1ZX6A

High-resolution crystal structure of yeast pin3 sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ypr154wp
molecule tags Protein binding
source organism Saccharomyces cerevisiae
publication title Structural genomics of yeast SH3 domains
rcsb
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zx6A00
1WI7A 1WXTA 2D8JA 2LMJA 2KEAA 2O2OA 4JZ4A 1OOTA 2DL7A 5FWBA 1AWJA 1Z9QA 1JQQA 1UTIA 2GTJA 2FG0A 2DJQA 1AOJA 2FPFA 1RI9A 1G2BA 2C0TA 1BBZA 3EG0A 3NGPA 3H0IA 2DRMA 2A37A 1ZLMA 2J6OA 3M0QA 1YWPA 2RQTA 1JEGA 2DILA 1GBQA 1ABOA 2ROTA 3SEMA 4J9FA 3R6NA 1OEBA 2L3PA 3JV3A 1H8KA 3H0HA 3THKA 2FPEA 3QWYA 3I9QA 4HVWA 2DYBA 1VA7A 2DNUA 4X1VA 3FJ5A 2VVKA 4AFUC 1WDXA 1E7OA 1NYFA 4GLMA 3REBB 3A98A 1M3BA 2QDLA 2JW4A 3EG3A 1H3HA 2F2XA 1K0SA 2PTKA 2EGAA 2FEIA 4LNPA 5EC7A 4GBQA 4KRTA 3VS1A 4RTUA 2D1XA 2GQIA 2LX7A 1U06A 4J9GA 1CKAA 2EBPA 1PNJA 2DX1A 2K3BA 1SRLA 1WXUA 2KE9A 2KT8A 2CT4A 2SRCA 1GCQA 2K2MA 1CSKA 2DL8A 3UF4A 4J9IA 1NLOC 2AK5A 1X6BA 3H0FA 4D8DA 2CSQA 2L3QA 2IIMA 1VYTA 3UA7A 2EVRA 4LUEA 2MOXA 2EKHA 2HCKA 2NWMA 1E6HA 1MV0B 2BTTA 2BZXA 1NG2A 2OI3A 1H92A 4A63B 1UHCA 2YT6A 4M4ZA 4RTZA 2H8HA 1ARKA 2AZSA 2C0IA 2V1RA 1EFNA 2FRWA 5IHIA 4ESRA 5IXFA 1X2KA 2DF6A 2KXCA 4RUGA 4CC4B 4LN2A 2CT3A 1LCKA 2YUNA 4HXJA 2K9GA 1QKXA 1OPKA 4K11A 1KFZA 4R0KA 2J6KA 4JJCA 1UFFA 4J9DA 1ZX6A 3EG2A 2RN8A 3VRYA 1X43A 3IQLA 2KYBA 1GBRA 2L0AA 2JS0A 5L23A 2O9SA 3VS2A 4AFQC 1KSWA 4RTWA 2CH4A 2ENMA 5IHNA 3TSZA 5GJWB 2LP5A 1U3OA 2X3XD 4J9BA 1VYUA 1KIKA 1GL5A 1K4US 1W6XA 2A08A 1GCQC 1T3LA 4AG2C 2I0NA 1HD3A 1AWOA 2DE0X 1T3SA 1GCPA 2D0NA 4EIKA 2PZ1A 1T0HA 2VWFA 1UHFA 2V1QA 1E6GA 2JMAA 3I5SA 2J06A 4RTTA 1ZUUA 1QKWA 2JXBA 3I5RA 1NLPC 1I07A 2OJ2A 3VS7A 1BB9A 2KXDA 2KRSA 4E6RA 1FMKA 1YN8A 1TUCA 3SHWA 1ZSGA 1AZEA 1OPLA 4LUDA 1PRLC 2GGRA 2JT4A 2M0YA 2ED1A 1PKSA 1HJDA 3PVQA 2EW3A 4Y92A 1Y57A 5IXBA 2O88A 1X69A 2DRKA 1I0CA 4CC7A 4IIOA 1M3AA 2CUDA 2GTOA 2ABLA 2RMOA 3VS3A 2FPDA 3RNJA 2W10A 4AFZC 3ZL7C 2KRNA 2ESWA 1WA7A 3NPFA 1SRMA 2AKLA 2BZYA 1K9AA 2EYXA 3H41A 1RUWA 1OV3A 1M8MA 2BZ8A 2EYWA 1GFCA 2LQWA 4RTXA 4DEXA 2YSQA 2X3WD 2OAWA 2E5KA 1VYVA 1UE9A 4ZNXA 2EYZA 1UG1A 2C0OA 2J05A 5IHKA 1ZUYA 1UGVA 2L2PA 1YNZA 5GJVB 1UECA 2CH4W 2CSIA 2LJ1A 1BU1A 3UA6A 3TSWA 2YUPA 2EGCA 4RTVA 2CDTA 3EHRA 3VRZA 1AD5A 1ZBJA 2F2WA 1B3QA 1M27C 1NEGA 1B07A 1JU5C 4Z8AA 4DEYA 2PNIA 3EHQA 2P4RA 1WXBA 3PE0A 2DL4A 3M0SA 4J9HA 2XMFA 1YWOA 2KNBB 3CQTA 2KR3A 3UATA 2M51A 1FYNA 2O9VA 3I35A 1BK2A 3ULRB 4IIMA 2GNCA 2D8HA 4D8KA 1SEMA 2DL3A 1PKTA 1J3TA 4F17A 4OMNA 5FW9A 1KJWA 4AFSC 1GRIA 1CKBA 3LH5A 2KYMA 3QWXX 1X6GA 1M30A 1RLQC 3EG1A 2HDAA 1NEBA 2HSPA 2JM8A 4AG1C 3KFVA 2EQIA 2DBMA 1QWFA 2GBQA 2DBKA 1YCSB 4WCIA 1JXOA 1HSQA 2EYYA 2CREA 1MUZA 4CC3A 1NYGA 1I1JA 1UJ0A 3U23A 1MV3A 2L3SA 4JJBA 2LNHB 2RQRA 2RQVA 2DM1A 1M3CA 4ORZA 2YDLA 3C0CA 4QT7A 1WYXA 1AEYA 2RPNA 2KRMA 2RQWA 5I22A 2O31A 1PHTA 1UDLA 4OMLA 5IH2A 2F2VA 4JPBW 2KBTA 5I11A 2LCSA 1W70A 4F14A 1WFWA 2W0ZA 1K1ZA 1IO6A 4OMOA 2YUQA 2A36A 1JO8A 4J9EA 1JXMA 1N5ZA 1K76A 3M0UA 1SSHA 1GFDA 4HCKA 1SHGA 2A28A 1XOVA 2LJ0A 3VS0A 4Z89A 