3ER0A

Crystal structure of the full length eif5a from saccharomyces cerevisiae
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
146
structure length
146
Chain Sequence
DAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 5A-2
publication title Crystal structure of the full length eIF5A from Saccharomyces cerevisiae
rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3er0A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3er0A02
4MTNA 2F4VQ 2C35B 2H5XA 4CRIA 1YJNA 1N8RU 1XMOQ 1PVOA 3GTQH 1G51A 1YJ9T 4JC0A 1IBML 3L7ZC 1NZ9A 2ID0A 1KRSA 1QUQA 3CCSA 4A76A 4DR1Q 1XNIA 1HNWQ 3GTLH 4AQYL 2CKZB 2IHEA 2R6GA 2YV5A 2ASBA 1XNQL 2KVQG 3GTJH 3CCRA 3UE0A 1I3QH 2ZJRA 3CCET 4DV7Q 3RLOA 5M3FG 1CKNA 3KJPA 1VQ6T 2Y0SG 3KF6A 1H95A 3NBHB 5M5YH 2LSSA 1NJIU 1G291 1L0WA 4NXML 2L3RA 3HOXH 2E5LQ 3TEHB 4R4QA 1KC8C 3FKIH 4LF5Q 4BXXG 3UDIA 2Q2HA 4YCWA 3I55T 4LFCL 4AYBE 3TQYA 3BZCA 3W5OA 4K0KL 1QVGS 1NY4A 4IPDA 4GLXA 4BBSG 4A3LH 1FGUA 2WP8J 1M1GA 4JI3L 1IBKL 3CPWA 2EXDA 2JUFA 3K80C 3I56T 2IT1A 4KLKA 3HOWG 2VS1A 2E8GA 4JI1Q 1UE1A 2RHQB 2A19A 1X9NA 2N49A 1Q81C 1G6PA 2VQFL 1VQKT 4OXPA 1VQ4T 1VQPT 1E7ZA 2PNHA 3M4QA 4GNXA 1XMQL 3G6EA 1VCIA 2LXJA 4PG3A 2EIFA 3G4ST 4C3JH 4DV1Q 2BA1A 1SN8A 4LF4Q 4H02A 2NVYH 1X65A 2UUCQ 1V1QA 5AJ3L 1PH8A 4JG2A 3I4NH 5IYCG 1N36Q 2YTVA 4HJ5A 1TWCH 3UDFA 2AHOB 2UXBQ 3W1GA 3HOZG 1QZGA 1SRUA 1HR0L 3PIPA 4DAMA 4A3BH 1QVFS 4IJHA 4PZ7A 4XTCS 4X66Q 2CQOA 5M3FH 5GAHC 3I7FA 3WWVA 1MIUA 4LUOA 4DR3Q 1XNQQ 4IFDG 2JQOA 3AFPA 4JI0L 1TWFH 1VQHA 2KENA 3TREA 1K8AU 1QVCA 3I4OA 4DR2L 1Y1WG 1EQQA 4BY1G 1P8LA 3S15H 4DV4L 3F2BA 3CW2C 3STBC 4X62L 3J81j 3M3YH 1V9PA 2KCTA 4A3JG 4BXXH 1SR3A 3DB3A 4DR7L 1FL0A 2OQKA 5GAEC 3AFQA 5GADC 1KQSS 4LW1A 1K9MC 4QJFA 4GKJL 1V43A 4LF7L 4POFA 3E0EA 4GKKL 2CCZA 1YEZA 1IBKQ 2NN6I 3K81C 1VQ9T 1A63A 1VQIA 2RCNA 1X56A 5LMNW 5K36G 3PCOB 2IG0A 1Q12A 1FVIA 3U4VA 3K7UC 4B3TQ 2R93H 3BZKA 3T1HQ 1PA6A 4UP9A 2UU9L 3HOUG 1K0RA 2Q2UA 3CAMA 2B3GA 2PQAA 3PUVA 2LQ8A 3KBGA 3CCMT 1K3RA 3U50C 4BBRG 3K0XA 4DV0Q 4GOPA 1JJ2S 1GD7A 3FP9A 3S2HH 2JNGA 1SE8A 1IL2A 5ELOA 5AJ3Q 5LMNL 1XNRQ 1HZAA 3CD6A 4IOAA 2DO3A 3GD7A 3UDXA 1VQ8T 2MNAA 2NVTH 2CFMA 1N8RC 2Z6KC 3EIVA 3MXNB 2I5LX 4PZ8A 3AQQA 1AE3A 4DV6Q 1S40A 4ZN3A 2HHHL 2UUAL 3TRZA 2JEBI 4OONA 1BBUA 1IXRA 4JBJA 3HKZE 4A93H 4IPCA 1YIJT 1WJJA 3D31A 4GNXB 4NXNL 4JI0Q 3PV0A 4DR4Q 3CP0A 2MWPA 4A3FH 2N3SA 4YWMA 4ALPA 1IBLL 1XPRA 4JYAL 1AH9A 3G71T 1M1KC 4DV4Q 4QQDA 1KRTA 5C3EG 2JE6I 3NENA 1C7YA 5C4XH 2YU9H 4C3HH 2CKKA 3DM3A 3KYHC 2IX1A 2V1CC 3PO3H 3ER0A 3CCUA 3BU2A 4APVA 5IP9G 3CCMA 1NJIC 3GDEA 1J6QA 4DNIA 4YTLA 1B70B 4BA1I 2ZJPA 3RN2A 4GKJQ 2MFIA 4DAYB 2E70A 1CSQA 3GTKH 1EYGA 1U0LA 3A5ZB 1VQ8A 2OTJT 2ZTEA 1YHQT 3P8BB 2AWOA 2VW9A 4L5QA 2Z0SA 1EQRA 4JI7L 3PUYA 1FJGL 4ME3A 4HJ8A 4OO1I 1TWGH 3S17H 4L5RC 3F2DA 1B7YB 2XTIA 3H3VH 3OW2S 2CWAA 1Q8KA 4QQBX 1S72T 1W2BA 2KCMA 4A3GH 4LUZA 4AH6A 2XGTA 4YHHL 1K73U 1PYSB 4MZ9A 1VQ7A 5M3MH 1JJCB 5IP7G 5LMNQ 1PH3A 1EIYB 1GO3E 2HIVA 2ZM6L 4R4TA 4DR6L 3CXCS 3KOJA 4X6AH 2BA0A 3CMEA 4GN5A 4KHZA 5LMUL 1HNXL 4HIOA 3KLWA 4DV3L 2KHIA 4NXNQ 4PZ6A 2JVVA 4A3KG 3PO2H 1WFQA 4DV5L 5C3EH 3JAMc 4A3EH 2IY5B 4GOPB 1M90U 1IBLQ 3CCLA 1YHQA 3CMAT 1VQ5T 1Q86C 1PH5A 4A3IG 1PV4A 4JV5L 4TVRA 1N32Q 3KDFA 3ERSX 5IP9H 3A5UA 1SLJA 3MEFA 3J81c 4DR5Q 4A3CH 1C0AA 3S1RH 1E1TA 4IPGA 4A3MG 3GTOH 2QA4T 1RL2A 5C4JH 1HNZQ 4JI4L 5IAYA 3HFZB 1BKBA 1NPPA 1YBYA 5E7NA 4QGUA 4GLVB 4LF6L 4B3RQ 4O2DA 3J80c 4IFDI 4LFBL 1YJ9A 1CKMA 5A2QE 1E1OA 2WB1E 1YNXA 1TWHH 3KF8B 2MO0A 3W1BA 3PGZA 4A75A 2VY3A 2A8VA 4IPHA 4JI7Q 4BY7G 1YI2T 2PI2A 3H0GG 2HQLA 4UY8C 3JC66 1HR0W 1GKHA 1J5EQ 3CCEA 2F3IA 1VQNT 4TQUS 1VQCA 2ES2A 4KHPL 4YHHQ 1XPOA 4C3IH 1VQ6A 1VQEA 4R4CA 1LM0A 5IYDG 4JI2L 2G3RA 1YHBA 3PUWA 4O0AA 2VQEL 1IBMQ 1OXSC 1T9HA 5FLXc 2QA4A 3ICEA 2MO1A 3K8AA 3CCQT 1RIPA 1HNXQ 1L2FA 3F8TA 4YY3L 3CC7T 1X3GA 3I55A 1LYLA 4LUVA 4DV3Q 4AQYQ 4A3KH 4P71A 3STBD 3CC2T 4LNQA 4ZN1A 2NVXH 4A3DG 4GLAC 4IJLA 1N9WA 1YITT 1UE5A 3HKZG 1WYDA 4GNXC 3I56A 3OTOL 1N33L 2FXQA 1NPRA 2UXDL 5JEAJ 1I94L 4B3SL 3H3VI 4JV5Q 1VQKA 1VQ4A 1VQPA 4UP7A 2K5HA 4LF9L 3HKSA 2NZOA 4NXMQ 2L15A 4JOIC 3G4SA 4YWLA 1QUQB 3RLNA 3RLFA 4JI6L 4BBSH 2DUDA 1K8GA 1EFWA 4LFCQ 1I50H 5BR8L 1LTLA 4GS3A 4HIKA 1Q1EA 1LUZA 2AKWB 3UE1A 4K0KQ 3HOWH 3J7AF 2MWOA 2VUMG 4WJ3M 2VL6A 5M5XH 2DGYA 4JI3Q 3CCJT 3PF5A 3NEMA 1CKNB 2LVMA 5C44G 5JJIA 3HOYG 2KHJA 3M4PA 4DK6C 3KF6B 3KJOA 3JAME 2Y0SE 3H0GH 1SSFA 3KDFB 4RMFA 2VQFQ 1VQMT 4QL5A 1Q1BA 3LGFA 2F52A 1JMCA 5IE8A 1XMQQ 1VQLT 4QIWE 3DLLA 4FDBA 3CC4T 4JBMA 4JBWA 3LGJA 4POGA 1HZCA 1NBWA 3RNUA 1N34L 3J81E 1KC8U 1L1OA 5IYCH 5DM7R 2JA9A 3HOZH 2OTLT 1EIFA 4JI2Q 4HJ7A 4P72A 2VQEQ 1VQDA 1QVGA 5H1SE 1KD1U 1K73C 4X65L 3J80E 1ASYA 3GTPH 3H15A 1NMFA 4Y52H 1HR0Q 3VDYA 4A3DH 1ASZA 1Q81U 2B63G 1DGSA 3PSIA 1UE7A 1A0IA 1Y1VG 2K4KA 1Y1WH 2JA8G 4BY1H 4DV2L 4LWCA 3SGIA 1HZ9A 4X34A 2QEXT 2IHFA 4PMWA 2K75A 3ZJYC 4LF8L 4DR2Q 1VQ9A 4JI8L 5C0XI 4DUZL 4OX9L 1N33Q 5ELNA 4A3JH 2XHCA 1I94Q 2JJQA 4GOPC 4X62Q 3RZDH 3CPFA 1OXXK 2K52A 4LFAL 3S14H 1Z47A 4DR7Q 4NPSA 1X3EA 