3I55Q

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3i55Q00
1Q86R 3CPWP 1VQ5Q 1VQ4Q 1M90R 3OW2P 1KD1R 3CCUQ 3CCJQ 1VQOQ 1KC8R 1VQLQ 1W2BP 1YJWQ 3G4SQ 3I55Q 1VQMQ 1JJ2P 1YIJQ 1K9MR 1NJIR 2OTLQ 3CCMQ 1VQPQ 1VQ7Q 1N8RR 3G6EQ 3CCVQ 1YITQ 3CC2Q 3CD6Q 1Q7YR 2QEXQ 3G71Q 2QA4Q 3CCEQ 3CCRQ 3CCQQ 1YI2Q 3CCSQ 1Q82R 1VQ8Q 1K73R 1VQNQ 1KQSP 2OTJQ 1VQKQ 1Q81R 1K8AR 1S72Q 1QVGP 3CC7Q 1YJ9Q 3I56Q 3CXCP 1VQ6Q 1VQ9Q 3CCLQ 1YHQQ 3CC4Q 1QVFP 3CMAQ 1M1KR 3CMEQ 1YJNQ
chains in the Genus database with same CATH superfamily
3I55A 2LCSA 2D0QB 3OSVA 4FW2A 7AT1B 1H92A 2LX7A 1SEMA 1X75C 4GBQA 3LYIA 3FRNA 3VYGA 4EMKA 3CCLQ 4CC7A 2WSCE 2DX1A 2YRCA 2F2XA 2O88A 1WHLA 3M0SA 1WI7A 1GCQA 1ZA2B 4J5YA 3OY9A 2EYWA 4M75D 2KBTA 2PU9B 3OYCA 2XG8D 4HT8A 2YUQA 3GNGA 3LX7A 1SPKA 1K8AU 1IXDA 1MNDA 1KD1C 2B86A 3BE3A 1AT1B 2QEXA 1UE9A 2K2VA 2LCLA 2KXDA 2ROLA 1GFDA 2LVMA 1VQ5Q 1M2VA 3UA7A 1M90R 1QWEA 1RABB 2RK2A 1NJIR 3CCVT 4OB2B 3MKDA 3QHSA 2PUKB 1Q7YU 4C92D 5GANf 1MMGA 2QEXT 2E6ZA 2CYZB 1U06A 2M16A 1W1FA 5FW9A 4N4GA 5GMKj 1U5SA 5L23A 1UTIA 4C8QD 1CKBA 2FRYA 5GAN5 2CP0A 4EMGA 3CCSA 1EX4A 2RK1A 3EG2A 4IUVA 3OYJA 1N27A 3NTKA 1CSKA 2V8KA 2XDPA 2YT6A 3CPFA 4C92G 2QEXQ 3EFRA 1VQPA 1YIJT 2RI2A 1YI2Q 5LJ5j 2EGAA 3MJXA 4C92B 2CSQA 4B6MA 4A53A 4GY5A 4C8QB 1B3QA 1QVFP 3SEMA 1M1KR 1M3AA 5IXFA 3CMAT 2AKLA 2J06A 3OYMA 4M7AC 2ZAEA 2CP2A 2EJGA 4DA4A 1UG1A 2HAXA 3FJ5A 2XDDA 2MI6A 4DBQA 1ZQ1A 4E47A 3CCSQ 2HL5C 1Q86C 3OYIA 2K57A 1LOJA 2DNUA 4NL2A 3A1PA 1RACB 1GCQC 4M7AE 4A4HA 1UB4A 4OB0B 1RAFB 3CCEA 3RERA 1M3BA 3EG9B 5IHKA 1YJNT 1K4US 3RMQA 4OB3B 2D8JA 5IT9E 1D0ZA 1AOJA 3H0FA 1YJ9A 1W2BP 1N8RC 4E7LA 4NS5A 4WCIA 4KGXB 1N8RR 3WVDB 1BI3A 2Y90A 1VQ5A 3HKSA 3HRSA 2K5LA 5GAMj 2K4YA 5GAN6 2BZYA 4WF2A 1MUZA 1FX7A 2DL8A 4C0FA 2YDLA 2RI5A 4M7AB 3PE0A 5DLQE 2O01E 2JM8A 2JW4A 4ELZC 2P0PA 4RTZA 1M9SA 2DYIA 4FT4A 4MZPA 3G71T 1NPPA 2JOYA 4C92C 4M75F 4C5EA 1Q81U 1KQ2A 4CI0C 4QVCA 1VQ9T 1I81A 2L8DA 2FPEA 1M1KC 2FB7A 1PSEA 2DXCA 5GMKe 2CSIA 1Z9QA 1D09B 5HK0A 3QZ9B 1U3OA 4YTLA 4M7DE 2E4HA 2OTLA 3CCMT 3OYFA 1K9MR 2BUDA 3JSCA 3EH1A 3DLMA 4TVRA 3CXCS 2EW3A 1BKBA 3RESA 3I9QA 4LD9K 3CC7Q 1VQNT 2Z0WA 1PRMC 3CC4Q 4J83A 1PD0A 3DB3A 3OMGA 3VS4A 1UHFA 1VQLQ 1I07A 4XU0A 3QKJA 1NJIC 1XTDA 4AMCA 3UDCA 1M90C 2RO0A 1VQNQ 3M9QA 5EC7A 5GANe 5GAOr 4Z02A 2GQVA 1LCKA 4R0KA 4IIMA 1RADB 4O6JA 2DL5A 4BUGA 1VQ5T 2NUPA 3F70A 2CH4A 2QI2A 2DF6A 3JRZA 1KC8R 1IHWA 4K11A 3AHUA 3QZ5B 4HVWA 3CCVQ 4ME7A 2VKNA 2NUTB 3OS2A 1YITT 2JTFA 2EKOA 1YJNA 1BI2A 4XQ3A 5D6YA 2A0FB 4PJNA 1ZSZB 1VQ6A 1YHQT 2OAUA 1YWPA 2LNVA 5IH2A 1H641 1KQSA 3EGXA 4Y92A 1VQ9A 4M75B 3EGDB 2V26A 1Y96A 2EVRA 1OQKA 3VS5A 3EHQA 2FZGB 3QXEB 4HA8A 2QG9B 3EH2A 1X43A 2ZPIB 2KMTA 4FYYB 2RPNA 2C0OA 1ARKA 2DERA 2A28A 3PTAA 3CPWP 4A54A 5CVIA 4J9DA 4FM4B 2ZPBB 4OF1A 1YIJA 2NUZA 1MMNA 2QA4Q 5GAOl 1PRLC 1QMCA 3EGUA 3INZA 3A98A 4RTVA 1WJSA 3MO8A 5FWCA 4M75C 2O9SA 3E2UA 1Q82C 2JJ9A 2DLPA 4JRQA 1B07A 4PJOD 6AT1B 4BD3A 5LJ5d 2DILA 1K73C 3R6NA 1A0NB 5I2MA 1OX8A 1VQ7A 5D6WA 3OYNA 1UGSB 2R57A 3L2RA 1BK2A 3M0TA 5AT1B 2RHYA 3KXTA 1PD1A 2KNBB 4JZ3A 1E7OA 1I0CA 4PJOB 4LUEA 2L0AA 2DL4A 2EIFA 1MV3A 2HQEA 1GBRA 1AHJB 2XU8A 3E9GA 3CC2A 4DBFA 2QTXA 1K0XA 2QDLA 3CCJA 2EWNA 2VWFA 3A8LB 3I5RA 1IREB 5LJ3f 1VQ6Q 2YUOA 2RQWA 1QCFA 2PTKA 1NYFA 1OZ2A 4PK4A 1MNEA 4Y91A 2EQUA 1ZUKA 1I4K1 2DZ9A 2FL7A 5ECAA 1ZX6A 1D1AA 3JCMW 1T3LA 1M1FA 1U1SA 3PFSA 3E19A 2MF2A 4OGCA 5KYWA 5GAOq 3RKYA 4JJNK 4JDSA 4BB7A 2KDSA 4ZNXA 5HK3A 3I5SA 1VYTA 5FU7B 2BKDN 2JMAA 3S3NA 1VQNA 4LXCA 2KYMA 1JQQA 1VQ7T 2OTLQ 4DBHA 1AZGB 1IB8A 2EYYA 2YWWA 3HRTA 1G5VA 1ZA1B 1UUEA 4J6WA 1KC8C 3LGFA 4HCBA 3TEEA 2AT1B 2FPDA 3LWIA 4LDUA 2JVVA 3JCMd 3G4SQ 3RNJA 1HYOA 4LN2A 2HD0A 2DJZA 4RTXA 2GNCA 1C0MA 4M78A 2OTJQ 4JRPA 3M0QA 2VXFA 1O75A 2DAQA 5IXBA 2DD5A 3GOXA 4E2FB 2JM9A 4AG2C 5FU6B 1NEGA 2O9VA 2RQRA 2RQVA 2GTJA 2FO0A 5GAN2 2NLUA 1PNJA 3HTRA 2LP5A 1JEGA 2JXBA 2EPDA 4C5GA 2DXUA 1E6HA 4DEXA 1G83A 2RN8A 1NG2A 5GAMh 4M78B 1KD1U 3HL8A 2QQSA 1G3SA 3CQTA 1AEYA 2RA2A 2RM4A 1X2QA 2BZXA 4LDYA 1EFNA 2DM1A 2QAZA 1B34A 2JMCA 1JJ2S 4M7AD 2YLBA 1VQMA 1OU8A 3M0RA 4M78F 1YHQQ 3FB9A 3CCQA 2YHTA 3HSBA 2CH4W 1Q86U 3EG1A 