3I55Q

Co-crystal structure of mycalamide a bound to the large ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3i55Q00
3I55Q 1VQOQ 1QVFP 3CCEQ 3CMEQ 3CCMQ 1Q82R 3G4SQ 1VQ6Q 1YITQ 3CD6Q 1VQMQ 1M90R 3CCVQ 1VQ4Q 3CPWP 1VQ8Q 3CXCP 3I56Q 3G71Q 1YI2Q 1QVGP 1KC8R 1VQLQ 1YIJQ 1YHQQ 1VQPQ 1Q86R 1K73R 2QA4Q 3CCUQ 1NJIR 2OTLQ 3CMAQ 3CCSQ 1K8AR 2OTJQ 3CC7Q 1S72Q 3CC2Q 1KQSP 1KD1R 3CCRQ 3CCQQ 3G6EQ 1YJWQ 3CCJQ 1N8RR 1K9MR 1VQKQ 1YJ9Q 1W2BP 1YJNQ 1VQ9Q 1VQNQ 3CC4Q 3CCLQ 1VQ5Q 1Q81R 1Q7YR 1VQ7Q 1JJ2P 1M1KR 2QEXQ 3OW2P
chains in the Genus database with same CATH superfamily
1FMWA 4KGXB 2PZ1A 5GAOn 5FRMA 3OS2A 4M77G 2RH2A 5DLQE 4Y91A 3H0HA 5KYWA 2DL4A 2KY9A 5J39A 2V8IA 2DZCA 4IUUA 1PD1A 4HT8A 1AVZC 1NYFA 1WZOA 5IXBA 3RNJA 1BK2A 4M7DG 1W70A 3CCUA 4IUPA 3V7RA 1NE8A 1R0BG 2RHZA 1AT1B 3R6NA 2ZCFB 1NLPC 4FIBA 4JLGA 4M7AA 1X01A 4JJDA 2GGRA 1KK7A 3A8MB 2AKLA 2F5KA 5FW9A 3QZ9B 2AHJB 3OS5A 2R5AA 3M4YA 2NUTA 1GCQC 1U8RA 5HK0A 3EGXA 4XU1A 2HD0A 3QDRB 3S6WA 1ZUYA 2CSQA 2V8JA 3LLRA 2MAMA 1X75C 2ED1A 3CCSQ 3DKMA 2QI2A 2E65A 3TVTA 4F7UE 3J7AF 2FEIA 2DRMA 4J6XA 3I56A 1Y0MA 4NOYA 3JCMb 3NGPA 2EGCA 2OI3A 3VKIA 5GAOm 3QWYA 3M58A 5KCOA 3G4ST 2EWNA 1HJDA 3THKA 4A63B 1VQ9A 2G6FX 1I81A 3I5SA 2FB7A 1QCFA 3O8VA 1O9SA 4OGEA 2RMOA 1N5ZA 1WHHA 1TTHB 2XKOC 1QVFP 1BI0A 2OTLA 1S1NA 5KYUB 4PNOA 1QP2A 2VC8A 2PVOB 4GLMA 5HCKA 5ECAA 1VQKA 2RI5A 5LJ5j 1JO8A 3I9QA 2O88A 3L42A 3PGGA 1AHJB 1BU1A 3REBB 3GLXA 4A4FA 2RN8A 2QTVA 3CPWS 2E1HA 1M1GA 1N8RU 5CQYA 1OEBA 1TS9A 2F5TX 3HFNA 4KUIA 1OI1A 2IVWA 2WSEE 1Z9QA 3QWXX 4M77E 2KVQG 2XIDA 4OMLA 1XQHA 2LQNA 4FW2A 1X43A 4LD9K 5GANg 1G3WA 2BZ8A 2KNBB 4M7DE 5LJ5e 3HP9A 1Q82U 2I0NA 4HVUA 1SG5A 2DFUA 3I35A 5I2MA 2RK2A 5AYFA 1KQSS 2MWOA 4V2SA 4II1A 1VQ4T 1E6HA 1OPLA 3X28B 5IXFA 1Y96A 4XAXB 2RNAA 1B7TA 3QPHA 3IQLA 2CP2A 2CZ0B 4BI4A 3EAEA 4LD6A 2F2VA 4GBQA 2FPFA 5GAMg 1UHCA 1WJRA 2DMOA 1RLQC 4LXCA 3V8JA 1YHQA 1M1KR 3M4GA 3G7ZA 3G1JA 2KDSA 2JS2A 3HRSA 3GNFB 4J83A 1GBRA 1PHTA 1ZX6A 4A4KA 2KRSA 1GCPA 4LN2A 2E5KA 2FZKB 4C8QA 2H8HA 2M16A 1UJYA 3M54A 4E47A 2EBPA 3V8KA 4J6WA 2MK5A 1C0MA 1D1AA 3EGUA 3CCRT 1VQ5Q 2DTHA 5AT1B 2X4XA 3CC4T 3BW1A 2ZPFB 4E7ZA 4L5GA 2ZGWA 1SRMA 2M51A 5GMKl 2E10A 2QG9B 1D0ZA 4TVRA 1K73R 4IUTA 4PJLA 1D0YA 2Z0WA 2V8KA 3LGFA 2HMAA 3V7CA 1B34B 4N0AC 3L2RA 1VQ6A 2DD4A 2EW3A 2VKNA 2CT4A 2E70A 2DK3A 3M0TA 3CCQT 1ZQ1A 3RIRA 1Q7YR 5DLOA 5IHIA 1HYOA 3CMAA 1WI7A 5A2QE 3EH2A 3RERA 4B6MA 4PK4A 4IIMA 3OSVA 1VQMT 5LJ3h 2DL5A 4QT7A 1XTDA 5L8RE 2A36A 3CCEA 1M1KC 1VYUA 2K5LA 4RTZA 2CP3A 2J6KA 2O4XA 2CSIA 2KR3A 3EG9A 1WGSA 1ABOA 4LUEA 2EJ9A 1BIAA 2Y90A 1UEBA 4LE9A 1LOJA 3OYFA 2VXFA 3HRUA 1X6BA 5CKHA 2G3RA 4J7IA 3SWNB 2H3JA 1YI2A 1VQ7Q 4JJCA 4F14A 3EG3A 3ZFJA 4FSXA 1K73C 2CZ1B 3JCMV 2GCXA 1LCKA 3CC2A 3V7SA 4DOWA 1ACMB 1PKSA 4J9DA 3FRNA 1M3BA 1WQWA 2O31A 1Q7YC 4ME7A 2A0FB 4JLIA 4JRKA 3PTAA 1Y7XA 3OW2S 3R6OA 2E12A 3QO3A 4AMCA 2HKQB 2NUPB 3N5BB 1QCNA 3GBQA 4JJNK 3OBYA 1TUGB 4AFZC 2K2MA 3UA6A 5C6SA 1YP5A 1LVKA 3I56Q 5FU7C 2QQRA 1JU5C 1BI1A 3PE0A 4X9CA 3VU3C 1IGQA 3I55A 3LGLA 4C0DB 5GAMj 1QCOA 2B8AA 4EMKC 3G6ET 3INZA 2C0IA 3QDFA 5KCHA 3HRTA 1QVGS 2ROLA 2YUQA 2RHXA 2RPNA 1VQOT 3CPWP 1M3CA 4IUQA 2V1QA 1KC8R 2LC4A 1NEGA 1RLPC 2C0OA 5EC7A 2P4TA 2OTLQ 1D3BB 3MP1A 2RI3A 4ESRA 2FPEA 1VQKQ 3OYCA 3JCMX 3LH0A 2PU9B 1ZLMA 4M7AD 3E9GA 5M9OA 2D9TA 4M78A 3CD6Q 2DL3A 2VYTA 5LJ3j 5CKDA 1M27C 3CBOA 2HQEA 3UATA 1WDXA 1VQNA 4M77B 2K3BA 2L3SA 2RQUA 4J9IA 4KGZB 1KQSP 3RMSA 2MYSA 1N6AA 2DILA 4M7AF 1MHNA 2K4YA 2MCNA 1FXXA 2BKDN 4Z02A 3OY9A 2COWA 2QA4A 1Q82R 1YWOA 4BY6B 1W4SA 2AIRB 2JN0A 1SF9A 3JAME 2GQIA 5IHNA 5GAOr 2XK0A 2H3EB 2QEXA 2E6NA 2EFIA 3OYLA 2LQWA 2DJQA 4FYYB 3FIFA 2OAWA 2GFUA 3PIOA 2DVEA 2R57A 5LJ3e 3MEWA 2CKKA 2LX9A 1KC8C 1K1ZA 5KYWB 3CXCS 3JSCA 2VASA 1QVFA 3MEAA 2DF6A 2COYA 1S72A 1MMDA 4OF1A 4XK8E 2P0KA 2KQWA 4MZMA 2XDPA 3JB9D 2EKOA 4C5HA 3MO8A 1UG1A 2PUKB 4E7KA 2DYIA 2HBPA 3BE3A 3JCMQ 4RG2A 2YDLA 4XTXA 3UWNA 3NFCA 4Z8AA 1E7OA 3L2QA 5GAN5 4RTYA 4C0DC 3OS0A 4E6RA 3OYDA 1I8FA 1IHVA 2J7IA 3DLLA 5KYXA 3QXEB 1D09B 2XU8A 2BE9B 4OMMA 5GAN4 2KYBA 3QKJA 2VGMA 4ZGDB 2IPOB 1Q86R 2NUTB 3A1PA 1IREB 3EGXB 1AWOA 3OB9A 3TU4K 1M8VA 1AOJA 