3M4GA

H57a hfq from pseudomonas aeruginosa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
68
structure length
68
Chain Sequence
KGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKAAISTVVPSRPVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Protein hfq
publication title The structures of mutant forms of Hfq from Pseudomonas aeruginosa reveal the importance of the conserved His57 for the protein hexamer organization.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 15
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3m4gA00
4PJOD 4XTZA 4XTUA 1WNLA 1M5Q1 4M75B 2EJFA 4C92A 5GAMe 5LJ5j 5GAN7 3JB9J 4PJOG 5GAOr 1U1SA 3EFSA 4RCCA 1HK9A 5GAMj 5GANh 3PGGA 1D3BB 4C92E 4NL2A 4EMKB 1X01A 5GAN4 4J6XA 2DXUA 2E41A 4M75D 1I5LA 3JCMh 1WQWA 4M7AG 2ZGWA 3QHSA 5GMKi 4M7DC 4JRKA 5LJ5g 3QUIA 4XTXA 2VXEA 1JRIA 3EFRA 4M75C 4XTYA 3V8KA 4A54A 5LJ3d 3BW1A 3SB2A 4Y91A 2FYKA 5GAMg 5GAN2 4M75E 5LJ5h 2QTXA 4PJOB 3GIBA 2RM4A 3BFMA 2DTOA 2EAYA 1N9RA 4EMKC 5GAMh 4HT8A 3JCMV 3FB9A 4HT9A 5GMKe 2YLCA 4M7AB 4M7DF 5GANd 3FIFA 1HXDA 2RA2A 5GAOl 4M7DB 1I81A 4XTWA 4M75F 3L1AA 4PJOA 3JCMd 4A53A 5GMKj 2K57A 2RD1A 3V8JA 3RERA 4XU2A 2DJZA 3JCMb 5GAOp 5GAOm 4PJOC 2DVEA 1N9SA 5GAN8 4M7AD 3M4GA 4C8QG 4M7DD 2DXTA 4XU3A 2DZ9A 3JB9F 4M7DA 4PJOE 1Y96B 3RKWA 4F7UG 4M75A 2HNIA 3BY7A 4MMKA 4M7AC 5I21A 2DZCA 4XU1A 2DTHA 4M77D 4HA8A 4OP0A 1B34B 4QVDA 3JB9I 4M7AE 4M7DE 3SWNB 4EMGA 4V2SA 1D3BA 2Y90A 4EMKA 5GMKh 4M77G 4PJOF 2DTIA 4JUVA 2FB7A 3V7CA 4JLIA 5LJ3f 2EJ9A 2YHTA 3INZA 5DY9A 4C8QB 3JCMQ 4PNOA 2E64A 2EWNA 5LJ3e 3FJPA 4C92G 1TH7A 2RB6A 4RCBA 1LOJA 4F7UB 4M7AF 4JRIA 3SWNA 3RKXA 4X9CA 4XU0A 4J5YA 4M78D 3RKYA 2YLBA 5LJ3j 3SWNC 3L2ZA 4C8QD 2VC8A 4M78G 3V8LA 1LNXA 4M77B 1LJOA 1WQ7A 5GANe 1I8FA 4M7AA 3BDUA 2E10A 4C8QC 3JCMX 3JB9H 3V7SA 3QO3A 4XTVA 5LJ5d 3JCMe 1BIBA 4C92B 5LJ3g 3JCMJ 5GAN3 2DEQA 5GAMd 3JB9G 4DQ2A 4M77A 5GAOn 5GAOq 4NL3A 3RIRA 2E65A 5LJ3h 5GMKl 1Y96A 4M77C 4M78B 4C92D 3HFOA 2CGHA 4C8QF 4M77E 5GANg 1YCYA 2JN0A 5GMKm 4XQ3A 1B34A 2E1HA 4X9DA 4EMHA 4F7UF 1KQ2A 4C92C 4QVCA 3JCMg 3RESA 3V7RA 1WPYA 4J6YA 5GAN6 1U1TA 4M78A 4WF2A 1BIAA 5GANf 1MGQA 4C8QA 4M7DG 1I4K1 4NOYA 4M77F 5CAIA 5GAN5 3HFNA 4M78C 1JBMA 4M75G 3HSBA 1M8VA 3JCMf 4F7UA 3AHUA 4N0AA 4M78E 3JCMW 2EJGA 4C8QE 3JB9D 4C92F 5GANj 3JCMc 2DKGA 4N0AC 3RUXA 4MMLA 4F7UE 5LJ5f 3JCMP 2I2LA 3QSUA 3VU3C 1H641 5LJ5e 1KQ1A 4J6WA 5GAMf 4M78F 2VXFA
chains in the Genus database with same CATH superfamily
2KSSA 4C92A 1M5Q1 1ZQ1A 1AZGB 2QAZA 1VQKA 1R0BG 3QZ9B 3BDLA 1MV3A 2QG9B 2JNGA 1X01A 1WQWA 4HVWA 1WI7A 3QHSA 2O88A 4B9WA 5LJ5g 2RHYA 1RADB 4OF1A 3A98A 1RAFB 4YTLA 1UFFA 2HBPA 1PKSA 1HXDA 1IO6A 1YITT 1IGQA 1K73C 1TUCA 2QDYB 4BI3A 2VV5A 4C8QG 3CCMT 3ME9A 3JB9F 2RQUA 5IN1A 2AKLA 1AHJB 1TSFA 5I21A 4AFZC 4M77D 4HA8A 2L2PA 4FYXB 3SWNB 1AVZC 4XK8E 2DIGA 3ZBDA 2GF7A 3WVEB 1YN8A 1YJNQ 2R5MA 2NUZA 4JUVA 1VQMQ 1YITA 3EGDB 5DY9A 3SD4A 4R0KA 2PZ1A 2HD0A 5LJ3e 3CCMA 3NGPA 2E6NA 4CRIA 3PNWC 5KE3A 1TTHB 1JJ2P 2Y4YA 3PVQA 2NUTA 2A36A 2CUDA 2XDPA 2OJ2A 1OX9A 2F2VA 2JUFA 1SRMA 3OYLA 3VS7A 4DBFA 1VQ6Q 1KD1R 2O9SA 2PQWA 3E19A 2AZSA 2LTOA 4C8QF 3MP6A 2RQVA 2Y4XA 1AWXA 3MJXA 5I11A 5IH2A 1MMDA 3TSWA 1M90U 2JW4A 1YJWT 1O75A 4Y92A 4OMQA 3CCQT 4JJNK 1EX4A 2HZYA 3A5ZB 2RK2A 1XJWB 5LJ5f 1UECA 2VWFA 3UDCA 1M27C 1WJQA 4LD9K 1U06A 1ABQA 1YWOA 1GCQA 1YJWA 4IUPA 2D6FA 1LCKA 4FM4B 3CCQA 1D3BB 4IURA 4C92E 1ZA2B 2QA4Q 5CKFA 2DXUA 3JCMh 2ZGWA 3UA6A 4E6RA 2EGEA 4XTYA 1NBEB 1AWOA 3JRZA 2J6FA 4B6MA 4RTVA 3FB9A 4IUUA 5GANd 3OYGA 2WSFE 2KQWA 3JV3A 2P4TA 1CKAA 3S3MA 3JCMb 3HP9A 4C0ZA 1UJYA 2EGCA 3A1PA 4L6V5 3RKWA 1IHVA 4MMKA 1NZ9A 4CC4B 2K79A 2J06A 4M7AE 1RUWA 3C95A 2GTOA 1H3HA 3CC7Q 3M0SA 2YRCA 4PFZA 4J9GA 3L2WA 2OTLQ 3OA6A 3M56A 5FROA 1YJNT 1X75C 3VJPA 4L59A 1VQMT 3OYNA 2KXDA 3MO8A 1NEGA 3NMZC 4FYWB 5GAOq 2YT6A 2VGNA 4PLIA 3DLLA 1QP3A 5D6WA 4M77C 3HFOA 1V29B 2DRMA 5GMKm 2IPOB 3TVTA 1BI3A 1MNEA 5DLOA 3X26B 4C92C 1PRLC 1YJNA 1OU8A 1VQMA 2GFAA 3T9NA 2XICA 3PIOA 4BDZA 1BIAA 3EGDA 3REAB 2X3XD 4B9XA 3X28B 1VQ6T 4BACA 1OEBA 2B86A 4LDWA 3JCMW 6AT1B 3IQLA 4LXCA 3JCMP 3FC3A 2BTTA 2V8IA 5IHNA 1ZX6A 1M3CA 2DBKA 3WVDB 1RAEB 4PJNA 4XTZA 4PJLA 2DBMA 1VQ6A 1F1BB 3E2UA 1HD3A 5FRNA 2MI6A 2VYTA 4JZ4A 4M7AG 2K9GA 1XQHA 1XOVA 4IIMA 2CP3A 3QUIA 5LJ3d 1Y57A 3GBQA 1UHCA 2L8DA 1X6GA 1D0ZA 3G7ZA 3J7AF 2QA4T 5GMKe 1QKWA 2P84A 4N4GA 1GFCA 1K8AC 3M4GA 2DERA 1G5VA 2EW3A 2KDSA 2J05A 2CREA 4F7UG 3OYJA 2KR3A 3QDFA 2HCKA 2JTEA 2DA9A 2DTHA 2QA4A 1D3BA 2FB7A 2HQXA 1WHLA 3M0PA 4C8QB 1QW1A 2MIOA 3QG1A 4M7AF 4IIOA 2DD5A 4JRIA 5CQXA 2EYXA 4BI8B 1T3LA 5D6XA 4E7JA 2ZPIB 3V8LA 1E7OA 2LRQA 2VGMA 3BDUA 1UUEA 3ULRB 1UTIA 3CC7T 2FRYA 3JCMe 1QWEA 2CP5A 1TWBA 4DEXA 2E70A 2OTLT 2P4RA 4AMCA 1YCYA 1KG1A 4F7UF 1RAHB 3M58A 1GCQC 3CC7A 4HCBA 1KFZA 1K4US 3QJ6A 4BI4A 1KIKA 2OTLA 4WCIA 1IB8A 3LYIA 4E7IA 3OYMA 3QSUA 3ASKA 1WGSA 2GCXA 1ARKA 2KBTA 4FT4A 1WNLA 5GAMe 1NJIC 3GLXA 7AT1B 4JPBW 4JS4A 3JB9J 1G8XA 1KD1U 4RCCA 1WLPB 4IUTA 1N8RR 2IVWA 3U23A 4NL2A 4EMKB 4M75D 1QMCA 2CP7A 3OW2A 4ME7A 2YUPA 4PJMA 3VS5A 2YWWA 3SB2A 2X4WA 1VQ8Q 4KUIA 2A28A 1N9RA 1RAGB 2A3LA 1BI2A 4VUBA 5CIUA 1GL5A 2JMCA 5EG2A 1I81A 1G3SA 4PJOA 2HMAA 4A53A 2O2OA 2RD1A 2A0FB 3H6ZA 2DVEA 2LZ6B 2DZ9A 5I22A 1KHCA 1Q86C 3GF5A 2RMOA 2PVGB 3DB3A 2BKDN 3CCEA 2R58A 3PFSA 1K9MR 3L2QA 2AK5A 2RJEA 2V26A 1N6AA 2KRSA 3C94A 1VUBA 1WZOA 4II1A 3PIPA 3RKYA 3SWNC 1OULA 1ZUYA 2EYWA 1WQ7A 2O4XB 2LNVA 3NPFA 1M2VB 3OBYA 5EC7A 1C0MA 5FU6B 3CCSQ 4LDVA 2L89A 2FO0A 1IZ6A 1Q81R 2KYMA 3G6EA 2LVMA 3EH2A 2MF2A 3EHQA 1VQLQ 3FLGA 4MZMA 1LVKA 1BB9A 1RI9A 4RG8A 2FZGB 2KE9A 2HQHA 1VIFA 3RESA 2KAFA 4ELZC 4M78A 2DYBA 4AFSC 4C8QA 1VQPQ 3GPLA 4K11A 3QYGB 2CT4A 1UDLA 2RHIA 2CP6A 2EVRA 3JB9D 4RTXA 3MPUB 2I2LA 1M9SA 4J6WA 4P5NA 2ROTA 1JXOA 3VV0A 2EGAA 2H8HA 1PWTA 5A0LA 1VQOQ 1KQSS 3N5BB 1UG1A 1KJWA 5HKCA 1WXUA 5LJ5h 5FRMA 3MCAB 2P0PA 3GIBA 2JTMA 4J9EA 3C4SA 1D0XA 3VUBA 4HT9A 4M7AB 3OW2P 3MEWA 2QI2A 3JCMd 1MUZA 1M1KR 1U5SA 5HK0A 3RBBB 1FMVA 3G71Q 5KCHA 4PJOE 1VQ8T 1Y96B 2PTKA 2LX9A 2XI9A 3OYYA 4C5EA 4OP0A 3CQTA 2VUBA 3TEEA 4EMKA 1BKBA 2QQRA 2HSPA 3MP1A 1YIJA 1ZUUA 4RTWA 3VS6A 2EWNA 4GY5A 4J9DA 4F7UB 4F16A 3PVLA 1WA7A 3PTAA 1SKUB 2LQNA 1ZBJA 2EKHA 1TS9A 4FL6A 3H0FA 2E10A 1ZSZA 4PK4A 4OB0B 5GAMd 1KK7A 1CKBA 1X6OA 3VS2A 1TU0B 1PM3A 4Q5WA 2M0OA 3RR6A 5GANg 2K7AA 2JN0A 1WHKA 9ATCB 1MNDA 2BZ8A 4DBHA 1M90C 3CCST 3QIIA 3GNGA 3OYBA 1PSEA 5FW9A 3HFNA 1SF9A 5I2SA 4M78E 1VQLT 3L2UA 4C8QE 2DX1A 3JCMc 3QPHA 4N0AC 2LMJA 3UT1A 2V1RA 2OTJQ 1M2VA 3CCSA 1VQPT 4MDWA 4PFPA 2C0OA 4RMOA 1Q82R 4RUGA 2GTJA 5LJ5j 1NM7A 2JJ9A 4Y28E 4PJOG 1M1FA 1U1SA 1T3SA 2ZCFB 4J7IA 2L0AA 2BIVA 1VQLA 3KFVA 2RJDA 3C0CA 2VXEA 3VS3A 5IAYA 3BW1A 1V1CA 4Y91A 4CC7A 