1X2KA

Solution structure of the sh3 domain of human osteoclast stimulating factor 1 (ostf1)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
b'GSSGSSGKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Osteoclast stimulating factor 1
publication title Solution Structure of the SH3 Domain of Human osteoclast stimulating factor 1 (OSTF1)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1x2kA00
1H3HA 2A37A 2EYZA 2KRMA 1UECA 2EGAA 1QKXA 4AG2C 2J6KA 4IIMA 2K6DA 2YUNA 3C0CA 2VKNA 1K1ZA 1BB9A 1I07A 2BTTA 3VS2A 1AOJA 2EQIA 1W70A 3THKA 2A08A 3UA6A 1K76A 3M0UA 2FRWA 3EHRA 1U06A 2DA9A 2EYYA 5IHKA 1KFZA 1NEGA 2X3WD 4LUDA 2VWFA 2AKKA 2HEQA 1OEBA 2JTEA 1B07A 2AKLA 5IXBA 2LQNA 2M0YA 1J3TA 4Y92A 1MV0B 4LUEA 2RQWA 3UF4A 2RQUA 2JXBA 4GBQA 1PKSA 2M51A 4CC2A 2ABLA 4J9CA 5IH2A 2DL5A 1VA7A 1N5ZA 1ZX6A 1WXBA 1HSQA 2EYXA 1IO6A 4Z88A 2DRKA 2KBTA 1OOTA 3PVLA 1ABQA 1X2QA 2C0OA 2L3SA 2DVJA 1WYXA 3I9QA 2F2WA 1NLOC 4J9DA 1A0NB 2DE0X 5I22A 1G83A 3TSZA 2RF0A 3KFVA 2EYWA 2GBQA 1HD3A 1BBZA 2JS2A 3CQTA 2KYBA 2RN8A 1TG0A 2O2OA 4JZ4A 1ZUUA 2RQTA 2RNAA 1M8MA 2GNCA 1GRIA 4OMLA 4J9FA 2JMCA 2MIOA 1QWFA 4LN2A 1SRMA 2DL3A 2KE9A 5I11A 1CKBA 3H0HA 3EG0A 2A36A 3H41A 1UDLA 3NHNA 2CSIA 1E6GA 1K4US 2I0NA 2DYBA 3FJ5A 1PRLC 2LJ1A 1YN8A 2DBKA 5FWCA 1MV3A 1ARKA 1NG2A 3R6NA 1G2BA 2HDAA 2SEMA 2EKHA 2L2PA 2DMOA 4ZNXA 1KJWA 1W6XA 2DILA 1YWOA 1KSWA 2JM8A 4LE9A 2DRMA 1WX6A 3I5RA 1UJ0A 1UJYA 2AZVA 2YDLA 2DF6A 2ECZA 1AVZC 4CC7A 5GJWB 2DNUA 2LJ0A 2K9GA 1U5SA 4JZ3A 5GJVB 2DL8A 5FWBA 1JEGA 2NWMA 4KRTA 2O31A 1NYGA 2C0IA 2DBMA 2CT3A 2EGEA 1WXUA 1T3LA 1AWWA 1TUDA 3VS7A 4DEXA 1Y57A 2G6FX 1UHFA 2CDTA 4Z8AA 3A98A 5IHIA 1SSHA 1X2KA 2KGTA 1H8KA 4JJCA 4J9GA 1TUCA 1WLPB 3NMZC 2KXCA 1PHTA 3EG1A 2K79A 4X1VA 2YUQA 1H92A 4Z89A 1YNZA 4IIOA 2J06A 4RUGA 1M3CA 2NUZA 1AEYA 1SPKA 3IQLA 3UATA 2O9VA 1PRMC 2DL4A 1UTIA 1Y0MA 2EW3A 2J6FA 2OAWA 1BK2A 1X43A 2HSPA 2CUBA 4ESRA 1BU1A 1Z9ZA 2K2MA 2RMOA 1GL5A 3H0FA 1X6GA 4RTXA 1QLYA 5EC7A 1GCQA 1UFFA 3U23A 1ZBJA 1AZEA 4M4ZA 1WIEA 2YSQA 2FPEA 1WI7A 4J9IA 1I0CA 1K9AA 2MCNA 4D8KA 2CH4W 4DEYA 1AZGB 1YWPA 1RLQC 1VYVA 2DX1A 2YT6A 1V1CA 2KNBB 1JO8A 2CREA 2EPDA 1JXOA 2GTOA 1WXTA 2JMAA 2DM1A 1GBQA 1M3AA 1SEMA 2RPNA 2V1RA 2KXDA 1SRLA 2BZXA 2IIMA 3RBBB 3VS5A 2YUPA 1GFDA 2PNIA 2OI3A 3SEMA 3TVTA 2J6OA 1UE9A 2D8HA 1UGVA 4JPBW 1WFWA 1RI9A 3VRZA 4QT7A 2ESWA 5L23A 2KRNA 2CUDA 1PWTA 1X6BA 1CSKA 3H0IA 2YUOA 1B3QA 2KYMA 2W10A 1GFCA 2SRCA 5IHNA 4K11A 3I35A 3VS0A 3EGUA 3VRYA 1NLPC 1GBRA 2CSQA 4OMNA 2KROA 4OMQA 1PNJA 3ULRB 2RQRA 1YP5A 1RUWA 2DLPA 3NPFA 2CT4A 2ROTA 5HCKA 2KT1A 3EG2A 3RNJA 2QDLA 2EBPA 3I5SA 1T3SA 4J9BA 2JW4A 2BZ8A 1OPKA 1ZUKA 2GTJA 4F14A 2D0NA 3EG3A 3REAB 2PTKA 1HJDA 1FMKA 3VS3A 4RTYA 1JQQA 2F2XA 2FRYA 5FW9A 4AFUC 2FEIA 4LNPA 4CC4B 1S1NA 4FSSA 3QWYA 4RTUA 2HCKA 2L0AA 3O5ZA 3M0RA 2PZ1A 2EVRA 1LCKA 4JJDA 1U3OA 4EIKA 3NGPA 1OV3A 2K7AA 1NEBA 3M0TA 4RTVA 2JM9A 2E5KA 2BZYA 2KR3A 2LQWA 2W0ZA 1ABOA 1K0SA 4E6RA 1MUZA 1X27A 1EFNA 1AWJA 1W1FA 4HVUA 1SHFA 1AWOA 1XOVA 1CKAA 1UUEA 4F16A 1K0XA 4HVWA 4J9EA 3M0QA 2LX7A 2B86A 1UHCA 4OMMA 1PKTA 1VYUA 2VVKA 3QWXX 2F2VA 4OMPA 3TSWA 5IXFA 3PE0A 1NYFA 2ENMA 1E6HA 2ROLA 1QWEA 2C0TA 4RTWA 3UA7A 2AK5A 3VS4A 1WDXA 2K3BA 2LJ3A 4AFZC 2L3QA 1UG1A 3M0PA 2D1XA 4R0KA 3SHWA 4OMOA 2LCSA 1SHGA 2DL7A 2LP5A 2KRSA 2H8HA 2RQVA 4J9HA 3VS6A 1AD5A 4A63B 4ORZA 1ZUYA 2CH4A 2KT8A 4AFQC 1ZSGA 1JU5C 2A28A 4D8DA 2HBWA 2LNHB 2DJQA 1T0HA 3EHQA 1KIKA 3REBB 1M30A 1NM7A 1GCPA 2FPFA 3VS1A 1ZLMA 1AWXA 2MOXA 2L3PA 2KEAA 2O9SA 2D8JA 2J7IA 4RTZA 2J05A 2X3XD 3GBQA 4HCKA 2JS0A 2OJ2A 4AG1C 3PVQA 1T0JA 4HXJA 3M0SA 2V1QA 1Z9QA 2FG0A 1I1JA 1RLPC 3JV3A 4GLMA 2GGRA 2AZSA 2ED1A 2O88A 2JT4A 3ZL7C 4RTTA 1WA7A 2LMJA 4CC3A 4WCIA 1M3BA 2FO0A 1M27C 4F17A 1GCQC 3LH5A 1YCSB 1JXMA 1X69A 1OPLA 2ED0A 5ECAA 2XMFA 1QKWA 2EGCA 2P4RA 4JJBA 2FPDA 2GQIA 1VYTA 1FYNA 4AFSC 2LZ6B 1QCFA 1E7OA 4HVVA
chains in the Genus database with same CATH superfamily
2AHJB 1VIEA 3WVDB 3RKWA 1MMGA 2EGAA 3UPUA 4O6JA 1UGQB 3CCST 3O8VA 2YUNA 1WHJA 2EQJA 1K1ZA 1UGRB 2E5QA 4C8QC 2EQIA 1W70A 1KQ1A 3HPWA 1K76A 1U1SA 3M0UA 3QBYA 4M7AF 3EHRA 3KBGA 1KFZA 4D6WA 1Q86U 4MZPA 2AKKA 2HEQA 2L89A 5KYXA 1OEBA 2AKLA 2K4YA 2LQNA 1Q86C 1J3TA 3CCMA 4XU2A 1K8AR 2BE9B 2WSEE 2KMTA 4OB1B 2RQUA 3NTHA 2XU8A 4CC2A 3J7AF 2ABLA 5IH2A 2DL5A 4ELZC 5GAOl 4XU0A 3VKIA 1VA7A 1WXBA 4XTUA 4DQ2A 4Z88A 1D3BB 3MP1A 1OOTA 1ABQA 1VOMA 2X4XA 4E7ZA 3ASKA 2F2WA 2HSEB 1A0NB 5GANe 2RF0A 1YJWT 2EYWA 1M1KC 2V8KA 2M9UA 1HD3A 2JS2A 1KQ2A 1RAGB 3CCRQ 1TG0A 3SWNC 3CCVT 2RNAA 3EGDA 1VQLA 2GNCA 2YXYA 3MJXA 1VQ5T 3BE3A 1VQ7T 2MIOA 3NTIA 4FYYB 4OGEA 3CCQA 1Q95G 2K5FA 4PNOA 1R8OB 3EG0A 2A36A 4M78C 1JBMA 4OB3B 4M75D 5KYWA 1TXQA 2I0NA 4C5EA 2LJ1A 3CCUA 3VU3C 3Q1JA 1YN8A 4BI4A 4LDVA 5FWCA 1G2BA 2SEMA 2L2PA 4LD6A 1W6XA 2DILA 1SF9A 1VQKA 4X9DA 2QGFB 4M7DG 5D6WA 2JM8A 4M77D 4KGZB 4LE9A 2DRMA 2EJGA 2CP6A 4BE2A 1UJYA 2JZ2A 2OX7A 3INZA 4QVZA 2ECZA 1AVZC 1VQ4T 4CC7A 3TREA 4Y28E 1W2BS 5CR2A 3J80E 2COWA 2ZGWA 3EFOB 4FT2A 1TTHB 3CC7Q 1D1CA 1JEGA 4KRTA 4C8QG 4DA4A 3CC2T 4NL3A 4II1A 4KUDK 4N0AA 4BACA 3BDLA 2DXTA 3EGXA 1TUDA 3CMAA 2G6FX 1IZ6A 4XK8E 5GANf 1UHFA 2CDTA 2R58A 2D0QB 5HKCA 5GAOp 2KGTA 1H8KA 1YJNA 3NMZC 2KXCA 3EG1A 2K79A 4C92B 1YNZA 2PVGB 1VQ8A 5A2QE 1WNLA 2FYKA 2FZCB 1AEYA 3IQLA 2K3XA 2MYSA 5A0DA 3CEYA 4ZN1A 4M7AA 3CCEQ 4R56A 3WVEB 3EG9B 2OAWA 1X43A 4OGCA 3M59A 2LCCA 4ESRA 1Z9ZA 3M5AA 2K2MA 2E4HA 1QLYA 4M4ZA 4PJOA 1I0CA 3I56Q 2MCNA 4C0FA 3FIFA 3E2UA 2CZ1B 1OYXA 2R5MA 1BIBA 1RLQC 1VYVA 2DX1A 2KNBB 4BDYA 1ACMB 2CREA 4A4HA 1PM3A 1JXOA 1UEBA 4LDYA 4BY6B 1SG5A 4M78G 2RB6A 6AT1B 1YCYA 1WQWA 3NTKA 1M3AA 2KXDA 3VS5A 2BZXA 3AHUA 1SSFA 1GXIE 2QA4Q 1OQKA 3TVTA 4L5GA 3CCQT 2D8HA 3UT1A 3AT1B 4JPBW 3X28B 4HT8A 1IREB 1IB8A 1K8AC 2M0OA 2X51A 1XNIA 2ESWA 5L23A 2JJ9A 2RA2A 2DFUA 3CMEQ 1EIFA 1X6BA 3V7RA 3TEEA 4DBQA 5KE2A 5A0LA 3VV0A 3H0IA 2YUOA 1Q7YU 1VQKT 4PLLA 5D7UA 2KYMA 4J8OA 3RERA 3G71Q 1Q7YC 1NJIU 3GNGA 3VS0A 4EMGA 2QQBA 4OMQA 3FC3A 3L2ZA 1Y96B 1W4SA 1V29B 3NPFA 2LQKA 4OVAA 5HCKA 4JLIA 2EBPA 5CKEA 4MDXA 1YITA 4QVCA 2BZ8A 3GNFB 3PMIA 2XK0A 3OYHA 3S6WA 5LJ3e 4DBHA 