1ZX6A

High-resolution crystal structure of yeast pin3 sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Ypr154wp
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zx6A00
2VVKA 3NGPA 3H0FA 2JM9A 2CT4A 2RMOA 3I5RA 3M0QA 2JTEA 1W70A 2LZ6B 3TSWA 4FSSA 2O9VA 4KRTA 2KRSA 1Y57A 1I07A 4JJCA 2K3BA 2YUOA 4ESRA 1I0CA 3NHNA 1FYNA 4Z8AA 1M27C 4J9GA 3REBB 4J9IA 1WXUA 1QKXA 1M30A 2B86A 2CUDA 2IIMA 3ZL7C 2DX1A 4DEYA 1YWPA 3KFVA 1QCFA 1TUDA 2YDLA 2CSQA 2EYXA 1QWFA 2LMJA 3I9QA 1TUCA 1H3HA 2JS2A 5IHKA 3REAB 2K7AA 1GBRA 4OMLA 1IO6A 4IIMA 2FO0A 1AZEA 1W1FA 2DL3A 2FG0A 2ED0A 4IIOA 2JT4A 3U23A 2X3XD 1UECA 1RUWA 1M3AA 1H92A 4J9FA 2P4RA 2AK5A 2HCKA 1AOJA 3VRYA 1Y0MA 1BBZA 2KE9A 2KRMA 2O88A 4JJDA 2PZ1A 1NEGA 2D1XA 2DMOA 1X2QA 5EC7A 2K2MA 4E6RA 2J6FA 1M3CA 2OJ2A 2DF6A 3VS5A 1K76A 4CC2A 2RQUA 1UDLA 2DILA 2JMAA 2RNAA 2PTKA 2DBMA 2CT3A 1ZUYA 4OMOA 1ZUUA 1AVZC 2LJ1A 1N5ZA 1JO8A 4J9CA 1JXMA 1QKWA 1BK2A 4RTYA 1WX6A 1GCPA 1A0NB 4GLMA 1PKSA 2F2XA 2H8HA 2J7IA 4Y92A 4J9EA 2ECZA 2KT1A 1T3LA 3TSZA 2CDTA 4M4ZA 4RUGA 2AKLA 1V1CA 2A28A 2J6OA 2GTJA 2EYZA 2QDLA 1U3OA 1NYGA 2DM1A 2EW3A 2XMFA 4J9HA 2KYMA 1SRLA 1WI7A 2GQIA 1RLPC 1K0SA 1WXBA 2RPNA 1B3QA 1GRIA 2BZXA 4JZ4A 2FRYA 2L3SA 2E5KA 3M0PA 3C0CA 3VS0A 2L3PA 3M0SA 4WCIA 5ECAA 1WXTA 3EGUA 2MOXA 2DL7A 4RTVA 3JV3A 3NPFA 4HVWA 4RTTA 2EKHA 2NWMA 1NLPC 1H8KA 4AFZC 1MV3A 2X3WD 1K4US 2DA9A 3VRZA 1KFZA 1J3TA 1AWOA 4LE9A 2K79A 2KYBA 1BB9A 2YUNA 1KSWA 1PRMC 5L23A 1T0JA 2EGEA 1AWWA 1ZX6A 1OOTA 3UA6A 1OPLA 3EG3A 1VYTA 1NYFA 1ZSGA 1AWXA 4OMPA 1NG2A 1UGVA 1WYXA 4OMQA 2RF0A 1JXOA 4CC3A 1KIKA 1GCQA 1GFCA 3VS4A 1AZGB 2RN8A 1U06A 5GJWB 2EPDA 2EYYA 1M8MA 2FPFA 1XOVA 2O31A 3R6NA 4D8DA 1QLYA 1GCQC 1SEMA 2ABLA 2VKNA 2EQIA 2GNCA 1X43A 2FRWA 2HEQA 3PVQA 1AEYA 4ORZA 1JEGA 2EGCA 1SSHA 4HCKA 2KXDA 2AZVA 4R0KA 1OEBA 4CC7A 2DLPA 1YWOA 2CH4A 1ARKA 2LCSA 2ENMA 1UHFA 1OV3A 1NLOC 1YN8A 1PHTA 3QWXX 1UFFA 1MV0B 2EYWA 4RTWA 2M0YA 4J9BA 2DYBA 1ZBJA 2HSPA 4Z88A 4EIKA 3I5SA 2YSQA 4J9DA 4QT7A 4JJBA 3VS7A 5FWBA 4RTXA 1PRLC 2FEIA 4F14A 2GTOA 2GGRA 2KEAA 2V1RA 2L0AA 1S1NA 1G83A 1WDXA 3QWYA 2SRCA 1ZUKA 1I1JA 1JU5C 2GBQA 1VA7A 2K6DA 1YNZA 1Z9QA 1E6HA 1YP5A 3VS1A 2LNHB 4AFUC 2FPDA 2RQTA 4JZ3A 2DJQA 1RLQC 3M0TA 2KNBB 3A98A 2ROLA 1W6XA 3O5ZA 3VS2A 2O2OA 3UA7A 3RNJA 1PWTA 1WIEA 1SHFA 4AG1C 1EFNA 1X27A 2DRMA 3GBQA 1SPKA 4RTUA 3LH5A 1Z9ZA 2JW4A 1T3SA 1X2KA 3THKA 4AG2C 1K0XA 2KXCA 4HVUA 2A36A 1JQQA 1RI9A 2LQWA 2HBWA 5HCKA 2KBTA 2A08A 3FJ5A 4CC4B 2LX7A 1T0HA 2M51A 1QWEA 1CKBA 2LJ0A 2AKKA 2KR3A 2BZ8A 2ED1A 3H0HA 2C0OA 3NMZC 1MUZA 2G6FX 1BU1A 5I22A 2CSIA 2JM8A 1X69A 5FWCA 2NUZA 1SHGA 1UJYA 3M0UA 2L3QA 2A37A 1HJDA 3SHWA 2KT8A 4X1VA 2J06A 2DL4A 1UHCA 2C0IA 2CREA 5IXBA 1WA7A 2MCNA 1ABQA 5GJVB 1K9AA 1TG0A 3TVTA 4HXJA 1ZLMA 2JS0A 4AFQC 1HSQA 2AZSA 1UJ0A 2KGTA 2W10A 2OAWA 1KJWA 2I0NA 4RTZA 1CSKA 2D8JA 4LNPA 1PKTA 2YUQA 1G2BA 1M3BA 1HD3A 5FW9A 3VS3A 1NEBA 2ROTA 1WLPB 5I11A 2DVJA 2D8HA 2FPEA 2K9GA 1UE9A 4OMNA 2CUBA 1UUEA 2DNUA 2JXBA 1WFWA 4Z89A 2KRNA 3PVLA 2LQNA 1UG1A 1OPKA 4HVVA 3EHQA 5IH2A 1NM7A 2RQVA 4F17A 2EGAA 3UF4A 3RBBB 2HDAA 3EG0A 2DRKA 1E6GA 2LP5A 2YUPA 3ULRB 4K11A 3CQTA 2LJ3A 1AWJA 4ZNXA 2EVRA 1U5SA 1VYVA 1GFDA 3IQLA 2KROA 3H41A 4DEXA 3H0IA 2DL5A 2V1QA 4OMMA 4LUEA 2MIOA 2W0ZA 1AD5A 4LUDA 3VS6A 2BZYA 1LCKA 2J05A 2ESWA 2BTTA 5IHNA 2DBKA 4A63B 1X6BA 1FMKA 2DE0X 2C0TA 2JMCA 2OI3A 3UATA 3M0RA 3SEMA 2CH4W 5IXFA 1VYUA 2D0NA 2J6KA 1CKAA 4JPBW 3EHRA 1PNJA 1X6GA 4F16A 2RQWA 2DL8A 1GL5A 1SRMA 3PE0A 2F2WA 1B07A 2RQRA 1UTIA 2SEMA 2O9SA 2PNIA 4GBQA 4AFSC 1ABOA 4D8KA 1E7OA 4LN2A 2F2VA 2VWFA 3I35A 2EBPA 1K1ZA 5IHIA 3EG2A 1YCSB 3EG1A 2L2PA 1GBQA 2YT6A
chains in the Genus database with same CATH superfamily
3NGPA 4IUQA 2LZ6B 3TSWA 1YHQT 1OQKA 3BY7A 5LJ5j 2FHDA 3UDCA 2JNGA 2KRSA 3JSCA 5FRNA 3CMEA 1WHHA 2K3BA 1M1KR 2YUOA 5M9OA 3CCRQ 4ESRA 3CXCS 1OYXA 3CCSA 3HFOA 1WXUA 1VQ7A 3QYHB 4DEYA 3KFVA 1TUDA 2CSQA 1QWFA 2LMJA 1TUGB 4FT4A 1D0YA 3LLRA 3S3MA 1GBRA 2HKQB 3RERA 4PJNA 3JCMf 2E4HA 3PFSA 4DBRA 2EFIA 2FO0A 2NYSA 1VQ8Q 4FL6A 4BE1A 1NPPA 3I56Q 5GAMd 2EQKA 4IIOA 1ZSZB 1ZSZA 2DK3A 2HNIA 4D6WA 5HY6A 1M3AA 3OW2S 4QVCA 4LDUA 5CR2A 1G5VA 2HCKA 2JVVA 1YJNT 2CS7A 2OTJQ 3S6WA 2KRMA 2O88A 1NEGA 2DXCA 4KGZB 1D0XA 3CBMA 4M78A 5CAIA 4XU2A 2MPXC 3RIRA 1VQ5Q 1UDLA 1R77A 2RNAA 2FYKA 4OF1A 1IGQA 1G3YA 3CMEQ 1OZ2A 3KBGA 3BDLA 1QKWA 5C0MA 1GCPA 2H8HA 1XNIA 3LH0A 2J7IA 3A8OB 5GAN7 3E2UA 3HRSA 1F1BB 4HKEA 1T3LA 4KULA 2CDTA 4ME7A 3OBWA 1V1CA 2OTLT 3RKWA 2RA2A 1O9SA 2QDYB 1U3OA 2EIFA 2KYMA 1SRLA 2GQIA 4RMOA 3FRNA 1RLPC 2E5QA 2RPNA 1B3QA 4KT0E 4C5EA 1GRIA 2BZXA 4M7DA 2CP5A 5ECAA 1XJWB 2DL7A 2DAQA 3CD6A 1JJ2P 1C0MA 1MV3A 1K4US 5GAOn 2QQRA 3LGLA 2QXFA 1WJSA 5GMKl 4LE9A 4M75A 2K79A 5DLOA 4M75D 1BB9A 3P8HA 1HYOA 2YUNA 3CC2Q 2E12A 5L23A 5FLXE 3GP8A 3FB9A 1AWWA 1ZX6A 1G8XA 4XTZA 1ZSGA 1AWXA 3OS2A 5A0DA 4BY6C 2DZCA 2LT4A 1IHVA 1U06A 3BW1A 5KYYB 3L2RA 5CKBA 1M1KU 4JLIA 2FPFA 1LPLA 1YJ9A 1MNEA 3CCEA 1QLYA 2ABLA 2VKNA 2EQIA 2RI3A 5FU7C 4PJOD 2VGNA 4M75B 2FRWA 2HEQA 3I56A 3DKMA 3OYEA 4R0KA 1M2VB 3FLGA 4MMKA 1G3WA 3NTKA 1YWOA 2CH4A 2K4YA 1YN8A 1PHTA 1K73R 1MMAA 1UFFA 1WJRA 4FW2A 3HSBA 1MV0B 2EYWA 3KUFA 4C0DC 8ATCB 2L89A 1R0CB 4AT1B 3ASKA 3I5SA 2RK2A 1QVFP 2YSQA 2MAMA 4Y91A 2JOYA 1VQLT 2GTOA 3ZEHA 2GGRA 2KEAA 3CPWA 5GAOp 4IUPA 2F1LA 2MI6A 3ZFJA 2SRCA 1FMWA 5HKCA 1ZUKA 2CP3A 2K6DA 3CCUT 1FXXA 1N8RR 1SSFA 2QA4Q 4JZ3A 4M7AA 3MP1A 3OY9A 2R57A 3M0TA 2EAYA 3VS2A 5GAN2 3RNJA 3CCVQ 4KUIA 3GF5A 1W2BP 1M90R 4X34A 1NZ9A 2QA4T 4ANJA 1KHCA 3JCMP 1Q81U 2X4JA 3M56A 3THKA 4AG2C 5GANj 1I81A 2KXCA 3QPHA 3G6ET 1C6VX 4B6MA 4PJMA 2KSSA 1S72T 2JTFA 1W2BS 2FZKB 1ZHIA 2KBTA 2A08A 4XTVA 4CC4B 5AYFA 1M9SA 2LX7A 1WHLA 4DQ2A 2BKDN 1M4ZA 1W2BA 1K9MU 2QQAA 3CC4Q 1RAFB 3NMZC 1N8RU 2COZA 1BU1A 1N9RA 1ZA1B 2CSIA 5I22A 1X69A 3SB2A 2FZCB 3M0UA 2L3QA 1HJDA 2J06A 2CREA 5IXBA 2L2PA 5IT9E 2MCNA 1ABQA 5GJVB 3VJPA 3OYKA 2JS0A 1HSQA 2YRCA 5KE3A 3SWNB 1TH7A 3X26B 3CCJT 1BI2A 2EYQA 2RJDA 3CCLQ 4KGXB 2OAWA 1I8FA 4RTZA 3JB9D 4OMFB 2JZ2A 2QGFB 2D8JA 4MDWA 3OYFA 1UGRB 4A4HA 1MMGA 3FJPA 1NEBA 3EAEA 3O8VA 5I11A 