1VA7A

Yeast myo3 sh3 domain, triclinic crystal form
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
DPKFEAAYDFPGSGSSSELPLKKGDIVFISRDEPSGWSLAKLLDGSKEGWVPTAYMTPYKDTRNTVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-throughput structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords Myosin-3 isoform
total genus 12
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1va7A01
1JQQA 2KROA 2L2PA 2MOXA 1SHFA 1NYFA 2PNIA 2KRMA 1WIEA 3EG0A 4HXJA 1K0XA 2K6DA 3SEMA 1AD5A 2A28A 2LP5A 2LJ0A 2NUZA 3M0QA 1PRMC 2FEIA 1A0NB 2W10A 2DLPA 2DNUA 2KRNA 2L3PA 3M0PA 1UHCA 4J9IA 1RUWA 2ESWA 1MV0B 4E6RA 2F2VA 1X2KA 1CKBA 1NYGA 4RTVA 5IXBA 1CSKA 3NMZC 5IHIA 2K79A 5IHNA 4ESRA 4J9CA 2AK5A 2ED0A 2DL4A 1UJ0A 4CC2A 1V1CA 3KFVA 5IHKA 1I0CA 4Z89A 1NLOC 1YNZA 1I07A 2LQWA 2HSPA 1GBRA 1VYVA 2O88A 2YSQA 1AZGB 3VRYA 2M51A 2O9VA 3EG2A 3R6NA 1ZBJA 1KFZA 1SRMA 2DM1A 5FW9A 1NLPC 4AG1C 1MV3A 1WXBA 1AWXA 2CH4W 2GTOA 1UJYA 2EBPA 3UF4A 1YCSB 2A37A 1SPKA 2BZXA 2MCNA 3IQLA 4RTYA 1U5SA 1WA7A 1WLPB 2OJ2A 3CQTA 4CC3A 1UG1A 2LCSA 2PTKA 2A08A 2KYBA 3UA6A 2CREA 1ZUUA 4J9FA 2C0IA 1YWPA 1Y0MA 4AFZC 1GL5A 1KJWA 2IIMA 1ARKA 4JJBA 2RQWA 1HJDA 1G2BA 1UTIA 4ZNXA 4X1VA 1Z9QA 1K76A 2JMAA 4OMQA 1WX6A 5L23A 3EG3A 2XMFA 3ZL7C 1NEBA 1OPLA 2KBTA 2EPDA 5I11A 2CT4A 2KGTA 1QKWA 4AG2C 2AZVA 1PKSA 3RNJA 5FWBA 2L0AA 3SHWA 2HCKA 2DL8A 2O2OA 2ROLA 1WI7A 4GLMA 2X3WD 2DYBA 1AOJA 4DEXA 3QWYA 2EKHA 4F16A 2DRKA 1PNJA 2GTJA 2DBMA 3GBQA 4M4ZA 4HVVA 2DF6A 2I0NA 2K2MA 2FO0A 2JTEA 1Z9ZA 2CSIA 1VYTA 2KYMA 2C0TA 2LNHB 2D0NA 1IO6A 2DE0X 2NWMA 1NM7A 4KRTA 2BTTA 2YUOA 3PVLA 1M3BA 4R0KA 1SHGA 2SEMA 1RI9A 4GBQA 1S1NA 2BZYA 2YUQA 2ROTA 1B07A 2CT3A 1E7OA 2LX7A 1GCQC 4A63B 2W0ZA 2CSQA 2VWFA 3UA7A 1BU1A 3PVQA 2PZ1A 1X2QA 2ECZA 2RQTA 1ZSGA 3VS4A 2M0YA 2DVJA 1G83A 4FSSA 3QWXX 2O31A 4JPBW 1OPKA 1WXUA 2SRCA 2GNCA 3LH5A 1AWWA 2EYWA 4QT7A 4OMMA 5IH2A 4JZ4A 2RQVA 1M27C 3VS3A 2HDAA 1RLQC 1JU5C 1J3TA 1M3CA 3M0TA 4CC7A 4AFQC 1K0SA 1AEYA 1UE9A 1MUZA 2VKNA 4D8KA 2JM9A 1N5ZA 2FPFA 2HBWA 3I35A 2HEQA 2KXCA 2MIOA 1W6XA 4RTXA 3O5ZA 5GJWB 2GBQA 1AWJA 2VVKA 2DBKA 1LCKA 3H41A 1PHTA 1QKXA 1GCPA 1YN8A 2KR3A 2DRMA 2LQNA 1H3HA 3H0FA 1M30A 2H8HA 1AZEA 2AZSA 1UGVA 2AKKA 2RQUA 1UUEA 1GCQA 2J6FA 4LUEA 2EYYA 2FPEA 1X6BA 1H92A 2YUNA 4J9BA 1GBQA 2L3QA 1OOTA 3NPFA 2K3BA 4CC4B 3TSWA 1HD3A 5ECAA 3M0SA 5GJVB 1AWOA 4DEYA 1JXOA 1QWFA 2X3XD 4LUDA 4OMLA 3THKA 1KIKA 2JS0A 1W1FA 1X43A 1ZUYA 1H8KA 2YUPA 3U23A 2RN8A 2J05A 4Z88A 1BB9A 2DMOA 1X27A 1QLYA 4HVWA 3VS1A 4EIKA 4LNPA 2FRYA 2JMCA 2RPNA 1SEMA 4LE9A 3UATA 1ABQA 1FMKA 2LJ1A 2BZ8A 2KT8A 3EG1A 2DL7A 3VS6A 2EGEA 1CKAA 3JV3A 4OMPA 2V1QA 3TSZA 1U06A 2K7AA 4J9HA 2DX1A 2V1RA 3H0IA 1RLPC 1WYXA 2KRSA 2LMJA 1ABOA 3A98A 1E6GA 1ZX6A 1NG2A 5EC7A 2JM8A 2D1XA 4AFUC 2FRWA 1T3SA 3C0CA 4F17A 1SSHA 1M3AA 2DA9A 2GQIA 3REBB 1E6HA 2J6OA 2B86A 1I1JA 2FPDA 1HSQA 1YP5A 1K1ZA 2F2WA 2P4RA 1PWTA 2LJ3A 3VS5A 2EGAA 2YDLA 2L3SA 3RBBB 4RTUA 2E5KA 2AKLA 1TUDA 1PRLC 1ZUKA 5I22A 4JJCA 3PE0A 1AVZC 1GRIA 1U3OA 4IIMA 1KSWA 4F14A 1FYNA 1PKTA 1JO8A 4RUGA 2DILA 2F2XA 2RF0A 4JZ3A 2G6FX 1X69A 4RTTA 1ZLMA 2EYXA 2JW4A 1QCFA 1OV3A 2D8HA 3M0UA 2O9SA 1K4US 4ORZA 2ENMA 2JXBA 1Y57A 2GGRA 2EW3A 3NGPA 2OAWA 2RNAA 4WCIA 4Y92A 3EGUA 1BBZA 1T3LA 2ABLA 2CDTA 2FG0A 2CH4A 2CUDA 2EVRA 3I5SA 2KEAA 3REAB 2JT4A 3I9QA 1UECA 2QDLA 1K9AA 1SRLA 2A36A 2RQRA 1GFCA 1W70A 1XOVA 2J7IA 3NHNA 2J06A 1UFFA 3VS2A 1QWEA 2ED1A 2KNBB 1YWOA 1TUCA 3I5RA 2YT6A 4D8DA 1EFNA 1JXMA 4OMNA 2DL5A 2EYZA 2DJQA 4J9DA 1VYUA 4RTWA 1NEGA 1T0JA 3EHQA 2RMOA 4RTZA 3VS7A 2JS2A 1OEBA 1WFWA 2K9GA 2OI3A 4Z8AA 3M0RA 4OMOA 2CUBA 3VS0A 3VRZA 1WDXA 1BK2A 3FJ5A 4IIOA 2EQIA 2J6KA 3EHRA 5FWCA 5IXFA 4HVUA 2KE9A 2C0OA 1UDLA 2KXDA 4LN2A 1T0HA 4J9GA 4K11A 2EGCA 3ULRB 4HCKA 1JEGA 5HCKA 1TG0A 1WXTA 2D8JA 2LZ6B 2KT1A 1UHFA 4JJDA 3TVTA 1B3QA 4J9EA 1GFDA 1VA7A 1X6GA 1M8MA 2DL3A 4AFSC 3H0HA
chains in the Genus database with same CATH superfamily
1JQQA 2L2PA 1SHFA 1NYFA 4E2FB 1IRXA 2PNIA 1Y96A 2KRMA 2F1LA 2LX9A 2RHUA 3EG0A 3MCAB 1VQ7T 4HXJA 2XIDA 2FZCB 1TS9A 2F69A 3QUIA 3V7CA 3OBWA 3CCLA 1NZ9A 2NLUA 4M7DF 3H8ZA 1YI2Q 1VQPA 4PJOA 5FU7C 1ZSZA 4RTVA 1BYMA 1YITQ 4BE0A 3RUXA 1D1BA 1G5VA 5CKEA 4J9CA 3JAME 3MO8A 4LDUA 5KYYB 1WHGA 2X35A 1NE8A 5IHKA 1I0CA 1NLOC 2QEXT 2YLCA 4PK4A 3V8LA 1VIEA 1NPRA 3LH0A 2OTLQ 1RL2A 3CCQA 4XTYA 1GBRA 1VYVA 2O88A 2YSQA 1AZGB 3VRYA 1U1SA 2O9VA 5GAOr 1MNDA 1KC8U 2K4YA 1KFZA 2E10A 1SRMA 5D6XA 1MV3A 3OYHA 1W4SA 1ZSZC 2GTOA 3OYFA 4A54A 1B7TA 2QQRA 4E7HA 5A0GA 5GAOl 2A37A 3C4SA 4KULA 2KQWA 4RTYA 1S72T 3CCMA 5LJ3j 5GANd 3NFCA 3BDUA 3F70A 4XAXB 2PTKA 3FIFA 3EFRA 2EYQA 2O4XA 3TQ7P 3JSCA 3JCMX 4FIBA 4AFZC 4C0ZA 1KJWA 4LD6A 1EIFA 3CCQQ 3LGFA 4ME7A 4ZTFA 4ZTJA 4GLKA 1UTIA 7AT1B 3SWNC 2DD5A 2E4HA 5GAMe 3QG1A 4ZN3A 1WX6A 2RI5A 3JRZA 4PJOE 2XMFA 3L2ZA 4J6WA 2YRVA 2CZ6B 4BY6C 2V8IA 4BDYA 3JCMP 3DB3A 2DL8A 1WI7A 4BI8B 2BIVA 1VQ4T 1IGQA 4PJOB 3RKWA 1AOJA 1WQWA 3QWYA 3TREA 1C1AA 2RHXA 1KD1C 5EG2A 2CP7A 1YJ9T 4MZMA 4M4ZA 4HVVA 1TH7A 1Q81U 2JTEA 4V2SA 3NTIA 3M5AA 4MDXA 2BE7D 2DE0X 1RAEB 4XTVA 2YUOA 3FC3A 2ZPEB 3PVLA 1M3BA 1BKBA 4HA8A 3CC2T 1IREB 2BZYA 2FZGB 3CPFA 4QW2A 5LJ3d 3CCMQ 1B07A 1W2BS 4PJOG 3PTAA 5KE2A 3L2VA 3OYGA 3JCMd 5GAN6 3UA7A 3DLLA 2HL3A 1IXDA 3GNGA 3I56A 1LNXA 4PJNA 5FU6B 1VQPQ 3PVQA 3VYGA 5GAMf 4RG2A 2MI6A 4X34A 1QCNA 4FT4A 2E1HA 1M90C 3CCJA 4B9WA 5CAIA 2COZA 3LH5A 4FW1A 4OMMA 3OBYA 4M77D 5L8RE 2QEXQ 4JZ4A 3VS3A 2HDAA 3PFSA 3GP8A 5KCHA 1M3CA 3UT1A 4F7UE 1TSFA 1UE9A 4E7JA 2DTIA 1VQ5T 3BFMA 1N5ZA 3L2WA 2JVVA 2A0FB 1Q82C 1K73C 5KYNA 2HEQA 1YIJA 4YTLA 2DXTA 2MIOA 2FVUA 5CR2A 4PJOF 1N9SA 3CXCS 3VUBA 4IUTA 1WQ7A 2KVQG 2QASA 1Y07A 2DBKA 1YIJQ 1GCPA 2HSEB 4ATOA 4EMKB 2EWNA 1JJ2P 1PCXA 3S3MA 4LXCA 2H8HA 2RQUA 1UGVA 1H3ZA 2KK4A 2DD4A 2LQ8A 2J6FA 4AMCA 3GOXA 4LUEA 3CCUA 2EYYA 1VQOT 1QMCA 2FPEA 3I55A 1X6BA 4J9BA 3BDLA 2PVOB 1YHQA 4M75E 1MNEA 4CC4B 1N8RC 5ECAA 1QVFA 5GJVB 3OYAA 1IGUA 2ZPBB 2A3LA 2JZ2A 1HXDA 4OMFB 4E7SA 3JB9F 2MWOA 3THKA 2L8DA 2JS0A 2LCLA 1H8KA 3HFOA 2CP2A 3G71Q 3FEOA 5GAOq 3M54A 3M59A 2J05A 2DMOA 4O5VA 1X27A 1M8VA 1G3YA 4OB3B 4LNPA 2JMCA 1SEMA 4QQ6A 2EQMA 