3M4GA

H57a hfq from pseudomonas aeruginosa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
68
structure length
68
Chain Sequence
b'KGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKAAISTVVPSRPVRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein hfq
molecule tags Rna binding protein
source organism Pseudomonas aeruginosa
publication title The structures of mutant forms of Hfq from Pseudomonas aeruginosa reveal the importance of the conserved His57 for the protein hexamer organization.
pubmed doi rcsb
total genus 15
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3m4gA00
1JRIA 4JRIA 3V7RA 2DZ9A 4N0AA 3V8LA 1HK9A 5GAOn 4WF2A 1I5LA 4M7DF 4XTUA 4PJOB 3PGGA 3JB9G 1HXDA 4QVDA 3JCMh 4C8QC 3QSUA 5GANd 3JB9F 4EMGA 4EMKB 5GAN4 5GAMe 3JB9I 2E64A 4N0AC 2RA2A 5LJ3h 4M78F 3RESA 5GAOl 5GAOr 4JUVA 4C8QE 3RUXA 1KQ2A 4M78G 1I81A 4MMKA 3RERA 2FB7A 1M5Q1 4A54A 4F7UF 5GMKh 1U1TA 2E41A 4V2SA 4M77A 4X9DA 4M75D 4M7AD 3FIFA 3RKWA 4C8QD 5GMKe 5LJ5g 3L1AA 3SWNB 1WQWA 3QUIA 4XTXA 2RB6A 4XU0A 1YCYA 1Y96A 3INZA 4M7DG 3V8JA 1WPYA 4XQ3A 5LJ3g 1WQ7A 5DY9A 1KQ1A 4A53A 4C8QB 2ZGWA 5LJ3e 4C92B 5GAMh 1H641 5LJ3f 3JB9D 2DTOA 4M78B 1N9SA 5GAOm 2EWNA 4PJOC 4QVCA 4DQ2A 5LJ5e 5GANf 4HT8A 2EJFA 2YLBA 4M77D 3GIBA 2DZCA 4HT9A 3EFRA 3JB9J 3JCMJ 5GAN7 2FYKA 1BIBA 4M7DE 4M7AE 1LOJA 2JN0A 4XTVA 4XTZA 5LJ5j 4PNOA 3BFMA 4M75C 4NL2A 4M7DB 4OP0A 4M78A 3HSBA 4C92C 4M7AA 2RM4A 4HA8A 4M77G 5LJ3j 4JRKA 5GAMg 2EJ9A 3EFSA 4M78E 4PJOD 4M77F 2DJZA 3RIRA 4J5YA 4C92E 3V7CA 5GAN8 1B34B 2YHTA 4M7DA 2EJGA 3JCMd 1U1SA 5GMKj 3AHUA 4M7AB 5LJ5h 2EAYA 1WNLA 3M4GA 3JCMX 2RD1A 5GAN2 2DEQA 4NL3A 4RCBA 2I2LA 1I8FA 2E10A 2Y90A 4C8QG 3HFNA 4C92G 4M75A 2VXEA 3VU3C 1B34A 3V7SA 4NOYA 4XU3A 1BIAA 3QO3A 3BDUA 4C8QF 3V8KA 4C8QA 2DTIA 1JBMA 4C92F 2E1HA 4C92A 4F7UA 5GAMj 2QTXA 4M77E 1MGQA 3RKYA 5I21A 5GAMf 5GAOq 4M77C 4XTWA 3JCMW 5CAIA 1I4K1 4M75B 4EMHA 4EMKA 5LJ3d 1TH7A 4M7AG 3JCMc 3FB9A 1D3BA 3SB2A 5GMKm 4F7UB 4M7AF 1M8VA 4XU1A 4X9CA 5LJ5d 1LNXA 3SWNC 4F7UE 2VXFA 3JCMP 3QHSA 2DXTA 4M75G 4MMLA 4M7DC 4J6WA 4M77B 3BY7A 4C92D 5GANh 4M75F 2DVEA 1Y96B 4RCCA 1D3BB 4XTYA 4M78D 2DKGA 4PJOE 3SWNA 5LJ5f 5GAN3 3HFOA 5GANe 4PJOG 3JCMe 3JCMf 4Y91A 3JCMQ 5GANj 4JLIA 2VC8A 2DTHA 3JCMV 1N9RA 3FJPA 4PJOF 4M78C 1LJOA 5GMKl 2HNIA 4PJOA 2CGHA 1X01A 2DXUA 4J6XA 4J6YA 4M75E 3JCMg 4EMKC 3BW1A 4F7UG 5GANg 4M7DD 2YLCA 3RKXA 4M7AC 2K57A 3L2ZA 3JB9H 5GAN5 5GAMd 5GAOp 4XU2A 5GMKi 3JCMb 5GAN6 2E65A
chains in the Genus database with same CATH superfamily
1Q81C 3VS4A 4PJOB 4B9XA 1ABOA 1GFDA 3PGGA 3QKJA 3CCVA 5FWCA 2GNCA 2VGMA 1Y07A 4RUGA 4J7FA 2A36A 1UGQB 3H0HA 2HD0A 5L23A 3MP6A 5J3BA 1JO8A 3UPUA 2F1LA 5CKEA 2EYZA 4P5NA 1I1JA 3CCEQ 5KYNA 3LLRA 3E1SA 5AT1B 3JRZA 1RLPC 3G4SQ 2F2VA 1KC8C 2OTLT 4PJOC 5CIUA 4RTWA 2DZCA 2NUTA 4KGXB 3JCMJ 1BIBA 3LYIA 5LJ5j 4M7DB 3OSVA 1Q7YC 2CT4A 1PCXA 1V29B 1PHTA 4OGCA 2EJ9A 2NUTB 4IUQA 1UECA 2P0QA 1KD1C 1Q95G 2YXYA 2EAYA 4N4GA 2D8HA 2C0OA 1R0BG 3OYCA 2Y90A 2JVVA 4BD3A 4J9BA 3QO3A 2DL7A 4WCIA 1NJIR 3X20B 1K4US 2B8AA 2YT6A 1D1AA 1U3OA 2CP7A 3URGA 3VYGA 4OB2B 2XU8A 3H8ZA 2X4XA 3QHSA 4RMOA 4MMLA 4J6WA 3TEEA 5GANh 2LX7A 3L2UA 4J9GA 1Y7XA 3CCLQ 3EG3A 1N9RA 3EG1A 3TSWA 1S72A 2DXUA 4M75E 4J6YA 2BTTA 1V1CA 2ZPBB 2EGAA 1OI1A 1TG0A 2DIQA 3VYHB 3NGPA 1ZX6A 2BUDA 1QVPA 1I07A 2E64A 5FLXE 2NUPA 4JUVA 5FU6C 1AWWA 4OMOA 1BYMA 2FB7A 3CC7T 4F7UF 2DBKA 2QQAA 1VQ8A 1A0NB 4OB3B 2GTOA 3CC7Q 4BDZA 5HK0A 3L2QA 5HCKA 3G6EQ 1R77A 2KT8A 4ZGDB 2JS0A 2YUOA 3C0CA 3CXCP 2P84A 4ZGEB 4R0KA 2CP3A 4L5GA 4YTLA 5FRMA 3JB9J 2FYKA 2HSEB 1J3TA 4PNOA 3BFMA 2K79A 1SHGA 1VQ4A 1C1AA 3G6EA 1MUZA 1IZ6A 2A37A 1D0YA 5D7UA 3CC4Q 4OB1B 1G83A 2DJQA 2I2LA 2IVWA 1ZA2B 2E10A 2GGRA 1YJWT 2RQVA 3G1JA 4M7AD 3OS1A 1JJ2P 4F7UA 1K73U 1TUCA 2A0FB 3QWXX 5C6SA 4HVUA 1U5SA 3CMEQ 2MAMA 4F7UB 1WLPB 1M8VA 1JB0E 1JXOA 2DXTA 5IN1A 4FW1A 3H6ZA 2DVEA 2XICA 3JCMQ 4PJOG 2ENMA 2XIDA 4LDVA 4HXJA 4M78C 3GNFB 2LCCA 2HSPA 3QZ9B 2QQ9A 4IURA 2PVDB 1IO6A 2F2XA 2V8IA 5GAN8 1VIFA 2RMOA 1SPKA 2CP2A 3QSUA 1NLPC 2LQ8A 1NEGA 1JJ2S 3WXMB 5KCOA 2DAQA 2WSFE 4JDSA 1EFNA 1SSHA 3OYLA 4IIOA 1I81A 2HMAA 2QAZA 4DBHA 4M77A 2ABLA 2MYSA 2E5QA 1E6HA 2QGGA 3KUFA 4LD9K 2RB6A 2QDLA 1RI0A 5CKHA 1VQMA 4QQGA 2SRCA 4C8QB 2JM8A 3ER0A 3FRNA 2DL3A 3OBYA 2KRNA 3LX7A 2JUFA 3EAEA 4HT9A 4PFPA 2DL4A 1K8AC 1JXMA 2CZ6B 4OVAA 3U23A 2EW3A 1VQ9T 1OULA 3HHTB 1QCFA 2D9TA 2LVMA 1VQOQ 1QCNA 4MDWA 3RBBB 3QPHA 4M4ZA 4C5IA 1WHHA 1W2BS 4NL3A 1AZGB 2DLPA 1OPKA 3CCQT 1XQHA 1KIKA 1V76A 4FYWB 2KRMA 2J6KA 1JBMA 5IT9E 1TS9A 3G7ZA 1OV3A 3G71T 4D6WA 4GBQA 4FL6A 3MEWA 4A4EA 3S6WA 1BBZA 1UEBA 2DD5A 3JCMP 1D1CA 1Q82R 1GBRA 3CCSA 4C92D 3FLGA 1NJIC 1WHJA 4R55A 5I2SA 3CCUQ 2V8JA 4M7DD 4HVVA 4M7AC 4FIBA 1WX6A 3PNWC 1ZSZA 2DD4A 3VJPA 1QVGP 1W70A 2VV5A 2ZPGB 3V7RA 1VQ9Q 2CT3A 3V8LA 1OU8A 4WF2A 1YJWA 1NYGA 2O01E 4UC4A 3RMSA 3JB9I 1KSWA 2RHYA 2KDSA 3PMTA 2HAXA 2E41A 2CREA 2YRCA 3EGDB 4PJMA 1RLQC 3O5ZA 1KHCA 5GMKe 2C0IA 5LJ5g 3OYJA 1KQSA 2L8DA 1N8RR 2CP5A 1RADB 1Y96A 3MP8A 3A1PA 4A4KA 2NWMA 2DRMA 2PNIA 3OYIA 1X6GA 2A08A 2K3BA 5GANf 4IKFA 3MCAB 3OYHA 4JJDA 2PVOB 4AFZC 2RO0A 1PSFA 5GJVB 2YUQA 3EG2A 1GFCA 4KT0E 4JRKA 1NZ9A 3C95A 2J6FA 4E6RA 4M78E 3HL8A 4C5GA 3A8MB 1VQNQ 4A4HA 2CZ1B 3OYEA 1NE8A 4EDUA 1YITA 2NUZA 2IPOB 1YHQT 1R8OB 1UJ0A 3I5RA 2EYYA 2VXEA 3RR6A 3V7SA 1I0CA 2CYZB 4C8QF 1YIJT 2OTJT 3S3NA 1SSFA 4XTWA 4J8OA 2M51A 1YI2A 3META 3SB2A 2XG8D 4OMFB 4XU1A 3A8GB 3E2UA 3E19A 3M55A 1VQ7Q 2OTLA 4MZPA 1VQMT 2R58A 1VQ9A 5KH6A 1QP2A 5GAN3 1YN8A 3CPWS 3JCMV 4JS5A 1VQ7A 2K5FA 3CCLT 3VRZA 3S3OA 4LDXA 2OTJQ 4AFSC 4F16A 5GAMd 2BZXA 4CRIA 4AG1C 5A0LA 3CCSQ 1FXXA 3MO8A 4AFQC 3Q1JA 2B86A 2RQTA 4AG2C 1MMDA 4XAXB 3G71A 4C8QE 1UHFA 1EIFA 4GLKA 4V2SA 1D09B 1JQQA 3QZ5B 4M75D 4BACA 3VV0A 1AWJA 1WQWA 2KBTA 1UG1A 1Q86C 2AKLA 4C5EA 2J05A 1X6OA 3CCUA 1YP5A 1SRLA 3HP9A 4J7IA 5LJ5e 3CXCS 1VQ6Q 5KE3A 4IUTA 3GIBA 4II1A 4PFZA 5KYYB 4XTVA 2QA4A 1B07A 3NTIA 1VYUA 3CXCA 2KY9A 2M0OA 2W10A 2RM4A 2ZCFB 1YWOA 2DXCA 2XMFA 2ZPEB 2X4YA 5KYWA 3UWNA 3V7CA 1WHGA 1H3ZA 3H41A 3AHUA 2LT1A 1SHFA 3JCMX 2JZ2A 2FEIA 2JM9A 2QQBA 3HFNA 1W4SA 4C8QA 2LDMA 3HRSA 3VKIA 1PKSA 3CCQQ 2LX9A 1Q81U 1TTHB 2EGEA 5EG2A 3I9QA 1YI2Q 2MK5A 1ZUUA 2QEXA 3PFSA 1LNXA 2VXFA 3G6ET 3M0PA 2KVQG 3D7SB 3A8OB 4XTYA 4R56A 4ZNXA 3FEOA 4Y91A 2DBMA 1ZSZC 4GLMA 2Y4XA 3HPWA 5IXFA 1QQJA 1OU9A 3RKXA 2RH2A 3QG1A 5DLOA 1UUEA 4J9FA 1I5LA 3REBB 2O4XA 1VQNT 1TU0B 4MZTA 4C8QC 1YIJA 2LZ6B 3EH1A 2EQKA 4A63B 1E6GA 3CCJQ 2RI2A 1IHVA 3EHQA 3RUXA 6AT1B 1U1TA 3CCMT 1YIJQ 1ZQ1A 3IQLA 1D1BA 3CCMQ 3EH2A 2FPDA 3LGFA 2JMAA 2GF7A 2HQEA 1VQOA 1K8AR 5LJ3g 5DY9A 3ZBDA 4RTVA 1YCSB 3M0SA 3CQTA 4M78B 2L2PA 2CH4A 2DETA 1ZSZB 2RI3A 1VQ7T 4M7AE 2D0QB 4NL2A 2AHJB 4C92C 5M9OA 4HA8A 