3M4GA

H57a hfq from pseudomonas aeruginosa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
68
structure length
68
Chain Sequence
KGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKAAISTVVPSRPVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of mutant forms of Hfq from Pseudomonas aeruginosa reveal the importance of the conserved His57 for the protein hexamer organization.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
molecule keywords Protein hfq
total genus 15
structure length 68
sequence length 68
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3m4gA00
4JRKA 4EMKB 4PJOG 2QTXA 4N0AC 3QSUA 3L2ZA 1I5LA 4QVDA 4M7DA 4NL2A 2K57A 4M75D 4C92C 2DTOA 1BIBA 4J5YA 1I81A 4A54A 4QVCA 1TH7A 5GAMd 3RKXA 5GAMg 5GAN2 1M8VA 4M77F 5LJ5f 4M78F 3JB9D 2VXEA 2YHTA 5GAMf 5GMKh 4XU3A 4Y91A 3V7SA 3JCMg 3BDUA 5GAN6 4M75B 2RM4A 3V8LA 4M75E 4C8QB 2EAYA 4C92F 5LJ3e 4DQ2A 3INZA 4M77B 4M77E 5LJ3g 5GAOq 2I2LA 5LJ3d 4C92D 5DY9A 3SB2A 1H641 3SWNB 1LNXA 4C92G 5GANd 4XTZA 3JCMb 4M7AB 5GAOp 4M7AE 4C8QD 3EFRA 4EMGA 4JUVA 4HT8A 1D3BB 4XU2A 1JRIA 4PJOC 5GANf 2RB6A 4A53A 2E65A 5GANh 5GAOl 4X9CA 3JCMf 1HXDA 2E41A 1KQ1A 2DKGA 4EMHA 4M75F 4PNOA 1KQ2A 3HSBA 4PJOA 5GANe 5GAMj 5LJ3h 1D3BA 4M7AA 3L1AA 4M75G 3RIRA 3SWNA 1LJOA 1N9RA 3GIBA 5GAN5 5GAOr 4M7AF 1HK9A 4XU1A 2CGHA 3JCMe 2E10A 5GAN8 4PJOD 4XU0A 4M7AC 4F7UG 1U1SA 4PJOF 3BW1A 5I21A 4XTXA 3RERA 4M75A 3RUXA 4M77C 3BFMA 4XTVA 3RKWA 3V7RA 3VU3C 4EMKA 4M7AG 1I8FA 4M7DC 5GAMe 3BY7A 4C8QC 3JB9H 2HNIA 4M7DF 3JB9I 4J6WA 2DTHA 5LJ5e 4M75C 5LJ3f 4MMLA 2Y90A 5GMKm 4M78E 4M78B 2YLBA 1WQ7A 2DVEA 4M77G 1I4K1 4N0AA 4M78G 3JCMJ 4HT9A 1LOJA 3PGGA 2VXFA 1U1TA 1WQWA 2EJFA 4C92A 2E64A 4C8QF 3HFOA 5GAN4 3QHSA 3QO3A 3QUIA 4RCCA 4C8QG 2RD1A 3FIFA 4XQ3A 2FB7A 5GAN3 4X9DA 4M7DE 2ZGWA 4F7UE 4M7DB 5GAN7 4F7UB 5GMKi 1X01A 4WF2A 1N9SA 5GMKe 5GANj 2FYKA 2DXTA 3JCMV 5LJ5j 4NOYA 3V8KA 5GMKj 2EJGA 1Y96B 4NL3A 3JCMh 3AHUA 4XTYA 3RESA 1MGQA 4XTUA 1B34B 2E1HA 2DZ9A 1WNLA 4C8QE 3JCMP 2DEQA 3JB9G 3JCMd 3JCMW 2YLCA 4RCBA 4OP0A 2DZCA 3V8JA 4F7UA 3JB9J 4J6YA 5CAIA 4M78C 5LJ5h 1WPYA 3FJPA 4M78D 4M77D 4XTWA 3JB9F 4V2SA 2VC8A 4C92E 5GAOm 4C92B 1Y96A 4JRIA 1BIAA 5GAOn 2DTIA 3FB9A 3V7CA 4M78A 3M4GA 4PJOE 4M77A 4PJOB 3EFSA 4EMKC 3HFNA 1JBMA 2EJ9A 5GANg 2RA2A 4C8QA 4M7DG 2JN0A 5GAMh 5LJ3j 4JLIA 5LJ5g 2EWNA 1B34A 4HA8A 4MMKA 3SWNC 2DXUA 3JCMc 4F7UF 3JCMX 4J6XA 5GMKl 4M7DD 1M5Q1 4M7AD 2DJZA 3RKYA 5LJ5d 3JCMQ 1YCYA
chains in the Genus database with same CATH superfamily
3SD4A 1WGSA 3WVDB 1UGVA 2QTXA 4ORZA 1OV3A 2LJ3A 1VQ9A 2K3BA 4E7JA 2G3RA 2GBQA 3VRZA 3URGA 2Y4XA 2E4HA 1U5SA 1PNJA 2OTLQ 2KROA 3BDLA 2X9HA 3M54A 1M3CA 4Y91A 1GFCA 2QXFA 1TXQA 3A8LB 2P0QA 2R5MA 4C5HA 2M16A 3G71A 1K8AC 3S3OA 3CCMT 2DM1A 5KE3A 1TUDA 2XG8D 1ZA1B 3LLRA 1UJ0A 1T3LA 3CXCP 2DL4A 2ZPFB 5GANh 2FRYA 1N8RR 2P4TA 3M55A 5GANe 1CKAA 4K11A 4M7AA 2A0FB 2L2PA 5GAN5 2DXCA 2XK0A 5ECAA 3M5AA 3BW1A 1FMKA 2WACA 4J9DA 4DOWA 2PUOB 3RKWA 3G71Q 4A4KA 2YWWA 4J6WA 2OTLA 4PLIA 3QYGB 1WQ7A 4L59A 4FW1A 1M1FA 2RI2A 1OPLA 1LOJA 4HT9A 1U1TA 2ZZDA 4OMPA 5I22A 3HFOA 2F2VA 1XNIA 4HCBA 1VQ9Q 3QO3A 2FEIA 2RD1A 4LNPA 1B7TA 1QW1A 2RHUA 2E70A 1YITQ 3TSZA 5GAN7 4EIKA 4ELYC 3OBYA 3SHWA 2D8JA 3ZL7C 1SSHA 1UFFA 1N27A 3M0UA 4JJBA 3JCMP 1FXXA 3PIOA 1ZUUA 5KCOA 1Y96A 1X75C 1BIAA 4BB7A 4MDXA 3OBWA 5HK3A 5GANg 4JJNK 2LP5A 3OMGA 2EWNA 2P0KA 4BE1A 3A8GB 1KD1R 2AZSA 2KAFA 3PNWC 2KSSA 2EYZA 1VQ4Q 1NBEB 4ELZC 1I5LA 2DE0X 4C92C 2DPPB 1K8AR 1X43A 4OGEA 1TH7A 4IURA 2QTVA 4Z02A 5D6XA 3X24B 4A4EA 5C6SA 2K7AA 4BY6B 3S3NA 2XIDA 4QQGA 3M4YA 2O31A 3SWNB 1BI1A 2KRMA 2HD0A 1NZ9A 3G7ZA 2LX7A 2PU9B 1D1BA 1R77A 3A98A 4OB2B 4D8KA 4PFZA 2QDLA 5GAMj 3NTIA 2DD5A 5L23A 2MPXC 2K3XA 1N9RA 3C0CA 2JUFA 1EX4A 1VYVA 2GNCA 1PHTA 2C0IA 2V8JA 4F7UG 1M90C 1PCXA 3BFMA 1Q86C 5GAMe 4B9WA 5IAYA 1M3AA 2HKNA 3CMET 2RN8A 1W1FA 4C92A 4C8QF 2EYQA 1OX9A 2FB7A 2KDSA 2JOYA 2FZCB 2CKKA 2QQ9A 3JCMh 1MV0B 2HAXA 1PG5B 2L5QA 4BI3A 2AIRB 4F14A 2QYZA 2GQIA 4XTWA 5KYUA 3HRUA 3OW2P 5GAOn 2CUBA 2CS7A 2F1LA 2OAWA 2LVMA 2YUNA 2RQTA 4LDWA 3CCSA 2PNIA 1VQLT 2DK3A 3GBQA 2HKQB 1B34A 1ZBXA 1VQ6T 1WA7A 1ABQA 3RNJA 1UJYA 4PJOG 2O01E 4M75D 3OYFA 1VQ6Q 2CP7A 3D7SB 3M0QA 4M78F 5HKCA 1UTIA 3J81E 1NJIC 3WXMB 3OYIA 3HRTA 5CKBA 2XICA 3C95A 1SRLA 1IZ6A 4M77E 2L89A 4OB1B 2KBTA 4BY6C 3EFRA 4XU2A 2LQWA 3A5ZB 2QGFB 2DKGA 1KK7A 2VKNA 4C5IA 3QWXX 1UDLA 2BZYA 4RTZA 2XU8A 1M9SA 2ATCB 2DAQA 1VQ4T 3LWHA 4C0FA 2VYTA 1VQ7T 2F5KA 4O5VA 1Q86U 5I21A 2KT1A 3RUXA 4FL6A 3QXEB 4RTTA 4J8OA 4L6V5 1GCQA 2KMTA 3CCQQ 3JB9I 2K5FA 1WHLA 1Y07A 1JB0E 1WHGA 3PGGA 4HVWA 1QWFA 2E64A 4C8QG 2FG0A 5GAN3 3TSWA 1B07A 1VQ7A 2LQKA 2EFIA 1KC8R 2O4XA 4OMQA 3AHUA 2DILA 1J3TA 1AWJA 3P8BB 2KI7A 5IXFA 3QBYA 4PJJA 5A0GA 4LN2A 2RPNA 3JB9F 3JSCA 2DD4A 3BE3A 4OMNA 2QA4A 1VQOT 1VA7A 1TG0A 3P8DA 5M9OA 1KC8U 4MMKA 4M7AD 5LJ5d 2JM9A 3CCSQ 4E7KA 4R55A 4GY5A 2KY9A 1VQ5A 2XDDA 2KT8A 4A54A 5FWBA 4M77F 5GMKh 1Z9ZA 3V7SA 4OMLA 2KXDA 4ESRA 4IUPA 4KUIA 3ER0A 3GP8A 1YITA 2AT1B 2EYYA 5CK9A 4C92G 2A36A 5GANd 3JCMb 1QCFA 3TREA 4FW2A 1G8XA 2YDLA 4PJMA 3Q1JA 1Z9QA 4X9CA 4EPCA 2KNBB 4M75F 5EG2A 2LNHB 3VS0A 1K73U 5EC7A 2CZ1B 1ZLMA 3MP1A 3GIBA 1LJOA 2LDMA 4JJCA 2LZ6B 1M1GA 2OI3A 5HY6A 2QEXT 1S72Q 1I07A 4XTXA 2DA9A 5J39A 1AT1B 3OB9A 1YJNQ 5GJWB 4M7DF 4M4ZA 2CP5A 3CMAA 1SEMA 4OMMA 5CQYA 4M78B 2MOXA 1PSEA 4M77G 3G4ST 4N4IA 3RMQA 3CCQA 3CCLT 1YJNT 3CMEA 4F7UE 4LDYA 3OA6A 5LJ5j 1QVGA 4KRTA 3EG0A 4OGCA 1BBZA 3P8HA 1PRMC 2VB6A 3MEUA 1WIEA 1G3SA 1VQ7Q 2GTJA 2XDPA 3H41A 4RCBA 1Q81U 1M90R 3JB9J 2QQBA 1OZ3A 4J9EA 3VUZA 2C0OA 3NTHA 1NJIR 5GAOm 2YRVA 1H3ZA 3M4GA 1Y71A 1JEGA 3EFSA 3UWNA 4KGVB 2ROTA 3CC2A 5IXBA 4PLLA 1SRMA 4J9BA 2DXUA 2QA4Q 5GMKl 3C94A 3O5ZA 1VQKA 3META 2AKKA 4PJLA 2PVOB 2C06A 3DB4A 3EHQA 4M7DA 3REAB 2EQIA 2W0ZA 1LVKA 1YIJQ 1NG2A 4DOVA 4M75B 2IVWA 1YJ9A 2GQVA 5KE2A 3QJYA 2OTJT 1KQSP 2I2LA 2RMOA 4C92D 2VWFA 1GFDA 1NEBA 1YIJT 2HQXA 3OMCA 2CT4A 2OTLT 4EMGA 2YXYA 5GANf 1WXTA 1HXDA 3LH5A 3EAEA 3OYJA 2P84A 4PJOA 1D3BA 4MZTA 1QCNA 4OF1A 2HSPA 4RKUE 2OTJA 2HL5C 3RIRA 3SWNA 5GAOr 2F2XA 2F69A 3EHRA 2DRMA 2DBMA 3VS3A 3OYGA 4A4FA 3VU3C 4M7AG 1R0CB 4IIOA 3JB9H 1E6GA 4HCZA 1KSWA 1UUEA 4FYYB 1ARKA 1VQLQ 4N0AA 3KUFA 2X4YA 2EGEA 3G71T 3I56A 4A4GA 2ROLA 4BE2A 3G1JA 1Q7YR 1RI9A 5GMKi 3CEYA 5GMKe 2KE9A 2DXTA 3JCMV 4C0DB 1IRXA 1M2VB 2PQWA 1Y96B 2FZGB 2LX9A 3QIIA 4BI8B 2KRNA 4BD3A 3FC3A 1WJQA 1JO8A 1AZGB 1S1NA 1SPKA 2CZ6B 1FWZA 1GL5A 3QDRB 1PD1A 3FJPA 5CKDA 1M3BA 1ZX6A 3M0RA 4C92B 1HD3A 4ZGDB 4LUEA 3FB9A 1F1BB 2P4RA 4M78A 3CCMA 4IUQA 4ZTFA 2RA2A 4HA8A 3A8OB 2M1HA 1Y57A 4JRKA 2A7YA 4IIMA 2JJ9A 2WSEE 3QSUA 3L2ZA 2CUDA 4QW2A 2HMAA 2HSEB 2RJFA 4QQDA 3E9FA 1QWEA 3I5RA 4C5EA 3CCUA 3JB9D 3I5SA 2EQUA 2QQRA 3QPHA 