1X2KA

Solution structure of the sh3 domain of human osteoclast stimulating factor 1 (ostf1)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
GSSGSSGKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Osteoclast stimulating factor 1
publication title Solution Structure of the SH3 Domain of Human osteoclast stimulating factor 1 (OSTF1)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2005-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1x2kA00
2EQIA 3VS6A 2KNBB 1X43A 2F2XA 2FRYA 1X6BA 4M4ZA 2D8HA 2ENMA 3UA6A 1VYTA 1K4US 1KFZA 5HCKA 1NEBA 3NHNA 4J9DA 4RUGA 1ABQA 4QT7A 2ROTA 4IIOA 1ZUYA 2L3SA 2A08A 1RUWA 2LJ0A 4AFZC 2BZ8A 2KROA 1WXUA 2NUZA 1GRIA 2F2WA 1K76A 2VVKA 2A28A 1AVZC 2RMOA 1AWXA 2BZXA 2DLPA 2FEIA 1H3HA 2KRMA 2JM8A 4D8DA 4Y92A 2EW3A 2RN8A 4JJBA 2YUPA 2BZYA 2EGEA 2KR3A 1GCQA 2RF0A 1Y57A 4D8KA 2J6KA 3RNJA 2DL7A 1UFFA 1HD3A 2KT1A 1JQQA 3PVQA 2J06A 1SRLA 3I35A 4AG1C 1TUCA 1GL5A 5FWCA 1PKTA 3VS0A 1HJDA 2GQIA 4OMPA 4OMNA 1MV0B 2GGRA 2RQRA 5ECAA 1AEYA 1Z9ZA 1A0NB 2AKKA 2CT4A 1JXOA 3SEMA 3M0TA 1UECA 2ABLA 2EGAA 3M0QA 2JMCA 2DL5A 1SSHA 1PRLC 2LX7A 4LN2A 1E6GA 4CC4B 1HSQA 1AWWA 2CDTA 1UUEA 4DEYA 1JU5C 2PNIA 1K1ZA 1WI7A 2MIOA 2DA9A 2MCNA 1AD5A 2CSQA 3GBQA 1NYFA 3RBBB 1M27C 4CC3A 1MV3A 2YDLA 1QKXA 2CUBA 2NWMA 1AWJA 1OOTA 3R6NA 5FWBA 2DRMA 1H92A 2FO0A 3H0HA 1U06A 2L3PA 3ZL7C 5IXBA 3QWXX 2PZ1A 2O88A 2GTOA 2K6DA 2KRNA 2PTKA 3NPFA 4HXJA 2JS0A 4RTUA 1UHFA 3TSWA 2L0AA 1W1FA 1PWTA 2XMFA 2CUDA 4F16A 2KXCA 2KYMA 5GJWB 1ZUUA 2K7AA 2CH4A 1QWEA 4Z89A 1M3BA 1MUZA 4OMQA 2J7IA 1ARKA 2OAWA 1SHFA 2KT8A 2DBMA 1X27A 4FSSA 1QLYA 2LMJA 4CC7A 2V1QA 2CREA 2H8HA 3M0PA 1VYUA 2OI3A 3EHRA 2GTJA 3VS2A 1VA7A 1QKWA 2JXBA 2W10A 1B07A 1BK2A 2C0OA 1NM7A 4ZNXA 4AG2C 2VKNA 4RTTA 1J3TA 2J6FA 1U3OA 4LE9A 1AZGB 2HCKA 1YP5A 1M30A 1H8KA 1RI9A 1YWPA 4Z8AA 2BTTA 2HDAA 2EPDA 3VS1A 2J05A 4IIMA 1GFDA 1NLOC 4J9IA 1SEMA 4J9CA 4RTWA 1NEGA 1QWFA 2DBKA 3UATA 4K11A 5I22A 2FPFA 1AZEA 1ABOA 3M0RA 1AOJA 2MOXA 2LZ6B 2EYXA 1T3SA 1WDXA 3A98A 4AFSC 2O2OA 1WX6A 1UJYA 2EKHA 1W6XA 4AFUC 1YN8A 4OMOA 2RNAA 1OPKA 1UTIA 2VWFA 1X6GA 1M3AA 3VS3A 2FG0A 4F17A 3PE0A 3EG1A 1GCPA 4KRTA 4HVVA 4LNPA 2CT3A 1UHCA 2DRKA 2M0YA 2JM9A 2X3WD 4JZ4A 3TVTA 1RLQC 2HEQA 2AK5A 2KRSA 3H0FA 4J9HA 2DF6A 4JJCA 1Z9QA 1PRMC 1KIKA 1NG2A 2DM1A 3M0UA 4EIKA 1LCKA 1I07A 1ZBJA 2AKLA 2KYBA 4J9FA 4RTZA 3H0IA 1OEBA 4JPBW 1YCSB 2KE9A 2AZSA 2JW4A 4HVWA 1KJWA 3M0SA 4OMMA 3VS7A 4LUEA 1V1CA 1U5SA 3EG0A 1M8MA 1GFCA 2SRCA 4J9EA 1KSWA 3I9QA 1S1NA 3UA7A 2DVJA 4E6RA 2G6FX 2K2MA 1K0XA 2K3BA 1M3CA 1PNJA 1T0JA 3THKA 1NLPC 2DE0X 2FPEA 1WXTA 2LJ3A 4HCKA 2O9VA 1UDLA 4ESRA 3REBB 4JZ3A 1NYGA 3O5ZA 1BB9A 2LQWA 2O9SA 2GNCA 3EG2A 3NMZC 1WIEA 2ROLA 2EYYA 1JXMA 4CC2A 1BU1A 1YWOA 2W0ZA 2DX1A 3EGUA 2EYWA 3H41A 2DMOA 3IQLA 5IHKA 1CSKA 3NGPA 1RLPC 2OJ2A 2YSQA 1TUDA 4LUDA 2KEAA 2L3QA 2LJ1A 1FYNA 2J6OA 3TSZA 2HSPA 3UF4A 2JT4A 1AWOA 1GBRA 4A63B 3SHWA 1CKBA 2YUOA 1OPLA 1UG1A 2RQTA 2D1XA 2V1RA 1QCFA 4RTVA 2P4RA 1ZSGA 1PKSA 1WFWA 1GCQC 1WXBA 2K79A 1UE9A 2SEMA 1T0HA 2O31A 1B3QA 2F2VA 4GLMA 2LP5A 3VRZA 1WA7A 2IIMA 4GBQA 2CSIA 2EBPA 2ECZA 2D8JA 1CKAA 1WYXA 2C0IA 4R0KA 4WCIA 1X69A 1BBZA 3EHQA 2YT6A 2DL3A 4X1VA 3KFVA 1GBQA 5IHNA 2YUNA 1SHGA 2CH4W 2E5KA 5EC7A 2A36A 1UGVA 5IHIA 3JV3A 1JEGA 3C0CA 5FW9A 1K9AA 3I5SA 5L23A 2L2PA 2M51A 1ZUKA 2RQVA 2HBWA 2DJQA 2DILA 5GJVB 4Z88A 1VYVA 3QWYA 1UJ0A 4DEXA 2RQUA 1PHTA 4J9GA 4HVUA 5I11A 2EGCA 2ESWA 1N5ZA 4J9BA 1G83A 2AZVA 2DL4A 3I5RA 3PVLA 2K9GA 1SPKA 3CQTA 3LH5A 2KGTA 2A37A 2DL8A 2LNHB 2B86A 4ORZA 4JJDA 5IXFA 2QDLA 2FRWA 1X2KA 1Y0MA 2C0TA 3U23A 1WLPB 2JMAA 2KBTA 4AFQC 4F14A 5IH2A 1E7OA 2KXDA 1EFNA 1W70A 2I0NA 2X3XD 1JO8A 2ED0A 2JTEA 2RPNA 1I0CA 1X2QA 1XOVA 2LCSA 2DYBA 3VRYA 1IO6A 2FPDA 2GBQA 1G2BA 1ZX6A 1SRMA 1ZLMA 2EVRA 2DNUA 2YUQA 1E6HA 1K0SA 3VS4A 3REAB 3FJ5A 1OV3A 1T3LA 1I1JA 1TG0A 3EG3A 2RQWA 1FMKA 2ED1A 4RTYA 3VS5A 4OMLA 2LQNA 2D0NA 3ULRB 4RTXA 1YNZA 2JS2A 2EYZA
chains in the Genus database with same CATH superfamily
4N0AC 2KNBB 1X43A 3RKWA 1VQ5A 3HP9A 5GAN6 4BI3A 3JAME 1M2VB 5M9OA 1WHMA 1X6BA 3S3NA 1M1KU 3CPFA 3MEWA 1K4US 4RG8A 1VQ6A 1NPRA 3VKIA 5HCKA 4D6WA 1VQPQ 2KVQG 2KDSA 3D7SB 4N0AA 5GAN8 2GFAA 1RUWA 1SF9A 2LJ0A 5GANh 2YRDA 1I81A 3VU3C 2D6FA 5KYUB 4RCBA 2E10A 4L6V5 4C5EA 1Q82C 3FIFA 3CCVQ 1H3HA 4D8DA 3V8LA 2EW3A 2YUPA 2BIVA 4A54A 1BYMA 2DEQA 2KR3A 1GCQA 1Y57A 3UDCA 4D8KA 1Y7XA 1YHQT 3OQ5A 4RMOA 1HD3A 1VQNA 5GMKl 2D0QB 3I35A 4C0DB 1VQMA 4OMPA 2RQRA 3I56Q 1WPYA 5ECAA 1Z9ZA 4C92G 1M1GA 1XNIA 4FU6A 1B34A 3OY9A 1A0NB 1D1CA 3HL8A 3CCJQ 2EGAA 2JMCA 2DL5A 3M53A 1NZ9A 4TVRA 3NTIA 2CZ1B 3QIIA 1AWWA 1QP3A 1UUEA 4DEYA 1V76A 1WI7A 4P5NA 1VQ7T 3VV0A 1AD5A 2AT1B 3GBQA 4O5VA 1VQ9A 1M27C 5GAOn 4CC3A 1HK9A 1MV3A 2YDLA 2D9TA 5GAOq 1TH7A 3TCJA 3RESA 3CC2T 1PD1A 3EGXA 2HKQB 3R6NA 2LVMA 3BY7A 4PKCC 1YJWA 3H0HA 2V8IA 5IN1A 4Q5WA 2L3PA 3ZL7C 5IXBA 2PZ1A 2F5TX 4N4GA 1KQ2A 2K6DA 1KC8U 1XQHA 4OB1B 2C06A 5CKDA 1UHFA 4J5YA 4PJOG 4IUTA 3EH1A 2Y4YA 2QGGA 3EH2A 4JRQA 3A8MB 1VQPT 5GJWB 2E64A 2ZPEB 1QWEA 2K3YA 2LTOA 1M3BA 4M75F 2IVWA 5I21A 1SHFA 5FU6C 2F69A 2HZYA 2RO0A 3CCLQ 4C8QC 1QLYA 2NUTA 3CCEQ 2H8HA 3CD6A 3P8HA 3EHRA 1YHQA 4JRPA 3VS2A 5L8RE 2MF2A 3QYGB 1N6AA 1IRXA 2JXBA 1TSFA 1OX8A 1B34B 4C8QA 3SB2A 2DPPB 1B07A 5D6YA 2C0OA 4ZNXA 2QTVA 1J3TA 3TQ7P 3GOXA 1U3OA 3CMEA 1AZGB 4B9XA 1BI2A 1D0XA 1RI9A 2ZZDA 5GAMf 2WSCE 2YLCA 3JB9F 2OTJT 3C95A 3Q1JA 4M7AG 4IIMA 1KG1A 1NLOC 3CCJT 4CRIA 4J9IA 4QVCA 1RABB 5GAMe 4J9CA 4RTWA 1NEGA 2CZ6B 4E7SA 3OW2A 3EFOA 1Q95G 2RD1A 1VQ7A 1YCYA 1VQOQ 2MOXA 2LNVA 1M9SA 1KD1C 4LDUA 1YITA 1RL2A 2VYTA 5GAN7 4ZN3A 3G4SQ 1UJYA 2EKHA 4AFUC 4OMOA 1IGQA 3OSVA 3MEUA 2RNAA 4EMHA 1UTIA 3OYCA 1M3AA 1RAHB 1PSEA 4JLGA 1GCPA 4HVVA 3O8VA 2COYA 4CI0C 5FRNA 2QTXA 2QGFB 1TS9A 1NPPA 2AK5A 4HT8A 3MP8A 4OB0B 1Q81U 1KIKA 2DM1A 4IUQA 2MYSA 1FXXA 5FLXE 3V8KA 3HFOA 2HKNA 3CMAQ 2KYBA 3CCRT 2GQVA 1OEBA 5FU6B 2KE9A 2AZSA 4HVWA 3CPWP 4PJLA 1KJWA 3CCLT 3KXTA 4M7DD 4LUEA 1V1CA 2K5LA 5LJ5j 2LRQA 3CCET 1S1NA 2ZPBB 4QQDA 1N27A 2XICA 4XU3A 4ZN1A 2CP6A 3CCMQ 1M3CA 2B8AA 2DE0X 4C0ZA 2FPEA 4X34A 4ESRA 3REBB 2L8DA 3O5ZA 3L2RA 3GNGA 