1PKSA

Structure of the pi3k sh3 domain and analysis of the sh3 family
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
EGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT SH3 DOMAIN
publication title Structure of the PI3K SH3 domain and analysis of the SH3 family.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 76
sequence length 76
ec nomenclature ec 2.7.1.137: Phosphatidylinositol 3-kinase.
pdb deposition date 1994-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1pksA00
3PVLA 1ZUYA 2YDLA 2LP5A 2YUOA 3UA6A 1B3QA 4D8DA 2LJ1A 2ECZA 1VYTA 1S1NA 1AWJA 1GFDA 1NYGA 3QWYA 2JS0A 3EG1A 1JEGA 3I5SA 2KYBA 1M27C 3EG3A 2RQWA 2KT1A 2M51A 1KSWA 3NGPA 2BZXA 1E6GA 2EVRA 2PTKA 2DM1A 1CKBA 1UHFA 4GBQA 3VS6A 1UGVA 2V1QA 2KE9A 3VS5A 4ESRA 2DMOA 1JO8A 2J6FA 1PWTA 2J05A 4D8KA 1AWXA 2LQNA 2DL8A 3THKA 5IXFA 2CT4A 5FWCA 2ENMA 5FW9A 1YWOA 2HSPA 1QCFA 4J9HA 1OOTA 2DL4A 1UE9A 4RTYA 2KYMA 3O5ZA 1KJWA 1PRLC 1WXBA 4HVVA 3VS7A 2OI3A 4JZ3A 3KFVA 3EG0A 2KROA 5IH2A 2JM9A 3H0FA 4M4ZA 4Z8AA 2M0YA 2EQIA 1VYVA 2DL3A 1SPKA 1PKTA 2ED0A 5ECAA 1UDLA 3TSWA 3VS4A 5GJWB 2L2PA 2A36A 1H3HA 3VS1A 5I11A 4OMOA 2AKKA 2MIOA 1WDXA 1NEGA 4A63B 4FSSA 4IIMA 2FPEA 2I0NA 3FJ5A 2DF6A 4OMLA 4AG2C 2CUBA 4HVWA 1UTIA 1X2QA 3VRZA 1UUEA 2V1RA 2A37A 1OEBA 1KFZA 2JM8A 2W0ZA 2HBWA 4ZNXA 2EGCA 1W70A 1V1CA 1M30A 2DRMA 1WA7A 2AK5A 2CUDA 2EYZA 3GBQA 1H92A 1K1ZA 4RTVA 4F16A 1Z9QA 2RN8A 1W1FA 2ROTA 1AEYA 4E6RA 1OPKA 2VKNA 3EHQA 1QWFA 1I0CA 4GLMA 3H0HA 1BK2A 1B07A 3PVQA 5EC7A 1AZEA 2K6DA 4R0KA 1I07A 1BBZA 2KR3A 1SSHA 1HJDA 1K4US 2D0NA 2C0TA 1G83A 2KXCA 2LQWA 3M0SA 1JQQA 2K7AA 2DLPA 3UATA 1TG0A 3M0PA 1E7OA 1WFWA 3TSZA 4OMMA 2FPDA 3JV3A 4J9IA 1K9AA 1X6GA 2RMOA 2ROLA 1X2KA 1FMKA 2QDLA 2AZVA 3ULRB 2JW4A 1YN8A 4F17A 4AFSC 3M0RA 2DYBA 2CDTA 1NG2A 2MCNA 1OV3A 1UHCA 1K0SA 2YUNA 1GL5A 1Y0MA 1T3LA 2MOXA 4AFZC 4JJCA 3SEMA 5IHNA 1FYNA 2B86A 4LUDA 4J9DA 1T3SA 4RTWA 3UA7A 1SRMA 2CH4W 2O9SA 4AG1C 2D1XA 1U3OA 2NUZA 1J3TA 1Y57A 4OMNA 3R6NA 4J9CA 2DJQA 4DEYA 1X6BA 1WYXA 2P4RA 2JTEA 2FRWA 1WX6A 3SHWA 2RPNA 2EW3A 2PZ1A 2L3SA 1RUWA 1I1JA 2KEAA 2O2OA 3I9QA 1CSKA 5FWBA 1VA7A 3VS3A 2J6KA 3LH5A 3RBBB 2EGAA 2KNBB 4RTZA 2JT4A 2DRKA 2C0IA 3IQLA 4F14A 1M3CA 1QKXA 2AZSA 2KBTA 2L0AA 1BU1A 1GFCA 4Z88A 3M0QA 1U06A 3EG2A 2CSQA 1ZUUA 2HEQA 4J9BA 4CC7A 2RF0A 3M0TA 2RQVA 5HCKA 2DILA 2HCKA 1ZSGA 3NPFA 2OAWA 4OMPA 2YUQA 2DA9A 2EBPA 1ZX6A 2SRCA 1MV0B 4CC3A 4LUEA 2LZ6B 2F2VA 4IIOA 1YNZA 1UFFA 3I35A 1WI7A 2XMFA 2DX1A 2O88A 4CC4B 2EGEA 1VYUA 2DNUA 4RTXA 2YSQA 2VVKA 1YP5A 1ARKA 3EGUA 2CH4A 2OJ2A 2YUPA 3ZL7C 1AD5A 2JMCA 2K9GA 1PNJA 2O31A 1TUCA 2J6OA 3QWXX 1CKAA 2D8JA 1BB9A 1U5SA 3RNJA 2EYWA 1WXTA 2JXBA 2X3XD 1K76A 1M3BA 2BZ8A 1EFNA 2LMJA 1PHTA 2J06A 2JMAA 5GJVB 2ED1A 4JZ4A 2CT3A 1QLYA 3REBB 3U23A 4Z89A 5L23A 1UG1A 1T0JA 4JPBW 2ABLA 1AZGB 1ABOA 1SHGA 2EPDA 2CSIA 2EYXA 2LJ0A 3H41A 2CREA 1ZBJA 1NM7A 1AWOA 1M3AA 2GBQA 2HDAA 3I5RA 1MV3A 2VWFA 1W6XA 1N5ZA 3VS0A 1HSQA 2SEMA 2C0OA 3UF4A 4CC2A 2GNCA 2KGTA 1YCSB 2GQIA 3A98A 1WXUA 1SHFA 2L3PA 4LNPA 1LCKA 1GCPA 1MUZA 4JJDA 1G2BA 4X1VA 2FPFA 1GCQA 2KXDA 1GBRA 4Y92A 1RLQC 2FRYA 1X69A 2PNIA 4EIKA 1OPLA 2A08A 2RNAA 1JXOA 4RUGA 4ORZA 2KRNA 2BZYA 4RTUA 2G6FX 1NLOC 1H8KA 1PRMC 2K3BA 3EHRA 2F2XA 2GTOA 1T0HA 4AFUC 3VS2A 1UJYA 4KRTA 5IHIA 2DL5A 3M0UA 1GCQC 2E5KA 1E6HA 1IO6A 1M8MA 2DE0X 2FEIA 2J7IA 2ESWA 1ABQA 4LE9A 2FO0A 3C0CA 3PE0A 3REAB 1KIKA 1QWEA 2RQTA 2LCSA 4LN2A 5I22A 2LX7A 4RTTA 4J9GA 4K11A 2FG0A 1QKWA 3NMZC 4QT7A 1PKSA 2L3QA 4J9FA 4JJBA 1A0NB 1NYFA 1TUDA 2LJ3A 3VRYA 4DEXA 1HD3A 1Z9ZA 2D8HA 2GGRA 2KRSA 1X27A 4HVUA 2YT6A 2RQRA 4OMQA 1GBQA 1UECA 2DBKA 3CQTA 5IXBA 1SEMA 4J9EA 1ZUKA 1AWWA 1AOJA 1RI9A 2RQUA 1XOVA 2F2WA 1RLPC 2EYYA 4WCIA 3H0IA 4HXJA 5IHKA 4AFQC 2KRMA 2BTTA 1X43A 2IIMA 2K79A 1NLPC 3TVTA 2EKHA 1SRLA 2O9VA 1WIEA 2DBMA 1YWPA 1UJ0A 2DL7A 1K0XA 2KT8A 1JU5C 1ZLMA 2H8HA 1AVZC 2LNHB 2A28A 2JS2A 3NHNA 2AKLA 1JXMA 2DVJA 2K2MA 2GTJA 2X3WD 4HCKA 1WLPB 2W10A 1GRIA 1NEBA 2NWMA
chains in the Genus database with same CATH superfamily
4JRKA 4XU1A 3SDZA 4C92F 3CC7T 1WHKA 1VYTA 2DEUA 1NYGA 1VQ5A 4C5GA 1KHIA 4IKFA 2QA4A 3CEYA 3CCUT 2X4XA 5LJ5d 3WVDB 4OB1B 5GAOq 4GBQA 1UHFA 2HSEB 2LVMA 3CCMA 3HP9A 3E9GA 3VS5A 4PJNA 3MEUA 4PNOA 2DMOA 3FC3A 1AWXA 4C0DB 1PD0A 3T9NA 1YWOA 1VOMA 3V7SA 5GAMd 4J9HA 4RG8A 3L42A 3L2WA 1LOJA 3L2QA 3O5ZA 3GLXA 1PRLC 3OYYA 4ZGEB 3RMQA 5IH2A 4EMKC 4C92B 3H0FA 1LPLA 4KULA 5LJ3d 2ED0A 3VS4A 1BI3A 2HAXA 5FU6B 4J7FA 3LWHA 5I11A 4B9XA 2AKKA 3CCVA 4HCBA 2NYSA 4M75D 4FSSA 1RAIB 4M78F 1D0YA 2FPEA 5LJ5h 1QW1A 1YFNA 2HZYA 3FJ5A 4AG2C 4J6YA 3E9FA 2HQEA 5KYXB 1KD1C 3RERA 4OB0B 4F7UF 1TWBA 3A8MB 4M75E 1M30A 1JBMA 2DRMA 2R58A 2MWOA 4JLIA 1K73C 1WA7A 3EH1A 2AK5A 4GLKA 4JRPA 2YRCA 3QZ5B 1M2VA 1ZSZC 2RHYA 2X35A 4PJJA 1OU9A 1W1FA 4E6RA 2HQHA 1OPKA 2DXCA 1I0CA 5GMKm 3JB9H 4GLMA 2R5AA 2Y4XA 2QG9B 3GNGA 3H0HA 3S3OA 2IG0A 5CKEA 1C6VX 4ZN1A 3PVQA 5LJ3h 3PIOA 4R0KA 5AT1B 3CBMA 3J81E 3HL8A 1SSHA 4M78B 2C0TA 2QI2A 3MEWA 2K7AA 2L8DA 3QXEB 1E7OA 2C06A 2HD0A 2YWWA 2NLUA 1IREB 2RMOA 3CCLA 2ROLA 4RKUE 4XTXA 1FMKA 2QDLA 3PMTA 4E7SA 2F1LA 1VQ6A 3GOXA 1U8RA 4VUBA 4F17A 1NG2A 1GXIE 5GANf 1OV3A 3G1JA 4UC4A 1UHCA 4CI0C 1X01A 4DBQA 1Y0MA 1T3LA 2MOXA 2RK1A 4JUVA 4AFZC 1Q81C 1ZSZB 2OTLQ 1DJ7B 1Y96B 3C4SA 5IHNA 3CXCA 1AHJB 5GAN4 4LUDA 2YRDA 2BUDA 3A8OB 1QP2A 2CP2A 2MPXC 5C6SA 4AG1C 2R5MA 2D1XA 1U3OA 1D09B 1YHQT 1K8AR 3I55Q 8AT1B 1YI2Q 1YBYA 3FDRA 2CKKA 1N6AA 2FRWA 3SHWA 3CXCS 4BE2A 4M7AD 5FRNA 1WZOA 5GAOl 3KUFA 2DO3A 4LXCA 4M78G 4A4KA 1RUWA 2IPOB 4BACA 3SB2A 2VGNA 4M7DG 3LH5A 2EGAA 2KNBB 1VQ9Q 4JRQA 1SG5A 2KAFA 5GANe 2BE7D 1BU1A 1GFCA 4O5VA 2NUTA 4F7UG 5J3BA 3EG2A 2CSQA 4M7AE 1M90C 4RCBA 4J9BA 2RF0A 4A4EA 3M0TA 4ZN3A 3X20B 3HRUA 2RHXA 2XK0A 2DILA 4P5NA 1HYOA 3QBYA 3OYGA 4OMPA 1KQSS 4OGCA 3QHSA 1KC8C 2LQKA 3NFCA 1MV0B 4LUEA 2OTLT 4IUVA 2LZ6B 4XK8E 5LJ5g 1QCOA 4CC4B 1KD1U 2EGEA 2DNUA 4RTXA 4PKCC 3EGUA 3CBPA 4KGXB 3NTHA 1K73U 3JCMe 2CH4A 1G8XA 1NPPA 4C8QD 3O8VA 1ZA1B 2JMCA 2VV5A 3I56A 2O31A 5GMKe 1CKAA 1XNIA 1YI2T 1BB9A 3EG9A 2E4HA 3JB9D 5GAMg 3RNJA 2EYWA 3BY7A 1M3BA 1KQ2A 1JRIA 2BZ8A 2CGHA 2LMJA 3QG1A 