1VA7A

Yeast myo3 sh3 domain, triclinic crystal form
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
DPKFEAAYDFPGSGSSSELPLKKGDIVFISRDEPSGWSLAKLLDGSKEGWVPTAYMTPYKDTRNTVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin-3 isoform
publication title High-throughput structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 12
structure length 68
sequence length 68
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1va7A01
2G6FX 2NUZA 2AZSA 1WXBA 3SHWA 3CQTA 4JPBW 4OMNA 4RTTA 1E6GA 1UTIA 4JZ3A 2YUQA 2KT1A 2O31A 3UATA 1N5ZA 1BBZA 3PE0A 4X1VA 2DYBA 3VS5A 1I0CA 1WLPB 1VA7A 2D8HA 1ZUYA 1WA7A 4LNPA 3VS6A 1G2BA 1CSKA 4CC4B 2L0AA 1U3OA 4LUDA 2JTEA 3REAB 1QKXA 2OAWA 2LJ1A 1NEBA 1FMKA 1SRLA 4HCKA 2W10A 2CDTA 2RF0A 2EKHA 4RTUA 1SEMA 3VS2A 2MCNA 2YT6A 2VVKA 1X2KA 2O9VA 1HJDA 1U06A 1K0XA 1JQQA 1UECA 4Z88A 2YDLA 1Z9QA 4IIOA 4AG1C 2C0IA 1TUDA 1SHGA 2KR3A 2DL8A 2L3SA 2EQIA 2KT8A 1CKAA 2LX7A 1AEYA 1WIEA 2KXCA 2ESWA 2GTJA 2EPDA 2J6KA 1JXMA 1T0HA 2JXBA 1MV0B 1B3QA 2CT3A 2SRCA 1RLPC 2KEAA 3SEMA 4Z89A 4AFZC 1W1FA 2DA9A 2X3WD 2K6DA 2LCSA 2BTTA 1AOJA 4LE9A 1XOVA 4CC2A 5GJWB 4HVUA 2AKLA 2SEMA 1AWXA 5GJVB 1BB9A 3GBQA 1GFCA 1NYFA 4AFQC 1JU5C 2RQUA 1PKSA 1J3TA 4LN2A 1QKWA 3M0SA 2K7AA 1H92A 1EFNA 5FWCA 1MV3A 4A63B 2GGRA 1GBRA 4GBQA 4K11A 4D8DA 2CH4A 2O88A 4J9GA 1RI9A 2GQIA 1WFWA 1E7OA 1UGVA 4J9IA 3RNJA 1NLOC 4OMMA 1TUCA 2EGEA 2DX1A 3H41A 2FPDA 2BZ8A 5IXFA 1M30A 1AWJA 1WI7A 1KJWA 5IHIA 2F2WA 1YCSB 3UA6A 2DM1A 3TSWA 1B07A 2M51A 3UF4A 2IIMA 2AKKA 3M0QA 3RBBB 3THKA 4WCIA 2EYZA 4AG2C 2O2OA 1YN8A 3VS7A 2LQWA 2FRYA 2ABLA 1AWOA 1JO8A 2JT4A 1A0NB 3QWYA 3REBB 2KGTA 1K1ZA 2EGCA 4OMOA 3NGPA 1PRLC 2DL7A 3NHNA 2KRMA 2GTOA 1OEBA 3I5SA 1GRIA 1RUWA 2OI3A 5EC7A 1Z9ZA 3TSZA 1NM7A 2EBPA 2AK5A 5IXBA 2KYMA 2DJQA 2YSQA 1WDXA 5ECAA 1WXTA 5IHNA 1GFDA 4DEXA 1M27C 2EYXA 1Y57A 1UFFA 2EYYA 4KRTA 2DILA 2O9SA 1M3AA 2CUBA 4JZ4A 1GCQC 2CT4A 4RTZA 2XMFA 2JS0A 2BZXA 1I1JA 1NEGA 1W6XA 3KFVA 1SHFA 2QDLA 2PNIA 3H0HA 3I35A 4RTYA 4J9CA 4DEYA 1VYUA 1SRMA 3VS0A 1KSWA 3VS4A 1Y0MA 2FEIA 4CC7A 3EHRA 2EGAA 2K3BA 2GBQA 2C0TA 2FPEA 1YWPA 1V1CA 2RMOA 3VRYA 1X2QA 2H8HA 2YUPA 1X43A 1AZEA 3PVQA 2F2VA 2CUDA 2ROTA 5IH2A 1BK2A 2KXDA 4JJDA 5IHKA 1ABQA 1ZLMA 2B86A 2DL4A 2ECZA 2HCKA 2EVRA 2HSPA 4J9DA 3H0IA 1NLPC 2C0OA 1VYVA 4F16A 4J9HA 2GNCA 1ZUKA 2LP5A 2KROA 1HD3A 1JEGA 1U5SA 1UDLA 1H8KA 2VWFA 1MUZA 2L3QA 2FPFA 2LZ6B 2BZYA 2HDAA 3EG1A 2AZVA 2JMCA 2LJ0A 1JXOA 5I22A 2JW4A 1H3HA 2FRWA 2YUOA 1K9AA 2J6OA 2A37A 1T3LA 2J7IA 1X69A 1K0SA 2JM9A 4M4ZA 4ORZA 3M0UA 3UA7A 2D1XA 1E6HA 1ZBJA 2CH4W 1GCPA 3R6NA 4AFUC 1UJ0A 2DRKA 1YP5A 4HVWA 2JS2A 2ED1A 2W0ZA 1OPKA 4GLMA 3I9QA 1ZSGA 1ARKA 1X6GA 4OMLA 1KFZA 1BU1A 1FYNA 1ZUUA 1QLYA 1OPLA 1AD5A 4RUGA 1PKTA 2K9GA 3I5RA 1G83A 2KRSA 2DRMA 5FWBA 1ZX6A 1AWWA 2CREA 1W70A 2DL3A 2DE0X 2HBWA 4OMQA 1K4US 1LCKA 4RTWA 1UHCA 4ESRA 3C0CA 4OMPA 2D8JA 2J06A 2JM8A 3QWXX 1RLQC 2VKNA 2RQTA 3EG2A 1X27A 4J9FA 1HSQA 1UUEA 3NPFA 2PZ1A 1UE9A 1YWOA 4F17A 1PWTA 3VS1A 4Z8AA 2KYBA 2I0NA 2KRNA 2L3PA 2ED0A 2DVJA 1QCFA 4QT7A 2PTKA 3LH5A 2ENMA 3TVTA 1UHFA 3A98A 2RNAA 3ZL7C 1GBQA 1SSHA 3O5ZA 1I07A 2RQRA 1OV3A 3M0TA 3PVLA 2LMJA 1X6BA 2LNHB 4R0KA 4EIKA 3EG0A 1AZGB 1PRMC 2EW3A 4CC3A 1TG0A 1IO6A 4J9EA 2DBKA 4Y92A 2ROLA 2KBTA 2YUNA 4JJCA 1T0JA 1WYXA 2V1RA 1VYTA 4HXJA 4JJBA 4AFSC 4ZNXA 2OJ2A 1SPKA 4D8KA 4J9BA 1YNZA 2E5KA 4IIMA 1QWFA 3NMZC 2RN8A 1CKBA 1M3BA 1NG2A 2K79A 2P4RA 2CSIA 3U23A 5I11A 3JV3A 4FSSA 1ABOA 2MOXA 2DBMA 2KNBB 2M0YA 1PHTA 1T3SA 1OOTA 1NYGA 2RQVA 1PNJA 2RPNA 3FJ5A 4HVVA 4F14A 2KE9A 1KIKA 2FO0A 5L23A 2A28A 4LUEA 2F2XA 2JMAA 2J05A 2A08A 1S1NA 1AVZC 2MIOA 2LQNA 4RTVA 3H0FA 2RQWA 3ULRB 3EG3A 2EYWA 2DF6A 3VRZA 2J6FA 2V1QA 2L2PA 2X3XD 1M3CA 1K76A 3VS3A 1M8MA 2LJ3A 1QWEA 2NWMA 2DL5A 1WX6A 1GCQA 2A36A 4RTXA 2K2MA 2DNUA 1WXUA 3EHQA 3EGUA 3M0RA 5FW9A 1UG1A 1UJYA 2CSQA 5HCKA 2D0NA 2DLPA 2HEQA 2FG0A 3M0PA 2DMOA 4E6RA 3IQLA 1GL5A
chains in the Genus database with same CATH superfamily
1WXBA 2XDDA 5CKDA 3FB9A 5HY6A 2OTJA 2OTJT 2QAZA 5KYUB 2EKOA 2ZCFB 3FC3A 1N5ZA 4Q5WA 1D3BA 1WHGA 1YJNQ 4C8QF 3HRTA 3EH1A 4X1VA 3VS5A 1I0CA 2CP6A 1WA7A 4X9CA 1CSKA 4CC4B 4HT9A 1D09B 4ME7A 4A4KA 5KYUA 3VYGA 3REAB 1WQ7A 3QSUA 1Q7YR 2EFIA 1M90R 2DK3A 1NEBA 2JN0A 2W10A 3JCMP 4KH0B 2EKHA 1SEMA 3VS2A 2O9VA 4CI0C 2A7YA 1HJDA 1QVFS 1K0XA 3MEWA 3J7AF 1WHLA 4Z88A 3H9NA 3GIBA 2C0IA 3QZ9B 2LCCA 1O75A 2DD5A 2KR3A 3OMGA 2M9UA 3HHTB 4KGZB 3JCMh 3JB9G 1I4K1 3QXEB 2KT8A 1CKAA 3RMSA 4BDZA 2BE7D 2M02A 1R8OB 3JCMQ 4XQ3A 2JXBA 2DVEA 2DZCA 2K2VA 3GF5A 4M7AE 4PJOG 2SRCA 1RLPC 3HRSA 3RKYA 1N8RC 2RHYA 4DBRA 2LCSA 5KYXB 5KYWB 3F70A 3CCSA 3CCST 4LE9A 2D0QB 4CC2A 5GJWB 1MMAA 2AKLA 1AWXA 3GBQA 1VOMA 4C0DC 3L2QA 4ELYC 2RQUA 3TQ7P 2CP3A 3CPWP 4LN2A 2QA4T 2QA4A 1D1CA 2H3EB 5CIUA 3VV0A 5KYNA 4A63B 4BY6C 3CCMQ 3MJXA 4XTXA 4K11A 2QI2A 3MEUA 2GQIA 4M78A 3EGXA 2BKDN 3MP1A 2VB6A 2CYZB 1TUCA 3H41A 1PSEA 2BZ8A 1M30A 2YRCA 3M4YA 4DOWA 1JBMA 4JRIA 4M7DB 1KG1A 2RJFA 5IHIA 2L8DA 2F2WA 3G4ST 4PKCC 1WHMA 1LVKA 1QVFA 1OX9A 2IIMA 4N0AA 3M0QA 1VQ9A 3G6EQ 1VQ9T 5GANj 4MZMA 4WCIA 2O2OA 1YN8A 4CRIA 2RHXA 5J26A 1VQ5Q 2EJFA 3DB3A 3CC7Q 2KGTA 2DD4A 1NJIU 2EGCA 3CCLQ 5CVIA 2R57A 5GMKi 3JB9F 3HL8A 1PRLC 4QQGA 1Q82U 3JCMf 4OB2B 4MDXA 1OEBA 3BY7A 1GRIA 4L6V5 1TXQA 4C8QE 1EZZB 1PG5B 2OI3A 3OBWA 1Z9ZA 3TSZA 3C12A 2HZYA 4C5GA 2VC8A 2YSQA 5IHNA 4J6YA 1VQNQ 2EQKA 1M27C 3OYLA 1UFFA 3OYEA 3DLMA 1IRXA 4KRTA 4WTOB 2OTJQ 2DXUA 1I8FA 1KQSP 2DILA 2XG8D 1M3AA 3X20B 1GCQC 2CT4A 3ZEHA 1KD1C 1KHCA 3GOXA 3JCMb 1BIBA 1B34B 5KE2A 3SFMA 3HKSA 1VIEA 4PJOA 4EPCA 4J9CA 4DEYA 1XNIA 2PUKB 2G3RA 1TH7A 3VS0A 4RMOA 2IVWA 4O6JA 2EGAA 1V1CA 1NPPA 1SF9A 1X43A 4EMHA 4M75C 3PVQA 1G3YA 3A8HB 3L2ZA 2KXDA 4C0FA 1Q7YC 1NZ9A 5IHKA 2C06A 4BE0A 2XKOC 3LWHA 5CO7A 3BE3A 4F7UG 2HCKA 2KQWA 4QKUA 4J9DA 2RA2A 3CXCP 2DFUA 1VQ8A 1VQ8T 4F16A 5M9OA 4X9DA 2KROA 5LJ5e 2NUPA 4XAXB 1JEGA 1UDLA 3S6WA 3LWIA 1JJ2S 1VQ6T 1VQ6A 3CCSQ 4J8OA 2AZVA 4FSXA 2EQMA 1F1BB 3UWNA 2KY9A 4HKEA 2HSEB 1K9AA 2D6FA 1N9RA 2J6OA 3LYIA 1OI1A 3QYGB 2QA4Q 4M77D 1K0SA 2FVUA 3M0UA 3UA7A 5A0DA 1U1TA 1ZBJA 5DM7R 3OYMA 4HVWA 2JS2A 5CR2A 3RUXA 