3OMCA 5I2MA 2VC8A 2WSCE 2X4XA 2KT8A 3EG1A 2RI3A 3VS6A 4LD9K 2EGEA 1IB8A 4QVCA 2E3IA 1D09B 3JV3A 2C06A 2VYTA 4OP0A 1ZA2B 4C92D 4Y91A 3EFOB 1OQKA 3H0IA 2QGFB 1RLPC 2VXEA 1WYXA 4KT0E 4ELYC 1NG2A 5EC7A 1F1BB 3A5ZB 2D1XA 5LL6S 4C5HA 3WVEB 3L2UA 3EGDA 3RIRA 1V76A 1QCOA 3HFNA 1I1JA 2FPDA 1JRIA 1TTHB 3MPUB 2E41A 5IAYA 2P4RA 3QPHA 1AT1B 5DLQE 5LJ5f 4RTUA 2E5KA 1TUDA 2HNIA 3G1JA 3CXCP 1VQMT 5I22A 5AT1B 1KQ1A 3PE0A 4ZGEB 5LJ3g 1GRIA 1U3OA 2ZPGB 1PKTA 2MPXC 2PUOB 2R5MA 4C0FA 4X9DA 3T9NA 2RHZA 4F04B 2GQVA 2F2XA 1LVKA 2RF0A 2DTOA 1ZHIA 2NUTA 4RTTA 1ZLMA 3VJPA 4C0DB 2K57A 5FRMA 3JB9I 2D8HA 3M0UA 4ZGDB 5KCOA 3OYLA 3I55Q 2O9SA 2RJEA 3I56Q 2ENMA 2LRQA 5KYUA 4M7AD 3OYDA 3NGPA 3C12A 4WCIA 5D6WA 2KMTA 2D6FA 1Y71A 3E9GA 1VOMA 3RKYA 2FG0A 1SF9A 2EVRA 1VQOQ 3LW5E 1WHLA 1SKUB 1M90U 1K9AA 2A36A 2E65A 2OAUA 1TOVA 1XOVA 2H3EB 5LJ5e 1OYXA 4ANJA 3RMSA 3CEYA 2KNBB 3LWHA 5AYFA 2EYZA 3JCMW 2DJQA 2DIQA 5KYUB 4J6XA 2RM4A 3CCRQ 1OEBA 2K9GA 4M7AE 4Z8AA 2HZYA 3A1PA 1BIBA 1WDXA 4A4EA 4OGEA 1FX7A 4JRKA 5IXFA 3ZFJA 2KE9A 4F7UA 4RG8A 4J9GA 2EGCA 3EH2A 2CKKA 1M1KC 1ZBXA 4J7FA 4EMGA 1FWZA 1TG0A 5GAOm 3CMEQ 1MMAA 1VQ7A 4OVAA 1VA7A 1MGQA 1I5OB 1M8MA 2DL3A 3VUZA 4AFSC 3CCLT 2Y4YA 2KROA 2MOXA 3QO3A 3N5BB 5CCAA 3MP1A 1M5Q1 2M0OA 1K0XA 2K6DA 2QQBA 3M9QA 1D3BA 1AD5A 3E2UA 1PRMC 1BIAA 2DLPA 3CC4Q 2L3PA 1MV0B 4E6RA 4ZGJB 1X2KA 1K9MC 1VQMQ 1RAAB 3E19A 3EFOA 3QBYA 5IHIA 4F7UF 4DA4A 2RK2A 4MZTA 3QIIA 1PD1A 1KC8C 5GAMg 1I81A 2HD0A 2AK5A 2ED0A 2XU8A 3SWNA 5IT9E 1UJ0A 1V1CA 3KFVA 3CCST 2K5LA 4Z89A 4FYWB 1YI2T 2M1HA 2HSPA 2CZ0B 2IPOB 4KGZB 3EGXB 3QDRB 3I55T 2D0QB 2NUTB 3R6NA 2NUPA 1YITT 2G3RA 3GF5A 5HY6A 1VQ6A 1NLPC 2P0QA 1VQKQ 1PSFA 3MHXA 1RAFB 2KI7A 2EBPA 1QVPA 3UF4A 1YJWT 1BI3A 4AT1B 4M78E 3IQLA 2P0KA 4M75B 5GMKl 5KYXB 1M2VA 4CC3A 2XKOC 3H9NA 2KSSA 1Q86U 1Q81R 5GAN3 4E7ZA 2YXYA 3SB2A 3CXCA 2YHTA 1R0CB 5GAMd 1M4ZA 1Y0MA 2IIMA 4M7DC 2RQWA 1KG1A 4ZNXA 5LJ5j 1VQ4A 3BE3A 2XDPA 1MHNA 3CPWA 1NEBA 1KQSP 4C0GA 3JB9D 2HL5C 2KBTA 3RKXA 2JN0A 1YHQQ 1YJ9A 1QKWA 2GCXA 3QDFA 1VQ9T 1PKSA 3RNJA 5FWBA 3SHWA 2DIGA 2ZCFB 4DEXA 4F16A 3OS0A 2E3HA 3G6EQ 2GTJA 3S3OA 4M77E 2DBMA 5CO7A 4WTOB 4FW2A 2DF6A 2P84A 2K2MA 4M7DA 2LNVA 2CSIA 3OYIA 4DBQA 1VQ6Q 1XTDA 1IO6A 1KK7A 5DM7R 2NWMA 3QSUA 2DETA 2F5KA 5GMKj 1M9SA 5LJ5h 3A8GB 4R0KA 2SEMA 2LT4A 1K9MR 2MWPA 5D6YA 1S1NA 3J81E 4II1A 2ROTA 2CT3A 2LX7A 2W0ZA 2CSQA 2DVEA 2OTJA 4BI3A 5CVIA 1VQ5Q 3FRNA 1X2QA 2PQWA 4NOYA 2DEQA 3CMAT 1ZSGA 4A53A 4FSSA 3QWXX 2O31A 1FMVA 4E7LA 2ZPHB 2EIFA 4M77B 3CC2Q 2LQKA 2EYWA 1AWWA 4JRQA 4C8QA 4PJJA 3V7SA 5KYXA 1JU5C 3C95A 1YIJT 1J3TA 2EKOA 2LVMA 2XK0A 4AFQC 2K5IA 2B8AA 1DJ7B 3MP8A 5CKHA 2BKDN 2DZCA 3O8VA 4KGVB 4RTXA 5C0MA 3ZBDA 1TXQA 2O01E 4L6V5 3CCUT 1VQOA 4C5GA 1YN8A 4RMOA 2DRMA 4MMKA 2LCCA 3H0FA 4DOVA 1BCMA 1WJRA 4XQ3A 2AKKA 2XI9A 2JNGA 4HCBA 4A4KA 1BI0A 4C92G 1I4K1 4QVDA 1RAHB 1VUBA 4QQGA 3QJ6A 3OYMA 2DERA 1H92A 3E1SA 4HKEA 2L3QA 2V8JA 2K3BA 3EG9A 3G4ST 1HD3A 3JCMh 4M7AB 1K8AR 4DEYA 1JXOA 3M4GA 1QWFA 2X3XD 4OMLA 5GMKe 2Y4XA 1X43A 1ZUYA 1O75A 2JUFA 2D9TA 1M1FA 2RN8A 1M2VB 2VASA 2EQJA 1JJ2A 1UGQB 1YBYA 1N9RA 2FRYA 3UATA 3EAEA 1D3BB 1FMKA 2XICA 4B6MA 2BZ8A 4IKFA 3OSSC 4MDWA 1CKAA 2X9HA 3L2QA 5DY9A 2RA2A 2V1QA 4C8QE 2COWA 3TSZA 3LWIA 3PGGA 3JB9G 1U06A 5CKDA 2EJFA 3LX7A 2OTJQ 1PD0A 1MMDA 3G71T 3WVDB 5GANj 4M78B 4M7DD 3V8KA 2E70A 2XHCA 2XD0A 1SSHA 1M2OA 4P5NA 2CS7A 3REBB 1E6HA 2J6OA 2LT1A 1C0MA 1K1ZA 2HQHA 1Q81C 3WXMB 2MAMA 1VQ8A 2O4XB 2EJGA 2YDLA 4FYYB 3RBBB 4A4FA 1BCOA 1M1GA 1NJIC 2K3YA 4JJCA 3OYEA 1C6VX 2XG8D 2IVWA 5KYWB 2ZAEA 1BI2A 2VV5A 4F14A 2MF2A 2DILA 3SFMA 2OX7A 4JZ3A 2WACA 1OV3A 1RACB 2QQ9A 3CCVA 1Q82U 1K73U 3CCET 3TCJA 1G3TA 1OU9A 5GAN7 4ORZA 3GIBA 4FL6A 4A4HA 1V29B 2K5FA 4Y92A 5CQYA 4HT9A 2PVDB 2OTLA 2CUDA 3D7SB 1Q7YR 3X28B 2JT4A 3I9QA 1UECA 3KXTA 2QDLA 2HKNA 1X75C 3OYNA 1VQLQ 1W70A 2AT1B 2ZZDA 3NHNA 5GAN8 2E12A 2J06A 1UFFA 2ED1A 3GPLA 1Y7XA 4PLIA 3G4SQ 1TUCA 2R5AA 3I5RA 3I56T 4D8DA 1EFNA 1JXMA 3QHSA 5C6SA 2DXUA 1D1CA 1VYUA 4RTWA 1NEGA 4C8QB 3RERA 4C8QD 2DXBA 1IHWA 3VU3C 2MK5A 2CUBA 3VS0A 1OI1A 2EQIA 2J6KA 4HVUA 2QGGA 2C0OA 1SG5A 1T0HA 1Q82R 1K73R 5A2QE 1UGPB 1JEGA 2QI2A 2R57A 5GAMh 1M1KR 5HCKA 4NS5A 1KD1U 2CP5A 4FT2A 3OY9A 2OTJT 4JJDA 3TVTA 3FB9A 4J9EA 1QVGA 4J83A 4KBMB 4UC4A 2JOYA 2R58A 5GANg 2QA4Q 3RR6A 2A28A 3M0QA 2LJ0A 3KUFA 1A0NB 4IURA 1YJNT 2DXCA 3CCSQ 3M0PA 1OX9A 4J9IA 2BE9B 3EH1A 3CMET 4BE1A 3JCMe 2RJFA 4M75F 3CCMT 1WNLA 1CKBA 3NTHA 1XNIA 1NYGA 2RH2A 1CSKA 3NMZC 2K79A 5KYYA 1JJ2S 4M77C 1N6AA 4ESRA 3INZA 4XU2A 2E64A 4JS4A 1PC0A 4CC2A 1YITA 3GLXA 3L1AA 5IN1A 4LDYA 1YNZA 2CP3A 2LQWA 5LJ3e 5GMKi 5FU7B 1G3WA 3G6EA 4BY6B 1MMGA 3LLRA 1HK9A 2HQEA 4AG1C 1WXBA 1AWXA 2CH4W 1ACMB 1D0YA 1UJYA 4F7UB 1YCSB 1VIFA 2PU9B 1KHCA 4IUVA 5GMKm 3AHUA 1U5SA 3UWNA 3QYHB 1I5LA 1VQLT 4CI0C 2JTMA 2DAQA 2OJ2A 4XTUA 3HTRA 3CQTA 4M77F 1VQNA 4E7IA 1UG1A 1WZOA 3JCMJ 2QTXA 2A08A 2KYBA 1VQ9Q 3UA6A 5KH6A 2GF7A 1D1AA 2CREA 1ZUUA 3OYBA 4Y28E 1GL5A 2F5TX 1ARKA 4HT8A 4M7DB 4JJBA 1G2BA 5CQXA 4E7KA 2VGNA 2JMAA 4OMQA 4N4IA 5L23A 2M02A 3EG3A 1Q86C 3OYCA 2YLBA 1OPLA 5LJ3f 3RMQA 2EPDA 2FB7A 2KGTA 3CBPA 4AG2C 1LPLA 3JCMg 2RHIA 3META 4QVZA 3OYJA 4GLMA 4KUDK 2QTVA 2HKQB 4C5EA 2DRKA 1PNJA 2M9UA 3GBQA 4ZN1A 1X01A 2I0NA 3S6WA 2FO0A 1Z9ZA 5CKBA 2D0NA 1VQ7Q 4A4GA 1OZ3A 2BTTA 1K8AC 1N8RR 4DOWA 1P92A 2ZPFB 2K3XA 3URGA 4C92C 9ATCB 3HKSA 1E7OA 2KY9A 2DTHA 3CC7T 4J6YA 2A7YA 1BU1A 2L5QA 3CCVT 2ECZA 2EFIA 2M0YA 3QKJA 3OS2A 2VGMA 2NUPB 1WXUA 1OPKA 1RI0A 3CD6A 4M78D 2GNCA 4LDXA 4EPCA 2P0PA 4KUIA 5IH2A 2RQVA 1M27C 3RESA 1RLQC 4M7DG 3DKMA 2OTLT 3FLGA 4OF1A 1K0SA 1AEYA 2WSEE 4N4HA 5HK3A 4JLIA 2HBWA 4PKCC 2KXCA 3CC4A 3FDRA 4EMKA 1AWJA 3HRTA 3V8JA 1LJOA 2VVKA 2VXFA 1PHTA 1QKXA 4F7UG 1M90R 2KR3A 1RAGB 2LQNA 3OW2P 1H3HA 1RADB 4M75A 1M30A 3SWNB 1UUEA 5GAOp 1GCQA 4CRIA 2IG0A 5LJ3h 3BW1A 2YUNA 2DKGA 4JS5A 1AHJB 4M7DE 5GANh 1OOTA 4HCZA 4EMHA 2FL7A 3M0SA 4X9CA 1AWOA 2RK1A 3HRUA 4LUDA 1R0BG 1W1FA 2YUPA 3U23A 3A8LB 2L3RA 1QLYA 2NYSA 2ZPIB 4HVWA 2RI2A 3CBMA 1VQMA 1VQ4Q 4EIKA 1WJSA 2QEXA 2DYIA 3J80E 2JJ9A 3OYYA 1MMNA 2RJDA 3CPWP 3X26B 4J9HA 4FCYA 1YJWA 2DX1A 