3ER0A

Crystal structure of the full length eif5a from saccharomyces cerevisiae
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
146
structure length
146
Chain Sequence
DAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the full length eIF5A from Saccharomyces cerevisiae
rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords Eukaryotic translation initiation factor 5A-2
total genus 14
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3er0A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3er0A02
3TEHB 1N34Q 4BBSH 5IP9H 3ULLA 4DV5Q 1K9MU 1UWVA 3J80c 3KDFA 3PO3G 2A19A 4LF7L 2BA0A 3H0GG 4LF5L 1R9TH 2NVTH 1YBYA 1L1OB 1L1OA 1NTGA 2ZJRA 2QEXA 3M4QA 1QVGA 4YY3Q 2K50A 4Y7NH 5AJ3Q 1IYJB 5LMNQ 3P8BB 2QA4T 2IX1A 1N32L 5IP7G 5C4XG 2PQAB 4HIDA 3CCJT 4A3BH 1PYSB 1CKNA 5M5XH 2Z6KC 3NENA 1W2BA 2MWPA 2E5LL 1M1KC 4JI4Q 2MQHA 1EQRA 3G48A 2KCMA 1M90C 3CC2T 5GROA 4YWLA 2IY5B 2RHSB 4JI1L 3CC4T 3G71T 5FLMH 5LMUL 1UE5A 2WB1G 4EX5A 3FP9A 2NZOA 4LNQA 4BBRG 2VQEQ 1J6QA 3FKIH 5IYDH 4A3CG 5IYBG 1RL2A 4A3MH 1Q81U 3CF5A 3CCET 1QVFA 4DAMA 5IYCG 3HOUH 4KI0A 1XPUA 2QA4A 4OXPA 4KHZA 3KDFB 1QVGS 2KVQG 2LSSA 3CAMA 1XJVA 4JI0Q 2ZTEA 4A75A 4LF8L 5DLQE 1FJGL 2VUMG 1YHBA 2UU9L 1XMQQ 3EBEA 2E6ZA 2MO0A 3CCLT 2B63G 2FXQA 3PO3H 4GKKQ 5M3MG 3KJOA 2N78A 1I94Q 4DR6Q 2V1CC 1B8AA 3I4NG 4JV5L 4IOAA 3UE1A 3S1RH 4LUZA 1VQGA 4JI0L 4LF7Q 1VQ7A 3DM3A 1VQ4A 1TWCH 3PUXA 2B29A 3CMEA 3U4VA 4IJHA 4YTLA 1E1OA 4GLVB 3BZCA 2JA8H 1A63A 1YNXA 5IP7H 5C4XH 2ZTDA 3F2BA 4DV5L 3KYHC 1XNIA 1VQPT 1P16A 1Q1BA 2CKZB 4PZ6A 3PO2G 4JBWA 1I3QH 3NELA 2MO1A 1WCMG 4TVRA 1SMXA 1WFQA 3RLOA 4LUVA 5IY0A 2KBNA 3NBHB 3S1QH 3S14H 1LM0A 4X62L 2EIFA 5LL6S 4L5SA 1Q82C 4DR3Q 3CC2A 2YTVA 1HZ9A 1TWAH 2BH8A 4JI2Q 5H1SE 2JNGA 1JJ2S 1K8GA 1KQSS 1VQLA 1VQAA 2IHEA 5LMNL 4DR7Q 1N32Q 1VS0A 3GTJH 4H02A 2VNUD 3I56A 1Y14B 3CW2C 3KLWA 5IYCH 3HOYH 2R93G 2G3RA 4LW1A 4WJ3M 1TWHH 3CP0A 4LF5Q 3PIPA 1VQ6A 1UE6A 1HR0L 5M3FH 5C0XG 1AH9A 3S2HH 3CQZH 3CMAT 3CMAA 1YEZA 2WB1E 4DV2L 1Y1WG 1HNXQ 4JI6L 1XNQQ 4A3JH 4HIMA 2ES2A 1KRSA 1G291 4NXML 2XGTA 2JA6H 4JV5Q 1VQHA 4A3IG 2JQOA 3K0XA 3CCRA 3S2DH 1VCIA 3RR5A 5C3EG 4BA1I 4MNOA 1EYGA 3CC4A 4OX9L 1XMOQ 1VQLT 5IYDG 4X62Q 4UPAA 1N36Q 1KHIA 2I5LX 3ULJA 5C44G 3J81c 4DV7Q 2JUFA 2R7FA 3PCOB 2KHJA 2YYZA 3AEVA 1K73U 4IFDG 1JE5A 1X56A 1X3EA 3CC7A 1GO3E 4DV0L 1YHQT 5K36G 2D0OA 2Z0SA 4AYBE 1IL2A 1WI5A 4BY7H 2MFIA 3CCUA 4JYAQ 4B3RL 3E0EA 3PUZA 3F8TA 4JI3Q 1EUJA 3K8AA 4LWCA 2DO3A 1VQEA 2NN6I 1JJCB 3KBGA 1FVIA 1Q7YU 1QVFS 1MKHA 4JI8L 1PH6A 2OTLT 4C3JH 3HOYG 2ZJQA 3CCSA 4APVA 2MWOA 3J81E 5GAHC 1XNRQ 1N9WA 4MTNA 4IPCA 3H0GH 1UEBA 4R4OA 4GOPA 2F52A 1KIXA 1OXTA 3J7ZC 4ZN3A 1NY4A 2VY3A 4A3FG 1IBML 2D62A 1MIUA 2K4KA 4P71A 2E2IH 5LMNW 1PH5A 2UUBL 3CCUT 3I55A 2ZJPA 3TS2A 5JEAJ 4DK6C 4EQ5A 2JA7G 1QUQA 3TS0A 2WP8J 4A3BG 5EAYA 4JI7Q 1X65A 4DV4L 2JA5G 1I6HH 1GD7A 2EXDA 1X3FA 3STBC 3HKZG 2R93H 4DV7L 1N36L 4R4TA 1CUKA 1FGUA 1Q1EA 4A93G 1U5KA 3WWVA 3J81i 4HIKA 1LTLA 1TXYA 1VQ7T 3PV0A 4GOPB 4AQYQ 4A3JG 1PH7A 1M1KU 2A1AA 2AHOB 2NVXH 4LFBQ 4QY7A 1QVCA 1NZ9A 3W1BA 4O0AA 5C0XJ 3OW2S 1PH1A 3AQQA 1ASZA 1WYDA 3ERSX 3M85A 3UE0A 2IX0A 4X66L 1HR0Q 1E1TA 3ICEA 4PZ7A 2E2JH 4X6AH 2UXDL 5JEAG 4KHPQ 1HR0W 1K8AU 2VUMH 1PH2A 3M7NA 3G4ST 2YTXA 1HNZQ 1A0IA 2VZAA 1YJ9A 5FLMG 4DR7L 3GTOH 5DM7R 1WOCA 4NB3A 2VQFQ 3HOZH 3CCEA 1SN8A 4JBJA 4R4QA 5GQOA 4HJAA 4A3FH 1JT8A 1EIFA 1PH4A 1CKOA 1XPRA 5GADC 3T1HQ 3RZOH 5FLXE 2R6GA 1L1OC 2WAQE 4YHHQ 3HOXH 4GOPC 1MJEA 2A8VA 2CWPA 2PI2E 1GM5A 3AYHB 3CXCA 1PVOA 3GTQH 1PH8A 3KF8B 3IRBA 2I5MX 2ATWA 4C3IH 2E70A 3LGJA 4JBKA 3PO2H 2F4VQ 5A2QE 1XTDA 1YVCA 4GLAC 3W1GA 1YITA 2R92H 1IZ6A 2LVMA 3E9IA 4JG2A 4O2DA 4X66Q 1KXLA 4A3IH 3M4PA 1IBKL 2E8GA 2AMCB 4BY1H 2YTYA 2IT1A 4DR6L 4CRIA 5IP9G 1V9PA 2OWOA 5J3BA 3H3VH 3I56T 4R1JA 5JJLA 4AQYL 3W5OA 1B70B 4X64Q 3ER0A 1VQNT 1YZ6A 2UUCQ 2UXBQ 1FJGQ 1A62A 4LF8Q 1BBUA 3F1ZA 1K0RA 4IPGA 4DR3L 3S16H 1SROA 3STBD 3DLLA 1KRTA 3I4MG 1K3RA 4A93H 1YI2T 1HZAA 4DUYQ 4MZ9A 4LFCQ 3KF6A 1Y1VH 4DV4Q 3S1NH 4BXXH 1BBWA 4TVAB 2VQFL 4Y52H 2ZM6Q 1VQIA 1K83H 3B6YA 3FHWA 3KOJA 3RZDH 3G4SA 5ELOA 2UUBQ 3CMET 5M3FG 4KHPL 3A5ZB 3L2PA 4A3EG 3I4NH 1T9HA 1IBLL 2K5HA 1HZBA 3CCMT 1TWFH 1I94L 1VQKT 3CD6T 1WJJA 2L15A 4JCVE 3JAMi 1JJGA 4B3ML 2ASBA 3CCST 3HOUG 1YHAA 3PF5A 4LF6Q 1PHJA 4OWXB 4OWWB 4GN3B 2MI6A 4IJLA 1KL9A 1X9NA 1Q86C 1EWIA 4HJ8A 2CQOA 2I0QA 3OW2A 2JEAI 2JA5H 1PFSA 4PMWA 1VQDA 2B63H 2LCLA 4QJFA 2PI2A 2RCNA 2N8NA 2K5NA 2VQEL 4POGA 1QZHA 5IAYA 1NMGA 4HJ7A 4X65Q 5GAEC 1N8RC 1X3GA 4R4IA 1B7YB 4HJ5A 2LXJA 1KD1U 3I55T 1K8AC 1HJPA 2YV5A 3I4OA 2KDSA 1PYBA 2JVVA 1VQNA 4PG3A 4YWKA 3TRZA 3DB4A 1VQMA 3BZKA 1J5EQ 3U50C 2NVYH 4XTCS 4JBMA 1YJWT 4BXXG 1VQ8A 3HOWH 4DUZL 3JAME 3UDFA 3F2CA 2UXDQ 3BJUA 1FL0A 2RHQB 4TQUS 1SE8A 1V43A 4X64L 1VQJA 2MNAA 1H95A 3GTLH 2LXKA 3GDEA 4QQDA 4DKAC 4LF4Q 4YY3L 4NXNL 1HNXL 1XNQL 5GAGC 4JI6Q 5JJKA 3LH0A 4JI8Q 4C3HH 1SSFA 3JAMc 3OTOQ 1EQQA 5J26A 4JI5Q 4OO1G 1HNWQ 1NPPA 1GKHA 1LYLA 3GO5A 1S72A 3AFQA 4ZN1A 3UDXA 5IT9c 1GVPA 3EIVA 4QL5A 4A3DG 1VQMT 1LUZA 1Y1VG 3U4ZA 2OTJT 4L5TA 3CC7T 