3UWNA 2JM8A 1ZSGA 2LCSA 1VQPA 3O5ZA 3REBB 1AWWA 4IUVA 2DJQA 2QQBA 1KC8U 1OPKA 3EHRA 4ZNXA 1VQOT 3EG2A 2DE0X 3KUFA 2XIDA 4OMNA 4XU2A 3UF4A 2DXTA 1SPKA 5L23A 3I55Q 3BY7A 2DZCA 3MEVA 2R57A 3META 1N8RU 1PRMC 3L2RA 4PJOF 1QVFA 2RNAA 1VQOA 2VVKA 1E6HA 3INZA 5CKDA 2EPDA 3G71T 4DA4A 2ZPFB 3OMGA 4R56A 1WHJA 3QWXX 4M78G 1QVFS 1JO8A 4ZGJB 4M7AA 4C8QC 3VRYA 3DKMA 1OZ2A 5LJ3g 3JCMJ 5DM7R 2CH4W 3G71A 1VQ7Q 4TVRA 1BU1A 4OMLA 5GMKl 1Y96A 4C92D 4KGVB 2BE9B 2D0NA 3LW5E 4N4HA 1K9MU 4HVUA 4M7DG 1JQQA 1M8VA 3FEOA 4F7UA 1X27A 2KY9A 1SHGA 4ZTJA 2LNHB 4AG1C 1WX6A 3VU3C 1ZHIA 4OB2B 1H641 4RTUA 4M78F 2QQSA 2SRCA 1Q81U 4JZ3A 5GAN7 1Q7YR 1IREB 1Q82C 5GAOr 4L5GA 3EFSA 4RTTA 3CBPA 1Y0MA 3QJYA 3J81E 3OSSC 1UJ0A 1QVPA 2DFUA 1OOTA 2F2XA 2OTJT 4OMMA 2CP0A 1AOJA 2K5LA 1YHQQ 1S1NA 3CCVQ 3BFMA 4EMKC 2FHDA 2DXBA 1M30A 1UGSB 4M7DF 2YUQA 1PD0A 3LX7A 1K1ZA 1DJ7B 2OTJA 5GAOp 2CSQA 3OBWA 1VQ4Q 1R77A 2HKQB 3VS1A 2LQ8A 4D8DA 1TOVA 3M59A 4A4KA 1SSFA 3TU4K 1X6BA 4LN2A 2DTIA 3VKIA 3V7CA 5LJ3f 2JZ2A 3FJPA 4J9FA 5D7UA 5CVIA 4F17A 3RKXA 3I55T 2A7YA 1S72Q 3SDZA 2W10A 2FPDA 5IXBA 1M1KU 2RF0A 2C0TA 1WJRA 4FYVB 3RIRA 5KH6A 3CPFA 2CYZB 3I55A 1RAAB 2OAUA 2H3EB 3VS0A 5FLXE 3A8OB 3ER0A 5FU6C 1KQ2A 5HY6A 2QTVA 4OB1B 1VQ5Q 1VQ7T 1I4K1 1PNJA 5GAN5 2QK0A 5CK9A 2ECZA 2ATCB 4C5GA 1FXXA 3RUXA 2EYZA 5KYXB 1WHMA 4AFUC 1SSHA 4F7UE 1KQ1A 4E7LA 1QP2A 2D0QB 4AFQC 2K2VA 5CQYA 3D7SB 1KD1C 3MEUA 1VQ7A 4KBMB 2LJ0A 2M9UA 1QWFA 4LUDA 1PG5B 4X34A 1PHTA 4PLLA 4C0DB 2CUBA 1ABOA 1UGRB 3P8DA 1VQ9Q 4DOVA 3FDRA 5GAN2 3CEYA 1G2BA 4PJOB 3C12A 2C06A 4HT8A 4J9CA 2MPXC 1SHFA 5KYWA 3S6WA 2NYSA 3OB9A 2JVVA 1MV0B 2LT1A 3V8JA 1Y71A 3OYIA 2BZXA 2LJ3A 1YHQT 2YRVA 3CCVT 1Q82U 2MYSA 2DL4A 2RJFA 3OYEA 4M7AC 2HBWA 1NPRA 3G4SQ 1RACB 2DEUA 1BI0A 1M8MA 2FRWA 1FWZA 4C5IA 3KBGA 1U3OA 2DIQA 5IXFA 2KK4A 1VQ4T 1H3ZA 3CBMA 1AZEA 1YHQA 3CPWS 2QQAA 3OSVA 2VC8A 4AG2C 4E47A 3VYHB 1LJOA 4E7ZA 1RLPC 3JB9H 1ZLMA 3HPWA 1H8KA 3MKDA 2LQWA 2VB6A 2LT4A 4Z02A 5ECAA 2E65A 1D09B 1S72T 4M78B 3EFOA 2E5QA 1OYXA 2CGHA 3AT1B 1D1BA 4C0GA 3OYKA 1ZA1B 3JCMg 3OY9A 8ATCB 2MOXA 1M3BA 1K0SA 3MHXA 2KMTA 3M57A 1S72A 2XU8A 4J9BA 3TSZA 1NE8A 2AZVA 2X4JA 1WXBA 1VQ5T 3GOXA 1BK2A 4HCKA 2OAWA 2JS2A 1HK9A 3OYCA 2QYZA 2HDAA 3EFRA 1YFNA 5GAMg 1VQ5A 4IUQA 1KC8R 3CD6Q 1W6XA 2K5FA 2QTXA 2COZA 3OS2A 3JCMV 4F14A 2DD4A 4KT0E 2E5KA 3EG3A 5KYXA 1VIEA 1VQ9T 1N9SA 1W2BA 1Q7YU 1M2OA 2KI7A 2DAQA 2LC4A 5CR2A 4J83A 2AKKA 3M9QA 4V2SA 2ESWA 1W2BS 4C0FA 1VQ9A 1KSWA 4RCBA 5IT9E 1ZSZB 1PSFA 4WTOB 2DLPA 4XU0A 5FWBA 3G4ST 4MDXA 2RO0A 2YLBA 2LCLA 4FW2A 4PKCC 2KRMA 1T0JA 2X51A 3JCMX 2JT4A 1I5OB 1RL2A 4UC4A 2DEQA 2FPFA 1YP5A 4GLMA 4DQ2A 3NHNA 3G4SA 1HSQA 2CS7A 1EFNA 2WACA 1UEBA 3A8HB 2RK1A 3MP8A 3E1SA 5GAN6 1JEGA 1NEBA 1IRXA 2RQTA 1UGPB 4EDUA 3LGFA 2V1QA 2ZPEB 8AT1B 2D9TA 1GBQA 1UGVA 1OV3A 1M1GA 2QEXQ 2QASA 4JJDA 2F5KA 4QKUA 5KYUA 5GAMf 2G3RA 4PJOD 5HK3A 1I5LA 4O6JA 1Y07A 2KYBA 3VRZA 2L5QA 2H3JA 4HCZA 4M75E 2RJCA 2EYYA 2EFIA 1KC8C 5J3BA 4CI0C 1KQSA 3FIFA 2F1LA 3CCJQ 3OYAA 5J26A 3ZFJA 2R5AA 2CZ1B 4D8KA 2JOYA 2MMPA 3OYHA 3CD6T 3S3OA 4M7DA 1N8RC 2AT1B 2L3QA 1QCNA 3R6OA 1NYFA 3THKA 3CMEQ 3X25B 1M4ZA 2EQJA 4JRPA 1W2BP 2PVDB 2COWA 1QKXA 3GNFB 3H0HA 3CD6A 2HKNA 4JJCA 2RI2A 3OS5A 4M78D 2QXFA 3FJ5A 3L2ZA 4C8QD 3CC2Q 1XTDA 1U8RA 3JAME 4M4ZA 2DL8A 4ANJA 3RMQA 2XDDA 4NS5A 5LJ3h 4RTYA 2J6OA 2FEIA 4EMHA 2ZPGB 1K9MC 4LDYA 1VQ8A 4J6YA 2RI3A 1BYMA 1MGQA 1OPLA 3PT9A 2CSIA 1N5ZA 4M75G 1JBMA 3LGLA 2CH4A 2YDLA 1NYGA 2EJGA 1B3QA 2QQ9A 2FVUA 2JXBA 3JSCA 2MCNA 4MMLA 1SRLA 1CSKA 2KEAA 5GJWB 1T0HA 1Q81C 4D6WA 1K73R 2JS0A 3EG9A 1D1CA 4JRQA 4FCYA 2M16A 2JM9A 5DLQE 3I5SA 3PGGA 5CKEA 5J39A 2QEXT 1AD5A 1M3AA 2KT8A 1JRIA 3V8KA 4A54A 2DTOA 1GFDA 2DPPB 4C0DC 4M75F 3I5RA 2QEXA 5GAOm 4LNPA 4PJOC 5GAN8 1JJ2S 4OGCA 1JB0E 3A8MB 1G3WA 2CZ0B 1KQSP 2HEQA 3M0RA 4BE1A 4ESRA 4M7DE 5C6SA 3CCJT 2JTFA 3ZEHA 4FSXA 2YHTA 4J9HA 2RH2A 1TH7A 4A4GA 4ZGDB 1WDXA 1V76A 5IHKA 5LJ3j 3MEAA 3CMET 2HL3A 5I2MA 3SHWA 1LNXA 1M1KC 2XHCA 5FWCA 1IHWA 3CCJA 4QVZA 3X24B 2O9VA 2C0IA 5CKHA 1BIBA 3JB9G 4E7SA 4M77A 3FRNA 2E4HA 3CC2T 2GQIA 3CMEA 2A08A 2E3IA 2RQWA 4X9DA 2MWPA 2DNUA 3HL8A 2RN8A 3QBYA 4Z89A 1A0NB 3QKJA 3CCUQ 4QQDA 1PC0A 2M1HA 5GANf 1X2QA 2YXYA 2M51A 4M78C 4OMOA 2LDMA 3CC2A 1ZUKA 2DKGA 2ED1A 4N4IA 3J80E 1ACMB 3EH1A 3DLMA 4ZN3A 2OX7A 2K2MA 5LJ5e 2M0YA 1K76A 4BB7A 4FW1A 3M5AA 4OGEA 3Q1JA 2HL5C 2DM1A 1ZBXA 2E3HA 4J6XA 3HHTB 4M7DC 4JRKA 4FSSA 2K6DA 5KYWB 3M55A 1JU5C 2FYKA 3M0QA 1W4SA 1I1JA 3O8VA 2J7IA 3A8GB 4XTWA 1Z9QA 1QLYA 4JLGA 1UHFA 5A0GA 1X43A 2GNCA 4M7AD 1C6VX 2PNIA 5KCOA 2X35A 1G83A 3JB9I 2L3RA 2RQRA 4LD6A 5L8RE 2Y90A 5GMKh 4OVAA 1JXMA 4FU6A 3QWYA 4JLIA 3VYGA 1QQJA 3OMCA 1YJ9Q 3URGA 4J5YA 2NLUA 3DB4A 1SG5A 1TG0A 2G6FX 5A2QE 1AEYA 3E9FA 4J8OA 3EFOB 1ZSZC 4J9IA 3CC4Q 2KNBB 4RTZA 2COYA 4ORZA 1BCMA 2E6ZA 1UB4A 2V8JA 4M77E 4OMPA 2V8KA 2KVQG 2PU9B 3LH5A 3CMAQ 1PKTA 1WPYA 2D1XA 1U1TA 4WF2A 1Y7XA 1QVFP 4Z88A 3HSBA 1P92A 3RMSA 2VKNA 5LL6S 3CXCA 4A63B 4BY6B 2L3PA 4KGZB 1B7TA 1R8OB 1X69A 2WSEE 1HYOA 3I9QA 3CCUT 2GBQA 5FU7B 2X4YA 4M75B 1K8AR 2EIFA 3CXCS 3HRTA 4BE0A 2RI5A 3PE0A 2GGRA 4XTXA 3CCUA 2RPNA 4GLKA 2RM4A 3E9GA 2EAYA 5GAMh 2DXCA 5IHIA 2PVOB 1D1AA 1D0YA 1E6GA 2KXCA 3L1AA 5GMKj 2XKOC 2CKKA 1Q7YC 4QW2A 1K73U 2K5IA 4PFOA 3OS0A 4KGXB 1QCOA 1UGQB 2EQUA 2X3WD 4XU1A 3S3NA 3HRUA 4KULA 4M77G 1FMKA 2SEMA 4MZTA 3BE3A 4PNOA 2DL3A 3M4YA 4GBQA 4C92G 2MWOA 1LOJA 4LUEA 3SWNA 1FX7A 4FYYB 3RNJA 1PCXA 3UPUA 3QZ5B 4ZN1A 3QO3A 5LJ5d 2ZPBB 4E7KA 3CPWA 3H41A 5GAN3 3LWIA 4NL3A 1G3YA 1YJ9T 1YCSB 2RHUA 2F5TX 2XK0A 3H8ZA 4CC3A 1NJIR 1GCPA 4BUGA 2ZPHB 4XQ3A 2E1HA 2RHZA 3CCVA 1KHIA 3V7RA 3CC4T 4JS5A 3CCEQ 2DF6A 4NOYA 2XD0A 4M77F 1VYTA 4CC2A 3TCJA 1YJ9A 4QQGA 3R6NA 5KYUB 3UA7A 2O31A 5D6YA 4C92F 2P0QA 1VQ4A 3CMAT 2HSEB 2I0NA 3CC4A 2VXFA 1YI2Q 1TXQA 5CKBA 5AYFA 2FZKB 3CXCP 3UATA 1UE9A 1VA7A 1I0CA 5GAMj 1Q86R 5GAN4 3G6EQ 1I07A 2E41A 3CCRQ 2EQIA 1FMWA 3CMAA 2X4XA 2Z0WA 2LX7A 2O01E 4LDUA 2LP5A 2HAXA 4M7DB 2RA2A 2ROLA 2K3XA 2DJZA 1VQNQ 4A4EA 2L3SA 4EIKA 4FT2A 2DL5A 5KYNA 5HCKA 4M75A 1OQKA 3PMTA 2GQVA 1W70A 2EQKA 3EG1A 4QVDA 1HJDA 2FPEA 2F2WA 4JDSA 1J3TA 4E2FB 2NUPB 1VYUA 4A4HA 1VOMA 2BUDA 1GBRA 4X9CA 1X2KA 3I56Q 3A8LB 1LPLA 2XG8D 2ZZDA 1O9SA 2F69A 1R0CB 2CZ6B 1BCOA 2IG0A 4JJBA 2PUOB 3H0IA 2ED0A 3LWHA 2BE7D 2D8JA 2X9HA 2IIMA 4DBQA 1RLQC 3CPWP 1WXTA 4MZPA 4QT7A 4QVCA 4ATOA 2VASA 1H92A 1GXIE 1WYXA 3HKSA 2LJ1A 3OQ5A 3JCMf 1YIJQ 2DK3A 4N0AA 4PJJA 4DEYA 2DYIA 2QDLA 3HTRA 2HQEA 3EG9B 1WFWA 3NTKA 3CBOA 1OZ3A 2XDBA 3OW2S 2NWMA 3CCET 2AHJB 2D8HA 2E12A 2FG0A 2JMAA 1YBYA 2AIRB 1MMAA 5GANh 4OMFB 1N27A 2LCCA 1NG2A 4HKEA 4A4FA 1YI2T 1NLPC 3SEMA 4BD3A 2W0ZA 4X1VA 2QGFB 1B07A 1MMGA 1GRIA 3G6ET 5GAOl 3CCRT 1WIEA 2XMFA 1QVGA 2MK5A 1QCFA 