3ER0A

Crystal structure of the full length eif5a from saccharomyces cerevisiae
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
146
structure length
146
Chain Sequence
DAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 5A-2
publication title Crystal structure of the full length eIF5A from Saccharomyces cerevisiae
rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 14
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3er0A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3er0A02
2ZM6L 4C3HH 4UP7A 5IP9G 4GNXA 4BXXH 3KOJA 2K75A 3K7AH 4JOIA 4DV5L 1B70B 3G6ET 3K80C 2CWAA 2GVAA 4AQYQ 5DM7R 1EFWA 4YWKA 2WAQE 1JMCA 1K9MU 1GKHA 4BBSG 3HKSA 4DV3L 4IJLA 2ZTEA 4NB3A 1K73U 5IWAL 1BBUA 1VQFA 2QEXT 3S2DH 3LGFA 3CPWS 1P16A 3PSIA 5AJ3L 4OWWB 5FJ8H 2JNGA 3PGZA 3S1RH 2KDSA 4L5TA 1XPRA 2K5NA 3CQZH 5BR8L 3I4MH 1HR0L 3M7NA 2QA4A 3GD7A 3HOZG 2LQ8A 1GD7A 3UDGA 1IBMQ 2MFIA 2GVBA 5JEAJ 2XHCA 1QZHA 3GTLH 1IXRA 4LW1A 1OTCA 4LF7L 3GTGH 5ELOA 2E70A 3OW2S 1I94Q 4P74A 4TQUS 1C7YA 4BY1H 2KHJA 1HNZQ 1XTDA 1SE8A 1SROA 1EQRA 3HOWG 2E6ZA 4GS3A 2Q2UA 4PZ6A 4JI1Q 3ULJA 1EIFA 2BA1A 5LMUL 1VQ6A 4QY7A 4RMFA 3GO5A 5M5WH 3KDFA 1VQ5T 4J15A 1SRUA 3CC7T 5GAHC 4NXMQ 5ELNA 4A93G 4B3TL 2Q2HA 3KJOA 1KRSA 1VQDA 1OXSC 4DR6Q 4X34A 3CCRA 3CCUA 3CC4A 3H3VH 1YHQA 1W2BA 3NBHB 4R4QA 1PH3A 3S14H 4MTNA 1YI2A 2VQFQ 4GLAC 1VQ7A 2CFMA 2JA6H 1X56A 1IBKQ 4B3SL 2QA4T 4DR1L 2ATWA 1TWAH 5M3FG 1AE2A 4AIMA 2ID0A 2FXQA 1YHAA 1CSPA 3G71A 1U0LA 4JBWA 4JC0A 4YCVA 4DAMA 3TREA 2V1CC 4R4CA 4JI5Q 1MKHA 2OQ0A 5M3MG 1S40A 2CWPA 1EQQA 2B63H 2BH2A 1XMOQ 3CMET 5IYDG 1NMGA 1M90C 2F4VQ 1VQPA 4A3CG 4QGUA 4JI7L 5FLXE 3KF8B 4MZ9A 3U50C 4B3ML 2PMZE 3CD6A 1KHIA 3AFQA 1YVCA 4HIKA 4AH6A 4GNXB 4OO1G 4GNXC 1PH2A 3S2HH 4JOIC 4IPGA 1K8AC 3T1HL 1V1QA 4GLXA 1I94L 5C44H 2R92H 1CKMA 4A3FH 1MJEA 2JA8G 4DV1Q 2E8GA 3J81i 5C44G 4OX9Q 3CCRT 1O7IA 3CC4T 4WJ3M 4HJ9A 2DO3A 3PCOB 2I5HA 1GO3E 3HOVH 3OTOQ 1YI2T 1M1KU 4DR5L 4NXML 2ASBA 1R9TH 2MQHA 3M4QA 1YJ9A 5M5YH 2EXDA 2K52A 3HKZE 3P8BB 4ZN1A 3F8TA 4P73A 1KC8C 4LFAQ 4X66Q 2ZJPA 4LF9Q 4Y52H 1L1OA 1SLJA 1WCMG 4X64Q 2UUBQ 1VS0A 2C35B 2D0PA 4A76A 3CCVA 1HJPA 3AFPA 1S72A 1U5KA 3FHWA 2IT1A 3H0GG 1HZAA 3K0XA 5IYBG 5IYCG 4A3BH 4X65Q 1VQGA 1VQPT 5GAGC 5FLMG 2KCMA 1XJVA 1VQLA 4A75A 2KHIA 2E2JH 4GKJL 1OXXK 1FL0A 1V9PA 4JI5L 2R93G 2L3RA 4DV2L 1YIJA 1NBWA 2PNHA 4JI3L 3LGJA 4BBRH 4LFBQ 4DK6C 4DR2L 1VQ4T 2ZJRA 1HNXQ 2F4VL 3CXCS 3E0EA 4OXPA 4A3EH 1QZGA 1KIXA 1NJIC 4JI6L 5J26A 1K83H 2VQEL 2WP8J 4A3LH 3KDFB 1B7YB 3CF5A 1XNRL 4IOAA 2OTJA 1FJGQ 1N32Q 4GN3B 1QVFA 1NTGA 3M3YH 4HIOA 1NPRA 1UWVA 4LF4Q 2PQAB 5IP7H 3A5UA 1J5EQ 5FLXc 1J6QA 2N3SA 3AEVA 2RHSB 4JI4Q 4GLVB 1YJ9T 2NZHA 3GDEA 1UE7A 2NN6G 1YJWA 2NZOA 3HOXH 2KCTA 1PYBA 1SMXA 2UXCL 1JJ2S 5IP9H 3S24A 3S1QH 1S72T 1MJCA 5LMNL 3A74A 2MI6A 2ALYB 4YY3Q 1XPOA 3J80E 4DR3L 4DV7Q 1VQEA 3EN2A 4BBSH 2WB1G 3U4ZA 1HNWQ 3RR5A 1JJ2A 4LF5Q 1C0AA 4DAYB 5C3EH 1PV4A 3RLNA 1IBLQ 2UUBL 1I3QH 1S3OA 1X54A 5C3EG 4LF8L 3PIPA 1WOCA 1SR3A 1TWGH 3TQYA 4DV0Q 2K50A 4DUYL 4DR4Q 1VQKA 3PIOA 1VQBA 5IAYA 1KAWA 3NELA 3U4VA 3AQQA 3CMAA 4JV5Q 2JJQA 4DNIA 3WWVA 4K0KQ 1NZ9A 1RIPA 2EIFA 4YWLA 3UDIA 3HOZH 4LFBL 1QVGS 1Y14B 1M90U 4PMWA 4AYBG 3CCJA 3CPWA 3CPFA 4IO9A 4ALPA 4R4TA 2F52A 2MO0A 1VQCA 4BY7H 4JYAL 2PI2A 3EBEA 4BY7G 2I5LX 1FVIA 4X62Q 3NEMA 1YJWT 3CC2T 4LF4L 1E1OA 3I2ZA 4CRIA 4HJ8A 1J5EL 2R7ZG 2F3IA 1VQMA 1Q1BA 3HOWH 2JE6I 4BA1I 2N78A 1HZBA 1N33Q 1K8AU 1VQIA 4IPDA 1EOVA 4NPSA 5EAYA 2UXBQ 1L1OC 3MEFA 4POFA 2K4KA 3PV0A 2MWPA 2MWOA 4JBKA 2VUMG 3OW2A 4YHHL 4A93H 4DUZL 2YU9H 2IHFA 1XNQL 4LUOA 1X65A 4KHPL 1G291 1LYLA 2VS1A 1VQ9A 1OXVA 3M4PA 4YY3L 5IE8A 4DV4Q 1N36Q 3JAMc 1Q8KA 1KC8U 1Q1EA 1VQKT 4JI2Q 3UDFA 2MO1A 4AQYL 4LF5L 3CMAT 5JEAG 1N8RC 3I55A 1CSQA 2I5MX 3W1GA 4A3KG 1IBLL 4JI8Q 3CCMA 1KQSS 2LVMA 3RLOA 3J80c 1A62A 3PUWA 3CCJT 3KLWA 1Y1VG 1L0WA 5M3FH 4JI0Q 4DV0L 5M3MH 1Q12A 2AKWB 2JUFA 4DR4L 2LSSA 4IPCA 1PVOA 5IYDH 1E7ZA 3DM3A 2HHHQ 1E3PA 2D62A 3JC66 4L5RC 3PO3G 4A3CH 2A1AA 1A63A 1YJNA 1FGUA 3GTPH 1VQMT 4LUZA 1IL2A 3U58A 3S16H 1NJIU 3I4NG 4DK3C 1IBML 1XMQQ 4DR7Q 4OWTB 1Q86C 2JQOA 4JBMA 1PYSB 3UDXA 1PH9A 3A5ZB 3PUVA 4LF6Q 4OWXB 1KXLA 1I5FA 1VQ6T 2K5HA 3PF5A 3UE1A 2UUCQ 4XTCS 3G48A 3BZCA 1K3RA 2E5LQ 2JA8H 3ZJYC 1K73C 2UU9Q 4GN4B 1N33L 3SGIA 1HNZL 4RG1A 1YITA 4LWCA 3S1NH 4OO1I 1VQ9T 1SN8A 1CUKA 2RHQB 3CCUT 4BA2I 4JI1L 1YHQT 4A3JG 1UE1A 1RL2A 1EUJA 3BJUA 1PH8A 1X3FA 2IHEA 2IX0A 2K14A 3B6YA 4TVAB 4DV6Q 1HNXL 1VQ7T 1KL9A 2EQSA 1Y1WG 1WYDA 4JV5L 1VQHA 4DR6L 1E22A 4DV4L 1WCMH 2UUAQ 2NVQH 3G71T 2OTLA 2NVXH 3H0GH 2UXDQ 1HZCA 5IYBH 5IYCH 4R1JA 2LXKA 5FLMH 4UP8A 2VQFL 3RZDH 4QIWE 1JE5A 4UY8C 1YJNT 2JOYA 1B8AA 2R7FA 1Q81C 3ULLA 4NXNQ 3GTMH 3ULPA 1VQAA 3OYYA 2R93H 4WJ4A 1X3GA 2QGQA 4JCVE 1N34Q 4A3GG 3E9HA 4FDBA 1H95A 4P71A 2AWNA 5E7NA 4LFCQ 3CD6T 3D31A 4A3IG 1XMOL 2A19A 2ZTCA 5GQOA 2VY3A 4QQDA 3H15A 1SSFA 3LGLA 2JA5G 2B3GA 1TXYA 3BZKA 3HOYG 4B3RQ 1D8LA 1C9OA 1QVCA 1YITT 3DB4A 2KBNA 4DV5Q 4DR3Q 3TEHB 4DR7L 5GAEC 4GOPA 2OCEA 1GVPA 1BBWA 2N49A 2YV5A 1LUZA 1M1GA 1TWCH 3CXCA 4P72A 4HIDA 4DV3Q 