1VA7A

Yeast myo3 sh3 domain, triclinic crystal form
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
b'DPKFEAAYDFPGSGSSSELPLKKGDIVFISRDEPSGWSLAKLLDGSKEGWVPTAYMTPYKDTRNTVPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin-3 isoform
publication title High-throughput structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 12
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1va7A01
2RQVA 1M27C 2L2PA 1AWWA 2YSQA 1VYTA 1GRIA 2DRMA 3UF4A 1NYFA 2OJ2A 1X27A 3PVLA 4JPBW 2J05A 4LN2A 3REAB 3I5SA 2K6DA 1BU1A 2V1RA 2DNUA 2CT4A 3CQTA 3M0PA 4OMLA 2LX7A 2CH4W 4RTXA 3REBB 1M30A 3VS3A 4LUEA 1KIKA 3VS4A 2RF0A 2DRKA 1QKWA 2K79A 1I07A 3NMZC 1Z9QA 1VYUA 4AFUC 2AKLA 2EYWA 1YCSB 2GBQA 3NHNA 3SEMA 2F2WA 2YDLA 1UHFA 1UG1A 2NUZA 2ABLA 2JMAA 3H0FA 4GBQA 2FEIA 5IXFA 3IQLA 1M8MA 1WX6A 1GCPA 3M0TA 2FRYA 1HD3A 3EG1A 2DBMA 3UA7A 1UHCA 1JXMA 1WXBA 2YUOA 4J9GA 2DM1A 1K9AA 2CREA 2EGCA 4AFSC 1PRMC 2P4RA 2KT8A 1BBZA 4J9BA 1VYVA 1S1NA 1AD5A 2HDAA 2FPFA 2KYMA 2AKKA 1AWJA 1T0JA 2X3XD 4F17A 3RBBB 4J9IA 1GBRA 2ROLA 2VVKA 2OAWA 2DVJA 4RTTA 1I0CA 1UE9A 1RLPC 2DX1A 2A08A 2K9GA 1WXTA 3I5RA 1MV3A 4RTZA 2EVRA 3M0UA 3LH5A 1T0HA 2EYXA 1M3CA 1N5ZA 1SRMA 3VRYA 2KRNA 1ABOA 1RI9A 2DJQA 2PNIA 2GNCA 2JT4A 1QKXA 1QWFA 2LCSA 5L23A 2QDLA 2D0NA 3PVQA 2KE9A 3KFVA 1AVZC 2EPDA 1NYGA 1B3QA 2L3QA 1X2QA 1B07A 5IHIA 1NM7A 1JEGA 1X6GA 1T3SA 1NEBA 2BZYA 1X6BA 4JJBA 4KRTA 1WA7A 2DMOA 1NEGA 1E7OA 1ARKA 4K11A 1UTIA 2LP5A 4FSSA 3GBQA 3THKA 2NWMA 1UDLA 1SHFA 1AOJA 1UFFA 1WI7A 2EBPA 4HVUA 4GLMA 2MOXA 3ZL7C 3M0SA 3PE0A 2F2VA 2J7IA 1E6HA 2RQUA 2CUBA 1RUWA 1PWTA 2KRMA 2PZ1A 1ZLMA 1X69A 2KGTA 2IIMA 2SRCA 3EG3A 1AWXA 2O2OA 2KBTA 1T3LA 1PNJA 4X1VA 4ZNXA 1G2BA 1SRLA 2H8HA 1G83A 1TUCA 1OV3A 2DLPA 1YP5A 4AFZC 2EGEA 2GTJA 3VS6A 3EG0A 3H0HA 4R0KA 1YN8A 2JS0A 2DL4A 2JS2A 2DL3A 2W0ZA 2HSPA 4D8DA 3EG2A 5IH2A 4J9HA 4CC3A 1UUEA 3VS2A 1K4US 1GCQA 1OPLA 2AK5A 1GFCA 1OPKA 2LMJA 1K0SA 1MV0B 1UECA 2KXCA 1GBQA 4J9DA 4AFQC 2EYZA 2JM9A 1OEBA 2KXDA 2KEAA 4DEXA 2KR3A 2W10A 4QT7A 1JQQA 1K1ZA 3TSWA 4JZ4A 3A98A 3UATA 4F16A 1WFWA 1ABQA 1WIEA 1BB9A 2JW4A 2A28A 1FMKA 2DILA 1J3TA 1HJDA 2YUPA 2HCKA 2J6FA 2RNAA 2A36A 1Y57A 3O5ZA 3R6NA 4IIMA 2RQTA 1WYXA 3RNJA 4D8KA 1Z9ZA 2KRSA 2C0OA 1SEMA 2O9SA 2EGAA 4RTUA 3TSZA 3QWXX 1CKBA 4OMOA 2ENMA 1W70A 2ROTA 2RMOA 3EHRA 1NLOC 4OMNA 2EYYA 4RTWA 1X43A 1ZBJA 1CKAA 2J6KA 3C0CA 2D8HA 3VS5A 1XOVA 1UGVA 2B86A 1H3HA 2FG0A 1WDXA 1M3BA 2AZSA 2DBKA 2JM8A 2PTKA 4J9EA 1KJWA 1SSHA 2RQWA 4A63B 3TVTA 2O88A 1TG0A 2GTOA 3U23A 5I11A 2L0AA 3JV3A 1ZSGA 1ZUKA 3ULRB 4HVWA 1ZUUA 4AG1C 2MIOA 1K0XA 2V1QA 1K76A 5FWBA 4OMMA 3H0IA 2MCNA 3VS0A 2RPNA 4Z89A 2DA9A 1V1CA 1AZGB 1U06A 1PKTA 2JXBA 3EHQA 2DL8A 2RN8A 1U3OA 1OOTA 2E5KA 1KFZA 1U5SA 5IHKA 2OI3A 2ECZA 2JTEA 1KSWA 1NG2A 1RLQC 2KROA 3NPFA 4CC4B 2X3WD 2LJ3A 1SPKA 1GFDA 2EW3A 3H41A 2DF6A 4RTVA 2LQNA 2K3BA 3EGUA 1A0NB 2DL5A 1YWOA 1AWOA 2FO0A 2RQRA 4CC7A 5IHNA 4EIKA 4Z8AA 2GGRA 1VA7A 2O9VA 5I22A 2YUNA 4JJDA 2FPEA 1QLYA 2LNHB 2GQIA 2J06A 1JXOA 1ZUYA 2G6FX 2XMFA 2D1XA 4AG2C 2AZVA 2FRWA 1GL5A 4J9FA 2YT6A 2CDTA 1UJ0A 2A37A 4ORZA 2HBWA 2O31A 2KNBB 2EQIA 1H92A 4Z88A 2BTTA 2BZ8A 2FPDA 1MUZA 3FJ5A 2LJ1A 1JU5C 2CUDA 5IXBA 2CH4A 4LUDA 3UA6A 1LCKA 5GJVB 2LQWA 4OMQA 4J9CA 2KYBA 1SHGA 1E6GA 4CC2A 1M3AA 1FYNA 5FWCA 1WXUA 4ESRA 1NLPC 4HXJA 3I9QA 1QWEA 4HVVA 1X2KA 3M0QA 2JMCA 1AZEA 2M0YA 1UJYA 1GCQC 2M51A 1BK2A 2L3SA 3NGPA 1PHTA 4LE9A 5GJWB 2DYBA 1EFNA 1I1JA 2HEQA 4WCIA 2K2MA 1PRLC 2ED1A 2D8JA 1AEYA 5EC7A 1CSKA 5HCKA 1W6XA 2YUQA 4HCKA 2I0NA 2EKHA 5FW9A 3VS1A 2VWFA 1JO8A 4RUGA 3M0RA 3VRZA 2CSIA 2SEMA 2C0IA 5ECAA 4IIOA 3I35A 1Y0MA 1TUDA 1PKSA 2C0TA 1IO6A 2CT3A 4JJCA 2F2XA 1HSQA 4E6RA 2K7AA 3SHWA 1WLPB 2VKNA 2BZXA 2DE0X 4F14A 2J6OA 2KT1A 4OMPA 4M4ZA 2L3PA 2LZ6B 1YWPA 2ESWA 4LNPA 4RTYA 4Y92A 3VS7A 2DL7A 1W1FA 2LJ0A 1QCFA 4JZ3A 1ZX6A 4DEYA 2ED0A 2CSQA 3QWYA 1H8KA 1YNZA
chains in the Genus database with same CATH superfamily
4XTUA 1WHHA 2RQVA 2DO3A 2L2PA 1AWWA 2QA4A 2OJ2A 4EDUA 4RCCA 4M7DG 3JCMf 2EFIA 3CQTA 4RTXA 2DNUA 4OMLA 4C8QA 2LX7A 2YLBA 2XHCA 1M90U 4M78B 2JJ9A 3PNWC 1KIKA 3CXCA 2VUBA 3H6ZA 4XU0A 4OF1A 3OBWA 1Z9QA 3L2QA 1OQKA 2EYWA 3JCMW 4FT2A 3QHSA 4M7DB 1UHFA 2E1HA 3CCMQ 4NS5A 3JB9G 1UEBA 1VQMT 3H0FA 3HRSA 4M78C 2FEIA 2DYIA 2CKKA 3BDLA 1YJNT 2OTJA 1GCPA 1EX4A 1BCMA 2IG0A 2FRYA 2YXYA 3EFSA 1VQPQ 1QVFS 2DBMA 1WXBA 3OYKA 4PLIA 2YUOA 1YI2A 1NBEB 2DXTA 2JNGA 3E1SA 4M7DC 2A0FB 2EGCA 1VQ8Q 1RAIB 3SB2A 5LJ3d 1OX9A 3UPUA 2BE9B 3LX7A 1S1NA 3FB9A 4X34A 2FPFA 5A0DA 2KYMA 4E47A 2H3JA 1M1KR 1AWJA 2LCLA 1YHQA 4RTTA 4LDVA 1NJIU 2OTLQ 1I0CA 1QW1A 1UE9A 5DM7R 2PU9B 3QPHA 4ZGEB 5J26A 3MP6A 1MV3A 5GAN7 4ZGJB 2FB7A 3L42A 3LH5A 3VRYA 4FYWB 2QQBA 5D6YA 4IURA 3CCUQ 4LD9K 1FXXA 2EPDA 3JCMg 4FYXB 1BIBA 1WJRA 5CIUA 4QW2A 2K4YA 1B3QA 2L3QA 1X2QA 2L5QA 4BI4A 5KYXB 3EFOB 5A2QE 1PG5B 2CGHA 5LJ3j 1LPLA 2EIFA 1T3SA 1KHIA 1X6BA 4BDYA 1PD1A 1E7OA 4J8OA 2B8AA 2D9TA 1UTIA 2MPXC 4FIBA 1X01A 4KT0E 1UFFA 3OYYA 3OYMA 3G71T 2EBPA 4GLMA 3M0SA 3DLMA 1UGQB 3J81E 2QGFB 1WHMA 2RA2A 1RUWA 1X6OA 1Q82U 4XTVA 1T3LA 4X1VA 3G4ST 1IREB 3QIIA 5GMKe 2OTJQ 1OV3A 4J6WA 4E2FB 2ZPHB 1YP5A 4IUUA 2ZPEB 2JS0A 2JS2A 1W4SA 3EG2A 2RJDA 4VUBA 5IH2A 3RUXA 3P8DA 2ZPIB 1K4US 1YI2Q 1GCQA 2AK5A 2DKGA 1VQKT 5FU7B 1OPKA 2LMJA 1JRIA 3PMIA 3V7SA 2KXCA 2QEXT 1H3ZA 2BIVA 4J9DA 2EYZA 1RABB 1VQ5T 2KXDA 3RMQA 2HZYA 2KEAA 5CCAA 5GMKl 4MMLA 2W10A 1VQ9Q 1JQQA 1K1ZA 1KQ1A 3ASKA 1K73C 3S3NA 3CCLT 3QDRB 5CKFA 5FU7C 2YHTA 3LH0A 3CXCS 1WIEA 1WQ7A 1J3TA 1HJDA 3CC2Q 3JCMc 4AT1B 4XQ3A 4N0AA 1IB8A 4QQGA 4M75G 4XAXB 1OU9A 2MYSA 3MEUA 3RNJA 3UDCA 4NL2A 3BDUA 2O9SA 3G71A 3RR6A 1V76A 1VQNA 2HKNA 2L8DA 4X9CA 1NLOC 2VGNA 4OMNA 4C8QE 5LJ5d 1ZBJA 2GCXA 2MF2A 3C0CA 3G4SA 1TH7A 1XOVA 3VU3C 4BI3A 5DY9A 3I55T 2DBKA 2AZSA 5GANd 3EFOA 2HQXA 3FDRA 2L0AA 1IRXA 4EMKB 4LDXA 1ZUKA 3CPWP 3OB9A 1VQKA 1ZUUA 2LT4A 2QTVA 2FL7A 2QEXA 4IUPA 4OMMA 2VV5A 1I5LA 1VQ5A 2JXBA 3PIOA 5KYNA 3X25B 4EMKC 1U5SA 3CCLA 1Q7YC 1GXIE 1YIJT 2OI3A 3KBGA 2WSEE 2JTEA 1KSWA 1F1BB 1NG2A 2PQWA 1I4K1 1VOMA 3FLGA 5LJ5j 1RAEB 4DQ2A 1SSFA 2QXFA 2K3BA 2LCCA 3A5ZB 5GANj 2FO0A 5FLXE 3JAME 