1X6OA 4YCVA 1PA6A 2D0PA 1X55A 4LFAQ 4JI2L 1M90U 1ASYA 4OX9Q 2R7ZH 1C9OA 1SFOH 3OYYA 4YHHL 4LUOA 4UY8C 1NJIU 3I7FA 4LF9Q 4ALPA 2ZTCA 1KQSA 3M3YH 1QUQB 1XMOL 1YJ9T 4A4IA 1D8LA 2HIVA 4X65L 1OXXK 1I5FA 4DPGA 3GD7A 4GS3A 3KFUA 3HOZG 1KD1C 3GTKH 4BY1G 5HY6A 1A8VA 1VQOA 3CCVT 3CPFA 1VQCA 3PUYA 4DV2Q 4A76A 2DGYA 3PGZA 3RLFA 4A3KG 4UP8A 4JI5L 3H15A 4IOCA 4A3GH 2GN5A 1NPRA 2VL6A 3CPWA 2AWNA 1OXSC 2KHIA 3PUWA 4DR1L 3J7AF 2GVAA 2Y0SE 3DB3A 2JOYA 3HOVH 2R92G 4B3MQ 1YJWA 2LQ8A 2N49A 4DR4L 1P8LA 1K73C 1IBLQ 1YJNA 1CKNB 2B3GA 4YCWA 4P74A 2PQAA 1VQ9T 4A3LG 3A5UA 2H5XA 4QQBX 1TWGH 2N3SA 5C0XI 4RG1A 2Y0SG 1K9MC 3KF6B 2KENA 4R4CA 3T1YL 3L7ZC 3F2DA 1PH9A 3G6ET 3G6EA 1N33L 3H3VI 4KLKA 1AE3A 2CWAA 1S72T 2NVQH 2BH2A 3CPWS 1D7QA 2UXCQ 1YI2A 2NZHA 3CCJA 2Z6KA 3CD6A 5HGQA 3PUVA 4YWMA 1UE7A 4QIWE 1L2FA 4NPSA 4GN4B 1XPOA 1RIPA 1KC8C 5FJ8G 1VQ5A 3S17H 1YIJA 1JJ2A 4J15A 3ULPA 1W2BS 1PH3A 2OQ0A 2IHFA 1XMQL 1U0LA 1G6PA 4RG2A 1Q46A 4DNIA 1IBKQ 5BR8L 2JEBI 1C0AA 2CCZA 3CCMA 1E7ZA 2OQKA 1Q8KA 4JYAL 3JC66 3K7UC 2ZM6L 4DV6L 4K0KQ 4GNXA 4DR5Q 1VQFA 4UP9A 2RF4A 3TQYA 3RNUA 2E2HH 3S24A 3HOWG 4LF9L 5C4JH 1Z9FA 2CFMA 1L0WA 5IWAQ 4JI4L 4DV3L 4YCUA 2E5LQ 1PV4A 1OXUA 2YU9H 3NEMA 4IPHA 5M5YH 4UP7A 3G71A 4HJ9A 2UUCL 2UXBL 1NJIC 2XHCA 1VQ4T 1OXVA 4DV6Q 3A74A 3M9BA 4QGUA 2HHHL 4B3TL 1YIJT 1E3PA 4NXMQ 4WJ4A 2C35B 3M4OH 1VQKA 2QGQA 2VS1A 3FKIG 3I2ZA 5IE8A 1HNWL 3MEFA 2EQSA 1JMCA 4JOIC 3HOXG 3OTOL 2UUAQ 4B3SQ 1UE1A 2JJQA 5BR8Q 2UUAL 4B3SL 2AWOA 3J7A5 2KCTA 1CKMA 2Q2IA 3HKSA 3LGFA 3HFZB 2DUDA 4PZ8A 1Q82U 5FLXc 4LF4L 1VQ5T 1CSQA 3RN5A 4B3TQ 2K14A 3I4MH 2QEXT 2HQLA 1N34L 3A0JA 1VQOT 4BBRH 5M3MH 2AKWB 1Z47A 4P73A 1CSPA 4DV3Q 4IFDI 1V1QA 5IWAL 4C2MH 4DV1L 1MJCA 4GKJQ 2K75A 3T1HL 4JOIA 3ZJYC 2Q2HA 3AFPA 4A3CH 3BU2A 1Q12A 1SR3A 4DR5L 2R7DA 4K0KL 4DR2L 4A3KH 2NN6G 4JC0A 5IT9E 2R7ZG 1HNZL 1N8RU 1VQ9A 1NBWA 2VW9A 2Q2UA 1SLJA 4OONA 5ELNA 5JJIA 1HH2P 1KAWA 3CCLA 5IYBH 4A3MG 4LF6L 2JA8G 3S1MH 4HIOA 4DR4Q 4LFBL 1EIYB 3VDYA 5E7NA 4GKKL 3S15H 2HIXA 2PNHA 1BKBA 1E22A 3GTGH 1Q81C 4DAYB 3MXNB 2UU9Q 4GN5A 4A3EH 1BVSA 3HOVG 1VQ6T 2XTIA 2UXCL 4IPDA 2OTLA 3CCVA 2ALYB 1E24A 4B3RQ 3J81j 1WCMH 3GTMH 4L5RC 4IO9A 3J80i 1EFWA 4ME3A 3J80E 1Q7YC 1N33Q 4DR2Q 3T1YQ 2I5HA 3K80C 2IG0A 2JK8A 4FDBA 4AH6A 5LMUQ 3U58A 4JI1Q 1OTCA 4JI7L 4LFCL 3PSIA 4DUYL 4BBSG 3RN2A 3UDGA 1YHQA 3UDIA 3PF4A 4DV1Q 4GKJL 1NE3A 4A3GG 4OO1I 1DGSA 2ID0A 3LGLA 2K5VA 1NMFA 2PMZE 1Y1WH 1YJNT 1C7YA 1IBMQ 1AE2A 4A3LH 2CKKA 2L3RA 2F3IA 2Q2TA 2OTJA 5M5WH 4POFA 3KJPA 2JA6G 1S3OA 4L5QA 4RMFA 4GLXA 3GTPH 3PIOA 1G51A 3CXCS 1SRUA 2WFWA 5C3EH 5AJ3L 4GNXC 1XNRL 3CCRT 3CCQT 3CCQA 1VQBA 2JA9A 4AIMA 1HZCA 1I50H 4DR1Q 4A3DH 5FJ8H 3HKZE 2WAQG 1Q86U 4DK3C 3SGIA 4X34A 5C44H 4P72A 2K52A 3K81C 2BA1A 1W3SA 4JI3L 3RLNA 2JE6I 1JB7A 4NXNQ 2F4VL 1M1GA 2OCEA 3D0FA 1EOVA 3EN2A 2HHHQ 3TREA 1YITT 3L0OA 4OWTB 1QZGA 1KC8U 4DV0Q 4BY7G 1X54A 3Q8DA 4AYBG 2HT1A 1VQ8T 4DUZQ 1IXRA 4P75A 3E9HA 1J5EL 4XIGS 4IFDJ 1VQPA 1O7IA 3K7AH 2GVBA 4GNXB 4BA2I 1S40A 4LFAL 3D31A 2JA7H
chains in the Genus database with same CATH superfamily
4Z89A 2X4XA 1HQRD 5IP9H 4DV5Q 1K9MU 2X4YA 4DEXA 5KYWA 4J7IA 3KDFA 3PO3G 2E41A 1NYFA 1STNA 3P7JA 3G71Q 2KXDA 4F7UF 4M7AG 1YWOA 3H91A 3H0GG 4OELB 5TSSA 2FPFA 1I5LA 1RADB 2QEXA 1NTGA 2ZJRA 1QVGA 3I4MB 1B2TA 5AJ3Q 2QA4T 2EYXA 1SMYC 1QVGP 2XMFA 5D7UA 4HT8A 2A74C 2PQAB 3SXHA 4A3BH 1LTSD 1M3BA 2VKNA 2G5DA 3PVLA 2E5LL 4Z02A 1M1KC 5FROA 1RHPA 2NB0A 4HCBA 4C92G 2HCCA 3OWEB 5IGFA 1X75C 3LWEA 1E2ZA 2JJ9A 2EY6A 1JXOA 1S72Q 1UEAB 3G71T 1PD0A 2ECZA 2CP5A 3LLRA 4XQQA 1H641 1J3TA 3V8LA 1UE5A 3FP9A 4AT1B 4RKBA 3P8DA 4KRTA 2R5AA 2F2WA 3OYEA 4A3MH 1Q81U 3CF5A 3FKIB 2RK2A 3OYIA 2E2HB 3CAMA 2ZTEA 1JRIA 4HCEA 1AN8A 1RD9D 1DJRD 2JTMA 4C8QG 2AIRB 2JSOA 2UU9L 3LYIA 2MO0A 3NQTA 3EA6A 2DEUA 1SPKA 4RHRA 3MAQA 4V2SA 2V1CC 1EY5A 3CCLQ 2GCXA 5KE2A 5CAIA 3CRLC 4C8QC 3EHRA 1LTTD 1EYDA 1OQKA 4LUZA 3PUXA 1VA7A 1B34A 3CMEA 3U4VA 2BTTA 2M02A 1E1OA 4OGEA 3G6JB 3MWYW 1EEFD 2RO0A 1WA7A 1YNXA 4J9IA 5IP7H 4DV5L 3UA6A 1XNIA 1P16A 4PZ6A 1Q1BA 5C3WA 2EQUA 1GUNA 3OMCA 1I3QH 2MO1A 1WCMG 3K6OA 4TKOB 1Y69U 1BOSA 2KEEA 5A0LA 1Q90A 2DJGC 1SHGA 4A3EB 3S14H 2DX1A 3M5AA 1LM0A 3TSZA 4KHVA 3IQLA 1M8MA 1UGPB 2JTEA 1Q82C 3CC2A 1I81A 1ZQ1A 3RIRA 1PFNA 1HZ9A 2DA9A 3UATA 1TWAH 4FNFA 2JNGA 3GTMB 4KK7A 1WNLA 4E7HA 4P2CB 2F5KA 1VQAA 1BO0A 3UWNA 4RH6A 5DEHA 4DR7Q 1VS0A 4C3JG 3A98A 1N32Q 4EPCA 5GAN5 1Y14B 2O31A 3CW2C 5IYCH 1UTIA 1RI9A 3J7YW 3HOYH 2R93G 4DAYA 2J6KA 4M78D 3CP0A 4JJBA 3TSSA 2JTFA 1UGRB 3HP3A 1HR0L 3MEVA 2A68D 1YI2Q 3E9FA 1JICA 3CQZH 3CMAA 5I9OA 4DQ2A 2YU9B 4OMLA 4HIMA 4OIJA 1PKSA 4NXML 1QP2A 4A3IG 3EFOB 2JQOA 2HSPA 4UHVA 1Y0MA 3S2DH 1VCIA 5C3EG 4DGZA 3UI2A 1TTHB 4OX9L 3OYKA 1KQSP 1VQLT 4X62Q 2DK3A 3FDRA 5C44G 2HQHA 1BBZA 4DBRA 2LP5A 3GNGA 3CCUQ 2CVRA 1WGSA 1K73U 3HG9A 1JE5A 1EFID 2RD1A 4EQNA 3CC7A 1GO3E 4QUFA 1MSGA 1PMRA 1SNQA 1M2OA 1IL2A 1WX6A 4C0GA 5IH2A 1LCKA 3PT9A 3DXJC 4C3HB 2YT6A 1EUJA 4A3GB 2PVOB 3K8AA 1JJCB 1WIEA 2LJ0A 1QVFS 3R2TA 2OTLT 4HT9A 1E6GA 2ZPBB 4J9FA 3J81E 5GAHC 1N9WA 4H7BA 1JB3A 1A15A 3MTSA 2K2MA 