1OQKA 2LQWA 1WIEA 2OTJA 1VQKQ 3E19A 3EFOB 3HRUA 4CC2A 5DLOA 3CCJA 1RADB 2EYWA 3H41A 1TOVA 2WSFE 3IQLA 4A4KA 3LX7A 2JZ2A 4FCYA 2GCXA 3EG9B 2LJ1A 4M78F 1Q86C 3F70A 3PMIA 1FWZA 4BE2A 3OMCA 1OZ3A 5LJ5d 4XU0A 3SHWA 2FHDA 4M75E 1O9SA 1CKBA 1RACB 3QZ5B 2D1XA 2HAXA 3G4ST 3MCAB 2EAYA 2V1RA 1QCFA 4RTVA 3EAEA 2DAQA 1WFWA 1S72Q 2EFIA 2P0QA 2A3LA 5GMKj 3MP6A 2F2VA 2LP5A 3VRZA 3LGFA 3LW5E 2CSIA 4C92C 8AT1B 3JB9J 3SWNA 3CCQQ 4WCIA 1YI2A 2RH2A 3MEAA 4PFPA 1R0BG 3JB9H 2DL3A 2DJZA 5IHNA 2YUNA 3HPWA 5GAN2 2XHCA 4PL6A 3CCRA 2XI9A 2E5KA 2HD0A 2DO3A 2X4YA 2A36A 3JV3A 2L2PA 2QDYB 3CCSA 1ZUKA 4AMCA 3CCEA 4XTWA 2DILA 4Y28E 3OYKA 4Z88A 5KYYA 5CR2A 1YIJA 3OYMA 3QWYA 2VXEA 4WTOB 2RQUA 4WF2A 1PHTA 4OVAA 4L5GA 3CCMT 2BE9B 2PU9B 5HK3A 3OYHA 1RI0A 2ESWA 4N4IA 3M54A 1N8RR 2DL4A 1SPKA 1K73R 2K57A 3V7RA 5AT1B 5I2SA 4PJOC 1VQKT 3JCMQ 1YFNA 3M57A 1WLPB 4EPCA 2JTMA 1B7TA 4PJOA 1JO8A 1I0CA 4KBMB 2DYBA 2DTIA 3GNFB 3CXCA 2GBQA 1ZX6A 1QCNA 4C8QD 2DNUA 2YUQA 3FJ5A 2FYKA 5DLQE 3DKMA 3CCUA 4XTYA 3JCMd 5CVIA 1OI1A 2P84A 4RTXA 1S72T 1AHJB 2F2XA 4QKUA 2DZCA 3OSSC 4XTZA 2FRYA 4XTXA 1U1TA 2D8HA 3S3OA 1VYTA 3M4YA 1KFZA 4C92B 2ZGWA 3L2UA 2QA4Q 1NEBA 3NHNA 2Y90A 4PFOA 5CQYA 1ABQA 4R55A 1ZUYA 4M7AC 2E41A 1D09B 9ATCB 2CYZB 3QHSA 4AFZC 2BZ8A 5LJ3j 1YJNT 4M7DF 4LD9K 2KROA 1G3TA 1WXUA 1GRIA 4OGEA 1K76A 2QI2A 2DD4A 1AWXA 2BZXA 2DLPA 4V2SA 2FEIA 4BB7A 3WVEB 1G3WA 4M7AA 3OYLA 4JJBA 3LWHA 2BZYA 3QXEB 3FRNA 4M78E 3HKSA 3CCMA 2RF0A 4A53A 1M2VA 5GAOr 2RI5A 1QVFP 1LVKA 2DL7A 1UFFA 2XDDA 4DBRA 2FZCB 1JQQA 2YHTA 1TU0B 2PVOB 4MMLA 1SRLA 1KQ1A 5EG2A 4AG1C 5GANj 1WHGA 6AT1B 1TUCA 1PKTA 4LDXA 2GQIA 1VQLQ 1ZHIA 4E7LA 3ME9A 4EDUA 1AEYA 5CAIA 1M90R 2WACA 2CT4A 4PJOB 1JXOA 4XU1A 3M0TA 5KYUA 3SEMA 1JB0E 2ABLA 5LJ3d 4JJNK 4LN2A 2LC4A 1ZA2B 1E6GA 1QVGS 4CC4B 4C0DC 2LDMA 1U8RA 1K1ZA 1YJ9A 2MIOA 4MDXA 2MCNA 2CSQA 1P92A 4M78B 2CKKA 5DY9A 3E1SA 2QQBA 3NFCA 2DIQA 3JCMP 4BY6B 3CC4T 4BDYA 5GANd 1U06A 3QWXX 4M75G 4OB2B 1UEBA 2KRNA 3NPFA 4HXJA 2JS0A 3OS1A 5GMKm 5AYFA 3OYBA 2XMFA 3L2ZA 4JUVA 3OYDA 1Q7YR 4F16A 3CBMA 2YXYA 1ZSZC 3KBGA 4JDSA 2K7AA 2CH4A 4HCCA 1YJNA 1QCOA 4M7AB 2J7IA 1ZBXA 2OAWA 1FMWA 2KT8A 2MMPA 4II1A 2X4WA 2LQKA 3PMTA 5LJ3e 2X9HA 2M02A 1X27A 5I2MA 2LMJA 4OB3B 1BKBA 1VYUA 2OI3A 5A0LA 3JB9G 2O4XA 1RAEB 1WJQA 1NM7A 4AG2C 2P4TA 5GAMg 1G5VA 2VC8A 2J6FA 4LE9A 1VQLT 1W4SA 1WJRA 1YP5A 1G8XA 1H8KA 2EQMA 3LLRA 2BTTA 1W2BP 2E5QA 3MP1A 2KK4A 3V7CA 2KSSA 4ELYC 1M5Q1 5CK9A 4RKUE 1K8AC 5C6SA 1BCOA 2PQWA 3QUIA 2CZ0B 5KCOA 4K11A 1XJWB 1X01A 2FPFA 2VV5A 2CP7A 1AZEA 3I55Q 4KULA 2PUOB 4J6XA 3TREA 2LZ6B 2QYZA 1K9MR 3A98A 4AFSC 1M1FA 3S3MA 1WHLA 1YBYA 3JCMJ 3CC4A 4QW2A 2X4XA 4NOYA 2VWFA 5GAN5 2FG0A 4HA8A 4NL2A 4KRTA 4C5IA 1D0YA 2K5FA 2M0YA 2QQRA 2JM9A 3JCMc 4ELZC 3L2VA 1PD0A 1VQ4Q 1R0CB 4PJOD 2KRSA 3H0FA 3QO3A 4JJCA 1RAFB 1Z9QA 2VXFA 1NJIR 1ZSZB 3QG1A 1MGQA 5GAN3 1ZBJA 3LYIA 4J9FA 4RTZA 3H0IA 1IGUA 1YCSB 3UT1A 1QVFS 2YRCA 3M59A 4F7UF 2O4XB 3M0SA 4PJJA 1N8RU 1H3ZA 1K73U 1M8MA 1GFCA 2SRCA 4PNOA 3QYHB 2EQKA 4E6RA 1R77A 3G71Q 4BE0A 3LWIA 2JN0A 3CEYA 1T0JA 3THKA 1NLPC 1WNLA 2CP5A 2FL7A 3VYHB 4JZ3A 4OMFB 4BE1A 5CCAA 4M78G 3M55A 3QBYA 2E1HA 2XG8D 3BE3A 3MHXA 3CCVT 2GNCA 4M77F 3EG2A 3NMZC 2ROLA 3X28B 1M1KC 2M0OA 1JXMA 1YWOA 3EGUA 2K5IA 2DMOA 5IHKA 2K2VA 4EMGA 1RLPC 2OJ2A 1Y71A 2YSQA 2E65A 1BIBA 2KEAA 2J6OA 2HQHA 3PT9A 5IT9E 3ZBDA 4Y91A 2OX7A 3EGDB 2R57A 3MKDA 3I56T 3PIOA 4MZTA 3GPLA 1OPLA 1UG1A 3M56A 1Q82R 2DETA 3TU4K 2P4RA 1IHWA 1ZSGA 3BDUA 4A4HA 2DIGA 2EQUA 1PKSA 4AT1B 2V8JA 4C5GA 2VUBA 5A0GA 1D1AA 1UE9A 4DBQA 5GAMh 2IIMA 4GBQA 3A1PA 1GXIE 3EG9A 5J39A 1K8AR 4LD6A 2I2LA 3CC7Q 3H6ZA 4ATOA 1HYOA 3CC2A 3EHQA 4BUGA 4X1VA 1GBQA 3FJPA 2V8KA 2CH4W 1KK7A 3META 1UGVA 1JEGA 1K9AA 2M51A 3PTAA 2ZAEA 2HNIA 1VQPA 4ANJA 1M90U 1UJ0A 1Y96B 4Z02A 5I11A 1WGSA 4E47A 1W2BS 3C12A 2E6NA 4R56A 1N5ZA 4FM4B 3PVLA 4M75C 1PSFA 3CCVA 2B86A 4ZTFA 4JJDA 1KC8C 3MPUB 3UPUA 2QDLA 2FRWA 3OYYA 2ZPGB 1Y0MA 1MHNA 2C0TA 2KBTA 2KXDA 1EFNA 7AT1B 3QDRB 3SFMA 2JVVA 1JJ2P 4J83A 3MJXA 4DOVA 3VRYA 1IO6A 3I56A 2FPDA 1ZLMA 2LT1A 3VUBA 2AIRB 4XQ3A 5KYWA 1K0SA 1O75A 1TTHB 1OV3A 2E12A 3EG3A 4FT4A 1FMKA 4DBHA 2ED1A 4IKFA 3V8JA 4F7UE 1QMCA 2D0NA 1Q7YU 4QQ6A 1RAAB 1M1KR 2EQIA 2OTLQ 4XAXB 2MAMA 3X25B 4M7DG 1R8OB 4M4ZA 2ENMA 1VQOT 3UA6A 3LH0A 1IHVA 4PJMA 3INZA 4FYVB 3CC7T 4IIOA 2A08A 2A7YA 3G1JA 4E7HA 2LQ8A 4M77E 4J7IA 3L2WA 2HQEA 4HCZA 2RJFA 5J3BA 2F2WA 2M16A 1G3SA 2A28A 3RMQA 1AVZC 2RMOA 2KRMA 2FVUA 2KAFA 1F1BB 2EGEA 2L3RA 2XDBA 3PVQA 1KD1R 2J06A 1U1SA 4C92A 4JS5A 1TXQA 3ZEHA 5FWCA 3VS0A 1HJDA 3CMAT 3CCLA 2LX9A 4OMNA 1MV0B 3N5BB 4M75B 3OA6A 2DTOA 5LJ5f 2AKKA 1VOMA 5CKFA 2ZPIB 1K9MU 3M0QA 3P8BB 1SSHA 2JOYA 2LX7A 5LJ5e 1LNXA 4ZGEB 2RHUA 5KYWB 1Q81C 4A4GA 1JU5C 1ACMB 1VQ5Q 1MMDA 3RDVA 1MNDA 3GP8A 1WQWA 1QVGA 3RBBB 1LPLA 3TEEA 1VQ6Q 3BW1A 1QKXA 2DKGA 2K4YA 3RUXA 2PVGB 3QZ9B 3UWNA 2VGNA 2DRMA 1H92A 4ME7A 3DLLA 3GLXA 4FYWB 3SD4A 1NJIU 2OTLT 1PCXA 1VQOA 4XTUA 2GTOA 2PTKA 4M78C 3PFSA 2RI2A 3OYNA 3A8GB 1PWTA 3CC7A 2E70A 2HBPA 3G4SA 2CUDA 1ZUUA 4BY6C 2RB6A 4Z89A 1UB4A 1VQNQ 4OMQA 2HSEB 3C94A 4FSXA 4M78A 1QP2A 3NTHA 2DBMA 2CP0A 1VQMQ 2V26A 4FSSA 2CREA 5GMKe 3M0PA 3CCQT 1I5OB 2GTJA 1Q86R 3CPWS 1QKWA 5CO7A 5GMKh 2JTFA 2W10A 2X35A 1D3BB 3H8ZA 1BK2A 4FT2A 3CMAA 1HXDA 1PG5B 2EQJA 3RKXA 1KQSP 2JNGA 1UGQB 1VQ9Q 2PVDB 4RCCA 1M30A 4Z8AA 2RA2A 5KH6A 2EPDA 1JJ2S 3HSBA 4J6WA 2EWNA 3VS1A 8ATCB 5J26A 1GFDA 5KE2A 3JCMf 3J80E 4PJNA 1YJWQ 1Q82U 2X4JA 2RJEA 5HKCA 2YWWA 2BUDA 3JCMe 5I22A 1VQ5T 1ABOA 1AOJA 1N9RA 3DLMA 4BI4A 3A8HB 1T3SA 1VQKA 3A5ZB 4F04B 4DBFA 1VQ6T 1WX6A 3M5AA 2QEXQ 1W6XA 1WHKA 2COWA 5CKHA 1OPKA 1EIFA 2NLUA 1X6GA 3OBYA 2XKOC 5CKBA 3VS3A 3R6OA 1Y07A 2AHJB 2CT3A 3JCMb 4IURA 5A2QE 2DRKA 5GAOp 2X3WD 1PC0A 4JZ4A 2XDPA 3OS0A 4F7UG 3HTRA 2HEQA 3CD6Q 2RHZA 2JUFA 1YHQQ 1BI0A 1PRMC 1FX7A 5D6XA 3M0UA 1VQNT 4NS5A 1S72A 3S6WA 2DXBA 2X51A 2JW4A 3KUFA 1BIAA 3CMEQ 3VS7A 3RIRA 1U5SA 3AT1B 3M4GA 3EG0A 4J9EA 3CCQA 2E3HA 3I9QA 3UA7A 4M77G 2DVJA 1QVFA 2QA4T 5KE3A 2L89A 1K0XA 2K3BA 1I4K1 2RK1A 1SKUB 2QK0A 3P8DA 5LJ3f 3JB9D 5HK0A 1WXTA 4B6MA 4J7FA 1UDLA 1VQ7Q 4M7DC 1BB9A 3NTKA 4C0FA 5CQXA 