1VA7A

Yeast myo3 sh3 domain, triclinic crystal form
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
DPKFEAAYDFPGSGSSSELPLKKGDIVFISRDEPSGWSLAKLLDGSKEGWVPTAYMTPYKDTRNTVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin-3 isoform
publication title High-throughput structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
total genus 12
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1va7A01
2EBPA 1S1NA 1WDXA 2J05A 2YUPA 2OI3A 3EG1A 1ZLMA 2CH4A 1OV3A 1I1JA 2F2WA 2LJ0A 2FG0A 1UG1A 1K4US 3TVTA 1WXUA 2J6FA 1GCPA 1K1ZA 2AZVA 3PVLA 4RTYA 1MV0B 2BTTA 5HCKA 4J9FA 1QCFA 2KNBB 4OMQA 1AEYA 4E6RA 4GBQA 2O2OA 2D8JA 2YT6A 3EG2A 2JM9A 3EG3A 2RF0A 3SEMA 2DF6A 4CC7A 2ESWA 2ECZA 2A37A 1Z9ZA 1H92A 3LH5A 2JXBA 2X3WD 1NYFA 5IXFA 1UTIA 2DYBA 1RUWA 2F2XA 1PKSA 1TUDA 2EGAA 4RUGA 2LX7A 1IO6A 1M3AA 5FW9A 2KT1A 1YCSB 2DA9A 1K9AA 3VS4A 3CQTA 4RTZA 1HSQA 1QLYA 3REAB 2L2PA 1B3QA 2FEIA 2I0NA 4Z8AA 4FSSA 5IXBA 2JW4A 4R0KA 3EG0A 4LE9A 3VS6A 2V1QA 4Z88A 1WIEA 1Y0MA 4M4ZA 3M0RA 1OPKA 2IIMA 1YP5A 1T0HA 1SHFA 1AWOA 2BZ8A 2DNUA 2KXCA 4JJBA 1VYTA 2JT4A 1K76A 2KRNA 2PTKA 1NLOC 3NPFA 2C0OA 4J9EA 1JU5C 1OPLA 2HCKA 1X6GA 3M0PA 4KRTA 5IHNA 2LNHB 1N5ZA 1PRMC 4OMLA 3O5ZA 2RQTA 2DE0X 1WYXA 4CC2A 2A36A 2KBTA 1LCKA 1A0NB 2RQWA 1M3CA 5IHKA 1AD5A 1ABOA 2CT3A 4AFQC 2RNAA 2RN8A 3EGUA 1XOVA 1ZUKA 1X43A 4DEYA 1V1CA 2RPNA 1NYGA 1UDLA 3NMZC 1M30A 2KEAA 1FYNA 2JMCA 2W10A 2DRKA 2JM8A 1SHGA 2FPDA 2AKLA 4RTVA 5EC7A 2RMOA 2V1RA 1W6XA 1M3BA 4X1VA 1SSHA 2DVJA 2D0NA 4AG2C 2L3QA 2RQUA 2EGEA 2CDTA 1UHCA 4HVVA 2J6KA 4J9DA 2M51A 3VS7A 2GNCA 5IHIA 1YWOA 3EHRA 4CC4B 3RNJA 2K9GA 2MCNA 1EFNA 1H8KA 2D1XA 5L23A 3TSWA 2YUQA 2B86A 1X2QA 1WI7A 4F17A 2VKNA 1E7OA 4JPBW 2GTJA 2KXDA 1FMKA 1M27C 2CH4W 1UHFA 2EKHA 5I11A 2ROTA 4RTUA 2FPFA 4IIOA 1ZSGA 1W1FA 2AK5A 2DRMA 2K2MA 3VS2A 4RTTA 4J9HA 1HD3A 1I0CA 1VA7A 4J9GA 2P4RA 2ROLA 2DJQA 2DBKA 3I35A 1QKXA 1RLQC 4J9CA 2EQIA 1KJWA 4QT7A 2RQVA 4AFUC 1NEBA 3H41A 1HJDA 1KFZA 2FRWA 2DLPA 3ULRB 2KRSA 2YSQA 1T0JA 2O9VA 2DX1A 1BK2A 1GL5A 1UJYA 2AZSA 1RLPC 2K6DA 3I9QA 1YNZA 3UA6A 2BZXA 1K0SA 2X3XD 1QKWA 1AZGB 2GTOA 1UJ0A 4JJDA 4HVWA 3UA7A 1NG2A 4RTXA 1Z9QA 1OOTA 3M0TA 4LUDA 4J9IA 1GBQA 2DBMA 1PHTA 1Y57A 1M8MA 2O88A 1G83A 3C0CA 1BB9A 1WLPB 1QWFA 3UF4A 1CKBA 3QWXX 1T3SA 1YWPA 4OMMA 3UATA 4LNPA 2LQNA 4HXJA 1GCQC 2RQRA 1K0XA 3U23A 1UFFA 2KROA 2OJ2A 2L0AA 4K11A 1RI9A 4WCIA 2KGTA 1CKAA 2JS2A 4LN2A 1SRMA 3M0SA 1QWEA 1UE9A 2JS0A 1U06A 4HCKA 4EIKA 4F14A 2DILA 1MUZA 3QWYA 5GJVB 1G2BA 2KT8A 1PKTA 4LUEA 2JTEA 2EYYA 2LJ3A 1ZUYA 2KRMA 4OMNA 3REBB 2EW3A 3H0IA 1GFDA 1BBZA 1E6GA 5FWBA 2E5KA 1BU1A 2J06A 1U3OA 2PNIA 5GJWB 4A63B 1AZEA 1JEGA 1NLPC 3VS0A 2LQWA 2DL3A 2ENMA 2F2VA 2W0ZA 3H0HA 1YN8A 3SHWA 1AWXA 1J3TA 1ZUUA 1ZBJA 2KYMA 2SEMA 1PWTA 3R6NA 2HBWA 3H0FA 4RTWA 3TSZA 1GCQA 1WXBA 3GBQA 2KE9A 2KYBA 2ABLA 4ZNXA 3RBBB 5I22A 2EYZA 2D8HA 1UGVA 2HEQA 4JZ3A 2HDAA 5IH2A 1E6HA 4IIMA 2O9SA 1MV3A 4ESRA 3NGPA 4OMPA 3M0QA 2EYWA 2LZ6B 3A98A 2DL8A 2FRYA 2J6OA 1W70A 1WXTA 2CREA 2CUBA 3VRZA 1WFWA 5ECAA 3VRYA 1JXOA 1T3LA 2YUNA 3M0UA 5FWCA 1ABQA 4F16A 2DL7A 1AOJA 2ED1A 3I5SA 3PVQA 4ORZA 2EYXA 1JO8A 2CT4A 3KFVA 4GLMA 2C0IA 1AWWA 1X27A 2YUOA 3PE0A 1JXMA 2VWFA 1VYUA 2YDLA 4J9BA 1TUCA 2DL4A 1X6BA 1I07A 2XMFA 3JV3A 4Y92A 2DM1A 1X2KA 2NWMA 2HSPA 4D8KA 1ZX6A 1PNJA 2CUDA 1UECA 2FO0A 3NHNA 2OAWA 2J7IA 4AFSC 3VS3A 2CSIA 2SRCA 3EHQA 1UUEA 2NUZA 2MOXA 2GGRA 4HVUA 1KSWA 2C0TA 4D8DA 2O31A 2L3PA 2K7AA 3IQLA 1NEGA 1ARKA 1NM7A 2GBQA 3VS5A 1KIKA 1B07A 2LP5A 4JZ4A 4Z89A 2K3BA 1PRLC 1WA7A 4OMOA 3VS1A 1GRIA 2MIOA 3I5RA 2M0YA 1SRLA 1JQQA 4DEXA 1H3HA 4AFZC 4CC3A 1TG0A 2K79A 2LMJA 1SPKA 1AVZC 2VVKA 1U5SA 1GBRA 1X69A 2LCSA 2A08A 1WX6A 2H8HA 1AWJA 2DMOA 2ED0A 4JJCA 2GQIA 2DL5A 2FPEA 1OEBA 2BZYA 2LJ1A 2G6FX 2L3SA 2EVRA 3FJ5A 1VYVA 2JMAA 2QDLA 1SEMA 3ZL7C 2EPDA 2KR3A 3THKA 2PZ1A 4AG1C 2AKKA 1CSKA 2A28A 1GFCA 2EGCA 2CSQA
chains in the Genus database with same CATH superfamily
1S1NA 3EG1A 3QJ6A 1OV3A 3OYYA 1VQMQ 4RKUE 1ZSZC 1GCPA 1K1ZA 4M75C 4RTYA 2E64A 2E41A 5HCKA 3QO3A 4J9FA 3CC2T 4E6RA 2ZZDA 1O75A 4BI8B 3CCEQ 2YT6A 4DBHA 3EG3A 3RKYA 1M1FA 2ECZA 4WTOB 1I8FA 4JJNK 1NYFA 2XG8D 2XK0A 1M8VA 1TUDA 2BE7D 4RUGA 3MEWA 1RAGB 2F5TX 1M3AA 2O4XB 3CPWS 2I0NA 4NS5A 1OZ2A 5IXBA 2JW4A 1M90R 3VS6A 4FSXA 2XI9A 4MMKA 4M4ZA 5GMKj 3LWHA 2E10A 1T0HA 1M5Q1 3VJPA 2R58A 3TEEA 1H3ZA 4MZMA 2JT4A 3G71Q 1JJ2P 2DEUA 5A2QE 2WSFE 2V8JA 3NPFA 4LD9K 4J9EA 2ZPGB 2HQHA 4C5HA 1ZHIA 5IHNA 4PJMA 3JCMX 1N5ZA 4OVAA 1PRMC 4OMLA 3O5ZA 5J3BA 2RQTA 4C8QF 5LJ3h 3GNFB 2DIQA 1ZBXA 3QZ5B 2A36A 3RKXA 1M3CA 1X75C 2CP6A 3QPHA 2LCCA 4AFQC 2FYKA 1ZUKA 1V1CA 1UDLA 3NMZC 1UGQB 4DBRA 2KEAA 5LJ3d 1JJ2A 2DRKA 3EH1A 1SHGA 3BDLA 2DK3A 1YIJQ 2V1RA 1SSHA 5HKCA 4C92F 3ME9A 4YTLA 1YJ9Q 2VC8A 2CDTA 2HZYA 4J9DA 2ZPEB 1K9MR 3BW1A 4F7UB 2KAFA 4DOWA 3OQ5A 1KD1C 1XTDA 5IHIA 1Q82U 1YITA 3RNJA 1M4ZA 1VQ6T 2K9GA 2MCNA 1EFNA 3CBMA 2BIVA 2D1XA 3HL8A 4BI4A 3TSWA 4FIBA 4A4EA 1X2QA 4F17A 2VKNA 1NJIC 2WSEE 4JPBW 2KXDA 1FMKA 2EKHA 5I11A 2QEXT 2ROTA 4RTUA 2PVDB 3EGDB 4C8QC 3V7SA 4OP0A 1ZSGA 1W1FA 3VS2A 4RTTA 2EJFA 4J9HA 1HD3A 1I0CA 1SF9A 1VA7A 2ZAEA 2P4RA 2ROLA 2DJQA 2L89A 2EKOA 3CXCP 3I35A 1QP2A 1QKXA 4C0DC 2CP7A 1OU8A 4M77B 3C95A 1YJNT 2Y4YA 3JB9I 3L2RA 4QT7A 4EMKB 4A4FA 4FYXB 2DLPA 3ULRB 2YSQA 4M77D 2ZPIB 5L8RE 1GL5A 1N9SA 4CRIA 3I9QA 1YNZA 3UA6A 1K0SA 3MEUA 1QKWA 3UA7A 1NG2A 1YI2Q 4O6JA 1BI3A 3HRUA 4QVDA 5KYNA 4J5YA 5LL6S 1WJQA 4ZN3A 4F7UG 3CXCA 1Y57A 4C92B 1M8MA 2V26A 2ZGWA 3MO8A 4F04B 4AT1B 3I55Q 1TOVA 3CC4Q 1WLPB 3TCJA 1Q7YU 4C92D 3GP8A 3QWXX 2O4XA 1YJ9A 1RADB 4M7DB 1UGSB 3LLRA 2RQRA 3BE3A 1K0XA 2HL3A 3CXCS 2LNVA 2F5KA 8ATCB 4TVRA 1CKAA 2JS2A 5CIUA 4M7DD 3M0SA 4J8OA 2COZA 2HAXA 2LDMA 2EFIA 1VQLT 3PMIA 3M9QA 4ELYC 4LUEA 2LJ3A 4M77G 4N0AC 2C06A 2QA4Q 3GLXA 1GFDA 1E6GA 2VGNA 1WJRA 1BU1A 2KDSA 5GJWB 2MMPA 4IUTA 3VS0A 1MGQA 3CCLQ 1EX4A 4NL2A 1G3YA 1J3TA 1ZUUA 1PWTA 4R56A 3OYJA 2HL5C 1K73C 4RTWA 4A53A 3D7SB 2QGGA 3QZ9B 3GBQA 1FX7A 3CCVT 3HRSA 5I22A 1PD1A 1BI2A 1MMAA 3HRTA 5KYXB 1MV3A 4ESRA 3EGXB 4IUQA 4OMPA 2EYWA 4M7DG 3CCJA 2DL8A 4F7UA 2FRYA 3QIIA 1WXTA 2CREA 2DTOA 4XTXA 