2MIOA 1U5SA 2J6FA 4JZ3A 1W1FA 2RQUA 2DMOA 1AVZC 2JM9A 3VS6A 2YUOA 1AZGB 1QCFA 2EGEA 1K0XA 2DLPA 2K6DA 2J7IA 1NM7A 2ED0A 1G83A 2EPDA 1UJYA 4OMQA 1AWWA 2JS2A 1X2QA 2FO0A 1AWXA 2DL5A 1TUDA 2AZVA 5HCKA 1WIEA 1SHFA 1RLPC 2HEQA 1Y0MA 4HVUA 3M0TA 1WX6A 2DA9A 2KGTA 2RNAA 2ECZA 4Z88A 1X27A 2K79A 3TVTA 4HVVA 1S1NA 4F16A 3RBBB 1YP5A 2ROLA 1ZUKA 2LJ3A 2NUZA 1PWTA 3M0RA 2K7AA 2DVJA 2MCNA 2G6FX 3REAB 1Z9ZA 4OMMA 1TG0A 1ABQA 2JMCA 1V1CA 2SEMA 5ECAA 3NMZC 3PVLA 1UUEA 2VKNA 1QWEA 3NHNA 2JTEA 3M0PA 1A0NB 4FSSA 4RTYA 1T0JA 4JJDA 3O5ZA 2CUBA 3VS5A 1WLPB 2RF0A 3GBQA 4CC2A 4J9CA 4OMPA 2HBWA 1QLYA 2FRYA 3EGUA 1PRMC 4LE9A 2B86A 2KT1A 3VS4A 2AKKA 2LZ6B 5FWCA 2LQNA 2KROA 1SPKA
chains in the Genus database with same CATH superfamily
2D8JA 4M78F 2LMJA 2O4XA 3CD6T 2R58A 3LLRA 2DL7A 2QTVA 4JLIA 4C8QE 3NFCA 2PVGB 3CMAT 1G2BA 1BBZA 4NS5A 3EG0A 2DRMA 2BUDA 4OVAA 1ZLMA 1KC8U 2EWNA 1BIAA 1YITA 3LX7A 3QHSA 1BCOA 3R6NA 4EMHA 1OEBA 1MMDA 2EIFA 3JV3A 2F5TX 3VV0A 2EQMA 4BI8B 5GAN4 5GAMd 1VQNT 3I9QA 2DYBA 4IUQA 4M7DG 1E7OA 4GLMA 1QP2A 1R0BG 2CP5A 2QDLA 5KYXB 1H3HA 2XU8A 1K0SA 1QW1A 2R5AA 5CKHA 4LNPA 5EC7A 4FYVB 4KRTA 2D1XA 2GQIA 2LX7A 2COYA 1IZ6A 1CKAA 5IN1A 4A4EA 3CPWP 4M77F 2K3BA 1SRLA 2KVQG 1WXUA 4V2SA 3TQ7P 1GCQA 5GAN2 3QYHB 1VQ9T 3G6EQ 3OSVA 1VQ7T 3UF4A 3CCQQ 1PSEA 1BIBA 1X6BA 4PFOA 2CSQA 5LJ5h 1KK7A 1VYTA 4VUBA 3CCJA 1WQ7A 1EZZB 3V7RA 1M8VA 3M57A 2NWMA 1WGSA 2H3EB 4J8OA 2HMAA 1NG2A 2OI3A 3ZBDA 3HRSA 4M4ZA 4RTZA 2H8HA 3EFRA 1K8AU 3KUFA 3GP8A 4LXCA 3G4SA 3M55A 3M4YA 5IHIA 5CAIA 1X2KA 3A8HB 2FZCB 3TREA 2RD1A 1LCKA 4PJOG 1VQ4T 3E2UA 1QKXA 2PU9B 2DTHA 4JRKA 3BFMA 1JJ2P 1KFZA 4JJCA 5LJ3e 1RAGB 3JCMX 3CCEQ 3L2UA 3GOXA 3OS0A 4HA8A 2BE9B 3JSCA 1VQMA 3VRYA 2FVUA 2NLUA 4Y28E 1Y07A 2E12A 5L23A 2X4XA 4J6WA 2CH4A 2ENMA 2LP5A 1U3OA 3META 4PJOF 3CCJQ 2A08A 1O9SA 1WZOA 3L1AA 2RK1A 2IVWA 2I0NA 3OYYA 1AWOA 4F7UA 1GCPA 3CD6A 3UWNA 2JJ9A 4DBFA 1B7TA 1T0HA 2OTLA 4E7IA 1D1CA 2JMAA 1Q95G 4PJJA 2EQJA 1ZUUA 3MEVA 1NLPC 3VS7A 2KXDA 4BI3A 2X35A 3JAME 2DPPB 1YN8A 3JB9D 1ZSGA 2EJFA 4F7UF 2DD4A 2GGRA 2M1HA 3MP6A 1PKSA 4PJMA 1WQWA 4Y92A 2PUKB 2YRDA 4DA4A 1X69A 1HYOA 1QVFA 1Q86U 2DJZA 4FYXB 2CUDA 3JB9J 4L5GA 2ABLA 1B34A 1VIFA 2FPDA 4ZGJB 1VQKT 4AFZC 1VQ6Q 2E64A 3MJXA 1WA7A 5EG2A 4BY6B 1RUWA 1FMVA 3CCMQ 3EGXA 4A54A 2BZ8A 3A8GB 5IT9E 4C5EA 1ZSZB 2DIGA 2EYZA 1UG1A 4ATOA 3RMQA 4OB1B 4JRPA 1UGVA 4IURA 4GLKA 1YNZA 1VQ5A 3G4SQ 1VQLQ 1WHMA 3OYIA 2LJ1A 1YIJQ 5KCHA 3M58A 2YUPA 4MMKA 1AD5A 4II1A 2MI6A 3CCJT 4M77G 2F2WA 2K5LA 3A5ZB 2HL3A 2EKOA 3OS2A 1QCOA 2ZGWA 2F1LA 1VUBA 5CQXA 2P4RA 1WXBA 2E3HA 2DL4A 4M78C 4PJOA 1UGRB 2PUOB 1MMGA 2M51A 2ZPHB 3EH1A 2O9VA 1BK2A 4ZGEB 1PKTA 4OMNA 5FW9A 3S3NA 4KGZB 3OYKA 2KI7A 4MDWA 1X6GA 3CCUT 3CCVQ 1M30A 4E7JA 4ELZC 3OYCA 3DLLA 4E7ZA 4KUIA 2DXTA 2QASA 2X4WA 2HSPA 4AG1C 3KFVA 2EQIA 1MMAA 1VQPA 2GBQA 4M75F 3SDZA 5GANj 3DLMA 3CBPA 5GAN6 2CREA 2AT1B 1MV3A 3VKIA 4JJBA 2CZ6B 5GAN3 2RQVA 4ORZA 4KH1B 2YDLA 3BDLA 3CBOA 1WYXA 1K73R 3CCMT 3HRUA 3A1PA 1YI2T 1NBEB 4FW1A 5LJ5e 2F2VA 4XU0A 4M7DB 3ME9A 5GAMh 5KYYB 3C94A 3OYEA 4F14A 1WFWA 