4M77G 1NPPA 2QK0A 3GLXA 1FMVA 2LJ3A 3H9NA 4PJOD 4M77F 2DJZA 2M9UA 2AKKA 1Y0MA 4JJBA 4RG8A 7AT1B 1VQ5Q 1C0MA 3NTKA 1GRIA 4XU3A 1BIAA 4QKUA 1QVGS 4BE1A 4OMMA 1Q7YR 4LN2A 2D0NA 4A4GA 2KGTA 3JCMc 2QYZA 4KUDK 3OS5A 4X9CA 1RAHB 2K2MA 3LW5E 1M3BA 1WJSA 4PJOE 4N4HA 2BZYA 5GANe 1QVFS 4HCKA 1ZBJA 2DL8A 2HDAA 2ZZDA 3PT9A 4F14A 3CCQA 1QVFA 2YLCA 2M16A 5GAOp 1QKXA 1IRXA 1VQKT 1WHMA 1WDXA 1D0ZA 1M90R 2WSCE 1WXBA 2XD0A 4PLLA 3EG9A 5GANd 2Z0WA 4EMGA 1UGVA 2SEMA 4EMKB 3CC2A 1WI7A 3JAME 2YUPA 1RACB 2KROA 1E7OA 2PQWA 2BE9B 2O88A 1WHLA 1KQ2A 1ZA1B 5GMKh 2PZ1A 2A28A 2KQWA 3O8VA 2ED0A 1YI2T 1ZUKA 3SWNB 2MPXC 3LH5A 4XQ3A 2QI2A 2VKNA 4C92B 4OB0B 3TREA 1AD5A 2QQSA 2DTOA 2FRWA 1YITQ 1QVGA 1PSEA 1ABQA 3EFRA 4KUIA 1VQLA 1LOJA 4DOVA 3OW2P 4Z8AA 1VUBA 1CKAA 1NG2A 1KJWA 1YBYA 2YHTA 2G6FX 1VQKA 1AOJA 2JTMA 2MF2A 2DA9A 2FZGB 1FMKA 2RJCA 1B34A 3BDLA 4CC2A 2CUDA 5IH2A 3OYDA 2EVRA 1YJNT 4DOWA 3WVDB 1M1KU 2MMPA 3E9FA 1VQOT 4K11A 1PWTA 2FPFA 1WJRA 1D3BA 2R57A 4RTZA 3OQ5A 4M75G 4M7DC 4M75F 1QKWA 4DA4A 5DM7R 1NBEB 3I55T 4IUPA 1IREB 2X51A 3RMQA 2RPNA 1QWFA 3JB9H 2RHXA 1MMNA 1WXTA 5CAIA 3J81E 1N8RU 4FT2A 1TWBA 2NYSA 2BKDN 5KYUB 3VS6A 2L3SA 1YHQA 2IIMA 4N0AC 2MOXA 3CCRA 2M02A 4IIMA 1VQ4T 1TXQA 3OYYA 4MMKA 1OPLA 2O2OA 1M5Q1 3L2RA 3VS3A 1FMWA 4L6V5 2RHUA 1OOTA 3L1AA 2KXDA 4MDXA 2CSQA 2HKNA 3GBQA 5LJ3e 2OTLQ 5LJ3f 1H8KA 2EWNA 4DQ2A 3QYHB 1G3YA 2ESWA 3HKSA 5KYXB 2HBPA 3NMZC 3VS1A 2YSQA 4M7AA 4LE9A 2F2WA 1RAEB 2CH4W 1BU1A 1Q86U 3TCJA 3RIRA 4J5YA 3QDFA 3QJYA 2KK4A 2EBPA 4XK8E 3JV3A 9ATCB 3CMAQ 1VYVA 2M1HA 1T0HA 2DEQA 4KULA 1DJ7B 1M27C 4BE0A 1IGUA 4C92F 3I55A 5GAMj 1UE9A 2F5KA 3X26B 3OYKA 3LWHA 2RJEA 4PK4A 3MEUA 4QT7A 5LJ3d 1TH7A 4E7SA 1WYXA 2EFIA 2FRYA 2J06A 3P8DA 4Y92A 1F1BB 4M77B 1RAAB 2MIOA 2RJFA 4M78D 1G3TA 3CCRT 3SDZA 1VA7A 2VC8A 5KYUA 1CKBA 2FVUA 3M0UA 3VUZA 3JCMg 1ZBXA 3CD6A 1H3HA 4QQDA 2JXBA 2DYIA 2X3WD 1QW1A 4QQ6A 1NEBA 2KNBB 3H0FA 1MV3A 3HRTA 2HQXA 5GAOr 4X34A 3EFOB 4PLIA 2XKOC 4A54A 1OEBA 5D6XA 4BE2A 2XK0A 2FZCB 2LMJA 2COZA 1YCYA 5KYXA 1AT1B 3UT1A 2GQVA 3OS0A 1KQ1A 2JTEA 2AZSA 3QYGB 3MKDA 3DKMA 1M4ZA 4BI4A 2ZAEA 3DB4A 1AEYA 1M30A 1VQMQ 1P92A 4M7DE 3SHWA 3OYGA 4NS5A 2FO0A 3X28B 2J7IA 2ROLA 5HK3A 2X4WA 1H92A 3I5SA 2KT1A 1YNZA 2A3LA 5D6WA 1T3LA 1GL5A 3OYBA 4C92E 4M7DA 2W0ZA 5CR2A 5LJ5h 4OMNA 4NOYA 1W2BA 2LQNA 4C92A 4FU6A 2AZVA 2KXCA 2K5IA 1JEGA 3R6OA 2VUBA 4A4FA 4HCBA 2X3XD 1KG1A 3CC4T 1TOVA 1MMAA 4DEXA 2FG0A 2DILA 2DERA 1G2BA 1HD3A 3M57A 5I11A 5GANj 1IGQA 4F04B 5CQXA 2EQIA 2CDTA 4LDUA 3PIOA 1NLOC 2BIVA 3CMAA 1K9MR 2JNGA 2CKKA 2K57A 2K9GA 2E6ZA 2JTFA 2E65A 2MWPA 5IHNA 2OAWA 2DZ9A 4N0AA 4XTUA 2HZYA 3L2WA 2OI3A 2DF6A 3I56Q 3THKA 1N8RC 2EYWA 3EGUA 1PG5B 1UDLA 2X35A 4BDYA 1ZSGA 2YRVA 4LXCA 2NUPB 4OGEA 2DM1A 2QA4Q 4M7DG 3L42A 3UA6A 3GF5A 1VOMA 1VQ5A 4HVWA 2AK5A 2OJ2A 5GAOm 2JW4A 1RI9A 2COYA 3QDRB 1X6BA 4AT1B 4Y28E 5IXBA 3CMEA 2ZPIB 2VWFA 2PUOB 2PUKB 2P0KA 4XTZA 1UJYA 2KI7A 2RHIA 3MPUB 1N6AA 3HRUA 1B3QA 1K0SA 4OMLA 2KSSA 3PVLA 1EZZB 4PKCC 4QVZA 2QEXT 1KQSS 4JLGA 4D8DA 3OYMA 3CD6Q 4ZTJA 2RD1A 2E5KA 2QTVA 4AFUC 3A8HB 2AIRB 2ATCB 2L89A 3V8KA 2EKHA 4OMQA 2LJ1A 4HCZA 4QW2A 3NTHA 1I4K1 4KH1B 2DPPB 3CCVT 2ED1A 4EMHA 3QJ6A 3FB9A 4F7UE 2ZPFB 1G8XA 3UDCA 3KFVA 5AYFA 3M59A 2LQKA 2VVKA 4JLIA 4MZMA 1PRLC 4FCYA 1WGSA 3ZFJA 1Q82C 4F7UG 1PC0A 1BI2A 5FROA 3T9NA 3ULRB 1RAGB 3DLLA 3EHRA 1JRIA 4JRIA 3OYFA 2E3IA 4BY6C 3R6NA 4E2FB 8AT1B 4QVDA 4KGZB 2XDPA 1CSKA 1SG5A 2KRSA 3S3MA 2V26A 2LTOA 3OMGA 1UGSB 2QEXQ 4M78F 5GAOl 1PRMC 2ECZA 1K0XA 3EGXB 3H0IA 1QP3A 2CP6A 4E47A 5KYWB 1Q81R 2OTJA 1VQLT 1SRMA 4N4IA 3C94A 4B6MA 1W2BP 1UB4A 2DYBA 4FYYB 5CKBA 4C8QD 1M3CA 5A0GA 4FW2A 2NLUA 3OSSC 3I55Q 4XU0A 2KYBA 1MHNA 4LDWA 1D0XA 2ZGWA 2E3HA 3E9GA 4ANJA 3G4SA 2RQWA 3M5AA 1Y71A 3CCEA 4OF1A 1KD1U 4DEYA 3TU4K 4RTYA 2E6NA 1NJIU 1KC8R 2GBQA 2O9VA 3EFOA 2ROTA 3VS5A 3MHXA 5ECAA 2COWA 2R5MA 3A98A 4OMPA 1W6XA 3TQ7P 2HBWA 2FPEA 4E7HA 3M4GA 2CP0A 1MMGA 2MI6A 2H3JA 2K3YA 2DRKA 4KRTA 4C92G 1GXIE 1KD1R 3PE0A 1M1KR 4RKUE 4ZN1A 3RKYA 2F5TX 3CC7A 3L2VA 2IG0A 4CC7A 2L3QA 4CC3A 1GCQA 4M7AF 5FRNA 2JJ9A 3UA7A 3CCUT 3CMET 3TSZA 1OZ2A 1UTIA 4BI8B 2C0TA 5LJ5f 1YJ9Q 1AVZC 1YFNA 1RAFB 2HNIA 5HY6A 4KBMB 5GANg 4BUGA 3BW1A 2FZKB 4E7KA 2EPDA 1OZ3A 1K73R 2D1XA 5IAYA 4JPBW 2LRQA 3KBGA 2GTJA 4D8KA 2EKOA 4CI0C 2KYMA 1Y57A 4C0DC 5LJ3h 1MV0B 1KHIA 3CCJT 3RERA 3C4SA 4PFOA 4PJJA 2OAUA 1JU5C 1M1FA 3REAB 3FIFA 5J26A 4WTOB 1VIEA 1T0JA 1UGRB 3PVQA 4JJCA 3OW2S 3QUIA 4PL6A 4XTXA 3INZA 2EYXA 2H3EB 1RL2A 4A53A 4C5HA 5KCHA 4C0GA 2DMOA 1WJQA 3VS7A 4HT8A 1WFWA 1LCKA 5D6YA 1NYFA 2V8KA 1VQ6A 1X2QA 2PVGB 4M75C 1Q86R 2LP5A 4C0DB 2P4TA 2VB6A 4OP0A 1X69A 5C0MA 2K6DA 4DBRA 3ME9A 3JCMd 1U1SA 5GMKj 5KYYA 4EIKA 1X43A 3OS2A 4JRPA 4BB7A 1QMCA 2DO3A 4LUDA 2V1QA 4ZTFA 3M54A 2JS2A 1M1GA 2LCLA 2MWOA 1Q7YU 2DTIA 4TVRA 3LH0A 1BI0A 2QTXA 1TSFA 3SFMA 2DEUA 2KR3A 3JCMW 4E7JA 3M58A 3FJ5A 4EMKA 3MP1A 2CSIA 1PM3A 1QVFP 2O9SA 1K73C 2E4HA 2XI9A 3M56A 1U06A 3QIIA 4E7ZA 3RDVA 3BY7A 1YJWQ 1VQPA 2WACA 2RQRA 3SWNA 1YWPA 4ELYC 1VQ6T 5FWBA 2X4JA 1WXUA 2LNVA 3A8LB 2A7YA 1GBQA 1M2OA 2HL3A 1NM7A 4CC4B 1YHQQ 3JB9F 5GAN4 1YJ9T 4ZN3A 1UHCA 4C0FA 4KGVB 1KQSP 2MCNA 3J7AF 1T3SA 1TUDA 4Z02A 1QCOA 2O4XB 1VQ4Q 2C06A 4X1VA 4Z89A 3DLMA 2E12A 3UF4A 1G3WA 1ZHIA 4E7LA 2DX1A 1VQLQ 1WQ7A 1XNIA 2M0YA 5GAMh 1H641 2RJDA 2BZ8A 1HJDA 1RUWA 2HL5C 2YLBA 4M77D 3VS2A 5GAN7 4FSXA 1SF9A 1VQ8T 1AWXA 4ME7A 3PTAA 2DFUA 4FT4A 2JMCA 3QBYA 4ATOA 5HKCA 3CCST 1Z9ZA 2P0PA 4RG2A 1WHKA 2EJGA 1N5ZA 4J9DA 3CC4A 4FYXB 2GCXA 1WNLA 3LWIA 3CC2T 1MNEA 5DLQE 3X25B 2J6OA 5I21A 1IHWA 1B7TA 2VASA 3CPFA 5FW9A 4IUUA 4ZGJB 3EGDA 3M0TA 4JS4A 3F70A 4KH0B 2KE9A 2VYTA 2CZ7B 1K9AA 1M90U 2XDBA 1KFZA 1Y96B 2CS7A 4RCCA 2DKGA 1X75C 4B9WA 2L3PA 5FU7C 5GMKl 2RK2A 1X01A 2D8JA 3NPFA 2ZPHB 3CBMA 4FYVB 1M2VB 5GAN5 3I56T 1TUGB 2DIGA 5CK9A 1G5VA 3FDRA 1KC8U 5A2QE 3JCMh 1M2VA 5GAMe 1PD1A 2LNHB 5CO7A 1RABB 2HQHA 2RA2A 2DVJA 4LNPA 1ZUYA 2YDLA 3ZEHA 1FX7A 3CBOA 1OX9A 4J83A 3HTRA 1OYXA 1N27A 4J9EA 2V1RA 1S72Q 1HSQA 1XTDA 5CKDA 3C12A 3EG9B 2QQRA 1K8AU 1U8RA 1BI1A 3SD4A 3OYAA 1XJWB 2RI5A 4ORZA 1NPRA 2EYQA 1VQ8Q 5CCAA 2JOYA 1BKBA 1VYTA 2K4YA 4VUBA 2Y4YA 4RTXA 5I2MA 3CCMA 4M78A 1M3AA 1ARKA 4J9IA 5LJ3j 2RQUA 4AMCA 2X9HA 4IUVA 3ASKA 1M1KC 4PJNA 5J39A 1Q82U 2HCKA 2YUNA 4HCCA 4JZ3A 3TVTA 1ACMB 2CUBA 3KXTA 2RK1A 1S1NA 3LGLA 1EX4A 1X27A 2AT1B 1I8FA 3CPWA 2F69A 3CCLA 3VU3C 2QASA 3CCJA 3BDUA 1PD0A 3N5BB 2WSEE 3J80E 1AWOA 2FL7A 4M77E 1LPLA 5GAOq 4M77C 2RNAA 4FSSA 2L5QA 2QDYB 3QWYA 4M7AG 4LDYA 3CPWP 1WIEA 3CC2Q 4DBQA 2LT4A 5LJ5d 3SWNC 1IB8A 1MNDA 1RAIB 5GJWB 1YITT 3JCMf 2RHZA 5LL6S 2CGHA 4C0ZA 2RF0A 1GCQC 2HEQA 2DK3A 2PTKA 1BCOA 1AHJB 2CZ0B 3M53A 3JCMb 5GAN6 3P8BB 2EQJA 2O31A 5GAOn 1VQ5T 1HXDA 2K2VA 2QA4T 4LD6A 