3I55Q

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3i55Q00
1M1KR 3CPWP 1VQMQ 1YJ9Q 1VQ5Q 3G4SQ 3CCLQ 3CCRQ 1M90R 1JJ2P 3CC2Q 3CXCP 3CCSQ 1YHQQ 1K73R 1W2BP 3CC4Q 1Q82R 1KQSP 2OTLQ 3G6EQ 1N8RR 1VQLQ 1VQ9Q 1KD1R 3CCJQ 1Q7YR 3G71Q 1VQKQ 1VQNQ 1QVGP 1K8AR 1VQ8Q 1K9MR 3CCQQ 2QEXQ 3CD6Q 2QA4Q 1VQ7Q 1VQOQ 3CMEQ 1S72Q 3CC7Q 1YI2Q 3CMAQ 3CCUQ 3CCVQ 3CCMQ 3OW2P 1YJWQ 1QVFP 1VQ6Q 3I56Q 1Q86R 1VQ4Q 3CCEQ 1KC8R 2OTJQ 1YITQ 3I55Q 1NJIR 1YJNQ 1Q81R 1VQPQ 1YIJQ
chains in the Genus database with same CATH superfamily
2HQHA 2YT6A 1M90R 3OQ5A 4JDSA 1Q82R 2RA2A 3DB3A 1LJOA 2COZA 4GLMA 2EKOA 1WHJA 1TWBA 2E41A 3JRZA 4RTZA 4WCIA 1UG1A 4JZ4A 4KGXB 2OTLT 3TVTA 2LVMA 5LJ5h 2PU9B 1OPLA 2C06A 1DJ7B 3M57A 5GMKl 3CBPA 1QVGP 5LL6S 1MV3A 2E6NA 4QW2A 4IIOA 4HVVA 5FU6C 1Y71A 4IUUA 3V8JA 2JT4A 3A8HB 4V2SA 3NTIA 2RI5A 4RCCA 5LJ3g 2BE7D 2H3EB 2JS0A 4BI4A 5GAN3 5I2SA 3O8VA 2LQKA 1K9MU 5AT1B 5FU7B 2PVGB 3PTAA 3CCSQ 1I4K1 2RB6A 2LTOA 1ZQ1A 2XDPA 2DX1A 4HCCA 2MI6A 4XTXA 1YWOA 2KI7A 5HY6A 2YLBA 5GAOn 2PVDB 3TSWA 2EYYA 4Z02A 5A0LA 3SDZA 2DTHA 2BUDA 4LNPA 1B7TA 2KYBA 2JN0A 1UB4A 2DPPB 2EYZA 1N9SA 2R57A 3KXTA 1BI2A 4JPBW 2A3LA 2LCLA 2M51A 3TQ7P 3RDVA 2GCXA 3PT9A 5FU7C 4N0AC 5IN1A 4A4EA 3PMIA 2C0TA 1RABB 3CCLT 2K7AA 3C12A 2JJ9A 1AWOA 2VB6A 1O9SA 3DB4A 3NMZC 3V7SA 3M58A 1U1SA 3WVEB 2Y4YA 1RAGB 2EYWA 1F1BB 1SSHA 1T0HA 4B6MA 2OTLQ 3TSZA 2CZ7B 3QZ9B 2D1XA 5KCHA 2X9HA 3CMAQ 4BY6C 3OYLA 1QQJA 2V1RA 1WXBA 3EH2A 3CC7T 2I2LA 1OX9A 2ZPEB 5J26A 2ZCFB 1LOJA 5GAN2 4BDZA 5GANj 4FW1A 3EGXA 2FEIA 4OB1B 3QPHA 4NL2A 2J7IA 5HCKA 3AHUA 5LJ5g 2COWA 1OOTA 3F70A 4AG2C 4M7DG 3VS5A 3CCST 2E10A 1M27C 2RPNA 3CCJT 3CCUQ 3CCVQ 4FW2A 4LDYA 1JBMA 5M9OA 3CCEQ 2R58A 1S72T 3EHRA 3QSUA 4IUTA 1E6GA 4JJDA 3M0UA 1KQ1A 3CXCP 1PM3A 1Y96A 3WVDB 4ZGDB 1T0JA 1SSFA 1H3HA 3UPUA 2QYZA 3JCMQ 3LH0A 4KH0B 3UA7A 4OMMA 2RI3A 1PRMC 2FVUA 2OTJQ 2FPFA 3X20B 1Q81C 1JO8A 3H8ZA 2CP5A 2ZZDA 1RLQC 2MCNA 3CCLQ 4XTUA 2GBQA 1YP5A 1PG5B 2YHTA 2AZVA 3JB9F 3ASKA 5IHKA 2JTMA 5KYNA 1YI2Q 1WA7A 4CC4B 2ECZA 2YDLA 1WGSA 5CVIA 1QCFA 1KD1U 3HL8A 2P0KA 3LGFA 1AOJA 2AKLA 4M78C 1D0XA 2BIVA 2ROTA 4GY5A 3L1AA 1X43A 4IUQA 3CCQQ 4II1A 2DRMA 2OTJA 1HD3A 3EG9B 3KFVA 3L2WA 1W2BA 2AKKA 1WYXA 2VXEA 4FCYA 4IKFA 2K2MA 4HCZA 1NYGA 3QYHB 5LJ5f 4AFQC 2GQIA 2ZPBB 4JZ3A 1VQ6A 3G7ZA 1GCPA 2LCCA 2JW4A 5L8RE 4OMOA 1TOVA 2FRYA 1A0NB 1D0YA 4DOWA 1Y96B 4N4HA 2EQKA 4PFPA 4B9WA 3CC2A 3MEWA 4N4IA 1EIFA 3GNGA 1B07A 1SF9A 2O31A 1M3AA 3QJ6A 5CKBA 2EKHA 2EJGA 2KT8A 4Y28E 5ECAA 1G3WA 2JVVA 5GAOr 1VQNA 1M2VA 2DRKA 4F17A 2M0YA 1WPYA 1YJWA 1KC8U 2COYA 3L2RA 3QYGB 4A4FA 3X26B 1WI7A 2RNAA 1BU1A 3CQTA 1GFCA 2HD0A 4PJNA 4Z89A 1QCNA 3ME9A 3HKSA 1QVGS 4M78G 3I5RA 1SRLA 1XOVA 2EQJA 3OYJA 3P8DA 3A8OB 1PNJA 1PD1A 2V8KA 5HK3A 4A54A 4OVAA 2QK0A 4J9GA 3CCQT 3JB9D 4QVDA 2PTKA 5D6WA 3MJXA 3M56A 2HEQA 2RN8A 1QVFS 1FMKA 3V7RA 4PJOB 3OW2S 3E9GA 3QWYA 3RMQA 2L3QA 2LJ1A 3CCUA 1WX6A 1V29B 1GRIA 1V1CA 1H641 3UA6A 3E2UA 3C0CA 2E64A 2QGGA 2E5QA 3OBYA 2SRCA 3ZL7C 4C92D 3NFCA 5CKHA 1R8OB 3CC2T 5DY9A 1PWTA 3CPWP 3CC4T 3G4SQ 1YITT 2C0OA 1ZSGA 2A08A 1QWFA 2JZ2A 3RKWA 2RO0A 2LT1A 3NHNA 1WHLA 1WXUA 2LP5A 4RTTA 4D6WA 4D8KA 1UJYA 1VQ4Q 3M9QA 3PMTA 1M8MA 2CH4A 4PJOD 3BY7A 3S3OA 2M9UA 5GAMd 1YHQQ 1BCOA 2B86A 2QQ9A 4X1VA 1N8RR 1OZ2A 2MIOA 4JRIA 5GANe 1ARKA 2K3XA 2HL5C 4DA4A 1GXIE 3SB2A 4CRIA 5CCAA 1VYVA 4J8OA 3I56Q 3DLLA 1UDLA 2DNUA 1PRLC 2DVJA 2ABLA 2VVKA 2FPEA 1JJ2S 3EFOB 4CC3A 2F1LA 4FU6A 2QDLA 3HFNA 4WTOB 1UTIA 1Q7YU 2VXFA 4EMHA 3EG2A 4C0DB 4MZMA 2X4XA 5LJ3h 1M1GA 3O5ZA 4F7UF 4HCKA 1UE9A 5KYUA 4F7UG 2XG8D 2CREA 4M7DB 1CSKA 5I2MA 3CXCA 1MNEA 2DXUA 3CC4A 1K73R 4JRQA 3BFMA 3HSBA 4XK8E 4ORZA 4F14A 1BYMA 4JS5A 2F5TX 3G71Q 4C92A 2KGTA 3CCQA 5GAOl 3EG1A 2FRWA 1YCSB 2DTOA 2KROA 1IB8A 3LGLA 4ELZC 4E7SA 3CCVT 1MGQA 2RHXA 4M77A 1X27A 4QKUA 4MMKA 4PJOE 2HBWA 4JUVA 3OS1A 1BIAA 2OAUA 3OB9A 2IIMA 4LDXA 3P8BB 5FRNA 2EFIA 2FG0A 3VKIA 1VQ8A 1B3QA 2XI9A 4M7AB 1PD0A 2DXTA 2FYKA 2AHJB 3I56A 3A8LB 2CKKA 2KVQG 1M90U 3RESA 1UGPB 5KYXB 4XU1A 3VRZA 2GNCA 2LX9A 5GAOp 2VGNA 2EQIA 1G3SA 2EJFA 3PIPA 3QDFA 5KYWB 4PJOF 2ZPIB 1S72A 4R55A 1B34B 3EHQA 2DERA 1TG0A 1ACMB 1G3TA 4GBQA 1JB0E 