3PUZA 1HZ9A 3PF4A 3KF6A 1YBYA 5IWAQ 3CW2C 3J7AF 5AJ3Q 3Q8DA 2DGYA 4DV1L 4GN5A 2LXJA 2Y0SG 4OX9L 2OTLT 1KD1C 4PG3A 3CCQA 5BR8Q 2AWOA 2JA9A 3JAME 3OTOL 1HR0Q 3CCVT 1CKNA 4QL5A 4PZ8A 3F2CA 2QEXA 4QJFA 3VDYA 2NN6I 1X3EA 1EYGA 4YWMA 4IFDG 1IZ6A 3J81c 4UPAA 4LFAL 3GTOH 4X66L 1D7QA 3FKIG 1VQLT 1WI5A 3E9IA 1A8VA 4LF9L 1Q7YC 4LF7Q 1VQJA 1L2FA 2UXDL 5C4XG 1VCIA 4X64L 1MIUA 2H5XA 1ASZA 1YIJT 3CCSA 1N8RU 1BVSA 1Z9FA 3RN5A 1EIYB 1IBKL 4AYBE 2JVVA 2PI2E 1KRTA 1VQNA 5IT9c 2Q2IA 3HOUG 3CCEA 4X65L 4YCWA 5C0XG 4ZN3A 3RLFA 3RNUA 1SFOH 4DPGA 5LMUQ 2KENA 2OTJT 1EWIA 1UE5A 3L0OA 4H02A 4EX5A 3F2BA 2E2IH 2Z6KC 3W5OA 5HGQA 1NPPA 4B3TQ 3BU2A 1DGSA 4HJAA 3KBGA 3PO2G 2B29A 5A2QE 5LMNW 2Q2TA 1I50H 1NE3A 2VL6A 4IFDI 1LTLA 3NENA 2HIXA 3RN2A 2R7ZH 1Q86U 4BXXG 1FJGL 3D0FA 1V43A 4DKAC 1N32L 1QVGA 1VQ5A 3CCQT 1CKOA 3CC7A 2YYZA 1PH1A 3T1YQ 1X9NA 3S1MH 3J7ZC 3IRBA 4B3SQ 4DR1Q 1OXUA 1K8GA 1L1OB 5HY6A 2YTYA 4JI4L 2VUMH 1E24A 3K81C 4UP9A 3CCLA 1Q82C 4IOCA 1VQOA 2WAQG 5FJ8G 3GTQH 3CCST 3UE0A 1IYJB 4XIGS 3CAMA 1HR0W 3I4MG 1VQNT 5GADC 4JI7Q 2VW9A 3CCET 3L7ZC 3M85A 2I0QA 5JJLA 4B3MQ 4A3KH 2Z0SA 4DV7L 1HNWL 1AH9A 4A4IA 1NY4A 3CMEA 3J7A5 1BKBA 1Q46A 1Y1VH 4QQBX 4X6AH 2NVYH 2VZAA 4GOPB 4HJ7A 3T1HQ 3A0JA 4GOPC 1Q81U 4BY1G 4JBJA 3G4SA 3S17H 1I6HH 2OWOA 2CQOA 3PO3H 3AYHB 1KQSA 3FP9A 1K0RA 1JJCB 3KF6B 2DUDA 1W2BS 4Y7NH 1ASYA 4LUVA 1YHBA 4K0KL 4A3MH 4DR5Q 1PH4A 4HJ5A 2BA0A 1YNXA 1PHJA 3I4NH 4LNQA 1PFSA 2D0OA 4A3MG 2PQAA 3L2PA 4GKKQ 4O2DA 3ERSX 2AHOB 4OONA 1YZ6A 1CKNB 1LM0A 3GTKH 4X62L 2A8VA 4RG2A 3CCLT 4YCUA 1K9MC 1VQOT 4P75A 4KI0A 3RZOH 3T1YL 2UXBL 1QUQA 2Z6KA 1OXTA 4A3JH 2HT1A 5C4JH 2XTIA 2JA6G 3H3VI 4L5SA 4GKJQ 2YTVA 3S15H 2N8NA 4PZ7A 5J3BA 4DV2Q 1PA6A 4IJHA 3J81E 1KD1U 1Y1WH 2XGTA 4JI3Q 2NVTH 4KHZA 5LL6S 3I55T 4DR2Q 2E2HH 2B63G 3TS2A 3CCMT 4JI6Q 4C3IH 5M5XH 3M9BA 1TWFH 3W1BA 2VQEQ 2JA7H 2IX1A 3J81j 5DLQE 1N36L 1XNRQ 1JJGA 5IT9E 2AMCB 4IPHA 3G4ST 2CKZB 4KLKA 4JI2L 2JA7G 1Q7YU 4R4OA 2CKKA 3ER0A 1VQ4A 2RCNA 4HIMA 4JI8L 1PH7A 1WJJA 3KFUA 3TS0A 1G6PA 3I4OA 1UEBA 1Z47A 4MNOA 5IY0A 5K36G 4A3GH 4JI0L 2YTXA 1NMFA 2R92G 5GROA 4A3IH 4A3FG 1P8LA 2HHHL 1VQ8A 1GM5A 2JA5H 2L15A 3HOYH 2HIVA 2UXCQ 2ES2A 1X6OA 2K5VA 3HFZB 5LMNQ 1W3SA 2ZM6Q 3HOVG 1TWHH 4YTLA 2R7DA 3I56A 4GKKL 3DB3A 2Y0SE 4JG2A 3KJPA 1XMQL 1JB7A 2MNAA 5JJKA 3STBD 2JK8A 4APVA 4LF6L 1N9WA 2UUCL 4R4IA 2E5LL 4LF8Q 1YEZA 2LCLA 2RF4A 2UU9L 4A3DH 4L5QA 5JJIA 3PUXA 3F2DA 3LH0A 3G6EA 3HKZG 2WFWA 3STBC 4DUYQ 3M4OH 4A3BG 4A3DG 2WB1E 3GTJH 3TRZA 2VNUD 1HH2P 1WFQA 2CCZA 1Q82U 2OQKA 3F1ZA 4IFDJ 2ZJQA 2GN5A 1QVFS 4DV6L 3EIVA 1XPUA 4BBRG 1A0IA 1T9HA 3PUYA 3FKIH 4POGA 3MXNB 2KVQG 4C2MH 2JEAI 1E1TA 2BH8A 5C4XH 3KYHC 3DLLA 4A3EG 3K7UC 2UUAL 4A3LG 4JYAQ 2IY5B 1JT8A 1G51A 3I7FA 3CP0A 4C3JH 2JEBI 4ME3A 4O0AA 1VQ8T 3K8AA 3HOUH 1X55A 2ZTDA 5C0XJ 1XNIA 2R6GA 5H1SE 5IP7G 2G3RA 1PH6A 4NXNL 4TVRA 3ICEA 1AE3A 1PH5A 3I56T 1N34L 2HQLA 3JAMi 3CC2A 4LFCL 4EQ5A 4YHHQ 4DUZQ 1QUQB 1XNQQ 5C0XI 1M1KC 3PO2H 3HOXG 4KHPQ 2IG0A 4B3RL 3J80i 1UE6A
chains in the Genus database with same CATH superfamily
3P8HA 4M7AB 5IP9G 4BXXH 2BIVA 2FZGB 3E5SA 1D0YA 3JB9G 1IHZA 1PNJA 4A4KA 2EYFA 3K80C 5DM7R 2DY8A 4LDUA 2NUCA 4IUUA 4XT1B 1LV9A 2WAQE 1IKMA 5HCKA 4QT7A 1MD2D 2NVTB 4Q0FA 1ZHIA 4ELYC 5IWAL 1BBUA 5EJWA 2BZ8A 5G3LD 4Q5VA 1Y57A 1IHWA 2RQXA 3PGZA 1LT3D 1XPRA 3CQZH 5IOCA 4ZAIA 3H91A 1WTVA 1PKSA 2F2XA 3UDGA 1NR2A 1XXGA 2KRNA 1AEYA 2NTSA 2J6FA 2CYZB 1OTCA 5GAOp 3I56Q 4LF7L 3NPPA 2IIMA 3GTGH 5ELOA 2QYZA 1I94Q 1RAHB 4P74A 4TQUS 3MEAA 3VRZA 2HL5C 3EH1A 1C7YA 2VWFA 3VS7A 1I4K1 2QCPX 1EZ8A 3QWXX 3NXWA 5F2DA 2BE5C 3HOWG 3OSVA 4GS3A 4XU0A 4PZ6A 5GANj 4XTXA 4AMCA 1X32A 4BI4A 4RMFA 4RWSC 2I46A 5AYFA 3QJ6A 4C8QE 3KK7A 1HA6A 3CC7T 1EZZB 3D4RA 3D6CA 4XXEA 3A8JE 4NXMQ 4HT9A 3S1NB 2L0AA 1KRSA 4M7AE 4A4HA 4CKBA 4M78F 4B6MA 3NBHB 1EY5A 3S14H 1ET9A 1RJTA 1EEFD 3SEMA 4MTNA 4DXFA 2KQWA 2MAMA 1TH7A 3W2DA 2JA6H 4DR1L 2AZVA 3MP6A 3KBXA 1SG5A 4J9CA 4XAXB 2FXQA 1TXQA 3QOLA 4WFN3 3CHBD 1K83B 4JC0A 4KY6A 4NOYA 4MDWA 4KH1B 2DL8A 1BUVT 1MKHA 4FVMA 2B63H 3LW5E 1W2BP 1JOOA 1XMOQ 4RCOA 3CMET 4M75E 1M90C 1WHJA 4XDXA 5EKIA 1E7OA 3Q1JA 3VA5A 5KNCA 3QSUA 4RGMA 5KYUB 2CT4A 1G8ZD 4AH6A 4GNXB 1FMKA 4GNXC 4TRDA 1M8MA 1UAPA 3T1HL 2R92H 2D9TA 1ZA2B 1JEGA 2JM8A 2WACA 1BXTA 2K3BA 2E8GA 5LJ3h 4OX9Q 1PXUA 1SXTA 3CCRT 2PW5A 3SB2A 2DO3A 5E4WC 1YWPA 2DXBA 1HRJA 3OTOQ 4DR5L 2DZ9A 4K5WA 2F3WA 3MP1A 5L8RE 1I3QB 1FMWA 2DETA 3A7LA 2QA4Q 5M5YH 2K7AA 2K52A 4P73A 3P8BB 3T13A 4DR3Q 4RGOS 1TWGB 1EY8A 4LJZC 4CDEC 2D0PA 3K5OA 2KEAA 2VKNA 1S72A 3H0GG 3DEPA 3M5AA 2XNAC 2O2OA 4FM4B 1VQGA 5I6YA 1II3A 3MJXA 5ELBA 1VQLA 4A75A 7AT1B 1XYIA 2DTIA 2KHIA 2JN0A 2PNHA 1NBWA 4DQ2A 3QYHB 3ITPA 2K5LA 4LFBQ 4YIJA 2B2YA 1HNXQ 2F4VL 5KCOA 4F17A 2DL5A 2ZPEB 3P7JA 3OS5A 4OGCA 4A3EH 1BO0A 5J26A 2VQEL 4C5EA 4L63B 2EJGA 3EGXB 4OMLA 2CQAA 4IOAA 2LCSA 1N32Q 2SNSA 4GN3B 1NTGA 3CCUQ 1NPRA 2VASA 3CC4Q 1KAAA 2PCFB 1BCOA 5IP7H 3QKJA 4PJOG 1JB3A 2A37A 2EQMA 2RHIA 1YI2Q 4U68A 2YU9B 5I2SA 2A0FB 3LWIA 3QWNA 2QXFA 3GDEA 3FJPA 1BK2A 1YJWA 2K2VA 2K01A 2NZOA 2HCCA 2V8JA 3O13A 1CTMA 