2KY9A 1JXOA 1T3LA 2YUNA 3G6EA 2EAYA 4F16A 2QXFA 3CC4A 4ZGJB 3TU4K 3I5SA 4M78E 2Y90A 4ORZA 3JCMJ 2JJ9A 1OULA 5CKEA 4E47A 1X27A 1AT1B 2VWFA 1X6BA 2E6NA 4Y28E 3EGDA 2ZPBB 1VQ7T 4N4GA 3P8BB 5DM7R 4VUBA 1ZX6A 4KGVB 4PJJA 2FO0A 2VASA 3PGGA 2R5AA 4QW2A 4AFSC 4XU2A 1M1KU 7AT1B 2CSIA 4QQGA 2YXYA 2KSSA 3JCMQ 4KUDK 3T9NA 2HKQB 4PFPA 2NUZA 3A1PA 4M77A 1VQOT 2GGRA 1IHWA 2C0TA 4M75E 2QTXA 2O31A 3LYIA 4EMKA 1XNIA 3PT9A 2QA4A 1ARKA 1NM7A 3QXEB 2GBQA 3VS5A 3MCAB 1B34B 3MP8A 4XU3A 5J39A 4FYVB 4J7FA 4P5NA 1PRLC 3VS1A 2MIOA 4BI3A 5LJ3e 2YLCA 3CMAA 1H3HA 1WGSA 5KYUB 1SSFA 1JB0E 3JCMc 4R55A 1K8AC 4C92A 1IXDA 1S72T 1U5SA 1UGPB 5M9OA 1U1SA 3G4SQ 3OYBA 1GXIE 3META 2H8HA 5CQXA 2ED0A 4JJCA 2JUFA 2DXCA 3CD6Q 1N8RR 4M7DA 1OEBA 5GAN8 2IPOB 3LX7A 2K57A 2RJEA 3TQ7P 1OZ3A 5AYFA 1SEMA 2EPDA 4EMGA 1OX9A 1M9SA 2OTLQ 4AG1C 1VQKT 4GY5A 2P0PA 4JS4A 2CSQA 2DXUA 2D6FA 2OI3A 1ZLMA 5A0LA 1I1JA 3L42A 1UG1A 2QGFB 1Q86C 3TVTA 3OW2P 1RAAB 3C12A 2AZVA 2XHCA 3MEVA 3S3NA 3I56A 1OQKA 1IB8A 3E2UA 2FZKB 1QCFA 2KNBB 1AEYA 4GBQA 2O2OA 1PSEA 2D8JA 3L2ZA 3EG2A 3FEOA 4XTYA 4RG2A 4PJOB 2DF6A 4CC7A 1WHMA 2A37A 3URGA 1Z9ZA 3CCMQ 3PFSA 2YRCA 5IXFA 1VQNA 3M5AA 4BACA 2DYBA 4PK4A 3RERA 4PJOD 5FROA 2DXTA 2KK4A 4IUUA 5FW9A 3RMQA 1YCSB 3OW2A 2DFUA 3E1SA 2EQMA 4RTZA 4C0ZA 4J83A 5KYXA 1HSQA 3REAB 4M7AF 1YCYA 1B3QA 1IREB 3EGXA 2FEIA 4OB0B 4ZTFA 1VQ5T 4FW2A 4LE9A 4Z88A 1WHGA 1WIEA 3Q1JA 5KE2A 1F1BB 2WACA 3QUIA 3OW2S 3DLMA 4JJBA 1Q81R 1VYTA 2PTKA 3GIBA 1NLOC 2LT4A 1JU5C 2LT1A 4C8QE 2HCKA 2CGHA 2XDDA 3LWIA 2XD0A 2GFUA 5CO7A 1Y07A 1N9RA 2VB6A 2VYTA 4KBMB 1EZZB 3M58A 4RMOA 3G7ZA 2HBPA 1A0NB 2RQWA 4KH1B 1ABOA 4PJOG 2RNAA 2RN8A 4DBQA 4DEYA 2OTJQ 2L8DA 2R57A 3CEYA 2NUPB 2E12A 3EAEA 3MHXA 1B34A 1VQ9A 2W10A 2JM8A 4FU6A 5KCOA 2DZCA 5EC7A 1U1TA 5CAIA 1W6XA 5FU7B 2L3RA 1VQPT 1ZA1B 3CPWP 4X1VA 3SWNB 3OSVA 1KHIA 3H9NA 3M53A 4ANJA 4DBFA 2D0NA 5LJ5j 3HP9A 2L3QA 2RQUA 3EFSA 5KYUA 3A5ZB 3MJXA 5GAN5 5IN1A 5GAMj 4M7AB 3JB9G 1H8KA 4O5VA 1M2VB 2MI6A 3F70A 2B86A 4MDXA 4M7AD 4IUPA 4M78B 2E4HA 4RG8A 1R0BG 3CC7A 2RD1A 3OYIA 2BUDA 3DLLA 2CH4W 1M27C 2QQSA 1RAFB 2FPFA 3CPWA 5GMKe 2DRMA 4EPCA 1WQWA 3FIFA 4XU0A 1YJWT 1YITQ 2KI7A 1JBMA 3QYGB 1N6AA 4J7IA 2EQKA 1ACMB 1KJWA 4F7UF 1ZSZB 1BIAA 3OYEA 3M54A 1D0XA 2RQVA 3P8DA 1NEBA 3H41A 2EYQA 8AT1B 2CP0A 1ZQ1A 2O9VA 2DX1A 1BK2A 5D6WA 2K6DA 3J80E 2BZXA 2X3XD 2GTOA 3OA6A 3CMET 2PVGB 4PJOA 2LCLA 2K2VA 4RTXA 4ZGEB 1QW1A 2RJFA 1H641 1OOTA 1KD1U 3M0TA 4LUDA 2OTJA 3HKSA 2PVOB 3CCST 4J9IA 1OX8A 2DBMA 2QQRA 3PIPA 1IRXA 4LDYA 3C0CA 4M7AG 1BB9A 1FWZA 3OYMA 1W2BP 1QQJA 4NL3A 1VQMT 3UF4A 5LJ3f 4M77F 1NJIU 1YWPA 4OMMA 2I2LA 1UGRB 4M78G 4LNPA 3QHSA 4FYWB 2MAMA 1Q82R 2YHTA 2AT1B 1IHVA 3U23A 2KROA 4B9XA 1KC8C 1TSFA 4KUIA 2G3RA 3EG9B 2KGTA 3CCET 1SRMA 1QWEA 1UE9A 2DZ9A 2JS0A 2FZCB 4A54A 2H3EB 2JZ2A 1LNXA 4E7SA 3QWYA 1BI1A 1LJOA 3FRNA 3E19A 2MWOA 4OMNA 3REBB 1YFNA 1W2BA 4PKCC 2EW3A 1I5LA 3H0IA 2RI3A 5LJ5g 2E5KA 2J06A 2CP2A 3DKMA 5EG2A 5GAMg 2DL3A 3H0HA 4M7DF 2XDBA 4HT8A 3UWNA 2NYSA 2KYMA 3GF5A 3A8LB 2NUPA 2B8AA 3QDRB 1W2BS 1WHHA 4ELZC 2RO0A 3PIOA 1WXBA 3FB9A 3G71T 3RBBB 4JLIA 5GANj 2EYZA 4JZ3A 3DB3A 4QKUA 2HDAA 3V8KA 4MZPA 1KQ1A 2X35A 4JUVA 3SWNA 2RHXA 4Q5WA 2M0OA 5HK0A 2CZ0B 3X26B 4C0FA 1W70A 1VQ6A 1G5VA 2VGMA 2CUBA 4JRPA 1WFWA 4M7AA 3VRYA 1M90C 1G3TA 1XJWB 1M2VA 1ABQA 2XICA 1Q7YR 4ME7A 4BD3A 1IGUA 1QVFP 2CT4A 4M78A 2LTOA 4KT0E 2YUOA 4C92C 3EH2A 2YWWA 4J9BA 1RAHB 4ZTJA 2DL4A 3M56A 3X24B 2BKDN 3NTIA 2FL7A 1YIJT 3CCJQ 4KGZB 3NHNA 2J7IA 1Y71A 1YJ9T 3VS3A 4OMFB 5AT1B 4M7DC 4BDYA 4FL6A 1YJNA 2SRCA 3EHQA 1UUEA 3G6EQ 1MMNA 2XDPA 1KSWA 1ZSZA 2QQAA 4D8DA 2K7AA 2E6ZA 1K73U 1UEBA 5CQYA 5KCHA 1KIKA 4QVZA 3V7RA 1B07A 3HSBA 3VV0A 4HT9A 3CCUQ 5LJ5h 1GRIA 2M0YA 2Z0WA 2Y4XA 1QCNA 5CKFA 3O8VA 1KQ2A 3KUFA 4CC3A 3J81E 1TG0A 2K79A 3UDCA 4E2FB 3S6WA 5D7UA 3M55A 2RK2A 3V7CA 2VVKA 4XTUA 1QVFS 1K9MC 1X69A 3NFCA 5LJ5d 2D0QB 2MF2A 2DMOA 5GAMd 5A0GA 2DL5A 2FPEA 5FU6B 4XTZA 3JCMb 2CP3A 5KYYB 2JMAA 3CMAQ 3OMCA 4PL6A 3EG9A 2FZGB 2KR3A 3THKA 4MMLA 2ATCB 1K8AR 2AKKA 2CS7A 1VQLA 2HD0A 2RHIA 1YI2T 2A28A 2R5MA 1TXQA 2CH4A 2LJ0A 2F2WA 3FC3A 5GAN6 4RCBA 3MEAA 3E9FA 1YHQQ 1VQ8A 2MK5A 5GANg 1D3BB 4PJLA 1WXUA 4FCYA 5KH6A 4FT4A 2NUTB 2IVWA 3I55T 3CC4T 2E70A 4MDWA 3JCMg 1D1CA 3C4SA 5GMKh 1M1KR 4IKFA 1WPYA 4QQDA 5DY9A 2OX7A 3OYDA 3CBPA 2DD5A 2X4WA 1C0MA 3SEMA 2V8IA 3SDZA 1LOJA 3LH5A 1Y7XA 2X3WD 1K8AU 1UTIA 1BI0A 2QG9B 2RK1A 1FMVA 3OY9A 3H6ZA 2LX7A 4HA8A 1IO6A 3CCUA 3I56Q 2DA9A 2K3YA 1K9AA 2QA4T 3CCRA 5KYWB 4Z8AA 2XKOC 2F69A 3OB9A 3EG0A 2MWPA 5A0DA 3L2VA 1PM3A 3M0RA 1OPKA 2IIMA 1YP5A 1VQNQ 1WHJA 1SHFA 3CCLT 2BZ8A 2DNUA 2KXCA 3FLGA 1R77A 4PFZA 4PJOF 1K76A 2KRNA 1Q86U 2K5IA 2OAUA 2JVVA 4C0GA 1W4SA 1OPLA 1X6GA 3QG1A 1VQ7A 3M0PA 2LNHB 2GCXA 3M4GA 1IGQA 4CC2A 1V76A 2KBTA 1LCKA 4E7IA 5IHKA 5CKHA 4N4HA 1VQOA 2CT3A 4KULA 1UB4A 1YHQA 1X43A 2IG0A 2DERA 2RPNA 3JB9F 1NYGA 4X34A 5GANh 2X4JA 4LDWA 4DQ2A 1FYNA 2JMCA 3NTKA 2FPDA 2AKLA 3JCMh 4RTVA 1VOMA 1NE8A 3NTHA 1VQ4A 1VIEA 1M3BA 1X01A 2CKKA 2DVJA 3OMGA 5GAOm 4AG2C 1LPLA 2EJ9A 5CK9A 5GANd 1YWOA 3C94A 2HSEB 1TU0B 3JCMd 1V29B 5L23A 5KE3A 2YUQA 1VQ9Q 3M4YA 1VQNT 3HPWA 2P0QA 4X9CA 2PQWA 4PLLA 4B6MA 1UHFA 2M1HA 5KYYA 2LC4A 2AK5A 2DJZA 4F7UE 3CCQQ 4J9GA 2K5FA 4X9DA 2JNGA 3AT1B 3SD4A 4Y91A 3RMSA 4OGCA 3L1AA 4BY6B 1D3BA 1DJ7B 4KGXB 5GAOl 4OB1B 3OYLA 1HJDA 2NUTA 2E3IA 2HKNA 3CC7Q 2FRWA 2X4YA 2HQEA 3G4ST 5CKDA 1RLPC 1AZGB 3HTRA 3CD6T 4M78F 4JJDA 4J6WA 2RB6A 2DETA 1Z9QA 3M57A 2P84A 2X51A 1KHCA 3JB9D 1GBQA 2OTLT 1PHTA 3S3MA 2O88A 2HNIA 2JOYA 1RL2A 3CC2Q 1OI1A 1CKBA 3R6OA 1T3SA 9ATCB 5LJ5e 1QVPA 1VQ5A 3UATA 5KYWA 4XK8E 2LQNA 1QCOA 4HXJA 3OYGA 5GAMe 1N8RC 1MHNA 2OJ2A 2L0AA 5FU7C 1RI9A 2CZ6B 2RHYA 2RJCA 4LN2A 3SWNC 1U06A 5GAOp 4EIKA 4F14A 3JB9J 4C92E 2DILA 1MUZA 2CZ1B 3CCMT 1G2BA 1G3SA 1PKTA 2O01E 2EYYA 5IAYA 2FB7A 4L6V5 4M7AC 2E5QA 2A3LA 5J26A 4QQ6A 2A7YA 4D6WA 5FWBA 4M7DE 1HXDA 3VU3C 1C6VX 3MKDA 3CCQA 2M9UA 4OF1A 4V2SA 4XAXB 1AZEA 2DPPB 1JEGA 1TTHB 2W0ZA 2DKGA 1YN8A 3SHWA 4C5IA 3S3OA 5D6YA 1I5OB 4BE2A 1ZBJA 2SEMA 3R6NA 5FRNA 3WXMB 1NBEB 1GCQA 2KE9A 2ABLA 4ZNXA 1TWBA 1VQPA 4FYYB 2D8HA 1UGVA 