4XTWA 3OYAA 1FMWA 1Q95G 2X51A 4DEYA 5GAMf 3QZ5B 3M4GA 4F7UA 2RK2A 3MHXA 4ELYC 2JTFA 2BE9B 1WIEA 2H3JA 2DETA 4C5IA 4F16A 2FZGB 2A0FB 2KRNA 1GL5A 3M53A 4X9CA 2MOXA 4ME7A 4XTYA 2LJ3A 1AT1B 1N8RU 2QAZA 1I5LA 4BB7A 2CP7A 5CK9A 2DA9A 3OA6A 2YLCA 2KAFA 2QQAA 2LQNA 1PSEA 1QWEA 1M90C 4LD9K 2X3XD 1VQOT 4ATOA 3EGXB 3CMET 1VYUA 2SEMA 3JV3A 3OYFA 1HK9A 1VQ7Q 2EBPA 4OF1A 1QVFP 4OMLA 4AFUC 4BD3A 4M75D 1VA7A 1TH7A 2J05A 2NUPA 3AT1B 2CSQA 3JCMf 3JCMV 1YIJQ 4J9FA 4PNOA 3UT1A 4C92B 2RK1A 4OB3B 4D8DA 4J7IA 1WQ7A 3M0PA 2CZ6B 1X6OA 4A63B 4Y91A 1ZA2B 4RMOA 2W10A 1BI3A 2EVRA 5DLQE 3QDRB 4Y92A 1OQKA 3OMGA 1RLPC 4RG2A 4M75A 4HT9A 1QP3A 3RIRA 2OX7A 1YJNA 4C92C 2MF2A 2F2XA 1X2KA 5LJ5e 2RQRA 1PC0A 2ENMA 1BB9A 1WFWA 2L3RA 2VUBA 3ULRB 1X75C 4ESRA 3OW2P 1ZSZB 3JCMJ 3P8HA 1ZLMA 3VS2A 1Y07A 2GQVA 4M7AD 1ABOA 5CKEA 2DD5A 4QQ6A 2CSIA 3FLGA 4EMKA 2QA4T 1K73U 5DLOA 1NPRA 5GAN8 5C0MA 1Q7YC 1H3ZA 5LJ3e 3SHWA 4HCBA 1KHCA 3E9FA 4KT0E 1S72Q 5GAN7 2Y90A 2RQWA 4CC7A 3QBYA 5LJ5d 1QCOA 3A98A 2RQTA 4JRPA 2DXCA 3EH1A 3PGGA 2KSSA 1IO6A 1JJ2A 1LVKA 1EX4A 1YJ9Q 2DM1A 3R6OA 2CP6A 4JS4A 2L89A 2EIFA 1HXDA 3OYHA 3UATA 3L2UA 3G4ST 2MMPA 2C0IA 4OMPA 1QLYA 1VQ8Q 2CH4W 2FB7A 3OYIA 1UGQB 2OAWA 5D6YA 1HSQA 3OS0A 2VWFA 4J5YA 4M78D 4IIMA 4FL6A 1KIKA 3D7SB 1D1AA 4KUDK 4R56A 3ZBDA 4DBQA 1RAHB 4M7DE 1QW1A 3T9NA 1C0MA 3CMAT 1W6XA 1K8AR 2M1HA 4EMKC 4PJOC 2X35A 4LDWA 2P0PA 5CQXA 2DAQA 2OTLA 2X3WD 2XKOC 3VS6A 5EG2A 1QVPA 2DFUA 2RF0A 3U23A 4DEXA 1KQSS 2EGCA 3H0IA 4J9EA 3UWNA 5DM7R 1WHMA 4ZGJB 3GIBA 2RHZA 1OULA 1I0CA 5J3BA 2K57A 1VQOQ 2E3HA 3OYGA 3V8KA 1VIFA 3URGA 3OYEA 1NZ9A 1Q86R 1NJIR 4DQ2A 2OJ2A 2M16A 4CC2A 2FZCB 4EMGA 4PJLA 4C0FA 4PLIA 4EDUA 1SG5A 4QQGA 2O01E 3GOXA 1KHIA 1IGQA 2GFUA 2K4YA 2K2VA 1UUEA 4M75C 2J06A 2JXBA 4M77G 5CQYA 3JCMh 3MEVA 2KXCA 2K6DA 5D6XA 1WHHA 2AT1B 4IURA 1NJIU 2DO3A 1W2BS 1D1BA 1M9SA 2L3PA 1VQLT 2M02A 2GTJA 3REBB 4VUBA 1VQ4A 1MMGA 2W0ZA 1VQMT 2V8JA 5FWCA 4M77B 3FB9A 4E7LA 2FZKB 4C0DC 2DXBA 4M75G 4EMKB 1M5Q1 5KYYA 4YTLA 3TCJA 2YRCA 3HTRA 5CKFA 4RTXA 1I8FA 4F7UB 3LX7A 1NEGA 5A2QE 4EIKA 5GMKm 3OSVA 1AVZC 9ATCB 4M7DA 3M59A 1H8KA 3A5ZB 1FX7A 4PFZA 4P5NA 3GF5A 3EGDB 1RAIB 2L8DA 3MPUB 4AG1C 1VQKA 3M0QA 1SHFA 5GMKi 2VKNA 1WJRA 2VGMA 1VQKQ 1R0CB 2JS2A 1K0XA 3G71T 1NE8A 3CEYA 1GCQA 2YXYA 1VQ6T 2HKNA 2KDSA 1YITA 2B8AA 1VQ9A 5KYYB 4C0ZA 1K76A 4ZN1A 3JCMX 2L2PA 2PUOB 3ER0A 3OS5A 2X4WA 1XNIA 1G5VA 1P92A 1RI0A 1K8AU 1KQSA 3A8GB 3JCMd 2ED1A 1JXMA 1U3OA 2LCSA 3META 4O5VA 3QG1A 1VQMA 1I81A 3OMCA 2RHIA 3PFSA 4C8QD 3QKJA 5GAMe 2A37A 4OGCA 2VC8A 1UHFA 5D7UA 1YIJT 2KRSA 4JJCA 1KQSP 3BW1A 1VQ5T 3H6ZA 4EPCA 2CP2A 1V76A 1UFFA 2OTJT 2E12A 2BZYA 1YJNT 1SPKA 4E7ZA 2HBPA 4R0KA 3EFOA 1XJWB 4MZPA 4NOYA 4OGEA 3L2ZA 2HQEA 1TUCA 2L5QA 1VQLA 1QKWA 1U06A 2QTXA 3OYBA 2MAMA 4PLLA 5GMKj 3LLRA 3QJYA 4M78A 5GAOm 1YI2T 1KD1C 2KEAA 4M78F 1K9MC 2HSPA 4ZNXA 4Z88A 2RQVA 2DEUA 1NLOC 2V26A 1YFNA 4M75E 5A0GA 2HDAA 1NG2A 1N9RA 1ZSZC 2P4TA 4C92G 4KUIA 1D3BA 3QHSA 1ZA1B 4RCBA 1N8RC 4GLKA 3UF4A 1MMAA 3M4YA 1JQQA 1G8XA 2D0NA 4L6V5 4QQDA 2PUKB 5IAYA 2E3IA 1X6GA 4JJBA 1IHWA 1M2VB 4N0AA 3L2VA 2Y4XA 3RKYA 1VQ7A 1GFDA 4BE1A 3BE3A 2FHDA 1C6VX 1VOMA 2WACA 4BY6B 2KQWA 3MKDA 2NWMA 4AT1B 3SWNC 1FXXA 1ZBXA 3MEUA 1KG1A 1QP2A 3I35A 1UGRB 3V8LA 3MP1A 2EQMA 2QXFA 2NUTA 4F04B 2LX7A 2QGFB 3QWXX 2L3SA 2KNBB 2RI2A 4XU3A 2E6ZA 2QTVA 1U8RA 3G4SA 2JMCA 1YCYA 4LN2A 4J9BA 2K3BA 2BZ8A 3OS2A 4M78B 1KSWA 1YWPA 5CIUA 2K5FA 3JB9H 4PFOA 1VQ9Q 2AK5A 5GAN5 4M7AG 4IUVA 4LDUA 2M0OA 3I55A 3H41A 3M0SA 4C92E 1WHGA 1U5SA 3KBGA 2WSFE 4QT7A 3CMEA 1E7OA 2P84A 4NL3A 2LDMA 3CCJA 1N5ZA 1M2OA 3H0FA 4IUPA 4E7KA 4C8QB 1PKSA 2NUZA 5IHNA 5FU6B 2WSEE 2R5MA 1OX8A 4FYWB 2LNVA 4DBFA 3CBOA 3IQLA 2QG9B 3GBQA 1QMCA 3H9NA 1RACB 1Q81U 2DL3A 2D8HA 3JCMe 4LD6A 4MDXA 3HP9A 1AD5A 4KULA 4PJJA 1RAEB 2CT3A 1EZZB 3FDRA 2CT4A 4RTVA 3J81E 1X6BA 3CCSA 1IHVA 1E6HA 1YITQ 4HT8A 2GTOA 1M1KR 2ZPGB 1AZEA 4HKEA 1MHNA 1AEYA 4AFSC 5FLXE 1W1FA 3LWIA 3CC7A 4KGVB 3MO8A 1NM7A 1IRXA 4E7JA 3FEOA 1JEGA 2ED0A 1YNZA 4M77C 2JM9A 2CDTA 5GAMg 2NYSA 1S1NA 2KT1A 1BKBA 2DILA 4DBRA 2ATCB 2IVWA 1AWXA 4XTVA 2EW3A 1WQWA 3TU4K 4FYYB 5CO7A 4C5HA 3FC3A 1HJDA 1VYTA 4ZTFA 4J9IA 