1QVFP 1YCSB 2AT1B 4AFSC 1NSNS 2MI6A 4HVUA 2EYMA 1VQPQ 5M3FB 4BBSH 5M3MB 3H0HA 2K5FA 4XU2A 2E5KA 1JJ2A 1XWEA 1TTHB 1BI2A 4RAUC 4DAYB 5C3EH 4E7JA 1BI0A 1PV4A 4IFDG 1G3WA 2A6HC 2BUDA 1WFWA 1STEA 5NUCA 1MHNA 5C3EG 4LF8L 1PHTA 1H9JA 3QO3A 3OS0A 2PTKA 1WOCA 1SR3A 4HMIA 4QMGA 3TQYA 2LJ1A 1KAWA 4N8FA 1HD3A 2JJQA 1NZ9A 1RLQC 1VYUA 2XICA 2EIFA 3PIO3 3SEBA 1SMYD 1QVGS 4IO9A 1M90U 1EYCA 4AYBG 2DTHA 1LTRD 1K4US 2NBFA 4R4TA 2MO0A 4LUEA 2F0EA 5IHNA 4MDXA 3CRKC 3AB9A 5C44B 1YJ9Q 1EEID 1FVIA 2O4XB 1BF4A 4LF4L 3AMUA 4HJ8A 4MN3A 4CC3A 2R7ZG 2SRCA 2K33A 1Q1BA 3Q23A 2GQVA 4UAIA 2E75C 1FYNA 1Y07A 4JJCA 2QG9B 5EAYA 1TG0A 2EXZA 3RMSA 1A15A 3CPWP 1PLFA 1D5ZC 3META 1FGBD 2VUMG 4K8JA 2IHFA 4OL7A 1BI3A 1UGSB 1Q95G 1I4GA 1F9PA 2CH4W 1X65A 2LKVA 3A8KE 4HAEA 3RZDB 1FXXA 1PSFA 3S3MA 2VS1A 1X6GA 2YUPA 2F1MA 4DV4Q 4OF1A 2CUDA 1NNXA 2EE1A 3M4PA 4KJNA 4RFBA 5IE8A 4YY3L 2HDAA 1F2MA 1Q1EA 4JI2Q 2MO1A 2R93B 4LF5L 5J22A 3CMAT 4A3KG 4M7DB 2I5MX 3W1GA 4ZKBB 3UATA 2B2VA 5ELCA 3RLOA 2LVMA 2X4WA 3OW2P 2EJ9A 2SNMA 5CBAE 4PQXA 3GBQA 3A8HB 1GHJA 4IUTA 1T3LA 5A0GA 4BWGB 5CK9A 4IPCA 1NEBA 1SYBA 2D62A 1NLOC 1Y96A 1SE2A 2CT3A 2PO4A 3JC66 3M3YB 4FF3A 3CC2Q 1X6BA 5I2MA 1FGUA 1TWCB 4LUZA 3GTPH 1K8OA 1QWYA 4M77G 2ZT9C 1RACB 2L0CA 3SK6A 4DR7Q 3JRZA 2E1HA 1B3QA 1I5OB 5IN1A 1PYSB 3PUVA 4OWXB 4MZTA 2G9HD 3EFRA 2K5HA 2FEIA 3PF5A 2UUCQ 3HHTB 2E5LQ 5GAOm 2OI3A 4GN4B 2HD3A 1QJOA 3NK9A 4LWCA 1LJOA 1M1FA 4OO1I 3PTAA 1CUKA 1EU3A 2ENBA 3MEHA 4K2LA 1PKTA 1F77A 4A3JG 1DD2A 5FWBA 3IKJA 2IHEA 2IX0A 3MP8A 3B6YA 2LMCB 4DV6Q 2MCNA 3UA7A 1H641 3C94A 2HDMA 5ELEA 2YWWA 1GFCA 2RJDA 1K0SA 4LDVA 1WCMH 2UUAQ 2NVQH 1PRTC 5C6SA 1HZCA 3BVMA 5CYUA 5IYCH 4R1JA 5GAN2 4M7DE 4M75G 4OELB 1JE5A 4ZCKA 5FU6C 3REAB 1RAGB 2K32A 3ULPA 3NGPA 1MMGA 4JCVE 1MMDA 1N34Q 3FEWX 4H0LC 4BY7B 4NDXA 4P71A 2QGFB 5EG2A 2AWNA 4JRPA 5E7NA 4LFCQ 1I4RA 2EGEA 1QLYA 2A19A 2GQIA 1VQ6Q 1N9RA 2V1QA 3H15A 2JA5G 1WJQA 4B3RQ 3BZKA 2WSEE 4FT4A 1C9OA 1BCPD 1NAPA 5A35A 4QVZA 1U5SA 2N49A 3L2QA 3KUFA 3CXCA 4DOVA 1NM7A 1ZUYA 3TMEA 1OYXA 2K5DA 3VYUA 4KUDK 3UI2A 3MZ5A 5IWAQ 5KYYA 3CW2C 2DZCA 2NN6H 4F7UG 2DGYA 1Q86R 2I2LA 1AWOA 2X6LA 5CO7A 1LCKA 2IVWA 4C92G 3JAML 2WKCA 4J9EA 2RKSA 3A8LB 4R9WA 2QI2A 1GUNA 1R0CB 4IURA 2RD1A 1F2LA 1Y1VB 2B8GA 4PMBA 1X3EA 4QJFA 4YWMA 5CC4A 1EYGA 1ZSZA 1RAIB 1OX8A 1PFMA 3J81c 5CKHA 4X66L 1VQLT 1WI5A 2FVUA 4ODGA 4KT0E 3H6MA 4LF7Q 5C5LA 5C4XG 4X64L 1TUCA 2ZXPA 2ZPIB 3CCSA 1BVSA 4KGZB 1VYVA 3CU7A 3RN5A 3OA6A 1RKNA 3PMIA 3R2IA 5IT9c 1A3TA 3NHHA 1W6XA 4X65L 2YRVA 5FO9B 3IL8A 3RNUA 1SDFA 4F14A 4ANJA 4O1NA 1BDOA 2G6FX 2L1BA 4E7KA 2KR3A 1HA5A 4WJWA 3H3VC 4L59A 1PC0A 5C5MA 3W5OA 1B53A 3RMHA 1DGSA 4HJAA 3BS1A 3QHSA 5A2QE 1C48A 1UJ0A 1SYEA 5D65A 2Q2TA 1I50H 1UG1A 2OJ2A 4I65A 1EWCA 4C3HG 3RN2A 2F0TA 4XQNA 5C4JB 4DKAC 3BE3A 1ICFB 1VQ5A 3S15B 2OTLQ 3V7CA 5EGTA 2P84A 3S1MH 1QW1A 4PL6A 1Y1WB 2C06A 4DR1Q 2W10A 4ME5A 3T51B 3MXGA 3CRLC 2E2HB 5HKCA 1SNPA 2MGSA 2DRKA 2QDLA 1ZX6A 4FCYA 1E24A 3EJIA 3K81C 5DM73 1VQOA 5FJ8G 3VS3A 2P4RA 3S9WA 3GTQH 1HXDA 1N27A 1HR0W 2HQXA 2QF7A 5D3IB 3MA2B 2VW9A 3CCET 3HG9A 3M85A 2XWJB 2BE5D 2Z0SA 2OAUA 4DV7L 1KD1R 1AH9A 1PRTF 3EG9B 3WVDB 4A3IB 3SHWA 1LT4D 4C5HA 5I4DA 2O9VA 1NG2A 4MZMA 3HOYB 2NVYH 3T1HQ 1SPKA 2PPBC 2O5JC 3MHXA 4BY1G 1SNMA 1Q7YR 1TWHB 3PT9A 2M0YA 4F16A 4OB0B 2CQOA 4HXJA 4JV5L 5J39A 2JN4A 2DUDA 1W2BS 2WSCE 3UPUA 1W70A 4DR5Q 2A74C 4HJ5A 3CCQQ 1PHJA 1D1CA 2DTOA 2C0OA 4M4ZA 1GFDA 4LNQA 2D0OA 1MSGA 3LLRA 1OPLA 3L2PA 2EYLA 2Y0SB 2QEXQ 3DUZA 3LWUA 2KT8A 1IW7C 5FROA 3NSWA 4X62L 3GTKH 2DLPA 1X69A 3OWEB 1JU5C 2M16A 3TZUA 3K5LA 1GUGA 2AHJB 3JCMQ 2ZAEA 2CP6A 8AT1B 1LTBD 2L8DA 2Z6KA 3H3VI 2H1EA 1VQNQ 1S5DD 4C0DC 4L5SA 2F0OA 4J8OA 2N8NA 3FPUB 2P0KA 5J3BA 4PZ7A 2JTEA 4M8AA 2XGTA 1TY2A 3FRPB 4EQNA 1M3AA 1KLUD 1TUDA 1RD9D 3EHQA 1STAA 1I4HA 2DYIA 3MWYW 1TWFH 4C3IH 1LNXA 2NWMA 2VQEQ 1TU2B 4FL6A 4F7XA 2F0PA 3HZXA 2HQEA 1N36L 2IX1A 1CI3M 1V29B 3G4ST 2CKZB 4KLKA 1TS5A 1OULA 4HIMA 3VS1A 2DAQA 2NUPA 5IY0A 5K36G 4A3GH 4JI0L 4EMKC 1G2BA 2M9VA 5GROA 2DYBA 4A3FG 3SWNB 1KABA 1P8LA 1G83A 1N8RR 1WGSA 2QQAA 3C46A 3CCLQ 1A2TA 1EY7A 3LWHA 2BDNA 3HFZB 1W3SA 1PZKD 1E2ZA 2ICEC 5ECAA 5J1ZA 2FJ2A 1SSHA 5CQYA 2Y0SE 3KJPA 4FYYB 1Y69U 2COWA 3IFDA 2RHUA 3S3NA 1YCYA 5I11A 3PMFA 1SHGA 3OYHA 3V8LA 4R4IA 4XQJA 1QP2A 4LF8Q 1OI1A 3CEYA 4L5QA 5JJIA 3LH0A 4LDXA 3M4OH 3F70A 4BE0A 2VNUD 2Q8IB 1JQYD 3FIFA 1B3AA 1WFQA 2E2DC 1QILA 1QVFS 3GTGB 1D0ZA 1LTTD 3A8OB 3NBHA 1A0IA 3PUYA 1NLPC 3FKIH 1Y96B 4ZK9B 3KYHC 3DLLA 5CKFA 2Y4XA 4CHTB 2LX9A 4C3JH 3VUZA 4EQPA 1NCVA 5EPJA 2KE9A 4AT1B 3WOEA 3PGGA 4MHEA 5FRNA 3HOUH 3M0SA 3GF5A 4JLIA 5H1SE 1UE9A 3JCMf 2DIQA 4NXNL 4QQ6A 3SXHA 1CSKA 1M8AA 3ICEA 4G7HC 3I56T 2RHYA 1PH5A 1ABOA 2SEBD 3JCMd 3CC2A 1UTIA 4E2FB 4KJOA 1T0HA 1QUQB 1EOTA 1M1KC 5C0XI 3PO2H 4YWKA 3J80i 2A6HD 3N52A 5FU7C 5KYUA 5L37A 2JA6B 2CHBD 4GNXA 2IPOB 2E3HA 2LRQA 1X75C 3KOJA 1D2BA 4OMQA 3DWPA 1EFWA 2K6DA 2GVAA 3HEJA 3M0QA 2YUQA 2D0QB 2B63B 2KA7A 1MGQA 2ZTEA 2K7VA 4CKEA 1VQ4Q 1HUMA 4JK1C 1STYA 1ILQA 1AEXA 3CPWS 2XU8A 4OWWB 1R77A 3DM1A 1WJSA 1LACA 3TZDA 2KDSA 4A54A 