2HEQA 4E7ZA 2DD4A 4M78D 1TH7A 5IH2A 4IIMA 1KG1A 2KVQG 1KD1R 3LW5E 3M59A 4HKEA 3A98A 3OYHA 1KC8U 2J6OA 1BKBA 3VRZA 2QYZA 4ATOA 2KMTA 1QMCA 2RI2A 3QJYA 2K5LA 4M75B 2K3XA 1NJIR 5I2SA 3PVQA 2XU8A 3CC2A 3ZBDA 3GPLA 2OTJT 1JO8A 3KFVA 1NZ9A 1AWWA 3MPUB 1P92A 1Q81C 4M75D 1JXMA 2X9HA 4ZGDB 1TUCA 1I07A 1RI0A 4Y92A 2DM1A 2RJDA 2DIGA 2NWMA 1SKUB 2EJGA 2CUDA 1YJWA 2OAWA 1VQ6Q 5GMKm 5CCAA 4E7HA 2A0FB 2JN0A 1B7TA 2MOXA 3ASKA 4A4GA 1MNDA 4LXCA 3IQLA 2V8KA 4C5EA 2QDYB 2DVEA 3OYKA 1PG5B 3X28B 2QEXQ 2RA2A 4JZ4A 2AIRB 4Z89A 4EDUA 2DTHA 2K3BA 3CMEA 2AHJB 3EFOB 4OMOA 2DTIA 4J6YA 5DLOA 3I5RA 1MMDA 1JQQA 3CCSA 3DB4A 2GF7A 2M16A 5GAN3 1YJNQ 1AVZC 5IT9E 1M90U 1GBRA 1YITT 3JSCA 2GFAA 5GANe 2A08A 1VQMA 3FDRA 1YBYA 4M75G 1WX6A 4CI0C 5GAN4 1AWJA 3JCMe 5GMKl 3BDUA 4N4IA 3OBYA 2GQIA 1WNLA 2BE9B 2LJ1A 1U8RA 1FXXA 2L3SA 1VYVA 5FRMA 3CCEA 3INZA 4XQ3A 4LDXA 1CSKA 2EGCA 3BY7A 2EBPA 1WDXA 2J05A 2YUPA 2E3HA 2EQUA 2FG0A 4LDUA 2EWNA 1K4US 4M77C 1JJ2S 3X20B 2J6FA 4C5GA 4L5GA 4EMKC 3VYHB 3PVLA 3OS0A 1MV0B 2BTTA 1MMGA 4OMQA 4DOVA 3OSSC 2JM9A 2RF0A 2ZPFB 4OB3B 1K73R 2ESWA 2LQ8A 1VQLQ 1H92A 2JXBA 2D9TA 1RUWA 2F2XA 1QVGP 1PKSA 1K9MU 1VQ8Q 2EGAA 3G71A 2QEXA 3KXTA 2E65A 4QVCA 2MPXC 1RACB 1PC0A 2QQ9A 4FM4B 2GQVA 2KT1A 2PU9B 4C8QB 2FVUA 3JCMW 3VS4A 3CQTA 1QLYA 3ZEHA 3PMTA 2L2PA 3ZFJA 4C8QD 4FSSA 2DO3A 3OS5A 4HCZA 1VIFA 2JTMA 4R0KA 4RCCA 3HFNA 4C0DB 4E7KA 3G1JA 4PJOE 2V1QA 1Y0MA 2QI2A 1Q82C 3A8HB 1AWOA 2PUOB 4M75A 6AT1B 3QBYA 3CCVQ 1QVFA 1QVGA 5LJ5f 2C0OA 3LGFA 2K4YA 2WSCE 1XQHA 4KRTA 5GAMf 1YIJA 4JDSA 3CCRQ 3J7AF 4JLGA 5GAMh 1O9SA 1WHKA 1TUGB 4E7JA 2DE0X 1WYXA 2X4XA 4BDZA 2VUBA 1BCMA 5FU6C 1D0ZA 1AD5A 4E7LA 3HHTB 1QVGS 2F1LA 3EGUA 1XOVA 1Y96B 5GAOn 4DA4A 4PJNA 5CKBA 4PNOA 4JS5A 3X25B 2CYZB 1M30A 2PUKB 1VQ7Q 3QDFA 2RMOA 2KQWA 3EFOA 4C8QG 5GAOq 3CBOA 2LQKA 5C0MA 1VQ8T 3SFMA 5CVIA 3A8GB 2EGEA 1UHCA 2EIFA 4HVVA 2J6KA 4JRKA 2M51A 2RM4A 3VS7A 1VQOQ 2GNCA 4OB2B 3EHRA 3CCJT 4CC4B 1Q95G 1LVKA 1D1AA 1VUBA 1KQSP 2FHDA 4BUGA 3G6ET 2YLBA 4FT2A 4EMHA 4KH0B 3JB9H 1EIFA 1X6OA 1Q7YC 1WI7A 4JRIA 1E7OA 2P0KA 1SG5A 4C92G 3L2WA 1VQ4Q 2GTJA 2RHZA 4B9WA 3L2QA 2DAQA 3CCUT 4IIOA 4BE0A 1WQ7A 2K2MA 3JCMV 1M1GA 1YI2A 1S72Q 3H8ZA 3E9GA 4PFOA 3MP1A 1PD0A 2HMAA 1Q86R 3OYCA 2DBKA 2RHUA 3CCRT 3CCVA 4M7AE 3SB2A 1RLQC 1BYMA 3VUBA 4J9CA 5GAN2 2M02A 3OBWA 2EQIA 1KQSA 2QAZA 3QYHB 2P4TA 1MNEA 3OS1A 4AFUC 3I55A 1KFZA 3PTAA 2LRQA 1N27A 2KRSA 1T0JA 3RDVA 1UJYA 2AZSA 2VV5A 5GAOr 1OYXA 2E1HA 1VQKQ 1UJ0A 4HVWA 3RIRA 1I81A 3CMAT 3V8JA 2QK0A 1KQSS 2JTFA 2LX9A 1G83A 4BE1A 4A4KA 4JRQA 4C8QA 1QWFA 4XTWA 1YHQT 5HY6A 4XTVA 2VXFA 3PNWC 1AHJB 1GCQC 3RR6A 3P8HA 1UFFA 4GLKA 1FMWA 4K11A 4WCIA 3KBGA 1VQ4T 2LVMA 4MZTA 3CCLA 5GANf 2YRDA 4HCKA 4IURA 1R8OB 1RAEB 5I2MA 1JRIA 5GJVB 3JCMf 2KT8A 2H3JA 1KK7A 3RESA 2JTEA 4J6XA 5DLQE 2QTVA 1ZUYA 3FJPA 2KRMA 1HK9A 3VKIA 3BFMA 4OGEA 2QQBA 2VXEA 5GAN7 3OYNA 1VQ5Q 1BBZA 3I56T 3WVDB 2EQJA 1U3OA 2PNIA 5CR2A 1S72A 4A63B 1NLPC 3AHUA 1M1KC 2LQWA 2ENMA 5LJ3j 3JCMP 1I4K1 2F2VA 3QKJA 1RAIB 4FW1A 4IUVA 4AMCA 4PJOC 1Y96A 1AWXA 4Z02A 1D09B 2XIDA 2DXBA 2HBWA 3H0FA 2ZPHB 3TSZA 3OYFA 3OYAA 3RKWA 2KYBA 3A8OB 2ZCFB 3A8MB 1C1AA 4BY6C 3UPUA 1E6HA 2O9SA 1VQKA 4A4HA 1ZA2B 3LGLA 3NGPA 3M0QA 2LZ6B 4XU1A 4PLIA 1D0YA 1WHLA 3VYGA 1N8RU 3MP6A 4N0AA 1PCXA 5ECAA 3M0UA 1TS9A 5FWCA 2COWA 2DL7A 3TREA 1AOJA 4NOYA 2ED1A 4II1A 1R0CB 4UC4A 2EYXA 2RI5A 2CZ7B 2L5QA 4WF2A 1VQPQ 4GLMA 2C0IA 3PE0A 3WVEB 2YDLA 1VYUA 2COYA 2YRVA 2HQXA 2XMFA 3JV3A 1X2KA 3QSUA 2HSPA 4D8KA 4L59A 1PNJA 1UECA 1G8XA 5I21A 4HCCA 4M77E 1OU9A 3JAME 3LH0A 4LD6A 5HK3A 1NPPA 1BIBA 3CPFA 4HVUA 1NPRA 2L3PA 2MYSA 1NEGA 1M2OA 1WJSA 4BB7A 3G4SA 2LP5A 4M75F 1VQ9T 2DEQA 2DYIA 3CD6A 1WA7A 3EFRA 3V8LA 1YJWQ 1SRLA 1WZOA 5GMKi 4DEXA 1RABB 3ER0A 4AFZC 2LMJA 2OTLA 1SPKA 1IZ6A 2QASA 1PSFA 3CCQT 1HYOA 3HFOA 3N5BB 2LCSA 1G3WA 5C6SA 3GNGA 5D6XA 4HCBA 1Q81U 3RUXA 1KC8R 3CMEQ 3JRZA 4M78C 3CC7T 3L2UA 2BZYA 2CP5A 2RH2A 2G6FX 1BCOA 1D1BA 2EVRA 3FJ5A 1QP3A 2QDLA 5LJ3g 3ZL7C 3OS2A 3CCSQ 3UT1A 4LDVA 4ZN1A 2PZ1A 3GOXA 3VUZA 5FLXE 3CCMA 1GFCA 2NLUA
chains in the Genus database with same CATH topology
2EBPA 1S1NA 1WDXA 2J05A 2YUPA 2OI3A 3EG1A 1ZLMA 2CH4A 1OV3A 1I1JA 2F2WA 2LJ0A 2FG0A 1UG1A 1K4US 3TVTA 1WXUA 2J6FA 1GCPA 1K1ZA 2AZVA 3PVLA 4RTYA 1MV0B 2BTTA 5HCKA 4J9FA 1QCFA 2KNBB 4OMQA 1AEYA 4E6RA 4GBQA 2O2OA 2D8JA 2YT6A 3EG2A 2JM9A 3EG3A 2RF0A 3SEMA 2DF6A 4CC7A 2ESWA 2ECZA 2A37A 1Z9ZA 1H92A 3LH5A 2JXBA 2X3WD 1NYFA 5IXFA 1UTIA 2DYBA 1RUWA 2F2XA 1PKSA 1TUDA 2EGAA 4RUGA 2LX7A 1IO6A 1M3AA 5FW9A 2KT1A 1YCSB 2DA9A 1K9AA 3VS4A 3CQTA 4RTZA 1HSQA 1QLYA 3REAB 2L2PA 1B3QA 2FEIA 2I0NA 4Z8AA 4FSSA 5IXBA 2JW4A 4R0KA 3EG0A 4LE9A 3VS6A 2V1QA 4Z88A 1WIEA 1Y0MA 4M4ZA 3M0RA 1OPKA 2IIMA 1YP5A 1T0HA 1SHFA 1AWOA 2BZ8A 2DNUA 2KXCA 4JJBA 1VYTA 2JT4A 1K76A 2KRNA 2PTKA 1NLOC 3NPFA 2C0OA 4J9EA 1JU5C 1OPLA 2HCKA 1X6GA 3M0PA 4KRTA 5IHNA 2LNHB 1N5ZA 1PRMC 4OMLA 3O5ZA 2RQTA 2DE0X 1WYXA 4CC2A 2A36A 2KBTA 1LCKA 1A0NB 2RQWA 1M3CA 5IHKA 1AD5A 1ABOA 2CT3A 4AFQC 2RNAA 2RN8A 3EGUA 1XOVA 1ZUKA 1X43A 4DEYA 1V1CA 2RPNA 1NYGA 1UDLA 3NMZC 1M30A 2KEAA 1FYNA 2JMCA 2W10A 2DRKA 2JM8A 1SHGA 2FPDA 2AKLA 4RTVA 5EC7A 2RMOA 2V1RA 1W6XA 1M3BA 4X1VA 1SSHA 2DVJA 2D0NA 4AG2C 2L3QA 2RQUA 2EGEA 2CDTA 1UHCA 4HVVA 2J6KA 4J9DA 2M51A 3VS7A 2GNCA 5IHIA 1YWOA 3EHRA 4CC4B 3RNJA 2K9GA 2MCNA 1EFNA 1H8KA 2D1XA 5L23A 3TSWA 2YUQA 2B86A 1X2QA 1WI7A 4F17A 2VKNA 1E7OA 4JPBW 2GTJA 2KXDA 1FMKA 1M27C 2CH4W 1UHFA 2EKHA 5I11A 2ROTA 4RTUA 2FPFA 4IIOA 1ZSGA 1W1FA 2AK5A 2DRMA 2K2MA 3VS2A 4RTTA 4J9HA 1HD3A 1I0CA 1VA7A 4J9GA 2P4RA 2ROLA 2DJQA 2DBKA 3I35A 1QKXA 1RLQC 4J9CA 2EQIA 1KJWA 4QT7A 2RQVA 4AFUC 1NEBA 3H41A 1HJDA 1KFZA 2FRWA 2DLPA 3ULRB 2KRSA 2YSQA 1T0JA 2O9VA 2DX1A 1BK2A 1GL5A 1UJYA 2AZSA 1RLPC 2K6DA 3I9QA 1YNZA 3UA6A 2BZXA 1K0SA 2X3XD 1QKWA 1AZGB 2GTOA 1UJ0A 4JJDA 4HVWA 3UA7A 1NG2A 4RTXA 1Z9QA 1OOTA 3M0TA 4LUDA 4J9IA 1GBQA 2DBMA 1PHTA 1Y57A 1M8MA 2O88A 1G83A 3C0CA 1BB9A 1WLPB 1QWFA 3UF4A 1CKBA 3QWXX 1T3SA 1YWPA 4OMMA 3UATA 4LNPA 2LQNA 4HXJA 1GCQC 2RQRA 1K0XA 3U23A 1UFFA 2KROA 2OJ2A 2L0AA 4K11A 1RI9A 4WCIA 2KGTA 1CKAA 2JS2A 4LN2A 1SRMA 