2W0ZA 3RKXA 5GAMf 4EMKC 2MYSA 3I9QA 3P8DA 1ZSGA 2QXFA 4PNOA 2EQUA 1N9SA 4M7AC 1ZUUA 1X75C 4YTLA 1QLYA 2R5AA 1AD5A 4BE2A 3I5RA 3G4SQ 3CCRA 2F69A 2PU9B 2QQBA 2QTXA 2DE0X 2VYTA 2RJCA 1LCKA 1QVGS 1K73U 5CKBA 4OMPA 2JM8A 4JUVA 4BI8B 3CCEQ 1VIFA 2FZGB 2FB7A 3EG2A 1M1KU 3OYIA 4MMKA 3NPFA 1YWOA 4FU6A 3VS1A 2VUBA 2X51A 4F7UF 1RABB 2KYBA 2KRNA 4TVRA 1QVPA 2HQEA 3SWNB 1JJ2A 1V76A 1M2VB 2ENMA 3GNFB 3TVTA 1V29B 3MP8A 1YBYA 4QVCA 1I07A 2Z0WA 2RQRA 3CC4A 3CC4T 1P92A 3M0TA 3PVLA 5LJ3e 2LNHB 4KBMB 3OW2P 1AZGB 2RHUA 4JRPA 2ROLA 1R0BG 2KBTA 4J6XA 1T0JA 4PFOA 4PJNA 3PNWC 1W4SA 1YCYA 2JOYA 4D8KA 1Y07A 2WSEE 5FU7B 3S3NA 1QWFA 1RL2A 2JVVA 3U23A 2YHTA 2CSIA 2XD0A 3JV3A 2P0PA 2KNBB 4C8QC 1T3SA 3HPWA 1OOTA 5CAIA 2KSSA 3FJ5A 4MZPA 4OB0B 3V7CA 1QVGA 2FO0A 1Y96B 4OMFB 3EAEA 2A28A 3NFCA 1N8RU 4LUEA 3OYFA 1VQOQ 2JMAA 1YHQA 1YHQT 5KCOA 2HL3A 2L3RA 4GY5A 2LQNA 3H0FA 1SSFA 2M1HA 1NJIC 3ULRB 2KAFA 3EG3A 4M7AG 2V8KA 2HQHA 3LLRA 4A4EA 2E3IA 3RKWA 4BD3A 1Q82C 3JCMe 1M3CA 3JSCA 3JB9H 1IGUA 1UGRB 4XTUA 3JCMV 1GCQA 2RK2A 4RTXA 4C5EA 4JRKA 1X6OA 4JLGA 4OVAA 1U1SA 2HEQA 3X24B 3M0PA 3X28B 2E12A 2QASA 1G3WA 2EJ9A 5GMKj 3MEAA 3O8VA 1RAFB 1E6GA 4JZ3A 1FXXA 1C1AA 4M78D 5GAN3 3ZFJA 2CKKA 2CP2A 4M75A 5HK3A 4ATOA 4XU1A 1Q81U 2DYBA 2MK5A 3TEEA 1WLPB 1VQ4Q 4LNPA 5LJ5h 3X25B 2MI6A 1U3OA 1K9MR 2LCLA 2JTEA 2YXYA 4A54A 1QKXA 2OAWA 3FJPA 2LJ1A 4NL3A 1IB8A 1YITA 1YITT 4N4GA 1SRLA 3G1JA 5IN1A 1VQMA 1TUGB 3LGLA 4M77B 1KC8U 1C6VX 1UGQB 2XICA 1FWZA 4DBQA 2DTOA 1UEBA 4JLIA 3QJYA 3CC2T 3EG9B 4NOYA 1YJWA 1YJWT 3TU4K 3G71T 4DBFA 4MZTA 5FU6B 2MAMA 2EQJA 4C8QG 4BI3A 4MDWA 2CP5A 2P0QA 2ESWA 2EPDA 1B3QA 2CT3A 3EG9A 5CQYA 3SEMA 2HBPA 4XTWA 1D1AA 4Z89A 1W1FA 2X3WD 4XTYA 4FCYA 1AOJA 2EIFA 4LD9K 2M0OA 4EMKA 4HVUA 2EWNA 4C92F 1MNEA 4M7AA 4J5YA 4FW1A 2ZPFB 2JTMA 3L2UA 1EFNA 5FWCA 3TREA 1MV3A 5GAMe 2QG9B 4PJOD 1RI9A 4FIBA 3QYHB 3EGDB 1IGQA 3JRZA 1M90U 4OMMA 3HFNA 2EGEA 2DX1A 5FRMA 2COZA 4XU0A 5C0MA 2JZ2A 5LJ5f 1KJWA 1K73C 4XK8E 8AT1B 5CKEA 2E4HA 1TTHB 1YJ9T 3TSWA 4PFZA 2KK4A 1B07A 2QQRA 1M1KC 1G3SA 3RBBB 5LJ3h 3P8BB 2EYZA 1D3BB 3PFSA 4AG2C 2DKGA 1QW1A 7AT1B 2FL7A 2HKQB 1QP3A 3LW5E 4A4GA 2ABLA 1AWOA 4EMGA 1JO8A 2JT4A 2K5LA 1WJQA 4OGCA 5DLOA 3DB4A 4PFPA 2XIDA 4OMOA 3NGPA 2E3HA 2DYIA 3LGFA 2LTOA 2DEQA 2KRMA 3I5SA 1M1FA 2MWOA 4B6MA 3HRUA 3QZ5B 2A0FB 1ZSZC 1S72T 1S72A 5GMKl 2BUDA 5IXBA 1WXTA 4KGXB 1BIAA 2VXFA 2DXCA 3MCAB 4Z02A 2RHZA 4NS5A 4NL2A 1RAEB 2O9SA 4JZ4A 2HD0A 4RTZA 4C8QA 2XMFA 2BZXA 1I1JA 2JS0A 3KFVA 2QDLA 3H0HA 2AT1B 3I35A 4RTYA 1XJWB 3A1PA 1SRMA 5GANe 3J80E 5DLQE 1MGQA 4E7HA 5I2MA 1DJ7B 3MP6A 4CC7A 4JDSA 2K3BA 2C0TA 3DKMA 1ACMB 1BI0A 3M53A 5IH2A 1W2BP 3CC2Q 1K9MC 3VU3C 4JJDA 5HK0A 1I81A 4M78B 2RHIA 5FROA 1YJWQ 3G71Q 3EGXB 3H0IA 5LJ3f 1R0CB 4J9HA 4R55A 4C92E 4VUBA 3OYDA 2VWFA 2COWA 1BI2A 2QGFB 1MHNA 2RI5A 3EG1A 2MPXC 1JXOA 4PJMA 5I22A 3C95A 1H3HA 1WGSA 2NUTB 2YUOA 3C4SA 2CGHA 5GAN8 4IUUA 2DJZA 2D1XA 4M7DF 2EJGA 1E6HA 1YI2A 1RACB 1Q81C 2CH4W 1GCPA 3M58A 5DY9A 2NUTA 2B8AA 5IAYA 1G8XA 4L5GA 4Y91A 2RH2A 4KUIA 2BE9B 2H3JA 4OMLA 2X4YA 1PD0A 2KI7A 3MEVA 1KC8C 2LQKA 2OX7A 3CCUA 3CCUT 1OPLA 3A8MB 1PKTA 1YJ9Q 2DRMA 3JB9I 4LDYA 3AT1B 1RADB 1W70A 4DBHA 2K5FA 2CZ1B 3MHXA 4ESRA 3QWXX 3VYHB 1RLQC 1VUBA 2VKNA 1QP2A 4PJOB 2MWPA 5CK9A 1UUEA 1PD1A 5A0LA 1WZOA 5GAOn 1PWTA 3E9FA 5J39A 4Z8AA 1D0XA 5GAMh 2L3PA 4AT1B 1N27A 1QCFA 2P0KA 3OYNA 2PTKA 5KYYA 2EAYA 2NLUA 1S72Q 3E2UA 2X35A 1GBQA 3O5ZA 1Y71A 3OY9A 3QJ6A 4KULA 2LMJA 1X6BA 2DZ9A 4CC3A 4KGVB 2LRQA 2YWWA 2DBKA 4J9EA 4Y92A 2YUNA 5AYFA 2QQSA 2DXBA 2NUPB 2YRDA 4M75D 4DOVA 1M90C 3JCMW 4ZTFA 1G5VA 5D6XA 2DO3A 4FT2A 4J9BA 2PQWA 1YFNA 2YLCA 3L2VA 3NMZC 1OULA 4HCCA 2RN8A 1NG2A 2K79A 2P4RA 4O5VA 3OB9A 1ABOA 4M78E 2MOXA 2M0YA 4E7KA 2VXEA 1LOJA 2R58A 3M59A 4F14A 1SKUB 2LX9A 5L23A 4XU2A 2F2XA 2GFUA 2J05A 2KMTA 3CBOA 2CS7A 5CCAA 4BB7A 5IT9E 3T9NA 1ZSZA 2DF6A 4RG2A 1QVFP 2V1QA 5KCHA 2L2PA 1RAIB 3V8LA 3META 4M7DE 2RB6A 5LL6S 2RJDA 3H8ZA 3OS2A 2LJ3A 1QWEA 3UPUA 2LQ8A 2DL5A 5GANh 1VQKA 1VQKT 4PK4A 3EGUA 4Y28E 1MNDA 5FRNA 2D0NA 1K8AR 2P84A 3CCRT 4J6WA 4M7AD 1VQ9Q 2HNIA 5GAOr 3CQTA 2LDMA 3OS5A 5FLXE 4JPBW 2VV5A 4RTTA 1UTIA 1YIJT 1YIJA 4JS4A 4C0DB 1IHWA 2O31A 3UATA 2E70A 3JB9J 3QG1A 2PVGB 4C92C 4BY6B 2Y4XA 3GLXA 4RG8A 1ZUYA 1G2BA 5AT1B 3CCUQ 3AHUA 4IUPA 3JAME 1SG5A 3G7ZA 5C6SA 2K3XA 4HCKA 1M9SA 2K5IA 3FEOA 2YT6A 2IPOB 1X2KA 1I5LA 1U06A 2DIGA 3BDUA 1JQQA 4LXCA 3PTAA 1Z9QA 4F7UA 4IIOA 4AG1C 3FRNA 1U8RA 3RESA 3CCQA 3CCQT 3GP8A 1TUDA 5GAOm 2DL8A 2L3SA 5A0GA 2EQIA 3ER0A 2LX7A 1AEYA 1WIEA 2V8IA 1OX8A 3WXMB 2X9HA 2YLBA 5GMKe 1KQ2A 4LDVA 1M8VA 1RAHB 2BTTA 4J83A 3CCJA 2F5KA 5GANf 2JUFA 2SEMA 5GJVB 1BB9A 1GFCA 1NYFA 4AFQC 1JU5C 1PKSA 1J3TA 2OTLA 2WACA 2OTLT 1QKWA 3CCVA 1PCXA 4C8QD 3M0SA 3CMEA 2ZPHB 1H92A 2D9TA 2E65A 3CMAA 2GGRA 4GBQA 4D8DA 2CH4A 3SD4A 2O88A 1TOVA 1VQ8Q 1K9MU 5LJ5d 4QVZA 1WNLA 4ZTJA 3RNJA 1NLOC 2QDYB 1IREB 4E7IA 2FPDA 4PLLA 2FHDA 2F5TX 2ZPEB 5CQXA 3HP9A 4V2SA 4F04B 4E7ZA 1VQ7A 1VQ6Q 3PIOA 4XU3A 3CBMA 1X01A 2QEXA 3UA6A 2DM1A 3NTHA 4FYVB 2M51A 2AKKA 1IXDA 1WPYA 2RJEA 3THKA 4M75B 3L1AA 4C92G 5I21A 3VS7A 2LQWA 3PMTA 3OYGA 3TCJA 3D7SB 4C5IA 3L2RA 2PVOB 4A4FA 2E41A 1A0NB 1QCNA 2LC4A 3REBB 2LT1A 1K1ZA 4J7FA 2QEXQ 4JJNK 4E47A 2DL7A 1LPLA 1VQKQ 4P5NA 2FZKB 2GFAA 2GTOA 1WHKA 2ZGWA 1RUWA 5EC7A 4ZGDB 3CPWS 1NM7A 3V7RA 4PJJA 4BACA 3CCRQ 2KYMA 1WDXA 5ECAA 1GFDA 1JJ2P 2DTHA 1VQMT 3EH2A 3FDRA 1TU0B 4DQ2A 3MPUB 1FMWA 3M56A 3PT9A 4M77F 1W6XA 1K8AC 1SHFA 4JS5A 2PNIA 3CD6A 3CD6T 2HKNA 5GAOl 1I5OB 4N4IA 4M7DC 3BFMA 1BCOA 5GAOp 2IG0A 2FEIA 1C0MA 3EHRA 4ZGJB 4EMKB 2FPEA 1YWPA 2RMOA 3VRYA 1X2QA 1OU8A 2H8HA 1BYMA 4M7AB 1AZEA 4IUTA 2K57A 5LJ3d 3CC4Q 2F2VA 2ROTA 1BK2A 1JB0E 3RMQA 1M2OA 1QCOA 3S3OA 1ZLMA 3OBYA 3CCQQ 2B86A 2DL4A 2EVRA 2HSPA 3EFOA 1MMGA 3JB9D 1QVGP 1NLPC 3OYAA 2C0OA 2GNCA 1ZUKA 2O4XA 1HD3A 1W2BA 1U5SA 3JCMc 4FL6A 2FPFA 1OQKA 4PLIA 4HA8A 3M54A 1ZA1B 2AIRB 3CPWA 2FZCB 1D0ZA 2LNVA 3A8LB 4KUDK 1HXDA 3V8KA 2JW4A 2FRWA 1KQSS 2V8JA 4C92A 2A37A 3FLGA 1T3LA 2J7IA 1X69A 5LJ5g 2JM9A 4IUVA 4M4ZA 1M1GA 5GAN6 1PM3A 3EFRA 1YHQQ 2WSFE 3DLLA 4AFUC 4II1A 2XI9A 2DRKA 2E1HA 2V26A 