WXBA 3X20B 3OS1A 4BACA 1C1AA 4M7AB 2FPEA 4M77G 1PNJA 3CC2A 2QEXT 1NEGA 2A7YA 3MCAB 2LT1A 4NL3A 4J8OA 4DBQA 3VRZA 1SRMA 2K2MA 5I21A 2KRNA 4MMKA 4FSSA 3CCEQ 1BYMA 3CCVA 2EPDA 2COWA 3G1JA 1FMWA 3MO8A 2JMCA 1RADB 1UUEA 3ER0A 5HY6A 2CYZB 1IXDA 2VUBA 5J3BA 1UJYA 2DKGA 2J6OA 2D9TA 3KBGA 1I5OB 2MPXC 2ZAEA 5KCOA 3QSUA 2PU9B 3M4YA 3SWNC 5IHKA 2C0IA 2D8JA 2MMPA 4IURA 1Y96A 2DILA 3V8KA 2K3XA 5GAOm 1ZSGA 3CXCS 2X3WD 4X9CA 1HJDA 2DAQA 3TEEA 2I0NA 3KXTA 2J05A 3P8DA 1BCOA 3CC4Q 2EKHA 1I81A 1M90U 4F7UF 3VU3C 1VQ8Q 2W10A 4NL2A 2KMTA 2EWNA 2YLCA 1SRLA 1R0CB 3SHWA 2VASA 3G71A 3X24B 2KDSA 4AG1C 3CCUQ 1ABQA 1M1GA 2RI3A 1Y0MA 1YITQ 2KGTA 3PE0A 1QVPA 1KD1C 1S1NA 2JXBA 4LDVA 5GAOp 4JRKA 2VXEA 2R57A 1GBRA 4RKUE 5GAN4 3CCLT 4MZTA 1U5SA 3A8GB 1VQ7T 3CPFA 4ZN3A 1YJWT 3R6OA 2ED1A 2QDLA 2O9SA 1UG1A 1NPPA 3EFRA 1QCFA 2XIDA 2RM4A 3OYLA 1MV0B 1J3TA 4F04B 2RHXA 3OYEA 4AMCA 1LPLA 3VYGA 1VQ9Q 2MYSA 4M7DE 2HKNA 2R5AA 3QBYA 2LQKA 1WNLA 2ROTA 4A4HA 1GL5A 2NUTB 5LL6S 3KFVA 4LD9K 3I55Q 2J6KA 5ECAA 1K0XA 1WJRA 2O4XB 3ZL7C 1M90C 2L0AA 2VGMA 4BB7A 4FYXB 5IXBA 2ZPGB 3DLMA 3SDZA 5GMKh 4GBQA 1BIAA 4QQGA 3CBMA 2KRMA 2M0OA 3RUXA 4FIBA 2OTJQ 3CMEA 5J26A 1BBZA 4ELYC 1Q82R 2ZZDA 3EHRA 1VQ4T 2QGFB 3L2VA 3H41A 4OVAA 4JDSA 3JCMQ 1X2KA 2EJ9A 5IHIA 4N0AC 3LGLA 1D1CA 4MZPA 4A53A 2K5LA 5GAMd 2EYQA 2E12A 3JB9D 3A8HB 1KIKA 2QA4A 2EYXA 5CAIA 1G3SA 2HCKA 4PKCC 5DLQE 3JCMV 2SEMA 4M7DC 1Y96B 1KC8U 1VQ5A 2KI7A 2W0ZA 2QQRA 3CCQT 1ZBJA 3GF5A 2J6FA 2CZ0B 4KBMB 1UEBA 4PJMA 4AFZC 4IUUA 4C92D 3EG3A 1YJNQ 2RQWA 3PVQA 2DE0X 5GMKe 2D6FA 4OB0B 1QVFP 1EFNA 2YSQA 2HMAA 3OYGA 4BY6C 4BE2A 2HEQA 2CP0A 3SWNA 1WLPB 4BE0A 4RCBA 1VQPT 1OV3A 2DIGA 2RQVA 3FJ5A 3HHTB 5CIUA 3JCMc 2HQEA 2FRYA 1VQOQ 1W70A 3EGDB 2CZ1B 1X01A 1GXIE 2DIQA 1OPLA 4KH1B 1Q95G 3QIIA 5KYNA 2DD5A 1OPKA 3RESA 2VYTA 3OSSC 3H9NA 3JCMW 3META 1KQSS 4QW2A 2G3RA 4EMKA 1RLPC 4XTXA 1AVZC 1T3SA 2JOYA 2LDMA 4M75F 4XTZA 4PJOF 2M02A 3WVDB 4M75D 3RDVA 1AD5A 1IHWA 2A08A 4PJOD 1YCSB 2JJ9A 1NJIR 3A98A 2PUKB 4J5YA 3VS3A 3ZFJA 3CC2Q 1SSHA 2KYBA 3GNGA 3S3MA 2KK4A 3LLRA 1FYNA 1V29B 2EYWA 3VJPA 1BKBA 1X27A 4ZNXA 5IT9E 4O6JA 1YJ9A 1BI1A 3PMTA 3G4SA 3CCVQ 5HCKA 2AIRB 1W4SA 8ATCB 1M9SA 3RBBB 3M4GA 5CQYA 2WSEE 5GMKl 1NZ9A 3OB9A 1HXDA 4J6YA 1B34B 3CCJA 3JB9G 2KY9A 2E6ZA 2IVWA 2OTLA 3OBWA 2CT3A 3OY9A 1YI2A 1TWBA 3G7ZA 1VQNT 1IRXA 4J9BA 3S3OA 3MEAA 2YHTA 2QTVA 5GANj 1W2BA 4XAXB 5GANf 1TH7A 3H0HA 2MAMA 3EFOA 3BFMA 4R0KA 1ZSZC 1UDLA 4C92G 2DM1A 3JCMP 3FC3A 3VS0A 3QJ6A 4BUGA 2Y4YA 2JTMA 4B9WA 4EMGA 2QQBA 4ORZA 5KE2A 3REBB 1UGPB 3DKMA 3NFCA 3PGGA 2L89A 2ROLA 4PJNA 3CXCA 2C0OA 1K8AR 1UHCA 3EFSA 1WIEA 3PT9A 5GAMh 1QP3A 2F1LA 3WXMB 4PJLA 3CC7Q 3I56T 1AWOA 2DL3A 2PQWA 1WXTA 3JB9J 2DYIA 4N0AA 1PD0A 2IPOB 1FMKA 1VQMA 2DEUA 5KYUA 3RMQA 1PRLC 1UGVA 1X69A 4QKUA 5IXFA 1GFCA 1M8VA 3SWNB 2AK5A 3NGPA 2EAYA 2KR3A 2QGGA 5LJ5d 4M7DA 2EQIA 4FW1A 3J81E 1SKUB 2PNIA 3FDRA 3LX7A 4CI0C 2H3EB 5IAYA 2AKLA 2CP2A 1D1AA 2A28A 2MIOA 1IGUA 2DBKA 4HCKA 3TQ7P 3O8VA 4ZTJA 4JZ3A 4VUBA 1M27C 1OQKA 5GAOq 3CCMA 5I2SA 1QWFA 4EMKB 3CEYA 2RI2A 3PVLA 2V1RA 1PD1A 2CP6A 2OI3A 2VKNA 3OYHA 2FPDA 1OOTA 1Y7XA 4JUVA 4AFQC 5GAMe 1VQLA 4XTYA 1G8XA 2K57A 3JCMf 4C8QG 3M56A 4F7UE 3ULRB 4OF1A 4M7AD 4ELZC 2BZYA 1W1FA 4HKEA 4ZGDB 3HRUA 2OAUA 4J7FA 5CCAA 3CMEQ 2HD0A 3VUBA 5IHNA 2QAZA 1D0ZA 1ZUUA 1RAIB 1M1KC 2QEXA 3OYAA 4M77F 1X2QA 2JW4A 2Y90A 1N8RC 4M77D 3OQ5A 2DPPB 2QA4Q 5GJVB 2R5MA 2DVJA 5HK3A 2O31A 2X3XD 1X6OA 4J9IA 2OAWA 1LOJA 4C0ZA 1VQ5Q 5D7UA 1RI0A 1C6VX 2CKKA 2COZA 2D8HA 2RHYA 1H8KA 2Y4XA 3LW5E 4XQ3A 2CH4A 3GP8A 1K9MC 8AT1B 1N5ZA 2L8DA 3JRZA 3E9FA 1GCPA 2X51A 5CVIA 4FYVB 3FIFA 3I9QA 1Q86C 2YRCA 2X4WA 4KRTA 4UC4A 2ZPEB 1PM3A 2BUDA 2LQNA 3V8JA 3KUFA 1QQJA 2VWFA 1PG5B 1ZSZA 2VVKA 2F2VA 4RG2A 1M4ZA 2E3HA 3EAEA 1Q82U 3I5RA 2DX1A 2KSSA 3MKDA 2K3YA 1PKSA 1IREB 5L8RE 4OMQA 2V26A 2QXFA 2K9GA 4F17A 2IG0A 2F5KA 1ACMB 2KVQG 4M7DB 1WHLA 1VQ8T 1O75A 3FRNA 4D6WA 1QCNA 1V76A 2LRQA 6AT1B 2DA9A 3CCLA 4BI4A 2CSQA 1NPRA 3OW2P 2K2VA 5LJ5h 1KQSA 4M7AG 2L3PA 3QDRB 1VQ7A 3CCST 1YJWA 1YNZA 3Q1JA 1YITT 2LT4A 1ABOA 5GAMg 3R6NA 2NUPB 2DXCA 1BIBA 7AT1B 1YJ9Q 1VOMA 1T0HA 3F70A 2RK1A 3OS0A 1X43A 3OYYA 3RKXA 2L3QA 2XG8D 1KG1A 1UFFA 2YT6A 1WXUA 3E9GA 4A4EA 1MV3A 3OYDA 4IUPA 3CCJQ 1OZ2A 1YHQT 2HDAA 4RTXA 2RNAA 2VV5A 1PKTA 1NYFA 2KT8A 4L6V5 4HT8A 5I11A 4JPBW 4MDXA 2BE7D 1JXMA 1XNIA 1QKXA 1W2BS 1C0MA 5A0LA 2DXBA 3QWXX 5GAOn 2EGAA 3VS7A 1OI1A 1Q81C 1WDXA 5LJ5e 4FL6A 1VQ4A 2LCSA 1WJQA 1VQKQ 2LCLA 5LJ3d 4LDYA 4BI3A 1NJIU 4ZGEB 4M75E 1K73R 1ARKA 4PJOE 1WHKA 4C92C 1SPKA 3CBPA 5HK0A 5GAN3 3QKJA 3D7SB 1JEGA 1MUZA 1PHTA 2CT4A 3A1PA 1ZX6A 5CKDA 2RN8A 3REAB 2LJ1A 3CCQA 2RO0A 4XU2A 3VS4A 2DO3A 1MMAA 1K76A 3M0PA 3JCMJ 4E7ZA 4F14A 4XU1A 1ZSZB 3UF4A 3H0IA 4MDWA 3P8HA 2XDDA 4C0DC 1VQPA 4NS5A 4F7UA 1Y71A 1QVFS 3JB9I 1Q86R 4D8DA 4PNOA 3CCMQ 2FZKB 4DOVA 4M78G 1NE8A 4DQ2A 1JRIA 2QQ9A 3OMGA 4M75C 4DBRA 3S3NA 1TU0B 3CCRT 5LJ3j 1WGSA 4PJOC 4E7IA 1V1CA 1Z9QA 3EH1A 1VQLQ 5LJ3f 2MOXA 4KH0B 4RG8A 2E64A 1K8AU 1MMGA 2P0QA 4C5IA 1QVGS 2DRMA 1YIJT 2GGRA 4HVWA 5I22A 2XICA 2JNGA 1NLPC 2EJFA 2OJ2A 4M78B 4FM4B 3EGXB 3NTKA 4IUVA 1PRMC 2EYZA 2ATCB 2GTOA 2KT1A 2GNCA 3C0CA 1RABB 3FB9A 2QEXQ 1ZA2B 2DL7A 2EQMA 1MNDA 2KRSA 5FU7C 2P84A 1QMCA 2RHUA 1P92A 3LGFA 3M0RA 2F69A 2PUOB 2M9UA 2CGHA 3TU4K 2GQVA 1AZGB 3RIRA 2A37A 1AWWA 1WYXA 2HZYA 3RKYA 1AEYA 1XTDA 4BE1A 2RD1A 2C0TA 1VQNA 1H641 2P0PA 3JB9F 2L2PA 1PCXA 2PZ1A 1N27A 2RJFA 2LJ3A 3GIBA 3CQTA 5FLXE 1JB0E 1KHCA 3A5ZB 4GLMA 3CXCP 2E5KA 2ZCFB 3AT1B 5CKHA 1BI3A 4J6XA 4C92F 2DZ9A 2RHZA 2O88A 2KEAA 3C4SA 3HSBA 1QWEA 3X28B 2HBWA 4JJDA 1U06A 1WX6A 