2LQ8A 3VJPA 1EZZB 1X01A 1PKTA 3ASKA 2KGTA 2YLCA 2K3YA 2HKNA 4IUTA 3MEWA 4OMNA 3GBQA 1V1CA 2ECZA 4BI8B 2ATCB 4FSSA 3S3OA 4KT0E 2QQBA 2JZ2A 1RAAB 5GAMf 1G8XA 2FHDA 4JS4A 4FIBA 3SD4A 5DM7R 2BE9B 4ZGEB 4RG2A 2R5MA 2YRDA 4XTYA 2GQIA 3OS1A 3CMEA 1ZHIA 2DJQA 5KYWB 2D9TA 2CGHA 3JCMP 4JLGA 2CUBA 3G7ZA 2QGFB 4L5GA 3QPHA 3OB9A 2A08A 4E7HA 1VQKQ 3QDFA 2F2WA 4A4KA 1S1NA 3CMEQ 4HT9A 3THKA 1NBEB 2D0NA 2HZYA 3J80E 2WACA 1UJ0A 3CC2Q 4OB1B 2DD4A 4OMPA 1W2BS 4RMOA 2FVUA 2CT4A 1QVGS 2CKKA 1VIEA 2MPXC 2M9UA 2GBQA 1YCSB 1VA7A 3CMET 1QP2A 2X35A 4BE0A 2QK0A 5CKBA 1W2BA 2VGMA 5CIUA 1GRIA 1VQ7Q 2M1HA 2OI3A 1N9RA 1D3BB 1X6OA 3VUZA 3REAB 9ATCB 3VV0A 3L2UA 1K8AR 2EYZA 4J9BA 8ATCB 2EQKA 1NZ9A 2DMOA 3L2VA 3OS5A 2IIMA 5IHNA 4RTUA 2YRVA 1K76A 3HP9A 2LJ0A 1HK9A 4PL6A 3ER0A 5GMKl 5GAN8 3C94A 1P92A 3V8JA 2QQRA 2DYBA 1Q7YR 2AIRB 2E5KA 4J9EA 3CCRT 5KYUB 1QKWA 5GAOp 4ZN3A 3VS7A 5GJVB 3I35A 3JCMf 1YWOA 2EQJA 3C4SA 4DOWA 1OYXA 1SSHA 3X28B 4RKUE 4QVZA 3CEYA 4JLIA 1M3CA 1GL5A 4PJLA 5CR2A 2GFAA 3JAME 2JTEA 1VQPT 1H8KA 3MP8A 4UC4A 2COWA 3EGXB 2G3RA 3CCST 1W6XA 1KQSP 4KRTA 3M59A 2M0OA 4R56A 1WLPB 3VS1A 1G3TA 3QYGB 1ZSZA 1UECA 2DPPB 3G6EA 4J7FA 2DXBA 2KRSA 1VQLT 1AVZC 3ZFJA 1ZSGA 5FWBA 3V8LA 3G4ST 2HMAA 4FYWB 3BY7A 2NUTA 2ZPEB 1R77A 1PWTA 4D8DA 3A8MB 3RKWA 5A0GA 2KYBA 3UPUA 2H3JA 4M78C 4J9IA 3ZBDA 4A4EA 2DL3A 2HBPA 3CCUA 1IO6A 2NUPB 1G3WA 3EFSA 4VUBA 2LT4A 1XNIA 2CZ1B 3WVEB 3R6OA 5IAYA 1QKXA 2FZCB 1PM3A 3OA6A 2XDBA 4J7IA 2CT3A 3DB4A 2XD0A 3BDLA 2MYSA 2RHXA 3GLXA 1ZSZC 1LPLA 3PT9A 1TSFA 2AZVA 1YITQ 1OULA 1NE8A 4M77F 1N6AA 2BIVA 1WYXA 1JBMA 2MK5A 2E3HA 4IUUA 1BBZA 2VYTA 2QYZA 1NM7A 4M77G 3E1SA 1AWJA 2K2MA 2XI9A 1B7TA 2L3SA 4C92E 2KR3A 3M54A 4BY6C 4QVDA 5KYUA 4C0DB 1NLPC 1FMWA 3A8GB 3UATA 2RHZA 3JB9J 3J7AF 1YJWA 4X1VA 2PVDB 1VQKT 3H6ZA 2P84A 3UA6A 4IKFA 3TQ7P 3MEAA 3M53A 4HKEA 2RQTA 2E64A 1PSFA 4JUVA 4ORZA 1D3BA 4JS5A 1GBQA 5HCKA 4XTZA 1VQ8Q 1MGQA 5LJ5g 2XKOC 5LJ3g 4JRKA 1WQWA 1HJDA 1Y0MA 2PVOB 3SWNC 3CMAA 1M90U 2RNAA 2YUPA 3PGGA 5CCAA 2LT1A 5KE2A 4FT2A 4X9CA 4BE2A 3M0PA 2VB6A 1WHHA 2ZCFB 2CP3A 5D7UA 3TREA 2X51A 5J3BA 3LW5E 1VQKA 1IZ6A 1YJWT 2E6NA 3CC2T 5EG2A 5C6SA 2F5TX 4JRIA 1KJWA 3T9NA 4KH1B 3CCLT 1M8VA 2EJFA 5LJ3d 4PJOF 3QIIA 2KI7A 3JV3A 4Y28E 3RBBB 1R0CB 3FIFA 1QVFA 2DVEA 4C5IA 3ZEHA 3X24B 1WGSA 2KY9A 3OW2A 5I22A 1VQPQ 1OEBA 3TVTA 4J9GA 3VS6A 4M7DD 1D0YA 4M78E 1FWZA 2F69A 1K73U 1M30A 2KQWA 1WX6A 4BE1A 2DBMA 2VASA 4A4GA 3J81E 5GANg 2XMFA 1YHQA 4M77C 2DEUA 2SEMA 2OTLT 1SHGA 2I2LA 4AFZC 2ZPFB 5I2SA 1B34B 2EKHA 4FW1A 2LCCA 3CCRQ 1PG5B 2KT1A 4PJOE 4X34A 1SF9A 2KRNA 5CAIA 2COYA 5GMKm 3N5BB 2LJ3A 4GLMA 5GAMe 2CP7A 3URGA 1KD1R 3VYHB 1VQ8A 4M7AG 2HEQA 1YIJQ 1NJIU 2QQ9A 1TTHB 1YFNA 3QYHB 4LE9A 1TUGB 4X9DA 1SG5A 1KFZA 2O31A 5A0LA 1D0XA 3JCMQ 1KG1A 3UF4A 2K7AA 4EMKB 3CMAQ 3KUFA 4L59A 2AK5A 4JPBW 3P8BB 1TH7A 4MMKA 2V1QA 2JN0A 5LJ3h 2KK4A 5KH6A 1OV3A 3DLLA 2V8IA 1WDXA 1U1TA 1Q81C 5GAMg 4XK8E 3V8KA 4JZ4A 2X4WA 1RL2A 3CPWS 2JS0A 1M1KU 2E10A 4ZGDB 4L6V5 4C5HA 2KT8A 2DTOA 3EFOB 1KSWA 1M1GA 2DZCA 1ZLMA 3G71A 3RIRA 3EG3A 4M7DG 1Q82U 3RDVA 2J6FA 1Y07A 4XU3A 3OBWA 3V7CA 3H41A 3M5AA 4RUGA 1YJ9Q 3C0CA 5FU6C 5DLOA 2PUOB 4F16A 5FRMA 4HCZA 2ESWA 2V8JA 3EAEA 5D6XA 4F14A 1MMDA 1WXTA 3LLRA 3CCUQ 4R55A 1WHMA 3NMZC 1N8RU 3CCMA 4XTWA 1WXUA 3MP1A 4N4IA 1BI1A 4PLLA 3VRYA 3EG0A 3X26B 1SHFA 3JCMh 5GAMd 2L3RA 1RLQC 3CXCP 1OX9A 2QGGA 1W4SA 4AFUC 4C0ZA 1RUWA 2HQXA 3ULRB 1WHKA 1UEBA 3P8HA 4V2SA 1NEBA 1UHCA 1D1BA 3CCJQ 2DETA 5J39A 1WHJA 3QBYA 1Y57A 1TXQA 2VGNA 5KYXB 4E7JA 2G6FX 4M4ZA 1VIFA 1YI2T 2KROA 4AFQC 1K8AC 2JT4A 4J9CA 3UWNA 4PJOA 1OU9A 1QVGP 2F5KA 5GAN4 4IIOA 2NWMA 4J6XA 3GF5A 4IURA 1VQ4A 1GCPA 2KAFA 1BB9A 4F7UG 2P4RA 4KULA 2M51A 3P8DA 3M55A 2IVWA 3FDRA 1HXDA 1T3SA 4LNPA 3QO3A 2ZGWA 4CC4B 2DRKA 3META 4QT7A 2LTOA 1J3TA 3ZL7C 1MV0B 1BU1A 2DL7A 2VVKA 2VUBA 1BYMA 5L8RE 3VS0A 1QCNA 2AZSA 2CUDA 4C0GA 1KK7A 2EBPA 1XOVA 2DK3A 3L2WA 5KYYB 4GLKA 4CRIA 2W10A 3OW2S 1RAHB 4KUIA 3OYAA 5FU7C 1AZEA 4Z8AA 1BIBA 4OMFB 3RMSA 2ZPHB 1S72T 4KH0B 4MMLA 3OYGA 2XHCA 3JB9H 3BFMA 2HSPA 4C8QF 2HCKA 5KCHA 4RTYA 1AD5A 2HQHA 1RI0A 2X3XD 2MIOA 2LQNA 5GAN3 2J6KA 3CD6Q 1Y96B 3OQ5A 3EGDA 4M75A 