1PKSA

Structure of the pi3k sh3 domain and analysis of the sh3 family
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
EGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT SH3 DOMAIN
publication title Structure of the PI3K SH3 domain and analysis of the SH3 family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphotransferase
total genus 11
structure length 76
sequence length 76
ec nomenclature ec 2.7.1.137: Phosphatidylinositol 3-kinase.
pdb deposition date 1994-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1pksA00
1N5ZA 1WXUA 2KRNA 2NUZA 1V1CA 3NMZC 1SHGA 4J9DA 1GBQA 2K9GA 2A28A 2DJQA 1CKAA 2ROLA 4AFZC 2PZ1A 4ESRA 2JS2A 2RQWA 1ZLMA 2M0YA 2DL5A 1X27A 1WXTA 3THKA 1GRIA 2DL3A 3SEMA 1ZX6A 4J9EA 1AWXA 1T3SA 1U3OA 1VYVA 4HCKA 2L2PA 2KT1A 1WIEA 2EYWA 2CSQA 4Z88A 4A63B 1WDXA 3O5ZA 2YDLA 4HVWA 2KYBA 3EG3A 2W0ZA 2CREA 2L3PA 2HSPA 2IIMA 2GQIA 1T3LA 4OMLA 2EPDA 2ESWA 4LN2A 5IH2A 1W1FA 4RTWA 1B07A 2O88A 2PTKA 2HBWA 4OMNA 2I0NA 2J6OA 2O9SA 5L23A 3EG2A 1CKBA 2FRYA 2P4RA 1X6GA 2RPNA 1MV3A 3TVTA 2RNAA 2O31A 1EFNA 1U06A 1YWPA 1XOVA 3PVLA 1Z9QA 2KXCA 2EGAA 4DEXA 1WLPB 2M51A 4JZ4A 4J9CA 1RLQC 1H3HA 1GL5A 1AEYA 1U5SA 2DL7A 3M0RA 2SRCA 3JV3A 1ABQA 1KJWA 1BBZA 2FEIA 1YNZA 1CSKA 1Z9ZA 1OEBA 1PKTA 2L0AA 2X3WD 1MUZA 4IIOA 4EIKA 2ROTA 4CC7A 4JJDA 2CH4W 4JPBW 1MV0B 2CSIA 2EYYA 1W6XA 1UJ0A 2LP5A 1SHFA 2F2WA 3KFVA 2E5KA 1YWOA 2LJ1A 1PRMC 1S1NA 1AVZC 4CC2A 3QWXX 3R6NA 1SRLA 2YSQA 3ZL7C 2DNUA 2RQRA 3IQLA 1GBRA 1JXOA 5GJVB 1WFWA 1VYUA 2AZSA 4J9GA 1LCKA 1ZUYA 2LX7A 1HD3A 1E6HA 1UFFA 1UG1A 4KRTA 2YT6A 4K11A 2EYZA 4M4ZA 2EYXA 2RMOA 4WCIA 1WYXA 4J9IA 4F14A 1PKSA 1QKXA 2KNBB 1X2KA 1M3BA 4JJBA 2GGRA 1TUDA 4LNPA 4OMPA 1M3CA 2D1XA 4OMOA 1RLPC 2KGTA 1NYFA 2KXDA 2G6FX 2GBQA 2FPFA 4HVUA 4J9HA 3UATA 2LJ0A 2JXBA 1QWEA 2BZYA 4E6RA 2K6DA 1K76A 5I11A 4J9BA 2GTOA 5IHIA 3REAB 1KSWA 1JO8A 3RNJA 1E6GA 2JMCA 2J6FA 2B86A 2CUDA 4AG2C 3M0QA 3NHNA 1YN8A 1Y57A 2K2MA 2O9VA 3EHQA 3I5SA 5GJWB 3EG0A 2DMOA 2PNIA 3VS1A 2VWFA 1UTIA 4J9FA 2DE0X 1T0HA 2QDLA 3QWYA 3I35A 5ECAA 1T0JA 5IHKA 2F2VA 2JM8A 4RTTA 4RTYA 5EC7A 2J6KA 2JMAA 4Y92A 3ULRB 4AFQC 1E7OA 4D8DA 1K9AA 4OMMA 4LE9A 1J3TA 4LUDA 1M27C 1UJYA 4Z89A 2ED1A 1WA7A 2DF6A 2W10A 4CC4B 1OPLA 4AFUC 3M0SA 2D8JA 3NGPA 2D0NA 2RQVA 2XMFA 2BZXA 2RN8A 2MOXA 3VRYA 1G83A 1HJDA 3SHWA 1SPKA 2JW4A 1JQQA 2DX1A 1NYGA 3M0PA 2KR3A 1ABOA 1UHFA 4RTVA 2FPDA 4RTUA 2CDTA 4RTZA 3I5RA 1GCPA 2KYMA 2O2OA 2DBKA 4LUEA 2AK5A 3CQTA 2MCNA 4IIMA 2CT3A 2LMJA 2X3XD 1ARKA 2V1RA 3C0CA 1NEBA 2YUOA 2KBTA 2EQIA 2D8HA 4F17A 3RBBB 1KFZA 4D8KA 2KEAA 1X43A 2JTEA 2FO0A 4FSSA 3U23A 5FWCA 1VA7A 1JU5C 2CUBA 1GCQA 2EBPA 2RF0A 3TSZA 2YUNA 1BK2A 1IO6A 1H8KA 4GLMA 5IXBA 4ZNXA 1I07A 2OI3A 1G2BA 1AZEA 5FWBA 4RTXA 3TSWA 1Y0MA 2ABLA 2OAWA 1JEGA 1YCSB 2L3SA 4F16A 3UA6A 2LZ6B 4JJCA 1X69A 1WI7A 1KIKA 2LQNA 2GTJA 1QLYA 2EW3A 3UF4A 3H0HA 3VS4A 3EGUA 2DRMA 1WXBA 2CH4A 1NEGA 1UE9A 2KT8A 2A08A 2EGCA 3NPFA 2K3BA 2GNCA 1OV3A 2C0OA 2KROA 2LNHB 3GBQA 1W70A 2F2XA 2ENMA 1AWWA 1A0NB 1AWOA 1YP5A 1UECA 1SRMA 2YUPA 1QWFA 2AKKA 4CC3A 3I9QA 1K0SA 1AOJA 1SEMA 5HCKA 1VYTA 1UDLA 1B3QA 2DLPA 3LH5A 1ZBJA 2EGEA 2JM9A 2V1QA 1AD5A 1TUCA 2MIOA 2ED0A 2KRMA 2RQUA 1X2QA 4QT7A 1PHTA 2LQWA 3REBB 4HXJA 1GCQC 1AWJA 1UUEA 2C0TA 2LCSA 4DEYA 1H92A 3H0FA 2LJ3A 1NM7A 4X1VA 5IHNA 1PWTA 2DA9A 4R0KA 4OMQA 1OOTA 3H41A 4GBQA 3VS5A 2K79A 1JXMA 1QCFA 3UA7A 2C0IA 1GFDA 2HDAA 1UHCA 2J7IA 1K0XA 4RUGA 5FW9A 1TG0A 2CT4A 2K7AA 2AZVA 1AZGB 1FYNA 3FJ5A 2KE9A 2DRKA 2AKLA 4JZ3A 4HVVA 2FRWA 1I1JA 2VVKA 1PRLC 2DBMA 2L3QA 3VRZA 3EG1A 2DVJA 2VKNA 2HCKA 2HEQA 3EHRA 3VS6A 2FG0A 1ZUUA 1OPKA 2DILA 1RI9A 2YUQA 4AG1C 3VS2A 2JS0A 3VS7A 3VS0A 4Z8AA 1M30A 1M8MA 1I0CA 2J06A 3H0IA 1K1ZA 2DL8A 2DYBA 1K4US 2EVRA 4AFSC 5IXFA 1WX6A 2OJ2A 2JT4A 2BTTA 3M0TA 1HSQA 1NLOC 2KRSA 1ZUKA 3M0UA 3VS3A 1RUWA 1FMKA 2A37A 2H8HA 2RQTA 2DL4A 2ECZA 1BU1A 3PE0A 2NWMA 1SSHA 1QKWA 5I22A 1UGVA 3A98A 2EKHA 2FPEA 2J05A 1M3AA 1X6BA 1NLPC 1BB9A 1GFCA 2A36A 4ORZA 3PVQA 2BZ8A 2DM1A 1PNJA 1NG2A 1ZSGA 2SEMA
chains in the Genus database with same CATH superfamily
3OYFA 3M58A 1GBQA 3KUFA 2A28A 1CKAA 2PZ1A 2NUPB 1N8RR 2JS2A 2DL5A 4FYYB 1AT1B 2E12A 2L5QA 4E7SA 2G3RA 1Q82U 4BE2A 2E64A 3SEMA 3ZBDA 1AWXA 1TSFA 2AIRB 3QJ6A 1WQ7A 3JB9I 2KT1A 1VIFA 1PG5B 2MAMA 4M77B 4A63B 4F7UG 1SSFA 3LH0A 1MMGA 3EG3A 4C92E 2CREA 2L3PA 1WHHA 2IIMA 3DLMA 1Y71A 1QVGA 3FB9A 2VC8A 3OY9A 2GFAA 2EPDA 3V8JA 1RACB 1VQ4Q 4J5YA 3C95A 4Z02A 2HQHA 4M77C 3R6OA 5L23A 5GAN2 1G8XA 2RPNA 4L59A 2IG0A 4RCCA 3FJPA 5KYUA 1U06A 1XOVA 4YTLA 3I56Q 3OSSC 2KMTA 5GAMg 3CMEQ 3DKMA 2RJEA 4HKEA 2Y4YA 5D6WA 3M0RA 1KJWA 1CSKA 2X3WD 5GANg 2RHZA 2X4WA 4M78B 1D0XA 4XK8E 2ROTA 4CC7A 1W2BS 5I21A 2CS7A 4BY6B 1VQ6T 2CSIA 1W6XA 1UJ0A 5C6SA 2LP5A 4M7AG 2GF7A 3MEVA 1YWOA 4M7DE 4M78C 2CZ7B 1S1NA 1M1GA 3JCMW 4QVZA 1I4K1 1VQMA 5J3BA 4C0DB 3E9GA 4BE1A 2FZCB 3CCUQ 1M5Q1 1X01A 3ZL7C 5KYUB 4NL2A 4DBRA 1GBRA 2DETA 4PK4A 1LCKA 2BE7D 2XDDA 2YHTA 1UFFA 5HK0A 4IUPA 4C0DC 4C8QA 1QCOA 4HT9A 2OTLT 3CCVQ 2RMOA 1WYXA 4J9IA 5D6YA 4F14A 2DZCA 4XU3A 1QVFS 1M3BA 4E7JA 2GGRA 2WSFE 2DXBA 1Q7YR 2KXDA 2PU9B 2YLBA 1N9SA 1JRIA 3OQ5A 3PMIA 3BW1A 4J9HA 2JXBA 1QWEA 1MNDA 1S72T 2WACA 3JB9F 2L3RA 3REAB 1JO8A 1Q82C 3RNJA 3LW5E 1WNLA 3RR6A 1GXIE 4B6MA 3PIPA 2J6FA 2CUDA 3JCMf 2BKDN 3J7AF 4BI4A 1ACMB 4ELZC 1U8RA 4C8QB 3I5SA 2KQWA 2K57A 3V8KA 2RI2A 3GP8A 1YITA 1JBMA 2EFIA 2VWFA 4OVAA 2XU8A 1T0HA 4PJJA 3G71T 4V2SA 3L2WA 1VQ7T 2QDLA 4M75G 4F7UE 4C8QC 1MMNA 1KQ1A 4EMKC 3CMAT 4IUUA 4UC4A 2QQRA 2JMAA 4FYXB 4Y92A 4AFQC 1E7OA 4OMMA 1M27C 5HK3A 3CCQT 1VQLQ 4OB2B 4JRQA 1QP2A 4BB7A 5KYYA 3M0SA 3NGPA 4L5GA 2KSSA 1Q81R 5J39A 2QEXA 2MOXA 2RJCA 4KH1B 4PFPA 4PJOA 4XTZA 2JW4A 1JQQA 3M0PA 4QKUA 1VQKQ 2VXEA 4RTUA 4RTZA 2KYMA 2O2OA 3E1SA 2MCNA 3M9QA 2E6NA 5FU6C 1N9RA 2LMJA 2X3XD 2V1RA 3CCEQ 5FLXE 4QVCA 1W4SA 5LJ3f 1NBEB 4D8KA 2XK0A 4RKUE 2KEAA 4E7ZA 4FSSA 2QA4A 4M7AE 2NUTA 4XQ3A 4JUVA 5KYYB 3PMTA 1VOMA 4DOWA 1D1AA 1FX7A 4ZNXA 1I07A 1IHVA 3CCLQ 2QQSA 4DBQA 2ABLA 2OAWA 3CCST 1BI0A 4PJOB 4F16A 1YI2A 2PVOB 1Q86U 4IKFA 1UGRB 3VS4A 3EGUA 3JCMb 2DVEA 2CH4A 5KYXA 1UE9A 5D6XA 2CZ6B 4PJOC 3NPFA 