2DTHA 1N9SA 4ZGJB 4FYWB 2D8HA 3G6EA 1UE9A 1UUEA 2YWWA 1OZ3A 1UG1A 2O01E 4HVVA 5IH2A 2JJ9A 4X9CA 2RQVA 4C92B 1K8AC 3J81E 3UF4A 3RBBB 4QKUA 5GANf 2HDAA 4PJOF 2DRKA 1KG1A 2LP5A 3JCMX 3CC7T 2LJ3A 1KD1U 2LVMA 2EVRA 3PIOA 2CP2A 1VYVA 1I5LA 1M5Q1 4R55A 2OX7A 3H0IA 4A4FA 4L5GA 1B7TA 4OMMA 4M77F 2RB6A 3CCET 1YITA 2MIOA 4F7UF 1AD5A 4J83A 1WQ7A 3LWHA 3X20B 4PJOG 2ESWA 4XTUA 2WACA 4E7HA 1X6BA 3V8JA 2DE0X 3MEWA 2DXBA 2M9UA 2C0TA 3G1JA 3L42A 3UATA 3OSSC 4PLIA 2D0NA 3JRZA 1FMVA 1VQNQ 2DL8A 4BY6B 2HAXA 1W4SA 4M77G 4J6YA 2C06A 5GMKm 2XKOC 2YRVA 4NL3A 4A54A 2O9SA 2PNIA 4AFSC 3V7CA 2F2VA 2A3LA 1X6OA 1K8AU 5FU7B 4FW1A 1UGPB 2WSFE 2P84A 2MYSA 1GBQA 4XAXB 3GLXA 3H0FA 2JM9A 3I5RA 2NUTA 1W70A 3X28B 1Q82R 5D6WA 2O9VA 3MEAA 3A8HB 1Y57A 1I07A 5HK3A 3HTRA 1VQ7T 2RJCA 4WF2A 2EQJA 1VQPQ 4Z8AA 4J9GA 1YJNQ 3REBB 4N4IA 1H641 1QKXA 2B86A 2IIMA 3DB3A 1BIBA 4QW2A 4ZN1A 2GQVA 1RAAB 4EMHA 1H3HA 2JS2A 5IHKA 3CCQQ 2RO0A 3REAB 4M78E 1IO6A 3CC7Q 3JAME 1AZEA 3PIPA 4QQ6A 2GCXA 1W1FA 3DLMA 3M53A 3QUIA 3TQ7P 4BI4A 1VQNA 4V2SA 5GAMf 2IPOB 1LVKA 1OULA 2ED0A 2ZPIB 3L2QA 4M7AD 1VQ6Q 4C92C 3U23A 2X3XD 1UECA 4J9FA 1TXQA 1N8RC 4DBFA 4J8OA 4LD9K 1Y0MA 3CCVT 5LJ5f 4M77B 3MEUA 2ZPGB 2RI2A 2X51A 4JJDA 4OP0A 4FIBA 4C0GA 3OA6A 1VQ4A 3E9GA 3CCMT 2J6FA 5KYXA 3G4SQ 4GY5A 5GAMh 3M54A 2CT3A 1YJWA 3EFOB 3C94A 1VQPA 1Q82C 1H3ZA 1ZUUA 1N5ZA 1JO8A 2X4XA 2RK1A 1V29B 4J9CA 1JXMA 1QVFA 1VQKA 3CD6T 1G3SA 1BK2A 2DO3A 1WX6A 1A0NB 4GLMA 1M2VA 4Y92A 2ECZA 2KT1A 3GNFB 4M75F 3TSZA 4ELYC 4RUGA 1FWZA 1WHJA 2QDLA 3QSUA 3M55A 3OS5A 3OSVA 2XMFA 2MWPA 1WI7A 4BI8B 2ZPEB 1VQ9T 4JS5A 2D9TA 4JZ4A 1VQOQ 2L3SA 3M0PA 2M1HA 1U1SA 4Z02A 4WCIA 4QQDA 4RTTA 2NWMA 3L2VA 2DA9A 1RAIB 3VRZA 5GAOm 2JN0A 5D6XA 1AWOA 1D09B 2KYBA 1QVGA 2M02A 2XIDA 2LNVA 3CCMQ 1T0JA 4PJLA 1K73C 2F5KA 4ZTJA 1OPLA 3EG3A 1NYFA 5EG2A 4OB1B 1Q95G 4KBMB 4M7AF 1UGVA 1WYXA 1PD1A 4DOVA 1KC8C 4EMKB 1GCQA 1AZGB 5GJWB 2EPDA 1M8MA 1WNLA 4PK4A 3R6NA 2HQXA 4JDSA 3RUXA 3RDVA 3G4ST 3CC2A 1IRXA 1WHGA 1D3BB 1YJ9T 3EGDB 1Q86C 3NTHA 1AEYA 1JRIA 4ORZA 3CC4T 1NPRA 2AZVA 1SG5A 2DLPA 3QBYA 2ZZDA 1IREB 1ARKA 3A8LB 2Z0WA 2DEUA 1VQ6A 5KYUA 4C8QG 1D1BA 1OV3A 3OMGA 4J7FA 5LJ3e 2BE7D 3RKXA 3DB4A 4BDYA 3ER0A 2QEXT 2XK0A 4EIKA 2HZYA 4FYXB 4J9DA 3VS7A 2EJ9A 4MZMA 1PRLC 4C92A 4F14A 2E1HA 4RCBA 5CK9A 2OTLA 1IB8A 2V1RA 1TSFA 2E10A 3VUBA 4QVDA 1RI0A 4C5IA 8AT1B 1EIFA 3CCUQ 1YNZA 1YIJA 1YP5A 3EH2A 4AFUC 4X9DA 3HFNA 4ELZC 1NJIC 4EDUA 2K2VA 2V8IA 4HCBA 1BI1A 2RHZA 2KNBB 2ROLA 1W6XA 3O5ZA 3MO8A 1I5OB 3LYIA 3OMCA 3J80E 1X27A 3QHSA 2R58A 2E70A 4B9XA 3JB9J 1X2KA 2BE9B 3A1PA 2XDDA 5CKFA 1OX9A 2ZPBB 4BE2A 2H3EB 2R5MA 4JRQA 1JQQA 4KGVB 1RI9A 2LQWA 1LOJA 1I4K1 2CZ0B 1RADB 2RI5A 3MHXA 4O6JA 5A0GA 4J6WA 2V8JA 2M51A 4M75G 1QWEA 3M5AA 4MMLA 2AKKA 2BZ8A 3H0HA 1MUZA 2G6FX 3CCSQ 1RAHB 2NUZA 2A0FB 1SHGA 5D7UA 1OX8A 3JCMh 2K5LA 1UJYA 4E7SA 4J7IA 2QGGA 4X1VA 2DL4A 4VUBA 2DETA 1BCOA 3CCRT 1WA7A 3CCJA 1K9MC 1TG0A 4HXJA 1ZLMA 2L8DA 4KUDK 1Q7YU 2E6NA 1D1AA 2KDSA 1OU8A 3VKIA 2YUQA 1PSFA 2Y4XA 5GAMg 1G2BA 4B9WA 1M3BA 1EZZB 4XK8E 1PG5B 1HD3A 5KYXB 1OI1A 5FW9A 3MCAB 2ROTA 4II1A 2BUDA 1K73U 2KRNA 3QG1A 3PVLA 3DLLA 1OPKA 4DA4A 3EHQA 5GAOq 1NM7A 3CCQT 5LJ3h 2B8AA 1YBYA 3CCEQ 3H9NA 3MJXA 4IURA 2EGAA 2DERA 3LX7A 3PMIA 2K5FA 1E6GA 3S3NA 3AHUA 3JB9I 2YUPA 3PNWC 3OB9A 1Y96A 4K11A 2DIGA 2RJEA 4LDWA 5KCHA 4M7DG 1KHIA 4ZNXA 2LCCA 3IQLA 2KROA 1SKUB 3H41A 4FSXA 2DL5A 4QQGA 3NTIA 2HL5C 4PL6A 5GMKj 2OTLQ 2X4WA 2XI9A 3F70A 2W0ZA 4LUDA 2YLCA 1MMDA 1YCYA 3M4GA 1MHNA 4MZTA 4M75E 4N4HA 3P8BB 3CMET 2KI7A 2JMCA 3I55A 2CH4W 2QYZA 5DM7R 1VYUA 4C0DB 4JPBW 2DXUA 1X6GA 4F16A 4PJOA 1SRMA 3PE0A 4E2FB 3H6ZA 2RHXA 5CCAA 2F2WA 3HKSA 1S72Q 1UTIA 2SEMA 4M7DE 2PQWA 2CKKA 4TVRA 1E7OA 2QASA 3CXCA 1PSEA 3EG1A 4RG8A 5CKHA 2CT4A 1VUBA 3META 3M0QA 3OBYA 4FSSA 3M57A 2QA4A 3L2ZA 2HQEA 3S3OA 4EPCA 3QJYA 1B34B 4FU6A 2G3RA 1I0CA 2DFUA 1FYNA 2QK0A 1M27C 3C12A 1IXDA 3CC4A 4J9IA 2CUDA 2M0OA 2DX1A 5LJ3j 1YWPA 1QCNA 5GANe 2QG9B 3RMSA 3I9QA 1VQ6T 1UGSB 5GAMe 3OYLA 3OW2A 3FDRA 5J26A 1Q86U 2K7AA 3LGFA 4OMLA 2X9HA 4FT2A 2LQ8A 4IIMA 3QZ9B 3I55T 1YITT 2FL7A 3URGA 3GNGA 3HHTB 1VQ4Q 3QYGB 3QIIA 3QO3A 4LXCA 3OYHA 3JCMe 2L5QA 1H92A 2P4RA 2P4TA 4PLLA 5KYWA 1M8VA 4LDYA 4IUUA 2D1XA 2RHYA 1X2QA 5EC7A 2K2MA 3TEEA 5GAN8 2Y90A 4XU1A 1M3CA 2OJ2A 2DF6A 3VS5A 1K76A 4CC2A 5GANh 1U8RA 1KQ1A 1HXDA 2JMAA 2LC4A 2I2LA 1ZUYA 1YFNA 4OMOA 1VOMA 4C8QC 2LJ1A 3UT1A 2X35A 3G71T 4BE0A 3SWNA 2XICA 2K57A 4KH0B 2OAUA 4PJJA 1BYMA 2P0PA 3MEVA 2CZ6B 2F69A 1PKSA 2F2XA 1PD0A 5GAN3 1YJWQ 2XD0A 2D0QB 2QQSA 2AKLA 5D6YA 2A28A 1RABB 2GTJA 1NYGA 2EW3A 3E1SA 2HBPA 2HSEB 4CRIA 4M77E 3LW5E 1QP3A 1K0SA 1WXBA 2JUFA 9ATCB 4C0ZA 3JB9G 2ZAEA 2FRYA 2E5KA 3C0CA 1YJWT 3M0SA 1NBEB 2KAFA 3VV0A 3QKJA 4PJOE 2DIQA 1WXTA 3EGUA 5CVIA 4RTVA 2WSEE 4HVWA 3NPFA 1YI2A 2EKHA 4A4KA 3KXTA 1UEBA 1NLPC 1VQKT 4AFZC 5DY9A 1PM3A 4E7JA 1WHMA 4F7UG 5J3BA 3OS1A 1J3TA 2HD0A 3JCMg 4JRIA 1IHWA 1OOTA 5LJ5e 4MZPA 3RR6A 1VYTA 2DJZA 2O4XA 4PFZA 4OMPA 2A7YA 1Y96B 3T9NA 4F7UA 4JJNK 4F7UB 2PU9B 4OMQA 2RF0A 4C92G 1GFCA 5KYUB 1QQJA 2EYYA 1IGUA 3HP9A 3VUZA 1XOVA 2O31A 2HKNA 1VIEA 2GFAA 1GCQC 5GAOl 5J39A 1R8OB 2GNCA 1DJ7B 1X43A 1LNXA 3EGDA 3PVQA 1QCOA 3TREA 2OTJA 2QEXQ 3CPWP 1JEGA 4M7AG 1SSHA 4HCKA 2KXDA 2DPPB 2H3JA 1C1AA 5GMKi 2X4YA 2LCSA 1UHFA 2ENMA 1NLOC 3QWXX 3CPWS 1QP2A 4NOYA 3EGXA 7AT1B 4J9BA 2DYBA 1ZBJA 5FRMA 1BI3A 4C5HA 4QT7A 1JJ2S 2PVOB 3BDUA 5FWBA 1YHQQ 5IAYA 1GXIE 2VC8A 2P0QA 1XTDA 5I2MA 2FEIA 4IUVA 2FB7A 1VQ7Q 2CP7A 2EQMA 5FROA 2K5IA 3JB9H 4HCCA 2L0AA 1S1NA 3OW2P 1MNDA 4OB3B 4E7LA 1JU5C 2GBQA 1EX4A 3VS1A 3GPLA 1VQMT 3HL8A 4HA8A 4LDVA 3A98A 2VUBA 3UA7A 4OVAA 1WIEA 1KQSS 1EFNA 1RL2A 3G71A 3EFRA 4BI3A 1Q7YR 2YRDA 4RTUA 1WGSA 4OGCA 2JW4A 1S72A 1NJIU 2LDMA 4RG2A 1KQSA 3CMAA 4J5YA 5GAN6 4HVUA 3SFMA 5A2QE 5FU6C 2OTJT 4FCYA 1Y7XA 4M78D 1RACB 2E64A 4C8QE 2HBWA 1Y71A 3FJ5A 3WVEB 1YIJQ 3EFOA 4PNOA 5LJ5g 4M7AE 1T0HA 2CGHA 1CKBA 2V26A 2LJ0A 2C0OA 2DEQA 3A8GB 1VQ8T 3VYHB 4CI0C 3CCRA 2YLBA 1XQHA 1YHQA 5C6SA 3RMQA 3JCMc 1TU0B 2C0IA 1KD1C 4C92E 4ZTFA 1K9AA 3TVTA 1LJOA 1VQLA 4AFQC 3QZ5B 3EG9A 2KGTA 