1VQ5A 2LT4A 3CC7A 3JCMd 4M78G 1Q86U 4GLMA 1X6GA 1H3ZA 1KD1R 4M75E 4UC4A 2P4TA 3CBPA 2KRSA 5FWBA 5GMKh 1ZX6A 1NE8A 1VQNA 1VQNT 2CREA 2Y90A 3I56A 3I56T 2HBWA 3CXCS 3PIPA 4C8QB 1UB4A 4ELZC 1UHCA 3OSSC 2D8JA 3L2WA 2RQTA 1X27A 4X34A 1HSQA 4M7DG 2DIQA 1UE9A 4F17A 1MMDA 4OF1A 2I0NA 3JCMJ 3A8OB 4J7IA 2QTVA 5GAMj 1GXIE 3LH5A 3NTIA 4M77E 4LDXA 4LDWA 1ZBXA 3ZL7C 1KQSA 1FX7A 1YITQ 4L59A 2ZZDA 1OV3A 1Q86R 1VQMQ 4R0KA 3E1SA 3RDVA 1PRMC 2EW3A 1IO6A 2DTIA 3ME9A 1IHVA 3OS1A 4HXJA 4JJBA 3CD6Q 1KK7A 4B9XA 1BI1A 4AFSC 3V7SA 1SPKA 2CZ6B 1Y7XA 1YNZA 3HSBA 4M78F 2DETA 5LJ3g 4IIMA 1CKBA 1M3BA 2JTFA 2VASA 5I11A 1LJOA 2ZPGB 4FSSA 1NPRA 1BKBA 1WHJA 1PHTA 1NYGA 2RQVA 1PNJA 3CXCA 2XHCA 5D7UA 2KE9A 5KYXA 5KYWA 4MMLA 1AVZC 2MIOA 2ZAEA 4E2FB 3LX7A 4XTZA 2RQWA 5GAMd 2OAUA 5KH6A 2EYWA 3OMCA 3SWNC 5GAOq 1YI2T 3UT1A 1M8MA 2DAQA 2CZ0B 2EYQA 2NWMA 4QVDA 2A36A 3OW2S 3G4SA 2DNUA 1WXUA 2WSCE 1ZHIA 3EHQA 5FW9A 1UG1A 3KBGA 2FG0A 2DMOA 2F1LA 1GL5A 4M7DA 3FIFA 3CCEA 2G6FX 2YRVA 3CCET 2NUZA 2AZSA 2O01E 3CPFA 3JCMg 3SHWA 4OMNA 4QW2A 3OSVA 4ZN3A 4OGEA 2YUQA 2KT1A 5FU7C 1BBZA 5KYYB 3PE0A 3KXTA 3VJPA 1OYXA 1VQPA 2MMPA 1VQPT 1VA7A 2D8HA 4BDYA 1QQJA 4PJOF 3VS6A 2L0AA 4LUDA 2R5MA 4RCCA 3RERA 4E7SA 1FMKA 3MO8A 4D6WA 4KT0E 3I56Q 2CDTA 2RF0A 4RTUA 2MCNA 2VVKA 3E19A 4KH1B 1UECA 1D1BA 2YDLA 3HFOA 4FYYB 1EIFA 1SHGA 1OZ2A 2GF7A 6AT1B 3QPHA 2QQAA 1EX4A 4FM4B 2GTJA 2KXCA 1KHIA 1JXMA 2J6KA 1T0HA 5GANd 1MV0B 3I55A 3I55T 1B34A 3OW2A 3NTKA 2KEAA 1K8AU 1NJIR 4RKUE 4AFZC 2DA9A 1UGPB 1WJSA 2KDSA 2K6DA 2VGNA 3L42A 1O9SA 1Q82R 1XOVA 1WHHA 2CP0A 1WJRA 1HK9A 1VQOA 1VQOT 1ZSZB 1VQLA 1VQLT 3C94A 4B9WA 4GLKA 2XK0A 2GQVA 2K7AA 3QUIA 2E6ZA 3QBYA 3S3MA 1WQWA 1Q86C 1GBRA 4FYXB 2RI3A 4J9GA 1WFWA 3PGGA 1E7OA 1UGVA 2RI2A 4J9IA 5IXFA 3VUBA 1BI3A 1AWJA 4M77C 1WI7A 4FYWB 3Q1JA 5GAN4 3ASKA 2LVMA 2PVDB 2RD1A 3H6ZA 1YCSB 2XDBA 5GAMg 2QGGA 2COYA 3UF4A 5D6YA 4A53A 2ATCB 2QYZA 2DXTA 4WF2A 4HCBA 3SDZA 1OZ3A 4JRQA 5FU6C 2FRYA 1MMNA 5J3BA 1BCMA 1YI2Q 3QO3A 2X4XA 3RIRA 5KE3A 5A2QE 4A4HA 5CKFA 3QWYA 3QDFA 2Y4YA 4BUGA 4E7JA 1VQ4A 9ATCB 1VQ4T 2K3YA 4R56A 4LD6A 2E64A 2KVQG 2HMAA 1LNXA 3NHNA 3UDCA 2NYSA 2DEUA 3GPLA 2EBPA 4C92D 2AK5A 5LJ5j 3P8HA 2DJQA 4PJOE 4F7UB 4DEXA 2EYXA 1Y57A 2EYYA 2RK1A 4QQDA 2CUBA 3M4GA 1QMCA 4PL6A 4OB3B 1NEGA 3OQ5A 4M75G 2L89A 2GCXA 2RM4A 1VQPQ 5HKCA 1VYUA 3OYBA 4EDUA 1KSWA 3QHSA 3X26B 3VS4A 1Y0MA 3KUFA 4HT8A 3PMIA 2E5QA 2GBQA 1HYOA 3GNGA 3OYJA 3SWNA 3V8JA 2YUPA 2A3LA 1M2VA 1OU9A 3OA6A 4RCBA 3CCJT 2CUDA 4OB1B 1KQ1A 3M55A 3OYHA 4FT4A 3OYCA 1ABQA 5GANg 1K73R 2ECZA 4N4HA 3OS0A 3CCVT 4FW2A 4PJLA 1VYVA 1XTDA 4M77G 3CMET 3URGA 2LP5A 1M1KR 1PSFA 5D6WA 3CMAT 3I55Q 1Q95G 1H8KA 5GAN7 4IURA 1MUZA 1JRIA 2L3QA 2DPPB 2LZ6B 2BZYA 2HDAA 4XTVA 2JMCA 2LJ0A 2HL5C 5GAN2 5EG2A 3OYYA 1VQ7T 1VQLQ 1M4ZA 2BIVA 2QEXT 3WVDB 1B7TA 5I2SA 3SB2A 3QKJA 2XU8A 4BI4A 4ORZA 1TWBA 3E9GA 3A8GB 4IUQA 5CKHA 2CZ7B 3R6NA 1Y96A 1UJ0A 2ZPIB 2AHJB 2XDPA 1YP5A 2L5QA 2ED1A 5LJ3j 1YJNA 1YJNT 2I2LA 4M75F 1OPKA 3R6OA 2PUOB 3JCMX 4DA4A 1ARKA 1IZ6A 1KFZA 1BU1A 2HQXA 1FYNA 1UGSB 1AHJB 3CEYA 1W2BS 4RUGA 2K9GA 4E7LA 1G83A 5L8RE 4ANJA 1AWWA 2QQ9A 3BW1A 3ZBDA 3OYKA 4M78C 2DL3A 5GAN5 4OMQA 1K4US 1RI0A 4RTWA 3C0CA 2J06A 2E10A 2E6NA 4J9FA 1TSFA 1N8RR 2PZ1A 1YIJQ 1D0YA 3M5AA 2CP7A 2JJ9A 2X4WA 4AMCA 2HAXA 2ED0A 5GMKm 4N0AC 2DVJA 4F7UE 4QT7A 1RAGB 4ZN1A 4C0ZA 2MF2A 4C0GA 3QIIA 1UHFA 3A98A 2RNAA 1SSHA 2JNGA 2M16A 1NBEB 1PC0A 4M7DD 4HCZA 4BE1A 3N5BB 4EIKA 3CC2A 3EG0A 1H641 3EFOB 1TG0A 3VUZA 3WVEB 4M77A 2O4XB 3G71A 1R77A 4JJCA 2DERA 3M9QA 4M7AF 1WYXA 2V1RA 1VYTA 1M5Q1 1G3TA 4ZNXA 3CCMA 3CCMT 2OJ2A 3A5ZB 3J81E 1ZA2B 1KD1U 2ZPBB 2E5KA 1TS9A 3MKDA 1Q81R 4C92B 2RO0A 3LH0A 2DBMA 3INZA 4HVVA 2RPNA 3QDRB 8ATCB 3CCJQ 3VKIA 1KIKA 4C5HA 4PJOC 2VGMA 1FMVA 2A08A 1S1NA 3G6EA 3G6ET 4ZGEB 1KC8R 2OTLQ 4RTVA 3CCVQ 3CMEQ 3M57A 4OP0A 1Q7YU 3VRZA 2J6FA 2X3XD 3CMAQ 1N6AA 1RAAB 1VQ5T 3HTRA 1K76A 3VS3A 3CC7T 4LDUA 1XQHA 3CCLA 3CCLT 2X4JA 4QQ6A 2FYKA 1WX6A 3EGDA 1YJ9A 2K2MA 2QK0A 3M0RA 1AT1B 3EFSA 1UJYA 1VQ7Q 1ZQ1A 2CSQA 2K4YA 4IKFA 5HCKA 2DLPA 3BDLA 4E6RA 3RR6A 3IQLA
chains in the Genus database with same CATH topology
2G6FX 2NUZA 2AZSA 1WXBA 3SHWA 3CQTA 4JPBW 4OMNA 4RTTA 1E6GA 1UTIA 4JZ3A 2YUQA 2KT1A 2O31A 3UATA 1N5ZA 1BBZA 3PE0A 4X1VA 2DYBA 3VS5A 1I0CA 1WLPB 1VA7A 2D8HA 1ZUYA 1WA7A 4LNPA 3VS6A 1G2BA 1CSKA 4CC4B 2L0AA 1U3OA 4LUDA 2JTEA 3REAB 1QKXA 2OAWA 2LJ1A 1NEBA 1FMKA 1SRLA 4HCKA 2W10A 2CDTA 2RF0A 2EKHA 4RTUA 1SEMA 3VS2A 2MCNA 2YT6A 2VVKA 1X2KA 2O9VA 1HJDA 1U06A 1K0XA 1JQQA 1UECA 4Z88A 2YDLA 1Z9QA 4IIOA 4AG1C 2C0IA 1TUDA 1SHGA 2KR3A 2DL8A 2L3SA 2EQIA 2KT8A 1CKAA 2LX7A 1AEYA 1WIEA 2KXCA 2ESWA 2GTJA 2EPDA 2J6KA 1JXMA 1T0HA 2JXBA 1MV0B 1B3QA 2CT3A 2SRCA 1RLPC 2KEAA 3SEMA 4Z89A 4AFZC 1W1FA 2DA9A 2X3WD 2K6DA 2LCSA 2BTTA 1AOJA 4LE9A 1XOVA 4CC2A 5GJWB 4HVUA 2AKLA 2SEMA 1AWXA 5GJVB 1BB9A 3GBQA 1GFCA 1NYFA 4AFQC 1JU5C 2RQUA 1PKSA 1J3TA 4LN2A 1QKWA 3M0SA 2K7AA 1H92A 1EFNA 5FWCA 1MV3A 4A63B 2GGRA 1GBRA 4GBQA 4K11A 4D8DA 2CH4A 2O88A 4J9GA 1RI9A 2GQIA 1WFWA 1E7OA 1UGVA 4J9IA 3RNJA 1NLOC 4OMMA 1TUCA 2EGEA 2DX1A 3H41A 2FPDA 2BZ8A 5IXFA 1M30A 1AWJA 1WI7A 1KJWA 5IHIA 2F2WA 1YCSB 3UA6A 2DM1A 3TSWA 1B07A 2M51A 3UF4A 2IIMA 2AKKA 3M0QA 3RBBB 3THKA 4WCIA 2EYZA 4AG2C 2O2OA 1YN8A 3VS7A 2LQWA 2FRYA 2ABLA 1AWOA 1JO8A 2JT4A 1A0NB 3QWYA 3REBB 2KGTA 1K1ZA 2EGCA 4OMOA 3NGPA 1PRLC 2DL7A 3NHNA 2KRMA 2GTOA 1OEBA 3I5SA 1GRIA 1RUWA 2OI3A 5EC7A 1Z9ZA 3TSZA 1NM7A 2EBPA 2AK5A 5IXBA 2KYMA 2DJQA 2YSQA 1WDXA 5ECAA 1WXTA 5IHNA 1GFDA 4DEXA 1M27C 2EYXA 1Y57A 1UFFA 2EYYA 4KRTA 2DILA 2O9SA 1M3AA 2CUBA 4JZ4A 1GCQC 2CT4A 4RTZA 2XMFA 2JS0A 2BZXA 1I1JA 1NEGA 1W6XA 3KFVA 1SHFA 2QDLA 2PNIA 3H0HA 3I35A 4RTYA 4J9CA 4DEYA 1VYUA 1SRMA 3VS0A 1KSWA 3VS4A 1Y0MA 2FEIA 4CC7A 3EHRA 2EGAA 2K3BA 2GBQA 2C0TA 2FPEA 1YWPA 1V1CA 2RMOA 3VRYA 1X2QA 2H8HA 2YUPA 1X43A 1AZEA 3PVQA 2F2VA 2CUDA 2ROTA 5IH2A 1BK2A 2KXDA 4JJDA 5IHKA 1ABQA 1ZLMA 2B86A 2DL4A 2ECZA 2HCKA 2EVRA 2HSPA 4J9DA 3H0IA 1NLPC 2C0OA 1VYVA 4F16A 4J9HA 2GNCA 1ZUKA 2LP5A 2KROA 1HD3A 1JEGA 1U5SA 1UDLA 1H8KA 2VWFA 1MUZA 2L3QA 2FPFA 2LZ6B 2BZYA 2HDAA 3EG1A 2AZVA 2JMCA 