3M0SA 1QWEA 1UE9A 2JS0A 1U06A 4HCKA 4EIKA 4F14A 2DILA 1MUZA 3QWYA 5GJVB 1G2BA 2KT8A 1PKTA 4LUEA 2JTEA 2EYYA 2LJ3A 1ZUYA 2KRMA 4OMNA 3REBB 2EW3A 3H0IA 1GFDA 1BBZA 1E6GA 5FWBA 2E5KA 1BU1A 2J06A 1U3OA 2PNIA 5GJWB 4A63B 1AZEA 1JEGA 1NLPC 3VS0A 2LQWA 2DL3A 2ENMA 2F2VA 2W0ZA 3H0HA 1YN8A 3SHWA 1AWXA 1J3TA 1ZUUA 1ZBJA 2KYMA 2SEMA 1PWTA 3R6NA 2HBWA 3H0FA 4RTWA 3TSZA 1GCQA 1WXBA 3GBQA 2KE9A 2KYBA 2ABLA 4ZNXA 3RBBB 5I22A 2EYZA 2D8HA 1UGVA 2HEQA 4JZ3A 2HDAA 5IH2A 1E6HA 4IIMA 2O9SA 1MV3A 4ESRA 3NGPA 4OMPA 3M0QA 2EYWA 2LZ6B 3A98A 2DL8A 2FRYA 2J6OA 1W70A 1WXTA 2CREA 2CUBA 3VRZA 1WFWA 5ECAA 3VRYA 1JXOA 1T3LA 2YUNA 3M0UA 5FWCA 1ABQA 4F16A 2DL7A 1AOJA 2ED1A 3I5SA 3PVQA 4ORZA 2EYXA 1JO8A 2CT4A 3KFVA 4GLMA 2C0IA 1AWWA 1X27A 2YUOA 3PE0A 1JXMA 2VWFA 1VYUA 2YDLA 4J9BA 1TUCA 2DL4A 1X6BA 1I07A 2XMFA 3JV3A 4Y92A 2DM1A 1X2KA 2NWMA 2HSPA 4D8KA 1ZX6A 1PNJA 2CUDA 1UECA 2FO0A 3NHNA 2OAWA 2J7IA 4AFSC 3VS3A 2CSIA 2SRCA 3EHQA 1UUEA 2NUZA 2MOXA 2GGRA 4HVUA 1KSWA 2C0TA 4D8DA 2O31A 2L3PA 2K7AA 3IQLA 1NEGA 1ARKA 1NM7A 2GBQA 3VS5A 1KIKA 1B07A 2LP5A 4JZ4A 4Z89A 2K3BA 1PRLC 1WA7A 4OMOA 3VS1A 1GRIA 2MIOA 3I5RA 2M0YA 1SRLA 1JQQA 4DEXA 1H3HA 4AFZC 4CC3A 1TG0A 2K79A 2LMJA 1SPKA 1AVZC 2VVKA 1U5SA 1GBRA 1X69A 2LCSA 2A08A 1WX6A 2H8HA 1AWJA 2DMOA 2ED0A 4JJCA 2GQIA 2DL5A 2FPEA 1OEBA 2BZYA 2LJ1A 2G6FX 2L3SA 2EVRA 3FJ5A 1VYVA 2JMAA 2QDLA 1SEMA 3ZL7C 2EPDA 2KR3A 3THKA 2PZ1A 4AG1C 2AKKA 1CSKA 2A28A 1GFCA 2EGCA 2CSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EBP A;  1S1N A;  1WDX A;  2J05 A;  2YUP A;  2OI3 A;  3EG1 A;  1ZLM A;  2CH4 A;  1OV3 A;  1I1J A;  2F2W A;  2LJ0 A;  2FG0 A;  1UG1 A;  1K4U S;  3TVT A;  1WXU A;  2J6F A;  1GCP A;  1K1Z A;  2AZV A;  3PVL A;  4RTY A;  1MV0 B;  2BTT A;  5HCK A;  4J9F A;  1QCF A;  2KNB B;  4OMQ A;  1AEY A;  4E6R A;  4GBQ A;  2O2O A;  2D8J A;  2YT6 A;  3EG2 A;  2JM9 A;  3EG3 A;  2RF0 A;  3SEM A;  2DF6 A;  4CC7 A;  2ESW A;  2ECZ A;  2A37 A;  1Z9Z A;  1H92 A;  3LH5 A;  2JXB A;  2X3W D;  1NYF A;  5IXF A;  1UTI A;  2DYB A;  1RUW A;  2F2X A;  1PKS A;  1TUD A;  2EGA A;  4RUG A;  2LX7 A;  1IO6 A;  1M3A A;  5FW9 A;  2KT1 A;  1YCS B;  2DA9 A;  1K9A A;  3VS4 A;  3CQT A;  4RTZ A;  1HSQ A;  1QLY A;  3REA B;  2L2P A;  1B3Q A;  2FEI A;  2I0N A;  4Z8A A;  4FSS A;  5IXB A;  2JW4 A;  4R0K A;  3EG0 A;  4LE9 A;  3VS6 A;  2V1Q A;  4Z88 A;  1WIE A;  1Y0M A;  4M4Z A;  3M0R A;  1OPK A;  2IIM A;  1YP5 A;  1T0H A;  1SHF A;  1AWO A;  2BZ8 A;  2DNU A;  2KXC A;  4JJB A;  1VYT A;  2JT4 A;  1K76 A;  2KRN A;  2PTK A;  1NLO C;  3NPF A;  2C0O A;  4J9E A;  1JU5 C;  1OPL A;  2HCK A;  1X6G A;  3M0P A;  4KRT A;  5IHN A;  2LNH B;  1N5Z A;  1PRM C;  4OML A;  3O5Z A;  2RQT A;  2DE0 X;  1WYX A;  4CC2 A;  2A36 A;  2KBT A;  1LCK A;  1A0N B;  2RQW A;  1M3C A;  5IHK A;  1AD5 A;  1ABO A;  2CT3 A;  4AFQ C;  2RNA A;  2RN8 A;  3EGU A;  1XOV A;  1ZUK A;  1X43 A;  4DEY A;  1V1C A;  2RPN A;  1NYG A;  1UDL A;  3NMZ C;  1M30 A;  2KEA A;  1FYN A;  2JMC A;  2W10 A;  2DRK A;  2JM8 A;  1SHG A;  2FPD A;  2AKL A;  4RTV A;  5EC7 A;  2RMO A;  2V1R A;  1W6X A;  1M3B A;  4X1V A;  1SSH A;  2DVJ A;  2D0N A;  4AG2 C;  2L3Q A;  2RQU A;  2EGE A;  2CDT A;  1UHC A;  4HVV A;  2J6K A;  4J9D A;  2M51 A;  3VS7 A;  2GNC A;  5IHI A;  1YWO A;  3EHR A;  4CC4 B;  3RNJ A;  2K9G A;  2MCN A;  1EFN A;  1H8K A;  2D1X A;  5L23 A;  3TSW A;  2YUQ A;  2B86 A;  1X2Q A;  1WI7 A;  4F17 A;  2VKN A;  1E7O A;  4JPB W;  2GTJ A;  2KXD A;  1FMK A;  1M27 C;  2CH4 W;  1UHF A;  2EKH A;  5I11 A;  2ROT A;  4RTU A;  2FPF A;  4IIO A;  1ZSG A;  1W1F A;  2AK5 A;  2DRM A;  2K2M A;  3VS2 A;  4RTT A;  4J9H A;  1HD3 A;  1I0C A;  1VA7 A;  4J9G A;  2P4R A;  2ROL A;  2DJQ A;  2DBK A;  3I35 A;  1QKX A;  1RLQ C;  4J9C A;  2EQI A;  1KJW A;  4QT7 A;  2RQV A;  4AFU C;  1NEB A;  3H41 A;  1HJD A;  1KFZ A;  2FRW A;  2DLP A;  3ULR B;  2KRS A;  2YSQ A;  1T0J A;  2O9V A;  2DX1 A;  1BK2 A;  1GL5 A;  1UJY A;  2AZS A;  1RLP C;  2K6D A;  3I9Q A;  1YNZ A;  3UA6 A;  2BZX A;  1K0S A;  2X3X D;  1QKW A;  1AZG B;  2GTO A;  1UJ0 A;  4JJD A;  4HVW A;  3UA7 A;  1NG2 A;  4RTX A;  1Z9Q A;  1OOT A;  3M0T A;  4LUD A;  4J9I A;  1GBQ A;  2DBM A;  1PHT A;  1Y57 A;  1M8M A;  2O88 A;  1G83 A;  3C0C A;  1BB9 A;  1WLP B;  1QWF A;  3UF4 A;  1CKB A;  3QWX X;  1T3S A;  1YWP A;  4OMM A;  3UAT A;  4LNP A;  2LQN A;  4HXJ A;  1GCQ C;  2RQR A;  1K0X A;  3U23 A;  1UFF A;  2KRO A;  2OJ2 A;  2L0A A;  4K11 A;  1RI9 A;  4WCI A;  2KGT A;  1CKA A;  2JS2 A;  4LN2 A;  1SRM A;  3M0S A;  1QWE A;  1UE9 A;  2JS0 A;  1U06 A;  4HCK A;  4EIK A;  4F14 A;  2DIL A;  1MUZ A;  3QWY A;  5GJV B;  1G2B A;  2KT8 A;  1PKT A;  4LUE A;  2JTE A;  2EYY A;  2LJ3 A;  1ZUY A;  2KRM A;  4OMN A;  3REB B;  2EW3 A;  3H0I A;  1GFD A;  1BBZ A;  1E6G A;  5FWB A;  2E5K A;  1BU1 A;  2J06 A;  1U3O A;  2PNI A;  5GJW B;  4A63 B;  1AZE A;  1JEG A;  1NLP C;  3VS0 A;  2LQW A;  2DL3 A;  2ENM A;  2F2V A;  2W0Z A;  3H0H A;  1YN8 A;  3SHW A;  1AWX A;  1J3T A;  1ZUU A;  1ZBJ A;  2KYM A;  2SEM A;  1PWT A;  3R6N A;  2HBW A;  3H0F A;  4RTW A;  3TSZ A;  1GCQ A;  1WXB A;  3GBQ A;  2KE9 A;  2KYB A;  2ABL A;  4ZNX A;  3RBB B;  5I22 A;  2EYZ A;  2D8H A;  1UGV A;  2HEQ A;  4JZ3 A;  2HDA A;  5IH2 A;  1E6H A;  4IIM A;  2O9S A;  1MV3 A;  4ESR A;  3NGP A;  4OMP A;  3M0Q A;  2EYW A;  2LZ6 B;  3A98 A;  2DL8 A;  2FRY A;  2J6O A;  1W70 A;  1WXT A;  2CRE A;  2CUB A;  3VRZ A;  1WFW A;  5ECA A;  3VRY A;  1JXO A;  1T3L A;  2YUN A;  3M0U A;  5FWC A;  1ABQ A;  4F16 A;  2DL7 A;  1AOJ A;  2ED1 A;  3I5S A;  3PVQ A;  4ORZ A;  2EYX A;  1JO8 A;  2CT4 A;  3KFV A;  4GLM A;  2C0I A;  1AWW A;  1X27 A;  2YUO A;  3PE0 A;  1JXM A;  2VWF A;  1VYU A;  2YDL A;  4J9B A;  1TUC A;  2DL4 A;  1X6B A;  1I07 A;  2XMF A;  3JV3 A;  4Y92 A;  2DM1 A;  1X2K A;  2NWM A;  2HSP A;  4D8K A;  1ZX6 A;  1PNJ A;  2CUD A;  1UEC A;  2FO0 A;  3NHN A;  2OAW A;  2J7I A;  4AFS C;  3VS3 A;  2CSI A;  2SRC A;  3EHQ A;  1UUE A;  2NUZ A;  2MOX A;  2GGR A;  4HVU A;  1KSW A;  2C0T A;  4D8D A;  2O31 A;  2L3P A;  2K7A A;  3IQL A;  1NEG A;  1ARK A;  1NM7 A;  2GBQ A;  3VS5 A;  1KIK A;  1B07 A;  2LP5 A;  4JZ4 A;  4Z89 A;  2K3B A;  1PRL C;  1WA7 A;  4OMO A;  3VS1 A;  1GRI A;  2MIO A;  3I5R A;  2M0Y A;  1SRL A;  1JQQ A;  4DEX A;  1H3H A;  4AFZ C;  4CC3 A;  1TG0 A;  2K79 A;  2LMJ A;  1SPK A;  1AVZ C;  2VVK A;  1U5S A;  1GBR A;  1X69 A;  2LCS A;  2A08 A;  1WX6 A;  2H8H A;  1AWJ A;  2DMO A;  2ED0 A;  4JJC A;  2GQI A;  2DL5 A;  2FPE A;  1OEB A;  2BZY A;  2LJ1 A;  2G6F X;  2L3S A;  2EVR A;  3FJ5 A;  1VYV A;  2JMA A;  2QDL A;  1SEM A;  3ZL7 C;  2EPD A;  2KR3 A;  3THK A;  2PZ1 A;  4AG1 C;  2AKK A;  1CSK A;  2A28 A;  1GFC A;  2EGC A;  2CSQ A; 