3E9IA 1YHAA 4JI6Q 4YWKA 2F4VL 1XMOL 2OCEA 2VUMH 2ATWA 3PO3G 4R4OA 5FLXE 3B6YA 5C44H 5IWAL 4LF7Q 4BA2I 2NZHA 3HOYH 2K50A 1QVFA 4GKKQ 1YJWT 2LXKA 1VQOT 4DR1L 1TXYA 1NE3A 4YCVA 4AYBG 4OO1G 1HNWL 1JT8A 1D7QA 3JAMi 3CPWS 3HOUH 3A74A 1X55A 4DV7L 4BBRH 2WB1G 1PH7A 2I0QA 4A4IA 2JK8A 2UU9Q 1YIJA 2RHSB 1OXVA 2OQ0A 3U58A 3J81i 3S16H 1YJNT 4GN3B 1B8AA 1CKOA 5EAYA 4JCVE 2JA5G 1BBWA 1X6OA 3G71A 1KQSA 5M5WH 4UP8A 4C2MH 3CCST 3J7ZC 1QZHA 2E5LL 4LF5L 1A8VA 1WCMG 3J80i 1XTDA 4X65Q 3HOXG 1MJEA 3RR5A 4EX5A 3RZOH 3FKIG 4DK3C 2JA8H 2HHHQ 2UUAQ 3CCRT 1KAWA 2JOYA 1A62A 1O7IA 3CQZH 3S1MH 5JJKA 2K5VA 3I4MG 1UE6A 1I5FA 1VQJA 3FHWA 1IYJB 2PQAB 4R1JA 1L1OB 4J15A 1OXUA 4IO9A 2OTJA 3S24A 5GROA 4JI8Q 4JYAQ 4B3ML 4DPGA 3RN5A 4HJ9A 2JEAI 3T1YL 2UXCL 1JJ2A 1K8AC 4DV1L 5JJLA 1Q82U 3M9BA 3GTMH 1VQGA 1Y14B 3ULLA 2UUCL 2GVBA 3PF4A 1S72A 1N36L 3M7NA 4JI5L 5GQOA 2VNUD 1SMXA 5IWAQ 2N8NA 2UXBL 3I4NG 2GN5A 4QY7A 1YZ6A 3BJUA 1PH6A 1Q7YU 4X66L 5FLMG 2K14A 3EBEA 3G6ET 3J7A5 4DR3L 4OWWB 1M1KU 4A3BG 2VZAA 4MNOA 1NMGA 1FJGQ 2LCLA 1OTCA 4AIMA 1CSPA 1XPUA 4WJ4A 2R7FA 2BH8A 2ZTDA 2JA5H 1WI5A 5IP7H 2R92G 5C0XG 2AWNA 1WCMH 4EQ5A 3M85A 4IOCA 3CMAA 1VQ5A 1KHIA 3U4ZA 1GM5A 1VQFA 2ALYB 4HIMA 1EUJA 1X54A 2JA7G 2ZM6Q 5IT9c 5FJ8G 1KL9A 2KBNA 4DR6Q 3I4MH 4IFDJ 2R7DA 2E2JH 2BH2A 2D0PA 5J26A 2Q2IA 5LMUQ 1GVPA 2WAQE 1KD1C 3AYHB 4R4IA 1SFOH 4L5SA 2JA6G 3M4OH 1D8LA 2MI6A 4DV5Q 4A3IH 3HOVG 3K7AH 1EOVA 1OXTA 4B3TL 4B3MQ 2YTXA 3A0JA 3OW2A 4YCUA 3T1HL 2HIXA 1VS0A 3T1YQ 2UXCQ 2KDSA 3OYYA 4A3MH 2R93G 1S3OA 4DV0L 1JJGA 1YI2A 2E2IH 1PHJA 1UWVA 3ULPA 3AEVA 1XNRL 4L5TA 3ULJA 4JI4Q 4JOIA 3CXCA 1UEBA 1VQNA 4XIGS 2UUBL 4JI5Q 2K5NA 5FLMH 4HIDA 1EWIA 1W3SA 3IRBA 5GAGC 4DV6L 5J3BA 2E6ZA 4RG1A 4LF6Q 2R7ZG 4LFBQ 4BY7H 2ZTCA 1E24A 1TWAH 2IX0A 1Q86U 3CCQA 4DR4L 4A93G 3CC7A 3PUZA 2RF4A 2R92H 2GVAA 3PIOA 3CCVT 3CC2A 2WFWA 3L2PA 1IZ6A 1VQAA 3CD6T 1HZBA 2N78A 4KI0A 4P75A 4A3FG 3S1NH 1YITA 2JA7H 3TS0A 4DKAC 1C9OA 3LH0A 4KHPQ 5IYDH 5LL6S 5FJ8H 1W2BS 1X3FA 5C4XG 2QGQA 1MJCA 5JEAG 2NVQH 1HJPA 2JA6H 2PMZE 2Z6KA 3DB4A 4YY3Q 1XJVA 5HY6A 4DUYL 1CUKA 2MQHA 3HOVH 1U5KA 1YVCA 1KXLA 1JB7A 3CCJA 2I5MX 3PUXA 3OTOQ 5DLQE 1L1OC 2UXDQ 4B3SQ 3CCUT 4OWXB 4X64L 1KIXA 1VQMA 4Y7NH 1M90C 4RG2A 3I2ZA 4LF9Q 3S1QH 1VQLA 3CCVA 3CF5A 5IYBG 3CC4A 2HT1A 2B29A 4OWTB 5IT9E 2R7ZH 4JBKA 4A3GG 2UUBQ 1Q82C 2PI2E 5BR8Q 2A1AA 5M3MG 5IY0A 2AMCB 1Z9FA 2OTLA 2YTYA 1HH2P 3KFUA 2I5HA 2ZJQA 5HGQA 2Q2TA 1SROA 5C0XJ 2NN6G 3E9HA 3L0OA 1Q7YC 2OWOA 1PYBA 4P74A 3S2DH 1I6HH 1VQ7T 3PO2G 1WOCA 3EN2A 3G48A 4A3EG 1R9TH 2QEXA 1PH4A 4HJAA 1N34Q 3TS2A 1N32L 1E3PA 1K9MU 4DR5L 1PH1A 3CMET 3Q8DA 4P73A 1HNZL 4A3CG 1PH9A 3GTGH 2B63H 1BVSA 3D0FA 3NELA 1P16A 1Y1VH 4TVAB 4NB3A 1PH2A 2EQSA 2E2HH 1VQBA 3UDGA 4B3RL 2D0OA 3GO5A 4GN4B 4DUYQ 1PFSA 3LGLA 3CCLT 4A3LG 4JI1L 1K83H 4DV2Q 1YJWA 1AE2A 1VQOA 2WAQG 2YYZA 4LF8Q 1Q46A 1JE5A 2CWPA 4DUZQ 3F2CA 2D62A 4OX9Q 3F1ZA 5IYBH 1E22A 1MKHA 4UPAA 4X64Q 4LFAQ 1NTGA 1J5EL 4LF4L
chains in the Genus database with same CATH superfamily
3VS5A 5JPNC 1LCKA 1YJNA 2QDLA 4MDXA 2OXPA 1ENFA 1G51A 1F9SA 1I4GA 3K5LA 3PO3B 5IGBA 1IBML 3L7ZC 2R58A 3CKIB 4ZTJA 4OELB 1AW7A 1QCFA 1GUTA 5A0GA 3VR2A 4AQYL 2CKZB 1IO6A 1F2LA 3UE0A 2O9VA 4FT2A 2PUOB 2ZJRA 3TQ7P 3HEJA 2HCCA 2DM1A 2MPMA 3R3OA 1JC7A 2PZ1A 2XI9A 3BDUA 2OF1A 1OOTA 3EA6A 2IJ0A 2L3SA 4NXML 5LL6X 1Z9ZA 4R4QA 1DYQA 1KC8C 2EJGA 3UDIA 5M5YB 2RK1A 4M77C 1LTSD 1ZKOA 4XU2A 1QVGS 4GLXA 4LE9A 1LLRD 4U68A 2E1HA 4EMHA 5L23A 3FKIB 4C92F 3EGDB 3I56T 4XXEA 3IAYA 1BI3A 2DX1A 1UE1A 3VS7A 2P0QA 1X9NA 1YWPA 2KJXA 2VQFL 2PNHA 3I5RA 1E7ZA 4GNXA 3NHHA 1XMQL 1VCIA 1MV0B 2LFNA 1B34B 2KEAA 2QDBA 4C3JH 2B2WC 5FW9A 1X65A 2F3WA 4R8NA 1ZSZA 3UWNA 2E74C 4WTOB 1PCXA 2BTTA 1AWOA 2Z6BA 2QQRA 2EPDA 3BG3A 1QZGA 3HOZG 1T3LA 5KE3A 1X75C 3PIPA 1BDOA 4K5XA 2ZCFB 1KLUD 4IUTA 2D9TA 2OAWA 2RHYA 5LJ5g 1KABA 1TWCB 2KRSA 3I55Q 2C06A 4IFDG 1CT1D 1NM7A 3I9QA 2KENA 1JRIA 4A3BB 1ZBXA 1K9AA 4NKLA 4M78B 1Y0MA 1LABA 1P8LA 1VDZA 4BY1G 1E2WA 2F4IA 3FJ5A 3BDCA 5IXFA 4WF2A 3J81j 2HD0A 1QOHA 1I6VC 2DNEA 1VQPQ 1FL0A 4TRDA 5A2QL 1KQSS 2Q8TA 2KSSA 4BI4A 2LT4A 5GMKm 3G4SQ 2CT4A 1GHJA 4QJFA 2AK5A 4C3HG 3MHXA 4DF7A 3E0EA 3P75A 3KK7A 1H3ZA 1X32A 1IBKQ 1WX6A 4M78E 1RADB 5LJ5h 4XTXA 3NQIA 3PMFA 1G5VA 4J6YA 2XICA 1Q12A 1FVIA 2K1BA 4KUDK 1HTLD 1BNZA 2R93H 1W2BP 2EGAA 3BZKA 3TMEA 4CKEA 4DXFA 3T1HQ 3IQLA 2UU9L 3HOVB 2Q2UA 2F5TX 4M75D 2B3GA 3PUVA 2LQ8A 3CCMT 1VMCA 1KJWA 3NMZC 1K3RA 3U50C 4DN4M 4DV0Q 4QCLA 3S2HH 5ELOA 2MUYA 3H91A 5D14A 5AJ3Q 3CD6A 2DO3A 2EQMA 4LDUA 1ZA1B 3GD7A 3UDXA 1AWXA 4C92B 3MXNB 1N8RC 1XYIA 2KXDA 4PZ8A 1MMGA 2KRMA 2JEBI 5JJLA 4FIBA 1NE8A 1RLQC 1ONLA 2CZ1B 2KI7A 1U4PA 1WJJA 4QF4A 2SNSA 2NVTB 1QP2A 1ICWA 4L8JA 4M7AB 4A93B 3G71T 1M1KC 2F2WA 1MV3A 4QQDA 1KRTA 3EGUA 4UC4A 4ZKCB 2J06A 2V8KA 4XYQA 2CKKA 3H41A 4GBQA 4A3FB 4HT9A 1LT4D 1NLPC 2NB0A 4OF1A 1M2OA 3CCMA 1N5ZA 3GDEA 4DNIA 3RN2A 4BA1I 1B70B 3JB9I 2AKKA 2CUDA 2W0ZA 4OP0A 2K01A 3HZXA 3BYTB 3QOJA 4F14A 2O01E 3E9GA 1LPLA 4J9GA 4DAYB 4C3HB 4J9HA 1T5XD 1U0LA 2OTJT 4Y28E 1SJHD 1WXUA 2ZTEA 2SOBA 3GP7A 4RAUC 1MD2D 