1ZX6A

High-resolution crystal structure of yeast pin3 sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ypr154wp
publication title Structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zx6A00
2DYBA 2DX1A 2ABLA 2DL4A 2DE0X 1PWTA 3VS3A 2O2OA 2PZ1A 2FPEA 3H41A 2D0NA 1N5ZA 1U5SA 2A08A 2K6DA 4HVVA 1OV3A 1UG1A 2JS0A 1YWOA 2ROLA 1AOJA 1WXBA 2RPNA 1M27C 1X2QA 4ORZA 1G2BA 1NLPC 1BK2A 2BZ8A 1H3HA 1WLPB 4AFQC 5IHIA 2LX7A 1ZSGA 1ZBJA 1VYUA 2DRKA 4Z89A 1PKTA 1G83A 1H8KA 2KR3A 1FMKA 2HCKA 5HCKA 4HVUA 1JQQA 2J6KA 1UHCA 1OPLA 2KYMA 1CSKA 1QKWA 2VWFA 2D1XA 1GFDA 1PRLC 1X6GA 2X3XD 1U3OA 1M3CA 2YUPA 4ESRA 2DILA 2CUDA 5GJVB 2JW4A 1EFNA 2DBMA 2D8HA 4HVWA 4JPBW 1E6HA 2ESWA 3VS1A 1YWPA 2GTOA 2G6FX 1WFWA 2EYXA 4Z8AA 4RTTA 2E5KA 4A63B 2LJ3A 4Y92A 1WI7A 1KJWA 1A0NB 2EQIA 1B07A 2MOXA 2CH4W 1X43A 2KXDA 2AZSA 3EG1A 2LQNA 2C0OA 3M0UA 1XOVA 2EPDA 3VS0A 4F17A 1AWWA 2LP5A 1RI9A 2BZYA 3UATA 4DEXA 4KRTA 1J3TA 1X27A 4F14A 4RTYA 2W10A 1E6GA 2J05A 2KYBA 2ENMA 2NWMA 2JM9A 1WYXA 2KT8A 2YUNA 3PVQA 4ZNXA 1AD5A 1SHGA 1WIEA 3TSWA 1ZUYA 1SPKA 1HD3A 2J6OA 4R0KA 2EKHA 2J6FA 2V1QA 1KIKA 1QWEA 5FWCA 4D8DA 3I5SA 2C0TA 2EGEA 4AFSC 1YN8A 2EYYA 2RQVA 2L0AA 2M51A 2MIOA 2FO0A 2BTTA 4JJBA 2J06A 1AZEA 2JS2A 2KRMA 1GCQA 1PHTA 1SHFA 1UJ0A 1ZUKA 2O9VA 1IO6A 2KNBB 2PNIA 4RTZA 1K76A 1UUEA 4J9IA 3RNJA 2O88A 2AZVA 3NGPA 3VS5A 1NM7A 2O9SA 2AKKA 4GBQA 2K3BA 3ZL7C 3SEMA 2RQUA 2DL7A 2CSIA 2RQRA 1ZLMA 2FG0A 3RBBB 3M0SA 4AG1C 1RLQC 4JJCA 1UE9A 2EW3A 2DF6A 1M30A 3M0QA 2P4RA 3JV3A 1M8MA 5FW9A 1RLPC 1MV3A 1ABQA 2CUBA 2JT4A 2DBKA 2DL8A 2DVJA 4J9BA 1YCSB 1NYGA 1GRIA 1M3BA 5IHNA 1QKXA 1CKAA 2DRMA 2KE9A 1NYFA 1FYNA 2RN8A 4OMLA 1PRMC 3GBQA 1PKSA 1WA7A 5I11A 2KGTA 1ZX6A 2LNHB 1T3LA 2KROA 2ED1A 1GCQC 4Z88A 4CC3A 3TVTA 1JO8A 2PTKA 1SRLA 2EVRA 2VKNA 4J9HA 1TUDA 2YT6A 1YP5A 3I5RA 1JU5C 1H92A 1BU1A 2A28A 5EC7A 5IHKA 4K11A 2L3QA 1QWFA 2C0IA 2EYZA 1OOTA 4OMPA 1K9AA 1Y57A 4AG2C 1JEGA 2CT3A 1I07A 2YUOA 4RTVA 1UJYA 2A36A 1Y0MA 3SHWA 3H0FA 4OMNA 2V1RA 3EHRA 4LE9A 1GFCA 1QCFA 2K9GA 3CQTA 4CC2A 2JMAA 1AEYA 3H0HA 1W6XA 4X1VA 1K0SA 5ECAA 2W0ZA 2K79A 4J9FA 2O31A 4FSSA 4WCIA 3VS4A 2EYWA 3IQLA 4OMMA 4F16A 1LCKA 3UF4A 2KEAA 1YNZA 3REBB 3UA6A 2GQIA 1MV0B 1U06A 2FEIA 2RQWA 3VRZA 2EGCA 1TUCA 1NEBA 1WXTA 1ZUUA 2CT4A 2LJ1A 1AWXA 1HSQA 1SEMA 2EBPA 4HCKA 4IIOA 1NLOC 2FRWA 2J7IA 4J9CA 1I0CA 2H8HA 3VS6A 1JXMA 3M0PA 3VS2A 2DL5A 3PVLA 1E7OA 2K7AA 4LNPA 1AVZC 3M0RA 2GBQA 2DNUA 1SRMA 3ULRB 4HXJA 2HDAA 1OEBA 4AFZC 1PNJA 2AK5A 4QT7A 1UFFA 3REAB 3NPFA 1VYTA 2DM1A 2NUZA 3I9QA 3I35A 4CC4B 2EGAA 1QLYA 1W70A 2A37A 2ED0A 1WXUA 2L2PA 4J9DA 2DA9A 2FPFA 3R6NA 1NEGA 2K2MA 5GJWB 2M0YA 2IIMA 3LH5A 2FPDA 4RTWA 4RUGA 1UGVA 4LUEA 4DEYA 2JMCA 1CKBA 4IIMA 1T0HA 1WX6A 4OMOA 2F2WA 4RTXA 1BB9A 5IH2A 2JXBA 2RMOA 3UA7A 3A98A 1X6BA 3QWYA 3FJ5A 5FWBA 1KFZA 2CDTA 2B86A 1K4US 1I1JA 1UECA 5I22A 2VVKA 2YDLA 1WDXA 5IXBA 4LN2A 1GBRA 1OPKA 4J9EA 4AFUC 4EIKA 1TG0A 3C0CA 2KXCA 1AWOA 1V1CA 3U23A 2QDLA 2LJ0A 3NHNA 4OMQA 2DL3A 1AWJA 3EG0A 4J9GA 3O5ZA 2KRSA 2F2XA 1RUWA 1SSHA 2OI3A 1K1ZA 2CREA 2L3PA 5IXFA 5L23A 1W1FA 2AKLA 2RQTA 4LUDA 1GBQA 2JM8A 1UTIA 3VRYA 4JZ4A 1ARKA 3EHQA 1GL5A 2ECZA 3EG3A 2OAWA 1M3AA 2HEQA 2KT1A 1VYVA 1BBZA 1MUZA 2DJQA 3EGUA 3THKA 2XMFA 3TSZA 1T3SA 4D8KA 4JZ3A 3EG2A 2BZXA 1AZGB 2GNCA 2X3WD 2GGRA 1S1NA 2MCNA 2F2VA 3KFVA 2OJ2A 1X2KA 1Z9QA 2DLPA 1GCPA 2ROTA 2GTJA 1JXOA 2RNAA 2D8JA 1KSWA 1UHFA 3PE0A 2LQWA 1X69A 2DMOA 2I0NA 2RF0A 4RTUA 1UDLA 4JJDA 2YUQA 3H0IA 3M0TA 1VA7A 1B3QA 1Z9ZA 2CH4A 2CSQA 2KRNA 2LMJA 2HSPA 1K0XA 3VS7A 2LZ6B 4M4ZA 2SRCA 3NMZC 1ABOA 4GLMA 2KBTA 4E6RA 2LCSA 1NG2A 1HJDA 2SEMA 4CC7A 2FRYA 2L3SA 2YSQA 2HBWA 3QWXX 1T0JA 2JTEA
chains in the Genus database with same CATH superfamily
4XU0A 5GANj 2ABLA 2NUPB 2DL4A 4DBFA 3PTAA 2MI6A 2E65A 2K2VA 1M1KR 2OTLT 2QA4A 2JS0A 2EAYA 3CCMQ 3I56Q 1M27C 3FB9A 2EQKA 1I5OB 5IHIA 4JS5A 3G6EQ 1YJWQ 2MWPA 1PKTA 2PVOB 4FYVB 1FMKA 5J39A 4BACA 5GMKi 1UHCA 3RKYA 3KBGA 2O01E 2DIGA 2FZGB 1TUGB 1YJNT 2Z0WA 4M75A 5L8RE 3J81E 2DAQA 2XICA 3CXCP 2FZCB 4ESRA 2JW4A 1EFNA 4BI8B 5KYWA 2EJGA 1E6HA 1ZSZA 5GMKl 2EFIA 2G6FX 1MGQA 4A63B 4BE0A 2LJ3A 4Y92A 2E12A 1EX4A 1IHWA 1D0YA 1B07A 3ZFJA 3E9FA 1VQNT 2KXDA 2AZSA 1LOJA 2CP0A 1LPLA 1M5Q1 3A5ZB 3LGLA 4F17A 1Q7YR 1AWWA 4PJJA 3CPWA 2LP5A 1X27A 1NJIC 3HRSA 1E6GA 1IB8A 3EFSA 5J26A 1PM3A 1VQ7T 1AD5A 4M77D 1WIEA 1SPKA 2HD0A 3TU4K 3RESA 4OVAA 3DLLA 3C4SA 4D8DA 2AIRB 4X9DA 3HSBA 3I5SA 1VQKT 3AHUA 4AFSC 2P0PA 2MIOA 4A4FA 1PCXA 3QZ5B 1AZEA 5IN1A 2KRMA 1SSFA 1GCQA 1UJ0A 1ZUKA 3RR6A 1IO6A 2ZPBB 4Y28E 2VXFA 1VQ5T 3V7SA 3HPWA 3CC7A 5KYXB 5DLQE 4FYXB 2RHZA 2AZVA 1NM7A 1NJIU 2AHJB 2AKKA 4PJOF 3ZL7C 5A0GA 1RADB 2VGNA 4EMKA 2E1HA 5LJ3g 2CP7A 3M0SA 4AG1C 3OSSC 1UE9A 3JB9I 2DVEA 2E3HA 5GAMj 2FVUA 3I55T 1KQSS 3M0QA 3VJPA 4FIBA 1F1BB 1YIJT 4M7AF 1RLPC 1MV3A 2JT4A 2DL8A 1VIFA 1OZ2A 2DVJA 5KYYA 4J9BA 5GAN8 1D1CA 1NYGA 1GRIA 1VQMT 2DEUA 1M3BA 5IHNA 1QKXA 1CKAA 1S72A 3JAME 1FYNA 2HKNA 1ZHIA 3GBQA 4JLIA 3VYHB 5CR2A 3MPUB 2MMPA 5I11A 2KGTA 1TOVA 2DIQA 2E6ZA 5D6WA 3BDLA 1T3LA 3JCMh 5I2SA 3KXTA 2KY9A 4M78D 2QEXT 3M9QA 1H92A 5CAIA 2A28A 3G71Q 2L5QA 2CKKA 5KYNA 3CC4A 4ATOA 5GAMe 1YITA 2BE7D 2CZ7B 2C0IA 4OMPA 4FU6A 4PJOE 1K9AA 3QKJA 4AG2C 1JBMA 3QUIA 4O6JA 2YUOA 1K8AC 4RTVA 2K5LA 3I56T 3FC3A 5KCOA 4N0AC 4X1VA 1TWBA 1LNXA 2O31A 3PNWC 3G6ET 1YJWT 3P8BB 2XIDA 4C92F 2K3YA 3HTRA 1I8FA 3CCSQ 1VQLQ 4BDYA 4M7AE 4UC4A 2ZZDA 1YNZA 3CMET 3CCLQ 1VQPT 2GQIA 2O4XB 3H9NA 1G5VA 1MV0B 1U06A 2QQAA 3VRZA 1WJSA 3JSCA 4JRIA 2EWNA 1ZUUA 1Y07A 1Y7XA 2R57A 2KQWA 2FB7A 1NJIR 1U1TA 1JJ2A 1NLOC 2J7IA 3OYCA 3WVEB 1I0CA 2QDYB 3CCEA 1EIFA 1YHQT 1KG1A 1D0ZA 1JXMA 2IG0A 3V8KA 2EIFA 1C0MA 2HQHA 4L5GA 2E41A 1D1AA 3M0RA 2GBQA 1K8AU 2OTJQ 4AFZC 4VUBA 1PNJA 5KYUB 1UFFA 3REAB 1VYTA 1NPRA 3VU3C 4M7DF 5HK3A 4PJOC 4CC4B 2EGAA 5KE3A 1BYMA 2RI5A 1VQ8Q 2LQ8A 5GMKm 2FPFA 3R6NA 1NEGA 4AMCA 1KQSP 4C92E 2LVMA 4XTZA 2RHYA 2RJCA 2XI9A 4RUGA 1UGVA 4M7AC 1CKBA 3MJXA 4IIMA 4KT0E 4KUIA 3OYNA 3OYKA 3HFOA 3OYYA 3UA7A 5CKHA 3JB9H 2V8JA 3SWNA 2DTHA 3TQ7P 5FU6C 1I1JA 1UECA 2YDLA 2FL7A 1N9RA 1OPKA 2COZA 4J9EA 