1ZX6A

High-resolution crystal structure of yeast pin3 sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ypr154wp
publication title Structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zx6A00
1I0CA 2J05A 3EG2A 2KRMA 2HEQA 3H41A 2HCKA 1GFDA 2PZ1A 3TVTA 1OOTA 1Z9ZA 1OEBA 1WLPB 3IQLA 1ZX6A 1XOVA 3JV3A 1KIKA 4LN2A 3A98A 1OPKA 1PKTA 1TG0A 1A0NB 1NYFA 2RF0A 4CC2A 2LNHB 1ABOA 1MV0B 1AWXA 1VA7A 4RTYA 1TUCA 2A28A 2KT8A 2DL8A 2F2XA 2B86A 2DBKA 4M4ZA 5GJWB 5ECAA 4AG2C 2RQWA 1QCFA 1GRIA 2LQWA 2EKHA 2FO0A 3REBB 1NG2A 4R0KA 2HDAA 2RPNA 2DRKA 1T0HA 1VYVA 5IH2A 1YCSB 1QWFA 1UFFA 1AEYA 2FPDA 1E7OA 2AZSA 2EBPA 4F16A 1SHGA 1NYGA 2M0YA 2EW3A 2DL7A 2YDLA 4E6RA 3NMZC 1X27A 1Y0MA 1I1JA 2GBQA 2ABLA 1S1NA 1UJ0A 3M0SA 3CQTA 1GL5A 2O9VA 4J9FA 1AWJA 1ZLMA 2CT3A 2FRYA 4JJDA 2JW4A 2E5KA 2RQRA 1ZUUA 2DVJA 4X1VA 1WXUA 1RLQC 2KXCA 4Z88A 3QWYA 3H0HA 3EG3A 4GBQA 3UF4A 2LP5A 2CH4W 2DF6A 2J06A 1W1FA 4Z89A 2K2MA 2K3BA 2EGCA 1RI9A 2K9GA 2EGAA 3UATA 1K9AA 4HVWA 2KYMA 2BZXA 3SEMA 2A37A 2DMOA 2AKLA 2G6FX 2ED0A 1E6HA 2BTTA 2JT4A 4ZNXA 3VS4A 1SPKA 2KNBB 3I5SA 4J9GA 2DX1A 3UA6A 1ZBJA 4K11A 1QWEA 1UJYA 4J9IA 2GTJA 2CSQA 2LX7A 2RNAA 2MCNA 1KSWA 3VS6A 2DNUA 1JQQA 4QT7A 4OMQA 2JMAA 1AOJA 2VKNA 2H8HA 1KJWA 4GLMA 2YT6A 1M3CA 2BZYA 3EGUA 2J6OA 2FEIA 1WYXA 3O5ZA 1NLPC 1RUWA 5GJVB 4D8KA 2CSIA 1EFNA 2LJ3A 1U06A 4OMNA 3M0QA 1T0JA 3TSWA 1TUDA 1IO6A 2FPFA 3VS7A 2KEAA 2OJ2A 4J9HA 2GTOA 1WXTA 2DL3A 3VS2A 1VYTA 3TSZA 1J3TA 4D8DA 1LCKA 4J9CA 2YSQA 2DRMA 1UHCA 4RUGA 2XMFA 4OMPA 1YP5A 5FWBA 5IHNA 2KGTA 2NUZA 2KYBA 2YUNA 1PKSA 1UDLA 1X2KA 2DBMA 2JXBA 1JU5C 1AWOA 2L3SA 4J9DA 2DA9A 1BB9A 3VS1A 1RLPC 3FJ5A 2MIOA 5IXBA 2HBWA 3GBQA 1UUEA 2K79A 2JS0A 1K1ZA 2YUOA 2V1RA 3C0CA 1BK2A 1NLOC 1GFCA 1UECA 4Z8AA 2J7IA 4DEXA 2KBTA 2M51A 2EGEA 1WFWA 3I9QA 1YWPA 3RBBB 2JM9A 1X2QA 4AFSC 1W70A 1MUZA 2CDTA 2KRNA 2KXDA 4RTUA 2RN8A 1UGVA 1E6GA 1GBRA 2ESWA 2OAWA 2ENMA 4EIKA 1WA7A 1BBZA 2LCSA 5IHIA 1QKWA 1V1CA 2EYXA 1QLYA 2FRWA 3VRYA 1GBQA 5IHKA 3M0UA 4HCKA 2DL5A 2EVRA 1AD5A 2QDLA 3EG0A 3ZL7C 4DEYA 1VYUA 2GGRA 1YN8A 3KFVA 2EYWA 2MOXA 4FSSA 1SEMA 1JO8A 3LH5A 3EHQA 1SSHA 2KE9A 4IIMA 4HVVA 1PHTA 2F2WA 2CUBA 1ABQA 1K76A 1JXMA 1U5SA 4OMOA 5I22A 1T3LA 3NPFA 2CT4A 3VRZA 4HVUA 1WX6A 2W10A 1AWWA 2L3QA 2JMCA 1HJDA 2D1XA 2O31A 2AKKA 1PRMC 4JZ4A 2X3WD 2LZ6B 2RMOA 1GCQC 1NM7A 2W0ZA 2JS2A 1YNZA 3PVQA 2ROLA 1X69A 2O9SA 4ESRA 4RTTA 2PTKA 4J9BA 2AZVA 2OI3A 2IIMA 1N5ZA 1ZSGA 2YUQA 1U3OA 1SRMA 2KR3A 2LQNA 2C0OA 1JXOA 1FYNA 1HSQA 1M27C 2EYZA 1M30A 1G83A 2DL4A 1H8KA 1Y57A 2PNIA 4RTWA 3I35A 3VS3A 2ED1A 1OPLA 2YUPA 2EQIA 2O2OA 1X6BA 2AK5A 4HXJA 1X6GA 2DM1A 4LUEA 2CUDA 1UHFA 2K6DA 3THKA 3VS5A 5IXFA 1H3HA 4OMLA 1FMKA 3R6NA 4JZ3A 1PRLC 2D8JA 2F2VA 2KROA 3UA7A 4LUDA 3RNJA 3SHWA 2L0AA 2SEMA 2GNCA 3M0RA 4LE9A 4WCIA 3H0IA 2V1QA 2A36A 2SRCA 1AVZC 1AZGB 2DLPA 1PNJA 2KT1A 1B07A 1M8MA 2K7AA 4RTXA 1SRLA 4AFZC 1JEGA 2ROTA 2C0TA 2RQTA 3EG1A 1K0SA 2JM8A 1H92A 4J9EA 2EYYA 4A63B 1PWTA 4AG1C 2ECZA 2FPEA 1ZUKA 4F14A 5EC7A 1BU1A 2DYBA 1CKAA 1M3BA 2NWMA 3NHNA 2A08A 1UG1A 1K4US 1WDXA 2DE0X 1CSKA 2EPDA 3H0FA 2LJ1A 2JTEA 2C0IA 3REAB 4CC7A 4JJBA 3NGPA 2LMJA 1SHFA 4Y92A 3M0TA 4JPBW 1NEBA 1UTIA 3PVLA 2L3PA 1GCQA 4KRTA 1HD3A 1KFZA 3VS0A 2X3XD 2P4RA 2CREA 1UE9A 1ARKA 1OV3A 2DJQA 4LNPA 1CKBA 3U23A 1AZEA 4IIOA 1WXBA 1WIEA 2LJ0A 2VVKA 5HCKA 4CC3A 2I0NA 2RQUA 1K0XA 1NEGA 4RTZA 5FWCA 4CC4B 1WI7A 5FW9A 4JJCA 2RQVA 4ORZA 3EHRA 1W6XA 2D0NA 4AFUC 2L2PA 2BZ8A 2GQIA 1T3SA 2FG0A 1QKXA 2HSPA 4RTVA 2O88A 3QWXX 1G2BA 4AFQC 3PE0A 1MV3A 1GCPA 2J6FA 3I5RA 2D8HA 5I11A 1YWOA 2DILA 1Z9QA 2CH4A 2KRSA 1B3QA 5L23A 2VWFA 4OMMA 3M0PA 1I07A 1M3AA 1ZUYA 3ULRB 1X43A 2J6KA 4F17A
chains in the Genus database with same CATH superfamily
2KRMA 3QYHB 1C1AA 3H41A 3G4SA 2E3IA 1OOTA 5HY6A 2JJ9A 1OEBA 7AT1B 1PKTA 3E2UA 1TG0A 3PIPA 1MV0B 5GAMh 3EH1A 2M0OA 4PJOB 3OYYA 2DBKA 2EJGA 4C92E 3INZA 2HKNA 2XKOC 2HKQB 4J7IA 2HDAA 2DRKA 3M9QA 1LVKA 2AT1B 3V8KA 8AT1B 1UFFA 2FPDA 3UPUA 4F16A 1OZ2A 2XD0A 1YJ9T 4XTVA 2M0YA 2VXFA 3PT9A 1EZZB 2FVUA 2DTIA 3CCQT 4XTXA 4XAXB 2ABLA 4EDUA 3CQTA 2PU9B 3FRNA 1KK7A 2QAZA 2JW4A 2F5KA 1ZUUA 2IG0A 5KYYB 5CKFA 1WQ7A 4GY5A 2DF6A 2GQVA 1YI2A 4HT8A 4A4FA 1K9AA 3HRTA 3SEMA 2NUPA 3L2QA 2RHXA 3I56Q 3M4GA 3VS4A 1SPKA 3EH2A 3I5SA 3RMQA 3CBPA 2KSSA 3C94A 3CC4T 3N5BB 4M75G 2RJEA 2LX7A 2ZCFB 3CCVT 3VS6A 1UGPB 1M4ZA 3I56A 2DXBA 2FHDA 1AOJA 2VKNA 4PJJA 3LX7A 2H8HA 2O4XB 2YT6A 4DOWA 1G3WA 3CCLQ 2FEIA 9ATCB 1WYXA 1BI3A 2ZAEA 2HL5C 1PC0A 3M0QA 1T0JA 3BDLA 5GAOp 3CC7T 4E7IA 2KEAA 4BI4A 3RKYA 3CCLA 2DL3A 1RAFB 1WHKA 3DB4A 2P84A 2E64A 3TU4K 1J3TA 3CCEQ 1KC8C 2DRMA 1UHCA 1YP5A 4PJOG 2DBMA 4ZN3A 2LCLA 5GAN6 3G1JA 1KC8R 1M90C 2HNIA 1N8RU 2RJCA 5IN1A 2K79A 3LYIA 1K1ZA 1K8AC 3C0CA 1BK2A 2RI2A 3FDRA 2KVQG 1BIAA 3L2ZA 1UECA 2LCCA 4Z8AA 3L42A 4DEXA 1M90R 1NE8A 3H6ZA 4C8QE 1WFWA 2OAUA 4JS5A 2JM9A 5KYWA 1X2QA 4AFSC 1K8AR 3QKJA 4L6V5 1W70A 1M2VB 2CP6A 2YLCA 1UGVA 2QG9B 1BBZA 1W2BP 3VRYA 4XTZA 3OQ5A 5IHKA 4E7SA 1SG5A 4PJLA 3JSCA 3NFCA 1VQNQ 3EG0A 2IVWA 4C92D 1YN8A 2DIGA 3JCMe 3M58A 5CQXA 5A0DA 2MAMA 2B8AA 3LLRA 3A8MB 1Q81U 1JO8A 1OX9A 3LH5A 3NTIA 1I4K1 4XK8E 1YITQ 4QQDA 5CVIA 2DJZA 3JRZA 2YRDA 1RAAB 3JCMc 2F2WA 5I2MA 1ABQA 1K76A 3OYGA 1D1CA 4KT0E 2KDSA 5I22A 2EAYA 2HL3A 4JRQA 3I56T 1RL2A 1WX6A 4C92F 3VYGA 2DEUA 2RMOA 4NS5A 4O5VA 2DFUA 3BW1A 3VV0A 4B9XA 3V8LA 4EMKB 2JTFA 2PTKA 3CCLT 4LXCA 2CZ7B 3JCMf 3URGA 1SRMA 4OF1A 1QVPA 5KYXB 2LQNA 3X24B 3CMAA 5CIUA 3RDVA 3F70A 1HSQA 5CAIA 2EYZA 5LJ3j 1G83A 1Y57A 2PNIA 1G8XA 2K5LA 4RTWA 1WPYA 3D7SB 2O2OA 1OU8A 1R0CB 5FU7B 1Y96A 2ZZDA 1C6VX 4LUEA 4MZPA 2CUDA 2K6DA 3THKA 2L5QA 1MNEA 4MZMA 4M78E 4LD6A 2D8JA 1WNLA 4AT1B 4FW2A 2KY9A 2JUFA 2HSEB 1QVGA 2L0AA 2HAXA 1VQKQ 2GNCA 4LE9A 1OZ3A 1AVZC 1PCXA 1PNJA 1PD1A 1M8MA 2LC4A 3R6OA 1JEGA 3ER0A 2C0TA 2RQTA 3OYNA 4A63B 1PWTA 4ZGEB 2FPEA 4JDSA 2YLBA 5EC7A 3M54A 4F7UF 1WDXA 4M7DF 1VQNT 4L59A 3RKXA 2RM4A 1W2BS 4CC7A 2F1LA 2LMJA 1SHFA 2DVEA 3EFSA 3HFOA 4PJMA 4V2SA 4C8QD 2DIQA 2RHIA 3CPWP 3VS0A 2HZYA 2M1HA 3VYHB 5LJ3d 2RH2A 2DZ9A 4MMKA 2WSEE 5LL6S 3U23A 5GAOq 1WXBA 2VVKA 5GAOl 