3H8ZA

The crystal structure of the tudor domains from fxr2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
123
structure length
112
Chain Sequence
AYFQGLPVEVRGSNGAFYKGFVKDVHEDSVTIFFENNWQSERQIPFGDVRLPPPAEITEGDEVEVYSRAEPCGWWLARVRMMKGDFYVIEYAACNEIVTLERLRPVNPNPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Fragile X mental retardation syndrome-related protein 2
publication title Structural Studies of the Tandem Tudor Domains of Fragile X Mental Retardation Related Proteins FXR1 and FXR2.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 112
sequence length 123
ec nomenclature
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05641 Agenet Agenet domain
A PF18336 Tudor_FRX1 Fragile X mental retardation Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3h8zA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3h8zA01
5IAYA 2L8DA 2EQJA 2R5MA 2EQMA 2RO0A 4GY5A 4E7HA 2X4YA 4E7LA 2WACA 2RI3A 3OS2A 2RHUA 4II1A 4IUQA 4IUVA 4BD3A 4ZTFA 4Q5WA 3KUFA 4L59A 5C6SA 4A4FA 3LH0A 3SD4A 2K3YA 3E9GA 3Q1JA 2EQUA 2RI2A 3META 4E7KA 4IUUA 4N4GA 3DLMA 3L2RA 4C5GA 4FL6A 1OZ2A 3O8VA 2MWOA 2RHYA 3PMTA 2GFUA 2JTFA 3MO8A 4FU6A 4PLLA 5D6WA 3UWNA 3MP1A 4E7IA 5FRNA 2BIVA 4RG2A 2K3XA 2RHIA 2M0OA 4BE0A 3LYIA 5KE2A 2CKKA 4NS5A 3OS1A 3FC3A 3S3OA 3C4SA 2X35A 5CIUA 5J39A 4C5HA 4BACA 3OS0A 2DIGA 3DB4A 2RJCA 1WGSA 3DB3A 3PMIA 2X4WA 3FDRA 3MEWA 2DAQA 3S3MA 4A4GA 3OYMA 2XDPA 3CEYA 2QQSA 4Z02A 3OYEA 2E6NA 5KE3A 3MP8A 3S6WA 4ZTJA 3LGFA 3OYJA 2BUDA 3NTIA 3PNWC 5D6YA 4HCZA 1KHCA 2RHXA 2RJFA 4QVZA 5KCHA 2HQEA 4CRIA 3L2VA 4IURA 4N4IA 3H8ZA 2RJDA 2YRVA 3OB9A 3FLGA 2R58A 2XK0A 3MEVA 5M9OA 2RI5A 5IN1A 2LRQA 2EFIA 3UT1A 4PLIA 5FROA 3OYNA 5KH6A 2LVMA 2R5AA 4A4HA 1WJSA 1WJRA 2EQKA 3ME9A 3OMCA 4LD6A 2L89A 2R57A 4A4EA 3ASKA 2VYTA 2F5KA 3M9QA 4BE1A 4C5EA 1RI0A 2O4XB 2PQWA 3L42A 4QQDA 3E9FA 3OYLA 4PL6A 3L2UA 1MHNA 5C0MA 2DIQA 4BDYA 2X4XA 3OYCA 4UC4A 1WJQA 3OA6A 4BDZA 3LX7A 3NTHA 3QJ6A 5D6XA 3F70A 4QW2A 2BKDN 4QQ6A 3P8DA 4B9XA 3LGLA 3GOXA 2IG0A 1H3ZA 3QBYA 2JZ2A 1N27A 3LLRA 4X34A 3EAEA 4C5IA 2GFAA 1XNIA 3P8HA 2QQRA 2G3RA 3OQ5A 4IUPA 4QQGA 3OYAA 3OMGA 2RJEA 3ZEHA 2GF7A 4IKFA 2LCCA 3PFSA 2E5QA 4B9WA 2LTOA 1G5VA 1OI1A 2LDMA 2M1HA 2M16A 3OYFA 3OYKA 3OYGA 3MEAA 2RHZA 2NLUA 5J26A 5KCOA 3OYIA 3NTKA 2L3RA 3OYBA 2EKOA 3MEUA 4EDUA 3OYHA 3MP6A 4OVAA 2MWPA 3L2WA 2D9TA 3BDLA 3OY9A 4BE2A 3S3NA 1OYXA 1SSFA 2B8AA 3L2QA 2HQXA 4N4HA 3OYDA 2P0KA 4IUTA 3QIIA 2FHDA 4E7JA 5FRMA 3FEOA 1OZ3A 3H6ZA 3QKJA 2O4XA
chains in the Genus database with same CATH superfamily
4HT9A 3JCMQ 2CUBA 2WSFE 2X4YA 5GAN3 4PFPA 5GMKl 1VQKQ 3CXCS 1VQ9T 4L59A 5C6SA 1GFDA 4LD9K 3KXTA 4N4GA 1M8MA 4Y28E 2BZ8A 3FRNA 2CP3A 2GCXA 4E7IA 2K3XA 1VYUA 1M2OA 5KYYA 2ESWA 1Q95G 1E7OA 3I55A 4KRTA 4ZTJA 2P4TA 2VXEA 3G6ET 2OJ2A 3EG2A 5HCKA 4GBQA 3JCMd 1K1ZA 5IH2A 5GAOm 1ZSGA 1YBYA 4DBQA 2QA4T 2O88A 5GANj 3EGUA 2YUNA 1VA7A 2VGMA 2DL7A 1U3OA 1BU1A 2EKHA 2R5AA 4PJMA 2QQAA 4CC3A 1W2BA 2QGFB 1WHLA 4FYVB 2V8IA 4M77G 1KFZA 5FW9A 2PZ1A 4GLMA 4F7UA 4F7UF 5CAIA 1VQNA 1OU9A 1BI0A 4LDUA 1G5VA 4DBRA 3LWIA 1OI1A 2LDMA 5J26A 3OYIA 2EW3A 3OYBA 2YHTA 3EG1A 2B8AA 1AWXA 3QXEB 1K8AR 4PFOA 4OMQA 2RF0A 1YNZA 3JCMX 2CSIA 1U8RA 1VQPQ 2XHCA 7AT1B 2HKNA 2KXCA 2XIDA 4Q5WA 3EGDA 2BTTA 4KUDK 1UEBA 1RADB 3CCRA 1LVKA 4IUUA 4PJOA 4PJOF 4XQ3A 2K3BA 2YRDA 2LP5A 1JJ2A 2HAXA 2BZYA 2HMAA 5GANf 3PVLA 1U1SA 4ZNXA 2RJCA 1YWOA 2X4WA 3FDRA 4J9CA 3CMAQ 1IHVA 2J06A 2CH4W 5DLQE 4FM4B 4CRIA 2E4HA 1YFNA 2E3IA 1PCXA 3CCET 3QDRB 1RL2A 3JB9F 5FU6B 2DK3A 1WNLA 2LRQA 5GANe 3HP9A 1KHIA 2L3PA 1M30A 3RKWA 1H92A 4R56A 1O75A 2CZ6B 1TTHB 1KIKA 4FW1A 1YI2Q 1MHNA 3WVEB 2DIQA 2OTLQ 1GCPA 3MJXA 3OW2P 4PJOG 5LJ5f 1W2BS 4M7DG 1MV3A 3HPWA 3EAEA 1VUBA 4MZTA 2RQRA 3EFSA 4KUIA 2IPOB 2QA4Q 1X6OA 3M4YA 4B9WA 4J6YA 4A63B 3EFRA 2K5LA 1YHQA 3NMZC 1I1JA 2JS0A 1YP5A 1KQSA 3BDLA 4RCCA 3OY9A 3JCMe 1RAEB 1VQOA 2KNBB 1OYXA 1UGRB 3JB9G 4L5GA 2LJ1A 4M7AG 2LX9A 2EYZA 1K0SA 5GJVB 4M4ZA 2O4XA 2L8DA 3EGXA 4M77B 4E7HA 4O5VA 1FWZA 1FX7A 5LJ3g 2C0OA 2CT3A 5KYYB 3CPWA 3PE0A 1OULA 2IIMA 2LZ6B 4K11A 3GLXA 1MMGA 4PLLA 5D6WA 1PKSA 3MP1A 4OMPA 3VS7A 4RG2A 2EGAA 2LQWA 2F69A 1YITT 2A3LA 3C0CA 2KT1A 3NPFA 3S3OA 1QW1A 2Y4XA 1QQJA 3MEWA 3MHXA 2ZPEB 1VQ5A 5HK0A 4QKUA 4PJOC 5KE3A 3V8LA 8ATCB 4MZPA 4N4IA 3H8ZA 3CD6A 1J3TA 1QWEA 2RMOA 2CP7A 3CMET 1S72T 3OSVA 3HSBA 5CO7A 1TOVA 4BE1A 3L42A 1ABOA 3UA7A 3OYLA 2MYSA 2AIRB 2FO0A 1Z9QA 5GJWB 4OB1B 2LNHB 3CCEQ 4J9IA 4RTXA 2CREA 4VUBA 1UG1A 2LCCA 1BIBA 2E5QA 4FIBA 1JXMA 1W2BP 1Q82C 2EYYA 1Q7YR 4QT7A 5IXFA 4EMHA 1M4ZA 4EDUA 3MP6A 2LC4A 2NUZA 1RUWA 4IUTA 3EGDB 4X1VA 4NL3A 5CKHA 2HD0A 4DEYA 4KH1B 4PJOB 4GY5A 2AZSA 4M7DB 1I5LA 1IXDA 4PJOE 3M0SA 1C1AA 3OSSC 2JNGA 5FU7C 1U1TA 3M59A 1KC8C 2J7IA 3META 2FL7A 1BI3A 3PMTA 1UUEA 2JTFA 9ATCB 1MUZA 3HFOA 4JRIA 1G2BA 2CKKA 3C12A 1KJWA 3A5ZB 2KR3A 2E5KA 4M7AB 1Q86R 1IO6A 2F5TX 1VQLQ 1VQMA 1M2VA 1WDXA 3G1JA 1M1FA 2DYBA 5GMKj 2K6DA 3M57A 4ELYC 4HCZA 1ZSZB 2HQEA 1N8RR 2K57A 1QMCA 2EJGA 1RAIB 3HL8A 1UHCA 1Y07A 3UA6A 1JJ2P 3REAB 4ANJA 3CCUT 1KC8U 1YITQ 4QVDA 2KGTA 2DVJA 2CZ7B 4BB7A 5C0MA 2J6KA 3M55A 3OA6A 1WLPB 4M78A 2HBPA 4M78F 3SEMA 4D6WA 2YLBA 4X34A 1WXTA 4XAXB 3VYHB 5GMKm 2DPPB 3GNGA 1MNDA 2EIFA 3EG3A 4C92A 3CMEQ 1YJWQ 1S72Q 3X25B 5IHNA 4C92F 4EIKA 2M1HA 3OYFA 4FYWB 3MEAA 4E2FB 1WA7A 2DTIA 3EGXB 3QWXX 3RUXA 3CCLT 3MEUA 1UECA 1ZUUA 1I5OB 3VS3A 2GQIA 1FMKA 1KQ2A 3CCJA 1ACMB 3A98A 2EJ9A 2RQUA 1NPRA 2HZYA 2LJ0A 5GAN4 1OQKA 1QKWA 1SSHA 2FPFA 1U06A 1WYXA 4AMCA 2FPDA 2YLCA 2JXBA 1V1CA 3TVTA 3CCST 1T3LA 1KQSP 1HSQA 2GNCA 1ZQ1A 2BZXA 3I56Q 2FVUA 4M78G 3NGPA 2JTEA 3INZA 3UWNA 5KYXB 1NG2A 1PG5B 4C8QD 2A37A 5FWCA 1CKBA 2DXCA 5KE2A 3RMSA 3CC4T 1PD1A 4C5HA 1AVZC 2V8JA 4C92G 6AT1B 3JCMg 1SHFA 3GIBA 1QCOA 2OTJQ 1MMDA 3CPWP 3QUIA 1VQ6T 5GMKe 3PNWC 4IIMA 4JRKA 3E1SA 3C95A 5GAN2 1SRLA 4J7IA 2QDYB 1I8FA 4JPBW 3UDCA 1R8OB 2DFUA 2CH4A 1A0NB 3G71A 1WJSA 1I4K1 4M75A 1UGVA 4LD6A 3LH5A 4M75F 3M0QA 1AOJA 2JS2A 2JUFA 2EGCA 4C5EA 4KGZB 2D6FA 4BDYA 1OU8A 4FCYA 2O2OA 3EG9A 3P8DA 3LGLA 1BBZA 4J5YA 2JT4A 3LLRA 4C5IA 2KRNA 1ZA2B 2RN8A 3JB9I 1S1NA 1KG1A 1PD0A 1C6VX 5GAMh 3PFSA 4JJCA 3CCMQ 2KE9A 2JOYA 5A0LA 1Y7XA 1VQ4A 3CCQT 5A0GA 1M27C 1Y71A 3OYKA 4HVWA 4M78C 2MI6A 2DETA 2P84A 2M51A 2OAWA 2EKOA 2FZCB 2IVWA 2Z0WA 4N4HA 4NL2A 1M5Q1 2ZPFB 2XG8D 5ECAA 3FEOA 4C92C 3V8JA 1SKUB 2DEQA 2ROTA 1OPKA 1PWTA 3URGA 4Z8AA 1LOJA 1JO8A 4M75G 1GCQA 1D0ZA 2FRYA 1H3HA 4PK4A 2LQNA 2X9HA 2YRCA 2RH2A 2DKGA 2EQUA 2VUBA 3DLMA 2KRSA 5CKBA 4Y91A 3CCLQ 3NFCA 4J9BA 5GANd 4NS5A 4RTZA 1B7TA 2DJQA 5I2SA 4AFSC 2DD5A 2HKQB 3HFNA 1RACB 4DA4A 1WI7A 2E6NA 2KYBA 5D6YA 3CC2Q 2RHXA 4QVZA 3VS1A 4IURA 4BI4A 3CCSQ 4M77A 5KYNA 4M77F 4BY6B 