2KXCA 1WPYA 1AWOA 1QVGS 2E3IA 2QDLA 4NL3A 4MDWA 2DL3A 2X4YA 3VUZA 4BE2A 1K1ZA 3ER0A 5L23A 2AKLA 3S3OA 2JM8A 2MF2A 3GOXA 2DZCA 3EFOA 4M7DE 1X6OA 5J3BA 2JTMA 3JRZA 1MMGA 1M3AA 2HEQA 2QK0A 3X25B 4RMOA 1BBZA 3THKA 1IHVA 1R77A 3R6OA 4JZ3A 3EG2A 4M78E 1AZGB 1WJRA 2GGRA 3CCVA 3H8ZA 1ZQ1A 3KFVA 3GPLA 2OJ2A 3QSUA 3G4SQ 4C92C 2F1LA 3PIOA 3JCMg 1JXOA 4J8OA 3PE0A 2E10A 1VQ4Q 1X69A 2RF0A 4C8QF 4A4GA 4JJDA 4PJOB 2WSFE 2KRNA 4OP0A 3VS7A 2BIVA 5C0MA 4M4ZA 2Y4XA 3EFRA 4B6MA 4GLMA 4ELYC 2LCSA 1PD1A 1HJDA 1WJQA 4CC7A 4M7AB 2PZ1A 1T0JA 3BW1A 2RJEA 5D6YA 4JRKA 3G71T 2O2OA 1M2VB 4E7JA 2MPXC 3H41A 3CMAA 2HQEA 1N5ZA 3HRUA 1OQKA 2K6DA 4M7DC 1UGRB 4JUVA 4HVVA 1OV3A 4PFPA 4QKUA 2WSCE 1YWOA 2ROLA 1AOJA 2RPNA 4RCCA 4ORZA 3JCMP 1G2BA 3JCMW 3PFSA 1BK2A 3M4GA 4OB1B 1H3HA 2LX7A 4KGVB 1R8OB 1ZSGA 3EGXA 2DD4A 1TTHB 2DD5A 2KR3A 1VQLT 3CCST 3PMTA 1Q82C 1JQQA 1R0CB 2J6KA 2X35A 3X24B 1M2OA 4A54A 2YLCA 3CCLT 1OPLA 2KYMA 2P4TA 5GMKe 3E1SA 1Q86C 2D1XA 3CCQQ 4HCZA 4J6WA 1DJ7B 1PRLC 1EZZB 2M16A 2X3XD 1U3OA 3WVDB 2YUPA 3CPWS 1QVGP 2RJDA 2P84A 3EGDB 4B9WA 4C92B 2R58A 4II1A 1U8RA 4HVWA 3M57A 4JPBW 1C6VX 3OYIA 2LC4A 4Z8AA 1VQ6A 3A1PA 4DA4A 4FW2A 5LJ5e 2CH4W 2H3JA 3QO3A 4PKCC 2LQNA 1TU0B 2C0OA 1XOVA 5LJ3j 1Q82U 1VQ8T 1QVFP 1BI2A 1WNLA 5HKCA 3UATA 3CCRQ 3C12A 4KRTA 1N6AA 2EYQA 3INZA 1YIJQ 2J05A 2KYBA 3QPHA 1Q86U 1YJ9A 2ENMA 1RAHB 2JM9A 2KT8A 4PJNA 4ZNXA 3RERA 4C8QC 1ZBXA 4RG8A 2QQRA 1ZUYA 2E5QA 2J6OA 4C5EA 4M7DB 1U1SA 4BUGA 2EKHA 1BCOA 1MMDA 2J6FA 2V1QA 1KIKA 2QXFA 1YITT 4JJNK 3OY9A 1RL2A 2DYIA 4HKEA 5FWCA 5FLXE 3CC2A 3QDRB 2GF7A 4MZPA 2FO0A 1MHNA 2R5MA 4F7UF 2GFUA 2J06A 2JS2A 2KAFA 3M54A 3MEWA 3URGA 4LDVA 3BE3A 4RTZA 1K76A 3QZ9B 4J9IA 3CBMA 2O88A 3S6WA 3NGPA 5D6XA 3VS5A 4C0ZA 2O9SA 4IURA 3QYGB 4M77A 2K3BA 3A8GB 3JCMQ 2RQUA 1TH7A 1UGPB 2DL7A 3EG9B 3VYGA 1MMNA 3MEAA 3RBBB 1PSEA 4IUPA 4JJCA 5HK0A 4C0DB 3OYJA 4HT9A 2M9UA 1UEBA 1IREB 3G4ST 3CMEQ 1VQPQ 3X28B 5KH6A 1M8MA 3OYBA 1VQ4T 5CVIA 2L89A 2CUBA 5GANe 1FXXA 3FRNA 2LQKA 4C8QG 3E9GA 4PJOD 2RI3A 2VUBA 1UB4A 2KE9A 2PVGB 1YHQQ 1XNIA 1AHJB 1LJOA 1PRMC 4TVRA 1WA7A 1K9MC 3CPWP 3RKWA 4FT4A 1LVKA 1Q82R 2ED1A 1OYXA 3FIFA 4OB0B 1KC8C 4Z88A 4CC3A 4F7UE 3TVTA 4Q5WA 2FZKB 1SRLA 3M59A 4BD3A 2MYSA 4ZTFA 3MKDA 3PT9A 2EVRA 2EQJA 4XTVA 4M7AD 3L2ZA 1YP5A 4C8QB 4IUUA 1Q86R 5CKBA 3LYIA 4BDZA 2MAMA 2BKDN 3F70A 4NOYA 2QASA 4XTXA 2Y4YA 4DBHA 4OMNA 1V76A 2IVWA 2V1RA 3EHRA 1GFCA 2DEQA 4CC2A 3LH0A 1JJ2S 5ECAA 4MMKA 4X9CA 1V29B 3ZEHA 3OBWA 2XD0A 4A4EA 1TS9A 3IQLA 3MHXA 4OMFB 5FROA 1I5LA 2YWWA 2QGFB 1K9MU 1R0BG 4M78A 1TSFA 2QA4Q 3SWNC 3EAEA 2ZPIB 2RQWA 1KC8U 3CCQT 3L42A 2LJ1A 2CT4A 2DO3A 2NUPA 1VQOA 2ATCB 1IGUA 1N8RC 2H8HA 3QG1A 2D6FA 4NL2A 1KQ1A 4C92D 1QVPA 5LJ5d 2DL5A 3QJYA 3PVLA 4DBRA 3EH2A 2K7AA 4BE1A 1O9SA 2M0OA 3GIBA 1AVZC 3L2RA 1SRMA 1VOMA 4LXCA 1OEBA 2AK5A 2LT1A 4ME7A 1D1BA 3I9QA 5AYFA 3I35A 1WZOA 2RI2A 4ELZC 3JCMb 3V7RA 3S3MA 1I4K1 4B9XA 2NUTB 8ATCB 3CCRT 3CCUA 2A7YA 1YI2A 4DEYA 1RAIB 1T0HA 1WX6A 5GANf 3UPUA 5IH2A 2EQMA 4QQDA 2QTXA 1N8RU 4M7DD 4D6WA 2OAUA 3FJ5A 2CP3A 2B86A 2EKOA 1G8XA 2KSSA 2VXEA 5I22A 3GLXA 3JCMV 4LN2A 1KHIA 3C0CA 4LDUA 4FSXA 2X51A 1XJWB 1V1CA 4OB2B 5CKFA 4ANJA 1AWJA 3EG0A 1PC0A 2KRSA 2X4WA 4F7UG 2A0FB 4GY5A 4XTWA 1WHKA 2OX7A 3UT1A 3JCMe 4J7IA 1D3BB 4ZGEB 2LNVA 4JZ4A 1G3SA 1D0XA 1K9MR 3A8OB 2KT1A 1MUZA 2HL5C 1HXDA 1PSFA 1KC8R 2RHUA 2XMFA 2DTOA 4D8KA 1JJ2P 2PVDB 2QG9B 1MNEA 4JDSA 3ME9A 1IRXA 4F7UB 1JRIA 5GANd 3OW2A 3QBYA 3OMGA 1ZA2B 2ROTA 4MZTA 2RH2A 4KUDK 3HRTA 1MNDA 1UHFA 3CC7Q 4RTUA 1WHMA 3H0IA 1Z9ZA 4C0GA 2CSQA 2HSPA 4M75F 2HAXA 2BUDA 5GAOr 2OTLA 3JCMJ 2KI7A 5KYXA 3HHTB 2KBTA 1IZ6A 2QI2A 2WSEE 3CCJT 4E7IA 1SF9A 2G3RA 1RABB 3CBPA 4L59A 2C06A 4LDXA 2CZ1B 8AT1B 3WXMB 4QVZA 2DYBA 4C8QD 2CZ6B 4PLLA 2PQWA 4QVCA 4OF1A 3JB9G 3OBYA 1N8RR 1UG1A 1O75A 1VQ9A 1X2QA 2COWA 1NLPC 1NE8A 1YJNA 1TXQA 2JZ2A 4PFZA 2P0QA 2MK5A 4Z89A 5DLOA 1H8KA 2HCKA 5CK9A 3CC4Q 3MEUA 1YITQ 2DZ9A 2RHIA 2QA4T 1CSKA 1W2BA 3A8LB 4AT1B 1VQNA 1WHLA 4ZTJA 1G3TA 2LCLA 2LCCA 1X6GA 2JUFA 1M3CA 2V8KA 2CUDA 3RUXA 4JRQA 3QYHB 1XTDA 2ESWA 1YWPA 5GAMf 2GTOA 2EYXA 1Y96B 1YCYA 4F04B 2RHXA 2E5KA 5KCHA 2DFUA 3MEVA 1VQ7A 4HCCA 1KJWA 1M9SA 5FU7C 2MOXA 3OSVA 2XDPA 3L1AA 2K3XA 3QDFA 3EG1A 1BI0A 4Y91A 2JTFA 1QVFS 5I2MA 3LGFA 3CCEQ 2EPDA 4R56A 2O4XA 4CI0C 3DKMA 1RI9A 2BZYA 1VQKA 5AT1B 3HL8A 4F14A 3V8JA 4XK8E 2W10A 3OYMA 1K8AR 1B34B 1WYXA 2GFAA 2YUNA 3PVQA 1I81A 1Q81U 3TSWA 3OA6A 1RI0A 4R0KA 1VQ5A 1YBYA 4KH0B 5GAN6 2XU8A 4M75C 4X34A 4E7LA 1H641 4LD6A 2DK3A 4C5GA 1KQ2A 3HKSA 3X26B 5GAMd 2DJZA 3PGGA 1ZSZC 2XK0A 5KYUA 2JOYA 2EYYA 2FHDA 2R5AA 2CYZB 2RQVA 2M51A 1QCNA 2BTTA 4JJBA 2HNIA 1XQHA 2F69A 3FDRA 4P5NA 3I55A 3FLGA 1PHTA 2O9VA 1VUBA 5FU6B 2KNBB 2PNIA 2QQBA 3HP9A 3MP1A 3CBOA 1RAFB 3OYGA 1AT1B 3UDCA 1VQMA 4GBQA 5CQXA 3SEMA 1VQOT 2LRQA 4DBQA 3CD6A 3GNGA 1W4SA 2DF6A 1M30A 3HFNA 4C8QE 5C6SA 4N0AA 1BIBA 2P4RA 3JV3A 2QEXA 3J7AF 3FEOA 4R55A 5FW9A 3CC7T 4HT8A 1QP2A 4FCYA 1ABQA 5FU7B 3S3NA 2VB6A 5EG2A 1HK9A 2L3RA 1M1KU 4N4GA 1NYFA 4M75G 2RN8A 1PKSA 3CCMA 2DXCA 2H3EB 3I56A 3QJ6A 3CCVQ 3EH1A 4JS4A 2KROA 4NS5A 5GAOp 1GCQC 1JO8A 3V8LA 3C95A 1NZ9A 1B7TA 1OU8A 2VKNA 5LJ5h 1TUDA 3CCUT 2F5KA 3G6EA 1YJWA 2KVQG 2VASA 2FYKA 1BU1A 3QHSA 2JJ9A 4K11A 4MDXA 4OGEA 1ACMB 4M75B 1Y71A 1QWFA 4DOWA 1VQPA 1OOTA 5GAN2 1S72T 4EMKC 2V8IA 1G3WA 1Y57A 5KYWB 4LD9K 1JEGA 2CT3A 1I07A 2A36A 1ZSZB 3SHWA 3H0FA 4J6YA 4LE9A 4PNOA 1QCFA 2K9GA 3CQTA 4XQ3A 2JMAA 4PJOA 3P8DA 1W6XA 2W0ZA 1SKUB 4EPCA 4J9FA 3JCMX 4FSSA 2BE9B 4O5VA 4HA8A 1RAEB 1WGSA 4F16A 3CC4T 1LCKA 2KEAA 2DTIA 3NFCA 3REBB 3CMAQ 3D7SB 3RDVA 2HSEB 4BY6C 4M7AA 2DERA 2FEIA 3RKXA 3E19A 1TUCA 1WXTA 2ZGWA 3L2UA 1HSQA 4PJMA 1SEMA 1M2VA 4HCKA 3RMQA 4J9CA 2FRWA 2ZPEB 5LJ3e 1Q95G 3PMIA 3VS6A 3KUFA 3VS2A 4IUTA 3TCJA 4IUQA 1OU9A 2P0KA 2DPPB 2DNUA 2VYTA 2CGHA 3ULRB 4HXJA 2NYSA 3AT1B 1FX7A 5GAN4 1OULA 4XU3A 2E70A 2YLBA 5CCAA 4ZN3A 2RD1A 4C5HA 1W70A 2PUOB 2A37A 3CCET 3P8HA 2ED0A 2MWOA 4XTYA 1IXDA 1MMAA 2QQ9A 4E7SA 2M0YA 2IIMA 5GANh 1VQ6Q 3LH5A 1RAAB 2FPDA 3OYDA 1PG5B 4LUEA 4QVDA 2HQXA 1M1FA 2DKGA 4OMOA 2JXBA 2RMOA 3EGDA 4C92A 