3GP8A 1SSFA 1PNJA 4MMKA 1U1TA 4XTUA 2FRWA 2DKGA 1VUBA 4VUBA 3LYIA 4HKEA 1JXOA 4XTWA 4Q5WA 3H0FA 4J8OA 1NJIR 3M59A 2QAZA 3VS6A 2IIMA 3HFOA 3OYNA 1K9MR 1UB4A 3CC7T 1M2OA 3WXMB 2KE9A 3T9NA 1ZBJA 1ARKA 2JOYA 1RAFB 3CCEQ 4X9DA 1M1KU 5GMKh 3VYGA 2EYZA 1NPRA 5GJVB 4LUDA 4C0GA 2MPXC 1GRIA 4BY6C 2DPPB 3OQ5A 2KSSA 2YRCA 1EX4A 4XTVA 1PD0A 5LJ5g 5GAN3 3X25B 1VQ4A 3CCLQ 4A54A 3OW2P 4RUGA 2E6ZA 4R55A 3PFSA 4C8QD 1Q86C 1X2QA 2DYBA 2GBQA 2RQWA 1YI2Q 1YJ9A 4FU6A 3VRYA 1K73U 4N4IA 3G71T 5GAN7 3CC2Q 3A8LB 2KMTA 3ME9A 1JRIA 2O9SA 2E64A 2PUOB 2CZ6B 4C92A 1TSFA 1EIFA 1CSKA 4C8QF 4LDUA 2NLUA 1OX9A 2F2WA 1Q7YU 1ZSZA 1NJIC 1MNDA 1AEYA 3CCRA 4BE2A 1VOMA 1KQ2A 4M7AC 4JRPA 1QVGP 1K9MC 2R5MA 3CC4A 2DM1A 2VUBA 1EZZB 4UC4A 2MI6A 2RJCA 4R56A 4MDXA 3M56A 1VQPT 4AFUC 3PMIA 2SRCA 1G3TA 4CI0C 2DBMA 4Y28E 2BZXA 5FU6B 3I55Q 2QQAA 1YIJA 2YLBA 2QYZA 1QWFA 4MZPA 1OZ2A 4E7SA 2ENMA 1W2BS 1YWPA 2JMAA 4DEYA 5CKFA 2CT3A 1VQMA 3CCST 2M0OA 2YRDA 3LH5A 4E7HA 4C8QB 3OYGA 8AT1B 4FM4B 1O75A 1RI0A 3OS1A 6AT1B 1PCXA 2CUBA 5I11A 4Z88A 1WFWA 3M0PA 1R0CB 2ED0A 3S3MA 4AFQC 4M7AG 3JCMf 3VUZA 2BIVA 1TH7A 1VQNQ 2JJ9A 3SDZA 4HT9A 2YSQA 3H8ZA 2HKNA 2DJZA 1KIKA 1IGUA 4BACA 4Y92A 3CXCP 1IXDA 1OU9A 2FVUA 3SEMA 3J80E 2J05A 4C0ZA 2XMFA 4EMHA 1SEMA 2QA4Q 3FC3A 2J06A 1TUDA 2YXYA 1ZBXA 1LPLA 2XHCA 1WXTA 3CBMA 4J9BA 2QEXQ 3UF4A 2E3IA 1Y07A 3TQ7P 3HL8A 2RHUA 2ECZA 2YHTA 4QQDA 3QHSA 3DB3A 1KHIA 3CPWA 1PKTA 1KC8U 4ATOA 2O4XB 3KUFA 5GMKe 1S72Q 3EG9B 1X27A 1D1BA 1U1SA 1QW1A 3DB4A 2DNUA 2A37A 3JCMJ 1B07A 2HQHA 2LRQA 3EH1A 3GIBA 1OZ3A 4DBQA 2OJ2A 3JB9G 3D7SB 2RM4A 4ELYC 1QP3A 5FU6C 4CC3A 2YT6A 2DO3A 2CS7A 2EQKA 4RMOA 1VQOA 4HA8A 3OYHA 3L2UA 1YJWQ 4M78D 3MP6A 2LVMA 2X51A 3EFSA 2ZPHB 2LMJA 2NUZA 4C5EA 3L2ZA 4HVVA 3QSUA 2KBTA 3CPFA 1DJ7B 3GPLA 2CP7A 2DL7A 3QG1A 4C8QC 2K79A 3NHNA 3CBPA 4M78F 4X1VA 2ROTA 4CC7A 4JS4A 1X6OA 3SB2A 1YJNQ 2OTJT 2FL7A 1VQ8A 1WXUA 2E5QA 1VQ5T 1E6GA 4J9HA 3QIIA 1TXQA 4FSSA 1WA7A 3RKXA 2XDDA 3ZBDA 3X26B 1RAHB 3M5AA 1G3YA 1IO6A 2EGAA 2VGNA 4FT4A 2CZ7B 1YCSB 2KROA 4BUGA 3MKDA 2DBKA 3TSWA 4C5GA 4YTLA 3V8LA 1WHJA 1WQ7A 1VQLA 5FU7B 3TREA 2A28A 1BIBA 3H6ZA 3M57A 4LDXA 4OB0B 3H41A 3RBBB 1VQ4Q 1CKAA 1F1BB 1GFDA 3CCMT 4J5YA 2ZPGB 3RKYA 4FL6A 5I22A 3E19A 4EMKB 5LJ3g 1Q86U 1HXDA 4M78B 2EVRA 2EQIA 1YJ9Q 3GF5A 2X4WA 4C8QG 5EG2A 5GAOp 1YITQ 3MCAB 5FLXE 4ZTFA 2QXFA 2F69A 2RHYA 1MMAA 1T0JA 3JB9I 3CCVT 3A8OB 3EFOB 1AZEA 1NJIU 1BKBA 4JJBA 4HCKA 2HL3A 3M0SA 4PFZA 3MEVA 5KE2A 1W2BP 2FG0A 1K9MU 1AZGB 2GFAA 1MGQA 4PKCC 4HCZA 3KFVA 1VQ7T 4PLLA 3JRZA 2XDBA 2RB6A 3MHXA 1YIJQ 4BE1A 3OMGA 3CCUQ 5KYUA 2EAYA 2XICA 2LP5A 4A53A 3WVDB 1WPYA 2OX7A 3FLGA 2X35A 3BY7A 3U23A 3HTRA 2DA9A 4M75A 2L3PA 1ZUKA 5GANf 2AT1B 2VXEA 3OW2A 1H92A 3CC7A 2VV5A 1VQMQ 4N4GA 5GANd 4FT2A 2AKKA 3JCMc 2CUDA 1VYVA 4NS5A 4J7FA 2EQJA 1BBZA 1Q81R 1YBYA 5GAMf 1W6XA 2E41A 3LWIA 2WACA 4A4GA 1YFNA 4EMGA 4RTWA 1UTIA 1IB8A 1JXMA 1N9SA 3A98A 1C1AA 2F1LA 2GNCA 4C92D 1BCOA 3RDVA 2KGTA 8ATCB 1Z9ZA 2OTLT 3G71A 2HZYA 1VQ9Q 3CCJT 2WSFE 1VQKT 3OYJA 4X34A 2ZZDA 4M78C 5CR2A 1C6VX 4BDZA 4L6V5 2DRKA 1TG0A 2J6OA 3KBGA 3CD6T 4C92F 1UGRB 2KI7A 2EJFA 3P8HA 1T0HA 2LJ0A 5CKEA 2Y4YA 5IAYA 2JZ2A 1SHFA 1JQQA 1Y71A 3RESA 5A0DA 2C0TA 4LNPA 3Q1JA 1AWXA 1VQPA 2ABLA 2KK4A 2LQKA 1UFFA 4C8QE 4EDUA 2X3XD 2D0QB 2K6DA 4JDSA 3CMET 1PRLC 1M2VB 2QGGA 4AFSC 1NZ9A 2D1XA 1Q81C 1UDLA 4PFOA 5J26A 5GMKm 1QWEA 2HDAA 3VS0A 4OMPA 4KRTA 2QDYB 3BFMA 4RTTA 3FEOA 1AD5A 3CCSA 4JS5A 3MP8A 4PJOA 3VS1A 2EJGA 3FJ5A 2J6FA 4BE0A 3CXCA 1HK9A 4ZGEB 1SKUB 5D7UA 4C92B 1QKXA 1ZSGA 4M78G 2BTTA 2HSEB 1JJ2S 1ZSZB 2OAUA 2RJDA 2YWWA 2CYZB 3A8HB 2RJEA 2LCCA 4OMOA 2DAQA 1IZ6A 3NMZC 2HQXA 2EYYA 4AT1B 4RTUA 1XNIA 1UECA 1VQ8Q 5D6YA 3RR6A 1QLYA 1YHQQ 3OYKA 3VRZA 2L3RA 2LNHB 3G4SA 3HKSA 2FZCB 4ORZA 4JZ3A 4M7AB 1P92A 1M9SA 1BB9A 4XU3A 3JCMP 3ER0A 3SWNA 4KGVB 3JB9H 4RCBA 5FWCA 4F17A 3JB9F 1VQLQ 1VIEA 2DD5A 2B86A 4PJNA 3M0QA 5C0MA 1U3OA 2FO0A 1KD1R 2QQ9A 3S3OA 2CP6A 2YUNA 2LJ3A 1IHWA 2QGFB 3A8GB 5KE3A 1MMGA 4F7UA 3QBYA 4LDWA 4F04B 1VQ6Q 5KH6A 3CCET 4J9EA 1XJWB 4QW2A 3PIPA 3CMAQ 4ANJA 3DLMA 2DETA 5CO7A 5HY6A 4JRIA 5GAOl 1RL2A 1PWTA 3CCLT 4K11A 2KYMA 4DA4A 2KT8A 1RABB 1VYTA 4PLIA 2ZPBB 