1X2KA

Solution structure of the sh3 domain of human osteoclast stimulating factor 1 (ostf1)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
GSSGSSGKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Osteoclast stimulating factor 1
publication title Solution Structure of the SH3 Domain of Human osteoclast stimulating factor 1 (OSTF1)
rcsb
source organism Homo sapiens
total genus 6
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1x2kA00
1I0CA 3H0IA 3CQTA 4Y92A 1BK2A 1Y57A 2J6FA 4Z88A 2JMAA 4WCIA 3TSZA 1VYVA 2LCSA 4RTVA 1RLQC 2JMCA 2PTKA 2FPEA 1WFWA 1HSQA 2ESWA 2OJ2A 2DM1A 2EYXA 2KRSA 4F16A 1SSHA 5L23A 2DYBA 3VS7A 1PRLC 2LP5A 2DE0X 2RQUA 2F2XA 1B07A 1WLPB 1OPLA 1X69A 2O31A 4RTWA 3UF4A 1OEBA 1TUCA 1PNJA 2CH4A 1AZEA 1GCQC 1X27A 3JV3A 2D8HA 1M3BA 1GCPA 1NEBA 4ESRA 4LE9A 2GTJA 2BZXA 1ARKA 1B3QA 2K6DA 2KT1A 4J9CA 2FPDA 2EGAA 4JJCA 1K76A 2DNUA 1VYTA 1AWJA 4CC2A 2A08A 4KRTA 2YUQA 5ECAA 2EGCA 2DX1A 2DVJA 1NYGA 2E5KA 3A98A 1JEGA 1KJWA 3SHWA 1WXUA 1VYUA 2L3QA 3H0HA 1GCQA 1UFFA 2KRNA 4RTTA 1JU5C 4LUDA 2J06A 3RBBB 5GJWB 1SHFA 2CREA 2I0NA 4DEXA 2BTTA 1OOTA 2GTOA 1T0HA 1TG0A 2KE9A 2IIMA 1UHCA 2DA9A 4J9GA 2JS2A 2RPNA 1YNZA 2P4RA 2AZVA 1QCFA 2J05A 1WXBA 1Y0MA 2SEMA 1MUZA 3I35A 1AWXA 1ABOA 1WX6A 2EQIA 4LUEA 2KGTA 2G6FX 3VS3A 1WA7A 2HSPA 2YUNA 3NHNA 4AFUC 1X6GA 2LX7A 1H3HA 4HVUA 1ABQA 1NYFA 2SRCA 3M0QA 2LQNA 3O5ZA 1M27C 2CH4W 2ECZA 3IQLA 1MV3A 5FWCA 2KEAA 2PNIA 3NGPA 2RF0A 3UA6A 2D8JA 4AFSC 3M0UA 4CC7A 2O88A 2DL3A 1GBRA 1WDXA 2W0ZA 2RQVA 2C0IA 1BBZA 2A28A 2A36A 2M51A 1PWTA 2DL5A 2DRKA 1M3AA 3ZL7C 2CT3A 1ZBJA 2O9SA 4J9HA 3H41A 1NM7A 2OI3A 4AG1C 2EBPA 3THKA 1G83A 3EHRA 2ROLA 2DBMA 2AZSA 3PVQA 1N5ZA 2HCKA 1CKBA 1W70A 1YP5A 3EG3A 2V1RA 1GL5A 2JT4A 3U23A 4FSSA 1JXOA 4AFQC 2DILA 1UUEA 3VS0A 2FPFA 3M0RA 1GFCA 1PKTA 2FRYA 2YSQA 4OMLA 2KNBB 2DF6A 3EG2A 1M8MA 4J9IA 2RNAA 2K9GA 4J9EA 1VA7A 3GBQA 2DL7A 1ZX6A 2L0AA 2JM8A 4J9FA 5HCKA 3I9QA 4DEYA 4JJBA 2GNCA 3VS6A 2FO0A 2KR3A 1E6HA 2YT6A 4OMNA 2QDLA 1RI9A 1W6XA 3TVTA 2LNHB 1AOJA 4K11A 4GLMA 1UDLA 1M30A 2RQTA 2X3XD 1KSWA 1X2QA 2XMFA 1K0XA 1AWWA 1K1ZA 2B86A 1SRLA 3FJ5A 4X1VA 1PRMC 1X43A 1RLPC 1ZUKA 4OMOA 3M0TA 1OV3A 2CUBA 1TUDA 1X6BA 2KYBA 1J3TA 1FYNA 1V1CA 1T3SA 2ABLA 1U5SA 4RTXA 1UJYA 1T0JA 1QWEA 5I11A 3RNJA 2FEIA 2C0TA 2ED0A 2D0NA 2RN8A 4OMMA 4D8KA 2K2MA 2FRWA 2FG0A 4CC3A 2HEQA 2JS0A 1YWPA 4RTZA 4J9DA 1H8KA 1NEGA 2GGRA 1U3OA 1UECA 2LJ0A 1OPKA 2AKLA 2CSQA 4RTYA 1Z9QA 1JXMA 2KRMA 4RUGA 1QLYA 2X3WD 2ENMA 2O9VA 2M0YA 3QWXX 2KXDA 2C0OA 2AKKA 1ZSGA 2EYZA 2NWMA 1K4US 2HBWA 1PHTA 1I07A 2RQWA 2EPDA 1YCSB 2MIOA 1GFDA 5IHIA 1GRIA 2JW4A 5IXBA 1AWOA 2DRMA 1Z9ZA 1IO6A 3VS4A 1GBQA 1T3LA 2KXCA 2GBQA 4CC4B 1UHFA 2YDLA 1CKAA 2OAWA 3TSWA 4OMQA 3I5RA 4ORZA 1BB9A 3QWYA 4Z89A 1YWOA 1QKWA 4LNPA 4J9BA 2JXBA 1AD5A 2JTEA 2DMOA 4IIMA 2ROTA 1WXTA 3PVLA 1UE9A 1W1FA 4JPBW 2LJ1A 1M3CA 2KT8A 4AFZC 1SPKA 3REBB 1NG2A 2CDTA 2V1QA 4F17A 1U06A 2CSIA 2KBTA 1I1JA 1XOVA 2CT4A 2EW3A 3SEMA 2MOXA 2W10A 4D8DA 2H8HA 4R0KA 2J6OA 3EG0A 2K79A 3REAB 2GQIA 1EFNA 1E7OA 2DLPA 1ZUYA 4JZ4A 2O2OA 1RUWA 1G2BA 3PE0A 1HJDA 5FW9A 1QWFA 3EHQA 3VS2A 1NLOC 5GJVB 1AEYA 2K3BA 5IXFA 3M0SA 2EKHA 2L3PA 5IHKA 3NPFA 2EGEA 1AVZC 2F2WA 2L2PA 2K7AA 2DL8A 2LQWA 1CSKA 2RQRA 2L3SA 3NMZC 4F14A 1SRMA 3VS1A 1UGVA 1NLPC 2HDAA 4HVWA 2CUDA 1WIEA 3H0FA 3UATA 3M0PA 1BU1A 5I22A 1K0SA 1WI7A 5EC7A 2BZ8A 1LCKA 5IH2A 1AZGB 2YUOA 2RMOA 4AG2C 3KFVA 4HCKA 4A63B 2JM9A 1SEMA 4LN2A 1UJ0A 3LH5A 2D1XA 1K9AA 4E6RA 1KFZA 4Z8AA 1YN8A 2YUPA 1ZLMA 1SHGA 1HD3A 2EYWA 2KROA 3UA7A 2A37A 4EIKA 4ZNXA 5IHNA 1X2KA 1UG1A 1ZUUA 3VS5A 1QKXA 4HXJA 2DJQA 3C0CA 3VRZA 1PKSA 4RTUA 2LMJA 1H92A 2F2VA 1JQQA 2MCNA 4JJDA 1S1NA 1KIKA 2VVKA 2KYMA 3R6NA 2DBKA 3EG1A 2BZYA 2EVRA 2PZ1A 2LJ3A 1A0NB 3EGUA 3I5SA 2LZ6B 5FWBA 1FMKA 4HVVA 4GBQA 3ULRB 3VRYA 2AK5A 1UTIA 2J7IA 1WYXA 2ED1A 1JO8A 4QT7A 1MV0B 2DL4A 2VWFA 4OMPA 4IIOA 4M4ZA 2NUZA 2VKNA 1E6GA 4JZ3A 2J6KA 2EYYA
chains in the Genus database with same CATH superfamily
4KULA 5LJ5d 1TUGB 2J6FA 2MWPA 4Z88A 2PVDB 4WCIA 1D0ZA 5FU7C 1RABB 2FPEA 4NOYA 4C92G 1WQ7A 2EYXA 2RJCA 4O6JA 4F16A 1Y71A 1SSHA 4XU1A 5FU7B 3CXCA 2NUTA 2LP5A 1JJ2A 2F2XA 2XKOC 2O31A 3UF4A 1OYXA 1KQ2A 5DLOA 2R5MA 2PVOB 1GCQC 5IN1A 2LVMA 4M78F 4HT9A 5GANg 2E10A 1KK7A 1M3BA 4ESRA 4FIBA 5GMKh 3HSBA 5KYXA 5GAMj 2JTMA 1WHLA 3G4ST 4OMFB 3OYFA 2GTJA 1S72A 4FW1A 2FPDA 3V8KA 4JJCA 5A0GA 4N0AC 3JCMP 1OZ2A 4AMCA 2QI2A 4CC2A 4BE0A 4KRTA 1MMAA 1TTHB 3PFSA 1MMDA 4KUDK 5HK3A 2EGCA 1NPRA 2LQKA 3L2QA 1NYGA 1JEGA 3CMET 3SHWA 1D0YA 3H9NA 4LDUA 2L3QA 1UFFA 2L8DA 3CEYA 4RTTA 4LUDA 3MHXA 2GTOA 3OS2A 1T0HA 2KE9A 2IIMA 2M9UA 2X4WA 2ATCB 2D6FA 2QEXA 1YNZA 1QCNA 3UPUA 2YHTA 2Y4XA 2K3XA 1YJ9Q 1WXBA 1PG5B 1Y0MA 5GANd 1AWXA 1WX6A 4C0DC 4OGEA 1RAGB 5D6XA 3VU3C 3JCMQ 2KGTA 3HRUA 1KHIA 1LVKA 4C0DB 3S3NA 2YUNA 4JLIA 3OYKA 2LX7A 5GAN8 2EJ9A 2NUPA 3OBYA 1H3HA 3HL8A 3DKMA 4E7ZA 1VIFA 3GIBA 3CCLT 3O5ZA 1M27C 5GAN6 2ECZA 3OS0A 3HPWA 5KH6A 5FWCA 4M7AE 3EFRA 3CCQT 4J6WA 3M4GA 4AFSC 2O88A 1GBRA 1WDXA 1VIEA 4FYWB 3CBPA 3KUFA 4BI4A 2A28A 3OB9A 5KYWB 2Y4YA 3QJ6A 5DY9A 1QVGP 2DRKA 3OYDA 2JTFA 1IREB 4J9HA 1Q7YC 4QQDA 4EMKA 3H41A 1KD1R 4C5GA 2DVEA 4MZMA 3EFSA 4IKFA 1TOVA 1W70A 2QA4Q 3BE3A 2JT4A 4ZTFA 5J26A 3CCVA 1UUEA 2FPFA 3M0RA 4C8QE 5CK9A 1RL2A 1YIJQ 2KNBB 2DF6A 4J9IA 1Q82R 1KHCA 3QDRB 5GAMg 2L0AA 2JM8A 4A54A 3C12A 2GNCA 3MCAB 1PSEA 2ZPHB 3SWNC 5KCHA 3ME9A 3CCJQ 1TU0B 1HK9A 2CGHA 5CQXA 3JB9G 3SWNB 2P4TA 1KSWA 2CP2A 2XMFA 1K0XA 1ZSZC 2H3EB 3GP8A 4OB0B 1X43A 1RLPC 5KYUA 1WHKA 3UDCA 1ZSZB 1TUDA 2ZPGB 2XDDA 3JCMg 2DYIA 4JUVA 1J3TA 2CZ6B 1T3SA 2ABLA 3GPLA 3EG9B 3QG1A 1K9MC 1YI2Q 3ZBDA 1QWEA 5I11A 2VGMA 4JRIA 3RNJA 2HL5C 1YHQA 1KD1U 2M02A 2CP5A 4M7AC 2C0TA 1YJ9T 2D0NA 2X4YA 3LX7A 4OMMA 2K2MA 2FG0A 4CC3A 2DK3A 2DD5A 4M7AB 3CXCP 2V8JA 2JS0A 2VUBA 3RESA 2GGRA 1M4ZA 2ZPIB 1U3OA 3CMAA 3HRTA 4DQ2A 4RUGA 1ACMB 3V7SA 2ZPBB 3CCEA 1Q82U 2EYZA 4J8OA 1BI0A 4C5EA 1GFDA 1SF9A 5IHIA 3SFMA 5KYYA 1Z9ZA 1R77A 1WJQA 3VS4A 3E9FA 1OX8A 2KXCA 4C8QC 1LJOA 1UHFA 2YDLA 2OAWA 4LD9K 1N8RR 3I5RA 2EKOA 4C8QB 1BB9A 4XAXB 3QIIA 3JCMd 4LNPA 2JXBA 2DPPB 5CKEA 5DM7R 