3A98A 2YRCA 4EMKB 4V2SA 3QWYA 5IAYA 1KFZA 1M8VA 3MP6A 2CDTA 4Z02A 1K4US 2LTOA 5KE2A 3CCJQ 4EMHA 3V7CA 2VVKA 1VQ9T 2K5IA 2DXTA 4OGCA 3CPFA 5IXBA 4FT2A 4AFUC 4IUVA 2VV5A 1YJ9Q 5KYYB 3DB3A 3OW2S 3NHNA 4OMQA 2ZPFB 4J9GA 3O5ZA 2F2XA 5LJ5f 3JB9F 1RUWA 3META 4QQ6A 2OI3A 4E47A 2CREA 5IXFA 2XKOC 3N5BB 4WF2A 4FL6A 4LUDA 4BY6B 1GBQA 2D0QB 3VRYA 2QAZA 5CKEA 2CZ0B 1GL5A 2ECZA 2OAWA 2K5FA 3CC2Q 1YFNA 1FMVA 1T3SA 5IT9E 2HL3A 4M7DA 4FM4B 2BZXA 3CXCA 3LW5E 2GNCA 1S1NA 2MCNA 2F2VA 4N4HA 2VGMA 1X2KA 1Z9QA 3M5AA 2DLPA 1GCPA 5M9OA 2JVVA 2E6NA 3OS0A 2RNAA 2EJFA 2LQWA 4E7HA 1N27A 2DMOA 2I0NA 2YRVA 1UDLA 3G71A 1IGQA 3L2WA 4E2FB 5LJ5g 2YHTA 2YUQA 4FYWB 4ZGJB 2XDDA 4A4KA 2LZ6B 4A53A 2SRCA 3NMZC 1ABOA 5LJ3f 4KGXB 3CCVT 3ZBDA 2QQSA 1NG2A 4A4HA 2SEMA 2FRYA 2L3SA 2HBWA 2DXBA 3QWXX 3EG9A 2PU9B 3LX7A 2DX1A 4EDUA 3CCSA 1VQLA 2DE0X 2VC8A 1PWTA 3VS3A 2FPEA 1C1AA 2D0NA 2X4XA 1U5SA 3CCLA 4M75D 2A08A 1W2BS 5HY6A 1WXBA 2LT4A 4KULA 3MP8A 2BZ8A 2ZAEA 1WLPB 4AFQC 1ZBJA 1VYUA 2DRKA 4JRPA 1K73C 1G83A 2F5TX 2AT1B 5HCKA 1M1GA 4HVUA 2ZPHB 1QCOA 3CMAT 2OTJA 1QKWA 4C0FA 1M90C 5LJ3d 2VWFA 1PD0A 1GFDA 4C8QA 1RAGB 3NTKA 2I2LA 1FMWA 4BI4A 1RACB 1M4ZA 3OB9A 5GAMh 2DILA 3GP8A 3L2VA 1VQ8A 3OYEA 5GJVB 3OW2P 5FRNA 3MCAB 3CD6T 2DBMA 2D8HA 3VS1A 1BI3A 3VKIA 3SWNB 1WFWA 3JB9J 4RTTA 1KK7A 4PLIA 2EQUA 5GANg 1WI7A 4M77F 1A0NB 2EQIA 4GLKA 1X43A 1VQOQ 4YTLA 2XHCA 1WHGA 3M0UA 1K73U 4J7FA 3VS0A 1HYOA 1VIEA 3NTIA 3CCMT 2E64A 1J3TA 4DEXA 3J80E 3A8MB 4RTYA 1M90U 4QW2A 3M55A 3EFOB 1VQ6T 2JNGA 2X4JA 2NWMA 3RMSA 3M4YA 1SHGA 4XAXB 4MMLA 1HD3A 2M02A 4CRIA 3LWIA 1QWEA 2RK2A 3H6ZA 3TEEA 1WQ7A 1P92A 1BIAA 2CP2A 2C0TA 2EGEA 4XTUA 3X20B 1YN8A 3CCUQ 2HZYA 2L0AA 5GAOl 1YJ9T 1UGSB 1YI2Q 4QQGA 4RKUE 3G4SA 1SHFA 2NUTA 2ZPGB 1S72Q 3DLMA 4M77E 2WACA 1VQ4A 1UUEA 1W2BP 3OYFA 5GAOn 2D9TA 3RNJA 2ZCFB 3M56A 4ZGDB 2L8DA 2JN0A 2RK1A 3G1JA 1SG5A 3CC2T 4HCBA 3OQ5A 2CSIA 2RQRA 1OX8A 1ZLMA 2V26A 2FG0A 3PIPA 1X75C 2YRDA 1ZA1B 1KD1C 2E4HA 1GXIE 1RLQC 5LL6S 2EW3A 2HMAA 4KBMB 2RB6A 2EJ9A 2RM4A 5CKDA 4L6V5 4M78F 2X9HA 3OMCA 4M75E 4BB7A 3BFMA 2DBKA 2HKQB 2Y90A 2B8AA 1YCSB 4OB3B 1Q81C 2DRMA 2DETA 3EGXB 4N4IA 4OMLA 3BDUA 2KDSA 1D3BA 3GNFB 1ZX6A 1K73R 2LNHB 1QQJA 3T9NA 2PTKA 1KQSA 3JCMf 3TREA 4J9HA 9ATCB 2CP5A 2YT6A 1M90R 3I5RA 1JU5C 5EC7A 3CEYA 5IHKA 4F7UA 3QIIA 4M77C 2L3QA 2YXYA 1KD1U 2EYZA 2OTLQ 5D7UA 3BY7A 3CCQA 1UJYA 1Y0MA 2QGGA 1JB0E 1AEYA 3LWHA 3H0HA 4XU2A 1K0SA 4PJOG 2K79A 4KH1B 4EMGA 2XDBA 6AT1B 3G7ZA 4LDWA 4WCIA 3VS4A 3FJPA 2QTVA 5GAMg 2EYWA 4OMMA 2A3LA 3SDZA 3UF4A 1D09B 3UA6A 2NLUA 3NTHA 1VQ9Q 4M7AG 2EGCA 1NEBA 2KK4A 3OS2A 3OYLA 1AWXA 1YJNQ 1M1KC 2HBPA 2EBPA 4IIOA 1QMCA 3JCMd 4E7KA 1BCMA 1G3YA 3M58A 4PK4A 5GAOq 3GF5A 5CIUA 3M0PA 3CCRA 5A0DA 5DY9A 4J83A 5GAN7 1E7OA 3OS1A 4LNPA 1YIJA 3RIRA 4PL6A 5I21A 5GMKj 1OX9A 2HDAA 1QW1A 1N9SA 2KMTA 2LX9A 4J6XA 4QT7A 4MZMA 4WTOB 4M77G 3C94A 1H3ZA 3NPFA 5A2QE 1VQNQ 2DM1A 2NUZA 3OYAA 3MO8A 1QLYA 1NBEB 1WXUA 5DM7R 2L2PA 4J9DA 2DA9A 5GMKh 2K2MA 5GJWB 3A8HB 4M78C 4RTWA 5A0LA 1UGQB 4E7ZA 2JMCA 4M77B 4FYYB 1VQ7Q 4BI3A 2K4YA 5LJ5j 2F2WA 4RTXA 1BB9A 1OI1A 5CO7A 4C92G 4RCBA 1X6BA 4J5YA 3SFMA 1Y96A 5FWBA 3VUBA 1KD1R 1QP3A 3O8VA 1VQKQ 4KGZB 5GAN3 1WDXA 4XU1A 4PJLA 3SB2A 1GBRA 3L2QA 3OS5A 4EIKA 3CXCS 1TG0A 4FW1A 3LLRA 4PFOA 4LDYA 3U23A 2LJ0A 1Q7YC 1YI2T 5FRMA 2QYZA 1SSHA 3CMEA 2XG8D 1Q81R 3SD4A 2L3PA 3Q1JA 4DOVA 1W1FA 1VQ5Q 2RQTA 4C0DC 1UTIA 1WQWA 2CS7A 2COYA 1BKBA 1NPPA 2OTJT 1ARKA 3EHQA 3EG3A 1B34A 1VYVA 2DJQA 3EGUA 1KHCA 4JLGA 5GAOm 3TSZA 1YHQA 1WHHA 1FWZA 4M7DG 2CP6A 3E2UA 1QVGA 2X3WD 4ZN1A 2K57A 3CCJA 3JB9D 4C5IA 2RJFA 3I55Q 2GTJA 2D8JA 1KSWA 1X01A 3JCMc 1BI1A 3ASKA 4M78G 2RO0A 2PUKB 3M53A 3OYHA 2GQVA 4IKFA 3M0TA 5CQYA 1VQMQ 1VA7A 1B3QA 3QXEB 2CH4A 5LJ3h 2IPOB 2RA2A 2LMJA 1Q7YU 3DB4A 1K0XA 1OZ3A 4DQ2A 2GCXA 3CD6Q 2LDMA 1QVFA 4E6RA 3UWNA 5GAN5 3VV0A 2DXUA 4M78B 4RG2A 2QEXQ 2YSQA 1WHJA 2M1HA 7AT1B 2JTEA
chains in the Genus database with same CATH topology
2DYBA 2DX1A 2ABLA 2DL4A 2DE0X 1PWTA 3VS3A 2O2OA 2PZ1A 2FPEA 3H41A 2D0NA 1N5ZA 1U5SA 2A08A 2K6DA 4HVVA 1OV3A 1UG1A 2JS0A 1YWOA 2ROLA 1AOJA 1WXBA 2RPNA 1M27C 1X2QA 4ORZA 1G2BA 1NLPC 1BK2A 2BZ8A 1H3HA 1WLPB 4AFQC 5IHIA 2LX7A 1ZSGA 1ZBJA 1VYUA 2DRKA 4Z89A 1PKTA 1G83A 1H8KA 2KR3A 1FMKA 2HCKA 5HCKA 4HVUA 1JQQA 2J6KA 1UHCA 1OPLA 2KYMA 1CSKA 1QKWA 2VWFA 2D1XA 1GFDA 1PRLC 1X6GA 2X3XD 1U3OA 1M3CA 2YUPA 4ESRA 2DILA 2CUDA 5GJVB 2JW4A 1EFNA 2DBMA 2D8HA 4HVWA 4JPBW 1E6HA 2ESWA 3VS1A 1YWPA 2GTOA 2G6FX 1WFWA 2EYXA 4Z8AA 4RTTA 2E5KA 4A63B 2LJ3A 4Y92A 1WI7A 1KJWA 1A0NB 2EQIA 1B07A 2MOXA 2CH4W 1X43A 2KXDA 2AZSA 3EG1A 2LQNA 2C0OA 3M0UA 1XOVA 2EPDA 3VS0A 4F17A 1AWWA 2LP5A 1RI9A 2BZYA 3UATA 4DEXA 4KRTA 1J3TA 1X27A 4F14A 4RTYA 2W10A 1E6GA 2J05A 2KYBA 2ENMA 2NWMA 2JM9A 1WYXA 2KT8A 2YUNA 3PVQA 4ZNXA 1AD5A 1SHGA 1WIEA 3TSWA 1ZUYA 1SPKA 1HD3A 2J6OA 4R0KA 2EKHA 2J6FA 2V1QA 1KIKA 1QWEA 5FWCA 4D8DA 3I5SA 2C0TA 2EGEA 4AFSC 1YN8A 2EYYA 2RQVA 2L0AA 2M51A 2MIOA 2FO0A 2BTTA 4JJBA 2J06A 1AZEA 2JS2A 2KRMA 1GCQA 1PHTA 1SHFA 1UJ0A 1ZUKA 2O9VA 1IO6A 2KNBB 2PNIA 4RTZA 1K76A 1UUEA 4J9IA 3RNJA 2O88A 2AZVA 3NGPA 3VS5A 1NM7A 2O9SA 2AKKA 4GBQA 2K3BA 3ZL7C 3SEMA 2RQUA 2DL7A 2CSIA 2RQRA 1ZLMA 2FG0A 3RBBB 3M0SA 4AG1C 1RLQC 4JJCA 1UE9A 2EW3A 2DF6A 1M30A 3M0QA 2P4RA 3JV3A 1M8MA 5FW9A 1RLPC 1MV3A 1ABQA 2CUBA 2JT4A 2DBKA 2DL8A 2DVJA 4J9BA 1YCSB 1NYGA 1GRIA 1M3BA 5IHNA 1QKXA 1CKAA 2DRMA 2KE9A 1NYFA 1FYNA 2RN8A 4OMLA 1PRMC 3GBQA 1PKSA 1WA7A 5I11A 2KGTA 1ZX6A 2LNHB 1T3LA 2KROA 2ED1A 1GCQC 4Z88A 4CC3A 3TVTA 1JO8A 2PTKA 1SRLA 2EVRA 2VKNA 4J9HA 1TUDA 2YT6A 1YP5A 3I5RA 1JU5C 1H92A 1BU1A 2A28A 5EC7A 5IHKA 4K11A 2L3QA 1QWFA 2C0IA 2EYZA 1OOTA 4OMPA 1K9AA 1Y57A 4AG2C 1JEGA 2CT3A 1I07A 2YUOA 4RTVA 1UJYA 2A36A 1Y0MA 3SHWA 3H0FA 4OMNA 2V1RA 3EHRA 4LE9A 1GFCA 1QCFA 2K9GA 3CQTA 4CC2A 2JMAA 1AEYA 3H0HA 1W6XA 4X1VA 1K0SA 5ECAA 2W0ZA 2K79A 4J9FA 2O31A 4FSSA 4WCIA 3VS4A 2EYWA 3IQLA 4OMMA 4F16A 1LCKA 3UF4A 2KEAA 1YNZA 3REBB 3UA6A 2GQIA 1MV0B 1U06A 2FEIA 2RQWA 3VRZA 2EGCA 1TUCA 1NEBA 1WXTA 1ZUUA 2CT4A 2LJ1A 1AWXA 1HSQA 1SEMA 2EBPA 4HCKA 4IIOA 1NLOC 2FRWA 2J7IA 