3PT9A 4MZMA 3CCQQ 2ED1A 1QLYA 5DY9A 4C8QE 3VU3C 3LX7A 1AZGB 3X28B 1SHGA 2EPDA 4FYWB 2CSIA 2EYXA 2RK2A 3KBGA 2CREA 1UGQB 5LJ3g 1VQ9T 1NM7A 1MV3A 3QIIA 4E2FB 2DTOA 3M56A 2GNCA 2GQIA 2L3PA 2AT1B 2QAZA 1IGQA 1XQHA 1G2BA 4X1VA 2FPFA 1N8RR 1QVGP 4NL2A 2WACA 1TS9A 3CBOA 1RLQC 2FRYA 2PNIA 2A08A 5GAOn 3CCRA 4M7DE 4RUGA 4N0AC 4RTUA 2G6FX 1B7TA 2FZKB 2DJZA 2RHIA 3E1SA 2L5QA 1NBEB 2K3BA 3EHRA 4M7DA 3MPUB 2F2XA 4QW2A 1Q81U 6AT1B 2DZCA 1MGQA 2OTJQ 5IHIA 1EX4A 2DL5A 4F7UA 1OX8A 1UGPB 2GCXA 3CMAA 3REAB 4IUTA 1KIKA 1BKBA 2E5QA 1YITT 4J6WA 3TQ7P 4LN2A 2I2LA 3G4SQ 3CCQT 4PJOD 3M9QA 4RTTA 2PUKB 5AYFA 1ZBXA 1R0BG 1Y96A 2EKOA 2MI6A 3EFSA 4J9FA 1TUDA 4PLLA 5GAN3 1SSFA 4MMLA 1NZ9A 3VRYA 3RR6A 1N9SA 3H6ZA 4OMQA 4KBMB 2DBKA 3X24B 4PJOE 2EAYA 4J9EA 2CP3A 5CK9A 1IB8A 2EYYA 2HMAA 4HKEA 2K5LA 1M90U 2BTTA 5C0MA 2XDPA 2F5TX 3LWIA 4YTLA 1NLPC 1KC8U 2EKHA 1VQPA 1SRLA 5GAOp 3SWNA 2HBPA 3OYIA 2YLCA 2OTJT 3M55A 1TTHB 3RKXA 2E3IA 2DYIA 4E7KA 2DL7A 1ZLMA 4QQDA 3DKMA 2H3JA 1PD1A 4FM4B 5HK0A 2P4TA 1VQ7A 3G4ST 3HFNA 2M16A 1QQJA 2X3WD 3FJPA 1MMAA 4IUQA 4M75F 2NWMA 1ZUYA 2YDLA 4XU3A 1AWJA 2NUPA 4EPCA 3EG1A 1JEGA 3CCSQ 4HCZA 3CCJQ 3FB9A 4FT4A 3G71Q 3RMSA 1VQLQ 4MZPA 3NGPA 1KQSP 2VB6A 2DETA 1YJ9A 1JJ2A 1E6GA 2PTKA 2HKNA 2QEXQ 2JUFA 3CD6A 4IUUA 3BDLA 3V8JA 2EWNA 2J6FA 2J05A 4A4HA 2EYQA 1OU8A 2JTFA 2LQNA 3THKA 5IXFA 2DEQA 2ENMA 3JCMW 2HSPA 3S6WA 1P92A 3HTRA 4NOYA 2DL4A 2QK0A 9ATCB 5DLOA 4HVVA 4JDSA 3PTAA 1JJ2S 1QVFP 4JZ3A 4M75B 2JM9A 1M2VB 1MMNA 1S72A 3OS0A 4JLGA 2M0YA 4PJLA 1BI1A 2DL3A 1SPKA 2KY9A 2M02A 5ECAA 3EGDA 2L2PA 1H3HA 3VS1A 2VUBA 3P8DA 2E41A 3BW1A 3V8LA 2MIOA 4LDYA 1NEGA 5GAN2 4M77D 2P84A 3OYLA 2I0NA 2DF6A 1IHWA 3CCST 3CCET 4HVWA 1PSEA 5KCOA 3CCJT 1X2QA 2PQWA 5D6WA 1X75C 2GFAA 1VQOA 2V1RA 3G71T 2JM8A 2W0ZA 5KCHA 4ZNXA 3JRZA 1W70A 4E47A 2FZCB 3JCMV 3OS5A 2QEXT 2DD4A 3CMEQ 2DAQA 1K1ZA 4RTVA 2COYA 3BDUA 5HK3A 3MEVA 3F70A 2ROTA 1YJNQ 1AEYA 4R55A 5FRMA 2VGMA 3CPFA 2QQAA 1Q7YC 5CR2A 2DTHA 3JCMd 2XKOC 2MAMA 1VQ5Q 5EC7A 4X9CA 1I07A 4M75G 2FHDA 4DA4A 2CYZB 2CP6A 2M9UA 3QDFA 1G83A 2KXCA 2RD1A 4DOVA 4RMOA 1XTDA 2DLPA 3UATA 4QVZA 2YLBA 1SF9A 3CCMQ 3M58A 4KUDK 4OMMA 5A0GA 5FU6C 2LCCA 3M5AA 2A0FB 5GANh 2DZ9A 5KYYA 4MDWA 5LJ5j 2VXFA 2O4XA 2JW4A 1YN8A 3OYDA 1OZ2A 4AFSC 2QDYB 2MCNA 3MHXA 4FCYA 1K0SA 2YUNA 4J83A 5D7UA 1GL5A 3GP8A 2F5KA 2JOYA 2RJCA 2B86A 3PIPA 2NUTB 1T3SA 4RTWA 1M1FA 5GAMj 1KK7A 1SRMA 3CMET 2O9SA 3JCMh 2NUZA 1D3BA 2MMPA 1WHJA 4C8QF 1J3TA 3CCVQ 1YJNT 5GMKh 1RI0A 1M1KR 1O75A 5LJ3j 1VQ5T 3MJXA 4HA8A 1QVGA 3H9NA 4MMKA 2PZ1A 4FL6A 4FYVB 4DBHA 4PFPA 1I1JA 4M78C 1G3WA 2O2OA 3C95A 1Q82R 2J6KA 4OP0A 4RTZA 2DRKA 3CC4A 4M7DF 3EG9B 4E7LA 2KBTA 2L0AA 4RCCA 3M0QA 1VQKQ 5CKFA 3ASKA 4C0FA 4CC7A 1QVGS 5HCKA 4ZGJB 2HCKA 1ZSGA 2RI3A 4LDXA 1OI1A 5I2SA 3LGFA 3RESA 4M75A 3OS2A 2EJGA 3MCAB 4CC3A 2DXUA 3GPLA 1UFFA 4XTVA 4NL3A 2O88A 4Z02A 1VYUA 4AMCA 1YP5A 3INZA 1U1SA 4JRIA 4M7AG 2YUPA 3CCVT 3ZL7C 1AD5A 3OA6A 2DTIA 4B6MA 2LQ8A 2E64A 3CCLQ 3E19A 3FLGA 1JJ2P 2D8JA 1ZA2B 1MNEA 1VQ6Q 1Y71A 1WXTA 4M7DB 2X3XD 5I2MA 1Q7YU 2RM4A 4PJOF 3WVEB 2JMAA 4JZ4A 5L23A 1UG1A 4BDZA 4J8OA 1ABOA 4F7UB 2X51A 2PVDB 3H41A 2LJ0A 1ZBJA 1VQMQ 1YHQA 3SWNC 1W6XA 3VS0A 1HSQA 3OSSC 1VQKT 4CC2A 1R8OB 2O01E 5D6XA 3OW2A 1K9MR 1WXUA 1SHFA 2BE9B 4WF2A 2KDSA 2Y90A 1MUZA 1BCMA 4ELYC 4BY6B 4IURA 3OYKA 4Y92A 4TVRA 1TXQA 3FIFA 4C8QG 4EIKA 1OPLA 2CP0A 2RNAA 1JXOA 3BE3A 4ORZA 1NLOC 1H8KA 5FU7B 3QJ6A 3OB9A 3DB3A 3OW2S 4E7IA 1BIAA 3EH2A 3VS2A 4CRIA 1UJYA 2WSCE 1GCQC 1IO6A 3RIRA 1LNXA 4WTOB 4C5HA 2X4JA 4OB3B 3VUZA 3C0CA 4HT9A 3PE0A 1VQ6T 3UDCA 2EQMA 1KQSA 3FRNA 2QASA 3JCMg 2LCSA 3JB9J 2OX7A 3SWNB 1LJOA 1VQ4A 5L8RE 4K11A 1QKWA 3NMZC 4QT7A 1PKSA 2L3QA 4JJBA 3OYEA 2LJ3A 4D6WA 2D9TA 2VASA 1VQMT 3ZBDA 2XDDA 3QJYA 4M7AA 1X27A 1SKUB 2YT6A 3L1AA 5D6YA 1I5LA 3TU4K 4C92D 1YIJA 3JCMQ 3OS1A 1TUGB 1YI2A 1NJIR 1QVFA 1D1AA 3I56Q 2VC8A 1RI9A 1XOVA 3X26B 2P0QA 3QKJA 3JB9I 4JS4A 3MEAA 1R77A 2NUPB 2RI2A 2ZAEA 2ZPGB 4LDWA 1VQ9A 3I55T 2QQBA 2KI7A 2V8JA 2CZ1B 1PCXA 2QGFB 4NS5A 1QVFS 4PJOG 3G6EQ 1ZHIA 3UWNA 4X9DA 4FYYB 4FT2A 1Y7XA 4LDUA 5CVIA 1JU5C 5GAMf 2M0OA 2JS2A 2ZPEB 3CC2A 4C8QA 4HCKA 3OY9A 1NEBA 3CCRQ 4FYXB 2LP5A 5J39A 1K8AC 4XTYA 4HCCA 2ECZA 2ATCB 4R56A 3QWYA 2JS0A 1JB0E 5KYUA 3BFMA 3I5SA 4JJNK 4II1A 2COZA 2KYBA 3EGDB 4M78D 1Q86R 1M1GA 1M4ZA 2M51A 2LNVA 2COWA 3CMAQ 1YITA 1FXXA 1CKBA 4BB7A 3VS6A 3CCQA 1EZZB 1EIFA 1UGVA 2DPPB 2KE9A 4ME7A 3EFRA 2LX9A 2CP5A 3J7AF 1JO8A 3D7SB 1PWTA 4D8KA 2DL8A 3R6OA 2CT4A 4FW2A 1H3ZA 2HL5C 8ATCB 1QCFA 1OOTA 5GAMe 3G6ET 1UE9A 2KYMA 1KJWA 1WXBA 1TH7A 3META 2OI3A 2E3HA 3KFVA 1KQ1A 4ATOA 1WJQA 3LLRA 4ANJA 1D1CA 3X25B 3L2UA 1PKTA 5GJWB 2LCLA 2GF7A 2A36A 1N9RA 1VQ8A 4A4FA 3CCRT 4C5IA 2GFUA 2IVWA 1FMVA 2OTJA 4LD9K 4OMLA 1VQPQ 4PFZA 2CUBA 2LT4A 4Q5WA 1UGRB 1BIBA 4ZTJA 4PJOA 3VRZA 1UUEA 2A37A 1KFZA 4N4HA 5GAOm 3CMAT 4DQ2A 1V1CA 4BDYA 5KYYB 3EAEA 1I5OB 3LW5E 3G4SA 1U1TA 2EYZA 4BI8B 2O4XB 3GBQA 1NPRA 2MWPA 1VQ7Q 4N4GA 1H92A 1C0MA 4F16A 1Z9QA 4HT8A 3OW2P 3AHUA 3EGXA 2E6NA 1QWFA 5GMKi 1VQNA 2HKQB 1TOVA 2XHCA 5GAN5 4C0GA 3VJPA 1UGSB 2CZ6B 2KMTA 1N8RC 2PU9B 3ER0A 1WQWA 4M77G 4M75C 2KR3A 4LD6A 4BUGA 3M4YA 1HJDA 1D3BB 5IT9E 2LQWA 3M0SA 1JQQA 3HPWA 1YJ9Q 2LRQA 3NTIA 1TG0A 1RAEB 5CAIA 1G3TA 1ACMB 2FYKA 2FPDA 2DERA 2DFUA 3JV3A 2WSEE 1K9AA 1X6GA 1AT1B 2D0QB 1X2KA 3OMCA 4O6JA 4MDXA 1WHHA 1RAFB 2BIVA 3ULRB 1WHGA 1C1AA 3M0RA 5A0DA 3OBYA 4OB2B 1W2BP 1K8AU 2FB7A 4JJCA 4JS5A 2RJDA 1FYNA 2ZZDA 1R0CB 4J9DA 3QSUA 1UB4A 4L5GA 2CH4W 2P0PA 1Y57A 1HK9A 4OMNA 3R6NA 4J9CA 2DJQA 3CCEA 2JVVA 2ZPHB 1WYXA 2P4RA 1F1BB 2DXTA 1WX6A 4OMFB 4E7ZA 2L3RA 1G3SA 1BI2A 3DB4A 2L3SA 1YJ9T 5FWBA 1VA7A 1IXDA 7AT1B 2XU8A 3IQLA 2FVUA 1M3CA 5GANd 4BD3A 5J26A 2YRVA 2HEQA 3V7RA 1VQLT 3E2UA 3QYHB 1Y07A 5GMKl 1YJWA 3JCMP 2RQVA 2JZ2A 2ZPBB 2V8IA 3NPFA 2OAWA 4M77E 1MHNA 2YUQA 1TSFA 2H3EB 3PMIA 3OYNA 2SRCA 1O9SA 4M77A 2RI5A 3MO8A 1WI7A 2XMFA 3CC7A 2DX1A 1VIEA 3EFOA 4B9WA 2RHZA 3UT1A 3OYBA 2VVKA 4PL6A 1ARKA 2XDBA 2V8KA 5GMKj 3CCUA 5GAOr 4M7AC 1PNJA 1TUCA 2QA4Q 4M7AF 4KH1B 1QCNA 2B8AA 3PGGA 2K3YA 4GY5A 1KD1R 4KGVB 5GAN8 5CKBA 1K76A 2JJ9A 4EMHA 3GF5A 1PHTA 3OYCA 