1PKSA

Structure of the pi3k sh3 domain and analysis of the sh3 family
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
76
structure length
76
Chain Sequence
EGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT SH3 DOMAIN
publication title Structure of the PI3K SH3 domain and analysis of the SH3 family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Phosphotransferase
total genus 11
structure length 76
sequence length 76
ec nomenclature ec 2.7.1.137: Phosphatidylinositol 3-kinase.
pdb deposition date 1994-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1pksA00
1EFNA 1TUDA 3I35A 5HCKA 1SSHA 4DEXA 5FW9A 5FWCA 3QWYA 2RQVA 4OMQA 2EW3A 2C0IA 2LX7A 4Y92A 1TG0A 4OMPA 1K0XA 4KRTA 1JQQA 1ZLMA 2VWFA 1QCFA 3A98A 2PTKA 2LQNA 1WYXA 2GGRA 1OEBA 2L3QA 2D1XA 1U5SA 1X2KA 2CREA 3C0CA 2LZ6B 4LE9A 4AFZC 4K11A 5IXBA 1WXUA 4EIKA 2FO0A 3EG3A 3VS6A 1U3OA 1I1JA 1HD3A 5IXFA 1UDLA 1TUCA 2LJ3A 2LNHB 2EGCA 1VA7A 2YUOA 1ZUUA 2ECZA 4Z89A 4F16A 1J3TA 2KBTA 2MOXA 4J9IA 2F2XA 4RTUA 4ORZA 1SRMA 3VS7A 4GBQA 5EC7A 2K6DA 2EGAA 1X27A 2EPDA 2JM9A 3O5ZA 2DLPA 1YNZA 2SEMA 3NPFA 1GCPA 2KXDA 2CUBA 2EYXA 2BZYA 1WDXA 1B07A 2AZVA 2DA9A 3SHWA 2A28A 4CC7A 2E5KA 3GBQA 2ABLA 2EGEA 2J06A 3VRZA 1I0CA 1W70A 2G6FX 1MV0B 1NEBA 2DL3A 2W0ZA 1Y57A 1GCQA 1K1ZA 4JZ4A 1WI7A 2GTOA 5I22A 3M0QA 2FPDA 2HSPA 2MIOA 4E6RA 1WFWA 2ESWA 2O88A 4AFUC 1K0SA 2YDLA 1V1CA 1I07A 1MV3A 2KGTA 4HCKA 2F2WA 3THKA 1JU5C 2JMCA 4RTZA 2AZSA 2FEIA 4OMNA 3SEMA 3VS3A 2DJQA 3PE0A 1UECA 2JM8A 2L3PA 3FJ5A 1E7OA 1ZSGA 2DL4A 4OMOA 3CQTA 2BZ8A 1BB9A 1H92A 1FMKA 3PVQA 2RF0A 3H0FA 2PZ1A 1JO8A 4J9HA 1SRLA 3NMZC 1CKBA 1SPKA 2HCKA 3NGPA 2JT4A 1GL5A 2YUPA 3M0UA 4AFQC 1YP5A 2LJ0A 2CH4A 1E6GA 1NLOC 1K9AA 4CC4B 2JMAA 2J05A 4R0KA 3H0HA 2DX1A 4CC3A 1H3HA 2LMJA 3M0RA 2KNBB 1W6XA 1RLQC 1UHCA 2D8HA 2GBQA 4HVWA 4OMMA 2CH4W 2RQRA 4QT7A 2KRMA 3M0SA 2KYBA 4DEYA 2LP5A 2RQWA 2RPNA 3LH5A 2DMOA 2KE9A 1SHFA 2B86A 3QWXX 2DYBA 2JS2A 2FPFA 2CT3A 1NYGA 3EG0A 2DL8A 3JV3A 2IIMA 3EGUA 1ARKA 1WA7A 4Z8AA 3ULRB 2J7IA 4AG2C 1AWXA 1OOTA 2EYZA 4GLMA 2FPEA 1T0JA 2DBMA 2D8JA 2DBKA 2W10A 1ZX6A 2K79A 5IHIA 1A0NB 1KSWA 1KJWA 2DRMA 2YT6A 2MCNA 1AOJA 4JJBA 4RUGA 1AWOA 3VS5A 3NHNA 2EQIA 1ABOA 4Z88A 3R6NA 3U23A 2SRCA 3PVLA 3VRYA 1CKAA 2H8HA 2VVKA 2HDAA 2JS0A 1MUZA 2O9VA 1T3SA 2KT1A 1UHFA 2DVJA 2A36A 1K76A 4D8KA 1AEYA 1YWOA 1BU1A 1JXMA 2LJ1A 1K4US 1IO6A 4LNPA 1UG1A 1BBZA 1AD5A 4HVUA 3RBBB 1B3QA 2V1QA 3TSWA 5ECAA 2A08A 2DRKA 4F14A 2OAWA 2DL5A 1QKXA 1LCKA 1M3AA 2D0NA 3H41A 2K2MA 2VKNA 4J9DA 2DNUA 1Z9QA 1KFZA 3EHQA 4JPBW 1X69A 2EKHA 2O31A 4WCIA 1WLPB 1ZBJA 4J9CA 2CDTA 1AVZC 1QKWA 1M27C 3VS1A 4JJCA 2ROLA 2HEQA 1UGVA 1AZGB 4J9FA 1H8KA 1OPLA 3EG1A 2YUNA 2KROA 1PKSA 1KIKA 1HSQA 1AWJA 3M0PA 2EVRA 2BTTA 1GBQA 4JJDA 3TVTA 1OV3A 3RNJA 1E6HA 2GNCA 2L2PA 2M51A 4A63B 1SEMA 1ZUKA 4CC2A 1M8MA 1RUWA 1UE9A 2P4RA 4J9EA 1CSKA 4AG1C 4X1VA 3EG2A 3UF4A 3TSZA 2CSQA 2DE0X 1PRMC 1NEGA 2CT4A 2XMFA 2JW4A 5FWBA 2J6FA 2O9SA 1QLYA 4RTTA 1T3LA 1ZUYA 1NM7A 1YWPA 1PKTA 2KRNA 5I11A 1ABQA 1WXBA 1X2QA 2KYMA 2K7AA 4LUEA 1JXOA 1PRLC 2CUDA 2J6OA 2K9GA 2OI3A 3VS0A 2PNIA 3UATA 4J9GA 4HVVA 2RMOA 2YUQA 2JXBA 3VS2A 4AFSC 2O2OA 4RTYA 5IHNA 2ED0A 4J9BA 2AKLA 1UFFA 3I5RA 2KXCA 4IIOA 1X6BA 3I9QA 3UA6A 2KT8A 4JZ3A 4LN2A 1WX6A 2ENMA 4D8DA 4RTWA 1Z9ZA 2C0TA 4HXJA 2V1RA 2I0NA 1RLPC 2FG0A 2RNAA 4IIMA 1BK2A 4F17A 1WXTA 1G2BA 1NLPC 2F2VA 3UA7A 1GCQC 4ZNXA 1WIEA 2QDLA 1NYFA 1N5ZA 1X43A 5IH2A 1T0HA 3ZL7C 1VYVA 2C0OA 1AWWA 2NWMA 3I5SA 2K3BA 4M4ZA 3REBB 2L3SA 1X6GA 1AZEA 1RI9A 2KRSA 2X3WD 1PHTA 2M0YA 2L0AA 3KFVA 2LQWA 2J6KA 2KR3A 4ESRA 1UTIA 2NUZA 1OPKA 2DL7A 2A37A 1M30A 2LCSA 3H0IA 1U06A 1SHGA 2GQIA 1VYTA 2YSQA 1G83A 2GTJA 4RTXA 2FRWA 4RTVA 2HBWA 1Y0MA 2EBPA 1XOVA 3VS4A 2X3XD 3EHRA 2RQUA 1M3BA 1FYNA 1W1FA 2RN8A 3IQLA 3M0TA 1VYUA 2EYWA 1QWEA 3REAB 4LUDA 1GFDA 2DILA 1QWFA 2CSIA 5IHKA 1JEGA 5GJVB 1YN8A 1M3CA 2KEAA 2OJ2A 4FSSA 2DF6A 2FRYA 2RQTA 2BZXA 1NG2A 1UJ0A 2AKKA 2ED1A 4OMLA 1UJYA 1GRIA 1S1NA 2EYYA 1PNJA 1UUEA 2JTEA 1HJDA 5GJWB 1GFCA 1GBRA 2AK5A 5L23A 2DM1A 1YCSB 2ROTA 1PWTA
chains in the Genus database with same CATH superfamily
3RUXA 5KYXB 2LCCA 1SSHA 3OSSC 4DEXA 4RCBA 3X26B 5FW9A 3JB9F 5FWCA 3PFSA 1K9MC 1KK7A 2LX7A 4EMHA 4E7HA 3R6OA 4F7UF 4ZN3A 2NUPA 1TG0A 2K3YA 4KRTA 1KD1R 3L2WA 2P0PA 4R55A 1EX4A 1YJNA 2LQNA 1LVKA 1UEBA 2X9HA 3CPFA 2D1XA 1M1FA 3KXTA 1V76A 1WGSA 1FXXA 5IXBA 1WXUA 5A0DA 5CQYA 3VS6A 1BIBA 1U3OA 1I1JA 2DO3A 4UC4A 1ZBXA 2PVGB 3QG1A 3MP8A 1OX8A 5IN1A 2EGCA 4EPCA 1ZUUA 2ECZA 2MPXC 1J3TA 5A2QE 2E3IA 2PU9B 4ORZA 1KD1C 5GANf 4GBQA 1RAIB 3O5ZA 2COZA 4M7AF 1VQ7T 3X25B 1QVGA 3G6ET 4M75B 1TH7A 2RHUA 3JCMV 3OS5A 1WDXA 3LGFA 5GAOm 5FU6B 2DA9A 2L8DA 3ZBDA 3P8DA 2A28A 5CK9A 3LWHA 2ABLA 5IAYA 1EZZB 2EGEA 1W70A 3OY9A 1C0MA 1NEBA 2DL3A 2W0ZA 1Y57A 1LOJA 1KQSP 1MMGA 1I5OB 1Q95G 3P8BB 4JZ4A 1WI7A 1M9SA 4FU6A 2H3EB 1OZ3A 4JUVA 2ESWA 4OB1B 3RMQA 1D0XA 4NOYA 4GY5A 5I2MA 3EG9A 1D0ZA 2M1HA 3JCMW 1MV3A 2KGTA 4HCKA 3QZ5B 2DXBA 4PL6A 5J3BA 5LJ5e 2JMCA 4RTZA 2MYSA 3I56A 2AZSA 4MZMA 2FEIA 3PE0A 1M2VB 4RMOA 3EFOB 1E7OA 4LDWA 1M2OA 1ZSGA 3QSUA 2QTXA 4C92B 2FB7A 1BB9A 2YWWA 1H92A 4M7AE 5KYUB 1FMKA 4DA4A 4L59A 5GAMd 2F5KA 1S72Q 3NMZC 2HCKA 1GL5A 3M4GA 2DXUA 2OX7A 3VV0A 1Q81U 4MDWA 1X6OA 3HKSA 4BUGA 2O4XB 1NLOC 1UB4A 2QXFA 2JMAA 2M0OA 3MEWA 2LMJA 3OBYA 2JVVA 1O9SA 2KNBB 4ZGJB 1W6XA 2K5FA 2JTFA 1PD0A 2GBQA 4HVWA 1YITT 4DEYA 2CP7A 2X4WA 2DMOA 1SHFA 1X01A 2CZ0B 1YI2Q 4J6YA 4ZTFA 3CBMA 3LGLA 4E7SA 2HKNA 2CT3A 2XICA 2IIMA 4XAXB 3ULRB 4QKUA 2FPEA 2W10A 3CCUA 2DBKA 1ZX6A 3SB2A 1A0NB 2NYSA 5GAMf 2MCNA 4BDZA 4YTLA 2M02A 2LQKA 1FMWA 1RL2A 3QKJA 2JTMA 3NFCA 3SWNA 1W2BS 5CKEA 2CP6A 3O8VA 2EQIA 3RKXA 1ABOA 4Z88A 3CCVA 2MWPA 2LVMA 2DTIA 1IZ6A 3EGDB 3VRYA 2HL5C 2H8HA 1N27A 3T9NA 1YJWQ 1MUZA 1KHIA 4C8QD 5GMKl 3OYMA 2EAYA 4C8QC 2A36A 1NBEB 2HD0A 1WHGA 1BU1A 4JRPA 3CMAT 3DLMA 3PIOA 2QK0A 5GAOq 3WVEB 3F70A 1VQ6T 2OAWA 2DEUA 3V8LA 2K2MA 3JB9H 2HMAA 2O01E 4PJOE 2DKGA 1RAHB 4M7DG 3JCMg 3CCST 1D0YA 4C8QF 4XTVA 1XNIA 1AVZC 3EGDA 1Y96A 2QQBA 2HEQA 1AZGB 2E1HA 2ZPBB 1OPLA 3EG1A 3S3NA 4C0FA 1AWJA 2QYZA 3M0PA 2H3JA 4C0DC 2MMPA 2BTTA 3G71Q 