4QQ6A 3CCQQ 3CBPA 1UGQB 3LGLA 2CZ0B 3V7RA 1AWWA 2DE0X 2D1XA 3EHRA 2JS2A 4M77E 4FYXB 3VKIA 3SDZA 3JB9D 3A8OB 3M58A 3KFVA 1O9SA 1UGRB 4PJOC 1M27C 1WA7A 4DEYA 1WPYA 5CO7A 1ZUUA 1XQHA 3S6WA 4JJBA 4QQDA 4F17A 1RI9A 4C8QE 2DBKA 3QUIA 2RHIA 3CC7T 2RJCA 3CC4T 4AG1C 2LZ6B 3Q1JA 4MZTA 1VYUA 4RCCA 4OP0A 2RI3A 1QQJA 2HKQB 2E70A 2QDYB 2X3WD 1JJ2P 5J26A 4IUPA 2J05A 3G71Q 1YNZA 2VV5A 4QQGA 3PIPA 5CK9A 2X4JA 3JCMc 1ACMB 2ROTA 4KBMB 3QJYA 4BACA 1VQ9Q 3I56A 1YITA 1IRXA 2CP6A 3MCAB 4ESRA 5KYNA 2ED1A 1PCXA 1GFCA 1QWFA 3SFMA 3G4SA 1M2OA 1KHIA 3X20B 1K9MC 4LDVA 5HKCA 1VQMT 1TOVA 3TSZA 3NTHA 3G6ET 2MWOA 1WJRA 4DBRA 1G3YA 3CCVA 4KGZB 2EYXA 2MOXA 3I56T 1H3HA 2COZA 1DJ7B 2EGEA 4RTTA 3M4GA 1D1CA 1R0BG 1VQMQ 3G6EQ 3PMIA 5I11A 2X9HA 4XAXB 2XK0A 3QDRB 4N0AA 4QW2A 2DEQA 1KHCA 3H0IA 1K9AA 3I56Q 4PFOA 4M7AA 2YXYA 2RMOA 5CKEA 3OYHA 3FLGA 2OTJA 1QVGA 4M77D 3TU4K 3L1AA 2JNGA 4BI3A 4E6RA 3OYEA 1YCYA 4ZN1A 2VXEA 1ABQA 1TUCA 2K79A 3EG9A 2K3BA 5GMKh 2CS7A 2GF7A 3OSSC 3GNFB 4ELYC 2P0QA 4DOVA 1Q86R 2KEAA 3U23A 1C6VX 2EAYA 3FEOA 2E1HA 3C12A 1Y71A 3PVLA 1ZBXA 2R5AA 4BDZA 4PJOG 3QWXX 1TWBA 1LNXA 2OTJT 3C95A 2I0NA 4EMKC 2O4XB 2EGCA 5CQXA 1BIAA 2OX7A 3BDUA 1WHGA 2MCNA 4XTVA 1IGUA 1OI1A 4F7UB 4C8QA 2L89A 5CKHA 1VQOQ 4Z88A 4M75G 2K5FA 4C92A 1SSFA 1UGVA 5A0DA 4OMQA 4DQ2A 3OYDA 3L2QA 2RB6A 3CD6A 1IHVA 2DA9A 2XIDA 2PZ1A 2YUNA 3L2ZA 2KSSA 1WIEA 3H9NA 4E7IA 1OOTA 3GPLA 1UDLA 4C92F 1VQOT 1ABOA 2CREA 1KIKA 2WSFE 8AT1B 2DO3A 1QVPA 2DRMA 4KGVB 4HVVA 5GAOm 4EDUA 2LX9A 3MHXA 1TG0A 2EFIA 2LDMA 3L42A 4QKUA 3SHWA 1U8RA 3S3MA 2H3EB 2L5QA 1NPRA 1M2VB 1VOMA 4ZTFA 3PIOA 2LMJA 1WJQA 4J9HA 2DIGA 5LJ3e 2RH2A 4O5VA 4M7DF 3QJ6A 4P5NA 4WTOB 4RG8A 1JJ2A 2RQUA 4PFPA 1UFFA 3JCMV 1QLYA 1TUDA 1QP3A 3CCQT 2JUFA 2H8HA 5A2QE 2WSEE 2FYKA 3JCMJ 1AWXA 1Q81R 1JO8A 2X4YA 5IHIA 3JB9I 1K0SA 3HPWA 3ME9A 1MMAA 1VYVA 4B9WA 2DXTA 1WFWA 2ZPGB 1PC0A 1RAIB 2CP5A 3NHNA 1YJWQ 1CKAA 1K9MU 2AKKA 2QA4A 2BTTA 4D8KA 2LNHB 1JB0E 4C8QC 2D6FA 3LH5A 2DKGA 1PKSA 2HNIA 1WNLA 1IGQA 4FSXA 3V7SA 3HFNA 2M02A 4II1A 4CC2A 5AYFA 1FXXA 1RAEB 2FRWA 2QXFA 2MWPA 3AT1B 1R8OB 3REBB 4MDXA 3MEVA 2L3QA 1T0JA 2VC8A 2RJEA 1QVFS 2DIQA 1WZOA 4F7UA 4F7UE 2YSQA 3RUXA 3A8HB 2M0YA 2P0KA 1VQ4Q 2K5IA 2J7IA 2O2OA 3OMCA 2O4XA 3I55T 2P4TA 2DFUA 3JCMb 5GANj 1I8FA 3SWNA 2DTIA 1M4ZA 1XJWB 3FJPA 3H0HA 3BW1A 3OYKA 1OZ3A 1V76A 3KBGA 1BI0A 1YJ9T 5C0MA 5CQYA 1F1BB 2A7YA 3SB2A 5FROA 4BDYA 2A36A 3CCUT 2ED0A 4Q5WA 1YBYA 2V1RA 3MPUB 3HFOA 4JJDA 5LL6S 1I5LA 2QASA 2K3XA 2A3LA 2LRQA 2OJ2A 4N0AC 2GTOA 1MHNA 3A5ZB 3JCMX 1VQLA 4F7UF 3JCMe 2DTHA 1X6GA 2SRCA 3VS2A 4M7DB 1W70A 3QSUA 2J6OA 1SKUB 1WXBA 2R58A 5LJ3j 3OYLA 2K6DA 2C0IA 3CBOA 4J9FA 2DVJA 2L3PA 1BCMA 2ZZDA 3X25B 3PMTA 5GAN7 1Q95G 1LJOA 3GIBA 3VS3A 4M77B 4BI4A 5IN1A 1UJYA 2IG0A 3CCEQ 4B9XA 1X27A 4PFZA 1SRMA 1LVKA 1HSQA 2LJ1A 2FPFA 4LDXA 3GP8A 2A37A 4LDWA 2IPOB 2HBWA 4OMLA 4HCCA 2RD1A 4EMHA 5LJ5h 4XU1A 2C0TA 3CC7A 2HSEB 2K9GA 2X4XA 4OMOA 3OS0A 1JU5C 2FZKB 1N9SA 2EJ9A 3NGPA 5KCOA 1RAGB 4LUDA 4C8QG 4C0DC 4F04B 2PQWA 3MP6A 2PVGB 2EQMA 4M78D 2CZ7B 3TCJA 2EYQA 3CBMA 2GCXA 1QW1A 1H3ZA 2KRMA 3NTIA 4A63B 4AFSC 4PKCC 2GFUA 2RHUA 1T0HA 4E7KA 2RF0A 4AT1B 1N5ZA 3OBYA 2EQIA 4HVUA 3IQLA 4HCKA 5GAOn 3PVQA 2F1LA 1I5OB 1KQ1A 2Y4XA 1Y7XA 4OGEA 3CCJT 4XTXA 2QA4T 1ZUYA 2XICA 2BE7D 4M78G 5CKDA 5LJ5e 3M4YA 4M7AF 2LQKA 5FRNA 1GXIE 4FYVB 1VUBA 1VQOA 3RR6A 4KUDK 2FEIA 2QQAA 2MMPA 4OVAA 1KC8U 1M5Q1 3M0UA 3JCMg 4D6WA 5GANh 4FU6A 1EIFA 2E5QA 4MZMA 3CD6T 1VQ8T 2E12A 5GJWB 1E6GA 2ENMA 5GMKi 3QWYA 1BCOA 1AWOA 1OPKA 1JRIA 3UT1A 2KE9A 1NYGA 1QCOA 4J6YA 5KE3A 1YP5A 1VQ4T 3JB9G 1YN8A 3I55Q 3OYYA 3CXCA 4PLIA 2KXCA 2E65A 5KYYA 1YI2A 4EIKA 1JXOA 2W0ZA 4PJJA 3JB9F 4M7DC 3LWHA 4PNOA 2E41A 4RCBA 1FMKA 1S72Q 4J8OA 2HL3A 4ANJA 4E7SA 1SRLA 4Z89A 3M57A 1G2BA 3OW2P 4HXJA 1FYNA 4FCYA 4XU2A 1FMVA 4M77A 1KQSS 3VRZA 3NFCA 2F2VA 4FL6A 3MEUA 1Z9ZA 2CDTA 3D7SB 3HRUA 4M75E 1C1AA 1V29B 3PNWC 3CCLA 4LD6A 1VQ6T 4M7DA 4ZGJB 2AHJB 1Q7YC 1I1JA 2LQWA 5GANd 1TU0B 4NL3A 5KYXA 2RJDA 3LH0A 3CC4A 3O5ZA 1UGPB 4RTWA 2ABLA 1PHTA 3NPFA 5M9OA 2FG0A 2CZ6B 2QTVA 1X69A 2OAWA 3HHTB 3E9FA 4XTUA 2Y4YA 3M56A 1YJNQ 4ATOA 4OMMA 4A4FA 2HDAA 1K1ZA 3CCMQ 3SWNB 4EPCA 2C06A 3QG1A 3G1JA 2B8AA 3H8ZA 1Q82R 1JXMA 1K73R 2KVQG 4BY6B 3O8VA 3FC3A 2RJFA 2L2PA 4PJMA 3VU3C 2JTMA 4CC3A 3RKXA 2BZ8A 1TS9A 4N4HA 3CPWA 1X2KA 5HY6A 2LC4A 2NYSA 4NOYA 1RLPC 2GGRA 3TSWA 3VUBA 5I21A 5LJ5f 3OYBA 1HD3A 4E7ZA 2E3IA 4ZTJA 3CCET 1WQ7A 4IUQA 5CKFA 1NLOC 1OPLA 2MAMA 1M8MA 3EFOA 2D8HA 1ZBJA 1S72A 5FLXE 5DY9A 2PNIA 4JJCA 3CCRA 1X6BA 3WXMB 4MDWA 3DKMA