2LJ0A 1JXOA 5I22A 2JW4A 1H3HA 2FRWA 2YUOA 1K9AA 2J6OA 2A37A 1T3LA 2J7IA 1X69A 1K0SA 2JM9A 4M4ZA 4ORZA 3M0UA 3UA7A 2D1XA 1E6HA 1ZBJA 2CH4W 1GCPA 3R6NA 4AFUC 1UJ0A 2DRKA 1YP5A 4HVWA 2JS2A 2ED1A 2W0ZA 1OPKA 4GLMA 3I9QA 1ZSGA 1ARKA 1X6GA 4OMLA 1KFZA 1BU1A 1FYNA 1ZUUA 1QLYA 1OPLA 1AD5A 4RUGA 1PKTA 2K9GA 3I5RA 1G83A 2KRSA 2DRMA 5FWBA 1ZX6A 1AWWA 2CREA 1W70A 2DL3A 2DE0X 2HBWA 4OMQA 1K4US 1LCKA 4RTWA 1UHCA 4ESRA 3C0CA 4OMPA 2D8JA 2J06A 2JM8A 3QWXX 1RLQC 2VKNA 2RQTA 3EG2A 1X27A 4J9FA 1HSQA 1UUEA 3NPFA 2PZ1A 1UE9A 1YWOA 4F17A 1PWTA 3VS1A 4Z8AA 2KYBA 2I0NA 2KRNA 2L3PA 2ED0A 2DVJA 1QCFA 4QT7A 2PTKA 3LH5A 2ENMA 3TVTA 1UHFA 3A98A 2RNAA 3ZL7C 1GBQA 1SSHA 3O5ZA 1I07A 2RQRA 1OV3A 3M0TA 3PVLA 2LMJA 1X6BA 2LNHB 4R0KA 4EIKA 3EG0A 1AZGB 1PRMC 2EW3A 4CC3A 1TG0A 1IO6A 4J9EA 2DBKA 4Y92A 2ROLA 2KBTA 2YUNA 4JJCA 1T0JA 1WYXA 2V1RA 1VYTA 4HXJA 4JJBA 4AFSC 4ZNXA 2OJ2A 1SPKA 4D8KA 4J9BA 1YNZA 2E5KA 4IIMA 1QWFA 3NMZC 2RN8A 1CKBA 1M3BA 1NG2A 2K79A 2P4RA 2CSIA 3U23A 5I11A 3JV3A 4FSSA 1ABOA 2MOXA 2DBMA 2KNBB 2M0YA 1PHTA 1T3SA 1OOTA 1NYGA 2RQVA 1PNJA 2RPNA 3FJ5A 4HVVA 4F14A 2KE9A 1KIKA 2FO0A 5L23A 2A28A 4LUEA 2F2XA 2JMAA 2J05A 2A08A 1S1NA 1AVZC 2MIOA 2LQNA 4RTVA 3H0FA 2RQWA 3ULRB 3EG3A 2EYWA 2DF6A 3VRZA 2J6FA 2V1QA 2L2PA 2X3XD 1M3CA 1K76A 3VS3A 1M8MA 2LJ3A 1QWEA 2NWMA 2DL5A 1WX6A 1GCQA 2A36A 4RTXA 2K2MA 2DNUA 1WXUA 3EHQA 3EGUA 3M0RA 5FW9A 1UG1A 1UJYA 2CSQA 5HCKA 2D0NA 2DLPA 2HEQA 2FG0A 3M0PA 2DMOA 4E6RA 3IQLA 1GL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G6F X;  2NUZ A;  2AZS A;  1WXB A;  3SHW A;  3CQT A;  4JPB W;  4OMN A;  4RTT A;  1E6G A;  1UTI A;  4JZ3 A;  2YUQ A;  2KT1 A;  2O31 A;  3UAT A;  1N5Z A;  1BBZ A;  3PE0 A;  4X1V A;  2DYB A;  3VS5 A;  1I0C A;  1WLP B;  1VA7 A;  2D8H A;  1ZUY A;  1WA7 A;  4LNP A;  3VS6 A;  1G2B A;  1CSK A;  4CC4 B;  2L0A A;  1U3O A;  4LUD A;  2JTE A;  3REA B;  1QKX A;  2OAW A;  2LJ1 A;  1NEB A;  1FMK A;  1SRL A;  4HCK A;  2W10 A;  2CDT A;  2RF0 A;  2EKH A;  4RTU A;  1SEM A;  3VS2 A;  2MCN A;  2YT6 A;  2VVK A;  1X2K A;  2O9V A;  1HJD A;  1U06 A;  1K0X A;  1JQQ A;  1UEC A;  4Z88 A;  2YDL A;  1Z9Q A;  4IIO A;  4AG1 C;  2C0I A;  1TUD A;  1SHG A;  2KR3 A;  2DL8 A;  2L3S A;  2EQI A;  2KT8 A;  1CKA A;  2LX7 A;  1AEY A;  1WIE A;  2KXC A;  2ESW A;  2GTJ A;  2EPD A;  2J6K A;  1JXM A;  1T0H A;  2JXB A;  1MV0 B;  1B3Q A;  2CT3 A;  2SRC A;  1RLP C;  2KEA A;  3SEM A;  4Z89 A;  4AFZ C;  1W1F A;  2DA9 A;  2X3W D;  2K6D A;  2LCS A;  2BTT A;  1AOJ A;  4LE9 A;  1XOV A;  4CC2 A;  5GJW B;  4HVU A;  2AKL A;  2SEM A;  1AWX A;  5GJV B;  1BB9 A;  3GBQ A;  1GFC A;  1NYF A;  4AFQ C;  1JU5 C;  2RQU A;  1PKS A;  1J3T A;  4LN2 A;  1QKW A;  3M0S A;  2K7A A;  1H92 A;  1EFN A;  5FWC A;  1MV3 A;  4A63 B;  2GGR A;  1GBR A;  4GBQ A;  4K11 A;  4D8D A;  2CH4 A;  2O88 A;  4J9G A;  1RI9 A;  2GQI A;  1WFW A;  1E7O A;  1UGV A;  4J9I A;  3RNJ A;  1NLO C;  4OMM A;  1TUC A;  2EGE A;  2DX1 A;  3H41 A;  2FPD A;  2BZ8 A;  5IXF A;  1M30 A;  1AWJ A;  1WI7 A;  1KJW A;  5IHI A;  2F2W A;  1YCS B;  3UA6 A;  2DM1 A;  3TSW A;  1B07 A;  2M51 A;  3UF4 A;  2IIM A;  2AKK A;  3M0Q A;  3RBB B;  3THK A;  4WCI A;  2EYZ A;  4AG2 C;  2O2O A;  1YN8 A;  3VS7 A;  2LQW A;  2FRY A;  2ABL A;  1AWO A;  1JO8 A;  2JT4 A;  1A0N B;  3QWY A;  3REB B;  2KGT A;  1K1Z A;  2EGC A;  4OMO A;  3NGP A;  1PRL C;  2DL7 A;  3NHN A;  2KRM A;  2GTO A;  1OEB A;  3I5S A;  1GRI A;  1RUW A;  2OI3 A;  5EC7 A;  1Z9Z A;  3TSZ A;  1NM7 A;  2EBP A;  2AK5 A;  5IXB A;  2KYM A;  2DJQ A;  2YSQ A;  1WDX A;  5ECA A;  1WXT A;  5IHN A;  1GFD A;  4DEX A;  1M27 C;  2EYX A;  1Y57 A;  1UFF A;  2EYY A;  4KRT A;  2DIL A;  2O9S A;  1M3A A;  2CUB A;  4JZ4 A;  1GCQ C;  2CT4 A;  4RTZ A;  2XMF A;  2JS0 A;  2BZX A;  1I1J A;  1NEG A;  1W6X A;  3KFV A;  1SHF A;  2QDL A;  2PNI A;  3H0H A;  3I35 A;  4RTY A;  4J9C A;  4DEY A;  1VYU A;  1SRM A;  3VS0 A;  1KSW A;  3VS4 A;  1Y0M A;  2FEI A;  4CC7 A;  3EHR A;  2EGA A;  2K3B A;  2GBQ A;  2C0T A;  2FPE A;  1YWP A;  1V1C A;  2RMO A;  3VRY A;  1X2Q A;  2H8H A;  2YUP A;  1X43 A;  1AZE A;  3PVQ A;  2F2V A;  2CUD A;  2ROT A;  5IH2 A;  1BK2 A;  2KXD A;  4JJD A;  5IHK A;  1ABQ A;  1ZLM A;  2B86 A;  2DL4 A;  2ECZ A;  2HCK A;  2EVR A;  2HSP A;  4J9D A;  3H0I A;  1NLP C;  2C0O A;  1VYV A;  4F16 A;  4J9H A;  2GNC A;  1ZUK A;  2LP5 A;  2KRO A;  1HD3 A;  1JEG A;  1U5S A;  1UDL A;  1H8K A;  2VWF A;  1MUZ A;  2L3Q A;  2FPF A;  2LZ6 B;  2BZY A;  2HDA A;  3EG1 A;  2AZV A;  2JMC A;  2LJ0 A;  1JXO A;  5I22 A;  2JW4 A;  1H3H A;  2FRW A;  2YUO A;  1K9A A;  2J6O A;  2A37 A;  1T3L A;  2J7I A;  1X69 A;  1K0S A;  2JM9 A;  4M4Z A;  4ORZ A;  3M0U A;  3UA7 A;  2D1X A;  1E6H A;  1ZBJ A;  2CH4 W;  1GCP A;  3R6N A;  4AFU C;  1UJ0 A;  2DRK A;  1YP5 A;  4HVW A;  2JS2 A;  2ED1 A;  2W0Z A;  1OPK A;  4GLM A;  3I9Q A;  1ZSG A;  1ARK A;  1X6G A;  4OML A;  1KFZ A;  1BU1 A;  1FYN A;  1ZUU A;  1QLY A;  1OPL A;  1AD5 A;  4RUG A;  1PKT A;  2K9G A;  3I5R A;  1G83 A;  2KRS A;  2DRM A;  5FWB A;  1ZX6 A;  1AWW A;  2CRE A;  1W70 A;  2DL3 A;  2DE0 X;  2HBW A;  4OMQ A;  1K4U S;  1LCK A;  4RTW A;  1UHC A;  4ESR A;  3C0C A;  4OMP A;  2D8J A;  2J06 A;  2JM8 A;  3QWX X;  1RLQ C;  2VKN A;  2RQT A;  3EG2 A;  1X27 A;  4J9F A;  1HSQ A;  1UUE A;  3NPF A;  2PZ1 A;  1UE9 A;  1YWO A;  4F17 A;  1PWT A;  3VS1 A;  4Z8A A;  2KYB A;  2I0N A;  2KRN A;  2L3P A;  2ED0 A;  2DVJ A;  1QCF A;  4QT7 A;  2PTK A;  3LH5 A;  2ENM A;  3TVT A;  1UHF A;  3A98 A;  2RNA A;  3ZL7 C;  1GBQ A;  1SSH A;  3O5Z A;  1I07 A;  2RQR A;  1OV3 A;  3M0T A;  3PVL A;  2LMJ A;  1X6B A;  2LNH B;  4R0K A;  4EIK A;  3EG0 A;  1AZG B;  1PRM C;  2EW3 A;  4CC3 A;  1TG0 A;  1IO6 A;  4J9E A;  2DBK A;  4Y92 A;  2ROL A;  2KBT A;  2YUN A;  4JJC A;  1T0J A;  1WYX A;  2V1R A;  1VYT A;  4HXJ A;  4JJB A;  4AFS C;  4ZNX A;  2OJ2 A;  1SPK A;  4D8K A;  4J9B A;  1YNZ A;  2E5K A;  4IIM A;  1QWF A;  3NMZ C;  2RN8 A;  1CKB A;  1M3B A;  1NG2 A;  2K79 A;  2P4R A;  2CSI A;  3U23 A;  5I11 A;  3JV3 A;  4FSS A;  1ABO A;  2MOX A;  2DBM A;  2KNB B;  2M0Y A;  1PHT A;  1T3S A;  1OOT A;  1NYG A;  2RQV A;  1PNJ A;  2RPN A;  3FJ5 A;  4HVV A;  4F14 A;  2KE9 A;  1KIK A;  2FO0 A;  5L23 A;  2A28 A;  4LUE A;  2F2X A;  2JMA A;  2J05 A;  2A08 A;  1S1N A;  1AVZ C;  2MIO A;  2LQN A;  4RTV A;  3H0F A;  2RQW A;  3ULR B;  3EG3 A;  2EYW A;  2DF6 A;  3VRZ A;  2J6F A;  2V1Q A;  2L2P A;  2X3X D;  1M3C A;  1K76 A;  3VS3 A;  1M8M A;  2LJ3 A;  1QWE A;  2NWM A;  2DL5 A;  1WX6 A;  1GCQ A;  2A36 A;  4RTX A;  2K2M A;  2DNU A;  1WXU A;  3EHQ A;  3EGU A;  3M0R A;  5FW9 A;  1UG1 A;  1UJY A;  2CSQ A;  5HCK A;  2D0N A;  2DLP A;  2HEQ A;  2FG0 A;  3M0P A;  2DMO A;  4E6R A;  3IQL A;  1GL5 A; 
