3ER0A

Crystal structure of the full length eif5a from saccharomyces cerevisiae
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
146
structure length
146
Chain Sequence
DAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 5A-2
publication title Crystal structure of the full length eIF5A from Saccharomyces cerevisiae
rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 14
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3er0A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3er0A02
2ZJQA 5DLQE 4HIKA 4A3MH 1X3EA 3G6EA 5M5WH 4DV7Q 5FLXE 2EXDA 2F3IA 2MFIA 2KVQG 2FXQA 2HIVA 4BY1G 4B3SQ 3HOUG 1AE2A 3RN2A 4GKKL 3CXCS 4DR1L 4GNXB 1M1KU 5LMNW 4OXPA 4KLKA 1X3FA 2DUDA 2CKKA 1AH9A 3HOYG 2WAQG 4H02A 3OTOQ 2JA6G 2IT1A 1PH7A 5IY0A 3H3VH 5GROA 2Q2UA 2V1CC 1WYDA 3GTKH 3G71T 3T1YL 4BA1I 2A8VA 2GVAA 5LL6S 4DV3L 3S16H 4IOAA 5C0XJ 1L0WA 1FL0A 1H95A 2L15A 1D8LA 1PH5A 1CSQA 1KL9A 1JMCA 1I6HH 4OONA 2QEXA 2E2HH 4A3BH 4X6AH 1YJNA 1IBKQ 1VQ5A 4K0KL 3CCLA 1Y1VG 4A3CH 2R7FA 1HNWL 1YITA 3A5ZB 3AFQA 5IP9G 3PO2G 3CCST 1VQFA 4TVAB 1VQOA 3W1BA 1VQAA 3CCQT 3DB4A 2VZAA 1VQCA 3CW2C 2YYZA 5C3EH 4DR4Q 3J81j 4MNOA 2VQEQ 2LVMA 4C3IH 4HJ8A 1PH9A 3HKSA 3CCUT 3L2PA 4A3FH 2KHIA 2DO3A 2YTXA 3KDFB 1CKNA 1I50H 1IBMQ 2AHOB 1BKBA 1KIXA 1QVFA 4DR2Q 2BH2A 4GS3A 1EIFA 2Y0SE 3GTMH 1X55A 5C44G 4OWWB 2AKWB 4DUYL 4OX9L 4X65L 2B63H 4WJ4A 1HR0Q 1WFQA 1IXRA 1YJWT 3K8AA 3CCVA 2YTYA 2ZJPA 4JYAQ 3LGLA 3CMET 4Y7NH 1KD1U 3F2DA 1TWCH 1G291 5BR8Q 4B3RQ 1C0AA 4JOIC 3H3VI 3BZCA 1PH1A 1KXLA 1VQKT 5C4XH 1OXVA 3RLNA 1IBLQ 5K36G 2HHHL 3ERSX 4GNXC 3G48A 4QL5A 2MNAA 3NENA 3HOWH 2D0OA 2OQKA 4YWLA 4A3CG 4LUZA 1YNXA 2GVBA 5FLMG 1A63A 3Q8DA 4HJ5A 4YWMA 4JI3Q 2K50A 3T1HQ 1TXYA 4B3TL 1YIJA 3CPWA 5FJ8G 2PQAA 3IRBA 2VUMH 1M90C 1Y14B 2UXDQ 1E1TA 1HR0W 3K7UC 4JBWA 4A3FG 1J5EQ 3OTOL 4GLXA 3PF4A 1M1KC 1YHAA 2WB1E 4C2MH 4POFA 4JCVE 1K3RA 2JA8G 2AWNA 1I94Q 3CCRA 5IP7G 5M5YH 4A76A 5IWAQ 4LFCQ 1S40A 3CC2T 3M7NA 4IPHA 1VQ8T 1CKOA 1MJCA 1IBKL 4LF8Q 2B63G 3B6YA 1PYBA 1W2BS 2PMZE 1GVPA 4FDBA 3TRZA 3PIPA 2N3SA 3M3YH 4A3GH 3HOVG 1FVIA 3G4ST 3H0GG 4DUZQ 1SROA 4R4TA 4JI1Q 2UUAQ 2IHFA 4UPAA 4DR4L 5C4XG 3U4VA 3CC4T 2ZM6Q 3K0XA 2JUFA 3KOJA 1SRUA 3JC66 4WJ3M 4ZN3A 3PUXA 3G71A 4CRIA 1EOVA 1Q7YU 3LGJA 2KCTA 1IBML 1YI2T 2N78A 1VQJA 4RG1A 3HOXG 1KQSS 2VQFQ 4DR2L 1QZGA 2GN5A 3OYYA 1PH2A 2E8GA 2ZTDA 1HH2P 2I5LX 4XIGS 5J3BA 2Z6KC 2A1AA 4DK3C 1VQEA 4A3JH 3TREA 1HR0L 5JJKA 1XTDA 4JYAL 1VQ7T 1VQLT 3CCSA 2NVQH 4NB3A 4A3LG 5FLXc 1IZ6A 4R1JA 3UDGA 4L5RC 1IL2A 1NZ9A 2OTJT 2JK8A 2VS1A 2JA9A 1PYSB 2Q2IA 4PZ8A 3W1GA 1VQ6A 2CFMA 4JI2L 1IBLL 4IOCA 2L3RA 1KD1C 1JJ2A 1DGSA 4RMFA 1OXSC 3CCUA 4YCUA 5ELNA 1PH4A 3I4NH 3I2ZA 5IYBH 2PI2E 3GTOH 2RCNA 3UE0A 4L5TA 4JI3L 3T1HL 3KF8B 1Q82U 2R7DA 3RLOA 1Y1WG 2XHCA 1G51A 1AE3A 1KRTA 1XPUA 4IJHA 4A3DH 4O2DA 2UUBQ 1ASZA 3FKIG 2F52A 1YJWA 1P8LA 5JEAJ 4JI4L 1WJJA 1QZHA 3CMEA 1J5EL 2OCEA 1FJGL 4JI7Q 4JV5L 1EUJA 2LXKA 4P73A 1VQGA 1N8RU 1I94L 1SMXA 1VQKA 3HOZH 4LFCL 5IYCG 2KHJA 1WI5A 3CC7T 3GTJH 2NN6G 3RZOH 2MQHA 4NXMQ 4A4IA 1EQRA 1S72A 4LF8L 3GTLH 4A3EH 1KC8U 2KCMA 1M90U 1MIUA 2BH8A 3KBGA 2NN6I 3UDXA 4B3TQ 1X3GA 4GKJQ 1G6PA 2E2JH 1PH6A 1XNQL 1NMFA 4DUZL 3E9IA 2UUAL 4OWTB 5E7NA 4JI1L 2UUCQ 2WFWA 3M9BA 3F2CA 3S1NH 3KYHC 3TS0A 2ZM6L 3I4NG 4IPDA 2R93H 2XGTA 1MJEA 3K80C 4AH6A 3S1QH 1X6OA 3I4MH 1HNZQ 4DV0Q 1VQMT 1NY4A 4GLVB 2K52A 2VQFL 2JA5G 4DV2Q 1XMOQ 4C3JH 1D7QA 1YHQT 3CC2A 1Q1BA 2AMCB 4JBJA 2K75A 2YU9H 5M3FH 3JAMi 1Q7YC 3A74A 2R6GA 4DV5Q 4UY8C 1XNRQ 1CSPA 3UDIA 2JOYA 2G3RA 4A93H 4QIWE 4GOPC 5H1SE 3J7AF 3M4PA 3G4SA 3KF6B 4NPSA 5JJLA 1PV4A 4BXXG 3PV0A 3S14H 3OW2S 2CWPA 2K14A 5GAHC 3CC4A 2MO0A 2JQOA 4JOIA 4YY3Q 3J80E 2OTLT 1HZ9A 1VQNT 1RIPA 2N49A 3A0JA 4POGA 4A3MG 2I0QA 2XTIA 3KJPA 4R4IA 3TS2A 1Q12A 1VQDA 4X64L 4GNXA 1IYJB 2KENA 3GO5A 2EIFA 1U5KA 3I4OA 4QY7A 2BA1A 4UP9A 3I7FA 1N33Q 1NBWA 4QGUA 1NPPA 4DAYB 3ER0A 2RHSB 5LMNL 4P75A 2VL6A 4YCVA 3S2DH 1LUZA 1Q82C 2R7ZH 4GN3B 4LWCA 1UE1A 1UWVA 4HIMA 1OTCA 1HJPA 2OTJA 1EIYB 2WAQE 1GKHA 2R92H 4A3BG 3AQQA 2RHQB 3ULLA 1YEZA 5JJIA 2QGQA 3CXCA 4NXML 4OWXB 1N8RC 4IJLA 2VNUD 3I56T 4GKJL 4DV7L 3UDFA 1QUQA 2UU9Q 2NZOA 1K9MU 1B8AA 5C3EG 1R9TH 2ASBA 3I55T 1A62A 2CQOA 3K81C 3S2HH 3PSIA 1KC8C 2UUCL 3LGFA 1KAWA 4DR3Q 4KHPQ 1Q1EA 1OXTA 1KHIA 2B3GA 3E0EA 3PO3H 4HJAA 2E6ZA 1T9HA 4GLAC 4JI6Q 4GN5A 3CCET 1HNZL 5GADC 4DV0L 4A3EG 3JAME 1OXUA 4DV2L 1XMOL 1L1OB 3CC7A 5GAEC 3M4OH 1TWFH 2KDSA 4HJ9A 4AYBG 2QA4T 2HIXA 1N36Q 1GD7A 4DR6Q 4DV5L 4BBRH 1XNRL 5DM7R 5A2QE 2Z6KA 4EX5A 2HQLA 2JE6I 4JI5Q 3PUWA 3EBEA 3U58A 1NE3A 4AQYQ 3J81E 1YJ9T 1K73C 3L7ZC 4LFAQ 2VQEL 4LF7Q 3K7AH 4EQ5A 1NJIU 1TWGH 3DB3A 2D62A 4YY3L 3HOWG 1SE8A 2ZTCA 1X54A 3BJUA 4DV6Q 4QJFA 4JI8Q 1K8AU 1E1OA 1N32Q 1VQMA 4MTNA 4BBSH 4O0AA 1WCMH 4HIOA 3W5OA 3HKZG 2IY5B 3AYHB 1YHQA 4X66Q 5IT9E 1N33L 2VUMG 3ICEA 4DV1Q 1YBYA 2QEXT 1YJNT 1K8GA 3PO3G 4X34A 1V43A 4DK6C 4LF9Q 1V9PA 1E3PA 3SGIA 2A19A 3S17H 4X62Q 3GTPH 4PZ7A 5HGQA 3CCQA 5BR8L 3J7ZC 1YZ6A 3PGZA 4A75A 4B3RL 2BA0A 4RG2A 3TEHB 2YV5A 2LCLA 2OTLA 1VQNA 5IAYA 1XMQQ 4BBRG 3D31A 1VQ9T 