4BY6B 5EC7A 2H8HA 2QG9B 3RESA 1C6VX 3G4ST 4JRQA 4M78G 3M0RA 3CBPA 3OW2A 2LC4A 3CCET 4X9DA 1K9MC 2P4RA 2XDDA 5CVIA 2OX7A 3DB3A 2D6FA 1G3SA 1WZOA 3SEMA 1WPYA 3RNJA 3PMIA 3QXEB 2L0AA 3JB9D 4PJLA 2EJFA 2EQMA 3MEAA 1KK7A 1BI3A 5KE2A 2JN0A 3ZL7C 1YJNA 1VQPQ 2YRDA 3HSBA 3EG0A 1YJNQ 3EFSA 2GQIA 3OYNA 1PKTA 1FYNA 1B34B 1BCMA 3CCRQ 4GY5A 4E7IA 1M9SA 1O9SA 5GAN2 1LVKA 4L59A 2PU9B 1OX8A 4M75A 5IHKA 1K76A 1Z9QA 1O75A 3PIPA 4ESRA 1MGQA 4M75B 2LJ0A 4BI3A 3CCVQ 2R5AA 3VS0A 1WA7A 4Z88A 3M4YA 1M8MA 1D3BB 2XHCA 1X2KA 1XOVA 3HFOA 3JCMe 2LCSA 3GP8A 2L3RA 2DTHA 3FJPA 1M90C 4PJOF 4EMKC 4J6XA 1BK2A 3VUBA 3L2ZA 2QGFB 1PNJA 4XU2A 5L8RE 2EQUA 4M7DF 1HK9A 3FC3A 3AT1B 8ATCB 3NHNA 3JB9G 2RN8A 5CQYA 2GFAA 1VQKQ 1OQKA 1K1ZA 2DE0X 5FU6B 1UGPB 2E70A 1JJ2A 3X24B 2GFUA 3JSCA 4RTTA 3RKWA 2BE7D 1ZLMA 3V8JA 3CD6T 2DL5A 3M9QA 3GPLA 2EGCA 1R0CB 2YWWA 5I22A 4LUEA 1VQPT 1I5OB 1N9SA 1W1FA 4J9CA 4QVCA 1S72T 1SKUB 3G71Q 2I0NA 2EIFA 3M0QA 5CKFA 2LQWA 3CMAT 3BE3A 3I56A 3GNGA 2DNUA 4RTUA 2G3RA 5GAMg 1UFFA 1QWEA 1FWZA 4O6JA 4M7AB 2HKQB 3P8HA 4FM4B 4F17A 1HYOA 3OY9A 4JZ4A 4RCBA 4C8QG 3VRYA 4J9HA 1VQNA 3UATA 1AZEA 3OA6A 3OBWA 4O5VA 5FU7B 4Q5WA 2E1HA 3OB9A 3OMCA 5GAMf 1QLYA 4EPCA 3MEVA 1K9MU 5IHIA 2K7AA 4ELZC 1BB9A 2K5LA 5GMKm 1GCPA 2JT4A 4DBFA 3EGXA 3WVEB 3MJXA 2DXBA 2KMTA 1YJ9A 2FHDA 3NFCA 3CEYA 4HKEA 2K3XA 3A5ZB 4JJNK 1SEMA 3GOXA 1LJOA 4PJOA 2VGNA 1IXDA 5A0DA 3I35A 2KEAA 2KAFA 5GMKi 2QXFA
chains in the Genus database with same CATH topology
4CRIA 1Q81C 1QW1A 4PJOB 4B9XA 4QQ6A 5A0LA 3PGGA 1FXXA 3MO8A 3QKJA 3CCVA 3JB9F 2VGMA 5GAN4 3Q1JA 1YJ9T 4ZN3A 3HRTA 4C0FA 1Y07A 4J7FA 2HQXA 4XAXB 3G71A 5GAOr 4X34A 1UGQB 4PLIA 2HD0A 4C8QE 1EIFA 4GLKA 3J7AF 2XKOC 3MP6A 4Z02A 4A54A 4V2SA 3QZ5B 4M75D 5J3BA 2O4XB 4BACA 2C06A 5D6XA 4BE2A 2XK0A 3DLMA 2E12A 3VV0A 1G3WA 3UPUA 1ZHIA 5CKEA 1WQWA 4E7LA 4P5NA 1YCYA 3UT1A 3LLRA 3E1SA 2GQVA 1WQ7A 4C5EA 1XNIA 3OS0A 1KQ1A 3JRZA 1Q86C 3QYGB 5GAMh 1X6OA 3CCUA 1H641 3DKMA 2RJDA 1M4ZA 4BI4A 1KC8C 3HP9A 2OTLT 4PJOC 4J7IA 3DB4A 5CIUA 5LJ5e 3CXCS 2YLBA 4M77D 5KE3A 4IUTA 3GIBA 2DZCA 4II1A 3JCMJ 1P92A 4FSXA 5GAN7 1BIBA 4M7DE 4XTVA 2QA4A 3LYIA 5LJ5j 3OYGA 1VQ8T 3NTIA 4M7DB 4NS5A 3CXCA 4ME7A 3PTAA 3OSVA 2KY9A 2M0OA 4FT4A 3X28B 5HK3A 1Q7YC 2X4WA 1V29B 2RM4A 5GMKi 2ZCFB 4OGCA 2EJ9A 3QBYA 4IUQA 2DXCA 2P0QA 2A3LA 5D6WA 1KD1C 2ZPEB 4ATOA 5HKCA 2X4YA 2P0PA 3CCST 3OYBA 4RG2A 3UWNA 3V7CA 4C92E 4M7DA 2EJGA 1H3ZA 5CR2A 3AHUA 2LT1A 3CC4A 5LJ5h 2EAYA 2GCXA 1WNLA 4N4GA 3JCMX 2JZ2A 3LWIA 3CC2T 2QQBA 3OYCA 2Y90A 2JVVA 4BD3A 3HFNA 4NOYA 1W2BA 3QO3A 1W4SA 5DLQE 4C8QA 2LDMA 4FU6A 3HRSA 4C92A 3VKIA 3X25B 2K5IA 3X20B 5I21A 3R6OA 2B8AA 3CPFA 2LX9A 1Q81U 2VUBA 4IUUA 4A4FA 5EG2A 4ZGJB 3URGA 3VYGA 4OB2B 2QEXA 4HCBA 3PFSA 1KG1A 2XU8A 3CC4T 1LNXA 3H8ZA 2X4XA 4JS4A 3F70A 2VXFA 3QHSA 4RMOA 2VYTA 4MMLA 2CZ7B 3G6ET 4J6WA 3TEEA 5GANh 3L2UA 1M90U 2XDBA 1Y96B 2KVQG 2CS7A 3M57A 4RCCA 3A8OB 4XTYA 4R56A 2DKGA 1X75C 4B9WA 5FU7C 5GANj 3FEOA 4Y91A 5CQXA 1Y7XA 1N9RA 4LDUA 3PIOA 2BIVA 5GMKl 2Y4XA 3CMAA 2RK2A 1S72A 1X01A 2DXUA 3HPWA 4J6YA 4M75E 2ZPHB 2JNGA 2ZPBB 2CKKA 3RKXA 3CBMA 2K57A 2RH2A 5GAN5 3QG1A 2E6ZA 2JTFA 3I56T 1OI1A 2DIGA 5CK9A 5DLOA 2E65A 2MWPA 2DZ9A 4N0AA 1G5VA 3FDRA 2DIQA 1KC8U 4XTUA 1I5LA 2O4XA 5A2QE 1VQNT 3VYHB 3L2WA 3JCMh 4MZTA 4C8QC 2BUDA 1YIJA 1QVPA 2EQKA 5GAMe 1N8RC 2E64A 5CO7A 5FLXE 2RA2A 3ZEHA 1FX7A 2RI2A 4JUVA 3CBOA 5FU6C 3RUXA 4J83A 1BYMA 2FB7A 3CC7T 4F7UF 1U1TA 1OYXA 2QQAA 1N27A 2X35A 4BDYA 3CCMT 4OB3B 1VQ8A 2YRVA 1XTDA 4BDZA 5CKDA 3C12A 1ZQ1A 5HK0A 2QQRA 4OGEA 1K8AU 3L2QA 3LGFA 4M7DG 4ZGDB 2GF7A 3L42A 2HQEA 1U8RA 1BI1A 1VQOA 3GF5A 3SD4A 3OYAA 2RI5A 5LJ3g 5DY9A 1VQ5A 3ZBDA 4ZGEB 1NPRA 2EYQA 4M78B 5CCAA 5GAOm 2RI3A 2JOYA 1VQ7T 1BKBA 3QDRB 4Y28E 4L5GA 2K4YA 2ZPIB 4YTLA 3CMEA 5FRMA 2PUOB 2PUKB 4VUBA 3JB9J 2FYKA 4M7AE 2Y4YA 2D0QB 2P0KA 4XTZA 5I2MA 4PNOA 3BFMA 4NL2A 2AHJB 3CCMA 4M78A 1VQ4A 2RHIA 4C92C 5M9OA 4HA8A 4M77G 1NPPA 3GLXA 1N6AA 3HRUA 5LJ3j 4IUVA 3ASKA 4PJOD 4M77F 2DJZA 2M9UA 3G6EA 1M1KC 2KSSA 5J39A 1Q82U 1IZ6A 4PKCC 4QVZA 2QEXT 1KQSS 4JLGA 3OYMA 4HCCA 4RG8A 3KXTA 4ZTJA 2RK1A 2RD1A 3LGLA 4OB1B 2IVWA 2I2LA 1I8FA 3NTKA 3CPWA 2E10A 2F69A 3A8HB 3CCLA 2L89A 3VU3C 1YJWT 3CCJA 4XU3A 4M7AD 1BIAA 3BDUA 3V8KA 3OS1A 1QVGS 3N5BB 2WSEE 4BE1A 4F7UA 3J80E 2FL7A 4M77E 5GAOq 4M77C 1K73U 4HCZA 4QW2A 2L5QA 3NTHA 1I4K1 5C6SA 2DPPB 2QDYB 3CCVT 4EMHA 3QJ6A 4A4GA 4M7AG 4LDYA 3JCMc 3FB9A 4KUDK 2MAMA 4F7UB 1M8VA 3OS5A 1JB0E 4X9CA 2LT4A 5LJ5d 3SWNC 4F7UE 2DXTA 2ZPFB 5IN1A 3H6ZA 3LW5E 3UDCA 2DVEA 5AYFA 3M59A 1WJSA 4PJOE 2LQKA 4N4HA 2XICA 5GANe 4PJOG 3JCMQ 3JCMf 1YITT 1QVFS 2RHZA 2XIDA 4JLIA 4LDVA 4MZMA 4M78C 5LL6S 1WGSA 2ZZDA 2LCCA 3GNFB 2CGHA 3ZFJA 3PT9A 4C0ZA 3QZ9B 2QQ9A 4IURA 3CCQA 4F7UG 1Q82C 1QVFA 1BI2A 2PVDB 2M16A 2YLCA 2DK3A 3T9NA 5FROA 5GAOp 2V8IA 2CZ0B 1AHJB 3M53A 5GAN8 3JCMb 5GAN6 3P8BB 3DLLA 1JRIA 1VIFA 2EQJA 4JRIA 5GAOn 3OYFA 1Q7YU 4BY6C 1VQKT 1VQ5T 1HXDA 2K2VA 2WSCE 4QVDA 2XD0A 4PLLA 2XDPA 3QSUA 2LQ8A 5GANd 2QA4T 4EMGA 3S3MA 4EMKB 1JJ2S 3CC2A 4LD6A 3WXMB 2LTOA 2DAQA 4BY6B 5KCOA 2WSFE 3OMGA 3JAME 1UGSB 4M78F 4JDSA 3RESA 5GAOl 3G4ST 2PQWA 4JRQA 3OYLA 1KQ2A 1QP3A 1I81A 4M78G 4E47A 3CBPA 2OTJA 3OW2A 2LC4A 1VQLT 3CCET 5GMKh 4N4IA 3C94A 4M77A 4X9DA 1UB4A 1K9MC 2KQWA 3O8VA 2XDDA 5CVIA 2E5QA 5CKBA 4C8QD 1YI2T 3SWNB 3DB3A 5A0GA 2NLUA 3KUFA 3OSSC 4LD9K 4XU0A 2RB6A 2D6FA 1G3SA 1RI0A 5CKHA 1VQMA 1WPYA 1MHNA 2QI2A 4LDWA 4QQGA 4XQ3A 4C8QB 2ZGWA 3PMIA 4OB0B 4C92B 3QXEB 3ER0A 3FRNA 3TREA 3E9GA 2QQSA 3JB9D 2DTOA 3OBYA 1QVGA 2EJFA 2EQMA 1PSEA 3MEAA 3G4SA 3M5AA 3LX7A 1BI3A 2JUFA 3EAEA 4HT9A 3EFRA 5KE2A 1Y71A 4KUIA 3CCEA 1LOJA 2JN0A 4DOVA 1K8AC 4OF1A 1VQLA 1YJNA 2CZ6B 4OVAA 1KD1U 1VQ9T 3HSBA 3TU4K 2E6NA 3HHTB 2D9TA 1VUBA 2LVMA 1NJIU 4MDWA 3EFSA 3MHXA 3OYNA 1YBYA 1B34B 2R5MA 2YHTA 3QPHA 4C5IA 4GY5A 1W2BS 1VQKA 2JTMA 4E7HA 3M4GA 4E7IA 1M9SA 1O9SA 5GAN2 2MF2A 4NL3A 2MI6A 4L59A 2H3JA 2PU9B 2K3YA 2RJCA 4C92G 1XQHA 4M75A 3CCQT 1B34A 1GXIE 3BDLA 3OYDA 1YJNT 1JBMA 1O75A 4RKUE 4DOWA 4ZN1A 3PIPA 5IT9E 1MGQA 2F5TX 3RKYA 2MMPA 3E9FA 3G7ZA 3WVDB 3L2VA 3CC7A 1VQOT 1M1KU 3G71T 2IG0A 4M75B 4D6WA 1WJRA 4FL6A 3MEWA 1D3BA 4A4EA 3S6WA 4M7AF 2R57A 5FRNA 1UEBA 3CCUT 3CMET 2DD5A 3OQ5A 4BI3A 1OZ2A 3JCMP 4M75G 4M7DC 2R5AA 3CCSA 4C92D 4BI8B 3FLGA 4M75F 3M4YA 4DA4A 5DM7R 1D3BB 2XHCA 5LJ5f 1XOVA 3HFOA 3JCMe 3GP8A 2L3RA 1NJIC 3I55T 4IUPA 2DTHA 1IREB 3FJPA 4R55A 4PJOF 1M90C 2HNIA 5HY6A 5I2SA 4KBMB 4EMKC 4J6XA 5GANg 4BUGA 3BW1A 3RMQA 3VUBA 2V8JA 4M7DD 4E7KA 4M7AC 3L2ZA 2RHXA 4FIBA 3JB9H 3PNWC 2DD4A 3VJPA 4XU2A 5L8RE 1OZ3A 2VV5A 5CAIA 2EQUA 2ZPGB 3V7RA 3J81E 1N8RU 4M7DF 3V8LA 1HK9A 4FT2A 4WF2A 5IAYA 3FC3A 1YJWA 2LRQA 3JB9G 2BKDN 2O01E 3KBGA 4UC4A 3RMSA 2EKOA 5CQYA 1YHQA 2GFAA 