2W10A 3INZA 4E47A 3M58A 1PKTA 3BE3A 2O4XB 4QVZA 3GOXA 4N0AC 2EKOA 2CZ7B 3V8KA 3E19A 4LDXA 1O75A 4A4GA 3A8MB 2NUPB 4PKCC 4OMNA 1BI0A 2CUBA 1WFWA 1ACMB 4Z89A 2GF7A 3OYAA 4JLGA 1VIFA 2M16A 3D7SB 4ZGDB 4F17A 4XTYA 3CCST 2CZ1B 2BIVA 4XU3A 3EG0A 1VQLQ 2EQUA 5CQXA 2EWNA 2E41A 3ULRB 1QMCA 3CQTA 4WTOB 2NUTB 2KK4A 5GAMj 2QI2A 2QQBA 3EH1A 4F7UE 1VQKQ 4OB0B 2NUPA 1GFDA 1VQ9A 2E6ZA 4HCZA 4RCCA 1Q86R 2MF2A 4LUEA 1Y07A 4JS4A 2BZYA 1D1CA 3PMTA 3HPWA 4C8QF 3SWNC 2BTTA 3ZBDA 2DBKA 5CQYA 1PC0A 5KCOA 3M0RA 4BDZA 5IXFA 3G6EQ 2J6KA 2DYIA 5CKEA 5LL6S 1KC8U 3EHRA 2CP0A 5LJ5d 3Q1JA 2QAZA 1GL5A 5DLQE 2QQ9A 2RQRA 2VXFA 4XTWA 2ZGWA 4LN2A 4OB2B 4A4EA 2EBPA 1K1ZA 2QTVA 2ZPHB 3EG2A 4C8QD 4E7KA 1YI2T 1YJ9Q 1QVPA 2RHUA 2VVKA 3G7ZA 5KYNA 5KYWB 2RMOA 2JTEA 1D0ZA 4PFPA 4KRTA 4JRKA 4DBQA 2LQKA 3TCJA 4JJCA 5L8RE 2HQHA 3M59A 3M4YA 3NHNA 4NS5A 5I21A 1HK9A 1QVGP 4AMCA 1M30A 4L59A 3ZL7C 4C92D 1QCFA 2YDLA 5CIUA 2EYXA 4C5GA 4E7ZA 4M7DC 1TUCA 3CCMA 2K3YA 2VV5A 3JCMV 3QDRB 4J6XA 3BFMA 1QVFS 5A0LA 3RESA 3MP6A 1JB0E 1JJ2A 2DVEA 1X01A 5CKDA 2DL3A 2KQWA 1KC8R 3HRUA 2FG0A 5I2SA 1G3TA 2JT4A 4M7AC 4M78G 1RUWA 1VQOT 1P92A 4C8QB 2YHTA 3CMAQ 2VXEA 2AK5A 1AOJA 3VRYA 1IZ6A 1BBZA 2KE9A 2MWOA 2F5TX 2PZ1A 2NLUA 2DXTA 2DMOA 3G71Q 4E6RA 4N4GA 1FX7A 1WJQA 3A5ZB 1ZSZC 1WHKA 2DILA 2DTIA 2RQUA 3V7RA 1VQ5T 2PTKA 2DBMA 3CCLT 4PJOB 5FU6B 5LJ3f 2L3RA 3VU3C 4PFOA 1N27A 2YXYA 1AVZC 3V8LA 1RAGB 3M9QA 1U1TA 4BD3A 3NFCA 4XQ3A 2K3XA 2RHIA 3TU4K 4RTYA 3OYCA 4IKFA 3JCMJ 2IG0A 4J9EA 3QJ6A 1X75C 4M4ZA 4FM4B 5KYYA 4A53A 2J6OA 2EYZA 5GAOr 1NJIR 1M2OA 2DM1A 3X24B 5GANd 1BKBA 4J9HA 2PVGB 2RM4A 2XU8A 2GFUA 2AIRB 3C4SA 3CBOA 2DZ9A 3RKYA 1VQ8A 3VS0A 3OYNA 2L3PA 1TOVA 4M7DF 1QW1A 3VYGA 2JTMA 1VQPT 2MOXA 2KMTA 3JV3A 3SDZA 3OQ5A 3C95A 1H8KA 2FZGB 2X3WD 1ZQ1A 6AT1B 2EJFA 1KFZA 3PTAA 4FYVB 3FEOA 1Q82U 1UGQB 2ZPFB 3CCQA 2LT1A 4P5NA 4ZGEB 3CPFA 1KSWA 1PRMC 5GAN4 4M7DB 4M75C 4BUGA 4PJOC 2EGEA 3UA6A 1VQMA 4ZN3A 1JBMA 4YTLA 1K9MR 1M1FA 1WPYA 4M7DD 4EMKA 1NG2A 2ATCB 2P0KA 1JXOA 2E65A 4CC3A 1KIKA 3VS4A 2RN8A 4EMGA 3G4SA 3CC2T 2DD4A 1VQNT 5IN1A 2VB6A 4D8DA 1SEMA 2RJFA 2AT1B 3JCMW 3AT1B 3WVDB 1B34A 1Q81R 1N6AA 2EGCA 4R56A 4C92F 3J7AF 1OEBA 4UC4A 3CXCP 4CC7A 4DOWA 3I56T 2KVQG 1TTHB 1NE8A 1V76A 1YIJT 4ATOA 2CYZB 4EMKC 4L6V5 4M78B 2LCLA 1QVGS 3CCVA 1AHJB 3PGGA 2PUKB 3OYIA 3WXMB 3P8DA 4RTWA 2M0YA 3JCMb 4HT8A 1KD1R 3L2UA 2WSCE 4RKUE 4F04B 2HSPA 1TWBA 1KQ2A 4Z88A 1M1GA 3MPUB 4DBHA 2XDPA 2XHCA 4JJBA 1VQ9Q 3LWIA 2RD1A 4RTXA 5KE2A 4BACA 1G83A 1WDXA 3QWYA 1RAEB 1I1JA 4IUTA 1VQMQ 1KQSP 1VA7A 4M78F 1Z9QA 1E6HA 3OYMA 3OS0A 2LNHB 1ZBXA 2FPDA 2RQTA 3L1AA 3UPUA 2DJQA 4NL2A 3CEYA 1RLQC 2PUOB 1WZOA 2O2OA 1PWTA 1Q7YC 1SHFA 4AG1C 4C8QA 1VQOA 2DD5A 2COWA 4MDXA 4HT9A 2DRMA 2R5AA 3GBQA 1UB4A 1SPKA 3LH5A 4Q5WA 1K8AR 4M77D 1Z9ZA 1T3SA 1BCMA 1K0XA 2FVUA 2MMPA 1MGQA 4M78C 2A36A 2XDBA 2DTOA 4Y28E 1VQ4T 3CC7A 5HCKA 2COYA 3I55Q 1D3BA 1OU9A 4M7AB 3R6OA 1R0BG 3EFSA 3CCUA 3SD4A 4JRPA 1Q81C 2AHJB 1ZA2B 5LJ3g 1KK7A 4N0AA 2KR3A 2ED1A 4GLKA 2KY9A 2JM8A 5FWCA 4M77C 1PCXA 2A37A 3SHWA 2KT8A 3JB9F 1UHCA 3OYYA 4LD6A 1AT1B 1YI2Q 1BIAA 3MP8A 2AZSA 5LJ3d 1UJ0A 2VYTA 3GIBA 3MKDA 3CD6Q 1KJWA 2I0NA 1CSKA 4LNPA 4KH1B 2LTOA 2IVWA 2PVDB 4C0FA 3ME9A 2RH2A 3QDFA 3VS3A 3OYJA 4FYYB 1WLPB 3CCLA 5HK0A 4OGEA 5CO7A 2DVJA 2QEXA 2DKGA 2EJGA 2FPEA 2K9GA 3N5BB 2DNUA 2JXBA 3FIFA 5AT1B 2E3HA 2LQNA 2HMAA 3CBPA 2VGMA 4XU0A 2LRQA 2D6FA 2Y4YA 3EG9B 3CMAT 1M90C 3OYGA 1YJNA 1YITQ 3JCMd 3CCJQ 3HRTA 1AWJA 3UWNA 5LJ5h 1U5SA 3EGXB 4DEXA 2V1QA 3JCMQ 2QTXA 1VQ5A 1MMNA 5GMKe 3VS6A 1TS9A 1LCKA 2J05A 5GANg 1SF9A 5IHNA 2HL3A 2V8KA 4BB7A 4A63B 4O5VA 5GAN5 4E7IA 1FMKA 2E3IA 3OYDA 2OI3A 3H8ZA 5GMKh 3SEMA 5KH6A 2LX9A 1WQWA 2VASA 1CKAA 1PNJA 3FC3A 3V7SA 2RQWA 2MK5A 3PT9A 1M1KC 1B07A 3QXEB 4XTXA 3E9FA 4GBQA 1ABOA 4D8KA 2VWFA 2ZCFB 3I35A 3X25B 4JUVA 5IHIA 1M90U 1YCSB 2CP6A 3OYBA 3L2WA 4M77A 2XG8D 2YT6A
chains in the Genus database with same CATH topology
2VVKA 3NGPA 3H0FA 2JM9A 2CT4A 2RMOA 3I5RA 3M0QA 2JTEA 1W70A 2LZ6B 3TSWA 4FSSA 2O9VA 4KRTA 2KRSA 1Y57A 1I07A 4JJCA 2K3BA 2YUOA 4ESRA 1I0CA 3NHNA 1FYNA 4Z8AA 1M27C 4J9GA 3REBB 4J9IA 1WXUA 1QKXA 1M30A 2B86A 2CUDA 2IIMA 3ZL7C 2DX1A 4DEYA 1YWPA 3KFVA 1QCFA 1TUDA 2YDLA 2CSQA 2EYXA 1QWFA 2LMJA 3I9QA 1TUCA 1H3HA 2JS2A 5IHKA 3REAB 2K7AA 1GBRA 4OMLA 1IO6A 4IIMA 2FO0A 1AZEA 1W1FA 2DL3A 2FG0A 2ED0A 4IIOA 2JT4A 3U23A 2X3XD 1UECA 1RUWA 1M3AA 1H92A 4J9FA 2P4RA 2AK5A 2HCKA 1AOJA 3VRYA 1Y0MA 1BBZA 2KE9A 2KRMA 2O88A 4JJDA 2PZ1A 1NEGA 2D1XA 2DMOA 1X2QA 5EC7A 2K2MA 4E6RA 2J6FA 1M3CA 2OJ2A 2DF6A 3VS5A 1K76A 4CC2A 2RQUA 1UDLA 2DILA 2JMAA 2RNAA 2PTKA 2DBMA 2CT3A 1ZUYA 4OMOA 1ZUUA 1AVZC 2LJ1A 1N5ZA 1JO8A 4J9CA 1JXMA 1QKWA 1BK2A 4RTYA 1WX6A 1GCPA 1A0NB 4GLMA 1PKSA 2F2XA 2H8HA 2J7IA 4Y92A 4J9EA 2ECZA 2KT1A 1T3LA 3TSZA 2CDTA 4M4ZA 4RUGA 2AKLA 1V1CA 2A28A 2J6OA 2GTJA 2EYZA 2QDLA 1U3OA 1NYGA 2DM1A 2EW3A 2XMFA 4J9HA 2KYMA 1SRLA 1WI7A 2GQIA 1RLPC 1K0SA 1WXBA 2RPNA 1B3QA 1GRIA 2BZXA 4JZ4A 2FRYA 2L3SA 2E5KA 3M0PA 3C0CA 3VS0A 2L3PA 3M0SA 4WCIA 5ECAA 1WXTA 3EGUA 2MOXA 2DL7A 4RTVA 3JV3A 3NPFA 4HVWA 4RTTA 2EKHA 2NWMA 1NLPC 1H8KA 4AFZC 1MV3A 2X3WD 1K4US 2DA9A 3VRZA 1KFZA 1J3TA 1AWOA 4LE9A 2K79A 2KYBA 1BB9A 2YUNA 1KSWA 1PRMC 5L23A 1T0JA 2EGEA 1AWWA 1ZX6A 1OOTA 3UA6A 1OPLA 3EG3A 1VYTA 1NYFA 1ZSGA 1AWXA 4OMPA 1NG2A 1UGVA 1WYXA 4OMQA 2RF0A 1JXOA 4CC3A 1KIKA 1GCQA 1GFCA 3VS4A 1AZGB 2RN8A 1U06A 5GJWB 2EPDA 2EYYA 1M8MA 2FPFA 1XOVA 2O31A 3R6NA 4D8DA 1QLYA 1GCQC 1SEMA 2ABLA 2VKNA 2EQIA 2GNCA 1X43A 2FRWA 2HEQA 3PVQA 1AEYA 4ORZA 1JEGA 2EGCA 1SSHA 4HCKA 2KXDA 2AZVA 4R0KA 1OEBA 4CC7A 2DLPA 1YWOA 2CH4A 1ARKA 2LCSA 2ENMA 1UHFA 1OV3A 1NLOC 1YN8A 1PHTA 3QWXX 1UFFA 1MV0B 2EYWA 4RTWA 2M0YA 4J9BA 2DYBA 1ZBJA 2HSPA 4Z88A 4EIKA 3I5SA 2YSQA 4J9DA 4QT7A 4JJBA 3VS7A 5FWBA 4RTXA 1PRLC 2FEIA 4F14A 2GTOA 2GGRA 2KEAA 2V1RA 2L0AA 1S1NA 1G83A 1WDXA 3QWYA 2SRCA 1ZUKA 1I1JA 1JU5C 2GBQA 1VA7A 2K6DA 1YNZA 1Z9QA 1E6HA 1YP5A 3VS1A 2LNHB 4AFUC 2FPDA 2RQTA 4JZ3A 2DJQA 1RLQC 3M0TA 2KNBB 3A98A 2ROLA 1W6XA 3O5ZA 3VS2A 2O2OA 3UA7A 3RNJA 1PWTA 1WIEA 1SHFA 4AG1C 1EFNA 1X27A 2DRMA 3GBQA 