4MDXA 5GAMf 2LT4A 1K1ZA 4JUVA 1KD1U 2E6NA 3BDUA 1D1AA 4A53A 2EAYA 1SSFA 4BI4A 1UGQB 3D7SB 1VQMQ 1BI0A 2CZ0B 1GFDA 1SHGA 4HT8A 1SF9A 1XOVA 4F7UB 2XDPA 4BE2A 4JZ3A 1U8RA 3CCEA 2DMOA 2JM9A 4NL3A 5CQYA 4B6MA 3OYGA 3LYIA 5FROA 1Q7YR 4LDXA 3H6ZA 3G71T 3CCLT 1RAIB 5HY6A 3CMET 1K73C 1AWWA 1YHQQ 4FW2A 1X2QA 4QW2A 1TUDA 2AZVA 1Y96A 3C4SA 1VQKA 2DVEA 1K9MU 4XTZA 3G71Q 5FRMA 2E41A 4XTUA 2HL5C 2KQWA 1MHNA 3RERA 2JVVA 3CCQA 1X27A 2LCCA 3G6EA 3TVTA 1OX9A 2XIDA 5CKEA 5J39A 1MMNA 4M77D 1TTHB 1ZUKA 2XKOC 4WTOB 4ZTFA 1YI2Q 2K7AA 2LQ8A 2MCNA 2G6FX 5GANd 3X20B 3JB9I 1PG5B 2VGMA 1ABQA 3V8LA 3J80E 1RAEB 3M56A 4OF1A 3CC7T 3OYNA 3H8ZA 4M75G 1M4ZA 1VQ8A 4BUGA 4M7AG 1UGPB 1MGQA 1TSFA 1LNXA 3VS5A 3PIPA 1SG5A 1Y7XA 3WVDB 3CBMA 1LJOA 2RJEA 4OMPA 4M7AA 4F04B 3GNFB 5GMKm 3HPWA 5I2SA 3VS4A 4C5GA 3CCST 4JRIA 4E47A 4EMKB 3CEYA 1SPKA 1C1AA 2JN0A 2RHYA 2KEAA 2O2OA 1KQ2A 4FIBA 5KYUA 1Z9QA 4OGEA 1UTIA 5KYNA 5I21A 2Y90A 5DM7R 1U1SA 2FG0A 2DJQA 5CO7A 1AOJA 1RI9A 2RHXA 3BY7A 4PJOB 1LOJA 2QA4A 3PTAA 4KGVB 4JJNK 1OQKA 4QQDA 3VU3C 3AT1B 2A37A 2J6OA 1JEGA 2Y4XA 4C8QF 8ATCB 3HTRA 4RG8A 1QQJA 3I55Q 3VYHB 2L3PA 2RJFA 1H8KA 3CXCS 4AMCA 1PSFA 3G1JA 2R57A 3CCRT 3THKA 3G4ST 2CP0A 3FJ5A 2M0OA 4AFUC 1WDXA 1NYFA 4A4GA 3A98A 1WJSA 3EG3A 2PTKA 4GBQA 3VS1A 4RTUA 3CCVA 2WSEE 4KGXB 5FU6C 5KH6A 2P4TA 1ZHIA 3UDCA 2L89A 2LQKA 4RCCA 2SRCA 4M78A 5GMKi 1Y96B 2K2MA 3CCET 1FXXA 4N4GA 2AK5A 1YIJA 1D1BA 3H0FA 3EG9B 5GAOp 4D8DA 5FU7C 2D9TA 3M4GA 2EVRA 2VXFA 5KYWB 1UEBA 4B9XA 2MOXA 2E10A 4J6YA 4Z02A 4XAXB 1MV0B 3LW5E 2HKNA 4D6WA 3EAEA 3MP1A 4M7AF 4C0DB 1VQNA 5CR2A 1VQLA 1EFNA 1VQ5Q 3QYGB 2FYKA 2QGFB 2QQAA 2VGNA 2KXCA 5I2MA 2JTFA 3CCUQ 2GFAA 4JLGA 2CT3A 4HCBA 1M2OA 2VXEA 2WSCE 3CC2A 2K3YA 1OPKA 1VIEA 4R0KA 3CC4Q 1ZBXA 3JCMg 1ZX6A 2RA2A 1QMCA 4BY6C 2K5FA 3UT1A 1X43A 2KYBA 2L0AA 2JS0A 3OMCA 4FT2A 3Q1JA 4M75E 1G3WA 4RTWA 1D0YA 2DEUA 1BYMA 2COWA 3FEOA 1NPPA 4J9BA 1W6XA 3CCSA 4RMOA 3QDRB 1GCQC 4AG2C 2LDMA 3VYGA 1V76A 4DBHA 4B9WA 4HKEA 2D0NA 2PZ1A 1RL2A 2VWFA 2V1QA 1E6GA 3M59A 3OYBA 3CMAQ 2DZCA 4PJOE 2H3JA 1ACMB 3OBWA 1OZ2A 2XD0A 2WSFE 1D0ZA 1VQ5T 2QA4T 2VASA 1S72A 1PD1A 1FMKA 2ZPIB 4L59A 1OZ3A 3CPWS 1M2VA 1W2BS 4LUDA 3JB9G 1PRLC 1M90R 1QVGS 3GF5A 3CC4A 2JNGA 2C06A 5IXBA 2O88A 2DXUA 3CXCP 3HRTA 4CC7A 2E6ZA 2V8KA 3FIFA 2GTOA 3M9QA 1YJ9Q 1OU9A 2EJ9A 2MMPA 1I5OB 2KRNA 3JCMP 4IKFA 3NPFA 2GCXA 2OAUA 2EYXA 2LQWA 2RHIA 2OAWA 3EFSA 3QSUA 3A8LB 1JJ2A 3LGLA 2C0OA 1YJWQ 4X34A 2HQHA 1YIJT 2CSIA 4BD3A 1BU1A 3QJ6A 4RTVA 2XG8D 3T9NA 1YJNQ 1RACB 1M27C 1B07A 2WACA 2NUPB 3EHQA 3CMEQ 3CCMA 2VYTA 2EFIA 4PKCC 4M78B 3TU4K 5LJ3j 4J7FA 1FYNA 4R56A 1QVFP 3QO3A 1SEMA 1J3TA 3QKJA 4EPCA 2OTJA 4AFSC 5HK0A 2KY9A 2KYMA 3QWXX 1ZSZA 1VQ8Q 2EYQA 2E65A 3FB9A 4JDSA 3JB9F 4PFPA 2HDAA 2M16A 2JM8A 3SD4A 3E9FA 3OMGA 1YCSB 2EQUA 2EYYA 3DB4A 3RKXA 2QGGA 5DLQE 4M7DD 2MYSA 4CC3A 1AT1B 1I1JA 3U23A 1VQ7Q 1X01A 3LWHA 3CC7Q 5J26A 2VV5A 1PCXA 2YXYA 2FZGB 5D7UA 2O31A 1PHTA 3CCQT 2CP3A 2L3RA 2FHDA 4QKUA 4E7KA 2YWWA 2QI2A 4N4HA 2L8DA 2LCSA 5D6WA 3OY9A 1TWBA 4JS5A 2MWOA 1XQHA 2QEXT 1D09B 2LTOA 5GAOl 2L5QA 4HCKA 