1UEBA 2RSOA 4R4OA 3RKYA 2FINB 1SNDA 3A8IE 1OXTA 2M0YA 3J7ZC 4PJOD 4GOPA 1OZ3A 4A3FG 3A8GB 3DUZA 2R92B 5CKBA 4PJOA 1PTOB 5LMNW 3TS2A 3I55A 2SEBD 4A3BG 5LHY1 2JA7G 1S5BD 5EAYA 4JJDA 5C4ZA 1WTHA 5JPNC 4DV4L 1QVFP 4TRDA 5KNBA 2DVEA 1BI2A 2L1BA 4DF7A 2P0QA 4CJ0B 2AQ2B 1KQ2A 4MHEA 1WTRA 2DYBA 4X3KA 5LJ3j 4R4TA 3QYGB 1Q1EA 3VV0A 2LCCA 3C46A 5C0XH 1RUWA 3SR1A 4C92C 3VJPA 3WWVA 5KYLA 1TXYA 5D6WA 2DBMA 4GOPB 4A3JG 3RKXA 3GTOB 3RERA 1M1KU 2OT2A 1SEMA 1D5XC 4LFBQ 4QY7A 1QVCA 4O0AA 1S1NA 3OW2S 3H8ZA 2JS0A 4FW2A 2DLPA 4OP0A 1GBRA 2IX0A 2A3LA 5JOBA 1K8AU 3I55Q 2VUMH 2PYKA 2XDBA 1T5XD 5HK3A 3KLSA 1HNZQ 3OYGA 1YCSB 5LJ5f 2HUGA 4NB3A 2VQFQ 4C92B 4J9GA 4R4QA 1W70A 3HOYB 2L3SA 5K36H 1EIFA 2KECA 1PH4A 5M3MB 2K3XA 2FZKB 1M27C 3LX0A 2OTLQ 4NKLA 2X6GA 3FPUB 3HOXH 1MJEA 2PI2E 1X69A 3OW2P 1FMKA 1YNJD 3LWHA 3TN2A 4NL2A 1PVOA 1D1AA 2RJEA 4F7UE 5LJ5h 5FLXL 3H0GB 3LGJA 2ESWA 3HHTB 1YWPA 4CDFC 2ZT9C 5A2QE 5HK0A 1D09B 1YITA 1IZ6A 1ILQA 2LVMA 4K8JA 3SK8A 1IBKL 2GF7A 4C92F 3Q22A 1VYUA 4RCNA 3HOWB 4DR6L 1KFZA 5J3BA 2F0LA 4FF1A 1H9JA 5KH6A 3EH1A 1UECA 3ER0A 3GTGB 3VR6A 2UXBQ 1FJGQ 4LF8Q 1BBUA 4DR3L 3DLLA 4PL6A 2JN0A 1XX8A 4HCCA 4YIJA 1IHVA 2B8AA 4A93H 2QYZA 2E5KA 1Y1VH 2FZGB 1XYIA 2F2VA 3SD4A 2XNAC 5E4WC 2PW5A 3ULRB 3B6YA 4HCKA 2D6FA 1SYDA 1LO5D 4OF1A 2K01A 1V8QA 4BI4A 2ZXRA 2PU9B 1HZBA 2J05A 4NL3A 4R0KA 4BB7A 4KKUA 3CD6T 2Y0SB 4RKUE 2CSQA 3F70A 4LE9A 1O9SA 5CYUA 1U5SA 8AT1B 1PHJA 1ZKOA 4OWXB 1E2VA 4KD3A 5JJZA 4OWWB 1KL9A 4LJZC 3M7GA 4HJ8A 4M75F 2I0QA 2CQOA 4R9WA 2XD0A 1PFSA 2E5QA 4PMWA 4QJFA 4K2LA 3GV3A 1TWFB 4E47A 3L3OC 1XJWB 2XIWA 4I65A 4X65Q 3P8HA 1A3UA 5GAEC 3SHLA 1AVZC 2YV5A 2F0HA 1Y1WB 3CEYA 2MK5A 4YWKA 3DB4A 1GHJA 4BXXG 2NBFA 1YJWT 1J9OA 3ME9A 4ZGJB 3UDFA 4DUZL 3F2CA 1AP0A 4TQUS 2FO0A 2F0PA 4XK8E 3GTLH 5L8RE 3GDEA 5AT1B 4BBSB 1GUSA 3NFCA 1H92A 5GAGC 4ZLTF 3LH0A 2QAZA 1SSOA 2EYZA 2WIIB 4JI8Q 3S14B 1L0XB 2ZPEB 5FU7B 1EQQA 1TR5A 3L9AX 3VYTA 1HNWQ 1FD7D 1MHNA 2RQUA 1F77A 2K4YA 3EIVA 4HA8A 3OHXC 2ZXPA 3NHNA 1AEXA 1LUZA 5FRMA 4L5TA 2BZYA 1K9AA 4EMHA 2D0PA 2MJ8A 3QIAA 1K76A 4AFUC 3OYYA 5CORA 4YHHL 4AFQC 3ONAB 3NK9A 3NWSA 4KH0B 2NN6H 5FO9B 1QUQB 1KDCA 2YUOA 5I11A 2FG0A 1IW7C 4M78B 1D8LA 4ZRZA 1OXXK 6AT1B 2EPBA 4FT4A 1JOKA 1KD1C 1AHJB 2QQAA 1GFCA 4BWGB 5HY6A 3GTKH 2RJCA 2BE9B 1U06A 3CPFA 4J9EA 4M75E 5I22A 3BVGA 2UXDQ 3RLFA 4C8QD 3RUXA 4JI5L 2LZ6B 2EGCA 4A3GH 3H0IA 4ELYC 4IQZA 1HTPA 1LOJA 2GVAA 4HMJA 4RTXA 2R92G 1YJWA 2LS01 1JORA 5GAOp 2DJFC 3MXGA 3FJPA 1IBLQ 1IKMA 2B3GA 4F7UA 2PUOB 2EOTA 4XQ3A 1TOVA 4C5GA 4CC7A 2RDGA 3PQIA 4M78A 2H5XA 3A5UA 4A3LG 3NE5B 3JSCA 1K0SA 1D0XA 1BQQT 1SAPA 1ENFA 1I4RA 5C0XI 1K9MC 3KF6B 1BCPD 3M53A 1VQ7Q 2KENA 2J6FA 3L7ZC 2L2PA 3G6EA 2DY8A 2RM4A 1N33L 3W2DA 5CV5A 4BUGA 2NVQH 1OYXA 4N9TA 1MV0B 3JRZA 1F2YA 2DRMA 2CW0C 3CCJA 4RHSA 4C1NK 2DNCA 2EWNA 1L2FA 4NPSA 4GN4B 3Q6SA 1LVKA 2ZPGB 1YJWQ 2XSCA 1S5CD 2MPMA 1YIJA 1JXMA 4XAXB 4GKKQ 3V8JA 1QG7A 2Z4HA 1LTAD 1HXDA 4XT3B 2CCZA 4K6LA 1RTOA 2DNEA 5C5LA 3OYFA 3K7UC 5GAN4 1M90R 4Y7NB 4OIKA 3JB9J 3I3CA 2JM9A 1QWYA 3RNUA 2VB2X 1C4QA 2KSSA 5CQYA 2Z6BA 5EKIA 3X3MA 3GP8A 4LF9L 2BE7D 1MMGA 2K28A 4DV3L 4YCUA 2D5DA 2G9DA 2D2CC 3C2PA 3JB9H 4M78E 1PV4A 1BR9A 3NEMA 4IPHA 4UP7A 4HJ9A 4LDXA 1RDPD 1N9SA 1NJIC 2EYLA 3KUPA 1E3PA 4WJ4A 1TWHB 2C35B 3M4OH 1VQKA 3I73A 2VS1A 1ZBJA 2RQWA 1HNWL 2AKKA 1OPKA 5M9OA 2SRCA 1UE1A 5FW9A 4PFPA 2A73B 1IREB 2AWOA 4JDSA 4KY6A 2W0ZA 4IUVA 3HKSA 1U3OA 1ILPA 2K5IA 3M55A 1Q82U 4RGMA 1DD2A 1NLOC 1VQ5T 3I4MH 2K14A 1TU2B 2HQLA 2DKGA 5M3MH 3TP8A 3TU4K 1CSPA 4J8QA 5EPLA 1NBEB 1H3ZA 4C92D 4C8QA 2O2LD 3NGPA 2H3EB 1PRMC 2QXFA 2VUMB 3AFPA 3OSSC 3LWUA 3BU2A 1Q12A 2M00A 1N6AA 4DR2L 4HR7B 4A3KH 3R3OA 4DXFA 2V1RA 2XK0A 5KIXA 1PTOC 1N8RU 1NBWA 1SLJA 1STAA 3O8VA 1W6KA 3C12A 1BF4A 5ELNA 1WQWA 4B9WA 1LABA 4A3MG 2RDFA 2DVJA 2RJFA 5KE3A 3JCMe 2JA8G 4LFBL 2QGGA 2Y4XA 1RTNA 4OL7A 2EYHA 3K5MA 1EIYB 1VQLQ 3VDYA 5E7NA 2QASA 3GTGH 3QPHA 1BI3A 1E22A 5IXFA 4ESRA 1Q81C 1FGBD 4Y92A 2V8JA 4GN5A 4NDXA 2ENBA 1BVSA 3GPLA 4L5GA 3X3NA 2DM1A 3CCVA 3CXCP 3EG3A 4B3RQ 4ULLA 1F9RA 2V8KA 1S5DD 5T1GA 4ME3A 4HKEA 3T1YQ 1IO6A 1U8RA 2VASA 2F1LA 2M51A 1H9RA 1GXDC 1PZKD 3K80C 4LK1C 4KMUC 2WSCE 1CQFA 2C0TA 4JI1Q 4WF2A 1ABQA 4OB2B 2PO4A 3UDIA 3PF4A 3X25B 3EGXA 4A3GG 2RHYA 2ID0A 3J80L 3LGLA 3H09A 1YIJQ 2PMZE 2Q8TA 1IBMQ 4A3LH 5D65A 4RUGA 1R8OB 4Y28E 2L3RA 1LT4D 2OTJA 2JA6G 1U4LA 1T5EA 2KJXA 2K3BA 1DONA 4JV5L 4WTOB 3CXCS 1SRUA 2F3WA 5C3EH 4C5HA 1K83B 2LX9A 2YLBA 3CCQT 4CC3A 4A3DH 2F1MA 5C44B 5FJ8H 1MGSA 2E1HA 4DK3C 1TU0B 3H3VC 3K81C 2J7ZA 3E1SA 2DTIA 2JE6I 3LNNA 2OCEA 3OS5A 3D0FA 4BY6B 4RGTA 3TREA 4KGVB 5IGEA 1EU4A 3R2IA 4OWTB 3EFXD 1KC8U 4EDUA 3Q8DA 1O80A 1QW1A 4DUZQ 3L2VA 1E2WA 5L23A 3G4SQ 5AFWA 2Z0WA 3CHBD 4OHJA 3OS0A 2RDHA 1LT5D 1M4ZA 3EH2A 1KC8R 1O7IA 4GNXB 2VGNA 2GNCA 4BA2I 5GAOr 3SWNB 4PK4A 4BBSH 1ZBXA 2DL5A 2A6ED 2FL7A 3J80c 2K04A 2QCPX 3VUZA 1Y71A 2YWWA 3SEBA 4F88A 2E3HA 4LF7L 4M78C 3WVDB 2HL5C 1M2VA 3SEMA 4FYDA 1PNJA 2B2YC 2NVTH 1Q82R 1L1OA 3FVQA 3ZEHA 2C0IA 2WSEE 4YY3Q 1IYJB 4CKCA 5GAN8 1N32L 3P8BB 1AD5A 1PHTA 4HIDA 1PYSB 5M5XH 