2K5NA 3X3MA 5BR8L 2ROTA 5GANe 2RNAA 3I4MH 3M0TA 1HR0L 1VQ8Q 1GL5A 4E7HA 3LX0A 3GD7A 3HOZG 1M8VA 2V4DA 5JAVA 2R92B 2MFIA 2HCKA 2D8JA 1SAPA 2A3LA 2CP0A 2LC4A 1U8RA 2EYHA 2HUGA 2RDHA 3RERA 2HZYA 3MO8A 3OW2S 1IL8A 2KHJA 3IFTA 2DJQA 1SROA 5KCHA 4XTVA 1QNKA 2EJMA 4FO2A 1K76A 1WTPA 2Q2UA 2K28A 5M5YB 2NUTA 5LJ3d 1EIFA 4FYWB 3JB9F 2BA1A 1VQ6A 5LMUL 4OMOA 3EGXA 1VQ5T 2FINB 2PUOB 5AT1B 2JW4A 1GUSA 1PSEA 1I4QA 5ELNA 4N0AA 3EG2A 4Y91A 3VS0A 1UGQB 2F5TX 3JV3A 1TWBA 4JUVA 4FU6A 5I21A 1BR9A 5DM63 3M9QA 2K05A 4A3DB 3CCRA 1RTNA 4HSPA 3H3VH 4PFZA 4BI8B 2XWBB 1OPKA 3SHLA 3OYAA 2QASA 4RMOA 1VQ7A 2CFMA 4GLAC 1CHPD 1GCPA 3A56A 4B3SL 2ATWA 2QA4T 2AKKA 3K58A 1AE2A 1GOZA 4A3EB 1PFNA 4K14A 4DAMA 4DOWA 3G71A 5LJ5j 4BE2A 4C2MB 3TREA 4JI5Q 3BW1A 5FKAC 3A55A 1S40A 2BH2A 2ZCFB 4TSSA 5CV9A 2KSSA 2X4JA 5I22A 1KDBA 3BY7A 4PJOC 2CW0C 2GBQA 1FD7D 4DAYA 2RB6A 1H3HA 3KF8B 3U50C 2F0LA 3VS4A 4BI3A 3OYGA 5LL6X 2DERA 1R4PB 1ILPA 2L9HA 4ATOA 3S2HH 5GMKm 5KGUA 2OAWA 4NS5A 2JS0A 4O5VA 3V8JA 1AWXA 3VJPA 1K8AC 1NUCA 4OEMB 4GLXA 4FYDA 2G5DA 2JA8G 3P20A 2ED0A 2E5QA 2JMAA 1DJ7B 3X25B 4ESRA 2J7ZA 1O7IA 3CC4T 4WJ3M 4HJ9A 4ZTFA 4BBSB 3HOVH 1YI2T 1M1KU 2O4XA 2ASBA 4QQGA 3OYIA 4M78B 2MQHA 3M4QA 5BN4A 1SBBB 2F69A 2HBWA 4ZN1A 3FVQA 4IUVA 4X66Q 4Q5WA 1G6PA 3RMQA 1GCQC 4Y52H 4X64Q 2BZXA 1VS0A 2C35B 5GAMe 2BOSA 3FHWA 3A1PA 3GTLH 4UC4A 3OYEA 1BCPB 1HZAA 1VIEA 5IYBG 4A3BH 4X65Q 5KEEA 1VQPT 5I2XA 2ZGWA 1XJVA 4Y28E 3NP8A 2E2JH 1OXXK 1FL0A 1V9PA 1K9MR 3MXPA 5I6WA 4DV2L 4BBRH 5CQXA 2OEOA 3LGJA 4PJMA 4DR2L 5GAN7 4OIKA 2ZJRA 5KH6A 3JCMJ 2X6GA 3BDOA 2ZPFB 2F0VA 1QZGA 1Z6HA 1VMPA 4K6LA 4M7DA 2FL7A 2HSEB 5FK9C 3M54A 1AZPA 2GCXA 1WZOA 4BY6B 2JXMB 4BY6C 1J5EQ 3VYHB 1UECA 2CP2A 2N3SA 4E7SA 5JVH3 1WLPB 2RDFA 5GANh 4J6HA 2IWHA 5K5PA 4GLVB 2PZUA 1YJ9T 2NZHA 3H0IA 4ZGEB 1ET6A 3HOXH 1OOTA 2XIDA 1QP3A 3ULRB 5GAN8 5IP9H 4K8IA 3S24A 3S1QH 3MKDA 5LMNL 3JB9H 3A74A 5CMDA 4M78E 1XPOA 4ZTJA 3U9OA 4DBRA 1VQEA 1YNJD 4DV7Q 3IAYA 2RCFA 4M1UB 3RLNA 2UUBL 4OMNA 3I4LA 3CD6Q 1S3OA 4RTTA 1X54A 2Z8LA 5BN5A 1SE3A 4DV0Q 3GTPB 4OMMA 3A8GB 4M77C 5D6WA 1T5EA 4K2KA 4DUYL 4C0GA 1VQBA 1C0MA 1ICWA 3AQQA 3CMAA 4JV5Q 2NUPB 1B9NA 1EIHA 3EGDB 1RIPA 3Q0AA 4YWLA 4E7IA 2CREA 2DXUA 1JJ2P 2DL7A 1Y14B 3UDIA 4ALPA 2XRQD 2CZ0B 2B2UC 5LHY1 4PJOF 3OHXC 4JS4A 1M3BA 2RA2A 3TP5A 4RTYA 1CT1D 4X62Q 2KK4A 4FIBA 1GRIA 3CC2T 1H3ZA 2OF1A 4F88A 3BYYB 3E9FA 1W6KA 3NTIA 1DCZA 3KFVA 3HOWH 2N78A 4BACA 1N33Q 1K8AU 2PNRC 1UHCA 1EOVA 4NPSA 1UUPA 5FO8B 3MAQA 1CZGA 3RBBB 1UB4A 1U3OA 2EQKA 2B2TC 1CFMA 2CVRA 5GJVB 1WCMB 1SEBD 3G1JA 4YHHL 2NVQB 2DK3A 2HL3A 3MTSA 4MTKA 4DAPA 5D6YA 2N55A 1D1AA 1U4RA 4ZQ3A 1A3UA 1A0NB 1DJRD 4K5XA 1ZXTA 1N36Q 2EW3A 4ULLA 3RNJA 5GAOl 1Q8KA 1PDQA 2A73B 5JEAG 2OTJQ 1DOMA 1IBLL 1KQSS 1ABQA 4C56C 2CP5A 1A62A 4UDUC 4JI0Q 2MPMA 3K57A 3GNFB 3S6WA 3DWAA 1Q12A 3HRZC 4DR4L 1M9SA 4XQ3A 1PVOA 1GUWA 2EGCA 4EPCA 1E7ZA 3E0JA 1Q90A 1IW7D 2VXWA 4HEDA 5DLOA 1WHHA 1OO9B 3PO3G 2A1AA 2QTXA 1A63A 1AHJB 5FLXL 2EYPA 4J1MA 5GAMh 2JXBA 1MI2A 3U58A 1RCVD 1IL2A 3S16H 3HGBA 5L23A 3I4NG 3JSCA 4WRDA 1U06A 2DJGC 3HSBA 5JOBA 2XI9A 4JBMA 5CBEE 2JSOA 3HFNA 1PH9A 2EFIA 4XTZA 2CP3A 4C92C 1VQ6T 3OMCA 1I5FA 3OBWA 2F0UA 2DY7A 2RQTA 3QZ5B 4EMHA 4X3TA 4XTCS 1K73C 3RUXA 3SGIA 1ZYRD 4RHRA 3HFOA 3L2UA 3QR8A 4RG1A 1H9RA 4LMQD 2RQVA 2RHQB 2WB1B 2FMCA 4JI1L 1SKUB 1WNLA 4ZGDB 5GMKe 1PTOC 1NYGA 3BJUA 1VQKQ 2VXFA 2NYSA 3P1HA 3SK8A 4MZPA 1ZBXA 3V7SA 2YT6A 1VQ7T 3CBPA 2JP1A 3AU7A 2RSOA 2E74C 1WYDA 1YN8A 4HVWA 4JRKA 3CCJQ 3TP7A 2K1BA 4CJ0B 2MJ8A 3G71T 2NVXH 3H0GH 2UXDQ 1WQ7A 5CV6A 3H09A 1UGVA 2VB6A 1SYDA 4E6RA 3V2TA 3L1AA 1OZ3A 2JOYA 3A98A 2R7FA 1VQMQ 2TMPA 2XSCA 3OOCA 1VUBA 1UHFA 1IGQA 2KROA 4NXNQ 2DX1A 2QGQA 4M77F 4L8JA 3E9HA 4J83A 4X9DA 2BTTA 3L2ZA 2DE0X 4KKSA 3T53B 1KNEA 1SSFA 2NUTB 4OMPA 4Z89A 1I4PA 1TXYA 2KNBB 3EG9A 2B3GA 4CKCA 3K59A 3C1EA 1JWUD 3S1MB 4LD9K 4JRQA 4HTHA 4F8MA 2B2WA 4X3UA 1LTSD 1GVPA 1BBWA 1VQ9Q 1QNUA 4JVZA 4OVAA 3THKA 3NFCA 4CDDC 3PUZA 3M7GA 3E6ZX 1HZ9A 1YBYA 3GTQB 3VS6A 2D6FA 2YRCA 4IUQA 4A4FA 4DV1L 4GN5A 4QB4A 1U4MA 5DAUA 2OTLT 3ZFJA 1PM3A 1OEBA 5BR8Q 1BIAA 1ZQ1A 2L3SA 1S5ED 3QO2A 3ZYYX 2JA9A 1HR0Q 3MHBA 4IFDH 3H9NA 1UJYA 1IKLA 3F2CA 3CXCP 4M75F 1OV3A 3JB9J 2F0FA 2NN6I 4UHVA 2NVYB 1YJNQ 3QB3A 3J80L 5EQ0A 4UPAA 5JPNC 1KTKA 4LFAL 4AG1C 2YUNA 2V26A 3E9IA 4LF9L 2BKDN 1VQJA 1TS4A 3EVQA 3M4GA 2H5XA 2YLCA 3R8BA 1DYQA 5CGKA 2KEDA 4MMKA 2PI2E 3W3AA 1EFNA 3EG0A 3INZA 3CCEA 1PWTA 4YCWA 4A93G 2YLBA 3OBYA 2F0DA 4EGVA 1YITQ 4DPGA 5IGGA 5LMUQ 1EWIA 4J7IA 2KCCA 4X3SA 3GTKB 3L0OA 4H02A 5LJ3j 4IN3A 5A2QL 1AFPA 2O9SA 3KBGA 1B4OA 4P2CB 3HS0C 3REBB 2AZSA 2HSPA 1D1KA 2VL6A 2JMCA 2QGGA 3QOJA 2HIXA 4F7UF 2R7ZH 2E3IA 4HA8A 1TS2A 3D0FA 2MIOA 5GAN5 3CCQT 2P0PA 2RQUA 4C92F 1VF7A 3T1YQ 1U1SA 1X9NA 1IGUA 1QKWA 1TS3A 3IRBA 3SWNA 3J7ZC 4B3SQ 1OXUA 1NJIR 2Z4IA 4JLGA 4B9XA 2AIRB 2YTYA 1I6VC 4C3IB 2XDDA 2VUMH 1H92A 2D1XA 1I4XA 5KYNA 2JYOA 1PTOF 3JCMV 3UF4A 1S5CD 2WAQG 1KG1A 5EC7A 4J9DA 3T9NA 1YIJQ 2VB3X 3CAMA 1VQNT 5GADC 2MHVA 2I0QA 5JJLA 1SEMA 2ENMA 6AT1B 4A3GB 4A3KH 4MIUA 2NTTA 1JO8A 1TU0B 4JRIA 1QMCA 