chains in the Genus database with same CATH topology
1Q86R 3CPWP 1VQ5Q 1VQ4Q 1M90R 3OW2P 1KD1R 3CCUQ 3CCJQ 1VQOQ 1KC8R 1VQLQ 1W2BP 1YJWQ 3G4SQ 3I55Q 1VQMQ 1JJ2P 1YIJQ 1K9MR 1NJIR 2OTLQ 3CCMQ 1VQPQ 1VQ7Q 1N8RR 3G6EQ 3CCVQ 1YITQ 3CC2Q 3CD6Q 1Q7YR 2QEXQ 3G71Q 2QA4Q 3CCEQ 3CCRQ 3CCQQ 1YI2Q 3CCSQ 1Q82R 1VQ8Q 1K73R 1VQNQ 1KQSP 2OTJQ 1VQKQ 1Q81R 1K8AR 1S72Q 1QVGP 3CC7Q 1YJ9Q 3I56Q 3CXCP 1VQ6Q 1VQ9Q 3CCLQ 1YHQQ 3CC4Q 1QVFP 3CMAQ 1M1KR 3CMEQ 1YJNQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 R;  3CPW P;  1VQ5 Q;  1VQ4 Q;  1M90 R;  3OW2 P;  1KD1 R;  3CCU Q;  3CCJ Q;  1VQO Q;  1KC8 R;  1VQL Q;  1W2B P;  1YJW Q;  3G4S Q;  3I55 Q;  1VQM Q;  1JJ2 P;  1YIJ Q;  1K9M R;  1NJI R;  2OTL Q;  3CCM Q;  1VQP Q;  1VQ7 Q;  1N8R R;  3G6E Q;  3CCV Q;  1YIT Q;  3CC2 Q;  3CD6 Q;  1Q7Y R;  2QEX Q;  3G71 Q;  2QA4 Q;  3CCE Q;  3CCR Q;  3CCQ Q;  1YI2 Q;  3CCS Q;  1Q82 R;  1VQ8 Q;  1K73 R;  1VQN Q;  1KQS P;  2OTJ Q;  1VQK Q;  1Q81 R;  1K8A R;  1S72 Q;  1QVG P;  3CC7 Q;  1YJ9 Q;  3I56 Q;  3CXC P;  1VQ6 Q;  1VQ9 Q;  3CCL Q;  1YHQ Q;  3CC4 Q;  1QVF P;  3CMA Q;  1M1K R;  3CME Q;  1YJN Q; 
#chains in the Genus database with same CATH topology
 3I55 A;  2LCS A;  2D0Q B;  3OSV A;  4FW2 A;  7AT1 B;  1H92 A;  2LX7 A;  1SEM A;  1X75 C;  4GBQ A;  3LYI A;  3FRN A;  3VYG A;  4EMK A;  3CCL Q;  4CC7 A;  2WSC E;  2DX1 A;  2YRC A;  2F2X A;  2O88 A;  1WHL A;  3M0S A;  1WI7 A;  1GCQ A;  1ZA2 B;  4J5Y A;  3OY9 A;  2EYW A;  4M75 D;  2KBT A;  2PU9 B;  3OYC A;  2XG8 D;  4HT8 A;  2YUQ A;  3GNG A;  3LX7 A;  1SPK A;  1K8A U;  1IXD A;  1MND A;  1KD1 C;  2B86 A;  3BE3 A;  1AT1 B;  2QEX A;  1UE9 A;  2K2V A;  2LCL A;  2KXD A;  2ROL A;  1GFD A;  2LVM A;  1VQ5 Q;  1M2V A;  3UA7 A;  1M90 R;  1QWE A;  1RAB B;  2RK2 A;  1NJI R;  3CCV T;  4OB2 B;  3MKD A;  3QHS A;  2PUK B;  1Q7Y U;  4C92 D;  5GAN f;  1MMG A;  2QEX T;  2E6Z A;  2CYZ B;  1U06 A;  2M16 A;  1W1F A;  5FW9 A;  4N4G A;  5GMK j;  1U5S A;  5L23 A;  1UTI A;  4C8Q D;  1CKB A;  2FRY A;  5GAN 5;  2CP0 A;  4EMG A;  3CCS A;  1EX4 A;  2RK1 A;  3EG2 A;  4IUV A;  3OYJ A;  1N27 A;  3NTK A;  1CSK A;  2V8K A;  2XDP A;  2YT6 A;  3CPF A;  4C92 G;  2QEX Q;  3EFR A;  1VQP A;  1YIJ T;  2RI2 A;  1YI2 Q;  5LJ5 j;  2EGA A;  3MJX A;  4C92 B;  2CSQ A;  4B6M A;  4A53 A;  4GY5 A;  4C8Q B;  1B3Q A;  1QVF P;  3SEM A;  1M1K R;  1M3A A;  5IXF A;  3CMA T;  2AKL A;  2J06 A;  3OYM A;  4M7A C;  2ZAE A;  2CP2 A;  2EJG A;  4DA4 A;  1UG1 A;  2HAX A;  3FJ5 A;  2XDD A;  2MI6 A;  4DBQ A;  1ZQ1 A;  4E47 A;  3CCS Q;  2HL5 C;  1Q86 C;  3OYI A;  2K57 A;  1LOJ A;  2DNU A;  4NL2 A;  3A1P A;  1RAC B;  1GCQ C;  4M7A E;  4A4H A;  1UB4 A;  4OB0 B;  1RAF B;  3CCE A;  3RER A;  1M3B A;  3EG9 B;  5IHK A;  1YJN T;  1K4U S;  3RMQ A;  4OB3 B;  2D8J A;  5IT9 E;  1D0Z A;  1AOJ A;  3H0F A;  1YJ9 A;  1W2B P;  1N8R C;  4E7L A;  4NS5 A;  4WCI A;  4KGX B;  1N8R R;  3WVD B;  1BI3 A;  2Y90 A;  1VQ5 A;  3HKS A;  3HRS A;  2K5L A;  5GAM j;  2K4Y A;  5GAN 6;  2BZY A;  4WF2 A;  1MUZ A;  1FX7 A;  2DL8 A;  4C0F A;  2YDL A;  2RI5 A;  4M7A B;  3PE0 A;  5DLQ E;  2O01 E;  2JM8 A;  2JW4 A;  4ELZ C;  2P0P A;  4RTZ A;  1M9S A;  2DYI A;  4FT4 A;  4MZP A;  3G71 T;  1NPP A;  2JOY A;  4C92 C;  4M75 F;  4C5E A;  1Q81 U;  1KQ2 A;  4CI0 C;  4QVC A;  1VQ9 T;  1I81 A;  2L8D A;  2FPE A;  1M1K C;  2FB7 A;  1PSE A;  2DXC A;  5GMK e;  2CSI A;  1Z9Q A;  1D09 B;  5HK0 A;  3QZ9 B;  1U3O A;  4YTL A;  4M7D E;  2E4H A;  2OTL A;  3CCM T;  3OYF A;  1K9M R;  2BUD A;  3JSC A;  3EH1 A;  3DLM A;  4TVR A;  3CXC S;  2EW3 A;  1BKB A;  3RES A;  3I9Q A;  4LD9 K;  3CC7 Q;  1VQN T;  2Z0W A;  1PRM C;  3CC4 Q;  4J83 A;  1PD0 A;  3DB3 A;  3OMG A;  3VS4 A;  1UHF A;  1VQL Q;  1I07 A;  4XU0 A;  3QKJ A;  1NJI C;  1XTD A;  4AMC A;  3UDC