4RKUE 1UGSB 1IB8A 2RI5A 1K9AA 2LMJA 3OYNA 3I55T 2LVMA 3V7RA 1AWWA 4M78B 1T3SA 4XU0A 4A4EA 4M78E 5I11A 3CMAA 1XQHA 2DVEA 3J81E 3LW5E 4QQDA 4PL6A 2A7YA 2RPNA 1FYNA 3TSWA 4C92B 5LJ5d 4HCBA 4B9XA 1VQ6Q 2K7AA 2PVGB 4C92E 4M75C 4OGCA 3X28B 2E64A 3P8HA 2ATCB 2QI2A 3JB9J 1VQ7Q 4IKFA 2YDLA 3OW2S 2QAZA 4JJBA 1ZHIA 2AHJB 2L2PA 2L3RA 1YI2A 3G4SA 4CC2A 2OTLA 2D9TA 1K4US 1VQNT 1WX6A 2JMAA 3TU4K 2XKOC 2ZPHB 2COYA 1M8VA 4RTTA 1JEGA 2QEXA 3QKJA 3VUBA 1Z9ZA 3M5AA 4O6JA 5FU6C 2ABLA 3VS4A 2RI3A 1NLPC 4LDVA 1QVGA 3KUFA 4X9DA 4JS4A 4OB0B 3TREA 4RMOA 3RBBB 3CCQQ 2EYQA 3L2RA 4ME7A 3FJ5A 4L6V5 2DL5A 1Q86C 5LJ5j 2RHYA 3E19A 3MO8A 2RM4A 1AHJB 3VS0A 1GCQC 2KAFA 3OS1A 1N8RC 1UTIA 4E6RA 3PTAA 4JUVA 2COZA 2ED0A 3EH2A 3CCRT 5IHIA 3A8GB 2CP6A 3LGFA 2QQ9A 3OYJA 4M75B 3JCMW 4A4KA 2VKNA 4M75E 4J6XA 4M7DA 3I5SA 4M7DF 2MCNA 4A53A 2X51A 1VIEA 2KVQG 3UT1A 2MMPA 1Q81R 4A4HA 2SEMA 3EG9B 2V1RA 3TCJA 2XDDA 1Q86U 3FB9A 1K73R 3WXMB 2HL3A 4M77C 2A36A 1QKXA 4ELZC 2KDSA 2HCKA 1N8RU 4JDSA 3OYCA 3H0FA 1AEYA 1WJQA 2RQVA 1VQ9Q 2D8JA 4QQ6A 1HJDA 2D0NA 4M7AA 1QWFA 2HL5C 4M7AF 3CCVT 2J6OA 2HBWA 1ZLMA 3LWHA 1AWJA 2VGNA 2KXDA 2YXYA 2EYWA 2DNUA 2P4RA 3QG1A 1TG0A 1VYVA 1RLQC 1ZSZA 1LJOA 3I55Q 3A1PA 1NEBA 4FSSA 2E41A 5LJ3h 4YTLA 3MCAB 2VB6A 1JQQA 1F1BB 1UJYA 3SDZA 3R6OA 2A0FB 3OYDA 1NJIR 4JJNK 1LCKA 1X6BA 3G6EQ 1X43A 1SRMA 1B3QA 1UJ0A 3RR6A 1YHQT 3M56A 1QVPA 5GAN8 3OS2A 4ORZA 1VQOT 2DERA 1NYGA 1JB0E 1U5SA 4JS5A 3O8VA 5LJ5e 2CT4A 1QVGS 4OMLA 1GBRA 2LQ8A 5KYWA 1VQNQ 4OMNA 1GL5A 3TSZA 2E1HA 3A8MB 3PMIA 3I5RA 4M77E 2ZZDA 1IZ6A 1D3BA 3VJPA 3S6WA 2P0QA 2RJFA 4Z88A 3L2VA 1G3TA 4RTVA 2RJDA 1PKTA 2AKLA 1UGPB 1YJNA 1VQ5T 4AFUC 5FROA 1KSWA 4JRPA 1VQLA 2VYTA 3M9QA 1RI0A 1JJ2S 5KYXA 3PIPA 3CD6T 1ZBJA 4M7DC 4UC4A 8AT1B 4BDZA 1M1KC 1QCNA 2CYZB 5L8RE 1TUCA 3DLLA 2QTVA 3CC7A 4HT8A 3M0RA 2DBMA 4J8OA 1IREB 1ZUKA 3NTKA 2EQIA 2ZPIB 4M7AC 3OS5A 2CZ0B 1QP3A 1WPYA 4NOYA 4DBFA 3JRZA 1ZSZC 3QPHA 2JM8A 1YJWA 3CCVQ 2WACA 2KQWA 5GAMf 1KD1C 1M90C 1M1KU 3C94A 2RD1A 3RERA 4KGVB 4E7KA 4PKCC 1B34A 2DRMA 4FL6A 1OZ2A 2GQVA 3UPUA 2J6FA 1CKAA 1D09B 3QHSA 2JMCA 2YT6A 5I2MA 1KQSS 2JW4A 5J39A 4OMFB 2XDBA 1RAFB 3ZL7C 1N9RA 3SWNA 4LNPA 1QVGP 3BE3A 1YHQQ 1M3CA 3X20B 3TQ7P 2XDPA 4DOVA 2QQSA 4M7DE 1X01A 3ER0A 3I56A 1Y0MA 1YIJA 2XICA 4FT2A 1KD1U 1M90U 1Q82U 4DOWA 1LPLA 2KEAA 3CPWS 1BCOA 4EMGA 3QJYA 1VQMT 5GAN5 2F2VA 5CVIA 1IGQA 3BY7A 3VKIA 3HRSA 2OTJA 3GBQA 3X26B 2DBKA 1IRXA 4M7AE 4PFZA 1OX8A 1G8XA 3CBOA 3OYYA 2DJZA 3VUZA 1EFNA 2BE7D 2HDAA 2Y90A 3V8KA 3JCMc 1SG5A 1PNJA 1FMVA 1YN8A 3PVQA 3OYGA 2NLUA 5KCOA 3HHTB 2KY9A 3VS2A 3M0UA 1SSFA 4X9CA 1JXOA 2P0KA 2EGEA 1AZGB 1HD3A 1UHFA 1YJ9A 2O31A 2V26A 5GAN7 2R5MA 5L23A 2RNAA 4F17A 2ROLA 3CCMA 2CSQA 1K8AC 1PRLC 4E7SA 5KYWB 4II1A 2EJFA 1K76A 4BD3A 3V7SA 2FZGB 3QDFA 3MPUB 4A4FA 1QVFA 3JCMh 4M77D 3CCJT 3A8OB 3M53A 4E7ZA 5GANg 5KYUA 2KROA 3QO3A 1G3SA 4FU6A 1D3BB 2ECZA 1VQ8A 1D0YA 2DZCA 4PJLA 2CZ1B 1JU5C 3NHNA 4J83A 5EG2A 2SRCA 4JLGA 4JZ3A 2E12A 3S3MA 3OYMA 1T0JA 4FSXA 3MP8A 2LX7A 4Y92A 1T0HA 2K2VA 4LDWA 2DO3A 2WSCE 1K8AU 1OV3A 1TSFA 3SWNC 5IXBA 3MEVA 3RKXA 5M9OA 1E6HA 4OF1A 1BB9A 3RKYA 4J9GA 2DEUA 3HKSA 4KULA 1JBMA 2PUKB 2WSEE 1FMWA 2PNIA 1VQKA 3GF5A 2DX1A 3M4GA 4J6WA 5LJ5g 2PQWA 2DZ9A 1NYFA 1MMNA 5GMKi 1Y96A 1W6XA 3CC2A 1AD5A 1WQWA 4HKEA 4MMKA 4KGXB 1H3ZA 5AYFA 2A08A 3G71T 1W4SA 3CXCA 2DYIA 3OQ5A 4BI8B 4RTYA 4RTUA 4DBHA 3ZEHA 1NJIC 4F14A 1JRIA 4LDXA 4EMKA 2RA2A 3BDUA 3VS5A 5CK9A 2LNVA 2HQXA 4FYXB 3QZ9B 2NUTB 1MGQA 2DL8A 1VQ4T 3H6ZA 5CR2A 1B34B 3MKDA 1G3YA 4MZMA 3WVDB 1O9SA 3HRUA 1VQ7A 2ZCFB 4BY6C 1GXIE 1ZBXA 1EZZB 2MK5A 3CCUQ 3JCMV 2YUQA 3UATA 3LH0A 3SD4A 4ZN1A 2RI2A 5A2QE 3SWNB 4PJOD 4ESRA 2CS7A 2NWMA 5LJ3f 2EAYA 4M7DD 1RI9A 2RK2A 4LDYA 1QVFS 2RHIA 3PIOA 3C4SA 2X3WD 3EHQA 1AZEA 4OB3B 2CDTA 2X3XD 1B07A 3BW1A 3CEYA 3RESA 3X24B 4WCIA 1WFWA 3VS6A 4HVVA 3JB9D 1M3AA 1WHJA 4R0KA 1WHGA 5J3BA 4C0DC 4OMOA 2O9SA 2YRVA 3HRTA 3CCJQ 2LT4A 1OOTA 4XU1A 5LL6S 4XTYA 1D1CA 1PSFA 1RLPC 4IIOA 2YWWA 3JSCA 1K9MR 1VQPA 4KT0E 4C0GA 2C06A 5D7UA 2JM9A 4MDWA 2X4XA 2QTXA 4C0ZA 4KH0B 2XD0A 3H41A 4PNOA 4AG2C 1YWPA 4XK8E 2G3RA 2ZPBB 3EH1A 2EBPA 5FLXE 2LJ3A 4IUPA 4QQGA 2P0PA 3CMAT 2RJEA 2GF7A 2F2WA 1NBEB 1ABQA 3VYGA 3GP8A 3CBPA 2KYMA 1RAGB 2HEQA 3CC4Q 1LNXA 2DTOA 1IHWA 4CC4B 2PVDB 2KK4A 2VXFA 3J7AF 3L2WA 2PUOB 1ZX6A 3G7ZA 4D8DA 1VQ9A 2K79A 1X2QA 2EWNA 2F1LA 1Q7YC 1I0CA 2E70A 3QZ5B 1RABB 4XU3A 1KC8R 2JJ9A 3G71Q 5KYUB 1WXBA 4EMKC 1YI2T 3G4ST 2XI9A 2OTLT 4E7LA 1R77A 1YCYA 4J9HA 3RMQA 3HTRA 1N9SA 4C0DB 3Q1JA 2QEXT 2MWOA 3GNFB 5CQYA 4XTWA 3V7CA 3G6EA 2AK5A 4DEXA 2M0OA 4C8QA 4BE0A 3LYIA 3FC3A 4C8QF 2DXTA 3SFMA 2QA4A 1VQ4Q 2DAQA 1Q7YU 1QVFP 4AFZC 4OGEA 5GAOp 3IQLA 4GLKA 2L0AA 4OMMA 2ZPGB 1Y96B 5IN1A 2C0IA 3EHRA 3U23A 3J80E 2EQKA 2I0NA 4J9EA 4XU2A 4HCCA 5GMKh 4XTUA 1WZOA 1G83A 3GOXA 2ZGWA 3JB9H 1ARKA 5FWBA 2I2LA 3OBWA 1PHTA 2KMTA 4EMKB 4C8QG 2FPEA 1SPKA 1NLOC 4A54A 4RCBA 1C0MA 3JCMP 4MMLA 3EG0A 2QASA 2CP2A 3M58A 1VIFA 1VYTA 3I35A 1GBQA 1TUGB 3QSUA 2RQWA 1R0CB 1X27A 1BCMA 3H9NA 2MAMA 5IT9E 3CXCP 1I07A 4QVCA 4E7JA 4F7UG 2FZKB 2KT8A 1TUDA 2AZVA 1IGUA 3SB2A 2HNIA 2EQMA 5GAMd 3ZFJA 4IUVA 2DE0X 4ZTFA 3AHUA 2B86A 1WXUA 4C5GA 2JVVA 3JCMb 3L1AA 1UFFA 2D0QB 2FG0A 5FRNA 1NZ9A 1BIAA 2V1QA 2XU8A 1D1BA 2DXBA 2HQHA 3CCEA 5CIUA 1PC0A 4JZ4A 3DB4A 1I81A 3DB3A 3CCVA 3M0PA 3FJPA 4A4GA 1Y57A 4Z02A 3H0HA 4RUGA 2V8KA 3G4SQ 2QYZA 1KHCA 4JRQA 5KCHA 3JCMf 4C8QC 2CGHA 3I9QA 1EIFA 4XTZA 2LCLA 3FLGA 4E47A 2QEXQ 1HXDA 5KH6A 4LE9A 1BI1A 5GAMj 1H8KA 2AT1B 3E9FA 1X6GA 1TWBA 4M78D 5AT1B 2YUOA 4D8KA 1YJNT 2BKDN 4HVUA 2CP5A 2ENMA 1R0BG 2JZ2A 5GAOl 2Y4YA 2MOXA 1VQLT 4C92D 2VV5A 2CP0A 2LTOA 3CPFA 4ZGDB 2QDLA 2GBQA 3O5ZA 3EFOA 2KRMA 3A8HB 1X75C 2X4JA 1D0XA 5CKEA 3CCRQ 3S3NA 2M02A 5HKCA 3KBGA 1V76A 3L2QA 3E2UA 1MNEA 2H3EB 3CC7T 1WIEA 1QP2A 2DD4A 5IAYA 2EQJA 1UE9A 4KBMB 4OP0A 4DQ2A 1YITA 2OI3A 4HA8A 1G3WA 1EX4A 4C8QB 2E10A 2K3YA 4C8QE 5GAOq 2VC8A 2NUPA 1SHGA 2HSPA 4LUEA 1YJWT 4F04B 2H3JA 4BACA 2W0ZA 1PSEA 5DM7R 4F7UB 3CMEA 1S72A 1XOVA 1D1AA 2YUPA 1H641 2H8HA 3FIFA 2NUTA 4F7UE 5DLOA 3QWYA 1K9MC 2GTJA 1HK9A 3QYHB 1KQ1A 1VOMA 2JTMA 2R58A 5I21A 5IHKA 2EFIA 4PLIA 4M75D 2DTHA 4J9FA 2W10A 3ASKA 5GAMe 3D7SB 3JV3A 3I56T 1X69A 2K2MA 1YIJT 1N6AA 3TEEA 1ZUYA 3LX7A 1VQOQ 4FW2A 2HSEB 3RIRA 3T9NA 2KSSA 3QBYA 1AWOA 5CCAA 2CUDA 4BI3A 1RAAB 1XNIA 4J9DA 2D1XA 2AKKA 2EYXA 4Z89A 1M3BA 2OTJT 2MPXC 2DL3A 1K0XA 2VWFA 1QCFA 1K9MU 2L3SA 1NPPA 2RHZA 3L2ZA 2MF2A 4XTVA 1V29B 5GAOr 3JCMJ 3VRYA 2FRWA 2GGRA 4LXCA 2O01E 5FRMA 5GANh 1UDLA 1YJNQ 2GTOA 4P5NA 5HY6A 4ATOA 4MDXA 2DMOA 3P8BB 1SEMA 2FYKA 4WF2A 5A0DA 2E3HA 1TS9A 1VQ5Q 4IUQA 3VU3C 4BUGA 2XMFA 2L5QA 5LJ3d 1YJ9T 2VASA 3CD6Q 2QGGA 3CCMT 2BIVA 4PJNA 