#chains in the Genus database with same CATH topology
 1WXB A;  2XDD A;  5CKD A;  3FB9 A;  5HY6 A;  2OTJ A;  2OTJ T;  2QAZ A;  5KYU B;  2EKO A;  2ZCF B;  3FC3 A;  1N5Z A;  4Q5W A;  1D3B A;  1WHG A;  1YJN Q;  4C8Q F;  3HRT A;  3EH1 A;  4X1V A;  3VS5 A;  1I0C A;  2CP6 A;  1WA7 A;  4X9C A;  1CSK A;  4CC4 B;  4HT9 A;  1D09 B;  4ME7 A;  4A4K A;  5KYU A;  3VYG A;  3REA B;  1WQ7 A;  3QSU A;  1Q7Y R;  2EFI A;  1M90 R;  2DK3 A;  1NEB A;  2JN0 A;  2W10 A;  3JCM P;  4KH0 B;  2EKH A;  1SEM A;  3VS2 A;  2O9V A;  4CI0 C;  2A7Y A;  1HJD A;  1QVF S;  1K0X A;  3MEW A;  3J7A F;  1WHL A;  4Z88 A;  3H9N A;  3GIB A;  2C0I A;  3QZ9 B;  2LCC A;  1O75 A;  2DD5 A;  2KR3 A;  3OMG A;  2M9U A;  3HHT B;  4KGZ B;  3JCM h;  3JB9 G;  1I4K 1;  3QXE B;  2KT8 A;  1CKA A;  3RMS A;  4BDZ A;  2BE7 D;  2M02 A;  1R8O B;  3JCM Q;  4XQ3 A;  2JXB A;  2DVE A;  2DZC A;  2K2V A;  3GF5 A;  4M7A E;  4PJO G;  2SRC A;  1RLP C;  3HRS A;  3RKY A;  1N8R C;  2RHY A;  4DBR A;  2LCS A;  5KYX B;  5KYW B;  3F70 A;  3CCS A;  3CCS T;  4LE9 A;  2D0Q B;  4CC2 A;  5GJW B;  1MMA A;  2AKL A;  1AWX A;  3GBQ A;  1VOM A;  4C0D C;  3L2Q A;  4ELY C;  2RQU A;  3TQ7 P;  2CP3 A;  3CPW P;  4LN2 A;  2QA4 T;  2QA4 A;  1D1C A;  2H3E B;  5CIU A;  3VV0 A;  5KYN A;  4A63 B;  4BY6 C;  3CCM Q;  3MJX A;  4XTX A;  4K11 A;  2QI2 A;  3MEU A;  2GQI A;  4M78 A;  3EGX A;  2BKD N;  3MP1 A;  2VB6 A;  2CYZ B;  1TUC A;  3H41 A;  1PSE A;  2BZ8 A;  1M30 A;  2YRC A;  3M4Y A;  4DOW A;  1JBM A;  4JRI A;  4M7D B;  1KG1 A;  2RJF A;  5IHI A;  2L8D A;  2F2W A;  3G4S T;  4PKC C;  1WHM A;  1LVK A;  1QVF A;  1OX9 A;  2IIM A;  4N0A A;  3M0Q A;  1VQ9 A;  3G6E Q;  1VQ9 T;  5GAN j;  4MZM A;  4WCI A;  2O2O A;  1YN8 A;  4CRI A;  2RHX A;  5J26 A;  1VQ5 Q;  2EJF A;  3DB3 A;  3CC7 Q;  2KGT A;  2DD4 A;  1NJI U;  2EGC A;  3CCL Q;  5CVI A;  2R57 A;  5GMK i;  3JB9 F;  3HL8 A;  1PRL C;  4QQG A;  1Q82 U;  3JCM f;  4OB2 B;  4MDX A;  1OEB A;  3BY7 A;  1GRI A;  4L6V 5;  1TXQ A;  4C8Q E;  1EZZ B;  1PG5 B;  2OI3 A;  3OBW A;  1Z9Z A;  3TSZ A;  3C12 A;  2HZY A;  4C5G A;  2VC8 A;  2YSQ A;  5IHN A;  4J6Y A;  1VQN Q;  2EQK A;  1M27 C;  3OYL A;  1UFF A;  3OYE A;  3DLM A;  1IRX A;  4KRT A;  4WTO B;  2OTJ Q;  2DXU A;  1I8F A;  1KQS P;  2DIL A;  2XG8 D;  1M3A A;  3X20 B;  1GCQ C;  2CT4 A;  3ZEH A;  1KD1 C;  1KHC A;  3GOX A;  3JCM b;  1BIB A;  1B34 B;  5KE2 A;  3SFM A;  3HKS A;  1VIE A;  4PJO A;  4EPC A;  4J9C A;  4DEY A;  1XNI A;  2PUK B;  2G3R A;  1TH7 A;  3VS0 A;  4RMO A;  2IVW A;  4O6J A;  2EGA A;  1V1C A;  1NPP A;  1SF9 A;  1X43 A;  4EMH A;  4M75 C;  3PVQ A;  1G3Y A;  3A8H B;  3L2Z A;  2KXD A;  4C0F A;  1Q7Y C;  1NZ9 A;  5IHK A;  2C06 A;  4BE0 A;  2XKO C;  3LWH A;  5CO7 A;  3BE3 A;  4F7U G;  2HCK A;  2KQW A;  4QKU A;  4J9D A;  2RA2 A;  3CXC P;  2DFU A;  1VQ8 A;  1VQ8 T;  4F16 A;  5M9O A;  4X9D A;  2KRO A;  5LJ5 e;  2NUP A;  4XAX B;  1JEG A;  1UDL A;  3S6W A;  3LWI A;  1JJ2 S;  1VQ6 T;  1VQ6 A;  3CCS Q;  4J8O A;  2AZV A;  4FSX A;  2EQM A;  1F1B B;  3UWN A;  2KY9 A;  4HKE A;  2HSE B;  1K9A A;  2D6F A;  1N9R A;  2J6O A;  3LYI A;  1OI1 A;  3QYG B;  2QA4 Q;  4M77 D;  1K0S A;  2FVU A;  3M0U A;  3UA7 A;  5A0D A;  1U1T A;  1ZBJ A;  5DM7 R;  3OYM A;  4HVW A;  2JS2 A;  5CR2 A;  3RUX A;  2W0Z A;  3RKX A;  5GAM f;  4EMK C;  2MYS A;  3I9Q A;  3P8D A;  1ZSG A;  2QXF A;  4PNO A;  2EQU A;  1N9S A;  4M7A C;  1ZUU A;  1X75 C;  4YTL A;  1QLY A;  2R5A A;  1AD5 A;  4BE2 A;  3I5R A;  3G4S Q;  3CCR A;  2F69 A;  2PU9 B;  2QQB A;  2QTX A;  2DE0 X;  2VYT A;  2RJC A;  1LCK A;  1QVG S;  1K73 U;  5CKB A;  4OMP A;  2JM8 A;  4JUV A;  4BI8 B;  3CCE Q;  1VIF A;  2FZG B;  2FB7 A;  3EG2 A;  1M1K U;  3OYI A;  4MMK A;  3NPF A;  1YWO A;  4FU6 A;  3VS1 A;  2VUB A;  2X51 A;  4F7U F;  1RAB B;  2KYB A;  2KRN A;  4TVR A;  1QVP A;  2HQE A;  3SWN B;  1JJ2 A;  1V76 A;  1M2V B;  2ENM A;  3GNF B;  3TVT A;  1V29 B;  3MP8 A;  1YBY A;  4QVC A;  1I07 A;  2Z0W A;  2RQR A;  3CC4 A;  3CC4 T;  1P92 A;  3M0T A;  3PVL A;  5LJ3 e;  2LNH B;  4KBM B;  3OW2 P;  1AZG B;  2RHU A;  4JRP A;  2ROL A;  1R0B G;  2KBT A;  4J6X A;  1T0J A;  4PFO A;  4PJN A;  3PNW C;  1W4S A;  1YCY A;  2JOY A;  4D8K A;  1Y07 A;  2WSE E;  5FU7 B;  3S3N A;  1QWF A;  1RL2 A;  2JVV A;  3U23 A;  2YHT A;  2CSI A;  2XD0 A;  3JV3 A;  2P0P A;  2KNB B;  4C8Q C;  1T3S A;  3HPW A;  1OOT A;  5CAI A;  2KSS A;  3FJ5 A;  4MZP A;  4OB0 B;  3V7C A;  1QVG A;  2FO0 A;  1Y96 B;  4OMF B;  3EAE A;  2A28 A;  3NFC A;  1N8R U;  4LUE A;  3OYF A;  1VQO Q;  2JMA A;  1YHQ A;  1YHQ T;  5KCO A;  2HL3 A;  2L3R A;  4GY5 A;  2LQN A;  3H0F A;  1SSF A;  2M1H A;  1NJI C;  3ULR B;  2KAF A;  3EG3 A;  4M7A G;  2V8K A;  2HQH A;  3LLR A;  4A4E A;  2E3I A;  3RKW A;  4BD3 A;  1Q82 C;  3JCM e;  1M3C A;  3JSC A;  3JB9 H;  1IGU A;  1UGR B;  4XTU A;  3JCM V;  1GCQ A;  2RK2 A;  4RTX A;  4C5E A;  4JRK A;  1X6O A;  4JLG A;  4OVA A;  1U1S A;  2HEQ A;  3X24 B;  3M0P A;  3X28 B;  2E12 A;  2QAS A;  1G3W A;  2EJ9 A;  5GMK j;  3MEA A;  3O8V A;  1RAF B;  1E6G A;  4JZ3 A;  1FXX A;  1C1A A;  4M78 D;  5GAN 3;  3ZFJ A;  2CKK A;  2CP2 A;  4M75 A;  5HK3 A;  4ATO A;  4XU1 A;  1Q81 U;  2DYB A;  2MK5 A;  3TEE A;  1WLP B;  1VQ4 Q;  4LNP A;  5LJ5 h;  3X25 B;  2MI6 A;  1U3O A;  1K9M R;  2LCL A;  2JTE A;  2YXY A;  4A54 A;  1QKX A;  2OAW A;  3FJP A;  2LJ1 A;  4NL3 A;  1IB8 A;  1YIT A;  1YIT T;  4N4G A;  1SRL A;  3G1J A;  5IN1 A;  1VQM A;  1TUG B;  3LGL A;  4M77 B;  1KC8 U;  1C6V X;  1UGQ B;  2XIC A;  1FWZ A;  4DBQ A;  2DTO