1SPKA 4RTUA 3LH5A 1Z9ZA 2JW4A 1T3SA 1X2KA 3THKA 4AG2C 1K0XA 2KXCA 4HVUA 2A36A 1JQQA 1RI9A 2LQWA 2HBWA 5HCKA 2KBTA 2A08A 3FJ5A 4CC4B 2LX7A 1T0HA 2M51A 1QWEA 1CKBA 2LJ0A 2AKKA 2KR3A 2BZ8A 2ED1A 3H0HA 2C0OA 3NMZC 1MUZA 2G6FX 1BU1A 5I22A 2CSIA 2JM8A 1X69A 5FWCA 2NUZA 1SHGA 1UJYA 3M0UA 2L3QA 2A37A 1HJDA 3SHWA 2KT8A 4X1VA 2J06A 2DL4A 1UHCA 2C0IA 2CREA 5IXBA 1WA7A 2MCNA 1ABQA 5GJVB 1K9AA 1TG0A 3TVTA 4HXJA 1ZLMA 2JS0A 4AFQC 1HSQA 2AZSA 1UJ0A 2KGTA 2W10A 2OAWA 1KJWA 2I0NA 4RTZA 1CSKA 2D8JA 4LNPA 1PKTA 2YUQA 1G2BA 1M3BA 1HD3A 5FW9A 3VS3A 1NEBA 2ROTA 1WLPB 5I11A 2DVJA 2D8HA 2FPEA 2K9GA 1UE9A 4OMNA 2CUBA 1UUEA 2DNUA 2JXBA 1WFWA 4Z89A 2KRNA 3PVLA 2LQNA 1UG1A 1OPKA 4HVVA 3EHQA 5IH2A 1NM7A 2RQVA 4F17A 2EGAA 3UF4A 3RBBB 2HDAA 3EG0A 2DRKA 1E6GA 2LP5A 2YUPA 3ULRB 4K11A 3CQTA 2LJ3A 1AWJA 4ZNXA 2EVRA 1U5SA 1VYVA 1GFDA 3IQLA 2KROA 3H41A 4DEXA 3H0IA 2DL5A 2V1QA 4OMMA 4LUEA 2MIOA 2W0ZA 1AD5A 4LUDA 3VS6A 2BZYA 1LCKA 2J05A 2ESWA 2BTTA 5IHNA 2DBKA 4A63B 1X6BA 1FMKA 2DE0X 2C0TA 2JMCA 2OI3A 3UATA 3M0RA 3SEMA 2CH4W 5IXFA 1VYUA 2D0NA 2J6KA 1CKAA 4JPBW 3EHRA 1PNJA 1X6GA 4F16A 2RQWA 2DL8A 1GL5A 1SRMA 3PE0A 2F2WA 1B07A 2RQRA 1UTIA 2SEMA 2O9SA 2PNIA 4GBQA 4AFSC 1ABOA 4D8KA 1E7OA 4LN2A 2F2VA 2VWFA 3I35A 2EBPA 1K1ZA 5IHIA 3EG2A 1YCSB 3EG1A 2L2PA 1GBQA 2YT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VVK A;  3NGP A;  3H0F A;  2JM9 A;  2CT4 A;  2RMO A;  3I5R A;  3M0Q A;  2JTE A;  1W70 A;  2LZ6 B;  3TSW A;  4FSS A;  2O9V A;  4KRT A;  2KRS A;  1Y57 A;  1I07 A;  4JJC A;  2K3B A;  2YUO A;  4ESR A;  1I0C A;  3NHN A;  1FYN A;  4Z8A A;  1M27 C;  4J9G A;  3REB B;  4J9I A;  1WXU A;  1QKX A;  1M30 A;  2B86 A;  2CUD A;  2IIM A;  3ZL7 C;  2DX1 A;  4DEY A;  1YWP A;  3KFV A;  1QCF A;  1TUD A;  2YDL A;  2CSQ A;  2EYX A;  1QWF A;  2LMJ A;  3I9Q A;  1TUC A;  1H3H A;  2JS2 A;  5IHK A;  3REA B;  2K7A A;  1GBR A;  4OML A;  1IO6 A;  4IIM A;  2FO0 A;  1AZE A;  1W1F A;  2DL3 A;  2FG0 A;  2ED0 A;  4IIO A;  2JT4 A;  3U23 A;  2X3X D;  1UEC A;  1RUW A;  1M3A A;  1H92 A;  4J9F A;  2P4R A;  2AK5 A;  2HCK A;  1AOJ A;  3VRY A;  1Y0M A;  1BBZ A;  2KE9 A;  2KRM A;  2O88 A;  4JJD A;  2PZ1 A;  1NEG A;  2D1X A;  2DMO A;  1X2Q A;  5EC7 A;  2K2M A;  4E6R A;  2J6F A;  1M3C A;  2OJ2 A;  2DF6 A;  3VS5 A;  1K76 A;  4CC2 A;  2RQU A;  1UDL A;  2DIL A;  2JMA A;  2RNA A;  2PTK A;  2DBM A;  2CT3 A;  1ZUY A;  4OMO A;  1ZUU A;  1AVZ C;  2LJ1 A;  1N5Z A;  1JO8 A;  4J9C A;  1JXM A;  1QKW A;  1BK2 A;  4RTY A;  1WX6 A;  1GCP A;  1A0N B;  4GLM A;  1PKS A;  2F2X A;  2H8H A;  2J7I A;  4Y92 A;  4J9E A;  2ECZ A;  2KT1 A;  1T3L A;  3TSZ A;  2CDT A;  4M4Z A;  4RUG A;  2AKL A;  1V1C A;  2A28 A;  2J6O A;  2GTJ A;  2EYZ A;  2QDL A;  1U3O A;  1NYG A;  2DM1 A;  2EW3 A;  2XMF A;  4J9H A;  2KYM A;  1SRL A;  1WI7 A;  2GQI A;  1RLP C;  1K0S A;  1WXB A;  2RPN A;  1B3Q A;  1GRI A;  2BZX A;  4JZ4 A;  2FRY A;  2L3S A;  2E5K A;  3M0P A;  3C0C A;  3VS0 A;  2L3P A;  3M0S A;  4WCI A;  5ECA A;  1WXT A;  3EGU A;  2MOX A;  2DL7 A;  4RTV A;  3JV3 A;  3NPF A;  4HVW A;  4RTT A;  2EKH A;  2NWM A;  1NLP C;  1H8K A;  4AFZ C;  1MV3 A;  2X3W D;  1K4U S;  2DA9 A;  3VRZ A;  1KFZ A;  1J3T A;  1AWO A;  4LE9 A;  2K79 A;  2KYB A;  1BB9 A;  2YUN A;  1KSW A;  1PRM C;  5L23 A;  1T0J A;  2EGE A;  1AWW A;  1ZX6 A;  1OOT A;  3UA6 A;  1OPL A;  3EG3 A;  1VYT A;  1NYF A;  1ZSG A;  1AWX A;  4OMP A;  1NG2 A;  1UGV A;  1WYX A;  4OMQ A;  2RF0 A;  1JXO A;  4CC3 A;  1KIK A;  1GCQ A;  1GFC A;  3VS4 A;  1AZG B;  2RN8 A;  1U06 A;  5GJW B;  2EPD A;  2EYY A;  1M8M A;  2FPF A;  1XOV A;  2O31 A;  3R6N A;  4D8D A;  1QLY A;  1GCQ C;  1SEM A;  2ABL A;  2VKN A;  2EQI A;  2GNC A;  1X43 A;  2FRW A;  2HEQ A;  3PVQ A;  1AEY A;  4ORZ A;  1JEG A;  2EGC A;  1SSH A;  4HCK A;  2KXD A;  2AZV A;  4R0K A;  1OEB A;  4CC7 A;  2DLP A;  1YWO A;  2CH4 A;  1ARK A;  2LCS A;  2ENM A;  1UHF A;  1OV3 A;  1NLO C;  1YN8 A;  1PHT A;  3QWX X;  1UFF A;  1MV0 B;  2EYW A;  4RTW A;  2M0Y A;  4J9B A;  2DYB A;  1ZBJ A;  2HSP A;  4Z88 A;  4EIK A;  3I5S A;  2YSQ A;  4J9D A;  4QT7 A;  4JJB A;  3VS7 A;  5FWB A;  4RTX A;  1PRL C;  2FEI A;  4F14 A;  2GTO A;  2GGR A;  2KEA A;  2V1R A;  2L0A A;  1S1N A;  1G83 A;  1WDX A;  3QWY A;  2SRC A;  1ZUK A;  1I1J A;  1JU5 C;  2GBQ A;  1VA7 A;  2K6D A;  1YNZ A;  1Z9Q A;  1E6H A;  1YP5 A;  3VS1 A;  2LNH B;  4AFU C;  2FPD A;  2RQT A;  4JZ3 A;  2DJQ A;  1RLQ C;  3M0T A;  2KNB B;  3A98 A;  2ROL A;  1W6X A;  3O5Z A;  3VS2 A;  2O2O A;  3UA7 A;  3RNJ A;  1PWT A;  1WIE A;  1SHF A;  4AG1 C;  1EFN A;  1X27 A;  2DRM A;  3GBQ A;  1SPK A;  4RTU A;  3LH5 A;  1Z9Z A;  2JW4 A;  1T3S A;  1X2K A;  3THK A;  4AG2 C;  1K0X A;  2KXC A;  4HVU A;  2A36 A;  1JQQ A;  1RI9 A;  2LQW A;  2HBW A;  5HCK A;  2KBT A;  2A08 A;  3FJ5 A;  4CC4 B;  2LX7 A;  1T0H A;  2M51 A;  1QWE A;  1CKB A;  2LJ0 A;  2AKK A;  2KR3 A;  2BZ8 A;  2ED1 A;  3H0H A;  2C0O A;  3NMZ C;  1MUZ A;  2G6F X;  1BU1 A;  5I22 A;  2CSI A;  2JM8 A;  1X69 A;  5FWC A;  2NUZ A;  1SHG A;  1UJY A;  3M0U A;  2L3Q A;  2A37 A;  1HJD A;  3SHW A;  2KT8 A;  4X1V A;  2J06 A;  2DL4 A;  1UHC A;  2C0I A;  2CRE A;  5IXB A;  1WA7 A;  2MCN A;  1ABQ A;  5GJV B;  1K9A A;  1TG0 A;  3TVT A;  4HXJ A;  1ZLM A;  2JS0 A;  4AFQ C;  1HSQ A;  2AZS A;  1UJ0 A;  2KGT A;  2W10 A;  2OAW A;  1KJW A;  2I0N A;  4RTZ A;  1CSK A;  2D8J A;  4LNP A;  1PKT A;  2YUQ A;  1G2B A;  1M3B A;  1HD3 A;  5FW9 A;  3VS3 A;  1NEB A;  2ROT A;  1WLP B;  5I11 A;  2DVJ A;  2D8H A;  2FPE A;  2K9G A;  1UE9 A;  4OMN A;  2CUB A;  1UUE A;  2DNU A;  2JXB A;  1WFW A;  4Z89 A;  2KRN A;  3PVL A;  2LQN A;  1UG1 A;  1OPK A;  4HVV A;  3EHQ A;  5IH2 A;  1NM7 A;  2RQV A;  4F17 A;  2EGA A;  3UF4 A;  3RBB B;  2HDA A;  3EG0 A;  2DRK A;  1E6G A;  2LP5 A;  2YUP A;  3ULR B;  4K11 A;  3CQT A;  2LJ3 A;  1AWJ A;  4ZNX A;  2EVR A;  1U5S A;  1VYV A;  1GFD A;  3IQL A;  2KRO A;  3H41 A;  4DEX A;  3H0I A;  2DL5 A;  2V1Q A;  4OMM A;  4LUE A;  2MIO A;  2W0Z A;  1AD5 A;  4LUD A;  3VS6 A;  2BZY A;  1LCK A;  2J05 A;  2ESW A;  2BTT A;  5IHN A;  2DBK A;  4A63 B;  1X6B A;  1FMK A;  2DE0 X;  2C0T A;  2JMC A;  2OI3 A;  3UAT A;  3M0R A;  3SEM A;  2CH4 W;  5IXF A;  1VYU A;  2D0N A;  2J6K A;  1CKA A;  4JPB W;  3EHR A;  1PNJ A;  1X6G A;  4F16 A;  2RQW A;  2DL8 A;  1GL5 A;  1SRM A;  3PE0 A;  2F2W A;  1B07 A;  2RQR A;  1UTI A;  2SEM A;  2O9S A;  2PNI A;  4GBQ A;  4AFS C;  1ABO A;  4D8K A;  1E7O A;  4LN2 A;  2F2V A;  2VWF A;  3I35 A;  2EBP A;  1K1Z A;  5IHI A;  3EG2 A;  1YCS B;  3EG1 A;  2L2P A;  1GBQ A;  2YT6 A; 