3J81L 4C5IA 2VW9A 4L5QA 4JI7L 1H3HA 4ME3A 4HJ8A 1A0NB 1EQTA 2XTIA 1UFFA 2QQ9A 1YIJQ 4IKFA 1EYAA 1MI2A 1UJYA 1MMAA 4ULLA 2A68D 4AH6A 2KVMA 2XGTA 4RA8A 5IP7G 2BZ8A 1TWGB 1JJCB 4IUQA 3HP9A 1MMDA 4J6XA 2HIVA 3I91A 4HCEA 1MHWC 4WJWA 5M3MB 1DJ7B 2Z1CA 4KBMB 2J6FA 2KYBA 2KEDA 4KHZA 3X3MA 1WTXA 2IPKD 3CRKC 2CP0A 2C0OA 3ME9A 1M4VA 4PZ6A 4A3KG 2A6HC 4A3EH 4AFUC 1DOMA 4HR7B 1CK1A 3MFYA 4QUFA 3CMAT 5GJVB 4A3IG 1PTOF 4JV5L 5GAMd 5FLXL 3PO2B 5KNBA 1SLJA 3MEFA 4A3CH 1C0AA 2DJFC 1TXQA 1OZ3A 4KD3A 1JQQA 4AMCA 3HFOA 4E7KA 3HFZB 4QGUA 1UUPA 4LF6L 1JXMA 4C5EA 3C1FA 3FB9A 4N4IA 3L2RA 3EQLC 4O2DA 3J80c 3CCSQ 1CKMA 5A2QE 3KF8B 1LVKA 4J9CA 2L0AA 3QJ6A 2DL4A 2VY3A 1D6EC 4BY7G 1PFMA 5KYWB 1YI2T 2B2UC 2HQLA 9ATCB 2PZWA 2HL5C 5CORA 3JC66 1WTOA 2QGFB 1J5EQ 3GP8A 1VQCA 2EBPA 2FZKB 1XPOA 4C3IH 1K28A 4HXJA 4R4CA 2L9HA 4CDFC 3M4GA 2EYWA 4JI2L 2LQWA 1DJRD 1JE4A 5LJ3g 3H8ZA 3L2VA 3JB9H 4KMUC 5DAUA 1OXSC 1IBMQ 1I4RA 3H0IA 3K5OA 3ICEA 3PNWC 1A3VA 1HNXQ 4KKUA 4XDXA 3CC7T 1YN8A 1QWEA 3I55A 1LYLA 1X3GA 4ILWA 4LUVA 4DEXA 4DV3Q 4AQYQ 1I5OB 2NYSA 3RMSA 4ZN1A 1FD7D 2NVXH 5KYNA 1EY8A 3M9QA 4FSSA 2HD3A 1XTCD 2A69D 2Y0SB 5I4DA 1VQKA 1VQPA 2HBWA 2PUKB 3DLMA 3HKSA 2K57A 2NZOA 4NXMQ 3V96A 2F1MA 3G4SA 1O7YA 1QUQB 1QVFP 4JOIC 1I07A 2JYOA 1S5FD 2DUDA 1HTPA 3RLNA 5LJ3h 2QKIC 1EWHA 1Q1EA 2ROLA 2ZZDA 3X25B 1VQNQ 3NBIA 3J7AF 2A37A 4H13C 2JMCA 2DGYA 1HYOA 3CCJT 1EOTA 3NEMA 2LVMA 5C44G 2FPDA 4DK6C 1NJIR 1E2ZA 1LTAD 3KF6B 5IIFA 3H0GH 2Y0SE 1EZ6A 2MMPA 4L6TB 5FKAC 2NBFA 2VQFQ 1ZYRD 4C0ZA 1V1PB 5C5MA 1KNEA 4OL7A 1GL5A 3INZA 1XMQQ 4QIWE 4POGA 4JBWA 3RNUA 5KYUB 5CKEA 3J81E 2BCOA 1KTKA 4KH0B 5DM7R 1ICFB 4N8FA 3UPUA 4ZAIA 3HPWA 4RHRA 3OS0A 2JA6B 3L3OC 1VQDA 4M75F 1M9SA 4IIMA 1QVGA 2J0TD 4X65L 1ASYA 1GXDC 1Y96B 4ORZA 4EIKA 3RKXA 1R4PB 1C4QA 1DGSA 4QUCA 1A0IA 1Y1VG 2K4KA 3ASKA 2CSIA 1Y1WH 2JA8G 3GTPB 2A28A 4DV2L 3OSSC 4LWCA 3SGIA 3T16A 2RHXA 4PMWA 1R4QB 5LHY1 3ZJYC 2X51A 4OX9L 5FU7B 3P8HA 2K3BA 1EY4A 4UAIA 2WINB 3S14H 3QWXX 3E9IA 4A3JB 4YWKA 2BZXA 1OV3A 1VQLQ 1PYWD 2OCEA 2VUMH 3SVMA 4Q5WA 5D6YA 3O8VA 5FLXE 1Y8NB 2RDFA 1TWBA 1CQVA 3A8HB 3URGA 4OMOA 1YJWT 2MIOA 1VQOT 5KCOA 4UHVA 5J22A 5FU6B 4IUPA 1WD1A 1XX8A 1FYNA 5AT1B 4QKUA 5E4WC 1LO5D 1X55A 4ID6A 2WB1G 2NTSA 2JTMA 3EGDA 5D3IB 1N9SA 1WTPA 1YIJA 1FR3A 2UU9Q 2MF2A 2K5DA 2OQ0A 3J81i 3S16H 2CYZB 4BY6C 2N55A 3KXTA 1TH7A 2I0NA 4GN3B 1MGQA 4KY5A 4BBRB 2AHJB 5DLOA 2QEXQ 4J9FA 2FFKB 4IUNA 2JA5G 5HCKA 1KQSA 1QZHA 4ELYC 4UP8A 1WHJA 3CCST 4LF5L 1B34A 1ZXTA 1OPKA 4IQZA 4DBRA 2DD4A 4FXGC 1LNXA 3R93A 1O7LA 3JCMb 2HNIA 4RKBA 3RKWA 3CCRT 1S5BD 1TR5A 3QB3A 5M5WB 4C0FA 2EYPA 1D3BA 1UE6A 2KNBB 2HAXA 3KLSA 5KYXA 1L1OB 4J15A 2ZXPA 1LTGD 2DXCA 1H8KA 2DY7A 1BI0A 4IO9A 2KQWA 3S1MB 3PTAA 4LN2A 4JRPA 4DV1L 1X43A 5GAMj 1Q82U 4M78A 1VQGA 1Y14B 1Z6HA 4M75B 3V05A 3ZFJA 1SYEA 4QMGA 1ACMB 5GAN7 3M7NA 5AYFA 2F0KA 3A1PA 1GUOA 1SG5A 1PKSA 2LJ0A 1SMXA 2GN5A 4QY7A 2RNAA 2A68C 2EY1A 2DVJA 1ENAA 5IHIA 2P84A 1IKLA 2FMMA 3G6ET 2FB7A 4MNOA 4LNPA 5GMKe 2LCLA 3LX7A 4FXKC 4AIMA 1M30A 1TTHB 1ENCA 5A0DA 3KLSX 2MK5A 1X69A 1U4MA 3DWQA 4U673 1CKBA 1PRTD 2E3IA 5I21A 2K7AA 4BACA 2IVWA 3TZDA 2D0QB 1HA5A 4AT1B 4K6LA 3NQTA 4Z8AA 4J9IA 4KKTA 1VQFA 5GAN2 2ALYB 1OPLA 1EUJA 1RDPD 3UF4A 2WV6D 2JA7G 1KL9A 2KBNA 5C6AA 3I4MH 4IFDJ 3OTOL 2DJGC 2LKVA 2HSPA 4IIOA 1KQ1A 5J26A 4DA2A 4F04B 1GVPA 3H09A 2RBMA 2VYTA 1KQ2A 4R4IA 5CV6A 3MXNA 4B08A 1SFOH 3QUIA 2JA6G 1OX8A 2MI6A 1K73R 3M59A 1EOVA 3K7AH 4B3MQ 1M2VB 3AT1B 2HIXA 5I2SA 3OIQA 3OYYA 2NVXB 2X4JA 2CUBA 2V1QA 4RTWA 3RMQA 4M7AA 3RMHA 2E2IH 1JJGA 4J7IA 2SRCA 3ULPA 3QHSA 3ULJA 1H9KA 2KCCA 1ZSZC 5CKDA 1VQNA 2UUBL 3VYTA 4R55A 3JCMQ 3IRBA 4LF6Q 3J7YW 5JPMC 4DV6L 2E6ZA 5J3BA 4L6V5 2RA4A 4DGZA 2X35A 4KULA 2WSCE 4XTUA 4C8QD 2FINB 4HCKA 2XKOC 1Q86U 1SSHA 1Q3LA 1PXUA 2RF4A 2GVAA 3PIOA 2K04A 2QASA 2MPXC 1TWAB 2DL7A 1IZ6A 2NUPB 4KI0A 3H0GB 1IW7D 2L3QA 3TS0A 4PQXA 1C9OA 3LH0A 4EMKB 5LL6S 1OI1A 3KBXA 3UT1A 4FW2A 1F2YA 3WXMB 3ONAB 1X6BA 5JEAG 1RAHB 4J8OA 3E6ZX 2LCCA 2L5QA 4CI0C 1HFGA 1AWWA 4NP5A 3O5ZA 3K57A 4OB0B 4PJNA 2PMZE 3LNNA 3DB4A 3QYGB 2RO0A 2DTOA 2Z0WA 2MQHA 3SHLA 1N6AA 4H7BA 1YVCA 2PCFB 2OEOA 2F1LA 2M00A 3MXGA 1GUSA 3PUXA 3MP8A 2A6EC 4OIJA 5DLQE 1WHMA 3QYHB 1QJOA 3CCUT 1AN8A 2DBMA 3OQ5A 2YRDA 1M90C 1QMCA 4M7DF 3S1QH 1VQLA 2X3XD 3NBHA 2R7ZH 5GAN6 1F9QA 2NUTA 1FGBD 5EBCA 3TCJA 1Z9FA 3TDQA 1BF4A 1D1BA 4CC2A 2LMJA 2VUMB 2DXUA 2ZJQA 3OYFA 1SMYC 3FLGA 5GMKl 3NPPA 3J7AV 2I2LA 1O9SA 1QILA 2NN6G 3VA5A 4VUBA 5FRMA 4M7DG 2M16A 1KDAA 4RHSA 5C3WA 2OWOA 3MP1A 1VQ7T 3MKDA 2RQVA 1G8ZD 2QEXA 1HPCA 4HJAA 3SFMA 3TS2A 1N32L 3MXUA 1ET9A 3K5NA 2PNIA 3CMET 2GQVA 1NCVA 3S16B 2X6GA 3A8GB 2F0QA 5CV5A 3D0FA 2B63H 4BI8B 2ED0A 4F7UE 1P16A 1BQQT 2EY6A 3NELA 4NB3A 4FYWB 1UTIA 3A8IE 4TVAB 2SNMA 3UDGA 4B3RL 4GN4B 3ITPA 4DUYQ 3LGLA 3GTGB 4XU1A 3EFRA 4A3LG 4HAEA 4J5YA 1K83H 1IL8A 3A8JE 5GANd 2WAQG 4II1A 4DV2Q 4OB1B 1Q46A 2AKLA 2D62A 4EQOA 4OX9Q 2F2XA 2Z8LA 5K5PA 1X27A 4ELZC 1E22A 2QGGA 2V1CC 3PO3H 1NEBA 4IALA 2H5XA 3SEMA 4C1NK 1ZX6A 3D8GA 3GTQH 1KNAA 4E7IA 1PLFA 1V8QA 1KRSA 2F0TA 3TVTA 1QUQA 2GNCA 