2DO3A 3ZL7C 4AT1B 4XU3A 1YI2A 1K8AU 1K9AA 3CCLQ 1VYVA 1B34B 5KYYB 4ZGEB 3M0TA 4EMGA 1QVGS 1XNIA 3CCRA 2EJ9A 1VQNT 2KGTA 4R55A 2E64A 1OI1A 2K3YA 1M90R 2RB6A 3LH0A 2EKOA 4HVVA 2YUOA 3NFCA 4E7HA 4M77B 2QGGA 3QYHB 2RHXA 4J7FA 1NLOC 1PD1A 4ELYC 1RI0A 3EGXB 3GP8A 3WXMB 4C92B 1WHGA 1VQNA 4QQ6A 4BDYA 5AT1B 5GAOn 2EBPA 2EQMA 1VQKQ 4F04B 1YNZA 2J6KA 3I56T 1Q95G 5C0MA 2DRKA 4HCCA 1G3TA 2ABLA 3VS4A 1TUDA 4RG2A 2M02A 2KROA 4ZTFA 1AT1B 5CAIA 2DETA 2NUPA 3OS1A 3F70A 3I56A 2LQKA 2K3BA 3LLRA 5CO7A 5GANj 5A0DA 3M54A 4LDXA 1IXDA 1EZZB 5CCAA 4HXJA 2WSCE 3OYDA 4XTUA 2BZYA 2EJFA 4KH0B 4BY6C 1YIJT 1WHHA 1YWPA 2DMOA 1NJIU 4DOWA 4M7DD 1OX8A 2KRNA 1TUGB 5GMKi 1YITQ 5FU7C 4M75C 4BE2A 3X20B 3CCMQ 5GJVB 1NPPA 1RABB 3P8BB 1K0XA 2YLCA 2NUTB 3SFMA 4DBRA 2CZ7B 2CT3A 2K57A 3RERA 4KRTA 1MHNA 4IKFA 3L42A 2YUNA 2FL7A 4LE9A 2HNIA 3EAEA 1BI1A 4OB3B 1Q86U 4PL6A 1QVGP 1FYNA 2EYQA 1JJ2A 1MMNA 2YRDA 3JCMQ 3M53A 3EGUA 1RAIB 3RDVA 3HRSA 3PMIA 2MAMA 5M9OA 3M0UA 2PUKB 4XAXB 1W1FA 3CCLT 1C1AA 1Z9ZA 2KT1A 5GANe 1I8FA 4C5HA 3G1JA 3NTHA 2FZCB 3V7SA 4XTVA 4KH1B 1AWJA 2DILA 1EIFA 2YSQA 2GFUA 1YJWQ 2O4XA 2DL7A 3CCQQ 3NTIA 2K4YA 2CDTA 3CCLA 3I35A 2A37A 4Z8AA 2ENMA 2B8AA 1B34A 5KYYA 1SEMA 2ZAEA 4RKUE 3L2VA 2DVJA 2P0KA 5KE2A 2CP2A 3OYFA 1BBZA 3TREA 1VQKT 3P8HA 3AHUA 3EG0A 3VUZA 3TQ7P 2OI3A 1OU9A 1IGUA 4FIBA 4KUDK 4O5VA 4EPCA 3QXEB 3QDRB 3KXTA 1WJSA 3EGXA 3H9NA
chains in the Genus database with same CATH topology
2KSSA 2X4YA 3GOXA 4M75B 1M5Q1 4C92A 1ZQ1A 2EIFA 3CXCS 1VQKA 3HRTA 3QZ9B 1HK9A 3BDLA 2JNGA 3VV0A 4BE0A 1X01A 2RI5A 1WQWA 3QHSA 4B9WA 3OYCA 5A0LA 5LJ5g 1KQSS 2RHYA 4XTXA 3N5BB 3EFRA 3CCUA 3CCLA 5HKCA 5GAMg 4OF1A 5LJ5h 1VQ5A 3MCAB 5FRMA 4IUQA 2K5FA 2P0PA 2QTXA 4GLKA 2RM4A 4YTLA 3GIBA 2JTMA 3E9GA 2EAYA 5GAMh 3C4SA 2DXCA 2HBPA 3OS2A 3JCMV 2PVOB 3VUBA 4HT9A 2DD4A 4M7AB 1HXDA 3L1AA 3MEWA 4KT0E 1YITT 2QI2A 3JCMd 1K73C 5GMKj 2XKOC 2CKKA 2QDYB 1VIEA 1Q7YC 4QW2A 1VQ9T 1N9SA 4BI3A 1W2BA 5HK0A 2VV5A 2K5IA 4C8QG 3CCMT 1K73U 3ME9A 5KCHA 4PJOE 1VQ8T 3JB9F 1Q7YU 1Y96B 3CPWS 5IN1A 2DAQA 2LC4A 1AHJB 2LX9A 3OS0A 5I21A 5CR2A 2XI9A 1UGQB 2EQUA 4XU1A 3OYYA 4C5EA 4J83A 4HA8A 4M77D 4OP0A 2VUBA 3S3NA 3HRUA 3M9QA 3SWNB 3TEEA 4V2SA 4KULA 2DIGA 1BKBA 2GF7A 4M77G 4XK8E 2QQRA 3WVEB 3ZBDA 2R5MA 4JUVA 1YITA 3MP1A 1W2BS 4MZTA 5DY9A 3SD4A 1YIJA 4C0FA 4PNOA 2EWNA 2HD0A 3M4YA 4C92G 5LJ3e 4GY5A 2MWOA 1LOJA 4RCBA 4F7UB 3CCMA 5IT9E 1PSFA 1FX7A 3SWNA 4XU0A 2E6NA 3G4ST 4MDXA 2RO0A 3UPUA 2YLBA 4CRIA 3PNWC 5KE3A 3PTAA 2LCLA 3QZ5B 2Y4YA 4PKCC 4ZN1A 4FL6A 2E10A 3JCMX 3QO3A 5LJ5d 2ZPBB 2XDPA 4E7KA 1RL2A 3CPWA 4UC4A 4OB0B 5GAN3 2DEQA 5GAMd 3LWIA 2JUFA 4DQ2A 4NL3A 1G3YA 1YJ9T 3OYLA 1X6OA 2RHUA 2F5TX 2PQWA 2XK0A 2CS7A 3E19A 3H8ZA 2M0OA 4Q5WA 3G4SA 2LTOA 4C8QF 4BUGA 2WACA 2ZPHB 1UEBA 3MP6A 5GANg 3A8HB 2JN0A 4XQ3A 2E1HA 2RHZA 2Y4XA 3CCVA 1KHIA 1M90C 3CCST 3QIIA 3V7RA 2RK1A 3MP8A 3CC4T 4JS5A 3GNGA 3E1SA 5GAN6 3OYBA 1M90U 1YJWT 1O75A 2XD0A 4NOYA 4M77F 1PSEA 3HFNA 1UGPB 3TCJA 4EDUA 3LGFA 1YJ9A 5I2SA 2ZPEB 3CCQT 4M78E 4QQGA 1VQLT 4JJNK 3L2UA 2D9TA 4C8QE 4C92F 5D6YA 2P0QA 3QPHA 3JCMc 4N0AC 3A5ZB 1VQ4A 2RK2A 1M1GA 5LJ5f 3UT1A 3CMAT 3CCSA 2F5KA 5GAMf 3CC4A 3UDCA 2VXFA 2G3RA 1WJQA 1VQPT 4LD9K 4MDWA 4PJOD 4RMOA 5CKBA 5AYFA 1YJWA 5LJ5j 4IUPA 2D6FA 4Y28E 4PJOG 1M1FA 1U1SA 2ZCFB 5GAMj 4J7IA 4FM4B 3CCQA 2BIVA 1D3BB 4IURA 4C92E 5GAN4 1VQLA 5HK3A 5CKFA 2DXUA 2E41A 1I5LA 3JCMh 4O6JA 2RJDA 1Y07A 2ZGWA 2L5QA 3CMAA 2H3JA 2VXEA 5IAYA 4HCZA 4XTYA 3BW1A 2X4XA 4Y91A 4M75E 3UWNA 2O01E 1VQPA 4LDUA 2RJCA 4IUVA 2EFIA 3JRZA 1KC8C 5J3BA 2QQBA 3FB9A 4CI0C 1KC8U 1KQSA 4IUUA 3FIFA 2RA2A 2WSFE 5GANd 3OYGA 2HAXA 4M7DB 2KQWA 3OYAA 2P4TA 1VQOT 3S3MA 2K3XA 5J26A 3KUFA 2XIDA 2R5AA 4XU2A 2DJZA 3HP9A 3ZFJA 3JCMb 2CZ1B 4C0ZA 4A4EA 4FT2A 2JOYA 2MMPA 3OYHA 4L6V5 2DXTA 3S3OA 3CD6T 4M7DA 3RKWA 1N8RC 4M75A 3BY7A 4MMKA 1NZ9A 3R6OA 3PMTA 2DZCA 2GQVA 3MEVA 2R57A 3META 2EQKA 1N8RU 4M7AE 3L2RA 4QVDA 3X25B 1M4ZA 2EQJA 4PJOF 1QVFA 3C95A 4JRPA 4JDSA 2PVDB 1VQOA 3INZA 3GNFB 5CKDA 3G71T 4A4HA 4DA4A 2BUDA 2ZPFB 3CD6A 4X9CA 2RI2A 3OS5A 4M78D 2QXFA 3L2WA 3OMGA 3L2ZA 4C8QD 4R56A 3A8LB 2XG8D 1XTDA 2ZZDA 4M78G 3OA6A 1O9SA 3M56A 5FROA 1QVFS 2F69A 4ZGJB 1U8RA 4M7AA 1YJNT 1X75C 3JAME 4C8QC 3VJPA 2CZ6B 5M9OA 4L59A 3DKMA 3OYNA 1VQMT 2IG0A 1OZ2A 2PUOB 3MO8A 5LJ3g 3JCMJ 5DM7R 3RMQA 2XDDA 3G71A 5GAOq 4NS5A 4TVRA 5LJ3h 2VGNA 4PLIA 3DLLA 1QP3A 5GMKl 1Y96A 5D6WA 3LWHA 4M77C 4C92D 3HFOA 1V29B 5GMKm 5DLOA 1BI3A 4EMHA 2ZPGB 3X26B 4MZPA 4C92C 4QVCA 1K9MC 1YJNA 4ATOA 4LDYA 1VQ8A 3LW5E 4N4HA 1VQMA 4J6YA 1K9MU 2GFAA 2RI3A 2XICA 3T9NA 4EMKA 3PIOA 1BIAA 4BDZA 1BYMA 1MGQA 4B9XA 1GXIE 3X28B 3PT9A 4M7DG 1VQ6T 4BACA 3HKSA 1JBMA 4M75G 3LGLA 3FEOA 3OQ5A 3JCMf 4F7UA 1M8VA 2DK3A 2KY9A 4LDWA 4N0AA 3JCMW 2EJGA 2QQ9A 2FVUA 4ZTJA 2HQEA 3JSCA 4MMLA 3JCMP 3NTKA 3FC3A 3VU3C 1ZHIA 2V8IA 4OB2B 1H641 3CBOA 1OZ3A 1Q81C 2XDBA 4D6WA 4M78F 3WVDB 3OW2S 3CCET 2AHJB 2QQSA 2E12A 4XTZA 1Q81U 5GAN7 4JRQA 1YBYA 2M16A 1VQ6A 1IREB 1Q82C 5GAOr 4L5GA 3EFSA 5DLQE 5GANh 5FRNA 3PGGA 3CBPA 4OMFB 2MI6A 2VYTA 3QJYA 5CKEA 1N27A 3J81E 4M7AG 5J39A 2QEXT 3OSSC 1QVPA 1XQHA 1XOVA 2OTJT 3QUIA 1JRIA 2LCCA 3V8KA 4A54A 4HKEA 5LJ3d 4A4FA 1YI2T 2K5LA 4BD3A 3BFMA 2DTOA 2L8DA 4EMKC 2FHDA 2DXBA 2DPPB 3G7ZA 2QA4T 3J7AF 3G6ET 1UGSB 5GMKe 4C0DC 4M7DF 5GAOl 3CCRT 4M75F 4N4GA 3LX7A 1QVGA 2QEXA 1DJ7B 2OTJA 5GAOm 2DO3A 5GAOp 4PJOC 5GAN8 1K8AC 3OBWA 1JJ2S 3M4GA 4OGCA 1JB0E 4XU3A 1YI2A 1G5VA 3A8MB 2KDSA 1K8AU 1G3WA 4F7UG 3OYJA 2LQ8A 2CZ0B 3M59A 4A4KA 2DTHA 4BE1A 1SSFA 1B34B 2QA4A 4ZGEB 4M7DE 4EMGA 5C6SA 3CCJT 1D3BA 3TU4K 1XNIA 1QVGS 3CCRA 2JTFA 2DTIA 3ZEHA 3VKIA 2FB7A 2HQXA 4FSXA 5LJ3f 2EJ9A 2YHTA 3V7CA 4C8QB 1VQNT 2JZ2A 1QW1A 4R55A 2E64A 1OI1A 2K3YA 2RH2A 3FJPA 1TH7A 2RB6A 3QG1A 4M7AF 3LH0A 2DD5A 4A4GA 4JRIA 5CVIA 4ZGDB 2EKOA 5CQXA 3RKXA 3I55T 2A7YA 4BI8B 5LJ3j 5D6XA 3NFCA 3MEAA 3CMET 5I2MA 3SDZA 4E7JA 2ZPIB 3V8LA 1LNXA 2LRQA 4E7HA 4M77B 4J7FA 2VGMA 2RHXA 2XHCA 3QYHB 4ELYC 1M1KC 1RI0A 3BDUA 3CCJA 4QVZA 3GP8A 3CC7T 1M1KU 3WXMB 3X24B 3JCMe 5CKHA 1BIBA 4C92B 1VQNA 4QQ6A 4BDYA 1WJRA 3JB9G 4M77A 5GAOn 3FRNA 3RIRA 2EQMA 5KH6A 3CPFA 2CYZB 3I55A 2E70A 2OAUA 2OTLT 3I56T 3CC2T 5C0MA 3CMEA 5FLXE 1YCYA 1KG1A 3A8OB 4F7UF 4X9DA 3ER0A 2MWPA 5FU6C 4HCCA 1G3TA 3HL8A 5HY6A 1KQ2A 3M58A 3QBYA 3QKJA 3CC7A 4HCBA 4QQDA 2M1HA 4OB1B 4RG2A 5GANf 1VQ7T 4ZTFA 1I4K1 5CAIA 5GAN5 4M78C 3QJ6A 3OS1A 4BI4A 5CK9A 2OTLA 2LDMA 3F70A 3I56A 3LYIA 2LQKA 3LLRA 5CO7A 4C5GA 1FXXA 2DKGA 5GANj 3RUXA 4N4IA 4E7IA 3J80E 4F7UE 5A0DA 3OYMA 3QSUA 3ASKA 3DLMA 3M54A 4ZN3A 4LDXA 1WGSA 2GCXA 1KQ1A 5LJ5e 4E7LA 1QP2A 2D0QB 2K2VA 4FT4A 5CCAA 2WSCE 5CQYA 3OYDA 1KD1C 3MEUA 4XTUA 1WNLA 4BB7A 5GAMe 2EJFA 1NJIC 1VQ7A 3GLXA 3M5AA 4OGEA 3Q1JA 4JS4A 4KBMB 