A;  1M90 C;  2RO0 A;  1VQN Q;  3M9Q A;  5EC7 A;  5GAN e;  5GAO r;  4Z02 A;  2GQV A;  1LCK A;  4R0K A;  4IIM A;  1RAD B;  4O6J A;  2DL5 A;  4BUG A;  1VQ5 T;  2NUP A;  3F70 A;  2CH4 A;  2QI2 A;  2DF6 A;  3JRZ A;  1KC8 R;  1IHW A;  4K11 A;  3AHU A;  3QZ5 B;  4HVW A;  3CCV Q;  4ME7 A;  2VKN A;  2NUT B;  3OS2 A;  1YIT T;  2JTF A;  2EKO A;  1YJN A;  1BI2 A;  4XQ3 A;  5D6Y A;  2A0F B;  4PJN A;  1ZSZ B;  1VQ6 A;  1YHQ T;  2OAU A;  1YWP A;  2LNV A;  5IH2 A;  1H64 1;  1KQS A;  3EGX A;  4Y92 A;  1VQ9 A;  4M75 B;  3EGD B;  2V26 A;  1Y96 A;  2EVR A;  1OQK A;  3VS5 A;  3EHQ A;  2FZG B;  3QXE B;  4HA8 A;  2QG9 B;  3EH2 A;  1X43 A;  2ZPI B;  2KMT A;  4FYY B;  2RPN A;  2C0O A;  1ARK A;  2DER A;  2A28 A;  3PTA A;  3CPW P;  4A54 A;  5CVI A;  4J9D A;  4FM4 B;  2ZPB B;  4OF1 A;  1YIJ A;  2NUZ A;  1MMN A;  2QA4 Q;  5GAO l;  1PRL C;  1QMC A;  3EGU A;  3INZ A;  3A98 A;  4RTV A;  1WJS A;  3MO8 A;  5FWC A;  4M75 C;  2O9S A;  3E2U A;  1Q82 C;  2JJ9 A;  2DLP A;  4JRQ A;  1B07 A;  4PJO D;  6AT1 B;  4BD3 A;  5LJ5 d;  2DIL A;  1K73 C;  3R6N A;  1A0N B;  5I2M A;  1OX8 A;  1VQ7 A;  5D6W A;  3OYN A;  1UGS B;  2R57 A;  3L2R A;  1BK2 A;  3M0T A;  5AT1 B;  2RHY A;  3KXT A;  1PD1 A;  2KNB B;  4JZ3 A;  1E7O A;  1I0C A;  4PJO B;  4LUE A;  2L0A A;  2DL4 A;  2EIF A;  1MV3 A;  2HQE A;  1GBR A;  1AHJ B;  2XU8 A;  3E9G A;  3CC2 A;  4DBF A;  2QTX A;  1K0X A;  2QDL A;  3CCJ A;  2EWN A;  2VWF A;  3A8L B;  3I5R A;  1IRE B;  5LJ3 f;  1VQ6 Q;  2YUO A;  2RQW A;  1QCF A;  2PTK A;  1NYF A;  1OZ2 A;  4PK4 A;  1MNE A;  4Y91 A;  2EQU A;  1ZUK A;  1I4K 1;  2DZ9 A;  2FL7 A;  5ECA A;  1ZX6 A;  1D1A A;  3JCM W;  1T3L A;  1M1F A;  1U1S A;  3PFS A;  3E19 A;  2MF2 A;  4OGC A;  5KYW A;  5GAO q;  3RKY A;  4JJN K;  4JDS A;  4BB7 A;  2KDS A;  4ZNX A;  5HK3 A;  3I5S A;  1VYT A;  5FU7 B;  2BKD N;  2JMA A;  3S3N A;  1VQN A;  4LXC A;  2KYM A;  1JQQ A;  1VQ7 T;  2OTL Q;  4DBH A;  1AZG B;  1IB8 A;  2EYY A;  2YWW A;  3HRT A;  1G5V A;  1ZA1 B;  1UUE A;  4J6W A;  1KC8 C;  3LGF A;  4HCB A;  3TEE A;  2AT1 B;  2FPD A;  3LWI A;  4LDU A;  2JVV A;  3JCM d;  3G4S Q;  3RNJ A;  1HYO A;  4LN2 A;  2HD0 A;  2DJZ A;  4RTX A;  2GNC A;  1C0M A;  4M78 A;  2OTJ Q;  4JRP A;  3M0Q A;  2VXF A;  1O75 A;  2DAQ A;  5IXB A;  2DD5 A;  3GOX A;  4E2F B;  2JM9 A;  4AG2 C;  5FU6 B;  1NEG A;  2O9V A;  2RQR A;  2RQV A;  2GTJ A;  2FO0 A;  5GAN 2;  2NLU A;  1PNJ A;  3HTR A;  2LP5 A;  1JEG A;  2JXB A;  2EPD A;  4C5G A;  2DXU A;  1E6H A;  4DEX A;  1G83 A;  2RN8 A;  1NG2 A;  5GAM h;  4M78 B;  1KD1 U;  3HL8 A;  2QQS A;  1G3S A;  3CQT A;  1AEY A;  2RA2 A;  2RM4 A;  1X2Q A;  2BZX A;  4LDY A;  1EFN A;  2DM1 A;  2QAZ A;  1B34 A;  2JMC A;  1JJ2 S;  4M7A D;  2YLB A;  1VQM A;  1OU8 A;  3M0R A;  4M78 F;  1YHQ Q;  3FB9 A;  3CCQ A;  2YHT A;  3HSB A;  2CH4 W;  1Q86 U;  3EG1 A;  2LQ8 A;  3VJP A;  1EZZ B;  1X01 A;  1PKT A;  3ASK A;  2KGT A;  2YLC A;  2K3Y A;  2HKN A;  4IUT A;  3MEW A;  4OMN A;  3GBQ A;  1V1C A;  2ECZ A;  4BI8 B;  2ATC B;  4FSS A;  3S3O A;  4KT0 E;  2QQB A;  2JZ2 A;  1RAA B;  5GAM f;  1G8X A;  2FHD A;  4JS4 A;  4FIB A;  3SD4 A;  5DM7 R;  2BE9 B;  4ZGE B;  4RG2 A;  2R5M A;  2YRD A;  4XTY A;  2GQI A;  3OS1 A;  3CME A;  1ZHI A;  2DJQ A;  5KYW B;  2D9T A;  2CGH A;  3JCM P;  4JLG A;  2CUB A;  3G7Z A;  2QGF B;  4L5G A;  3QPH A;  3OB9 A;  2A08 A;  4E7H A;  1VQK Q;  3QDF A;  2F2W A;  4A4K A;  1S1N A;  3CME Q;  4HT9 A;  3THK A;  1NBE B;  2D0N A;  2HZY A;  3J80 E;  2WAC A;  1UJ0 A;  3CC2 Q;  4OB1 B;  2DD4 A;  4OMP A;  1W2B S;  4RMO A;  2FVU A;  2CT4 A;  1QVG S;  2CKK A;  1VIE A;  2MPX C;  2M9U A;  2GBQ A;  1YCS B;  1VA7 A;  3CME T;  1QP2 A;  2X35 A;  4BE0 A;  2QK0 A;  5CKB A;  1W2B A;  2VGM A;  5CIU A;  1GRI A;  1VQ7 Q;  2M1H A;  2OI3 A;  1N9R A;  1D3B B;  1X6O A;  3VUZ A;  3REA B;  9ATC B;  3VV0 A;  3L2U A;  1K8A R;  2EYZ A;  4J9B A;  8ATC B;  2EQK A;  1NZ9 A;  2DMO A;  3L2V A;  3OS5 A;  2IIM A;  5IHN A;  4RTU A;  2YRV A;  1K76 A;  3HP9 A;  2LJ0 A;  1HK9 A;  4PL6 A;  3ER0 A;  5GMK l;  5GAN 8;  3C94 A;  1P92 A;  3V8J A;  2QQR A;  2DYB A;  1Q7Y R;  2AIR B;  2E5K A;  4J9E A;  3CCR T;  5KYU B;  1QKW