1VA7A

Yeast myo3 sh3 domain, triclinic crystal form
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
DPKFEAAYDFPGSGSSSELPLKKGDIVFISRDEPSGWSLAKLLDGSKEGWVPTAYMTPYKDTRNTVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-throughput structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords Myosin-3 isoform
total genus 12
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1va7A01
1ABQA 2KNBB 1AZGB 1B07A 1G83A 2D8HA 4LN2A 3NGPA 5FWCA 2RN8A 2X3XD 1M30A 1AWXA 4EIKA 2HEQA 2DYBA 2YDLA 4RTXA 2MOXA 1N5ZA 1W6XA 2PZ1A 1X6GA 4RTVA 2AZSA 3M0RA 1ZUUA 3PE0A 3VRZA 1GCQC 1X2KA 2H8HA 4HCKA 2J6FA 2KXDA 1SRLA 4OMNA 1NEGA 2EBPA 2JMAA 4AFUC 2V1QA 1K0XA 2J6KA 1LCKA 4ZNXA 1T0JA 4J9EA 2HBWA 2A08A 2CSIA 2G6FX 1I07A 2DBMA 4AFQC 4Z8AA 2GQIA 1MV3A 3H0IA 2FEIA 2CH4W 1WXTA 1YWOA 2BZ8A 2EYWA 4K11A 2LJ3A 2HDAA 1H3HA 1WIEA 5HCKA 2E5KA 2M51A 3UA6A 1HJDA 2JS2A 2K7AA 2KYMA 4HVWA 4IIOA 1K0SA 4J9GA 2YSQA 4JZ4A 1RI9A 1UJYA 1ZX6A 2KRMA 1JEGA 1G2BA 1SPKA 2KXCA 3I5RA 2P4RA 1CKAA 1H92A 2L0AA 4CC3A 3VS5A 1UHFA 1RUWA 1M8MA 1UJ0A 2K3BA 1AZEA 2EQIA 2KBTA 1PRMC 2QDLA 3JV3A 2GTOA 2PTKA 1SHGA 1M3AA 1JXOA 1GBQA 2KRNA 2KROA 1KIKA 2EW3A 1AD5A 1TUDA 2RPNA 2DILA 2RQWA 2FRYA 4RTZA 1S1NA 4JJCA 1AEYA 1WA7A 1FYNA 1U06A 2CUDA 2DJQA 2DA9A 1ZUYA 2KRSA 4HVUA 2L3PA 1WLPB 1X2QA 2ABLA 1QCFA 1X6BA 1T3SA 4AG1C 1PNJA 1KSWA 1JXMA 4LE9A 5EC7A 1GCQA 3R6NA 4DEXA 3VS1A 3H0FA 2KYBA 2DLPA 1YWPA 2BZYA 1H8KA 2BTTA 2FPFA 3PVQA 3I9QA 1ARKA 3VS4A 2L2PA 1SRMA 1GBRA 3M0PA 5I22A 1EFNA 2D0NA 2LQNA 3EHRA 1GFDA 2K9GA 4WCIA 2B86A 2JT4A 2LJ1A 4F17A 3RBBB 2F2WA 1ZSGA 1JO8A 1K76A 4RTTA 1M3BA 1UDLA 4J9HA 4CC7A 4E6RA 1VA7A 1T3LA 1AVZC 2X3WD 4OMPA 1BBZA 1UFFA 3U23A 1YCSB 2AZVA 2JW4A 4KRTA 1NG2A 2JM8A 1PWTA 2O2OA 2MCNA 2JM9A 2KEAA 2LNHB 2YUPA 1ABOA 2DL8A 4HXJA 4CC4B 4RUGA 1OEBA 3FJ5A 2FPDA 2YUQA 5ECAA 2K6DA 5IHIA 2J06A 2CT4A 3TVTA 1PHTA 1CKBA 1NEBA 2W0ZA 1QLYA 4AFSC 2KT8A 1UECA 4AFZC 1MV0B 1I1JA 3NMZC 4Z89A 3CQTA 2DL3A 3UA7A 3REBB 1NLOC 2O9SA 2D8JA 4F16A 3UATA 2RF0A 1W1FA 2FO0A 2LJ0A 2EYYA 3IQLA 3O5ZA 1RLQC 4JZ3A 1E6GA 1SSHA 2GTJA 2RQUA 2XMFA 4LUEA 2KGTA 1PRLC 1A0NB 2CT3A 1M27C 1XOVA 1IO6A 2W10A 1UUEA 1UHCA 1X43A 1KJWA 1HD3A 1PKSA 3EG3A 2VVKA 1MUZA 2O9VA 3UF4A 1GRIA 2KR3A 1TG0A 2RQVA 3VS0A 2EGEA 1K9AA 2C0TA 2V1RA 1UE9A 2DE0X 1SHFA 3VRYA 4J9FA 1KFZA 2MIOA 3QWXX 2OI3A 3LH5A 4LNPA 4ORZA 3VS3A 4GBQA 4R0KA 2EGAA 3NPFA 2O31A 2RQTA 4DEYA 1OOTA 2ESWA 4J9CA 2ED0A 2YT6A 2HSPA 5IXFA 4J9BA 1PKTA 2RMOA 2AKLA 2JMCA 2LQWA 1HSQA 2EYZA 2KE9A 1I0CA 1WI7A 2EGCA 4RTYA 2CUBA 2AKKA 2IIMA 2PNIA 2RNAA 4JPBW 4RTWA 2OJ2A 1BK2A 1CSKA 2LMJA 4A63B 3SHWA 1GCPA 1Y57A 4QT7A 1WX6A 2ENMA 1VYUA 2ROTA 2CDTA 2NWMA 3M0UA 2DMOA 1Z9ZA 1NYFA 1OPKA 5FWBA 4CC2A 2DBKA 2VWFA 2LCSA 2EPDA 4HVVA 2SRCA 2GBQA 2DL7A 2J05A 1U3OA 1ZUKA 1UG1A 3ULRB 1VYTA 2DL5A 3KFVA 2CSQA 1J3TA 1OPLA 2YUNA 2F2XA 1BB9A 2DF6A 3NHNA 2A37A 1JU5C 2C0OA 3ZL7C 5GJVB 1TUCA 2ECZA 1AOJA 1WXUA 1VYVA 1NYGA 2ED1A 4OMQA 1WDXA 3EG0A 2NUZA 3VS7A 1QWEA 4JJBA 2DX1A 1V1CA 1M3CA 1K4US 1FMKA 2SEMA 1QWFA 4OMOA 4D8KA 2KT1A 5IH2A 4J9IA 1X69A 1SEMA 4OMLA 1BU1A 1NLPC 1ZLMA 4Z88A 2F2VA 2D1XA 4D8DA 2LZ6B 2A28A 1RLPC 4OMMA 4J9DA 2DL4A 3EG1A 1W70A 3H41A 4F14A 1NM7A 3PVLA 1WFWA 3SEMA 1QKXA 1YNZA 1X27A 5IXBA 4GLMA 2DVJA 3I5SA 3REAB 2J6OA 3H0HA 4ESRA 2VKNA 2K79A 2I0NA 1T0HA 2YUOA 2DM1A 1AWOA 2C0IA 4JJDA 1E6HA 3A98A 1UTIA 1OV3A 2EYXA 4AG2C 3QWYA 2BZXA 3VS6A 2CREA 3TSWA 1QKWA 2L3QA 3I35A 2O88A 1GL5A 1UGVA 4FSSA 1Z9QA 3GBQA 2JS0A 1WYXA 5I11A 2M0YA 2ROLA 2FG0A 2HCKA 2LX7A 1WXBA 1U5SA 2OAWA 4RTUA 5IHNA 4LUDA 1ZBJA 5L23A 3VS2A 2GNCA 4IIMA 2K2MA 3EGUA 3EHQA 2RQRA 2FPEA 2CH4A 2JTEA 2FRWA 2AK5A 4X1VA 1E7OA 1B3QA 3TSZA 1AWJA 3THKA 3M0QA 2DNUA 3EG2A 2A36A 1Y0MA 2L3SA 2GGRA 4Y92A 4M4ZA 1GFCA 1K1ZA 1JQQA 2JXBA 5FW9A 2DRMA 2EKHA 3M0TA 3C0CA 1YN8A 1AWWA 2J7IA 3M0SA 5IHKA 1YP5A 5GJWB 2EVRA 3RNJA 2DRKA 2LP5A
chains in the Genus database with same CATH superfamily
2KNBB 2OTLQ 1B07A 1G83A 2DK3A 5CK9A 4LN2A 2X3XD 2LQKA 3HPWA 4E7KA 2PZ1A 1X6GA 4RTVA 2AZSA 3VRZA 3HHTB 1KQSS 4HCZA 3I55Q 3VYHB 2J6FA 3CC2Q 4OMNA 3A8GB 5LJ5f 2JMAA 2YHTA 5GAN5 4FL6A 1K0XA 5GAN4 1QMCA 3PIPA 2EQKA 2DIGA 2G6FX 1G3YA 4EMKC 1OU8A 4AFQC 3DB4A 2XDPA 4XU3A 1VQ6T 2GQIA 3OBYA 3HTRA 2ZPGB 2CP3A 2AHJB 2LJ3A 2ZPEB 2HDAA 4ZN1A 3JB9G 3CMAT 2JNGA 2YLBA 2XD0A 1QP3A 2K7AA 4PJJA 3EGXB 3L42A 3DLLA 1QP2A 1N8RC 4JS4A 4C92D 1RI9A 1UJYA 2LRQA 5KYYA 3M4YA 1SPKA 3X24B 4OP0A 2PU9B 1VQ6Q 4CC3A 4UC4A 1NJIR 2CP7A 2I2LA 1RUWA 2M02A 1PRMC 4XTWA 3JV3A 2GTOA 2ZAEA 4M7DG 1GBQA 2KRNA 4LD6A 3LGFA 1M9SA 2RPNA 2DILA 2RQWA 3LGLA 4M75E 3JB9D 1SG5A 2K3XA 1S1NA 1AT1B 2CP2A 1U06A 2DA9A 1RL2A 4XTUA 1MMGA 1MHNA 4HVUA 1WLPB 4C0GA 2P0PA 1KG1A 3MP8A 3CCVT 4FCYA 2HKQB 3E9GA 3MP1A 1U8RA 3CMAA 4M7DC 1GCQA 1I8FA 2CYZB 2DLPA 4A4GA 4M75A 4X9CA 5CKDA 3PVQA 3RKYA 4M78B 3VS4A 4DBQA 4KT0E 2X4JA 1VQLA 1EFNA 2D0NA 3QIIA 1GFDA 2YLCA 4ZN3A 4OGEA 3GOXA 3N5BB 3CCUT 2JT4A 4ELZC 4FM4B 3H8ZA 4MDWA 1VQ5Q 1YITA 4M7DE 1SSFA 4HCCA 1WHLA 2F2WA 1JO8A 3FIFA 4M78G 4CC7A 5LJ5e 1T3LA 4ANJA 2HKNA 2HL5C 1UFFA 2M0OA 3U23A 2COZA 3CCRT 2K4YA 1M1KC 4KH1B 1M90R 2JM8A 2RD1A 1N6AA 1PWTA 1LNXA 1MNEA 2KEAA 5FRMA 4CC4B 3I56Q 3FJ5A 2QASA 2FPDA 4OB3B 4NL3A 4FT2A 3OYJA 2CT4A 1PHTA 1NEBA 5GAN7 4AFSC 1MV0B 1I1JA 1VQPA 4RCBA 4C5GA 3HFOA 2KI7A 3UA7A 3ZEHA 1VQPQ 4V2SA 1BYMA 1VQMT 1AHJB 1PM3A 4F16A 1RI0A 5KYUB 3UATA 1WPYA 2RF0A 1W1FA 2EYYA 3O5ZA 1E6GA 3PGGA 2QEXT 4LUEA 4J5YA 3CCEQ 3VUZA 2RHUA 3META 1M27C 3OYAA 4PJOC 4M75F 1RADB 2W10A 1UHCA 4QQ6A 1KJWA 3J81E 1XJWB 1ZA1B 1D1BA 1HD3A 5D7UA 2A7YA 1VQMQ 3VV0A 2O9VA 3UF4A 3EG9B 4BD3A 1K9MU 1KC8R 3OYHA 5LJ3d 1K9AA 2C0TA 4PJMA 4J9FA 2MIOA 2M16A 2LVMA 4LNPA 3P8BB 3VS3A 2DKGA 2E4HA 2RJDA 3CCRA 2WACA 3NPFA 2O31A 2HMAA 1OOTA 3OS5A 2ESWA 4J9CA 3JCMV 3QUIA 3NFCA 3VYGA 4M75D 3OYIA 2KE9A 1I0CA 3L2RA 5GAMj 1TU0B 3G4ST 2V8JA 4M75B 4RTWA 5GAN6 1VQNT 2LMJA 4A63B 1GCPA 1EIFA 1OU9A 2DMOA 3T9NA 1Z9ZA 4JRQA 1NYFA 2FZGB 3WVDB 1QVFS 2MI6A 2VWFA 2RJFA 3JCMQ 3CCMT 3OW2S 2GBQA 2DL7A 4M7AA 1D3BA 3OS0A 1ZUKA 4M7AF 1UG1A 1YI2T 3CMEA 4EPCA 2DL5A 1VQ7Q 4KBMB 5LJ3h 4EMKB 2YUNA 1YITQ 1X01A 4MZPA 2D0QB 