1MGQA 2LTOA 2HD0A 4RTZA 2NUPB 2RB6A 4C92C 3P8HA 1LJOA 1WI7A 1HXDA 1N9RA 4JJCA 2AIRB 1RAGB 1M2OA 3JB9I 3QZ9B 1W6XA 4AFUC 2L2PA 5GANe 2BZ8A 3FC3A 1B7TA 4QKUA 5LJ5j 3CMAT 4ZN1A 3DKMA 3QWXX 4M7AF 3H9NA 3M4YA 1D0ZA 4M77F 1YBYA 1Z9QA 4EMKC 2CH4A 1YIJA 1MNDA 1I07A 3OBYA 3L1AA 4KGXB 2RHYA 2J6KA 4F17A 1I0CA 3JCMh 2HEQA 4A4HA 5DLQE 1N6AA 4BDZA 2E5QA 1Q7YC 1VQLQ 1Z9ZA 1Q81C 3IQLA 2VXEA 4PNOA 1AHJB 2A3LA 5LJ3g 2ZPGB 3CCUQ 2RF0A 2RJFA 2LNHB 4RTYA 1Q7YR 5FU7C 2A28A 2KT8A 1Q81R 2K3XA 2JZ2A 2F2XA 2B86A 4N4HA 5ECAA 2A0FB 1R0BG 3PMIA 1HK9A 4N4IA 5IT9E 1QCFA 1AT1B 1GRIA 2DYIA 1VQKT 2O01E 5KYNA 2FO0A 3FIFA 2WSCE 1U1SA 1PSFA 5IH2A 1YCSB 1QWFA 5L8RE 3LGFA 1E7OA 3G71Q 4RKUE 3CD6Q 1SHGA 1BYMA 1NYGA 2DL7A 4DBHA 3WXMB 1XNIA 3NMZC 1X27A 1I1JA 1X75C 4M78D 5GAMj 1UJ0A 2V8KA 3CCQA 5LJ5d 2CT3A 5DM7R 3JCMX 3JAME 4C92A 2DVJA 1ZSZC 1RLQC 2KXCA 4Y28E 2X4YA 4Z88A 1NPPA 3QWYA 4M78B 4PLIA 3JB9G 2CH4W 2KMTA 2J06A 1W1FA 3J7AF 3HRUA 2K3BA 2EGCA 2PQWA 1RI9A 2K9GA 1K8AU 3UATA 3QJYA 4NOYA 2DXUA 4HCZA 3DLMA 2PUOB 1TU0B 3FB9A 2RK1A 2NYSA 3KUFA 2G3RA 3EAEA 3CMEQ 5GAN3 3CPWS 3MP6A 4OB1B 2EJFA 4BI3A 2KNBB 3OYJA 4NL2A 3OMCA 3UA6A 4J9IA 1TUGB 1HYOA 2OTLQ 2CSQA 2K2VA 4IKFA 3GLXA 1KG1A 4WF2A 1KSWA 2X4XA 1PM3A 1JQQA 4X34A 4C8QC 2RO0A 8ATCB 4OMQA 1C0MA 3TCJA 1KQSP 3OY9A 5KYXA 3ASKA 4GLMA 1M3CA 1O75A 5CKDA 3EGUA 1D1BA 3HHTB 3O5ZA 1NLPC 1RUWA 2OTLA 3UWNA 4BB7A 3G6EQ 1U06A 4HT9A 1TUDA 3PIOA 5LJ5g 1PSEA 1JJ2P 4FW1A 3VS2A 3GNFB 1UB4A 4BE0A 3CC7A 2DTOA 4M75F 4E7HA 3Q1JA 3WVEB 2YSQA 1RAEB 1OULA 5A0LA 1VQLT 5FWBA 5IHNA 2H3JA 1TSFA 3LH0A 5GAMd 2DXTA 5EG2A 1JU5C 1Y96B 2L3SA 3CCUT 1NJIU 1IGQA 1BB9A 4A4KA 4PKCC 3OA6A 3MEVA 2R5MA 4JRPA 4BI8B 2MIOA 4QQ6A 1UUEA 1WHLA 4OB0B 1MMGA 2V1RA 2Y4YA 2K4YA 5A2QE 1VQPQ 2QK0A 1LPLA 2KBTA 4E7KA 2M51A 3WVDB 4KUDK 2EGEA 3I9QA 5GANh 4BE1A 2CDTA 3G71T 4RTUA 1ZSZA 3CD6T 1VQPA 4PJOF 2RHUA 4EIKA 2LCSA 5IHIA 2EYXA 3GNGA 1GXIE 3OS5A 1QLYA 1LNXA 1ZQ1A 3V7CA 2DL5A 2EVRA 1AD5A 2V8JA 4DEYA 4YTLA 3LW5E 2L8DA 1ZHIA 1SEMA 3LGLA 3OYCA 4FYWB 2RK2A 2PVOB 1WJSA 4DBFA 1SSHA 1WJQA 1WHHA 3M59A 5GAMg 4C8QA 4FCYA 1JXMA 5D6WA 4M78C 1YHQQ 1T3LA 2DAQA 3QXEB 2QYZA 1VQMQ 1VQ6Q 4HVUA 3CMET 1KQ2A 1AWWA 1OI1A 2L3QA 2JMCA 4KGZB 2D1XA 1MMDA 2AKKA 3CPFA 2ZPBB 2VUBA 2X3WD 2LZ6B 4A4GA 2X9HA 2OTLT 1BKBA 1VQMA 2K57A 1VQ6A 1WQWA 3OYDA 2W0ZA 2JS2A 4B6MA 1UGQB 2ROLA 4KULA 1X69A 4ESRA 4NL3A 2D6FA 2OI3A 4BE2A 4JLIA 3VJPA 4F7UE 1KQSS 4MZTA 4M7DE 1F1BB 5GAN4 1Y71A 2XICA 3CC2Q 5GAN7 1FYNA 3A8LB 4JRKA 3M55A 4J6YA 4MMLA 1M30A 4C0FA 2P0PA 2XK0A 1H8KA 3CXCP 5KH6A 4EMGA 2DO3A 3VS3A 2YUPA 2EQIA 1VQ7Q 1M9SA 1JJ2S 1S72Q 2L3RA 3BE3A 3CCEA 3VUBA 4OMLA 1FMKA 4C0ZA 3LWIA 3OMGA 3T9NA 5I21A 1PRLC 1I81A 1RAHB 4P5NA 1RABB 1S72A 2EQUA 3SHWA 4C0GA 2SEMA 3M0RA 1YJWQ 1VQPT 2A36A 2SRCA 2KT1A 3OSSC 4B9WA 1M1GA 2M16A 4GLKA 1ZA2B 2K7AA 4M7AE 1SRLA 3ZBDA 2IPOB 3MKDA 4M77E 5CR2A 3EG1A 1H92A 2E6NA 2R57A 2K5IA 4AG1C 2QTVA 1IHVA 4XU1A 3MHXA 2DYBA 1MMAA 1Q7YU 1M3BA 1UEBA 3ZFJA 2A08A 2XHCA 2XDDA 4M78A 2DE0X 3CCSQ 2LJ1A 3HFNA 3OB9A 4Y92A 1VQNA 3I55Q 5CKEA 3OYEA 1NEBA 2ZPEB 4C92B 4BD3A 4KRTA 1HD3A 4MDWA 5AYFA 1YITA 5LJ3f 2X3XD 4ATOA 2CREA 2MMPA 1ARKA 1OV3A 2DJQA 1CKBA 4IIOA 4ME7A 3I55A 1NJIC 2E10A 1WIEA 1YHQT 1VQMT 1VQ6T 1BIBA 1JBMA 5FWCA 3S6WA 4CC4B 5FW9A 3C4SA 4BY6B 4QVCA 4HCCA 5GAN5 1NJIR 3EHRA 1QVFP 1QQJA 3META 2GQIA 2FYKA 2MWOA 4O6JA 2O88A 5GAOm 1G2BA 4ELYC 2CP5A 1MV3A 2VGMA 2YHTA 4N4GA 3SWNC 4CI0C 2QDYB 4OMMA 2R5AA 1QCOA 3ULRB 1KQ1A 3CCET 2KI7A 2J05A 1Q86U 1GFDA 2PZ1A 3QBYA 3JB9H 1WLPB 3RR6A 3AHUA 3EGDA 4J83A 1VUBA 3JV3A 1KIKA 4LN2A 3CXCS 1S72T 2P0KA 1OPKA 3P8BB 5GMKe 5AT1B 4D6WA 1ABOA 1AWXA 4FYVB 2F69A 1BI0A 1QP2A 4M7DD 1WGSA 2CKKA 4M4ZA 3MJXA 4AG2C 4IUQA 2BKDN 4LD9K 2V26A 4PJNA 3V8JA 2LQWA 2EKHA 2MPXC 3REBB 3CCRQ 3OYLA 1NG2A 4R0KA 3JCMP 1YJWT 2RPNA 3CCMQ 1VQKA 3NTHA 5GAOn 1VYVA 2E3HA 2CZ0B 4F7UB 4M7DB 1AEYA 3V7RA 5HKCA 3CBOA 3CBMA 3OW2P 4XTYA 1U8RA 2DTHA 5HK3A 2YDLA 2RHZA 3HSBA 3CCRA 1Y0MA 1ZSZB 3V7SA 2QA4Q 4C5HA 1S1NA 4M75E 2WACA 2C06A 3M0SA 5LJ5f 3G7ZA 4IUTA 2O9VA 4J9FA 4XTUA 1FX7A 1NBEB 4FL6A 1ZLMA 1YITT 2FRYA 2ZPFB 3CCST 2HQXA 4ZGJB 2RQRA 4C92G 3OS1A 4X1VA 3OYMA 1I5LA 3I55T 4GBQA 2PVGB 4M7AD 3E9GA 4Z89A 2K2MA 1P92A 4M77D 4JJNK 3ZEHA 2EGAA 4BDYA 5J39A 3FLGA 2KYMA 2BZXA 2A37A 4C8QB 4XU2A 3A1PA 1G3YA 2AKLA 2G6FX 2ED0A 3M53A 1Q82U 3A8GB 3AT1B 2BTTA 1QMCA 2JT4A 4ZNXA 4M7AB 3E1SA 1R77A 2DX1A 1ZBJA 4K11A 1UJYA 3SWNA 4M77B 2GTJA 3OBWA 4BUGA 2AHJB 4C5GA 2RNAA 2MCNA 1U1TA 4QW2A 4PJOE 2VASA 1WHMA 4IURA 4BY6C 2M9UA 5GJVB 4D8KA 1QP3A 1VIEA 1EFNA 4OGCA 2GCXA 4KGVB 2QASA 3HPWA 2JVVA 3BFMA 3TSWA 1IO6A 1W2BA 1M8VA 2R58A 3VS7A 2YRVA 2OJ2A 4J9HA 2BIVA 2F5TX 5J26A 1X01A 4D8DA 4PFPA 3PMTA 1BCMA 1VQ9Q 2LVMA 1VQ5Q 4RUGA 4ANJA 4OMPA 5GAMf 2NUZA 3L2VA 2KYBA 2YUNA 2RI5A 1XJWB 1N9SA 3MPUB 1VQLA 1UDLA 4CRIA 4J9DA 2DA9A 4EMHA 1RLPC 3FJ5A 2BE9B 4N0AC 2DERA 5IXBA 3GBQA 1OQKA 3CCUA 1VQ5A 1EIFA 2JS0A 3E9FA 2YUOA 2ATCB 2FB7A 1NLOC 4HKEA 4PFOA 3SD4A 2J7IA 4FM4B 3CCRT 3GPLA 3CCMT 2DKGA 1V29B 2LT1A 3RBBB 4C5IA 1MUZA 2GFUA 5KCHA 1GBRA 3S3MA 2ENMA 3G71A 1QKWA 4M7DC 3CD6A 2Z0WA 1IB8A 4OVAA 2MF2A 2QA4T 3EFRA 3JCMg 2OTJQ 3OW2S 2QDLA 4RG8A 2GGRA 3KFVA 2OX7A 3HL8A 2MOXA 4FSSA 3SB2A 4E2FB 1UGRB 1I8FA 3DLLA 2K5FA 1Q86C 2XIDA 1TS9A 4HVVA 3EFOB 1B34A 4J6XA 4C8QG 5GMKh 1PG5B 5GANj 2EWNA 3HP9A 1Q86R 1U5SA 5KE3A 3M57A 5I2SA 1MMNA 1KD1C 3RKWA 2CP7A 1RADB 4M75D 3L2WA 3QPHA 3JCMQ 4DBQA 1HJDA 2O31A 1VQ4Q 4OGEA 1PRMC 3CMEA 3TREA 5M9OA 3JCMb 3LWHA 1GCQC 2X51A 2X4WA 4ZTFA 3CC4Q 4PL6A 1KD1R 4M7AC 1YNZA 4M77C 1VQOQ 3PVQA 1Y07A 1VQ4A 2COZA 4J9BA 3RMSA 3MP8A 2IIMA 1ZSGA 2YUQA 2CP2A 1U3OA 4EPCA 2COYA 2CS7A 3HTRA 5FRNA 2GFAA 3G4SQ 2DD4A 5CKHA 4E47A 4N0AA 3G6EA 3TEEA 2DL4A 3A5ZB 2VGNA 2LT4A 3BDUA 3I35A 2AK5A 1VQ9T 2YRCA 4HXJA 4PJOD 4LDWA 1VQ5T 5FLXE 2KAFA 1H3HA 5IXFA 2RI3A 3EGDB 3CPWA 5GAN8 4IUPA 3PNWC 2ZPIB 2F2VA 2KROA 3UA7A 4Y91A 2QQRA 4LUDA 3GOXA 2NUTA 4FU6A 4F7UA 5HK0A 4M7DA 1Q82C 3QHSA 3H0IA 1WJRA 2MK5A 2E41A 1AZGB 3JCMJ 1M1KU 2DLPA 1B07A 5GANd 2HMAA 2WSFE 2KQWA 4AFZC 2RJDA 4J7FA 1VOMA 5KCOA 1Q82R 3UT1A 1M1FA 2DD5A 4F04B 