4J9CA 1I0CA 2H8HA 3VS6A 1JXMA 3M0PA 3VS2A 2DL5A 3PVLA 1E7OA 2K7AA 4LNPA 1AVZC 3M0RA 2GBQA 2DNUA 1SRMA 3ULRB 4HXJA 2HDAA 1OEBA 4AFZC 1PNJA 2AK5A 4QT7A 1UFFA 3REAB 3NPFA 1VYTA 2DM1A 2NUZA 3I9QA 3I35A 4CC4B 2EGAA 1QLYA 1W70A 2A37A 2ED0A 1WXUA 2L2PA 4J9DA 2DA9A 2FPFA 3R6NA 1NEGA 2K2MA 5GJWB 2M0YA 2IIMA 3LH5A 2FPDA 4RTWA 4RUGA 1UGVA 4LUEA 4DEYA 2JMCA 1CKBA 4IIMA 1T0HA 1WX6A 4OMOA 2F2WA 4RTXA 1BB9A 5IH2A 2JXBA 2RMOA 3UA7A 3A98A 1X6BA 3QWYA 3FJ5A 5FWBA 1KFZA 2CDTA 2B86A 1K4US 1I1JA 1UECA 5I22A 2VVKA 2YDLA 1WDXA 5IXBA 4LN2A 1GBRA 1OPKA 4J9EA 4AFUC 4EIKA 1TG0A 3C0CA 2KXCA 1AWOA 1V1CA 3U23A 2QDLA 2LJ0A 3NHNA 4OMQA 2DL3A 1AWJA 3EG0A 4J9GA 3O5ZA 2KRSA 2F2XA 1RUWA 1SSHA 2OI3A 1K1ZA 2CREA 2L3PA 5IXFA 5L23A 1W1FA 2AKLA 2RQTA 4LUDA 1GBQA 2JM8A 1UTIA 3VRYA 4JZ4A 1ARKA 3EHQA 1GL5A 2ECZA 3EG3A 2OAWA 1M3AA 2HEQA 2KT1A 1VYVA 1BBZA 1MUZA 2DJQA 3EGUA 3THKA 2XMFA 3TSZA 1T3SA 4D8KA 4JZ3A 3EG2A 2BZXA 1AZGB 2GNCA 2X3WD 2GGRA 1S1NA 2MCNA 2F2VA 3KFVA 2OJ2A 1X2KA 1Z9QA 2DLPA 1GCPA 2ROTA 2GTJA 1JXOA 2RNAA 2D8JA 1KSWA 1UHFA 3PE0A 2LQWA 1X69A 2DMOA 2I0NA 2RF0A 4RTUA 1UDLA 4JJDA 2YUQA 3H0IA 3M0TA 1VA7A 1B3QA 1Z9ZA 2CH4A 2CSQA 2KRNA 2LMJA 2HSPA 1K0XA 3VS7A 2LZ6B 4M4ZA 2SRCA 3NMZC 1ABOA 4GLMA 2KBTA 4E6RA 2LCSA 1NG2A 1HJDA 2SEMA 4CC7A 2FRYA 2L3SA 2YSQA 2HBWA 3QWXX 1T0JA 2JTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYB A;  2DX1 A;  2ABL A;  2DL4 A;  2DE0 X;  1PWT A;  3VS3 A;  2O2O A;  2PZ1 A;  2FPE A;  3H41 A;  2D0N A;  1N5Z A;  1U5S A;  2A08 A;  2K6D A;  4HVV A;  1OV3 A;  1UG1 A;  2JS0 A;  1YWO A;  2ROL A;  1AOJ A;  1WXB A;  2RPN A;  1M27 C;  1X2Q A;  4ORZ A;  1G2B A;  1NLP C;  1BK2 A;  2BZ8 A;  1H3H A;  1WLP B;  4AFQ C;  5IHI A;  2LX7 A;  1ZSG A;  1ZBJ A;  1VYU A;  2DRK A;  4Z89 A;  1PKT A;  1G83 A;  1H8K A;  2KR3 A;  1FMK A;  2HCK A;  5HCK A;  4HVU A;  1JQQ A;  2J6K A;  1UHC A;  1OPL A;  2KYM A;  1CSK A;  1QKW A;  2VWF A;  2D1X A;  1GFD A;  1PRL C;  1X6G A;  2X3X D;  1U3O A;  1M3C A;  2YUP A;  4ESR A;  2DIL A;  2CUD A;  5GJV B;  2JW4 A;  1EFN A;  2DBM A;  2D8H A;  4HVW A;  4JPB W;  1E6H A;  2ESW A;  3VS1 A;  1YWP A;  2GTO A;  2G6F X;  1WFW A;  2EYX A;  4Z8A A;  4RTT A;  2E5K A;  4A63 B;  2LJ3 A;  4Y92 A;  1WI7 A;  1KJW A;  1A0N B;  2EQI A;  1B07 A;  2MOX A;  2CH4 W;  1X43 A;  2KXD A;  2AZS A;  3EG1 A;  2LQN A;  2C0O A;  3M0U A;  1XOV A;  2EPD A;  3VS0 A;  4F17 A;  1AWW A;  2LP5 A;  1RI9 A;  2BZY A;  3UAT A;  4DEX A;  4KRT A;  1J3T A;  1X27 A;  4F14 A;  4RTY A;  2W10 A;  1E6G A;  2J05 A;  2KYB A;  2ENM A;  2NWM A;  2JM9 A;  1WYX A;  2KT8 A;  2YUN A;  3PVQ A;  4ZNX A;  1AD5 A;  1SHG A;  1WIE A;  3TSW A;  1ZUY A;  1SPK A;  1HD3 A;  2J6O A;  4R0K A;  2EKH A;  2J6F A;  2V1Q A;  1KIK A;  1QWE A;  5FWC A;  4D8D A;  3I5S A;  2C0T A;  2EGE A;  4AFS C;  1YN8 A;  2EYY A;  2RQV A;  2L0A A;  2M51 A;  2MIO A;  2FO0 A;  2BTT A;  4JJB A;  2J06 A;  1AZE A;  2JS2 A;  2KRM A;  1GCQ A;  1PHT A;  1SHF A;  1UJ0 A;  1ZUK A;  2O9V A;  1IO6 A;  2KNB B;  2PNI A;  4RTZ A;  1K76 A;  1UUE A;  4J9I A;  3RNJ A;  2O88 A;  2AZV A;  3NGP A;  3VS5 A;  1NM7 A;  2O9S A;  2AKK A;  4GBQ A;  2K3B A;  3ZL7 C;  3SEM A;  2RQU A;  2DL7 A;  2CSI A;  2RQR A;  1ZLM A;  2FG0 A;  3RBB B;  3M0S A;  4AG1 C;  1RLQ C;  4JJC A;  1UE9 A;  2EW3 A;  2DF6 A;  1M30 A;  3M0Q A;  2P4R A;  3JV3 A;  1M8M A;  5FW9 A;  1RLP C;  1MV3 A;  1ABQ A;  2CUB A;  2JT4 A;  2DBK A;  2DL8 A;  2DVJ A;  4J9B A;  1YCS B;  1NYG A;  1GRI A;  1M3B A;  5IHN A;  1QKX A;  1CKA A;  2DRM A;  2KE9 A;  1NYF A;  1FYN A;  2RN8 A;  4OML A;  1PRM C;  3GBQ A;  1PKS A;  1WA7 A;  5I11 A;  2KGT A;  1ZX6 A;  2LNH B;  1T3L A;  2KRO A;  2ED1 A;  1GCQ C;  4Z88 A;  4CC3 A;  3TVT A;  1JO8 A;  2PTK A;  1SRL A;  2EVR A;  2VKN A;  4J9H A;  1TUD A;  2YT6 A;  1YP5 A;  3I5R A;  1JU5 C;  1H92 A;  1BU1 A;  2A28 A;  5EC7 A;  5IHK A;  4K11 A;  2L3Q A;  1QWF A;  2C0I A;  2EYZ A;  1OOT A;  4OMP A;  1K9A A;  1Y57 A;  4AG2 C;  1JEG A;  2CT3 A;  1I07 A;  2YUO A;  4RTV A;  1UJY A;  2A36 A;  1Y0M A;  3SHW A;  3H0F A;  4OMN A;  2V1R A;  3EHR A;  4LE9 A;  1GFC A;  1QCF A;  2K9G A;  3CQT A;  4CC2 A;  2JMA A;  1AEY A;  3H0H A;  1W6X A;  4X1V A;  1K0S A;  5ECA A;  2W0Z A;  2K79 A;  4J9F A;  2O31 A;  4FSS A;  4WCI A;  3VS4 A;  2EYW A;  3IQL A;  4OMM A;  4F16 A;  1LCK A;  3UF4 A;  2KEA A;  1YNZ A;  3REB B;  3UA6 A;  2GQI A;  1MV0 B;  1U06 A;  2FEI A;  2RQW A;  3VRZ A;  2EGC A;  1TUC A;  1NEB A;  1WXT A;  1ZUU A;  2CT4 A;  2LJ1 A;  1AWX A;  1HSQ A;  1SEM A;  2EBP A;  4HCK A;  4IIO A;  1NLO C;  2FRW A;  2J7I A;  4J9C A;  1I0C A;  2H8H A;  3VS6 A;  1JXM A;  3M0P A;  3VS2 A;  2DL5 A;  3PVL A;  1E7O A;  2K7A A;  4LNP A;  1AVZ C;  3M0R A;  2GBQ A;  2DNU A;  1SRM A;  3ULR B;  4HXJ A;  2HDA A;  1OEB A;  4AFZ C;  1PNJ A;  2AK5 A;  4QT7 A;  1UFF A;  3REA B;  3NPF A;  1VYT A;  2DM1 A;  2NUZ A;  3I9Q A;  3I35 A;  4CC4 B;  2EGA A;  1QLY A;  1W70 A;  2A37 A;  2ED0 A;  1WXU A;  2L2P A;  4J9D A;  2DA9 A;  2FPF A;  3R6N A;  1NEG A;  2K2M A;  5GJW B;  2M0Y A;  2IIM A;  3LH5 A;  2FPD A;  4RTW A;  4RUG A;  1UGV A;  4LUE A;  4DEY A;  2JMC A;  1CKB A;  4IIM A;  1T0H A;  1WX6 A;  4OMO A;  2F2W A;  4RTX A;  1BB9 A;  5IH2 A;  2JXB A;  2RMO A;  3UA7 A;  3A98 A;  1X6B A;  3QWY A;  3FJ5 A;  5FWB A;  1KFZ A;  2CDT A;  2B86 A;  1K4U S;  1I1J A;  1UEC A;  5I22 A;  2VVK A;  2YDL A;  1WDX A;  5IXB A;  4LN2 A;  1GBR A;  1OPK A;  4J9E A;  4AFU C;  4EIK A;  1TG0 A;  3C0C A;  2KXC A;  1AWO A;  1V1C A;  3U23 A;  2QDL A;  2LJ0 A;  3NHN A;  4OMQ A;  2DL3 A;  1AWJ A;  3EG0 A;  4J9G A;  3O5Z A;  2KRS A;  2F2X A;  1RUW A;  1SSH A;  2OI3 A;  1K1Z A;  2CRE A;  2L3P A;  5IXF A;  5L23 A;  1W1F A;  2AKL A;  2RQT A;  4LUD A;  1GBQ A;  2JM8 A;  1UTI A;  3VRY A;  4JZ4 A;  1ARK A;  3EHQ A;  1GL5 A;  2ECZ A;  3EG3 A;  2OAW A;  1M3A A;  2HEQ A;  2KT1 A;  1VYV A;  1BBZ A;  1MUZ A;  2DJQ A;  3EGU A;  3THK A;  2XMF A;  3TSZ A;  1T3S A;  4D8K A;  4JZ3 A;  3EG2 A;  2BZX A;  1AZG B;  2GNC A;  2X3W D;  2GGR A;  1S1N A;  2MCN A;  2F2V A;  3KFV A;  2OJ2 A;  1X2K A;  1Z9Q A;  2DLP A;  1GCP A;  2ROT A;  2GTJ A;  1JXO A;  2RNA A;  2D8J A;  1KSW A;  1UHF A;  3PE0 A;  2LQW A;  1X69 A;  2DMO A;  2I0N A;  2RF0 A;  4RTU A;  1UDL A;  4JJD A;  2YUQ A;  3H0I A;  3M0T A;  1VA7 A;  1B3Q A;  1Z9Z A;  2CH4 A;  2CSQ A;  2KRN A;  2LMJ A;  2HSP A;  1K0X A;  3VS7 A;  2LZ6 B;  4M4Z A;  2SRC A;  3NMZ C;  1ABO A;  4GLM A;  2KBT A;  4E6R A;  2LCS A;  1NG2 A;  1HJD A;  2SEM A;  4CC7 A;  2FRY A;  2L3S A;  2YSQ A;  2HBW A;  3QWX X;  1T0J A;  2JTE A; 