5M5XH 5IYDH 3T1YQ 3CD6T 4A3GG 3J80i 1BBWA 1Q46A 4BY7H 1MKHA 2ALYB 2IX0A 4AYBE 2UU9L 3MEFA 1QVGS 4ALPA 2UXDL 4DR3L 1O7IA 2JA7H 1TWAH 1L1OC 1BBUA 1K9MC 1XNIA 3KFUA 4JI0Q 4PMWA 2UXBQ 4DNIA 4A3IG 2ID0A 3MXNB 3HOUH 4BY1H 4YHHQ 1W2BA 1E24A 1VS0A 2MO1A 3H15A 1UEBA 5IWAL 1LTLA 3F2BA 4LF4Q 1E7ZA 1C9OA 1TWHH 1EQQA 1XJVA 3S1MH 3HOYH 3U50C 4IO9A 4A3JG 1SFOH 1N36L 1HZBA 3J80c 2JA6H 4DR6L 3I56A 4JV5Q 2JJQA 3HFZB 3J7A5 4YTLA 1YIJT 5LMUQ 4DPGA 4JI5L 3I55A 4GOPA 2IG0A 2ZTEA 3BZKA 4AQYL 4DUYQ 4X65Q 1HNXQ 4LF7L 1KQSA 3PUYA 4LFAL 4JC0A 1YVCA 1QVCA 1CKMA 1Y1VH 3CF5A 1VCIA 4DV6L 5IP9H 3F1ZA 3TQYA 3CCEA 5M3MH 5IYBG 4HIDA 2E5LQ 3PO2H 3UE1A 1N32L 2Z0SA 4BY7G 3S24A 1NJIC 3KJOA 1SN8A 4X66L 1SLJA 4LF5Q 3CMAT 1SSFA 3CCMT 1Q81C 1VQ8A 1K8AC 2QA4A 1E22A 2JEBI 3FHWA 2K4KA 2Y0SG 4P71A 4APVA 4JBMA 1PH8A 4LF9L 1K73U 1PVOA 2JVVA 1JJGA 2RF4A 4X62L 1CKNB 1EYGA 4L5QA 4GN4B 1X9NA 1WOCA 2CKZB 1YJ9A 3HOZG 1VQ4T 5C44H 1VQIA 1L2FA 3LH0A 1HZCA 1QVGA 3GDEA 2Q2HA 3CPWS 4LW1A 4ZN1A 3J81i 1GM5A 1YI2A 2JNGA 4YWKA 4KHZA 2OWOA 4MZ9A 2K5VA 4PZ6A 3RN5A 3PIOA 1I3QH 3JAMc 1LYLA 3BU2A 3E9HA 2B29A 3PUVA 2UUBL 4KI0A 2NVXH 2R93G 2H5XA 2LQ8A 1A0IA 1VQ7A 1VQLA 5M3MG 5FLMH 4JI0L 3I4MG 4JI7L 2F4VQ 2UXBL 3A5UA 1CUKA 4YHHL 2Q2TA 1N9WA 5FJ8H 2WB1G 1QUQB 1VQ6T 1KRSA 5M3FG 4LF4L 3J81c 2PQAB 3RZDH 3GTQH 4TVRA 3CP0A 4AIMA 2PNHA 1VQ9A 4A93G 3KF6A 1U0LA 3KLWA 4DV4Q 3CD6A 4GOPB 4HJ7A 1XMQL 1NPRA 1N34Q 1FGUA 1W3SA 2JA8H 4Y52H 2K5HA 3DLLA 5IP7H 3RR5A 5LMUL 3NBHB 2OQ0A 3L0OA 2E70A 1PFSA 5IT9c 2CCZA 1K0RA 4NXNQ 2D0PA 1J6QA 3KDFA 1HNXL 1I5FA 2ES2A 2CWAA 2N8NA 1VQPT 3HOVH 3CAMA 1BVSA 3NEMA 5IE8A 3H0GH 5JEAG 4A3KH 5EAYA 2E5LL 4DAMA 4IPCA 3CQZH 1RL2A 3PCOB 4JI2Q 4IFDG 3CCJT 2UXCQ 1EWIA 4LF5L 1Z9FA 4C3HH 2E2IH 4OO1G 1S72T 5ELOA 3OW2A 4QQBX 1SR3A 1EFWA 1JE5A 4IFDI 3FP9A 3GD7A 3G6ET 1Q8KA 5AJ3Q 2R7ZG 1HZAA 3ULPA 1XPOA 4OO1I 3HOXH 3RNUA 4TQUS 1JJ2S 4BA2I 1X65A 4B3MQ 2R92G 3F8TA 4LF6Q 3WWVA 2VY3A 4JI4Q 3CPFA 1JB7A 1LM0A 3RLFA 4R4CA 1Q81U 1V1QA 1FJGQ 1Q86U 1VQHA 4DR7Q 4QQDA 4LFBQ 4A3LH 3AEVA 4JBKA 4DR5Q 4P72A 1UE6A 3D0FA 1UE5A 3CMAA 3CCMA 2I5HA 5C0XG 4A3IH 3M85A 1VQ5T 2C35B 4B3SL 3CCLT 2ATWA 1UE7A 2NZHA 1ASYA 3EIVA 3STBD 2WP8J 5HY6A 4XTCS 1YITT 5C0XI 1A8VA 3PF5A 2MWOA 1XNQQ 4GKKQ 4A3KG 1VQOT 1L1OA 4DR1Q 2F4VL 3EN2A 1X56A 2IHEA 1Y1WH 3S15H 1YHBA 1VQ4A 1B70B 2LXJA 1PH3A 2DGYA 3U4ZA 3FKIH 4DKAC 2YTVA 4UP7A 2IX1A 2MI6A 4P74A 3AFPA 4DV4L 3M4QA 4DV3Q 3VDYA 1N34L 5GQOA 3STBC 2HT1A 1PHJA 1PA6A 5IYCH 4UP8A 4R4QA 4K0KQ 1B7YB 2KBNA 3NELA 1NTGA 4IPGA 4LUVA 5GAGC 4NXNL 1S3OA 4KHPL 1HNWQ 3CCVT 2AWOA 4BBSG 4JI6L 3PUZA 1WCMG 2NVTH 1OXXK 2K5NA 2NVYH 3S1RH 2UXCL 2VW9A 1C7YA 1M1GA 3HKZE 3GTGH 4X64Q 5AJ3L 1XPRA 2LSSA 2MWPA 5C4JH 4J15A 4ME3A 3DM3A 2JA5H 5J26A 2I5MX 2ZJRA 4L5SA 4PG3A 4B3ML 4OX9Q 5LMNQ 4LF6L 1JT8A 3ZJYC 2PI2A 1QVFS 1GO3E 2EQSA 2JEAI 5IYDG 4A3DG 1VQPA 4JI8L 4DR7L 1JJCB 1P16A 4LNQA 4IFDJ 4LFBL 3CCRT 1Z47A 4BXXH 4DR5L 4R4OA 4YCWA 3ULJA 3CCJA 1VQBA 3P8BB 2HHHQ 4DV1L 4JG2A 1K83H 1Q86C 2JA7G 4LUOA 1NMGA
chains in the Genus database with same CATH superfamily
4HIKA 2J05A 2OXPA 4O42A 2PW5A 5CGKA 2DM1A 2RDHA 2FXQA 3EG9A 1CTMA 1XYIA 2EY6A 4KY5A 1M1KU 5GAOm 2JXMB 4M75G 4K8JA 1BI3A 1FD7D 1AH9A 2E3HA 3A55A 3H3VH 3NQTA 2Q2UA 4PKCC 1UGPB 4VUBA 1WYDA 3RD4A 4BA1I 2D5DA 4PLIA 4IOAA 2WSEE 4HCSA 5C0XJ 4ULLA 1JMCA 3MP6A 2E2HH 2O31A 4IKFA 3Q0AA 1N6AA 4K0KL 1X2QA 2XDDA 1EFID 2AZVA 3A5ZB 1WJQA 1YITA 1LT5D 3AFQA 3O8VA 4II1A 4M7DG 1VQFA 5CV5A 3KUFA 1D1KA 3W1BA 4A4KA 1VQAA 4FT4A 3I4NB 3NPFA 4M1UB 3CW2C 3D4DA 3VS7A 2YYZA 1QWEA 4FCYA 1E2VA 3DMUA 2LVMA 4MNOA 2VQEQ 3GTOB 4DNRB 5E3FA 3CCUT 3DKMA 3L2PA 4XT3B 1CKNA 2LCCA 5KYXB 2AT1B 2AHOB 1BKBA 1WNLA 1QVFA 4HSPA 2M9UA 5CV9A 4DR2Q 1WTOA 1GCPA 1X55A 4DA4A 4N9PA 5C44G 1TKWB 2AKWB 4MIUA 4M7AB 2B63H 4H7BA 1WFQA 1LTSD 1U4MA 1MMNA 3CCVA 2YTYA 2ZJPA 3LGLA 3RZOB 3F2DA 1TWCH 1RF2D 2PVGB 3META 4B3RQ 3M0SA 1I1JA 3QZ5B 4K6DA 4A3EB 2ZPGB 1KXLA 1H9JA 5DEHA 5K36G 1OXVA 1B9NA 2KQWA 1BB9A 1HA5A 4OB2B 2QQSA 3K6OA 4GNXC 3NENA 4XXEA 2OQKA 2EFIA 4EQNA 1Y71A 5FLMG 2MHVA 4UDUC 4HJ5A 4KV6A 2Y90A 2K50A 4HMIA 2R93B 4MMLA 1JJ2P 5FJ8G 1TUDA 3GTKB 2NWGA 1E1TA 1HR0W 3W3AA 3PFSA 1VQMQ 3K7UC 2H1EA 2PO4A 1ZUUA 1YHQQ 1PD1A 1YHAA 2B2UA 4C2MH 4WCIA 2KT8A 1F9PA 2D6FA 2AWNA 4A76A 4MDXA 1KNAA 3CC2T 2E65A 4BE0A 2GFUA 2B63G 1CKOA 1OPLA 1JWMD 3BYTB 1LNXA 2PMZE 2ENBA 2EYOA 3MCAB 3PIPA 2N3SA 1EY9A 4A3GH 1WXTA 3SHWA 1SROA 4QUFA 1QP3A 2EE1A 4DR4L 1QP2A 4JRIA 3M4GA 2HDAA 3KOJA 3SWNB 1BCPF 6AT1B 4KY7A 5FU6C 1AZEA 3UA7A 2F0LA 3LGJA 4CRIA 3OS0A 3PUXA 1IBML 2KCTA 5HK3A 2FB7A 1YI2T 2N78A 1UTIA 1PKSA 2TSSA 1PH2A 2G5DA 2ZTDA 1EZ8A 2R7ZB 2GTJA 4ZNXA 3CMEQ 2EY1A 4BY6C 2ZPFB 2Z6KC 4XIGS 1X01A 4E6IA 4O6JA 2DIGA 5DM73 2R92B 1XTDA 4M77A 1ZHIA 1VQ7T 4NW2A 4PFOA 2SEBD 1X3PA 5GAOp 5FLXc 2YRDA 4L5RC 4N4HA 4CGYB 1M30A 3A8HB 5IH2A 2JA9A 4LAAA 1VQ6A 1YN8A 3BE3A 2EYMA 2L3RA 2L3PA 5GANg 3M7NA 4RMFA 3I4NH 3TDQA 1VIEA 1YWPA 1Q95G 3OYJA 3H94A 4RAUC 5C5MA 5IGCA 1ZUKA 3GTOH 4JI3L 3T1HL 1LTBD 2RH2A 2FRWA 1G51A 3PVQA 3E3XA 1H9KA 2K5QA 2KRSA 2V4DA 3OHXC 3V05A 4OMPA 1X2KA 1VOMA 4QVCA 