2ESWA 3VYHB 1YI2T 3EG2A 2YUPA 4HCBA 3EG0A 2JM9A 2JTMA 1LNXA 2VB6A 4O5VA 4CRIA 3E2UA 2PVGB 4PJMA 2D8JA 4QVCA 2XG8D 4C92C 2R58A 3NTKA 2LQ8A 2HAXA 3EG1A 1YN8A 1ZSZC 2OTJA 3VS4A 4DBHA 3C12A 4J6YA 4QVDA 1KD1C 1HD3A 2K57A 4QKUA 2EKHA 4J9CA 4XQ3A 1VQ5A 2DZ9A 2O9VA 1BCMA 3JCMh 3RUXA 1NLOC 4QQGA 1MUZA 2D6FA 3ASKA 3C94A 4CC4B 4M77A 5FRNA 1WHGA 1X6GA 2YUOA 4HXJA 4M78E 4E7LA 2CH4W 1TWBA 4XU2A 3I55T 2X3WD 4RTVA 1V76A 4M7DA 1YCYA 5J3BA 2DXCA 1G2BA 5IHKA 3VS7A 5KYNA 3CCMA 1FYNA 2K5IA 5KYYA 1SHGA 4OMQA 2MF2A 1W2BA 2COZA 2V1RA 4FYXB 2MMPA 4OB1B 2EYXA 3M55A 1PM3A 2E4HA 3L1AA 3CCQA 4JRQA 1Y96B 3G71Q 4C92G 4MDWA 1RADB 3URGA 3JB9J 2CP5A 2M02A 4KULA 3ULRB 3QYGB 3VUBA 2W0ZA 4KH1B 1K4US 3CCVA 3C95A 1ZUUA 4A4EA 3ZL7C 1ZHIA 1FMKA 1VQNT 2P84A 1K8AC 1I4K1 4ZN1A 4M75D 3E9FA 4J9GA 1VQPQ 3OYBA 1VQ7A 2MIOA 2KRNA 4D6WA 3PMTA 3VJPA 2QA4T 2P0PA 3PVQA 1JJ2P 3C4SA 3MJXA 5GMKj 1G83A 5IH2A 1Q81U 4GY5A 3L2VA 2QEXT 1W1FA 5GAN8 2BZYA 4M75F 4XU0A 1X69A 3JCMd 2JT4A 1MV3A 5LJ5f 2MWPA 1S72T 2DEUA 2DXBA 1GCQA 4IUVA 3REAB 1EFNA 2D0NA 1JB0E 5LJ5d 1AWWA 1WXBA 3F70A 1M3AA 1K76A 2VVKA 5HKCA 4Z89A 3GNGA 1H3ZA 3EGDA 1OYXA 2KAFA 3OA6A 1YJWT 1JBMA 1T3LA 2JS0A 1N27A 2C06A 3NPFA 3G4SQ 5GAOq 2XI9A 2JUFA 5A0LA 1V1CA 3G6EA 3CCJA 4M75B 4AG1C 1OULA 2AZVA 1UGQB 3JV3A 2KT1A 2JTFA 2FZGB 1TOVA 4ZGJB 3SHWA 3OYIA 4OGCA 1FWZA 3CD6A 4E2FB 2LTOA 4AG2C 1SPKA 1KQSA 1R8OB 2RQVA 2E3HA 3EFRA 2FYKA 2RHIA 1HSQA 1YJNT 2HNIA 3M9QA 3JCMe 1UHFA 3MPUB 5FWBA 2LJ1A 2M9UA 2A7YA 4LDVA 4PJJA 2ZPEB 1R77A 2X9HA 3QJ6A 5L23A 5I21A 4KH0B 2X4JA 2DXTA 2LDMA 4C92E 4NL3A 1WYXA 4PL6A 3CMEA 3J81E 2YLCA 3NTHA 4R0KA 4B9WA 4PJOD 3HSBA 3LW5E 1M4ZA 4ZNXA 1WNLA 3EHQA 2DTIA 3PNWC 2DXUA 2RO0A 3OYMA 5HK3A 1JEGA 3WVEB 5IN1A 1KFZA 1KG1A 3O5ZA 2I2LA 1M90R 4B9XA 2D8HA 3GOXA 2NWMA 2DE0X 1WLPB 1AWJA 5D6WA 4PJOF 5GANh 2DX1A 1NPPA 1GL5A 3BDLA 1YJ9T 4M7AE 1X2KA 4NL2A 2CREA 3L2WA 1QKWA 1SRLA 1YNZA 4JUVA 5CIUA 1UJ0A 2DTOA 1YITT 2YRVA 1PRMC 1ZA2B 2LZ6B 1RAAB 2OTJQ 3FDRA 4E7JA 4J9FA 2PVDB 4CC2A 4DOVA 4WTOB 4KUDK 5GAN6 1KD1U 5GAMh 2JXBA 1FX7A 4GLKA 3FB9A 2EYWA 5GAN2 2QTXA 3OBWA 2DLPA 4DEXA 1G5VA 4IKFA 2W10A 1UGVA 2KXDA 2RQRA 1PG5B 1M1FA 3AHUA 3TCJA 1YIJT 2LT1A 3CCRQ 3CCUT 2RI2A 2RF0A 4M75C 4PJOB 3QYHB 2L0AA 3UT1A 1M90C 2DERA 4L59A 3CC4Q 1T3SA 1SSHA 1Y57A 3EHRA 2LT4A 2P0QA 3CCMQ 5DY9A 3QZ5B 1I5OB 4P5NA 1H8KA 4QQ6A 2L89A 2M0YA 2K9GA 3X20B 2LX7A 2QQSA 2K2VA 2VWFA 4F7UF 1OX8A 2RA2A 4N0AA 2K7AA 3CCQQ 1I1JA 4O6JA 1K0SA 3X24B 1PSFA 4WF2A 1WHLA 1NM7A 5CCAA 3P8BB 1KHCA 1D1CA 3CCVQ 3QUIA 2GQVA 1OQKA 1GFCA 3CCLA 2RJFA 4F16A 1WJQA 3I56T 1V29B 5D6XA 2L8DA 1K8AU 5CQXA 5CK9A 3LWHA 1UE9A 5KYXB 3UPUA 1G8XA 1KSWA 3AT1B 3VS3A 2EPDA 1KJWA 4D8KA 2F2XA 1D0XA 4EIKA 2IG0A 1VQ9T 1M8MA 4M75G 1BI3A 1OV3A 1M5Q1 2CDTA 2CH4A 3I5RA 4M77D 2NYSA 2JNGA 5GAMd 4DQ2A 1QVGA 5GANj 4JPBW 2ZAEA 3VS5A 1BYMA 1LJOA 4F7UB 1ABQA 2K5FA 3M53A 4RKUE 2RK1A 2JTEA 4M7DD 1K0XA 5CAIA 4XTZA 1U06A 2QDLA 4M77F 2V26A 2JMCA 1QQJA 2JW4A 5LJ3f 1VA7A 2P4RA 2HEQA 4BI8B 2EGEA 1K9AA 3OYEA 1TU0B 3E1SA 2WSCE 4M7DF 3PT9A 5CVIA 1QMCA 3H0IA 3M0UA 5LJ3d 2BUDA 1MMNA 5GANe 4PJOC 3P8DA 4A4HA 2DEQA 2K3YA 4FYWB 4N4HA 2PNIA 4OB3B 1NYGA 2QQBA 5DM7R 1WX6A 2FHDA 2JVVA 2AK5A 4OP0A 3SFMA 3G6EQ 3CCJQ 4IURA 4EMKA 2Y4XA 1N8RR 2KEAA 1JJ2A 1B34A 2QASA 1VQOQ 2EQMA 4MZTA 4MMLA 1Q95G 1WJSA 2O2OA 3QJYA 4QVZA 4ZN3A 5GAMe 5GMKi 3A5ZB 5FROA 4FYVB 1GBQA 1I5LA 1VQ8T 1UUEA 1YHQT 1UGPB 1OU8A 3META 4EPCA 4DBRA 1A0NB 2L3QA 4BD3A 1BI2A 4IIOA 3EFOA 1M30A 4HVWA 4M7DB 3CMEQ 1WIEA 2A08A 3MEUA 4KT0E 3SWNC 1GXIE 3RMQA 1MV0B 2DL8A 5KYYB 2MOXA 1XOVA 4OVAA 3RKWA 3HPWA 4ELZC 2PQWA 1VQLT 2DIQA 2FRYA 4PJOG 1RACB 4BDYA 1U5SA 2QK0A 2ZPIB 4OMNA 3VV0A 3HHTB 7AT1B 3JCMW 2LCSA 2ATCB 2BE7D 2FPDA 3CQTA 2XD0A 1IRXA 1RUWA 2X4YA 4D8DA 2KRMA 4RTXA 3ZEHA 1WHKA 2EIFA 5A0GA 2EYQA 1NEBA 2DVJA 3TSZA 1VQ6T 3LX7A 4M75E 2L2PA 2CGHA 2M1HA 3TEEA 1N8RC 1RAEB 3CMAT 2KXCA 1QVFS 1RAGB 4DBFA 4OB2B 2GTJA 1RI9A 1CKBA 4HCCA 3S3NA 5I2SA 4ZTJA 2DIGA 2HBWA 2AZSA 1YJWA 2RD1A 4RCCA 2NUPA 3OYAA 1NBEB 3H9NA 2RQTA 1NG2A 2HCKA 2CP0A 1OPKA 2JM8A 1Q82C 3UDCA 1H641 3OYYA 4WCIA 4C0FA 3BDUA 1RAIB 1QVPA 1PC0A 1OOTA 1I07A 1ZA1B 1MNEA 4LDYA 4OMFB 4C5IA 1M90U 1YJNA 2K3XA 3OSSC 4KBMB 4FW1A 2LCLA 4F7UG 1G3SA 2GTOA 4FCYA 4E7IA 9ATCB 2L5QA 2GF7A 3JCMg 1WHMA 4M77C 4BB7A 3CC2T 1B3QA 3CEYA 4BI3A 1D3BA 2PTKA 3M0RA 1N9RA 5GJWB 3SD4A 3UA7A 3PVLA 3VS2A 3FJPA 5CKBA 2HSPA 3EGDB 4M7DC 2SEMA 4RG8A 2EQUA 2LNVA 5LL6S 1K8AR 3CC7Q 1UGSB 1M2VA 1KQ1A 1PSEA 2HL5C 1H3HA 4PFPA 3NTIA 4XTYA 1I0CA 2A3LA 4M4ZA 3OMCA 4JZ4A 3C0CA 2O01E 5LJ5h 1J3TA 1YITA 1FMVA 1TUCA 4PJOE 3KXTA 1VIFA 5IT9E