1M1FA 3M0TA 4PKCC 2ESWA 1XQHA 3VS3A 2G6FX 5CKDA 2CZ0B 2DLPA 2JNGA 2E4HA 2RM4A 1RL2A 4M77F 3CCET 2HSEB 5LJ5j 2XD0A 5GANf 4LUEA 1H92A 1KJWA 4JLIA 1TSFA 1IZ6A 4JRKA 5GMKe 1EFNA 2LNHB 4E7IA 4AMCA 1OI1A 3NTKA 3N5BB 2E1HA 1AWJA 1SRMA 3VS0A 5IXFA 3REAB 3DKMA 1OEBA 5GAOq 3QXEB 1TXQA 1BI0A 4C5GA 4M77E 2KXDA 2A36A 4BE0A 4M7DC 4J7FA 3HPWA 2LJ0A 2IPOB 3INZA 3FRNA 4UC4A 3VU3C 2DTIA 2XIDA 3EAEA 2EYXA 2LZ6B 5KE3A 4XTZA 2FPDA 2KMTA 2DBKA 1M30A 3M5AA 2DMOA 4RTWA 1AZGB 3JCMg 4J9DA 3S6WA 1T3LA 4LXCA 1ZUYA 2K5IA 2JUFA 3UDCA 1VQPQ 3G1JA 2XDBA 2R5AA 2BZXA 1W70A 3G6EA 1JXOA 2DKGA 1D3BB 3OW2A 3Q1JA 4FYXB 3EG9A 3CCVA 1Q7YR 2ZAEA 3TEEA 5GAN6 3VS1A 3I56T 2CGHA 1FYNA 2D9TA 3MCAB 2EPDA 5GANh 3OYCA 3FIFA 1UGVA 1KC8R 4ZN3A 2DL8A 3JB9J 2EYQA 4FIBA 1YJNQ 4E7HA 3G71A 3X25B 3CPWA 1LPLA 1WDXA 4KRTA 4E2FB 1WHKA 2GGRA 1WJSA 3RUXA 1Q82C 1MMDA 4J83A 2MPXC 3NTHA 1NLPC 2DYBA 2HQXA 2NUTB 5J39A 4C5EA 2ZPHB 1VQKT 2NUPB 3OYKA 1G3YA 3EG3A 1X01A 3JAME 1RADB 1QVGA 4MDWA 2D6FA 2RQUA 5FW9A 1GCQC 1I5OB 2KBTA 3RMSA 1OU8A 3JB9G 4ZTJA 2WSCE 5FRMA 1K8AC 2CUDA 4Q5WA 3GPLA 5KH6A 4M7AC 1WLPB 2XMFA 4FSXA 3L42A 1LCKA 2RH2A 2F2WA 1FMVA 3GNFB 2HCKA 3BDLA 2DL5A 2HZYA 3OYYA 3LH5A 1ABQA 1VQMQ 1M4ZA 4OMFB 2HMAA 1Q86U 1NBEB 2XU8A 4ZGEB 1YJWT 1UEBA 3RBBB 1Q82U 1TU0B 1SKUB 4C8QA 4E47A 4C8QF 1ZSZA 1Q86C 2DZ9A 2KK4A 2RJFA 3RERA 1N6AA 1NJIC 3I55Q 2D0QB 1B34A 1J3TA 2CZ1B 3A1PA 4MMLA 3J7AF 1K1ZA 1MMNA 2LQWA 4JLGA 2BKDN 2KYMA 1VQ9T 2V1QA 3OBWA 1PHTA 1Y57A 1ZUKA 3JCMb 1JU5C 3EGDA 1OPKA 4C8QE 2O88A 4FT2A 1K0SA 2CP3A 4OB2B 5LJ3j 3CCRA 1K4US 4RG8A 4QVZA 3ZFJA 4OP0A 1UECA 3JCMc 4DOVA 2ZPFB 4E6RA 1OU9A 4PJMA 3CCMA 4JJNK 3SD4A 4BI3A 4C8QC 2RJCA 3JSCA 3OSSC 1KQ2A 1ZHIA 4M7DD 3OY9A 4A53A 3RNJA 5GANg 2ZGWA 3HRSA 1GBQA 3CMAA 2F2VA 4J6YA 2GF7A 4J9CA 3CBMA 2A28A 5KYUB 2AIRB 4WF2A 3CCEA 2KE9A 1YJWQ 1OYXA 4X9DA 2CYZB 2G3RA 2LT4A 1MUZA 3FJ5A 1M8VA 1AWWA 2QQRA 1YJ9T 3PVLA 1YN8A 4J9HA 2EGEA 4XAXB 2F69A 1PKTA 2MYSA 3LYIA 1T3SA 2DL4A 5AYFA 1R77A 1VQNQ 3SWNA 3VS7A 2K79A 4Z8AA 3NGPA 4OMQA 4M78E 2YRDA 5CAIA 1YHQA 3HRUA 3CPFA 2P0QA 4M75F 2XHCA 3E19A 3THKA 1Q81R 2MK5A 3JCMW 1M3CA 2YUQA 4HA8A 2DIGA 2DBMA 3M0RA 2QEXT 3CD6T 4A4GA 3CC4Q 1R0BG 4PJOG 2HAXA 1SEMA 5FWBA 1G83A 2DF6A 1M1KU 1BK2A 3FJPA 1WZOA 3CCMQ 1VIEA 1VQ6Q 3VUBA 3HRTA 4LE9A 4LUDA 1XTDA 2L0AA 2J6FA 3SFMA 2KRMA 3TREA 1LNXA 5GMKh 2RJEA 3V7CA 4A4KA 3EGUA 3GP8A 3S3NA 1AHJB 1IGUA 3ZEHA 2V8IA 2NLUA 2XDDA 2RD1A 4K11A 3RR6A 1VQOA 1O75A 4BACA 2LMJA 2DIQA 4AFZC 3JCMP 4HXJA 3VYHB 1ZUUA 5L23A 3VRYA 1VQ8T 3NPFA 3C4SA 3CCLA 1KD1R 2X4YA 4PJOA 4BI8B 1K9MR 4M7DF 5GJWB 2HNIA 2JMAA 2X4JA 5KCOA 3CPWS 2CP0A 2OI3A 3I9QA 2QA4A 2QEXA 3CD6A 3C95A 5IT9E 2YUPA 1JRIA 1K9AA 4QVCA 1VUBA 2FO0A 2K5LA 4BE2A 3PE0A 2ROLA 2O4XB 4L59A 2QQSA 2QEXQ 3CD6Q 1N27A 1UJ0A 3CC7Q 4HVUA 5LJ3f 1BBZA 2A7YA 2BTTA 5GAMj 1ZX6A 2YSQA 1NEBA 1U1TA 2YUOA 1Y0MA 3EG0A 1UGSB 1WNLA 4XU0A 1TTHB 2YWWA 1JJ2P 3S3MA 2YUNA 3PVQA 1BI1A 1YJ9A 4O6JA 4RTUA 1CKBA 2JTEA 1MNDA 4X34A 2PZ1A 1FWZA 2GFAA 3X24B 1WJQA 5GANd 2CS7A 4KBMB 1VQ7T 2RHYA 1TUGB 1VQ5A 2LC4A 4BDYA 1W4SA 2DEQA 1Z9ZA 2VASA 4MZTA 2Z0WA 3QUIA 3EFSA 3CC2Q 3QIIA 3PIOA 5GAMh 1W2BP 2P4RA 1X2QA 2QI2A 4C92F 4M77D 1MV0B 3MP8A 1RAFB 1D1CA 2EWNA 5IH2A 1I07A 1PSFA 4PK4A 2FL7A 1ZBJA 2DYIA 2CUBA 4XU2A 3CCRT 4XQ3A 2QQBA 1C1AA 3M54A 4KH1B 1TS9A 2HL3A 1X69A 2LRQA 1SHGA 3BDUA 3G6EQ 4M4ZA 3HHTB 2VYTA 1Y7XA 2E65A 1G2BA 1YHQT 1RAAB 2D8JA 1IXDA 3GLXA 1QVFA 4HVWA 4ANJA 5CR2A 4FYVB 2MWOA 3CCMT 2DD4A 1VQPA 4M75B 2O9VA 3PNWC 4C8QG 3I55T 3VS4A 1WXTA 2RHUA 5KE2A 3CCUT 2QASA 3CXCS 2QA4Q 2PNIA 1CKAA 4RUGA 1YBYA 5HKCA 3KUFA 3OYDA 2J6OA 3RKXA 1M1KC 4FM4B 2J6KA 4FSSA 4J6XA 4B9XA 3C94A 1UHCA 3I5SA 5GAN4 5KYWA 3DLMA 1M3BA 5KYXA 5A0DA 8AT1B 2PVOB 3SEMA 3LW5E 1NYFA 2XICA 1YI2A 4C0GA 1PCXA 2DVEA 4L5GA 1VQ4T 5HK0A 4N4GA 3CCRQ 4NS5A 4F7UE 2HKQB 1K73C 2KY9A 1D09B 4OB0B 4J6WA 2QDYB 2IG0A 2KR3A 3MEAA 4TVRA 2DE0X 1QKXA 2AZSA 1VQPT 3H0HA 3VJPA 5IXBA 4BUGA 3R6NA 2EJ9A 5FROA 2E70A 4M7AE 1VQ5Q 1D0ZA 1KFZA 3E1SA 2K3YA 3A8MB 2O9SA 5GJVB 3SWNB 1RI9A 2XK0A 2O4XA 4OMNA 1VQNT 2F5KA 2YRVA 4LDVA 4KGZB 1RUWA 4RKUE 2RMOA 5LJ3d 2PQWA 8ATCB 2MWPA 4CI0C 2I0NA 1GBRA 3VUZA 2DJZA 5C6SA 3OYNA 5I22A 2DL7A 2RJDA 6AT1B 4DBHA 2E5KA 3J80E 4M7AF 4M7AA 2EAYA 3HFOA 1OV3A 2DZCA 3LWHA 1YIJA 1KK7A 1IREB 3M55A 2K9GA 4RTYA 5IHIA 2EGAA 5EC7A 1BCMA 5I21A 3MP6A 5I11A 4PL6A 2VV5A 3EFRA 3JB9I 2H8HA 3VV0A 1NPPA 1I1JA 1OZ3A 1VQLQ 2DK3A 1Z9QA 2EQUA 7AT1B 4A4HA 3CCJQ 1TUDA 3L2QA 1HYOA 2LQ8A 2O2OA 2DJQA 3G6ET 3X28B 3VYGA 3CMEQ 3OYMA 2JOYA 3QO3A 4FT4A 1BIBA 2JM8A 1KC8C 3WXMB