1BK2A 4ZGJB 3JAME 1NM7A 2PU9B 2LT1A 3CC7Q 1WGSA 4JJDA 1GFCA 3CCUA 1CSKA 4OB2B 5CKFA 4FYYB 4J7FA 4B6MA 1VQ8T 2M9UA 5LJ5h 2L3QA 2DF6A 4WTOB 1OX9A 2PTKA 3VRZA 2M0YA 3OB9A 4F16A 2XK0A 1M1GA 5FU7B 2COWA 5HK3A 3ME9A 3OMCA 1MV0B 2L89A 2R57A 3M0TA 4V2SA 2F5KA 2O4XB 2ZAEA 2ED1A 2DILA 2PVOB 2QXFA 1Q81C 3A8LB 2O9VA 5LJ3j 2QQBA 2RB6A 3QJ6A 1W1FA 3NTHA 5D6XA 3ULRB 3F70A 2D8HA 1NE8A 2K9GA 3EFOB 1TXQA 3CCLA 1K73C 2BE9B 1M9SA 1E6GA 2FEIA 2QQRA 3SHWA 1N5ZA 2RQTA 1VQKT 5GAOn 4JLIA 2C0TA 3RDVA 3CC2T 4N0AA 2NYSA 3CBMA 4R55A 2A28A 1BI2A 2LCSA 4EPCA 1OPLA 5CKDA 2MIOA 2E6ZA 4OVAA 4RTWA 2MWPA 2OX7A 3RNJA 3PGGA 1QLYA 1UGQB 3KFVA 4CI0C 2K5IA 1YIJQ 3CCSA 4RG8A 3QIIA 5EC7A 1Q81U 5GAN6 4CC7A 2RO0A 2NUPB 3CQTA 1BYMA 2FB7A 1W70A 2G6FX 1K73U 2RHUA 4TVRA 3AT1B 1VQMQ 3CC4A 3E9GA 1WQ7A 2DRKA 4FT4A 2KI7A 2GFUA 4AG1C 1VQ6A 1VQ7T 3OBYA 1KK7A 4XTXA 2OAUA 4AFQC 2X35A 1YCSB 3OS0A 2DIGA 2DXUA 4ZN3A 3DKMA 1XTDA 3OYEA 1WHHA 4ZGEB 2BUDA 3NTIA 1BKBA 2E65A 1NJIU 3OW2A 1RAHB 2F2XA 1YJ9Q 1DJ7B 1WHMA 3GPLA 2DLPA 2EPDA 3THKA 3PT9A 2JN0A 1P92A 3ZBDA 1WJRA 2DA9A 5I22A 4C0FA 3QYGB 1M1KR 1SF9A 1MMAA 1AT1B 3L2UA 2VVKA 3CCQA 3M54A 5CQXA 1GRIA 3REBB 3UF4A 1PM3A 2EVRA 4QW2A 5LJ3e 1WHKA 4PJJA 4M7AD 2IG0A 4LN2A 1VQ8Q 1ZA1B 1N27A 3VV0A 1TH7A 2GFAA 2QK0A 1VQPT 2YSQA 4AT1B 3OYAA 2DM1A 3OMGA 4LUDA 1NEGA 2J05A 2KBTA 2M16A 5DY9A 1X2KA 1OEBA 1UB4A 2DL4A 2K4YA 3OYHA 4BE2A 2QG9B 2K5FA 2LQKA 3N5BB 3H0IA 2RK1A 1M2VB 4HCKA 1PRMC 3BFMA 2FHDA 1KD1R 1M90R 1TU0B 3R6NA 1HYOA 5GAMg 1Q82R 1OZ3A 4HXJA 4N0AC 1XJWB 1FXXA
chains in the Genus database with same CATH topology
3SB2A 5GAN4 2HNIA 2EQMA 4HT9A 3JCMQ 3QPHA 1YJWA 5GAMd 2WSFE 2X4YA 5GAN3 3ZFJA 2WACA 2KQWA 2YLCA 5GAMf 5GMKl 1KD1C 3CXCS 1M90C 4IUVA 1M1KU 1VQ9T 4ZTFA 3C94A 2RD1A 4L59A 5C6SA 3CCST 3AHUA 3RERA 4LD9K 3KXTA 4E7KA 4N4GA 4PKCC 4Y28E 1ZQ1A 4C5GA 1B34A 4FL6A 1OZ2A 2JVVA 2FVUA 4M78G 3FRNA 3JCMb 2GQVA 3L1AA 3INZA 2D0QB 2GCXA 3UWNA 3UPUA 4E7IA 4C8QD 5FRNA 1NZ9A 2K3XA 3QHSA 1BIAA 5KE2A 2DXCA 2XU8A 2DXBA 5I2MA 3RMSA 3CC4T 3CCEA 5CIUA 1KQSS 5J39A 4OMFB 4C5HA 2XDBA 3DB4A 2V8JA 1N9RA 1I81A 3SWNA 3DB3A 3CCVA 4C92G 3JCMg 3FJPA 3GIBA 3I55A 4A4GA 3X20B 2XDPA 4DOVA 2QQSA 4Z02A 4ZTJA 2P4TA 2V8KA 3QUIA 1VQ6T 4M7DE 2VXEA 5GMKe 3PNWC 3G6ET 1X01A 1KHCA 3JCMd 4JRQA 5KCHA 3JCMf 4C8QC 3ER0A 2CGHA 4JRKA 5GAOm 1YBYA 3I56A 3E1SA 1EIFA 1YIJA 4XTZA 2XICA 2LCLA 4FT2A 1KD1U 1M90U 3C95A 5GAN2 2QA4T 3FLGA 4J7IA 1Q82U 4DOWA 2QDYB 1I8FA 3UDCA 4E47A 3CPWS 5GANj 4EMGA 1HXDA 1R8OB 3QJYA 2VGMA 1VQMT 5KH6A 5GAN5 2R5AA 3G71A 1WJSA 5CVIA 1I4K1 3BY7A 4M75A 1BI1A 4LD6A 4M75F 3VKIA 5GAMj 3HRSA 2JUFA 2OTJA 3X26B 2QQAA 4C5EA 1W2BA 3E9FA 4M7AE 2D6FA 4BDYA 2V8IA 4M78D 3CBOA 3OYYA 4M77G 1YJNT 2BKDN 3P8DA 2DJZA 3LGLA 4J5YA 3VUZA 2JZ2A 5GAOl 3LLRA 2Y4YA 4C5IA 2Y90A 4F7UA 1VQLT 4F7UF 5CAIA 3V8KA 3JB9I 1VQNA 1KG1A 4C92D 2VV5A 1BI0A 5GAMh 3PFSA 2JOYA 5A0LA 4LDUA 1Y7XA 1G5VA 2LTOA 3CPFA 3JCMc 4ZGDB 3LWIA 1VQ4A 1OI1A 3CCQT 2LDMA 5A0GA 1Y71A 3OYKA 3OYGA 4M78C 2MI6A 2NLUA 5J26A 3A8HB 5KCOA 3HHTB 3OYIA 2KY9A 1X75C 2EKOA 2X4JA 2YHTA 3OYBA 5CKEA 2IVWA 3S3NA 5HKCA 3KBGA 1SSFA 4X9CA 2B8AA 3L2QA 4N4HA 3QXEB 4NL2A 2P0KA 1M5Q1 2ZPFB 2XG8D 1YJ9A 3FEOA 4C92C 3CC7T 3V8JA 2DEQA 1QP2A 2DD4A 5IAYA 3JCMX 3URGA 5GAN7 2EQJA 1LOJA 2R5MA 4KBMB 4OP0A 4M75G 4DQ2A 3CCMA 1U8RA 1K8AC 1YITA 2XHCA 4II1A 2EJFA 4HA8A 2XIDA 4BD3A 1G3WA 4C8QB 4Q5WA 2RH2A 2DKGA 3V7SA 4KUDK 4A4FA 2E10A 1QVFA 1UEBA 2K3YA 3JCMh 2EQUA 4M77D 3CCRA 4IUUA 3A8OB 2VUBA 4C8QE 3DLMA 3CCJT 3M53A 5GANg 5GAOq 3QO3A 5CKBA 4Y91A 4PJOA 1G3SA 2VC8A 4FU6A 1D3BB 4PJOF 1VQ8A 2DZCA 4XQ3A 1YJWT 1JJ2A 3NFCA 5GANd 2HAXA 2H3JA 4NS5A 2CZ1B 5GANf 4BACA 5I2SA 4J83A 5EG2A 1U1SA 2DD5A 2RJCA 4JLGA 1PSEA 5DM7R 2X4WA 3FDRA 3HFNA 4F7UB 3CMEA 1S72A 4DA4A 1XOVA 1H641 2E12A 3S3MA 3OYMA 4FSXA 3FIFA 2E6NA 3MP8A 4F7UE 5DLOA 5DLQE 5D6YA 4FM4B 2RHXA 4QVZA 1K9MC 2K2VA 4CRIA 4IURA 4LDWA 4BI4A 2DO3A 2WSCE 3QDRB 4M77A 1RL2A 1K8AU 3CCET 1HK9A 3QYHB 4M77F 3JB9F 1KQ1A 4BY6B 3SWNC 2JTMA 5FU6B 2DK3A 4RKUE 2R58A 1UGSB 3MEVA 3RKXA 1WNLA 5I21A 2RI5A 5M9OA 2LRQA 5GANe 2EFIA 3HP9A 4OF1A 4PLIA 4M75D 3RKYA 2DTHA 3OYNA 2LVMA 1KHIA 3V7RA 3I55T 3HKSA 4M78B 4KULA 1JBMA 2PUKB 2WSEE 4XU0A 3RKWA 4A4EA 4R56A 3ASKA 5GAMe 1O75A 4M78E 1VQKA 3GF5A 3M4GA 4J6WA 1XQHA 2DVEA 2PQWA 5LJ5g 3LW5E 2CZ6B 2DZ9A 4QQDA 3J81E 3I56T 5GMKi 1YIJT 1Y96A 1N6AA 4PL6A 1MHNA 3TEEA 2DIQA 3WVEB 2A7YA 3CC2A 1WQWA 4HKEA 4C92B 5LJ5d 3LX7A 4HCBA 4MMKA 3RIRA 3T9NA 4PJOG 4B9XA 5LJ5f 2KSSA 1H3ZA 5AYFA 3QBYA 1W2BS 4M7DG 2PVGB 3HPWA 4C92E 3G71T 1W4SA 4M75C 4OGCA 3X28B 2E64A 3EAEA 1VUBA 4MZTA 4BI3A 5CCAA 1XNIA 3EFSA 3P8HA 3CXCA 3OQ5A 2QI2A 4KUIA 4BI8B 2OTJT 3JB9J 3ZEHA 1K9MU 4IKFA 1NJIC 3OW2S 1X6OA 3M4YA 4B9WA 1ZHIA 4J6YA 2AHJB 3EFRA 1NPPA 2K5LA 1JRIA 1YHQA 2RHZA 4LDXA 3L2ZA 2MF2A 4XTVA 1V29B 5GAOr 2L3RA 1YI2A 4EMKA 3G4SA 3JCMJ 2OTLA 2RA2A 1KQSA 2D9TA 3BDUA 3BDLA 4RCCA 5CK9A 3JCMe 3OY9A 1VQOA 1OYXA 1UGRB 2LNVA 1VQNT 3JB9G 2HQXA 4L5GA 4M7AG 2O01E 2XKOC 3TU4K 3QZ9B 1MGQA 2ZPHB 5FRMA 5GANh 2LX9A 1M8VA 1VQ4T 2QEXA 3H6ZA 5CR2A 3QKJA 2O4XA 1B34B 2L8DA 1G3YA 4MZMA 4M77B 4P5NA 1O9SA 3HRUA 5HY6A 3VUBA 3WVDB 1VQ7A 2ZCFB 4ATOA 4MDXA 3M5AA 4BY6C 3P8BB 4O6JA 1FWZA 4O5VA 5FU6C 3CMAA 4E7HA 1ZBXA 1GXIE 2FYKA 4WF2A 1FX7A 2RI3A 5A0DA 5LJ3g 3JCMV 4IUQA 4LDVA 1QVGA 3KUFA 4X9DA 3VU3C 4JS4A 4OB0B 3TREA 3LH0A 3SD4A 4BUGA 4ZN1A 4RMOA 3CPWA 2RI2A 5A2QE 2L5QA 2EYQA 5LJ3d 3SWNB 3L2RA 1YJ9T 4ME7A 4PJOD 4L6V5 1Q86C 2CS7A 5LJ3f 2EAYA 5LJ5j 4M7DD 2RHYA 3E19A 3GLXA 3MO8A 4PLLA 5D6WA 2RM4A 1AHJB 3MP1A 2RK2A 4LDYA 3CCMT 2BIVA 4RG2A 1QVFS 2KAFA 2RHIA 3PIOA 1YITT 2F69A 2A3LA 3OS1A 4ZGJB 3S3OA 3C4SA 3JAME 1N8RC 1QW1A 2Y4XA 3PTAA 2PU9B 4JUVA 2LT1A 4OB3B 1WGSA 3MEWA 3MHXA 3CCRT 3CCUA 2ZPEB 1VQ5A 5HK0A 4OB2B 3BW1A 3A8GB 3CEYA 5CKFA 3RESA 3X24B 4J7FA 5KE3A 4PJOC 3V8LA 3LGFA 2QQ9A 3OYJA 1VQ8T 4M75B 2M9UA 5LJ5h 3JB9D 4MZPA 4A4KA 3JCMW 4N4IA 3H8ZA 5J3BA 4C0DC 3CD6A 2YRVA 3OB9A 4M75E 3HRTA 4J6XA 4M7DA 2LT4A 5LL6S 4XU1A 2XK0A 4M7DF 4XTYA 4A53A 3CMET 1PSFA 1VIEA 1M1GA 2KVQG 3OSVA 3UT1A 1S72T 3HSBA 2MMPA 5FU7B 4A4HA 2XDDA 3TCJA 1Q86U 3JSCA 5HK3A 3ME9A 3OMCA 5CO7A 2L89A 2R57A 3FB9A 1VQPA 4V2SA 2F5KA 4BE1A 2O4XB 3L42A 3WXMB 4KT0E 4M77C 4C0GA 3OYLA 4ELZC 2KDSA 2C06A 2PVOB 2QXFA 1Q81C 1N8RU 4JDSA 4MDWA 2X4XA 3A8LB 3OYCA 2QTXA 1WJQA 2QQBA 2RB6A 4C0ZA 3QJ6A 3NTHA 5D6XA 5LJ3j 2XD0A 3F70A 4QQ6A 1NE8A 4PNOA 3CCLA 1K73C 1M9SA 4M7AA 4XK8E 4M7AF 4OB1B 2QQRA 2G3RA 2ZPBB 3CCVT 1VQKT 5FLXE 3CMAT 4IUPA 4QQGA 2P0PA 5GAOn 2RJEA 2GF7A 4JLIA 4VUBA 3LWHA 2LCCA 1BIBA 2VGNA 3VYGA 2E5QA 3CC2T 3GP8A 3CBPA 3QG1A 4FIBA 4N0AA 1LJOA 1Q82C 1LNXA 3CBMA 4R55A 2DTOA 2PVDB 1BI2A 2KK4A 4EMHA 1M4ZA 2VXFA 4EPCA 3J7AF 2E41A 5LJ3h 