chains in the Genus database with same CATH topology
3I55Q 1VQOQ 1QVFP 3CCEQ 3CMEQ 3CCMQ 1Q82R 3G4SQ 1VQ6Q 1YITQ 3CD6Q 1VQMQ 1M90R 3CCVQ 1VQ4Q 3CPWP 1VQ8Q 3CXCP 3I56Q 3G71Q 1YI2Q 1QVGP 1KC8R 1VQLQ 1YIJQ 1YHQQ 1VQPQ 1Q86R 1K73R 2QA4Q 3CCUQ 1NJIR 2OTLQ 3CMAQ 3CCSQ 1K8AR 2OTJQ 3CC7Q 1S72Q 3CC2Q 1KQSP 1KD1R 3CCRQ 3CCQQ 3G6EQ 1YJWQ 3CCJQ 1N8RR 1K9MR 1VQKQ 1YJ9Q 1W2BP 1YJNQ 1VQ9Q 1VQNQ 3CC4Q 3CCLQ 1VQ5Q 1Q81R 1Q7YR 1VQ7Q 1JJ2P 1M1KR 2QEXQ 3OW2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 Q;  1VQO Q;  1QVF P;  3CCE Q;  3CME Q;  3CCM Q;  1Q82 R;  3G4S Q;  1VQ6 Q;  1YIT Q;  3CD6 Q;  1VQM Q;  1M90 R;  3CCV Q;  1VQ4 Q;  3CPW P;  1VQ8 Q;  3CXC P;  3I56 Q;  3G71 Q;  1YI2 Q;  1QVG P;  1KC8 R;  1VQL Q;  1YIJ Q;  1YHQ Q;  1VQP Q;  1Q86 R;  1K73 R;  2QA4 Q;  3CCU Q;  1NJI R;  2OTL Q;  3CMA Q;  3CCS Q;  1K8A R;  2OTJ Q;  3CC7 Q;  1S72 Q;  3CC2 Q;  1KQS P;  1KD1 R;  3CCR Q;  3CCQ Q;  3G6E Q;  1YJW Q;  3CCJ Q;  1N8R R;  1K9M R;  1VQK Q;  1YJ9 Q;  1W2B P;  1YJN Q;  1VQ9 Q;  1VQN Q;  3CC4 Q;  3CCL Q;  1VQ5 Q;  1Q81 R;  1Q7Y R;  1VQ7 Q;  1JJ2 P;  1M1K R;  2QEX Q;  3OW2 P; 
#chains in the Genus database with same CATH topology
 1FMW A;  4KGX B;  2PZ1 A;  5GAO n;  5FRM A;  3OS2 A;  4M77 G;  2RH2 A;  5DLQ E;  4Y91 A;  3H0H A;  5KYW A;  2DL4 A;  2KY9 A;  5J39 A;  2V8I A;  2DZC A;  4IUU A;  1PD1 A;  4HT8 A;  1AVZ C;  1NYF A;  1WZO A;  5IXB A;  3RNJ A;  1BK2 A;  4M7D G;  1W70 A;  3CCU A;  4IUP A;  3V7R A;  1NE8 A;  1R0B G;  2RHZ A;  1AT1 B;  3R6N A;  2ZCF B;  1NLP C;  4FIB A;  4JLG A;  4M7A A;  1X01 A;  4JJD A;  2GGR A;  1KK7 A;  3A8M B;  2AKL A;  2F5K A;  5FW9 A;  3QZ9 B;  2AHJ B;  3OS5 A;  2R5A A;  3M4Y A;  2NUT A;  1GCQ C;  1U8R A;  5HK0 A;  3EGX A;  4XU1 A;  2HD0 A;  3QDR B;  3S6W A;  1ZUY A;  2CSQ A;  2V8J A;  3LLR A;  2MAM A;  1X75 C;  2ED1 A;  3CCS Q;  3DKM A;  2QI2 A;  2E65 A;  3TVT A;  4F7U E;  3J7A F;  2FEI A;  2DRM A;  4J6X A;  3I56 A;  1Y0M A;  4NOY A;  3JCM b;  3NGP A;  2EGC A;  2OI3 A;  3VKI A;  5GAO m;  3QWY A;  3M58 A;  5KCO A;  3G4S T;  2EWN A;  1HJD A;  3THK A;  4A63 B;  1VQ9 A;  2G6F X;  1I81 A;  3I5S A;  2FB7 A;  1QCF A;  3O8V A;  1O9S A;  4OGE A;  2RMO A;  1N5Z A;  1WHH A;  1TTH B;  2XKO C;  1QVF P;  1BI0 A;  2OTL A;  1S1N A;  5KYU B;  4PNO A;  1QP2 A;  2VC8 A;  2PVO B;  4GLM A;  5HCK A;  5ECA A;  1VQK A;  2RI5 A;  5LJ5 j;  1JO8 A;  3I9Q A;  2O88 A;  3L42 A;  3PGG A;  1AHJ B;  1BU1 A;  3REB B;  3GLX A;  4A4F A;  2RN8 A;  2QTV A;  3CPW S;  2E1H A;  1M1G A;  1N8R U;  5CQY A;  1OEB A;  1TS9 A;  2F5T X;  3HFN A;  4KUI A;  1OI1 A;  2IVW A;  2WSE E;  1Z9Q A;  3QWX X;  4M77 E;  2KVQ G;  2XID A;  4OML A;  1XQH A;  2LQN A;  4FW2 A;  1X43 A;  4LD9 K;  5GAN g;  1G3W A;  2BZ8 A;  2KNB B;  4M7D E;  5LJ5 e;  3HP9 A;  1Q82 U;  2I0N A;  4HVU A;  1SG5 A;  2DFU A;  3I35 A;  5I2M A;  2RK2 A;  5AYF A;  1KQS S;  2MWO A;  4V2S A;  4II1 A;  1VQ4 T;  1E6H A;  1OPL A;  3X28 B;  5IXF A;  1Y96 A;  4XAX B;  2RNA A;  1B7T A;  3QPH A;  3IQL A;  2CP2 A;  2CZ0 B;  4BI4 A;  3EAE A;  4LD6 A;  2F2V A;  4GBQ A;  2FPF A;  5GAM g;  1UHC A;  1WJR A;  2DMO A;  1RLQ C;  4LXC A;  3V8J A;  1YHQ A;  1M1K R;  3M4G A;  3G7Z A;  3G1J A;  2KDS A;  2JS2 A;  3HRS A;  3GNF B;  4J83 A;  1GBR A;  1PHT A;  1ZX6 A;  4A4K A;  2KRS A;  1GCP A;  4LN2 A;  2E5K A;  2FZK B;  4C8Q A;  2H8H A;  2M16 A;  1UJY A;  3M54 A;  4E47 A;  2EBP A;  3V8K A;  4J6W A;  2MK5 A;  1C0M A;  1D1A A;  3EGU A;  3CCR T;  1VQ5 Q;  2DTH A;  5AT1 B;  2X4X A;  3CC4 T;  3BW1 A;  2ZPF B;  4E7Z A;  4L5G A;  2ZGW A;  1SRM A;  2M51 A;  5GMK l;  2E10 A;  2QG9 B;  1D0Z A;  4TVR A;  1K73 R;  4IUT A;  4PJL A;  1D0Y A;  2Z0W A;  2V8K A;  3LGF A;  2HMA A;  3V7C A;  1B34 B;  4N0A C;  