2C0OA 1RADB 3OS5A 1IGQA 2F2XA 2ZPIB 4XTUA 1SRMA 1VQ8A 2AKKA 1LJOA 1NPPA 1SEMA 2NUTB 1KQSA 3PIOA 3NTHA 2VASA 2HL3A 3LH5A 1ZBJA 2EGEA 3CCJT 2MIOA 2RQUA 1G3YA 1AWJA 1UUEA 1YJWA 3OW2A 3ZFJA 3GNGA 1H92A 2LJ3A 1X75C 3OMCA 4PFOA 2CGHA 3A8GB 3H6ZA 1VQNA 2K79A 1JXMA 1HXDA 2QK0A 1TUGB 2QASA 1QCFA 3HTRA 1UHCA 1K0XA 3EG9A 1G3TA 4J83A 1NJIC 2HAXA 2MWPA 1AZGB 1FYNA 2AKLA 3URGA 3P8DA 4LDVA 2L89A 5CQXA 2EJFA 2MPXC 2VVKA 2XG8D 1PRLC 3C12A 5KE3A 3EG1A 1V29B 2VKNA 2HEQA 4C0ZA 3EHRA 2HL5C 1D0YA 1VQMT 3LLRA 1ZUUA 3CPFA 1RI9A 2YUQA 4OGCA 4XTXA 3VS2A 2JS0A 3JCMd 5GAMh 1M30A 3HP9A 3CC2Q 2ZZDA 2DL8A 4EDUA 2EVRA 2GCXA 2DERA 1RAGB 4CRIA 2QQAA 4JJNK 1BKBA 1K9MU 2JT4A 2JN0A 2RH2A 5EG2A 2KY9A 3EG9B 1LVKA 1K73R 3M0UA 3VS3A 2H8HA 2RQTA 4QQGA 2DL4A 2VB6A 2OAUA 2ECZA 3CCMQ 4O5VA 2DPPB 4M77F 2KI7A 3JRZA 3JCMc 3RMQA 2EJGA 3JCMX 1NLPC 2ZGWA 1YHQA 1KHCA 1NPRA 2YXYA 3L2UA 4FW1A 1M90U 1OZ2A 3QO3A 2DTOA 4JDSA 3A1PA 2OTLA 3HSBA 1QW1A 4DBFA 1N8RU 2KRNA 1MMDA 2NUZA 1SHGA 4J9DA 2K9GA 2ROLA 4AFZC 2DK3A 1C1AA 1ZLMA 1X27A 4M7AD 4ZN1A 3M54A 3L2ZA 4N4GA 3OYMA 2R5MA 1QVGP 3CD6Q 2F5KA 1ZX6A 1I5OB 4M78F 1M1FA 5LJ3d 1WDXA 2RD1A 4AMCA 2F1LA 2HZYA 2KYBA 4F04B 1YITQ 5LJ5f 2D6FA 4E7LA 2A0FB 4X9CA 3SWNA 1W1FA 2WSEE 4RTWA 2DTHA 2O88A 1H641 2HBWA 5KE2A 2I0NA 2J6OA 2O9SA 3EG2A 1CKBA 3G71A 2FRYA 3GLXA 1K8AR 1X6GA 1VQ7A 1MV3A 2RNAA 2QEXT 1ZSZA 1Z9QA 1WPYA 5LJ3j 3PTAA 5CKEA 1WLPB 2M51A 3QXEB 4J9CA 4QVDA 2RI5A 2QTVA 5I2SA 1H3HA 3JV3A 1BBZA 1PD0A 2FEIA 3JCMe 2L0AA 4EIKA 1PKTA 2YRDA 1KD1R 1MUZA 2DZ9A 2COYA 4FIBA 3CC7T 1WQWA 4C5EA 4XU0A 3MEWA 1PSFA 4C8QD 2F5TX 3SWNB 1KK7A 5CCAA 3DB4A 3OBYA 2CP3A 2F2WA 2E5KA 3KFVA 4BI3A 2CP5A 2VV5A 3MKDA 4EPCA 1TU0B 2K5IA 3QWXX 3I55A 1ZSZB 2P4TA 1SRLA 3SWNC 2O4XA 3DB3A 3M59A 5GJVB 5HY6A 4E7HA 1YIJT 3LWHA 2DEQA 2AZSA 2QA4Q 3FLGA 1M1KU 4M77A 4J9GA 1OU8A 2LT1A 3PGGA 1IHWA 2VGNA 4R55A 1ZSZC 2YT6A 2XHCA 1O75A 4M4ZA 1RL2A 3P8HA 4PFZA 2YRVA 4C5HA 1Q7YU 1I8FA 4LDWA 1PKSA 3HFNA 1VQ8T 1X2KA 4JJBA 2ZPFB 3J80E 1F1BB 4LNPA 3JCMJ 4ANJA 4FM4B 1QVGS 1OX9A 3NTIA 3CCSA 2DTIA 3S3MA 2JZ2A 1WHKA 1NE8A 4LXCA 5GMKh 2LJ0A 1B34A 4E6RA 4PLIA 5GAOr 1K76A 5I11A 3G6EQ 2MK5A 2GQVA 2O4XB 5IHIA 1KSWA 3MEUA 1E6GA 2JMCA 3A8MB 3TCJA 5LJ3e 1YJWT 2IVWA 4M78A 3NHNA 1YN8A 3P8BB 5CKDA 2O9VA 1C6VX 4KBMB 4E7IA 2XDPA 1TXQA 2KAFA 1OI1A 1VQNT 3EG0A 2DMOA 1TS9A 1R8OB 2MMPA 4C5GA 5GAN4 2P0QA 1UTIA 2DE0X 4NS5A 3GIBA 3JCMg 2E41A 3CCJA 2H3EB 5IHKA 4F7UB 2XIDA 2F2VA 5EC7A 5GAN8 4D8DA 2DFUA 3LX7A 3CC4Q 1B34B 2Y90A 1UJYA 1V76A 4Z89A 2ED1A 4MZPA 4EMGA 1Q81U 1VQPT 4CC4B 1ZBXA 2JTFA 1OPLA 4AFUC 3OYKA 2FZKB 2RJDA 1UGQB 2RQVA 2XMFA 3HL8A 2BZXA 2RN8A 4ZTFA 4PJOF 1KC8C 4OGEA 2EQUA 4JS5A 3T9NA 1ABOA 2CDTA 3X26B 4LUEA 3CQTA 3UWNA 4PLLA 2CT3A 3G7ZA 1ARKA 3C0CA 4NL3A 2KDSA 2O01E 1IZ6A 1YHQT 2AHJB 3V7RA 4F17A 5LJ5d 3QIIA 3RBBB 1JJ2A 3VJPA 1KFZA 1VQ6Q 5KYNA 3U23A 2X9HA 1TTHB 3FIFA 1VA7A 2CUBA 3RKWA 2EBPA 3TSZA 4ATOA 1BK2A 4EMKA 2K2VA 1BIBA 1VQOA 2EYQA 5IXBA 3VKIA 3JB9D 2PVDB 5FWBA 4RTXA 3TSWA 2L3SA 3FEOA 1W2BA 1KIKA 5FROA 1FXXA 1IREB 5LJ5j 2EW3A 1HYOA 2WSCE 2M9UA 1KQSP 3UDCA 4PJMA 3META 2A08A 2EGCA 3QJYA 5CO7A 3A5ZB 3GBQA 3RKXA 1A0NB 1YP5A 3PFSA 2HMAA 2YUPA 2YLCA 1QWFA 1VQ9A 4CC3A 4MDWA 1M2VA 2DXUA 3QPHA 4KGZB 1VYTA 3INZA 4OB3B 1MHNA 3A8LB 3OW2P 1B3QA 4C8QG 4EMKB 3OMGA 2DEUA 3RDVA 1TUCA 3GF5A 1S72Q 2FZGB 5IT9E 1Q82R 1Y96A 4A4EA 1D1BA 4HXJA 4DOVA 4M77E 2RHIA 5CVIA 2C0TA 1QVFA 3KXTA 4DEYA 4GY5A 1R77A 4X1VA 1BIAA 5IHNA 3H41A 4XU2A 2LCLA 3VS5A 4M75B 3UA7A 3G71Q 2C06A 2DD4A 1VQ7Q 3EH1A 4RUGA 3CCRT 2LDMA 3OYJA 2COWA 3QYGB 3UT1A 3FJ5A 1M2VB 3CMAQ 2PVGB 3QZ9B 1MGQA 2FRWA 1NZ9A 4M75C 5FU6B 1IXDA 3QKJA 3G1JA 4OB1B 5GANf 1PD1A 2XI9A 3CCQQ 5CKFA 2L8DA 2DVJA 3VS6A 1Y96B 3I55T 1OULA 3OYAA 1YJ9T 2D9TA 2FYKA 3MEAA 5LJ5e 2BUDA 1K1ZA 2DYBA 2X35A 1K4US 3CC7A 1K73U 2OJ2A 5FRNA 3SB2A 3SD4A 1C0MA 3M0TA 2JTMA 2XDBA 1HSQA 1NLOC 2KRSA 1ZUKA 1RUWA 2A37A 5L8RE 2LC4A 1DJ7B 1BU1A 3PE0A 2NWMA 1QKWA 1AHJB 2CP2A 1YJNA 1RI0A 4A4HA 4C92F 2QQBA 1BB9A 1GFCA 4PJOG 1YIJA 2CKKA 8AT1B 2EKOA 1MNEA 4LDYA 3DLLA 2DM1A 1NG2A 2A7YA 4FL6A 2A3LA 3ASKA 2SEMA 3OW2S 2NYSA 3CCSQ 1YCYA 1Q95G 3CPWA 2YRCA 1HK9A 2JVVA 1FMVA 1WJRA 4LDUA 2M0YA 2FB7A 3THKA 1LOJA 2X4YA 4XTWA 3OYNA 4J9EA 4RG8A 9ATCB 1T3SA 1U3OA 2RK2A 3OYLA 3OA6A 4HCKA 2MYSA 3VYHB 2ATCB 2EYWA 1XNIA 3O5ZA 5A2QE 2W0ZA 4HCZA 2HSPA 4C8QE 1OX8A 4E47A 3E19A 2LNVA 2ESWA 3EFOB 4A53A 4M7DF 3CCJQ 3BFMA 4A4GA 3G4ST 2VXFA 5GAN3 3PNWC 2P4RA 1G5VA 4MMLA 3EAEA 3TVTA 2B8AA 2O31A 2HKQB 5FU7B 3JB9G 3EFRA 1YWPA 3EH2A 3JCMh 2P0KA 2EGAA 4DEXA 3M53A 2MWOA 4JZ4A 5DLQE 2FHDA 5DY9A 1KD1U 3CMEA 4LDXA 1U5SA 5FU7C 4J8OA 1ABQA 2DIQA 2V8JA 1VQPA 1NJIR 1YNZA 1Z9ZA 4E7KA 4M77D 4DQ2A 2ZPBB 4JJDA 4XAXB 1BI2A 2CH4W 1IRXA 4JPBW 1MV0B 1OYXA 5CIUA 1N6AA 2HQXA 1ZA1B 1U1SA 4PNOA 1VQOT 2V26A 2LJ1A 1PRMC 3TQ7P 1VQMQ 1AVZC 4R56A 4A4FA 4KH0B 4CC2A 1OZ3A 3MP6A 2YSQA 2RQRA 3TREA 3IQLA 5KYWA 3CCUA 5GAOp 1JXOA 1WFWA 1VYUA 3WXMB 5CQYA 1TOVA 1ZUYA 2LX7A 4C92A 1HD3A 2F69A 3VUBA 1UG1A 5IAYA 1I5LA 2RB6A 1XQHA 4K11A 2EYZA 4X9DA 2EQMA 4FT2A 2CZ1B 1RAHB 4KULA 4MZTA 3H9NA 4WCIA 2P0PA 1Q86C 4F7UF 1QKXA 3SDZA 2QG9B 2KNBB 1VQ9T 4M78D 2QGGA 3L2RA 5IN1A 4OMPA 4PJOE 1M3CA 1R0CB 4OMOA 5GANd 1NYFA 4ME7A 3CXCA 7AT1B 3D7SB 5LJ3h 3L1AA 2OTJT 4C0GA 1O9SA 2BZYA 3FDRA 3C94A 1D1CA 2GTOA 5KYWB 4PKCC 1D3BB 2YWWA 4D6WA 4N4IA 2DXCA 3HRTA 1M2OA 2B86A 4FYVB 4NOYA 4C92B 1Y57A 2K2MA 3EHQA 3M4YA 5GJWB 1UEBA 5GANj 5KH6A 3VYGA 3OYBA 3QWYA 1EIFA 1M4ZA 2HSEB 4M7DA 5ECAA 1T0JA 3OYEA 4C92C 2CP6A 2JM8A 3N5BB 1VQ5T 4RTYA 1UGPB 2J6KA 2M1HA 1BYMA 1JB0E 2LRQA 4LE9A 5DM7R 4LUDA 4E2FB 2LVMA 2FL7A 1WA7A 4KUDK 2DF6A 2LCCA 1PC0A 2P84A 3Q1JA 3GNFB 3HPWA 2D8JA 3X24B 5GAOm 3CCRA 2D0NA 2QEXQ 5AYFA 4IUTA 3VRYA 1HJDA 5CR2A 2HQEA 2KVQG 8ATCB 2DX1A 1NYGA 2H3JA 3JAME 2KR3A 4HCBA 4TVRA 1UHFA 1WZOA 1JJ2P 4M7DB 4J6WA 2R58A 3I5RA 2VUBA 2DBKA 1X6OA 1K9MC 1YJNT 1WJQA 5GMKm 1SG5A 1YJ9A 3CC7Q 2EQIA 2D8HA 3CCEA 2QGFB 4M7DC 3GPLA 1X43A 2JTEA 2FO0A 3HHTB 1OQKA 5FWCA 2RF0A 1D09B 4OMFB 1W2BP 2YUNA 4BD3A 4BDYA 4KUIA 2K3YA 1M90C 4Y91A 2OI3A 1G2BA 5AT1B 1AZEA 3QZ5B 1Y0MA 1R0BG 5GANe 4F7UA 3CCLA 1YCSB 5J26A 3M57A 4HCCA 2PQWA 