1ZSZA 1SG5A 2O9SA 1VQ9T 1YITQ 1OYXA 2EYYA 2VGMA 5LJ3h 1UGSB 1QVPA 5IAYA 3J7AF 4BDZA 1CSKA 2ZPHB 3NGPA 3ZFJA 1TUDA 4LUDA 4KGXB 4ZTJA 1M8VA 1YJWT 1UGRB 5GANf 3TSZA 3UF4A 3OYEA 4E7JA 1FMVA 2R5AA 3OYGA 1ZA1B 2GF7A 4A63B 4E2FB 5GANe 2CP3A 1M4ZA 4C92D 2RQTA 2RM4A 5GAOl 2QEXT 2H3EB 3E2UA 3MEVA 4A4FA 1GCQC 4C8QF 3OS2A 1WXBA 4C0GA 4MZPA 2DFUA 2SEMA 1T0HA 2O31A 3BFMA 3GIBA 1B3QA 4GLMA 4IUVA 1WA7A 3LGLA 1WJSA 2EBPA 1CKAA 1VIEA 1WYXA 2C0IA 4MDWA 4M7DE 3CD6T 1X69A 2QAZA 1BBZA 2YT6A 2M9UA 3EGDA 1SHGA 2YLBA 1VUBA 2ZPFB 5IHIA 4KH0B 3C0CA 4QQGA 5FW9A 1KD1U 4KH1B 2FZGB 3CMET 3ER0A 5DM7R 4BD3A 2OTJQ 4JS4A 5GAMj 1LOJA 5GJVB 3DB3A 2QA4A 1MNEA 1VYVA 2E3IA 1KQSS 1IREB 3G6EQ 4J9GA 2BE7D 2EGCA 1SSFA 1QW1A 1VQ8Q 2K9GA 3LH5A 2A37A 3QDFA 3A8OB 2LNHB 3RERA 4M7DB 5LL6S 4KT0E 2DYIA 1W2BA 2FB7A 4M78D 2ZCFB 2F1LA 1YITT 3U23A 3L1AA 2JMAA 4AFQC 3WXMB 1X6OA 1E7OA 4F14A 5IH2A 5CKEA 2I0NA 1C0MA 2H3JA 1UGPB 3OW2P 2WSEE 2ED0A 2JTEA 2RPNA 4OGCA 1X2QA 1VQLA 1XOVA 1Y96A 3OS5A 3RMSA 2LCSA 2DXCA 5GAMd 1G2BA 5FROA 1E6HA 3REAB 1T3LA 1I1JA 2QEXA 3PIPA 2RQWA 1YI2Q 2QQAA 2R5MA 1H641 4RTYA 3OYJA 4OMLA 4DQ2A 1LJOA 2LQNA 2DVEA 4M7AD 3ULRB 4EMKC 3CCRQ 2EYZA 1WHJA 3VS6A 1WQ7A 3URGA 2HMAA 3CCSQ 3I55T 4A4EA 3AHUA 1RAGB 4RUGA 4J9DA 1WHHA 4J8OA 4EMKA 1YIJQ 2R58A 5D6WA 1OULA 2MWPA 4KUIA 4QT7A 2ROTA 2L3SA 1Q86U 3FDRA 2NUZA 2M1HA 2VVKA 4KUDK 2JM8A 4Y92A 2RN8A 1NBEB 3QPHA 3JCMX 1VQ4T 1RAIB 2J6KA 3RNJA 3G6ET 3OMGA 2KT1A 4DA4A 2DEUA 1GL5A 5LJ5g 3EFRA 1VQ8T 3EGXB 2GGRA 2NYSA 3EFSA 1IXDA 2E4HA 4HT9A 3X20B 1OU9A 4C8QE 3CCUQ 3RR6A 1UECA 1PRLC 3OYIA 4YTLA 3G71T 1HSQA 2CDTA 3FB9A 1XTDA 4C92F 2IG0A 5HY6A 2PNIA 4F7UA 2DA9A 4HCBA 2COZA 2LT4A 4JRIA 3HFNA 1NYFA 2ATCB 3QSUA 3GF5A 1N8RC 2DXTA 2CUBA 1K73C 2NWMA 4M77C 1NE8A 1AWJA 4FIBA 1OOTA 2YRVA 2Z0WA 1YI2T 4X9CA 4LDVA 3JCMW 2NUTB 5FWBA 4M75A 2FO0A 2LCCA 2DERA 3PGGA 4EMKB 2O88A 1IZ6A 4PLIA 3I55A 4M77A 2CGHA 2KMTA 3H9NA 4RTUA 4C8QB 2EYQA 3TSWA 3CCST 4LDYA 2L0AA 2CP2A 5D7UA 1W1FA 2RJDA 2KXCA 2KYMA 1YIJT 4KGVB 5FRMA 2CZ7B 4GY5A 1MUZA 1AT1B 1ARKA 2QQ9A 4KGZB 3SDZA 5GMKi 2RI3A 4PJOF 1KHCA 2KQWA 3L42A 2KI7A 1VIFA 2HL5C 4CC7A 2V1QA 4PLLA 1G3YA 1VQ4A 1X75C 4VUBA 4XK8E 3CBPA 4QVZA 3G6EA 3G7ZA 1VA7A 4LXCA 5KYNA 3A8LB 4B9WA 1VQ8A 2VKNA 4RTTA 1YJ9Q 2PUKB 3CPWA 2EJFA 1OZ2A 1EZZB 4IUUA 2XIDA 2HCKA 4E7ZA 4MZMA 3JCMg 1YWPA 1QVGP 3OW2S 2HDAA 3VUZA 2RHIA 4F7UB 3CCUT 2J05A 5KYXA 3G71A 3QJ6A 3SWNC 1SEMA 2MK5A 1QWFA 3HRTA 1JJ2A 2DBKA 3UATA 1MMNA 4E7IA 3M0RA 4BACA 2EYXA 3X24B 2RHXA 1WDXA 3CXCP 4M7AF 1D3BA 4NL3A 3FC3A 2O2OA 4N4HA 1YN8A 1YJNQ 4M77B 1M90C 2QXFA 1MMAA 4DOWA 4FYXB 1BCMA 4F17A 3PE0A 3EG1A 2HL3A 4LNPA 5LJ5h 1UHCA 3V7SA 1I8FA 2QASA 3TVTA 1IB8A 2DXUA 2NUPA 1RLQC 4J9HA 2DF6A 2QQSA 3OYAA 4XTVA 3ASKA 1NG2A 1V29B 3JRZA 2L5QA 4EIKA 1KC8R 1LCKA 2O01E 1I07A 2AKLA 3HRSA 2DK3A 4JPBW 4C5HA 4X9DA 4IUPA 3VJPA 3J81E 5GAN4 1C6VX 4OMMA 1WZOA 2Y4XA 1KHIA 4PK4A 1JRIA 1DJ7B 1KSWA 3M58A 5LJ3g 4ZGJB 2EJGA 3JSCA 4UC4A 4C92E 5FU7C 2G6FX 2K2MA 2KY9A 1PNJA 1N9SA 1OX9A 1EX4A 4OF1A 3WVDB 2LJ3A 4HCKA 4JRKA 2O9VA 3QJYA 3QKJA 1Q7YC 2RHYA 4FW1A 4O6JA 1NYGA 5A0DA 5KYXB 2EIFA 1YJ9T 4LDWA 3RKYA 2DZ9A 4QVDA 1BU1A 2W0ZA 3X26B 2DX1A 5KCHA 3CC4Q 5GANg 3SWNB 2K3XA 2L3QA 1FYNA 1TWBA 2DD5A 2E6ZA 2HSPA 2F5KA 4C8QG 2EJ9A 2JT4A 1AWOA 2RK2A 1GBRA 2EKOA 2DTHA 4BI8B 1BI1A 3FEOA 3OYFA 2YUOA 4XU2A 1ZQ1A 4FYYB 2A0FB 4PJOE 1BI3A 2P0PA 3PNWC 2NUPB 1OU8A 5KYYB 2K79A 4HKEA 2MPXC 2VASA 4L59A 4J6YA 2ECZA 2OAUA 1QQJA 2D8JA 4PFZA 3JCMh 4R0KA 2RJCA 2HQXA 1K8AU 3KFVA 1K9MC 3E9GA 4OP0A 2OTLA 5EC7A 3T9NA 5L23A 3I5SA 3JB9I 1D1BA 2RQVA 4M75D 2HBWA 4MMKA 2DJQA 1Q81R 3HHTB 4FL6A 2FZKB 1M2OA 4GLKA 3M9QA 4DEXA 3VYGA 4M77D 5FU7B 4HVUA 2BKDN 2LCLA 4RG2A 4M7AE 1C1AA 4E7KA 5GAOm 4J9BA 1G83A 2AZVA 1KQSA 2VB6A 3I5RA 2QG9B 3CQTA 3DB4A 2KGTA 2DL8A 1NJIC 1JBMA 2GFUA 4ORZA 1VQMT 2XD0A 5IXFA 2IPOB 2MI6A 3CBOA 2CS7A 4JLIA 1X2KA 5C0MA 1TUGB 2XK0A 3OBWA 3MO8A 3JCMV 1W70A 3CXCS 1PM3A 2X3XD 1D0ZA 3BDLA 2P0KA 4FW2A 3L2QA 2G3RA 3OB9A 1SRMA 2EVRA 2XU8A 4ZGDB 5CIUA 3VS4A 3E9FA 1TG0A 3FLGA 2JJ9A 3CC2Q 3VS5A 3C4SA 1I5LA 4M7DA 2MWOA 1MMGA 1YNZA 2JS2A
chains in the Genus database with same CATH topology
2EQIA 3VS6A 2KNBB 1X43A 2F2XA 2FRYA 1X6BA 4M4ZA 2D8HA 2ENMA 3UA6A 1VYTA 1K4US 1KFZA 5HCKA 1NEBA 3NHNA 4J9DA 4RUGA 1ABQA 4QT7A 2ROTA 4IIOA 1ZUYA 2L3SA 2A08A 1RUWA 2LJ0A 4AFZC 2BZ8A 2KROA 1WXUA 2NUZA 1GRIA 2F2WA 1K76A 2VVKA 2A28A 1AVZC 2RMOA 1AWXA 2BZXA 2DLPA 2FEIA 1H3HA 2KRMA 2JM8A 4D8DA 4Y92A 2EW3A 2RN8A 4JJBA 2YUPA 2BZYA 2EGEA 2KR3A 1GCQA 2RF0A 1Y57A 4D8KA 2J6KA 3RNJA 2DL7A 1UFFA 1HD3A 2KT1A 1JQQA 3PVQA 2J06A 1SRLA 3I35A 4AG1C 1TUCA 1GL5A 5FWCA 1PKTA 3VS0A 1HJDA 2GQIA 4OMPA 4OMNA 1MV0B 2GGRA 2RQRA 5ECAA 1AEYA 1Z9ZA 1A0NB 2AKKA 2CT4A 1JXOA 3SEMA 3M0TA 1UECA 2ABLA 2EGAA 3M0QA 2JMCA 2DL5A 1SSHA 1PRLC 2LX7A 4LN2A 1E6GA 4CC4B 1HSQA 1AWWA 2CDTA 1UUEA 4DEYA 1JU5C 2PNIA 1K1ZA 1WI7A 2MIOA 2DA9A 2MCNA 1AD5A 2CSQA 3GBQA 1NYFA 3RBBB 1M27C 4CC3A 1MV3A 2YDLA 1QKXA 2CUBA 2NWMA 1AWJA 1OOTA 3R6NA 5FWBA 2DRMA 1H92A 2FO0A 3H0HA 1U06A 2L3PA 3ZL7C 5IXBA 3QWXX 2PZ1A 2O88A 2GTOA 2K6DA 2KRNA 2PTKA 3NPFA 4HXJA 2JS0A 4RTUA 1UHFA 3TSWA 2L0AA 1W1FA 1PWTA 2XMFA 2CUDA 4F16A 2KXCA 2KYMA 5GJWB 1ZUUA 2K7AA 2CH4A 1QWEA 4Z89A 1M3BA 1MUZA 4OMQA 2J7IA 1ARKA 2OAWA 1SHFA 2KT8A 2DBMA 1X27A 4FSSA 1QLYA 2LMJA 4CC7A 2V1QA 2CREA 2H8HA 3M0PA 1VYUA 2OI3A 3EHRA 2GTJA 3VS2A 1VA7A 1QKWA 2JXBA 2W10A 1B07A 1BK2A 2C0OA 1NM7A 4ZNXA 4AG2C 2VKNA 4RTTA 1J3TA 2J6FA 1U3OA 4LE9A 1AZGB 2HCKA 1YP5A 1M30A 1H8KA 1RI9A 1YWPA 4Z8AA 2BTTA 2HDAA 2EPDA 3VS1A 2J05A 4IIMA 1GFDA 1NLOC 4J9IA 1SEMA 4J9CA 4RTWA 1NEGA 1QWFA 2DBKA 3UATA 4K11A 5I22A 2FPFA 1AZEA 1ABOA 3M0RA 1AOJA 2MOXA 2LZ6B 2EYXA 1T3SA 1WDXA 3A98A 4AFSC 2O2OA 1WX6A 1UJYA 2EKHA 1W6XA 4AFUC 1YN8A 4OMOA 2RNAA 1OPKA 1UTIA 2VWFA 1X6GA 1M3AA 3VS3A 2FG0A 4F17A 3PE0A 3EG1A 1GCPA 4KRTA 4HVVA 4LNPA 2CT3A 1UHCA 2DRKA 2M0YA 2JM9A 2X3WD 4JZ4A 3TVTA 1RLQC 2HEQA 2AK5A 2KRSA 3H0FA 4J9HA 2DF6A 4JJCA 1Z9QA 1PRMC 1KIKA 1NG2A 2DM1A 3M0UA 4EIKA 1LCKA 1I07A 1ZBJA 2AKLA 2KYBA 4J9FA 4RTZA 3H0IA 1OEBA 4JPBW 1YCSB 2KE9A 2AZSA 2JW4A 4HVWA 1KJWA 3M0SA 4OMMA 3VS7A 