3I55Q

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3i55Q00
3CC4Q 3CCJQ 3CC2Q 3CMAQ 1N8RR 3CCUQ 1W2BP 1K9MR 1JJ2P 3CMEQ 1VQNQ 1NJIR 1KC8R 1VQLQ 1YI2Q 1VQOQ 1VQ4Q 1VQ5Q 1Q7YR 3CCVQ 3I56Q 3OW2P 1VQMQ 3CXCP 2QA4Q 1K73R 1KD1R 3CCRQ 1YJNQ 3CCQQ 3CCEQ 1YIJQ 1VQ9Q 1QVFP 3CCMQ 1YJWQ 1VQPQ 3G6EQ 1QVGP 1K8AR 3CD6Q 1M90R 3G4SQ 3CCLQ 3CPWP 3CC7Q 2QEXQ 1S72Q 3CCSQ 3G71Q 1Q81R 1VQ7Q 1YHQQ 1Q82R 2OTLQ 1KQSP 3I55Q 1M1KR 1YJ9Q 1VQKQ 2OTJQ 1YITQ 1VQ8Q 1VQ6Q 1Q86R
chains in the Genus database with same CATH superfamily
2VYTA 4M7DD 4LXCA 4M77A 1YI2Q 3CXCS 1UTIA 1C6VX 2X4JA 2QA4T 2C0IA 3CCJA 1G5VA 1WYXA 2DYIA 2GBQA 3P8DA 2JXBA 2DEUA 3CCMT 4R56A 3BW1A 2DXUA 4CC2A 2QQSA 1NEGA 3JB9F 2RB6A 3MP6A 1JXOA 3OBWA 2KEAA 2RQUA 2NUPA 2R5MA 2DTHA 2H3EB 5GAMe 3TREA 4N4GA 2EFIA 3EFOA 1EX4A 3J80E 1SRLA 3CC2A 5J3BA 5LJ3d 3SDZA 2R5AA 1ZSZC 2QQAA 2GGRA 3VS2A 4QVCA 3G71T 3MO8A 4JLIA 4WCIA 3JB9D 1VQ8Q 2XU8A 1M30A 5GAN8 3OYBA 3CCUQ 1N8RR 1UG1A 4M75E 1ZUUA 2OAWA 1Q81C 3EGXB 2QI2A 4FYYB 1VQ5Q 4M77G 1NLOC 1SSHA 1EIFA 3L1AA 4J9IA 2VGNA 1P92A 1CKBA 1AD5A 3OYEA 2IG0A 3G6EQ 4MZMA 2CP6A 2D6FA 3JCMc 1B07A 3F70A 1Q7YU 2DA9A 1VQ6Q 2L3SA 2EVRA 3O8VA 3CCSA 4PK4A 2VV5A 3H41A 2HKQB 4RTWA 2RJFA 3EG9B 1M1KU 3META 3A8GB 2AIRB 4V2SA 3CD6Q 3G4SQ 2YDLA 1WIEA 4E7HA 2OJ2A 1VIFA 1GBQA 5KYXB 5AYFA 3HRUA 1F1BB 2M16A 5LJ3e 1UE9A 4FM4B 1IB8A 1Q82U 1R77A 1QMCA 4DQ2A 3WXMB 3QHSA 5GANg 1Q86U 2EWNA 5M9OA 3CCVA 2QASA 4EDUA 2EKHA 1OPLA 4Z89A 1M8VA 3X25B 2F2VA 2B8AA 1BI0A 2JJ9A 2L0AA 3OYYA 1Y7XA 2M51A 4PLIA 2B86A 3OYCA 1WHMA 4A54A 4E7IA 2KNBB 2NYSA 2KDSA 4MMKA 2HQEA 5CQXA 4F16A 4OMNA 3RDVA 2FL7A 2QDYB 4PJOA 4AFQC 1YJ9T 2H8HA 4ZTJA 4M75F 1OPKA 3A8OB 4RMOA 5GAN3 1K8AC 3QG1A 1NPPA 2JS0A 3MPUB 4AT1B 3EHQA 3MEVA 3CCRQ 3HTRA 2DIQA 4C8QG 3M9QA 2QK0A 1KQSS 3CC7Q 1IHWA 3NTKA 1I8FA 3V8KA 1LCKA 1FXXA 3JCMW 4M75D 2E1HA 5KYWA 2L2PA 4M7AD 2DJQA 2VWFA 5A0GA 8ATCB 1H3HA 1UHCA 2C06A 3OQ5A 2RA2A 3EH1A 2ENMA 1FMVA 2E6NA 2LJ3A 2HL5C 2RQVA 3PMIA 3JCMf 1KC8C 3V7CA 5FWCA 1KFZA 2LJ0A 4HCZA 4PJOG 3ER0A 3MKDA 4HVVA 1S72A 4N0AC 2L3RA 1YI2T 3C4SA 3OY9A 4FYWB 4M77E 3CXCP 1M9SA 3L2QA 4PJNA 5CIUA 4DOVA 4FU6A 1YBYA 2DD4A 1M2OA 2ED1A 2I2LA 1G83A 4O5VA 1M27C 4AG2C 2CYZB 3GPLA 3M0RA 2HAXA 1YWPA 4PFZA 4C92F 4C8QC 5I11A 2AKKA 2YT6A 4JRQA 5GANj 2EJFA 2DX1A 1X6BA 2CSQA 2KR3A 4WF2A 1OX9A 2FRYA 1PD1A 4RTTA 1AVZC 1U06A 3UWNA 1Y96A 2DIGA 1KD1C 2YSQA 1T3SA 1VQ8T 2QTXA 4P5NA 1WFWA 2V8KA 2XK0A 2PVOB 3CCUT 1WQWA 1MV3A 4VUBA 3D7SB 1D1BA 4X9CA 4C92D 1VQ5T 1A0NB 4A4GA 2K6DA 1VYTA 1ZHIA 2CGHA 1JB0E 3G6ET 5ECAA 1T3LA 3G1JA 1KK7A 4NOYA 3GBQA 1VQ6T 3CBPA 3LX7A 3OMGA 3X24B 2ZPFB 2RQTA 3BDLA 1RLPC 3PMTA 2YLCA 1QVFS 1M3BA 2DILA 2GTJA 4LDWA 1I5OB 1ABOA 3CD6T 2FEIA 3G4ST 1U5SA 1SRMA 1IGQA 2CH4A 3LLRA 2F2XA 3PFSA 1YIJA 5GAMf 3CMAT 2L5QA 2K79A 1PRLC 3MP8A 4FIBA 2LQ8A 1Y0MA 3L42A 1KC8R 4M77F 5IHKA 2LNVA 3EGDB 2RK1A 4C8QE 2DJZA 3ZBDA 2JN0A 1GCPA 1PG5B 4IUUA 2LX7A 3EFRA 3GNGA 2GTOA 2ZPBB 1UFFA 4ATOA 1M2VA 2W10A 4C5IA 2A0FB 1HJDA 1KIKA 4GBQA 2DL8A 4J8OA 3UA6A 3J7AF 2HQXA 4MDXA 4N4IA 4JRPA 1BU1A 5EG2A 2LVMA 4C0DB 2NUTA 4A4HA 2LT1A 3DKMA 3RUXA 3CC4Q 5GANe 1TSFA 2MMPA 1WZOA 4LE9A 1VQLQ 2WACA 3OW2S 1M90U 1K73R 1KD1R 2ABLA 4R0KA 1T0JA 3THKA 2DL3A 2K4YA 2DNUA 3N5BB 3S6WA 3CC7T 3G71Q 4BY6C 1KQSP 2QAZA 4OVAA 1KJWA 4E47A 5FRMA 1TS9A 1D0XA 2KK4A 1TXQA 1GCQC 4PL6A 1JBMA 4E7ZA 4M78D 2DTIA 1UDLA 3I55A 4HCCA 3JCMd 4J6YA 2VC8A 1YFNA 3REAB 5FROA 1QKWA 5I2MA 2D8JA 1JU5C 3CMEA 1QVGS 3SWNB 1K9MC 4J9DA 2LJ1A 2P0PA 1NZ9A 1G8XA 1D3BB 2P4TA 2FHDA 3HHTB 2E70A 4DEXA 2COZA 1X27A 3M53A 3QDRB 2HEQA 3ME9A 4JRKA 5GAOm 3T9NA 1TG0A 2HKNA 1D0ZA 3M54A 3A8MB 3A98A 3QZ5B 5C0MA 3JB9J 2RJCA 2X4YA 3LYIA 2QEXQ 3C95A 5IXFA 2K2MA 3OYFA 3CCQA 1QWEA 2RO0A 1M1GA 2ROLA 2XHCA 3NGPA 1YJWA 4M7DB 2E10A 1QW1A 4XU1A 3CBMA 1W4SA 1ARKA 3RMQA 2HD0A 1YJNT 4JJDA 1FYNA 1ZSZA 1OEBA 1T0HA 1MV0B 1VYVA 2L8DA 5FLXE 1EZZB 2LQKA 1Y07A 4RCCA 4PJOF 3UATA 2EYZA 5DLQE 3UF4A 3X20B 4IUVA 1RLQC 1GL5A 2RN8A 3H0IA 1YN8A 2RHIA 4B6MA 1VQ4Q 5GJWB 2PQWA 5D6YA 4QW2A 1IZ6A 1WA7A 2RI3A 5KCOA 3M56A 3FB9A 4M4ZA 3L2VA 3EAEA 1VQPQ 3CCLT 3OA6A 2G3RA 2CSIA 4ZGEB 1Q7YC 4PJOD 1JO8A 4MZTA 3ZL7C 1YJ9Q 