4Q5WA 3TVTA 1RAGB 2GCXA 3M54A 1OV3A 1VQPA 3L2RA 1Q82R 2E10A 3BY7A 2PVDB 4HT8A 1SEMA 1ZUKA 4CC2A 4F7UA 1UE9A 5LJ3j 3MPUB 4A4EA 3NTKA 3G4SA 2CT4A 4M77G 4FW1A 3X20B 2K5IA 5FWBA 1S72T 1QLYA 1M90U 1PKTA 2KRNA 1ABQA 1FX7A 1TS9A 5LJ5d 2NLUA 2VYTA 1JXOA 3EFRA 4XTXA 5GAOp 1VQOQ 3N5BB 1Q82C 3VS0A 4R56A 4J9GA 2YUQA 3QBYA 4AFSC 4RTYA 4ELZC 5LJ3g 1UFFA 2P0KA 3CCMA 4XTUA 1VQLA 4LN2A 4M7AA 1M1KU 5D6XA 2OAUA 3OYHA 5GAN8 4OF1A 3UDCA 1QVFA 3JCMQ 1QP3A 2FL7A 4OB2B 3NTHA 2FZKB 4PFZA 4IIMA 4OB3B 4F17A 1WXTA 4M78G 4ZNXA 2QDLA 2ZZDA 2KSSA 1YFNA 1X43A 3GOXA 5AYFA 5D7UA 2QTVA 3ZL7C 3MHXA 1Q7YR 1QP2A 4M4ZA 3HTRA 3REBB 4QW2A 1RI9A 2KRSA 1Y07A 3OYDA 2QA4Q 4JLIA 2L0AA 3KFVA 2LQWA 4ESRA 2NUZA 1OPKA 1M30A 4JS4A 2NUTA 2FHDA 3H0IA 1U06A 2GQIA 1VQ9A 2YSQA 4QQ6A 7AT1B 3PIPA 1VQ4A 3GP8A 1M1KR 3A8HB 2EBPA 2VC8A 4C0ZA 3JB9J 3EHRA 1ZA2B 3E19A 1FYNA 3L42A 3JCMh 3CCEQ 2QGFB 4PJOG 1QWEA 1Q7YC 1YJWT 4LUDA 2CP0A 3QIIA 1M3CA 3I56T 5KYNA 2KEAA 2EFIA 3M53A 4QVDA 2CKKA 1VQ5T 1UJ0A 5CCAA 1V29B 1X75C 1M1KC 1PNJA 2DM1A 3X28B 4DBRA 2ROTA 1PWTA 3KBGA 1G8XA 2HBPA 4E47A 1YIJA 1RAEB 2ZCFB 3V7SA 1O75A 2RQVA 3OW2A 4Y92A 4X9DA 4OMPA 4E7JA 3A5ZB 2EQJA 3CD6A 2LT4A 1WYXA 3EH2A 3SDZA 3JCMe 1IGUA 1X2KA 2CREA 4LE9A 2LZ6B 3META 3CCQQ 3OYCA 1BI2A 2LRQA 3DLLA 3EG3A 1M4ZA 3VKIA 3CBOA 5LJ3h 3I55Q 4J83A 1HD3A 3FC3A 1MNDA 1TUCA 4GLKA 3FB9A 2LJ3A 2FZCB 2HZYA 5CKFA 2LNHB 5DY9A 3ASKA 5HY6A 1KC8R 3PMIA 3SWNC 4E7ZA 2LQ8A 4ATOA 1B34B 2MOXA 4J9IA 4NS5A 1AHJB 1WHJA 3LW5E 2F2XA 1HK9A 5GMKm 2XU8A 3UPUA 3CCUT 5EC7A 4C8QB 3CPWP 1MMNA 1X27A 1VQOT 3CC2A 1YNZA 4M75E 2CUBA 1VQKA 4KUDK 2MAMA 2AZVA 2XD0A 2F1LA 2IPOB 4CC7A 2VXEA 1QCOA 1KC8C 2G6FX 2RJDA 5CO7A 5J39A 5GMKe 1GCQA 2AT1B 4ELYC 1YJ9T 2GTOA 5I22A 1OZ2A 5LJ3e 1IXDA 3HRTA 4E6RA 1TOVA 1VQ8Q 2DXTA 4AFUC 1RADB 1K0SA 2E3HA 4J6XA 4C0DB 5IT9E 1V1CA 2NUPB 1JU5C 1N9SA 4C5HA 2VV5A 2P0QA 3M56A 3CC7A 4OMNA 4WF2A 2QEXT 1Y7XA 3RESA 3E2UA 2DL4A 4C92E 3EAEA 1QVFS 4OB0B 3PVQA 2RF0A 4Y28E 4J6WA 1SRLA 1CKBA 1SPKA 1BI3A 1R77A 2YUPA 2D0QB 3CCET 1W4SA 1YP5A 2LJ0A 2E12A 4CC4B 3OYYA 4XTZA 3H0HA 2VASA 3UWNA 4CC3A 1H3HA 3CCLA 4RKUE 5HK0A 2BE9B 4KH0B 1UHCA 4VUBA 4M7AD 4E7LA 4M7AC 1BCOA 1FWZA 4QT7A 1Q86R 2KRMA 4BACA 3M0SA 1AT1B 3A8MB 2RQWA 5AT1B 1KQSA 2PVOB 4FT2A 1G3WA 2V8IA 4M7DF 1IRXA 1VOMA 1YCYA 3VYHB 4FYXB 3GNFB 1NYGA 2CZ7B 4IUVA 1VQNA 3JV3A 1ARKA 5LJ5h 3H8ZA 2A0FB 1N9RA 2EYZA 4GLMA 2X4YA 4F04B 5IHIA 4JJNK 3EG9B 2DRMA 4LD9K 4X9CA 5A0GA 3CMAQ 2RI5A 3CCQT 2RJCA 4JJBA 3FEOA 3D7SB 1Q86C 1VQ6Q 3I55T 4M75G 3QJYA 2CYZB 2FYKA 4ZGEB 5DLOA 4AMCA 3BW1A 2SRCA 2DPPB 3PVLA 3MEUA 3CCSQ 1QW1A 4NL3A 4HCBA 4M77F 4L6V5 1WHMA 2HDAA 2JS0A 2RHYA 3TQ7P 1QMCA 3M4YA 4QVZA 4DOWA 3JCMd 3PNWC 3OW2S 5GAOn 3QDRB 2DVJA 2LNVA 4LDUA 3GIBA 4XU1A 1JXMA 4EMGA 2AIRB 4LNPA 1UG1A 4HVUA 1B3QA 3L2QA 4F14A 1KQ2A 2DIGA 4QVCA 4M7DE 2HQXA 3MP1A 1PSEA 3DB4A 2RM4A 4JLGA 3S6WA 3HRUA 3JCMX 4WCIA 2AHJB 1ZBJA 4LDYA 4IUUA 3S3MA 1QKWA 4OMFB 1BI0A 3H9NA 2E4HA 4O5VA 2OTJT 3QXEB 3LH0A 4J9FA 4C92G 5GAN6 4PJMA 1VQ8T 1WHKA 4M78F 2KROA 2VGNA 1PKSA 3OMCA 3FJPA 2ZPIB 2HKQB 2EVRA 5GANj 1B7TA 4PFOA 4XQ3A 2Y90A 1VQMA 3RNJA 1OU8A 4JRQA 1JJ2P 4A54A 2GNCA 4A63B 2EQKA 3FRNA 1RUWA 5FU7C 4J9EA 4BI8B 4PJOD 4M77E 1CSKA 4X1VA 4PJOC 3UF4A 3TSZA 2GQVA 4KGVB 2M9UA 1G3YA 3SWNB 5LJ3d 1YIJT 3CMEA 2JW4A 4J5YA 5KCOA 1X2QA 5GANg 2K7AA 4LUEA 2WSFE 3G71A 1VIFA 2COYA 4ZGDB 4Y91A 2CUDA 1QCNA 4PJOF 2I2LA 4HVVA 2RMOA 4ZTJA 2O2OA 1XJWB 4BB7A 2VUBA 1K73U 2CGHA 2KXCA 3I9QA 3UA6A 4JZ3A 3OYGA 1Q81R 1WX6A 1YHQT 1RAFB 1Z9ZA 2DTOA 3VUBA 2ATCB 3H6ZA 4M78E 1K8AU 2I0NA 3CXCA 1RLPC 5A0LA 3EH1A 1NJIU 1G3TA 2RNAA 1BK2A 4OVAA 1G2BA 1NLPC 2F2VA 3CCJA 1GCQC 3NTIA 1WIEA 2KQWA 1M8VA 3CC2T 5IH2A 1Y96B 2DD4A 2XK0A 3RKWA 1ZHIA 2XDDA 2C0OA 2DYIA 4QQDA 3RDVA 2BE7D 3I5SA 2JJ9A 2E64A 1Q81C 2X3WD 4II1A 3I56Q 2Y4YA 4BE1A 3ER0A 4PJNA 2A37A 2DXCA 1R0BG 4DOVA 4TVRA 1K73R 1VQ5Q 4F7UB 1SHGA 1VYTA 4FW2A 3HSBA 1M1GA 1RAAB 5EG2A 1G83A 4RTXA 2PUOB 1XOVA 2X3XD 2JN0A 3CXCP 4PKCC 2COWA 5D6WA 1KQSS 4KGZB 1M3BA 2RN8A 3OQ5A 4A53A 1XTDA 2EYWA 3V8KA 3V7CA 1D09B 1D1AA 2CSIA 2MWOA 5CKHA 3QJ6A 3CC7T 2YHTA 3S3OA 2FVUA 2FRYA 5KYYA 3HL8A 4KUIA 5GMKj 1K73C 4IUPA 1UGRB 1QVGS 4OMLA 4DBFA 3MEAA 4B9XA 4M7AB 1UUEA 4A4GA 2JTEA 3JCMP 2RK1A 1GFCA 5L23A 4LD6A 5CIUA 1YCSB 1ACMB 2MK5A 1EFNA 3I35A 1PSFA 1ZA1B 1ZSZA 3QWYA 3E9FA 2C0IA 1K0XA 2LT1A 1JQQA 4M7DA 1ZLMA 2VWFA 1QCFA 3CCUQ 1YJNT 3A98A 3CCLT 1I4K1 2GGRA 2L3QA 3AHUA 1U5SA 1FMVA 4K11A 4OP0A 2FO0A 1OQKA 4HT9A 1KQ1A 2HNIA 5GAN2 2HQHA 5IXFA 2MF2A 4O6JA 2NUTB 3CC4A 3INZA 2QQ9A 3VUZA 2YUOA 5CQXA 2R5MA 2E5QA 4Z89A 1D1CA 1D3BB 3CBPA 2RA2A 1YJ9Q 1VQNT 3MO8A 2OTLA 4NL2A 4RTUA 1TUGB 5DLQE 2K6DA 2CZ6B 2EGAA 3M58A 3LWIA 2SEMA 3NPFA 1WZOA 1VQ7A 3PT9A 4M77A 3G6EA 2EYXA 4BI3A 1M90R 1P92A 2R5AA 3A8OB 3P8HA 2K5LA 3SHWA 2RHIA 2E5KA 2QAZA 1PD1A 2K4YA 1BI1A 2QEXQ 3VRZA 1UGQB 5GANe 2RI3A 1MV0B 2L89A 2RHZA 2RJEA 3Q1JA 1RACB 5LJ5f 1TXQA 1K1ZA 1N6AA 2GF7A 2DERA 3M0QA 1D3BA 2RHXA 4L5GA 5L8RE 2HSPA 4PJLA 3OS0A 1IHWA 5D6YA 4XU0A 3RERA 2G3RA 4M75D 4B9WA 1M90C 4M75C 2DVEA 2ZAEA 1DJ7B 1I07A 3CCRA 6AT1B 1TSFA 2F2WA 3THKA 1VQPQ 3MJXA 1N8RU 4FT4A 2XI9A 4JRKA 4M78A 3SEMA 3VS3A 1UECA 2JM8A 3FJ5A 2CS7A 4PJOB 4QQGA 2KVQG 2M16A 2D9TA 3E1SA 4N4GA 2LX9A 4M75F 3ZFJA 3H0FA 2WSCE 3NGPA 2EQMA 2JT4A 3G7ZA 4ANJA 2CH4A 1IGQA 4EMKA 1E6GA 3CPWA 1VQMT 1K9AA 4PLIA 3PMTA 4R0KA 2DX1A 1F1BB 3L2ZA 4OGEA 5GMKh 4C92D 4FIBA 4PJOA 1MHNA 3HRSA 4C92C 2D8HA 2HQEA 4OMMA 4PNOA 3JRZA 4Z02A 1YITA 4BD3A 2LP5A 2RPNA 3QO3A 3QWXX 4PFPA 4ZN1A 2DYBA 2HL3A 3MP6A 2FPFA 5M9OA 3EG0A 2DL8A 4IUQA 3EGUA 4Z8AA 1LPLA 4FYYB 4C92F 4AG2C 1AWXA 1T0JA 2DBMA 3L2UA 2EJGA 1KSWA 3ME9A 1VUBA 2YT6A 2DZ9A 1N8RC 2Z0WA 3FLGA 1AOJA 1WHHA 4RUGA 3VJPA 3WXMB 5FROA 1VQ9Q 1VQ4Q 1K9MU 3R6NA 3J7AF 2DK3A 3CCVT 3GF5A 2E65A 2RH2A 3U23A 4JDSA 1CKAA 2RK2A 4E7KA 2VVKA 1D1BA 3EFSA 5KH6A 2HAXA 3JCMb 2PQWA 2O9VA 5GMKi 2OTJQ 1NZ9A 2DD5A 5FLXE 4D8KA 4J7FA 3M59A 1YWOA 1AEYA 2F5TX 3A8GB 2LJ1A 1K4US 5GAN5 2D6FA 1BBZA 1AD5A 3RBBB 2V1QA 3OYIA 4C5EA 1M3AA 3H41A 2QASA 2DNUA 2EJFA 4PJJA 5HK3A 1Z9QA 1KFZA 4JPBW 2EKHA 2O31A 4MZTA 4BY6C 1KD1U 4C5GA 2CDTA 1YIJQ 3M55A 3QDFA 2EKOA 4FYVB 2C06A 