4CI0C 3JB9I 4N0AC 4C0DC 3CCRA 5LJ3h 5FU6B 1VQ4T 1UGPB 2E70A 1KHIA 2RHYA 3CCJT 2KDSA 3OYYA 4MMKA 3RERA 1JJ2A 3PMTA 3X24B 2HAXA 1M5Q1 3C4SA 3L2RA 2GFUA 2E41A 4L6V5 2OAUA 2RHUA 1M1FA 3JSCA 3FIFA 5J26A 3RKWA 1KHCA 5GMKe 5LJ5g 1VIEA 1UGRB 3L1AA 3OYJA 1KQSA 2L8DA 3OW2S 3QUIA 4PL6A 4XTXA 4MDXA 1Y96A 3INZA 3MP8A 3V8JA 3CD6T 4A4KA 1RL2A 4A53A 4C5HA 5KCHA 3M9QA 4C0GA 5LJ3e 3GPLA 5LJ3f 3OYIA 1VQPT 1N9SA 2EWNA 1WJQA 4QVCA 4DQ2A 5GANf 4HT8A 3QYHB 1S72T 4IKFA 1G3YA 5D6YA 2V8KA 1VQ6A 2EIFA 3MCAB 5CKFA 3OYHA 2PVGB 2PVOB 3HKSA 3CMAT 2RO0A 3I56A 2HBPA 4M75C 1PSFA 4C0DB 2P4TA 3GNGA 4OP0A 4C92F 4M7AA 5C0MA 4KT0E 4JRKA 2G3RA 1NZ9A 5GAMg 3C95A 1Q86U 3ME9A 4M78E 3HL8A 3TCJA 4C5GA 3A8MB 3RIRA 4J5YA 4A4HA 2CZ1B 1FWZA 3QJYA 3OYEA 1NE8A 4EDUA 3JCMd 1U1SA 4O6JA 5GMKj 2KK4A 4XK8E 4M7AB 3P8HA 1YITA 3OS2A 4JRPA 4BB7A 2M1HA 2DO3A 4FM4B 3OY9A 2DEQA 1YHQT 4RCBA 4ZTFA 1R8OB 3M54A 4KULA 4C8QG 1DJ7B 1M1GA 2VXEA 1VQNA 4BE0A 2LCLA 2MWOA 3V7SA 2CYZB 4C8QF 3OBWA 3OA6A 2DTIA 4O5VA 4Q5WA 2E1HA 3OB9A 3OMCA 4TVRA 3LH0A 5FU7B 1BI0A 5GAMj 2QTXA 3I55A 2F5KA 2OTJT 5GAMf 3X26B 3S3NA 3SFMA 3OYKA 1SSFA 3LWHA 2RJEA 4EPCA 4XTWA 3MEUA 3JCMW 4E7JA 4J8OA 3M58A 3MEVA 1YI2A 3META 4EMKA 5LJ3d 1TH7A 1K9MU 3MP1A 2EFIA 4ELZC 2K5LA 3SB2A 2XG8D 5GMKm 3P8DA 4OMFB 4XU1A 1K73C 3A8GB 2XI9A 3E19A 3M56A 3QIIA 3M55A 3WVEB 2OTLA 4M77B 1YIJT 3BY7A 4MZPA 1VQMT 1VQPA 2DXBA 2KMTA 2R58A 2WACA 1VQ9A 1YJ9A 2RJFA 4M78D 1QP2A 5KH6A 1G3TA 2FHDA 3CEYA 3NFCA 4HKEA 3SWNA 2K3XA 5GAN3 3A5ZB 3CCRT 4ELYC 3SDZA 1VQ6T 2VC8A 3CPWS 3JCMV 2X4JA 4JJNK 4JS5A 2FVUA 3GOXA 1LJOA 3VUZA 4PJOA 1VQ7A 2VGNA 2K5FA 3JCMg 3CCLT 1ZBXA 3CD6A 3S3OA 2LNVA 4LDXA 5A0DA 3A8LB 4QQDA 5GAMd 2KAFA 2A7YA 2QXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRI A;  4JRI A;  3V7R A;  2DZ9 A;  4N0A A;  3V8L A;  1HK9 A;  5GAO n;  4WF2 A;  1I5L A;  4M7D F;  4XTU A;  4PJO B;  3PGG A;  3JB9 G;  1HXD A;  4QVD A;  3JCM h;  4C8Q C;  3QSU A;  5GAN d;  3JB9 F;  4EMG A;  4EMK B;  5GAN 4;  5GAM e;  3JB9 I;  2E64 A;  4N0A C;  2RA2 A;  5LJ3 h;  4M78 F;  3RES A;  5GAO l;  5GAO r;  4JUV A;  4C8Q E;  3RUX A;  1KQ2 A;  4M78 G;  1I81 A;  4MMK A;  3RER A;  2FB7 A;  1M5Q 1;  4A54 A;  4F7U F;  5GMK h;  1U1T A;  2E41 A;  4V2S A;  4M77 A;  4X9D A;  4M75 D;  4M7A D;  3FIF A;  3RKW A;  4C8Q D;  5GMK e;  5LJ5 g;  3L1A A;  3SWN B;  1WQW A;  3QUI A;  4XTX A;  2RB6 A;  4XU0 A;  1YCY A;  1Y96 A;  3INZ A;  4M7D G;  3V8J A;  1WPY A;  4XQ3 A;  5LJ3 g;  1WQ7 A;  5DY9 A;  1KQ1 A;  4A53 A;  4C8Q B;  2ZGW A;  5LJ3 e;  4C92 B;  5GAM h;  1H64 1;  5LJ3 f;  3JB9 D;  2DTO A;  4M78 B;  1N9S A;  5GAO m;  2EWN A;  4PJO C;  4QVC A;  4DQ2 A;  5LJ5 e;  5GAN f;  4HT8 A;  2EJF A;  2YLB A;  4M77 D;  3GIB A;  2DZC A;  4HT9 A;  3EFR A;  3JB9 J;  3JCM J;  5GAN 7;  2FYK A;  1BIB A;  4M7D E;  4M7A E;  1LOJ A;  2JN0 A;  4XTV A;  4XTZ A;  5LJ5 j;  4PNO A;  3BFM A;  4M75 C;  4NL2 A;  4M7D B;  4OP0 A;  4M78 A;  3HSB A;  4C92 C;  4M7A A;  2RM4 A;  4HA8 A;  4M77 G;  5LJ3 j;  4JRK A;  5GAM g;  2EJ9 A;  3EFS A;  4M78 E;  4PJO D;  4M77 F;  2DJZ A;  3RIR A;  4J5Y A;  4C92 E;  3V7C A;  5GAN 8;  1B34 B;  2YHT A;  4M7D A;  2EJG A;  3JCM d;  1U1S A;  5GMK j;  3AHU A;  4M7A B;  5LJ5 h;  2EAY A;  1WNL A;  3M4G A;  3JCM X;  2RD1 A;  5GAN 2;  2DEQ A;  4NL3 A;  4RCB A;  2I2L A;  1I8F A;  2E10 A;  2Y90 A;  4C8Q G;  3HFN A;  4C92 G;  4M75 A;  2VXE A;  3VU3 C;  1B34 A;  3V7S A;  4NOY A;  4XU3 A;  1BIA A;  3QO3 A;  3BDU A;  4C8Q F;  3V8K A;  4C8Q A;  2DTI A;  1JBM A;  4C92 F;  2E1H A;  4C92 A;  4F7U A;  5GAM j;  2QTX A;  4M77 E;  1MGQ A;  3RKY A;  5I21 A;  5GAM f;  5GAO q;  4M77 C;  4XTW A;  3JCM W;  5CAI A;  1I4K 1;  4M75 B;  4EMH A;  4EMK A;  5LJ3 d;  1TH7 A;  4M7A G;  3JCM c;  3FB9 A;  1D3B A;  3SB2 A;  5GMK m;  4F7U B;  4M7A F;  1M8V A;  4XU1 A;  4X9C A;  5LJ5 d;  1LNX A;  3SWN C;  4F7U E;  2VXF A;  3JCM P;  3QHS A;  2DXT A;  4M75 G;  4MML A;  4M7D C;  4J6W A;  4M77 B;  3BY7 A;  4C92 D;  5GAN h;  4M75 F;  2DVE A;  1Y96 B;  4RCC A;  1D3B B;  4XTY A;  4M78 D;  2DKG A;  4PJO E;  3SWN A;  5LJ5 f;  5GAN 3;  3HFO A;  5GAN e;  4PJO G;  3JCM e;  3JCM f;  4Y91 A;  3JCM Q;  5GAN j;  4JLI A;  2VC8 A;  2DTH A;  3JCM V;  1N9R A;  3FJP A;  4PJO F;  4M78 C;  1LJO A;  5GMK l;  2HNI A;  4PJO A;  2CGH A;  1X01 A;  2DXU A;  4J6X A;  4J6Y A;  4M75 E;  3JCM g;  4EMK C;  3BW1 A;  4F7U G;  5GAN g;  4M7D D;  2YLC A;  3RKX A;  4M7A C;  2K57 A;  3L2Z A;  3JB9 H;  5GAN 5;  5GAM d;  5GAO p;  4XU2 A;  5GMK i;  3JCM b;  5GAN 6;  2E65 A; 
#chains in the Genus database with same CATH topology
 1Q81 C;  3VS4 A;  4PJO B;  4B9X A;  1ABO A;  1GFD A;  3PGG A;  3QKJ A;  3CCV A;  5FWC A;  2GNC A;  2VGM A;  1Y07 A;  4RUG A;  4J7F A;  2A36 A;  1UGQ B;  3H0H A;  2HD0 A;  5L23 A;  3MP6 A;  5J3B A;  1JO8 A;  3UPU A;  2F1L A;  5CKE A;  2EYZ A;  4P5N A;  1I1J A;  3CCE Q;  5KYN A;  3LLR A;  3E1S A;  5AT1 B;  3JRZ A;  1RLP C;  3G4S Q;  2F2V A;  1KC8 C;  2OTL T;  4PJO C;  5CIU A;  4RTW A;  2DZC A;  2NUT A;  4KGX B;  3JCM J;  1BIB A;  3LYI A;  5LJ5 j;  4M7D B;  3OSV A;  1Q7Y C;  2CT4 A;  1PCX A;  1V29 B;  1PHT A;  4OGC A;  2EJ9 A;  2NUT B;  4IUQ A;  1UEC A;  2P0Q A;  1KD1 C;  1Q95 G;  2YXY A;  2EAY A;  4N4G A;  2D8H A;  2C0O A;  1R0B G;  3OYC A;  2Y90 A;  2JVV A;  4BD3 A;  4J9B A;  3QO3 A;  2DL7 A;  4WCI A;  1NJI R;  3X20 B;  1K4U S;  2B8A A;  2YT6 A;  1D1A A;  1U3O A;  2CP7 A;  3URG A;  3VYG A;  4OB2 B;  2XU8 A;  3H8Z A;  2X4X A;  3QHS A;  4RMO A;  4MML A;  4J6W A;  3TEE A;  5GAN h;  2LX7 A;  3L2U A;  4J9G A;  1Y7X A;  3CCL Q;  3EG3 A;  1N9R A;  3EG1 A;  3TSW A;  1S72 A;  2DXU A;  4M75 E;  4J6Y A;  2BTT A;  1V1C A;  2ZPB B;  2EGA A;  1OI1 A;  1TG0 A;  2DIQ A;  3VYH B;  3NGP A;  1ZX6 A;  2BUD A;  1QVP A;  1I07 A;  2E64 A;  5FLX E;  2NUP A;  4JUV A;  5FU6 C;  1AWW A;  4OMO A;  1BYM A;  2FB7 A;  3CC7 T;  4F7U F;  2DBK A;  2QQA A;  1VQ8 A;  1A0N B;  4OB3 B;  2GTO A;  3CC7 Q;  4BDZ A;  5HK0 A;  3L2Q A;  5HCK A;  3G6E Q;  1R77 A;  2KT8 A;  4ZGD B;  2JS0 A;  2YUO A;  3C0C A;  3CXC P;  2P84 A;  4ZGE B;  4R0K A;  2CP3 A;  4L5G A;  4YTL A;  5FRM A;  3JB9 J;  2FYK A;  2HSE B;  1J3T A;  4PNO A;  3BFM A;  2K79 A;  1SHG A;  1VQ4 A;  1C1A A;  3G6E A;  1MUZ A;  1IZ6 A;  2A37 A;  1D0Y A;  5D7U A;  3CC4 Q;  4OB1 B;  1G83 A;  2DJQ A;  2I2L A;  2IVW A;  1ZA2 B;  2E10 A;  2GGR A;  1YJW T;  2RQV A;  3G1J A;  4M7A D;  3OS1 A;  1JJ2 P;  4F7U A;  1K73 U;  1TUC A;  2A0F B;  3QWX X;  5C6S A;  4HVU A;  1U5S A;  3CME Q;  2MAM A;  4F7U B;  1WLP B;  1M8V A;  1JB0 E;  1JXO A;  2DXT A;  5IN1 A;  4FW1 A;  3H6Z A;  2DVE A;  2XIC A;  3JCM Q;  4PJO G;  2ENM A;  2XID A;  4LDV A;  4HXJ A;  4M78 C;  3GNF B;  2LCC A;  2HSP A;  3QZ9 B;  2QQ9 