2KXDA 2HZYA 3OSSC 5D6XA 3OSVA 3OYLA 1PD0A 1IHVA 3EG1A 3A5ZB 1N27A 1PC0A 3M4YA 2JUFA 3VYHB 1HXDA 3VV0A 2ZZDA 3RMSA 1M1KC 1OU9A 1RUWA 2F2WA 5GAMd 1VQNA 1QVFP 2DMOA 4BE0A 4J9BA 3KUFA 1C0MA 1GRIA 4WTOB 4OB3B 5GAN5 2HMAA 4KT0E 2RPNA 3MEAA 1AEYA 4LDUA 3WVEB 1BIBA 1QVGA 1VQKQ 3URGA 2O9VA 3RERA 1V1CA 1X69A 4L5GA 5IN1A 4OB2B 3OBYA 1GFCA 3RNJA 1Q82C 2COWA 2CH4W 4F04B 2L3QA 5A2QE 3KBGA 3PTAA 5D6WA 2EYXA 2P4RA 4HT9A 3PT9A 2YUNA 2QA4A 2XKOC 1RACB 2CZ0B 3L2ZA 2QQBA 3CCMA 2CDTA 4LUDA 1MMGA 1KSWA 4Y92A 4M7AC 2QTVA 4OMOA 3M0UA 3X28B 5GMKj 1NPRA 2CT4A 4ZNXA 5DLOA 3EFSA 5CVIA 1RI0A 3GP8A 3J81E 1YCSB 1WXTA 1NJIU 2CT3A 2E41A 1BI2A 1XNIA 2EGAA 3CC4T 5FU7B 2CP2A 4KUDK 2CUBA 4QQGA 1G2BA 2CP0A 2FG0A 3M0PA 1BKBA 4J6WA 1VQLT 3I56Q 3OW2P 2O4XB 2K2VA 1WLPB 1TOVA 4QQDA 3V8LA 2DXTA 2C0OA 2EJ9A 2XICA 1WXUA 1YHQQ 5LJ5h 4CRIA 2LNHB 2EGCA 2O9SA 2BKDN 3BE3A 1SSFA 4PKCC 3SB2A 4EMKB 3JCMP 2LT4A 2JMCA 5J26A 5GAOr 3PE0A 5GAN4 2XD0A 3EG0A 1KHCA 2KRNA 1QVGP 3X26B 1NLPC 1E6GA 4RG8A 4JPBW 2D8HA 2KY9A 4M75B 2KBTA 4NL3A 2X9HA 4FW1A 1UGVA 4M7AB 4N0AA 1ZBXA 4XTUA 1I07A 1WXBA 3FIFA 3PIOA 4LD9K 3PVLA 3VYGA 1IO6A 1XQHA 2FZCB 5A0DA 1SPKA 3TSZA 2DK3A 3SD4A 2DL7A 4XTXA 1N8RU 1NYGA 1ZLMA 5GANf 2QEXT 3LH0A 4O6JA 1RAEB 2NLUA 1ACMB 3I35A 3CMAQ 2LTOA 1UGPB 4IUQA 4J83A 4KULA 2DBMA 1VQOQ 2DPPB 4C0GA 5GMKm 2KVQG 2DFUA 2X51A 4Z02A 3E2UA 4C8QA 2HL3A 2LCLA 1OYXA 3EGDA 2X4WA 4F14A 1MNEA 4BDYA 3CCST 1ZQ1A 3CBOA 1QCOA 4E7LA 5GMKe 2PNIA 1BB9A 1JXMA 1YWOA 1X43A 4PJMA 1YITQ 3SEMA 1JJ2S 1VQ9A 2CZ7B 2FVUA 1N6AA 1SF9A 3JCMJ 2RJDA 1Z9QA 4XAXB 1QKXA 2E64A 1VQ4T 1R8OB 2KAFA 2DXCA 1B34A 1N5ZA 2DRMA 3CPWS 3RKWA 1VQPT 2O31A 2ZGWA 2K5LA 4A4FA 1MUZA 2EBPA 5HY6A 2GQIA 1W2BS 2JOYA 2ZAEA 4PJLA 4C92B 5DY9A 2VVKA 4BD3A 1VQMQ 4LN2A 4F7UA 2DEQA 4RCBA 2X35A 4E7JA 3OS2A 5LJ5g 3OS5A 2DVEA 3U23A 2DRKA 2PVDB 2DAQA 3JRZA 3UT1A 1Q81R 1VQ7Q 2OTLQ 4JJCA 4RTZA 4AFUC 3GLXA 4JUVA 2RK2A 1VQKT 1AWWA 3QUIA 3RESA 3KXTA 3RR6A 3S3MA 4XU3A 5KYYB 3RIRA 2OTJA 4LD6A 4HT8A 3JB9I 1UJ0A 1RABB 3ZFJA 1X01A 3H0HA 1YI2A 5FRNA 4HXJA 1B3QA 4RG2A 5J39A 4J9CA 1BBZA 4IKFA 2L89A 2AT1B 2NWMA 1D1CA 2FPDA 1C1AA 2JTEA 2A37A 4CI0C 2D1XA 4JRIA 2E5QA 1PRMC 1R0CB 1PM3A 5FWBA 5GAOn 1AWJA 4F7UG 2E4HA 1K76A 2L3PA 1I1JA 4FCYA 2A7YA 3C12A 3NPFA 1QCFA 3ASKA 3QWXX 4BI3A 2X3WD 5LL6S 1X2KA 4M7DA 1LNXA 2CKKA 4OMMA 3JV3A 1X75C 4JZ3A 3GNFB 4J7IA 2DKGA 1WNLA 2HQHA 1VQ8A 3I56T 5IHIA 1JJ2A 1YJNQ 3CCUA 3CPFA 3NMZC 2RHXA 2HDAA 3DLLA 1VQ5A 3MJXA 2HBWA 1YHQT 4BDZA 1W70A 1QP3A 1G3WA 1GCQA 3CPWA 3G6EA 2NUPB 2CP3A 4OMQA 1QVPA 5HK3A 2LP5A 2RI5A 2VB6A 3NTHA 1VQ6A 1W2BA 4C5EA 2BZ8A 4MMLA 1AWXA 4ZN1A 1K8AR 3CCLQ 1H3ZA 4C0DC 1BI1A 4ZGDB 4KGXB 2JS2A 3UDCA 3QO3A 5CKFA 5HCKA 4M78B 2PU9B 3G4SA 2CP5A 4M7DG 4IURA 2MK5A 1FMKA 1G3SA 5GANd 3RKXA 5LJ5j 2GFAA 2JTFA 2LX9A 4J9FA 3PNWC 3VUBA 2ZPEB 2YUPA 2EQKA 2ZPGB 5KE3A 2V1RA 5CCAA 3TCJA 4KUIA 5LJ3h 1RAGB 4AFSC 1JQQA 1VQOT 1Y71A 3O5ZA 2AHJB 2MF2A 4ORZA 1QWFA 3A1PA 2IVWA 4QVDA 4OMFB 3SWNC 4XTZA 2RHUA 3INZA 3Q1JA 3LWIA 2JW4A 3BDUA 2E12A 1YITT 3JCMQ 3HPWA 1BCOA 1JJ2P 1AZEA 5AT1B 1IRXA 4M77D 4CC3A 4KH1B 4C0ZA 4J9HA 1YIJT 5EC7A 1TTHB 2EQIA 2KYBA 2O01E 2ROTA 3CPWP 1WPYA 4X1VA 3CCRA 1KC8U 3I9QA 2K9GA 4FSXA 2EKOA 2HSEB 3G7ZA 1KHIA 3S3NA 3PIPA 1UEBA 3CC7A 1W2BP 4M7DC 3CEYA 1GFDA 2EQUA 4OGCA 3M4GA 2AZVA 1OU8A 1VQMT 3OS1A 2O4XA 2JVVA 3OYHA 1WGSA 3CCEQ 3MP1A 4F7UE 3AHUA 3VU3C 4PJOB 1VUBA 3QJYA 1VQ7T 2OTLT 2FO0A 2A3LA 4OB0B 4J9EA 2O2OA 3CCJQ 2ESWA 1M4ZA 5GAN7 4EMKA 2KMTA 3QYHB 2E6ZA 2J6OA 2BZYA 3EGXA 1IGUA 1O75A 3M0QA 2EGEA 2DZCA 1RAIB 2E3IA 2FRWA 2KQWA 4CC4B 7AT1B 1I5LA 2ED0A 4HVUA 2VKNA 2WSEE 3EG2A 5GAN2 5LJ5e 4IUTA 1PKSA 1K73U 1KD1U 4D8KA 4AG1C 3CC2Q 1AHJB 3VS3A 4M7AA 4A63B 3CQTA 4E2FB 1XOVA 1N9RA 3FJPA 3EG9A 2J06A 3V7RA 2RH2A 4C8QF 4E7SA 2CS7A 1NJIC 5LJ3g 3HP9A 3I55T 4KGVB 1WX6A 2YRVA 2ZCFB 2DLPA 4II1A 1AZGB 3NTIA 5KYXA 4QT7A 4HCBA 1MMNA 3BFMA 4M7DE 1R0BG 2PZ1A 2RQWA 4C8QD 2EYQA 4PNOA 2RMOA 3EG3A 3M0SA 3CCSQ 5KE2A 2KYMA 1M3CA 2M0OA 2QQRA 1WQ7A 4Z8AA 5CKBA 2WSFE 2A28A 2J6KA 2M02A 2BE9B 4M7AG 5DM7R 1WHGA 2V8IA 3R6OA 3QSUA 1TU0B 1PHTA 2OAUA 3VS0A 4F7UF 3QKJA 2JM8A 4ANJA 1ZBJA 2K5IA 3OMCA 5IAYA 1Y96B 2YHTA 3TQ7P 