3WXMB 1WXTA 4NS5A 1UE9A 2GCXA 4JPBW 1NJIC 2CKKA 1M3CA 2KT8A 1WHJA 5GAN5 3CPWS 1ZA1B 2CDTA 2NLUA 3QDFA 2QA4T 3FJPA 5LJ5e 2MWOA 3OY9A 1VQOT 1I1JA 4IUTA 1UGSB 3EGDB 4QQ6A 3G6EA 2EW3A 4DBQA 2OTJA 1S72Q 1YIJT 1D3BA 3RR6A 2DEQA 4D8DA 4R0KA 2GQIA 4FM4B 4XTUA 1M1GA 1RUWA 3PE0A 2MMPA 3EHQA 3X25B 2M1HA 5LJ3e 1VQKT 1FX7A 5IXFA 2GFAA 1VQ9A 3NPFA 1VQ8Q 5EG2A 4JS4A 2F2WA 2KK4A 2DL8A 2K3YA 4YTLA 2L3SA 1SRMA 3EH2A 1UGVA 1NLPC 5CKBA 3JCMW 2FYKA 1N8RU 4GY5A 2HAXA 1WIEA 1BU1A 3OYMA 5J39A 4QVCA 5EC7A 2QEXQ 2WSFE 5IH2A 1M90R 4M7DE 4BD3A 1YI2T 2YUOA 2RMOA 1M1FA 4A63B 2RB6A 4LN2A 4BUGA 1F1BB 2EAYA 4MDXA 2P0QA 1B7TA 1K9AA 4QVZA 4E6RA 2RI5A 3G71Q 3INZA 3PGGA 3X28B 2ZPFB 4M7DD 3O8VA 2KROA 4PJOE 2COWA 4LD6A 1QQJA 1ZUUA 1WPYA 2DXTA 4KH1B 5GAN7 1PKSA 4RTUA 2LMJA 1HYOA 4XTZA 5GANe 3I56A 1KIKA 4XK8E 3RKXA 3H6ZA 2BZYA 1Q81C 1N9RA 1OULA 4JLGA 4GBQA 3OW2S 2EYQA 3SD4A 2ED1A 1JO8A 2QYZA 2RO0A 2NUZA 3QXEB 1E6GA 2J6KA 3MP8A 3TEEA 2MI6A 3H0IA 1W2BP 2R58A 3TSZA 1M90U 3JCMb 4FYVB 2QTVA 5A2QE 1G8XA 1W2BS 5GANh 3CCVQ 1KC8R 2OJ2A 4IUQA 5L23A 4PKCC 1PRLC 1UEBA 1Y96A 2RHZA 1B07A 3A8MB 1WLPB 1OZ3A 4XTXA 4ANJA 1TUCA 2CH4A 2XI9A 1S72T 1AZEA 5FRNA 3FEOA 3DLLA 5GAOm 4M78E 1GCPA 5CKDA 3EFOA 4HCBA 3KBGA 4M77C 4J6XA 2COZA 1K76A 3CC2A 4GLKA 2DNUA 3QPHA 1VYTA 4M77B 3PIPA 2BKDN 7AT1B 2D0QB 3RMSA 3BY7A 3JB9I 1VQ8T 2QQ9A 3PT9A 2DEUA 2FL7A 3ZEHA 4C92D 2DX1A 2EQKA 1V29B 5AYFA 1KJWA 4PJOB 1WZOA 3HP9A 1WXUA 2F5KA 1GCQA 5GAOr 1JU5C 4CRIA 9ATCB 4VUBA 4M77G 1H641 2ZAEA 1QVFP 2CREA 2I0NA 4DEXA 2BTTA 1OOTA 3CCUA 1TG0A 3L2UA 4PLLA 1UHCA 3JAME 4J9GA 1QVFS 3G71T 3C95A 3FB9A 3CMAQ 1KC8U 3VJPA 2J05A 1KQSS 1MUZA 2EQIA 1QW1A 3CCSQ 4LUEA 5AT1B 4P5NA 2G6FX 3VS3A 2HSPA 3M5AA 2DETA 1BIBA 3NHNA 4PFPA 4UC4A 4AFUC 2HZYA 4JRPA 1PC0A 4KGVB 1NYFA 2SRCA 3VUZA 3M0QA 2LQNA 3ASKA 4Z02A 3FLGA 4B6MA 5GAMe 2RK2A 1VQMA 4WF2A 1WNLA 2PNIA 1MHNA 3UA6A 1V76A 2LC4A 4M78C 2W0ZA 2R57A 2CZ0B 4J6YA 2YLCA 2C0IA 1M9SA 4M78B 4KUIA 4FW2A 1PWTA 3WVDB 1TXQA 1M3AA 3I55Q 4FSXA 2CT3A 1ZBXA 3MJXA 1WQWA 2DTHA 4ELYC 3JCMe 4C0GA 1B34B 1NE8A 3THKA 1G83A 3G6EQ 2ROLA 2OTJQ 3PVQA 1I5OB 2HCKA 4M75G 2K5IA 2O4XB 4BB7A 4LXCA 1YJNA 3U23A 4FSSA 4XTYA 2DILA 3GF5A 4C92F 3JCMJ 3SDZA 5LJ3d 2OTLA 3M58A 1JRIA 2PQWA 2XD0A 4E7IA 2JZ2A 1WJRA 5KYWA 4OMLA 3UT1A 3EG2A 1VQ7Q 1M8MA 3CC7A 4J9EA 2RA2A 1ZX6A 3X26B 3I9QA 2HKNA 3AT1B 4DEYA 2F69A 5CO7A 2FO0A 3HFNA 3GOXA 2V8KA 4BDZA 1RI9A 4BACA 2RM4A 1W6XA 3G1JA 2LNHB 5DLQE 4RG8A 3JCMh 5GMKj 1K8AC 1UDLA 1M30A 3OBWA 2RQTA 1PD1A 1GXIE 4PLIA 1X2QA 1AWWA 1RAFB 1SRLA 2V26A 4X1VA 1PRMC 2JOYA 1X6BA 4IUUA 5IT9E 2XU8A 4JDSA 3E1SA 3SB2A 4RTXA 4OF1A 1OI1A 3V8LA 2RN8A 4OGCA 2HEQA 3CCST 4JJNK 3SWNA 4F7UB 3CC4A 5M9OA 1NEGA 1K73R 1R8OB 2M16A 3QO3A 2LJ0A 3A5ZB 3JB9D 2CSQA 3CCMQ 2QGGA 2E70A 2DTIA 5KE3A 1ZSZA 1XNIA 3X20B 1QLYA 2X3WD 2Y90A 2EQJA 2O9VA 3QWXX 1C6VX 5I2SA 3CCRA 5HKCA 2NWMA 1K4US 3EG9A 2M0OA 3RKYA 1BCOA 4L5GA 4R55A 4F7UG 3BW1A 3MO8A 1KD1C 2EPDA 2JW4A 1AWOA 1VQLA 2EWNA 2E41A 3CD6Q 2KDSA 3TSWA 4OMQA 4OP0A 3META 4ORZA 3QWYA 1QKWA 4J9BA 4PJMA 2DKGA 1WGSA 4IIMA 2DJZA 3PVLA 1IGQA 3I55T 1ZA2B 2QQRA 1QVGS 1Q82C 3WVEB 2DXBA 1WHHA 5GANf 1PCXA 3M53A 2DXCA 4AFZC 2OAUA 5CIUA 1I4K1 2RHXA 2CSIA 2QASA 1K73U 3SEMA 4KGZB 2EJFA 3PNWC 5A0DA 1VQ7T 2GF7A 3CC2Q 1VUBA 2H8HA 4ZN3A 3EG0A 3REAB 1IZ6A 3OSSC 4HCZA 5CR2A 2O2OA 5J3BA 5FW9A 1VQNQ 3A8GB 3R6OA 1AEYA 4PL6A 2L3RA 2JUFA 4RMOA 2EKHA 4BE1A 2A7YA 2VASA 5IHKA 1PSFA 1AVZC 2L2PA 2LCLA 2XIDA 3OW2A 1I81A 3G4SA 3M4YA 1BI2A 2HDAA 1BYMA 4HVWA 2MF2A 3G7ZA 2RI3A 3JB9F 3M0PA 1K0SA 1WI7A 2NYSA 1R0CB 2RJEA 3L2WA 1EZZB 3JB9H 2YRCA 3KFVA 3OQ5A 2JM9A 4HT8A 4A4EA 1JBMA 1UJ0A 2KAFA 3CMEA 3M57A 2QGFB 1JJ2P 4Z8AA 1VQPA 2CYZB 3OYAA 2YUPA 1ZLMA 3CXCS 1SHGA 1TH7A 5C6SA 2EYWA 3UA7A 2A37A 2RD1A 4EIKA 5GAMd 3CCMT 5IHNA 1X2KA 1IGUA 3E19A 3VS5A 1QKXA 1YITQ 3VUBA 3C0CA 2IG0A 3LYIA 4HKEA 4II1A 3VKIA 2MAMA 2P0PA 4BDYA 3E2UA 2HSEB 4M7AG 2DFUA 2YWWA 3L2VA 3RUXA 3FC3A 3EG1A 2FZGB 2LJ3A 1IHWA 1A0NB 2LZ6B 1FMKA 2BUDA 1Q95G 3VRYA 3ULRB 1FMVA 3CD6T 3EGXA 2AK5A 5GAOl 4E7HA 2DIQA 4X9CA 4QT7A 2O01E 3M59A 3T9NA 2VKNA 4V2SA 4QQGA 1I0CA 2FZKB 4Y92A 1BK2A 1Y57A 4FYXB 2VV5A 2BIVA 2JMAA 3VYGA 1VYVA 2LCSA 3CCQA 1RLQC 2JMCA 2PTKA 4C8QG 1G3SA 1WFWA 1HSQA 2KRSA 3A8HB 4KGXB 1U8RA 2DE0X 2RQUA 3OS1A 1MMGA 3F70A 4RTWA 1D1CA 4ELZC 1LOJA 1VQ4A 1MGQA 1X27A 3JV3A 3PMTA 3CC2T 2D8HA 4TVRA 1RAEB 1NBEB 2PU9B 4LE9A 1ARKA 2BZXA 2RHIA 1VQNT 1B3QA 5KYUB 5HK0A 1MMNA 2KT1A 4J9CA 3CCJT 3ER0A 2COYA 2EGAA 1M90C 2WSCE 1N6AA 3C4SA 4N4IA 2QQBA 4E7JA 1Y7XA 3LLRA 2A08A 3M9QA 1IB8A 3JCMf 2YUQA 3FIFA 3FRNA 3RERA 2KI7A 5ECAA 5LJ5h 2DVJA 2JNGA 2E5KA 1G3TA 3KXTA 5GMKi 2LTOA 1RI0A 2XHCA 3GLXA 3HTRA 1U1TA 1Y07A 3V7CA 2J06A 2KSSA 3RBBB 5CCAA 5GJWB 1SHFA 4RCCA 1EIFA 3OYCA 4M77A 1VQ5A 2E5QA 1QMCA 3LGFA 1ZQ1A 3J81E 5LJ3h 2CP7A 1QCFA 5FU6C 2CS7A 1M1KR 1ABOA 2X4XA 5KYYB 5FU6B 5FROA 1YITT 3CCRQ 4C0FA 1OX9A 3EH1A 5HY6A 3QSUA 2DZCA 2A0FB 2QQSA 2E3HA 3BDUA 4DBFA 3L42A 4HVUA 3PMIA 1ABQA 1EX4A 1X01A 4BI8B 1XJWB 2CH4W 1VOMA 2VB6A 1VQ6A 2DIGA 3NGPA 5D7UA 4L6V5 2CP0A 2D8JA 2YRDA 3M0UA 4CC7A 2X51A 3RKWA 2RQVA 3OYBA 1MNDA 1BBZA 3JCMc 5GMKm 3JCMV 2A36A 2M51A 3PTAA 1QCOA 1ZBJA 2FVUA 2E4HA 1NM7A 2DXUA 2OI3A 2EBPA 8ATCB 1C0MA 1BKBA 2DBMA 1C1AA 1N5ZA 1CKBA 2V8IA 1R0BG 3EG3A 4R56A 1GL5A 4AFQC 1QP3A 1M1KU 4NL2A 4M75A 4C92E 4M7DC 3PIOA 2P0KA 1YJWA 2BE9B 2RH2A 3QUIA 1GFCA 1PKTA 4M78A 4XQ3A 2FRYA 5GANj 1Q86R 4M7DB 4QVDA 2RNAA 2K9GA 2QA4A 4JRQA 3GBQA 2DL7A 3OMGA 2QXFA 4J9FA 5HCKA 2QTXA 2HD0A 1VQOA 3QKJA 4FCYA 2KR3A 4PJOC 2YT6A 4OMNA 2QDLA 1YIJA 1UGQB 2OX7A 1AOJA 4K11A 4GLMA 3MEVA 3JCMX 2X3XD 4M7DG 4M75D 4C5IA 2QEXT 1YHQQ 2B86A 1RADB 2XDBA 3FJ5A 4RCBA 1OV3A 1VQKA 3TREA 2KYBA 1N27A 2ZGWA 1FXXA 1VQPQ 4Y91A 4N0AA 2A3LA 4PJOG 2DAQA 4M77F 4FT2A 3V7RA 1LNXA 5KE2A 5CKFA 3CCEQ 3Q1JA 3CCRT 4JS5A 1OPKA 2AKLA 1YI2A 3A8LB 3DB4A 1JXMA 4FT4A 2KRMA 1O9SA 3LW5E 2ENMA 1Q86U 2F5TX 2MYSA 2XK0A 3JSCA 2KXDA 2FB7A 2AKKA 1ZSGA 3OS5A 3J7AF 2E6NA 4A4FA 2LNVA 3MEUA 2HBWA 1PHTA 3OYEA 2RQWA 5L8RE 2MIOA 3NTIA 3OYHA 1GRIA 2ZZDA 4ZN1A 4F7UA 3RIRA 4FU6A 2GBQA 4C92C 4CC4B 1Y96B 1CKAA 4C92B 2CZ7B 2JTEA 3CCQQ 2CP6A 