1SF9A 4EIKA 2RHIA 4M77D 5FRNA 4JJDA 2V8IA 3EG9A 1P92A 1C6VX 4KH0B 5GAMd 2QAZA 2FYKA 2AZVA 3I55A 4C5HA 2A37A 3G71Q 1TU0B 1WPYA 1H92A 2KK4A 1VQNQ 2DTHA 3META 4MZPA 4MMKA 3INZA 5CQXA 1OYXA 2XDBA 3BW1A 5GAOm 2CH4A 3ZFJA 4E7SA 2RB6A 1KD1R 2KY9A 1LCKA 4OMQA 4J9CA 4FM4B 4CC2A 4JS5A 4KULA 4ESRA 3CPWA 2XIDA 4F7UG 1QVFP 1QWEA 1TSFA 4M75A 2DD4A 2M0YA 4M77F 5GMKh 3DB3A 4XU1A 5GJWB 5GAMj 1EFNA 5KYUA 1VQ5Q 2ZPBB 2LVMA 4PJMA 2ED1A 2QK0A 2D8JA 1AEYA 4A4HA 5CK9A 3CCQA 1D3BB 4F7UB 4HCKA 1B34A 1RACB 4FYYB 1Q86C 4MDWA 2EKHA 3VS1A 1M2OA 2X4WA 3CCVT 2SEMA 2ZAEA 1D1BA 2NUPA 2CP6A 4BE1A 4QQ6A 3JCMJ 1PSFA 1TUDA 1Y0MA 1OZ2A 1IO6A 4WTOB 2E41A 1VQLA 3ZEHA 4E7JA 3NTIA 3L1AA 2EQKA 1WHLA 3OYEA 3LW5E 1OI1A 3D7SB 2J6OA 4A54A 4PJOG 2LZ6B 1YWPA 5GAN2 2ESWA 4JDSA 4RTYA 3P8HA 2QYZA 1IHWA 1B7TA 3VS7A 2DL7A 2LJ0A 1QCFA 3CCET 7AT1B 3A8HB 5GAMf 2ED0A 3H9NA 1H8KA 3OS1A 1UGPB 1YNZA 3JCMb 4PJOB 1ZSZB 2YSQA 1VYTA 3M56A 2DZCA 1K9MC 1Q86R 1I8FA 4V2SA 2XDPA 2DXCA 3PVLA 4LN2A 4XTXA 3M0PA 2CT4A 3I56Q 3EGDB 4ZTFA 4LUEA 1QVFA 5KCHA 3CMAA 1YJ9Q 5CKBA 2DRKA 4PJOC 5GMKj 1ZSZC 1QKWA 4PL6A 2MWPA 1M2VB 4PNOA 3VUBA 3NMZC 3C94A 1VYUA 2AKLA 5EG2A 1VQOQ 2GBQA 3NHNA 3LYIA 3QZ9B 2F2WA 3CCVA 5KYYA 2NUZA 1EIFA 2ABLA 1V29B 4YTLA 2FZCB 5IXFA 3IQLA 3CC4T 1Y71A 3FIFA 3CCQQ 2EJGA 4M7AD 3EH1A 4J9GA 3SFMA 2NUTA 1K9AA 2DIQA 1UGRB 2CREA 4BB7A 1IGUA 3CMEA 4J9BA 1VYVA 5FRMA 1K9MR 4LD6A 1LOJA 2AKKA 1T0JA 3CCEA 1VQLQ 4F17A 2ROLA 4ELZC 1XNIA 1MMNA 3OYHA 2I2LA 4JLIA 3CPWS 4M7AE 3M4GA 2VXFA 3RKYA 4DOWA 2EVRA 3L2VA 3M0UA 1WHKA 3V8KA 1SRMA 2KRNA 1ABOA 2GFAA 1RI9A 2KQWA 1YBYA 1RAAB 4QVCA 3QBYA 2V26A 2HL5C 2RO0A 3X20B 3PVQA 3KXTA 2GF7A 2KE9A 1K8AR 4FU6A 4M7AF 1HYOA 1B07A 1WJSA 5IHIA 2HL3A 6AT1B 1NEBA 4JJBA 4KRTA 1WA7A 3CCJT 3CCST 3OW2P 2LP5A 2ATCB 4FSSA 3T9NA 4PJOA 4FYVB 4M75E 2R5AA 1VIFA 3CMAQ 2MOXA 4OB1B 3PE0A 1E6HA 2HBPA 2R58A 3A8MB 1ZLMA 3ZBDA 3CCVQ 2IIMA 2X51A 4A53A 1M1KC 2KBTA 2DJZA 4ZNXA 3QO3A 3UWNA 2KVQG 4BUGA 2GTJA 3H0HA 4R0KA 2COYA 2W0ZA 4D8DA 4M77B 3CC7T 4DBHA 3TCJA 1NE8A 4J9HA 1S72A 3VS2A 1OPLA 3C4SA 3CMEQ 1K0SA 1GBQA 2M0OA 3M4YA 4C0DB 4AFQC 2JM9A 2PVGB 4J7IA 3CCEQ 4M77C 4BDZA 4QT7A 1KC8C 1K73U 1ZQ1A 1RAHB 2ZPFB 3TSWA 4JZ4A 5GAOn 4OGCA 2VYTA 2DTOA 5CKEA 1R77A 4IUQA 3ME9A 1WFWA 1ABQA 2QI2A 4C92A 2A28A 4C0DC 5J3BA 2LQKA 1YITQ 2DIGA 3V7CA 2KDSA 3CCJA 1FWZA 3NTKA 4D8KA 3RERA 2KRSA 2P0QA 1VQ7T 2EGAA 4RTUA 3S6WA 2LQ8A 3DLLA 4BACA 2RMOA 3VUZA 3LWIA 4PJJA 3OW2A 1X43A 1Q81C 2J6KA 3OYAA 2Y4XA 3VS5A 1UGVA 1M3BA 2JM8A 2PTKA 2QASA 4HCBA 1KJWA 1SSHA 2RQWA 4A4GA 3CC7A 4A63B 3TVTA 1KC8R 3U23A 5I11A 4XU3A 1D0XA 3GLXA 3EGXA 3ULRB 1R0CB 2AT1B 4AG1C 2QA4Q 1K0XA 4PLLA 1VQMA 2FVUA 2RPNA 2PVDB 2E12A 1V1CA 1U06A 2DAQA 1YJNA 3EHQA 2LTOA 3HFNA 1U3OA 2E5KA 1Q7YU 1UGSB 2CZ1B 2RJFA 2K3XA 4IUVA 2EAYA 1S72Q 2OX7A 4D6WA 2ECZA 2BE7D 2KROA 3E9FA 4BD3A 1IGQA 4M78A 4CC4B 4N4GA 2GFUA 1SPKA 2CP3A 3H41A 4E7IA 4RTVA 1Q81R 3QUIA 3OYDA 1AWOA 2L89A 2DETA 2RQRA 4HKEA 3G6ET 5IHNA 1VQ7A 2JVVA 2GGRA 1VA7A 4M7DA 2O9VA 3HHTB 3M55A 2FPEA 1QLYA 4PKCC 3NTHA 4QKUA 2GQIA 1NPRA 3X26B 2J06A 5CO7A 4A4EA 8AT1B 3JCMX 2QG9B 3V7RA 2DD5A 3QYHB 3BE3A 3RDVA 1YHQQ 5A0LA 2KNBB 2EQIA 4C5EA 5LL6S 3QJYA 4C8QD 2FPDA 2MMPA 4OVAA 1ZHIA 4PK4A 1BIAA 1WQWA 5FU6B 2JN0A 2XU8A 3OS0A 1IXDA 4M7AB 1SHGA 3EAEA 4EPCA 2RHUA 1FYNA 1MNDA 2LRQA 4DBRA 4RMOA 1Y96B 1NLPC 2XD0A 4JUVA 4HXJA 2BUDA 1X2KA 5D6XA 2JMCA 1AZEA 1G8XA 2L3SA 3S3OA 1PHTA 5FU6C 3LWHA 4M7AC 2K5IA 1VQMQ 3V8LA 1KHCA 4WCIA 2K2MA 4LDWA 2MWOA 4C92D 1PRLC 1YJNQ 2D0QB 5GAN3 3OMCA 5KYXA 1W6XA 1M90R 3OBYA 3G6EA 2HNIA 2COZA 2I0NA 1W2BA 3M58A 4RCBA 2VWFA 4C8QF 3L2RA 3M0RA 2CSIA 1YJWT 3PT9A 2C0IA 3MEVA 3I35A 3OW2S 1PKSA 5DLQE 1TOVA 2F2XA 4DA4A 3L2UA 4C92E 1VQ7Q 2DE0X 2F1LA 5GAN6 1WGSA 1KG1A 2KT1A 2L3PA 2ZPGB 3HRTA 2EKOA 2FZKB 3RKXA 3CEYA 1FMWA 1KD1C 1BCOA 5I2SA 1KQSP 1M1FA 4JZ3A 2K57A 4ZGDB 2CSQA 1JBMA 1N27A 2LC4A 1ACMB 1QCNA 3GPLA 1K9MU 1NJIR 1GRIA 2DRMA 3UF4A 2LDMA 1NYFA 4PJNA 1QVGP 4JPBW 1Q82C 4KGZB 4XTWA 3REAB 3LLRA 5KYWB 2K6DA 2V1RA 1ZA2B 4B9WA 3VS3A 2CH4W 2VB6A 4OGEA 3VS4A 4M78D 2E70A 3M9QA 1I07A 2ZGWA 3OS2A 2A3LA 4LDYA 3SEMA 1UG1A 1YJWA 2JMAA 2OAUA 4GBQA 3PIPA 4M7DD 4JRPA 3G4SQ 3QJ6A 3OSSC 3A8OB 3EFRA 3PFSA 3MEAA 1HD3A 5CKHA 3EG1A 1R0BG 3UA7A 1JXMA 2MAMA 4M78E 4R55A 5CR2A 1YIJA 2KI7A 4AFSC 1PRMC 2KT8A 1VQKQ 1WHJA 2RI3A 3HPWA 4EMGA 2QEXQ 2E10A 3JB9D 1Q82R 3BFMA 2HKQB 4M7DE 4HA8A 3N5BB 1GBRA 2OAWA 2RHYA 4EMKA 2R57A 4M78F 3RKWA 4Y28E 5HK0A 3CCLQ 4OP0A 1RLPC 4QVDA 1KQSA 3LGFA 2A08A 2CP0A 2RHXA 3A8GB 1T0HA 2EYXA 1M3CA 2QDYB 3SWNB 1WJQA 2DJQA 4OB0B 4FCYA 1I5OB 1MGQA 2RK2A 2GNCA 2JT4A 5L23A 2D0NA 5LJ3e 3KFVA 4KUDK 1AVZC 1FX7A 2WACA 1NYGA 1QVGA 8ATCB 1XQHA 4PFOA 5GAOl 1X6GA 1W2BS 2DTIA 2BZYA 3SWNC 4BY6B 2DMOA 1NEGA 4P5NA 1ARKA 3JB9F 3I55Q 3THKA 1RADB 2NWMA 4MZMA 2V8JA 1SHFA 1AOJA 4R56A 1WI7A 1O9SA 4HVUA 4KBMB 4KGXB 2JUFA 3OYJA 5IAYA 2J7IA 2CUBA 3R6OA 5KYWA 2KRMA 4BY6C 1M1KU 3CCMT 2PZ1A 1X69A 2KGTA 2SRCA 2O4XB 3EG3A 1YJWQ 1FMVA 5CAIA 1SRLA 1TUCA 3MPUB 3P8BB 4L5GA 3VS6A 1VQPT 3OYBA 2P0PA 4AMCA 1YN8A 1Q95G 2WSCE 1X75C 2K5FA 4JRQA 2DL3A 1TTHB 2XICA 5GAOp 1UUEA 4JLGA 1YIJQ 3MP8A 1VQ8T 4ME7A 4RKUE 1GFCA 1MV0B 1N6AA 4XTZA 2P4TA 5GAOr 1OEBA 3VYHB 1KC8U 1M5Q1 4C5IA 4DEXA 5GAOq 2KR3A 2ZZDA 2X4YA 1K8AC 2OTLT 3V8JA 4KH1B 4C8QB 3UATA 4ATOA 2K5LA 5GAN4 2ZCFB 2JW4A 1N9SA 2CS7A 3OA6A 2DILA 1TXQA 2YUPA 2HCKA 3VYGA 2J6FA 2X4XA 3GNFB 2M02A 2RNAA 4XTYA 3CCUT 3HKSA 1D3BA 4F7UA 1N8RC 1M1GA 3A8LB 2RQTA 4C8QC 1WYXA 4J5YA 1YFNA 3MJXA 3WXMB 2RI5A 2WSFE 3TSZA 1CKBA 4OMOA 4IKFA 3VKIA 4BI8B 2CZ7B 1Q81U 2COWA 4RTWA 3JB9J 3A1PA 4PFPA 4C0FA 4IUTA 1H3HA 4M75D 2FG0A 4J6YA 4MZTA 5FROA 1VQPA 2AIRB 2E4HA 3OYLA 2DEUA 2O88A 1TG0A 4BE0A 1PM3A 2YLCA 1LNXA 1Y7XA 3JV3A 1QCOA 3FC3A 4WF2A 1VQ8A 4HVWA 1U1TA 3RMSA 3JCMP 1KQSS 3TEEA 1K76A 4HT8A 5FWBA 3FEOA 3M5AA 2RHZA 1QVPA 3H0IA 4C5GA 2M9UA 2MCNA 3VS0A 4Z89A 1AZGB 1LJOA 2AHJB 3NFCA 3J80E 4DBQA 3CC4A 1ZSZA 1N8RR 2DL8A 2EJ9A 2K2VA 1OOTA 5LJ5e 3OYFA 4JJNK 4M77G 1PSEA 1RLQC 4ZN3A 5GMKi 4BE2A 2DXBA 1QVGS 2QGGA 3NPFA 3LGLA 3EGDA 5GANe 2X4JA 2X3WD 2JZ2A 1NZ9A 2LJ3A 1GFDA 2PUKB 2DF6A 1TUGB 2LQNA 3CCUA 