A;  1UEB A;  4JLI A;  3QJY A;  3CC2 T;  3EG9 B;  4NOY A;  1YJW A;  1YJW T;  3TU4 K;  3G71 T;  4DBF A;  4MZT A;  5FU6 B;  2MAM A;  2EQJ A;  4C8Q G;  4BI3 A;  4MDW A;  2CP5 A;  2P0Q A;  2ESW A;  2EPD A;  1B3Q A;  2CT3 A;  3EG9 A;  5CQY A;  3SEM A;  2HBP A;  4XTW A;  1D1A A;  4Z89 A;  1W1F A;  2X3W D;  4XTY A;  4FCY A;  1AOJ A;  2EIF A;  4LD9 K;  2M0O A;  4EMK A;  4HVU A;  2EWN A;  4C92 F;  1MNE A;  4M7A A;  4J5Y A;  4FW1 A;  2ZPF B;  2JTM A;  3L2U A;  1EFN A;  5FWC A;  3TRE A;  1MV3 A;  5GAM e;  2QG9 B;  4PJO D;  1RI9 A;  4FIB A;  3QYH B;  3EGD B;  1IGQ A;  3JRZ A;  1M90 U;  4OMM A;  3HFN A;  2EGE A;  2DX1 A;  5FRM A;  2COZ A;  4XU0 A;  5C0M A;  2JZ2 A;  5LJ5 f;  1KJW A;  1K73 C;  4XK8 E;  8AT1 B;  5CKE A;  2E4H A;  1TTH B;  1YJ9 T;  3TSW A;  4PFZ A;  2KK4 A;  1B07 A;  2QQR A;  1M1K C;  1G3S A;  3RBB B;  5LJ3 h;  3P8B B;  2EYZ A;  1D3B B;  3PFS A;  4AG2 C;  2DKG A;  1QW1 A;  7AT1 B;  2FL7 A;  2HKQ B;  1QP3 A;  3LW5 E;  4A4G A;  2ABL A;  1AWO A;  4EMG A;  1JO8 A;  2JT4 A;  2K5L A;  1WJQ A;  4OGC A;  5DLO A;  3DB4 A;  4PFP A;  2XID A;  4OMO A;  3NGP A;  2E3H A;  2DYI A;  3LGF A;  2LTO A;  2DEQ A;  2KRM A;  3I5S A;  1M1F A;  2MWO A;  4B6M A;  3HRU A;  3QZ5 B;  2A0F B;  1ZSZ C;  1S72 T;  1S72 A;  5GMK l;  2BUD A;  5IXB A;  1WXT A;  4KGX B;  1BIA A;  2VXF A;  2DXC A;  3MCA B;  4Z02 A;  2RHZ A;  4NS5 A;  4NL2 A;  1RAE B;  2O9S A;  4JZ4 A;  2HD0 A;  4RTZ A;  4C8Q A;  2XMF A;  2BZX A;  1I1J A;  2JS0 A;  3KFV A;  2QDL A;  3H0H A;  2AT1 B;  3I35 A;  4RTY A;  1XJW B;  3A1P A;  1SRM A;  5GAN e;  3J80 E;  5DLQ E;  1MGQ A;  4E7H A;  5I2M A;  1DJ7 B;  3MP6 A;  4CC7 A;  4JDS A;  2K3B A;  2C0T A;  3DKM A;  1ACM B;  1BI0 A;  3M53 A;  5IH2 A;  1W2B P;  3CC2 Q;  1K9M C;  3VU3 C;  4JJD A;  5HK0 A;  1I81 A;  4M78 B;  2RHI A;  5FRO A;  1YJW Q;  3G71 Q;  3EGX B;  3H0I A;  5LJ3 f;  1R0C B;  4J9H A;  4R55 A;  4C92 E;  4VUB A;  3OYD A;  2VWF A;  2COW A;  1BI2 A;  2QGF B;  1MHN A;  2RI5 A;  3EG1 A;  2MPX C;  1JXO A;  4PJM A;  5I22 A;  3C95 A;  1H3H A;  1WGS A;  2NUT B;  2YUO A;  3C4S A;  2CGH A;  5GAN 8;  4IUU A;  2DJZ A;  2D1X A;  4M7D F;  2EJG A;  1E6H A;  1YI2 A;  1RAC B;  1Q81 C;  2CH4 W;  1GCP A;  3M58 A;  5DY9 A;  2NUT A;  2B8A A;  5IAY A;  1G8X A;  4L5G A;  4Y91 A;  2RH2 A;  4KUI A;  2BE9 B;  2H3J A;  4OML A;  2X4Y A;  1PD0 A;  2KI7 A;  3MEV A;  1KC8 C;  2LQK A;  2OX7 A;  3CCU A;  3CCU T;  1OPL A;  3A8M B;  1PKT A;  1YJ9 Q;  2DRM A;  3JB9 I;  4LDY A;  3AT1 B;  1RAD B;  1W70 A;  4DBH A;  2K5F A;  2CZ1 B;  3MHX A;  4ESR A;  3QWX X;  3VYH B;  1RLQ C;  1VUB A;  2VKN A;  1QP2 A;  4PJO B;  2MWP A;  5CK9 A;  1UUE A;  1PD1 A;  5A0L A;  1WZO A;  5GAO n;  1PWT A;  3E9F A;  5J39 A;  4Z8A A;  1D0X A;  5GAM h;  2L3P A;  4AT1 B;  1N27 A;  1QCF A;  2P0K A;  3OYN A;  2PTK A;  5KYY A;  2EAY A;  2NLU A;  1S72 Q;  3E2U A;  2X35 A;  1GBQ A;  3O5Z A;  1Y71 A;  3OY9 A;  3QJ6 A;  4KUL A;  2LMJ A;  1X6B A;  2DZ9 A;  4CC3 A;  4KGV B;  2LRQ A;  2YWW A;  2DBK A;  4J9E A;  4Y92 A;  2YUN A;  5AYF A;  2QQS A;  2DXB A;  2NUP B;  2YRD A;  4M75 D;  4DOV A;  1M90 C;  3JCM W;  4ZTF A;  1G5V A;  5D6X A;  2DO3 A;  4FT2 A;  4J9B A;  2PQW A;  1YFN A;  2YLC A;  3L2V A;  3NMZ C;  1OUL A;  4HCC A;  2RN8 A;  1NG2 A;  2K79 A;  2P4R A;  4O5V A;  3OB9 A;  1ABO A;  4M78 E;  2MOX A;  2M0Y A;  4E7K A;  2VXE A;  1LOJ A;  2R58 A;  3M59 A;  4F14 A;  1SKU B;  2LX9 A;  5L23 A;  4XU2 A;  2F2X A;  2GFU A;  2J05 A;  2KMT A;  3CBO A;  2CS7 A;  5CCA A;  4BB7 A;  5IT9 E;  3T9N A;  1ZSZ A;  2DF6 A;  4RG2 A;  1QVF P;  2V1Q A;  5KCH A;  2L2P A;  1RAI B;  3V8L A;  3MET A;  4M7D E;  2RB6 A;  5LL6 S;  2RJD A;  3H8Z A;  3OS2 A;  2LJ3 A;  1QWE A;  3UPU A;  2LQ8 A;  2DL5 A;  5GAN h;  1VQK A;  1VQK T;  4PK4 A;  3EGU A;  4Y28 E;  1MND A;  5FRN A;  2D0N A;  1K8A R;  2P84 A;  3CCR T;  4J6W A;  4M7A D;  1VQ9 Q;  2HNI A;  5GAO r;  3CQT A;  2LDM A;  3OS5 A;  5FLX E;  4JPB W;  2VV5 A;  4RTT A;  1UTI A;  1YIJ T;  1YIJ A;  4JS4 A;  4C0D B;  1IHW A;  2O31 A;  3UAT A;  2E70 A;  3JB9 J;  3QG1 A;  2PVG B;  4C92 C;  4BY6 B;  2Y4X A;  3GLX A;  4RG8 A;  1ZUY A;  1G2B A;  5AT1 B;  3CCU Q;  3AHU A;  4IUP A;  3JAM E;  1SG5 A;  3G7Z A;  5C6S A;  2K3X A;  4HCK A;  1M9S A;  2K5I A;  3FEO A;  2YT6 A;  2IPO B;  1X2K A;  1I5L A;  1U06 A;  2DIG A;  3BDU A;  1JQQ A;  4LXC A;  3PTA A;  1Z9Q A;  4F7U A;  4IIO A;  4AG1 C;  3FRN A;  1U8R A;  3RES A;  3CCQ A;  3CCQ T;  3GP8 A;  1TUD A;  5GAO m;  2DL8 A;  2L3S A;  5A0G A;  2EQI A;  3ER0 A;  2LX7 A;  1AEY A;  1WIE A;  2V8I A;  1OX8 A;  3WXM B;  2X9H A;  2YLB A;  5GMK e;  1KQ2 A;  4LDV A;  1M8V A;  1RAH B;  2BTT A;  4J83 A;  3CCJ A;  2F5K A;  5GAN f;  2JUF A;  2SEM A;  5GJV B;  1BB9 A;  1GFC A;  1NYF A;  4AFQ C;  1JU5 C;  1PKS A;  1J3T A;  2OTL A;  2WAC A;  2OTL T;  1QKW A;  3CCV A;  1PCX A;  4C8Q D;  3M0S A;  3CME A;  2ZPH B;  1H92 A;  2D9T A;  2E65 A;  3CMA A;  2GGR A;  4GBQ A;  4D8D A;  2CH4 A;  3SD4 A;  2O88 A;  1TOV A;  1VQ8 Q;  1K9M U;  5LJ5 d;  4QVZ A;  1WNL A;  4ZTJ A;  3RNJ A;  1NLO C;  2QDY B;  1IRE B;  4E7I A;  2FPD A;  4PLL A;  2FHD A;  2F5T X;  2ZPE B;  5CQX A;  3HP9 A;  4V2S A;  4F04 B;  4E7Z A;  1VQ7 A;  1VQ6 Q;  3PIO A;  4XU3 A;  3CBM A;  1X01 A;  2QEX A;  3UA6 A;  2DM1 A;  3NTH A;  4FYV B;  2M51 A;  2AKK A;  1IXD A;  1WPY A;  2RJE A;  3THK A;  4M75 B;  3L1A A;  4C92 G;  5I21 A;  3VS7 A;  2LQW A;  3PMT A;  3OYG A;  3TCJ A;  3D7S B;  4C5I A;  3L2R A;  2PVO B;  4A4F A;  2E41 A;  1A0N B;  1QCN A;  2LC4 A;  3REB B;  2LT1 A;  1K1Z A;  4J7F A;  2QEX Q;  4JJN K;  4E47 A;  2DL7 A;  1LPL A;  1VQK Q;  4P5N A;  2FZK B;  2GFA A;  2GTO A;  1WHK A;  2ZGW A;  1RUW A;  5EC7 A;  4ZGD B;  3CPW S;  1NM7 A;  3V7R A;  4PJJ A;  4BAC A;  3CCR Q;  2KYM A;  1WDX A;  5ECA A;  1GFD A;  1JJ2 P;  2DTH A;  1VQM T;  3EH2 A;  3FDR A;  1TU0 B;  4DQ2 A;  3MPU B;  1FMW A;  3M56 A;  3PT9 A;  4M77 F;  1W6X A;  1K8A C;  1SHF A;  4JS5 A;  2PNI A;  3CD6 A;  3CD6 T;  2HKN A;  5GAO l;  1I5O B;  4N4I A;  4M7D C;  3BFM A;  1BCO A;  5GAO p;  2IG0 A;  2FEI A;  1C0M A;  3EHR A;  4ZGJ B;  4EMK B;  2FPE