3L2R A;  1VQ6 A;  2DD4 A;  2EW3 A;  2VKN A;  2CT4 A;  2E70 A;  2DK3 A;  3M0T A;  3CCQ T;  1ZQ1 A;  3RIR A;  1Q7Y R;  5DLO A;  5IHI A;  1HYO A;  3CMA A;  1WI7 A;  5A2Q E;  3EH2 A;  3RER A;  4B6M A;  4PK4 A;  4IIM A;  3OSV A;  1VQM T;  5LJ3 h;  2DL5 A;  4QT7 A;  1XTD A;  5L8R E;  2A36 A;  3CCE A;  1M1K C;  1VYU A;  2K5L A;  4RTZ A;  2CP3 A;  2J6K A;  2O4X A;  2CSI A;  2KR3 A;  3EG9 A;  1WGS A;  1ABO A;  4LUE A;  2EJ9 A;  1BIA A;  2Y90 A;  1UEB A;  4LE9 A;  1LOJ A;  3OYF A;  2VXF A;  3HRU A;  1X6B A;  5CKH A;  2G3R A;  4J7I A;  3SWN B;  2H3J A;  1YI2 A;  1VQ7 Q;  4JJC A;  4F14 A;  3EG3 A;  3ZFJ A;  4FSX A;  1K73 C;  2CZ1 B;  3JCM V;  2GCX A;  1LCK A;  3CC2 A;  3V7S A;  4DOW A;  1ACM B;  1PKS A;  4J9D A;  3FRN A;  1M3B A;  1WQW A;  2O31 A;  1Q7Y C;  4ME7 A;  2A0F B;  4JLI A;  4JRK A;  3PTA A;  1Y7X A;  3OW2 S;  3R6O A;  2E12 A;  3QO3 A;  4AMC A;  2HKQ B;  2NUP B;  3N5B B;  1QCN A;  3GBQ A;  4JJN K;  3OBY A;  1TUG B;  4AFZ C;  2K2M A;  3UA6 A;  5C6S A;  1YP5 A;  1LVK A;  3I56 Q;  5FU7 C;  2QQR A;  1JU5 C;  1BI1 A;  3PE0 A;  4X9C A;  3VU3 C;  1IGQ A;  3I55 A;  3LGL A;  4C0D B;  5GAM j;  1QCO A;  2B8A A;  4EMK C;  3G6E T;  3INZ A;  2C0I A;  3QDF A;  5KCH A;  3HRT A;  1QVG S;  2ROL A;  2YUQ A;  2RHX A;  2RPN A;  1VQO T;  3CPW P;  1M3C A;  4IUQ A;  2V1Q A;  1KC8 R;  2LC4 A;  1NEG A;  1RLP C;  2C0O A;  5EC7 A;  2P4T A;  2OTL Q;  1D3B B;  3MP1 A;  2RI3 A;  4ESR A;  2FPE A;  1VQK Q;  3OYC A;  3JCM X;  3LH0 A;  2PU9 B;  1ZLM A;  4M7A D;  3E9G A;  5M9O A;  2D9T A;  4M78 A;  3CD6 Q;  2DL3 A;  2VYT A;  5LJ3 j;  5CKD A;  1M27 C;  3CBO A;  2HQE A;  3UAT A;  1WDX A;  1VQN A;  4M77 B;  2K3B A;  2L3S A;  2RQU A;  4J9I A;  4KGZ B;  1KQS P;  3RMS A;  2MYS A;  1N6A A;  2DIL A;  4M7A F;  1MHN A;  2K4Y A;  2MCN A;  1FXX A;  2BKD N;  4Z02 A;  3OY9 A;  2COW A;  2QA4 A;  1Q82 R;  1YWO A;  4BY6 B;  1W4S A;  2AIR B;  2JN0 A;  1SF9 A;  3JAM E;  2GQI A;  5IHN A;  5GAO r;  2XK0 A;  2H3E B;  2QEX A;  2E6N A;  2EFI A;  3OYL A;  2LQW A;  2DJQ A;  4FYY B;  3FIF A;  2OAW A;  2GFU A;  3PIO A;  2DVE A;  2R57 A;  5LJ3 e;  3MEW A;  2CKK A;  2LX9 A;  1KC8 C;  1K1Z A;  5KYW B;  3CXC S;  3JSC A;  2VAS A;  1QVF A;  3MEA A;  2DF6 A;  2COY A;  1S72 A;  1MMD A;  4OF1 A;  4XK8 E;  2P0K A;  2KQW A;  4MZM A;  2XDP A;  3JB9 D;  2EKO A;  4C5H A;  3MO8 A;  1UG1 A;  2PUK B;  4E7K A;  2DYI A;  2HBP A;  3BE3 A;  3JCM Q;  4RG2 A;  2YDL A;  4XTX A;  3UWN A;  3NFC A;  4Z8A A;  1E7O A;  3L2Q A;  5GAN 5;  4RTY A;  4C0D C;  3OS0 A;  4E6R A;  3OYD A;  1I8F A;  1IHV A;  2J7I A;  3DLL A;  5KYX A;  3QXE B;  1D09 B;  2XU8 A;  2BE9 B;  4OMM A;  5GAN 4;  2KYB A;  3QKJ A;  2VGM A;  4ZGD B;  2IPO B;  1Q86 R;  2NUT B;  3A1P A;  1IRE B;  3EGX B;  1AWO A;  3OB9 A;  3TU4 K;  1M8V A;  1AOJ A;  3GP8 A;  1SSF A;  1PNJ A;  4MMK A;  1U1T A;  4XTU A;  2FRW A;  2DKG A;  1VUB A;  4VUB A;  3LYI A;  4HKE A;  1JXO A;  4XTW A;  4Q5W A;  3H0F A;  4J8O A;  1NJI R;  3M59 A;  2QAZ A;  3VS6 A;  2IIM A;  3HFO A;  3OYN A;  1K9M R;  1UB4 A;  3CC7 T;  1M2O A;  3WXM B;  2KE9 A;  3T9N A;  1ZBJ A;  1ARK A;  2JOY A;  1RAF B;  3CCE Q;  4X9D A;  1M1K U;  5GMK h;  3VYG A;  2EYZ A;  1NPR A;  5GJV B;  4LUD A;  4C0G A;  2MPX C;  1GRI A;  4BY6 C;  2DPP B;  3OQ5 A;  2KSS A;  2YRC A;  1EX4 A;  4XTV A;  1PD0 A;  5LJ5 g;  5GAN 3;  3X25 B;  1VQ4 A;  3CCL Q;  4A54 A;  3OW2 P;  4RUG A;  2E6Z A;  4R55 A;  3PFS A;  4C8Q D;  1Q86 C;  1X2Q A;  2DYB A;  2GBQ A;  2RQW A;  1YI2 Q;  1YJ9 A;  4FU6 A;  3VRY A;  1K73 U;  4N4I A;  3G71 T;  5GAN 7;  3CC2 Q;  3A8L B;  2KMT A;  3ME9 A;  1JRI A;  2O9S A;  2E64 A;  2PUO B;  2CZ6 B;  4C92 A;  1TSF A;  1EIF A;  1CSK A;  4C8Q F;  4LDU A;  2NLU A;  1OX9 A;  2F2W A;  1Q7Y U;  1ZSZ A;  1NJI C;  1MND A;  1AEY A;  3CCR A;  4BE2 A;  1VOM A;  1KQ2 A;  4M7A C;  4JRP A;  1QVG P;  1K9M C;  2R5M A;  3CC4 A;  2DM1 A;  2VUB A;  1EZZ B;  4UC4 A;  2MI6 A;  2RJC A;  4R56 A;  4MDX A;  3M56 A;  1VQP T;  4AFU C;  3PMI A;  2SRC A;  1G3T A;  4CI0 C;  2DBM A;  4Y28 E;  2BZX A;  5FU6 B;  3I55 Q;  2QQA A;  1YIJ A;  2YLB A;  2QYZ A;  1QWF A;  4MZP A;  1OZ2 A;  4E7S A;  2ENM A;  1W2B S;  1YWP A;  