3FDRA

Crystal structure of tdrd2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
89
structure length
89
Chain Sequence
LQLDKLVNEMTQHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Tudor and KH domain-containing protein
publication title Mouse Piwi interactome identifies binding mechanism of Tdrkh Tudor domain to arginine methylated Miwi
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2008-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3fdrA00
3P8DA 2M1HA 3OYDA 2YRVA 2EQKA 3ASKA 4E7KA 3Q1JA 3OYMA 4C5GA 3MEVA 3E9FA 2LDMA 3QIIA 4X34A 3PMTA 5IAYA 3S3OA 3DB3A 4Q5WA 3QBYA 4BDYA 5KE3A 1OZ3A 3LX7A 1OI1A 4BE0A 4HCZA 2RJDA 2RJEA 3NTKA 1H3ZA 2GFAA 1MHNA 1WGSA 4C5EA 4L59A 3OS0A 3P8HA 2DIGA 4PLIA 2RHZA 2RI3A 5CIUA 2D9TA 2DAQA 3GOXA 4BD3A 4QQ6A 2B8AA 4II1A 3LYIA 3OS2A 3OYNA 4N4GA 3BDLA 2R57A 2R58A 3UWNA 1SSFA 3OYEA 2XK0A 2M16A 2M0OA 3MP8A 3NTIA 4IUVA 5C0MA 3OYFA 3M9QA 3LLRA 1XNIA 3C4SA 3LH0A 4E7JA 5FRNA 3KUFA 4PL6A 2BIVA 3H8ZA 3OMCA 4GY5A 4E7LA 2PQWA 3MEUA 3OB9A 5KCHA 3L2VA 2L89A 2L3RA 2F5KA 4UC4A 2X4YA 3OYCA 2RJCA 3MEAA 2LVMA 2DIQA 4QVZA 3FDRA 4N4IA 2P0KA 4NS5A 4QW2A 4ZTJA 3OYGA 4FL6A 3OYIA 4C5HA 2WACA 4B9WA 2RJFA 3OYHA 3S3MA 2X35A 1KHCA 2L8DA 3META 5IN1A 2EFIA 4LD6A 3DB4A 5KH6A 4IURA 4A4EA 3ME9A 3OQ5A 3PNWC 2RHIA 3S6WA 4BE2A 1OZ2A 4EDUA 2X4WA 3L2QA 2QQRA 3MO8A 4RG2A 4BACA 2EQMA 2G3RA 3DLMA 3OA6A 4IUQA 3L2WA 5M9OA 2FHDA 2RHYA 3O8VA 2O4XA 3E9GA 2HQEA 4N4HA 3OYBA 2EQJA 2K3YA 3CEYA 2X4XA 4ZTFA 5KCOA 3F70A 3FEOA 4E7IA 5FRMA 2GF7A 2LRQA 3MP6A 4IKFA 5J39A 2MWOA 1RI0A 3OYJA 3OS1A 2JTFA 3L2RA 3LGLA 2HQXA 3OMGA 3OYAA 3MEWA 2CKKA 4FU6A 2RHXA 3NTHA 2K3XA 4PLLA 4IUUA 4E7HA 2EQUA 2IG0A 3QJ6A 4C5IA 4IUTA 2EKOA 3S3NA 3OYKA 2R5AA 3LGFA 4A4HA 4Z02A 3QKJA 4BDZA 2RI5A 1WJSA 1N27A 3L2UA 3ZEHA 4BE1A 5D6WA 1OYXA 2RHUA 3L42A 5D6YA 5FROA 3OY9A 3FC3A 3OYLA 5D6XA 3PFSA 3UT1A 3FLGA 5C6SA 2NLUA 2LTOA 4OVAA 1G5VA 4B9XA 2RO0A 3EAEA 1WJQA 3PMIA 4A4FA 1WJRA 2GFUA 3H6ZA 3SD4A 2LCCA 4A4GA 2BKDN 2E6NA 4QQDA 5J26A 2RI2A 2BUDA 4CRIA 2MWPA 2QQSA 4IUPA 3MP1A 2O4XB 2R5MA 2E5QA 2VYTA 2XDPA 5KE2A 4QQGA 2JZ2A
chains in the Genus database with same CATH superfamily
1ABOA 3QO3A 2YRVA 3I5SA 4X34A 2CT3A 1UECA 2ABLA 3KXTA 4EMGA 1TG0A 2PVGB 4HCZA 1SSHA 1D1CA 1V76A 1K9AA 2ZPHB 2QA4T 3C95A 3VS1A 1X69A 1UUEA 2RI3A 1XQHA 1SHFA 2D9TA 1UGPB 4JJCA 4FIBA 3RESA 3OYNA 1X01A 2E3IA 2R58A 2EKHA 3QYGB 2XK0A 2QDYB 3QZ5B 1G3WA 4C92B 4FSSA 1NJIR 5GAN3 1VQLA 5KYNA 1T3LA 1M9SA 1Q82R 1X2KA 5KYWB 3O5ZA 1Q7YC 4HA8A 5GAN4 4M7AB 2DF6A 3CCMT 2VGMA 3VS3A 3VUZA 4C8QC 1M8MA 2WSEE 2EFIA 4EMKA 2L0AA 4ZNXA 1QVGA 2HAXA 3CCET 3THKA 3WVDB 4AFQC 4JRQA 1YITT 2YXYA 2NUTB 3PVLA 1T3SA 3OA6A 3H0HA 1NLPC 4MZPA 1MUZA 2DERA 3HL8A 5CKHA 2OTJA 3L2RA 2AKKA 1Y0MA 1QWEA 2RHXA 3FIFA 4M77B 4AFSC 1YJNT 3MPUB 4X9DA 4E7HA 3JB9F 1M27C 1HSQA 3C0CA 1BI0A 2R5AA 3LGFA 4Z02A 1TS9A 2RI5A 3CD6T 1N27A 5KYYA 2BE7D 1UJ0A 2K5IA 3SB2A 2KSSA 1HD3A 1ZX6A 4M7DE 4KUDK 1RAFB 2KT8A 2LJ0A 1U06A 3RKWA 1KC8U 1VQKA 1AD5A 3A8HB 1GCPA 4CC3A 1K9MR 1NJIC 1KQSP 1VQ7Q 2CP2A 2SEMA 2FPEA 1Q82C 2KMTA 2HMAA 4KT0E 2EYYA 4XAXB 2ZPFB 3NTKA 4LDYA 4C5EA 3OW2S 2LT1A 3CCVQ 4PJOG 4QQ6A 2R57A 3BFMA 1VQ9A 1WHKA 2L3SA 2M0OA 3NTIA 2FO0A 2CP3A 2DE0X 3LLRA 1AZGB 2I0NA 3A98A 2YUNA 2ED0A 2QG9B 1BK2A 3JSCA 2HKQB 4CC7A 4FYWB 4PJOD 1WHMA 2DEUA 1YCYA 2PVOB 1MNDA 2E64A 3A8OB 4B9WA 2VV5A 4A63B 1BBZA 2ESWA 3X24B 3J80E 3SDZA 1IXDA 2VC8A 3E2UA 3BDUA 5A0LA 1W2BP 3TCJA 2EQJA 3R6NA 3EGDB 1KD1U 4PJOB 1K9MC 1VQ4A 3OS1A 3SEMA 2JS2A 2IG0A 3ULRB 4OP0A 4HT9A 3A8LB 2EJFA 2JMCA 1PKTA 1WJSA 2E1HA 3I55A 2J6OA 5IHKA 1O75A 3UT1A 3NHNA 4B9XA 3GNFB 1WJQA 2CYZB 3CCUA 3D7SB 1AWJA 2RQVA 4QQGA 2F2VA 3CC7Q 1PSFA 2DA9A 3OSVA 2EQIA 3S3OA 2QDLA 4XTYA 2A36A 2DK3A 4KUIA 4A4KA 3HRUA 3N5BB 1M90R 1H3ZA 2XKOC 5CIUA 2LMJA 5EC7A 2DAQA 2RPNA 1UE9A 5CCAA 5GJWB 5KYXA 2O88A 2AZSA 3REBB 1RAEB 1RAIB 5HK0A 1Y57A 2DILA 1XOVA 2QGGA 4PNOA 2BE9B 5KCHA 1S72A 1VQ8A 1LOJA 2F5KA 4M7DC 2DXTA 5GMKh 1QP3A 3RKYA 2DRMA 1M1GA 5CAIA 4PJOF 1VQPT 1UDLA 3NFCA 1AHJB 1Y7XA 1W4SA 1ZBJA 2GNCA 1D0XA 1KQSS 4M7AE 2X4WA 4M78A 2RK1A 4J7IA 4EIKA 1VQ6A 2MF2A 4N4HA 4R56A 1U3OA 4A53A 2D1XA 4MZMA 3QWXX 2X4XA 1AWOA 3MP6A 3EH2A 3CCJT 4XU2A 5LJ3e 5GJVB 2DTHA 5DM7R 3PGGA 4FU6A 4RKUE 2K5FA 3HRSA 2LQKA 5HKCA 1B7TA 2B86A 2KVQG 1M90C 1JJ2A 2COYA 5GAOm 2QQ9A 2MPXC 2KRSA 3L42A 3FC3A 1M2VA 4M77E 5C6SA 2FVUA 1VQ5Q 3ER0A 2LCSA 2JS0A 1D3BB 2VYTA 1PHTA 2MYSA 3P8DA 2M1HA 5CO7A 1UFFA 1RAGB 2QA4A 4E7KA 2YLCA 3Q1JA 5IT9E 3CCRT 2CGHA 4C0DC 4JRKA 2D8JA 4Q5WA 3UF4A 3CBMA 3VU3C 5GANd 1YJWA 2ZPGB 2OTLQ 1QKXA 3C94A 1W2BS 2CT4A 4II1A 3REAB 2YDLA 2AK5A 2CZ7B 2IIMA 1AOJA 2KYMA 3L2ZA 3M0TA 1MMNA 2GTOA 2AHJB 3M9QA 1SRMA 2O31A 4RMOA 3KUFA 1G83A 1Q95G 1YI2T 2OX7A 5LJ3g 2AIRB 4E7LA 3H41A 3CPWS 1M1FA 4J9IA 1R0BG 3SWNC 4E6RA 2RM4A 2E70A 1AWXA 1KHCA 2EVRA 3MJXA 5A0GA 2KDSA 2CS7A 1G3SA 3V8LA 5GAOr 1W70A 1WQ7A 3QJYA 2QEXQ 3OYBA 5GAOl 5IXFA 4LDUA 3CXCA 1VQNT 3FEOA 1WA7A 2FZCB 2KXCA 2EBPA 1KHIA 2P84A 2VGNA 4DBQA 5J39A 3CD6A 3OMGA 4FCYA 4ELYC 4IUUA 2LCLA 1CSKA 8AT1B 2LJ1A 4C0GA 1K73U 1IGQA 4MZTA 5AT1B 2A0FB 5HCKA 4PJOE 3G6EA 1RI9A 1AT1B 1D0ZA 5GMKj 4LNPA 3FLGA 3VS2A 1I1JA 2HEQA 3JCMV 1N8RU 2KRMA 2AKLA 3DLLA 1K73R 2EW3A 5KE2A 2EGEA 1D1AA 2E4HA 1IHVA 3OYDA 4M7AC 5GAOp 2MOXA 8ATCB 3GBQA 3ZFJA 4BDYA 4MMKA 2QASA 2F2XA 1QW1A 1K0SA 2RJDA 4F16A 3E1SA 2EAYA 1GFCA 2QK0A 1UGRB 5GAMf 2DYIA 4KGVB 4PLIA 4DBFA 2RHZA 4BD3A 1VIEA 2V8JA 5FWBA 1HXDA 2P0QA 1HJDA 2M16A 3M58A 4E7SA 5GANg 1XNIA 3LH0A 5LJ5d 3PE0A 5FU7B 4N0AC 2KRNA 2M9UA 2FZKB 1QCFA 4M77C 1KQ1A 1VA7A 2L5QA 4DBHA 4JZ4A 3MEAA 2NYSA 2Y4XA 1VQLQ 2KQWA 4CI0C 1V1CA 4VUBA 4IURA 1D1BA 4PFPA 4ZGDB 4RTYA 1FWZA 4DOWA 3A8MB 1FYNA 1YNZA 2LJ3A 4M4ZA 1LNXA 3JCMd 1K73C 2C06A 1MNEA 2P4TA 1RI0A 2JTFA 1VYUA 1Z9QA 1VQ7T 3OYAA 2YHTA 1UG1A 1QQJA 1Q7YU 2EQUA 3S3NA 2EKOA 1M4ZA 3JRZA 4Y91A 3M0UA 4EMKB 2OTJQ 1X43A 5D6WA 3OY9A 4OMMA 3CCVT 3OW2P 1AEYA 4JUVA 5CKBA 2RO0A 3KBGA 4A4FA 1YIJA 1I5LA 3A5ZB 4QQDA 5J26A 1I4K1 1TTHB 3L2QA 3RKXA 3JCMW 1QLYA 5IXBA 2AT1B 4KGZB 5FWCA 3HFNA 3M54A 1MMGA 4LD9K 2JM8A 1K76A 1VQKQ 1PC0A 2H3EB 1JU5C 1MHNA 1BIBA 2GTJA 1K4US 2DIGA 4OB0B 3CCLQ 2B8AA 2YUQA 5IHNA 3HSBA 3QXEB 4RTTA 3CPFA 3EG9B 3OYFA 4PJOC 1OU9A 3BW1A 3JCMP 5DLOA 3SHWA 1M30A 4KGXB 1VQ9Q 3M0SA 5A0DA 1NJIU 1LPLA 4RTZA 1NEGA 3OYCA 4ZTJA 2X3XD 2SRCA 1Q82U 2KGTA 2HDAA 4JJNK 5I11A 3QZ9B 3META 5IN1A 1ARKA 3EH1A 1B3QA 4A4EA 4PJJA 3ME9A 1OQKA 1JEGA 4BE2A 2CP7A 1ZLMA 4AG1C 2QQRA 5IHIA 1PRMC 2EQMA 2G3RA 2QXFA 1UEBA 3G4SQ 3EG1A 2QTXA 3BY7A 2GCXA 4A54A 3CEYA 5CKEA 3CCSQ 5KCOA 2LC4A 3F70A 4M75A 1GXIE 2JJ9A 2ED1A 2MWOA 3CC7T 3OYJA 2CP6A 4J8OA 1KQ2A 