#chains in the Genus database with same CATH topology
 4XU0 A;  5GAN j;  2ABL A;  2NUP B;  2DL4 A;  4DBF A;  3PTA A;  2MI6 A;  2E65 A;  2K2V A;  1M1K R;  2OTL T;  2QA4 A;  2JS0 A;  2EAY A;  3CCM Q;  3I56 Q;  1M27 C;  3FB9 A;  2EQK A;  1I5O B;  5IHI A;  4JS5 A;  3G6E Q;  1YJW Q;  2MWP A;  1PKT A;  2PVO B;  4FYV B;  1FMK A;  5J39 A;  4BAC A;  5GMK i;  1UHC A;  3RKY A;  3KBG A;  2O01 E;  2DIG A;  2FZG B;  1TUG B;  1YJN T;  2Z0W A;  4M75 A;  5L8R E;  3J81 E;  2DAQ A;  2XIC A;  3CXC P;  2FZC B;  4ESR A;  2JW4 A;  1EFN A;  4BI8 B;  5KYW A;  2EJG A;  1E6H A;  1ZSZ A;  5GMK l;  2EFI A;  2G6F X;  1MGQ A;  4A63 B;  4BE0 A;  2LJ3 A;  4Y92 A;  2E12 A;  1EX4 A;  1IHW A;  1D0Y A;  1B07 A;  3ZFJ A;  3E9F A;  1VQN T;  2KXD A;  2AZS A;  1LOJ A;  2CP0 A;  1LPL A;  1M5Q 1;  3A5Z B;  3LGL A;  4F17 A;  1Q7Y R;  1AWW A;  4PJJ A;  3CPW A;  2LP5 A;  1X27 A;  1NJI C;  3HRS A;  1E6G A;  1IB8 A;  3EFS A;  5J26 A;  1PM3 A;  1VQ7 T;  1AD5 A;  4M77 D;  1WIE A;  1SPK A;  2HD0 A;  3TU4 K;  3RES A;  4OVA A;  3DLL A;  3C4S A;  4D8D A;  2AIR B;  4X9D A;  3HSB A;  3I5S A;  1VQK T;  3AHU A;  4AFS C;  2P0P A;  2MIO A;  4A4F A;  1PCX A;  3QZ5 B;  1AZE A;  5IN1 A;  2KRM A;  1SSF A;  1GCQ A;  1UJ0 A;  1ZUK A;  3RR6 A;  1IO6 A;  2ZPB B;  4Y28 E;  2VXF A;  1VQ5 T;  3V7S A;  3HPW A;  3CC7 A;  5KYX B;  5DLQ E;  4FYX B;  2RHZ A;  2AZV A;  1NM7 A;  1NJI U;  2AHJ B;  2AKK A;  4PJO F;  3ZL7 C;  5A0G A;  1RAD B;  2VGN A;  4EMK A;  2E1H A;  5LJ3 g;  2CP7 A;  3M0S A;  4AG1 C;  3OSS C;  1UE9 A;  3JB9 I;  2DVE A;  2E3H A;  5GAM j;  2FVU A;  3I55 T;  1KQS S;  3M0Q A;  3VJP A;  4FIB A;  1F1B B;  1YIJ T;  4M7A F;  1RLP C;  1MV3 A;  2JT4 A;  2DL8 A;  1VIF A;  1OZ2 A;  2DVJ A;  5KYY A;  4J9B A;  5GAN 8;  1D1C A;  1NYG A;  1GRI A;  1VQM T;  2DEU A;  1M3B A;  5IHN A;  1QKX A;  1CKA A;  1S72 A;  3JAM E;  1FYN A;  2HKN A;  1ZHI A;  3GBQ A;  4JLI A;  3VYH B;  5CR2 A;  3MPU B;  2MMP A;  5I11 A;  2KGT A;  1TOV A;  2DIQ A;  2E6Z A;  5D6W A;  3BDL A;  1T3L A;  3JCM h;  5I2S A;  3KXT A;  2KY9 A;  4M78 D;  2QEX T;  3M9Q A;  1H92 A;  5CAI A;  2A28 A;  3G71 Q;  2L5Q A;  2CKK A;  5KYN A;  3CC4 A;  4ATO A;  5GAM e;  1YIT A;  2BE7 D;  2CZ7 B;  2C0I A;  4OMP A;  4FU6 A;  4PJO E;  1K9A A;  3QKJ A;  4AG2 C;  1JBM A;  3QUI A;  4O6J A;  2YUO A;  1K8A C;  4RTV A;  2K5L A;  3I56 T;  3FC3 A;  5KCO A;  4N0A C;  4X1V A;  1TWB A;  1LNX A;  2O31 A;  3PNW C;  3G6E T;  1YJW T;  3P8B B;  2XID A;  4C92 F;  2K3Y A;  3HTR A;  1I8F A;  3CCS Q;  1VQL Q;  4BDY A;  4M7A E;  4UC4 A;  2ZZD A;  1YNZ A;  3CME T;  3CCL Q;  1VQP T;  2GQI A;  2O4X B;  3H9N A;  1G5V A;  1MV0 B;  1U06 A;  2QQA A;  3VRZ A;  1WJS A;  3JSC A;  4JRI A;  2EWN A;  1ZUU A;  1Y07 A;  1Y7X A;  2R57 A;  2KQW A;  2FB7 A;  1NJI R;  1U1T A;  1JJ2 A;  1NLO C;  2J7I A;  3OYC A;  3WVE B;  1I0C A;  2QDY B;  3CCE A;  1EIF A;  1YHQ T;  1KG1 A;  1D0Z A;  1JXM A;  2IG0 A;  3V8K A;  2EIF A;  1C0M A;  2HQH A;  4L5G A;  2E41 A;  1D1A A;  3M0R A;  2GBQ A;  1K8A U;  2OTJ Q;  4AFZ C;  4VUB A;  1PNJ A;  5KYU B;  1UFF A;  3REA B;  1VYT A;  1NPR A;  3VU3 C;  4M7D F;  5HK3 A;  4PJO C;  4CC4 B;  2EGA A;  5KE3 A;  1BYM A;  2RI5 A;  1VQ8 Q;  2LQ8 A;  5GMK m;  2FPF A;  3R6N A;  1NEG A;  4AMC A;  1KQS P;  4C92 E;  2LVM A;  4XTZ A;  2RHY A;  2RJC A;  2XI9 A;  4RUG A;  1UGV A;  4M7A C;  1CKB A;  3MJX A;  4IIM A;  4KT0 E;  4KUI A;  3OYN A;  3OYK A;  3HFO A;  3OYY A;  3UA7 A;  5CKH A;  3JB9 H;  2V8J A;  3SWN A;  2DTH A;  3TQ7 P;  5FU6 C;  1I1J A;  1UEC A;  2YDL A;  2FL7 A;  1N9R A;  1OPK A;  2COZ A;  4J9E A;  2KXC A;  1WPY A;  1AWO A;  1QVG S;  2E3I A;  2QDL A;  4NL3 A;  4MDW A;  2DL3 A;  2X4Y A;  3VUZ A;  4BE2 A;  1K1Z A;  3ER0 A;  5L23 A;  2AKL A;  3S3O A;  2JM8 A;  2MF2 A;  3GOX A;  2DZC A;  3EFO A;  4M7D E;  1X6O A;  5J3B A;  2JTM A;  3JRZ A;  1MMG A;  1M3A A;  2HEQ A;  2QK0 A;  3X25 B;  4RMO A;  1BBZ A;  3THK A;  1IHV A;  1R77 A;  3R6O A;  4JZ3 A;  3EG2 A;  4M78 E;  1AZG B;  1WJR A;  2GGR A;  3CCV A;  3H8Z A;  1ZQ1 A;  3KFV A;  3GPL A;  2OJ2 A;  3QSU A;  3G4S Q;  4C92 C;  2F1L A;  3PIO A;  3JCM g;  1JXO A;  4J8O A;  3PE0 A;  2E10 A;  1VQ4 Q;  1X69 A;  2RF0 A;  4C8Q F;  4A4G A;  4JJD A;  4PJO B;  2WSF E;  2KRN A;  4OP0 A;  3VS7 A;  2BIV A;  5C0M A;  4M4Z A;  2Y4X A;  3EFR A;  4B6M A;  4GLM A;  4ELY C;  2LCS A;  1PD1 A;  1HJD A;  1WJQ A;  4CC7 A;  4M7A B;  2PZ1 A;  1T0J A;  3BW1 A;  2RJE A;  5D6Y A;  4JRK A;  3G71 T;  2O2O A;  1M2V B;  4E7J A;  2MPX C;  3H41 A;  3CMA A;  2HQE A;  1N5Z A;  3HRU A;  1OQK A;  2K6D A;  4M7D C;  1UGR B;  4JUV A;  4HVV A;  1OV3 A;  4PFP A;  4QKU A;  2WSC E;  1YWO A;  2ROL A;  1AOJ A;  2RPN A;  4RCC A;  4ORZ A;  3JCM P;  1G2B A;  3JCM W;  3PFS A;  1BK2 A;  3M4G A;  4OB1 B;  1H3H A;  2LX7 A;  4KGV B;  1R8O B;  1ZSG A;  3EGX A;  2DD4 A;  1TTH B;  2DD5 A;  2KR3 A;  1VQL T;  3CCS T;  3PMT A;  1Q82 C;  1JQQ A;  1R0C B;  2J6K A;  2X35 A;  3X24 B;  1M2O A;  4A54 A;  2YLC A;  3CCL T;  1OPL A;  2KYM A;  2P4T A;  5GMK e;  3E1S A;  1Q86 C;  2D1X A;  3CCQ Q;  4HCZ A;  4J6W A;  1DJ7 B;  1PRL C;  1EZZ B;  2M16 A;  2X3X D;  1U3O A;  3WVD B;  2YUP A;  3CPW S;  1QVG P;  2RJD A;  2P84 A;  3EGD B;  4B9W A;  4C92 B;  2R58 A;  4II1 A;  1U8R A;  4HVW A;  3M57 A;  4JPB W;  1C6V X;  3OYI A;  2LC4 A;  4Z8A A;  1VQ6 A;  3A1P A;  4DA4 A;  4FW2 A;  5LJ5 e;  2CH4 W;  2H3J A;  3QO3 A;  4PKC C;  2LQN A;  1TU0 B;  2C0O A;  1XOV A;  5LJ3 j;  1Q82 U;  1VQ8 T;  1QVF P;  1BI2 A;  1WNL A;  5HKC A;  3UAT A;  3CCR Q;  3C12 A;  4KRT A;  1N6A A;  2EYQ A;  3INZ A;  1YIJ Q;  2J05 A;  2KYB A;  3QPH