4YTLA 5CKDA 4EDUA 2E6ZA 2PUOB 3MCAB 2MWPA 2LC4A 3MP6A 4OVAA 3L2WA 3PGGA 3G7ZA 3SDZA 1UGQB 4CI0C 3R6OA 1VQ9A 2K5IA 2EWNA 3OYDA 3CCSA 4IUTA 4RG8A 4JJNK 3QIIA 1Q7YC 2E70A 3QZ5B 4NL3A 5CKHA 2HD0A 4XU3A 1Q81U 5GAN6 1YHQT 3M56A 2RO0A 4PJOB 4GY5A 4EMKC 1QVPA 1YI2T 3G4ST 4M7DB 2XI9A 2OTLT 1I5LA 4E7LA 2FB7A 1BYMA 1YCYA 5GAN8 3OS2A 1K73U 4PJOE 2RHUA 4TVRA 3RMQA 3CC4A 3OSSC 1VQOT 2JNGA 5FU7C 1N9SA 1U1TA 4C0DB 3M59A 1KC8C 3E9GA 3Q1JA 3META 1WQ7A 2FL7A 1JB0E 4JS5A 4FT4A 2QEXT 3O8VA 1BI3A 2MWOA 3PMTA 2GFUA 5LJ5e 2JTFA 3GNFB 1QVGS 1VQ6A 1VQ7T 5CQYA 2LQ8A 3OBYA 3HFOA 4XTWA 3V7CA 3G6EA 4JRIA 2M0OA 4XTXA 4C8QA 4BE0A 3LYIA 2CKKA 2OAUA 3FC3A 3C12A 4C8QF 2X35A 2DXTA 3SFMA 3OS0A 2QA4A 2DIGA 3A5ZB 2E1HA 3A8MB 4M7AB 3PMIA 2DXUA 2F5TX 4ZN3A 2DAQA 2ZZDA 3DKMA 4M77E 1VQMA 1Q7YU 1XTDA 1IZ6A 1D3BA 3OYEA 3VJPA 1M1FA 4OGEA 3S6WA 4ZGEB 5GMKj 5GAOp 2P0QA 3M57A 4ELYC 2BUDA 3NTIA 4HCZA 2RJFA 4GLKA 1BKBA 2HQEA 2K57A 3L2VA 2E65A 1NJIU 2EJGA 1G3TA 3OW2A 2RJDA 3HL8A 2ZPGB 1Y07A 1Y96B 1DJ7B 1UGPB 3GPLA 5IN1A 3CCUT 1YJNA 1KC8U 1VQ5T 5FROA 3PT9A 2JN0A 1P92A 3ZBDA 1WJRA 3J80E 2EQKA 4JRPA 4XU2A 1VQLA 2VYTA 4HCCA 3M9QA 4C0FA 4QVDA 3QYGB 1RI0A 5GMKh 1JJ2S 2CZ7B 3PIPA 4XTUA 3CD6T 4BB7A 3L2UA 5C0MA 4M7DC 3M55A 3CCQA 4UC4A 3M54A 5CQXA 3OA6A 4BDZA 5LJ3e 4QW2A 3GOXA 4M7AD 2ZGWA 4M78A 2HBPA 2IG0A 3JB9H 4M78F 1N27A 2I2LA 4D6WA 1M1KC 3OBWA 2YLBA 4X34A 1TH7A 2KMTA 3VV0A 2GFAA 4EMKB 4C8QG 1VQPT 4A54A 4RCBA 2CYZB 4XAXB 3OMGA 5L8RE 4MMLA 3VYHB 5GMKm 3OYAA 3JCMP 2DPPB 3DLLA 3GNGA 3CC7A 4HT8A 2EIFA 4C92A 3X25B 4C92F 4J8OA 2M1HA 2M16A 3OYFA 3M58A 3MEAA 5DY9A 2DTIA 1VIFA 1IREB 3NTKA 3RUXA 2ZPIB 3CCLT 4M7AC 1UB4A 3MEUA 3QSUA 2K4YA 3OYHA 4BE2A 3OS5A 2K5FA 2LQKA 2CZ0B 3N5BB 2MAMA 1QP3A 2RK1A 5IT9E 1WPYA 4NOYA 3BFMA 3JRZA 2FHDA 4QVCA 4F7UG 4E7JA 3CCJA 1KQ2A 5GAMg 1OZ3A 2EJ9A 4N0AC 1NPRA 1FXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IAY A;  2L8D A;  2EQJ A;  2R5M A;  2EQM A;  2RO0 A;  4GY5 A;  4E7H A;  2X4Y A;  4E7L A;  2WAC A;  2RI3 A;  3OS2 A;  2RHU A;  4II1 A;  4IUQ A;  4IUV A;  4BD3 A;  4ZTF A;  4Q5W A;  3KUF A;  4L59 A;  5C6S A;  4A4F A;  3LH0 A;  3SD4 A;  2K3Y A;  3E9G A;  3Q1J A;  2EQU A;  2RI2 A;  3MET A;  4E7K A;  4IUU A;  4N4G A;  3DLM A;  3L2R A;  4C5G A;  4FL6 A;  1OZ2 A;  3O8V A;  2MWO A;  2RHY A;  3PMT A;  2GFU A;  2JTF A;  3MO8 A;  4FU6 A;  4PLL A;  5D6W A;  3UWN A;  3MP1 A;  4E7I A;  5FRN A;  2BIV A;  4RG2 A;  2K3X A;  2RHI A;  2M0O A;  4BE0 A;  3LYI A;  5KE2 A;  2CKK A;  4NS5 A;  3OS1 A;  3FC3 A;  3S3O A;  3C4S A;  2X35 A;  5CIU A;  5J39 A;  4C5H A;  4BAC A;  3OS0 A;  2DIG A;  3DB4 A;  2RJC A;  1WGS A;  3DB3 A;  3PMI A;  2X4W A;  3FDR A;  3MEW A;  2DAQ A;  3S3M A;  4A4G A;  3OYM A;  2XDP A;  3CEY A;  2QQS A;  4Z02 A;  3OYE A;  2E6N A;  5KE3 A;  3MP8 A;  3S6W A;  4ZTJ A;  3LGF A;  3OYJ A;  2BUD A;  3NTI A;  3PNW C;  5D6Y A;  4HCZ A;  1KHC A;  2RHX A;  2RJF A;  4QVZ A;  5KCH A;  2HQE A;  4CRI A;  3L2V A;  4IUR A;  4N4I A;  3H8Z A;  2RJD A;  2YRV A;  3OB9 A;  3FLG A;  2R58 A;  2XK0 A;  3MEV A;  5M9O A;  2RI5 A;  5IN1 A;  2LRQ A;  2EFI A;  3UT1 A;  4PLI A;  5FRO A;  3OYN A;  5KH6 A;  2LVM A;  2R5A A;  4A4H A;  1WJS A;  1WJR A;  2EQK A;  3ME9 A;  3OMC A;  4LD6 A;  2L89 A;  2R57 A;  4A4E A;  3ASK A;  2VYT A;  2F5K A;  3M9Q A;  4BE1 A;  4C5E A;  1RI0 A;  2O4X B;  2PQW A;  3L42 A;  4QQD A;  3E9F A;  3OYL A;  4PL6 A;  3L2U A;  1MHN A;  5C0M A;  2DIQ A;  4BDY A;  2X4X A;  3OYC A;  4UC4 A;  1WJQ A;  3OA6 A;  4BDZ A;  3LX7 A;  3NTH A;  3QJ6 A;  5D6X A;  3F70 A;  4QW2 A;  2BKD N;  4QQ6 A;  3P8D A;  4B9X A;  3LGL A;  3GOX A;  2IG0 A;  1H3Z A;  3QBY A;  2JZ2 A;  1N27 A;  3LLR A;  4X34 A;  3EAE A;  4C5I A;  2GFA A;  1XNI A;  3P8H A;  2QQR A;  2G3R A;  3OQ5 A;  4IUP A;  4QQG A;  3OYA A;  3OMG A;  2RJE A;  3ZEH A;  2GF7 A;  4IKF A;  2LCC A;  3PFS A;  2E5Q A;  4B9W A;  2LTO A;  1G5V A;  1OI1 A;  2LDM A;  2M1H A;  2M16 A;  3OYF A;  3OYK A;  3OYG A;  3MEA A;  2RHZ A;  2NLU A;  5J26 A;  5KCO A;  3OYI A;  3NTK A;  2L3R A;  3OYB A;  2EKO A;  3MEU A;  4EDU A;  3OYH A;  3MP6 A;  4OVA A;  2MWP A;  3L2W A;  2D9T A;  3BDL A;  3OY9 A;  4BE2 A;  3S3N A;  1OYX A;  1SSF A;  2B8A A;  3L2Q A;  2HQX A;  4N4H A;  3OYD A;  2P0K A;  4IUT A;  3QII A;  2FHD A;  4E7J A;  5FRM A;  3FEO A;  1OZ3 A;  3H6Z A;  3QKJ A;  2O4X A; 
#chains in the Genus database with same CATH topology
 4HT9 A;  3JCM Q;  2CUB A;  2WSF E;  2X4Y A;  5GAN 3;  4PFP A;  5GMK l;  1VQK Q;  3CXC S;  1VQ9 T;  4L59 A;  5C6S A;  1GFD A;  4LD9 K;  3KXT A;  4N4G A;  1M8M A;  4Y28 E;  2BZ8 A;  3FRN A;  2CP3 A;  2GCX A;  4E7I A;  2K3X A;  1VYU A;  1M2O A;  5KYY A;  2ESW A;  1Q95 G;  1E7O A;  3I55 A;  4KRT A;  4ZTJ A;  2P4T A;  2VXE A;  3G6E T;  2OJ2 A;  3EG2 A;  5HCK A;  4GBQ A;  3JCM d;  1K1Z A;  5IH2 A;  5GAO m;  1ZSG A;  1YBY A;  4DBQ A;  2QA4 T;  2O88 A;  5GAN j;  3EGU A;  2YUN A;  1VA7 A;  2VGM A;  2DL7 A;  1U3O A;  1BU1 A;  2EKH A;  2R5A A;  4PJM A;  2QQA A;  4CC3 A;  1W2B A;  2QGF B;  1WHL A;  4FYV B;  2V8I A;  4M77 G;  1KFZ A;  5FW9 A;  2PZ1 A;  4GLM A;  4F7U A;  4F7U F;  5CAI A;  1VQN A;  1OU9 A;  1BI0 A;  4LDU A;  1G5V A;  4DBR A;  3LWI A;  1OI1 A;  2LDM A;  5J26 A;  3OYI A;  2EW3 A;  3OYB A;  2YHT A;  3EG1 A;  2B8A A;  1AWX A;  3QXE B;  1K8A R;  4PFO A;  4OMQ A;  2RF0 A;  1YNZ A;  3JCM X;  2CSI A;  1U8R A;  1VQP Q;  2XHC A;  7AT1 B;  2HKN A;  2KXC A;  2XID A;  4Q5W A;  3EGD A;  2BTT A;  4KUD K;  1UEB A;  1RAD B;  3CCR A;  1LVK A;  4IUU A;  4PJO A;  4PJO F;  4XQ3 A;  2K3B A;  2YRD A;  2LP5 A;  1JJ2 A;  2HAX A;  2BZY A;  2HMA A;  5GAN f;  3PVL A;  1U1S A;  4ZNX A;  2RJC A;  1YWO A;  2X4W A;  3FDR A;  4J9C A;  3CMA Q;  1IHV A;  2J06 A;  2CH4 W;  5DLQ E;  4FM4 B;  4CRI A;  2E4H A;  1YFN A;  2E3I A;  1PCX A;  3CCE T;  3QDR B;  1RL2 A;  3JB9 F;  5FU6 B;  2DK3 A;  1WNL A;  2LRQ A;  5GAN e;  3HP9 A;  1KHI A;  2L3P A;  1M30 A;  3RKW A;  1H92 A;  4R56 A;  1O75 A;  2CZ6 B;  1TTH B;  1KIK A;  4FW1 A;  1YI2 Q;  1MHN A;  3WVE B;  2DIQ A;  2OTL Q;  1GCP A;  3MJX A;  3OW2 P;  4PJO G;  5LJ5 f;  1W2B S;  4M7D G;  1MV3 A;  3HPW A;  3EAE A;  1VUB A;  4MZT A;  2RQR A;  3EFS A;  4KUI A;  2IPO B;  2QA4 Q;  1X6O A;  3M4Y A;  4B9W A;  4J6Y A;  4A63 B;  3EFR A;  2K5L A;  1YHQ A;  3NMZ C;  1I1J A;  2JS0 A;  1YP5 A;  1KQS A;  3BDL A;  4RCC A;  3OY9 A;  3JCM e;  1RAE B;  1VQO A;  2KNB B;  1OYX A;  1UGR B;  3JB9 G;  4L5G A;  2LJ1 A;  4M7A G;  2LX9 A;  2EYZ A;  1K0S A;  5GJV B;  4M4Z A;  2O4X A;  2L8D A;  3EGX A;  4M77 B;  4E7H A;  4O5V A;  1FWZ A;  1FX7 A;  5LJ3 g;  2C0O A;  2CT3 A;  5KYY B;  3CPW A;  3PE0 A;  1OUL A;  2IIM A;  2LZ6 B;  4K11 A;  3GLX A;  1MMG A;  