3ER0A

Crystal structure of the full length eif5a from saccharomyces cerevisiae
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
146
structure length
146
Chain Sequence
DAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the full length eIF5A from Saccharomyces cerevisiae
rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 5A-2
total genus 14
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3er0A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3er0A02
2IHEA 2Y0SE 2IX0A 3K7AH 1UE5A 1OXSC 1G6PA 2B63G 2JEAI 4AH6A 2CQOA 3GTPH 5IP9G 4A3CH 4A3EG 4OX9L 3GDEA 5IP9H 4LUOA 1VQPA 3PIPA 3CXCA 2VUMG 3RN5A 5AJ3Q 2JA8H 4L5QA 3CC2T 1K73C 2OQ0A 4DNIA 4DV7L 1SR3A 1FGUA 1J5EL 1VQMA 2HIXA 3CCST 1VQ9A 2GN5A 2RHQB 4FDBA 4DAYB 3CCVA 3H15A 4DV2L 2R7ZG 3HOZH 2ZM6Q 1I94Q 2E5LQ 2BH8A 4MZ9A 2VNUD 4TQUS 4IOCA 1SMXA 1HNXQ 1VQNA 2HIVA 2OTJT 4UP8A 3W1BA 3ICEA 3TRZA 4BXXH 4RMFA 3PUYA 1NPRA 3H0GH 3J80i 2JVVA 4LF8Q 2HQLA 2ZJQA 5M5YH 2VW9A 1YI2T 5JJLA 3RN2A 3H3VI 1U5KA 1YEZA 4X65Q 1TWGH 1VQ4A 1EWIA 2DGYA 4YY3L 5C44H 1QVCA 2PNHA 1YITA 4JYAL 3CW2C 1Z9FA 1UE6A 1Y1VH 3GTJH 4JI0Q 1YHBA 1IZ6A 4WJ3M 2MWOA 3HOZG 3KBGA 4JI7L 2JEBI 1KRSA 3CC2A 4YWMA 3J81c 2UXCQ 2Y0SG 4L5TA 1Y1WH 4BBSG 1PH2A 5JJKA 3CCEA 2EIFA 3CCUA 2BA0A 3B6YA 3KDFB 1X6OA 5C4JH 4OO1G 2UXCL 1XMQL 3S1RH 3H0GG 5ELNA 5IT9c 1O7IA 2NN6I 1I3QH 3STBC 4DUYQ 4A93G 1HZ9A 1JE5A 2B29A 1Q82U 1VQ5A 1XMQQ 2KBNA 4YHHL 4DV5Q 5J26A 1VQMT 3CCQT 4JBJA 3TQYA 4QY7A 4B3SQ 2JA7H 3I2ZA 1VQJA 1E3PA 4HIKA 3G6EA 4OO1I 1N32L 5FLXc 1QZGA 1IBKQ 1JMCA 3AYHB 1FJGQ 1VQPT 4JI6Q 4LF9Q 2D62A 3ZJYC 2UUAL 3LGJA 1HJPA 2GVAA 2R92G 5IP7G 4BA1I 1X56A 4X65L 3CC4A 4OONA 4R4QA 2KVQG 1UE1A 1IBLL 2ID0A 1M90U 4LF8L 1N33L 4LW1A 2E8GA 2UXDQ 1SRUA 1I5FA 4PZ8A 5M5WH 1XMOL 3KDFA 2VQFL 5GAEC 4A4IA 4A3JH 4LF5L 2HT1A 3I4NG 4DR6Q 1N8RC 3CAMA 3KYHC 4A3JG 3I4NH 1B7YB 3FKIH 3HKSA 2HHHQ 2LXKA 1W2BS 4LF5Q 1VQ7A 3KOJA 2MWPA 3S24A 4UP7A 2VZAA 4GOPA 2UXBQ 3F2CA 3HOUG 2AWNA 4HJ7A 5A2QE 2HHHL 1HNWQ 2D0PA 3HKZG 4Y7NH 1QUQB 3T1HQ 4UPAA 2UUCL 4DR7L 3RLFA 4LF7Q 2KHIA 4A3GG 5LL6S 1XPUA 4L5RC 1FVIA 3ULPA 5FJ8H 2WP8J 2E70A 3G71T 1KC8C 3F8TA 3A0JA 4R4TA 3OTOL 1JJGA 1WJJA 1YHAA 1Q8KA 1VQDA 4QGUA 1QVGA 1HH2P 2MNAA 2YU9H 2OCEA 3WWVA 4QIWE 2R7DA 1WOCA 3EIVA 4IFDG 2R93H 2YTYA 5IYBH 1CUKA 1H95A 4P72A 5LMUL 5C4XH 2BH2A 1ASYA 5IWAQ 1TWHH 3K0XA 1N32Q 4A3MG 1D7QA 1YJWT 1VQEA 4JI3Q 3J7ZC 1CSQA 4XTCS 2C35B 2JA6G 4GOPB 4X64Q 1T9HA 2LSSA 1LTLA 2WFWA 1EQQA 4B3TL 4L5SA 2VY3A 1XNRL 1KD1C 2A19A 3PUVA 4AQYL 2YYZA 3GTLH 4X6AH 4GS3A 3L0OA 2PQAB 1YIJT 3NEMA 1K3RA 1NBWA 3FKIG 4LF4L 4AQYQ 5J3BA 1SFOH 1P16A 4YCWA 4DAMA 3HOYG 2YV5A 4JI5Q 1YBYA 4O0AA 2VQFQ 4JV5Q 4LF4Q 1Q81U 3A74A 4DR6L 4A3BH 3CMET 1K83H 1X3GA 3UE0A 1A8VA 1E22A 4QQDA 1VQ8T 3K7UC 1HR0W 1PA6A 5DM7R 4JI1Q 4KHPQ 1WYDA 4QL5A 1I50H 3ER0A 4DV1Q 4R4IA 1WFQA 1EOVA 3DM3A 1K0RA 2R92H 3T1HL 1WCMH 3PUZA 1NE3A 4PMWA 1B70B 2NVTH 3S1MH 1YJWA 4BA2I 4K0KQ 4NXNQ 4DR5L 3PF5A 4ZN3A 3HOVG 1X9NA 2JA9A 2MO0A 3NELA 3IRBA 4GLAC 1AH9A 3OTOQ 1EQRA 1G291 2Z6KC 2UU9L 5GROA 4LFCQ 2Q2UA 2WAQE 3BZKA 1VQ8A 1GKHA 1PFSA 4EX5A 2PQAA 5AJ3L 1Q86U 1YJ9A 1L0WA 1NJIC 2CCZA 1RIPA 2NVQH 2NN6G 4LFBQ 1Y14B 1UE7A 1J5EQ 4DR3Q 4LFAQ 5IWAL 1N34Q 1FL0A 4DUZQ 1GO3E 2EXDA 4A3BG 2K5VA 2ZTDA 4C2MH 2JE6I 3CCVT 2QGQA 4A3DH 2KCMA 2BA1A 1PH8A 4R4CA 4DUZL 4BXXG 1Y1WG 1IL2A 3M9BA 2K50A 5LMNL 4HJ8A 3M7NA 4BY7H 1CKMA 4R1JA 4DR4Q 4GKJL 2LCLA 2K5NA 3PSIA 1VQAA 2KDSA 2N78A 1A62A 3S16H 2YTVA 4NXML 1IXRA 4DV0Q 4JI1L 4B3RL 5C44G 4KHPL 4JV5L 4LWCA 1VQFA 4DV1L 1QUQA 1LUZA 4UP9A 2XTIA 3U50C 5E7NA 1YHQT 4C3IH 3S2DH 1HNZL 3PUXA 1Q12A 4TVRA 3FP9A 4JI8L 3RNUA 2ZJRA 4GKKL 3OW2A 4AYBE 2UUCQ 4JI2L 4A3KG 2B63H 3S1NH 5BR8L 1XPRA 2D0OA 4GN3B 3HOWG 2E6ZA 3PO2G 4JI2Q 5FLXE 4BY1G 4JOIA 1XNIA 4LUVA 5JEAJ 3BU2A 3BZCA 1XPOA 2WAQG 2K75A 2JA8G 4OWWB 1KC8U 1QVFA 2QEXA 2IT1A 4RG1A 1S3OA 3I56T 3FHWA 1N34L 3CPWA 1K9MC 3TS2A 2DO3A 1JJCB 1BVSA 5HY6A 2CWAA 3HFZB 5LMUQ 4OX9Q 1JJ2S 4LUZA 2ATWA 4PG3A 3TEHB 3CD6A 5C4XG 3CMAT 1D8LA 1OXXK 3CCUT 4X66L 1Q1EA 2IX1A 5GAGC 4A3FG 2E2JH 4DV4L 4JCVE 5M5XH 4A3KH 1DGSA 1SSFA 3GTQH 3KF8B 3CC7A 4X66Q 1RL2A 3CCJT 5H1SE 3CCRT 2E5LL 1PH1A 3G4ST 1VQCA 5FLMH 2K5HA 4YWKA 4HIDA 3Q8DA 1CKOA 4DV3L 1VQHA 4YY3Q 4P75A 4GLXA 2PI2E 2V1CC 1J6QA 4KI0A 1K8AU 4O2DA 3S2HH 1WI5A 3PUWA 3SGIA 1QZHA 4DR1Q 3G6ET 3J81i 4UY8C 3KJOA 3DB3A 1VQGA 3PIOA 1KQSA 2DUDA 3K80C 1XTDA 3OYYA 4C3JH 4ME3A 3HOUH 3HOWH 5ELOA 4IJHA 4AYBG 1KIXA 1EFWA 3PO2H 4YTLA 1AE3A 1SROA 4A3FH 2K4KA 3G4SA 1G51A 1UEBA 4GOPC 1VQ6A 1PH7A 3MXNB 2MFIA 2R6GA 3A5UA 4JI7Q 1YI2A 4ALPA 3GTOH 3PF4A 2VUMH 1PH3A 4RG2A 1X54A 5C0XJ 2AMCB 5FJ8G 3J7AF 2XHCA 1EIYB 4J15A 1TXYA 1K8AC 4PZ6A 3J81E 1VQKA 2OTLT 4DV6Q 3H3VH 3I4MG 4DPGA 2VL6A 2ALYB 3TREA 1VQBA 3RR5A 2KHJA 1MJCA 3A5ZB 5FLMG 2AKWB 2AHOB 1NJIU 3CCSA 1VQ9T 1VQ4T 5IT9E 3JAME 4B3SL 4C3HH 1C7YA 1YHQA 2ES2A 2AWOA 3KFUA 3PO3G 4HJ5A 1HNXL 1XNQL 2JK8A 1FJGL 3U4ZA 1N36L 1KHIA 1M1GA 1XNQQ 2MO1A 4IO9A 1JT8A 3E9HA 1U0LA 2I5HA 3D31A 5GQOA 2UUBQ 4POFA 1X65A 1EIFA 1SN8A 3OW2S 2IG0A 1TWCH 2YTXA 2UXDL 1BKBA 2UXBL 1MKHA 