4FT4A 3G4SA 3G6ET 2JS0A 1IGUA 1YNZA 2EKOA 4DQ2A 3INZA 2P0PA 2MYSA 5LL6S 3SB2A 1X27A 2DYBA 1I0CA 4X34A 1AWOA 1IXDA 1YJ9Q 4JUVA 4KGZB 4HT8A 1H8KA 3L2WA 2PUKB 1QP2A 3HKSA 2MMPA 3LGLA 4E2FB 2QA4T 3M0TA 1VQOA 2CSQA 1TWBA 3QDFA 4ZN1A 2PVDB 3HHTB 2HQHA 4LD9K 2COYA 4YTLA 3JCMe 3U23A 4JZ4A 2EVRA 2D0NA 4M77C 3V7RA 1VQ5T 1PM3A 4RTXA 2FRWA 1VIFA 4CC2A 4E47A 2COZA 5I2SA 4M75C 2X51A 1AEYA 1A0NB 2YLBA 2CREA 4HXJA 1WQWA 1R8OB 5KYWA 1VQ5Q 1O9SA 1P92A 5FLXE 3AT1B 4M7DB 1VQMQ 4CC3A 2FYKA 1KQSS 3SFMA 2R57A 2LC4A 5D7UA 1QVGP 3L2VA 1VQNT 2RQWA 1N8RU 4RG8A 1QVFA 4P5NA 4QT7A 4OMOA 5LJ5h 2V1QA 4V2SA 2RH2A 2HBWA 1YI2A 1B3QA 3V7CA 2DF6A 1SKUB 2YSQA 1VQNQ 5LJ3j 2DERA 3JCMX 1U3OA 3PFSA 3RKYA 3OS2A 4QVDA 3O8VA 1Q7YU 5LJ5f 2ED0A 3HL8A 2J6OA 4FIBA 3CCRQ 1WLPB 1OX8A 3BDUA 2LNVA 4FYWB 1YI2T 2EW3A 2HQEA 5DY9A 1VQ8Q 1JXMA 4XK8E 1C6VX 1QKXA 1BK2A 3CCRT 1QVFS 2JMAA 4LDVA 3TU4K 2KRSA 2DYIA 1K1ZA 1X69A 1UHFA 3M58A 2XDBA 1RAFB 1K9MC 2G6FX 4M7AC 3GLXA 5HCKA 3OYYA 4PJOF 5KCHA 1BI2A 4MDWA 1Y7XA 5KYWB 3M53A 1QCOA 4C8QC 1OZ2A 2CP6A 3CCRA 1QMCA 3CCVQ 5GMKm 4J9IA 2EIFA 1IHWA 4ATOA 2ZPHB 1YHQA 2EJFA 3MCAB 3L42A 1KHCA 3CCJA 4IUTA 3S3MA 3QUIA 2O2OA 1YJWQ 3NGPA 2ZGWA 4LD6A 3VUBA 3CCVT 4F7UB 3PE0A 1PKTA 5A2QE 3CCEQ 4LUDA 4AG1C 2FPEA 2DLPA 1VQMA 3CD6A 2RNAA 4XTUA 2NUTB 1M90U 1NYGA 2QEXA 4KUDK 2M51A 2YLCA 3TCJA 5CAIA 9ATCB 5J26A 2JNGA 4BDYA 4PJNA 2MF2A 3I55Q 1T0HA 3H0IA 1PSFA 1TUGB 2RF0A 2GTOA 1SF9A 3OYBA 2HZYA 3GF5A 3CBOA 1EIFA 4OB0B 3I55T 3M56A 1BU1A 4N0AC 3CPWA 1N5ZA 1OU8A 3OYKA 4NL2A 2K57A 1Q7YC 1BIBA 4J5YA 4JS5A 4QVZA 2K5IA 2EQKA 2X4XA 3EGUA 3V8LA 4M75E 2EAYA 5FW9A 3OS0A 3HP9A 1H641 5CIUA 5IT9E 4XTZA 2LTOA 1D3BB 1JRIA 4A53A 2E65A 3ZEHA 4ZTJA 1Q82U 5LJ3h 4OB3B 2KR3A 1T0JA 2A08A 2KXCA 2ESWA 3CMEQ 4M75A 1LPLA 2RHYA 1I8FA 2LMJA 3CCEA 3PVQA 2DTHA 4AT1B 3S6WA 4E7LA 1WHKA 3I55A 1VQ8T 4X1VA 3HTRA 2RQRA 5HK0A 5CKFA 4DEXA 3JAME 4D6WA 2H3JA 2EQJA 2I0NA 3NFCA 3VKIA 2VV5A 1TOVA 4GLMA 2K2VA 3OYNA 2RQUA 1M30A 2FZKB 1G3TA 3CCLQ 3CMAT 2B86A 4XTYA 1MNEA 2XD0A 3WVEB 4O6JA 2DEQA 3CC7A 1UG1A 2L3QA 3EG2A 2DZCA 3HPWA 2QQAA 3PIPA 1VUBA 3N5BB 2O88A 1G3WA 1ZSZB 4EMKC 4ZN3A 3DLLA 3UT1A 3H0FA 3JCMc 2M0YA 3PMTA 3THKA 3X28B 3JCMQ 3TVTA 1VQ8A 4EMKB 3OYLA 3EH1A 3PTAA 2EGCA 3EFOA 1CSKA 2BKDN 2OAUA 4JRPA 2E6ZA 1NYFA 2ZPBB 3CCET 5GAMg 1QLYA 5IH2A 2LT1A 2QGGA 1XQHA 2GFAA 1VQPQ 2RJCA 1QVPA 1KFZA 4FSSA 5FU7C 5GAOq 4R0KA 1GBQA 1M1KC 1LNXA 4C0DC 4JRQA 3VYHB 2PVGB 4E7SA 2XMFA 2KQWA 4C0GA 1KQSA 3CBPA 1UB4A 3CD6T 3GNGA 1Q82R 4DBQA 3CC2T 1RABB 2E3HA 2F5TX 4HKEA 4VUBA 2XI9A 4DA4A 2CGHA 5CCAA 3CCUT 1OOTA 2RK1A 1M2OA 4EMKA 5IN1A 1IO6A 1PKSA 3REBB 2CDTA 1NEGA 2DVEA 1PRLC 4B9XA 3G6EA 3QYHB 3CXCS 3J80E 1K0XA 1W4SA 1ZUYA 4X9DA 1YFNA 5KH6A 3VS4A 2CSIA 2QI2A 4CC7A 2BZ8A 2CZ7B 2YT6A 2LJ1A 4GBQA 4ZGJB 1ABOA 2VVKA 5IHNA 3JB9G 1XJWB 3X20B 4Q5WA 1MMGA 3VS1A 2DNUA 2JXBA 4J7IA 2BE9B 3CC7Q 3FLGA 1PC0A 3CPWP 2D1XA 1HSQA 2EJ9A 3R6NA 4IKFA 3L2RA 3MHXA 2E6NA 2YUQA 2J06A 5L8RE 2LCCA 4CRIA 4JPBW 4PFPA 2LJ0A 2R5AA 3R6OA 1I1JA 1M1KR 3KXTA 2DTOA 1RUWA 1M8VA 1IGQA 1WDXA 3OYEA 3CCVA 3JCMg 1VQ6A 4C8QB 4AFZC 4HCCA 1AZEA 7AT1B 2JM8A 1YCSB 5AT1B 4JDSA 5GAOp 1MMNA 2B8AA 2O9VA 1OQKA 4KBMB 5GAOl 1ZUKA 2E41A 2EKHA 3HSBA 3UATA 3M0SA 1MNDA 3QG1A 2M9UA 2ZCFB 4Z8AA 4XU1A 2R58A 3MP6A 4XTVA 4A63B 2DBKA 2EYWA 2K3YA 3X26B 3RMSA 5LJ3f 3ULRB 3OW2S 1GCQC 1S72T 1G5VA 1VYUA 2HL3A 2JW4A 1G3YA 4JLGA 2FL7A 1V76A 1K4US 5DLQE 3F70A 1VQKQ 3I9QA 2E5KA 4KT0E 2DETA 3KFVA 2EJGA 1UGPB 2K5LA 2X3XD 2E1HA 4F04B 4C8QE 4RG2A 1X6OA 4F7UA 3GPLA 1RAAB 2DL5A 5J3BA 3MP8A 1VYTA 2AKLA 1WX6A 4J9GA 4BUGA 3HFNA 2A37A 1ZBJA 4HVUA 4JLIA 3SWNC 3EG3A 2AK5A 4PKCC 2ZPEB 3ZBDA 4BI4A 5FU6C 1I81A 4J9FA 5GAN2 2VXEA 1V1CA 1K73C 2D6FA 4QKUA 1M1KU 1RADB 2HDAA 1T3SA 5LJ3d 1E7OA 1JXOA 1EZZB 2D0QB 2CYZB 2OX7A 4E6RA 3H9NA 1WHMA 1KQ1A 3CCMQ 2X4JA 1W2BP 2DFUA 3EG1A 1KD1C 1NE8A 2E12A 4M7AF 5D6YA 1HK9A 3PT9A 8AT1B 1VOMA 2MCNA 1U1SA 4KULA 3EGDA 1K9MU 4M7DC 3BY7A 3UPUA 1KC8C 1E6HA 1YITT 1FMVA 4M78E 1I4K1 3EGXA 4EDUA 2Z0WA 1JJ2S 5I11A 2SRCA 1WFWA 2D8HA 1JJ2P 2L3RA 4XQ3A 2XHCA 4IUVA 2DEUA 1HJDA 2CT3A 4JZ3A 3EG9B 2DIGA 3RESA 1MGQA 3RBBB 1O75A 1OI1A 1VQPT 1TSFA 4DBRA 5IHKA 1YI2Q 1MUZA 1SSFA 3JCMd 3J7AF 3PVLA 1N6AA 3VS7A 1NLOC 4M78C 4B6MA 4C0ZA 1Q81C 4JRIA 3ZFJA 1FYNA 1NPRA 4PJOB 3PMIA 3MPUB 2H3EB 2QASA 2DJQA 4M7DG 2JN0A 3RR6A 1X6GA 2K9GA 4M7DD 1VQPA 2WSFE 4J6XA 1YJNA 3LYIA 4GLKA 1UE9A 2V26A 4E7IA 1M2VA 2LQNA 3VYGA 1BB9A 3FRNA 3FEOA 1VQKT 2YHTA 5DLOA 1RAHB 5I2MA 2ABLA 5LJ3g 3C12A 1OYXA 2L8DA 1WZOA 2AZVA 4M7AB 4CC4B 2YUPA 3JV3A 2NUPB 3JCMf 4EMHA 3CC4T 3E1SA 1NJIU 1M8MA 2M0OA 2GCXA 1K9AA 2RHXA 3M0PA 4ANJA 2MAMA 2JT4A 2YRCA 2JS2A 2H8HA 2E10A 5A0LA 4FCYA 2DL3A 2NUZA 1NPPA 1V29B 1EFNA 2K79A 3CC7T 1X2QA 2MIOA 1YHQQ 1PWTA 4ME7A 4E7HA 4MMLA 1YP5A 2OTJQ 2Y90A 1YIJA 1G83A 2YRDA 1BCMA 3JCMJ 2VXFA 3M59A 1OULA 2C0TA 3LX7A 2DO3A 5GAN4 3QHSA 1YHQT 2LT4A 1HYOA 3FIFA 4LXCA 1W70A 1M27C 3QWYA 1UEBA 2AHJB 4J7FA 5GANj 2L3PA 1M4ZA 4KH0B 2L0AA 5FU7B 2MK5A 1RLQC 1ZSZC 4J9HA 1TS9A 3VS6A 1KD1U 3OY9A 4IUUA 1GBRA 3JCMW 2BUDA 4OP0A 2BTTA 3V8JA 4J6YA 3NMZC 1WJRA 2JVVA 6AT1B 2VGNA 5DM7R 1K73R 4RTWA 4C92E 2DTIA 3SDZA 4CI0C 4AFSC 3EGXB 4AFUC 3OQ5A 4F17A 3I56T 4OMFB 2KGTA 2FHDA 3QZ9B 1D1CA 1D0ZA 1VQ9T 1LCKA 2EGAA 2ECZA 2K6DA 2E5QA 4WTOB 2O9SA 4QVCA 3I56Q 5GAMd 4J83A 1Y0MA 1BYMA 2BZXA 1NLPC 1GXIE 5KYXA 5GAN6 3HRSA 3LW5E 4C92F 3OYAA 3DLMA 4AMCA 5FRNA 1C0MA 3DB3A 4QQ6A 3LGFA 2FVUA 4UC4A 2NLUA 1IREB 2ZPIB 1KHIA 8ATCB 2X3WD 1UECA 4PNOA 5KYXB 2GGRA 3ASKA 4BE0A 4J9CA 1JU5C 2KVQG 4FSXA 2VASA 1W2BA 4C5GA 3RERA 4RMOA 4TVRA 1OU9A 2O4XB 3VRYA 4II1A 2BIVA 4RTYA 3CCUQ 3CCJQ 4BDZA 1D0YA 5CO7A 1XTDA 3CCQT 4XAXB 2M02A 1X01A 4WF2A 5CR2A 2NWMA 2Y4YA 1JJ2A 2FPDA 1SHGA 1GRIA 1VQOQ 2FO0A 3MEVA 2DMOA 3EFOB 1KG1A 4DEYA 1G2BA 1ZA2B 1CKBA 1UGRB 2VC8A 1RI0A 4M77A 1YBYA 5CVIA 3CCLA 4FYXB 4Y92A 4C8QA 5LJ5g 1M5Q1 5CQXA 3A1PA 1U8RA 2RJEA 4KGXB 3A8HB 4MZPA 1H92A 3FJ5A 4Z88A 3UA7A 2KEAA 3CCST 5GAMf 1VQLA 1MHNA 1WJSA 2DL8A 4FYVB 2LQ8A 3QKJA 4RTVA 5AYFA 4E7ZA 1VQ4A 1XOVA 1GCPA 1Q81R 1D0XA 3IQLA 1YN8A 5FRMA 2RO0A 2J05A 5GJVB 4PJOC 2RB6A 5C0MA 3L2UA 2V1RA 3NHNA 3E2UA 3FDRA 2KK4A 2CP0A 4PK4A 4N4HA 4AFQC 1RAEB 4WCIA 3OSVA 3L1AA 4M75G 3OS1A 3NPFA 4FU6A 1ACMB 5KYYA 3RDVA 5GAN8 4PJOD 4JJDA 4AG2C 1H3HA 1S72A 1YWOA 2DRKA 5LJ5e 1K8AU 3OS5A 3CQTA 1TUCA 1FX7A 5FWCA 2DL7A 4DBFA 4RCCA 2J6FA 2JZ2A 5D6WA 1RL2A 4OVAA 3G4SQ 2EBPA 2K4YA 4Y28E 1B34B 2XKOC 3OW2A 2RHZA 3CPWS 3L2QA 5FU6B 4D8DA 3CMAQ 1UGQB 1IB8A 5CKEA 2MI6A 1QVFP 4LDUA 1QQJA 3CPFA 2NUPA 2RK2A 3MJXA 4F7UF 3CCJT 2DJZA 3EGDB 1K0SA 3C4SA 1BCOA 1KJWA 1X2KA 1WHJA 3H0HA 1C1AA 4ZNXA 1MMDA 1AD5A 3OSSC 1RAIB 2VUBA 2ED1A 1QVGS 1UGSB 3T9NA 1WI7A 2J6KA 2RI5A 1W6XA 3CXCA 2L3SA 2JTEA 5LJ3e 