2DF6A 3ZFJA 4JRIA 2O4XA 5CO7A 3M9QA 5GJVB 2NLUA 2ECZA 1K9MC 2DVEA 3RMSA 5A2QE 5AYFA 2LCLA 1BCMA 2DX1A 2QA4A 1FMKA 1IHWA 4J9IA 4XU2A 1RAHB 4IKFA 1NLPC 3WXMB 4X9DA 2DTIA 3FRNA 3OW2P 2F2VA 4M77C 4D8DA 3X20B 1D0XA 1RAEB 3PFSA 5GAN8 3EG1A 5A0LA 3LWIA 1WFWA 4F7UB 4N4GA 1PC0A 4CRIA 4GLMA 2DVJA 1BI2A 1W2BS 2HZYA 2EFIA 1T0HA 1JJ2A 2C0IA 1IRXA 3A98A 1HXDA 1KQSA 3CCMA 3QWYA 3TSWA 1GL5A 1WHHA 1UGVA 4C8QF 4JLGA 4DOVA 3I55A 4PJOG 1YJWQ 4F7UE 5KCHA 1N8RR 4EDUA 2HCKA 2EQJA 2DZCA 4RTUA 2EQMA 4PL6A 3CMAQ 2X51A 1C6VX 4OB2B 1VQOA 1YJ9T 3RMQA 4IIMA 2HL3A 2K2MA 2MWOA 3G6EQ 1NJIC 5KE2A 2X35A 1V76A 1VQLT 5CR2A 2WSEE 1YI2A 4LDVA 3V7SA 2YRDA 2JTEA 3HP9A 2AK5A 1I81A 3TSZA 1YIJA 3OY9A 3V7RA 1RAGB 3EG2A 1G3TA 3R6OA 1Y7XA 3ZBDA 2A36A 3JB9H 3G71Q 2LCCA 3P8HA 1GFCA 2RK1A 1VQKA 2DXCA 3TU4K 4E7LA 2RH2A 4M78F 8AT1B 2J7IA 1TS9A 5IHKA 1QVGS 1VQKT 2JN0A 2E3IA 3M57A 3RKXA 1YP5A 2EVRA 2DRKA 4OVAA 1X6OA 3MEVA 4J6YA 3JB9F 1QVGA 5I2MA 1W2BA 3OYMA 3CEYA 3NGPA 2RN8A 1M30A 2QDYB 4L59A 4FYXB 4RG8A 3M0RA 1VQ8Q 3RKWA 5CQYA 3EGDA 1QCNA 3A8MB 4HCKA 2DEQA 1NBEB 1S72A 1VQ4Q 1LCKA 1IB8A 3G71A 1OX8A 2A08A 4RG2A 2OTLT 2R57A 5KCOA 2FB7A 1I07A 3HRUA 5KH6A 1Q86C 2FEIA 2CH4W 3QZ9B 1YWOA 4K11A 3SWNA 3VUBA 2QTXA 5CIUA 2KYMA 2DIQA 4IIOA 3UT1A 3RERA 4J9GA 2KY9A 2E12A 1VIEA 2KRMA 5HKCA 1RAIB 5DLQE 3I5RA 2KXCA 2RHZA 4C92G 2P4RA 4IUPA 1CKAA 1W4SA 3VS5A 2DFUA 5GAN3 3LX7A 5FU7B 1UHFA 3QDRB 5CQXA 1AZEA 2KBTA 3G6ET 4R55A 4DA4A 1Q82C 3CBOA 4ZTFA 5C6SA 3M5AA 5GANj 1QVFP 2BE7D 3JB9I 2YWWA 2EW3A 5GMKe 4QVZA 2IPOB 3GNFB 3O8VA 1NZ9A 2A0FB 4J83A 3JCMe 2QYZA 3CMET 2XK0A 3EGXA 1IZ6A 5GMKm 3EFOA 2L3PA 2ZZDA 5L8RE 1X2QA 2ABLA 1QCFA 3CCJA 3VJPA 3C12A 1VQ9Q 1N9SA 3SDZA 1PCXA 4HT8A 2DEUA 4LE9A 4X34A 1C1AA 2XKOC 3HL8A 2QA4Q 1TUGB 3A8OB 3TEEA 3H0FA 5LJ5j 1YWPA 3JRZA 1H8KA 1TTHB 2FPFA 3I9QA 1ZA2B 1ARKA 4PFOA 1GBRA 1VQ9T 3SWNB 3M0PA 3JCMb 3OYEA 2LQNA 3EHRA 3CD6A 4WCIA 2B86A 3UPUA 3C94A 3CMEQ 1SF9A 4P5NA 1UDLA 3NTHA 1U1TA 3F70A 2IG0A 4BUGA 5CKHA 3H9NA 1VQ4A 1YCSB 1Q82U 2CZ7B 1R77A 4EMGA 4KRTA 1NG2A 1K8AR 3M54A 4E7SA 1K73R 3INZA 5GAMd 4A4HA 1YI2Q 2XU8A 5LJ3f 2MCNA 2LNHB 5GAN2 4M7DF 5GAOl 4M7DA 2DL8A 4L5GA 4HXJA 4PJLA 1Q81U 3L1AA 2RJCA 5CCAA 2KSSA 2E6ZA 3MEAA 2RHIA 1JB0E 4BY6C 2LTOA 1IGUA 2LNVA 3PNWC 5CKEA 2W0ZA 4C5HA 4KGXB 4J7FA 4AFZC 3PIOA 4C8QD 4FSXA 4XTXA 4Z89A 3S3OA 4FT4A 4C8QE 3REBB 2O9SA 2D8JA 1YFNA 2JOYA 4JZ3A 1SSHA 4Z02A 4A4EA 4N0AA 2KGTA 4QVDA 5GANg 4M7AB 1WNLA 3DB3A 3RESA 3AHUA 2RA2A 1TWBA 3QHSA 1XOVA 3A8HB 5GANe 3OW2A 1UUEA 1QQJA 1BKBA 5FLXE 1LVKA 2VVKA 4FYWB 1M90C 5M9OA 4XU1A 2KR3A 4E7HA 2FZKB 1UE9A 2DE0X 1SHFA 3VRYA 3LH5A 2O4XB 2OTJA 4QVCA 5D6XA 4R0KA 2EGAA 2XHCA 1VQKQ 4PJNA 2RQTA 3QJYA 2X9HA 2ZPBB 3M56A 4LDYA 2YT6A 1VQ5A 4HKEA 5C0MA 1KHCA 1QVFA 3CCLQ 5KYXA 2ZPHB 2PNIA 2WSCE 2KQWA 1BK2A 1CSKA 3CCQQ 4LD9K 1Y57A 4QT7A 2COYA 3MPUB 4O5VA 1WX6A 2ENMA 1VYUA 3GF5A 1B34B 1M1FA 1M8VA 1PG5B 1OPKA 5FWBA 2QG9B 3MO8A 2GFAA 3I56T 3BY7A 5HY6A 4CC2A 1Q86U 2OTLA 3G4SQ 1YHQT 2ZCFB 2DERA 2EPDA 2J05A 4AT1B 1KC8C 3CCRQ 2PVDB 1YHQA 2JZ2A 1I5OB 3BDUA 1TUCA 5GMKj 2QXFA 3LYIA 2MF2A 1VYVA 4J6WA 4OMQA 2HBPA 3EG0A 2EJGA 1V1CA 1M3CA 2QK0A 4M7DB 4QQGA 1K4US 2F1LA 3KBGA 2DAQA 1X69A 2Y90A 4XTYA 1BU1A 5LJ3j 4BDZA 2COWA 4PJOA 4M77G 1VQ9A 1Y96A 1X75C 2A28A 4J9DA 2VC8A 3H41A 3M59A 1QVGP 4L6V5 1YNZA 5IXBA 2RB6A 4B9WA 3M4GA 3REAB 5HK0A 3H0HA 2VKNA 4M7AC 2K57A 1JJ2P 2LC4A 4O6JA 1WHJA 1HYOA 2DM1A 2OTJQ 4E2FB 4JJDA 1OV3A 2EYXA 1YITT 4PJOE 1QKWA 2O88A 1TSFA 2LQ8A 2RHXA 3TREA 5I11A 1PD1A 2BUDA 5LJ5h 4F04B 3RIRA 1U5SA 3G1JA 2DJZA 3EH1A 4LUDA 2E6NA 1PSEA 2MWPA 3CBPA 5L23A 1YJ9Q 2HQHA 4M7AG 2GNCA 1Q7YU 3EGUA 4A54A 1I5LA 2RQRA 3JCMc 2E3HA 3CCJT 1VQOQ 2CH4A 2KAFA 3L2VA 2B8AA 3GLXA 3GPLA 3CCLA 1M1GA 4JDSA 3OQ5A 1HK9A 4ZTJA 3THKA 2OAUA 2EJ9A 3M0QA 5GAMg 4M4ZA 2QEXA 1UGRB 2DRMA 2RI5A 3J80E 1BI0A 2K3YA 1D1CA 4PKCC 1D1AA 4ZGJB 3V8LA 5GMKh 2K5IA 2VXFA 4JLIA 1ABQA 4C5EA 3EGDB 1RABB 2QQBA 4RMOA 2D8HA 3BW1A 1AWXA 4EIKA 2HEQA 1BIBA 4RTXA 1OQKA 4XAXB 1N5ZA 4GY5A 3WVEB 3A8LB 1ZUUA 4BE2A 2CZ6B 5LJ5d 4DBFA 1NE8A 5KYWB 2DYIA 4PJOD 1X2KA 4PK4A 5KYNA 1BI3A 1JRIA 1SRLA 4HCBA 1NEGA 1Y71A 3CC7Q 2V1QA 2J6KA 1KD1R 2KDSA 4C92A 5CKBA 2QEXQ 4ZNXA 2HBWA 2CKKA 4ATOA 2CSIA 4ZGEB 4NS5A 2DBMA 2NUPB 1YHQQ 1MV3A 2P84A 3H0IA 1Q7YR 3E9FA 2BZ8A 5HCKA 2M51A 1UGSB 2QQ9A 1VQLQ 4KUDK 3OA6A 3CCST 2F5KA 4HVWA 3CCSQ 2XIDA 3MEWA 2VB6A 1VQNQ 3OYBA 4IURA 3E19A 4JZ4A 2V8IA 1WGSA 1G2BA 4M75C 2QQAA 1H92A 1WJSA 2L0AA 4QQDA 1MNDA 1Y07A 1Q7YC 2F69A 4EMKA 4PJOF 4RKUE 5FU6C 4M77D 1M8MA 1UJ0A 2K3BA 3X28B 1GXIE 2EQIA 2QGGA 2GCXA 3CC7T 1FX7A 1NPPA 2PTKA 2L3RA 1M3AA 3KXTA 1KIKA 4C5IA 1TUDA 2NUTB 2M9UA 2FRYA 4RTZA 2ZGWA 2GQVA 1N27A 4JJCA 4YTLA 2HQXA 1WA7A 1Q82R 1FYNA 3J7AF 1ZUYA 4HA8A 2CP0A 4IUUA 5FU6B 2ZPFB 1X6BA 4M78C 2RJEA 4AG1C 2R5AA 4HT9A 1DJ7B 4PLIA 5EC7A 7AT1B 3QPHA 3R6NA 3AT1B 3VS1A 2KYBA 4JS5A 2EKOA 1YJNQ 2MMPA 2DD4A 2L2PA 2DD5A 2LT1A 1KQ2A 4B6MA 3QSUA 3EAEA 2HQEA 2JUFA 3CC4T 1IHVA 3RBBB 3CBMA 1TH7A 3FJPA 1FXXA 1ZSGA 3CD6Q 3P8DA 4C0DB 1M3BA 4FYYB 4J9HA 4E6RA 1S72Q 1VA7A 5I21A 2P0KA 2JVVA 1AVZC 4MMLA 1QW1A 2DPPB 2X4XA 1BBZA 4A53A 3M58A 3OYNA 1ZBXA 2AZVA 1VQMA 5EG2A 1IGQA 2KVQG 2AIRB 3SWNC 4BB7A 3I56A 2JM9A 4FIBA 3SB2A 2YUPA 1ABOA 5J26A 1D3BB 3QBYA 1N8RU 2H3EB 3JB9J 4N4HA 3CXCS 1BIAA 1K8AU 5HK3A 2K6DA 5IHIA 2J06A 4M78A 4BI3A 1XNIA 5GANd 1MMNA 3BE3A 1KQ1A 2NYSA 4GLKA 1QLYA 1UECA 1BI1A 3CXCP 2KMTA 1VQ5T 3QJ6A 3NMZC 3CQTA 1F1BB 1QVPA 3JSCA 1NLOC 5FROA 2BIVA 2JTMA 4BI8B 3JCMX 2LDMA 3X25B 2GTJA 4Y28E 4C0FA 2RQUA 2XMFA 3LW5E 3RR6A 4F7UG 1PD0A 3S3NA 4A4KA 1YJNA 1IO6A 2RK2A 2RI2A 4EMHA 1X43A 4OB0B 2LT4A 4C8QA 2E10A 1PKSA 2QAZA 5GAMh 2HNIA 4IUTA 4M77B 4XQ3A 1K8AC 1MUZA 3QYGB 1GRIA 5J39A 5A0GA 2RQVA 1UB4A 2NUTA 2V1RA 2P0QA 1NJIU 3CCMQ 1KFZA 2MK5A 3QWXX 2OI3A 2MYSA 1R8OB 4ORZA 2DXTA 3FDRA 4GBQA 4TVRA 3S3MA 4C8QB 2P4TA 4DEYA 2ED0A 2HSPA 5IXFA 5GANh 2D6FA 5KYWA 2AKLA 2JMCA 1OX9A 1VQ7T 4PFZA 2EGCA 4RTYA 4VUBA 2IIMA 3CPWP 1M5Q1 1WHGA 3ME9A 2OJ2A 2FYKA 3L2UA 2GF7A 3CCQA 1S72T 2ROTA 2NWMA 1KC8U 3M0UA 1V29B 1B7TA 1FWZA 1FMWA 5IT9E 4XTZA 3EG9A 1Q95G 3NTIA 3MP6A 3LWHA 3CCQT 2SRCA 