1PFBA 2F3VA 5GMKh 4QQBX 1OU9A 3JCMb 2JZ2A 4JBJA 3M53A 3G4SA 1LT5D 2TSSA 2OWOA 4KY5A 1PYWD 4LDWA 3EFOB 3KF6B 4LUVA 4LXCA 3PVLA 3NQTA 1YNXA 5CV7A 3R6OA 4DAVA 3NHNA 2V8KA 2PQAA 1X43A 4OONA 1CKNB 2Y90A 3GP7A 3M4OB 1AZQA 2QQ9A 1HK9A 4RG2A 1WXTA 5GANg 3CCLT 2VQFL 2MP1A 4FW2A 4C8QG 1MSHA 3RZOH 1XX8A 2RI5A 1EX4A 5I9OA 1SYGA 3UWNA 3TBIB 2DIGA 2UXBL 1QUQA 4M7AG 4A3JH 1ARKA 2F0MA 3FKIB 4O42A 4O6JA 1JJGA 2HEQA 4DV2Q 4IJHA 3J81E 1N9SA 3FB9A 1GXDC 2NVTH 4C3JB 4CJ1B 4DR2Q 2PZWA 3ND9A 2I07B 2FZKB 3HOUB 2RQRA 5M5XH 3RKYA 1SRMA 1KQ2A 1PRTB 3GLXA 5IT9E 3K0YA 4H13C 4RTZA 2EGAA 5LJ5f 4LE9A 1WTWA 4DK1A 2XK0A 2RCNA 3KFUA 5FU6B 4JI8L 1WJJA 2BE7D 3I4OA 1UEBA 3PO2B 5LJ5d 2J6OA 1B34A 9ATCB 3C2PA 1E6HA 4OIJA 4HT8A 1T3SA 4M78D 4V190 2A28A 2K3XA 5EBDA 3X20B 2C0IA 1RTOA 2JA5H 4LN2A 1M27C 2ICIA 2P0QA 2K5VA 5LMNQ 2A6EC 4G4KA 3I56A 2RN8A 3DB3A 1I81A 2MNAA 3STBD 3SFMA 1Q8IA 2EYJA 2J4XA 1WA7A 1S5FD 1JXMA 2EVRA 4FYXB 1C6VX 2G9DA 5E4XA 3I4MB 1YEZA 2UU9L 2RF4A 1D5XC 1HFNA 5GAOr 3CCMQ 3PUXA 1EQVA 4DUYQ 3TU4K 1G2SA 1L0XB 4K11A 1RI0A 3PMTA 4RTUA 2XRSD 4E7LA 5DEHA 3TRZA 4G7OC 4IIOA 4ABNA 5KYWA 2LTOA 2OQKA 2GF7A 3F1ZA 5CORA 2ZJQA 4IFDJ 2PYKA 1WHGA 2K6AA 3EIVA 2EYZA 1T9HA 2KMTA 4X9CA 1BOSA 4POGA 2ZPBB 1PTOH 2QDBA 2BH8A 5C4XH 2PUKB 1ZSGA 3K7UC 4KV6A 4A3LG 1G51A 3CP0A 4ME3A 3GNGA 4O0AA 4XYQA 1VQ8T 2K5QA 2EKOA 3K5NA 2YUOA 4CC2A 2EPBA 5IXFA 2R6GA 2KHSA 2EPDA 3VR6A 1LPLA 4A3MB 3JCMg 2G3RA 5HK3A 1Y71A 5IGEA 4KHVA 4FF1A 1BYMA 2FPEA 4FXKC 4EQ5A 2D2CC 4YHHQ 2PZ1A 5GAMg 2J06A 3KF8A 5KNDA 2VGNA 4EDUA 4PMCA 2DKGA 1Q81R 4C3HH 2ZM6L 3MFYA 2K75A 3K7AH 2EKHA 1I07A 1DOLA 4DV5L 2Z4HA 1PD0A 2EWNA 2KXCA 2CUBA 1M30A 2M9UA 2JJ9A 1HQMC 2M00A 1JMCA 2DEUA 1B44D 3HKSA 2A68C 4J9IA 4OGEA 4DV3L 2XVSA 2EY2A 1RDPD 2H4OA 1VQFA 3I72A 3S2DH 1P16A 1NE8A 2WV6D 3H94A 4RKUE 4DFAA 5FJ8H 1WTQA 2DM1A 2JA7B 3S1RH 1V1CA 4M78A 4L5TA 1CQFA 1AD5A 2ESWA 3TVTA 2X69A 3JCMc 4JPBW 2QA4A 3NPFA 3D8GA 1ZEQX 2OX7A 3DEOA 1QKXA 5HURA 3S2HB 4QCLA 4N4GA 1YNNC 2GVBA 1X3QA 2XHCA 3E3XA 1QZHA 1IXRA 4LW1A 3F2UA 4DNRB 1FX7A 3NQIA 3VUBA 1UFFA 4BB7A 1X01A 5CVIA 4CGYB 4RG8A 2E70A 2KCNA 5JVG3 4BY1H 3HOVB 2E6ZA 3WVEB 1EL0A 1OU8A 4ZUJA 4JI1Q 3G6EQ 4QY7A 1LLRD 1SNDA 4J15A 4B3TL 3GTLB 1D3BA 3I5RA 3KJOA 1G3YA 4OB1B 1RAEB 4V2SA 1F9QA 3HKZB 4KKUA 2MK5A 4A3BB 3CCUA 1QG7A 3CC4A 2F0QA 1X2QA 4R4QA 1PH3A 5GMKl 4KULA 3D4WA 2E2JB 3QIAA 5C4ZA 1YI2A 1F9RA 4FYVB 3VS5A 1AWWA 4BBRB 2DPPB 4H44C 4AFUC 3AHUA 2CSIA 2XDBA 3K5MA 1TWAH 4C0DB 1Y0MA 1CSPA 5M3FG 5M3MG 2OQ0A 2LJ3A 2CWPA 1SHFA 1EQQA 1RAAB 2AUJD 4EQOA 2RA4A 3VYGA 2F0NA 5KRUA 2F0HA 5KYLA 5IYDG 2F4VQ 1VQPA 3OYBA 3RIRA 3X24B 3X28B 4D6WA 1F9SA 4A3CG 2HBPA 4JI7L 2K5IA 2X3XD 4MZ9A 4B3ML 3Q6SA 2WSFE 1KHCA 1YWOA 4ZRZA 4J7FA 1KHIA 1LVKA 2D5DA 1YVCA 3AFQA 2QW7A 4HCSA 1O7LA 1WTRA 3PVQA 3HOXB 4OO1G 1HPCA 5K36H 4HCCA 4JOIC 1I94L 4EMKB 1O7ZA 5C44H 1CKMA 3S1QB 4A3FH 3EGDA 1X27A 4IQZA 4DV1Q 3J81i 2B2UA 5C44G 3AT1B 1MMNA 2R5AA 1GO3E 1LTID 2I5HA 4IZ8A 4NXML 1AN8A 2A69C 1R9TH 1MNEA 1VMCA 3OYJA 3D4DA 1YJ9A 5KE3A 4PNOA 1JR0D 2EXDA 3HKZE 3HTRA 1XOVA 4LFAQ 1XJWB 1KC8C 4GKKL 2ZJPA 4LF9Q 3NUCA 4RCCA 5CKBA 1PG5B 2B8FA 1JORA 4A76A 3AFPA 3E1SA 3EA6A 2IT1A 3CQZB 2PVGB 2HDLA 3K0XA 5FLMG 5GAGC 4ZUIA 2KCMA 2DA9A 2DVJA 3VYRA 3CBMA 2R93G 2DBKA 3VRYA 1YIJA 3EFXD 2LCCA 3MEUA 3I91A 4M7DG 5GAN6 4BD3A 2MF2A 4II1A 2R61A 3CXCS 4JI6L 1KIXA 4HCEA 1MMAA 5G3LF 3HOWB 3KDFB 1B7YB 3LH5A 1HJDA 1WTOA 3M3YH 1UWVA 4LF4Q 2PQAB 1CKAA 1STGA 1KJWA 5GAHC 1CKBA 2HAXA 1ZKOA 1QQJA 2RHSB 3EQLC 3X3NA 4QF4A 3HP3A 4KD4A 4Y92A 3CKIB 5A0LA 1STBA 2KCTA 1PYBA 3TDQA 3S14B 1SMXA 2CGHA 2VXEA 1KQ1A 1K8AR 1AWJA 2L89A 5FU7B 2B86A 4PKCC 2LNHB 1Y8PB 2RHXA 3ERQA 4YY3Q 4DR3L 2M51A 3EN2A 2BCOA 3L42A 2VYTA 3U4ZA 3RR5A 2EJFC 4LF5Q 5D3DA 1C0AA 1J9OA 4CJ2C 4FNFA 1WHKA 3JB9I 1JRIA 4OB2B 1H8KA 4KH0B 4XK8E 4KY7A 4QVDA 3PIPA 2K03A 4DA2A 2NZ1D 1CK1A 3NELA 2M0OA 3U4VA 1FNUA 1EY4A 2F1LA 5KYXA 1B34B 3E2UA 3TSWA 3HOZH 4KUIA 4LFBL 5IODA 1IYVA 1HNXL 4A4EA 2LDMA 3E9GA 1HQRD 2F52A 3BVGA 3P75A 1VQCA 4KN7C 4BY7H 1IHVA 2O31A 3O5ZA 2PI2A 2IX3A 1OX9A 2I5LX 4BY7G 3G6JB 4QW2A 3NEMA 4AFQC 1O9SA 1YNZA 1EWHA 2F3IA 3VKIA 1UGRB 2COZA 5LJ3f 1CM9A 1VQIA 3DMUA 2UXBQ 1S72Q 4C0FA 1IRXA 1QWFA 1L1OC 2KUMA 5IGDA 4RTVA 1VIFA 3OS2A 4POFA 2MWPA 2HD0A 3C1FA 4HSVA 2KJXA 1VQLQ 3NBIA 3I90A 4RH6A 4JBKA 4A93H 4DUZL 5GJWB 2NVXB 3H0GB 3SDZA 4B9WA 5DNFA 4KHPL 5HK0A 1X2KA 2Q8RE 1LYLA 3M0PA 5KYWB 5E1FA 3BDUA 1GBQA 3K6OA 3JAMc 1KC8U 2I0NA 1VQKT 4EVOA 3BG3A 2K2MA 4AQYL 4R8NA 3NMZC 1N8RC 1GXIE 1CSQA 4JI8Q 3CCMA 4QIWB 1TOVA 4LNPA 2LNVA 3CCJT 1A3VA 1Y1VG 2IJ0A 2RI2A 1E2WA 1LOJA 3H6ZA 2LSSA 4E7ZA 1PRLC 3DM3A 1O7YA 4KK7A 1E3PA 2RHZA 1YJWQ 2JTMA 4PJOB 1AW7A 1RHPA 3QWYA 4N4HA 1VQMT 2RJEA 2X4YA 1JWMD 1RF2D 2L11A 2PW7A 3GP8A 4Z9CB 4J9GA 1IBML 3M4YA 3VS2A 2COYA 1K9AA 3FPPA 3UDXA 1KXLA 3A5ZB 2VB2X 4HKEA 5CV4A 4PJJA 1NEGA 4DNTB 1DONA 2DNCA 4WCIA 4U673 4WF2A 3HPWA 1K3RA 1ZSZC 1UEAB 2E10A 1UNSA 3ZJYC 2UU9Q 4FF4A 2EQJA 2P5ZX 4WORA 2JA8H 3L9AX 2ZPHB 1WQWA 4FXDA 2B8AA 1VQ9T 1SN8A 1G6ZA 3CCUT 4BA2I 3TN2A 1UE1A 1PH8A 1EUJA 1STHA 1PRTD 4I7ZC 1HNZQ 2K14A 