3PIPA 2LMJA 1ABOA 1OX8A 4BDZA 6AT1B 2KDSA 2JM8A 2FRWA 1T3SA 4M7AC 3C0CA 3X25B 3MJXA 1M3AA 4OB2B 2GQIA 5FU6C 2B86A 3CC7Q 3P8DA 1HSQA 4M78A 3EFSA 4XTXA 2F2WA 1PWTA 3VS5A 2EGAA 5A0LA 1FMWA 4DBHA 4C0DC 2AKLA 4M75D 1ZUKA 5HK0A 3FJPA 5HKCA 1AVZC 3CCJQ 1OULA 5GAN4 1KSWA 3HPWA 3MEVA 4C8QG 3OW2S 4QQDA 3UPUA 3OB9A 1VQNT 2DFUA 3LYIA 3OMGA 2JW4A 1QCFA 1K4US 3E9FA 2OAWA 3MKDA 5A0DA 1VQKT 3EGUA 1BBZA 2X4YA 1T3LA 3DB4A 2CDTA 1KC8R 2YRDA 4E47A 3I5SA 3L2RA 2BUDA 2RQRA 1SRLA 1GFCA 1U8RA 4MMLA 3VS2A 3CCRA 1YWOA 2YT6A 4OMNA 2COYA 4ELZC 1KQSA 4PJMA 4J9DA 1X6OA 3HRSA 3CPWS 3EHQA 2YRCA 2RMOA 4R55A 3VS7A 2JS2A 2CP0A 2P4TA 4Q5WA 4M77A 3M0RA 4OMOA 1G8XA 3VRZA 3HL8A 1BK2A 3Q1JA 1W2BP 5FWCA 1QVFP 2KXDA 4LN2A 5KE3A 4K11A 2Z0WA 3AT1B 4HCKA 3CC7A 2QG9B 2GFAA 4N0AA 2LZ6B 2QDYB 2YWWA 1RABB 3CCSA 2MMPA 1B3QA 4RCBA 2PVGB 4PNOA 1PSEA 1GFDA 4M78G 2DEUA 1QQJA 3H0HA 5GANf 2XDBA 1K9MU 3CMEA 3X20B 1YCYA 3JCMc 2X51A 4LDVA 1WIEA 1SSFA 4FYXB 3SEMA 3RDVA 2NUZA 2LP5A 1UGSB 2FEIA 4DBRA 1B34B 2W10A 3OQ5A 4FU6A 4JRPA 1WHMA 2DNUA 2KRNA 1UHCA 3PMIA 1RUWA 2ESWA 1WHHA 2F2VA 4NL3A 3HSBA 3EG9B 3G4SA 3CD6Q 5IXBA 1PM3A 4PL6A 3MP6A 1N27A 3OS1A 5IHNA 2QQAA 1OU8A 5FRNA 3M57A 2CYZB 2QA4T 2DL4A 4PFOA 4M7AG 5J26A 1Q95G 1YJNQ 1I07A 1S72Q 4XU3A 2AHJB 4J7IA 4OGCA 2JTFA 4BACA 1UEBA 3TU4K 2M51A 2RD1A 3EG2A 4C92B 4C92F 5LJ5g 1GXIE 1ZBJA 1NJIU 2DM1A 1VQ9A 5FW9A 1ZA1B 2QAZA 3M56A 4FSXA 4BD3A 3VKIA 1Q86R 4JLGA 3CCQT 2CZ7B 2EQUA 2X4WA 1SPKA 2BZXA 1YFNA 2MCNA 2M16A 3JCMb 1QVGS 4XTWA 1WA7A 1WLPB 4OB0B 3JCMf 2LDMA 1R8OB 2RJCA 2WSFE 2LCSA 3JB9H 4C92A 4PJOC 3HP9A 4J9FA 4TVRA 2C0IA 1YWPA 3NTKA 3UDCA 4M75C 5M9OA 3V7RA 1HJDA 2EQKA 3MEAA 1EX4A 1YJ9Q 4M77G 4X1VA 1Z9QA 5I2SA 1K76A 2AIRB 3ZL7C 5GMKh 1VQ8Q 2RHYA 4MZPA 4D6WA 1PG5B 2CT4A 5I11A 2AZVA 1XJWB 2L0AA 2X4JA 2HCKA 2O2OA 2ROLA 3OSVA 1BI1A 3PT9A 2X3WD 2DYBA 3ASKA 2CP6A 4PJOD 2EKHA 2CZ1B 1NBEB 3CCLQ 2QYZA 4EMKC 3CCVQ 1ZQ1A 1HYOA 4PJLA 1VYTA 2KYMA 2C0TA 2DZ9A 2LNHB 4XK8E 3M53A 1NM7A 4KRTA 4DBFA 5DLOA 2RO0A 2E6NA 1SHGA 5GAOn 1RI9A 3P8HA 4GBQA 3A8OB 3JCMV 3OW2A 2YUQA 4RKUE 5CKFA 1GCQC 4A63B 3CD6T 2VWFA 1QVFS 2QXFA 2L89A 4JDSA 4M7AA 2PZ1A 4BE2A 3CC2A 2FYKA 2DJZA 2RQTA 3VS4A 2DVJA 1G83A 1R77A 4IUQA 4M78C 4JPBW 4J8OA 2HAXA 2SRCA 3ZEHA 4M78F 4R56A 4QT7A 3L42A 3M0TA 1QP3A 4XU1A 4CC7A 3BY7A 4PLLA 2V26A 1MUZA 2VKNA 4D8KA 4XU0A 1EZZB 2JM9A 1VQPT 2FPFA 1QP2A 3I35A 5GAN2 5CK9A 2HQXA 1YJWQ 1OZ2A 1W6XA 2DO3A 3O5ZA 1JB0E 5GJWB 2GBQA 4M75G 3CCEQ 3ME9A 3R6OA 3SD4A 1Q7YU 3H41A 1LCKA 1VQ5A 1I8FA 2GFUA 8ATCB 4JRIA 1B34A 1O9SA 2Y90A 3C94A 1KQSS 1AZEA 4VUBA 2AZSA 3KBGA 1YJNA 3G71A 5LJ5d 4LDWA 5J3BA 2LTOA 1GBQA 2PUKB 1N8RU 1Q7YC 3NPFA 3MEUA 3QYGB 4DQ2A 3TSWA 4RCCA 5KYWA 4J5YA 4JJNK 1VQ8T 1KIKA 1YHQT 1D0XA 3OS5A 1S72A 1WGSA 4C92E 4BI4A 1JBMA 5GANe 3M58A 4Z88A 3DLMA 1BB9A 3VS1A 2LC4A 1KD1R 2RPNA 4LE9A 1ABQA 2LJ1A 3J7AF 1YI2A 1QVGP 1KQ2A 3G6ET 2CGHA 2DL7A 2E5QA 4OMPA 3X24B 3PNWC 2K2VA 3QZ5B 4XTZA 2K7AA 1VQ6T 1H641 2V1RA 4HCCA 1NPPA 2KRSA 3A98A 5J39A 1E6GA 2RB6A 3CBOA 1ZX6A 4KH1B 4AFUC 3CCEA 2QA4A 1VQLA 4FYVB 3SDZA 8AT1B 4F17A 4KH0B 2DA9A 4NL2A 1NJIR 1TU0B 2DK3A 2HMAA 2XDDA 1U1TA 2I2LA 2E6ZA 3GNFB 1Y96B 1WHKA 2VB6A 4IUUA 1QW1A 1YP5A 2DPPB 4PFPA 2LJ3A 2VUBA 3M55A 2MYSA 1ZSZB 3PIOA 3CMAQ 1WJQA 2L3SA 4KGXB 3TEEA 1TWBA 1PRLC 1RAIB 1WPYA 2KAFA 5GAN5 4IIMA 4BB7A 4L59A 1FYNA 1FXXA 2EJ9A 4O6JA 1JO8A 4RUGA 5FLXE 3G7ZA 1XQHA 3H6ZA 4Z02A 1W2BA 2ZGWA 1IHVA 1VQKA 2G6FX 1X69A 3LGLA 2EYXA 2FZKB 3OA6A 3QJYA 1D0ZA 4N0AC 4WF2A 3CCUQ 2JXBA 4M7AF 4BUGA 1Y57A 2GGRA 2EW3A 3CCJT 2RNAA 1G3SA 2H3JA 2FHDA 3A8HB 3ER0A 3P8BB 3VYHB 2ABLA 3CCRT 1LOJA 4N4GA 1UB4A 1VQNQ 2CH4A 4JUVA 3JCMQ 4C5IA 2KEAA 3REAB 4C8QF 4OB1B 1KHIA 4GY5A 3PMTA 2QQSA 2J7IA 4FM4B 5GAMj 4EDUA 1QWEA 4QKUA 4PFZA 3M4YA 3VV0A 2DL5A 3A8MB 1T0JA 4L5GA 1WHJA 1TUGB 2HBPA 4RTZA 3CMAA 1WFWA 2ATCB 2OI3A 2V8KA 3S3NA 1M1KU 3OYKA 5CIUA 1K8AU 3FJ5A 4IIOA 3EGDB 1IZ6A 3EHRA 2QK0A 3JB9J 1UDLA 4B9XA 3ULRB 4IUPA 5I21A 1WXTA 3MEWA 3CC4T 1UGRB 3EGXA 2D8JA 4C8QC 2KT1A 1UHFA 3QXEB 2EAYA 5FROA 1X6GA 3QZ9B 3HHTB 5D7UA
chains in the Genus database with same CATH topology
1JQQA 2KROA 2L2PA 2MOXA 1SHFA 1NYFA 2PNIA 2KRMA 1WIEA 3EG0A 4HXJA 1K0XA 2K6DA 3SEMA 1AD5A 2A28A 2LP5A 2LJ0A 2NUZA 3M0QA 1PRMC 2FEIA 1A0NB 2W10A 2DLPA 2DNUA 2KRNA 2L3PA 3M0PA 1UHCA 4J9IA 1RUWA 2ESWA 1MV0B 4E6RA 2F2VA 1X2KA 1CKBA 1NYGA 4RTVA 5IXBA 1CSKA 3NMZC 5IHIA 2K79A 5IHNA 4ESRA 4J9CA 2AK5A 2ED0A 2DL4A 1UJ0A 4CC2A 1V1CA 3KFVA 5IHKA 1I0CA 4Z89A 1NLOC 1YNZA 1I07A 2LQWA 2HSPA 1GBRA 1VYVA 2O88A 2YSQA 1AZGB 3VRYA 2M51A 2O9VA 3EG2A 3R6NA 1ZBJA 1KFZA 1SRMA 2DM1A 5FW9A 1NLPC 4AG1C 1MV3A 1WXBA 1AWXA 2CH4W 2GTOA 1UJYA 2EBPA 3UF4A 1YCSB 2A37A 1SPKA 2BZXA 2MCNA 3IQLA 4RTYA 1U5SA 1WA7A 1WLPB 2OJ2A 3CQTA 4CC3A 1UG1A 2LCSA 2PTKA 2A08A 2KYBA 3UA6A 2CREA 1ZUUA 4J9FA 2C0IA 1YWPA 1Y0MA 4AFZC 1GL5A 1KJWA 2IIMA 1ARKA 4JJBA 2RQWA 1HJDA 1G2BA 1UTIA 4ZNXA 4X1VA 1Z9QA 1K76A 2JMAA 4OMQA 1WX6A 5L23A 3EG3A 2XMFA 3ZL7C 1NEBA 1OPLA 2KBTA 2EPDA 5I11A 2CT4A 2KGTA 1QKWA 4AG2C 2AZVA 1PKSA 3RNJA 5FWBA 2L0AA 3SHWA 2HCKA 2DL8A 2O2OA 2ROLA 1WI7A 4GLMA 2X3WD 2DYBA 1AOJA 4DEXA 3QWYA 2EKHA 4F16A 2DRKA 1PNJA 2GTJA 2DBMA 3GBQA 4M4ZA 4HVVA 2DF6A 2I0NA 2K2MA 2FO0A 2JTEA 1Z9ZA 2CSIA 1VYTA 2KYMA 2C0TA 2LNHB 2D0NA 1IO6A 2DE0X 2NWMA 1NM7A 4KRTA 2BTTA 2YUOA 3PVLA 1M3BA 4R0KA 1SHGA 2SEMA 1RI9A 4GBQA 1S1NA 2BZYA 2YUQA 2ROTA 1B07A 2CT3A 1E7OA 2LX7A 1GCQC 4A63B 2W0ZA 2CSQA 2VWFA 3UA7A 1BU1A 3PVQA 2PZ1A 1X2QA 2ECZA 2RQTA 1ZSGA 3VS4A 2M0YA 2DVJA 1G83A 4FSSA 3QWXX 2O31A 4JPBW 1OPKA 1WXUA 2SRCA 2GNCA 3LH5A 1AWWA 2EYWA 4QT7A 4OMMA 5IH2A 4JZ4A 2RQVA 1M27C 3VS3A 2HDAA 1RLQC 1JU5C 1J3TA 1M3CA 3M0TA 4CC7A 4AFQC 1K0SA 1AEYA 1UE9A 1MUZA 2VKNA 4D8KA 2JM9A 1N5ZA 2FPFA 2HBWA 3I35A 2HEQA 2KXCA 2MIOA 1W6XA 4RTXA 3O5ZA 5GJWB 2GBQA 1AWJA 2VVKA 2DBKA 1LCKA 3H41A 1PHTA 1QKXA 1GCPA 1YN8A 2KR3A 2DRMA 2LQNA 1H3HA 3H0FA 1M30A 2H8HA 1AZEA 2AZSA 1UGVA 2AKKA 2RQUA 1UUEA 1GCQA 2J6FA 4LUEA 2EYYA 2FPEA 1X6BA 1H92A 2YUNA 4J9BA 1GBQA 2L3QA 1OOTA 3NPFA 2K3BA 4CC4B 3TSWA 1HD3A 5ECAA 3M0SA 5GJVB 1AWOA 4DEYA 1JXOA 1QWFA 2X3XD 4LUDA 4OMLA 3THKA 1KIKA 2JS0A 