3H8ZA

The crystal structure of the tudor domains from fxr2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
123
structure length
112
Chain Sequence
b'AYFQGLPVEVRGSNGAFYKGFVKDVHEDSVTIFFENNWQSERQIPFGDVRLPPPAEITEGDEVEVYSRAEPCGWWLARVRMMKGDFYVIEYAACNEIVTLERLRPVNPNPLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fragile X mental retardation syndrome-related protein 2
publication title Structural Studies of the Tandem Tudor Domains of Fragile X Mental Retardation Related Proteins FXR1 and FXR2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 22
structure length 112
sequence length 123
ec nomenclature
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05641 Agenet Agenet domain
A PF18336 Tudor_FRX1 Fragile X mental retardation Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3h8zA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3h8zA01
2QQRA 1MHNA 4IUUA 4E7IA 4BACA 2PQWA 3DB4A 3OYEA 5D6WA 3QJ6A 3OQ5A 2X4WA 3UT1A 1WGSA 2R5AA 3DB3A 4NS5A 3ASKA 2O4XB 4N4HA 3O8VA 2X4XA 4E7JA 4A4HA 3UWNA 1N27A 1OYXA 2FHDA 3LH0A 4L59A 2RJDA 1G5VA 2EQUA 3MP8A 3OYAA 2RI5A 3BDLA 3FEOA 4PLLA 3FLGA 1SSFA 3FC3A 3ZEHA 4BDZA 1H3ZA 2M16A 3L42A 5FRNA 4FU6A 4IUPA 4QQGA 4QQ6A 2CKKA 4II1A 2RJEA 2G3RA 5CIUA 2RHXA 3OMGA 5M9OA 2JZ2A 3L2QA 3PMIA 2HQXA 2RJCA 2L8DA 3MEAA 3MP1A 2LDMA 3MP6A 2L89A 4Q5WA 2P0KA 4B9WA 3H8ZA 4QVZA 3OB9A 2NLUA 3ME9A 2DAQA 2GFAA 3NTHA 5KE3A 2LTOA 4LD6A 2QQSA 4C5IA 4EDUA 5C6SA 4PLIA 3LGLA 3S3OA 3CEYA 5FROA 5KCHA 4RG2A 3F70A 1WJSA 2EKOA 2BUDA 2EQJA 3LYIA 2RHZA 2X4YA 3MEUA 4BD3A 4B9XA 3GOXA 2R5MA 3Q1JA 3L2UA 2XDPA 4C5EA 4A4FA 3OYKA 1RI0A 5D6XA 4C5GA 4HCZA 2RI2A 4E7LA 4N4IA 4A4GA 3OYIA 3NTKA 2HQEA 4BE2A 5FRMA 5KE2A 5KCOA 2LRQA 4IUVA 4BE1A 1WJRA 2MWOA 2DIQA 4FL6A 2O4XA 2RHIA 3C4SA 4PL6A 3QBYA 3OA6A 1XNIA 2D9TA 2M0OA 3EAEA 5J39A 3OS0A 3PMTA 3MEWA 3OYBA 3L2WA 2GFUA 2BIVA 3NTIA 3OYMA 3P8DA 3L2RA 3OYGA 2BKDN 2RHYA 2B8AA 2XK0A 3S6WA 2RHUA 4ZTFA 5IN1A 3OYJA 2DIGA 2K3XA 3PFSA 5IAYA 1WJQA 3OYNA 2RI3A 4CRIA 1OZ2A 3OY9A 3OYFA 4N4GA 3OS1A 2F5KA 4QW2A 3KUFA 4IKFA 3LGFA 4UC4A 3S3MA 2VYTA 5C0MA 2E6NA 2X35A 4QQDA 3SD4A 3OS2A 2WACA 3PNWC 2M1HA 3OMCA 1OZ3A 2MWPA 5D6YA 3E9FA 4A4EA 2IG0A 3OYDA 3LX7A 4OVAA 3OYLA 3FDRA 4ZTJA 2GF7A 2E5QA 1KHCA 4IUTA 3OYCA 3E9GA 3QIIA 4X34A 4E7HA 1OI1A 5J26A 2LCCA 2EFIA 2L3RA 2R58A 3MO8A 2EQKA 3LLRA 3P8HA 3L2VA 3DLMA 3QKJA 4C5HA 4E7KA 2K3YA 2YRVA 2R57A 3H6ZA 4BDYA 4BE0A 3META 4GY5A 2RO0A 3OYHA 5KH6A 3S3NA 4IUQA 4Z02A 2RJFA 3M9QA 4IURA 2LVMA 3MEVA 2JTFA 2EQMA
chains in the Genus database with same CATH superfamily
2QQRA 5FLXE 1M2VB 3HRUA 2IIMA 4FCYA 5D6WA 1Q82R 2WSEE 1WZOA 2FYKA 1F1BB 1NBEB 1AWWA 3GF5A 3CC7T 2D1XA 1M1KC 1Y57A 1ZUYA 2E10A 2K3BA 2C0TA 2P4TA 2EJGA 5M9OA 2E3IA 1SSHA 3JCMc 5KYNA 1VQ8A 1KQ2A 3RR6A 2KXCA 4Q5WA 2L89A 3URGA 3MHXA 2P4RA 3V7SA 2DAQA 1Q7YR 4CC3A 2YXYA 1WXUA 2KR3A 4PLIA 2CP7A 3I56T 3EHQA 4RCBA 1VQLT 3WVDB 2JNGA 2PVGB 1RI0A 2DL8A 2K2MA 1E6GA 5LJ3h 2YSQA 3RKXA 1EX4A 3OA6A 1WHJA 4JZ3A 3CC7A 4CC7A 2QA4T 3EG9B 1JJ2P 2QQAA 3OYBA 2DD5A 2LQ8A 4FW1A 2QYZA 3OYGA 1GBRA 3VU3C 1VQ9A 2F69A 3SFMA 2KRMA 1W2BS 4EMKC 1AOJA 3VKIA 1GXIE 2YLCA 4C0FA 3CXCP 2EYXA 1D3BB 3M57A 1VIEA 2FL7A 1UTIA 4MZTA 4ZGDB 2MWPA 3VYGA 3QIIA 5ECAA 4LXCA 4HCCA 1KC8C 1VQLA 3WVEB 4D8DA 1G83A 2CREA 2L3QA 1N6AA 2K3YA 1ACMB 1ZSZA 2DF6A 2CH4W 3OYHA 2ZZDA 5CVIA 2CP2A 2F2WA 1YP5A 3SEMA 2CP0A 4QKUA 4XU0A 3DB4A 3QJ6A 4HKEA 3OQ5A 1WGSA 1M27C 3RIRA 2LJ3A 1K9MR 1VQNQ 1FMVA 1BIBA 2O31A 1PKSA 4F7UE 5I2MA 2FRYA 1VQ6Q 2X9HA 5GMKl 3PMIA 2FPEA 3G71Q 2MF2A 1M1FA 4EMGA 2QDLA 3X25B 1H92A 2AT1B 4OMPA 1M5Q1 1KK7A 5FU7C 5GAMd 3ME9A 5GJVB 5C6SA 1FWZA 3INZA 5GAN4 1K8AR 1KQ1A 2YHTA 2KMTA 2LQNA 5CAIA 1YI2T 5IH2A 4E7LA 2RM4A 4HXJA 3RBBB 2NWMA 3D7SB 4FL6A 4PL6A 3CCST 2GBQA 1Q81R 5CKEA 3JCMP 1MMAA 5GAMg 4RTWA 1BI3A 3OYJA 4DA4A 1HSQA 4RTVA 2EGEA 1M2OA 4CC2A 2DBKA 2O9VA 4OMNA 4MZPA 1WI7A 1D1BA 4A4EA 2DZ9A 1C6VX 2DYBA 4R55A 1RAGB 2K6DA 1NJIR 3JB9H 2QASA 1JJ2A 1OQKA 4M7AG 5LJ3g 2VWFA 2XI9A 2OJ2A 3EFSA 4C0ZA 1YI2A 3CCMT 5GJWB 3UPUA 3CD6T 3CCET 3S3NA 3EFRA 1JU5C 1ZLMA 4E7ZA 2MMPA 1UE9A 1DJ7B 3HRSA 5CO7A 3JCMW 2NUPB 2DXCA 2BZYA 3CCSA 3V8JA 2RNAA 2R5AA 1RL2A 5GAN6 4PJOD 2L5QA 4C92C 4M7AB 5GAOp 1K73R 3MCAB 1KD1C 3RKWA 3UA7A 3VS2A 2LZ6B 1VQPT 1QP2A 2HKQB 1VQ8Q 4XU3A 1VQ5A 5GAN2 4FSSA 1VQOT 1B34B 3QG1A 4M77C 3CCMA 2GFAA 1M1GA 2ROTA 2QQSA 2BZXA 4RG2A 3F70A 2A3LA 2EKOA 3CCEA 2DL7A 2X4YA 2ZAEA 1YIJT 2VGNA 2CT3A 1WX6A 2IPOB 2EGAA 2HCKA 4J9FA 4PJNA 2RI2A 1QCFA 3FRNA 4FM4B 5CR2A 2DIQA 4M75G 2RHIA 1HXDA 2FG0A 1XNIA 3L1AA 1OEBA 1RLQC 3PMTA 1AHJB 3C94A 2FRWA 3CCJT 2X3XD 3EH2A 5LJ5e 5IHKA 2JM8A 3LW5E 3L2RA 1X01A 4CI0C 2FZCB 2ZPBB 2DO3A 1VQ4A 4F7UA 1VQPA 4C0DB 3KUFA 2QGGA 4J83A 1JO8A 1J3TA 2QI2A 1Q86R 1VQOA 1GL5A 2VC8A 1OZ3A 3REBB 1BI1A 2CDTA 4M75B 2KEAA 4DBRA 4J9DA 1M8MA 3I56Q 1YIJA 2CYZB 4BY6B 2LCCA 1UJ0A 1HK9A 2DFUA 2O2OA 3JRZA 4JZ4A 1D09B 2L2PA 4ANJA 3H41A 2QA4Q 2KSSA 2BIVA 3CCJA 3V8LA 4IUUA 4M78D 1N8RR 4AFUC 4MDWA 4E7SA 3RDVA 2O4XB 7AT1B 3CCRA 1YCYA 2GQIA 3LH0A 2WSFE 2VXFA 5LJ5f 2HSEB 2XICA 4M78A 1R8OB 2CT4A 1K0XA 4QQGA 2RHXA 1V1CA 3VS1A 3OSSC 2JZ2A 4RCCA 3G4SA 2L8DA 3G7ZA 4AFSC 2QQBA 2YUPA 5LJ3e 1KQSP 4NL3A 4EDUA 4FYXB 1OULA 2OTLT 5CQXA 1RAIB 1U1SA 1MGQA 1TXQA 3Q1JA 4E47A 1IHVA 2D0NA 1NZ9A 1B07A 1T3LA 4D6WA 3H9NA 4ZGEB 2J6FA 2HEQA 2DL3A 3PTAA 1W6XA 1I5LA 2ZPFB 1KHIA 3JCMg 3M0UA 2JVVA 1JJ2S 3OYFA 3TSZA 4EMKB 4PJLA 1G8XA 4A63B 2MAMA 1KC8R 1ZSGA 1UDLA 2OTLA 1TH7A 4DBQA 4FT4A 1K76A 2PTKA 2VXEA 3H0FA 3PT9A 5J26A 5LJ3f 1UGQB 1QMCA 3L2VA 2V8JA 1WIEA 3QKJA 5CK9A 5A0GA 2YRVA 4C8QD 2XDDA 1BI2A 1M3CA 1QVFP 3CQTA 1I81A 5I22A 4M77E 4CC4B 5FWCA 3CCSQ 5IT9E 5CCAA 1OV3A 2RQRA 3OW2P 4C8QA 2C06A 1M4ZA 4BB7A 3ASKA 2X4XA 4LE9A 3JB9I 3G71T 1N27A 1OYXA 1G2BA 4OMFB 2DEQA 2YDLA 3BDLA 4J7IA 3VS4A 4F14A 2LMJA 2KGTA 3LWHA 4A4KA 1UGRB 4JPBW 1UGVA 3VS3A 2RJEA 3THKA 1JXOA 5LJ5j 1NM7A 4XTYA 4KGVB 3MP6A 2DXBA 2L3SA 4XTZA 1Y96B 3CCMQ 1TS9A 2MCNA 1VQNA 5FU7B 2P0PA 3CEYA 2QDYB 3CD6Q 1WHLA 3LYIA 4RMOA 4B9XA 4LD9K 2JT4A 2EW3A 4A53A 1YWPA 4DEYA 2A08A 1I5OB 1VQMQ 2HQEA 5IXBA 2E1HA 1K9MU 3G71A 1GRIA 2D9TA 5HY6A 3AHUA 4HVVA 3OYMA 4QVDA 1KQSA 2L3PA 5EC7A 2KYMA 2QG9B 3OYNA 1SHGA 5GMKi 4J9IA 4BI8B 1VQPQ 2C0IA 1MMDA 3UA6A 5EG2A 4ORZA 4VUBA 2EJFA 3M58A 3G6EQ 3T9NA 3QZ9B 1YJ9Q 3QHSA 1YIJQ 1IRXA 3EFOB 2CZ1B 2NUTB 2JM9A 4C92G 4E7KA 2COYA 2FZKB 2QK0A 1U8RA 4C0DC 2D0QB 5LJ3j 3M9QA 1YITT 2H8HA 2DK3A 3EGUA 3SDZA 1VQKT 1EZZB 1UUEA 4N4HA 3JCMe 4J6YA 2FHDA 2GTJA 4M77G 1WHHA 5DLQE 2EQUA 4F7UF 1KD1R 5GANg 1CKAA 3UDCA 2DLPA 4C92B 3CPFA 1AEYA 1H3ZA 1IO6A 2VGMA 4IUPA 1SKUB 1BCMA 3CBMA 2BE7D 1QVFA 3RERA 4HT9A 1FYNA 2VB6A 4HA8A 4DEXA 5KYWB 5AT1B 4R0KA 