4PLL A;  5D6W A;  1PKS A;  3MP1 A;  4OMP A;  3VS7 A;  4RG2 A;  2EGA A;  2LQW A;  2F69 A;  1YIT T;  2A3L A;  3C0C A;  2KT1 A;  3NPF A;  3S3O A;  1QW1 A;  2Y4X A;  1QQJ A;  3MEW A;  3MHX A;  2ZPE B;  1VQ5 A;  5HK0 A;  4QKU A;  4PJO C;  5KE3 A;  3V8L A;  8ATC B;  4MZP A;  4N4I A;  3H8Z A;  3CD6 A;  1J3T A;  1QWE A;  2RMO A;  2CP7 A;  3CME T;  1S72 T;  3OSV A;  3HSB A;  5CO7 A;  1TOV A;  4BE1 A;  3L42 A;  1ABO A;  3UA7 A;  3OYL A;  2MYS A;  2AIR B;  2FO0 A;  1Z9Q A;  5GJW B;  4OB1 B;  2LNH B;  3CCE Q;  4J9I A;  4RTX A;  2CRE A;  4VUB A;  1UG1 A;  2LCC A;  1BIB A;  2E5Q A;  4FIB A;  1JXM A;  1W2B P;  1Q82 C;  2EYY A;  1Q7Y R;  4QT7 A;  5IXF A;  4EMH A;  1M4Z A;  4EDU A;  3MP6 A;  2LC4 A;  2NUZ A;  1RUW A;  4IUT A;  3EGD B;  4X1V A;  4NL3 A;  5CKH A;  2HD0 A;  4DEY A;  4KH1 B;  4PJO B;  4GY5 A;  2AZS A;  4M7D B;  1I5L A;  1IXD A;  4PJO E;  3M0S A;  1C1A A;  3OSS C;  2JNG A;  5FU7 C;  1U1T A;  3M59 A;  1KC8 C;  2J7I A;  3MET A;  2FL7 A;  1BI3 A;  3PMT A;  1UUE A;  2JTF A;  9ATC B;  1MUZ A;  3HFO A;  4JRI A;  1G2B A;  2CKK A;  3C12 A;  1KJW A;  3A5Z B;  2KR3 A;  2E5K A;  4M7A B;  1Q86 R;  1IO6 A;  2F5T X;  1VQL Q;  1VQM A;  1M2V A;  1WDX A;  3G1J A;  1M1F A;  2DYB A;  5GMK j;  2K6D A;  3M57 A;  4ELY C;  4HCZ A;  1ZSZ B;  2HQE A;  1N8R R;  2K57 A;  1QMC A;  2EJG A;  1RAI B;  3HL8 A;  1UHC A;  1Y07 A;  3UA6 A;  1JJ2 P;  3REA B;  4ANJ A;  3CCU T;  1KC8 U;  1YIT Q;  4QVD A;  2KGT A;  2DVJ A;  2CZ7 B;  4BB7 A;  5C0M A;  2J6K A;  3M55 A;  3OA6 A;  1WLP B;  4M78 A;  2HBP A;  4M78 F;  3SEM A;  4D6W A;  2YLB A;  4X34 A;  1WXT A;  4XAX B;  3VYH B;  5GMK m;  2DPP B;  3GNG A;  1MND A;  2EIF A;  3EG3 A;  4C92 A;  3CME Q;  1YJW Q;  1S72 Q;  3X25 B;  5IHN A;  4C92 F;  4EIK A;  2M1H A;  3OYF A;  4FYW B;  3MEA A;  4E2F B;  1WA7 A;  2DTI A;  3EGX B;  3QWX X;  3RUX A;  3CCL T;  3MEU A;  1UEC A;  1ZUU A;  1I5O B;  3VS3 A;  2GQI A;  1FMK A;  1KQ2 A;  3CCJ A;  1ACM B;  3A98 A;  2EJ9 A;  2RQU A;  1NPR A;  2HZY A;  2LJ0 A;  5GAN 4;  1OQK A;  1QKW A;  1SSH A;  2FPF A;  1U06 A;  1WYX A;  4AMC A;  2FPD A;  2YLC A;  2JXB A;  1V1C A;  3TVT A;  3CCS T;  1T3L A;  1KQS P;  1HSQ A;  2GNC A;  1ZQ1 A;  2BZX A;  3I56 Q;  2FVU A;  4M78 G;  3NGP A;  2JTE A;  3INZ A;  3UWN A;  5KYX B;  1NG2 A;  1PG5 B;  4C8Q D;  2A37 A;  5FWC A;  1CKB A;  2DXC A;  5KE2 A;  3RMS A;  3CC4 T;  1PD1 A;  4C5H A;  1AVZ C;  2V8J A;  4C92 G;  6AT1 B;  3JCM g;  1SHF A;  3GIB A;  1QCO A;  2OTJ Q;  1MMD A;  3CPW P;  3QUI A;  1VQ6 T;  5GMK e;  3PNW C;  4IIM A;  4JRK A;  3E1S A;  3C95 A;  5GAN 2;  1SRL A;  4J7I A;  2QDY B;  1I8F A;  4JPB W;  3UDC A;  1R8O B;  2DFU A;  2CH4 A;  1A0N B;  3G71 A;  1WJS A;  1I4K 1;  4M75 A;  1UGV A;  4LD6 A;  3LH5 A;  4M75 F;  3M0Q A;  1AOJ A;  2JS2 A;  2JUF A;  2EGC A;  4C5E A;  4KGZ B;  2D6F A;  4BDY A;  1OU8 A;  4FCY A;  2O2O A;  3EG9 A;  3P8D A;  3LGL A;  1BBZ A;  4J5Y A;  2JT4 A;  3LLR A;  4C5I A;  2KRN A;  1ZA2 B;  2RN8 A;  3JB9 I;  1S1N A;  1KG1 A;  1PD0 A;  1C6V X;  5GAM h;  3PFS A;  4JJC A;  3CCM Q;  2KE9 A;  2JOY A;  5A0L A;  1Y7X A;  1VQ4 A;  3CCQ T;  5A0G A;  1M27 C;  1Y71 A;  3OYK A;  4HVW A;  4M78 C;  2MI6 A;  2DET A;  2P84 A;  2M51 A;  2OAW A;  2EKO A;  2FZC B;  2IVW A;  2Z0W A;  4N4H A;  4NL2 A;  1M5Q 1;  2ZPF B;  2XG8 D;  5ECA A;  3FEO A;  4C92 C;  3V8J A;  1SKU B;  2DEQ A;  2ROT A;  1OPK A;  1PWT A;  3URG A;  4Z8A A;  1LOJ A;  1JO8 A;  4M75 G;  1GCQ A;  1D0Z A;  2FRY A;  1H3H A;  4PK4 A;  2LQN A;  2X9H A;  2YRC A;  2RH2 A;  2DKG A;  2EQU A;  2VUB A;  3DLM A;  2KRS A;  5CKB A;  4Y91 A;  3CCL Q;  3NFC A;  4J9B A;  5GAN d;  4NS5 A;  4RTZ A;  1B7T A;  2DJQ A;  5I2S A;  4AFS C;  2DD5 A;  2HKQ B;  3HFN A;  1RAC B;  4DA4 A;  1WI7 A;  2E6N A;  2KYB A;  5D6Y A;  3CC2 Q;  2RHX A;  4QVZ A;  3VS1 A;  4IUR A;  4BI4 A;  3CCS Q;  4M77 A;  5KYN A;  4M77 F;  4BY6 B;  4RKU E;  1UGS B;  1IB8 A;  2RI5 A;  1K9A A;  2LMJ A;  3OYN A;  3I55 T;  2LVM A;  3V7R A;  1AWW A;  4M78 B;  1T3S A;  4XU0 A;  4A4E A;  4M78 E;  5I11 A;  3CMA A;  1XQH A;  2DVE A;  3J81 E;  3LW5 E;  4QQD A;  4PL6 A;  2A7Y A;  2RPN A;  1FYN A;  3TSW A;  4C92 B;  5LJ5 d;  4HCB A;  4B9X A;  1VQ6 Q;  2K7A A;  2PVG B;  4C92 E;  4M75 C;  4OGC A;  3X28 B;  2E64 A;  3P8H A;  2ATC B;  2QI2 A;  3JB9 J;  1VQ7 Q;  4IKF A;  2YDL A;  3OW2 S;  2QAZ A;  4JJB A;  1ZHI A;  2AHJ B;  2L2P A;  2L3R A;  1YI2 A;  3G4S A;  4CC2 A;  2OTL A;  2D9T A;  1K4U S;  1VQN T;  1WX6 A;  2JMA A;  3TU4 K;  2XKO C;  2ZPH B;  2COY A;  1M8V A;  4RTT A;  1JEG A;  2QEX A;  3QKJ A;  3VUB A;  1Z9Z A;  3M5A A;  4O6J A;  5FU6 C;  2ABL A;  3VS4 A;  2RI3 A;  1NLP C;  4LDV A;  1QVG A;  3KUF A;  4X9D A;  4JS4 A;  4OB0 B;  3TRE A;  4RMO A;  3RBB B;  3CCQ Q;  2EYQ A;  3L2R A;  4ME7 A;  3FJ5 A;  4L6V 5;  2DL5 A;  1Q86 C;  5LJ5 j;  2RHY A;  3E19 A;  3MO8 A;  2RM4 A;  1AHJ B;  3VS0 A;  1GCQ C;  2KAF A;  3OS1 A;  1N8R C;  1UTI A;  4E6R A;  3PTA A;  4JUV A;  2COZ A;  2ED0 A;  3EH2 A;  3CCR T;  5IHI A;  3A8G B;  2CP6 A;  3LGF A;  2QQ9 A;  3OYJ A;  4M75 B;  3JCM W;  4A4K A;  2VKN A;  4M75 E;  4J6X A;  4M7D A;  3I5S A;  4M7D F;  2MCN A;  4A53 A;  2X51 A;  1VIE A;  2KVQ G;  3UT1 A;  2MMP A;  1Q81 R;  4A4H A;  2SEM A;  3EG9 B;  2V1R A;  3TCJ A;  2XDD A;  1Q86 U;  3FB9 A;  1K73 R;  3WXM B;  2HL3 A;  4M77 C;  2A36 A;  1QKX A;  4ELZ C;  2KDS A;  2HCK A;  1N8R U;  4JDS A;  3OYC A;  3H0F A;  1AEY A;  1WJQ A;  2RQV A;  1VQ9 Q;  2D8J A;  4QQ6 A;  1HJD A;  2D0N A;  4M7A A;  1QWF A;  2HL5 C;  4M7A F;  3CCV T;  2J6O A;  2HBW A;  1ZLM A;  3LWH A;  1AWJ A;  2VGN A;  2KXD A;  2YXY A;  2EYW A;  2DNU A;  2P4R A;  3QG1 A;  1TG0 A;  1VYV A;  1RLQ C;  1ZSZ A;  1LJO A;  3I55 Q;  3A1P A;  1NEB A;  4FSS A;  2E41 A;  5LJ3 h;  4YTL A;  3MCA B;  2VB6 A;  1JQQ A;  1F1B B;  1UJY A;  3SDZ A;  3R6O A;  2A0F B;  3OYD A;  1NJI R;  4JJN K;  1LCK A;  1X6B A;  3G6E Q;  1X43 A;  1SRM A;  1B3Q A;  1UJ0 A;  3RR6 A;  1YHQ T;  3M56 A;  1QVP A;  5GAN 8;  3OS2 A;  4ORZ A;  1VQO T;  2DER A;  1NYG A;  1JB0 E;  1U5S A;  4JS5 A;  3O8V A;  5LJ5 e;  2CT4 A;  1QVG S;  4OML A;  1GBR A;  2LQ8 A;  5KYW A;  1VQN Q;  4OMN A;  1GL5 A;  3TSZ A;  2E1H A;  3A8M B;  3PMI A;  3I5R A;  4M77 E;  2ZZD A;  1IZ6 A;  1D3B A;  3VJP A;  3S6W A;  2P0Q A;  2RJF A;  4Z88 A;  3L2V A;  1G3T A;  4RTV A;  2RJD A;  1PKT A;  2AKL A;  1UGP B;  1YJN A;  1VQ5 T;  4AFU C;  5FRO A;  1KSW A;  4JRP A;  1VQL A;  2VYT A;  3M9Q A;  1RI0 A;  1JJ2 S;  5KYX A;  3PIP A;  3CD6 T;  1ZBJ A;  4M7D C;  4UC4 A;  8AT1 B;  4BDZ A;  1M1K C;  1QCN A;  2CYZ B;  5L8R E;  1TUC A;  3DLL A;  2QTV A;  3CC7 A;  4HT8 A;  3M0R A;  2DBM A;  4J8O A;  1IRE B;  1ZUK A;  3NTK A;  