4RTVA 1Q7YU 4RTWA 5GAN7 4XU3A 3OYFA 4EMHA 3I56A 1QW1A 4RTTA 4X9DA 2DETA 1VIEA 1H3HA 2RA2A 4XK8E 1JO8A 1LVKA 2X9HA 3CPWS 1S72T 1U1TA 3CD6T 4M77E 4C92A 2VC8A 1OEBA 3CCLQ 3TCJA 4JS4A 3CC7T 2WSFE 4F7UB 1VQ7Q 2AT1B 1YJWQ 4PL6A 5GANd 2XDBA 1ZA1B 1HK9A 3ZBDA 2GCXA 2E3IA 1TSFA 3V8LA 3TSWA 4LUDA 4CRIA 1PWTA 4C0FA 2GQIA 2X4XA 4E7LA 2A3LA 4WTOB 2HQHA 2ZGWA 1KD1R 3INZA 3JCMX 1VYVA 1KC8C 3LH5A 1K0SA 5FU6B 2K6DA 2JUFA 3G6ET 3BW1A 1RAHB 3OS2A 4LN2A 3LH0A 4M4ZA 4M75A 2HSEB 4PJOA 4OB1B 1Q7YC 3QUIA 5KYYA 1M1FA 4C8QF 4M77C 1TXQA 1PSFA 2QG9B 1R0BG 1AT1B 2QK0A 4C8QD 5A0DA 3VV0A 4LD6A 2LMJA 1KSWA 1VQ4Q 2YXYA 4LE9A 5AT1B 1A0NB 3HFOA 2L3SA 1NG2A 2LZ6B 4E7HA 1JQQA 1M90R 4EPCA 5KYWA 1TUGB 3SEMA 1VQ6T 2QI2A 1WFWA 1R8OB 3HTRA 2MK5A 2ABLA 2LVMA 4KT0E 4ZGJB 3QO3A 1MNEA 3X25B 4DEYA 1WHGA 4J9CA 4ZTFA 2DL4A 3TVTA 3CCQQ 2LNVA 4AFSC 1EIFA 1VIFA 3DB3A 3JCMd 4IUTA 3UA6A 4D8KA 3UPUA 1I8FA 2J7IA 4HXJA 5DY9A 3G71Q 3ZEHA 1AWXA 2A36A 4ATOA 4R55A 3OYCA 3CMAT 4IKFA 4N4IA 4JLGA 3FLGA 3HFNA 5L23A 1D1BA 2DMOA 1RAGB 1YWPA 4J6WA 3VS2A 1VQPQ 3OYIA 3EG0A 2COYA 1JBMA 3GOXA 4JJBA 4HCCA 1M2VA 1SSFA 1WA7A 2BIVA 4JS5A 3MP8A 2KE9A 4HCZA 4C0GA 1KHIA 2RK2A 1M2OA 4LNPA 1QVFA 1K73U 1BB9A 1FMVA 1Y07A 2K4YA 3HRSA 1JJ2S 1VQ8A 1KQSP 2DTIA 1M3CA 2EQKA 2QTXA 3EG1A 4XTVA 4II1A 1IHVA 2O01E 3CCSA 2QDYB 1QVGA 1YITA 5GANh 1SF9A 5J39A 2DL5A 1NEBA 4RTZA 2A0FB 1WQWA 4M7AF 4RMOA 1G5VA 4C0DB 1H3ZA 1O9SA 3PTAA 4AG2C 5GAOl 1T0JA 3AHUA 4KUIA 4OGCA 4OMFB 1OYXA 4QVZA 4C5GA 4M75B 1UTIA 2DLPA 4QVDA 5C0MA 2CDTA 5DM7R 1YHQA 3M53A 4EDUA 3C12A 4CC4B 4P5NA 4PLLA 1K4US 4DBHA 1VQNQ 3E1SA 2P0KA 3OS5A 2X35A 3HKSA 3DB4A 2RJCA 1X75C 4ESRA 4LUEA 4HCBA 4OMMA 1VA7A 3QYGB 4CC3A 1FXXA 4HA8A 2DBMA 1ZUYA 1RL2A 4PLIA 1IGQA 4DA4A 1GRIA 1WHJA 3EFOB 3THKA 2BZXA 2V1QA 1AZEA 5GANe 4M77A 4ME7A 1RLQC 3MEUA 3VS5A 9ATCB 3M0UA 4NOYA 3CCET 2DXUA 1X6GA 4A54A 1FX7A 2OTJA 4FYYB 1JU5C 3MJXA 4O5VA 5GJWB 1UECA 3I56Q 4BI8B 2NUZA 1M30A 2E5QA 4M7DG 1VQKT 1GCQC 2HBPA 2KAFA 3UDCA 3JV3A 2XU8A 2LJ0A 2GFUA 1VYTA 3JCMh 1NLOC 2AZSA 4IUQA 4PFZA 5KYUB 2JVVA 3SB2A 1BCMA 3CC4T 5GMKm 3CPWA 1M2VB 1I0CA 3GBQA 2KXDA 4WCIA 1E7OA 4KGVB 2RMOA 2D0NA 2CZ7B 2JT4A 4PFPA 3BDLA 2ZPIB 2XHCA 5FW9A 5CKEA 3M54A 3M58A 3CCUT 5GAOr 3OYJA 3O5ZA 1TTHB 3H6ZA 3CCRA 2E1HA 2LNHB 4BY6B 3HL8A 4M78F 1G83A 4OMPA 3EHQA 5D6XA 3LWIA 4M78D 3I5SA 3JB9H 4C92E 1YIJA 4QQDA 5M9OA 2DL8A 2AKKA 3G4SQ 2XK0A 1Y57A 5FRMA 2PVOB 4RTYA 3NMZC 2RQTA 1F1BB 2AZVA 3JCMe 3M55A 1RUWA 2HAXA 2FB7A 1UGRB 3HP9A 1LCKA 1RAEB 4J9GA 2OTLQ 1ZHIA 3VS1A 2OX7A 2LC4A 1YWOA 5D6WA 1YI2Q 3BY7A 1N6AA 4FU6A 4JRQA 3TSZA 1VQ9T 2QQSA 1Q82C 1EZZB 2O9VA 5IN1A 2H8HA 4FCYA 2JMAA 1AHJB 3I55T 1UHFA 1KFZA 4HVVA 1UB4A 2P4TA 3H8ZA 2EGCA 3I35A 3OYKA 1KD1U 1BU1A 2FRWA 5GANg 4OGEA 3J80E 4Y28E 5I2MA 1M1KR 4PJJA 2LX7A 2OTJT 1B07A 1YP5A 3OYBA 1N8RR 4M77B 4HVUA 1OU8A 2LTOA 1LNXA 1K1ZA 3GLXA 2DJQA 5GAN6 1VQMQ 2K5FA 1U1SA 3WVEB 3RMSA 2R58A 1NBEB 1IB8A 3NTHA 3MHXA 2MF2A 1KQ1A 5A2QE 5GMKj 3FEOA 2HNIA 3UATA 4J7IA 4C8QE 1OX9A 2E4HA 2M16A 1AWJA 2LCCA 4OP0A 1K9MR 4FT4A 1WJSA 2KQWA 4LDWA 1MMNA 3L2UA 1JXOA 2EW3A 4GLKA 1S72A 1YJNT 4PFOA 3CD6A 4EMKC 1SHFA 2FL7A 1UJ0A 1WPYA 1CKAA 3A8OB 4A63B 3LWHA 3OSVA 4X1VA 4KGXB 4XTUA 3CC7A 3CCSQ 1GCQA 1PC0A 2EFIA 1JJ2A 1FWZA 3EGDA 4F16A 2E70A 4J9FA 4ANJA 2YUPA 2X4YA 1NJIC 1E6HA 2LQWA 4Y91A 1VQOT 3ASKA 3GNFB 3L42A 2BZ8A 4CC7A 5CR2A 3EGUA 4R56A 2K5IA 3JCMg 2K3BA 4J9HA 3OW2A 4FW2A 4XTWA 3L1AA 4QVCA 5KCHA 1YHQQ 2DNUA 4C8QC 3N5BB 3G6EA 2QASA 2M1HA 3M57A 2Z0WA 2DEQA 1H92A 2L3RA 4FSXA 5FROA 2EVRA 2MWOA 2JTEA 3LYIA 3L2ZA 3QZ5B 1G2BA 3CC2T 3EG2A 1UE9A 1VYUA 2YDLA 3BDUA 2LX9A 4PK4A 1W2BP 4TVRA 4B6MA 5LJ5g 1M3BA 3PIPA 4K11A 4RUGA 1RI9A 1B34A 1QCOA 3OBYA 3CCVT 4C5EA 1VQ6A 1CSKA 4A4KA 2L5QA 2ED0A 1N9RA 4OB3B 1TS9A 1I07A 3RKWA 1K8AC 4OMNA 1GBQA 1VUBA 3MPUB 4JJCA 4MZMA 2HL3A 1G3YA 2PVGB 4M7AE 5KH6A 1Q81R 5LJ3h 2XD0A 4B9XA 5FWCA 3BE3A 1MGQA 4F7UG 1G3WA 2CP7A 2IIMA 5AYFA 2DD4A 4GY5A 1M8MA 2XMFA 3DLLA 2G6FX 4DBFA 3CMAA 2KYMA 4A4GA 1RAAB 4N4HA 3M0TA 2JTFA 5GAN8 2QYZA 4LDXA 3OYNA 2RHIA 2JN0A 1U8RA 2RB6A 3PNWC 4EIKA 2FVUA 2M0YA 1IZ6A 3VUZA 2JS0A 2V8JA 1D3BA 2E10A 2P4RA 2ZPFB 3G71T 3FJPA 2DVEA 1AOJA 3QG1A 3JSCA 3QJYA 4FYWB 4E6RA 2EJGA 4FT2A 4BDYA 3QDFA 4MMLA 3CCRQ 1I1JA 2F5TX 4Y92A 5KYXA 2RQUA 5GAN5 3QPHA 2CH4W 3V7SA 5GMKi 2CP3A 1YIJQ 2NLUA 2KXCA 1OX8A 1YN8A 3MP1A 5C6SA 1QVGP 2DZCA 3IQLA 4M7AC 2M51A 4RCCA 2D0QB 5LJ3e 2EQJA 1HSQA 1XJWB 2DK3A 3L2QA 1BK2A 4LXCA 1B3QA 5GAMj 2K79A 2EQUA 2RQRA 2J06A 3QZ9B 3M9QA 5GAMf 5DLOA 1Z9ZA 2ZPBB 3VKIA 3UT1A 3JCMb 1ZUKA 3QXEB 1MMDA 4JRPA 4N4GA 5A0GA 3QWYA 2YUQA 3NHNA 3C94A 1QLYA 2YLBA 2XI9A 3T9NA 3GPLA 1OULA 1KQ2A 1RACB 1W6XA 2RJEA 1YCYA 2XKOC 3V7RA 3RR6A 4DEXA 2EYYA 3CMET 2HQXA 5EC7A 2B8AA 1WHHA 3M0QA 3RNJA 3NTIA 4KULA 4C8QA 3V7CA 4J83A 1I4K1 1UGQB 2FYKA 4M78E 4HT9A 4L5GA 3P8BB 1KK7A 3OMCA 5KE3A 3CCEA 1SEMA 2QA4T 1WHMA 2AHJB 4Z89A 3L2WA 2MI6A 1R77A 2C06A 2F2XA 1VQ5T 3UA7A 2DTOA 1D09B 1BI2A 1D0XA 3E19A 1TOVA 2FZGB 1VQKA 3CBOA 3NPFA 2RI5A 1TUDA 1OZ3A 1QP2A 2FHDA 2E41A 2E6NA 2X4JA 1S72Q 2DERA 3CD6Q 1WQ7A 4M7DF 3CPWP 3EH2A 2LQ8A 3L2RA 4M7DD 2YRDA 2JM9A 2HSPA 4C92B 1B7TA 2BTTA 5EG2A 3CC4A 1D3BB 2LP5A 4BDZA 1M1KU 3PFSA 1TG0A 3JAME 2YWWA 1NM7A 2I2LA 2CUDA 2K7AA 2YUOA 1IO6A 2PVDB 1YBYA 1N8RU 3A8LB 4QT7A 4M78C 5CO7A 1K9AA 2FG0A 2EKOA 5KYXB 2CS7A 1M3AA 5CK9A 5CKFA 2CSIA 5LJ3g 4M75G 3PMIA 1KJWA 2B86A 3RERA 3CCUA 3UWNA 3EG9A 3MEVA 1YFNA 2JZ2A 5FWBA 4PJOG 1XOVA 3VRYA 2MWPA 2CUBA 3S6WA 4C5HA 4BD3A 3G6EQ 1RAFB 1CKBA 2ZPHB 2FO0A 1ZBXA 4E47A 3OA6A 3OW2S 4Z88A 3MEWA 2RH2A 1K9MU 2DFUA 2NUPA 2DXTA 4JZ4A 2WACA 1BI0A 2FPFA 1DJ7B 