2JMA A;  4DEY A;  5CKF A;  2CT3 A;  1VQM A;  3CCS T;  2M0O A;  2YRD A;  3LH5 A;  4E7H A;  4C8Q B;  3OYG A;  8AT1 B;  4FM4 B;  1O75 A;  1RI0 A;  3OS1 A;  6AT1 B;  1PCX A;  2CUB A;  5I11 A;  4Z88 A;  1WFW A;  3M0P A;  1R0C B;  2ED0 A;  3S3M A;  4AFQ C;  4M7A G;  3JCM f;  3VUZ A;  2BIV A;  1TH7 A;  1VQN Q;  2JJ9 A;  3SDZ A;  4HT9 A;  2YSQ A;  3H8Z A;  2HKN A;  2DJZ A;  1KIK A;  1IGU A;  4BAC A;  4Y92 A;  3CXC P;  1IXD A;  1OU9 A;  2FVU A;  3SEM A;  3J80 E;  2J05 A;  4C0Z A;  2XMF A;  4EMH A;  1SEM A;  2QA4 Q;  3FC3 A;  2J06 A;  1TUD A;  2YXY A;  1ZBX A;  1LPL A;  2XHC A;  1WXT A;  3CBM A;  4J9B A;  2QEX Q;  3UF4 A;  2E3I A;  1Y07 A;  3TQ7 P;  3HL8 A;  2RHU A;  2ECZ A;  2YHT A;  4QQD A;  3QHS A;  3DB3 A;  1KHI A;  3CPW A;  1PKT A;  1KC8 U;  4ATO A;  2O4X B;  3KUF A;  5GMK e;  1S72 Q;  3EG9 B;  1X27 A;  1D1B A;  1U1S A;  1QW1 A;  3DB4 A;  2DNU A;  2A37 A;  3JCM J;  1B07 A;  2HQH A;  2LRQ A;  3EH1 A;  3GIB A;  1OZ3 A;  4DBQ A;  2OJ2 A;  3JB9 G;  3D7S B;  2RM4 A;  4ELY C;  1QP3 A;  5FU6 C;  4CC3 A;  2YT6 A;  2DO3 A;  2CS7 A;  2EQK A;  4RMO A;  1VQO A;  4HA8 A;  3OYH A;  3L2U A;  1YJW Q;  4M78 D;  3MP6 A;  2LVM A;  2X51 A;  3EFS A;  2ZPH B;  2LMJ A;  2NUZ A;  4C5E A;  3L2Z A;  4HVV A;  3QSU A;  2KBT A;  3CPF A;  1DJ7 B;  3GPL A;  2CP7 A;  2DL7 A;  3QG1 A;  4C8Q C;  2K79 A;  3NHN A;  3CBP A;  4M78 F;  4X1V A;  2ROT A;  4CC7 A;  4JS4 A;  1X6O A;  3SB2 A;  1YJN Q;  2OTJ T;  2FL7 A;  1VQ8 A;  1WXU A;  2E5Q A;  1VQ5 T;  1E6G A;  4J9H A;  3QII A;  1TXQ A;  4FSS A;  1WA7 A;  3RKX A;  2XDD A;  3ZBD A;  3X26 B;  1RAH B;  3M5A A;  1G3Y A;  1IO6 A;  2EGA A;  2VGN A;  4FT4 A;  2CZ7 B;  1YCS B;  2KRO A;  4BUG A;  3MKD A;  2DBK A;  3TSW A;  4C5G A;  4YTL A;  3V8L A;  1WHJ A;  1WQ7 A;  1VQL A;  5FU7 B;  3TRE A;  2A28 A;  1BIB A;  3H6Z A;  3M57 A;  4LDX A;  4OB0 B;  3H41 A;  3RBB B;  1VQ4 Q;  1CKA A;  1F1B B;  1GFD A;  3CCM T;  4J5Y A;  2ZPG B;  3RKY A;  4FL6 A;  5I22 A;  3E19 A;  4EMK B;  5LJ3 g;  1Q86 U;  1HXD A;  4M78 B;  2EVR A;  2EQI A;  1YJ9 Q;  3GF5 A;  2X4W A;  4C8Q G;  5EG2 A;  5GAO p;  1YIT Q;  3MCA B;  5FLX E;  4ZTF A;  2QXF A;  2F69 A;  2RHY A;  1MMA A;  1T0J A;  3JB9 I;  3CCV T;  3A8O B;  3EFO B;  1AZE A;  1NJI U;  1BKB A;  4JJB A;  4HCK A;  2HL3 A;  3M0S A;  4PFZ A;  3MEV A;  5KE2 A;  1W2B P;  2FG0 A;  1K9M U;  1AZG B;  2GFA A;  1MGQ A;  4PKC C;  4HCZ A;  3KFV A;  1VQ7 T;  4PLL A;  3JRZ A;  2XDB A;  2RB6 A;  3MHX A;  1YIJ Q;  4BE1 A;  3OMG A;  3CCU Q;  5KYU A;  2EAY A;  2XIC A;  2LP5 A;  4A53 A;  3WVD B;  1WPY A;  2OX7 A;  3FLG A;  2X35 A;  3BY7 A;  3U23 A;  3HTR A;  2DA9 A;  4M75 A;  2L3P A;  1ZUK A;  5GAN f;  2AT1 B;  2VXE A;  3OW2 A;  1H92 A;  3CC7 A;  2VV5 A;  1VQM Q;  4N4G A;  5GAN d;  4FT2 A;  2AKK A;  3JCM c;  2CUD A;  1VYV A;  4NS5 A;  4J7F A;  2EQJ A;  1BBZ A;  1Q81 R;  1YBY A;  5GAM f;  1W6X A;  2E41 A;  3LWI A;  2WAC A;  4A4G A;  1YFN A;  4EMG A;  4RTW A;  1UTI A;  1IB8 A;  1JXM A;  1N9S A;  3A98 A;  1C1A A;  2F1L A;  2GNC A;  4C92 D;  1BCO A;  3RDV A;  2KGT A;  8ATC B;  1Z9Z A;  2OTL T;  3G71 A;  2HZY A;  1VQ9 Q;  3CCJ T;  2WSF E;  1VQK T;  3OYJ A;  4X34 A;  2ZZD A;  4M78 C;  5CR2 A;  1C6V X;  4BDZ A;  4L6V 5;  2DRK A;  1TG0 A;  2J6O A;  3KBG A;  3CD6 T;  4C92 F;  1UGR B;  2KI7 A;  2EJF A;  3P8H A;  1T0H A;  2LJ0 A;  5CKE A;  2Y4Y A;  5IAY A;  2JZ2 A;  1SHF A;  1JQQ A;  1Y71 A;  3RES A;  5A0D A;  2C0T A;  4LNP A;  3Q1J A;  1AWX A;  1VQP A;  2ABL A;  2KK4 A;  2LQK A;  1UFF A;  4C8Q E;  4EDU A;  2X3X D;  2D0Q B;  2K6D A;  4JDS A;  3CME T;  1PRL C;  1M2V B;  2QGG A;  4AFS C;  1NZ9 A;  2D1X A;  1Q81 C;  1UDL A;  4PFO A;  5J26 A;  5GMK m;  1QWE A;  2HDA A;  3VS0 A;  4OMP A;  4KRT A;  2QDY B;  3BFM A;  4RTT A;  3FEO A;  1AD5 A;  3CCS A;  4JS5 A;  3MP8 A;  4PJO A;  3VS1 A;  2EJG A;  3FJ5 A;  2J6F A;  4BE0 A;  3CXC A;  1HK9 A;  4ZGE B;  1SKU B;  5D7U A;  4C92 B;  1QKX A;  1ZSG A;  4M78 G;  2BTT A;  2HSE B;  1JJ2 S;  1ZSZ B;  2OAU A;  2RJD A;  2YWW A;  2CYZ B;  3A8H B;  2RJE A;  2LCC A;  4OMO A;  2DAQ A;  1IZ6 A;  3NMZ C;  2HQX A;  2EYY A;  4AT1 B;  4RTU A;  1XNI A;  1UEC A;  1VQ8 Q;  5D6Y A;  