1M4ZA 1U3OA 1VOMA 1KK7A 1VYTA 1J3TA 3KFVA 2CSQA 3HRSA 3C4SA 5CAIA 3NTKA 3CCUQ 2CZ0B 1VQ4T 1BB9A 2K5LA 2VYTA 1XTDA 1JU5C 3ZL7C 2QQSA 4C92F 5J3BA 4M7DD 1H3ZA 2E65A 4OF1A 1WDXA 3VS7A 1QWEA 1QWFA 4OMOA 2CS7A 4D8KA 3M53A 2KT1A 3MJXA 1B34A 4FW2A 1SEMA 4OMLA 1ZLMA 3CCVQ 4Z88A 3CCLT 3HRTA 1H641 2LZ6B 3FEOA 3V8JA 4NOYA 3DKMA 3L2WA 3X26B 3RDVA 1W70A 1NM7A 2PVGB 1R0BG 1X27A 4N0AC 3OMGA 1OYXA 1Q86R 1UGQB 2YUOA 3DLMA 2VGMA 5FU7C 1TXQA 2G3RA 2YRCA 2CREA 3I35A 1R0CB 3G4SA 5D6YA 1Z9QA 5LJ3e 2JS0A 1O75A 1WYXA 2ROLA 3E2UA 4D6WA 4WF2A 4NL2A 1G5VA 1WXBA 1QCOA 4C0ZA 2OAWA 3PT9A 5IHNA 6AT1B 1ZBJA 3VU3C 1K73C 4LDXA 5FRNA 1P92A 3VS2A 1FMVA 3EHQA 3H6ZA 3RUXA 4M78E 4JRKA 3CCSA 5GAOq 3E1SA 1YJWT 4M7AE 5CKFA 4DBRA 2FRWA 4X1VA 1JBMA 2QGFB 3BFMA 2JJ9A 2DNUA 1ACMB 3JCMf 2HD0A 1G3WA 1YJWA 2BE9B 1Y0MA 1KD1C 1JJ2S 2L3SA 5GAOp 3EFOB 4Y92A 5DY9A 1JQQA 4MZTA 3OYLA 5FW9A 2EKHA 1YN8A 1VQ8T 1AWWA 1Q81C 2EYQA 3M0SA 5A0DA 3OS1A 1KHIA 2OX7A 2QA4T 5LJ5g 3CC2A 1VQ6A 4BY6B 3GIBA 3D7SB 3RNJA 3ULRB 1G8XA 2ZPIB 4KULA 2CGHA 1AZGB 1D09B 4FYVB 2MPXC 5FWCA 2DYBA 2YDLA 2VGNA 4XK8E 2MOXA 1SKUB 4M77E 2C06A 1W6XA 3OYGA 3MHXA 4M77F 3PE0A 5DLOA 1GCQC 2H8HA 2LX9A 3VKIA 1UGPB 1OI1A 2KXDA 2EBPA 3OS2A 4AFUC 1N9RA 4DQ2A 5GAOm 2HAXA 2E41A 4LXCA 4QKUA 1T0JA 2FHDA 2H3JA 4J9EA 2D9TA 2RHYA 5I2SA 4Z8AA 3QZ5B 1M1KU 1U1SA 2RM4A 1WXTA 4J8OA 3PMIA 2EYWA 3A1PA 2KK4A 2L5QA 4J7IA 5D6WA 1H3HA 3CPWA 4C8QC 1WIEA 1WQ7A 2E5KA 3UA6A 4ME7A 4N4IA 1HJDA 4II1A 4MDXA 1WJRA 1WHKA 2JS2A 1K0SA 2GFUA 3OSSC 2Y4YA 3TQ7P 2YSQA 3HKSA 2VUBA 1ZX6A 3CCVA 1ZSZB 1JEGA 2V8KA 2YRVA 4B9XA 3JCMJ 1ZHIA 4M78D 2R5MA 1EZZB 4C92B 1I4K1 3PTAA 2E5QA 1WZOA 3CCJQ 4E47A 2QDLA 3BDLA 3EH2A 5KYYB 1SHGA 1K9MR 3CC2T 1Q81R 3QYHB 2PUOB 5IN1A 1JXOA 4ELYC 3L2ZA 4R56A 2KROA 3JCMg 1AD5A 3JAME 1M2VB 2EIFA 4RCCA 2EQUA 4E7JA 1AEYA 2CUDA 2DJQA 2V26A 3Q1JA 1OULA 2KRSA 2DTOA 4C92C 1T3SA 1YIJQ 2DTHA 1PNJA 1EX4A 3I55T 3JCMh 3GNGA 1KSWA 2PUKB 4PLLA 1JXMA 4OMFB 4DEXA 2BZYA 2BTTA 1NPRA 2AT1B 3PMTA 2FL7A 1ZQ1A 1SRMA 3LLRA 4C0DC 3G71T 5I22A 5GAMe 2CZ1B 4M75G 2K9GA 3CCEA 3QDFA 2LJ1A 1VQ7A 2X4WA 1O9SA 4F17A 4BE0A 2XDBA 1K76A 1IREB 4RTTA 1D0YA 4BDYA 4F7UA 4OB1B 2DO3A 2K5FA 3CC7A 1YCYA 4MMKA 2X3WD 4OMPA 2E70A 2M1HA 5CVIA 1M2OA 1D0ZA 3HFNA 3OB9A 4M7AD 4LDUA 2JW4A 4KH0B 3ER0A 3OMCA 1WJQA 2O2OA 3FB9A 4DBHA 4IUVA 5GAMf 4JJNK 1TOVA 1LOJA 4RUGA 1OEBA 1LJOA 5GANf 2YUQA 4CI0C 5ECAA 1WHMA 1MMDA 2Y4XA 1RAFB 3GP8A 1G3SA 1VQOT 1YJ9A 1M90U 2CP6A 2E64A 2YXYA 3TVTA 2VASA 2EAYA 1CKBA 2X4YA 2QTVA 2KT8A 1MGQA 4PNOA 2FZCB 3UWNA 3HSBA 4OGCA 2DL3A 3URGA 3TCJA 2FO0A 2LJ0A 3CCUA 3IQLA 1RLQC 3S6WA 2DXBA 2O01E 1PRLC 4KGZB 5GAOr 1PSFA 2CT3A 2PQWA 2R58A 1WQWA 4M77A 1UEBA 1KQSP 2VXEA 3OYFA 3CXCA 1XQHA 3G6EA 3MEUA 2BKDN 3EG3A 2QI2A 1VQPT 4JRPA 8ATCB 2WSFE 5AT1B 1TG0A 3VS0A 2EGEA 4XTVA 2EJFA 4QW2A 2MAMA 3MKDA 4KGVB 3FC3A 3OYDA 5DM7R 3OYYA 4J6XA 4E7ZA 4BI4A 3L2QA 2IVWA 4Q5WA 2ATCB 2RO0A 4J9BA 1PKTA 2RMOA 2XDDA 1YBYA 2LQWA 1HSQA 2EYZA 1KD1U 5KYXB 1WI7A 4XU0A 3EFRA 2CUBA 2AKKA 3SD4A 2RNAA 4JPBW 3ASKA 5GMKl 1ZSZC 2CP5A 3LH0A 5LL6S 3SHWA 2DZ9A 3OYKA 9ATCB 1IXDA 2CDTA 2HSEB 3OSVA 1VQNA 4PFPA 1K73U 2DBKA 4KUIA 1OZ3A 2LCSA 3FLGA 4HVVA 2L8DA 1VIFA 4F7UF 1OPLA 4JUVA 2F2XA 2VV5A 5GAOn 3M55A 3V7CA 3CPFA 3NHNA 3QXEB 2OTJT 2A37A 2C0OA 3MCAB 1VUBA 4A4FA 3KUFA 1AOJA 1WXUA 2QQRA 3C95A 1NYGA 2ED1A 1YJNT 2NUZA 1W2BP 1BCOA 4JJBA 4C92E 2SEMA 5IH2A 2E1HA 3CC4Q 1MMAA 2DETA 4FW1A 3SFMA 3JCMd 1YIJT 2XI9A 2D1XA 1Y96B 2JTFA 1RLPC 4OMMA 3UDCA 5KE3A 2DL4A 3JCMP 4F14A 3PVLA 2L89A 3OYCA 3SEMA 1QKXA 3I5SA 1RACB 2J6OA 4ESRA 1RAAB 2K79A 3JCMW 2I0NA 1LPLA 4E7IA 3EFSA 4Y91A 3CCET 1AWOA 1E6HA 1UTIA 2A3LA 4AG2C 3VS6A 2BZXA 1A0NB 2L3QA 4WTOB 4FU6A 4FSSA 3GBQA 3QG1A 2K2VA 2M0YA 2FG0A 1VQ8A 3A5ZB 2LX7A 5GMKi 2RI3A 5IAYA 4BE1A 3G7ZA 2Z0WA 5KYUA 4MZMA 4PJOB 2FPEA 4BACA 4IUQA 3V8KA 3OBWA 1E7OA 3CC4A 1M2VA 1B3QA 2EWNA 1AWJA 4ZGDB 3CPWS 1C0MA 2F5TX 3QKJA 1M1KR 2GGRA 2DXUA 1K1ZA 2FVUA 2JXBA 2NUPA 1ZSZA 3M0TA 3C0CA 3QO3A 4AMCA 4DOWA 3CD6T 4C8QG 2XICA 1OZ2A 5GJWB 2XG8D 5LJ3g 2LP5A 4LDWA 2PVOB
chains in the Genus database with same CATH topology
1ABQA 2KNBB 1AZGB 1B07A 1G83A 2D8HA 4LN2A 3NGPA 5FWCA 2RN8A 2X3XD 1M30A 1AWXA 4EIKA 2HEQA 2DYBA 2YDLA 4RTXA 2MOXA 1N5ZA 1W6XA 2PZ1A 1X6GA 4RTVA 2AZSA 3M0RA 1ZUUA 3PE0A 3VRZA 1GCQC 1X2KA 2H8HA 4HCKA 2J6FA 2KXDA 1SRLA 4OMNA 1NEGA 2EBPA 2JMAA 4AFUC 2V1QA 1K0XA 2J6KA 1LCKA 4ZNXA 1T0JA 4J9EA 2HBWA 2A08A 2CSIA 2G6FX 1I07A 2DBMA 4AFQC 4Z8AA 2GQIA 1MV3A 3H0IA 2FEIA 2CH4W 1WXTA 1YWOA 2BZ8A 2EYWA 4K11A 2LJ3A 2HDAA 1H3HA 1WIEA 5HCKA 2E5KA 2M51A 3UA6A 1HJDA 2JS2A 2K7AA 2KYMA 4HVWA 4IIOA 1K0SA 4J9GA 2YSQA 4JZ4A 1RI9A 1UJYA 1ZX6A 2KRMA 1JEGA 1G2BA 1SPKA 2KXCA 3I5RA 2P4RA 1CKAA 1H92A 2L0AA 4CC3A 3VS5A 1UHFA 1RUWA 1M8MA 1UJ0A 2K3BA 1AZEA 2EQIA 2KBTA 1PRMC 2QDLA 3JV3A 2GTOA 2PTKA 1SHGA 1M3AA 1JXOA 1GBQA 2KRNA 2KROA 1KIKA 2EW3A 1AD5A 1TUDA 2RPNA 2DILA 2RQWA 2FRYA 4RTZA 1S1NA 4JJCA 1AEYA 1WA7A 1FYNA 1U06A 2CUDA 2DJQA 2DA9A 1ZUYA 2KRSA 4HVUA 2L3PA 1WLPB 1X2QA 2ABLA 1QCFA 1X6BA 1T3SA 4AG1C 1PNJA 1KSWA 1JXMA 4LE9A 5EC7A 1GCQA 3R6NA 4DEXA 3VS1A 3H0FA 2KYBA 2DLPA 1YWPA 2BZYA 1H8KA 2BTTA 2FPFA 3PVQA 3I9QA 1ARKA 3VS4A 2L2PA 1SRMA 1GBRA 3M0PA 5I22A 1EFNA 2D0NA 2LQNA 3EHRA 1GFDA 2K9GA 4WCIA 2B86A 2JT4A 2LJ1A 4F17A 3RBBB 2F2WA 1ZSGA 1JO8A 1K76A 4RTTA 1M3BA 1UDLA 4J9HA 4CC7A 4E6RA 1VA7A 1T3LA 1AVZC 2X3WD 4OMPA 1BBZA 1UFFA 3U23A 1YCSB 2AZVA 2JW4A 4KRTA 1NG2A 2JM8A 1PWTA 2O2OA 2MCNA 2JM9A 2KEAA 2LNHB 2YUPA 1ABOA 2DL8A 4HXJA 4CC4B 4RUGA 1OEBA 3FJ5A 2FPDA 2YUQA 5ECAA 2K6DA 5IHIA 2J06A 2CT4A 3TVTA 1PHTA 1CKBA 1NEBA 2W0ZA 1QLYA 4AFSC 2KT8A 1UECA 4AFZC 1MV0B 1I1JA 3NMZC 4Z89A 3CQTA 2DL3A 3UA7A 3REBB 1NLOC 2O9SA 2D8JA 4F16A 3UATA 2RF0A 1W1FA 2FO0A 2LJ0A 2EYYA 3IQLA 3O5ZA 1RLQC 4JZ3A 1E6GA 1SSHA 2GTJA 2RQUA 2XMFA 4LUEA 2KGTA 1PRLC 1A0NB 2CT3A 1M27C 1XOVA 1IO6A 2W10A 1UUEA 1UHCA 1X43A 1KJWA 1HD3A 1PKSA 3EG3A 2VVKA 1MUZA 2O9VA 3UF4A 1GRIA 2KR3A 1TG0A 2RQVA 3VS0A 2EGEA 1K9AA 2C0TA 2V1RA 1UE9A 2DE0X 1SHFA 3VRYA 4J9FA 1KFZA 2MIOA 3QWXX 2OI3A 3LH5A 4LNPA 4ORZA 3VS3A 4GBQA 4R0KA 2EGAA 3NPFA 2O31A 2RQTA 4DEYA 1OOTA 