1W1FA 1X43A 1ZUYA 1H8KA 2YUPA 3U23A 2RN8A 2J05A 4Z88A 1BB9A 2DMOA 1X27A 1QLYA 4HVWA 3VS1A 4EIKA 4LNPA 2FRYA 2JMCA 2RPNA 1SEMA 4LE9A 3UATA 1ABQA 1FMKA 2LJ1A 2BZ8A 2KT8A 3EG1A 2DL7A 3VS6A 2EGEA 1CKAA 3JV3A 4OMPA 2V1QA 3TSZA 1U06A 2K7AA 4J9HA 2DX1A 2V1RA 3H0IA 1RLPC 1WYXA 2KRSA 2LMJA 1ABOA 3A98A 1E6GA 1ZX6A 1NG2A 5EC7A 2JM8A 2D1XA 4AFUC 2FRWA 1T3SA 3C0CA 4F17A 1SSHA 1M3AA 2DA9A 2GQIA 3REBB 1E6HA 2J6OA 2B86A 1I1JA 2FPDA 1HSQA 1YP5A 1K1ZA 2F2WA 2P4RA 1PWTA 2LJ3A 3VS5A 2EGAA 2YDLA 2L3SA 3RBBB 4RTUA 2E5KA 2AKLA 1TUDA 1PRLC 1ZUKA 5I22A 4JJCA 3PE0A 1AVZC 1GRIA 1U3OA 4IIMA 1KSWA 4F14A 1FYNA 1PKTA 1JO8A 4RUGA 2DILA 2F2XA 2RF0A 4JZ3A 2G6FX 1X69A 4RTTA 1ZLMA 2EYXA 2JW4A 1QCFA 1OV3A 2D8HA 3M0UA 2O9SA 1K4US 4ORZA 2ENMA 2JXBA 1Y57A 2GGRA 2EW3A 3NGPA 2OAWA 2RNAA 4WCIA 4Y92A 3EGUA 1BBZA 1T3LA 2ABLA 2CDTA 2FG0A 2CH4A 2CUDA 2EVRA 3I5SA 2KEAA 3REAB 2JT4A 3I9QA 1UECA 2QDLA 1K9AA 1SRLA 2A36A 2RQRA 1GFCA 1W70A 1XOVA 2J7IA 3NHNA 2J06A 1UFFA 3VS2A 1QWEA 2ED1A 2KNBB 1YWOA 1TUCA 3I5RA 2YT6A 4D8DA 1EFNA 1JXMA 4OMNA 2DL5A 2EYZA 2DJQA 4J9DA 1VYUA 4RTWA 1NEGA 1T0JA 3EHQA 2RMOA 4RTZA 3VS7A 2JS2A 1OEBA 1WFWA 2K9GA 2OI3A 4Z8AA 3M0RA 4OMOA 2CUBA 3VS0A 3VRZA 1WDXA 1BK2A 3FJ5A 4IIOA 2EQIA 2J6KA 3EHRA 5FWCA 5IXFA 4HVUA 2KE9A 2C0OA 1UDLA 2KXDA 4LN2A 1T0HA 4J9GA 4K11A 2EGCA 3ULRB 4HCKA 1JEGA 5HCKA 1TG0A 1WXTA 2D8JA 2LZ6B 2KT1A 1UHFA 4JJDA 3TVTA 1B3QA 4J9EA 1GFDA 1VA7A 1X6GA 1M8MA 2DL3A 4AFSC 3H0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQQ A;  2KRO A;  2L2P A;  2MOX A;  1SHF A;  1NYF A;  2PNI A;  2KRM A;  1WIE A;  3EG0 A;  4HXJ A;  1K0X A;  2K6D A;  3SEM A;  1AD5 A;  2A28 A;  2LP5 A;  2LJ0 A;  2NUZ A;  3M0Q A;  1PRM C;  2FEI A;  1A0N B;  2W10 A;  2DLP A;  2DNU A;  2KRN A;  2L3P A;  3M0P A;  1UHC A;  4J9I A;  1RUW A;  2ESW A;  1MV0 B;  4E6R A;  2F2V A;  1X2K A;  1CKB A;  1NYG A;  4RTV A;  5IXB A;  1CSK A;  3NMZ C;  5IHI A;  2K79 A;  5IHN A;  4ESR A;  4J9C A;  2AK5 A;  2ED0 A;  2DL4 A;  1UJ0 A;  4CC2 A;  1V1C A;  3KFV A;  5IHK A;  1I0C A;  4Z89 A;  1NLO C;  1YNZ A;  1I07 A;  2LQW A;  2HSP A;  1GBR A;  1VYV A;  2O88 A;  2YSQ A;  1AZG B;  3VRY A;  2M51 A;  2O9V A;  3EG2 A;  3R6N A;  1ZBJ A;  1KFZ A;  1SRM A;  2DM1 A;  5FW9 A;  1NLP C;  4AG1 C;  1MV3 A;  1WXB A;  1AWX A;  2CH4 W;  2GTO A;  1UJY A;  2EBP A;  3UF4 A;  1YCS B;  2A37 A;  1SPK A;  2BZX A;  2MCN A;  3IQL A;  4RTY A;  1U5S A;  1WA7 A;  1WLP B;  2OJ2 A;  3CQT A;  4CC3 A;  1UG1 A;  2LCS A;  2PTK A;  2A08 A;  2KYB A;  3UA6 A;  2CRE A;  1ZUU A;  4J9F A;  2C0I A;  1YWP A;  1Y0M A;  4AFZ C;  1GL5 A;  1KJW A;  2IIM A;  1ARK A;  4JJB A;  2RQW A;  1HJD A;  1G2B A;  1UTI A;  4ZNX A;  4X1V A;  1Z9Q A;  1K76 A;  2JMA A;  4OMQ A;  1WX6 A;  5L23 A;  3EG3 A;  2XMF A;  3ZL7 C;  1NEB A;  1OPL A;  2KBT A;  2EPD A;  5I11 A;  2CT4 A;  2KGT A;  1QKW A;  4AG2 C;  2AZV A;  1PKS A;  3RNJ A;  5FWB A;  2L0A A;  3SHW A;  2HCK A;  2DL8 A;  2O2O A;  2ROL A;  1WI7 A;  4GLM A;  2X3W D;  2DYB A;  1AOJ A;  4DEX A;  3QWY A;  2EKH A;  4F16 A;  2DRK A;  1PNJ A;  2GTJ A;  2DBM A;  3GBQ A;  4M4Z A;  4HVV A;  2DF6 A;  2I0N A;  2K2M A;  2FO0 A;  2JTE A;  1Z9Z A;  2CSI A;  1VYT A;  2KYM A;  2C0T A;  2LNH B;  2D0N A;  1IO6 A;  2DE0 X;  2NWM A;  1NM7 A;  4KRT A;  2BTT A;  2YUO A;  3PVL A;  1M3B A;  4R0K A;  1SHG A;  2SEM A;  1RI9 A;  4GBQ A;  1S1N A;  2BZY A;  2YUQ A;  2ROT A;  1B07 A;  2CT3 A;  1E7O A;  2LX7 A;  1GCQ C;  4A63 B;  2W0Z A;  2CSQ A;  2VWF A;  3UA7 A;  1BU1 A;  3PVQ A;  2PZ1 A;  1X2Q A;  2ECZ A;  2RQT A;  1ZSG A;  3VS4 A;  2M0Y A;  2DVJ A;  1G83 A;  4FSS A;  3QWX X;  2O31 A;  4JPB W;  1OPK A;  1WXU A;  2SRC A;  2GNC A;  3LH5 A;  1AWW A;  2EYW A;  4QT7 A;  4OMM A;  5IH2 A;  4JZ4 A;  2RQV A;  1M27 C;  3VS3 A;  2HDA A;  1RLQ C;  1JU5 C;  1J3T A;  1M3C A;  3M0T A;  4CC7 A;  4AFQ C;  1K0S A;  1AEY A;  1UE9 A;  1MUZ A;  2VKN A;  4D8K A;  2JM9 A;  1N5Z A;  2FPF A;  2HBW A;  3I35 A;  2HEQ A;  2KXC A;  2MIO A;  1W6X A;  4RTX A;  3O5Z A;  5GJW B;  2GBQ A;  1AWJ A;  2VVK A;  2DBK A;  1LCK A;  3H41 A;  1PHT A;  1QKX A;  1GCP A;  1YN8 A;  2KR3 A;  2DRM A;  2LQN A;  1H3H A;  3H0F A;  1M30 A;  2H8H A;  1AZE A;  2AZS A;  1UGV A;  2AKK A;  2RQU A;  1UUE A;  1GCQ A;  2J6F A;  4LUE A;  2EYY A;  2FPE A;  1X6B A;  1H92 A;  2YUN A;  4J9B A;  1GBQ A;  2L3Q A;  1OOT A;  3NPF A;  2K3B A;  4CC4 B;  3TSW A;  1HD3 A;  5ECA A;  3M0S A;  5GJV B;  1AWO A;  4DEY A;  1JXO A;  1QWF A;  2X3X D;  4LUD A;  4OML A;  3THK A;  1KIK A;  2JS0 A;  1W1F A;  1X43 A;  1ZUY A;  1H8K A;  2YUP A;  3U23 A;  2RN8 A;  2J05 A;  4Z88 A;  1BB9 A;  2DMO A;  1X27 A;  1QLY A;  4HVW A;  3VS1 A;  4EIK A;  4LNP A;  2FRY A;  2JMC A;  2RPN A;  1SEM A;  4LE9 A;  3UAT A;  1ABQ A;  1FMK A;  2LJ1 A;  2BZ8 A;  2KT8 A;  3EG1 A;  2DL7 A;  3VS6 A;  2EGE A;  1CKA A;  3JV3 A;  4OMP A;  2V1Q A;  3TSZ A;  1U06 A;  2K7A A;  4J9H A;  2DX1 A;  2V1R A;  3H0I A;  1RLP C;  1WYX A;  2KRS A;  2LMJ A;  1ABO A;  3A98 A;  1E6G A;  1ZX6 A;  1NG2 A;  5EC7 A;  2JM8 A;  2D1X A;  4AFU C;  2FRW A;  1T3S A;  3C0C A;  4F17 A;  1SSH A;  1M3A A;  2DA9 A;  2GQI A;  3REB B;  1E6H A;  2J6O A;  2B86 A;  1I1J A;  2FPD A;  1HSQ A;  1YP5 A;  1K1Z A;  2F2W A;  2P4R A;  1PWT A;  2LJ3 A;  3VS5 A;  2EGA A;  2YDL A;  2L3S A;  3RBB B;  4RTU A;  2E5K A;  2AKL A;  1TUD A;  1PRL C;  1ZUK A;  5I22 A;  4JJC A;  3PE0 A;  1AVZ C;  1GRI A;  1U3O A;  4IIM A;  1KSW A;  4F14 A;  1FYN A;  1PKT A;  1JO8 A;  4RUG A;  2DIL A;  2F2X A;  2RF0 A;  4JZ3 A;  2G6F X;  1X69 A;  4RTT A;  1ZLM A;  2EYX A;  2JW4 A;  1QCF A;  1OV3 A;  2D8H A;  3M0U A;  2O9S A;  1K4U S;  4ORZ A;  2ENM A;  2JXB A;  1Y57 A;  2GGR A;  2EW3 A;  3NGP A;  2OAW A;  2RNA A;  4WCI A;  4Y92 A;  3EGU A;  1BBZ A;  1T3L A;  2ABL A;  2CDT A;  2FG0 A;  2CH4 A;  2CUD A;  2EVR A;  3I5S A;  2KEA A;  3REA B;  2JT4 A;  3I9Q A;  1UEC A;  2QDL A;  1K9A A;  1SRL A;  2A36 A;  2RQR A;  1GFC A;  1W70 A;  1XOV A;  2J7I A;  3NHN A;  2J06 A;  1UFF A;  3VS2 A;  1QWE A;  2ED1 A;  2KNB B;  1YWO A;  1TUC A;  3I5R A;  2YT6 A;  4D8D A;  1EFN A;  1JXM A;  4OMN A;  2DL5 A;  2EYZ A;  2DJQ A;  4J9D A;  1VYU A;  4RTW A;  1NEG A;  1T0J A;  3EHQ A;  2RMO A;  4RTZ A;  3VS7 A;  2JS2 A;  1OEB A;  1WFW A;  2K9G A;  2OI3 A;  4Z8A A;  3M0R A;  4OMO A;  2CUB A;  3VS0 A;  3VRZ A;  1WDX A;  1BK2 A;  3FJ5 A;  4IIO A;  2EQI A;  2J6K A;  3EHR A;  5FWC A;  5IXF A;  4HVU A;  2KE9 A;  2C0O A;  1UDL A;  2KXD A;  4LN2 A;  1T0H A;  4J9G A;  4K11 A;  2EGC A;  3ULR B;  4HCK A;  1JEG A;  5HCK A;  1TG0 A;  1WXT A;  2D8J A;  2LZ6 B;  2KT1 A;  1UHF A;  4JJD A;  3TVT A;  1B3Q A;  4J9E A;  1GFD A;  1VA7 A;  1X6G A;  1M8M A;  2DL3 A;  4AFS C;  3H0H A; 