4APVA 1X3FA 4JC0A 2JA5G 5IYBG 3UDXA 4GN5A 1VQ7T 2PMZE 1Q81C 3ULJA 1ASZA 1GD7A 2R7FA 2WB1E 4A3GH 3CPFA 3HOXH 1XJVA 4QJFA 2A8VA 2NZHA 3CCLA 4GN4B 3CF5A 1IBML 1S72T 3CQZH 3M4PA 1S72A 4YCVA 3STBD 1VQLA 1HZCA 2Q2HA 1PH5A 1JB7A 3PO3H 4DR7Q 4LF7L 1GM5A 1GVPA 2ZM6L 4DV6L 1I94L 3LGLA 3G48A 1OXUA 4OWXB 3AEVA 3S1QH 1IYJB 1X3EA 2N49A 2Z6KA 2JOYA 3CCET 2IHFA 2G3RA 4R4OA 4X62L 2VQEQ 4DV7Q 1YNXA 2I0QA 2JA5H 4DV2Q 3CPWS 2JA7G 2IY5B 2I5LX 2JQOA 2VQEL 1PHJA 2L15A 1YJNT 1E1TA 4X64L 2CKZB 3T1YL 1HR0L 1XNRQ 4A3DG 1OTCA 3JAMi 5JJIA 3KLWA 1VQ5T 1MIUA 1PH9A 3M4OH 4A3CG 1VQ6T 1XMOQ 1QVGS 2RF4A 3J7A5 1VQIA 1V1QA 4KHZA 5M3FG 4HIOA 1N36Q 3ULLA 4GNXA 1CKNB 4B3TQ 4EQ5A 1YIJA 1YJ9T 1KAWA 3LGFA 3DLLA 3RZDH 4JYAQ 1E7ZA 1PV4A 1SLJA 3LH0A 2F4VQ 3F1ZA 1PH4A 4JI0L 3L2PA 3RZOH 3M4QA 2I5MX 5K36G 4BY7G 1YZ6A 1VQOT 2E2HH 1Q46A 1YITT 4IPCA 3PV0A 3AFPA 4DUYL 4HJAA 3CCRA 1PH6A 3I4MH 1M90C 1K8GA 4HJ9A 5DLQE 3E0EA 4DV5L 4Y52H 1NZ9A 2LVMA 2MQHA 1PVOA 1KRTA 4DR2Q 3UDIA 1KL9A 4YCUA 2K14A 1V9PA 2R93G 4OXPA 4GLVB 5GADC 3J80c 2FXQA 5EAYA 4BBRG 1Y1VG 3GTKH 1V43A 4JOIC 1L1OC 4YHHQ 4LFBL 3EN2A 3KF6A 3MEFA 4JI3L 5M3FH 4GNXB 4DR3L 4JBMA 1R9TH 1M1KU 4LFCL 4X62Q 2NVYH 2UU9Q 2VS1A 3CCLT 4LFAL 1N8RU 4IPHA 3BJUA 3S14H 1OXVA 1M1KC 1UWVA 4TVAB 1KXLA 1Z47A 3G71A 2UUAQ 4DV4Q 2F3IA 4IPGA 4GNXC 5GAHC 1VCIA 1Q7YU 3I56A 1TWAH 2F52A 1QVFS 1Q82C 3JAMc 3HOVH 4HIMA 4BY1H 3DB4A 5LMNQ 5C0XI 5M3MG 4B3RQ 3CC4T 2LXJA 1HNWL 1NMFA 4JI5L 1A63A 1YVCA 3UDFA 3UE1A 5IYDG 4JG2A 3GTMH 2JUFA 4JBWA 3J80E 2B3GA 4JBKA 1CKNA 1L1OA 3I7FA 1VS0A 3GO5A 2JA6H 3E9IA 3F2BA 4A3LG 4BBSH 2EQSA 2K52A 5C0XG 1NPPA 2MI6A 5IE8A 2KCTA 3CP0A 2OWOA 3PGZA 1X55A 4K0KL 4DR2L 4H02A 5HGQA 4DR5Q 1HZAA 3GD7A 3VDYA 3AFQA 2GVBA 4NPSA 4P71A 4A75A 1I6HH 3K81C 3S17H 4JI4L 4IPDA 1IBKL 5C3EG 1LM0A 5IYDH 4JI6L 4LF9L 3TS0A 2QA4A 4JI4Q 5C3EH 4IFDJ 3F2DA 1NMGA 1B8AA 2PI2A 3KF6B 2JJQA 3JC66 2R7ZH 1BBUA 3CXCS 2NZOA 1L2FA 1LYLA 4OWTB 1TWFH 1E24A 4NB3A 4DK6C 4B3MQ 2OTLA 3I55T 1HZBA 4A76A 4MNOA 4ZN1A 3UDGA 4DR4L 3I55A 4GKJQ 3CCMA 1EUJA 2XGTA 3M85A 2KENA 3CCQA 2CWPA 4DKAC 2WB1G 4YWLA 1C9OA 4A93H 4CRIA 1VQOA 2E2IH 4A3LH 3I4OA 2OTJA 2ZTEA 1KQSS 5BR8Q 3CCJA 1VQKT 1NTGA 3CC7T 2N8NA 3L7ZC 4NXNL 2A1AA 5JEAG 4LNQA 1AE2A 3HOXG 1YJNA 1K73U 3CCMT 4BBRH 3S15H 4GKKQ 3CMAA 4MTNA 3CMEA 1NY4A 4IFDI 1K9MU 1PYBA 2RHSB 2RCNA 1IBMQ 3HKZE 3NENA 3P8BB 4PZ7A 1N9WA 3K8AA 2Q2TA 1CSPA 1Q1BA 2Q2IA 4A3IH 4WJ4A 3J81j 3RLNA 2QEXT 4XIGS 4A3EH 1S40A 2CFMA 3PCOB 2N3SA 2QA4T 1Q86C 2LQ8A 3AQQA 4POGA 1MJEA 2ASBA 3RLOA 1JJ2A 4DV0L 2H5XA 2JNGA 3U4VA 4LF6Q 4IJLA 4X34A 1SE8A 3GTGH 3T1YQ 1HR0Q 1E1OA 2OQKA 5M3MH 1VQNT 4P74A 1P8LA 2ZJPA 4LF6L 4QQBX 2CKKA 1KD1U 2Z0SA 4DV3Q 1BBWA 1IBLQ 1N33Q 1EYGA 4B3ML 3W5OA 4DR1L 3ERSX 1C0AA 2UUBL 3D0FA 5IP7H 2ZTCA 4A3IG 4DK3C 3CD6T 4NXMQ 2NVXH 1L1OB 1HNZQ 3HOYH 5IY0A 1W2BA 4JI8Q 3EBEA 1OXTA 4KLKA 3KJPA 3U58A 4A3MH 2F4VL 4IOAA 2L3RA 5IAYA 4P73A 1A0IA 1PYSB 3NBHB 1W3SA 5LMNW 1VQLT 5IYCH 4AIMA 1Q7YC 3W1GA 1WCMG 5IYCG 3M3YH
chains in the Genus database with same CATH superfamily
2Y0SE 2QDLA 3K7AH 1UE5A 1OXSC 3LLRA 2F0OA 3E19A 3PT9A 1A0NB 2CQOA 3V2TA 2XIWA 4AH6A 3Q24A 2X4YA 2RSNA 4QKUA 2WV6D 3GNGA 1KAAA 1GOZA 3CXCA 1ENCA 3DEOA 4N4IA 3H3VH 5KYUB 1SJED 2EQKA 1ACMB 4FDBA 4DAYB 3SD4A 3CCVA 4DV2L 3MFYA 4FF2A 3HOZH 2VNUD 1HNXQ 4K14A 2HIVA 2OTJT 3D4WA 3L9AX 2EYZA 4OP0A 4M75C 4EQNA 1ZUKA 2P5ZX 4HAEA 4E2FB 2XI9A 2PUOB 4JRQA 4GBQA 1K1ZA 2JVVA 3UF4A 5J39A 5J1ZA 2WAQB 5M5YH 4RHSA 1UTIA 1YI2T 5JJLA 1N27A 3TU4K 3H3VI 3JRZA 5GAOn 5GANf 4YY3L 4X65Q 4OMLA 1SEBD 3NP8A 1PC0A 3DUZA 3CQTA 1UE6A 1Y1VH 3GTJH 2AKLA 1D1KA 2A6EC 4JI0Q 4WJ3M 1WDXA 2FRYA 4FW1A 1IW7D 4JI7L 3OWEB 1TS4A 5FRMA 3J81c 4KUDK 5I6WA 2W0ZA 3ITPA 4ZGJB 2L3PA 2F0EA 3SHLA 3D3RA 3SK5A 2EIFA 3TSWA 1X6OA 4OO1G 1JORA 5LJ3e 1M2OA 4EDUA 3RMQA 4PNOA 5GAN7 3OBWA 2NN6I 1N5ZA 4IIMA 1XMQQ 2F0KA 2M51A 1MMAA 2KBNA 1CM9A 2O4XB 5J26A 4A4FA 4JBJA 4F7UG 1TR5A 4M7DE 3KLRA 1N32L 3E0JA 4YHHL 1EU4A 1QZGA 1R9TB 1IBKQ 1FJGQ 2QAZA 3IQLA 2DAQA 1Y1VB 2B2VA 5CQXA 3LGJA 3GTKB 1SE2A 2GVAA 3TMEA 5IP7G 3C1EA 5CCAA 5FO7B 2DVJA 3P8DA 2YU9B 1PRMC 1ENFA 1VQMQ 2LQKA 1IBLL 3OBYA 1M90U 4LF8L 4LW1A 2E8GA 1N33L 3BDUA 1SRUA 4JRPA 1I5FA 4M78F 2NTSA 2Z9HA 2PVGB 2VQFL 1STAA 4DR6Q 3CAMA 2F0UA 1HSQA 4BY7B 4D8DA 3HKSA 4Z89A 4LF5Q 2PMZB 1M3AA 4C2MB 4Z02A 2TSSA 2AWNA 1T0JA 2K3BA 3I9QA 5GAOp 1HNWQ 3VR2A 3HKZG 4FO2A 4UPAA 4KBMB 4R55A 2K5DA 1BOSA 4C8QE 3RLFA 4JI6L 4MMLA 4L5RC 4RMOA 1ICWA 3UDCA 4F8MA 3W2DA 4R4TA 3OTOL 3H6ZA 4J8QA 3L2QA 1WJJA 1YHAA 3JSCA 2IVWA 2HDLA 4M4ZA 4G57A 5IXFA 3K5LA 2CP2A 3GPLA 2NB0A 2F2XA 2LTOA 3R2IA 4KKTA 4V190 4KK7A 1SYEA 4K8JA 5LMUL 1LVKA 5IWAQ 1D7QA 1QKXA 4A3MG 3EFOA 1HUMA 3TP8A 1CSQA 1G6ZA 2QYZA 2JA6G 3OS0A 4GOPB 2RHYA 4L5SA 1LTLA 1I0CA 2RBMA 1XNRL 4N0AC 5JPMC 2A19A 4DEYA 4GS3A 3NEMA 1K3RA 3FKIG 5EPLA 2JP1A 2MK5A 3C94A 5CKDA 1HJDA 4J1MA 1SFOH 1P16A 5LJ3j 2F5KA 4DAMA 4DBHA 2YV5A 4O0AA 1BCMA 2WSFE 4A3GB 4DR6L 2K5WA 4A3BH 5KNBA 1O75A 2COWA 2ZT9C 4KT0E 1O7YA 3W3AA 1TIID 4HEDA 1HR0W 5I21A 1YCSB 3HOUB 4F17A 1F9PA 4QL5A 1W70A 1R4PB 5BN5A 4R4IA 1VIEA 1SNQA 