2J05A 2MAMA 1BCMA 5I21A 3I5SA 5FU7C 2Y4YA 4EMHA 3VS7A 1UGRB 1WI7A 3CCVQ 3R6NA 1D0YA 1VA7A 1K9AA 1H8KA 2GQVA 3OYKA 1VQ9Q 1OULA 4UC4A 1MGQA 1LVKA 2F5TX 4QVZA 4JLGA 2YXYA 2LMJA 2PUKB 4MDWA 1K9MR 4LUEA 4X9DA 4EMKC 3JB9H 4DA4A 4KBMB 2AZSA 2FB7A 4D6WA 5C6SA 1SHGA 2LDMA 2KI7A 1G3TA 1Q86C 5KCHA 1WHKA 3HFNA 3S3OA 1M3AA 2XG8D 1ZA2B 5CAIA 5KYNA 4M75C 4M7DF 1LOJA 1E7OA 1E6HA 1PSFA 4FYXB 2BUDA 1M8MA 3FLGA 3CC4A 1H92A 4RUGA 1FWZA 1XTDA 1VQLA 2EPDA 1G3YA 4RKUE 2F69A 3JCMX 3FC3A 1RAHB 2RF0A 4FW2A 1K0SA 1M2VB 1IXDA 3OYDA 4ELYC 2DF6A 4NL2A 2J7IA 1WDXA 2FZKB 2MWOA 3G71A 2XDPA 4OGEA 3QWYA 1V29B 1SEMA 3DB3A 1PNJA 1NE8A 3CCET 4ESRA 2MIOA 2NUTB 4ZTFA 1S72Q 2JMAA 3AT1B 2ATCB 1BIAA 5GJVB 2YWWA 4TVRA 3CCJT 4BE2A 2DTOA 4OMPA 5FW9A 2K57A 2MWPA 1GBRA 5KYUB 3L2UA 1Q7YR 3VS1A 4EMGA 1TUGB 2DETA 2MCNA 4F17A 2E5KA 2D0QB 1M1KR 4M78A 2R58A 3CC2T 1KQ1A 2A08A 2QEXA 2EYWA 1M1FA 2KE9A 1U3OA 2KT8A 2CUDA 4M7AE 4C92C 1AOJA 1RADB 3RBBB 3QZ9B 4XU2A 3QJ6A 3MEUA 4HVWA 3VJPA 3HKSA 3VKIA 1Q82R 5CQYA 2FPEA 4L59A 3L2WA 1WJSA 1SG5A 2XMFA 1Q86R 2ECZA 5IXBA 3HRSA 3MHXA 3OB9A 1TUCA 3QDFA 5CK9A 4R55A 2BZXA 3LWHA 2BIVA 1V76A 2XI9A 3C0CA 4PFPA 4LDVA 1I81A 1D09B 3V7SA 1ZUKA 3H6ZA 3IQLA 2DVJA 1S1NA 2VGMA 1VQ4A 2VXFA 1UHFA 6AT1B 3MEWA 3JCMh 4LDXA 2Z0WA 2NUZA 2CZ1B 3FRNA 1I4K1 2LCSA 4E7KA 1VQPA 4M78G 5IT9E 5CKEA 2K5FA 1YJ9A 3GOXA 1ZSZB 2W0ZA 2F5KA 4RTXA 1YIJQ 2EIFA 3CXCA 5LJ5f 1MHNA 4JS4A 2LC4A 4XK8E 3HSBA 4PLLA 5FU6C 1QCNA 4BB7A 1U8RA 3PVQA 4FSSA 3OYMA 2VUBA 2GCXA 4DBQA 5HKCA 2K3YA 4M77C 1PCXA 5IH2A 1VQKA 3CCVT 4C92E 1QQJA 2C0TA 1ABQA 2JT4A 1VQ9T 4GLKA 1KG1A 1TUDA 5I2SA 4AMCA 2EQMA 3VUZA 2X3XD 3E9FA 1PSEA 5CKHA 4DBFA 4HKEA 4ME7A 4GLMA 3QYGB 1HYOA 1RAFB 1HK9A 2KROA 5L23A 4M7AF 1SKUB 4FT2A 2RD1A 2ZPIB 3HFOA 9ATCB 5GAOq 3LW5E 4FT4A 3V8JA 1PKTA 2QGGA 3SWNA 2WSCE 4EPCA 2JNGA 4PFOA 4J5YA 4BE1A 5L8RE 1D3BA 1FX7A 1OV3A 2HSPA 3OS0A 2YRDA 4M78C 4OF1A 2DYBA 3M55A 2KXCA 1M5Q1 3JAME 4Z88A 1RL2A 1Q81U 1DJ7B 4ZN3A 4YTLA 2MI6A 4J6XA 5D7UA 4XTYA 1Z9ZA 3VRYA 2EW3A 3P8HA 3I56A 4JJBA 3OYJA 2I0NA 1EFNA 2VASA 3I55Q 2Y4XA 5FU6B 2JZ2A 2PUOB 2OTJT 3E9GA 3MCAB 2EYYA 3NHNA 5GAMh 3CMEQ 4J9GA 1YHQA 4M77B 2YLBA 1M90C 3OYGA 3ULRB 2QQ9A 4BUGA 1WHHA 4GY5A 2E65A 3JCMg 4XTWA 1ZUYA 1S72T 1LPLA 3LGLA 2D0NA 1NEBA 2JM9A 3BY7A 2FZGB 2R57A 1UB4A 1UUEA 4BI8B 2PVGB 3EFOB 1O9SA 1QLYA 2OI3A 3A8HB 5GMKi 3TEEA 3CCQQ 4B9WA 2FYKA 1ZA1B 2DBKA 1YJWQ 1TH7A 2RNAA 4OMLA 2OX7A 1VYUA 1B7TA 2DL5A 3LH5A 5GAOl 1K73C 2GFUA 2HBPA 4BACA 1BK2A 2CZ6B 1X6GA 1UGSB 3CD6A 1BI3A 2SRCA 4M78E 2M1HA 2HNIA 2CREA 1OZ2A 2D9TA 2M9UA 4C5HA 2M0YA 3CMAA 4LDYA 3SHWA 4CC7A 2ZPHB 1N9SA 1RAAB 1KQ2A 3KFVA 2V26A 3JCMb 1VQOA 2BTTA 4JDSA 1HD3A 3WVDB 4PJOC 2VXEA 2JTMA 1KQSA 4KRTA 2KGTA 1OQKA 4HCKA 1K8AU 1MMAA 8AT1B 5IHNA 1YITA 1MMDA 2YUOA 1SHFA 2K3BA 2RI2A 4IUPA 5GMKh 1IREB 3QPHA 1WJQA 2XDDA 1XJWB 1OOTA 2CP7A 4Q5WA 1CKAA 3PGGA 4Y28E 4IIMA 2P0QA 4AFZC 3JB9G 3VRZA 1AWOA 2HCKA 1I0CA 4OB1B 4JJNK 1VQNQ 3QBYA 5LJ5d 1GXIE 4C5GA 4FYVB 4C8QB 4XU0A 1PWTA 2DM1A 3L2RA 3HL8A 1M90R 2XDBA 2A36A 2G6FX 1VQMA 5GAMg 1JEGA 1NBEB 3M5AA 2AK5A 2X4XA 4L6V5 2DERA 1J3TA 2QDLA 1LJOA 1VQ7A 3QXEB 3OYNA 1K0XA 2OTLA 4A53A 2GF7A 4DOWA 2P0KA 1U1SA 3TVTA 2QA4Q 3H0FA 2DL4A 4E6RA 4OP0A 1B34B 4EIKA 1TWBA 3CCMQ 3M0TA 4A4EA 4RTUA 3GIBA 3SFMA 1CSKA 4PJOE 5CKDA 4M78F 1RI9A 3TU4K 1H641 4NS5A 1VIEA 3E1SA 3VS4A 2GNCA 4XTVA 5KYUA 2IPOB 4F7UB 2DZ9A 2QYZA 4K11A 3CCRT 2RJEA 4MZPA 4HA8A 1OX8A 1X2QA 2KRMA 3LGFA 2EJGA 5LJ3f 3UA7A 4M75A 3H8ZA 4X34A 5KYWB 2LRQA 1BYMA 2SEMA 1Q95G 2DE0X 2QXFA 4A4KA 1WHJA 1UJYA 2RM4A 1HSQA 4J7FA 4Y91A 4RTVA 4JS5A 4KH0B 1QVFA 1YJNA 1JRIA 4RTYA 1QP2A 2KSSA 2LZ6B 4D8DA 3I5RA 3OYIA 2COYA 1X6OA 3JCMV 4B9XA 3CMET 1OZ3A 2MYSA 1UGQB 3C94A 5GAN6 3A8LB 4LNPA 4KGZB 2K3XA 2J6FA 1UECA 3EHRA 3REBB 5CR2A 2EAYA 3QIIA 3CCLA 4M75G 2IIMA 3M59A 2O88A 3DLMA 5A0LA 2LQWA 2V8JA 1NG2A 1YNZA 1YCYA 3DB4A 2BE7D 1NYFA 1ZSGA 3CCQT 3E19A 1K1ZA 3OYAA 1ZX6A 1YJWT 3FJ5A 2KRSA 4BY6B 2QG9B 4QKUA 5GAMj 1MNDA 1WJRA 1YP5A 4XQ3A 3JCMe 5I22A 2RQRA 2RHZA 1OI1A 2XIDA 3JSCA 2F1LA 1U1TA 4C0FA 3VS5A 4C92A 3GF5A 4ZGJB 2DO3A 5GAOp 3OW2A 1N8RC 1Y57A 4PJJA 3ZEHA 2E3HA 1WHLA 5GMKl 1D1AA 3H9NA 1VOMA 3EGUA 3M57A 2AKLA 4JZ4A 1FMWA 3EH2A 5KYYA 2YRCA 3TSWA 2FPFA 5KH6A 2DXBA 1NM7A 4DEYA 5CO7A 2K7AA 4DBRA 4BI4A 3UPUA 3M58A 3FDRA 2DD5A 2MOXA 3NFCA 2RHYA 1NJIR 1VQNT 2H3JA 4IIOA 1W6XA 2MPXC 2Y90A 2KT1A 4C92G 2P84A 4FL6A 1K4US 2EQJA 2V1QA 4N4HA 4QQ6A 4ELZC 1K9MU 3FEOA 3HRTA 3RKYA 5LJ3j 3VS6A 1W1FA 2QGFB 5HK0A 2YUQA 1AT1B 2LQNA 3P8BB 5GANh 3CCEA 2PTKA 2OTJQ 4DBHA 2LCCA