2LZ6B 4FYWB 4FW2A 1PCXA 4JJCA 1X69A 4EMHA 4ZN3A 1YI2Q 1N8RC 4IURA 1N27A 3RMSA 3UF4A 3H0HA 4A4KA 3OS1A 2DRMA 4M75F 1WXBA 3MP8A 4RG2A 3VV0A 2XD0A 2PUOB 4N0AA 3X28B 2IPOB 2LNHB 2HNIA 1VQ8Q 2ZPHB 2ENMA 1AWOA 1ZHIA 3JB9H 3EGXA 4FU6A 1B7TA 2ZPGB 4M77G 3WVDB 4BE0A 5CKBA 4DA4A 3FC3A 2QYZA 1QVFP 1WGSA 2DLPA 1VQ4T 4PJNA 2JM9A 1QP3A 1M9SA 3KBGA 1AD5A 2E5QA 2BE9B 2KRMA 4N4HA 1PHTA 2LQWA 1YJWQ 2ZCFB 3REBB 3OYCA 4BUGA 4PJOD 3OYIA 4ZGEB 2LCSA 3I56T 3H0FA 1M8VA 3CC4T 4R0KA 3H8ZA 1VQNQ 4GBQA 3CMET 4M7AA 2DO3A 2C0IA 1GFDA 2HDAA 2BIVA 1FWZA 3EGXB 2K7AA 3G4SA 2KE9A 1JJ2S 4JZ3A 1BCMA 4M78G 1SKUB 4N0AC 1WHJA 2L3QA 2DBMA 4B9XA 4OF1A 3RERA 5GMKj 1XJWB 3EGDA 5LJ5h 2RHXA 1VQPQ 3MCAB 2FG0A 4JS4A 2DILA 2QTXA 4AG1C 3VS7A 3CCUT 4P5NA 2QAZA 3M5AA 1KC8R 5GMKi 5GAN5 1EX4A 3CC2A 1KQ2A 4AFSC 4M7AB 1LNXA 4J7IA 2OX7A 3OYHA 5GAN6 1M1KC 3SFMA 1TWBA 3CCVT 4O6JA 4PL6A 3M55A 5LJ3g 2LX9A 3QUIA 4BY6C 3UPUA 1SSHA 1WHMA 4M7AC 3CCMA 3GOXA 1YHQQ 2FPEA 1M3AA 2DD5A 3QG1A 1Q7YC 4J6YA 2DIGA 2DXTA 2QQ9A 3EGDB 2A36A 4ORZA 4ELYC 2E65A 3PVQA 3CPWP 1MMAA 1M1KR 3NFCA 2OTLQ 4QW2A 2HD0A 3L2VA 2NLUA 1ZSGA 4M75A 5CK9A 2KK4A 1N5ZA 4RMOA 3CBOA 1WXUA 1V1CA 3NMZC 2DJQA 4B9WA 4ESRA 3LYIA 2RQWA 4IUVA 2I2LA 3E9FA 1OU9A 4BACA 1RAEB 1WXTA 4KT0E 3WVEB 1GRIA 2DL3A 2OTJA 3CD6A 1VYVA 3CBMA 2L2PA 1UB4A 1WIEA 3RKYA 2CSQA 4Z88A 3JSCA 2YDLA 5GMKe 1G3WA 2CP7A 4HVWA 2QI2A 2GQIA 3ZEHA 3RESA 1T3LA 5A0GA 2DJZA 4OMLA 2Z0WA 4LN2A 1VQLT 5IH2A 1EZZB 1B07A 2E1HA 2PTKA 4OMNA 3MP1A 2QXFA 3BDLA 4J6XA 5FRMA 5GAMf 4JLIA 2CP0A 1ZA2B 4BI8B 1Q81C 3M56A 1EFNA 3PVLA 3RIRA 4MDXA 5D7UA 3TU4K 1VQ5A 2KXCA 3V7CA 1RLQC 3L42A 2ZPEB 2JOYA 1WHLA 2Y4XA 3MHXA 1NJIU 1VQKT 1QMCA 1GL5A 1AEYA 2DL7A 3CCRQ 2QDYB 2E70A 2SRCA 2VYTA 3OS2A 2CYZB 4IIOA 2GFUA 1OEBA 2EWNA 3VUZA 3E2UA 4M78E 2K5LA 3CCET 1VIEA 2ZAEA 4C92D 1PM3A 3OS0A 2EYYA 3OYGA 1SHFA 3HKSA 2RHUA 3I55Q 1G3SA 1D0ZA 5CKHA 1KHIA 3R6NA 5GAOq 4GLKA 1YJ9Q 3CPWS 2DNUA 3CCLT 4VUBA 1Y7XA 2E3IA 4Q5WA 1KQSS 2RO0A 1PSEA 1E6HA 4KRTA 2V8KA 3CXCP 3BDUA 2LQ8A 2EYXA 1BCOA 3EFOA 4OB0B 3OYDA 1H3ZA 3FRNA 4LD9K 3JB9J 3HRUA 1TUDA 2D1XA 1RLPC 5DLOA 2KGTA 3LGLA 2RJFA 1P92A 5GAOl 2G6FX 4HA8A 3AT1B 2FVUA 2GBQA 2RHYA 2FPFA 4HVUA 5C0MA 3UATA 4QQDA 4M7DD 2K6DA 4J9BA 3O8VA 4ZTJA 3G6EA 1QVPA 3JCMQ 4PJLA 2K3XA 4ZGJB 4AG2C 3M0QA 5GMKl 2PNIA 1I81A 3VS1A 3OBWA 3OYYA 2PUKB 1K8AU 4J9FA 2RK1A 3HFOA 5HKCA 1VQ4A 4OP0A 2XKOC 1LPLA 2D0QB 3I35A 4QQ6A 3ME9A 5LJ5g 3S3OA 3JCMV 3NTKA 3TEEA 4RTTA 3ULRB 2LTOA 5KCHA 4FSXA 1K9AA 3PT9A 3QSUA 4MZMA 3I56A 1J3TA 5KYXB 4WF2A 3CC4A 1RAIB 4M75E 2K4YA 2W10A 3G4SQ 3RUXA 2JJ9A 2R5AA 3CC2T 1G83A 6AT1B 4L6V5 3SHWA 1SPKA 1VUBA 2RM4A 4WTOB 2EAYA 4RTVA 2COZA 2FPDA 5A0LA 3CBPA 4MMKA 1GCPA 2MF2A 1K73C 2AK5A 3BE3A 1ZQ1A 4IIMA 4XTYA 3CCMT 1NEBA 2E6ZA 2HKNA 2YUOA 1D3BA 2KBTA 3EFSA 3CXCS 4HT8A 3X25B 2EJ9A 2E10A 5M9OA 1VQ6A 5GANh 4FCYA 1JU5C 1GCQA 2X51A 1VQOQ 1Y07A 3CEYA 4AT1B 1IO6A 1H8KA 5GAMd 4GLMA 3CCVA 1YBYA 2V8IA 3LWIA 1U1TA 1JEGA 1WJSA 4JRIA 4C5IA 3UA6A 2DAQA 4ZGDB 4JRKA 2HBPA 4IUQA 1WI7A 2LQNA 2R57A 2GTJA 1QCNA 1QLYA 2CZ0B 3JCMP 3QDRB 3ER0A 3A8OB 2EQJA 1NEGA 3VU3C 3CD6T 2XICA 2KT8A 1Q86R 4JRPA 2K3BA 2GNCA 1OV3A 2KROA 5I2MA 1BI1A 1W70A 5GAMj 1VQ9Q 1AWWA 1UECA 1YFNA 3MO8A 3I9QA 1K0SA 1AOJA 5HCKA 1YITT 1RAFB 3C4SA 5A0DA 1UDLA 4C92G 2K5FA 2OTJQ 3S6WA 2V1QA 1XTDA 2RI3A 2ED0A 5KCOA 1X2QA 1S72A 4QT7A 1K8AC 1KG1A 1GCQC 5CAIA 1SF9A 1NM7A 3BY7A 1PWTA 2DA9A 4M7AF 4OMQA 1OOTA 2EQKA 2LQKA 2X4JA 3AHUA 2EIFA 2E3HA 2JUFA 3J81E 4CI0C 1VQLA 4C0FA 2M0OA 2J7IA 5FW9A 4II1A 1TG0A 2CT4A 1KD1C 2AZVA 2DRKA 3MPUB 1VQ5Q 4Y28E 4HVVA 3CMAA 3A8HB 1I1JA 4X34A 3M4GA 5LL6S 4KGVB 3VRZA 5GAN7 2X4XA 1RAAB 4LD6A 2M16A 2HCKA 3CCQA 1IB8A 4KGXB 4XU1A 1QQJA 2LT4A 1VQKA 1OPKA 1KC8U 4M7DG 5GAOn 3LGFA 2DYIA 3V7SA 3VS0A 2RA2A 4Z8AA 1M8MA 1I0CA 2J06A 1RABB 2E4HA 3H0IA 4J7FA 1WHGA 3QBYA 2QA4T 1TH7A 2AT1B 4A54A 5IXFA 1WX6A 2NUPA 2BTTA 3OSVA 4M75D 5GAMe 1UGSB 2DKGA 2VGMA 4FT4A 1IGUA 3QHSA 1FMKA 1K9MR 1YJNQ 4XTVA 3L2QA 3V8LA 5I22A 3QDFA 3MJXA 1UGVA 3X20B 3A98A 2EKHA 4JLGA 1BI3A 2J05A 1X6BA 1YIJQ 4C8QF 1YI2T 3QYHB 3OB9A 4BDZA 4DBHA 1FMWA 3F70A 2JNGA 2BZ8A 1PNJA 2M02A 4RCBA 2MI6A 3S3NA 3G6ET 1M90R 3HRSA
chains in the Genus database with same CATH topology
1N5ZA 1WXUA 2KRNA 2NUZA 1V1CA 3NMZC 1SHGA 4J9DA 1GBQA 2K9GA 2A28A 2DJQA 1CKAA 2ROLA 4AFZC 2PZ1A 4ESRA 2JS2A 2RQWA 1ZLMA 2M0YA 2DL5A 1X27A 1WXTA 3THKA 1GRIA 2DL3A 3SEMA 1ZX6A 4J9EA 1AWXA 1T3SA 1U3OA 1VYVA 4HCKA 2L2PA 2KT1A 1WIEA 2EYWA 2CSQA 4Z88A 4A63B 1WDXA 3O5ZA 2YDLA 4HVWA 2KYBA 3EG3A 2W0ZA 2CREA 2L3PA 2HSPA 2IIMA 2GQIA 1T3LA 4OMLA 2EPDA 2ESWA 4LN2A 5IH2A 1W1FA 4RTWA 1B07A 2O88A 2PTKA 2HBWA 4OMNA 2I0NA 2J6OA 2O9SA 5L23A 3EG2A 1CKBA 2FRYA 2P4RA 1X6GA 2RPNA 1MV3A 3TVTA 2RNAA 2O31A 1EFNA 1U06A 1YWPA 1XOVA 3PVLA 1Z9QA 2KXCA 2EGAA 4DEXA 1WLPB 2M51A 4JZ4A 4J9CA 1RLQC 1H3HA 1GL5A 1AEYA 1U5SA 2DL7A 3M0RA 2SRCA 3JV3A 1ABQA 1KJWA 1BBZA 2FEIA 1YNZA 1CSKA 1Z9ZA 1OEBA 1PKTA 2L0AA 2X3WD 1MUZA 4IIOA 4EIKA 2ROTA 4CC7A 4JJDA 2CH4W 4JPBW 1MV0B 2CSIA 2EYYA 1W6XA 1UJ0A 2LP5A 1SHFA 2F2WA 3KFVA 2E5KA 1YWOA 2LJ1A 1PRMC 1S1NA 1AVZC 4CC2A 3QWXX 3R6NA 1SRLA 2YSQA 3ZL7C 2DNUA 2RQRA 3IQLA 1GBRA 1JXOA 5GJVB 1WFWA 1VYUA 2AZSA 4J9GA 1LCKA 1ZUYA 2LX7A 1HD3A 1E6HA 1UFFA 1UG1A 4KRTA 2YT6A 4K11A 2EYZA 4M4ZA 2EYXA 2RMOA 4WCIA 1WYXA 4J9IA 4F14A 1PKSA 1QKXA 2KNBB 1X2KA 1M3BA 4JJBA 2GGRA 1TUDA 4LNPA 4OMPA 1M3CA 2D1XA 4OMOA 1RLPC 2KGTA 1NYFA 2KXDA 2G6FX 2GBQA 2FPFA 4HVUA 4J9HA 3UATA 2LJ0A 2JXBA 1QWEA 2BZYA 4E6RA 2K6DA 1K76A 5I11A 4J9BA 2GTOA 5IHIA 3REAB 1KSWA 1JO8A 3RNJA 1E6GA 2JMCA 2J6FA 2B86A 2CUDA 4AG2C 3M0QA 3NHNA 1YN8A 1Y57A 2K2MA 2O9VA 3EHQA 3I5SA 5GJWB 3EG0A 2DMOA 2PNIA 3VS1A 2VWFA 1UTIA 4J9FA 2DE0X 1T0HA 2QDLA 3QWYA 3I35A 5ECAA 1T0JA 5IHKA 2F2VA 2JM8A 4RTTA 4RTYA 5EC7A 2J6KA 2JMAA 4Y92A 3ULRB 4AFQC 1E7OA 4D8DA 1K9AA 4OMMA 4LE9A 1J3TA 4LUDA 1M27C 1UJYA 4Z89A 2ED1A 1WA7A 2DF6A 2W10A 4CC4B 1OPLA 4AFUC 3M0SA 2D8JA 3NGPA 2D0NA 2RQVA 2XMFA 2BZXA 2RN8A 2MOXA 3VRYA 1G83A 1HJDA 3SHWA 1SPKA 2JW4A 1JQQA 2DX1A 1NYGA 3M0PA 2KR3A 1ABOA 1UHFA 4RTVA 2FPDA 4RTUA 2CDTA 4RTZA 3I5RA 1GCPA 2KYMA 2O2OA 2DBKA 4LUEA 2AK5A 3CQTA 2MCNA 