2EYYA 2FZGB 1FMVA 4QQGA 1FWZA 4A4EA 2EKOA 1BU1A 2YWWA 3QSUA 2VV5A 2QQAA 2OTJT 2NWMA 3NHNA 1UG1A 2QTXA 4M78G 1Y7XA 2EPDA 2RD1A 3H0FA 3QDRB 5C0MA 3JCMW 3REAB 1O9SA 3NGPA 3M0TA 6AT1B 1XTDA 1YI2Q 3OYHA 2GF7A 1UTIA 3PVLA 4II1A 2L3PA 2MWPA 1GCQA 2VC8A 1G3TA 2H3EB 5FRMA 4M7AA 4ZGDB 2P4RA 1UE9A 4M77A 3BY7A 2LRQA 5HCKA 1QVGP 1FXXA 4CC3A 2RQUA 3SFMA 1K0XA 2A7YA 1NEGA 2JOYA 5DY9A 3CCJQ 2JTMA 1YHQA 2E70A 1FMWA 5GANg 1VQ4T 1WZOA 4C5EA 4OB2B 4MDXA 2RQVA 2CP3A 2Y4XA 5DLOA 2LNVA 3QJ6A 3SWNB 4DA4A 3MP1A 1T3SA 2FG0A 3X25B 1QKXA 2HSPA 2X35A 3CCJA 3EG9A 3QG1A 4PFZA 5IAYA 1VQOT 1RI0A 4HA8A 1H641 4FSXA 3S3NA 3G6ET 3TQ7P 1GCPA 2D8HA 2PVDB 1XQHA 4RCCA 3RERA 1B3QA 4QVZA 1TWBA 5L23A 4M75C 1NPRA 3G4ST 1ZUYA 2DZCA 1X43A 3CC2A 5FU6C 3EG2A 3OYFA 4R56A 3A8HB 2HCKA 3TVTA 1VQ8Q 3JB9J 4J6WA 1ZX6A 3GIBA 1XOVA 2LQ8A 3A98A 2V8IA 4FT4A 1K73U 1OX8A 4X9DA 1A0NB 1NYFA 1VQ7A 4CC2A 3VKIA 1VA7A 1M5Q1 1TUCA 5LJ3e 1VQ8A 4X9CA 1Q95G 1V76A 3J80E 2DL8A 3JCMV 5GJWB 1SKUB 2RQWA 3P8DA 4PK4A 2NLUA 4KH0B 1YCYA 1DJ7B 5CK9A 3PFSA 1JB0E 4E7JA 5FROA 1T0HA 4PJOC 4A53A 1YJWA 4XTWA 4UC4A 2AZSA 1D3BA 2EIFA 2EBPA 1KQSA 5D7UA 2DETA 1PD0A 2EW3A 1EX4A 4E6RA 2LQKA 2VB6A 2FL7A 2MI6A 2LDMA 2GBQA 5KYUB 2K3YA 2RA2A 3FEOA 1GL5A 3EFOA 1AWJA 1D09B 3L2UA 2DK3A 3X26B 4JJDA 1JJ2A 2E5KA 1WXUA 3CCSA 3H0HA 3EG3A 3UF4A 3X28B 1YI2T 2CZ6B 2LP5A 3L2RA 5J3BA 1RAIB 1TOVA 1G5VA 1K9MU 1B34B 4HVWA 5GMKm 2HQHA 2MYSA 4J5YA 2DMOA 3EGXB 1IHWA 1E6HA 4HCBA 3C95A 3M56A 4DOVA 4J9GA 4DQ2A 3CCJT 2P0QA 1QWEA 2XG8D 4RMOA 4M75A 4WTOB 1QVGS 2DNUA 2EFIA 4QT7A 4C0DB 2XDPA 1M1KC 2JMAA 1SSFA 4L5GA 3RIRA 2ZGWA 1KJWA 4VUBA 2BZYA 2J6OA 2QI2A 3CMAQ 1D0XA 3PGGA 3CC2T 2CSIA 1M1KR 2LJ3A 2DPPB 4OMNA 2FPFA 2COWA 2GTOA 2M02A 1WXTA 4E7LA 1VYTA 4XQ3A 3QDFA 5LJ5e 3TSZA 1VQ7T 1LCKA 4J9CA 1BCOA 4R55A 2QQBA 2QQSA 1VQ8T 2CP0A 4RCBA 2XMFA 2JN0A 2KGTA 1PKSA 1KD1U 4PLLA 4PJOA 1X2KA 2JXBA 1AWOA 3VS1A 4LDXA 3SDZA 2HBWA 4OB3B 1R8OB 4ELZC 3VUZA 1I5OB 3HRSA 2NUTB 1GFCA 2D9TA 1YFNA 1IRXA 4JLGA 3MEWA 1QCNA 1KHIA 1G3SA 1YWPA 1TXQA 3OYKA 3O8VA 2KRNA 2KXDA 3CCMA 4JS4A 2QGGA 2RN8A 1E6GA 2ESWA 2OAWA 1WA7A 1OU9A 1V1CA 2CGHA 1BI1A 2QEXQ 4J8OA 1W4SA 2FRWA 5GMKl 1GBQA 1YJNQ 3M0UA 4HCKA 3OYBA 2PUKB 3ZL7C 1VYUA 3RESA 2QA4A 3MEAA 1RACB 2EYWA 5KYYA 2E65A 3EHQA 3QIIA 3CXCA 4QVDA 2QEXA 3JB9D 2KE9A 4IIMA 1UGSB 1YJNA 4FIBA 4BACA 1PHTA 3OS2A 2CUBA 5GAMe 1K73C 2DEQA 4OMOA 3NPFA 3QUIA 5KE2A 5LJ3h 2CT4A 2JNGA 2DXCA 3VRZA 5GMKi 3OYIA 2W10A 2EJ9A 2VYTA 3M5AA 1SF9A 4JZ4A 1K73R 1N8RC 3MO8A 3H8ZA 2P4TA 2O4XA 4OP0A 3JB9F 1NM7A 4LDYA 2CYZB 2D0QB 2E4HA 5GAN2 1IREB 4TVRA 1QVFS 2E12A 2O9SA 4RTTA 1YIJQ 4C8QF 1N8RR 3E19A 2AZVA 4C0DC 1N5ZA 1TTHB 3EG9B 1IGUA 5GMKj 3JCMd 2KR3A 4E7ZA 2C0OA 5GAOr 1JXOA 1VIFA 4KH1B 2EQKA 2BUDA 1M27C 3J81E 4IUUA 2EQMA 2L89A 4XU3A 3HKSA 2FZCB 4FYYB 2ED1A 1OPLA 4Z02A 1X6BA 1D1AA 5D6YA 1X6GA 2DM1A 1UHFA 3VS5A 4AMCA 1VQ9A 2Y90A 2LX9A 3R6NA 4JZ3A 3A8OB 1K9MC 3ME9A 3RNJA 1TH7A 1BI2A 2QQ9A 3MCAB 4JUVA 4F7UG 4M7DG 3GF5A 4WCIA 5A0GA 3RUXA 5GANf 2V1QA 3C12A 2X4JA 4ZTJA 4RG2A 1K9MR 3DB3A 1M2VA 2I2LA 3VU3C 4RTXA 2ROTA 3OS0A 2YXYA 1ZA1B 1YJ9Q 1QVFA 5KYUA 3S3OA 1K0SA 2JM8A 4J9EA 1D3BB 2E1HA 4Q5WA 2ECZA 1WHJA 3CCQQ 1ZUKA 4F14A 5KYWB 1LOJA 4KBMB 2XDBA 5CQYA 2QEXT 5CCAA 4LDUA 1N27A 1CKAA 1YJ9A 1YJNT 1MHNA 1K4US 3QZ5B 1OYXA 1X6OA 1JRIA 1QW1A 4FT2A 1CSKA 2OTJA 2JTEA 2C0IA 2HBPA 1KC8U 4KUIA 4JJBA 5LJ5h 3CEYA 4JPBW 3NTKA 2BE7D 3EGXA 4LDVA 1KFZA 1IZ6A 3OSVA 4M7AG 1M90U 4M77G 5D6XA 4LNPA 1AZEA 1KHCA 3GP8A 1ACMB 5CKBA 2LJ0A 2QXFA 3KBGA 3QYGB 2I0NA 2QGFB 2ZPHB 5CO7A 2EQJA 5C6SA 4XU0A 4M78F 2E6ZA 4DBRA 4FYXB 1ZBXA 3QO3A 3CCVQ 3OYAA 4ORZA 4EMKA 3X20B 3UDCA 2XU8A 2D0NA 1IXDA 1WHGA 3KXTA 4M75B 2FZKB 4IUVA 3MEUA 2CZ1B 2HQEA 4RTVA 2EYQA 3FJPA 3CC4A 5FU6B 4AFQC 4OMFB 3PE0A 1YIJT 3CCVA 3OW2A 2J6FA 3I5RA 4A54A 5I11A 1D0YA 1VQOA 1YWOA 2DILA 2XI9A 2KRSA 3CC7Q 2VWFA 3M0PA 2KK4A 1M3AA 4JRIA 1NZ9A 3PTAA 1H3ZA
chains in the Genus database with same CATH topology
1I0CA 2J05A 3EG2A 2KRMA 2HEQA 3H41A 2HCKA 1GFDA 2PZ1A 3TVTA 1OOTA 1Z9ZA 1OEBA 1WLPB 3IQLA 1ZX6A 1XOVA 3JV3A 1KIKA 4LN2A 3A98A 1OPKA 1PKTA 1TG0A 1A0NB 1NYFA 2RF0A 4CC2A 2LNHB 1ABOA 1MV0B 1AWXA 1VA7A 4RTYA 1TUCA 2A28A 2KT8A 2DL8A 2F2XA 2B86A 2DBKA 4M4ZA 5GJWB 5ECAA 4AG2C 2RQWA 1QCFA 1GRIA 2LQWA 2EKHA 2FO0A 3REBB 1NG2A 4R0KA 2HDAA 2RPNA 2DRKA 1T0HA 1VYVA 5IH2A 1YCSB 1QWFA 1UFFA 1AEYA 2FPDA 1E7OA 2AZSA 2EBPA 4F16A 1SHGA 1NYGA 2M0YA 2EW3A 2DL7A 2YDLA 4E6RA 3NMZC 1X27A 1Y0MA 1I1JA 2GBQA 2ABLA 1S1NA 1UJ0A 3M0SA 3CQTA 1GL5A 2O9VA 4J9FA 1AWJA 1ZLMA 2CT3A 2FRYA 4JJDA 2JW4A 2E5KA 2RQRA 1ZUUA 2DVJA 4X1VA 1WXUA 1RLQC 2KXCA 4Z88A 3QWYA 3H0HA 3EG3A 4GBQA 3UF4A 2LP5A 2CH4W 2DF6A 2J06A 1W1FA 4Z89A 2K2MA 2K3BA 2EGCA 1RI9A 2K9GA 2EGAA 3UATA 1K9AA 4HVWA 2KYMA 2BZXA 3SEMA 2A37A 2DMOA 2AKLA 2G6FX 2ED0A 1E6HA 2BTTA 2JT4A 4ZNXA 3VS4A 1SPKA 2KNBB 3I5SA 4J9GA 2DX1A 3UA6A 1ZBJA 4K11A 1QWEA 1UJYA 4J9IA 2GTJA 2CSQA 2LX7A 2RNAA 2MCNA 1KSWA 3VS6A 2DNUA 1JQQA 4QT7A 4OMQA 2JMAA 1AOJA 2VKNA 2H8HA 1KJWA 4GLMA 2YT6A 1M3CA 2BZYA 3EGUA 2J6OA 2FEIA 1WYXA 3O5ZA 1NLPC 1RUWA 5GJVB 4D8KA 2CSIA 1EFNA 2LJ3A 1U06A 4OMNA 3M0QA 1T0JA 3TSWA 1TUDA 1IO6A 2FPFA 3VS7A 2KEAA 2OJ2A 4J9HA 2GTOA 1WXTA 2DL3A 3VS2A 1VYTA 3TSZA 1J3TA 4D8DA 1LCKA 4J9CA 2YSQA 2DRMA 1UHCA 4RUGA 2XMFA 4OMPA 1YP5A 5FWBA 5IHNA 2KGTA 2NUZA 2KYBA 2YUNA 1PKSA 1UDLA 1X2KA 2DBMA 2JXBA 1JU5C 1AWOA 2L3SA 4J9DA 2DA9A 1BB9A 3VS1A 1RLPC 3FJ5A 2MIOA 5IXBA 2HBWA 3GBQA 1UUEA 2K79A 2JS0A 1K1ZA 2YUOA 2V1RA 3C0CA 1BK2A 1NLOC 1GFCA 1UECA 4Z8AA 2J7IA 4DEXA 2KBTA 2M51A 2EGEA 1WFWA 3I9QA 1YWPA 3RBBB 2JM9A 1X2QA 4AFSC 1W70A 1MUZA 2CDTA 2KRNA 2KXDA 4RTUA 2RN8A 1UGVA 1E6GA 1GBRA 2ESWA 2OAWA 2ENMA 4EIKA 1WA7A 1BBZA 2LCSA 5IHIA 1QKWA 1V1CA 2EYXA 1QLYA 2FRWA 3VRYA 1GBQA 5IHKA 3M0UA 4HCKA 2DL5A 2EVRA 1AD5A 2QDLA 3EG0A 3ZL7C 4DEYA 1VYUA 2GGRA 1YN8A 3KFVA 2EYWA 2MOXA 4FSSA 1SEMA 1JO8A 3LH5A 3EHQA 1SSHA 2KE9A 4IIMA 4HVVA 1PHTA 2F2WA 2CUBA 1ABQA 1K76A 1JXMA 1U5SA 4OMOA 5I22A 1T3LA 3NPFA 2CT4A 3VRZA 4HVUA 1WX6A 2W10A 1AWWA 2L3QA 2JMCA 1HJDA 2D1XA 2O31A 2AKKA 1PRMC 4JZ4A 2X3WD 2LZ6B 2RMOA 1GCQC 1NM7A 