2F69A 4JUVA 1WCMH 4PMWA 4CDFC 3S1MH 2G9DA 1PD1A 4CJ0B 5GAMd 1WLPB 3EFOB 2H4OA 3PF5A 3DMUA 5KE2A 2FHTA 2V8JA 3K6OA 3NELA 1AH9A 2E3IA 1G291 4C0DC 4R8IA 2G9HD 2UU9L 5GROA 3E9GA 5IHNA 1GKHA 4EX5A 1K0XA 1I4QA 1Q86U 1YJ9A 4LFBQ 3VR5A 2KRMA 2CP3A 2X6GA 2EJGC 4K5VA 4AFQC 1UE7A 1J5EQ 3GTMB 1QG7A 1GXDC 1BI3A 3BDLA 4N0AA 1FL0A 2AUKA 5KYYB 2EXDA 4A3BG 3H8ZA 2K5VA 4RGOS 1RI0A 4F7UB 3L2VA 3NGPA 4NL3A 3M9BA 4HJ8A 4M77D 2IL8A 3VA7A 2LJ0A 4DR4Q 3RDVA 2LCLA 1M1KR 1JICA 4QT7A 3QB3A 4GKJL 2KDSA 3LYIA 4J9FA 2HUGA 2ICIA 1ZYRC 2YTVA 4KHPL 2RB6A 5GAN8 4LWCA 4RWSC 4LDUA 3U50C 2NBFA 4P2CB 1Y8OB 3NQTA 2A28A 4C3IH 1ML0D 1F1BB 1Y96A 3MEVA 2XRQD 4ZQ3A 4Z8AA 1D1AA 1OV3A 3FP9A 4RAUC 1HNZL 4JI8L 4GKKL 2K03A 2ZJRA 4AYBE 2UUCQ 1QLYA 1PRTF 5LJ5h 3OS5A 3HOYB 4DOWA 2FVUA 3GP7A 2D0OA 1HRJA 1VDZA 1I07A 4WORA 1JWUD 4JOIA 3BS1A 1V1OA 2WAQG 4CJ2C 1STEA 4XDXA 2QKIC 3I56T 3FHWA 2DIQA 1OULA 1JJCB 2YHTA 2A0FB 2CWAA 3A7LA 4OX9Q 2BE5C 2Y4YA 1JJ2S 2Z6BA 2ATWA 1SDFA 3TEHB 4M7DA 1RAAB 3MKDA 2LJ1A 1O78A 2BDOA 2RI2A 1RHPA 4X66L 2IX1A 4A3FG 4DV4L 1I81A 3GTQH 4X66Q 5H1SE 2E5LL 1UE9A 4XQQA 1VQCA 2FEIA 5GAOl 1CKOA 1MHNA 4DV3L 4YY3Q 3HPWA 3REBB 1SXTA 3S2HH 4KI0A 2X51A 5ELBA 2B63B 1WI5A 2NUTB 1Q82R 3SGIA 4UY8C 4GLKA 1AFPA 1DOLA 2ZPEB 3I56Q 3DB3A 1VQGA 1I50B 4ZK9B 1XTDA 2H8HA 3OYYA 4Y92A 2Q8TA 4C3JH 3H6MA 4PJOG 1VMPA 5ELOA 4IJHA 4BWGB 4FYWB 1KIXA 3HOWH 1F9SA 1DJ7B 3NWTA 4A3FH 1DZ1A 3G4SA 2VB3X 4XYOA 1UEBA 4GOPC 4ATOA 1WD0A 3C3LA 3MXNB 3JCMe 3A5UA 2EVRA 2JT4A 3LW5E 3IKJA 4JI7Q 4C8QC 3PF4A 5C0XJ 3VR3A 1NLPC 2PUKB 2XHCA 2EYLA 1OX9A 2FPEA 4PZ6A 4H13C 2JS0A 2OAUA 2OTLT 2Z8LA 4FNFA 2B2WA 4DPGA 4DV6Q 3FRNA 4KN4C 2ALYB 1ILQA 3TREA 4LXCA 2E6NA 1SNCA 2EGCA 1OX8A 1ZBJA 2GNCA 3LWHA 1F2ZA 2AKWB 3CRLC 4ZTJA 5KYXB 1VQ9T 4QW2A 1EY9A 4E7ZA 3JCMf 4B3SL 1BBXC 2ES2A 4GZYC 2GA4B 1FGBD 3AMUA 3PO3G 4JZ4A 2L5QA 1T5EA 5CBEE 1YHQQ 1XNQL 1W2BP 2OTJQ 1MV0B 2A08A 4IUQA 2K4YA 2J06A 3A8MB 1QOHA 1U0LA 3P75A 1X65A 3OYBA 4C92A 3F2UA 2UXBL 1X3FA 2DTIA 5GMKh 4C0GA 4ZGDB 1PTOD 1ONLA 1IYUA 1TWGB 1VQ7T 4KKUA 3UDXA 2HSEB 1GD7A 3CPFA 3HOXH 2O5IC 4RTWA 5GAN5 2EXZA 3M57A 1RAHB 5M9OA 3CF5A 5DY9A 2HCKA 2GFUA 4QQ6A 4YCVA 1PH5A 4KUIA 1OZ3A 4E7SA 3BVGA 2DM1A 2JN4A 4K11A 2HD0A 2M00A 2RVLA 3BDCA 3LGLA 3S1QH 1OXUA 3AEVA 1FWZA 1RKNA 1X3EA 4C3HG 4WJ4A 1NG2A 1WIEA 2AHJB 2VWFA 1KG1A 2ATCB 2JA5H 3IAYA 2WSCE 4K8IA 2VQEL 5I9OA 1G5VA 5FU6C 3H94A 3KLWA 5JJIA 1Y7XA 2D8JA 4C1NI 1OI1A 3WVEB 1MI2A 4C8QF 1CQFA 4F16A 3NHHA 4BE1A 1QWEA 2Y4XA 3NXWA 1X2QA 1PDQA 4HIOA 2MPXC 3WXMB 3DLLA 2LKVA 2CGHA 2MIOA 4JYAQ 1WYXA 1E7ZA 1A3TA 1G8ZD 1RD9D 3HEJA 4ILWA 1HXDA 1SLJA 3LH0A 3RZOH 3HSBA 2B2WC 2OF1A 1GJXA 1LABA 1OYXA 1C6VX 4WCIA 5EJWA 1RLPC 4OGQC 4XQJA 3SWNA 2M02A 1EYDA 3I4NB 1RACB 4JRIA 2BZYA 3AFPA 3G6JB 2C9OA 3OIPA 1M90C 2A6HD 4OB2B 3ZEHA 2LVMA 4VUBA 3P1HA 3X3NA 4DR2Q 1KL9A 1V9PA 1RABB 3C4SA 3EGDB 3X25B 1AD5A 4QB4A 1V43A 1Z9ZA 3MEFA 1LT5D 4CGYB 4DR3L 2F0PA 1M1KU 3VRZA 3EGUA 1FYNA 1WHLA 1M4VA 2KBTA 5KNDA 1CA5A 1E7OA 4V0BA 4CC4B 4TVAB 4F88A 4A93B 4CC2A 4DV4Q 3SEMA 1WHJA 2QGGA 3NHNA 1D0ZA 2HEQA 4BBRB 5GMKi 3S15B 1B1ZA 2RNAA 3CBMA 1OOTA 2ZXRA 3OA6A 1Q82C 5C5LA 1NR4A 4HIMA 5M3MG 1TSFA 2AQ2B 4PJOF 4JJBA 1BXTA 3DWQA 1IHVA 3ASKA 4JI5L 1A63A 4KY6A 3GTMH 3K5NA 1CKNA 2K9GA 2DIGA 1S4ZA 3I7FA 1UGVA 3OWFA 2JA6H 3E9IA 4BBSH 3T13A 2MI6A 2YT6A 3SFMA 3TDQA 4NS5A 2FPDA 2MJ8A 2QDYB 3KUFA 1EL0A 1X55A 2OI3A 1AZGB 2R5MA 1BI2A 4MDWA 3THKA 4AT1B 1U4PA 4K0KL 5HGQA 2K6AA 3M4OB 3M0PA 1H9JA 2ICEC 3S1MB 3CRKC 2JXBA 3VDYA 4NPSA 3KF8A 4P71A 4U68A 1S1NA 2YLBA 5IN1A 1I6HH 4RUGA 3UT1A 3Q23A 4JDSA 1B9NA 2EY6A 3NPPA 2FZGB 2BUDA 5KH6A 4V2SA 2XNAC 3FMCA 3NBIA 3TS0A 2E5QA 1QVFP 4JI4Q 1X3QA 2DKGA 1G83A 3M0TA 5KYUA 2JSOA 1FMWA 2EE1A 3KF6B 3OS1A 2E2DC 2KEEA 3M59A 2R7ZH 1KDAA 2NZOA 4RH6A 4DK6C 4KN7C 1TWFH 3Q1JA 3EFRA 4HCZA 4MDXA 1E24A 3I55T 2RF0A 3UDGA 4DR4L 4GKJQ 1V29B 3H41A 2KENA 2XGTA 2LNHB 4DKAC 3K59A 3TEEA 1M2VA 4YWLA 4CRIA 2NUPA 5GAN2 1RLQC 2JS2A 2YLCA 2A68D 1KDCA 4FYDA 1ICFB 2DTOA 2RD1A 4M78D 4M75A 1VQKT 1NTGA 3CC7T 1V1CA 2VV5A 4JJCA 4NDXA 1AE2A 2FZKB 1B9MA 4BBRH 3CCMT 1BCPC 1F9QA 3S15H 4N9TA 4GKKQ 4MTNA 4J6YA 3S2HB 1YJNQ 1PKTA 1NY4A 3QO3A 3FJ5A 2A69C 2A6HC 2RHSB 3P8BB 1JOOA 5CV4A 4L6TB 3SXHA 2ENMA 2JTFA 4A3IH 3I5SA 3J81j 2QEXT 2CUBA 3OYKA 3CC7Q 5CQYA 4DA2A 3QHSA 5IGGA 1M4ZA 3K58A 3RKYA 4J83A 3QJ6A 2LQ8A 3AQQA 2NN6H 3RLOA 4KTAA 2H5XA 1K83B 3U4VA 1X6BA 1L0YB 3ERQA 2ROLA 3GTGH 2E1HA 1E1OA 2ZJPA 2MOXA 2ROTA 1VQNT 4J9IA 2G5DA 4DK1A 4LF6L 2CKKA 1LT6D 5IGDA 1IBLQ 1N33Q 1EYGA 2EDGA 2E2JB 2QA4Q 2UUBL 4CBVA 2YUOA 2RA2A 1FMKA 4A3IG 3CD6T 3HOYH 4JI8Q 3VRYA 3I72A 3NPFA 1W1FA 2M1HA 4DFAA 4KLKA 3KJPA 2KVMA 4B9XA 2F4VL 4IOAA 4AYBB 4PJOB 1LTBD 1PTOF 4ZKCB 5CKHA 1DXMA 4IZ8A 1J9OA 2NVXB 2NWMA 1HD3A 1WQ7A 1O9SA 2P84A 1SYFA 2IX0A 3TN2A 1G6PA 3VUBA 4M7AE 4ESRA 3GTPH 4ZRZA 1RAGB 5DLOA 1Q81R 4A3CH 2XDPA 3GDEA 5IP9H 2K6DA 4HSPA 3D8GA 4KH0B 2HL3A 1VQPA 4LUOA 5D65A 3TSZA 1BNZA 4MMKA 2FMCA 3D6CA 5AJ3Q 2JA8H 1NAPA 3DKMA 1YI2Q 2RHQB 2EYHA 2R7ZG 2N55A 2BH8A 2Q8RE 4LJZC 3ICEA 3W1BA 1U1TA 3V8KA 3OSSC 4FU6A 1TWCB 3QO2A 5CC4A 2J4XA 