2ROLA 1I81A 5KYWA 1UGVA 5CVIA 2LC4A 3M5AA 1H8KA 4JS5A 4KH1B 1UGSB 2YUNA 4DBHA 1KIKA 3EGXA 1QQJA 1ZSZC 3CD6Q 4JJDA 1VQPT 3L2VA 4M7DD 3URGA 2RB6A 2M51A 5GANd 1PM3A 4M7DC 3BFMA 2P4RA 4A4HA 3QPHA 4WTOB 1XQHA 2BIVA 2WACA 4XU3A 1YHQQ 1BKBA 2WSEE 2CSQA 2DE0X 3G4ST 2X51A 1NEGA 4IURA 2XMFA 1NPPA 2K3XA 1S72A 2O9SA 1JBMA 1T3LA 2LTOA 2LCLA 1ZUYA 3BE3A 1YWPA 2ZPHB 3TEEA 1WXBA 3C94A 2KYMA 3OS1A 2XDBA 3CC2Q 1PRLC 2K9GA 2OI3A 2PNIA 4DQ2A 3UATA 4AT1B 2QQRA 1VQKQ 2JXBA 1SKUB 4J9BA 2AKLA 3I5RA 2EIFA 3CCMT 1X6BA 4M77D 1W2BP 1VQLT 3CEYA 4LDVA 3LLRA 4M77C 3CC4T 4D8DA 3DB3A 5KE3A 3UT1A 1PG5B 5I2SA 4RTWA 3ZEHA 4HXJA 1RI0A 3AT1B 2RO0A 5KYXA 3VYGA 1ZQ1A 1WQWA 2OTLT 2FG0A 3OYEA 4BI4A 4ME7A 3SFMA 1U1TA 3C95A 1YI2A 3C4SA 2VGMA 3A8LB 1NYFA 4N0AC 1N5ZA 1WJSA 4OGCA 1T0HA 2YRCA 2ZPGB 5KCHA 2K3BA 1UGPB 1X6GA 3OB9A 3CPWS 3CC7Q 1PHTA 2LDMA 2M0YA 3OYFA 2J6KA 1JJ2A 1UTIA 4J8OA 2DL7A 4J7IA 2IVWA 3JSCA 1MNEA 4M78D 4F7UE 1U1SA 3E9GA 4M78C 2QQSA 3HP9A 1VQ9T 1VQ4T 2GTJA 2FRWA 4XTYA 2HBWA 1Y0MA 3VS4A 2FZGB 4XTWA 4MZPA 1W1FA 3IQLA 1YJWA 2F69A 2DILA 3CCRT 1QWFA 4M75A 5IHKA 1JEGA 2R57A 1QVGP 1YN8A 5GAN7 2OJ2A 4FSSA 2DF6A 5LL6S 2L5QA 4EMKC 1YJNQ 1U8RA 3CCLQ 4IKFA 2RD1A 1VQ5A 1NG2A 2XKOC 2AKKA 3SD4A 4C0GA 2XIDA 4P5NA 1UJYA 1GRIA 1SG5A 1S1NA 3HPWA 2DETA 1HJDA 3OYLA 2AK5A 1NE8A 3HHTB 3JCMf 1AWWA 2XHCA 3PTAA 1TUDA 2YLBA 5HCKA 4FCYA 2QGGA 3OYJA 2CP5A 2KI7A 2YRVA 4FL6A 4OMQA 2EW3A 1VQNQ 4PK4A 1WJRA 5CKDA 2DZCA 2PTKA 3CD6T 1OEBA 1M2VA 3C0CA 4CRIA 3EFOA 4AFZC 1H3ZA 3GLXA 4EIKA 4DBQA 3RIRA 4C92A 5DM7R 5KYUA 1UDLA 1TWBA 5CR2A 9ATCB 1VA7A 4F16A 2KBTA 4LDXA 2QG9B 2KK4A 1Y71A 1SRMA 2O4XA 3VS7A 2EPDA 3M57A 2JM9A 2DLPA 1VQOA 1VIEA 1GCPA 2KXDA 1VQKT 2BZYA 2P84A 3DKMA 1B07A 5LJ3f 4RG8A 3TREA 5KYYB 3GBQA 2J06A 3BDLA 5KE2A 1I8FA 1RABB 3WVDB 2X4XA 1I0CA 1G5VA 4BY6B 3JB9G 1YJ9A 4BE0A 1PCXA 2JOYA 1LNXA 2FPDA 2RJFA 1Q82U 4IUTA 4F7UG 4X34A 1OI1A 2ZGWA 2MIOA 1WFWA 2O88A 1K8AR 1ZSZB 2EYQA 4A4KA 2HSEB 8ATCB 1NJIR 2YDLA 2L3RA 1VQMQ 1QVPA 3FDRA 4M7DB 1WHLA 3J81E 2ZPEB 2QA4A 1WJQA 2DJQA 2QEXA 2GFUA 2L3PA 2A3LA 5GAMj 4OMOA 3M9QA 3CQTA 3X24B 2BZ8A 2VB6A 1C6VX 3CMEQ 4HCCA 5C6SA 2PZ1A 3L1AA 1JO8A 4J9HA 4KBMB 1K8AC 4M7AG 1BCMA 3M0UA 3CCEA 1NJIC 1MMDA 4AFQC 3LYIA 2V8JA 1KG1A 3LX7A 8AT1B 1G3SA 2KAFA 2J05A 2DAQA 1EIFA 3C12A 3TU4K 1R0CB 4M77B 5GANh 3M0RA 5FRMA 2X35A 5GAMg 3QUIA 1JJ2S 4A4FA 3JAME 4RCCA 1RLQC 1IHVA 5C0MA 2A7YA 5HKCA 3TCJA 2DIQA 1JRIA 1LJOA 2CH4W 2RQRA 4MMKA 2KYBA 1Q7YU 1OYXA 4MMLA 3LH5A 2KE9A 2B86A 2P4TA 3CCJQ 3CCVQ 4KT0E 2YXYA 1MGQA 4N4HA 2JS2A 4HCZA 3V7RA 1BYMA 3HFOA 1SSFA 1MMAA 1GXIE 1WA7A 3RR6A 2J7IA 2E6NA 1OOTA 4C8QE 2D8JA 2K79A 1NPRA 3QZ9B 3JCMJ 2QQAA 1KJWA 3CCQA 2E6ZA 3OBWA 5GAN3 5FRNA 2ZPFB 4M78B 2KDSA 1AWOA 4XU2A 3VS5A 3I55A 3NHNA 4CI0C 1H641 1YI2T 4FSXA 5CKBA 4FYWB 2CP2A 4N0AA 4FM4B 2R58A 4PLLA 1T3SA 2KT1A 2QI2A 5I21A 1UHFA 1PC0A 1K76A 2X4JA 2JUFA 1I5LA 4EMKB 1IO6A 4E7IA 5GAOl 3TSWA 5ECAA 2A08A 2DRKA 5FU6C 2DEQA 2DL5A 3RKYA 1QKXA 1LCKA 2D0NA 3OSVA 2VKNA 4J9DA 5FU7B 3OYKA 1QVFP 4XK8E 2BUDA 3EHQA 1X69A 1WLPB 1IB8A 3G4SQ 2V26A 2EQUA 4J9CA 4V2SA 2XDPA 1YBYA 1M27C 3VS1A 4JJCA 3MCAB 2RI2A 2OTJA 3CXCS 1VQ8A 2MI6A 1HSQA 4B6MA 1GBQA 3OYBA 2EJ9A 1E6HA 2L2PA 4LXCA 1KC8U 2GFAA 1M8MA 3BDUA 3CCMQ 5GAN4 4AG1C 1VQLQ 3EG2A 1OULA 3CC4Q 3QHSA 1N8RR 1PRMC 5GAMh 3MEVA 3HFNA 3CMET 2E70A 2PUKB 2J6FA 5LJ5j 2OTLQ 4RTTA 1TU0B 1NM7A 2VXFA 3FIFA 3OMGA 5I11A 1HXDA 2JNGA 4N4IA 2YLCA 3G71T 1VQ7Q 2J6OA 1SF9A 3QYGB 2QDYB 3G6EQ 2KMTA 1KHCA 3VS2A 3RMSA 4JRIA 2ED0A 5IHNA 4IIOA 5CAIA 2Y4XA 4BE2A 2KT8A 2K2VA 1C1AA 2ENMA 1YHQA 2C0TA 2V1RA 5GAOr 2DJZA 4KGXB 4C8QG 3JB9I 3OS2A 3VU3C 2IG0A 5LJ5g 2B8AA 4D6WA 1TTHB 2CZ1B 3CCJT 3UA7A 3OW2P 2DFUA 3PGGA 5GAMe 1VYVA 5KYWB 2CP3A 2NWMA 2BKDN 2DTHA 1HYOA 2XG8D 3J80E 4HKEA 3CCRQ 2L3SA 1AZEA 3EGXB 1WQ7A 4MDXA 2KR3A 3CMAA 4BDYA 1R8OB 2LCSA 1VQ6A 1JB0E 1M5Q1 1OX9A 1OU9A 3MKDA 2K57A 4RTVA 1B34A 2V8KA 5J26A 3V8JA 3GPLA 4E2FB 3CCSA 3QYHB 2RQUA 3KUFA 3OYAA 4RG2A 4C8QA 3M0TA 1VYUA 3OYNA 3JCMc 3REAB 1GFDA 2YRDA 1K9MR 2EWNA 1WPYA 2E41A 4C5IA 5GJVB 1WNLA 3JB9D 2QA4T 3GNGA 3A1PA 2KY9A 4KULA 1Q86U 2JZ2A 3OA6A 4EDUA 2RQTA 3G1JA 2BZXA 2ED1A 1W2BA 4HA8A 2EYYA 1BIAA 5GJWB 1YITQ 1GBRA 1IREB
chains in the Genus database with same CATH topology
1EFNA 1TUDA 3I35A 5HCKA 1SSHA 4DEXA 5FW9A 5FWCA 3QWYA 2RQVA 4OMQA 2EW3A 2C0IA 2LX7A 4Y92A 1TG0A 4OMPA 1K0XA 4KRTA 1JQQA 1ZLMA 2VWFA 1QCFA 3A98A 2PTKA 2LQNA 1WYXA 2GGRA 1OEBA 2L3QA 2D1XA 1U5SA 1X2KA 2CREA 3C0CA 2LZ6B 4LE9A 4AFZC 4K11A 5IXBA 1WXUA 4EIKA 2FO0A 3EG3A 3VS6A 1U3OA 1I1JA 1HD3A 5IXFA 1UDLA 1TUCA 2LJ3A 2LNHB 2EGCA 1VA7A 2YUOA 1ZUUA 2ECZA 4Z89A 4F16A 1J3TA 2KBTA 2MOXA 4J9IA 2F2XA 4RTUA 4ORZA 1SRMA 3VS7A 4GBQA 5EC7A 2K6DA 2EGAA 1X27A 2EPDA 2JM9A 3O5ZA 2DLPA 1YNZA 2SEMA 3NPFA 1GCPA 2KXDA 2CUBA 2EYXA 2BZYA 1WDXA 1B07A 2AZVA 2DA9A 3SHWA 2A28A 4CC7A 2E5KA 3GBQA 2ABLA 2EGEA 2J06A 3VRZA 1I0CA 1W70A 2G6FX 1MV0B 1NEBA 2DL3A 2W0ZA 1Y57A 1GCQA 1K1ZA 4JZ4A 1WI7A 2GTOA 5I22A 3M0QA 2FPDA 2HSPA 2MIOA 4E6RA 1WFWA 2ESWA 2O88A 4AFUC 1K0SA 2YDLA 1V1CA 1I07A 1MV3A 2KGTA 4HCKA 2F2WA 3THKA 1JU5C 2JMCA 4RTZA 2AZSA 2FEIA 4OMNA 3SEMA 3VS3A 2DJQA 3PE0A 1UECA 2JM8A 2L3PA 3FJ5A 1E7OA 1ZSGA 2DL4A 4OMOA 3CQTA 2BZ8A 1BB9A 1H92A 1FMKA 3PVQA 2RF0A 3H0FA 2PZ1A 1JO8A 4J9HA 1SRLA 3NMZC 1CKBA 1SPKA 2HCKA 3NGPA 2JT4A 1GL5A 2YUPA 3M0UA 4AFQC 1YP5A 2LJ0A 2CH4A 1E6GA 1NLOC 1K9AA 4CC4B 2JMAA 2J05A 4R0KA 3H0HA 2DX1A 4CC3A 1H3HA 2LMJA 3M0RA 2KNBB 1W6XA 1RLQC 1UHCA 2D8HA 2GBQA 4HVWA 4OMMA 2CH4W 2RQRA 4QT7A 2KRMA 3M0SA 2KYBA 4DEYA 2LP5A 2RQWA 2RPNA 3LH5A 2DMOA 2KE9A 1SHFA 2B86A 3QWXX 2DYBA 2JS2A 2FPFA 2CT3A 1NYGA 3EG0A 2DL8A 3JV3A 2IIMA 3EGUA 1ARKA 1WA7A 4Z8AA 3ULRB 2J7IA 4AG2C 1AWXA 1OOTA 2EYZA 4GLMA 2FPEA 1T0JA 2DBMA 2D8JA 2DBKA 2W10A 1ZX6A 2K79A 5IHIA 1A0NB 1KSWA 1KJWA 2DRMA 2YT6A 2MCNA 1AOJA 4JJBA 4RUGA 1AWOA 3VS5A 3NHNA 2EQIA 1ABOA 4Z88A 3R6NA 3U23A 2SRCA 3PVLA 3VRYA 1CKAA 2H8HA 2VVKA 2HDAA 2JS0A 1MUZA 2O9VA 1T3SA 2KT1A 1UHFA 2DVJA 2A36A 1K76A 4D8KA 1AEYA 1YWOA 1BU1A 1JXMA 2LJ1A 1K4US 1IO6A 4LNPA 1UG1A 1BBZA 1AD5A 4HVUA 3RBBB 1B3QA 2V1QA 3TSWA 5ECAA 2A08A 2DRKA 4F14A 2OAWA 2DL5A 1QKXA 