#chains in the Genus database with same CATH topology
 3NGP A;  4IUQ A;  2LZ6 B;  3TSW A;  1YHQ T;  1OQK A;  3BY7 A;  5LJ5 j;  2FHD A;  3UDC A;  2JNG A;  2KRS A;  3JSC A;  5FRN A;  3CME A;  1WHH A;  2K3B A;  1M1K R;  2YUO A;  5M9O A;  3CCR Q;  4ESR A;  3CXC S;  1OYX A;  3CCS A;  3HFO A;  1WXU A;  1VQ7 A;  3QYH B;  4DEY A;  3KFV A;  1TUD A;  2CSQ A;  1QWF A;  2LMJ A;  1TUG B;  4FT4 A;  1D0Y A;  3LLR A;  3S3M A;  1GBR A;  2HKQ B;  3RER A;  4PJN A;  3JCM f;  2E4H A;  3PFS A;  4DBR A;  2EFI A;  2FO0 A;  2NYS A;  1VQ8 Q;  4FL6 A;  4BE1 A;  1NPP A;  3I56 Q;  5GAM d;  2EQK A;  4IIO A;  1ZSZ B;  1ZSZ A;  2DK3 A;  2HNI A;  4D6W A;  5HY6 A;  1M3A A;  3OW2 S;  4QVC A;  4LDU A;  5CR2 A;  1G5V A;  2HCK A;  2JVV A;  1YJN T;  2CS7 A;  2OTJ Q;  3S6W A;  2KRM A;  2O88 A;  1NEG A;  2DXC A;  4KGZ B;  1D0X A;  3CBM A;  4M78 A;  5CAI A;  4XU2 A;  2MPX C;  3RIR A;  1VQ5 Q;  1UDL A;  1R77 A;  2RNA A;  2FYK A;  4OF1 A;  1IGQ A;  1G3Y A;  3CME Q;  1OZ2 A;  3KBG A;  3BDL A;  1QKW A;  5C0M A;  1GCP A;  2H8H A;  1XNI A;  3LH0 A;  2J7I A;  3A8O B;  5GAN 7;  3E2U A;  3HRS A;  1F1B B;  4HKE A;  1T3L A;  4KUL A;  2CDT A;  4ME7 A;  3OBW A;  1V1C A;  2OTL T;  3RKW A;  2RA2 A;  1O9S A;  2QDY B;  1U3O A;  2EIF A;  2KYM A;  1SRL A;  2GQI A;  4RMO A;  3FRN A;  1RLP C;  2E5Q A;  2RPN A;  1B3Q A;  4KT0 E;  4C5E A;  1GRI A;  2BZX A;  4M7D A;  2CP5 A;  5ECA A;  1XJW B;  2DL7 A;  2DAQ A;  3CD6 A;  1JJ2 P;  1C0M A;  1MV3 A;  1K4U S;  5GAO n;  2QQR A;  3LGL A;  2QXF A;  1WJS A;  5GMK l;  4LE9 A;  4M75 A;  2K79 A;  5DLO A;  4M75 D;  1BB9 A;  3P8H A;  1HYO A;  2YUN A;  3CC2 Q;  2E12 A;  5L23 A;  5FLX E;  3GP8 A;  3FB9 A;  1AWW A;  1ZX6 A;  1G8X A;  4XTZ A;  1ZSG A;  1AWX A;  3OS2 A;  5A0D A;  4BY6 C;  2DZC A;  2LT4 A;  1IHV A;  1U06 A;  3BW1 A;  5KYY B;  3L2R A;  5CKB A;  1M1K U;  4JLI A;  2FPF A;  1LPL A;  1YJ9 A;  1MNE A;  3CCE A;  1QLY A;  2ABL A;  2VKN A;  2EQI A;  2RI3 A;  5FU7 C;  4PJO D;  2VGN A;  4M75 B;  2FRW A;  2HEQ A;  3I56 A;  3DKM A;  3OYE A;  4R0K A;  1M2V B;  3FLG A;  4MMK A;  1G3W A;  3NTK A;  1YWO A;  2CH4 A;  2K4Y A;  1YN8 A;  1PHT A;  1K73 R;  1MMA A;  1UFF A;  1WJR A;  4FW2 A;  3HSB A;  1MV0 B;  2EYW A;  3KUF A;  4C0D C;  8ATC B;  2L89 A;  1R0C B;  4AT1 B;  3ASK A;  3I5S A;  2RK2 A;  1QVF P;  2YSQ A;  2MAM A;  4Y91 A;  2JOY A;  1VQL T;  2GTO A;  3ZEH A;  2GGR A;  2KEA A;  3CPW A;  5GAO p;  4IUP A;  2F1L A;  2MI6 A;  3ZFJ A;  2SRC A;  1FMW A;  5HKC A;  1ZUK A;  2CP3 A;  2K6D A;  3CCU T;  1FXX A;  1N8R R;  1SSF A;  2QA4 Q;  4JZ3 A;  4M7A A;  3MP1 A;  3OY9 A;  2R57 A;  3M0T A;  2EAY A;  3VS2 A;  5GAN 2;  3RNJ A;  3CCV Q;  4KUI A;  3GF5 A;  1W2B P;  1M90 R;  4X34 A;  1NZ9 A;  2QA4 T;  4ANJ A;  1KHC A;  3JCM P;  1Q81 U;  2X4J A;  3M56 A;  3THK A;  4AG2 C;  5GAN j;  1I81 A;  2KXC A;  3QPH A;  3G6E T;  1C6V X;  4B6M A;  4PJM A;  2KSS A;  1S72 T;  2JTF A;  1W2B S;  2FZK B;  1ZHI A;  2KBT A;  2A08 A;  4XTV A;  4CC4 B;  5AYF A;  1M9S A;  2LX7 A;  1WHL A;  4DQ2 A;  2BKD N;  1M4Z A;  1W2B A;  1K9M U;  2QQA A;  3CC4 Q;  1RAF B;  3NMZ C;  1N8R U;  2COZ A;  1BU1 A;  1N9R A;  1ZA1 B;  2CSI A;  5I22 A;  1X69 A;  3SB2 A;  2FZC B;  3M0U A;  2L3Q A;  1HJD A;  2J06 A;  2CRE A;  5IXB A;  2L2P A;  5IT9 E;  2MCN A;  1ABQ A;  5GJV B;  3VJP A;  3OYK A;  2JS0 A;  1HSQ A;  2YRC A;  5KE3 A;  3SWN B;  1TH7 A;  3X26 B;  3CCJ T;  1BI2 A;  2EYQ A;  2RJD A;  3CCL Q;  4KGX B;  2OAW A;  1I8F A;  4RTZ A;  3JB9 D;  4OMF B;  2JZ2 A;  2QGF B;  2D8J A;  4MDW A;  3OYF A;  1UGR B;  4A4H A;  1MMG A;  3FJP A;  1NEB A;  3EAE A;  3O8V A;  5I11 A;  2DTH A;  1N9S A;  4ZGJ B;  4FYW B;  2D8H A;  3G6E A;  1UE9 A;  1UUE A;  2YWW A;  1OZ3 A;  1UG1 A;  2O01 E;  4HVV A;  5IH2 A;  2JJ9 A;  4X9C A;  2RQV A;  4C92 B;  1K8A C;  3J81 E;  3UF4 A;  3RBB B;  4QKU A;  5GAN f;  2HDA A;  4PJO F;  2DRK A;  1KG1 A;  2LP5 A;  3JCM X;  3CC7 T;  2LJ3 A;  1KD1 U;  2LVM A;  2EVR A;  3PIO A;  2CP2 A;  1VYV A;  1I5L A;  1M5Q 1;  4R55 A;  2OX7 A;  3H0I A;  4A4F A;  4L5G A;  1B7T A;  4OMM A;  4M77 F;  2RB6 A;  3CCE T;  1YIT A;  2MIO A;  4F7U F;  1AD5 A;  4J83 A;  1WQ7 A;  3LWH A;  3X20 B;  4PJO G;  2ESW A;  4XTU A;  2WAC A;  4E7H A;  1X6B A;  3V8J A;  2DE0 X;  3MEW A;  2DXB A;  2M9U A;  2C0T A;  3G1J A;  3L42 A;  3UAT A;  3OSS C;  4PLI A;  2D0N A;  3JRZ A;  1FMV A;  1VQN Q;  2DL8 A;  4BY6 B;  2HAX A;  1W4S A;  4M77 G;  4J6Y A;  2C06 A;  5GMK m;  2XKO C;  2YRV A;  4NL3 A;  4A54 A;  2O9S A;  2PNI A;  4AFS C;  3V7C A;  2F2V A;  2A3L A;  1X6O A;  1K8A U;  5FU7 B;  4FW1 A;  1UGP B;  2WSF E;  2P84 A;  2MYS A;  1GBQ A;  4XAX B;  3GLX A;  3H0F A;  2JM9 A;  3I5R A;  2NUT A;  1W70 A;  3X28 B;  1Q82 R;  5D6W A;  2O9V A;  3MEA A;  3A8H B;  1Y57 A;  1I07 A;  5HK3 A;  3HTR A;  1VQ7 T;  2RJC A;  4WF2 A;  2EQJ A;  1VQP Q;  4Z8A A;  4J9G A;  1YJN Q;  3REB B;  4N4I A;  1H64 1;  1QKX A;  2B86 A;  2IIM A;  3DB3 A;  1BIB A;  4QW2 A;  4ZN1 A;  2GQV A;  1RAA B;  4EMH A;  1H3H A;  2JS2 A;  5IHK A;  3CCQ Q;  2RO0 A;  3REA B;  4M78 E;  1IO6 A;  3CC7 Q;  3JAM E;  1AZE A;  3PIP A;  4QQ6 A;  2GCX A;  1W1F A;  3DLM A;  3M53 A;  3QUI A;  3TQ7 P;  4BI4 A;  1VQN A;  4V2S A;  5GAM f;  2IPO B;  1LVK A;  1OUL A;  2ED0 A;  2ZPI B;  3L2Q A;  4M7A D;  1VQ6 Q;  4C92 C;  3U23 A;  2X3X D;  1UEC A;  4J9F A;  1TXQ A;  1N8R C;  4DBF A;  4J8O A;  4LD9 K;  1Y0M A;  3CCV T;  5LJ5 f;  4M77 B;  3MEU A;  2ZPG B;  2RI2 A;  2X51 A;  4JJD A;  4OP0 A;  4FIB A;  4C0G A;  3OA6 A;  1VQ4 A;  3E9G A;  3CCM T;  2J6F A;  5KYX A;  3G4S Q;  4GY5 A;  5GAM h;  3M54 A;  2CT3 A;  1YJW A;  3EFO B;  