#chains in the Genus database with same CATH topology
 1S1N A;  3EG1 A;  3QJ6 A;  1OV3 A;  3OYY A;  1VQM Q;  4RKU E;  1ZSZ C;  1GCP A;  1K1Z A;  4M75 C;  4RTY A;  2E64 A;  2E41 A;  5HCK A;  3QO3 A;  4J9F A;  3CC2 T;  4E6R A;  2ZZD A;  1O75 A;  4BI8 B;  3CCE Q;  2YT6 A;  4DBH A;  3EG3 A;  3RKY A;  1M1F A;  2ECZ A;  4WTO B;  1I8F A;  4JJN K;  1NYF A;  2XG8 D;  2XK0 A;  1M8V A;  1TUD A;  2BE7 D;  4RUG A;  3MEW A;  1RAG B;  2F5T X;  1M3A A;  2O4X B;  3CPW S;  2I0N A;  4NS5 A;  1OZ2 A;  5IXB A;  2JW4 A;  1M90 R;  3VS6 A;  4FSX A;  2XI9 A;  4MMK A;  4M4Z A;  5GMK j;  3LWH A;  2E10 A;  1T0H A;  1M5Q 1;  3VJP A;  2R58 A;  3TEE A;  1H3Z A;  4MZM A;  2JT4 A;  3G71 Q;  1JJ2 P;  2DEU A;  5A2Q E;  2WSF E;  2V8J A;  3NPF A;  4LD9 K;  4J9E A;  2ZPG B;  2HQH A;  4C5H A;  1ZHI A;  5IHN A;  4PJM A;  3JCM X;  1N5Z A;  4OVA A;  1PRM C;  4OML A;  3O5Z A;  5J3B A;  2RQT A;  4C8Q F;  5LJ3 h;  3GNF B;  2DIQ A;  1ZBX A;  3QZ5 B;  2A36 A;  3RKX A;  1M3C A;  1X75 C;  2CP6 A;  3QPH A;  2LCC A;  4AFQ C;  2FYK A;  1ZUK A;  1V1C A;  1UDL A;  3NMZ C;  1UGQ B;  4DBR A;  2KEA A;  5LJ3 d;  1JJ2 A;  2DRK A;  3EH1 A;  1SHG A;  3BDL A;  2DK3 A;  1YIJ Q;  2V1R A;  1SSH A;  5HKC A;  4C92 F;  3ME9 A;  4YTL A;  1YJ9 Q;  2VC8 A;  2CDT A;  2HZY A;  4J9D A;  2ZPE B;  1K9M R;  3BW1 A;  4F7U B;  2KAF A;  4DOW A;  3OQ5 A;  1KD1 C;  1XTD A;  5IHI A;  1Q82 U;  1YIT A;  3RNJ A;  1M4Z A;  1VQ6 T;  2K9G A;  2MCN A;  1EFN A;  3CBM A;  2BIV A;  2D1X A;  3HL8 A;  4BI4 A;  3TSW A;  4FIB A;  4A4E A;  1X2Q A;  4F17 A;  2VKN A;  1NJI C;  2WSE E;  4JPB W;  2KXD A;  1FMK A;  2EKH A;  5I11 A;  2QEX T;  2ROT A;  4RTU A;  2PVD B;  3EGD B;  4C8Q C;  3V7S A;  4OP0 A;  1ZSG A;  1W1F A;  3VS2 A;  4RTT A;  2EJF A;  4J9H A;  1HD3 A;  1I0C A;  1SF9 A;  1VA7 A;  2ZAE A;  2P4R A;  2ROL A;  2DJQ A;  2L89 A;  2EKO A;  3CXC P;  3I35 A;  1QP2 A;  1QKX A;  4C0D C;  2CP7 A;  1OU8 A;  4M77 B;  3C95 A;  1YJN T;  2Y4Y A;  3JB9 I;  3L2R A;  4QT7 A;  4EMK B;  4A4F A;  4FYX B;  2DLP A;  3ULR B;  2YSQ A;  4M77 D;  2ZPI B;  5L8R E;  1GL5 A;  1N9S A;  4CRI A;  3I9Q A;  1YNZ A;  3UA6 A;  1K0S A;  3MEU A;  1QKW A;  3UA7 A;  1NG2 A;  1YI2 Q;  4O6J A;  1BI3 A;  3HRU A;  4QVD A;  5KYN A;  4J5Y A;  5LL6 S;  1WJQ A;  4ZN3 A;  4F7U G;  3CXC A;  1Y57 A;  4C92 B;  1M8M A;  2V26 A;  2ZGW A;  3MO8 A;  4F04 B;  4AT1 B;  3I55 Q;  1TOV A;  3CC4 Q;  1WLP B;  3TCJ A;  1Q7Y U;  4C92 D;  3GP8 A;  3QWX X;  2O4X A;  1YJ9 A;  1RAD B;  4M7D B;  1UGS B;  3LLR A;  2RQR A;  3BE3 A;  1K0X A;  2HL3 A;  3CXC S;  2LNV A;  2F5K A;  8ATC B;  4TVR A;  1CKA A;  2JS2 A;  5CIU A;  4M7D D;  3M0S A;  4J8O A;  2COZ A;  2HAX A;  2LDM A;  2EFI A;  1VQL T;  3PMI A;  3M9Q A;  4ELY C;  4LUE A;  2LJ3 A;  4M77 G;  4N0A C;  2C06 A;  2QA4 Q;  3GLX A;  1GFD A;  1E6G A;  2VGN A;  1WJR A;  1BU1 A;  2KDS A;  5GJW B;  2MMP A;  4IUT A;  3VS0 A;  1MGQ A;  3CCL Q;  1EX4 A;  4NL2 A;  1G3Y A;  1J3T A;  1ZUU A;  1PWT A;  4R56 A;  3OYJ A;  2HL5 C;  1K73 C;  4RTW A;  4A53 A;  3D7S B;  2QGG A;  3QZ9 B;  3GBQ A;  1FX7 A;  3CCV T;  3HRS A;  5I22 A;  1PD1 A;  1BI2 A;  1MMA A;  3HRT A;  5KYX B;  1MV3 A;  4ESR A;  3EGX B;  4IUQ A;  4OMP A;  2EYW A;  4M7D G;  3CCJ A;  2DL8 A;  4F7U A;  2FRY A;  3QII A;  1WXT A;  2CRE A;  2DTO A;  4XTX A;  2KY9 A;  1JXO A;  1T3L A;  2YUN A;  3G6E A;  2EAY A;  4F16 A;  2QXF A;  3CC4 A;  4ZGJ B;  3TU4 K;  3I5S A;  4M78 E;  2Y90 A;  4ORZ A;  3JCM J;  2JJ9 A;  1OUL A;  5CKE A;  4E47 A;  1X27 A;  1AT1 B;  2VWF A;  1X6B A;  2E6N A;  4Y28 E;  3EGD A;  2ZPB B;  1VQ7 T;  4N4G A;  3P8B B;  5DM7 R;  4VUB A;  1ZX6 A;  4KGV B;  4PJJ A;  2FO0 A;  2VAS A;  3PGG A;  2R5A A;  4QW2 A;  4AFS C;  4XU2 A;  1M1K U;  7AT1 B;  2CSI A;  4QQG A;  2YXY A;  2KSS A;  3JCM Q;  4KUD K;  3T9N A;  2HKQ B;  4PFP A;  2NUZ A;  3A1P A;  4M77 A;  1VQO T;  2GGR A;  1IHW A;  2C0T A;  4M75 E;  2QTX A;  2O31 A;  3LYI A;  4EMK A;  1XNI A;  3PT9 A;  2QA4 A;  1ARK A;  1NM7 A;  3QXE B;  2GBQ A;  3VS5 A;  3MCA B;  1B34 B;  3MP8 A;  4XU3 A;  5J39 A;  4FYV B;  4J7F A;  4P5N A;  1PRL C;  3VS1 A;  2MIO A;  4BI3 A;  5LJ3 e;  2YLC A;  3CMA A;  1H3H A;  1WGS A;  5KYU B;  1SSF A;  1JB0 E;  3JCM c;  4R55 A;  1K8A C;  4C92 A;  1IXD A;  1S72 T;  1U5S A;  1UGP B;  5M9O A;  1U1S A;  3G4S Q;  3OYB A;  1GXI E;  3MET A;  2H8H A;  5CQX A;  2ED0 A;  4JJC A;  2JUF A;  2DXC A;  3CD6 Q;  1N8R R;  4M7D A;  1OEB A;  5GAN 8;  2IPO B;  3LX7 A;  2K57 A;  2RJE A;  3TQ7 P;  1OZ3 A;  5AYF A;  1SEM A;  2EPD A;  4EMG A;  1OX9 A;  1M9S A;  2OTL Q;  4AG1 C;  1VQK T;  4GY5 A;  2P0P A;  4JS4 A;  2CSQ A;  2DXU A;  2D6F A;  2OI3 A;  1ZLM A;  5A0L A;  1I1J A;  3L42 A;  1UG1 A;  2QGF B;  1Q86 C;  3TVT A;  3OW2 P;  1RAA B;  3C12 A;  2AZV A;  2XHC A;  3MEV A;  3S3N A;  3I56 A;  1OQK A;  1IB8 A;  3E2U A;  2FZK B;  1QCF A;  2KNB B;  1AEY A;  4GBQ A;  2O2O A;  1PSE A;  2D8J A;  3L2Z A;  3EG2 A;  3FEO A;  4XTY A;  4RG2 A;  4PJO B;  2DF6 A;  4CC7 A;  1WHM A;  2A37 A;  3URG A;  1Z9Z A;  3CCM Q;  3PFS A;  2YRC A;  5IXF A;  1VQN A;  3M5A A;  4BAC A;  2DYB A;  4PK4 A;  3RER A;  4PJO D;  5FRO A;  2DXT A;  2KK4 A;  4IUU A;  5FW9 A;  3RMQ A;  1YCS B;  3OW2 A;  2DFU A;  3E1S A;  2EQM A;  4RTZ A;  4C0Z A;  4J83 A;  5KYX A;  1HSQ A;  3REA B;  4M7A F;  1YCY A;  1B3Q A;  1IRE B;  3EGX A;  2FEI A;  4OB0 B;  4ZTF A;  1VQ5 T;  4FW2 A;  4LE9 A;  4Z88 A;  1WHG A;  1WIE A;  3Q1J A;  5KE2 A;  1F1B B;  2WAC A;  3QUI A;  3OW2 S;  3DLM A;  4JJB A;  1Q81 R;  1VYT A;  2PTK A;  3GIB