4IIMA 2CT3A 2LMJA 2X3XD 1ARKA 2V1RA 3C0CA 1NEBA 2YUOA 2KBTA 2EQIA 2D8HA 4F17A 3RBBB 1KFZA 4D8KA 2KEAA 1X43A 2JTEA 2FO0A 4FSSA 3U23A 5FWCA 1VA7A 1JU5C 2CUBA 1GCQA 2EBPA 2RF0A 3TSZA 2YUNA 1BK2A 1IO6A 1H8KA 4GLMA 5IXBA 4ZNXA 1I07A 2OI3A 1G2BA 1AZEA 5FWBA 4RTXA 3TSWA 1Y0MA 2ABLA 2OAWA 1JEGA 1YCSB 2L3SA 4F16A 3UA6A 2LZ6B 4JJCA 1X69A 1WI7A 1KIKA 2LQNA 2GTJA 1QLYA 2EW3A 3UF4A 3H0HA 3VS4A 3EGUA 2DRMA 1WXBA 2CH4A 1NEGA 1UE9A 2KT8A 2A08A 2EGCA 3NPFA 2K3BA 2GNCA 1OV3A 2C0OA 2KROA 2LNHB 3GBQA 1W70A 2F2XA 2ENMA 1AWWA 1A0NB 1AWOA 1YP5A 1UECA 1SRMA 2YUPA 1QWFA 2AKKA 4CC3A 3I9QA 1K0SA 1AOJA 1SEMA 5HCKA 1VYTA 1UDLA 1B3QA 2DLPA 3LH5A 1ZBJA 2EGEA 2JM9A 2V1QA 1AD5A 1TUCA 2MIOA 2ED0A 2KRMA 2RQUA 1X2QA 4QT7A 1PHTA 2LQWA 3REBB 4HXJA 1GCQC 1AWJA 1UUEA 2C0TA 2LCSA 4DEYA 1H92A 3H0FA 2LJ3A 1NM7A 4X1VA 5IHNA 1PWTA 2DA9A 4R0KA 4OMQA 1OOTA 3H41A 4GBQA 3VS5A 2K79A 1JXMA 1QCFA 3UA7A 2C0IA 1GFDA 2HDAA 1UHCA 2J7IA 1K0XA 4RUGA 5FW9A 1TG0A 2CT4A 2K7AA 2AZVA 1AZGB 1FYNA 3FJ5A 2KE9A 2DRKA 2AKLA 4JZ3A 4HVVA 2FRWA 1I1JA 2VVKA 1PRLC 2DBMA 2L3QA 3VRZA 3EG1A 2DVJA 2VKNA 2HCKA 2HEQA 3EHRA 3VS6A 2FG0A 1ZUUA 1OPKA 2DILA 1RI9A 2YUQA 4AG1C 3VS2A 2JS0A 3VS7A 3VS0A 4Z8AA 1M30A 1M8MA 1I0CA 2J06A 3H0IA 1K1ZA 2DL8A 2DYBA 1K4US 2EVRA 4AFSC 5IXFA 1WX6A 2OJ2A 2JT4A 2BTTA 3M0TA 1HSQA 1NLOC 2KRSA 1ZUKA 3M0UA 3VS3A 1RUWA 1FMKA 2A37A 2H8HA 2RQTA 2DL4A 2ECZA 1BU1A 3PE0A 2NWMA 1SSHA 1QKWA 5I22A 1UGVA 3A98A 2EKHA 2FPEA 2J05A 1M3AA 1X6BA 1NLPC 1BB9A 1GFCA 2A36A 4ORZA 3PVQA 2BZ8A 2DM1A 1PNJA 1NG2A 1ZSGA 2SEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5Z A;  1WXU A;  2KRN A;  2NUZ A;  1V1C A;  3NMZ C;  1SHG A;  4J9D A;  1GBQ A;  2K9G A;  2A28 A;  2DJQ A;  1CKA A;  2ROL A;  4AFZ C;  2PZ1 A;  4ESR A;  2JS2 A;  2RQW A;  1ZLM A;  2M0Y A;  2DL5 A;  1X27 A;  1WXT A;  3THK A;  1GRI A;  2DL3 A;  3SEM A;  1ZX6 A;  4J9E A;  1AWX A;  1T3S A;  1U3O A;  1VYV A;  4HCK A;  2L2P A;  2KT1 A;  1WIE A;  2EYW A;  2CSQ A;  4Z88 A;  4A63 B;  1WDX A;  3O5Z A;  2YDL A;  4HVW A;  2KYB A;  3EG3 A;  2W0Z A;  2CRE A;  2L3P A;  2HSP A;  2IIM A;  2GQI A;  1T3L A;  4OML A;  2EPD A;  2ESW A;  4LN2 A;  5IH2 A;  1W1F A;  4RTW A;  1B07 A;  2O88 A;  2PTK A;  2HBW A;  4OMN A;  2I0N A;  2J6O A;  2O9S A;  5L23 A;  3EG2 A;  1CKB A;  2FRY A;  2P4R A;  1X6G A;  2RPN A;  1MV3 A;  3TVT A;  2RNA A;  2O31 A;  1EFN A;  1U06 A;  1YWP A;  1XOV A;  3PVL A;  1Z9Q A;  2KXC A;  2EGA A;  4DEX A;  1WLP B;  2M51 A;  4JZ4 A;  4J9C A;  1RLQ C;  1H3H A;  1GL5 A;  1AEY A;  1U5S A;  2DL7 A;  3M0R A;  2SRC A;  3JV3 A;  1ABQ A;  1KJW A;  1BBZ A;  2FEI A;  1YNZ A;  1CSK A;  1Z9Z A;  1OEB A;  1PKT A;  2L0A A;  2X3W D;  1MUZ A;  4IIO A;  4EIK A;  2ROT A;  4CC7 A;  4JJD A;  2CH4 W;  4JPB W;  1MV0 B;  2CSI A;  2EYY A;  1W6X A;  1UJ0 A;  2LP5 A;  1SHF A;  2F2W A;  3KFV A;  2E5K A;  1YWO A;  2LJ1 A;  1PRM C;  1S1N A;  1AVZ C;  4CC2 A;  3QWX X;  3R6N A;  1SRL A;  2YSQ A;  3ZL7 C;  2DNU A;  2RQR A;  3IQL A;  1GBR A;  1JXO A;  5GJV B;  1WFW A;  1VYU A;  2AZS A;  4J9G A;  1LCK A;  1ZUY A;  2LX7 A;  1HD3 A;  1E6H A;  1UFF A;  1UG1 A;  4KRT A;  2YT6 A;  4K11 A;  2EYZ A;  4M4Z A;  2EYX A;  2RMO A;  4WCI A;  1WYX A;  4J9I A;  4F14 A;  1PKS A;  1QKX A;  2KNB B;  1X2K A;  1M3B A;  4JJB A;  2GGR A;  1TUD A;  4LNP A;  4OMP A;  1M3C A;  2D1X A;  4OMO A;  1RLP C;  2KGT A;  1NYF A;  2KXD A;  2G6F X;  2GBQ A;  2FPF A;  4HVU A;  4J9H A;  3UAT A;  2LJ0 A;  2JXB A;  1QWE A;  2BZY A;  4E6R A;  2K6D A;  1K76 A;  5I11 A;  4J9B A;  2GTO A;  5IHI A;  3REA B;  1KSW A;  1JO8 A;  3RNJ A;  1E6G A;  2JMC A;  2J6F A;  2B86 A;  2CUD A;  4AG2 C;  3M0Q A;  3NHN A;  1YN8 A;  1Y57 A;  2K2M A;  2O9V A;  3EHQ A;  3I5S A;  5GJW B;  3EG0 A;  2DMO A;  2PNI A;  3VS1 A;  2VWF A;  1UTI A;  4J9F A;  2DE0 X;  1T0H A;  2QDL A;  3QWY A;  3I35 A;  5ECA A;  1T0J A;  5IHK A;  2F2V A;  2JM8 A;  4RTT A;  4RTY A;  5EC7 A;  2J6K A;  2JMA A;  4Y92 A;  3ULR B;  4AFQ C;  1E7O A;  4D8D A;  1K9A A;  4OMM A;  4LE9 A;  1J3T A;  4LUD A;  1M27 C;  1UJY A;  4Z89 A;  2ED1 A;  1WA7 A;  2DF6 A;  2W10 A;  4CC4 B;  1OPL A;  4AFU C;  3M0S A;  2D8J A;  3NGP A;  2D0N A;  2RQV A;  2XMF A;  2BZX A;  2RN8 A;  2MOX A;  3VRY A;  1G83 A;  1HJD A;  3SHW A;  1SPK A;  2JW4 A;  1JQQ A;  2DX1 A;  1NYG A;  3M0P A;  2KR3 A;  1ABO A;  1UHF A;  4RTV A;  2FPD A;  4RTU A;  2CDT A;  4RTZ A;  3I5R A;  1GCP A;  2KYM A;  2O2O A;  2DBK A;  4LUE A;  2AK5 A;  3CQT A;  2MCN A;  4IIM A;  2CT3 A;  2LMJ A;  2X3X D;  1ARK A;  2V1R A;  3C0C A;  1NEB A;  2YUO A;  2KBT A;  2EQI A;  2D8H A;  4F17 A;  3RBB B;  1KFZ A;  4D8K A;  2KEA A;  1X43 A;  2JTE A;  2FO0 A;  4FSS A;  3U23 A;  5FWC A;  1VA7 A;  1JU5 C;  2CUB A;  1GCQ A;  2EBP A;  2RF0 A;  3TSZ A;  2YUN A;  1BK2 A;  1IO6 A;  1H8K A;  4GLM A;  5IXB A;  4ZNX A;  1I07 A;  2OI3 A;  1G2B A;  1AZE A;  5FWB A;  4RTX A;  3TSW A;  1Y0M A;  2ABL A;  2OAW A;  1JEG A;  1YCS B;  2L3S A;  4F16 A;  3UA6 A;  2LZ6 B;  4JJC A;  1X69 A;  1WI7 A;  1KIK A;  2LQN A;  2GTJ A;  1QLY A;  2EW3 A;  3UF4 A;  3H0H A;  3VS4 A;  3EGU A;  2DRM A;  1WXB A;  2CH4 A;  1NEG A;  1UE9 A;  2KT8 A;  2A08 A;  2EGC A;  3NPF A;  2K3B A;  2GNC A;  1OV3 A;  2C0O A;  2KRO A;  2LNH B;  3GBQ A;  1W70 A;  2F2X A;  2ENM A;  1AWW A;  1A0N B;  1AWO A;  1YP5 A;  1UEC A;  1SRM A;  2YUP A;  1QWF A;  2AKK A;  4CC3 A;  3I9Q A;  1K0S A;  1AOJ A;  1SEM A;  5HCK A;  1VYT A;  1UDL A;  1B3Q A;  2DLP A;  3LH5 A;  1ZBJ A;  2EGE A;  2JM9 A;  2V1Q A;  1AD5 A;  1TUC A;  2MIO A;  2ED0 A;  2KRM A;  2RQU A;  1X2Q A;  4QT7 A;  1PHT A;  2LQW A;  3REB B;  4HXJ A;  1GCQ C;  1AWJ A;  1UUE A;  2C0T A;  2LCS A;  4DEY A;  1H92 A;  3H0F A;  2LJ3 A;  1NM7 A;  4X1V A;  5IHN A;  1PWT A;  2DA9 A;  4R0K A;  4OMQ A;  1OOT A;  3H41 A;  4GBQ A;  3VS5 A;  2K79 A;  1JXM A;  1QCF A;  3UA7 A;  2C0I A;  1GFD A;  2HDA A;  1UHC A;  2J7I A;  1K0X A;  4RUG A;  5FW9 A;  1TG0 A;  2CT4 A;  2K7A A;  2AZV A;  1AZG B;  1FYN A;  3FJ5 A;  2KE9 A;  2DRK A;  2AKL A;  4JZ3 A;  4HVV A;  2FRW A;  1I1J A;  2VVK A;  1PRL C;  2DBM A;  2L3Q A;  3VRZ A;  3EG1 A;  2DVJ A;  2VKN A;  2HCK A;  2HEQ A;  3EHR A;  3VS6 A;  2FG0 A;  1ZUU A;  1OPK A;  2DIL A;  1RI9 A;  2YUQ A;  4AG1 C;  3VS2 A;  2JS0 A;  3VS7 A;  3VS0 A;  4Z8A A;  1M30 A;  1M8M A;  1I0C A;  2J06 A;  3H0I A;  1K1Z A;  2DL8 A;  2DYB A;  1K4U S;  2EVR A;  4AFS C;  5IXF A;  1WX6 A;  2OJ2 A;  2JT4 A;  2BTT A;  3M0T A;  1HSQ A;  1NLO C;  2KRS A;  1ZUK A;  3M0U A;  3VS3 A;  1RUW A;  1FMK A;  2A37 A;  2H8H A;  2RQT A;  2DL4 A;  2ECZ A;  1BU1 A;  3PE0 A;  2NWM A;  1SSH A;  1QKW A;  5I22 A;  1UGV A;  3A98 A;  2EKH A;  2FPE A;  2J05 A;  1M3A A;  1X6B A;  1NLP C;  1BB9 A;  1GFC A;  2A36 A;  4ORZ A;  3PVQ A;  2BZ8 A;  2DM1 A;  1PNJ A;  1NG2 A;  1ZSG A;  2SEM A; 