1ZSZA 3CD6Q 1WXUA 2J7IA 1BI0A 4M7AE 2RHIA 1IHVA 2CP2A 3H8ZA 2ZPGB 3X25B 4NS5A 1QKWA 1OEBA 1TTHB 1TU0B 1KQ2A 2DVJA 2LCSA 3A8MB 3GOXA 1MV3A 1ZSGA 2DXBA 2JMCA 2PZ1A 3MKDA 2ENMA 2K2MA 3VS5A 1RLPC 2CZ0B 4XU0A 2IIMA 2YUOA 1PD0A 4Z89A 1VQNA 1D09B 1NM7A 4HVVA 4L5GA 2A28A 2QK0A 1JQQA 1MMAA 3EH2A 4RUGA 3E19A 3LWIA 1OPKA 1Q86R 2HEQA 1AHJB 4DBHA 2WSCE 2GFUA 3MO8A 5KYUB 1ZQ1A 1SG5A 2IG0A 3I35A 3NTKA 2IPOB 1I5OB 1BKBA 1N9SA 2PTKA 5CKHA 3MEWA 2QQSA 1FMWA 2DIQA 3V8KA 3GNFB 1YWPA 2RQVA 3VS2A 4LDXA 2ZAEA 3ME9A 4PFOA 4BACA 2V8IA 1AWWA 3E9GA 2EYXA 4KH1B 3OYMA 3MEAA 2NUTA 1WPYA 2F2WA 4RTUA 3LH0A 2HBPA 1X6BA 4PJOE 2W10A 5IHIA 2E3IA 3VV0A 1JBMA 1K76A 1R0BG 3UDCA 3EG9A 1YCYA 2HCKA 3JRZA 2BE7D 1Q82C 1N8RC 3H6ZA 5FROA 2GF7A 2QAZA 1UHCA 4JS4A 4N4GA 3RKXA 2KYBA 3OYDA 2MWOA 1YJ9T 4XU3A 2RM4A 2LCLA 3UA6A 3DKMA 1RACB 4M77B 4A4HA 2COWA 3KBGA 2CP3A 1K9MR 1ZHIA 3OYHA 4LE9A 1AOJA 4C8QD 1YJWT 3QZ5B 1BI3A 3G6EQ 3QJ6A 2QEXQ 1AWXA 3VJPA 1RAGB 1Q95G 1WYXA 3TQ7P 3OYCA 4FM4B 1AVZC 1KIKA 2A3LA 1WXBA 5KYYB 3CBMA 2OJ2A 3CC4Q 1YJWA 2MWPA 2CH4W 1VIEA 2JTMA 2HNIA 2V8KA 4R56A 4PL6A 1VQMT 2RI3A 4M78G 2RJDA 2X35A 4ZGEB 1QP3A 5A0DA 4FT2A 2SEMA 1D1AA 2FPFA 4M7DE 3M57A 5KYNA 1U06A 3M9QA 2KYMA 4NOYA 3CC2Q 5GMKj 4HCKA 2QG9B 4NL3A 2LRQA 3CC4A 2EQMA 2D9TA 2DZ9A 1WNLA 1SHFA 2NYSA 2EPDA 1W2BS 2X4WA 2QDYB 4M78D 4M77D 3SEMA 4MZMA 3TEEA 2DX1A 3UF4A 4F16A 5GAMh 2JTFA 2VGMA 1WHHA 1DJ7B 2CH4A
chains in the Genus database with same CATH topology
1VQKA 3SD4A 1WGSA 3META 1VQ9T 4EMKB 3WVDB 3OYLA 2PVOB 1VQ8A 2QTXA 3PTAA 2C06A 3DB4A 2OAUA 2BKDN 1VQ9A 4M7DA 4E7JA 2E5QA 2G3RA 4JRPA 2E6ZA 3URGA 2ZPBB 4QVCA 2Y4XA 5GAMd 4J83A 3CCET 5GAMg 1BYMA 4DOVA 1GXIE 2LT1A 3BDLA 4Y91A 3M54A 1XQHA 2GFAA 2QXFA 5GAN6 4M75B 2RJCA 2IVWA 2P0QA 3A8LB 2R5MA 2GQVA 3HRSA 3LW5E 4C5HA 3QJYA 4C92F 5KE2A 3OYAA 1QVPA 2M16A 3DLMA 3G71A 1K8AC 5FRNA 3S3OA 3CCMT 5FU7C 2I2LA 5GAOq 4C92D 5KE3A 1YIJT 3DB3A 1M1KC 2HQXA 1LNXA 2XG8D 4C0DC 3LLRA 3OMCA 4JRQA 4QQ6A 3VYHB 2PVGB 3LGFA 2OTLT 2KQWA 4EMGA 2FVUA 4UC4A 2NLUA 5GANf 4C0GA 2ZPFB 5GANh 1IREB 2ZPIB 1KHIA 1KQSA 3CBPA 1HXDA 1UB4A 3CD6T 3GNGA 2P4TA 3EAEA 4PNOA 3OYJA 4PJOA 3M55A 5GANe 1D3BA 4MZTA 3CC2T 4OF1A 2F5TX 4M7AA 3ASKA 4RKUE 4BE0A 2OTJA 4HKEA 2KVQG 3RIRA 4VUBA 2XI9A 3SWNA 4FSXA 5GAN5 5GAOr 2DXCA 4DA4A 2XK0A 2CGHA 1W2BA 2F69A 3M5AA 4C5GA 5CCAA 3CCUT 3BW1A 2RK1A 3OYGA 2WACA 3RERA 4DOWA 4RMOA 2PUOB 4TVRA 3RKWA 4A4FA 1W2BS 3VU3C 4EMKA 4M7AG 4A4KA 3JB9H 2O4XB 5IN1A 4J6WA 4HCZA 2OTLA 4II1A 4PLIA 3QYGB 2BIVA 1WQ7A 4L59A 2DVEA 4N0AA 3KUFA 3QYHB 1M1FA 2RI2A 2X4YA 4B9XA 1LOJA 3J80E 3CXCS 3I56A 3G71T 1U1TA 4A4GA 4BDZA 2ZZDA 4BE2A 3HFOA 5CO7A 1XNIA 1W4SA 4HCBA 3QO3A 1XTDA 3CCQT 2RD1A 4XAXB 1QW1A 2RHUA 2E70A 4X9DA 5KH6A 5GAN7 5GMKi 1X01A 3CEYA 2QI2A 4WF2A 5GMKe 4ELYC 3OBYA 2DXTA 3JCMV 2CZ7B 4C0DB 5CR2A 4ZGJB 2PQWA 1Y96B 2Y4YA 2LX9A 1JJ2A 1N27A 3QIIA 4BI8B 4BD3A 3JCMP 3JB9G 3MEVA 3FC3A 1WJQA 3X20B 4Q5WA 1FXXA 1KG1A 2CZ6B 3PIOA 1FWZA 3QDRB 4ZTFA 4J7IA 3FJPA 5CKDA 5KCOA 1UGRB 2VC8A 4C92B 1RI0A 1X75C 1BIAA 1Y96A 4BB7A 3FLGA 4ZGDB 3FB9A 4MDXA 4M78A 3CCMA 4M77A 1YBYA 4IUQA 5CVIA 3OBWA 4IKFA 2EJ9A 5HK3A 2RA2A 4C8QA 3MHXA 2E6NA 5GANg 3L2RA 5LJ5g 3OMGA 2EWNA 3CCLA 4HA8A 2P0KA 3A8OB 3A8GB 5L8RE 4BE1A 1M5Q1 2M1HA 2LCCA 2KAFA 3PNWC 4CRIA 2KSSA 4JRKA 2A7YA 5CQXA 2R5AA 1U8RA 3R6OA 2RJEA 2WSEE 4ELZC 3QSUA 3L2ZA 1I5LA 3A8HB 4C92C 3KXTA 2DTOA 2DPPB 4QW2A 2RJFA 4MZPA 4QQDA 3E9FA 4OGEA 1TH7A 4IURA 4C5EA 1M8VA 3CCUA 3JB9D 3CCVA 3OYEA 2EQUA 5GAMf 3CCST 1VQLA 1MHNA 2QQRA 1WJSA 3QPHA 4FT4A 2LQ8A 4Z02A 5D6XA 3QKJA 3JCMg 3X24B 4C8QB 3G4SA 3G6ET 3CCQA 4A4EA 5AYFA 5C6SA 2EKOA 4HCCA 4BY6B 4DQ2A 3INZA 2P0PA 1VQ4A 1XOVA 3S3NA 5LL6S 3SB2A 2XIDA 4QQGA 3M4YA 4X34A 3SWNB 1BI1A 4JDSA 5GAOp 2B8AA 5FRMA 2RO0A 2HD0A 1NZ9A 4JUVA 3G7ZA 2PU9B 4HT8A 4PJOC 2RB6A 4KBMB 5C0MA 5GAOl 3L2UA 3L2WA 4OB2B 2E41A 2PUKB 1QP2A 3HKSA 2MMPA 3LGLA 3HSBA 3FDRA 2KK4A 2QA4T 5GAMj 1VQOA 3NTIA 2DD5A 4N4HA 4ZN1A 3QG1A 2M9UA 2PVDB 3OSVA 3L1AA 3HHTB 4M75G 3OS1A 1VQ5A 2K3XA 1N9RA 2ZCFB 4FU6A 4LD9K 4YTLA 2JUFA 4XU1A 3JCMe 5GAN8 4PJOD 1M90C 4F7UG 2V8JA 2R58A 3BFMA 3MP6A 4M77C 4XTVA 3V7RA 1S72A 1Q86C 5GAMe 1VQ5T 4B9WA 2K3YA 5IAYA 1VIFA 3X26B 4E47A 5I2SA 5LJ5e 4M75C 1K8AU 3RMSA 5LJ3f 3OW2S 3OS5A 2YLBA 1S72T 1G5VA 3CMET 1FX7A 1WQWA 1G3YA 4C92A 1R8OB 4C8QF 2EYQA 1O9SA 1VQKT 1P92A 4RCCA 5FLXE 4JLGA 2JZ2A 2FL7A 2FB7A 5DLQE 4M7DB 3F70A 5D6WA 1RL2A 4OVAA 2FYKA 4KT0E 1KQSS 2KDSA 2JOYA 3SFMA 2CKKA 2QQ9A 2EJGA 2R57A 1UGPB 2K4YA 3JCMh 4Y28E 2K5LA 2LC4A 1B34B 2E1HA 4C8QE 2XKOC 3OW2A 2RHZA 2HAXA 4RG2A 3L2VA 1X6OA 1VQNT 4F7UA 3GPLA 3CPWS 1N8RU 4RG8A 1QVFA 4P5NA 2L5QA 4BI3A 3L2QA 5LJ5h 5J3BA 4XTWA 3MP8A 4V2SA 5FU6B 2RH2A 3HRUA 1YI2A 5GAOn 1UGQB 3V7CA 2CS7A 5CKEA 2LVMA 4BUGA 2MI6A 3HFNA 4LDUA 4LDWA 3CCSA 1VQLT 2DK3A 3CPFA 4JLIA 5LJ3j 1B34A 1ZBXA 3SWNC 1VQ6T 2RK2A 4F7UF 3JCMX 3OYKA 3CCJT 2DJZA 3PFSA 3RKYA 4PKCC 2ZPEB 3ZBDA 3C4SA 4BI4A 3OS2A 4PJOG 5FU6C 4QVDA 2O01E 4M75D 1I81A 3O8VA 3OYFA 5GAN2 1Q7YU 5LJ5f 3OSSC 4M78F 2VXEA 3HL8A 2VUBA 4FIBA 5HKCA 3J81E 1QVGS 1UGSB 3T9NA 3WXMB 1K73C 3BDUA 2RI5A 1NJIC 2LNVA 2D6FA 3OYIA 3CXCA 1YI2T 3HRTA 5CKBA 5LJ3e 1M1KU 2XICA 3C95A 1IZ6A 4M77E 2HQEA 1BI0A 5LJ3d 5DY9A 2L89A 4OB1B 4XK8E 2D0QB 3CCRT 4BY6C 3EFRA 1QVFS 2RHIA 4M7AE 2CYZB 4XU2A 3H8ZA 2ZPGB 3A5ZB 4LDVA 3X25B 4NS5A 3TU4K 1KQ1A 2DKGA 4C5IA 2X4JA 1KQ2A 3M58A 2XU8A 3A8MB 1KD1C 3GOXA 1M9SA 2DXBA 1NE8A 2XDBA 2DAQA 1VQ4T 3LWHA 4C0FA 2E12A 2VYTA 5D6YA 1HK9A 2F5KA 3PT9A 1VQ7T 1K9MC 4M7AF 2CZ0B 4XU0A 1YJ9A 4M7AC 3GLXA 4O5VA 1U1SA 3OYYA 4PJOF 5KCHA 5I21A 1Q86U 1BI2A 4KULA 3RUXA 4MDWA 1Y7XA 4FL6A 1VQNA 1K9MU 3M53A 4M7DC 3QXEB 3BY7A 4C8QC 4J8OA 4L6V5 4L5GA 2KMTA 3UPUA 4HT9A 3JB9I 1OZ2A 2K5FA 1KC8C 2OTJT 3CCRA 1YITT 1Y07A 5GMKm 4M78E 3E19A 3LWIA 1I4K1 1JB0E 2EIFA 4ATOA 2ZPHB 3PGGA 4EDUA 1JJ2S 1YHQA 2EJFA 1AHJB 3MCAB 2WSCE 2E64A 3L42A 1KHCA 2GFUA 3MO8A 4IUTA 3CCJA 3S3MA 3QUIA 1ZQ1A 4C8QG 2L3RA 4XQ3A 2IG0A 5GAN3 3NTKA 2ZGWA 4LD6A 3VUBA 3CCVT 4F7UB 1BKBA 1N9SA 1VQ7A 5CKHA 3MEWA 2QQSA 5A2QE 2DIQA 2LQKA 2EFIA 2XHCA 4JJNK 3V8KA 3GNFB 4IUVA 1VQMA 2O4XA 3AHUA 3CD6A 2DIGA 3RESA 1MGQA 4XTUA 4LDXA 1O75A 1OI1A 1VQPT 1M90U 3ME9A 4BACA 2V8IA 3JCMd 1SSFA 3E9GA 3P8BB 2QEXA 3J7AF 4KUDK 2YLCA 3QBYA 3TCJA 1N6AA 5A0GA 3OYMA 5CAIA 4M78C 3MEAA 4C0ZA 5J26A 1Q81C 1WPYA 3JB9F 2JNGA 4BDYA 3JSCA 3LH0A 2HBPA 4JRIA 2DD4A 2MF2A 3ZFJA 1PSFA 2QA4A 1NPRA 1VQOT 4PJOE 4PJOB 3PMIA 3OYBA 3P8DA 3VV0A 1JBMA 5M9OA 4M7DG 2JN0A 3GF5A 3UDCA 1KC8U 4MMKA 4M7DD 4M7AD 1VQPA 2WSFE 4J6XA 1YJNA 3LYIA 3CBOA 4GLKA 5LJ5d 1EIFA 1YCYA 4E7IA 4E7KA 4OB0B 3JRZA 3VYGA 3I55T 1Q82C 3M56A 4N0AC 3CPWA 1N8RC 4R55A 3FRNA 3FEOA 2KY9A 2K57A 3H6ZA 2GF7A 4GY5A 4NL2A 1BIBA 4J5YA 5FROA 2XDDA 1Q7YC 4JS4A 