3OSVA 4LDVA 4MMKA 3CCVT 1W1FA 4XTVA 3QHSA 2LJ1A 5CQYA 2LDMA 4ZGEB 2EQUA 4OVAA 2HMAA 1VQ4Q 1X75C 2CZ1B 3A1PA 5GAMh 4M78G 4A4GA 1IXDA 2DERA 2DO3A 4FYYB 2E1HA 1XOVA 2CT4A 3VYHB 3QBYA 4B9WA 2W10A 4M75F 2XG8D 3OYYA 1VQ9Q 3LWHA 2J6OA 2K79A 3LGLA 2RJDA 1O75A 1EFNA 4ME7A 4XU3A 4E7KA 2EFIA 4JZ4A 5I2MA 1G2BA 1M2VB 4LDWA 1M5Q1 1NLOC 2ZCFB 2K3BA 3M0SA 2E6ZA 5LJ5f 2EGEA 1TWBA 4F04B 2LQWA 1YHQT 3LH0A 2D9TA 3VS1A 1D1AA 1BCMA 1K73C 5IAYA 1AT1B 4N4HA 2K5FA 1VQ5Q 3H0FA 2Z0WA 1VQPT 4JRKA 1W4SA 3CMAT 2BZ8A 1VQ8A 4AG2C 3CPWA 4C0ZA 1G3YA 4HCKA 5A0LA 3MPUB 1YFNA 2MPXC 1SEMA 4A4KA 5LJ3f 3LH5A 2VXFA 4MZPA 1KFZA 3CCET 4XU2A 3RMQA 2XDPA 3I56Q 4E7SA 1WJSA 4O5VA 3OMCA 1PD0A 2HKQB 4C5HA 1K8AR 2XICA 3V8JA 3MEWA 4DOVA 2I2LA 3VRZA 4J7IA 3G71A 2FHDA 1H92A 2F2VA 3OYLA 1JQQA 2MCNA 4JJDA 2LQ8A 1VQ6Q 2VVKA 2KYMA 4BI3A 2EVRA 2PZ1A 3RDVA 3QJYA 4M7AA 1RAHB 3MEAA 3I5SA 3DLMA 5GAOn 2JJ9A 2NUTB 3UWNA 3OYGA 3E9GA 4E7LA 4IUVA 1UTIA 3L1AA 4F7UF 2QAZA 4FL6A 1MV0B 4Y28E 2RK1A 2VWFA 2K2VA 4IIOA 3BFMA 1ZHIA 4JZ3A 2IPOB 5GAN3 2EYYA 5KYXB 3G6ET 2PUOB 3CQTA 4N4GA 2OTJT 5KCOA 2E12A 3P8HA 2G3RA 4KH0B 1VQ4T 4RTVA 4M7AD 3NTKA 1MNEA 1SSFA 1UGPB 2DM1A 2ESWA 4RKUE 5D6WA 2DYBA 3VS7A 4EMGA 1YJWQ 2DTOA 4C8QA 1OPLA 1X69A 4DA4A 1OEBA 1PNJA 4PFOA 4EPCA 3M56A 1K8AU 2L89A 1VQ9T 3TU4K 3QYGB 1VQOQ 1TS9A 1NEBA 2VC8A 3OYJA 2JN0A 1YBYA 4DOWA 2K4YA 4PJNA 3L2RA 1Q7YR 1OU9A 2K6DA 4EMHA 1AWJA 1FWZA 1RAAB 2EIFA 3EGDA 4C8QD 3CCUQ 3S6WA 1VQKQ 2EQMA 3CBMA 3A98A 1QVPA 4PJLA 1VQ5T 2HQXA 1VYUA 4CI0C 3H0HA 2KRNA 3VV0A 4ZGJB 5FLXE 8AT1B 4HCCA 2AIRB 2NUPB 1W2BA 4BY6C 2DA9A 3HHTB 5C0MA 2JS2A 4BY6B 3H8ZA 3I56T 2RPNA 1JJ2S 4MDWA 2P4RA 1SG5A 2AZVA 3QZ9B 2SEMA 3I35A 3AHUA 1N8RC 3D7SB 5GMKl 2MK5A 2BE7D 1WA7A 1BI1A 2P84A 2WACA 1VQMQ 2LCCA 2RHUA 1VQ6T 3M55A 2JVVA 1X6GA 4PNOA 1LPLA 4LDYA 3M54A 4EMKC 1K9MR 1KQ1A 3CCSA 1Q7YU 1D0XA 2R5AA 4EMKB 4EDUA 2K57A 2PUKB 2KQWA 1P92A 3EAEA 3IQLA 4M7AF 3JB9J 4X34A 1MV3A 1DJ7B 2KEAA 4D6WA 1FMWA 2RF0A 1H3ZA 1D1BA 4ATOA 1NPPA 1X6OA 4KBMB 4L59A 3CCLA 2DL3A 1UB4A 1G5VA 1WHGA 5D6YA 1I5LA 3L2ZA 2DL5A 2K5LA 4DBRA 2E64A 5CKHA 1YJNQ 2L5QA 1QVFA 3ZL7C 2OTLQ 2O9SA 2HL3A 5LL6S 4AG1C 3CPWP 1YJWT 5GAMf 3EHRA 2AT1B 1KQSA 2YRVA 2AZSA 3CC7Q 3MP1A 1YP5A 2V1RA 4C8QF 1JXOA 3I55A 4RG2A 2LX9A 5GAN2 3VS0A 3TCJA 1SKUB 1RAIB 2ZPEB 2YSQA 1G3WA 1NJIR 1OQKA 1VA7A 3URGA 1K9MU 4JJBA 3NFCA 1XQHA 2RI2A 3CPFA 3VS6A 2VGNA 3QZ5B 1E6HA 3OYIA 4MMLA 3CCUT 5FRMA 3TVTA 3S3MA 4NL3A 1XTDA 1VQ7A 3DB3A 2QQAA 2X35A 4QW2A 1M1KC 3JRZA 1K1ZA 1YCYA 3J80E 1ZUKA 4DBHA 4OMOA 4M7DA 3M0TA 2CUBA 1WHMA 3HFOA 4J5YA 3CC4Q 1FYNA 1V1CA 5LJ5j 5GAOq 1U5SA 4OB3B 1UJYA 1T0JA 4BE2A 3LWIA 3A8OB 4MZTA 2FEIA 2ED0A 2X4JA 4M77E 4D8KA 2FRWA 4PJOA 4A53A 5GAOp 3BDLA 1YWPA 4E2FB 4RTZA 4J9DA 1H8KA 1UECA 1VQMT 2QG9B 2H3JA 3EGXB 4IURA 4RTYA 1U1SA 3N5BB 1YJ9A 1Z9QA 1AHJB 4PFZA 1VQLQ 3QYHB 4M77D 5LJ3j 1NJIU 2M0YA 2C0OA 5KYNA 1IHVA 1KC8C 3ZFJA 3HKSA 1I07A 3CCMA 1YCSB 4PJOD 5IXBA 2DRMA 1IO6A 2KMTA 3OW2P 1GBQA 1T3LA 4PK4A 4QKUA 4A4HA 4Z89A 1D3BB 1YWOA 3OA6A 4Q5WA 4WTOB 1AD5A 2FZCB 1OU8A 2IVWA 2DMOA 2CP3A 3OYNA 1YJNT 2E65A 1JB0E 2B8AA 2ROTA 2OTLT 1Q86C 1Q81R 3CD6A 4X9DA 1SPKA 3REBB 2AHJB 2LRQA 3CC7T 1NG2A 5CVIA 2V1QA 2VXEA 4F17A 1U06A 2EJGA 2KBTA 4KT0E 4LDXA 1BIAA 3FDRA 3CBOA 1RACB 1QP2A 3P8DA 2E3IA 4C92A 2MOXA 4B9XA 1M2OA 4M75E 2F1LA 1B34A 4HA8A 1E7OA 2DLPA 1ZUYA 4ZGDB 3TQ7P 3MP6A 3G4SQ 1IRXA 1UGRB 1HJDA 1QWFA 4E47A 2DZ9A 2O4XA 3VS2A 2YLBA 5I21A 1BI3A 3MKDA 5GJVB 3GNFB 2L3PA 3NTHA 2LT4A 5GAN4 4M78D 2K7AA 1CSKA 2RQRA 3NMZC 3X24B 4F14A 2WSEE 2HBPA 1VQNA 3CMEQ 3CCJA 1QVGA 2CUDA 3S3OA 1TSFA 3CC4T 2YXYA 3UATA 5I22A 2DD4A 4M7DF 1NZ9A 2GFUA 1LCKA 2VYTA 2LT1A 5CAIA 1AZGB 3P8BB 2C06A 1M2VA 2X9HA 2HQEA 1N9SA 4OB1B 5LJ5g 1Q81U 4XU0A 2D1XA 4PJJA 4XTWA 1HXDA 2HQHA 4ZTJA 1YN8A 1KQSP 4PJOF 2RJFA 1KG1A 1HD3A 1M8VA 4ZNXA 1UG1A 4J83A 1VQLT 4HXJA 2DJQA 2RHYA 3C94A 2KY9A 6AT1B 1I8FA 4OB2B 5LJ3g 4IUPA 1S1NA 3HRSA 3R6NA 2DBKA 1D09B 3EGUA 3CCLQ 5FWBA 1YITA 4HVVA 1PM3A 2QK0A 4J7FA 2HNIA 2J7IA 2GQVA 1WYXA 5GMKe 2KVQG 2DL4A 4F7UE 3GNGA 4OMPA 4M75C 2PVGB 4M4ZA 2QDYB 4AT1B 3EFOB 4M75B
chains in the Genus database with same CATH topology
1I0CA 3H0IA 3CQTA 4Y92A 1BK2A 1Y57A 2J6FA 4Z88A 2JMAA 4WCIA 3TSZA 1VYVA 2LCSA 4RTVA 1RLQC 2JMCA 2PTKA 2FPEA 1WFWA 1HSQA 2ESWA 2OJ2A 2DM1A 2EYXA 2KRSA 4F16A 1SSHA 5L23A 2DYBA 3VS7A 1PRLC 2LP5A 2DE0X 2RQUA 2F2XA 1B07A 1WLPB 1OPLA 1X69A 2O31A 4RTWA 3UF4A 1OEBA 1TUCA 1PNJA 2CH4A 1AZEA 1GCQC 1X27A 3JV3A 2D8HA 1M3BA 1GCPA 1NEBA 4ESRA 4LE9A 2GTJA 2BZXA 1ARKA 1B3QA 2K6DA 2KT1A 4J9CA 2FPDA 2EGAA 4JJCA 1K76A 2DNUA 1VYTA 1AWJA 4CC2A 2A08A 4KRTA 2YUQA 5ECAA 2EGCA 2DX1A 2DVJA 1NYGA 2E5KA 3A98A 1JEGA 1KJWA 3SHWA 1WXUA 1VYUA 2L3QA 3H0HA 1GCQA 1UFFA 2KRNA 4RTTA 1JU5C 4LUDA 2J06A 3RBBB 5GJWB 1SHFA 2CREA 2I0NA 4DEXA 2BTTA 1OOTA 2GTOA 1T0HA 1TG0A 2KE9A 2IIMA 1UHCA 2DA9A 4J9GA 2JS2A 2RPNA 1YNZA 2P4RA 2AZVA 1QCFA 2J05A 1WXBA 1Y0MA 2SEMA 1MUZA 3I35A 1AWXA 1ABOA 1WX6A 2EQIA 4LUEA 2KGTA 2G6FX 3VS3A 1WA7A 2HSPA 2YUNA 3NHNA 4AFUC 1X6GA 2LX7A 1H3HA 4HVUA 1ABQA 1NYFA 2SRCA 3M0QA 2LQNA 3O5ZA 1M27C 2CH4W 2ECZA 3IQLA 1MV3A 5FWCA 2KEAA 2PNIA 3NGPA 2RF0A 3UA6A 2D8JA 4AFSC 3M0UA 4CC7A 2O88A 2DL3A 1GBRA 1WDXA 2W0ZA 2RQVA 2C0IA 1BBZA 2A28A 2A36A 2M51A 1PWTA 2DL5A 2DRKA 1M3AA 3ZL7C 2CT3A 1ZBJA 2O9SA 4J9HA 3H41A 1NM7A 2OI3A 4AG1C 2EBPA 3THKA 1G83A 3EHRA 2ROLA 2DBMA 2AZSA 3PVQA 1N5ZA 2HCKA 1CKBA 1W70A 1YP5A 3EG3A 2V1RA 1GL5A 2JT4A 3U23A 4FSSA 1JXOA 4AFQC 2DILA 1UUEA 3VS0A 2FPFA 3M0RA 1GFCA 1PKTA 2FRYA 2YSQA 4OMLA 2KNBB 2DF6A 3EG2A 1M8MA 4J9IA 2RNAA 2K9GA 4J9EA 1VA7A 3GBQA 2DL7A 1ZX6A 2L0AA 2JM8A 4J9FA 5HCKA 3I9QA 4DEYA 4JJBA 2GNCA 3VS6A 2FO0A 2KR3A 1E6HA 2YT6A 4OMNA 2QDLA 1RI9A 1W6XA 3TVTA 2LNHB 1AOJA 4K11A 4GLMA 1UDLA 1M30A 2RQTA 2X3XD 1KSWA 1X2QA 2XMFA 1K0XA 1AWWA 1K1ZA 2B86A 1SRLA 3FJ5A 4X1VA 1PRMC 1X43A 1RLPC 1ZUKA 4OMOA 3M0TA 1OV3A 2CUBA 1TUDA 1X6BA 2KYBA 1J3TA 1FYNA 1V1CA 1T3SA 2ABLA 1U5SA 4RTXA 1UJYA 1T0JA 1QWEA 5I11A 3RNJA 2FEIA 2C0TA 2ED0A 2D0NA 2RN8A 4OMMA 4D8KA 2K2MA 2FRWA 2FG0A 4CC3A 2HEQA 2JS0A 1YWPA 4RTZA 4J9DA 1H8KA 1NEGA 2GGRA 1U3OA 1UECA 2LJ0A 1OPKA 2AKLA 