4A76A 2F5KA 4NS5A 1ZQ1A 2HDAA 3A8LB 1TQOA 1WXTA 1SHFA 1G8XA 1I3QH 3CCET 5M3FG 3KJPA 3W2DA 4DK0A 4DAVA 3GTLB 1VQ6T 3DMUA 3KF6A 2B2UA 2LRQA 3CCLQ 1YHQQ 5M5YH 3GTJB 1XQHA 1A3TA 1NJIU 1CQFA 1G291 4L63B 2RD1A 1L0WA 3U9SA 2L3RA 2P5ZX 4DBHA 1OO9B 2AUJD 2EOTA 3FKIH 3FVQA 4LF5Q 4NDXA 4M4ZA 2EW3A 3E19A 2Q2HA 4YCWA 2V8IA 3W5OA 4XQNA 5GAN5 1NY4A 4BBSG 5CKBA 3HOXB 1FGUA 3OWFA 1IBKL 1M1GA 3VUZA 3K80C 2EXDA 2JUFA 1WYXA 2RB6A 3X20B 3HOWG 3I4MB 2AIRB 1K76A 1Y96A 2D8JA 2DNUA 2MAMA 1Q81C 2A19A 1OX9A 2CQAA 2EY2A 2N49A 1PFNA 1E6GA 5KIXA 4PG3A 3SK8A 1AVZC 2EIFA 1AZGB 4DV1Q 2HMAA 4XYOA 3RESA 2VB3X 5I9PA 2LMCB 5AJ3L 1W6JA 2D0NA 2E75C 2YTVA 2O2OA 1PRTC 1TWCH 2RPNA 2EVRA 2AHOB 2PYKA 2NVYB 5JOBA 1DONA 2AZVA 3FMCA 2EJ9A 1HR0L 1BCOA 5CC4A 3I4NB 4A3BH 2GBQA 1UB4A 2QA4Q 2ATCB 3W3AA 3M0UA 4IJHA 5BN5A 4PFOA 2F3VA 1XNQQ 1RI0A 3X3NA 5GAMg 2JQOA 4ZNXA 3AFPA 4ZK9B 1EQQA 1K8AU 4DR2L 2AZSA 1FX7A 3NK9A 3HS0C 3I56Q 1FWZA 4QVDA 2ZPHB 4DXGA 3STBC 4X62L 4C8QF 1BO0A 2KCTA 3BYYB 1BIBA 3UDCA 1Q7YR 1HK9A 2D5DA 5GAEC 3LWHA 3S15B 4PJOF 1U06A 1KAAA 2L4NA 1V43A 4K8IA 4LF7L 4POFA 4GKKL 4XTWA 1QCOA 1S5CD 1YEZA 3K81C 4CKCA 3D4DA 5EQ0A 1A63A 1VQIA 2RCNA 1X56A 4HVWA 5K36G 1RD9D 2IG0A 1U4LA 3U4VA 2B86A 3I8ZA 3HOUG 1K0RA 1SF9A 4BB7A 3CAMA 1VF5C 4PJOG 3RUXA 1A15A 1JORA 1JJ2S 3FP9A 1PRTB 1SE8A 4G7HC 1HZAA 5EJWA 4O5VA 2MNAA 3SHWA 2NVTH 1IW7C 2CFMA 2XRSD 4DV6Q 1BIAA 2I5LX 1S40A 2B8FA 2R7ZB 2M02A 4JBJA 2KR3A 1IXRA 1RLPC 2Q8RE 1H9JA 3HKZE 1ZUKA 4A93H 4JI0Q 2CH4A 4FU6A 4OB3B 3JCMd 2VXWA 3SK4A 3SD4A 1UGRB 4A3FH 4JYAL 2RJEA 1SEMA 3NXWA 4DV4Q 5C3EG 2DJZA 3OWEB 4C0GA 3A56A 4HVVA 1ABQA 2DEUA 4RGNA 1HXYD 4CC7A 2YU9H 4C3HH 5T1IA 3ER0A 1MSGA 2K79A 3PVLA 3BU2A 4APVA 5IP9G 4MZMA 1KFZA 4GKJQ 5C4XB 3JAML 1KDBA 2DILA 2R57A 2E65A 2E4HA 3BVZA 3HTRA 1EYGA 3TP8A 1YHQT 1B4OA 2DYIA 3DEPA 1YWOA 1SKUB 3C3LA 2F0VA 2Z0SA 5KYLA 2RDGA 3T53B 1FJGL 4C8QB 1TWGH 3FDTA 5IGCA 4L5RC 1B7YB 2RJCA 1CTMA 4K14A 1M2VA 1K73U 1SYBA 4MZ9A 3AB9A 5M3MH 5LMNQ 3A98A 1EIYB 3G71Q 1GO3E 5CK9A 4A3GB 4KGXB 3D3RA 3CXCS 3KOJA 2EYYA 2BA0A 3MVVA 3QDRB 3GBQA 4GN5A 1HNXL 3OOCA 4HIOA 3GTQB 5CVIA 4DV3L 5D7UA 3CEYA 1NAPA 1PTOD 2HDMA 4XQJA 4NXNQ 3GQBA 3PO2H 1WFQA 1M1FA 2DIGA 2EKHA 3LYIA 3V8KA 1WHHA 3H0FA 1TUCA 1U1SA 4GOPB 3CCLA 1YNZA 1YHQA 2OTJQ 1VQ5T 1PH5A 4OGCA 3ND8A 5D6WA 1FXXA 1N32Q 2DMOA 1OZ2A 3M57A 2P4TA 4M78C 2COZA 1I3QB 1WA7A 3IKJA 2GTOA 1E1TA 4A3MG 3A7AB 2QA4T 1RL2A 5KYYB 4I7AA 1WTQA 4JI4L 2DETA 4TSSA 5IAYA 1JWSD 3NWTA 4M77F 4PNOA 4EMKA 1NPPA 1LT5D 5E7NA 1Y71A 4GLVB 4B3RQ 3GTOB 5IGFA 3OHXC 5C4JB 1AZPA 5C6SA 1YNXA 3META 1K9MR 1B53A 1Y8PB 2BE5D 2MO0A 4H0LC 3W1BA 4IPHA 4KJOA 1NR2A 4XAXB 3BZDB 4JJBA 4AFQC 5IHNA 4MDWA 2YLCA 1M3AA 2AQ1B 1TWHB 4B6MA 4IZ8A 2KHSA 4M77G 2ES2A 1SNPA 3HG9A 4K11A 1TUDA 1LM0A 2VVKA 3CMAQ 1YHBA 3PIO3 4O0AA 4K5WA 1EYDA 1RAGB 2QA4A 1RIPA 2PTKA 4OMFB 1L2FA 2MJ8A 3F8TA 4A3KH 2YSQA 2J7IA 3OB9A 4C92C 1RI9A 4P71A 1QWFA 4LNQA 1Q82R 1SE4A 4A3DG 5GAN3 2BZYA 3D7SB 1EL0A 2FPEA 4IJLA 3MEAA 1YITT 3I56A 4RCNA 2B2TC 4RGMA 4J7FA 1PMRA 1NPRA 4F7UA 5JEAJ 2FRYA 4M7AC 2DNCA 1CFMA 5GMKj 3MJXA 2K5HA 5FO9B 1YI2Q 2XD0A 1DOLA 1L0YB 2K6DA 1K8GA 2LY7A 1JWUD 1VYTA 2QK0A 5JVH3 4GS3A 4HIKA 2GGRA 1LUZA 3K59A 3C12A 2MWOA 4QW2A 3MPUB 4WJ3M 2R5MA 1PTOH 1CKNB 3VUBA 3HOYG 4HCZA 2KHJA 2FZGB 3KJOA 2AQ2B 3JAME 1SSFA 1WLPB 3KDFB 1VQMT 4QL5A 1Q1BA 2F52A 2NZ1D 4PFPA 2DXBA 4N4GA 3CC7Q 2HL3A 2JM8A 1NBWA 1N34L 2FHTA 1KC8U 3VR5A 2F0HA 5IYCH 4XT1B 4FF1A 1K8MA 2L3PA 3WDNA 4F16A 3S3NA 2ABLA 1YFNA 2JA9A 2F0GA 1EIFA 1OQKA 3VJPA 2D2CC 4DA4A 1Q95G 3QSUA 3GTPH 1M4ZA 2BDOA 3WOEA 3RERA 1HR0Q 3HOZB 3NFCA 2ESWA 2HKQB 3Q24A 3PSIA 1UE7A 1WI7A 2RHIA 1MMNA 3MEVA 4OGQC 5I22A 4FM4B 4Z88A 1HZ9A 1I0CA 2K75A 4DR2Q 5FROA 3Q0AA 1E6HA 3CCJQ 1JB3A 1LTID 2OT2A 3HFNA 3DWPA 4HTHA 4A3JH 4BD3A 1I94Q 4BY1B 4X62Q 3CPFA 3GNGA 1KDCA 2DN8A 4C92E 2XSCA 2F4VL 4WORA 1PD0A 3CCVQ 1C6VX 4J83A 1Q86R 1M8MA 1STNA 2KROA 5C44H 1I4PA 1FNWA 4LF7Q 4GKKQ 2H8HA 2V4DA 2LXKA 1IGUA 4M7AE 1VIEA 2K33A 5GAOq 3KUPA 4YCVA 4AYBG 4OO1G 1D7QA 4WCIA 3JAMi 1PRMC 3CPWS 2HKNA 5LJ5e 2O4XA 4P5NA 4HMIA 4RKLA 4BBRH 5I2XA 3TP7A 4A4IA 2JK8A 3U58A 2COWA 1YNJD 1STBA 5A35A 1WHKA 1B8AA 5EAYA 4JCVE 1BBWA 1X6OA 3G71A 5M5WH 1R8OB 1JWMD 3LWUA 3MO8A 4KY7A 1WCMG 1XTDA 4PMBA 2VB2X 4N0AA 5FO7B 2EYMA 4AFZC 4DOVA 3OYGA 4EX5A 2JA8H 3C0CA 4IUVA 1UHCA 3S1MH 5I6YA 1FNVA 1G3WA 2RQTA 4E6IA 5JJKA 2BE9B 5GAMf 2KOLA 3FHWA 1IYJB 3OW2P 4PJMA 5EBDA 4BE1A 1WNLA 1OXUA 1BUVT 2BDNA 2OTJA 3S24A 1YJWQ 5GROA 4JI8Q 1VQOQ 4JYAQ 4B3ML 4DPGA 5IT9L 3JCMW 2VC8A 3EHQA 1H9SB 4QT7A 4CC3A 1JJ2A 3WOFA 5D65A 2K9GA 3M9BA 2MHVA 3ULLA 2ASBA 4C3JG 1NR4A 4JJNK 2DL3A 2VNUD 1U3OA 5IWAQ 1G6ZA 2EZVA 2ZXOA 3GPLA 3VYHB 1YZ6A 3BJUA 2HCKA 1RABB 1Q7YU 2BKDN 3DEOA 4X66L 5FLMG 3V8JA 2QXFA 1T0HA 4DR3L 1M1KU 2QCPX 2F0DA 2VZAA 1SNQA 3PQIA 1FJGQ 2WIIB 2A3LA 1CSPA 3V2TA 3RR6A 4F17A 3CCRQ 1QWYA 2A5HA 3MC0B 4KJNA 2BH8A 4KN7C 2ZTDA 2JA5H 1WI5A 1PTOC 2MGSA 3EG1A 4KTAA 2R92G 2HEQA 1VF7A 3ERQA 4RH6A 3M85A 2ZPIB 3I4LA 3CMAA 3C94A 3FJPA 1GM5A 2DFUA 3CU7A 1QB5D 5FJ8G 4AG2C 3D4RA 1BK2A 5GANg 5KEEA 1SNMA 