4N0AC 3VS0A 2MIOA 1U5SA 2KSSA 1K9MC 4BACA 3EG9A 3HHTB 4FYYB 1NE8A 2NYSA 3CCLQ 1O75A 1BI3A 1G83A 1VQ4Q 1UJYA 1K73U 4J5YA 2MF2A 2JS2A 2FO0A 1AWXA 2DL5A 3FJPA 4AT1B 2KMTA 2HAXA 1Y0MA 4HVUA 3X26B 5GAMj 3V8KA 2DA9A 2ECZA 5LJ5f 3PGGA 4Z88A 3RR6A 3EGXB 1KD1C 1N8RR 3JCMe 2HZYA 5AYFA 1XJWB 4C92G 2MWPA 1BI1A 5GANg 1W2BA 2X4YA 4DBQA 3GPLA 2OTJQ 4OGCA 2FL7A 2JMCA 3JCMf 1V1CA 3DB3A 5ECAA 4KBMB 2Z0WA 2VKNA 4M7DA 2JTEA 5GANh 3JCMQ 3QZ5B 4FSSA 5DY9A 3OYAA 2FB7A 4RTYA 1BCMA 3PMIA 3JB9H 4XTWA 4FYWB 1M1KR 3I56A 2HBWA 1QLYA 3FC3A 3RIRA 2KT1A 1YJ9T 2RH2A 5FWCA 2LQNA 3CCVT 1D3BA 2DTOA 1RAAB 5LJ5d 4J7IA 4JZ4A 2OTLT 4XU3A 3I55T 3E19A 1AWJA 1YJNA 4XU2A 5CIUA 2FPFA 2C0TA 1XNIA 4Y91A 2RJCA 1OU8A 1YJWA 1VQPQ 1NPRA 2DILA 5DLOA 5A0DA 3QDFA 1R8OB 1GBQA 1ABOA 1I81A 3SWNB 1EIFA 2QQBA 2ZCFB 4FU6A 2E4HA 2HQEA 4M78G 4PJLA 3H0HA 2QDYB 2M9UA 4PK4A 3TCJA 4M7AE 1VQ6A 3QWYA 1VQLT 4HVWA 2VVKA 3REBB 5LL6S 2JW4A 1D0XA 2EGAA 1WJRA 2FEIA 1WHJA 3HFOA 1U06A 4IUPA 2EBPA 2QQRA 2DX1A 2QAZA 1G3SA 2KT8A 2CKKA 4E2FB 4QVDA 2CT4A 3S6WA 4YTLA 1KHCA 3X24B 3OBYA 2DL8A 2P0PA 1KQSP 1FMWA 1QP3A 2IIMA 4KUDK 2DIQA 3UA7A 4M7DF 1Q86C 4ELYC 3SWNC 2X51A 4RCBA 2EKHA 2HCKA 2PVDB 3VUZA 2E70A 4FT4A 1E6HA 2IPOB 4GY5A 3A8MB 5A0LA 3L2ZA 2BZXA 5CKDA 4HT9A 1H92A 2OTLQ 4ANJA 3LH0A 4LDVA 1K8AR 1ARKA 1VOMA 3JCMh 2FRWA 5IXFA 2ZPFB 2DF6A 3S3OA 1AHJB 4RUGA 4CC4B 3VUBA 1MNDA 4PNOA 2HSEB 1S72T 2K9GA 3C12A 3M5AA 4XK8E 3EG2A 3JCMJ 4N0AA 3L2QA 3IQLA 1GBRA 2ZAEA 1D3BB 3FLGA 5LJ3f 2O9SA 3VS2A 3UPUA 4OB0B 4EDUA 1KSWA 5LJ3h 3V8JA 5IHNA 1G5VA 5FLXE 1VYUA 1KIKA 1GL5A 4M7AB 4C92D 2DXBA 1T3LA 1HD3A 4CRIA 2DE0X 3MEAA 2F5KA 3H9NA 1RABB 1UHFA 1GXIE 5GMKl 5J3BA 3I5SA 1YI2A 2YLBA 2DXCA 4QVCA 5KYUB 4M77A 1UB4A 3I5RA 4LD6A 4LDYA 3ZFJA 4C92B 2OJ2A 1QVFS 3TEEA 4E6RA 1I5LA 1C0MA 1TUCA 2QYZA 3SHWA 3HKSA 2AHJB 1OPLA 1K8AC 4J6XA 3LWIA 3MPUB 2XDBA 3JCMc 1KG1A 5AT1B 1I8FA 3NTIA 1W2BP 3RMSA 1IGUA 1JJ2S 1Q86R 1TU0B 4IIOA 3RDVA 3WVEB 1VQ9Q 1RADB 1VQOT 3RNJA 4RG2A 1M2VB 3JRZA 2W10A 4M77E 4XTVA 2ESWA 1SRMA 4R55A 2BZYA 1K9AA 3P8BB 4F7UG 2EYWA 2YLCA 4XTYA 3G6ET 1TS9A 4DEXA 2YSQA 2D0QB 2X3WD 4O5VA 1IREB 1TUGB 1DJ7B 3HL8A 1YITQ 2BE7D 2J05A 5IHKA 1IB8A 3MKDA 1WNLA 1VQ7A 2PQWA 1Q81R 5GJVB 5M9OA 1UECA 1K9MR 2DK3A 2JZ2A 3UA6A 3OYMA 2VC8A 3KXTA 2EGCA 2CDTA 2R5MA 3VRZA 3L2WA 1ZBJA 1PM3A 5GAOm 3CC7A 2P0QA 4QQGA 4WF2A 4DEYA 2PNIA 1VQ8T 4J9HA 2DD5A 1WJQA 1YWOA 2KNBB 3EGDB 2EQKA 3OW2S 3UATA 4HCZA 4X9CA 2DETA 3QJYA 1B34B 1KC8C 2DTIA 3BE3A 2GNCA 3URGA 2D8HA 2DL3A 1N9RA 1GRIA 1CKBA 3RUXA 2QEXA 4RKUE 5CKBA 4C0DC 2RI2A 4PL6A 1OI1A 1R0CB 4C0FA 1NEBA 2DZ9A 2GQVA 4JRQA 4N4IA 3MO8A 5GMKh 2DBMA 1QWFA 1Q81C 2FZKB 4WCIA 1JXOA 5A0GA 1NYGA 1M1KC 2YHTA 4M7AC 3X25B 2K3XA 3SWNA 3V7CA 4EMGA 2LNHB 2RQRA 3HFNA 2P84A 1MNEA 2DM1A 1M3CA 1HXDA 2LT1A 1I4K1 2LRQA 2GFUA 1AEYA 2RPNA 2KRMA 2RQWA 5I22A 2RM4A 2DERA 1UDLA 2IG0A 2COZA 2RI5A 5KYXA 3V7SA 1VQOQ 1JB0E 3ASKA 5I11A 1M9SA 2W0ZA 4C0GA 2HBPA 4OMOA 2XHCA 1KD1R 2AIRB 1JXMA 1N5ZA 4LDWA 2A28A 5GAMe 2LJ0A 4Z89A 4E7HA 2J6FA 1W1FA 4C5HA 1YHQT 2DO3A 3N5BB 1AZGB 1OX8A 2EGEA 2DLPA 3INZA 