3H8ZA 4HVWA 3OW2A 2ZGWA 4AG1C 2HL5C 2NUZA 4C5IA 5GAN8 4M77B 2W10A 5KCHA 1QKWA 3I5RA 4JRPA 1QCOA 1X6OA 2MK5A 1YITA 3BY7A 3QYHB 3L2UA 1C1AA 2GNCA 2I0NA 1M2VA 2KBTA 3A8LB 2FEIA 4XTUA 1VQKA 2LRQA 4LUDA 4BE1A 4M7DC 4ELYC 5HCKA 5GAMh 2W0ZA 1RI9A 1UGSB 4OF1A 3PVLA 4M77A 1U1TA 4QVCA 2XHCA 1K73U 4M78F 3X20B 5GAOq 3CMET 3JCMf 1UHFA 1ZA1B 1IGUA 3CCQT 1WFWA 4J7FA 1GCQA 2RQVA 4UC4A 1I0CA 4J6XA 1X6BA 2WACA 1JB0E 2M1HA 3M0RA 1I8FA 1QWEA 3OYLA 2LCLA 4J9CA 2OTLQ 2DE0X 2HSPA 1YFNA 2O88A 1WLPB 1NE8A 1TTHB 1SG5A 1X27A 2DL4A 3OYYA 5KYYB 1WNLA 5GAOl 3UATA 2YUNA 3N5BB 5L23A 3EG9A 4QT7A 4M7AE 1PCXA 3UT1A 3CMEA 1N9RA 2FPDA 2DZCA 3O8VA 4E7JA 3I56A 4OGEA 2DJZA 3CCQA 4GBQA 2H3EB 1HYOA 2HDAA 3ZEHA 3M54A 2M16A 3L42A 1BB9A 1D3BA 1Q86U 2BE9B 1BU1A 2XG8D 1M3BA 2QA4A 4OMMA 5KYUB 2YT6A 1OX8A 1W70A 4LDWA 2P0KA 5GMKm 4ZGJB 2DM1A 3E1SA 3CBOA 3QWXX 2RF0A 3TCJA 2KAFA 4F17A 3LGLA 1OX9A 1X75C 3HL8A 2DERA 2PNIA 1H641 1KQSS 1YWOA 4A4FA 3TREA 3M0SA 4C8QF 3CCUQ 1KJWA 2K5FA 4OB0B 3A98A 3OS0A 2GQVA 5GANe 4GLMA 3MEWA 1UFFA 3I55T 2D8JA 4OMLA 1H3HA 1LNXA 3VS5A 2RHUA 4YTLA 2Y4XA 1OZ2A 4M75E 8AT1B 2I2LA 2XKOC 4QW2A 3ZBDA 4IKFA 2EYZA 4AG2C 5A2QE 3S3MA 1ZUKA 1RACB 4XU1A 3HSBA 4M4ZA 1MMGA 1UHCA 1PRLC 2DL5A 1IHWA 3OYCA 4J5YA 1M8VA 3FJPA 1OI1A 3A5ZB 2L3RA 3MO8A 3LLRA 2VKNA 3A1PA 2CP6A 2EQIA 3CBPA 3PIOA 4BE0A 2CSIA 1M3AA 4NOYA 1B3QA 2GTOA 3MEVA 4OGCA 2V1QA 3I55A 4E7IA 1UB4A 2PQWA 4L6V5 5HK0A 3OBYA 2EYQA 1Y0MA 1QVFS 1IGQA 2RJDA 2HMAA 1I4K1 5GANf 3RUXA 2YRCA 3EHRA 2CUBA 3OW2S 6AT1B 3V8KA 4M7DE 2EYWA 2ZPEB 3JB9J 2KVQG 4II1A 1PSEA 2RMOA 4RTXA 5FW9A 2O01E 3MP1A 2RA2A 1RAFB 1VQMT 1WXTA 1NLOC 5FROA 3CCVT 3CCLQ 1NLPC 2LX7A 1YITQ 1X43A 3KXTA 2NUPA 4M7AD 4HCZA 3PIPA 1ZBXA 4XAXB 1R0BG 4PKCC 4DBHA 1VQKQ 1X2KA 1WJRA 3V7RA 3JCMh 1YHQQ 2B86A 2F2XA 3NTIA 3P8DA 4M7AA 3G6ET 5LL6S 3OSVA 1YJ9T 2XK0A 2RHYA 1D0YA 2F1LA 1M90R 3CD6A 4MDXA 2JS0A 2JMAA 3LGFA 1RAAB 2VYTA 4P5NA 3FJ5A 1Q95G 1VQMA 1B34A 2Z0WA 5D6YA 3C95A 2E5QA 2JMCA 4IUTA 3I9QA 3CCVA 4HCKA 2CGHA 4PFPA 1Q82C 2EQKA 2KYBA 1WHKA 1PC0A 2E4HA 3JSCA 4BDYA 2M0YA 5KH6A 2CZ7B 1AVZC 4KT0E 4M77F 3O5ZA 3G6EA 1YJ9A 1RAHB 4NS5A 1GFCA 3CMEQ 3M59A 3CCQQ 1V29B 2EKHA 2MPXC 4M75D 4O6JA 3FEOA 2PUOB 5GMKh 3CMAQ 2ABLA 4B6MA 4BUGA 2AKLA 4AMCA 3HFOA 4FU6A 4QQ6A 5GANj 3EG0A 4M75A 4HVUA 1VOMA 2EIFA 2HQXA 4N0AA 1O75A 2HQHA 4M7DG 1BI0A 2HZYA 3VS6A 1S1NA 1T0HA 5GAMe 1OU9A 1M1KR 3S3OA 1PHTA 4JJBA 4BD3A 3GLXA 2R5MA 2M02A 1ZSZC 4C5EA 3QPHA 4NL2A 1U3OA 3HRTA 5GAOn 3JCMb 4FW2A 2O4XA 2CP5A 3C4SA 3QBYA 3TQ7P 4M7DB 1EIFA 9ATCB 2RN8A 2X3WD 3PE0A 2ZPGB 4F16A 4ZTFA 1K9AA 3UF4A 3TVTA 3OY9A 3CC4T 1X6GA 1TSFA 3A8MB 4M7DA 2KRSA 1Q82U 3G1JA 4Z8AA 3RMQA 2GF7A 2K7AA 2SEMA 1BKBA 2EYYA 2JOYA 1TG0A 1BIAA 1AWJA 5GAMf 2YWWA 1K9MC 1G3YA 3META 3MPUB 2VUBA 4JS4A 2HD0A 4EIKA 2HNIA 1AT1B 1NPRA 4IURA 2LVMA 2VASA 3SB2A 3L2ZA 3I55Q 4DOVA 1AD5A 1MHNA 1BK2A 1CSKA 5GANh 3LH5A 3JB9G 2G6FX 3DB3A 4C92E 1Q7YU 1ABOA 4ME7A 5HK3A 1Y71A 1WYXA 3UWNA 2RK2A 2MYSA 4ZN1A 1SSFA 1QP3A 4EMKA 5DM7R 1XTDA 2PU9B 3HP9A 5FRNA 2E3HA 1M30A 3FB9A 2LX9A 1NYFA 5CQYA 1K8AC 2V26A 3ER0A 4ZN3A 2C0OA 2J6OA 3VS0A 4Z89A 2KY9A 4V2SA 1EFNA 3TU4K 2DTOA 2OTJQ 1G3SA 1M9SA 4XTWA 3CCUT 5KE3A 2DMOA 2PVOB 2RHZA 2MI6A 3DLLA 3ULRB 1MV3A 1YNZA 2K5LA 2ED1A 2NYSA 3I35A 3NTKA 3A8OB 5FU6B 3SWNB 3QDRB 1VYVA 1JRIA 3S6WA 5I21A 1NJIC 3H0HA 3M0TA 3PFSA 3SHWA 4MMKA 2FZGB 4WTOB 4JLGA 3A8GB 4E2FB 4PJOC 2LT4A 2JJ9A 4HCBA 2Y4YA 3CCUA 3OYDA 1Y96A 3E9FA 1NYGA 3CCVQ 4X34A 2KDSA 1VQ7Q 2DXUA 2KNBB 3QDFA 1T0JA 1PRMC 3EGDB 4JDSA 4OMQA 2J6KA 1K73C 2RJFA 2CP3A 3HKSA 5GAMj 1FMWA 4M7AF 2RD1A 2RQUA 1OU8A 2X4WA 1FXXA 4A4HA 3NMZC 4LDUA 1K8AU 1ARKA 2CZ0B 2A36A 3X28B 3AT1B 3EGXB 2DJQA 3CCLT 1D0XA 2WSCE 2RH2A 1O9SA 2KQWA 2QTVA 4OB1B 5DLOA 4J8OA 3EFOA 2RQWA 2DYIA 3VRYA 1Q81U 2NUTA 2AZVA 5KYXB 4WF2A 3E2UA 3NTHA 2DRKA 2LTOA 2PUKB 4LD6A 4DBFA 1CKBA 2COWA 1YHQT 4JLIA 2K57A 2HL3A 1IXDA 3GPLA 3NPFA 2HAXA 2ESWA 2E6ZA 4RTZA 1C0MA 4C92D 1I1JA 2YUQA 3CPWP 2KE9A 3GNFB 5HKCA 1NJIU 1Q86C 2QXFA 3L2WA 3V7CA 4IIMA 2E64A 2QEXT 4C92A 4LDXA 4OMOA 3CCLA 4M78C 2COZA 2RK1A 4M75F 4M77D 4E6RA 3OS1A 2DTIA 4D8KA 5KYWA 3NGPA 2ZCFB 3OS2A 3R6NA 3WXMB 1GCPA 4KH0B 1KHCA 1D1CA 1TUDA 1VIFA 1YHQA 2IVWA 3QJYA 1N8RC 1KIKA 2E65A 2A7YA 2LQKA 1ZQ1A 3NHNA 4C5HA 1VQ9T 2R57A 3JCMX 4J9GA 3M0QA 5GMKe 2BTTA 2KI7A 1QWFA 3I5SA 4E7HA 3CMAT 5GAOm 1LJOA 1MNDA 2XMFA 2QEXA 1E6HA 5CKFA 1KSWA 5IXFA 1UG1A 4LN2A 4FIBA 2K5IA 1M90U 1OPLA 5DY9A 3CC4Q 4PLLA 4KUDK 1OOTA 2KK4A 4Z88A 4M7DF 3J7AF 2G3RA 4BI3A 3OMGA 5L8RE 4R56A 3MEAA 2DILA 2H3JA 3MJXA 1QVPA 2M51A 3CC2T 3OB9A 4XK8E 1TUCA 1NPPA 3JCMJ 1KFZA 3H0IA 4LDYA 3MEUA 5KYYA 4PJOE 2OI3A 3GOXA 1UEBA 4JJDA 1NG2A 2DD4A 4RTUA 3CMAA 5D6XA 1WHGA 1RAEB 1TU0B 1ZSZB 3QXEB 3QZ5B 3RESA 4BE2A 3EG3A 3RMSA 5KCOA 2EAYA 1UECA 3GIBA 2CSQA 4JRKA 4C8QC 2AK5A 2A28A 3VJPA 2KT8A 2LNVA 4AFQC 5LJ5d 5GAN7 3HHTB 1HJDA 2J7IA 1VYTA 2PVDB 2K3XA 2DEUA 5J3BA 5IAYA 1WA7A 1FMKA 2F5KA 5KYUA 1SEMA 4QQDA 2E6NA 2JS2A 2X35A 3QWYA 5C0MA 3CC2A 1N8RU 1YJNT 5FU6C 1QCNA 1M1KU 3SWNC 4ZTJA 2E41A 1SF9A 3CPWA 1PKTA 4KGZB 4F04B 1PD1A 5LJ5g 1PNJA 4FYYB 2X4JA 4GY5A 1WXBA 5I2SA 3JB9F 4IUQA 5CKDA 4DOWA 4KH1B 1G3WA 2AIRB 4O5VA 2RPNA 3OYEA 4JS5A 2FVUA 2LT1A 4ESRA 1S72Q 1NEGA 3VRZA 2XU8A 5AYFA 2OTJT 1X69A 3FC3A 2LNHB 4PJJA 4A54A 3PGGA 1YJNA 3X24B 2LJ0A 5CIUA 1ZHIA 4X9DA 4OP0A 3TSWA 2ATCB 2LDMA 2KRNA 5LJ3d 2EBPA 4MMLA 3A8HB 1JXMA 1XQHA 4QVZA 4AT1B 4M78E 1QVGP 1AZGB 1WJSA 4X9CA 4AFZC 3OBWA 4J9BA 2FO0A 2YRDA 1KC8U 4KBMB 2EWNA 3OYIA 4ELZC 2LP5A 4PJOG 2KXDA 5KE2A 3BE3A 4IUVA 1Z9QA 2MWOA 3M4GA 1BBZA 4KGXB 1VQ5T 2F2VA 2OTJA 2CH4A 3U23A 5GMKj 1BYMA 4EPCA 1YJWT 3C0CA 3PVQA 4FYWB 5IN1A 4FYVB 4JUVA 1WJQA 4KULA 1RLPC 1VQ7T 4KRTA 1FX7A 2AKKA 2DKGA 1UGPB 3CXCA 3X26B 1LOJA 2J05A 3PNWC 4PJOB 4XU2A 4OVAA 2ECZA 4Y92A 4J6WA 3E9GA 3JV3A 4OB2B 3M5AA 1MMNA 2R58A 3LWIA 1K1ZA 3DLMA 1MUZA 3H6ZA 4PJOA 1G3TA 1QW1A 4PFOA 4Z02A 4F7UG 1VQ4T 3QYGB 2JTFA 2JW4A 4RTYA 2QEXQ 2F5TX 1YJWA 4C92F 1E7OA 1WHMA 5A0LA 2JXBA 1VQ7A 4JRIA 3OYAA 4BDZA 2RQTA 2OAUA 3JCMV 3HFNA 1JEGA 1GCQC 2AHJB 4C8QE 4F7UB 2QGFB 3L2QA 4RUGA 1ABQA 3CC7Q 2D6FA 2JN0A 2FPFA 3DKMA 3RKYA 1D1AA 5A0DA 1VQ9Q 1RABB 3CCRT 2BUDA 3EH1A 2JUFA 1Q7YC 2XDPA 4M78G 2JTEA 2YUOA 3KBGA 3OYKA 4RTTA 1GFDA 4A4GA 1W1FA 2A37A 1VA7A 4K11A 1W2BP 2CZ6B 5J39A 3EAEA 5CKBA 3G4ST 3JAME 1A0NB 4LNPA 3QSUA 1VQLQ 2KT1A 1ZX6A 3HTRA 2B8AA 3VUBA 1QVGA 3CPWS 1W4SA 4J9HA 2RB6A 2QQ9A 3BW1A 2DPPB 1TUGB 4RG8A 4M78B 3NFCA 1TOVA 3SD4A 3CC2Q 1SHFA 1SPKA 1RUWA 1IB8A 8ATCB 2V8KA 4IIOA 2EPDA 4MZMA 4BI4A 1WQWA 1N9SA 1KD1U 2DX1A 2EFIA 2ENMA 4M7DD 2HKNA 2XDBA 1SRMA 2JTMA 1YCSB 2PZ1A 1P92A 5I11A 2DVJA 1AZEA 1T3SA 2EQMA 1TWBA 2XIDA 4GLKA 3M53A 4J9EA 3JCMd 1QLYA 1ZA2B 2MOXA 