2L1BA 1YJWA 1F2YA 2WKDA 2MP1A 4G57A 4MDWA 1GUWA 1ZKOA 1YP5A 1TVXA 1TWFB 3UATA 2OCEA 4DN4M 1EUJA 1FJGL 3M4OB 3PGGA 1Q81R 1SMXA 1PTOB 1VQKA 1SNQA 4LFCL 5IYCG 1KLGD 3RZOH 1D0YA 1STHA 3M3YB 1GUSA 1WA7A 4Y91A 4ELZC 7AT1B 3N5BB 1S72A 4LF8L 3G4SQ 4BE1A 4A3EH 4EPCA 2EBPA 3H9NA 1EY4A 2FO0A 2NN6I 4GKJQ 3NPPA 2E2JH 1TWGB 1PH6A 2QK0A 4OMNA 1U4RA 4BDZA 4DUZL 1HHVA 4IZ8A 2UUAL 4GBQA 3CXCP 4OWTB 5KE3A 1E6GA 2EGCA 4K14A 5E7NA 4JI1L 4Y92A 5C4ZA 3I4NG 4IPDA 2R93H 5DM63 1QWYA 1TS5A 4RTVA 4DK0A 4IALA 3TVTA 3BVGA 1TU0B 3HTRA 5CVIA 3HEJA 3MVVA 1VQMT 1NY4A 5EKIA 1PZKD 1MMDA 3ND9A 1S5DD 4DV2Q 1XMOQ 1D7QA 1YHQT 1QW1A 1AZQA 2K75A 4MN3A 1NLPC 2A69D 2B8AA 1Q7YC 1LV9A 5KNBA 1KAAA 4IUUA 4HCBA 1CSPA 2G3RA 1IHZA 2CH4W 1VUBA 3SXHA 3M4PA 2DAQA 4F7UF 3RBBB 4M7AG 1WTXA 3PV0A 5M5XB 3OW2S 2CWPA 4XTWA 1CZGA 1JXMA 3P7JA 2FMCA 1HZ9A 2QQ9A 2N49A 4Y28E 1VQNT 1GXDC 3U9SA 4BY7B 2K7AA 3RMQA 1OO9B 3KJPA 3C3LA 3TS2A 1G3YA 2LP5A 1Q12A 4X64L 2B2YC 4JZ3A 5COYA 2EIFA 3UA6A 1TY2A 4DA2A 5KCHA 3M0PA 1NBWA 1EEFD 4IFDH 4DAYB 3OYDA 2A6HC 2RHSB 3S2DH 4YCVA 1PC0A 3R3OA 3D4RA 4FF4A 3F2UA 1VF5C 1RAIB 3AB9A 4PMCA 5TSSA 3H91A 1TWHB 2E64A 4GN3B 4LWCA 1G83A 3SVMA 4ZRZA 1G91A 3CRKC 5ELBA 1GKHA 4FXGC 2R92H 2J7IA 3AQQA 4OWXB 2L3SA 5E1FA 1LTRD 1N8RC 4IJLA 2EYYA 3UF4A 3UDFA 2YLBA 2UU9Q 2QDLA 1Y1VB 2NTTA 3HFNA 3I55T 1NM7A 2B2VA 3K81C 1KC8C 3LGFA 4C3IG 5C0XH 2J6KA 1M1KR 4KHPQ 1KHIA 2B3GA 1ET6A 2DLPA 3MPUB 4HJAA 2YU9B 2RJFA 4GLAC 4JI6Q 3X20B 2KR3A 3J7YW 5GADC 1KNEA 4WFN3 1RLPC 1A3VA 1F2LA 2XU8A 1TWFH 2F0KA 4LMQD 2PMZB 4AYBG 5GAEC 1N36Q 3M4OH 4DV5L 2CSIA 1W2BP 2HL5C 5DM7R 1PTOH 3Q6SA 1XNRL 4CKBA 5F2DA 4FYDA 1D5MC 2BZXA 1GJXA 1XQHA 2AKKA 3Q1JA 3L7ZC 4K5WA 3K7AH 3VU3C 1NJIU 1TWGH 4I7ZC 2M1HA 4QW2A 3BJUA 4DV6Q 2VVKA 2WSFE 1E1OA 1OX8A 4MTNA 3JCMc 3EFXD 1PMRA 4M77E 3AYHB 4X66Q 2D9UA 5IT9E 2VUMG 2C5CA 3ICEA 1UGSB 1YBYA 1EY6A 1RUWA 1YJNT 2E5KA 1EZ6A 4OP0A 4XQQA 2LDMA 4X34A 4DK6C 4LF9Q 2YUNA 1SYFA 1V9PA 1E3PA 3SGIA 2A19A 1R4QB 4HCEA 1F9RA 3VYUA 2IX3A 3A8OB 5KCOA 2EDGA 5BR8L 2RQTA 4OVAA 4JVZA 2BA0A 5EBDA 2K3XA 2DA9A 5D7UA 1XMQQ 3FDRA 4OMLA 4XU2A 2BE9B 3TN2A 5M5XH 1EX4A 3SR1A 3J80i 2GGRA 4BY7H 4N8FA 5I11A 2YT6A 1DJRD 1SDFA 2KQ3A 1QVGS 3HOVB 1UG1A 3EH1A 3M55A 2F0TA 5KYWA 2F2WA 4DR3L 5JPMC 2O4XB 1XNIA 1ICFB 3KFUA 2LC4A 2R93G 1SXTA 1BXTA 5IGGA 2ID0A 3M0RA 1V1CA 1E24A 4C5IA 2F2XA 4BI4A 4C8QF 3EG9B 2MO1A 2Q8IB 2HDMA 3L3OC 3H15A 4KKSA 1WTHA 4NDXA 4PV1C 1TWHH 2DEUA 3SB2A 2BDNA 1AWOA 2FFKB 4IO9A 1CM9A 4A3JG 2L11A 1HZBA 4JV5Q 2JJQA 2ICIA 3HFZB 1O9SA 4KGVB 1PCXA 5KYUB 5KYYA 1SPKA 2HBWA 2QAZA 1G3WA 4LFAL 1R8OB 3C1FA 1YVCA 4JC0A 5A0DA 1CKMA 1Y1VH 3S9WA 3M0UA 1VA7A 3LW5E 4C92A 4HIDA 2E5LQ 2RF0A 3CCEA 4A3IB 3KLSA 4E6RA 3UE1A 5EBCA 2Z0SA 5D6YA 4BY7G 2EYFA 4WTOB 3S24A 3KJOA 1JR0D 1YITQ 1SSFA 3CCMT 1LT3D 4FIBA 1K8AC 2JEBI 3FHWA 5CIUA 2GCXA 3EG1A 3SEBA 2DJZA 1Y1WB 3OPOA 1MV3A 3OYHA 1CKNB 4KRTA 1X9NA 2K3YA 4M78F 1QG7A 5CR2A 2FMMA 4A4GA 2QCPX 3S1MB 1SJHD 1V1PB 2CH4A 3M7GA 1MV0B 2OEOA 1TU2B 4XTYA 1L2FA 4LW1A 1QVGA 2E4HA 3I35A 2A69C 2Q2HA 3GDEA 4R56A 2QASA 1YI2A 1RACB 1PM3A 1R0CB 2JNGA 4YWKA 2M00A 3EH2A 5CCAA 4MZ9A 4PZ6A 3RN5A 2L3QA 3PIOA 1A2UA 3NTHA 3BU2A 2BE5C 1STGA 2K05A 3H0HA 3PUVA 2K2VA 2UUBL 2EYWA 4KI0A 4RGTA 5LJ3e 2LQ8A 1VQ7A 1A0IA 5JOBA 4JI7L 2F4VQ 4L63B 2CZ0B 3HOYB 2IWHA 3A5UA 5IIFA 2Q2TA 3FEOA 4LF4L 2LZ6B 3JV3A 3REAB 1A0NB 4TVRA 3CP0A 5GAMg 3GV6A 4C1NK 4XQJA 3VYGA 1VQ9A 2K57A 2EXZA 3KLWA 1N34Q 5L23A 4HJ7A 1VYTA 1FGUA 1TUGB 3RMHA 5GANj 3RR5A 5LMUL 3NBHB 2AKLA 4Q5WA 1BIBA 4CHTB 2E70A 4PJJA 3C95A 2D0PA 1G5VA 5HCKA 5KYXA 1BCPC 1SNCA 3VS0A 3FMCA 5FKAC 3HOVH 3CMAQ 2EYLA 4JUVA 3NEMA 1Y0MA 3H41A 2KOLA 4A3MB 1I4HA 1EY0A 3NE5B 3PCOB 3L2UA 2JTEA 1EWIA 1SYCA 2YWWA 1VYUA 2EJGC 2KEEA 4LF5L 2AK5A 5I21A 1SR3A 1EFWA 4IFDI 5GANf 4A53A 1MHWC 4A4EA 1U4PA 1VQ4Q 4OO1I 4J9CA 1JBMA 4ZGDB 1JJ2S 2EGEA 3H0FA 5GAN2 1QQJA 3HRSA 2L0AA 2JYOA 2VY3A 4LF6Q 2GNCA 4PJLA 2KT1A 1S5CD 3BDOA 2E5QA 1LM0A 1FJGQ 2CGHA 1V1QA 1IB8A 4LFBQ 4M77B 1IL8A 3EFSA 4JBKA 3I3CA 4P72A 2KEDA 1M8AA 1H3HA 3D0FA 2F0MA 4OGQC 2AQ2B 1E6HA 2RSNA 1D1AA 1WVLA 1B3QA 4A3IH 4C0DB 1UGVA 1I6VC 3FB9A 1F9QA 1ASYA 4B3SQ 5LJ5g 4XTCS 5IGFA 5I4DA 1YITT 5C0XI 1JORA 3ITPA 2WACA 1VQ6Q 4GKKQ 1L1OA 1WHGA 4DR1Q 2IHEA 3DEOA 3VR2A 1Y1WH 2QDBA 1FNUA 3MFGA 2VV5A 2Q8TA 4ZKBB 1B70B 3U4ZA 1RDPD 2YTVA 4DAVA 1RLQC 2O2OA 1ONLA 2QW7A 2IX1A 4J9HA 5K5PA 4DV4L 3M4QA 2FZGB 5D14A 1MMGA 1H9MA 2K3BA 1YJWQ 2ROLA 1PA6A 2DZCA 4UP8A 3P8DA 1HUNA 4LUVA 2FPDA 1FNWA 2O9SA 4JK1C 3PT9A 1S3OA 2DVEA 2EGAA 3CCVT 1PSEA 4M78D 3C12A 4BBSG 5CV4A 1BUVT 1HK9A 3JCMQ 4CDEC 1S72Q 3VV0A 1BIAA 5D6WA 3FC3A 1PZID 1PDQA 2UXCL 4GLKA 2VW9A 1C7YA 4V190 4E2FB 2A3LA 3TSSA 2E75C 1BNZA 2ECZA 4X64Q 2LSSA 5I2MA 2BTTA 2AUKA 2DXTA 2F69A 4C92E 5J26A 4X3TA 5A2QL 2I5MX 4J6XA 1S5FD 4OX9Q 2FEIA 3ZJYC 4FSSA 5M5YB 2PI2A 2DTIA 2K32A 2DBMA 1RADB 2B2TC 2P0QA 5I2YA 2JEAI 1IHWA 2XIWA 3EHRA 1NJIR 1VQPA 4Q5VA 2F0NA 2L8DA 5GMKj 9ATCB 1E2WA 1VQ5Q 2K01A 2FINB 3R2TA 4DR5L 3S3MA 1NR4A 1VQBA 3P8BB 3VR4A 5KNCA 4DV1L 5ELCA 4JG2A 1K83H 4FYXB 4Y52H 3NP8A 2ZJQA 3QB3A 1CKAA 4KH0B 3U9OA 