2J7IA 2VB6A 2ED0A 2DEQA 4OMQA 1WIEA 2RB6A 1SHFA 4F7UE 1RLPC 5IAYA 4EMKA 1WX6A 3L42A 1X6OA 2RNAA 2K79A 4MMLA 3SB2A 3J7AF 1KQSA 4HVVA 1S1NA 3CCSQ 1YJNT 1YP5A 1RAHB 3CMAA 3GNGA 2DVJA 3REAB 1Y71A 4OMMA 3SFMA 4MZMA 1YJWT 1QVPA 1YITT 1N27A 3PVLA 1UUEA 5L8RE 4C92F 4M7DE 4XTXA 1A0NB 2LVMA 5FU7B 1T0JA 1QVGA 4JJDA 2CUBA 3CPFA 2A3LA 2RF0A 2NUPA 3GBQA 1NJIR 4M77C 4J9CA 3OW2P 2FRYA 4QVZA 1PRMC 3RESA 4C8QD 2B86A 2GF7A 2AKKA 2DFUA 1TOVA 3PMTA 5A2QE 2E5QA 1VQNQ 1WI7A 1WXTA 1YCYA 2DAQA 4PFZA 2NUTB 1IHVA 1N8RC 4NOYA 3OYLA 1OOTA 5FWBA 2QTXA 1U1TA 3GLXA 1WHLA 1JQQA 2MPXC 4C8QG 3OYDA 3EGDA 1LPLA 2GTJA 3KBGA 2RK2A 2XK0A 5D6YA 4PLIA 3NGPA 3H0IA 2HQXA 3MEWA 1G3YA 3M0QA 1YWPA 2QK0A 2RQTA 3MEUA 3HP9A 2MK5A 1PC0A 1H641 2ROTA 3SEMA 4DBRA 3QIIA 4M75B 4J9FA 2E3IA 3OS5A 5GAOr 4KT0E 4ZN1A 5GAMg 2QEXQ 2FPEA 4OMFB 4IUUA 3I56T 4FL6A 1VA7A 2DNUA 4X1VA 1JBMA 3OW2A 1M3BA 5FRNA 2F2XA 3LGFA 3M53A 3I56Q 3O8VA 1Q7YU 3CCRQ 1NJIC 3PIOA 4TVRA 4J9GA 1PNJA 1JRIA 2A0FB 2KE9A 3JCMd 4FSXA 1QCNA 3I55A 3EFOA 2ATCB 3VJPA 1CSKA 2BIVA 4BDYA 4J9IA 4ZTJA 1NLOC 3JCMb 5KE2A 2D6FA 2KDSA 3MP8A 2LCLA 2L3QA 1M90U 3CMEA 3OYHA 1TXQA 1Q82C 1ZQ1A 4E7LA 1N6AA 4LUEA 4M75C 1YFNA 1KQSS 3PFSA 2RI3A 2X4JA 2F69A 2DKGA 2BTTA 3EH2A 2V8IA 4UC4A 2ZPEB 4A63B 1UHCA 4QQ6A 3CD6Q 3E1SA 2JOYA 2YT6A 4OP0A 3G7ZA 2AZSA 2CYZB 2I2LA 1WHHA 2C0IA 2PVOB 2V1RA 1FWZA 4ESRA 1IGQA 4J83A 2XI9A 3GIBA 2RO0A 3P8HA 4LN2A 3ZEHA 2YUNA 3CC2Q 1ZA1B 4HXJA 3QXEB 4M78E 3QPHA 4K11A 2J6KA 1UFFA 9ATCB 1PD0A 4J9DA 4X9DA 5CVIA 1M1FA 1G8XA 2RN8A 1VQ9A 4IUTA 4C8QA 4BB7A 1F1BB 1WHKA 1C6VX 1KC8R 3OQ5A 4AFQC 4NL2A 2LNVA 3QZ9B 5KYWA 5GAOn 2RHZA 4P5NA 3TSZA 5GJWB 2X3XD 1VQOA 4HCCA 1IHWA 1K4US 5GAOq 4XQ3A 2HD0A 1T3SA 2V26A 4EIKA 4XU1A 1UGSB 5KE3A 5LJ3g 4OB3B 3OA6A 2J06A 4RTTA 4M78D 3OYFA 2XDDA 1VQKQ 1QKWA 2JXBA 2P0KA 1Q82R 3M54A 1I07A 3MHXA 1BB9A 2KRSA 4PJOC 4L6V5 4A4FA 3L2RA 4OB2B 1AZEA 2JT4A 2M0YA 1BI2A 2ED1A 5HKCA 1VQMT 1HJDA 3PVQA 5GAN8 3AHUA 2B8AA 1W4SA 4BE0A 2EW3A 1Y57A 4M77B 5CKFA 4C5IA 1IRXA 2EJGA 3CCRA 1HK9A 2DRKA 1I0CA 1H3ZA 1R77A 3BW1A 4C92A 1Q82U 1M90C 1SKUB 2MAMA 3EFOB 1M3AA 2VUBA 1LVKA 3RKYA 4DQ2A 4A4HA 2QG9B 2RMOA 5D6XA 3VS3A 1KHIA 1KQ1A 3ZL7C 2CGHA 2AKLA 2V8JA 4C92C 1QVGP 3H41A 2QA4Q 1OV3A 1M8MA 3NTHA 4RTXA 1GFCA 3NTKA 1OULA 2E5KA 1VYVA 1UE9A 4ZNXA 3OSSC 1NJIU 1ZUYA 1Q7YC 2ZZDA 3MCAB 2L2PA 3P8DA 1M5Q1 2CH4W 2DYIA 3TSWA 3L2VA 3EHRA 3JCMV 1M1GA 4LD9K 8AT1B 1WHGA 2O4XB 3OS1A 2K4YA 1P92A 1B3QA 4M75D 1NEGA 5GANf 1RAFB 4Z8AA 1JU5C 5LJ5j 3PE0A 1G3TA 4A4KA 3M0SA 4KULA 2XMFA 5FU6B 3CQTA 3QUIA 1ZA2B 2KR3A 3CXCA 5GANe 3I35A 3ULRB 4IIMA 1YJ9A 4D8KA 4C8QB 2K2VA 4F17A 1KJWA 2NUTA 3X28B 5GMKj 3LH5A 2CS7A 5KYYA 3J81E 3OYJA 1S72Q 5CK9A 3CC2T 3OB9A 1RLQC 3EG1A 3QG1A 4ZN3A 7AT1B 2X9HA 1N8RU 5GMKe 5LJ5g 5GAN7 4CI0C 2YRVA 4PJNA 4M7DC 2A7YA 2DBKA 4ZGDB 3PT9A 2YRCA 2OX7A 1WPYA 3QBYA 4JS4A 1HSQA 3G71A 3RKWA 1V29B 3WXMB 1MUZA 2ZPBB 1UJ0A 2L3SA 4M75A 1IXDA 1NZ9A 2HKQB 3C0CA 4QT7A 2M02A 6AT1B 3HSBA 3FDRA 3FRNA 1FX7A 2G3RA 2KAFA 4MZPA 1RI0A 4BE1A 1VQ6T 4OMLA 3CPWA 1EX4A 5IH2A 4C92E 2LC4A 4JPBW 2KBTA 3S3MA 1W70A 