2EQI A;  2ZPI B;  4M7A C;  3OS5 A;  2CZ0 B;  1QP3 A;  1WPY A;  4NOY A;  4DBF A;  3JRZ A;  1ZSZ C;  3QPH A;  2JM8 A;  1YJW A;  3CCV Q;  2WAC A;  2KQW A;  5GAM f;  1KD1 C;  1M90 C;  1M1K U;  3C94 A;  2RD1 A;  3RER A;  4KGV B;  4E7K A;  4PKC C;  1B34 A;  2DRM A;  4FL6 A;  1OZ2 A;  2GQV A;  3UPU A;  2J6F A;  1CKA A;  1D09 B;  3QHS A;  2JMC A;  2YT6 A;  5I2M A;  1KQS S;  2JW4 A;  5J39 A;  4OMF B;  2XDB A;  1RAF B;  3ZL7 C;  1N9R A;  3SWN A;  4LNP A;  1QVG P;  3BE3 A;  1YHQ Q;  1M3C A;  3X20 B;  3TQ7 P;  2XDP A;  4DOV A;  2QQS A;  4M7D E;  1X01 A;  3ER0 A;  3I56 A;  1Y0M A;  1YIJ A;  2XIC A;  4FT2 A;  1KD1 U;  1M90 U;  1Q82 U;  4DOW A;  1LPL A;  2KEA A;  3CPW S;  1BCO A;  4EMG A;  3QJY A;  1VQM T;  5GAN 5;  2F2V A;  5CVI A;  1IGQ A;  3BY7 A;  3VKI A;  3HRS A;  2OTJ A;  3GBQ A;  3X26 B;  2DBK A;  1IRX A;  4M7A E;  4PFZ A;  1OX8 A;  1G8X A;  3CBO A;  3OYY A;  2DJZ A;  3VUZ A;  1EFN A;  2BE7 D;  2HDA A;  2Y90 A;  3V8K A;  3JCM c;  1SG5 A;  1PNJ A;  1FMV A;  1YN8 A;  3PVQ A;  3OYG A;  2NLU A;  5KCO A;  3HHT B;  2KY9 A;  3VS2 A;  3M0U A;  1SSF A;  4X9C A;  1JXO A;  2P0K A;  2EGE A;  1AZG B;  1HD3 A;  1UHF A;  1YJ9 A;  2O31 A;  2V26 A;  5GAN 7;  2R5M A;  5L23 A;  2RNA A;  4F17 A;  2ROL A;  3CCM A;  2CSQ A;  1K8A C;  1PRL C;  4E7S A;  5KYW B;  4II1 A;  2EJF A;  1K76 A;  4BD3 A;  3V7S A;  2FZG B;  3QDF A;  3MPU B;  4A4F A;  1QVF A;  3JCM h;  4M77 D;  3CCJ T;  3A8O B;  3M53 A;  4E7Z A;  5GAN g;  5KYU A;  2KRO A;  3QO3 A;  1G3S A;  4FU6 A;  1D3B B;  2ECZ A;  1VQ8 A;  1D0Y A;  2DZC A;  4PJL A;  2CZ1 B;  1JU5 C;  3NHN A;  4J83 A;  5EG2 A;  2SRC A;  4JLG A;  4JZ3 A;  2E12 A;  3S3M A;  3OYM A;  1T0J A;  4FSX A;  3MP8 A;  2LX7 A;  4Y92 A;  1T0H A;  2K2V A;  4LDW A;  2DO3 A;  2WSC E;  1K8A U;  1OV3 A;  1TSF A;  3SWN C;  5IXB A;  3MEV A;  3RKX A;  5M9O A;  1E6H A;  4OF1 A;  1BB9 A;  3RKY A;  4J9G A;  2DEU A;  3HKS A;  4KUL A;  1JBM A;  2PUK B;  2WSE E;  1FMW A;  2PNI A;  1VQK A;  3GF5 A;  2DX1 A;  3M4G A;  4J6W A;  5LJ5 g;  2PQW A;  2DZ9 A;  1NYF A;  1MMN A;  5GMK i;  1Y96 A;  1W6X A;  3CC2 A;  1AD5 A;  1WQW A;  4HKE A;  4MMK A;  4KGX B;  1H3Z A;  5AYF A;  2A08 A;  3G71 T;  1W4S A;  3CXC A;  2DYI A;  3OQ5 A;  4BI8 B;  4RTY A;  4RTU A;  4DBH A;  3ZEH A;  1NJI C;  4F14 A;  1JRI A;  4LDX A;  4EMK A;  2RA2 A;  3BDU A;  3VS5 A;  5CK9 A;  2LNV A;  2HQX A;  4FYX B;  3QZ9 B;  2NUT B;  1MGQ A;  2DL8 A;  1VQ4 T;  3H6Z A;  5CR2 A;  1B34 B;  3MKD A;  1G3Y A;  4MZM A;  3WVD B;  1O9S A;  3HRU A;  1VQ7 A;  2ZCF B;  4BY6 C;  1GXI E;  1ZBX A;  1EZZ B;  2MK5 A;  3CCU Q;  3JCM V;  2YUQ A;  3UAT A;  3LH0 A;  3SD4 A;  4ZN1 A;  2RI2 A;  5A2Q E;  3SWN B;  4PJO D;  4ESR A;  2CS7 A;  2NWM A;  5LJ3 f;  2EAY A;  4M7D D;  1RI9 A;  2RK2 A;  4LDY A;  1QVF S;  2RHI A;  3PIO A;  3C4S A;  2X3W D;  3EHQ A;  1AZE A;  4OB3 B;  2CDT A;  2X3X D;  1B07 A;  3BW1 A;  3CEY A;  3RES A;  3X24 B;  4WCI A;  1WFW A;  3VS6 A;  4HVV A;  3JB9 D;  1M3A A;  1WHJ A;  4R0K A;  1WHG A;  5J3B A;  4C0D C;  4OMO A;  2O9S A;  2YRV A;  3HRT A;  3CCJ Q;  2LT4 A;  1OOT A;  4XU1 A;  5LL6 S;  4XTY A;  1D1C A;  1PSF A;  1RLP C;  4IIO A;  2YWW A;  3JSC A;  1K9M R;  1VQP A;  4KT0 E;  4C0G A;  2C06 A;  5D7U A;  2JM9 A;  4MDW A;  2X4X A;  2QTX A;  4C0Z A;  4KH0 B;  2XD0 A;  3H41 A;  4PNO A;  4AG2 C;  1YWP A;  4XK8 E;  2G3R A;  2ZPB B;  3EH1 A;  2EBP A;  5FLX E;  2LJ3 A;  4IUP A;  4QQG A;  2P0P A;  3CMA T;  2RJE A;  2GF7 A;  2F2W A;  1NBE B;  1ABQ A;  3VYG A;  3GP8 A;  3CBP A;  2KYM A;  1RAG B;  2HEQ A;  3CC4 Q;  1LNX A;  2DTO A;  1IHW A;  4CC4 B;  2PVD B;  2KK4 A;  2VXF A;  3J7A F;  3L2W A;  2PUO B;  1ZX6 A;  3G7Z A;  4D8D A;  1VQ9 A;  2K79 A;  1X2Q A;  2EWN A;  2F1L A;  1Q7Y C;  1I0C A;  2E70 A;  3QZ5 B;  1RAB B;  4XU3 A;  1KC8 R;  2JJ9 A;  3G71 Q;  5KYU B;  1WXB A;  4EMK C;  1YI2 T;  3G4S T;  2XI9 A;  2OTL T;  4E7L A;  1R77 A;  1YCY A;  4J9H A;  3RMQ A;  3HTR A;  1N9S A;  4C0D B;  3Q1J A;  2QEX T;  2MWO A;  3GNF B;  5CQY A;  4XTW A;  3V7C A;  3G6E A;  2AK5 A;  4DEX A;  2M0O A;  4C8Q A;  4BE0 A;  3LYI A;  3FC3 A;  4C8Q F;  2DXT A;  3SFM A;  2QA4 A;  1VQ4 Q;  2DAQ A;  1Q7Y U;  1QVF P;  4AFZ C;  4OGE A;  5GAO p;  3IQL A;  4GLK A;  2L0A A;  4OMM A;  2ZPG B;  1Y96 B;  5IN1 A;  2C0I A;  3EHR A;  3U23 A;  3J80 E;  2EQK A;  2I0N A;  4J9E A;  4XU2 A;  4HCC A;  5GMK h;  4XTU A;  1WZO A;  1G83 A;  3GOX A;  2ZGW A;  3JB9 H;  1ARK A;  5FWB A;  2I2L A;  3OBW A;  1PHT A;  2KMT A;  4EMK B;  4C8Q G;  2FPE A;  1SPK A;  1NLO C;  4A54 A;  4RCB A;  1C0M A;  3JCM P;  4MML A;  3EG0 A;  2QAS A;  2CP2 A;  3M58 A;  1VIF A;  1VYT A;  3I35 A;  1GBQ A;  1TUG B;  3QSU A;  2RQW A;  1R0C B;  1X27 A;  1BCM A;  3H9N A;  2MAM A;  5IT9 E;  3CXC P;  1I07 A;  4QVC A;  4E7J A;  4F7U G;  2FZK B;  2KT8 A;  1TUD A;  2AZV A;  1IGU A;  3SB2 A;  2HNI A;  2EQM A;  5GAM d;  3ZFJ A;  4IUV A;  2DE0 X;  4ZTF A;  3AHU A;  2B86 A;  1WXU A;  4C5G A;  2JVV A;  3JCM b;  3L1A A;  1UFF A;  2D0Q B;  2FG0 A;  5FRN A;  1NZ9 A;  1BIA A;  2V1Q A;  2XU8 A;  1D1B A;  2DXB A;  2HQH A;  3CCE A;  5CIU A;  1PC0 A;  4JZ4 A;  3DB4 A;  1I81 A;  3DB3 A;  3CCV A;  3M0P A;  3FJP A;  4A4G A;  1Y57 A;  4Z02 A;  3H0H A;  4RUG A;  2V8K A;  3G4S Q;  2QYZ A;  1KHC A;  4JRQ A;  5KCH A;  3JCM f;  4C8Q C;  2CGH A;  3I9Q A;  1EIF A;  4XTZ A;  2LCL A;  3FLG A;  4E47 A;  2QEX Q;  1HXD A;  5KH6 A;  4LE9 A;  1BI1 A;  5GAM j;  1H8K A;  2AT1 B;  3E9F A;  1X6G A;  1TWB A;  4M78 D;  5AT1 B;  2YUO A;  4D8K A;  1YJN T;  2BKD N;  4HVU A;  2CP5 A;  2ENM A;  1R0B G;  2JZ2 A;  5GAO l;  2Y4Y A;  2MOX A;  1VQL T;  4C92 D;  2VV5 A;  2CP0 A;  2LTO A;  3CPF A;  4ZGD B;  2QDL A;  2GBQ A;  3O5Z A;  3EFO A;  2KRM A;  3A8H B;  1X75 C;  2X4J A;  1D0X A;  5CKE A;  3CCR Q;  3S3N A;  2M02 A;  5HKC A;  3KBG A;  1V76 A;  3L2Q A;  3E2U A;  1MNE A;  2H3E B;  3CC7 T;  1WIE A;  1QP2 A;  2DD4 A;  5IAY A;  2EQJ A;  1UE9 A;  4KBM B;  4OP0 A;  4DQ2 A;  1YIT A;  2OI3 A;  4HA8 A;  1G3W A;  1EX4 A;  4C8Q B;  2E10 A;  2K3Y A;  4C8Q E;  5GAO q;  2VC8 A;  2NUP A;  1SHG A;  2HSP A;  4LUE A;  1YJW T;  4F04 B;  2H3J A;  4BAC A;  2W0Z A;  1PSE A;  5DM7 R;  4F7U B;  3CME A;  1S72 A;  1XOV A;  1D1A A;  2YUP A;  1H64 1;  2H8H A;  3FIF A;  2NUT A;  4F7U E;  5DLO A;  3QWY A;  1K9M C;  2GTJ A;  1HK9 A;  3QYH B;  1KQ1 A;  1VOM A;  2JTM A;  2R58 A;  5I21 A;  5IHK A;  2EFI A;  4PLI A;  4M75 D;  2DTH A;  4J9F A;  2W10 A;  3ASK A;  5GAM e;  3D7S B;  3JV3 A;  3I56 T;  1X69 A;  2K2M A;  1YIJ T;  1N6A A;  3TEE A;  1ZUY A;  3LX7 A;  1VQO Q;  4FW2 A;  2HSE B;  3RIR A;  3T9N A;  2KSS A;  3QBY A;  1AWO A;  5CCA A;  2CUD A;  4BI3 A;  1RAA B;  1XNI A;  4J9D A;  