2Z6KC 3NENA 5C6AA 1CA6A 3D6WA 1I50B 2MYSA 4JI4Q 1H9SB 4PJNA 3N6RA 1QMCA 1BDOA 3G48A 1M90C 3Q0AA 4YWLA 1V29B 2IY5B 2F0OA 1R0CB 2E4HA 2KE9A 4C8QB 5GMKj 2WB1G 1DXMA 3OIQA 5C3XA 1J6QA 5IYDH 3T13A 4ILWA 3FLGA 3A56A 1UG1A 2M9VA 1SE4A 4JJNK 1LLRD 4OXPA 4KHZA 2B2VA 1HD3A 2KVQG 4ODGA 4LF8L 4JZ3A 3PTAA 2VUMG 5DLQE 3NWTA 2E75C 1TS5A 5FO8B 1XMQQ 3AHUA 1X6BA 2EZVA 2F5TX 1SMYD 3KJOA 1JQYD 2N78A 1I94Q 2YUNA 4DR6Q 1SYBA 3I4NG 1Q95G 4LNPA 4OMMA 3HKZB 3JCMP 2QG9B 1JJ2P 4IOAA 1IGUA 1NR2A 4JI0L 4V190 1BCPB 4LF7Q 3DM3A 1N9RA 2B29A 4J7FA 1T0JA 1CKAA 3RDVA 2NZ1D 5LJ3f 2PW7A 3A1PA 5KNCA 4WJ3M 1VQPT 2CKZB 3BYTB 4ATOA 2L89A 5IY0A 4FP5D 4TVRA 1WFQA 2E10A 4LUDA 4PNOA 1WHLA 1D5ZC 3RNJA 1I3QB 3IKJA 4A54A 4GLKA 4K5VA 1J8IA 4X62L 5LL6S 2EIFA 1BCMA 4J1MA 4PMCA 2CQAA 5H1SE 2J0TD 3RBBB 1X43A 3OYMA 1JJ2S 4JI2Q 4CGYB 3QOLA 2PTKA 1KQSS 1ESRA 2IHEA 3GTJH 4J9HA 3D4RA 4OMOA 1EY9A 3KLWA 1EL0A 2D9UA 3K0YA 3HRUA 1BIBA 1TWHH 4IUPA 3M4OB 3PIPA 1VQ6A 1UE6A 4K8IA 2L3QA 4E7JA 3NMZC 3VS0A 1EY4A 2EJ9A 3G1JA 1HXYD 5ISRA 1Y1WG 1HNXQ 1U9RA 4ZYSA 4GLMA 3WVEB 3S1MB 1I5OB 1G291 4WORA 4BY7B 4J8OA 3C1EA 1I07A 4QMGA 3RR5A 1TY0A 4MNOA 4KUIA 4O5VA 3TMEA 1ESFA 1IW7D 1TUGB 2FMMA 1UUPA 2W10A 4MZTA 3L1AA 5IODA 3VS6A 3ULJA 4DV7Q 2YDLA 2JUFA 2EAYA 2KHJA 4M7DC 2O2OA 4CDCC 2PPBC 1WHMA 1R77A 1C0MA 1TS4A 1X3EA 5A2QL 5K36G 1CZWA 1TXQA 1ZA1B 3E19A 1Z6HA 2QDBA 5KYYA 1LT6D 1PD1A 3CCUA 3EGDA 3SK6A 1V1OA 3PUZA 4B3RL 3JCMb 3F8TA 4JI3Q 3T51B 2JS2A 1VQ6Q 1PKTA 4CJ1B 3SK4A 1G8ZD 4CC2A 1QILA 5L37A 1MI2A 2E2IB 1MKHA 5GAN6 1ABOA 4C3JH 3INZA 1HUMA 4X3SA 4F14A 3CCSA 2ZJQA 4FU6A 4APVA 4C3IG 3Q24A 4MTNA 1YNZA 4IPCA 1AOJA 1ENAA 1Y8PB 2ED1A 2EJMA 4C92A 3CD6Q 4LN2A 4M75A 2F52A 1KIXA 4J83A 1KDBA 2EGAA 1QE6A 1Q7YR 3I70A 2WINB 3L2QA 1BIAA 1MIUA 1B7TA 2K4KA 4HSVA 4P71A 5KYIA 3DEPA 4CDEC 2F0KA 1R9TB 2UUBL 2EKOA 5JEAJ 4EQ5A 1QUQA 2B2YA 1UB4A 2B2VC 2WP8J 2KYBA 3F2UA 4KKSA 4JI7Q 4A53A 1X65A 2ZXOA 2H8HA 5KYNA 2V4DA 1MMAA 3STBC 2R93H 4BI8B 2CHBD 3CU7A 4L8JA 1N36L 4FF4A 2Y4YA 2PZ1A 1CUKA 4ZNXA 2KVMA 4A93G 2E2JB 3EGDB 5A0GA 2X6LA 2K2VA 3EGXB 2KT8A 4X3TA 3S1RB 2X4JA 4DNTB 4AQYQ 1WJRA 2NVXH 3V7SA 3C0CA 3SK5A 4BS9A 1PH1A 3VS1A 3GTKB 4N4GA 5GAMg 3M0SA 2Z8LA 3UE0A 1DM0B 4X6AH 2DL8A 5I2XA 4KHPQ 1HR0W 1RACB 2LQWA 4C56C 5KYXA 2EYQA 3G4ST 1Y8OB 2KR3A 2EYWA 2YTXA 1YNND 2VZAA 5I21A 5FLMG 1PRLC 3TQ7P 1WOCA 3GTOH 3HOZH 3CCEA 1X3PA 4HJAA 4RTTA 3OS2A 4HCZA 4KY7A 1CKOA 2HL3A 1XPRA 5FRNA 2V8IA 4M77D 2MHVA 1OU8A 1K73R 2SDFA 1ET9A 2WAQE 3U9SA 4B08A 2DL4A 4F8MA 1ML0D 5CBAE 5EPJA 5CQXA 3GBQA 3AYHB 3GTQH 4M78F 1PH8A 3KF8B 3IRBA 2K1BA 3TZDA 1D1BA 2ATWA 1U4MA 1F2ZA 2K5DA 1SG5A 1AZEA 4H13C 2RH2A 4DA2A 1YVCA 3W1GA 1UGSB 4A4EA 4FL6A 1PXUA 2OXPA 2R92H 2EQIA 3E9IA 1KLGD 4JG2A 1KXLA 3MEAA 3M4PA 4FW1A 2FRWA 2AMCB 3OW7A 1ZSZA 2IL8A 4RKLA 2EYOA 3H3VH 1UGVA 1W6XA 4R1JA 3JCMd 2A0FB 4AQYL 4X64Q 2NTTA 1VQNT 4HVVA 1YZ6A 1WXBA 4FXDA 2RI5A 3S16H 2DJZA 1DOKA 1MD2D 1YNJC 2K33A 1SROA 5F2DA 1UJ0A 1QCNA 3FPPA 2KEDA 2XDDA 1HZAA 2HCKA 4DUYQ 3JB9D 1PG5B 3S9WA 2NUPB 3SB2A 4TVAB 4Y52H 1K83H 5FWCA 3FHWA 3KOJA 1M3CA 2JT4A 3PGGA 4IFDH 2JXBA 5GANg 5ELOA 4QF4A 5LJ3h 2FVUA 3L2PA 3M0QA 3JCMW 2K5HA 4DK0A 3DMUA 5ELCA 1I94L 1U4RA 1VQKT 2L15A 2AUJD 1AEYA 2F0SA 3CCST 4C0FA 1YHAA 3HOUG 3BG3A 2NUZA 2RA4A 1Q8IA 2E64A 5JVH3 1Q86C 1EWIA 1MNEA 3OYCA 4PLLA 1TS9A 2A36A 1G3WA 3EG0A 4POGA 5FU7C 5IXBA 2K5NA 3QZ5B 2N8NA 1JO8A 5IHNA 5IAYA 2A6HD 2RCNA 3A54A 2OAUA 3OBWA 3JCMf 4M7DD 1N8RC 1X3GA 1B7YB 1VQ8Q 5A0DA 4M75D 4HJ5A 2ICEC 1JWSD 3H0FA 1K8AC 1HJPA 4JUVA 1PYBA 1VQNA 5GAN2 3SHWA 2C9OA 4PG3A 2XG8D 3BZKA 5EPKA 3RR6A 3VUBA 1RODA 3HOWH 3JAME 2ED0A 3I91A 2R61A 5D6YA 3M4GA 1ET6A 1VQJA 2MNAA 3S2DB 1JQQA 2KMTA 4LF4Q 5LJ3e 5CGKA 4YY3L 4NXNL 5I9PA 1HNXL 3TSWA 2P84A 3MXNA 4JI6Q 5JJKA 1QCFA 5IGCA 4A4HA 2CSIA 1B53A 3QDRB 1SSFA 2DETA 3OTOQ 1G91A 2AQ1B 3V7RA 1NM7A 4PKCC 4ELZC 4E7KA 2DN8A 1LV9A 1Y1VB 1LTGD 4RWSC 4ZN1A 2YSQA 4LD6A 1VQMT 1DZ1A 3U4ZA 3E0JA 4YCVA 3CC7T 4JI2L 1ASYA 3V2TA 3IFTA 1ZEQX 4XYQA 2LX7A 4RCOA 4FYVB 3I7FA 3QWNA 4ALPA 2RN8A 2EYJA 2Q8RE 1XMOL 4Z88A 3MEHA 1O75A 4X65L 3RESA 1I5FA 1SEBD 1NAPA 5CK9A 2DFUA 2R7ZB 1EQVA 4BY1G 4RCBA 3MHBA 1VQOA 1XQHA 1VQCA 1VUBA 2KXCA 3A7LA 4DV2Q 1A2TA 2F69A 1NCVA 5I2SA 1TWCB 4UP8A 4PV1C 2GN5A 2VL6A 4IOCA 3PUWA 1WHJA 1HJDA 2PZWA 2JOYA 3HOVH 3KXTA 4ZUJA 3T4AC 1P8LA 2F03A 1SFOB 1K73C 1QVPA 3TP7A 3QXEB 2QI2A 3U23A 3O5ZA 1FWZA 1CKNB 2DL7A 2J7IA 1BCOA 4YCWA 2X9HA 1VQ9T 5LJ5g 5CR2A 4JLIA 5GAMh 1W6JA 3S1NB 2IJ0A 4M7AA 4RG1A 4R4CA 3F2DA 1PH9A 4J9BA 1I0CA 2LJ1A 3QZ9B 1VQOQ 3DWQA 4NP5A 2DE0X 4ZAIA 5BN3A 2R93B 2XWBB 3HEJA 2HNIA 2Z6KA 1M3AA 1YCYA 3PUVA 5HGQA 3PO3B 2CZ1B 1B3QA 1KC8C 5FJ8G 3UT1A 1Y7XA 4M77B 4E7SA 1PTOF 3HPWA 2IHFA 1U0LA 4Y91A 1V76A 4RG2A 1Q46A 4R56A 2O9SA 1WTPA 4HVUA 4E2FB 3CCMA 2K57A 4OVAA 1ZYRD 2CZ0B 4PJOG 4WRDA 2OQKA 1GUOA 5GAOl 1Q8KA 3VA5A 4JYAL 3E2UA 5EGTA 5DM63 2ZM6L 3EFSA 5KYXB 3RZDB 3S15B 1SE3A 1D3BB 4UC4A 2MGSA 3NPPA 1ICFB 4L6TB 5G3LD 1ZUYA 3S24A 2DY7A 1W4SA 4J6HA 5COYA 2RK1A 2E5LQ 3VR5A 1GUTA 1OXUA 5CCAA 4PJOE 3G71A 1GHKA 2WV6D 1OXVA 1VQ4T 3JCMQ 3M9BA 2R3ZA 1YIJT 