1XJWB 1N8RU 4V2SA 1K73R 3JCMc 3RKYA 4J5YA 5CQYA 3HFOA 2LTOA 3CPWP 1AWOA 1M3AA 2GBQA 2FZGB 2VWFA 1YJNA 1N5ZA 5KE2A 4QKUA 2QGGA 1G3YA 2SEMA 3URGA 2C0OA 1YCSB 4LNPA 4E7HA 1LCKA 4PLIA 1GCPA 4DOWA 2KXDA 1GBRA 1IGUA 3KXTA 4KT0E 1X69A 1M8VA 4MZTA 2E12A 3VYHB 4C8QC 2XG8D 2BZYA 2KRNA 2RHUA 2ZGWA 2EJFA 5EG2A 4M7AB 1OZ3A 1D1BA 1WHMA 3A8GB 2Y4YA 2GTOA 1B34A 4AFUC 3JB9F 5GAN6 3CC4Q 3LH0A 2E5KA 1WJSA 2QA4T 1I8FA 1M8MA 2DE0X 2FEIA 2ZPIB 1ABQA 2MK5A 2EQJA 4LE9A 2XIDA 2JNGA 1W4SA 2QQRA 1QWEA 5KH6A 4KUIA 2RQTA 3UPUA 4KGZB 4M7DC 3CCMT 4F04B 1Q81R 4J9GA 2FG0A 1NYFA 2WSFE 3OYMA 1HD3A 2D8HA 2QYZA 2KRSA 4IUPA 4HVUA 1UECA 5IXBA 2E6ZA 4C8QB 4PFOA 1ZUKA 1AOJA 1BCOA 3H0IA 4HXJA 4BY6C 4AFQC 3QZ9B 2KRMA 3ZFJA 2DD5A 5KYUB 1WPYA 3HHTB 3A5ZB 2BKDN 2D6FA 3H8ZA 2DIGA 2K79A 1RACB 5FU7C 1PG5B 3ZEHA 3TVTA 3TREA 5CCAA 1RADB 4Y28E 5GAMh 1WIEA 1VQKA 2DBMA 3V7CA 2AIRB 2A7YA 3CC4T 1YHQQ 4PJOC 3QUIA 1UJ0A 4EMKB 4J7IA 1M90R 2YHTA 4J6XA 5CKDA 3N5BB 1K0XA 3RUXA 3Q1JA 4BI4A 2LNHB 2A28A 3NHNA 2PUOB 3C94A 2AKLA 1KC8R 2DVJA 2K2MA 2GTJA 2R57A 4C92G 1WLPB 1GRIA 3PVLA 3QPHA 5KE3A 2YUOA 3UA6A 1B3QA 1OULA 4D8DA 2QQSA 4OVAA 2LJ1A 3JSCA 3G7ZA 3SD4A 3DLMA 2E10A 1S1NA 5IN1A 1GFDA 1M1KC 2HL3A 3SFMA 1IRXA 5GANg 1M27C 3EG3A 2RQWA 2KT1A 1KSWA 1X6OA 5FROA 2BZXA 2EVRA 2L89A 2DM1A 2G3RA 1OX9A 4C0ZA 1Q82C 3PFSA 3JB9G 3MP8A 1I4K1 2V1QA 1UEBA 4ESRA 5I21A 4DBFA 3JCMJ 4PJOB 1HXDA 2KK4A 1VQ4Q 2QTVA 1VQMA 5FWCA 3CCLT 1RAHB 5FW9A 5KYWB 2K5FA 2RJEA 4RTYA 5GAN7 3VS7A 2AHJB 1W2BA 1N27A 2HQXA 3EG0A 2OTLA 2KROA 1YIJQ 4M4ZA 4Z8AA 1I81A 3JCMf 1WGSA 2EQIA 1VYVA 3EGXB 4QQGA 3MP1A 1UDLA 3TSWA 4OGEA 4BE1A 1V76A 1RAAB 4Y91A 3NTKA 4OMOA 3S3MA 3I55A 1RAGB 1WDXA 4EDUA 4A63B 1QP3A 4IIMA 5DM7R 2RB6A 1W2BS 2K2VA 4X34A 2RO0A 1UTIA 2RH2A 1WNLA 1OEBA 2HBWA 5LJ5f 2EGCA 2MYSA 3QYGB 2LT1A 4C92E 1M9SA 2CUDA 3TCJA 5LL6S 3CC2Q 4C92A 1VQ4T 3OBWA 2RN8A 2EQUA 2VKNA 3EHQA 3OYHA 1K9MC 3J80E 3M54A 4XQ3A 1BK2A 1PSFA 2E70A 2MF2A 2DKGA 1B07A 3AT1B 1AZEA 2K6DA 1MMDA 1BBZA 2DK3A 1YIJT 3A1PA 4ZTFA 2F69A 1K4US 2D0NA 2ZPFB 4M77C 4M77F 1YITQ 5LJ3f 5KYXA 2P0KA 3M0PA 1WFWA 3TSZA 3TEEA 1PC0A 1QVPA 1KG1A 2OAUA 4XTWA 4XTUA 5M9OA 4J9IA 2VYTA 5CIUA 1QMCA 3JCMb 2M1HA 4XTZA 3OYJA 2AZVA 3G6EA 5LJ5e 3I56T 2JTMA 4M7DD 2DYBA 2CDTA 1WQ7A 3VYGA 3RKWA 3M53A 1M1KU 4L59A 4EMKA 1M5Q1 3SEMA 2EIFA 1FMWA 4XU2A 4M78E 3UA7A 2DIQA 4AT1B 3CC2T 3JCMX 3CPWA 4M78A 2ZCFB 1VQ8Q 1VUBA 4A54A 1Q82U 2K3XA 4QVCA 1NJIC 4F7UE 4M77B 1WJRA 4DEYA 1X6BA 2JTEA 2RPNA 3GIBA 5LJ3e 3EFOB 2EW3A 2KSSA 5FLXE 3HRSA 2KEAA 3OSVA 3I9QA 1CSKA 3CPWS 3VS3A 3RBBB 3QO3A 2JT4A 3L2RA 4ELZC 2C0IA 1ZSZA 4F14A 4A4GA 1QKXA 2AZSA 2LDMA 4Z88A 3OQ5A 5A2QE 3M57A 1U06A 1ZUUA 4PK4A 1VQNQ 5KYWA 4KH0B 5A0LA 5HKCA 3FEOA 5KYNA 2DA9A 2EBPA 1ZX6A 3LGLA 4IIOA 2F2VA 1YNZA 3RDVA 3I35A 2QQ9A 4PJMA 3VKIA 1G5VA 2YSQA 2X4WA 2DXBA 3DLLA 2OJ2A 1VQ8T 3M4GA 4FSXA 3ME9A 2K9GA 2VXEA 2J6OA 2X4YA 1Q86C 2E1HA 3QWXX 3V8KA 3M59A 2KVQG 1D0ZA 1U5SA 2JXBA 2YXYA 1K9MU 5CQXA 1EFNA 3CXCP 2J06A 2RA2A 5GJVB 3REBB 4DBRA 2CT3A 3A8LB 1B34B 3CD6Q 3U23A 4Z89A 1T0JA 2XICA 2ABLA 4JPBW 1BYMA 2EQKA 1LVKA 2EFIA 2QTXA 2HDAA 1VQPT 3I5RA 5CO7A 1OQKA 2E65A 4FW1A 3GNFB 1VIFA 3UF4A 2KGTA 4A53A 2GQVA 3C12A 3A98A 1Q7YR 3HSBA 2KQWA 3VV0A 1VQNT 5IAYA 4JJDA 3OYAA 3CCEQ 1GCQA 1BI0A 3WXMB 1S72Q 4FIBA 3L2ZA 4N4IA 2EJ9A 2XD0A 1VQ7T 1MMGA 1D0XA 2QXFA 1PRMC 4E7JA 4C5EA 1YCYA 2A3LA 3CCSA 2K4YA 4BI3A 3CCJA 1T0HA 4XAXB 3G71A 4KRTA 1VQLA 3M0UA 2JN0A 1H641 1E6HA 1OYXA 2CZ0B 2J7IA 2ESWA 1VQOQ 2FO0A 5HY6A 2X9HA 2QEXA 3JAME 1YJWQ 3A8HB 3OYFA 1V29B 4EMGA 1KHCA 1RABB 5I22A 2XI9A 1NJIU 4XU0A 2LX7A 3LYIA 5GANj 1ZQ1A 4FU6A 4QVDA 3CD6T 3PNWC 2CZ7B 3MKDA 1WHLA 1A0NB 2K5IA 3HKSA 3CC7Q 4DEXA 1Z9ZA 2GGRA 2HNIA 4ZGDB 1FX7A 2Z0WA 3HRTA 2RQRA 1GBQA 4BE0A 3CQTA 2CP7A 3CCUQ 2V26A 3QDRB 1SEMA 4OF1A 2LC4A 1AWWA 2RQUA 3P8BB 2F2WA 1RLPC 3VUBA 3MP6A 4WCIA 1S72T 2FL7A 2PVGB 5IHKA 2RJFA 1M2OA 1RL2A 3S3NA 1X43A 1FWZA 2IIMA 3P8HA 4QQ6A 3L2VA 1Q95G 2CS7A 2O9VA 2PVOB 5DLQE 1NE8A 1YWPA 2K57A 3OMGA 4RG2A 1VQOT 4C0DC 2KT8A 2H8HA 1AVZC 5CKHA 4LDVA 1PM3A 1YJWT 1TU0B 3CMEA 1JXMA 1Q86U 4N0AA 1MNDA 1IZ6A 2DVEA 2W10A 4L6V5 1IHVA 4C92C
chains in the Genus database with same CATH topology
3PVLA 1ZUYA 2YDLA 2LP5A 2YUOA 3UA6A 1B3QA 4D8DA 2LJ1A 2ECZA 1VYTA 1S1NA 1AWJA 1GFDA 1NYGA 3QWYA 2JS0A 3EG1A 1JEGA 3I5SA 2KYBA 1M27C 3EG3A 2RQWA 2KT1A 2M51A 1KSWA 3NGPA 2BZXA 1E6GA 2EVRA 2PTKA 2DM1A 1CKBA 1UHFA 4GBQA 3VS6A 1UGVA 2V1QA 2KE9A 3VS5A 4ESRA 2DMOA 1JO8A 2J6FA 1PWTA 2J05A 4D8KA 1AWXA 2LQNA 2DL8A 3THKA 5IXFA 2CT4A 5FWCA 2ENMA 5FW9A 1YWOA 2HSPA 1QCFA 4J9HA 1OOTA 2DL4A 1UE9A 4RTYA 2KYMA 3O5ZA 1KJWA 1PRLC 1WXBA 4HVVA 3VS7A 2OI3A 4JZ3A 3KFVA 3EG0A 2KROA 5IH2A 2JM9A 3H0FA 4M4ZA 4Z8AA 2M0YA 2EQIA 1VYVA 2DL3A 1SPKA 1PKTA 2ED0A 5ECAA 1UDLA 3TSWA 3VS4A 5GJWB 2L2PA 2A36A 1H3HA 3VS1A 5I11A 4OMOA 2AKKA 2MIOA 1WDXA 1NEGA 4A63B 4FSSA 4IIMA 2FPEA 2I0NA 3FJ5A 2DF6A 4OMLA 4AG2C 2CUBA 4HVWA 1UTIA 1X2QA 3VRZA 1UUEA 2V1RA 2A37A 1OEBA 1KFZA 2JM8A 2W0ZA 2HBWA 4ZNXA 2EGCA 1W70A 1V1CA 1M30A 2DRMA 1WA7A 2AK5A 2CUDA 2EYZA 3GBQA 1H92A 1K1ZA 4RTVA 4F16A 1Z9QA 2RN8A 1W1FA 2ROTA 1AEYA 4E6RA 1OPKA 2VKNA 3EHQA 1QWFA 1I0CA 4GLMA 3H0HA 1BK2A 1B07A 3PVQA 5EC7A 1AZEA 2K6DA 4R0KA 1I07A 1BBZA 2KR3A 1SSHA 1HJDA 1K4US 2D0NA 2C0TA 1G83A 2KXCA 2LQWA 3M0SA 1JQQA 2K7AA 2DLPA 3UATA 1TG0A 3M0PA 1E7OA 1WFWA 3TSZA 4OMMA 2FPDA 3JV3A 4J9IA 1K9AA 1X6GA 2RMOA 2ROLA 1X2KA 1FMKA 2QDLA 2AZVA 3ULRB 2JW4A 1YN8A 4F17A 4AFSC 3M0RA 2DYBA 2CDTA 1NG2A 2MCNA 1OV3A 1UHCA 1K0SA 2YUNA 1GL5A 1Y0MA 1T3LA 2MOXA 4AFZC 4JJCA 3SEMA 5IHNA 1FYNA 2B86A 4LUDA 4J9DA 1T3SA 4RTWA 3UA7A 1SRMA 2CH4W 2O9SA 4AG1C 2D1XA 1U3OA 2NUZA 1J3TA 1Y57A 4OMNA 3R6NA 4J9CA 2DJQA 4DEYA 1X6BA 1WYXA 2P4RA 2JTEA 2FRWA 1WX6A 3SHWA 2RPNA 2EW3A 2PZ1A 2L3SA 1RUWA 1I1JA 2KEAA 2O2OA 3I9QA 1CSKA 5FWBA 1VA7A 3VS3A 2J6KA 3LH5A 3RBBB 2EGAA 2KNBB 4RTZA 2JT4A 2DRKA 2C0IA 3IQLA 4F14A 1M3CA 1QKXA 2AZSA 2KBTA 2L0AA 1BU1A 1GFCA 4Z88A 3M0QA 1U06A 3EG2A 2CSQA 1ZUUA 2HEQA 4J9BA 4CC7A 2RF0A 3M0TA 2RQVA 5HCKA 2DILA 2HCKA 1ZSGA 3NPFA 2OAWA 4OMPA 2YUQA 2DA9A 2EBPA 1ZX6A 2SRCA 1MV0B 4CC3A 4LUEA 2LZ6B 2F2VA 4IIOA 1YNZA 