3A8MB 5HKCA 3J7AF 2FZCB 4PJOB 1Q86U 1I5LA 5KYYB 2RF0A 2V8KA 2WSCE 1YJ9T 4OB2B 3QHSA 4M7AA 4J9DA 2GTJA 3G4ST 1KC8R 3H0FA 2GFAA 1LJOA 2H3JA 1ZQ1A 1VQ9A 1VQ6Q 2EBPA 4KGZB 4AT1B 3X26B 2HL5C 4JRIA 3CCJT 3I55A 5CQXA 1K73C 5KYWB 1Q7YR 4YTLA 1PSEA 1G3TA 2OTLT 3VYHB 2FEIA 2DJZA 5LJ5j 1YI2T 1E6GA 4C8QB 5LJ5f 2YUNA 3URGA 3ME9A 2CREA 4LDUA 2PTKA 4ZN1A 2VGNA 5FU7B 1UGSB 4IIOA 2XDPA 4A4FA 1XQHA 2CP5A 1D0YA 5CKBA 1HYOA 1WI7A 4L59A 1MHNA 3MP6A 2E65A 3CMAQ 3SD4A 5GAN2 3QYHB 4Z02A 3VS6A 1N9SA 1ZLMA 5FRNA 4JLIA 4DOWA 2ECZA 2D1XA 2DTHA 4XU0A 1NYGA 4Q5WA 4IIMA 2EIFA 2KNBB 2DYBA 2GF7A 3C95A 2RPNA 1SHGA 2DF6A 1U3OA 1EX4A 4Z8AA 2NWMA 4RTUA 1VQMT 2HKQB 3M0SA 4E7KA 2VB6A 2QQAA 2RJDA 4X34A 3E2UA 1YJNA 2MCNA 2YRVA 4V2SA 2SRCA 1JJ2P 4AFUC 2O2OA 4KUDK 3PIOA 4E2FB 3HPWA 3U23A 5FU6C 3M5AA 1Q81U 4E7SA 4OMLA 3HRTA 1M5Q1 2CZ6B 2NYSA 2F2WA 1WZOA 2JM8A 3CCMT 3EG9B 3SFMA 1T3LA 1VQOA 2EGEA 5D6YA 2VXFA 2GBQA 1TUCA 2DRKA 4E7JA 2V8IA 5IH2A 2JS2A 1X6BA 4WF2A 1VQLT 3TREA 4CC2A
chains in the Genus database with same CATH topology
2ENMA 2KROA 2K6DA 2DNUA 4J9EA 3ULRB 4LN2A 4M4ZA 4OMOA 2KBTA 2BZYA 1W1FA 1H92A 1HD3A 2ESWA 2EVRA 1QKWA 2JTEA 1GFDA 1WXBA 5IHNA 1G2BA 2FPEA 1PNJA 3EG2A 1ZUUA 1UE9A 1VYUA 2YDLA 1NEGA 2LMJA 1KSWA 4LE9A 1A0NB 1M3BA 4K11A 1X2QA 2JW4A 3VRZA 1SRMA 2K2MA 2L3SA 4RUGA 1RI9A 1NG2A 2LZ6B 1JQQA 2KRNA 3SEMA 4FSSA 2EPDA 1WFWA 5GJVB 1CSKA 2ABLA 2ED0A 2DVJA 4DEYA 2JMCA 2O31A 2X3XD 1I07A 1UUEA 4J9CA 4J9IA 2OAWA 1UJYA 2J6OA 2DL4A 4OMNA 1GBQA 4JJCA 3TVTA 4AFSC 2D8HA 1H8KA 5IHKA 2C0IA 2D8JA 2CH4A 3UA6A 4D8KA 5FWCA 2J7IA 4HXJA 1N5ZA 2DILA 1ZSGA 1GCPA 1AWXA 2X3WD 1HJDA 2A36A 2IIMA 2I0NA 2J05A 3I9QA 1M8MA 2XMFA 2G6FX 2KYMA 5L23A 2EKHA 2DMOA 4KRTA 1YWPA 3M0TA 3VS2A 2LQNA 2VWFA 2W10A 2VVKA 3EG0A 2F2VA 4EIKA 2M0YA 4JJBA 2JS0A 2P4RA 1SRLA 1AOJA 3SHWA 1WA7A 3I5RA 2DX1A 4E6RA 4AG1C 1PKSA 4OMQA 2KE9A 2K9GA 4F17A 1ABQA 1Y0MA 1I1JA 2KGTA 4LNPA 3PE0A 4Y92A 1BB9A 2RQUA 1S1NA 4AFQC 2CH4W 2JXBA 1M3CA 2KXCA 1GBRA 2DA9A 1YN8A 3EG1A 3IQLA 1U5SA 2CSQA 2M51A 2L3PA 2ED1A 1HSQA 1YNZA 2QDLA 2O9SA 1BK2A 1UG1A 1QCFA 1ABOA 1B3QA 2DL5A 2K79A 1NEBA 4RTZA 3R6NA 2RQRA 1MV0B 2J06A 1J3TA 1Z9ZA 1ZUKA 4AG2C 1T0HA 1X43A 1T0JA 2L3QA 3QWYA 2ROTA 1GL5A 1UFFA 2YUQA 2YT6A 3NHNA 1WXUA 3KFVA 1QLYA 2J6KA 5ECAA 1MV3A 1UTIA 2DLPA 1K0XA 3ZL7C 2CDTA 2L0AA 2HDAA 4RTXA 5IXBA 2RNAA 1W6XA 1PKTA 1NYFA 2KT8A 4CC4B 1K4US 5I11A 4GBQA 4JPBW 4ESRA 2KRMA 1JXMA 4LUEA 4DEXA 2EYYA 5EC7A 4OMMA 1QKXA 1VA7A 3M0QA 3RNJA 4CC3A 3QWXX 1BBZA 2EGAA 3VS7A 2DBMA 1ZUYA 1WDXA 3EHRA 3H41A 1GRIA 2LCSA 1X2KA 2BZXA 3THKA 2V1QA 5IHIA 1AZEA 1RLQC 1ARKA 3VS5A 3M0UA 1X6GA 1SEMA 1KIKA 4Z89A 2EYXA 1SPKA 1JU5C 2HCKA 5GJWB 2F2XA 1UECA 1JEGA 2SEMA 3UA7A 1MUZA 2NUZA 1M30A 1PHTA 2CT4A 1ZX6A 2RN8A 2W0ZA 3REAB 2LJ1A 1ZBJA 2J6FA 1GCQC 3NPFA 1TUDA 3JV3A 4AFZC 2LJ0A 3EG3A 3VS4A 1VYTA 2RQWA 1K76A 3PVQA 2DE0X 3M0PA 1NLOC 2AZSA 1EFNA 2YSQA 4F14A 2JM9A 2HSPA 3UF4A 2BTTA 2HEQA 3H0IA 2LP5A 1WLPB 1I0CA 1OV3A 2RQVA 3FJ5A 3GBQA 1TG0A 2KXDA 4WCIA 1E7OA 1NM7A 2RMOA 2CUDA 2K7AA 2YUOA 1IO6A 2D0NA 4D8DA 2JT4A 4QT7A 2FRYA 1W70A 1K9AA 2FG0A 5FW9A 1OPLA 1M3AA 2CSIA 1KJWA 2B86A 1OPKA 3O5ZA 1V1CA 5FWBA 1Z9QA 2LNHB 2MOXA 1G83A 4OMPA 3EHQA 1XOVA 3VRYA 2CUBA 1RLPC 1AVZC 1T3SA 3I5SA 1CKBA 2DRMA 2GGRA 2FO0A 4Z88A 4HVWA 5I22A 2DL8A 2AKKA 1AD5A 2A08A 1NLPC 1Y57A 1YCSB 4JZ4A 3A98A 2OJ2A 4RTYA 3NMZC 3VS3A 2FPFA 2RQTA 2AZVA 1SSHA 1PRMC 2EYZA 2KYBA 2GTOA 1RUWA 2KT1A 2GNCA 3C0CA 1FYNA 2EYWA 2DL7A 1LCKA 4J9GA 2RF0A 3VS1A 1X27A 4ZNXA 1YWOA 2KRSA 2GTJA 4J9DA 3H0FA 3TSZA 3M0RA 5HCKA 2EBPA 2O9VA 2H8HA 3RBBB 2JMAA 1AZGB 2A37A 1AWWA 1UHFA 1WYXA 1KFZA 4HVVA 1AEYA 2FEIA 1E6GA 2CT3A 2EGCA 2YUNA 3I35A 1BU1A 4J9BA 2FRWA 2C0TA 2CREA 2L2PA 2PTKA 2PZ1A 2LX7A 3H0HA 4IIOA 1B07A 1YP5A 2LJ3A 4R0KA 3CQTA 1UDLA 2DM1A 4HVUA 3VS0A 1WI7A 4ORZA 4GLMA 2E5KA 1K1ZA 3REBB 2DJQA 2ROLA 2O88A 3VS6A 1ZLMA 2KEAA 2C0OA 2ECZA 1QWEA 1UHCA 2D1XA 2HBWA 1WIEA 1NYGA 4JJDA 1U06A 4IIMA 1WX6A 4RTVA 3UATA 2KNBB 2DYBA 4RTWA 2RPNA 1AWOA 1AWJA 2DL3A 1SHGA 2DF6A 1U3OA 1WXTA 4Z8AA 2NWMA 4RTUA 4RTTA 3M0SA 1FMKA 1JXOA 1H3HA 2EW3A 1JO8A 1PRLC 1UGVA 1X69A 5IXFA 1GFCA 1SHFA 2AK5A 3NGPA 2MCNA 1UJ0A 2SRCA 2KR3A 1CKAA 1OEBA 4AFUC 2O2OA 4A63B 4X1VA 2EQIA 3U23A 1GCQA 2PNIA 4F16A 2AKLA 4J9FA 2YUPA 4OMLA 2A28A 3TSWA 4LUDA 2MIOA 1PWTA 2DBKA 4HCKA 2F2WA 1E6HA 2GQIA 2LQWA 2JM8A 4JZ3A 1M27C 1T3LA 2EGEA 1QWFA 2BZ8A 2GBQA 4CC7A 1TUCA 3PVLA 2V1RA 3EGUA 2DRKA 2OI3A 5IH2A 2VKNA 2JS2A 2FPDA 1X6BA 1OOTA 1VYVA 1K0SA 3LH5A 2K3BA 4CC2A 4J9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENM A;  2KRO A;  2K6D A;  2DNU A;  4J9E A;  3ULR B;  4LN2 A;  4M4Z A;  4OMO A;  2KBT A;  2BZY A;  1W1F A;  1H92 A;  1HD3 A;  2ESW A;  2EVR A;  1QKW A;  2JTE A;  1GFD A;  1WXB A;  5IHN A;  1G2B A;  2FPE A;  1PNJ A;  3EG2 A;  1ZUU A;  1UE9 A;  1VYU A;  2YDL A;  1NEG A;  2LMJ A;  1KSW A;  4LE9 A;  1A0N B;  1M3B A;  4K11 A;  1X2Q A;  2JW4 A;  3VRZ A;  1SRM A;  2K2M A;  2L3S A;  4RUG A;  1RI9 A;  1NG2 A;  2LZ6 B;  1JQQ A;  2KRN A;  3SEM A;  4FSS A;  2EPD A;  1WFW A;  5GJV B;  1CSK A;  2ABL A;  2ED0 A;  2DVJ A;  4DEY A;  2JMC A;  2O31 A;  2X3X D;  1I07 A;  1UUE A;  4J9C A;  4J9I A;  2OAW A;  1UJY A;  2J6O A;  2DL4 A;  4OMN A;  1GBQ A;  4JJC A;  3TVT A;  4AFS C;  2D8H A;  1H8K A;  5IHK A;  2C0I A;  2D8J A;  2CH4 A;  3UA6 A;  4D8K A;  5FWC A;  2J7I A;  4HXJ A;  1N5Z A;  2DIL A;  1ZSG A;  1GCP A;  1AWX A;  2X3W D;  1HJD A;  2A36 A;  2IIM A;  2I0N A;  2J05 A;  3I9Q A;  1M8M A;  2XMF A;  2G6F X;  2KYM A;  5L23 A;  2EKH A;  2DMO A;  4KRT A;  1YWP A;  3M0T A;  3VS2 A;  2LQN A;  2VWF