2CSQA 4RTYA 1Z9QA 1JXMA 2KRMA 4RUGA 1QLYA 2X3WD 2ENMA 2O9VA 2M0YA 3QWXX 2KXDA 2C0OA 2AKKA 1ZSGA 2EYZA 2NWMA 1K4US 2HBWA 1PHTA 1I07A 2RQWA 2EPDA 1YCSB 2MIOA 1GFDA 5IHIA 1GRIA 2JW4A 5IXBA 1AWOA 2DRMA 1Z9ZA 1IO6A 3VS4A 1GBQA 1T3LA 2KXCA 2GBQA 4CC4B 1UHFA 2YDLA 1CKAA 2OAWA 3TSWA 4OMQA 3I5RA 4ORZA 1BB9A 3QWYA 4Z89A 1YWOA 1QKWA 4LNPA 4J9BA 2JXBA 1AD5A 2JTEA 2DMOA 4IIMA 2ROTA 1WXTA 3PVLA 1UE9A 1W1FA 4JPBW 2LJ1A 1M3CA 2KT8A 4AFZC 1SPKA 3REBB 1NG2A 2CDTA 2V1QA 4F17A 1U06A 2CSIA 2KBTA 1I1JA 1XOVA 2CT4A 2EW3A 3SEMA 2MOXA 2W10A 4D8DA 2H8HA 4R0KA 2J6OA 3EG0A 2K79A 3REAB 2GQIA 1EFNA 1E7OA 2DLPA 1ZUYA 4JZ4A 2O2OA 1RUWA 1G2BA 3PE0A 1HJDA 5FW9A 1QWFA 3EHQA 3VS2A 1NLOC 5GJVB 1AEYA 2K3BA 5IXFA 3M0SA 2EKHA 2L3PA 5IHKA 3NPFA 2EGEA 1AVZC 2F2WA 2L2PA 2K7AA 2DL8A 2LQWA 1CSKA 2RQRA 2L3SA 3NMZC 4F14A 1SRMA 3VS1A 1UGVA 1NLPC 2HDAA 4HVWA 2CUDA 1WIEA 3H0FA 3UATA 3M0PA 1BU1A 5I22A 1K0SA 1WI7A 5EC7A 2BZ8A 1LCKA 5IH2A 1AZGB 2YUOA 2RMOA 4AG2C 3KFVA 4HCKA 4A63B 2JM9A 1SEMA 4LN2A 1UJ0A 3LH5A 2D1XA 1K9AA 4E6RA 1KFZA 4Z8AA 1YN8A 2YUPA 1ZLMA 1SHGA 1HD3A 2EYWA 2KROA 3UA7A 2A37A 4EIKA 4ZNXA 5IHNA 1X2KA 1UG1A 1ZUUA 3VS5A 1QKXA 4HXJA 2DJQA 3C0CA 3VRZA 1PKSA 4RTUA 2LMJA 1H92A 2F2VA 1JQQA 2MCNA 4JJDA 1S1NA 1KIKA 2VVKA 2KYMA 3R6NA 2DBKA 3EG1A 2BZYA 2EVRA 2PZ1A 2LJ3A 1A0NB 3EGUA 3I5SA 2LZ6B 5FWBA 1FMKA 4HVVA 4GBQA 3ULRB 3VRYA 2AK5A 1UTIA 2J7IA 1WYXA 2ED1A 1JO8A 4QT7A 1MV0B 2DL4A 2VWFA 4OMPA 4IIOA 4M4ZA 2NUZA 2VKNA 1E6GA 4JZ3A 2J6KA 2EYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I0C A;  3H0I A;  3CQT A;  4Y92 A;  1BK2 A;  1Y57 A;  2J6F A;  4Z88 A;  2JMA A;  4WCI A;  3TSZ A;  1VYV A;  2LCS A;  4RTV A;  1RLQ C;  2JMC A;  2PTK A;  2FPE A;  1WFW A;  1HSQ A;  2ESW A;  2OJ2 A;  2DM1 A;  2EYX A;  2KRS A;  4F16 A;  1SSH A;  5L23 A;  2DYB A;  3VS7 A;  1PRL C;  2LP5 A;  2DE0 X;  2RQU A;  2F2X A;  1B07 A;  1WLP B;  1OPL A;  1X69 A;  2O31 A;  4RTW A;  3UF4 A;  1OEB A;  1TUC A;  1PNJ A;  2CH4 A;  1AZE A;  1GCQ C;  1X27 A;  3JV3 A;  2D8H A;  1M3B A;  1GCP A;  1NEB A;  4ESR A;  4LE9 A;  2GTJ A;  2BZX A;  1ARK A;  1B3Q A;  2K6D A;  2KT1 A;  4J9C A;  2FPD A;  2EGA A;  4JJC A;  1K76 A;  2DNU A;  1VYT A;  1AWJ A;  4CC2 A;  2A08 A;  4KRT A;  2YUQ A;  5ECA A;  2EGC A;  2DX1 A;  2DVJ A;  1NYG A;  2E5K A;  3A98 A;  1JEG A;  1KJW A;  3SHW A;  1WXU A;  1VYU A;  2L3Q A;  3H0H A;  1GCQ A;  1UFF A;  2KRN A;  4RTT A;  1JU5 C;  4LUD A;  2J06 A;  3RBB B;  5GJW B;  1SHF A;  2CRE A;  2I0N A;  4DEX A;  2BTT A;  1OOT A;  2GTO A;  1T0H A;  1TG0 A;  2KE9 A;  2IIM A;  1UHC A;  2DA9 A;  4J9G A;  2JS2 A;  2RPN A;  1YNZ A;  2P4R A;  2AZV A;  1QCF A;  2J05 A;  1WXB A;  1Y0M A;  2SEM A;  1MUZ A;  3I35 A;  1AWX A;  1ABO A;  1WX6 A;  2EQI A;  4LUE A;  2KGT A;  2G6F X;  3VS3 A;  1WA7 A;  2HSP A;  2YUN A;  3NHN A;  4AFU C;  1X6G A;  2LX7 A;  1H3H A;  4HVU A;  1ABQ A;  1NYF A;  2SRC A;  3M0Q A;  2LQN A;  3O5Z A;  1M27 C;  2CH4 W;  2ECZ A;  3IQL A;  1MV3 A;  5FWC A;  2KEA A;  2PNI A;  3NGP A;  2RF0 A;  3UA6 A;  2D8J A;  4AFS C;  3M0U A;  4CC7 A;  2O88 A;  2DL3 A;  1GBR A;  1WDX A;  2W0Z A;  2RQV A;  2C0I A;  1BBZ A;  2A28 A;  2A36 A;  2M51 A;  1PWT A;  2DL5 A;  2DRK A;  1M3A A;  3ZL7 C;  2CT3 A;  1ZBJ A;  2O9S A;  4J9H A;  3H41 A;  1NM7 A;  2OI3 A;  4AG1 C;  2EBP A;  3THK A;  1G83 A;  3EHR A;  2ROL A;  2DBM A;  2AZS A;  3PVQ A;  1N5Z A;  2HCK A;  1CKB A;  1W70 A;  1YP5 A;  3EG3 A;  2V1R A;  1GL5 A;  2JT4 A;  3U23 A;  4FSS A;  1JXO A;  4AFQ C;  2DIL A;  1UUE A;  3VS0 A;  2FPF A;  3M0R A;  1GFC A;  1PKT A;  2FRY A;  2YSQ A;  4OML A;  2KNB B;  2DF6 A;  3EG2 A;  1M8M A;  4J9I A;  2RNA A;  2K9G A;  4J9E A;  1VA7 A;  3GBQ A;  2DL7 A;  1ZX6 A;  2L0A A;  2JM8 A;  4J9F A;  5HCK A;  3I9Q A;  4DEY A;  4JJB A;  2GNC A;  3VS6 A;  2FO0 A;  2KR3 A;  1E6H A;  2YT6 A;  4OMN A;  2QDL A;  1RI9 A;  1W6X A;  3TVT A;  2LNH B;  1AOJ A;  4K11 A;  4GLM A;  1UDL A;  1M30 A;  2RQT A;  2X3X D;  1KSW A;  1X2Q A;  2XMF A;  1K0X A;  1AWW A;  1K1Z A;  2B86 A;  1SRL A;  3FJ5 A;  4X1V A;  1PRM C;  1X43 A;  1RLP C;  1ZUK A;  4OMO A;  3M0T A;  1OV3 A;  2CUB A;  1TUD A;  1X6B A;  2KYB A;  1J3T A;  1FYN A;  1V1C A;  1T3S A;  2ABL A;  1U5S A;  4RTX A;  1UJY A;  1T0J A;  1QWE A;  5I11 A;  3RNJ A;  2FEI A;  2C0T A;  2ED0 A;  2D0N A;  2RN8 A;  4OMM A;  4D8K A;  2K2M A;  2FRW A;  2FG0 A;  4CC3 A;  2HEQ A;  2JS0 A;  1YWP A;  4RTZ A;  4J9D A;  1H8K A;  1NEG A;  2GGR A;  1U3O A;  1UEC A;  2LJ0 A;  1OPK A;  2AKL A;  2CSQ A;  4RTY A;  1Z9Q A;  1JXM A;  2KRM A;  4RUG A;  1QLY A;  2X3W D;  2ENM A;  2O9V A;  2M0Y A;  3QWX X;  2KXD A;  2C0O A;  2AKK A;  1ZSG A;  2EYZ A;  2NWM A;  1K4U S;  2HBW A;  1PHT A;  1I07 A;  2RQW A;  2EPD A;  1YCS B;  2MIO A;  1GFD A;  5IHI A;  1GRI A;  2JW4 A;  5IXB A;  1AWO A;  2DRM A;  1Z9Z A;  1IO6 A;  3VS4 A;  1GBQ A;  1T3L A;  2KXC A;  2GBQ A;  4CC4 B;  1UHF A;  2YDL A;  1CKA A;  2OAW A;  3TSW A;  4OMQ A;  3I5R A;  4ORZ A;  1BB9 A;  3QWY A;  4Z89 A;  1YWO A;  1QKW A;  4LNP A;  4J9B A;  2JXB A;  1AD5 A;  2JTE A;  2DMO A;  4IIM A;  2ROT A;  1WXT A;  3PVL A;  1UE9 A;  1W1F A;  4JPB W;  2LJ1 A;  1M3C A;  2KT8 A;  4AFZ C;  1SPK A;  3REB B;  1NG2 A;  2CDT A;  2V1Q A;  4F17 A;  1U06 A;  2CSI A;  2KBT A;  1I1J A;  1XOV A;  2CT4 A;  2EW3 A;  3SEM A;  2MOX A;  2W10 A;  4D8D A;  2H8H A;  4R0K A;  2J6O A;  3EG0 A;  2K79 A;  3REA B;  2GQI A;  1EFN A;  1E7O A;  2DLP A;  1ZUY A;  4JZ4 A;  2O2O A;  1RUW A;  1G2B A;  3PE0 A;  1HJD A;  5FW9 A;  1QWF A;  3EHQ A;  3VS2 A;  1NLO C;  5GJV B;  1AEY A;  2K3B A;  5IXF A;  3M0S A;  2EKH A;  2L3P A;  5IHK A;  3NPF A;  2EGE A;  1AVZ C;  2F2W A;  2L2P A;  2K7A A;  2DL8 A;  2LQW A;  1CSK A;  2RQR A;  2L3S A;  3NMZ C;  4F14 A;  1SRM A;  3VS1 A;  1UGV A;  1NLP C;  2HDA A;  4HVW A;  2CUD A;  1WIE A;  3H0F A;  3UAT A;  3M0P A;  1BU1 A;  5I22 A;  1K0S A;  1WI7 A;  5EC7 A;  2BZ8 A;  1LCK A;  5IH2 A;  1AZG B;  2YUO A;  2RMO A;  4AG2 C;  3KFV A;  4HCK A;  4A63 B;  2JM9 A;  1SEM A;  4LN2 A;  1UJ0 A;  3LH5 A;  2D1X A;  1K9A A;  4E6R A;  1KFZ A;  4Z8A A;  1YN8 A;  2YUP A;  1ZLM A;  1SHG A;  1HD3 A;  2EYW A;  2KRO A;  3UA7 A;  2A37 A;  4EIK A;  4ZNX A;  5IHN A;  1X2K A;  1UG1 A;  1ZUU A;  3VS5 A;  1QKX A;  4HXJ A;  2DJQ A;  3C0C A;  3VRZ A;  1PKS A;  4RTU A;  2LMJ A;  1H92 A;  2F2V A;  1JQQ A;  2MCN A;  4JJD A;  1S1N A;  1KIK A;  2VVK A;  2KYM A;  3R6N A;  2DBK A;  3EG1 A;  2BZY A;  2EVR A;  2PZ1 A;  2LJ3 A;  1A0N B;  3EGU A;  3I5S A;  2LZ6 B;  5FWB A;  1FMK A;  4HVV A;  4GBQ A;  3ULR B;  3VRY A;  2AK5 A;  1UTI A;  2J7I A;  1WYX A;  2ED1 A;  1JO8 A;  4QT7 A;  1MV0 B;  2DL4 A;  2VWF A;  4OMP A;  4IIO A;  4M4Z A;  2NUZ A;  2VKN A;  1E6G A;  4JZ3 A;  2J6K A;  2EYY A; 