5LJ5j 3M55A 2OI3A 2KYBA 3ZL7C 4L6V5 1MV3A 3I9QA 5CQXA 2KT1A 3JCMg 2CP0A 3HTRA 3J81E 5J3BA 1EFNA 1VQ4Q 1YHQQ 1I0CA 2NUPA 1N6AA 3OYLA 3JB9J 3GLXA 2J7IA 2MWPA 2XIDA 4IUPA 3DLMA 2HQEA 1IGUA 1P92A 2WSCE 3EGUA 4XK8E 4ZN1A 1BI1A 5GMKi 4C5GA 1M3CA 4F7UA 3VUBA 1K9MU 3CCUQ 3GIBA 3LWHA 4DEYA 2XG8D 5DLQE 4JRIA 3P8BB 5LL6S 4FW1A 4ANJA 3EG0A 1YI2A 3VKIA 1ZQ1A 4DQ2A 3C4SA 5FRNA 2K2VA 1VQOQ 2HNIA 1OEBA 1OX9A 1R77A 2FL7A 1PCXA 4HT8A 4M78G 2RJCA 3G71A 2GQIA 4C5HA 4XTXA 1QVFP 1X6BA 1ZSZA 1S72Q 1VQ8Q 2DO3A 2FB7A 3CC4A 3OBYA 1RAAB 2KROA 3TVTA 4J9GA 4DA4A 5GAN8 2X4JA 2NUZA 1BCMA 4M78D 1SRLA 1VQ5T 2KEAA 1TUCA 5FLXE 2GF7A 4C92A 2VVKA 2L3PA 3H0FA 1WDXA 1GCQA 2FPDA 1HK9A 4J9DA 3NGPA 2XDBA 5KYWA 3JCMb 3JCMQ 1PSEA 1OV3A 4J9BA 1C0MA 3CMAQ 1T0JA 1QWFA 3FJ5A 4BE1A 2OTLT 4M7AA 3U23A 4ORZA 2KXDA 2LX9A 3G1JA 3DKMA 2GFUA 3LW5E 2LCCA 2LP5A 4KULA 1ACMB 2CZ1B 2EGCA 3CMEA 1LVKA 2NUTA 5GAOn 3E9FA 2LDMA 2FYKA 3J7AF 2QAZA 4FYVB 3CPWP 2LQ8A 2GFAA 4N0AA 2CH4W 4M77A 1YCSB 1M90U 2E41A 3LYIA 4O6JA 4N4GA 1IRXA 2ROTA 3OYEA 1EIFA 4OGEA 1YJWQ 7AT1B 4J9FA 2P4RA 2DVJA 2HSPA 4LDXA 1UB4A 4PL6A 1M8VA 5GMKm 3OMCA 2CUBA 1KFZA 1RLPC 2YLBA 2QEXT 2DBMA 5GAN7 2BTTA 4BY6B 2MAMA 2GGRA 5KYUA 2X4YA 2ATCB 1KIKA 4F14A 3M5AA 2CP5A 1BYMA 4HCBA 4LD6A 5KH6A 2MCNA 1QVPA 2EPDA 3I56A 2EGAA 2X9HA 3CCQA 1VQMA 6AT1B 3CC2Q 3JCMJ 2PTKA 5LJ3h 2D8HA 1N9RA 2D0NA 5GAN5 2QYZA 4X9CA 4YTLA 2PVDB 4M78F 3LH5A 4F04B 5LJ3f 1G2BA 3CCVA 4XTWA 2I2LA 4HCCA 3URGA 3M59A 2XI9A 1JXMA 2LQNA 3EGXA 2JT4A 1ZUYA 1NG2A 3TQ7P 1OU8A 1TUDA 5CVIA 2DMOA 5D6YA 3T9NA 3CXCS 4J6YA 1BU1A 2G6FX 2DXUA 5FU7C 3EAEA 1SKUB 2E6NA 1GRIA 1YP5A 1PWTA 3G6EQ 2JM9A 1WI7A 1M3AA 2FPFA 4PJLA 2O9SA 1QVFS 1DJ7B 3RMSA 1YJ9A 1OZ3A 3QG1A 1FMWA 4OF1A 5GAN6 4J6XA 2JNGA 3M0PA 4OB3B 1K1ZA 2RF0A 3G7ZA 4FM4B 1VQLT 4LE9A 1B34B 2PU9B 3GOXA 4XTUA 1PKSA 3RUXA 3I5RA 1Q81R 1AWWA 5GMKe 1MV0B 4E2FB 1Y96B 1UGQB 2BIVA 3QDFA 4JZ3A 1WPYA 2PQWA 4TVRA 1C6VX 2L89A 2XDDA 1JQQA 2KI7A 1OX8A 2RNAA 1WHJA 4EMKC 4QVZA 1QVGP 3FDRA 3QPHA 2P0KA 4GLKA 3C12A 3HKSA 2M51A 2VASA 2OTJT 2VXFA 2EYQA 1WIEA 4C8QA 2HCKA 4WTOB 3CCMA 3EFRA 1T0HA 4PJMA 1R0CB 1CKBA 3CCEA 4GLMA 2LRQA 2J05A 1YITA 1FXXA 2JN0A 2BZYA 2RQWA 1FMKA 3V7RA 4LN2A 1VQKT 3EFOB 1BKBA 3X20B 2YRDA 4J9EA 3PFSA 4QVDA 3CCLT 2XHCA 2ROLA 1YJNA 3PMIA 5GANe 1Q81C 4FYYB 2BUDA 2CDTA 3MP1A 3TSWA 1GL5A 1WQWA 1WYXA 1QKWA 2WSFE 4OMNA 3ASKA 4M7DG 4LUDA 4M78E 2A37A 2YRCA 5IAYA 1YIJQ 4D8DA 3UPUA 1RLQC 5KE3A 4C0FA 1VQ9T 2PNIA 4BE0A 1KQSA 2RQTA 1WGSA 4ZGJB 3P8HA 1WXTA 2CZ0B 1V29B 3OS2A 2C0TA 1SSFA 1YWPA 1N5ZA 4JRPA 2JW4A 1M3BA 5D7UA 4XQ3A 5GAMd 5GAMh 3G4ST 4ATOA 2RB6A 3HHTB 2HL5C 3CCST 2L3RA 2YUPA 4RTWA 2RA2A 4UC4A 2C0IA 2LVMA 2XU8A 1I5OB 1SHGA 2EJGA 1VUBA 1ZUUA 3PTAA 3QWYA 4M75G 1NLOC 4J5YA 4EPCA 1UTIA 1VQ4T 1YHQT 2EWNA 1IO6A 2DL5A 2F5TX 2VXEA 3MO8A 4OMOA 2LT4A 4FYXB 4JDSA 1WHLA 5M9OA 2Z0WA 4HKEA 2O4XA 2NWMA 1F1BB 2DYBA 2K3YA 3L1AA 4IKFA 4FT4A 3LGLA 2CSIA 4MDXA 1W2BA 2DNUA 2DBKA 4M75D 4PFOA 4PLLA 4XU0A 4LDVA 1E7OA 2DX1A 1VOMA 3WVEB 3CCUT 2F69A 3M4YA 1LJOA 1X6GA 4PFZA 4F7UG 2DXCA 2HBWA 3RIRA 3SD4A 1I07A 4Z88A 4HVVA 4NOYA 1W1FA 2DD4A 5GAN2 1TWBA 1QVGS 1TUGB 2JZ2A 2EQKA 1VQOT 1UGVA 4M75B 1JB0E 1WHHA 4FW2A 2JTEA 1NYFA 3QBYA 3HP9A 5LJ5e 1NZ9A 2HL3A 1D09B 1YWOA 3PT9A 4HCKA 3OS0A 2K7AA 1MGQA 2NUPB 4MDWA 1S72T 3BDLA 1E6HA 4J6WA 2O2OA 2K79A 3JB9H 4E7JA 3H8ZA 4B6MA 1IHWA 3RMQA 2COWA 4F7UB 3TSZA 2LX7A 1D0YA 4D6WA 3M53A 5KYYB 3FRNA 2GQVA 4J9HA 3JCMe 4M7DA 4ZGEB 5CK9A 2A3LA 2WACA 3S3MA 2O9VA 2JMAA 4C92G 3RNJA 3CMAT 3OQ5A 1Y71A 3PNWC 3G71Q 1M2OA 3M57A 2DZ9A 2RMOA 2Y90A 1VQPA 4M7AG 2W10A 3CC4Q 3SFMA 4J7FA 1ZSGA 4XTVA 2DXBA 4BUGA 5LJ5g 1JJ2P 4C92D 1K8AR 1M5Q1 1EZZB 5GAMj 4KH0B 4C5IA 4M75F 1ZSZB 2J6KA 3CCJA 4DEXA 4M7AD 4HVUA 4OVAA 1G5VA 4OMQA 1WHGA 3MCAB 3H6ZA 4V2SA 2DFUA 2XMFA 2DETA 1AVZC 1YJWT 4CC2A 1JXOA 4M77G 3OYKA 4BY6C 3HFOA 3V7SA 2RH2A 2DTOA 2V8KA 4F17A 2QQBA 1UHFA 2RJEA 3CMEQ 3ZBDA 2OAUA 4Y92A 3FJPA 5IH2A 4IIMA 4XU1A 4L59A 1R8OB 4F7UF 4GBQA 2V1QA 3CCRA 3CQTA 2VWFA 5FU6B 4M77D 4JPBW 2EYXA 3UWNA 3I55Q 3QHSA 3LWIA 3CC2T 2AZVA 2J6FA 3OB9A 3L2VA 4WF2A 1RAHB 2M0YA 1OULA 2BZXA 1I8FA 1JO8A 2K6DA 1K8AC 4J83A 4FSXA 2RJFA 2X35A 3SWNA 1G3YA 3H9NA 1BB9A 4BB7A 4NL3A 1WXUA 1W6XA 3OBWA 1IREB 5I2SA 4NL2A 3CXCP 1YFNA 4IUQA 1X75C 2FHDA 3E9GA 1SPKA 1TOVA 1CKAA 3EG9A 2E6ZA 3VS4A 3G6ET 3I56Q 2MIOA 4E7IA 3CCQQ 3NPFA 1VQMQ 1UJYA 3I35A 2FRYA 5KYUB 1X27A 4D8KA 2A08A 3MEWA 1QCNA 4OGCA 3CCLA 5FW9A 4ESRA 4HXJA 1M1KU 3QKJA 3JAME 4C92F 1TH7A 1ZHIA 3M0RA 5KYXB 2DJZA 1VQNA 4RCCA 5I2MA 5D6XA 3MHXA 3GPLA 1KC8R 2HBPA 4MMLA 1NYGA 4AT1B 4Y28E 1TXQA 3X28B 3NMZC 2DL3A 2LNVA 4O5VA 4M7AF 4LDWA 3QJ6A 2XDPA 1M1KR 2K5LA 3VYHB 3PIPA 2YSQA 3V7CA 1ZBXA 1VQ6Q 2HSEB 1RABB 3DB3A 3V8KA 2ZZDA 4OMPA 2EJ9A 4OB2B 3EGXB 4M75E 4M78B 2LQWA 1FX7A 4L5GA 1YJ9Q 1RUWA 3G4SA 3PVQA 4C0ZA 3CCSA 1JJ2S 4M77F 4IUVA 2KY9A 4BI4A 1X6OA 2VB6A 2L3QA 2CSQA 4LUEA 4OB1B 2KNBB 4C8QG 2QGFB 1ZA1B 1SF9A 1MMAA 2ZPEB 2QA4Q 2DIQA 3UDCA 2FRWA 3WXMB 1OOTA 1YHQA 1M2VB 1J3TA 4ME7A 4P5NA 4F7UE 5CQYA 1VYTA 1I81A 2ZCFB 1Y07A 4QVCA 3VS7A 2M02A 2VKNA 1KC8C 1KD1R 4RG2A 4BACA 4QKUA 3BE3A 4C8QD 2DPPB 3GNGA 3O8VA 4PKCC 3RDVA 2JUFA 2IVWA 1M1KC 2OJ2A 3AHUA 2JTMA 3QYHB 2W0ZA 3CCMQ 1YIJT 2DLPA 4OMLA 1U1TA 2DTIA 4AG2C 4HVWA 3GF5A 4J9CA 1BIAA 3CCEQ 4JS4A 2E5KA 2RHUA 1YITQ 3R6OA 1VQ7A 4C8QB 1ZUKA 4Z89A 2LTOA 5A2QE 5LJ3d 1VQOA 2CUDA 4JLIA 1WJRA 1AZEA 4DOVA 4RG8A 2QQSA 3TREA 1K0XA 3OW2A 2E5QA 4PK4A 3INZA 2QTVA 2LZ6B 2KE9A 1WFWA 2D0QB 4K11A 1HYOA 2HQHA 3MEVA 3QIIA 1YJNQ 1S1NA 2V8IA 3EG3A 2KK4A 3CD6Q 1RADB 4FT2A 2KR3A 1SEMA 1IZ6A 2QQAA 1C1AA 1TSFA 4C92E 1WZOA 3A1PA 1QMCA 1H641 2DM1A 3VRZA 4E47A 3EG2A 2CZ6B 1G3TA 3QDRB 3E19A 2KAFA 5C0MA 4Z8AA 3RR6A 1KD1C 2K4YA 4JJDA 1E6GA 1Q81U 1BCOA 3EGDA 5L23A 4PJOA 5GMKl 1ZA2B 3MKDA 5HY6A 2K57A 3CMAA 2JVVA 1H92A 1PRLC 1MMDA 1NPRA 1YN8A 1SG5A 2X3WD 1NM7A 2ZGWA 3TEEA 2A28A 2RHIA 3VS0A 4R55A 1X2QA 4EDUA 1O9SA 1Z9ZA 4M75C 3JCMX 3VRYA 1U8RA 4EMHA 1NPPA 2K9GA 4C8QF 4AMCA 1NEBA 3TU4K 1KG1A 4KH1B 4E7ZA 2EIFA 2A7YA 2HQXA 1ABQA 1FMVA 3JV3A 1Q86U 1U5SA 3AT1B 1PG5B 1BI2A 3UA7A 5ECAA 2E65A 2EYWA 4IIOA 2E12A 4BDZA 3CBOA 3L2UA 2H8HA 1OYXA 5FROA 5GANh 3RERA 1LCKA 3CC7A 3X25B 1PD1A 3GP8A 4JLGA 2HKNA 2DVEA 2RK2A 3OYYA 3VV0A 1Q86R 2BKDN 5GANf 2O4XB 3HRTA 2OAWA 4XTZA 3OSSC 3OYMA 3VS6A 1EX4A 2GBQA 3PMTA 3UA6A 2ECZA 3EHRA 1OI1A 2O01E 2YWWA 1RACB 3EHQA 3UATA 2F1LA 1QCOA 1GBQA 3CC2A 1UHCA 2DL7A 5I22A 2JXBA 2PUKB 2CREA 3G71T 1PD0A 1JRIA 1KK7A 1UGSB 2L2PA 2QI2A 4GY5A 5CR2A 5LJ3j 3CC4T 2LNHB 4BI3A 1B07A 1TU0B 4RCBA 1ZSZC 4JS5A 2RD1A 4N4IA 4NS5A 1U1SA 4X1VA 4QT7A 1VYVA 4RTXA 1NE8A 1XJWB 1PM3A 2MK5A 2F2WA 4RUGA 