A;  1NLO C;  2LT4 A;  1JU5 C;  2LT1 A;  4C8Q E;  2HCK A;  2CGH A;  2XDD A;  3LWI A;  2XD0 A;  2GFU A;  5CO7 A;  1Y07 A;  1N9R A;  2VB6 A;  2VYT A;  4KBM B;  1EZZ B;  3M58 A;  4RMO A;  3G7Z A;  2HBP A;  1A0N B;  2RQW A;  4KH1 B;  1ABO A;  4PJO G;  2RNA A;  2RN8 A;  4DBQ A;  4DEY A;  2OTJ Q;  2L8D A;  2R57 A;  3CEY A;  2NUP B;  2E12 A;  3EAE A;  3MHX A;  1B34 A;  1VQ9 A;  2W10 A;  2JM8 A;  4FU6 A;  5KCO A;  2DZC A;  5EC7 A;  1U1T A;  5CAI A;  1W6X A;  5FU7 B;  2L3R A;  1VQP T;  1ZA1 B;  3CPW P;  4X1V A;  3SWN B;  3OSV A;  1KHI A;  3H9N A;  3M53 A;  4ANJ A;  4DBF A;  2D0N A;  5LJ5 j;  3HP9 A;  2L3Q A;  2RQU A;  3EFS A;  5KYU A;  3A5Z B;  3MJX A;  5GAN 5;  5IN1 A;  5GAM j;  4M7A B;  3JB9 G;  1H8K A;  4O5V A;  1M2V B;  2MI6 A;  3F70 A;  2B86 A;  4MDX A;  4M7A D;  4IUP A;  4M78 B;  2E4H A;  4RG8 A;  1R0B G;  3CC7 A;  2RD1 A;  3OYI A;  2BUD A;  3DLL A;  2CH4 W;  1M27 C;  2QQS A;  1RAF B;  2FPF A;  3CPW A;  5GMK e;  2DRM A;  4EPC A;  1WQW A;  3FIF A;  4XU0 A;  1YJW T;  1YIT Q;  2KI7 A;  1JBM A;  3QYG B;  1N6A A;  4J7I A;  2EQK A;  1ACM B;  1KJW A;  4F7U F;  1ZSZ B;  1BIA A;  3OYE A;  3M54 A;  1D0X A;  2RQV A;  3P8D A;  1NEB A;  3H41 A;  2EYQ A;  8AT1 B;  2CP0 A;  1ZQ1 A;  2O9V A;  2DX1 A;  1BK2 A;  5D6W A;  2K6D A;  3J80 E;  2BZX A;  2X3X D;  2GTO A;  3OA6 A;  3CME T;  2PVG B;  4PJO A;  2LCL A;  2K2V A;  4RTX A;  4ZGE B;  1QW1 A;  2RJF A;  1H64 1;  1OOT A;  1KD1 U;  3M0T A;  4LUD A;  2OTJ A;  3HKS A;  2PVO B;  3CCS T;  4J9I A;  1OX8 A;  2DBM A;  2QQR A;  3PIP A;  1IRX A;  4LDY A;  3C0C A;  4M7A G;  1BB9 A;  1FWZ A;  3OYM A;  1W2B P;  1QQJ A;  4NL3 A;  1VQM T;  3UF4 A;  5LJ3 f;  4M77 F;  1NJI U;  1YWP A;  4OMM A;  2I2L A;  1UGR B;  4M78 G;  4LNP A;  3QHS A;  4FYW B;  2MAM A;  1Q82 R;  2YHT A;  2AT1 B;  1IHV A;  3U23 A;  2KRO A;  4B9X A;  1KC8 C;  1TSF A;  4KUI A;  2G3R A;  3EG9 B;  2KGT A;  3CCE T;  1SRM A;  1QWE A;  1UE9 A;  2DZ9 A;  2JS0 A;  2FZC B;  4A54 A;  2H3E B;  2JZ2 A;  1LNX A;  4E7S A;  3QWY A;  1BI1 A;  1LJO A;  3FRN A;  3E19 A;  2MWO A;  4OMN A;  3REB B;  1YFN A;  1W2B A;  4PKC C;  2EW3 A;  1I5L A;  3H0I A;  2RI3 A;  5LJ5 g;  2E5K A;  2J06 A;  2CP2 A;  3DKM A;  5EG2 A;  5GAM g;  2DL3 A;  3H0H A;  4M7D F;  2XDB A;  4HT8 A;  3UWN A;  2NYS A;  2KYM A;  3GF5 A;  3A8L B;  2NUP A;  2B8A A;  3QDR B;  1W2B S;  1WHH A;  4ELZ C;  2RO0 A;  3PIO A;  1WXB A;  3FB9 A;  3G71 T;  3RBB B;  4JLI A;  5GAN j;  2EYZ A;  4JZ3 A;  3DB3 A;  4QKU A;  2HDA A;  3V8K A;  4MZP A;  1KQ1 A;  2X35 A;  4JUV A;  3SWN A;  2RHX A;  4Q5W A;  2M0O A;  5HK0 A;  2CZ0 B;  3X26 B;  4C0F A;  1W70 A;  1VQ6 A;  1G5V A;  2VGM A;  2CUB A;  4JRP A;  1WFW A;  4M7A A;  3VRY A;  1M90 C;  1G3T A;  1XJW B;  1M2V A;  1ABQ A;  2XIC A;  1Q7Y R;  4ME7 A;  4BD3 A;  1IGU A;  1QVF P;  2CT4 A;  4M78 A;  2LTO A;  4KT0 E;  2YUO A;  4C92 C;  3EH2 A;  2YWW A;  4J9B A;  1RAH B;  4ZTJ A;  2DL4 A;  3M56 A;  3X24 B;  2BKD N;  3NTI A;  2FL7 A;  1YIJ T;  3CCJ Q;  4KGZ B;  3NHN A;  2J7I A;  1Y71 A;  1YJ9 T;  3VS3 A;  4OMF B;  5AT1 B;  4M7D C;  4BDY A;  4FL6 A;  1YJN A;  2SRC A;  3EHQ A;  1UUE A;  3G6E Q;  1MMN A;  2XDP A;  1KSW A;  1ZSZ A;  2QQA A;  4D8D A;  2K7A A;  2E6Z A;  1K73 U;  1UEB A;  5CQY A;  5KCH A;  1KIK A;  4QVZ A;  3V7R A;  1B07 A;  3HSB A;  3VV0 A;  4HT9 A;  3CCU Q;  5LJ5 h;  1GRI A;  2M0Y A;  2Z0W A;  2Y4X A;  1QCN A;  5CKF A;  3O8V A;  1KQ2 A;  3KUF A;  4CC3 A;  3J81 E;  1TG0 A;  2K79 A;  3UDC A;  4E2F B;  3S6W A;  5D7U A;  3M55 A;  2RK2 A;  3V7C A;  2VVK A;  4XTU A;  1QVF S;  1K9M C;  1X69 A;  3NFC A;  5LJ5 d;  2D0Q B;  2MF2 A;  2DMO A;  5GAM d;  5A0G A;  2DL5 A;  2FPE A;  5FU6 B;  4XTZ A;  3JCM b;  2CP3 A;  5KYY B;  2JMA A;  3CMA Q;  3OMC A;  4PL6 A;  3EG9 A;  2FZG B;  2KR3 A;  3THK A;  4MML A;  2ATC B;  1K8A R;  2AKK A;  2CS7 A;  1VQL A;  2HD0 A;  2RHI A;  1YI2 T;  2A28 A;  2R5M A;  1TXQ A;  2CH4 A;  2LJ0 A;  2F2W A;  3FC3 A;  5GAN 6;  4RCB A;  3MEA A;  3E9F A;  1YHQ Q;  1VQ8 A;  2MK5 A;  5GAN g;  1D3B B;  4PJL A;  1WXU A;  4FCY A;  5KH6 A;  4FT4 A;  2NUT B;  2IVW A;  3I55 T;  3CC4 T;  2E70 A;  4MDW A;  3JCM g;  1D1C A;  3C4S A;  5GMK h;  1M1K R;  4IKF A;  1WPY A;  4QQD A;  5DY9 A;  2OX7 A;  3OYD A;  3CBP A;  2DD5 A;  2X4W A;  1C0M A;  3SEM A;  2V8I A;  3SDZ A;  1LOJ A;  3LH5 A;  1Y7X A;  2X3W D;  1K8A U;  1UTI A;  1BI0 A;  2QG9 B;  2RK1 A;  1FMV A;  3OY9 A;  3H6Z A;  2LX7 A;  4HA8 A;  1IO6 A;  3CCU A;  3I56 Q;  2DA9 A;  2K3Y A;  1K9A A;  2QA4 T;  3CCR A;  5KYW B;  4Z8A A;  2XKO C;  2F69 A;  3OB9 A;  3EG0 A;  2MWP A;  5A0D A;  3L2V A;  1PM3 A;  3M0R A;  1OPK A;  2IIM A;  1YP5 A;  1VQN Q;  1WHJ A;  1SHF A;  3CCL T;  2BZ8 A;  2DNU A;  2KXC A;  3FLG A;  1R77 A;  4PFZ A;  4PJO F;  1K76 A;  2KRN A;  1Q86 U;  2K5I A;  2OAU A;  2JVV A;  4C0G A;  1W4S A;  1OPL A;  1X6G A;  3QG1 A;  1VQ7 A;  3M0P A;  2LNH B;  2GCX A;  3M4G A;  1IGQ A;  4CC2 A;  1V76 A;  2KBT A;  1LCK A;  4E7I A;  5IHK A;  5CKH A;  4N4H A;  1VQO A;  2CT3 A;  4KUL A;  1UB4 A;  1YHQ A;  1X43 A;  2IG0 A;  2DER A;  2RPN A;  3JB9 F;  1NYG A;  4X34 A;  5GAN h;  2X4J A;  4LDW A;  4DQ2 A;  1FYN A;  2JMC A;  3NTK A;  2FPD A;  2AKL A;  3JCM h;  4RTV A;  1VOM A;  1NE8 A;  3NTH A;  1VQ4 A;  1VIE A;  1M3B A;  1X01 A;  2CKK A;  2DVJ A;  3OMG A;  5GAO m;  4AG2 C;  1LPL A;  2EJ9 A;  5CK9 A;  5GAN d;  1YWO A;  3C94 A;  2HSE B;  1TU0 B;  3JCM d;  1V29 B;  5L23 A;  5KE3 A;  2YUQ A;  1VQ9 Q;  3M4Y A;  1VQN T;  3HPW A;  2P0Q A;  4X9C A;  2PQW A;  4PLL A;  4B6M A;  1UHF A;  2M1H A;  5KYY A;  2LC4 A;  2AK5 A;  2DJZ A;  4F7U E;  3CCQ Q;  4J9G A;  2K5F A;  4X9D A;  2JNG A;  3AT1 B;  3SD4 A;  4Y91 A;  3RMS A;  4OGC A;  3L1A A;  4BY6 B;  1D3B A;  1DJ7 B;  4KGX B;  5GAO l;  4OB1 B;  3OYL A;  1HJD A;  2NUT A;  2E3I A;  2HKN A;  3CC7 Q;  2FRW A;  2X4Y A;  2HQE A;  3G4S T;  5CKD A;  1RLP C;  1AZG B;  3HTR A;  3CD6 T;  4M78 F;  4JJD A;  4J6W A;  2RB6 A;  2DET A;  1Z9Q A;  3M57 A;  2P84 A;  2X51 A;  1KHC A;  3JB9 D;  1GBQ A;  2OTL T;  1PHT A;  3S3M A;  2O88 A;  2HNI A;  2JOY A;  1RL2 A;  3CC2 Q;  1OI1 A;  1CKB A;  3R6O