1UFFA 3I35A 1WI7A 2XMFA 2DX1A 2O88A 4CC4B 2EGEA 1VYUA 2DNUA 4RTXA 2YSQA 2VVKA 1YP5A 1ARKA 3EGUA 2CH4A 2OJ2A 2YUPA 3ZL7C 1AD5A 2JMCA 2K9GA 1PNJA 2O31A 1TUCA 2J6OA 3QWXX 1CKAA 2D8JA 1BB9A 1U5SA 3RNJA 2EYWA 1WXTA 2JXBA 2X3XD 1K76A 1M3BA 2BZ8A 1EFNA 2LMJA 1PHTA 2J06A 2JMAA 5GJVB 2ED1A 4JZ4A 2CT3A 1QLYA 3REBB 3U23A 4Z89A 5L23A 1UG1A 1T0JA 4JPBW 2ABLA 1AZGB 1ABOA 1SHGA 2EPDA 2CSIA 2EYXA 2LJ0A 3H41A 2CREA 1ZBJA 1NM7A 1AWOA 1M3AA 2GBQA 2HDAA 3I5RA 1MV3A 2VWFA 1W6XA 1N5ZA 3VS0A 1HSQA 2SEMA 2C0OA 3UF4A 4CC2A 2GNCA 2KGTA 1YCSB 2GQIA 3A98A 1WXUA 1SHFA 2L3PA 4LNPA 1LCKA 1GCPA 1MUZA 4JJDA 1G2BA 4X1VA 2FPFA 1GCQA 2KXDA 1GBRA 4Y92A 1RLQC 2FRYA 1X69A 2PNIA 4EIKA 1OPLA 2A08A 2RNAA 1JXOA 4RUGA 4ORZA 2KRNA 2BZYA 4RTUA 2G6FX 1NLOC 1H8KA 1PRMC 2K3BA 3EHRA 2F2XA 2GTOA 1T0HA 4AFUC 3VS2A 1UJYA 4KRTA 5IHIA 2DL5A 3M0UA 1GCQC 2E5KA 1E6HA 1IO6A 1M8MA 2DE0X 2FEIA 2J7IA 2ESWA 1ABQA 4LE9A 2FO0A 3C0CA 3PE0A 3REAB 1KIKA 1QWEA 2RQTA 2LCSA 4LN2A 5I22A 2LX7A 4RTTA 4J9GA 4K11A 2FG0A 1QKWA 3NMZC 4QT7A 1PKSA 2L3QA 4J9FA 4JJBA 1A0NB 1NYFA 1TUDA 2LJ3A 3VRYA 4DEXA 1HD3A 1Z9ZA 2D8HA 2GGRA 2KRSA 1X27A 4HVUA 2YT6A 2RQRA 4OMQA 1GBQA 1UECA 2DBKA 3CQTA 5IXBA 1SEMA 4J9EA 1ZUKA 1AWWA 1AOJA 1RI9A 2RQUA 1XOVA 2F2WA 1RLPC 2EYYA 4WCIA 3H0IA 4HXJA 5IHKA 4AFQC 2KRMA 2BTTA 1X43A 2IIMA 2K79A 1NLPC 3TVTA 2EKHA 1SRLA 2O9VA 1WIEA 2DBMA 1YWPA 1UJ0A 2DL7A 1K0XA 2KT8A 1JU5C 1ZLMA 2H8HA 1AVZC 2LNHB 2A28A 2JS2A 3NHNA 2AKLA 1JXMA 2DVJA 2K2MA 2GTJA 2X3WD 4HCKA 1WLPB 2W10A 1GRIA 1NEBA 2NWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVL A;  1ZUY A;  2YDL A;  2LP5 A;  2YUO A;  3UA6 A;  1B3Q A;  4D8D A;  2LJ1 A;  2ECZ A;  1VYT A;  1S1N A;  1AWJ A;  1GFD A;  1NYG A;  3QWY A;  2JS0 A;  3EG1 A;  1JEG A;  3I5S A;  2KYB A;  1M27 C;  3EG3 A;  2RQW A;  2KT1 A;  2M51 A;  1KSW A;  3NGP A;  2BZX A;  1E6G A;  2EVR A;  2PTK A;  2DM1 A;  1CKB A;  1UHF A;  4GBQ A;  3VS6 A;  1UGV A;  2V1Q A;  2KE9 A;  3VS5 A;  4ESR A;  2DMO A;  1JO8 A;  2J6F A;  1PWT A;  2J05 A;  4D8K A;  1AWX A;  2LQN A;  2DL8 A;  3THK A;  5IXF A;  2CT4 A;  5FWC A;  2ENM A;  5FW9 A;  1YWO A;  2HSP A;  1QCF A;  4J9H A;  1OOT A;  2DL4 A;  1UE9 A;  4RTY A;  2KYM A;  3O5Z A;  1KJW A;  1PRL C;  1WXB A;  4HVV A;  3VS7 A;  2OI3 A;  4JZ3 A;  3KFV A;  3EG0 A;  2KRO A;  5IH2 A;  2JM9 A;  3H0F A;  4M4Z A;  4Z8A A;  2M0Y A;  2EQI A;  1VYV A;  2DL3 A;  1SPK A;  1PKT A;  2ED0 A;  5ECA A;  1UDL A;  3TSW A;  3VS4 A;  5GJW B;  2L2P A;  2A36 A;  1H3H A;  3VS1 A;  5I11 A;  4OMO A;  2AKK A;  2MIO A;  1WDX A;  1NEG A;  4A63 B;  4FSS A;  4IIM A;  2FPE A;  2I0N A;  3FJ5 A;  2DF6 A;  4OML A;  4AG2 C;  2CUB A;  4HVW A;  1UTI A;  1X2Q A;  3VRZ A;  1UUE A;  2V1R A;  2A37 A;  1OEB A;  1KFZ A;  2JM8 A;  2W0Z A;  2HBW A;  4ZNX A;  2EGC A;  1W70 A;  1V1C A;  1M30 A;  2DRM A;  1WA7 A;  2AK5 A;  2CUD A;  2EYZ A;  3GBQ A;  1H92 A;  1K1Z A;  4RTV A;  4F16 A;  1Z9Q A;  2RN8 A;  1W1F A;  2ROT A;  1AEY A;  4E6R A;  1OPK A;  2VKN A;  3EHQ A;  1QWF A;  1I0C A;  4GLM A;  3H0H A;  1BK2 A;  1B07 A;  3PVQ A;  5EC7 A;  1AZE A;  2K6D A;  4R0K A;  1I07 A;  1BBZ A;  2KR3 A;  1SSH A;  1HJD A;  1K4U S;  2D0N A;  2C0T A;  1G83 A;  2KXC A;  2LQW A;  3M0S A;  1JQQ A;  2K7A A;  2DLP A;  3UAT A;  1TG0 A;  3M0P A;  1E7O A;  1WFW A;  3TSZ A;  4OMM A;  2FPD A;  3JV3 A;  4J9I A;  1K9A A;  1X6G A;  2RMO A;  2ROL A;  1X2K A;  1FMK A;  2QDL A;  2AZV A;  3ULR B;  2JW4 A;  1YN8 A;  4F17 A;  4AFS C;  3M0R A;  2DYB A;  2CDT A;  1NG2 A;  2MCN A;  1OV3 A;  1UHC A;  1K0S A;  2YUN A;  1GL5 A;  1Y0M A;  1T3L A;  2MOX A;  4AFZ C;  4JJC A;  3SEM A;  5IHN A;  1FYN A;  2B86 A;  4LUD A;  4J9D A;  1T3S A;  4RTW A;  3UA7 A;  1SRM A;  2CH4 W;  2O9S A;  4AG1 C;  2D1X A;  1U3O A;  2NUZ A;  1J3T A;  1Y57 A;  4OMN A;  3R6N A;  4J9C A;  2DJQ A;  4DEY A;  1X6B A;  1WYX A;  2P4R A;  2JTE A;  2FRW A;  1WX6 A;  3SHW A;  2RPN A;  2EW3 A;  2PZ1 A;  2L3S A;  1RUW A;  1I1J A;  2KEA A;  2O2O A;  3I9Q A;  1CSK A;  5FWB A;  1VA7 A;  3VS3 A;  2J6K A;  3LH5 A;  3RBB B;  2EGA A;  2KNB B;  4RTZ A;  2JT4 A;  2DRK A;  2C0I A;  3IQL A;  4F14 A;  1M3C A;  1QKX A;  2AZS A;  2KBT A;  2L0A A;  1BU1 A;  1GFC A;  4Z88 A;  3M0Q A;  1U06 A;  3EG2 A;  2CSQ A;  1ZUU A;  2HEQ A;  4J9B A;  4CC7 A;  2RF0 A;  3M0T A;  2RQV A;  5HCK A;  2DIL A;  2HCK A;  1ZSG A;  3NPF A;  2OAW A;  4OMP A;  2YUQ A;  2DA9 A;  2EBP A;  1ZX6 A;  2SRC A;  1MV0 B;  4CC3 A;  4LUE A;  2LZ6 B;  2F2V A;  4IIO A;  1YNZ A;  1UFF A;  3I35 A;  1WI7 A;  2XMF A;  2DX1 A;  2O88 A;  4CC4 B;  2EGE A;  1VYU A;  2DNU A;  4RTX A;  2YSQ A;  2VVK A;  1YP5 A;  1ARK A;  3EGU A;  2CH4 A;  2OJ2 A;  2YUP A;  3ZL7 C;  1AD5 A;  2JMC A;  2K9G A;  1PNJ A;  2O31 A;  1TUC A;  2J6O A;  3QWX X;  1CKA A;  2D8J A;  1BB9 A;  1U5S A;  3RNJ A;  2EYW A;  1WXT A;  2JXB A;  2X3X D;  1K76 A;  1M3B A;  2BZ8 A;  1EFN A;  2LMJ A;  1PHT A;  2J06 A;  2JMA A;  5GJV B;  2ED1 A;  4JZ4 A;  2CT3 A;  1QLY A;  3REB B;  3U23 A;  4Z89 A;  5L23 A;  1UG1 A;  1T0J A;  4JPB W;  2ABL A;  1AZG B;  1ABO A;  1SHG A;  2EPD A;  2CSI A;  2EYX A;  2LJ0 A;  3H41 A;  2CRE A;  1ZBJ A;  1NM7 A;  1AWO A;  1M3A A;  2GBQ A;  2HDA A;  3I5R A;  1MV3 A;  2VWF A;  1W6X A;  1N5Z A;  3VS0 A;  1HSQ A;  2SEM A;  2C0O A;  3UF4 A;  4CC2 A;  2GNC A;  2KGT A;  1YCS B;  2GQI A;  3A98 A;  1WXU A;  1SHF A;  2L3P A;  4LNP A;  1LCK A;  1GCP A;  1MUZ A;  4JJD A;  1G2B A;  4X1V A;  2FPF A;  1GCQ A;  2KXD A;  1GBR A;  4Y92 A;  1RLQ C;  2FRY A;  1X69 A;  2PNI A;  4EIK A;  1OPL A;  2A08 A;  2RNA A;  1JXO A;  4RUG A;  4ORZ A;  2KRN A;  2BZY A;  4RTU A;  2G6F X;  1NLO C;  1H8K A;  1PRM C;  2K3B A;  3EHR A;  2F2X A;  2GTO A;  1T0H A;  4AFU C;  3VS2 A;  1UJY A;  4KRT A;  5IHI A;  2DL5 A;  3M0U A;  1GCQ C;  2E5K A;  1E6H A;  1IO6 A;  1M8M A;  2DE0 X;  2FEI A;  2J7I A;  2ESW A;  1ABQ A;  4LE9 A;  2FO0 A;  3C0C A;  3PE0 A;  3REA B;  1KIK A;  1QWE A;  2RQT A;  2LCS A;  4LN2 A;  5I22 A;  2LX7 A;  4RTT A;  4J9G A;  4K11 A;  2FG0 A;  1QKW A;  3NMZ C;  4QT7 A;  1PKS A;  2L3Q A;  4J9F A;  4JJB A;  1A0N B;  1NYF A;  1TUD A;  2LJ3 A;  3VRY A;  4DEX A;  1HD3 A;  1Z9Z A;  2D8H A;  2GGR A;  2KRS A;  1X27 A;  4HVU A;  2YT6 A;  2RQR A;  4OMQ A;  1GBQ A;  1UEC A;  2DBK A;  3CQT A;  5IXB A;  1SEM A;  4J9E A;  1ZUK A;  1AWW A;  1AOJ A;  1RI9 A;  2RQU A;  1XOV A;  2F2W A;  1RLP C;  2EYY A;  4WCI A;  3H0I A;  4HXJ A;  5IHK A;  4AFQ C;  2KRM A;  2BTT A;  1X43 A;  2IIM A;  2K79 A;  1NLP C;  3TVT A;  2EKH A;  1SRL A;  2O9V A;  1WIE A;  2DBM A;  1YWP A;  1UJ0 A;  2DL7 A;  1K0X A;  2KT8 A;  1JU5 C;  1ZLM A;  2H8H A;  1AVZ C;  2LNH B;  2A28 A;  2JS2 A;  3NHN A;  2AKL A;  1JXM A;  2DVJ A;  2K2M A;  2GTJ A;  2X3W D;  4HCK A;  1WLP B;  2W10 A;  1GRI A;  1NEB A;  2NWM A; 