3DB4A 5CKDA 4M7DD 3S6WA 1OZ2A 1QVFA 2FG0A 3A8GB 1B34A 4C92C 1Q86C 1WNLA 2PZ1A 1D3BA 2DJQA 1GCQC 5DY9A 1XTDA 1RL2A 4XU3A 3VS5A 9ATCB 1OPKA 5FRMA 3V8JA 2KBTA 3OS5A 1Y96A 1A0NB 3NTHA 1H3HA 3HPWA 1VQPQ 2FZGB 3CBPA 2MI6A 4IUTA 2V1RA 4M7DB 3QUIA 5FU6C 1VQ5A 2VUBA 3CMET 2DL4A 3ZEHA 2EYZA 1N8RR 4AFZC 3PIOA 1KSWA 4A4GA 1G8XA 2RI2A 2P0PA 3I55T 2XD0A 2XICA 3H0IA 2ZPIB 2H3JA 1BI3A 5HK3A 1YBYA 2IPOB 3CCJQ 2OTLA 1GFDA 4RTVA 1JBMA 4C8QE 4KRTA 5LJ5h 4CC4B 2RN8A 3LX7A 2MMPA 5EG2A 1WXBA 5GAMe 3QSUA 5LJ5f 1N9SA 2DZCA 2HZYA 3RBBB 3CPWA 3JCMc 2ZAEA 4JJBA 4DBRA 3VYGA 5I21A 3EFOA 4KBMB 3MP8A 5GAOq 5GANj 2JOYA 2DKGA 3CCRQ 3MEUA 2FEIA 2PUOB 2Y4YA 2HD0A 3IQLA 1OPLA 3I56T 3FB9A 3JCMh 3CCQT 2BZ8A 1VQMT 2K3BA 4ZN3A 1IB8A 4LXCA 4QW2A 3OYGA 4C0DB 4FL6A 3JB9I 3OYIA 3JB9G 2J06A 3KFVA 1VQ8T 3JCMf 3OYHA 2L8DA 2QEXA 4PJNA 1GBRA 2DL8A 3EFSA 1WLPB 3M4GA 2YT6A 3X26B 2E3HA 2CH4A 1N8RC 4M7DF 2C0OA 1NBEB 3L2WA 2V26A 4RTUA 2RHYA 1YI2Q 3M0QA 2E10A 4OMFB 1Q7YR 4ZTFA 2K2MA 3JB9D 1VQ6T 1QP2A 4WCIA 2DEQA 2CKKA 2K3XA 2DRKA 5GAMg 4M78C 4BI8B 1PNJA 4A4HA 1H8KA 2RQRA 2DD5A 1KJWA 2D6FA 2YUOA 3SWNB 4ELZC 5AYFA 1K8AU 2ZPBB 1VIFA 5L8RE 3M56A 2RQUA 1WX6A 2NLUA 2ENMA 1YJ9T 2X51A 5CKFA 4AFUC 4CRIA 4R0KA 2R5MA 1VQNQ 3VJPA 2COZA
chains in the Genus database with same CATH topology
3V7CA 1ZBXA 3QO3A 3OYDA 2YRVA 4M7AC 5GAOp 1QVFS 4X34A 1DJ7B 3ZFJA 3DB3A 4EMGA 3KXTA 4BDYA 3RMSA 2PVGB 3V8KA 4MMKA 1YJ9A 1OZ3A 3QG1A 2ZZDA 1QW1A 4OF1A 4HCZA 5GAN6 2EJ9A 4J6XA 2RJDA 3E1SA 2EAYA 2JNGA 4OB2B 2QA4T 2ZPHB 4OB3B 3C95A 3G7ZA 4M75E 4FM4B 1UGRB 5GAMf 1VQLT 4M78B 4PLIA 2RHZA 1XQHA 1B34B 2RI3A 2PU9B 2D9TA 4XTUA 3GOXA 1FX7A 1UGPB 4L5GA 4FIBA 4BD3A 3RUXA 1VIEA 2V8JA 3RESA 3OYNA 5GMKe 1X01A 1HXDA 2R58A 3G4SA 2P0QA 3QYGB 4C0ZA 2XK0A 2M16A 2QDYB 3M58A 3CCSA 3QZ5B 4M77F 4IUVA 1JJ2S 5GANg 1G3WA 4C92B 1XNIA 3LH0A 5LJ5d 2KY9A 1Y96B 4BI4A 1UGQB 5FU7B 5GAN3 1X6OA 2M9UA 2BIVA 4N0AC 1VQLA 1M9SA 1WPYA 2PQWA 4M77C 4TVRA 4OB1B 1KQ1A 2L89A 4C8QG 2XDDA 1Q7YC 2L5QA 4HA8A 2ZPEB 5GAN4 3MEAA 4M7AB 4EMKC 2DIQA 4QVZA 3UDCA 3FDRA 3WXMB 2Y4XA 2P0KA 3QPHA 1YHQA 3CCMT 2VGMA 4GLKA 3C12A 4ME7A 3VUZA 2KQWA 4C8QC 3HKSA 2WSEE 4CI0C 2EFIA 4P5NA 4EMKA 4VUBA 4F7UE 5CQYA 1QVGA 2HAXA 3CCET 4IURA 2OTJT 2VXFA 1I81A 2EYQA 2ZCFB 1Y07A 4ZGDB 3WVDB 4QVCA 1FWZA 4C8QA 4JRQA 1YITT 1KC8C 4RG2A 4BACA 3OA6A 4DOWA 3A8MB 3CCMA 4C8QD 3EFRA 2DPPB 3GNGA 3O8VA 4PKCC 1LNXA 3JCMd 4MZPA 2JUFA 1K73C 2IVWA 2C06A 1M1KC 3CCEA 3HL8A 5CKHA 2OTJA 2LRQA 3AHUA 2P4TA 3L2RA 1RI0A 2JTMA 2JTFA 1YITA 1VQ7T 3OYAA 2YHTA 3QYHB 1FXXA 2JN0A 2RHXA 3FIFA 4M77B 1YJNT 1YIJT 1Q7YU 4X9DA 4E7HA 3JB9F 1U1TA 3V7RA 2DTIA 2EQUA 3S3NA 2EKOA 1BI0A 2R5AA 3GF5A 3LGFA 4Z02A 1M4ZA 1BIAA 3JRZA 1VQKT 4Y91A 4JS4A 2RI5A 4EMKB 3CD6T 1N27A 1BKBA 3X20B 5D6WA 2RHUA 3OY9A 2K5IA 3CCVT 3R6OA 3PFSA 4QVDA 3CCLT 4JUVA 3SB2A 2KSSA 5CKBA 4C8QB 1VQ7A 2LTOA 2XHCA 5A2QE 2RO0A 3KBGA 5LJ3d 3PMIA 4A4FA 5GANe 4JLIA 1WJRA 1VQOA 1YIJA 3A5ZB 4DOVA 1I5LA 4M7DE 1Q81C 4KUDK 4QQDA 5J26A 1I4K1 2BUDA 1KG1A 4RG8A 2QQSA 3TREA 3MP1A 3OW2A 3RKWA 2E5QA 1WQWA 3L2QA 1KC8U 1VQKA 3RKXA 3JCMW 3A8HB 2WSFE 3INZA 1NJIC 3ASKA 4M7DG 2D0QB 3MEVA 3HFNA 4M78E 3QIIA 5IAYA 3M54A 3UPUA 5KE3A 1Q82C 4C0FA 1VQ9T 4LD9K 2KMTA 4KT0E 4BE0A 2V8IA 1KQSA 4XAXB 2ZPFB 2KK4A 3NTKA 4LDYA 1MHNA 1WGSA 1BIBA 4FT2A 4C5EA 3OW2S 1IZ6A 2QQAA 2LT1A 4C92E 4ZGJB 3P8HA 2DIGA 4OB0B 4PJOG 2CZ0B 1H641 1V29B 2B8AA 4QQ6A 4E47A 3HSBA 2CZ6B 3OS2A 2R57A 1G3TA 3BFMA 3QXEB 1VQ9A 3QDRB 3CPFA 3E19A 1SSFA 2M0OA 4JRPA 2KAFA 3NTIA 5C0MA 3OYFA 3LLRA 4PJOC 1KD1C 3BW1A 2K4YA 4XQ3A 3JCMP 5DLOA 1Q81U 5GAMd 5GAMh 3G4ST 4ATOA 2RB6A 3HHTB 4PJOA 3CCST 2L3RA 5A0DA 3JSCA 2RA2A 4UC4A 5GMKl 1NJIU 5HY6A 3OYCA 2K57A 3CMAA 4PJOD 2LVMA 2XU8A 2JVVA 4ZTJA 1Q82U 1YCYA 2PVOB 2E64A 2EJGA 4JJNK 1VUBA 3A8OB 4B9WA 3PTAA 1NPRA 3QZ9B 3META 4M75G 5IN1A 2VV5A 4J5YA 2ZGWA 4A4EA 4EPCA 3X24B 3ME9A 3TEEA 2RHIA 4BE2A 1VQ4T 1YHQT 4R55A 4EDUA 3J80E 2EWNA 3SDZA 2F5TX 1O9SA 2VXEA 2QQRA 3MO8A 2EQMA 2G3RA 2VC8A 4M75C 2LT4A 2QXFA 4JDSA 5M9OA 3JCMX 1UEBA 3BDUA 4HKEA 2O4XA 5A0LA 2QTXA 4EMHA 1U8RA 3TCJA 1NPPA 2EQJA 2GCXA 2K3YA 3BY7A 3CEYA 5CKEA 4A54A 4C8QF 1KD1U 5KCOA 2LC4A 3F70A 4M75A 3L1AA 3TU4K 4PJOB 1K9MC 4IKFA 1GXIE 2MWOA 2EIFA 3OYJA 3OS1A 1VQ4A 3CC7T 2A7YA 4FT4A 3LGLA 2HQXA 4J8OA 1KQ2A 4MDXA 1W2BA 5LJ5j 3M55A 4M75D 1Q86U 4PLLA 1BI2A 4XU0A 4LDVA 2IG0A 2E65A 3WVEB 3CCUT 2F69A 4L6V5 4OP0A 5CQXA 4HT9A 2E12A 3A8LB 3M4YA 2EJFA 3JCMg 4BDZA 3CBOA 1WJSA 3L2UA 2E1HA 3J81E 5J3BA 1LJOA 3I55A 1OYXA 5FROA 5GANh 1YJNA 4F7UG 3RERA 3CC7A 1N6AA 3OYLA 3X25B 1O75A 3UT1A 3JB9J 3GP8A 2DXCA 3GLXA 4JLGA 4B9XA 3GNFB 1WJQA 2DVEA 2RK2A 3OYYA 3RIRA 3VV0A 3SD4A 2BKDN 2CYZB 3CCUA 5GANf 4NOYA 2MWPA 2DD4A 2XIDA 4IUPA 5GAN2 2O4XB 1QVGS 3DLMA 3HRTA 4QQGA 2JZ2A 2HQEA 1P92A 2WSCE 2EQKA 4XK8E 4XTZA 1VQOT 4M75B 4ZN1A 1PSFA 3OSSC 1BI1A 5GMKi 3OYMA 4C5GA 1JB0E 3OSVA 3PMTA 4XTYA 4F7UA 3S3OA 2DK3A 3QBYA 4KUIA 3VUBA 4A4KA 3HRUA 1OI1A 2O01E 3HP9A 3N5BB 1K9MU 5LJ5e 1NZ9A 1H3ZA 3GIBA 2XKOC 3LWHA 3PT9A 3OS0A 5CIUA 1MGQA 2XG8D 2DAQA 5DLQE 4JRIA 3CC2A 4MDWA 3P8BB 1S72T 5LL6S 3BDLA 4J6WA 5CCAA 1YI2A 2PUKB 3VKIA 1ZQ1A 4DQ2A 3JB9H 3G71T 1JRIA 3C4SA 4E7JA 5FRNA 5HK0A 1UGSB 2K2VA 2QI2A 2HNIA 3H8ZA 3VYHB 4GY5A 5CR2A 5LJ3j 3RMQA 3CC4T 1XOVA 4PNOA 5KCHA 1S72A 1VQ8A 4F7UB 1LOJA 2F5KA 2FL7A 4BI3A 4HT8A 4M7DC 4M78G 2DXTA 4RCBA 2RJCA 3M53A 4D6WA 3G71A 3FRNA 4JS5A 5GMKh 2RD1A 4N4IA 2GQVA 1QP3A 1U1SA 4NS5A 3JCMe 3RKYA 4M7DA 1M1GA 4ZGEB 2A3LA 4PJOF 4XTXA 2WACA 4C5HA 5CAIA 5CK9A 3S3MA 1VQPT 1NE8A 3NFCA 4C92G 2DO3A 2FB7A 3CC4A 1AHJB 1Y7XA 3DB4A 1W4SA 3OBYA 5CKDA 3CMAT 4M7DD 3OQ5A 1Y71A 3PNWC 3S6WA 1KQSS 4M7AE 1OZ2A 2X4WA 4DA4A 1QVFA 3M57A 2DZ9A 4M78A 3A8GB 5GAN8 1B34A 2X4JA 2RK1A 4J7IA 2Y90A 1VQ6A 2MF2A 4C92C 1Q86C 1WNLA 1VQPA 4M78D 1D3BA 4N4HA 4R56A 1VQ5T 4M7AG 4A53A 3SFMA 4MZMA 5DY9A 4J7FA 2X4XA 1XTDA 1RL2A 4XU3A 5FLXE 5FRMA 2GF7A 4C92A 3MP6A 3V8JA 3CCJT 4XTVA 3OS5A 1Y96A 4XU2A 5LJ3e 2DXBA 2DTHA 5DM7R 4BUGA 5LJ5g 3PGGA 4FU6A 4RKUE 3NTHA 4C92D 1HK9A 1M5Q1 2K5FA 2LQKA 3HRSA 5HKCA 3HPWA 5GAMj 3CBPA 2MI6A 2KVQG 4IUTA 4C5IA 3JCMb 2XDBA 3JCMQ 3QUIA 4M7DB 1PSEA 4M75F 5FU6C 1VQ5A 2VUBA 3PIPA 3CMET 1M90C 1JJ2A 3ZEHA 4BE1A 5GAOm 2OTLT 4M7AA 2QQ9A 3L42A 3FC3A 3CCJA 2LX9A 3PIOA 4M77E 5C6SA 4M7AD 4OVAA 1G5VA 3DKMA 3MCAB 2FVUA 3H6ZA 2GFUA 4V2SA 3LW5E 2LCCA 4A4GA 4KULA 2RI2A 3ER0A 2CZ1B 2P0PA 3I55T 1YJWT 2XD0A 1D3BB 2VYTA 2XICA 3CMEA 4M77G 2ZPIB 3OYKA 4BY6C 3P8DA 2H3JA 1BI3A 2M1HA 1YBYA 5CO7A 5HK3A 5GAOn 2OTLA 3HFOA 2QA4A 4E7KA 3V7SA 1JBMA 2YLCA 2RH2A 3Q1JA 4C8QE 5IT9E 5LJ5h 3CCRT 3E9FA 2CGHA 2FYKA 2LDMA 4C0DC 2DTOA 4JRKA 4Q5WA 3J7AF 3CBMA 2V8KA 2QQBA 3LX7A 