chains in the Genus database with same CATH topology
3CC4Q 3CCJQ 3CC2Q 3CMAQ 1N8RR 3CCUQ 1W2BP 1K9MR 1JJ2P 3CMEQ 1VQNQ 1NJIR 1KC8R 1VQLQ 1YI2Q 1VQOQ 1VQ4Q 1VQ5Q 1Q7YR 3CCVQ 3I56Q 3OW2P 1VQMQ 3CXCP 2QA4Q 1K73R 1KD1R 3CCRQ 1YJNQ 3CCQQ 3CCEQ 1YIJQ 1VQ9Q 1QVFP 3CCMQ 1YJWQ 1VQPQ 3G6EQ 1QVGP 1K8AR 3CD6Q 1M90R 3G4SQ 3CCLQ 3CPWP 3CC7Q 2QEXQ 1S72Q 3CCSQ 3G71Q 1Q81R 1VQ7Q 1YHQQ 1Q82R 2OTLQ 1KQSP 3I55Q 1M1KR 1YJ9Q 1VQKQ 2OTJQ 1YITQ 1VQ8Q 1VQ6Q 1Q86R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 Q;  3CCJ Q;  3CC2 Q;  3CMA Q;  1N8R R;  3CCU Q;  1W2B P;  1K9M R;  1JJ2 P;  3CME Q;  1VQN Q;  1NJI R;  1KC8 R;  1VQL Q;  1YI2 Q;  1VQO Q;  1VQ4 Q;  1VQ5 Q;  1Q7Y R;  3CCV Q;  3I56 Q;  3OW2 P;  1VQM Q;  3CXC P;  2QA4 Q;  1K73 R;  1KD1 R;  3CCR Q;  1YJN Q;  3CCQ Q;  3CCE Q;  1YIJ Q;  1VQ9 Q;  1QVF P;  3CCM Q;  1YJW Q;  1VQP Q;  3G6E Q;  1QVG P;  1K8A R;  3CD6 Q;  1M90 R;  3G4S Q;  3CCL Q;  3CPW P;  3CC7 Q;  2QEX Q;  1S72 Q;  3CCS Q;  3G71 Q;  1Q81 R;  1VQ7 Q;  1YHQ Q;  1Q82 R;  2OTL Q;  1KQS P;  3I55 Q;  1M1K R;  1YJ9 Q;  1VQK Q;  2OTJ Q;  1YIT Q;  1VQ8 Q;  1VQ6 Q;  1Q86 R; 
#chains in the Genus database with same CATH topology
 2VYT A;  4M7D D;  4LXC A;  4M77 A;  1YI2 Q;  3CXC S;  1UTI A;  1C6V X;  2X4J A;  2QA4 T;  2C0I A;  3CCJ A;  1G5V A;  1WYX A;  2DYI A;  2GBQ A;  3P8D A;  2JXB A;  2DEU A;  3CCM T;  4R56 A;  3BW1 A;  2DXU A;  4CC2 A;  2QQS A;  1NEG A;  3JB9 F;  2RB6 A;  3MP6 A;  1JXO A;  3OBW A;  2KEA A;  2RQU A;  2NUP A;  2R5M A;  2DTH A;  2H3E B;  5GAM e;  3TRE A;  4N4G A;  2EFI A;  3EFO A;  1EX4 A;  3J80 E;  1SRL A;  3CC2 A;  5J3B A;  5LJ3 d;  3SDZ A;  2R5A A;  1ZSZ C;  2QQA A;  2GGR A;  3VS2 A;  4QVC A;  3G71 T;  3MO8 A;  4JLI A;  4WCI A;  3JB9 D;  1VQ8 Q;  2XU8 A;  1M30 A;  5GAN 8;  3OYB A;  3CCU Q;  1N8R R;  1UG1 A;  4M75 E;  1ZUU A;  2OAW A;  1Q81 C;  3EGX B;  2QI2 A;  4FYY B;  1VQ5 Q;  4M77 G;  1NLO C;  1SSH A;  1EIF A;  3L1A A;  4J9I A;  2VGN A;  1P92 A;  1CKB A;  1AD5 A;  3OYE A;  2IG0 A;  3G6E Q;  4MZM A;  2CP6 A;  2D6F A;  3JCM c;  1B07 A;  3F70 A;  1Q7Y U;  2DA9 A;  1VQ6 Q;  2L3S A;  2EVR A;  3O8V A;  3CCS A;  4PK4 A;  2VV5 A;  3H41 A;  2HKQ B;  4RTW A;  2RJF A;  3EG9 B;  1M1K U;  3MET A;  3A8G B;  2AIR B;  4V2S A;  3CD6 Q;  3G4S Q;  2YDL A;  1WIE A;  4E7H A;  2OJ2 A;  1VIF A;  1GBQ A;  5KYX B;  5AYF A;  3HRU A;  1F1B B;  2M16 A;  5LJ3 e;  1UE9 A;  4FM4 B;  1IB8 A;  1Q82 U;  1R77 A;  1QMC A;  4DQ2 A;  3WXM B;  3QHS A;  5GAN g;  1Q86 U;  2EWN A;  5M9O A;  3CCV A;  2QAS A;  4EDU A;  2EKH A;  1OPL A;  4Z89 A;  1M8V A;  3X25 B;  2F2V A;  2B8A A;  1BI0 A;  2JJ9 A;  2L0A A;  3OYY A;  1Y7X A;  2M51 A;  4PLI A;  2B86 A;  3OYC A;  1WHM A;  4A54 A;  4E7I A;  2KNB B;  2NYS A;  2KDS A;  4MMK A;  2HQE A;  5CQX A;  4F16 A;  4OMN A;  3RDV A;  2FL7 A;  2QDY B;  4PJO A;  4AFQ C;  1YJ9 T;  2H8H A;  4ZTJ A;  4M75 F;  1OPK A;  3A8O B;  4RMO A;  5GAN 3;  1K8A C;  3QG1 A;  1NPP A;  2JS0 A;  3MPU B;  4AT1 B;  3EHQ A;  3MEV A;  3CCR Q;  3HTR A;  2DIQ A;  4C8Q G;  3M9Q A;  2QK0 A;  1KQS S;  3CC7 Q;  1IHW A;  3NTK A;  1I8F A;  3V8K A;  1LCK A;  1FXX A;  3JCM W;  4M75 D;  2E1H A;  5KYW A;  2L2P A;  4M7A D;  2DJQ A;  2VWF A;  5A0G A;  8ATC B;  1H3H A;  1UHC A;  2C06 A;  3OQ5 A;  2RA2 A;  3EH1 A;  2ENM A;  1FMV A;  2E6N A;  2LJ3 A;  2HL5 C;  2RQV A;  3PMI A;  3JCM f;  1KC8 C;  3V7C A;  5FWC A;  1KFZ A;  2LJ0 A;  4HCZ A;  4PJO G;  3ER0 A;  3MKD A;  4HVV A;  1S72 A;  4N0A C;  2L3R A;  1YI2 T;  3C4S A;  3OY9 A;  4FYW B;  4M77 E;  3CXC P;  1M9S A;  3L2Q A;  4PJN A;  5CIU A;  4DOV A;  4FU6 A;  1YBY A;  2DD4 A;  1M2O A;  2ED1 A;  2I2L A;  1G83 A;  4O5V A;  1M27 C;  4AG2 C;  2CYZ B;  3GPL A;  3M0R A;  2HAX A;  1YWP A;  4PFZ A;  4C92 F;  4C8Q C;  5I11 