#chains in the Genus database with same CATH topology
 4JRK A;  4XU1 A;  3SDZ A;  4C92 F;  3CC7 T;  1WHK A;  1VYT A;  2DEU A;  1NYG A;  1VQ5 A;  4C5G A;  1KHI A;  4IKF A;  2QA4 A;  3CEY A;  3CCU T;  2X4X A;  5LJ5 d;  3WVD B;  4OB1 B;  5GAO q;  4GBQ A;  1UHF A;  2HSE B;  2LVM A;  3CCM A;  3HP9 A;  3E9G A;  3VS5 A;  4PJN A;  3MEU A;  4PNO A;  2DMO A;  3FC3 A;  1AWX A;  4C0D B;  1PD0 A;  3T9N A;  1YWO A;  1VOM A;  3V7S A;  5GAM d;  4J9H A;  4RG8 A;  3L42 A;  3L2W A;  1LOJ A;  3L2Q A;  3O5Z A;  3GLX A;  1PRL C;  3OYY A;  4ZGE B;  3RMQ A;  5IH2 A;  4EMK C;  4C92 B;  3H0F A;  1LPL A;  4KUL A;  5LJ3 d;  2ED0 A;  3VS4 A;  1BI3 A;  2HAX A;  5FU6 B;  4J7F A;  3LWH A;  5I11 A;  4B9X A;  2AKK A;  3CCV A;  4HCB A;  2NYS A;  4M75 D;  4FSS A;  1RAI B;  4M78 F;  1D0Y A;  2FPE A;  5LJ5 h;  1QW1 A;  1YFN A;  2HZY A;  3FJ5 A;  4AG2 C;  4J6Y A;  3E9F A;  2HQE A;  5KYX B;  1KD1 C;  3RER A;  4OB0 B;  4F7U F;  1TWB A;  3A8M B;  4M75 E;  1M30 A;  1JBM A;  2DRM A;  2R58 A;  2MWO A;  4JLI A;  1K73 C;  1WA7 A;  3EH1 A;  2AK5 A;  4GLK A;  4JRP A;  2YRC A;  3QZ5 B;  1M2V A;  1ZSZ C;  2RHY A;  2X35 A;  4PJJ A;  1OU9 A;  1W1F A;  4E6R A;  2HQH A;  1OPK A;  2DXC A;  1I0C A;  5GMK m;  3JB9 H;  4GLM A;  2R5A A;  2Y4X A;  2QG9 B;  3GNG A;  3H0H A;  3S3O A;  2IG0 A;  5CKE A;  1C6V X;  4ZN1 A;  3PVQ A;  5LJ3 h;  3PIO A;  4R0K A;  5AT1 B;  3CBM A;  3J81 E;  3HL8 A;  1SSH A;  4M78 B;  2C0T A;  2QI2 A;  3MEW A;  2K7A A;  2L8D A;  3QXE B;  1E7O A;  2C06 A;  2HD0 A;  2YWW A;  2NLU A;  1IRE B;  2RMO A;  3CCL A;  2ROL A;  4RKU E;  4XTX A;  1FMK A;  2QDL A;  3PMT A;  4E7S A;  2F1L A;  1VQ6 A;  3GOX A;  1U8R A;  4VUB A;  4F17 A;  1NG2 A;  1GXI E;  5GAN f;  1OV3 A;  3G1J A;  4UC4 A;  1UHC A;  4CI0 C;  1X01 A;  4DBQ A;  1Y0M A;  1T3L A;  2MOX A;  2RK1 A;  4JUV A;  4AFZ C;  1Q81 C;  1ZSZ B;  2OTL Q;  1DJ7 B;  1Y96 B;  3C4S A;  5IHN A;  3CXC A;  1AHJ B;  5GAN 4;  4LUD A;  2YRD A;  2BUD A;  3A8O B;  1QP2 A;  2CP2 A;  2MPX C;  5C6S A;  4AG1 C;  2R5M A;  2D1X A;  1U3O A;  1D09 B;  1YHQ T;  1K8A R;  3I55 Q;  8AT1 B;  1YI2 Q;  1YBY A;  3FDR A;  2CKK A;  1N6A A;  2FRW A;  3SHW A;  3CXC S;  4BE2 A;  4M7A D;  5FRN A;  1WZO A;  5GAO l;  3KUF A;  2DO3 A;  4LXC A;  4M78 G;  4A4K A;  1RUW A;  2IPO B;  4BAC A;  3SB2 A;  2VGN A;  4M7D G;  3LH5 A;  2EGA A;  2KNB B;  1VQ9 Q;  4JRQ A;  1SG5 A;  2KAF A;  5GAN e;  2BE7 D;  1BU1 A;  1GFC A;  4O5V A;  2NUT A;  4F7U G;  5J3B A;  3EG2 A;  2CSQ A;  4M7A E;  1M90 C;  4RCB A;  4J9B A;  2RF0 A;  4A4E A;  3M0T A;  4ZN3 A;  3X20 B;  3HRU A;  2RHX A;  2XK0 A;  2DIL A;  4P5N A;  1HYO A;  3QBY A;  3OYG A;  4OMP A;  1KQS S;  4OGC A;  3QHS A;  1KC8 C;  2LQK A;  3NFC A;  1MV0 B;  4LUE A;  2OTL T;  4IUV A;  2LZ6 B;  4XK8 E;  5LJ5 g;  1QCO A;  4CC4 B;  1KD1 U;  2EGE A;  2DNU A;  4RTX A;  4PKC C;  3EGU A;  3CBP A;  4KGX B;  3NTH A;  1K73 U;  3JCM e;  2CH4 A;  1G8X A;  1NPP A;  4C8Q D;  3O8V A;  1ZA1 B;  2JMC A;  2VV5 A;  3I56 A;  2O31 A;  5GMK e;  1CKA A;  1XNI A;  1YI2 T;  1BB9 A;  3EG9 A;  2E4H A;  3JB9 D;  5GAM g;  3RNJ A;  2EYW A;  3BY7 A;  1M3B A;  1KQ2 A;  1JRI A;  2BZ8 A;  2CGH A;  2LMJ A;  3QG1 A;  3PT9 A;  4MZM A;  3CCQ Q;  2ED1 A;  1QLY A;  5DY9 A;  4C8Q E;  3VU3 C;  3LX7 A;  1AZG B;  3X28 B;  1SHG A;  2EPD A;  4FYW B;  2CSI A;  2EYX A;  2RK2 A;  3KBG A;  2CRE A;  1UGQ B;  5LJ3 g;  1VQ9 T;  1NM7 A;  1MV3 A;  3QII A;  4E2F B;  2DTO A;  3M56 A;  2GNC A;  2GQI A;  2L3P A;  2AT1 B;  2QAZ A;  1IGQ A;  1XQH A;  1G2B A;  4X1V A;  2FPF A;  1N8R R;  1QVG P;  4NL2 A;  2WAC A;  1TS9 A;  3CBO A;  1RLQ C;  2FRY A;  2PNI A;  2A08 A;  5GAO n;  3CCR A;  4M7D E;  4RUG A;  4N0A C;  4RTU A;  2G6F X;  1B7T A;  2FZK B;  2DJZ A;  2RHI A;  3E1S A;  2L5Q A;  1NBE B;  2K3B A;  3EHR A;  4M7D A;  3MPU B;  2F2X A;  4QW2 A;  1Q81 U;  6AT1 B;  2DZC A;  1MGQ A;  2OTJ Q;  5IHI A;  1EX4 A;  2DL5 A;  4F7U A;  1OX8 A;  1UGP B;  2GCX A;  3CMA A;  3REA B;  4IUT A;  1KIK A;  1BKB A;  2E5Q A;  1YIT T;  4J6W A;  3TQ7 P;  4LN2 A;  2I2L A;  3G4S Q;  3CCQ T;  4PJO D;  3M9Q A;  4RTT A;  2PUK B;  5AYF A;  1ZBX A;  1R0B G;  1Y96 A;  2EKO A;  2MI6 A;  3EFS A;  4J9F A;  1TUD A;  4PLL A;  5GAN 3;  1SSF A;  4MML A;  1NZ9 A;  3VRY A;  3RR6 A;  1N9S A;  3H6Z A;  4OMQ A;  4KBM B;  2DBK A;  3X24 B;  4PJO E;  2EAY A;  4J9E A;  2CP3 A;  5CK9 A;  1IB8 A;  2EYY A;  2HMA A;  4HKE A;  2K5L A;  1M90 U;  2BTT A;  5C0M A;  2XDP A;  2F5T X;  3LWI A;  4YTL A;  1NLP C;  1KC8 U;  2EKH A;  1VQP A;  1SRL A;  5GAO p;  3SWN A;  2HBP A;  3OYI A;  2YLC A;  2OTJ T;  3M55 A;  1TTH B;  3RKX A;  2E3I A;  2DYI A;  4E7K A;  2DL7 A;  1ZLM A;  4QQD A;  3DKM A;  2H3J A;  1PD1 A;  4FM4 B;  5HK0 A;  2P4T A;  1VQ7 A;  3G4S T;  3HFN A;  2M16 A;  1QQJ A;  2X3W D;  3FJP A;  1MMA A;  4IUQ A;  4M75 F;  2NWM A;  1ZUY A;  2YDL A;  4XU3 A;  1AWJ A;  2NUP A;  4EPC A;  3EG1 A;  1JEG A;  3CCS Q;  4HCZ A;  3CCJ Q;  3FB9 A;  4FT4 A;  3G71 Q;  3RMS A;  1VQL Q;  4MZP A;  3NGP A;  1KQS P;  2VB6 A;  2DET A;  1YJ9 A;  1JJ2 A;  1E6G A;  2PTK A;  2HKN A;  2QEX Q;  2JUF A;  3CD6 A;  4IUU A;  3BDL A;  3V8J A;  2EWN A;  2J6F A;  2J05 A;  4A4H A;  2EYQ A;  1OU8 A;  2JTF A;  2LQN A;  3THK A;  5IXF A;  2DEQ A;  2ENM A;  3JCM W;  2HSP A;  3S6W A;  1P92 A;  3HTR A;  4NOY A;  2DL4 A;  2QK0 A;  9ATC B;  5DLO A;  4HVV A;  4JDS A;  3PTA A;  1JJ2 S;  1QVF P;  4JZ3 A;  4M75 B;  2JM9 A;  1M2V B;  1MMN A;  1S72 A;  3OS0 A;  4JLG A;  2M0Y A;  4PJL A;  1BI1 A;  