3VU3C 2LQ8A 2MMPA 5GANd 2RJEA 3ZBDA 1YJWA 5EG2A 2OAUA 3FJPA 2GFAA 2ZPGB 5GAMe 4N0AA 5LJ5f 3QSUA 1N9SA 4XU1A 2DZCA 4L59A 1R8OB 4M77A 4F7UF 3CPWA 3C94A 3JCMc 1W2BS 3CCRA 2E41A 1M90U 4II1A 5FU6B 3LYIA 4M77D 4O6JA 4N4GA 3VYGA 2CZ7B 5I21A 3UWNA 3OYEA 3L2ZA 1EIFA 4OGEA 4KBMB 3MP8A 2AHJB 5GAOq 3M9QA 5GANj 3QHSA 3LWIA 4RMOA 3KUFA 4LDXA 1UB4A 4PL6A 1M8VA 3CC2T 5GMKm 3OMCA 2JOYA 2DKGA 1YI2T 2YLBA 5LJ3g 2QEXT 4E7LA 3MEUA 3CPWS 2PUOB 3OB9A 5GAN7 4WF2A 2Y4YA 1M1FA 2HD0A 3L2VA 3I56T 3FB9A 4BY6B 3JCMh 2MAMA 3CCQT 2X4YA 1VQMT 4ZN3A 3SWNC 1I8FA 4QW2A 3OYGA 4C0DB 1K8AC 4FL6A 3JB9I 3OYIA 3JB9G 4J83A 4FSXA 2RM4A 1VQ8T 2E70A 3M5AA 2RJFA 3JCMf 3OYHA 2X35A 1KHCA 2L8DA 5A0GA 3SWNA 1G3YA 2QEXA 1BYMA 4HCBA 3EFSA 4LD6A 5KH6A 2KDSA 1QVPA 3M4GA 4BB7A 4NL3A 3I56A 2CS7A 3X26B 3CCQA 1VQMA 1N8RC 3OBWA 1G3SA 3V8LA 4M7DF 1IREB 5I2SA 4NL2A 5GAOr 4IUQA 3L2WA 3JCMJ 1WQ7A 1X75C 2FHDA 3QJYA 2RHYA 2E10A 3E9GA 5LJ3h 3OYBA 5GAOl 1N9RA 2E6ZA 4LDUA 4OMFB 3G6ET 5GAN5 3CXCA 4X9CA 4ZTFA 1VQNT 4YTLA 3FEOA 4E7IA 2PVDB 4M78F 5J39A 1KHIA 3JB9D 2VGNA 1VQ6T 3CD6A 3OMGA 1QP2A 4ELYC 2DEQA 2CKKA 3MEWA 5LJ3f 2K3XA 4IUUA 5GAMg 3CCVA 2LCLA 4OGCA 2I2LA 4M78C 4XTWA 3CCLA 4HCCA 3URGA 3M59A 4BI8B 4C0GA 1K73U 2XI9A 4A4HA 1M1KU 3QKJA 2DD5A 4MZTA 4C92F 3JAME 1TH7A 2D6FA 1ZHIA 3SWNB 4PJOE 2DJZA 4ELZC 3G6EA 1VQNA 5AYFA 5CVIA 1K8AU 4RCCA 2ZPBB 5D6YA 1VIFA 5I2MA 3M56A 5L8RE 3T9NA 5GMKj 5D6XA 3CXCS 3MHXA 3FLGA 3GPLA 2HBPA 4J6YA 2NLUA 4MMLA 2DXUA 5FU7C 3EAEA 4Y28E 3X28B 1YJ9T 3JCMV 5CKFA 2LNVA 2E6NA 4O5VA 4CRIA 1N8RU 4M7AF 4LDWA 3DLLA 2R5MA 5KE2A 3QJ6A 2XDPA 2K5LA 3VJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8D A;  2M1H A;  3OYD A;  2YRV A;  2EQK A;  3ASK A;  4E7K A;  3Q1J A;  3OYM A;  4C5G A;  3MEV A;  3E9F A;  2LDM A;  3QII A;  4X34 A;  3PMT A;  5IAY A;  3S3O A;  3DB3 A;  4Q5W A;  3QBY A;  4BDY A;  5KE3 A;  1OZ3 A;  3LX7 A;  1OI1 A;  4BE0 A;  4HCZ A;  2RJD A;  2RJE A;  3NTK A;  1H3Z A;  2GFA A;  1MHN A;  1WGS A;  4C5E A;  4L59 A;  3OS0 A;  3P8H A;  2DIG A;  4PLI A;  2RHZ A;  2RI3 A;  5CIU A;  2D9T A;  2DAQ A;  3GOX A;  4BD3 A;  4QQ6 A;  2B8A A;  4II1 A;  3LYI A;  3OS2 A;  3OYN A;  4N4G A;  3BDL A;  2R57 A;  2R58 A;  3UWN A;  1SSF A;  3OYE A;  2XK0 A;  2M16 A;  2M0O A;  3MP8 A;  3NTI A;  4IUV A;  5C0M A;  3OYF A;  3M9Q A;  3LLR A;  1XNI A;  3C4S A;  3LH0 A;  4E7J A;  5FRN A;  3KUF A;  4PL6 A;  2BIV A;  3H8Z A;  3OMC A;  4GY5 A;  4E7L A;  2PQW A;  3MEU A;  3OB9 A;  5KCH A;  3L2V A;  2L89 A;  2L3R A;  2F5K A;  4UC4 A;  2X4Y A;  3OYC A;  2RJC A;  3MEA A;  2LVM A;  2DIQ A;  4QVZ A;  3FDR A;  4N4I A;  2P0K A;  4NS5 A;  4QW2 A;  4ZTJ A;  3OYG A;  4FL6 A;  3OYI A;  4C5H A;  2WAC A;  4B9W A;  2RJF A;  3OYH A;  3S3M A;  2X35 A;  1KHC A;  2L8D A;  3MET A;  5IN1 A;  2EFI A;  4LD6 A;  3DB4 A;  5KH6 A;  4IUR A;  4A4E A;  3ME9 A;  3OQ5 A;  3PNW C;  2RHI A;  3S6W A;  4BE2 A;  1OZ2 A;  4EDU A;  2X4W A;  3L2Q A;  2QQR A;  3MO8 A;  4RG2 A;  4BAC A;  2EQM A;  2G3R A;  3DLM A;  3OA6 A;  4IUQ A;  3L2W A;  5M9O A;  2FHD A;  2RHY A;  3O8V A;  2O4X A;  3E9G A;  2HQE A;  4N4H A;  3OYB A;  2EQJ A;  2K3Y A;  3CEY A;  2X4X A;  4ZTF A;  5KCO A;  3F70 A;  3FEO A;  4E7I A;  5FRM A;  2GF7 A;  2LRQ A;  3MP6 A;  4IKF A;  5J39 A;  2MWO A;  1RI0 A;  3OYJ A;  3OS1 A;  2JTF A;  3L2R A;  3LGL A;  2HQX A;  3OMG A;  3OYA A;  3MEW A;  2CKK A;  4FU6 A;  2RHX A;  3NTH A;  2K3X A;  4PLL A;  4IUU A;  4E7H A;  2EQU A;  2IG0 A;  3QJ6 A;  4C5I A;  4IUT A;  2EKO A;  3S3N A;  3OYK A;  2R5A A;  3LGF A;  4A4H A;  4Z02 A;  3QKJ A;  4BDZ A;  2RI5 A;  1WJS A;  1N27 A;  3L2U A;  3ZEH A;  4BE1 A;  5D6W A;  1OYX A;  2RHU A;  3L42 A;  5D6Y A;  5FRO A;  3OY9 A;  3FC3 A;  3OYL A;  5D6X A;  3PFS A;  3UT1 A;  3FLG A;  5C6S A;  2NLU A;  2LTO A;  4OVA A;  1G5V A;  4B9X A;  2RO0 A;  3EAE A;  1WJQ A;  3PMI A;  4A4F A;  1WJR A;  2GFU A;  3H6Z A;  3SD4 A;  2LCC A;  4A4G A;  2BKD N;  2E6N A;  4QQD A;  5J26 A;  2RI2 A;  2BUD A;  4CRI A;  2MWP A;  2QQS A;  4IUP A;  3MP1 A;  2O4X B;  2R5M A;  2E5Q A;  2VYT A;  2XDP A;  5KE2 A;  4QQG A;  2JZ2 A; 
#chains in the Genus database with same CATH topology
 1ABO A;  3QO3 A;  2YRV A;  3I5S A;  4X34 A;  2CT3 A;  1UEC A;  2ABL A;  3KXT A;  4EMG A;  1TG0 A;  2PVG B;  4HCZ A;  1SSH A;  1D1C A;  1V76 A;  1K9A A;  2ZPH B;  2QA4 T;  3C95 A;  3VS1 A;  1X69 A;  1UUE A;  2RI3 A;  1XQH A;  1SHF A;  2D9T A;  1UGP B;  4JJC A;  4FIB A;  3RES A;  3OYN A;  1X01 A;  2E3I A;  2R58 A;  2EKH A;  3QYG B;  2XK0 A;  2QDY B;  3QZ5 B;  1G3W A;  4C92 B;  4FSS A;  1NJI R;  5GAN 3;  1VQL A;  5KYN A;  1T3L A;  1M9S A;  1Q82 R;  1X2K A;  5KYW B;  3O5Z A;  1Q7Y C;  4HA8 A;  5GAN 4;  4M7A B;  2DF6 A;  3CCM T;  2VGM A;  3VS3 A;  3VUZ A;  4C8Q C;  1M8M A;  2WSE E;  2EFI A;  4EMK A;  2L0A A;  4ZNX A;  1QVG A;  2HAX A;  3CCE T;  3THK A;  3WVD B;  4AFQ C;  4JRQ A;  1YIT T;  2YXY A;  2NUT B;  3PVL A;  1T3S A;  3OA6 A;  3H0H A;  1NLP C;  4MZP A;  1MUZ A;  2DER A;  3HL8 A;  5CKH A;  2OTJ A;  3L2R A;  2AKK A;  1Y0M A;  1QWE A;  2RHX A;  3FIF A;  4M77 B;  4AFS C;  1YJN T;  3MPU B;  4X9D A;  4E7H A;  3JB9 F;  1M27 C;  1HSQ A;  3C0C A;  1BI0 A;  2R5A A;  3LGF A;  4Z02 A;  1TS9 A;  2RI5 A;  3CD6 T;  1N27 A;  5KYY A;  2BE7 D;  1UJ0 A;  2K5I A;  3SB2 A;  2KSS A;  1HD3 A;  1ZX6 A;  4M7D E;  4KUD K;  1RAF B;  2KT8 A;  2LJ0 A;  1U06 A;  3RKW A;  1KC8 U;  1VQK A;  1AD5 A;  3A8H B;  1GCP A;  4CC3 A;  1K9M R;  1NJI C;  1KQS P;  1VQ7 Q;  2CP2 A;  2SEM A;  2FPE A;  1Q82 C;  2KMT A;  2HMA A;  4KT0 E;  2EYY A;  4XAX B;  2ZPF B;  3NTK A;  4LDY A;  4C5E A;  3OW2 S;  2LT1 A;  3CCV Q;  4PJO G;  4QQ6 A;  2R57 A;  3BFM A;  1VQ9 A;  1WHK A;  2L3S A;  2M0O A;  3NTI A;  2FO0 A;  2CP3 A;  2DE0 X;  3LLR A;  1AZG B;  2I0N A;  3A98 A;  2YUN A;  2ED0 A;  2QG9 B;  1BK2 A;  3JSC A;  2HKQ B;  4CC7 A;  4FYW B;  4PJO D;  1WHM A;  2DEU A;  1YCY A;  2PVO B;  1MND A;  2E64 A;  3A8O B;  4B9W A;  2VV5 A;  4A63 B;  1BBZ A;  2ESW A;  3X24 B;  3J80 E;  3SDZ A;  1IXD A;  2VC8 A;  3E2U A;  3BDU A;  5A0L A;  1W2B P;  3TCJ A;  2EQJ A;  3R6N A;  3EGD B;  1KD1 U;  4PJO B;  1K9M C;  1VQ4 A;  3OS1 A;  3SEM A;  2JS2 A;  2IG0 A;  3ULR B;  4OP0 A;  4HT9 A;  3A8L B;  2EJF A;  2JMC A;  1PKT A;  1WJS A;  2E1H A;  3I55 A;  2J6O A;  5IHK A;  1O75 A;  3UT1 A;  3NHN A;  4B9X A;  3GNF B;  1WJQ A;  2CYZ B;  3CCU A;  3D7S B;  1AWJ A;  2RQV A;  4QQG A;  2F2V A;  3CC7 Q;  1PSF A;  2DA9 A;  3OSV A;  2EQI A;  3S3O A;  2QDL A;  4XTY A;  2A36 A;  2DK3 A;  4KUI A;  4A4K A;  3HRU A;  3N5B B;  1M90 R;  1H3Z A;  2XKO C;  5CIU A;  2LMJ A;  5EC7 A;  2DAQ A;  2RPN A;  1UE9 A;  5CCA A;  