A;  2AKK A;  2YT6 A;  4JRQ A;  5GAN j;  2EJF A;  2DX1 A;  1X6B A;  2CSQ A;  2KR3 A;  4WF2 A;  1OX9 A;  2FRY A;  1PD1 A;  4RTT A;  1AVZ C;  1U06 A;  3UWN A;  1Y96 A;  2DIG A;  1KD1 C;  2YSQ A;  1T3S A;  1VQ8 T;  2QTX A;  4P5N A;  1WFW A;  2V8K A;  2XK0 A;  2PVO B;  3CCU T;  1WQW A;  1MV3 A;  4VUB A;  3D7S B;  1D1B A;  4X9C A;  4C92 D;  1VQ5 T;  1A0N B;  4A4G A;  2K6D A;  1VYT A;  1ZHI A;  2CGH A;  1JB0 E;  3G6E T;  5ECA A;  1T3L A;  3G1J A;  1KK7 A;  4NOY A;  3GBQ A;  1VQ6 T;  3CBP A;  3LX7 A;  3OMG A;  3X24 B;  2ZPF B;  2RQT A;  3BDL A;  1RLP C;  3PMT A;  2YLC A;  1QVF S;  1M3B A;  2DIL A;  2GTJ A;  4LDW A;  1I5O B;  1ABO A;  3CD6 T;  2FEI A;  3G4S T;  1U5S A;  1SRM A;  1IGQ A;  2CH4 A;  3LLR A;  2F2X A;  3PFS A;  1YIJ A;  5GAM f;  3CMA T;  2L5Q A;  2K79 A;  1PRL C;  3MP8 A;  4FIB A;  2LQ8 A;  1Y0M A;  3L42 A;  1KC8 R;  4M77 F;  5IHK A;  2LNV A;  3EGD B;  2RK1 A;  4C8Q E;  2DJZ A;  3ZBD A;  2JN0 A;  1GCP A;  1PG5 B;  4IUU A;  2LX7 A;  3EFR A;  3GNG A;  2GTO A;  2ZPB B;  1UFF A;  4ATO A;  1M2V A;  2W10 A;  4C5I A;  2A0F B;  1HJD A;  1KIK A;  4GBQ A;  2DL8 A;  4J8O A;  3UA6 A;  3J7A F;  2HQX A;  4MDX A;  4N4I A;  4JRP A;  1BU1 A;  5EG2 A;  2LVM A;  4C0D B;  2NUT A;  4A4H A;  2LT1 A;  3DKM A;  3RUX A;  3CC4 Q;  5GAN e;  1TSF A;  2MMP A;  1WZO A;  4LE9 A;  1VQL Q;  2WAC A;  3OW2 S;  1M90 U;  1K73 R;  1KD1 R;  2ABL A;  4R0K A;  1T0J A;  3THK A;  2DL3 A;  2K4Y A;  2DNU A;  3N5B B;  3S6W A;  3CC7 T;  3G71 Q;  4BY6 C;  1KQS P;  2QAZ A;  4OVA A;  1KJW A;  4E47 A;  5FRM A;  1TS9 A;  1D0X A;  2KK4 A;  1TXQ A;  1GCQ C;  4PL6 A;  1JBM A;  4E7Z A;  4M78 D;  2DTI A;  1UDL A;  3I55 A;  4HCC A;  3JCM d;  4J6Y A;  2VC8 A;  1YFN A;  3REA B;  5FRO A;  1QKW A;  5I2M A;  2D8J A;  1JU5 C;  3CME A;  1QVG S;  3SWN B;  1K9M C;  4J9D A;  2LJ1 A;  2P0P A;  1NZ9 A;  1G8X A;  1D3B B;  2P4T A;  2FHD A;  3HHT B;  2E70 A;  4DEX A;  2COZ A;  1X27 A;  3M53 A;  3QDR B;  2HEQ A;  3ME9 A;  4JRK A;  5GAO m;  3T9N A;  1TG0 A;  2HKN A;  1D0Z A;  3M54 A;  3A8M B;  3A98 A;  3QZ5 B;  5C0M A;  3JB9 J;  2RJC A;  2X4Y A;  3LYI A;  2QEX Q;  3C95 A;  5IXF A;  2K2M A;  3OYF A;  3CCQ A;  1QWE A;  2RO0 A;  1M1G A;  2ROL A;  2XHC A;  3NGP A;  1YJW A;  4M7D B;  2E10 A;  1QW1 A;  4XU1 A;  3CBM A;  1W4S A;  1ARK A;  3RMQ A;  2HD0 A;  1YJN T;  4JJD A;  1FYN A;  1ZSZ A;  1OEB A;  1T0H A;  1MV0 B;  1VYV A;  2L8D A;  5FLX E;  1EZZ B;  2LQK A;  1Y07 A;  4RCC A;  4PJO F;  3UAT A;  2EYZ A;  5DLQ E;  3UF4 A;  3X20 B;  4IUV A;  1RLQ C;  1GL5 A;  2RN8 A;  3H0I A;  1YN8 A;  2RHI A;  4B6M A;  1VQ4 Q;  5GJW B;  2PQW A;  5D6Y A;  4QW2 A;  1IZ6 A;  1WA7 A;  2RI3 A;  5KCO A;  3M56 A;  3FB9 A;  4M4Z A;  3L2V A;  3EAE A;  1VQP Q;  3CCL T;  3OA6 A;  2G3R A;  2CSI A;  4ZGE B;  1Q7Y C;  4PJO D;  1JO8 A;  4MZT A;  3ZL7 C;  1YJ9 Q;  2KXD A;  2HZY A;  3OSS C;  5D6X A;  3OSV A;  3OYL A;  1PD0 A;  1IHV A;  3EG1 A;  3A5Z B;  1N27 A;  1PC0 A;  3M4Y A;  2JUF A;  3VYH B;  1HXD A;  3VV0 A;  2ZZD A;  3RMS A;  1M1K C;  1OU9 A;  1RUW A;  2F2W A;  5GAM d;  1VQN A;  1QVF P;  2DMO A;  4BE0 A;  4J9B A;  3KUF A;  1C0M A;  1GRI A;  4WTO B;  4OB3 B;  5GAN 5;  2HMA A;  4KT0 E;  2RPN A;  3MEA A;  1AEY A;  4LDU A;  3WVE B;  1BIB A;  1QVG A;  1VQK Q;  3URG A;  2O9V A;  3RER A;  1V1C A;  1X69 A;  4L5G A;  5IN1 A;  4OB2 B;  3OBY A;  1GFC A;  3RNJ A;  1Q82 C;  2COW A;  2CH4 W;  4F04 B;  2L3Q A;  5A2Q E;  3KBG A;  3PTA A;  5D6W A;  2EYX A;  2P4R A;  4HT9 A;  3PT9 A;  2YUN A;  2QA4 A;  2XKO C;  1RAC B;  2CZ0 B;  3L2Z A;  2QQB A;  3CCM A;  2CDT A;  4LUD A;  1MMG A;  1KSW A;  4Y92 A;  4M7A C;  2QTV A;  4OMO A;  3M0U A;  3X28 B;  5GMK j;  1NPR A;  2CT4 A;  4ZNX A;  5DLO A;  3EFS A;  5CVI A;  1RI0 A;  3GP8 A;  3J81 E;  1YCS B;  1WXT A;  1NJI U;  2CT3 A;  2E41 A;  1BI2 A;  1XNI A;  2EGA A;  3CC4 T;  5FU7 B;  2CP2 A;  4KUD K;  2CUB A;  4QQG A;  1G2B A;  2CP0 A;  2FG0 A;  3M0P A;  1BKB A;  4J6W A;  1VQL T;  3I56 Q;  3OW2 P;  2O4X B;  2K2V A;  1WLP B;  1TOV A;  4QQD A;  3V8L A;  2DXT A;  2C0O A;  2EJ9 A;  2XIC A;  1WXU A;  1YHQ Q;  5LJ5 h;  4CRI A;  2LNH B;  2EGC A;  2O9S A;  2BKD N;  3BE3 