2DL3 A;  1SPK A;  2KY9 A;  2M02 A;  5ECA A;  3EGD A;  2L2P A;  1H3H A;  3VS1 A;  2VUB A;  3P8D A;  2E41 A;  3BW1 A;  3V8L A;  2MIO A;  4LDY A;  1NEG A;  5GAN 2;  4M77 D;  2P84 A;  3OYL A;  2I0N A;  2DF6 A;  1IHW A;  3CCS T;  3CCE T;  4HVW A;  1PSE A;  5KCO A;  3CCJ T;  1X2Q A;  2PQW A;  5D6W A;  1X75 C;  2GFA A;  1VQO A;  2V1R A;  3G71 T;  2JM8 A;  2W0Z A;  5KCH A;  4ZNX A;  3JRZ A;  1W70 A;  4E47 A;  2FZC B;  3JCM V;  3OS5 A;  2QEX T;  2DD4 A;  3CME Q;  2DAQ A;  1K1Z A;  4RTV A;  2COY A;  3BDU A;  5HK3 A;  3MEV A;  3F70 A;  2ROT A;  1YJN Q;  1AEY A;  4R55 A;  5FRM A;  2VGM A;  3CPF A;  2QQA A;  1Q7Y C;  5CR2 A;  2DTH A;  3JCM d;  2XKO C;  2MAM A;  1VQ5 Q;  5EC7 A;  4X9C A;  1I07 A;  4M75 G;  2FHD A;  4DA4 A;  2CYZ B;  2CP6 A;  2M9U A;  3QDF A;  1G83 A;  2KXC A;  2RD1 A;  4DOV A;  4RMO A;  1XTD A;  2DLP A;  3UAT A;  4QVZ A;  2YLB A;  1SF9 A;  3CCM Q;  3M58 A;  4KUD K;  4OMM A;  5A0G A;  5FU6 C;  2LCC A;  3M5A A;  2A0F B;  5GAN h;  2DZ9 A;  5KYY A;  4MDW A;  5LJ5 j;  2VXF A;  2O4X A;  2JW4 A;  1YN8 A;  3OYD A;  1OZ2 A;  4AFS C;  2QDY B;  2MCN A;  3MHX A;  4FCY A;  1K0S A;  2YUN A;  4J83 A;  5D7U A;  1GL5 A;  3GP8 A;  2F5K A;  2JOY A;  2RJC A;  2B86 A;  3PIP A;  2NUT B;  1T3S A;  4RTW A;  1M1F A;  5GAM j;  1KK7 A;  1SRM A;  3CME T;  2O9S A;  3JCM h;  2NUZ A;  1D3B A;  2MMP A;  1WHJ A;  4C8Q F;  1J3T A;  3CCV Q;  1YJN T;  5GMK h;  1RI0 A;  1M1K R;  1O75 A;  5LJ3 j;  1VQ5 T;  3MJX A;  4HA8 A;  1QVG A;  3H9N A;  4MMK A;  2PZ1 A;  4FL6 A;  4FYV B;  4DBH A;  4PFP A;  1I1J A;  4M78 C;  1G3W A;  2O2O A;  3C95 A;  1Q82 R;  2J6K A;  4OP0 A;  4RTZ A;  2DRK A;  3CC4 A;  4M7D F;  3EG9 B;  4E7L A;  2KBT A;  2L0A A;  4RCC A;  3M0Q A;  1VQK Q;  5CKF A;  3ASK A;  4C0F A;  4CC7 A;  1QVG S;  5HCK A;  4ZGJ B;  2HCK A;  1ZSG A;  2RI3 A;  4LDX A;  1OI1 A;  5I2S A;  3LGF A;  3RES A;  4M75 A;  3OS2 A;  2EJG A;  3MCA B;  4CC3 A;  2DXU A;  3GPL A;  1UFF A;  4XTV A;  4NL3 A;  2O88 A;  4Z02 A;  1VYU A;  4AMC A;  1YP5 A;  3INZ A;  1U1S A;  4JRI A;  4M7A G;  2YUP A;  3CCV T;  3ZL7 C;  1AD5 A;  3OA6 A;  2DTI A;  4B6M A;  2LQ8 A;  2E64 A;  3CCL Q;  3E19 A;  3FLG A;  1JJ2 P;  2D8J A;  1ZA2 B;  1MNE A;  1VQ6 Q;  1Y71 A;  1WXT A;  4M7D B;  2X3X D;  5I2M A;  1Q7Y U;  2RM4 A;  4PJO F;  3WVE B;  2JMA A;  4JZ4 A;  5L23 A;  1UG1 A;  4BDZ A;  4J8O A;  1ABO A;  4F7U B;  2X51 A;  2PVD B;  3H41 A;  2LJ0 A;  1ZBJ A;  1VQM Q;  1YHQ A;  3SWN C;  1W6X A;  3VS0 A;  1HSQ A;  3OSS C;  1VQK T;  4CC2 A;  1R8O B;  2O01 E;  5D6X A;  3OW2 A;  1K9M R;  1WXU A;  1SHF A;  2BE9 B;  4WF2 A;  2KDS A;  2Y90 A;  1MUZ A;  1BCM A;  4ELY C;  4BY6 B;  4IUR A;  3OYK A;  4Y92 A;  4TVR A;  1TXQ A;  3FIF A;  4C8Q G;  4EIK A;  1OPL A;  2CP0 A;  2RNA A;  1JXO A;  3BE3 A;  4ORZ A;  1NLO C;  1H8K A;  5FU7 B;  3QJ6 A;  3OB9 A;  3DB3 A;  3OW2 S;  4E7I A;  1BIA A;  3EH2 A;  3VS2 A;  4CRI A;  1UJY A;  2WSC E;  1GCQ C;  1IO6 A;  3RIR A;  1LNX A;  4WTO B;  4C5H A;  2X4J A;  4OB3 B;  3VUZ A;  3C0C A;  4HT9 A;  3PE0 A;  1VQ6 T;  3UDC A;  2EQM A;  1KQS A;  3FRN A;  2QAS A;  3JCM g;  2LCS A;  3JB9 J;  2OX7 A;  3SWN B;  1LJO A;  1VQ4 A;  5L8R E;  4K11 A;  1QKW A;  3NMZ C;  4QT7 A;  1PKS A;  2L3Q A;  4JJB A;  3OYE A;  2LJ3 A;  4D6W A;  2D9T A;  2VAS A;  1VQM T;  3ZBD A;  2XDD A;  3QJY A;  4M7A A;  1X27 A;  1SKU B;  2YT6 A;  3L1A A;  5D6Y A;  1I5L A;  3TU4 K;  4C92 D;  1YIJ A;  3JCM Q;  3OS1 A;  1TUG B;  1YI2 A;  1NJI R;  1QVF A;  1D1A A;  3I56 Q;  2VC8 A;  1RI9 A;  1XOV A;  3X26 B;  2P0Q A;  3QKJ A;  3JB9 I;  4JS4 A;  3MEA A;  1R77 A;  2NUP B;  2RI2 A;  2ZAE A;  2ZPG B;  4LDW A;  1VQ9 A;  3I55 T;  2QQB A;  2KI7 A;  2V8J A;  2CZ1 B;  1PCX A;  2QGF B;  4NS5 A;  1QVF S;  4PJO G;  3G6E Q;  1ZHI A;  3UWN A;  4X9D A;  4FYY B;  4FT2 A;  1Y7X A;  4LDU A;  5CVI A;  1JU5 C;  5GAM f;  2M0O A;  2JS2 A;  2ZPE B;  3CC2 A;  4C8Q A;  4HCK A;  3OY9 A;  1NEB A;  3CCR Q;  4FYX B;  2LP5 A;  5J39 A;  1K8A C;  4XTY A;  4HCC A;  2ECZ A;  2ATC B;  4R56 A;  3QWY A;  2JS0 A;  1JB0 E;  5KYU A;  3BFM A;  3I5S A;  4JJN K;  4II1 A;  2COZ A;  2KYB A;  3EGD B;  4M78 D;  1Q86 R;  1M1G A;  1M4Z A;  2M51 A;  2LNV A;  2COW A;  3CMA Q;  1YIT A;  1FXX A;  1CKB A;  4BB7 A;  3VS6 A;  3CCQ A;  1EZZ B;  1EIF A;  1UGV A;  2DPP B;  2KE9 A;  4ME7 A;  3EFR A;  2LX9 A;  2CP5 A;  3J7A F;  1JO8 A;  3D7S B;  1PWT A;  4D8K A;  2DL8 A;  3R6O A;  2CT4 A;  4FW2 A;  1H3Z A;  2HL5 C;  8ATC B;  1QCF A;  1OOT A;  5GAM e;  3G6E T;  1UE9 A;  2KYM A;  1KJW A;  1WXB A;  1TH7 A;  3MET A;  2OI3 A;  2E3H A;  3KFV A;  1KQ1 A;  4ATO A;  1WJQ A;  3LLR A;  4ANJ A;  1D1C A;  3X25 B;  3L2U A;  1PKT A;  5GJW B;  2LCL A;  2GF7 A;  2A36 A;  1N9R A;  1VQ8 A;  4A4F A;  3CCR T;  4C5I A;  2GFU A;  2IVW A;  1FMV A;  2OTJ A;  4LD9 K;  4OML A;  1VQP Q;  4PFZ A;  2CUB A;  2LT4 A;  4Q5W A;  1UGR B;  1BIB A;  4ZTJ A;  4PJO A;  3VRZ A;  1UUE A;  2A37 A;  1KFZ A;  4N4H A;  5GAO m;  3CMA T;  4DQ2 A;  1V1C A;  4BDY A;  5KYY B;  3EAE A;  1I5O B;  3LW5 E;  3G4S A;  1U1T A;  2EYZ A;  4BI8 B;  2O4X B;  3GBQ A;  1NPR A;  2MWP A;  1VQ7 Q;  4N4G A;  1H92 A;  1C0M A;  4F16 A;  1Z9Q A;  4HT8 A;  3OW2 P;  3AHU A;  3EGX A;  2E6N A;  1QWF A;  5GMK i;  1VQN A;  2HKQ B;  1TOV A;  2XHC A;  5GAN 5;  4C0G A;  3VJP A;  1UGS B;  2CZ6 B;  2KMT A;  1N8R C;  2PU9 B;  3ER0 A;  1WQW A;  4M77 G;  4M75 C;  2KR3 A;  4LD6 A;  4BUG A;  3M4Y A;  1HJD A;  1D3B B;  5IT9 E;  2LQW A;  3M0S A;  1JQQ A;  3HPW A;  1YJ9 Q;  2LRQ A;  3NTI A;  1TG0 A;  1RAE B;  5CAI A;  1G3T A;  1ACM B;  2FYK A;  2FPD A;  2DER A;  2DFU A;  3JV3 A;  2WSE E;  1K9A A;  1X6G A;  1AT1 B;  2D0Q B;  1X2K A;  3OMC A;  4O6J A;  4MDX A;  1WHH A;  1RAF B;  2BIV A;  3ULR B;  1WHG A;  1C1A A;  3M0R A;  5A0D A;  3OBY A;  4OB2 B;  1W2B P;  1K8A U;  2FB7 A;  4JJC A;  4JS5 A;  2RJD A;  1FYN A;  2ZZD A;  1R0C B;  4J9D A;  3QSU A;  1UB4 A;  4L5G A;  2CH4 W;  2P0P A;  1Y57 A;  1HK9 A;  4OMN A;  3R6N A;  4J9C A;  2DJQ A;  3CCE A;  2JVV A;  2ZPH B;  1WYX A;  2P4R A;  1F1B B;  2DXT A;  1WX6 A;  4OMF B;  4E7Z A;  2L3R A;  1G3S A;  1BI2 A;  3DB4 A;  2L3S A;  