A;  1Q86 U;  1YJ9 A;  2ENM A;  1RAH B;  2JM9 A;  2KT8 A;  4PJN A;  4ZNX A;  3RER A;  4C8Q C;  1ZBX A;  4RG8 A;  2QQR A;  1ZUY A;  2E5Q A;  2J6O A;  4C5E A;  4M7D B;  1U1S A;  4BUG A;  2EKH A;  1BCO A;  1MMD A;  2J6F A;  2V1Q A;  1KIK A;  2QXF A;  1YIT T;  4JJN K;  3OY9 A;  1RL2 A;  2DYI A;  4HKE A;  5FWC A;  5FLX E;  3CC2 A;  3QDR B;  2GF7 A;  4MZP A;  2FO0 A;  1MHN A;  2R5M A;  4F7U F;  2GFU A;  2J06 A;  2JS2 A;  2KAF A;  3M54 A;  3MEW A;  3URG A;  4LDV A;  3BE3 A;  4RTZ A;  1K76 A;  3QZ9 B;  4J9I A;  3CBM A;  2O88 A;  3S6W A;  3NGP A;  5D6X A;  3VS5 A;  4C0Z A;  2O9S A;  4IUR A;  3QYG B;  4M77 A;  2K3B A;  3A8G B;  3JCM Q;  2RQU A;  1TH7 A;  1UGP B;  2DL7 A;  3EG9 B;  3VYG A;  1MMN A;  3MEA A;  3RBB B;  1PSE A;  4IUP A;  4JJC A;  5HK0 A;  4C0D B;  3OYJ A;  4HT9 A;  2M9U A;  1UEB A;  1IRE B;  3G4S T;  3CME Q;  1VQP Q;  3X28 B;  5KH6 A;  1M8M A;  3OYB A;  1VQ4 T;  5CVI A;  2L89 A;  2CUB A;  5GAN e;  1FXX A;  3FRN A;  2LQK A;  4C8Q G;  3E9G A;  4PJO D;  2RI3 A;  2VUB A;  1UB4 A;  2KE9 A;  2PVG B;  1YHQ Q;  1XNI A;  1AHJ B;  1LJO A;  1PRM C;  4TVR A;  1WA7 A;  1K9M C;  3CPW P;  3RKW A;  4FT4 A;  1LVK A;  1Q82 R;  2ED1 A;  1OYX A;  3FIF A;  4OB0 B;  1KC8 C;  4Z88 A;  4CC3 A;  4F7U E;  3TVT A;  4Q5W A;  2FZK B;  1SRL A;  3M59 A;  4BD3 A;  2MYS A;  4ZTF A;  3MKD A;  3PT9 A;  2EVR A;  2EQJ A;  4XTV A;  4M7A D;  3L2Z A;  1YP5 A;  4C8Q B;  4IUU A;  1Q86 R;  5CKB A;  3LYI A;  4BDZ A;  2MAM A;  2BKD N;  3F70 A;  4NOY A;  2QAS A;  4XTX A;  2Y4Y A;  4DBH A;  4OMN A;  1V76 A;  2IVW A;  2V1R A;  3EHR A;  1GFC A;  2DEQ A;  4CC2 A;  3LH0 A;  1JJ2 S;  5ECA A;  4MMK A;  4X9C A;  1V29 B;  3ZEH A;  3OBW A;  2XD0 A;  4A4E A;  1TS9 A;  3IQL A;  3MHX A;  4OMF B;  5FRO A;  1I5L A;  2YWW A;  2QGF B;  1K9M U;  1R0B G;  4M78 A;  1TSF A;  2QA4 Q;  3SWN C;  3EAE A;  2ZPI B;  2RQW A;  1KC8 U;  3CCQ T;  3L42 A;  2LJ1 A;  2CT4 A;  2DO3 A;  2NUP A;  1VQO A;  2ATC B;  1IGU A;  1N8R C;  2H8H A;  3QG1 A;  2D6F A;  4NL2 A;  1KQ1 A;  4C92 D;  1QVP A;  5LJ5 d;  2DL5 A;  3QJY A;  3PVL A;  4DBR A;  3EH2 A;  2K7A A;  4BE1 A;  1O9S A;  2M0O A;  3GIB A;  1AVZ C;  3L2R A;  1SRM A;  1VOM A;  4LXC A;  1OEB A;  2AK5 A;  2LT1 A;  4ME7 A;  1D1B A;  3I9Q A;  5AYF A;  3I35 A;  1WZO A;  2RI2 A;  4ELZ C;  3JCM b;  3V7R A;  3S3M A;  1I4K 1;  4B9X A;  2NUT B;  8ATC B;  3CCR T;  3CCU A;  2A7Y A;  1YI2 A;  4DEY A;  1RAI B;  1T0H A;  1WX6 A;  5GAN f;  3UPU A;  5IH2 A;  2EQM A;  4QQD A;  2QTX A;  1N8R U;  4M7D D;  4D6W A;  2OAU A;  3FJ5 A;  2CP3 A;  2B86 A;  2EKO A;  1G8X A;  2KSS A;  2VXE A;  5I22 A;  3GLX A;  3JCM V;  4LN2 A;  1KHI A;  3C0C A;  4LDU A;  4FSX A;  2X51 A;  1XJW B;  1V1C A;  4OB2 B;  5CKF A;  4ANJ A;  1AWJ A;  3EG0 A;  1PC0 A;  2KRS A;  2X4W A;  4F7U G;  2A0F B;  4GY5 A;  4XTW A;  1WHK A;  2OX7 A;  3UT1 A;  3JCM e;  4J7I A;  1D3B B;  4ZGE B;  2LNV A;  4JZ4 A;  1G3S A;  1D0X A;  1K9M R;  3A8O B;  2KT1 A;  1MUZ A;  2HL5 C;  1HXD A;  1PSF A;  1KC8 R;  2RHU A;  2XMF A;  2DTO A;  4D8K A;  1JJ2 P;  2PVD B;  2QG9 B;  1MNE A;  4JDS A;  3ME9 A;  1IRX A;  4F7U B;  1JRI A;  5GAN d;  3OW2 A;  3QBY A;  3OMG A;  1ZA2 B;  2ROT A;  4MZT A;  2RH2 A;  4KUD K;  3HRT A;  1MND A;  1UHF A;  3CC7 Q;  4RTU A;  1WHM A;  3H0I A;  1Z9Z A;  4C0G A;  2CSQ A;  2HSP A;  4M75 F;  2HAX A;  2BUD A;  5GAO r;  2OTL A;  3JCM J;  2KI7 A;  5KYX A;  3HHT B;  2KBT A;  1IZ6 A;  2QI2 A;  2WSE E;  3CCJ T;  4E7I A;  1SF9 A;  2G3R A;  1RAB B;  3CBP A;  4L59 A;  2C06 A;  4LDX A;  2CZ1 B;  8AT1 B;  3WXM B;  4QVZ A;  2DYB A;  4C8Q D;  2CZ6 B;  4PLL A;  2PQW A;  4QVC A;  4OF1 A;  3JB9 G;  3OBY A;  1N8R R;  1UG1 A;  1O75 A;  1VQ9 A;  1X2Q A;  2COW A;  1NLP C;  1NE8 A;  1YJN A;  1TXQ A;  2JZ2 A;  4PFZ A;  2P0Q A;  2MK5 A;  4Z89 A;  5DLO A;  1H8K A;  2HCK A;  5CK9 A;  3CC4 Q;  3MEU A;  1YIT Q;  2DZ9 A;  2RHI A;  2QA4 T;  1CSK A;  1W2B A;  3A8L B;  4AT1 B;  1VQN A;  1WHL A;  4ZTJ A;  1G3T A;  2LCL A;  2LCC A;  1X6G A;  2JUF A;  1M3C A;  2V8K A;  2CUD A;  3RUX A;  4JRQ A;  3QYH B;  1XTD A;  2ESW A;  1YWP A;  5GAM f;  2GTO A;  2EYX A;  1Y96 B;  1YCY A;  4F04 B;  2RHX A;  2E5K A;  5KCH A;  2DFU A;  3MEV A;  1VQ7 A;  4HCC A;  1KJW A;  1M9S A;  5FU7 C;  2MOX A;  3OSV A;  2XDP A;  3L1A A;  2K3X A;  3QDF A;  3EG1 A;  1BI0 A;  4Y91 A;  2JTF A;  1QVF S;  5I2M A;  3LGF A;  3CCE Q;  2EPD A;  4R56 A;  2O4X A;  4CI0 C;  3DKM A;  1RI9 A;  2BZY A;  1VQK A;  5AT1 B;  3HL8 A;  4F14 A;  3V8J A;  4XK8 E;  2W10 A;  3OYM A;  1K8A R;  1B34 B;  1WYX A;  2GFA A;  2YUN A;  3PVQ A;  1I81 A;  1Q81 U;  3TSW A;  3OA6 A;  1RI0 A;  4R0K A;  1VQ5 A;  1YBY A;  4KH0 B;  5GAN 6;  2XU8 A;  4M75 C;  4X34 A;  4E7L A;  1H64 1;  4LD6 A;  2DK3 A;  4C5G A;  1KQ2 A;  3HKS A;  3X26 B;  5GAM d;  2DJZ A;  3PGG A;  1ZSZ C;  2XK0 A;  5KYU A;  2JOY A;  2EYY A;  2FHD A;  2R5A A;  2CYZ B;  2RQV A;  2M51 A;  1QCN A;  2BTT A;  4JJB A;  2HNI A;  1XQH A;  2F69 A;  3FDR A;  4P5N A;  3I55 A;  3FLG A;  1PHT A;  2O9V A;  1VUB A;  5FU6 B;  2KNB B;  2PNI A;  2QQB A;  3HP9 A;  3MP1 A;  3CBO A;  1RAF B;  3OYG A;  1AT1 B;  3UDC A;  1VQM A;  4GBQ A;  5CQX A;  3SEM A;  1VQO T;  2LRQ A;  4DBQ A;  3CD6 A;  3GNG A;  1W4S A;  2DF6 A;  1M30 A;  3HFN A;  4C8Q E;  5C6S A;  4N0A A;  1BIB A;  2P4R A;  3JV3 A;  2QEX A;  3J7A F;  3FEO A;  4R55 A;  5FW9 A;  3CC7 T;  4HT8 A;  1QP2 A;  4FCY A;  1ABQ A;  5FU7 B;  3S3N A;  2VB6 A;  5EG2 A;  1HK9 A;  2L3R A;  1M1K U;  4N4G A;  1NYF A;  4M75 G;  2RN8 A;  1PKS A;  3CCM A;  2DXC A;  2H3E B;  3I56 A;  3QJ6 A;  3CCV Q;  3EH1 A;  4JS4 A;  2KRO A;  4NS5 A;  5GAO p;  1GCQ C;  1JO8 A;  3V8L A;  3C95 A;  1NZ9 A;  1B7T A;  1OU8 A;  2VKN A;  5LJ5 h;  1TUD A;  3CCU T;  2F5K A;  3G6E A;  1YJW A;  2KVQ G;  2VAS A;  2FYK A;  1BU1 A;  3QHS A;  2JJ9 A;  4K11 A;  4MDX A;  4OGE A;  1ACM B;  4M75 B;  1Y71 A;  1QWF A;  4DOW A;  1VQP A;  1OOT A;  5GAN 2;  1S72 T;  4EMK C;  2V8I A;  1G3W A;  1Y57 A;  5KYW B;  4LD9 K;  1JEG A;  2CT3 A;  1I07 A;  2A36 A;  1ZSZ B;  3SHW A;  3H0F A;  4J6Y A;  4LE9 A;  4PNO A;  1QCF A;  