4RGOS 4NXMQ 5GANf 3I2ZA 5IE8A 3VS3A 3MEFA 1VQ9Q 4JOIC 3HOXG 1JMCA 3OTOL 4BDZA 2UUAQ 2JJQA 4RTWA 1HHVA 1NUCA 3J7A5 1WLPB 1UNSA 2Q2IA 1TWAB 5LJ3g 5FLXc 4LF4L 4HXJA 2RCFA 4G57A 3E6ZX 2QEXT 2FMCA 1JBMA 3TP6A 3VYSA 3L42A 1VQOT 3A0JA 1N34L 2AKWB 4XTWA 4WJWA 2PZUA 1AZPA 1L0YB 1IYVA 4DV3Q 2Z9HA 5IWAL 1MJCA 2K75A 3UPUA 3ZJYC 3SE0A 5C0MA 4EMGA 1E0BA 5EBCA 2R7DA 1WHHA 1Z9QA 3QDFA 1Q81R 5IT9E 1MHWC 4JC0A 3X28B 2R7ZG 2F0TA 3MO8A 4CKBA 2IX3A 2VW9A 1ZLMA 1VQ9A 1F9QA 2ZGWA 3PMFA 1MMDA 3TVTA 5KYYB 1IHWA 3QR8A 4OONA 4PQXA 1K9MR 1KAWA 3OYJA 3CCLA 5IHKA 1QOHA 1X32A 1QQJA 1B4OA 2L4NA 1CM9A 3JAML 3PIO3 2PNHA 1BKBA 3GTLB 3MXNB 1EFNA 3OOCA 2RSNA 2OX7A 3OIPA 1WJQA 5GANd 2DF6A 4A3EH 2K5QA 3QBYA 5BN5A 4IPDA 3H0HA 3D8GA 1E24A 4JK1C 2LQKA 2EVBA 1B9NA 1BU1A 1PDQA 1MBYA 2MUYA 3GTMH 1N33Q 1GCQC 3NTKA 2A08A 1JEGA 4FDBA 2IG0A 5LMUQ 1AZQA 4K5WA 3FRPB 1KAAA 3BDLA 5CV6A 4DUYL 1K1ZA 4CDDC 1YHQA 3RN2A 1T3LA 4DV1Q 4QCLA 1MMNA 5CBEE 2L5QA 3QO3A 4JZ4A 1Y1WH 1C7YA 1YJNT 2QILA 2CKKA 3CCQQ 5KYWB 2F3IA 2HEQA 4XU1A 1KD1R 4KV6A 4POFA 4JLGA 1I4HA 5M5WH 4RMFA 1WTVA 2WFWA 1G51A 5AJ3L 1C6VX 3CMAQ 2FHDA 4ZGEB 1XNRL 3SWNC 1TQOA 5LJ5j 2AHJB 1VQBA 1X27A 2JA9A 1HZCA 2H4OA 2NWGA 2VB3X 4P5NA 2RA2A 3H6MA 2WAQG 4Z9CB 2E3IA 1I4PA 5KYUB 1U4PA 5CV4A 3SGIA 5C44H 2DPPB 4D8KA 1HFNA 1R4PB 1W3SA 4JI3L 2LMCB 2TSSA 1SNPA 1EOVA 4I7ZC 3HGBA 5K5PA 1PTOD 5IOCA 1CQVA 4G7OC 4RMOA 5GMKe 4GZYC 2SNSA 4MDWA 1JWUD 4DAPA 4LUEA 4P75A 2V26A 3HOUB 3OBYA 3EQLC 1DOLA 2NUPA 4ZTFA 2NUTA 2EW3A 4IKFA 1AZGB 2HBPA 1VF7A 3NSWA 2JMCA 3M56A 4BY1B 4NOYA 2CP0A 3GP7A 2DTHA 3D31A 3K58A 3Q23A 4LFAL 2IPKD 2JA8B 1N34Q 2HDAA 3ULLA 1UWVA 2I46A 2JP1A 1EYCA 2BKDN 1F2MA 3AB9A 2F3VA 2DJQA 4FYWB 3QKJA 1SSHA 1G3SA 2EYFA 2NVQB 2K6DA 2HKQB 1R9TH 4HTHA 3A8MB 2SNMA 1HSQA 2K6AA 1RAAB 3M4QA 4KD4A 2K50A 4QB4A 3L2ZA 2O88A 1TH7A 4RG8A 3JB9I 2QTVA 3HOVB 4JRKA 2QTXA 2AT1B 2QDLA 3CCJT 1CKNA 2MWPA 3QWXX 4U673 4K5XA 2MQHA 2RBMA 5KRUA 2O5IC 3E3XA 4CJ2C 1GRIA 4AIMA 5GROA 2KCMA 1BCPC 3TCJA 2RHSB 3CC4T 5FLMH 5LMUL 2LY7A 3HZXA 4V0BA 2VQEQ 2XDPA 1SNCA 3FKIH 3M0TA 4QQGA 2A6HC 4A3CG 5IYBG 3HOUH 1IXDA 3CCET 1QVFA 3BVMA 4DAMA 1XPUA 4XTZA 2QA4A 3I5RA 1NSNS 4FF2A 4JI0Q 2L5TA 2GTOA 2EYMA 4BE2A 1D0YA 2M2LA 3CCLT 2DTOA 2C5CA 3EFRA 1M5Q1 2K5FA 1B8AA 3S1QB 1AWXA 3UE1A 3M57A 1XXGA 1GL5A 2JA5B 1VQ7A 4E7ZA 4O42A 1TWCH 4F04B 2I07B 2YRCA 3NHHA 4IJHA 5C4XB 2PUKB 4GLVB 3BZCA 3RMSA 2JA8H 2LQNA 1A63A 2ZZDA 1WXTA 3F2BA 5GANh 4MMKA 4N4IA 3DEOA 2RHIA 3PO2G 2RKSA 4JBWA 3NELA 1SMXA 3NBHB 1GJXA 1JB0E 2KT1A 2YRVA 3QHSA 1RKNA 5CV9A 4L5SA 1HPCA 4DR3Q 1R4QB 2BH8A 3A8LB 1VQLA 5GJVB 4BY6C 5LMNL 2VNUD 7AT1B 4CKEA 2TMPA 4LW1A 1PM3A 2VXWA 1RAIB 3OWFA 3DWAA 1RAHB 4M7DB 4LF5Q 4EMKB 2M0OA 2XIDA 2KOLA 4X3UA 5M3FH 5C0XG 3OB9A 2E2DC 2P5ZX 3S2HH 3CMAT 2D0QB 3HFNA 3A8OB 1YEZA 3CC4Q 2KCCA 2WB1E 3D4DA 4DV2L 4A3JH 2KQ3A 2J06A 4IIMA 4VUBA 4EIKA 4KT0E 1FMWA 2EE1A 2SOBA 5E4XA 3D7SB 3KBXA 2JA6H 1O7YA 3K0XA 3CCRA 1EYGA 4II1A 2OI3A 1XMOQ 2L8DA 4Z8AA 3FEOA 5JEAH 4UPAA 1S5FD 5IYDG 1KHIA 2KQWA 4ZCKA 1N36Q 3HRZC 3PCOB 4KBMB 2R7FA 3CQZB 1PTOH 3AEVA 3OA6A 1VQKQ 1HCZA 1X56A 4QVZA 5LJ3d 2EY2A 5CKHA 3QJ6A 1QWEA 2O4XA 4KH1B 1G2SA 2D0OA 4AYBE 1WI5A 4FSSA 4JYAQ 2L55A 3QSUA 2HD0A 1VQEA 3Q1JA 2RI2A 4CI0C 2NN6I 2EDGA 1VQMQ 1Q7YU 5T1IA 1PH6A 1K8AR 2HZYA 4M78G 3R8BA 2DBKA 2MWOA 3AT1B 4EVOA 2HAXA 1MUZA 3L2RA 4KUDK 5C3EB 3CBOA 4ZN3A 1NY4A 2VY3A 3P20A 1IBML 1AWOA 2D62A 3J81L 4IZ8A 3MC0B 3CCUT 2ZJPA 2COWA 4OMQA 1Z7TA 4DK6C 1QWFA 1QCBD 1WJSA 1EEID 2B2WC 2ENMA 5DM73 2JA5G 3LWIA 1OEBA 3GQBA 5EBDA 4M8AA 2PCFB 4DV7L 2I0NA 2KNBB 1EWHA 2XVSA 3TP5A 3OYDA 1XTCD 2V1QA 5E1FA 3KF8A 3J81i 2LKVA 4HIKA 1B07A 1TUCA 1VQ7T 1STHA 4MN3A 1PH7A 2AHOB 3MXPA 1BB9A 3UA7A 3CCVQ 3J7AV 2A68C 1NZ9A 1GOZA 1IHZA 3NQIA 3W1BA 1WYDA 2XI9A 5ELEA 1PCXA 3SFMA 4X66L 3HSBA 2WB1B 4PZ7A 2E2JH 3VYHB 3VR2A 2AK5A 3KK7A 3I5SA 2PQEA 1PH2A 1AWJA 4OGCA 3EFOA 5JPMC 1OX8A 4C3IB 1SN8A 4A3FH 1JT8A 1FXXA 4A4KA 1VMCA 5GQOA 3S3NA 5C4JB 2DERA 2BZXA 2HQEA 3S6WA 2R6GA 4M77C 1L1OC 2RJDA 4X1VA 1D3BA 3CCEQ 5I2YA 3VKIA 5CKFA 2A8VA 4F7XA 1GM5A 1IL8A 2CT3A 2M1HA 1D1IA 1RJTA 2E70A 3GTQB 3VS2A 3PO2H 1SYCA 3CC2Q 1XTDA 2CGHA 5LJ5d 2HSEB 5FWBA 1VYVA 1PFBA 4GLAC 4MMLA 4O2DA 1B3AA 4X66Q 2E65A 1X3QA 5NUCA 2YUPA 4BY1H 2E8GA 2AZSA 3MP1A 2YTYA 1SNMA 2OTJQ 1V9PA 1M2VB 2OWOA 3I56T 3CBMA 1M1KR 2D8JA 2ATCB 1BCPF 2B8FA 4G4KA 5D3DA 1M30A 3F1ZA 1K0RA 4IPGA 4J9CA 3STBD 1KRTA 1KABA 5GANe 3VA7A 3G6EQ 3I90A 1GBQA 3V8KA 1K3RA 3I4MG 3D4WA 4M77G 4LFCQ 1IGQA 4M7AB 1AW7A 4DV4Q 2CDTA 2LC4A 2QGFB 3S1NH 4BXXH 1BBWA 2XU8A 4FYYB 3GIBA 1M8AA 3CCJQ 3G4SA 2LRQA 1K8MA 2K03A 5HURA 5KNDA 3CMET 5M3FG 4KHPL 3QWYA 4PJOC 3A5ZB 3RMHA 4A3EG 3I4NH 1T9HA 1OPLA 2B2TC 4B6MA 1GCPA 3FC3A 3UDCA 1TWFH 1WJJA 4QW2A 4B3ML 2ASBA 3PF5A 1TIID 2ZPIB 3JCMV 3ZFJA 4GN3B 4IJLA 2Z4IA 2BDNA 1X9NA 8ATCB 2X3XD 3NTIA 1BNZA 3OW2A 1B44D 2A6EC 2JA5H 5GAOm 3X24B 3A8HB 2O4XB 2LCLA 1VQDA 2L0CA 3KLRA 2B63H 2PI2A 3ZBDA 2VQEL 3BDOA 1NMGA 1RI0A 3QB3A 4FO2A 4HJ7A 4H44C 3GTPB 5D3IB 4XU2A 4R4IA 1EY6A 1NG2A 1KD1U 3I55T 2JXMB 3MCAB 2KDSA 1TVXA 1CKBA 1NYGA 2RHZA 3R6NA 2NVYH 1VQ8A 