2ZPGB 1OYXA 1IO6A 5HK3A 2YUQA 3JCMW 2A36A 1JO8A 3CCUA 4E7SA 4J9EA 4ME7A 4PLLA 1K76A 3M0UA 1SSHA 3ER0A 2CP7A 2RQUA 2O01E 4IUVA 1VQPT 1AVZC 3VS6A 2CZ1B 3CC4T 2JTMA 2YUOA 1QCFA 1K0XA 2CP6A 4LDUA 2K6DA 1NM7A 2EPDA 4KH0B 3A8OB 2RJDA 5C6SA 2K5IA 2QQSA 2XICA 3F70A 4O6JA 4M7AD 5HCKA 1N9SA 2HEQA 4Q5WA 2KK4A 3M0TA 2RHUA 2KGTA 2JUFA 2HNIA 2Y4YA 1XTDA 4C8QC 1X75C 4C0ZA 3C95A 4F16A 2BKDN 3RBBB 4DOVA 2ROLA 3PNWC 2E1HA 2LJ3A 4DOWA 2NUZA 4FM4B 2QXFA 1PWTA 3M0RA 1VQ4A 1Z9ZA 4BDZA 1TG0A 2SEMA 2LX9A 3NMZC 5C0MA 1QWEA 3NHNA 1YHQA 4PJOD 3M0PA 2CZ7B 2QQ9A 1TH7A 2CP2A 3O5ZA 4MZTA 1WLPB 2K57A 3CCLA 1M1KU 4CC2A 3E9GA 5CCAA 5KCOA 5GAN5 3EGUA 4LE9A 4EMKC 3R6OA 1ZSZC 5LJ3d 3DKMA 1Q81U 2LZ6B 1BKBA 2OTJT 1YBYA 2KROA 4FCYA
chains in the Genus database with same CATH topology
1WI7A 1WXTA 2D8JA 2LMJA 2KEAA 2O2OA 4JZ4A 1OOTA 2DL7A 5FWBA 1AWJA 1Z9QA 1JQQA 1UTIA 2GTJA 2FG0A 2DJQA 1AOJA 2FPFA 1RI9A 1G2BA 2C0TA 1BBZA 3EG0A 3NGPA 3H0IA 2DRMA 2A37A 1ZLMA 2J6OA 3M0QA 1YWPA 2RQTA 1JEGA 2DILA 1GBQA 1ABOA 2ROTA 3SEMA 4J9FA 3R6NA 1OEBA 2L3PA 3JV3A 1H8KA 3H0HA 3THKA 2FPEA 3QWYA 3I9QA 4HVWA 2DYBA 1VA7A 2DNUA 4X1VA 3FJ5A 2VVKA 4AFUC 1WDXA 1E7OA 1NYFA 4GLMA 3REBB 3A98A 1M3BA 2QDLA 2JW4A 3EG3A 1H3HA 2F2XA 1K0SA 2PTKA 2EGAA 2FEIA 4LNPA 5EC7A 4GBQA 4KRTA 3VS1A 4RTUA 2D1XA 2GQIA 2LX7A 1U06A 4J9GA 1CKAA 2EBPA 1PNJA 2DX1A 2K3BA 1SRLA 1WXUA 2KE9A 2KT8A 2CT4A 2SRCA 1GCQA 2K2MA 1CSKA 2DL8A 3UF4A 4J9IA 1NLOC 2AK5A 1X6BA 3H0FA 4D8DA 2CSQA 2L3QA 2IIMA 1VYTA 3UA7A 2EVRA 4LUEA 2MOXA 2EKHA 2HCKA 2NWMA 1E6HA 1MV0B 2BTTA 2BZXA 1NG2A 2OI3A 1H92A 4A63B 1UHCA 2YT6A 4M4ZA 4RTZA 2H8HA 1ARKA 2AZSA 2C0IA 2V1RA 1EFNA 2FRWA 5IHIA 4ESRA 5IXFA 1X2KA 2DF6A 2KXCA 4RUGA 4CC4B 4LN2A 2CT3A 1LCKA 2YUNA 4HXJA 2K9GA 1QKXA 1OPKA 4K11A 1KFZA 4R0KA 2J6KA 4JJCA 1UFFA 4J9DA 1ZX6A 3EG2A 2RN8A 3VRYA 1X43A 3IQLA 2KYBA 1GBRA 2L0AA 2JS0A 5L23A 2O9SA 3VS2A 4AFQC 1KSWA 4RTWA 2CH4A 2ENMA 5IHNA 3TSZA 5GJWB 2LP5A 1U3OA 2X3XD 4J9BA 1VYUA 1KIKA 1GL5A 1K4US 1W6XA 2A08A 1GCQC 1T3LA 4AG2C 2I0NA 1HD3A 1AWOA 2DE0X 1T3SA 1GCPA 2D0NA 4EIKA 2PZ1A 1T0HA 2VWFA 1UHFA 2V1QA 1E6GA 2JMAA 3I5SA 2J06A 4RTTA 1ZUUA 1QKWA 2JXBA 3I5RA 1NLPC 1I07A 2OJ2A 3VS7A 1BB9A 2KXDA 2KRSA 4E6RA 1FMKA 1YN8A 1TUCA 3SHWA 1ZSGA 1AZEA 1OPLA 4LUDA 1PRLC 2GGRA 2JT4A 2M0YA 2ED1A 1PKSA 1HJDA 3PVQA 2EW3A 4Y92A 1Y57A 5IXBA 2O88A 1X69A 2DRKA 1I0CA 4CC7A 4IIOA 1M3AA 2CUDA 2GTOA 2ABLA 2RMOA 3VS3A 2FPDA 3RNJA 2W10A 4AFZC 3ZL7C 2KRNA 2ESWA 1WA7A 3NPFA 1SRMA 2AKLA 2BZYA 1K9AA 2EYXA 3H41A 1RUWA 1OV3A 1M8MA 2BZ8A 2EYWA 1GFCA 2LQWA 4RTXA 4DEXA 2YSQA 2X3WD 2OAWA 2E5KA 1VYVA 1UE9A 4ZNXA 2EYZA 1UG1A 2C0OA 2J05A 5IHKA 1ZUYA 1UGVA 2L2PA 1YNZA 5GJVB 1UECA 2CH4W 2CSIA 2LJ1A 1BU1A 3UA6A 3TSWA 2YUPA 2EGCA 4RTVA 2CDTA 3EHRA 3VRZA 1AD5A 1ZBJA 2F2WA 1B3QA 1M27C 1NEGA 1B07A 1JU5C 4Z8AA 4DEYA 2PNIA 3EHQA 2P4RA 1WXBA 3PE0A 2DL4A 3M0SA 4J9HA 2XMFA 1YWOA 2KNBB 3CQTA 2KR3A 3UATA 2M51A 1FYNA 2O9VA 3I35A 1BK2A 3ULRB 4IIMA 2GNCA 2D8HA 4D8KA 1SEMA 2DL3A 1PKTA 1J3TA 4F17A 4OMNA 5FW9A 1KJWA 4AFSC 1GRIA 1CKBA 3LH5A 2KYMA 3QWXX 1X6GA 1M30A 1RLQC 3EG1A 2HDAA 