#chains in the Genus database with same CATH topology
 4KUL A;  5LJ5 d;  1TUG B;  2J6F A;  2MWP A;  4Z88 A;  2PVD B;  4WCI A;  1D0Z A;  5FU7 C;  1RAB B;  2FPE A;  4NOY A;  4C92 G;  1WQ7 A;  2EYX A;  2RJC A;  4O6J A;  4F16 A;  1Y71 A;  1SSH A;  4XU1 A;  5FU7 B;  3CXC A;  2NUT A;  2LP5 A;  1JJ2 A;  2F2X A;  2XKO C;  2O31 A;  3UF4 A;  1OYX A;  1KQ2 A;  5DLO A;  2R5M A;  2PVO B;  1GCQ C;  5IN1 A;  2LVM A;  4M78 F;  4HT9 A;  5GAN g;  2E10 A;  1KK7 A;  1M3B A;  4ESR A;  4FIB A;  5GMK h;  3HSB A;  5KYX A;  5GAM j;  2JTM A;  1WHL A;  3G4S T;  4OMF B;  3OYF A;  2GTJ A;  1S72 A;  4FW1 A;  2FPD A;  3V8K A;  4JJC A;  5A0G A;  4N0A C;  3JCM P;  1OZ2 A;  4AMC A;  2QI2 A;  4CC2 A;  4BE0 A;  4KRT A;  1MMA A;  1TTH B;  3PFS A;  1MMD A;  4KUD K;  5HK3 A;  2EGC A;  1NPR A;  2LQK A;  3L2Q A;  1NYG A;  1JEG A;  3CME T;  3SHW A;  1D0Y A;  3H9N A;  4LDU A;  2L3Q A;  1UFF A;  2L8D A;  3CEY A;  4RTT A;  4LUD A;  3MHX A;  2GTO A;  3OS2 A;  1T0H A;  2KE9 A;  2IIM A;  2M9U A;  2X4W A;  2ATC B;  2D6F A;  2QEX A;  1YNZ A;  1QCN A;  3UPU A;  2YHT A;  2Y4X A;  2K3X A;  1YJ9 Q;  1WXB A;  1PG5 B;  1Y0M A;  5GAN d;  1AWX A;  1WX6 A;  4C0D C;  4OGE A;  1RAG B;  5D6X A;  3VU3 C;  3JCM Q;  2KGT A;  3HRU A;  1KHI A;  1LVK A;  4C0D B;  3S3N A;  2YUN A;  4JLI A;  3OYK A;  2LX7 A;  5GAN 8;  2EJ9 A;  2NUP A;  3OBY A;  1H3H A;  3HL8 A;  3DKM A;  4E7Z A;  1VIF A;  3GIB A;  3CCL T;  3O5Z A;  1M27 C;  5GAN 6;  2ECZ A;  3OS0 A;  3HPW A;  5KH6 A;  5FWC A;  4M7A E;  3EFR A;  3CCQ T;  4J6W A;  3M4G A;  4AFS C;  2O88 A;  1GBR A;  1WDX A;  1VIE A;  4FYW B;  3CBP A;  3KUF A;  4BI4 A;  2A28 A;  3OB9 A;  5KYW B;  2Y4Y A;  3QJ6 A;  5DY9 A;  1QVG P;  2DRK A;  3OYD A;  2JTF A;  1IRE B;  4J9H A;  1Q7Y C;  4QQD A;  4EMK A;  3H41 A;  1KD1 R;  4C5G A;  2DVE A;  4MZM A;  3EFS A;  4IKF A;  1TOV A;  1W70 A;  2QA4 Q;  3BE3 A;  2JT4 A;  4ZTF A;  5J26 A;  3CCV A;  1UUE A;  2FPF A;  3M0R A;  4C8Q E;  5CK9 A;  1RL2 A;  1YIJ Q;  2KNB B;  2DF6 A;  4J9I A;  1Q82 R;  1KHC A;  3QDR B;  5GAM g;  2L0A A;  2JM8 A;  4A54 A;  3C12 A;  2GNC A;  3MCA B;  1PSE A;  2ZPH B;  3SWN C;  5KCH A;  3ME9 A;  3CCJ Q;  1TU0 B;  1HK9 A;  2CGH A;  5CQX A;  3JB9 G;  3SWN B;  2P4T A;  1KSW A;  2CP2 A;  2XMF A;  1K0X A;  1ZSZ C;  2H3E B;  3GP8 A;  4OB0 B;  1X43 A;  1RLP C;  5KYU A;  1WHK A;  3UDC A;  1ZSZ B;  1TUD A;  2ZPG B;  2XDD A;  3JCM g;  2DYI A;  4JUV A;  1J3T A;  2CZ6 B;  1T3S A;  2ABL A;  3GPL A;  3EG9 B;  3QG1 A;  1K9M C;  1YI2 Q;  3ZBD A;  1QWE A;  5I11 A;  2VGM A;  4JRI A;  3RNJ A;  2HL5 C;  1YHQ A;  1KD1 U;  2M02 A;  2CP5 A;  4M7A C;  2C0T A;  1YJ9 T;  2D0N A;  2X4Y A;  3LX7 A;  4OMM A;  2K2M A;  2FG0 A;  4CC3 A;  2DK3 A;  2DD5 A;  4M7A B;  3CXC P;  2V8J A;  2JS0 A;  2VUB A;  3RES A;  2GGR A;  1M4Z A;  2ZPI B;  1U3O A;  3CMA A;  3HRT A;  4DQ2 A;  4RUG A;  1ACM B;  3V7S A;  2ZPB B;  3CCE A;  1Q82 U;  2EYZ A;  4J8O A;  1BI0 A;  4C5E A;  1GFD A;  1SF9 A;  5IHI A;  3SFM A;  5KYY A;  1Z9Z A;  1R77 A;  1WJQ A;  3VS4 A;  3E9F A;  1OX8 A;  2KXC A;  4C8Q C;  1LJO A;  1UHF A;  2YDL A;  2OAW A;  4LD9 K;  1N8R R;  3I5R A;  2EKO A;  4C8Q B;  1BB9 A;  4XAX B;  3QII A;  3JCM d;  4LNP A;  2JXB A;  2DPP B;  5CKE A;  5DM7 R;  3WXM B;  1WXT A;  4NS5 A;  1UE9 A;  2GCX A;  4JPB W;  1NJI C;  2CKK A;  1M3C A;  2KT8 A;  1WHJ A;  5GAN 5;  3CPW S;  1ZA1 B;  2CDT A;  2NLU A;  3QDF A;  2QA4 T;  3FJP A;  5LJ5 e;  2MWO A;  3OY9 A;  1VQO T;  1I1J A;  4IUT A;  1UGS B;  3EGD B;  4QQ6 A;  3G6E A;  2EW3 A;  4DBQ A;  2OTJ A;  1S72 Q;  1YIJ T;  1D3B A;  3RR6 A;  2DEQ A;  4D8D A;  4R0K A;  2GQI A;  4FM4 B;  4XTU A;  1M1G A;  1RUW A;  3PE0 A;  2MMP A;  3EHQ A;  3X25 B;  2M1H A;  5LJ3 e;  1VQK T;  1FX7 A;  5IXF A;  2GFA A;  1VQ9 A;  3NPF A;  1VQ8 Q;  5EG2 A;  4JS4 A;  2F2W A;  2KK4 A;  2DL8 A;  2K3Y A;  4YTL A;  2L3S A;  1SRM A;  3EH2 A;  1UGV A;  1NLP C;  5CKB A;  3JCM W;  2FYK A;  1N8R U;  4GY5 A;  2HAX A;  1WIE A;  1BU1 A;  3OYM A;  5J39 A;  4QVC A;  5EC7 A;  2QEX Q;  2WSF E;  5IH2 A;  1M90 R;  4M7D E;  4BD3 A;  1YI2 T;  2YUO A;  2RMO A;  1M1F A;  4A63 B;  2RB6 A;  4LN2 A;  4BUG A;  1F1B B;  2EAY A;  4MDX A;  2P0Q A;  1B7T A;  1K9A A;  4QVZ A;  4E6R A;  2RI5 A;  3G71 Q;  3INZ A;  3PGG A;  3X28 B;  2ZPF B;  4M7D D;  3O8V A;  2KRO A;  4PJO E;  2COW A;  4LD6 A;  1QQJ A;  1ZUU A;  1WPY A;  2DXT A;  4KH1 B;  5GAN 7;  1PKS A;  4RTU A;  2LMJ A;  1HYO A;  4XTZ A;  5GAN e;  3I56 A;  1KIK A;  4XK8 E;  3RKX A;  3H6Z A;  2BZY A;  1Q81 C;  1N9R A;  1OUL A;  4JLG A;  4GBQ A;  3OW2 S;  2EYQ A;  3SD4 A;  2ED1 A;  1JO8 A;  2QYZ A;  2RO0 A;  2NUZ A;  3QXE B;  1E6G A;  2J6K A;  3MP8 A;  3TEE A;  2MI6 A;  3H0I A;  1W2B P;  2R58 A;  3TSZ A;  1M90 U;  3JCM b;  4FYV B;  2QTV A;  5A2Q E;  1G8X A;  1W2B S;  5GAN h;  3CCV Q;  1KC8 R;  2OJ2 A;  4IUQ A;  5L23 A;  4PKC C;  1PRL C;  1UEB A;  1Y96 A;  2RHZ A;  1B07 A;  3A8M B;  1WLP B;  1OZ3 A;  4XTX A;  4ANJ A;  1TUC A;  2CH4 A;  2XI9 A;  1S72 T;  1AZE A;  5FRN A;  3FEO A;  3DLL A;  5GAO m;  4M78 E;  1GCP A;  5CKD A;  3EFO A;  4HCB A;  3KBG A;  4M77 C;  4J6X A;  2COZ A;  1K76 A;  3CC2 A;  4GLK A;  2DNU A;  3QPH A;  1VYT A;  4M77 B;  3PIP A;  2BKD N;  7AT1 B;  2D0Q B;  3RMS A;  3BY7 A;  3JB9 I;  1VQ8 T;  2QQ9 A;  3PT9 A;  2DEU A;  2FL7 A;  3ZEH A;  4C92 D;  2DX1 A;  2EQK A;  1V29 B;  5AYF A;  1KJW A;  4PJO B;  1WZO A;  3HP9 A;  1WXU A;  2F5K A;  1GCQ A;  5GAO r;  1JU5 C;  4CRI A;  9ATC B;  4VUB A;  4M77 G;  1H64 1;  2ZAE A;  1QVF P;  