3PUYA 1NPRA 3J80i 1EU3A 2CQAA 1UJYA 2VW9A 2DXTA 3T51B 1PG5B 1U5KA 1TWGH 1EWIA 4JYAL 3TBIB 2RM4A 1K73R 5C44H 3PO2B 1QB5D 4EMHA 1IZ6A 3K5OA 2MWOA 3CMEQ 5K5PA 1NSNS 2AIRB 3GV6A 1Y71A 1A3VA 2XDDA 1Y1WH 4BBSG 1KD1R 1PH2A 5JJKA 4RGNA 3CCUA 2KCCA 2YWWA 4DXFA 4C8QD 1XMQL 5ELNA 3EROA 4C5HA 3MPUB 4C92E 1I3QH 3STBC 2RJDA 4DUYQ 3MA2B 5KCOA 1JE5A 4RHRA 3OSVA 1H9RA 2L11A 1PRTD 2KT8A 3QDFA 3I90A 5EBCA 4A4GA 2WINB 2IIMA 5EC7A 3FEWX 4DGZA 3OPOA 4QY7A 2XKOC 3I2ZA 1YNNC 2BTTA 1VQJA 1K0SA 3G6EA 4L5GA 1LO5D 2X69A 3AYHB 4MTKA 4JI6Q 1H9KA 2D62A 3PGGA 1MGSA 3ZJYC 3MCAB 4L8JA 1EFNA 3HRTA 3K5MA 4X65L 2HBWA 3CC4A 4OONA 4ZKBB 1D2BA 2K2MA 1A6XA 4TSSA 4OMPA 3OMGA 4PZ8A 3I5RA 1XMOL 3HOVB 1K76A 4JV5L 4A3JH 1TWHB 1N8RC 3KYHC 2P0QA 1SYBA 1EZ6A 1STBA 3I4NH 2HHHQ 2EJ9A 2LXKA 1W2BS 1VQ7A 3S24A 4GOPA 2UXBQ 1JQQA 3J80L 4LUDA 4D6WA 1MHWC 4HJ7A 5A2QE 4CDEC 3TZDA 4BE2A 4RTZA 4KMUC 4Y7NH 3T1HQ 3MZ5A 1Y8PB 2CDTA 2F0NA 4DR7L 4LF7Q 4C0ZA 1PTOB 2KHIA 1GUGA 1WTQA 1XPUA 4A3GG 2Q8IB 3M0RA 3G71T 1KC8C 3F8TA 3QYHB 2E65A 3GTOB 4ZLTF 1WJRA 4M75G 3OB9A 1VQDA 4QGUA 1QVGA 1JU5C 1RUWA 4A3DB 4PLIA 2YU9H 5KYYA 2R7DA 3PMFA 4QQGA 3EIVA 5NUCA 1OQKA 2YTYA 3QSUA 1AW7A 2BH2A 2OTLQ 1SMYD 2E75C 1TWHH 1ASYA 1N32Q 1YJWT 2EQMA 3SK4A 1ZSZC 1S5CD 1CTMA 3VR6A 3UPUA 4HVUA 2C35B 1ZYRD 4KKSA 4PFZA 4X64Q 1ZEQX 1EQQA 1S5ED 2EJFC 1UHFA 1YIJT 5IGFA 1EX4A 4OGCA 2DJFC 4Z88A 4M1UB 4AQYQ 5J3BA 2WKCA 2KXDA 2X6LA 1EFID 3MXGA 3QIIA 1E2VA 4JV5Q 1WTRA 4LF4Q 3JCMV 3EHRA 1TY2A 2B2UA 1X3GA 3UE0A 2RK1A 3EAEA 3K7UC 4XT1B 2FINB 5GANj 4KHPQ 1I50H 2DY8A 1AWOA 1IYVA 1EOVA 3DM3A 4ID6A 2R92H 3T1HL 3PUZA 2K28A 3BYTB 3GTLB 2KR3A 5D3IB 2X9HA 1U06A 1SNPA 5CMDA 1X9NA 3HOVG 2MO0A 5GMKj 3IRBA 2PTKA 1T0HA 5GANh 3PO3B 1EQRA 3TP6A 2DL7A 4LFCQ 3SB2A 2I46A 3EA6A 2WAQE 1C4QA 2Q2UA 3S1NB 1VQ8A 3IFTA 4CC3A 2DY7A 1HFNA 1BCPD 3C0CA 2DJGC 3U9OA 5AJ3L 1EQVA 2NVQH 1RIPA 2NN6G 1Y14B 4DR3Q 5GMKe 3NK9A 2VUBA 4LFAQ 3FLGA 1M27C 3RNJA 4HT9A 1LTAD 1EIHA 1HTPA 1B50A 1VA7A 2ZTDA 1HQMC 3CCVT 4WTOB 2KCMA 5ELDA 1PH8A 1G3YA 2EQJA 4BXXG 3M7NA 1IKLA 1CKMA 3P7JA 1S5DD 3NBHA 3S1RB 1ESFA 1F77A 1A62A 4PL6A 2CSQA 5LJ5e 5GANg 1STYA 1VF5C 4NXML 1VQ4Q 3JCMQ 2HDAA 3CBPA 2B8AA 3E6ZX 3KBXA 4M77E 1LUZA 4XTYA 2EQIA 2XTIA 2XICA 4UP9A 1A3UA 1YHQT 2F0JA 1TWBA 1TS5A 1SE4A 3I4LA 4K5WA 1GCQC 2H3JA 3S2DH 3PUXA 3SDZA 4KGZB 3OW2A 4JI2L 2B63H 5BR8L 3RUZA 4GN3B 1TUGB 2OAWA 5AFWA 3HOWG 4FSSA 4IURA 5FLXE 2D9UA 1EZ8A 4BY1G 4CKEA 2EYYA 2K57A 4M7DG 1SNMA 3BU2A 3BZCA 1XPOA 1OU8A 2OX7A 2MMPA 1FX7A 2RN8A 1E2WA 1KC8U 2RQVA 2RHUA 3QDRB 4XK8E 2CP6A 2QEXA 2IT1A 2IPOB 4ME5A 3MAQA 1PSEA 3OY9A 2CUDA 4IUTA 2J7ZA 3I91A 1BVSA 5D6WA 2K2VA 5HY6A 4ZYSA 5LMUQ 3QPHA 4RTTA 4DXGA 5CV7A 3MXNA 1W4SA 4OL7A 3CD6A 1I4XA 3UA6A 1NE8A 3CMAT 1BR9A 2BDNA 4JVZA 1OPKA 2KQWA 2VC8A 1P92A 2E2JH 5M5XH 1SSFA 2K05A 2F4IA 3CC7A 1RL2A 3CCJT 1ZSGA 2LDMA 2EVBA 2VUMB 1PH1A 2DL5A 5KE3A 1AEXA 1B44D 2K5HA 1HTLD 4IALA 3L1AA 4IIOA 4P75A 5F2DA 2V1CC 1BYMA 1J6QA 4O2DA 2DVEA 3M3YB 5GAMj 1BUVT 1QZHA 3J81i 2R61A 1O80A 3G1JA 2W10A 1WCMB 1WZOA 1ZXTA 2DUDA 4OB3B 2KEDA 4E6RA 2I2LA 3HOUH 2J0TD 1EFWA 4JJNK 4K5XA 5GMKl 1SROA 3OIQA 5GAMe 3WDNA 1PH7A 1J3TA 2B86A 2R6GA 2O2OA 2RSOA 4K2KA 1NLOC 1KIKA 2V1QA 4RG2A 1X54A 2EGAA 1TKWB 2AMCB 3J7AF 2I07B 3NWSA 4DV5Q 1WXUA 1SFOB 3C46A 4J15A 1TY0A 3V8JA 3N5BB 1KSWA 1K8AC 1VQKA 2DL3A 1IGUA 2VL6A 2K1BA 1VQBA 3S3NA 3RBBB 2FB7A 2QK0A 3LWEA 5FU7B 3X28B 2ZAEA 4E7HA 2RH2A 2HMAA 3DEPA 2XK0A 4JW0A 4QIWB 5GAOq 1W6JA 2KE9A 3CCSA 1VQ4T 5IT9E 3JAME 2AWOA 2QXFA 2E41A 1KDBA 4BI8B 1WTWA 1FJGL 2EKHA 1FXXA 1WJQA 1LACA 1M1GA 1B7TA 1UGRB 1VIFA 1H3HA 2D2CC 2CZ7B 2J6KA 5GQOA 3OYFA 3MFGA 3HFNA 1EIFA 2LCSA 3OW2S 2LS01 3H9NA 2IG0A 2CP7A 1WGSA 2UXDL 3FJPA 2QW7A 1I6HB 5FROA 2ENBA 2F0HA 4JC0A 2JA5G 5IYBG 1I4GA 1Q81C 2RDFA 1CKBA 2WB1E 3DM1A 1NM7A 5I2YA 1GUNA 5C0XH 2CZ0B 4ANJA 2KCNA 4A3GH 1VQ6Q 2A8VA 4KGVB 1EZZB 2BE7D 2NZHA 5HURA 1I5OB 4M7DD 3G7ZA 3CCLA 1S72A 1GHJA 4DBQA 1HZCA 2JA6B 3PO3H 4DR7Q 4FF3A 1GVPA 3J81L 3MP1A 4JRKA 4XTZA 4IUPA 3EGXA 4M7AA 1STNA 1IYJB 1WPYA 3MVVA 2IHFA 1YFNA 4R4OA 3EG0A 4ZUIA 2I0QA 1YNXA 2I0NA 4DV2Q 2JA7G 1PTOC 2I5LX 2OT2A 2JQOA 1WTVA 1QCFA 1YJNT 1HR0L 1UNSA 2CKZB 4ZNXA 1PFBA 2HDMA 1UGSB 1VQ5T 1MIUA 3VYTA 4OVAA 1VQ6T 1XMOQ 1SHFA 1AVZC 1VQIA 1X3PA 2EYFA 3OW2P 2OXPA 1ZBXA 5CVIA 4RKLA 4KHVA 4GNXA 1N36Q 1Z7TA 1PHTA 3RMSA 1YJ9T 4EQ5A 3DWAA 3RZDH 3AU7A 1Y57A 1Q8IA 1NUCA 3HGBA 3EHQA 3S3OA 2E2IB 1HHVA 1UGQB 2EGEA 1PH4A 4HMJA 4JI0L 3M4QA 3BZDB 4KY7A 3T9NA 1VQOT 1ZQ1A 4EMKC 2V26A 5LJ3d 2VB6A 1YITT 1LLRD 4IPCA 1D1BA 4BB7A 4ZGEB 4DUYL 1X27A 3CCRA 3A8OB 4DV5L 1SYCA 5M3MB 1NZ9A 1V8QA 2R5AA 1HA5A 4O42A 4YCUA 2VGMA 3PVQA 5HK3A 3IFDA 3BY7A 3VS7A 4FCYA 3QIAA 4GLVB 4L63B 1C0MA 5GADC 3GTKH 1T5XD 4YHHQ 3CMAQ 4KY5A 3KF6A 4JI3L 4GNXB 1R9TH 2ABLA 2NVYH 3CCLT 3GF5A 3INZA 1N8RU 2DEQA 2KNBB 1GFDA 3BJUA 2GGRA 3UATA 4IPHA 4WRDA 4OMMA 4X3KA 3TP5A 5I9PA 3S14H 3EH1A 1Z47A 5EPKA 5DM73 2DF6A 3JB9F 2JYOA 2Z4IA 1LV9A 2F3IA 1JO8A 2R57A 1M2VB 2ESWA 5E4WC 1VCIA 2EYMA 1WA7A 2F52A 2COZA 3HOVH 3JAMc 5E1FA 3M56A 4BY1H 3KK7A 4TKOB 3WOEA 4PJOE 4B3RQ 4A63B 