4LUEA 1V1CA 1U5SA 3EG0A 1M8MA 1GFCA 2SRCA 4J9EA 1KSWA 3I9QA 1S1NA 3UA7A 2DVJA 4E6RA 2G6FX 2K2MA 1K0XA 2K3BA 1M3CA 1PNJA 1T0JA 3THKA 1NLPC 2DE0X 2FPEA 1WXTA 2LJ3A 4HCKA 2O9VA 1UDLA 4ESRA 3REBB 4JZ3A 1NYGA 3O5ZA 1BB9A 2LQWA 2O9SA 2GNCA 3EG2A 3NMZC 1WIEA 2ROLA 2EYYA 1JXMA 4CC2A 1BU1A 1YWOA 2W0ZA 2DX1A 3EGUA 2EYWA 3H41A 2DMOA 3IQLA 5IHKA 1CSKA 3NGPA 1RLPC 2OJ2A 2YSQA 1TUDA 4LUDA 2KEAA 2L3QA 2LJ1A 1FYNA 2J6OA 3TSZA 2HSPA 3UF4A 2JT4A 1AWOA 1GBRA 4A63B 3SHWA 1CKBA 2YUOA 1OPLA 1UG1A 2RQTA 2D1XA 2V1RA 1QCFA 4RTVA 2P4RA 1ZSGA 1PKSA 1WFWA 1GCQC 1WXBA 2K79A 1UE9A 2SEMA 1T0HA 2O31A 1B3QA 2F2VA 4GLMA 2LP5A 3VRZA 1WA7A 2IIMA 4GBQA 2CSIA 2EBPA 2ECZA 2D8JA 1CKAA 1WYXA 2C0IA 4R0KA 4WCIA 1X69A 1BBZA 3EHQA 2YT6A 2DL3A 4X1VA 3KFVA 1GBQA 5IHNA 2YUNA 1SHGA 2CH4W 2E5KA 5EC7A 2A36A 1UGVA 5IHIA 3JV3A 1JEGA 3C0CA 5FW9A 1K9AA 3I5SA 5L23A 2L2PA 2M51A 1ZUKA 2RQVA 2HBWA 2DJQA 2DILA 5GJVB 4Z88A 1VYVA 3QWYA 1UJ0A 4DEXA 2RQUA 1PHTA 4J9GA 4HVUA 5I11A 2EGCA 2ESWA 1N5ZA 4J9BA 1G83A 2AZVA 2DL4A 3I5RA 3PVLA 2K9GA 1SPKA 3CQTA 3LH5A 2KGTA 2A37A 2DL8A 2LNHB 2B86A 4ORZA 4JJDA 5IXFA 2QDLA 2FRWA 1X2KA 1Y0MA 2C0TA 3U23A 1WLPB 2JMAA 2KBTA 4AFQC 4F14A 5IH2A 1E7OA 2KXDA 1EFNA 1W70A 2I0NA 2X3XD 1JO8A 2ED0A 2JTEA 2RPNA 1I0CA 1X2QA 1XOVA 2LCSA 2DYBA 3VRYA 1IO6A 2FPDA 2GBQA 1G2BA 1ZX6A 1SRMA 1ZLMA 2EVRA 2DNUA 2YUQA 1E6HA 1K0SA 3VS4A 3REAB 3FJ5A 1OV3A 1T3LA 1I1JA 1TG0A 3EG3A 2RQWA 1FMKA 2ED1A 4RTYA 3VS5A 4OMLA 2LQNA 2D0NA 3ULRB 4RTXA 1YNZA 2JS2A 2EYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQI A;  3VS6 A;  2KNB B;  1X43 A;  2F2X A;  2FRY A;  1X6B A;  4M4Z A;  2D8H A;  2ENM A;  3UA6 A;  1VYT A;  1K4U S;  1KFZ A;  5HCK A;  1NEB A;  3NHN A;  4J9D A;  4RUG A;  1ABQ A;  4QT7 A;  2ROT A;  4IIO A;  1ZUY A;  2L3S A;  2A08 A;  1RUW A;  2LJ0 A;  4AFZ C;  2BZ8 A;  2KRO A;  1WXU A;  2NUZ A;  1GRI A;  2F2W A;  1K76 A;  2VVK A;  2A28 A;  1AVZ C;  2RMO A;  1AWX A;  2BZX A;  2DLP A;  2FEI A;  1H3H A;  2KRM A;  2JM8 A;  4D8D A;  4Y92 A;  2EW3 A;  2RN8 A;  4JJB A;  2YUP A;  2BZY A;  2EGE A;  2KR3 A;  1GCQ A;  2RF0 A;  1Y57 A;  4D8K A;  2J6K A;  3RNJ A;  2DL7 A;  1UFF A;  1HD3 A;  2KT1 A;  1JQQ A;  3PVQ A;  2J06 A;  1SRL A;  3I35 A;  4AG1 C;  1TUC A;  1GL5 A;  5FWC A;  1PKT A;  3VS0 A;  1HJD A;  2GQI A;  4OMP A;  4OMN A;  1MV0 B;  2GGR A;  2RQR A;  5ECA A;  1AEY A;  1Z9Z A;  1A0N B;  2AKK A;  2CT4 A;  1JXO A;  3SEM A;  3M0T A;  1UEC A;  2ABL A;  2EGA A;  3M0Q A;  2JMC A;  2DL5 A;  1SSH A;  1PRL C;  2LX7 A;  4LN2 A;  1E6G A;  4CC4 B;  1HSQ A;  1AWW A;  2CDT A;  1UUE A;  4DEY A;  1JU5 C;  2PNI A;  1K1Z A;  1WI7 A;  2MIO A;  2DA9 A;  2MCN A;  1AD5 A;  2CSQ A;  3GBQ A;  1NYF A;  3RBB B;  1M27 C;  4CC3 A;  1MV3 A;  2YDL A;  1QKX A;  2CUB A;  2NWM A;  1AWJ A;  1OOT A;  3R6N A;  5FWB A;  2DRM A;  1H92 A;  2FO0 A;  3H0H A;  1U06 A;  2L3P A;  3ZL7 C;  5IXB A;  3QWX X;  2PZ1 A;  2O88 A;  2GTO A;  2K6D A;  2KRN A;  2PTK A;  3NPF A;  4HXJ A;  2JS0 A;  4RTU A;  1UHF A;  3TSW A;  2L0A A;  1W1F A;  1PWT A;  2XMF A;  2CUD A;  4F16 A;  2KXC A;  2KYM A;  5GJW B;  1ZUU A;  2K7A A;  2CH4 A;  1QWE A;  4Z89 A;  1M3B A;  1MUZ A;  4OMQ A;  2J7I A;  1ARK A;  2OAW A;  1SHF A;  2KT8 A;  2DBM A;  1X27 A;  4FSS A;  1QLY A;  2LMJ A;  4CC7 A;  2V1Q A;  2CRE A;  2H8H A;  3M0P A;  1VYU A;  2OI3 A;  3EHR A;  2GTJ A;  3VS2 A;  1VA7 A;  1QKW A;  2JXB A;  2W10 A;  1B07 A;  1BK2 A;  2C0O A;  1NM7 A;  4ZNX A;  4AG2 C;  2VKN A;  4RTT A;  1J3T A;  2J6F A;  1U3O A;  4LE9 A;  1AZG B;  2HCK A;  1YP5 A;  1M30 A;  1H8K A;  1RI9 A;  1YWP A;  4Z8A A;  2BTT A;  2HDA A;  2EPD A;  3VS1 A;  2J05 A;  4IIM A;  1GFD A;  1NLO C;  4J9I A;  1SEM A;  4J9C A;  4RTW A;  1NEG A;  1QWF A;  2DBK A;  3UAT A;  4K11 A;  5I22 A;  2FPF A;  1AZE A;  1ABO A;  3M0R A;  1AOJ A;  2MOX A;  2LZ6 B;  2EYX A;  1T3S A;  1WDX A;  3A98 A;  4AFS C;  2O2O A;  1WX6 A;  1UJY A;  2EKH A;  1W6X A;  4AFU C;  1YN8 A;  4OMO A;  2RNA A;  1OPK A;  1UTI A;  2VWF A;  1X6G A;  1M3A A;  3VS3 A;  2FG0 A;  4F17 A;  3PE0 A;  3EG1 A;  1GCP A;  4KRT A;  4HVV A;  4LNP A;  2CT3 A;  1UHC A;  2DRK A;  2M0Y A;  2JM9 A;  2X3W D;  4JZ4 A;  3TVT A;  1RLQ C;  2HEQ A;  2AK5 A;  2KRS A;  3H0F A;  4J9H A;  2DF6 A;  4JJC A;  1Z9Q A;  1PRM C;  1KIK A;  1NG2 A;  2DM1 A;  3M0U A;  4EIK A;  1LCK A;  1I07 A;  1ZBJ A;  2AKL A;  2KYB A;  4J9F A;  4RTZ A;  3H0I A;  1OEB A;  4JPB W;  1YCS B;  2KE9 A;  2AZS A;  2JW4 A;  4HVW A;  1KJW A;  3M0S A;  4OMM A;  3VS7 A;  4LUE A;  1V1C A;  1U5S A;  3EG0 A;  1M8M A;  1GFC A;  2SRC A;  4J9E A;  1KSW A;  3I9Q A;  1S1N A;  3UA7 A;  2DVJ A;  4E6R A;  2G6F X;  2K2M A;  1K0X A;  2K3B A;  1M3C A;  1PNJ A;  1T0J A;  3THK A;  1NLP C;  2DE0 X;  2FPE A;  1WXT A;  2LJ3 A;  4HCK A;  2O9V A;  1UDL A;  4ESR A;  3REB B;  4JZ3 A;  1NYG A;  3O5Z A;  1BB9 A;  2LQW A;  2O9S A;  2GNC A;  3EG2 A;  3NMZ C;  1WIE A;  2ROL A;  2EYY A;  1JXM A;  4CC2 A;  1BU1 A;  1YWO A;  2W0Z A;  2DX1 A;  3EGU A;  2EYW A;  3H41 A;  2DMO A;  3IQL A;  5IHK A;  1CSK A;  3NGP A;  1RLP C;  2OJ2 A;  2YSQ A;  1TUD A;  4LUD A;  2KEA A;  2L3Q A;  2LJ1 A;  1FYN A;  2J6O A;  3TSZ A;  2HSP A;  3UF4 A;  2JT4 A;  1AWO A;  1GBR A;  4A63 B;  3SHW A;  1CKB A;  2YUO A;  1OPL A;  1UG1 A;  2RQT A;  2D1X A;  2V1R A;  1QCF A;  4RTV A;  2P4R A;  1ZSG A;  1PKS A;  1WFW A;  1GCQ C;  1WXB A;  2K79 A;  1UE9 A;  2SEM A;  1T0H A;  2O31 A;  1B3Q A;  2F2V A;  4GLM A;  2LP5 A;  3VRZ A;  1WA7 A;  2IIM A;  4GBQ A;  2CSI A;  2EBP A;  2ECZ A;  2D8J A;  1CKA A;  1WYX A;  2C0I A;  4R0K A;  4WCI A;  1X69 A;  1BBZ A;  3EHQ A;  2YT6 A;  2DL3 A;  4X1V A;  3KFV A;  1GBQ A;  5IHN A;  2YUN A;  1SHG A;  2CH4 W;  2E5K A;  5EC7 A;  2A36 A;  1UGV A;  5IHI A;  3JV3 A;  1JEG A;  3C0C A;  5FW9 A;  1K9A A;  3I5S A;  5L23 A;  2L2P A;  2M51 A;  1ZUK A;  2RQV A;  2HBW A;  2DJQ A;  2DIL A;  5GJV B;  4Z88 A;  1VYV A;  3QWY A;  1UJ0 A;  4DEX A;  2RQU A;  1PHT A;  4J9G A;  4HVU A;  5I11 A;  2EGC A;  2ESW A;  1N5Z A;  4J9B A;  1G83 A;  2AZV A;  2DL4 A;  3I5R A;  3PVL A;  2K9G A;  1SPK A;  3CQT A;  3LH5 A;  2KGT A;  2A37 A;  2DL8 A;  2LNH B;  2B86 A;  4ORZ A;  4JJD A;  5IXF A;  2QDL A;  2FRW A;  1X2K A;  1Y0M A;  2C0T A;  3U23 A;  1WLP B;  2JMA A;  2KBT A;  4AFQ C;  4F14 A;  5IH2 A;  1E7O A;  2KXD A;  1EFN A;  1W70 A;  2I0N A;  2X3X D;  1JO8 A;  2ED0 A;  2JTE A;  2RPN A;  1I0C A;  1X2Q A;  1XOV A;  2LCS A;  2DYB A;  3VRY A;  1IO6 A;  2FPD A;  2GBQ A;  1G2B A;  1ZX6 A;  1SRM A;  1ZLM A;  2EVR A;  2DNU A;  2YUQ A;  1E6H A;  1K0S A;  3VS4 A;  3REA B;  3FJ5 A;  1OV3 A;  1T3L A;  1I1J A;  1TG0 A;  3EG3 A;  2RQW A;  1FMK A;  2ED1 A;  4RTY A;  3VS5 A;  4OML A;  2LQN A;  2D0N A;  3ULR B;  4RTX A;  1YNZ A;  2JS2 A;  2EYZ A; 