4L59A 1G5VA 2RI5A 3RNJA 2DA9A 4JJCA 2EGCA 1X2QA 3C12A 4JJNK 2VVKA 1Y7XA 1YJNQ 1MNEA 4L5GA 1V76A 3VYHB 2LJ1A 4FSXA 2V8IA 2OX7A 2RJCA 3R6OA 3GNGA 1PD0A 4B9WA 3J81E 1AWXA 2K79A 1IZ6A 2NLUA 4C8QG 4XTVA 3J80E 1AWOA 1MV0B 4Y28E 2D8HA 2EQJA 2A0FB 2MIOA 3CC4A 3VV0A 3M56A 3QUIA 1I07A 1UJYA 4C5GA 1K4US 4LDVA 4N4IA 1LCKA 5FRMA 2E5KA 1R77A 2SRCA 3GP8A 1PSFA 4WCIA 2O9SA 2GCXA 1U06A 3CXCS 2GFUA 2YLBA 4C8QB 1ZBJA 2X51A 1BCOA 1YI2Q 1LPLA 4C0GA 3JB9D 4JRQA 1VQNT 2DIGA 4CRIA 1XJWB 4HT8A 1Q81C 5CKHA 4N4GA 1GBQA 2CUDA 2ED0A 1N5ZA 3KFVA 1Y07A 1VQ6T 1R0CB 3P8BB 2QAZA 2DNUA 3LX7A 3BDUA 1SRLA 1YN8A 2Y90A 1W2BA 4LUEA 3E19A 3EG1A 1HD3A 1WPYA 1Z9ZA 1VUBA 2DBMA 2K9GA 2EJ9A 1QKXA 1S72T 5IHNA 1KG1A 2RO0A 2J06A 3VS7A 3TEEA 1VQ5Q 2HBWA 4PFZA 3SWNA 4BACA 1PG5B 1YJWQ 2M9UA 2LQWA 4PNOA 4X1VA 1QQJA 2K4YA 5FWBA 4Y91A 4XQ3A 5GAN3 4M7AC 2L0AA 3M4YA 1PM3A 1XOVA 3ZFJA 3CCEQ 3MP8A 3FLGA 2K2VA 3M55A 2CS7A 1VQ6A 1OPKA 2CKKA 1H8KA 4EMHA 3MKDA 4PJMA 2P0QA 2XD0A 4OB3B 3VUZA 3FIFA 5GAN5 1NEBA 3QO3A 4FT2A 3OS5A 1S72A 2P84A 1PWTA 4PJOF 1D0ZA 3EGDA 1VQ4Q 2DTHA 3REAB 2EVRA 2QTXA 1VQOQ 1M90C 1QVGS 2DRMA 2ZPIB 1WQ7A 2LCSA 2ZPHB 2M0OA 1WDXA 5GANd 2E70A 5D7UA 2ROLA 2BKDN 3EGXA 2V1RA 3JCMQ 4ZNXA 2DETA 4XTXA 3M0PA 1YBYA 2RI3A 3HPWA 1U5SA 2LC4A 2DXTA 3EG2A 5IHIA 2DVEA 3CCJQ 1RADB 2HBPA 4M75C 3OMCA 5KYXA 2IG0A 4N0AC 5LJ5h 3FDRA 3CCRQ 2GGRA 2FB7A 1VQ8T 1LVKA 4BY6C 2KROA 4PK4A 4DQ2A 1B7TA 3P8HA 4ATOA 3GBQA 3BFMA 2OAWA 1ZUUA 3IQLA 4TVRA 5GAOr 2BZ8A 4RKUE 1VYUA 2AZSA 3G4SQ 4KUIA 1JQQA 3ZL7C 1JBMA 1K0SA 1IREB 2E12A 2VV5A
chains in the Genus database with same CATH topology
1G3WA 2QQRA 5FLXE 4O5VA 3HRUA 5IT9E 5CCAA 3OYEA 3G6EA 5D6WA 4JS5A 2FVUA 2WSEE 4C8QA 1YJ9A 2C06A 2FYKA 2LT1A 1M4ZA 4NS5A 4BB7A 3ASKA 3M59A 2X4XA 3GF5A 3JB9I 3G71T 3CC7T 1N27A 1OYXA 1V29B 4OMFB 4M75D 2DEQA 2XU8A 5AYFA 4O6JA 3BDLA 3FEOA 2OTJT 2PUOB 4J7IA 5GMKh 3FC3A 1M1KC 3LWHA 4A4KA 1UGRB 4BUGA 2E10A 4A54A 3PGGA 1YJNA 3HFOA 4FU6A 3X24B 4QQ6A 2P4TA 5CIUA 2RJEA 5GANj 1ZHIA 2EJGA 5M9OA 4X9DA 5LJ5j 4M75A 3JCMc 1VQ8A 2EIFA 1KQ2A 2HQXA 4OP0A 4N0AA 1O75A 4XTYA 2LDMA 3MP6A 2L89A 2DXBA 1BI0A 4MMLA 4Q5WA 5LJ3d 3URGA 4XTZA 4M7DG 3A8HB 1XQHA 4QVZA 3MHXA 1Y96B 5GAMe 3V7SA 2DAQA 4M78E 1VQNA 5FU7B 3S3OA 4PLIA 2P0PA 3CEYA 3CCJT 2QDYB 1WJSA 3LYIA 4X9CA 4RMOA 3OBWA 4BD3A 3I56T 4RCBA 4B9XA 1VQLT 3GLXA 2R5MA 4LD9K 3WVDB 4A53A 4C5EA 2JNGA 2PVGB 1RI0A 1KC8U 4KBMB 2EWNA 3QPHA 3OYIA 2HQEA 4ELZC 4PJOG 5LJ3h 4NL2A 5KE2A 3RKXA 4IUVA 3HRTA 5GAOn 3JCMb 2E1HA 2MWOA 3OA6A 2O4XA 3G71A 3C4SA 3CC7A 3QBYA 3M4GA 2QA4T 1K9MU 2D9TA 5HY6A 4M7DB 1EIFA 3AHUA 2QQAA 3OYBA 1VQ5T 2OTJA 2DD5A 2LQ8A 3OYMA 4QVDA 1KQSA 3OYGA 5GMKj 3VU3C 1VQ9A 4EPCA 1YJWT 1BYMA 2F69A 2ZPGB 3SFMA 4ZTFA 5IN1A 4JUVA 3OYNA 1WJQA 1W2BS 4EMKC 4KULA 5GMKi 1VQ7T 4BI8B 3OY9A 3VKIA 1GXIE 1FX7A 3CC4T 2DKGA 2YLCA 4C0FA 1UGPB 1D3BB 3M57A 3CXCA 3A8MB 1VIEA 5EG2A 4VUBA 2FL7A 1LOJA 3X26B 4M7DA 3PNWC 2EJFA 3M58A 1Q82U 4PJOB 4XU2A 4MZTA 4ZGDB 2MWPA 3T9NA 3QZ9B 4OVAA 3RMQA 2GF7A 3VYGA 4J6WA 3QHSA 3E9GA 3QIIA 1BKBA 4HCCA 2JOYA 1KC8C 4OB2B 3M5AA 1BIAA 3WVEB 1VQLA 2CZ1B 2R58A 3LWIA 5GAMf 3DLMA 1N6AA 1K9MC 4C92G 4E7KA 2K3YA 1G3YA 3H6ZA 1U8RA 3META 2D0QB 4C0DC 2VUBA 4JS4A 2HD0A 3OYHA 1G3TA 2ZZDA 5CVIA 5LJ3j 4PJOA 1QW1A 2HNIA 4Z02A 3M9QA 4F7UG 1NPRA 1VQ4T 3QYGB 2LVMA 4IURA 1YITT 2JTFA 3SB2A 2DK3A 3L2ZA 4DOVA 1MHNA 4XU0A 3SDZA 3DB4A 5GANh 3QJ6A 4HKEA 2F5TX 1YJWA 3OQ5A 3JB9G 1WGSA 4C92F 3DB3A 4C92E 1Q7YU 1VQKT 3RIRA 4ME7A 4N4HA 3JCMe 5HK3A 4J6YA 1Y71A 5A0LA 3UWNA 1BIBA 2FHDA 2RK2A 4M77G 1VQ7A 5DLQE 2EQUA 4F7UF 4JRIA 4F7UE 4ZN1A 3OYAA 5GANg 5I2MA 1SSFA 3UDCA 1QP3A 4EMKA 4C92B 4BDZA 3CPFA 3JCMV 2OAUA 5DM7R 1H3ZA 1XTDA 2PU9B 3HFNA 3HP9A 5FRNA 2VGMA 3FB9A 4IUPA 4M77F 2LX9A 5CQYA 1K8AC 2AHJB 3ER0A 3CBMA 4C8QE 4F7UB 4ZN3A 1QVFA 5GMKl 3RERA 3L2QA 4HT9A 2KY9A 3PMIA 4V2SA 2MF2A 2D6FA 4HA8A 1M1FA 2JN0A 4EMGA 3X25B 3TU4K 1M5Q1 2DTOA 1G3SA 3DKMA 3H8ZA 5FU7C 3RKYA 5GAMd 3OW2A 2ZGWA 1M9SA 4XTWA 3ME9A 5A0DA 3CCUT 5KE3A 4C5IA 5GAN8 5C6SA 1FWZA 3INZA 4M77B 5KCHA 3CCRT 4JRPA 2PVOB 2BUDA 5GAN4 2RHZA 1X6OA 1KQ1A 2MI6A 3DLLA 1YITA 2JUFA 3BY7A 3QYHB 2K5LA 2XDPA 2YHTA 4M78G 3KBGA 3L2UA 2KMTA 3OYKA 1Q7YC 5CAIA 1YI2T 4E7LA 4A4GA 2RM4A 3NTKA 3A8LB 4XTUA 1VQKA 2LRQA 4M7DC 4BE1A 4FL6A 3A8OB 4ELYC 4PL6A 5GAMh 5FU6B 1UGSB 2CZ6B 4OF1A 3EAEA 4M77A 5CKBA 1U1TA 3SWNB 4QVCA 5J39A 3QDRB 3JAME 3G4ST 3QSUA 3CCST 2XHCA 1K73U 4M78F 5CKEA 3X20B 3JCMP 1JRIA 2B8AA 3S6WA 5GAOq 3VUBA 5GAMg 5I21A 3JCMf 3CMET 3OYJA 1BI3A 3CPWS 4DA4A 1QVGA 1W4SA 3PFSA 1NJIC 2RB6A 2QQ9A 4MMKA 3CCQT 3BW1A 2DPPB 4J7FA 4RG8A 4JLGA 4M78B 3NFCA 3A8GB 4UC4A 4PJOC 2LT4A 4MZPA 3SD4A 4J6XA 4HCBA 2WACA 2Y4YA 2V8KA 1JB0E 2M1HA 3CCUA 4MZMA 4A4EA 3OYDA 1Y96A 1I8FA 2DZ9A 3E9FA 3OYLA 2LCLA 4BI4A 1WQWA 4X34A 4R55A 3JB9H 2KDSA 1N9SA 1JJ2A 1KD1U 2DXUA 2EFIA 5LJ3g 4M7AG 1NE8A 4M7DD 2XI9A 4C0ZA 3EFSA 1YI2A 3CCMT 2XDBA 3OYYA 3UPUA 3CD6T 4JDSA 3CCET 1WNLA 3S3NA 3EFRA 1K73C 2JTMA 5GAOl 2RJFA 1VQPA 2MMPA 3HKSA 1DJ7B 1P92A 3HRSA 3N5BB 5CO7A 5GAMj 3JCMW 2EQMA 2XIDA 2DXCA 3CCSA 3V8JA 4M7AF 2RD1A 4M7AE 2X4WA 3UT1A 2R5AA 1FXXA 4GLKA 1RL2A 3M53A 5GAN6 3JCMd 3CMEA 1N9RA 3O8VA 2DZCA 4E7JA 4PJOD 2L5QA 4A4HA 4L59A 3I56A 4LDUA 2DJZA 4OGEA 3CCQA 1K8AU 1G5VA 4C92C 4M7AB 2RI5A 5GAOp 2CZ0B 3C12A 3X28B 4JJNK 3ZEHA 3M54A 2M16A 3L42A 1D3BA 1Q86U 1Y7XA 3MCAB 4L5GA 3VYHB 1KD1C 3RKWA 3CCLT 2XG8D 2WSCE 4FSXA 2RH2A 2QA4A 1VQPT 2V8IA 1QP2A 1O9SA 2KQWA 4XU3A 2RJCA 4OB1B 3R6OA 5GAN2 1VQ5A 5DLOA 3GNGA 4LDWA 1VQOT 4B9WA 3J81E 2P0KA 5GMKm 4J8OA 1B34B 1Q81U 4ZGJB 1IZ6A 3QG1A 2NLUA 4C8QG 4M77C 3E1SA 4WF2A 3CCMA 2GFAA 3CBOA 3NTHA 1M1GA 2LTOA 2KAFA 2PUKB 2QQSA 4LD6A 4XTVA 3TCJA 3LGLA 3J80E 1X75C 4Y28E 4RG2A 3F70A 2A3LA 2EKOA 2EQJA 2K57A 3HL8A 2X4YA 4JLIA 3CCEA 1YHQT 2VGNA 3VV0A 1YIJT 3M56A 3CC4A 1H641 1KQSS 3GPLA 4A4FA 3QUIA 3TREA 2HAXA 2E6ZA 4C5GA 2RI2A 4LDVA 4N4IA 4C8QF 4C92D 5FRMA 3FRNA 4FM4B 5CR2A 3GP8A 1PSFA 2DIQA 4M75G 2RHIA 2K5FA 1HXDA 3GNFB 4OB0B 2GCXA 1XNIA 3L1AA 2GQVA 5HKCA 3OS0A 1Q86C 1NJIU 3PMTA 1AHJB 2QXFA 3C94A 3MEWA 5GANe 3I55T 3CXCS 3L2WA 2GFUA 3V7CA 5LJ5e 2E64A 2YLBA 4C8QB 3LW5E 3L2RA 1LNXA 2QEXT 4C92A 2RHUA 1X01A 4C0GA 3JB9D 4JRQA 4CI0C 2DIGA 4LDXA 4YTLA 3CCLA 2Y4XA 1VQNT 2ZPBB 2DO3A 4M78C 4CRIA 4HT8A 1OZ2A 1VQ4A 1Q81C 4F7UA 2RK1A 4M75F 5CKHA 4M75E 4M77D 4N4GA 4KT0E 2I2LA 4C0DB 2XKOC 3OS1A 4QW2A 3KUFA 2DTIA 4J83A 3ZBDA 4IKFA 2QI2A 5A2QE 3S3MA 1VQOA 1VQ6T 1Y07A 2ZCFB 3OS2A 4XU1A 3HSBA 3P8BB 2VC8A 1OZ3A 3WXMB 1BI1A 3LX7A 4M75B 1KHCA 3BDUA 3OYCA 1VIFA 1W2BA 2Y90A 1YHQA 4J5YA 1M8VA 3FJPA 1OI1A 3E19A 2IVWA 2CYZB 1YIJA 3QJYA 1N8RC 3A5ZB 2LCCA 4BY6B 2L3RA 1HK9A 3MO8A 3LLRA 1WPYA 2E65A 2A7YA 2LQKA 1ZQ1A 1VUBA 4C5HA 1VQ9T 3CBPA 