3M54A 1EY5A 1N6AA 3CC4T 1VQ8Q 1AWJA 1TU0B 2PNRC 1NMFA 1VQ7Q 4XTVA 1PKSA 2D5DA 1UGPB 1YVCA 3UE1A 4JG2A 3V7CA 1F2LA 1LNXA 3J80E 3A55A 4JBWA 2RPNA 3GTJB 4JBKA 3C1FA 2BZ8A 4EQOA 5C0XG 3HRSA 1NPPA 1CFMA 3RZDB 5IE8A 2KCTA 4H44C 2EWNA 3JB9G 3CP0A 3MP8A 4DR2L 3TSSA 3MEAA 4M77B 2NTTA 1HZAA 3GD7A 2VB2X 5FKAC 5FOBB 3GIBA 2GVBA 3OW7A 2A3LA 1G8XA 2JMCA 5CKBA 3EG1A 4A75A 3K81C 3NTKA 1RODA 2LT1A 3QWYA 4IPDA 3HP9A 5C3EG 5IYDH 1CZWA 2JA7B 2AT1B 2QA4A 3CCMQ 2EAYA 2ZPBB 4O1NA 1BB9A 1M8MA 4Q0FA 4F14A 3FPPA 2MP1A 2L89A 4NW2A 1L2FA 3BE3A 4NB3A 5CK9A 1G3WA 3VS6A 2OTLA 1HZBA 4ZN1A 2QEXQ 2J05A 2VVKA 3I55A 3SK6A 2CWPA 1ZUUA 4M77C 3OYEA 3QR8A 3S3MA 1WTOA 1VQOA 2E2IH 4A3LH 1NYGA 2WKDA 3I4OA 2D1XA 4AMCA 5I11A 2ZXOA 3MEHA 4M78G 5JPNC 1ABQA 3CCJA 2N8NA 1FNVA 4NXNL 4A3IB 2JA5B 1D5MC 2A1AA 2IX3A 5BN3A 5C4ZA 1YJNA 1M90R 4P5NA 1QKWA 2RHIA 4C5EA 3CMAA 3CMEA 2FFKB 3ZBDA 4M78A 4HVWA 1IBMQ 1C8CA 1B34B 2RI5A 4BI4A 3NENA 2VKNA 1IL8A 3WVDB 2F0IA 2ZCFB 1N9WA 1CI3M 3K8AA 5IIFA 1CSPA 1Q86R 2C0TA 4IQZA 1Z9QA 1G2SA 3D7SB 2QQ9A 1KQ1A 2CFMA 5C0MA 1LOJA 2K01A 3L2WA 4POGA 1MJEA 2ASBA 1JJ2A 2JNGA 4X1VA 3MWYW 4IJLA 4X9CA 4AFUC 1SE8A 1WTXA 2JW4A 2X4WA 3H09A 1HR0Q 3A8IE 4P74A 1MMNA 2DRMA 4DV3Q 3I4MB 1MNDA 2LMJA 1BBWA 4H0LC 2V4DA 3EG9A 4XQNA 3A7AB 5JAVA 2RQXA 1C0AA 2LY7A 3D0FA 2ZTCA 1AP0A 2ED1A 4J7FA 2QTXA 1KFZA 4M78B 1L1OB 4QUFA 5IY0A 1R4QB 2XSCA 5I6YA 1LCKA 1KK7A 1YNND 4A3MH 1KNAA 1MV3A 2BIVA 4FXGC 4RFBA 4LDVA 1A0IA 1PYSB 4UAIA 4G4KA 1W3SA 1PRTC 5LMNW 4KRTA 5IYCH 4AIMA 1RI9A 1Q7YC 2O4XA 1KTKA 2IHEA 3M3YH 3MXUA 2XWJB 4FIBA 4FYXB 1BK2A 2X35A 4Y91A 4J5YA 1TTHB 4Z9CB 4CHTB 2EFIA 1HXYD 1WHMA 1OU9A 4A3EG 4OX9L 2D0NA 2JTEA 1LTGD 1TWAB 1B07A 3PIPA 4TRDA 3Q6SA 3RN5A 4LDWA 1SJHD 4L6V5 3R2TA 5M5XB 1GUTA 2EYJA 3FEOA 1RDPD 4IUNA 3CC2T 4L5QA 2LMCB 4DV7L 1GHKA 1FGUA 1PZID 1VQMA 4A3FB 3CCST 4IFDG 2GN5A 3D4DA 2AKKA 4YIJA 2RHXA 1TQOA 3U9SA 1STHA 4X3SA 2CSIA 1ZLMA 5C5MA 2E5LQ 4IOCA 1SMXA 1VQNA 4UP8A 2NZ1D 4OMFB 4LE9A 1QW1A 3VS4A 1KLUD 5KYWB 3PE0A 1U9RA 4RMFA 5EG2A 1RAEB 1BCOA 3VYGA 2HQLA 2ZJQA 1SG5A 4M7DB 2DA9A 1PCXA 3RN2A 2DGYA 1VQ4A 3A8JE 2F0TA 2EYXA 1MMDA 1QVCA 1QWYA 4MN3A 4ABNA 1D09B 2DTHA 2EY1A 3CW2C 3HG9A 4I65A 2L0CA 1YHBA 5CR2A 4HXJA 2QEJC 3AB9A 1VYUA 2M0YA 1WI7A 3KBGA 1KRSA 1STGA 2JEBI 2ED0A 3BW1A 3META 4BUGA 3CCSQ 4YWMA 4RGTA 2UXCQ 4L5TA 2VYTA 1B34A 1KJWA 1JWMD 2NUTA 2B8GA 2BA0A 3B6YA 5IXBA 3PVLA 3MTSA 2BZXA 1Q7YR 5C4JH 3HFOA 4OMNA 1PRLC 4N8X1 4B08A 3S1RH 1DCZA 3X3MA 1SBBB 3T53B 4Q5WA 2B2UC 1HZ9A 5KYWA 3QBYA 1AN8A 1YNZA 4CI0C 3E2UA 1ENAA 4M7DC 1IHZA 2LP5A 9ATCB 3CCQT 3TQYA 2DPPB 2JA7H 3RUXA 1ZHIA 1TU2B 1E3PA 2TMPA 2FO0A 1A2UA 1TT2A 3OSOA 5FLXc 4A3BB 2CVRA 2KT1A 1O7ZA 1KC8R 3OYGA 1HJPA 5I4DA 2PPBC 1JEGA 2R92G 4BD3A 4BA1I 1X56A 2EYPA 4JPBW 3OHXC 5LJ5f 1UE1A 1KHCA 2MHVA 2JXMB 3CEYA 2ID0A 6AT1B 2UXDQ 3G7LA 5M5WH 1WTHA 2CW0D 3EVQA 3KDFA 1SNOA 2F0WA 4A4IA 4LF5L 4PNYA 5LJ5d 1OEBA 1CQVA 4AG2C 3O13A 4M75D 1IXDA 1BO0A 2JZ2A 1ZSZA 1V1PB 2F0GA 5I22A 2HHHL 1QCNA 2DZCA 3NTHA 2D0PA 3KFVA 3ND8A 1QUQB 2GF7A 4A54A 3BYYB 4KD4A 2PU9B 5IHKA 2YXYA 3RESA 4JK1C 5JJZA 4KJNA 4XQ3A 1FVIA 2LZ6B 2DRKA 2XRSD 5FJ8H 2E70A 1FNWA 3RKXA 2FRWA 1Q8KA 3EQLC 2MNAA 1UG1A 3RKWA 2OCEA 1D5XC 3WWVA 3NMZC 4M78C 1F9RA 2R93H 3LWUA 5IYBH 2A68C 4RTVA 4P72A 1WXTA 5C4XH 1A2TA 3K0XA 3OYCA 4A3MB 1VQEA 4JI3Q 4J9DA 2BE9B 4FVMA 1UFFA 5GAOm 4OIKA 4XTCS 2RCFA 2LQWA 3FC3A 1ESRA 1T9HA 2WFWA 2NUPB 1BI0A 2HSPA 1TXQA 1VQ9Q 1B4OA 1KD1C 1LTTD 1SNDA 1XX8A 3NE5B 3GTLH 3X20B 4X6AH 3L0OA 2PQAB 2RK2A 4NKLA 1NBWA 2B2YA 1J8IA 2X4JA 5A0LA 4KULA 5GAN3 1PTOH 4YCWA 1SEMA 3VA5A 1YBYA 2VQFQ 1Q81U 1FR3A 1CT1D 1WHKA 1EY8A 1A8VA 1K8MA 3GOXA 1E22A 2LQNA 1X01A 1Y07A 3CC4Q 1VQ8T 2HKQB 1HCZA 4JI1Q 3S17B 5FK9C 2HCCA 3ER0A 4DV1Q 1G91A 1WFQA 2K79A 4C3HH 2E12A 1JR0D 4DNTB 4A3JB 1EOTA 2JM8A 4FYYB 1YJWA 4FXKC 3S1QB 4DR5L 4ZN3A 3G6EQ 1LTID 2JA9A 2F03A 2O5JC 4GLAC 1SSHA 2KXCA 2K7VA 3OTOQ 5LJ3h 1N8RR 2Z6KC 4A53A 2O88A 4J7IA 2PQWA 2F5TX 4OMQA 3TQ7P 2PQAA 2NUZA 3PFSA 1NJIC 2K3YA 2RI3A 4HCKA 2SEBD 1YWOA 3HTRA 1UDLA 2DJQA 5I2MA 5GAN4 1N34Q 4LDYA 1GO3E 2SDFA 4C2MH 1H9SB 2DYBA 3PNWC 3S6WA 2JE6I 1DOMA 2BA1A 1BU1A 5KEEA 4DUZL 1Y1WG 1IL2A 2K50A 4BY7H 1H92A 1RTNA 1I3QB 3NSWA 2KRNA 2K5NA 3H0HA 1VQAA 2L9HA 3J7YW 1JXMA 3P20A 4DAPA 5CR3A 1IXRA 4B3RL 5C44G 3I55Q 2YUPA 3GQBA 2BOSA 2A74C 5CKEA 1QUQA 4ORZA 4G7OC 5E7NA 5AT1B 4DQ2A 1GL5A 5G3LD 5GMKm 5BN4A 1QJOA 4DN4M 1Q12A 2SNMA 3M7GA 2DN8A 3MHBA 4CDCC 2RQRA 3EFSA 4A3KG 1XPRA 3ULRB 1MMGA 1XNIA 5DNFA 1UB4A 4II1A 4CKBA 1X75C 5KYXA 1XXGA 2JA8G 1E6GA 1G3TA 2EJGA 4RG1A 1IKMA 3TZUA 1VQPQ 3CPWA 1BF4A 1JB3A 2KAFA 3HFZB 2ZPHB 1OZ2A 4N8FA 3U23A 4XYQA 2KQ3A 2EPDA 5DEHA 1CK1A 2EW3A 4R9WA 5C4XG 1D8LA 3CCUT 1S72Q 1GBRA 2H1EA 5CV5A 5GAGC 3M0SA 1I4HA 2JA8B 3JAML 4PJOD 2K5FA 2ZPFB 2N88A 3KF8B 1D3BB 4RTYA 4BY1B 1CKAA 2DD4A 4J8OA 5CAIA 1SYDA 3QWXX 4YWKA 4M7AF 1TOVA 4CKCA 5FLMH 1EWHA 2PYKA 4U673 4HIDA 2PI2E 3PMIA 4J6WA 1RF2D 4F7UA 5IGEA 4DR1Q 3G6ET 2DL8A 3KJOA 1GCQA 4EMGA 2EOTA 3GTQB 3K80C 3PIOA 2YDLA 1KQSA 1VQLQ 1SAPA 1W6KA 5EBDA 4G7HC 3C2PA 2PW7A 4FP5D 4ME3A 2G6FX 