chains in the Genus database with same CATH topology
1M1KR 3CPWP 1VQMQ 1YJ9Q 1VQ5Q 3G4SQ 3CCLQ 3CCRQ 1M90R 1JJ2P 3CC2Q 3CXCP 3CCSQ 1YHQQ 1K73R 1W2BP 3CC4Q 1Q82R 1KQSP 2OTLQ 3G6EQ 1N8RR 1VQLQ 1VQ9Q 1KD1R 3CCJQ 1Q7YR 3G71Q 1VQKQ 1VQNQ 1QVGP 1K8AR 1VQ8Q 1K9MR 3CCQQ 2QEXQ 3CD6Q 2QA4Q 1VQ7Q 1VQOQ 3CMEQ 1S72Q 3CC7Q 1YI2Q 3CMAQ 3CCUQ 3CCVQ 3CCMQ 3OW2P 1YJWQ 1QVFP 1VQ6Q 3I56Q 1Q86R 1VQ4Q 3CCEQ 1KC8R 2OTJQ 1YITQ 3I55Q 1NJIR 1YJNQ 1Q81R 1VQPQ 1YIJQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K R;  3CPW P;  1VQM Q;  1YJ9 Q;  1VQ5 Q;  3G4S Q;  3CCL Q;  3CCR Q;  1M90 R;  1JJ2 P;  3CC2 Q;  3CXC P;  3CCS Q;  1YHQ Q;  1K73 R;  1W2B P;  3CC4 Q;  1Q82 R;  1KQS P;  2OTL Q;  3G6E Q;  1N8R R;  1VQL Q;  1VQ9 Q;  1KD1 R;  3CCJ Q;  1Q7Y R;  3G71 Q;  1VQK Q;  1VQN Q;  1QVG P;  1K8A R;  1VQ8 Q;  1K9M R;  3CCQ Q;  2QEX Q;  3CD6 Q;  2QA4 Q;  1VQ7 Q;  1VQO Q;  3CME Q;  1S72 Q;  3CC7 Q;  1YI2 Q;  3CMA Q;  3CCU Q;  3CCV Q;  3CCM Q;  3OW2 P;  1YJW Q;  1QVF P;  1VQ6 Q;  3I56 Q;  1Q86 R;  1VQ4 Q;  3CCE Q;  1KC8 R;  2OTJ Q;  1YIT Q;  3I55 Q;  1NJI R;  1YJN Q;  1Q81 R;  1VQP Q;  1YIJ Q; 
#chains in the Genus database with same CATH topology
 2HQH A;  2YT6 A;  1M90 R;  3OQ5 A;  4JDS A;  1Q82 R;  2RA2 A;  3DB3 A;  1LJO A;  2COZ A;  4GLM A;  2EKO A;  1WHJ A;  1TWB A;  2E41 A;  3JRZ A;  4RTZ A;  4WCI A;  1UG1 A;  4JZ4 A;  4KGX B;  2OTL T;  3TVT A;  2LVM A;  5LJ5 h;  2PU9 B;  1OPL A;  2C06 A;  1DJ7 B;  3M57 A;  5GMK l;  3CBP A;  1QVG P;  5LL6 S;  1MV3 A;  2E6N A;  4QW2 A;  4IIO A;  4HVV A;  5FU6 C;  1Y71 A;  4IUU A;  3V8J A;  2JT4 A;  3A8H B;  4V2S A;  3NTI A;  2RI5 A;  4RCC A;  5LJ3 g;  2BE7 D;  2H3E B;  2JS0 A;  4BI4 A;  5GAN 3;  5I2S A;  3O8V A;  2LQK A;  1K9M U;  5AT1 B;  5FU7 B;  2PVG B;  3PTA A;  3CCS Q;  1I4K 1;  2RB6 A;  2LTO A;  1ZQ1 A;  2XDP A;  2DX1 A;  4HCC A;  2MI6 A;  4XTX A;  1YWO A;  2KI7 A;  5HY6 A;  2YLB A;  5GAO n;  2PVD B;  3TSW A;  2EYY A;  4Z02 A;  5A0L A;  3SDZ A;  2DTH A;  2BUD A;  4LNP A;  1B7T A;  2KYB A;  2JN0 A;  1UB4 A;  2DPP B;  2EYZ A;  1N9S A;  2R57 A;  3KXT A;  1BI2 A;  4JPB W;  2A3L A;  2LCL A;  2M51 A;  3TQ7 P;  3RDV A;  2GCX A;  3PT9 A;  5FU7 C;  4N0A C;  5IN1 A;  4A4E A;  3PMI A;  2C0T A;  1RAB B;  3CCL T;  2K7A A;  3C12 A;  2JJ9 A;  1AWO A;  2VB6 A;  1O9S A;  3DB4 A;  3NMZ C;  3V7S A;  3M58 A;  1U1S A;  3WVE B;  2Y4Y A;  1RAG B;  2EYW A;  1F1B B;  1SSH A;  1T0H A;  4B6M A;  2OTL Q;  3TSZ A;  2CZ7 B;  3QZ9 B;  2D1X A;  5KCH A;  2X9H A;  3CMA Q;  4BY6 C;  3OYL A;  1QQJ A;  2V1R A;  1WXB A;  3EH2 A;  3CC7 T;  2I2L A;  1OX9 A;  2ZPE B;  5J26 A;  2ZCF B;  1LOJ A;  5GAN 2;  4BDZ A;  5GAN j;  4FW1 A;  3EGX A;  2FEI A;  4OB1 B;  3QPH A;  4NL2 A;  2J7I A;  5HCK A;  3AHU A;  5LJ5 g;  2COW A;  1OOT A;  3F70 A;  4AG2 C;  4M7D G;  3VS5 A;  3CCS T;  2E10 A;  1M27 C;  2RPN A;  3CCJ T;  3CCU Q;  3CCV Q;  4FW2 A;  4LDY A;  1JBM A;  5M9O A;  3CCE Q;  2R58 A;  1S72 T;  3EHR A;  3QSU A;  4IUT A;  1E6G A;  4JJD A;  3M0U A;  1KQ1 A;  3CXC P;  1PM3 A;  1Y96 A;  3WVD B;  4ZGD B;  1T0J A;  1SSF A;  1H3H A;  3UPU A;  2QYZ A;  3JCM Q;  3LH0 A;  4KH0 B;  3UA7 A;  4OMM A;  2RI3 A;  1PRM C;  2FVU A;  2OTJ Q;  2FPF A;  3X20 B;  1Q81 C;  1JO8 A;  3H8Z A;  2CP5 A;  2ZZD A;  1RLQ C;  2MCN A;  3CCL Q;  4XTU A;  2GBQ A;  1YP5 A;  1PG5 B;  2YHT A;  2AZV A;  3JB9 F;  3ASK A;  5IHK A;  2JTM A;  5KYN A;  1YI2 Q;  1WA7 A;  4CC4 B;  2ECZ A;  2YDL A;  1WGS A;  5CVI A;  1QCF A;  1KD1 U;  3HL8 A;  2P0K A;  3LGF A;  1AOJ A;  2AKL A;  4M78 C;  1D0X A;  2BIV A;  2ROT A;  4GY5 A;  3L1A A;  1X43 A;  4IUQ A;  3CCQ Q;  4II1 A;  2DRM A;  2OTJ A;  1HD3 A;  3EG9 B;  3KFV A;  3L2W A;  1W2B A;  2AKK A;  1WYX A;  2VXE A;  4FCY A;  4IKF A;  2K2M A;  4HCZ A;  1NYG A;  