#chains in the Genus database with same CATH topology
 3OYF A;  3M58 A;  1GBQ A;  3KUF A;  2A28 A;  1CKA A;  2PZ1 A;  2NUP B;  1N8R R;  2JS2 A;  2DL5 A;  4FYY B;  1AT1 B;  2E12 A;  2L5Q A;  4E7S A;  2G3R A;  1Q82 U;  4BE2 A;  2E64 A;  3SEM A;  3ZBD A;  1AWX A;  1TSF A;  2AIR B;  3QJ6 A;  1WQ7 A;  3JB9 I;  2KT1 A;  1VIF A;  1PG5 B;  2MAM A;  4M77 B;  4A63 B;  4F7U G;  1SSF A;  3LH0 A;  1MMG A;  3EG3 A;  4C92 E;  2CRE A;  2L3P A;  1WHH A;  2IIM A;  3DLM A;  1Y71 A;  1QVG A;  3FB9 A;  2VC8 A;  3OY9 A;  2GFA A;  2EPD A;  3V8J A;  1RAC B;  1VQ4 Q;  4J5Y A;  3C95 A;  4Z02 A;  2HQH A;  4M77 C;  3R6O A;  5L23 A;  5GAN 2;  1G8X A;  2RPN A;  4L59 A;  2IG0 A;  4RCC A;  3FJP A;  5KYU A;  1U06 A;  1XOV A;  4YTL A;  3I56 Q;  3OSS C;  2KMT A;  5GAM g;  3CME Q;  3DKM A;  2RJE A;  4HKE A;  2Y4Y A;  5D6W A;  3M0R A;  1KJW A;  1CSK A;  2X3W D;  5GAN g;  2RHZ A;  2X4W A;  4M78 B;  1D0X A;  4XK8 E;  2ROT A;  4CC7 A;  1W2B S;  5I21 A;  2CS7 A;  4BY6 B;  1VQ6 T;  2CSI A;  1W6X A;  1UJ0 A;  5C6S A;  2LP5 A;  4M7A G;  2GF7 A;  3MEV A;  1YWO A;  4M7D E;  4M78 C;  2CZ7 B;  1S1N A;  1M1G A;  3JCM W;  4QVZ A;  1I4K 1;  1VQM A;  5J3B A;  4C0D B;  3E9G A;  4BE1 A;  2FZC B;  3CCU Q;  1M5Q 1;  1X01 A;  3ZL7 C;  5KYU B;  4NL2 A;  4DBR A;  1GBR A;  2DET A;  4PK4 A;  1LCK A;  2BE7 D;  2XDD A;  2YHT A;  1UFF A;  5HK0 A;  4IUP A;  4C0D C;  4C8Q A;  1QCO A;  4HT9 A;  2OTL T;  3CCV Q;  2RMO A;  1WYX A;  4J9I A;  5D6Y A;  4F14 A;  2DZC A;  4XU3 A;  1QVF S;  1M3B A;  4E7J A;  2GGR A;  2WSF E;  2DXB A;  1Q7Y R;  2KXD A;  2PU9 B;  2YLB A;  1N9S A;  1JRI A;  3OQ5 A;  3PMI A;  3BW1 A;  4J9H A;  2JXB A;  1QWE A;  1MND A;  1S72 T;  2WAC A;  3JB9 F;  2L3R A;  3REA B;  1JO8 A;  1Q82 C;  3RNJ A;  3LW5 E;  1WNL A;  3RR6 A;  1GXI E;  4B6M A;  3PIP A;  2J6F A;  2CUD A;  3JCM f;  2BKD N;  3J7A F;  4BI4 A;  1ACM B;  4ELZ C;  1U8R A;  4C8Q B;  3I5S A;  2KQW A;  2K57 A;  3V8K A;  2RI2 A;  3GP8 A;  1YIT A;  1JBM A;  2EFI A;  2VWF A;  4OVA A;  2XU8 A;  1T0H A;  4PJJ A;  3G71 T;  4V2S A;  3L2W A;  1VQ7 T;  2QDL A;  4M75 G;  4F7U E;  4C8Q C;  1MMN A;  1KQ1 A;  4EMK C;  3CMA T;  4IUU A;  4UC4 A;  2QQR A;  2JMA A;  4FYX B;  4Y92 A;  4AFQ C;  1E7O A;  4OMM A;  1M27 C;  5HK3 A;  3CCQ T;  1VQL Q;  4OB2 B;  4JRQ A;  1QP2 A;  4BB7 A;  5KYY A;  3M0S A;  3NGP A;  4L5G A;  2KSS A;  1Q81 R;  5J39 A;  2QEX A;  2MOX A;  2RJC A;  4KH1 B;  4PFP A;  4PJO A;  4XTZ A;  2JW4 A;  1JQQ A;  3M0P A;  4QKU A;  1VQK Q;  2VXE A;  4RTU A;  4RTZ A;  2KYM A;  2O2O A;  3E1S A;  2MCN A;  3M9Q A;  2E6N A;  5FU6 C;  1N9R A;  2LMJ A;  2X3X D;  2V1R A;  3CCE Q;  5FLX E;  4QVC A;  1W4S A;  5LJ3 f;  1NBE B;  4D8K A;  2XK0 A;  4RKU E;  2KEA A;  4E7Z A;  4FSS A;  2QA4 A;  4M7A E;  2NUT A;  4XQ3 A;  4JUV A;  5KYY B;  3PMT A;  1VOM A;  4DOW A;  1D1A A;  1FX7 A;  4ZNX A;  1I07 A;  1IHV A;  3CCL Q;  2QQS A;  4DBQ A;  2ABL A;  2OAW A;  3CCS T;  1BI0 A;  4PJO B;  4F16 A;  1YI2 A;  2PVO B;  1Q86 U;  4IKF A;  1UGR B;  3VS4 A;  3EGU A;  3JCM b;  2DVE A;  2CH4 A;  5KYX A;  1UE9 A;  5D6X A;  2CZ6 B;  4PJO C;  3NPF A;  2C0O A;  1RAD B;  3OS5 A;  1IGQ A;  2F2X A;  2ZPI B;  4XTU A;  1SRM A;  1VQ8 A;  2AKK A;  1LJO A;  1NPP A;  1SEM A;  2NUT B;  1KQS A;  3PIO A;  3NTH A;  2VAS A;  2HL3 A;  3LH5 A;  1ZBJ A;  2EGE A;  3CCJ T;  2MIO A;  2RQU A;  1G3Y A;  1AWJ A;  1UUE A;  1YJW A;  3OW2 A;  3ZFJ A;  3GNG A;  1H92 A;  2LJ3 A;  1X75 C;  3OMC A;  4PFO A;  2CGH A;  3A8G B;  3H6Z A;  1VQN A;  2K79 A;  1JXM A;  1HXD A;  2QK0 A;  1TUG B;  2QAS A;  1QCF A;  3HTR A;  1UHC A;  1K0X A;  3EG9 A;  1G3T A;  4J83 A;  1NJI C;  2HAX A;  2MWP A;  1AZG B;  1FYN A;  2AKL A;  3URG A;  3P8D A;  4LDV A;  2L89 A;  5CQX A;  2EJF A;  2MPX C;  2VVK A;  2XG8 D;  1PRL C;  3C12 A;  5KE3 A;  3EG1 A;  1V29 B;  2VKN A;  2HEQ A;  4C0Z A;  3EHR A;  2HL5 C;  1D0Y A;  1VQM T;  3LLR A;  1ZUU A;  3CPF A;  1RI9 A;  2YUQ A;  4OGC A;  4XTX A;  3VS2 A;  2JS0 A;  3JCM d;  5GAM h;  1M30 A;  3HP9 A;  3CC2 Q;  2ZZD A;  2DL8 A;  4EDU A;  2EVR A;  2GCX A;  2DER A;  1RAG B;  4CRI A;  2QQA A;  4JJN K;  1BKB A;  1K9M U;  2JT4 A;  2JN0 A;  2RH2 A;  5EG2 A;  2KY9 A;  3EG9 B;  1LVK A;  1K73 R;  3M0U A;  3VS3 A;  2H8H A;  2RQT A;  4QQG A;  2DL4 A;  2VB6 A;  2OAU A;  2ECZ A;  3CCM Q;  4O5V A;  2DPP B;  4M77 F;  2KI7 A;  3JRZ A;  3JCM c;  3RMQ A;  2EJG A;  3JCM X;  1NLP C;  2ZGW A;  1YHQ A;  1KHC A;  1NPR A;  2YXY A;  3L2U A;  4FW1 A;  1M90 U;  1OZ2 A;  3QO3 A;  2DTO A;  4JDS A;  3A1P A;  2OTL A;  3HSB A;  1QW1 A;  4DBF A;  1N8R U;  2KRN A;  1MMD A;  2NUZ A;  1SHG A;  4J9D A;  2K9G A;  2ROL A;  4AFZ C;  2DK3 A;  1C1A A;  1ZLM A;  1X27 A;  4M7A D;  4ZN1 A;  3M54 A;  3L2Z A;  4N4G A;  3OYM A;  2R5M A;  1QVG P;  3CD6 Q;  2F5K A;  1ZX6 A;  1I5O B;  4M78 F;  1M1F A;  5LJ3 d;  1WDX A;  2RD1 A;  4AMC A;  2F1L A;  2HZY A;  2KYB A;  4F04 B;  1YIT Q;  5LJ5 f;  2D6F A;  4E7L A;  2A0F B;  4X9C A;  3SWN A;  1W1F A;  2WSE E;  4RTW A;  2DTH A;  2O88 A;  1H64 1;  2HBW A;  5KE2 A;  2I0N A;  2J6O A;  2O9S A;  3EG2 A;  1CKB A;  3G71 A;  2FRY A;  3GLX A;  1K8A R;  1X6G A;  1VQ7 A;  1MV3 A;  2RNA A;  2QEX T;  1ZSZ A;  1Z9Q A;  1WPY A;  5LJ3 j;  3PTA A;  5CKE A;  1WLP B;  2M51 A;  3QXE B;  4J9C A;  4QVD A;  2RI5 A;  2QTV A;  5I2S A;  1H3H A;  3JV3 A;  1BBZ A;  1PD0 A;  2FEI A;  3JCM e;  2L0A A;  4EIK A;  1PKT A;  2YRD A;  1KD1 R;  1MUZ A;  2DZ9 A;  2COY A;  4FIB A;  3CC7 T;  1WQW A;  4C5E A;  