A;  2W10 A;  2VVK A;  3EG0 A;  2F2V A;  4EIK A;  2M0Y A;  4JJB A;  2JS0 A;  2P4R A;  1SRL A;  1AOJ A;  3SHW A;  1WA7 A;  3I5R A;  2DX1 A;  4E6R A;  4AG1 C;  1PKS A;  4OMQ A;  2KE9 A;  2K9G A;  4F17 A;  1ABQ A;  1Y0M A;  1I1J A;  2KGT A;  4LNP A;  3PE0 A;  4Y92 A;  1BB9 A;  2RQU A;  1S1N A;  4AFQ C;  2CH4 W;  2JXB A;  1M3C A;  2KXC A;  1GBR A;  2DA9 A;  1YN8 A;  3EG1 A;  3IQL A;  1U5S A;  2CSQ A;  2M51 A;  2L3P A;  2ED1 A;  1HSQ A;  1YNZ A;  2QDL A;  2O9S A;  1BK2 A;  1UG1 A;  1QCF A;  1ABO A;  1B3Q A;  2DL5 A;  2K79 A;  1NEB A;  4RTZ A;  3R6N A;  2RQR A;  1MV0 B;  2J06 A;  1J3T A;  1Z9Z A;  1ZUK A;  4AG2 C;  1T0H A;  1X43 A;  1T0J A;  2L3Q A;  3QWY A;  2ROT A;  1GL5 A;  1UFF A;  2YUQ A;  2YT6 A;  3NHN A;  1WXU A;  3KFV A;  1QLY A;  2J6K A;  5ECA A;  1MV3 A;  1UTI A;  2DLP A;  1K0X A;  3ZL7 C;  2CDT A;  2L0A A;  2HDA A;  4RTX A;  5IXB A;  2RNA A;  1W6X A;  1PKT A;  1NYF A;  2KT8 A;  4CC4 B;  1K4U S;  5I11 A;  4GBQ A;  4JPB W;  4ESR A;  2KRM A;  1JXM A;  4LUE A;  4DEX A;  2EYY A;  5EC7 A;  4OMM A;  1QKX A;  1VA7 A;  3M0Q A;  3RNJ A;  4CC3 A;  3QWX X;  1BBZ A;  2EGA A;  3VS7 A;  2DBM A;  1ZUY A;  1WDX A;  3EHR A;  3H41 A;  1GRI A;  2LCS A;  1X2K A;  2BZX A;  3THK A;  2V1Q A;  5IHI A;  1AZE A;  1RLQ C;  1ARK A;  3VS5 A;  3M0U A;  1X6G A;  1SEM A;  1KIK A;  4Z89 A;  2EYX A;  1SPK A;  1JU5 C;  2HCK A;  5GJW B;  2F2X A;  1UEC A;  1JEG A;  2SEM A;  3UA7 A;  1MUZ A;  2NUZ A;  1M30 A;  1PHT A;  2CT4 A;  1ZX6 A;  2RN8 A;  2W0Z A;  3REA B;  2LJ1 A;  1ZBJ A;  2J6F A;  1GCQ C;  3NPF A;  1TUD A;  3JV3 A;  4AFZ C;  2LJ0 A;  3EG3 A;  3VS4 A;  1VYT A;  2RQW A;  1K76 A;  3PVQ A;  2DE0 X;  3M0P A;  1NLO C;  2AZS A;  1EFN A;  2YSQ A;  4F14 A;  2JM9 A;  2HSP A;  3UF4 A;  2BTT A;  2HEQ A;  3H0I A;  2LP5 A;  1WLP B;  1I0C A;  1OV3 A;  2RQV A;  3FJ5 A;  3GBQ A;  1TG0 A;  2KXD A;  4WCI A;  1E7O A;  1NM7 A;  2RMO A;  2CUD A;  2K7A A;  2YUO A;  1IO6 A;  2D0N A;  4D8D A;  2JT4 A;  4QT7 A;  2FRY A;  1W70 A;  1K9A A;  2FG0 A;  5FW9 A;  1OPL A;  1M3A A;  2CSI A;  1KJW A;  2B86 A;  1OPK A;  3O5Z A;  1V1C A;  5FWB A;  1Z9Q A;  2LNH B;  2MOX A;  1G83 A;  4OMP A;  3EHQ A;  1XOV A;  3VRY A;  2CUB A;  1RLP C;  1AVZ C;  1T3S A;  3I5S A;  1CKB A;  2DRM A;  2GGR A;  2FO0 A;  4Z88 A;  4HVW A;  5I22 A;  2DL8 A;  2AKK A;  1AD5 A;  2A08 A;  1NLP C;  1Y57 A;  1YCS B;  4JZ4 A;  3A98 A;  2OJ2 A;  4RTY A;  3NMZ C;  3VS3 A;  2FPF A;  2RQT A;  2AZV A;  1SSH A;  1PRM C;  2EYZ A;  2KYB A;  2GTO A;  1RUW A;  2KT1 A;  2GNC A;  3C0C A;  1FYN A;  2EYW A;  2DL7 A;  1LCK A;  4J9G A;  2RF0 A;  3VS1 A;  1X27 A;  4ZNX A;  1YWO A;  2KRS A;  2GTJ A;  4J9D A;  3H0F A;  3TSZ A;  3M0R A;  5HCK A;  2EBP A;  2O9V A;  2H8H A;  3RBB B;  2JMA A;  1AZG B;  2A37 A;  1AWW A;  1UHF A;  1WYX A;  1KFZ A;  4HVV A;  1AEY A;  2FEI A;  1E6G A;  2CT3 A;  2EGC A;  2YUN A;  3I35 A;  1BU1 A;  4J9B A;  2FRW A;  2C0T A;  2CRE A;  2L2P A;  2PTK A;  2PZ1 A;  2LX7 A;  3H0H A;  4IIO A;  1B07 A;  1YP5 A;  2LJ3 A;  4R0K A;  3CQT A;  1UDL A;  2DM1 A;  4HVU A;  3VS0 A;  1WI7 A;  4ORZ A;  4GLM A;  2E5K A;  1K1Z A;  3REB B;  2DJQ A;  2ROL A;  2O88 A;  3VS6 A;  1ZLM A;  2KEA A;  2C0O A;  2ECZ A;  1QWE A;  1UHC A;  2D1X A;  2HBW A;  1WIE A;  1NYG A;  4JJD A;  1U06 A;  4IIM A;  1WX6 A;  4RTV A;  3UAT A;  2KNB B;  2DYB A;  4RTW A;  2RPN A;  1AWO A;  1AWJ A;  2DL3 A;  1SHG A;  2DF6 A;  1U3O A;  1WXT A;  4Z8A A;  2NWM A;  4RTU A;  4RTT A;  3M0S A;  1FMK A;  1JXO A;  1H3H A;  2EW3 A;  1JO8 A;  1PRL C;  1UGV A;  1X69 A;  5IXF A;  1GFC A;  1SHF A;  2AK5 A;  3NGP A;  2MCN A;  1UJ0 A;  2SRC A;  2KR3 A;  1CKA A;  1OEB A;  4AFU C;  2O2O A;  4A63 B;  4X1V A;  2EQI A;  3U23 A;  1GCQ A;  2PNI A;  4F16 A;  2AKL A;  4J9F A;  2YUP A;  4OML A;  2A28 A;  3TSW A;  4LUD A;  2MIO A;  1PWT A;  2DBK A;  4HCK A;  2F2W A;  1E6H A;  2GQI A;  2LQW A;  2JM8 A;  4JZ3 A;  1M27 C;  1T3L A;  2EGE A;  1QWF A;  2BZ8 A;  2GBQ A;  4CC7 A;  1TUC A;  3PVL A;  2V1R A;  3EGU A;  2DRK A;  2OI3 A;  5IH2 A;  2VKN A;  2JS2 A;  2FPD A;  1X6B A;  1OOT A;  1VYV A;  1K0S A;  3LH5 A;  2K3B A;  4CC2 A;  4J9H A; 
#chains in the Genus database with same CATH topology
 2ENM A;  2KRO A;  4M78 A;  2NUT A;  4J9E A;  4QQ6 A;  3EGX A;  3M59 A;  4OMO A;  3OYM A;  1SG5 A;  2KBT A;  1HD3 A;  2O4X A;  2BKD N;  2ESW A;  2BE9 B;  4JJN K;  1QKW A;  1GFD A;  1OU9 A;  1WXB A;  3X20 B;  3OS1 A;  4BAC A;  1C1A A;  4M7A B;  2FPE A;  4M77 G;  1PNJ A;  3CC2 A;  2QEX T;  1NEG A;  2A7Y A;  3MCA B;  2LT1 A;  4NL3 A;  4J8O A;  4DBQ A;  3VRZ A;  1SRM A;  2K2M A;  5I21 A;  2KRN A;  4MMK A;  4FSS A;  3CCE Q;  1BYM A;  3CCV A;  2EPD A;  2COW A;  3G1J A;  1FMW A;  3MO8 A;  2JMC A;  1RAD B;  1UUE A;  3ER0 A;  5HY6 A;  2CYZ B;  1IXD A;  2VUB A;  5J3B A;  1UJY A;  2DKG A;  2J6O A;  2D9T A;  3KBG A;  1I5O B;  2MPX C;  2ZAE A;  5KCO A;  3QSU A;  2PU9 B;  3M4Y A;  3SWN C;  5IHK A;  2C0I A;  2D8J A;  2MMP A;  4IUR A;  1Y96 A;  2DIL A;  3V8K A;  2K3X A;  5GAO m;  1ZSG A;  3CXC S;  2X3W D;  4X9C A;  1HJD A;  2DAQ A;  3TEE A;  2I0N A;  3KXT A;  2J05 A;  3P8D A;  1BCO A;  3CC4 Q;  2EKH A;  1I81 A;  1M90 U;  4F7U F;  3VU3 C;  1VQ8 Q;  2W10 A;  4NL2 A;  2KMT A;  2EWN A;  2YLC A;  1SRL A;  1R0C B;  3SHW A;  2VAS A;  3G71 A;  3X24 B;  2KDS A;  4AG1 C;  3CCU Q;  1ABQ A;  1M1G A;  2RI3 A;  1Y0M A;  1YIT Q;  2KGT A;  3PE0 A;  1QVP A;  1KD1 C;  1S1N A;  2JXB A;  4LDV A;  5GAO p;  4JRK A;  2VXE A;  2R57 A;  1GBR A;  4RKU E;  5GAN 4;  3CCL T;  4MZT A;  1U5S A;  3A8G B;  1VQ7 T;  3CPF A;  4ZN3 A;  1YJW T;  3R6O A;  