2VXFA 4CJ0B 1WPYA 2W10A 2K5WA 1PD1A 1ZLMA 2EQIA 1YNND 2G9HD 5F2DA 1WDXA 3AYHB 1SYFA 4ANJA 1YJ9Q 1D8LA 3M0QA 1NG2A 1RAEB 1ZA2B 4M8AA 1OXTA 4A3KB 1AEXA 1WQ7A 1I4XA 1SEBD 1K0XA 2YTXA 4S3SA 2EGEA 4A54A 3T1YQ 1RAFB 2KDSA 3M4OB 2UXCQ 3G6EQ 3K5MA 2R93G 1S3OA 5EC7A 4A3IB 1YI2A 5FU7C 2ROTA 5DNFA 1PHJA 3A55A 3BS1A 4L5TA 1XNRL 1G3SA 4JI4Q 4A4EA 1QVPA 3E3XA 3CXCA 1HUMA 4XIGS 1JR0D 4JI5Q 2CH4W 3HRUA 2KXCA 1W3SA 4MZTA 2K5FA 4JDSA 1GRIA 4KGVB 2PU9B 4BE2A 1TWAH 4O1NA 1OU9A 2VGMA 2LCSA 3V8LA 5FU6C 3OYCA 2N88A 4DR4L 3QZ9B 3CC7A 1PTOB 4JVZA 2C9OA 4A4GA 2EYLA 4BY7B 3CCVT 2IIMA 4HA8A 3L2PA 1VQAA 3R2TA 1FMVA 2K03A 4R8IA 5IYDH 1GFCA 2JA7H 3A7LA 4X9CA 1W2BS 2JTFA 2KT1A 2Z9HA 2CGHA 1X3FA 1LTBD 5FO8B 1X6GA 1STYA 2E5KA 2FMCA 3VYSA 1HJPA 1ESRA 1W6XA 4F7XA 2JA6H 1BI1A 4FO2A 1XJVA 5HY6A 4DUYL 4OMLA 1JICA 2YUNA 2GQIA 1KXLA 4M7DD 2FEIA 1CHQD 1PWTA 3CCJA 1SBBB 2I5MX 1JB7A 4ME7A 5IN1A 1UE9A 2PQEA 4A63B 1L1OC 1XJWB 3T56B 4TKOB 3HRZC 4OWXB 4PMCA 3A54A 5E3FA 1TVXA 3CCVA 5IGEA 4X9DA 2M0OA 3VR3A 3L2UA 1D1CA 5IT9E 4K6DA 3VYUA 2A74C 1Q82C 2PI2E 4E6RA 4Y7NB 4M75C 5LJ3e 5IY0A 2AMCB 1K8AR 3URYA 3GLXA 1QQJA 2LJ3A 2PVOB 2VWFA 5KYYA 1HH2P 1W6KA 3K6OA 5ISRA 3UATA 4FVMA 2EE1A 2V26A 5GAOm 1WVLA 3EFOB 5GJWB 5C44B 5C0XJ 2QF7A 2FYKA 1B07A 3E9HA 2CREA 3BFMA 2QDYB 1WTRA 1TY2A 5GMKi 2YRCA 1N34Q 4A3EG 1PH4A 1BYMA 1J3TA 2Z4HA 1K9MU 4DR5L 3VS0A 2SDFA 3LW5E 1STAA 3Q8DA 1H641 4P73A 4A3CG 2F0UA 3CCUQ 3GTGH 2F69A 2E2DC 2TSSA 2LT1A 4DNRB 1STGA 4DK1A 1PH2A 2E2HH 5I6WA 1QCBD 3N52A 3JV3A 1PFSA 4CC4B 1YJWA 1Y1VB 2JA8B 1VQOA 2DBKA 2YYZA 2PO4A 3DXJC 2EJFC 3JB9F 3TSZA 1EFNA 3ZBDA 3F1ZA 3MWYW 2E6NA 1KD1R 1LT6D 1STHA 4D8KA 1NTGA 4OGEA 2COYA 1F2ZA 2GA4B 2H3EB 1B3AA 4NMZA 2F4VQ 4MMLA 3MEUA 4CRIA 2K7VA 1G2BA 3QOLA 1VQ7Q 4GZYC 2M2LA 1YJ9T 1YNJC 2B2VA 4C3IG 2AQ3B 3M4YA 4ESRA 1Y69U 2ID0A 3JCMg 3CCSA 3RDVA 1UGVA 1V29B 3VS4A 3JB9G 4JJDA 3CMEQ 2NN6H 2O2LD 3GTLH 2SEMA 2EVBA 1XNQL 3GTJH 3CCRA 4ZGJB 2J4XA 4HSVA 1FMWA 1FYCA 1CKNA 1TS2A 1EYCA 4M75E 2WB1B 4CBVA 4KGZB 5IGGA 1H95A 5LJ5d 2LQNA 1D1AA 2AUKA 4X3TA 3FEOA 2K2VA 2KEEA 4C5GA 4JZ4A 4GLMA 3HOXH 5IH2A 1EIGA 3TEHB 2QQAA 2JA5B 4BXXG 1IKMA 2L8DA 4EMKC 2ECZA 2RQWA 4EQPA 4LFCL 5KCHA 3ULRB 2A08A 3TQYA 4IPDA 4A3LH 3PMIA 4JS4A 4FT4A 3OMGA 1L0XB 2X6LA 1SJED 3CPWA 1B3QA 1O80A 4KLKA 2IT1A 2J7ZA 2VS1A 4C92A 4OHJA 4RWSC 1F77A 4R56A 4DNTB 3L42A 3V7RA 1VQ4T 2JMAA 3M0RA 3G6EA 3EFXD 4KH1B 2B2TA 1CSKA 2KA7A 2F0SA 4QVCA 2BA1A 4H02A 2NVYH 4IN3A 4JJCA 3CCEQ 1B7TA 1V1QA 3I4NH 1VQ6Q 3M53A 3GIBA 7AT1B 1SE3A 1ZEQX 2CW0D 1CZWA 3UDFA 2JJ9A 4KY6A 3BY7A 3VV0A 1O7ZA 1SRUA 1F9PA 3MXPA 5EG2A 2EYXA 4DAMA 1QVFS 2FVUA 4X66Q 2CQOA 5M3FH 3WWVA 4A53A 1AWJA 4LUOA 1KIKA 4DAYA 4DR3Q 4JI0L 1KSWA 2RJFA 1TWFH 4KHVA 2O5IC 1QVCA 3I4OA 2EWNA 1Y1WG 1D1IA 4PJOD 3S15H 4WRDA 1B1ZA 4DV4L 5BN3A 3A8KE 1V9PA 1KLGD 1SR3A 4PL6A 3DB3A 1S5ED 2JP1A 5G3LF 4DR7L 1C0MA 4ZCKA 2OQKA 1NSNS 5ELDA 2ED1A 1TKWB 4GKJL 3M3YB 2JA7B 1WJRA 2F0IA 1NUCA 2A69C 4LK1C 1NNXA 4Z9CB 2CCZA 1SRMA 1SDFA 3L2WA 3EHRA 4LAAA 4PKCC 1VQ9T 4F7UG 2D9UA 2B8GA 2GCXA 3OS2A 5LMNW 1B50A 1UAPA 3HRTA 4N9PA 1GHKA 4V2SA 3H0HA 1U9RA 2K6AA 1QE6A 2R5AA 1PNJA 3S6WA 3CCQQ 4ZQ3A 4FXDA 4HEDA 2RI5A 3E0JA 1GUWA 3AU7A 2LNHB 3K0XA 3CHBD 1XNRQ 1ZYRC 5LMNL 1TS3A 1H9SA 5EKIA 5DM73 3QBYA 2EJMA 1TU0B 4BS9A 2E5QA 4Z89A 3LWIA 2DKGA 2RM4A 2XWJB 4HSPA 4X1VA 3CBOA 5T1GA 4G7OC 2Z6KC 2UUAL 1AE3A 3C46A 1M5Q1 2RQUA 4ZN3A 4CKBA 3SWNC 2RQXA 4GNXB 4LD9K 4NXNL 1NBEB 2DERA 1XWEA 3PV0A 4DR4Q 1I1JA 2EQUA 2M0YA 5CQYA 3SB2A 3OYLA 2L1BA 5J1ZA 4YWMA 4ALPA 1D0ZA 1SXTA 3PMTA 3KF8A 1NEGA 1C8CA 2K5IA 3QJYA 3VKIA 2F0FA 2JE6I 1C7YA 5KYWA 5C4XH 3DM3A 2IX1A 4DFAA 2DRKA 2EGCA 1TY0A 3QO3A 3CCUA 1JOOA 2WKCA 2YDLA 2DLPA 1NJIC 1J6QA 2WSFE 3H94A 4OMQA 5GANf 2ZJPA 2CZ6B 3GF5A 3HRSA 5CV8A 2JW4A 3H6MA 2MFIA 3HGBA 4RFBA 3CBPA 2E70A 3S3OA 3G7LA 5NUCA 1GBRA 1CSQA 3A5ZB 1U4RA 1KC8R 1TS9A 5ELCA 3NGPA 3HSBA 2XN9C 3OPOA 2E2HB 1RTOA 4E47A 3PUYA 1J8IA 2JN4A 3NWSA 2G6FX 3GTKB 3MEWA 4NOYA 3F2DA 1R77A 5FWCA 3H3VH 2CWAA 1Q8KA 1S72T 1W2BA 1PDQA 2KCMA 3J80L 4LUZA 1VIFA 4A3GH 2ENMA 1BCMA 4DBQA 1VQ7A 2DY8A 1UGSB 1PH3A 1ZUYA 4Y91A 2F0OA 2ICEC 4N0AC 2ZM6L 4R4TA 4DR6L 3C4SA 4X6AH 3SWNB 3CMEA 3EG3A 3RIRA 2BUDA 3G7ZA 3RD4A 2KBTA 1U5SA 3KLWA 1GFDA 5LJ3d 2MOXA 3AHUA 4MTKA 2JVVA 3FPUB 4DBFA 5C3EH 1RAAB 1TG0A 2IY5B 1M90U 1IBLQ 1YCSB 5C4HA 3BE3A 4XU3A 4M77D 5A0LA 4M7DB 4RCCA 1EY9A 1UG1A 4RCBA 4FSXA 4TVRA 5LJ5j 5FWBA 1EY6A 2QILA 1V1PA 3ERSX 2IWHA 5IP9H 3J81c 3A5UA 4DR5Q 4IPGA 2QI2A 3GTOH 5ELBA 1DD2A 1JOQA 5KYUA 5C4JH 3MFGA 4L59A 4RMOA 1K8OA 1BKBA 3NP8A 1YBYA 3S1RB 1WGSA 4IFDI 4LFBL 1EZZB 1RACB 1TUGB 2DE0X 1SNDA 1P92A 1JQYD 1E1OA 2CT3A 4M7DE 3PT9A 1TWHH 4KN4C 1AP0A 5EPKA 3PGZA 4C5HA 4J1MA 4D6WA 4OO1H 5L8RE 1AHJB 2WAQB 2PI2A 5C0XH 1OEBA 4OB2B 4UY8C 4LF8L 3H9NA 5FRNA 3VRYA 2XG8D 4A4KA 3CCEA 1GKHA 2F3IA 4TQUS 1HR0W 4KHPL 4J8QA 2F03A 2M1HA 4YHHQ 4JK1C 1VQ6A 3M55A 4PV1C 2G3RA 2K32A 1VQ5Q 3TU4K 5GAN8 1D1KA 4PLLA 5FLXc 2MO1A 3K8AA 3CCQT 4YY3L 4JRKA 3BW1A 5EGTA 3SE0A 3CC2T 1G2SA 1UJ0A 3RNJA 3E9FA 4KK7A 2QTVA 1UECA 1RHPA 1N8RR 3HKZG 1A2TA 2L2PA 