2D1X A;  2AKK A;  2EYX A;  4Z89 A;  1M3B A;  2OTJ T;  2MPX C;  2DL3 A;  1K0X A;  2VWF A;  1QCF A;  1K9M U;  2L3S A;  1NPP A;  2RHZ A;  3L2Z A;  2MF2 A;  4XTV A;  1V29 B;  5GAO r;  3JCM J;  3VRY A;  2FRW A;  2GGR A;  4LXC A;  2O01 E;  5FRM A;  5GAN h;  1UDL A;  1YJN Q;  2GTO A;  4P5N A;  5HY6 A;  4ATO A;  4MDX A;  2DMO A;  3P8B B;  1SEM A;  2FYK A;  4WF2 A;  5A0D A;  2E3H A;  1TS9 A;  1VQ5 Q;  4IUQ A;  3VU3 C;  4BUG A;  2XMF A;  2L5Q A;  5LJ3 d;  1YJ9 T;  2VAS A;  3CD6 Q;  2QGG A;  3CCM T;  2BIV A;  4PJN A;  1BK2 A;  4ZGJ B;  3JAM E;  1NM7 A;  2PU9 B;  2LT1 A;  3CC7 Q;  1WGS A;  4JJD A;  1GFC A;  3CCU A;  1CSK A;  4OB2 B;  5CKF A;  4FYY B;  4J7F A;  4B6M A;  1VQ8 T;  2M9U A;  5LJ5 h;  2L3Q A;  2DF6 A;  4WTO B;  1OX9 A;  2PTK A;  3VRZ A;  2M0Y A;  3OB9 A;  4F16 A;  2XK0 A;  1M1G A;  5FU7 B;  2COW A;  5HK3 A;  3ME9 A;  3OMC A;  1MV0 B;  2L89 A;  2R57 A;  3M0T A;  4V2S A;  2F5K A;  2O4X B;  2ZAE A;  2ED1 A;  2DIL A;  2PVO B;  2QXF A;  1Q81 C;  3A8L B;  2O9V A;  5LJ3 j;  2QQB A;  2RB6 A;  3QJ6 A;  1W1F A;  3NTH A;  5D6X A;  3ULR B;  3F70 A;  2D8H A;  1NE8 A;  2K9G A;  3EFO B;  1TXQ A;  3CCL A;  1K73 C;  2BE9 B;  1M9S A;  1E6G A;  2FEI A;  2QQR A;  3SHW A;  1N5Z A;  2RQT A;  1VQK T;  5GAO n;  4JLI A;  2C0T A;  3RDV A;  3CC2 T;  4N0A A;  2NYS A;  3CBM A;  4R55 A;  2A28 A;  1BI2 A;  2LCS A;  4EPC A;  1OPL A;  5CKD A;  2MIO A;  2E6Z A;  4OVA A;  4RTW A;  2MWP A;  2OX7 A;  3RNJ A;  3PGG A;  1QLY A;  1UGQ B;  3KFV A;  4CI0 C;  2K5I A;  1YIJ Q;  3CCS A;  4RG8 A;  3QII A;  5EC7 A;  1Q81 U;  5GAN 6;  4CC7 A;  2RO0 A;  2NUP B;  3CQT A;  1BYM A;  2FB7 A;  1W70 A;  2G6F X;  1K73 U;  2RHU A;  4TVR A;  3AT1 B;  1VQM Q;  3CC4 A;  3E9G A;  1WQ7 A;  2DRK A;  4FT4 A;  2KI7 A;  2GFU A;  4AG1 C;  1VQ6 A;  1VQ7 T;  3OBY A;  1KK7 A;  4XTX A;  2OAU A;  4AFQ C;  2X35 A;  1YCS B;  3OS0 A;  2DIG A;  2DXU A;  4ZN3 A;  3DKM A;  1XTD A;  3OYE A;  1WHH A;  4ZGE B;  2BUD A;  3NTI A;  1BKB A;  2E65 A;  1NJI U;  3OW2 A;  1RAH B;  2F2X A;  1YJ9 Q;  1DJ7 B;  1WHM A;  3GPL A;  2DLP A;  2EPD A;  3THK A;  3PT9 A;  2JN0 A;  1P92 A;  3ZBD A;  1WJR A;  2DA9 A;  5I22 A;  4C0F A;  3QYG B;  1M1K R;  1SF9 A;  1MMA A;  1AT1 B;  3L2U A;  2VVK A;  3CCQ A;  3M54 A;  5CQX A;  1GRI A;  3REB B;  3UF4 A;  1PM3 A;  2EVR A;  4QW2 A;  5LJ3 e;  1WHK A;  4PJJ A;  4M7A D;  2IG0 A;  4LN2 A;  1VQ8 Q;  1ZA1 B;  1N27 A;  3VV0 A;  1TH7 A;  2GFA A;  2QK0 A;  1VQP T;  2YSQ A;  4AT1 B;  3OYA A;  2DM1 A;  3OMG A;  4LUD A;  1NEG A;  2J05 A;  2KBT A;  2M16 A;  5DY9 A;  1X2K A;  1OEB A;  1UB4 A;  2DL4 A;  2K4Y A;  3OYH A;  4BE2 A;  2QG9 B;  2K5F A;  2LQK A;  3N5B B;  3H0I A;  2RK1 A;  1M2V B;  4HCK A;  1PRM C;  3BFM A;  2FHD A;  1KD1 R;  1M90 R;  1TU0 B;  3R6N A;  1HYO A;  5GAM g;  1Q82 R;  1OZ3 A;  4HXJ A;  4N0A C;  1XJW B;  1FXX A; 
#chains in the Genus database with same CATH homology
 3SB2 A;  5GAN 4;  2HNI A;  2EQM A;  4HT9 A;  3JCM Q;  3QPH A;  1YJW A;  5GAM d;  2WSF E;  2X4Y A;  5GAN 3;  3ZFJ A;  2WAC A;  2KQW A;  2YLC A;  5GAM f;  5GMK l;  1KD1 C;  3CXC S;  1M90 C;  4IUV A;  1M1K U;  1VQ9 T;  4ZTF A;  3C94 A;  2RD1 A;  4L59 A;  5C6S A;  3CCS T;  3AHU A;  3RER A;  4LD9 K;  3KXT A;  4E7K A;  4N4G A;  4PKC C;  4Y28 E;  1ZQ1 A;  4C5G A;  1B34 A;  4FL6 A;  1OZ2 A;  2JVV A;  2FVU A;  4M78 G;  3FRN A;  3JCM b;  2GQV A;  3L1A A;  3INZ A;  2D0Q B;  2GCX A;  3UWN A;  3UPU A;  4E7I A;  4C8Q D;  5FRN A;  1NZ9 A;  2K3X A;  3QHS A;  1BIA A;  5KE2 A;  2DXC A;  2XU8 A;  2DXB A;  5I2M A;  3RMS A;  3CC4 T;  3CCE A;  5CIU A;  1KQS S;  5J39 A;  4OMF B;  4C5H A;  2XDB A;  3DB4 A;  2V8J A;  1N9R A;  1I81 A;  3SWN A;  3DB3 A;  3CCV A;  4C92 G;  3JCM g;  3FJP A;  3GIB A;  3I55 A;  4A4G A;  3X20 B;  2XDP A;  4DOV A;  2QQS A;  4Z02 A;  4ZTJ A;  2P4T A;  2V8K A;  3QUI A;  1VQ6 T;  4M7D E;  2VXE A;  5GMK e;  3PNW C;  3G6E T;  1X01 A;  1KHC A;  3JCM d;  4JRQ A;  5KCH A;  3JCM f;  4C8Q C;  3ER0 A;  2CGH A;  4JRK A;  5GAO m;  1YBY A;  3I56 A;  3E1S A;  1EIF A;  1YIJ A;  4XTZ A;  2XIC A;  2LCL A;  4FT2 A;  1KD1 U;  1M90 U;  3C95 A;  5GAN 2;  2QA4 T;  3FLG A;  4J7I A;  1Q82 U;  4DOW A;  2QDY B;  1I8F A;  3UDC A;  4E47 A;  3CPW S;  5GAN j;  4EMG A;  1HXD A;  1R8O B;  3QJY A;  2VGM A;  1VQM T;  5KH6 A;  5GAN 5;  2R5A A;  3G71 A;  1WJS A;  5CVI A;  1I4K 1;  3BY7 A;  4M75 A;  1BI1 A;  4LD6 A;  4M75 F;  3VKI A;  5GAM j;  3HRS A;  2JUF A;  2OTJ A;  3X26 B;  2QQA A;  4C5E A;  1W2B A;  3E9F A;  4M7A E;  2D6F A;  4BDY A;  2V8I A;  4M78 D;  3CBO A;  3OYY A;  4M77 G;  1YJN T;  2BKD N;  3P8D A;  2DJZ A;  3LGL A;  4J5Y A;  3VUZ A;  2JZ2 A;  5GAO l;  3LLR A;  2Y4Y A;  4C5I A;  2Y90 A;  4F7U A;  1VQL T;  4F7U F;  5CAI A;  3V8K A;  3JB9 I;  1VQN A;  1KG1 A;  4C92 D;  2VV5 A;  1BI0 A;  5GAM h;  3PFS A;  2JOY A;  5A0L A;  4LDU A;  1Y7X A;  1G5V A;  2LTO A;  3CPF A;  3JCM c;  4ZGD B;  3LWI A;  1VQ4 A;  1OI1 A;  3CCQ T;  2LDM A;  5A0G A;  1Y71 A;  3OYK A;  3OYG A;  4M78 C;  2MI6 A;  2NLU A;  5J26 A;  3A8H B;  5KCO A;  3HHT B;  3OYI A;  2KY9 A;  1X75 C;  2EKO A;  2X4J A;  2YHT A;  3OYB A;  5CKE A;  2IVW A;  3S3N A;  5HKC A;  3KBG A;  1SSF A;  4X9C A;  2B8A A;  3L2Q A;  4N4H A;  3QXE B;  4NL2 A;  2P0K A;  1M5Q 1;  2ZPF B;  2XG8 D;  1YJ9 A;  3FEO A;  4C92 C;  3CC7 T;  3V8J A;  2DEQ A;  1QP2 A;  2DD4 A;  5IAY A;  3JCM X;  3URG A;  5GAN 7;  2EQJ A;  1LOJ A;  2R5M A;  4KBM B;  4OP0 A;  4M75 G;  4DQ2 A;  3CCM A;  1U8R A;  1K8A C;  1YIT A;  2XHC A;  4II1 A;  2EJF A;  4HA8 A;  2XID A;  4BD3 A;  1G3W A;  4C8Q B;  4Q5W A;  2RH2 A;  2DKG A;  3V7S A;  4KUD K;  4A4F A;  2E10 A;  1QVF A;  1UEB A;  2K3Y A;  3JCM h;  2EQU A;  4M77 D;  3CCR A;  4IUU A;  3A8O B;  2VUB A;  4C8Q E;  3DLM A;  3CCJ T;  3M53 A;  5GAN g;  5GAO q;  3QO3 A;  5CKB A;  4Y91 A;  4PJO A;  1G3S A;  2VC8 A;  4FU6 A;  1D3B B;  4PJO F;  1VQ8 A;  2DZC A;  4XQ3 A;  1YJW T;  1JJ2 A;  3NFC A;  5GAN d;  2HAX A;  2H3J A;  4NS5 A;  2CZ1 B;  5GAN f;  4BAC A;  5I2S A;  4J83 A;  5EG2 A;  1U1S A;  2DD5 A;  2RJC A;  4JLG A;  1PSE A;  5DM7 R;  2X4W A;  3FDR A;  3HFN A;  4F7U B;  3CME A;  1S72 A;  4DA4 A;  1XOV A;  1H64 1;  2E12 A;  3S3M A;  3OYM A;  4FSX A;  3FIF A;  2E6N A;  3MP8 A;  4F7U E;  5DLO A;  5DLQ E;  5D6Y A;  4FM4 B;  2RHX A;  4QVZ A;  1K9M C;  2K2V A;  4CRI A;  4IUR A;  4LDW A;  4BI4 A;  2DO3 A;  2WSC E;  3QDR B;  4M77 A;  1RL2 A;  1K8A U;  3CCE T;  1HK9 A;  3QYH B;  4M77 F;  3JB9 F;  1KQ1 A;  4BY6 B;  3SWN C;  2JTM A;  5FU6 B;  2DK3 A;  4RKU E;  2R58 A;  1UGS B;  3MEV A;  3RKX A;  1WNL A;  5I21 A;  2RI5 A;  5M9O A;  2LRQ A;  5GAN e;  2EFI A;  3HP9 A;  4OF1 A;  4PLI A;  4M75 D;  3RKY A;  2DTH