2ED1 A;  2QDL A;  2O9S A;  1UG1 A;  1NPP A;  3EFR A;  1QCF A;  2XID A;  2RM4 A;  3OYL A;  1MV0 B;  1J3T A;  4F04 B;  2RHX A;  3OYE A;  4AMC A;  1LPL A;  3VYG A;  1VQ9 Q;  2MYS A;  4M7D E;  2HKN A;  2R5A A;  3QBY A;  2LQK A;  1WNL A;  2ROT A;  4A4H A;  1GL5 A;  2NUT B;  5LL6 S;  3KFV A;  4LD9 K;  3I55 Q;  2J6K A;  5ECA A;  1K0X A;  1WJR A;  2O4X B;  3ZL7 C;  1M90 C;  2L0A A;  2VGM A;  4BB7 A;  4FYX B;  5IXB A;  2ZPG B;  3DLM A;  3SDZ A;  5GMK h;  4GBQ A;  1BIA A;  4QQG A;  3CBM A;  2KRM A;  2M0O A;  3RUX A;  4FIB A;  2OTJ Q;  3CME A;  5J26 A;  1BBZ A;  4ELY C;  1Q82 R;  2ZZD A;  3EHR A;  1VQ4 T;  2QGF B;  3L2V A;  3H41 A;  4OVA A;  4JDS A;  3JCM Q;  1X2K A;  2EJ9 A;  5IHI A;  4N0A C;  3LGL A;  1D1C A;  4MZP A;  4A53 A;  2K5L A;  5GAM d;  2EYQ A;  2E12 A;  3JB9 D;  3A8H B;  1KIK A;  2QA4 A;  2EYX A;  5CAI A;  1G3S A;  2HCK A;  4PKC C;  5DLQ E;  3JCM V;  2SEM A;  4M7D C;  1Y96 B;  1KC8 U;  1VQ5 A;  2KI7 A;  2W0Z A;  2QQR A;  3CCQ T;  1ZBJ A;  3GF5 A;  2J6F A;  2CZ0 B;  4KBM B;  1UEB A;  4PJM A;  4AFZ C;  4IUU A;  4C92 D;  3EG3 A;  1YJN Q;  2RQW A;  3PVQ A;  2DE0 X;  5GMK e;  2D6F A;  4OB0 B;  1QVF P;  1EFN A;  2YSQ A;  2HMA A;  3OYG A;  4BY6 C;  4BE2 A;  2HEQ A;  2CP0 A;  3SWN A;  1WLP B;  4BE0 A;  4RCB A;  1VQP T;  1OV3 A;  2DIG A;  2RQV A;  3FJ5 A;  3HHT B;  5CIU A;  3JCM c;  2HQE A;  2FRY A;  1VQO Q;  1W70 A;  3EGD B;  2CZ1 B;  1X01 A;  1GXI E;  2DIQ A;  1OPL A;  4KH1 B;  1Q95 G;  3QII A;  5KYN A;  2DD5 A;  1OPK A;  3RES A;  2VYT A;  3OSS C;  3H9N A;  3JCM W;  3MET A;  1KQS S;  4QW2 A;  2G3R A;  4EMK A;  1RLP C;  4XTX A;  1AVZ C;  1T3S A;  2JOY A;  2LDM A;  4M75 F;  4XTZ A;  4PJO F;  2M02 A;  3WVD B;  4M75 D;  3RDV A;  1AD5 A;  1IHW A;  2A08 A;  4PJO D;  1YCS B;  2JJ9 A;  1NJI R;  3A98 A;  2PUK B;  4J5Y A;  3VS3 A;  3ZFJ A;  3CC2 Q;  1SSH A;  2KYB A;  3GNG A;  3S3M A;  2KK4 A;  3LLR A;  1FYN A;  1V29 B;  2EYW A;  3VJP A;  1BKB A;  1X27 A;  4ZNX A;  5IT9 E;  4O6J A;  1YJ9 A;  1BI1 A;  3PMT A;  3G4S A;  3CCV Q;  5HCK A;  2AIR B;  1W4S A;  8ATC B;  1M9S A;  3RBB B;  3M4G A;  5CQY A;  2WSE E;  5GMK l;  1NZ9 A;  3OB9 A;  1HXD A;  4J6Y A;  1B34 B;  3CCJ A;  3JB9 G;  2KY9 A;  2E6Z A;  2IVW A;  2OTL A;  3OBW A;  2CT3 A;  3OY9 A;  1YI2 A;  1TWB A;  3G7Z A;  1VQN T;  1IRX A;  4J9B A;  3S3O A;  3MEA A;  2YHT A;  2QTV A;  5GAN j;  1W2B A;  4XAX B;  5GAN f;  1TH7 A;  3H0H A;  2MAM A;  3EFO A;  3BFM A;  4R0K A;  1ZSZ C;  1UDL A;  4C92 G;  2DM1 A;  3JCM P;  3FC3 A;  3VS0 A;  3QJ6 A;  4BUG A;  2Y4Y A;  2JTM A;  4B9W A;  4EMG A;  2QQB A;  4ORZ A;  5KE2 A;  3REB B;  1UGP B;  3DKM A;  3NFC A;  3PGG A;  2L89 A;  2ROL A;  4PJN A;  3CXC A;  2C0O A;  1K8A R;  1UHC A;  3EFS A;  1WIE A;  3PT9 A;  5GAM h;  1QP3 A;  2F1L A;  3WXM B;  4PJL A;  3CC7 Q;  3I56 T;  1AWO A;  2DL3 A;  2PQW A;  1WXT A;  3JB9 J;  2DYI A;  4N0A A;  1PD0 A;  2IPO B;  1FMK A;  1VQM A;  2DEU A;  5KYU A;  3RMQ A;  1PRL C;  1UGV A;  1X69 A;  4QKU A;  5IXF A;  1GFC A;  1M8V A;  3SWN B;  2AK5 A;  3NGP A;  2EAY A;  2KR3 A;  2QGG A;  5LJ5 d;  4M7D A;  2EQI A;  4FW1 A;  3J81 E;  1SKU B;  2PNI A;  3FDR A;  3LX7 A;  4CI0 C;  2H3E B;  5IAY A;  2AKL A;  2CP2 A;  1D1A A;  2A28 A;  2MIO A;  1IGU A;  2DBK A;  4HCK A;  3TQ7 P;  3O8V A;  4ZTJ A;  4JZ3 A;  4VUB A;  1M27 C;  1OQK A;  5GAO q;  3CCM A;  5I2S A;  1QWF A;  4EMK B;  3CEY A;  2RI2 A;  3PVL A;  2V1R A;  1PD1 A;  2CP6 A;  2OI3 A;  2VKN A;  3OYH A;  2FPD A;  1OOT A;  1Y7X A;  4JUV A;  4AFQ C;  5GAM e;  1VQL A;  4XTY A;  1G8X A;  2K57 A;  3JCM f;  4C8Q G;  3M56 A;  4F7U E;  3ULR B;  4OF1 A;  4M7A D;  4ELZ C;  2BZY A;  1W1F A;  4HKE A;  4ZGD B;  3HRU A;  2OAU A;  4J7F A;  5CCA A;  3CME Q;  2HD0 A;  3VUB A;  5IHN A;  2QAZ A;  1D0Z A;  1ZUU A;  1RAI B;  1M1K C;  2QEX A;  3OYA A;  4M77 F;  1X2Q A;  2JW4 A;  2Y90 A;  1N8R C;  4M77 D;  3OQ5 A;  2DPP B;  2QA4 Q;  5GJV B;  2R5M A;  2DVJ A;  5HK3 A;  2O31 A;  2X3X D;  1X6O A;  4J9I A;  2OAW A;  1LOJ A;  4C0Z A;  1VQ5 Q;  5D7U A;  1RI0 A;  1C6V X;  2CKK A;  2COZ A;  2D8H A;  2RHY A;  1H8K A;  2Y4X A;  3LW5 E;  4XQ3 A;  2CH4 A;  3GP8 A;  1K9M C;  8AT1 B;  1N5Z A;  2L8D A;  3JRZ A;  3E9F A;  1GCP A;  2X51 A;  5CVI A;  4FYV B;  3FIF A;  3I9Q A;  1Q86 C;  2YRC A;  2X4W A;  4KRT A;  4UC4 A;  2ZPE B;  1PM3 A;  2BUD A;  2LQN A;  3V8J A;  3KUF A;  1QQJ A;  2VWF A;  1PG5 B;  1ZSZ A;  2VVK A;  2F2V A;  4RG2 A;  1M4Z A;  2E3H A;  3EAE A;  1Q82 U;  3I5R A;  2DX1 A;  2KSS A;  3MKD A;  2K3Y A;  1PKS A;  1IRE B;  5L8R E;  4OMQ A;  2V26 A;  2QXF A;  2K9G A;  4F17 A;  2IG0 A;  2F5K A;  1ACM B;  2KVQ G;  4M7D B;  1WHL A;  1VQ8 T;  1O75 A;  3FRN A;  4D6W A;  1QCN A;  1V76 A;  2LRQ A;  6AT1 B;  2DA9 A;  3CCL A;  4BI4 A;  2CSQ A;  1NPR A;  3OW2 P;  2K2V A;  5LJ5 h;  1KQS A;  4M7A G;  2L3P A;  3QDR B;  1VQ7 A;  3CCS T;  1YJW A;  1YNZ A;  3Q1J A;  1YIT T;  2LT4 A;  1ABO A;  5GAM g;  3R6N A;  2NUP B;  2DXC A;  1BIB A;  7AT1 B;  1YJ9 Q;  1VOM A;  1T0H A;  3F70 A;  2RK1 A;  3OS0 A;  1X43 A;  3OYY A;  3RKX A;  2L3Q A;  2XG8 D;  1KG1 A;  1UFF A;  2YT6 A;  1WXU A;  3E9G A;  4A4E A;  1MV3 A;  3OYD A;  4IUP A;  3CCJ Q;  1OZ2 A;  1YHQ T;  2HDA A;  4RTX A;  2RNA A;  2VV5 A;  1PKT A;  1NYF A;  2KT8 A;  4L6V 5;  4HT8 A;  5I11 A;  4JPB W;  4MDX A;  2BE7 D;  1JXM A;  1XNI A;  1QKX A;  1W2B S;  1C0M A;  5A0L A;  2DXB A;  3QWX X;  5GAO n;  2EGA A;  3VS7 A;  1OI1 A;  1Q81 C;  1WDX A;  5LJ5 e;  4FL6 A;  1VQ4 A;  2LCS A;  1WJQ A;  1VQK Q;  2LCL A;  5LJ3 d;  4LDY A;  4BI3 A;  1NJI U;  4ZGE B;  4M75 E;  1K73 R;  1ARK A;  4PJO E;  1WHK A;  