#chains in the Genus database with same CATH topology
 1JQQ A;  2L2P A;  1SHF A;  1NYF A;  4E2F B;  1IRX A;  2PNI A;  1Y96 A;  2KRM A;  2F1L A;  2LX9 A;  2RHU A;  3EG0 A;  3MCA B;  1VQ7 T;  4HXJ A;  2XID A;  2FZC B;  1TS9 A;  2F69 A;  3QUI A;  3V7C A;  3OBW A;  3CCL A;  1NZ9 A;  2NLU A;  4M7D F;  3H8Z A;  1YI2 Q;  1VQP A;  4PJO A;  5FU7 C;  1ZSZ A;  4RTV A;  1BYM A;  1YIT Q;  4BE0 A;  3RUX A;  1D1B A;  1G5V A;  5CKE A;  4J9C A;  3JAM E;  3MO8 A;  4LDU A;  5KYY B;  1WHG A;  2X35 A;  1NE8 A;  5IHK A;  1I0C A;  1NLO C;  2QEX T;  2YLC A;  4PK4 A;  3V8L A;  1VIE A;  1NPR A;  3LH0 A;  2OTL Q;  1RL2 A;  3CCQ A;  4XTY A;  1GBR A;  1VYV A;  2O88 A;  2YSQ A;  1AZG B;  3VRY A;  1U1S A;  2O9V A;  5GAO r;  1MND A;  1KC8 U;  2K4Y A;  1KFZ A;  2E10 A;  1SRM A;  5D6X A;  1MV3 A;  3OYH A;  1W4S A;  1ZSZ C;  2GTO A;  3OYF A;  4A54 A;  1B7T A;  2QQR A;  4E7H A;  5A0G A;  5GAO l;  2A37 A;  3C4S A;  4KUL A;  2KQW A;  4RTY A;  1S72 T;  3CCM A;  5LJ3 j;  5GAN d;  3NFC A;  3BDU A;  3F70 A;  4XAX B;  2PTK A;  3FIF A;  3EFR A;  2EYQ A;  2O4X A;  3TQ7 P;  3JSC A;  3JCM X;  4FIB A;  4AFZ C;  4C0Z A;  1KJW A;  4LD6 A;  1EIF A;  3CCQ Q;  3LGF A;  4ME7 A;  4ZTF A;  4ZTJ A;  4GLK A;  1UTI A;  7AT1 B;  3SWN C;  2DD5 A;  2E4H A;  5GAM e;  3QG1 A;  4ZN3 A;  1WX6 A;  2RI5 A;  3JRZ A;  4PJO E;  2XMF A;  3L2Z A;  4J6W A;  2YRV A;  2CZ6 B;  4BY6 C;  2V8I A;  4BDY A;  3JCM P;  3DB3 A;  2DL8 A;  1WI7 A;  4BI8 B;  2BIV A;  1VQ4 T;  1IGQ A;  4PJO B;  3RKW A;  1AOJ A;  1WQW A;  3QWY A;  3TRE A;  1C1A A;  2RHX A;  1KD1 C;  5EG2 A;  2CP7 A;  1YJ9 T;  4MZM A;  4M4Z A;  4HVV A;  1TH7 A;  1Q81 U;  2JTE A;  4V2S A;  3NTI A;  3M5A A;  4MDX A;  2BE7 D;  2DE0 X;  1RAE B;  4XTV A;  2YUO A;  3FC3 A;  2ZPE B;  3PVL A;  1M3B A;  1BKB A;  4HA8 A;  3CC2 T;  1IRE B;  2BZY A;  2FZG B;  3CPF A;  4QW2 A;  5LJ3 d;  3CCM Q;  1B07 A;  1W2B S;  4PJO G;  3PTA A;  5KE2 A;  3L2V A;  3OYG A;  3JCM d;  5GAN 6;  3UA7 A;  3DLL A;  2HL3 A;  1IXD A;  3GNG A;  3I56 A;  1LNX A;  4PJN A;  5FU6 B;  1VQP Q;  3PVQ A;  3VYG A;  5GAM f;  4RG2 A;  2MI6 A;  4X34 A;  1QCN A;  4FT4 A;  2E1H A;  1M90 C;  3CCJ A;  4B9W A;  5CAI A;  2COZ A;  3LH5 A;  4FW1 A;  4OMM A;  3OBY A;  4M77 D;  5L8R E;  2QEX Q;  4JZ4 A;  3VS3 A;  2HDA A;  3PFS A;  3GP8 A;  5KCH A;  1M3C A;  3UT1 A;  4F7U E;  1TSF A;  1UE9 A;  4E7J A;  2DTI A;  1VQ5 T;  3BFM A;  1N5Z A;  3L2W A;  2JVV A;  2A0F B;  1Q82 C;  1K73 C;  5KYN A;  2HEQ A;  1YIJ A;  4YTL A;  2DXT A;  2MIO A;  2FVU A;  5CR2 A;  4PJO F;  1N9S A;  3CXC S;  3VUB A;  4IUT A;  1WQ7 A;  2KVQ G;  2QAS A;  1Y07 A;  2DBK A;  1YIJ Q;  1GCP A;  2HSE B;  4ATO A;  4EMK B;  2EWN A;  1JJ2 P;  1PCX A;  3S3M A;  4LXC A;  2H8H A;  2RQU A;  1UGV A;  1H3Z A;  2KK4 A;  2DD4 A;  2LQ8 A;  2J6F A;  4AMC A;  3GOX A;  4LUE A;  3CCU A;  2EYY A;  1VQO T;  1QMC A;  2FPE A;  3I55 A;  1X6B A;  4J9B A;  3BDL A;  2PVO B;  1YHQ A;  4M75 E;  1MNE A;  4CC4 B;  1N8R C;  5ECA A;  1QVF A;  5GJV B;  3OYA A;  1IGU A;  2ZPB B;  2A3L A;  2JZ2 A;  1HXD A;  4OMF B;  4E7S A;  3JB9 F;  2MWO A;  3THK A;  2L8D A;  2JS0 A;  2LCL A;  1H8K A;  3HFO A;  2CP2 A;  3G71 Q;  3FEO A;  5GAO q;  3M54 A;  3M59 A;  2J05 A;  2DMO A;  4O5V A;  1X27 A;  1M8V A;  1G3Y A;  4OB3 B;  4LNP A;  2JMC A;  1SEM A;  4QQ6 A;  2EQM A;  3OMC A;  5I2M A;  2VC8 A;  2WSC E;  2X4X A;  2KT8 A;  3EG1 A;  2RI3 A;  3VS6 A;  4LD9 K;  2EGE A;  1IB8 A;  4QVC A;  2E3I A;  1D09 B;  3JV3 A;  2C06 A;  2VYT A;  4OP0 A;  1ZA2 B;  4C92 D;  4Y91 A;  3EFO B;  1OQK A;  3H0I A;  2QGF B;  1RLP C;  2VXE A;  1WYX A;  4KT0 E;  4ELY C;  1NG2 A;  5EC7 A;  1F1B B;  3A5Z B;  2D1X A;  5LL6 S;  4C5H A;  3WVE B;  3L2U A;  3EGD A;  3RIR A;  1V76 A;  1QCO A;  3HFN A;  1I1J A;  2FPD A;  1JRI A;  1TTH B;  3MPU B;  2E41 A;  5IAY A;  2P4R A;  3QPH A;  1AT1 B;  5DLQ E;  5LJ5 f;  4RTU A;  2E5K A;  1TUD A;  2HNI A;  3G1J A;  3CXC P;  1VQM T;  5I22 A;  5AT1 B;  1KQ1 A;  3PE0 A;  4ZGE B;  5LJ3 g;  1GRI A;  1U3O A;  2ZPG B;  1PKT A;  2MPX C;  2PUO B;  2R5M A;  4C0F A;  4X9D A;  3T9N A;  2RHZ A;  4F04 B;  2GQV A;  2F2X A;  1LVK A;  2RF0 A;  2DTO A;  1ZHI A;  2NUT A;  4RTT A;  1ZLM A;  3VJP A;  4C0D B;  2K57 A;  5FRM A;  3JB9 I;  2D8H A;  3M0U A;  4ZGD B;  5KCO A;  3OYL A;  3I55 Q;  2O9S A;  2RJE A;  3I56 Q;  2ENM A;  2LRQ A;  5KYU A;  4M7A D;  3OYD A;  3NGP A;  3C12 A;  4WCI A;  5D6W A;  2KMT A;  2D6F A;  1Y71 A;  3E9G A;  1VOM A;  3RKY A;  2FG0 A;  1SF9 A;  2EVR A;  1VQO Q;  3LW5 E;  1WHL A;  1SKU B;  1M90 U;  1K9A A;  2A36 A;  2E65 A;  2OAU A;  1TOV A;  1XOV A;  2H3E B;  5LJ5 e;  1OYX A;  4ANJ A;  3RMS A;  3CEY A;  2KNB B;  3LWH A;  5AYF A;  2EYZ A;  3JCM W;  2DJQ A;  2DIQ A;  5KYU B;  4J6X A;  2RM4 A;  3CCR Q;  1OEB A;  2K9G A;  4M7A E;  4Z8A A;  2HZY A;  3A1P A;  1BIB A;  1WDX A;  4A4E A;  4OGE A;  1FX7 A;  4JRK A;  5IXF A;  3ZFJ A;  2KE9 A;  4F7U A;  4RG8 A;  4J9G A;  2EGC A;  3EH2 A;  2CKK A;  1M1K C;  1ZBX A;  4J7F A;  4EMG A;  1FWZ A;  1TG0 A;  5GAO m;  3CME Q;  1MMA A;  1VQ7 A;  4OVA A;  1VA7 A;  1MGQ A;  1I5O B;  1M8M A;  2DL3 A;  3VUZ A;  4AFS C;  3CCL T;  2Y4Y A;  2KRO A;  2MOX A;  3QO3 A;  3N5B B;  5CCA A;  3MP1 A;  1M5Q 1;  2M0O A;  1K0X A;  2K6D A;  2QQB A;  3M9Q A;  1D3B A;  1AD5 A;  3E2U A;  1PRM C;  1BIA A;  2DLP A;  3CC4 Q;  2L3P A;  1MV0 B;  4E6R A;  4ZGJ B;  1X2K A;  1K9M C;  1VQM Q;  1RAA B;  3E19 A;  3EFO A;  3QBY A;  5IHI A;  4F7U F;  4DA4 A;  2RK2 A;  4MZT A;  3QII A;  1PD1 A;  1KC8 C;  5GAM g;  1I81 A;  