4JS5A 4A54A 4N4GA 4QVZA 3RKXA 2K5IA 4M77F 2EQKA 3OYDA 2X4XA 2MWOA 2YHTA 5GMKh 1YJ9T 4XU3A 5DLOA 3V7SA 3V8LA 2RM4A 2LCLA 4M75E 5I2MA 2EAYA 4IUPA 3DKMA 4M77B 4KUIA 3ER0A 3HP9A 4A4HA 5LJ3g 3OS0A 3G6EA 3GP8A 3C12A 3KBGA 1OYXA 1YITA 5CK9A 1ZHIA 2L8DA 1H641 5CIUA 5IT9E 4C92G 5GANd 3OYHA 4XTZA 3JCMb 4M7AB 3TREA 4C8QD 2LTOA 1D3BB 1YJWT 1JRIA 3QZ5B 1BI3A 3Q1JA 2E65A 4A53A 4X9CA 3JCMf 4EPCA 3QJ6A 4EMHA 4M75F 3ZEHA 5EG2A 3VJPA 4ZTJA 1Q82U 3CC4T 3E1SA 5LJ3h 2M0OA 1K73U 2GCXA 1NJIU 2CZ1B 2RHXA 2MAMA 3MP1A 4OB3B 3OYCA 3GIBA 1LJOA 4FM4B 2LDMA 2A3LA 2E10A 5A0LA 3PIPA 1M1GA 5HY6A 2QEXT 4XTXA 3CBMA 4M75A 5J39A 1YJWA 2MWPA 1NPPA 1V29B 2RHYA 1I8FA 1VIEA 3OB9A 2JTMA 2HNIA 2V8KA 3CC7T 4M7DF 3CCEA 1VQ6A 4R56A 2DTHA 4ME7A 4PL6A 3S6WA 4E7HA 4E7LA 4MMLA 3CMAA 1VQMT 2Y90A 2RI3A 5CQYA 1YIJA 4M78B 1PSEA 4M77G 3JCMJ 4M78G 3I55A 3G4ST 2RJDA 1VQ8T 4N4IA 2X35A 2VXFA 3M59A 3RMQA 3LX7A 4ZGEB 3CCLT 1QP3A 5A0DA 2DO3A 5CKFA 4FT2A 5HK0A 5GAN4 1YJNT 3QHSA 1YHQT 3JAME 2LT4A 3FIFA 3CMEA 4D6WA 2H3JA 2EQJA 4M7DE 3NFCA 4F7UE 3VKIA 4LDYA 3OA6A 1UEBA 2AHJB 3M57A 4J7FA 5GANj 3M9QA 2VV5A 5LJ5j 1M4ZA 2K2VA 1QVGA 4NOYA 4OGCA 3OYNA 3P8HA 5GMKj 1G3TA 5FU7B 4NL3A 3CMAT 4XTYA 2LRQA 3CC4A 2XD0A 3MEUA 3WVEB 1G3SA 2D9TA 2DZ9A 1WNLA 2EQMA 4O6JA 2DEQA 3OY9A 3CC7A 1KD1U 4IUUA 2XDPA 3JCMW 2BUDA 4RCBA 1Q81U 4OP0A 2DZCA 3HPWA 3V8JA 3JB9J 4J6YA 1WJRA 2QQAA 2JVVA 2QQBA 2QDYB 1VUBA 2VGNA 1OZ3A 2X4WA 3N5BB 5DM7R 4M78D 3VUZA 3NTHA 4M77D 4C92E 5GAOm 2YRVA 1H3ZA 2DTIA 3SDZA 3M4GA 4CI0C 4MZMA 1Y71A 1G3WA 3TEEA 3EFSA 4EMKC 3UWNA 4ZN3A 3OQ5A 3CC2A 5GAMh 3UT1A 4PLLA 3I56T 2JTFA 3DLLA 2DXUA 2VGMA 4OMFB 3JCMc 3PMTA 5GMKl 1DJ7B 2FHDA 3QZ9B 3X28B 3C94A 3JCMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRK A;  4EMK B;  4PJO G;  2QTX A;  4N0A C;  3QSU A;  3L2Z A;  1I5L A;  4QVD A;  4M7D A;  4NL2 A;  2K57 A;  4M75 D;  4C92 C;  2DTO A;  1BIB A;  4J5Y A;  1I81 A;  4A54 A;  4QVC A;  1TH7 A;  5GAM d;  3RKX A;  5GAM g;  5GAN 2;  1M8V A;  4M77 F;  5LJ5 f;  4M78 F;  3JB9 D;  2VXE A;  2YHT A;  5GAM f;  5GMK h;  4XU3 A;  4Y91 A;  3V7S A;  3JCM g;  3BDU A;  5GAN 6;  4M75 B;  2RM4 A;  3V8L A;  4M75 E;  4C8Q B;  2EAY A;  4C92 F;  5LJ3 e;  4DQ2 A;  3INZ A;  4M77 B;  4M77 E;  5LJ3 g;  5GAO q;  2I2L A;  5LJ3 d;  4C92 D;  5DY9 A;  3SB2 A;  1H64 1;  3SWN B;  1LNX A;  4C92 G;  5GAN d;  4XTZ A;  3JCM b;  4M7A B;  5GAO p;  4M7A E;  4C8Q D;  3EFR A;  4EMG A;  4JUV A;  4HT8 A;  1D3B B;  4XU2 A;  1JRI A;  4PJO C;  5GAN f;  2RB6 A;  4A53 A;  2E65 A;  5GAN h;  5GAO l;  4X9C A;  3JCM f;  1HXD A;  2E41 A;  1KQ1 A;  2DKG A;  4EMH A;  4M75 F;  4PNO A;  1KQ2 A;  3HSB A;  4PJO A;  5GAN e;  5GAM j;  5LJ3 h;  1D3B A;  4M7A A;  3L1A A;  4M75 G;  3RIR A;  3SWN A;  1LJO A;  1N9R A;  3GIB A;  5GAN 5;  5GAO r;  4M7A F;  1HK9 A;  4XU1 A;  2CGH A;  3JCM e;  2E10 A;  5GAN 8;  4PJO D;  4XU0 A;  4M7A C;  4F7U G;  1U1S A;  4PJO F;  3BW1 A;  5I21 A;  4XTX A;  3RER A;  4M75 A;  3RUX A;  4M77 C;  3BFM A;  4XTV A;  3RKW A;  3V7R A;  3VU3 C;  4EMK A;  4M7A G;  1I8F A;  4M7D C;  5GAM e;  3BY7 A;  4C8Q C;  3JB9 H;  2HNI A;  4M7D F;  3JB9 I;  4J6W A;  2DTH A;  5LJ5 e;  4M75 C;  5LJ3 f;  4MML A;  2Y90 A;  5GMK m;  4M78 E;  4M78 B;  2YLB A;  1WQ7 A;  2DVE A;  4M77 G;  1I4K 1;  4N0A A;  4M78 G;  3JCM J;  4HT9 A;  1LOJ A;  3PGG A;  2VXF A;  1U1T A;  1WQW A;  2EJF A;  4C92 A;  2E64 A;  4C8Q F;  3HFO A;  5GAN 4;  3QHS A;  3QO3 A;  3QUI A;  4RCC A;  4C8Q G;  2RD1 A;  3FIF A;  4XQ3 A;  2FB7 A;  5GAN 3;  4X9D A;  4M7D E;  2ZGW A;  4F7U E;  4M7D B;  5GAN 7;  4F7U B;  5GMK i;  1X01 A;  4WF2 A;  1N9S A;  5GMK e;  5GAN j;  2FYK A;  2DXT A;  3JCM V;  5LJ5 j;  4NOY A;  3V8K A;  5GMK j;  2EJG A;  1Y96 B;  4NL3 A;  3JCM h;  3AHU A;  4XTY A;  3RES A;  1MGQ A;  4XTU A;  1B34 B;  2E1H A;  2DZ9 A;  1WNL A;  4C8Q E;  3JCM P;  2DEQ A;  3JB9 G;  3JCM d;  3JCM W;  2YLC A;  4RCB A;  4OP0 A;  2DZC A;  3V8J A;  4F7U A;  3JB9 J;  4J6Y A;  5CAI A;  4M78 C;  5LJ5 h;  1WPY A;  3FJP A;  4M78 D;  4M77 D;  4XTW A;  3JB9 F;  4V2S A;  2VC8 A;  4C92 E;  5GAO m;  4C92 B;  1Y96 A;  4JRI A;  1BIA A;  5GAO n;  2DTI A;  3FB9 A;  3V7C A;  4M78 A;  3M4G A;  4PJO E;  4M77 A;  4PJO B;  3EFS A;  4EMK C;  3HFN A;  1JBM A;  2EJ9 A;  5GAN g;  2RA2 A;  4C8Q A;  4M7D G;  2JN0 A;  5GAM h;  5LJ3 j;  4JLI A;  5LJ5 g;  2EWN A;  1B34 A;  4HA8 A;  4MMK A;  3SWN C;  2DXU A;  3JCM c;  4F7U F;  3JCM X;  4J6X A;  5GMK l;  4M7D D;  1M5Q 1;  4M7A D;  2DJZ A;  3RKY A;  5LJ5 d;  3JCM Q;  1YCY A; 
#chains in the Genus database with same CATH topology
 3SD4 A;  1WGS A;  3WVD B;  1UGV A;  2QTX A;  4ORZ A;  1OV3 A;  2LJ3 A;  1VQ9 A;  2K3B A;  4E7J A;  2G3R A;  2GBQ A;  3VRZ A;  3URG A;  2Y4X A;  2E4H A;  1U5S A;  1PNJ A;  2OTL Q;  2KRO A;  3BDL A;  2X9H A;  3M54 A;  1M3C A;  4Y91 A;  1GFC A;  2QXF A;  1TXQ A;  3A8L B;  2P0Q A;  2R5M A;  4C5H A;  2M16 A;  3G71 A;  1K8A C;  3S3O A;  3CCM T;  2DM1 A;  5KE3 A;  1TUD A;  2XG8 D;  1ZA1 B;  3LLR A;  1UJ0 A;  1T3L A;  3CXC P;  2DL4 A;  2ZPF B;  5GAN h;  2FRY A;  1N8R R;  2P4T A;  3M55 A;  5GAN e;  1CKA A;  4K11 A;  4M7A A;  2A0F B;  2L2P A;  5GAN 5;  2DXC A;  2XK0 A;  5ECA A;  3M5A A;  3BW1 A;  1FMK A;  2WAC A;  4J9D A;  4DOW A;  2PUO B;  3RKW A;  3G71 Q;  4A4K A;  2YWW A;  4J6W A;  2OTL A;  4PLI A;  3QYG B;  1WQ7 A;  4L59 A;  4FW1 A;  1M1F A;  2RI2 A;  1OPL A;  1LOJ A;  4HT9 A;  1U1T A;  2ZZD A;  4OMP A;  5I22 A;  3HFO A;  2F2V A;  1XNI A;  4HCB A;  1VQ9 Q;  3QO3 A;  2FEI A;  2RD1 A;  4LNP A;  1B7T A;  1QW1 A;  2RHU A;  2E70 A;  1YIT Q;  3TSZ A;  5GAN 7;  4EIK A;  4ELY C;  3OBY A;  3SHW A;  2D8J A;  3ZL7 C;  1SSH A;  1UFF A;  1N27 A;  3M0U A;  4JJB A;  3JCM P;  1FXX A;  3PIO A;  1ZUU A;  5KCO A;  1Y96 A;  1X75 C;  1BIA A;  4BB7 A;  4MDX A;  3OBW A;  5HK3 A;  5GAN g;  4JJN K;  2LP5 A;  3OMG A;  2EWN A;  2P0K A;  4BE1 A;  3A8G B;  1KD1 R;  2AZS A;  2KAF A;  3PNW C;  2KSS A;  2EYZ A;  1VQ4 Q;  1NBE B;  4ELZ C;  1I5L A;  2DE0 X;  4C92 C;  2DPP B;  1K8A R;  1X43 A;  4OGE A;  1TH7 A;  4IUR A;  2QTV A;  4Z02 A;  5D6X A;  3X24 B;  4A4E A;  5C6S A;  2K7A A;  4BY6 B;  3S3N A;  2XID A;  4QQG A;  3M4Y A;  2O31 A;  3SWN B;  1BI1 A;  2KRM A;  2HD0 A;  1NZ9 A;  3G7Z A;  2LX7 A;  2PU9 B;  1D1B A;  1R77 A;  3A98 A;  4OB2 B;  4D8K A;  4PFZ A;  2QDL A;  5GAM j;  3NTI A;  2DD5 A;  5L23 A;  2MPX C;  2K3X A;  1N9R A;  3C0C A;  2JUF A;  1EX4 A;  1VYV A;  2GNC A;  1PHT A;  2C0I A;  2V8J A;  4F7U G;  1M90 C;  1PCX A;  3BFM A;  1Q86 C;  5GAM e;  4B9W A;  5IAY A;  1M3A A;  2HKN A;  3CME T;  2RN8 A;  1W1F A;  4C92 A;  4C8Q F;  2EYQ A;  1OX9 A;  2FB7 A;  2KDS A;  2JOY A;  2FZC B;  2CKK A;  2QQ9 A;  3JCM h;  1MV0 B;  2HAX A;  1PG5 B;  