3RR6 A;  1QLY A;  1YHQ Q;  3OYK A;  3VRZ A;  2L3R A;  2LNH B;  3G4S A;  3HKS A;  2FZC B;  4ORZ A;  4JZ3 A;  4M7A B;  1P92 A;  1M9S A;  1BB9 A;  4XU3 A;  3JCM P;  3ER0 A;  3SWN A;  4KGV B;  3JB9 H;  4RCB A;  5FWC A;  4F17 A;  3JB9 F;  1VQL Q;  1VIE A;  2DD5 A;  2B86 A;  4PJN A;  3M0Q A;  5C0M A;  1U3O A;  2FO0 A;  1KD1 R;  2QQ9 A;  3S3O A;  2CP6 A;  2YUN A;  2LJ3 A;  1IHW A;  2QGF B;  3A8G B;  5KE3 A;  1MMG A;  4F7U A;  3QBY A;  4LDW A;  4F04 B;  1VQ6 Q;  5KH6 A;  3CCE T;  4J9E A;  1XJW B;  4QW2 A;  3PIP A;  3CMA Q;  4ANJ A;  3DLM A;  2DET A;  5CO7 A;  5HY6 A;  4JRI A;  5GAO l;  1RL2 A;  1PWT A;  3CCL T;  4K11 A;  2KYM A;  4DA4 A;  2KT8 A;  1RAB B;  1VYT A;  4PLI A;  2ZPB B;  2ESW A;  3VYH B;  1YI2 T;  3EG2 A;  2YUP A;  4HCB A;  3EG0 A;  2JM9 A;  2JTM A;  1LNX A;  2VB6 A;  4O5V A;  4CRI A;  3E2U A;  2PVG B;  4PJM A;  2D8J A;  4QVC A;  2XG8 D;  4C92 C;  2R58 A;  3NTK A;  2LQ8 A;  2HAX A;  3EG1 A;  1YN8 A;  1ZSZ C;  2OTJ A;  3VS4 A;  4DBH A;  3C12 A;  4J6Y A;  4QVD A;  1KD1 C;  1HD3 A;  2K57 A;  4QKU A;  2EKH A;  4J9C A;  4XQ3 A;  1VQ5 A;  2DZ9 A;  2O9V A;  1BCM A;  3JCM h;  3RUX A;  1NLO C;  4QQG A;  1MUZ A;  2D6F A;  3ASK A;  3C94 A;  4CC4 B;  4M77 A;  5FRN A;  1WHG A;  1X6G A;  2YUO A;  4HXJ A;  4M78 E;  4E7L A;  2CH4 W;  1TWB A;  4XU2 A;  3I55 T;  2X3W D;  4RTV A;  1V76 A;  4M7D A;  1YCY A;  5J3B A;  2DXC A;  1G2B A;  5IHK A;  3VS7 A;  5KYN A;  3CCM A;  1FYN A;  2K5I A;  5KYY A;  1SHG A;  4OMQ A;  2MF2 A;  1W2B A;  2COZ A;  2V1R A;  4FYX B;  2MMP A;  4OB1 B;  2EYX A;  3M55 A;  1PM3 A;  2E4H A;  3L1A A;  3CCQ A;  4JRQ A;  1Y96 B;  3G71 Q;  4C92 G;  4MDW A;  1RAD B;  3URG A;  3JB9 J;  2CP5 A;  2M02 A;  4KUL A;  3ULR B;  3QYG B;  3VUB A;  2W0Z A;  4KH1 B;  1K4U S;  3CCV A;  3C95 A;  1ZUU A;  4A4E A;  3ZL7 C;  1ZHI A;  1FMK A;  1VQN T;  2P84 A;  1K8A C;  1I4K 1;  4ZN1 A;  4M75 D;  3E9F A;  4J9G A;  1VQP Q;  3OYB A;  1VQ7 A;  2MIO A;  2KRN A;  4D6W A;  3PMT A;  3VJP A;  2QA4 T;  2P0P A;  3PVQ A;  1JJ2 P;  3C4S A;  3MJX A;  5GMK j;  1G83 A;  5IH2 A;  1Q81 U;  4GY5 A;  3L2V A;  2QEX T;  1W1F A;  5GAN 8;  2BZY A;  4M75 F;  4XU0 A;  1X69 A;  3JCM d;  2JT4 A;  1MV3 A;  5LJ5 f;  2MWP A;  1S72 T;  2DEU A;  2DXB A;  1GCQ A;  4IUV A;  3REA B;  1EFN A;  2D0N A;  1JB0 E;  5LJ5 d;  1AWW A;  1WXB A;  3F70 A;  1M3A A;  1K76 A;  2VVK A;  5HKC A;  4Z89 A;  3GNG A;  1H3Z A;  3EGD A;  1OYX A;  2KAF A;  3OA6 A;  1YJW T;  1JBM A;  1T3L A;  2JS0 A;  1N27 A;  2C06 A;  3NPF A;  3G4S Q;  5GAO q;  2XI9 A;  2JUF A;  5A0L A;  1V1C A;  3G6E A;  3CCJ A;  4M75 B;  4AG1 C;  1OUL A;  2AZV A;  1UGQ B;  3JV3 A;  2KT1 A;  2JTF A;  2FZG B;  1TOV A;  4ZGJ B;  3SHW A;  3OYI A;  4OGC A;  1FWZ A;  3CD6 A;  4E2F B;  2LTO A;  4AG2 C;  1SPK A;  1KQS A;  1R8O B;  2RQV A;  2E3H A;  3EFR A;  2FYK A;  2RHI A;  1HSQ A;  1YJN T;  2HNI A;  3M9Q A;  3JCM e;  1UHF A;  3MPU B;  5FWB A;  2LJ1 A;  2M9U A;  2A7Y A;  4LDV A;  4PJJ A;  2ZPE B;  1R77 A;  2X9H A;  3QJ6 A;  5L23 A;  5I21 A;  4KH0 B;  2X4J A;  2DXT A;  2LDM A;  4C92 E;  4NL3 A;  1WYX A;  4PL6 A;  3CME A;  3J81 E;  2YLC A;  3NTH A;  4R0K A;  4B9W A;  4PJO D;  3HSB A;  3LW5 E;  1M4Z A;  4ZNX A;  1WNL A;  3EHQ A;  2DTI A;  3PNW C;  2DXU A;  2RO0 A;  3OYM A;  5HK3 A;  1JEG A;  3WVE B;  5IN1 A;  1KFZ A;  1KG1 A;  3O5Z A;  2I2L A;  1M90 R;  4B9X A;  2D8H A;  3GOX A;  2NWM A;  2DE0 X;  1WLP B;  1AWJ A;  5D6W A;  4PJO F;  5GAN h;  2DX1 A;  1NPP A;  1GL5 A;  3BDL A;  1YJ9 T;  4M7A E;  1X2K A;  4NL2 A;  2CRE A;  3L2W A;  1QKW A;  1SRL A;  1YNZ A;  4JUV A;  5CIU A;  1UJ0 A;  2DTO A;  1YIT T;  2YRV A;  1PRM C;  1ZA2 B;  2LZ6 B;  1RAA B;  2OTJ Q;  3FDR A;  4E7J A;  4J9F A;  2PVD B;  4CC2 A;  4DOV A;  4WTO B;  4KUD K;  5GAN 6;  1KD1 U;  5GAM h;  2JXB A;  1FX7 A;  4GLK A;  3FB9 A;  2EYW A;  5GAN 2;  2QTX A;  3OBW A;  2DLP A;  4DEX A;  1G5V A;  4IKF A;  2W10 A;  1UGV A;  2KXD A;  2RQR A;  1PG5 B;  1M1F A;  3AHU A;  3TCJ A;  1YIJ T;  2LT1 A;  3CCR Q;  3CCU T;  2RI2 A;  2RF0 A;  4M75 C;  4PJO B;  3QYH B;  2L0A A;  3UT1 A;  1M90 C;  2DER A;  4L59 A;  3CC4 Q;  1T3S A;  1SSH A;  1Y57 A;  3EHR A;  2LT4 A;  