1VQ9T 4M75F 1M2VA 2DL5A 4RG8A 1YWOA 2E5QA 5CQYA 4ZTJA 4CC7A 2NYSA 4Z8AA 5I22A 3F70A 3CC2T 2D6FA 1DJ7B 4A4KA 4A4FA 3G1JA 1RL2A 1LVKA 3FRNA 2G6FX 2XMFA 5LJ3h 2CDTA 1SKUB 1UJ0A 1PC0A 4PJLA 3JB9H 2HBWA 1G3TA 5D7UA 4E7LA 2RI2A 2DXUA 2E6NA 4FSXA 2VASA 4C0GA 1ZBXA 2BTTA 2BZ8A 1MUZA 3FJ5A 2LJ1A 4DBFA 2R5MA 3UT1A 1WZOA 1BI3A 5KE2A 3TQ7P 1WNLA 3SDZA 4E7HA 2FHDA 3CCSA 3WVEB 2KYBA 3TREA 1E6GA 4DOVA 1KK7A 5FWCA 1TWBA 5GAMe 2F5KA 3M0QA 1UJYA 1GCQC 1BK2A 2V8KA 4Z02A 2DYBA 3PMTA 1I1JA 2HEQA 4KGVB 3E9GA 4PFZA 1VQ9A 3CPFA 3CC4Q 5KCOA 1PCXA 2E6ZA 3OQ5A 2YUQA 4J83A 2CP2A 1U8RA 2E3IA 3MO8A 3CBPA 1JO8A 3CC2A 1O75A 3OS5A 5ECAA 4IIOA 4B6MA 4N0AC 1D0ZA 1HXDA 1G5VA 4E6RA 2LNVA 2K7AA 1MMAA 3SHWA 3M57A 2P0KA 1RAFB 5GMKm 3OYGA 1VUBA 4OMPA 3MCAB 3CCRT 1KD1U 4F7UE 3OYNA 4Y92A 1W2BP 5I21A 1I81A 3OYCA 1W1FA 4M77A 3L2ZA 3GIBA 1G3SA 3E19A 2DVEA 2RD1A 4LXCA 3DB4A 1VQNT 4FT4A 1NPPA 3WVDB 2M16A 4QQDA 1M27C 4HCZA 4F7UF 1WHGA 4CRIA 3GP8A 4PJOD 1X27A 2EYQA 4X9DA 2J05A 2YRCA 3I5SA 1BU1A 2IPOB 1RI0A 3CCJQ 2MI6A 2Y90A 3REBB 3CCSQ 1M30A 1M90C 4M7AG 1AT1B 2RF0A 3O8VA 4II1A 3RIRA 3JCMQ 2K79A 4UC4A 4AFUC 5KE3A 1JJ2S 5DLOA 3BY7A 5IN1A 1YCSB 3C12A 2YDLA 3QKJA 3PTAA 4QVZA 4HT9A 4LDUA 4PJOE 1MMGA 5LJ5h 3MP1A 2CP7A 3EG9B 5LJ3f 1M8MA 1MHNA 1WX6A 2KAFA 2HMAA 3CBOA 3M0TA 3HL8A 2X9HA 1UHCA 3CC7Q 5GANh 1MNEA 2DM1A 2O01E 1U1SA 4ELYC 4OMFB 4Q5WA 2P4RA 3HFOA 3CCRA 1M8VA 1BBZA 4PJOF 1BYMA 1AD5A 2HDAA 5M9OA 2HAXA 2PUOB 1D09B 2F69A 3X28B 2X3XD 4F04B 3RBBB 4J9IA 4KUIA 2VVKA 2DVJA 3JCMe 5HKCA 4HCCA 1G3WA 1YCYA 1Q86U 1NJIC 1EZZB 2DX1A 4GY5A 2K9GA 1WXTA 3I5RA 4RTZA 1D0YA 1C1AA 4M75B 4NL3A 1N5ZA 3MEWA 2PNIA 1QKXA 1QWFA 2LCSA 5KYUB 2QDLA 5IT9E 2CYZB 2DK3A 3GF5A 3JCMV 1K73R 3JRZA 2LT1A 3SD4A 1PD0A 2RJEA 1NM7A 1JEGA 1AHJB 4M75C 3S3MA 4J7FA 1G3YA 1B34B 2XK0A 3I56T 4K11A 1M9SA 2NUPB 5GAMh 3GBQA 1YJ9T 1UDLA 4C92F 3CD6T 1VQ6T 1R8OB 3M59A 5LJ3g 2HD0A 2XI9A 3ZL7C 1VQOT 2QQRA 3URGA 2F2VA 2RQUA 1PWTA 2QQSA 2XDDA 2G3RA 1AWXA 2O2OA 1PNJA 1G2BA 2H8HA 1G83A 2DZ9A 1KQ2A 2DLPA 5CKDA 2EWNA 2EGEA 4AFZC 3CCQT 3EG0A 3AT1B 4ZN1A 2DL4A 2HSPA 3HP9A 5GAN8 4CC3A 2E64A 4N4HA 2XG8D 2MK5A 5HK3A 3CCRQ 2KMTA 1UECA 1BI2A 4M7AA 1OULA 2PVOB 3PGGA 4EMHA 1Y96A 5I2MA 1VQLT 5A0GA 1K8AU 1MMDA 2K3YA 2JTFA 5D6WA 3HRUA 3A98A 3DKMA 5GAN5 3G6EQ 4FW2A 4F16A 3L2WA 2EQMA 1HK9A 1Q7YR 1OX8A 1BB9A 1ZA1B 1JB0E 2DPPB 1FMKA 2F5TX 2VXEA 4M77E 4JS4A 1OU8A 1BKBA 2EJFA 1SG5A 2FZGB 1N8RU 1C0MA 5L8RE 5LJ5f 3I56A 5KH6A 2A36A 5KYYB 1Y57A 3O5ZA 3R6NA 4IIMA 2DFUA 2YRVA 2JOYA 1YJ9A 4JRIA 1Z9ZA 2CZ0B 2L3RA 2RK1A 2C0OA 1H641 1SEMA 3CD6A 1VQ6A 3M53A 3QWXX 2DEQA 1IHVA 5GANf 2ENMA 3GOXA 3Q1JA 1VQOA 1W70A 2ROTA 4FL6A 3EHRA 2Y4YA 3HSBA 1QP3A 4O5VA 2EYYA 2NUTB 2HSEB 1CKAA 1UB4A 2D8HA 4M7DF 2B86A 1QQJA 1WDXA 3CMAT 4J9EA 4O6JA 2VC8A 1VQ4T 2GTOA 1IZ6A 2EQJA 1BI0A 3ER0A 4N4IA 1RAGB 1ZSGA 1QMCA 3E2UA 2MIOA 3JSCA 2V1QA 3M54A 1N9RA 2DA9A 2NLUA 5CVIA 1PKTA 4L59A 2RN8A 4JRKA 1KFZA 2IVWA 5IHKA 3CMET 4J6XA 4XU2A 2C06A 4CI0C 2JTMA 3MHXA 2RJCA 3RESA 1VIEA 2LX9A 3EH2A 3KUFA 3JCMh 2EW3A 2X35A 4GLKA 2VGMA 2EQUA 3EGUA 1M4ZA 1A0NB 3QG1A 1OZ3A 2QTXA 4XK8E 5LJ5g 2YRDA 4C8QG 3QDFA 2YUNA 5AT1B 3X24B 1YITT 2M1HA 2LNHB 4C0ZA 2H3EB 1JXOA 1ZUYA 5GANg 2D1XA 5C0MA 4AG2C 2FRWA 3JB9I 1GL5A 4J9FA 2YT6A 1BI1A 2HQEA 2RM4A 3OMGA 4OB3B 4ORZA 2O31A 4OB2B 4B9XA 3QYGB 3CD6Q 1VQ6Q 1VQ4A 2KSSA 3J7AF 1XTDA 3G7ZA 4Z88A 5J39A 1JJ2P 3JCMd 1JU5C 2CUDA 2BKDN 3QZ5B 5IXBA 4LUDA 3UA6A 4C92G 5GJVB 2LQWA 1D1AA 2P84A 3GNGA 2CZ6B 1M3AA 2Z0WA 1WXUA 3I9QA 1QP2A 4HVVA 3CBMA 2HQHA 5HY6A 3CXCP 2QA4T 2M51A 3SWNA 1TS9A 3AHUA 3NGPA 2GQVA 2QQAA 5C6SA 4LE9A 3CCMA 4C92B 3VV0A 2CP5A 3H8ZA 9ATCB 2DERA 3HTRA 4FW1A 5AYFA 5EC7A 1CSKA 5HCKA 4ANJA 1S72T 2QQ9A 3OY9A 3C95A 5GAMg 4E7KA 5FW9A 2E3HA 3FJPA 4RUGA 1YITA 4Y91A 3VRZA 4C92C 4NOYA 1XJWB 3QSUA 2OTJT 2C0TA 4E7ZA 4JJCA 2CT3A 1HSQA 1WLPB 2VKNA 4MDXA 2BZXA 2OTLA 2A7YA 3QXEB 1YI2T 2O4XA 4TVRA 4F14A 3VJPA 4M4ZA 4L6V5 3TU4K 4LNPA 3EGXB 1Y07A 2RH2A 1ZX6A 1YHQT 2XKOC 4DEYA 4M78G 1D1CA 3MKDA 2YWWA 3OYIA 3QWYA 3OSVA 2E65A 4RG2A 1JJ2A 1VQ4Q
chains in the Genus database with same CATH topology
2RQVA 1M27C 2L2PA 1AWWA 2YSQA 1VYTA 1GRIA 2DRMA 3UF4A 1NYFA 2OJ2A 1X27A 3PVLA 4JPBW 2J05A 4LN2A 3REAB 3I5SA 2K6DA 1BU1A 2V1RA 2DNUA 2CT4A 3CQTA 3M0PA 4OMLA 2LX7A 2CH4W 4RTXA 3REBB 1M30A 3VS3A 4LUEA 1KIKA 3VS4A 2RF0A 2DRKA 1QKWA 2K79A 1I07A 3NMZC 1Z9QA 1VYUA 4AFUC 2AKLA 2EYWA 1YCSB 2GBQA 3NHNA 3SEMA 2F2WA 2YDLA 1UHFA 1UG1A 2NUZA 2ABLA 2JMAA 3H0FA 4GBQA 2FEIA 5IXFA 3IQLA 1M8MA 1WX6A 1GCPA 3M0TA 2FRYA 1HD3A 3EG1A 2DBMA 3UA7A 1UHCA 1JXMA 1WXBA 2YUOA 4J9GA 2DM1A 1K9AA 2CREA 2EGCA 4AFSC 1PRMC 2P4RA 2KT8A 1BBZA 4J9BA 1VYVA 1S1NA 1AD5A 2HDAA 2FPFA 2KYMA 2AKKA 1AWJA 1T0JA 2X3XD 4F17A 3RBBB 4J9IA 1GBRA 2ROLA 2VVKA 2OAWA 2DVJA 4RTTA 1I0CA 1UE9A 1RLPC 2DX1A 2A08A 2K9GA 1WXTA 3I5RA 1MV3A 4RTZA 2EVRA 3M0UA 3LH5A 1T0HA 2EYXA 1M3CA 1N5ZA 1SRMA 3VRYA 2KRNA 1ABOA 1RI9A 2DJQA 2PNIA 2GNCA 2JT4A 1QKXA 1QWFA 2LCSA 5L23A 2QDLA 2D0NA 3PVQA 2KE9A 3KFVA 1AVZC 2EPDA 1NYGA 1B3QA 2L3QA 1X2QA 1B07A 5IHIA 1NM7A 1JEGA 1X6GA 1T3SA 1NEBA 2BZYA 1X6BA 4JJBA 4KRTA 1WA7A 2DMOA 1NEGA 1E7OA 1ARKA 4K11A 1UTIA 2LP5A 4FSSA 3GBQA 3THKA 2NWMA 1UDLA 1SHFA 1AOJA 1UFFA 1WI7A 2EBPA 4HVUA 4GLMA 2MOXA 3ZL7C 3M0SA 3PE0A 2F2VA 2J7IA 1E6HA 2RQUA 2CUBA 1RUWA 1PWTA 2KRMA 2PZ1A 1ZLMA 1X69A 2KGTA 2IIMA 2SRCA 3EG3A 1AWXA 2O2OA 2KBTA 1T3LA 1PNJA 4X1VA 4ZNXA 1G2BA 1SRLA 2H8HA 1G83A 1TUCA 1OV3A 2DLPA 1YP5A 4AFZC 2EGEA 2GTJA 3VS6A 3EG0A 3H0HA 4R0KA 1YN8A 2JS0A 2DL4A 2JS2A 2DL3A 2W0ZA 2HSPA 4D8DA 3EG2A 5IH2A 4J9HA 4CC3A 1UUEA 3VS2A 1K4US 1GCQA 1OPLA 2AK5A 1GFCA 1OPKA 2LMJA 1K0SA 1MV0B 1UECA 2KXCA 1GBQA 4J9DA 4AFQC 2EYZA 2JM9A 1OEBA 2KXDA 2KEAA 4DEXA 2KR3A 2W10A 4QT7A 1JQQA 1K1ZA 3TSWA 4JZ4A 3A98A 3UATA 4F16A 1WFWA 1ABQA 1WIEA 1BB9A 2JW4A 2A28A 1FMKA 2DILA 1J3TA 1HJDA 2YUPA 2HCKA 2J6FA 2RNAA 2A36A 1Y57A 3O5ZA 3R6NA 4IIMA 2RQTA 1WYXA 3RNJA 4D8KA 1Z9ZA 2KRSA 2C0OA 1SEMA 2O9SA 2EGAA 4RTUA 3TSZA 3QWXX 1CKBA 4OMOA 2ENMA 1W70A 2ROTA 2RMOA 3EHRA 1NLOC 4OMNA 2EYYA 4RTWA 1X43A 1ZBJA 1CKAA 2J6KA 3C0CA 2D8HA 3VS5A 1XOVA 1UGVA 2B86A 1H3HA 2FG0A 