2W0ZA 2JS2A 1YNZA 3PVQA 2ROLA 1X69A 2O9SA 4ESRA 4RTTA 2PTKA 4J9BA 2AZVA 2OI3A 2IIMA 1N5ZA 1ZSGA 2YUQA 1U3OA 1SRMA 2KR3A 2LQNA 2C0OA 1JXOA 1FYNA 1HSQA 1M27C 2EYZA 1M30A 1G83A 2DL4A 1H8KA 1Y57A 2PNIA 4RTWA 3I35A 3VS3A 2ED1A 1OPLA 2YUPA 2EQIA 2O2OA 1X6BA 2AK5A 4HXJA 1X6GA 2DM1A 4LUEA 2CUDA 1UHFA 2K6DA 3THKA 3VS5A 5IXFA 1H3HA 4OMLA 1FMKA 3R6NA 4JZ3A 1PRLC 2D8JA 2F2VA 2KROA 3UA7A 4LUDA 3RNJA 3SHWA 2L0AA 2SEMA 2GNCA 3M0RA 4LE9A 4WCIA 3H0IA 2V1QA 2A36A 2SRCA 1AVZC 1AZGB 2DLPA 1PNJA 2KT1A 1B07A 1M8MA 2K7AA 4RTXA 1SRLA 4AFZC 1JEGA 2ROTA 2C0TA 2RQTA 3EG1A 1K0SA 2JM8A 1H92A 4J9EA 2EYYA 4A63B 1PWTA 4AG1C 2ECZA 2FPEA 1ZUKA 4F14A 5EC7A 1BU1A 2DYBA 1CKAA 1M3BA 2NWMA 3NHNA 2A08A 1UG1A 1K4US 1WDXA 2DE0X 1CSKA 2EPDA 3H0FA 2LJ1A 2JTEA 2C0IA 3REAB 4CC7A 4JJBA 3NGPA 2LMJA 1SHFA 4Y92A 3M0TA 4JPBW 1NEBA 1UTIA 3PVLA 2L3PA 1GCQA 4KRTA 1HD3A 1KFZA 3VS0A 2X3XD 2P4RA 2CREA 1UE9A 1ARKA 1OV3A 2DJQA 4LNPA 1CKBA 3U23A 1AZEA 4IIOA 1WXBA 1WIEA 2LJ0A 2VVKA 5HCKA 4CC3A 2I0NA 2RQUA 1K0XA 1NEGA 4RTZA 5FWCA 4CC4B 1WI7A 5FW9A 4JJCA 2RQVA 4ORZA 3EHRA 1W6XA 2D0NA 4AFUC 2L2PA 2BZ8A 2GQIA 1T3SA 2FG0A 1QKXA 2HSPA 4RTVA 2O88A 3QWXX 1G2BA 4AFQC 3PE0A 1MV3A 1GCPA 2J6FA 3I5RA 2D8HA 5I11A 1YWOA 2DILA 1Z9QA 2CH4A 2KRSA 1B3QA 5L23A 2VWFA 4OMMA 3M0PA 1I07A 1M3AA 1ZUYA 3ULRB 1X43A 2J6KA 4F17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I0C A;  2J05 A;  3EG2 A;  2KRM A;  2HEQ A;  3H41 A;  2HCK A;  1GFD A;  2PZ1 A;  3TVT A;  1OOT A;  1Z9Z A;  1OEB A;  1WLP B;  3IQL A;  1ZX6 A;  1XOV A;  3JV3 A;  1KIK A;  4LN2 A;  3A98 A;  1OPK A;  1PKT A;  1TG0 A;  1A0N B;  1NYF A;  2RF0 A;  4CC2 A;  2LNH B;  1ABO A;  1MV0 B;  1AWX A;  1VA7 A;  4RTY A;  1TUC A;  2A28 A;  2KT8 A;  2DL8 A;  2F2X A;  2B86 A;  2DBK A;  4M4Z A;  5GJW B;  5ECA A;  4AG2 C;  2RQW A;  1QCF A;  1GRI A;  2LQW A;  2EKH A;  2FO0 A;  3REB B;  1NG2 A;  4R0K A;  2HDA A;  2RPN A;  2DRK A;  1T0H A;  1VYV A;  5IH2 A;  1YCS B;  1QWF A;  1UFF A;  1AEY A;  2FPD A;  1E7O A;  2AZS A;  2EBP A;  4F16 A;  1SHG A;  1NYG A;  2M0Y A;  2EW3 A;  2DL7 A;  2YDL A;  4E6R A;  3NMZ C;  1X27 A;  1Y0M A;  1I1J A;  2GBQ A;  2ABL A;  1S1N A;  1UJ0 A;  3M0S A;  3CQT A;  1GL5 A;  2O9V A;  4J9F A;  1AWJ A;  1ZLM A;  2CT3 A;  2FRY A;  4JJD A;  2JW4 A;  2E5K A;  2RQR A;  1ZUU A;  2DVJ A;  4X1V A;  1WXU A;  1RLQ C;  2KXC A;  4Z88 A;  3QWY A;  3H0H A;  3EG3 A;  4GBQ A;  3UF4 A;  2LP5 A;  2CH4 W;  2DF6 A;  2J06 A;  1W1F A;  4Z89 A;  2K2M A;  2K3B A;  2EGC A;  1RI9 A;  2K9G A;  2EGA A;  3UAT A;  1K9A A;  4HVW A;  2KYM A;  2BZX A;  3SEM A;  2A37 A;  2DMO A;  2AKL A;  2G6F X;  2ED0 A;  1E6H A;  2BTT A;  2JT4 A;  4ZNX A;  3VS4 A;  1SPK A;  2KNB B;  3I5S A;  4J9G A;  2DX1 A;  3UA6 A;  1ZBJ A;  4K11 A;  1QWE A;  1UJY A;  4J9I A;  2GTJ A;  2CSQ A;  2LX7 A;  2RNA A;  2MCN A;  1KSW A;  3VS6 A;  2DNU A;  1JQQ A;  4QT7 A;  4OMQ A;  2JMA A;  1AOJ A;  2VKN A;  2H8H A;  1KJW A;  4GLM A;  2YT6 A;  1M3C A;  2BZY A;  3EGU A;  2J6O A;  2FEI A;  1WYX A;  3O5Z A;  1NLP C;  1RUW A;  5GJV B;  4D8K A;  2CSI A;  1EFN A;  2LJ3 A;  1U06 A;  4OMN A;  3M0Q A;  1T0J A;  3TSW A;  1TUD A;  1IO6 A;  2FPF A;  3VS7 A;  2KEA A;  2OJ2 A;  4J9H A;  2GTO A;  1WXT A;  2DL3 A;  3VS2 A;  1VYT A;  3TSZ A;  1J3T A;  4D8D A;  1LCK A;  4J9C A;  2YSQ A;  2DRM A;  1UHC A;  4RUG A;  2XMF A;  4OMP A;  1YP5 A;  5FWB A;  5IHN A;  2KGT A;  2NUZ A;  2KYB A;  2YUN A;  1PKS A;  1UDL A;  1X2K A;  2DBM A;  2JXB A;  1JU5 C;  1AWO A;  2L3S A;  4J9D A;  2DA9 A;  1BB9 A;  3VS1 A;  1RLP C;  3FJ5 A;  2MIO A;  5IXB A;  2HBW A;  3GBQ A;  1UUE A;  2K79 A;  2JS0 A;  1K1Z A;  2YUO A;  2V1R A;  3C0C A;  1BK2 A;  1NLO C;  1GFC A;  1UEC A;  4Z8A A;  2J7I A;  4DEX A;  2KBT A;  2M51 A;  2EGE A;  1WFW A;  3I9Q A;  1YWP A;  3RBB B;  2JM9 A;  1X2Q A;  4AFS C;  1W70 A;  1MUZ A;  2CDT A;  2KRN A;  2KXD A;  4RTU A;  2RN8 A;  1UGV A;  1E6G A;  1GBR A;  2ESW A;  2OAW A;  2ENM A;  4EIK A;  1WA7 A;  1BBZ A;  2LCS A;  5IHI A;  1QKW A;  1V1C A;  2EYX A;  1QLY A;  2FRW A;  3VRY A;  1GBQ A;  5IHK A;  3M0U A;  4HCK A;  2DL5 A;  2EVR A;  1AD5 A;  2QDL A;  3EG0 A;  3ZL7 C;  4DEY A;  1VYU A;  2GGR A;  1YN8 A;  3KFV A;  2EYW A;  2MOX A;  4FSS A;  1SEM A;  1JO8 A;  3LH5 A;  3EHQ A;  1SSH A;  2KE9 A;  4IIM A;  4HVV A;  1PHT A;  2F2W A;  2CUB A;  1ABQ A;  1K76 A;  1JXM A;  1U5S A;  4OMO A;  5I22 A;  1T3L A;  3NPF A;  2CT4 A;  3VRZ A;  4HVU A;  1WX6 A;  2W10 A;  1AWW A;  2L3Q A;  2JMC A;  1HJD A;  2D1X A;  2O31 A;  2AKK A;  1PRM C;  4JZ4 A;  2X3W D;  2LZ6 B;  2RMO A;  1GCQ C;  1NM7 A;  2W0Z A;  2JS2 A;  1YNZ A;  3PVQ A;  2ROL A;  1X69 A;  2O9S A;  4ESR A;  4RTT A;  2PTK A;  4J9B A;  2AZV A;  2OI3 A;  2IIM A;  1N5Z A;  1ZSG A;  2YUQ A;  1U3O A;  1SRM A;  2KR3 A;  2LQN A;  2C0O A;  1JXO A;  1FYN A;  1HSQ A;  1M27 C;  2EYZ A;  1M30 A;  1G83 A;  2DL4 A;  1H8K A;  1Y57 A;  2PNI A;  4RTW A;  3I35 A;  3VS3 A;  2ED1 A;  1OPL A;  2YUP A;  2EQI A;  2O2O A;  1X6B A;  2AK5 A;  4HXJ A;  1X6G A;  2DM1 A;  4LUE A;  2CUD A;  1UHF A;  2K6D A;  3THK A;  3VS5 A;  5IXF A;  1H3H A;  4OML A;  1FMK A;  3R6N A;  4JZ3 A;  1PRL C;  2D8J A;  2F2V A;  2KRO A;  3UA7 A;  4LUD A;  3RNJ A;  3SHW A;  2L0A A;  2SEM A;  2GNC A;  3M0R A;  4LE9 A;  4WCI A;  3H0I A;  2V1Q A;  2A36 A;  2SRC A;  1AVZ C;  1AZG B;  2DLP A;  1PNJ A;  2KT1 A;  1B07 A;  1M8M A;  2K7A A;  4RTX A;  1SRL A;  4AFZ C;  1JEG A;  2ROT A;  2C0T A;  2RQT A;  3EG1 A;  1K0S A;  2JM8 A;  1H92 A;  4J9E A;  2EYY A;  4A63 B;  1PWT A;  4AG1 C;  2ECZ A;  2FPE A;  1ZUK A;  4F14 A;  5EC7 A;  1BU1 A;  2DYB A;  1CKA A;  1M3B A;  2NWM A;  3NHN A;  2A08 A;  1UG1 A;  1K4U S;  1WDX A;  2DE0 X;  1CSK A;  2EPD A;  3H0F A;  2LJ1 A;  2JTE A;  2C0I A;  3REA B;  4CC7 A;  4JJB A;  3NGP A;  2LMJ A;  1SHF A;  4Y92 A;  3M0T A;  4JPB W;  1NEB A;  1UTI A;  3PVL A;  2L3P A;  1GCQ A;  4KRT A;  1HD3 A;  1KFZ A;  3VS0 A;  2X3X D;  2P4R A;  2CRE A;  1UE9 A;  1ARK A;  1OV3 A;  2DJQ A;  4LNP A;  1CKB A;  3U23 A;  1AZE A;  4IIO A;  1WXB A;  1WIE A;  2LJ0 A;  2VVK A;  5HCK A;  4CC3 A;  2I0N A;  2RQU A;  1K0X A;  1NEG A;  4RTZ A;  5FWC A;  4CC4 B;  1WI7 A;  5FW9 A;  4JJC A;  2RQV A;  4ORZ A;  3EHR A;  1W6X A;  2D0N A;  4AFU C;  2L2P A;  2BZ8 A;  2GQI A;  1T3S A;  2FG0 A;  1QKX A;  2HSP A;  4RTV A;  2O88 A;  3QWX X;  1G2B A;  4AFQ C;  3PE0 A;  1MV3 A;  1GCP A;  2J6F A;  3I5R A;  2D8H A;  5I11 A;  1YWO A;  2DIL A;  1Z9Q A;  2CH4 A;  2KRS A;  1B3Q A;  5L23 A;  2VWF A;  4OMM A;  3M0P A;  1I07 A;  1M3A A;  1ZUY A;  3ULR B;  1X43 A;  2J6K A;  4F17 A; 