A;  4IUR A;  2PVD B;  1IO6 A;  2F2X A;  2V8I A;  5GAN 8;  1VIF A;  2RMO A;  1SPK A;  2CP2 A;  3QSU A;  1NLP C;  2LQ8 A;  1NEG A;  1JJ2 S;  3WXM B;  5KCO A;  2DAQ A;  2WSF E;  4JDS A;  1EFN A;  1SSH A;  3OYL A;  4IIO A;  1I81 A;  2HMA A;  2QAZ A;  4DBH A;  4M77 A;  2ABL A;  2MYS A;  2E5Q A;  1E6H A;  2QGG A;  3KUF A;  4LD9 K;  2RB6 A;  2QDL A;  1RI0 A;  5CKH A;  1VQM A;  4QQG A;  2SRC A;  4C8Q B;  2JM8 A;  3ER0 A;  3FRN A;  2DL3 A;  3OBY A;  2KRN A;  3LX7 A;  2JUF A;  3EAE A;  4HT9 A;  4PFP A;  2DL4 A;  1K8A C;  1JXM A;  2CZ6 B;  4OVA A;  3U23 A;  2EW3 A;  1VQ9 T;  1OUL A;  3HHT B;  1QCF A;  2D9T A;  2LVM A;  1VQO Q;  1QCN A;  4MDW A;  3RBB B;  3QPH A;  4M4Z A;  4C5I A;  1WHH A;  1W2B S;  4NL3 A;  1AZG B;  2DLP A;  1OPK A;  3CCQ T;  1XQH A;  1KIK A;  1V76 A;  4FYW B;  2KRM A;  2J6K A;  1JBM A;  5IT9 E;  1TS9 A;  3G7Z A;  1OV3 A;  3G71 T;  4D6W A;  4GBQ A;  4FL6 A;  3MEW A;  4A4E A;  3S6W A;  1BBZ A;  1UEB A;  2DD5 A;  3JCM P;  1D1C A;  1Q82 R;  1GBR A;  3CCS A;  4C92 D;  3FLG A;  1NJI C;  1WHJ A;  4R55 A;  5I2S A;  3CCU Q;  2V8J A;  4M7D D;  4HVV A;  4M7A C;  4FIB A;  1WX6 A;  3PNW C;  1ZSZ A;  2DD4 A;  3VJP A;  1QVG P;  1W70 A;  2VV5 A;  2ZPG B;  3V7R A;  1VQ9 Q;  2CT3 A;  3V8L A;  1OU8 A;  4WF2 A;  1YJW A;  1NYG A;  2O01 E;  4UC4 A;  3RMS A;  3JB9 I;  1KSW A;  2RHY A;  2KDS A;  3PMT A;  2HAX A;  2E41 A;  2CRE A;  2YRC A;  3EGD B;  4PJM A;  1RLQ C;  3O5Z A;  1KHC A;  5GMK e;  2C0I A;  5LJ5 g;  3OYJ A;  1KQS A;  2L8D A;  1N8R R;  2CP5 A;  1RAD B;  1Y96 A;  3MP8 A;  3A1P A;  4A4K A;  2NWM A;  2DRM A;  2PNI A;  3OYI A;  1X6G A;  2A08 A;  2K3B A;  5GAN f;  4IKF A;  3MCA B;  3OYH A;  4JJD A;  2PVO B;  4AFZ C;  2RO0 A;  1PSF A;  5GJV B;  2YUQ A;  3EG2 A;  1GFC A;  4KT0 E;  4JRK A;  1NZ9 A;  3C95 A;  2J6F A;  4E6R A;  4M78 E;  3HL8 A;  4C5G A;  3A8M B;  1VQN Q;  4A4H A;  2CZ1 B;  3OYE A;  1NE8 A;  4EDU A;  1YIT A;  2NUZ A;  2IPO B;  1YHQ T;  1R8O B;  1UJ0 A;  3I5R A;  2EYY A;  2VXE A;  3RR6 A;  3V7S A;  1I0C A;  2CYZ B;  4C8Q F;  1YIJ T;  2OTJ T;  3S3N A;  1SSF A;  4XTW A;  4J8O A;  2M51 A;  1YI2 A;  3MET A;  3SB2 A;  2XG8 D;  4OMF B;  4XU1 A;  3A8G B;  3E2U A;  3E19 A;  3M55 A;  1VQ7 Q;  2OTL A;  4MZP A;  1VQM T;  2R58 A;  1VQ9 A;  5KH6 A;  1QP2 A;  5GAN 3;  1YN8 A;  3CPW S;  3JCM V;  4JS5 A;  1VQ7 A;  2K5F A;  3CCL T;  3VRZ A;  3S3O A;  4LDX A;  2OTJ Q;  4AFS C;  4F16 A;  5GAM d;  2BZX A;  4CRI A;  4AG1 C;  5A0L A;  3CCS Q;  1FXX A;  3MO8 A;  4AFQ C;  3Q1J A;  2B86 A;  2RQT A;  4AG2 C;  1MMD A;  4XAX B;  3G71 A;  4C8Q E;  1UHF A;  1EIF A;  4GLK A;  4V2S A;  1D09 B;  1JQQ A;  3QZ5 B;  4M75 D;  4BAC A;  3VV0 A;  1AWJ A;  1WQW A;  2KBT A;  1UG1 A;  1Q86 C;  2AKL A;  4C5E A;  2J05 A;  1X6O A;  3CCU A;  1YP5 A;  1SRL A;  3HP9 A;  4J7I A;  5LJ5 e;  3CXC S;  1VQ6 Q;  5KE3 A;  4IUT A;  3GIB A;  4II1 A;  4PFZ A;  5KYY B;  4XTV A;  2QA4 A;  1B07 A;  3NTI A;  1VYU A;  3CXC A;  2KY9 A;  2M0O A;  2W10 A;  2RM4 A;  2ZCF B;  1YWO A;  2DXC A;  2XMF A;  2ZPE B;  2X4Y A;  5KYW A;  3UWN A;  3V7C A;  1WHG A;  1H3Z A;  3H41 A;  3AHU A;  2LT1 A;  1SHF A;  3JCM X;  2JZ2 A;  2FEI A;  2JM9 A;  2QQB A;  3HFN A;  1W4S A;  4C8Q A;  2LDM A;  3HRS A;  3VKI A;  1PKS A;  3CCQ Q;  2LX9 A;  1Q81 U;  1TTH B;  2EGE A;  5EG2 A;  3I9Q A;  1YI2 Q;  2MK5 A;  1ZUU A;  2QEX A;  3PFS A;  1LNX A;  2VXF A;  3G6E T;  3M0P A;  2KVQ G;  3D7S B;  3A8O B;  4XTY A;  4R56 A;  4ZNX A;  3FEO A;  4Y91 A;  2DBM A;  1ZSZ C;  4GLM A;  2Y4X A;  3HPW A;  5IXF A;  1QQJ A;  1OU9 A;  3RKX A;  2RH2 A;  3QG1 A;  5DLO A;  1UUE A;  4J9F A;  1I5L A;  3REB B;  2O4X A;  1VQN T;  1TU0 B;  4MZT A;  4C8Q C;  1YIJ A;  2LZ6 B;  3EH1 A;  2EQK A;  4A63 B;  1E6G A;  3CCJ Q;  2RI2 A;  1IHV A;  3EHQ A;  3RUX A;  6AT1 B;  1U1T A;  3CCM T;  1YIJ Q;  1ZQ1 A;  3IQL A;  1D1B A;  3CCM Q;  3EH2 A;  2FPD A;  3LGF A;  2JMA A;  2GF7 A;  2HQE A;  1VQO A;  1K8A R;  5LJ3 g;  5DY9 A;  3ZBD A;  4RTV A;  1YCS B;  3M0S A;  3CQT A;  4M78 B;  2L2P A;  2CH4 A;  2DET A;  1ZSZ B;  2RI3 A;  1VQ7 T;  4M7A E;  2D0Q B;  4NL2 A;  2AHJ B;  4C92 C;  5M9O A;  4HA8 A;  4M77 G;  1NPP A;  2QK0 A;  3GLX A;  1FMV A;  2LJ3 A;  3H9N A;  4PJO D;  4M77 F;  2DJZ A;  2M9U A;  2AKK A;  1Y0M A;  4JJB A;  4RG8 A;  7AT1 B;  1VQ5 Q;  1C0M A;  3NTK A;  1GRI A;  4XU3 A;  1BIA A;  4QKU A;  1QVG S;  4BE1 A;  4OMM A;  1Q7Y R;  4LN2 A;  2D0N A;  4A4G A;  2KGT A;  3JCM c;  2QYZ A;  4KUD K;  3OS5 A;  4X9C A;  1RAH B;  2K2M A;  3LW5 E;  1M3B A;  1WJS A;  4PJO E;  4N4H A;  2BZY A;  5GAN e;  1QVF S;  4HCK A;  1ZBJ A;  2DL8 A;  2HDA A;  2ZZD A;  3PT9 A;  4F14 A;  3CCQ A;  1QVF A;  2YLC A;  2M16 A;  5GAO p;  1QKX A;  1IRX A;  1VQK T;  1WHM A;  1WDX A;  1D0Z A;  1M90 R;  2WSC E;  1WXB A;  2XD0 A;  4PLL A;  3EG9 A;  5GAN d;  2Z0W A;  4EMG A;  1UGV A;  2SEM A;  4EMK B;  3CC2 A;  1WI7 A;  3JAM E;  2YUP A;  1RAC B;  2KRO A;  1E7O A;  2PQW A;  2BE9 B;  2O88 A;  1WHL A;  1KQ2 A;  1ZA1 B;  5GMK h;  2PZ1 A;  2A28 A;  2KQW A;  3O8V A;  2ED0 A;  1YI2 T;  1ZUK A;  3SWN B;  2MPX C;  3LH5 A;  4XQ3 A;  2QI2 A;  2VKN A;  4C92 B;  4OB0 B;  3TRE A;  1AD5 A;  2QQS A;  2DTO A;  2FRW A;  1YIT Q;  1QVG A;  1PSE A;  1ABQ A;  3EFR A;  4KUI A;  1VQL A;  1LOJ A;  4DOV A;  3OW2 P;  4Z8A A;  1VUB A;  1CKA A;  1NG2 A;  1KJW A;  1YBY A;  2YHT A;  2G6F X;  1VQK A;  1AOJ A;  2JTM A;  2MF2 A;  2DA9 A;  2FZG B;  1FMK A;  2RJC A;  1B34 A;  3BDL A;  4CC2 A;  2CUD A;  5IH2 A;  3OYD A;  2EVR A;  1YJN T;  4DOW A;  3WVD B;  1M1K U;  2MMP A;  3E9F A;  1VQO T;  4K11 A;  1PWT A;  2FPF A;  1WJR A;  1D3B A;  2R57 A;  4RTZ A;  3OQ5 A;  4M75 G;  4M7D C;  4M75 F;  1QKW A;  4DA4 A;  5DM7 R;  1NBE B;  3I55 T;  4IUP A;  1IRE B;  2X51 A;  3RMQ A;  2RPN A;  1QWF A;  3JB9 H;  2RHX A;  1MMN A;  1WXT A;  5CAI A;  3J81 E;  1N8R U;  4FT2 A;  1TWB A;  2NYS A;  2BKD N;  5KYU B;  3VS6 A;  2L3S A;  1YHQ A;  2IIM A;  4N0A C;  2MOX A;  3CCR A;  2M02 A;  4IIM A;  1VQ4 T;  1TXQ A;  3OYY A;  4MMK A;  1OPL A;  2O2O A;  1M5Q 1;  3L2R A;  3VS3 A;  1FMW A;  4L6V 5;  2RHU A;  1OOT A;  3L1A A;  2KXD A;  4MDX A;  2CSQ A;  2HKN A;  3GBQ A;  5LJ3 e;  2OTL Q;  5LJ3 f;  1H8K A;  2EWN A;  4DQ2 A;  3QYH B;  1G3Y A;  2ESW A;  3HKS A;  5KYX B;  2HBP A;  3NMZ C;  3VS1 A;  2YSQ A;  4M7A A;  4LE9 A;  2F2W A;  1RAE B;  2CH4 W;  1BU1 A;  1Q86 U;  3TCJ A;  3RIR A;  4J5Y A;  3QDF A;  3QJY A;  2KK4 A;  2EBP A;  4XK8 E;  3JV3 A;  9ATC B;  3CMA Q;  1VYV A;  2M1H A;  1T0H A;  2DEQ A;  4KUL A;  1DJ7 B;  1M27 C;  4BE0 A;  1IGU A;  4C92 F;  3I55 A;  5GAM j;  1UE9 A;  2F5K A;  3X26 B;  3OYK A;  3LWH A;  2RJE A;  4PK4 A;  3MEU A;  4QT7 A;  5LJ3 d;  1TH7 A;  4E7S A;  1WYX A;  2EFI A;  2FRY A;  2J06 