1WDXA 1M3BA 2AZSA 2DBKA 2JM8A 2PTKA 4J9EA 1KJWA 1SSHA 2RQWA 4A63B 3TVTA 2O88A 1TG0A 2GTOA 3U23A 5I11A 2L0AA 3JV3A 1ZSGA 1ZUKA 3ULRB 4HVWA 1ZUUA 4AG1C 2MIOA 1K0XA 2V1QA 1K76A 5FWBA 4OMMA 3H0IA 2MCNA 3VS0A 2RPNA 4Z89A 2DA9A 1V1CA 1AZGB 1U06A 1PKTA 2JXBA 3EHQA 2DL8A 2RN8A 1U3OA 1OOTA 2E5KA 1KFZA 1U5SA 5IHKA 2OI3A 2ECZA 2JTEA 1KSWA 1NG2A 1RLQC 2KROA 3NPFA 4CC4B 2X3WD 2LJ3A 1SPKA 1GFDA 2EW3A 3H41A 2DF6A 4RTVA 2LQNA 2K3BA 3EGUA 1A0NB 2DL5A 1YWOA 1AWOA 2FO0A 2RQRA 4CC7A 5IHNA 4EIKA 4Z8AA 2GGRA 1VA7A 2O9VA 5I22A 2YUNA 4JJDA 2FPEA 1QLYA 2LNHB 2GQIA 2J06A 1JXOA 1ZUYA 2G6FX 2XMFA 2D1XA 4AG2C 2AZVA 2FRWA 1GL5A 4J9FA 2YT6A 2CDTA 1UJ0A 2A37A 4ORZA 2HBWA 2O31A 2KNBB 2EQIA 1H92A 4Z88A 2BTTA 2BZ8A 2FPDA 1MUZA 3FJ5A 2LJ1A 1JU5C 2CUDA 5IXBA 2CH4A 4LUDA 3UA6A 1LCKA 5GJVB 2LQWA 4OMQA 4J9CA 2KYBA 1SHGA 1E6GA 4CC2A 1M3AA 1FYNA 5FWCA 1WXUA 4ESRA 1NLPC 4HXJA 3I9QA 1QWEA 4HVVA 1X2KA 3M0QA 2JMCA 1AZEA 2M0YA 1UJYA 1GCQC 2M51A 1BK2A 2L3SA 3NGPA 1PHTA 4LE9A 5GJWB 2DYBA 1EFNA 1I1JA 2HEQA 4WCIA 2K2MA 1PRLC 2ED1A 2D8JA 1AEYA 5EC7A 1CSKA 5HCKA 1W6XA 2YUQA 4HCKA 2I0NA 2EKHA 5FW9A 3VS1A 2VWFA 1JO8A 4RUGA 3M0RA 3VRZA 2CSIA 2SEMA 2C0IA 5ECAA 4IIOA 3I35A 1Y0MA 1TUDA 1PKSA 2C0TA 1IO6A 2CT3A 4JJCA 2F2XA 1HSQA 4E6RA 2K7AA 3SHWA 1WLPB 2VKNA 2BZXA 2DE0X 4F14A 2J6OA 2KT1A 4OMPA 4M4ZA 2L3PA 2LZ6B 1YWPA 2ESWA 4LNPA 4RTYA 4Y92A 3VS7A 2DL7A 1W1FA 2LJ0A 1QCFA 4JZ3A 1ZX6A 4DEYA 2ED0A 2CSQA 3QWYA 1H8KA 1YNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQV A;  1M27 C;  2L2P A;  1AWW A;  2YSQ A;  1VYT A;  1GRI A;  2DRM A;  3UF4 A;  1NYF A;  2OJ2 A;  1X27 A;  3PVL A;  4JPB W;  2J05 A;  4LN2 A;  3REA B;  3I5S A;  2K6D A;  1BU1 A;  2V1R A;  2DNU A;  2CT4 A;  3CQT A;  3M0P A;  4OML A;  2LX7 A;  2CH4 W;  4RTX A;  3REB B;  1M30 A;  3VS3 A;  4LUE A;  1KIK A;  3VS4 A;  2RF0 A;  2DRK A;  1QKW A;  2K79 A;  1I07 A;  3NMZ C;  1Z9Q A;  1VYU A;  4AFU C;  2AKL A;  2EYW A;  1YCS B;  2GBQ A;  3NHN A;  3SEM A;  2F2W A;  2YDL A;  1UHF A;  1UG1 A;  2NUZ A;  2ABL A;  2JMA A;  3H0F A;  4GBQ A;  2FEI A;  5IXF A;  3IQL A;  1M8M A;  1WX6 A;  1GCP A;  3M0T A;  2FRY A;  1HD3 A;  3EG1 A;  2DBM A;  3UA7 A;  1UHC A;  1JXM A;  1WXB A;  2YUO A;  4J9G A;  2DM1 A;  1K9A A;  2CRE A;  2EGC A;  4AFS C;  1PRM C;  2P4R A;  2KT8 A;  1BBZ A;  4J9B A;  1VYV A;  1S1N A;  1AD5 A;  2HDA A;  2FPF A;  2KYM A;  2AKK A;  1AWJ A;  1T0J A;  2X3X D;  4F17 A;  3RBB B;  4J9I A;  1GBR A;  2ROL A;  2VVK A;  2OAW A;  2DVJ A;  4RTT A;  1I0C A;  1UE9 A;  1RLP C;  2DX1 A;  2A08 A;  2K9G A;  1WXT A;  3I5R A;  1MV3 A;  4RTZ A;  2EVR A;  3M0U A;  3LH5 A;  1T0H A;  2EYX A;  1M3C A;  1N5Z A;  1SRM A;  3VRY A;  2KRN A;  1ABO A;  1RI9 A;  2DJQ A;  2PNI A;  2GNC A;  2JT4 A;  1QKX A;  1QWF A;  2LCS A;  5L23 A;  2QDL A;  2D0N A;  3PVQ A;  2KE9 A;  3KFV A;  1AVZ C;  2EPD A;  1NYG A;  1B3Q A;  2L3Q A;  1X2Q A;  1B07 A;  5IHI A;  1NM7 A;  1JEG A;  1X6G A;  1T3S A;  1NEB A;  2BZY A;  1X6B A;  4JJB A;  4KRT A;  1WA7 A;  2DMO A;  1NEG A;  1E7O A;  1ARK A;  4K11 A;  1UTI A;  2LP5 A;  4FSS A;  3GBQ A;  3THK A;  2NWM A;  1UDL A;  1SHF A;  1AOJ A;  1UFF A;  1WI7 A;  2EBP A;  4HVU A;  4GLM A;  2MOX A;  3ZL7 C;  3M0S A;  3PE0 A;  2F2V A;  2J7I A;  1E6H A;  2RQU A;  2CUB A;  1RUW A;  1PWT A;  2KRM A;  2PZ1 A;  1ZLM A;  1X69 A;  2KGT A;  2IIM A;  2SRC A;  3EG3 A;  1AWX A;  2O2O A;  2KBT A;  1T3L A;  1PNJ A;  4X1V A;  4ZNX A;  1G2B A;  1SRL A;  2H8H A;  1G83 A;  1TUC A;  1OV3 A;  2DLP A;  1YP5 A;  4AFZ C;  2EGE A;  2GTJ A;  3VS6 A;  3EG0 A;  3H0H A;  4R0K A;  1YN8 A;  2JS0 A;  2DL4 A;  2JS2 A;  2DL3 A;  2W0Z A;  2HSP A;  4D8D A;  3EG2 A;  5IH2 A;  4J9H A;  4CC3 A;  1UUE A;  3VS2 A;  1K4U S;  1GCQ A;  1OPL A;  2AK5 A;  1GFC A;  1OPK A;  2LMJ A;  1K0S A;  1MV0 B;  1UEC A;  2KXC A;  1GBQ A;  4J9D A;  4AFQ C;  2EYZ A;  2JM9 A;  1OEB A;  2KXD A;  2KEA A;  4DEX A;  2KR3 A;  2W10 A;  4QT7 A;  1JQQ A;  1K1Z A;  3TSW A;  4JZ4 A;  3A98 A;  3UAT A;  4F16 A;  1WFW A;  1ABQ A;  1WIE A;  1BB9 A;  2JW4 A;  2A28 A;  1FMK A;  2DIL A;  1J3T A;  1HJD A;  2YUP A;  2HCK A;  2J6F A;  2RNA A;  2A36 A;  1Y57 A;  3O5Z A;  3R6N A;  4IIM A;  2RQT A;  1WYX A;  3RNJ A;  4D8K A;  1Z9Z A;  2KRS A;  2C0O A;  1SEM A;  2O9S A;  2EGA A;  4RTU A;  3TSZ A;  3QWX X;  1CKB A;  4OMO A;  2ENM A;  1W70 A;  2ROT A;  2RMO A;  3EHR A;  1NLO C;  4OMN A;  2EYY A;  4RTW A;  1X43 A;  1ZBJ A;  1CKA A;  2J6K A;  3C0C A;  2D8H A;  3VS5 A;  1XOV A;  1UGV A;  2B86 A;  1H3H A;  2FG0 A;  1WDX A;  1M3B A;  2AZS A;  2DBK A;  2JM8 A;  2PTK A;  4J9E A;  1KJW A;  1SSH A;  2RQW A;  4A63 B;  3TVT A;  2O88 A;  1TG0 A;  2GTO A;  3U23 A;  5I11 A;  2L0A A;  3JV3 A;  1ZSG A;  1ZUK A;  3ULR B;  4HVW A;  1ZUU A;  4AG1 C;  2MIO A;  1K0X A;  2V1Q A;  1K76 A;  5FWB A;  4OMM A;  3H0I A;  2MCN A;  3VS0 A;  2RPN A;  4Z89 A;  2DA9 A;  1V1C A;  1AZG B;  1U06 A;  1PKT A;  2JXB A;  3EHQ A;  2DL8 A;  2RN8 A;  1U3O A;  1OOT A;  2E5K A;  1KFZ A;  1U5S A;  5IHK A;  2OI3 A;  2ECZ A;  2JTE A;  1KSW A;  1NG2 A;  1RLQ C;  2KRO A;  3NPF A;  4CC4 B;  2X3W D;  2LJ3 A;  1SPK A;  1GFD A;  2EW3 A;  3H41 A;  2DF6 A;  4RTV A;  2LQN A;  2K3B A;  3EGU A;  1A0N B;  2DL5 A;  1YWO A;  1AWO A;  2FO0 A;  2RQR A;  4CC7 A;  5IHN A;  4EIK A;  4Z8A A;  2GGR A;  1VA7 A;  2O9V A;  5I22 A;  2YUN A;  4JJD A;  2FPE A;  1QLY A;  2LNH B;  2GQI A;  2J06 A;  1JXO A;  1ZUY A;  2G6F X;  2XMF A;  2D1X A;  4AG2 C;  2AZV A;  2FRW A;  1GL5 A;  4J9F A;  2YT6 A;  2CDT A;  1UJ0 A;  2A37 A;  4ORZ A;  2HBW A;  2O31 A;  2KNB B;  2EQI A;  1H92 A;  4Z88 A;  2BTT A;  2BZ8 A;  2FPD A;  1MUZ A;  3FJ5 A;  2LJ1 A;  1JU5 C;  2CUD A;  5IXB A;  2CH4 A;  4LUD A;  3UA6 A;  1LCK A;  5GJV B;  2LQW A;  4OMQ A;  4J9C A;  2KYB A;  1SHG A;  1E6G A;  4CC2 A;  1M3A A;  1FYN A;  5FWC A;  1WXU A;  4ESR A;  1NLP C;  4HXJ A;  3I9Q A;  1QWE A;  4HVV A;  1X2K A;  3M0Q A;  2JMC A;  1AZE A;  2M0Y A;  1UJY A;  1GCQ C;  2M51 A;  1BK2 A;  2L3S A;  3NGP A;  1PHT A;  4LE9 A;  5GJW B;  2DYB A;  1EFN A;  1I1J A;  2HEQ A;  4WCI A;  2K2M A;  1PRL C;  2ED1 A;  2D8J A;  1AEY A;  5EC7 A;  1CSK A;  5HCK A;  1W6X A;  2YUQ A;  4HCK A;  2I0N A;  2EKH A;  5FW9 A;  3VS1 A;  2VWF A;  1JO8 A;  4RUG A;  3M0R A;  3VRZ A;  2CSI A;  2SEM A;  2C0I A;  5ECA A;  4IIO A;  3I35 A;  1Y0M A;  1TUD A;  1PKS A;  2C0T A;  1IO6 A;  2CT3 A;  4JJC A;  2F2X A;  1HSQ A;  4E6R A;  2K7A A;  3SHW A;  1WLP B;  2VKN A;  2BZX A;  2DE0 X;  4F14 A;  2J6O A;  2KT1 A;  4OMP A;  4M4Z A;  2L3P A;  2LZ6 B;  1YWP A;  2ESW A;  4LNP A;  4RTY A;  4Y92 A;  3VS7 A;  2DL7 A;  1W1F A;  2LJ0 A;  1QCF A;  4JZ3 A;  1ZX6 A;  4DEY A;  2ED0 A;  2CSQ A;  3QWY A;  1H8K A;  1YNZ A; 