1NEBA 2HSPA 2JM8A 4AG1C 3KFVA 2EQIA 2DBMA 1QWFA 2GBQA 2DBKA 1YCSB 4WCIA 1JXOA 1HSQA 2EYYA 2CREA 1MUZA 4CC3A 1NYGA 1I1JA 1UJ0A 3U23A 1MV3A 2L3SA 4JJBA 2LNHB 2RQRA 2RQVA 2DM1A 1M3CA 4ORZA 2YDLA 3C0CA 4QT7A 1WYXA 1AEYA 2RPNA 2KRMA 2RQWA 5I22A 2O31A 1PHTA 1UDLA 4OMLA 5IH2A 2F2VA 4JPBW 2KBTA 5I11A 2LCSA 1W70A 4F14A 1WFWA 2W0ZA 1K1ZA 1IO6A 4OMOA 2YUQA 2A36A 1JO8A 4J9EA 1JXMA 1N5ZA 1K76A 3M0UA 1SSHA 1GFDA 4HCKA 1SHGA 2A28A 1XOVA 2LJ0A 3VS0A 4Z89A 2MIOA 1U5SA 2J6FA 4JZ3A 1W1FA 2RQUA 2DMOA 1AVZC 2JM9A 3VS6A 2YUOA 1AZGB 1QCFA 2EGEA 1K0XA 2DLPA 2K6DA 2J7IA 1NM7A 2ED0A 1G83A 2EPDA 1UJYA 4OMQA 1AWWA 2JS2A 1X2QA 2FO0A 1AWXA 2DL5A 1TUDA 2AZVA 5HCKA 1WIEA 1SHFA 1RLPC 2HEQA 1Y0MA 4HVUA 3M0TA 1WX6A 2DA9A 2KGTA 2RNAA 2ECZA 4Z88A 1X27A 2K79A 3TVTA 4HVVA 1S1NA 4F16A 3RBBB 1YP5A 2ROLA 1ZUKA 2LJ3A 2NUZA 1PWTA 3M0RA 2K7AA 2DVJA 2MCNA 2G6FX 3REAB 1Z9ZA 4OMMA 1TG0A 1ABQA 2JMCA 1V1CA 2SEMA 5ECAA 3NMZC 3PVLA 1UUEA 2VKNA 1QWEA 3NHNA 2JTEA 3M0PA 1A0NB 4FSSA 4RTYA 1T0JA 4JJDA 3O5ZA 2CUBA 3VS5A 1WLPB 2RF0A 3GBQA 4CC2A 4J9CA 4OMPA 2HBWA 1QLYA 2FRYA 3EGUA 1PRMC 4LE9A 2B86A 2KT1A 3VS4A 2AKKA 2LZ6B 5FWCA 2LQNA 2KROA 1SPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WI7 A;  1WXT A;  2D8J A;  2LMJ A;  2KEA A;  2O2O A;  4JZ4 A;  1OOT A;  2DL7 A;  5FWB A;  1AWJ A;  1Z9Q A;  1JQQ A;  1UTI A;  2GTJ A;  2FG0 A;  2DJQ A;  1AOJ A;  2FPF A;  1RI9 A;  1G2B A;  2C0T A;  1BBZ A;  3EG0 A;  3NGP A;  3H0I A;  2DRM A;  2A37 A;  1ZLM A;  2J6O A;  3M0Q A;  1YWP A;  2RQT A;  1JEG A;  2DIL A;  1GBQ A;  1ABO A;  2ROT A;  3SEM A;  4J9F A;  3R6N A;  1OEB A;  2L3P A;  3JV3 A;  1H8K A;  3H0H A;  3THK A;  2FPE A;  3QWY A;  3I9Q A;  4HVW A;  2DYB A;  1VA7 A;  2DNU A;  4X1V A;  3FJ5 A;  2VVK A;  4AFU C;  1WDX A;  1E7O A;  1NYF A;  4GLM A;  3REB B;  3A98 A;  1M3B A;  2QDL A;  2JW4 A;  3EG3 A;  1H3H A;  2F2X A;  1K0S A;  2PTK A;  2EGA A;  2FEI A;  4LNP A;  5EC7 A;  4GBQ A;  4KRT A;  3VS1 A;  4RTU A;  2D1X A;  2GQI A;  2LX7 A;  1U06 A;  4J9G A;  1CKA A;  2EBP A;  1PNJ A;  2DX1 A;  2K3B A;  1SRL A;  1WXU A;  2KE9 A;  2KT8 A;  2CT4 A;  2SRC A;  1GCQ A;  2K2M A;  1CSK A;  2DL8 A;  3UF4 A;  4J9I A;  1NLO C;  2AK5 A;  1X6B A;  3H0F A;  4D8D A;  2CSQ A;  2L3Q A;  2IIM A;  1VYT A;  3UA7 A;  2EVR A;  4LUE A;  2MOX A;  2EKH A;  2HCK A;  2NWM A;  1E6H A;  1MV0 B;  2BTT A;  2BZX A;  1NG2 A;  2OI3 A;  1H92 A;  4A63 B;  1UHC A;  2YT6 A;  4M4Z A;  4RTZ A;  2H8H A;  1ARK A;  2AZS A;  2C0I A;  2V1R A;  1EFN A;  2FRW A;  5IHI A;  4ESR A;  5IXF A;  1X2K A;  2DF6 A;  2KXC A;  4RUG A;  4CC4 B;  4LN2 A;  2CT3 A;  1LCK A;  2YUN A;  4HXJ A;  2K9G A;  1QKX A;  1OPK A;  4K11 A;  1KFZ A;  4R0K A;  2J6K A;  4JJC A;  1UFF A;  4J9D A;  1ZX6 A;  3EG2 A;  2RN8 A;  3VRY A;  1X43 A;  3IQL A;  2KYB A;  1GBR A;  2L0A A;  2JS0 A;  5L23 A;  2O9S A;  3VS2 A;  4AFQ C;  1KSW A;  4RTW A;  2CH4 A;  2ENM A;  5IHN A;  3TSZ A;  5GJW B;  2LP5 A;  1U3O A;  2X3X D;  4J9B A;  1VYU A;  1KIK A;  1GL5 A;  1K4U S;  1W6X A;  2A08 A;  1GCQ C;  1T3L A;  4AG2 C;  2I0N A;  1HD3 A;  1AWO A;  2DE0 