4M78F 3H9NA 2DERA 1KHIA 1C0MA 1YFNA 2ZPEB 1FMKA 1ZSZA 2KVQG 2CP5A 1U8RA 2FEIA 2GFAA 2P84A 5GAN8 3QDFA 4CC4B 1NPRA 3NFCA 3QWYA 2OTLA 3CMAT 3LGLA 4JJDA 3CCLA 1U3OA 3V7SA 2E3IA 1OV3A 3MEAA 2DZ9A 4RTVA 4ANJA 1FMWA 2EKOA 2LQWA 1ABOA 1K0SA 4E6RA 3DLMA 3JCMJ 4PFOA 1AWJA 3HHTB 1SHFA 2PVOB 2MMPA 1AWOA 2MWOA 3FB9A 1CKAA 3G4SQ 1KQSP 1UUEA 1G8XA 3ZFJA 4J9EA 1UB4A 3CBMA 1VYUA 2ZPGB 4BDZA 3QWXX 5IXFA 4LXCA 2PVDB 4RTWA 4B9XA 3PIPA 4NL2A 1M2OA 2ZPFB 2MK5A 1TH7A 1ZQ1A 4OMOA 3H6ZA 2A0FB 4BB7A 1AT1B 4F7UB 4C8QA 2KRSA 2YHTA 2H8HA 1FMVA 4J9HA 4A63B 4ORZA 3DB4A 3UDCA 4D8DA 2LNHB 1BKBA 3CCJQ 1ZLMA 1IHVA 4JS5A 4PK4A 3M54A 1VQ6A 2RJFA 3P8BB 2CYZB 1OI1A 3S3OA 3ER0A 3QPHA 2H3EB 2B8AA 1VIFA 4LD9K 3GBQA 5KYUB 2OJ2A 3CD6T 2CP0A 2VUBA 4F7UE 2JNGA 4HXJA 3JB9G 3N5BB 2FG0A 1I1JA 3OQ5A 2VC8A 1MMDA 4GLMA 2EYQA 2F1LA 2GGRA 2ED1A 1NZ9A 3ZL7C 4RTTA 3EH1A 3TQ7P 4PFPA 5DLOA 4B6MA 3OYLA 2NUPA 2DYIA 5GAOr 4FIBA 1QMCA 4NOYA 3HL8A 1MMAA 1OPLA 2KDSA 2ZPHB 1YITT 1F1BB 3FEOA 2KQWA 2DIQA 5ECAA 3CXCS 3CBOA 2P4RA 4JJBA 3OYAA 3OYJA 2PU9B 2LZ6B 3J81E 4M78A 2X4WA 2EYZA 2DXCA 2WSFE 2RHIA 3OYIA 3OW2S 4CI0C 3GF5A 3RIRA 1N9RA 1LVKA 4AG2C 3OYYA 2K6DA 5GAMe 2OTLT 2CZ6B 3CCLT 4KUIA 2LRQA 1I07A 1WPYA 3ZBDA 3VS2A 2K57A 1RAIB 2ZZDA 3OYBA 4EDUA 1SKUB 2FRWA 5IHKA 2K5LA 1NEGA 3A5ZB 1QP3A 1PSEA 4QW2A 2JTEA 5IXBA 4Y92A 4EMKB 2R5AA 1OU8A 1VQ5Q 2M51A 3JCMW 3EH2A 2QTXA 1TOVA 2QDYB 3SFMA 3OYNA 4M7AD 1N5ZA 1ZX6A 2CZ0B 3QIIA 1HSQA 5GMKi 2JTMA 1WHGA 3PVLA 3LW5E 1YJWA 2KI7A 2K5IA 2L3SA 1WYXA 4RCBA 1O9SA 1D1BA 5KYYA 1NLOC 1QCOA 4J9DA 4DBRA 5I22A 1G83A 5GAMh 2HQEA 3CCVA 2GBQA 2MF2A 4PJOD 1N6AA 5DY9A 1BBZA 2JTFA 3CQTA 5D6XA 2RN8A 4M7DB 3JRZA 5GAN4 1VQ7A 4FW2A 4KULA 3G6EQ 4RG2A 1N8RU 2E65A 1YIJQ 3QO3A 2KAFA 1QWFA 3F70A 4LN2A 1SRMA 2DL3A 2D6FA 5I11A 1Y7XA 3H0HA 1UDLA 2DKGA 3V8JA 5GMKe 2CSIA 4M7AG 2DYBA 3FJ5A 2V26A 4KGVB 3JAME 2CS7A 4M75B 3CXCP 5GAMf 1JJ2S 4Q5WA 1ARKA 3E19A 1NG2A 1PD1A 5FU6C 3R6NA 4XU3A 2HDAA 3JCMc 3GIBA 2DXBA 3M55A 1KJWA 2DTOA 2EFIA 2QEXT 2Z0WA 1YI2T 3OW2P 3JCMP 3SDZA 4J7FA 1WX6A 4M77B 2QK0A 4IUVA 3FJPA 2YDLA 2DF6A 3CC4T 4QQ6A 5A0GA 4MZMA 1M8VA 1TWBA 4M75E 3CC2A 3HRUA 3OYDA 4JZ3A 1NE8A 2NWMA 2JOYA 3CCMQ 2COZA 2BE7D 1M9SA 2CT3A 4FYXB 2DXUA 2FVUA 5GMKh 1VUBA 1AWWA 3VS7A 1WHKA 4DEXA 5CQYA 3A1PA 2XG8D 4Z8AA 2DVEA 2E6ZA 1WGSA 4M77E 5FU7C 3L2VA 3SWNB 1WLPB 4JRKA 4E7SA 3EG9A 3SD4A 2G3RA 3MO8A 5I2MA 2J06A 1VQNQ 4OP0A 1M3CA 5GAN5 4GLKA 2DTIA 2R57A 4HKEA 1K9MR 3JCMe 2O9VA 1VQ9T 4HCCA 1UTIA 3A8MB 2HSPA 4B9WA 2CUBA 2DD5A 2M1HA 1VQLQ 2RMOA 1GCQA 1UFFA 1WIEA 4HT9A 1K9AA 1Q7YR 2CH4W 1RABB 2QQRA 1OX9A 2O4XB 2A7YA 3CCUQ 4M7DD 1NJIR 2V8IA 2RK1A 1JJ2P 2AIRB 4PJLA 2JMAA 2RHUA 2FZKB 1G3TA 2ZPIB 1X01A 5LJ5e 3RBBB 2PNIA 2ATCB 3SEMA 3OMCA 2J6OA 3JCMh 1UE9A 5D6YA 1UGVA 1WFWA 2LCLA 1RI9A 5C6SA 4C8QD 4QT7A 1B34A 3MKDA 3A8OB 2CGHA 1PWTA 2IVWA 2DEQA 5GANh 2W10A 1RAAB 1GFCA 1KHCA 1QCNA 3CMAQ 4QVDA 1GBRA 2CSQA 3JCMf 1PNJA 2K2VA 5IN1A 1YP5A 2EQMA 1YJNQ 3L1AA 2ROTA 1YJ9Q 2KT1A 3EG2A 1YHQA 2LQ8A 1VQ8Q 3OYCA 4J9BA 5CO7A 3RR6A 5LJ5h 2GTJA 3RDVA 4F14A 2D0NA 3REAB 2PTKA 2QI2A 2YRDA 2P0QA 1HJDA 1HK9A 1LPLA 3VS3A 1M2VA 4KBMB 3X25B 2ZCFB 4A54A 4JDSA 3QUIA 4AFUC 2YWWA 3A8LB 1S1NA 3O5ZA 3M0RA 2PZ1A 2EVRA 2K7AA 3LLRA 1H641 2DAQA 4M78D 3TCJA 2BZYA 5J39A 4J6YA 5LJ5f 3LYIA 3L2QA 1EFNA 1BI3A 2RI3A 3M53A 3GOXA 3JSCA 3OY9A 4IUTA 2XIDA 2KK4A 1BCOA 3C94A 2LX7A 1PCXA 1K73U 1OULA 2KY9A 1PKTA 1M5Q1 2F2VA 4OMPA 3FRNA 4C5IA 3PE0A 3RMQA 1BI1A 2ROLA 4C92E 1QWEA 3V8LA 2RK2A 2AK5A 2JUFA 5EG2A 1PC0A 5KYXB 3OBYA 2K3BA 4AFZC 2L8DA 4V2SA 3M0PA 2PQWA 4E47A 2XDPA 3L42A 2LCSA 1SHGA 2LP5A 4M75F 2CP7A 1ZUYA 5GAOm 1K9MU 2KT8A 2WSCE 3KXTA 1JU5C 3ZEHA 1VQOA 2HBWA 1K9MC 4MDWA 1AHJB 3QJ6A 1NM7A 3OYMA 2CP2A 3VS1A 2MOXA 1W2BP 2KEAA 2O9SA 2MAMA 2J7IA 4RTZA 3CD6A 2J05A 2X3XD 3G7ZA 3MP8A 3P8HA 3EGDB 2VXEA 3PVQA 4RCCA 3D7SB 3M0SA 2EIFA 2VB6A 1Y07A 3I55Q 1NJIC 1R77A 4IUUA 2OTLQ 2LMJA 5KYWB 2OTJA 3CCRT 2RJDA 1FX7A 1VQMQ 2LDMA 4C0DC 3MPUB 2VASA 1M3BA 1Q82U 1M27C 1KQSA 1YHQT 1GCQC 3OS5A 1LOJA 3CPWS 4FW1A 5KYNA 2JN0A 3M9QA 4BY6C 1QKWA 2HNIA 4J6WA 1BI0A 2ZAEA 2GQIA 2LT1A 1FYNA 1OZ2A 2AT1B 1QCFA 2XKOC 4O5VA 1C1AA 2KRMA 1MNEA 1MGQA 1UECA 3PT9A 1LJOA 1MMNA 2KSSA 1OX8A 1QKXA 2J6KA 2JVVA 2NYSA 4IIMA 2A3LA 3T9NA 2QXFA 4IKFA 5J26A 1BB9A 2BTTA 1ZA1B 1IHWA 5GAN2 1TU0B 4PKCC 5AYFA 4R55A 4Y91A 3S3NA 1N8RR 4ZTFA 4ATOA 3EGXB 5GAN7 1B07A 4JRQA 4J83A 4OF1A 1MV0B 2EJ9A 4JJNK 2V8JA 4PJNA 2MI6A 2QQAA 5LJ3h 3QYGB 4GBQA 3JCMd 4JLGA 4L59A 4LDWA 2P4TA 4M7AB 2KBTA 1VQ6Q 3MEVA 2F5TX 2C0OA 3JB9D 9ATCB 3I9QA 4DOWA 2LNVA 2DE0X 3TSZA 3DKMA 1R0CB 5GANd 3VUBA 4PJOB 5LJ3f 2RQTA 1M8MA 3S3MA 1VQOT 2JMCA 8ATCB 4E7LA 1RAFB 1D0YA 4N4IA 5FLXE 5LJ5d 5J3BA 3NHNA 1K4US 1E6GA 3V8KA 4M7AE 3E9FA 4IUPA 3CPWP 2XDBA 4LDUA 3BDUA 1S72A 1VQPA 3HFNA 1MV3A 2QEXA 4F04B 2HL5C 2EKHA 4ZNXA 1ZHIA 1YI2A 2COYA 3CCSQ 2D9TA 2NUTA 2NLUA 4PJOE 1WHMA 2XD0A 3EFRA 2HKQB 2OTJT 1UJ0A 3CC4A 4C0GA 4Z02A 3PMTA 2QA4T 4LDXA 2LT4A 2DO3A 2HAXA 5GJWB 2DNUA 2FB7A 2LJ0A 4HA8A 4C92F 1QVFS 1DJ7B 5GJVB 3RESA 2MWPA 3LH0A 3A8HB 2O31A 4DOVA 2C0IA 2DBMA 2EGEA 1WXUA 1WJRA 1Y57A 5GANg 4EPCA 1KC8R 4ZTJA 1SSHA 4OB0B 4YTLA 4J9GA 3L2UA 1TUCA 4MZTA 1PHTA 1FWZA 1YJWQ 2YUQA 1VQ9A 8AT1B 1ZSZB 1EX4A 1SPKA 3CCVQ 1PRMC 1D3BA 3C95A 5CCAA 4KGXB 2DL4A 1Y0MA 1IRXA 1QVGS 2J6FA 1MNDA 4ZGEB 1VQ7Q 1D0ZA 1TSFA 4P5NA 2O4XA 1BU1A 2C06A 1GL5A 2MPXC 5EC7A 3U23A 5FU6B 1ZBJA 3OSSC 3CXCA 2FPEA 1WI7A 4J9IA 2RHXA 1JB0E 1KD1U 4IUQA 2CP3A 4QKUA 4DEYA 3R6OA 1YWPA 1KD1C 4XTZA 4NS5A 2YT6A 1V1CA 3RUXA 1B7TA 3OW2A 4XTYA 2EPDA 2GTOA 3BFMA 2QG9B 2XICA 1RADB 4GY5A 2PUOB 1GBQA 2VXFA 3RKYA 5DM7R 2RPNA 1SRLA 2IIMA 1G5VA 1N8RC 3G4ST 2OI3A 5CK9A 1VQ4Q 1BYMA 4XTWA 1D09B 1MHNA 1U1TA 5CIUA 4C8QB 3CC2Q 4WF2A 1S72T 3PFSA 3META 1VQPT 1I5LA 1R0BG 2PUKB 4PFZA 1QVFP 2F5KA 5FROA 4M7DE 1G3YA 4EMKC 1FXXA 1O75A 3EFOA 4HCBA 5GAMj 2QYZA 4F7UG 4IURA 2DETA 3I35A 5DLQE 3EGUA 1NLPC 1I81A 1WJSA 2FZGB 2RQRA 2LX9A 1RUWA 2DLPA 1IGUA 2CT4A 1YIJA 5IAYA 3RNJA 2QDLA 4JUVA 1RAEB 3I5SA 1T3SA 2RHZA 1K73R 1OPKA 4BD3A 2YLCA 2BUDA 4C8QE 3EG3A 1I5OB 2Y90A 4C92A 5LJ3d 3X20B 1JQQA 2F2XA 1QVGP 5FW9A 1WHLA 