2ESWA 4J9CA 2ED0A 2YT6A 2HSPA 5IXFA 4J9BA 1PKTA 2RMOA 2AKLA 2JMCA 2LQWA 1HSQA 2EYZA 2KE9A 1I0CA 1WI7A 2EGCA 4RTYA 2CUBA 2AKKA 2IIMA 2PNIA 2RNAA 4JPBW 4RTWA 2OJ2A 1BK2A 1CSKA 2LMJA 4A63B 3SHWA 1GCPA 1Y57A 4QT7A 1WX6A 2ENMA 1VYUA 2ROTA 2CDTA 2NWMA 3M0UA 2DMOA 1Z9ZA 1NYFA 1OPKA 5FWBA 4CC2A 2DBKA 2VWFA 2LCSA 2EPDA 4HVVA 2SRCA 2GBQA 2DL7A 2J05A 1U3OA 1ZUKA 1UG1A 3ULRB 1VYTA 2DL5A 3KFVA 2CSQA 1J3TA 1OPLA 2YUNA 2F2XA 1BB9A 2DF6A 3NHNA 2A37A 1JU5C 2C0OA 3ZL7C 5GJVB 1TUCA 2ECZA 1AOJA 1WXUA 1VYVA 1NYGA 2ED1A 4OMQA 1WDXA 3EG0A 2NUZA 3VS7A 1QWEA 4JJBA 2DX1A 1V1CA 1M3CA 1K4US 1FMKA 2SEMA 1QWFA 4OMOA 4D8KA 2KT1A 5IH2A 4J9IA 1X69A 1SEMA 4OMLA 1BU1A 1NLPC 1ZLMA 4Z88A 2F2VA 2D1XA 4D8DA 2LZ6B 2A28A 1RLPC 4OMMA 4J9DA 2DL4A 3EG1A 1W70A 3H41A 4F14A 1NM7A 3PVLA 1WFWA 3SEMA 1QKXA 1YNZA 1X27A 5IXBA 4GLMA 2DVJA 3I5SA 3REAB 2J6OA 3H0HA 4ESRA 2VKNA 2K79A 2I0NA 1T0HA 2YUOA 2DM1A 1AWOA 2C0IA 4JJDA 1E6HA 3A98A 1UTIA 1OV3A 2EYXA 4AG2C 3QWYA 2BZXA 3VS6A 2CREA 3TSWA 1QKWA 2L3QA 3I35A 2O88A 1GL5A 1UGVA 4FSSA 1Z9QA 3GBQA 2JS0A 1WYXA 5I11A 2M0YA 2ROLA 2FG0A 2HCKA 2LX7A 1WXBA 1U5SA 2OAWA 4RTUA 5IHNA 4LUDA 1ZBJA 5L23A 3VS2A 2GNCA 4IIMA 2K2MA 3EGUA 3EHQA 2RQRA 2FPEA 2CH4A 2JTEA 2FRWA 2AK5A 4X1VA 1E7OA 1B3QA 3TSZA 1AWJA 3THKA 3M0QA 2DNUA 3EG2A 2A36A 1Y0MA 2L3SA 2GGRA 4Y92A 4M4ZA 1GFCA 1K1ZA 1JQQA 2JXBA 5FW9A 2DRMA 2EKHA 3M0TA 3C0CA 1YN8A 1AWWA 2J7IA 3M0SA 5IHKA 1YP5A 5GJWB 2EVRA 3RNJA 2DRKA 2LP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ABQ A;  2KNB B;  1AZG B;  1B07 A;  1G83 A;  2D8H A;  4LN2 A;  3NGP A;  5FWC A;  2RN8 A;  2X3X D;  1M30 A;  1AWX A;  4EIK A;  2HEQ A;  2DYB A;  2YDL A;  4RTX A;  2MOX A;  1N5Z A;  1W6X A;  2PZ1 A;  1X6G A;  4RTV A;  2AZS A;  3M0R A;  1ZUU A;  3PE0 A;  3VRZ A;  1GCQ C;  1X2K A;  2H8H A;  4HCK A;  2J6F A;  2KXD A;  1SRL A;  4OMN A;  1NEG A;  2EBP A;  2JMA A;  4AFU C;  2V1Q A;  1K0X A;  2J6K A;  1LCK A;  4ZNX A;  1T0J A;  4J9E A;  2HBW A;  2A08 A;  2CSI A;  2G6F X;  1I07 A;  2DBM A;  4AFQ C;  4Z8A A;  2GQI A;  1MV3 A;  3H0I A;  2FEI A;  2CH4 W;  1WXT A;  1YWO A;  2BZ8 A;  2EYW A;  4K11 A;  2LJ3 A;  2HDA A;  1H3H A;  1WIE A;  5HCK A;  2E5K A;  2M51 A;  3UA6 A;  1HJD A;  2JS2 A;  2K7A A;  2KYM A;  4HVW A;  4IIO A;  1K0S A;  4J9G A;  2YSQ A;  4JZ4 A;  1RI9 A;  1UJY A;  1ZX6 A;  2KRM A;  1JEG A;  1G2B A;  1SPK A;  2KXC A;  3I5R A;  2P4R A;  1CKA A;  1H92 A;  2L0A A;  4CC3 A;  3VS5 A;  1UHF A;  1RUW A;  1M8M A;  1UJ0 A;  2K3B A;  1AZE A;  2EQI A;  2KBT A;  1PRM C;  2QDL A;  3JV3 A;  2GTO A;  2PTK A;  1SHG A;  1M3A A;  1JXO A;  1GBQ A;  2KRN A;  2KRO A;  1KIK A;  2EW3 A;  1AD5 A;  1TUD A;  2RPN A;  2DIL A;  2RQW A;  2FRY A;  4RTZ A;  1S1N A;  4JJC A;  1AEY A;  1WA7 A;  1FYN A;  1U06 A;  2CUD A;  2DJQ A;  2DA9 A;  1ZUY A;  2KRS A;  4HVU A;  2L3P A;  1WLP B;  1X2Q A;  2ABL A;  1QCF A;  1X6B A;  1T3S A;  4AG1 C;  1PNJ A;  1KSW A;  1JXM A;  4LE9 A;  5EC7 A;  1GCQ A;  3R6N A;  4DEX A;  3VS1 A;  3H0F A;  2KYB A;  2DLP A;  1YWP A;  2BZY A;  1H8K A;  2BTT A;  2FPF A;  3PVQ A;  3I9Q A;  1ARK A;  3VS4 A;  2L2P A;  1SRM A;  1GBR A;  3M0P A;  5I22 A;  1EFN A;  2D0N A;  2LQN A;  3EHR A;  1GFD A;  2K9G A;  4WCI A;  2B86 A;  2JT4 A;  2LJ1 A;  4F17 A;  3RBB B;  2F2W A;  1ZSG A;  1JO8 A;  1K76 A;  4RTT A;  1M3B A;  1UDL A;  4J9H A;  4CC7 A;  4E6R A;  1VA7 A;  1T3L A;  1AVZ C;  2X3W D;  4OMP A;  1BBZ A;  1UFF A;  3U23 A;  1YCS B;  2AZV A;  2JW4 A;  4KRT A;  1NG2 A;  2JM8 A;  1PWT A;  2O2O A;  2MCN A;  2JM9 A;  2KEA A;  2LNH B;  2YUP A;  1ABO A;  2DL8 A;  4HXJ A;  4CC4 B;  4RUG A;  1OEB A;  3FJ5 A;  2FPD A;  2YUQ A;  5ECA A;  2K6D A;  5IHI A;  2J06 A;  2CT4 A;  3TVT A;  1PHT A;  1CKB A;  1NEB A;  2W0Z A;  1QLY A;  4AFS C;  2KT8 A;  1UEC A;  4AFZ C;  1MV0 B;  1I1J A;  3NMZ C;  4Z89 A;  3CQT A;  2DL3 A;  3UA7 A;  3REB B;  1NLO C;  2O9S A;  2D8J A;  4F16 A;  3UAT A;  2RF0 A;  1W1F A;  2FO0 A;  2LJ0 A;  2EYY A;  3IQL A;  3O5Z A;  1RLQ C;  4JZ3 A;  1E6G A;  1SSH A;  2GTJ A;  2RQU A;  2XMF A;  4LUE A;  2KGT A;  1PRL C;  1A0N B;  2CT3 A;  1M27 C;  1XOV A;  1IO6 A;  2W10 A;  1UUE A;  1UHC A;  1X43 A;  1KJW A;  1HD3 A;  1PKS A;  3EG3 A;  2VVK A;  1MUZ A;  2O9V A;  3UF4 A;  1GRI A;  2KR3 A;  1TG0 A;  2RQV A;  3VS0 A;  2EGE A;  1K9A A;  2C0T A;  2V1R A;  1UE9 A;  2DE0 X;  1SHF A;  3VRY A;  4J9F A;  1KFZ A;  2MIO A;  3QWX X;  2OI3 A;  3LH5 A;  4LNP A;  4ORZ A;  3VS3 A;  4GBQ A;  4R0K A;  2EGA A;  3NPF A;  2O31 A;  2RQT A;  4DEY A;  1OOT A;  2ESW A;  4J9C A;  2ED0 A;  2YT6 A;  2HSP A;  5IXF A;  4J9B A;  1PKT A;  2RMO A;  2AKL A;  2JMC A;  2LQW A;  1HSQ A;  2EYZ A;  2KE9 A;  1I0C A;  1WI7 A;  2EGC A;  4RTY A;  2CUB A;  2AKK A;  2IIM A;  2PNI A;  2RNA A;  4JPB W;  4RTW A;  2OJ2 A;  1BK2 A;  1CSK A;  2LMJ A;  4A63 B;  3SHW A;  1GCP A;  1Y57 A;  4QT7 A;  1WX6 A;  2ENM A;  1VYU A;  2ROT A;  2CDT A;  2NWM A;  3M0U A;  2DMO A;  1Z9Z A;  1NYF A;  1OPK A;  5FWB A;  4CC2 A;  2DBK A;  2VWF A;  2LCS A;  2EPD A;  4HVV A;  2SRC A;  2GBQ A;  2DL7 A;  2J05 A;  1U3O A;  1ZUK A;  1UG1 A;  3ULR B;  1VYT A;  2DL5 A;  3KFV A;  2CSQ A;  1J3T A;  1OPL A;  2YUN A;  2F2X A;  1BB9 A;  2DF6 A;  3NHN A;  2A37 A;  1JU5 C;  2C0O A;  3ZL7 C;  5GJV B;  1TUC A;  2ECZ A;  1AOJ A;  1WXU A;  1VYV A;  1NYG A;  2ED1 A;  4OMQ A;  1WDX A;  3EG0 A;  2NUZ A;  3VS7 A;  1QWE A;  4JJB A;  2DX1 A;  1V1C A;  1M3C A;  1K4U S;  1FMK A;  2SEM A;  1QWF A;  4OMO A;  4D8K A;  2KT1 A;  5IH2 A;  4J9I A;  1X69 A;  1SEM A;  4OML A;  1BU1 A;  1NLP C;  1ZLM A;  4Z88 A;  2F2V A;  2D1X A;  4D8D A;  2LZ6 B;  2A28 A;  1RLP C;  4OMM A;  4J9D A;  2DL4 A;  3EG1 A;  1W70 A;  3H41 A;  4F14 A;  1NM7 A;  3PVL A;  1WFW A;  3SEM A;  1QKX A;  1YNZ A;  1X27 A;  5IXB A;  4GLM A;  2DVJ A;  3I5S A;  3REA B;  2J6O A;  3H0H A;  4ESR A;  2VKN A;  2K79 A;  2I0N A;  1T0H A;  2YUO A;  2DM1 A;  1AWO A;  2C0I A;  4JJD A;  1E6H A;  3A98 A;  1UTI A;  1OV3 A;  2EYX A;  4AG2 C;  3QWY A;  2BZX A;  3VS6 A;  2CRE A;  3TSW A;  1QKW A;  2L3Q A;  3I35 A;  2O88 A;  1GL5 A;  1UGV A;  4FSS A;  1Z9Q A;  3GBQ A;  2JS0 A;  1WYX A;  5I11 A;  2M0Y A;  2ROL A;  2FG0 A;  2HCK A;  2LX7 A;  1WXB A;  1U5S A;  2OAW A;  4RTU A;  5IHN A;  4LUD A;  1ZBJ A;  5L23 A;  3VS2 A;  2GNC A;  4IIM A;  2K2M A;  3EGU A;  3EHQ A;  2RQR A;  2FPE A;  2CH4 A;  2JTE A;  2FRW A;  2AK5 A;  4X1V A;  1E7O A;  1B3Q A;  3TSZ A;  1AWJ A;  3THK A;  3M0Q A;  2DNU A;  3EG2 A;  2A36 A;  1Y0M A;  2L3S A;  2GGR A;  4Y92 A;  4M4Z A;  1GFC A;  1K1Z A;  1JQQ A;  2JXB A;  5FW9 A;  2DRM A;  2EKH A;  3M0T A;  3C0C A;  1YN8 A;  1AWW A;  2J7I A;  3M0S A;  5IHK A;  1YP5 A;  5GJW B;  2EVR A;  3RNJ A;  2DRK A;  2LP5 A; 