#chains in the Genus database with same CATH topology
 2KRM A;  3QYH B;  1C1A A;  3H41 A;  3G4S A;  2E3I A;  1OOT A;  5HY6 A;  2JJ9 A;  1OEB A;  7AT1 B;  1PKT A;  3E2U A;  1TG0 A;  3PIP A;  1MV0 B;  5GAM h;  3EH1 A;  2M0O A;  4PJO B;  3OYY A;  2DBK A;  2EJG A;  4C92 E;  3INZ A;  2HKN A;  2XKO C;  2HKQ B;  4J7I A;  2HDA A;  2DRK A;  3M9Q A;  1LVK A;  2AT1 B;  3V8K A;  8AT1 B;  1UFF A;  2FPD A;  3UPU A;  4F16 A;  1OZ2 A;  2XD0 A;  1YJ9 T;  4XTV A;  2M0Y A;  2VXF A;  3PT9 A;  1EZZ B;  2FVU A;  2DTI A;  3CCQ T;  4XTX A;  4XAX B;  2ABL A;  4EDU A;  3CQT A;  2PU9 B;  3FRN A;  1KK7 A;  2QAZ A;  2JW4 A;  2F5K A;  1ZUU A;  2IG0 A;  5KYY B;  5CKF A;  1WQ7 A;  4GY5 A;  2DF6 A;  2GQV A;  1YI2 A;  4HT8 A;  4A4F A;  1K9A A;  3HRT A;  3SEM A;  2NUP A;  3L2Q A;  2RHX A;  3I56 Q;  3M4G A;  3VS4 A;  1SPK A;  3EH2 A;  3I5S A;  3RMQ A;  3CBP A;  2KSS A;  3C94 A;  3CC4 T;  3N5B B;  4M75 G;  2RJE A;  2LX7 A;  2ZCF B;  3CCV T;  3VS6 A;  1UGP B;  1M4Z A;  3I56 A;  2DXB A;  2FHD A;  1AOJ A;  2VKN A;  4PJJ A;  3LX7 A;  2H8H A;  2O4X B;  2YT6 A;  4DOW A;  1G3W A;  3CCL Q;  2FEI A;  9ATC B;  1WYX A;  1BI3 A;  2ZAE A;  2HL5 C;  1PC0 A;  3M0Q A;  1T0J A;  3BDL A;  5GAO p;  3CC7 T;  4E7I A;  2KEA A;  4BI4 A;  3RKY A;  3CCL A;  2DL3 A;  1RAF B;  1WHK A;  3DB4 A;  2P84 A;  2E64 A;  3TU4 K;  1J3T A;  3CCE Q;  1KC8 C;  2DRM A;  1UHC A;  1YP5 A;  4PJO G;  2DBM A;  4ZN3 A;  2LCL A;  5GAN 6;  3G1J A;  1KC8 R;  1M90 C;  2HNI A;  1N8R U;  2RJC A;  5IN1 A;  2K79 A;  3LYI A;  1K1Z A;  1K8A C;  3C0C A;  1BK2 A;  2RI2 A;  3FDR A;  2KVQ G;  1BIA A;  3L2Z A;  1UEC A;  2LCC A;  4Z8A A;  3L42 A;  4DEX A;  1M90 R;  1NE8 A;  3H6Z A;  4C8Q E;  1WFW A;  2OAU A;  4JS5 A;  2JM9 A;  5KYW A;  1X2Q A;  4AFS C;  1K8A R;  3QKJ A;  4L6V 5;  1W70 A;  1M2V B;  2CP6 A;  2YLC A;  1UGV A;  2QG9 B;  1BBZ A;  1W2B P;  3VRY A;  4XTZ A;  3OQ5 A;  5IHK A;  4E7S A;  1SG5 A;  4PJL A;  3JSC A;  3NFC A;  1VQN Q;  3EG0 A;  2IVW A;  4C92 D;  1YN8 A;  2DIG A;  3JCM e;  3M58 A;  5CQX A;  5A0D A;  2MAM A;  2B8A A;  3LLR A;  3A8M B;  1Q81 U;  1JO8 A;  1OX9 A;  3LH5 A;  3NTI A;  1I4K 1;  4XK8 E;  1YIT Q;  4QQD A;  5CVI A;  2DJZ A;  3JRZ A;  2YRD A;  1RAA B;  3JCM c;  2F2W A;  5I2M A;  1ABQ A;  1K76 A;  3OYG A;  1D1C A;  4KT0 E;  2KDS A;  5I22 A;  2EAY A;  2HL3 A;  4JRQ A;  3I56 T;  1RL2 A;  1WX6 A;  4C92 F;  3VYG A;  2DEU A;  2RMO A;  4NS5 A;  4O5V A;  2DFU A;  3BW1 A;  3VV0 A;  4B9X A;  3V8L A;  4EMK B;  2JTF A;  2PTK A;  3CCL T;  4LXC A;  2CZ7 B;  3JCM f;  3URG A;  1SRM A;  4OF1 A;  1QVP A;  5KYX B;  2LQN A;  3X24 B;  3CMA A;  5CIU A;  3RDV A;  3F70 A;  1HSQ A;  5CAI A;  2EYZ A;  5LJ3 j;  1G83 A;  1Y57 A;  2PNI A;  1G8X A;  2K5L A;  4RTW A;  1WPY A;  3D7S B;  2O2O A;  1OU8 A;  1R0C B;  5FU7 B;  1Y96 A;  2ZZD A;  1C6V X;  4LUE A;  4MZP A;  2CUD A;  2K6D A;  3THK A;  2L5Q A;  1MNE A;  4MZM A;  4M78 E;  4LD6 A;  2D8J A;  1WNL A;  4AT1 B;  4FW2 A;  2KY9 A;  2JUF A;  2HSE B;  1QVG A;  2L0A A;  2HAX A;  1VQK Q;  2GNC A;  4LE9 A;  1OZ3 A;  1AVZ C;  1PCX A;  1PNJ A;  1PD1 A;  1M8M A;  2LC4 A;  3R6O A;  1JEG A;  3ER0 A;  2C0T A;  2RQT A;  3OYN A;  4A63 B;  1PWT A;  4ZGE B;  2FPE A;  4JDS A;  2YLB A;  5EC7 A;  3M54 A;  4F7U F;  1WDX A;  4M7D F;  1VQN T;  4L59 A;  3RKX A;  2RM4 A;  1W2B S;  4CC7 A;  2F1L A;  2LMJ A;  1SHF A;  2DVE A;  3EFS A;  3HFO A;  4PJM A;  4V2S A;  4C8Q D;  2DIQ A;  2RHI A;  3CPW P;  3VS0 A;  2HZY A;  2M1H A;  3VYH B;  5LJ3 d;  2RH2 A;  2DZ9 A;  4MMK A;  2WSE E;  5LL6 S;  3U23 A;  5GAO q;  1WXB A;  2VVK A;  5GAO l;  1MGQ A;  2LTO A;  2HD0 A;  4RTZ A;  2NUP B;  2RB6 A;  4C92 C;  3P8H A;  1LJO A;  1WI7 A;  1HXD A;  1N9R A;  4JJC A;  2AIR B;  1RAG B;  1M2O A;  3JB9 I;  3QZ9 B;  1W6X A;  4AFU C;  2L2P A;  5GAN e;  2BZ8 A;  3FC3 A;  1B7T A;  4QKU A;  5LJ5 j;  3CMA T;  4ZN1 A;  3DKM A;  3QWX X;  4M7A F;  3H9N A;  3M4Y A;  1D0Z A;  4M77 F;  1YBY A;  1Z9Q A;  4EMK C;  2CH4 A;  1YIJ A;  1MND A;  1I07 A;  3OBY A;  3L1A A;  4KGX B;  2RHY A;  2J6K A;  4F17 A;  1I0C A;  3JCM h;  2HEQ A;  4A4H A;  5DLQ E;  1N6A A;  4BDZ A;  2E5Q A;  1Q7Y C;  1VQL Q;  1Z9Z A;  1Q81 C;  3IQL A;  2VXE A;  4PNO A;  1AHJ B;  2A3L A;  5LJ3 g;  2ZPG B;  3CCU Q;  2RF0 A;  2RJF A;  2LNH B;  4RTY A;  1Q7Y R;  5FU7 C;  2A28 A;  2KT8 A;  1Q81 R;  2K3X A;  2JZ2 A;  2F2X A;  2B86 A;  4N4H A;  5ECA A;  2A0F B;  1R0B G;  3PMI A;  1HK9 A;  4N4I A;  5IT9 E;  1QCF A;  1AT1 B;  1GRI A;  2DYI A;  1VQK T;  2O01 E;  5KYN A;  2FO0 A;  3FIF A;  2WSC E;  1U1S A;  1PSF A;  5IH2 A;  1YCS B;  1QWF A;  5L8R E;  3LGF A;  1E7O A;  3G71 Q;  4RKU E;  3CD6 Q;  1SHG A;  1BYM A;  1NYG A;  2DL7 A;  4DBH A;  3WXM B;  1XNI A;  3NMZ C;  1X27 A;  1I1J A;  1X75 C;  4M78 D;  5GAM j;  1UJ0 A;  2V8K A;  3CCQ A;  5LJ5 d;  2CT3 A;  5DM7 R;  3JCM X;  3JAM E;  4C92 A;  2DVJ A;  1ZSZ C;  1RLQ C;  2KXC A;  4Y28 E;  2X4Y A;  4Z88 A;  1NPP A;  3QWY A;  4M78 B;  4PLI A;  3JB9 G;  2CH4 W;  2KMT A;  2J06 A;  1W1F A;  3J7A F;  3HRU A;  2K3B A;  2EGC A;  2PQW A;  1RI9 A;  2K9G A;  1K8A U;  3UAT A;  3QJY A;  4NOY A;  2DXU A;  4HCZ A;  3DLM A;  2PUO B;  1TU0 B;  3FB9 A;  2RK1 A;  2NYS A;  3KUF A;  2G3R A;  3EAE A;  3CME Q;  5GAN 3;  3CPW S;  3MP6 A;  4OB1 B;  2EJF A;  4BI3 A;  2KNB B;  3OYJ A;  4NL2 A;  3OMC A;  3UA6 A;  4J9I A;  1TUG B;  1HYO A;  2OTL Q;  2CSQ A;  2K2V A;  4IKF A;  3GLX A;  1KG1 A;  4WF2 A;  1KSW A;  2X4X A;  1PM3 A;  1JQQ A;  4X34 A;  4C8Q C;  2RO0 A;  8ATC B;  4OMQ A;  1C0M A;  3TCJ A;  1KQS P;  3OY9 A;  5KYX A;  3ASK A;  4GLM A;  1M3C A;  1O75 A;  5CKD A;  