3QYH B;  5LJ5 f;  4AFQ C;  2GQI A;  2ZPB B;  4JZ3 A;  1VQ6 A;  3G7Z A;  1GCP A;  2LCC A;  2JW4 A;  5L8R E;  4OMO A;  1TOV A;  2FRY A;  1A0N B;  1D0Y A;  4DOW A;  1Y96 B;  4N4H A;  2EQK A;  4PFP A;  4B9W A;  3CC2 A;  3MEW A;  4N4I A;  1EIF A;  3GNG A;  1B07 A;  1SF9 A;  2O31 A;  1M3A A;  3QJ6 A;  5CKB A;  2EKH A;  2EJG A;  2KT8 A;  4Y28 E;  5ECA A;  1G3W A;  2JVV A;  5GAO r;  1VQN A;  1M2V A;  2DRK A;  4F17 A;  2M0Y A;  1WPY A;  1YJW A;  1KC8 U;  2COY A;  3L2R A;  3QYG B;  4A4F A;  3X26 B;  1WI7 A;  2RNA A;  1BU1 A;  3CQT A;  1GFC A;  2HD0 A;  4PJN A;  4Z89 A;  1QCN A;  3ME9 A;  3HKS A;  1QVG S;  4M78 G;  3I5R A;  1SRL A;  1XOV A;  2EQJ A;  3OYJ A;  3P8D A;  3A8O B;  1PNJ A;  1PD1 A;  2V8K A;  5HK3 A;  4A54 A;  4OVA A;  2QK0 A;  4J9G A;  3CCQ T;  3JB9 D;  4QVD A;  2PTK A;  5D6W A;  3MJX A;  3M56 A;  2HEQ A;  2RN8 A;  1QVF S;  1FMK A;  3V7R A;  4PJO B;  3OW2 S;  3E9G A;  3QWY A;  3RMQ A;  2L3Q A;  2LJ1 A;  3CCU A;  1WX6 A;  1V29 B;  1GRI A;  1V1C A;  1H64 1;  3UA6 A;  3E2U A;  3C0C A;  2E64 A;  2QGG A;  2E5Q A;  3OBY A;  2SRC A;  3ZL7 C;  4C92 D;  3NFC A;  5CKH A;  1R8O B;  3CC2 T;  5DY9 A;  1PWT A;  3CPW P;  3CC4 T;  3G4S Q;  1YIT T;  2C0O A;  1ZSG A;  2A08 A;  1QWF A;  2JZ2 A;  3RKW A;  2RO0 A;  2LT1 A;  3NHN A;  1WHL A;  1WXU A;  2LP5 A;  4RTT A;  4D6W A;  4D8K A;  1UJY A;  1VQ4 Q;  3M9Q A;  3PMT A;  1M8M A;  2CH4 A;  4PJO D;  3BY7 A;  3S3O A;  2M9U A;  5GAM d;  1YHQ Q;  1BCO A;  2B86 A;  2QQ9 A;  4X1V A;  1N8R R;  1OZ2 A;  2MIO A;  4JRI A;  5GAN e;  1ARK A;  2K3X A;  2HL5 C;  4DA4 A;  1GXI E;  3SB2 A;  4CRI A;  5CCA A;  1VYV A;  4J8O A;  3I56 Q;  3DLL A;  1UDL A;  2DNU A;  1PRL C;  2DVJ A;  2ABL A;  2VVK A;  2FPE A;  1JJ2 S;  3EFO B;  4CC3 A;  2F1L A;  4FU6 A;  2QDL A;  3HFN A;  4WTO B;  1UTI A;  1Q7Y U;  2VXF A;  4EMH A;  3EG2 A;  4C0D B;  4MZM A;  2X4X A;  5LJ3 h;  1M1G A;  3O5Z A;  4F7U F;  4HCK A;  1UE9 A;  5KYU A;  4F7U G;  2XG8 D;  2CRE A;  4M7D B;  1CSK A;  5I2M A;  3CXC A;  1MNE A;  2DXU A;  3CC4 A;  1K73 R;  4JRQ A;  3BFM A;  3HSB A;  4XK8 E;  4ORZ A;  4F14 A;  1BYM A;  4JS5 A;  2F5T X;  3G71 Q;  4C92 A;  2KGT A;  3CCQ A;  5GAO l;  3EG1 A;  2FRW A;  1YCS B;  2DTO A;  2KRO A;  1IB8 A;  3LGL A;  4ELZ C;  4E7S A;  3CCV T;  1MGQ A;  2RHX A;  4M77 A;  1X27 A;  4QKU A;  4MMK A;  4PJO E;  2HBW A;  4JUV A;  3OS1 A;  1BIA A;  2OAU A;  3OB9 A;  2IIM A;  4LDX A;  3P8B B;  5FRN A;  2EFI A;  2FG0 A;  3VKI A;  1VQ8 A;  1B3Q A;  2XI9 A;  4M7A B;  1PD0 A;  2DXT A;  2FYK A;  2AHJ B;  3I56 A;  3A8L B;  2CKK A;  2KVQ G;  1M90 U;  3RES A;  1UGP B;  5KYX B;  4XU1 A;  3VRZ A;  2GNC A;  2LX9 A;  5GAO p;  2VGN A;  2EQI A;  1G3S A;  2EJF A;  3PIP A;  3QDF A;  5KYW B;  4PJO F;  2ZPI B;  1S72 A;  4R55 A;  1B34 B;  3EHQ A;  2DER A;  1TG0 A;  1ACM B;  1G3T A;  4GBQ A;  1JB0 E;  4XTW A;  3OYA A;  1FMW A;  1Q95 G;  2X51 A;  4DEY A;  5GAM f;  3QZ5 B;  3M4G A;  4F7U A;  2RK2 A;  3MHX A;  4ELY C;  2JTF A;  2BE9 B;  1WIE A;  2H3J A;  2DET A;  4C5I A;  4F16 A;  2FZG B;  2A0F B;  2KRN A;  1GL5 A;  3M53 A;  4X9C A;  2MOX A;  4ME7 A;  4XTY A;  2LJ3 A;  1AT1 B;  1N8R U;  2QAZ A;  1I5L A;  4BB7 A;  2CP7 A;  5CK9 A;  2DA9 A;  3OA6 A;  2YLC A;  2KAF A;  2QQA A;  2LQN A;  1PSE A;  1QWE A;  1M90 C;  4LD9 K;  2X3X D;  1VQO T;  4ATO A;  3EGX B;  3CME T;  1VYU A;  2SEM A;  3JV3 A;  3OYF A;  1HK9 A;  1VQ7 Q;  2EBP A;  4OF1 A;  1QVF P;  4OML A;  4AFU C;  4BD3 A;  4M75 D;  1VA7 A;  1TH7 A;  2J05 A;  2NUP A;  3AT1 B;  2CSQ A;  3JCM f;  3JCM V;  1YIJ Q;  4J9F A;  4PNO A;  3UT1 A;  4C92 B;  2RK1 A;  4OB3 B;  4D8D A;  4J7I A;  1WQ7 A;  3M0P A;  2CZ6 B;  1X6O A;  4A63 B;  4Y91 A;  1ZA2 B;  4RMO A;  2W10 A;  1BI3 A;  2EVR A;  5DLQ E;  3QDR B;  4Y92 A;  1OQK A;  3OMG A;  1RLP C;  4RG2 A;  4M75 A;  4HT9 A;  1QP3 A;  3RIR A;  2OX7 A;  1YJN A;  4C92 C;  2MF2 A;  2F2X A;  1X2K A;  5LJ5 e;  2RQR A;  1PC0 A;  2ENM A;  1BB9 A;  1WFW A;  2L3R A;  2VUB A;  3ULR B;  1X75 C;  4ESR A;  3OW2 P;  1ZSZ B;  3JCM J;  3P8H A;  1ZLM A;  3VS2 A;  1Y07 A;  2GQV A;  4M7A D;  1ABO A;  5CKE A;  2DD5 A;  4QQ6 A;  2CSI A;  3FLG A;  4EMK A;  2QA4 T;  1K73 