2K5WA 4A3MH 2V8JA 3G6EA 4ILWA 1ZXTA 3MKDA 5DY9A 5GAN6 2KVQG 1HFGA 2EXDA 2MFIA 4RGOS 5IHIA 1GXIE 5FW9A 1AE2A 4MZMA 2MCNA 3CXCS 2XRSD 1PRMC 2DPPB 3GLXA 3BVMA 2VYTA 2JTMA 1X3FA 2DUDA 2N55A 2NTSA 3A56A 3HOYG 2IPOB 4DQ2A 2YUQA 5CK9A 1BI0A 2IT1A 2MJ8A 1BI2A 4C0ZA 3L2VA 3OTOQ 1PH7A 2JA6G 2V1CC 1W6XA 1IGUA 2VB2X 5C3XA 2GVAA 1TT2A 5C5LA 2A8VA 1H95A 2L15A 1CSQA 1KL9A 3BDCA 1SE4A 4LDUA 4L6TB 1YJNA 4PJOG 2H3JA 3U23A 4BB7A 1GUNA 2B8FA 3CCLA 2PZUA 3LWUA 2RQUA 4HVVA 1KJWA 2RHZA 4DXGA 3GTGB 1EU3A 1MHNA 2LCSA 1VQOA 1BO0A 4RTZA 3QO2A 3DWQA 3PMIA 1DM0B 5CR3A 3M58A 3CCQT 1N27A 4N0AC 2VZAA 2XSCA 3OYEA 5T1GA 3J81j 1TUCA 2B8GA 3F70A 1ACMB 2RB6A 2XK0A 5FO9B 4OB3B 2JA5B 1JB0E 3VS5A 1JE4A 2KHIA 4ZUJA 3RKWA 2YTXA 4A3DB 5FK9C 1AZPA 3BG3A 1I4XA 2BKDN 5C3WA 2BH2A 4GS3A 2Y0SE 3G6JB 4KD4A 3GTMH 3TSWA 4U673 1GCQA 1WGSA 1VF7A 2D8HA 2P84A 1MSHA 3NUCA 1PRTF 1IXRA 1ZA2B 1QKXA 1YJWT 1TS2A 2KHSA 3K8AA 1STNA 1D1BA 1HTLD 2A74C 3GTJB 3CKIB 1FR3A 5BR8Q 3QSUA 4DAYA 3BZCA 4EQOA 1VQKT 1IBLQ 4EMKC 4IQZA 2ED1A 3ERQA 4M77G 3RNJA 1L0YB 3G48A 2MNAA 2D0OA 4LUZA 2O88A 1XJWB 1YNXA 3REBB 2GVBA 3Q8DA 3S1NB 4LUEA 5T1IA 3QYHB 3CPWA 4H44C 4K5VA 1PRLC 1M90C 3QG1A 1II3A 1Y14B 4J83A 2CP7A 2QILA 2RVLA 1MD2D 4JBWA 1TXQA 4GLXA 2WB1B 1HNWL 5GAN4 4BWGB 4X9CA 3PF4A 3J80L 1M1KC 1KDAA 1UUPA 3T13A 2JA8G 3CCRA 1QMCA 5M5YH 2DL7A 5CQYA 1IKMA 1S40A 2EAYA 1XWEA 1Q3LA 1ZEQX 1W2BS 5FO7B 3K5NA 3NWTA 1L0XB 1C48A 2HCIA 4C8QC 1HRJA 4KH1B 1AW7A 3P20A 5GANh 1SF9A 4KN7C 4BE2A 4HTHA 3K0XA 2AHJB 1K28A 4KJOA 2ZM6Q 3FVQA 2DJFC 1EY8A 1LPLA 2DRKA 2LJ0A 3QDFA 5CO7A 1WQWA 5CORA 3OMCA 1UHCA 2P4RA 4LN2A 4XT1B 3OYYA 5DNFA 1ZSZA 1CQVA 2B86A 1HH2P 1QVPA 3QWXX 2I46A 5GAMd 3JB9D 3PE0A 3TREA 4BDYA 4JYAL 2OF1A 4NB3A 4R1JA 3UDGA 4LDXA 1NZ9A 2DNUA 1PYSB 2HCKA 2E6NA 2Q2IA 4PZ8A 2YSQA 4E7HA 3VYHB 1PXUA 5KYYB 3W1GA 3NMZC 4IOCA 4JI2L 3GTGH 1OXSC 1R9TB 4HVUA 1M2VB 3I2ZA 4I7AA 5JVG3 4D8DA 3TP7A 4RTUA 2A28A 2DZ9A 5IYBH 2PI2E 1W1FA 2F0JA 1Q82U 3RLOA 2A7YA 4M75F 5GAMj 1OU9A 1ZLMA 1O7YA 4C5HA 2M9VA 1KRTA 5BN3A 3L42A 4A3DH 2UUBQ 3ZEHA 3FKIG 2DEQA 3OY9A 1I4GA 4K11A 1J5EL 2JM9A 1B53A 4JI7Q 2COZA 3X3NA 2FRYA 1VQGA 4BBRB 1I94L 5GJWB 1B2TA 5E4WC 1B34A 1WD1A 3GTJH 4G7OC 2NN6G 4HVWA 2MQHA 2LQNA 1NEBA 1EQRA 2NLUA 1JQYD 1M90U 4M7DF 4J7FA 4ZKCB 1MMAA 5GAMf 1G6PA 4RTTA 1XNQL 3JCMg 2UUCQ 1PRTD 3F2CA 3M9BA 3S1NH 1Y96B 1JB3A 3I70A 3KYHC 3QOLA 1WCMB 2F0OA 1YI2Q 2R57A 4FYYB 5LJ5d 4AH6A 2LS01 1Y8NB 1DOKA 5KYUA 1RKNA 3K5LA 4GLVB 2R58A 2VQFL 2JA5G 1F1BB 3S17B 2H4OA 2AMCB 5I22A 2RO0A 2RJEA 1VQ7Q 3TP6A 4OIKA 5J22A 1WHMA 1XOVA 2SRCA 4J8OA 1STEA 1FYNA 3TP8A 4QIWE 4GOPC 3J7AF 5JJLA 2A6HD 4BXXG 2XI9A 2IIMA 3CC4A 2H3EB 5LJ5j 5ELFA 3WXMB 2JQOA 1M1FA 3J80E 1MI2A 4J9EA 3A0JA 4POGA 2EYZA 4IIOA 2ED0A 2MIOA 2HQHA 4F16A 2ZPIB 1SNMA 2GTOA 4GNXA 2KENA 2Y0SB 4QY7A 1V1PA 3DM1A 5GMKh 5E4XA 1NPPA 4BY1B 2ZPHB 2EVBA 2MOXA 5CV7A 4P75A 3NFCA 3VJPA 3FDTA 1G2SA 3VA5A 1SSHA 3UPUA 2LKVA 8ATCB 2HQEA 3E0JA 2CT3A 1EQVA 1UE1A 1UWVA 2G9DA 5LJ5f 2WAQB 3I90A 2OTJA 3R2IA 4S3SA 5CKHA 2CUBA 2E2JB 1YEZA 5CKFA 2QGQA 4NXML 2VNUD 2K6AA 2E12A 2D2CC 1V1OA 2E3IA 2CP0A 2R61A 5GAOl 2YXYA 4QQGA 1K9MU 2NZOA 2QYZA 1R9TH 3PO2B 4XQ3A 3C0CA 1AWJA 1E2ZA 3RKXA 3E0EA 4L5GA 3WOFA 3HRUA 3CCET 1F2MA 3NBHA 1HNZL 1U06A 4DV0L 5LJ3g 3MP1A 3JAME 4RKBA 1W4SA 1OXUA 1L1OB 1KLUD 2VC8A 1QCNA 1SHGA 4DR6Q 4BBRH 2ROTA 1B07A 2ICEC 2L12A 2Z6KA 4EX5A 3A8KE 5ELEA 3PUWA 1HA6A 1VQNQ 4J5YA 4JRKA 4AQYQ 4LK1C 2EQUA 2L89A 2K28A 2PVDB 2EQJA 4EQ5A 5GAOr 1KIKA 3DB3A 4YY3L 2I07B 1SE8A 2ZTCA 2MUYA 1TIID 4QJFA 4FW2A 2RQRA 3HRTA 1N32Q 4BS9A 3S2DB 1GFCA 4O0AA 1WCMH 2NVXB 1KQSP 3QKJA 4KGZB 1N33L 4DV1Q 1G6ZA 2QEXT 1UB4A 4M7DD 1OZ3A 5CV6A 4C92G 1K8GA 4WF2A 5IHNA 3JCMX 2CZ7B 3S17H 1HD3A 1QOHA 3A7LA 4HKEA 4F04B 4X62Q 1ZQ1A 4YIJA 1PFNA 3D6CA 3CCQA 1YZ6A 1M9SA 4PJOC 1SAPA 1JC7A 2YV5A 4P2CB 5KYLA 1WDXA 1AVZC 1ZBXA 2OTLA 3VKIA 4BBRG 4XTUA 3D31A 1VQ9T 4LD9K 1V8QA 4H13C 3I55Q 5IYDH 1EYCA 3MXUA 4ID6A 4A3GG 3EG3A 1Q46A 1D1IA 2EYPA 2IX0A 4QKUA 2O5IC 1E0BA 3H0GB 3CEYA 3KXTA 4A3KB 3NHHA 2UXDL 1M5Q1 3CQZB 2UXBQ 1D5XC 4JI0Q 4PMWA 4C3HB 3MXNB 3HOUH 4BY1H 2KE9A 3F2BA 5GMKi 3MA2B 3G6EQ 2NUZA 1A2TA 3HOXB 2JM8A 3S1MH 2X9HA 1CKBA 3I56A 1M8MA 3HZXA 3L1AA 4M7AF 3AT1B 2K33A 3K7AB 1ENCA 4WORA 2DTHA 5GAN7 4QB4A 3ZYYX 4XK8E 2AIRB 5KYNA 1AOJA 3BW1A 2A0FB 2DD4A 5J1ZA 3BZKA 4JI5L 4C5EA 1CZWA 4QT7A 1GL5A 4KGXB 4LF7L 1TS4A 3PUYA 1WIEA 5GMKm 2AUJD 2DXCA 2EOTA 5C4HA 1VCIA 5IP9H 3F1ZA 3V8LA 4IN3A 3TQYA 2EQMA 5KIXA 2PPBC 2E76C 3PO2H 2ABLA 1YJNQ 1TY0A 3X26B 2RDFA 1WHHA 3CCLQ 1NJIC 1CA5A 1HTPA 2B2YA 1RAAB 1H3ZA 4E7JA 1EWHA 4K5XA 1E22A 4JBMA 3HPWA 1K9AA 2K4KA 1VQOQ 3NHNA 3I5SA 1TS9A 1PRTC 3CBMA 2Y0SG 2ZXOA 4QIWB 3AMUA 4FT2A 5EQ0A 1JJGA 4K2KA 4DF7A 2M0OA 2HZYA 1NR2A 2EVRA 4EMKB 3ZBDA 1EYGA 2BE5D 2L55A 4ZAIA 3VYRA 4JJDA 1YJ9A 3D6WA 1VQIA 5GAMh 3OQ5A 2X35A 2RA4A 1EIGA 5LL6X 3LH0A 3J81i 4A3EG 1RAFB 3K5MA 4ZN1A 2D0QB 3OB9A 2K1BA 4JDSA 1C0MA 5FU7C 2JN4A 5A0GA 3H09A 4XTXA 2OWOA 3JRZA 1PZJD 4DAPA 3TCJA 1RAEB 1Q82R 1LYLA 2NZ1D 4RGNA 4OMMA 2B29A 3ONAB 1T5EA 2NVYB 4Z9CB 2NVXH 4OO1H 3EGXA 3QOJA 4KHVA 