3JCMc 4B9WA 4F8MA 2JZ2A 5KGUA 2KT8A 3OYHA 2CP6A 1CI3M 2FXQA 1LJOA 5M3FB 2F0WA 1I94L 4B3SL 1WHLA 1U1TA 2SEBD 2DZ9A 1TWFB 1DZ1A 4UP7A 4BDZA 2M9VA 8ATCB 1O78A 3D4WA 1ILQA 2EKOA 1H92A 1M1KR 1WZOA 2RMOA 1MBYA 3WVEB 1EFWA 1TOVA 2LNVA 4LFCQ 2AKWB 1Q8IA 5C5LA 2VL6A 2LS01 3PF5A 1UUEA 4BBSB 4JLIA 5JJIA 4ZTFA 1I50B 3M4PA 2HUGA 5GAMh 1RF2D 3HOWB 3F2UA 3BVMA 2K2MA 2DTHA 1JMCA 3I5SA 4HVUA 4JBMA 1BCPF 4FDBA 3CC4T 5I2MA 2PNRC 1KQSP 4Y92A 1EIHA 1L1OA 1M8AA 3FPPA 4C8QC 2YUOA 1YITQ 2XWBB 2Y4YA 1EZ8A 2OTLT 3HOZH 1GCQC 4HJ7A 2ZGWA 4PJOC 2J6OA 2VQEQ 5H1SE 3JCMf 1KD1U 1K73C 2KK4A 3J80E 1HUNA 3F70A 4M75A 1RKNA 3JSCA 4OMPA 3H3VC 4A3DH 1ASZA 1Q81U 3TSWA 1B9MA 2B63G 4IFDH 2RCFA 2RH2A 3Q23A 3P8DA 4N9TA 4BY1H 2A73B 4RKUE 4DQ2A 3EGXB 1N33Q 4JI8L 3G6JB 5ELNA 1MSHA 2UXBQ 4HCBA 2G5DA 4GOPC 3RZDH 4XQ3A 1OXXK 2K52A 4RGOS 4LFAL 5KYIA 3SK6A 4DR7Q 2ZPBB 1VQMQ 1X3EA 1MHNA 4NPSA 4JI6Q 1XMOL 3PO3G 2AT1B 3D6CA 1VMPA 2CHBD 1XXGA 2X69A 3B6YA 5IWAL 4BA2I 4E7HA 2NZHA 3MEHA 3QWYA 1QVFA 2K50A 3HOYH 1JU5C 4DR1L 1JT8A 4C56C 1HNWL 2X4XA 4FF4A 1X2KA 5GAMe 4CDEC 4DV7L 1PH7A 1BBXC 2I0QA 1WD0A 2EJFA 1F2MA 2RHSB 2PZUA 1YJNT 2RVLA 1D5XC 3HOUB 2XIWA 2FO0A 2J6KA 3R8BA 1LOJA 1CKOA 4PJOB 2F0EA 2HQEA 2E5LL 3JB9J 1A8VA 3K58A 2PVDB 1D0XA 3J80i 2IW3A 2A6HD 1OU8A 1V1CA 3FKIG 2UUAQ 4A4HA 2JOYA 2CP7A 4FYXB 4JLGA 1A62A 1I4HA 2K5VA 1N9RA 4C8QE 2R3ZA 4HT8A 1I5FA 2I46A 3I72A 2WACA 5LJ3j 3OBWA 1JCKB 2PQAB 3OIPA 4LD6A 4PJOE 3CQZB 4C0DB 4HJ9A 2JEAI 3T1YL 2UXCL 1R0BG 2KAFA 2XVSA 3ZEHA 4M78F 5C3EB 3LX0A 2HQHA 1B9NA 2UUCL 1S5DD 2NUPA 2E12A 2Y4XA 2B2VC 1N36L 4JI5L 3TEEA 2QEJC 4G57A 5GQOA 2UXBL 3GTMB 3EG2A 1I5LA 4BWGB 4EDUA 3T4AC 2GFAA 2RI3A 4DEYA 3J7A5 1VYUA 2QG9B 4ZUJA 4A3BG 4M78G 4HMJA 1XPUA 5I2YA 4ZLTF 5HGTA 4WJ4A 4NL2A 3RUZA 3OYBA 2XU8A 2D6FA 3VS2A 1LT3D 5IP7H 2FPFA 4ZYSA 2JS0A 1WCMH 4IOCA 4FYVB 1VQ5A 1KHIA 3UA7A 4BI3A 3K0YA 5ELEA 4RTVA 4K2LA 4V0BA 2ZM6Q 1HSQA 4DR6Q 2M51A 2ZPGB 2R7DA 2E2JH 4E2FB 4LDWA 2E10A 1W1FA 2Q2IA 5DY9A 2VV5A 4RTUA 5CQXA 1BXTA 4IURA 1BB9A 4L5SA 2XNAC 3M4OH 2F0JA 3M0SA 3U9OA 4A3IH 1JOKA 3HOVG 2D8HA 4B3TL 2IL8A 3A0JA 4YCUA 1EEFD 4E7JA 1VS0A 1G3TA 4M7AF 2RKSA 3TSSA 4O6JA 1UWVA 3AEVA 5I9OA 1K0SA 1M27C 4A3MB 1UEBA 2FG0A 4C92G 1D3BB 1F9RA 1E0BA 3KUFA 5FLMH 4ATOA 1EWIA 5GAGC 4HIDA 4LFBQ 3EAEA 2LDMA 5KYXB 4N8X1 4BY7H 1D0YA 1E24A 2IX0A 4M7AG 1LTTD 3IL8A 1VA7A 3G1JA 2XRQD 5EPJA 4A93G 1GBQA 3PUZA 2JS2A 3BVGA 1AZQA 2R92H 1A2UA 1ML0D 3S1NH 3CD6T 4HCCA 4P75A 4A3FG 4KHPQ 1YITA 2JXMB 4M77B 1VQKQ 5FJ8H 3QKJA 4Q0FA 2DRMA 1HXDA 1BU1A 2H3JA 1F1BB 1MJCA 2NVQH 1IHWA 3ZYYX 2DK3A 2C0TA 2Y90A 2Z6KA 4ZUIA 4YY3Q 2LP5A 4JS5A 1U5KA 2EY5A 3FC3A 1PM3A 3R6NA 4D8DA 3SWNA 5ECAA 4A3DB 3EFSA 3OTOQ 4M77E 3VA7A 1M3CA 5CYUA 1PC0A 2FJ2A 4LUEA 2CSQA 4B3SQ 1KIXA 2OX7A 1VQMA 4Y7NH 4RG2A 4QVZA 4RG8A 4EMGA 3I2ZA 3CF5A 5IYBG 4M7DA 2C5CA 2HT1A 2B29A 4OWTB 2CZ0B 3VYRA 1VOMA 3RZDB 5CAIA 5M3MG 5DEHA 3KFUA 2YTYA 1WFWA 4GLKA 5CKFA 2R61A 1WJQA 8AT1B 2RHUA 1FMKA 5HGQA 1SROA 3HOYB 2WKDA 3L0OA 1Q7YC 5IOCA 1PYBA 1SYCA 4P74A 3BDLA 4NL3A 3KFVA 3PO2G 2E64A 2NWMA 1GOZA 2RK2A 3A8MB 2XDDA 4LDXA 1PH1A 4XTVA 4KKSA 3S2DB 3QPHA 1I6HB 3DWAA 5KNDA 1HQRD 2QAZA 1R9TB 4LDVA 1PH9A 1HNZL 1IXDA 4CJ2C 3M5AA 1BVSA 2NLUA 1Y1VH 2DAQA 3JB9D 2EQSA 1VQBA 2BOSA 2D0OA 3GO5A 2V8JA 4G4KA 2CZ7B 1AOJA 4QQ6A 1OULA 2O31A 1VQ8Q 3QR8A 4PNYA 1AE2A 1Z9QA 1JE5A 3F2CA 5IODA 2RF0A 3OYDA 1A3UA 4ZKBB 1MKHA 4X64Q 1D09B 1AFPA 4LFAQ 2F0PA 3JCMP 4QB4A 4MTNA 2IX3A 5CBEE 2C35B 4CHTB 1N8RU 4DU9A 1XMOQ 2LZ6B 3OSVA 3QXEB 1PVOA 3MHBA 2MYSA 2CS7A 1N27A 4JC0A 4LDYA 2LTOA 1NZ9A 2ZPEB 3A8OB 2XIDA 3QIAA 1C48A 2O5JC 4DR1Q 1XNIA 1HNWQ 2IHEA 2R6GA 2YV5A 1Y57A 4AYBB 1KHCA 2XDPA 5I11A 1ABOA 2KVQG 3JRZA 1CHPD 1KK7A 4DV7Q 2X4YA 3RLOA 3NTIA 1G91A 1DXMA 4KRTA 1HCZA 2Y0SG 4OVAA 3NBHB 2LSSA 1O75A 2JXBA 2K4YA 2NUTB 4NW2A 3QDFA 3EROA 4X3KA 4IUUA 2E5LQ 3VU3C 2DTIA 3TZUA 4QQGA 3I55T 4AYBE 4PK4A 3EH1A 3BZCA 4K0KL 2KMTA 1WCMB 2TMPA 2YLBA 3SDZA 2WP8J 2ICIA 4JI3L 2H4OA 1HRJA 5C3XA 4OMMA 1EWCA 2E8GA 4JI1Q 2RHQB 2E2JB 1G6PA 1VQKT 4OXPA 1VQPT 3SEBA 5AFWA 3T9NA 3M4QA 5ELFA 5BN4A 5GAOp 4R9WA 2LXJA 2DL8A 2HBPA 3PE0A 3G4ST 4F87A 1R0CB 3EGXA 1V76A 1ZBJA 1SN8A 2BE5C 4LF4Q 2JTEA 3DKMA 4XK8E 2UUCQ 3T51B 3P1HA 1PH8A 4JG2A 5IYCG 1TS4A 2L55A 4C3JB 1N36Q 4HJ5A 1JBMA 3IFTA 4RTYA 2OAUA 5GANh 3O13A 4K5VA 1M90R 3W1GA 2NWGA 2ZPFB 3VS6A 3KLRA 4RUGA 4PZ7A 3L2QA 3CRLC 4XTCS 3UI2A 4RTXA 1IHZA 4KD4A 4ODGA 3I7FA 5GAHC 1MIUA 3M0PA 1PSFA 2HZYA 1VQHA 1FNUA 5HURA 1T5EA 3TREA 4XQQA 2X4WA 5GAOr 1D5MC 1PZJD 1T3SA 3F2BA 2BE7D 1C1AA 3CW2C 3FRNA 3SR1A 3M3YH 4BXXH 1PFBA 4A3JG 4RTZA 4C8QA 4XTZA 2R92B 1VQ4Q 4QIWB 2RN8A 1V1OA 2K05A 2VXEA 3AFQA 4J9DA 5GADC 2PPBC 4LW1A 3S1NB 1K9MC 1GCQA 2EFIA 3EG0A 2DIQA 2FHDA 2EYHA 4PFZA 4PJOA 1ZSGA 1JB0E 1SRLA 5E1FA 4RCOA 3REBB 5G3LD 1QNUA 2A6ED 4FNFA 1M8VA 2NN6I 1HD3A 1T0JA 2NVQB 3GOXA 3DUZA 3PCOB 4B3TQ 3K7UC 3QWNA 2BIVA 1PA6A 2M9UA 4UP9A 2HSEB 3Q6SA 5IXBA 2PQAA 3C1EA 5D6XA 3KBGA 5GAN4 4BBRG 4GOPA 2JM9A 1GD7A 2R93B 2JNGA 1IL2A 2GTJA 1ZUUA 4IOAA 1EEID 1SMYD 1UEAB 2DYBA 1VQ8T 4ZGDB 4FL6A 2RI2A 4N4HA 4ME5A 2P0KA 