3EGU A;  1D1B A;  3HHT B;  3O5Z A;  1NLP C;  1RUW A;  2OTL A;  3UWN A;  4BB7 A;  3G6E Q;  1U06 A;  4HT9 A;  1TUD A;  3PIO A;  5LJ5 g;  1PSE A;  1JJ2 P;  4FW1 A;  3VS2 A;  3GNF B;  1UB4 A;  4BE0 A;  3CC7 A;  2DTO A;  4M75 F;  4E7H A;  3Q1J A;  3WVE B;  2YSQ A;  1RAE B;  1OUL A;  5A0L A;  1VQL T;  5FWB A;  5IHN A;  2H3J A;  1TSF A;  3LH0 A;  5GAM d;  2DXT A;  5EG2 A;  1JU5 C;  1Y96 B;  2L3S A;  3CCU T;  1NJI U;  1IGQ A;  1BB9 A;  4A4K A;  4PKC C;  3OA6 A;  3MEV A;  2R5M A;  4JRP A;  4BI8 B;  2MIO A;  4QQ6 A;  1UUE A;  1WHL A;  4OB0 B;  1MMG A;  2V1R A;  2Y4Y A;  2K4Y A;  5A2Q E;  1VQP Q;  2QK0 A;  1LPL A;  2KBT A;  4E7K A;  2M51 A;  3WVD B;  4KUD K;  2EGE A;  3I9Q A;  5GAN h;  4BE1 A;  2CDT A;  3G71 T;  4RTU A;  1ZSZ A;  3CD6 T;  1VQP A;  4PJO F;  2RHU A;  4EIK A;  2LCS A;  5IHI A;  2EYX A;  3GNG A;  1GXI E;  3OS5 A;  1QLY A;  1LNX A;  1ZQ1 A;  3V7C A;  2DL5 A;  2EVR A;  1AD5 A;  2V8J A;  4DEY A;  4YTL A;  3LW5 E;  2L8D A;  1ZHI A;  1SEM A;  3LGL A;  3OYC A;  4FYW B;  2RK2 A;  2PVO B;  1WJS A;  4DBF A;  1SSH A;  1WJQ A;  1WHH A;  3M59 A;  5GAM g;  4C8Q A;  4FCY A;  1JXM A;  5D6W A;  4M78 C;  1YHQ Q;  1T3L A;  2DAQ A;  3QXE B;  2QYZ A;  1VQM Q;  1VQ6 Q;  4HVU A;  3CME T;  1KQ2 A;  1AWW A;  1OI1 A;  2L3Q A;  2JMC A;  4KGZ B;  2D1X A;  1MMD A;  2AKK A;  3CPF A;  2ZPB B;  2VUB A;  2X3W D;  2LZ6 B;  4A4G A;  2X9H A;  2OTL T;  1BKB A;  1VQM A;  2K57 A;  1VQ6 A;  1WQW A;  3OYD A;  2W0Z A;  2JS2 A;  4B6M A;  1UGQ B;  2ROL A;  4KUL A;  1X69 A;  4ESR A;  4NL3 A;  2D6F A;  2OI3 A;  4BE2 A;  4JLI A;  3VJP A;  4F7U E;  1KQS S;  4MZT A;  4M7D E;  1F1B B;  5GAN 4;  1Y71 A;  2XIC A;  3CC2 Q;  5GAN 7;  1FYN A;  3A8L B;  4JRK A;  3M55 A;  4J6Y A;  4MML A;  1M30 A;  4C0F A;  2P0P A;  2XK0 A;  1H8K A;  3CXC P;  5KH6 A;  4EMG A;  2DO3 A;  3VS3 A;  2YUP A;  2EQI A;  1VQ7 Q;  1M9S A;  1JJ2 S;  1S72 Q;  2L3R A;  3BE3 A;  3CCE A;  3VUB A;  4OML A;  1FMK A;  4C0Z A;  3LWI A;  3OMG A;  3T9N A;  5I21 A;  1PRL C;  1I81 A;  1RAH B;  4P5N A;  1RAB B;  1S72 A;  2EQU A;  3SHW A;  4C0G A;  2SEM A;  3M0R A;  1YJW Q;  1VQP T;  2A36 A;  2SRC A;  2KT1 A;  3OSS C;  4B9W A;  1M1G A;  2M16 A;  4GLK A;  1ZA2 B;  2K7A A;  4M7A E;  1SRL A;  3ZBD A;  2IPO B;  3MKD A;  4M77 E;  5CR2 A;  3EG1 A;  1H92 A;  2E6N A;  2R57 A;  2K5I A;  4AG1 C;  2QTV A;  1IHV A;  4XU1 A;  3MHX A;  2DYB A;  1MMA A;  1Q7Y U;  1M3B A;  1UEB A;  3ZFJ A;  2A08 A;  2XHC A;  2XDD A;  4M78 A;  2DE0 X;  3CCS Q;  2LJ1 A;  3HFN A;  3OB9 A;  4Y92 A;  1VQN A;  3I55 Q;  5CKE A;  3OYE A;  1NEB A;  2ZPE B;  4C92 B;  4BD3 A;  4KRT A;  1HD3 A;  4MDW A;  5AYF A;  1YIT A;  5LJ3 f;  2X3X D;  4ATO A;  2CRE A;  2MMP A;  1ARK A;  1OV3 A;  2DJQ A;  1CKB A;  4IIO A;  4ME7 A;  3I55 A;  1NJI C;  2E10 A;  1WIE A;  1YHQ T;  1VQM T;  1VQ6 T;  1BIB A;  1JBM A;  5FWC A;  3S6W A;  4CC4 B;  5FW9 A;  3C4S A;  4BY6 B;  4QVC A;  4HCC A;  5GAN 5;  1NJI R;  3EHR A;  1QVF P;  1QQJ A;  3MET A;  2GQI A;  2FYK A;  2MWO A;  4O6J A;  2O88 A;  5GAO m;  1G2B A;  4ELY C;  2CP5 A;  1MV3 A;  2VGM A;  2YHT A;  4N4G A;  3SWN C;  4CI0 C;  2QDY B;  4OMM A;  2R5A A;  1QCO A;  3ULR B;  1KQ1 A;  3CCE T;  2KI7 A;  2J05 A;  1Q86 U;  1GFD A;  2PZ1 A;  3QBY A;  3JB9 H;  1WLP B;  3RR6 A;  3AHU A;  3EGD A;  4J83 A;  1VUB A;  3JV3 A;  1KIK A;  4LN2 A;  3CXC S;  1S72 T;  2P0K A;  1OPK A;  3P8B B;  5GMK e;  5AT1 B;  4D6W A;  1ABO A;  1AWX A;  4FYV B;  2F69 A;  1BI0 A;  1QP2 A;  4M7D D;  1WGS A;  2CKK A;  4M4Z A;  3MJX A;  4AG2 C;  4IUQ A;  2BKD N;  4LD9 K;  2V26 A;  4PJN A;  3V8J A;  2LQW A;  2EKH A;  2MPX C;  3REB B;  3CCR Q;  3OYL A;  1NG2 A;  4R0K A;  3JCM P;  1YJW T;  2RPN A;  3CCM Q;  1VQK A;  3NTH A;  5GAO n;  1VYV A;  2E3H A;  2CZ0 B;  4F7U B;  4M7D B;  1AEY A;  3V7R A;  5HKC A;  3CBO A;  3CBM A;  3OW2 P;  4XTY A;  1U8R A;  2DTH A;  5HK3 A;  2YDL A;  2RHZ A;  3HSB A;  3CCR A;  1Y0M A;  1ZSZ B;  3V7S A;  2QA4 Q;  4C5H A;  1S1N A;  4M75 E;  2WAC A;  2C06 A;  3M0S A;  5LJ5 f;  3G7Z A;  4IUT A;  2O9V A;  4J9F A;  4XTU A;  1FX7 A;  1NBE B;  4FL6 A;  1ZLM A;  1YIT T;  2FRY A;  2ZPF B;  3CCS T;  2HQX A;  4ZGJ B;  2RQR A;  4C92 G;  3OS1 A;  4X1V A;  3OYM A;  1I5L A;  3I55 T;  4GBQ A;  2PVG B;  4M7A D;  3E9G A;  4Z89 A;  2K2M A;  1P92 A;  4M77 D;  4JJN K;  3ZEH A;  2EGA A;  4BDY A;  5J39 A;  3FLG A;  2KYM A;  2BZX A;  2A37 A;  4C8Q B;  4XU2 A;  3A1P A;  1G3Y A;  2AKL A;  2G6F X;  2ED0 A;  3M53 A;  1Q82 U;  3A8G B;  3AT1 B;  2BTT A;  1QMC A;  2JT4 A;  4ZNX A;  4M7A B;  3E1S A;  1R77 A;  2DX1 A;  1ZBJ A;  4K11 A;  1UJY A;  3SWN A;  4M77 B;  2GTJ A;  3OBW A;  4BUG A;  2AHJ B;  4C5G A;  2RNA A;  2MCN A;  1U1T A;  4QW2 A;  4PJO E;  2VAS A;  1WHM A;  4IUR A;  4BY6 C;  2M9U A;  5GJV B;  4D8K A;  1QP3 A;  1VIE A;  1EFN A;  4OGC A;  2GCX A;  4KGV B;  2QAS A;  3HPW A;  2JVV A;  3BFM A;  3TSW A;  1IO6 A;  1W2B A;  1M8V A;  2R58 A;  3VS7 A;  2YRV A;  2OJ2 A;  4J9H A;  2BIV A;  2F5T X;  5J26 A;  1X01 A;  4D8D A;  4PFP A;  3PMT A;  1BCM A;  1VQ9 Q;  2LVM A;  1VQ5 Q;  4RUG A;  4ANJ A;  4OMP A;  5GAM f;  2NUZ A;  3L2V A;  2KYB A;  2YUN A;  2RI5 A;  1XJW B;  1N9S A;  3MPU B;  1VQL A;  1UDL A;  4CRI A;  4J9D A;  2DA9 A;  4EMH A;  1RLP C;  3FJ5 A;  2BE9 B;  4N0A C;  2DER A;  5IXB A;  3GBQ A;  1OQK A;  3CCU A;  1VQ5 A;  1EIF A;  2JS0 A;  3E9F A;  2YUO A;  2ATC B;  2FB7 A;  1NLO C;  4HKE A;  4PFO A;  3SD4 A;  2J7I A;  4FM4 B;  3CCR T;  3GPL A;  3CCM T;  2DKG A;  1V29 B;  2LT1 A;  3RBB B;  4C5I A;  1MUZ A;  2GFU A;  5KCH A;  1GBR A;  3S3M A;  2ENM A;  3G71 A;  1QKW A;  4M7D C;  3CD6 A;  2Z0W A;  1IB8 A;  4OVA A;  2MF2 A;  2QA4 T;  3EFR A;  3JCM g;  2OTJ Q;  3OW2 S;  2QDL A;  4RG8 A;  2GGR A;  3KFV A;  2OX7 A;  3HL8 A;  2MOX A;  4FSS A;  3SB2 A;  4E2F B;  1UGR B;  1I8F A;  3DLL A;  2K5F A;  1Q86 C;  2XID A;  1TS9 A;  4HVV A;  3EFO B;  1B34 A;  4J6X A;  4C8Q G;  5GMK h;  1PG5 B;  5GAN j;  2EWN A;  3HP9 A;  1Q86 R;  1U5S A;  5KE3 A;  3M57 A;  5I2S A;  1MMN A;  1KD1 C;  3RKW A;  2CP7 A;  1RAD B;  4M75 D;  3L2W A;  3QPH A;  3JCM Q;  