A;  3P8D A;  4Y92 A;  1F1B B;  4M77 B;  1RAA B;  2MIO A;  2RJF A;  4M78 D;  1G3T A;  3CCR T;  3SDZ A;  1VA7 A;  2VC8 A;  5KYU A;  1CKB A;  2FVU A;  3M0U A;  3VUZ A;  3JCM g;  1ZBX A;  3CD6 A;  1H3H A;  4QQD A;  2JXB A;  2DYI A;  2X3W D;  1QW1 A;  4QQ6 A;  1NEB A;  2KNB B;  3H0F A;  1MV3 A;  3HRT A;  2HQX A;  5GAO r;  4X34 A;  3EFO B;  4PLI A;  2XKO C;  4A54 A;  1OEB A;  5D6X A;  4BE2 A;  2XK0 A;  2FZC B;  2LMJ A;  2COZ A;  1YCY A;  5KYX A;  1AT1 B;  3UT1 A;  2GQV A;  3OS0 A;  1KQ1 A;  2JTE A;  2AZS A;  3QYG B;  3MKD A;  3DKM A;  1M4Z A;  4BI4 A;  2ZAE A;  3DB4 A;  1AEY A;  1M30 A;  1VQM Q;  1P92 A;  4M7D E;  3SHW A;  3OYG A;  4NS5 A;  2FO0 A;  3X28 B;  2J7I A;  2ROL A;  5HK3 A;  2X4W A;  1H92 A;  3I5S A;  2KT1 A;  1YNZ A;  2A3L A;  5D6W A;  1T3L A;  1GL5 A;  3OYB A;  4C92 E;  4M7D A;  2W0Z A;  5CR2 A;  5LJ5 h;  4OMN A;  4NOY A;  1W2B A;  2LQN A;  4C92 A;  4FU6 A;  2AZV A;  2KXC A;  2K5I A;  1JEG A;  3R6O A;  2VUB A;  4A4F A;  4HCB A;  2X3X D;  1KG1 A;  3CC4 T;  1TOV A;  1MMA A;  4DEX A;  2FG0 A;  2DIL A;  2DER A;  1G2B A;  1HD3 A;  3M57 A;  5I11 A;  5GAN j;  1IGQ A;  4F04 B;  5CQX A;  2EQI A;  2CDT A;  4LDU A;  3PIO A;  1NLO C;  2BIV A;  3CMA A;  1K9M R;  2JNG A;  2CKK A;  2K57 A;  2K9G A;  2E6Z A;  2JTF A;  2E65 A;  2MWP A;  5IHN A;  2OAW A;  2DZ9 A;  4N0A A;  4XTU A;  2HZY A;  3L2W A;  2OI3 A;  2DF6 A;  3I56 Q;  3THK A;  1N8R C;  2EYW A;  3EGU A;  1PG5 B;  1UDL A;  2X35 A;  4BDY A;  1ZSG A;  2YRV A;  4LXC A;  2NUP B;  4OGE A;  2DM1 A;  2QA4 Q;  4M7D G;  3L42 A;  3UA6 A;  3GF5 A;  1VOM A;  1VQ5 A;  4HVW A;  2AK5 A;  2OJ2 A;  5GAO m;  2JW4 A;  1RI9 A;  2COY A;  3QDR B;  1X6B A;  4AT1 B;  4Y28 E;  5IXB A;  3CME A;  2ZPI B;  2VWF A;  2PUO B;  2PUK B;  2P0K A;  4XTZ A;  1UJY A;  2KI7 A;  2RHI A;  3MPU B;  1N6A A;  3HRU A;  1B3Q A;  1K0S A;  4OML A;  2KSS A;  3PVL A;  1EZZ B;  4PKC C;  4QVZ A;  2QEX T;  1KQS S;  4JLG A;  4D8D A;  3OYM A;  3CD6 Q;  4ZTJ A;  2RD1 A;  2E5K A;  2QTV A;  4AFU C;  3A8H B;  2AIR B;  2ATC B;  2L89 A;  3V8K A;  2EKH A;  4OMQ A;  2LJ1 A;  4HCZ A;  4QW2 A;  3NTH A;  1I4K 1;  4KH1 B;  2DPP B;  3CCV T;  2ED1 A;  4EMH A;  3QJ6 A;  3FB9 A;  4F7U E;  2ZPF B;  1G8X A;  3UDC A;  3KFV A;  5AYF A;  3M59 A;  2LQK A;  2VVK A;  4JLI A;  4MZM A;  1PRL C;  4FCY A;  1WGS A;  3ZFJ A;  1Q82 C;  4F7U G;  1PC0 A;  1BI2 A;  5FRO A;  3T9N A;  3ULR B;  1RAG B;  3DLL A;  3EHR A;  1JRI A;  4JRI A;  3OYF A;  2E3I A;  4BY6 C;  3R6N A;  4E2F B;  8AT1 B;  4QVD A;  4KGZ B;  2XDP A;  1CSK A;  1SG5 A;  2KRS A;  3S3M A;  2V26 A;  2LTO A;  3OMG A;  1UGS B;  2QEX Q;  4M78 F;  5GAO l;  1PRM C;  2ECZ A;  1K0X A;  3EGX B;  3H0I A;  1QP3 A;  2CP6 A;  4E47 A;  5KYW B;  1Q81 R;  2OTJ A;  1VQL T;  1SRM A;  4N4I A;  3C94 A;  4B6M A;  1W2B P;  1UB4 A;  2DYB A;  4FYY B;  5CKB A;  4C8Q D;  1M3C A;  5A0G A;  4FW2 A;  2NLU A;  3OSS C;  3I55 Q;  4XU0 A;  2KYB A;  1MHN A;  4LDW A;  1D0X A;  2ZGW A;  2E3H A;  3E9G A;  4ANJ A;  3G4S A;  2RQW A;  3M5A A;  1Y71 A;  3CCE A;  4OF1 A;  1KD1 U;  4DEY A;  3TU4 K;  4RTY A;  2E6N A;  1NJI U;  1KC8 R;  2GBQ A;  2O9V A;  3EFO A;  2ROT A;  3VS5 A;  3MHX A;  5ECA A;  2COW A;  2R5M A;  3A98 A;  4OMP A;  1W6X A;  3TQ7 P;  2HBW A;  2FPE A;  4E7H A;  3M4G A;  2CP0 A;  1MMG A;  2MI6 A;  2H3J A;  2K3Y A;  2DRK A;  4KRT A;  4C92 G;  1GXI E;  1KD1 R;  3PE0 A;  1M1K R;  4RKU E;  4ZN1 A;  3RKY A;  2F5T X;  3CC7 A;  3L2V A;  2IG0 A;  4CC7 A;  2L3Q A;  4CC3 A;  1GCQ A;  4M7A F;  5FRN A;  2JJ9 A;  3UA7 A;  3CCU T;  3CME T;  3TSZ A;  1OZ2 A;  1UTI A;  4BI8 B;  2C0T A;  5LJ5 f;  1YJ9 Q;  1AVZ C;  1YFN A;  1RAF B;  2HNI A;  5HY6 A;  4KBM B;  5GAN g;  4BUG A;  3BW1 A;  2FZK B;  4E7K A;  2EPD A;  1OZ3 A;  1K73 R;  2D1X A;  5IAY A;  4JPB W;  2LRQ A;  3KBG A;  2GTJ A;  4D8K A;  2EKO A;  4CI0 C;  2KYM A;  1Y57 A;  4C0D C;  5LJ3 h;  1MV0 B;  1KHI A;  3CCJ T;  3RER A;  3C4S A;  4PFO A;  4PJJ A;  2OAU A;  1JU5 C;  1M1F A;  3REA B;  3FIF A;  5J26 A;  4WTO B;  1VIE A;  1T0J A;  1UGR B;  3PVQ A;  4JJC A;  3OW2 S;  3QUI A;  4PL6 A;  4XTX A;  3INZ A;  2EYX A;  2H3E B;  1RL2 A;  4A53 A;  4C5H A;  5KCH A;  4C0G A;  2DMO A;  1WJQ A;  3VS7 A;  4HT8 A;  1WFW A;  1LCK A;  5D6Y A;  1NYF A;  2V8K A;  1VQ6 A;  1X2Q A;  2PVG B;  4M75 C;  1Q86 R;  2LP5 A;  4C0D B;  2P4T A;  2VB6 A;  4OP0 A;  1X69 A;  5C0M A;  2K6D A;  4DBR A;  3ME9 A;  3JCM d;  1U1S A;  5GMK j;  5KYY A;  4EIK A;  1X43 A;  3OS2 A;  4JRP A;  4BB7 A;  1QMC A;  2DO3 A;  4LUD A;  2V1Q A;  4ZTF A;  3M54 A;  2JS2 A;  1M1G A;  2LCL A;  2MWO A;  1Q7Y U;  2DTI A;  4TVR A;  3LH0 A;  1BI0 A;  2QTX A;  1TSF A;  3SFM A;  2DEU A;  2KR3 A;  3JCM W;  4E7J A;  3M58 A;  3FJ5 A;  4EMK A;  3MP1 A;  2CSI A;  1PM3 A;  1QVF P;  2O9S A;  1K73 C;  2E4H A;  2XI9 A;  3M56 A;  1U06 A;  3QII A;  4E7Z A;  3RDV A;  3BY7 A;  1YJW Q;  1VQP A;  2WAC A;  2RQR A;  3SWN A;  1YWP A;  4ELY C;  1VQ6 T;  5FWB A;  2X4J A;  1WXU A;  2LNV A;  3A8L B;  2A7Y A;  1GBQ A;  1M2O A;  2HL3 A;  1NM7 A;  4CC4 B;  1YHQ Q;  3JB9 F;  5GAN 4;  1YJ9 T;  4ZN3 A;  1UHC A;  4C0F A;  4KGV B;  1KQS P;  2MCN A;  3J7A F;  1T3S A;  1TUD A;  4Z02 A;  1QCO A;  2O4X B;  1VQ4 Q;  2C06 A;  4X1V A;  4Z89 A;  3DLM A;  2E12 A;  3UF4 A;  1G3W A;  1ZHI A;  4E7L A;  2DX1 A;  1VQL Q;  1WQ7 A;  1XNI A;  2M0Y A;  5GAM h;  1H64 1;  2RJD A;  2BZ8 A;  1HJD A;  1RUW A;  2HL5 C;  2YLB A;  4M77 D;  3VS2 A;  5GAN 7;  4FSX A;  1SF9 A;  1VQ8 T;  1AWX A;  4ME7 A;  3PTA A;  2DFU A;  4FT4 A;  2JMC A;  3QBY A;  4ATO A;  5HKC A;  3CCS T;  1Z9Z A;  2P0P A;  4RG2 A;  1WHK A;  2EJG A;  1N5Z A;  4J9D A;  3CC4 A;  4FYX B;  2GCX A;  1WNL A;  3LWI A;  3CC2 T;  1MNE A;  5DLQ E;  3X25 B;  2J6O A;  5I21 A;  1IHW A;  1B7T A;  2VAS A;  3CPF A;  5FW9 A;  4IUU A;  4ZGJ B;  3EGD A;  3M0T A;  4JS4 A;  3F70 A;  4KH0 B;  2KE9 A;  2VYT A;  2CZ7 B;  1K9A A;  1M90 U;  2XDB A;  1KFZ A;  1Y96 B;  2CS7 A;  4RCC A;  2DKG A;  1X75 C;  4B9W A;  2L3P A;  5FU7 C;  5GMK l;  2RK2 A;  1X01 A;  2D8J A;  3NPF A;  2ZPH B;  3CBM A;  4FYV B;  1M2V B;  5GAN 5;  3I56 T;  1TUG B;  2DIG A;  5CK9 A;  1G5V A;  3FDR A;  1KC8 U;  5A2Q E;  3JCM h;  1M2V A;  5GAM e;  1PD1 A;  2LNH B;  5CO7 A;  1RAB B;  2HQH A;  2RA2 A;  2DVJ A;  4LNP A;  1ZUY A;  2YDL A;  3ZEH A;  1FX7 A;  3CBO A;  1OX9 A;  4J83 A;  3HTR A;  1OYX A;  1N27 A;  4J9E A;  2V1R A;  1S72 Q;  1HSQ A;  1XTD A;  5CKD A;  3C12 A;  3EG9 B;  2QQR A;  1K8A U;  1U8R A;  1BI1 A;  3SD4 A;  3OYA A;  1XJW B;  2RI5 A;  4ORZ A;  1NPR A;  2EYQ A;  1VQ8 Q;  5CCA A;  2JOY A;  1BKB A;  1VYT A;  2K4Y A;  4VUB A;  2Y4Y A;  4RTX A;  5I2M A;  3CCM A;  4M78 A;  1M3A A;  1ARK A;  4J9I A;  5LJ3 j;  2RQU A;  4AMC A;  2X9H A;  