5GJW B;  5KYX A;  2O88 A;  2AZS A;  3REB B;  1RAE B;  1RAI B;  5HK0 A;  1Y57 A;  2DIL A;  1XOV A;  2QGG A;  4PNO A;  2BE9 B;  5KCH A;  1S72 A;  1VQ8 A;  1LOJ A;  2F5K A;  4M7D C;  2DXT A;  5GMK h;  1QP3 A;  3RKY A;  2DRM A;  1M1G A;  5CAI A;  4PJO F;  1VQP T;  1UDL A;  3NFC A;  1AHJ B;  1Y7X A;  1W4S A;  1ZBJ A;  2GNC A;  1D0X A;  1KQS S;  4M7A E;  2X4W A;  4M78 A;  2RK1 A;  4J7I A;  4EIK A;  1VQ6 A;  2MF2 A;  4N4H A;  4R56 A;  1U3O A;  4A53 A;  2D1X A;  4MZM A;  3QWX X;  2X4X A;  1AWO A;  3MP6 A;  3EH2 A;  3CCJ T;  4XU2 A;  5LJ3 e;  5GJV B;  2DTH A;  5DM7 R;  3PGG A;  4FU6 A;  4RKU E;  2K5F A;  3HRS A;  2LQK A;  5HKC A;  1B7T A;  2B86 A;  2KVQ G;  1M90 C;  1JJ2 A;  2COY A;  5GAO m;  2QQ9 A;  2MPX C;  2KRS A;  3L42 A;  3FC3 A;  1M2V A;  4M77 E;  5C6S A;  2FVU A;  1VQ5 Q;  3ER0 A;  2LCS A;  2JS0 A;  1D3B B;  2VYT A;  1PHT A;  2MYS A;  3P8D A;  2M1H A;  5CO7 A;  1UFF A;  1RAG B;  2QA4 A;  4E7K A;  2YLC A;  3Q1J A;  5IT9 E;  3CCR T;  2CGH A;  4C0D C;  4JRK A;  2D8J A;  4Q5W A;  3UF4 A;  3CBM A;  3VU3 C;  5GAN d;  1YJW A;  2ZPG B;  2OTL Q;  1QKX A;  3C94 A;  1W2B S;  2CT4 A;  4II1 A;  3REA B;  2YDL A;  2AK5 A;  2CZ7 B;  2IIM A;  1AOJ A;  2KYM A;  3L2Z A;  3M0T A;  1MMN A;  2GTO A;  2AHJ B;  3M9Q A;  1SRM A;  2O31 A;  4RMO A;  3KUF A;  1G83 A;  1Q95 G;  1YI2 T;  2OX7 A;  5LJ3 g;  2AIR B;  4E7L A;  3H41 A;  3CPW S;  1M1F A;  4J9I A;  1R0B G;  3SWN C;  4E6R A;  2RM4 A;  2E70 A;  1AWX A;  1KHC A;  2EVR A;  3MJX A;  5A0G A;  2KDS A;  2CS7 A;  1G3S A;  3V8L A;  5GAO r;  1W70 A;  1WQ7 A;  3QJY A;  2QEX Q;  3OYB A;  5GAO l;  5IXF A;  4LDU A;  3CXC A;  1VQN T;  3FEO A;  1WA7 A;  2FZC B;  2KXC A;  2EBP A;  1KHI A;  2P84 A;  2VGN A;  4DBQ A;  5J39 A;  3CD6 A;  3OMG A;  4FCY A;  4ELY C;  4IUU A;  2LCL A;  1CSK A;  8AT1 B;  2LJ1 A;  4C0G A;  1K73 U;  1IGQ A;  4MZT A;  5AT1 B;  2A0F B;  5HCK A;  4PJO E;  3G6E A;  1RI9 A;  1AT1 B;  1D0Z A;  5GMK j;  4LNP A;  3FLG A;  3VS2 A;  1I1J A;  2HEQ A;  3JCM V;  1N8R U;  2KRM A;  2AKL A;  3DLL A;  1K73 R;  2EW3 A;  5KE2 A;  2EGE A;  1D1A A;  2E4H A;  1IHV A;  3OYD A;  4M7A C;  5GAO p;  2MOX A;  8ATC B;  3GBQ A;  3ZFJ A;  4BDY A;  4MMK A;  2QAS A;  2F2X A;  1QW1 A;  1K0S A;  2RJD A;  4F16 A;  3E1S A;  2EAY A;  1GFC A;  2QK0 A;  1UGR B;  5GAM f;  2DYI A;  4KGV B;  4PLI A;  4DBF A;  2RHZ A;  4BD3 A;  1VIE A;  2V8J A;  5FWB A;  1HXD A;  2P0Q A;  1HJD A;  2M16 A;  3M58 A;  4E7S A;  5GAN g;  1XNI A;  3LH0 A;  5LJ5 d;  3PE0 A;  5FU7 B;  4N0A C;  2KRN A;  2M9U A;  2FZK B;  1QCF A;  4M77 C;  1KQ1 A;  1VA7 A;  2L5Q A;  4DBH A;  4JZ4 A;  3MEA A;  2NYS A;  2Y4X A;  1VQL Q;  2KQW A;  4CI0 C;  1V1C A;  4VUB A;  4IUR A;  1D1B A;  4PFP A;  4ZGD B;  4RTY A;  1FWZ A;  4DOW A;  3A8M B;  1FYN A;  1YNZ A;  2LJ3 A;  4M4Z A;  1LNX A;  3JCM d;  1K73 C;  2C06 A;  1MNE A;  2P4T A;  1RI0 A;  2JTF A;  1VYU A;  1Z9Q A;  1VQ7 T;  3OYA A;  2YHT A;  1UG1 A;  1QQJ A;  1Q7Y U;  2EQU A;  3S3N A;  2EKO A;  1M4Z A;  3JRZ A;  4Y91 A;  3M0U A;  4EMK B;  2OTJ Q;  1X43 A;  5D6W A;  3OY9 A;  4OMM A;  3CCV T;  3OW2 P;  1AEY A;  4JUV A;  5CKB A;  2RO0 A;  3KBG A;  4A4F A;  1YIJ A;  1I5L A;  3A5Z B;  4QQD A;  5J26 A;  1I4K 1;  1TTH B;  3L2Q A;  3RKX A;  3JCM W;  1QLY A;  5IXB A;  2AT1 B;  4KGZ B;  5FWC A;  3HFN A;  3M54 A;  1MMG A;  4LD9 K;  2JM8 A;  1K76 A;  1VQK Q;  1PC0 A;  2H3E B;  1JU5 C;  1MHN A;  1BIB A;  2GTJ A;  1K4U S;  2DIG A;  4OB0 B;  3CCL Q;  2B8A A;  2YUQ A;  5IHN A;  3HSB A;  3QXE B;  4RTT A;  3CPF A;  3EG9 B;  3OYF A;  4PJO C;  1OU9 A;  3BW1 A;  3JCM P;  5DLO A;  3SHW A;  1M30 A;  4KGX B;  1VQ9 Q;  3M0S A;  5A0D A;  1NJI U;  1LPL A;  4RTZ A;  1NEG A;  3OYC A;  4ZTJ A;  2X3X D;  2SRC A;  1Q82 U;  2KGT A;  2HDA A;  4JJN K;  5I11 A;  3QZ9 B;  3MET A;  5IN1 A;  1ARK A;  3EH1 A;  1B3Q A;  4A4E A;  4PJJ A;  3ME9 A;  1OQK A;  1JEG A;  4BE2 A;  2CP7 A;  1ZLM A;  4AG1 C;  2QQR A;  5IHI A;  1PRM C;  2EQM A;  2G3R A;  2QXF A;  1UEB A;  3G4S Q;  3EG1 A;  2QTX A;  3BY7 A;  2GCX A;  4A54 A;  3CEY A;  5CKE A;  3CCS Q;  5KCO A;  2LC4 A;  3F70 A;  4M75 A;  1GXI E;  2JJ9 A;  2ED1 A;  2MWO A;  3CC7 T;  3OYJ A;  2CP6 A;  4J8O A;  1KQ2 A;  5LJ5 j;  3M55 A;  2OI3 A;  2KYB A;  3ZL7 C;  4L6V 5;  1MV3 A;  3I9Q A;  5CQX A;  2KT1 A;  3JCM g;  2CP0 A;  3HTR A;  3J81 E;  5J3B A;  1EFN A;  1VQ4 Q;  1YHQ Q;  1I0C A;  2NUP A;  1N6A A;  3OYL A;  3JB9 J;  3GLX A;  2J7I A;  2MWP A;  2XID A;  4IUP A;  3DLM A;  2HQE A;  1IGU A;  1P92 A;  2WSC E;  3EGU A;  4XK8 E;  4ZN1 A;  1BI1 A;  5GMK i;  4C5G A;  1M3C A;  4F7U A;  3VUB A;  1K9M U;  3CCU Q;  3GIB A;  3LWH A;  4DEY A;  2XG8 D;  5DLQ E;  4JRI A;  3P8B B;  5LL6 S;  4FW1 A;  4ANJ A;  3EG0 A;  1YI2 A;  3VKI A;  1ZQ1 A;  4DQ2 A;  3C4S A;  5FRN A;  2K2V A;  1VQO Q;  2HNI A;  1OEB A;  1OX9 A;  1R77 A;  2FL7 A;  1PCX A;  4HT8 A;  4M78 G;  2RJC A;  3G71 A;  2GQI A;  4C5H A;  4XTX A;  1QVF P;  1X6B A;  1ZSZ A;  1S72 Q;  1VQ8 Q;  2DO3 A;  2FB7 A;  3CC4 A;  3OBY A;  1RAA B;  2KRO A;  3TVT A;  4J9G A;  4DA4 A;  5GAN 8;  2X4J A;  2NUZ A;  1BCM A;  4M78 D;  1SRL A;  1VQ5 T;  2KEA A;  1TUC A;  5FLX E;  2GF7 A;  4C92 A;  2VVK A;  2L3P A;  3H0F A;  1WDX A;  1GCQ A;  2FPD A;  1HK9 A;  4J9D A;  3NGP A;  2XDB A;  5KYW A;  3JCM b;  3JCM Q;  1PSE A;  1OV3 A;  4J9B A;  1C0M A;  3CMA Q;  1T0J A;  1QWF A;  3FJ5 A;  4BE1 A;  2OTL T;  4M7A A;  3U23 A;  4ORZ A;  2KXD A;  2LX9 A;  3G1J A;  3DKM A;  2GFU A;  3LW5 E;  2LCC A;  2LP5 A;  4KUL A;  1ACM B;  2CZ1 B;  2EGC A;  3CME A;  1LVK A;  2NUT A;  5GAO n;  3E9F A;  2LDM A;  2FYK A;  3J7A F;  2QAZ A;  4FYV B;  3CPW P;  2LQ8 A;  2GFA A;  4N0A A;  2CH4 W;  4M77 A;  1YCS B;  1M90 U;  2E41 A;  3LYI A;  4O6J A;  4N4G A;  1IRX A;  2ROT A;  3OYE A;  1EIF A;  4OGE A;  1YJW Q;  7AT1 B;  4J9F A;  2P4R A;  2DVJ A;  2HSP A;  4LDX A;  1UB4 A;  4PL6 A;  1M8V A;  5GMK m;  3OMC A;  2CUB A;  1KFZ A;  1RLP C;  2YLB A;  2QEX T;  2DBM A;  5GAN 7;  2BTT A;  4BY6 B;  2MAM A;  2GGR A;  5KYU A;  2X4Y A;  2ATC B;  1KIK A;  4F14 A;  3M5A A;  2CP5 A;  1BYM A;  4HCB A;  4LD6 A;  5KH6 A;  2MCN A;  1QVP A;  2EPD A;  3I56 A;  2EGA A;  2X9H A;  3CCQ A;  1VQM A;  6AT1 B;  3CC2 Q;  3JCM J;  2PTK A;  5LJ3 h;  2D8H A;  1N9R A;  2D0N A;  5GAN 5;  2QYZ A;  4X9C A;  4YTL A;  2PVD B;  4M78 F;  3LH5 A;  4F04 B;  5LJ3 f;  1G2B A;  3CCV A;  4XTW A;  2I2L A;  4HCC A;  3URG A;  3M59 A;  2XI9 A;  1JXM A;  2LQN A;  3EGX A;  2JT4 A;  1ZUY A;  1NG2 A;  3TQ7 P;  1OU8 A;  1TUD A;  5CVI A;  2DMO A;  5D6Y A;  3T9N A;  3CXC S;  4J6Y A;  1BU1 A;  2G6F X;  2DXU A;  5FU7 C;  3EAE A;  1SKU B;  2E6N A;  1GRI