3C94 A;  1VQP A;  1Q82 C;  1H3Z A;  1ZUU A;  1N5Z A;  1JO8 A;  2X4X A;  2RK1 A;  1V29 B;  4J9C A;  1JXM A;  1QVF A;  1VQK A;  3CD6 T;  1G3S A;  1BK2 A;  2DO3 A;  1WX6 A;  1A0N B;  4GLM A;  1M2V A;  4Y92 A;  2ECZ A;  2KT1 A;  3GNF B;  4M75 F;  3TSZ A;  4ELY C;  4RUG A;  1FWZ A;  1WHJ A;  2QDL A;  3QSU A;  3M55 A;  3OS5 A;  3OSV A;  2XMF A;  2MWP A;  1WI7 A;  4BI8 B;  2ZPE B;  1VQ9 T;  4JS5 A;  2D9T A;  4JZ4 A;  1VQO Q;  2L3S A;  3M0P A;  2M1H A;  1U1S A;  4Z02 A;  4WCI A;  4QQD A;  4RTT A;  2NWM A;  3L2V A;  2DA9 A;  1RAI B;  3VRZ A;  5GAO m;  2JN0 A;  5D6X A;  1AWO A;  1D09 B;  2KYB A;  1QVG A;  2M02 A;  2XID A;  2LNV A;  3CCM Q;  1T0J A;  4PJL A;  1K73 C;  2F5K A;  4ZTJ A;  1OPL A;  3EG3 A;  1NYF A;  5EG2 A;  4OB1 B;  1Q95 G;  4KBM B;  4M7A F;  1UGV A;  1WYX A;  1PD1 A;  4DOV A;  1KC8 C;  4EMK B;  1GCQ A;  1AZG B;  5GJW B;  2EPD A;  1M8M A;  1WNL A;  4PK4 A;  3R6N A;  2HQX A;  4JDS A;  3RUX A;  3RDV A;  3G4S T;  3CC2 A;  1IRX A;  1WHG A;  1D3B B;  1YJ9 T;  3EGD B;  1Q86 C;  3NTH A;  1AEY A;  1JRI A;  4ORZ A;  3CC4 T;  1NPR A;  2AZV A;  1SG5 A;  2DLP A;  3QBY A;  2ZZD A;  1IRE B;  1ARK A;  3A8L B;  2Z0W A;  2DEU A;  1VQ6 A;  5KYU A;  4C8Q G;  1D1B A;  1OV3 A;  3OMG A;  4J7F A;  5LJ3 e;  2BE7 D;  3RKX A;  3DB4 A;  4BDY A;  3ER0 A;  2QEX T;  2XK0 A;  4EIK A;  2HZY A;  4FYX B;  4J9D A;  3VS7 A;  2EJ9 A;  4MZM A;  1PRL C;  4C92 A;  4F14 A;  2E1H A;  4RCB A;  5CK9 A;  2OTL A;  1IB8 A;  2V1R A;  1TSF A;  2E10 A;  3VUB A;  4QVD A;  1RI0 A;  4C5I A;  8AT1 B;  1EIF A;  3CCU Q;  1YNZ A;  1YIJ A;  1YP5 A;  3EH2 A;  4AFU C;  4X9D A;  3HFN A;  4ELZ C;  1NJI C;  4EDU A;  2K2V A;  2V8I A;  4HCB A;  1BI1 A;  2RHZ A;  2KNB B;  2ROL A;  1W6X A;  3O5Z A;  3MO8 A;  1I5O B;  3LYI A;  3OMC A;  3J80 E;  1X27 A;  3QHS A;  2R58 A;  2E70 A;  4B9X A;  3JB9 J;  1X2K A;  2BE9 B;  3A1P A;  2XDD A;  5CKF A;  1OX9 A;  2ZPB B;  4BE2 A;  2H3E B;  2R5M A;  4JRQ A;  1JQQ A;  4KGV B;  1RI9 A;  2LQW A;  1LOJ A;  1I4K 1;  2CZ0 B;  1RAD B;  2RI5 A;  3MHX A;  4O6J A;  5A0G A;  4J6W A;  2V8J A;  2M51 A;  4M75 G;  1QWE A;  3M5A A;  4MML A;  2AKK A;  2BZ8 A;  3H0H A;  1MUZ A;  2G6F X;  3CCS Q;  1RAH B;  2NUZ A;  2A0F B;  1SHG A;  5D7U A;  1OX8 A;  3JCM h;  2K5L A;  1UJY A;  4E7S A;  4J7I A;  2QGG A;  4X1V A;  2DL4 A;  4VUB A;  2DET A;  1BCO A;  3CCR T;  1WA7 A;  3CCJ A;  1K9M C;  1TG0 A;  4HXJ A;  1ZLM A;  2L8D A;  4KUD K;  1Q7Y U;  2E6N A;  1D1A A;  2KDS A;  1OU8 A;  3VKI A;  2YUQ A;  1PSF A;  2Y4X A;  5GAM g;  1G2B A;  4B9W A;  1M3B A;  1EZZ B;  4XK8 E;  1PG5 B;  1HD3 A;  5KYX B;  1OI1 A;  5FW9 A;  3MCA B;  2ROT A;  4II1 A;  2BUD A;  1K73 U;  2KRN A;  3QG1 A;  3PVL A;  3DLL A;  1OPK A;  4DA4 A;  3EHQ A;  5GAO q;  1NM7 A;  3CCQ T;  5LJ3 h;  2B8A A;  1YBY A;  3CCE Q;  3H9N A;  3MJX A;  4IUR A;  2EGA A;  2DER A;  3LX7 A;  3PMI A;  2K5F A;  1E6G A;  3S3N A;  3AHU A;  3JB9 I;  2YUP A;  3PNW C;  3OB9 A;  1Y96 A;  4K11 A;  2DIG A;  2RJE A;  4LDW A;  5KCH A;  4M7D G;  1KHI A;  4ZNX A;  2LCC A;  3IQL A;  2KRO A;  1SKU B;  3H41 A;  4FSX A;  2DL5 A;  4QQG A;  3NTI A;  2HL5 C;  4PL6 A;  5GMK j;  2OTL Q;  2X4W A;  2XI9 A;  3F70 A;  2W0Z A;  4LUD A;  2YLC A;  1MMD A;  1YCY A;  3M4G A;  1MHN A;  4MZT A;  4M75 E;  4N4H A;  3P8B B;  3CME T;  2KI7 A;  2JMC A;  3I55 A;  2CH4 W;  2QYZ A;  5DM7 R;  1VYU A;  4C0D B;  4JPB W;  2DXU A;  1X6G A;  4F16 A;  4PJO A;  1SRM A;  3PE0 A;  4E2F B;  3H6Z A;  2RHX A;  5CCA A;  2F2W A;  3HKS A;  1S72 Q;  1UTI A;  2SEM A;  4M7D E;  2PQW A;  2CKK A;  4TVR A;  1E7O A;  2QAS A;  3CXC A;  1PSE A;  3EG1 A;  4RG8 A;  5CKH A;  2CT4 A;  1VUB A;  3MET A;  3M0Q A;  3OBY A;  4FSS A;  3M57 A;  2QA4 A;  3L2Z A;  2HQE A;  3S3O A;  4EPC A;  3QJY A;  1B34 B;  4FU6 A;  2G3R A;  1I0C A;  2DFU A;  1FYN A;  2QK0 A;  1M27 C;  3C12 A;  1IXD A;  3CC4 A;  4J9I A;  2CUD A;  2M0O A;  2DX1 A;  5LJ3 j;  1YWP A;  1QCN A;  5GAN e;  2QG9 B;  3RMS A;  3I9Q A;  1VQ6 T;  1UGS B;  5GAM e;  3OYL A;  3OW2 A;  3FDR A;  5J26 A;  1Q86 U;  2K7A A;  3LGF A;  4OML A;  2X9H A;  4FT2 A;  2LQ8 A;  4IIM A;  3QZ9 B;  3I55 T;  1YIT T;  2FL7 A;  3URG A;  3GNG A;  3HHT B;  1VQ4 Q;  3QYG B;  3QII A;  3QO3 A;  4LXC A;  3OYH A;  3JCM e;  2L5Q A;  1H92 A;  2P4R A;  2P4T A;  4PLL A;  5KYW A;  1M8V A;  4LDY A;  4IUU A;  2D1X A;  2RHY A;  1X2Q A;  5EC7 A;  2K2M A;  3TEE A;  5GAN 8;  2Y90 A;  4XU1 A;  1M3C A;  2OJ2 A;  2DF6 A;  3VS5 A;  1K76 A;  4CC2 A;  5GAN h;  1U8R A;  1KQ1 A;  1HXD A;  2JMA A;  2LC4 A;  2I2L A;  1ZUY A;  1YFN A;  4OMO A;  1VOM A;  4C8Q C;  2LJ1 A;  3UT1 A;  2X35 A;  3G71 T;  4BE0 A;  3SWN A;  2XIC A;  2K57 A;  4KH0 B;  2OAU A;  4PJJ A;  1BYM A;  2P0P A;  3MEV A;  2CZ6 B;  2F69 A;  1PKS A;  2F2X A;  1PD0 A;  5GAN 3;  1YJW Q;  2XD0 A;  2D0Q B;  2QQS A;  2AKL A;  5D6Y A;  2A28 A;  1RAB B;  2GTJ A;  1NYG A;  2EW3 A;  3E1S A;  2HBP A;  2HSE B;  4CRI A;  4M77 E;  3LW5 E;  1QP3 A;  1K0S A;  1WXB A;  2JUF A;  9ATC B;  4C0Z A;  3JB9 G;  2ZAE A;  2FRY A;  2E5K A;  3C0C A;  1YJW T;  3M0S A;  1NBE B;  2KAF A;  3VV0 A;  3QKJ A;  4PJO E;  2DIQ A;  1WXT A;  3EGU A;  5CVI A;  4RTV A;  2WSE E;  4HVW A;  3NPF A;  1YI2 A;  2EKH A;  4A4K A;  3KXT A;  1UEB A;  1NLP C;  1VQK T;  4AFZ C;  5DY9 A;  1PM3 A;  4E7J A;  1WHM A;  4F7U G;  5J3B A;  3OS1 A;  1J3T A;  2HD0 A;  3JCM g;  4JRI A;  1IHW A;  1OOT A;  5LJ5 e;  4MZP A;  3RR6 A;  1VYT A;  2DJZ A;  2O4X A;  4PFZ A;  4OMP A;  2A7Y A;  1Y96 B;  3T9N A;  4F7U A;  4JJN K;  4F7U B;  2PU9 B;  4OMQ A;  2RF0 A;  4C92 G;  1GFC A;  5KYU B;  1QQJ A;  2EYY A;  1IGU A;  3HP9 A;  3VUZ A;  1XOV A;  2O31 A;  2HKN A;  1VIE A;  2GFA A;  1GCQ C;  5GAO l;  5J39 A;  1R8O B;  2GNC A;  1DJ7 B;  1X43 A;  1LNX A;  3EGD A;  3PVQ A;  1QCO A;  3TRE A;  2OTJ A;  2QEX Q;  3CPW P;  1JEG A;  4M7A G;  1SSH A;  4HCK A;  2KXD A;  2DPP B;  2H3J A;  1C1A A;  5GMK i;  2X4Y A;  2LCS A;  1UHF A;  2ENM A;  1NLO C;  3QWX X;  3CPW S;  1QP2 A;  4NOY A;  3EGX A;  7AT1 B;  4J9B A;  2DYB A;  1ZBJ A;  5FRM A;  1BI3 A;  4C5H A;  4QT7 A;  1JJ2 S;  2PVO