4XU0 A;  3MEW A;  1PSF A;  4C8Q D;  2F5T X;  3SWN B;  1KK7 A;  5CCA A;  3DB4 A;  3OBY A;  2CP3 A;  2F2W A;  2E5K A;  3KFV A;  4BI3 A;  2CP5 A;  2VV5 A;  3MKD A;  4EPC A;  1TU0 B;  2K5I A;  3QWX X;  3I55 A;  1ZSZ B;  2P4T A;  1SRL A;  3SWN C;  2O4X A;  3DB3 A;  3M59 A;  5GJV B;  5HY6 A;  4E7H A;  1YIJ T;  3LWH A;  2DEQ A;  2AZS A;  2QA4 Q;  3FLG A;  1M1K U;  4M77 A;  4J9G A;  1OU8 A;  2LT1 A;  3PGG A;  1IHW A;  2VGN A;  4R55 A;  1ZSZ C;  2YT6 A;  2XHC A;  1O75 A;  4M4Z A;  1RL2 A;  3P8H A;  4PFZ A;  2YRV A;  4C5H A;  1Q7Y U;  1I8F A;  4LDW A;  1PKS A;  3HFN A;  1VQ8 T;  1X2K A;  4JJB A;  2ZPF B;  3J80 E;  1F1B B;  4LNP A;  3JCM J;  4ANJ A;  4FM4 B;  1QVG S;  1OX9 A;  3NTI A;  3CCS A;  2DTI A;  3S3M A;  2JZ2 A;  1WHK A;  1NE8 A;  4LXC A;  5GMK h;  2LJ0 A;  1B34 A;  4E6R A;  4PLI A;  5GAO r;  1K76 A;  5I11 A;  3G6E Q;  2MK5 A;  2GQV A;  2O4X B;  5IHI A;  1KSW A;  3MEU A;  1E6G A;  2JMC A;  3A8M B;  3TCJ A;  5LJ3 e;  1YJW T;  2IVW A;  4M78 A;  3NHN A;  1YN8 A;  3P8B B;  5CKD A;  2O9V A;  1C6V X;  4KBM B;  4E7I A;  2XDP A;  1TXQ A;  2KAF A;  1OI1 A;  1VQN T;  3EG0 A;  2DMO A;  1TS9 A;  1R8O B;  2MMP A;  4C5G A;  5GAN 4;  2P0Q A;  1UTI A;  2DE0 X;  4NS5 A;  3GIB A;  3JCM g;  2E41 A;  3CCJ A;  2H3E B;  5IHK A;  4F7U B;  2XID A;  2F2V A;  5EC7 A;  5GAN 8;  4D8D A;  2DFU A;  3LX7 A;  3CC4 Q;  1B34 B;  2Y90 A;  1UJY A;  1V76 A;  4Z89 A;  2ED1 A;  4MZP A;  4EMG A;  1Q81 U;  1VQP T;  4CC4 B;  1ZBX A;  2JTF A;  1OPL A;  4AFU C;  3OYK A;  2FZK B;  2RJD A;  1UGQ B;  2RQV A;  2XMF A;  3HL8 A;  2BZX A;  2RN8 A;  4ZTF A;  4PJO F;  1KC8 C;  4OGE A;  2EQU A;  4JS5 A;  3T9N A;  1ABO A;  2CDT A;  3X26 B;  4LUE A;  3CQT A;  3UWN A;  4PLL A;  2CT3 A;  3G7Z A;  1ARK A;  3C0C A;  4NL3 A;  2KDS A;  2O01 E;  1IZ6 A;  1YHQ T;  2AHJ B;  3V7R A;  4F17 A;  5LJ5 d;  3QII A;  3RBB B;  1JJ2 A;  3VJP A;  1KFZ A;  1VQ6 Q;  5KYN A;  3U23 A;  2X9H A;  1TTH B;  3FIF A;  1VA7 A;  2CUB A;  3RKW A;  2EBP A;  3TSZ A;  4ATO A;  1BK2 A;  4EMK A;  2K2V A;  1BIB A;  1VQO A;  2EYQ A;  5IXB A;  3VKI A;  3JB9 D;  2PVD B;  5FWB A;  4RTX A;  3TSW A;  2L3S A;  3FEO A;  1W2B A;  1KIK A;  5FRO A;  1FXX A;  1IRE B;  5LJ5 j;  2EW3 A;  1HYO A;  2WSC E;  2M9U A;  1KQS P;  3UDC A;  4PJM A;  3MET A;  2A08 A;  2EGC A;  3QJY A;  5CO7 A;  3A5Z B;  3GBQ A;  3RKX A;  1A0N B;  1YP5 A;  3PFS A;  2HMA A;  2YUP A;  2YLC A;  1QWF A;  1VQ9 A;  4CC3 A;  4MDW A;  1M2V A;  2DXU A;  3QPH A;  4KGZ B;  1VYT A;  3INZ A;  4OB3 B;  1MHN A;  3A8L B;  3OW2 P;  1B3Q A;  4C8Q G;  4EMK B;  3OMG A;  2DEU A;  3RDV A;  1TUC A;  3GF5 A;  1S72 Q;  2FZG B;  5IT9 E;  1Q82 R;  1Y96 A;  4A4E A;  1D1B A;  4HXJ A;  4DOV A;  4M77 E;  2RHI A;  5CVI A;  2C0T A;  1QVF A;  3KXT A;  4DEY A;  4GY5 A;  1R77 A;  4X1V A;  1BIA A;  5IHN A;  3H41 A;  4XU2 A;  2LCL A;  3VS5 A;  4M75 B;  3UA7 A;  3G71 Q;  2C06 A;  2DD4 A;  1VQ7 Q;  3EH1 A;  4RUG A;  3CCR T;  2LDM A;  3OYJ A;  2COW A;  3QYG B;  3UT1 A;  3FJ5 A;  1M2V B;  3CMA Q;  2PVG B;  3QZ9 B;  1MGQ A;  2FRW A;  1NZ9 A;  4M75 C;  5FU6 B;  1IXD A;  3QKJ A;  3G1J A;  4OB1 B;  5GAN f;  1PD1 A;  2XI9 A;  3CCQ Q;  5CKF A;  2L8D A;  2DVJ A;  3VS6 A;  1Y96 B;  3I55 T;  1OUL A;  3OYA A;  1YJ9 T;  2D9T A;  2FYK A;  3MEA A;  5LJ5 e;  2BUD A;  1K1Z A;  2DYB A;  2X35 A;  1K4U S;  3CC7 A;  1K73 U;  2OJ2 A;  5FRN A;  3SB2 A;  3SD4 A;  1C0M A;  3M0T A;  2JTM A;  2XDB A;  1HSQ A;  1NLO C;  2KRS A;  1ZUK A;  1RUW A;  2A37 A;  5L8R E;  2LC4 A;  1DJ7 B;  1BU1 A;  3PE0 A;  2NWM A;  1QKW A;  1AHJ B;  2CP2 A;  1YJN A;  1RI0 A;  4A4H A;  4C92 F;  2QQB A;  1BB9 A;  1GFC A;  4PJO G;  1YIJ A;  2CKK A;  8AT1 B;  2EKO A;  1MNE A;  4LDY A;  3DLL A;  2DM1 A;  1NG2 A;  2A7Y A;  4FL6 A;  2A3L A;  3ASK A;  2SEM A;  3OW2 S;  2NYS A;  3CCS Q;  1YCY A;  1Q95 G;  3CPW A;  2YRC A;  1HK9 A;  2JVV A;  1FMV A;  1WJR A;  4LDU A;  2M0Y A;  2FB7 A;  3THK A;  1LOJ A;  2X4Y A;  4XTW A;  3OYN A;  4J9E A;  4RG8 A;  9ATC B;  1T3S A;  1U3O A;  2RK2 A;  3OYL A;  3OA6 A;  4HCK A;  2MYS A;  3VYH B;  2ATC B;  2EYW A;  1XNI A;  3O5Z A;  5A2Q E;  2W0Z A;  4HCZ A;  2HSP A;  4C8Q E;  1OX8 A;  4E47 A;  3E19 A;  2LNV A;  2ESW A;  3EFO B;  4A53 A;  4M7D F;  3CCJ Q;  3BFM A;  4A4G A;  3G4S T;  2VXF A;  5GAN 3;  3PNW C;  2P4R A;  1G5V A;  4MML A;  3EAE A;  3TVT A;  2B8A A;  2O31 A;  2HKQ B;  5FU7 B;  3JB9 G;  3EFR A;  1YWP A;  3EH2 A;  3JCM h;  2P0K A;  2EGA A;  4DEX A;  3M53 A;  2MWO A;  4JZ4 A;  5DLQ E;  2FHD A;  5DY9 A;  1KD1 U;  3CME A;  4LDX A;  1U5S A;  5FU7 C;  4J8O A;  1ABQ A;  2DIQ A;  2V8J A;  1VQP A;  1NJI R;  1YNZ A;  1Z9Z A;  4E7K A;  4M77 D;  4DQ2 A;  2ZPB B;  4JJD A;  4XAX B;  1BI2 A;  2CH4 W;  1IRX A;  4JPB W;  1MV0 B;  1OYX A;  5CIU A;  1N6A A;  2HQX A;  1ZA1 B;  1U1S A;  4PNO A;  1VQO T;  2V26 A;  2LJ1 A;  1PRM C;  3TQ7 P;  1VQM Q;  1AVZ C;  4R56 A;  4A4F A;  4KH0 B;  4CC2 A;  1OZ3 A;  3MP6 A;  2YSQ A;  2RQR A;  3TRE A;  3IQL A;  5KYW A;  3CCU A;  5GAO p;  1JXO A;  1WFW A;  1VYU A;  3WXM B;  5CQY A;  1TOV A;  1ZUY A;  2LX7 A;  4C92 A;  1HD3 A;  2F69 A;  3VUB A;  1UG1 A;  5IAY A;  1I5L A;  2RB6 A;  1XQH A;  4K11 A;  2EYZ A;  4X9D A;  2EQM A;  4FT2 A;  2CZ1 B;  1RAH B;  4KUL A;  4MZT A;  3H9N A;  4WCI A;  2P0P A;  1Q86 C;  4F7U F;  1QKX A;  3SDZ A;  2QG9 B;  2KNB B;  1VQ9 T;  4M78 D;  2QGG A;  3L2R A;  5IN1 A;  4OMP A;  4PJO E;  1M3C A;  1R0C B;  4OMO A;  5GAN d;  1NYF A;  4ME7 A;  3CXC A;  7AT1 B;  3D7S B;  5LJ3 h;  3L1A A;  2OTJ T;  4C0G A;  1O9S A;  2BZY A;  3FDR A;  3C94 A;  1D1C A;  2GTO A;  5KYW B;  4PKC C;  1D3B B;  2YWW A;  4D6W A;  4N4I A;  2DXC A;  3HRT A;  1M2O A;  2B86 A;  4FYV B;  4NOY A;  4C92 B;  1Y57 A;  2K2M A;  3EHQ A;  3M4Y A;  5GJW B;  1UEB A;  5GAN j;  5KH6 A;  3VYG A;  3OYB A;  3QWY A;  1EIF A;  1M4Z A;  2HSE B;  4M7D A;  5ECA A;  1T0J A;  3OYE A;  4C92 C;  2CP6 A;  2JM8 A;  3N5B B;  1VQ5 T;  4RTY A;  1UGP B;  2J6K A;  2M1H A;  1BYM A;  1JB0 E;  2LRQ A;  4LE9 A;  5DM7 R;  4LUD A;  4E2F B;  2LVM A;  2FL7 A;  1WA7 A;  4KUD K;  2DF6 A;  2LCC A;  1PC0 A;  2P84 A;  3Q1J A;  3GNF B;  3HPW A;  2D8J