#chains in the Genus database with same CATH topology
 4XTU A;  1WHH A;  2RQV A;  2DO3 A;  2L2P A;  1AWW A;  2QA4 A;  2OJ2 A;  4EDU A;  4RCC A;  4M7D G;  3JCM f;  2EFI A;  3CQT A;  4RTX A;  2DNU A;  4OML A;  4C8Q A;  2LX7 A;  2YLB A;  2XHC A;  1M90 U;  4M78 B;  2JJ9 A;  3PNW C;  1KIK A;  3CXC A;  2VUB A;  3H6Z A;  4XU0 A;  4OF1 A;  3OBW A;  1Z9Q A;  3L2Q A;  1OQK A;  2EYW A;  3JCM W;  4FT2 A;  3QHS A;  4M7D B;  1UHF A;  2E1H A;  3CCM Q;  4NS5 A;  3JB9 G;  1UEB A;  1VQM T;  3H0F A;  3HRS A;  4M78 C;  2FEI A;  2DYI A;  2CKK A;  3BDL A;  1YJN T;  2OTJ A;  1GCP A;  1EX4 A;  1BCM A;  2IG0 A;  2FRY A;  2YXY A;  3EFS A;  1VQP Q;  1QVF S;  2DBM A;  1WXB A;  3OYK A;  4PLI A;  2YUO A;  1YI2 A;  1NBE B;  2DXT A;  2JNG A;  3E1S A;  4M7D C;  2A0F B;  2EGC A;  1VQ8 Q;  1RAI B;  3SB2 A;  5LJ3 d;  1OX9 A;  3UPU A;  2BE9 B;  3LX7 A;  1S1N A;  3FB9 A;  4X34 A;  2FPF A;  5A0D A;  2KYM A;  4E47 A;  2H3J A;  1M1K R;  1AWJ A;  2LCL A;  1YHQ A;  4RTT A;  4LDV A;  1NJI U;  2OTL Q;  1I0C A;  1QW1 A;  1UE9 A;  5DM7 R;  2PU9 B;  3QPH A;  4ZGE B;  5J26 A;  3MP6 A;  1MV3 A;  5GAN 7;  4ZGJ B;  2FB7 A;  3L42 A;  3LH5 A;  3VRY A;  4FYW B;  2QQB A;  5D6Y A;  4IUR A;  3CCU Q;  4LD9 K;  1FXX A;  2EPD A;  3JCM g;  4FYX B;  1BIB A;  1WJR A;  5CIU A;  4QW2 A;  2K4Y A;  1B3Q A;  2L3Q A;  1X2Q A;  2L5Q A;  4BI4 A;  5KYX B;  3EFO B;  5A2Q E;  1PG5 B;  2CGH A;  5LJ3 j;  1LPL A;  2EIF A;  1T3S A;  1KHI A;  1X6B A;  4BDY A;  1PD1 A;  1E7O A;  4J8O A;  2B8A A;  2D9T A;  1UTI A;  2MPX C;  4FIB A;  1X01 A;  4KT0 E;  1UFF A;  3OYY A;  3OYM A;  3G71 T;  2EBP A;  4GLM A;  3M0S A;  3DLM A;  1UGQ B;  3J81 E;  2QGF B;  1WHM A;  2RA2 A;  1RUW A;  1X6O A;  1Q82 U;  4XTV A;  1T3L A;  4X1V A;  3G4S T;  1IRE B;  3QII A;  5GMK e;  2OTJ Q;  1OV3 A;  4J6W A;  4E2F B;  2ZPH B;  1YP5 A;  4IUU A;  2ZPE B;  2JS0 A;  2JS2 A;  1W4S A;  3EG2 A;  2RJD A;  4VUB A;  5IH2 A;  3RUX A;  3P8D A;  2ZPI B;  1K4U S;  1YI2 Q;  1GCQ A;  2AK5 A;  2DKG A;  1VQK T;  5FU7 B;  1OPK A;  2LMJ A;  1JRI A;  3PMI A;  3V7S A;  2KXC A;  2QEX T;  1H3Z A;  2BIV A;  4J9D A;  2EYZ A;  1RAB B;  1VQ5 T;  2KXD A;  3RMQ A;  2HZY A;  2KEA A;  5CCA A;  5GMK l;  4MML A;  2W10 A;  1VQ9 Q;  1JQQ A;  1K1Z A;  1KQ1 A;  3ASK A;  1K73 C;  3S3N A;  3CCL T;  3QDR B;  5CKF A;  5FU7 C;  2YHT A;  3LH0 A;  3CXC S;  1WIE A;  1WQ7 A;  1J3T A;  1HJD A;  3CC2 Q;  3JCM c;  4AT1 B;  4XQ3 A;  4N0A A;  1IB8 A;  4QQG A;  4M75 G;  4XAX B;  1OU9 A;  2MYS A;  3MEU A;  3RNJ A;  3UDC A;  4NL2 A;  3BDU A;  2O9S A;  3G71 A;  3RR6 A;  1V76 A;  1VQN A;  2HKN A;  2L8D A;  4X9C A;  1NLO C;  2VGN A;  4OMN A;  4C8Q E;  5LJ5 d;  1ZBJ A;  2GCX A;  2MF2 A;  3C0C A;  3G4S A;  1TH7 A;  1XOV A;  3VU3 C;  4BI3 A;  5DY9 A;  3I55 T;  2DBK A;  2AZS A;  5GAN d;  3EFO A;  2HQX A;  3FDR A;  2L0A A;  1IRX A;  4EMK B;  4LDX A;  1ZUK A;  3CPW P;  3OB9 A;  1VQK A;  1ZUU A;  2LT4 A;  2QTV A;  2FL7 A;  2QEX A;  4IUP A;  4OMM A;  2VV5 A;  1I5L A;  1VQ5 A;  2JXB A;  3PIO A;  5KYN A;  3X25 B;  4EMK C;  1U5S A;  3CCL A;  1Q7Y C;  1GXI E;  1YIJ T;  2OI3 A;  3KBG A;  2WSE E;  2JTE A;  1KSW A;  1F1B B;  1NG2 A;  2PQW A;  1I4K 1;  1VOM A;  3FLG A;  5LJ5 j;  1RAE B;  4DQ2 A;  1SSF A;  2QXF A;  2K3B A;  2LCC A;  3A5Z B;  5GAN j;  2FO0 A;  5FLX E;  3JAM E;  1SF9 A;  4EIK A;  2RHI A;  4M77 D;  5FRN A;  4JJD A;  2V8I A;  3EG9 A;  1P92 A;  1C6V X;  4KH0 B;  5GAM d;  2QAZ A;  2FYK A;  2AZV A;  3I55 A;  4C5H A;  2A37 A;  3G71 Q;  1TU0 B;  1WPY A;  1H92 A;  2KK4 A;  1VQN Q;  2DTH A;  3MET A;  4MZP A;  4MMK A;  3INZ A;  5CQX A;  1OYX A;  2XDB A;  3BW1 A;  5GAO m;  2CH4 A;  3ZFJ A;  4E7S A;  2RB6 A;  1KD1 R;  2KY9 A;  1LCK A;  4OMQ A;  4J9C A;  4FM4 B;  4CC2 A;  4JS5 A;  4KUL A;  4ESR A;  3CPW A;  2XID A;  4F7U G;  1QVF P;  1QWE A;  1TSF A;  4M75 A;  2DD4 A;  2M0Y A;  4M77 F;  5GMK h;  3DB3 A;  4XU1 A;  5GJW B;  5GAM j;  1EFN A;  5KYU A;  1VQ5 Q;  2ZPB B;  2LVM A;  4PJM A;  2ED1 A;  2QK0 A;  2D8J A;  1AEY A;  4A4H A;  5CK9 A;  3CCQ A;  1D3B B;  4F7U B;  4HCK A;  1B34 A;  1RAC B;  4FYY B;  1Q86 C;  4MDW A;  2EKH A;  3VS1 A;  1M2O A;  2X4W A;  3CCV T;  2SEM A;  2ZAE A;  1D1B A;  2NUP A;  2CP6 A;  4BE1 A;  4QQ6 A;  3JCM J;  1PSF A;  1TUD A;  1Y0M A;  1OZ2 A;  1IO6 A;  4WTO B;  2E41 A;  1VQL A;  3ZEH A;  4E7J A;  3NTI A;  3L1A A;  2EQK A;  1WHL A;  3OYE A;  3LW5 E;  1OI1 A;  3D7S B;  2J6O A;  4A54 A;  4PJO G;  2LZ6 B;  1YWP A;  5GAN 2;  2ESW A;  4JDS A;  4RTY A;  3P8H A;  2QYZ A;  1IHW A;  1B7T A;  3VS7 A;  2DL7 A;  2LJ0 A;  1QCF A;  3CCE T;  7AT1 B;  3A8H B;  5GAM f;  2ED0 A;  3H9N A;  1H8K A;  3OS1 A;  1UGP B;  1YNZ A;  3JCM b;  4PJO B;  1ZSZ B;  2YSQ A;  1VYT A;  3M56 A;  2DZC A;  1K9M C;  1Q86 R;  1I8F A;  4V2S A;  2XDP A;  2DXC A;  3PVL A;  4LN2 A;  4XTX A;  3M0P A;  2CT4 A;  3I56 Q;  3EGD B;  4ZTF A;  4LUE A;  1QVF A;  5KCH A;  3CMA A;  1YJ9 Q;  5CKB A;  2DRK A;  4PJO C;  5GMK j;  1ZSZ C;  1QKW A;  4PL6 A;  2MWP A;  1M2V B;  4PNO A;  3VUB A;  3NMZ C;  3C94 A;  1VYU A;  2AKL A;  5EG2 A;  1VQO Q;  2GBQ A;  3NHN A;  3LYI A;  3QZ9 B;  2F2W A;  3CCV A;  5KYY A;  2NUZ A;  1EIF A;  2ABL A;  1V29 B;  4YTL A;  2FZC B;  5IXF A;  3IQL A;  3CC4 T;  1Y71 A;  3FIF A;  3CCQ Q;  2EJG A;  4M7A D;  3EH1 A;  4J9G A;  3SFM A;  2NUT A;  1K9A A;  2DIQ A;  1UGR B;  2CRE A;  4BB7 A;  1IGU A;  3CME A;  4J9B A;  1VYV A;  5FRM A;  1K9M R;  4LD6 A;  1LOJ A;  2AKK A;  1T0J A;  3CCE A;  1VQL Q;  4F17 A;  2ROL A;  4ELZ C;  1XNI A;  1MMN A;  3OYH A;  