5HK3A 4XTVA 2GQVA 2M16A 4FSSA 2RD1A 4PJMA 3FLGA 2L0AA 3PIOA 4FCYA 5IT9E 1JJ2A 3NGPA 4A4FA 3HKSA 2GF7A 4ZN3A 4C0ZA 3M0TA 2IPOB 2JM9A 2QQSA 4M75C 1KG1A 2KR3A 4A4KA 4M78B 1MUZA 1N9SA 4E7HA 1HYOA 2OAUA 3OYFA 3VUZA 2YRCA 1XOVA 2CKKA 3LX7A 4F16A 4HVWA 4F7UF 4M77C 2O01E 3CCQQ 3QDRB 1UHCA 5CAIA 4OMMA 2VVKA 3TSWA 5GAOn 4PJOF 1E6HA 3VYHB 5GMKj 3SB2A 2YLBA 3QJYA 2QAZA 1KC8U 1WDXA 3VYGA 1TUGB 5GMKm 1UG1A 4M78E 1KC8C 1VQKQ 2D1XA 4R0KA 5GAN3 1M1KU 1VQNA 1Q82R 3JCMV 2CH4A 2DD4A 3OS0A 1ZSGA 2A28A 5LJ3g 3PTAA 2E6NA 4C5HA 3OMGA 1KIKA 3REBB 2QQ9A 1GCPA 5KYYB 3M58A 1AWXA 1YHQQ 3X24B 3QYHB 2D8JA 2FHDA 1Q81U 2VGMA 1Y96A 2P0KA 1C6VX 1BI2A 1Q81C 4HCKA 1PG5B 2GCXA 2JS0A 4AG1C 3OA6A 1T0JA 2EQKA 2V1QA 3MEUA 3CCRA 2VV5A 5M9OA 2O88A 2JT4A 2DEUA 4BI3A 3DB3A 4CC3A 1IXDA 4E2FB 3MHXA 2DJZA 2K3YA 3MEWA 5CKHA 3G6ET 1M4ZA 3CBPA 2FO0A 1YIJT 2HQHA 3KUFA 1JXMA 1M90U 3BW1A 3M4YA 3LWHA 2FPDA 3HRSA 1M90C 1VYTA 2H3JA 4AFSC 4M75G 2E41A 3A8GB 5I21A 1H3HA 1BIAA 2A37A 4BUGA 4J6XA 2E1HA 1M1FA 2X4YA 2HL3A 3C0CA 2X9HA 2VKNA 2BKDN 2CZ7B 5GAMd 5GANj 2HKNA 2VYTA 3GPLA 1AOJA 4M77G 3THKA 2A08A 3UA6A 1U06A 2DA9A 2EYYA 1M1GA 1YJ9A 2X3WD 1RI0A 4LUDA 2VWFA 3CC7A 2M0YA 4LUEA 1I8FA 1HXDA 5LJ5j 2E3HA 2RQWA 1W2BA 2P0PA 3UF4A 2JXBA 4CRIA 2DTHA 1PKSA 1K73C 3CCMT 1VQOQ 4M7DF 4F7UA 4E7KA 4KT0E 4J9CA 2QGGA 4FT4A 1LNXA 2RJEA 4JS4A 1Y71A 5CKDA 2EYXA 1IO6A 2HZYA 2DRKA 1X2QA 2DVJA 3CD6Q 1NPPA 4C0DB 3QSUA 5FRMA 1H3ZA 1N27A 2RI5A 4FU6A 3KFVA 3CCEA 1VQNT 2KYBA 3M57A 3QKJA 2HBPA 4C8QF 2O2OA 4JZ4A 1ZUUA 5KYUA 5KCOA 1KQSS 1GRIA 4OMLA 4J9FA 1QQJA 4C92C 4MMKA 2RM4A 4EMHA 2OTJQ 2KE9A 1YITQ 1VQLT 3I56A 4M77F 1CKBA 2DPPB 4BE1A 3H41A 1K8AU 1KK7A 1PRLC 4A4EA 5GAMg 2DBKA 3OB9A 3E1SA 3CCUT 2DMOA 3PNWC 1QP2A 3GP8A 3JB9I 1YWOA 4A4GA 1KSWA 4ZGDB 3JCMX 3CCLQ 1PD0A 2QA4A 4KH0B 3I5RA 1B34B 2AZVA 1Q82C 4VUBA 5KH6A 2K9GA 1U5SA 1G3SA 4X34A 1XQHA 3CMEA 2XI9A 2DL8A 1V76A 5FWBA 2HMAA 1KD1R 2ZPBB 1NYGA 5L8RE 3M56A 1I4K1 4J7IA 1T3LA 2EJFA 3G71A 3GLXA 3OBWA 4XQ3A 3A98A 5IHIA 4J5YA 4EMKA 1X2KA 4JJCA 3I55A 4C92D 2LTOA 2HQXA 1VQMA 4X1VA 1H92A 4Z89A 4IIOA 4RUGA 1YJNT 4JRPA 1M2VB 1RL2A 1YJ9T 2NUZA 3UATA 3HRTA 1VQ8T 3CC7T 4HCZA 3M4GA 2EW3A 4UC4A 1BK2A 3QZ9B 4RKUE 2X35A 4XU1A 1P92A 3CPWA 3H0FA 1X6GA 4RTXA 4DBFA 4QQDA 1AZEA 1WJQA 2Y4YA 2YSQA 1EZZB 1ZA2B 4M7DA 3MCAB 4D8KA 1QVPA 3ME9A 3L2WA 1AZGB 4XTXA 1WHHA 4C92G 1JO8A 2EQUA 4ZGJB 1S72Q 1VQPQ 4PLIA 2QEXQ 2QTVA 2QASA 4PL6A 3CCET 1WXTA 5GAOq 1YI2Q 3OS2A 3BY7A 4M75A 2LC4A 3OYKA 3G4SA 2DM1A 2FL7A 4ELYC 1SEMA 2V1RA 4A53A 2XHCA 2YUPA 1GFDA 1YBYA 4RMOA 2L5QA 3CC4Q 3TU4K 2LVMA 1PSFA 3I56T 5LJ3j 2GFUA 3E9GA 3VRZA 2E10A 4M77A 4N0AC 3C4SA 2KRNA 4BE0A 2CUDA 2DK3A 4TVRA 5C0MA 4QQGA 5CKBA 1CSKA 1BCMA 1XJWB 3LGFA 3QZ5B 1B3QA 1D1AA 2Y4XA 2SRCA 5IHNA 4K11A 4MMLA 5AT1B 3RKXA 2EWNA 3JCMg 3VRYA 4OMNA 2KROA 3MP6A 5HK0A 4M7AC 3ULRB 1Q86R 3JCMb 3CCJA 4N4HA 4X9CA 1VQ9Q 1QW1A 2JW4A 3H8ZA 2XDDA 1D0XA 3SWNA 1JRIA 1ZUKA 1X75C 1RAHB 3CMET 4PJOC 5HY6A 4C5GA 4RTYA 2FRYA 3JB9J 2L3RA 4LNPA 3VJPA 3OYEA 3UWNA 3G71T 4RTUA 2HCKA 3CCSA 2I2LA 1LCKA 1M1KR 4EIKA 3HTRA 3EAEA 3I55T 1NEBA 3X26B 4FYVB 2E5KA 3QHSA 1VQMT 5LJ5g 3L2RA 2E70A 4E7IA 2W0ZA 3JCMQ 1X27A 1W1FA 4HVUA 3URGA 4FSXA 3OSVA 1UGSB 3HP9A 1K0XA 2WACA 1Q81R 3M0QA 3JB9F 5GMKl 2YRVA 2B86A 3G1JA 2DZCA 2RI2A 2RJCA 5FRNA 4OB2B 1QVFA 1NYFA 2ENMA 2X4JA 2C0TA 3P8DA 3UA7A 3VS4A 1WQ7A 1XTDA 4FYWB 3EFSA 5CQXA 1OU9A 2LJ3A 2L3QA 1TS9A 4N4GA 2EAYA 2E12A 2RHYA 3SHWA 3RMSA 1ZBXA 2E64A 3C12A 5CVIA 2DL7A 7AT1B 1X6OA 2RQVA 3VS6A 1AD5A 4BI8B 1M90R 4AFQC 1RACB 1VQ5A 3DLLA 4ME7A 4E7JA 2DJQA 1T0HA 2M02A 2VGNA 3CPFA 3EHQA 5KCHA 1M30A 5KE3A 3QXEB 4XAXB 4WTOB 2FPFA 3HFOA 1UGPB 3WXMB 4AT1B 1ZSZC 5FU7B 1QVGA 2RO0A 1NBEB 2L3PA 1IGQA 3HSBA 2DIGA 4KH1B 3LWIA 1VQ6T 4JRIA 3PGGA 4RG8A 1Z9QA 3JB9H 1RLPC 5I2SA 3JV3A 4L6V5 5LL6S 2AZSA 5GAN6 3G6EA 1WA7A 4PJOG 4AMCA 4WCIA 3CCJT 2F69A 1OZ3A 4F17A 2HD0A 1VQ4A 3OS1A 3QG1A 4PJJA 3LH5A 1YCSB 1WZOA 1X69A 5CKFA 2BIVA 4M7DC 2ED0A 2IG0A 3OYGA 3V7CA 2XMFA 3FDRA 2NUTB 2EGCA 4FL6A 2RH2A 2NUPB 4OMFB 4FM4B 1G3WA 1E7OA 4HVVA
chains in the Genus database with same CATH topology
1H3HA 2A37A 2EYZA 2KRMA 1UECA 2EGAA 1QKXA 4AG2C 2J6KA 4IIMA 2K6DA 2YUNA 3C0CA 2VKNA 1K1ZA 1BB9A 1I07A 2BTTA 3VS2A 1AOJA 2EQIA 1W70A 3THKA 2A08A 3UA6A 1K76A 3M0UA 2FRWA 3EHRA 1U06A 2DA9A 2EYYA 5IHKA 1KFZA 1NEGA 2X3WD 4LUDA 2VWFA 2AKKA 2HEQA 1OEBA 2JTEA 1B07A 2AKLA 5IXBA 2LQNA 2M0YA 1J3TA 4Y92A 1MV0B 4LUEA 2RQWA 3UF4A 2RQUA 2JXBA 4GBQA 1PKSA 2M51A 4CC2A 2ABLA 4J9CA 5IH2A 2DL5A 1VA7A 1N5ZA 1ZX6A 1WXBA 1HSQA 2EYXA 1IO6A 4Z88A 2DRKA 2KBTA 1OOTA 3PVLA 1ABQA 1X2QA 2C0OA 2L3SA 2DVJA 1WYXA 3I9QA 2F2WA 1NLOC 4J9DA 1A0NB 2DE0X 5I22A 1G83A 3TSZA 2RF0A 3KFVA 2EYWA 2GBQA 1HD3A 1BBZA 2JS2A 3CQTA 2KYBA 2RN8A 1TG0A 2O2OA 4JZ4A 1ZUUA 2RQTA 2RNAA 1M8MA 2GNCA 1GRIA 4OMLA 4J9FA 2JMCA 2MIOA 1QWFA 4LN2A 1SRMA 2DL3A 2KE9A 5I11A 1CKBA 3H0HA 3EG0A 2A36A 3H41A 1UDLA 3NHNA 2CSIA 1E6GA 1K4US 2I0NA 2DYBA 3FJ5A 1PRLC 2LJ1A 1YN8A 2DBKA 5FWCA 1MV3A 1ARKA 1NG2A 3R6NA 1G2BA 2HDAA 2SEMA 2EKHA 2L2PA 2DMOA 4ZNXA 1KJWA 1W6XA 2DILA 1YWOA 1KSWA 2JM8A 4LE9A 2DRMA 1WX6A 3I5RA 1UJ0A 1UJYA 2AZVA 2YDLA 2DF6A 2ECZA 1AVZC 4CC7A 5GJWB 2DNUA 2LJ0A 2K9GA 1U5SA 4JZ3A 5GJVB 2DL8A 5FWBA 1JEGA 2NWMA 4KRTA 2O31A 1NYGA 2C0IA 2DBMA 2CT3A 2EGEA 1WXUA 1T3LA 1AWWA 1TUDA 3VS7A 4DEXA 1Y57A 2G6FX 1UHFA 2CDTA 4Z8AA 3A98A 5IHIA 1SSHA 1X2KA 2KGTA 1H8KA 4JJCA 4J9GA 1TUCA 1WLPB 3NMZC 2KXCA 1PHTA 3EG1A 2K79A 4X1VA 2YUQA 1H92A 4Z89A 1YNZA 4IIOA 2J06A 4RUGA 1M3CA 2NUZA 1AEYA 1SPKA 3IQLA 3UATA 2O9VA 1PRMC 2DL4A 1UTIA 1Y0MA 2EW3A 2J6FA 2OAWA 1BK2A 1X43A 2HSPA 2CUBA 4ESRA 1BU1A 1Z9ZA 2K2MA 2RMOA 1GL5A 3H0FA 1X6GA 4RTXA 1QLYA 5EC7A 1GCQA 1UFFA 3U23A 1ZBJA 1AZEA 4M4ZA 1WIEA 2YSQA 2FPEA 1WI7A 4J9IA 1I0CA 1K9AA 2MCNA 4D8KA 2CH4W 4DEYA 1AZGB 1YWPA 1RLQC 1VYVA 2DX1A 2YT6A 1V1CA 2KNBB 1JO8A 2CREA 2EPDA 1JXOA 2GTOA 1WXTA 2JMAA 2DM1A 1GBQA 1M3AA 1SEMA 2RPNA 2V1RA 2KXDA 1SRLA 2BZXA 2IIMA 3RBBB 3VS5A 2YUPA 1GFDA 2PNIA 2OI3A 3SEMA 3TVTA 2J6OA 1UE9A 2D8HA 1UGVA 4JPBW 1WFWA 1RI9A 3VRZA 4QT7A 2ESWA 5L23A 2KRNA 2CUDA 1PWTA 1X6BA 1CSKA 3H0IA 2YUOA 1B3QA 