A;  1YP5 A;  1PWT A;  3G6E Q;  2JM9 A;  1WI7 A;  1M3A A;  2FPF A;  4PJL A;  2O9S A;  1QVF S;  1DJ7 B;  3RMS A;  1YJ9 A;  1OZ3 A;  3QG1 A;  1FMW A;  4OF1 A;  5GAN 6;  4J6X A;  2JNG A;  3M0P A;  4OB3 B;  1K1Z A;  2RF0 A;  3G7Z A;  4FM4 B;  1VQL T;  4LE9 A;  1B34 B;  2PU9 B;  3GOX A;  4XTU A;  1PKS A;  3RUX A;  3I5R A;  1Q81 R;  1AWW A;  5GMK e;  1MV0 B;  4E2F B;  1Y96 B;  1UGQ B;  2BIV A;  3QDF A;  4JZ3 A;  1WPY A;  2PQW A;  4TVR A;  1C6V X;  2L89 A;  2XDD A;  1JQQ A;  2KI7 A;  1OX8 A;  2RNA A;  1WHJ A;  4EMK C;  4QVZ A;  1QVG P;  3FDR A;  3QPH A;  2P0K A;  4GLK A;  3C12 A;  3HKS A;  2M51 A;  2VAS A;  2OTJ T;  2VXF A;  2EYQ A;  1WIE A;  4C8Q A;  2HCK A;  4WTO B;  3CCM A;  3EFR A;  1T0H A;  4PJM A;  1R0C B;  1CKB A;  3CCE A;  4GLM A;  2LRQ A;  2J05 A;  1YIT A;  1FXX A;  2JN0 A;  2BZY A;  2RQW A;  1FMK A;  3V7R A;  4LN2 A;  1VQK T;  3EFO B;  1BKB A;  3X20 B;  2YRD A;  4J9E A;  3PFS A;  4QVD A;  3CCL T;  2XHC A;  2ROL A;  1YJN A;  3PMI A;  5GAN e;  1Q81 C;  4FYY B;  2BUD A;  2CDT A;  3MP1 A;  3TSW A;  1GL5 A;  1WQW A;  1WYX A;  1QKW A;  2WSF E;  4OMN A;  3ASK A;  4M7D G;  4LUD A;  4M78 E;  2A37 A;  2YRC A;  5IAY A;  1YIJ Q;  4D8D A;  3UPU A;  1RLQ C;  5KE3 A;  4C0F A;  1VQ9 T;  2PNI A;  4BE0 A;  1KQS A;  2RQT A;  1WGS A;  4ZGJ B;  3P8H A;  1WXT A;  2CZ0 B;  1V29 B;  3OS2 A;  2C0T A;  1SSF A;  1YWP A;  1N5Z A;  4JRP A;  2JW4 A;  1M3B A;  5D7U A;  4XQ3 A;  5GAM d;  5GAM h;  3G4S T;  4ATO A;  2RB6 A;  3HHT B;  2HL5 C;  3CCS T;  2L3R A;  2YUP A;  4RTW A;  2RA2 A;  4UC4 A;  2C0I A;  2LVM A;  2XU8 A;  1I5O B;  1SHG A;  2EJG A;  1VUB A;  1ZUU A;  3PTA A;  3QWY A;  4M75 G;  1NLO C;  4J5Y A;  4EPC A;  1UTI A;  1VQ4 T;  1YHQ T;  2EWN A;  1IO6 A;  2DL5 A;  2F5T X;  2VXE A;  3MO8 A;  4OMO A;  2LT4 A;  4FYX B;  4JDS A;  1WHL A;  5M9O A;  2Z0W A;  4HKE A;  2O4X A;  2NWM A;  1F1B B;  2DYB A;  2K3Y A;  3L1A A;  4IKF A;  4FT4 A;  3LGL A;  2CSI A;  4MDX A;  1W2B A;  2DNU A;  2DBK A;  4M75 D;  4PFO A;  4PLL A;  4XU0 A;  4LDV A;  1E7O A;  2DX1 A;  1VOM A;  3WVE B;  3CCU T;  2F69 A;  3M4Y A;  1LJO A;  1X6G A;  4PFZ A;  4F7U G;  2DXC A;  2HBW A;  3RIR A;  3SD4 A;  1I07 A;  4Z88 A;  4HVV A;  4NOY A;  1W1F A;  2DD4 A;  5GAN 2;  1TWB A;  1QVG S;  1TUG B;  2JZ2 A;  2EQK A;  1VQO T;  1UGV A;  4M75 B;  1JB0 E;  1WHH A;  4FW2 A;  2JTE A;  1NYF A;  3QBY A;  3HP9 A;  5LJ5 e;  1NZ9 A;  2HL3 A;  1D09 B;  1YWO A;  3PT9 A;  4HCK A;  3OS0 A;  2K7A A;  1MGQ A;  2NUP B;  4MDW A;  1S72 T;  3BDL A;  1E6H A;  4J6W A;  2O2O A;  2K79 A;  3JB9 H;  4E7J A;  3H8Z A;  4B6M A;  1IHW A;  3RMQ A;  2COW A;  4F7U B;  3TSZ A;  2LX7 A;  1D0Y A;  4D6W A;  3M53 A;  5KYY B;  3FRN A;  2GQV A;  4J9H A;  3JCM e;  4M7D A;  4ZGE B;  5CK9 A;  2A3L A;  2WAC A;  3S3M A;  2O9V A;  2JMA A;  4C92 G;  3RNJ A;  3CMA T;  3OQ5 A;  1Y71 A;  3PNW C;  3G71 Q;  1M2O A;  3M57 A;  2DZ9 A;  2RMO A;  2Y90 A;  1VQP A;  4M7A G;  2W10 A;  3CC4 Q;  3SFM A;  4J7F A;  1ZSG A;  4XTV A;  2DXB A;  4BUG A;  5LJ5 g;  1JJ2 P;  4C92 D;  1K8A R;  1M5Q 1;  1EZZ B;  5GAM j;  4KH0 B;  4C5I A;  4M75 F;  1ZSZ B;  2J6K A;  3CCJ A;  4DEX A;  4M7A D;  4HVU A;  4OVA A;  1G5V A;  4OMQ A;  1WHG A;  3MCA B;  3H6Z A;  4V2S A;  2DFU A;  2XMF A;  2DET A;  1AVZ C;  1YJW T;  4CC2 A;  1JXO A;  4M77 G;  3OYK A;  4BY6 C;  3HFO A;  3V7S A;  2RH2 A;  2DTO A;  2V8K A;  4F17 A;  2QQB A;  1UHF A;  2RJE A;  3CME Q;  3ZBD A;  2OAU A;  4Y92 A;  3FJP A;  5IH2 A;  4IIM A;  4XU1 A;  4L59 A;  1R8O B;  4F7U F;  4GBQ A;  2V1Q A;  3CCR A;  3CQT A;  2VWF A;  5FU6 B;  4M77 D;  4JPB W;  2EYX A;  3UWN A;  3I55 Q;  3QHS A;  3LWI A;  3CC2 T;  2AZV A;  2J6F A;  3OB9 A;  3L2V A;  4WF2 A;  1RAH B;  2M0Y A;  1OUL A;  2BZX A;  1I8F A;  1JO8 A;  2K6D A;  1K8A C;  4J83 A;  4FSX A;  2RJF A;  2X35 A;  3SWN A;  1G3Y A;  3H9N A;  1BB9 A;  4BB7 A;  4NL3 A;  1WXU A;  1W6X A;  3OBW A;  1IRE B;  5I2S A;  4NL2 A;  3CXC P;  1YFN A;  4IUQ A;  1X75 C;  2FHD A;  3E9G A;  1SPK A;  1TOV A;  1CKA A;  3EG9 A;  2E6Z A;  3VS4 A;  3G6E T;  3I56 Q;  2MIO A;  4E7I A;  3CCQ Q;  3NPF A;  1VQM Q;  1UJY A;  3I35 A;  2FRY A;  5KYU B;  1X27 A;  4D8K A;  2A08 A;  3MEW A;  1QCN A;  4OGC A;  3CCL A;  5FW9 A;  4ESR A;  4HXJ A;  1M1K U;  3QKJ A;  3JAM E;  4C92 F;  1TH7 A;  1ZHI A;  3M0R A;  5KYX B;  2DJZ A;  1VQN A;  4RCC A;  5I2M A;  5D6X A;  3MHX A;  3GPL A;  1KC8 R;  2HBP A;  4MML A;  1NYG A;  4AT1 B;  4Y28 E;  1TXQ A;  3X28 B;  3NMZ C;  2DL3 A;  2LNV A;  4O5V A;  4M7A F;  4LDW A;  3QJ6 A;  2XDP A;  1M1K R;  2K5L A;  3VYH B;  3PIP A;  2YSQ A;  3V7C A;  1ZBX A;  1VQ6 Q;  2HSE B;  1RAB B;  3DB3 A;  3V8K A;  2ZZD A;  4OMP A;  2EJ9 A;  4OB2 B;  3EGX B;  4M75 E;  4M78 B;  2LQW A;  1FX7 A;  4L5G A;  1YJ9 Q;  1RUW A;  3G4S A;  3PVQ A;  4C0Z A;  3CCS A;  1JJ2 S;  4M77 F;  4IUV A;  2KY9 A;  4BI4 A;  1X6O A;  2VB6 A;  2L3Q A;  2CSQ A;  4LUE A;  4OB1 B;  2KNB B;  4C8Q G;  2QGF B;  1ZA1 B;  1SF9 A;  1MMA A;  2ZPE B;  2QA4 Q;  2DIQ A;  3UDC A;  2FRW A;  3WXM B;  1OOT A;  1YHQ A;  1M2V B;  1J3T A;  4ME7 A;  4P5N A;  4F7U E;  5CQY A;  1VYT A;  1I81 A;  2ZCF B;  1Y07 A;  4QVC A;  3VS7 A;  2M02 A;  2VKN A;  1KC8 C;  1KD1 R;  4RG2 A;  4BAC A;  4QKU A;  3BE3 A;  4C8Q D;  2DPP B;  3GNG A;  3O8V A;  4PKC C;  3RDV A;  2JUF A;  2IVW A;  1M1K C;  2OJ2 A;  3AHU A;  2JTM A;  3QYH B;  2W0Z A;  3CCM Q;  1YIJ T;  2DLP A;  4OML A;  1U1T A;  2DTI A;  4AG2 C;  4HVW A;  3GF5 A;  4J9C A;  1BIA A;  3CCE Q;  4JS4 A;  2E5K A;  2RHU A;  1YIT Q;  3R6O A;  1VQ7 A;  4C8Q B;  1ZUK A;  4Z89 A;  2LTO A;  5A2Q E;  5LJ3 d;  1VQO A;  2CUD A;  4JLI A;  1WJR A;  1AZE A;  4DOV A;  4RG8 A;  2QQS A;  3TRE A;  1K0X A;  3OW2 A;  2E5Q A;  4PK4 A;  3INZ A;  2QTV A;  2LZ6 B;  2KE9 A;  1WFW A;  2D0Q B;  4K11 A;  1HYO A;  2HQH A;  3MEV A;  3QII A;  1YJN Q;  1S1N A;  2V8I A;  3EG3 A;  2KK4 A;  3CD6 Q;  1RAD B;  4FT2 A;  2KR3 A;  1SEM A;  1IZ6 A;  2QQA A;  1C1A A;  1TSF A;  4C92 E;  1WZO A;  3A1P A;  1QMC A;  1H64 1;  2DM1 A;  3VRZ A;  4E47 A;  3EG2 A;  2CZ6 B;  1G3T A;  3QDR B;  3E19 A;  2KAF A;  5C0M A;  4Z8A A;  3RR6 A;  1KD1 C;  2K4Y A;  4JJD A;  1E6G A;  1Q81 U;  1BCO A;  3EGD A;  5L23 A;  4PJO A;  5GMK l;  1ZA2 B;  3MKD A;  5HY6 A;  2K57 A;  3CMA A;  2JVV A;  1H92 A;  1PRL C;  1MMD A;  1NPR A;  1YN8 A;  1SG5 A;  2X3W D;  1NM7 A;  2ZGW A;  3TEE A;  2A28 A;  2RHI A;  3VS0 A;  4R55 A;  1X2Q A;  4EDU A;  1O9S A;  1Z9Z A;  4M75 C;  3JCM X;  3VRY A;  1U8R A;  4EMH A;  1NPP A;  2K9G A;  4C8Q F;  4AMC A;  1NEB A;  3TU4 K;  1KG1 A;  4KH1 B;  4E7Z A;  2EIF A;  2A7Y A;  2HQX A;  1ABQ A;  1FMV A;  3JV3 A;  1Q86 U;  1U5S