4BY6C 3JB9J 1YIJT 1KD1U 4RCCA 2M9UA 1NJIU 4DOWA 4IUTA 2IVWA 4M7DD 4NL2A 4EMKB 1ZBXA 4J6XA 4M75D 4X34A 3HHTB 3OW2A 5GMKi 4ME7A 4PLLA 4C0DB 4M7DC 4JRKA 5FU7C 1UGRB 4M75C 3M55A 3P8DA 3X20B 4BE2A 3SB2A 4DOVA 2FYKA 3FDRA 5GAN2 3CEYA 4PJOB 2X4WA 3C12A 4KUIA 2C06A 4HT8A 1N9RA 1W4SA 2A3LA 1NPPA 1BI2A 3O8VA 3P8BB 3A8GB 4VUBA 5CIUA 2YLCA 3S6WA 3SFMA 5EG2A 2CZ7B 1I81A 4XTWA 1G3SA 3OB9A 2JVVA 1VQ9A 4PJOA 4A53A 2LT1A 4JLGA 2K57A 2RD1A 3V8JA 3RERA 1Y71A 3H6ZA 3OYIA 1MHNA 5A0GA 2DVEA 4M7AD 1YHQT 2YRVA 3CCVT 1Q82U 4IKFA 3L42A 2DZ9A 2RJFA 3OYEA 1KHCA 1Q86C 2FL7A 5KCOA 2HNIA 4M7AC 1NPRA 2X35A 3EAEA 1BI1A 3GF5A 4OB3B 1Q86U 1BI0A 3JB9I 4PL6A 3CC2A 2L3RA 2PVGB 4LD6A 3DB3A 5L8RE 2Y90A 2BKDN 2EYQA 4OVAA 2R58A 5GMKh 3CCEA 4FU6A 1JJ2A 1FWZA 3PFSA 4JLIA 4C5IA 3JCMQ 3KBGA 3VYGA 3M53A 3L2QA 2DIQA 1VQ4T 2KK4A 2RJEA 1H3ZA 3CBMA 3HRSA 3PMIA 1YHQA 1N6AA 2MAMA 3C94A 2QQAA 1VUBA 2PUKB 3OMCA 4II1A 4J5YA 4XAXB 3URGA 3PIPA 3RKYA 2NLUA 3CCLT 3SWNC 3OSVA 3DB4A 2VC8A 4E47A 3VYHB 1LJOA 1WQ7A 2O4XB 1I8FA 2LNVA 4C5HA 5GANe 5A2QE 3OBYA 3JB9H 3E9FA 3NTHA 3V7SA 4XTVA 4J8OA 3HPWA 5FU6B 4LDVA 2L89A 1IZ6A 1EIFA 2GFUA 2LT4A 3G6EA 4Z02A 2LVMA 2O4XA 2E65A 1S72T 2MF2A 2K4YA 2E5QA 3NTIA 3FLGA 1OYXA 1UB4A 2E6ZA 2CGHA 2V8JA 4M78B 4MZMA 4M77E 2B8AA 1B34A 2KVQG 2V8KA 4RG8A 4RKUE 4C0GA 2PU9B 3OYKA 3L2VA 3JCMg 1VIFA 3RESA 3OY9A 2KAFA 1WPYA 4ELZC 1U1TA 4M78A 4WF2A 1Y7XA 4C8QA 2P0KA 5KE2A 3OYFA 3GPLA 3TREA 3MHXA 1VQKT 3HSBA 3P8HA 1P92A 2KMTA 3M57A 3QYGB 3AHUA 3RMSA 3VUZA 2RHIA 5LL6S 3CXCA 2XU8A 1S72A 4BY6B 3JB9D 1R8OB 4FIBA 4KUDK 4O5VA 4EPCA 3QXEB 2WSEE 3QDRB 2I2LA 3KXTA 1NE8A 3CCUT 1WJSA 2X4JA 1M9SA 4J6WA 1VQ5T 4P5NA 5FU7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJO D;  4XTZ A;  4XTU A;  1WNL A;  1M5Q 1;  4M75 B;  2EJF A;  4C92 A;  5GAM e;  5LJ5 j;  5GAN 7;  3JB9 J;  4PJO G;  5GAO r;  1U1S A;  3EFS A;  4RCC A;  1HK9 A;  5GAM j;  5GAN h;  3PGG A;  1D3B B;  4C92 E;  4NL2 A;  4EMK B;  1X01 A;  5GAN 4;  4J6X A;  2DXU A;  2E41 A;  4M75 D;  1I5L A;  3JCM h;  1WQW A;  4M7A G;  2ZGW A;  3QHS A;  5GMK i;  4M7D C;  4JRK A;  5LJ5 g;  3QUI A;  4XTX A;  2VXE A;  1JRI A;  3EFR A;  4M75 C;  4XTY A;  3V8K A;  4A54 A;  5LJ3 d;  3BW1 A;  3SB2 A;  4Y91 A;  2FYK A;  5GAM g;  5GAN 2;  4M75 E;  5LJ5 h;  2QTX A;  4PJO B;  3GIB A;  2RM4 A;  3BFM A;  2DTO A;  2EAY A;  1N9R A;  4EMK C;  5GAM h;  4HT8 A;  3JCM V;  3FB9 A;  4HT9 A;  5GMK e;  2YLC A;  4M7A B;  4M7D F;  5GAN d;  3FIF A;  1HXD A;  2RA2 A;  5GAO l;  4M7D B;  1I81 A;  4XTW A;  4M75 F;  3L1A A;  4PJO A;  3JCM d;  4A53 A;  5GMK j;  2K57 A;  2RD1 A;  3V8J A;  3RER A;  4XU2 A;  2DJZ A;  3JCM b;  5GAO p;  5GAO m;  4PJO C;  2DVE A;  1N9S A;  5GAN 8;  4M7A D;  3M4G A;  4C8Q G;  4M7D D;  2DXT A;  4XU3 A;  2DZ9 A;  3JB9 F;  4M7D A;  4PJO E;  1Y96 B;  3RKW A;  4F7U G;  4M75 A;  2HNI A;  3BY7 A;  4MMK A;  4M7A C;  5I21 A;  2DZC A;  4XU1 A;  2DTH A;  4M77 D;  4HA8 A;  4OP0 A;  1B34 B;  4QVD A;  3JB9 I;  4M7A E;  4M7D E;  3SWN B;  4EMG A;  4V2S A;  1D3B A;  2Y90 A;  4EMK A;  5GMK h;  4M77 G;  4PJO F;  2DTI A;  4JUV A;  2FB7 A;  3V7C A;  4JLI A;  5LJ3 f;  2EJ9 A;  2YHT A;  3INZ A;  5DY9 A;  4C8Q B;  3JCM Q;  4PNO A;  2E64 A;  2EWN A;  5LJ3 e;  3FJP A;  4C92 G;  1TH7 A;  2RB6 A;  4RCB A;  1LOJ A;  4F7U B;  4M7A F;  4JRI A;  3SWN A;  3RKX A;  4X9C A;  4XU0 A;  4J5Y A;  4M78 D;  3RKY A;  2YLB A;  5LJ3 j;  3SWN C;  3L2Z A;  4C8Q D;  2VC8 A;  4M78 G;  3V8L A;  1LNX A;  4M77 B;  1LJO A;  1WQ7 A;  5GAN e;  1I8F A;  4M7A A;  3BDU A;  2E10 A;  4C8Q C;  3JCM X;  3JB9 H;  3V7S A;  3QO3 A;  4XTV A;  5LJ5 d;  3JCM e;  1BIB A;  4C92 B;  5LJ3 g;  3JCM J;  5GAN 3;  2DEQ A;  5GAM d;  3JB9 G;  4DQ2 A;  4M77 A;  5GAO n;  5GAO q;  4NL3 A;  3RIR A;  2E65 A;  5LJ3 h;  5GMK l;  1Y96 A;  4M77 C;  4M78 B;  4C92 D;  3HFO A;  2CGH A;  4C8Q F;  4M77 E;  5GAN g;  1YCY A;  2JN0 A;  5GMK m;  4XQ3 A;  1B34 A;  2E1H A;  4X9D A;  4EMH A;  4F7U F;  1KQ2 A;  4C92 C;  4QVC A;  3JCM g;  3RES A;  3V7R A;  1WPY A;  4J6Y A;  5GAN 6;  1U1T A;  4M78 A;  4WF2 A;  1BIA A;  5GAN f;  1MGQ A;  4C8Q A;  4M7D G;  1I4K 1;  4NOY A;  4M77 F;  5CAI A;  5GAN 5;  3HFN A;  4M78 C;  1JBM A;  4M75 G;  3HSB A;  1M8V A;  3JCM f;  4F7U A;  3AHU A;  4N0A A;  4M78 E;  3JCM W;  2EJG A;  4C8Q E;  3JB9 D;  4C92 F;  5GAN j;  3JCM c;  2DKG A;  4N0A C;  3RUX A;  4MML A;  4F7U E;  5LJ5 f;  3JCM P;  2I2L A;  3QSU A;  3VU3 C;  1H64 1;  5LJ5 e;  1KQ1 A;  4J6W A;  5GAM f;  4M78 F;  2VXF A; 
#chains in the Genus database with same CATH topology
 2KSS A;  4C92 A;  1M5Q 1;  1ZQ1 A;  1AZG B;  2QAZ A;  1VQK A;  1R0B G;  3QZ9 B;  3BDL A;  1MV3 A;  2QG9 B;  2JNG A;  1X01 A;  1WQW A;  4HVW A;  1WI7 A;  3QHS A;  2O88 A;  4B9W A;  5LJ5 g;  2RHY A;  1RAD B;  4OF1 A;  3A98 A;  1RAF B;  4YTL A;  1UFF A;  2HBP A;  1PKS A;  1HXD A;  1IO6 A;  1YIT T;  1IGQ A;  1K73 C;  1TUC A;  2QDY B;  4BI3 A;  2VV5 A;  4C8Q G;  3CCM T;  3ME9 A;  3JB9 F;  2RQU A;  5IN1 A;  2AKL A;  1AHJ B;  1TSF A;  5I21 A;  4AFZ C;  4M77 D;  4HA8 A;  2L2P A;  4FYX B;  3SWN B;  1AVZ C;  4XK8 E;  2DIG A;  3ZBD A;  2GF7 A;  3WVE B;  1YN8 A;  1YJN Q;  2R5M A;  2NUZ A;  4JUV A;  1VQM Q;  1YIT A;  3EGD B;  5DY9 A;  3SD4 A;  4R0K A;  2PZ1 A;  2HD0 A;  5LJ3 e;  3CCM A;  3NGP A;  2E6N A;  4CRI A;  3PNW C;  5KE3 A;  1TTH B;  1JJ2 P;  2Y4Y A;  3PVQ A;  2NUT A;  2A36 A;  2CUD A;  2XDP A;  2OJ2 A;  1OX9 A;  2F2V A;  2JUF A;  1SRM A;  3OYL A;  3VS7 A;  4DBF A;  1VQ6 Q;  1KD1 R;  2O9S A;  2PQW A;  3E19 A;  2AZS A;  2LTO A;  4C8Q F;  3MP6 A;  2RQV A;  2Y4X A;  1AWX A;  3MJX A;  5I11 A;  5IH2 A;  1MMD A;  3TSW A;  1M90 U;  2JW4 A;  1YJW T;  1O75 A;  4Y92 A;  4OMQ A;  3CCQ T;  4JJN K;  1EX4 A;  2HZY A;  3A5Z B;  2RK2 A;  1XJW B;  5LJ5 f;  1UEC A;  2VWF A;  3UDC A;  1M27 C;  1WJQ A;  4LD9 K;  1U06 A;  1ABQ A;  1YWO A;  1GCQ A;  1YJW A;  4IUP A;  2D6F A;  1LCK A;  4FM4 B;  3CCQ A;  1D3B B;  4IUR A;  4C92 E;  1ZA2 B;  2QA4 Q;  5CKF A;  2DXU A;  3JCM h;  2ZGW A;  3UA6 A;  4E6R A;  2EGE A;  4XTY A;  1NBE B;  1AWO A;  3JRZ A;  2J6F A;  4B6M A;  4RTV A;  3FB9 A;  4IUU A;  5GAN d;  3OYG A;  2WSF E;  2KQW A;  3JV3 A;  2P4T A;  1CKA A;  3S3M A;  3JCM b;  3HP9 A;  4C0Z A;  1UJY A;  2EGC A;  3A1P A;  4L6V 5;  3RKW A;  1IHV A;  4MMK A;  1NZ9 A;  4CC4 B;  2K79 A;  2J06 A;  4M7A E;  1RUW A;  3C95 A;  2GTO A;  1H3H A;  3CC7 Q;  3M0S A;  2YRC A;  4PFZ A;  4J9G A;  3L2W A;  2OTL Q;  3OA6 A;  3M56 A;  5FRO A;  1YJN T;  1X75 C;  3VJP A;  4L59 A;  1VQM T;  3OYN A;  2KXD A;  3MO8 A;  1NEG A;  3NMZ C;  4FYW B;  5GAO q;  2YT6 A;  2VGN A;  4PLI A;  3DLL A;  1QP3 A;  5D6W A;  4M77 C;  3HFO A;  1V29 B;  2DRM A;  5GMK m;  2IPO B;  3TVT A;  1BI3 A;  