A;  1SSF A;  4PKC C;  3SB2 A;  4EMK B;  3JCM P;  2LT4 A;  2JMC A;  5J26 A;  5GAO r;  3PE0 A;  5GAN 4;  2XD0 A;  3EG0 A;  1KHC A;  2KRN A;  1QVG P;  3X26 B;  1NLP C;  1E6G A;  4RG8 A;  4JPB W;  2D8H A;  2KY9 A;  4M75 B;  2KBT A;  4NL3 A;  2X9H A;  4FW1 A;  1UGV A;  4M7A B;  4N0A A;  1ZBX A;  4XTU A;  1I07 A;  1WXB A;  3FIF A;  3PIO A;  4LD9 K;  3PVL A;  3VYG A;  1IO6 A;  1XQH A;  2FZC B;  5A0D A;  1SPK A;  3TSZ A;  2DK3 A;  3SD4 A;  2DL7 A;  4XTX A;  1N8R U;  1NYG A;  1ZLM A;  5GAN f;  2QEX T;  3LH0 A;  4O6J A;  1RAE B;  2NLU A;  1ACM B;  3I35 A;  3CMA Q;  2LTO A;  1UGP B;  4IUQ A;  4J83 A;  4KUL A;  2DBM A;  1VQO Q;  2DPP B;  4C0G A;  5GMK m;  2KVQ G;  2DFU A;  2X51 A;  4Z02 A;  3E2U A;  4C8Q A;  2HL3 A;  2LCL A;  1OYX A;  3EGD A;  2X4W A;  4F14 A;  1MNE A;  4BDY A;  3CCS T;  1ZQ1 A;  3CBO A;  1QCO A;  4E7L A;  5GMK e;  2PNI A;  1BB9 A;  1JXM A;  1YWO A;  1X43 A;  4PJM A;  1YIT Q;  3SEM A;  1JJ2 S;  1VQ9 A;  2CZ7 B;  2FVU A;  1N6A A;  1SF9 A;  3JCM J;  2RJD A;  1Z9Q A;  4XAX B;  1QKX A;  2E64 A;  1VQ4 T;  1R8O B;  2KAF A;  2DXC A;  1B34 A;  1N5Z A;  2DRM A;  3CPW S;  3RKW A;  1VQP T;  2O31 A;  2ZGW A;  2K5L A;  4A4F A;  1MUZ A;  2EBP A;  5HY6 A;  2GQI A;  1W2B S;  2JOY A;  2ZAE A;  4PJL A;  4C92 B;  5DY9 A;  2VVK A;  4BD3 A;  1VQM Q;  4LN2 A;  4F7U A;  2DEQ A;  4RCB A;  2X35 A;  4E7J A;  3OS2 A;  5LJ5 g;  3OS5 A;  2DVE A;  3U23 A;  2DRK A;  2PVD B;  2DAQ A;  3JRZ A;  3UT1 A;  1Q81 R;  1VQ7 Q;  2OTL Q;  4JJC A;  4RTZ A;  4AFU C;  3GLX A;  4JUV A;  2RK2 A;  1VQK T;  1AWW A;  3QUI A;  3RES A;  3KXT A;  3RR6 A;  3S3M A;  4XU3 A;  5KYY B;  3RIR A;  2OTJ A;  4LD6 A;  4HT8 A;  3JB9 I;  1UJ0 A;  1RAB B;  3ZFJ A;  1X01 A;  3H0H A;  1YI2 A;  5FRN A;  4HXJ A;  1B3Q A;  4RG2 A;  5J39 A;  4J9C A;  1BBZ A;  4IKF A;  2L89 A;  2AT1 B;  2NWM A;  1D1C A;  2FPD A;  1C1A A;  2JTE A;  2A37 A;  4CI0 C;  2D1X A;  4JRI A;  2E5Q A;  1PRM C;  1R0C B;  1PM3 A;  5FWB A;  5GAO n;  1AWJ A;  4F7U G;  2E4H A;  1K76 A;  2L3P A;  1I1J A;  4FCY A;  2A7Y A;  3C12 A;  3NPF A;  1QCF A;  3ASK A;  3QWX X;  4BI3 A;  2X3W D;  5LL6 S;  1X2K A;  4M7D A;  1LNX A;  2CKK A;  4OMM A;  3JV3 A;  1X75 C;  4JZ3 A;  3GNF B;  4J7I A;  2DKG A;  1WNL A;  2HQH A;  1VQ8 A;  3I56 T;  5IHI A;  1JJ2 A;  1YJN Q;  3CCU A;  3CPF A;  3NMZ C;  2RHX A;  2HDA A;  3DLL A;  1VQ5 A;  3MJX A;  2HBW A;  1YHQ T;  4BDZ A;  1W70 A;  1QP3 A;  1G3W A;  1GCQ A;  3CPW A;  3G6E A;  2NUP B;  2CP3 A;  4OMQ A;  1QVP A;  5HK3 A;  2LP5 A;  2RI5 A;  2VB6 A;  3NTH A;  1VQ6 A;  1W2B A;  4C5E A;  2BZ8 A;  4MML A;  1AWX A;  4ZN1 A;  1K8A R;  3CCL Q;  1H3Z A;  4C0D C;  1BI1 A;  4ZGD B;  4KGX B;  2JS2 A;  3UDC A;  3QO3 A;  5CKF A;  5HCK A;  4M78 B;  2PU9 B;  3G4S A;  2CP5 A;  4M7D G;  4IUR A;  2MK5 A;  1FMK A;  1G3S A;  5GAN d;  3RKX A;  5LJ5 j;  2GFA A;  2JTF A;  2LX9 A;  4J9F A;  3PNW C;  3VUB A;  2ZPE B;  2YUP A;  2EQK A;  2ZPG B;  5KE3 A;  2V1R A;  5CCA A;  3TCJ A;  4KUI A;  5LJ3 h;  1RAG B;  4AFS C;  1JQQ A;  1VQO T;  1Y71 A;  3O5Z A;  2AHJ B;  2MF2 A;  4ORZ A;  1QWF A;  3A1P A;  2IVW A;  4QVD A;  4OMF B;  3SWN C;  4XTZ A;  2RHU A;  3INZ A;  3Q1J A;  3LWI A;  2JW4 A;  3BDU A;  2E12 A;  1YIT T;  3JCM Q;  3HPW A;  1BCO A;  1JJ2 P;  1AZE A;  5AT1 B;  1IRX A;  4M77 D;  4CC3 A;  4KH1 B;  4C0Z A;  4J9H A;  1YIJ T;  5EC7 A;  1TTH B;  2EQI A;  2KYB A;  2O01 E;  2ROT A;  3CPW P;  1WPY A;  4X1V A;  3CCR A;  1KC8 U;  3I9Q A;  2K9G A;  4FSX A;  2EKO A;  2HSE B;  3G7Z A;  1KHI A;  3S3N A;  3PIP A;  1UEB A;  3CC7 A;  1W2B P;  4M7D C;  3CEY A;  1GFD A;  2EQU A;  4OGC A;  3M4G A;  2AZV A;  1OU8 A;  1VQM T;  3OS1 A;  2O4X A;  2JVV A;  3OYH A;  1WGS A;  3CCE Q;  3MP1 A;  4F7U E;  3AHU A;  3VU3 C;  4PJO B;  1VUB A;  3QJY A;  1VQ7 T;  2OTL T;  2FO0 A;  2A3L A;  4OB0 B;  4J9E A;  2O2O A;  3CCJ Q;  2ESW A;  1M4Z A;  5GAN 7;  4EMK A;  2KMT A;  3QYH B;  2E6Z A;  2J6O A;  2BZY A;  3EGX A;  1IGU A;  1O75 A;  3M0Q A;  2EGE A;  2DZC A;  1RAI B;  2E3I A;  2FRW A;  2KQW A;  4CC4 B;  7AT1 B;  1I5L A;  2ED0 A;  4HVU A;  2VKN A;  2WSE E;  3EG2 A;  5GAN 2;  5LJ5 e;  4IUT A;  1PKS A;  1K73 U;  1KD1 