4IUV A;  3ASK A;  1M1K C;  4PJN A;  5J39 A;  1Q82 U;  2HCK A;  2YUN A;  4HCC A;  4JZ3 A;  3TVT A;  1ACM B;  2CUB A;  3KXT A;  2RK1 A;  1S1N A;  3LGL A;  1EX4 A;  1X27 A;  2AT1 B;  1I8F A;  3CPW A;  2F69 A;  3CCL A;  3VU3 C;  2QAS A;  3CCJ A;  3BDU A;  1PD0 A;  3N5B B;  2WSE E;  3J80 E;  1AWO A;  2FL7 A;  4M77 E;  1LPL A;  5GAO q;  4M77 C;  2RNA A;  4FSS A;  2L5Q A;  2QDY B;  3QWY A;  4M7A G;  4LDY A;  3CPW P;  1WIE A;  3CC2 Q;  4DBQ A;  2LT4 A;  5LJ5 d;  3SWN C;  1IB8 A;  1MND A;  1RAI B;  5GJW B;  1YIT T;  3JCM f;  2RHZ A;  5LL6 S;  2CGH A;  4C0Z A;  2RF0 A;  1GCQ C;  2HEQ A;  2DK3 A;  2PTK A;  1BCO A;  1AHJ B;  2CZ0 B;  3M53 A;  3JCM b;  5GAN 6;  3P8B B;  2EQJ A;  2O31 A;  5GAO n;  1VQ5 T;  1HXD A;  2K2V A;  2QA4 T;  4LD6 A;  4BY6 B;  5EC7 A;  2H8H A;  2QG9 B;  3RES A;  1C6V X;  3G4S T;  4JRQ A;  4M78 G;  3M0R A;  3CBP A;  3OW2 A;  2LC4 A;  3CCE T;  4X9D A;  1K9M C;  2P4R A;  2XDD A;  5CVI A;  2OX7 A;  3DB3 A;  2D6F A;  1G3S A;  1WZO A;  3SEM A;  1WPY A;  3RNJ A;  3PMI A;  3QXE B;  2L0A A;  3JB9 D;  4PJL A;  2EJF A;  2EQM A;  3MEA A;  1KK7 A;  1BI3 A;  5KE2 A;  2JN0 A;  3ZL7 C;  1YJN A;  1VQP Q;  2YRD A;  3HSB A;  3EG0 A;  1YJN Q;  3EFS A;  2GQI A;  3OYN A;  1PKT A;  1FYN A;  1B34 B;  1BCM A;  3CCR Q;  4GY5 A;  4E7I A;  1M9S A;  1O9S A;  5GAN 2;  1LVK A;  4L59 A;  2PU9 B;  1OX8 A;  4M75 A;  5IHK A;  1K76 A;  1Z9Q A;  1O75 A;  3PIP A;  4ESR A;  1MGQ A;  4M75 B;  2LJ0 A;  4BI3 A;  3CCV Q;  2R5A A;  3VS0 A;  1WA7 A;  4Z88 A;  3M4Y A;  1M8M A;  1D3B B;  2XHC A;  1X2K A;  1XOV A;  3HFO A;  3JCM e;  2LCS A;  3GP8 A;  2L3R A;  2DTH A;  3FJP A;  1M90 C;  4PJO F;  4EMK C;  4J6X A;  1BK2 A;  3VUB A;  3L2Z A;  2QGF B;  1PNJ A;  4XU2 A;  5L8R E;  2EQU A;  4M7D F;  1HK9 A;  3FC3 A;  3AT1 B;  8ATC B;  3NHN A;  3JB9 G;  2RN8 A;  5CQY A;  2GFA A;  1VQK Q;  1OQK A;  1K1Z A;  2DE0 X;  5FU6 B;  1UGP B;  2E70 A;  1JJ2 A;  3X24 B;  2GFU A;  3JSC A;  4RTT A;  3RKW A;  2BE7 D;  1ZLM A;  3V8J A;  3CD6 T;  2DL5 A;  3M9Q A;  3GPL A;  2EGC A;  1R0C B;  2YWW A;  5I22 A;  4LUE A;  1VQP T;  1I5O B;  1N9S A;  1W1F A;  4J9C A;  4QVC A;  1S72 T;  1SKU B;  3G71 Q;  2I0N A;  2EIF A;  3M0Q A;  5CKF A;  2LQW A;  3CMA T;  3BE3 A;  3I56 A;  3GNG A;  2DNU A;  4RTU A;  2G3R A;  5GAM g;  1UFF A;  1QWE A;  1FWZ A;  4O6J A;  4M7A B;  2HKQ B;  3P8H A;  4FM4 B;  4F17 A;  1HYO A;  3OY9 A;  4JZ4 A;  4RCB A;  4C8Q G;  3VRY A;  4J9H A;  1VQN A;  3UAT A;  1AZE A;  3OA6 A;  3OBW A;  4O5V A;  5FU7 B;  4Q5W A;  2E1H A;  3OB9 A;  3OMC A;  5GAM f;  1QLY A;  4EPC A;  3MEV A;  1K9M U;  5IHI A;  2K7A A;  4ELZ C;  1BB9 A;  2K5L A;  5GMK m;  1GCP A;  2JT4 A;  4DBF A;  3EGX A;  3WVE B;  3MJX A;  2DXB A;  2KMT A;  1YJ9 A;  2FHD A;  3NFC A;  3CEY A;  4HKE A;  2K3X A;  3A5Z B;  4JJN K;  1SEM A;  3GOX A;  1LJO A;  4PJO A;  2VGN A;  1IXD A;  5A0D A;  3I35 A;  2KEA A;  2KAF A;  5GMK i;  2QXF A; 
#chains in the Genus database with same CATH homology
 4CRI A;  1Q81 C;  1QW1 A;  4PJO B;  4B9X A;  4QQ6 A;  5A0L A;  3PGG A;  1FXX A;  3MO8 A;  3QKJ A;  3CCV A;  3JB9 F;  2VGM A;  5GAN 4;  3Q1J A;  1YJ9 T;  4ZN3 A;  3HRT A;  4C0F A;  1Y07 A;  4J7F A;  2HQX A;  4XAX B;  3G71 A;  5GAO r;  4X34 A;  1UGQ B;  4PLI A;  2HD0 A;  4C8Q E;  1EIF A;  4GLK A;  3J7A F;  2XKO C;  3MP6 A;  4Z02 A;  4A54 A;  4V2S A;  3QZ5 B;  4M75 D;  5J3B A;  2O4X B;  4BAC A;  2C06 A;  5D6X A;  4BE2 A;  2XK0 A;  3DLM A;  2E12 A;  3VV0 A;  1G3W A;  3UPU A;  1ZHI A;  5CKE A;  1WQW A;  4E7L A;  4P5N A;  1YCY A;  3UT1 A;  3LLR A;  3E1S A;  2GQV A;  1WQ7 A;  4C5E A;  1XNI A;  3OS0 A;  1KQ1 A;  3JRZ A;  1Q86 C;  3QYG B;  5GAM h;  1X6O A;  3CCU A;  1H64 1;  3DKM A;  2RJD A;  1M4Z A;  4BI4 A;  1KC8 C;  3HP9 A;  2OTL T;  4PJO C;  4J7I A;  3DB4 A;  5CIU A;  5LJ5 e;  3CXC S;  2YLB A;  4M77 D;  5KE3 A;  4IUT A;  3GIB A;  2DZC A;  4II1 A;  3JCM J;  1P92 A;  4FSX A;  5GAN 7;  1BIB A;  4M7D E;  4XTV A;  2QA4 A;  3LYI A;  5LJ5 j;  3OYG A;  1VQ8 T;  3NTI A;  4M7D B;  4NS5 A;  3CXC A;  4ME7 A;  3PTA A;  3OSV A;  2KY9 A;  2M0O A;  4FT4 A;  3X28 B;  5HK3 A;  1Q7Y C;  2X4W A;  1V29 B;  2RM4 A;  5GMK i;  2ZCF B;  4OGC A;  2EJ9 A;  3QBY A;  4IUQ A;  2DXC A;  2P0Q A;  2A3L A;  5D6W A;  1KD1 C;  2ZPE B;  4ATO A;  5HKC A;  2X4Y A;  2P0P A;  3CCS T;  3OYB A;  4RG2 A;  3UWN A;  3V7C A;  4C92 E;  4M7D A;  2EJG A;  1H3Z A;  5CR2 A;  3AHU A;  2LT1 A;  3CC4 A;  5LJ5 h;  2EAY A;  2GCX A;  1WNL A;  4N4G A;  3JCM X;  2JZ2 A;  3LWI A;  3CC2 T;  2QQB A;  3OYC A;  2Y90 A;  2JVV A;  4BD3 A;  3HFN A;  4NOY A;  1W2B A;  3QO3 A;  1W4S A;  5DLQ E;  4C8Q A;  2LDM A;  4FU6 A;  3HRS A;  4C92 A;  3VKI A;  3X25 B;  2K5I A;  3X20 B;  5I21 A;  3R6O A;  2B8A A;  3CPF A;  2LX9 A;  1Q81 U;  2VUB A;  4IUU A;  4A4F A;  5EG2 A;  4ZGJ B;  3URG A;  3VYG A;  4OB2 B;  2QEX A;  4HCB A;  3PFS A;  1KG1 A;  2XU8 A;  3CC4 T;  1LNX A;  3H8Z A;  2X4X A;  4JS4 A;  3F70 A;  2VXF A;  3QHS A;  4RMO A;  2VYT A;  4MML A;  2CZ7 B;  3G6E T;  4J6W A;  3TEE A;  5GAN h;  3L2U A;  1M90 U;  2XDB A;  1Y96 B;  2KVQ G;  2CS7 A;  3M57 A;  4RCC A;  3A8O B;  4XTY A;  4R56 A;  2DKG A;  1X75 C;  4B9W A;  5FU7 C;  5GAN j;  3FEO A;  4Y91 A;  5CQX A;  1Y7X A;  1N9R A;  4LDU A;  3PIO A;  2BIV A;  5GMK l;  2Y4X A;  3CMA A;  2RK2 A;  1S72 A;  1X01 A;  2DXU A;  3HPW A;  4J6Y A;  4M75 E;  2ZPH B;  2JNG A;  2ZPB B;  2CKK A;  3RKX A;  3CBM A;  2K57 A;  2RH2 A;  5GAN 5;  3QG1 A;  2E6Z A;  2JTF A;  3I56 T;  1OI1 A;  2DIG A;  5CK9 A;  5DLO A;  2E65 A;  2MWP A;  2DZ9 A;  4N0A A;  1G5V A;  3FDR A;  2DIQ A;  1KC8 U;  4XTU A;  1I5L A;  2O4X A;  5A2Q E;  1VQN T;  3VYH B;  3L2W A;  3JCM h;  4MZT A;  4C8Q C;  2BUD A;  1YIJ A;  1QVP A;  2EQK A;  5GAM e;  1N8R C;  2E64 A;  5CO7 A;  5FLX E;  2RA2 A;  3ZEH A;  1FX7 A;  2RI2 A;  4JUV A;  3CBO A;  5FU6 C;  3RUX A;  4J83 A;  1BYM A;  2FB7 A;  3CC7 T;  4F7U F;  1U1T A;  1OYX A;  2QQA A;  1N27 A;  2X35 A;  4BDY A;  3CCM T;  4OB3 B;  1VQ8 A;  2YRV A;  1XTD A;  4BDZ A;  5CKD A;  3C12 A;  1ZQ1 A;  5HK0 A;  2QQR A;  4OGE A;  1K8A U;  3L2Q A;  3LGF A;  4M7D G;  4ZGD B;  2GF7 A;  3L42 A;  2HQE A;  1U8R A;  1BI1 A;  1VQO A;  3GF5 A;  3SD4 A;  3OYA A;  2RI5 A;  5LJ3 g;  5DY9 A;  1VQ5 A;  3ZBD A;  4ZGE B;  1NPR A;  2EYQ A;  4M78 B;  5CCA A;  5GAO m;  2RI3 A;  2JOY A;  1VQ7 T;  1BKB A;  3QDR B;  4Y28 E;  4L5G A;  2K4Y A;  2ZPI B;  4YTL A;  3CME A;  5FRM A;  2PUO B;  2PUK B;  4VUB A;  3JB9 J;  2FYK A;  4M7A E;  2Y4Y A;  2D0Q B;  2P0K A;  4XTZ A;  5I2M A;  4PNO A;  3BFM A;  4NL2 A;  2AHJ B;  3CCM A;  4M78 A;  1VQ4 A;  2RHI A;  4C92 C;  5M9O A;  4HA8 A;  4M77 G;  1NPP A;  3GLX A;  1N6A A;  3HRU A;  5LJ3 j;  4IUV A;  3ASK A;  4PJO D;  4M77 F;  