1MNE A;  5DLO A;  3X26 B;  4C92 C;  1PRL C;  1YJN A;  1OU8 A;  1VQM A;  2GFA A;  3T9N A;  2XIC A;  3PIO A;  4BDZ A;  1BIA A;  3EGD A;  3REA B;  2X3X D;  4B9X A;  3X28 B;  1VQ6 T;  4BAC A;  1OEB A;  2B86 A;  4LDW A;  3JCM W;  6AT1 B;  3IQL A;  4LXC A;  3JCM P;  3FC3 A;  2BTT A;  2V8I A;  5IHN A;  1ZX6 A;  1M3C A;  2DBK A;  3WVD B;  1RAE B;  4PJN A;  4XTZ A;  4PJL A;  2DBM A;  1VQ6 A;  1F1B B;  3E2U A;  1HD3 A;  5FRN A;  2MI6 A;  2VYT A;  4JZ4 A;  4M7A G;  2K9G A;  1XQH A;  1XOV A;  4IIM A;  2CP3 A;  3QUI A;  5LJ3 d;  1Y57 A;  3GBQ A;  1UHC A;  2L8D A;  1X6G A;  1D0Z A;  3G7Z A;  3J7A F;  2QA4 T;  5GMK e;  1QKW A;  2P84 A;  4N4G A;  1GFC A;  1K8A C;  3M4G A;  2DER A;  1G5V A;  2EW3 A;  2KDS A;  2J05 A;  2CRE A;  4F7U G;  3OYJ A;  2KR3 A;  3QDF A;  2HCK A;  2JTE A;  2DA9 A;  2DTH A;  2QA4 A;  1D3B A;  2FB7 A;  2HQX A;  1WHL A;  3M0P A;  4C8Q B;  1QW1 A;  2MIO A;  3QG1 A;  4M7A F;  4IIO A;  2DD5 A;  4JRI A;  5CQX A;  2EYX A;  4BI8 B;  1T3L A;  5D6X A;  4E7J A;  2ZPI B;  3V8L A;  1E7O A;  2LRQ A;  2VGM A;  3BDU A;  1UUE A;  3ULR B;  1UTI A;  3CC7 T;  2FRY A;  3JCM e;  1QWE A;  2CP5 A;  1TWB A;  4DEX A;  2E70 A;  2OTL T;  2P4R A;  4AMC A;  1YCY A;  1KG1 A;  4F7U F;  1RAH B;  3M58 A;  1GCQ C;  3CC7 A;  4HCB A;  1KFZ A;  1K4U S;  3QJ6 A;  4BI4 A;  1KIK A;  2OTL A;  4WCI A;  1IB8 A;  3LYI A;  4E7I A;  3OYM A;  3QSU A;  3ASK A;  1WGS A;  2GCX A;  1ARK A;  2KBT A;  4FT4 A;  1WNL A;  5GAM e;  1NJI C;  3GLX A;  7AT1 B;  4JPB W;  4JS4 A;  3JB9 J;  1G8X A;  1KD1 U;  4RCC A;  1WLP B;  4IUT A;  1N8R R;  2IVW A;  3U23 A;  4NL2 A;  4EMK B;  4M75 D;  1QMC A;  2CP7 A;  3OW2 A;  4ME7 A;  2YUP A;  4PJM A;  3VS5 A;  2YWW A;  3SB2 A;  2X4W A;  1VQ8 Q;  4KUI A;  2A28 A;  1N9R A;  1RAG B;  2A3L A;  1BI2 A;  4VUB A;  5CIU A;  1GL5 A;  2JMC A;  5EG2 A;  1I81 A;  1G3S A;  4PJO A;  2HMA A;  4A53 A;  2O2O A;  2RD1 A;  2A0F B;  3H6Z A;  2DVE A;  2LZ6 B;  2DZ9 A;  5I22 A;  1KHC A;  1Q86 C;  3GF5 A;  2RMO A;  2PVG B;  3DB3 A;  2BKD N;  3CCE A;  2R58 A;  3PFS A;  1K9M R;  3L2Q A;  2AK5 A;  2RJE A;  2V26 A;  1N6A A;  2KRS A;  3C94 A;  1VUB A;  1WZO A;  4II1 A;  3PIP A;  3RKY A;  3SWN C;  1OUL A;  1ZUY A;  2EYW A;  1WQ7 A;  2O4X B;  2LNV A;  3NPF A;  1M2V B;  3OBY A;  5EC7 A;  1C0M A;  5FU6 B;  3CCS Q;  4LDV A;  2L89 A;  2FO0 A;  1IZ6 A;  1Q81 R;  2KYM A;  3G6E A;  2LVM A;  3EH2 A;  2MF2 A;  3EHQ A;  1VQL Q;  3FLG A;  4MZM A;  1LVK A;  1BB9 A;  1RI9 A;  4RG8 A;  2FZG B;  2KE9 A;  2HQH A;  1VIF A;  3RES A;  2KAF A;  4ELZ C;  4M78 A;  2DYB A;  4AFS C;  4C8Q A;  1VQP Q;  3GPL A;  4K11 A;  3QYG B;  2CT4 A;  1UDL A;  2RHI A;  2CP6 A;  2EVR A;  3JB9 D;  4RTX A;  3MPU B;  2I2L A;  1M9S A;  4J6W A;  4P5N A;  2ROT A;  1JXO A;  3VV0 A;  2EGA A;  2H8H A;  1PWT A;  5A0L A;  1VQO Q;  1KQS S;  3N5B B;  1UG1 A;  1KJW A;  5HKC A;  1WXU A;  5LJ5 h;  5FRM A;  3MCA B;  2P0P A;  3GIB A;  2JTM A;  4J9E A;  3C4S A;  1D0X A;  3VUB A;  4HT9 A;  4M7A B;  3OW2 P;  3MEW A;  2QI2 A;  3JCM d;  1MUZ A;  1M1K R;  1U5S A;  5HK0 A;  3RBB B;  1FMV A;  3G71 Q;  5KCH A;  4PJO E;  1VQ8 T;  1Y96 B;  2PTK A;  2LX9 A;  2XI9 A;  3OYY A;  4C5E A;  4OP0 A;  3CQT A;  2VUB A;  3TEE A;  4EMK A;  1BKB A;  2QQR A;  2HSP A;  3MP1 A;  1YIJ A;  1ZUU A;  4RTW A;  3VS6 A;  2EWN A;  4GY5 A;  4J9D A;  4F7U B;  4F16 A;  3PVL A;  1WA7 A;  3PTA A;  1SKU B;  2LQN A;  1ZBJ A;  2EKH A;  1TS9 A;  4FL6 A;  3H0F A;  2E10 A;  1ZSZ A;  4PK4 A;  4OB0 B;  5GAM d;  1KK7 A;  1CKB A;  1X6O A;  3VS2 A;  1TU0 B;  1PM3 A;  4Q5W A;  2M0O A;  3RR6 A;  5GAN g;  2K7A A;  2JN0 A;  1WHK A;  9ATC B;  1MND A;  2BZ8 A;  4DBH A;  1M90 C;  3CCS T;  3QII A;  3GNG A;  3OYB A;  1PSE A;  5FW9 A;  3HFN A;  1SF9 A;  5I2S A;  4M78 E;  1VQL T;  3L2U A;  4C8Q E;  2DX1 A;  3JCM c;  3QPH A;  4N0A C;  2LMJ A;  3UT1 A;  2V1R A;  2OTJ Q;  1M2V A;  3CCS A;  1VQP T;  4MDW A;  4PFP A;  2C0O A;  4RMO A;  1Q82 R;  4RUG A;  2GTJ A;  5LJ5 j;  1NM7 A;  2JJ9 A;  4Y28 E;  4PJO G;  1M1F A;  1U1S A;  1T3S A;  2ZCF B;  4J7I A;  2L0A A;  2BIV A;  1VQL A;  3KFV A;  2RJD A;  3C0C A;  2VXE A;  3VS3 A;  5IAY A;  3BW1 A;  1V1C A;  4Y91 A;  4CC7 A;  3UWN A;  2JM8 A;  1ZSG A;  2LCS A;  1VQP A;  3O5Z A;  3REB B;  1AWW A;  4IUV A;  2DJQ A;  2QQB A;  1KC8 U;  1OPK A;  3EHR A;  4ZNX A;  1VQO T;  3EG2 A;  2DE0 X;  3KUF A;  2XID A;  4OMN A;  4XU2 A;  3UF4 A;  2DXT A;  1SPK A;  5L23 A;  3I55 Q;  3BY7 A;  2DZC A;  3MEV A;  2R57 A;  3MET A;  1N8R U;  1PRM C;  3L2R A;  4PJO F;  1QVF A;  2RNA A;  1VQO A;  2VVK A;  1E6H A;  3INZ A;  5CKD A;  2EPD A;  3G71 T;  4DA4 A;  2ZPF B;  3OMG A;  4R56 A;  1WHJ A;  3QWX X;  4M78 G;  1QVF S;  1JO8 A;  4ZGJ B;  4M7A A;  4C8Q C;  3VRY A;  3DKM A;  1OZ2 A;  5LJ3 g;  3JCM J;  5DM7 R;  2CH4 W;  3G71 A;  1VQ7 Q;  4TVR A;  1BU1 A;  4OML A;  5GMK l;  1Y96 A;  4C92 D;  4KGV B;  2BE9 B;  2D0N A;  3LW5 E;  4N4H A;  1K9M U;  4HVU A;  4M7D G;  1JQQ A;  1M8V A;  3FEO A;  4F7U A;  1X27 A;  2KY9 A;  1SHG A;  4ZTJ A;  2LNH B;  4AG1 C;  1WX6 A;  3VU3 C;  1ZHI A;  4OB2 B;  1H64 1;  4RTU A;  4M78 F;  2QQS A;  2SRC A;  1Q81 U;  4JZ3 A;  5GAN 7;  1Q7Y R;  1IRE B;  1Q82 C;  5GAO r;  4L5G A;  3EFS A;  4RTT A;  3CBP A;  1Y0M A;  3QJY A;  3J81 E;  3OSS C;  1UJ0 A;  1QVP A;  2DFU A;  1OOT A;  2F2X A;  2OTJ T;  4OMM A;  2CP0 A;  1AOJ A;  2K5L A;  1YHQ Q;  1S1N A;  3CCV Q;  3BFM A;  4EMK C;  2FHD A;  2DXB A;  1M30 A;  1UGS B;  4M7D F;  2YUQ A;  1PD0 A;  3LX7 A;  1K1Z A;  1DJ7 B;  2OTJ A;  5GAO p;  2CSQ A;  3OBW A;  1VQ4 Q;  1R77 A;  2HKQ B;  3VS1 A;  2LQ8 A;  4D8D A;  1TOV A;  3M59 A;  4A4K A;  1SSF A;  3TU4 K;  1X6B A;  4LN2 A;  2DTI A;  3VKI A;  3V7C A;  5LJ3 f;  2JZ2 A;  3FJP A;  4J9F A;  5D7U A;  5CVI A;  4F17 A;  3RKX A;  3I55 T;  2A7Y A;  1S72 Q;  3SDZ A;  2W10 A;  2FPD A;  5IXB A;  1M1K U;  2RF0 A;  2C0T A;  1WJR A;  4FYV B;  3RIR A;  5KH6 A;  3CPF A;  2CYZ B;  3I55 A;  1RAA B;  2OAU A;  2H3E B;  3VS0 A;  5FLX E;  3A8O B;  3ER0 A;  5FU6 C;  1KQ2 A;  5HY6 A;  2QTV A;  4OB1 B;  1VQ5 Q;  1VQ7 T;  1I4K 1;  1PNJ A;  5GAN 5;  2QK0 A;  5CK9 A;  2ECZ A;  2ATC B;  4C5G A;  1FXX A;  3RUX A;  2EYZ A;  5KYX B;  1WHM A;  4AFU C;  1SSH A;  4F7U E;  1KQ1 A;  4E7L A;  1QP2 A;  2D0Q B;  4AFQ C;  2K2V A;  5CQY A;  3D7S B;  1KD1 C;  3MEU A;  1VQ7 A;  4KBM B;  2LJ0 A;  2M9U A;  1QWF A;  4LUD A;  1PG5 B;  4X34 A;  1PHT A;  4PLL A;  4C0D B;  2CUB A;  1ABO A;  1UGR B;  3P8D A;  1VQ9 Q;  4DOV A;  3FDR A;  5GAN 2;  3CEY A;  1G2B A;  4PJO B;  3C12 A;  2C06 A;  4HT8 A;  4J9C A;  2MPX C;  1SHF A;  5KYW A;  3S6W A;  2NYS A;  3OB9 A;  2JVV A;  1MV0 B;  2LT1 A;  3V8J A;  1Y71 A;  3OYI A;  2BZX A;  2LJ3 A;  1YHQ T;  2YRV A;  3CCV T;  1Q82 