U;  4D8K A;  4AG1 C;  3CC2 Q;  1AHJ B;  3VS3 A;  4M7A A;  4A63 B;  3CQT A;  4E2F B;  1XOV A;  1N9R A;  3FJP A;  3EG9 A;  2J06 A;  3V7R A;  2RH2 A;  4C8Q F;  4E7S A;  2CS7 A;  1NJI C;  5LJ3 g;  3HP9 A;  3I55 T;  4KGV B;  1WX6 A;  2YRV A;  2ZCF B;  2DLP A;  4II1 A;  1AZG B;  3NTI A;  5KYX A;  4QT7 A;  4HCB A;  1MMN A;  3BFM A;  4M7D E;  1R0B G;  2PZ1 A;  2RQW A;  4C8Q D;  2EYQ A;  4PNO A;  2RMO A;  3EG3 A;  3M0S A;  3CCS Q;  5KE2 A;  2KYM A;  1M3C A;  2M0O A;  2QQR A;  1WQ7 A;  4Z8A A;  5CKB A;  2WSF E;  2A28 A;  2J6K A;  2M02 A;  2BE9 B;  4M7A G;  5DM7 R;  1WHG A;  2V8I A;  3R6O A;  3QSU A;  1TU0 B;  1PHT A;  2OAU A;  3VS0 A;  4F7U F;  3QKJ A;  2JM8 A;  4ANJ A;  1ZBJ A;  2K5I A;  3OMC A;  5IAY A;  1Y96 B;  2YHT A;  3TQ7 P;  2J05 A;  2MAM A;  1BCM A;  5I21 A;  3I5S A;  5FU7 C;  2Y4Y A;  4EMH A;  3VS7 A;  1UGR B;  1WI7 A;  3CCV Q;  3R6N A;  1D0Y A;  1VA7 A;  1K9A A;  1H8K A;  2GQV A;  3OYK A;  1VQ9 Q;  1OUL A;  4UC4 A;  1MGQ A;  1LVK A;  2F5T X;  4QVZ A;  4JLG A;  2YXY A;  2LMJ A;  2PUK B;  4MDW A;  1K9M R;  4LUE A;  4X9D A;  4EMK C;  3JB9 H;  4DA4 A;  4KBM B;  2AZS A;  2FB7 A;  4D6W A;  5C6S A;  1SHG A;  2LDM A;  2KI7 A;  1G3T A;  1Q86 C;  5KCH A;  1WHK A;  3HFN A;  3S3O A;  1M3A A;  2XG8 D;  1ZA2 B;  5CAI A;  5KYN A;  4M75 C;  4M7D F;  1LOJ A;  1E7O A;  1E6H A;  1PSF A;  4FYX B;  2BUD A;  1M8M A;  3FLG A;  3CC4 A;  1H92 A;  4RUG A;  1FWZ A;  1XTD A;  1VQL A;  2EPD A;  1G3Y A;  4RKU E;  2F69 A;  3JCM X;  3FC3 A;  1RAH B;  2RF0 A;  4FW2 A;  1K0S A;  1M2V B;  1IXD A;  3OYD A;  4ELY C;  2DF6 A;  4NL2 A;  2J7I A;  1WDX A;  2FZK B;  2MWO A;  3G71 A;  2XDP A;  4OGE A;  3QWY A;  1V29 B;  1SEM A;  3DB3 A;  1PNJ A;  1NE8 A;  3CCE T;  4ESR A;  2MIO A;  2NUT B;  4ZTF A;  1S72 Q;  2JMA A;  3AT1 B;  2ATC B;  1BIA A;  5GJV B;  2YWW A;  4TVR A;  3CCJ T;  4BE2 A;  2DTO A;  4OMP A;  5FW9 A;  2K57 A;  2MWP A;  1GBR A;  5KYU B;  3L2U A;  1Q7Y R;  3VS1 A;  4EMG A;  1TUG B;  2DET A;  2MCN A;  4F17 A;  2E5K A;  2D0Q B;  1M1K R;  4M78 A;  2R58 A;  3CC2 T;  1KQ1 A;  2A08 A;  2QEX A;  2EYW A;  1M1F A;  2KE9 A;  1U3O A;  2KT8 A;  2CUD A;  4M7A E;  4C92 C;  1AOJ A;  1RAD B;  3RBB B;  3QZ9 B;  4XU2 A;  3QJ6 A;  3MEU A;  4HVW A;  3VJP A;  3HKS A;  3VKI A;  1Q82 R;  5CQY A;  2FPE A;  4L59 A;  3L2W A;  1WJS A;  1SG5 A;  2XMF A;  1Q86 R;  2ECZ A;  5IXB A;  3HRS A;  3MHX A;  3OB9 A;  1TUC A;  3QDF A;  5CK9 A;  4R55 A;  2BZX A;  3LWH A;  2BIV A;  1V76 A;  2XI9 A;  3C0C A;  4PFP A;  4LDV A;  1I81 A;  1D09 B;  3V7S A;  1ZUK A;  3H6Z A;  3IQL A;  2DVJ A;  1S1N A;  2VGM A;  1VQ4 A;  2VXF A;  1UHF A;  6AT1 B;  3MEW A;  3JCM h;  4LDX A;  2Z0W A;  2NUZ A;  2CZ1 B;  3FRN A;  1I4K 1;  2LCS A;  4E7K A;  1VQP A;  4M78 G;  5IT9 E;  5CKE A;  2K5F A;  1YJ9 A;  3GOX A;  1ZSZ B;  2W0Z A;  2F5K A;  4RTX A;  1YIJ Q;  2EIF A;  3CXC A;  5LJ5 f;  1MHN A;  4JS4 A;  2LC4 A;  4XK8 E;  3HSB A;  4PLL A;  5FU6 C;  1QCN A;  4BB7 A;  1U8R A;  3PVQ A;  4FSS A;  3OYM A;  2VUB A;  2GCX A;  4DBQ A;  5HKC A;  2K3Y A;  4M77 C;  1PCX A;  5IH2 A;  1VQK A;  3CCV T;  4C92 E;  1QQJ A;  2C0T A;  1ABQ A;  2JT4 A;  1VQ9 T;  4GLK A;  1KG1 A;  1TUD A;  5I2S A;  4AMC A;  2EQM A;  3VUZ A;  2X3X D;  3E9F A;  1PSE A;  5CKH A;  4DBF A;  4HKE A;  4ME7 A;  4GLM A;  3QYG B;  1HYO A;  1RAF B;  1HK9 A;  2KRO A;  5L23 A;  4M7A F;  1SKU B;  4FT2 A;  2RD1 A;  2ZPI B;  3HFO A;  9ATC B;  5GAO q;  3LW5 E;  4FT4 A;  3V8J A;  1PKT A;  2QGG A;  3SWN A;  2WSC E;  4EPC A;  2JNG A;  4PFO A;  4J5Y A;  4BE1 A;  5L8R E;  1D3B A;  1FX7 A;  1OV3 A;  2HSP A;  3OS0 A;  2YRD A;  4M78 C;  4OF1 A;  2DYB A;  3M55 A;  2KXC A;  1M5Q 1;  3JAM E;  4Z88 A;  1RL2 A;  1Q81 U;  1DJ7 B;  4ZN3 A;  4YTL A;  2MI6 A;  4J6X A;  5D7U A;  4XTY A;  1Z9Z A;  3VRY A;  2EW3 A;  3P8H A;  3I56 A;  4JJB A;  3OYJ A;  2I0N A;  1EFN A;  2VAS A;  3I55 Q;  2Y4X A;  5FU6 B;  2JZ2 A;  2PUO B;  2OTJ T;  3E9G A;  3MCA B;  2EYY A;  3NHN A;  5GAM h;  3CME Q;  4J9G A;  1YHQ A;  4M77 B;  2YLB A;  1M90 C;  3OYG A;  3ULR B;  2QQ9 A;  4BUG A;  1WHH A;  4GY5 A;  2E65 A;  3JCM g;  4XTW A;  1ZUY A;  1S72 T;  1LPL A;  3LGL A;  2D0N