2HD0 A;  2AK5 A;  2ED0 A;  2XU8 A;  3SWN A;  5IT9 E;  1UJ0 A;  1V1C A;  3KFV A;  3CCS T;  2K5L A;  4Z89 A;  4FYW B;  1YI2 T;  2M1H A;  2HSP A;  2CZ0 B;  2IPO B;  4KGZ B;  3EGX B;  3QDR B;  3I55 T;  2D0Q B;  2NUT B;  3R6N A;  2NUP A;  1YIT T;  2G3R A;  3GF5 A;  5HY6 A;  1VQ6 A;  1NLP C;  2P0Q A;  1VQK Q;  1PSF A;  3MHX A;  1RAF B;  2KI7 A;  2EBP A;  1QVP A;  3UF4 A;  1YJW T;  1BI3 A;  4AT1 B;  4M78 E;  3IQL A;  2P0K A;  4M75 B;  5GMK l;  5KYX B;  1M2V A;  4CC3 A;  2XKO C;  3H9N A;  2KSS A;  1Q86 U;  1Q81 R;  5GAN 3;  4E7Z A;  2YXY A;  3SB2 A;  3CXC A;  2YHT A;  1R0C B;  5GAM d;  1M4Z A;  1Y0M A;  2IIM A;  4M7D C;  2RQW A;  1KG1 A;  4ZNX A;  5LJ5 j;  1VQ4 A;  3BE3 A;  2XDP A;  1MHN A;  3CPW A;  1NEB A;  1KQS P;  4C0G A;  3JB9 D;  2HL5 C;  2KBT A;  3RKX A;  2JN0 A;  1YHQ Q;  1YJ9 A;  1QKW A;  2GCX A;  3QDF A;  1VQ9 T;  1PKS A;  3RNJ A;  5FWB A;  3SHW A;  2DIG A;  2ZCF B;  4DEX A;  4F16 A;  3OS0 A;  2E3H A;  3G6E Q;  2GTJ A;  3S3O A;  4M77 E;  2DBM A;  5CO7 A;  4WTO B;  4FW2 A;  2DF6 A;  2P84 A;  2K2M A;  4M7D A;  2LNV A;  2CSI A;  3OYI A;  4DBQ A;  1VQ6 Q;  1XTD A;  1IO6 A;  1KK7 A;  5DM7 R;  2NWM A;  3QSU A;  2DET A;  2F5K A;  5GMK j;  1M9S A;  5LJ5 h;  3A8G B;  4R0K A;  2SEM A;  2LT4 A;  1K9M R;  2MWP A;  5D6Y A;  1S1N A;  3J81 E;  4II1 A;  2ROT A;  2CT3 A;  2LX7 A;  2W0Z A;  2CSQ A;  2DVE A;  2OTJ A;  4BI3 A;  5CVI A;  1VQ5 Q;  3FRN A;  1X2Q A;  2PQW A;  4NOY A;  2DEQ A;  3CMA T;  1ZSG A;  4A53 A;  4FSS A;  3QWX X;  2O31 A;  1FMV A;  4E7L A;  2ZPH B;  2EIF A;  4M77 B;  3CC2 Q;  2LQK A;  2EYW A;  1AWW A;  4JRQ A;  4C8Q A;  4PJJ A;  3V7S A;  5KYX A;  1JU5 C;  3C95 A;  1YIJ T;  1J3T A;  2EKO A;  2LVM A;  2XK0 A;  4AFQ C;  2K5I A;  2B8A A;  1DJ7 B;  3MP8 A;  5CKH A;  2BKD N;  2DZC A;  3O8V A;  4KGV B;  4RTX A;  5C0M A;  3ZBD A;  1TXQ A;  2O01 E;  4L6V 5;  3CCU T;  1VQO A;  4C5G A;  1YN8 A;  4RMO A;  2DRM A;  4MMK A;  2LCC A;  3H0F A;  4DOV A;  1BCM A;  1WJR A;  4XQ3 A;  2AKK A;  2XI9 A;  2JNG A;  4HCB A;  4A4K A;  1BI0 A;  4C92 G;  1I4K 1;  4QVD A;  1RAH B;  1VUB A;  4QQG A;  3QJ6 A;  3OYM A;  2DER A;  1H92 A;  3E1S A;  4HKE A;  2L3Q A;  2V8J A;  2K3B A;  3EG9 A;  3G4S T;  1HD3 A;  3JCM h;  4M7A B;  1K8A R;  4DEY A;  1JXO A;  3M4G A;  1QWF A;  2X3X D;  4OML A;  5GMK e;  2Y4X A;  1X43 A;  1ZUY A;  1O75 A;  2JUF A;  2D9T A;  1M1F A;  2RN8 A;  1M2V B;  2VAS A;  2EQJ A;  1JJ2 A;  1UGQ B;  1YBY A;  1N9R A;  2FRY A;  3UAT A;  3EAE A;  1D3B B;  1FMK A;  2XIC A;  4B6M A;  2BZ8 A;  4IKF A;  3OSS C;  4MDW A;  1CKA A;  2X9H A;  3L2Q A;  5DY9 A;  2RA2 A;  2V1Q A;  4C8Q E;  2COW A;  3TSZ A;  3LWI A;  3PGG A;  3JB9 G;  1U06 A;  5CKD A;  2EJF A;  3LX7 A;  2OTJ Q;  1PD0 A;  1MMD A;  3G71 T;  3WVD B;  5GAN j;  4M78 B;  4M7D D;  3V8K A;  2E70 A;  2XHC A;  2XD0 A;  1SSH A;  1M2O A;  4P5N A;  2CS7 A;  3REB B;  1E6H A;  2J6O A;  2LT1 A;  1C0M A;  1K1Z A;  2HQH A;  1Q81 C;  3WXM B;  2MAM A;  1VQ8 A;  2O4X B;  2EJG A;  2YDL A;  4FYY B;  3RBB B;  4A4F A;  1BCO A;  1M1G A;  1NJI C;  2K3Y A;  4JJC A;  3OYE A;  1C6V X;  2XG8 D;  2IVW A;  5KYW B;  2ZAE A;  1BI2 A;  2VV5 A;  4F14 A;  2MF2 A;  2DIL A;  3SFM A;  2OX7 A;  4JZ3 A;  2WAC A;  1OV3 A;  1RAC B;  2QQ9 A;  3CCV A;  1Q82 U;  1K73 U;  3CCE T;  3TCJ A;  1G3T A;  1OU9 A;  5GAN 7;  4ORZ A;  3GIB A;  4FL6 A;  4A4H A;  1V29 B;  2K5F A;  4Y92 A;  5CQY A;  4HT9 A;  2PVD B;  2OTL A;  2CUD A;  3D7S B;  1Q7Y R;  3X28 B;  2JT4 A;  3I9Q A;  1UEC A;  3KXT A;  2QDL A;  2HKN A;  1X75 C;  3OYN A;  1VQL Q;  1W70 A;  2AT1 B;  2ZZD A;  3NHN A;  5GAN 8;  2E12 A;  2J06 A;  1UFF A;  2ED1 A;  3GPL A;  1Y7X A;  4PLI A;  3G4S Q;  1TUC A;  2R5A A;  3I5R A;  3I56 T;  4D8D A;  1EFN A;  1JXM A;  3QHS A;  5C6S A;  2DXU A;  1D1C A;  1VYU A;  4RTW A;  1NEG A;  4C8Q B;  3RER A;  4C8Q D;  2DXB A;  1IHW A;  3VU3 C;  2MK5 A;  2CUB A;  3VS0 A;  1OI1 A;  2EQI A;  2J6K A;  4HVU A;  2QGG A;  2C0O A;  1SG5 A;  1T0H A;  1Q82 R;  1K73 R;  5A2Q E;  1UGP B;  1JEG A;  2QI2 A;  2R57 A;  5GAM h;  1M1K R;  5HCK A;  4NS5 A;  1KD1 U;  2CP5 A;  4FT2 A;  3OY9 A;  2OTJ T;  4JJD A;  3TVT A;  3FB9 A;  4J9E A;  1QVG A;  4J83 A;  4KBM B;  4UC4 A;  2JOY A;  2R58 A;  5GAN g;  2QA4 Q;  3RR6 A;  2A28 A;  3M0Q A;  2LJ0 A;  3KUF A;  1A0N B;  4IUR A;  1YJN T;  2DXC A;  3CCS Q;  3M0P A;  1OX9 A;  4J9I A;  2BE9 B;  3EH1 A;  3CME T;  4BE1 A;  3JCM e;  2RJF A;  4M75 F;  3CCM T;  1WNL A;  1CKB A;  3NTH A;  1XNI A;  1NYG A;  2RH2 A;  1CSK A;  3NMZ C;  2K79 A;  5KYY A;  1JJ2 S;  4M77 C;  1N6A A;  4ESR A;  3INZ A;  4XU2 A;  2E64 A;  4JS4 A;  1PC0 A;  4CC2 A;  1YIT A;  3GLX A;  3L1A A;  5IN1 A;  4LDY A;  1YNZ A;  2CP3 A;  2LQW A;  5LJ3 e;  5GMK i;  5FU7 B;  1G3W A;  3G6E A;  4BY6 B;  1MMG A;  3LLR A;  1HK9 A;  2HQE A;  4AG1 C;  1WXB A;  1AWX A;  2CH4 W;  1ACM B;  1D0Y A;  1UJY A;  4F7U B;  1YCS B;  1VIF A;  2PU9 B;  1KHC A;  4IUV A;  5GMK m;  3AHU A;  1U5S A;  3UWN A;  3QYH B;  1I5L A;  1VQL T;  4CI0 C;  2JTM A;  2DAQ A;  2OJ2 A;  4XTU A;  3HTR A;  3CQT A;  4M77 F;  1VQN A;  4E7I A;  1UG1 A;  1WZO A;  3JCM J;  2QTX A;  2A08 A;  2KYB A;  1VQ9 Q;  3UA6 A;  5KH6 A;  2GF7 A;  1D1A A;  2CRE A;  1ZUU A;  3OYB A;  4Y28 E;  1GL5 A;  2F5T X;  1ARK A;  4HT8 A;  4M7D B;  4JJB A;  1G2B A;  5CQX A;  4E7K A;  2VGN A;  2JMA A;  4OMQ A;  4N4I A;  5L23 A;  2M02 A;  3EG3 A;  1Q86 C;  3OYC A;  2YLB A;  1OPL A;  5LJ3 f;  3RMQ A;  2EPD A;  2FB7 A;  2KGT A;  3CBP A;  4AG2 C;  1LPL A;  3JCM g;  2RHI A;  3MET A;  4QVZ A;  3OYJ A;  4GLM A;  4KUD K;  2QTV A;  2HKQ B;  4C5E A;  2DRK A;  1PNJ A;  2M9U A;  3GBQ A;  4ZN1 A;  1X01 A;  2I0N A;  3S6W A;  2FO0 A;  1Z9Z A;  5CKB A;  2D0N A;  1VQ7 Q;  4A4G A;  1OZ3 A;  2BTT A;  1K8A C;  1N8R R;  4DOW A;  1P92 A;  2ZPF B;  2K3X A;  3URG A;  4C92 C;  9ATC B;  3HKS A;  1E7O A;  2KY9 A;  2DTH A;  3CC7 T;  4J6Y A;  2A7Y A;  1BU1 A;  2L5Q A;  3CCV T;  2ECZ A;  2EFI A;  2M0Y A;  3QKJ A;  3OS2 A;  2VGM A;  2NUP B;  1WXU A;  1OPK A;  1RI0 A;  3CD6 A;  4M78 D;  2GNC A;  4LDX A;  4EPC A;  2P0P A;  4KUI A;  5IH2 A;  2RQV A;  1M27 C;  3RES