A;  1T3S A;  9ATC B;  5LJ5 e;  1QVP A;  1VQ5 A;  3UAT A;  5KYW A;  4XK8 E;  2LQN A;  1QCO A;  4HXJ A;  3OYG A;  5GAM e;  1N8R C;  1MHN A;  2OJ2 A;  2L0A A;  5FU7 C;  1RI9 A;  2CZ6 B;  2RHY A;  2RJC A;  4LN2 A;  3SWN C;  1U06 A;  5GAO p;  4EIK A;  4F14 A;  3JB9 J;  4C92 E;  2DIL A;  1MUZ A;  2CZ1 B;  3CCM T;  1G2B A;  1G3S A;  1PKT A;  2O01 E;  2EYY A;  5IAY A;  2FB7 A;  4L6V 5;  4M7A C;  2E5Q A;  2A3L A;  5J26 A;  4QQ6 A;  2A7Y A;  4D6W A;  5FWB A;  4M7D E;  1HXD A;  3VU3 C;  1C6V X;  3MKD A;  3CCQ A;  2M9U A;  4OF1 A;  4V2S A;  4XAX B;  1AZE A;  2DPP B;  1JEG A;  1TTH B;  2W0Z A;  2DKG A;  1YN8 A;  3SHW A;  4C5I A;  3S3O A;  5D6Y A;  1I5O B;  4BE2 A;  1ZBJ A;  2SEM A;  3R6N A;  5FRN A;  3WXM B;  1NBE B;  1GCQ A;  2KE9 A;  2ABL A;  4ZNX A;  1TWB A;  1VQP A;  4FYY B;  2D8H A;  1UGV A;  2HEQ A;  4E7Z A;  2DD4 A;  4M78 D;  1TH7 A;  5IH2 A;  4IIM A;  1KG1 A;  2KVQ G;  1KD1 R;  3LW5 E;  3M59 A;  4HKE A;  3A98 A;  3OYH A;  1KC8 U;  2J6O A;  1BKB A;  3VRZ A;  2QYZ A;  4ATO A;  2KMT A;  1QMC A;  2RI2 A;  3QJY A;  2K5L A;  4M75 B;  2K3X A;  1NJI R;  5I2S A;  3PVQ A;  2XU8 A;  3CC2 A;  3ZBD A;  3GPL A;  2OTJ T;  1JO8 A;  3KFV A;  1NZ9 A;  1AWW A;  3MPU B;  1P92 A;  1Q81 C;  4M75 D;  1JXM A;  2X9H A;  4ZGD B;  1TUC A;  1I07 A;  1RI0 A;  4Y92 A;  2DM1 A;  2RJD A;  2DIG A;  2NWM A;  1SKU B;  2EJG A;  2CUD A;  1YJW A;  2OAW A;  1VQ6 Q;  5GMK m;  5CCA A;  4E7H A;  2A0F B;  2JN0 A;  1B7T A;  2MOX A;  3ASK A;  4A4G A;  1MND A;  4LXC A;  3IQL A;  2V8K A;  4C5E A;  2QDY B;  2DVE A;  3OYK A;  1PG5 B;  3X28 B;  2QEX Q;  2RA2 A;  4JZ4 A;  2AIR B;  4Z89 A;  4EDU A;  2DTH A;  2K3B A;  3CME A;  2AHJ B;  3EFO B;  4OMO A;  2DTI A;  4J6Y A;  5DLO A;  3I5R A;  1MMD A;  1JQQ A;  3CCS A;  3DB4 A;  2GF7 A;  2M16 A;  5GAN 3;  1YJN Q;  1AVZ C;  5IT9 E;  1M90 U;  1GBR A;  1YIT T;  3JSC A;  2GFA A;  5GAN e;  2A08 A;  1VQM A;  3FDR A;  1YBY A;  4M75 G;  1WX6 A;  4CI0 C;  5GAN 4;  1AWJ A;  3JCM e;  5GMK l;  3BDU A;  4N4I A;  3OBY A;  2GQI A;  1WNL A;  2BE9 B;  2LJ1 A;  1U8R A;  1FXX A;  2L3S A;  1VYV A;  5FRM A;  3CCE A;  3INZ A;  4XQ3 A;  4LDX A;  1CSK A;  2EGC A;  3BY7 A;  2EBP A;  1WDX A;  2J05 A;  2YUP A;  2E3H A;  2EQU A;  2FG0 A;  4LDU A;  2EWN A;  1K4U S;  4M77 C;  1JJ2 S;  3X20 B;  2J6F A;  4C5G A;  4L5G A;  4EMK C;  3VYH B;  3PVL A;  3OS0 A;  1MV0 B;  2BTT A;  1MMG A;  4OMQ A;  4DOV A;  3OSS C;  2JM9 A;  2RF0 A;  2ZPF B;  4OB3 B;  1K73 R;  2ESW A;  2LQ8 A;  1VQL Q;  1H92 A;  2JXB A;  2D9T A;  1RUW A;  2F2X A;  1QVG P;  1PKS A;  1K9M U;  1VQ8 Q;  2EGA A;  3G71 A;  2QEX A;  3KXT A;  2E65 A;  4QVC A;  2MPX C;  1RAC B;  1PC0 A;  2QQ9 A;  4FM4 B;  2GQV A;  2KT1 A;  2PU9 B;  4C8Q B;  2FVU A;  3JCM W;  3VS4 A;  3CQT A;  1QLY A;  3ZEH A;  3PMT A;  2L2P A;  3ZFJ A;  4C8Q D;  4FSS A;  2DO3 A;  3OS5 A;  4HCZ A;  1VIF A;  2JTM A;  4R0K A;  4RCC A;  3HFN A;  4C0D B;  4E7K A;  3G1J A;  4PJO E;  2V1Q A;  1Y0M A;  2QI2 A;  1Q82 C;  3A8H B;  1AWO A;  2PUO B;  4M75 A;  6AT1 B;  3QBY A;  3CCV Q;  1QVF A;  1QVG A;  5LJ5 f;  2C0O A;  3LGF A;  2K4Y A;  2WSC E;  1XQH A;  4KRT A;  5GAM f;  1YIJ A;  4JDS A;  3CCR Q;  3J7A F;  4JLG A;  5GAM h;  1O9S A;  1WHK A;  1TUG B;  4E7J A;  2DE0 X;  1WYX A;  2X4X A;  4BDZ A;  2VUB A;  1BCM A;  5FU6 C;  1D0Z A;  1AD5 A;  4E7L A;  3HHT B;  1QVG S;  2F1L A;  3EGU A;  1XOV A;  1Y96 B;  5GAO n;  4DA4 A;  4PJN A;  5CKB A;  4PNO A;  4JS5 A;  3X25 B;  2CYZ B;  1M30 A;  2PUK B;  1VQ7 Q;  3QDF A;  2RMO A;  2KQW A;  3EFO A;  4C8Q G;  5GAO q;  3CBO A;  2LQK A;  5C0M A;  1VQ8 T;  3SFM A;  5CVI A;  3A8G B;  2EGE A;  1UHC A;  2EIF A;  4HVV A;  2J6K A;  4JRK A;  2M51 A;  2RM4 A;  3VS7 A;  1VQO Q;  2GNC A;  4OB2 B;  3EHR A;  3CCJ T;  4CC4 B;  1Q95 G;  1LVK A;  1D1A A;  1VUB A;  1KQS P;  2FHD A;  4BUG A;  3G6E T;  2YLB A;  4FT2 A;  4EMH A;  4KH0 B;  3JB9 H;  1EIF A;  1X6O A;  1Q7Y C;  1WI7 A;  4JRI A;  1E7O A;  2P0K A;  1SG5 A;  4C92 G;  3L2W A;  1VQ4 Q;  2GTJ A;  2RHZ A;  4B9W A;  3L2Q A;  2DAQ A;  3CCU T;  4IIO A;  4BE0 A;  1WQ7 A;  2K2M A;  3JCM V;  1M1G A;  1YI2 A;  1S72 Q;  3H8Z A;  3E9G A;  4PFO A;  3MP1 A;  1PD0 A;  2HMA A;  1Q86 R;  3OYC A;  2DBK A;  2RHU A;  3CCR T;  3CCV A;  4M7A E;  3SB2 A;  1RLQ C;  1BYM A;  3VUB A;  4J9C A;  5GAN 2;  2M02 A;  3OBW A;  2EQI A;  1KQS A;  2QAZ A;  3QYH B;  2P4T A;  1MNE A;  3OS1 A;  4AFU C;  3I55 A;  1KFZ A;  3PTA A;  2LRQ A;  1N27 A;  2KRS A;  1T0J A;  3RDV A;  1UJY A;  2AZS A;  2VV5 A;  5GAO r;  1OYX A;  2E1H A;  1VQK Q;  1UJ0 A;  4HVW A;  3RIR A;  1I81 A;  3CMA T;  3V8J A;  2QK0 A;  1KQS S;  2JTF A;  2LX9 A;  1G83 A;  4BE1 A;  4A4K A;  4JRQ A;  4C8Q A;  1QWF A;  4XTW A;  1YHQ T;  5HY6 A;  4XTV A;  2VXF A;  3PNW C;  1AHJ B;  1GCQ C;  3RR6 A;  3P8H A;  1UFF A;  4GLK A;  1FMW A;  4K11 A;  4WCI A;  3KBG A;  1VQ4 T;  2LVM A;  4MZT A;  3CCL A;  5GAN f;  2YRD A;  4HCK A;  4IUR A;  1R8O B;  1RAE B;  5I2M A;  1JRI A;  5GJV B;  3JCM f;  2KT8 A;  2H3J A;  1KK7 A;  3RES A;  2JTE A;  4J6X A;  5DLQ E;  2QTV A;  1ZUY A;  3FJP A;  2KRM A;  1HK9 A;  3VKI A;  3BFM A;  4OGE A;  2QQB A;  2VXE A;  5GAN 7;  3OYN A;  1VQ5 Q;  1BBZ A;  3I56 T;  3WVD B;  2EQJ A;  1U3O A;  2PNI A;  5CR2 A;  1S72 A;  4A63 B;  1NLP C;  3AHU A;  1M1K C;  2LQW A;  2ENM A;  5LJ3 j;  3JCM P;  1I4K 1;  2F2V A;  3QKJ A;  1RAI B;  4FW1 A;  4IUV A;  4AMC A;  4PJO C;  1Y96 A;  1AWX A;  4Z02 A;  1D09 B;  2XID A;  2DXB A;  2HBW A;  3H0F A;  2ZPH B;  3TSZ A;  3OYF A;  3OYA A;  3RKW A;  2KYB A;  3A8O B;  2ZCF B;  3A8M B;  1C1A A;  4BY6 C;  3UPU A;  1E6H A;  2O9S A;  1VQK A;  4A4H A;  1ZA2 B;  3LGL A;  3NGP A;  3M0Q A;  2LZ6 B;  4XU1 A;  4PLI A;  1D0Y A;  1WHL A;  3VYG A;  1N8R U;  3MP6 A;  4N0A A;  1PCX A;  5ECA A;  3M0U A;  1TS9 A;  5FWC A;  2COW A;  2DL7 A;  3TRE A;  1AOJ A;  4NOY A;  2ED1 A;  4II1 A;  1R0C B;  4UC4 A;  2EYX A;  2RI5 A;  2CZ7 B;  2L5Q A;  4WF2 A;  1VQP Q;  4GLM A;  2C0I A;  3PE0 A;  3WVE B;  2YDL A;  1VYU A;  2COY A;  2YRV A;  2HQX A;  2XMF A;  3JV3 A;  1X2K A;  3QSU A;  2HSP A;  4D8K A;  4L59 A;  1PNJ A;  1UEC A;  1G8X A;  5I21 A;  4HCC A;  4M77 E;  1OU9 A;  3JAM E;  3LH0 A;  4LD6 A;  5HK3 A;  1NPP A;  1BIB A;  3CPF A;  4HVU A;  1NPR A;  2L3P A;  2MYS A;  1NEG A;  1M2O A;  1WJS A;  4BB7 A;  3G4S A;  2LP5 A;  4M75 F;  1VQ9 T;  2DEQ A;  2DYI A;  3CD6 A;  1WA7 A;  3EFR A;  3V8L A;  1YJW Q;  1SRL A;  1WZO A;  5GMK i;  4DEX A;  1RAB B;  3ER0 A;  4AFZ C;  2LMJ A;  2OTL A;  1SPK A;  1IZ6 A;  2QAS A;  1PSF A;  3CCQ T;  1HYO A;  3HFO A;  3N5B B;  2LCS A;  1G3W A;  5C6S A;  3GNG A;  5D6X A;  4HCB A;  1Q81 U;  3RUX A;  1KC8 R;  3CME Q;  3JRZ A;  4M78 C;  3CC7 T;  3L2U A;  2BZY A;  2CP5 A;  2RH2 A;  2G6F X;  1BCO A;  1D1B A;  2EVR A;  3FJ5 A;  1QP3 A;  2QDL A;  5LJ3 g;  3ZL7 C;  3OS2 A;  3CCS Q;  3UT1 A;  4LDV A;  4ZN1 A;  2PZ1 A;  3GOX A;  3VUZ A;  5FLX E;  3CCM A;  1GFC A;  2NLU A; 