2KYMA 2W10A 1GFCA 2SRCA 5IHNA 4K11A 3I35A 3VS0A 3EGUA 3VRYA 1NLPC 1GBRA 2CSQA 4OMNA 2KROA 4OMQA 1PNJA 3ULRB 2RQRA 1YP5A 1RUWA 2DLPA 3NPFA 2CT4A 2ROTA 5HCKA 2KT1A 3EG2A 3RNJA 2QDLA 2EBPA 3I5SA 1T3SA 4J9BA 2JW4A 2BZ8A 1OPKA 1ZUKA 2GTJA 4F14A 2D0NA 3EG3A 3REAB 2PTKA 1HJDA 1FMKA 3VS3A 4RTYA 1JQQA 2F2XA 2FRYA 5FW9A 4AFUC 2FEIA 4LNPA 4CC4B 1S1NA 4FSSA 3QWYA 4RTUA 2HCKA 2L0AA 3O5ZA 3M0RA 2PZ1A 2EVRA 1LCKA 4JJDA 1U3OA 4EIKA 3NGPA 1OV3A 2K7AA 1NEBA 3M0TA 4RTVA 2JM9A 2E5KA 2BZYA 2KR3A 2LQWA 2W0ZA 1ABOA 1K0SA 4E6RA 1MUZA 1X27A 1EFNA 1AWJA 1W1FA 4HVUA 1SHFA 1AWOA 1XOVA 1CKAA 1UUEA 4F16A 1K0XA 4HVWA 4J9EA 3M0QA 2LX7A 2B86A 1UHCA 4OMMA 1PKTA 1VYUA 2VVKA 3QWXX 2F2VA 4OMPA 3TSWA 5IXFA 3PE0A 1NYFA 2ENMA 1E6HA 2ROLA 1QWEA 2C0TA 4RTWA 3UA7A 2AK5A 3VS4A 1WDXA 2K3BA 2LJ3A 4AFZC 2L3QA 1UG1A 3M0PA 2D1XA 4R0KA 3SHWA 4OMOA 2LCSA 1SHGA 2DL7A 2LP5A 2KRSA 2H8HA 2RQVA 4J9HA 3VS6A 1AD5A 4A63B 4ORZA 1ZUYA 2CH4A 2KT8A 4AFQC 1ZSGA 1JU5C 2A28A 4D8DA 2HBWA 2LNHB 2DJQA 1T0HA 3EHQA 1KIKA 3REBB 1M30A 1NM7A 1GCPA 2FPFA 3VS1A 1ZLMA 1AWXA 2MOXA 2L3PA 2KEAA 2O9SA 2D8JA 2J7IA 4RTZA 2J05A 2X3XD 3GBQA 4HCKA 2JS0A 2OJ2A 4AG1C 3PVQA 1T0JA 4HXJA 3M0SA 2V1QA 1Z9QA 2FG0A 1I1JA 1RLPC 3JV3A 4GLMA 2GGRA 2AZSA 2ED1A 2O88A 2JT4A 3ZL7C 4RTTA 1WA7A 2LMJA 4CC3A 4WCIA 1M3BA 2FO0A 1M27C 4F17A 1GCQC 3LH5A 1YCSB 1JXMA 1X69A 1OPLA 2ED0A 5ECAA 2XMFA 1QKWA 2EGCA 2P4RA 4JJBA 2FPDA 2GQIA 1VYTA 1FYNA 4AFSC 2LZ6B 1QCFA 1E7OA 4HVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H3H A;  2A37 A;  2EYZ A;  2KRM A;  1UEC A;  2EGA A;  1QKX A;  4AG2 C;  2J6K A;  4IIM A;  2K6D A;  2YUN A;  3C0C A;  2VKN A;  1K1Z A;  1BB9 A;  1I07 A;  2BTT A;  3VS2 A;  1AOJ A;  2EQI A;  1W70 A;  3THK A;  2A08 A;  3UA6 A;  1K76 A;  3M0U A;  2FRW A;  3EHR A;  1U06 A;  2DA9 A;  2EYY A;  5IHK A;  1KFZ A;  1NEG A;  2X3W D;  4LUD A;  2VWF A;  2AKK A;  2HEQ A;  1OEB A;  2JTE A;  1B07 A;  2AKL A;  5IXB A;  2LQN A;  2M0Y A;  1J3T A;  4Y92 A;  1MV0 B;  4LUE A;  2RQW A;  3UF4 A;  2RQU A;  2JXB A;  4GBQ A;  1PKS A;  2M51 A;  4CC2 A;  2ABL A;  4J9C A;  5IH2 A;  2DL5 A;  1VA7 A;  1N5Z A;  1ZX6 A;  1WXB A;  1HSQ A;  2EYX A;  1IO6 A;  4Z88 A;  2DRK A;  2KBT A;  1OOT A;  3PVL A;  1ABQ A;  1X2Q A;  2C0O A;  2L3S A;  2DVJ A;  1WYX A;  3I9Q A;  2F2W A;  1NLO C;  4J9D A;  1A0N B;  2DE0 X;  5I22 A;  1G83 A;  3TSZ A;  2RF0 A;  3KFV A;  2EYW A;  2GBQ A;  1HD3 A;  1BBZ A;  2JS2 A;  3CQT A;  2KYB A;  2RN8 A;  1TG0 A;  2O2O A;  4JZ4 A;  1ZUU A;  2RQT A;  2RNA A;  1M8M A;  2GNC A;  1GRI A;  4OML A;  4J9F A;  2JMC A;  2MIO A;  1QWF A;  4LN2 A;  1SRM A;  2DL3 A;  2KE9 A;  5I11 A;  1CKB A;  3H0H A;  3EG0 A;  2A36 A;  3H41 A;  1UDL A;  3NHN A;  2CSI A;  1E6G A;  1K4U S;  2I0N A;  2DYB A;  3FJ5 A;  1PRL C;  2LJ1 A;  1YN8 A;  2DBK A;  5FWC A;  1MV3 A;  1ARK A;  1NG2 A;  3R6N A;  1G2B A;  2HDA A;  2SEM A;  2EKH A;  2L2P A;  2DMO A;  4ZNX A;  1KJW A;  1W6X A;  2DIL A;  1YWO A;  1KSW A;  2JM8 A;  4LE9 A;  2DRM A;  1WX6 A;  3I5R A;  1UJ0 A;  1UJY A;  2AZV A;  2YDL A;  2DF6 A;  2ECZ A;  1AVZ C;  4CC7 A;  5GJW B;  2DNU A;  2LJ0 A;  2K9G A;  1U5S A;  4JZ3 A;  5GJV B;  2DL8 A;  5FWB A;  1JEG A;  2NWM A;  4KRT A;  2O31 A;  1NYG A;  2C0I A;  2DBM A;  2CT3 A;  2EGE A;  1WXU A;  1T3L A;  1AWW A;  1TUD A;  3VS7 A;  4DEX A;  1Y57 A;  2G6F X;  1UHF A;  2CDT A;  4Z8A A;  3A98 A;  5IHI A;  1SSH A;  1X2K A;  2KGT A;  1H8K A;  4JJC A;  4J9G A;  1TUC A;  1WLP B;  3NMZ C;  2KXC A;  1PHT A;  3EG1 A;  2K79 A;  4X1V A;  2YUQ A;  1H92 A;  4Z89 A;  1YNZ A;  4IIO A;  2J06 A;  4RUG A;  1M3C A;  2NUZ A;  1AEY A;  1SPK A;  3IQL A;  3UAT A;  2O9V A;  1PRM C;  2DL4 A;  1UTI A;  1Y0M A;  2EW3 A;  2J6F A;  2OAW A;  1BK2 A;  1X43 A;  2HSP A;  2CUB A;  4ESR A;  1BU1 A;  1Z9Z A;  2K2M A;  2RMO A;  1GL5 A;  3H0F A;  1X6G A;  4RTX A;  1QLY A;  5EC7 A;  1GCQ A;  1UFF A;  3U23 A;  1ZBJ A;  1AZE A;  4M4Z A;  1WIE A;  2YSQ A;  2FPE A;  1WI7 A;  4J9I A;  1I0C A;  1K9A A;  2MCN A;  4D8K A;  2CH4 W;  4DEY A;  1AZG B;  1YWP A;  1RLQ C;  1VYV A;  2DX1 A;  2YT6 A;  1V1C A;  2KNB B;  1JO8 A;  2CRE A;  2EPD A;  1JXO A;  2GTO A;  1WXT A;  2JMA A;  2DM1 A;  1GBQ A;  1M3A A;  1SEM A;  2RPN A;  2V1R A;  2KXD A;  1SRL A;  2BZX A;  2IIM A;  3RBB B;  3VS5 A;  2YUP A;  1GFD A;  2PNI A;  2OI3 A;  3SEM A;  3TVT A;  2J6O A;  1UE9 A;  2D8H A;  1UGV A;  4JPB W;  1WFW A;  1RI9 A;  3VRZ A;  4QT7 A;  2ESW A;  5L23 A;  2KRN A;  2CUD A;  1PWT A;  1X6B A;  1CSK A;  3H0I A;  2YUO A;  1B3Q A;  2KYM A;  2W10 A;  1GFC A;  2SRC A;  5IHN A;  4K11 A;  3I35 A;  3VS0 A;  3EGU A;  3VRY A;  1NLP C;  1GBR A;  2CSQ A;  4OMN A;  2KRO A;  4OMQ A;  1PNJ A;  3ULR B;  2RQR A;  1YP5 A;  1RUW A;  2DLP A;  3NPF A;  2CT4 A;  2ROT A;  5HCK A;  2KT1 A;  3EG2 A;  3RNJ A;  2QDL A;  2EBP A;  3I5S A;  1T3S A;  4J9B A;  2JW4 A;  2BZ8 A;  1OPK A;  1ZUK A;  2GTJ A;  4F14 A;  2D0N A;  3EG3 A;  3REA B;  2PTK A;  1HJD A;  1FMK A;  3VS3 A;  4RTY A;  1JQQ A;  2F2X A;  2FRY A;  5FW9 A;  4AFU C;  2FEI A;  4LNP A;  4CC4 B;  1S1N A;  4FSS A;  3QWY A;  4RTU A;  2HCK A;  2L0A A;  3O5Z A;  3M0R A;  2PZ1 A;  2EVR A;  1LCK A;  4JJD A;  1U3O A;  4EIK A;  3NGP A;  1OV3 A;  2K7A A;  1NEB A;  3M0T A;  4RTV A;  2JM9 A;  2E5K A;  2BZY A;  2KR3 A;  2LQW A;  2W0Z A;  1ABO A;  1K0S A;  4E6R A;  1MUZ A;  1X27 A;  1EFN A;  1AWJ A;  1W1F A;  4HVU A;  1SHF A;  1AWO A;  1XOV A;  1CKA A;  1UUE A;  4F16 A;  1K0X A;  4HVW A;  4J9E A;  3M0Q A;  2LX7 A;  2B86 A;  1UHC A;  4OMM A;  1PKT A;  1VYU A;  2VVK A;  3QWX X;  2F2V A;  4OMP A;  3TSW A;  5IXF A;  3PE0 A;  1NYF A;  2ENM A;  1E6H A;  2ROL A;  1QWE A;  2C0T A;  4RTW A;  3UA7 A;  2AK5 A;  3VS4 A;  1WDX A;  2K3B A;  2LJ3 A;  4AFZ C;  2L3Q A;  1UG1 A;  3M0P A;  2D1X A;  4R0K A;  3SHW A;  4OMO A;  2LCS A;  1SHG A;  2DL7 A;  2LP5 A;  2KRS A;  2H8H A;  2RQV A;  4J9H A;  3VS6 A;  1AD5 A;  4A63 B;  4ORZ A;  1ZUY A;  2CH4 A;  2KT8 A;  4AFQ C;  1ZSG A;  1JU5 C;  2A28 A;  4D8D A;  2HBW A;  2LNH B;  2DJQ A;  1T0H A;  3EHQ A;  1KIK A;  3REB B;  1M30 A;  1NM7 A;  1GCP A;  2FPF A;  3VS1 A;  1ZLM A;  1AWX A;  2MOX A;  2L3P A;  2KEA A;  2O9S A;  2D8J A;  2J7I A;  4RTZ A;  2J05 A;  2X3X D;  3GBQ A;  4HCK A;  2JS0 A;  2OJ2 A;  4AG1 C;  3PVQ A;  1T0J A;  4HXJ A;  3M0S A;  2V1Q A;  1Z9Q A;  2FG0 A;  1I1J A;  1RLP C;  3JV3 A;  4GLM A;  2GGR A;  2AZS A;  2ED1 A;  2O88 A;  2JT4 A;  3ZL7 C;  4RTT A;  1WA7 A;  2LMJ A;  4CC3 A;  4WCI A;  1M3B A;  2FO0 A;  1M27 C;  4F17 A;  1GCQ C;  3LH5 A;  1YCS B;  1JXM A;  1X69 A;  1OPL A;  2ED0 A;  5ECA A;  2XMF A;  1QKW A;  2EGC A;  2P4R A;  4JJB A;  2FPD A;  2GQI A;  1VYT A;  1FYN A;  4AFS C;  2LZ6 B;  1QCF A;  1E7O A;  4HVV A; 