3CCJQ 3NQIA 5C44B 1SMYC 3PO2H 3MJXA 5C3WA 4FSXA 2J7IA 4M75E 3GBQA 2JMAA 4OELB 2MFIA 2CH4A 1BDOA 1OO9B 4ODGA 1KLGD 4ALPA 1Y69U 3TCJA 4I7AA 4QF4A 1YCYA 2VUMH 1Y96B 3I8ZA 2IW3A 5FJ8G 3A98A 4IUUA 1WQWA 1QNUA 2E74C 1TXYA 4HCSA 1EIYB 3I4MG 1S5BD 2XN9C 2F1MA 1MJCA 3JCMX 1MSHA 4PJNA 1H9SA 5FLMG 3SWNC 3M4GA 1NJIU 2WACA 1B3AA 5D7UA 1V76A 2DMOA 4F7UF 4G7ZC 2HKNA 1I4RA 1TVXA 1YHQA 1PYWD 2VXFA 2R3ZA 3KUPA 2L8DA 3QOLA 3MEUA 3KFUA 2KYBA 2MCNA 4HJ5A 3SVMA 2ZXPA 2IPKD 1KHIA 1KQSP 1K9MR 3D6WA 1JT8A 1JBMA 3E9HA 4E7LA 3D31A 1UJ0A 2KK4A 4RGMA 4POFA 3QJYA 1HA6A 1U3OA 2YTXA 4QCLA 3OYAA 5ISRA 2VASA 2X3XD 4J9BA 4AG1C 1K8AR 1I4PA 1UAPA 3FPUB 3TP7A 3JCMg 4CJ1B 4GN5A 1VQ5Q 4PFPA 2F0MA 1W6XA 2YRDA 2R7FA 3O8VA 3OMCA 2RQWA 4LN2A 2LX7A 1XJVA 2CT4A 4ME7A 2K04A 4QJFA 3FKIB 5L37A 4J9GA 2YRCA 4OF1A 1IBML 3CCUQ 1S72T 3QZ9B 1II3A 2Z4HA 4LD9K 3STBD 1DJRD 1VQLA 2HBPA 1JB7A 2KA7A 4JJDA 3OS2A 1F2MA 2BCOA 3I3CA 2ZM6L 1I94L 1LPLA 1YWPA 4NOYA 1KNEA 1MNEA 3DXJC 3G48A 4BS9A 2N49A 2JOYA 3PQIA 2VQEQ 2G3RA 1PZJD 2GTJA 2HQXA 4LNPA 3PIP3 2IY5B 4IFDH 2EY2A 1PHJA 1H3ZA 1JOKA 1E1TA 3CCRQ 2L3SA 4FF1A 1OTCA 3JAMi 1XNRQ 4A3DG 1PD0A 3M4OH 1YJWQ 1QVGS 4M77G 4BI3A 1I8FA 3ULLA 3H0IA 2E5KA 1CKNB 4C92C 4LK1C 1YIJA 1KAWA 1JB0E 3LGFA 2CP5A 3GTPB 1HPCA 4PJJA 2L1BA 3OYDA 1PV4A 3KXTA 1NYFA 2F4VQ 3F1ZA 1N9SA 2I5MX 3R93A 2QQRA 4C3IG 4BY7G 1YZ6A 2O31A 2DERA 3JB9J 1BBZA 2EYOA 4ZCKA 4O6JA 3PV0A 1R8OB 3C95A 4HJ9A 5DLQE 1R0CB 3E0EA 4X3TA 2MQHA 4R0KA 1PVOA 5KYLA 2M0OA 4OGEA 2K14A 2R93G 4OXPA 3CBOA 3SEBA 2M16A 2FXQA 3J80c 2QF7A 4JS5A 1Y1VG 2LNVA 2D9TA 2DFUA 3A56A 5L23A 4LFAL 4LFCL 4KD3A 2VS1A 1NEGA 4HKEA 3MO8A 2VXEA 2IJ0A 1OXVA 2VXWA 4OHJA 2O2LD 4ZUJA 3G71A 5AYFA 3HL8A 1ZA2B 4GNXC 1AWWA 2DK3A 3JV3A 3BG3A 4J9EA 5GAHC 1Y8NB 2AUJD 2PNIA 1QVFS 3V96A 1GBQA 4BBSB 4DU9A 2Y0SB 5C0XI 3LX7A 5LMNQ 4Y7NB 5CO7A 2FYKA 3LWIA 3Q0AA 2F2VA 1I4K1 3LNNA 2LXJA 3HOZB 3JCMb 3L2UA 4LAAA 1KQ2A 2P0PA 4E6IA 3UDFA 5IYDG 4A4EA 3CXCP 5FRNA 1WFWA 2A7YA 2M9UA 2O9SA 1L1OA 1VS0A 2PO4A 4XU1A 5EKIA 5IODA 1AZQA 3F2BA 4A3LG 2EQSA 3A8KE 4N4HA 3CCEQ 2LJ3A 3GNFB 3CD6Q 4XU3A 1D5ZC 3I70A 3PGZA 2FPFA 1JCKB 5D3DA 5A35A 1GUWA 1HUNA 5FU7C 2K5LA 1EWCA 4DR5Q 1CZGA 2A69D 4RKBA 1MGQA 5T1GA 3V05A 1PZKD 2R7ZB 1F2YA 4EGVA 3S17H 4JI4L 5CGKA 4QMGA 1LM0A 5G3LF 4LF9L 2A37A 4IFDJ 1GXIE 2PQEA 5C3EH 5FWBA 1M5Q1 5IGCA 1ZA1B 4F7UE 4HR7B 3M53A 2PI2A 1NEBA 1IB8A 3EH2A 4A3EB 3JC66 2QCPX 1U4RA 3HP3A 3UWNA 1LYLA 2FL7A 3CKIB 4MNOA 2DBKA 3M55A 1O7LA 2J6OA 4HT8A 2HD3A 1EUJA 1WD1A 2QQBA 5KRUA 4BY6B 2WB1G 1ET9A 2EZVA 3RZOB 4JLGA 4J6HA 2AK5A 2C06A 3S14B 2OTJA 2HNIA 1S5FD 5CV8A 3T56B 2E3HA 4DBRA 5C6SA 2DETA 2K5QA 2K32A 2F0QA 4AFSC 2EBPA 1BIBA 5JEAG 3VS2A 3HOXG 2DBMA 2D0QB 4BACA 3JCMd 1M8AA 4EMKB 2KUMA 1BI1A 4NL2A 3N52A 1CHPD 2KGTA 2XDBA 2DNUA 1XYIA 1K9MU 2RCNA 4DNRB 3HKZE 4M7AD 1HYOA 2EYWA 4IUVA 4RG8A 1VQNQ 4PZ7A 2GQVA 2Q2TA 4UC4A 3JCMh 4C8QG 1Q1BA 1RAFB 2FJ2A 3UI2A 4XIGS 4E47A 4A3EH 2PZ1A 3CCLQ 1TUDA 2P4TA 3A8LB 2N3SA 3PCOB 2QA4T 1S40A 2ZZDA 2JTMA 3RD4A 3GP8A 4QVZA 4DV0L 3N6RA 3LH5A 2PVOB 2V8KA 4C8QB 4CDDC 4F87A 1M9SA 2CYZB 1LJOA 2B2TC 1QILA 2OQKA 2F3WA 4M75F 1P8LA 3FDTA 4QQBX 1KD1U 2Z0SA 1BCPB 4R8NA 5JVH3 1K8OA 1RADB 3M5AA 4H7BA 4B3ML 1RAIB 3ERSX 3HOXB 2WSEE 1K28A 2KMTA 2Z0WA 3A8HB 2RJEA 4MZTA 5IP7H 5KNCA 1ZX6A 2NVXH 1HNZQ 5IOCA 5ELFA 3EBEA 1IRXA 1YITQ 3A8GB 3U58A 3NTIA 5IAYA 4P73A 3VS0A 1VOMA 2FG0A 4XTWA 5KYIA 3REAB 5CORA 4R56A 4OEMB 2O9VA 3W1GA 1I5LA 1QE6A 5IYCG 3X24B 3CPWP 1U5SA 2B63G 2JEAI 2V8IA 1R77A 1TS3A 2L2PA 3E9FA 4PKCC 5IP9G 3T4AC 1NR2A 5IT9L 2YUNA 2VUMG 1HK9A 2F0DA 4J6XA 2QI2A 3L2ZA 2DEUA 1IW7C 2DXCA 2DILA 2CS7A 1K73C 2OQ0A 4DNIA 1SR3A 5C3EB 1J5EL 2A6ED 2HIXA 1VQ9A 2GBQA 2KRSA 3H15A 2LC4A 4PK4A 2E76C 1AWXA 2ZM6Q 1I94Q 4MZ9A 4TQUS 1SPKA 1ZKOA 4N9PA 3TS2A 2ZPGB 1HQRD 3TRZA 2RKSA 4BXXH 3LX0A 2F0SA 2LCCA 4A3DH 3K57A 4KH1B 3ZYYX 1UHCA 4HVVA 1X69A 4HA8A 4HCBA 3RERA 2RA4A 3VYHB 3H0GH 5DM63 4LF8Q 3CCVQ 4N4GA 1EY6A 4XT3B 2COYA 3VS3A 1YEZA 2PCFB 4ZTFA 1DOKA 3QZ5B 4QVDA 3NUCA 2WIIB 1SRLA 1JRIA 2GTOA 2LT4A 1YITA 2NUCA 3V7RA 2PNHA 3HOWB 1Z9FA 5CKFA 4A3KB 5HKCA 2IWHA 2ECZA 4OIJA 3HOZG 4XU2A 2EQUA 1CSKA 1JE4A 3VKIA 3CCQQ 3CC2A 3R8BA 4EPCA 4E7KA 2Y0SG 2RQTA 1PWTA 3NFCA 3CCEA 4EVOA 2J6FA 2F1LA 5ECAA 3HS0C 3KDFB 2UXCL 2QDBA 3QUIA 3RMHA 3H0GG 4C92F 5IT9c 1T3LA 1O7IA 1ZSZB 4FT2A 5GAOr 1MD2D 4DK0A 5C4HA 3DLMA 2B29A 1SF9A 1Q82U 1VQ5A 3E5SA 2O01E 3M58A 1VQMT 4NMZA 1Y1WB 4B3SQ 1DD2A 4HIKA 2CZ1B 3MC0B 4OO1I 1VF7A 1JMCA 1VQPT 3A54A 4DF7A 2DYIA 4LF9Q 3GV3A 4QVCA 3VS1A 2UUAL 3JCMP 3AHUA 2R93B 5ELCA 4DOVA 3G71Q 2K33A 2LRQA 3ME9A 4R4QA 2KVQG 3FVQA 1AOJA 4RKUE 4DAYA 4C5IA 1GCPA 4WFN3 2HT1A 1U8RA 4M78E 2FHDA 5GAEC 1AT1B 1JJ2P 1ET6A 3I4NG 5C3XA 1ARKA 4A3JG 1U4LA 1B7YB 3FKIH 4C3IB 1T3SA 2XWBB 4PMBA 3EJIA 3KOJA 2MWPA 3H0FA 2VZAA 1PXUA 1YP5A 4MHEA 2KECA 1H9MA 2F2WA 3H91A 4M77A 4MIUA 3F2CA 3HOUG 3VJPA 4DEXA 2EJFA 3FRPB 4UHVA 3V8LA 4EQPA 4C3JB 1M3CA 2UUCL 1DYQA 2L12A 2ZPIB 5M3FB 5LL6S 5LJ5j 3E1SA 2E10A 4LUEA 1FD7D 1UUPA 3ULPA 2WP8J 1U1SA 1WVLA 3A0JA 1JJGA 2HL5C 2RDHA 3T16A 1HH2P 2D6FA 2KOLA 2QILA 3L2RA 