A;  3X24 B;  5GAO m;  3CCR A;  2D0N A;  2QEX Q;  5AYF A;  4IUT A;  3VRY A;  1HJD A;  5CR2 A;  2HQE A;  2KVQ G;  8ATC B;  2DX1 A;  1NYG A;  2H3J A;  3JAM E;  2KR3 A;  4HCB A;  4TVR A;  1UHF A;  1WZO A;  1JJ2 P;  4M7D B;  4J6W A;  2R58 A;  3I5R A;  2VUB A;  2DBK A;  1X6O A;  1K9M C;  1YJN T;  1WJQ A;  5GMK m;  1SG5 A;  1YJ9 A;  3CC7 Q;  2EQI A;  2D8H A;  3CCE A;  2QGF B;  4M7D C;  3GPL A;  1X43 A;  2JTE A;  2FO0 A;  3HHT B;  1OQK A;  5FWC A;  2RF0 A;  1D09 B;  4OMF B;  1W2B P;  2YUN A;  4BD3 A;  4BDY A;  4KUI A;  2K3Y A;  1M90 C;  4Y91 A;  2OI3 A;  1G2B A;  5AT1 B;  1AZE A;  3QZ5 B;  1Y0M A;  1R0B G;  5GAN e;  4F7U A;  3CCL A;  1YCS B;  5J26 A;  3M57 A;  4HCC A;  2PQW A;  2LZ6 B;  4FYW B;  4FW2 A;  1PCX A;  4JJC A;  1X69 A;  4EMH A;  4ZN3 A;  1YI2 Q;  1N8R C;  4IUR A;  1N27 A;  3RMS A;  3UF4 A;  3H0H A;  4A4K A;  3OS1 A;  2DRM A;  4M75 F;  1WXB A;  3MP8 A;  4RG2 A;  3VV0 A;  2XD0 A;  2PUO B;  4N0A A;  3X28 B;  2IPO B;  2LNH B;  2HNI A;  1VQ8 Q;  2ZPH B;  2ENM A;  1AWO A;  1ZHI A;  3JB9 H;  3EGX A;  4FU6 A;  1B7T A;  2ZPG B;  4M77 G;  3WVD B;  4BE0 A;  5CKB A;  4DA4 A;  3FC3 A;  2QYZ A;  1QVF P;  1WGS A;  2DLP A;  1VQ4 T;  4PJN A;  2JM9 A;  1QP3 A;  1M9S A;  3KBG A;  1AD5 A;  2E5Q A;  2BE9 B;  2KRM A;  4N4H A;  1PHT A;  2LQW A;  1YJW Q;  2ZCF B;  3REB B;  3OYC A;  4BUG A;  4PJO D;  3OYI A;  4ZGE B;  2LCS A;  3I56 T;  3H0F A;  1M8V A;  3CC4 T;  4R0K A;  3H8Z A;  1VQN Q;  4GBQ A;  3CME T;  4M7A A;  2DO3 A;  2C0I A;  1GFD A;  2HDA A;  2BIV A;  1FWZ A;  3EGX B;  2K7A A;  3G4S A;  2KE9 A;  1JJ2 S;  4JZ3 A;  1BCM A;  4M78 G;  1SKU B;  4N0A C;  1WHJ A;  2L3Q A;  2DBM A;  4B9X A;  4OF1 A;  3RER A;  5GMK j;  1XJW B;  3EGD A;  5LJ5 h;  2RHX A;  1VQP Q;  3MCA B;  2FG0 A;  4JS4 A;  2DIL A;  2QTX A;  4AG1 C;  3VS7 A;  3CCU T;  4P5N A;  2QAZ A;  3M5A A;  1KC8 R;  5GMK i;  5GAN 5;  1EX4 A;  3CC2 A;  1KQ2 A;  4AFS C;  4M7A B;  1LNX A;  4J7I A;  2OX7 A;  3OYH A;  5GAN 6;  1M1K C;  3SFM A;  1TWB A;  3CCV T;  4O6J A;  4PL6 A;  3M55 A;  5LJ3 g;  2LX9 A;  3QUI A;  4BY6 C;  3UPU A;  1SSH A;  1WHM A;  4M7A C;  3CCM A;  3GOX A;  1YHQ Q;  2FPE A;  1M3A A;  2DD5 A;  3QG1 A;  1Q7Y C;  4J6Y A;  2DIG A;  2DXT A;  2QQ9 A;  3EGD B;  2A36 A;  4ORZ A;  4ELY C;  2E65 A;  3PVQ A;  3CPW P;  1MMA A;  1M1K R;  3NFC A;  2OTL Q;  4QW2 A;  2HD0 A;  3L2V A;  2NLU A;  1ZSG A;  4M75 A;  5CK9 A;  2KK4 A;  1N5Z A;  4RMO A;  3CBO A;  1WXU A;  1V1C A;  3NMZ C;  2DJQ A;  4B9W A;  4ESR A;  3LYI A;  2RQW A;  4IUV A;  2I2L A;  3E9F A;  1OU9 A;  4BAC A;  1RAE B;  1WXT A;  4KT0 E;  3WVE B;  1GRI A;  2DL3 A;  2OTJ A;  3CD6 A;  1VYV A;  3CBM A;  2L2P A;  1UB4 A;  1WIE A;  3RKY A;  2CSQ A;  4Z88 A;  3JSC A;  2YDL A;  5GMK e;  1G3W A;  2CP7 A;  4HVW A;  2QI2 A;  2GQI A;  3ZEH A;  3RES A;  1T3L A;  5A0G A;  2DJZ A;  4OML A;  2Z0W A;  4LN2 A;  1VQL T;  5IH2 A;  1EZZ B;  1B07 A;  2E1H A;  2PTK A;  4OMN A;  3MP1 A;  2QXF A;  3BDL A;  4J6X A;  5FRM A;  5GAM f;  4JLI A;  2CP0 A;  1ZA2 B;  4BI8 B;  1Q81 C;  3M56 A;  1EFN A;  3PVL A;  3RIR A;  4MDX A;  5D7U A;  3TU4 K;  1VQ5 A;  2KXC A;  3V7C A;  1RLQ C;  3L42 A;  2ZPE B;  2JOY A;  1WHL A;  2Y4X A;  3MHX A;  1NJI U;  1VQK T;  1QMC A;  1GL5 A;  1AEY A;  2DL7 A;  3CCR Q;  2QDY B;  2E70 A;  2SRC A;  2VYT A;  3OS2 A;  2CYZ B;  4IIO A;  2GFU A;  1OEB A;  2EWN A;  3VUZ A;  3E2U A;  4M78 E;  2K5L A;  3CCE T;  1VIE A;  2ZAE A;  4C92 D;  1PM3 A;  3OS0 A;  2EYY A;  3OYG A;  1SHF A;  3HKS A;  2RHU A;  3I55 Q;  1G3S A;  1D0Z A;  5CKH A;  1KHI A;  3R6N A;  5GAO q;  4GLK A;  1YJ9 Q;  3CPW S;  2DNU A;  3CCL T;  4VUB A;  1Y7X A;  2E3I A;  4Q5W A;  1KQS S;  2RO0 A;  1PSE A;  1E6H A;  4KRT A;  2V8K A;  3CXC P;  3BDU A;  2LQ8 A;  2EYX A;  1BCO A;  3EFO A;  4OB0 B;  3OYD A;  1H3Z A;  3FRN A;  4LD9 K;  3JB9 J;  3HRU A;  1TUD A;  2D1X A;  1RLP C;  5DLO A;  2KGT A;  3LGL A;  2RJF A;  1P92 A;  5GAO l;  2G6F X;  4HA8 A;  3AT1 B;  2FVU A;  2GBQ A;  2RHY A;  2FPF A;  4HVU A;  5C0M A;  3UAT A;  4QQD A;  4M7D D;  2K6D A;  4J9B A;  3O8V A;  4ZTJ A;  3G6E A;  1QVP A;  3JCM Q;  4PJL A;  2K3X A;  4ZGJ B;  4AG2 C;  3M0Q A;  5GMK l;  2PNI A;  1I81 A;  3VS1 A;  3OBW A;  3OYY A;  2PUK B;  1K8A U;  4J9F A;  2RK1 A;  3HFO A;  5HKC A;  1VQ4 A;  4OP0 A;  2XKO C;  1LPL A;  2D0Q B;  3I35 A;  4QQ6 A;  3ME9 A;  5LJ5 g;  3S3O A;  3JCM V;  3NTK A;  3TEE A;  4RTT A;  3ULR B;  2LTO A;  5KCH A;  4FSX A;  1K9A A;  3PT9 A;  3QSU A;  4MZM A;  3I56 A;  1J3T A;  5KYX B;  4WF2 A;  3CC4 A;  1RAI B;  4M75 E;  2K4Y A;  2W10 A;  3G4S Q;  3RUX A;  2JJ9 A;  2R5A A;  3CC2 T;  1G83 A;  6AT1 B;  4L6V 5;  3SHW A;  1SPK A;  1VUB A;  2RM4 A;  4WTO B;  2EAY A;  4RTV A;  2COZ A;  2FPD A;  5A0L A;  3CBP A;  4MMK A;  1GCP A;  2MF2 A;  1K73 C;  2AK5 A;  3BE3 A;  1ZQ1 A;  4IIM A;  4XTY A;  3CCM T;  1NEB A;  2E6Z A;  2HKN A;  2YUO A;  1D3B A;  2KBT A;  3EFS A;  3CXC S;  4HT8 A;  3X25 B;  2EJ9 A;  2E10 A;  5M9O A;  1VQ6 A;  5GAN h;  4FCY A;  1JU5 C;  1GCQ A;  2X51 A;  1VQO Q;  1Y07 A;  3CEY A;  4AT1 B;  1IO6 A;  1H8K A;  5GAM d;  4GLM A;  3CCV A;  1YBY A;  2V8I A;  3LWI A;  1U1T A;  1JEG A;  1WJS A;  4JRI A;  4C5I A;  3UA6 A;  2DAQ A;  4ZGD B;  4JRK A;  2HBP A;  4IUQ A;  1WI7 A;  2LQN A;  2R57 A;  2GTJ A;  1QCN A;  1QLY A;  2CZ0 B;  3JCM P;  3QDR B;  3ER0 A;  3A8O B;  2EQJ A;  1NEG A;  3VU3 C;  3CD6 T;  2XIC A;  2KT8 A;  1Q86 R;  4JRP A;  2K3B A;  2GNC A;  1OV3 A;  2KRO A;  5I2M A;  1BI1 A;  1W70 A;  5GAM j;  1VQ9 Q;  1AWW A;  1UEC A;  1YFN A;  3MO8 A;  3I9Q A;  1K0S A;  1AOJ A;  5HCK A;  1YIT T;  1RAF B;  3C4S A;  5A0D A;  1UDL A;  4C92 G;  2K5F A;  2OTJ Q;  3S6W A;  2V1Q A;  1XTD A;  2RI3 A;  2ED0 A;  5KCO A;  1X2Q A;  1S72 A;  4QT7 A;  1K8A C;  1KG1 A;  1GCQ C;  5CAI A;  1SF9 A;  1NM7 A;  3BY7 A;  1PWT A;  2DA9 A;  4M7A F;  4OMQ A;  1OOT A;  2EQK A;  2LQK A;  2X4J A;  3AHU A;  2EIF A;  2E3H A;  2JUF A;  3J81 E;  4CI0 C;  1VQL A;  4C0F A;  2M0O A;  2J7I A;  5FW9 A;  4II1 A;  1TG0 A;  2CT4 A;  1KD1 C;  2AZV A;  2DRK A;  3MPU B;  1VQ5 Q;  4Y28 E;  4HVV A;  3CMA A;  3A8H B;  1I1J A;  4X34 A;  3M4G A;  5LL6 S;  4KGV B;  3VRZ A;  5GAN 7;  2X4X A;  1RAA B;  4LD6 A;  2M16 A;  2HCK A;  3CCQ A;  1IB8 A;  4KGX B;  4XU1 A;  1QQJ A;  2LT4 A;  1VQK A;  1OPK A;  1KC8 U;  4M7D G;  5GAO n;  3LGF A;  2DYI A;  3V7S A;  3VS0 A;  2RA2 A;  4Z8A A;  1M8M A;  1I0C A;  2J06 A;  1RAB B;  2E4H A;  3H0I A;  4J7F A;  1WHG A;  3QBY A;  2QA4 T;  1TH7 A;  2AT1 B;  4A54 A;  5IXF A;  1WX6 A;  2NUP A;  2BTT A;  3OSV A;  4M75 D;  5GAM e;  1UGS B;  2DKG A;  2VGM A;  4FT4 A;  1IGU A;  3QHS A;  1FMK A;  1K9M R;  1YJN Q;  4XTV A;  3L2Q A;  3V8L A;  5I22 A;  3QDF A;  3MJX A;  1UGV A;  3X20 B;  3A98 A;  2EKH A;  4JLG A;  1BI3 A;  2J05 A;  1X6B A;  1YIJ Q;  4C8Q F;  1YI2 T;  3QYH B;  3OB9 A;  4BDZ A;  4DBH A;  1FMW A;  3F70 A;  2JNG A;  2BZ8 A;  1PNJ A;  2M02 A;  4RCB A;  2MI6 A;  3S3N A;  3G6E T;  1M90 R;  3HRS A; 