#chains in the Genus database with same CATH topology
 2AHJ B;  1VIE A;  3WVD B;  3RKW A;  1MMG A;  2EGA A;  3UPU A;  4O6J A;  1UGQ B;  3CCS T;  3O8V A;  2YUN A;  1WHJ A;  2EQJ A;  1K1Z A;  1UGR B;  2E5Q A;  4C8Q C;  2EQI A;  1W70 A;  1KQ1 A;  3HPW A;  1K76 A;  1U1S A;  3M0U A;  3QBY A;  4M7A F;  3EHR A;  3KBG A;  1KFZ A;  4D6W A;  1Q86 U;  4MZP A;  2AKK A;  2HEQ A;  2L89 A;  5KYX A;  1OEB A;  2AKL A;  2K4Y A;  2LQN A;  1Q86 C;  1J3T A;  3CCM A;  4XU2 A;  1K8A R;  2BE9 B;  2WSE E;  2KMT A;  4OB1 B;  2RQU A;  3NTH A;  2XU8 A;  4CC2 A;  3J7A F;  2ABL A;  5IH2 A;  2DL5 A;  4ELZ C;  5GAO l;  4XU0 A;  3VKI A;  1VA7 A;  1WXB A;  4XTU A;  4DQ2 A;  4Z88 A;  1D3B B;  3MP1 A;  1OOT A;  1ABQ A;  1VOM A;  2X4X A;  4E7Z A;  3ASK A;  2F2W A;  2HSE B;  1A0N B;  5GAN e;  2RF0 A;  1YJW T;  2EYW A;  1M1K C;  2V8K A;  2M9U A;  1HD3 A;  2JS2 A;  1KQ2 A;  1RAG B;  3CCR Q;  1TG0 A;  3SWN C;  3CCV T;  2RNA A;  3EGD A;  1VQL A;  2GNC A;  2YXY A;  3MJX A;  1VQ5 T;  3BE3 A;  1VQ7 T;  2MIO A;  3NTI A;  4FYY B;  4OGE A;  3CCQ A;  1Q95 G;  2K5F A;  4PNO A;  1R8O B;  3EG0 A;  2A36 A;  4M78 C;  1JBM A;  4OB3 B;  4M75 D;  5KYW A;  1TXQ A;  2I0N A;  4C5E A;  2LJ1 A;  3CCU A;  3VU3 C;  3Q1J A;  1YN8 A;  4BI4 A;  4LDV A;  5FWC A;  1G2B A;  2SEM A;  2L2P A;  4LD6 A;  1W6X A;  2DIL A;  1SF9 A;  1VQK A;  4X9D A;  2QGF B;  4M7D G;  5D6W A;  2JM8 A;  4M77 D;  4KGZ B;  4LE9 A;  2DRM A;  2EJG A;  2CP6 A;  4BE2 A;  1UJY A;  2JZ2 A;  2OX7 A;  3INZ A;  4QVZ A;  2ECZ A;  1AVZ C;  1VQ4 T;  4CC7 A;  3TRE A;  4Y28 E;  1W2B S;  5CR2 A;  3J80 E;  2COW A;  2ZGW A;  3EFO B;  4FT2 A;  1TTH B;  3CC7 Q;  1D1C A;  1JEG A;  4KRT A;  4C8Q G;  4DA4 A;  3CC2 T;  4NL3 A;  4II1 A;  4KUD K;  4N0A A;  4BAC A;  3BDL A;  2DXT A;  3EGX A;  1TUD A;  3CMA A;  2G6F X;  1IZ6 A;  4XK8 E;  5GAN f;  1UHF A;  2CDT A;  2R58 A;  2D0Q B;  5HKC A;  5GAO p;  2KGT A;  1H8K A;  1YJN A;  3NMZ C;  2KXC A;  3EG1 A;  2K79 A;  4C92 B;  1YNZ A;  2PVG B;  1VQ8 A;  5A2Q E;  1WNL A;  2FYK A;  2FZC B;  1AEY A;  3IQL A;  2K3X A;  2MYS A;  5A0D A;  3CEY A;  4ZN1 A;  4M7A A;  3CCE Q;  4R56 A;  3WVE B;  3EG9 B;  2OAW A;  1X43 A;  4OGC A;  3M59 A;  2LCC A;  4ESR A;  1Z9Z A;  3M5A A;  2K2M A;  2E4H A;  1QLY A;  4M4Z A;  4PJO A;  1I0C A;  3I56 Q;  2MCN A;  4C0F A;  3FIF A;  3E2U A;  2CZ1 B;  1OYX A;  2R5M A;  1BIB A;  1RLQ C;  1VYV A;  2DX1 A;  2KNB B;  4BDY A;  1ACM B;  2CRE A;  4A4H A;  1PM3 A;  1JXO A;  1UEB A;  4LDY A;  4BY6 B;  1SG5 A;  4M78 G;  2RB6 A;  6AT1 B;  1YCY A;  1WQW A;  3NTK A;  1M3A A;  2KXD A;  3VS5 A;  2BZX A;  3AHU A;  1SSF A;  1GXI E;  2QA4 Q;  1OQK A;  3TVT A;  4L5G A;  3CCQ T;  2D8H A;  3UT1 A;  3AT1 B;  4JPB W;  3X28 B;  4HT8 A;  1IRE B;  1IB8 A;  1K8A C;  2M0O A;  2X51 A;  1XNI A;  2ESW A;  5L23 A;  2JJ9 A;  2RA2 A;  2DFU A;  3CME Q;  1EIF A;  1X6B A;  3V7R A;  3TEE A;  4DBQ A;  5KE2 A;  5A0L A;  3VV0 A;  3H0I A;  2YUO A;  1Q7Y U;  1VQK T;  4PLL A;  5D7U A;  2KYM A;  4J8O A;  3RER A;  3G71 Q;  1Q7Y C;  1NJI U;  3GNG A;  3VS0 A;  4EMG A;  2QQB A;  4OMQ A;  3FC3 A;  3L2Z A;  1Y96 B;  1W4S A;  1V29 B;  3NPF A;  2LQK A;  4OVA A;  5HCK A;  4JLI A;  2EBP A;  5CKE A;  4MDX A;  1YIT A;  4QVC A;  2BZ8 A;  3GNF B;  3PMI A;  2XK0 A;  3OYH A;  3S6W A;  5LJ3 e;  4DBH A;  4M78 F;  3H9N A;  2DER A;  1KHI A;  1C0M A;  1YFN A;  2ZPE B;  1FMK A;  1ZSZ A;  2KVQ G;  2CP5 A;  1U8R A;  2FEI A;  2GFA A;  2P84 A;  5GAN 8;  3QDF A;  4CC4 B;  1NPR A;  3NFC A;  3QWY A;  2OTL A;  3CMA T;  3LGL A;  4JJD A;  3CCL A;  1U3O A;  3V7S A;  2E3I A;  1OV3 A;  3MEA A;  2DZ9 A;  4RTV A;  4ANJ A;  1FMW A;  2EKO A;  2LQW A;  1ABO A;  1K0S A;  4E6R A;  3DLM A;  3JCM J;  4PFO A;  1AWJ A;  3HHT B;  1SHF A;  2PVO B;  2MMP A;  1AWO A;  2MWO A;  3FB9 A;  1CKA A;  3G4S Q;  1KQS P;  1UUE A;  1G8X A;  3ZFJ A;  4J9E A;  1UB4 A;  3CBM A;  1VYU A;  2ZPG B;  4BDZ A;  3QWX X;  5IXF A;  4LXC A;  2PVD B;  4RTW A;  4B9X A;  3PIP A;  4NL2 A;  1M2O A;  2ZPF B;  2MK5 A;  1TH7 A;  1ZQ1 A;  4OMO A;  3H6Z A;  2A0F B;  4BB7 A;  1AT1 B;  4F7U B;  4C8Q A;  2KRS A;  2YHT A;  2H8H A;  1FMV A;  4J9H A;  4A63 B;  4ORZ A;  3DB4 A;  3UDC A;  4D8D A;  2LNH B;  1BKB A;  3CCJ Q;  1ZLM A;  1IHV A;  4JS5 A;  4PK4 A;  3M54 A;  1VQ6 A;  2RJF A;  3P8B B;  2CYZ B;  1OI1 A;  3S3O A;  3ER0 A;  3QPH A;  2H3E B;  2B8A A;  1VIF A;  4LD9 K;  3GBQ A;  5KYU B;  2OJ2 A;  3CD6 T;  2CP0 A;  2VUB A;  4F7U E;  2JNG A;  4HXJ A;  3JB9 G;  3N5B B;  2FG0 A;  1I1J A;  3OQ5 A;  2VC8 A;  1MMD A;  4GLM A;  2EYQ A;  2F1L A;  2GGR A;  2ED1 A;  1NZ9 A;  3ZL7 C;  4RTT A;  3EH1 A;  3TQ7 P;  4PFP A;  5DLO A;  4B6M A;  3OYL A;  2NUP A;  2DYI A;  5GAO r;  4FIB A;  1QMC A;  4NOY A;  3HL8 A;  1MMA A;  1OPL A;  2KDS A;  2ZPH B;  1YIT T;  1F1B B;  3FEO A;  2KQW A;  2DIQ A;  5ECA A;  3CXC S;  3CBO A;  2P4R A;  4JJB A;  3OYA A;  3OYJ A;  2PU9 B;  2LZ6 B;  3J81 E;  4M78 A;  2X4W A;  2EYZ A;  2DXC A;  2WSF E;  2RHI A;  3OYI A;  3OW2 S;  4CI0 C;  3GF5 A;  3RIR A;  1N9R A;  1LVK A;  4AG2 C;  3OYY A;  2K6D A;  5GAM e;  2OTL T;  2CZ6 B;  3CCL T;  4KUI A;  2LRQ A;  1I07 A;  1WPY A;  3ZBD A;  3VS2 A;  2K57 A;  1RAI B;  2ZZD A;  3OYB A;  4EDU A;  1SKU B;  2FRW A;  5IHK A;  2K5L A;  1NEG A;  3A5Z B;  1QP3 A;  1PSE A;  4QW2 A;  2JTE A;  5IXB A;  4Y92 A;  4EMK B;  2R5A A;  1OU8 A;  1VQ5 Q;  2M51 A;  3JCM W;  3EH2 A;  2QTX A;  1TOV A;  2QDY B;  3SFM A;  3OYN A;  4M7A D;  1N5Z A;  1ZX6 A;  2CZ0 B;  3QII A;  1HSQ A;  5GMK i;  2JTM A;  1WHG A;  3PVL A;  