2MYSA 4QIWE 1AHJB 4ZAIA 5CIUA 1WOCA 1CUKA 2B2VC 5JVG3 1H95A 2YSQA 2PZUA 4C3HB 1AZPA 2F0LA 1IGQA 4A93G 1LTRD 2EKOA 3J7ZC 3VUZA 1PNJA 2LSSA 4B3TL 5KIXA 2ZGWA 2VY3A 1GRIA 1NCVA 4C5GA 3PUVA 4AQYL 2YYZA 1GUSA 4UP7A 4M75B 2B2TA 4LF4L 3ND9A 3CU7A 3HOYG 4JI5Q 1EYAA 2EYQA 3A74A 3VV0A 2XMFA 3CMET 2OEOA 1FYCA 4M7DF 2XD0A 1B3QA 1K83H 4C3JG 1X43A 4QQDA 1QCBD 1PA6A 5DM7R 3VYRA 5A0GA 1YN8A 1WYDA 3MP6A 3IL8A 2BE5D 3HRUA 1K0RA 4OMOA 4BA2I 1NE3A 3SE0A 1B70B 1XQHA 4AFZC 1EY4A 2NVTH 5FLXL 3KLSA 4K0KQ 4NXNQ 1QP3A 2B39A 3R6NA 1QCOA 2DZ9A 4M7AC 2HZYA 2HCIA 1YNJD 2KJXA 2L4NA 3I35A 3BZKA 3SWNB 1PFSA 3S2DB 2CCZA 1L0WA 2R92B 1PLFA 1D3BA 1PFMA 5IWAL 4DUZQ 1B2TA 1OPLA 1E6HA 2NYZD 2QGQA 1TG0A 4R4CA 1AZEA 4FF4A 2OJ2A 5LMNL 3M9QA 4R1JA 3OOCA 4KV6A 5HGTA 3BVZA 3PSIA 4PFOA 2GCXA 2N78A 4HN7A 4QUCA 1SYGA 5FU6B 3S16H 5LHY1 4F7XA 1WX6A 2FMMA 1M3BA 5FW9A 5E4XA 4JI1L 4DV0Q 2YRVA 4C0FA 1VQFA 4DV1L 2E64A 5K36H 1SRMA 3HRZC 5EKLA 3QG1A 1M8VA 5FO9B 3RNUA 4TVRA 4OB1B 2QG9B 2C0OA 4XTXA 1EEID 3S1NH 2RQUA 3MHXA 3QKJA 3G4SQ 3H3VC 3PO2G 2E6ZA 1VQOQ 1TS2A 4JI2Q 2K5IA 2VGNA 4HCEA 3VYUA 2AQ3B 4LUVA 5JEAJ 5GAMf 2SOBA 5CV6A 1IO6A 2K75A 4KGXB 4OWWB 1QVFA 2SEMA 1S3OA 1N34L 5C4XB 3JB9D 1K9MC 2DO3A 1R0BG 2RMOA 1QMCA 4O5VA 1MSGA 2C5CA 3VR4A 1QVPA 1EY0A 1XOVA 1TS9A 4HMIA 4LUZA 2M2LA 1B53A 1XTCD 5HK0A 4PG3A 4C1NK 1OXXK 1Q1EA 1RTOA 3CC2Q 3OYIA 4GLMA 2CW0C 4JCVE 2XIDA 1DGSA 4A3KH 2V1RA 5GANe 5LJ5g 3CCRT 1NNXA 1G2BA 1D6EC 3G4ST 1QQJA 4PJLA 3Q8DA 1VQHA 4GLXA 1KABA 1K8AU 3HZXA 5ELEA 2RJCA 1VQKQ 1H641 3PUWA 4K2LA 2KROA 3DHQA 3SK8A 4PMCA 4IN3A 3PIO3 4BDZA 5EQ0A 4D8KA 2C0IA 2PW5A 2A36A 4FL6A 4AYBG 1IHWA 4FW2A 4YTLA 1AE3A 2D8HA 2K4KA 4K6LA 1E2ZA 1G51A 4XAXB 3VS5A 1VQ6A 4LMQD 3OYJA 2QTVA 3GTOH 1YI2A 2JN0A 3EFXD 5EKKA 4JS4A 1IREB 2L0AA 2P4RA 2XVSA 1PH3A 3OQ5A 4PJMA 2NVTB 1QNKA 4RCCA 5GAMh 3HHTB 3J81E 3SHWA 1YIJQ 1NJIR 2CH4W 3RR5A 4C0DB 4KJOA 4LDXA 2KHJA 2DX1A 4M77F 3A5ZB 2Z1CA 2E4HA 1DONA 2AHOB 3PMTA 3K0YA 1RJTA 5JOBA 2HQEA 2RDGA 4RA8A 2X3WD 1C7YA 4E7JA 1RCVD 5KGUA 4XTUA 2F0FA 1HNXL 1M1FA 2JK8A 1MUZA 1Q90A 2F3VA 3U4ZA 4C92D 1I6VC 2DXBA 3VYSA 5EGTA 1N36L 1XNQQ 3S16B 2MO1A 4IO9A 1G3SA 3C12A 5LJ3g 2I5HA 2UUBQ 1QP2A 1SN8A 4WJWA 1TWCH 1X6GA 2FZCB 1BKBA 1MKHA 3PTAA 4RCOA 2DLPA 4APVA 5LL6X 1K9AA 3Q22A 1ASZA 2PMZE 3BDOA 3ULJA 2L55A 1LT4D 1JOQA 4ELZC 2GFAA 2DNCA 5A2QL 5L8RE 4DAVA 3R6OA 1DM0B 2WB1B 1SKUB 1WNLA 2CT3A 3QXEB 2AZSA 4B9WA 4GN4B 3CQZH 4IKFA 3M4PA 4Q5VA 4PJOA 1PM3A 2Q2HA 1E0BA 8ATCB 1U4MA 7AT1B 1CHQD 2EY5A 1GM5A 4LF7L 2A5HA 4DV6L 4OB0B 4Y28E 4OWXB 2QASA 1HFGA 2EPBA 5TSSA 1LTSD 2X4XA 2Z6KA 3CCET 3DWPA 5C6AA 4X62L 4DV7Q 4HTHA 4BE0A 2PZWA 5KYNA 3CPWS 2NVYB 4X9DA 2M9VA 3O5ZA 2L15A 1EY7A 4C92B 4X64L 3T1YL 3URYA 4S3SA 1VUBA 1BCPF 2NLUA 1JWSD 2L3QA 4K6DA 1BIAA 1PH9A 4M8AA 1D0XA 4A3CG 2RF4A 3J7A5 2GQIA 1SSOA 2KI7A 1SE3A 1V1QA 2L5TA 4KHZA 5M3FG 3X26B 3ZL7C 4B3TQ 3HKZB 2CREA 5GJWB 1Q95G 2F0VA 4PV1C 4FM4B 3K7AB 2RHZA 1ABOA 3QYGB 3JB9I 3L2PA 1Q3LA 5K36G 4F04B 2EJMA 4HSVA 5DAUA 5D6XA 2NWGA 2E2HH 1Q46A 4X3UA 3ZFJA 2KY9A 3EG3A 4HJAA 1PH6A 3I4MH 5M5WB 2KHSA 5IHIA 3TVTA 1NBEB 1C1AA 1ZUYA 1K8GA 4Y52H 2JM9A 2LX9A 2QGFB 1EIGA 5LJ3f 3JCMW 3MXPA 1KRTA 5GANd 3UDIA 1VMCA 4HCCA 2HAXA 1FMVA 5EAYA 1PMRA 2QQSA 4BBRG 3JB9H 3FDRA 2Y90A 1TH7A 3FIFA 1L1OC 4JOIC 4LFBL 3EN2A 4M7AG 5CV9A 3M0UA 2RO0A 1YJ9Q 1D1CA 2MPMA 5M3FH 2AZVA 4JBMA 2UU9Q 4X62Q 2HQHA 3D4RA 2K7AA 1EEFD 1LT3D 3OYLA 2A73B 1UWVA 1N9RA 3GLXA 1M1KC 1KXLA 2UUAQ 2DE0X 1D1IA 4XU0A 2KYMA 3EGXB 4JLIA 3M4YA 4M7AB 4DBFA 5KCHA 2SNSA 4IPGA 1UEAB 1WXBA 2LFNA 3H0GB 3S9WA 1K4US 5COYA 1Q7YU 3I56A 2DD5A 1TWAH 1TWFB 3QWNA 5C4JB 3DB4A 4J9CA 1X32A 3SR1A 3GTGB 4GY5A 5T1IA 1M30A 2BKDN 3URGA 2MUYA 4ELYC 1HNWL 1H8KA 2DXUA 4FT4A 4PJOC 3KLSX 4RTUA 2QQAA 4EMKA 3BVMA 3JCMJ 5J22A 2B8FA 2JUFA 2B3GA 1UECA 3L42A 1K3BC 3GO5A 4I7ZC 2NVQB 3RIRA 3F70A 4PQXA 2K52A 1YNJC 2MAMA 1WHHA 3MEWA 1G2TA 5FWCA 1GFCA 1L0XB 2OWOA 2DL4A 1V1PA 2K3XA 3J7AV 5D14A 4H02A 1PSFA 5D6YA 4BDYA 3CHBD 4C8QA 1GUOA 1BQQT 1C48A 3AFQA 3EG2A 1TUCA 1D0YA 1I1JA 5A0DA 3JCMc 4C92G 1IBKL 3RR6A 1UUEA 1EQTA 4DA4A 3EGDA 3EG9B 3F2DA 2XU8A 1NMGA 1B8AA 4E7IA 2JJQA 1Y0MA 3M0QA 1AEYA 3QOJA 1BBUA 4FYVB 3CXCS 1QWFA 4OWTB 1VYTA 2AQ1B 4B3MQ 1PRTB 4A76A 3V7SA 5CYUA 4C56C 3VU3C 3CCMA 3M85A 2KEAA 5HCKA 4ULLA 3CCQA 2E2HB 2RJFA 4A4HA 5FO8B 3FB9A 1MBYA 5IGBA 1WTPA 1C9OA 2P0KA 4RCNA 5I2XA 4A93H 2SRCA 2DNEA 1FNUA 1JQYD 2ZTEA 2XG8D 1KQSS 5BR8Q 1VYVA 2CP0A 4XXEA 3L7ZC 4UDUC 4LNQA 5EPJA 1PFNA 4WF2A 1K73U 5M5YB 5JEAH 4EIKA 4RTXA 3L3OC 3WOFA 4IFDI 4NP5A 1PYBA 2YUQA 1Z6HA 3AT1B 5GJVB 3OYNA 2H3EB 3I73A 1ILPA 4L59A 1JC7A 1XWEA 2PVDB 2Q2IA 3P8HA 4OO1H 3RLNA 1XJWB 1Q86C 3UA7A 1EYCA 2R58A 4MZPA 4A4KA 4J9HA 3R3OA 3E3XA 5E3FA 1WJSA 4LF6Q 1JXOA 4FXDA 4X34A 5CBAE 2DJZA 8AT1B 2B2YC 3T1YQ 3CQZB 2KSSA 3A1PA 5M3MH 3ONAB 5IH2A 3OYMA 2PZTA 2JJ9A 5GAMg 5GAN6 4JZ3A 2CHBD 3BFMA 5I2SA 3W5OA 4B6MA 1SHGA 4DR1L 4MZMA 4BY6C 4DK3C 4NXMQ 1X2KA 2CZ6B 4LD6A 4PLLA 1A15A 1W2BA 1CA6A 1WHGA 1OXTA 1QVGP 2NYSA 2L3RA 2MGSA 3OYHA 2MF2A 3NBHB 4RCBA 4CC7A 1VQLT 1WCMG
chains in the Genus database with same CATH topology