U;  5DLO A;  1NPR A;  5GAN 8;  5C0M A;  1Q7Y C;  1H3Z A;  5LJ3 e;  3SHW A;  4HCB A;  1KHC A;  3E9F A;  4KT0 E;  1S72 Q;  5GAN 7;  2Y90 A;  2RQW A;  4CC7 A;  3QBY A;  5LJ5 d;  1QCO A;  3A98 A;  2RQT A;  4JRP A;  2DXC A;  3EH1 A;  3PGG A;  2KSS A;  1IO6 A;  1JJ2 A;  1LVK A;  1EX4 A;  1YJ9 Q;  2DM1 A;  3R6O A;  2CP6 A;  4JS4 A;  2L89 A;  2EIF A;  1HXD A;  3OYH A;  3UAT A;  3L2U A;  3G4S T;  2MMP A;  2C0I A;  4OMP A;  1QLY A;  1VQ8 Q;  2CH4 W;  2FB7 A;  3OYI A;  1UGQ B;  2OAW A;  5D6Y A;  1HSQ A;  3OS0 A;  2VWF A;  4J5Y A;  4M78 D;  4IIM A;  4FL6 A;  1KIK A;  3D7S B;  1D1A A;  4KUD K;  4R56 A;  3ZBD A;  4DBQ A;  1RAH B;  4M7D E;  1QW1 A;  3T9N A;  1C0M A;  3CMA T;  1W6X A;  1K8A R;  2M1H A;  4EMK C;  4PJO C;  2X35 A;  4LDW A;  2P0P A;  5CQX A;  2DAQ A;  2OTL A;  2X3W D;  2XKO C;  3VS6 A;  5EG2 A;  1QVP A;  2DFU A;  2RF0 A;  3U23 A;  4DEX A;  1KQS S;  2EGC A;  3H0I A;  4J9E A;  3UWN A;  5DM7 R;  1WHM A;  4ZGJ B;  3GIB A;  2RHZ A;  1OUL A;  1I0C A;  5J3B A;  2K57 A;  1VQO Q;  2E3H A;  3OYG A;  3V8K A;  1VIF A;  3URG A;  3OYE A;  1NZ9 A;  1Q86 R;  1NJI R;  4DQ2 A;  2OJ2 A;  2M16 A;  4CC2 A;  2FZC B;  4EMG A;  4PJL A;  4C0F A;  4PLI A;  4EDU A;  1SG5 A;  4QQG A;  2O01 E;  3GOX A;  1KHI A;  1IGQ A;  2GFU A;  2K4Y A;  2K2V A;  1UUE A;  4M75 C;  2J06 A;  2JXB A;  4M77 G;  5CQY A;  3JCM h;  3MEV A;  2KXC A;  2K6D A;  5D6X A;  1WHH A;  2AT1 B;  4IUR A;  1NJI U;  2DO3 A;  1W2B S;  1D1B A;  1M9S A;  2L3P A;  1VQL T;  2M02 A;  2GTJ A;  3REB B;  4VUB A;  1VQ4 A;  1MMG A;  2W0Z A;  1VQM T;  2V8J A;  5FWC A;  4M77 B;  3FB9 A;  4E7L A;  2FZK B;  4C0D C;  2DXB A;  4M75 G;  4EMK B;  1M5Q 1;  5KYY A;  4YTL A;  3TCJ A;  2YRC A;  3HTR A;  5CKF A;  4RTX A;  1I8F A;  4F7U B;  3LX7 A;  1NEG A;  5A2Q E;  4EIK A;  5GMK m;  3OSV A;  1AVZ C;  9ATC B;  4M7D A;  3M59 A;  1H8K A;  3A5Z B;  1FX7 A;  4PFZ A;  4P5N A;  3GF5 A;  3EGD B;  1RAI B;  2L8D A;  3MPU B;  4AG1 C;  1VQK A;  3M0Q A;  1SHF A;  5GMK i;  2VKN A;  1WJR A;  2VGM A;  1VQK Q;  1R0C B;  2JS2 A;  1K0X A;  3G71 T;  1NE8 A;  3CEY A;  1GCQ A;  2YXY A;  1VQ6 T;  2HKN A;  2KDS A;  1YIT A;  2B8A A;  1VQ9 A;  5KYY B;  4C0Z A;  1K76 A;  4ZN1 A;  3JCM X;  2L2P A;  2PUO B;  3ER0 A;  3OS5 A;  2X4W A;  1XNI A;  1G5V A;  1P92 A;  1RI0 A;  1K8A U;  1KQS A;  3A8G B;  3JCM d;  2ED1 A;  1JXM A;  1U3O A;  2LCS A;  3MET A;  4O5V A;  3QG1 A;  1VQM A;  1I81 A;  3OMC A;  2RHI A;  3PFS A;  4C8Q D;  3QKJ A;  5GAM e;  2A37 A;  4OGC A;  2VC8 A;  1UHF A;  5D7U A;  1YIJ T;  2KRS A;  4JJC A;  1KQS P;  3BW1 A;  1VQ5 T;  3H6Z A;  4EPC A;  2CP2 A;  1V76 A;  1UFF A;  2OTJ T;  2E12 A;  2BZY A;  1YJN T;  1SPK A;  4E7Z A;  2HBP A;  4R0K A;  3EFO A;  1XJW B;  4MZP A;  4NOY A;  4OGE A;  3L2Z A;  2HQE A;  1TUC A;  2L5Q A;  1VQL A;  1QKW A;  1U06 A;  2QTX A;  3OYB A;  2MAM A;  4PLL A;  5GMK j;  3LLR A;  3QJY A;  4M78 A;  5GAO m;  1YI2 T;  1KD1 C;  2KEA A;  4M78 F;  1K9M C;  2HSP A;  4ZNX A;  4Z88 A;  2RQV A;  2DEU A;  1NLO C;  2V26 A;  1YFN A;  4M75 E;  5A0G A;  2HDA A;  1NG2 A;  1N9R A;  1ZSZ C;  2P4T A;  4C92 G;  4KUI A;  1D3B A;  3QHS A;  1ZA1 B;  4RCB A;  1N8R C;  4GLK A;  3UF4 A;  1MMA A;  3M4Y A;  1JQQ A;  1G8X A;  2D0N A;  4L6V 5;  4QQD A;  2PUK B;  5IAY A;  2E3I A;  1X6G A;  4JJB A;  1IHW A;  1M2V B;  4N0A A;  3L2V A;  2Y4X A;  3RKY A;  1VQ7 A;  1GFD A;  4BE1 A;  3BE3 A;  2FHD A;  1C6V X;  1VOM A;  2WAC A;  4BY6 B;  2KQW A;  3MKD A;  2NWM A;  4AT1 B;  3SWN C;  1FXX A;  1ZBX A;  3MEU A;  1KG1 A;  1QP2 A;  3I35 A;  1UGR B;  3V8L A;  3MP1 A;  2EQM A;  2QXF A;  2NUT A;  4F04 B;  2LX7 A;  2QGF B;  3QWX X;  2L3S A;  2KNB B;  2RI2 A;  4XU3 A;  2E6Z A;  2QTV A;  1U8R A;  3G4S A;  2JMC A;  1YCY A;  4LN2 A;  4J9B A;  2K3B A;  2BZ8 A;  3OS2 A;  4M78 B;  1KSW A;  1YWP A;  5CIU A;  2K5F A;  3JB9 H;  4PFO A;  1VQ9 Q;  2AK5 A;  5GAN 5;  4M7A G;  4IUV A;  4LDU A;  2M0O A;  3I55 A;  3H41 A;  3M0S A;  4C92 E;  1WHG A;  1U5S A;  3KBG A;  2WSF E;  4QT7 A;  3CME A;  1E7O A;  2P84 A;  4NL3 A;  2LDM A;  3CCJ A;  1N5Z A;  1M2O A;  3H0F A;  4IUP A;  4E7K A;  4C8Q B;  1PKS A;  2NUZ A;  5IHN A;  5FU6 B;  2WSE