3LW5 E;  1YJW A;  2KI7 A;  2K5I A;  2L3S A;  1WYX A;  4RCB A;  1O9S A;  1D1B A;  5KYY A;  1NLO C;  1QCO A;  4J9D A;  4DBR A;  5I22 A;  1G83 A;  5GAM h;  2HQE A;  3CCV A;  2GBQ A;  2MF2 A;  4PJO D;  1N6A A;  5DY9 A;  1BBZ A;  2JTF A;  3CQT A;  5D6X A;  2RN8 A;  4M7D B;  3JRZ A;  5GAN 4;  1VQ7 A;  4FW2 A;  4KUL A;  3G6E Q;  4RG2 A;  1N8R U;  2E65 A;  1YIJ Q;  3QO3 A;  2KAF A;  1QWF A;  3F70 A;  4LN2 A;  1SRM A;  2DL3 A;  2D6F A;  5I11 A;  1Y7X A;  3H0H A;  1UDL A;  2DKG A;  3V8J A;  5GMK e;  2CSI A;  4M7A G;  2DYB A;  3FJ5 A;  2V26 A;  4KGV B;  3JAM E;  2CS7 A;  4M75 B;  3CXC P;  5GAM f;  1JJ2 S;  4Q5W A;  1ARK A;  3E19 A;  1NG2 A;  1PD1 A;  5FU6 C;  3R6N A;  4XU3 A;  2HDA A;  3JCM c;  3GIB A;  2DXB A;  3M55 A;  1KJW A;  2DTO A;  2EFI A;  2QEX T;  2Z0W A;  1YI2 T;  3OW2 P;  3JCM P;  3SDZ A;  4J7F A;  1WX6 A;  4M77 B;  2QK0 A;  4IUV A;  3FJP A;  2YDL A;  2DF6 A;  3CC4 T;  4QQ6 A;  5A0G A;  4MZM A;  1M8V A;  1TWB A;  4M75 E;  3CC2 A;  3HRU A;  3OYD A;  4JZ3 A;  1NE8 A;  2NWM A;  2JOY A;  3CCM Q;  2COZ A;  2BE7 D;  1M9S A;  2CT3 A;  4FYX B;  2DXU A;  2FVU A;  5GMK h;  1VUB A;  1AWW A;  3VS7 A;  1WHK A;  4DEX A;  5CQY A;  3A1P A;  2XG8 D;  4Z8A A;  2DVE A;  2E6Z A;  1WGS A;  4M77 E;  5FU7 C;  3L2V A;  3SWN B;  1WLP B;  4JRK A;  4E7S A;  3EG9 A;  3SD4 A;  2G3R A;  3MO8 A;  5I2M A;  2J06 A;  1VQN Q;  4OP0 A;  1M3C A;  5GAN 5;  4GLK A;  2DTI A;  2R57 A;  4HKE A;  1K9M R;  3JCM e;  2O9V A;  1VQ9 T;  4HCC A;  1UTI A;  3A8M B;  2HSP A;  4B9W A;  2CUB A;  2DD5 A;  2M1H A;  1VQL Q;  2RMO A;  1GCQ A;  1UFF A;  1WIE A;  4HT9 A;  1K9A A;  1Q7Y R;  2CH4 W;  1RAB B;  2QQR A;  1OX9 A;  2O4X B;  2A7Y A;  3CCU Q;  4M7D D;  1NJI R;  2V8I A;  2RK1 A;  1JJ2 P;  2AIR B;  4PJL A;  2JMA A;  2RHU A;  2FZK B;  1G3T A;  2ZPI B;  1X01 A;  5LJ5 e;  3RBB B;  2PNI A;  2ATC B;  3SEM A;  3OMC A;  2J6O A;  3JCM h;  1UE9 A;  5D6Y A;  1UGV A;  1WFW A;  2LCL A;  1RI9 A;  5C6S A;  4C8Q D;  4QT7 A;  1B34 A;  3MKD A;  3A8O B;  2CGH A;  1PWT A;  2IVW A;  2DEQ A;  5GAN h;  2W10 A;  1RAA B;  1GFC A;  1KHC A;  1QCN A;  3CMA Q;  4QVD A;  1GBR A;  2CSQ A;  3JCM f;  1PNJ A;  2K2V A;  5IN1 A;  1YP5 A;  2EQM A;  1YJN Q;  3L1A A;  2ROT A;  1YJ9 Q;  2KT1 A;  3EG2 A;  1YHQ A;  2LQ8 A;  1VQ8 Q;  3OYC A;  4J9B A;  5CO7 A;  3RR6 A;  5LJ5 h;  2GTJ A;  3RDV A;  4F14 A;  2D0N A;  3REA B;  2PTK A;  2QI2 A;  2YRD A;  2P0Q A;  1HJD A;  1HK9 A;  1LPL A;  3VS3 A;  1M2V A;  4KBM B;  3X25 B;  2ZCF B;  4A54 A;  4JDS A;  3QUI A;  4AFU C;  2YWW A;  3A8L B;  1S1N A;  3O5Z A;  3M0R A;  2PZ1 A;  2EVR A;  2K7A A;  3LLR A;  1H64 1;  2DAQ A;  4M78 D;  3TCJ A;  2BZY A;  5J39 A;  4J6Y A;  5LJ5 f;  3LYI A;  3L2Q A;  1EFN A;  1BI3 A;  2RI3 A;  3M53 A;  3GOX A;  3JSC A;  3OY9 A;  4IUT A;  2XID A;  2KK4 A;  1BCO A;  3C94 A;  2LX7 A;  1PCX A;  1K73 U;  1OUL A;  2KY9 A;  1PKT A;  1M5Q 1;  2F2V A;  4OMP A;  3FRN A;  4C5I A;  3PE0 A;  3RMQ A;  1BI1 A;  2ROL A;  4C92 E;  1QWE A;  3V8L A;  2RK2 A;  2AK5 A;  2JUF A;  5EG2 A;  1PC0 A;  5KYX B;  3OBY A;  2K3B A;  4AFZ C;  2L8D A;  4V2S A;  3M0P A;  2PQW A;  4E47 A;  2XDP A;  3L42 A;  2LCS A;  1SHG A;  2LP5 A;  4M75 F;  2CP7 A;  1ZUY A;  5GAO m;  1K9M U;  2KT8 A;  2WSC E;  3KXT A;  1JU5 C;  3ZEH A;  1VQO A;  2HBW A;  1K9M C;  4MDW A;  1AHJ B;  3QJ6 A;  1NM7 A;  3OYM A;  2CP2 A;  3VS1 A;  2MOX A;  1W2B P;  2KEA A;  2O9S A;  2MAM A;  2J7I A;  4RTZ A;  3CD6 A;  2J05 A;  2X3X D;  3G7Z A;  3MP8 A;  3P8H A;  3EGD B;  2VXE A;  3PVQ A;  4RCC A;  3D7S B;  3M0S A;  2EIF A;  2VB6 A;  1Y07 A;  3I55 Q;  1NJI C;  1R77 A;  4IUU A;  2OTL Q;  2LMJ A;  5KYW B;  2OTJ A;  3CCR T;  2RJD A;  1FX7 A;  1VQM Q;  2LDM A;  4C0D C;  3MPU B;  2VAS A;  1M3B A;  1Q82 U;  1M27 C;  1KQS A;  1YHQ T;  1GCQ C;  3OS5 A;  1LOJ A;  3CPW S;  4FW1 A;  5KYN A;  2JN0 A;  3M9Q A;  4BY6 C;  1QKW A;  2HNI A;  4J6W A;  1BI0 A;  2ZAE A;  2GQI A;  2LT1 A;  1FYN A;  1OZ2 A;  2AT1 B;  1QCF A;  2XKO C;  4O5V A;  1C1A A;  2KRM A;  1MNE A;  1MGQ A;  1UEC A;  3PT9 A;  1LJO A;  1MMN A;  2KSS A;  1OX8 A;  1QKX A;  2J6K A;  2JVV A;  2NYS A;  4IIM A;  2A3L A;  3T9N A;  2QXF A;  4IKF A;  5J26 A;  1BB9 A;  2BTT A;  1ZA1 B;  1IHW A;  5GAN 2;  1TU0 B;  4PKC C;  5AYF A;  4R55 A;  4Y91 A;  3S3N A;  1N8R R;  4ZTF A;  4ATO A;  3EGX B;  5GAN 7;  1B07 A;  4JRQ A;  4J83 A;  4OF1 A;  1MV0 B;  2EJ9 A;  4JJN K;  2V8J A;  4PJN A;  2MI6 A;  2QQA A;  5LJ3 h;  3QYG B;  4GBQ A;  3JCM d;  4JLG A;  4L59 A;  4LDW A;  2P4T A;  4M7A B;  2KBT A;  1VQ6 Q;  3MEV A;  2F5T X;  2C0O A;  3JB9 D;  9ATC B;  3I9Q A;  4DOW A;  2LNV A;  2DE0 X;  3TSZ A;  3DKM A;  1R0C B;  5GAN d;  3VUB A;  4PJO B;  5LJ3 f;  2RQT A;  1M8M A;  3S3M A;  1VQO T;  2JMC A;  8ATC B;  4E7L A;  1RAF B;  1D0Y A;  4N4I A;  5FLX E;  5LJ5 d;  5J3B A;  3NHN A;  1K4U S;  1E6G A;  3V8K A;  4M7A E;  3E9F A;  4IUP A;  3CPW P;  2XDB A;  4LDU A;  3BDU A;  1S72 A;  1VQP A;  3HFN A;  1MV3 A;  2QEX A;  4F04 B;  2HL5 C;  2EKH A;  4ZNX A;  1ZHI A;  1YI2 A;  2COY A;  3CCS Q;  2D9T A;  2NUT A;  2NLU A;  4PJO E;  1WHM A;  2XD0 A;  3EFR A;  2HKQ B;  2OTJ T;  1UJ0 A;  3CC4 A;  4C0G A;  4Z02 A;  3PMT A;  2QA4 T;  4LDX A;  2LT4 A;  2DO3 A;  2HAX A;  5GJW B;  2DNU A;  2FB7 A;  2LJ0 A;  4HA8 A;  4C92 F;  1QVF S;  1DJ7 B;  5GJV B;  3RES A;  2MWP A;  3LH0 A;  3A8H B;  2O31 A;  4DOV A;  2C0I A;  2DBM A;  2EGE A;  1WXU A;  1WJR A;  1Y57 A;  5GAN g;  4EPC A;  1KC8 R;  4ZTJ A;  1SSH A;  4OB0 B;  4YTL A;  4J9G A;  3L2U A;  1TUC A;  4MZT A;  1PHT A;  1FWZ A;  1YJW Q;  2YUQ A;  1VQ9 A;  8AT1 B;  1ZSZ B;  1EX4 A;  1SPK A;  3CCV Q;  1PRM C;  1D3B A;  3C95 A;  5CCA A;  4KGX B;  2DL4 A;  1Y0M A;  1IRX A;  1QVG S;  2J6F A;  1MND A;  4ZGE B;  1VQ7 Q;  1D0Z A;  1TSF A;  4P5N A;  2O4X A;  1BU1 A;  2C06 A;  1GL5 A;  2MPX C;  5EC7 A;  3U23 A;  5FU6 B;  1ZBJ A;  3OSS C;  3CXC A;  2FPE A;  1WI7 A;  4J9I A;  2RHX A;  1JB0 E;  1KD1 U;  4IUQ A;  2CP3 A;  4QKU A;  4DEY A;  3R6O A;  1YWP A;  1KD1 C;  4XTZ A;  4NS5 A;  2YT6 A;  1V1C A;  3RUX A;  1B7T A;  3OW2 A;  4XTY A;  2EPD A;  2GTO A;  3BFM A;  2QG9 