A;  1RLQ C;  4M7D G;  3DKM A;  2OTL T;  3FLG A;  4OF1 A;  1K0S A;  1AEY A;  2WSE E;  4N4H A;  5HK3 A;  4JLI A;  2HBW A;  4PKC C;  2KXC A;  3CC4 A;  3FDR A;  4EMK A;  1AWJ A;  3HRT A;  3V8J A;  1LJO A;  2VVK A;  2VXF A;  1PHT A;  1QKX A;  4F7U G;  1M90 R;  2KR3 A;  1RAG B;  2LQN A;  3OW2 P;  1H3H A;  1RAD B;  4M75 A;  1M30 A;  3SWN B;  1UUE A;  5GAO p;  1GCQ A;  4CRI A;  2IG0 A;  5LJ3 h;  3BW1 A;  2YUN A;  2DKG A;  4JS5 A;  1AHJ B;  4M7D E;  5GAN h;  1OOT A;  4HCZ A;  4EMH A;  2FL7 A;  3M0S A;  4X9C A;  1AWO A;  2RK1 A;  3HRU A;  4LUD A;  1R0B G;  1W1F A;  2YUP A;  3U23 A;  3A8L B;  2L3R A;  1QLY A;  2NYS A;  2ZPI B;  4HVW A;  2RI2 A;  3CBM A;  1VQM A;  1VQ4 Q;  4EIK A;  1WJS A;  2QEX A;  2DYI A;  3J80 E;  2JJ9 A;  3OYY A;  1MMN A;  2RJD A;  3CPW P;  3X26 B;  4J9H A;  4FCY A;  1YJW A;  2DX1 A;  3PIP A;  2LMJ A;  1ABO A;  1OX8 A;  4BDZ A;  6AT1 B;  2KDS A;  2JM8 A;  2FRW A;  1T3S A;  4M7A C;  3C0C A;  3X25 B;  3MJX A;  1M3A A;  4OB2 B;  2GQI A;  5FU6 C;  2B86 A;  3CC7 Q;  3P8D A;  1HSQ A;  4M78 A;  3EFS A;  4XTX A;  2F2W A;  1PWT A;  3VS5 A;  2EGA A;  5A0L A;  1FMW A;  4DBH A;  4C0D C;  2AKL A;  4M75 D;  1ZUK A;  5HK0 A;  3FJP A;  5HKC A;  1AVZ C;  3CCJ Q;  1OUL A;  5GAN 4;  1KSW A;  3HPW A;  3MEV A;  4C8Q G;  3OW2 S;  4QQD A;  3UPU A;  3OB9 A;  1VQN T;  2DFU A;  3LYI A;  3OMG A;  2JW4 A;  1QCF A;  1K4U S;  3E9F A;  2OAW A;  3MKD A;  5A0D A;  1VQK T;  3EGU A;  1BBZ A;  2X4Y A;  1T3L A;  3DB4 A;  2CDT A;  1KC8 R;  2YRD A;  4E47 A;  3I5S A;  3L2R A;  2BUD A;  2RQR A;  1SRL A;  1GFC A;  1U8R A;  4MML A;  3VS2 A;  3CCR A;  1YWO A;  2YT6 A;  4OMN A;  2COY A;  4ELZ C;  1KQS A;  4PJM A;  4J9D A;  1X6O A;  3HRS A;  3CPW S;  3EHQ A;  2YRC A;  2RMO A;  4R55 A;  3VS7 A;  2JS2 A;  2CP0 A;  2P4T A;  4Q5W A;  4M77 A;  3M0R A;  4OMO A;  1G8X A;  3VRZ A;  3HL8 A;  1BK2 A;  3Q1J A;  1W2B P;  5FWC A;  1QVF P;  2KXD A;  4LN2 A;  5KE3 A;  4K11 A;  2Z0W A;  3AT1 B;  4HCK A;  3CC7 A;  2QG9 B;  2GFA A;  4N0A A;  2LZ6 B;  2QDY B;  2YWW A;  1RAB B;  3CCS A;  2MMP A;  1B3Q A;  4RCB A;  2PVG B;  4PNO A;  1PSE A;  1GFD A;  4M78 G;  2DEU A;  1QQJ A;  3H0H A;  5GAN f;  2XDB A;  1K9M U;  3CME A;  3X20 B;  1YCY A;  3JCM c;  2X51 A;  4LDV A;  1WIE A;  1SSF A;  4FYX B;  3SEM A;  3RDV A;  2NUZ A;  2LP5 A;  1UGS B;  2FEI A;  4DBR A;  1B34 B;  2W10 A;  3OQ5 A;  4FU6 A;  4JRP A;  1WHM A;  2DNU A;  2KRN A;  1UHC A;  3PMI A;  1RUW A;  2ESW A;  1WHH A;  2F2V A;  4NL3 A;  3HSB A;  3EG9 B;  3G4S A;  3CD6 Q;  5IXB A;  1PM3 A;  4PL6 A;  3MP6 A;  1N27 A;  3OS1 A;  5IHN A;  2QQA A;  1OU8 A;  5FRN A;  3M57 A;  2CYZ B;  2QA4 T;  2DL4 A;  4PFO A;  4M7A G;  5J26 A;  1Q95 G;  1YJN Q;  1I07 A;  1S72 Q;  4XU3 A;  2AHJ B;  4J7I A;  4OGC A;  2JTF A;  4BAC A;  1UEB A;  3TU4 K;  2M51 A;  2RD1 A;  3EG2 A;  4C92 B;  4C92 F;  5LJ5 g;  1GXI E;  1ZBJ A;  1NJI U;  2DM1 A;  1VQ9 A;  5FW9 A;  1ZA1 B;  2QAZ A;  3M56 A;  4FSX A;  4BD3 A;  3VKI A;  1Q86 R;  4JLG A;  3CCQ T;  2CZ7 B;  2EQU A;  2X4W A;  1SPK A;  2BZX A;  1YFN A;  2MCN A;  2M16 A;  3JCM b;  1QVG S;  4XTW A;  1WA7 A;  1WLP B;  4OB0 B;  3JCM f;  2LDM A;  1R8O B;  2RJC A;  2WSF E;  2LCS A;  3JB9 H;  4C92 A;  4PJO C;  3HP9 A;  4J9F A;  4TVR A;  2C0I A;  1YWP A;  3NTK A;  3UDC A;  4M75 C;  5M9O A;  3V7R A;  1HJD A;  2EQK A;  3MEA A;  1EX4 A;  1YJ9 Q;  4M77 G;  4X1V A;  1Z9Q A;  5I2S A;  1K76 A;  2AIR B;  3ZL7 C;  5GMK h;  1VQ8 Q;  2RHY A;  4MZP A;  4D6W A;  1PG5 B;  2CT4 A;  5I11 A;  2AZV A;  1XJW B;  2L0A A;  2X4J A;  2HCK A;  2O2O A;  2ROL A;  3OSV A;  1BI1 A;  3PT9 A;  2X3W D;  2DYB A;  3ASK A;  2CP6 A;  4PJO D;  2EKH A;  2CZ1 B;  1NBE B;  3CCL Q;  2QYZ A;  4EMK C;  3CCV Q;  1ZQ1 A;  1HYO A;  4PJL A;  1VYT A;  2KYM A;  2C0T A;  2DZ9 A;  2LNH B;  4XK8 E;  3M53 A;  1NM7 A;  4KRT A;  4DBF A;  5DLO A;  2RO0 A;  2E6N A;  1SHG A;  5GAO n;  1RI9 A;  3P8H A;  4GBQ A;  3A8O B;  3JCM V;  3OW2 A;  2YUQ A;  4RKU E;  5CKF A;  1GCQ C;  4A63 B;  3CD6 T;  2VWF A;  1QVF S;  2QXF A;  2L89 A;  4JDS A;  4M7A A;  2PZ1 A;  4BE2 A;  3CC2 A;  2FYK A;  2DJZ A;  2RQT A;  3VS4 A;  2DVJ A;  1G83 A;  1R77 A;  4IUQ A;  4M78 C;  4JPB W;  4J8O A;  2HAX A;  2SRC A;  3ZEH A;  4M78 F;  4R56 A;  4QT7 A;  3L42 A;  3M0T A;  1QP3 A;  4XU1 A;  4CC7 A;  3BY7 A;  4PLL A;  2V26 A;  1MUZ A;  2VKN A;  4D8K A;  4XU0 A;  1EZZ B;  2JM9 A;  1VQP T;  2FPF A;  1QP2 A;  3I35 A;  5GAN 2;  5CK9 A;  2HQX A;  1YJW Q;  1OZ2 A;  1W6X A;  2DO3 A;  3O5Z A;  1JB0 E;  5GJW B;  2GBQ A;  4M75 G;  3CCE Q;  3ME9 A;  3R6O A;  3SD4 A;  1Q7Y U;  3H41 A;  1LCK A;  1VQ5 A;  1I8F A;  2GFU A;  8ATC B;  4JRI A;  1B34 A;  1O9S A;  2Y90 A;  3C94 A;  1KQS S;  1AZE A;  4VUB A;  2AZS A;  3KBG A;  1YJN A;  3G71 A;  5LJ5 d;  4LDW A;  5J3B A;  2LTO A;  1GBQ A;  2PUK B;  1N8R U;  1Q7Y C;  3NPF A;  3MEU A;  3QYG B;  4DQ2 A;  3TSW A;  4RCC A;  5KYW A;  4J5Y A;  4JJN K;  1VQ8 T;  1KIK A;  1YHQ T;  1D0X A;  3OS5 A;  1S72 A;  1WGS A;  4C92 E;  4BI4 A;  1JBM A;  5GAN e;  3M58 A;  4Z88 A;  3DLM A;  1BB9 A;  3VS1 A;  2LC4 A;  1KD1 R;  2RPN A;  4LE9 A;  1ABQ A;  2LJ1 A;  3J7A F;  1YI2 A;  1QVG P;  1KQ2 A;  3G6E T;  2CGH A;  2DL7 A;  2E5Q A;  4OMP A;  3X24 B;  3PNW C;  2K2V A;  3QZ5 B;  4XTZ A;  2K7A A;  1VQ6 T;  1H64 1;  2V1R A;  4HCC A;  1NPP A;  2KRS A;  3A98 A;  5J39 A;  1E6G A;  2RB6 A;  3CBO A;  1ZX6 A;  4KH1 B;  4AFU C;  3CCE A;  2QA4 A;  1VQL A;  4FYV B;  3SDZ A;  8AT1 B;  4F17 A;  4KH0 B;  2DA9 A;  4NL2 A;  1NJI R;  1TU0 B;  2DK3 A;  2HMA A;  2XDD A;  1U1T A;  2I2L A;  2E6Z A;  3GNF B;  1Y96 B;  1WHK A;  2VB6 A;  4IUU A;  1QW1 A;  1YP5 A;  2DPP B;  4PFP A;  2LJ3 A;  2VUB A;  3M55 A;  2MYS A;  1ZSZ B;  3PIO A;  3CMA Q;  1WJQ A;  2L3S A;  4KGX B;  3TEE A;  1TWB A;  1PRL C;  1RAI B;  1WPY A;  2KAF A;  5GAN 5;  4IIM A;  4BB7 A;  4L59 A;  1FYN A;  1FXX A;  2EJ9 A;  4O6J A;  1JO8 A;  4RUG A;  5FLX E;  3G7Z A;  1XQH A;  3H6Z A;  4Z02 A;  1W2B A;  2ZGW A;  1IHV A;  1VQK A;  2G6F X;  1X69 A;  3LGL A;  2EYX A;  2FZK B;  3OA6 A;  3QJY A;  1D0Z A;  4N0A C;  4WF2 A;  3CCU Q;  2JXB A;  4M7A F;  4BUG A;  1Y57 A;  2GGR A;  2EW3 A;  3CCJ T;  2RNA A;  1G3S A;  2H3J A;  2FHD A;  3A8H B;  3ER0 A;  3P8B B;  3VYH B;  2ABL A;  3CCR T;  1LOJ A;  4N4G A;  1UB4 A;  1VQN Q;  2CH4 A;  4JUV A;  3JCM Q;  4C5I A;  2KEA A;  3REA B;  4C8Q F;  4OB1 B;  1KHI A;  4GY5 A;  3PMT A;  2QQS A;  2J7I A;  4FM4 B;  5GAM j;  4EDU A;  1QWE A;  4QKU A;  4PFZ A;  3M4Y A;  3VV0 A;  2DL5 A;  3A8M B;  1T0J A;  4L5G A;  1WHJ A;  1TUG B;  2HBP A;  4RTZ A;  3CMA A;  1WFW A;  2ATC B;  2OI3 A;  2V8K A;  3S3N A;  1M1K U;  3OYK A;  5CIU A;  1K8A U;  3FJ5 A;  4IIO A;  3EGD B;  1IZ6 A;  3EHR A;  2QK0 A;  3JB9 J;  1UDL A;  4B9X A;  3ULR B;  4IUP A;  5I21 A;  1WXT A;  3MEW A;  3CC4 T;  1UGR B;  3EGX A;  2D8J A;  4C8Q C;  2KT1 A;  1UHF A;  3QXE B;  2EAY A;  5FRO A;  1X6G A;  3QZ9 B;  3HHT B;  5D7U A; 