1I8FA 2CP5A 5CIUA 3EIVA 2HHHL 3AQQA 5GANe 2YRVA 2K5QA 3TRZA 4AG1C 5JJZA 4OONA 1BBUA 1YP5A 4C1NI 1VUBA 1UNSA 2KCNA 1XOVA 1YIJT 1PSEA 5CKHA 3D31A 4HN7A 4JRQA 4IPCA 3S2HB 1BI2A 5CO7A 3CP0A 5HKCA 2MWPA 4CDDC 5CCAA 1LV9A 2EYFA 2N3SA 1EQVA 1IBLL 1XPRA 2VGNA 4KUIA 1AH9A 1VQ9Q 1MGSA 4J6WA 1IGQA 3NPFA 3NENA 2FL7A 1H9MA 4M75G 2VASA 4G7ZC 1QW1A 3KYHC 5E4XA 5JEAH 4F88A 1A6XA 4LXCA 3RKYA 1NYFA 2PVGB 3GV6A 4EVOA 4YTLA 4MMKA 2B2YC 3S9WA 3OYJA 4ZGEB 2CP3A 3OYAA 1HJDA 5CV9A 1VQ8A 3GTKH 3M0TA 1ARKA 1SSOA 4MIUA 4XU0A 5GAOn 2WSEE 3P8BB 5GMKh 1DOKA 4OIKA 1Y7XA 2AWOA 1S4ZA 1EQRA 1CM9A 3M54A 4X3UA 1SAPA 3S17H 1AD5A 4QQBX 4XTYA 3OW2S 2LJ1A 1QKWA 1CKAA 1Q81R 2ZXRA 4YHHL 2FRWA 1PYSB 1SE2A 1G2TA 2KYMA 1HHVA 4I65A 5EKLA 1RAIB 4J9EA 1K3BC 2YUQA 5LMUL 5LJ5f 2I07B 1BBZA 1EY0A 2KHIA 1X01A 2A0FB 4DV5L 1QKXA 3JAMc 1STEA 1WXBA 1AT1B 3IFDA 1JXOA 1Q86C 3N6RA 1PV4A 2OJ2A 3KDFA 1I81A 1W70A 4A3EB 2IPOB 4AFSC 3MTSA 3S1RH 2DZCA 1Z7TA 2RHZA 1EU3A 2K5LA 3S3MA 2Z4IA 1HNZQ 2JSOA 4GY5A 1UGQB 2LQKA 1D2BA 1JO8A 2F2VA 2RSNA 4M77A 1S72Q 1II3A 1IRXA 3JCMh 4E7SA 2EDGA 2G9DA 2RSOA 5KNCA 1PKTA 1YJ9A 1WHGA 1TS5A 1IB8A 5KH6A 2WB1E 3EG9B 4E7LA 3NSWA 2EQJA 2L5TA 4A75A 5TSSA 2ZT9C 3UA6A 2A8VA 4JI7Q 4BY6B 5IGDA 2X9HA 2QYZA 1EY5A 3H0GG 3PIP3 4H44C 2MCNA 2DPPB 2FZCB 1IREB 3MP6A 1ESFA 2DVEA 1VQNT 1PG5B 2B2WA 1VQEA 2EJGC 3TN2A 1I4QA 4B9XA 2HDLA 1QP3A 5IYDG 4X3SA 5FK9C 4J9BA 2V1RA 3I35A 5C0MA 3M56A 1X3PA 4JZ3A 2PZTA 3PUWA 4I7ZC 4M1UB 1Q90A 2VQEL 1Y8OB 1T9HA 3CQTA 4C3IB 1RTNA 3LWEA 2DJQA 1QG7A 3NUCA 1LACA 3STBD 3FIFA 3TP6A 1M3BA 3NE5B 2K3XA 4GLAC 3I90A 4P2CB 1N9WA 3RBBB 1UE5A 4GNXC 1BOSA 1WYDA 5COYA 1N33L 4F7UF 5KE2A 2QQSA 3VS1A 1DCZA 2UXDL 1EU4A 3CBMA 3FRPB 1YNNC 2EYOA 2EAYA 3H3VI 4JV5Q 1E7OA 1VQ4A 4LF9L 3OYEA 2LX9A 3OYNA 1QNKA 2L15A 1MNEA 2DD5A 1SNOA 4K8JA 4YWLA 4JI6L 3OYKA 4BBSH 3TBIB 1NYGA 1I50H 2KY9A 4JPBW 1LTLA 5BR8L 3UE1A 4K0KQ 1TSFA 5L37A 3P20A 2VUMG 3X24B 3HOWH 5M5XH 1NLOC 3N5BB 3JCMe 1WJSA 1K4US 1BCPD 5CR3A 4JI3Q 4YIJA 1U8RA 4RMFA 2PMZB 5HK3A 1UDLA 3LGFA 2GFUA 3OBYA 5IE8A 1VQLT 3OMCA 3DLLA 2L89A 3LGJA 3U23A 1HZCA 2P0PA 2YU9B 4PJLA 3CC2Q 4DAPA 2LX7A 1UHFA 2YWWA 3MCAB 4Q5VA 3HHTB 4JI2Q 2CP2A 3H6ZA 2KUMA 4P72A 3PGGA 5DM63 3M58A 2NUCA 3JCMV 2GF7A 4HKEA 1NMFA 3H15A 4Y52H 1B44D 3VDYA 2ENBA 1JEGA 2KECA 2HQXA 3R2IA 4X34A 3V7SA 2QEXT 2IHFA 1JJ2P 2PW5A 1I4K1 2RDHA 1VQ9A 4LJZC 2C0IA 5C0XI 1SYGA 4DUZL 4OO1I 4MN3A 1GUNA 2XHCA 1GCPA 1Y1WB 2JJQA 4A4FA 5CR2A 2Q8IB 1WTHA 1K1ZA 1ZSZB 2EQKA 1Z47A 4CDCC 2YT6A 4FYYB 3V7CA 4M7DC 2L0CA 2K3YA 1YHAA 5KRUA 3OY9A 2ATWA 3CC4Q 4R4OA 2YXYA 1GXIE 3S14B 4PLIA 1TIID 1TXYA 1NE3A 5EPLA 3ZL7C 5IHKA 2OTLQ 2VKNA 5K36H 1X3QA 3LLRA 1IHVA 4F7UB 3HOUH 3A74A 4KT0E 5CMDA 1OXVA 2O88A 4OMNA 1QLYA 3AMUA 1D5ZC 3I73A 4O42A 1MNDA 3S17B 4C2MH 3NTHA 5LJ3f 3QZ5B 3J7ZC 1EY7A 4E7ZA 2JN0A 4X65Q 2A7YA 4RTTA 3HOXG 1MJEA 3RR5A 3RZOH 2PQWA 3E2UA 4DK3C 3NHNA 5HK0A 2HHHQ 3REAB 1KAWA 1O7IA 3CQZH 3RLFA 4ABNA 3LH5A 3I4MG 2KE9A 1VQJA 1HQMC 4M78D 1PZID 2RA2A 4K2KA 4R1JA 4JW0A 3HP3A 4J6HA 4EGVA 4JRIA 3RN5A 1WTWA 3FDRA 1K8AC 3CXCP 2E41A 1SNCA 1IYUA 1SHGA 3OS1A 1MUZA 2B8AA 2XMFA 3L9AX 3OSOA 4XT3B 4V190 3GTMH 2GVBA 3C95A 3PF4A 1S72A 1YJNQ 2RQRA 1ILPA 2N8NA 1CA5A 3I4NG 2RJDA 1AZEA 4CGYB 1YCYA 4LUDA 1PH6A 1W4SA 3MZ5A 2B39A 2K14A 3EBEA 3OA6A 2E76C 2EYZA 4HCSA 3D6WA 1E2VA 4FP5D 4OWWB 4DOWA 3THKA 1NMGA 1OTCA 3SK5A 2R7FA 3EH2A 1WQWA 2J05A 2EYJA 1BR9A 2DEQA 2AWNA 4MHEA 2LC4A 4EQ5A 1QVGP 4EQNA 4C92D 4BE0A 3U4ZA 4HIMA 1X54A 1PRTF 1EFID 4UDUC 3TP5A 5IT9c 2X3WD 2F0LA 1B2TA 1HFNA 2BH2A 4Z02A 2A36A 2O4XB 2D0PA 1SPKA 5JAVA 3WVDB 1RODA 2WAQE 5LMUQ 3I3CA 1KD1C 4M7AD 3JCMJ 4BDYA 1WIEA 2JT4A 4DV5Q 3OW7A 2F0MA 2DA9A 2KRNA 2CVRA 3T1HL 3MA2B 3OW2A 3EFOA 1SFOB 2MP1A 3PFSA 4A3MH 4FF3A 5JVG3 4MZPA 4DV0L 3K7AB 1GUGA 1J9OA 5CV7A 3DHQA 1S1NA 2L12A 4JOIA 3HL8A 2KQ3A 2K5NA 1PZKD 2NUZA 3QIIA 2E2IB 3L1AA 2R7ZG 3X26B 4RG1A 4FYDA 3EVQA 2ZTCA 3T13A 4BUGA 1KG1A 6AT1B 2CW0C 2F0NA 2NYZD 5FOBB 3CCQA 2VUBA 5M5XB 2PW7A 4RGTA 1PRLC 2E3HA 3CC2A 2WFWA 3P7JA 1WTVA 2EXZA 1QCNA 2N78A 1HZBA 5CV4A 4DKAC 2XK0A 3R6OA 2O9SA 1RUWA 1H9RA 1CA6A 1ZHIA 1Y07A 3M7GA 4JUVA 1EX4A 5C4XG 2QW7A 2QGQA 5C4ZA 3GV3A 4EPCA 3L2ZA 3JCMX 3VS3A 1LTRD 1G83A 1G3YA 1CUKA 1TU2B 2NTTA 3OYMA 3HOVH 4R0KA 2L11A 4PJJA 2OI3A 4WFN3 1TT2A 1X2QA 2ZAEA 5J39A 4C8QG 4FCYA 3E5SA 2EYQA 1CZGA 3HKZB 1BCPC 2XDBA 3Q22A 2DF6A 2UXDQ 2HCIA 4FF2A 1HA6A 1AEYA 2KGTA 4X64L 2EPBA 4LMQD 2YHTA 4C0DC 4LF9Q 5CBAE 3CC4A 2QQBA 4KV6A 4A3GG 4JBKA 2UUBQ 1PHTA 4OEMB 5BR8Q 3PVQA 3CD6Q 3VR6A 2A1AA 3S1QB 2B2YA 2OTLA 2I5HA 4ZRZA 3GNFB 4FW1A 3C2PA 2Q2TA 2H1EA 3NTKA 3E1SA 2K28A 5D3DA 3OS5A 3EG9A 3S2DH 3QO2A 3SXHA 1I6HH 1IYVA 3I70A 1WOCA 3QG1A 3EN2A 3FEWX 3G48A 1RJTA 3EJIA 1R9TH 3Q1JA 1ET6A 1E3PA 3X28B 2YUPA 3MAQA 4CJ1B 2QTXA 2VB6A 3OYIA 2D1XA 3CPWP 3CCMQ 5M9OA 3DM1A 3VRZA 1GJXA 1UGPB 1DM0B 4C2MB 5CGKA 3VYGA 1RCVD 3CCLT 2B63B 4L5GA 4JI1L 3RZOB 1BCPB 5EKKA 4LF8Q 3BDOA 5GANj 2CWPA 4DUZQ 2P4RA 2DL5A 3VR4A 2CDTA 2DXTA 5IYBH 5GAOl 1SYDA 3ND9A 1K83B 1OYXA 1VYVA 4UPAA 1J5EL 5C0XG 4LF4L
chains in the Genus database with same CATH topology