B;  2XIC A;  1RAD B;  4GY5 A;  2PUO B;  1GBQ A;  2VXF A;  3RKY A;  5DM7 R;  2RPN A;  1SRL A;  2IIM A;  1G5V A;  1N8R C;  3G4S T;  2OI3 A;  5CK9 A;  1VQ4 Q;  1BYM A;  4XTW A;  1D09 B;  1MHN A;  1U1T A;  5CIU A;  4C8Q B;  3CC2 Q;  4WF2 A;  1S72 T;  3PFS A;  3MET A;  1VQP T;  1I5L A;  1R0B G;  2PUK B;  4PFZ A;  1QVF P;  2F5K A;  5FRO A;  4M7D E;  1G3Y A;  4EMK C;  1FXX A;  1O75 A;  3EFO A;  4HCB A;  5GAM j;  2QYZ A;  4F7U G;  4IUR A;  2DET A;  3I35 A;  5DLQ E;  3EGU A;  1NLP C;  1I81 A;  1WJS A;  2FZG B;  2RQR A;  2LX9 A;  1RUW A;  2DLP A;  1IGU A;  2CT4 A;  1YIJ A;  5IAY A;  3RNJ A;  2QDL A;  4JUV A;  1RAE B;  3I5S A;  1T3S A;  2RHZ A;  1K73 R;  1OPK A;  4BD3 A;  2YLC A;  2BUD A;  4C8Q E;  3EG3 A;  1I5O B;  2Y90 A;  4C92 A;  5LJ3 d;  3X20 B;  1JQQ A;  2F2X A;  1QVG P;  5FW9 A;  1WHL A;  5HK3 A;  4XTV A;  2GQV A;  2M16 A;  4FSS A;  2RD1 A;  4PJM A;  3FLG A;  2L0A A;  3PIO A;  4FCY A;  5IT9 E;  1JJ2 A;  3NGP A;  4A4F A;  3HKS A;  2GF7 A;  4ZN3 A;  4C0Z A;  3M0T A;  2IPO B;  2JM9 A;  2QQS A;  4M75 C;  1KG1 A;  2KR3 A;  4A4K A;  4M78 B;  1MUZ A;  1N9S A;  4E7H A;  1HYO A;  2OAU A;  3OYF A;  3VUZ A;  2YRC A;  1XOV A;  2CKK A;  3LX7 A;  4F16 A;  4HVW A;  4F7U F;  4M77 C;  2O01 E;  3CCQ Q;  3QDR B;  1UHC A;  5CAI A;  4OMM A;  2VVK A;  3TSW A;  5GAO n;  4PJO F;  1E6H A;  3VYH B;  5GMK j;  3SB2 A;  2YLB A;  3QJY A;  2QAZ A;  1KC8 U;  1WDX A;  3VYG A;  1TUG B;  5GMK m;  1UG1 A;  4M78 E;  1KC8 C;  1VQK Q;  2D1X A;  4R0K A;  5GAN 3;  1M1K U;  1VQN A;  1Q82 R;  3JCM V;  2CH4 A;  2DD4 A;  3OS0 A;  1ZSG A;  2A28 A;  5LJ3 g;  3PTA A;  2E6N A;  4C5H A;  3OMG A;  1KIK A;  3REB B;  2QQ9 A;  1GCP A;  5KYY B;  3M58 A;  1AWX A;  1YHQ Q;  3X24 B;  3QYH B;  2D8J A;  2FHD A;  1Q81 U;  2VGM A;  1Y96 A;  2P0K A;  1C6V X;  1BI2 A;  1Q81 C;  4HCK A;  1PG5 B;  2GCX A;  2JS0 A;  4AG1 C;  3OA6 A;  1T0J A;  2EQK A;  2V1Q A;  3MEU A;  3CCR A;  2VV5 A;  5M9O A;  2O88 A;  2JT4 A;  2DEU A;  4BI3 A;  3DB3 A;  4CC3 A;  1IXD A;  4E2F B;  3MHX A;  2DJZ A;  2K3Y A;  3MEW A;  5CKH A;  3G6E T;  1M4Z A;  3CBP A;  2FO0 A;  1YIJ T;  2HQH A;  3KUF A;  1JXM A;  1M90 U;  3BW1 A;  3M4Y A;  3LWH A;  2FPD A;  3HRS A;  1M90 C;  1VYT A;  2H3J A;  4AFS C;  4M75 G;  2E41 A;  3A8G B;  5I21 A;  1H3H A;  1BIA A;  2A37 A;  4BUG A;  4J6X A;  2E1H A;  1M1F A;  2X4Y A;  2HL3 A;  3C0C A;  2X9H A;  2VKN A;  2BKD N;  2CZ7 B;  5GAM d;  5GAN j;  2HKN A;  2VYT A;  3GPL A;  1AOJ A;  4M77 G;  3THK A;  2A08 A;  3UA6 A;  1U06 A;  2DA9 A;  2EYY A;  1M1G A;  1YJ9 A;  2X3W D;  1RI0 A;  4LUD A;  2VWF A;  3CC7 A;  2M0Y A;  4LUE A;  1I8F A;  1HXD A;  5LJ5 j;  2E3H A;  2RQW A;  1W2B A;  2P0P A;  3UF4 A;  2JXB A;  4CRI A;  2DTH A;  1PKS A;  1K73 C;  3CCM T;  1VQO Q;  4M7D F;  4F7U A;  4E7K A;  4KT0 E;  4J9C A;  2QGG A;  4FT4 A;  1LNX A;  2RJE A;  4JS4 A;  1Y71 A;  5CKD A;  2EYX A;  1IO6 A;  2HZY A;  2DRK A;  1X2Q A;  2DVJ A;  3CD6 Q;  1NPP A;  4C0D B;  3QSU A;  5FRM A;  1H3Z A;  1N27 A;  2RI5 A;  4FU6 A;  3KFV A;  3CCE A;  1VQN T;  2KYB A;  3M57 A;  3QKJ A;  2HBP A;  4C8Q F;  2O2O A;  4JZ4 A;  1ZUU A;  5KYU A;  5KCO A;  1KQS S;  1GRI A;  4OML A;  4J9F A;  1QQJ A;  4C92 C;  4MMK A;  2RM4 A;  4EMH A;  2OTJ Q;  2KE9 A;  1YIT Q;  1VQL T;  3I56 A;  4M77 F;  1CKB A;  2DPP B;  4BE1 A;  3H41 A;  1K8A U;  1KK7 A;  1PRL C;  4A4E A;  5GAM g;  2DBK A;  3OB9 A;  3E1S A;  3CCU T;  2DMO A;  3PNW C;  1QP2 A;  3GP8 A;  3JB9 I;  1YWO A;  4A4G A;  1KSW A;  4ZGD B;  3JCM X;  3CCL Q;  1PD0 A;  2QA4 A;  4KH0 B;  3I5R A;  1B34 B;  2AZV A;  1Q82 C;  4VUB A;  5KH6 A;  2K9G A;  1U5S A;  1G3S A;  4X34 A;  1XQH A;  3CME A;  2XI9 A;  2DL8 A;  1V76 A;  5FWB A;  2HMA A;  1KD1 R;  2ZPB B;  1NYG A;  5L8R E;  3M56 A;  1I4K 1;  4J7I A;  1T3L A;  2EJF A;  3G71 A;  3GLX A;  3OBW A;  4XQ3 A;  3A98 A;  5IHI A;  4J5Y A;  4EMK A;  1X2K A;  4JJC A;  3I55 A;  4C92 D;  2LTO A;  2HQX A;  1VQM A;  4X1V A;  1H92 A;  4Z89 A;  4IIO A;  4RUG A;  1YJN T;  4JRP A;  1M2V B;  1RL2 A;  1YJ9 T;  2NUZ A;  3UAT A;  3HRT A;  1VQ8 T;  3CC7 T;  4HCZ A;  3M4G A;  2EW3 A;  4UC4 A;  1BK2 A;  3QZ9 B;  4RKU E;  2X35 A;  4XU1 A;  1P92 A;  3CPW A;  3H0F A;  1X6G A;  4RTX A;  4DBF A;  4QQD A;  1AZE A;  1WJQ A;  2Y4Y A;  2YSQ A;  1EZZ B;  1ZA2 B;  4M7D A;  3MCA B;  4D8K A;  1QVP A;  3ME9 A;  3L2W A;  1AZG B;  4XTX A;  1WHH A;  4C92 G;  1JO8 A;  2EQU A;  4ZGJ B;  1S72 Q;  1VQP Q;  4PLI A;  2QEX Q;  2QTV A;  2QAS A;  4PL6 A;  3CCE T;  1WXT A;  5GAO q;  1YI2 Q;  3OS2 A;  3BY7 A;  4M75 A;  2LC4 A;  3OYK A;  3G4S A;  2DM1 A;  2FL7 A;  4ELY C;  1SEM A;  2V1R A;  4A53 A;  2XHC A;  2YUP A;  1GFD A;  1YBY A;  4RMO A;  2L5Q A;  3CC4 Q;  3TU4 K;  2LVM A;  1PSF A;  3I56 T;  5LJ3 j;  2GFU A;  3E9G A;  3VRZ A;  2E10 A;  4M77 A;  4N0A C;  3C4S A;  2KRN A;  4BE0 A;  2CUD A;  2DK3 A;  4TVR A;  5C0M A;  4QQG A;  5CKB A;  1CSK A;  1BCM A;  1XJW B;  3LGF A;  3QZ5 B;  1B3Q A;  1D1A A;  2Y4X A;  2SRC A;  5IHN A;  4K11 A;  4MML A;  5AT1 B;  3RKX A;  2EWN A;  3JCM g;  3VRY A;  4OMN A;  2KRO A;  3MP6 A;  5HK0 A;  4M7A C;  3ULR B;  1Q86 R;  3JCM b;  3CCJ A;  4N4H A;  4X9C A;  1VQ9 Q;  1QW1 A;  2JW4 A;  3H8Z A;  2XDD A;  1D0X A;  3SWN A;  1JRI A;  1ZUK A;  1X75 C;  1RAH B;  3CME T;  4PJO C;  5HY6 A;  4C5G A;  4RTY A;  2FRY A;  3JB9 J;  2L3R A;  4LNP A;  3VJP A;  3OYE A;  3UWN A;  3G71 T;  4RTU A;  2HCK A;  3CCS A;  2I2L A;  1LCK A;  1M1K R;  4EIK A;  3HTR A;  3EAE A;  3I55 T;  1NEB A;  3X26 B;  4FYV B;  2E5K A;  3QHS A;  1VQM T;  5LJ5 g;  3L2R A;  2E70 A;  4E7I A;  2W0Z A;  3JCM Q;  1X27 A;  1W1F A;  4HVU A;  3URG A;  4FSX A;  3OSV A;  1UGS B;  3HP9 A;  1K0X A;  2WAC A;  1Q81 R;  3M0Q A;  3JB9 F;  5GMK l;  2YRV A;  2B86 A;  3G1J A;  2DZC A;  2RI2 A;  2RJC A;  5FRN A;  4OB2 B;  1QVF A;  1NYF A;  2ENM A;  2X4J A;  2C0T A;  3P8D A;  3UA7 A;  3VS4 A;  1WQ7 A;  1XTD A;  4FYW B;  3EFS A;  5CQX A;  1OU9 A;  2LJ3 A;  2L3Q A;  1TS9 A;  4N4G A;  2EAY A;  2E12 A;  2RHY A;  3SHW A;  3RMS A;  1ZBX A;  2E64 A;  3C12 A;  5CVI A;  2DL7 A;  7AT1 B;  1X6O A;  2RQV A;  3VS6 A;  1AD5 A;  4BI8 B;  1M90 R;  4AFQ C;  1RAC B;  1VQ5 A;  3DLL A;  4ME7 A;  4E7J A;  2DJQ A;  1T0H A;  2M02 A;  2VGN A;  3CPF A;  3EHQ A;  5KCH A;  1M30 A;  5KE3 A;  3QXE B;  4XAX B;  4WTO B;  2FPF A;  3HFO A;  1UGP B;  3WXM B;  4AT1 B;  1ZSZ C;  5FU7 B;  1QVG A;  2RO0 A;  1NBE B;  2L3P A;  1IGQ A;  3HSB A;  2DIG A;  4KH1 B;  3LWI A;  1VQ6 T;  4JRI A;  3PGG A;  4RG8 A;  1Z9Q A;  3JB9 H;  1RLP C;  5I2S A;  3JV3 A;  4L6V 5;  5LL6 S;  2AZS A;  5GAN 6;  3G6E A;  1WA7 A;  4PJO G;  4AMC A;  4WCI A;  3CCJ T;  2F69 A;  1OZ3 A;  4F17 A;  2HD0 A;  1VQ4 A;  3OS1 A;  3QG1 A;  4PJJ A;  3LH5 A;  1YCS B;  1WZO A;  1X69 A;  5CKF A;  2BIV A;  4M7D C;  2ED0 A;  2IG0 A;  3OYG A;  3V7C A;  2XMF A;  3FDR A;  2NUT B;  2EGC A;  4FL6 A;  2RH2 A;  2NUP B;  4OMF B;  4FM4 B;  1G3W A;  1E7O A;  4HVV A; 