4N8X1 3LX7A 3BJUA 1FL0A 4X64L 4DA4A 1YP5A 2LXKA 4QQDA 4DKAC 2WSFE 2PZTA 2DXBA 1XNQL 1WI7A 4EMKA 2PQWA 2RMOA 1EY0A 4L6V5 4C3HH 1H3HA 3JAMc 4JI5Q 2O01E 2YHTA 3HL8A 5J26A 2LNVA 1HFGA 2FB7A 3IL8A 1NPPA 1TWGB 1EZ6A 1S72A 3AFQA 3EHQA 3N5BB 4L59A 4QL5A 3UDXA 4M77F 5IT9c 1QNKA 3FRNA 3HS0C 2OTJT 4KN7C 1X6OA 1BYMA 1PA6A 3GOXA 4LFAQ 3OQ5A 3URYA 3BVZA 1C9OA 2QQBA 2H3JA 1VYTA 4LUOA 5BN4A 4DOWA 4LF9Q 4BE0A 2ZTCA 4C0DB 2E6NA 4RAUC 1YJ9T 4A4IA 3WOFA 2HIVA 3GTJB 2GGRA 4DPGA 4JRPA 4GS3A 1E7OA 2I2LA 4BE1A 4O1NA 4DNRB 4OB3B 1SHFA 1ZUUA 3CCVT 4AFZC 1I4QA 1Y96A 4KTAA 4A76A 3H15A 4ZUIA 4RCCA 1EX4A 2AWNA 1OXSC 2EXZA 2KHIA 4U68A 4F16A 3J7AF 2NTSA 4C1NI 1UDLA 2B2WA 2RPNA 5ELFA 2BIVA 2LQ8A 4F87A 4ZTJA 2N49A 3KLSX 2KEAA 1SKUB 4M1UB 1QCOA 4OO1H 2ROTA 4LDVA 3ASKA 2MAMA 1EY7A 3RMQA 5HGTA 2F0NA 4P74A 2ZPFB 3MA2B 2KYMA 5JAVA 2EKHA 1JU5C 1W2BP 1WHGA 1TWGH 2N3SA 1ICWA 2YXYA 1NR4A 2PNIA 2JA6B 2GQVA 4PJOF 3JB9G 1UGQB 2BE5D 3G6ET 3H3VI 1O7LA 2K32A 2EFIA 3TEEA 2BH2A 3CPWS 1D7QA 1I8FA 5M3FB 1VQ5Q 4K11A 1VIEA 1YI2A 1VQPQ 4C2MB 1T3SA 3CD6A 4YWMA 1D5MC 1UE7A 2L11A 4QIWE 4CBVA 3MJXA 1N8RR 2A28A 5CIUA 1SJED 1S5ED 3S17H 3G7ZA 1JJ2A 4J15A 4KN4C 2F0GA 1W2BS 1PH3A 2OQ0A 1XMQL 1G6PA 4KY5A 4CHTB 4ZKBB 2JEBI 3DLMA 1C0AA 3VR4A 4DOVA 4F7UB 3VR3A 2R57A 4OMFB 3M0PA 1E7ZA 4JRIA 3SDZA 4ANJA 2BDOA 5GMKi 3S3MA 4BI3A 1ZXTA 1TUDA 3CPWP 1HK9A 2R5MA 4DV6L 2NYZD 4DR5Q 1FNUA 1G2TA 4IURA 1LPLA 2F0FA 5HCKA 4UP9A 2WKCA 4XU0A 3T16A 2E2HH 4LDWA 2FJ2A 4FCYA 1Z9FA 1JWMD 2XRSD 2CFMA 1WZOA 2GFAA 5IWAQ 4JI4L 1V1CA 3QOJA 4PJMA 4XDXA 1ACMB 4DK1A 2EQJA 3BY7A 2UXBL 4KKTA 2LT4A 5M5YH 1DYQA 2CP2A 1KNEA 2F0DA 3QIIA 4JS5A 1KQ1A 4DV6Q 3A74A 2RQTA 1H9MA 1JR0D 4QGUA 3EG9B 3VRYA 2YRDA 4AFSC 2D1XA 3FKIG 3PO2B 4C0ZA 3CC7Q 2DZ9A 3VYUA 4B3SQ 2UUAL 1UFFA 3KUFA 2JMAA 2OJ2A 1LACA 3MEUA 2KCTA 1CKMA 3LGFA 2CH4W 4EQOA 4FT2A 1HRJA 5EKKA 3NXWA 5I6WA 2EY1A 1CSQA 4B3TQ 3SVMA 1WTWA 4BBRH 2AZVA 4RTVA 2EJFC 1RABB 4P73A 4ABNA 2RB6A 3OYBA 1VQNQ 1STGA 3PFSA 4JVZA 1CTMA 4DV1L 2IIMA 4AG2C 1KLUD 4E6RA 2QW7A 3QG1A 3I72A 3T56B 3E5SA 1X01A 2RI3A 4A3KB 1SR3A 2RHXA 4K0KL 3O13A 2NN6G 1ZUKA 1KIKA 1HNZL 2EYYA 3PMIA 3MXUA 2P0KA 1H8KA 4ME7A 1KK7A 3WDNA 2VVKA 2DMOA 1EOTA 2KROA 2MCNA 5FO7B 2VC8A 3QUIA 1HH2P 5KEEA 5IYBH 3S1MH 5C4HA 4HIOA 3LW5E 4M77E 3CKIB 2Z1CA 4GKKL 3S15H 2HIXA 1EZ8A 5JVG3 1WVLA 3REAB 3HRSA 3HOVG 4A63B 1VQ6T 3R6OA 5D14A 2UXCL 5GAN3 1D0ZA 3IAYA 2C06A 2OTLA 2J4XA 2ALYB 5J39A 4C5EA 2E74C 2IW3A 4N0AA 3J81j 4L5RC 5EC7A 3VS4A 4IO9A 1Q7YC 3BS1A 2I5HA 4AH6A 2JK8A 3U58A 4LMQD 1OTCA 3I56Q 4LFCL 4JW0A 3UDGA 4BBSG 1IYUA 3ND8A 3C4SA 4QKUA 1OU9A 2J6OA 2D8HA 4C5IA 4GKJL 1NE3A 1V1PB 1DGSA 2PNRC 4PMBA 3K5OA 2DIGA 1A2UA 4RFBA 5ELBA 1I4GA 2B2UC 2EJGC 3EJIA 3MP8A 2Q2TA 3KJPA 1S3OA 5EQ0A 1K3BC 1XWEA 1TWBA 1ZA2B 4GNXC 2EQKA 1SJHD 5KCHA 3CCRT 1RAGB 4FXKC 3GNFB 2OAWA 5IHIA 3CCQA 2X69A 4HSPA 4DR1Q 2RNAA 2MIOA 1DOMA 2QF7A 2KRNA 4X34A 3C1FA 3C95A 4P72A 2MPXC 1PLFA 1PZID 2BOSA 2NUCA 1M1GA 1CHQD 2B8GA 1EYAA 3EN2A 5M5WB 2HHHQ 5EG2A 4BY7G 1X54A 4AYBG 1UJYA 1VQ8T 2HT1A 1SF9A 2C0OA 3OYAA 4J6XA 2DNUA 4XIGS 2F4IA 4M7DG 1A3VA 4FIBA 3FJ5A 3JCMh 1LNXA 5ECAA 3K7AH 3DKMA 1PZJD 2JA7H 4MZMA 4EMKC 4N0AC 1ZX6A 3TEHB 5DLOA 5DAUA 1X2KA 3FMCA 3IFDA 1VOMA 2A7YA 2DEQA 2HCIA 2DD5A 4M4ZA 1EQTA 3BE3A 2KI7A 2COYA 4C92E 2A19A 2LNHB 2BA0A 4M7DE 1GFDA 2LTOA 4LF5L 2OF1A 1EIHA 2Y90A 1YBYA 1L1OB 1G5VA 5FOBB 4M7DA 3VRZA 1Z9ZA 2B2UA 2QEJC 4Y7NH 2DXUA 1IRXA 4M7AC 5LMNQ 2IX1A 5IP7G 5C4XG 4J5YA 4FM4B 2CP7A 1W2BA 1W1FA 4D6WA 1EQRA 1CA5A 1VQ4Q 3SWNA 1OV3A 1C1AA 3CC2T 1A3TA 1D1CA 4JI1L 3I9QA 3NBHA 4M75C 1WD1A 4XU3A 2DYIA 4EX5A 1SNOA 2NZOA 2DAQA 4M7AF 4BBRG 4LNQA 1LTRD 5CV8A 1II3A 1RL2A 1KSWA 2NWMA 5M5XB 5FU6C 5IYCG 4KI0A 4G7ZC 1MV3A 2N88A 3KDFB 1QVGS 3EG2A 2LSSA 1XJVA 4S3SA 1FJGL 4A75A 2JN4A 1DCZA 1BXTA 3K7AB 2RQVA 1QP3A 1YHBA 3EBEA 2E6ZA 1YJ9Q 2B63G 2G9HD 2QQRA 2FXQA 3HOZB 3VYGA 3PO3H 4PJLA 5GANj 3GV6A 5M3MG 1PC0A 2F0UA 1TKWB 3OYHA 5FKAC 5CKEA 3S1RH 1YITQ 1VQGA 5GJWB 1VQ4A 1B1ZA 1BBXC 4YTLA 5FU6B 2JA7B 5C4XH 2ZTDA 2X35A 3OYLA 3KYHC 1I6HB 1HQMC 4O6JA 1D2BA 1H9KA 1OO9B 5J1ZA 3RLOA 2DIQA 5GAMf 2HDLA 2A69D 2KBNA 2EBPA 3H41A 3A8KE 4M75G 4IALA 4LUVA 4RGNA 2QQ9A 5DNFA 5KGUA 2KGTA 1XOVA 2X51A 3HTRA 2GFUA 3QJYA 3S3OA 2YTVA 5G3LF 3RKWA 1K8GA 3EG9A 1O78A 4KJOA 3X20B 1RAEB 4AG1C 1GXIE 3GLXA 1O7ZA 1K28A 4H02A 2KRMA 2AKLA 3I56A 3FB9A 1E6HA 3OMGA 3M4YA 2G3RA 1G2BA 1F9SA 3TZUA 2VGMA 1P92A 4K14A 5GAOq 1AH9A 3S1QH 4PJJA 4JI6L 1QLYA 1LTID 2BUDA 4FXGC 2CS7A 2DXCA 4F17A 1K0XA 4G7HC 3S2HB 4FSXA 2ES2A 1KRSA 4JV5Q 2XGTA 1TS3A 1N27A 1VQHA 4XXEA 4A3FB 1ENCA 2GA4B 4BA1I 1KTKA 3CC4A 4X9DA 3PE0A 2RQRA 3BYYB 5I6YA 2I5LX 3J81c 2K3YA 2L0AA 4A3IB 2NUTB 2YYZA 3T53B 2WAQB 2GTJA 4IFDG 2ZAEA 1FMVA 2DRKA 2LJ3A 4C8QE 3ZL7C 1SRLA 3EAEA 4DV0L 4C8QF 2QK0A 3OSVA 4KGZB 5LJ5e 5GAMj 1YHQT 3QO2A 1PRTB 2Z0SA 4XTXA 4IUTA 4RTZA 4HCSA 4BY7H 2MFIA 2F0JA 1OULA 3E0EA 1YNNC 2WACA 5C6SA 1STEA 5C5MA 1NJIR 2DO3A 4LWCA 1QNUA 1GCQA 3KBGA 4C3JB 1FVIA 2KBTA 3H6ZA 2RF0A 4MTKA 3LH5A 2O9VA 4Q0FA 4JI8L 4A4GA 2M9UA 1SYGA 3HOYG 1XNRQ 2COZA 4QUCA 5KCOA 3H0GH 3RUZA 