2R57A 3JRZA 3PIOA 2EJ9A 3JCMX 4BE0A 1S72T 5GMKe 1KG1A 2RO0A 4NOYA 2KSSA 3MEVA 3TEEA 4OGCA 2BIVA 3CCJA 3V8LA 3I55A 4E7HA 3CMAT 4IUUA 1LJOA 3SWNA 5GAOm 4E7IA 1UB4A 2PQWA 4L6V5 4M78D 5HK0A 4BACA 3OBYA 2QEXA 2EYQA 2M9UA 5CKFA 4MDWA 4PNOA 2O4XB 1QVFS 4FIBA 2K4YA 3CCRA 1YCYA 4Y91A 4XQ3A 2K5IA 5GAN3 1M90U 3LH0A 4M7AC 3M4YA 2WSFE 1XOVA 2RJDA 3ZFJA 1I4K1 5GANf 5DY9A 3MP8A 2VXFA 3RUXA 4PLLA 3FLGA 5LJ5f 2XICA 2K2VA 4KUDK 4M78A 2KK4A 3M55A 2CS7A 1R8OB 3OW2S 3V8KA 1VQ6A 4M7DF 4M7DE 2ZPEB 3JB9J 4QQGA 2KVQG 2CKKA 4II1A 1PSEA 2G3RA 3J7AF 4BI3A 2RHXA 4EMHA 3OMGA 5L8RE 3OSSC 2JZ2A 4R56A 4RCCA 3G4SA 2L8DA 2O01E 2P0QA 2H3JA 3MEAA 3G7ZA 3MP1A 4OB3B 2XD0A 2RA2A 1QVPA 2QQBA 3FIFA 3VUZA 5LJ3e 3CC2T 5GAN5 1VQMT 4FT2A 3OB9A 3QO3A 4XK8E 4NL3A 3JCMJ 1NPPA 3OS5A 4EDUA 5FROA 1S72A 2OTLT 4LDYA 3CCVT 5CQXA 4PJOF 3MEUA 4PJOE 3GOXA 1U1SA 1MGQA 1UEBA 2DTHA 3Q1JA 4E47A 3CMAA 2DD4A 3KXTA 5D6XA 2QTXA 4M7AD 4HCZA 3PIPA 1M90C 1ZBXA 3QXEB 4XAXB 3QZ5B 1NZ9A 4PKCC 3RESA 1QVGS 4BE2A 2ZPIB 3RMSA 4D6WA 5KCOA 1WQ7A 1WJRA 2ZPHB 3V7RA 2EAYA 4ZGEB 3GIBA 4JRKA 2M0OA 3JCMh 3VJPA 4C8QC 5GANd 2LNVA 2E70A 3NTIA 5LJ5d 3P8DA 5GAN7 3HHTB 4M7AA 3G6ET 5LL6S 3OSVA 3PTAA 1YJ9T 2BKDN 2PVDB 2RHYA 2XK0A 3JCMQ 1I5LA 2ZPFB 1KHIA 3CD6A 4MDXA 2K3XA 4XTXA 5J3BA 3JCMg 5IAYA 1YBYA 2JVVA 2RI3A 3HPWA 1JJ2S 3OYFA 2LC4A 4EMKB 2F5KA 2DXTA 3LGFA 2VYTA 2DVEA 5C0MA 2E6NA 2X35A 4P5NA 4QQDA 3CC2A 1VQMA 2HBPA 2MAMA 1N8RU 4M75C 1YJNT 1B34A 5FU6C 3OMCA 5D6YA 2IG0A 3C95A 4N0AC 3SWNC 5LJ5h 3FDRA 2E41A 4ZTJA 1M1KU 2E5QA 2OTLA 3CPWA 1TH7A 2FB7A 4IUTA 1VQ8T 4FT4A 3CCVA 4BY6C 2VXEA 3PT9A 5J26A 4DQ2A 2CGHA 5LJ3f 1Q82C 3P8HA 4ATOA 1UGQB 2EQKA 3L2VA 3BFMA 5LJ5g 2V8JA 3QKJA 5CK9A 5A0GA 2YRVA 4TVRA 5GAOr 4C8QD 2XDDA 3JSCA 1BI2A 2X4JA 4RKUE 4BDYA 4GY5A 5I2SA 3JB9F 5KH6A 4IUQA 2CZ7B 4KUIA 5CKDA 4DOWA 1JBMA 1I81A 1IREB 2E12A 2VV5A 4M77E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQR A;  1MHN A;  4IUU A;  4E7I A;  4BAC A;  2PQW A;  3DB4 A;  3OYE A;  5D6W A;  3QJ6 A;  3OQ5 A;  2X4W A;  3UT1 A;  1WGS A;  2R5A A;  3DB3 A;  4NS5 A;  3ASK A;  2O4X B;  4N4H A;  3O8V A;  2X4X A;  4E7J A;  4A4H A;  3UWN A;  1N27 A;  1OYX A;  2FHD A;  3LH0 A;  4L59 A;  2RJD A;  1G5V A;  2EQU A;  3MP8 A;  3OYA A;  2RI5 A;  3BDL A;  3FEO A;  4PLL A;  3FLG A;  1SSF A;  3FC3 A;  3ZEH A;  4BDZ A;  1H3Z A;  2M16 A;  3L42 A;  5FRN A;  4FU6 A;  4IUP A;  4QQG A;  4QQ6 A;  2CKK A;  4II1 A;  2RJE A;  2G3R A;  5CIU A;  2RHX A;  3OMG A;  5M9O A;  2JZ2 A;  3L2Q A;  3PMI A;  2HQX A;  2RJC A;  2L8D A;  3MEA A;  3MP1 A;  2LDM A;  3MP6 A;  2L89 A;  4Q5W A;  2P0K A;  4B9W A;  3H8Z A;  4QVZ A;  3OB9 A;  2NLU A;  3ME9 A;  2DAQ A;  2GFA A;  3NTH A;  5KE3 A;  2LTO A;  4LD6 A;  2QQS A;  4C5I A;  4EDU A;  5C6S A;  4PLI A;  3LGL A;  3S3O A;  3CEY A;  5FRO A;  5KCH A;  4RG2 A;  3F70 A;  1WJS A;  2EKO A;  2BUD A;  2EQJ A;  3LYI A;  2RHZ A;  2X4Y A;  3MEU A;  4BD3 A;  4B9X A;  3GOX A;  2R5M A;  3Q1J A;  3L2U A;  2XDP A;  4C5E A;  4A4F A;  3OYK A;  1RI0 A;  5D6X A;  4C5G A;  4HCZ A;  2RI2 A;  4E7L A;  4N4I A;  4A4G A;  3OYI A;  3NTK A;  2HQE A;  4BE2 A;  5FRM A;  5KE2 A;  5KCO A;  2LRQ A;  4IUV A;  4BE1 A;  1WJR A;  2MWO A;  2DIQ A;  4FL6 A;  2O4X A;  2RHI A;  3C4S A;  4PL6 A;  3QBY A;  3OA6 A;  1XNI A;  2D9T A;  2M0O A;  3EAE A;  5J39 A;  3OS0 A;  3PMT A;  3MEW A;  3OYB A;  3L2W A;  2GFU A;  2BIV A;  3NTI A;  3OYM A;  3P8D A;  3L2R A;  3OYG A;  2BKD N;  2RHY A;  2B8A A;  2XK0 A;  3S6W A;  2RHU A;  4ZTF A;  5IN1 A;  3OYJ A;  2DIG A;  2K3X A;  3PFS A;  5IAY A;  1WJQ A;  3OYN A;  2RI3 A;  4CRI A;  1OZ2 A;  3OY9 A;  3OYF A;  4N4G A;  3OS1 A;  2F5K A;  4QW2 A;  3KUF A;  4IKF A;  3LGF A;  4UC4 A;  3S3M A;  2VYT A;  5C0M A;  2E6N A;  2X35 A;  4QQD A;  3SD4 A;  3OS2 A;  2WAC A;  3PNW C;  2M1H A;  3OMC A;  1OZ3 A;  2MWP A;  5D6Y A;  3E9F A;  4A4E A;  2IG0 A;  3OYD A;  3LX7 A;  4OVA A;  3OYL A;  3FDR A;  4ZTJ A;  2GF7 A;  2E5Q A;  1KHC A;  4IUT A;  3OYC A;  3E9G A;  3QII A;  4X34 A;  4E7H A;  1OI1 A;  5J26 A;  2LCC A;  2EFI A;  2L3R A;  2R58 A;  3MO8 A;  2EQK A;  3LLR A;  3P8H A;  3L2V A;  3DLM A;  3QKJ A;  4C5H A;  4E7K A;  2K3Y A;  2YRV A;  2R57 A;  3H6Z A;  4BDY A;  4BE0 A;  3MET A;  4GY5 A;  2RO0 A;  3OYH A;  5KH6 A;  3S3N A;  4IUQ A;  4Z02 A;  2RJF A;  3M9Q A;  4IUR A;  2LVM A;  3MEV A;  2JTF A;  2EQM A; 
#chains in the Genus database with same CATH topology
 2QQR A;  5FLX E;  1M2V B;  3HRU A;  2IIM A;  4FCY A;  5D6W A;  1Q82 R;  2WSE E;  1WZO A;  2FYK A;  1F1B B;  1NBE B;  1AWW A;  3GF5 A;  3CC7 T;  2D1X A;  1M1K C;  1Y57 A;  1ZUY A;  2E10 A;  2K3B A;  2C0T A;  2P4T A;  2EJG A;  5M9O A;  2E3I A;  1SSH A;  3JCM c;  5KYN A;  1VQ8 A;  1KQ2 A;  3RR6 A;  2KXC A;  4Q5W A;  2L89 A;  3URG A;  3MHX A;  2P4R A;  3V7S A;  2DAQ A;  1Q7Y R;  4CC3 A;  2YXY A;  1WXU A;  2KR3 A;  4PLI A;  2CP7 A;  3I56 T;  3EHQ A;  4RCB A;  1VQL T;  3WVD B;  2JNG A;  2PVG B;  1RI0 A;  2DL8 A;  2K2M A;  1E6G A;  5LJ3 h;  2YSQ A;  3RKX A;  1EX4 A;  3OA6 A;  1WHJ A;  4JZ3 A;  3CC7 A;  4CC7 A;  2QA4 T;  3EG9 B;  1JJ2 P;  2QQA A;  3OYB A;  2DD5 A;  2LQ8 A;  4FW1 A;  2QYZ A;  3OYG A;  1GBR A;  3VU3 C;  1VQ9 A;  2F69 A;  3SFM A;  2KRM A;  1W2B S;  4EMK C;  1AOJ A;  3VKI A;  1GXI E;  2YLC A;  4C0F A;  3CXC P;  2EYX A;  1D3B B;  3M57 A;  1VIE A;  2FL7 A;  1UTI A;  4MZT A;  4ZGD B;  2MWP A;  3VYG A;  3QII A;  5ECA A;  4LXC A;  4HCC A;  1KC8 C;  1VQL A;  3WVE B;  4D8D A;  1G83 A;  2CRE A;  2L3Q A;  1N6A A;  2K3Y A;  1ACM B;  1ZSZ A;  2DF6 A;  2CH4 W;  3OYH A;  2ZZD A;  5CVI A;  2CP2 A;  2F2W A;  1YP5 A;  3SEM A;  2CP0 A;  4QKU A;  4XU0 A;  3DB4 A;  3QJ6 A;  4HKE A;  3OQ5 A;  1WGS A;  1M27 C;  3RIR A;  2LJ3 A;  1K9M R;  1VQN Q;  1FMV A;  1BIB A;  2O31 A;  1PKS A;  4F7U E;  5I2M A;  2FRY A;  1VQ6 Q;  2X9H A;  5GMK l;  3PMI A;  2FPE A;  3G71 Q;  2MF2 A;  1M1F A;  4EMG A;  2QDL A;  3X25 B;  1H92 A;  2AT1 B;  4OMP A;  1M5Q 1;  1KK7 A;  5FU7 C;  5GAM d;  3ME9 A;  5GJV B;  5C6S A;  1FWZ A;  3INZ A;  5GAN 4;  1K8A R;  1KQ1 A;  2YHT A;  2KMT A;  2LQN A;  5CAI A;  1YI2 T;  5IH2 A;  4E7L A;  2RM4 A;  4HXJ A;  3RBB B;  2NWM A;  3D7S B;  4FL6 A;  4PL6 A;  3CCS T;  2GBQ A;  1Q81 R;  5CKE A;  3JCM P;  1MMA A;  5GAM g;  4RTW A;  1BI3 A;  3OYJ A;  4DA4 A;  1HSQ A;  4RTV A;  2EGE A;  1M2O A;  4CC2 A;  2DBK A;  2O9V A;  4OMN A;  4MZP A;  1WI7 A;  1D1B A;  4A4E A;  2DZ9 A;  1C6V X;  2DYB A;  4R55 A;  1RAG B;  2K6D A;  1NJI R;  3JB9 H;  2QAS A;  1JJ2 A;  1OQK A;  4M7A G;  5LJ3 g;  2VWF A;  2XI9 A;  2OJ2 A;  3EFS A;  4C0Z A;  1YI2 A;  3CCM T;  5GJW B;  3UPU A;  3CD6 T;  3CCE T;  3S3N A;  3EFR A;  1JU5 C;  1ZLM A;  4E7Z A;  2MMP A;  1UE9 A;  