A;  3OYN A;  2LVM A;  1KHI A;  3V7R A;  3I55 T;  3HKS A;  4M78 B;  4KUL A;  1JBM A;  2PUK B;  2WSE E;  4XU0 A;  3RKW A;  4A4E A;  4R56 A;  3ASK A;  5GAM e;  1O75 A;  4M78 E;  1VQK A;  3GF5 A;  3M4G A;  4J6W A;  1XQH A;  2DVE A;  2PQW A;  5LJ5 g;  3LW5 E;  2CZ6 B;  2DZ9 A;  4QQD A;  3J81 E;  3I56 T;  5GMK i;  1YIJ T;  1Y96 A;  1N6A A;  4PL6 A;  1MHN A;  3TEE A;  2DIQ A;  3WVE B;  2A7Y A;  3CC2 A;  1WQW A;  4HKE A;  4C92 B;  5LJ5 d;  3LX7 A;  4HCB A;  4MMK A;  3RIR A;  3T9N A;  4PJO G;  4B9X A;  5LJ5 f;  2KSS A;  1H3Z A;  5AYF A;  3QBY A;  1W2B S;  4M7D G;  2PVG B;  3HPW A;  4C92 E;  3G71 T;  1W4S A;  4M75 C;  4OGC A;  3X28 B;  2E64 A;  3EAE A;  1VUB A;  4MZT A;  4BI3 A;  5CCA A;  1XNI A;  3EFS A;  3P8H A;  3CXC A;  3OQ5 A;  2QI2 A;  4KUI A;  4BI8 B;  2OTJ T;  3JB9 J;  3ZEH A;  1K9M U;  4IKF A;  1NJI C;  3OW2 S;  1X6O A;  3M4Y A;  4B9W A;  1ZHI A;  4J6Y A;  2AHJ B;  3EFR A;  1NPP A;  2K5L A;  1JRI A;  1YHQ A;  2RHZ A;  4LDX A;  3L2Z A;  2MF2 A;  4XTV A;  1V29 B;  5GAO r;  2L3R A;  1YI2 A;  4EMK A;  3G4S A;  3JCM J;  2OTL A;  2RA2 A;  1KQS A;  2D9T A;  3BDU A;  3BDL A;  4RCC A;  5CK9 A;  3JCM e;  3OY9 A;  1VQO A;  1OYX A;  1UGR B;  2LNV A;  1VQN T;  3JB9 G;  2HQX A;  4L5G A;  4M7A G;  2O01 E;  2XKO C;  3TU4 K;  3QZ9 B;  1MGQ A;  2ZPH B;  5FRM A;  5GAN h;  2LX9 A;  1M8V A;  1VQ4 T;  2QEX A;  3H6Z A;  5CR2 A;  3QKJ A;  2O4X A;  1B34 B;  2L8D A;  1G3Y A;  4MZM A;  4M77 B;  4P5N A;  1O9S A;  3HRU A;  5HY6 A;  3VUB A;  3WVD B;  1VQ7 A;  2ZCF B;  4ATO A;  4MDX A;  3M5A A;  4BY6 C;  3P8B B;  4O6J A;  1FWZ A;  4O5V A;  5FU6 C;  3CMA A;  4E7H A;  1ZBX A;  1GXI E;  2FYK A;  4WF2 A;  1FX7 A;  2RI3 A;  5A0D A;  5LJ3 g;  3JCM V;  4IUQ A;  4LDV A;  1QVG A;  3KUF A;  4X9D A;  3VU3 C;  4JS4 A;  4OB0 B;  3TRE A;  3LH0 A;  3SD4 A;  4BUG A;  4ZN1 A;  4RMO A;  3CPW A;  2RI2 A;  5A2Q E;  2L5Q A;  2EYQ A;  5LJ3 d;  3SWN B;  3L2R A;  1YJ9 T;  4ME7 A;  4PJO D;  4L6V 5;  1Q86 C;  2CS7 A;  5LJ3 f;  2EAY A;  5LJ5 j;  4M7D D;  2RHY A;  3E19 A;  3GLX A;  3MO8 A;  4PLL A;  5D6W A;  2RM4 A;  1AHJ B;  3MP1 A;  2RK2 A;  4LDY A;  3CCM T;  2BIV A;  4RG2 A;  1QVF S;  2KAF A;  2RHI A;  3PIO A;  1YIT T;  2F69 A;  2A3L A;  3OS1 A;  4ZGJ B;  3S3O A;  3C4S A;  3JAM E;  1N8R C;  1QW1 A;  2Y4X A;  3PTA A;  2PU9 B;  4JUV A;  2LT1 A;  4OB3 B;  1WGS A;  3MEW A;  3MHX A;  3CCR T;  3CCU A;  2ZPE B;  1VQ5 A;  5HK0 A;  4OB2 B;  3BW1 A;  3A8G B;  3CEY A;  5CKF A;  3RES A;  3X24 B;  4J7F A;  5KE3 A;  4PJO C;  3V8L A;  3LGF A;  2QQ9 A;  3OYJ A;  1VQ8 T;  4M75 B;  2M9U A;  5LJ5 h;  3JB9 D;  4MZP A;  4A4K A;  3JCM W;  4N4I A;  3H8Z A;  5J3B A;  4C0D C;  3CD6 A;  2YRV A;  3OB9 A;  4M75 E;  3HRT A;  4J6X A;  4M7D A;  2LT4 A;  5LL6 S;  4XU1 A;  2XK0 A;  4M7D F;  4XTY A;  4A53 A;  3CME T;  1PSF A;  1VIE A;  1M1G A;  2KVQ G;  3OSV A;  3UT1 A;  1S72 T;  3HSB A;  2MMP A;  5FU7 B;  4A4H A;  2XDD A;  3TCJ A;  1Q86 U;  3JSC A;  5HK3 A;  3ME9 A;  3OMC A;  5CO7 A;  2L89 A;  2R57 A;  3FB9 A;  1VQP A;  4V2S A;  2F5K A;  4BE1 A;  2O4X B;  3L42 A;  3WXM B;  4KT0 E;  4M77 C;  4C0G A;  3OYL A;  4ELZ C;  2KDS A;  2C06 A;  2PVO B;  2QXF A;  1Q81 C;  1N8R U;  4JDS A;  4MDW A;  2X4X A;  3A8L B;  3OYC A;  2QTX A;  1WJQ A;  2QQB A;  2RB6 A;  4C0Z A;  3QJ6 A;  3NTH A;  5D6X A;  5LJ3 j;  2XD0 A;  3F70 A;  4QQ6 A;  1NE8 A;  4PNO A;  3CCL A;  1K73 C;  1M9S A;  4M7A A;  4XK8 E;  4M7A F;  4OB1 B;  2QQR A;  2G3R A;  2ZPB B;  3CCV T;  1VQK T;  5FLX E;  3CMA T;  4IUP A;  4QQG A;  2P0P A;  5GAO n;  2RJE A;  2GF7 A;  4JLI A;  4VUB A;  3LWH A;  2LCC A;  1BIB A;  2VGN A;  3VYG A;  2E5Q A;  3CC2 T;  3GP8 A;  3CBP A;  3QG1 A;  4FIB A;  4N0A A;  1LJO A;  1Q82 C;  1LNX A;  3CBM A;  4R55 A;  2DTO A;  2PVD B;  1BI2 A;  2KK4 A;  4EMH A;  1M4Z A;  2VXF A;  4EPC A;  3J7A F;  2E41 A;  5LJ3 h;  4YTL A;  5CKD A;  4EDU A;  2E6Z A;  2PUO B;  3MCA B;  2MWP A;  2LC4 A;  3MP6 A;  4OVA A;  3L2W A;  3PGG A;  3G7Z A;  3SDZ A;  1UGQ B;  4CI0 C;  3R6O A;  1VQ9 A;  2K5I A;  2EWN A;  3OYD A;  3CCS A;  4IUT A;  4RG8 A;  4JJN K;  3QII A;  1Q7Y C;  2E70 A;  3QZ5 B;  4NL3 A;  5CKH A;  2HD0 A;  4XU3 A;  1Q81 U;  5GAN 6;  1YHQ T;  3M56 A;  2RO0 A;  4PJO B;  4GY5 A;  4EMK C;  1QVP A;  1YI2 T;  3G4S T;  4M7D B;  2XI9 A;  2OTL T;  1I5L A;  4E7L A;  2FB7 A;  1BYM A;  1YCY A;  5GAN 8;  3OS2 A;  1K73 U;  4PJO E;  2RHU A;  4TVR A;  3RMQ A;  3CC4 A;  3OSS C;  1VQO T;  2JNG A;  5FU7 C;  1N9S A;  1U1T A;  4C0D B;  3M59 A;  1KC8 C;  3E9G A;  3Q1J A;  3MET A;  1WQ7 A;  2FL7 A;  1JB0 E;  4JS5 A;  4FT4 A;  2QEX T;  3O8V A;  1BI3 A;  2MWO A;  3PMT A;  2GFU A;  5LJ5 e;  2JTF A;  3GNF B;  1QVG S;  1VQ6 A;  1VQ7 T;  5CQY A;  2LQ8 A;  3OBY A;  3HFO A;  4XTW A;  3V7C A;  3G6E A;  4JRI A;  2M0O A;  4XTX A;  4C8Q A;  4BE0 A;  3LYI A;  2CKK A;  2OAU A;  3FC3 A;  3C12 A;  4C8Q F;  2X35 A;  2DXT A;  3SFM A;  3OS0 A;  2QA4 A;  2DIG A;  3A5Z B;  2E1H A;  3A8M B;  4M7A B;  3PMI A;  2DXU A;  2F5T X;  4ZN3 A;  2DAQ A;  2ZZD A;  3DKM A;  4M77 E;  1VQM A;  1Q7Y U;  1XTD A;  1IZ6 A;  1D3B A;  3OYE A;  3VJP A;  1M1F A;  4OGE A;  3S6W A;  4ZGE B;  5GMK j;  5GAO p;  2P0Q A;  3M57 A;  4ELY C;  2BUD A;  3NTI A;  4HCZ A;  2RJF A;  4GLK A;  1BKB A;  2HQE A;  2K57 A;  3L2V A;  2E65 A;  1NJI U;  2EJG A;  1G3T A;  3OW2 A;  2RJD A;  3HL8 A;  2ZPG B;  1Y07 A;  1Y96 B;  1DJ7 B;  1UGP B;  3GPL A;  5IN1 A;  3CCU T;  1YJN A;  1KC8 U;  1VQ5 T;  5FRO A;  3PT9 A;  2JN0 A;  1P92 A;  3ZBD A;  1WJR A;  3J80 E;  2EQK A;  4JRP A;  4XU2 A;  1VQL A;  2VYT A;  4HCC A;  3M9Q A;  4C0F A;  4QVD A;  3QYG B;  1RI0 A;  5GMK h;  1JJ2 S;  2CZ7 B;  3PIP A;  4XTU A;  3CD6 T;  4BB7 A;  3L2U A;  5C0M A;  4M7D C;  3M55 A;  3CCQ A;  4UC4 A;  3M54 A;  5CQX A;  3OA6 A;  4BDZ A;  5LJ3 e;  4QW2 A;  3GOX A;  4M7A D;  2ZGW A;  4M78 A;  2HBP A;  2IG0 A;  3JB9 H;  4M78 F;  1N27 A;  2I2L A;  4D6W A;  1M1K C;  3OBW A;  2YLB A;  4X34 A;  1TH7 A;  2KMT A;  3VV0 A;  2GFA A;  4EMK B;  4C8Q G;  1VQP T;  4A54 A;  4RCB A;  2CYZ B;  4XAX B;  3OMG A;  5L8R E;  4MML A;  3VYH B;  5GMK m;  3OYA A;  3JCM P;  2DPP B;  3DLL A;  3GNG A;  3CC7 A;  4HT8 A;  2EIF A;  4C92 A;  3X25 B;  4C92 F;  4J8O A;  2M1H A;  2M16 A;  3OYF A;  3M58 A;  3MEA A;  5DY9 A;  2DTI A;  1VIF A;  1IRE B;  3NTK A;  3RUX A;  2ZPI B;  3CCL T;  4M7A C;  1UB4 A;  3MEU A;  3QSU A;  2K4Y A;  3OYH A;  4BE2 A;  3OS5 A;  2K5F A;  2LQK A;  2CZ0 B;  3N5B B;  2MAM A;  1QP3 A;  2RK1 A;  5IT9 E;  1WPY A;  4NOY A;  3BFM A;  3JRZ A;  2FHD A;  4QVC A;  4F7U G;  4E7J A;  3CCJ A;  1KQ2 A;  5GAM g;  1OZ3 A;  2EJ9 A;  4N0A C;  1NPR A;  1FXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...