A;  1YWP A;  2RMO A;  3VRY A;  1X2Q A;  1OU8 A;  2H8H A;  1BYM A;  4M7A B;  1AZE A;  4IUT A;  2K57 A;  5LJ3 d;  3CC4 Q;  2F2V A;  2ROT A;  1BK2 A;  1JB0 E;  3RMQ A;  1M2O A;  1QCO A;  3S3O A;  1ZLM A;  3OBY A;  3CCQ Q;  2B86 A;  2DL4 A;  2EVR A;  2HSP A;  3EFO A;  1MMG A;  3JB9 D;  1QVG P;  1NLP C;  3OYA A;  2C0O A;  2GNC A;  1ZUK A;  2O4X A;  1HD3 A;  1W2B A;  1U5S A;  3JCM c;  4FL6 A;  2FPF A;  1OQK A;  4PLI A;  4HA8 A;  3M54 A;  1ZA1 B;  2AIR B;  3CPW A;  2FZC B;  1D0Z A;  2LNV A;  3A8L B;  4KUD K;  1HXD A;  3V8K A;  2JW4 A;  2FRW A;  1KQS S;  2V8J A;  4C92 A;  2A37 A;  3FLG A;  1T3L A;  2J7I A;  1X69 A;  5LJ5 g;  2JM9 A;  4IUV A;  4M4Z A;  1M1G A;  5GAN 6;  1PM3 A;  3EFR A;  1YHQ Q;  2WSF E;  3DLL A;  4AFU C;  4II1 A;  2XI9 A;  2DRK A;  2E1H A;  2V26 A;  1VQ5 A;  2LT4 A;  3CC7 A;  3JCM d;  4M78 G;  1Q86 U;  4GLM A;  1X6G A;  1H3Z A;  1KD1 R;  4M75 E;  4UC4 A;  2P4T A;  3CBP A;  2KRS A;  5FWB A;  5GMK h;  1ZX6 A;  1NE8 A;  1VQN A;  1VQN T;  2CRE A;  2Y90 A;  3I56 A;  3I56 T;  2HBW A;  3CXC S;  3PIP A;  4C8Q B;  1UB4 A;  4ELZ C;  1UHC A;  3OSS C;  2D8J A;  3L2W A;  2RQT A;  1X27 A;  4X34 A;  1HSQ A;  4M7D G;  2DIQ A;  1UE9 A;  4F17 A;  1MMD A;  4OF1 A;  2I0N A;  3JCM J;  3A8O B;  4J7I A;  2QTV A;  5GAM j;  1GXI E;  3LH5 A;  3NTI A;  4M77 E;  4LDX A;  4LDW A;  1ZBX A;  3ZL7 C;  1KQS A;  1FX7 A;  1YIT Q;  4L59 A;  2ZZD A;  1OV3 A;  1Q86 R;  1VQM Q;  4R0K A;  3E1S A;  3RDV A;  1PRM C;  2EW3 A;  1IO6 A;  2DTI A;  3ME9 A;  1IHV A;  3OS1 A;  4HXJ A;  4JJB A;  3CD6 Q;  1KK7 A;  4B9X A;  1BI1 A;  4AFS C;  3V7S A;  1SPK A;  2CZ6 B;  1Y7X A;  1YNZ A;  3HSB A;  4M78 F;  2DET A;  5LJ3 g;  4IIM A;  1CKB A;  1M3B A;  2JTF A;  2VAS A;  5I11 A;  1LJO A;  2ZPG B;  4FSS A;  1NPR A;  1BKB A;  1WHJ A;  1PHT A;  1NYG A;  2RQV A;  1PNJ A;  3CXC A;  2XHC A;  5D7U A;  2KE9 A;  5KYX A;  5KYW A;  4MML A;  1AVZ C;  2MIO A;  2ZAE A;  4E2F B;  3LX7 A;  4XTZ A;  2RQW A;  5GAM d;  2OAU A;  5KH6 A;  2EYW A;  3OMC A;  3SWN C;  5GAO q;  1YI2 T;  3UT1 A;  1M8M A;  2DAQ A;  2CZ0 B;  2EYQ A;  2NWM A;  4QVD A;  2A36 A;  3OW2 S;  3G4S A;  2DNU A;  1WXU A;  2WSC E;  1ZHI A;  3EHQ A;  5FW9 A;  1UG1 A;  3KBG A;  2FG0 A;  2DMO A;  2F1L A;  1GL5 A;  4M7D A;  3FIF A;  3CCE A;  2G6F X;  2YRV A;  3CCE T;  2NUZ A;  2AZS A;  2O01 E;  3CPF A;  3JCM g;  3SHW A;  4OMN A;  4QW2 A;  3OSV A;  4ZN3 A;  4OGE A;  2YUQ A;  2KT1 A;  5FU7 C;  1BBZ A;  5KYY B;  3PE0 A;  3KXT A;  3VJP A;  1OYX A;  1VQP A;  2MMP A;  1VQP T;  1VA7 A;  2D8H A;  4BDY A;  1QQJ A;  4PJO F;  3VS6 A;  2L0A A;  4LUD A;  2R5M A;  4RCC A;  3RER A;  4E7S A;  1FMK A;  3MO8 A;  4D6W A;  4KT0 E;  3I56 Q;  2CDT A;  2RF0 A;  4RTU A;  2MCN A;  2VVK A;  3E19 A;  4KH1 B;  1UEC A;  1D1B A;  2YDL A;  3HFO A;  4FYY B;  1EIF A;  1SHG A;  1OZ2 A;  2GF7 A;  6AT1 B;  3QPH A;  2QQA A;  1EX4 A;  4FM4 B;  2GTJ A;  2KXC A;  1KHI A;  1JXM A;  2J6K A;  1T0H A;  5GAN d;  1MV0 B;  3I55 A;  3I55 T;  1B34 A;  3OW2 A;  3NTK A;  2KEA A;  1K8A U;  1NJI R;  4RKU E;  4AFZ C;  2DA9 A;  1UGP B;  1WJS A;  2KDS A;  2K6D A;  2VGN A;  3L42 A;  1O9S A;  1Q82 R;  1XOV A;  1WHH A;  2CP0 A;  1WJR A;  1HK9 A;  1VQO A;  1VQO T;  1ZSZ B;  1VQL A;  1VQL T;  3C94 A;  4B9W A;  4GLK A;  2XK0 A;  2GQV A;  2K7A A;  3QUI A;  2E6Z A;  3QBY A;  3S3M A;  1WQW A;  1Q86 C;  1GBR A;  4FYX B;  2RI3 A;  4J9G A;  1WFW A;  3PGG A;  1E7O A;  1UGV A;  2RI2 A;  4J9I A;  5IXF A;  3VUB A;  1BI3 A;  1AWJ A;  4M77 C;  1WI7 A;  4FYW B;  3Q1J A;  5GAN 4;  3ASK A;  2LVM A;  2PVD B;  2RD1 A;  3H6Z A;  1YCS B;  2XDB A;  5GAM g;  2QGG A;  2COY A;  3UF4 A;  5D6Y A;  4A53 A;  2ATC B;  2QYZ A;  2DXT A;  4WF2 A;  4HCB A;  3SDZ A;  1OZ3 A;  4JRQ A;  5FU6 C;  2FRY A;  1MMN A;  5J3B A;  1BCM A;  1YI2 Q;  3QO3 A;  2X4X A;  3RIR A;  5KE3 A;  5A2Q E;  4A4H A;  5CKF A;  3QWY A;  3QDF A;  2Y4Y A;  4BUG A;  4E7J A;  1VQ4 A;  9ATC B;  1VQ4 T;  2K3Y A;  4R56 A;  4LD6 A;  2E64 A;  2KVQ G;  2HMA A;  1LNX A;  3NHN A;  3UDC A;  2NYS A;  2DEU A;  3GPL A;  2EBP A;  4C92 D;  2AK5 A;  5LJ5 j;  3P8H A;  2DJQ A;  4PJO E;  4F7U B;  4DEX A;  2EYX A;  1Y57 A;  2EYY A;  2RK1 A;  4QQD A;  2CUB A;  3M4G A;  1QMC A;  4PL6 A;  4OB3 B;  1NEG A;  3OQ5 A;  4M75 G;  2L89 A;  2GCX A;  2RM4 A;  1VQP Q;  5HKC A;  1VYU A;  3OYB A;  4EDU A;  1KSW A;  3QHS A;  3X26 B;  3VS4 A;  1Y0M A;  3KUF A;  4HT8 A;  3PMI A;  2E5Q A;  2GBQ A;  1HYO A;  3GNG A;  3OYJ A;  3SWN A;  3V8J A;  2YUP A;  2A3L A;  1M2V A;  1OU9 A;  3OA6 A;  4RCB A;  3CCJ T;  2CUD A;  4OB1 B;  1KQ1 A;  3M55 A;  3OYH A;  4FT4 A;  3OYC A;  1ABQ A;  5GAN g;  1K73 R;  2ECZ A;  4N4H A;  3OS0 A;  3CCV T;  4FW2 A;  4PJL A;  1VYV A;  1XTD A;  4M77 G;  3CME T;  3URG A;  2LP5 A;  1M1K R;  1PSF A;  5D6W A;  3CMA T;  3I55 Q;  1Q95 G;  1H8K A;  5GAN 7;  4IUR A;  1MUZ A;  1JRI A;  2L3Q A;  2DPP B;  2LZ6 B;  2BZY A;  2HDA A;  4XTV A;  2JMC A;  2LJ0 A;  2HL5 C;  5GAN 2;  5EG2 A;  3OYY A;  1VQ7 T;  1VQL Q;  1M4Z A;  2BIV A;  2QEX T;  3WVD B;  1B7T A;  5I2S A;  3SB2 A;  3QKJ A;  2XU8 A;  4BI4 A;  4ORZ A;  1TWB A;  3E9G A;  3A8G B;  4IUQ A;  5CKH A;  2CZ7 B;  3R6N A;  1Y96 A;  1UJ0 A;  2ZPI B;  2AHJ B;  2XDP A;  1YP5 A;  2L5Q A;  2ED1 A;  5LJ3 j;  1YJN A;  1YJN T;  2I2L A;  4M75 F;  1OPK A;  3R6O A;  2PUO B;  3JCM X;  4DA4 A;  1ARK A;  1IZ6 A;  1KFZ A;  1BU1 A;  2HQX A;  1FYN A;  1UGS B;  1AHJ B;  3CEY A;  1W2B S;  4RUG A;  2K9G A;  4E7L A;  1G83 A;  5L8R E;  4ANJ A;  1AWW A;  2QQ9 A;  3BW1 A;  3ZBD A;  3OYK A;  4M78 C;  2DL3 A;  5GAN 5;  4OMQ A;  1K4U S;  1RI0 A;  4RTW A;  3C0C A;  2J06 A;  2E10 A;  2E6N A;  4J9F A;  1TSF A;  1N8R R;  2PZ1 A;  1YIJ Q;  1D0Y A;  3M5A A;  2CP7 A;  2JJ9 A;  2X4W A;  4AMC A;  2HAX A;  2ED0 A;  5GMK m;  4N0A C;  2DVJ A;  4F7U E;  4QT7 A;  1RAG B;  4ZN1 A;  4C0Z A;  2MF2 A;  4C0G A;  3QII A;  1UHF A;  3A98 A;  2RNA A;  1SSH A;  2JNG A;  2M16 A;  1NBE B;  1PC0 A;  4M7D D;  4HCZ A;  4BE1 A;  3N5B B;  4EIK A;  3CC2 A;  3EG0 A;  1H64 1;  3EFO B;  1TG0 A;  3VUZ A;  3WVE B;  4M77 A;  2O4X B;  3G71 A;  1R77 A;  4JJC A;  2DER A;  3M9Q A;  4M7A F;  1WYX A;  2V1R A;  1VYT A;  1M5Q 1;  1G3T A;  4ZNX A;  3CCM A;  3CCM T;  2OJ2 A;  3A5Z B;  3J81 E;  1ZA2 B;  1KD1 U;  2ZPB B;  2E5K A;  1TS9 A;  3MKD A;  1Q81 R;  4C92 B;  2RO0 A;  3LH0 A;  2DBM A;  3INZ A;  4HVV A;  2RPN A;  3QDR B;  8ATC B;  3CCJ Q;  3VKI A;  1KIK A;  4C5H A;  4PJO C;  2VGM A;  1FMV A;  2A08 A;  1S1N A;  3G6E A;  3G6E T;  4ZGE B;  1KC8 R;  2OTL Q;  4RTV A;  3CCV Q;  3CME Q;  3M57 A;  4OP0 A;  1Q7Y U;  3VRZ A;  2J6F A;  2X3X D;  3CMA Q;  1N6A A;  1RAA B;  1VQ5 T;  3HTR A;  1K76 A;  3VS3 A;  3CC7 T;  4LDU A;  1XQH A;  3CCL A;  3CCL T;  2X4J A;  4QQ6 A;  2FYK A;  1WX6 A;  3EGD A;  1YJ9 A;  2K2M A;  2QK0 A;  3M0R A;  1AT1 B;  3EFS A;  1UJY A;  1VQ7 Q;  1ZQ1 A;  2CSQ A;  2K4Y A;  4IKF A;  5HCK A;  2DLP A;  3BDL A;  4E6R A;  3RR6 A;  3IQL A; 