2NB0A 1O80A 4KRTA 5C3EB 1Y1WG 3FDTA 3JCMe 1K0XA 1CQVA 1SYFA 2RDGA 1VQHA 2PVDB 4DR6L 4DV4L 3X26B 4KGXB 1ML0D 1WJRA 2MPXC 2OTLA 5IYBH 1MV3A 2K57A 2L3PA 2AQ1B 1PZJD 2LXKA 3EH2A 1A2UA 3QDRB 4RTWA 1TQOA 4QIWE 4AYBB 3VR5A 1YJNT 4RGNA 1B8AA 3ULLA 3O8VA 3EAEA 3GTMH 2ZXRA 3OYYA 1GBRA 1X3GA 4E6IA 2E76C 1F2YA 1TS9A 2IL8A 2K5WA 2R7ZB 3D31A 4KD3A 4A3IG 4F04B 2YHTA 2ZTCA 2W0ZA 4PJOE 4QQDA 2VY3A 3LGLA 3HOYG 5KNBA 4DBHA 1D8LA 1JOQA 1QVCA 1YITT 2KBNA 4DV5Q 2X4XA 5GMKi 4DR7L 5GAEC 2OCEA 2VUMB 1D3BB 1M3CA 4DA4A 1YHQQ 1M1GA 2RM4A 1M90R 8ATCB 1I8FA 3NTHA 1EY0A 3BDCA 5C6AA 4DV3Q 4HIDA 2EYWA 3EFOA 3M0UA 3KF6A 3J7AF 1AZGB 2Q8TA 3Q8DA 3OYNA 2LXJA 2Y0SG 5AFWA 1FR3A 5EPKA 3OYCA 4S3SA 2DMOA 2GFAA 3BZDB 3CBOA 4PG3A 1BBZA 3CCQA 4A3KB 3EG1A 1QWEA 1M4VA 1CKNA 4QL5A 4A53A 4PZ8A 2F5KA 2QEXA 1FNWA 3VDYA 2EYOA 2QQRA 3GTOH 5GAOn 1MHWC 1K28A 1TIID 2RSNA 3U23A 2RBMA 4IFDI 1MIUA 1YIJT 3JCMX 1N8RU 1Z9FA 4XQQA 3SD4A 2K79A 4AYBE 2JVVA 3I70A 2HMAA 1VQNA 1IBKL 2Q2IA 4G57A 4GZYC 4M77B 2XG8D 5C0XG 1EIGA 3FC3A 1SFOH 2AKLA 3Q24A 2FPDA 1HSQA 2YDLA 3QIIA 4LAAA 4N9PA 2PZTA 3MCAB 1UE5A 3BYTB 3F2BA 2LT1A 4C8QC 2E2IH 1G3SA 3CQTA 2Z6KC 1KSWA 1NPPA 1K8MA 2A68D 4B3TQ 3RZOB 3NWTA 4C0ZA 1R4QB 1MUZA 4M7AC 5DY9A 1NE3A 3VA7A 4LDYA 4BXXG 4JJDA 4A3JB 3OB9A 1G5VA 1FJGL 1ZBJA 1QVGA 1NBEB 2F2VA 1CHQD 5I2YA 2M2LA 1CKOA 4J6XA 3D6WA 4FSXA 3QDFA 4RKBA 2KECA 3CCVQ 1DZ1A 4L6V5 5HY6A 4JI4L 5M5XB 3L2WA 1YNND 1R0BG 2ROLA 1HYOA 3V7RA 3CCLA 2KRSA 1Q82C 4OHJA 4EIKA 1U9RA 4IOCA 5IXBA 2FB7A 1BQQT 1WHMA 1H9SB 1VF5C 4M75B 1EY6A 3UE0A 1IYJB 4M75C 2M1HA 1FWZA 4JI7Q 5JEAH 2EY1A 1IB8A 4B3MQ 1HNWL 2P4TA 4A4IA 3C4SA 4IIMA 3L2VA 1NY4A 4BDZA 3FRNA 3MC0B 1BKBA 1Q46A 2PU9B 4X6AH 2JA5B 1TT2A 2L5QA 4Z88A 2VZAA 4GOPB 2CZ6B 2D8HA 1SF9A 3A0JA 2RF0A 4GOPC 4M77E 1SNQA 1QCNA 3I5SA 3JCMh 3S17H 1I6HH 3PO3H 3AYHB 4DF7A 3M56A 4IKFA 1JJCB 1K0RA 4Y7NH 4K0KL 4PJNA 1ASYA 1YHBA 1KDAA 1PH4A 1M5Q1 4ELZC 1HTLD 3I4NH 2EAYA 4F7UB 4GKKQ 3ERSX 2XDPA 2PVOB 1YZ6A 4RKLA 2MOXA 4C92B 3GQBA 3VR3A 1PMRA 4YCUA 5C4HA 1K9MC 1JE4A 4P75A 5ELFA 4KI0A 5JPMC 2LJ0A 2E12A 1QCBD 3OWFA 3CCSQ 5EKLA 3A8MB 1D1IA 1BCPF 1I5LA 2HT1A 1OXTA 2JA6G 2XTIA 3T56B 1PTOB 3J81L 2KOLA 5C4XB 2VV5A 2A7YA 5LL6S 1TVXA 2B63G 1M2OA 3TS2A 3CCMT 4JI6Q 3M9BA 1FYCA 1JOKA 2E41A 5KYXB 1EY9A 5IT9L 4F87A 1YFNA 3U9SA 3J81j 1BBXC 1D6EC 1JWSD 2R5MA 5LJ5g 3JB9D 3H41A 3ER0A 4ZNXA 1VQ4A 1IREB 1EZ6A 2DNEA 3TS0A 1VQ5Q 2EY6A 2Z1CA 1X3PA 2EOTA 1DM0B 2YTXA 5D6XA 1NMFA 2A69D 4KGVB 2R92G 2NYZD 2Z6BA 4C3HB 3FLGA 3K7AB 2GGRA 1I50B 2ED1A 1V1PA 1JQQA 1VQ8A 1Y8OB 2FHTA 3R3OA 1GM5A 1OQKA 2HHHL 2HIVA 2VUBA 1VQOQ 4C8QF 4NP5A 4DGZA 4QUFA 3SVMA 1I1JA 2J6KA 3OIQA 4N4IA 2EY5A 3GPLA 4F7UE 1T5XD 1B1ZA 4JG2A 1HXYD 4M7AF 3OSOA 4RCBA 1XMQL 3H0FA 3ONAB 1JB7A 3S2DB 2JK8A 4C92E 2AQ2B 4LF6L 2F2WA 3S1RB 4PFOA 3I55Q 4A3DH 1K1ZA 5A0DA 3RKWA 4A3DG 4PV1C 2WB1E 3GTJH 1N5ZA 1HH2P 1PD1A 4JZ4A 1Q82U 4K5VA 2GN5A 1SJHD 4HMJA 1P92A 2Z0WA 2A5HA 4ZYSA 2L4NA 1U1TA 3MXNB 4FXGC 4C2MH 2RQWA 2O88A 1E1TA 1CA6A 4BY1B 4A3EG 2JEAI 2IY5B 3BDLA 4R56A 2DILA 1LTGD 4P5NA 4R0KA 2EVBA 1JT8A 4GLMA 3RDVA 5GAMj 4DEXA 3M59A 2JEBI 1BB9A 4N0AC 1DOKA 1QB5D 3VYTA 1X55A 5C0XJ 4KKTA 1XNIA 4ME7A 1SSOA 2DBMA 3ZBDA 3EG3A 5IP7G 1CA5A 1TY0A 3SR1A 2DL4A 3RESA 1PH6A 4DR4Q 1R8OB 1UUEA 4AG2C 2EYYA 3D7SB 1MGSA 5E3FA 4DUZQ 1D5MC 2X3WD 1KLGD 5COYA 4HCBA 4KHPQ 2IG0A 1Z7TA 5HGTA 2CDTA 4UP7A 1D09B 1L0YB 4N8X1 4JOIA 1TWAB 1B70B 3G6ET 4H7BA 4EMKA 4AQYQ 2LQKA 2CWAA 1WX6A 2QTVA 5C3WA 1D0XA 3C3LA 1K9MU 2DRMA 1GKHA 4XTUA 3G7LA 4ID6A 2XIWA 2ZXOA 2FRYA 4BBSG 4JDSA 4QKUA 3DXJC 4IJLA 2FMMA 1K73U 4NB3A 4OGQC 4PLIA 2MYSA 1RADB 2QEXT 4M78G 3LGFA 3PSIA 5AJ3L 1TWFB 4A4GA 2X35A 1KK7A 3NE5B 2JNGA 3E19A 1Q3LA 1ZA1B 2VC8A 4C1NI 4CDCC 1AT1B 1B7TA 4HVVA 4JJNK 3V96A 1LABA 3M7NA 2LQ8A 5D7UA 1GD7A 1QE6A 1IBMQ 4X1VA 1AP0A 5JEAJ 4CDFC 2PMZB 4A3FB 2KAFA 1W4SA 1RUWA 2XMFA 4RGTA 1SNOA 1M2VB 2L12A 2RPNA 4JJBA 1HFGA 2OT2A 3MEWA 3R93A 3KXTA 1XTDA 3OY9A 1SE8A 3OIPA 1EQRA 1GUOA 1R9TB 2M02A 2FG0A 3ULJA 4J9FA 2VVKA 3MVVA 4NL3A 3GO5A 1BI1A 5M5WH 3KDFA 2EYQA 1T0JA 3LX7A 3RKXA 1SRUA 1GHKA 2O2LD 2R57A 5GAN4 3HL8A 2Q2HA 2F0SA 2HKQB 1OXSC 1VQDA 4DR6Q 4X34A 3V05A 3V8KA 1B07A 1YHQA 1W2BA 2QDYB 4CC7A 3GV3A 4A63B 1OZ2A 2VQFQ 1B50A 3ME9A 4M7DC 5EPLA 5EBCA 2O5IC 1X56A 4NW2A 4VUBA 1HHVA 1WD0A 2KYBA 2NUZA 2H8HA 4PJOD 2CW0D 4AIMA 4CBVA 2ID0A 1BIBA 4YCVA 1YHAA 4JBWA 4V0BA 1U0LA 3N6RA 2ABLA 2CH4A 3HP9A 2V1CC 4R4CA 4RTXA 1G8XA 2CSQA 4HR7B 4ORZA 1NMGA 2EJFA 2QKIC 3NWSA 4XT3B 1NR4A 4RHSA 4QGUA 1S1NA 2VGMA 3QJYA 5FLXE 4ILWA 4J6YA 4LD6A 5GAOq 4OMFB 5ISRA 2RVLA 2PMZE 1EU4A 2QQBA 1LO5D 3CD6A 2A08A 4HIKA 2LS01 4PFPA 2E6NA 4B08A 1PH2A 4IPGA 4PJLA 1U4LA 3CC7Q 1V1QA 3PNWC 1MJEA 2J7IA 2D9UA 3KUPA 2FRWA 4C5GA 1QOHA 1HCZA 3PCOB 5IH2A 1EQTA 1J8IA 5FOBB 5ELDA 1TKWB 2KVMA 4PK4A 3VYSA 3DKMA 1KFZA 3R6NA 4J9BA 1RODA 1WXBA 3F8TA 1WVLA 1RABB 2EBPA 4DBFA 1L1OA 1SLJA 1ENCA 1WCMG 1W6JA 2UUBQ 3CCVA 1HJPA 1IBKQ 1U5KA 2E65A 3S1NH 5D14A 3CMEQ 3TP6A 1E6GA 5IYCG 3HOZB 3M0RA 1W1FA 2QQSA 1WIEA 1GUTA 5GMKj 4DEYA 4GKJL 3TCJA 3FMCA 5BN3A 4JI5L 2L3RA 1ONLA 2LZ6B 1Y8NB 