2L5Q A;  4BI3 A;  2AIR B;  4F14 A;  2QYZ A;  2GQI A;  4XTW A;  5KYU A;  3HRU A;  3OW2 P;  5GAO n;  2CUB A;  2CS7 A;  2F1L A;  2OAW A;  2LVM A;  2YUN A;  2RQT A;  4LDW A;  3CCS A;  2PNI A;  1VQL T;  2DK3 A;  3GBQ A;  2HKQ B;  1B34 A;  1ZBX A;  1VQ6 T;  1WA7 A;  1ABQ A;  3RNJ A;  1UJY A;  4PJO G;  2O01 E;  4M75 D;  3OYF A;  1VQ6 Q;  2CP7 A;  3D7S B;  3M0Q A;  4M78 F;  5HKC A;  1UTI A;  3J81 E;  1NJI C;  3WXM B;  3OYI A;  3HRT A;  5CKB A;  2XIC A;  3C95 A;  1SRL A;  1IZ6 A;  4M77 E;  2L89 A;  4OB1 B;  2KBT A;  4BY6 C;  3EFR A;  4XU2 A;  2LQW A;  3A5Z B;  2QGF B;  2DKG A;  1KK7 A;  2VKN A;  4C5I A;  3QWX X;  1UDL A;  2BZY A;  4RTZ A;  2XU8 A;  1M9S A;  2ATC B;  2DAQ A;  1VQ4 T;  3LWH A;  4C0F A;  2VYT A;  1VQ7 T;  2F5K A;  4O5V A;  1Q86 U;  5I21 A;  2KT1 A;  3RUX A;  4FL6 A;  3QXE B;  4RTT A;  4J8O A;  4L6V 5;  1GCQ A;  2KMT A;  3CCQ Q;  3JB9 I;  2K5F A;  1WHL A;  1Y07 A;  1JB0 E;  1WHG A;  3PGG A;  4HVW A;  1QWF A;  2E64 A;  4C8Q G;  2FG0 A;  5GAN 3;  3TSW A;  1B07 A;  1VQ7 A;  2LQK A;  2EFI A;  1KC8 R;  2O4X A;  4OMQ A;  3AHU A;  2DIL A;  1J3T A;  1AWJ A;  3P8B B;  2KI7 A;  5IXF A;  3QBY A;  4PJJ A;  5A0G A;  4LN2 A;  2RPN A;  3JB9 F;  3JSC A;  2DD4 A;  3BE3 A;  4OMN A;  2QA4 A;  1VQO T;  1VA7 A;  1TG0 A;  3P8D A;  5M9O A;  1KC8 U;  4MMK A;  4M7A D;  5LJ5 d;  2JM9 A;  3CCS Q;  4E7K A;  4R55 A;  4GY5 A;  2KY9 A;  1VQ5 A;  2XDD A;  2KT8 A;  4A54 A;  5FWB A;  4M77 F;  5GMK h;  1Z9Z A;  3V7S A;  4OML A;  2KXD A;  4ESR A;  4IUP A;  4KUI A;  3ER0 A;  3GP8 A;  1YIT A;  2AT1 B;  2EYY A;  5CK9 A;  4C92 G;  2A36 A;  5GAN d;  3JCM b;  1QCF A;  3TRE A;  4FW2 A;  1G8X A;  2YDL A;  4PJM A;  3Q1J A;  1Z9Q A;  4X9C A;  4EPC A;  2KNB B;  4M75 F;  5EG2 A;  2LNH B;  3VS0 A;  1K73 U;  5EC7 A;  2CZ1 B;  1ZLM A;  3MP1 A;  3GIB A;  1LJO A;  2LDM A;  4JJC A;  2LZ6 B;  1M1G A;  2OI3 A;  5HY6 A;  2QEX T;  1S72 Q;  1I07 A;  4XTX A;  2DA9 A;  5J39 A;  1AT1 B;  3OB9 A;  1YJN Q;  5GJW B;  4M7D F;  4M4Z A;  2CP5 A;  3CMA A;  1SEM A;  4OMM A;  5CQY A;  4M78 B;  2MOX A;  1PSE A;  4M77 G;  3G4S T;  4N4I A;  3RMQ A;  3CCQ A;  3CCL T;  1YJN T;  3CME A;  4F7U E;  4LDY A;  3OA6 A;  5LJ5 j;  1QVG A;  4KRT A;  3EG0 A;  4OGC A;  1BBZ A;  3P8H A;  1PRM C;  2VB6 A;  3MEU A;  1WIE A;  1G3S A;  1VQ7 Q;  2GTJ A;  2XDP A;  3H41 A;  4RCB A;  1Q81 U;  1M90 R;  3JB9 J;  2QQB A;  1OZ3 A;  4J9E A;  3VUZ A;  2C0O A;  3NTH A;  1NJI R;  5GAO m;  2YRV A;  1H3Z A;  3M4G A;  1Y71 A;  1JEG A;  3EFS A;  3UWN A;  4KGV B;  2ROT A;  3CC2 A;  5IXB A;  4PLL A;  1SRM A;  4J9B A;  2DXU A;  2QA4 Q;  5GMK l;  3C94 A;  3O5Z A;  1VQK A;  3MET A;  2AKK A;  4PJL A;  2PVO B;  2C06 A;  3DB4 A;  3EHQ A;  4M7D A;  3REA B;  2EQI A;  2W0Z A;  1LVK A;  1YIJ Q;  1NG2 A;  4DOV A;  4M75 B;  2IVW A;  1YJ9 A;  2GQV A;  5KE2 A;  3QJY A;  2OTJ T;  1KQS P;  2I2L A;  2RMO A;  4C92 D;  2VWF A;  1GFD A;  1NEB A;  1YIJ T;  2HQX A;  3OMC A;  2CT4 A;  2OTL T;  4EMG A;  2YXY A;  5GAN f;  1WXT A;  1HXD A;  3LH5 A;  3EAE A;  3OYJ A;  2P84 A;  4PJO A;  1D3B A;  4MZT A;  1QCN A;  4OF1 A;  2HSP A;  4RKU E;  2OTJ A;  2HL5 C;  3RIR A;  3SWN A;  5GAO r;  2F2X A;  2F69 A;  3EHR A;  2DRM A;  2DBM A;  3VS3 A;  3OYG A;  4A4F A;  3VU3 C;  4M7A G;  1R0C B;  4IIO A;  3JB9 H;  1E6G A;  4HCZ A;  1KSW A;  1UUE A;  4FYY B;  1ARK A;  1VQL Q;  4N0A A;  3KUF A;  2X4Y A;  2EGE A;  3G71 T;  3I56 A;  4A4G A;  2ROL A;  4BE2 A;  3G1J A;  1Q7Y R;  1RI9 A;  5GMK i;  3CEY A;  5GMK e;  2KE9 A;  2DXT A;  3JCM V;  4C0D B;  1IRX A;  1M2V B;  2PQW A;  1Y96 B;  2FZG B;  2LX9 A;  3QII A;  4BI8 B;  2KRN A;  4BD3 A;  3FC3 A;  1WJQ A;  1JO8 A;  1AZG B;  1S1N A;  1SPK A;  2CZ6 B;  1FWZ A;  1GL5 A;  3QDR B;  1PD1 A;  3FJP A;  5CKD A;  1M3B A;  1ZX6 A;  3M0R A;  4C92 B;  1HD3 A;  4ZGD B;  4LUE A;  3FB9 A;  1F1B B;  2P4R A;  4M78 A;  3CCM A;  4IUQ A;  4ZTF A;  2RA2 A;  4HA8 A;  3A8O B;  2M1H A;  1Y57 A;  4JRK A;  2A7Y A;  4IIM A;  2JJ9 A;  2WSE E;  3QSU A;  3L2Z A;  2CUD A;  4QW2 A;  2HMA A;  2HSE B;  2RJF A;  4QQD A;  3E9F A;  1QWE A;  3I5R A;  4C5E A;  3CCU A;  3JB9 D;  3I5S A;  2EQU A;  2QQR A;  3QPH A;  4FT4 A;  3G4S A;  3G6E T;  2JS0 A;  1IGU A;  1YNZ A;  2EKO A;  4DQ2 A;  3INZ A;  2P0P A;  2MYS A;  5LL6 S;  3SB2 A;  1X27 A;  2DYB A;  1I0C A;  4X34 A;  1AWO A;  1IXD A;  1YJ9 Q;  4JUV A;  4KGZ B;  4HT8 A;  1H8K A;  3L2W A;  2PUK B;  1QP2 A;  3HKS A;  2MMP A;  3LGL A;  4E2F B;  2QA4 T;  3M0T A;  1VQO A;  2CSQ A;  1TWB A;  3QDF A;  4ZN1 A;  2PVD B;  3HHT B;  2HQH A;  4LD9 K;  2COY A;  4YTL A;  3JCM e;  3U23 A;  4JZ4 A;  2EVR A;  2D0N A;  4M77 C;  3V7R A;  1VQ5 T;  1PM3 A;  4RTX A;  2FRW A;  1VIF A;  4CC2 A;  4E47 A;  2COZ A;  5I2S A;  4M75 C;  2X51 A;  1AEY A;  1A0N B;  2YLB A;  2CRE A;  4HXJ A;  1WQW A;  1R8O B;  5KYW A;  1VQ5 Q;  1O9S A;  1P92 A;  5FLX E;  3AT1 B;  4M7D B;  1VQM Q;  4CC3 A;  2FYK A;  1KQS S;  3SFM A;  2R57 A;  2LC4 A;  5D7U A;  1QVG P;  3L2V A;  1VQN T;  2RQW A;  1N8R U;  4RG8 A;  1QVF A;  4P5N A;  4QT7 A;  4OMO A;  5LJ5 h;  2V1Q A;  4V2S A;  2RH2 A;  2HBW A;  1YI2 A;  1B3Q A;  3V7C A;  2DF6 A;  1SKU B;  2YSQ A;  1VQN Q;  5LJ3 j;  2DER A;  3JCM X;  1U3O A;  3PFS A;  3RKY A;  3OS2 A;  4QVD A;  3O8V A;  1Q7Y U;  5LJ5 f;  2ED0 A;  3HL8 A;  2J6O A;  4FIB A;  3CCR Q;  1WLP B;  1OX8 A;  3BDU A;  2LNV A;  4FYW B;  1YI2 T;  2EW3 A;  2HQE A;  5DY9 A;  1VQ8 Q;  1JXM A;  4XK8 E;  1C6V X;  1QKX A;  1BK2 A;  3CCR T;  1QVF S;  2JMA A;  4LDV A;  3TU4 K;  2KRS A;  2DYI A;  1K1Z A;  1X69 A;  1UHF A;  3M58 A;  2XDB A;  1RAF B;  1K9M C;  2G6F X;  4M7A C;  3GLX A;  5HCK A;  3OYY A;  4PJO F;  5KCH A;  1BI2 A;  4MDW A;  1Y7X A;  5KYW B;  3M53 A;  1QCO A;  4C8Q C;  1OZ2 A;  2CP6 A;  3CCR A;  1QMC A;  3CCV Q;  5GMK m;  4J9I A;  2EIF A;  1IHW A;  4ATO A;  2ZPH B;  1YHQ A;  2EJF A;  3MCA B;  3L42 A;  1KHC A;  3CCJ A;  4IUT A;  3S3M A;  3QUI A;  2O2O A;  1YJW Q;  3NGP A;  2ZGW A;  4LD6 A;  3VUB A;  3CCV T;  4F7U B;  3PE0 A;  1PKT A;  5A2Q E;  3CCE Q;  4LUD A;  4AG1 C;  2FPE A;  2DLP A;  1VQM A;  3CD6 A;  2RNA A;  4XTU A;  2NUT B;  1M90 U;  1NYG A;  2QEX A;  4KUD K;  2M51 A;  2YLC A;  3TCJ A;  5CAI A;  9ATC B;  5J26 A;  2JNG A;  4BDY A;  4PJN A;  2MF2 A;  3I55 Q;  1T0H A;  3H0I A;  1PSF A;  1TUG B;  2RF0 A;  2GTO A;  1SF9 A;  3OYB A;  2HZY A;  3GF5 A;  3CBO A;  1EIF A;  4OB0 B;  3I55 T;  3M56 A;  1BU1 A;  4N0A C;  3CPW A;  1N5Z A;  1OU8 A;  3OYK A;  4NL2 A;  2K57 A;  1Q7Y C;  1BIB A;  4J5Y A;  4JS5 A;  4QVZ A;  2K5I A;  2EQK A;  2X4X A;  3EGU A;  3V8L A;  4M75 E;  2EAY A;  5FW9 A;  3OS0 A;  3HP9 A;  1H64 1;  5CIU A;  5IT9 E;  4XTZ A;  2LTO A;  1D3B B;  1JRI A;  4A53 A;  2E65 A;  3ZEH A;  4ZTJ A;  1Q82 U;  