2K9G A;  3CQT A;  4XQ3 A;  2JMA A;  4PJO A;  3P8D A;  1W6X A;  2W0Z A;  1SKU B;  4EPC A;  4J9F A;  3JCM X;  4FSS A;  2BE9 B;  4O5V A;  4HA8 A;  1RAE B;  1WGS A;  4F16 A;  3CC4 T;  1LCK A;  2KEA A;  2DTI A;  3NFC A;  3REB B;  3CMA Q;  3D7S B;  3RDV A;  2HSE B;  4BY6 C;  4M7A A;  2DER A;  2FEI A;  3RKX A;  3E19 A;  1TUC A;  1WXT A;  2ZGW A;  3L2U A;  1HSQ A;  4PJM A;  1SEM A;  1M2V A;  4HCK A;  3RMQ A;  4J9C A;  2FRW A;  2ZPE B;  5LJ3 e;  1Q95 G;  3PMI A;  3VS6 A;  3KUF A;  3VS2 A;  4IUT A;  3TCJ A;  4IUQ A;  1OU9 A;  2P0K A;  2DPP B;  2DNU A;  2VYT A;  2CGH A;  3ULR B;  4HXJ A;  2NYS A;  3AT1 B;  1FX7 A;  5GAN 4;  1OUL A;  4XU3 A;  2E70 A;  2YLB A;  5CCA A;  4ZN3 A;  2RD1 A;  4C5H A;  1W70 A;  2PUO B;  2A37 A;  3CCE T;  3P8H A;  2ED0 A;  2MWO A;  4XTY A;  1IXD A;  1MMA A;  2QQ9 A;  4E7S A;  2M0Y A;  2IIM A;  5GAN h;  1VQ6 Q;  3LH5 A;  1RAA B;  2FPD A;  3OYD A;  1PG5 B;  4LUE A;  4QVD A;  2HQX A;  1M1F A;  2DKG A;  4OMO A;  2JXB A;  2RMO A;  3EGD A;  4C92 A;  3A98 A;  2YRC A;  4EMK B;  4V2S A;  3QWY A;  5IAY A;  1KFZ A;  1M8V A;  3MP6 A;  2CDT A;  4Z02 A;  1K4U S;  2LTO A;  5KE2 A;  3CCJ Q;  4EMH A;  3V7C A;  2VVK A;  1VQ9 T;  2K5I A;  2DXT A;  4OGC A;  3CPF A;  5IXB A;  4FT2 A;  4AFU C;  4IUV A;  2VV5 A;  1YJ9 Q;  5KYY B;  3DB3 A;  3OW2 S;  3NHN A;  4OMQ A;  2ZPF B;  4J9G A;  3O5Z A;  2F2X A;  5LJ5 f;  3JB9 F;  1RUW A;  3MET A;  4QQ6 A;  2OI3 A;  4E47 A;  2CRE A;  5IXF A;  2XKO C;  3N5B B;  4WF2 A;  4FL6 A;  4LUD A;  4BY6 B;  1GBQ A;  2D0Q B;  3VRY A;  2QAZ A;  5CKE A;  2CZ0 B;  1GL5 A;  2ECZ A;  2OAW A;  2K5F A;  3CC2 Q;  1YFN A;  1FMV A;  1T3S A;  5IT9 E;  2HL3 A;  4M7D A;  4FM4 B;  2BZX A;  3CXC A;  3LW5 E;  2GNC A;  1S1N A;  2MCN A;  2F2V A;  4N4H A;  2VGM A;  1X2K A;  1Z9Q A;  3M5A A;  2DLP A;  1GCP A;  5M9O A;  2JVV A;  2E6N A;  3OS0 A;  2RNA A;  2EJF A;  2LQW A;  4E7H A;  1N27 A;  2DMO A;  2I0N A;  2YRV A;  1UDL A;  3G71 A;  1IGQ A;  3L2W A;  4E2F B;  5LJ5 g;  2YHT A;  2YUQ A;  4FYW B;  4ZGJ B;  2XDD A;  4A4K A;  2LZ6 B;  4A53 A;  2SRC A;  3NMZ C;  1ABO A;  5LJ3 f;  4KGX B;  3CCV T;  3ZBD A;  2QQS A;  1NG2 A;  4A4H A;  2SEM A;  2FRY A;  2L3S A;  2HBW A;  2DXB A;  3QWX X;  3EG9 A;  2PU9 B;  3LX7 A;  2DX1 A;  4EDU A;  3CCS A;  1VQL A;  2DE0 X;  2VC8 A;  1PWT A;  3VS3 A;  2FPE A;  1C1A A;  2D0N A;  2X4X A;  1U5S A;  3CCL A;  4M75 D;  2A08 A;  1W2B S;  5HY6 A;  1WXB A;  2LT4 A;  4KUL A;  3MP8 A;  2BZ8 A;  2ZAE A;  1WLP B;  4AFQ C;  1ZBJ A;  1VYU A;  2DRK A;  4JRP A;  1K73 C;  1G83 A;  2F5T X;  2AT1 B;  5HCK A;  1M1G A;  4HVU A;  2ZPH B;  1QCO A;  3CMA T;  2OTJ A;  1QKW A;  4C0F A;  1M90 C;  5LJ3 d;  2VWF A;  1PD0 A;  1GFD A;  4C8Q A;  1RAG B;  3NTK A;  2I2L A;  1FMW A;  4BI4 A;  1RAC B;  1M4Z A;  3OB9 A;  5GAM h;  2DIL A;  3GP8 A;  3L2V A;  1VQ8 A;  3OYE A;  5GJV B;  3OW2 P;  5FRN A;  3MCA B;  3CD6 T;  2DBM A;  2D8H A;  3VS1 A;  1BI3 A;  3VKI A;  3SWN B;  1WFW A;  3JB9 J;  4RTT A;  1KK7 A;  4PLI A;  2EQU A;  5GAN g;  1WI7 A;  4M77 F;  1A0N B;  2EQI A;  4GLK A;  1X43 A;  1VQO Q;  4YTL A;  2XHC A;  1WHG A;  3M0U A;  1K73 U;  4J7F A;  3VS0 A;  1HYO A;  1VIE A;  3NTI A;  3CCM T;  2E64 A;  1J3T A;  4DEX A;  3J80 E;  3A8M B;  4RTY A;  1M90 U;  4QW2 A;  3M55 A;  3EFO B;  1VQ6 T;  2JNG A;  2X4J A;  2NWM A;  3RMS A;  3M4Y A;  1SHG A;  4XAX B;  4MML A;  1HD3 A;  2M02 A;  4CRI A;  3LWI A;  1QWE A;  2RK2 A;  3H6Z A;  3TEE A;  1WQ7 A;  1P92 A;  1BIA A;  2CP2 A;  2C0T A;  2EGE A;  4XTU A;  3X20 B;  1YN8 A;  3CCU Q;  2HZY A;  2L0A A;  5GAO l;  1YJ9 T;  1UGS B;  1YI2 Q;  4QQG A;  4RKU E;  3G4S A;  1SHF A;  2NUT A;  2ZPG B;  1S72 Q;  3DLM A;  4M77 E;  2WAC A;  1VQ4 A;  1UUE A;  1W2B P;  3OYF A;  5GAO n;  2D9T A;  3RNJ A;  2ZCF B;  3M56 A;  4ZGD B;  2L8D A;  2JN0 A;  2RK1 A;  3G1J A;  1SG5 A;  3CC2 T;  4HCB A;  3OQ5 A;  2CSI A;  2RQR A;  1OX8 A;  1ZLM A;  2V26 A;  2FG0 A;  3PIP A;  1X75 C;  2YRD A;  1ZA1 B;  1KD1 C;  2E4H A;  1GXI E;  1RLQ C;  5LL6 S;  2EW3 A;  2HMA A;  4KBM B;  2RB6 A;  2EJ9 A;  2RM4 A;  5CKD A;  4L6V 5;  4M78 F;  2X9H A;  3OMC A;  4M75 E;  4BB7 A;  3BFM A;  2DBK A;  2HKQ B;  2Y90 A;  2B8A A;  1YCS B;  4OB3 B;  1Q81 C;  2DRM A;  2DET A;  3EGX B;  4N4I A;  4OML A;  3BDU A;  2KDS A;  1D3B A;  3GNF B;  1ZX6 A;  1K73 R;  2LNH B;  1QQJ A;  3T9N A;  2PTK A;  1KQS A;  3JCM f;  3TRE A;  4J9H A;  9ATC B;  2CP5 A;  2YT6 A;  1M90 R;  3I5R A;  1JU5 C;  5EC7 A;  3CEY A;  5IHK A;  4F7U A;  3QII A;  4M77 C;  2L3Q A;  2YXY A;  1KD1 U;  2EYZ A;  2OTL Q;  5D7U A;  3BY7 A;  3CCQ A;  1UJY A;  1Y0M A;  2QGG A;  1JB0 E;  1AEY A;  3LWH A;  3H0H A;  4XU2 A;  1K0S A;  4PJO G;  2K79 A;  4KH1 B;  4EMG A;  2XDB A;  6AT1 B;  3G7Z A;  4LDW A;  4WCI A;  3VS4 A;  3FJP A;  2QTV A;  5GAM g;  2EYW A;  4OMM A;  2A3L A;  3SDZ A;  3UF4 A;  1D09 B;  3UA6 A;  2NLU A;  3NTH A;  1VQ9 Q;  4M7A G;  2EGC A;  1NEB A;  2KK4 A;  3OS2 A;  3OYL A;  1AWX A;  1YJN Q;  1M1K C;  2HBP A;  2EBP A;  4IIO A;  1QMC A;  3JCM d;  4E7K A;  1BCM A;  1G3Y A;  3M58 A;  4PK4 A;  5GAO q;  3GF5 A;  5CIU A;  3M0P A;  3CCR A;  5A0D A;  5DY9 A;  4J83 A;  5GAN 7;  1E7O A;  3OS1 A;  4LNP A;  1YIJ A;  3RIR A;  4PL6 A;  5I21 A;  5GMK j;  1OX9 A;  2HDA A;  1QW1 A;  1N9S A;  2KMT A;  2LX9 A;  4J6X A;  4QT7 A;  4MZM A;  4WTO B;  4M77 G;  3C94 A;  1H3Z A;  3NPF A;  5A2Q E;  1VQN Q;  2DM1 A;  2NUZ A;  3OYA A;  3MO8 A;  1QLY A;  1NBE B;  1WXU A;  5DM7 R;  2L2P A;  4J9D A;  2DA9 A;  5GMK h;  2K2M A;  5GJW B;  3A8H B;  4M78 C;  4RTW A;  5A0L A;  1UGQ B;  4E7Z A;  2JMC A;  4M77 B;  4FYY B;  1VQ7 Q;  4BI3 A;  2K4Y A;  5LJ5 j;  2F2W A;  4RTX A;  1BB9 A;  1OI1 A;  5CO7 A;  4C92 G;  4RCB A;  1X6B A;  4J5Y A;  3SFM A;  1Y96 A;  5FWB A;  3VUB A;  1KD1 R;  1QP3 A;  3O8V A;  1VQK Q;  4KGZ B;  5GAN 3;  1WDX A;  4XU1 A;  4PJL A;  3SB2 A;  1GBR A;  3L2Q A;  3OS5 A;  4EIK A;  3CXC S;  1TG0 A;  4FW1 A;  3LLR A;  4PFO A;  4LDY A;  3U23 A;  2LJ0 A;  1Q7Y C;  1YI2 T;  5FRM A;  2QYZ A;  1SSH A;  3CME A;  2XG8 D;  1Q81 R;  3SD4 A;  2L3P A;  3Q1J A;  4DOV A;  1W1F A;  1VQ5 Q;  2RQT A;  4C0D C;  1UTI A;  1WQW A;  2CS7 A;  2COY A;  1BKB A;  1NPP A;  2OTJ T;  1ARK A;  3EHQ A;  3EG3 A;  1B34 A;  1VYV A;  2DJQ A;  3EGU A;  1KHC A;  4JLG A;  5GAO m;  3TSZ A;  1YHQ A;  1WHH A;  1FWZ A;  4M7D G;  2CP6 A;  3E2U A;  1QVG A;  2X3W D;  4ZN1 A;  2K57 A;  3CCJ A;  3JB9 D;  4C5I A;  2RJF A;  3I55 Q;  2GTJ A;  2D8J A;  1KSW A;  1X01 A;  3JCM c;  1BI1 A;  3ASK A;  4M78 G;  2RO0 A;  2PUK B;  3M53 A;  3OYH A;  2GQV A;  4IKF A;  3M0T A;  5CQY A;  1VQM Q;  1VA7 A;  1B3Q A;  3QXE B;  2CH4 A;  5LJ3 h;  2IPO B;  2RA2 A;  2LMJ A;  1Q7Y U;  3DB4 A;  1K0X A;  1OZ3 A;  4DQ2 A;  2GCX A;  3CD6 Q;  2LDM A;  1QVF A;  4E6R A;  3UWN A;  5GAN 5;  3VV0 A;  2DXU A;  4M78 B;  4RG2 A;  2QEX Q;  2YSQ A;  1WHJ A;  2M1H A;  7AT1 B;  2JTE A; 