4JI3L 4DK6C 1VQ4T 3KLRA 3OQ5A 1S5BD 2HNIA 3E0EA 4OXPA 4A3LH 1NJIC 2HCIA 2FZCB 1K83H 1TR5A 2WP8J 4BS9A 2AK5A 3HRSA 3CF5A 2CZ7B 1K3BC 1WXUA 2DD4A 2F0KA 1XNRL 4LUDA 2OTJA 1C4QA 1KDCA 1FJGQ 2DF6A 1QVFA 2ZPGB 2SEMA 3CCRQ 4HIOA 1XQHA 1SRLA 3A5UA 5FLXc 1J6QA 1UGPB 3AEVA 4A93B 2YXYA 1VQ7Q 3WXMB 4L6TB 4JI4Q 1Y7XA 4XTWA 4PJOA 1V8QA 2IW3A 1UE7A 2NN6G 3C0CA 5CKEA 3G71Q 2JTFA 3I35A 4QVCA 1KNAA 4BUGA 2ECZA 2UXCL 1JJ2S 1WPYA 1S72T 1ZLMA 1MJCA 1F2ZA 2ALYB 1WTHA 2F0IA 2DNUA 3J80E 2LX7A 1HNWQ 4M77D 4CI0C 2WB1G 3FEOA 1JB0E 1IBLQ 2L3QA 1JXOA 4FSSA 1ENAA 1I3QH 1O75A 3VV0A 4M7DF 4C8QD 1TUGB 1KIKA 4DU9A 3TQ7P 1TWGH 5C3XA 1YNJC 1A6XA 3TEEA 1KC8R 4J6WA 2K50A 2KY9A 1VQKA 1RAFB 4MMLA 5IAYA 3PIOA 1MNDA 2HKNA 4M7AD 3SK5A 3J7YW 4DNIA 5KE2A 3WWVA 3PIP3 4K0KQ 2QEJC 3OS1A 1V1OA 4D8KA 1GCQA 2YSQA 4PMWA 1VYTA 2CZ1B 3CPFA 3CPWA 3CCJA 1V1PB 3LYIA 2JA8B 3L3OC 3QYGB 5M9OA 4JYAL 2K3YA 3C95A 2KGTA 2QILA 3EBEA 1YJWT 1TSFA 1E1OA 4CRIA 3I2ZA 1J5EL 1XTCD 2DN8A 1VQMA 4DN4M 2JE6I 4BA1I 5LJ3g 1HZBA 5CR3A 4IPDA 4M75D 3I3CA 2WKDA 3MEFA 1VA7A 2DVEA 3ASKA 3EFSA 1U4PA 1RLPC 2KXDA 2K4KA 2C9OA 2SOBA 3PV0A 2MWOA 4NL2A 3OW2A 3A54A 1IO6A 5LJ5e 2YU9H 1I0CA 3VU3C 4LUOA 1XNQL 1HUNA 3URGA 2GTJA 3BFMA 3UT1A 1G291 3GV6A 1SYCA 1Z9QA 3LWEA 4XU3A 2F03A 2FO0A 3OW7A 3RD4A 4RCNA 3A7AB 2HQHA 2RI3A 2CS7A 1D1BA 1VQ9A 1OXVA 3DHQA 3GTMB 2B2YC 3UDFA 4KMUC 1ZUKA 2MMPA 3I55A 1M1KR 5FW9A 3KLSA 4HN7A 3KLSX 1STNA 1F1BB 4WTOB 2EJGC 2BDOA 3J80c 3PUWA 5M3FH 2B2WC 3KLWA 1L0WA 1MBYA 1JCKB 3NTKA 4D8DA 4DV0L 5M3MH 2AKWB 1AOJA 2JUFA 1JC7A 5IYDH 2JM9A 2HHHQ 4L5RC 4A3CH 2WINB 4C92D 2RH2A 2DJFC 3EROA 1YJNA 1ENFA 2DEQA 1ESFA 1NJIU 4DK3C 4R8IA 2V1RA 1XMQQ 4OWTB 1Q86C 2JQOA 4OO1H 4KN4C 2QAZA 1V76A 2EQUA 3EGUA 2RK1A 2X9HA 4M77A 5GANf 5GAN3 1PTOD 4LF6Q 3UE1A 5CCAA 3G48A 3BZCA 1KQSP 1N33L 3M55A 5I9PA 1HNZL 5GANd 4C8QA 2DFUA 1YITA 2QK0A 2H3EB 1BCMA 3S3OA 5IGBA 4RUGA 1YP5A 1YHQT 3GIBA 1RL2A 3OMGA 4M7AA 3GTOB 1G91A 1X3FA 4TVAB 3CMAQ 4XTYA 1QCFA 1KL9A 1ZYRC 2EQSA 1C8CA 3HRUA 5CR2A 2GNCA 1E22A 3G7ZA 4C3IG 2OXPA 4HCKA 4NMZA 2C0TA 1SFOB 2B2TA 5FO7B 1WD1A 2BZYA 3PE0A 1DXMA 5FLMH 4UP8A 2FYKA 3RZDH 4UY8C 2EZVA 4GBQA 4EMGA 2E2IB 2N88A 1H9SA 1Q81C 4WJ4A 4HCZA 4M75A 1VQAA 2R93H 4A3GG 4JS5A 4FDBA 4RA8A 3SWNC 2A36A 3CD6T 2RO0A 1XMOL 5IHKA 5GQOA 1SJED 2Z9HA 3OYKA 3H8ZA 3I73A 3URYA 4QUCA 2H3JA 4PNYA 3DB4A 4C5IA 2LY7A 1G2TA 3TEHB 4GOPA 3QBYA 2YV5A 3Q22A 1LUZA 3ZEHA 1TWCH 4P72A 1PRMC 5C0MA 4OP0A 2RK2A 3PF4A 1O78A 4FT2A 2XKOC 5AJ3Q 1SNCA 3UA6A 3DWQA 4OX9L 3J7AV 3A8IE 2B2VC 1KD1C 4ZLTF 1IXDA 4F7UA 2AWOA 2DL3A 3JAME 3OTOL 3CCVT 4C92A 3L2RA 2E4HA 4BE1A 2PQEA 1IZ6A 2AUKA 3WOFA 1JICA 1D7QA 2CP7A 3FKIG 1A8VA 2RJFA 3UDCA 1BU1A 2EQIA 1Q7YC 4G7ZC 1L2FA 2UXDL 3HRTA 3S17B 1VCIA 4C1NK 1ASZA 3PO3B 1I6HB 4I7AA 4Y7NB 3EHRA 4C3JG 4DXGA 1EIYB 5LJ5h 1KRTA 5IGCA 3HOUG 3I4NB 4Z02A 4ZN3A 3R2TA 4XYOA 3RLFA 3MFGA 3S16B 2EYXA 1FMVA 2KENA 2OTJT 2XN9C 5CAIA 2F0GA 2GFUA 5GAMf 4EX5A 2GTOA 4GY5A 5HGQA 2Y4YA 1EFID 3JCMP 3BU2A 3PO2G 2F0JA 2B29A 5LMNW 5GAMd 3C12A 3TSZA 2GA4B 1LTLA 3NENA 2O01E 5CIUA 1Q86U 2C5CA 3TP8A 1N32L 1V43A 4J5YA 2DD5A 5JJZA 1SMYC 2YYZA 3OYFA 3CC7A 1SE4A 1PH1A 2J05A 1K8GA 2J0TD 3OPOA 1L1OB 3LNNA 2AQ3B 5EKKA 1ZUUA 4NKLA 5T1GA 4UP9A 3OYLA 3MXUA 3MEVA 3DLMA 1H9MA 3TSSA 2KEEA 1WDXA 1N6AA 3QUIA 3IQLA 2ZZDA 4TKOB 3CCST 1QVGP 1EYAA 4XIGS 1AZEA 3I4MG 3L7ZC 3FDRA 3RUZA 4GLKA 2EDGA 2RMOA 2D0NA 3MPUB 4KTAA 5TSSA 2IPKD 2JT4A 3CMEA 1CZWA 3J7A5 1Y1VH 2LP5A 3VR4A 1H9KA 4N9TA 3SK4A 1B9MA 4HJ7A 5CV5A 3T4AC 2JS2A 1NYFA 1Q81U 4J9HA 2KYMA 3FP9A 1KQSA 3MXNA 3N5BB 5KYYB 2NWGA 4A3MH 3M58A 1IYUA 2BA0A 4FF2A 5CKDA 4M7DD 1PFSA 1QVPA 2V8IA 4A3MG 3QG1A 4O2DA 5T1IA 2F0WA 2AHOB 2LQNA 1LM0A 2A8VA 2F4IA 2FPFA 3RR6A 3GTJB 1VQOT 1ZSZB 3I8ZA 2LQWA 3OSSC 1FNVA 3T1YL 1S4ZA 3ND8A 2R3ZA 1PZID 3PQIA 1UDLA 5C4JH 2BE9B 4IUPA 3CCEQ 1LTAD 2K04A 1WTXA 4GKJQ 2YTVA 3S15H 1LT6D 1PA6A 2DJZA 2K9GA 2PQWA 3M57A 1KD1U 1Y1WH 4JI3Q 4KHZA 2DXTA 3QPHA 3I55T 1RI9A 2KBTA 3BVZA 4X3KA 2E2HH 4AFZC 1WYXA 2LT4A 3W1BA 4PLLA 1ACMB 5FRMA 2JA7H 3GOXA 5DLQE 2XD0A 5KIXA 4OB3B 1XNRQ 1Q82R 2AMCB 4IPHA 4JI2L 2JA7G 5FWCA 1Q7YU 2CKKA 4R4OA 2DXCA 1VOMA 1AVZC 2L5TA 1PH7A 2KT1A 3P8DA 4ZGJB 1H95A 1Z47A 4E47A 4MNOA 4CC4B 2A6ED 1C1AA 5IIFA 1WHLA 4A3IH 3PFSA 3VR2A 1M4ZA 4FP5D 3HOYH 2FFKB 2L15A 1B2TA 3OYDA 2UXCQ 3SE0A 1VDZA 3I9QA 2ES2A 1X6OA 2L2PA 2ZM6Q 3HOVG 1M2VA 2LMJA 1TWHH 4YTLA 2R7DA 4M78C 4ZKCB 5JJKA 4FW1A 1BNZA 2ATCB 3QZ9B 4J8QA 1ESRA 1EYDA 4APVA 2WAQB 1N9WA 4JZ3A 3FJ5A 5KYIA 2UUCL 2E5LL 5CV8A 2KRMA 2E64A 2LCLA 1BCPC 2YRDA 3JCMW 1J3TA 4K6DA 2B39A 3F2DA 4A3BG 3G6EA 3HKZG 2WFWA 3STBC 4LK1C 5IGFA 1GJXA 2RJCA 2CCZA 4DK0A 4Z8AA 3G4SQ 1G3TA 1HTPA 3OYMA 1E0BA 4DV6L 2FHDA 1K73R 1XPUA 1PCXA 4BBRG 1MV0B 2KI7A 3QXEB 5LJ3e 2KVQG 4IUNA 4JYAQ 1QCOA 2UUAL 2NLUA 3I7FA 3T16A 2K4YA 3K8AA 1E2VA 2ZTDA 3WDNA 5C0XH 1Z9ZA 2R58A 5M5WB 4KBMB 4DBQA 1JBMA 2MUYA 5IHIA 2L55A 4JW0A 4TVRA 1WI7A 4R55A 1AE3A 1N34L 4IALA 3ZL7C 2HQLA 2KQ3A 2LFNA 4LFCL 4BDYA 3JAMi 4XU1A 4C8QB 1XNQQ 2X51A 2PNIA 2WIIB 3HOXG 4L5GA 3D3RA 4B3RL 2SDFA 1UE6A
chains in the Genus database with same CATH topology