E;  2R5M A;  1OX8 A;  4FYW B;  2LNV A;  4DBF A;  3CBO A;  3IQL A;  2QG9 B;  3GBQ A;  1QMC A;  3H9N A;  1RAC B;  1Q81 U;  2DL3 A;  2D8H A;  3JCM e;  4LD6 A;  4MDX A;  3HP9 A;  1AD5 A;  4KUL A;  4PJJ A;  1RAE B;  2CT3 A;  1EZZ B;  3FDR A;  2CT4 A;  4RTV A;  3J81 E;  1X6B A;  3CCS A;  1IHV A;  1E6H A;  1YIT Q;  4HT8 A;  2GTO A;  1M1K R;  2ZPG B;  1AZE A;  4HKE A;  1MHN A;  1AEY A;  4AFS C;  5FLX E;  1W1F A;  3LWI A;  3CC7 A;  4KGV B;  3MO8 A;  1NM7 A;  1IRX A;  4E7J A;  3FEO A;  1JEG A;  2ED0 A;  1YNZ A;  4M77 C;  2JM9 A;  2CDT A;  5GAM g;  2NYS A;  1S1N A;  2KT1 A;  1BKB A;  2DIL A;  4DBR A;  2ATC B;  2IVW A;  1AWX A;  4XTV A;  2EW3 A;  1WQW A;  3TU4 K;  4FYY B;  5CO7 A;  4C5H A;  3FC3 A;  1HJD A;  1VYT A;  4ZTF A;  4J9I A;  1M1F A;  3M0T A;  4PKC C;  2ESW A;  1XQH A;  3VS3 A;  2G6F X;  5CKD A;  2CZ0 B;  2DLP A;  2JNG A;  2E4H A;  2RM4 A;  1RL2 A;  4M77 F;  3CCE T;  2HSE B;  5LJ5 j;  2XD0 A;  5GAN f;  4LUE A;  1H92 A;  1KJW A;  4JLI A;  1TSF A;  1IZ6 A;  4JRK A;  5GMK e;  1EFN A;  2LNH B;  4E7I A;  4AMC A;  1OI1 A;  3NTK A;  3N5B B;  2E1H A;  1AWJ A;  1SRM A;  3VS0 A;  5IXF A;  3REA B;  3DKM A;  1OEB A;  5GAO q;  3QXE B;  1TXQ A;  1BI0 A;  4C5G A;  4M77 E;  2KXD A;  2A36 A;  4BE0 A;  4M7D C;  4J7F A;  3HPW A;  2LJ0 A;  2IPO B;  3INZ A;  3FRN A;  4UC4 A;  3VU3 C;  2DTI A;  2XID A;  3EAE A;  2EYX A;  2LZ6 B;  5KE3 A;  4XTZ A;  2FPD A;  2KMT A;  2DBK A;  1M30 A;  3M5A A;  2DMO A;  4RTW A;  1AZG B;  3JCM g;  4J9D A;  3S6W A;  1T3L A;  4LXC A;  1ZUY A;  2K5I A;  2JUF A;  3UDC A;  1VQP Q;  3G1J A;  2XDB A;  2R5A A;  2BZX A;  1W70 A;  3G6E A;  1JXO A;  2DKG A;  1D3B B;  3OW2 A;  3Q1J A;  4FYX B;  3EG9 A;  3CCV A;  1Q7Y R;  2ZAE A;  3TEE A;  5GAN 6;  3VS1 A;  3I56 T;  2CGH A;  1FYN A;  2D9T A;  3MCA B;  2EPD A;  5GAN h;  3OYC A;  3FIF A;  1UGV A;  1KC8 R;  4ZN3 A;  2DL8 A;  3JB9 J;  2EYQ A;  4FIB A;  1YJN Q;  4E7H A;  3G71 A;  3X25 B;  3CPW A;  1LPL A;  1WDX A;  4KRT A;  4E2F B;  1WHK A;  2GGR A;  1WJS A;  3RUX A;  1Q82 C;  1MMD A;  4J83 A;  2MPX C;  3NTH A;  1NLP C;  2DYB A;  2HQX A;  2NUT B;  5J39 A;  4C5E A;  2ZPH B;  1VQK T;  2NUP B;  3OYK A;  1G3Y A;  3EG3 A;  1X01 A;  3JAM E;  1RAD B;  1QVG A;  4MDW A;  2D6F A;  2RQU A;  5FW9 A;  1GCQ C;  1I5O B;  2KBT A;  3RMS A;  1OU8 A;  3JB9 G;  4ZTJ A;  2WSC E;  5FRM A;  1K8A C;  2CUD A;  4Q5W A;  3GPL A;  5KH6 A;  4M7A C;  1WLP B;  2XMF A;  4FSX A;  3L42 A;  1LCK A;  2RH2 A;  2F2W A;  1FMV A;  3GNF B;  2HCK A;  3BDL A;  2DL5 A;  2HZY A;  3OYY A;  3LH5 A;  1ABQ A;  1VQM Q;  1M4Z A;  4OMF B;  2HMA A;  1Q86 U;  1NBE B;  2XU8 A;  4ZGE B;  1YJW T;  1UEB A;  3RBB B;  1Q82 U;  1TU0 B;  1SKU B;  4C8Q A;  4E47 A;  4C8Q F;  1ZSZ A;  1Q86 C;  2DZ9 A;  2KK4 A;  2RJF A;  3RER A;  1N6A A;  1NJI C;  3I55 Q;  2D0Q B;  1B34 A;  1J3T A;  2CZ1 B;  3A1P A;  4MML A;  3J7A F;  1K1Z A;  1MMN A;  2LQW A;  4JLG A;  2BKD N;  2KYM A;  1VQ9 T;  2V1Q A;  3OBW A;  1PHT A;  1Y57 A;  1ZUK A;  3JCM b;  1JU5 C;  3EGD A;  1OPK A;  4C8Q E;  2O88 A;  4FT2 A;  1K0S A;  2CP3 A;  4OB2 B;  5LJ3 j;  3CCR A;  1K4U S;  4RG8 A;  4QVZ A;  3ZFJ A;  4OP0 A;  1UEC A;  3JCM c;  4DOV A;  2ZPF B;  4E6R A;  1OU9 A;  4PJM A;  3CCM A;  4JJN K;  3SD4 A;  4BI3 A;  4C8Q C;  2RJC A;  3JSC A;  3OSS C;  1KQ2 A;  1ZHI A;  4M7D D;  3OY9 A;  4A53 A;  3RNJ A;  5GAN g;  2ZGW A;  3HRS A;  1GBQ A;  3CMA A;  2F2V A;  4J6Y A;  2GF7 A;  4J9C A;  3CBM A;  2A28 A;  5KYU B;  2AIR B;  4WF2 A;  3CCE A;  2KE9 A;  1YJW Q;  1OYX A;  4X9D A;  2CYZ B;  2G3R A;  2LT4 A;  1MUZ A;  3FJ5 A;  1M8V A;  1AWW A;  2QQR A;  1YJ9 T;  3PVL A;  1YN8 A;  4J9H A;  2EGE A;  4XAX B;  2F69 A;  1PKT A;  2MYS A;  3LYI A;  1T3S A;  2DL4 A;  5AYF A;  1R77 A;  1VQN Q;  3SWN A;  3VS7 A;  2K79 A;  4Z8A A;  3NGP A;  4OMQ A;  4M78 E;  2YRD A;  5CAI A;  1YHQ A;  3HRU A;  3CPF A;  2P0Q A;  4M75 F;  2XHC A;  3E19 A;  3THK A;  1Q81 R;  2MK5 A;  3JCM W;  1M3C A;  2YUQ A;  4HA8 A;  2DIG A;  2DBM A;  3M0R A;  2QEX T;  3CD6 T;  4A4G A;  3CC4 Q;  1R0B G;  4PJO G;  2HAX A;  1SEM A;  5FWB A;  1G83 A;  2DF6 A;  1M1K U;  1BK2 A;  3FJP A;  1WZO A;  3CCM Q;  1VIE