A;  1NEB A;  2JM9 A;  3BY7 A;  2FZG B;  2R57 A;  1UB4 A;  1UUE A;  4BI8 B;  2PVG B;  3EFO B;  1O9S A;  1QLY A;  2OI3 A;  3A8H B;  5GMK i;  3TEE A;  3CCQ Q;  4B9W A;  2FYK A;  1ZA1 B;  2DBK A;  1YJW Q;  1TH7 A;  2RNA A;  4OML A;  2OX7 A;  1VYU A;  1B7T A;  2DL5 A;  3LH5 A;  5GAO l;  1K73 C;  2GFU A;  2HBP A;  4BAC A;  1BK2 A;  2CZ6 B;  1X6G A;  1UGS B;  3CD6 A;  1BI3 A;  2SRC A;  4M78 E;  2M1H A;  2HNI A;  2CRE A;  1OZ2 A;  2D9T A;  2M9U A;  4C5H A;  2M0Y A;  3CMA A;  4LDY A;  3SHW A;  4CC7 A;  2ZPH B;  1N9S A;  1RAA B;  1KQ2 A;  3KFV A;  2V26 A;  3JCM b;  1VQO A;  2BTT A;  4JDS A;  1HD3 A;  3WVD B;  4PJO C;  2VXE A;  2JTM A;  1KQS A;  4KRT A;  2KGT A;  1OQK A;  4HCK A;  1K8A U;  1MMA A;  8AT1 B;  5IHN A;  1YIT A;  1MMD A;  2YUO A;  1SHF A;  2K3B A;  2RI2 A;  4IUP A;  5GMK h;  1IRE B;  3QPH A;  1WJQ A;  2XDD A;  1XJW B;  1OOT A;  2CP7 A;  4Q5W A;  1CKA A;  3PGG A;  4Y28 E;  4IIM A;  2P0Q A;  4AFZ C;  3JB9 G;  3VRZ A;  1AWO A;  2HCK A;  1I0C A;  4OB1 B;  4JJN K;  1VQN Q;  3QBY A;  5LJ5 d;  1GXI E;  4C5G A;  4FYV B;  4C8Q B;  4XU0 A;  1PWT A;  2DM1 A;  3L2R A;  3HL8 A;  1M90 R;  2XDB A;  2A36 A;  2G6F X;  1VQM A;  5GAM g;  1JEG A;  1NBE B;  3M5A A;  2AK5 A;  2X4X A;  4L6V 5;  2DER A;  1J3T A;  2QDL A;  1LJO A;  1VQ7 A;  3QXE B;  3OYN A;  1K0X A;  2OTL A;  4A53 A;  2GF7 A;  4DOW A;  2P0K A;  1U1S A;  3TVT A;  2QA4 Q;  3H0F A;  2DL4 A;  4E6R A;  4OP0 A;  1B34 B;  4EIK A;  1TWB A;  3CCM Q;  3M0T A;  4A4E A;  4RTU A;  3GIB A;  3SFM A;  1CSK A;  4PJO E;  5CKD A;  4M78 F;  1RI9 A;  3TU4 K;  1H64 1;  4NS5 A;  1VIE A;  3E1S A;  3VS4 A;  2GNC A;  4XTV A;  5KYU A;  2IPO B;  4F7U B;  2DZ9 A;  2QYZ A;  4K11 A;  3CCR T;  2RJE A;  4MZP A;  4HA8 A;  1OX8 A;  1X2Q A;  2KRM A;  3LGF A;  2EJG A;  5LJ3 f;  3UA7 A;  4M75 A;  3H8Z A;  4X34 A;  5KYW B;  2LRQ A;  1BYM A;  2SEM A;  1Q95 G;  2DE0 X;  2QXF A;  4A4K A;  1WHJ A;  1UJY A;  2RM4 A;  1HSQ A;  4J7F A;  4Y91 A;  4RTV A;  4JS5 A;  4KH0 B;  1QVF A;  1YJN A;  1JRI A;  4RTY A;  1QP2 A;  2KSS A;  2LZ6 B;  4D8D A;  3I5R A;  3OYI A;  2COY A;  1X6O A;  3JCM V;  4B9X A;  3CME T;  1OZ3 A;  2MYS A;  1UGQ B;  3C94 A;  5GAN 6;  3A8L B;  4LNP A;  4KGZ B;  2K3X A;  2J6F A;  1UEC A;  3EHR A;  3REB B;  5CR2 A;  2EAY A;  3QII A;  3CCL A;  4M75 G;  2IIM A;  3M59 A;  2O88 A;  3DLM A;  5A0L A;  2LQW A;  2V8J A;  1NG2 A;  1YNZ A;  1YCY A;  3DB4 A;  2BE7 D;  1NYF A;  1ZSG A;  3CCQ T;  3E19 A;  1K1Z A;  3OYA A;  1ZX6 A;  1YJW T;  3FJ5 A;  2KRS A;  4BY6 B;  2QG9 B;  4QKU A;  5GAM j;  1MND A;  1WJR A;  1YP5 A;  4XQ3 A;  3JCM e;  5I22 A;  2RQR A;  2RHZ A;  1OI1 A;  2XID A;  3JSC A;  2F1L A;  1U1T A;  4C0F A;  3VS5 A;  4C92 A;  3GF5 A;  4ZGJ B;  2DO3 A;  5GAO p;  3OW2 A;  1N8R C;  1Y57 A;  4PJJ A;  3ZEH A;  2E3H A;  1WHL A;  5GMK l;  1D1A A;  3H9N A;  1VOM A;  3EGU A;  3M57 A;  2AKL A;  4JZ4 A;  1FMW A;  3EH2 A;  5KYY A;  2YRC A;  3TSW A;  2FPF A;  5KH6 A;  2DXB A;  1NM7 A;  4DEY A;  5CO7 A;  2K7A A;  4DBR A;  4BI4 A;  3UPU A;  3M58 A;  3FDR A;  2DD5 A;  2MOX A;  3NFC A;  2RHY A;  1NJI R;  1VQN T;  2H3J A;  4IIO A;  1W6X A;  2MPX C;  2Y90 A;  2KT1 A;  4C92 G;  2P84 A;  4FL6 A;  1K4U S;  2EQJ A;  2V1Q A;  4N4H A;  4QQ6 A;  4ELZ C;  1K9M U;  3FEO A;  3HRT A;  3RKY A;  5LJ3 j;  3VS6 A;  1W1F A;  2QGF B;  5HK0 A;  2YUQ A;  1AT1 B;  2LQN A;  3P8B B;  5GAN h;  3CCE A;  2PTK A;  2OTJ Q;  4DBH A;  2LCC A; 
#chains in the Genus database with same CATH homology
 3CC4 Q;  3CCJ Q;  3CC2 Q;  3CMA Q;  1N8R R;  3CCU Q;  1W2B P;  1K9M R;  1JJ2 P;  3CME Q;  1VQN Q;  1NJI R;  1KC8 R;  1VQL Q;  1YI2 Q;  1VQO Q;  1VQ4 Q;  1VQ5 Q;  1Q7Y R;  3CCV Q;  3I56 Q;  3OW2 P;  1VQM Q;  3CXC P;  2QA4 Q;  1K73 R;  1KD1 R;  3CCR Q;  1YJN Q;  3CCQ Q;  3CCE Q;  1YIJ Q;  1VQ9 Q;  1QVF P;  3CCM Q;  1YJW Q;  1VQP Q;  3G6E Q;  1QVG P;  1K8A R;  3CD6 Q;  1M90 R;  3G4S Q;  3CCL Q;  3CPW P;  3CC7 Q;  2QEX Q;  1S72 Q;  3CCS Q;  3G71 Q;  1Q81 R;  1VQ7 Q;  1YHQ Q;  1Q82 R;  2OTL Q;  1KQS P;  3I55 Q;  1M1K R;  1YJ9 Q;  1VQK Q;  2OTJ Q;  1YIT Q;  1VQ8 Q;  1VQ6 Q;  1Q86 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...