2I2L A;  4JLI A;  3CPW S;  4M7A E;  3M4G A;  2VXF A;  3RKY A;  4DOW A;  2EVR A;  3L2V A;  3M0U A;  1WHK A;  3V8K A;  1SRM A;  2KRN A;  1ABO A;  2GFA A;  1RI9 A;  2KQW A;  1YBY A;  1RAA B;  4QVC A;  3QBY A;  2V26 A;  2HL5 C;  2RO0 A;  3X20 B;  3PVQ A;  3KXT A;  2GF7 A;  2KE9 A;  1K8A R;  4FU6 A;  4M7A F;  1HYO A;  1B07 A;  1WJS A;  5IHI A;  2HL3 A;  6AT1 B;  1NEB A;  4JJB A;  4KRT A;  1WA7 A;  3CCJ T;  3CCS T;  3OW2 P;  2LP5 A;  2ATC B;  4FSS A;  3T9N A;  4PJO A;  4FYV B;  4M75 E;  2R5A A;  1VIF A;  3CMA Q;  2MOX A;  4OB1 B;  3PE0 A;  1E6H A;  2HBP A;  2R58 A;  3A8M B;  1ZLM A;  3ZBD A;  3CCV Q;  2IIM A;  2X51 A;  4A53 A;  1M1K C;  2KBT A;  2DJZ A;  4ZNX A;  3QO3 A;  3UWN A;  2KVQ G;  4BUG A;  2GTJ A;  3H0H A;  4R0K A;  2COY A;  2W0Z A;  4D8D A;  4M77 B;  3CC7 T;  4DBH A;  3TCJ A;  1NE8 A;  4J9H A;  1S72 A;  3VS2 A;  1OPL A;  3C4S A;  3CME Q;  1K0S A;  1GBQ A;  2M0O A;  3M4Y A;  4C0D B;  4AFQ C;  2JM9 A;  2PVG B;  4J7I A;  3CCE Q;  4M77 C;  4BDZ A;  4QT7 A;  1KC8 C;  1K73 U;  1ZQ1 A;  1RAH B;  2ZPF B;  3TSW A;  4JZ4 A;  5GAO n;  4OGC A;  2VYT A;  2DTO A;  5CKE A;  1R77 A;  4IUQ A;  3ME9 A;  1WFW A;  1ABQ A;  2QI2 A;  4C92 A;  2A28 A;  4C0D C;  5J3B A;  2LQK A;  1YIT Q;  2DIG A;  3V7C A;  2KDS A;  3CCJ A;  1FWZ A;  3NTK A;  4D8K A;  3RER A;  2KRS A;  2P0Q A;  1VQ7 T;  2EGA A;  4RTU A;  3S6W A;  2LQ8 A;  3DLL A;  4BAC A;  2RMO A;  3VUZ A;  3LWI A;  4PJJ A;  3OW2 A;  1X43 A;  1Q81 C;  2J6K A;  3OYA A;  2Y4X A;  3VS5 A;  1UGV A;  1M3B A;  2JM8 A;  2PTK A;  2QAS A;  4HCB A;  1KJW A;  1SSH A;  2RQW A;  4A4G A;  3CC7 A;  4A63 B;  3TVT A;  1KC8 R;  3U23 A;  5I11 A;  4XU3 A;  1D0X A;  3GLX A;  3EGX A;  3ULR B;  1R0C B;  2AT1 B;  4AG1 C;  2QA4 Q;  1K0X A;  4PLL A;  1VQM A;  2FVU A;  2RPN A;  2PVD B;  2E12 A;  1V1C A;  1U06 A;  2DAQ A;  1YJN A;  3EHQ A;  2LTO A;  3HFN A;  1U3O A;  2E5K A;  1Q7Y U;  1UGS B;  2CZ1 B;  2RJF A;  2K3X A;  4IUV A;  2EAY A;  1S72 Q;  2OX7 A;  4D6W A;  2ECZ A;  2BE7 D;  2KRO A;  3E9F A;  4BD3 A;  1IGQ A;  4M78 A;  4CC4 B;  4N4G A;  2GFU A;  1SPK A;  2CP3 A;  3H41 A;  4E7I A;  4RTV A;  1Q81 R;  3QUI A;  3OYD A;  1AWO A;  2L89 A;  2DET A;  2RQR A;  4HKE A;  3G6E T;  5IHN A;  1VQ7 A;  2JVV A;  2GGR A;  1VA7 A;  4M7D A;  2O9V A;  3HHT B;  3M55 A;  2FPE A;  1QLY A;  4PKC C;  3NTH A;  4QKU A;  2GQI A;  1NPR A;  3X26 B;  2J06 A;  5CO7 A;  4A4E A;  8AT1 B;  3JCM X;  2QG9 B;  3V7R A;  2DD5 A;  3QYH B;  3BE3 A;  3RDV A;  1YHQ Q;  5A0L A;  2KNB B;  2EQI A;  4C5E A;  5LL6 S;  3QJY A;  4C8Q D;  2FPD A;  2MMP A;  4OVA A;  1ZHI A;  4PK4 A;  1BIA A;  1WQW A;  5FU6 B;  2JN0 A;  2XU8 A;  3OS0 A;  1IXD A;  4M7A B;  1SHG A;  3EAE A;  4EPC A;  2RHU A;  1FYN A;  1MND A;  2LRQ A;  4DBR A;  4RMO A;  1Y96 B;  1NLP C;  2XD0 A;  4JUV A;  4HXJ A;  2BUD A;  1X2K A;  5D6X A;  2JMC A;  1AZE A;  1G8X A;  2L3S A;  3S3O A;  1PHT A;  5FU6 C;  3LWH A;  4M7A C;  2K5I A;  1VQM Q;  3V8L A;  1KHC A;  4WCI A;  2K2M A;  4LDW A;  2MWO A;  4C92 D;  1PRL C;  1YJN Q;  2D0Q B;  5GAN 3;  3OMC A;  5KYX A;  1W6X A;  1M90 R;  3OBY A;  3G6E A;  2HNI A;  2COZ A;  2I0N A;  1W2B A;  3M58 A;  4RCB A;  2VWF A;  4C8Q F;  3L2R A;  3M0R A;  2CSI A;  1YJW T;  3PT9 A;  2C0I A;  3MEV A;  3I35 A;  3OW2 S;  1PKS A;  5DLQ E;  1TOV A;  2F2X A;  4DA4 A;  3L2U A;  4C92 E;  1VQ7 Q;  2DE0 X;  2F1L A;  5GAN 6;  1WGS A;  1KG1 A;  2KT1 A;  2L3P A;  2ZPG B;  3HRT A;  2EKO A;  2FZK B;  3RKX A;  3CEY A;  1FMW A;  1KD1 C;  1BCO A;  5I2S A;  1KQS P;  1M1F A;  4JZ3 A;  2K57 A;  4ZGD B;  2CSQ A;  1JBM A;  1N27 A;  2LC4 A;  1ACM B;  1QCN A;  3GPL A;  1K9M U;  1NJI R;  1GRI A;  2DRM A;  3UF4 A;  2LDM A;  1NYF A;  4PJN A;  1QVG P;  4JPB W;  1Q82 C;  4KGZ B;  4XTW A;  3REA B;  3LLR A;  5KYW B;  2K6D A;  2V1R A;  1ZA2 B;  4B9W A;  3VS3 A;  2CH4 W;  2VB6 A;  4OGE A;  3VS4 A;  4M78 D;  2E70 A;  3M9Q A;  1I07 A;  2ZGW A;  3OS2 A;  2A3L A;  4LDY A;  3SEM A;  1UG1 A;  1YJW A;  2JMA A;  2OAU A;  4GBQ A;  3PIP A;  4M7D D;  4JRP A;  3G4S Q;  3QJ6 A;  3OSS C;  3A8O B;  3EFR A;  3PFS A;  3MEA A;  1HD3 A;  5CKH A;  3EG1 A;  1R0B G;  3UA7 A;  1JXM A;  2MAM A;  4M78 E;  4R55 A;  5CR2 A;  1YIJ A;  2KI7 A;  4AFS C;  1PRM C;  2KT8 A;  1VQK Q;  1WHJ A;  2RI3 A;  3HPW A;  4EMG A;  2QEX Q;  2E10 A;  3JB9 D;  1Q82 R;  3BFM A;  2HKQ B;  4M7D E;  4HA8 A;  3N5B B;  1GBR A;  2OAW A;  2RHY A;  4EMK A;  2R57 A;  4M78 F;  3RKW A;  4Y28 E;  5HK0 A;  3CCL Q;  4OP0 A;  1RLP C;  4QVD A;  1KQS A;  3LGF A;  2A08 A;  2CP0 A;  2RHX A;  3A8G B;  1T0H A;  2EYX A;  1M3C A;  2QDY B;  3SWN B;  1WJQ A;  2DJQ A;  4OB0 B;  4FCY A;  1I5O B;  1MGQ A;  2RK2 A;  2GNC A;  2JT4 A;  5L23 A;  2D0N A;  5LJ3 e;  3KFV A;  4KUD K;  1AVZ C;  1FX7 A;  2WAC A;  1NYG A;  1QVG A;  8ATC B;  1XQH A;  4PFO A;  5GAO l;  1X6G A;  1W2B S;  2DTI A;  2BZY A;  3SWN C;  4BY6 B;  2DMO A;  1NEG A;  4P5N A;  1ARK A;  3JB9 F;  3I55 Q;  3THK A;  1RAD B;  2NWM A;  4MZM A;  2V8J A;  1SHF A;  1AOJ A;  4R56 A;  1WI7 A;  1O9S A;  4HVU A;  4KBM B;  4KGX B;  2JUF A;  3OYJ A;  5IAY A;  2J7I A;  2CUB A;  3R6O A;  5KYW A;  2KRM A;  4BY6 C;  1M1K U;  3CCM T;  2PZ1 A;  1X69 A;  2KGT A;  2SRC A;  2O4X B;  3EG3 A;  1YJW Q;  1FMV A;  5CAI A;  1SRL A;  1TUC A;  3MPU B;  3P8B B;  4L5G A;  3VS6 A;  1VQP T;  3OYB A;  2P0P A;  4AMC A;  1YN8 A;  1Q95 G;  2WSC E;  1X75 C;  2K5F A;  4JRQ A;  2DL3 A;  1TTH B;  2XIC A;  5GAO p;  1UUE A;  4JLG A;  1YIJ Q;  3MP8 A;  1VQ8 T;  4ME7 A;  4RKU E;  1GFC A;  1MV0 B;  1N6A A;  4XTZ A;  2P4T A;  5GAO r;  1OEB A;  3VYH B;  1KC8 U;  1M5Q 1;  4C5I A;  4DEX A;  5GAO q;  2KR3 A;  2ZZD A;  2X4Y A;  1K8A C;  2OTL T;  3V8J A;  4KH1 B;  4C8Q B;  3UAT A;  4ATO A;  2K5L A;  5GAN 4;  2ZCF B;  2JW4 A;  1N9S A;  2CS7 A;  3OA6 A;  2DIL A;  1TXQ A;  2YUP A;  2HCK A;  3VYG A;  2J6F A;  2X4X A;  3GNF B;  2M02 A;  2RNA A;  4XTY A;  3CCU T;  3HKS A;  1D3B A;  4F7U A;  1N8R C;  1M1G A;  3A8L B;  2RQT A;  4C8Q C;  1WYX A;  4J5Y A;  1YFN A;  3MJX A;  3WXM B;  2RI5 A;  2WSF E;  3TSZ A;  1CKB A;  4OMO A;  4IKF A;  3VKI A;  4BI8 B;  2CZ7 B;  1Q81 