3P8HA 4M7AB 5IP9G 4BXXH 2BIVA 3JB9G 3K80C 4A4KA 5DM7R 4LDUA 4IUUA 2WAQE 1ZHIA 4ELYC 5IWAL 1BBUA 3PGZA 1XPRA 3CQZH 3UDGA 2CYZB 1OTCA 5GAOp 4LF7L 3GTGH 5ELOA 1I94Q 4P74A 4TQUS 1C7YA 3MEAA 1HNZQ 1I4K1 3HOWG 3OSVA 4GS3A 4XU0A 4PZ6A 5GANj 4XTXA 4BI4A 4RMFA 5AYFA 3QJ6A 4C8QE 3CC7T 4NXMQ 4HT9A 1KRSA 4M7AE 4A4HA 4M78F 3NBHB 3S14H 4MTNA 2KQWA 2MAMA 1TH7A 2JA6H 4DR1L 3MP6A 4XAXB 2FXQA 4JC0A 4NOYA 4MDWA 1MKHA 2B63H 3LW5E 1XMOQ 3CMET 4M75E 1M90C 3Q1JA 3QSUA 4AH6A 4GNXB 4GNXC 3T1HL 2R92H 2D9TA 2WACA 2E8GA 5LJ3h 4OX9Q 3CCRT 3SB2A 2DO3A 2DXBA 3OTOQ 4DR5L 2DZ9A 3MP1A 5L8RE 5M5YH 2K52A 4P73A 3P8BB 4DR3Q 2D0PA 1S72A 3H0GG 3M5AA 4FM4B 1VQGA 1VQLA 4A75A 2DTIA 2KHIA 2JN0A 2PNHA 1NBWA 4DQ2A 3QYHB 2K5LA 4LFBQ 1HNXQ 2F4VL 5KCOA 4A3EH 2ZPEB 3OS5A 4OGCA 5J26A 2VQEL 4C5EA 2EJGA 4IOAA 1N32Q 4GN3B 1NTGA 1NPRA 5IP7H 3QKJA 4PJOG 2EQMA 2RHIA 5I2SA 3LWIA 2QXFA 3GDEA 3FJPA 1YJWA 2NZOA 2K2VA 2V8JA 2MI6A 4BBSH 2K5FA 4XU2A 1JJ2A 4DAYB 1BI2A 5C3EH 1PV4A 4E7JA 1BI0A 1G3WA 2BUDA 5C3EG 1MHNA 4LF8L 3QO3A 3OS0A 1WOCA 1SR3A 3TQYA 1KAWA 2JJQA 1NZ9A 2XICA 2EIFA 1QVGS 4IO9A 1M90U 4AYBG 2DTHA 4R4TA 2MO0A 4MDXA 1FVIA 2O4XB 4LF4L 2R7ZG 4HJ8A 1Q1BA 2GQVA 1Y07A 5EAYA 3RMSA 3META 2VUMG 2IHFA 1BI3A 1UGSB 1X65A 1FXXA 1PSFA 3S3MA 2VS1A 4DV4Q 4OF1A 3M4PA 5IE8A 4YY3L 1Q1EA 4JI2Q 2MO1A 4LF5L 3CMAT 4A3KG 4M7DB 2I5MX 3W1GA 3RLOA 2LVMA 2X4WA 2EJ9A 3A8HB 4IUTA 5A0GA 5CK9A 4IPCA 2D62A 1Y96A 3JC66 5I2MA 1FGUA 3GTPH 4LUZA 4M77G 4DR7Q 3JRZA 2E1HA 5IN1A 1PYSB 3PUVA 4OWXB 4MZTA 3EFRA 2K5HA 3PF5A 2UUCQ 3HHTB 2E5LQ 5GAOm 4GN4B 4LWCA 1LJOA 1M1FA 4OO1I 3PTAA 1CUKA 4A3JG 2IHEA 2IX0A 3MP8A 3B6YA 4DV6Q 1H641 3C94A 2RJDA 4LDVA 1WCMH 2UUAQ 2NVQH 5C6SA 1HZCA 5IYCH 4R1JA 5GAN2 4M7DE 4M75G 1JE5A 5FU6C 3ULPA 4JCVE 1N34Q 4P71A 5EG2A 2AWNA 5E7NA 4JRPA 4LFCQ 2A19A 1N9RA 3H15A 2JA5G 1WJQA 4B3RQ 3BZKA 2WSEE 4FT4A 1C9OA 4QVZA 2N49A 3L2QA 3KUFA 3CXCA 4DOVA 1OYXA 4KUDK 5IWAQ 3CW2C 2DZCA 4F7UG 2DGYA 2I2LA 5CO7A 2IVWA 4C92G 3A8LB 2QI2A 4IURA 2RD1A 4QJFA 1X3EA 1EYGA 4YWMA 3J81c 5CKHA 4X66L 1VQLT 1WI5A 2FVUA 4KT0E 4LF7Q 5C4XG 4X64L 2ZPIB 3CCSA 1BVSA 3RN5A 3OA6A 3PMIA 5IT9c 4X65L 2YRVA 3RNUA 4E7KA 4L59A 3W5OA 1DGSA 4HJAA 3QHSA 5A2QE 2Q2TA 1I50H 3RN2A 4DKAC 1VQ5A 3V7CA 3S1MH 1QW1A 4PL6A 2C06A 4DR1Q 5HKCA 1E24A 3K81C 1VQOA 5FJ8G 3GTQH 1HXDA 1N27A 1HR0W 2HQXA 2VW9A 3CCET 3M85A 2Z0SA 2OAUA 4DV7L 1AH9A 3WVDB 4C5HA 4MZMA 2NVYH 3T1HQ 3MHXA 4BY1G 3PT9A 2CQOA 4OB0B 4JV5L 5J39A 2DUDA 1W2BS 2WSCE 3UPUA 4DR5Q 4HJ5A 1PHJA 2DTOA 4LNQA 2D0OA 3LLRA 3L2PA 5FROA 3GTKH 4X62L 2M16A 2AHJB 3JCMQ 2L8DA 2Z6KA 3H3VI 4C0DC 4L5SA 4J8OA 2N8NA 2P0KA 5J3BA 4PZ7A 2XGTA 4C3IH 1TWFH 1LNXA 2VQEQ 4FL6A 2IX1A 2HQEA 1N36L 1V29B 3G4ST 2CKZB 4KLKA 4HIMA 2DAQA 5IY0A 5K36G 4A3GH 4JI0L 4EMKC 5GROA 4A3FG 3SWNB 1P8LA 1WGSA 2QQAA 3LWHA 3HFZB 1W3SA 5CQYA 2Y0SE 3KJPA 2RHUA 3S3NA 1YCYA 4R4IA 3OYHA 3V8LA 1QP2A 4LF8Q 1OI1A 3CEYA 4L5QA 5JJIA 3LH0A 4LDXA 3M4OH 3F70A 4BE0A 2VNUD 3FIFA 1WFQA 1QVFS 3A8OB 1A0IA 3PUYA 3FKIH 1Y96B 3KYHC 3DLLA 5CKFA 2Y4XA 2LX9A 4C3JH 3VUZA 3PGGA 3HOUH 5FRNA 3GF5A 4JLIA 5H1SE 3JCMf 2DIQA 4NXNL 4QQ6A 3ICEA 1PH5A 3I56T 2RHYA 3JCMd 3CC2A 1QUQB 5C0XI 1M1KC 3PO2H 4YWKA 3J80i 5FU7C 4GNXA 2LRQA 3KOJA 1X75C 1EFWA 2GVAA 2D0QB 1MGQA 2ZTEA 3CPWS 2XU8A 4OWWB 1WJSA 2KDSA 4A54A 2K5NA 5BR8L 3I4MH 5GANe 1HR0L 4E7HA 3GD7A 3HOZG 1M8VA 2MFIA 2A3LA 2LC4A 1U8RA 3RERA 3MO8A 3OW2S 2KHJA 1SROA 5KCHA 4XTVA 2Q2UA 5LJ3d 1EIFA 2BA1A 3JB9F 5LMUL 1VQ6A 1VQ5T 2PUOB 5GAHC 4A93G 1PSEA 5ELNA 4N0AA 4Y91A 5I21A 1UGQB 2F5TX 4JUVA 4FU6A 3M9QA 3CCRA 3H3VH 4BI8B 3OYAA 4RMOA 1VQ7A 2CFMA 4GLAC 4B3SL 2ATWA 2QA4T 1AE2A 4DAMA 4DOWA 3G71A 5LJ5j 4BE2A 3TREA 4JI5Q 3BW1A 1S40A 2BH2A 2ZCFB 2KSSA 2X4JA 3BY7A 4PJOC 2RB6A 3KF8B 3U50C 4BI3A 3OYGA 4ATOA 3S2HH 5GMKm 4O5VA 4NS5A 3V8JA 3VJPA 1K8AC 4GLXA 2JA8G 3X25B 2E5QA 1DJ7B 1O7IA 3CC4T 4WJ3M 4HJ9A 4ZTFA 3HOVH 1YI2T 1M1KU 2O4XA 2ASBA 4QQGA 3OYIA 4M78B 2MQHA 3M4QA 2F69A 1G6PA 4ZN1A 4X66Q 4IUVA 4Q5WA 3RMQA 4Y52H 4X64Q 1VS0A 2C35B 5GAMe 3FHWA 3GTLH 4UC4A 3OYEA 5IYBG 1HZAA 1VIEA 4A3BH 4X65Q 1VQPT 2ZGWA 1XJVA 4Y28E 2E2JH 1OXXK 1FL0A 1V9PA 4DV2L 4BBRH 5CQXA 3LGJA 4DR2L 5GAN7 2ZJRA 5KH6A 3JCMJ 2ZPFB 1QZGA 4M7DA 2FL7A 3M54A 2GCXA 4BY6B 4BY6C 1J5EQ 3VYHB 2N3SA 5GANh 4GLVB 1YJ9T 2NZHA 4ZGEB 3HOXH 2XIDA 1QP3A 5GAN8 5IP9H 3S24A 3S1QH 5LMNL 3JB9H 3A74A 4M78E 1XPOA 4ZTJA 4DV7Q 1VQEA 3RLNA 2UUBL 1S3OA 1X54A 4DV0Q 3A8GB 4M77C 5D6WA 4DUYL 4C0GA 1VQBA 3AQQA 3CMAA 4JV5Q 1RIPA 4YWLA 4E7IA 2DXUA 3UDIA 1Y14B 4ALPA 2CZ0B 4PJOF 4JS4A 2RA2A 4X62Q 2KK4A 4FIBA 3CC2T 1H3ZA 3E9FA 3NTIA 3HOWH 2N78A 4BACA 1N33Q 1K8AU 1EOVA 4NPSA 1UB4A 2EQKA 4YHHL 2DK3A 5D6YA 1N36Q 1Q8KA 5GAOl 5JEAG 1IBLL 1KQSS 1A62A 4JI0Q 3GNFB 3S6WA 1Q12A 4DR4L 1M9SA 4XQ3A 1PVOA 4EPCA 1E7ZA 5DLOA 3PO3G 2A1AA 2QTXA 1A63A 1AHJB 5GAMh 1IL2A 3U58A 3S16H 3I4NG 3JSCA 3HSBA 2XI9A 4JBMA 3HFNA 1PH9A 2EFIA 4XTZA 4C92C 1VQ6T 1I5FA 3OMCA 3OBWA 4XTCS 3QZ5B 4EMHA 1K73C 3RUXA 3SGIA 3HFOA 3L2UA 4RG1A 2RHQB 4JI1L 1WNLA 4ZGDB 5GMKe 3BJUA 2VXFA 4MZPA 1ZBXA 3V7SA 1VQ7T 3CBPA 1WYDA 4JRKA 3G71T 2NVXH 3H0GH 2UXDQ