#chains in the Genus database with same CATH topology
 4N0A C;  2KNB B;  1X43 A;  3RKW A;  1VQ5 A;  3HP9 A;  5GAN 6;  4BI3 A;  3JAM E;  1M2V B;  5M9O A;  1WHM A;  1X6B A;  3S3N A;  1M1K U;  3CPF A;  3MEW A;  1K4U S;  4RG8 A;  1VQ6 A;  1NPR A;  3VKI A;  5HCK A;  4D6W A;  1VQP Q;  2KVQ G;  2KDS A;  3D7S B;  4N0A A;  5GAN 8;  2GFA A;  1RUW A;  1SF9 A;  2LJ0 A;  5GAN h;  2YRD A;  1I81 A;  3VU3 C;  2D6F A;  5KYU B;  4RCB A;  2E10 A;  4L6V 5;  4C5E A;  1Q82 C;  3FIF A;  3CCV Q;  1H3H A;  4D8D A;  3V8L A;  2EW3 A;  2YUP A;  2BIV A;  4A54 A;  1BYM A;  2DEQ A;  2KR3 A;  1GCQ A;  1Y57 A;  3UDC A;  4D8K A;  1Y7X A;  1YHQ T;  3OQ5 A;  4RMO A;  1HD3 A;  1VQN A;  5GMK l;  2D0Q B;  3I35 A;  4C0D B;  1VQM A;  4OMP A;  2RQR A;  3I56 Q;  1WPY A;  5ECA A;  1Z9Z A;  4C92 G;  1M1G A;  1XNI A;  4FU6 A;  1B34 A;  3OY9 A;  1A0N B;  1D1C A;  3HL8 A;  3CCJ Q;  2EGA A;  2JMC A;  2DL5 A;  3M53 A;  1NZ9 A;  4TVR A;  3NTI A;  2CZ1 B;  3QII A;  1AWW A;  1QP3 A;  1UUE A;  4DEY A;  1V76 A;  1WI7 A;  4P5N A;  1VQ7 T;  3VV0 A;  1AD5 A;  2AT1 B;  3GBQ A;  4O5V A;  1VQ9 A;  1M27 C;  5GAO n;  4CC3 A;  1HK9 A;  1MV3 A;  2YDL A;  2D9T A;  5GAO q;  1TH7 A;  3TCJ A;  3RES A;  3CC2 T;  1PD1 A;  3EGX A;  2HKQ B;  3R6N A;  2LVM A;  3BY7 A;  4PKC C;  1YJW A;  3H0H A;  2V8I A;  5IN1 A;  4Q5W A;  2L3P A;  3ZL7 C;  5IXB A;  2PZ1 A;  2F5T X;  4N4G A;  1KQ2 A;  2K6D A;  1KC8 U;  1XQH A;  4OB1 B;  2C06 A;  5CKD A;  1UHF A;  4J5Y A;  4PJO G;  4IUT A;  3EH1 A;  2Y4Y A;  2QGG A;  3EH2 A;  4JRQ A;  3A8M B;  1VQP T;  5GJW B;  2E64 A;  2ZPE B;  1QWE A;  2K3Y A;  2LTO A;  1M3B A;  4M75 F;  2IVW A;  5I21 A;  1SHF A;  5FU6 C;  2F69 A;  2HZY A;  2RO0 A;  3CCL Q;  4C8Q C;  1QLY A;  2NUT A;  3CCE Q;  2H8H A;  3CD6 A;  3P8H A;  3EHR A;  1YHQ A;  4JRP A;  3VS2 A;  5L8R E;  2MF2 A;  3QYG B;  1N6A A;  1IRX A;  2JXB A;  1TSF A;  1OX8 A;  1B34 B;  4C8Q A;  3SB2 A;  2DPP B;  1B07 A;  5D6Y A;  2C0O A;  4ZNX A;  2QTV A;  1J3T A;  3TQ7 P;  3GOX A;  1U3O A;  3CME A;  1AZG B;  4B9X A;  1BI2 A;  1D0X A;  1RI9 A;  2ZZD A;  5GAM f;  2WSC E;  2YLC A;  3JB9 F;  2OTJ T;  3C95 A;  3Q1J A;  4M7A G;  4IIM A;  1KG1 A;  1NLO C;  3CCJ T;  4CRI A;  4J9I A;  4QVC A;  1RAB B;  5GAM e;  4J9C A;  4RTW A;  1NEG A;  2CZ6 B;  4E7S A;  3OW2 A;  3EFO A;  1Q95 G;  2RD1 A;  1VQ7 A;  1YCY A;  1VQO Q;  2MOX A;  2LNV A;  1M9S A;  1KD1 C;  4LDU A;  1YIT A;  1RL2 A;  2VYT A;  5GAN 7;  4ZN3 A;  3G4S Q;  1UJY A;  2EKH A;  4AFU C;  4OMO A;  1IGQ A;  3OSV A;  3MEU A;  2RNA A;  4EMH A;  1UTI A;  3OYC A;  1M3A A;  1RAH B;  1PSE A;  4JLG A;  1GCP A;  4HVV A;  3O8V A;  2COY A;  4CI0 C;  5FRN A;  2QTX A;  2QGF B;  1TS9 A;  1NPP A;  2AK5 A;  4HT8 A;  3MP8 A;  4OB0 B;  1Q81 U;  1KIK A;  2DM1 A;  4IUQ A;  2MYS A;  1FXX A;  5FLX E;  3V8K A;  3HFO A;  2HKN A;  3CMA Q;  2KYB A;  3CCR T;  2GQV A;  1OEB A;  5FU6 B;  2KE9 A;  2AZS A;  4HVW A;  3CPW P;  4PJL A;  1KJW A;  3CCL T;  3KXT A;  4M7D D;  4LUE A;  1V1C A;  2K5L A;  5LJ5 j;  2LRQ A;  3CCE T;  1S1N A;  2ZPB B;  4QQD A;  1N27 A;  2XIC A;  4XU3 A;  4ZN1 A;  2CP6 A;  3CCM Q;  1M3C A;  2B8A A;  2DE0 X;  4C0Z A;  2FPE A;  4X34 A;  4ESR A;  3REB B;  2L8D A;  3O5Z A;  3L2R A;  3GNG A;  1OQK A;  2LQW A;  1WIE A;  2OTJ A;  1VQK Q;  3E19 A;  3EFO B;  3HRU A;  4CC2 A;  5DLO A;  3CCJ A;  1RAD B;  2EYW A;  3H41 A;  1TOV A;  2WSF E;  3IQL A;  4A4K A;  3LX7 A;  2JZ2 A;  4FCY A;  2GCX A;  3EG9 B;  2LJ1 A;  4M78 F;  1Q86 C;  3F70 A;  3PMI A;  1FWZ A;  4BE2 A;  3OMC A;  1OZ3 A;  5LJ5 d;  4XU0 A;  3SHW A;  2FHD A;  4M75 E;  1O9S A;  1CKB A;  1RAC B;  3QZ5 B;  2D1X A;  2HAX A;  3G4S T;  3MCA B;  2EAY A;  2V1R A;  1QCF A;  4RTV A;  3EAE A;  2DAQ A;  1WFW A;  1S72 Q;  2EFI A;  2P0Q A;  2A3L A;  5GMK j;  3MP6 A;  2F2V A;  2LP5 A;  3VRZ A;  3LGF A;  3LW5 E;  2CSI A;  4C92 C;  8AT1 B;  3JB9 J;  3SWN A;  3CCQ Q;  4WCI A;  1YI2 A;  2RH2 A;  3MEA A;  4PFP A;  1R0B G;  3JB9 H;  2DL3 A;  2DJZ A;  5IHN A;  2YUN A;  3HPW A;  5GAN 2;  2XHC A;  4PL6 A;  3CCR A;  2XI9 A;  2E5K A;  2HD0 A;  2DO3 A;  2X4Y A;  2A36 A;  3JV3 A;  2L2P A;  2QDY B;  3CCS A;  1ZUK A;  4AMC A;  3CCE A;  4XTW A;  2DIL A;  4Y28 E;  3OYK A;  4Z88 A;  5KYY A;  5CR2 A;  1YIJ A;  3OYM A;  3QWY A;  2VXE A;  4WTO B;  2RQU A;  4WF2 A;  1PHT A;  4OVA A;  4L5G A;  3CCM T;  2BE9 B;  2PU9 B;  5HK3 A;  3OYH A;  1RI0 A;  2ESW A;  4N4I A;  3M54 A;  1N8R R;  2DL4 A;  1SPK A;  1K73 R;  2K57 A;  3V7R A;  5AT1 B;  5I2S A;  4PJO C;  1VQK T;  3JCM Q;  1YFN A;  3M57 A;  1WLP B;  4EPC A;  2JTM A;  1B7T A;  4PJO A;  1JO8 A;  1I0C A;  4KBM B;  2DYB A;  2DTI A;  3GNF B;  3CXC A;  2GBQ A;  1ZX6 A;  1QCN A;  4C8Q D;  2DNU A;  2YUQ A;  3FJ5 A;  2FYK A;  5DLQ E;  3DKM A;  3CCU A;  4XTY A;  3JCM d;  5CVI A;  1OI1 A;  2P84 A;  4RTX A;  1S72 T;  1AHJ B;  2F2X A;  4QKU A;  2DZC A;  3OSS C;  4XTZ A;  2FRY A;  4XTX A;  1U1T A;  2D8H A;  3S3O A;  1VYT A;  3M4Y A;  1KFZ A;  4C92 B;  2ZGW A;  3L2U A;  2QA4 Q;  1NEB A;  3NHN A;  2Y90 A;  4PFO A;  5CQY A;  1ABQ A;  4R55 A;  1ZUY A;  4M7A C;  2E41 A;  1D09 B;  9ATC B;  2CYZ B;  3QHS A;  4AFZ C;  2BZ8 A;  5LJ3 j;  1YJN T;  4M7D F;  4LD9 K;  2KRO A;  1G3T A;  1WXU A;  1GRI A;  4OGE A;  1K76 A;  2QI2 A;  2DD4 A;  1AWX A;  2BZX A;  2DLP A;  4V2S A;  2FEI A;  4BB7 A;  3WVE B;  1G3W A;  4M7A A;  3OYL A;  4JJB A;  3LWH A;  2BZY A;  3QXE B;  3FRN A;  4M78 E;  3HKS A;  3CCM A;  2RF0 A;  4A53 A;  1M2V A;  5GAO r;  2RI5 A;  1QVF P;  1LVK A;  2DL7 A;  1UFF