1XNQQ 1GUWA 5GMKl 1F2LA 4ZQ3A 2KY9A 1PWTA 2LMJA 2JYOA 3C3LA 1NEBA 3FIFA 4DEYA 4E7IA 4XTVA 5IGDA 2E2IH 1PH5A 3MZ5A 2RQXA 3U9OA 5M5YB 2VV5A 3TS0A 3ITPA 3AU7A 4IUUA 1STBA 1CT1D 2NVXB 1Y8NB 1K8OA 4A3MB 5A35A 1KHCA 1I6HH 1GD7A 2EXDA 1X3FA 3HKZG 4L63B 3I4NB 1Y96B 1FGUA 2VYTA 2NVTB 1U5KA 1WDXA 4PFZA 2CH4A 2XKOC 3X26B 3THKA 3BZDB 4J6WA 1B9MA 1TT2A 1V1PA 4JS4A 1LTLA 3V96A 4DN4M 2EVRA 2FPDA 3C94A 3PV0A 1HYOA 2A1AA 2IVWA 1N5ZA 4A3BB 3CRKC 4E7LA 2CZ7B 3NUCA 4OEMB 4XYOA 3R93A 1MSHA 3AQQA 5C0XJ 4DU9A 3ERSX 3M85A 1ASZA 3ICEA 1HR0Q 1E1TA 4PFOA 2UXDL 5JEAG 4ME5A 1RAFB 3M7NA 4PNYA 3VS5A 4JRQA 1YHQQ 1PRTF 1A0IA 2KHSA 4N8FA 1YJ9A 4IUQA 4DR7L 1D1KA 3K59A 5DM7R 3A8JE 1EWCA 2XRQD 4JBJA 3EGUA 1WQ7A 1FNVA 4HMIA 3WOEA 2VXEA 5CO7A 2D0NA 5GADC 3T1HQ 5FLXE 3BW1A 3M0RA 2KUMA 3RZOH 3HOXB 2GBQA 2D9TA 2VUBA 3MFGA 4YHHQ 1OX9A 2DXTA 4GOPC 2CWPA 3DM1A 1NNXA 3CXCA 4X9CA 1SDFA 2QQSA 2I5MX 4C3IH 4JBKA 3I8ZA 2HQXA 1ZHIA 2F4VQ 3V05A 1B50A 3VS7A 1ZSGA 4ZKCB 4A3IH 1JOOA 1SXTA 1WTQA 2HMAA 1FYCA 4IN3A 4JJCA 2IT1A 4CRIA 2Q8IB 5IP9G 3OPOA 1HA6A 5JJLA 1HUNA 5GMKm 3W5OA 4PJOB 1B70B 1YFNA 2FFKB 1Y57A 1I6VC 2UUCQ 1VIFA 1A62A 4B9XA 4RTYA 1NEGA 5CR3A 4XQJA 1SYEA 3ZYYX 3S16B 2JM8A 1A0NB 1STYA 2FRYA 1YI2T 4WFN3 1CZGA 4MZ9A 2KAFA 1C8CA 3HFOA 3KF6A 1YJNQ 1OZ2A 3V7CA 2X3WD 2VQFL 4LDUA 2ZM6Q 1VQIA 4K6DA 1ZSZC 4FYXB 5I2MA 1OOTA 3RZDH 1ZYRC 3VYRA 1PYWD 5IN1A 3MVVA 3VU3C 2UUBQ 3A7AB 4HEDA 4M75B 4RA8A 4OB1B 1UHFA 3M54A 1CSKA 1IBLL 1WCMB 5CKDA 2P4RA 2GVBA 4CC4B 1CHPD 1UE9A 2FEIA 4M7AD 1KDAA 3CCMT 1DJ7B 1I1JA 1TS2A 3M0UA 3ERQA 1WPYA 4JCVE 1U1TA 3JAMi 1JJGA 3OSOA 2F0EA 4KULA 2CW0D 4LF6Q 2MI6A 1JE4A 2OEOA 3ND9A 1M1FA 1JCKB 5FK9C 4XTYA 3NTHA 2JEAI 3P75A 2PVDB 1TG0A 1WXUA 2IPOB 5GAMe 4FF3A 1UHCA 2B63B 1QZHA 1KG1A 4R8NA 2P0PA 1M4VA 3K57A 4J9DA 3BFMA 1IB8A 4DBFA 1TY2A 4OMPA 2LXJA 2EYPA 2F0WA 4FVMA 2XICA 3I4OA 3TRZA 2A37A 2JVVA 1CK1A 3JCMX 1FX7A 2FZCB 1VQMA 2M16A 1J5EQ 3U50C 4JBMA 4XTCS 2KK4A 3NPFA 1H9SA 2RHQB 4OGQC 1SE8A 1V43A 1F1BB 2HBWA 4C0DC 1H95A 1RCVD 1LT3D 1BK2A 1VF5C 2E76C 2B86A 2MF2A 9ATCB 1PSEA 2EJFA 3META 4BDYA 2QKIC 2HDMA 3NP8A 5IIFA 3RZOB 1PRTC 2YLCA 4M77A 2K5LA 4OO1G 5GAMd 1M8VA 2NLUA 1GKHA 4QT7A 2K5WA 2IWHA 1A6XA 1NE8A 2FHTA 1LYLA 3GO5A 4LAAA 4ZK9B 1GVPA 4A3DG 5LL6X 1Y1VG 2B2TA 1B34B 2R7ZH 1WFWA 1MGQA 2QDYB 1X55A 4XT1B 3JCMJ 1M90U 2R58A 4Q5VA 3K5LA 3OS1A 1JOQA 1SFOH 3I4LA 1FR3A 3T9NA 1NLPC 2A69C 4UY8C 4MZPA 5CVIA 1NJIU 1G3YA 3M3YH 4ZGDB 1KQSA 3KFVA 4M7AE 2SEMA 4A93B 4JPBW 4Q5WA 5HKCA 3GD7A 3KFUA 3HOZG 5CMDA 4OB0B 1OI1A 1A8VA 3BDCA 3JB9F 3PUYA 4ORZA 2DGYA 2RVLA 3URGA 3PGZA 4A3KG 1NPRA 3CPWA 1Y07A 4DR1L 1WYXA 2Y0SE 4ID6A 3DB3A 4NS5A 4WCIA 2KCNA 1SBBB 4B3MQ 2DL3A 4BBRB 2CT4A 1BUVT 2G6FX 1S4ZA 2LFNA 4HAEA 4DR4L 4GBQA 3JCMg 2ROLA 3L2WA 4DFAA 1YJNA 4R8IA 3OY9A 4HVWA 2VXFA 4BD3A 1QJOA 2PQAA 2B39A 2DZCA 2GQIA 4QQBX 2MOXA 1AFPA 5KYUA 5IT9L 1FNWA 2Y0SG 3JV3A 2MMPA 1GUGA 2N55A 4E6IA 2CP3A 3T1YL 3CCRQ 2BE5C 2FYKA 2L9HA 4KLKA 2CUBA 2XN9C 1AE3A 2CWAA 5IGBA 1S72T 3WXMB 5GAN7 3E9GA 3M59A 1EU3A 2VWFA 3GF5A 4DBQA 4MIUA 2UXCQ 2ICIA 2L3PA 3L2UA 1I4XA 2NZHA 1ONLA 2E12A 1BI1A 1PSFA 1HTLD 3HRTA 1XPOA 1RIPA 1X6GA 1C48A 2ZCFB 2BZ8A 3MPUB 2HKNA 1VQ5A 1K4US 1QB5D 3ULPA 3H9NA 3EVQA 5E3FA 5GMKh 3HP9A 4DNIA 1IBKQ 3CQTA 2KRSA 1WD0A 3A55A 3PIP3 5BR8L 2EY5A 1T0HA 4OMNA 2MP1A 1F9PA 5D6XA 3UF4A 1MNDA 3NBIA 3JC66 4XQNA 2DILA 2EQMA 3N52A 5AYFA 2LCSA 1ARKA 1SYFA 2ABLA 1UAPA 4GNXA 4K0KQ 1VQFA 3EG1A 2RF4A 3TQYA 3PVQA 2JW4A 3HOWG 1VMPA 5C4JH 1WTOA 2ZPHB 1L0WA 1YN8A 5IGGA 1G6ZA 1SE2A 5EJWA 1EZZB 2F2XA 4DAVA 4OX9Q 4R55A 2PMZB 2YU9H 3M3YB 1X2QA 2UUCL 3JCMc 2NYSA 4AMCA 4H0LC 1G3TA 1G8XA 1BI0A 2XHCA 2F0IA 5EKLA 3MP6A 2HHHL 1VDZA 2K7VA 4B3TL 2L12A 2QGQA 2EQSA 1ZSZB 5BR8Q 4B3SL 2JZ2A 4EGVA 3HFZB 1QKWA 2DUDA 4PZ8A 3RN5A 1R0BG 2CUDA 1CI3M 5DY9A 4QVCA 2P4TA 2PVGB 3S17B 4KJNA 2F0VA 1WTXA 1Z47A 5GAOn 2QEXQ 4J6YA 2EJGA 3BDUA 1IKLA 1JC7A 2K05A 4IUNA 1KJWA 4IFDI 1V1QA 3I35A 2K79A 4C2MH 1FYNA 5CC4A 4GKJQ 3T1HL 3FDTA 4JOIA 1QKXA 2Q2HA 4A3CH 4A3JB 4N9PA 4UAIA 2QA4Q 4DR5L 2H1EA 3DWPA 1SRMA 3MEWA 1CFMA 2FPEA 2EGEA 3MHXA 2Q2UA 4DBHA 1LTBD 2CREA 4MDXA 3FEWX 3AMUA 3P1HA 4DXGA 1D6EC 5JJIA 4TSSA 3CMEQ 2EPDA 4QIWB 4LF6L 4GY5A 4QVDA 4DR4Q 3RD4A 4K2KA 4QQ6A 4LDYA 4UDUC 3TDQA 4DAYB 2AQ3B 4HN7A 1U1SA 2UU9Q 3OYNA 2K9GA 2XWJB 4F7UG 1RLQC 2LT1A 3W3AA 4A3DB 3EROA 2CYZB 2XTIA 4AYBB 1WHKA 5CV7A 3PMTA 1WCMH 1EY8A 1EFWA 3PNWC 3H94A 3J80i 3J80E 3QYHB 4DR2Q 5I4DA 3G7LA 3K5NA 4IIOA 1RF2D 4JI7L 1AWWA 1Q3LA 3PSIA 2CP6A 1RLPC 2WKDA 2RHUA 2KA7A 4OO1I 3MKDA 2AUKA 2K5VA 1G83A 1NMFA 3REBB 3DHQA 4LXCA 2F0MA 1LJOA 1I4K1 1AE2A 5J22A 4M7DF 4C3HG 1AT1B 4L5QA 4GLXA 3GTPH 3PIOA 2X4WA 1UUEA 1EIGA 2DD4A 3M58A 2K7AA 4XTUA 4I7AA 1HA5A 3M9QA 1I50H 1PFMA 1PRTD 3D6CA 3HKZE 4NW2A 4D8DA 1Q86U 5ELDA 2O5JC 4BACA 2K52A 2BA1A 3RLNA 4N4HA 1JB7A 2LDMA 2F4VL 4NXNQ 4A4FA 3CCSQ 4PLIA 1YITT 2VB6A 1M9SA 1Q86R 3L0OA 1QZGA 3CCMQ 4DV0Q 2HD3A 2F0QA 2A5HA 4EQPA 1IXRA 1KNAA 3E9HA 2BCOA 1J5EL 3CBPA 4IFDJ 3MFYA 3D3RA 2NVYB 4NMZA 2CZ6B 1VQPA 3TBIB 4LD9K 4KGXB 4RTUA 1TSFA 2YUQA 1S40A