U;  2MYS A;  2DL4 A;  2RJF A;  3OYE A;  4M7A C;  2HBW A;  1NPR A;  3G4S Q;  1RAC B;  2DEU A;  1BI0 A;  1M8M A;  2FRW A;  1FWZ A;  4C5I A;  3KBG A;  1U3O A;  2DIQ A;  5IXF A;  2KK4 A;  1VQ4 T;  1H3Z A;  3CBM A;  1AZE A;  1YHQ A;  3CPW S;  2QQA A;  3OSV A;  2VC8 A;  4AG2 C;  4E47 A;  3VYH B;  1LJO A;  4E7Z A;  1RLP C;  3JB9 H;  1ZLM A;  3HPW A;  1H8K A;  3MKD A;  2LQW A;  2VB6 A;  2LT4 A;  4Z02 A;  5ECA A;  2E65 A;  1D09 B;  1S72 T;  4M78 B;  3EFO A;  2E5Q A;  1OYX A;  2CGH A;  3AT1 B;  1D1B A;  4C0G A;  3OYK A;  1ZA1 B;  3JCM g;  3OY9 A;  8ATC B;  2MOX A;  1M3B A;  1K0S A;  3MHX A;  2KMT A;  3M57 A;  1S72 A;  2XU8 A;  4J9B A;  3TSZ A;  1NE8 A;  2AZV A;  2X4J A;  1WXB A;  1VQ5 T;  3GOX A;  1BK2 A;  4HCK A;  2OAW A;  2JS2 A;  1HK9 A;  3OYC A;  2QYZ A;  2HDA A;  3EFR A;  1YFN A;  5GAM g;  1VQ5 A;  4IUQ A;  1KC8 R;  3CD6 Q;  1W6X A;  2K5F A;  2QTX A;  2COZ A;  3OS2 A;  3JCM V;  4F14 A;  2DD4 A;  4KT0 E;  2E5K A;  3EG3 A;  5KYX A;  1VIE A;  1VQ9 T;  1N9S A;  1W2B A;  1Q7Y U;  1M2O A;  2KI7 A;  2DAQ A;  2LC4 A;  5CR2 A;  4J83 A;  2AKK A;  3M9Q A;  4V2S A;  2ESW A;  1W2B S;  4C0F A;  1VQ9 A;  1KSW A;  4RCB A;  5IT9 E;  1ZSZ B;  1PSF A;  4WTO B;  2DLP A;  4XU0 A;  5FWB A;  3G4S T;  4MDX A;  2RO0 A;  2YLB A;  2LCL A;  4FW2 A;  4PKC C;  2KRM A;  1T0J A;  2X51 A;  3JCM X;  2JT4 A;  1I5O B;  1RL2 A;  4UC4 A;  2DEQ A;  2FPF A;  1YP5 A;  4GLM A;  4DQ2 A;  3NHN A;  3G4S A;  1HSQ A;  2CS7 A;  1EFN A;  2WAC A;  1UEB A;  3A8H B;  2RK1 A;  3MP8 A;  3E1S A;  5GAN 6;  1JEG A;  1NEB A;  1IRX A;  2RQT A;  1UGP B;  4EDU A;  3LGF A;  2V1Q A;  2ZPE B;  8AT1 B;  2D9T A;  1GBQ A;  1UGV A;  1OV3 A;  1M1G A;  2QEX Q;  2QAS A;  4JJD A;  2F5K A;  4QKU A;  5KYU A;  5GAM f;  2G3R A;  4PJO D;  5HK3 A;  1I5L A;  4O6J A;  1Y07 A;  2KYB A;  3VRZ A;  2L5Q A;  2H3J A;  4HCZ A;  4M75 E;  2RJC A;  2EYY A;  2EFI A;  1KC8 C;  5J3B A;  4CI0 C;  1KQS A;  3FIF A;  2F1L A;  3CCJ Q;  3OYA A;  5J26 A;  3ZFJ A;  2R5A A;  2CZ1 B;  4D8K A;  2JOY A;  2MMP A;  3OYH A;  3CD6 T;  3S3O A;  4M7D A;  1N8R C;  2AT1 B;  2L3Q A;  1QCN A;  3R6O A;  1NYF A;  3THK A;  3CME Q;  3X25 B;  1M4Z A;  2EQJ A;  4JRP A;  1W2B P;  2PVD B;  2COW A;  1QKX A;  3GNF B;  3H0H A;  3CD6 A;  2HKN A;  4JJC A;  2RI2 A;  3OS5 A;  4M78 D;  2QXF A;  3FJ5 A;  3L2Z A;  4C8Q D;  3CC2 Q;  1XTD A;  1U8R A;  3JAM E;  4M4Z A;  2DL8 A;  4ANJ A;  3RMQ A;  2XDD A;  4NS5 A;  5LJ3 h;  4RTY A;  2J6O A;  2FEI A;  4EMH A;  2ZPG B;  1K9M C;  4LDY A;  1VQ8 A;  4J6Y A;  2RI3 A;  1BYM A;  1MGQ A;  1OPL A;  3PT9 A;  2CSI A;  1N5Z A;  4M75 G;  1JBM A;  3LGL A;  2CH4 A;  2YDL A;  1NYG A;  2EJG A;  1B3Q A;  2QQ9 A;  2FVU A;  2JXB A;  3JSC A;  2MCN A;  4MML A;  1SRL A;  1CSK A;  2KEA A;  5GJW B;  1T0H A;  1Q81 C;  4D6W A;  1K73 R;  2JS0 A;  3EG9 A;  1D1C A;  4JRQ A;  4FCY A;  2M16 A;  2JM9 A;  5DLQ E;  3I5S A;  3PGG A;  5CKE A;  5J39 A;  2QEX T;  1AD5 A;  1M3A A;  2KT8 A;  1JRI A;  3V8K A;  4A54 A;  2DTO A;  1GFD A;  2DPP B;  4C0D C;  4M75 F;  3I5R A;  2QEX A;  5GAO m;  4LNP A;  4PJO C;  5GAN 8;  1JJ2 S;  4OGC A;  1JB0 E;  3A8M B;  1G3W A;  2CZ0 B;  1KQS P;  2HEQ A;  3M0R A;  4BE1 A;  4ESR A;  4M7D E;  5C6S A;  3CCJ T;  2JTF A;  3ZEH A;  4FSX A;  2YHT A;  4J9H A;  2RH2 A;  1TH7 A;  4A4G A;  4ZGD B;  1WDX A;  1V76 A;  5IHK A;  5LJ3 j;  3MEA A;  3CME T;  2HL3 A;  5I2M A;  3SHW A;  1LNX A;  1M1K C;  2XHC A;  5FWC A;  1IHW A;  3CCJ A;  4QVZ A;  3X24 B;  2O9V A;  2C0I A;  5CKH A;  1BIB A;  3JB9 G;  4E7S A;  4M77 A;  3FRN A;  2E4H A;  3CC2 T;  2GQI A;  3CME A;  2A08 A;  2E3I A;  2RQW A;  4X9D A;  2MWP A;  2DNU A;  3HL8 A;  2RN8 A;  3QBY A;  4Z89 A;  1A0N B;  3QKJ A;  3CCU Q;  4QQD A;  1PC0 A;  2M1H A;  5GAN f;  1X2Q A;  2YXY A;  2M51 A;  4M78 C;  4OMO A;  2LDM A;  3CC2 A;  1ZUK A;  2DKG A;  2ED1 A;  4N4I A;  3J80 E;  1ACM B;  3EH1 A;  3DLM A;  4ZN3 A;  2OX7 A;  2K2M A;  5LJ5 e;  2M0Y A;  1K76 A;  4BB7 A;  4FW1 A;  3M5A A;  4OGE A;  3Q1J A;  2HL5 C;  2DM1 A;  1ZBX A;  2E3H A;  4J6X A;  3HHT B;  4M7D C;  4JRK A;  4FSS A;  2K6D A;  5KYW B;  3M55 A;  1JU5 C;  2FYK A;  3M0Q A;  1W4S A;  1I1J A;  3O8V A;  2J7I A;  3A8G B;  4XTW A;  1Z9Q A;  1QLY A;  4JLG A;  1UHF A;  5A0G A;  1X43 A;  2GNC A;  4M7A D;  1C6V X;  2PNI A;  5KCO A;  2X35 A;  1G83 A;  3JB9 I;  2L3R A;  2RQR A;  4LD6 A;  5L8R E;  2Y90 A;  5GMK h;  4OVA A;  1JXM A;  4FU6 A;  3QWY A;  4JLI A;  3VYG A;  1QQJ A;  3OMC A;  1YJ9 Q;  3URG A;  4J5Y A;  2NLU A;  3DB4 A;  1SG5 A;  1TG0 A;  2G6F X;  5A2Q E;  1AEY A;  3E9F A;  4J8O A;  3EFO B;  1ZSZ C;  4J9I A;  3CC4 Q;  2KNB B;  4RTZ A;  2COY A;  4ORZ A;  1BCM A;  2E6Z A;  1UB4 A;  2V8J A;  4M77 E;  4OMP A;  2V8K A;  2KVQ G;  2PU9 B;  3LH5 A;  3CMA Q;  1PKT A;  1WPY A;  2D1X A;  1U1T A;  4WF2 A;  1Y7X A;  1QVF P;  4Z88 A;  3HSB A;  1P92 A;  3RMS A;  2VKN A;  5LL6 S;  3CXC A;  4A63 B;  4BY6 B;  2L3P A;  4KGZ B;  1B7T A;  1R8O B;  1X69 A;  2WSE E;  1HYO A;  3I9Q A;  3CCU T;  2GBQ A;  5FU7 B;  2X4Y A;  4M75 B;  1K8A R;  2EIF A;  3CXC S;  3HRT A;  4BE0 A;  2RI5 A;  3PE0 A;  2GGR A;  4XTX A;  3CCU A;  2RPN A;  4GLK A;  2RM4 A;  3E9G A;  2EAY A;  5GAM h;  2DXC A;  5IHI A;  2PVO B;  1D1A A;  1D0Y A;  1E6G A;  2KXC A;  3L1A A;  5GMK j;  2XKO C;  2CKK A;  1Q7Y C;  4QW2 A;  1K73 U;  2K5I A;  4PFO A;  3OS0 A;  4KGX B;  1QCO A;  1UGQ B;  2EQU A;  2X3W D;  4XU1 A;  3S3N A;  3HRU A;  4KUL A;  4M77 G;  1FMK A;  2SEM A;  4MZT A;  3BE3 A;  4PNO A;  2DL3 A;  3M4Y A;  4GBQ A;  4C92 G;  2MWO A;  1LOJ A;  4LUE A;  3SWN A;  1FX7 A;  4FYY B;  3RNJ A;  1PCX A;  3UPU A;  3QZ5 B;  4ZN1 A;  3QO3 A;  5LJ5 d;  2ZPB B;  4E7K A;  3CPW A;  3H41 A;  5GAN 3;  3LWI A;  4NL3 A;  1G3Y A;  1YJ9 T;  1YCS B;  2RHU A;  2F5T X;  2XK0 A;  3H8Z A;  4CC3 A;  1NJI R;  1GCP A;  4BUG A;  2ZPH B;  4XQ3 A;  2E1H A;  2RHZ A;  3CCV A;  1KHI A;  3V7R A;  3CC4 T;  4JS5 A;  3CCE Q;  2DF6 A;  4NOY A;  2XD0 A;  4M77 F;  1VYT A;  4CC2 A;  3TCJ A;  1YJ9 A;  4QQG A;  3R6N A;  5KYU B;  3UA7 A;  2O31 A;  5D6Y A;  4C92 F;  2P0Q A;  1VQ4 A;  3CMA T;  2HSE B;  2I0N A;  3CC4 A;  2VXF A;  1YI2 Q;  1TXQ A;  5CKB A;  5AYF A;  2FZK B;  3CXC P;  3UAT A;  1UE9 A;  1VA7 A;  1I0C A;  5GAM j;  1Q86 R;  5GAN 4;  3G6E Q;  1I07 A;  2E41 A;  3CCR Q;  2EQI A;  1FMW A;  3CMA A;  2X4X A;  2Z0W A;  2LX7 A;  2O01 E;  4LDU A;  2LP5 A;  2HAX A;  4M7D B;  2RA2 A;  2ROL A;  2K3X A;  2DJZ A;  1VQN Q;  4A4E A;  2L3S A;  4EIK A;  4FT2 A;  2DL5 A;  5KYN A;  5HCK A;  4M75 A;  1OQK A;  3PMT A;  2GQV A;  1W70 A;  2EQK A;  3EG1 A;  4QVD A;  1HJD A;  2FPE A;  2F2W A;  4JDS A;  1J3T A;  4E2F B;  2NUP B;  1VYU A;  4A4H A;  1VOM A;  2BUD A;  1GBR A;  4X9C A;  1X2K A;  3I56 