4C92 C;  1SPK A;  3CBP A;  5HK0 A;  5GAN 3;  3QKJ A;  3D7S B;  1JEG A;  1MUZ A;  1PHT A;  2CT4 A;  3A1P A;  1ZX6 A;  5CKD A;  2RN8 A;  3REA B;  2LJ1 A;  3CCQ A;  2RO0 A;  4XU2 A;  3VS4 A;  2DO3 A;  1MMA A;  1K76 A;  3M0P A;  3JCM J;  4E7Z A;  4F14 A;  4XU1 A;  1ZSZ B;  3UF4 A;  3H0I A;  4MDW A;  3P8H A;  2XDD A;  4C0D C;  1VQP A;  4NS5 A;  4F7U A;  1Y71 A;  1QVF S;  3JB9 I;  1Q86 R;  4D8D A;  4PNO A;  3CCM Q;  2FZK B;  4DOV A;  4M78 G;  1NE8 A;  4DQ2 A;  1JRI A;  2QQ9 A;  3OMG A;  4M75 C;  4DBR A;  3S3N A;  1TU0 B;  3CCR T;  5LJ3 j;  1WGS A;  4PJO C;  4E7I A;  1V1C A;  1Z9Q A;  3EH1 A;  1VQL Q;  5LJ3 f;  2MOX A;  4KH0 B;  4RG8 A;  2E64 A;  1K8A U;  1MMG A;  2P0Q A;  4C5I A;  1QVG S;  2DRM A;  1YIJ T;  2GGR A;  4HVW A;  5I22 A;  2XIC A;  2JNG A;  1NLP C;  2EJF A;  2OJ2 A;  4M78 B;  4FM4 B;  3EGX B;  3NTK A;  4IUV A;  1PRM C;  2EYZ A;  2ATC B;  2GTO A;  2KT1 A;  2GNC A;  3C0C A;  1RAB B;  3FB9 A;  2QEX Q;  1ZA2 B;  2DL7 A;  2EQM A;  1MND A;  2KRS A;  5FU7 C;  2P84 A;  1QMC A;  2RHU A;  1P92 A;  3LGF A;  3M0R A;  2F69 A;  2PUO B;  2M9U A;  2CGH A;  3TU4 K;  2GQV A;  1AZG B;  3RIR A;  2A37 A;  1AWW A;  1WYX A;  2HZY A;  3RKY A;  1AEY A;  1XTD A;  4BE1 A;  2RD1 A;  2C0T A;  1VQN A;  1H64 1;  2P0P A;  3JB9 F;  2L2P A;  1PCX A;  2PZ1 A;  1N27 A;  2RJF A;  2LJ3 A;  3GIB A;  3CQT A;  5FLX E;  1JB0 E;  1KHC A;  3A5Z B;  4GLM A;  3CXC P;  2E5K A;  2ZCF B;  3AT1 B;  5CKH A;  1BI3 A;  4J6X A;  4C92 F;  2DZ9 A;  2RHZ A;  2O88 A;  2KEA A;  3C4S A;  3HSB A;  1QWE A;  3X28 B;  2HBW A;  4JJD A;  1U06 A;  1WX6 A;  4RTV A;  1Q7Y U;  4RTW A;  5GAN 7;  4XU3 A;  3OYF A;  4EMH A;  3I56 A;  1QW1 A;  4RTT A;  4X9D A;  2DET A;  1VIE A;  1H3H A;  2RA2 A;  4XK8 E;  1JO8 A;  1LVK A;  2X9H A;  3CPW S;  1S72 T;  1U1T A;  3CD6 T;  4M77 E;  4C92 A;  2VC8 A;  1OEB A;  3CCL Q;  3TCJ A;  4JS4 A;  3CC7 T;  2WSF E;  4F7U B;  1VQ7 Q;  2AT1 B;  1YJW Q;  4PL6 A;  5GAN d;  2XDB A;  1ZA1 B;  1HK9 A;  3ZBD A;  2GCX A;  2E3I A;  1TSF A;  3V8L A;  3TSW A;  4LUD A;  4CRI A;  1PWT A;  4C0F A;  2GQI A;  2X4X A;  4E7L A;  2A3L A;  4WTO B;  2HQH A;  2ZGW A;  1KD1 R;  3INZ A;  3JCM X;  1VYV A;  1KC8 C;  3LH5 A;  1K0S A;  5FU6 B;  2K6D A;  2JUF A;  3G6E T;  3BW1 A;  1RAH B;  3OS2 A;  4LN2 A;  3LH0 A;  4M4Z A;  4M75 A;  2HSE B;  4PJO A;  4OB1 B;  1Q7Y C;  3QUI A;  5KYY A;  1M1F A;  4C8Q F;  4M77 C;  1TXQ A;  1PSF A;  2QG9 B;  1R0B G;  1AT1 B;  2QK0 A;  4C8Q D;  5A0D A;  3VV0 A;  4LD6 A;  2LMJ A;  1KSW A;  1VQ4 Q;  2YXY A;  4LE9 A;  5AT1 B;  1A0N B;  3HFO A;  2L3S A;  1NG2 A;  2LZ6 B;  4E7H A;  1JQQ A;  1M90 R;  4EPC A;  5KYW A;  1TUG B;  3SEM A;  1VQ6 T;  2QI2 A;  1WFW A;  1R8O B;  3HTR A;  2MK5 A;  2ABL A;  2LVM A;  4KT0 E;  4ZGJ B;  3QO3 A;  1MNE A;  3X25 B;  4DEY A;  1WHG A;  4J9C A;  4ZTF A;  2DL4 A;  3TVT A;  3CCQ Q;  2LNV A;  4AFS C;  1EIF A;  1VIF A;  3DB3 A;  3JCM d;  4IUT A;  3UA6 A;  4D8K A;  3UPU A;  1I8F A;  2J7I A;  4HXJ A;  5DY9 A;  3G71 Q;  3ZEH A;  1AWX A;  2A36 A;  4ATO A;  4R55 A;  3OYC A;  3CMA T;  4IKF A;  4N4I A;  4JLG A;  3FLG A;  3HFN A;  5L23 A;  1D1B A;  2DMO A;  1RAG B;  1YWP A;  4J6W A;  3VS2 A;  1VQP Q;  3OYI A;  3EG0 A;  2COY A;  1JBM A;  3GOX A;  4JJB A;  4HCC A;  1M2V A;  1SSF A;  1WA7 A;  2BIV A;  4JS5 A;  3MP8 A;  2KE9 A;  4HCZ A;  4C0G A;  1KHI A;  2RK2 A;  1M2O A;  4LNP A;  1QVF A;  1K73 U;  1BB9 A;  1FMV A;  1Y07 A;  2K4Y A;  3HRS A;  1JJ2 S;  1VQ8 A;  1KQS P;  2DTI A;  1M3C A;  2EQK A;  2QTX A;  3EG1 A;  4XTV A;  4II1 A;  1IHV A;  2O01 E;  3CCS A;  2QDY B;  1QVG A;  1YIT A;  5GAN h;  1SF9 A;  5J39 A;  2DL5 A;  1NEB A;  4RTZ A;  2A0F B;  1WQW A;  4M7A F;  4RMO A;  1G5V A;  4C0D B;  1H3Z A;  1O9S A;  3PTA A;  4AG2 C;  5GAO l;  1T0J A;  3AHU A;  4KUI A;  4OGC A;  4OMF B;  1OYX A;  4QVZ A;  4C5G A;  4M75 B;  1UTI A;  2DLP A;  4QVD A;  5C0M A;  2CDT A;  5DM7 R;  1YHQ A;  3M53 A;  4EDU A;  3C12 A;  4CC4 B;  4P5N A;  4PLL A;  1K4U S;  4DBH A;  1VQN Q;  3E1S A;  2P0K A;  3OS5 A;  2X35 A;  3HKS A;  3DB4 A;  2RJC A;  1X75 C;  4ESR A;  4LUE A;  4HCB A;  4OMM A;  1VA7 A;  3QYG B;  4CC3 A;  1FXX A;  4HA8 A;  2DBM A;  1ZUY A;  1RL2 A;  4PLI A;  1IGQ A;  4DA4 A;  1GRI A;  1WHJ A;  3EFO B;  3THK A;  2BZX A;  2V1Q A;  1AZE A;  5GAN e;  4M77 A;  4ME7 A;  1RLQ C;  3MEU A;  3VS5 A;  9ATC B;  3M0U A;  4NOY A;  3CCE T;  2DXU A;  1X6G A;  4A54 A;  1FX7 A;  2OTJ A;  4FYY B;  1JU5 C;  3MJX A;  4O5V A;  5GJW B;  1UEC A;  3I56 Q;  4BI8 B;  2NUZ A;  1M30 A;  2E5Q A;  4M7D G;  1VQK T;  1GCQ C;  2HBP A;  2KAF A;  3UDC A;  3JV3 A;  2XU8 A;  2LJ0 A;  2GFU A;  1VYT A;  3JCM h;  1NLO C;  2AZS A;  4IUQ A;  4PFZ A;  5KYU B;  2JVV A;  3SB2 A;  1BCM A;  3CC4 T;  5GMK m;  3CPW A;  1M2V B;  1I0C A;  3GBQ A;  2KXD A;  4WCI A;  1E7O A;  4KGV B;  2RMO A;  2D0N A;  2CZ7 B;  2JT4 A;  4PFP A;  3BDL A;  2ZPI B;  2XHC A;  5FW9 A;  5CKE A;  3M54 A;  3M58 A;  3CCU T;  5GAO r;  3OYJ A;  3O5Z A;  1TTH B;  3H6Z A;  3CCR A;  2E1H A;  2LNH B;  4BY6 B;  3HL8 A;  4M78 F;  1G83 A;  4OMP A;  3EHQ A;  5D6X A;  3LWI A;  4M78 D;  3I5S A;  3JB9 H;  4C92 E;  1YIJ A;  4QQD A;  5M9O A;  2DL8 A;  2AKK A;  3G4S Q;  2XK0 A;  1Y57 A;  5FRM A;  2PVO B;  4RTY A;  3NMZ C;  2RQT A;  1F1B B;  2AZV A;  3JCM e;  3M55 A;  1RUW A;  2HAX A;  2FB7 A;  1UGR B;  3HP9 A;  1LCK A;  1RAE B;  4J9G A;  2OTL Q;  1ZHI A;  3VS1 A;  2OX7 A;  2LC4 A;  1YWO A;  5D6W A;  1YI2 Q;  3BY7 A;  1N6A A;  4FU6 A;  4JRQ A;  3TSZ A;  1VQ9 T;  2QQS A;  1Q82 C;  1EZZ B;  2O9V A;  5IN1 A;  2H8H A;  4FCY A;  2JMA A;  1AHJ B;  3I55 T;  1UHF A;  