A;  5GAO p;  4ZN3 A;  3VS7 A;  5GJV B;  3I35 A;  3JCM f;  1YWO A;  2EQJ A;  3C4S A;  4DOW A;  1OYX A;  1SSH A;  3X28 B;  4RKU E;  4QVZ A;  3CEY A;  4JLI A;  1M3C A;  1GL5 A;  4PJL A;  5CR2 A;  2GFA A;  3JAM E;  2JTE A;  1VQP T;  1H8K A;  3MP8 A;  4UC4 A;  2COW A;  3EGX B;  2G3R A;  3CCS T;  1W6X A;  1KQS P;  4KRT A;  3M59 A;  2M0O A;  4R56 A;  1WLP B;  3VS1 A;  1G3T A;  3QYG B;  1ZSZ A;  1UEC A;  2DPP B;  3G6E A;  4J7F A;  2DXB A;  2KRS A;  1VQL T;  1AVZ C;  3ZFJ A;  1ZSG A;  5FWB A;  3V8L A;  3G4S T;  2HMA A;  4FYW B;  3BY7 A;  2NUT A;  2ZPE B;  1R77 A;  1PWT A;  4D8D A;  3A8M B;  3RKW A;  5A0G A;  2KYB A;  3UPU A;  2H3J A;  4M78 C;  4J9I A;  3ZBD A;  4A4E A;  2DL3 A;  2HBP A;  3CCU A;  1IO6 A;  2NUP B;  1G3W A;  3EFS A;  4VUB A;  2LT4 A;  1XNI A;  2CZ1 B;  3WVE B;  3R6O A;  5IAY A;  1QKX A;  2FZC B;  1PM3 A;  3OA6 A;  2XDB A;  4J7I A;  2CT3 A;  3DB4 A;  2XD0 A;  3BDL A;  2MYS A;  2RHX A;  3GLX A;  1ZSZ C;  1LPL A;  3PT9 A;  1TSF A;  2AZV A;  1YIT Q;  1OUL A;  1NE8 A;  4M77 F;  1N6A A;  2BIV A;  1WYX A;  1JBM A;  2MK5 A;  2E3H A;  4IUU A;  1BBZ A;  2VYT A;  2QYZ A;  1NM7 A;  4M77 G;  3E1S A;  1AWJ A;  2K2M A;  2XI9 A;  1B7T A;  2L3S A;  4C92 E;  2KR3 A;  3M54 A;  4BY6 C;  4QVD A;  5KYU A;  4C0D B;  1NLP C;  1FMW A;  3A8G B;  3UAT A;  2RHZ A;  3JB9 J;  3J7A F;  1YJW A;  4X1V A;  2PVD B;  1VQK T;  3H6Z A;  2P84 A;  3UA6 A;  4IKF A;  3TQ7 P;  3MEA A;  3M53 A;  4HKE A;  2RQT A;  2E64 A;  1PSF A;  4JUV A;  4ORZ A;  1D3B A;  4JS5 A;  1GBQ A;  5HCK A;  4XTZ A;  1VQ8 Q;  1MGQ A;  5LJ5 g;  2XKO C;  5LJ3 g;  4JRK A;  1WQW A;  1HJD A;  1Y0M A;  2PVO B;  3SWN C;  3CMA A;  1M90 U;  2RNA A;  2YUP A;  3PGG A;  5CCA A;  2LT1 A;  5KE2 A;  4FT2 A;  4X9C A;  4BE2 A;  3M0P A;  2VB6 A;  1WHH A;  2ZCF B;  2CP3 A;  5D7U A;  3TRE A;  2X51 A;  5J3B A;  3LW5 E;  1VQK A;  1IZ6 A;  1YJW T;  2E6N A;  3CC2 T;  5EG2 A;  5C6S A;  2F5T X;  4JRI A;  1KJW A;  3T9N A;  4KH1 B;  3CCL T;  1M8V A;  2EJF A;  5LJ3 d;  4PJO F;  3QII A;  2KI7 A;  3JV3 A;  4Y28 E;  3RBB B;  1R0C B;  3FIF A;  1QVF A;  2DVE A;  4C5I A;  3ZEH A;  3X24 B;  1WGS A;  2KY9 A;  3OW2 A;  5I22 A;  1VQP Q;  1OEB A;  3TVT A;  4J9G A;  3VS6 A;  4M7D D;  1D0Y A;  4M78 E;  1FWZ A;  2F69 A;  1K73 U;  1M30 A;  2KQW A;  1WX6 A;  4BE1 A;  2DBM A;  2VAS A;  4A4G A;  3J81 E;  5GAN g;  2XMF A;  1YHQ A;  4M77 C;  2DEU A;  2SEM A;  2OTL T;  1SHG A;  2I2L A;  4AFZ C;  2ZPF B;  5I2S A;  1B34 B;  2EKH A;  4FW1 A;  2LCC A;  3CCR Q;  1PG5 B;  2KT1 A;  4PJO E;  4X34 A;  1SF9 A;  2KRN A;  5CAI A;  2COY A;  5GMK m;  3N5B B;  2LJ3 A;  4GLM A;  5GAM e;  2CP7 A;  3URG A;  1KD1 R;  3VYH B;  1VQ8 A;  4M7A G;  2HEQ A;  1YIJ Q;  1NJI U;  2QQ9 A;  1TTH B;  1YFN A;  3QYH B;  4LE9 A;  1TUG B;  4X9D A;  1SG5 A;  1KFZ A;  2O31 A;  5A0L A;  1D0X A;  3JCM Q;  1KG1 A;  3UF4 A;  2K7A A;  4EMK B;  3CMA Q;  3KUF A;  4L59 A;  2AK5 A;  4JPB W;  3P8B B;  1TH7 A;  4MMK A;  2V1Q A;  2JN0 A;  5LJ3 h;  2KK4 A;  5KH6 A;  1OV3 A;  3DLL A;  2V8I A;  1WDX A;  1U1T A;  1Q81 C;  5GAM g;  4XK8 E;  3V8K A;  4JZ4 A;  2X4W A;  1RL2 A;  3CPW S;  2JS0 A;  1M1K U;  2E10 A;  4ZGD B;  4L6V 5;  4C5H A;  2KT8 A;  2DTO A;  3EFO B;  1KSW A;  1M1G A;  2DZC A;  1ZLM A;  3G71 A;  3RIR A;  3EG3 A;  4M7D G;  1Q82 U;  3RDV A;  2J6F A;  1Y07 A;  4XU3 A;  3OBW A;  3V7C A;  3H41 A;  3M5A A;  4RUG A;  1YJ9 Q;  3C0C A;  5FU6 C;  5DLO A;  2PUO B;  4F16 A;  5FRM A;  4HCZ A;  2ESW A;  2V8J A;  3EAE A;  5D6X A;  4F14 A;  1MMD A;  1WXT A;  3LLR A;  3CCU Q;  4R55 A;  1WHM A;  3NMZ C;  1N8R U;  3CCM A;  4XTW A;  1WXU A;  3MP1 A;  4N4I A;  1BI1 A;  4PLL A;  3VRY A;  3EG0 A;  3X26 B;  1SHF A;  3JCM h;  5GAM d;  2L3R A;  1RLQ C;  3CXC P;  1OX9 A;  2QGG A;  1W4S A;  4AFU C;  4C0Z A;  1RUW A;  2HQX A;  3ULR B;  1WHK A;  1UEB A;  3P8H A;  4V2S A;  1NEB A;  1UHC A;  1D1B A;  3CCJ Q;  2DET A;  5J39 A;  1WHJ A;  3QBY A;  1Y57 A;  1TXQ A;  2VGN A;  5KYX B;  4E7J A;  2G6F X;  4M4Z A;  1VIF A;  1YI2 T;  2KRO A;  4AFQ C;  1K8A C;  2JT4 A;  4J9C A;  3UWN A;  4PJO A;  1OU9 A;  1QVG P;  2F5K A;  5GAN 4;  4IIO A;  2NWM A;  4J6X A;  3GF5 A;  4IUR