4DBQ A;  1HJD A;  2O31 A;  1VQ4 Q;  4OGE A;  1PRM C;  3CME A;  3TRE A;  5M9O A;  3JCM b;  3LWH A;  1GCQ C;  2X51 A;  2X4W A;  4ZTF A;  3CC4 Q;  4PL6 A;  1KD1 R;  4M7A C;  1YNZ A;  4M77 C;  1VQO Q;  3PVQ A;  1Y07 A;  1VQ4 A;  2COZ A;  4J9B A;  3RMS A;  3MP8 A;  2IIM A;  1ZSG A;  2YUQ A;  2CP2 A;  1U3O A;  4EPC A;  2COY A;  2CS7 A;  3HTR A;  5FRN A;  2GFA A;  3G4S Q;  2DD4 A;  5CKH A;  4E47 A;  4N0A A;  3G6E A;  3TEE A;  2DL4 A;  3A5Z B;  2VGN A;  2LT4 A;  3BDU A;  3I35 A;  2AK5 A;  1VQ9 T;  2YRC A;  4HXJ A;  4PJO D;  4LDW A;  1VQ5 T;  5FLX E;  2KAF A;  1H3H A;  5IXF A;  2RI3 A;  3EGD B;  3CPW A;  5GAN 8;  4IUP A;  3PNW C;  2ZPI B;  2F2V A;  2KRO A;  3UA7 A;  4Y91 A;  2QQR A;  4LUD A;  3GOX A;  2NUT A;  4FU6 A;  4F7U A;  5HK0 A;  4M7D A;  1Q82 C;  3QHS A;  3H0I A;  1WJR A;  2MK5 A;  2E41 A;  1AZG B;  3JCM J;  1M1K U;  2DLP A;  1B07 A;  5GAN d;  2HMA A;  2WSF E;  2KQW A;  4AFZ C;  2RJD A;  4J7F A;  1VOM A;  5KCO A;  1Q82 R;  3UT1 A;  1M1F A;  2DD5 A;  4F04 B;  2EYY A;  2FZG B;  1FMV A;  4QQG A;  1FWZ A;  4A4E A;  2EKO A;  1BU1 A;  2YWW A;  3QSU A;  2VV5 A;  2QQA A;  2OTJ T;  2NWM A;  3NHN A;  1UG1 A;  2QTX A;  4M78 G;  1Y7X A;  2EPD A;  2RD1 A;  3H0F A;  3QDR B;  5C0M A;  3JCM W;  3REA B;  1O9S A;  3NGP A;  3M0T A;  6AT1 B;  1XTD A;  1YI2 Q;  3OYH A;  2GF7 A;  1UTI A;  3PVL A;  4II1 A;  2L3P A;  2MWP A;  1GCQ A;  2VC8 A;  1G3T A;  2H3E B;  5FRM A;  4M7A A;  4ZGD B;  2P4R A;  1UE9 A;  4M77 A;  3BY7 A;  2LRQ A;  5HCK A;  1QVG P;  1FXX A;  4CC3 A;  2RQU A;  3SFM A;  1K0X A;  2A7Y A;  1NEG A;  2JOY A;  5DY9 A;  3CCJ Q;  2JTM A;  1YHQ A;  2E70 A;  1FMW A;  5GAN g;  1VQ4 T;  1WZO A;  4C5E A;  4OB2 B;  4MDX A;  2RQV A;  2CP3 A;  2Y4X A;  5DLO A;  2LNV A;  3QJ6 A;  3SWN B;  4DA4 A;  3MP1 A;  1T3S A;  2FG0 A;  3X25 B;  1QKX A;  2HSP A;  2X35 A;  3CCJ A;  3EG9 A;  3QG1 A;  4PFZ A;  5IAY A;  1VQO T;  1RI0 A;  4HA8 A;  1H64 1;  4FSX A;  3S3N A;  3G6E T;  3TQ7 P;  1GCP A;  2D8H A;  2PVD B;  1XQH A;  4RCC A;  3RER A;  1B3Q A;  4QVZ A;  1TWB A;  5L23 A;  4M75 C;  1NPR A;  3G4S T;  1ZUY A;  2DZC A;  1X43 A;  3CC2 A;  5FU6 C;  3EG2 A;  3OYF A;  4R56 A;  3A8H B;  2HCK A;  3TVT A;  1VQ8 Q;  3JB9 J;  4J6W A;  1ZX6 A;  3GIB A;  1XOV A;  2LQ8 A;  3A98 A;  2V8I A;  4FT4 A;  1K73 U;  1OX8 A;  4X9D A;  1A0N B;  1NYF A;  1VQ7 A;  4CC2 A;  3VKI A;  1VA7 A;  1M5Q 1;  1TUC A;  5LJ3 e;  1VQ8 A;  4X9C A;  1Q95 G;  1V76 A;  3J80 E;  2DL8 A;  3JCM V;  5GJW B;  1SKU B;  2RQW A;  3P8D A;  4PK4 A;  2NLU A;  4KH0 B;  1YCY A;  1DJ7 B;  5CK9 A;  3PFS A;  1JB0 E;  4E7J A;  5FRO A;  1T0H A;  4PJO C;  4A53 A;  1YJW A;  4XTW A;  4UC4 A;  2AZS A;  1D3B A;  2EIF A;  2EBP A;  1KQS A;  5D7U A;  2DET A;  1PD0 A;  2EW3 A;  1EX4 A;  4E6R A;  2LQK A;  2VB6 A;  2FL7 A;  2MI6 A;  2LDM A;  2GBQ A;  5KYU B;  2K3Y A;  2RA2 A;  3FEO A;  1GL5 A;  3EFO A;  1AWJ A;  1D09 B;  3L2U A;  2DK3 A;  3X26 B;  4JJD A;  1JJ2 A;  2E5K A;  1WXU A;  3CCS A;  3H0H A;  3EG3 A;  3UF4 A;  3X28 B;  1YI2 T;  2CZ6 B;  2LP5 A;  3L2R A;  5J3B A;  1RAI B;  1TOV A;  1G5V A;  1K9M U;  1B34 B;  4HVW A;  5GMK m;  2HQH A;  2MYS A;  4J5Y A;  2DMO A;  3EGX B;  1IHW A;  1E6H A;  4HCB A;  3C95 A;  3M56 A;  4DOV A;  4J9G A;  4DQ2 A;  3CCJ T;  2P0Q A;  1QWE A;  2XG8 D;  4RMO A;  4M75 A;  4WTO B;  1QVG S;  2DNU A;  2EFI A;  4QT7 A;  4C0D B;  2XDP A;  1M1K C;  2JMA A;  1SSF A;  4L5G A;  3RIR A;  2ZGW A;  1KJW A;  4VUB A;  2BZY A;  2J6O A;  2QI2 A;  3CMA Q;  1D0X A;  3PGG A;  3CC2 T;  2CSI A;  1M1K R;  2LJ3 A;  2DPP B;  4OMN A;  2FPF A;  2COW A;  2GTO A;  2M02 A;  1WXT A;  4E7L A;  1VYT A;  4XQ3 A;  3QDF A;  5LJ5 e;  3TSZ A;  1VQ7 T;  1LCK A;  4J9C A;  1BCO A;  4R55 A;  2QQB A;  2QQS A;  1VQ8 T;  2CP0 A;  4RCB A;  2XMF A;  2JN0 A;  2KGT A;  1PKS A;  1KD1 U;  4PLL A;  4PJO A;  1X2K A;  2JXB A;  1AWO A;  3VS1 A;  4LDX A;  3SDZ A;  2HBW A;  4OB3 B;  1R8O B;  4ELZ C;  3VUZ A;  1I5O B;  3HRS A;  2NUT B;  1GFC A;  2D9T A;  1YFN A;  1IRX A;  4JLG A;  3MEW A;  1QCN A;  1KHI A;  1G3S A;  1YWP A;  1TXQ A;  3OYK A;  3O8V A;  2KRN A;  2KXD A;  3CCM A;  4JS4 A;  2QGG A;  2RN8 A;  1E6G A;  2ESW A;  2OAW A;  1WA7 A;  1OU9 A;  1V1C A;  2CGH A;  1BI1 A;  2QEX Q;  4J8O A;  1W4S A;  2FRW A;  5GMK l;  1GBQ A;  1YJN Q;  3M0U A;  4HCK A;  3OYB A;  2PUK B;  3ZL7 C;  1VYU A;  3RES A;  2QA4 A;  3MEA A;  1RAC B;  2EYW A;  5KYY A;  2E65 A;  3EHQ A;  3QII A;  3CXC A;  4QVD A;  2QEX A;  3JB9 D;  2KE9 A;  4IIM A;  1UGS B;  1YJN A;  4FIB A;  4BAC A;  1PHT A;  3OS2 A;  2CUB A;  5GAM e;  1K73 C;  2DEQ A;  4OMO A;  3NPF A;  3QUI A;  5KE2 A;  5LJ3 h;  2CT4 A;  2JNG A;  2DXC A;  3VRZ A;  5GMK i;  3OYI A;  2W10 A;  2EJ9 A;  2VYT A;  3M5A A;  1SF9 A;  4JZ4 A;  1K73 R;  1N8R C;  3MO8 A;  3H8Z A;  2P4T A;  2O4X A;  4OP0 A;  3JB9 F;  1NM7 A;  4LDY A;  2CYZ B;  2D0Q B;  2E4H A;  5GAN 2;  1IRE B;  4TVR A;  1QVF S;  2E12 A;  2O9S A;  4RTT A;  1YIJ Q;  4C8Q F;  1N8R R;  3E19 A;  2AZV A;  4C0D C;  1N5Z A;  1TTH B;  3EG9 B;  1IGU A;  5GMK j;  3JCM d;  2KR3 A;  4E7Z A;  2C0O A;  5GAO r;  1JXO A;  1VIF A;  4KH1 B;  2EQK A;  2BUD A;  1M27 C;  3J81 E;  4IUU A;  2EQM A;  2L89 A;  4XU3 A;  3HKS A;  2FZC B;  4FYY B;  2ED1 A;  1OPL A;  4Z02 A;  1X6B A;  1D1A A;  5D6Y A;  1X6G A;  2DM1 A;  1UHF A;  3VS5 A;  4AMC A;  1VQ9 A;  2Y90 A;  2LX9 A;  3R6N A;  4JZ3 A;  3A8O B;  1K9M C;  3ME9 A;  3RNJ A;  1TH7 A;  1BI2 A;  2QQ9 A;  3MCA B;  4JUV A;  4F7U G;  4M7D G;  3GF5 A;  4WCI A;  5A0G A;  3RUX A;  5GAN f;  2V1Q A;  3C12 A;  2X4J A;  4ZTJ A;  4RG2 A;  1K9M R;  3DB3 A;  1M2V A;  2I2L A;  3VU3 C;  4RTX A;  2ROT A;  3OS0 A;  2YXY A;  1ZA1 B;  1YJ9 Q;  1QVF A;  5KYU A;  3S3O A;  1K0S A;  2JM8 A;  4J9E A;  1D3B B;  2E1H A;  4Q5W A;  2ECZ A;  1WHJ A;  3CCQ Q;  1ZUK A;  4F14 A;  5KYW B;  1LOJ A;  4KBM B;  2XDB A;  5CQY A;  2QEX T;  5CCA A;  4LDU A;  1N27 A;  1CKA A;  1YJ9 A;  1YJN T;  1MHN A;  1K4U S;  3QZ5 B;  1OYX A;  1X6O A;  1JRI A;  1QW1 A;  4FT2 A;  1CSK A;  2OTJ A;  2JTE A;  2C0I A;  2HBP A;  1KC8 U;  4KUI A;  4JJB A;  5LJ5 h;  3CEY A;  4JPB W;  3NTK A;  2BE7 D;  3EGX A;  4LDV A;  1KFZ A;  1IZ6 A;  3OSV A;  4M7A G;  1M90 U;  4M77 G;  5D6X A;  4LNP A;  1AZE A;  1KHC A;  3GP8 A;  1ACM B;  5CKB A;  2LJ0 A;  2QXF A;  3KBG A;  3QYG B;  2I0N A;  2QGF B;  2ZPH B;  5CO7 A;  2EQJ A;  5C6S A;  4XU0 A;  4M78 F;  2E6Z A;  4DBR A;  4FYX B;  1ZBX A;  3QO3 A;  3CCV Q;  3OYA A;  4ORZ A;  4EMK A;  3X20 B;  3UDC A;  2XU8 A;  2D0N A;  1IXD A;  1WHG A;  3KXT A;  4M75 B;  2FZK B;  4IUV A;  3MEU A;  2CZ1 B;  2HQE A;  4RTV A;  2EYQ A;  3FJP A;  3CC4 A;  5FU6 B;  4AFQ C;  4OMF B;  3PE0 A;  1YIJ T;  3CCV A;  3OW2 A;  2J6F A;  3I5R A;  4A54 A;  5I11 A;  1D0Y A;  1VQO A;  1YWO A;  2DIL A;  2XI9 A;  2KRS A;  3CC7 Q;  2VWF A;  3M0P A;  2KK4 A;  1M3A A;  4JRI A;  1NZ9 A;  3PTA A;  1H3Z A; 