2DJZ A;  2M9U A;  3G6E A;  1M1K C;  2KSS A;  5J39 A;  1Q82 U;  1IZ6 A;  4PKC C;  4QVZ A;  2QEX T;  1KQS S;  4JLG A;  3OYM A;  4HCC A;  4RG8 A;  3KXT A;  4ZTJ A;  2RK1 A;  2RD1 A;  3LGL A;  4OB1 B;  2IVW A;  2I2L A;  1I8F A;  3NTK A;  3CPW A;  2E10 A;  2F69 A;  3A8H B;  3CCL A;  2L89 A;  3VU3 C;  1YJW T;  3CCJ A;  4XU3 A;  4M7A D;  1BIA A;  3BDU A;  3V8K A;  3OS1 A;  1QVG S;  3N5B B;  2WSE E;  4BE1 A;  4F7U A;  3J80 E;  2FL7 A;  4M77 E;  5GAO q;  4M77 C;  1K73 U;  4HCZ A;  4QW2 A;  2L5Q A;  3NTH A;  1I4K 1;  5C6S A;  2DPP B;  2QDY B;  3CCV T;  4EMH A;  3QJ6 A;  4A4G A;  4M7A G;  4LDY A;  3JCM c;  3FB9 A;  4KUD K;  2MAM A;  4F7U B;  1M8V A;  3OS5 A;  1JB0 E;  4X9C A;  2LT4 A;  5LJ5 d;  3SWN C;  4F7U E;  2DXT A;  2ZPF B;  5IN1 A;  3H6Z A;  3LW5 E;  3UDC A;  2DVE A;  5AYF A;  3M59 A;  1WJS A;  4PJO E;  2LQK A;  4N4H A;  2XIC A;  5GAN e;  4PJO G;  3JCM Q;  3JCM f;  1YIT T;  1QVF S;  2RHZ A;  2XID A;  4JLI A;  4LDV A;  4MZM A;  4M78 C;  5LL6 S;  1WGS A;  2ZZD A;  2LCC A;  3GNF B;  2CGH A;  3ZFJ A;  3PT9 A;  4C0Z A;  3QZ9 B;  2QQ9 A;  4IUR A;  3CCQ A;  4F7U G;  1Q82 C;  1QVF A;  1BI2 A;  2PVD B;  2M16 A;  2YLC A;  2DK3 A;  3T9N A;  5FRO A;  5GAO p;  2V8I A;  2CZ0 B;  1AHJ B;  3M53 A;  5GAN 8;  3JCM b;  5GAN 6;  3P8B B;  3DLL A;  1JRI A;  1VIF A;  2EQJ A;  4JRI A;  5GAO n;  3OYF A;  1Q7Y U;  4BY6 C;  1VQK T;  1VQ5 T;  1HXD A;  2K2V A;  2WSC E;  4QVD A;  2XD0 A;  4PLL A;  2XDP A;  3QSU A;  2LQ8 A;  5GAN d;  2QA4 T;  4EMG A;  3S3M A;  4EMK B;  1JJ2 S;  3CC2 A;  4LD6 A;  3WXM B;  2LTO A;  2DAQ A;  4BY6 B;  5KCO A;  2WSF E;  3OMG A;  3JAM E;  1UGS B;  4M78 F;  4JDS A;  3RES A;  5GAO l;  3G4S T;  2PQW A;  4JRQ A;  3OYL A;  1KQ2 A;  1QP3 A;  1I81 A;  4M78 G;  4E47 A;  3CBP A;  2OTJ A;  3OW2 A;  2LC4 A;  1VQL T;  3CCE T;  5GMK h;  4N4I A;  3C94 A;  4M77 A;  4X9D A;  1UB4 A;  1K9M C;  2KQW A;  3O8V A;  2XDD A;  5CVI A;  2E5Q A;  5CKB A;  4C8Q D;  1YI2 T;  3SWN B;  3DB3 A;  5A0G A;  2NLU A;  3KUF A;  3OSS C;  4LD9 K;  4XU0 A;  2RB6 A;  2D6F A;  1G3S A;  1RI0 A;  5CKH A;  1VQM A;  1WPY A;  1MHN A;  2QI2 A;  4LDW A;  4QQG A;  4XQ3 A;  4C8Q B;  2ZGW A;  3PMI A;  4OB0 B;  4C92 B;  3QXE B;  3ER0 A;  3FRN A;  3TRE A;  3E9G A;  2QQS A;  3JB9 D;  2DTO A;  3OBY A;  1QVG A;  2EJF A;  2EQM A;  1PSE A;  3MEA A;  3G4S A;  3M5A A;  3LX7 A;  1BI3 A;  2JUF A;  3EAE A;  4HT9 A;  3EFR A;  5KE2 A;  1Y71 A;  4KUI A;  3CCE A;  1LOJ A;  2JN0 A;  4DOV A;  1K8A C;  4OF1 A;  1VQL A;  1YJN A;  2CZ6 B;  4OVA A;  1KD1 U;  1VQ9 T;  3HSB A;  3TU4 K;  2E6N A;  3HHT B;  2D9T A;  1VUB A;  2LVM A;  1NJI U;  4MDW A;  3EFS A;  3MHX A;  3OYN A;  1YBY A;  1B34 B;  2R5M A;  2YHT A;  3QPH A;  4C5I A;  4GY5 A;  1W2B S;  1VQK A;  2JTM A;  4E7H A;  3M4G A;  4E7I A;  1M9S A;  1O9S A;  5GAN 2;  2MF2 A;  4NL3 A;  2MI6 A;  4L59 A;  2H3J A;  2PU9 B;  2K3Y A;  2RJC A;  4C92 G;  1XQH A;  4M75 A;  3CCQ T;  1B34 A;  1GXI E;  3BDL A;  3OYD A;  1YJN T;  1JBM A;  1O75 A;  4RKU E;  4DOW A;  4ZN1 A;  3PIP A;  5IT9 E;  1MGQ A;  2F5T X;  3RKY A;  2MMP A;  3E9F A;  3G7Z A;  3WVD B;  3L2V A;  3CC7 A;  1VQO T;  1M1K U;  3G71 T;  2IG0 A;  4M75 B;  4D6W A;  1WJR A;  4FL6 A;  3MEW A;  1D3B A;  4A4E A;  3S6W A;  4M7A F;  2R57 A;  5FRN A;  1UEB A;  3CCU T;  3CME T;  2DD5 A;  3OQ5 A;  4BI3 A;  1OZ2 A;  3JCM P;  4M75 G;  4M7D C;  2R5A A;  3CCS A;  4C92 D;  4BI8 B;  3FLG A;  4M75 F;  3M4Y A;  4DA4 A;  5DM7 R;  1D3B B;  2XHC A;  5LJ5 f;  1XOV A;  3HFO A;  3JCM e;  3GP8 A;  2L3R A;  1NJI C;  3I55 T;  4IUP A;  2DTH A;  1IRE B;  3FJP A;  4R55 A;  4PJO F;  1M90 C;  2HNI A;  5HY6 A;  5I2S A;  4KBM B;  4EMK C;  4J6X A;  5GAN g;  4BUG A;  3BW1 A;  3RMQ A;  3VUB A;  2V8J A;  4M7D D;  4E7K A;  4M7A C;  3L2Z A;  2RHX A;  4FIB A;  3JB9 H;  3PNW C;  2DD4 A;  3VJP A;  4XU2 A;  5L8R E;  1OZ3 A;  2VV5 A;  5CAI A;  2EQU A;  2ZPG B;  3V7R A;  3J81 E;  1N8R U;  4M7D F;  3V8L A;  1HK9 A;  4FT2 A;  4WF2 A;  5IAY A;  3FC3 A;  1YJW A;  2LRQ A;  3JB9 G;  2BKD N;  2O01 E;  3KBG A;  4UC4 A;  3RMS A;  2EKO A;  5CQY A;  1YHQ A;  2GFA A;  4CI0 C;  3JB9 I;  4N0A C;  4C0D C;  3CCR A;  5LJ3 h;  5FU6 B;  1VQ4 T;  1UGP B;  2E70 A;  1KHI A;  2RHY A;  3CCJ T;  2KDS A;  3OYY A;  4MMK A;  3RER A;  1JJ2 A;  3PMT A;  3X24 B;  2HAX A;  1M5Q 1;  3C4S A;  3L2R A;  2GFU A;  2E41 A;  4L6V 5;  2OAU A;  2RHU A;  1M1F A;  3JSC A;  3FIF A;  5J26 A;  3RKW A;  1KHC A;  5GMK e;  5LJ5 g;  1VIE A;  1UGR B;  3L1A A;  3OYJ A;  1KQS A;  2L8D A;  3OW2 S;  3QUI A;  4PL6 A;  4XTX A;  4MDX A;  1Y96 A;  3INZ A;  3MP8 A;  3V8J A;  3CD6 T;  4A4K A;  1RL2 A;  4A53 A;  4C5H A;  5KCH A;  3M9Q A;  4C0G A;  5LJ3 e;  3GPL A;  5LJ3 f;  3OYI A;  1VQP T;  1N9S A;  2EWN A;  1WJQ A;  4QVC A;  4DQ2 A;  5GAN f;  4HT8 A;  3QYH B;  1S72 T;  4IKF A;  1G3Y A;  5D6Y A;  2V8K A;  1VQ6 A;  2EIF A;  3MCA B;  5CKF A;  3OYH A;  2PVG B;  2PVO B;  3HKS A;  3CMA T;  2RO0 A;  3I56 A;  2HBP A;  4M75 C;  1PSF A;  4C0D B;  2P4T A;  3GNG A;  4OP0 A;  4C92 F;  4M7A A;  5C0M A;  4KT0 E;  4JRK A;  2G3R A;  1NZ9 A;  5GAM g;  3C95 A;  1Q86 U;  3ME9 A;  4M78 E;  3HL8 A;  3TCJ A;  4C5G A;  3A8M B;  3RIR A;  4J5Y A;  4A4H A;  2CZ1 B;  1FWZ A;  3QJY A;  3OYE A;  1NE8 A;  4EDU A;  3JCM d;  1U1S A;  4O6J A;  5GMK j;  2KK4 A;  4XK8 E;  4M7A B;  3P8H A;  1YIT A;  3OS2 A;  4JRP A;  4BB7 A;  2M1H A;  2DO3 A;  4FM4 B;  3OY9 A;  2DEQ A;  1YHQ T;  4RCB A;  4ZTF A;  1R8O B;  3M54 A;  4KUL A;  4C8Q G;  1DJ7 B;  1M1G A;  2VXE A;  1VQN A;  4BE0 A;  2LCL A;  2MWO A;  3V7S A;  2CYZ B;  4C8Q F;  3OBW A;  3OA6 A;  2DTI A;  4O5V A;  4Q5W A;  2E1H A;  3OB9 A;  3OMC A;  4TVR A;  3LH0 A;  5FU7 B;  1BI0 A;  5GAM j;  2QTX A;  3I55 A;  2F5K A;  2OTJ T;  5GAM f;  3X26 B;  3S3N A;  3SFM A;  3OYK A;  1SSF A;  3LWH A;  2RJE A;  4EPC A;  4XTW A;  3MEU A;  3JCM W;  4E7J A;  4J8O A;  3M58 A;  3MEV A;  1YI2 A;  3MET A;  4EMK A;  5LJ3 d;  1TH7 A;  1K9M U;  3MP1 A;  2EFI A;  4ELZ C;  2K5L A;  3SB2 A;  2XG8 D;  5GMK m;  3P8D A;  4OMF B;  4XU1 A;  1K73 C;  3A8G B;  2XI9 A;  3E19 A;  3M56 A;  3QII A;  3M55 A;  3WVE B;  2OTL A;  4M77 B;  1YIJ T;  3BY7 A;  4MZP A;  1VQM T;  1VQP A;  2DXB A;  2KMT A;  2R58 A;  2WAC A;  1VQ9 A;  1YJ9 A;  2RJF A;  4M78 D;  1QP2 A;  5KH6 A;  1G3T A;  2FHD A;  3CEY A;  3NFC A;  4HKE A;  3SWN A;  2K3X A;  5GAN 3;  3A5Z B;  3CCR T;  4ELY C;  3SDZ A;  1VQ6 T;  2VC8 A;  3CPW S;  3JCM V;  2X4J A;  4JJN K;  4JS5 A;  2FVU A;  3GOX A;  1LJO A;  3VUZ A;  4PJO A;  1VQ7 A;  2VGN A;  2K5F A;  3JCM g;  3CCL T;  1ZBX A;  3CD6 A;  3S3O A;  2LNV A;  4LDX A;  5A0D A;  3A8L B;  4QQD A;  5GAM d;  2KAF A;  2A7Y A;  2QXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...