#chains in the Genus database with same CATH topology
 2KNB B;  2OTL Q;  1B07 A;  1G83 A;  2DK3 A;  5CK9 A;  4LN2 A;  2X3X D;  2LQK A;  3HPW A;  4E7K A;  2PZ1 A;  1X6G A;  4RTV A;  2AZS A;  3VRZ A;  3HHT B;  1KQS S;  4HCZ A;  3I55 Q;  3VYH B;  2J6F A;  3CC2 Q;  4OMN A;  3A8G B;  5LJ5 f;  2JMA A;  2YHT A;  5GAN 5;  4FL6 A;  1K0X A;  5GAN 4;  1QMC A;  3PIP A;  2EQK A;  2DIG A;  2G6F X;  1G3Y A;  4EMK C;  1OU8 A;  4AFQ C;  3DB4 A;  2XDP A;  4XU3 A;  1VQ6 T;  2GQI A;  3OBY A;  3HTR A;  2ZPG B;  2CP3 A;  2AHJ B;  2LJ3 A;  2ZPE B;  2HDA A;  4ZN1 A;  3JB9 G;  3CMA T;  2JNG A;  2YLB A;  2XD0 A;  1QP3 A;  2K7A A;  4PJJ A;  3EGX B;  3L42 A;  3DLL A;  1QP2 A;  1N8R C;  4JS4 A;  4C92 D;  1RI9 A;  1UJY A;  2LRQ A;  5KYY A;  3M4Y A;  1SPK A;  3X24 B;  4OP0 A;  2PU9 B;  1VQ6 Q;  4CC3 A;  4UC4 A;  1NJI R;  2CP7 A;  2I2L A;  1RUW A;  2M02 A;  1PRM C;  4XTW A;  3JV3 A;  2GTO A;  2ZAE A;  4M7D G;  1GBQ A;  2KRN A;  4LD6 A;  3LGF A;  1M9S A;  2RPN A;  2DIL A;  2RQW A;  3LGL A;  4M75 E;  3JB9 D;  1SG5 A;  2K3X A;  1S1N A;  1AT1 B;  2CP2 A;  1U06 A;  2DA9 A;  1RL2 A;  4XTU A;  1MMG A;  1MHN A;  4HVU A;  1WLP B;  4C0G A;  2P0P A;  1KG1 A;  3MP8 A;  3CCV T;  4FCY A;  2HKQ B;  3E9G A;  3MP1 A;  1U8R A;  3CMA A;  4M7D C;  1GCQ A;  1I8F A;  2CYZ B;  2DLP A;  4A4G A;  4M75 A;  4X9C A;  5CKD A;  3PVQ A;  3RKY A;  4M78 B;  3VS4 A;  4DBQ A;  4KT0 E;  2X4J A;  1VQL A;  1EFN A;  2D0N A;  3QII A;  1GFD A;  2YLC A;  4ZN3 A;  4OGE A;  3GOX A;  3N5B B;  3CCU T;  2JT4 A;  4ELZ C;  4FM4 B;  3H8Z A;  4MDW A;  1VQ5 Q;  1YIT A;  4M7D E;  1SSF A;  4HCC A;  1WHL A;  2F2W A;  1JO8 A;  3FIF A;  4M78 G;  4CC7 A;  5LJ5 e;  1T3L A;  4ANJ A;  2HKN A;  2HL5 C;  1UFF A;  2M0O A;  3U23 A;  2COZ A;  3CCR T;  2K4Y A;  1M1K C;  4KH1 B;  1M90 R;  2JM8 A;  2RD1 A;  1N6A A;  1PWT A;  1LNX A;  1MNE A;  2KEA A;  5FRM A;  4CC4 B;  3I56 Q;  3FJ5 A;  2QAS A;  2FPD A;  4OB3 B;  4NL3 A;  4FT2 A;  3OYJ A;  2CT4 A;  1PHT A;  1NEB A;  5GAN 7;  4AFS C;  1MV0 B;  1I1J A;  1VQP A;  4RCB A;  4C5G A;  3HFO A;  2KI7 A;  3UA7 A;  3ZEH A;  1VQP Q;  4V2S A;  1BYM A;  1VQM T;  1AHJ B;  1PM3 A;  4F16 A;  1RI0 A;  5KYU B;  3UAT A;  1WPY A;  2RF0 A;  1W1F A;  2EYY A;  3O5Z A;  1E6G A;  3PGG A;  2QEX T;  4LUE A;  4J5Y A;  3CCE Q;  3VUZ A;  2RHU A;  3MET A;  1M27 C;  3OYA A;  4PJO C;  4M75 F;  1RAD B;  2W10 A;  1UHC A;  4QQ6 A;  1KJW A;  3J81 E;  1XJW B;  1ZA1 B;  1D1B A;  1HD3 A;  5D7U A;  2A7Y A;  1VQM Q;  3VV0 A;  2O9V A;  3UF4 A;  3EG9 B;  4BD3 A;  1K9M U;  1KC8 R;  3OYH A;  5LJ3 d;  1K9A A;  2C0T A;  4PJM A;  4J9F A;  2MIO A;  2M16 A;  2LVM A;  4LNP A;  3P8B B;  3VS3 A;  2DKG A;  2E4H A;  2RJD A;  3CCR A;  2WAC A;  3NPF A;  2O31 A;  2HMA A;  1OOT A;  3OS5 A;  2ESW A;  4J9C A;  3JCM V;  3QUI A;  3NFC A;  3VYG A;  4M75 D;  3OYI A;  2KE9 A;  1I0C A;  3L2R A;  5GAM j;  1TU0 B;  3G4S T;  2V8J A;  4M75 B;  4RTW A;  5GAN 6;  1VQN T;  2LMJ A;  4A63 B;  1GCP A;  1EIF A;  1OU9 A;  2DMO A;  3T9N A;  1Z9Z A;  4JRQ A;  1NYF A;  2FZG B;  3WVD B;  1QVF S;  2MI6 A;  2VWF A;  2RJF A;  3JCM Q;  3CCM T;  3OW2 S;  2GBQ A;  2DL7 A;  4M7A A;  1D3B A;  3OS0 A;  1ZUK A;  4M7A F;  1UG1 A;  1YI2 T;  3CME A;  4EPC A;  2DL5 A;  1VQ7 Q;  4KBM B;  5LJ3 h;  4EMK B;  2YUN A;  1YIT Q;  1X01 A;  4MZP A;  2D0Q B;  2DF6 A;  3ZFJ A;  4JRI A;  2O4X A;  5CO7 A;  3M9Q A;  5GJV B;  2NLU A;  2ECZ A;  1K9M C;  2DVE A;  3RMS A;  5A2Q E;  5AYF A;  2LCL A;  1BCM A;  2DX1 A;  2QA4 A;  1FMK A;  1IHW A;  4J9I A;  4XU2 A;  1RAH B;  4IKF A;  1NLP C;  3WXM B;  4X9D A;  2DTI A;  3FRN A;  3OW2 P;  2F2V A;  4M77 C;  4D8D A;  3X20 B;  1D0X A;  1RAE B;  3PFS A;  5GAN 8;  3EG1 A;  5A0L A;  3LWI A;  1WFW A;  4F7U B;  4N4G A;  1PC0 A;  4CRI A;  4GLM A;  2DVJ A;  1BI2 A;  1W2B S;  2HZY A;  2EFI A;  1T0H A;  1JJ2 A;  2C0I A;  1IRX A;  3A98 A;  1HXD A;  1KQS A;  3CCM A;  3QWY A;  3TSW A;  1GL5 A;  1WHH A;  1UGV A;  4C8Q F;  4JLG A;  4DOV A;  3I55 A;  4PJO G;  1YJW Q;  4F7U E;  5KCH A;  1N8R R;  4EDU A;  2HCK A;  2EQJ A;  2DZC A;  4RTU A;  2EQM A;  4PL6 A;  3CMA Q;  2X51 A;  1C6V X;  4OB2 B;  1VQO A;  1YJ9 T;  3RMQ A;  4IIM A;  2HL3 A;  2K2M A;  2MWO A;  3G6E Q;  1NJI C;  5KE2 A;  2X35 A;  1V76 A;  1VQL T;  5CR2 A;  2WSE E;  1YI2 A;  4LDV A;  3V7S A;  2YRD A;  2JTE A;  3HP9 A;  2AK5 A;  1I81 A;  3TSZ A;  1YIJ A;  3OY9 A;  3V7R A;  1RAG B;  3EG2 A;  1G3T A;  3R6O A;  1Y7X A;  3ZBD A;  2A36 A;  3JB9 H;  3G71 Q;  2LCC A;  3P8H A;  1GFC A;  2RK1 A;  1VQK A;  2DXC A;  3TU4 K;  4E7L A;  2RH2 A;  4M78 F;  8AT1 B;  2J7I A;  1TS9 A;  5IHK A;  1QVG S;  1VQK T;  2JN0 A;  2E3I A;  3M57 A;  3RKX A;  1YP5 A;  2EVR A;  2DRK A;  4OVA A;  1X6O A;  3MEV A;  4J6Y A;  3JB9 F;  1QVG A;  5I2M A;  1W2B A;  3OYM A;  3CEY A;  3NGP A;  2RN8 A;  1M30 A;  2QDY B;  4L59 A;  4FYX B;  4RG8 A;  3M0R A;  1VQ8 Q;  3RKW A;  5CQY A;  3EGD A;  1QCN A;  3A8M B;  4HCK A;  2DEQ A;  1NBE B;  1S72 A;  1VQ4 Q;  1LCK A;  1IB8 A;  3G71 A;  1OX8 A;  2A08 A;  4RG2 A;  2OTL T;  2R57 A;  5KCO A;  2FB7 A;  1I07 A;  3HRU A;  5KH6 A;  1Q86 C;  2FEI A;  2CH4 W;  3QZ9 B;  1YWO A;  4K11 A;  3SWN A;  3VUB A;  2QTX A;  5CIU A;  2KYM A;  2DIQ A;  4IIO A;  3UT1 A;  3RER A;  4J9G A;  2KY9 A;  2E12 A;  1VIE A;  2KRM A;  5HKC A;  1RAI B;  5DLQ E;  3I5R A;  2KXC A;  2RHZ A;  4C92 G;  2P4R A;  4IUP A;  1CKA A;  1W4S A;  3VS5 A;  2DFU A;  5GAN 3;  3LX7 A;  5FU7 B;  1UHF A;  3QDR B;  5CQX A;  1AZE A;  2KBT A;  3G6E T;  4R55 A;  4DA4 A;  1Q82 C;  3CBO A;  