1LCKA 1M3AA 2D0NA 3H41A 2K2MA 2VKNA 4J9DA 2DNUA 1Z9QA 1KFZA 3EHQA 4JPBW 1X69A 2EKHA 2O31A 4WCIA 1WLPB 1ZBJA 4J9CA 2CDTA 1AVZC 1QKWA 1M27C 3VS1A 4JJCA 2ROLA 2HEQA 1UGVA 1AZGB 4J9FA 1H8KA 1OPLA 3EG1A 2YUNA 2KROA 1PKSA 1KIKA 1HSQA 1AWJA 3M0PA 2EVRA 2BTTA 1GBQA 4JJDA 3TVTA 1OV3A 3RNJA 1E6HA 2GNCA 2L2PA 2M51A 4A63B 1SEMA 1ZUKA 4CC2A 1M8MA 1RUWA 1UE9A 2P4RA 4J9EA 1CSKA 4AG1C 4X1VA 3EG2A 3UF4A 3TSZA 2CSQA 2DE0X 1PRMC 1NEGA 2CT4A 2XMFA 2JW4A 5FWBA 2J6FA 2O9SA 1QLYA 4RTTA 1T3LA 1ZUYA 1NM7A 1YWPA 1PKTA 2KRNA 5I11A 1ABQA 1WXBA 1X2QA 2KYMA 2K7AA 4LUEA 1JXOA 1PRLC 2CUDA 2J6OA 2K9GA 2OI3A 3VS0A 2PNIA 3UATA 4J9GA 4HVVA 2RMOA 2YUQA 2JXBA 3VS2A 4AFSC 2O2OA 4RTYA 5IHNA 2ED0A 4J9BA 2AKLA 1UFFA 3I5RA 2KXCA 4IIOA 1X6BA 3I9QA 3UA6A 2KT8A 4JZ3A 4LN2A 1WX6A 2ENMA 4D8DA 4RTWA 1Z9ZA 2C0TA 4HXJA 2V1RA 2I0NA 1RLPC 2FG0A 2RNAA 4IIMA 1BK2A 4F17A 1WXTA 1G2BA 1NLPC 2F2VA 3UA7A 1GCQC 4ZNXA 1WIEA 2QDLA 1NYFA 1N5ZA 1X43A 5IH2A 1T0HA 3ZL7C 1VYVA 2C0OA 1AWWA 2NWMA 3I5SA 2K3BA 4M4ZA 3REBB 2L3SA 1X6GA 1AZEA 1RI9A 2KRSA 2X3WD 1PHTA 2M0YA 2L0AA 3KFVA 2LQWA 2J6KA 2KR3A 4ESRA 1UTIA 2NUZA 1OPKA 2DL7A 2A37A 1M30A 2LCSA 3H0IA 1U06A 1SHGA 2GQIA 1VYTA 2YSQA 1G83A 2GTJA 4RTXA 2FRWA 4RTVA 2HBWA 1Y0MA 2EBPA 1XOVA 3VS4A 2X3XD 3EHRA 2RQUA 1M3BA 1FYNA 1W1FA 2RN8A 3IQLA 3M0TA 1VYUA 2EYWA 1QWEA 3REAB 4LUDA 1GFDA 2DILA 1QWFA 2CSIA 5IHKA 1JEGA 5GJVB 1YN8A 1M3CA 2KEAA 2OJ2A 4FSSA 2DF6A 2FRYA 2RQTA 2BZXA 1NG2A 1UJ0A 2AKKA 2ED1A 4OMLA 1UJYA 1GRIA 1S1NA 2EYYA 1PNJA 1UUEA 2JTEA 1HJDA 5GJWB 1GFCA 1GBRA 2AK5A 5L23A 2DM1A 1YCSB 2ROTA 1PWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EFN A;  1TUD A;  3I35 A;  5HCK A;  1SSH A;  4DEX A;  5FW9 A;  5FWC A;  3QWY A;  2RQV A;  4OMQ A;  2EW3 A;  2C0I A;  2LX7 A;  4Y92 A;  1TG0 A;  4OMP A;  1K0X A;  4KRT A;  1JQQ A;  1ZLM A;  2VWF A;  1QCF A;  3A98 A;  2PTK A;  2LQN A;  1WYX A;  2GGR A;  1OEB A;  2L3Q A;  2D1X A;  1U5S A;  1X2K A;  2CRE A;  3C0C A;  2LZ6 B;  4LE9 A;  4AFZ C;  4K11 A;  5IXB A;  1WXU A;  4EIK A;  2FO0 A;  3EG3 A;  3VS6 A;  1U3O A;  1I1J A;  1HD3 A;  5IXF A;  1UDL A;  1TUC A;  2LJ3 A;  2LNH B;  2EGC A;  1VA7 A;  2YUO A;  1ZUU A;  2ECZ A;  4Z89 A;  4F16 A;  1J3T A;  2KBT A;  2MOX A;  4J9I A;  2F2X A;  4RTU A;  4ORZ A;  1SRM A;  3VS7 A;  4GBQ A;  5EC7 A;  2K6D A;  2EGA A;  1X27 A;  2EPD A;  2JM9 A;  3O5Z A;  2DLP A;  1YNZ A;  2SEM A;  3NPF A;  1GCP A;  2KXD A;  2CUB A;  2EYX A;  2BZY A;  1WDX A;  1B07 A;  2AZV A;  2DA9 A;  3SHW A;  2A28 A;  4CC7 A;  2E5K A;  3GBQ A;  2ABL A;  2EGE A;  2J06 A;  3VRZ A;  1I0C A;  1W70 A;  2G6F X;  1MV0 B;  1NEB A;  2DL3 A;  2W0Z A;  1Y57 A;  1GCQ A;  1K1Z A;  4JZ4 A;  1WI7 A;  2GTO A;  5I22 A;  3M0Q A;  2FPD A;  2HSP A;  2MIO A;  4E6R A;  1WFW A;  2ESW A;  2O88 A;  4AFU C;  1K0S A;  2YDL A;  1V1C A;  1I07 A;  1MV3 A;  2KGT A;  4HCK A;  2F2W A;  3THK A;  1JU5 C;  2JMC A;  4RTZ A;  2AZS A;  2FEI A;  4OMN A;  3SEM A;  3VS3 A;  2DJQ A;  3PE0 A;  1UEC A;  2JM8 A;  2L3P A;  3FJ5 A;  1E7O A;  1ZSG A;  2DL4 A;  4OMO A;  3CQT A;  2BZ8 A;  1BB9 A;  1H92 A;  1FMK A;  3PVQ A;  2RF0 A;  3H0F A;  2PZ1 A;  1JO8 A;  4J9H A;  1SRL A;  3NMZ C;  1CKB A;  1SPK A;  2HCK A;  3NGP A;  2JT4 A;  1GL5 A;  2YUP A;  3M0U A;  4AFQ C;  1YP5 A;  2LJ0 A;  2CH4 A;  1E6G A;  1NLO C;  1K9A A;  4CC4 B;  2JMA A;  2J05 A;  4R0K A;  3H0H A;  2DX1 A;  4CC3 A;  1H3H A;  2LMJ A;  3M0R A;  2KNB B;  1W6X A;  1RLQ C;  1UHC A;  2D8H A;  2GBQ A;  4HVW A;  4OMM A;  2CH4 W;  2RQR A;  4QT7 A;  2KRM A;  3M0S A;  2KYB A;  4DEY A;  2LP5 A;  2RQW A;  2RPN A;  3LH5 A;  2DMO A;  2KE9 A;  1SHF A;  2B86 A;  3QWX X;  2DYB A;  2JS2 A;  2FPF A;  2CT3 A;  1NYG A;  3EG0 A;  2DL8 A;  3JV3 A;  2IIM A;  3EGU A;  1ARK A;  1WA7 A;  4Z8A A;  3ULR B;  2J7I A;  4AG2 C;  1AWX A;  1OOT A;  2EYZ A;  4GLM A;  2FPE A;  1T0J A;  2DBM A;  2D8J A;  2DBK A;  2W10 A;  1ZX6 A;  2K79 A;  5IHI A;  1A0N B;  1KSW A;  1KJW A;  2DRM A;  2YT6 A;  2MCN A;  1AOJ A;  4JJB A;  4RUG A;  1AWO A;  3VS5 A;  3NHN A;  2EQI A;  1ABO A;  4Z88 A;  3R6N A;  3U23 A;  2SRC A;  3PVL A;  3VRY A;  1CKA A;  2H8H A;  2VVK A;  2HDA A;  2JS0 A;  1MUZ A;  2O9V A;  1T3S A;  2KT1 A;  1UHF A;  2DVJ A;  2A36 A;  1K76 A;  4D8K A;  1AEY A;  1YWO A;  1BU1 A;  1JXM A;  2LJ1 A;  1K4U S;  1IO6 A;  4LNP A;  1UG1 A;  1BBZ A;  1AD5 A;  4HVU A;  3RBB B;  1B3Q A;  2V1Q A;  3TSW A;  5ECA A;  2A08 A;  2DRK A;  4F14 A;  2OAW A;  2DL5 A;  1QKX A;  1LCK A;  1M3A A;  2D0N A;  3H41 A;  2K2M A;  2VKN A;  4J9D A;  2DNU A;  1Z9Q A;  1KFZ A;  3EHQ A;  4JPB W;  1X69 A;  2EKH A;  2O31 A;  4WCI A;  1WLP B;  1ZBJ A;  4J9C A;  2CDT A;  1AVZ C;  1QKW A;  1M27 C;  3VS1 A;  4JJC A;  2ROL A;  2HEQ A;  1UGV A;  1AZG B;  4J9F A;  1H8K A;  1OPL A;  3EG1 A;  2YUN A;  2KRO A;  1PKS A;  1KIK A;  1HSQ A;  1AWJ A;  3M0P A;  2EVR A;  2BTT A;  1GBQ A;  4JJD A;  3TVT A;  1OV3 A;  3RNJ A;  1E6H A;  2GNC A;  2L2P A;  2M51 A;  4A63 B;  1SEM A;  1ZUK A;  4CC2 A;  1M8M A;  1RUW A;  1UE9 A;  2P4R A;  4J9E A;  1CSK A;  4AG1 C;  4X1V A;  3EG2 A;  3UF4 A;  3TSZ A;  2CSQ A;  2DE0 X;  1PRM C;  1NEG A;  2CT4 A;  2XMF A;  2JW4 A;  5FWB A;  2J6F A;  2O9S A;  1QLY A;  4RTT A;  1T3L A;  1ZUY A;  1NM7 A;  1YWP A;  1PKT A;  2KRN A;  5I11 A;  1ABQ A;  1WXB A;  1X2Q A;  2KYM A;  2K7A A;  4LUE A;  1JXO A;  1PRL C;  2CUD A;  2J6O A;  2K9G A;  2OI3 A;  3VS0 A;  2PNI A;  3UAT A;  4J9G A;  4HVV A;  2RMO A;  2YUQ A;  2JXB A;  3VS2 A;  4AFS C;  2O2O A;  4RTY A;  5IHN A;  2ED0 A;  4J9B A;  2AKL A;  1UFF A;  3I5R A;  2KXC A;  4IIO A;  1X6B A;  3I9Q A;  3UA6 A;  2KT8 A;  4JZ3 A;  4LN2 A;  1WX6 A;  2ENM A;  4D8D A;  4RTW A;  1Z9Z A;  2C0T A;  4HXJ A;  2V1R A;  2I0N A;  1RLP C;  2FG0 A;  2RNA A;  4IIM A;  1BK2 A;  4F17 A;  1WXT A;  1G2B A;  1NLP C;  2F2V A;  3UA7 A;  1GCQ C;  4ZNX A;  1WIE A;  2QDL A;  1NYF A;  1N5Z A;  1X43 A;  5IH2 A;  1T0H A;  3ZL7 C;  1VYV A;  2C0O A;  1AWW A;  2NWM A;  3I5S A;  2K3B A;  4M4Z A;  3REB B;  2L3S A;  1X6G A;  1AZE A;  1RI9 A;  2KRS A;  2X3W D;  1PHT A;  2M0Y A;  2L0A A;  3KFV A;  2LQW A;  2J6K A;  2KR3 A;  4ESR A;  1UTI A;  2NUZ A;  1OPK A;  2DL7 A;  2A37 A;  1M30 A;  2LCS A;  3H0I A;  1U06 A;  1SHG A;  2GQI A;  1VYT A;  2YSQ A;  1G83 A;  2GTJ A;  4RTX A;  2FRW A;  4RTV A;  2HBW A;  1Y0M A;  2EBP A;  1XOV A;  3VS4 A;  2X3X D;  3EHR A;  2RQU A;  1M3B A;  1FYN A;  1W1F A;  2RN8 A;  3IQL A;  3M0T A;  1VYU A;  2EYW A;  1QWE A;  3REA B;  4LUD A;  1GFD A;  2DIL A;  1QWF A;  2CSI A;  5IHK A;  1JEG A;  5GJV B;  1YN8 A;  1M3C A;  2KEA A;  2OJ2 A;  4FSS A;  2DF6 A;  2FRY A;  2RQT A;  2BZX A;  1NG2 A;  1UJ0 A;  2AKK A;  2ED1 A;  4OML A;  1UJY A;  1GRI A;  1S1N A;  2EYY A;  1PNJ A;  1UUE A;  2JTE A;  1HJD A;  5GJW B;  1GFC A;  1GBR A;  2AK5 A;  5L23 A;  2DM1 A;  1YCS B;  2ROT A;  1PWT A; 