2Y0SE 3K7AH 1UE5A 1OXSC 3LLRA 3E19A 3PT9A 2CQOA 4AH6A 2X4YA 3GNGA 3CXCA 4N4IA 3H3VH 2EQKA 4FDBA 4DAYB 4DV2L 3SD4A 3CCVA 3HOZH 2VNUD 1HNXQ 2HIVA 2OTJT 4OP0A 4M75C 2XI9A 2PUOB 4JRQA 2JVVA 5J39A 5M5YH 1YI2T 5JJLA 1N27A 3TU4K 3H3VI 3JRZA 5GAOn 5GANf 4YY3L 4X65Q 1UE6A 1Y1VH 3GTJH 4JI0Q 4WJ3M 4JI7L 5FRMA 3J81c 4KUDK 4ZGJB 2EIFA 1X6OA 4OO1G 5LJ3e 4EDUA 3RMQA 4PNOA 5GAN7 3OBWA 2NN6I 1XMQQ 2KBNA 2O4XB 5J26A 4A4FA 4JBJA 4F7UG 4M7DE 1N32L 1QZGA 1IBKQ 1FJGQ 2DAQA 5CQXA 3LGJA 2GVAA 5IP7G 5CCAA 3P8DA 2LQKA 1IBLL 3OBYA 1M90U 4LF8L 4LW1A 2E8GA 1N33L 3BDUA 1SRUA 4JRPA 1I5FA 4M78F 2PVGB 2VQFL 4DR6Q 3CAMA 3HKSA 4LF5Q 4Z02A 2AWNA 5GAOp 1HNWQ 3HKZG 4UPAA 4KBMB 4R55A 4C8QE 3RLFA 4MMLA 4L5RC 4RMOA 3UDCA 4R4TA 3OTOL 3H6ZA 3L2QA 1YHAA 1WJJA 3JSCA 2IVWA 3GPLA 2LTOA 5LMUL 5IWAQ 1D7QA 4A3MG 1CSQA 2JA6G 3OS0A 4GOPB 2RHYA 4L5SA 1LTLA 1XNRL 4N0AC 2A19A 4GS3A 3NEMA 1K3RA 3FKIG 3C94A 5CKDA 1SFOH 1P16A 5LJ3j 2F5KA 4DAMA 2YV5A 4O0AA 2WSFE 4DR6L 4A3BH 1O75A 4KT0E 1HR0W 5I21A 4QL5A 4R4IA 1VIEA 2F69A 4JUVA 1WCMH 4PMWA 3S1MH 5GAMd 3PF5A 5KE2A 2V8JA 3NELA 1AH9A 1G291 4C0DC 2UU9L 5GROA 3E9GA 1GKHA 4EX5A 1Q86U 1YJ9A 4LFBQ 1UE7A 1J5EQ 1BI3A 3BDLA 4N0AA 1FL0A 2EXDA 4A3BG 3H8ZA 2K5VA 1RI0A 4F7UB 3L2VA 4NL3A 3M9BA 4HJ8A 4M77D 4DR4Q 4GKJL 2LCLA 2KDSA 3LYIA 2YTVA 4KHPL 2RB6A 5GAN8 4LWCA 4LDUA 3U50C 4C3IH 3MEVA 1Y96A 1HNZL 3FP9A 4JI8L 4GKKL 2ZJRA 4AYBE 2UUCQ 5LJ5h 3OS5A 4DOWA 2FVUA 2D0OA 4JOIA 2WAQG 3I56T 3FHWA 2DIQA 1JJCB 2YHTA 2CWAA 4OX9Q 2Y4YA 1JJ2S 2ATWA 3TEHB 4M7DA 2RI2A 4X66L 2IX1A 4A3FG 4DV4L 1I81A 3GTQH 4X66Q 5H1SE 2E5LL 1VQCA 5GAOl 1CKOA 1MHNA 4DV3L 4YY3Q 3HPWA 3S2HH 4KI0A 1WI5A 3SGIA 4UY8C 4GLKA 2ZPEB 3DB3A 1VQGA 1XTDA 3OYYA 4C3JH 4PJOG 3HOWH 5ELOA 4IJHA 1KIXA 1DJ7B 4A3FH 3G4SA 1UEBA 4GOPC 4ATOA 3MXNB 3JCMe 3A5UA 3PF4A 3LW5E 4JI7Q 4C8QC 5C0XJ 2PUKB 2XHCA 4PZ6A 2OAUA 2OTLT 4DV6Q 4DPGA 3FRNA 2ALYB 3TREA 2E6NA 2AKWB 3LWHA 4ZTJA 1VQ9T 4QW2A 3JCMf 4B3SL 2ES2A 3PO3G 2L5QA 1XNQL 4IUQA 2K4YA 3A8MB 1U0LA 1X65A 3OYBA 4C92A 2UXBL 1X3FA 2DTIA 5GMKh 4C0GA 4ZGDB 3UDXA 1VQ7T 1GD7A 3CPFA 3HOXH 5GAN5 3M57A 5M9OA 3CF5A 5DY9A 2GFUA 4QQ6A 4YCVA 1PH5A 4KUIA 1OZ3A 2HD0A 3LGLA 3S1QH 1OXUA 3AEVA 1FWZA 1X3EA 4WJ4A 2AHJB 1KG1A 2JA5H 2WSCE 2VQEL 1G5VA 5FU6C 5JJIA 3KLWA 1Y7XA 1OI1A 3WVEB 4C8QF 4HIOA 4BE1A 2Y4XA 3WXMB 3DLLA 2CGHA 4JYAQ 1E7ZA 1HXDA 1SLJA 3LH0A 3RZOH 3HSBA 1OYXA 3SWNA 4JRIA 3AFPA 1M90C 4OB2B 3ZEHA 2LVMA 4VUBA 4DR2Q 1KL9A 1V9PA 3C4SA 3X25B 1V43A 3MEFA 4DR3L 1M1KU 4TVAB 4DV4Q 5GMKi 3CBMA 3OA6A 1Q82C 4HIMA 5M3MG 4PJOF 3ASKA 4JI5L 1A63A 3GTMH 1CKNA 2DIGA 3I7FA 2JA6H 3E9IA 4BBSH 2MI6A 3SFMA 4NS5A 2QDYB 3KUFA 1X55A 2R5MA 4MDWA 1BI2A 4K0KL 5HGQA 3VDYA 4NPSA 4P71A 2YLBA 1I6HH 5IN1A 3UT1A 4JDSA 5KH6A 2BUDA 4JI6L 4V2SA 3TS0A 4JI4Q 2E5QA 2DKGA 3KF6B 3OS1A 3M59A 2R7ZH 2NZOA 4DK6C 1TWFH 4MDXA 1E24A 3Q1JA 3EFRA 4HCZA 3I55T 3UDGA 4DR4L 4GKJQ 1V29B 2XGTA 2KENA 4DKAC 3TEEA 4YWLA 4CRIA 5GAN2 2YLCA 2DTOA 2RD1A 4M78D 4M75A 1VQKT 1NTGA 3CC7T 2VV5A 1AE2A 4BBRH 3CCMT 3S15H 4GKKQ 4MTNA 4J6YA 1NY4A 3QO3A 2RHSB 3P8BB 2JTFA 4A3IH 3J81j 2QEXT 3OYKA 5CQYA 3QHSA 1M4ZA 3RKYA 4J83A 3QJ6A 2LQ8A 3AQQA 3RLOA 2H5XA 3U4VA 3GTGH 2E1HA 1E1OA 2ZJPA 1VQNT 4LF6L 2CKKA 1IBLQ 1N33Q 1EYGA 2UUBL 2RA2A 4A3IG 3CD6T 3HOYH 4JI8Q 2M1HA 4KLKA 3KJPA 4B9XA 2F4VL 4IOAA 4PJOB 5CKHA 1WQ7A 1O9SA 2IX0A 1G6PA 3VUBA 4M7AE 3GTPH 5DLOA 4A3CH 2XDPA 3GDEA 5IP9H 4LUOA 1VQPA 4MMKA 5AJ3Q 2JA8H 3DKMA 2RHQB 2R7ZG 2BH8A 3ICEA 3W1BA 1U1TA 3V8KA 3OSSC 4FU6A 3PUYA 1NPRA 3J80i 2VW9A 2DXTA 1U5KA 1TWGH 1EWIA 4JYAL 2RM4A 5C44H 4EMHA 1IZ6A 2MWOA 1Y71A 2XDDA 1Y1WH 4BBSG 1PH2A 5JJKA 3CCUA 4C8QD 1XMQL 5ELNA 4C5HA 4C92E 1I3QH 3STBC 2RJDA 4DUYQ 4A93G 5KCOA 1JE5A 3OSVA 4YHHL 4DV5Q 4A4GA 4QY7A 2XKOC 3I2ZA 1VQJA 3G6EA 4L5GA 3AYHB 4JI6Q 2D62A 3PGGA 3ZJYC 3MCAB 3HRTA 4X65L 3CC4A 4OONA 3OMGA 4PZ8A 1XMOL 4JV5L 4A3JH 1N8RC 3KYHC 2P0QA 3I4NH 2HHHQ 2EJ9A 2LXKA 1W2BS 1VQ7A 3S24A 4GOPA 2UXBQ 4D6WA 4HJ7A 5A2QE 4BE2A 4Y7NH 3T1HQ 4DR7L 4LF7Q 4C0ZA 2KHIA 4A3GG 1XPUA 3G71T 1KC8C 3F8TA 3QYHB 2E65A 1WJRA 4M75G 3OB9A 1VQDA 4QGUA 1QVGA 4PLIA 2YU9H 2R7DA 4QQGA 3EIVA 2YTYA 3QSUA 2BH2A 1ASYA 1TWHH 1N32Q 1YJWT 2EQMA 3UPUA 2C35B 4X64Q 1EQQA 1YIJT 4OGCA 4AQYQ 5J3BA 3QIIA 4JV5Q 4LF4Q 3JCMV 1X3GA 3UE0A 2RK1A 3EAEA 3K7UC 4KHPQ 5GANj 1I50H 1EOVA 3DM3A 2R92H 3T1HL 3PUZA 3HOVG 1X9NA 2MO0A 5GMKj 3IRBA 5GANh 1EQRA 4LFCQ 3SB2A 2Q2UA 2WAQE 1VQ8A 5AJ3L 2NVQH 1RIPA 2NN6G 1Y14B 4DR3Q 5GMKe 4LFAQ 2VUBA 3FLGA 4HT9A 2ZTDA 3CCVT 2KCMA 1PH8A 1G3YA 2EQJA 4BXXG 3M7NA 1CKMA 1A62A 4PL6A 5LJ5e 5GANg 4NXML 3JCMQ 3CBPA 2B8AA 4M77E 1LUZA 4XTYA 2XTIA 4UP9A 2XICA 1YHQT 2H3JA 3S2DH 3PUXA 3SDZA 3OW2A 4JI2L 2B63H 5BR8L 4GN3B 3HOWG 4IURA 5FLXE 4BY1G 2K57A 4M7DG 3BU2A 3BZCA 1XPOA 2MMPA 1FX7A 1KC8U 2IT1A 2RHUA 3QDRB 4XK8E 2QEXA 1PSEA 3OY9A 4IUTA 3TS2A 1BVSA 2K2VA 5D6WA 5HY6A 5LMUQ 3QPHA 1W4SA 3CD6A 3CMAT 1NE8A 2KQWA 2VC8A 1P92A 2E2JH 5M5XH 1SSFA 3CC7A 1RL2A 3CCJT 2LDMA 1PH1A 5KE3A 2K5HA 3L1AA 4P75A 2V1CC 1BYMA 1J6QA 4O2DA 2DVEA 5GAMj 1QZHA 3J81i 2DUDA 4OB3B 2I2LA 3HOUH 1EFWA 4JJNK 5GMKl 1SROA 5GAMe