B;  3BDU A;  5FWB A;  1YHQ Q;  5IAY A;  1GXI E;  2VC8 A;  2P0Q A;  1XTD A;  5I2M A;  2FEI A;  4IUV A;  2FB7 A;  1VQ7 Q;  2CP7 A;  2EQM A;  5FRO A;  2K5I A;  3JB9 H;  4HCC A;  2L0A A;  1S1N A;  3OW2 P;  1MND A;  4OB3 B;  4E7L A;  1JU5 C;  2GBQ A;  1EX4 A;  3VS1 A;  3GPL A;  1VQM T;  3HL8 A;  4HA8 A;  4LDV A;  3A98 A;  2VUB A;  3UA7 A;  4OVA A;  1WIE A;  1KQS S;  1EFN A;  1RL2 A;  3G71 A;  3EFR A;  4BI3 A;  1Q7Y R;  2YRD A;  4RTU A;  1WGS A;  4OGC A;  2JW4 A;  1S72 A;  1NJI U;  2LDM A;  4RG2 A;  1KQS A;  3CMA A;  4J5Y A;  5GAN 6;  4HVU A;  3SFM A;  5A2Q E;  5FU6 C;  2OTJ T;  4FCY A;  1Y7X A;  4M78 D;  1RAC B;  2E64 A;  4C8Q E;  2HBW A;  1Y71 A;  3FJ5 A;  3WVE B;  1YIJ Q;  3EFO A;  4PNO A;  5LJ5 g;  4M7A E;  1T0H A;  2CGH A;  1CKB A;  2V26 A;  2LJ0 A;  2C0O A;  2DEQ A;  3A8G B;  1VQ8 T;  3VYH B;  4CI0 C;  3CCR A;  2YLB A;  1XQH A;  1YHQ A;  5C6S A;  3RMQ A;  3JCM c;  1TU0 B;  2C0I A;  1KD1 C;  4C92 E;  4ZTF A;  1K9A A;  3TVT A;  1LJO A;  1VQL A;  4AFQ C;  3QZ5 B;  3EG9 A;  2KGT A;  2W10 A;  3INZ A;  4E47 A;  3M58 A;  1PKT A;  3BE3 A;  2O4X B;  4QVZ A;  3GOX A;  4N0A C;  2EKO A;  2CZ7 B;  3V8K A;  3E19 A;  4LDX A;  1O75 A;  4A4G A;  3A8M B;  2NUP B;  4PKC C;  4OMN A;  1BI0 A;  2CUB A;  1WFW A;  1ACM B;  4Z89 A;  2GF7 A;  3OYA A;  4JLG A;  1VIF A;  2M16 A;  3D7S B;  4ZGD B;  4F17 A;  4XTY A;  3CCS T;  2CZ1 B;  2BIV A;  4XU3 A;  3EG0 A;  1VQL Q;  2EQU A;  5CQX A;  2EWN A;  2E41 A;  3ULR B;  1QMC A;  3CQT A;  4WTO B;  2NUT B;  2KK4 A;  5GAM j;  2QI2 A;  2QQB A;  3EH1 A;  4F7U E;  1VQK Q;  4OB0 B;  2NUP A;  1GFD A;  1VQ9 A;  2E6Z A;  4HCZ A;  4RCC A;  1Q86 R;  2MF2 A;  4LUE A;  1Y07 A;  4JS4 A;  2BZY A;  1D1C A;  3PMT A;  3HPW A;  4C8Q F;  3SWN C;  2BTT A;  3ZBD A;  2DBK A;  5CQY A;  1PC0 A;  5KCO A;  3M0R A;  4BDZ A;  5IXF A;  3G6E Q;  2J6K A;  2DYI A;  5CKE A;  5LL6 S;  1KC8 U;  3EHR A;  2CP0 A;  5LJ5 d;  3Q1J A;  2QAZ A;  1GL5 A;  5DLQ E;  2QQ9 A;  2RQR A;  2VXF A;  4XTW A;  2ZGW A;  4LN2 A;  4OB2 B;  4A4E A;  2EBP A;  1K1Z A;  2QTV A;  2ZPH B;  3EG2 A;  4C8Q D;  4E7K A;  1YI2 T;  1YJ9 Q;  1QVP A;  2RHU A;  2VVK A;  3G7Z A;  5KYN A;  5KYW B;  2RMO A;  2JTE A;  1D0Z A;  4PFP A;  4KRT A;  4JRK A;  4DBQ A;  2LQK A;  3TCJ A;  4JJC A;  5L8R E;  2HQH A;  3M59 A;  3M4Y A;  3NHN A;  4NS5 A;  5I21 A;  1HK9 A;  1QVG P;  4AMC A;  1M30 A;  4L59 A;  3ZL7 C;  4C92 D;  1QCF A;  2YDL A;  5CIU A;  2EYX A;  4C5G A;  4E7Z A;  4M7D C;  1TUC A;  3CCM A;  2K3Y A;  2VV5 A;  3JCM V;  3QDR B;  4J6X A;  3BFM A;  1QVF S;  5A0L A;  3RES A;  3MP6 A;  1JB0 E;  1JJ2 A;  2DVE A;  1X01 A;  5CKD A;  2DL3 A;  2KQW A;  1KC8 R;  3HRU A;  2FG0 A;  5I2S A;  1G3T A;  2JT4 A;  4M7A C;  4M78 G;  1RUW A;  1VQO T;  1P92 A;  4C8Q B;  2YHT A;  3CMA Q;  2VXE A;  2AK5 A;  1AOJ A;  3VRY A;  1IZ6 A;  1BBZ A;  2KE9 A;  2MWO A;  2F5T X;  2PZ1 A;  2NLU A;  2DXT A;  2DMO A;  3G71 Q;  4E6R A;  4N4G A;  1FX7 A;  1WJQ A;  3A5Z B;  1ZSZ C;  1WHK A;  2DIL A;  2DTI A;  2RQU A;  3V7R A;  1VQ5 T;  2PTK A;  2DBM A;  3CCL T;  4PJO B;  5FU6 B;  5LJ3 f;  2L3R A;  3VU3 C;  4PFO A;  1N27 A;  2YXY A;  1AVZ C;  3V8L A;  1RAG B;  3M9Q A;  1U1T A;  4BD3 A;  3NFC A;  4XQ3 A;  2K3X A;  2RHI A;  3TU4 K;  4RTY A;  3OYC A;  4IKF A;  3JCM J;  2IG0 A;  4J9E A;  3QJ6 A;  1X75 C;  4M4Z A;  4FM4 B;  5KYY A;  4A53 A;  2J6O A;  2EYZ A;  5GAO r;  1NJI R;  1M2O A;  2DM1 A;  3X24 B;  5GAN d;  1BKB A;  4J9H A;  2PVG B;  2RM4 A;  2XU8 A;  2GFU A;  2AIR B;  3C4S A;  3CBO A;  2DZ9 A;  3RKY A;  1VQ8 A;  3VS0 A;  3OYN A;  2L3P A;  1TOV A;  4M7D F;  1QW1 A;  3VYG A;  2JTM A;  1VQP T;  2MOX A;  2KMT A;  3JV3 A;  3SDZ A;  3OQ5 A;  3C95 A;  1H8K A;  2FZG B;  2X3W D;  1ZQ1 A;  6AT1 B;  2EJF A;  1KFZ A;  3PTA A;  4FYV B;  3FEO A;  1Q82 U;  1UGQ B;  2ZPF B;  3CCQ A;  2LT1 A;  4P5N A;  4ZGE B;  3CPF A;  1KSW A;  1PRM C;  5GAN 4;  4M7D B;  4M75 C;  4BUG A;  4PJO C;  2EGE A;  3UA6 A;  1VQM A;  4ZN3 A;  1JBM A;  4YTL A;  1K9M R;  1M1F A;  1WPY A;  4M7D D;  4EMK A;  1NG2 A;  2ATC B;  2P0K A;  1JXO A;  2E65 A;  4CC3 A;  1KIK A;  3VS4 A;  2RN8 A;  4EMG A;  3G4S A;  3CC2 T;  2DD4 A;  1VQN T;  5IN1 A;  2VB6 A;  4D8D A;  1SEM A;  2RJF A;  2AT1 B;  3JCM W;  3AT1 B;  3WVD B;  1B34 A;  1Q81 R;  1N6A A;  2EGC A;  4R56 A;  4C92 F;  3J7A F;  1OEB A;  4UC4 A;  3CXC P;  4CC7 A;  4DOW A;  3I56 T;  2KVQ G;  1TTH B;  1NE8 A;  1V76 A;  1YIJ T;  4ATO A;  2CYZ B;  4EMK C;  4L6V 5;  4M78 B;  2LCL A;  1QVG S;  3CCV A;  1AHJ B;  3PGG A;  2PUK B;  3OYI A;  3WXM B;  3P8D A;  4RTW A;  2M0Y A;  3JCM b;  4HT8 A;  1KD1 R;  3L2U A;  2WSC E;  4RKU E;  4F04 B;  2HSP A;  1TWB A;  1KQ2 A;  4Z88 A;  1M1G A;  3MPU B;  4DBH A;  2XDP A;  2XHC A;  4JJB A;  1VQ9 Q;  3LWI A;  2RD1 A;  4RTX A;  5KE2 A;  4BAC A;  1G83 A;  1WDX A;  3QWY A;  1RAE B;  1I1J A;  4IUT A;  1VQM Q;  1KQS P;  1VA7 A;  4M78 F;  1Z9Q A;  1E6H A;  3OYM A;  3OS0 A;  2LNH B;  1ZBX A;  2FPD A;  2RQT A;  3L1A A;  3UPU A;  2DJQ A;  4NL2 A;  3CEY A;  1RLQ C;  2PUO B;  1WZO A;  2O2O A;  1PWT A;  1Q7Y C;  1SHF A;  4AG1 C;  4C8Q A;  1VQO A;  2DD5 A;  2COW A;  4MDX A;  4HT9 A;  2DRM A;  2R5A A;  3GBQ A;  1UB4 A;  1SPK A;  3LH5 A;  4Q5W A;  1K8A R;  4M77 D;  1Z9Z A;  1T3S A;  1BCM A;  1K0X A;  2FVU A;  2MMP A;  1MGQ A;  4M78 C;  2A36 A;  2XDB A;  2DTO A;  4Y28 E;  1VQ4 T;  3CC7 A;  5HCK A;  2COY A;  3I55 Q;  1D3B A;  1OU9 A;  4M7A B;  3R6O A;  1R0B G;  3EFS A;  3CCU A;  3SD4 A;  4JRP A;  1Q81 C;  2AHJ B;  1ZA2 B;  5LJ3 g;  1KK7 A;  4N0A A;  2KR3 A;  2ED1 A;  4GLK A;  2KY9 A;  2JM8 A;  5FWC A;  4M77 C;  1PCX A;  2A37 A;  3SHW A;  2KT8 A;  3JB9 F;  1UHC A;  3OYY A;  4LD6 A;  1AT1 B;  1YI2 Q;  1BIA A;  3MP8 A;  2AZS A;  5LJ3 d;  1UJ0 A;  2VYT A;  3GIB A;  3MKD A;  3CD6 Q;  1KJW A;  2I0N A;  1CSK A;  4LNP A;  4KH1 B;  2LTO A;  2IVW A;  2PVD B;  4C0F A;  3ME9 A;  2RH2 A;  3QDF A;  3VS3 A;  3OYJ A;  4FYY B;  1WLP B;  3CCL A;  5HK0 A;  4OGE A;  5CO7 A;  2DVJ A;  2QEX A;  2DKG A;  2EJG A;  2FPE A;  2K9G A;  3N5B B;  2DNU A;  2JXB A;  3FIF A;  5AT1 B;  2E3H A;  2LQN A;  2HMA A;  3CBP A;  2VGM A;  4XU0 A;  2LRQ A;  2D6F A;  2Y4Y A;  3EG9 B;  3CMA T;  1M90 C;  3OYG A;  1YJN A;  1YIT Q;  3JCM d;  3CCJ Q;  3HRT A;  1AWJ A;  3UWN A;  5LJ5 h;  1U5S A;  3EGX B;  4DEX A;  2V1Q A;  3JCM Q;  2QTX A;  1VQ5 A;  1MMN A;  5GMK e;  3VS6 A;  1TS9 A;  1LCK A;  2J05 A;  5GAN g;  1SF9 A;  5IHN A;  2HL3 A;  2V8K A;  4BB7 A;  4A63 B;  4O5V A;  5GAN 5;  4E7I A;  1FMK A;  2E3I A;  3OYD A;  2OI3 A;  3H8Z A;  5GMK h;  3SEM A;  5KH6 A;  2LX9 A;  1WQW A;  2VAS A;  1CKA A;  1PNJ A;  3FC3 A;  3V7S A;  2RQW A;  2MK5 A;  3PT9 A;  1M1K C;  1B07 A;  3QXE B;  4XTX A;  3E9F A;  4GBQ A;  1ABO A;  4D8K A;  2VWF A;  2ZCF B;  3I35 A;  3X25 B;  4JUV A;  5IHI A;  1M90 U;  1YCS B;  2CP6 A;  3OYB A;  3L2W A;  4M77 A;  2XG8 D;  2YT6 A; 