A;  1VQ4 A;  1GCP A;  2KAF A;  1BB9 A;  4F7U G;  2P4R A;  4KUL A;  2M51 A;  3P8D A;  3M55 A;  2IVW A;  3FDR A;  1HXD A;  1T3S A;  4LNP A;  3QO3 A;  2ZGW A;  4CC4 B;  2DRK A;  3MET A;  4QT7 A;  2LTO A;  1J3T A;  3ZL7 C;  1MV0 B;  1BU1 A;  2DL7 A;  2VVK A;  2VUB A;  1BYM A;  5L8R E;  3VS0 A;  1QCN A;  2AZS A;  2CUD A;  4C0G A;  1KK7 A;  2EBP A;  1XOV A;  2DK3 A;  3L2W A;  5KYY B;  4GLK A;  4CRI A;  2W10 A;  3OW2 S;  1RAH B;  4KUI A;  3OYA A;  5FU7 C;  1AZE A;  4Z8A A;  1BIB A;  4OMF B;  3RMS A;  2ZPH B;  1S72 T;  4KH0 B;  4MML A;  3OYG A;  2XHC A;  3JB9 H;  3BFM A;  2HSP A;  4C8Q F;  2HCK A;  5KCH A;  4RTY A;  1AD5 A;  2HQH A;  1RI0 A;  2X3X D;  2MIO A;  2LQN A;  5GAN 3;  2J6K A;  3CD6 Q;  1Y96 B;  3OQ5 A;  3EGD A;  4M75 A;  4QQ6 A;  3CCQ Q;  3CBP A;  1UGQ B;  3LGL A;  2CZ0 B;  3V7R A;  1AWW A;  2DE0 X;  2D1X A;  3EHR A;  2JS2 A;  4M77 E;  4FYX B;  3VKI A;  3SDZ A;  3JB9 D;  3A8O B;  3M58 A;  3KFV A;  1O9S A;  1UGR B;  4PJO C;  1M27 C;  1WA7 A;  4DEY A;  1WPY A;  5CO7 A;  1ZUU A;  1XQH A;  3S6W A;  4JJB A;  4QQD A;  4F17 A;  1RI9 A;  4C8Q E;  2DBK A;  3QUI A;  2RHI A;  3CC7 T;  2RJC A;  3CC4 T;  4AG1 C;  2LZ6 B;  3Q1J A;  4MZT A;  1VYU A;  4RCC A;  4OP0 A;  2RI3 A;  1QQJ A;  2HKQ B;  2E70 A;  2QDY B;  2X3W D;  1JJ2 P;  5J26 A;  4IUP A;  2J05 A;  3G71 Q;  1YNZ A;  2VV5 A;  4QQG A;  3PIP A;  5CK9 A;  2X4J A;  3JCM c;  1ACM B;  2ROT A;  4KBM B;  3QJY A;  4BAC A;  1VQ9 Q;  3I56 A;  1YIT A;  1IRX A;  2CP6 A;  3MCA B;  4ESR A;  5KYN A;  2ED1 A;  1PCX A;  1GFC A;  1QWF A;  3SFM A;  3G4S A;  1M2O A;  1KHI A;  3X20 B;  1K9M C;  4LDV A;  5HKC A;  1VQM T;  1TOV A;  3TSZ A;  3NTH A;  3G6E T;  2MWO A;  1WJR A;  4DBR A;  1G3Y A;  3CCV A;  4KGZ B;  2EYX A;  2MOX A;  3I56 T;  1H3H A;  2COZ A;  1DJ7 B;  2EGE A;  4RTT A;  3M4G A;  1D1C A;  1R0B G;  1VQM Q;  3G6E Q;  3PMI A;  5I11 A;  2X9H A;  4XAX B;  2XK0 A;  3QDR B;  4N0A A;  4QW2 A;  2DEQ A;  1KHC A;  3H0I A;  1K9A A;  3I56 Q;  4PFO A;  4M7A A;  2YXY A;  2RMO A;  5CKE A;  3OYH A;  3FLG A;  2OTJ A;  1QVG A;  4M77 D;  3TU4 K;  3L1A A;  2JNG A;  4BI3 A;  4E6R A;  3OYE A;  1YCY A;  4ZN1 A;  2VXE A;  1ABQ A;  1TUC A;  2K79 A;  3EG9 A;  2K3B A;  5GMK h;  2CS7 A;  2GF7 A;  3OSS C;  3GNF B;  4ELY C;  2P0Q A;  4DOV A;  1Q86 R;  2KEA A;  3U23 A;  1C6V X;  2EAY A;  3FEO A;  2E1H A;  3C12 A;  1Y71 A;  3PVL A;  1ZBX A;  2R5A A;  4BDZ A;  4PJO G;  3QWX X;  1TWB A;  1LNX A;  2OTJ T;  3C95 A;  2I0N A;  4EMK C;  2O4X B;  2EGC A;  5CQX A;  1BIA A;  2OX7 A;  3BDU A;  1WHG A;  2MCN A;  4XTV A;  1IGU A;  1OI1 A;  4F7U B;  4C8Q A;  2L89 A;  5CKH A;  1VQO Q;  4Z88 A;  4M75 G;  2K5F A;  4C92 A;  1SSF A;  1UGV A;  5A0D A;  4OMQ A;  4DQ2 A;  3OYD A;  3L2Q A;  2RB6 A;  3CD6 A;  1IHV A;  2DA9 A;  2XID A;  2PZ1 A;  2YUN A;  3L2Z A;  2KSS A;  1WIE A;  3H9N A;  4E7I A;  1OOT A;  3GPL A;  1UDL A;  4C92 F;  1VQO T;  1ABO A;  2CRE A;  1KIK A;  2WSF E;  8AT1 B;  2DO3 A;  1QVP A;  2DRM A;  4KGV B;  4HVV A;  5GAO m;  4EDU A;  2LX9 A;  3MHX A;  1TG0 A;  2EFI A;  2LDM A;  3L42 A;  4QKU A;  3SHW A;  1U8R A;  3S3M A;  2H3E B;  2L5Q A;  1NPR A;  1M2V B;  1VOM A;  4ZTF A;  3PIO A;  2LMJ A;  1WJQ A;  4J9H A;  2DIG A;  5LJ3 e;  2RH2 A;  4O5V A;  4M7D F;  3QJ6 A;  4P5N A;  4WTO B;  4RG8 A;  1JJ2 A;  2RQU A;  4PFP A;  1UFF A;  3JCM V;  1QLY A;  1TUD A;  1QP3 A;  3CCQ T;  2JUF A;  2H8H A;  5A2Q E;  2WSE E;  2FYK A;  3JCM J;  1AWX A;  1Q81 R;  1JO8 A;  2X4Y A;  5IHI A;  3JB9 I;  1K0S A;  3HPW A;  3ME9 A;  1MMA A;  1VYV A;  4B9W A;  2DXT A;  1WFW A;  2ZPG B;  1PC0 A;  1RAI B;  2CP5 A;  3NHN A;  1YJW Q;  1CKA A;  1K9M U;  2AKK A;  2QA4 A;  2BTT A;  4D8K A;  2LNH B;  1JB0 E;  4C8Q C;  2D6F A;  3LH5 A;  2DKG A;  1PKS A;  2HNI A;  1WNL A;  1IGQ A;  4FSX A;  3V7S A;  3HFN A;  2M02 A;  4II1 A;  4CC2 A;  5AYF A;  1FXX A;  1RAE B;  2FRW A;  2QXF A;  2MWP A;  3AT1 B;  1R8O B;  3REB B;  4MDX A;  3MEV A;  2L3Q A;  1T0J A;  2VC8 A;  2RJE A;  1QVF S;  2DIQ A;  1WZO A;  4F7U A;  4F7U E;  2YSQ A;  3RUX A;  3A8H B;  2M0Y A;  2P0K A;  1VQ4 Q;  2K5I A;  2J7I A;  2O2O A;  3OMC A;  2O4X A;  3I55 T;  2P4T A;  2DFU