#chains in the Genus database with same CATH homology
 1N5Z A;  1WXU A;  2KRN A;  2NUZ A;  1V1C A;  3NMZ C;  1SHG A;  4J9D A;  1GBQ A;  2K9G A;  2A28 A;  2DJQ A;  1CKA A;  2ROL A;  4AFZ C;  2PZ1 A;  4ESR A;  2JS2 A;  2RQW A;  1ZLM A;  2M0Y A;  2DL5 A;  1X27 A;  1WXT A;  3THK A;  1GRI A;  2DL3 A;  3SEM A;  1ZX6 A;  4J9E A;  1AWX A;  1T3S A;  1U3O A;  1VYV A;  4HCK A;  2L2P A;  2KT1 A;  1WIE A;  2EYW A;  2CSQ A;  4Z88 A;  4A63 B;  1WDX A;  3O5Z A;  2YDL A;  4HVW A;  2KYB A;  3EG3 A;  2W0Z A;  2CRE A;  2L3P A;  2HSP A;  2IIM A;  2GQI A;  1T3L A;  4OML A;  2EPD A;  2ESW A;  4LN2 A;  5IH2 A;  1W1F A;  4RTW A;  1B07 A;  2O88 A;  2PTK A;  2HBW A;  4OMN A;  2I0N A;  2J6O A;  2O9S A;  5L23 A;  3EG2 A;  1CKB A;  2FRY A;  2P4R A;  1X6G A;  2RPN A;  1MV3 A;  3TVT A;  2RNA A;  2O31 A;  1EFN A;  1U06 A;  1YWP A;  1XOV A;  3PVL A;  1Z9Q A;  2KXC A;  2EGA A;  4DEX A;  1WLP B;  2M51 A;  4JZ4 A;  4J9C A;  1RLQ C;  1H3H A;  1GL5 A;  1AEY A;  1U5S A;  2DL7 A;  3M0R A;  2SRC A;  3JV3 A;  1ABQ A;  1KJW A;  1BBZ A;  2FEI A;  1YNZ A;  1CSK A;  1Z9Z A;  1OEB A;  1PKT A;  2L0A A;  2X3W D;  1MUZ A;  4IIO A;  4EIK A;  2ROT A;  4CC7 A;  4JJD A;  2CH4 W;  4JPB W;  1MV0 B;  2CSI A;  2EYY A;  1W6X A;  1UJ0 A;  2LP5 A;  1SHF A;  2F2W A;  3KFV A;  2E5K A;  1YWO A;  2LJ1 A;  1PRM C;  1S1N A;  1AVZ C;  4CC2 A;  3QWX X;  3R6N A;  1SRL A;  2YSQ A;  3ZL7 C;  2DNU A;  2RQR A;  3IQL A;  1GBR A;  1JXO A;  5GJV B;  1WFW A;  1VYU A;  2AZS A;  4J9G A;  1LCK A;  1ZUY A;  2LX7 A;  1HD3 A;  1E6H A;  1UFF A;  1UG1 A;  4KRT A;  2YT6 A;  4K11 A;  2EYZ A;  4M4Z A;  2EYX A;  2RMO A;  4WCI A;  1WYX A;  4J9I A;  4F14 A;  1PKS A;  1QKX A;  2KNB B;  1X2K A;  1M3B A;  4JJB A;  2GGR A;  1TUD A;  4LNP A;  4OMP A;  1M3C A;  2D1X A;  4OMO A;  1RLP C;  2KGT A;  1NYF A;  2KXD A;  2G6F X;  2GBQ A;  2FPF A;  4HVU A;  4J9H A;  3UAT A;  2LJ0 A;  2JXB A;  1QWE A;  2BZY A;  4E6R A;  2K6D A;  1K76 A;  5I11 A;  4J9B A;  2GTO A;  5IHI A;  3REA B;  1KSW A;  1JO8 A;  3RNJ A;  1E6G A;  2JMC A;  2J6F A;  2B86 A;  2CUD A;  4AG2 C;  3M0Q A;  3NHN A;  1YN8 A;  1Y57 A;  2K2M A;  2O9V A;  3EHQ A;  3I5S A;  5GJW B;  3EG0 A;  2DMO A;  2PNI A;  3VS1 A;  2VWF A;  1UTI A;  4J9F A;  2DE0 X;  1T0H A;  2QDL A;  3QWY A;  3I35 A;  5ECA A;  1T0J A;  5IHK A;  2F2V A;  2JM8 A;  4RTT A;  4RTY A;  5EC7 A;  2J6K A;  2JMA A;  4Y92 A;  3ULR B;  4AFQ C;  1E7O A;  4D8D A;  1K9A A;  4OMM A;  4LE9 A;  1J3T A;  4LUD A;  1M27 C;  1UJY A;  4Z89 A;  2ED1 A;  1WA7 A;  2DF6 A;  2W10 A;  4CC4 B;  1OPL A;  4AFU C;  3M0S A;  2D8J A;  3NGP A;  2D0N A;  2RQV A;  2XMF A;  2BZX A;  2RN8 A;  2MOX A;  3VRY A;  1G83 A;  1HJD A;  3SHW A;  1SPK A;  2JW4 A;  1JQQ A;  2DX1 A;  1NYG A;  3M0P A;  2KR3 A;  1ABO A;  1UHF A;  4RTV A;  2FPD A;  4RTU A;  2CDT A;  4RTZ A;  3I5R A;  1GCP A;  2KYM A;  2O2O A;  2DBK A;  4LUE A;  2AK5 A;  3CQT A;  2MCN A;  4IIM A;  2CT3 A;  2LMJ A;  2X3X D;  1ARK A;  2V1R A;  3C0C A;  1NEB A;  2YUO A;  2KBT A;  2EQI A;  2D8H A;  4F17 A;  3RBB B;  1KFZ A;  4D8K A;  2KEA A;  1X43 A;  2JTE A;  2FO0 A;  4FSS A;  3U23 A;  5FWC A;  1VA7 A;  1JU5 C;  2CUB A;  1GCQ A;  2EBP A;  2RF0 A;  3TSZ A;  2YUN A;  1BK2 A;  1IO6 A;  1H8K A;  4GLM A;  5IXB A;  4ZNX A;  1I07 A;  2OI3 A;  1G2B A;  1AZE A;  5FWB A;  4RTX A;  3TSW A;  1Y0M A;  2ABL A;  2OAW A;  1JEG A;  1YCS B;  2L3S A;  4F16 A;  3UA6 A;  2LZ6 B;  4JJC A;  1X69 A;  1WI7 A;  1KIK A;  2LQN A;  2GTJ A;  1QLY A;  2EW3 A;  3UF4 A;  3H0H A;  3VS4 A;  3EGU A;  2DRM A;  1WXB A;  2CH4 A;  1NEG A;  1UE9 A;  2KT8 A;  2A08 A;  2EGC A;  3NPF A;  2K3B A;  2GNC A;  1OV3 A;  2C0O A;  2KRO A;  2LNH B;  3GBQ A;  1W70 A;  2F2X A;  2ENM A;  1AWW A;  1A0N B;  1AWO A;  1YP5 A;  1UEC A;  1SRM A;  2YUP A;  1QWF A;  2AKK A;  4CC3 A;  3I9Q A;  1K0S A;  1AOJ A;  1SEM A;  5HCK A;  1VYT A;  1UDL A;  1B3Q A;  2DLP A;  3LH5 A;  1ZBJ A;  2EGE A;  2JM9 A;  2V1Q A;  1AD5 A;  1TUC A;  2MIO A;  2ED0 A;  2KRM A;  2RQU A;  1X2Q A;  4QT7 A;  1PHT A;  2LQW A;  3REB B;  4HXJ A;  1GCQ C;  1AWJ A;  1UUE A;  2C0T A;  2LCS A;  4DEY A;  1H92 A;  3H0F A;  2LJ3 A;  1NM7 A;  4X1V A;  5IHN A;  1PWT A;  2DA9 A;  4R0K A;  4OMQ A;  1OOT A;  3H41 A;  4GBQ A;  3VS5 A;  2K79 A;  1JXM A;  1QCF A;  3UA7 A;  2C0I A;  1GFD A;  2HDA A;  1UHC A;  2J7I A;  1K0X A;  4RUG A;  5FW9 A;  1TG0 A;  2CT4 A;  2K7A A;  2AZV A;  1AZG B;  1FYN A;  3FJ5 A;  2KE9 A;  2DRK A;  2AKL A;  4JZ3 A;  4HVV A;  2FRW A;  1I1J A;  2VVK A;  1PRL C;  2DBM A;  2L3Q A;  3VRZ A;  3EG1 A;  2DVJ A;  2VKN A;  2HCK A;  2HEQ A;  3EHR A;  3VS6 A;  2FG0 A;  1ZUU A;  1OPK A;  2DIL A;  1RI9 A;  2YUQ A;  4AG1 C;  3VS2 A;  2JS0 A;  3VS7 A;  3VS0 A;  4Z8A A;  1M30 A;  1M8M A;  1I0C A;  2J06 A;  3H0I A;  1K1Z A;  2DL8 A;  2DYB A;  1K4U S;  2EVR A;  4AFS C;  5IXF A;  1WX6 A;  2OJ2 A;  2JT4 A;  2BTT A;  3M0T A;  1HSQ A;  1NLO C;  2KRS A;  1ZUK A;  3M0U A;  3VS3 A;  1RUW A;  1FMK A;  2A37 A;  2H8H A;  2RQT A;  2DL4 A;  2ECZ A;  1BU1 A;  3PE0 A;  2NWM A;  1SSH A;  1QKW A;  5I22 A;  1UGV A;  3A98 A;  2EKH A;  2FPE A;  2J05 A;  1M3A A;  1X6B A;  1NLP C;  1BB9 A;  1GFC A;  2A36 A;  4ORZ A;  3PVQ A;  2BZ8 A;  2DM1 A;  1PNJ A;  1NG2 A;  1ZSG A;  2SEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...