#chains in the Genus database with same CATH topology
 3RUX A;  5KYX B;  2LCC A;  1SSH A;  3OSS C;  4DEX A;  4RCB A;  3X26 B;  5FW9 A;  3JB9 F;  5FWC A;  3PFS A;  1K9M C;  1KK7 A;  2LX7 A;  4EMH A;  4E7H A;  3R6O A;  4F7U F;  4ZN3 A;  2NUP A;  1TG0 A;  2K3Y A;  4KRT A;  1KD1 R;  3L2W A;  2P0P A;  4R55 A;  1EX4 A;  1YJN A;  2LQN A;  1LVK A;  1UEB A;  2X9H A;  3CPF A;  2D1X A;  1M1F A;  3KXT A;  1V76 A;  1WGS A;  1FXX A;  5IXB A;  1WXU A;  5A0D A;  5CQY A;  3VS6 A;  1BIB A;  1U3O A;  1I1J A;  2DO3 A;  4UC4 A;  1ZBX A;  2PVG B;  3QG1 A;  3MP8 A;  1OX8 A;  5IN1 A;  2EGC A;  4EPC A;  1ZUU A;  2ECZ A;  2MPX C;  1J3T A;  5A2Q E;  2E3I A;  2PU9 B;  4ORZ A;  1KD1 C;  5GAN f;  4GBQ A;  1RAI B;  3O5Z A;  2COZ A;  4M7A F;  1VQ7 T;  3X25 B;  1QVG A;  3G6E T;  4M75 B;  1TH7 A;  2RHU A;  3JCM V;  3OS5 A;  1WDX A;  3LGF A;  5GAO m;  5FU6 B;  2DA9 A;  2L8D A;  3ZBD A;  3P8D A;  2A28 A;  5CK9 A;  3LWH A;  2ABL A;  5IAY A;  1EZZ B;  2EGE A;  1W70 A;  3OY9 A;  1C0M A;  1NEB A;  2DL3 A;  2W0Z A;  1Y57 A;  1LOJ A;  1KQS P;  1MMG A;  1I5O B;  1Q95 G;  3P8B B;  4JZ4 A;  1WI7 A;  1M9S A;  4FU6 A;  2H3E B;  1OZ3 A;  4JUV A;  2ESW A;  4OB1 B;  3RMQ A;  1D0X A;  4NOY A;  4GY5 A;  5I2M A;  3EG9 A;  1D0Z A;  2M1H A;  3JCM W;  1MV3 A;  2KGT A;  4HCK A;  3QZ5 B;  2DXB A;  4PL6 A;  5J3B A;  5LJ5 e;  2JMC A;  4RTZ A;  2MYS A;  3I56 A;  2AZS A;  4MZM A;  2FEI A;  3PE0 A;  1M2V B;  4RMO A;  3EFO B;  1E7O A;  4LDW A;  1M2O A;  1ZSG A;  3QSU A;  2QTX A;  4C92 B;  2FB7 A;  1BB9 A;  2YWW A;  1H92 A;  4M7A E;  5KYU B;  1FMK A;  4DA4 A;  4L59 A;  5GAM d;  2F5K A;  1S72 Q;  3NMZ C;  2HCK A;  1GL5 A;  3M4G A;  2DXU A;  2OX7 A;  3VV0 A;  1Q81 U;  4MDW A;  1X6O A;  3HKS A;  4BUG A;  2O4X B;  1NLO C;  1UB4 A;  2QXF A;  2JMA A;  2M0O A;  3MEW A;  2LMJ A;  3OBY A;  2JVV A;  1O9S A;  2KNB B;  4ZGJ B;  1W6X A;  2K5F A;  2JTF A;  1PD0 A;  2GBQ A;  4HVW A;  1YIT T;  4DEY A;  2CP7 A;  2X4W A;  2DMO A;  1SHF A;  1X01 A;  2CZ0 B;  1YI2 Q;  4J6Y A;  4ZTF A;  3CBM A;  3LGL A;  4E7S A;  2HKN A;  2CT3 A;  2XIC A;  2IIM A;  4XAX B;  3ULR B;  4QKU A;  2FPE A;  2W10 A;  3CCU A;  2DBK A;  1ZX6 A;  3SB2 A;  1A0N B;  2NYS A;  5GAM f;  2MCN A;  4BDZ A;  4YTL A;  2M02 A;  2LQK A;  1FMW A;  1RL2 A;  3QKJ A;  2JTM A;  3NFC A;  3SWN A;  1W2B S;  5CKE A;  2CP6 A;  3O8V A;  2EQI A;  3RKX A;  1ABO A;  4Z88 A;  3CCV A;  2MWP A;  2LVM A;  2DTI A;  1IZ6 A;  3EGD B;  3VRY A;  2HL5 C;  2H8H A;  1N27 A;  3T9N A;  1YJW Q;  1MUZ A;  1KHI A;  4C8Q D;  5GMK l;  3OYM A;  2EAY A;  4C8Q C;  2A36 A;  1NBE B;  2HD0 A;  1WHG A;  1BU1 A;  4JRP A;  3CMA T;  3DLM A;  3PIO A;  2QK0 A;  5GAO q;  3WVE B;  3F70 A;  1VQ6 T;  2OAW A;  2DEU A;  3V8L A;  2K2M A;  3JB9 H;  2HMA A;  2O01 E;  4PJO E;  2DKG A;  1RAH B;  4M7D G;  3JCM g;  3CCS T;  1D0Y A;  4C8Q F;  4XTV A;  1XNI A;  1AVZ C;  3EGD A;  1Y96 A;  2QQB A;  2HEQ A;  1AZG B;  2E1H A;  2ZPB B;  1OPL A;  3EG1 A;  3S3N A;  4C0F A;  1AWJ A;  2QYZ A;  3M0P A;  2H3J A;  4C0D C;  2MMP A;  2BTT A;  3G71 Q;  4Q5W A;  3TVT A;  1RAG B;  2GCX A;  3M54 A;  1OV3 A;  1VQP A;  3L2R A;  1Q82 R;  2E10 A;  3BY7 A;  2PVD B;  4HT8 A;  1SEM A;  1ZUK A;  4CC2 A;  4F7U A;  1UE9 A;  5LJ3 j;  3MPU B;  4A4E A;  3NTK A;  3G4S A;  2CT4 A;  4M77 G;  4FW1 A;  3X20 B;  2K5I A;  5FWB A;  1S72 T;  1QLY A;  1M90 U;  1PKT A;  2KRN A;  1ABQ A;  1FX7 A;  1TS9 A;  5LJ5 d;  2NLU A;  2VYT A;  1JXO A;  3EFR A;  4XTX A;  5GAO p;  1VQO Q;  3N5B B;  1Q82 C;  3VS0 A;  4R56 A;  4J9G A;  2YUQ A;  3QBY A;  4AFS C;  4RTY A;  4ELZ C;  5LJ3 g;  1UFF A;  2P0K A;  3CCM A;  4XTU A;  1VQL A;  4LN2 A;  4M7A A;  1M1K U;  5D6X A;  2OAU A;  3OYH A;  5GAN 8;  4OF1 A;  3UDC A;  1QVF A;  3JCM Q;  1QP3 A;  2FL7 A;  4OB2 B;  3NTH A;  2FZK B;  4PFZ A;  4IIM A;  4OB3 B;  4F17 A;  1WXT A;  4M78 G;  4ZNX A;  2QDL A;  2ZZD A;  2KSS A;  1YFN A;  1X43 A;  3GOX A;  5AYF A;  5D7U A;  2QTV A;  3ZL7 C;  3MHX A;  1Q7Y R;  1QP2 A;  4M4Z A;  3HTR A;  3REB B;  4QW2 A;  1RI9 A;  2KRS A;  1Y07 A;  3OYD A;  2QA4 Q;  4JLI A;  2L0A A;  3KFV A;  2LQW A;  4ESR A;  2NUZ A;  1OPK A;  1M30 A;  4JS4 A;  2NUT A;  2FHD A;  3H0I A;  1U06 A;  2GQI A;  1VQ9 A;  2YSQ A;  4QQ6 A;  7AT1 B;  3PIP A;  1VQ4 A;  3GP8 A;  1M1K R;  3A8H B;  2EBP A;  2VC8 A;  4C0Z A;  3JB9 J;  3EHR A;  1ZA2 B;  3E19 A;  1FYN A;  3L42 A;  3JCM h;  3CCE Q;  2QGF B;  4PJO G;  1QWE A;  1Q7Y C;  1YJW T;  4LUD A;  2CP0 A;  3QII A;  1M3C A;  3I56 T;  5KYN A;  2KEA A;  2EFI A;  3M53 A;  4QVD A;  2CKK A;  1VQ5 T;  1UJ0 A;  5CCA A;  1V29 B;  1X75 C;  1M1K C;  1PNJ A;  2DM1 A;  3X28 B;  4DBR A;  2ROT A;  1PWT A;  3KBG A;  1G8X A;  2HBP A;  4E47 A;  1YIJ A;  1RAE B;  2ZCF B;  3V7S A;  1O75 A;  2RQV A;  3OW2 A;  4Y92 A;  4X9D A;  4OMP A;  4E7J A;  3A5Z B;  2EQJ A;  3CD6 A;  2LT4 A;  1WYX A;  3EH2 A;  3SDZ A;  3JCM e;  1IGU A;  1X2K A;  2CRE A;  4LE9 A;  2LZ6 B;  3MET A;  3CCQ Q;  3OYC A;  1BI2 A;  2LRQ A;  3DLL A;  3EG3 A;  1M4Z A;  3VKI A;  3CBO A;  5LJ3 h;  3I55 Q;  4J83 A;  1HD3 A;  3FC3 A;  1MND A;  1TUC A;  4GLK A;  3FB9 A;  2LJ3 A;  2FZC B;  2HZY A;  5CKF A;  2LNH B;  5DY9 A;  3ASK A;  5HY6 A;  1KC8 R;  3PMI A;  3SWN C;  4E7Z A;  2LQ8 A;  4ATO A;  1B34 B;  2MOX A;  4J9I A;  4NS5 A;  1AHJ B;  1WHJ A;  3LW5 E;  2F2X A;  1HK9 A;  5GMK m;  2XU8 A;  3UPU A;  3CCU T;  5EC7 A;  4C8Q B;  3CPW P;  1MMN A;  1X27 A;  1VQO T;  3CC2 A;  1YNZ A;  4M75 E;  2CUB A;  1VQK