1YJ9 T;  5FWB A;  1VA7 A;  1IXD A;  7AT1 B;  2XU8 A;  3IQL A;  2FVU A;  1M3C A;  5GAN d;  4BD3 A;  5J26 A;  2YRV A;  2HEQ A;  3V7R A;  1VQL T;  3E2U A;  3QYH B;  1Y07 A;  5GMK l;  1YJW A;  3JCM P;  2RQV A;  2JZ2 A;  2ZPB B;  2V8I A;  3NPF A;  2OAW A;  4M77 E;  1MHN A;  2YUQ A;  1TSF A;  2H3E B;  3PMI A;  3OYN A;  2SRC A;  1O9S A;  4M77 A;  2RI5 A;  3MO8 A;  1WI7 A;  2XMF A;  3CC7 A;  2DX1 A;  1VIE A;  3EFO A;  4B9W A;  2RHZ A;  3UT1 A;  3OYB A;  2VVK A;  4PL6 A;  1ARK A;  2XDB A;  2V8K A;  5GMK j;  3CCU A;  5GAO r;  4M7A C;  1PNJ A;  1TUC A;  2QA4 Q;  4M7A F;  4KH1 B;  1QCN A;  2B8A A;  3PGG A;  2K3Y A;  4GY5 A;  1KD1 R;  4KGV B;  5GAN 8;  5CKB A;  1K76 A;  2JJ9 A;  4EMH A;  3GF5 A;  1PHT A;  3OYC A;  1XJW B;  1N8R U;  4V2S A;  1K73 R;  3JCM c;  3RKY A;  4J5Y A;  5CQY A;  3HFO A;  2LTO A;  3CPW P;  1AWO A;  1M3A A;  2GBQ A;  2FZG B;  2VWF A;  1YJN A;  1N5Z A;  5KE2 A;  4QKU A;  2QGG A;  1G3Y A;  2SEM A;  3URG A;  2C0O A;  1YCS B;  4LNP A;  4E7H A;  1LCK A;  4PLI A;  1GCP A;  4DOW A;  2KXD A;  1GBR A;  1IGU A;  3KXT A;  4KT0 E;  1X69 A;  1M8V A;  4MZT A;  2E12 A;  3VYH B;  4C8Q C;  2XG8 D;  2BZY A;  2KRN A;  2RHU A;  2ZGW A;  2EJF A;  5EG2 A;  4M7A B;  1OZ3 A;  1D1B A;  1WHM A;  3A8G B;  2Y4Y A;  2GTO A;  1B34 A;  4AFU C;  3JB9 F;  5GAN 6;  3CC4 Q;  3LH0 A;  2E5K A;  1WJS A;  2QA4 T;  1I8F A;  1M8M A;  2DE0 X;  2FEI A;  2ZPI B;  1ABQ A;  2MK5 A;  2EQJ A;  4LE9 A;  2XID A;  2JNG A;  1W4S A;  2QQR A;  1QWE A;  5KH6 A;  4KUI A;  2RQT A;  3UPU A;  4KGZ B;  4M7D C;  3CCM T;  4F04 B;  1Q81 R;  4J9G A;  2FG0 A;  1NYF A;  2WSF E;  3OYM A;  1HD3 A;  2D8H A;  2QYZ A;  2KRS A;  4IUP A;  4HVU A;  1UEC A;  5IXB A;  2E6Z A;  4C8Q B;  4PFO A;  1ZUK A;  1AOJ A;  1BCO A;  3H0I A;  4HXJ A;  4BY6 C;  4AFQ C;  3QZ9 B;  2KRM A;  3ZFJ A;  2DD5 A;  5KYU B;  1WPY A;  3HHT B;  3A5Z B;  2BKD N;  2D6F A;  3H8Z A;  2DIG A;  2K79 A;  1RAC B;  5FU7 C;  1PG5 B;  3ZEH A;  3TVT A;  3TRE A;  5CCA A;  1RAD B;  4Y28 E;  5GAM h;  1WIE A;  1VQK A;  2DBM A;  3V7C A;  2AIR B;  2A7Y A;  3CC4 T;  1YHQ Q;  4PJO C;  3QUI A;  1UJ0 A;  4EMK B;  4J7I A;  1M90 R;  2YHT A;  4J6X A;  5CKD A;  3N5B B;  1K0X A;  3RUX A;  3Q1J A;  4BI4 A;  2LNH B;  2A28 A;  3NHN A;  2PUO B;  3C94 A;  2AKL A;  1KC8 R;  2DVJ A;  2K2M A;  2GTJ A;  2R57 A;  4C92 G;  1WLP B;  1GRI A;  3PVL A;  3QPH A;  5KE3 A;  2YUO A;  3UA6 A;  1B3Q A;  1OUL A;  4D8D A;  2QQS A;  4OVA A;  2LJ1 A;  3JSC A;  3G7Z A;  3SD4 A;  3DLM A;  2E10 A;  1S1N A;  5IN1 A;  1GFD A;  1M1K C;  2HL3 A;  3SFM A;  1IRX A;  5GAN g;  1M27 C;  3EG3 A;  2RQW A;  2KT1 A;  1KSW A;  1X6O A;  5FRO A;  2BZX A;  2EVR A;  2L89 A;  2DM1 A;  2G3R A;  1OX9 A;  4C0Z A;  1Q82 C;  3PFS A;  3JB9 G;  3MP8 A;  1I4K 1;  2V1Q A;  1UEB A;  4ESR A;  5I21 A;  4DBF A;  3JCM J;  4PJO B;  1HXD A;  2KK4 A;  1VQ4 Q;  2QTV A;  1VQM A;  5FWC A;  3CCL T;  1RAH B;  5FW9 A;  5KYW B;  2K5F A;  2RJE A;  4RTY A;  5GAN 7;  3VS7 A;  2AHJ B;  1W2B A;  1N27 A;  2HQX A;  3EG0 A;  2OTL A;  2KRO A;  1YIJ Q;  4M4Z A;  4Z8A A;  1I81 A;  3JCM f;  1WGS A;  2EQI A;  1VYV A;  3EGX B;  4QQG A;  3MP1 A;  1UDL A;  3TSW A;  4OGE A;  4BE1 A;  1V76 A;  1RAA B;  4Y91 A;  3NTK A;  4OMO A;  3S3M A;  3I55 A;  1RAG B;  1WDX A;  4EDU A;  4A63 B;  1QP3 A;  4IIM A;  5DM7 R;  2RB6 A;  1W2B S;  2K2V A;  4X34 A;  2RO0 A;  1UTI A;  2RH2 A;  1WNL A;  1OEB A;  2HBW A;  5LJ5 f;  2EGC A;  2MYS A;  3QYG B;  2LT1 A;  4C92 E;  1M9S A;  2CUD A;  3TCJ A;  5LL6 S;  3CC2 Q;  4C92 A;  1VQ4 T;  3OBW A;  2RN8 A;  2EQU A;  2VKN A;  3EHQ A;  3OYH A;  1K9M C;  3J80 E;  3M54 A;  4XQ3 A;  1BK2 A;  1PSF A;  2E70 A;  2MF2 A;  2DKG A;  1B07 A;  3AT1 B;  1AZE A;  2K6D A;  1MMD A;  1BBZ A;  2DK3 A;  1YIJ T;  3A1P A;  4ZTF A;  2F69 A;  1K4U S;  2D0N A;  2ZPF B;  4M77 C;  4M77 F;  1YIT Q;  5LJ3 f;  5KYX A;  2P0K A;  3M0P A;  1WFW A;  3TSZ A;  3TEE A;  1PC0 A;  1QVP A;  1KG1 A;  2OAU A;  4XTW A;  4XTU A;  5M9O A;  4J9I A;  2VYT A;  5CIU A;  1QMC A;  3JCM b;  2M1H A;  4XTZ A;  3OYJ A;  2AZV A;  3G6E A;  5LJ5 e;  3I56 T;  2JTM A;  4M7D D;  2DYB A;  2CDT A;  1WQ7 A;  3VYG A;  3RKW A;  3M53 A;  1M1K U;  4L59 A;  4EMK A;  1M5Q 1;  3SEM A;  2EIF A;  1FMW A;  4XU2 A;  4M78 E;  3UA7 A;  2DIQ A;  4AT1 B;  3CC2 T;  3JCM X;  3CPW A;  4M78 A;  2ZCF B;  1VQ8 Q;  1VUB A;  4A54 A;  1Q82 U;  2K3X A;  4QVC A;  1NJI C;  4F7U E;  4M77 B;  1WJR A;  4DEY A;  1X6B A;  2JTE A;  2RPN A;  3GIB A;  5LJ3 e;  3EFO B;  2EW3 A;  2KSS A;  5FLX E;  3HRS A;  2KEA A;  3OSV A;  3I9Q A;  1CSK A;  3CPW S;  3VS3 A;  3RBB B;  3QO3 A;  2JT4 A;  3L2R A;  4ELZ C;  2C0I A;  1ZSZ A;  4F14 A;  4A4G A;  1QKX A;  2AZS A;  2LDM A;  4Z88 A;  3OQ5 A;  5A2Q E;  3M57 A;  1U06 A;  1ZUU A;  4PK4 A;  1VQN Q;  5KYW A;  4KH0 B;  5A0L A;  5HKC A;  3FEO A;  5KYN A;  2DA9 A;  2EBP A;  1ZX6 A;  3LGL A;  4IIO A;  2F2V A;  1YNZ A;  3RDV A;  3I35 A;  2QQ9 A;  4PJM A;  3VKI A;  1G5V A;  2YSQ A;  2X4W A;  2DXB A;  3DLL A;  2OJ2 A;  1VQ8 T;  3M4G A;  4FSX A;  3ME9 A;  2K9G A;  2VXE A;  2J6O A;  2X4Y A;  1Q86 C;  2E1H A;  3QWX X;  3V8K A;  3M59 A;  2KVQ G;  1D0Z A;  1U5S A;  2JXB A;  2YXY A;  1K9M U;  5CQX A;  1EFN A;  3CXC P;  2J06 A;  2RA2 A;  5GJV B;  3REB B;  4DBR A;  2CT3 A;  3A8L B;  1B34 B;  3CD6 Q;  3U23 A;  4Z89 A;  1T0J A;  2XIC A;  2ABL A;  4JPB W;  1BYM A;  2EQK A;  1LVK A;  2EFI A;  2QTX A;  2HDA A;  1VQP T;  3I5R A;  5CO7 A;  1OQK A;  2E65 A;  4FW1 A;  3GNF B;  1VIF A;  3UF4 A;  2KGT A;  4A53 A;  2GQV A;  3C12 A;  3A98 A;  1Q7Y R;  3HSB A;  2KQW A;  3VV0 A;  1VQN T;  5IAY A;  4JJD A;  3OYA A;  3CCE Q;  1GCQ A;  1BI0 A;  3WXM B;  1S72 Q;  4FIB A;  3L2Z A;  4N4I A;  2EJ9 A;  2XD0 A;  1VQ7 T;  1MMG A;  1D0X A;  2QXF A;  1PRM C;  4E7J A;  4C5E A;  1YCY A;  2A3L A;  3CCS A;  2K4Y A;  4BI3 A;  3CCJ A;  1T0H A;  4XAX B;  3G71 A;  4KRT A;  1VQL A;  3M0U A;  2JN0 A;  1H64 1;  1E6H A;  1OYX A;  2CZ0 B;  2J7I A;  2ESW A;  1VQO Q;  2FO0 A;  5HY6 A;  2X9H A;  2QEX A;  3JAM E;  1YJW Q;  3A8H B;  3OYF A;  1V29 B;  4EMG A;  1KHC A;  1RAB B;  5I22 A;  2XI9 A;  1NJI U;  4XU0 A;  2LX7 A;  3LYI A;  5GAN j;  1ZQ1 A;  4FU6 A;  4QVD A;  3CD6 T;  3PNW C;  2CZ7 B;  3MKD A;  1WHL A;  1A0N B;  2K5I A;  3HKS A;  3CC7 Q;  4DEX A;  1Z9Z A;  2GGR A;  2HNI A;  4ZGD B;  1FX7 A;  2Z0W A;  3HRT A;  2RQR A;  1GBQ A;  4BE0 A;  3CQT A;  2CP7 A;  3CCU Q;  2V26 A;  3QDR B;  1SEM A;  4OF1 A;  2LC4 A;  1AWW A;  2RQU A;  3P8B B;  2F2W A;  1RLP C;  3VUB A;  3MP6 A;  4WCI A;  1S72 T;  2FL7 A;  2PVG B;  5IHK A;  2RJF A;  1M2O A;  1RL2 A;  3S3N A;  1X43 A;  1FWZ A;  2IIM A;  3P8H A;  4QQ6 A;  3L2V A;  1Q95 G;  2CS7 A;  2O9V A;  2PVO B;  5DLQ E;  1NE8 A;  1YWP A;  2K57 A;  3OMG A;  4RG2 A;  1VQO T;  4C0D C;  2KT8 A;  2H8H A;  1AVZ C;  5CKH A;  4LDV A;  1PM3 A;  1YJW T;  1TU0 B;  3CME A;  1JXM A;  1Q86 U;  4N0A A;  1MND A;  1IZ6 A;  2DVE A;  2W10 A;  4L6V 5;  1IHV A;  4C92 C; 