A;  2XDD A;  4DBR A;  2FZC B;  1JQQ A;  2YHT A;  1TU0 B;  2PVO B;  4MML A;  1SRL A;  1KQ1 A;  5EG2 A;  4AG1 C;  5GAN j;  1WHG A;  6AT1 B;  1TUC A;  1PKT A;  4LDX A;  2GQI A;  1VQL Q;  1ZHI A;  4E7L A;  3ME9 A;  4EDU A;  1AEY A;  5CAI A;  1M90 R;  2WAC A;  2CT4 A;  4PJO B;  1JXO A;  4XU1 A;  3M0T A;  5KYU A;  3SEM A;  1JB0 E;  2ABL A;  5LJ3 d;  4JJN K;  4LN2 A;  2LC4 A;  1ZA2 B;  1E6G A;  1QVG S;  4CC4 B;  4C0D C;  2LDM A;  1U8R A;  1K1Z A;  1YJ9 A;  2MIO A;  4MDX A;  2MCN A;  2CSQ A;  1P92 A;  4M78 B;  2CKK A;  5DY9 A;  3E1S A;  2QQB A;  3NFC A;  2DIQ A;  3JCM P;  4BY6 B;  3CC4 T;  4BDY A;  5GAN d;  1U06 A;  3QWX X;  4M75 G;  4OB2 B;  1UEB A;  2KRN A;  3NPF A;  4HXJ A;  2JS0 A;  3OS1 A;  5GMK m;  5AYF A;  3OYB A;  2XMF A;  3L2Z A;  4JUV A;  3OYD A;  1Q7Y R;  4F16 A;  3CBM A;  2YXY A;  1ZSZ C;  3KBG A;  4JDS A;  2K7A A;  2CH4 A;  4HCC A;  1YJN A;  1QCO A;  4M7A B;  2J7I A;  1ZBX A;  2OAW A;  1FMW A;  2KT8 A;  2MMP A;  4II1 A;  2X4W A;  2LQK A;  3PMT A;  5LJ3 e;  2X9H A;  2M02 A;  1X27 A;  5I2M A;  2LMJ A;  4OB3 B;  1BKB A;  1VYU A;  2OI3 A;  5A0L A;  3JB9 G;  2O4X A;  1RAE B;  1WJQ A;  1NM7 A;  4AG2 C;  2P4T A;  5GAM g;  1G5V A;  2VC8 A;  2J6F A;  4LE9 A;  1VQL T;  1W4S A;  1WJR A;  1YP5 A;  1G8X A;  1H8K A;  2EQM A;  3LLR A;  2BTT A;  1W2B P;  2E5Q A;  3MP1 A;  2KK4 A;  3V7C A;  2KSS A;  4ELY C;  1M5Q 1;  5CK9 A;  4RKU E;  1K8A C;  5C6S A;  1BCO A;  2PQW A;  3QUI A;  2CZ0 B;  5KCO A;  4K11 A;  1XJW B;  1X01 A;  2FPF A;  2VV5 A;  2CP7 A;  1AZE A;  3I55 Q;  4KUL A;  2PUO B;  4J6X A;  3TRE A;  2LZ6 B;  2QYZ A;  1K9M R;  3A98 A;  4AFS C;  1M1F A;  3S3M A;  1WHL A;  1YBY A;  3JCM J;  3CC4 A;  4QW2 A;  2X4X A;  4NOY A;  2VWF A;  5GAN 5;  2FG0 A;  4HA8 A;  4NL2 A;  4KRT A;  4C5I A;  1D0Y A;  2K5F A;  2M0Y A;  2QQR A;  2JM9 A;  3JCM c;  4ELZ C;  3L2V A;  1PD0 A;  1VQ4 Q;  1R0C B;  4PJO D;  2KRS A;  3H0F A;  3QO3 A;  4JJC A;  1RAF B;  1Z9Q A;  2VXF A;  1NJI R;  1ZSZ B;  3QG1 A;  1MGQ A;  5GAN 3;  1ZBJ A;  3LYI A;  4J9F A;  4RTZ A;  3H0I A;  1IGU A;  1YCS B;  3UT1 A;  1QVF S;  2YRC A;  3M59 A;  4F7U F;  2O4X B;  3M0S A;  4PJJ A;  1N8R U;  1H3Z A;  1K73 U;  1M8M A;  1GFC A;  2SRC A;  4PNO A;  3QYH B;  2EQK A;  4E6R A;  1R77 A;  3G71 Q;  4BE0 A;  3LWI A;  2JN0 A;  3CEY A;  1T0J A;  3THK A;  1NLP C;  1WNL A;  2CP5 A;  2FL7 A;  3VYH B;  4JZ3 A;  4OMF B;  4BE1 A;  5CCA A;  4M78 G;  3M55 A;  3QBY A;  2E1H A;  2XG8 D;  3BE3 A;  3MHX A;  3CCV T;  2GNC A;  4M77 F;  3EG2 A;  3NMZ C;  2ROL A;  3X28 B;  1M1K C;  2M0O A;  1JXM A;  1YWO A;  3EGU A;  2K5I A;  2DMO A;  5IHK A;  2K2V A;  4EMG A;  1RLP C;  2OJ2 A;  1Y71 A;  2YSQ A;  2E65 A;  1BIB A;  2KEA A;  2J6O A;  2HQH A;  3PT9 A;  5IT9 E;  3ZBD A;  4Y91 A;  2OX7 A;  3EGD B;  2R57 A;  3MKD A;  3I56 T;  3PIO A;  4MZT A;  3GPL A;  1OPL A;  1UG1 A;  3M56 A;  1Q82 R;  2DET A;  3TU4 K;  2P4R A;  1IHW A;  1ZSG A;  3BDU A;  4A4H A;  2DIG A;  2EQU A;  1PKS A;  4AT1 B;  2V8J A;  4C5G A;  2VUB A;  5A0G A;  1D1A A;  1UE9 A;  4DBQ A;  5GAM h;  2IIM A;  4GBQ A;  3A1P A;  1GXI E;  3EG9 A;  5J39 A;  1K8A R;  4LD6 A;  2I2L A;  3CC7 Q;  3H6Z A;  4ATO A;  1HYO A;  3CC2 A;  3EHQ A;  4BUG A;  4X1V A;  1GBQ A;  3FJP A;  2V8K A;  2CH4 W;  1KK7 A;  3MET A;  1UGV A;  1JEG A;  1K9A A;  2M51 A;  3PTA A;  2ZAE A;  2HNI A;  1VQP A;  4ANJ A;  1M90 U;  1UJ0 A;  1Y96 B;  4Z02 A;  5I11 A;  1WGS A;  4E47 A;  1W2B S;  3C12 A;  2E6N A;  4R56 A;  1N5Z A;  4FM4 B;  3PVL A;  4M75 C;  1PSF A;  3CCV A;  2B86 A;  4ZTF A;  4JJD A;  1KC8 C;  3MPU B;  3UPU A;  2QDL A;  2FRW A;  3OYY A;  2ZPG B;  1Y0M A;  1MHN A;  2C0T A;  2KBT A;  2KXD A;  1EFN A;  7AT1 B;  3QDR B;  3SFM A;  2JVV A;  1JJ2 P;  4J83 A;  3MJX A;  4DOV A;  3VRY A;  1IO6 A;  3I56 A;  2FPD A;  1ZLM A;  2LT1 A;  3VUB A;  2AIR B;  4XQ3 A;  5KYW A;  1K0S A;  1O75 A;  1TTH B;  1OV3 A;  2E12 A;  3EG3 A;  4FT4 A;  1FMK A;  4DBH A;  2ED1 A;  4IKF A;  3V8J A;  4F7U E;  1QMC A;  2D0N A;  1Q7Y U;  4QQ6 A;  1RAA B;  1M1K R;  2EQI A;  2OTL Q;  4XAX B;  2MAM A;  3X25 B;  4M7D G;  1R8O B;  4M4Z A;  2ENM A;  1VQO T;  3UA6 A;  3LH0 A;  1IHV A;  4PJM A;  3INZ A;  4FYV B;  3CC7 T;  4IIO A;  2A08 A;  2A7Y A;  3G1J A;  4E7H A;  2LQ8 A;  4M77 E;  4J7I A;  3L2W A;  2HQE A;  4HCZ A;  2RJF A;  5J3B A;  2F2W A;  2M16 A;  1G3S A;  2A28 A;  3RMQ A;  1AVZ C;  2RMO A;  2KRM A;  2FVU A;  2KAF A;  1F1B B;  2EGE A;  2L3R A;  2XDB A;  3PVQ A;  1KD1 R;  2J06 A;  1U1S A;  4C92 A;  4JS5 A;  1TXQ A;  3ZEH A;  5FWC A;  3VS0 A;  1HJD A;  3CMA T;  3CCL A;  2LX9 A;  4OMN A;  1MV0 B;  3N5B B;  4M75 B;  3OA6 A;  2DTO A;  5LJ5 f;  2AKK A;  1VOM A;  5CKF A;  2ZPI B;  1K9M U;  3M0Q A;  3P8B B;  1SSH A;  2JOY A;  2LX7 A;  5LJ5 e;  1LNX A;  4ZGE B;  2RHU A;  5KYW B;  1Q81 C;  4A4G A;  1JU5 C;  1ACM B;  1VQ5 Q;  1MMD A;  3RDV A;  1MND A;  3GP8 A;  1WQW A;  1QVG A;  3RBB B;  1LPL A;  3TEE A;  1VQ6 Q;  3BW1 A;  1QKX A;  2DKG A;  2K4Y A;  3RUX A;  2PVG B;  3QZ9 B;  3UWN A;  2VGN A;  2DRM A;  1H92 A;  4ME7 A;  3DLL A;  3GLX A;  4FYW B;  3SD4 A;  1NJI U;  2OTL T;  1PCX A;  1VQO A;  4XTU A;  2GTO A;  2PTK A;  4M78 C;  3PFS A;  2RI2 A;  3OYN A;  3A8G B;  1PWT A;  3CC7 A;  2E70 A;  2HBP A;  3G4S A;  2CUD A;  1ZUU A;  4BY6 C;  2RB6 A;  4Z89 A;  1UB4 A;  1VQN Q;  4OMQ A;  2HSE B;  3C94 A;  4FSX A;  4M78 A;  1QP2 A;  3NTH A;  2DBM A;  2CP0 A;  1VQM Q;  2V26 A;  4FSS A;  2CRE A;  5GMK e;  3M0P A;  3CCQ T;  1I5O B;  2GTJ A;  1Q86 R;  3CPW S;  1QKW A;  5CO7 A;  5GMK h;  2JTF A;  2W10 A;  2X35 A;  1D3B B;  3H8Z A;  1BK2 A;  4FT2 A;  3CMA A;  1HXD A;  1PG5 B;  2EQJ A;  3RKX A;  1KQS P;  2JNG A;  1UGQ B;  1VQ9 Q;  2PVD B;  4RCC A;  1M30 A;  4Z8A A;  2RA2 A;  5KH6 A;  2EPD A;  1JJ2 S;  3HSB A;  4J6W A;  2EWN A;  3VS1 A;  8ATC B;  5J26 A;  1GFD A;  5KE2 A;  3JCM f;  3J80 E;  4PJN A;  1YJW Q;  1Q82 U;  2X4J A;  2RJE A;  5HKC A;  2YWW A;  2BUD A;  3JCM e;  5I22 A;  1VQ5 T;  1ABO A;  1AOJ A;  1N9R A;  3DLM A;  4BI4 A;  3A8H B;  1T3S A;  1VQK A;  3A5Z B;  4F04 B;  4DBF A;  1VQ6 T;  1WX6 A;  3M5A A;  2QEX Q;  1W6X A;  1WHK A;  