2CRE A;  2I0N A;  4DEX A;  2BTT A;  1OOT A;  3CCU A;  1TG0 A;  3L2U A;  4PLL A;  1UHC A;  3JAM E;  4J9G A;  1QVF S;  3G71 T;  3C95 A;  3FB9 A;  3CMA Q;  1KC8 U;  3VJP A;  2J05 A;  1KQS S;  1MUZ A;  2EQI A;  1QW1 A;  3CCS Q;  4LUE A;  5AT1 B;  4P5N A;  2G6F X;  3VS3 A;  2HSP A;  3M5A A;  2DET A;  1BIB A;  3NHN A;  4PFP A;  4UC4 A;  4AFU C;  2HZY A;  4JRP A;  1PC0 A;  4KGV B;  1NYF A;  2SRC A;  3VUZ A;  3M0Q A;  2LQN A;  3ASK A;  4Z02 A;  3FLG A;  4B6M A;  5GAM e;  2RK2 A;  1VQM A;  4WF2 A;  1WNL A;  2PNI A;  1MHN A;  3UA6 A;  1V76 A;  2LC4 A;  4M78 C;  2W0Z A;  2R57 A;  2CZ0 B;  4J6Y A;  2YLC A;  2C0I A;  1M9S A;  4M78 B;  4KUI A;  4FW2 A;  1PWT A;  3WVD B;  1TXQ A;  1M3A A;  3I55 Q;  4FSX A;  2CT3 A;  1ZBX A;  3MJX A;  1WQW A;  2DTH A;  4ELY C;  3JCM e;  4C0G A;  1B34 B;  1NE8 A;  3THK A;  1G83 A;  3G6E Q;  2ROL A;  2OTJ Q;  3PVQ A;  1I5O B;  2HCK A;  4M75 G;  2K5I A;  2O4X B;  4BB7 A;  4LXC A;  1YJN A;  3U23 A;  4FSS A;  4XTY A;  2DIL A;  3GF5 A;  4C92 F;  3JCM J;  3SDZ A;  5LJ3 d;  2OTL A;  3M58 A;  1JRI A;  2PQW A;  2XD0 A;  4E7I A;  2JZ2 A;  1WJR A;  5KYW A;  4OML A;  3UT1 A;  3EG2 A;  1VQ7 Q;  1M8M A;  3CC7 A;  4J9E A;  2RA2 A;  1ZX6 A;  3X26 B;  3I9Q A;  2HKN A;  3AT1 B;  4DEY A;  2F69 A;  5CO7 A;  2FO0 A;  3HFN A;  3GOX A;  2V8K A;  4BDZ A;  1RI9 A;  4BAC A;  2RM4 A;  1W6X A;  3G1J A;  2LNH B;  5DLQ E;  4RG8 A;  3JCM h;  5GMK j;  1K8A C;  1UDL A;  1M30 A;  3OBW A;  2RQT A;  1PD1 A;  1GXI E;  4PLI A;  1X2Q A;  1AWW A;  1RAF B;  1SRL A;  2V26 A;  4X1V A;  1PRM C;  2JOY A;  1X6B A;  4IUU A;  5IT9 E;  2XU8 A;  4JDS A;  3E1S A;  3SB2 A;  4RTX A;  4OF1 A;  1OI1 A;  3V8L A;  2RN8 A;  4OGC A;  2HEQ A;  3CCS T;  4JJN K;  3SWN A;  4F7U B;  3CC4 A;  5M9O A;  1NEG A;  1K73 R;  1R8O B;  2M16 A;  3QO3 A;  2LJ0 A;  3A5Z B;  3JB9 D;  2CSQ A;  3CCM Q;  2QGG A;  2E70 A;  2DTI A;  5KE3 A;  1ZSZ A;  1XNI A;  3X20 B;  1QLY A;  2X3W D;  2Y90 A;  2EQJ A;  2O9V A;  3QWX X;  1C6V X;  5I2S A;  3CCR A;  5HKC A;  2NWM A;  1K4U S;  3EG9 A;  2M0O A;  3RKY A;  1BCO A;  4L5G A;  4R55 A;  4F7U G;  3BW1 A;  3MO8 A;  1KD1 C;  2EPD A;  2JW4 A;  1AWO A;  1VQL A;  2EWN A;  2E41 A;  3CD6 Q;  2KDS A;  3TSW A;  4OMQ A;  4OP0 A;  3MET A;  4ORZ A;  3QWY A;  1QKW A;  4J9B A;  4PJM A;  2DKG A;  1WGS A;  4IIM A;  2DJZ A;  3PVL A;  1IGQ A;  3I55 T;  1ZA2 B;  2QQR A;  1QVG S;  1Q82 C;  3WVE B;  2DXB A;  1WHH A;  5GAN f;  1PCX A;  3M53 A;  2DXC A;  4AFZ C;  2OAU A;  5CIU A;  1I4K 1;  2RHX A;  2CSI A;  2QAS A;  1K73 U;  3SEM A;  4KGZ B;  2EJF A;  3PNW C;  5A0D A;  1VQ7 T;  2GF7 A;  3CC2 Q;  1VUB A;  2H8H A;  4ZN3 A;  3EG0 A;  3REA B;  1IZ6 A;  3OSS C;  4HCZ A;  5CR2 A;  2O2O A;  5J3B A;  5FW9 A;  1VQN Q;  3A8G B;  3R6O A;  1AEY A;  4PL6 A;  2L3R A;  2JUF A;  4RMO A;  2EKH A;  4BE1 A;  2A7Y A;  2VAS A;  5IHK A;  1PSF A;  1AVZ C;  2L2P A;  2LCL A;  2XID A;  3OW2 A;  1I81 A;  3G4S A;  3M4Y A;  1BI2 A;  2HDA A;  1BYM A;  4HVW A;  2MF2 A;  3G7Z A;  2RI3 A;  3JB9 F;  3M0P A;  1K0S A;  1WI7 A;  2NYS A;  1R0C B;  2RJE A;  3L2W A;  1EZZ B;  3JB9 H;  2YRC A;  3KFV A;  3OQ5 A;  2JM9 A;  4HT8 A;  4A4E A;  1JBM A;  1UJ0 A;  2KAF A;  3CME A;  3M57 A;  2QGF B;  1JJ2 P;  4Z8A A;  1VQP A;  2CYZ B;  3OYA A;  2YUP A;  1ZLM A;  3CXC S;  1SHG A;  1TH7 A;  5C6S A;  2EYW A;  3UA7 A;  2A37 A;  2RD1 A;  4EIK A;  5GAM d;  3CCM T;  5IHN A;  1X2K A;  1IGU A;  3E19 A;  3VS5 A;  1QKX A;  1YIT Q;  3VUB A;  3C0C A;  2IG0 A;  3LYI A;  4HKE A;  4II1 A;  3VKI A;  2MAM A;  2P0P A;  4BDY A;  3E2U A;  2HSE B;  4M7A G;  2DFU A;  2YWW A;  3L2V A;  3RUX A;  3FC3 A;  3EG1 A;  2FZG B;  2LJ3 A;  1IHW A;  1A0N B;  2LZ6 B;  1FMK A;  2BUD A;  1Q95 G;  3VRY A;  3ULR B;  1FMV A;  3CD6 T;  3EGX A;  2AK5 A;  5GAO l;  4E7H A;  2DIQ A;  4X9C A;  4QT7 A;  2O01 E;  3M59 A;  3T9N A;  2VKN A;  4V2S A;  4QQG A;  1I0C A;  2FZK B;  4Y92 A;  1BK2 A;  1Y57 A;  4FYX B;  2VV5 A;  2BIV A;  2JMA A;  3VYG A;  1VYV A;  2LCS A;  3CCQ A;  1RLQ C;  2JMC A;  2PTK A;  4C8Q G;  1G3S A;  1WFW A;  1HSQ A;  2KRS A;  3A8H B;  4KGX B;  1U8R A;  2DE0 X;  2RQU A;  3OS1 A;  1MMG A;  3F70 A;  4RTW A;  1D1C A;  4ELZ C;  1LOJ A;  1VQ4 A;  1MGQ A;  1X27 A;  3JV3 A;  3PMT A;  3CC2 T;  2D8H A;  4TVR A;  1RAE B;  1NBE B;  2PU9 B;  4LE9 A;  1ARK A;  2BZX A;  2RHI A;  1VQN T;  1B3Q A;  5KYU B;  5HK0 A;  1MMN A;  2KT1 A;  4J9C A;  3CCJ T;  3ER0 A;  2COY A;  2EGA A;  1M90 C;  2WSC E;  1N6A A;  3C4S A;  4N4I A;  2QQB A;  4E7J A;  1Y7X A;  3LLR A;  2A08 A;  3M9Q A;  1IB8 A;  3JCM f;  2YUQ A;  3FIF A;  3FRN A;  3RER A;  2KI7 A;  5ECA A;  5LJ5 h;  2DVJ A;  2JNG A;  2E5K A;  1G3T A;  3KXT A;  5GMK i;  2LTO A;  1RI0 A;  2XHC A;  3GLX A;  3HTR A;  1U1T A;  1Y07 A;  3V7C A;  2J06 A;  2KSS A;  3RBB B;  5CCA A;  5GJW B;  1SHF A;  4RCC A;  1EIF A;  3OYC A;  4M77 A;  1VQ5 A;  2E5Q A;  1QMC A;  3LGF A;  1ZQ1 A;  3J81 E;  5LJ3 h;  2CP7 A;  1QCF A;  5FU6 C;  2CS7 A;  1M1K R;  1ABO A;  2X4X A;  5KYY B;  5FU6 B;  5FRO A;  1YIT T;  3CCR Q;  4C0F A;  1OX9 A;  3EH1 A;  5HY6 A;  3QSU A;  2DZC A;  2A0F B;  2QQS A;  2E3H A;  3BDU A;  4DBF A;  3L42 A;  4HVU A;  3PMI A;  1ABQ A;  1EX4 A;  1X01 A;  4BI8 B;  1XJW B;  2CH4 W;  1VOM A;  2VB6 A;  1VQ6 A;  2DIG A;  3NGP A;  5D7U A;  4L6V 5;  2CP0 A;  2D8J A;  2YRD A;  3M0U A;  4CC7 A;  2X51 A;  3RKW A;  2RQV A;  3OYB A;  1MND A;  1BBZ A;  3JCM c;  5GMK m;  3JCM V;  2A36 A;  2M51 A;  3PTA A;  1QCO A;  1ZBJ A;  2FVU A;  2E4H A;  1NM7 A;  2DXU A;  2OI3 A;  2EBP A;  8ATC B;  1C0M A;  1BKB A;  2DBM A;  1C1A A;  1N5Z A;  1CKB A;  2V8I A;  1R0B G;  3EG3 A;  4R56 A;  1GL5 A;  4AFQ C;  1QP3 A;  1M1K U;  4NL2 A;  4M75 A;  4C92 E;  4M7D C;  3PIO A;  2P0K A;  1YJW A;  2BE9 B;  2RH2 A;  3QUI A;  1GFC A;  1PKT A;  4M78 A;  4XQ3 A;  2FRY A;  5GAN j;  1Q86 R;  4M7D B;  4QVD A;  2RNA A;  2K9G A;  2QA4 A;  4JRQ A;  3GBQ A;  2DL7 A;  3OMG A;  2QXF A;  4J9F A;  5HCK A;  2QTX A;  2HD0 A;  1VQO A;  3QKJ A;  4FCY A;  2KR3 A;  4PJO C;  2YT6 A;  4OMN A;  2QDL A;  1YIJ A;  1UGQ B;  2OX7 A;  1AOJ A;  4K11 A;  4GLM A;  3MEV A;  3JCM X;  