A;  4KUD K;  2MAM A;  2AZV A;  2XD0 A;  2F1L A;  2IPO B;  4CC7 A;  2VXE A;  1QCO A;  1KC8 C;  2G6F X;  2RJD A;  5CO7 A;  5J39 A;  5GMK e;  1GCQ A;  2AT1 B;  4ELY C;  1YJ9 T;  2GTO A;  5I22 A;  1OZ2 A;  5LJ3 e;  1IXD A;  3HRT A;  4E6R A;  1TOV A;  1VQ8 Q;  2DXT A;  4AFU C;  1RAD B;  1K0S A;  2E3H A;  4J6X A;  4C0D B;  5IT9 E;  1V1C A;  2NUP B;  1JU5 C;  1N9S A;  4C5H A;  2VV5 A;  2P0Q A;  3M56 A;  3CC7 A;  4OMN A;  4WF2 A;  2QEX T;  1Y7X A;  3RES A;  3E2U A;  2DL4 A;  4C92 E;  3EAE A;  1QVF S;  4OB0 B;  3PVQ A;  2RF0 A;  4Y28 E;  4J6W A;  1SRL A;  1CKB A;  1SPK A;  1BI3 A;  1R77 A;  2YUP A;  2D0Q B;  3CCE T;  1W4S A;  1YP5 A;  2LJ0 A;  2E12 A;  4CC4 B;  3OYY A;  4XTZ A;  3H0H A;  2VAS A;  3UWN A;  4CC3 A;  1H3H A;  3CCL A;  4RKU E;  5HK0 A;  2BE9 B;  4KH0 B;  1UHC A;  4VUB A;  4M7A D;  4E7L A;  4M7A C;  1BCO A;  1FWZ A;  4QT7 A;  1Q86 R;  2KRM A;  4BAC A;  3M0S A;  1AT1 B;  3A8M B;  2RQW A;  5AT1 B;  1KQS A;  2PVO B;  4FT2 A;  1G3W A;  2V8I A;  4M7D F;  1IRX A;  1VOM A;  1YCY A;  3VYH B;  4FYX B;  3GNF B;  1NYG A;  2CZ7 B;  4IUV A;  1VQN A;  3JV3 A;  1ARK A;  5LJ5 h;  3H8Z A;  2A0F B;  1N9R A;  2EYZ A;  4GLM A;  2X4Y A;  4F04 B;  5IHI A;  4JJN K;  3EG9 B;  2DRM A;  4LD9 K;  4X9C A;  5A0G A;  3CMA Q;  2RI5 A;  3CCQ T;  2RJC A;  4JJB A;  3FEO A;  3D7S B;  1Q86 C;  1VQ6 Q;  3I55 T;  4M75 G;  3QJY A;  2CYZ B;  2FYK A;  4ZGE B;  5DLO A;  4AMC A;  3BW1 A;  2SRC A;  2DPP B;  3PVL A;  3MEU A;  3CCS Q;  1QW1 A;  4NL3 A;  4HCB A;  4M77 F;  4L6V 5;  1WHM A;  2HDA A;  2JS0 A;  2RHY A;  3TQ7 P;  1QMC A;  3M4Y A;  4QVZ A;  4DOW A;  3JCM d;  3PNW C;  3OW2 S;  5GAO n;  3QDR B;  2DVJ A;  2LNV A;  4LDU A;  3GIB A;  4XU1 A;  1JXM A;  4EMG A;  2AIR B;  4LNP A;  1UG1 A;  4HVU A;  1B3Q A;  3L2Q A;  4F14 A;  1KQ2 A;  2DIG A;  4QVC A;  4M7D E;  2HQX A;  3MP1 A;  1PSE A;  3DB4 A;  2RM4 A;  4JLG A;  3S6W A;  3HRU A;  3JCM X;  4WCI A;  2AHJ B;  1ZBJ A;  4LDY A;  4IUU A;  3S3M A;  1QKW A;  4OMF B;  1BI0 A;  3H9N A;  2E4H A;  4O5V A;  2OTJ T;  3QXE B;  3LH0 A;  4J9F A;  4C92 G;  5GAN 6;  4PJM A;  1VQ8 T;  1WHK A;  4M78 F;  2KRO A;  2VGN A;  1PKS A;  3OMC A;  3FJP A;  2ZPI B;  2HKQ B;  2EVR A;  5GAN j;  1B7T A;  4PFO A;  4XQ3 A;  2Y90 A;  1VQM A;  3RNJ A;  1OU8 A;  4JRQ A;  1JJ2 P;  4A54 A;  2GNC A;  4A63 B;  2EQK A;  3FRN A;  1RUW A;  5FU7 C;  4J9E A;  4BI8 B;  4PJO D;  4M77 E;  1CSK A;  4X1V A;  4PJO C;  3UF4 A;  3TSZ A;  2GQV A;  4KGV B;  2M9U A;  1G3Y A;  3SWN B;  5LJ3 d;  1YIJ T;  3CME A;  2JW4 A;  4J5Y A;  5KCO A;  1X2Q A;  5GAN g;  2K7A A;  4LUE A;  2WSF E;  3G71 A;  1VIF A;  2COY A;  4ZGD B;  4Y91 A;  2CUD A;  1QCN A;  4PJO F;  2I2L A;  4HVV A;  2RMO A;  4ZTJ A;  2O2O A;  1XJW B;  4BB7 A;  2VUB A;  1K73 U;  2CGH A;  2KXC A;  3I9Q A;  3UA6 A;  4JZ3 A;  3OYG A;  1Q81 R;  1WX6 A;  1YHQ T;  1RAF B;  1Z9Z A;  2DTO A;  3VUB A;  2ATC B;  3H6Z A;  4M78 E;  1K8A U;  2I0N A;  3CXC A;  1RLP C;  5A0L A;  3EH1 A;  1NJI U;  1G3T A;  2RNA A;  1BK2 A;  4OVA A;  1G2B A;  1NLP C;  2F2V A;  3CCJ A;  1GCQ C;  3NTI A;  1WIE A;  2KQW A;  1M8V A;  3CC2 T;  5IH2 A;  1Y96 B;  2DD4 A;  2XK0 A;  3RKW A;  1ZHI A;  2XDD A;  2C0O A;  2DYI A;  4QQD A;  3RDV A;  2BE7 D;  3I5S A;  2JJ9 A;  2E64 A;  1Q81 C;  2X3W D;  4II1 A;  3I56 Q;  2Y4Y A;  4BE1 A;  3ER0 A;  4PJN A;  2A37 A;  2DXC A;  1R0B G;  4DOV A;  4TVR A;  1K73 R;  1VQ5 Q;  4F7U B;  1SHG A;  1VYT A;  4FW2 A;  3HSB A;  1M1G A;  1RAA B;  5EG2 A;  1G83 A;  4RTX A;  2PUO B;  1XOV A;  2X3X D;  2JN0 A;  3CXC P;  4PKC C;  2COW A;  5D6W A;  1KQS S;  4KGZ B;  1M3B A;  2RN8 A;  3OQ5 A;  4A53 A;  1XTD A;  2EYW A;  3V8K A;  3V7C A;  1D09 B;  1D1A A;  2CSI A;  2MWO A;  5CKH A;  3QJ6 A;  3CC7 T;  2YHT A;  3S3O A;  2FVU A;  2FRY A;  5KYY A;  3HL8 A;  4KUI A;  5GMK j;  1K73 C;  4IUP A;  1UGR B;  1QVG S;  4OML A;  4DBF A;  3MEA A;  4B9X A;  4M7A B;  1UUE A;  4A4G A;  2JTE A;  3JCM P;  2RK1 A;  1GFC A;  5L23 A;  4LD6 A;  5CIU A;  1YCS B;  1ACM B;  2MK5 A;  1EFN A;  3I35 A;  1PSF A;  1ZA1 B;  1ZSZ A;  3QWY A;  3E9F A;  2C0I A;  1K0X A;  2LT1 A;  1JQQ A;  4M7D A;  1ZLM A;  2VWF A;  1QCF A;  3CCU Q;  1YJN T;  3A98 A;  3CCL T;  1I4K 1;  2GGR A;  2L3Q A;  3AHU A;  1U5S A;  1FMV A;  4K11 A;  4OP0 A;  2FO0 A;  1OQK A;  4HT9 A;  1KQ1 A;  2HNI A;  5GAN 2;  2HQH A;  5IXF A;  2MF2 A;  4O6J A;  2NUT B;  3CC4 A;  3INZ A;  2QQ9 A;  3VUZ A;  2YUO A;  5CQX A;  2R5M A;  2E5Q A;  4Z89 A;  1D1C A;  1D3B B;  3CBP A;  2RA2 A;  1YJ9 Q;  1VQN T;  3MO8 A;  2OTL A;  4NL2 A;  4RTU A;  1TUG B;  5DLQ E;  2K6D A;  2CZ6 B;  2EGA A;  3M58 A;  3LWI A;  2SEM A;  3NPF A;  1WZO A;  1VQ7 A;  3PT9 A;  4M77 A;  3G6E A;  2EYX A;  4BI3 A;  1M90 R;  1P92 A;  2R5A A;  3A8O B;  3P8H A;  2K5L A;  3SHW A;  2RHI A;  2E5K A;  2QAZ A;  1PD1 A;  2K4Y A;  1BI1 A;  2QEX Q;  3VRZ A;  1UGQ B;  5GAN e;  2RI3 A;  1MV0 B;  2L89 A;  2RHZ A;  2RJE A;  3Q1J A;  1RAC B;  5LJ5 f;  1TXQ A;  1K1Z A;  1N6A A;  2GF7 A;  2DER A;  3M0Q A;  1D3B A;  2RHX A;  4L5G A;  5L8R E;  2HSP A;  4PJL A;  3OS0 A;  1IHW A;  5D6Y A;  4XU0 A;  3RER A;  2G3R A;  4M75 D;  4B9W A;  1M90 C;  4M75 C;  2DVE A;  2ZAE A;  1DJ7 B;  1I07 A;  3CCR A;  6AT1 B;  1TSF A;  2F2W A;  3THK A;  1VQP Q;  3MJX A;  1N8R U;  4FT4 A;  2XI9 A;  4JRK A;  4M78 A;  3SEM A;  3VS3 A;  1UEC A;  2JM8 A;  3FJ5 A;  2CS7 A;  4PJO B;  4QQG A;  2KVQ G;  2M16 A;  2D9T A;  3E1S A;  4N4G A;  2LX9 A;  4M75 F;  3ZFJ A;  3H0F A;  2WSC E;  3NGP A;  2EQM A;  2JT4 A;  3G7Z A;  4ANJ A;  2CH4 A;  1IGQ A;  4EMK A;  1E6G A;  3CPW A;  1VQM T;  1K9A A;  4PLI A;  3PMT A;  4R0K A;  2DX1 A;  1F1B B;  3L2Z A;  4OGE A;  5GMK h;  4C92 D;  4FIB A;  4PJO A;  1MHN A;  3HRS A;  4C92 C;  2D8H A;  2HQE A;  4OMM A;  4PNO A;  3JRZ A;  4Z02 A;  1YIT A;  4BD3 A;  2LP5 A;  2RPN A;  3QO3 A;  3QWX X;  4PFP A;  4ZN1 A;  2DYB A;  2HL3 A;  3MP6 A;  2FPF A;  5M9O A;  3EG0 A;  2DL8 A;  4IUQ A;  3EGU A;  4Z8A A;  1LPL A;  4FYY B;  4C92 F;  4AG2 C;  1AWX A;  1T0J A;  2DBM A;  3L2U A;  2EJG A;  1KSW A;  3ME9 A;  1VUB A;  2YT6 A;  2DZ9 A;  1N8R C;  2Z0W A;  3FLG A;  1AOJ A;  1WHH A;  4RUG