2COW A;  5CKH A;  1OPK A;  1EIF A;  2NLU A;  1X6G A;  3OBY A;  2XKO C;  5CKB A;  3VS3 A;  3R6O A;  1Y07 A;  2AHJ B;  2CT3 A;  3JCM b;  4IUR A;  5A2Q E;  2DRK A;  5GAO p;  2X3W D;  1PC0 A;  4JZ4 A;  2XDP A;  3OS0 A;  4F7U G;  3HTR A;  2HEQ A;  3CD6 Q;  2RHZ A;  2JUF A;  1YHQ Q;  1BI0 A;  1PRM C;  1FX7 A;  5D6X A;  3M0U A;  1VQN T;  4NS5 A;  1S72 A;  3S6W A;  2DXB A;  2X51 A;  2JW4 A;  3KUF A;  1BIA A;  3CME Q;  3VS7 A;  3RIR A;  1U5S A;  3AT1 B;  3M4G A;  3EG0 A;  4J9E A;  3CCQ A;  2E3H A;  3I9Q A;  3UA7 A;  4M77 G;  2DVJ A;  1QVF A;  2QA4 T;  5KE3 A;  2L89 A;  1K0X A;  2K3B A;  1I4K 1;  2RK1 A;  1SKU B;  2QK0 A;  3P8D A;  5LJ3 f;  3JB9 D;  5HK0 A;  1WXT A;  4B6M A;  4J7F A;  1UDL A;  1VQ7 Q;  4M7D C;  1BB9 A;  3NTK A;  4C0F A;  5CQX A;  1ZSZ A;  1SG5 A;  2O9S A;  1VQ9 T;  1YIT Q;  1OYX A;  2EYY A;  2VGM A;  5LJ3 h;  1UGS B;  1QVP A;  5IAY A;  3J7A F;  4BDZ A;  1CSK A;  2ZPH B;  3NGP A;  3ZFJ A;  1TUD A;  4LUD A;  4KGX B;  4ZTJ A;  1M8V A;  1YJW T;  1UGR B;  5GAN f;  3TSZ A;  3UF4 A;  3OYE A;  4E7J A;  1FMV A;  2R5A A;  3OYG A;  1ZA1 B;  2GF7 A;  4A63 B;  4E2F B;  5GAN e;  2CP3 A;  1M4Z A;  4C92 D;  2RQT A;  2RM4 A;  5GAO l;  2QEX T;  2H3E B;  3E2U A;  3MEV A;  4A4F A;  1GCQ C;  4C8Q F;  3OS2 A;  1WXB A;  4C0G A;  4MZP A;  2DFU A;  2SEM A;  1T0H A;  2O31 A;  3BFM A;  3GIB A;  1B3Q A;  4GLM A;  4IUV A;  1WA7 A;  3LGL A;  1WJS A;  2EBP A;  1CKA A;  1VIE A;  1WYX A;  2C0I A;  4MDW A;  4M7D E;  3CD6 T;  1X69 A;  2QAZ A;  1BBZ A;  2YT6 A;  2M9U A;  3EGD A;  1SHG A;  2YLB A;  1VUB A;  2ZPF B;  5IHI A;  4KH0 B;  3C0C A;  4QQG A;  5FW9 A;  1KD1 U;  4KH1 B;  2FZG B;  3CME T;  3ER0 A;  5DM7 R;  4BD3 A;  2OTJ Q;  4JS4 A;  5GAM j;  1LOJ A;  5GJV B;  3DB3 A;  2QA4 A;  1MNE A;  1VYV A;  2E3I A;  1KQS S;  1IRE B;  3G6E Q;  4J9G A;  2BE7 D;  2EGC A;  1SSF A;  1QW1 A;  1VQ8 Q;  2K9G A;  3LH5 A;  2A37 A;  3QDF A;  3A8O B;  2LNH B;  3RER A;  4M7D B;  5LL6 S;  4KT0 E;  2DYI A;  1W2B A;  2FB7 A;  4M78 D;  2ZCF B;  2F1L A;  1YIT T;  3U23 A;  3L1A A;  2JMA A;  4AFQ C;  3WXM B;  1X6O A;  1E7O A;  4F14 A;  5IH2 A;  5CKE A;  2I0N A;  1C0M A;  2H3J A;  1UGP B;  3OW2 P;  2WSE E;  2ED0 A;  2JTE A;  2RPN A;  4OGC A;  1X2Q A;  1VQL A;  1XOV A;  1Y96 A;  3OS5 A;  3RMS A;  2LCS A;  2DXC A;  5GAM d;  1G2B A;  5FRO A;  1E6H A;  3REA B;  1T3L A;  1I1J A;  2QEX A;  3PIP A;  2RQW A;  1YI2 Q;  2QQA A;  2R5M A;  1H64 1;  4RTY A;  3OYJ A;  4OML A;  4DQ2 A;  1LJO A;  2LQN A;  2DVE A;  4M7A D;  3ULR B;  4EMK C;  3CCR Q;  2EYZ A;  1WHJ A;  3VS6 A;  1WQ7 A;  3URG A;  2HMA A;  3CCS Q;  3I55 T;  4A4E A;  3AHU A;  1RAG B;  4RUG A;  4J9D A;  1WHH A;  4J8O A;  4EMK A;  1YIJ Q;  2R58 A;  5D6W A;  1OUL A;  2MWP A;  4KUI A;  4QT7 A;  2ROT A;  2L3S A;  1Q86 U;  3FDR A;  2NUZ A;  2M1H A;  2VVK A;  4KUD K;  2JM8 A;  4Y92 A;  2RN8 A;  1NBE B;  3QPH A;  3JCM X;  1VQ4 T;  1RAI B;  2J6K A;  3RNJ A;  3G6E T;  3OMG A;  2KT1 A;  4DA4 A;  2DEU A;  1GL5 A;  5LJ5 g;  3EFR A;  1VQ8 T;  3EGX B;  2GGR A;  2NYS A;  3EFS A;  1IXD A;  2E4H A;  4HT9 A;  3X20 B;  1OU9 A;  4C8Q E;  3CCU Q;  3RR6 A;  1UEC A;  1PRL C;  3OYI A;  4YTL A;  3G71 T;  1HSQ A;  2CDT A;  3FB9 A;  1XTD A;  4C92 F;  2IG0 A;  5HY6 A;  2PNI A;  4F7U A;  2DA9 A;  4HCB A;  2COZ A;  2LT4 A;  4JRI A;  3HFN A;  1NYF A;  2ATC B;  3QSU A;  3GF5 A;  1N8R C;  2DXT A;  2CUB A;  1K73 C;  2NWM A;  4M77 C;  1NE8 A;  1AWJ A;  4FIB A;  1OOT A;  2YRV A;  2Z0W A;  1YI2 T;  4X9C A;  4LDV A;  3JCM W;  2NUT B;  5FWB A;  4M75 A;  2FO0 A;  2LCC A;  2DER A;  3PGG A;  4EMK B;  2O88 A;  1IZ6 A;  4PLI A;  3I55 A;  4M77 A;  2CGH A;  2KMT A;  3H9N A;  4RTU A;  4C8Q B;  2EYQ A;  3TSW A;  3CCS T;  4LDY A;  2L0A A;  2CP2 A;  5D7U A;  1W1F A;  2RJD A;  2KXC A;  2KYM A;  1YIJ T;  4KGV B;  5FRM A;  2CZ7 B;  4GY5 A;  1MUZ A;  1AT1 B;  1ARK A;  2QQ9 A;  4KGZ B;  3SDZ A;  5GMK i;  2RI3 A;  4PJO F;  1KHC A;  2KQW A;  3L42 A;  2KI7 A;  1VIF A;  2HL5 C;  4CC7 A;  2V1Q A;  4PLL A;  1G3Y A;  1VQ4 A;  1X75 C;  4VUB A;  4XK8 E;  3CBP A;  4QVZ A;  3G6E A;  3G7Z A;  1VA7 A;  4LXC A;  5KYN A;  3A8L B;  4B9W A;  1VQ8 A;  2VKN A;  4RTT A;  1YJ9 Q;  2PUK B;  3CPW A;  2EJF A;  1OZ2 A;  1EZZ B;  4IUU A;  2XID A;  2HCK A;  4E7Z A;  4MZM A;  3JCM g;  1YWP A;  1QVG P;  3OW2 S;  2HDA A;  3VUZ A;  2RHI A;  4F7U B;  3CCU T;  2J05 A;  5KYX A;  3G71 A;  3QJ6 A;  3SWN C;  1SEM A;  2MK5 A;  1QWF A;  3HRT A;  1JJ2 A;  2DBK A;  3UAT A;  1MMN A;  4E7I A;  3M0R A;  4BAC A;  2EYX A;  3X24 B;  2RHX A;  1WDX A;  3CXC P;  4M7A F;  1D3B A;  4NL3 A;  3FC3 A;  2O2O A;  4N4H A;  1YN8 A;  1YJN Q;  4M77 B;  1M90 C;  2QXF A;  1MMA A;  4DOW A;  4FYX B;  1BCM A;  4F17 A;  3PE0 A;  3EG1 A;  2HL3 A;  4LNP A;  5LJ5 h;  1UHC A;  3V7S A;  1I8F A;  2QAS A;  3TVT A;  1IB8 A;  2DXU A;  2NUP A;  1RLQ C;  4J9H A;  2DF6 A;  2QQS A;  3OYA A;  4XTV A;  3ASK A;  1NG2 A;  1V29 B;  3JRZ A;  2L5Q A;  4EIK A;  1KC8 R;  1LCK A;  2O01 E;  1I07 A;  2AKL A;  3HRS A;  2DK3 A;  4JPB W;  4C5H A;  4X9D A;  4IUP A;  3VJP A;  3J81 E;  5GAN 4;  1C6V X;  4OMM A;  1WZO A;  2Y4X A;  1KHI A;  4PK4 A;  1JRI A;  1DJ7 B;  1KSW A;  3M58 A;  5LJ3 g;  4ZGJ B;  2EJG A;  3JSC A;  4UC4 A;  4C92 E;  5FU7 C;  2G6F X;  2K2M A;  2KY9 A;  1PNJ A;  1N9S A;  1OX9 A;  1EX4 A;  4OF1 A;  3WVD B;  2LJ3 A;  4HCK A;  4JRK A;  2O9V A;  3QJY A;  3QKJ A;  1Q7Y C;  2RHY A;  4FW1 A;  4O6J A;  1NYG A;  5A0D A;  5KYX B;  2EIF A;  1YJ9 T;  4LDW A;  3RKY A;  2DZ9 A;  4QVD A;  1BU1 A;  2W0Z A;  3X26 B;  2DX1 A;  5KCH A;  3CC4 Q;  5GAN g;  3SWN B;  2K3X A;  2L3Q A;  1FYN A;  1TWB A;  2DD5 A;  2E6Z A;  2HSP A;  2F5K A;  4C8Q G;  2EJ9 A;  2JT4 A;  1AWO A;  2RK2 A;  1GBR A;  2EKO A;  2DTH A;  4BI8 B;  1BI1 A;  3FEO A;  3OYF A;  2YUO A;  4XU2 A;  1ZQ1 A;  4FYY B;  2A0F B;  4PJO E;  1BI3 A;  2P0P A;  3PNW C;  2NUP B;  1OU8 A;  5KYY B;  2K79 A;  4HKE A;  2MPX C;  2VAS A;  4L59 A;  4J6Y A;  2ECZ A;  2OAU A;  1QQJ A;  2D8J A;  4PFZ A;  3JCM h;  4R0K A;  2RJC A;  2HQX A;  1K8A U;  3KFV A;  1K9M C;  3E9G A;  4OP0 A;  2OTL A;  5EC7 A;  3T9N A;  5L23 A;  3I5S A;  3JB9 I;  1D1B A;  2RQV A;  4M75 D;  2HBW A;  4MMK A;  2DJQ A;  1Q81 R;  3HHT B;  4FL6 A;  2FZK B;  1M2O A;  4GLK A;  3M9Q A;  4DEX A;  3VYG A;  4M77 D;  5FU7 B;  4HVU A;  2BKD N;  2LCL A;  4RG2 A;  4M7A E;  1C1A A;  4E7K A;  5GAO m;  4J9B A;  1G83 A;  2AZV A;  1KQS A;  2VB6 A;  3I5R A;  2QG9 B;  3CQT A;  3DB4 A;  2KGT A;  2DL8 A;  1NJI C;  1JBM A;  2GFU A;  4ORZ A;  1VQM T;  2XD0 A;  5IXF A;  2IPO B;  2MI6 A;  3CBO A;  2CS7 A;  4JLI A;  1X2K A;  5C0M A;  1TUG B;  2XK0 A;  3OBW A;  3MO8 A;  3JCM V;  1W70 A;  3CXC S;  1PM3 A;  2X3X D;  1D0Z A;  3BDL A;  2P0K A;  4FW2 A;  3L2Q A;  2G3R A;  3OB9 A;  1SRM A;  2EVR A;  2XU8 A;  4ZGD B;  5CIU A;  3VS4 A;  3E9F A;  1TG0 A;  3FLG A;  2JJ9 A;  3CC2 Q;  3VS5 A;  3C4S A;  1I5L A;  4M7D A;  2MWO A;  1MMG A;  1YNZ A;  2JS2 A; 