A;  3JCM b;  5GAN j;  1I8F A;  3SWN A;  2DTI A;  1M4Z A;  1XJW B;  3FJP A;  3H0H A;  3BW1 A;  3OYK A;  1OZ3 A;  1V76 A;  3KBG A;  1BI0 A;  1YJ9 T;  5C0M A;  5CQY A;  1F1B B;  2A7Y A;  3SB2 A;  5FRO A;  4BDY A;  2A36 A;  3CCU T;  2ED0 A;  4Q5W A;  1YBY A;  2V1R A;  3MPU B;  3HFO A;  4JJD A;  5LL6 S;  1I5L A;  2QAS A;  2K3X A;  2A3L A;  2LRQ A;  2OJ2 A;  4N0A C;  2GTO A;  1MHN A;  3A5Z B;  3JCM X;  1VQL A;  4F7U F;  3JCM e;  2DTH A;  1X6G A;  2SRC A;  3VS2 A;  4M7D B;  1W70 A;  3QSU A;  2J6O A;  1SKU B;  1WXB A;  2R58 A;  5LJ3 j;  3OYL A;  2K6D A;  2C0I A;  3CBO A;  4J9F A;  2DVJ A;  2L3P A;  1BCM A;  2ZZD A;  3X25 B;  3PMT A;  5GAN 7;  1Q95 G;  1LJO A;  3GIB A;  3VS3 A;  4M77 B;  4BI4 A;  5IN1 A;  1UJY A;  2IG0 A;  3CCE Q;  4B9X A;  1X27 A;  4PFZ A;  1SRM A;  1LVK A;  1HSQ A;  2LJ1 A;  2FPF A;  4LDX A;  3GP8 A;  2A37 A;  4LDW A;  2IPO B;  2HBW A;  4OML A;  4HCC A;  2RD1 A;  4EMH A;  5LJ5 h;  4XU1 A;  2C0T A;  3CC7 A;  2HSE B;  2K9G A;  2X4X A;  4OMO A;  3OS0 A;  1JU5 C;  2FZK B;  1N9S A;  2EJ9 A;  3NGP A;  5KCO A;  1RAG B;  4LUD A;  4C8Q G;  4C0D C;  4F04 B;  2PQW A;  3MP6 A;  2PVG B;  2EQM A;  4M78 D;  2CZ7 B;  3TCJ A;  2EYQ A;  3CBM A;  2GCX A;  1QW1 A;  1H3Z A;  2KRM A;  3NTI A;  4A63 B;  4AFS C;  4PKC C;  2GFU A;  2RHU A;  1T0H A;  4E7K A;  2RF0 A;  4AT1 B;  1N5Z A;  3OBY A;  2EQI A;  4HVU A;  3IQL A;  4HCK A;  5GAO n;  3PVQ A;  2F1L A;  1I5O B;  1KQ1 A;  2Y4X A;  1Y7X A;  4OGE A;  3CCJ T;  4XTX A;  2QA4 T;  1ZUY A;  2XIC A;  2BE7 D;  4M78 G;  5CKD A;  5LJ5 e;  3M4Y A;  4M7A F;  2LQK A;  5FRN A;  1GXI E;  4FYV B;  1VUB A;  1VQO A;  3RR6 A;  4KUD K;  2FEI A;  2QQA A;  2MMP A;  4OVA A;  1KC8 U;  1M5Q 1;  3M0U A;  3JCM g;  4D6W A;  5GAN h;  4FU6 A;  1EIF A;  2E5Q A;  4MZM A;  3CD6 T;  1VQ8 T;  2E12 A;  5GJW B;  1E6G A;  2ENM A;  5GMK i;  3QWY A;  1BCO A;  1AWO A;  1OPK A;  1JRI A;  3UT1 A;  2KE9 A;  1NYG A;  1QCO A;  4J6Y A;  5KE3 A;  1YP5 A;  1VQ4 T;  3JB9 G;  1YN8 A;  3I55 Q;  3OYY A;  3CXC A;  4PLI A;  2KXC A;  2E65 A;  5KYY A;  1YI2 A;  4EIK A;  1JXO A;  2W0Z A;  4PJJ A;  3JB9 F;  4M7D C;  3LWH A;  4PNO A;  2E41 A;  4RCB A;  1FMK A;  1S72 Q;  4J8O A;  2HL3 A;  4ANJ A;  4E7S A;  1SRL A;  4Z89 A;  3M57 A;  1G2B A;  3OW2 P;  4HXJ A;  1FYN A;  4FCY A;  4XU2 A;  1FMV A;  4M77 A;  1KQS S;  3VRZ A;  3NFC A;  2F2V A;  4FL6 A;  3MEU A;  1Z9Z A;  2CDT A;  3D7S B;  3HRU A;  4M75 E;  1C1A A;  1V29 B;  3PNW C;  3CCL A;  4LD6 A;  1VQ6 T;  4M7D A;  4ZGJ B;  2AHJ B;  1Q7Y C;  1I1J A;  2LQW A;  5GAN d;  1TU0 B;  4NL3 A;  5KYX A;  2RJD A;  3LH0 A;  3CC4 A;  3O5Z A;  1UGP B;  4RTW A;  2ABL A;  1PHT A;  3NPF A;  5M9O A;  2FG0 A;  2CZ6 B;  2QTV A;  1X69 A;  2OAW A;  3HHT B;  3E9F A;  4XTU A;  2Y4Y A;  3M56 A;  1YJN Q;  4ATO A;  4OMM A;  4A4F A;  2HDA A;  1K1Z A;  3CCM Q;  3SWN B;  4EPC A;  2C06 A;  3QG1 A;  3G1J A;  2B8A A;  3H8Z A;  1Q82 R;  1JXM A;  1K73 R;  2KVQ G;  4BY6 B;  3O8V A;  3FC3 A;  2RJF A;  2L2P A;  4PJM A;  3VU3 C;  2JTM A;  4CC3 A;  3RKX A;  2BZ8 A;  1TS9 A;  4N4H A;  3CPW A;  1X2K A;  5HY6 A;  2LC4 A;  2NYS A;  4NOY A;  1RLP C;  2GGR A;  3TSW A;  3VUB A;  5I21 A;  5LJ5 f;  3OYB A;  1HD3 A;  4E7Z A;  2E3I A;  4ZTJ A;  3CCE T;  1WQ7 A;  4IUQ A;  5CKF A;  1NLO C;  1OPL A;  2MAM A;  1M8M A;  3EFO A;  2D8H A;  1ZBJ A;  1S72 A;  5FLX E;  5DY9 A;  2PNI A;  4JJC A;  3CCR A;  1X6B A;  3WXM B;  4MDW A;  3DKM A; 
#chains in the Genus database with same CATH homology
 1Q86 R;  3CPW P;  1VQ5 Q;  1VQ4 Q;  1M90 R;  3OW2 P;  1KD1 R;  3CCU Q;  3CCJ Q;  1VQO Q;  1KC8 R;  1VQL Q;  1W2B P;  1YJW Q;  3G4S Q;  3I55 Q;  1VQM Q;  1JJ2 P;  1YIJ Q;  1K9M R;  1NJI R;  2OTL Q;  3CCM Q;  1VQP Q;  1VQ7 Q;  1N8R R;  3G6E Q;  3CCV Q;  1YIT Q;  3CC2 Q;  3CD6 Q;  1Q7Y R;  2QEX Q;  3G71 Q;  2QA4 Q;  3CCE Q;  3CCR Q;  3CCQ Q;  1YI2 Q;  3CCS Q;  1Q82 R;  1VQ8 Q;  1K73 R;  1VQN Q;  1KQS P;  2OTJ Q;  1VQK Q;  1Q81 R;  1K8A R;  1S72 Q;  1QVG P;  3CC7 Q;  1YJ9 Q;  3I56 Q;  3CXC P;  1VQ6 Q;  1VQ9 Q;  3CCL Q;  1YHQ Q;  3CC4 Q;  1QVF P;  3CMA Q;  1M1K R;  3CME Q;  1YJN Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...