5LJ3 h;  4OB3 B;  2KR3 A;  1T0J A;  2A08 A;  2KXC A;  2ESW A;  3CME Q;  4M75 A;  1LPL A;  2RHY A;  1I8F A;  2LMJ A;  3CCE A;  3PVQ A;  2DTH A;  4AT1 B;  3S6W A;  4E7L A;  1WHK A;  3I55 A;  1VQ8 T;  4X1V A;  3HTR A;  2RQR A;  5HK0 A;  5CKF A;  4DEX A;  3JAM E;  4D6W A;  2H3J A;  2EQJ A;  2I0N A;  3NFC A;  3VKI A;  2VV5 A;  1TOV A;  4GLM A;  2K2V A;  3OYN A;  2RQU A;  1M30 A;  2FZK B;  1G3T A;  3CCL Q;  3CMA T;  2B86 A;  4XTY A;  1MNE A;  2XD0 A;  3WVE B;  4O6J A;  2DEQ A;  3CC7 A;  1UG1 A;  2L3Q A;  3EG2 A;  2DZC A;  3HPW A;  2QQA A;  3PIP A;  1VUB A;  3N5B B;  2O88 A;  1G3W A;  1ZSZ B;  4EMK C;  4ZN3 A;  3DLL A;  3UT1 A;  3H0F A;  3JCM c;  2M0Y A;  3PMT A;  3THK A;  3X28 B;  3JCM Q;  3TVT A;  1VQ8 A;  4EMK B;  3OYL A;  3EH1 A;  3PTA A;  2EGC A;  3EFO A;  1CSK A;  2BKD N;  2OAU A;  4JRP A;  2E6Z A;  1NYF A;  2ZPB B;  3CCE T;  5GAM g;  1QLY A;  5IH2 A;  2LT1 A;  2QGG A;  1XQH A;  2GFA A;  1VQP Q;  2RJC A;  1QVP A;  1KFZ A;  4FSS A;  5FU7 C;  5GAO q;  4R0K A;  1GBQ A;  1M1K C;  1LNX A;  4C0D C;  4JRQ A;  3VYH B;  2PVG B;  4E7S A;  2XMF A;  2KQW A;  4C0G A;  1KQS A;  3CBP A;  1UB4 A;  3CD6 T;  3GNG A;  1Q82 R;  4DBQ A;  3CC2 T;  1RAB B;  2E3H A;  2F5T X;  4HKE A;  4VUB A;  2XI9 A;  4DA4 A;  2CGH A;  5CCA A;  3CCU T;  1OOT A;  2RK1 A;  1M2O A;  4EMK A;  5IN1 A;  1IO6 A;  1PKS A;  3REB B;  2CDT A;  1NEG A;  2DVE A;  1PRL C;  4B9X A;  3G6E A;  3QYH B;  3CXC S;  3J80 E;  1K0X A;  1W4S A;  1ZUY A;  4X9D A;  1YFN A;  5KH6 A;  3VS4 A;  2CSI A;  2QI2 A;  4CC7 A;  2BZ8 A;  2CZ7 B;  2YT6 A;  2LJ1 A;  4GBQ A;  4ZGJ B;  1ABO A;  2VVK A;  5IHN A;  3JB9 G;  1XJW B;  3X20 B;  4Q5W A;  1MMG A;  3VS1 A;  2DNU A;  2JXB A;  4J7I A;  2BE9 B;  3CC7 Q;  3FLG A;  1PC0 A;  3CPW P;  2D1X A;  1HSQ A;  2EJ9 A;  3R6N A;  4IKF A;  3L2R A;  3MHX A;  2E6N A;  2YUQ A;  2J06 A;  5L8R E;  2LCC A;  4CRI A;  4JPB W;  4PFP A;  2LJ0 A;  2R5A A;  3R6O A;  1I1J A;  1M1K R;  3KXT A;  2DTO A;  1RUW A;  1M8V A;  1IGQ A;  1WDX A;  3OYE A;  3CCV A;  3JCM g;  1VQ6 A;  4C8Q B;  4AFZ C;  4HCC A;  1AZE A;  7AT1 B;  2JM8 A;  1YCS B;  5AT1 B;  4JDS A;  5GAO p;  1MMN A;  2B8A A;  2O9V A;  1OQK A;  4KBM B;  5GAO l;  1ZUK A;  2E41 A;  2EKH A;  3HSB A;  3UAT A;  3M0S A;  1MND A;  3QG1 A;  2M9U A;  2ZCF B;  4Z8A A;  4XU1 A;  2R58 A;  3MP6 A;  4XTV A;  4A63 B;  2DBK A;  2EYW A;  2K3Y A;  3X26 B;  3RMS A;  5LJ3 f;  3ULR B;  3OW2 S;  1GCQ C;  1S72 T;  1G5V A;  1VYU A;  2HL3 A;  2JW4 A;  1G3Y A;  4JLG A;  2FL7 A;  1V76 A;  1K4U S;  5DLQ E;  3F70 A;  1VQK Q;  3I9Q A;  2E5K A;  4KT0 E;  2DET A;  3KFV A;  2EJG A;  1UGP B;  2K5L A;  2X3X D;  2E1H A;  4F04 B;  4C8Q E;  4RG2 A;  1X6O A;  4F7U A;  3GPL A;  1RAA B;  2DL5 A;  5J3B A;  3MP8 A;  1VYT A;  2AKL A;  1WX6 A;  4J9G A;  4BUG A;  3HFN A;  2A37 A;  1ZBJ A;  4HVU A;  4JLI A;  3SWN C;  3EG3 A;  2AK5 A;  4PKC C;  2ZPE B;  3ZBD A;  4BI4 A;  5FU6 C;  1I81 A;  4J9F A;  5GAN 2;  2VXE A;  1V1C A;  1K73 C;  2D6F A;  4QKU A;  1M1K U;  1RAD B;  2HDA A;  1T3S A;  5LJ3 d;  1E7O A;  1JXO A;  1EZZ B;  2D0Q B;  2CYZ B;  2OX7 A;  4E6R A;  3H9N A;  1WHM A;  1KQ1 A;  3CCM Q;  2X4J A;  1W2B P;  2DFU A;  3EG1 A;  1KD1 C;  1NE8 A;  2E12 A;  4M7A F;  5D6Y A;  1HK9 A;  3PT9 A;  8AT1 B;  1VOM A;  2MCN A;  1U1S A;  4KUL A;  3EGD A;  1K9M U;  4M7D C;  3BY7 A;  3UPU A;  1KC8 C;  1E6H A;  1YIT T;  1FMV A;  4M78 E;  1I4K 1;  3EGX A;  4EDU A;  2Z0W A;  1JJ2 S;  5I11 A;  2SRC A;  1WFW A;  2D8H A;  1JJ2 P;  2L3R A;  4XQ3 A;  2XHC A;  4IUV A;  2DEU A;  1HJD A;  2CT3 A;  4JZ3 A;  3EG9 B;  2DIG A;  3RES A;  1MGQ A;  3RBB B;  1O75 A;  1OI1 A;  1VQP T;  1TSF A;  4DBR A;  5IHK A;  1YI2 Q;  1MUZ A;  1SSF A;  3JCM d;  3J7A F;  3PVL A;  1N6A A;  3VS7 A;  1NLO C;  4M78 C;  4B6M A;  4C0Z A;  1Q81 C;  4JRI A;  3ZFJ A;  1FYN A;  1NPR A;  4PJO B;  3PMI A;  3MPU B;  2H3E B;  2QAS A;  2DJQ A;  4M7D G;  2JN0 A;  3RR6 A;  1X6G A;  2K9G A;  4M7D D;  1VQP A;  2WSF E;  4J6X A;  1YJN A;  3LYI A;  4GLK A;  1UE9 A;  2V26 A;  4E7I A;  1M2V A;  2LQN A;  3VYG A;  1BB9 A;  3FRN A;  3FEO A;  1VQK T;  2YHT A;  5DLO A;  1RAH B;  5I2M A;  2ABL A;  5LJ3 g;  3C12 A;  1OYX A;  2L8D A;  1WZO A;  2AZV A;  4M7A B;  4CC4 B;  2YUP A;  3JV3 A;  2NUP B;  3JCM f;  4EMH A;  3CC4 T;  3E1S A;  1NJI U;  1M8M A;  2M0O A;  2GCX A;  1K9A A;  2RHX A;  3M0P A;  4ANJ A;  2MAM A;  2JT4 A;  2YRC A;  2JS2 A;  2H8H A;  2E10 A;  5A0L A;  4FCY A;  2DL3 A;  2NUZ A;  1NPP A;  1V29 B;  1EFN A;  2K79 A;  3CC7 T;  1X2Q A;  2MIO A;  1YHQ Q;  1PWT A;  4ME7 A;  4E7H A;  4MML A;  1YP5 A;  2OTJ Q;  2Y90 A;  1YIJ A;  1G83 A;  2YRD A;  1BCM A;  3JCM J;  2VXF A;  3M59 A;  1OUL A;  2C0T A;  3LX7 A;  2DO3 A;  5GAN 4;  3QHS A;  1YHQ T;  2LT4 A;  1HYO A;  3FIF A;  4LXC A;  1W70 A;  1M27 C;  3QWY A;  1UEB A;  2AHJ B;  4J7F A;  5GAN j;  2L3P A;  1M4Z A;  4KH0 B;  2L0A A;  5FU7 B;  2MK5 A;  1RLQ C;  1ZSZ C;  4J9H A;  1TS9 A;  3VS6 A;  1KD1 U;  3OY9 A;  4IUU A;  1GBR A;  3JCM W;  2BUD A;  4OP0 A;  2BTT A;  3V8J A;  4J6Y A;  3NMZ C;  1WJR A;  2JVV A;  6AT1 B;  2VGN A;  5DM7 R;  1K73 R;  4RTW A;  4C92 E;  2DTI A;  3SDZ A;  4CI0 C;  4AFS C;  3EGX B;  4AFU C;  3OQ5 A;  4F17 A;  3I56 T;  4OMF B;  2KGT A;  2FHD A;  3QZ9 B;  1D1C A;  1D0Z A;  1VQ9 T;  1LCK A;  2EGA A;  2ECZ A;  2K6D A;  2E5Q A;  4WTO B;  2O9S A;  4QVC A;  3I56 Q;  5GAM d;  4J83 A;  1Y0M A;  1BYM A;  2BZX A;  1NLP C;  1GXI E;  5KYX A;  5GAN 6;  3HRS A;  3LW5 E;  4C92 F;  3OYA A;  3DLM A;  4AMC A;  5FRN A;  1C0M A;  3DB3 A;  4QQ6 A;  3LGF A;  2FVU A;  4UC4 A;  2NLU A;  1IRE B;  2ZPI B;  1KHI A;  8ATC B;  2X3W D;  1UEC A;  4PNO A;  5KYX B;  2GGR A;  3ASK A;  4BE0 A;  4J9C A;  1JU5 C;  2KVQ G;  4FSX A;  2VAS A;  1W2B A;  4C5G A;  3RER A;  4RMO A;  4TVR A;  1OU9 A;  2O4X B;  3VRY A;  4II1 A;  2BIV A;  4RTY A;  3CCU Q;  3CCJ Q;  4BDZ A;  1D0Y A;  5CO7 A;  1XTD A;  3CCQ T;  4XAX B;  2M02 A;  1X01 A;  4WF2 A;  5CR2 A;  2NWM A;  2Y4Y A;  1JJ2 A;  2FPD A;  1SHG A;  1GRI A;  1VQO Q;  2FO0 A;  3MEV A;  2DMO A;  3EFO B;  1KG1 A;  4DEY A;  1G2B A;  1ZA2 B;  1CKB A;  1UGR B;  2VC8 A;  1RI0 A;  4M77 A;  1YBY A;  5CVI A;  3CCL A;  4FYX B;  4Y92 A;  4C8Q A;  5LJ5 g;  1M5Q 1;  5CQX A;  3A1P A;  1U8R A;  2RJE A;  4KGX B;  3A8H B;  4MZP A;  1H92 A;  3FJ5 A;  4Z88 A;  3UA7 A;  2KEA A;  3CCS T;  5GAM f;  1VQL A;  1MHN A;  1WJS A;  2DL8 A;  4FYV B;  2LQ8 A;  3QKJ A;  4RTV A;  5AYF A;  4E7Z A;  1VQ4 A;  1XOV A;  1GCP A;  1Q81 R;  1D0X A;  3IQL A;  1YN8 A;  5FRM A;  2RO0 A;  2J05 A;  5GJV B;  4PJO C;  2RB6 A;  5C0M A;  3L2U A;  2V1R A;  3NHN A;  3E2U A;  3FDR A;  2KK4 A;  2CP0 A;  4PK4 A;  4N4H A;  4AFQ C;  1RAE B;  4WCI A;  3OSV A;  3L1A A;  4M75 