A;  3AT1 B;  1PG5 B;  1BI2 A;  3UA7 A;  5ECA A;  2E65 A;  2EYW A;  4IIO A;  2E12 A;  4BDZ A;  3CBO A;  3L2U A;  2H8H A;  1OYX A;  5FRO A;  5GAN h;  3RER A;  1LCK A;  3CC7 A;  3X25 B;  1PD1 A;  3GP8 A;  4JLG A;  2HKN A;  2DVE A;  2RK2 A;  3OYY A;  3VV0 A;  1Q86 R;  2BKD N;  5GAN f;  2O4X B;  3HRT A;  2OAW A;  4XTZ A;  3OSS C;  3OYM A;  3VS6 A;  1EX4 A;  2GBQ A;  3PMT A;  3UA6 A;  2ECZ A;  3EHR A;  1OI1 A;  2O01 E;  2YWW A;  1RAC B;  3EHQ A;  3UAT A;  2F1L A;  1QCO A;  1GBQ A;  3CC2 A;  1UHC A;  2DL7 A;  5I22 A;  2JXB A;  2PUK B;  2CRE A;  3G71 T;  1PD0 A;  1JRI A;  1KK7 A;  1UGS B;  2L2P A;  2QI2 A;  4GY5 A;  5CR2 A;  5LJ3 j;  3CC4 T;  2LNH B;  4BI3 A;  1B07 A;  1TU0 B;  4RCB A;  1ZSZ C;  4JS5 A;  2RD1 A;  4N4I A;  4NS5 A;  1U1S A;  4X1V A;  4QT7 A;  1VYV A;  4RTX A;  1NE8 A;  1XJW B;  1PM3 A;  2MK5 A;  2F2W A;  4RUG A;  3DB4 A;  5CKD A;  4M7D D;  3S6W A;  1OZ2 A;  1QVF A;  2FG0 A;  3A8G B;  1B34 A;  4C92 C;  1Q86 C;  1WNL A;  2PZ1 A;  1D3B A;  2DJQ A;  1GCQ C;  5DY9 A;  1XTD A;  1RL2 A;  4XU3 A;  3VS5 A;  9ATC B;  1OPK A;  5FRM A;  3V8J A;  2KBT A;  3OS5 A;  1Y96 A;  1A0N B;  3NTH A;  1H3H A;  3HPW A;  1VQP Q;  2FZG B;  3CBP A;  2MI6 A;  4IUT A;  2V1R A;  4M7D B;  3QUI A;  5FU6 C;  1VQ5 A;  2VUB A;  3CME T;  2DL4 A;  3ZEH A;  2EYZ A;  1N8R R;  4AFZ C;  3PIO A;  1KSW A;  4A4G A;  1G8X A;  2RI2 A;  2P0P A;  3I55 T;  2XD0 A;  2XIC A;  3H0I A;  2ZPI B;  2H3J A;  1BI3 A;  5HK3 A;  1YBY A;  2IPO B;  3CCJ Q;  2OTL A;  1GFD A;  4RTV A;  1JBM A;  4C8Q E;  4KRT A;  5LJ5 h;  4CC4 B;  2RN8 A;  3LX7 A;  2MMP A;  5EG2 A;  1WXB A;  5GAM e;  3QSU A;  5LJ5 f;  1N9S A;  2DZC A;  2HZY A;  3RBB B;  3CPW A;  3JCM c;  2ZAE A;  4JJB A;  4DBR A;  3VYG A;  5I21 A;  3EFO A;  4KBM B;  3MP8 A;  5GAO q;  5GAN j;  2JOY A;  2DKG A;  3CCR Q;  3MEU A;  2FEI A;  2PUO B;  2Y4Y A;  2HD0 A;  3IQL A;  1OPL A;  3I56 T;  3FB9 A;  3JCM h;  3CCQ T;  2BZ8 A;  1VQM T;  2K3B A;  4ZN3 A;  1IB8 A;  4LXC A;  4QW2 A;  3OYG A;  4C0D B;  4FL6 A;  3JB9 I;  3OYI A;  3JB9 G;  2J06 A;  3KFV A;  1VQ8 T;  3JCM f;  3OYH A;  2L8D A;  2QEX A;  4PJN A;  1GBR A;  2DL8 A;  3EFS A;  1WLP B;  3M4G A;  2YT6 A;  3X26 B;  2E3H A;  2CH4 A;  1N8R C;  4M7D F;  2C0O A;  1NBE B;  3L2W A;  2V26 A;  4RTU A;  2RHY A;  1YI2 Q;  3M0Q A;  2E10 A;  4OMF B;  1Q7Y R;  4ZTF A;  2K2M A;  3JB9 D;  1VQ6 T;  1QP2 A;  4WCI A;  2DEQ A;  2CKK A;  2K3X A;  2DRK A;  5GAM g;  4M78 C;  4BI8 B;  1PNJ A;  4A4H A;  1H8K A;  2RQR A;  2DD5 A;  1KJW A;  2D6F A;  2YUO A;  3SWN B;  4ELZ C;  5AYF A;  1K8A U;  2ZPB B;  1VIF A;  5L8R E;  3M56 A;  2RQU A;  1WX6 A;  2NLU A;  2ENM A;  1YJ9 T;  2X51 A;  5CKF A;  4AFU C;  4CRI A;  4R0K A;  2R5M A;  1VQN Q;  3VJP A;  2COZ A; 
#chains in the Genus database with same CATH homology
 3V7C A;  1ZBX A;  3QO3 A;  3OYD A;  2YRV A;  4M7A C;  5GAO p;  1QVF S;  4X34 A;  1DJ7 B;  3ZFJ A;  3DB3 A;  4EMG A;  3KXT A;  4BDY A;  3RMS A;  2PVG B;  3V8K A;  4MMK A;  1YJ9 A;  1OZ3 A;  3QG1 A;  2ZZD A;  1QW1 A;  4OF1 A;  4HCZ A;  5GAN 6;  2EJ9 A;  4J6X A;  2RJD A;  3E1S A;  2EAY A;  2JNG A;  4OB2 B;  2QA4 T;  2ZPH B;  4OB3 B;  3C95 A;  3G7Z A;  4M75 E;  4FM4 B;  1UGR B;  5GAM f;  1VQL T;  4M78 B;  4PLI A;  2RHZ A;  1XQH A;  1B34 B;  2RI3 A;  2PU9 B;  2D9T A;  4XTU A;  3GOX A;  1FX7 A;  1UGP B;  4L5G A;  4FIB A;  4BD3 A;  3RUX A;  1VIE A;  2V8J A;  3RES A;  3OYN A;  5GMK e;  1X01 A;  1HXD A;  2R58 A;  3G4S A;  2P0Q A;  3QYG B;  4C0Z A;  2XK0 A;  2M16 A;  2QDY B;  3M58 A;  3CCS A;  3QZ5 B;  4M77 F;  4IUV A;  1JJ2 S;  5GAN g;  1G3W A;  4C92 B;  1XNI A;  3LH0 A;  5LJ5 d;  2KY9 A;  1Y96 B;  4BI4 A;  1UGQ B;  5FU7 B;  5GAN 3;  1X6O A;  2M9U A;  2BIV A;  4N0A C;  1VQL A;  1M9S A;  1WPY A;  2PQW A;  4M77 C;  4TVR A;  4OB1 B;  1KQ1 A;  2L89 A;  4C8Q G;  2XDD A;  1Q7Y C;  2L5Q A;  4HA8 A;  2ZPE B;  5GAN 4;  3MEA A;  4M7A B;  4EMK C;  2DIQ A;  4QVZ A;  3UDC A;  3FDR A;  3WXM B;  2Y4X A;  2P0K A;  3QPH A;  1YHQ A;  3CCM T;  2VGM A;  4GLK A;  3C12 A;  4ME7 A;  3VUZ A;  2KQW A;  4C8Q C;  3HKS A;  2WSE E;  4CI0 C;  2EFI A;  4P5N A;  4EMK A;  4VUB A;  4F7U E;  5CQY A;  1QVG A;  2HAX A;  3CCE T;  4IUR A;  2OTJ T;  2VXF A;  1I81 A;  2EYQ A;  2ZCF B;  1Y07 A;  4ZGD B;  3WVD B;  4QVC A;  1FWZ A;  4C8Q A;  4JRQ A;  1YIT T;  1KC8 C;  4RG2 A;  4BAC A;  3OA6 A;  4DOW A;  3A8M B;  3CCM A;  4C8Q D;  3EFR A;  2DPP B;  3GNG A;  3O8V A;  4PKC C;  1LNX A;  3JCM d;  4MZP A;  2JUF A;  1K73 C;  2IVW A;  2C06 A;  1M1K C;  3CCE A;  3HL8 A;  5CKH A;  2OTJ A;  2LRQ A;  3AHU A;  2P4T A;  3L2R A;  1RI0 A;  2JTM A;  2JTF A;  1YIT A;  1VQ7 T;  3OYA A;  2YHT A;  3QYH B;  1FXX A;  2JN0 A;  2RHX A;  3FIF A;  4M77 B;  1YJN T;  1YIJ T;  1Q7Y U;  4X9D A;  4E7H A;  3JB9 F;  1U1T A;  3V7R A;  2DTI A;  2EQU A;  3S3N A;  2EKO A;  1BI0 A;  2R5A A;  3GF5 A;  3LGF A;  4Z02 A;  1M4Z A;  1BIA A;  3JRZ A;  1VQK T;  4Y91 A;  4JS4 A;  2RI5 A;  4EMK B;  3CD6 T;  1N27 A;  1BKB A;  3X20 B;  5D6W A;  2RHU A;  3OY9 A;  2K5I A;  3CCV T;  3R6O A;  3PFS A;  4QVD A;  3CCL T;  4JUV A;  3SB2 A;  2KSS A;  5CKB A;  4C8Q B;  1VQ7 A;  2LTO A;  2XHC A;  5A2Q E;  2RO0 A;  3KBG A;  5LJ3 d;  3PMI A;  4A4F A;  5GAN e;  4JLI A;  1WJR A;  1VQO A;  1YIJ A;  3A5Z B;  4DOV A;  1I5L A;  4M7D E;  1Q81 C;  4KUD K;  4QQD A;  5J26 A;  1I4K 1;  2BUD A;  1KG1 A;  4RG8 A;  2QQS A;  3TRE A;  3MP1 A;  3OW2 A;  3RKW A;  2E5Q A;  1WQW A;  3L2Q A;  1KC8 U;  1VQK A;  3RKX A;  3JCM W;  3A8H B;  2WSF E;  3INZ A;  1NJI C;  3ASK A;  4M7D G;  2D0Q B;  3MEV A;  3HFN A;  4M78 E;  3QII A;  5IAY A;  3M54 A;  3UPU A;  5KE3 A;  1Q82 C;  4C0F A;  1VQ9 T;  4LD9 K;  2KMT A;  4KT0 E;  4BE0 A;  2V8I A;  1KQS A;  4XAX B;  2ZPF B;  2KK4 A;  3NTK A;  4LDY A;  1MHN A;  1WGS A;  1BIB A;  4FT2 A;  4C5E A;  3OW2 S;  1IZ6 A;  2QQA A;  2LT1 A;  4C92 E;  4ZGJ B;  3P8H A;  2DIG A;  4OB0 B;  4PJO G;  2CZ0 B;  1H64 1;  1V29 B;  2B8A A;  4QQ6 A;  4E47 A;  3HSB A;  2CZ6 B;  3OS2 A;  2R57 A;  1G3T A;  3BFM A;  3QXE B;  1VQ9 A;  3QDR B;  3CPF A;  3E19 A;  1SSF A;  2M0O A;  4JRP A;  2KAF A;  3NTI A;  5C0M A;  3OYF A;  3LLR A;  4PJO C;  1KD1 C;  3BW1 A;  2K4Y A;  4XQ3 A;  3JCM P;  5DLO A;  1Q81 U;  5GAM d;  5GAM h;  3G4S T;  4ATO A;  2RB6 A;  3HHT B;  4PJO A;  3CCS T;  2L3R A;  5A0D A;  3JSC A;  2RA2 A;  4UC4 A;  5GMK l;  1NJI U;  5HY6 A;  3OYC A;  2K57 A;  3CMA A;  4PJO D;  2LVM A;  2XU8 A;  2JVV A;  4ZTJ A;  1Q82 U;  1YCY A;  2PVO B;  2E64 A;  2EJG A;  4JJN K;  1VUB A;  3A8O B;  4B9W A;  3PTA A;  1NPR A;  3QZ9 B;  3MET A;  4M75 G;  5IN1 A;  2VV5 A;  4J5Y A;  2ZGW A;  4A4E A;  4EPC A;  