1ILQA 1JO8A 1X43A 4PL6A 2L5QA 3RR6A 1AEXA 4YHHL 1FX7A 1QUQB 1X32A 1BCPD 3MEAA 3KK7A 1AFPA 3CQTA 2JW4A 1B7TA 1H9SB 2CREA 4DEXA 4BUGA 3CD6A 1JOOA 1U0LA 3A8JE 4B3TL 4BD3A 1M90R 1QLYA 2K5HA 2HDLA 5IP7H 2QDYB 2OQ0A 1WXBA 5IT9c 4NXNQ 1HNXL 1J6QA 2X4WA 4JZ4A 4J8QA 2CWAA 1C4QA 2I2LA 2X6LA 1VQPT 3CAMA 3CCMQ 4A3KH 3H0GH 1D09B 1SG5A 3JCMd 3CQZH 1RL2A 3GF5A 4JI2Q 4IFDG 2LQKA 3ZL7C 3R93A 1Z9FA 4C3HH 4OO1G 2P0PA 1RI9A 3OW2A 4RCBA 5LJ5h 4E7KA 4HT9A 1JE5A 1EYAA 2OAUA 3FP9A 3G6ET 3GD7A 5AJ3Q 3M9QA 2R7ZG 2JMAA 3ULPA 1XPOA 2J0TD 3C2PA 3L9AX 1HXDA 4AFSC 4TQUS 3HOXH 3RNUA 2J06A 4B3MQ 2R92G 5I9PA 4DBFA 1I81A 1U4LA 3MC0B 1ZSZB 1PTOF 5I9OA 2JN0A 1I6HB 4A3BB 4M78B 4EMHA 2XNAC 4DGZA 4ANJA 4DR7Q 3GNGA 3HSBA 4FF2A 4A3LH 2RJCA 3LYIA 2M0YA 4M75C 2XDBA 3X24B 1GRIA 4UAIA 4LXCA 5C0XG 1K8OA 2C35B 1DCZA 2XVSA 3CCLT 5C3EB 2ATWA 1T3LA 3EIVA 4GY5A 2WP8J 2C9OA 4KMUC 1A8VA 2B2VC 1XNQQ 3EA6A 4NMZA 3WDNA 1E7OA 4OMQA 3M53A 1PWTA 1VQOT 5CKEA 3C1EA 3MXGA 2LT4A 4A3FB 3UDCA 1SBBB 3G7ZA 2VGNA 3EG0A 2DMOA 1JOKA 3FRNA 2LXJA 2DD5A 2EQIA 3JCMf 2DGYA 1IBKQ 5L8RE 4M7DC 4HSVA 3OWEB 1A6XA 4PNOA 4X3SA 3BVZA 3KLSX 2HT1A 4Y7NB 4NOYA 1K9MR 4BI3A 2KBNA 4IPGA 3NELA 1NTGA 5GAGC 1B34B 2LX9A 4K0KQ 1AZGB 1OX9A 1HNWQ 5C4XB 1NG2A 4HCCA 3JB9J 1IO6A 3O5ZA 4ZGEB 3OS2A 1EL0A 3K0YA 4NL3A 2RJDA 1VMCA 1GBRA 2K5NA 2HSEB 4Q0FA 2NVYH 1EY7A 4FU6A 1SYDA 3O13A 3T56B 3W2DA 2X3WD 3H3VC 2O9VA 2EJFC 5IXFA 1LT4D 3A8GB 1M1GA 1K1ZA 3VR6A 3N52A 2L9HA 2JP1A 1AN8A 3D7SB 5LJ3d 4ME3A 3OYCA 3TMEA 5LHY1 4L5SA 1M2VA 1EFNA 4G7ZC 2P0KA 1AHJB 1QJOA 1BQQT 3QZ9B 3BYYB 1BU1A 2P4TA 3CCRT 2RI2A 2HCCA 2PQEA 4KD3A 5G3LF 4RTWA 3ULJA 4HXJA 3MWYW 3FPUB 4IUPA 4RHSA 2PTKA 3EFOA 2VB3X 5LJ3j 1X3EA 1HPCA 4HEDA 4O5VA 4P5NA 2HIVA 4N8X1 5EPJA 2E74C 3T51B 4C1NI 3VUBA 3RN2A 4EGVA 1IREB 3BDLA 3NK9A 2O2LD 2DJQA 4GNXB 4KLKA 4PFPA 2CKKA 4CC3A 4AT1B 3HGBA 1WI7A 2EJ9A 4F8MA 5IY0A 1BCMA 3T1YL 4DV3L 1RTOA 1ZUYA 1Y96A 1FL0A 1ZYRC 2JSOA 1VMPA 1I6HH 4A54A 3CCVQ 2QEXA 4A3BH 2NVQB 4X6AH 1WTRA 1FWZA 1JXOA 3AHUA 1Y1VG 2F03A 1D5ZC 1DOLA 1H8KA 1D3BA 2HD0A 2G9HD 3QJYA 2CW0C 3M59A 1CI3M 1TR5A 4DR4Q 5C3EH 2WSCE 1A3UA 1VQCA 2CUDA 1Y8OB 2K5IA 4C92C 5D3DA 3MHBA 3HKSA 5HK0A 4A3FH 2DNCA 4OL7A 3GOXA 1IBMQ 1YNJC 3OWFA 2EJGA 1T0HA 4IUTA 2FJ2A 1KIXA 2F0HA 3MZ5A 1U9RA 4K8IA 1EIFA 3VS3A 4OEMB 1JEGA 1VDZA 5FU6B 2LX7A 2Q8RE 1UECA 5JAVA 2DNEA 2CSQA 3HOZB 2JXBA 1N9RA 4Y7NH 1KD1U 3OIPA 1HCZA 1K83B 2DRMA 4BY6B 4JOIC 2KYBA 3QWNA 1PH1A 4H0LC 1BYMA 4BACA 5C4XH 3RLNA 5CKBA 2HHHL 3C94A 4JJNK 1PD0A 3E1SA 2A08A 2LNHB 3H0IA 3HOWH 1A63A 2DY7A 4XYOA 2Z9HA 4YWMA 4JI3Q 5EGTA 2LQWA 3BZDB 3T1HQ 4JRPA 5HURA 3S1QB 1ESRA 1MGSA 2PQAA 3I4MB 3EG2A 2UXDQ 4RTYA 4TKOB 1H9RA 1GBQA 2NBFA 4NP5A 4A3FG 3OBYA 2F2VA 3QUIA 3M0TA 4C8QD 2WB1E 5M3FB 4JCVE 1K3RA 3EVQA 1F2ZA 4RWSC 3OYLA 2X3XD 3V96A 4ORZA 4LFCQ 1FYCA 4A93B 1M2OA 2K5FA 2K7VA 5IODA 3Q24A 1VQ8T 1MJCA 4LF8Q 4LDYA 1MBYA 1N9SA 1PYBA 3B6YA 4FDBA 1WD0A 2KSSA 3CCQQ 1K3BC 4JW0A 2DL4A 3HOVG 1FVIA 2HQXA 1CHPD 4DUZQ 3C46A 2OTLQ 5GANe 3JCMP 1ENAA 3A7AB 4KJNA 2YLCA 4JI1Q 4UPAA 2UUAQ 5C4XG 3IFDA 4XU3A 2QQAA 4GLMA 3CC4T 1RAHB 4CDCC 1KQ1A 4RKLA 3MAQA 1OOTA 2XWJB 2QXFA 3PVLA 3GTMB 4ZN3A 2F1LA 4WJ3M 5G3LD 3G71A 4M7AC 1EOVA 1VQJA 2O5JC 1KQSS 4DR2L 1SRMA 1SE2A 2VKNA 1X27A 2NYZD 2DFUA 2E8GA 1WHLA 2HMAA 2RQWA 3HL8A 4F7UA 4V0BA 3L2ZA 4R55A 1BI1A 5ELDA 2GBQA 4DK3C 1VQEA 4ZLTF 2RQXA 5JJKA 4JLIA 4WRDA 1VQKQ 3L2RA 1VQLT 4K2LA 3CCSA 2NVQH 4FF1A 1SE3A 2OTJT 2JK8A 2HSPA 2VS1A 1FMKA 2V8IA 2CFMA 4A3IG 1JJ2A 4YCUA 2R3ZA 5CV8A 5IGBA 3S2HB 2FZKB 5DAUA 3VA7A 2F3VA 3VS4A 2F0SA 2R7ZH 4M4ZA 3DUZA 4L5TA 4CJ2C 3JCMh 4DK1A 1QE6A 4B6MA 3GPLA 2R7DA 4OF1A 1Y1WG 1XPUA 3LWHA 2HNIA 2C0IA 3DLMA 2F5TX 4RHRA 2NB0A 1D1CA 4KN4C 4CI0C 1B44D 2KA7A 3J81L 1ASZA 5JEAJ 3SK6A 4XQNA 2A37A 1WJJA 3CMEA 2EYJA 4UHVA 3S3OA 2LXKA 4P73A 1MUZA 1UHFA 1O80A 2DBKA 2DTOA 3HOZH 4PJOF 1RI0A 4BI8B 4PNYA 3QR8A 3V8KA 4A4IA 1KFZA 1T0JA 3SHLA 3MXNA 2EW3A 4B3TQ 1HFNA 1ET9A 1MIUA 5CAIA 4J7IA 1QCBD 3UDXA 1PFMA 2R5MA 2FHTA 2X6GA 3T53B 1TSFA 3SWNC 2NUTA 3I73A 3UT1A 4X3KA 4XYQA 5KH6A 1RAGB 1G2TA 3OSSC 2PZWA 5GAN5 2KVMA 2SOBA 3M54A 4N0AA 1NLOC 2XGTA 1MJEA 2EJMA 1I8FA 4X9DA 4ZGJB 3EGDA 4ABNA 3S1QH 1X6OA 3A8MB 4RFBA 3I4MH 2VXEA 3EGXB 1WLPB 1LJOA 2DK3A 2AQ3B 2PVOB 3JB9H 5GAOq 5D65A 2BZYA 3LH5A 4FP5D 3GTPB 5M3FH 4HR7B 3A74A 1LABA 4DV5Q 3TU4K 1XNRQ 2DF6A 4PK4A 3UDIA 4A93H 2EYQA 4KKUA 5H1SE 3HG9A 4OB0B 3R8BA 3G4SA 4NPSA 4A63B 4ZTJA 1O7LA 1RABB 3ULRB 1SEBD 4M77F 3OYKA 1SMYD 5IGEA 1M4VA 2OTLT 3OYBA 2DETA 1RIPA 4A3MG 2I0QA 2XTIA 4EMKA 4R4IA 3X3MA 1I0CA 1VQDA 1UFFA 5GMKe 1IYJB 2JA7B 3GO5A 3I4OA 3FLGA 1U5KA 1W6JA 1PNJA 2BA1A 4UP9A 3I7FA 4RH6A 1OPKA 4QGUA 1U3OA 3FIFA 2NUPA 5BN4A 2VL6A 1PTOC 1C8CA 3L2QA 4J6WA 1Q82C 2HKNA 2OX7A 1ZA1B 1JWSD 1LTID 4E7IA 4N4IA 5BN5A 5EG2A 5IOCA 1CFMA 2PUOB 3JB9G 2Z1CA 1QNUA 2WAQE 4XU1A 3PTAA 2WIIB 1DXMA 1EY5A 1Y7XA 4FXKC 5JJIA 3CXCA 3IQLA 4QVDA 4A3KG 3I56T 1U5SA 1I4PA 2L5TA 4LUDA 2L2PA 4DV7L 4GKJL 1QUQA 1PYWD 1D0ZA 3TZDA 4R8IA 1B8AA 3S2HH 2ASBA 2CQOA 4DBRA 1A62A 2DYIA 3EROA 3PSIA 2QF7A 4M7DB 3BFMA 1G8ZD 1KAWA 4QVZA 5M3MB 