1DJ7 B;  3HRS A;  5CO7 A;  3JCM W;  2NUP B;  2DXC A;  2BZY A;  3CCS A;  3V8J A;  2RNA A;  2R5A A;  1RL2 A;  5GAN 6;  4PJO D;  2L5Q A;  4C92 C;  4M7A B;  5GAO p;  1K73 R;  3MCA B;  1KD1 C;  3RKW A;  3UA7 A;  3VS2 A;  2LZ6 B;  1VQP T;  1QP2 A;  2HKQ B;  1VQ8 Q;  4XU3 A;  1VQ5 A;  5GAN 2;  4FSS A;  1VQO T;  1B34 B;  3QG1 A;  4M77 C;  3CCM A;  2GFA A;  1M1G A;  2ROT A;  2QQS A;  2BZX A;  4RG2 A;  3F70 A;  2A3L A;  2EKO A;  3CCE A;  2DL7 A;  2X4Y A;  2ZAE A;  1YIJ T;  2VGN A;  2CT3 A;  1WX6 A;  2IPO B;  2EGA A;  2HCK A;  4J9F A;  4PJN A;  2RI2 A;  1QCF A;  3FRN A;  4FM4 B;  5CR2 A;  2DIQ A;  4M75 G;  2RHI A;  1HXD A;  2FG0 A;  1XNI A;  3L1A A;  1OEB A;  1RLQ C;  3PMT A;  1AHJ B;  3C94 A;  2FRW A;  3CCJ T;  2X3X D;  3EH2 A;  5LJ5 e;  5IHK A;  2JM8 A;  3LW5 E;  3L2R A;  1X01 A;  4CI0 C;  2FZC B;  2ZPB B;  2DO3 A;  1VQ4 A;  4F7U A;  1VQP A;  4C0D B;  3KUF A;  2QGG A;  4J83 A;  1JO8 A;  1J3T A;  2QI2 A;  1Q86 R;  1VQO A;  1GL5 A;  2VC8 A;  1OZ3 A;  3REB B;  1BI1 A;  2CDT A;  4M75 B;  2KEA A;  4DBR A;  4J9D A;  1M8M A;  3I56 Q;  1YIJ A;  2CYZ B;  4BY6 B;  2LCC A;  1UJ0 A;  1HK9 A;  2DFU A;  2O2O A;  3JRZ A;  4JZ4 A;  1D09 B;  2L2P A;  4ANJ A;  3H41 A;  2QA4 Q;  2KSS A;  2BIV A;  3CCJ A;  3V8L A;  4IUU A;  4M78 D;  1N8R R;  4AFU C;  4MDW A;  4E7S A;  3RDV A;  2O4X B;  7AT1 B;  3CCR A;  1YCY A;  2GQI A;  3LH0 A;  2WSF E;  2VXF A;  5LJ5 f;  2HSE B;  2XIC A;  4M78 A;  1R8O B;  2CT4 A;  1K0X A;  4QQG A;  2RHX A;  1V1C A;  3VS1 A;  3OSS C;  2JZ2 A;  4RCC A;  3G4S A;  2L8D A;  3G7Z A;  4AFS C;  2QQB A;  2YUP A;  5LJ3 e;  1KQS P;  4NL3 A;  4EDU A;  4FYX B;  1OUL A;  2OTL T;  5CQX A;  1RAI B;  1U1S A;  1MGQ A;  1TXQ A;  3Q1J A;  4E47 A;  1IHV A;  2D0N A;  1NZ9 A;  1B07 A;  1T3L A;  4D6W A;  3H9N A;  4ZGE B;  2J6F A;  2HEQ A;  2DL3 A;  3PTA A;  1W6X A;  1I5L A;  2ZPF B;  1KHI A;  3JCM g;  3M0U A;  2JVV A;  1JJ2 S;  3OYF A;  3TSZ A;  4EMK B;  4PJL A;  1G8X A;  4A63 B;  2MAM A;  1KC8 R;  1ZSG A;  1UDL A;  2OTL A;  1TH7 A;  4DBQ A;  4FT4 A;  1K76 A;  2PTK A;  2VXE A;  3H0F A;  3PT9 A;  5J26 A;  5LJ3 f;  1UGQ B;  1QMC A;  3L2V A;  2V8J A;  1WIE A;  3QKJ A;  5CK9 A;  5A0G A;  2YRV A;  4C8Q D;  2XDD A;  1BI2 A;  1M3C A;  1QVF P;  3CQT A;  1I81 A;  5I22 A;  4M77 E;  4CC4 B;  5FWC A;  3CCS Q;  5IT9 E;  5CCA A;  1OV3 A;  2RQR A;  3OW2 P;  4C8Q A;  2C06 A;  1M4Z A;  4BB7 A;  3ASK A;  2X4X A;  4LE9 A;  3JB9 I;  3G71 T;  1N27 A;  1OYX A;  1G2B A;  4OMF B;  2DEQ A;  2YDL A;  3BDL A;  4J7I A;  3VS4 A;  4F14 A;  2LMJ A;  2KGT A;  3LWH A;  4A4K A;  1UGR B;  4JPB W;  1UGV A;  3VS3 A;  2RJE A;  3THK A;  1JXO A;  5LJ5 j;  1NM7 A;  4XTY A;  4KGV B;  3MP6 A;  2DXB A;  2L3S A;  4XTZ A;  1Y96 B;  3CCM Q;  1TS9 A;  2MCN A;  1VQN A;  5FU7 B;  2P0P A;  3CEY A;  2QDY B;  3CD6 Q;  1WHL A;  3LYI A;  4RMO A;  4B9X A;  4LD9 K;  2JT4 A;  2EW3 A;  4A53 A;  1YWP A;  4DEY A;  2A08 A;  1I5O B;  1VQM Q;  2HQE A;  5IXB A;  2E1H A;  1K9M U;  3G71 A;  1GRI A;  2D9T A;  5HY6 A;  3AHU A;  4HVV A;  3OYM A;  4QVD A;  1KQS A;  2L3P A;  5EC7 A;  2KYM A;  2QG9 B;  3OYN A;  1SHG A;  5GMK i;  4J9I A;  4BI8 B;  1VQP Q;  2C0I A;  1MMD A;  3UA6 A;  5EG2 A;  4ORZ A;  4VUB A;  2EJF A;  3M58 A;  3G6E Q;  3T9N A;  3QZ9 B;  1YJ9 Q;  3QHS A;  1YIJ Q;  1IRX A;  3EFO B;  2CZ1 B;  2NUT B;  2JM9 A;  4C92 G;  4E7K A;  2COY A;  2FZK B;  2QK0 A;  1U8R A;  4C0D C;  2D0Q B;  5LJ3 j;  3M9Q A;  1YIT T;  2H8H A;  2DK3 A;  3EGU A;  3SDZ A;  1VQK T;  1EZZ B;  1UUE A;  4N4H A;  3JCM e;  4J6Y A;  2FHD A;  2GTJ A;  4M77 G;  1WHH A;  5DLQ E;  2EQU A;  4F7U F;  1KD1 R;  5GAN g;  1CKA A;  3UDC A;  2DLP A;  4C92 B;  3CPF A;  1AEY A;  1H3Z A;  1IO6 A;  2VGM A;  4IUP A;  1SKU B;  1BCM A;  3CBM A;  2BE7 D;  1QVF A;  3RER A;  4HT9 A;  1FYN A;  2VB6 A;  4HA8 A;  4DEX A;  5KYW B;  5AT1 B;  4R0K A;  3H8Z A;  4HVW A;  3OW2 A;  2ZGW A;  4AG1 C;  2HL5 C;  2NUZ A;  4C5I A;  5GAN 8;  4M77 B;  2W10 A;  5KCH A;  1QKW A;  3I5R A;  4JRP A;  1QCO A;  1X6O A;  2MK5 A;  1YIT A;  3BY7 A;  3QYH B;  3L2U A;  1C1A A;  2GNC A;  2I0N A;  1M2V A;  2KBT A;  3A8L B;  2FEI A;  4XTU A;  1VQK A;  2LRQ A;  4LUD A;  4BE1 A;  4M7D C;  4ELY C;  5HCK A;  5GAM h;  2W0Z A;  1RI9 A;  1UGS B;  4OF1 A;  3PVL A;  4M77 A;  1U1T A;  4QVC A;  2XHC A;  1K73 U;  4M78 F;  3X20 B;  5GAO q;  3CME T;  3JCM f;  1UHF A;  1ZA1 B;  1IGU A;  3CCQ T;  1WFW A;  4J7F A;  1GCQ A;  2RQV A;  4UC4 A;  1I0C A;  4J6X A;  1X6B A;  2WAC A;  1JB0 E;  2M1H A;  3M0R A;  1I8F A;  1QWE A;  3OYL A;  2LCL A;  4J9C A;  2OTL Q;  2DE0 X;  2HSP A;  1YFN A;  2O88 A;  1WLP B;  1NE8 A;  1TTH B;  1SG5 A;  1X27 A;  2DL4 A;  3OYY A;  5KYY B;  1WNL A;  5GAO l;  3UAT A;  2YUN A;  3N5B B;  5L23 A;  3EG9 A;  4QT7 A;  4M7A E;  1PCX A;  3UT1 A;  3CME A;  1N9R A;  2FPD A;  2DZC A;  3O8V A;  4E7J A;  3I56 A;  4OGE A;  2DJZ A;  3CCQ A;  4GBQ A;  2H3E B;  1HYO A;  2HDA A;  3ZEH A;  3M54 A;  2M16 A;  3L42 A;  1BB9 A;  1D3B A;  1Q86 U;  2BE9 B;  1BU1 A;  2XG8 D;  1M3B A;  2QA4 A;  4OMM A;  5KYU B;  2YT6 A;  1OX8 A;  1W70 A;  4LDW A;  2P0K A;  5GMK m;  4ZGJ B;  2DM1 A;  3E1S A;  3CBO A;  3QWX X;  2RF0 A;  3TCJ A;  2KAF A;  4F17 A;  3LGL A;  1OX9 A;  1X75 C;  3HL8 A;  2DER A;  2PNI A;  1H64 1;  1KQS S;  1YWO A;  4A4F A;  3TRE A;  3M0S A;  4C8Q F;  3CCU Q;  1KJW A;  2K5F A;  4OB0 B;  3A98 A;  3OS0 A;  2GQV A;  5GAN e;  4GLM A;  3MEW A;  1UFF A;  3I55 T;  2D8J A;  4OML A;  1H3H A;  1LNX A;  3VS5 A;  2RHU A;  4YTL A;  2Y4X A;  1OZ2 A;  4M75 E;  8AT1 B;  2I2L A;  2XKO C;  4QW2 A;  3ZBD A;  4IKF A;  2EYZ A;  4AG2 C;  5A2Q E;  3S3M A;  1ZUK A;  1RAC B;  4XU1 A;  3HSB A;  4M4Z A;  1MMG A;  1UHC A;  1PRL C;  2DL5 A;  1IHW A;  3OYC A;  4J5Y A;  1M8V A;  3FJP A;  1OI1 A;  3A5Z B;  2L3R A;  3MO8 A;  3LLR A;  2VKN A;  3A1P A;  2CP6 A;  2EQI A;  3CBP A;  3PIO A;  4BE0 A;  2CSI A;  1M3A A;  4NOY A;  1B3Q A;  2GTO A;  3MEV A;  4OGC A;  2V1Q A;  3I55 A;  4E7I A;  1UB4 A;  2PQW A;  4L6V 5;  5HK0 A;  3OBY A;  2EYQ A;  1Y0M A;  1QVF S;  1IGQ A;  2RJD A;  2HMA A;  1I4K 1;  5GAN f;  3RUX A;  2YRC A;  3EHR A;  2CUB A;  3OW2 S;  6AT1 B;  3V8K A;  4M7D E;  2EYW A;  2ZPE B;  3JB9 J;  2KVQ G;  4II1 A;  1PSE A;  2RMO A;  4RTX A;  5FW9 A;  2O01 E;  3MP1 A;  2RA2 A;  1RAF B;  1VQM T;  1WXT A;  1NLO C;  5FRO A;  3CCV T;  3CCL Q;  1NLP C;  2LX7 A;  1YIT Q;  1X43 A;  3KXT A;  2NUP A;  4M7A D;  4HCZ A;  3PIP A;  1ZBX A;  4XAX B;  1R0B G;  4PKC C;  4DBH A;  1VQK Q;  1X2K A;  1WJR A;  3V7R A;  3JCM h;  1YHQ Q;  2B86 A;  2F2X A;  3NTI A;  3P8D A;  4M7A A;  3G6E T;  5LL6 S;  3OSV A;  1YJ9 T;  2XK0 A;  2RHY A;  1D0Y A;  2F1L A;  1M90 R;  3CD6 A;  4MDX A;  