U;  2COW A;  4RTW A;  3JB9 J;  3A1P A;  4PFP A;  4C0F A;  4IUT A;  1H3H A;  4M75 D;  2FG0 A;  4J6Y A;  4MZT A;  5FRO A;  1VQP A;  2AIR B;  2E4H A;  3OYL A;  2DEU A;  2O88 A;  1TG0 A;  4BE0 A;  1PM3 A;  2YLC A;  1LNX A;  1Y7X A;  3JV3 A;  1QCO A;  3FC3 A;  4WF2 A;  1VQ8 A;  4HVW A;  1U1T A;  3RMS A;  3JCM P;  1KQS S;  3TEE A;  1K76 A;  4HT8 A;  5FWB A;  3FEO A;  3M5A A;  2RHZ A;  1QVP A;  3H0I A;  4C5G A;  2M9U A;  2MCN A;  3VS0 A;  4Z89 A;  1AZG B;  1LJO A;  2AHJ B;  3NFC A;  3J80 E;  4DBQ A;  3CC4 A;  1ZSZ A;  1N8R R;  2DL8 A;  2EJ9 A;  2K2V A;  1OOT A;  5LJ5 e;  3OYF A;  4JJN K;  4M77 G;  1PSE A;  1RLQ C;  4ZN3 A;  5GMK i;  4BE2 A;  2DXB A;  1QVG S;  2QGG A;  3NPF A;  3LGL A;  3EGD A;  5GAN e;  2X4J A;  2X3W D;  2JZ2 A;  1NZ9 A;  2LJ3 A;  1GFD A;  2PUK B;  2DF6 A;  1TUG B;  2LQN A;  3CCU A;  1VQ9 T;  4M75 F;  1M2V A;  2DL5 A;  4RG8 A;  1YWO A;  2E5Q A;  5CQY A;  4ZTJ A;  4CC7 A;  2NYS A;  4Z8A A;  5I22 A;  3F70 A;  3CC2 T;  2D6F A;  1DJ7 B;  4A4K A;  4A4F A;  3G1J A;  1RL2 A;  1LVK A;  3FRN A;  2G6F X;  2XMF A;  5LJ3 h;  2CDT A;  1SKU B;  1UJ0 A;  1PC0 A;  4PJL A;  3JB9 H;  2HBW A;  1G3T A;  5D7U A;  4E7L A;  2RI2 A;  2DXU A;  2E6N A;  4FSX A;  2VAS A;  4C0G A;  1ZBX A;  2BTT A;  2BZ8 A;  1MUZ A;  3FJ5 A;  2LJ1 A;  4DBF A;  2R5M A;  3UT1 A;  1WZO A;  1BI3 A;  5KE2 A;  3TQ7 P;  1WNL A;  3SDZ A;  4E7H A;  2FHD A;  3CCS A;  3WVE B;  2KYB A;  3TRE A;  1E6G A;  4DOV A;  1KK7 A;  5FWC A;  1TWB A;  5GAM e;  2F5K A;  3M0Q A;  1UJY A;  1GCQ C;  1BK2 A;  2V8K A;  4Z02 A;  2DYB A;  3PMT A;  1I1J A;  2HEQ A;  4KGV B;  3E9G A;  4PFZ A;  1VQ9 A;  3CPF A;  3CC4 Q;  5KCO A;  1PCX A;  2E6Z A;  3OQ5 A;  2YUQ A;  4J83 A;  2CP2 A;  1U8R A;  2E3I A;  3MO8 A;  3CBP A;  1JO8 A;  3CC2 A;  1O75 A;  3OS5 A;  5ECA A;  4IIO A;  4B6M A;  4N0A C;  1D0Z A;  1HXD A;  1G5V A;  4E6R A;  2LNV A;  2K7A A;  1MMA A;  3SHW A;  3M57 A;  2P0K A;  1RAF B;  5GMK m;  3OYG A;  1VUB A;  4OMP A;  3MCA B;  3CCR T;  1KD1 U;  4F7U E;  3OYN A;  4Y92 A;  1W2B P;  5I21 A;  1I81 A;  3OYC A;  1W1F A;  4M77 A;  3L2Z A;  3GIB A;  1G3S A;  3E19 A;  2DVE A;  2RD1 A;  4LXC A;  3DB4 A;  1VQN T;  4FT4 A;  1NPP A;  3WVD B;  2M16 A;  4QQD A;  1M27 C;  4HCZ A;  4F7U F;  1WHG A;  4CRI A;  3GP8 A;  4PJO D;  1X27 A;  2EYQ A;  4X9D A;  2J05 A;  2YRC A;  3I5S A;  1BU1 A;  2IPO B;  1RI0 A;  3CCJ Q;  2MI6 A;  2Y90 A;  3REB B;  3CCS Q;  1M30 A;  1M90 C;  4M7A G;  1AT1 B;  2RF0 A;  3O8V A;  4II1 A;  3RIR A;  3JCM Q;  2K79 A;  4UC4 A;  4AFU C;  5KE3 A;  1JJ2 S;  5DLO A;  3BY7 A;  5IN1 A;  1YCS B;  3C12 A;  2YDL A;  3QKJ A;  3PTA A;  4QVZ A;  4HT9 A;  4LDU A;  4PJO E;  1MMG A;  5LJ5 h;  3MP1 A;  2CP7 A;  3EG9 B;  5LJ3 f;  1M8M A;  1MHN A;  1WX6 A;  2KAF A;  2HMA A;  3CBO A;  3M0T A;  3HL8 A;  2X9H A;  1UHC A;  3CC7 Q;  5GAN h;  1MNE A;  2DM1 A;  2O01 E;  1U1S A;  4ELY C;  4OMF B;  4Q5W A;  2P4R A;  3HFO A;  3CCR A;  1M8V A;  1BBZ A;  4PJO F;  1BYM A;  1AD5 A;  2HDA A;  5M9O A;  2HAX A;  2PUO B;  1D09 B;  2F69 A;  3X28 B;  2X3X D;  4F04 B;  3RBB B;  4J9I A;  4KUI A;  2VVK A;  2DVJ A;  3JCM e;  5HKC A;  4HCC A;  1G3W A;  1YCY A;  1Q86 U;  1NJI C;  1EZZ B;  2DX1 A;  4GY5 A;  2K9G A;  1WXT A;  3I5R A;  4RTZ A;  1D0Y A;  1C1A A;  4M75 B;  4NL3 A;  1N5Z A;  3MEW A;  2PNI A;  1QKX A;  1QWF A;  2LCS A;  5KYU B;  2QDL A;  5IT9 E;  2CYZ B;  2DK3 A;  3GF5 A;  3JCM V;  1K73 R;  3JRZ A;  2LT1 A;  3SD4 A;  1PD0 A;  2RJE A;  1NM7 A;  1JEG A;  1AHJ B;  4M75 C;  3S3M A;  4J7F A;  1G3Y A;  1B34 B;  2XK0 A;  3I56 T;  4K11 A;  1M9S A;  2NUP B;  5GAM h;  3GBQ A;  1YJ9 T;  1UDL A;  4C92 F;  3CD6 T;  1VQ6 T;  1R8O B;  3M59 A;  5LJ3 g;  2HD0 A;  2XI9 A;  3ZL7 C;  1VQO T;  2QQR A;  3URG A;  2F2V A;  2RQU A;  1PWT A;  2QQS A;  2XDD A;  2G3R A;  1AWX A;  2O2O A;  1PNJ A;  1G2B A;  2H8H A;  1G83 A;  2DZ9 A;  1KQ2 A;  2DLP A;  5CKD A;  2EWN A;  2EGE A;  4AFZ C;  3CCQ T;  3EG0 A;  3AT1 B;  4ZN1 A;  2DL4 A;  2HSP A;  3HP9 A;  5GAN 8;  4CC3 A;  2E64 A;  4N4H A;  2XG8 D;  2MK5 A;  5HK3 A;  3CCR Q;  2KMT A;  1UEC A;  1BI2 A;  4M7A A;  1OUL A;  2PVO B;  3PGG A;  4EMH A;  1Y96 A;  5I2M A;  1VQL T;  5A0G A;  1K8A U;  1MMD A;  2K3Y A;  2JTF A;  5D6W A;  3HRU A;  3A98 A;  3DKM A;  5GAN 5;  3G6E Q;  4FW2 A;  4F16 A;  3L2W A;  2EQM A;  1HK9 A;  1Q7Y R;  1OX8 A;  1BB9 A;  1ZA1 B;  1JB0 E;  2DPP B;  1FMK A;  2F5T X;  2VXE A;  4M77 E;  4JS4 A;  1OU8 A;  1BKB A;  2EJF A;  1SG5 A;  2FZG B;  1N8R U;  1C0M A;  5L8R E;  5LJ5 f;  3I56 A;  5KH6 A;  2A36 A;  5KYY B;  1Y57 A;  3O5Z A;  3R6N A;  4IIM A;  2DFU A;  2YRV A;  2JOY A;  1YJ9 A;  4JRI A;  1Z9Z A;  2CZ0 B;  2L3R A;  2RK1 A;  2C0O A;  1H64 1;  1SEM A;  3CD6 A;  1VQ6 A;  3M53 A;  3QWX X;  2DEQ A;  1IHV A;  5GAN f;  2ENM A;  3GOX A;  3Q1J A;  1VQO A;  1W70 A;  2ROT A;  4FL6 A;  3EHR A;  2Y4Y A;  3HSB A;  1QP3 A;  4O5V A;  2EYY A;  2NUT B;  2HSE B;  1CKA A;  1UB4 A;  2D8H A;  4M7D F;  2B86 A;  1QQJ A;  1WDX A;  3CMA T;  4J9E A;  4O6J A;  2VC8 A;  1VQ4 T;  2GTO A;  1IZ6 A;  2EQJ A;  1BI0 A;  3ER0 A;  4N4I A;  1RAG B;  1ZSG A;  1QMC A;  3E2U A;  2MIO A;  3JSC A;  2V1Q A;  3M54 A;  1N9R A;  2DA9 A;  2NLU A;  5CVI A;  1PKT A;  4L59 A;  2RN8 A;  4JRK A;  1KFZ A;  2IVW A;  5IHK A;  3CME T;  4J6X A;  4XU2 A;  2C06 A;  4CI0 C;  2JTM A;  3MHX A;  2RJC A;  3RES A;  1VIE A;  2LX9 A;  3EH2 A;  3KUF A;  3JCM h;  2EW3 A;  2X35 A;  4GLK A;  2VGM A;  2EQU A;  3EGU A;  1M4Z A;  1A0N B;  3QG1 A;  1OZ3 A;  2QTX A;  4XK8 E;  5LJ5 g;  2YRD A;  4C8Q G;  3QDF A;  2YUN A;  5AT1 B;  3X24 B;  1YIT T;  2M1H A;  2LNH B;  4C0Z A;  2H3E B;  1JXO A;  1ZUY A;  5GAN g;  2D1X A;  5C0M A;  4AG2 C;  2FRW A;  3JB9 I;  1GL5 A;  4J9F A;  2YT6 A;  1BI1 A;  2HQE A;  2RM4 A;  3OMG A;  4OB3 B;  4ORZ A;  2O31 A;  4OB2 B;  4B9X A;  3QYG B;  3CD6 Q;  1VQ6 Q;  1VQ4 A;  2KSS A;  3J7A F;  1XTD A;  3G7Z A;  4Z88 A;  5J39 A;  1JJ2 P;  3JCM d;  1JU5 C;  2CUD A;  2BKD N;  3QZ5 B;  5IXB A;  4LUD A;  3UA6 A;  4C92 G;  5GJV B;  2LQW A;  1D1A A;  2P84 A;  3GNG A;  2CZ6 B;  1M3A A;  2Z0W A;  1WXU A;  3I9Q A;  1QP2 A;  4HVV A;  3CBM A;  2HQH A;  5HY6 A;  3CXC P;  2QA4 T;  2M51 A;  3SWN A;  1TS9 A;  3AHU A;  3NGP A;  2GQV A;  2QQA A;  5C6S A;  4LE9 A;  3CCM A;  4C92 B;  3VV0 A;  2CP5 A;  3H8Z A;  9ATC B;  2DER A;  3HTR A;  4FW1 A;  5AYF A;  5EC7 A;  1CSK A;  5HCK A;  4ANJ A;  1S72 T;  2QQ9 A;  3OY9 A;  3C95 A;  5GAM g;  4E7K A;  5FW9 A;  2E3H A;  3FJP A;  4RUG A;  1YIT A;  4Y91 A;  3VRZ A;  4C92 C;  4NOY A;  1XJW B;  3QSU A;  2OTJ T;  2C0T A;  4E7Z A;  4JJC A;  2CT3 A;  1HSQ A;  1WLP B;  2VKN A;  4MDX A;  2BZX A;  2OTL A;  2A7Y A;  3QXE B;  1YI2 T;  2O4X A;  4TVR A;  4F14 A;  3VJP A;  4M4Z A;  4L6V 5;  3TU4 K;  4LNP A;  3EGX B;  1Y07 A;  2RH2 A;  1ZX6 A;  1YHQ T;  2XKO C;  4DEY A;  4M78 G;  1D1C A;  3MKD A;  2YWW A;  3OYI A;  3QWY A;  3OSV A;  2E65 A;  4RG2 A;  1JJ2 A;  1VQ4 Q; 