#chains in the Genus database with same CATH homology
 1I0C A;  2J05 A;  3EG2 A;  2KRM A;  2HEQ A;  3H41 A;  2HCK A;  1GFD A;  2PZ1 A;  3TVT A;  1OOT A;  1Z9Z A;  1OEB A;  1WLP B;  3IQL A;  1ZX6 A;  1XOV A;  3JV3 A;  1KIK A;  4LN2 A;  3A98 A;  1OPK A;  1PKT A;  1TG0 A;  1A0N B;  1NYF A;  2RF0 A;  4CC2 A;  2LNH B;  1ABO A;  1MV0 B;  1AWX A;  1VA7 A;  4RTY A;  1TUC A;  2A28 A;  2KT8 A;  2DL8 A;  2F2X A;  2B86 A;  2DBK A;  4M4Z A;  5GJW B;  5ECA A;  4AG2 C;  2RQW A;  1QCF A;  1GRI A;  2LQW A;  2EKH A;  2FO0 A;  3REB B;  1NG2 A;  4R0K A;  2HDA A;  2RPN A;  2DRK A;  1T0H A;  1VYV A;  5IH2 A;  1YCS B;  1QWF A;  1UFF A;  1AEY A;  2FPD A;  1E7O A;  2AZS A;  2EBP A;  4F16 A;  1SHG A;  1NYG A;  2M0Y A;  2EW3 A;  2DL7 A;  2YDL A;  4E6R A;  3NMZ C;  1X27 A;  1Y0M A;  1I1J A;  2GBQ A;  2ABL A;  1S1N A;  1UJ0 A;  3M0S A;  3CQT A;  1GL5 A;  2O9V A;  4J9F A;  1AWJ A;  1ZLM A;  2CT3 A;  2FRY A;  4JJD A;  2JW4 A;  2E5K A;  2RQR A;  1ZUU A;  2DVJ A;  4X1V A;  1WXU A;  1RLQ C;  2KXC A;  4Z88 A;  3QWY A;  3H0H A;  3EG3 A;  4GBQ A;  3UF4 A;  2LP5 A;  2CH4 W;  2DF6 A;  2J06 A;  1W1F A;  4Z89 A;  2K2M A;  2K3B A;  2EGC A;  1RI9 A;  2K9G A;  2EGA A;  3UAT A;  1K9A A;  4HVW A;  2KYM A;  2BZX A;  3SEM A;  2A37 A;  2DMO A;  2AKL A;  2G6F X;  2ED0 A;  1E6H A;  2BTT A;  2JT4 A;  4ZNX A;  3VS4 A;  1SPK A;  2KNB B;  3I5S A;  4J9G A;  2DX1 A;  3UA6 A;  1ZBJ A;  4K11 A;  1QWE A;  1UJY A;  4J9I A;  2GTJ A;  2CSQ A;  2LX7 A;  2RNA A;  2MCN A;  1KSW A;  3VS6 A;  2DNU A;  1JQQ A;  4QT7 A;  4OMQ A;  2JMA A;  1AOJ A;  2VKN A;  2H8H A;  1KJW A;  4GLM A;  2YT6 A;  1M3C A;  2BZY A;  3EGU A;  2J6O A;  2FEI A;  1WYX A;  3O5Z A;  1NLP C;  1RUW A;  5GJV B;  4D8K A;  2CSI A;  1EFN A;  2LJ3 A;  1U06 A;  4OMN A;  3M0Q A;  1T0J A;  3TSW A;  1TUD A;  1IO6 A;  2FPF A;  3VS7 A;  2KEA A;  2OJ2 A;  4J9H A;  2GTO A;  1WXT A;  2DL3 A;  3VS2 A;  1VYT A;  3TSZ A;  1J3T A;  4D8D A;  1LCK A;  4J9C A;  2YSQ A;  2DRM A;  1UHC A;  4RUG A;  2XMF A;  4OMP A;  1YP5 A;  5FWB A;  5IHN A;  2KGT A;  2NUZ A;  2KYB A;  2YUN A;  1PKS A;  1UDL A;  1X2K A;  2DBM A;  2JXB A;  1JU5 C;  1AWO A;  2L3S A;  4J9D A;  2DA9 A;  1BB9 A;  3VS1 A;  1RLP C;  3FJ5 A;  2MIO A;  5IXB A;  2HBW A;  3GBQ A;  1UUE A;  2K79 A;  2JS0 A;  1K1Z A;  2YUO A;  2V1R A;  3C0C A;  1BK2 A;  1NLO C;  1GFC A;  1UEC A;  4Z8A A;  2J7I A;  4DEX A;  2KBT A;  2M51 A;  2EGE A;  1WFW A;  3I9Q A;  1YWP A;  3RBB B;  2JM9 A;  1X2Q A;  4AFS C;  1W70 A;  1MUZ A;  2CDT A;  2KRN A;  2KXD A;  4RTU A;  2RN8 A;  1UGV A;  1E6G A;  1GBR A;  2ESW A;  2OAW A;  2ENM A;  4EIK A;  1WA7 A;  1BBZ A;  2LCS A;  5IHI A;  1QKW A;  1V1C A;  2EYX A;  1QLY A;  2FRW A;  3VRY A;  1GBQ A;  5IHK A;  3M0U A;  4HCK A;  2DL5 A;  2EVR A;  1AD5 A;  2QDL A;  3EG0 A;  3ZL7 C;  4DEY A;  1VYU A;  2GGR A;  1YN8 A;  3KFV A;  2EYW A;  2MOX A;  4FSS A;  1SEM A;  1JO8 A;  3LH5 A;  3EHQ A;  1SSH A;  2KE9 A;  4IIM A;  4HVV A;  1PHT A;  2F2W A;  2CUB A;  1ABQ A;  1K76 A;  1JXM A;  1U5S A;  4OMO A;  5I22 A;  1T3L A;  3NPF A;  2CT4 A;  3VRZ A;  4HVU A;  1WX6 A;  2W10 A;  1AWW A;  2L3Q A;  2JMC A;  1HJD A;  2D1X A;  2O31 A;  2AKK A;  1PRM C;  4JZ4 A;  2X3W D;  2LZ6 B;  2RMO A;  1GCQ C;  1NM7 A;  2W0Z A;  2JS2 A;  1YNZ A;  3PVQ A;  2ROL A;  1X69 A;  2O9S A;  4ESR A;  4RTT A;  2PTK A;  4J9B A;  2AZV A;  2OI3 A;  2IIM A;  1N5Z A;  1ZSG A;  2YUQ A;  1U3O A;  1SRM A;  2KR3 A;  2LQN A;  2C0O A;  1JXO A;  1FYN A;  1HSQ A;  1M27 C;  2EYZ A;  1M30 A;  1G83 A;  2DL4 A;  1H8K A;  1Y57 A;  2PNI A;  4RTW A;  3I35 A;  3VS3 A;  2ED1 A;  1OPL A;  2YUP A;  2EQI A;  2O2O A;  1X6B A;  2AK5 A;  4HXJ A;  1X6G A;  2DM1 A;  4LUE A;  2CUD A;  1UHF A;  2K6D A;  3THK A;  3VS5 A;  5IXF A;  1H3H A;  4OML A;  1FMK A;  3R6N A;  4JZ3 A;  1PRL C;  2D8J A;  2F2V A;  2KRO A;  3UA7 A;  4LUD A;  3RNJ A;  3SHW A;  2L0A A;  2SEM A;  2GNC A;  3M0R A;  4LE9 A;  4WCI A;  3H0I A;  2V1Q A;  2A36 A;  2SRC A;  1AVZ C;  1AZG B;  2DLP A;  1PNJ A;  2KT1 A;  1B07 A;  1M8M A;  2K7A A;  4RTX A;  1SRL A;  4AFZ C;  1JEG A;  2ROT A;  2C0T A;  2RQT A;  3EG1 A;  1K0S A;  2JM8 A;  1H92 A;  4J9E A;  2EYY A;  4A63 B;  1PWT A;  4AG1 C;  2ECZ A;  2FPE A;  1ZUK A;  4F14 A;  5EC7 A;  1BU1 A;  2DYB A;  1CKA A;  1M3B A;  2NWM A;  3NHN A;  2A08 A;  1UG1 A;  1K4U S;  1WDX A;  2DE0 X;  1CSK A;  2EPD A;  3H0F A;  2LJ1 A;  2JTE A;  2C0I A;  3REA B;  4CC7 A;  4JJB A;  3NGP A;  2LMJ A;  1SHF A;  4Y92 A;  3M0T A;  4JPB W;  1NEB A;  1UTI A;  3PVL A;  2L3P A;  1GCQ A;  4KRT A;  1HD3 A;  1KFZ A;  3VS0 A;  2X3X D;  2P4R A;  2CRE A;  1UE9 A;  1ARK A;  1OV3 A;  2DJQ A;  4LNP A;  1CKB A;  3U23 A;  1AZE A;  4IIO A;  1WXB A;  1WIE A;  2LJ0 A;  2VVK A;  5HCK A;  4CC3 A;  2I0N A;  2RQU A;  1K0X A;  1NEG A;  4RTZ A;  5FWC A;  4CC4 B;  1WI7 A;  5FW9 A;  4JJC A;  2RQV A;  4ORZ A;  3EHR A;  1W6X A;  2D0N A;  4AFU C;  2L2P A;  2BZ8 A;  2GQI A;  1T3S A;  2FG0 A;  1QKX A;  2HSP A;  4RTV A;  2O88 A;  3QWX X;  1G2B A;  4AFQ C;  3PE0 A;  1MV3 A;  1GCP A;  2J6F A;  3I5R A;  2D8H A;  5I11 A;  1YWO A;  2DIL A;  1Z9Q A;  2CH4 A;  2KRS A;  1B3Q A;  5L23 A;  2VWF A;  4OMM A;  3M0P A;  1I07 A;  1M3A A;  1ZUY A;  3ULR B;  1X43 A;  2J6K A;  4F17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...