2JS0 A;  2JMA A;  3LGF A;  1RAA B;  2VYT A;  4P5N A;  3FJ5 A;  1Q95 G;  1VQM A;  1B34 A;  2Z0W A;  5D6Y A;  3C95 A;  2E5Q A;  2JMC A;  4IUT A;  3I9Q A;  3CCV A;  4HCK A;  2CGH A;  4PFP A;  1Q82 C;  2EQK A;  2KYB A;  1WHK A;  1PC0 A;  2E4H A;  3JSC A;  4BDY A;  2M0Y A;  5KH6 A;  2CZ7 B;  1AVZ C;  4KT0 E;  4M77 F;  3O5Z A;  3G6E A;  1YJ9 A;  1RAH B;  4NS5 A;  1GFC A;  3CME Q;  3M59 A;  3CCQ Q;  1V29 B;  2EKH A;  2MPX C;  4M75 D;  4O6J A;  3FEO A;  2PUO B;  5GMK h;  3CMA Q;  2ABL A;  4B6M A;  4BUG A;  2AKL A;  4AMC A;  3HFO A;  4FU6 A;  4QQ6 A;  5GAN j;  3EG0 A;  4M75 A;  4HVU A;  1VOM A;  2EIF A;  2HQX A;  4N0A A;  1O75 A;  2HQH A;  4M7D G;  1BI0 A;  2HZY A;  3VS6 A;  1S1N A;  1T0H A;  5GAM e;  1OU9 A;  1M1K R;  3S3O A;  1PHT A;  4JJB A;  4BD3 A;  3GLX A;  2R5M A;  2M02 A;  1ZSZ C;  4C5E A;  3QPH A;  4NL2 A;  1U3O A;  3HRT A;  5GAO n;  3JCM b;  4FW2 A;  2O4X A;  2CP5 A;  3C4S A;  3QBY A;  3TQ7 P;  4M7D B;  1EIF A;  9ATC B;  2RN8 A;  2X3W D;  3PE0 A;  2ZPG B;  4F16 A;  4ZTF A;  1K9A A;  3UF4 A;  3TVT A;  3OY9 A;  3CC4 T;  1X6G A;  1TSF A;  3A8M B;  4M7D A;  2KRS A;  1Q82 U;  3G1J A;  4Z8A A;  3RMQ A;  2GF7 A;  2K7A A;  2SEM A;  1BKB A;  2EYY A;  2JOY A;  1TG0 A;  1BIA A;  1AWJ A;  5GAM f;  2YWW A;  1K9M C;  1G3Y A;  3MET A;  3MPU B;  2VUB A;  4JS4 A;  2HD0 A;  4EIK A;  2HNI A;  1AT1 B;  1NPR A;  4IUR A;  2LVM A;  2VAS A;  3SB2 A;  3L2Z A;  3I55 Q;  4DOV A;  1AD5 A;  1MHN A;  1BK2 A;  1CSK A;  5GAN h;  3LH5 A;  3JB9 G;  2G6F X;  3DB3 A;  4C92 E;  1Q7Y U;  1ABO A;  4ME7 A;  5HK3 A;  1Y71 A;  1WYX A;  3UWN A;  2RK2 A;  2MYS A;  4ZN1 A;  1SSF A;  1QP3 A;  4EMK A;  5DM7 R;  1XTD A;  2PU9 B;  3HP9 A;  5FRN A;  2E3H A;  1M30 A;  3FB9 A;  2LX9 A;  1NYF A;  5CQY A;  1K8A C;  2V26 A;  3ER0 A;  4ZN3 A;  2C0O A;  2J6O A;  3VS0 A;  4Z89 A;  2KY9 A;  4V2S A;  1EFN A;  3TU4 K;  2DTO A;  2OTJ Q;  1G3S A;  1M9S A;  4XTW A;  3CCU T;  5KE3 A;  2DMO A;  2PVO B;  2RHZ A;  2MI6 A;  3DLL A;  3ULR B;  1MV3 A;  1YNZ A;  2K5L A;  2ED1 A;  2NYS A;  3I35 A;  3NTK A;  3A8O B;  5FU6 B;  3SWN B;  3QDR B;  1VYV A;  1JRI A;  3S6W A;  5I21 A;  1NJI C;  3H0H A;  3M0T A;  3PFS A;  3SHW A;  4MMK A;  2FZG B;  4WTO B;  4JLG A;  3A8G B;  4E2F B;  4PJO C;  2LT4 A;  2JJ9 A;  4HCB A;  2Y4Y A;  3CCU A;  3OYD A;  1Y96 A;  3E9F A;  1NYG A;  3CCV Q;  4X34 A;  2KDS A;  1VQ7 Q;  2DXU A;  2KNB B;  3QDF A;  1T0J A;  1PRM C;  3EGD B;  4JDS A;  4OMQ A;  2J6K A;  1K73 C;  2RJF A;  2CP3 A;  3HKS A;  5GAM j;  1FMW A;  4M7A F;  2RD1 A;  2RQU A;  1OU8 A;  2X4W A;  1FXX A;  4A4H A;  3NMZ C;  4LDU A;  1K8A U;  1ARK A;  2CZ0 B;  2A36 A;  3X28 B;  3AT1 B;  3EGX B;  2DJQ A;  3CCL T;  1D0X A;  2WSC E;  2RH2 A;  1O9S A;  2KQW A;  2QTV A;  4OB1 B;  5DLO A;  4J8O A;  3EFO A;  2RQW A;  2DYI A;  3VRY A;  1Q81 U;  2NUT A;  2AZV A;  5KYX B;  4WF2 A;  3E2U A;  3NTH A;  2DRK A;  2LTO A;  2PUK B;  4LD6 A;  4DBF A;  1CKB A;  2COW A;  1YHQ T;  4JLI A;  2K57 A;  2HL3 A;  1IXD A;  3GPL A;  3NPF A;  2HAX A;  2ESW A;  2E6Z A;  4RTZ A;  1C0M A;  4C92 D;  1I1J A;  2YUQ A;  3CPW P;  2KE9 A;  3GNF B;  5HKC A;  1NJI U;  1Q86 C;  2QXF A;  3L2W A;  3V7C A;  4IIM A;  2E64 A;  2QEX T;  4C92 A;  4LDX A;  4OMO A;  3CCL A;  4M78 C;  2COZ A;  2RK1 A;  4M75 F;  4M77 D;  4E6R A;  3OS1 A;  2DTI A;  4D8K A;  5KYW A;  3NGP A;  2ZCF B;  3OS2 A;  3R6N A;  3WXM B;  1GCP A;  4KH0 B;  1KHC A;  1D1C A;  1TUD A;  1VIF A;  1YHQ A;  2IVW A;  3QJY A;  1N8R C;  1KIK A;  2E65 A;  2A7Y A;  2LQK A;  1ZQ1 A;  3NHN A;  4C5H A;  1VQ9 T;  2R57 A;  3JCM X;  4J9G A;  3M0Q A;  5GMK e;  2BTT A;  2KI7 A;  1QWF A;  3I5S A;  4E7H A;  3CMA T;  5GAO m;  1LJO A;  1MND A;  2XMF A;  2QEX A;  1E6H A;  5CKF A;  1KSW A;  5IXF A;  1UG1 A;  4LN2 A;  4FIB A;  2K5I A;  1M90 U;  1OPL A;  5DY9 A;  3CC4 Q;  4PLL A;  4KUD K;  1OOT A;  2KK4 A;  4Z88 A;  4M7D F;  3J7A F;  2G3R A;  4BI3 A;  3OMG A;  5L8R E;  4R56 A;  3MEA A;  2DIL A;  2H3J A;  3MJX A;  1QVP A;  2M51 A;  3CC2 T;  3OB9 A;  4XK8 E;  1TUC A;  1NPP A;  3JCM J;  1KFZ A;  3H0I A;  4LDY A;  3MEU A;  5KYY A;  4PJO E;  2OI3 A;  3GOX A;  1UEB A;  4JJD A;  1NG2 A;  2DD4 A;  4RTU A;  3CMA A;  5D6X A;  1WHG A;  1RAE B;  1TU0 B;  1ZSZ B;  3QXE B;  3QZ5 B;  3RES A;  4BE2 A;  3EG3 A;  3RMS A;  5KCO A;  2EAY A;  1UEC A;  3GIB A;  2CSQ A;  4JRK A;  4C8Q C;  2AK5 A;  2A28 A;  3VJP A;  2KT8 A;  2LNV A;  4AFQ C;  5LJ5 d;  5GAN 7;  3HHT B;  1HJD A;  2J7I A;  1VYT A;  2PVD B;  2K3X A;  2DEU A;  5J3B A;  5IAY A;  1WA7 A;  1FMK A;  2F5K A;  5KYU A;  1SEM A;  4QQD A;  2E6N A;  2JS2 A;  2X35 A;  3QWY A;  5C0M A;  3CC2 A;  1N8R U;  1YJN T;  5FU6 C;  1QCN A;  1M1K U;  3SWN C;  4ZTJ A;  2E41 A;  1SF9 A;  3CPW A;  1PKT A;  4KGZ B;  4F04 B;  1PD1 A;  5LJ5 g;  1PNJ A;  4FYY B;  2X4J A;  4GY5 A;  1WXB A;  5I2S A;  3JB9 F;  4IUQ A;  5CKD A;  4DOW A;  4KH1 B;  1G3W A;  2AIR B;  4O5V A;  2RPN A;  3OYE A;  4JS5 A;  2FVU A;  2LT1 A;  4ESR A;  1S72 Q;  1NEG A;  3VRZ A;  2XU8 A;  5AYF A;  2OTJ T;  1X69 A;  3FC3 A;  2LNH B;  4PJJ A;  4A54 A;  3PGG A;  1YJN A;  3X24 B;  2LJ0 A;  5CIU A;  1ZHI A;  4X9D A;  4OP0 A;  3TSW A;  2ATC B;  2LDM A;  2KRN A;  5LJ3 d;  2EBP A;  4MML A;  3A8H B;  1JXM A;  1XQH A;  4QVZ A;  4AT1 B;  4M78 E;  1QVG P;  1AZG B;  1WJS A;  4X9C A;  4AFZ C;  3OBW A;  4J9B A;  2FO0 A;  2YRD A;  1KC8 U;  4KBM B;  2EWN A;  3OYI A;  4ELZ C;  2LP5 A;  4PJO G;  2KXD A;  5KE2 A;  3BE3 A;  4IUV A;  1Z9Q A;  2MWO A;  3M4G A;  1BBZ A;  4KGX B;  1VQ5 T;  2F2V A;  2OTJ A;  2CH4 A;  3U23 A;  5GMK j;  1BYM A;  4EPC A;  1YJW T;  3C0C A;  3PVQ A;  4FYW B;  5IN1 A;  4FYV B;  4JUV A;  1WJQ A;  4KUL A;  1RLP C;  1VQ7 T;  4KRT A;  1FX7 A;  2AKK A;  2DKG A;  1UGP B;  3CXC A;  3X26 B;  1LOJ A;  2J05 A;  3PNW C;  4PJO B;  4XU2 A;  4OVA A;  2ECZ A;  4Y92 A;  4J6W A;  3E9G A;  3JV3 A;  4OB2 B;  3M5A A;  1MMN A;  2R58 A;  3LWI A;  1K1Z A;  3DLM A;  1MUZ A;  3H6Z A;  4PJO A;  1G3T A;  1QW1 A;  4PFO A;  4Z02 A;  4F7U G;  1VQ4 T;  3QYG B;  2JTF A;  2JW4 A;  4RTY A;  2QEX Q;  2F5T X;  1YJW A;  4C92 F;  1E7O A;  1WHM A;  5A0L A;  2JXB A;  1VQ7 A;  4JRI A;  3OYA A;  4BDZ A;  2RQT A;  2OAU A;  3JCM V;  3HFN A;  1JEG A;  1GCQ C;  2AHJ B;  4C8Q E;  4F7U B;  2QGF B;  3L2Q A;  4RUG A;  1ABQ A;  3CC7 Q;  2D6F A;  2JN0 A;  2FPF A;  3DKM A;  3RKY A;  1D1A A;  5A0D A;  1VQ9 Q;  1RAB B;  3CCR T;  2BUD A;  3EH1 A;  2JUF A;  1Q7Y C;  2XDP A;  4M78 G;  2JTE A;  2YUO A;  3KBG A;  3OYK A;  4RTT A;  1GFD A;  4A4G A;  1W1F A;  2A37 A;  1VA7 A;  4K11 A;  1W2B P;  2CZ6 B;  5J39 A;  3EAE A;  5CKB A;  3G4S T;  3JAM E;  1A0N B;  4LNP A;  3QSU A;  1VQL Q;  2KT1 A;  1ZX6 A;  3HTR A;  2B8A