1YJNA 4MDXA 1G51A 1IBML 3L7ZC 2R58A 4ZTJA 5A0GA 4AQYL 2CKZB 3UE0A 4FT2A 2PUOB 2ZJRA 2XI9A 3BDUA 4NXML 4R4QA 1KC8C 2EJGA 3UDIA 2RK1A 4M77C 4XU2A 1QVGS 4GLXA 2E1HA 4EMHA 4C92F 3I56T 1BI3A 1UE1A 2P0QA 1X9NA 2VQFL 2PNHA 1E7ZA 4GNXA 1XMQL 1VCIA 4C3JH 1B34B 1X65A 3UWNA 3HOZG 2QQRA 1QZGA 5KE3A 1X75C 3PIPA 2ZCFB 4IUTA 2RHYA 2D9TA 5LJ5g 2C06A 4IFDG 2KENA 1JRIA 1ZBXA 4BY1G 4M78B 1P8LA 4WF2A 3J81j 2HD0A 1FL0A 1KQSS 2KSSA 4BI4A 2LT4A 5GMKm 4QJFA 3MHXA 3E0EA 1H3ZA 1IBKQ 4M78E 5LJ5h 4XTXA 1G5VA 4J6YA 2XICA 1Q12A 1FVIA 4KUDK 2R93H 3BZKA 3T1HQ 2UU9L 2Q2UA 2F5TX 4M75D 2B3GA 3PUVA 2LQ8A 3CCMT 3U50C 1K3RA 4DV0Q 3S2HH 5ELOA 5AJ3Q 3CD6A 2DO3A 2EQMA 4LDUA 3GD7A 3UDXA 4C92B 3MXNB 1N8RC 4PZ8A 2JEBI 5JJLA 4FIBA 1NE8A 2CZ1B 1WJJA 1QP2A 4M7AB 3G71T 1M1KC 4QQDA 1KRTA 4UC4A 2V8KA 2CKKA 4HT9A 4OF1A 3CCMA 3RN2A 3GDEA 4DNIA 4BA1I 1B70B 3JB9I 4OP0A 4DAYB 2O01E 3E9GA 1U0LA 2OTJT 4Y28E 2ZTEA 4C5IA 2VW9A 4L5QA 4JI7L 4ME3A 4HJ8A 2XTIA 4IKFA 2QQ9A 4AH6A 2XGTA 5IP7G 1JJCB 4IUQA 3HP9A 4J6XA 2HIVA 1DJ7B 4KBMB 4KHZA 3ME9A 4PZ6A 4A3KG 4A3EH 3CMAT 4A3IG 4JV5L 5GAMd 1SLJA 3MEFA 4A3CH 1C0AA 1OZ3A 3HFOA 4E7KA 3HFZB 4QGUA 4LF6L 4C5EA 4O2DA 3FB9A 4N4IA 3L2RA 3J80c 1CKMA 5A2QE 3KF8B 3QJ6A 2VY3A 4BY7G 1YI2T 2HQLA 3JC66 1J5EQ 3GP8A 1VQCA 1XPOA 4C3IH 4R4CA 3M4GA 4JI2L 5LJ3g 3H8ZA 3L2VA 3JB9H 1IBMQ 1OXSC 3ICEA 3PNWC 1HNXQ 3CC7T 1X3GA 3I55A 1LYLA 4LUVA 4DV3Q 4AQYQ 4ZN1A 3RMSA 2NVXH 3M9QA 1VQKA 1VQPA 2PUKB 3DLMA 3HKSA 2K57A 2NZOA 4NXMQ 4JOIC 3G4SA 3RLFA 1QUQB 3RLNA 2DUDA 5LJ3h 1Q1EA 2ZZDA 3X25B 3J7AF 2DGYA 3CCJT 3NEMA 2LVMA 5C44G 4DK6C 3KF6B 3H0GH 2Y0SE 2MMPA 2VQFQ 4C0ZA 3INZA 1XMQQ 4QIWE 4POGA 4JBWA 3RNUA 5CKEA 3J81E 5DM7R 3UPUA 3HPWA 3OS0A 1VQDA 4M75F 1M9SA 1QVGA 4X65L 1ASYA 1Y96B 3RKXA 1DGSA 1A0IA 1Y1VG 2K4KA 3ASKA 1Y1WH 2JA8G 4DV2L 3OSSC 4LWCA 3SGIA 2RHXA 4PMWA 3ZJYC 4OX9L 5FU7B 3P8HA 3S14H 3E9IA 4YWKA 2OCEA 2VUMH 4Q5WA 5D6YA 3O8VA 5FLXE 3A8HB 3URGA 1YJWT 1VQOT 5KCOA 5FU6B 4IUPA 1X55A 2WB1G 2JTMA 1N9SA 2UU9Q 1YIJA 2MF2A 2OQ0A 3J81i 3S16H 2CYZB 4BY6C 3KXTA 1TH7A 4GN3B 1MGQA 2AHJB 5DLOA 2JA5G 1KQSA 1QZHA 4ELYC 4UP8A 3CCST 4LF5L 1B34A 2DD4A 1LNXA 3JCMb 2HNIA 3RKWA 3CCRT 4C0FA 1D3BA 1UE6A 2HAXA 1L1OB 4J15A 4IO9A 2DXCA 1BI0A 2KQWA 3PTAA 4JRPA 4DV1L 5GAMj 1Q82U 4M78A 1VQGA 1Y14B 4M75B 3ZFJA 5GAN7 3M7NA 5AYFA 1SMXA 2GN5A 4QY7A 3G6ET 2FB7A 4MNOA 5GMKe 2LCLA 3LX7A 4AIMA 5A0DA 5I21A 4BACA 2IVWA 2D0QB 1VQFA 5GAN2 2ALYB 1EUJA 2JA7G 1KL9A 2KBNA 4IFDJ 3I4MH 1KQ1A 5J26A 1GVPA 2VYTA 1KQ2A 4R4IA 1SFOH 2JA6G 3QUIA 2MI6A 3M59A 1EOVA 3K7AH 4B3MQ 2HIXA 5I2SA 3OYYA 2X4JA 4M7AA 1JJGA 3RMQA 2E2IH 4J7IA 3ULPA 3QHSA 3ULJA 5CKDA 1VQNA 2UUBL 4R55A 3JCMQ 3IRBA 4LF6Q 4DV6L 2E6ZA 5J3BA 4L6V5 2X35A 4KULA 2WSCE 4XTUA 4C8QD 2XKOC 1Q86U 2RF4A 2GVAA 3PIOA 1IZ6A 4KI0A 3TS0A 1C9OA 3LH0A 4EMKB 5LL6S 1OI1A 3UT1A 3WXMB 5JEAG 4J8OA 2LCCA 2L5QA 4CI0C 4OB0B 2PMZE 3DB4A 3QYGB 2RO0A 2DTOA 2MQHA 1N6AA 1YVCA 3PUXA 3MP8A 5DLQE 3QYHB 3CCUT 3OQ5A 1M90C 3S1QH 4M7DF 1VQLA 2R7ZH 5GAN6 3TCJA 1Z9FA 2DXUA 2ZJQA 3OYFA 3FLGA 5GMKl 2I2LA 1O9SA 2NN6G 4VUBA 5FRMA 4M7DG 2M16A 2OWOA 3MP1A 1VQ7T 3TS2A 2QEXA 1N32L 4HJAA 3SFMA 3CMET 2GQVA 3A8GB 2B63H 3D0FA 4BI8B 4F7UE 1P16A 3NELA 4TVAB 4NB3A 4B3RL 3UDGA 4GN4B 4DUYQ 3LGLA 4XU1A 3EFRA 4A3LG 4J5YA 1K83H 4DV2Q 5GANd 2WAQG 4II1A 4OB1B 1Q46A 2D62A 4OX9Q 4ELZC 1E22A 2V1CC 3PO3H 2H5XA 3GTQH 4E7IA 1KRSA 1QUQA 4A76A 2F5KA 4NS5A 1ZQ1A 3A8LB 1I3QH 3CCET 5M3FG 3KJPA 1VQ6T 3KF6A 2LRQA 5M5YH 1XQHA 1NJIU 1G291 2RD1A 1L0WA 2L3RA 4LF5Q 3FKIH 2Q2HA 3E19A 4YCWA 2V8IA 3W5OA 5GAN5 1NY4A 4BBSG 5CKBA 1FGUA 1IBKL 1M1GA 3VUZA 3K80C 2EXDA 2JUFA 2RB6A 3X20B 3HOWG 1Y96A 2A19A 2MAMA 1Q81C 2N49A 4PG3A 2EIFA 4DV1Q 3RESA 5AJ3L 2YTVA 1TWCH 2AHOB 2EJ9A 1HR0L 4A3BH 1UB4A 4IJHA 1XNQQ 1RI0A 5GAMg 2JQOA 3AFPA 1EQQA 1K8AU 4DR2L 1FX7A 1FWZA 4QVDA 2ZPHB 3STBC 4X62L 4C8QF 2KCTA 1BIBA 3UDCA 1HK9A 5GAEC 3LWHA 4PJOF 1V43A 4LF7L 4POFA 4GKKL 4XTWA 1YEZA 3K81C 1A63A 1VQIA 2RCNA 1X56A 5K36G 2IG0A 3U4VA 3HOUG 1K0RA 4BB7A 3CAMA 4PJOG 3RUXA 1JJ2S 3FP9A 1SE8A 1HZAA 4O5VA 2MNAA 2NVTH 2CFMA 4DV6Q 1BIAA 2I5LX 1S40A 4JBJA 1IXRA 4A93H 3HKZE 4JI0Q 4FU6A 4OB3B 3JCMd 3SD4A 1UGRB 4A3FH 4JYAL 2RJEA 4DV4Q 5C3EG 2DJZA 4C0GA 2YU9H 4C3HH 3ER0A 3BU2A 4APVA 5IP9G 4MZMA 4GKJQ 2R57A 2E65A 1EYGA 1YHQT 1FJGL 2Z0SA 4C8QB 1TWGH 4L5RC 1B7YB 2RJCA 1K73U 4MZ9A 5LMNQ 5M3MH 1EIYB 1GO3E 5CK9A 3CXCS 3KOJA 2BA0A 3QDRB 4GN5A 1HNXL 4HIOA 5CVIA 4DV3L 3CEYA 4NXNQ 3PO2H 1WFQA 1M1FA 2DIGA 3LYIA 3V8KA 4GOPB 1U1SA 3CCLA 1YHQA 1VQ5T 1PH5A 4OGCA 5D6WA 1FXXA 1N32Q 1OZ2A 3M57A 2P4TA 4M78C 1E1TA 4A3MG 2QA4T 1RL2A 4JI4L 5IAYA 4M77F 4PNOA 4EMKA 1NPPA 5E7NA 1Y71A 4GLVB 4B3RQ 5C6SA 1YNXA 3META 2MO0A 3W1BA 4IPHA 4XAXB 4MDWA 2YLCA 4M77G 2ES2A 1LM0A 1YHBA 4O0AA 2QA4A 1RIPA 4OMFB 1L2FA 3F8TA 4A3KH 3OB9A 4C92C 4P71A 4LNQA 4A3DG 5GAN3 4IJLA 3MEAA 1YITT 3I56A 4J7FA 1NPRA 4F7UA 5JEAJ 4M7AC 5GMKj 2K5HA 2XD0A 1K8GA 4GS3A 4HIKA 1LUZA 3C12A 2MWOA 4QW2A 4WJ3M 2R5MA 1CKNB 3VUBA 3HOYG 4HCZA 2KHJA 3KJOA 3JAME 1SSFA 3KDFB 1VQMT 4QL5A 1Q1BA 2F52A 2DXBA 4N4GA 1NBWA 1N34L 1KC8U 5IYCH 3S3NA