4DR3Q 4C8QA 1H9SA 1OXTA 2QTXA 4ME7A 3MEHA 4C5GA 3VR3A 2DXUA 2YHTA 2HKQB 2F0QA 1T9HA 4QCLA 1GFDA 2SNSA 4DV2L 1HSQA 1XMOL 2XN9C 3CC7A 3RESA 2KDSA 4HJ9A 3PIO3 2HIXA 5IHKA 1LCKA 2SEMA 2LFNA 2EZVA 5A2QE 5C44B 2DYBA 2KROA 3HRZC 4MTKA 1T3SA 2LMJA 2RI5A 1NE3A 1WYXA 3V8JA 3MEVA 3J81E 1YJ9T 1IW7C 4ESRA 1SEMA 1K73C 1CT1D 1F77A 4LFAQ 4MMKA 1KSWA 1DONA 4FSXA 2K9GA 2CYZB 1X54A 1XXGA 4F7UE 2B2WC 1SNPA 2W0ZA 4PJOD 1BDOA 2J6FA 3S3NA 3I91A 2CHBD 1WFWA 4KUDK 4N9TA 3ZFJA 1KHCA 2AZSA 4M78A 5EKKA 3K5OA 2ZPBB 4PQXA 3C4SA 3GTPH 3GTQB 1FXXA 2EYXA 4PZ7A 5HGQA 1KD1R 3ASKA 3SE0A 3PGZA 3KLRA 4RG2A 2RD1A 3TEHB 2DJGC 2LCLA 4J6HA 2KRMA 5IAYA 2K2MA 2ZGWA 5AYFA 3T1YQ 3MXPA 1R77A 3CD6T 5JJZA 2EYHA 2BCOA 1EU4A 4AYBE 4HCZA 4EMGA 1J9OA 2ALYB 2UU9L 3KBXA 3MEFA 2MPMA 1CQFA 1K8MA 3CCEQ 2QGGA 3EJIA 2VWFA 1O7IA 1HUMA 2JA7H 3M57A 1K9MC 4MZPA 4DNIA 3EFOB 1W2BA 4M77D 1J3TA 1VS0A 2IW3A 1UEBA 5IWAL 4LF4Q 1C9OA 1B3AA 3PMTA 2LMCB 2DN8A 4FO2A 5KEEA 1N36L 4LNPA 2FZCB 3J80c 2PW7A 2OJ2A 3OIQA 3TZUA 3RKYA 1NNXA 2QI2A 4J9FA 4YTLA 5AT1B 3R6NA 1YIJT 3OA6A 3FPPA 5LMUQ 1B50A 4GOPA 2IG0A 2VUBA 1P92A 2GA4B 2EY5A 3VR5A 2EWNA 1QVCA 2G6FX 1KG1A 1M8VA 2FVUA 4DV6L 1QWFA 5IYBG 4FXDA 1ABQA 3JCMW 2QEXQ 3FEWX 5M3MH 1AP0A 5A35A 1D3BB 3IL8A 4CBVA 2C0TA 8AT1B 5GAOn 1EOTA 2RQVA 1BCPB 1SN8A 4OIJA 1SLJA 1RD9D 4X66L 5L37A 4LF5Q 4A3DG 1VQ8A 2QA4A 2L4NA 4APVA 3KUPA 2MAMA 1K73U 3IAYA 4LF9L 4PLLA 2JVVA 2C06A 1LTGD 1MNEA 1G2BA 2RF4A 3OS1A 1M3CA 2E2DC 3CU7A 4L5QA 4GN4B 2CKZB 5GAMe 1FGBD 5D3IB 1VQ9Q 5GJVB 2F0PA 5C44H 2FG0A 3EHQA 3VRZA 4IUVA 1XMQL 1GM5A 3UI2A 1GHJA 1OU8A 1HQRD 3QXEB 5JEAH 4KHZA 2K5VA 3NBIA 1YNNC 3JAMc 5K36H 2M16A 3HOUB 2NVTB 3VS1A 1CK1A 4N4GA 3S1RB 4Z88A 4V2SA 1SMYC 5FLMH 1OEBA 1VQLA 5M3MG 3I5RA 1CUKA 2CP3A 4KT0E 5FJ8H 2WB1G 2PQAB 5C4JB 3GTQH 3X28B 3QDRB 3JB9I 3RERA 3BDUA 2K04A 1C6VX 3KF6A 4JV5L 4DV4Q 1NPRA 4C8QE 3LWEA 1W3SA 3DLLA 4KUIA 4QQ6A 5FLXL 4Z02A 1TG0A 1PFSA 1FMWA 3A54A 1WJRA 1K0RA 2CCZA 3RIRA 2F1MA 2N8NA 4FNFA 1Q8IA 1UDLA 1X3QA 3WVDB 2E5LL 5IE8A 5JEAG 4WJ4A 1LOJA 2V8KA 2ZAEA 3OYMA 5EAYA 4DAMA 2RPNA 2F0WA 5M5WB 2MF2A 2UXCQ 4C92F 3V7CA 1ICWA 1M3AA 2PUKB 5LJ5e 2DERA 2F0EA 4EQPA 3I9QA 3E5SA 2ZXPA 3Q22A 4C0FA 4M75D 1HZAA 1LTTD 2MMPA 2XIDA 3OS5A 1D0XA 1X65A 2C0OA 3GP7A 1LVKA 3G71Q 3HFOA 3S16B 2RN8A 2KUMA 5ISRA 2A68C 3CPFA 1WXUA 4PJOA 4F7UB 2F3WA 1JB7A 2NWMA 3I4LA 4R4CA 1G3SA 1U1SA 1EWCA 1Q86U 1VQHA 3A1PA 4M78E 4QQDA 2VXFA 3CRLC 3AEVA 2E10A 3TBIB 4DR5Q 3INZA 1OV3A 1UJYA 2QTVA 4HT8A 2WKCA 1WTVA 3CMAA 1STAA 1NBEB 3CBOA 3OYFA 4FYVB 3RMSA 4CC2A 3CCSQ 1SJED 1MSGA 3PF5A 4C3IB 1VYVA 2CQAA 2JT4A 1HJDA 4RCOA 2GFAA 1H92A 1X75C 2F4VL 1X56A 5A0LA 1YWOA 1K76A 1I50B 1I5OB 4RTXA 4E47A 1VQ4A 1UNSA 2B2UC 4DEYA 1WPYA 4QMGA 4DKAC 4F17A 4JS5A 2MI6A 5KRUA 4P74A 1N34L 2QQBA 3Q23A 4AYBB 2BDOA 3EQLC 5GQOA 3STBC 1Z9QA 3S16H 4JLGA 2KJXA 1HQMC 4RA8A 5IYCH 4FF3A 1VQPQ 4PFZA 2QQRA 2LY7A 2XKOC 1Y69U 4FW1A 1KABA 2K4YA 1WCMG 3PUZA 2NVTH 1IHVA 1OXXK 3S1RH 2NUTB 4ZTFA 3QWYA 2KEAA 2KGTA 1I4K1 1DOMA 3MHXA 2VUMB 3HKZE 1ESFA 4LE9A 3P75A 1XPRA 2BZ8A 3EGDB 1U1TA 2Y4XA 1R4PB 5C4JH 2EKHA 1RJTA 4CDFC 3LNNA 4ODGA 3S6WA 5GAN8 4M77C 5CMDA 4LF6L 1JT8A 3LWIA 4G4KA 4ZUIA 5FWCA 2ZCFB 1EEID 1GHKA 2EQSA 2HUGA 2A6EC 5IYDG 5KYIA 4JI8L 4C0DC 1JJCB 1P16A 4LNQA 4LFBL 2K03A 4R4OA 4YCWA 3CCJA 1JOQA 4RUGA 5IT9L 1A15A 1NMGA 5DLQE 3I72A 1K4US 1ZYRD 5M5WH 2KY9A 5FLXE 4DV7Q 2F3IA 4B3SL 3RUZA 4BY1G 3HOUG 4GKKL 2ZPEB 2MPXC 1CHQD 4DR1L 4ATOA 3URGA 1D6EC 2OT2A 4OXPA 2E41A 5LMNW 2RDGA 4KKTA 1YNZA 1I07A 2WAQG 3P1HA 4H02A 2CW0D 2NUPB 2JMCA 2NYSA 5GROA 2IPKD 2V1RA 3GTKH 3CPWP 3G71T 3T4AC 2VB6A 4FM4B 2CP6A 2FL7A 5LL6S 3FJ5A 4C92D 3KFVA 1HXYD 1L0WA 4A3JB 1PH5A 1D8LA 4E7ZA 1KQ2A 2JZ2A 1S5BD 2PZTA 4OONA 4XDXA 2E1HA 4RGMA 1VQ5A 1YNJD 1DD2A 3BY7A 1LACA 2A36A 2VASA 2R7FA 4A3CH 3QIAA 1IYUA 5IP9G 1PHTA 3PO2G 3CCST 1O75A 2N88A 3OSOA 4TVAB 3DB4A 2CZ6B 1H641 3V2TA 1YCYA 1B4OA 4C3IH 5FO8B 1NYFA 1IGQA 4HJ8A 4J9IA 1PH9A 3AU7A 2DO3A 1J8IA 4C8QB 4PJNA 1LTAD 1I50H 3KDFB 2J6OA 4XAXB 1NAPA 4LJZC 4B9XA 2LJ3A 2D9TA 1X69A 1DYQA 4OWWB 4DUYL 4OX9L 5GMKl 4X65L 3SK5A 2EQKA 3CCRQ 2COWA 1Z7TA 4ZCKA 4JYAQ 5AFWA 3CMET 2PYKA 3CC7Q 4KULA 1G291 1C0AA 1I5LA 3LX0A 3H3VI 4AMCA 3GTLB 3QO3A 4F7UG 2ZXRA 5EPLA 1UAPA 3ERSX 5J39A 2RI3A 4M75A 4QL5A 3K59A 3OOCA 4YWLA 4A3CG 1OYXA 1TXYA 4RG8A 1YIJA 1K73R 4PJOE 1O78A 4EVOA 1RCVD 3A8IE 3GP8A 2IVWA 1TH7A 2JS2A 4OGCA 3TSZA 4A4HA 4AFQC 3IRBA 2VUMH 3SK8A 1VIFA 4C3JB 1J5EQ 3OTOL 2RMOA 2HAXA 4POFA 1PG5B 3IFTA 1I94Q 5IP7G 4M7DA 2R5AA 1RHPA 5IWAQ 3P8HA 2QKIC 1NCVA 3N6RA 4IPHA 4KY6A 4DBHA 1IBKL 3H8ZA 4M7AD 3TRZA 3S14B 1GVPA 1C1AA 1X6BA 2EKOA 4HN7A 3URYA 2RNAA 3OSVA 3QIIA 4J6YA 3THKA 5KE2A 2Z4IA 3M3YH 3H0GG 3G4ST 4DNTB 4R4TA 2CP5A 2LNVA 2D1XA 2K6DA 2IHFA 4IUQA 3U4VA 4X3UA 3TP5A 1WTQA 4QUCA 4C3HG 2JUFA 1KDCA 2QEJC 1EIHA 3E19A 5C6SA 2DL8A 1SRUA 3JC66 3TEEA 1WHKA 1Q7YU 2EJFA 2SNMA 2RHUA 1PFBA 3D4WA 1WJSA 4RG1A 2P5ZX 3HOXG 2VQFQ 4LDWA 1QZGA 2FPFA 2GN5A 4JJCA 3VYTA 2I5LX 4RCNA 2BUDA 3OYAA 5J3BA 2A1AA 1Q86C 1YFNA 4A3JH 2AQ1B 1HR0L 2M51A 2F0FA 2RKSA 4A3LG 1IZ6A 2F0VA 1IL2A 3HOWB 