A;  3VUB A;  1QVG A;  3CPW S;  1W4S A;  4J9H A;  2RB6 A;  2QQ9 A;  3BW1 A;  2DPP B;  1TUG B;  4RG8 A;  4M78 B;  3NFC A;  1TOV A;  3SD4 A;  3CC2 Q;  1SHF A;  1SPK A;  1RUW A;  1IB8 A;  8ATC B;  2V8K A;  4IIO A;  2EPD A;  4MZM A;  4BI4 A;  1WQW A;  1N9S A;  1KD1 U;  2DX1 A;  2EFI A;  2ENM A;  4M7D D;  2HKN A;  2XDB A;  1SRM A;  2JTM A;  1YCS B;  2PZ1 A;  1P92 A;  5I11 A;  2DVJ A;  1AZE A;  1T3S A;  2EQM A;  1TWB A;  2XID A;  4GLK A;  3M53 A;  4J9E A;  3JCM d;  1QLY A;  1ZA2 B;  2MOX A;  4L59 A;  1G5V A;  2RI5 A;  3RNJ A;  2DA9 A;  4JJC A;  2EGC A;  1X2Q A;  3C12 A;  4JJN K;  2VVK A;  1Y7X A;  1YJN Q;  1MNE A;  4L5G A;  1V76 A;  3VYH B;  2LJ1 A;  4FSX A;  2V8I A;  2OX7 A;  2RJC A;  3R6O A;  3GNG A;  1PD0 A;  4B9W A;  3J81 E;  1AWX A;  2K79 A;  1IZ6 A;  2NLU A;  4C8Q G;  4XTV A;  3J80 E;  1AWO A;  1MV0 B;  4Y28 E;  2D8H A;  2EQJ A;  2A0F B;  2MIO A;  3CC4 A;  3VV0 A;  3M56 A;  3QUI A;  1I07 A;  1UJY A;  4C5G A;  1K4U S;  4LDV A;  4N4I A;  1LCK A;  5FRM A;  2E5K A;  1R77 A;  2SRC A;  3GP8 A;  1PSF A;  4WCI A;  2O9S A;  2GCX A;  1U06 A;  3CXC S;  2GFU A;  2YLB A;  4C8Q B;  1ZBJ A;  2X51 A;  1BCO A;  1YI2 Q;  1LPL A;  4C0G A;  3JB9 D;  4JRQ A;  1VQN T;  2DIG A;  4CRI A;  1XJW B;  4HT8 A;  1Q81 C;  5CKH A;  4N4G A;  1GBQ A;  2CUD A;  2ED0 A;  1N5Z A;  3KFV A;  1Y07 A;  1VQ6 T;  1R0C B;  3P8B B;  2QAZ A;  2DNU A;  3LX7 A;  3BDU A;  1SRL A;  1YN8 A;  2Y90 A;  1W2B A;  4LUE A;  3E19 A;  3EG1 A;  1HD3 A;  1WPY A;  1Z9Z A;  1VUB A;  2DBM A;  2K9G A;  2EJ9 A;  1QKX A;  1S72 T;  5IHN A;  1KG1 A;  2RO0 A;  2J06 A;  3VS7 A;  3TEE A;  1VQ5 Q;  2HBW A;  4PFZ A;  3SWN A;  4BAC A;  1PG5 B;  1YJW Q;  2M9U A;  2LQW A;  4PNO A;  4X1V A;  1QQJ A;  2K4Y A;  5FWB A;  4Y91 A;  4XQ3 A;  5GAN 3;  4M7A C;  2L0A A;  3M4Y A;  1PM3 A;  1XOV A;  3ZFJ A;  3CCE Q;  3MP8 A;  3FLG A;  2K2V A;  3M55 A;  2CS7 A;  1VQ6 A;  1OPK A;  2CKK A;  1H8K A;  4EMH A;  3MKD A;  4PJM A;  2P0Q A;  2XD0 A;  4OB3 B;  3VUZ A;  3FIF A;  5GAN 5;  1NEB A;  3QO3 A;  4FT2 A;  3OS5 A;  1S72 A;  2P84 A;  1PWT A;  4PJO F;  1D0Z A;  3EGD A;  1VQ4 Q;  2DTH A;  3REA B;  2EVR A;  2QTX A;  1VQO Q;  1M90 C;  1QVG S;  2DRM A;  2ZPI B;  1WQ7 A;  2LCS A;  2ZPH B;  2M0O A;  1WDX A;  5GAN d;  2E70 A;  5D7U A;  2ROL A;  2BKD N;  3EGX A;  2V1R A;  3JCM Q;  4ZNX A;  2DET A;  4XTX A;  3M0P A;  1YBY A;  2RI3 A;  3HPW A;  1U5S A;  2LC4 A;  2DXT A;  3EG2 A;  5IHI A;  2DVE A;  3CCJ Q;  1RAD B;  2HBP A;  4M75 C;  3OMC A;  5KYX A;  2IG0 A;  4N0A C;  5LJ5 h;  3FDR A;  3CCR Q;  2GGR A;  2FB7 A;  1VQ8 T;  1LVK A;  4BY6 C;  2KRO A;  4PK4 A;  4DQ2 A;  1B7T A;  3P8H A;  4ATO A;  3GBQ A;  3BFM A;  2OAW A;  1ZUU A;  3IQL A;  4TVR A;  5GAO r;  2BZ8 A;  4RKU E;  1VYU A;  2AZS A;  3G4S Q;  4KUI A;  1JQQ A;  3ZL7 C;  1JBM A;  1K0S A;  1IRE B;  2E12 A;  2VV5 A; 
#chains in the Genus database with same CATH homology
 1G3W A;  2QQR A;  5FLX E;  4O5V A;  3HRU A;  5IT9 E;  5CCA A;  3OYE A;  3G6E A;  5D6W A;  4JS5 A;  2FVU A;  2WSE E;  4C8Q A;  1YJ9 A;  2C06 A;  2FYK A;  2LT1 A;  1M4Z A;  4NS5 A;  4BB7 A;  3ASK A;  3M59 A;  2X4X A;  3GF5 A;  3JB9 I;  3G71 T;  3CC7 T;  1N27 A;  1OYX A;  1V29 B;  4OMF B;  4M75 D;  2DEQ A;  2XU8 A;  5AYF A;  4O6J A;  3BDL A;  3FEO A;  2OTJ T;  2PUO B;  4J7I A;  5GMK h;  3FC3 A;  1M1K C;  3LWH A;  4A4K A;  1UGR B;  4BUG A;  2E10 A;  4A54 A;  3PGG A;  1YJN A;  3HFO A;  4FU6 A;  3X24 B;  4QQ6 A;  2P4T A;  5CIU A;  2RJE A;  5GAN j;  1ZHI A;  2EJG A;  5M9O A;  4X9D A;  5LJ5 j;  4M75 A;  3JCM c;  1VQ8 A;  2EIF A;  1KQ2 A;  2HQX A;  4OP0 A;  4N0A A;  1O75 A;  4XTY A;  2LDM A;  3MP6 A;  2L89 A;  2DXB A;  1BI0 A;  4MML A;  4Q5W A;  5LJ3 d;  3URG A;  4XTZ A;  4M7D G;  3A8H B;  1XQH A;  4QVZ A;  3MHX A;  1Y96 B;  5GAM e;  3V7S A;  2DAQ A;  4M78 E;  1VQN A;  5FU7 B;  3S3O A;  4PLI A;  2P0P A;  3CEY A;  3CCJ T;  2QDY B;  1WJS A;  3LYI A;  4X9C A;  4RMO A;  3OBW A;  4BD3 A;  3I56 T;  4RCB A;  4B9X A;  1VQL T;  3GLX A;  2R5M A;  4LD9 K;  3WVD B;  4A53 A;  4C5E A;  2JNG A;  2PVG B;  1RI0 A;  1KC8 U;  4KBM B;  2EWN A;  3QPH A;  3OYI A;  2HQE A;  4ELZ C;  4PJO G;  5LJ3 h;  4NL2 A;  5KE2 A;  3RKX A;  4IUV A;  3HRT A;  5GAO n;  3JCM b;  2E1H A;  2MWO A;  3OA6 A;  2O4X A;  3G71 A;  3C4S A;  3CC7 A;  3QBY A;  3M4G A;  2QA4 T;  1K9M U;  2D9T A;  5HY6 A;  4M7D B;  1EIF A;  3AHU A;  2QQA A;  3OYB A;  1VQ5 T;  2OTJ A;  2DD5 A;  2LQ8 A;  3OYM A;  4QVD A;  1KQS A;  3OYG A;  5GMK j;  3VU3 C;  1VQ9 A;  4EPC A;  1YJW T;  1BYM A;  2F69 A;  2ZPG B;  3SFM A;  4ZTF A;  5IN1 A;  4JUV A;  3OYN A;  1WJQ A;  1W2B S;  4EMK C;  4KUL A;  5GMK i;  1VQ7 T;  4BI8 B;  3OY9 A;  3VKI A;  1GXI E;  1FX7 A;  3CC4 T;  2DKG A;  2YLC A;  4C0F A;  1UGP B;  1D3B B;  3M57 A;  3CXC A;  3A8M B;  1VIE A;  5EG2 A;  4VUB A;  2FL7 A;  1LOJ A;  3X26 B;  4M7D A;  3PNW C;  2EJF A;  3M58 A;  1Q82 U;  4PJO B;  4XU2 A;  4MZT A;  4ZGD B;  2MWP A;  3T9N A;  3QZ9 B;  4OVA A;  3RMQ A;  2GF7 A;  3VYG A;  4J6W A;  3QHS A;  3E9G A;  3QII A;  1BKB A;  4HCC A;  2JOY A;  1KC8 C;  4OB2 B;  3M5A A;  1BIA A;  3WVE B;  1VQL A;  2CZ1 B;  2R58 A;  3LWI A;  5GAM f;  3DLM A;  1N6A A;  1K9M C;  4C92 G;  4E7K A;  2K3Y A;  1G3Y A;  3H6Z A;  1U8R A;  3MET A;  2D0Q B;  4C0D C;  2VUB A;  4JS4 A;  2HD0 A;  3OYH A;  1G3T A;  2ZZD A;  5CVI A;  5LJ3 j;  4PJO A;  1QW1 A;  2HNI A;  4Z02 A;  3M9Q A;  4F7U G;  1NPR A;  1VQ4 T;  3QYG B;  2LVM A;  4IUR A;  1YIT T;  2JTF A;  3SB2 A;  2DK3 A;  3L2Z A;  4DOV A;  1MHN A;  4XU0 A;  3SDZ A;  3DB4 A;  5GAN h;  3QJ6 A;  4HKE A;  2F5T X;  1YJW A;  3OQ5 A;  3JB9 G;  1WGS A;  4C92 F;  3DB3 A;  4C92 E;  1Q7Y U;  1VQK T;  3RIR A;  4ME7 A;  4N4H A;  3JCM e;  5HK3 A;  4J6Y A;  1Y71 A;  5A0L A;  3UWN A;  1BIB A;  2FHD A;  2RK2 A;  4M77 G;  1VQ7 A;  5DLQ E;  2EQU A;  4F7U F;  4JRI A;  4F7U E;  4ZN1 A;  3OYA A;  5GAN g;  5I2M A;  1SSF A;  3UDC A;  1QP3 A;  4EMK A;  4C92 B;  4BDZ A;  3CPF A;  3JCM V;  2OAU A;  5DM7 R;  1H3Z A;  1XTD A;  2PU9 B;  3HFN A;  3HP9 A;  5FRN A;  2VGM A;  3FB9 A;  4IUP A;  4M77 F;  2LX9 A;  5CQY A;  1K8A C;  2AHJ B;  3ER0 A;  3CBM A;  4C8Q E;  4F7U B;  4ZN3 A;  1QVF A;  5GMK l;  3RER A;  3L2Q A;  4HT9 A;  2KY9 A;  3PMI A;  4V2S A;  2MF2 A;  2D6F A;  4HA8 A;  1M1F A;  2JN0 A;  4EMG A;  3X25 B;  3TU4 K;  1M5Q 1;  2DTO A;  1G3S A;  3DKM A;  3H8Z A;  5FU7 C;  3RKY A;  5GAM d;  3OW2 A;  2ZGW A;  1M9S A;  4XTW A;  3ME9 A;  5A0D A;  3CCU T;  5KE3 A;  4C5I A;  5GAN 8;  5C6S A;  1FWZ A;  3INZ A;  4M77 B;  5KCH A;  3CCR T;  4JRP A;  2PVO B;  2BUD A;  5GAN 4;  2RHZ A;  1X6O A;  1KQ1 A;  2MI6 A;  3DLL A;  1YIT A;  2JUF A;  3BY7 A;  3QYH B;  2K5L A;  2XDP