2P0Q A;  3CCM Q;  5DY9 A;  3QZ5 B;  1I5O B;  4P5N A;  1H8K A;  4QQ6 A;  2L89 A;  2M0Y A;  2K9G A;  3X20 B;  2LX7 A;  2QQS A;  2K2V A;  2VWF A;  4F7U F;  1OX8 A;  2RA2 A;  4N0A A;  2K7A A;  3CCQ Q;  1I1J A;  4O6J A;  1K0S A;  3X24 B;  1PSF A;  4WF2 A;  1WHL A;  1NM7 A;  5CCA A;  3P8B B;  1KHC A;  1D1C A;  3CCV Q;  3QUI A;  2GQV A;  1OQK A;  1GFC A;  3CCL A;  2RJF A;  4F16 A;  1WJQ A;  3I56 T;  1V29 B;  5D6X A;  2L8D A;  1K8A U;  5CQX A;  5CK9 A;  3LWH A;  1UE9 A;  5KYX B;  3UPU A;  1G8X A;  1KSW A;  3AT1 B;  3VS3 A;  2EPD A;  1KJW A;  4D8K A;  2F2X A;  1D0X A;  4EIK A;  2IG0 A;  1VQ9 T;  1M8M A;  4M75 G;  1BI3 A;  1OV3 A;  1M5Q 1;  2CDT A;  2CH4 A;  3I5R A;  4M77 D;  2NYS A;  2JNG A;  5GAM d;  4DQ2 A;  1QVG A;  5GAN j;  4JPB W;  2ZAE A;  3VS5 A;  1BYM A;  1LJO A;  4F7U B;  1ABQ A;  2K5F A;  3M53 A;  4RKU E;  2RK1 A;  2JTE A;  4M7D D;  1K0X A;  5CAI A;  4XTZ A;  1U06 A;  2QDL A;  4M77 F;  2V26 A;  2JMC A;  1QQJ A;  2JW4 A;  5LJ3 f;  1VA7 A;  2P4R A;  2HEQ A;  4BI8 B;  2EGE A;  1K9A A;  3OYE A;  1TU0 B;  3E1S A;  2WSC E;  4M7D F;  3PT9 A;  5CVI A;  1QMC A;  3H0I A;  3M0U A;  5LJ3 d;  2BUD A;  1MMN A;  5GAN e;  4PJO C;  3P8D A;  4A4H A;  2DEQ A;  2K3Y A;  4FYW B;  4N4H A;  2PNI A;  4OB3 B;  1NYG A;  2QQB A;  5DM7 R;  1WX6 A;  2FHD A;  2JVV A;  2AK5 A;  4OP0 A;  3SFM A;  3G6E Q;  3CCJ Q;  4IUR A;  4EMK A;  2Y4X A;  1N8R R;  2KEA A;  1JJ2 A;  1B34 A;  2QAS A;  1VQO Q;  2EQM A;  4MZT A;  4MML A;  1Q95 G;  1WJS A;  2O2O A;  3QJY A;  4QVZ A;  4ZN3 A;  5GAM e;  5GMK i;  3A5Z B;  5FRO A;  4FYV B;  1GBQ A;  1I5L A;  1VQ8 T;  1UUE A;  1YHQ T;  1UGP B;  1OU8 A;  3MET A;  4EPC A;  4DBR A;  1A0N B;  2L3Q A;  4BD3 A;  1BI2 A;  4IIO A;  3EFO A;  1M30 A;  4HVW A;  4M7D B;  3CME Q;  1WIE A;  2A08 A;  3MEU A;  4KT0 E;  3SWN C;  1GXI E;  3RMQ A;  1MV0 B;  2DL8 A;  5KYY B;  2MOX A;  1XOV A;  4OVA A;  3RKW A;  3HPW A;  4ELZ C;  2PQW A;  1VQL T;  2DIQ A;  2FRY A;  4PJO G;  1RAC B;  4BDY A;  1U5S A;  2QK0 A;  2ZPI B;  4OMN A;  3VV0 A;  3HHT B;  7AT1 B;  3JCM W;  2LCS A;  2ATC B;  2BE7 D;  2FPD A;  3CQT A;  2XD0 A;  1IRX A;  1RUW A;  2X4Y A;  4D8D A;  2KRM A;  4RTX A;  3ZEH A;  1WHK A;  2EIF A;  5A0G A;  2EYQ A;  1NEB A;  2DVJ A;  3TSZ A;  1VQ6 T;  3LX7 A;  4M75 E;  2L2P A;  2CGH A;  2M1H A;  3TEE A;  1N8R C;  1RAE B;  3CMA T;  2KXC A;  1QVF S;  1RAG B;  4DBF A;  4OB2 B;  2GTJ A;  1RI9 A;  1CKB A;  4HCC A;  3S3N A;  5I2S A;  4ZTJ A;  2DIG A;  2HBW A;  2AZS A;  1YJW A;  2RD1 A;  4RCC A;  2NUP A;  3OYA A;  1NBE B;  3H9N A;  2RQT A;  1NG2 A;  2HCK A;  2CP0 A;  1OPK A;  2JM8 A;  1Q82 C;  3UDC A;  1H64 1;  3OYY A;  4WCI A;  4C0F A;  3BDU A;  1RAI B;  1QVP A;  1PC0 A;  1OOT A;  1I07 A;  1ZA1 B;  1MNE A;  4LDY A;  4OMF B;  4C5I A;  1M90 U;  1YJN A;  2K3X A;  3OSS C;  4KBM B;  4FW1 A;  2LCL A;  4F7U G;  1G3S A;  2GTO A;  4FCY A;  4E7I A;  9ATC B;  2L5Q A;  2GF7 A;  3JCM g;  1WHM A;  4M77 C;  4BB7 A;  3CC2 T;  1B3Q A;  3CEY A;  4BI3 A;  1D3B A;  2PTK A;  3M0R A;  1N9R A;  5GJW B;  3SD4 A;  3UA7 A;  3PVL A;  3VS2 A;  3FJP A;  5CKB A;  2HSP A;  3EGD B;  4M7D C;  2SEM A;  4RG8 A;  2EQU A;  2LNV A;  5LL6 S;  1K8A R;  3CC7 Q;  1UGS B;  1M2V A;  1KQ1 A;  1PSE A;  2HL5 C;  1H3H A;  4PFP A;  3NTI A;  4XTY A;  1I0C A;  2A3L A;  4M4Z A;  3OMC A;  4JZ4 A;  3C0C A;  2O01 E;  5LJ5 h;  1J3T A;  1YIT A;  1FMV A;  1TUC A;  4PJO E;  3KXT A;  1VIF A;  5IT9 E; 
#chains in the Genus database with same CATH homology
 3I55 Q;  1VQO Q;  1QVF P;  3CCE Q;  3CME Q;  3CCM Q;  1Q82 R;  3G4S Q;  1VQ6 Q;  1YIT Q;  3CD6 Q;  1VQM Q;  1M90 R;  3CCV Q;  1VQ4 Q;  3CPW P;  1VQ8 Q;  3CXC P;  3I56 Q;  3G71 Q;  1YI2 Q;  1QVG P;  1KC8 R;  1VQL Q;  1YIJ Q;  1YHQ Q;  1VQP Q;  1Q86 R;  1K73 R;  2QA4 Q;  3CCU Q;  1NJI R;  2OTL Q;  3CMA Q;  3CCS Q;  1K8A R;  2OTJ Q;  3CC7 Q;  1S72 Q;  3CC2 Q;  1KQS P;  1KD1 R;  3CCR Q;  3CCQ Q;  3G6E Q;  1YJW Q;  3CCJ Q;  1N8R R;  1K9M R;  1VQK Q;  1YJ9 Q;  1W2B P;  1YJN Q;  1VQ9 Q;  1VQN Q;  3CC4 Q;  3CCL Q;  1VQ5 Q;  1Q81 R;  1Q7Y R;  1VQ7 Q;  1JJ2 P;  1M1K R;  2QEX Q;  3OW2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...