2W10A 2I0NA 5CC4A 4G7HC 3SDZA 3OMGA 1WHJA 4OELB 1IBLL 4GOPB 1KD1C 1DGSA 1N5ZA 4E7LA 2RK1A 5DLOA 3CCUA 3HKZB 2RM4A 4LD6A 2F0GA 1PH4A 3JCMe 3HP3A 3PIP3 2RCNA 3UE0A 1JQQA 4U68A 3PO3B 3KF8B 4TRDA 4CJ0B 2XHCA 2HEQA 1AE3A 3HHTB 4IJHA 3SK4A 4O2DA 4R8NA 1ML0D 2KMTA 1QILA 4DBQA 1P8LA 3M4YA 3JSCA 1QVFP 2F52A 1QZHA 4JI4L 1SNDA 3RUXA 3VS6A 1VQ8Q 1Y57A 2QA4Q 1N8RU 1Q86R 2KHJA 1WI5A 3CC7T 1TWBA 5EJWA 4NXMQ 3DWPA 2DILA 2K5LA 4D6WA 1QKWA 3GTLH 2M02A 1KC8U 2KCMA 2BH8A 3KBGA 4XTZA 1K0XA 2IJ0A 2X51A 4OGEA 1X3GA 3CC4Q 3WOEA 1ILPA 1BK2A 1NMFA 2PCFB 2RBMA 2OI3A 2X4YA 2L0CA 3E9IA 5I2XA 4EIKA 1Y07A 1OI1A 1WZOA 1I4RA 2WFWA 4ZYSA 4BBSB 2DVJA 1GUOA 1QCOA 1MGQA 2ZM6L 3TS0A 4WJWA 1A3TA 2DY8A 5FOBB 3K80C 2FPEA 2TMPA 1HNZQ 2KYMA 4DV0Q 2DKGA 2K52A 3MFYA 1M3BA 4C3JH 1KDBA 3CC2A 1Q1BA 4JBJA 4J9DA 1V29B 4C8QG 2CP2A 4J1MA 2YU9H 5LJ3f 1VQLQ 3JAMi 1XTCD 2R6GA 4UY8C 2OTJQ 2XG8D 2JOYA 3DWAA 3V7RA 1B9MA 4A4FA 4F87A 3JCMJ 4MHEA 1DJ7B 3KF6B 4CC4B 1STBA 4CKCA 4HAEA 1PV4A 3S14H 2YRCA 1G3TA 1PTOD 1Y8PB 2K14A 3D3RA 5GAHC 2MO0A 2H8HA 4JOIA 4YY3Q 4D8KA 3NWSA 3VS2A 4OB1B 2V1QA 2XD0A 4RCCA 2CT4A 4K6LA 1STYA 4OMFB 5I6YA 2MK5A 3V7SA 2B39A 2YDLA 1TWAB 1N33Q 4C0GA 2QGFB 3ER0A 5GANd 1BR9A 5LMNL 5CQXA 2KCNA 1LUZA 4FVMA 2KBTA 1IYVA 2Z4HA 4M75E 1V76A 1Q90A 2KXCA 2D8JA 2WV6D 2PNIA 1OULA 1HJPA 1Z6HA 4HIMA 2PQWA 4C3JG 1SFOB 1OTCA 1EIYB 2JA6B 4A3BG 3ULLA 4M78G 2RHQB 4NS5A 1SYEA 4L59A 4AFUC 2D0NA 5JVH3 1QCFA 4PJOB 1KTKA 3OYGA 2ATCB 5C3EG 4JRQA 4L8JA 1BF4A 3ND8A 2UUCL 4F7XA 2KNBB 3QJ6A 4E7SA 4M7DE 1Q1EA 1TS3A 2ENMA 3PO3H 2DL3A 2E6ZA 3S15B 4GN5A 1IW7D 2Z0WA 1SYBA 2F0UA 4JJBA 2ESWA 4M7AA 1EZZB 2XICA 2JS0A 2RA2A 4KBMB 5FROA 3FRPB 1BBZA 1I4QA 2QA4T 2X69A 1GD7A 2Z8LA 2GQVA 3A98A 3DXJC 4I65A 3FJPA 5EKLA 2HQLA 3GBQA 4B9WA 5EPKA 2JE6I 4JI5Q 3U58A 3EBEA 5JPNC 2O01E 2YUOA 1RODA 4C56C 3SD4A 2VQEL 4LF7Q 4AG2C 2RSOA 2D62A 4DFAA 3HOWG 1KK7A 1I3QB 1W70A 4JI8Q 1ZSGA 1K8AU 2MGSA 1VQMA 1BOSA 4BBSH 4DOVA 1ZX6A 4HIOA 3W5OA 3E2UA 1RTNA 2PZ1A 3GV3A 1YHQA 3HKZG 2IY5B 3WVEB 1QB5D 2FHDA 2KCCA 2SDFA 4RMOA 3PQIA 3NXWA 5NUCA 1HR0Q 1V43A 3PO3G 4PJMA 1IXDA 1X6GA 2VXWA 4OMOA 2LTOA 3RZDB 2ZZDA 2J4XA 1ZBJA 2B2TA 3DEPA 4B3RL 3ME9A 1CSKA 3QBYA 3J7ZC 3GNFB 1SYGA 1PRTB 4A75A 1DZ1A 3I56Q 1TOVA 1Z9ZA 4DOWA 1B1ZA 2JA8B 2DL5A 2LT1A 1VQNA 2BE7D 4O1NA 3OW7A 2F5KA 2FYKA 1BBWA 2A73B 1ENFA 2YUPA 1MKHA 2F0IA 1AWWA 2HBPA 3M56A 3SWNA 3EFRA 4ALPA 1FNVA 3H6MA 1TWAH 5FU7B 5HKCA 1L1OC 1BBUA 1UGQB 2JJ9A 3CCJQ 2E2IB 4YHHQ 3UWNA 2CVRA 3SFMA 1M27C 4ELYC 1LTLA 1E7ZA 2RHXA 5IGDA 1LO5D 1SNOA 1EQQA 1XJVA 4Z8AA 2M2LA 3I8ZA 3U50C 3HOYH 1SFOH 2JA6H 4DR6L 3R6OA 1YJ9Q 1NEGA 3VRYA 3NTKA 3J7A5 1OZ2A 3JCMV 4DPGA 4DXFA 1AT1B 3I55A 3SEMA 2EPBA 2ZTEA 4AQYL 4DUYQ 2KXDA 4CDDC 3RDVA 4X65Q 1HNXQ 1AD5A 1KQSA 4KK7A 1LT6D 2XDPA 2VGMA 1SRLA 2CS7A 3CF5A 4L6V5 1CA6A 1N32L 4GZYC 2J7ZA 4J9GA 1NYGA 2COYA 2CZ1B 1Q7YR 2K5DA 3MO8A 3CMAT 1W6KA 3G7LA 1YCSB 5C0MA 1Q81C 5ELNA 3S15H 2F4IA 4P71A 2X4XA 4LDVA 4MZTA 1PH8A 1PVOA 1S5ED 5IXBA 5GAN3 3JB9F 1XX8A 2XMFA 2X4JA 1YNND 3FKIB 4DU9A 4X62L 1WOCA 3HOZG 1PLFA 3OW2P 1VQ4T 4IURA 1QNKA 3CD6Q 1WTPA 3CBPA 2NUCA 1GOZA 1HZCA 1BBXC 3CPWS 3LLRA 1AWXA 1IRXA 2MYSA 1UUEA 4EDUA 1EQTA 1D2BA 1FMVA 1I3QH 2EPDA 4CKEA 1MNDA 2RK2A 2DX1A 3E9HA 4IUNA 1NUCA 2RHYA 4ME5A 2DXBA 4UC4A 4M75B 4JS4A 2H5XA 3I4MG 1GUGA 4JI0L 2UXBL 4Z89A 2IL8A 3BS1A 5LJ3h 5I6WA 2DIQA 4R9WA 5FRNA 1S1NA 4AFZC 3OYIA 5EC7A 1N9WA 1U8RA 2OAWA 3H6ZA 1N8RR 1VQ6T 1KRSA 5KGUA 5M3FG 3J81c 4R0KA 3RZDH 2LRQA 1O7ZA 4AIMA 1YIJQ 1JWUD 3EAEA 2PNHA 4A93G 3M5AA 5FWBA 3MP8A 1ABOA 1KC8R 4QF4A 2JA8H 1ARKA 1G8XA 3L2WA 3DHQA 3L0OA 4OHJA 3GIBA 1JRIA 1S4ZA 2KRNA 2EY2A 2CDTA 4JPBW 3KDFA 2K79A 2ES2A 1I5FA 4M7AE 3IKJA 5IN1A 1F9SA 1UEAB 4J9BA 4XTVA 1BVSA 3GQBA 1T5XD 2V26A 1WQ7A 3T16A 2B2WA 2A68D 4IPCA 3VUZA 3CCJT 3NSWA 3K58A 1AEYA 2E2IH 3LX7A 1S72T 2RCFA 4X1VA 5ELOA 4QQBX 3MEUA 1Q8KA 1JICA 1GCQC 2HD3A 2KAFA 3A8LB 3QYGB 4BA2I 1R0BG 1PSFA 1BCOA 3JCMb 3OYNA 3F8TA 1HYOA 3WWVA 5CBEE 1SSOA 2XRQD 4PMBA 3M0QA 2F0DA 4JI4Q 3PMFA 3D8GA 2E2HB 3RLFA 3T9NA 3X25B 3EGUA 1Q81U 2WINB 4B08A 3MEWA 3TQ7P 1LLRD 3E9FA 1NSNS 4AG1C 2RHIA 1UE6A 1UE5A 3HP9A 3CHBD 3CCMA 3QHSA 2I5HA 1SHFA 2GQIA 1VQ5T 3HS0C 5I2SA 3M85A 2KI7A 3E9GA 1UE7A 2NZHA 3STBD 5HGTA 5HY6A 2PU9B 5C6AA 2MWOA 2KECA 4CC7A 3J7AV 2PNRC 1IKLA 4F14A 1JU5C 5CKDA 2BOSA 3EN2A 3CCUQ 3K57A 1YHBA 1K0SA 3NQIA 4NL2A 4CJ1B 1PH3A 3FKIH 4UP7A 5CYUA 1WX6A 5KYWB 4F88A 1TQOA 3AFPA 3VDYA 4DV3Q 2B63B 2XWBB 3VYSA 2HL3A 1TTHB 1PHJA 5FRMA 1TWCB 4R4QA 1UJ0A 4RKUE 1QVGP 1B7YB 2NN6H 2YRVA 1WTWA 4KHPL 4NXNL 5CBAE 2GF7A 5D6XA 2AWOA 4KTAA 4JI6L 3NGPA 3PNWC 4M8AA 4HA8A 4NKLA 3OBWA 4HCKA 2A6ED 2ZT9C 1NE8A 4HMJA 3JAML 1UE9A 5KNDA 1GUTA 2BIVA 2LJ1A 3NTIA 5AJ3L 1ZSZC 4C92B 4ZQ3A 1EYDA 2MWPA 4J15A 3DM3A 4FYWB 4M78C 2JA5H 2JTFA 2Z6BA 5ECAA 4C2MB 4PG3A 4ZK9B 2ZJRA 4B3ML 5LMNQ 2QG9B 4FL6A 2DE0X 1OQKA 1QVFS 1GO3E 4TSSA 1UGRB 3MTSA 3CC2Q 2Y4YA 3KF8A 4DR7L 4XU0A 4IFDJ 1SKUB 1K8AR 1Z47A 4IIMA 2A5HA 3G1JA 4BXXH 3E6ZX 2HHHQ 4A3GB 1JCKB 2O4XA 1PKTA 3MJXA 3QPHA 5M9OA 2KK4A 2JA7G 4LUOA 1M4ZA
chains in the Genus database with same CATH topology