#chains in the Genus database with same CATH homology
 2G6F X;  2NUZ A;  2AZS A;  1WXB A;  3SHW A;  3CQT A;  4JPB W;  4OMN A;  4RTT A;  1E6G A;  1UTI A;  4JZ3 A;  2YUQ A;  2KT1 A;  2O31 A;  3UAT A;  1N5Z A;  1BBZ A;  3PE0 A;  4X1V A;  2DYB A;  3VS5 A;  1I0C A;  1WLP B;  1VA7 A;  2D8H A;  1ZUY A;  1WA7 A;  4LNP A;  3VS6 A;  1G2B A;  1CSK A;  4CC4 B;  2L0A A;  1U3O A;  4LUD A;  2JTE A;  3REA B;  1QKX A;  2OAW A;  2LJ1 A;  1NEB A;  1FMK A;  1SRL A;  4HCK A;  2W10 A;  2CDT A;  2RF0 A;  2EKH A;  4RTU A;  1SEM A;  3VS2 A;  2MCN A;  2YT6 A;  2VVK A;  1X2K A;  2O9V A;  1HJD A;  1U06 A;  1K0X A;  1JQQ A;  1UEC A;  4Z88 A;  2YDL A;  1Z9Q A;  4IIO A;  4AG1 C;  2C0I A;  1TUD A;  1SHG A;  2KR3 A;  2DL8 A;  2L3S A;  2EQI A;  2KT8 A;  1CKA A;  2LX7 A;  1AEY A;  1WIE A;  2KXC A;  2ESW A;  2GTJ A;  2EPD A;  2J6K A;  1JXM A;  1T0H A;  2JXB A;  1MV0 B;  1B3Q A;  2CT3 A;  2SRC A;  1RLP C;  2KEA A;  3SEM A;  4Z89 A;  4AFZ C;  1W1F A;  2DA9 A;  2X3W D;  2K6D A;  2LCS A;  2BTT A;  1AOJ A;  4LE9 A;  1XOV A;  4CC2 A;  5GJW B;  4HVU A;  2AKL A;  2SEM A;  1AWX A;  5GJV B;  1BB9 A;  3GBQ A;  1GFC A;  1NYF A;  4AFQ C;  1JU5 C;  2RQU A;  1PKS A;  1J3T A;  4LN2 A;  1QKW A;  3M0S A;  2K7A A;  1H92 A;  1EFN A;  5FWC A;  1MV3 A;  4A63 B;  2GGR A;  1GBR A;  4GBQ A;  4K11 A;  4D8D A;  2CH4 A;  2O88 A;  4J9G A;  1RI9 A;  2GQI A;  1WFW A;  1E7O A;  1UGV A;  4J9I A;  3RNJ A;  1NLO C;  4OMM A;  1TUC A;  2EGE A;  2DX1 A;  3H41 A;  2FPD A;  2BZ8 A;  5IXF A;  1M30 A;  1AWJ A;  1WI7 A;  1KJW A;  5IHI A;  2F2W A;  1YCS B;  3UA6 A;  2DM1 A;  3TSW A;  1B07 A;  2M51 A;  3UF4 A;  2IIM A;  2AKK A;  3M0Q A;  3RBB B;  3THK A;  4WCI A;  2EYZ A;  4AG2 C;  2O2O A;  1YN8 A;  3VS7 A;  2LQW A;  2FRY A;  2ABL A;  1AWO A;  1JO8 A;  2JT4 A;  1A0N B;  3QWY A;  3REB B;  2KGT A;  1K1Z A;  2EGC A;  4OMO A;  3NGP A;  1PRL C;  2DL7 A;  3NHN A;  2KRM A;  2GTO A;  1OEB A;  3I5S A;  1GRI A;  1RUW A;  2OI3 A;  5EC7 A;  1Z9Z A;  3TSZ A;  1NM7 A;  2EBP A;  2AK5 A;  5IXB A;  2KYM A;  2DJQ A;  2YSQ A;  1WDX A;  5ECA A;  1WXT A;  5IHN A;  1GFD A;  4DEX A;  1M27 C;  2EYX A;  1Y57 A;  1UFF A;  2EYY A;  4KRT A;  2DIL A;  2O9S A;  1M3A A;  2CUB A;  4JZ4 A;  1GCQ C;  2CT4 A;  4RTZ A;  2XMF A;  2JS0 A;  2BZX A;  1I1J A;  1NEG A;  1W6X A;  3KFV A;  1SHF A;  2QDL A;  2PNI A;  3H0H A;  3I35 A;  4RTY A;  4J9C A;  4DEY A;  1VYU A;  1SRM A;  3VS0 A;  1KSW A;  3VS4 A;  1Y0M A;  2FEI A;  4CC7 A;  3EHR A;  2EGA A;  2K3B A;  2GBQ A;  2C0T A;  2FPE A;  1YWP A;  1V1C A;  2RMO A;  3VRY A;  1X2Q A;  2H8H A;  2YUP A;  1X43 A;  1AZE A;  3PVQ A;  2F2V A;  2CUD A;  2ROT A;  5IH2 A;  1BK2 A;  2KXD A;  4JJD A;  5IHK A;  1ABQ A;  1ZLM A;  2B86 A;  2DL4 A;  2ECZ A;  2HCK A;  2EVR A;  2HSP A;  4J9D A;  3H0I A;  1NLP C;  2C0O A;  1VYV A;  4F16 A;  4J9H A;  2GNC A;  1ZUK A;  2LP5 A;  2KRO A;  1HD3 A;  1JEG A;  1U5S A;  1UDL A;  1H8K A;  2VWF A;  1MUZ A;  2L3Q A;  2FPF A;  2LZ6 B;  2BZY A;  2HDA A;  3EG1 A;  2AZV A;  2JMC A;  2LJ0 A;  1JXO A;  5I22 A;  2JW4 A;  1H3H A;  2FRW A;  2YUO A;  1K9A A;  2J6O A;  2A37 A;  1T3L A;  2J7I A;  1X69 A;  1K0S A;  2JM9 A;  4M4Z A;  4ORZ A;  3M0U A;  3UA7 A;  2D1X A;  1E6H A;  1ZBJ A;  2CH4 W;  1GCP A;  3R6N A;  4AFU C;  1UJ0 A;  2DRK A;  1YP5 A;  4HVW A;  2JS2 A;  2ED1 A;  2W0Z A;  1OPK A;  4GLM A;  3I9Q A;  1ZSG A;  1ARK A;  1X6G A;  4OML A;  1KFZ A;  1BU1 A;  1FYN A;  1ZUU A;  1QLY A;  1OPL A;  1AD5 A;  4RUG A;  1PKT A;  2K9G A;  3I5R A;  1G83 A;  2KRS A;  2DRM A;  5FWB A;  1ZX6 A;  1AWW A;  2CRE A;  1W70 A;  2DL3 A;  2DE0 X;  2HBW A;  4OMQ A;  1K4U S;  1LCK A;  4RTW A;  1UHC A;  4ESR A;  3C0C A;  4OMP A;  2D8J A;  2J06 A;  2JM8 A;  3QWX X;  1RLQ C;  2VKN A;  2RQT A;  3EG2 A;  1X27 A;  4J9F A;  1HSQ A;  1UUE A;  3NPF A;  2PZ1 A;  1UE9 A;  1YWO A;  4F17 A;  1PWT A;  3VS1 A;  4Z8A A;  2KYB A;  2I0N A;  2KRN A;  2L3P A;  2ED0 A;  2DVJ A;  1QCF A;  4QT7 A;  2PTK A;  3LH5 A;  2ENM A;  3TVT A;  1UHF A;  3A98 A;  2RNA A;  3ZL7 C;  1GBQ A;  1SSH A;  3O5Z A;  1I07 A;  2RQR A;  1OV3 A;  3M0T A;  3PVL A;  2LMJ A;  1X6B A;  2LNH B;  4R0K A;  4EIK A;  3EG0 A;  1AZG B;  1PRM C;  2EW3 A;  4CC3 A;  1TG0 A;  1IO6 A;  4J9E A;  2DBK A;  4Y92 A;  2ROL A;  2KBT A;  2YUN A;  4JJC A;  1T0J A;  1WYX A;  2V1R A;  1VYT A;  4HXJ A;  4JJB A;  4AFS C;  4ZNX A;  2OJ2 A;  1SPK A;  4D8K A;  4J9B A;  1YNZ A;  2E5K A;  4IIM A;  1QWF A;  3NMZ C;  2RN8 A;  1CKB A;  1M3B A;  1NG2 A;  2K79 A;  2P4R A;  2CSI A;  3U23 A;  5I11 A;  3JV3 A;  4FSS A;  1ABO A;  2MOX A;  2DBM A;  2KNB B;  2M0Y A;  1PHT A;  1T3S A;  1OOT A;  1NYG A;  2RQV A;  1PNJ A;  2RPN A;  3FJ5 A;  4HVV A;  4F14 A;  2KE9 A;  1KIK A;  2FO0 A;  5L23 A;  2A28 A;  4LUE A;  2F2X A;  2JMA A;  2J05 A;  2A08 A;  1S1N A;  1AVZ C;  2MIO A;  2LQN A;  4RTV A;  3H0F A;  2RQW A;  3ULR B;  3EG3 A;  2EYW A;  2DF6 A;  3VRZ A;  2J6F A;  2V1Q A;  2L2P A;  2X3X D;  1M3C A;  1K76 A;  3VS3 A;  1M8M A;  2LJ3 A;  1QWE A;  2NWM A;  2DL5 A;  1WX6 A;  1GCQ A;  2A36 A;  4RTX A;  2K2M A;  2DNU A;  1WXU A;  3EHQ A;  3EGU A;  3M0R A;  5FW9 A;  1UG1 A;  1UJY A;  2CSQ A;  5HCK A;  2D0N A;  2DLP A;  2HEQ A;  2FG0 A;  3M0P A;  2DMO A;  4E6R A;  3IQL A;  1GL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...