A;  3VJP A;  3WXM B;  5FRO A;  1VQ9 Q;  1VQ4 Q;  1K9M U;  3R6N A;  3J7A F;  2DK3 A;  3CCV T;  3GF5 A;  2E65 A;  2RH2 A;  3U23 A;  4JDS A;  1CKA A;  2RK2 A;  4E7K A;  2VVK A;  1D1B A;  3EFS A;  5KH6 A;  2HAX A;  3JCM b;  2PQW A;  2O9V A;  5GMK i;  2OTJ Q;  1NZ9 A;  2DD5 A;  5FLX E;  4D8K A;  4J7F A;  3M59 A;  1YWO A;  1AEY A;  2F5T X;  3A8G B;  2LJ1 A;  1K4U S;  5GAN 5;  2D6F A;  1BBZ A;  1AD5 A;  3RBB B;  2V1Q A;  3OYI A;  4C5E A;  1M3A A;  3H41 A;  2QAS A;  2DNU A;  2EJF A;  4PJJ A;  5HK3 A;  1Z9Q A;  1KFZ A;  4JPB W;  2EKH A;  2O31 A;  4MZT A;  4BY6 C;  1KD1 U;  4C5G A;  2CDT A;  1YIJ Q;  3M55 A;  3QDF A;  2EKO A;  4FYV B;  2C06 A;  2ROL A;  1I81 A;  5KYW A;  1UGV A;  5CVI A;  2LC4 A;  3M5A A;  1H8K A;  4JS5 A;  4KH1 B;  1UGS B;  2YUN A;  4DBH A;  1KIK A;  3EGX A;  1QQJ A;  1ZSZ C;  3CD6 Q;  4JJD A;  1VQP T;  3L2V A;  4M7D D;  3URG A;  2RB6 A;  2M51 A;  5GAN d;  1PM3 A;  4M7D C;  3BFM A;  2P4R A;  4A4H A;  3QPH A;  4WTO B;  1XQH A;  2BIV A;  2WAC A;  4XU3 A;  1YHQ Q;  1BKB A;  2WSE E;  2CSQ A;  2DE0 X;  3G4S T;  2X51 A;  1NEG A;  4IUR A;  2XMF A;  1NPP A;  2K3X A;  1S72 A;  2O9S A;  1JBM A;  1T3L A;  2LTO A;  2LCL A;  1ZUY A;  3BE3 A;  1YWP A;  2ZPH B;  3TEE A;  1WXB A;  3C94 A;  2KYM A;  3OS1 A;  2XDB A;  3CC2 Q;  1PRL C;  2K9G A;  2OI3 A;  2PNI A;  4DQ2 A;  3UAT A;  4AT1 B;  2QQR A;  1VQK Q;  2JXB A;  1SKU B;  4J9B A;  2AKL A;  3I5R A;  2EIF A;  3CCM T;  1X6B A;  4M77 D;  1W2B P;  1VQL T;  3CEY A;  4LDV A;  3LLR A;  4M77 C;  3CC4 T;  4D8D A;  3DB3 A;  5KE3 A;  3UT1 A;  1PG5 B;  5I2S A;  4RTW A;  3ZEH A;  4HXJ A;  1RI0 A;  3AT1 B;  2RO0 A;  5KYX A;  3VYG A;  1ZQ1 A;  1WQW A;  2OTL T;  2FG0 A;  3OYE A;  4BI4 A;  4ME7 A;  3SFM A;  1U1T A;  3C95 A;  1YI2 A;  3C4S A;  2VGM A;  3A8L B;  1NYF A;  4N0A C;  1N5Z A;  1WJS A;  4OGC A;  1T0H A;  2YRC A;  2ZPG B;  5KCH A;  2K3B A;  1UGP B;  1X6G A;  3OB9 A;  3CPW S;  3CC7 Q;  1PHT A;  2LDM A;  2M0Y A;  3OYF A;  2J6K A;  1JJ2 A;  1UTI A;  4J8O A;  2DL7 A;  4J7I A;  2IVW A;  3JSC A;  1MNE A;  4M78 D;  4F7U E;  1U1S A;  3E9G A;  4M78 C;  2QQS A;  3HP9 A;  1VQ9 T;  1VQ4 T;  2GTJ A;  2FRW A;  4XTY A;  2HBW A;  1Y0M A;  3VS4 A;  2FZG B;  4XTW A;  4MZP A;  1W1F A;  3IQL A;  1YJW A;  2F69 A;  2DIL A;  3CCR T;  1QWF A;  4M75 A;  5IHK A;  1JEG A;  2R57 A;  1QVG P;  1YN8 A;  5GAN 7;  2OJ2 A;  4FSS A;  2DF6 A;  5LL6 S;  2L5Q A;  4EMK C;  1YJN Q;  1U8R A;  3CCL Q;  4IKF A;  2RD1 A;  1VQ5 A;  1NG2 A;  2XKO C;  2AKK A;  3SD4 A;  4C0G A;  2XID A;  4P5N A;  1UJY A;  1GRI A;  1SG5 A;  1S1N A;  3HPW A;  2DET A;  1HJD A;  3OYL A;  2AK5 A;  1NE8 A;  3HHT B;  3JCM f;  1AWW A;  2XHC A;  3PTA A;  1TUD A;  2YLB A;  5HCK A;  4FCY A;  2QGG A;  3OYJ A;  2CP5 A;  2KI7 A;  2YRV A;  4FL6 A;  4OMQ A;  2EW3 A;  1VQN Q;  4PK4 A;  1WJR A;  5CKD A;  2DZC A;  2PTK A;  3CD6 T;  1OEB A;  1M2V A;  3C0C A;  4CRI A;  3EFO A;  4AFZ C;  1H3Z A;  3GLX A;  4EIK A;  4DBQ A;  3RIR A;  4C92 A;  5DM7 R;  5KYU A;  1UDL A;  1TWB A;  5CR2 A;  9ATC B;  1VA7 A;  4F16 A;  2KBT A;  4LDX A;  2QG9 B;  2KK4 A;  1Y71 A;  1SRM A;  2O4X A;  3VS7 A;  2EPD A;  3M57 A;  2JM9 A;  2DLP A;  1VQO A;  1VIE A;  1GCP A;  2KXD A;  1VQK T;  2BZY A;  2P84 A;  3DKM A;  1B07 A;  5LJ3 f;  4RG8 A;  3TRE A;  5KYY B;  3GBQ A;  2J06 A;  3BDL A;  5KE2 A;  1I8F A;  1RAB B;  3WVD B;  2X4X A;  1I0C A;  1G5V A;  4BY6 B;  3JB9 G;  1YJ9 A;  4BE0 A;  1PCX A;  2JOY A;  1LNX A;  2FPD A;  2RJF A;  1Q82 U;  4IUT A;  4F7U G;  4X34 A;  1OI1 A;  2ZGW A;  2MIO A;  1WFW A;  2O88 A;  1K8A R;  1ZSZ B;  2EYQ A;  4A4K A;  2HSE B;  8ATC B;  1NJI R;  2YDL A;  2L3R A;  1VQM Q;  1QVP A;  3FDR A;  4M7D B;  1WHL A;  3J81 E;  2ZPE B;  2QA4 A;  1WJQ A;  2DJQ A;  2QEX A;  2GFU A;  2L3P A;  2A3L A;  5GAM j;  4OMO A;  3M9Q A;  3CQT A;  3X24 B;  2BZ8 A;  2VB6 A;  1C6V X;  3CME Q;  4HCC A;  5C6S A;  2PZ1 A;  3L1A A;  1JO8 A;  4J9H A;  4KBM B;  1K8A C;  4M7A G;  1BCM A;  3M0U A;  3CCE A;  1NJI C;  1MMD A;  4AFQ C;  3LYI A;  2V8J A;  1KG1 A;  3LX7 A;  8AT1 B;  1G3S A;  2KAF A;  2J05 A;  2DAQ A;  1EIF A;  3C12 A;  3TU4 K;  1R0C B;  4M77 B;  5GAN h;  3M0R A;  5FRM A;  2X35 A;  5GAM g;  3QUI A;  1JJ2 S;  4A4F A;  3JAM E;  4RCC A;  1RLQ C;  1IHV A;  5C0M A;  2A7Y A;  5HKC A;  3TCJ A;  2DIQ A;  1JRI A;  1LJO A;  2CH4 W;  2RQR A;  4MMK A;  2KYB A;  1Q7Y U;  1OYX A;  4MML A;  3LH5 A;  2KE9 A;  2B86 A;  2P4T A;  3CCJ Q;  3CCV Q;  4KT0 E;  2YXY A;  1MGQ A;  4N4H A;  2JS2 A;  4HCZ A;  3V7R A;  1BYM A;  3HFO A;  1SSF A;  1MMA A;  1GXI E;  1WA7 A;  3RR6 A;  2J7I A;  2E6N A;  1OOT A;  4C8Q E;  2D8J A;  2K79 A;  1NPR A;  3QZ9 B;  3JCM J;  2QQA A;  1KJW A;  3CCQ A;  2E6Z A;  3OBW A;  5GAN 3;  5FRN A;  2ZPF B;  4M78 B;  2KDS A;  1AWO A;  4XU2 A;  3VS5 A;  3I55 A;  3NHN A;  4CI0 C;  1H64 1;  1YI2 T;  4FSX A;  5CKB A;  4FYW B;  2CP2 A;  4N0A A;  4FM4 B;  2R58 A;  4PLL A;  1T3S A;  2KT1 A;  2QI2 A;  5I21 A;  1UHF A;  1PC0 A;  1K76 A;  2X4J A;  2JUF A;  1I5L A;  4EMK B;  1IO6 A;  4E7I A;  5GAO l;  3TSW A;  5ECA A;  2A08 A;  2DRK A;  5FU6 C;  2DEQ A;  2DL5 A;  3RKY A;  1QKX A;  1LCK A;  2D0N A;  3OSV A;  2VKN A;  4J9D A;  5FU7 B;  3OYK A;  1QVF P;  4XK8 E;  2BUD A;  3EHQ A;  1X69 A;  1WLP B;  1IB8 A;  3G4S Q;  2V26 A;  2EQU A;  4J9C A;  4V2S A;  2XDP A;  1YBY A;  1M27 C;  3VS1 A;  4JJC A;  3MCA B;  2RI2 A;  2OTJ A;  3CXC S;  1VQ8 A;  2MI6 A;  1HSQ A;  4B6M A;  1GBQ A;  3OYB A;  2EJ9 A;  1E6H A;  2L2P A;  4LXC A;  1KC8 U;  2GFA A;  1M8M A;  3BDU A;  3CCM Q;  5GAN 4;  4AG1 C;  1VQL Q;  3EG2 A;  1OUL A;  3CC4 Q;  3QHS A;  1N8R R;  1PRM C;  5GAM h;  3MEV A;  3HFN A;  3CME T;  2E70 A;  2PUK B;  2J6F A;  5LJ5 j;  2OTL Q;  4RTT A;  1TU0 B;  1NM7 A;  2VXF A;  3FIF A;  3OMG A;  5I11 A;  1HXD A;  2JNG A;  4N4I A;  2YLC A;  3G71 T;  1VQ7 Q;  2J6O A;  1SF9 A;  3QYG B;  2QDY B;  3G6E Q;  2KMT A;  1KHC A;  3VS2 A;  3RMS A;  4JRI A;  2ED0 A;  5IHN A;  4IIO A;  5CAI A;  2Y4X A;  4BE2 A;  2KT8 A;  2K2V A;  1C1A A;  2ENM A;  1YHQ A;  2C0T A;  2V1R A;  5GAO r;  2DJZ A;  4KGX B;  4C8Q G;  3JB9 I;  3OS2 A;  3VU3 C;  2IG0 A;  5LJ5 g;  2B8A A;  4D6W A;  1TTH B;  2CZ1 B;  3CCJ T;  3UA7 A;  3OW2 P;  2DFU A;  3PGG A;  5GAM e;  1VYV A;  5KYW B;  2CP3 A;  2NWM A;  2BKD N;  2DTH A;  1HYO A;  2XG8 D;  3J80 E;  4HKE A;  3CCR Q;  2L3S A;  1AZE A;  3EGX B;  1WQ7 A;  4MDX A;  2KR3 A;  3CMA A;  4BDY A;  1R8O B;  2LCS A;  1VQ6 A;  1JB0 E;  1M5Q 1;  1OX9 A;  1OU9 A;  3MKD A;  2K57 A;  4RTV A;  1B34 A;  2V8K A;  5J26 A;  3V8J A;  3GPL A;  4E2F B;  3CCS A;  3QYH B;  2RQU A;  3KUF A;  3OYA A;  4RG2 A;  4C8Q A;  3M0T A;  1VYU A;  3OYN A;  3JCM c;  3REA B;  1GFD A;  2YRD A;  1K9M R;  2EWN A;  1WPY A;  2E41 A;  4C5I A;  5GJV B;  1WNL A;  3JB9 D;  2QA4 T;  3GNG A;  3A1P A;  2KY9 A;  4KUL A;  1Q86 U;  2JZ2 A;  3OA6 A;  4EDU A;  2RQT A;  3G1J A;  2BZX A;  2ED1 A;  1W2B A;  4HA8 A;  2EYY A;  1BIA A;  5GJW B;  1YIT Q;  1GBR A;  1IRE B; 