2X3X D;  4M7D G;  4M75 D;  4C5I A;  2QEX T;  1YHQ Q;  2B86 A;  1RAD B;  2XDB A;  3FJ5 A;  4RCB A;  1OV3 A;  1VQK A;  3TRE A;  2KYB A;  1N27 A;  2ZGW A;  1FXX A;  1VQP Q;  4Y91 A;  4N0A A;  2A3L A;  4PJO G;  2DAQ A;  4M77 F;  4FT2 A;  3V7R A;  1LNX A;  5KE2 A;  5CKF A;  3CCE Q;  3Q1J A;  3CCR T;  4JS5 A;  1OPK A;  2AKL A;  1YI2 A;  3A8L B;  3DB4 A;  1JXM A;  4FT4 A;  2KRM A;  1O9S A;  3LW5 E;  2ENM A;  1Q86 U;  2F5T X;  2MYS A;  2XK0 A;  3JSC A;  2KXD A;  2FB7 A;  2AKK A;  1ZSG A;  3OS5 A;  3J7A F;  2E6N A;  4A4F A;  2LNV A;  3MEU A;  2HBW A;  1PHT A;  3OYE A;  2RQW A;  5L8R E;  2MIO A;  3NTI A;  3OYH A;  1GRI A;  2ZZD A;  4ZN1 A;  4F7U A;  3RIR A;  4FU6 A;  2GBQ A;  4C92 C;  4CC4 B;  1Y96 B;  1CKA A;  4C92 B;  2CZ7 B;  2JTE A;  3CCQ Q;  2CP6 A;  3OSV A;  4LDV A;  4MMK A;  3CCV T;  1W1F A;  4XTV A;  3QHS A;  2LJ1 A;  5CQY A;  2LDM A;  4ZGE B;  2EQU A;  4OVA A;  2HMA A;  1VQ4 Q;  1X75 C;  2CZ1 B;  3A1P A;  5GAM h;  4M78 G;  4A4G A;  1IXD A;  2DER A;  2DO3 A;  4FYY B;  2E1H A;  1XOV A;  2CT4 A;  3VYH B;  3QBY A;  4B9W A;  2W10 A;  4M75 F;  2XG8 D;  3OYY A;  1VQ9 Q;  3LWH A;  2J6O A;  2K79 A;  3LGL A;  2RJD A;  1O75 A;  1EFN A;  4ME7 A;  4XU3 A;  4E7K A;  2EFI A;  4JZ4 A;  5I2M A;  1G2B A;  1M2V B;  4LDW A;  1M5Q 1;  1NLO C;  2ZCF B;  2K3B A;  3M0S A;  2E6Z A;  5LJ5 f;  2EGE A;  1TWB A;  4F04 B;  2LQW A;  1YHQ T;  3LH0 A;  2D9T A;  3VS1 A;  1D1A A;  1BCM A;  1K73 C;  5IAY A;  1AT1 B;  4N4H A;  2K5F A;  1VQ5 Q;  3H0F A;  2Z0W A;  1VQP T;  4JRK A;  1W4S A;  3CMA T;  2BZ8 A;  1VQ8 A;  4AG2 C;  3CPW A;  4C0Z A;  1G3Y A;  4HCK A;  5A0L A;  3MPU B;  1YFN A;  2MPX C;  1SEM A;  4A4K A;  5LJ3 f;  3LH5 A;  2VXF A;  4MZP A;  1KFZ A;  3CCE T;  4XU2 A;  3RMQ A;  2XDP A;  3I56 Q;  4E7S A;  1WJS A;  4O5V A;  3OMC A;  1PD0 A;  2HKQ B;  4C5H A;  1K8A R;  2XIC A;  3V8J A;  3MEW A;  4DOV A;  2I2L A;  3VRZ A;  4J7I A;  3G71 A;  2FHD A;  1H92 A;  2F2V A;  3OYL A;  1JQQ A;  2MCN A;  4JJD A;  2LQ8 A;  1VQ6 Q;  2VVK A;  2KYM A;  4BI3 A;  2EVR A;  2PZ1 A;  3RDV A;  3QJY A;  4M7A A;  1RAH B;  3MEA A;  3I5S A;  3DLM A;  5GAO n;  2JJ9 A;  2NUT B;  3UWN A;  3OYG A;  3E9G A;  4E7L A;  4IUV A;  1UTI A;  3L1A A;  4F7U F;  2QAZ A;  4FL6 A;  1MV0 B;  4Y28 E;  2RK1 A;  2VWF A;  2K2V A;  4IIO A;  3BFM A;  1ZHI A;  4JZ3 A;  2IPO B;  5GAN 3;  2EYY A;  5KYX B;  3G6E T;  2PUO B;  3CQT A;  4N4G A;  2OTJ T;  5KCO A;  2E12 A;  3P8H A;  2G3R A;  4KH0 B;  1VQ4 T;  4RTV A;  4M7A D;  3NTK A;  1MNE A;  1SSF A;  1UGP B;  2DM1 A;  2ESW A;  4RKU E;  5D6W A;  2DYB A;  3VS7 A;  4EMG A;  1YJW Q;  2DTO A;  4C8Q A;  1OPL A;  1X69 A;  4DA4 A;  1OEB A;  1PNJ A;  4PFO A;  4EPC A;  3M56 A;  1K8A U;  2L89 A;  1VQ9 T;  3TU4 K;  3QYG B;  1VQO Q;  1TS9 A;  1NEB A;  2VC8 A;  3OYJ A;  2JN0 A;  1YBY A;  4DOW A;  2K4Y A;  4PJN A;  3L2R A;  1Q7Y R;  1OU9 A;  2K6D A;  4EMH A;  1AWJ A;  1FWZ A;  1RAA B;  2EIF A;  3EGD A;  4C8Q D;  3CCU Q;  3S6W A;  1VQK Q;  2EQM A;  3CBM A;  3A98 A;  1QVP A;  4PJL A;  1VQ5 T;  2HQX A;  1VYU A;  4CI0 C;  3H0H A;  2KRN A;  3VV0 A;  4ZGJ B;  5FLX E;  8AT1 B;  4HCC A;  2AIR B;  2NUP B;  1W2B A;  4BY6 C;  2DA9 A;  3HHT B;  5C0M A;  2JS2 A;  4BY6 B;  3H8Z A;  3I56 T;  2RPN A;  1JJ2 S;  4MDW A;  2P4R A;  1SG5 A;  2AZV A;  3QZ9 B;  2SEM A;  3I35 A;  3AHU A;  1N8R C;  3D7S B;  5GMK l;  2MK5 A;  2BE7 D;  1WA7 A;  1BI1 A;  2P84 A;  2WAC A;  1VQM Q;  2LCC A;  2RHU A;  1VQ6 T;  3M55 A;  2JVV A;  1X6G A;  4PNO A;  1LPL A;  4LDY A;  3M54 A;  4EMK C;  1K9M R;  1KQ1 A;  3CCS A;  1Q7Y U;  1D0X A;  2R5A A;  4EMK B;  4EDU A;  2K57 A;  2PUK B;  2KQW A;  1P92 A;  3EAE A;  3IQL A;  4M7A F;  3JB9 J;  4X34 A;  1MV3 A;  1DJ7 B;  2KEA A;  4D6W A;  1FMW A;  2RF0 A;  1H3Z A;  1D1B A;  4ATO A;  1NPP A;  1X6O A;  4KBM B;  4L59 A;  3CCL A;  2DL3 A;  1UB4 A;  1G5V A;  1WHG A;  5D6Y A;  1I5L A;  3L2Z A;  2DL5 A;  2K5L A;  4DBR A;  2E64 A;  5CKH A;  1YJN Q;  2L5Q A;  1QVF A;  3ZL7 C;  2OTL Q;  2O9S A;  2HL3 A;  5LL6 S;  4AG1 C;  3CPW P;  1YJW T;  5GAM f;  3EHR A;  2AT1 B;  1KQS A;  2YRV A;  2AZS A;  3CC7 Q;  3MP1 A;  1YP5 A;  2V1R A;  4C8Q F;  1JXO A;  3I55 A;  4RG2 A;  2LX9 A;  5GAN 2;  3VS0 A;  3TCJ A;  1SKU B;  1RAI B;  2ZPE B;  2YSQ A;  1G3W A;  1NJI R;  1OQK A;  1VA7 A;  3URG A;  1K9M U;  4JJB A;  3NFC A;  1XQH A;  2RI2 A;  3CPF A;  3VS6 A;  2VGN A;  3QZ5 B;  1E6H A;  3OYI A;  4MML A;  3CCU T;  5FRM A;  3TVT A;  3S3M A;  4NL3 A;  1XTD A;  1VQ7 A;  3DB3 A;  2QQA A;  2X35 A;  4QW2 A;  1M1K C;  3JRZ A;  1K1Z A;  1YCY A;  3J80 E;  1ZUK A;  4DBH A;  4OMO A;  4M7D A;  3M0T A;  2CUB A;  1WHM A;  3HFO A;  4J5Y A;  3CC4 Q;  1FYN A;  1V1C A;  5LJ5 j;  5GAO q;  1U5S A;  4OB3 B;  1UJY A;  1T0J A;  4BE2 A;  3LWI A;  3A8O B;  4MZT A;  2FEI A;  2ED0 A;  2X4J A;  4M77 E;  4D8K A;  2FRW A;  4PJO A;  4A53 A;  5GAO p;  3BDL A;  1YWP A;  4E2F B;  4RTZ A;  4J9D A;  1H8K A;  1UEC A;  1VQM T;  2QG9 B;  2H3J A;  3EGX B;  4IUR A;  4RTY A;  1U1S A;  3N5B B;  1YJ9 A;  1Z9Q A;  1AHJ B;  4PFZ A;  1VQL Q;  3QYH B;  4M77 D;  5LJ3 j;  1NJI U;  2M0Y A;  2C0O A;  5KYN A;  1IHV A;  1KC8 C;  3ZFJ A;  3HKS A;  1I07 A;  3CCM A;  1YCS B;  4PJO D;  5IXB A;  2DRM A;  1IO6 A;  2KMT A;  3OW2 P;  1GBQ A;  1T3L A;  4PK4 A;  4QKU A;  4A4H A;  4Z89 A;  1D3B B;  1YWO A;  3OA6 A;  4Q5W A;  4WTO B;  1AD5 A;  2FZC B;  1OU8 A;  2IVW A;  2DMO A;  2CP3 A;  3OYN A;  1YJN T;  2E65 A;  1JB0 E;  2B8A A;  2ROT A;  2OTL T;  1Q86 C;  1Q81 R;  3CD6 A;  4X9D A;  1SPK A;  3REB B;  2AHJ B;  2LRQ A;  3CC7 T;  1NG2 A;  5CVI A;  2V1Q A;  2VXE A;  4F17 A;  1U06 A;  2EJG A;  2KBT A;  4KT0 E;  4LDX A;  1BIA A;  3FDR A;  3CBO A;  1RAC B;  1QP2 A;  3P8D A;  2E3I A;  4C92 A;  2MOX A;  4B9X A;  1M2O A;  4M75 E;  2F1L A;  1B34 A;  4HA8 A;  1E7O A;  2DLP A;  1ZUY A;  4ZGD B;  3TQ7 P;  3MP6 A;  3G4S Q;  1IRX A;  1UGR B;  1HJD A;  1QWF A;  4E47 A;  2DZ9 A;  2O4X A;  3VS2 A;  2YLB A;  5I21 A;  1BI3 A;  3MKD A;  5GJV B;  3GNF B;  2L3P A;  3NTH A;  2LT4 A;  5GAN 4;  4M78 D;  2K7A A;  1CSK A;  2RQR A;  3NMZ C;  3X24 B;  4F14 A;  2WSE E;  2HBP A;  1VQN A;  3CME Q;  3CCJ A;  1QVG A;  2CUD A;  3S3O A;  1TSF A;  3CC4 T;  2YXY A;  3UAT A;  5I22 A;  2DD4 A;  4M7D F;  1NZ9 A;  2GFU A;  1LCK A;  2VYT A;  2LT1 A;  5CAI A;  1AZG B;  3P8B B;  2C06 A;  1M2V A;  2X9H A;  2HQE A;  1N9S A;  4OB1 B;  5LJ5 g;  1Q81 U;  4XU0 A;  2D1X A;  4PJJ A;  4XTW A;  1HXD A;  2HQH A;  4ZTJ A;  1YN8 A;  1KQS P;  4PJO F;  2RJF A;  1KG1 A;  1HD3 A;  1M8V A;  4ZNX A;  1UG1 A;  4J83 A;  1VQL T;  4HXJ A;  2DJQ A;  2RHY A;  3C94 A;  2KY9 A;  6AT1 B;  1I8F A;  4OB2 B;  5LJ3 g;  4IUP A;  1S1N A;  3HRS A;  3R6N A;  2DBK A;  1D09 B;  3EGU A;  3CCL Q;  5FWB A;  1YIT A;  4HVV A;  1PM3 A;  2QK0 A;  4J7F A;  2HNI A;  2J7I A;  2GQV A;  1WYX A;  5GMK e;  2KVQ G;  2DL4 A;  4F7U E;  3GNG A;  4OMP A;  4M75 C;  2PVG B;  4M4Z A;  2QDY B;  4AT1 B;  3EFO B;  4M75 B; 