A;  1VQ6 Q;  3VUB A;  3HRT A;  4LE9 A;  4LUD A;  1XTD A;  2L0A A;  2J6F A;  3SFM A;  2KRM A;  3TRE A;  1LNX A;  5GMK h;  2RJE A;  3V7C A;  4A4K A;  3EGU A;  3GP8 A;  3S3N A;  1AHJ B;  1IGU A;  3ZEH A;  2V8I A;  2NLU A;  2XDD A;  2RD1 A;  4K11 A;  3RR6 A;  1VQO A;  1O75 A;  4BAC A;  2LMJ A;  2DIQ A;  4AFZ C;  3JCM P;  4HXJ A;  3VYH B;  1ZUU A;  5L23 A;  3VRY A;  1VQ8 T;  3NPF A;  3C4S A;  3CCL A;  1KD1 R;  2X4Y A;  4PJO A;  4BI8 B;  1K9M R;  4M7D F;  5GJW B;  2HNI A;  2JMA A;  2X4J A;  5KCO A;  3CPW S;  2CP0 A;  2OI3 A;  3I9Q A;  2QA4 A;  2QEX A;  3CD6 A;  3C95 A;  5IT9 E;  2YUP A;  1JRI A;  1K9A A;  4QVC A;  1VUB A;  2FO0 A;  2K5L A;  4BE2 A;  3PE0 A;  2ROL A;  2O4X B;  4L59 A;  2QQS A;  2QEX Q;  3CD6 Q;  1N27 A;  1UJ0 A;  3CC7 Q;  4HVU A;  5LJ3 f;  1BBZ A;  2A7Y A;  2BTT A;  5GAM j;  1ZX6 A;  2YSQ A;  1NEB A;  1U1T A;  2YUO A;  1Y0M A;  3EG0 A;  1UGS B;  1WNL A;  4XU0 A;  1TTH B;  2YWW A;  1JJ2 P;  3S3M A;  2YUN A;  3PVQ A;  1BI1 A;  1YJ9 A;  4O6J A;  4RTU A;  1CKB A;  2JTE A;  1MND A;  4X34 A;  2PZ1 A;  1FWZ A;  2GFA A;  3X24 B;  1WJQ A;  5GAN d;  2CS7 A;  4KBM B;  1VQ7 T;  2RHY A;  1TUG B;  1VQ5 A;  2LC4 A;  4BDY A;  1W4S A;  2DEQ A;  1Z9Z A;  2VAS A;  4MZT A;  2Z0W A;  3QUI A;  3EFS A;  3CC2 Q;  3QII A;  3PIO A;  5GAM h;  1W2B P;  2P4R A;  1X2Q A;  2QI2 A;  4C92 F;  4M77 D;  1MV0 B;  3MP8 A;  1RAF B;  1D1C A;  2EWN A;  5IH2 A;  1I07 A;  1PSF A;  4PK4 A;  2FL7 A;  1ZBJ A;  2DYI A;  2CUB A;  4XU2 A;  3CCR T;  4XQ3 A;  2QQB A;  1C1A A;  3M54 A;  4KH1 B;  1TS9 A;  2HL3 A;  1X69 A;  2LRQ A;  1SHG A;  3BDU A;  3G6E Q;  4M4Z A;  3HHT B;  2VYT A;  1Y7X A;  2E65 A;  1G2B A;  1YHQ T;  1RAA B;  2D8J A;  1IXD A;  3GLX A;  1QVF A;  4HVW A;  4ANJ A;  5CR2 A;  4FYV B;  2MWO A;  3CCM T;  2DD4 A;  1VQP A;  4M75 B;  2O9V A;  3PNW C;  4C8Q G;  3I55 T;  3VS4 A;  1WXT A;  2RHU A;  5KE2 A;  3CCU T;  2QAS A;  3CXC S;  2QA4 Q;  2PNI A;  1CKA A;  4RUG A;  1YBY A;  5HKC A;  3KUF A;  3OYD A;  2J6O A;  3RKX A;  1M1K C;  4FM4 B;  2J6K A;  4FSS A;  4J6X A;  4B9X A;  3C94 A;  1UHC A;  3I5S A;  5GAN 4;  5KYW A;  3DLM A;  1M3B A;  5KYX A;  5A0D A;  8AT1 B;  2PVO B;  3SEM A;  3LW5 E;  1NYF A;  2XIC A;  1YI2 A;  4C0G A;  1PCX A;  2DVE A;  4L5G A;  1VQ4 T;  5HK0 A;  4N4G A;  3CCR Q;  4NS5 A;  4F7U E;  2HKQ B;  1K73 C;  2KY9 A;  1D09 B;  4OB0 B;  4J6W A;  2QDY B;  2IG0 A;  2KR3 A;  3MEA A;  4TVR A;  2DE0 X;  1QKX A;  2AZS A;  1VQP T;  3H0H A;  3VJP A;  5IXB A;  4BUG A;  3R6N A;  2EJ9 A;  5FRO A;  2E70 A;  4M7A E;  1VQ5 Q;  1D0Z A;  1KFZ A;  3E1S A;  2K3Y A;  3A8M B;  2O9S A;  5GJV B;  3SWN B;  1RI9 A;  2XK0 A;  2O4X A;  4OMN A;  1VQN T;  2F5K A;  2YRV A;  4LDV A;  4KGZ B;  1RUW A;  4RKU E;  2RMO A;  5LJ3 d;  2PQW A;  8ATC B;  2MWP A;  4CI0 C;  2I0N A;  1GBR A;  3VUZ A;  2DJZ A;  5C6S A;  3OYN A;  5I22 A;  2DL7 A;  2RJD A;  6AT1 B;  4DBH A;  2E5K A;  3J80 E;  4M7A F;  4M7A A;  2EAY A;  3HFO A;  1OV3 A;  2DZC A;  3LWH A;  1YIJ A;  1KK7 A;  1IRE B;  3M55 A;  2K9G A;  4RTY A;  5IHI A;  2EGA A;  5EC7 A;  1BCM A;  5I21 A;  3MP6 A;  5I11 A;  4PL6 A;  2VV5 A;  3EFR A;  3JB9 I;  2H8H A;  3VV0 A;  1NPP A;  1I1J A;  1OZ3 A;  1VQL Q;  2DK3 A;  1Z9Q A;  2EQU A;  7AT1 B;  4A4H A;  3CCJ Q;  1TUD A;  3L2Q A;  1HYO A;  2LQ8 A;  2O2O A;  2DJQ A;  3G6E T;  3X28 B;  3VYG A;  3CME Q;  3OYM A;  2JOY A;  3QO3 A;  4FT4 A;  1BIB A;  2JM8 A;  1KC8 C;  3WXM B; 
#chains in the Genus database with same CATH homology
 1M1K R;  3CPW P;  1VQM Q;  1YJ9 Q;  1VQ5 Q;  3G4S Q;  3CCL Q;  3CCR Q;  1M90 R;  1JJ2 P;  3CC2 Q;  3CXC P;  3CCS Q;  1YHQ Q;  1K73 R;  1W2B P;  3CC4 Q;  1Q82 R;  1KQS P;  2OTL Q;  3G6E Q;  1N8R R;  1VQL Q;  1VQ9 Q;  1KD1 R;  3CCJ Q;  1Q7Y R;  3G71 Q;  1VQK Q;  1VQN Q;  1QVG P;  1K8A R;  1VQ8 Q;  1K9M R;  3CCQ Q;  2QEX Q;  3CD6 Q;  2QA4 Q;  1VQ7 Q;  1VQO Q;  3CME Q;  1S72 Q;  3CC7 Q;  1YI2 Q;  3CMA Q;  3CCU Q;  3CCV Q;  3CCM Q;  3OW2 P;  1YJW Q;  1QVF P;  1VQ6 Q;  3I56 Q;  1Q86 R;  1VQ4 Q;  3CCE Q;  1KC8 R;  2OTJ Q;  1YIT Q;  3I55 Q;  1NJI R;  1YJN Q;  1Q81 R;  1VQP Q;  1YIJ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...