4ZTF A;  5C6S A;  3M5A A;  5GAN j;  1QVF P;  2BE7 D;  3JB9 I;  2YWW A;  2EW3 A;  5GMK e;  4QVZ A;  2IPO B;  3GNF B;  3O8V A;  1NZ9 A;  2A0F B;  4J83 A;  3JCM e;  2QYZ A;  3CME T;  2XK0 A;  3EGX A;  1IZ6 A;  5GMK m;  3EFO A;  2L3P A;  2ZZD A;  5L8R E;  1X2Q A;  2ABL A;  1QCF A;  3CCJ A;  3VJP A;  3C12 A;  1VQ9 Q;  1N9S A;  3SDZ A;  1PCX A;  4HT8 A;  2DEU A;  4LE9 A;  4X34 A;  1C1A A;  2XKO C;  3HL8 A;  2QA4 Q;  1TUG B;  3A8O B;  3TEE A;  3H0F A;  5LJ5 j;  1YWP A;  3JRZ A;  1H8K A;  1TTH B;  2FPF A;  3I9Q A;  1ZA2 B;  1ARK A;  4PFO A;  1GBR A;  1VQ9 T;  3SWN B;  3M0P A;  3JCM b;  3OYE A;  2LQN A;  3EHR A;  3CD6 A;  4WCI A;  2B86 A;  3UPU A;  3C94 A;  3CME Q;  1SF9 A;  4P5N A;  1UDL A;  3NTH A;  1U1T A;  3F70 A;  2IG0 A;  4BUG A;  5CKH A;  3H9N A;  1VQ4 A;  1YCS B;  1Q82 U;  2CZ7 B;  1R77 A;  4EMG A;  4KRT A;  1NG2 A;  1K8A R;  3M54 A;  4E7S A;  1K73 R;  3INZ A;  5GAM d;  4A4H A;  1YI2 Q;  2XU8 A;  5LJ3 f;  2MCN A;  2LNH B;  5GAN 2;  4M7D F;  5GAO l;  4M7D A;  2DL8 A;  4L5G A;  4HXJ A;  4PJL A;  1Q81 U;  3L1A A;  2RJC A;  5CCA A;  2KSS A;  2E6Z A;  3MEA A;  2RHI A;  1JB0 E;  4BY6 C;  2LTO A;  1IGU A;  2LNV A;  3PNW C;  5CKE A;  2W0Z A;  4C5H A;  4KGX B;  4J7F A;  4AFZ C;  3PIO A;  4C8Q D;  4FSX A;  4XTX A;  4Z89 A;  3S3O A;  4FT4 A;  4C8Q E;  3REB B;  2O9S A;  2D8J A;  1YFN A;  2JOY A;  4JZ3 A;  1SSH A;  4Z02 A;  4A4E A;  4N0A A;  2KGT A;  4QVD A;  5GAN g;  4M7A B;  1WNL A;  3DB3 A;  3RES A;  3AHU A;  2RA2 A;  1TWB A;  3QHS A;  1XOV A;  3A8H B;  5GAN e;  3OW2 A;  1UUE A;  1QQJ A;  1BKB A;  5FLX E;  1LVK A;  2VVK A;  4FYW B;  1M90 C;  5M9O A;  4XU1 A;  2KR3 A;  4E7H A;  2FZK B;  1UE9 A;  2DE0 X;  1SHF A;  3VRY A;  3LH5 A;  2O4X B;  2OTJ A;  4QVC A;  5D6X A;  4R0K A;  2EGA A;  2XHC A;  1VQK Q;  4PJN A;  2RQT A;  3QJY A;  2X9H A;  2ZPB B;  3M56 A;  4LDY A;  2YT6 A;  1VQ5 A;  4HKE A;  5C0M A;  1KHC A;  1QVF A;  3CCL Q;  5KYX A;  2ZPH B;  2PNI A;  2WSC E;  2KQW A;  1BK2 A;  1CSK A;  3CCQ Q;  4LD9 K;  1Y57 A;  4QT7 A;  2COY A;  3MPU B;  4O5V A;  1WX6 A;  2ENM A;  1VYU A;  3GF5 A;  1B34 B;  1M1F A;  1M8V A;  1PG5 B;  1OPK A;  5FWB A;  2QG9 B;  3MO8 A;  2GFA A;  3I56 T;  3BY7 A;  5HY6 A;  4CC2 A;  1Q86 U;  2OTL A;  3G4S Q;  1YHQ T;  2ZCF B;  2DER A;  2EPD A;  2J05 A;  4AT1 B;  1KC8 C;  3CCR Q;  2PVD B;  1YHQ A;  2JZ2 A;  1I5O B;  3BDU A;  1TUC A;  5GMK j;  2QXF A;  3LYI A;  2MF2 A;  1VYV A;  4J6W A;  4OMQ A;  2HBP A;  3EG0 A;  2EJG A;  1V1C A;  1M3C A;  2QK0 A;  4M7D B;  4QQG A;  1K4U S;  2F1L A;  3KBG A;  2DAQ A;  1X69 A;  2Y90 A;  4XTY A;  1BU1 A;  5LJ3 j;  4BDZ A;  2COW A;  4PJO A;  4M77 G;  1VQ9 A;  1Y96 A;  1X75 C;  2A28 A;  4J9D A;  2VC8 A;  3H41 A;  3M59 A;  1QVG P;  4L6V 5;  1YNZ A;  5IXB A;  2RB6 A;  4B9W A;  3M4G A;  3REA B;  5HK0 A;  3H0H A;  2VKN A;  4M7A C;  2K57 A;  1JJ2 P;  2LC4 A;  4O6J A;  1WHJ A;  1HYO A;  2DM1 A;  2OTJ Q;  4E2F B;  4JJD A;  1OV3 A;  2EYX A;  1YIT T;  4PJO E;  1QKW A;  2O88 A;  1TSF A;  2LQ8 A;  2RHX A;  3TRE A;  5I11 A;  1PD1 A;  2BUD A;  5LJ5 h;  4F04 B;  3RIR A;  1U5S A;  3G1J A;  2DJZ A;  3EH1 A;  4LUD A;  2E6N A;  1PSE A;  2MWP A;  3CBP A;  5L23 A;  1YJ9 Q;  2HQH A;  4M7A G;  2GNC A;  1Q7Y U;  3EGU A;  4A54 A;  1I5L A;  2RQR A;  3JCM c;  2E3H A;  3CCJ T;  1VQO Q;  2CH4 A;  2KAF A;  3L2V A;  2B8A A;  3GLX A;  3GPL A;  3CCL A;  1M1G A;  4JDS A;  3OQ5 A;  1HK9 A;  4ZTJ A;  3THK A;  2OAU A;  2EJ9 A;  3M0Q A;  5GAM g;  4M4Z A;  2QEX A;  1UGR B;  2DRM A;  2RI5 A;  3J80 E;  1BI0 A;  2K3Y A;  1D1C A;  4PKC C;  1D1A A;  4ZGJ B;  3V8L A;  5GMK h;  2K5I A;  2VXF A;  4JLI A;  1ABQ A;  4C5E A;  3EGD B;  1RAB B;  2QQB A;  4RMO A;  2D8H A;  3BW1 A;  1AWX A;  4EIK A;  2HEQ A;  1BIB A;  4RTX A;  1OQK A;  4XAX B;  1N5Z A;  4GY5 A;  3WVE B;  3A8L B;  1ZUU A;  4BE2 A;  2CZ6 B;  5LJ5 d;  4DBF A;  1NE8 A;  5KYW B;  2DYI A;  4PJO D;  1X2K A;  4PK4 A;  5KYN A;  1BI3 A;  1JRI A;  1SRL A;  4HCB A;  1NEG A;  1Y71 A;  3CC7 Q;  2V1Q A;  2J6K A;  1KD1 R;  2KDS A;  4C92 A;  5CKB A;  2QEX Q;  4ZNX A;  2HBW A;  2CKK A;  4ATO A;  2CSI A;  4ZGE B;  4NS5 A;  2DBM A;  2NUP B;  1YHQ Q;  1MV3 A;  2P84 A;  3H0I A;  1Q7Y R;  3E9F A;  2BZ8 A;  5HCK A;  2M51 A;  1UGS B;  2QQ9 A;  1VQL Q;  4KUD K;  3OA6 A;  3CCS T;  2F5K A;  4HVW A;  3CCS Q;  2XID A;  3MEW A;  2VB6 A;  1VQN Q;  3OYB A;  4IUR A;  3E19 A;  4JZ4 A;  2V8I A;  1WGS A;  1G2B A;  4M75 C;  2QQA A;  1H92 A;  1WJS A;  2L0A A;  4QQD A;  1MND A;  1Y07 A;  1Q7Y C;  2F69 A;  4EMK A;  4PJO F;  4RKU E;  5FU6 C;  4M77 D;  1M8M A;  1UJ0 A;  2K3B A;  3X28 B;  1GXI E;  2EQI A;  2QGG A;  2GCX A;  3CC7 T;  1FX7 A;  1NPP A;  2PTK A;  2L3R A;  1M3A A;  3KXT A;  1KIK A;  4C5I A;  1TUD A;  2NUT B;  2M9U A;  2FRY A;  4RTZ A;  2ZGW A;  2GQV A;  1N27 A;  4JJC A;  4YTL A;  2HQX A;  1WA7 A;  1Q82 R;  1FYN A;  3J7A F;  1ZUY A;  4HA8 A;  2CP0 A;  4IUU A;  5FU6 B;  2ZPF B;  1X6B A;  4M78 C;  2RJE A;  4AG1 C;  2R5A A;  4HT9 A;  1DJ7 B;  4PLI A;  5EC7 A;  7AT1 B;  3QPH A;  3R6N A;  3AT1 B;  3VS1 A;  2KYB A;  4JS5 A;  2EKO A;  1YJN Q;  2MMP A;  2DD4 A;  2L2P A;  2DD5 A;  2LT1 A;  1KQ2 A;  4B6M A;  3QSU A;  3EAE A;  2HQE A;  2JUF A;  3CC4 T;  1IHV A;  3RBB B;  3CBM A;  1TH7 A;  3FJP A;  1FXX A;  1ZSG A;  3CD6 Q;  3P8D A;  4C0D B;  1M3B A;  4FYY B;  4J9H A;  4E6R A;  1S72 Q;  1VA7 A;  5I21 A;  2P0K A;  2JVV A;  1AVZ C;  4MML A;  1QW1 A;  2DPP B;  2X4X A;  1BBZ A;  4A53 A;  3M58 A;  3OYN A;  1ZBX A;  2AZV A;  1VQM A;  5EG2 A;  1IGQ A;  2KVQ G;  2AIR B;  3SWN C;  4BB7 A;  3I56 A;  2JM9 A;  4FIB A;  3SB2 A;  2YUP A;  1ABO A;  5J26 A;  1D3B B;  3QBY A;  1N8R U;  2H3E B;  3JB9 J;  4N4H A;  3CXC S;  1BIA A;  1K8A U;  5HK3 A;  2K6D A;  5IHI A;  2J06 A;  4M78 A;  4BI3 A;  1XNI A;  5GAN d;  1MMN A;  3BE3 A;  1KQ1 A;  2NYS A;  4GLK A;  1QLY A;  1UEC A;  1BI1 A;  3CXC P;  2KMT A;  1VQ5 T;  3QJ6 A;  3NMZ C;  3CQT A;  1F1B B;  1QVP A;  3JSC A;  1NLO C;  5FRO A;  2BIV A;  2JTM A;  4BI8 B;  3JCM X;  2LDM A;  3X25 B;  2GTJ A;  4Y28 E;  4C0F A;  2RQU A;  2XMF A;  3LW5 E;  3RR6 A;  4F7U G;  1PD0 