#chains in the Genus database with same CATH homology
 2EBP A;  1S1N A;  1WDX A;  2J05 A;  2YUP A;  2OI3 A;  3EG1 A;  1ZLM A;  2CH4 A;  1OV3 A;  1I1J A;  2F2W A;  2LJ0 A;  2FG0 A;  1UG1 A;  1K4U S;  3TVT A;  1WXU A;  2J6F A;  1GCP A;  1K1Z A;  2AZV A;  3PVL A;  4RTY A;  1MV0 B;  2BTT A;  5HCK A;  4J9F A;  1QCF A;  2KNB B;  4OMQ A;  1AEY A;  4E6R A;  4GBQ A;  2O2O A;  2D8J A;  2YT6 A;  3EG2 A;  2JM9 A;  3EG3 A;  2RF0 A;  3SEM A;  2DF6 A;  4CC7 A;  2ESW A;  2ECZ A;  2A37 A;  1Z9Z A;  1H92 A;  3LH5 A;  2JXB A;  2X3W D;  1NYF A;  5IXF A;  1UTI A;  2DYB A;  1RUW A;  2F2X A;  1PKS A;  1TUD A;  2EGA A;  4RUG A;  2LX7 A;  1IO6 A;  1M3A A;  5FW9 A;  2KT1 A;  1YCS B;  2DA9 A;  1K9A A;  3VS4 A;  3CQT A;  4RTZ A;  1HSQ A;  1QLY A;  3REA B;  2L2P A;  1B3Q A;  2FEI A;  2I0N A;  4Z8A A;  4FSS A;  5IXB A;  2JW4 A;  4R0K A;  3EG0 A;  4LE9 A;  3VS6 A;  2V1Q A;  4Z88 A;  1WIE A;  1Y0M A;  4M4Z A;  3M0R A;  1OPK A;  2IIM A;  1YP5 A;  1T0H A;  1SHF A;  1AWO A;  2BZ8 A;  2DNU A;  2KXC A;  4JJB A;  1VYT A;  2JT4 A;  1K76 A;  2KRN A;  2PTK A;  1NLO C;  3NPF A;  2C0O A;  4J9E A;  1JU5 C;  1OPL A;  2HCK A;  1X6G A;  3M0P A;  4KRT A;  5IHN A;  2LNH B;  1N5Z A;  1PRM C;  4OML A;  3O5Z A;  2RQT A;  2DE0 X;  1WYX A;  4CC2 A;  2A36 A;  2KBT A;  1LCK A;  1A0N B;  2RQW A;  1M3C A;  5IHK A;  1AD5 A;  1ABO A;  2CT3 A;  4AFQ C;  2RNA A;  2RN8 A;  3EGU A;  1XOV A;  1ZUK A;  1X43 A;  4DEY A;  1V1C A;  2RPN A;  1NYG A;  1UDL A;  3NMZ C;  1M30 A;  2KEA A;  1FYN A;  2JMC A;  2W10 A;  2DRK A;  2JM8 A;  1SHG A;  2FPD A;  2AKL A;  4RTV A;  5EC7 A;  2RMO A;  2V1R A;  1W6X A;  1M3B A;  4X1V A;  1SSH A;  2DVJ A;  2D0N A;  4AG2 C;  2L3Q A;  2RQU A;  2EGE A;  2CDT A;  1UHC A;  4HVV A;  2J6K A;  4J9D A;  2M51 A;  3VS7 A;  2GNC A;  5IHI A;  1YWO A;  3EHR A;  4CC4 B;  3RNJ A;  2K9G A;  2MCN A;  1EFN A;  1H8K A;  2D1X A;  5L23 A;  3TSW A;  2YUQ A;  2B86 A;  1X2Q A;  1WI7 A;  4F17 A;  2VKN A;  1E7O A;  4JPB W;  2GTJ A;  2KXD A;  1FMK A;  1M27 C;  2CH4 W;  1UHF A;  2EKH A;  5I11 A;  2ROT A;  4RTU A;  2FPF A;  4IIO A;  1ZSG A;  1W1F A;  2AK5 A;  2DRM A;  2K2M A;  3VS2 A;  4RTT A;  4J9H A;  1HD3 A;  1I0C A;  1VA7 A;  4J9G A;  2P4R A;  2ROL A;  2DJQ A;  2DBK A;  3I35 A;  1QKX A;  1RLQ C;  4J9C A;  2EQI A;  1KJW A;  4QT7 A;  2RQV A;  4AFU C;  1NEB A;  3H41 A;  1HJD A;  1KFZ A;  2FRW A;  2DLP A;  3ULR B;  2KRS A;  2YSQ A;  1T0J A;  2O9V A;  2DX1 A;  1BK2 A;  1GL5 A;  1UJY A;  2AZS A;  1RLP C;  2K6D A;  3I9Q A;  1YNZ A;  3UA6 A;  2BZX A;  1K0S A;  2X3X D;  1QKW A;  1AZG B;  2GTO A;  1UJ0 A;  4JJD A;  4HVW A;  3UA7 A;  1NG2 A;  4RTX A;  1Z9Q A;  1OOT A;  3M0T A;  4LUD A;  4J9I A;  1GBQ A;  2DBM A;  1PHT A;  1Y57 A;  1M8M A;  2O88 A;  1G83 A;  3C0C A;  1BB9 A;  1WLP B;  1QWF A;  3UF4 A;  1CKB A;  3QWX X;  1T3S A;  1YWP A;  4OMM A;  3UAT A;  4LNP A;  2LQN A;  4HXJ A;  1GCQ C;  2RQR A;  1K0X A;  3U23 A;  1UFF A;  2KRO A;  2OJ2 A;  2L0A A;  4K11 A;  1RI9 A;  4WCI A;  2KGT A;  1CKA A;  2JS2 A;  4LN2 A;  1SRM A;  3M0S A;  1QWE A;  1UE9 A;  2JS0 A;  1U06 A;  4HCK A;  4EIK A;  4F14 A;  2DIL A;  1MUZ A;  3QWY A;  5GJV B;  1G2B A;  2KT8 A;  1PKT A;  4LUE A;  2JTE A;  2EYY A;  2LJ3 A;  1ZUY A;  2KRM A;  4OMN A;  3REB B;  2EW3 A;  3H0I A;  1GFD A;  1BBZ A;  1E6G A;  5FWB A;  2E5K A;  1BU1 A;  2J06 A;  1U3O A;  2PNI A;  5GJW B;  4A63 B;  1AZE A;  1JEG A;  1NLP C;  3VS0 A;  2LQW A;  2DL3 A;  2ENM A;  2F2V A;  2W0Z A;  3H0H A;  1YN8 A;  3SHW A;  1AWX A;  1J3T A;  1ZUU A;  1ZBJ A;  2KYM A;  2SEM A;  1PWT A;  3R6N A;  2HBW A;  3H0F A;  4RTW A;  3TSZ A;  1GCQ A;  1WXB A;  3GBQ A;  2KE9 A;  2KYB A;  2ABL A;  4ZNX A;  3RBB B;  5I22 A;  2EYZ A;  2D8H A;  1UGV A;  2HEQ A;  4JZ3 A;  2HDA A;  5IH2 A;  1E6H A;  4IIM A;  2O9S A;  1MV3 A;  4ESR A;  3NGP A;  4OMP A;  3M0Q A;  2EYW A;  2LZ6 B;  3A98 A;  2DL8 A;  2FRY A;  2J6O A;  1W70 A;  1WXT A;  2CRE A;  2CUB A;  3VRZ A;  1WFW A;  5ECA A;  3VRY A;  1JXO A;  1T3L A;  2YUN A;  3M0U A;  5FWC A;  1ABQ A;  4F16 A;  2DL7 A;  1AOJ A;  2ED1 A;  3I5S A;  3PVQ A;  4ORZ A;  2EYX A;  1JO8 A;  2CT4 A;  3KFV A;  4GLM A;  2C0I A;  1AWW A;  1X27 A;  2YUO A;  3PE0 A;  1JXM A;  2VWF A;  1VYU A;  2YDL A;  4J9B A;  1TUC A;  2DL4 A;  1X6B A;  1I07 A;  2XMF A;  3JV3 A;  4Y92 A;  2DM1 A;  1X2K A;  2NWM A;  2HSP A;  4D8K A;  1ZX6 A;  1PNJ A;  2CUD A;  1UEC A;  2FO0 A;  3NHN A;  2OAW A;  2J7I A;  4AFS C;  3VS3 A;  2CSI A;  2SRC A;  3EHQ A;  1UUE A;  2NUZ A;  2MOX A;  2GGR A;  4HVU A;  1KSW A;  2C0T A;  4D8D A;  2O31 A;  2L3P A;  2K7A A;  3IQL A;  1NEG A;  1ARK A;  1NM7 A;  2GBQ A;  3VS5 A;  1KIK A;  1B07 A;  2LP5 A;  4JZ4 A;  4Z89 A;  2K3B A;  1PRL C;  1WA7 A;  4OMO A;  3VS1 A;  1GRI A;  2MIO A;  3I5R A;  2M0Y A;  1SRL A;  1JQQ A;  4DEX A;  1H3H A;  4AFZ C;  4CC3 A;  1TG0 A;  2K79 A;  2LMJ A;  1SPK A;  1AVZ C;  2VVK A;  1U5S A;  1GBR A;  1X69 A;  2LCS A;  2A08 A;  1WX6 A;  2H8H A;  1AWJ A;  2DMO A;  2ED0 A;  4JJC A;  2GQI A;  2DL5 A;  2FPE A;  1OEB A;  2BZY A;  2LJ1 A;  2G6F X;  2L3S A;  2EVR A;  3FJ5 A;  1VYV A;  2JMA A;  2QDL A;  1SEM A;  3ZL7 C;  2EPD A;  2KR3 A;  3THK A;  2PZ1 A;  4AG1 C;  2AKK A;  1CSK A;  2A28 A;  1GFC A;  2EGC A;  2CSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...