chains in the Genus database with same CATH topology
2X4XA 5IP9H 4DV5Q 1K9MU 2X4YA 3KDFA 4J7IA 3PO3G 2E41A 4F7UF 4M7AG 3H0GG 1I5LA 1NTGA 2ZJRA 2QEXA 1QVGA 5AJ3Q 2QA4T 4HT8A 2PQAB 4A3BH 2E5LL 4Z02A 1M1KC 5FROA 4HCBA 4C92G 1X75C 3G71T 3LLRA 1H641 1UE5A 3V8LA 3FP9A 3P8DA 2R5AA 3OYEA 4A3MH 1Q81U 3CF5A 2RK2A 3OYIA 3CAMA 2ZTEA 1JRIA 2JTMA 4C8QG 2UU9L 3LYIA 2MO0A 4V2SA 2V1CC 2GCXA 5KE2A 5CAIA 4C8QC 4LUZA 3PUXA 1B34A 3CMEA 3U4VA 1E1OA 4OGEA 2RO0A 1YNXA 5IP7H 4DV5L 1XNIA 1P16A 4PZ6A 1Q1BA 2EQUA 3OMCA 1I3QH 2MO1A 1WCMG 5A0LA 3S14H 1LM0A 3M5AA 1UGPB 1Q82C 3CC2A 1I81A 1ZQ1A 3RIRA 1HZ9A 1TWAH 2JNGA 1WNLA 4E7HA 2F5KA 1VQAA 3UWNA 1N32Q 4DR7Q 1VS0A 4EPCA 5GAN5 1Y14B 3CW2C 5IYCH 3HOYH 2R93G 4M78D 3CP0A 2JTFA 1UGRB 1HR0L 3MEVA 3E9FA 3CQZH 3CMAA 4DQ2A 4HIMA 4NXML 1QP2A 4A3IG 2JQOA 3S2DH 1VCIA 5C3EG 4OX9L 3OYKA 1VQLT 4X62Q 2DK3A 3FDRA 5C44G 3GNGA 1WGSA 1K73U 1JE5A 2RD1A 3CC7A 1GO3E 1IL2A 4C0GA 3PT9A 1EUJA 2PVOB 3K8AA 1JJCB 1QVFS 2OTLT 4HT9A 2ZPBB 5GAHC 3J81E 1N9WA 1UEBA 4R4OA 3RKYA 4GOPA 1OXTA 3J7ZC 4PJOD 1OZ3A 4A3FG 3A8GB 5CKBA 4PJOA 5LMNW 3TS2A 3I55A 4A3BG 2JA7G 5EAYA 4DV4L 2DVEA 1BI2A 2P0QA 1KQ2A 5LJ3j 4R4TA 3QYGB 1Q1EA 3VV0A 2LCCA 4C92C 3VJPA 3WWVA 1TXYA 5D6WA 4GOPB 4A3JG 3RKXA 3RERA 1M1KU 4LFBQ 4QY7A 1QVCA 4O0AA 3OW2S 3H8ZA 4OP0A 2IX0A 2A3LA 1K8AU 2VUMH 2XDBA 1HNZQ 5HK3A 3OYGA 5LJ5f 2VQFQ 4NB3A 4C92B 4R4QA 1EIFA 1PH4A 2K3XA 3HOXH 1MJEA 2PI2E 1PVOA 3LWHA 4NL2A 2RJEA 4F7UE 5LJ5h 3LGJA 3HHTB 5A2QE 5HK0A 1YITA 1IZ6A 2LVMA 1IBKL 2GF7A 4C92F 4DR6L 5J3BA 5KH6A 3ER0A 2UXBQ 1FJGQ 4LF8Q 1BBUA 4DR3L 3DLLA 4PL6A 2JN0A 4HCCA 2B8AA 4A93H 1Y1VH 3SD4A 3B6YA 2D6FA 4OF1A 4BI4A 2PU9B 1HZBA 4NL3A 4BB7A 3CD6T 4RKUE 3F70A 1O9SA 1PHJA 4OWXB 4OWWB 1KL9A 2I0QA 4HJ8A 4M75F 2CQOA 2XD0A 1PFSA 2E5QA 4PMWA 4QJFA 4E47A 4X65Q 3P8HA 5GAEC 2YV5A 3CEYA 4YWKA 3DB4A 4BXXG 1YJWT 3ME9A 4ZGJB 3UDFA 4DUZL 3F2CA 4TQUS 4XK8E 3GTLH 5L8RE 3GDEA 3NFCA 5GAGC 3LH0A 4JI8Q 2ZPEB 5FU7B 1EQQA 1HNWQ 1MHNA 2K4YA 3EIVA 4HA8A 1LUZA 5FRMA 4L5TA 2D0PA 4EMHA 3OYYA 4YHHL 1QUQB 1D8LA 4M78B 1OXXK 4FT4A 1KD1C 1AHJB 2QQAA 3GTKH 5HY6A 2RJCA 3CPFA 4M75E 2UXDQ 3RLFA 4C8QD 3RUXA 4JI5L 4A3GH 4ELYC 1LOJA 2GVAA 2R92G 1YJWA 5GAOp 3FJPA 1IBLQ 2B3GA 4F7UA 2PUOB 4XQ3A 4C5GA 4A3LG 3A5UA 4M78A 2H5XA 3JSCA 5C0XI 1K9MC 3KF6B 3M53A 2KENA 3L7ZC 3G6EA 1N33L 2RM4A 4BUGA 2NVQH 1OYXA 3JRZA 3CCJA 2EWNA 1L2FA 4NPSA 4GN4B 2ZPGB 1YIJA 4XAXB 3V8JA 1HXDA 2CCZA 3OYFA 3K7UC 5GAN4 3JB9J 3RNUA 2KSSA 5CQYA 4LF9L 3GP8A 4DV3L 4YCUA 3JB9H 4M78E 1PV4A 3NEMA 4IPHA 4HJ9A 4UP7A 4LDXA 1N9SA 1NJIC 1E3PA 4WJ4A 2C35B 3M4OH 1VQKA 2VS1A 1HNWL 5M9OA 1UE1A 2AWOA 1IREB 4JDSA 4IUVA 3HKSA 2K5IA 3M55A 1Q82U 1VQ5T 3I4MH 2K14A 2HQLA 2DKGA 5M3MH 3TU4K 1CSPA 1H3ZA 4C92D 4C8QA 2QXFA 3AFPA 3OSSC 3BU2A 1Q12A 1N6AA 4DR2L 4A3KH 2XK0A 1N8RU 1NBWA 1SLJA 3O8VA 3C12A 5ELNA 1WQWA 4B9WA 4A3MG 5KE3A 2RJFA 3JCMe 2JA8G 4LFBL 2Y4XA 1EIYB 3VDYA 5E7NA 3GTGH 3QPHA 1BI3A 1E22A 1Q81C 4GN5A 2V8JA 1BVSA 3GPLA 4L5GA 3CCVA 4B3RQ 2V8KA 4ME3A 4HKEA 3T1YQ 1U8RA 3K80C 4JI1Q 2WSCE 4OB2B 4WF2A 3UDIA 3PF4A 3X25B 4A3GG 2RHYA 2ID0A 3LGLA 2PMZE 1IBMQ 4A3LH 1R8OB 4Y28E 2L3RA 2OTJA 2JA6G 4JV5L 3CXCS 1SRUA 5C3EH 4C5HA 2LX9A 2YLBA 3CCQT 4A3DH 5FJ8H 2E1HA 4DK3C 3K81C 3E1SA 2DTIA 2JE6I 2OCEA 3OS5A 3D0FA 4BY6B 3TREA 4OWTB 1KC8U 4EDUA 3Q8DA 1QW1A 4DUZQ 3L2VA 3OS0A 1M4ZA 1O7IA 4GNXB 2VGNA 4BA2I 5GAOr 3SWNB 4BBSH 1ZBXA 3J80c 2FL7A 3VUZA 1Y71A 4LF7L 4M78C 3WVDB 2NVTH 1L1OA 3ZEHA 2WSEE 4YY3Q 1IYJB 5GAN8 1N32L 3P8BB 4HIDA 1PYSB 5M5XH 2Z6KC 3NENA 4JI4Q 3G48A 1M90C 4YWLA 1V29B 2IY5B 4C8QB 5GMKj 2WB1G 1J6QA 5IYDH 3FLGA 4JJNK 4OXPA 4KHZA 2KVQG 4LF8L 2VUMG 3PTAA 5DLQE 1XMQQ 3AHUA 2F5TX 3KJOA 2N78A 1I94Q 4DR6Q 3I4NG 4IOAA 3JCMP 4JI0L 4LF7Q 3DM3A 1N9RA 2B29A 4J7FA 5LJ3f 4WJ3M 1VQPT 2CKZB 4ATOA 2L89A 5IY0A 4TVRA 1WFQA 2E10A 4PNOA 4A54A 4GLKA 4X62L 2EIFA 5LL6S 5H1SE 4JI2Q 3OYMA 1JJ2S 1KQSS 2IHEA 3GTJH 3KLWA 3HRUA 1TWHH 1BIBA 4IUPA 3PIPA 1UE6A 1VQ6A 4E7JA 1Y1WG 2EJ9A 1HNXQ 3WVEB 1G291 4J8OA 3RR5A 4MNOA 4KUIA 4O5VA 4MZTA 3L1AA 3ULJA 4DV7Q 2JUFA 2EAYA 2KHJA 4M7DC 1X3EA 5K36G 3E19A 3CCUA 4B3RL 3PUZA 3JCMb 3F8TA 4JI3Q 1MKHA 5GAN6 4C3JH 3INZA 2ZJQA 3CCSA 4FU6A 4APVA 4MTNA 4IPCA 4C92A 4M75A 2F52A 1KIXA 4J83A 3L2QA 1BIAA 1MIUA 2K4KA 4P71A 2UUBL 2EKOA 5JEAJ 4EQ5A 1QUQA 1UB4A 2WP8J 4JI7Q 4A53A 1X65A 3STBC 2R93H 4BI8B 1N36L 2Y4YA 1CUKA 4A93G 5A0GA 2K2VA 2X4JA 4AQYQ 1WJRA 2NVXH 3V7SA 1PH1A 4N4GA 5GAMg 3UE0A 4X6AH 4KHPQ 1HR0W 2EYQA 3G4ST 2YTXA 2VZAA 5I21A 5FLMG 3GTOH 1WOCA 3HOZH 3CCEA 4HJAA 3OS2A 4HCZA 1CKOA 1XPRA 5FRNA 2V8IA 4M77D 2WAQE 5CQXA 3AYHB 3GTQH 4M78F 1PH8A 3KF8B 3IRBA 2ATWA 2RH2A 1YVCA 3W1GA 1UGSB 4A4EA 4FL6A 2R92H 3E9IA 4JG2A 1KXLA 3MEAA 3M4PA 2AMCB 3H3VH 4R1JA 3JCMd 4AQYL 4X64Q 1VQNT 1YZ6A 2RI5A 3S16H 2DJZA 1SROA 2XDDA 1HZAA 4DUYQ 3JB9D 3SB2A 4TVAB 4Y52H 1K83H 3FHWA 3KOJA 3PGGA 5GANg 5ELOA 5LJ3h 2FVUA 3L2PA 3JCMW 2K5HA 1I94L 1VQKT 2L15A 3CCST 4C0FA 1YHAA 3HOUG 2E64A 1Q86C 1EWIA 3OYCA 4PLLA 1G3WA 4POGA 5FU7C 2N8NA 2K5NA 3QZ5B 2RCNA 5IAYA 2OAUA 3OBWA 3JCMf 4M7DD 1N8RC 1X3GA 1B7YB 4HJ5A 5A0DA 4M75D 1K8AC 1HJPA 1PYBA 4JUVA 1VQNA 5GAN2 4PG3A 2XG8D