#chains in the Genus database with same CATH homology
 2EQI A;  3VS6 A;  2KNB B;  1X43 A;  2F2X A;  2FRY A;  1X6B A;  4M4Z A;  2D8H A;  2ENM A;  3UA6 A;  1VYT A;  1K4U S;  1KFZ A;  5HCK A;  1NEB A;  3NHN A;  4J9D A;  4RUG A;  1ABQ A;  4QT7 A;  2ROT A;  4IIO A;  1ZUY A;  2L3S A;  2A08 A;  1RUW A;  2LJ0 A;  4AFZ C;  2BZ8 A;  2KRO A;  1WXU A;  2NUZ A;  1GRI A;  2F2W A;  1K76 A;  2VVK A;  2A28 A;  1AVZ C;  2RMO A;  1AWX A;  2BZX A;  2DLP A;  2FEI A;  1H3H A;  2KRM A;  2JM8 A;  4D8D A;  4Y92 A;  2EW3 A;  2RN8 A;  4JJB A;  2YUP A;  2BZY A;  2EGE A;  2KR3 A;  1GCQ A;  2RF0 A;  1Y57 A;  4D8K A;  2J6K A;  3RNJ A;  2DL7 A;  1UFF A;  1HD3 A;  2KT1 A;  1JQQ A;  3PVQ A;  2J06 A;  1SRL A;  3I35 A;  4AG1 C;  1TUC A;  1GL5 A;  5FWC A;  1PKT A;  3VS0 A;  1HJD A;  2GQI A;  4OMP A;  4OMN A;  1MV0 B;  2GGR A;  2RQR A;  5ECA A;  1AEY A;  1Z9Z A;  1A0N B;  2AKK A;  2CT4 A;  1JXO A;  3SEM A;  3M0T A;  1UEC A;  2ABL A;  2EGA A;  3M0Q A;  2JMC A;  2DL5 A;  1SSH A;  1PRL C;  2LX7 A;  4LN2 A;  1E6G A;  4CC4 B;  1HSQ A;  1AWW A;  2CDT A;  1UUE A;  4DEY A;  1JU5 C;  2PNI A;  1K1Z A;  1WI7 A;  2MIO A;  2DA9 A;  2MCN A;  1AD5 A;  2CSQ A;  3GBQ A;  1NYF A;  3RBB B;  1M27 C;  4CC3 A;  1MV3 A;  2YDL A;  1QKX A;  2CUB A;  2NWM A;  1AWJ A;  1OOT A;  3R6N A;  5FWB A;  2DRM A;  1H92 A;  2FO0 A;  3H0H A;  1U06 A;  2L3P A;  3ZL7 C;  5IXB A;  3QWX X;  2PZ1 A;  2O88 A;  2GTO A;  2K6D A;  2KRN A;  2PTK A;  3NPF A;  4HXJ A;  2JS0 A;  4RTU A;  1UHF A;  3TSW A;  2L0A A;  1W1F A;  1PWT A;  2XMF A;  2CUD A;  4F16 A;  2KXC A;  2KYM A;  5GJW B;  1ZUU A;  2K7A A;  2CH4 A;  1QWE A;  4Z89 A;  1M3B A;  1MUZ A;  4OMQ A;  2J7I A;  1ARK A;  2OAW A;  1SHF A;  2KT8 A;  2DBM A;  1X27 A;  4FSS A;  1QLY A;  2LMJ A;  4CC7 A;  2V1Q A;  2CRE A;  2H8H A;  3M0P A;  1VYU A;  2OI3 A;  3EHR A;  2GTJ A;  3VS2 A;  1VA7 A;  1QKW A;  2JXB A;  2W10 A;  1B07 A;  1BK2 A;  2C0O A;  1NM7 A;  4ZNX A;  4AG2 C;  2VKN A;  4RTT A;  1J3T A;  2J6F A;  1U3O A;  4LE9 A;  1AZG B;  2HCK A;  1YP5 A;  1M30 A;  1H8K A;  1RI9 A;  1YWP A;  4Z8A A;  2BTT A;  2HDA A;  2EPD A;  3VS1 A;  2J05 A;  4IIM A;  1GFD A;  1NLO C;  4J9I A;  1SEM A;  4J9C A;  4RTW A;  1NEG A;  1QWF A;  2DBK A;  3UAT A;  4K11 A;  5I22 A;  2FPF A;  1AZE A;  1ABO A;  3M0R A;  1AOJ A;  2MOX A;  2LZ6 B;  2EYX A;  1T3S A;  1WDX A;  3A98 A;  4AFS C;  2O2O A;  1WX6 A;  1UJY A;  2EKH A;  1W6X A;  4AFU C;  1YN8 A;  4OMO A;  2RNA A;  1OPK A;  1UTI A;  2VWF A;  1X6G A;  1M3A A;  3VS3 A;  2FG0 A;  4F17 A;  3PE0 A;  3EG1 A;  1GCP A;  4KRT A;  4HVV A;  4LNP A;  2CT3 A;  1UHC A;  2DRK A;  2M0Y A;  2JM9 A;  2X3W D;  4JZ4 A;  3TVT A;  1RLQ C;  2HEQ A;  2AK5 A;  2KRS A;  3H0F A;  4J9H A;  2DF6 A;  4JJC A;  1Z9Q A;  1PRM C;  1KIK A;  1NG2 A;  2DM1 A;  3M0U A;  4EIK A;  1LCK A;  1I07 A;  1ZBJ A;  2AKL A;  2KYB A;  4J9F A;  4RTZ A;  3H0I A;  1OEB A;  4JPB W;  1YCS B;  2KE9 A;  2AZS A;  2JW4 A;  4HVW A;  1KJW A;  3M0S A;  4OMM A;  3VS7 A;  4LUE A;  1V1C A;  1U5S A;  3EG0 A;  1M8M A;  1GFC A;  2SRC A;  4J9E A;  1KSW A;  3I9Q A;  1S1N A;  3UA7 A;  2DVJ A;  4E6R A;  2G6F X;  2K2M A;  1K0X A;  2K3B A;  1M3C A;  1PNJ A;  1T0J A;  3THK A;  1NLP C;  2DE0 X;  2FPE A;  1WXT A;  2LJ3 A;  4HCK A;  2O9V A;  1UDL A;  4ESR A;  3REB B;  4JZ3 A;  1NYG A;  3O5Z A;  1BB9 A;  2LQW A;  2O9S A;  2GNC A;  3EG2 A;  3NMZ C;  1WIE A;  2ROL A;  2EYY A;  1JXM A;  4CC2 A;  1BU1 A;  1YWO A;  2W0Z A;  2DX1 A;  3EGU A;  2EYW A;  3H41 A;  2DMO A;  3IQL A;  5IHK A;  1CSK A;  3NGP A;  1RLP C;  2OJ2 A;  2YSQ A;  1TUD A;  4LUD A;  2KEA A;  2L3Q A;  2LJ1 A;  1FYN A;  2J6O A;  3TSZ A;  2HSP A;  3UF4 A;  2JT4 A;  1AWO A;  1GBR A;  4A63 B;  3SHW A;  1CKB A;  2YUO A;  1OPL A;  1UG1 A;  2RQT A;  2D1X A;  2V1R A;  1QCF A;  4RTV A;  2P4R A;  1ZSG A;  1PKS A;  1WFW A;  1GCQ C;  1WXB A;  2K79 A;  1UE9 A;  2SEM A;  1T0H A;  2O31 A;  1B3Q A;  2F2V A;  4GLM A;  2LP5 A;  3VRZ A;  1WA7 A;  2IIM A;  4GBQ A;  2CSI A;  2EBP A;  2ECZ A;  2D8J A;  1CKA A;  1WYX A;  2C0I A;  4R0K A;  4WCI A;  1X69 A;  1BBZ A;  3EHQ A;  2YT6 A;  2DL3 A;  4X1V A;  3KFV A;  1GBQ A;  5IHN A;  2YUN A;  1SHG A;  2CH4 W;  2E5K A;  5EC7 A;  2A36 A;  1UGV A;  5IHI A;  3JV3 A;  1JEG A;  3C0C A;  5FW9 A;  1K9A A;  3I5S A;  5L23 A;  2L2P A;  2M51 A;  1ZUK A;  2RQV A;  2HBW A;  2DJQ A;  2DIL A;  5GJV B;  4Z88 A;  1VYV A;  3QWY A;  1UJ0 A;  4DEX A;  2RQU A;  1PHT A;  4J9G A;  4HVU A;  5I11 A;  2EGC A;  2ESW A;  1N5Z A;  4J9B A;  1G83 A;  2AZV A;  2DL4 A;  3I5R A;  3PVL A;  2K9G A;  1SPK A;  3CQT A;  3LH5 A;  2KGT A;  2A37 A;  2DL8 A;  2LNH B;  2B86 A;  4ORZ A;  4JJD A;  5IXF A;  2QDL A;  2FRW A;  1X2K A;  1Y0M A;  2C0T A;  3U23 A;  1WLP B;  2JMA A;  2KBT A;  4AFQ C;  4F14 A;  5IH2 A;  1E7O A;  2KXD A;  1EFN A;  1W70 A;  2I0N A;  2X3X D;  1JO8 A;  2ED0 A;  2JTE A;  2RPN A;  1I0C A;  1X2Q A;  1XOV A;  2LCS A;  2DYB A;  3VRY A;  1IO6 A;  2FPD A;  2GBQ A;  1G2B A;  1ZX6 A;  1SRM A;  1ZLM A;  2EVR A;  2DNU A;  2YUQ A;  1E6H A;  1K0S A;  3VS4 A;  3REA B;  3FJ5 A;  1OV3 A;  1T3L A;  1I1J A;  1TG0 A;  3EG3 A;  2RQW A;  1FMK A;  2ED1 A;  4RTY A;  3VS5 A;  4OML A;  2LQN A;  2D0N A;  3ULR B;  4RTX A;  1YNZ A;  2JS2 A;  2EYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...