#chains in the Genus database with same CATH homology
 2DYB A;  2DX1 A;  2ABL A;  2DL4 A;  2DE0 X;  1PWT A;  3VS3 A;  2O2O A;  2PZ1 A;  2FPE A;  3H41 A;  2D0N A;  1N5Z A;  1U5S A;  2A08 A;  2K6D A;  4HVV A;  1OV3 A;  1UG1 A;  2JS0 A;  1YWO A;  2ROL A;  1AOJ A;  1WXB A;  2RPN A;  1M27 C;  1X2Q A;  4ORZ A;  1G2B A;  1NLP C;  1BK2 A;  2BZ8 A;  1H3H A;  1WLP B;  4AFQ C;  5IHI A;  2LX7 A;  1ZSG A;  1ZBJ A;  1VYU A;  2DRK A;  4Z89 A;  1PKT A;  1G83 A;  1H8K A;  2KR3 A;  1FMK A;  2HCK A;  5HCK A;  4HVU A;  1JQQ A;  2J6K A;  1UHC A;  1OPL A;  2KYM A;  1CSK A;  1QKW A;  2VWF A;  2D1X A;  1GFD A;  1PRL C;  1X6G A;  2X3X D;  1U3O A;  1M3C A;  2YUP A;  4ESR A;  2DIL A;  2CUD A;  5GJV B;  2JW4 A;  1EFN A;  2DBM A;  2D8H A;  4HVW A;  4JPB W;  1E6H A;  2ESW A;  3VS1 A;  1YWP A;  2GTO A;  2G6F X;  1WFW A;  2EYX A;  4Z8A A;  4RTT A;  2E5K A;  4A63 B;  2LJ3 A;  4Y92 A;  1WI7 A;  1KJW A;  1A0N B;  2EQI A;  1B07 A;  2MOX A;  2CH4 W;  1X43 A;  2KXD A;  2AZS A;  3EG1 A;  2LQN A;  2C0O A;  3M0U A;  1XOV A;  2EPD A;  3VS0 A;  4F17 A;  1AWW A;  2LP5 A;  1RI9 A;  2BZY A;  3UAT A;  4DEX A;  4KRT A;  1J3T A;  1X27 A;  4F14 A;  4RTY A;  2W10 A;  1E6G A;  2J05 A;  2KYB A;  2ENM A;  2NWM A;  2JM9 A;  1WYX A;  2KT8 A;  2YUN A;  3PVQ A;  4ZNX A;  1AD5 A;  1SHG A;  1WIE A;  3TSW A;  1ZUY A;  1SPK A;  1HD3 A;  2J6O A;  4R0K A;  2EKH A;  2J6F A;  2V1Q A;  1KIK A;  1QWE A;  5FWC A;  4D8D A;  3I5S A;  2C0T A;  2EGE A;  4AFS C;  1YN8 A;  2EYY A;  2RQV A;  2L0A A;  2M51 A;  2MIO A;  2FO0 A;  2BTT A;  4JJB A;  2J06 A;  1AZE A;  2JS2 A;  2KRM A;  1GCQ A;  1PHT A;  1SHF A;  1UJ0 A;  1ZUK A;  2O9V A;  1IO6 A;  2KNB B;  2PNI A;  4RTZ A;  1K76 A;  1UUE A;  4J9I A;  3RNJ A;  2O88 A;  2AZV A;  3NGP A;  3VS5 A;  1NM7 A;  2O9S A;  2AKK A;  4GBQ A;  2K3B A;  3ZL7 C;  3SEM A;  2RQU A;  2DL7 A;  2CSI A;  2RQR A;  1ZLM A;  2FG0 A;  3RBB B;  3M0S A;  4AG1 C;  1RLQ C;  4JJC A;  1UE9 A;  2EW3 A;  2DF6 A;  1M30 A;  3M0Q A;  2P4R A;  3JV3 A;  1M8M A;  5FW9 A;  1RLP C;  1MV3 A;  1ABQ A;  2CUB A;  2JT4 A;  2DBK A;  2DL8 A;  2DVJ A;  4J9B A;  1YCS B;  1NYG A;  1GRI A;  1M3B A;  5IHN A;  1QKX A;  1CKA A;  2DRM A;  2KE9 A;  1NYF A;  1FYN A;  2RN8 A;  4OML A;  1PRM C;  3GBQ A;  1PKS A;  1WA7 A;  5I11 A;  2KGT A;  1ZX6 A;  2LNH B;  1T3L A;  2KRO A;  2ED1 A;  1GCQ C;  4Z88 A;  4CC3 A;  3TVT A;  1JO8 A;  2PTK A;  1SRL A;  2EVR A;  2VKN A;  4J9H A;  1TUD A;  2YT6 A;  1YP5 A;  3I5R A;  1JU5 C;  1H92 A;  1BU1 A;  2A28 A;  5EC7 A;  5IHK A;  4K11 A;  2L3Q A;  1QWF A;  2C0I A;  2EYZ A;  1OOT A;  4OMP A;  1K9A A;  1Y57 A;  4AG2 C;  1JEG A;  2CT3 A;  1I07 A;  2YUO A;  4RTV A;  1UJY A;  2A36 A;  1Y0M A;  3SHW A;  3H0F A;  4OMN A;  2V1R A;  3EHR A;  4LE9 A;  1GFC A;  1QCF A;  2K9G A;  3CQT A;  4CC2 A;  2JMA A;  1AEY A;  3H0H A;  1W6X A;  4X1V A;  1K0S A;  5ECA A;  2W0Z A;  2K79 A;  4J9F A;  2O31 A;  4FSS A;  4WCI A;  3VS4 A;  2EYW A;  3IQL A;  4OMM A;  4F16 A;  1LCK A;  3UF4 A;  2KEA A;  1YNZ A;  3REB B;  3UA6 A;  2GQI A;  1MV0 B;  1U06 A;  2FEI A;  2RQW A;  3VRZ A;  2EGC A;  1TUC A;  1NEB A;  1WXT A;  1ZUU A;  2CT4 A;  2LJ1 A;  1AWX A;  1HSQ A;  1SEM A;  2EBP A;  4HCK A;  4IIO A;  1NLO C;  2FRW A;  2J7I A;  4J9C A;  1I0C A;  2H8H A;  3VS6 A;  1JXM A;  3M0P A;  3VS2 A;  2DL5 A;  3PVL A;  1E7O A;  2K7A A;  4LNP A;  1AVZ C;  3M0R A;  2GBQ A;  2DNU A;  1SRM A;  3ULR B;  4HXJ A;  2HDA A;  1OEB A;  4AFZ C;  1PNJ A;  2AK5 A;  4QT7 A;  1UFF A;  3REA B;  3NPF A;  1VYT A;  2DM1 A;  2NUZ A;  3I9Q A;  3I35 A;  4CC4 B;  2EGA A;  1QLY A;  1W70 A;  2A37 A;  2ED0 A;  1WXU A;  2L2P A;  4J9D A;  2DA9 A;  2FPF A;  3R6N A;  1NEG A;  2K2M A;  5GJW B;  2M0Y A;  2IIM A;  3LH5 A;  2FPD A;  4RTW A;  4RUG A;  1UGV A;  4LUE A;  4DEY A;  2JMC A;  1CKB A;  4IIM A;  1T0H A;  1WX6 A;  4OMO A;  2F2W A;  4RTX A;  1BB9 A;  5IH2 A;  2JXB A;  2RMO A;  3UA7 A;  3A98 A;  1X6B A;  3QWY A;  3FJ5 A;  5FWB A;  1KFZ A;  2CDT A;  2B86 A;  1K4U S;  1I1J A;  1UEC A;  5I22 A;  2VVK A;  2YDL A;  1WDX A;  5IXB A;  4LN2 A;  1GBR A;  1OPK A;  4J9E A;  4AFU C;  4EIK A;  1TG0 A;  3C0C A;  2KXC A;  1AWO A;  1V1C A;  3U23 A;  2QDL A;  2LJ0 A;  3NHN A;  4OMQ A;  2DL3 A;  1AWJ A;  3EG0 A;  4J9G A;  3O5Z A;  2KRS A;  2F2X A;  1RUW A;  1SSH A;  2OI3 A;  1K1Z A;  2CRE A;  2L3P A;  5IXF A;  5L23 A;  1W1F A;  2AKL A;  2RQT A;  4LUD A;  1GBQ A;  2JM8 A;  1UTI A;  3VRY A;  4JZ4 A;  1ARK A;  3EHQ A;  1GL5 A;  2ECZ A;  3EG3 A;  2OAW A;  1M3A A;  2HEQ A;  2KT1 A;  1VYV A;  1BBZ A;  1MUZ A;  2DJQ A;  3EGU A;  3THK A;  2XMF A;  3TSZ A;  1T3S A;  4D8K A;  4JZ3 A;  3EG2 A;  2BZX A;  1AZG B;  2GNC A;  2X3W D;  2GGR A;  1S1N A;  2MCN A;  2F2V A;  3KFV A;  2OJ2 A;  1X2K A;  1Z9Q A;  2DLP A;  1GCP A;  2ROT A;  2GTJ A;  1JXO A;  2RNA A;  2D8J A;  1KSW A;  1UHF A;  3PE0 A;  2LQW A;  1X69 A;  2DMO A;  2I0N A;  2RF0 A;  4RTU A;  1UDL A;  4JJD A;  2YUQ A;  3H0I A;  3M0T A;  1VA7 A;  1B3Q A;  1Z9Z A;  2CH4 A;  2CSQ A;  2KRN A;  2LMJ A;  2HSP A;  1K0X A;  3VS7 A;  2LZ6 B;  4M4Z A;  2SRC A;  3NMZ C;  1ABO A;  4GLM A;  2KBT A;  4E6R A;  2LCS A;  1NG2 A;  1HJD A;  2SEM A;  4CC7 A;  2FRY A;  2L3S A;  2YSQ A;  2HBW A;  3QWX X;  1T0J A;  2JTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...