G;  3OS1 A;  3NPF A;  4FU6 A;  1ACM B;  5KYY A;  3RDV A;  5GAN 8;  4PJO D;  4JJD A;  4AG2 C;  1H3H A;  1S72 A;  1YWO A;  2DRK A;  5LJ5 e;  1K8A U;  3OS5 A;  3CQT A;  1TUC A;  1FX7 A;  5FWC A;  2DL7 A;  4DBF A;  4RCC A;  2J6F A;  2JZ2 A;  5D6W A;  1RL2 A;  4OVA A;  3G4S Q;  2EBP A;  2K4Y A;  4Y28 E;  1B34 B;  2XKO C;  3OW2 A;  2RHZ A;  3CPW S;  3L2Q A;  5FU6 B;  4D8D A;  3CMA Q;  1UGQ B;  1IB8 A;  5CKE A;  2MI6 A;  1QVF P;  4LDU A;  1QQJ A;  3CPF A;  2NUP A;  2RK2 A;  3MJX A;  4F7U F;  3CCJ T;  2DJZ A;  3EGD B;  1K0S A;  3C4S A;  1BCO A;  1KJW A;  1X2K A;  1WHJ A;  3H0H A;  1C1A A;  4ZNX A;  1MMD A;  1AD5 A;  3OSS C;  1RAI B;  2VUB A;  2ED1 A;  1QVG S;  1UGS B;  3T9N A;  1WI7 A;  2J6K A;  2RI5 A;  1W6X A;  3CXC A;  2L3S A;  2JTE A;  5LJ3 e;  1ZSZ A;  3CD6 Q;  1WXU A;  2J7I A;  1BI0 A;  4M7A E;  2RHI A;  1IHV A;  2CP2 A;  3H8Z A;  2ZPG B;  3X25 B;  4NS5 A;  1QKW A;  1OEB A;  1TTH B;  1TU0 B;  1KQ2 A;  2DVJ A;  2LCS A;  3A8M B;  3GOX A;  1MV3 A;  1ZSG A;  2DXB A;  2JMC A;  2PZ1 A;  3MKD A;  2ENM A;  2K2M A;  3VS5 A;  1RLP C;  2CZ0 B;  4XU0 A;  2IIM A;  2YUO A;  1PD0 A;  4Z89 A;  1VQN A;  1D09 B;  1NM7 A;  4HVV A;  4L5G A;  2A28 A;  2QK0 A;  1JQQ A;  1MMA A;  3EH2 A;  4RUG A;  3E19 A;  3LWI A;  1OPK A;  1Q86 R;  2HEQ A;  1AHJ B;  4DBH A;  2WSC E;  2GFU A;  3MO8 A;  5KYU B;  1ZQ1 A;  1SG5 A;  2IG0 A;  3I35 A;  3NTK A;  2IPO B;  1I5O B;  1BKB A;  1N9S A;  2PTK A;  5CKH A;  3MEW A;  2QQS A;  1FMW A;  2DIQ A;  3V8K A;  3GNF B;  1YWP A;  2RQV A;  3VS2 A;  4LDX A;  2ZAE A;  3ME9 A;  4PFO A;  4BAC A;  2V8I A;  1AWW A;  3E9G A;  2EYX A;  4KH1 B;  3OYM A;  3MEA A;  2NUT A;  1WPY A;  2F2W A;  4RTU A;  3LH0 A;  2HBP A;  1X6B A;  4PJO E;  2W10 A;  5IHI A;  2E3I A;  3VV0 A;  1JBM A;  1K76 A;  1R0B G;  3UDC A;  3EG9 A;  1YCY A;  2HCK A;  3JRZ A;  2BE7 D;  1Q82 C;  1N8R C;  3H6Z A;  5FRO A;  2GF7 A;  2QAZ A;  1UHC A;  4JS4 A;  4N4G A;  3RKX A;  2KYB A;  3OYD A;  2MWO A;  1YJ9 T;  4XU3 A;  2RM4 A;  2LCL A;  3UA6 A;  3DKM A;  1RAC B;  4M77 B;  4A4H A;  2COW A;  3KBG A;  2CP3 A;  1K9M R;  1ZHI A;  3OYH A;  4LE9 A;  1AOJ A;  4C8Q D;  1YJW T;  3QZ5 B;  1BI3 A;  3G6E Q;  3QJ6 A;  2QEX Q;  1AWX A;  3VJP A;  1RAG B;  1Q95 G;  1WYX A;  3TQ7 P;  3OYC A;  4FM4 B;  1AVZ C;  1KIK A;  2A3L A;  1WXB A;  5KYY B;  3CBM A;  2OJ2 A;  3CC4 Q;  1YJW A;  2MWP A;  2CH4 W;  1VIE A;  2JTM A;  2HNI A;  2V8K A;  4R56 A;  4PL6 A;  1VQM T;  2RI3 A;  4M78 G;  2RJD A;  2X35 A;  4ZGE B;  1QP3 A;  5A0D A;  4FT2 A;  2SEM A;  1D1A A;  2FPF A;  4M7D E;  3M57 A;  5KYN A;  1U06 A;  3M9Q A;  2KYM A;  4NOY A;  3CC2 Q;  5GMK j;  4HCK A;  2QG9 B;  4NL3 A;  2LRQ A;  3CC4 A;  2EQM A;  2D9T A;  2DZ9 A;  1WNL A;  1SHF A;  2NYS A;  2EPD A;  1W2B S;  2X4W A;  2QDY B;  4M78 D;  4M77 D;  3SEM A;  4MZM A;  3TEE A;  2DX1 A;  3UF4 A;  4F16 A;  5GAM h;  2JTF A;  2VGM A;  1WHH A;  1DJ7 B;  2CH4 A; 
#chains in the Genus database with same CATH homology
 1VQK A;  3SD4 A;  1WGS A;  3MET A;  1VQ9 T;  4EMK B;  3WVD B;  3OYL A;  2PVO B;  1VQ8 A;  2QTX A;  3PTA A;  2C06 A;  3DB4 A;  2OAU A;  2BKD N;  1VQ9 A;  4M7D A;  4E7J A;  2E5Q A;  2G3R A;  4JRP A;  2E6Z A;  3URG A;  2ZPB B;  4QVC A;  2Y4X A;  5GAM d;  4J83 A;  3CCE T;  5GAM g;  1BYM A;  4DOV A;  1GXI E;  2LT1 A;  3BDL A;  4Y91 A;  3M54 A;  1XQH A;  2GFA A;  2QXF A;  5GAN 6;  4M75 B;  2RJC A;  2IVW A;  2P0Q A;  3A8L B;  2R5M A;  2GQV A;  3HRS A;  3LW5 E;  4C5H A;  3QJY A;  4C92 F;  5KE2 A;  3OYA A;  1QVP A;  2M16 A;  3DLM A;  3G71 A;  1K8A C;  5FRN A;  3S3O A;  3CCM T;  5FU7 C;  2I2L A;  5GAO q;  4C92 D;  5KE3 A;  1YIJ T;  3DB3 A;  1M1K C;  2HQX A;  1LNX A;  2XG8 D;  4C0D C;  3LLR A;  3OMC A;  4JRQ A;  4QQ6 A;  3VYH B;  2PVG B;  3LGF A;  2OTL T;  2KQW A;  4EMG A;  2FVU A;  4UC4 A;  2NLU A;  5GAN f;  4C0G A;  2ZPF B;  5GAN h;  1IRE B;  2ZPI B;  1KHI A;  1KQS A;  3CBP A;  1HXD A;  1UB4 A;  3CD6 T;  3GNG A;  2P4T A;  3EAE A;  4PNO A;  3OYJ A;  4PJO A;  3M55 A;  5GAN e;  1D3B A;  4MZT A;  3CC2 T;  4OF1 A;  2F5T X;  4M7A A;  3ASK A;  4RKU E;  4BE0 A;  2OTJ A;  4HKE A;  2KVQ G;  3RIR A;  4VUB A;  2XI9 A;  3SWN A;  4FSX A;  5GAN 5;  5GAO r;  2DXC A;  4DA4 A;  2XK0 A;  2CGH A;  1W2B A;  2F69 A;  3M5A A;  4C5G A;  5CCA A;  3CCU T;  3BW1 A;  2RK1 A;  3OYG A;  2WAC A;  3RER A;  4DOW A;  4RMO A;  2PUO B;  4TVR A;  3RKW A;  4A4F A;  1W2B S;  3VU3 C;  4EMK A;  4M7A G;  4A4K A;  3JB9 H;  2O4X B;  5IN1 A;  4J6W A;  4HCZ A;  2OTL A;  4II1 A;  4PLI A;  3QYG B;  2BIV A;  1WQ7 A;  4L59 A;  2DVE A;  4N0A A;  3KUF A;  3QYH B;  1M1F A;  2RI2 A;  2X4Y A;  4B9X A;  1LOJ A;  3J80 E;  3CXC S;  3I56 A;  3G71 T;  1U1T A;  4A4G A;  4BDZ A;  2ZZD A;  4BE2 A;  3HFO A;  5CO7 A;  1XNI A;  1W4S A;  4HCB A;  3QO3 A;  1XTD A;  3CCQ T;  2RD1 A;  4XAX B;  1QW1 A;  2RHU A;  2E70 A;  4X9D A;  5KH6 A;  5GAN 7;  5GMK i;  1X01 A;  3CEY A;  2QI2 A;  4WF2 A;  5GMK e;  4ELY C;  3OBY A;  2DXT A;  3JCM V;  2CZ7 B;  4C0D B;  5CR2 A;  4ZGJ B;  2PQW A;  1Y96 B;  2Y4Y A;  2LX9 A;  1JJ2 A;  1N27 A;  3QII A;  4BI8 B;  4BD3 A;  3JCM P;  3JB9 G;  3MEV A;  3FC3 A;  1WJQ A;  3X20 B;  4Q5W A;  1FXX A;  1KG1 A;  2CZ6 B;  3PIO A;  1FWZ A;  3QDR B;  4ZTF A;  4J7I A;  3FJP A;  5CKD A;  5KCO A;  1UGR B;  2VC8 A;  4C92 B;  1RI0 A;  1X75 C;  1BIA A;  1Y96 A;  4BB7 A;  3FLG A;  4ZGD B;  3FB9 A;  4MDX A;  4M78 A;  3CCM A;  4M77 A;  1YBY A;  4IUQ A;  5CVI A;  3OBW A;  4IKF A;  2EJ9 A;  5HK3 A;  2RA2 A;  4C8Q A;  3MHX A;  2E6N A;  5GAN g;  3L2R A;  5LJ5 g;  3OMG A;  2EWN A;  3CCL A;  4HA8 A;  2P0K A;  3A8O B;  3A8G B;  5L8R E;  4BE1 A;  1M5Q 1;  2M1H A;  2LCC A;  2KAF A;  3PNW C;  4CRI A;  2KSS A;  4JRK A;  2A7Y A;  5CQX A;  2R5A A;  1U8R A;  3R6O A;  2RJE A;  2WSE E;  4ELZ C;  3QSU A;  3L2Z A;  1I5L A;  3A8H B;  4C92 C;  3KXT A;  2DTO A;  2DPP B;  4QW2 A;  2RJF A;  4MZP A;  4QQD A;  3E9F A;  4OGE A;  1TH7 A;  4IUR A;  4C5E A;  1M8V A;  3CCU A;  3JB9 D;  3CCV A;  3OYE A;  2EQU A;  5GAM f;  3CCS T;  1VQL A;  1MHN A;  2QQR A;  1WJS A;  3QPH A;  4FT4 A;  2LQ8 A;  4Z02 A;  5D6X A;  3QKJ A;  3JCM g;  3X24 B;  4C8Q B;  3G4S A;  3G6E T;  3CCQ A;  4A4E A;  5AYF A;  5C6S A;  2EKO A;  4HCC A;  4BY6 B;  4DQ2 A;  3INZ A;  2P0P A;  1VQ4 A;  1XOV A;  3S3N A;  5LL6 S;  3SB2 A;  2XID A;  4QQG A;  3M4Y A;  4X34 A;  3SWN B;  1BI1 A;  4JDS A;  5GAO p;  2B8A A;  5FRM A;  2RO0 A;  2HD0 A;  1NZ9 A;  4JUV A;  3G7Z A;  2PU9 B;  4HT8 A;  4PJO C;  2RB6 A;  4KBM B;  5C0M A;  5GAO l;  3L2U A;  3L2W A;  4OB2 B;  2E41 A;  2PUK B;  1QP2 A;  3HKS A;  2MMP A;  3LGL A;  3HSB A;  3FDR A;  2KK4 A;  2QA4 T;  5GAM j;  1VQO A;  3NTI A;  2DD5 A;  4N4H A;  4ZN1 A;  3QG1 A;  2M9U A;  2PVD B;  