#chains in the Genus database with same CATH homology
 1H3H A;  2A37 A;  2EYZ A;  2KRM A;  1UEC A;  2EGA A;  1QKX A;  4AG2 C;  2J6K A;  4IIM A;  2K6D A;  2YUN A;  3C0C A;  2VKN A;  1K1Z A;  1BB9 A;  1I07 A;  2BTT A;  3VS2 A;  1AOJ A;  2EQI A;  1W70 A;  3THK A;  2A08 A;  3UA6 A;  1K76 A;  3M0U A;  2FRW A;  3EHR A;  1U06 A;  2DA9 A;  2EYY A;  5IHK A;  1KFZ A;  1NEG A;  2X3W D;  4LUD A;  2VWF A;  2AKK A;  2HEQ A;  1OEB A;  2JTE A;  1B07 A;  2AKL A;  5IXB A;  2LQN A;  2M0Y A;  1J3T A;  4Y92 A;  1MV0 B;  4LUE A;  2RQW A;  3UF4 A;  2RQU A;  2JXB A;  4GBQ A;  1PKS A;  2M51 A;  4CC2 A;  2ABL A;  4J9C A;  5IH2 A;  2DL5 A;  1VA7 A;  1N5Z A;  1ZX6 A;  1WXB A;  1HSQ A;  2EYX A;  1IO6 A;  4Z88 A;  2DRK A;  2KBT A;  1OOT A;  3PVL A;  1ABQ A;  1X2Q A;  2C0O A;  2L3S A;  2DVJ A;  1WYX A;  3I9Q A;  2F2W A;  1NLO C;  4J9D A;  1A0N B;  2DE0 X;  5I22 A;  1G83 A;  3TSZ A;  2RF0 A;  3KFV A;  2EYW A;  2GBQ A;  1HD3 A;  1BBZ A;  2JS2 A;  3CQT A;  2KYB A;  2RN8 A;  1TG0 A;  2O2O A;  4JZ4 A;  1ZUU A;  2RQT A;  2RNA A;  1M8M A;  2GNC A;  1GRI A;  4OML A;  4J9F A;  2JMC A;  2MIO A;  1QWF A;  4LN2 A;  1SRM A;  2DL3 A;  2KE9 A;  5I11 A;  1CKB A;  3H0H A;  3EG0 A;  2A36 A;  3H41 A;  1UDL A;  3NHN A;  2CSI A;  1E6G A;  1K4U S;  2I0N A;  2DYB A;  3FJ5 A;  1PRL C;  2LJ1 A;  1YN8 A;  2DBK A;  5FWC A;  1MV3 A;  1ARK A;  1NG2 A;  3R6N A;  1G2B A;  2HDA A;  2SEM A;  2EKH A;  2L2P A;  2DMO A;  4ZNX A;  1KJW A;  1W6X A;  2DIL A;  1YWO A;  1KSW A;  2JM8 A;  4LE9 A;  2DRM A;  1WX6 A;  3I5R A;  1UJ0 A;  1UJY A;  2AZV A;  2YDL A;  2DF6 A;  2ECZ A;  1AVZ C;  4CC7 A;  5GJW B;  2DNU A;  2LJ0 A;  2K9G A;  1U5S A;  4JZ3 A;  5GJV B;  2DL8 A;  5FWB A;  1JEG A;  2NWM A;  4KRT A;  2O31 A;  1NYG A;  2C0I A;  2DBM A;  2CT3 A;  2EGE A;  1WXU A;  1T3L A;  1AWW A;  1TUD A;  3VS7 A;  4DEX A;  1Y57 A;  2G6F X;  1UHF A;  2CDT A;  4Z8A A;  3A98 A;  5IHI A;  1SSH A;  1X2K A;  2KGT A;  1H8K A;  4JJC A;  4J9G A;  1TUC A;  1WLP B;  3NMZ C;  2KXC A;  1PHT A;  3EG1 A;  2K79 A;  4X1V A;  2YUQ A;  1H92 A;  4Z89 A;  1YNZ A;  4IIO A;  2J06 A;  4RUG A;  1M3C A;  2NUZ A;  1AEY A;  1SPK A;  3IQL A;  3UAT A;  2O9V A;  1PRM C;  2DL4 A;  1UTI A;  1Y0M A;  2EW3 A;  2J6F A;  2OAW A;  1BK2 A;  1X43 A;  2HSP A;  2CUB A;  4ESR A;  1BU1 A;  1Z9Z A;  2K2M A;  2RMO A;  1GL5 A;  3H0F A;  1X6G A;  4RTX A;  1QLY A;  5EC7 A;  1GCQ A;  1UFF A;  3U23 A;  1ZBJ A;  1AZE A;  4M4Z A;  1WIE A;  2YSQ A;  2FPE A;  1WI7 A;  4J9I A;  1I0C A;  1K9A A;  2MCN A;  4D8K A;  2CH4 W;  4DEY A;  1AZG B;  1YWP A;  1RLQ C;  1VYV A;  2DX1 A;  2YT6 A;  1V1C A;  2KNB B;  1JO8 A;  2CRE A;  2EPD A;  1JXO A;  2GTO A;  1WXT A;  2JMA A;  2DM1 A;  1GBQ A;  1M3A A;  1SEM A;  2RPN A;  2V1R A;  2KXD A;  1SRL A;  2BZX A;  2IIM A;  3RBB B;  3VS5 A;  2YUP A;  1GFD A;  2PNI A;  2OI3 A;  3SEM A;  3TVT A;  2J6O A;  1UE9 A;  2D8H A;  1UGV A;  4JPB W;  1WFW A;  1RI9 A;  3VRZ A;  4QT7 A;  2ESW A;  5L23 A;  2KRN A;  2CUD A;  1PWT A;  1X6B A;  1CSK A;  3H0I A;  2YUO A;  1B3Q A;  2KYM A;  2W10 A;  1GFC A;  2SRC A;  5IHN A;  4K11 A;  3I35 A;  3VS0 A;  3EGU A;  3VRY A;  1NLP C;  1GBR A;  2CSQ A;  4OMN A;  2KRO A;  4OMQ A;  1PNJ A;  3ULR B;  2RQR A;  1YP5 A;  1RUW A;  2DLP A;  3NPF A;  2CT4 A;  2ROT A;  5HCK A;  2KT1 A;  3EG2 A;  3RNJ A;  2QDL A;  2EBP A;  3I5S A;  1T3S A;  4J9B A;  2JW4 A;  2BZ8 A;  1OPK A;  1ZUK A;  2GTJ A;  4F14 A;  2D0N A;  3EG3 A;  3REA B;  2PTK A;  1HJD A;  1FMK A;  3VS3 A;  4RTY A;  1JQQ A;  2F2X A;  2FRY A;  5FW9 A;  4AFU C;  2FEI A;  4LNP A;  4CC4 B;  1S1N A;  4FSS A;  3QWY A;  4RTU A;  2HCK A;  2L0A A;  3O5Z A;  3M0R A;  2PZ1 A;  2EVR A;  1LCK A;  4JJD A;  1U3O A;  4EIK A;  3NGP A;  1OV3 A;  2K7A A;  1NEB A;  3M0T A;  4RTV A;  2JM9 A;  2E5K A;  2BZY A;  2KR3 A;  2LQW A;  2W0Z A;  1ABO A;  1K0S A;  4E6R A;  1MUZ A;  1X27 A;  1EFN A;  1AWJ A;  1W1F A;  4HVU A;  1SHF A;  1AWO A;  1XOV A;  1CKA A;  1UUE A;  4F16 A;  1K0X A;  4HVW A;  4J9E A;  3M0Q A;  2LX7 A;  2B86 A;  1UHC A;  4OMM A;  1PKT A;  1VYU A;  2VVK A;  3QWX X;  2F2V A;  4OMP A;  3TSW A;  5IXF A;  3PE0 A;  1NYF A;  2ENM A;  1E6H A;  2ROL A;  1QWE A;  2C0T A;  4RTW A;  3UA7 A;  2AK5 A;  3VS4 A;  1WDX A;  2K3B A;  2LJ3 A;  4AFZ C;  2L3Q A;  1UG1 A;  3M0P A;  2D1X A;  4R0K A;  3SHW A;  4OMO A;  2LCS A;  1SHG A;  2DL7 A;  2LP5 A;  2KRS A;  2H8H A;  2RQV A;  4J9H A;  3VS6 A;  1AD5 A;  4A63 B;  4ORZ A;  1ZUY A;  2CH4 A;  2KT8 A;  4AFQ C;  1ZSG A;  1JU5 C;  2A28 A;  4D8D A;  2HBW A;  2LNH B;  2DJQ A;  1T0H A;  3EHQ A;  1KIK A;  3REB B;  1M30 A;  1NM7 A;  1GCP A;  2FPF A;  3VS1 A;  1ZLM A;  1AWX A;  2MOX A;  2L3P A;  2KEA A;  2O9S A;  2D8J A;  2J7I A;  4RTZ A;  2J05 A;  2X3X D;  3GBQ A;  4HCK A;  2JS0 A;  2OJ2 A;  4AG1 C;  3PVQ A;  1T0J A;  4HXJ A;  3M0S A;  2V1Q A;  1Z9Q A;  2FG0 A;  1I1J A;  1RLP C;  3JV3 A;  4GLM A;  2GGR A;  2AZS A;  2ED1 A;  2O88 A;  2JT4 A;  3ZL7 C;  4RTT A;  1WA7 A;  2LMJ A;  4CC3 A;  4WCI A;  1M3B A;  2FO0 A;  1M27 C;  4F17 A;  1GCQ C;  3LH5 A;  1YCS B;  1JXM A;  1X69 A;  1OPL A;  2ED0 A;  5ECA A;  2XMF A;  1QKW A;  2EGC A;  2P4R A;  4JJB A;  2FPD A;  2GQI A;  1VYT A;  1FYN A;  4AFS C;  2LZ6 B;  1QCF A;  1E7O A;  4HVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...