#chains in the Genus database with same CATH homology
 3PVL A;  1ZUY A;  2YDL A;  2LP5 A;  2YUO A;  3UA6 A;  1B3Q A;  4D8D A;  2LJ1 A;  2ECZ A;  1VYT A;  1S1N A;  1AWJ A;  1GFD A;  1NYG A;  3QWY A;  2JS0 A;  3EG1 A;  1JEG A;  3I5S A;  2KYB A;  1M27 C;  3EG3 A;  2RQW A;  2KT1 A;  2M51 A;  1KSW A;  3NGP A;  2BZX A;  1E6G A;  2EVR A;  2PTK A;  2DM1 A;  1CKB A;  1UHF A;  4GBQ A;  3VS6 A;  1UGV A;  2V1Q A;  2KE9 A;  3VS5 A;  4ESR A;  2DMO A;  1JO8 A;  2J6F A;  1PWT A;  2J05 A;  4D8K A;  1AWX A;  2LQN A;  2DL8 A;  3THK A;  5IXF A;  2CT4 A;  5FWC A;  2ENM A;  5FW9 A;  1YWO A;  2HSP A;  1QCF A;  4J9H A;  1OOT A;  2DL4 A;  1UE9 A;  4RTY A;  2KYM A;  3O5Z A;  1KJW A;  1PRL C;  1WXB A;  4HVV A;  3VS7 A;  2OI3 A;  4JZ3 A;  3KFV A;  3EG0 A;  2KRO A;  5IH2 A;  2JM9 A;  3H0F A;  4M4Z A;  4Z8A A;  2M0Y A;  2EQI A;  1VYV A;  2DL3 A;  1SPK A;  1PKT A;  2ED0 A;  5ECA A;  1UDL A;  3TSW A;  3VS4 A;  5GJW B;  2L2P A;  2A36 A;  1H3H A;  3VS1 A;  5I11 A;  4OMO A;  2AKK A;  2MIO A;  1WDX A;  1NEG A;  4A63 B;  4FSS A;  4IIM A;  2FPE A;  2I0N A;  3FJ5 A;  2DF6 A;  4OML A;  4AG2 C;  2CUB A;  4HVW A;  1UTI A;  1X2Q A;  3VRZ A;  1UUE A;  2V1R A;  2A37 A;  1OEB A;  1KFZ A;  2JM8 A;  2W0Z A;  2HBW A;  4ZNX A;  2EGC A;  1W70 A;  1V1C A;  1M30 A;  2DRM A;  1WA7 A;  2AK5 A;  2CUD A;  2EYZ A;  3GBQ A;  1H92 A;  1K1Z A;  4RTV A;  4F16 A;  1Z9Q A;  2RN8 A;  1W1F A;  2ROT A;  1AEY A;  4E6R A;  1OPK A;  2VKN A;  3EHQ A;  1QWF A;  1I0C A;  4GLM A;  3H0H A;  1BK2 A;  1B07 A;  3PVQ A;  5EC7 A;  1AZE A;  2K6D A;  4R0K A;  1I07 A;  1BBZ A;  2KR3 A;  1SSH A;  1HJD A;  1K4U S;  2D0N A;  2C0T A;  1G83 A;  2KXC A;  2LQW A;  3M0S A;  1JQQ A;  2K7A A;  2DLP A;  3UAT A;  1TG0 A;  3M0P A;  1E7O A;  1WFW A;  3TSZ A;  4OMM A;  2FPD A;  3JV3 A;  4J9I A;  1K9A A;  1X6G A;  2RMO A;  2ROL A;  1X2K A;  1FMK A;  2QDL A;  2AZV A;  3ULR B;  2JW4 A;  1YN8 A;  4F17 A;  4AFS C;  3M0R A;  2DYB A;  2CDT A;  1NG2 A;  2MCN A;  1OV3 A;  1UHC A;  1K0S A;  2YUN A;  1GL5 A;  1Y0M A;  1T3L A;  2MOX A;  4AFZ C;  4JJC A;  3SEM A;  5IHN A;  1FYN A;  2B86 A;  4LUD A;  4J9D A;  1T3S A;  4RTW A;  3UA7 A;  1SRM A;  2CH4 W;  2O9S A;  4AG1 C;  2D1X A;  1U3O A;  2NUZ A;  1J3T A;  1Y57 A;  4OMN A;  3R6N A;  4J9C A;  2DJQ A;  4DEY A;  1X6B A;  1WYX A;  2P4R A;  2JTE A;  2FRW A;  1WX6 A;  3SHW A;  2RPN A;  2EW3 A;  2PZ1 A;  2L3S A;  1RUW A;  1I1J A;  2KEA A;  2O2O A;  3I9Q A;  1CSK A;  5FWB A;  1VA7 A;  3VS3 A;  2J6K A;  3LH5 A;  3RBB B;  2EGA A;  2KNB B;  4RTZ A;  2JT4 A;  2DRK A;  2C0I A;  3IQL A;  4F14 A;  1M3C A;  1QKX A;  2AZS A;  2KBT A;  2L0A A;  1BU1 A;  1GFC A;  4Z88 A;  3M0Q A;  1U06 A;  3EG2 A;  2CSQ A;  1ZUU A;  2HEQ A;  4J9B A;  4CC7 A;  2RF0 A;  3M0T A;  2RQV A;  5HCK A;  2DIL A;  2HCK A;  1ZSG A;  3NPF A;  2OAW A;  4OMP A;  2YUQ A;  2DA9 A;  2EBP A;  1ZX6 A;  2SRC A;  1MV0 B;  4CC3 A;  4LUE A;  2LZ6 B;  2F2V A;  4IIO A;  1YNZ A;  1UFF A;  3I35 A;  1WI7 A;  2XMF A;  2DX1 A;  2O88 A;  4CC4 B;  2EGE A;  1VYU A;  2DNU A;  4RTX A;  2YSQ A;  2VVK A;  1YP5 A;  1ARK A;  3EGU A;  2CH4 A;  2OJ2 A;  2YUP A;  3ZL7 C;  1AD5 A;  2JMC A;  2K9G A;  1PNJ A;  2O31 A;  1TUC A;  2J6O A;  3QWX X;  1CKA A;  2D8J A;  1BB9 A;  1U5S A;  3RNJ A;  2EYW A;  1WXT A;  2JXB A;  2X3X D;  1K76 A;  1M3B A;  2BZ8 A;  1EFN A;  2LMJ A;  1PHT A;  2J06 A;  2JMA A;  5GJV B;  2ED1 A;  4JZ4 A;  2CT3 A;  1QLY A;  3REB B;  3U23 A;  4Z89 A;  5L23 A;  1UG1 A;  1T0J A;  4JPB W;  2ABL A;  1AZG B;  1ABO A;  1SHG A;  2EPD A;  2CSI A;  2EYX A;  2LJ0 A;  3H41 A;  2CRE A;  1ZBJ A;  1NM7 A;  1AWO A;  1M3A A;  2GBQ A;  2HDA A;  3I5R A;  1MV3 A;  2VWF A;  1W6X A;  1N5Z A;  3VS0 A;  1HSQ A;  2SEM A;  2C0O A;  3UF4 A;  4CC2 A;  2GNC A;  2KGT A;  1YCS B;  2GQI A;  3A98 A;  1WXU A;  1SHF A;  2L3P A;  4LNP A;  1LCK A;  1GCP A;  1MUZ A;  4JJD A;  1G2B A;  4X1V A;  2FPF A;  1GCQ A;  2KXD A;  1GBR A;  4Y92 A;  1RLQ C;  2FRY A;  1X69 A;  2PNI A;  4EIK A;  1OPL A;  2A08 A;  2RNA A;  1JXO A;  4RUG A;  4ORZ A;  2KRN A;  2BZY A;  4RTU A;  2G6F X;  1NLO C;  1H8K A;  1PRM C;  2K3B A;  3EHR A;  2F2X A;  2GTO A;  1T0H A;  4AFU C;  3VS2 A;  1UJY A;  4KRT A;  5IHI A;  2DL5 A;  3M0U A;  1GCQ C;  2E5K A;  1E6H A;  1IO6 A;  1M8M A;  2DE0 X;  2FEI A;  2J7I A;  2ESW A;  1ABQ A;  4LE9 A;  2FO0 A;  3C0C A;  3PE0 A;  3REA B;  1KIK A;  1QWE A;  2RQT A;  2LCS A;  4LN2 A;  5I22 A;  2LX7 A;  4RTT A;  4J9G A;  4K11 A;  2FG0 A;  1QKW A;  3NMZ C;  4QT7 A;  1PKS A;  2L3Q A;  4J9F A;  4JJB A;  1A0N B;  1NYF A;  1TUD A;  2LJ3 A;  3VRY A;  4DEX A;  1HD3 A;  1Z9Z A;  2D8H A;  2GGR A;  2KRS A;  1X27 A;  4HVU A;  2YT6 A;  2RQR A;  4OMQ A;  1GBQ A;  1UEC A;  2DBK A;  3CQT A;  5IXB A;  1SEM A;  4J9E A;  1ZUK A;  1AWW A;  1AOJ A;  1RI9 A;  2RQU A;  1XOV A;  2F2W A;  1RLP C;  2EYY A;  4WCI A;  3H0I A;  4HXJ A;  5IHK A;  4AFQ C;  2KRM A;  2BTT A;  1X43 A;  2IIM A;  2K79 A;  1NLP C;  3TVT A;  2EKH A;  1SRL A;  2O9V A;  1WIE A;  2DBM A;  1YWP A;  1UJ0 A;  2DL7 A;  1K0X A;  2KT8 A;  1JU5 C;  1ZLM A;  2H8H A;  1AVZ C;  2LNH B;  2A28 A;  2JS2 A;  3NHN A;  2AKL A;  1JXM A;  2DVJ A;  2K2M A;  2GTJ A;  2X3W D;  4HCK A;  1WLP B;  2W10 A;  1GRI A;  1NEB A;  2NWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...