#chains in the Genus database with same CATH homology
 2VVK A;  3NGP A;  3H0F A;  2JM9 A;  2CT4 A;  2RMO A;  3I5R A;  3M0Q A;  2JTE A;  1W70 A;  2LZ6 B;  3TSW A;  4FSS A;  2O9V A;  4KRT A;  2KRS A;  1Y57 A;  1I07 A;  4JJC A;  2K3B A;  2YUO A;  4ESR A;  1I0C A;  3NHN A;  1FYN A;  4Z8A A;  1M27 C;  4J9G A;  3REB B;  4J9I A;  1WXU A;  1QKX A;  1M30 A;  2B86 A;  2CUD A;  2IIM A;  3ZL7 C;  2DX1 A;  4DEY A;  1YWP A;  3KFV A;  1QCF A;  1TUD A;  2YDL A;  2CSQ A;  2EYX A;  1QWF A;  2LMJ A;  3I9Q A;  1TUC A;  1H3H A;  2JS2 A;  5IHK A;  3REA B;  2K7A A;  1GBR A;  4OML A;  1IO6 A;  4IIM A;  2FO0 A;  1AZE A;  1W1F A;  2DL3 A;  2FG0 A;  2ED0 A;  4IIO A;  2JT4 A;  3U23 A;  2X3X D;  1UEC A;  1RUW A;  1M3A A;  1H92 A;  4J9F A;  2P4R A;  2AK5 A;  2HCK A;  1AOJ A;  3VRY A;  1Y0M A;  1BBZ A;  2KE9 A;  2KRM A;  2O88 A;  4JJD A;  2PZ1 A;  1NEG A;  2D1X A;  2DMO A;  1X2Q A;  5EC7 A;  2K2M A;  4E6R A;  2J6F A;  1M3C A;  2OJ2 A;  2DF6 A;  3VS5 A;  1K76 A;  4CC2 A;  2RQU A;  1UDL A;  2DIL A;  2JMA A;  2RNA A;  2PTK A;  2DBM A;  2CT3 A;  1ZUY A;  4OMO A;  1ZUU A;  1AVZ C;  2LJ1 A;  1N5Z A;  1JO8 A;  4J9C A;  1JXM A;  1QKW A;  1BK2 A;  4RTY A;  1WX6 A;  1GCP A;  1A0N B;  4GLM A;  1PKS A;  2F2X A;  2H8H A;  2J7I A;  4Y92 A;  4J9E A;  2ECZ A;  2KT1 A;  1T3L A;  3TSZ A;  2CDT A;  4M4Z A;  4RUG A;  2AKL A;  1V1C A;  2A28 A;  2J6O A;  2GTJ A;  2EYZ A;  2QDL A;  1U3O A;  1NYG A;  2DM1 A;  2EW3 A;  2XMF A;  4J9H A;  2KYM A;  1SRL A;  1WI7 A;  2GQI A;  1RLP C;  1K0S A;  1WXB A;  2RPN A;  1B3Q A;  1GRI A;  2BZX A;  4JZ4 A;  2FRY A;  2L3S A;  2E5K A;  3M0P A;  3C0C A;  3VS0 A;  2L3P A;  3M0S A;  4WCI A;  5ECA A;  1WXT A;  3EGU A;  2MOX A;  2DL7 A;  4RTV A;  3JV3 A;  3NPF A;  4HVW A;  4RTT A;  2EKH A;  2NWM A;  1NLP C;  1H8K A;  4AFZ C;  1MV3 A;  2X3W D;  1K4U S;  2DA9 A;  3VRZ A;  1KFZ A;  1J3T A;  1AWO A;  4LE9 A;  2K79 A;  2KYB A;  1BB9 A;  2YUN A;  1KSW A;  1PRM C;  5L23 A;  1T0J A;  2EGE A;  1AWW A;  1ZX6 A;  1OOT A;  3UA6 A;  1OPL A;  3EG3 A;  1VYT A;  1NYF A;  1ZSG A;  1AWX A;  4OMP A;  1NG2 A;  1UGV A;  1WYX A;  4OMQ A;  2RF0 A;  1JXO A;  4CC3 A;  1KIK A;  1GCQ A;  1GFC A;  3VS4 A;  1AZG B;  2RN8 A;  1U06 A;  5GJW B;  2EPD A;  2EYY A;  1M8M A;  2FPF A;  1XOV A;  2O31 A;  3R6N A;  4D8D A;  1QLY A;  1GCQ C;  1SEM A;  2ABL A;  2VKN A;  2EQI A;  2GNC A;  1X43 A;  2FRW A;  2HEQ A;  3PVQ A;  1AEY A;  4ORZ A;  1JEG A;  2EGC A;  1SSH A;  4HCK A;  2KXD A;  2AZV A;  4R0K A;  1OEB A;  4CC7 A;  2DLP A;  1YWO A;  2CH4 A;  1ARK A;  2LCS A;  2ENM A;  1UHF A;  1OV3 A;  1NLO C;  1YN8 A;  1PHT A;  3QWX X;  1UFF A;  1MV0 B;  2EYW A;  4RTW A;  2M0Y A;  4J9B A;  2DYB A;  1ZBJ A;  2HSP A;  4Z88 A;  4EIK A;  3I5S A;  2YSQ A;  4J9D A;  4QT7 A;  4JJB A;  3VS7 A;  5FWB A;  4RTX A;  1PRL C;  2FEI A;  4F14 A;  2GTO A;  2GGR A;  2KEA A;  2V1R A;  2L0A A;  1S1N A;  1G83 A;  1WDX A;  3QWY A;  2SRC A;  1ZUK A;  1I1J A;  1JU5 C;  2GBQ A;  1VA7 A;  2K6D A;  1YNZ A;  1Z9Q A;  1E6H A;  1YP5 A;  3VS1 A;  2LNH B;  4AFU C;  2FPD A;  2RQT A;  4JZ3 A;  2DJQ A;  1RLQ C;  3M0T A;  2KNB B;  3A98 A;  2ROL A;  1W6X A;  3O5Z A;  3VS2 A;  2O2O A;  3UA7 A;  3RNJ A;  1PWT A;  1WIE A;  1SHF A;  4AG1 C;  1EFN A;  1X27 A;  2DRM A;  3GBQ A;  1SPK A;  4RTU A;  3LH5 A;  1Z9Z A;  2JW4 A;  1T3S A;  1X2K A;  3THK A;  4AG2 C;  1K0X A;  2KXC A;  4HVU A;  2A36 A;  1JQQ A;  1RI9 A;  2LQW A;  2HBW A;  5HCK A;  2KBT A;  2A08 A;  3FJ5 A;  4CC4 B;  2LX7 A;  1T0H A;  2M51 A;  1QWE A;  1CKB A;  2LJ0 A;  2AKK A;  2KR3 A;  2BZ8 A;  2ED1 A;  3H0H A;  2C0O A;  3NMZ C;  1MUZ A;  2G6F X;  1BU1 A;  5I22 A;  2CSI A;  2JM8 A;  1X69 A;  5FWC A;  2NUZ A;  1SHG A;  1UJY A;  3M0U A;  2L3Q A;  2A37 A;  1HJD A;  3SHW A;  2KT8 A;  4X1V A;  2J06 A;  2DL4 A;  1UHC A;  2C0I A;  2CRE A;  5IXB A;  1WA7 A;  2MCN A;  1ABQ A;  5GJV B;  1K9A A;  1TG0 A;  3TVT A;  4HXJ A;  1ZLM A;  2JS0 A;  4AFQ C;  1HSQ A;  2AZS A;  1UJ0 A;  2KGT A;  2W10 A;  2OAW A;  1KJW A;  2I0N A;  4RTZ A;  1CSK A;  2D8J A;  4LNP A;  1PKT A;  2YUQ A;  1G2B A;  1M3B A;  1HD3 A;  5FW9 A;  3VS3 A;  1NEB A;  2ROT A;  1WLP B;  5I11 A;  2DVJ A;  2D8H A;  2FPE A;  2K9G A;  1UE9 A;  4OMN A;  2CUB A;  1UUE A;  2DNU A;  2JXB A;  1WFW A;  4Z89 A;  2KRN A;  3PVL A;  2LQN A;  1UG1 A;  1OPK A;  4HVV A;  3EHQ A;  5IH2 A;  1NM7 A;  2RQV A;  4F17 A;  2EGA A;  3UF4 A;  3RBB B;  2HDA A;  3EG0 A;  2DRK A;  1E6G A;  2LP5 A;  2YUP A;  3ULR B;  4K11 A;  3CQT A;  2LJ3 A;  1AWJ A;  4ZNX A;  2EVR A;  1U5S A;  1VYV A;  1GFD A;  3IQL A;  2KRO A;  3H41 A;  4DEX A;  3H0I A;  2DL5 A;  2V1Q A;  4OMM A;  4LUE A;  2MIO A;  2W0Z A;  1AD5 A;  4LUD A;  3VS6 A;  2BZY A;  1LCK A;  2J05 A;  2ESW A;  2BTT A;  5IHN A;  2DBK A;  4A63 B;  1X6B A;  1FMK A;  2DE0 X;  2C0T A;  2JMC A;  2OI3 A;  3UAT A;  3M0R A;  3SEM A;  2CH4 W;  5IXF A;  1VYU A;  2D0N A;  2J6K A;  1CKA A;  4JPB W;  3EHR A;  1PNJ A;  1X6G A;  4F16 A;  2RQW A;  2DL8 A;  1GL5 A;  1SRM A;  3PE0 A;  2F2W A;  1B07 A;  2RQR A;  1UTI A;  2SEM A;  2O9S A;  2PNI A;  4GBQ A;  4AFS C;  1ABO A;  4D8K A;  1E7O A;  4LN2 A;  2F2V A;  2VWF A;  3I35 A;  2EBP A;  1K1Z A;  5IHI A;  3EG2 A;  1YCS B;  3EG1 A;  2L2P A;  1GBQ A;  2YT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...