1KFZ A;  4HVV A;  1UB4 A;  2P4T A;  3H8Z A;  2EGC A;  3I35 A;  3OYK A;  1KD1 U;  1BU1 A;  2FRW A;  5GAN g;  4OGE A;  3J80 E;  4Y28 E;  5I2M A;  1M1K R;  4PJJ A;  2LX7 A;  2OTJ T;  1B07 A;  1YP5 A;  3OYB A;  1N8R R;  4M77 B;  4HVU A;  1OU8 A;  2LTO A;  1LNX A;  1K1Z A;  3GLX A;  2DJQ A;  5GAN 6;  1VQM Q;  2K5F A;  1U1S A;  3WVE B;  3RMS A;  2R58 A;  1NBE B;  1IB8 A;  3NTH A;  3MHX A;  2MF2 A;  1KQ1 A;  5A2Q E;  5GMK j;  3FEO A;  2HNI A;  3UAT A;  4J7I A;  4C8Q E;  1OX9 A;  2E4H A;  2M16 A;  1AWJ A;  2LCC A;  4OP0 A;  1K9M R;  4FT4 A;  1WJS A;  2KQW A;  4LDW A;  1MMN A;  3L2U A;  1JXO A;  2EW3 A;  4GLK A;  1S72 A;  1YJN T;  4PFO A;  3CD6 A;  4EMK C;  1SHF A;  2FL7 A;  1UJ0 A;  1WPY A;  1CKA A;  3A8O B;  4A63 B;  3LWH A;  3OSV A;  4X1V A;  4KGX B;  4XTU A;  3CC7 A;  3CCS Q;  1GCQ A;  1PC0 A;  2EFI A;  1JJ2 A;  1FWZ A;  3EGD A;  4F16 A;  2E70 A;  4J9F A;  4ANJ A;  2YUP A;  2X4Y A;  1NJI C;  1E6H A;  2LQW A;  4Y91 A;  1VQO T;  3ASK A;  3GNF B;  3L42 A;  2BZ8 A;  4CC7 A;  5CR2 A;  3EGU A;  4R56 A;  2K5I A;  3JCM g;  2K3B A;  4J9H A;  3OW2 A;  4FW2 A;  4XTW A;  3L1A A;  4QVC A;  5KCH A;  1YHQ Q;  2DNU A;  4C8Q C;  3N5B B;  3G6E A;  2QAS A;  2M1H A;  3M57 A;  2Z0W A;  2DEQ A;  1H92 A;  2L3R A;  4FSX A;  5FRO A;  2EVR A;  2MWO A;  2JTE A;  3LYI A;  3L2Z A;  3QZ5 B;  1G2B A;  3CC2 T;  3EG2 A;  1UE9 A;  1VYU A;  2YDL A;  3BDU A;  2LX9 A;  4PK4 A;  1W2B P;  4TVR A;  4B6M A;  5LJ5 g;  1M3B A;  3PIP A;  4K11 A;  4RUG A;  1RI9 A;  1B34 A;  1QCO A;  3OBY A;  3CCV T;  4C5E A;  1VQ6 A;  1CSK A;  4A4K A;  2L5Q A;  2ED0 A;  1N9R A;  4OB3 B;  1TS9 A;  1I07 A;  3RKW A;  1K8A C;  4OMN A;  1GBQ A;  1VUB A;  3MPU B;  4JJC A;  4MZM A;  2HL3 A;  1G3Y A;  2PVG B;  4M7A E;  5KH6 A;  1Q81 R;  5LJ3 h;  2XD0 A;  4B9X A;  5FWC A;  3BE3 A;  1MGQ A;  4F7U G;  1G3W A;  2CP7 A;  2IIM A;  5AYF A;  2DD4 A;  4GY5 A;  1M8M A;  2XMF A;  3DLL A;  2G6F X;  4DBF A;  3CMA A;  2KYM A;  4A4G A;  1RAA B;  4N4H A;  3M0T A;  2JTF A;  5GAN 8;  2QYZ A;  4LDX A;  3OYN A;  2RHI A;  2JN0 A;  1U8R A;  2RB6 A;  3PNW C;  4EIK A;  2FVU A;  2M0Y A;  1IZ6 A;  3VUZ A;  2JS0 A;  2V8J A;  1D3B A;  2E10 A;  2P4R A;  2ZPF B;  3G71 T;  3FJP A;  2DVE A;  1AOJ A;  3QG1 A;  3JSC A;  3QJY A;  4FYW B;  4E6R A;  2EJG A;  4FT2 A;  4BDY A;  3QDF A;  4MML A;  3CCR Q;  1I1J A;  2F5T X;  4Y92 A;  5KYX A;  2RQU A;  5GAN 5;  3QPH A;  2CH4 W;  3V7S A;  5GMK i;  2CP3 A;  1YIJ Q;  2NLU A;  2KXC A;  1OX8 A;  1YN8 A;  3MP1 A;  5C6S A;  1QVG P;  2DZC A;  3IQL A;  4M7A C;  2M51 A;  4RCC A;  2D0Q B;  5LJ3 e;  2EQJ A;  1HSQ A;  1XJW B;  2DK3 A;  3L2Q A;  1BK2 A;  4LXC A;  1B3Q A;  5GAM j;  2K79 A;  2EQU A;  2RQR A;  2J06 A;  3QZ9 B;  3M9Q A;  5GAM f;  5DLO A;  1Z9Z A;  2ZPB B;  3VKI A;  3UT1 A;  3JCM b;  1ZUK A;  3QXE B;  1MMD A;  4JRP A;  4N4G A;  5A0G A;  3QWY A;  2YUQ A;  3NHN A;  3C94 A;  1QLY A;  2YLB A;  2XI9 A;  3T9N A;  3GPL A;  1OUL A;  1KQ2 A;  1RAC B;  1W6X A;  2RJE A;  1YCY A;  2XKO C;  3V7R A;  3RR6 A;  4DEX A;  2EYY A;  3CME T;  2HQX A;  5EC7 A;  2B8A A;  1WHH A;  3M0Q A;  3RNJ A;  3NTI A;  4KUL A;  4C8Q A;  3V7C A;  4J83 A;  1I4K 1;  1UGQ B;  2FYK A;  4M78 E;  4HT9 A;  4L5G A;  3P8B B;  1KK7 A;  3OMC A;  5KE3 A;  3CCE A;  1SEM A;  2QA4 T;  1WHM A;  2AHJ B;  4Z89 A;  3L2W A;  2MI6 A;  1R77 A;  2C06 A;  2F2X A;  1VQ5 T;  3UA7 A;  2DTO A;  1D09 B;  1BI2 A;  1D0X A;  3E19 A;  1TOV A;  2FZG B;  1VQK A;  3CBO A;  3NPF A;  2RI5 A;  1TUD A;  1OZ3 A;  1QP2 A;  2FHD A;  2E41 A;  2E6N A;  2X4J A;  1S72 Q;  2DER A;  3CD6 Q;  1WQ7 A;  4M7D F;  3CPW P;  3EH2 A;  2LQ8 A;  3L2R A;  4M7D D;  2YRD A;  2JM9 A;  2HSP A;  4C92 B;  1B7T A;  2BTT A;  5EG2 A;  3CC4 A;  1D3B B;  2LP5 A;  4BDZ A;  1M1K U;  3PFS A;  1TG0 A;  3JAM E;  2YWW A;  1NM7 A;  2I2L A;  2CUD A;  2K7A A;  2YUO A;  1IO6 A;  2PVD B;  1YBY A;  1N8R U;  3A8L B;  4QT7 A;  4M78 C;  5CO7 A;  1K9A A;  2FG0 A;  2EKO A;  5KYX B;  2CS7 A;  1M3A A;  5CK9 A;  5CKF A;  2CSI A;  5LJ3 g;  4M75 G;  3PMI A;  1KJW A;  2B86 A;  3RER A;  3CCU A;  3UWN A;  3EG9 A;  3MEV A;  1YFN A;  2JZ2 A;  5FWB A;  4PJO G;  1XOV A;  3VRY A;  2MWP A;  2CUB A;  3S6W A;  4C5H A;  4BD3 A;  3G6E Q;  1RAF B;  1CKB A;  2ZPH B;  2FO0 A;  1ZBX A;  4E47 A;  3OA6 A;  3OW2 S;  4Z88 A;  3MEW A;  2RH2 A;  1K9M U;  2DFU A;  2NUP A;  2DXT A;  4JZ4 A;  2WAC A;  1BI0 A;  2FPF A;  1DJ7 B;  3A8M B;  5HKC A;  3J7A F;  2FZC B;  4PJO B;  1Q86 U;  1I5L A;  5KYY B;  2RF0 A;  2V8K A;  2WSC E;  1YJ9 T;  4OB2 B;  3QHS A;  4M7A A;  4J9D A;  2GTJ A;  3G4S T;  1KC8 R;  3H0F A;  2GFA A;  1LJO A;  2H3J A;  1ZQ1 A;  1VQ9 A;  1VQ6 Q;  2EBP A;  4KGZ B;  4AT1 B;  3X26 B;  2HL5 C;  4JRI A;  3CCJ T;  3I55 A;  5CQX A;  1K73 C;  5KYW B;  1Q7Y R;  4YTL A;  1PSE A;  1G3T A;  2OTL T;  3VYH B;  2FEI A;  2DJZ A;  5LJ5 j;  1YI2 T;  1E6G A;  4C8Q B;  5LJ5 f;  2YUN A;  3URG A;  3ME9 A;  2CRE A;  4LDU A;  2PTK A;  4ZN1 A;  2VGN A;  5FU7 B;  1UGS B;  4IIO A;  2XDP A;  4A4F A;  1XQH A;  2CP5 A;  1D0Y A;  5CKB A;  1HYO A;  1WI7 A;  4L59 A;  1MHN A;  3MP6 A;  2E65 A;  3CMA Q;  3SD4 A;  5GAN 2;  3QYH B;  4Z02 A;  3VS6 A;  1N9S A;  1ZLM A;  5FRN A;  4JLI A;  4DOW A;  2ECZ A;  2D1X A;  2DTH A;  4XU0 A;  1NYG A;  4Q5W A;  4IIM A;  2EIF A;  2KNB B;  2DYB A;  2GF7 A;  3C95 A;  2RPN A;  1SHG A;  2DF6 A;  1U3O A;  1EX4 A;  4Z8A A;  2NWM A;  4RTU A;  1VQM T;  2HKQ B;  3M0S A;  4E7K A;  2VB6 A;  2QQA A;  2RJD A;  4X34 A;  3E2U A;  1YJN A;  2MCN A;  2YRV A;  4V2S A;  2SRC A;  1JJ2 P;  4AFU C;  2O2O A;  4KUD K;  3PIO A;  4E2F B;  3HPW A;  3U23 A;  5FU6 C;  3M5A A;  1Q81 U;  4E7S A;  4OML A;  3HRT A;  1M5Q 1;  2CZ6 B;  2NYS A;  2F2W A;  1WZO A;  2JM8 A;  3CCM T;  3EG9 B;  3SFM A;  1T3L A;  1VQO A;  2EGE A;  5D6Y A;  2VXF A;  2GBQ A;  1TUC A;  2DRK A;  4E7J A;  2V8I A;  5IH2 A;  2JS2 A;  1X6B A;  4WF2 A;  1VQL T;  3TRE A;  4CC2 A; 