#chains in the Genus database with same CATH homology
 1JQQ A;  2KRO A;  2L2P A;  2MOX A;  1SHF A;  1NYF A;  2PNI A;  2KRM A;  1WIE A;  3EG0 A;  4HXJ A;  1K0X A;  2K6D A;  3SEM A;  1AD5 A;  2A28 A;  2LP5 A;  2LJ0 A;  2NUZ A;  3M0Q A;  1PRM C;  2FEI A;  1A0N B;  2W10 A;  2DLP A;  2DNU A;  2KRN A;  2L3P A;  3M0P A;  1UHC A;  4J9I A;  1RUW A;  2ESW A;  1MV0 B;  4E6R A;  2F2V A;  1X2K A;  1CKB A;  1NYG A;  4RTV A;  5IXB A;  1CSK A;  3NMZ C;  5IHI A;  2K79 A;  5IHN A;  4ESR A;  4J9C A;  2AK5 A;  2ED0 A;  2DL4 A;  1UJ0 A;  4CC2 A;  1V1C A;  3KFV A;  5IHK A;  1I0C A;  4Z89 A;  1NLO C;  1YNZ A;  1I07 A;  2LQW A;  2HSP A;  1GBR A;  1VYV A;  2O88 A;  2YSQ A;  1AZG B;  3VRY A;  2M51 A;  2O9V A;  3EG2 A;  3R6N A;  1ZBJ A;  1KFZ A;  1SRM A;  2DM1 A;  5FW9 A;  1NLP C;  4AG1 C;  1MV3 A;  1WXB A;  1AWX A;  2CH4 W;  2GTO A;  1UJY A;  2EBP A;  3UF4 A;  1YCS B;  2A37 A;  1SPK A;  2BZX A;  2MCN A;  3IQL A;  4RTY A;  1U5S A;  1WA7 A;  1WLP B;  2OJ2 A;  3CQT A;  4CC3 A;  1UG1 A;  2LCS A;  2PTK A;  2A08 A;  2KYB A;  3UA6 A;  2CRE A;  1ZUU A;  4J9F A;  2C0I A;  1YWP A;  1Y0M A;  4AFZ C;  1GL5 A;  1KJW A;  2IIM A;  1ARK A;  4JJB A;  2RQW A;  1HJD A;  1G2B A;  1UTI A;  4ZNX A;  4X1V A;  1Z9Q A;  1K76 A;  2JMA A;  4OMQ A;  1WX6 A;  5L23 A;  3EG3 A;  2XMF A;  3ZL7 C;  1NEB A;  1OPL A;  2KBT A;  2EPD A;  5I11 A;  2CT4 A;  2KGT A;  1QKW A;  4AG2 C;  2AZV A;  1PKS A;  3RNJ A;  5FWB A;  2L0A A;  3SHW A;  2HCK A;  2DL8 A;  2O2O A;  2ROL A;  1WI7 A;  4GLM A;  2X3W D;  2DYB A;  1AOJ A;  4DEX A;  3QWY A;  2EKH A;  4F16 A;  2DRK A;  1PNJ A;  2GTJ A;  2DBM A;  3GBQ A;  4M4Z A;  4HVV A;  2DF6 A;  2I0N A;  2K2M A;  2FO0 A;  2JTE A;  1Z9Z A;  2CSI A;  1VYT A;  2KYM A;  2C0T A;  2LNH B;  2D0N A;  1IO6 A;  2DE0 X;  2NWM A;  1NM7 A;  4KRT A;  2BTT A;  2YUO A;  3PVL A;  1M3B A;  4R0K A;  1SHG A;  2SEM A;  1RI9 A;  4GBQ A;  1S1N A;  2BZY A;  2YUQ A;  2ROT A;  1B07 A;  2CT3 A;  1E7O A;  2LX7 A;  1GCQ C;  4A63 B;  2W0Z A;  2CSQ A;  2VWF A;  3UA7 A;  1BU1 A;  3PVQ A;  2PZ1 A;  1X2Q A;  2ECZ A;  2RQT A;  1ZSG A;  3VS4 A;  2M0Y A;  2DVJ A;  1G83 A;  4FSS A;  3QWX X;  2O31 A;  4JPB W;  1OPK A;  1WXU A;  2SRC A;  2GNC A;  3LH5 A;  1AWW A;  2EYW A;  4QT7 A;  4OMM A;  5IH2 A;  4JZ4 A;  2RQV A;  1M27 C;  3VS3 A;  2HDA A;  1RLQ C;  1JU5 C;  1J3T A;  1M3C A;  3M0T A;  4CC7 A;  4AFQ C;  1K0S A;  1AEY A;  1UE9 A;  1MUZ A;  2VKN A;  4D8K A;  2JM9 A;  1N5Z A;  2FPF A;  2HBW A;  3I35 A;  2HEQ A;  2KXC A;  2MIO A;  1W6X A;  4RTX A;  3O5Z A;  5GJW B;  2GBQ A;  1AWJ A;  2VVK A;  2DBK A;  1LCK A;  3H41 A;  1PHT A;  1QKX A;  1GCP A;  1YN8 A;  2KR3 A;  2DRM A;  2LQN A;  1H3H A;  3H0F A;  1M30 A;  2H8H A;  1AZE A;  2AZS A;  1UGV A;  2AKK A;  2RQU A;  1UUE A;  1GCQ A;  2J6F A;  4LUE A;  2EYY A;  2FPE A;  1X6B A;  1H92 A;  2YUN A;  4J9B A;  1GBQ A;  2L3Q A;  1OOT A;  3NPF A;  2K3B A;  4CC4 B;  3TSW A;  1HD3 A;  5ECA A;  3M0S A;  5GJV B;  1AWO A;  4DEY A;  1JXO A;  1QWF A;  2X3X D;  4LUD A;  4OML A;  3THK A;  1KIK A;  2JS0 A;  1W1F A;  1X43 A;  1ZUY A;  1H8K A;  2YUP A;  3U23 A;  2RN8 A;  2J05 A;  4Z88 A;  1BB9 A;  2DMO A;  1X27 A;  1QLY A;  4HVW A;  3VS1 A;  4EIK A;  4LNP A;  2FRY A;  2JMC A;  2RPN A;  1SEM A;  4LE9 A;  3UAT A;  1ABQ A;  1FMK A;  2LJ1 A;  2BZ8 A;  2KT8 A;  3EG1 A;  2DL7 A;  3VS6 A;  2EGE A;  1CKA A;  3JV3 A;  4OMP A;  2V1Q A;  3TSZ A;  1U06 A;  2K7A A;  4J9H A;  2DX1 A;  2V1R A;  3H0I A;  1RLP C;  1WYX A;  2KRS A;  2LMJ A;  1ABO A;  3A98 A;  1E6G A;  1ZX6 A;  1NG2 A;  5EC7 A;  2JM8 A;  2D1X A;  4AFU C;  2FRW A;  1T3S A;  3C0C A;  4F17 A;  1SSH A;  1M3A A;  2DA9 A;  2GQI A;  3REB B;  1E6H A;  2J6O A;  2B86 A;  1I1J A;  2FPD A;  1HSQ A;  1YP5 A;  1K1Z A;  2F2W A;  2P4R A;  1PWT A;  2LJ3 A;  3VS5 A;  2EGA A;  2YDL A;  2L3S A;  3RBB B;  4RTU A;  2E5K A;  2AKL A;  1TUD A;  1PRL C;  1ZUK A;  5I22 A;  4JJC A;  3PE0 A;  1AVZ C;  1GRI A;  1U3O A;  4IIM A;  1KSW A;  4F14 A;  1FYN A;  1PKT A;  1JO8 A;  4RUG A;  2DIL A;  2F2X A;  2RF0 A;  4JZ3 A;  2G6F X;  1X69 A;  4RTT A;  1ZLM A;  2EYX A;  2JW4 A;  1QCF A;  1OV3 A;  2D8H A;  3M0U A;  2O9S A;  1K4U S;  4ORZ A;  2ENM A;  2JXB A;  1Y57 A;  2GGR A;  2EW3 A;  3NGP A;  2OAW A;  2RNA A;  4WCI A;  4Y92 A;  3EGU A;  1BBZ A;  1T3L A;  2ABL A;  2CDT A;  2FG0 A;  2CH4 A;  2CUD A;  2EVR A;  3I5S A;  2KEA A;  3REA B;  2JT4 A;  3I9Q A;  1UEC A;  2QDL A;  1K9A A;  1SRL A;  2A36 A;  2RQR A;  1GFC A;  1W70 A;  1XOV A;  2J7I A;  3NHN A;  2J06 A;  1UFF A;  3VS2 A;  1QWE A;  2ED1 A;  2KNB B;  1YWO A;  1TUC A;  3I5R A;  2YT6 A;  4D8D A;  1EFN A;  1JXM A;  4OMN A;  2DL5 A;  2EYZ A;  2DJQ A;  4J9D A;  1VYU A;  4RTW A;  1NEG A;  1T0J A;  3EHQ A;  2RMO A;  4RTZ A;  3VS7 A;  2JS2 A;  1OEB A;  1WFW A;  2K9G A;  2OI3 A;  4Z8A A;  3M0R A;  4OMO A;  2CUB A;  3VS0 A;  3VRZ A;  1WDX A;  1BK2 A;  3FJ5 A;  4IIO A;  2EQI A;  2J6K A;  3EHR A;  5FWC A;  5IXF A;  4HVU A;  2KE9 A;  2C0O A;  1UDL A;  2KXD A;  4LN2 A;  1T0H A;  4J9G A;  4K11 A;  2EGC A;  3ULR B;  4HCK A;  1JEG A;  5HCK A;  1TG0 A;  1WXT A;  2D8J A;  2LZ6 B;  2KT1 A;  1UHF A;  4JJD A;  3TVT A;  1B3Q A;  4J9E A;  1GFD A;  1VA7 A;  1X6G A;  1M8M A;  2DL3 A;  4AFS C;  3H0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...