#chains in the Genus database with same CATH homology
 2RQV A;  1M27 C;  2L2P A;  1AWW A;  2YSQ A;  1VYT A;  1GRI A;  2DRM A;  3UF4 A;  1NYF A;  2OJ2 A;  1X27 A;  3PVL A;  4JPB W;  2J05 A;  4LN2 A;  3REA B;  3I5S A;  2K6D A;  1BU1 A;  2V1R A;  2DNU A;  2CT4 A;  3CQT A;  3M0P A;  4OML A;  2LX7 A;  2CH4 W;  4RTX A;  3REB B;  1M30 A;  3VS3 A;  4LUE A;  1KIK A;  3VS4 A;  2RF0 A;  2DRK A;  1QKW A;  2K79 A;  1I07 A;  3NMZ C;  1Z9Q A;  1VYU A;  4AFU C;  2AKL A;  2EYW A;  1YCS B;  2GBQ A;  3NHN A;  3SEM A;  2F2W A;  2YDL A;  1UHF A;  1UG1 A;  2NUZ A;  2ABL A;  2JMA A;  3H0F A;  4GBQ A;  2FEI A;  5IXF A;  3IQL A;  1M8M A;  1WX6 A;  1GCP A;  3M0T A;  2FRY A;  1HD3 A;  3EG1 A;  2DBM A;  3UA7 A;  1UHC A;  1JXM A;  1WXB A;  2YUO A;  4J9G A;  2DM1 A;  1K9A A;  2CRE A;  2EGC A;  4AFS C;  1PRM C;  2P4R A;  2KT8 A;  1BBZ A;  4J9B A;  1VYV A;  1S1N A;  1AD5 A;  2HDA A;  2FPF A;  2KYM A;  2AKK A;  1AWJ A;  1T0J A;  2X3X D;  4F17 A;  3RBB B;  4J9I A;  1GBR A;  2ROL A;  2VVK A;  2OAW A;  2DVJ A;  4RTT A;  1I0C A;  1UE9 A;  1RLP C;  2DX1 A;  2A08 A;  2K9G A;  1WXT A;  3I5R A;  1MV3 A;  4RTZ A;  2EVR A;  3M0U A;  3LH5 A;  1T0H A;  2EYX A;  1M3C A;  1N5Z A;  1SRM A;  3VRY A;  2KRN A;  1ABO A;  1RI9 A;  2DJQ A;  2PNI A;  2GNC A;  2JT4 A;  1QKX A;  1QWF A;  2LCS A;  5L23 A;  2QDL A;  2D0N A;  3PVQ A;  2KE9 A;  3KFV A;  1AVZ C;  2EPD A;  1NYG A;  1B3Q A;  2L3Q A;  1X2Q A;  1B07 A;  5IHI A;  1NM7 A;  1JEG A;  1X6G A;  1T3S A;  1NEB A;  2BZY A;  1X6B A;  4JJB A;  4KRT A;  1WA7 A;  2DMO A;  1NEG A;  1E7O A;  1ARK A;  4K11 A;  1UTI A;  2LP5 A;  4FSS A;  3GBQ A;  3THK A;  2NWM A;  1UDL A;  1SHF A;  1AOJ A;  1UFF A;  1WI7 A;  2EBP A;  4HVU A;  4GLM A;  2MOX A;  3ZL7 C;  3M0S A;  3PE0 A;  2F2V A;  2J7I A;  1E6H A;  2RQU A;  2CUB A;  1RUW A;  1PWT A;  2KRM A;  2PZ1 A;  1ZLM A;  1X69 A;  2KGT A;  2IIM A;  2SRC A;  3EG3 A;  1AWX A;  2O2O A;  2KBT A;  1T3L A;  1PNJ A;  4X1V A;  4ZNX A;  1G2B A;  1SRL A;  2H8H A;  1G83 A;  1TUC A;  1OV3 A;  2DLP A;  1YP5 A;  4AFZ C;  2EGE A;  2GTJ A;  3VS6 A;  3EG0 A;  3H0H A;  4R0K A;  1YN8 A;  2JS0 A;  2DL4 A;  2JS2 A;  2DL3 A;  2W0Z A;  2HSP A;  4D8D A;  3EG2 A;  5IH2 A;  4J9H A;  4CC3 A;  1UUE A;  3VS2 A;  1K4U S;  1GCQ A;  1OPL A;  2AK5 A;  1GFC A;  1OPK A;  2LMJ A;  1K0S A;  1MV0 B;  1UEC A;  2KXC A;  1GBQ A;  4J9D A;  4AFQ C;  2EYZ A;  2JM9 A;  1OEB A;  2KXD A;  2KEA A;  4DEX A;  2KR3 A;  2W10 A;  4QT7 A;  1JQQ A;  1K1Z A;  3TSW A;  4JZ4 A;  3A98 A;  3UAT A;  4F16 A;  1WFW A;  1ABQ A;  1WIE A;  1BB9 A;  2JW4 A;  2A28 A;  1FMK A;  2DIL A;  1J3T A;  1HJD A;  2YUP A;  2HCK A;  2J6F A;  2RNA A;  2A36 A;  1Y57 A;  3O5Z A;  3R6N A;  4IIM A;  2RQT A;  1WYX A;  3RNJ A;  4D8K A;  1Z9Z A;  2KRS A;  2C0O A;  1SEM A;  2O9S A;  2EGA A;  4RTU A;  3TSZ A;  3QWX X;  1CKB A;  4OMO A;  2ENM A;  1W70 A;  2ROT A;  2RMO A;  3EHR A;  1NLO C;  4OMN A;  2EYY A;  4RTW A;  1X43 A;  1ZBJ A;  1CKA A;  2J6K A;  3C0C A;  2D8H A;  3VS5 A;  1XOV A;  1UGV A;  2B86 A;  1H3H A;  2FG0 A;  1WDX A;  1M3B A;  2AZS A;  2DBK A;  2JM8 A;  2PTK A;  4J9E A;  1KJW A;  1SSH A;  2RQW A;  4A63 B;  3TVT A;  2O88 A;  1TG0 A;  2GTO A;  3U23 A;  5I11 A;  2L0A A;  3JV3 A;  1ZSG A;  1ZUK A;  3ULR B;  4HVW A;  1ZUU A;  4AG1 C;  2MIO A;  1K0X A;  2V1Q A;  1K76 A;  5FWB A;  4OMM A;  3H0I A;  2MCN A;  3VS0 A;  2RPN A;  4Z89 A;  2DA9 A;  1V1C A;  1AZG B;  1U06 A;  1PKT A;  2JXB A;  3EHQ A;  2DL8 A;  2RN8 A;  1U3O A;  1OOT A;  2E5K A;  1KFZ A;  1U5S A;  5IHK A;  2OI3 A;  2ECZ A;  2JTE A;  1KSW A;  1NG2 A;  1RLQ C;  2KRO A;  3NPF A;  4CC4 B;  2X3W D;  2LJ3 A;  1SPK A;  1GFD A;  2EW3 A;  3H41 A;  2DF6 A;  4RTV A;  2LQN A;  2K3B A;  3EGU A;  1A0N B;  2DL5 A;  1YWO A;  1AWO A;  2FO0 A;  2RQR A;  4CC7 A;  5IHN A;  4EIK A;  4Z8A A;  2GGR A;  1VA7 A;  2O9V A;  5I22 A;  2YUN A;  4JJD A;  2FPE A;  1QLY A;  2LNH B;  2GQI A;  2J06 A;  1JXO A;  1ZUY A;  2G6F X;  2XMF A;  2D1X A;  4AG2 C;  2AZV A;  2FRW A;  1GL5 A;  4J9F A;  2YT6 A;  2CDT A;  1UJ0 A;  2A37 A;  4ORZ A;  2HBW A;  2O31 A;  2KNB B;  2EQI A;  1H92 A;  4Z88 A;  2BTT A;  2BZ8 A;  2FPD A;  1MUZ A;  3FJ5 A;  2LJ1 A;  1JU5 C;  2CUD A;  5IXB A;  2CH4 A;  4LUD A;  3UA6 A;  1LCK A;  5GJV B;  2LQW A;  4OMQ A;  4J9C A;  2KYB A;  1SHG A;  1E6G A;  4CC2 A;  1M3A A;  1FYN A;  5FWC A;  1WXU A;  4ESR A;  1NLP C;  4HXJ A;  3I9Q A;  1QWE A;  4HVV A;  1X2K A;  3M0Q A;  2JMC A;  1AZE A;  2M0Y A;  1UJY A;  1GCQ C;  2M51 A;  1BK2 A;  2L3S A;  3NGP A;  1PHT A;  4LE9 A;  5GJW B;  2DYB A;  1EFN A;  1I1J A;  2HEQ A;  4WCI A;  2K2M A;  1PRL C;  2ED1 A;  2D8J A;  1AEY A;  5EC7 A;  1CSK A;  5HCK A;  1W6X A;  2YUQ A;  4HCK A;  2I0N A;  2EKH A;  5FW9 A;  3VS1 A;  2VWF A;  1JO8 A;  4RUG A;  3M0R A;  3VRZ A;  2CSI A;  2SEM A;  2C0I A;  5ECA A;  4IIO A;  3I35 A;  1Y0M A;  1TUD A;  1PKS A;  2C0T A;  1IO6 A;  2CT3 A;  4JJC A;  2F2X A;  1HSQ A;  4E6R A;  2K7A A;  3SHW A;  1WLP B;  2VKN A;  2BZX A;  2DE0 X;  4F14 A;  2J6O A;  2KT1 A;  4OMP A;  4M4Z A;  2L3P A;  2LZ6 B;  1YWP A;  2ESW A;  4LNP A;  4RTY A;  4Y92 A;  3VS7 A;  2DL7 A;  1W1F A;  2LJ0 A;  1QCF A;  4JZ3 A;  1ZX6 A;  4DEY A;  2ED0 A;  2CSQ A;  3QWY A;  1H8K A;  1YNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...