A;  3S3N A;  4A4K A;  1YJN A;  1IO6 A;  2RK2 A;  2RI2 A;  4EMH A;  1X43 A;  4OB0 B;  2LT4 A;  4C8Q A;  2E10 A;  1PKS A;  2QAZ A;  5GAM h;  2HNI A;  4IUT A;  4M77 B;  4XQ3 A;  1K8A C;  1MUZ A;  3QYG B;  1GRI A;  5J39 A;  5A0G A;  2RQV A;  1UB4 A;  2NUT A;  2V1R A;  2P0Q A;  1NJI U;  3CCM Q;  1KFZ A;  2MK5 A;  3QWX X;  2OI3 A;  2MYS A;  1R8O B;  4ORZ A;  2DXT A;  3FDR A;  4GBQ A;  4TVR A;  3S3M A;  4C8Q B;  2P4T A;  4DEY A;  2ED0 A;  2HSP A;  5IXF A;  5GAN h;  2D6F A;  5KYW A;  2AKL A;  2JMC A;  1OX9 A;  1VQ7 T;  4PFZ A;  2EGC A;  4RTY A;  4VUB A;  2IIM A;  3CPW P;  1M5Q 1;  1WHG A;  3ME9 A;  2OJ2 A;  2FYK A;  3L2U A;  2GF7 A;  3CCQ A;  1S72 T;  2ROT A;  2NWM A;  1KC8 U;  3M0U A;  1V29 B;  1B7T A;  1FWZ A;  1FMW A;  5IT9 E;  4XTZ A;  3EG9 A;  1Q95 G;  3NTI A;  3MP6 A;  3LWH A;  3CCQ T;  2SRC A;  1M4Z A;  1U3O A;  1VOM A;  1KK7 A;  1VYT A;  1J3T A;  3KFV A;  2CSQ A;  3HRS A;  3C4S A;  5CAI A;  3NTK A;  3CCU Q;  2CZ0 B;  1VQ4 T;  1BB9 A;  2K5L A;  2VYT A;  1XTD A;  1JU5 C;  3ZL7 C;  2QQS A;  4C92 F;  5J3B A;  4M7D D;  1H3Z A;  2E65 A;  4OF1 A;  1WDX A;  3VS7 A;  1QWE A;  1QWF A;  4OMO A;  2CS7 A;  4D8K A;  3M53 A;  2KT1 A;  3MJX A;  1B34 A;  4FW2 A;  1SEM A;  4OML A;  1ZLM A;  3CCV Q;  4Z88 A;  3CCL T;  3HRT A;  1H64 1;  2LZ6 B;  3FEO A;  3V8J A;  4NOY A;  3DKM A;  3L2W A;  3X26 B;  3RDV A;  1W70 A;  1NM7 A;  2PVG B;  1R0B G;  1X27 A;  4N0A C;  3OMG A;  1OYX A;  1Q86 R;  1UGQ B;  2YUO A;  3DLM A;  2VGM A;  5FU7 C;  1TXQ A;  2G3R A;  2YRC A;  2CRE A;  3I35 A;  1R0C B;  3G4S A;  5D6Y A;  1Z9Q A;  5LJ3 e;  2JS0 A;  1O75 A;  1WYX A;  2ROL A;  3E2U A;  4D6W A;  4WF2 A;  4NL2 A;  1G5V A;  1WXB A;  1QCO A;  4C0Z A;  2OAW A;  3PT9 A;  5IHN A;  6AT1 B;  1ZBJ A;  3VU3 C;  1K73 C;  4LDX A;  5FRN A;  1P92 A;  3VS2 A;  1FMV A;  3EHQ A;  3H6Z A;  3RUX A;  4M78 E;  4JRK A;  3CCS A;  5GAO q;  3E1S A;  1YJW T;  4M7A E;  5CKF A;  4DBR A;  2FRW A;  4X1V A;  1JBM A;  2QGF B;  3BFM A;  2JJ9 A;  2DNU A;  1ACM B;  3JCM f;  2HD0 A;  1G3W A;  1YJW A;  2BE9 B;  1Y0M A;  1KD1 C;  1JJ2 S;  2L3S A;  5GAO p;  3EFO B;  4Y92 A;  5DY9 A;  1JQQ A;  4MZT A;  3OYL A;  5FW9 A;  2EKH A;  1YN8 A;  1VQ8 T;  1AWW A;  1Q81 C;  2EYQ A;  3M0S A;  5A0D A;  3OS1 A;  1KHI A;  2OX7 A;  2QA4 T;  5LJ5 g;  3CC2 A;  1VQ6 A;  4BY6 B;  3GIB A;  3D7S B;  3RNJ A;  3ULR B;  1G8X A;  2ZPI B;  4KUL A;  2CGH A;  1AZG B;  1D09 B;  4FYV B;  2MPX C;  5FWC A;  2DYB A;  2YDL A;  2VGN A;  4XK8 E;  2MOX A;  1SKU B;  4M77 E;  2C06 A;  1W6X A;  3OYG A;  3MHX A;  4M77 F;  3PE0 A;  5DLO A;  1GCQ C;  2H8H A;  2LX9 A;  3VKI A;  1UGP B;  1OI1 A;  2KXD A;  2EBP A;  3OS2 A;  4AFU C;  1N9R A;  4DQ2 A;  5GAO m;  2HAX A;  2E41 A;  4LXC A;  4QKU A;  1T0J A;  2FHD A;  2H3J A;  4J9E A;  2D9T A;  2RHY A;  5I2S A;  4Z8A A;  3QZ5 B;  1M1K U;  1U1S A;  2RM4 A;  1WXT A;  4J8O A;  3PMI A;  2EYW A;  3A1P A;  2KK4 A;  2L5Q A;  4J7I A;  5D6W A;  1H3H A;  3CPW A;  4C8Q C;  1WIE A;  1WQ7 A;  2E5K A;  3UA6 A;  4ME7 A;  4N4I A;  1HJD A;  4II1 A;  4MDX A;  1WJR A;  1WHK A;  2JS2 A;  1K0S A;  2GFU A;  3OSS C;  2Y4Y A;  3TQ7 P;  2YSQ A;  3HKS A;  2VUB A;  1ZX6 A;  3CCV A;  1ZSZ B;  1JEG A;  2V8K A;  2YRV A;  4B9X A;  3JCM J;  1ZHI A;  4M78 D;  2R5M A;  1EZZ B;  4C92 B;  1I4K 1;  3PTA A;  2E5Q A;  1WZO A;  3CCJ Q;  4E47 A;  2QDL A;  3BDL A;  3EH2 A;  5KYY B;  1SHG A;  1K9M R;  3CC2 T;  1Q81 R;  3QYH B;  2PUO B;  5IN1 A;  1JXO A;  4ELY C;  3L2Z A;  4R56 A;  2KRO A;  3JCM g;  1AD5 A;  3JAM E;  1M2V B;  2EIF A;  4RCC A;  2EQU A;  4E7J A;  1AEY A;  2CUD A;  2DJQ A;  2V26 A;  3Q1J A;  1OUL A;  2KRS A;  2DTO A;  4C92 C;  1T3S A;  1YIJ Q;  2DTH A;  1PNJ A;  1EX4 A;  3I55 T;  3JCM h;  3GNG A;  1KSW A;  2PUK B;  4PLL A;  1JXM A;  4OMF B;  4DEX A;  2BZY A;  2BTT A;  1NPR A;  2AT1 B;  3PMT A;  2FL7 A;  1ZQ1 A;  1SRM A;  3LLR A;  4C0D C;  3G71 T;  5I22 A;  5GAM e;  2CZ1 B;  4M75 G;  2K9G A;  3CCE A;  3QDF A;  2LJ1 A;  1VQ7 A;  2X4W A;  1O9S A;  4F17 A;  4BE0 A;  2XDB A;  1K76 A;  1IRE B;  4RTT A;  1D0Y A;  4BDY A;  4F7U A;  4OB1 B;  2DO3 A;  2K5F A;  3CC7 A;  1YCY A;  4MMK A;  2X3W D;  4OMP A;  2E70 A;  2M1H A;  5CVI A;  1M2O A;  1D0Z A;  3HFN A;  3OB9 A;  4M7A D;  4LDU A;  2JW4 A;  4KH0 B;  3ER0 A;  3OMC A;  1WJQ A;  2O2O A;  3FB9 A;  4DBH A;  4IUV A;  5GAM f;  4JJN K;  1TOV A;  1LOJ A;  4RUG A;  1OEB A;  1LJO A;  5GAN f;  2YUQ A;  4CI0 C;  5ECA A;  1WHM A;  1MMD A;  2Y4X A;  1RAF B;  3GP8 A;  1G3S A;  1VQO T;  1YJ9 A;  1M90 U;  2CP6 A;  2E64 A;  2YXY A;  3TVT A;  2VAS A;  2EAY A;  1CKB A;  2X4Y A;  2QTV A;  2KT8 A;  1MGQ A;  4PNO A;  2FZC B;  3UWN A;  3HSB A;  4OGC A;  2DL3 A;  3URG A;  3TCJ A;  2FO0 A;  2LJ0 A;  3CCU A;  3IQL A;  1RLQ C;  3S6W A;  2DXB A;  2O01 E;  1PRL C;  4KGZ B;  5GAO r;  1PSF A;  2CT3 A;  2PQW A;  2R58 A;  1WQW A;  4M77 A;  1UEB A;  1KQS P;  2VXE A;  3OYF A;  3CXC A;  1XQH A;  3G6E A;  3MEU A;  2BKD N;  3EG3 A;  2QI2 A;  1VQP T;  4JRP A;  8ATC B;  2WSF E;  5AT1 B;  1TG0 A;  3VS0 A;  2EGE A;  4XTV A;  2EJF A;  4QW2 A;  2MAM A;  3MKD A;  4KGV B;  3FC3 A;  3OYD A;  5DM7 R;  3OYY A;  4J6X A;  4E7Z A;  4BI4 A;  3L2Q A;  2IVW A;  4Q5W A;  2ATC B;  2RO0 A;  4J9B A;  1PKT A;  2RMO A;  2XDD A;  1YBY A;  2LQW A;  1HSQ A;  2EYZ A;  1KD1 U;  5KYX B;  1WI7 A;  4XU0 A;  3EFR A;  2CUB A;  2AKK A;  3SD4 A;  2RNA A;  4JPB W;  3ASK A;  5GMK l;  1ZSZ C;  2CP5 A;  3LH0 A;  5LL6 S;  3SHW A;  2DZ9 A;  3OYK A;  9ATC B;  1IXD A;  2CDT A;  2HSE B;  3OSV A;  1VQN A;  4PFP A;  1K73 U;  2DBK A;  4KUI A;  1OZ3 A;  2LCS A;  3FLG A;  4HVV A;  2L8D A;  1VIF A;  4F7U F;  1OPL A;  4JUV A;  2F2X A;  2VV5 A;  5GAO n;  3M55 A;  3V7C A;  3CPF A;  3NHN A;  3QXE B;  2OTJ T;  2A37 A;  2C0O A;  3MCA B;  1VUB A;  4A4F A;  3KUF A;  1AOJ A;  1WXU A;  2QQR A;  3C95 A;  1NYG A;  2ED1 A;  1YJN T;  2NUZ A;  1W2B P;  1BCO A;  4JJB A;  4C92 E;  2SEM A;  5IH2 A;  2E1H A;  3CC4 Q;  1MMA A;  2DET A;  4FW1 A;  3SFM A;  3JCM d;  1YIJ T;  2XI9 A;  2D1X A;  1Y96 B;  2JTF A;  1RLP C;  4OMM A;  3UDC A;  5KE3 A;  2DL4 A;  3JCM P;  4F14 A;  3PVL A;  2L89 A;  3OYC A;  3SEM A;  1QKX A;  3I5S A;  1RAC B;  2J6O A;  4ESR A;  1RAA B;  2K79 A;  3JCM W;  2I0N A;  1LPL A;  4E7I A;  3EFS A;  4Y91 A;  3CCE T;  1AWO A;  1E6H A;  1UTI A;  2A3L A;  4AG2 C;  3VS6 A;  2BZX A;  1A0N B;  2L3Q A;  4WTO B;  4FU6 A;  4FSS A;  3GBQ A;  3QG1 A;  2K2V A;  2M0Y A;  2FG0 A;  1VQ8 A;  3A5Z B;  2LX7 A;  5GMK i;  2RI3 A;  5IAY A;  4BE1 A;  3G7Z A;  2Z0W A;  5KYU A;  4MZM A;  4PJO B;  2FPE A;  4BAC A;  4IUQ A;  3V8K A;  3OBW A;  1E7O A;  3CC4 A;  1M2V A;  1B3Q A;  2EWN A;  1AWJ A;  4ZGD B;  3CPW S;  1C0M A;  2F5T X;  3QKJ A;  1M1K R;  2GGR A;  2DXU A;  1K1Z A;  2FVU A;  2JXB A;  2NUP A;  1ZSZ A;  3M0T A;  3C0C A;  3QO3 A;  4AMC A;  4DOW A;  3CD6 T;  4C8Q G;  2XIC A;  1OZ2 A;  5GJW B;  2XG8 D;  5LJ3 g;  2LP5 A;  4LDW A;  2PVO B; 