3OSV A;  3L1A A;  3HHT B;  4M75 G;  3OS1 A;  1VQ5 A;  2K3X A;  1N9R A;  2ZCF B;  4FU6 A;  4LD9 K;  4YTL A;  2JUF A;  4XU1 A;  3JCM e;  5GAN 8;  4PJO D;  1M90 C;  4F7U G;  2V8J A;  2R58 A;  3BFM A;  3MP6 A;  4M77 C;  4XTV A;  3V7R A;  1S72 A;  1Q86 C;  5GAM e;  1VQ5 T;  4B9W A;  2K3Y A;  5IAY A;  1VIF A;  3X26 B;  4E47 A;  5I2S A;  5LJ5 e;  4M75 C;  1K8A U;  3RMS A;  5LJ3 f;  3OW2 S;  3OS5 A;  2YLB A;  1S72 T;  1G5V A;  3CME T;  1FX7 A;  1WQW A;  1G3Y A;  4C92 A;  1R8O B;  4C8Q F;  2EYQ A;  1O9S A;  1VQK T;  1P92 A;  4RCC A;  5FLX E;  4JLG A;  2JZ2 A;  2FL7 A;  2FB7 A;  5DLQ E;  4M7D B;  3F70 A;  5D6W A;  1RL2 A;  4OVA A;  2FYK A;  4KT0 E;  1KQS S;  2KDS A;  2JOY A;  3SFM A;  2CKK A;  2QQ9 A;  2EJG A;  2R57 A;  1UGP B;  2K4Y A;  3JCM h;  4Y28 E;  2K5L A;  2LC4 A;  1B34 B;  2E1H A;  4C8Q E;  2XKO C;  3OW2 A;  2RHZ A;  2HAX A;  4RG2 A;  3L2V A;  1X6O A;  1VQN T;  4F7U A;  3GPL A;  3CPW S;  1N8R U;  4RG8 A;  1QVF A;  4P5N A;  2L5Q A;  4BI3 A;  3L2Q A;  5LJ5 h;  5J3B A;  4XTW A;  3MP8 A;  4V2S A;  5FU6 B;  2RH2 A;  3HRU A;  1YI2 A;  5GAO n;  1UGQ B;  3V7C A;  2CS7 A;  5CKE A;  2LVM A;  4BUG A;  2MI6 A;  3HFN A;  4LDU A;  4LDW A;  3CCS A;  1VQL T;  2DK3 A;  3CPF A;  4JLI A;  5LJ3 j;  1B34 A;  1ZBX A;  3SWN C;  1VQ6 T;  2RK2 A;  4F7U F;  3JCM X;  3OYK A;  3CCJ T;  2DJZ A;  3PFS A;  3RKY A;  4PKC C;  2ZPE B;  3ZBD A;  3C4S A;  4BI4 A;  3OS2 A;  4PJO G;  5FU6 C;  4QVD A;  2O01 E;  4M75 D;  1I81 A;  3O8V A;  3OYF A;  5GAN 2;  1Q7Y U;  5LJ5 f;  3OSS C;  4M78 F;  2VXE A;  3HL8 A;  2VUB A;  4FIB A;  5HKC A;  3J81 E;  1QVG S;  1UGS B;  3T9N A;  3WXM B;  1K73 C;  3BDU A;  2RI5 A;  1NJI C;  2LNV A;  2D6F A;  3OYI A;  3CXC A;  1YI2 T;  3HRT A;  5CKB A;  5LJ3 e;  1M1K U;  2XIC A;  3C95 A;  1IZ6 A;  4M77 E;  2HQE A;  1BI0 A;  5LJ3 d;  5DY9 A;  2L89 A;  4OB1 B;  4XK8 E;  2D0Q B;  3CCR T;  4BY6 C;  3EFR A;  1QVF S;  2RHI A;  4M7A E;  2CYZ B;  4XU2 A;  3H8Z A;  2ZPG B;  3A5Z B;  4LDV A;  3X25 B;  4NS5 A;  3TU4 K;  1KQ1 A;  2DKG A;  4C5I A;  2X4J A;  1KQ2 A;  3M58 A;  2XU8 A;  3A8M B;  1KD1 C;  3GOX A;  1M9S A;  2DXB A;  1NE8 A;  2XDB A;  2DAQ A;  1VQ4 T;  3LWH A;  4C0F A;  2E12 A;  2VYT A;  5D6Y A;  1HK9 A;  2F5K A;  3PT9 A;  1VQ7 T;  1K9M C;  4M7A F;  2CZ0 B;  4XU0 A;  1YJ9 A;  4M7A C;  3GLX A;  4O5V A;  1U1S A;  3OYY A;  4PJO F;  5KCH A;  5I21 A;  1Q86 U;  1BI2 A;  4KUL A;  3RUX A;  4MDW A;  1Y7X A;  4FL6 A;  1VQN A;  1K9M U;  3M53 A;  4M7D C;  3QXE B;  3BY7 A;  4C8Q C;  4J8O A;  4L6V 5;  4L5G A;  2KMT A;  3UPU A;  4HT9 A;  3JB9 I;  1OZ2 A;  2K5F A;  1KC8 C;  2OTJ T;  3CCR A;  1YIT T;  1Y07 A;  5GMK m;  4M78 E;  3E19 A;  3LWI A;  1I4K 1;  1JB0 E;  2EIF A;  4ATO A;  2ZPH B;  3PGG A;  4EDU A;  1JJ2 S;  1YHQ A;  2EJF A;  1AHJ B;  3MCA B;  2WSC E;  2E64 A;  3L42 A;  1KHC A;  2GFU A;  3MO8 A;  4IUT A;  3CCJ A;  3S3M A;  3QUI A;  1ZQ1 A;  4C8Q G;  2L3R A;  4XQ3 A;  2IG0 A;  5GAN 3;  3NTK A;  2ZGW A;  4LD6 A;  3VUB A;  3CCV T;  4F7U B;  1BKB A;  1N9S A;  1VQ7 A;  5CKH A;  3MEW A;  2QQS A;  5A2Q E;  2DIQ A;  2LQK A;  2EFI A;  2XHC A;  4JJN K;  3V8K A;  3GNF B;  4IUV A;  1VQM A;  2O4X A;  3AHU A;  3CD6 A;  2DIG A;  3RES A;  1MGQ A;  4XTU A;  4LDX A;  1O75 A;  1OI1 A;  1VQP T;  1M90 U;  3ME9 A;  4BAC A;  2V8I A;  3JCM d;  1SSF A;  3E9G A;  3P8B B;  2QEX A;  3J7A F;  4KUD K;  2YLC A;  3QBY A;  3TCJ A;  1N6A A;  5A0G A;  3OYM A;  5CAI A;  4M78 C;  3MEA A;  4C0Z A;  5J26 A;  1Q81 C;  1WPY A;  3JB9 F;  2JNG A;  4BDY A;  3JSC A;  3LH0 A;  2HBP A;  4JRI A;  2DD4 A;  2MF2 A;  3ZFJ A;  1PSF A;  2QA4 A;  1NPR A;  1VQO T;  4PJO E;  4PJO B;  3PMI A;  3OYB A;  3P8D A;  3VV0 A;  1JBM A;  5M9O A;  4M7D G;  2JN0 A;  3GF5 A;  3UDC A;  1KC8 U;  4MMK A;  4M7D D;  4M7A D;  1VQP A;  2WSF E;  4J6X A;  1YJN A;  3LYI A;  3CBO A;  4GLK A;  5LJ5 d;  1EIF A;  1YCY A;  4E7I A;  4E7K A;  4OB0 B;  3JRZ A;  3VYG A;  3I55 T;  1Q82 C;  3M56 A;  4N0A C;  3CPW A;  1N8R C;  4R55 A;  3FRN A;  3FEO A;  2KY9 A;  2K57 A;  3H6Z A;  2GF7 A;  4GY5 A;  4NL2 A;  1BIB A;  4J5Y A;  5FRO A;  2XDD A;  1Q7Y C;  4JS4 A;  4JS5 A;  4A54 A;  4N4G A;  4QVZ A;  3RKX A;  2K5I A;  4M77 F;  2EQK A;  3OYD A;  2X4X A;  2MWO A;  2YHT A;  5GMK h;  1YJ9 T;  4XU3 A;  5DLO A;  3V7S A;  3V8L A;  2RM4 A;  2LCL A;  4M75 E;  5I2M A;  2EAY A;  4IUP A;  3DKM A;  4M77 B;  4KUI A;  3ER0 A;  3HP9 A;  4A4H A;  5LJ3 g;  3OS0 A;  3G6E A;  3GP8 A;  3C12 A;  3KBG A;  1OYX A;  1YIT A;  5CK9 A;  1ZHI A;  2L8D A;  1H64 1;  5CIU A;  5IT9 E;  4C92 G;  5GAN d;  3OYH A;  4XTZ A;  3JCM b;  4M7A B;  3TRE A;  4C8Q D;  2LTO A;  1D3B B;  1YJW T;  1JRI A;  3QZ5 B;  1BI3 A;  3Q1J A;  2E65 A;  4A53 A;  4X9C A;  3JCM f;  4EPC A;  3QJ6 A;  4EMH A;  4M75 F;  3ZEH A;  5EG2 A;  3VJP A;  4ZTJ A;  1Q82 U;  3CC4 T;  3E1S A;  5LJ3 h;  2M0O A;  1K73 U;  2GCX A;  1NJI U;  2CZ1 B;  2RHX A;  2MAM A;  3MP1 A;  4OB3 B;  3OYC A;  3GIB A;  1LJO A;  4FM4 B;  2LDM A;  2A3L A;  2E10 A;  5A0L A;  3PIP A;  1M1G A;  5HY6 A;  2QEX T;  4XTX A;  3CBM A;  4M75 A;  5J39 A;  1YJW A;  2MWP A;  1NPP A;  1V29 B;  2RHY A;  1I8F A;  1VIE A;  3OB9 A;  2JTM A;  2HNI A;  2V8K A;  3CC7 T;  4M7D F;  3CCE A;  1VQ6 A;  4R56 A;  2DTH A;  4ME7 A;  4PL6 A;  3S6W A;  4E7H A;  4E7L A;  4MML A;  3CMA A;  1VQM T;  2Y90 A;  2RI3 A;  5CQY A;  1YIJ A;  4M78 B;  1PSE A;  4M77 G;  3JCM J;  4M78 G;  3I55 A;  3G4S T;  2RJD A;  1VQ8 T;  4N4I A;  2X35 A;  2VXF A;  3M59 A;  3RMQ A;  3LX7 A;  4ZGE B;  3CCL T;  1QP3 A;  5A0D A;  2DO3 A;  5CKF A;  4FT2 A;  5HK0 A;  5GAN 4;  1YJN T;  3QHS A;  1YHQ T;  3JAM E;  2LT4 A;  3FIF A;  3CME A;  4D6W A;  2H3J A;  2EQJ A;  4M7D E;  3NFC A;  4F7U E;  3VKI A;  4LDY A;  3OA6 A;  1UEB A;  2AHJ B;  3M57 A;  4J7F A;  5GAN j;  3M9Q A;  2VV5 A;  5LJ5 j;  1M4Z A;  2K2V A;  1QVG A;  4NOY A;  4OGC A;  3OYN A;  3P8H A;  5GMK j;  1G3T A;  5FU7 B;  4NL3 A;  3CMA T;  4XTY A;  2LRQ A;  3CC4 A;  2XD0 A;  3MEU A;  3WVE B;  1G3S A;  2D9T A;  2DZ9 A;  1WNL A;  2EQM A;  4O6J A;  2DEQ A;  3OY9 A;  3CC7 A;  1KD1 U;  4IUU A;  2XDP A;  3JCM W;  2BUD A;  4RCB A;  1Q81 U;  4OP0 A;  2DZC A;  3HPW A;  3V8J A;  3JB9 J;  4J6Y A;  1WJR A;  2QQA A;  2JVV A;  2QQB A;  2QDY B;  1VUB A;  2VGN A;  1OZ3 A;  2X4W A;  3N5B B;  5DM7 R;  4M78 D;  3VUZ A;  3NTH A;  4M77 D;  4C92 E;  5GAO m;  2YRV A;  1H3Z A;  2DTI A;  3SDZ A;  3M4G A;  4CI0 C;  4MZM A;  1Y71 A;  1G3W A;  3TEE A;  3EFS A;  4EMK C;  3UWN A;  4ZN3 A;  3OQ5 A;  3CC2 A;  5GAM h;  3UT1 A;  4PLL A;  3I56 T;  2JTF A;  3DLL A;  2DXU A;  2VGM A;  4OMF B;  3JCM c;  3PMT A;  5GMK l;  1DJ7 B;  2FHD A;  3QZ9 B;  3X28 B;  3C94 A;  3JCM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...