#chains in the Genus database with same CATH homology
 2ENM A;  2KRO A;  2K6D A;  2DNU A;  4J9E A;  3ULR B;  4LN2 A;  4M4Z A;  4OMO A;  2KBT A;  2BZY A;  1W1F A;  1H92 A;  1HD3 A;  2ESW A;  2EVR A;  1QKW A;  2JTE A;  1GFD A;  1WXB A;  5IHN A;  1G2B A;  2FPE A;  1PNJ A;  3EG2 A;  1ZUU A;  1UE9 A;  1VYU A;  2YDL A;  1NEG A;  2LMJ A;  1KSW A;  4LE9 A;  1A0N B;  1M3B A;  4K11 A;  1X2Q A;  2JW4 A;  3VRZ A;  1SRM A;  2K2M A;  2L3S A;  4RUG A;  1RI9 A;  1NG2 A;  2LZ6 B;  1JQQ A;  2KRN A;  3SEM A;  4FSS A;  2EPD A;  1WFW A;  5GJV B;  1CSK A;  2ABL A;  2ED0 A;  2DVJ A;  4DEY A;  2JMC A;  2O31 A;  2X3X D;  1I07 A;  1UUE A;  4J9C A;  4J9I A;  2OAW A;  1UJY A;  2J6O A;  2DL4 A;  4OMN A;  1GBQ A;  4JJC A;  3TVT A;  4AFS C;  2D8H A;  1H8K A;  5IHK A;  2C0I A;  2D8J A;  2CH4 A;  3UA6 A;  4D8K A;  5FWC A;  2J7I A;  4HXJ A;  1N5Z A;  2DIL A;  1ZSG A;  1GCP A;  1AWX A;  2X3W D;  1HJD A;  2A36 A;  2IIM A;  2I0N A;  2J05 A;  3I9Q A;  1M8M A;  2XMF A;  2G6F X;  2KYM A;  5L23 A;  2EKH A;  2DMO A;  4KRT A;  1YWP A;  3M0T A;  3VS2 A;  2LQN A;  2VWF A;  2W10 A;  2VVK A;  3EG0 A;  2F2V A;  4EIK A;  2M0Y A;  4JJB A;  2JS0 A;  2P4R A;  1SRL A;  1AOJ A;  3SHW A;  1WA7 A;  3I5R A;  2DX1 A;  4E6R A;  4AG1 C;  1PKS A;  4OMQ A;  2KE9 A;  2K9G A;  4F17 A;  1ABQ A;  1Y0M A;  1I1J A;  2KGT A;  4LNP A;  3PE0 A;  4Y92 A;  1BB9 A;  2RQU A;  1S1N A;  4AFQ C;  2CH4 W;  2JXB A;  1M3C A;  2KXC A;  1GBR A;  2DA9 A;  1YN8 A;  3EG1 A;  3IQL A;  1U5S A;  2CSQ A;  2M51 A;  2L3P A;  2ED1 A;  1HSQ A;  1YNZ A;  2QDL A;  2O9S A;  1BK2 A;  1UG1 A;  1QCF A;  1ABO A;  1B3Q A;  2DL5 A;  2K79 A;  1NEB A;  4RTZ A;  3R6N A;  2RQR A;  1MV0 B;  2J06 A;  1J3T A;  1Z9Z A;  1ZUK A;  4AG2 C;  1T0H A;  1X43 A;  1T0J A;  2L3Q A;  3QWY A;  2ROT A;  1GL5 A;  1UFF A;  2YUQ A;  2YT6 A;  3NHN A;  1WXU A;  3KFV A;  1QLY A;  2J6K A;  5ECA A;  1MV3 A;  1UTI A;  2DLP A;  1K0X A;  3ZL7 C;  2CDT A;  2L0A A;  2HDA A;  4RTX A;  5IXB A;  2RNA A;  1W6X A;  1PKT A;  1NYF A;  2KT8 A;  4CC4 B;  1K4U S;  5I11 A;  4GBQ A;  4JPB W;  4ESR A;  2KRM A;  1JXM A;  4LUE A;  4DEX A;  2EYY A;  5EC7 A;  4OMM A;  1QKX A;  1VA7 A;  3M0Q A;  3RNJ A;  4CC3 A;  3QWX X;  1BBZ A;  2EGA A;  3VS7 A;  2DBM A;  1ZUY A;  1WDX A;  3EHR A;  3H41 A;  1GRI A;  2LCS A;  1X2K A;  2BZX A;  3THK A;  2V1Q A;  5IHI A;  1AZE A;  1RLQ C;  1ARK A;  3VS5 A;  3M0U A;  1X6G A;  1SEM A;  1KIK A;  4Z89 A;  2EYX A;  1SPK A;  1JU5 C;  2HCK A;  5GJW B;  2F2X A;  1UEC A;  1JEG A;  2SEM A;  3UA7 A;  1MUZ A;  2NUZ A;  1M30 A;  1PHT A;  2CT4 A;  1ZX6 A;  2RN8 A;  2W0Z A;  3REA B;  2LJ1 A;  1ZBJ A;  2J6F A;  1GCQ C;  3NPF A;  1TUD A;  3JV3 A;  4AFZ C;  2LJ0 A;  3EG3 A;  3VS4 A;  1VYT A;  2RQW A;  1K76 A;  3PVQ A;  2DE0 X;  3M0P A;  1NLO C;  2AZS A;  1EFN A;  2YSQ A;  4F14 A;  2JM9 A;  2HSP A;  3UF4 A;  2BTT A;  2HEQ A;  3H0I A;  2LP5 A;  1WLP B;  1I0C A;  1OV3 A;  2RQV A;  3FJ5 A;  3GBQ A;  1TG0 A;  2KXD A;  4WCI A;  1E7O A;  1NM7 A;  2RMO A;  2CUD A;  2K7A A;  2YUO A;  1IO6 A;  2D0N A;  4D8D A;  2JT4 A;  4QT7 A;  2FRY A;  1W70 A;  1K9A A;  2FG0 A;  5FW9 A;  1OPL A;  1M3A A;  2CSI A;  1KJW A;  2B86 A;  1OPK A;  3O5Z A;  1V1C A;  5FWB A;  1Z9Q A;  2LNH B;  2MOX A;  1G83 A;  4OMP A;  3EHQ A;  1XOV A;  3VRY A;  2CUB A;  1RLP C;  1AVZ C;  1T3S A;  3I5S A;  1CKB A;  2DRM A;  2GGR A;  2FO0 A;  4Z88 A;  4HVW A;  5I22 A;  2DL8 A;  2AKK A;  1AD5 A;  2A08 A;  1NLP C;  1Y57 A;  1YCS B;  4JZ4 A;  3A98 A;  2OJ2 A;  4RTY A;  3NMZ C;  3VS3 A;  2FPF A;  2RQT A;  2AZV A;  1SSH A;  1PRM C;  2EYZ A;  2KYB A;  2GTO A;  1RUW A;  2KT1 A;  2GNC A;  3C0C A;  1FYN A;  2EYW A;  2DL7 A;  1LCK A;  4J9G A;  2RF0 A;  3VS1 A;  1X27 A;  4ZNX A;  1YWO A;  2KRS A;  2GTJ A;  4J9D A;  3H0F A;  3TSZ A;  3M0R A;  5HCK A;  2EBP A;  2O9V A;  2H8H A;  3RBB B;  2JMA A;  1AZG B;  2A37 A;  1AWW A;  1UHF A;  1WYX A;  1KFZ A;  4HVV A;  1AEY A;  2FEI A;  1E6G A;  2CT3 A;  2EGC A;  2YUN A;  3I35 A;  1BU1 A;  4J9B A;  2FRW A;  2C0T A;  2CRE A;  2L2P A;  2PTK A;  2PZ1 A;  2LX7 A;  3H0H A;  4IIO A;  1B07 A;  1YP5 A;  2LJ3 A;  4R0K A;  3CQT A;  1UDL A;  2DM1 A;  4HVU A;  3VS0 A;  1WI7 A;  4ORZ A;  4GLM A;  2E5K A;  1K1Z A;  3REB B;  2DJQ A;  2ROL A;  2O88 A;  3VS6 A;  1ZLM A;  2KEA A;  2C0O A;  2ECZ A;  1QWE A;  1UHC A;  2D1X A;  2HBW A;  1WIE A;  1NYG A;  4JJD A;  1U06 A;  4IIM A;  1WX6 A;  4RTV A;  3UAT A;  2KNB B;  2DYB A;  4RTW A;  2RPN A;  1AWO A;  1AWJ A;  2DL3 A;  1SHG A;  2DF6 A;  1U3O A;  1WXT A;  4Z8A A;  2NWM A;  4RTU A;  4RTT A;  3M0S A;  1FMK A;  1JXO A;  1H3H A;  2EW3 A;  1JO8 A;  1PRL C;  1UGV A;  1X69 A;  5IXF A;  1GFC A;  1SHF A;  2AK5 A;  3NGP A;  2MCN A;  1UJ0 A;  2SRC A;  2KR3 A;  1CKA A;  1OEB A;  4AFU C;  2O2O A;  4A63 B;  4X1V A;  2EQI A;  3U23 A;  1GCQ A;  2PNI A;  4F16 A;  2AKL A;  4J9F A;  2YUP A;  4OML A;  2A28 A;  3TSW A;  4LUD A;  2MIO A;  1PWT A;  2DBK A;  4HCK A;  2F2W A;  1E6H A;  2GQI A;  2LQW A;  2JM8 A;  4JZ3 A;  1M27 C;  1T3L A;  2EGE A;  1QWF A;  2BZ8 A;  2GBQ A;  4CC7 A;  1TUC A;  3PVL A;  2V1R A;  3EGU A;  2DRK A;  2OI3 A;  5IH2 A;  2VKN A;  2JS2 A;  2FPD A;  1X6B A;  1OOT A;  1VYV A;  1K0S A;  3LH5 A;  2K3B A;  4CC2 A;  4J9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...