#chains in the Genus database with same CATH homology
 1I0C A;  3H0I A;  3CQT A;  4Y92 A;  1BK2 A;  1Y57 A;  2J6F A;  4Z88 A;  2JMA A;  4WCI A;  3TSZ A;  1VYV A;  2LCS A;  4RTV A;  1RLQ C;  2JMC A;  2PTK A;  2FPE A;  1WFW A;  1HSQ A;  2ESW A;  2OJ2 A;  2DM1 A;  2EYX A;  2KRS A;  4F16 A;  1SSH A;  5L23 A;  2DYB A;  3VS7 A;  1PRL C;  2LP5 A;  2DE0 X;  2RQU A;  2F2X A;  1B07 A;  1WLP B;  1OPL A;  1X69 A;  2O31 A;  4RTW A;  3UF4 A;  1OEB A;  1TUC A;  1PNJ A;  2CH4 A;  1AZE A;  1GCQ C;  1X27 A;  3JV3 A;  2D8H A;  1M3B A;  1GCP A;  1NEB A;  4ESR A;  4LE9 A;  2GTJ A;  2BZX A;  1ARK A;  1B3Q A;  2K6D A;  2KT1 A;  4J9C A;  2FPD A;  2EGA A;  4JJC A;  1K76 A;  2DNU A;  1VYT A;  1AWJ A;  4CC2 A;  2A08 A;  4KRT A;  2YUQ A;  5ECA A;  2EGC A;  2DX1 A;  2DVJ A;  1NYG A;  2E5K A;  3A98 A;  1JEG A;  1KJW A;  3SHW A;  1WXU A;  1VYU A;  2L3Q A;  3H0H A;  1GCQ A;  1UFF A;  2KRN A;  4RTT A;  1JU5 C;  4LUD A;  2J06 A;  3RBB B;  5GJW B;  1SHF A;  2CRE A;  2I0N A;  4DEX A;  2BTT A;  1OOT A;  2GTO A;  1T0H A;  1TG0 A;  2KE9 A;  2IIM A;  1UHC A;  2DA9 A;  4J9G A;  2JS2 A;  2RPN A;  1YNZ A;  2P4R A;  2AZV A;  1QCF A;  2J05 A;  1WXB A;  1Y0M A;  2SEM A;  1MUZ A;  3I35 A;  1AWX A;  1ABO A;  1WX6 A;  2EQI A;  4LUE A;  2KGT A;  2G6F X;  3VS3 A;  1WA7 A;  2HSP A;  2YUN A;  3NHN A;  4AFU C;  1X6G A;  2LX7 A;  1H3H A;  4HVU A;  1ABQ A;  1NYF A;  2SRC A;  3M0Q A;  2LQN A;  3O5Z A;  1M27 C;  2CH4 W;  2ECZ A;  3IQL A;  1MV3 A;  5FWC A;  2KEA A;  2PNI A;  3NGP A;  2RF0 A;  3UA6 A;  2D8J A;  4AFS C;  3M0U A;  4CC7 A;  2O88 A;  2DL3 A;  1GBR A;  1WDX A;  2W0Z A;  2RQV A;  2C0I A;  1BBZ A;  2A28 A;  2A36 A;  2M51 A;  1PWT A;  2DL5 A;  2DRK A;  1M3A A;  3ZL7 C;  2CT3 A;  1ZBJ A;  2O9S A;  4J9H A;  3H41 A;  1NM7 A;  2OI3 A;  4AG1 C;  2EBP A;  3THK A;  1G83 A;  3EHR A;  2ROL A;  2DBM A;  2AZS A;  3PVQ A;  1N5Z A;  2HCK A;  1CKB A;  1W70 A;  1YP5 A;  3EG3 A;  2V1R A;  1GL5 A;  2JT4 A;  3U23 A;  4FSS A;  1JXO A;  4AFQ C;  2DIL A;  1UUE A;  3VS0 A;  2FPF A;  3M0R A;  1GFC A;  1PKT A;  2FRY A;  2YSQ A;  4OML A;  2KNB B;  2DF6 A;  3EG2 A;  1M8M A;  4J9I A;  2RNA A;  2K9G A;  4J9E A;  1VA7 A;  3GBQ A;  2DL7 A;  1ZX6 A;  2L0A A;  2JM8 A;  4J9F A;  5HCK A;  3I9Q A;  4DEY A;  4JJB A;  2GNC A;  3VS6 A;  2FO0 A;  2KR3 A;  1E6H A;  2YT6 A;  4OMN A;  2QDL A;  1RI9 A;  1W6X A;  3TVT A;  2LNH B;  1AOJ A;  4K11 A;  4GLM A;  1UDL A;  1M30 A;  2RQT A;  2X3X D;  1KSW A;  1X2Q A;  2XMF A;  1K0X A;  1AWW A;  1K1Z A;  2B86 A;  1SRL A;  3FJ5 A;  4X1V A;  1PRM C;  1X43 A;  1RLP C;  1ZUK A;  4OMO A;  3M0T A;  1OV3 A;  2CUB A;  1TUD A;  1X6B A;  2KYB A;  1J3T A;  1FYN A;  1V1C A;  1T3S A;  2ABL A;  1U5S A;  4RTX A;  1UJY A;  1T0J A;  1QWE A;  5I11 A;  3RNJ A;  2FEI A;  2C0T A;  2ED0 A;  2D0N A;  2RN8 A;  4OMM A;  4D8K A;  2K2M A;  2FRW A;  2FG0 A;  4CC3 A;  2HEQ A;  2JS0 A;  1YWP A;  4RTZ A;  4J9D A;  1H8K A;  1NEG A;  2GGR A;  1U3O A;  1UEC A;  2LJ0 A;  1OPK A;  2AKL A;  2CSQ A;  4RTY A;  1Z9Q A;  1JXM A;  2KRM A;  4RUG A;  1QLY A;  2X3W D;  2ENM A;  2O9V A;  2M0Y A;  3QWX X;  2KXD A;  2C0O A;  2AKK A;  1ZSG A;  2EYZ A;  2NWM A;  1K4U S;  2HBW A;  1PHT A;  1I07 A;  2RQW A;  2EPD A;  1YCS B;  2MIO A;  1GFD A;  5IHI A;  1GRI A;  2JW4 A;  5IXB A;  1AWO A;  2DRM A;  1Z9Z A;  1IO6 A;  3VS4 A;  1GBQ A;  1T3L A;  2KXC A;  2GBQ A;  4CC4 B;  1UHF A;  2YDL A;  1CKA A;  2OAW A;  3TSW A;  4OMQ A;  3I5R A;  4ORZ A;  1BB9 A;  3QWY A;  4Z89 A;  1YWO A;  1QKW A;  4LNP A;  4J9B A;  2JXB A;  1AD5 A;  2JTE A;  2DMO A;  4IIM A;  2ROT A;  1WXT A;  3PVL A;  1UE9 A;  1W1F A;  4JPB W;  2LJ1 A;  1M3C A;  2KT8 A;  4AFZ C;  1SPK A;  3REB B;  1NG2 A;  2CDT A;  2V1Q A;  4F17 A;  1U06 A;  2CSI A;  2KBT A;  1I1J A;  1XOV A;  2CT4 A;  2EW3 A;  3SEM A;  2MOX A;  2W10 A;  4D8D A;  2H8H A;  4R0K A;  2J6O A;  3EG0 A;  2K79 A;  3REA B;  2GQI A;  1EFN A;  1E7O A;  2DLP A;  1ZUY A;  4JZ4 A;  2O2O A;  1RUW A;  1G2B A;  3PE0 A;  1HJD A;  5FW9 A;  1QWF A;  3EHQ A;  3VS2 A;  1NLO C;  5GJV B;  1AEY A;  2K3B A;  5IXF A;  3M0S A;  2EKH A;  2L3P A;  5IHK A;  3NPF A;  2EGE A;  1AVZ C;  2F2W A;  2L2P A;  2K7A A;  2DL8 A;  2LQW A;  1CSK A;  2RQR A;  2L3S A;  3NMZ C;  4F14 A;  1SRM A;  3VS1 A;  1UGV A;  1NLP C;  2HDA A;  4HVW A;  2CUD A;  1WIE A;  3H0F A;  3UAT A;  3M0P A;  1BU1 A;  5I22 A;  1K0S A;  1WI7 A;  5EC7 A;  2BZ8 A;  1LCK A;  5IH2 A;  1AZG B;  2YUO A;  2RMO A;  4AG2 C;  3KFV A;  4HCK A;  4A63 B;  2JM9 A;  1SEM A;  4LN2 A;  1UJ0 A;  3LH5 A;  2D1X A;  1K9A A;  4E6R A;  1KFZ A;  4Z8A A;  1YN8 A;  2YUP A;  1ZLM A;  1SHG A;  1HD3 A;  2EYW A;  2KRO A;  3UA7 A;  2A37 A;  4EIK A;  4ZNX A;  5IHN A;  1X2K A;  1UG1 A;  1ZUU A;  3VS5 A;  1QKX A;  4HXJ A;  2DJQ A;  3C0C A;  3VRZ A;  1PKS A;  4RTU A;  2LMJ A;  1H92 A;  2F2V A;  1JQQ A;  2MCN A;  4JJD A;  1S1N A;  1KIK A;  2VVK A;  2KYM A;  3R6N A;  2DBK A;  3EG1 A;  2BZY A;  2EVR A;  2PZ1 A;  2LJ3 A;  1A0N B;  3EGU A;  3I5S A;  2LZ6 B;  5FWB A;  1FMK A;  4HVV A;  4GBQ A;  3ULR B;  3VRY A;  2AK5 A;  1UTI A;  2J7I A;  1WYX A;  2ED1 A;  1JO8 A;  4QT7 A;  1MV0 B;  2DL4 A;  2VWF A;  4OMP A;  4IIO A;  4M4Z A;  2NUZ A;  2VKN A;  1E6G A;  4JZ3 A;  2J6K A;  2EYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...