#chains in the Genus database with same CATH homology
 1ABQ A;  2KNB B;  1AZG B;  1B07 A;  1G83 A;  2D8H A;  4LN2 A;  3NGP A;  5FWC A;  2RN8 A;  2X3X D;  1M30 A;  1AWX A;  4EIK A;  2HEQ A;  2DYB A;  2YDL A;  4RTX A;  2MOX A;  1N5Z A;  1W6X A;  2PZ1 A;  1X6G A;  4RTV A;  2AZS A;  3M0R A;  1ZUU A;  3PE0 A;  3VRZ A;  1GCQ C;  1X2K A;  2H8H A;  4HCK A;  2J6F A;  2KXD A;  1SRL A;  4OMN A;  1NEG A;  2EBP A;  2JMA A;  4AFU C;  2V1Q A;  1K0X A;  2J6K A;  1LCK A;  4ZNX A;  1T0J A;  4J9E A;  2HBW A;  2A08 A;  2CSI A;  2G6F X;  1I07 A;  2DBM A;  4AFQ C;  4Z8A A;  2GQI A;  1MV3 A;  3H0I A;  2FEI A;  2CH4 W;  1WXT A;  1YWO A;  2BZ8 A;  2EYW A;  4K11 A;  2LJ3 A;  2HDA A;  1H3H A;  1WIE A;  5HCK A;  2E5K A;  2M51 A;  3UA6 A;  1HJD A;  2JS2 A;  2K7A A;  2KYM A;  4HVW A;  4IIO A;  1K0S A;  4J9G A;  2YSQ A;  4JZ4 A;  1RI9 A;  1UJY A;  1ZX6 A;  2KRM A;  1JEG A;  1G2B A;  1SPK A;  2KXC A;  3I5R A;  2P4R A;  1CKA A;  1H92 A;  2L0A A;  4CC3 A;  3VS5 A;  1UHF A;  1RUW A;  1M8M A;  1UJ0 A;  2K3B A;  1AZE A;  2EQI A;  2KBT A;  1PRM C;  2QDL A;  3JV3 A;  2GTO A;  2PTK A;  1SHG A;  1M3A A;  1JXO A;  1GBQ A;  2KRN A;  2KRO A;  1KIK A;  2EW3 A;  1AD5 A;  1TUD A;  2RPN A;  2DIL A;  2RQW A;  2FRY A;  4RTZ A;  1S1N A;  4JJC A;  1AEY A;  1WA7 A;  1FYN A;  1U06 A;  2CUD A;  2DJQ A;  2DA9 A;  1ZUY A;  2KRS A;  4HVU A;  2L3P A;  1WLP B;  1X2Q A;  2ABL A;  1QCF A;  1X6B A;  1T3S A;  4AG1 C;  1PNJ A;  1KSW A;  1JXM A;  4LE9 A;  5EC7 A;  1GCQ A;  3R6N A;  4DEX A;  3VS1 A;  3H0F A;  2KYB A;  2DLP A;  1YWP A;  2BZY A;  1H8K A;  2BTT A;  2FPF A;  3PVQ A;  3I9Q A;  1ARK A;  3VS4 A;  2L2P A;  1SRM A;  1GBR A;  3M0P A;  5I22 A;  1EFN A;  2D0N A;  2LQN A;  3EHR A;  1GFD A;  2K9G A;  4WCI A;  2B86 A;  2JT4 A;  2LJ1 A;  4F17 A;  3RBB B;  2F2W A;  1ZSG A;  1JO8 A;  1K76 A;  4RTT A;  1M3B A;  1UDL A;  4J9H A;  4CC7 A;  4E6R A;  1VA7 A;  1T3L A;  1AVZ C;  2X3W D;  4OMP A;  1BBZ A;  1UFF A;  3U23 A;  1YCS B;  2AZV A;  2JW4 A;  4KRT A;  1NG2 A;  2JM8 A;  1PWT A;  2O2O A;  2MCN A;  2JM9 A;  2KEA A;  2LNH B;  2YUP A;  1ABO A;  2DL8 A;  4HXJ A;  4CC4 B;  4RUG A;  1OEB A;  3FJ5 A;  2FPD A;  2YUQ A;  5ECA A;  2K6D A;  5IHI A;  2J06 A;  2CT4 A;  3TVT A;  1PHT A;  1CKB A;  1NEB A;  2W0Z A;  1QLY A;  4AFS C;  2KT8 A;  1UEC A;  4AFZ C;  1MV0 B;  1I1J A;  3NMZ C;  4Z89 A;  3CQT A;  2DL3 A;  3UA7 A;  3REB B;  1NLO C;  2O9S A;  2D8J A;  4F16 A;  3UAT A;  2RF0 A;  1W1F A;  2FO0 A;  2LJ0 A;  2EYY A;  3IQL A;  3O5Z A;  1RLQ C;  4JZ3 A;  1E6G A;  1SSH A;  2GTJ A;  2RQU A;  2XMF A;  4LUE A;  2KGT A;  1PRL C;  1A0N B;  2CT3 A;  1M27 C;  1XOV A;  1IO6 A;  2W10 A;  1UUE A;  1UHC A;  1X43 A;  1KJW A;  1HD3 A;  1PKS A;  3EG3 A;  2VVK A;  1MUZ A;  2O9V A;  3UF4 A;  1GRI A;  2KR3 A;  1TG0 A;  2RQV A;  3VS0 A;  2EGE A;  1K9A A;  2C0T A;  2V1R A;  1UE9 A;  2DE0 X;  1SHF A;  3VRY A;  4J9F A;  1KFZ A;  2MIO A;  3QWX X;  2OI3 A;  3LH5 A;  4LNP A;  4ORZ A;  3VS3 A;  4GBQ A;  4R0K A;  2EGA A;  3NPF A;  2O31 A;  2RQT A;  4DEY A;  1OOT A;  2ESW A;  4J9C A;  2ED0 A;  2YT6 A;  2HSP A;  5IXF A;  4J9B A;  1PKT A;  2RMO A;  2AKL A;  2JMC A;  2LQW A;  1HSQ A;  2EYZ A;  2KE9 A;  1I0C A;  1WI7 A;  2EGC A;  4RTY A;  2CUB A;  2AKK A;  2IIM A;  2PNI A;  2RNA A;  4JPB W;  4RTW A;  2OJ2 A;  1BK2 A;  1CSK A;  2LMJ A;  4A63 B;  3SHW A;  1GCP A;  1Y57 A;  4QT7 A;  1WX6 A;  2ENM A;  1VYU A;  2ROT A;  2CDT A;  2NWM A;  3M0U A;  2DMO A;  1Z9Z A;  1NYF A;  1OPK A;  5FWB A;  4CC2 A;  2DBK A;  2VWF A;  2LCS A;  2EPD A;  4HVV A;  2SRC A;  2GBQ A;  2DL7 A;  2J05 A;  1U3O A;  1ZUK A;  1UG1 A;  3ULR B;  1VYT A;  2DL5 A;  3KFV A;  2CSQ A;  1J3T A;  1OPL A;  2YUN A;  2F2X A;  1BB9 A;  2DF6 A;  3NHN A;  2A37 A;  1JU5 C;  2C0O A;  3ZL7 C;  5GJV B;  1TUC A;  2ECZ A;  1AOJ A;  1WXU A;  1VYV A;  1NYG A;  2ED1 A;  4OMQ A;  1WDX A;  3EG0 A;  2NUZ A;  3VS7 A;  1QWE A;  4JJB A;  2DX1 A;  1V1C A;  1M3C A;  1K4U S;  1FMK A;  2SEM A;  1QWF A;  4OMO A;  4D8K A;  2KT1 A;  5IH2 A;  4J9I A;  1X69 A;  1SEM A;  4OML A;  1BU1 A;  1NLP C;  1ZLM A;  4Z88 A;  2F2V A;  2D1X A;  4D8D A;  2LZ6 B;  2A28 A;  1RLP C;  4OMM A;  4J9D A;  2DL4 A;  3EG1 A;  1W70 A;  3H41 A;  4F14 A;  1NM7 A;  3PVL A;  1WFW A;  3SEM A;  1QKX A;  1YNZ A;  1X27 A;  5IXB A;  4GLM A;  2DVJ A;  3I5S A;  3REA B;  2J6O A;  3H0H A;  4ESR A;  2VKN A;  2K79 A;  2I0N A;  1T0H A;  2YUO A;  2DM1 A;  1AWO A;  2C0I A;  4JJD A;  1E6H A;  3A98 A;  1UTI A;  1OV3 A;  2EYX A;  4AG2 C;  3QWY A;  2BZX A;  3VS6 A;  2CRE A;  3TSW A;  1QKW A;  2L3Q A;  3I35 A;  2O88 A;  1GL5 A;  1UGV A;  4FSS A;  1Z9Q A;  3GBQ A;  2JS0 A;  1WYX A;  5I11 A;  2M0Y A;  2ROL A;  2FG0 A;  2HCK A;  2LX7 A;  1WXB A;  1U5S A;  2OAW A;  4RTU A;  5IHN A;  4LUD A;  1ZBJ A;  5L23 A;  3VS2 A;  2GNC A;  4IIM A;  2K2M A;  3EGU A;  3EHQ A;  2RQR A;  2FPE A;  2CH4 A;  2JTE A;  2FRW A;  2AK5 A;  4X1V A;  1E7O A;  1B3Q A;  3TSZ A;  1AWJ A;  3THK A;  3M0Q A;  2DNU A;  3EG2 A;  2A36 A;  1Y0M A;  2L3S A;  2GGR A;  4Y92 A;  4M4Z A;  1GFC A;  1K1Z A;  1JQQ A;  2JXB A;  5FW9 A;  2DRM A;  2EKH A;  3M0T A;  3C0C A;  1YN8 A;  1AWW A;  2J7I A;  3M0S A;  5IHK A;  1YP5 A;  5GJW B;  2EVR A;  3RNJ A;  2DRK A;  2LP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...