4HIKA 2FXQA 1M1KU 5GAOm 4M75G 1BI3A 1AH9A 3H3VH 2Q2UA 4PKCC 1UGPB 4VUBA 1WYDA 4BA1I 4PLIA 4IOAA 2WSEE 5C0XJ 1JMCA 3MP6A 2E2HH 4IKFA 1N6AA 4K0KL 2XDDA 1HNWL 1YITA 3A5ZB 1WJQA 3AFQA 3O8VA 4II1A 1VQFA 4M7DG 3KUFA 3W1BA 4A4KA 1VQAA 4FT4A 3CW2C 2YYZA 4MNOA 2VQEQ 2LVMA 3CCUT 3DKMA 3L2PA 1CKNA 2LCCA 2AHOB 1BKBA 1WNLA 1QVFA 4DR2Q 2M9UA 1X55A 4DA4A 5C44G 2AKWB 4M7AB 2B63H 1WFQA 3CCVA 2YTYA 2ZJPA 3LGLA 3F2DA 1TWCH 2PVGB 3META 4B3RQ 3QZ5B 2ZPGB 1KXLA 5K36G 1OXVA 2KQWA 4OB2B 2QQSA 4GNXC 3NENA 2OQKA 2EFIA 1Y71A 5FLMG 4HJ5A 2Y90A 2K50A 4MMLA 5FJ8G 1E1TA 1HR0W 3PFSA 3K7UC 1YHAA 4C2MH 2D6FA 2AWNA 4A76A 4MDXA 3CC2T 2E65A 4BE0A 2GFUA 2B63G 1CKOA 1LNXA 2PMZE 3MCAB 3PIPA 2N3SA 4A3GH 1SROA 1QP3A 4DR4L 1QP2A 4JRIA 3M4GA 3KOJA 3SWNB 5FU6C 3PUXA 3LGJA 4CRIA 3OS0A 1IBML 2KCTA 5HK3A 2FB7A 1YI2T 2N78A 1PH2A 2ZTDA 4XIGS 4BY6C 2ZPFB 2Z6KC 1X01A 4O6JA 2DIGA 1XTDA 4M77A 1ZHIA 1VQ7T 5FLXc 5GAOp 4L5RC 4N4HA 3A8HB 2JA9A 1VQ6A 3M7NA 2L3RA 5GANg 4RMFA 3I4NH 1VIEA 3OYJA 3GTOH 4JI3L 3T1HL 2RH2A 1G51A 4QVCA 1YJWA 4MDWA 2OCEA 1FJGL 1EUJA 3PGGA 1SMXA 1VQKA 4LFCL 5IYCG 3RZOH 4Y91A 4ELZC 3N5BB 1S72A 4LF8L 4BE1A 4A3EH 4EPCA 2NN6I 4GKJQ 2E2JH 1PH6A 4BDZA 4DUZL 2UUAL 4OWTB 5E7NA 4JI1L 5KE3A 3I4NG 4IPDA 2R93H 5CVIA 1VQMT 1NY4A 1D7QA 4DV2Q 1XMOQ 1YHQT 1QW1A 2K75A 2B8AA 1Q7YC 4IUUA 4HCBA 1CSPA 2G3RA 1VUBA 3M4PA 2DAQA 4F7UF 4M7AG 3PV0A 3OW2S 2CWPA 4XTWA 1HZ9A 2QQ9A 2N49A 4Y28E 1VQNT 3RMQA 3KJPA 3TS2A 1G3YA 1Q12A 4X64L 2EIFA 5KCHA 1NBWA 4DAYB 3OYDA 2RHSB 3S2DH 4YCVA 2R7ZH 2E64A 4GN3B 4LWCA 1GKHA 2R92H 3AQQA 4OWXB 1N8RC 4IJLA 3UDFA 2YLBA 2UU9Q 3HFNA 3I55T 3K81C 1KC8C 3LGFA 4KHPQ 1KHIA 2B3GA 4HJAA 2RJFA 4GLAC 4JI6Q 3X20B 5GADC 5GAEC 2XU8A 1TWFH 3M4OH 4AYBG 1N36Q 4DV5L 1XNRL 5DM7R 1XQHA 3Q1JA 3L7ZC 3K7AH 3VU3C 1NJIU 1TWGH 2M1HA 4QW2A 3BJUA 4DV6Q 2WSFE 1E1OA 4MTNA 3JCMc 4M77E 3AYHB 4X66Q 5IT9E 2VUMG 3ICEA 1UGSB 1YBYA 1YJNT 4OP0A 2LDMA 4X34A 4DK6C 4LF9Q 1V9PA 1E3PA 3SGIA 2A19A 3A8OB 5KCOA 5BR8L 4OVAA 2BA0A 2K3XA 1XMQQ 3FDRA 4XU2A 5M5XH 3J80i 4BY7H 1QVGS 3M55A 4DR3L 2O4XB 1XNIA 3KFUA 2LC4A 2ID0A 1E24A 4C5IA 4BI4A 4C8QF 2MO1A 3H15A 1TWHH 3SB2A 4IO9A 4A3JG 1HZBA 4JV5Q 2JJQA 3HFZB 1O9SA 1G3WA 4LFAL 1R8OB 4JC0A 1YVCA 5A0DA 1CKMA 1Y1VH 3LW5E 4C92A 4HIDA 2E5LQ 3CCEA 3UE1A 2Z0SA 5D6YA 4BY7G 3S24A 3KJOA 1SSFA 3CCMT 2JEBI 4FIBA 1K8AC 3FHWA 5CIUA 2GCXA 2DJZA 3OYHA 1CKNB 1X9NA 2K3YA 4M78F 5CR2A 4A4GA 4XTYA 1L2FA 4LW1A 1QVGA 3GDEA 2Q2HA 4R56A 1YI2A 2JNGA 4YWKA 4MZ9A 5CCAA 4PZ6A 3RN5A 3PIOA 3NTHA 3BU2A 3PUVA 2K2VA 2UUBL 4KI0A 5LJ3e 2LQ8A 1VQ7A 1A0IA 4JI7L 2F4VQ 2CZ0B 3A5UA 2Q2TA 3FEOA 4LF4L 4TVRA 3CP0A 5GAMg 3VYGA 1VQ9A 2K57A 3KLWA 1N34Q 4HJ7A 1FGUA 5GANj 3RR5A 5LMUL 3NBHB 4Q5WA 1BIBA 2E70A 3C95A 2D0PA 1G5VA 3HOVH 4JUVA 3NEMA 3PCOB 3L2UA 1EWIA 4LF5L 5I21A 1SR3A 1EFWA 4IFDI 5GANf 4A53A 4A4EA 4OO1I 1JBMA 4ZGDB 1JJ2S 5GAN2 3HRSA 4LF6Q 2VY3A 1LM0A 2E5QA 1FJGQ 1V1QA 2CGHA 4LFBQ 4M77B 3EFSA 4JBKA 4P72A 3D0FA 4A3IH 4C0DB 3FB9A 1ASYA 4B3SQ 5LJ5g 4XTCS 1YITT 5C0XI 2WACA 4GKKQ 1L1OA 4DR1Q 2IHEA 1Y1WH 2VV5A 1B70B 3U4ZA 2YTVA 2IX1A 4DV4L 3M4QA 1PA6A 2DZCA 4UP8A 3P8DA 4LUVA 3PT9A 1S3OA 2DVEA 3CCVT 1PSEA 4M78D 3C12A 4BBSG 1HK9A 3JCMQ 3VV0A 1BIAA 5D6WA 3FC3A 2UXCL 4GLKA 2VW9A 1C7YA 2A3LA 4X64Q 2LSSA 5I2MA 2DXTA 2F69A 4C92E 5J26A 2I5MX 4J6XA 4OX9Q 3ZJYC 2PI2A 2DTIA 2P0QA 2JEAI 1VQPA 2L8DA 5GMKj 4DR5L 3S3MA 1VQBA 3P8BB 4DV1L 4JG2A 1K83H 4Y52H 2ZJQA 4A3MH 2V8JA 3G6EA 2EXDA 5DY9A 5GAN6 2KVQG 2MFIA 1GXIE 1AE2A 4MZMA 3CXCS 2DPPB 3GLXA 2VYTA 2JTMA 1X3FA 2DUDA 3HOYG 4DQ2A 5CK9A 3OTOQ 1BI0A 2IT1A 1PH7A 1BI2A 4C0ZA 3L2VA 2JA6G 2V1CC 2A8VA 2GVAA 1H95A 2L15A 1CSQA 1KL9A 4LDUA 1YJNA 4PJOG 2H3JA 4BB7A 1IBKQ 3CCLA 2RHZA 1MHNA 1VQOA 3PMIA 3M58A 3CCQT 1N27A 4N0AC 2VZAA 3OYEA 3J81j 3F70A 2RB6A 2XK0A 4OB3B 1JB0E 2KHIA 3RKWA 2YTXA 2BKDN 2BH2A 4GS3A 2Y0SE 3GTMH 1WGSA 4WJ4A 1HR0Q 1IXRA 1YJWT 3K8AA 5BR8Q 3QSUA 3BZCA 1VQKT 1IBLQ 4EMKC 4M77G 3G48A 2MNAA 2D0OA 4LUZA 1YNXA 2GVBA 3Q8DA 3QYHB 3CPWA 1M90C 3QG1A 1Y14B 4J83A 4JBWA 4GLXA 5GAN4 3PF4A 4X9CA 1M1KC 2JA8G 3CCRA 5M5YH 5CQYA 1S40A 2EAYA 1W2BS 4C8QC 5GANh 2ZM6Q 4BE2A 3K0XA 2AHJB 5CO7A 1WQWA 3OMCA 3OYYA 1HH2P 1QVPA 5GAMd 3JB9D 3TREA 4BDYA 4JYAL 4NB3A 4R1JA 3UDGA 4LDXA 1NZ9A 1PYSB 2Q2IA 2E6NA 4PZ8A 3W1GA 4E7HA 3VYHB 4JI2L 3GTGH 4IOCA 1OXSC 3I2ZA 2DZ9A 5IYBH 2PI2E 1Q82U 3RLOA 2A7YA 4M75F 5GAMj 1KRTA 4C5HA 3L42A 4A3DH 2UUBQ 3ZEHA 3FKIG 2DEQA 3OY9A 1J5EL 4JI7Q 1VQGA 1I94L 1B34A 3GTJH 2NN6G 2MQHA 1EQRA 2NLUA 1M90U 4M7DF 4J7FA 5GAMf 1G6PA 1XNQL 3JCMg 2UUCQ 3F2CA 3M9BA 3S1NH 1Y96B 3KYHC 2R57A 4AH6A 5LJ5d 4GLVB 2R58A 2VQFL 2JA5G 2AMCB 2RO0A 2RJEA 1XOVA 4J8OA 4QIWE 4GOPC 3J7AF 5JJLA 4BXXG 2XI9A 3CC4A 5LJ5j 3WXMB 2JQOA 1M1FA 3J80E 3A0JA 4POGA 2ZPIB 4GNXA 2KENA 4QY7A 5GMKh 1NPPA 2ZPHB 4P75A 3NFCA 3VJPA 3UPUA 2HQEA 1UE1A 1UWVA 5LJ5f 2OTJA 5CKHA 1YEZA 5CKFA 2QGQA 4NXML 2VNUD 2E12A 5GAOl 1K9MU 4QQGA 2NZOA 1R9TH 4XQ3A 3RKXA 3E0EA 4L5GA 3HRUA 3CCET 1HNZL 4DV0L 5LJ3g 3MP1A 3JAME 1W4SA 1OXUA 1L1OB 2VC8A 4DR6Q 4BBRH 2Z6KA 4EX5A 3PUWA 4J5YA 4JRKA 4AQYQ 2EQUA 2L89A 2PVDB 2EQJA 4EQ5A