#chains in the Genus database with same CATH homology
 1EFN A;  1TUD A;  3I35 A;  5HCK A;  1SSH A;  4DEX A;  5FW9 A;  5FWC A;  3QWY A;  2RQV A;  4OMQ A;  2EW3 A;  2C0I A;  2LX7 A;  4Y92 A;  1TG0 A;  4OMP A;  1K0X A;  4KRT A;  1JQQ A;  1ZLM A;  2VWF A;  1QCF A;  3A98 A;  2PTK A;  2LQN A;  1WYX A;  2GGR A;  1OEB A;  2L3Q A;  2D1X A;  1U5S A;  1X2K A;  2CRE A;  3C0C A;  2LZ6 B;  4LE9 A;  4AFZ C;  4K11 A;  5IXB A;  1WXU A;  4EIK A;  2FO0 A;  3EG3 A;  3VS6 A;  1U3O A;  1I1J A;  1HD3 A;  5IXF A;  1UDL A;  1TUC A;  2LJ3 A;  2LNH B;  2EGC A;  1VA7 A;  2YUO A;  1ZUU A;  2ECZ A;  4Z89 A;  4F16 A;  1J3T A;  2KBT A;  2MOX A;  4J9I A;  2F2X A;  4RTU A;  4ORZ A;  1SRM A;  3VS7 A;  4GBQ A;  5EC7 A;  2K6D A;  2EGA A;  1X27 A;  2EPD A;  2JM9 A;  3O5Z A;  2DLP A;  1YNZ A;  2SEM A;  3NPF A;  1GCP A;  2KXD A;  2CUB A;  2EYX A;  2BZY A;  1WDX A;  1B07 A;  2AZV A;  2DA9 A;  3SHW A;  2A28 A;  4CC7 A;  2E5K A;  3GBQ A;  2ABL A;  2EGE A;  2J06 A;  3VRZ A;  1I0C A;  1W70 A;  2G6F X;  1MV0 B;  1NEB A;  2DL3 A;  2W0Z A;  1Y57 A;  1GCQ A;  1K1Z A;  4JZ4 A;  1WI7 A;  2GTO A;  5I22 A;  3M0Q A;  2FPD A;  2HSP A;  2MIO A;  4E6R A;  1WFW A;  2ESW A;  2O88 A;  4AFU C;  1K0S A;  2YDL A;  1V1C A;  1I07 A;  1MV3 A;  2KGT A;  4HCK A;  2F2W A;  3THK A;  1JU5 C;  2JMC A;  4RTZ A;  2AZS A;  2FEI A;  4OMN A;  3SEM A;  3VS3 A;  2DJQ A;  3PE0 A;  1UEC A;  2JM8 A;  2L3P A;  3FJ5 A;  1E7O A;  1ZSG A;  2DL4 A;  4OMO A;  3CQT A;  2BZ8 A;  1BB9 A;  1H92 A;  1FMK A;  3PVQ A;  2RF0 A;  3H0F A;  2PZ1 A;  1JO8 A;  4J9H A;  1SRL A;  3NMZ C;  1CKB A;  1SPK A;  2HCK A;  3NGP A;  2JT4 A;  1GL5 A;  2YUP A;  3M0U A;  4AFQ C;  1YP5 A;  2LJ0 A;  2CH4 A;  1E6G A;  1NLO C;  1K9A A;  4CC4 B;  2JMA A;  2J05 A;  4R0K A;  3H0H A;  2DX1 A;  4CC3 A;  1H3H A;  2LMJ A;  3M0R A;  2KNB B;  1W6X A;  1RLQ C;  1UHC A;  2D8H A;  2GBQ A;  4HVW A;  4OMM A;  2CH4 W;  2RQR A;  4QT7 A;  2KRM A;  3M0S A;  2KYB A;  4DEY A;  2LP5 A;  2RQW A;  2RPN A;  3LH5 A;  2DMO A;  2KE9 A;  1SHF A;  2B86 A;  3QWX X;  2DYB A;  2JS2 A;  2FPF A;  2CT3 A;  1NYG A;  3EG0 A;  2DL8 A;  3JV3 A;  2IIM A;  3EGU A;  1ARK A;  1WA7 A;  4Z8A A;  3ULR B;  2J7I A;  4AG2 C;  1AWX A;  1OOT A;  2EYZ A;  4GLM A;  2FPE A;  1T0J A;  2DBM A;  2D8J A;  2DBK A;  2W10 A;  1ZX6 A;  2K79 A;  5IHI A;  1A0N B;  1KSW A;  1KJW A;  2DRM A;  2YT6 A;  2MCN A;  1AOJ A;  4JJB A;  4RUG A;  1AWO A;  3VS5 A;  3NHN A;  2EQI A;  1ABO A;  4Z88 A;  3R6N A;  3U23 A;  2SRC A;  3PVL A;  3VRY A;  1CKA A;  2H8H A;  2VVK A;  2HDA A;  2JS0 A;  1MUZ A;  2O9V A;  1T3S A;  2KT1 A;  1UHF A;  2DVJ A;  2A36 A;  1K76 A;  4D8K A;  1AEY A;  1YWO A;  1BU1 A;  1JXM A;  2LJ1 A;  1K4U S;  1IO6 A;  4LNP A;  1UG1 A;  1BBZ A;  1AD5 A;  4HVU A;  3RBB B;  1B3Q A;  2V1Q A;  3TSW A;  5ECA A;  2A08 A;  2DRK A;  4F14 A;  2OAW A;  2DL5 A;  1QKX A;  1LCK A;  1M3A A;  2D0N A;  3H41 A;  2K2M A;  2VKN A;  4J9D A;  2DNU A;  1Z9Q A;  1KFZ A;  3EHQ A;  4JPB W;  1X69 A;  2EKH A;  2O31 A;  4WCI A;  1WLP B;  1ZBJ A;  4J9C A;  2CDT A;  1AVZ C;  1QKW A;  1M27 C;  3VS1 A;  4JJC A;  2ROL A;  2HEQ A;  1UGV A;  1AZG B;  4J9F A;  1H8K A;  1OPL A;  3EG1 A;  2YUN A;  2KRO A;  1PKS A;  1KIK A;  1HSQ A;  1AWJ A;  3M0P A;  2EVR A;  2BTT A;  1GBQ A;  4JJD A;  3TVT A;  1OV3 A;  3RNJ A;  1E6H A;  2GNC A;  2L2P A;  2M51 A;  4A63 B;  1SEM A;  1ZUK A;  4CC2 A;  1M8M A;  1RUW A;  1UE9 A;  2P4R A;  4J9E A;  1CSK A;  4AG1 C;  4X1V A;  3EG2 A;  3UF4 A;  3TSZ A;  2CSQ A;  2DE0 X;  1PRM C;  1NEG A;  2CT4 A;  2XMF A;  2JW4 A;  5FWB A;  2J6F A;  2O9S A;  1QLY A;  4RTT A;  1T3L A;  1ZUY A;  1NM7 A;  1YWP A;  1PKT A;  2KRN A;  5I11 A;  1ABQ A;  1WXB A;  1X2Q A;  2KYM A;  2K7A A;  4LUE A;  1JXO A;  1PRL C;  2CUD A;  2J6O A;  2K9G A;  2OI3 A;  3VS0 A;  2PNI A;  3UAT A;  4J9G A;  4HVV A;  2RMO A;  2YUQ A;  2JXB A;  3VS2 A;  4AFS C;  2O2O A;  4RTY A;  5IHN A;  2ED0 A;  4J9B A;  2AKL A;  1UFF A;  3I5R A;  2KXC A;  4IIO A;  1X6B A;  3I9Q A;  3UA6 A;  2KT8 A;  4JZ3 A;  4LN2 A;  1WX6 A;  2ENM A;  4D8D A;  4RTW A;  1Z9Z A;  2C0T A;  4HXJ A;  2V1R A;  2I0N A;  1RLP C;  2FG0 A;  2RNA A;  4IIM A;  1BK2 A;  4F17 A;  1WXT A;  1G2B A;  1NLP C;  2F2V A;  3UA7 A;  1GCQ C;  4ZNX A;  1WIE A;  2QDL A;  1NYF A;  1N5Z A;  1X43 A;  5IH2 A;  1T0H A;  3ZL7 C;  1VYV A;  2C0O A;  1AWW A;  2NWM A;  3I5S A;  2K3B A;  4M4Z A;  3REB B;  2L3S A;  1X6G A;  1AZE A;  1RI9 A;  2KRS A;  2X3W D;  1PHT A;  2M0Y A;  2L0A A;  3KFV A;  2LQW A;  2J6K A;  2KR3 A;  4ESR A;  1UTI A;  2NUZ A;  1OPK A;  2DL7 A;  2A37 A;  1M30 A;  2LCS A;  3H0I A;  1U06 A;  1SHG A;  2GQI A;  1VYT A;  2YSQ A;  1G83 A;  2GTJ A;  4RTX A;  2FRW A;  4RTV A;  2HBW A;  1Y0M A;  2EBP A;  1XOV A;  3VS4 A;  2X3X D;  3EHR A;  2RQU A;  1M3B A;  1FYN A;  1W1F A;  2RN8 A;  3IQL A;  3M0T A;  1VYU A;  2EYW A;  1QWE A;  3REA B;  4LUD A;  1GFD A;  2DIL A;  1QWF A;  2CSI A;  5IHK A;  1JEG A;  5GJV B;  1YN8 A;  1M3C A;  2KEA A;  2OJ2 A;  4FSS A;  2DF6 A;  2FRY A;  2RQT A;  2BZX A;  1NG2 A;  1UJ0 A;  2AKK A;  2ED1 A;  4OML A;  1UJY A;  1GRI A;  1S1N A;  2EYY A;  1PNJ A;  1UUE A;  2JTE A;  1HJD A;  5GJW B;  1GFC A;  1GBR A;  2AK5 A;  5L23 A;  2DM1 A;  1YCS B;  2ROT A;  1PWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...