3X24 B;  3ME9 A;  3TEE A;  2RHI A;  4BE2 A;  1VQ4 T;  1YHQ T;  4R55 A;  4EDU A;  3J80 E;  2EWN A;  3SDZ A;  2F5T X;  1O9S A;  2VXE A;  2QQR A;  3MO8 A;  2EQM A;  2G3R A;  2VC8 A;  4M75 C;  2LT4 A;  2QXF A;  4JDS A;  5M9O A;  3JCM X;  1UEB A;  3BDU A;  4HKE A;  2O4X A;  5A0L A;  2QTX A;  4EMH A;  1U8R A;  3TCJ A;  1NPP A;  2EQJ A;  2GCX A;  2K3Y A;  3BY7 A;  3CEY A;  5CKE A;  4A54 A;  4C8Q F;  1KD1 U;  5KCO A;  2LC4 A;  3F70 A;  4M75 A;  3L1A A;  3TU4 K;  4PJO B;  1K9M C;  4IKF A;  1GXI E;  2MWO A;  2EIF A;  3OYJ A;  3OS1 A;  1VQ4 A;  3CC7 T;  2A7Y A;  4FT4 A;  3LGL A;  2HQX A;  4J8O A;  1KQ2 A;  4MDX A;  1W2B A;  5LJ5 j;  3M55 A;  4M75 D;  1Q86 U;  4PLL A;  1BI2 A;  4XU0 A;  4LDV A;  2IG0 A;  2E65 A;  3WVE B;  3CCU T;  2F69 A;  4L6V 5;  4OP0 A;  5CQX A;  4HT9 A;  2E12 A;  3A8L B;  3M4Y A;  2EJF A;  3JCM g;  4BDZ A;  3CBO A;  1WJS A;  3L2U A;  2E1H A;  3J81 E;  5J3B A;  1LJO A;  3I55 A;  1OYX A;  5FRO A;  5GAN h;  1YJN A;  4F7U G;  3RER A;  3CC7 A;  1N6A A;  3OYL A;  3X25 B;  1O75 A;  3UT1 A;  3JB9 J;  3GP8 A;  2DXC A;  3GLX A;  4JLG A;  4B9X A;  3GNF B;  1WJQ A;  2DVE A;  2RK2 A;  3OYY A;  3RIR A;  3VV0 A;  3SD4 A;  2BKD N;  2CYZ B;  3CCU A;  5GAN f;  4NOY A;  2MWP A;  2DD4 A;  2XID A;  4IUP A;  5GAN 2;  2O4X B;  1QVG S;  3DLM A;  3HRT A;  4QQG A;  2JZ2 A;  2HQE A;  1P92 A;  2WSC E;  2EQK A;  4XK8 E;  4XTZ A;  1VQO T;  4M75 B;  4ZN1 A;  1PSF A;  3OSS C;  1BI1 A;  5GMK i;  3OYM A;  4C5G A;  1JB0 E;  3OSV A;  3PMT A;  4XTY A;  4F7U A;  3S3O A;  2DK3 A;  3QBY A;  4KUI A;  3VUB A;  4A4K A;  3HRU A;  1OI1 A;  2O01 E;  3HP9 A;  3N5B B;  1K9M U;  5LJ5 e;  1NZ9 A;  1H3Z A;  3GIB A;  2XKO C;  3LWH A;  3PT9 A;  3OS0 A;  5CIU A;  1MGQ A;  2XG8 D;  2DAQ A;  5DLQ E;  4JRI A;  3CC2 A;  4MDW A;  3P8B B;  1S72 T;  5LL6 S;  3BDL A;  4J6W A;  5CCA A;  1YI2 A;  2PUK B;  3VKI A;  1ZQ1 A;  4DQ2 A;  3JB9 H;  3G71 T;  1JRI A;  3C4S A;  4E7J A;  5FRN A;  5HK0 A;  1UGS B;  2K2V A;  2QI2 A;  2HNI A;  3H8Z A;  3VYH B;  4GY5 A;  5CR2 A;  5LJ3 j;  3RMQ A;  3CC4 T;  1XOV A;  4PNO A;  5KCH A;  1S72 A;  1VQ8 A;  4F7U B;  1LOJ A;  2F5K A;  2FL7 A;  4BI3 A;  4HT8 A;  4M7D C;  4M78 G;  2DXT A;  4RCB A;  2RJC A;  3M53 A;  4D6W A;  3G71 A;  3FRN A;  4JS5 A;  5GMK h;  2RD1 A;  4N4I A;  2GQV A;  1QP3 A;  1U1S A;  4NS5 A;  3JCM e;  3RKY A;  4M7D A;  1M1G A;  4ZGE B;  2A3L A;  4PJO F;  4XTX A;  2WAC A;  4C5H A;  5CAI A;  5CK9 A;  3S3M A;  1VQP T;  1NE8 A;  3NFC A;  4C92 G;  2DO3 A;  2FB7 A;  3CC4 A;  1AHJ B;  1Y7X A;  3DB4 A;  1W4S A;  3OBY A;  5CKD A;  3CMA T;  4M7D D;  3OQ5 A;  1Y71 A;  3PNW C;  3S6W A;  1KQS S;  4M7A E;  1OZ2 A;  2X4W A;  4DA4 A;  1QVF A;  3M57 A;  2DZ9 A;  4M78 A;  3A8G B;  5GAN 8;  1B34 A;  2X4J A;  2RK1 A;  4J7I A;  2Y90 A;  1VQ6 A;  2MF2 A;  4C92 C;  1Q86 C;  1WNL A;  1VQP A;  4M78 D;  1D3B A;  4N4H A;  4R56 A;  1VQ5 T;  4M7A G;  4A53 A;  3SFM A;  4MZM A;  5DY9 A;  4J7F A;  2X4X A;  1XTD A;  1RL2 A;  4XU3 A;  5FLX E;  5FRM A;  2GF7 A;  4C92 A;  3MP6 A;  3V8J A;  3CCJ T;  4XTV A;  3OS5 A;  1Y96 A;  4XU2 A;  5LJ3 e;  2DXB A;  2DTH A;  5DM7 R;  4BUG A;  5LJ5 g;  3PGG A;  4FU6 A;  4RKU E;  3NTH A;  4C92 D;  1HK9 A;  1M5Q 1;  2K5F A;  2LQK A;  3HRS A;  5HKC A;  3HPW A;  5GAM j;  3CBP A;  2MI6 A;  2KVQ G;  4IUT A;  4C5I A;  3JCM b;  2XDB A;  3JCM Q;  3QUI A;  4M7D B;  1PSE A;  4M75 F;  5FU6 C;  1VQ5 A;  2VUB A;  3PIP A;  3CME T;  1M90 C;  1JJ2 A;  3ZEH A;  4BE1 A;  5GAO m;  2OTL T;  4M7A A;  2QQ9 A;  3L42 A;  3FC3 A;  3CCJ A;  2LX9 A;  3PIO A;  4M77 E;  5C6S A;  4M7A D;  4OVA A;  1G5V A;  3DKM A;  3MCA B;  2FVU A;  3H6Z A;  2GFU A;  4V2S A;  3LW5 E;  2LCC A;  4A4G A;  4KUL A;  2RI2 A;  3ER0 A;  2CZ1 B;  2P0P A;  3I55 T;  1YJW T;  2XD0 A;  1D3B B;  2VYT A;  2XIC A;  3CME A;  4M77 G;  2ZPI B;  3OYK A;  4BY6 C;  3P8D A;  2H3J A;  1BI3 A;  2M1H A;  1YBY A;  5CO7 A;  5HK3 A;  5GAO n;  2OTL A;  3HFO A;  2QA4 A;  4E7K A;  3V7S A;  1JBM A;  2YLC A;  2RH2 A;  3Q1J A;  4C8Q E;  5IT9 E;  5LJ5 h;  3CCR T;  3E9F A;  2CGH A;  2FYK A;  2LDM A;  4C0D C;  2DTO A;  4JRK A;  4Q5W A;  3J7A F;  3CBM A;  2V8K A;  2QQB A;  3LX7 A;  3VU3 C;  2LQ8 A;  2MMP A;  5GAN d;  2RJE A;  3ZBD A;  1YJW A;  5EG2 A;  2OAU A;  3FJP A;  2GFA A;  2ZPG B;  5GAM e;  4N0A A;  5LJ5 f;  3QSU A;  1N9S A;  4XU1 A;  2DZC A;  4L59 A;  1R8O B;  4M77 A;  4F7U F;  3CPW A;  3C94 A;  3JCM c;  1W2B S;  3CCR A;  2E41 A;  1M90 U;  4II1 A;  5FU6 B;  3LYI A;  4M77 D;  4O6J A;  4N4G A;  3VYG A;  2CZ7 B;  5I21 A;  3UWN A;  3OYE A;  3L2Z A;  1EIF A;  4OGE A;  4KBM B;  3MP8 A;  2AHJ B;  5GAO q;  3M9Q A;  5GAN j;  3QHS A;  3LWI A;  4RMO A;  3KUF A;  4LDX A;  1UB4 A;  4PL6 A;  1M8V A;  3CC2 T;  5GMK m;  3OMC A;  2JOY A;  2DKG A;  1YI2 T;  2YLB A;  5LJ3 g;  2QEX T;  4E7L A;  3MEU A;  3CPW S;  2PUO B;  3OB9 A;  5GAN 7;  4WF2 A;  2Y4Y A;  1M1F A;  2HD0 A;  3L2V A;  3I56 T;  3FB9 A;  4BY6 B;  3JCM h;  2MAM A;  3CCQ T;  2X4Y A;  1VQM T;  4ZN3 A;  3SWN C;  1I8F A;  4QW2 A;  3OYG A;  4C0D B;  1K8A C;  4FL6 A;  3JB9 I;  3OYI A;  3JB9 G;  4J83 A;  4FSX A;  2RM4 A;  1VQ8 T;  2E70 A;  3M5A A;  2RJF A;  3JCM f;  3OYH A;  2X35 A;  1KHC A;  2L8D A;  5A0G A;  3SWN A;  1G3Y A;  2QEX A;  1BYM A;  4HCB A;  3EFS A;  4LD6 A;  5KH6 A;  2KDS A;  1QVP A;  3M4G A;  4BB7 A;  4NL3 A;  3I56 A;  2CS7 A;  3X26 B;  3CCQ A;  1VQM A;  1N8R C;  3OBW A;  1G3S A;  3V8L A;  4M7D F;  1IRE B;  5I2S A;  4NL2 A;  5GAO r;  4IUQ A;  3L2W A;  3JCM J;  1WQ7 A;  1X75 C;  2FHD A;  3QJY A;  2RHY A;  2E10 A;  3E9G A;  5LJ3 h;  3OYB A;  5GAO l;  1N9R A;  2E6Z A;  4LDU A;  4OMF B;  3G6E T;  5GAN 5;  3CXC A;  4X9C A;  4ZTF A;  1VQN T;  4YTL A;  3FEO A;  4E7I A;  2PVD B;  4M78 F;  5J39 A;  1KHI A;  3JB9 D;  2VGN A;  1VQ6 T;  3CD6 A;  3OMG A;  1QP2 A;  4ELY C;  2DEQ A;  2CKK A;  3MEW A;  5LJ3 f;  2K3X A;  4IUU A;  5GAM g;  3CCV A;  2LCL A;  4OGC A;  2I2L A;  4M78 C;  4XTW A;  3CCL A;  4HCC A;  3URG A;  3M59 A;  4BI8 B;  4C0G A;  1K73 U;  2XI9 A;  4A4H A;  1M1K U;  3QKJ A;  2DD5 A;  4MZT A;  4C92 F;  3JAM E;  1TH7 A;  2D6F A;  1ZHI A;  3SWN B;  4PJO E;  2DJZ A;  4ELZ C;  3G6E A;  1VQN A;  5AYF A;  5CVI A;  1K8A U;  4RCC A;  2ZPB B;  5D6Y A;  1VIF A;  5I2M A;  3M56 A;  5L8R E;  3T9N A;  5GMK j;  5D6X A;  3CXC S;  3MHX A;  3FLG A;  3GPL A;  2HBP A;  4J6Y A;  2NLU A;  4MML A;  2DXU A;  5FU7 C;  3EAE A;  4Y28 E;  3X28 B;  1YJ9 T;  3JCM V;  5CKF A;  2LNV A;  2E6N A;  4O5V A;  4CRI A;  1N8R U;  4M7A F;  4LDW A;  3DLL A;  2R5M A;  5KE2 A;  3QJ6 A;  2XDP A;  2K5L A;  3VJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...