Q;  3A8L B;  1LPL A;  2XG8 D;  2ZZD A;  1O9S A;  2F69 A;  1R0C B;  2CZ6 B;  1BCO A;  2IG0 A;  4JJB A;  2PUO B;  3H0I A;  2ED0 A;  3LWH A;  2BE7 D;  2D8J A;  2X9H A;  2IIM A;  4DBQ A;  1RLQ C;  3CPW P;  1WXT A;  4MZP A;  4QT7 A;  4QVC A;  4ATO A;  2VAS A;  1H92 A;  1GXI E;  1WYX A;  3HKS A;  2LJ1 A;  3OQ5 A;  3JCM f;  1YIJ Q;  2DK3 A;  4N0A A;  4PJJ A;  4DEY A;  2DYI A;  2QDL A;  3HTR A;  2HQE A;  3EG9 B;  1WFW A;  3NTK A;  3CBO A;  1OZ3 A;  2XDB A;  3OW2 S;  2NWM A;  3CCE T;  2AHJ B;  2D8H A;  2E12 A;  2FG0 A;  2JMA A;  1YBY A;  2AIR B;  1MMA A;  5GAN h;  4OMF B;  1N27 A;  2LCC A;  1NG2 A;  4HKE A;  4A4F A;  1YI2 T;  1NLP C;  3SEM A;  4BD3 A;  2W0Z A;  4X1V A;  2QGF B;  1B07 A;  1MMG A;  1GRI A;  3G6E T;  5GAO l;  3CCR T;  1WIE A;  2XMF A;  1QVG A;  2MK5 A;  1QCF A;  2DO3 A;  3ZL7 C;  4AT1 B;  4XU3 A;  1YI2 A;  1K8A U;  1K9A A;  3CCL Q;  1VYV A;  1B34 B;  5KYY B;  4ZGE B;  3M0T A;  4EMG A;  1QVG S;  1XNI A;  3CCR A;  2EJ9 A;  1VQN T;  2KGT A;  4R55 A;  2E64 A;  1OI1 A;  2K3Y A;  1M90 R;  2RB6 A;  3LH0 A;  2EKO A;  4HVV A;  2YUO A;  3NFC A;  4E7H A;  4M77 B;  2QGG A;  3QYH B;  2RHX A;  4J7F A;  1NLO C;  1PD1 A;  4ELY C;  1RI0 A;  3EGX B;  3GP8 A;  3WXM B;  4C92 B;  1WHG A;  1VQN A;  4QQ6 A;  4BDY A;  5AT1 B;  5GAO n;  2EBP A;  2EQM A;  1VQK Q;  4F04 B;  1YNZ A;  2J6K A;  3I56 T;  1Q95 G;  5C0M A;  2DRK A;  4HCC A;  1G3T A;  2ABL A;  3VS4 A;  1TUD A;  4RG2 A;  2M02 A;  2KRO A;  4ZTF A;  1AT1 B;  5CAI A;  2DET A;  2NUP A;  3OS1 A;  3F70 A;  3I56 A;  2LQK A;  2K3B A;  3LLR A;  5CO7 A;  5GAN j;  5A0D A;  3M54 A;  4LDX A;  1IXD A;  1EZZ B;  5CCA A;  4HXJ A;  2WSC E;  3OYD A;  4XTU A;  2BZY A;  2EJF A;  4KH0 B;  4BY6 C;  1YIJ T;  1WHH A;  1YWP A;  2DMO A;  1NJI U;  4DOW A;  4M7D D;  1OX8 A;  2KRN A;  1TUG B;  5GMK i;  1YIT Q;  5FU7 C;  4M75 C;  4BE2 A;  3X20 B;  3CCM Q;  5GJV B;  1NPP A;  1RAB B;  3P8B B;  1K0X A;  2YLC A;  2NUT B;  3SFM A;  4DBR A;  2CZ7 B;  2CT3 A;  2K57 A;  3RER A;  4KRT A;  1MHN A;  4IKF A;  3L42 A;  2YUN A;  2FL7 A;  4LE9 A;  2HNI A;  3EAE A;  1BI1 A;  4OB3 B;  1Q86 U;  4PL6 A;  1QVG P;  1FYN A;  2EYQ A;  1JJ2 A;  1MMN A;  2YRD A;  3JCM Q;  3M53 A;  3EGU A;  1RAI B;  3RDV A;  3HRS A;  3PMI A;  2MAM A;  5M9O A;  3M0U A;  2PUK B;  4XAX B;  1W1F A;  3CCL T;  1C1A A;  1Z9Z A;  2KT1 A;  5GAN e;  1I8F A;  4C5H A;  3G1J A;  3NTH A;  2FZC B;  3V7S A;  4XTV A;  4KH1 B;  1AWJ A;  2DIL A;  1EIF A;  2YSQ A;  2GFU A;  1YJW Q;  2O4X A;  2DL7 A;  3CCQ Q;  3NTI A;  2K4Y A;  2CDT A;  3CCL A;  3I35 A;  2A37 A;  4Z8A A;  2ENM A;  2B8A A;  1B34 A;  5KYY A;  1SEM A;  2ZAE A;  4RKU E;  3L2V A;  2DVJ A;  2P0K A;  5KE2 A;  2CP2 A;  3OYF A;  1BBZ A;  3TRE A;  1VQK T;  3P8H A;  3AHU A;  3EG0 A;  3VUZ A;  3TQ7 P;  2OI3 A;  1OU9 A;  1IGU A;  4FIB A;  4KUD K;  4O5V A;  4EPC A;  3QXE B;  3QDR B;  3KXT A;  1WJS A;  3EGX A;  3H9N A; 
#chains in the Genus database with same CATH homology
 2KSS A;  2X4Y A;  3GOX A;  4M75 B;  1M5Q 1;  4C92 A;  1ZQ1 A;  2EIF A;  3CXC S;  1VQK A;  3HRT A;  3QZ9 B;  1HK9 A;  3BDL A;  2JNG A;  3VV0 A;  4BE0 A;  1X01 A;  2RI5 A;  1WQW A;  3QHS A;  4B9W A;  3OYC A;  5A0L A;  5LJ5 g;  1KQS S;  2RHY A;  4XTX A;  3N5B B;  3EFR A;  3CCU A;  3CCL A;  5HKC A;  5GAM g;  4OF1 A;  5LJ5 h;  1VQ5 A;  3MCA B;  5FRM A;  4IUQ A;  2K5F A;  2P0P A;  2QTX A;  4GLK A;  2RM4 A;  4YTL A;  3GIB A;  2JTM A;  3E9G A;  2EAY A;  5GAM h;  3C4S A;  2DXC A;  2HBP A;  3OS2 A;  3JCM V;  2PVO B;  3VUB A;  4HT9 A;  2DD4 A;  4M7A B;  1HXD A;  3L1A A;  3MEW A;  4KT0 E;  1YIT T;  2QI2 A;  3JCM d;  1K73 C;  5GMK j;  2XKO C;  2CKK A;  2QDY B;  1VIE A;  1Q7Y C;  4QW2 A;  1VQ9 T;  1N9S A;  4BI3 A;  1W2B A;  5HK0 A;  2VV5 A;  2K5I A;  4C8Q G;  3CCM T;  1K73 U;  3ME9 A;  5KCH A;  4PJO E;  1VQ8 T;  3JB9 F;  1Q7Y U;  1Y96 B;  3CPW S;  5IN1 A;  2DAQ A;  2LC4 A;  1AHJ B;  2LX9 A;  3OS0 A;  5I21 A;  5CR2 A;  2XI9 A;  1UGQ B;  2EQU A;  4XU1 A;  3OYY A;  4C5E A;  4J83 A;  4HA8 A;  4M77 D;  4OP0 A;  2VUB A;  3S3N A;  3HRU A;  3M9Q A;  3SWN B;  3TEE A;  4V2S A;  4KUL A;  2DIG A;  1BKB A;  2GF7 A;  4M77 G;  4XK8 E;  2QQR A;  3WVE B;  3ZBD A;  2R5M A;  4JUV A;  1YIT A;  3MP1 A;  1W2B S;  4MZT A;  5DY9 A;  3SD4 A;  1YIJ A;  4C0F A;  4PNO A;  2EWN A;  2HD0 A;  3M4Y A;  4C92 G;  5LJ3 e;  4GY5 A;  2MWO A;  1LOJ A;  4RCB A;  4F7U B;  3CCM A;  5IT9 E;  1PSF A;  1FX7 A;  3SWN A;  4XU0 A;  2E6N A;  3G4S T;  4MDX A;  2RO0 A;  3UPU A;  2YLB A;  4CRI A;  3PNW C;  5KE3 A;  3PTA A;  2LCL A;  3QZ5 B;  2Y4Y A;  4PKC C;  4ZN1 A;  4FL6 A;  2E10 A;  3JCM X;  3QO3 A;  5LJ5 d;  2ZPB B;  2XDP A;  4E7K A;  1RL2 A;  3CPW A;  4UC4 A;  4OB0 B;  5GAN 3;  2DEQ A;  5GAM d;  3LWI A;  2JUF A;  4DQ2 A;  4NL3 A;  1G3Y A;  1YJ9 T;  3OYL A;  1X6O A;  2RHU A;  2F5T X;  2PQW A;  2XK0 A;  2CS7 A;  3E19 A;  3H8Z A;  2M0O A;  4Q5W A;  3G4S A;  2LTO A;  4C8Q F;  4BUG A;  2WAC A;  2ZPH B;  1UEB A;  3MP6 A;  5GAN g;  3A8H B;  2JN0 A;  4XQ3 A;  2E1H A;  2RHZ A;  2Y4X A;  3CCV A;  1KHI A;  1M90 C;  3CCS T;  3QII A;  3V7R A;  2RK1 A;  3MP8 A;  3CC4 T;  4JS5 A;  3GNG A;  3E1S A;  5GAN 6;  3OYB A;  1M90 U;  1YJW T;  1O75 A;  2XD0 A;  4NOY A;  4M77 F;  1PSE A;  3HFN A;  1UGP B;  3TCJ A;  4EDU A;  3LGF A;  1YJ9 A;  5I2S A;  2ZPE B;  3CCQ T;  4M78 E;  4QQG A;  1VQL T;  4JJN K;  3L2U A;  2D9T A;  4C8Q E;  4C92 F;  5D6Y A;  2P0Q A;  3QPH A;  3JCM c;  4N0A C;  3A5Z B;  1VQ4 A;  2RK2 A;  1M1G A;  5LJ5 f;  3UT1 A;  3CMA T;  3CCS A;  2F5K A;  5GAM f;  3CC4 A;  3UDC A;  2VXF A;  2G3R A;  1WJQ A;  1VQP T;  4LD9 K;  4MDW A;  4PJO D;  4RMO A;  5CKB A;  5AYF A;  1YJW A;  5LJ5 j;  4IUP A;  2D6F A;  4Y28 E;  4PJO G;  1M1F A;  1U1S A;  2ZCF B;  5GAM j;  4J7I A;  4FM4 B;  3CCQ A;  2BIV A;  1D3B B;  4IUR A;  4C92 E;  5GAN 4;  1VQL A;  5HK3 A;  5CKF A;  2DXU A;  2E41 A;  1I5L A;  3JCM h;  4O6J A;  2RJD A;  1Y07 A;  2ZGW A;  2L5Q A;  3CMA A;  2H3J A;  2VXE A;  5IAY A;  4HCZ A;  4XTY A;  3BW1 A;  2X4X A;  4Y91 A;  4M75 E;  3UWN A;  2O01 E;  1VQP A;  4LDU A;  2RJC A;  4IUV A;  2EFI A;  3JRZ A;  1KC8 C;  5J3B A;  2QQB A;  3FB9 A;  4CI0 C;  1KC8 U;  1KQS A;  4IUU A;  3FIF A;  2RA2 A;  2WSF E;  5GAN d;  3OYG A;  2HAX A;  4M7D B;  2KQW A;  3OYA A;  2P4T A;  1VQO T;  3S3M A;  2K3X A;  5J26 A;  3KUF A;  2XID A;  2R5A A;  4XU2 A;  2DJZ A;  3HP9 A;  3ZFJ A;  3JCM b;  2CZ1 B;  4C0Z A;  4A4E A;  4FT2 A;  2JOY A;  2MMP A;  3OYH A;  4L6V 5;  2DXT A;  3S3O A;  3CD6 T;  4M7D A;  3RKW A;  1N8R C;  4M75 A;  3BY7 A;  4MMK A;  1NZ9 A;  3R6O A;  3PMT A;  2DZC A;  2GQV A;  3MEV A;  2R57 A;  3MET A;  2EQK A;  1N8R U;  4M7A E;  3L2R A;  4QVD A;  3X25 B;  1M4Z A;  2EQJ A;  4PJO F;  1QVF