A;  2YHT A;  4M78 G;  3KBG A;  3L2U A;  2KMT A;  3OYK A;  1Q7Y C;  5CAI A;  1YI2 T;  4E7L A;  4A4G A;  2RM4 A;  3NTK A;  3A8L B;  4XTU A;  1VQK A;  2LRQ A;  4M7D C;  4BE1 A;  4FL6 A;  3A8O B;  4ELY C;  4PL6 A;  5GAM h;  5FU6 B;  1UGS B;  2CZ6 B;  4OF1 A;  3EAE A;  4M77 A;  5CKB A;  1U1T A;  3SWN B;  4QVC A;  5J39 A;  3QDR B;  3JAM E;  3G4S T;  3QSU A;  3CCS T;  2XHC A;  1K73 U;  4M78 F;  5CKE A;  3X20 B;  3JCM P;  1JRI A;  2B8A A;  3S6W A;  5GAO q;  3VUB A;  5GAM g;  5I21 A;  3JCM f;  3CME T;  3OYJ A;  1BI3 A;  3CPW S;  4DA4 A;  1QVG A;  1W4S A;  3PFS A;  1NJI C;  2RB6 A;  2QQ9 A;  4MMK A;  3CCQ T;  3BW1 A;  2DPP B;  4J7F A;  4RG8 A;  4JLG A;  4M78 B;  3NFC A;  3A8G B;  4UC4 A;  4PJO C;  2LT4 A;  4MZP A;  3SD4 A;  4J6X A;  4HCB A;  2WAC A;  2Y4Y A;  2V8K A;  1JB0 E;  2M1H A;  3CCU A;  4MZM A;  4A4E A;  3OYD A;  1Y96 A;  1I8F A;  2DZ9 A;  3E9F A;  3OYL A;  2LCL A;  4BI4 A;  1WQW A;  4X34 A;  4R55 A;  3JB9 H;  2KDS A;  1N9S A;  1JJ2 A;  1KD1 U;  2DXU A;  2EFI A;  5LJ3 g;  4M7A G;  1NE8 A;  4M7D D;  2XI9 A;  4C0Z A;  3EFS A;  1YI2 A;  3CCM T;  2XDB A;  3OYY A;  3UPU A;  3CD6 T;  4JDS A;  3CCE T;  1WNL A;  3S3N A;  3EFR A;  1K73 C;  2JTM A;  5GAO l;  2RJF A;  1VQP A;  2MMP A;  3HKS A;  1DJ7 B;  1P92 A;  3HRS A;  3N5B B;  5CO7 A;  5GAM j;  3JCM W;  2EQM A;  2XID A;  2DXC A;  3CCS A;  3V8J A;  4M7A F;  2RD1 A;  4M7A E;  2X4W A;  3UT1 A;  2R5A A;  1FXX A;  4GLK A;  1RL2 A;  3M53 A;  5GAN 6;  3JCM d;  3CME A;  1N9R A;  3O8V A;  2DZC A;  4E7J A;  4PJO D;  2L5Q A;  4A4H A;  4L59 A;  3I56 A;  4LDU A;  2DJZ A;  4OGE A;  3CCQ A;  1K8A U;  1G5V A;  4C92 C;  4M7A B;  2RI5 A;  5GAO p;  2CZ0 B;  3C12 A;  3X28 B;  4JJN K;  3ZEH A;  3M54 A;  2M16 A;  3L42 A;  1D3B A;  1Q86 U;  1Y7X A;  3MCA B;  4L5G A;  3VYH B;  1KD1 C;  3RKW A;  3CCL T;  2XG8 D;  2WSC E;  4FSX A;  2RH2 A;  2QA4 A;  1VQP T;  2V8I A;  1QP2 A;  1O9S A;  2KQW A;  4XU3 A;  2RJC A;  4OB1 B;  3R6O A;  5GAN 2;  1VQ5 A;  5DLO A;  3GNG A;  4LDW A;  1VQO T;  4B9W A;  3J81 E;  2P0K A;  5GMK m;  4J8O A;  1B34 B;  1Q81 U;  4ZGJ B;  1IZ6 A;  3QG1 A;  2NLU A;  4C8Q G;  4M77 C;  3E1S A;  4WF2 A;  3CCM A;  2GFA A;  3CBO A;  3NTH A;  1M1G A;  2LTO A;  2KAF A;  2PUK B;  2QQS A;  4LD6 A;  4XTV A;  3TCJ A;  3LGL A;  3J80 E;  1X75 C;  4Y28 E;  4RG2 A;  3F70 A;  2A3L A;  2EKO A;  2EQJ A;  2K57 A;  3HL8 A;  2X4Y A;  4JLI A;  3CCE A;  1YHQ T;  2VGN A;  3VV0 A;  1YIJ T;  3M56 A;  3CC4 A;  1H64 1;  1KQS S;  3GPL A;  4A4F A;  3QUI A;  3TRE A;  2HAX A;  2E6Z A;  4C5G A;  2RI2 A;  4LDV A;  4N4I A;  4C8Q F;  4C92 D;  5FRM A;  3FRN A;  4FM4 B;  5CR2 A;  3GP8 A;  1PSF A;  2DIQ A;  4M75 G;  2RHI A;  2K5F A;  1HXD A;  3GNF B;  4OB0 B;  2GCX A;  1XNI A;  3L1A A;  2GQV A;  5HKC A;  3OS0 A;  1Q86 C;  1NJI U;  3PMT A;  1AHJ B;  2QXF A;  3C94 A;  3MEW A;  5GAN e;  3I55 T;  3CXC S;  3L2W A;  2GFU A;  3V7C A;  5LJ5 e;  2E64 A;  2YLB A;  4C8Q B;  3LW5 E;  3L2R A;  1LNX A;  2QEX T;  4C92 A;  2RHU A;  1X01 A;  4C0G A;  3JB9 D;  4JRQ A;  4CI0 C;  2DIG A;  4LDX A;  4YTL A;  3CCL A;  2Y4X A;  1VQN T;  2ZPB B;  2DO3 A;  4M78 C;  4CRI A;  4HT8 A;  1OZ2 A;  1VQ4 A;  1Q81 C;  4F7U A;  2RK1 A;  4M75 F;  5CKH A;  4M75 E;  4M77 D;  4N4G A;  4KT0 E;  2I2L A;  4C0D B;  2XKO C;  3OS1 A;  4QW2 A;  3KUF A;  2DTI A;  4J83 A;  3ZBD A;  4IKF A;  2QI2 A;  5A2Q E;  3S3M A;  1VQO A;  1VQ6 T;  1Y07 A;  2ZCF B;  3OS2 A;  4XU1 A;  3HSB A;  3P8B B;  2VC8 A;  1OZ3 A;  3WXM B;  1BI1 A;  3LX7 A;  4M75 B;  1KHC A;  3BDU A;  3OYC A;  1VIF A;  1W2B A;  2Y90 A;  1YHQ A;  4J5Y A;  1M8V A;  3FJP A;  1OI1 A;  3E19 A;  2IVW A;  2CYZ B;  1YIJ A;  3QJY A;  1N8R C;  3A5Z B;  2LCC A;  4BY6 B;  2L3R A;  1HK9 A;  3MO8 A;  3LLR A;  1WPY A;  2E65 A;  2A7Y A;  2LQK A;  1ZQ1 A;  1VUB A;  4C5H A;  1VQ9 T;  3CBP A;  2R57 A;  3JRZ A;  3PIO A;  2EJ9 A;  3JCM X;  4BE0 A;  1S72 T;  5GMK e;  1KG1 A;  2RO0 A;  4NOY A;  2KSS A;  3MEV A;  3TEE A;  4OGC A;  2BIV A;  3CCJ A;  3V8L A;  3I55 A;  4E7H A;  3CMA T;  4IUU A;  1LJO A;  3SWN A;  5GAO m;  4E7I A;  1UB4 A;  2PQW A;  4L6V 5;  4M78 D;  5HK0 A;  4BAC A;  3OBY A;  2QEX A;  2EYQ A;  2M9U A;  5CKF A;  4MDW A;  4PNO A;  2O4X B;  1QVF S;  4FIB A;  2K4Y A;  3CCR A;  1YCY A;  4Y91 A;  4XQ3 A;  2K5I A;  5GAN 3;  1M90 U;  3LH0 A;  4M7A C;  3M4Y A;  2WSF E;  1XOV A;  2RJD A;  3ZFJ A;  1I4K 1;  5GAN f;  5DY9 A;  3MP8 A;  2VXF A;  3RUX A;  4PLL A;  3FLG A;  5LJ5 f;  2XIC A;  2K2V A;  4KUD K;  4M78 A;  2KK4 A;  3M55 A;  2CS7 A;  1R8O B;  3OW2 S;  3V8K A;  1VQ6 A;  4M7D F;  4M7D E;  2ZPE B;  3JB9 J;  4QQG A;  2KVQ G;  2CKK A;  4II1 A;  1PSE A;  2G3R A;  3J7A F;  4BI3 A;  2RHX A;  4EMH A;  3OMG A;  5L8R E;  3OSS C;  2JZ2 A;  4R56 A;  4RCC A;  3G4S A;  2L8D A;  2O01 E;  2P0Q A;  2H3J A;  3MEA A;  3G7Z A;  3MP1 A;  4OB3 B;  2XD0 A;  2RA2 A;  1QVP A;  2QQB A;  3FIF A;  3VUZ A;  5LJ3 e;  3CC2 T;  5GAN 5;  1VQM T;  4FT2 A;  3OB9 A;  3QO3 A;  4XK8 E;  4NL3 A;  3JCM J;  1NPP A;  3OS5 A;  4EDU A;  5FRO A;  1S72 A;  2OTL T;  4LDY A;  3CCV T;  5CQX A;  4PJO F;  3MEU A;  4PJO E;  3GOX A;  1U1S A;  1MGQ A;  1UEB A;  2DTH A;  3Q1J A;  4E47 A;  3CMA A;  2DD4 A;  3KXT A;  5D6X A;  2QTX A;  4M7A D;  4HCZ A;  3PIP A;  1M90 C;  1ZBX A;  3QXE B;  4XAX B;  3QZ5 B;  1NZ9 A;  4PKC C;  3RES A;  1QVG S;  4BE2 A;  2ZPI B;  3RMS A;  4D6W A;  5KCO A;  1WQ7 A;  1WJR A;  2ZPH B;  3V7R A;  2EAY A;  4ZGE B;  3GIB A;  4JRK A;  2M0O A;  3JCM h;  3VJP A;  4C8Q C;  5GAN d;  2LNV A;  2E70 A;  3NTI A;  5LJ5 d;  3P8D A;  5GAN 7;  3HHT B;  4M7A A;  3G6E T;  5LL6 S;  3OSV A;  3PTA A;  1YJ9 T;  2BKD N;  2PVD B;  2RHY A;  2XK0 A;  3JCM Q;  1I5L A;  2ZPF B;  1KHI A;  3CD6 A;  4MDX A;  2K3X A;  4XTX A;  5J3B A;  3JCM g;  5IAY A;  1YBY A;  2JVV A;  2RI3 A;  3HPW A;  1JJ2 S;  3OYF A;  2LC4 A;  4EMK B;  2F5K A;  2DXT A;  3LGF A;  2VYT A;  2DVE A;  5C0M A;  2E6N A;  2X35 A;  4P5N A;  4QQD A;  3CC2 A;  1VQM A;  2HBP A;  2MAM A;  1N8R U;  4M75 C;  1YJN T;  1B34 A;  5FU6 C;  3OMC A;  5D6Y A;  2IG0 A;  3C95 A;  4N0A C;  3SWN C;  5LJ5 h;  3FDR A;  2E41 A;  4ZTJ A;  1M1K U;  2E5Q A;  2OTL A;  3CPW A;  1TH7 A;  2FB7 A;  4IUT A;  1VQ8 T;  4FT4 A;  3CCV A;  4BY6 C;  2VXE A;  3PT9 A;  5J26 A;  4DQ2 A;  2CGH A;  5LJ3 f;  1Q82 C;  3P8H A;  4ATO A;  1UGQ B;  2EQK A;  3L2V A;  3BFM A;  5LJ5 g;  2V8J A;  3QKJ A;  5CK9 A;  5A0G A;  2YRV A;  4TVR A;  5GAO r;  4C8Q D;  2XDD A;  3JSC A;  1BI2 A;  2X4J A;  4RKU E;  4BDY A;  4GY5 A;  5I2S A;  3JB9 F;  5KH6 A;  4IUQ A;  2CZ7 B;  4KUI A;  5CKD A;  4DOW A;  1JBM A;  1I81 A;  1IRE B;  2E12 A;  2VV5 A;  4M77 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...