A;  3C95 A;  4JRP A;  4JDS A;  2PVD B;  1VQO A;  3INZ A;  3GNF B;  5CKD A;  3G71 T;  4A4H A;  4DA4 A;  2BUD A;  2ZPF B;  3CD6 A;  4X9C A;  2RI2 A;  3OS5 A;  4M78 D;  2QXF A;  3L2W A;  3OMG A;  3L2Z A;  4C8Q D;  4R56 A;  3A8L B;  2XG8 D;  1XTD A;  2ZZD A;  4M78 G;  3OA6 A;  1O9S A;  3M56 A;  5FRO A;  1QVF S;  2F69 A;  4ZGJ B;  1U8R A;  4M7A A;  1YJN T;  1X75 C;  3JAM E;  4C8Q C;  3VJP A;  2CZ6 B;  5M9O A;  4L59 A;  3DKM A;  3OYN A;  1VQM T;  2IG0 A;  1OZ2 A;  2PUO B;  3MO8 A;  5LJ3 g;  3JCM J;  5DM7 R;  3RMQ A;  2XDD A;  3G71 A;  5GAO q;  4NS5 A;  4TVR A;  5LJ3 h;  2VGN A;  4PLI A;  3DLL A;  1QP3 A;  5GMK l;  1Y96 A;  5D6W A;  3LWH A;  4M77 C;  4C92 D;  3HFO A;  1V29 B;  5GMK m;  5DLO A;  1BI3 A;  4EMH A;  2ZPG B;  3X26 B;  4MZP A;  4C92 C;  4QVC A;  1K9M C;  1YJN A;  4ATO A;  4LDY A;  1VQ8 A;  3LW5 E;  4N4H A;  1VQM A;  4J6Y A;  1K9M U;  2GFA A;  2RI3 A;  2XIC A;  3T9N A;  4EMK A;  3PIO A;  1BIA A;  4BDZ A;  1BYM A;  1MGQ A;  4B9X A;  1GXI E;  3X28 B;  3PT9 A;  4M7D G;  1VQ6 T;  4BAC A;  3HKS A;  1JBM A;  4M75 G;  3LGL A;  3FEO A;  3OQ5 A;  3JCM f;  4F7U A;  1M8V A;  2DK3 A;  2KY9 A;  4LDW A;  4N0A A;  3JCM W;  2EJG A;  2QQ9 A;  2FVU A;  4ZTJ A;  2HQE A;  3JSC A;  4MML A;  3JCM P;  3NTK A;  3FC3 A;  3VU3 C;  1ZHI A;  2V8I A;  4OB2 B;  1H64 1;  3CBO A;  1OZ3 A;  1Q81 C;  2XDB A;  4D6W A;  4M78 F;  3WVD B;  3OW2 S;  3CCE T;  2AHJ B;  2QQS A;  2E12 A;  4XTZ A;  1Q81 U;  5GAN 7;  4JRQ A;  1YBY A;  2M16 A;  1VQ6 A;  1IRE B;  1Q82 C;  5GAO r;  4L5G A;  3EFS A;  5DLQ E;  5GAN h;  5FRN A;  3PGG A;  3CBP A;  4OMF B;  2MI6 A;  2VYT A;  3QJY A;  5CKE A;  1N27 A;  3J81 E;  4M7A G;  5J39 A;  2QEX T;  3OSS C;  1QVP A;  1XQH A;  1XOV A;  2OTJ T;  3QUI A;  1JRI A;  2LCC A;  3V8K A;  4A54 A;  4HKE A;  5LJ3 d;  4A4F A;  1YI2 T;  2K5L A;  4BD3 A;  3BFM A;  2DTO A;  2L8D A;  4EMK C;  2FHD A;  2DXB A;  2DPP B;  3G7Z A;  2QA4 T;  3J7A F;  3G6E T;  1UGS B;  5GMK e;  4C0D C;  4M7D F;  5GAO l;  3CCR T;  4M75 F;  4N4G A;  3LX7 A;  1QVG A;  2QEX A;  1DJ7 B;  2OTJ A;  5GAO m;  2DO3 A;  5GAO p;  4PJO C;  5GAN 8;  1K8A C;  3OBW A;  1JJ2 S;  3M4G A;  4OGC A;  1JB0 E;  4XU3 A;  1YI2 A;  1G5V A;  3A8M B;  2KDS A;  1K8A U;  1G3W A;  4F7U G;  3OYJ A;  2LQ8 A;  2CZ0 B;  3M59 A;  4A4K A;  2DTH A;  4BE1 A;  1SSF A;  1B34 B;  2QA4 A;  4ZGE B;  4M7D E;  4EMG A;  5C6S A;  3CCJ T;  1D3B A;  3TU4 K;  1XNI A;  1QVG S;  3CCR A;  2JTF A;  2DTI A;  3ZEH A;  3VKI A;  2FB7 A;  2HQX A;  4FSX A;  5LJ3 f;  2EJ9 A;  2YHT A;  3V7C A;  4C8Q B;  1VQN T;  2JZ2 A;  1QW1 A;  4R55 A;  2E64 A;  1OI1 A;  2K3Y A;  2RH2 A;  3FJP A;  1TH7 A;  2RB6 A;  3QG1 A;  4M7A F;  3LH0 A;  2DD5 A;  4A4G A;  4JRI A;  5CVI A;  4ZGD B;  2EKO A;  5CQX A;  3RKX A;  3I55 T;  2A7Y A;  4BI8 B;  5LJ3 j;  5D6X A;  3NFC A;  3MEA A;  3CME T;  5I2M A;  3SDZ A;  4E7J A;  2ZPI B;  3V8L A;  1LNX A;  2LRQ A;  4E7H A;  4M77 B;  4J7F A;  2VGM A;  2RHX A;  2XHC A;  3QYH B;  4ELY C;  1M1K C;  1RI0 A;  3BDU A;  3CCJ A;  4QVZ A;  3GP8 A;  3CC7 T;  1M1K U;  3WXM B;  3X24 B;  3JCM e;  5CKH A;  1BIB A;  4C92 B;  1VQN A;  4QQ6 A;  4BDY A;  1WJR A;  3JB9 G;  4M77 A;  5GAO n;  3FRN A;  3RIR A;  2EQM A;  5KH6 A;  3CPF A;  2CYZ B;  3I55 A;  2E70 A;  2OAU A;  2OTL T;  3I56 T;  3CC2 T;  5C0M A;  3CME A;  5FLX E;  1YCY A;  1KG1 A;  3A8O B;  4F7U F;  4X9D A;  3ER0 A;  2MWP A;  5FU6 C;  4HCC A;  1G3T A;  3HL8 A;  5HY6 A;  1KQ2 A;  3M58 A;  3QBY A;  3QKJ A;  3CC7 A;  4HCB A;  4QQD A;  2M1H A;  4OB1 B;  4RG2 A;  5GAN f;  1VQ7 T;  4ZTF A;  1I4K 1;  5CAI A;  5GAN 5;  4M78 C;  3QJ6 A;  3OS1 A;  4BI4 A;  5CK9 A;  2OTL A;  2LDM A;  3F70 A;  3I56 A;  3LYI A;  2LQK A;  3LLR A;  5CO7 A;  4C5G A;  1FXX A;  2DKG A;  5GAN j;  3RUX A;  4N4I A;  4E7I A;  3J80 E;  4F7U E;  5A0D A;  3OYM A;  3QSU A;  3ASK A;  3DLM A;  3M54 A;  4ZN3 A;  4LDX A;  1WGS A;  2GCX A;  1KQ1 A;  5LJ5 e;  4E7L A;  1QP2 A;  2D0Q B;  2K2V A;  4FT4 A;  5CCA A;  2WSC E;  5CQY A;  3OYD A;  1KD1 C;  3MEU A;  4XTU A;  1WNL A;  4BB7 A;  5GAM e;  2EJF A;  1NJI C;  1VQ7 A;  3GLX A;  3M5A A;  4OGE A;  3Q1J A;  4JS4 A;  4KBM B;  4BY6 C;  3JB9 J;  1YIJ T;  1KD1 U;  4RCC A;  2M9U A;  1NJI U;  4DOW A;  4IUT A;  2IVW A;  4M7D D;  4NL2 A;  4EMK B;  1ZBX A;  4J6X A;  4M75 D;  4X34 A;  3HHT B;  3OW2 A;  5GMK i;  4ME7 A;  4PLL A;  4C0D B;  4M7D C;  4JRK A;  5FU7 C;  1UGR B;  4M75 C;  3M55 A;  3P8D A;  3X20 B;  4BE2 A;  3SB2 A;  4DOV A;  2FYK A;  3FDR A;  5GAN 2;  3CEY A;  4PJO B;  2X4W A;  3C12 A;  4KUI A;  2C06 A;  4HT8 A;  1N9R A;  1W4S A;  2A3L A;  1NPP A;  1BI2 A;  3O8V A;  3P8B B;  3A8G B;  4VUB A;  5CIU A;  2YLC A;  3S6W A;  3SFM A;  5EG2 A;  2CZ7 B;  1I81 A;  4XTW A;  1G3S A;  3OB9 A;  2JVV A;  1VQ9 A;  4PJO A;  4A53 A;  2LT1 A;  4JLG A;  2K57 A;  2RD1 A;  3V8J A;  3RER A;  1Y71 A;  3H6Z A;  3OYI A;  1MHN A;  5A0G A;  2DVE A;  4M7A D;  1YHQ T;  2YRV A;  3CCV T;  1Q82 U;  4IKF A;  3L42 A;  2DZ9 A;  2RJF A;  3OYE A;  1KHC A;  1Q86 C;  2FL7 A;  5KCO A;  2HNI A;  4M7A C;  1NPR A;  2X35 A;  3EAE A;  1BI1 A;  3GF5 A;  4OB3 B;  1Q86 U;  1BI0 A;  3JB9 I;  4PL6 A;  3CC2 A;  2L3R A;  2PVG B;  4LD6 A;  3DB3 A;  5L8R E;  2Y90 A;  2BKD N;  2EYQ A;  4OVA A;  2R58 A;  5GMK h;  3CCE A;  4FU6 A;  1JJ2 A;  1FWZ A;  3PFS A;  4JLI A;  4C5I A;  3JCM Q;  3KBG A;  3VYG A;  3M53 A;  3L2Q A;  2DIQ A;  1VQ4 T;  2KK4 A;  2RJE A;  1H3Z A;  3CBM A;  3HRS A;  3PMI A;  1YHQ A;  1N6A A;  2MAM A;  3C94 A;  2QQA A;  1VUB A;  2PUK B;  3OMC A;  4II1 A;  4J5Y A;  4XAX B;  3URG A;  3PIP A;  3RKY A;  2NLU A;  3CCL T;  3SWN C;  3OSV A;  3DB4 A;  2VC8 A;  4E47 A;  3VYH B;  1LJO A;  1WQ7 A;  2O4X B;  1I8F A;  2LNV A;  4C5H A;  5GAN e;  5A2Q E;  3OBY A;  3JB9 H;  3E9F A;  3NTH A;  3V7S A;  4XTV A;  4J8O A;  3HPW A;  5FU6 B;  4LDV A;  2L89 A;  1IZ6 A;  1EIF A;  2GFU A;  2LT4 A;  3G6E A;  4Z02 A;  2LVM A;  2O4X A;  2E65 A;  1S72 T;  2MF2 A;  2K4Y A;  2E5Q A;  3NTI A;  3FLG A;  1OYX A;  1UB4 A;  2E6Z A;  2CGH A;  2V8J A;  4M78 B;  4MZM A;  4M77 E;  2B8A A;  1B34 A;  2KVQ G;  2V8K A;  4RG8 A;  4RKU E;  4C0G A;  2PU9 B;  3OYK A;  3L2V A;  3JCM g;  1VIF A;  3RES A;  3OY9 A;  2KAF A;  1WPY A;  4ELZ C;  1U1T A;  4M78 A;  4WF2 A;  1Y7X A;  4C8Q A;  2P0K A;  5KE2 A;  3OYF A;  3GPL A;  3TRE A;  3MHX A;  1VQK T;  3HSB A;  3P8H A;  1P92 A;  2KMT A;  3M57 A;  3QYG B;  3AHU A;  3RMS A;  3VUZ A;  2RHI A;  5LL6 S;  3CXC A;  2XU8 A;  1S72 A;  4BY6 B;  3JB9 D;  1R8O B;  4FIB A;  4KUD K;  4O5V A;  4EPC A;  3QXE B;  2WSE E;  3QDR B;  2I2L A;  3KXT A;  1NE8 A;  3CCU T;  1WJS A;  2X4J A;  1M9S A;  4J6W A;  1VQ5 T;  4P5N A;  5FU7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...