X;  1T3S A;  1GCP A;  2D0N A;  4EIK A;  2PZ1 A;  1T0H A;  2VWF A;  1UHF A;  2V1Q A;  1E6G A;  2JMA A;  3I5S A;  2J06 A;  4RTT A;  1ZUU A;  1QKW A;  2JXB A;  3I5R A;  1NLP C;  1I07 A;  2OJ2 A;  3VS7 A;  1BB9 A;  2KXD A;  2KRS A;  4E6R A;  1FMK A;  1YN8 A;  1TUC A;  3SHW A;  1ZSG A;  1AZE A;  1OPL A;  4LUD A;  1PRL C;  2GGR A;  2JT4 A;  2M0Y A;  2ED1 A;  1PKS A;  1HJD A;  3PVQ A;  2EW3 A;  4Y92 A;  1Y57 A;  5IXB A;  2O88 A;  1X69 A;  2DRK A;  1I0C A;  4CC7 A;  4IIO A;  1M3A A;  2CUD A;  2GTO A;  2ABL A;  2RMO A;  3VS3 A;  2FPD A;  3RNJ A;  2W10 A;  4AFZ C;  3ZL7 C;  2KRN A;  2ESW A;  1WA7 A;  3NPF A;  1SRM A;  2AKL A;  2BZY A;  1K9A A;  2EYX A;  3H41 A;  1RUW A;  1OV3 A;  1M8M A;  2BZ8 A;  2EYW A;  1GFC A;  2LQW A;  4RTX A;  4DEX A;  2YSQ A;  2X3W D;  2OAW A;  2E5K A;  1VYV A;  1UE9 A;  4ZNX A;  2EYZ A;  1UG1 A;  2C0O A;  2J05 A;  5IHK A;  1ZUY A;  1UGV A;  2L2P A;  1YNZ A;  5GJV B;  1UEC A;  2CH4 W;  2CSI A;  2LJ1 A;  1BU1 A;  3UA6 A;  3TSW A;  2YUP A;  2EGC A;  4RTV A;  2CDT A;  3EHR A;  3VRZ A;  1AD5 A;  1ZBJ A;  2F2W A;  1B3Q A;  1M27 C;  1NEG A;  1B07 A;  1JU5 C;  4Z8A A;  4DEY A;  2PNI A;  3EHQ A;  2P4R A;  1WXB A;  3PE0 A;  2DL4 A;  3M0S A;  4J9H A;  2XMF A;  1YWO A;  2KNB B;  3CQT A;  2KR3 A;  3UAT A;  2M51 A;  1FYN A;  2O9V A;  3I35 A;  1BK2 A;  3ULR B;  4IIM A;  2GNC A;  2D8H A;  4D8K A;  1SEM A;  2DL3 A;  1PKT A;  1J3T A;  4F17 A;  4OMN A;  5FW9 A;  1KJW A;  4AFS C;  1GRI A;  1CKB A;  3LH5 A;  2KYM A;  3QWX X;  1X6G A;  1M30 A;  1RLQ C;  3EG1 A;  2HDA A;  1NEB A;  2HSP A;  2JM8 A;  4AG1 C;  3KFV A;  2EQI A;  2DBM A;  1QWF A;  2GBQ A;  2DBK A;  1YCS B;  4WCI A;  1JXO A;  1HSQ A;  2EYY A;  2CRE A;  1MUZ A;  4CC3 A;  1NYG A;  1I1J A;  1UJ0 A;  3U23 A;  1MV3 A;  2L3S A;  4JJB A;  2LNH B;  2RQR A;  2RQV A;  2DM1 A;  1M3C A;  4ORZ A;  2YDL A;  3C0C A;  4QT7 A;  1WYX A;  1AEY A;  2RPN A;  2KRM A;  2RQW A;  5I22 A;  2O31 A;  1PHT A;  1UDL A;  4OML A;  5IH2 A;  2F2V A;  4JPB W;  2KBT A;  5I11 A;  2LCS A;  1W70 A;  4F14 A;  1WFW A;  2W0Z A;  1K1Z A;  1IO6 A;  4OMO A;  2YUQ A;  2A36 A;  1JO8 A;  4J9E A;  1JXM A;  1N5Z A;  1K76 A;  3M0U A;  1SSH A;  1GFD A;  4HCK A;  1SHG A;  2A28 A;  1XOV A;  2LJ0 A;  3VS0 A;  4Z89 A;  2MIO A;  1U5S A;  2J6F A;  4JZ3 A;  1W1F A;  2RQU A;  2DMO A;  1AVZ C;  2JM9 A;  3VS6 A;  2YUO A;  1AZG B;  1QCF A;  2EGE A;  1K0X A;  2DLP A;  2K6D A;  2J7I A;  1NM7 A;  2ED0 A;  1G83 A;  2EPD A;  1UJY A;  4OMQ A;  1AWW A;  2JS2 A;  1X2Q A;  2FO0 A;  1AWX A;  2DL5 A;  1TUD A;  2AZV A;  5HCK A;  1WIE A;  1SHF A;  1RLP C;  2HEQ A;  1Y0M A;  4HVU A;  3M0T A;  1WX6 A;  2DA9 A;  2KGT A;  2RNA A;  2ECZ A;  4Z88 A;  1X27 A;  2K79 A;  3TVT A;  4HVV A;  1S1N A;  4F16 A;  3RBB B;  1YP5 A;  2ROL A;  1ZUK A;  2LJ3 A;  2NUZ A;  1PWT A;  3M0R A;  2K7A A;  2DVJ A;  2MCN A;  2G6F X;  3REA B;  1Z9Z A;  4OMM A;  1TG0 A;  1ABQ A;  2JMC A;  1V1C A;  2SEM A;  5ECA A;  3NMZ C;  3PVL A;  1UUE A;  2VKN A;  1QWE A;  3NHN A;  2JTE A;  3M0P A;  1A0N B;  4FSS A;  4RTY A;  1T0J A;  4JJD A;  3O5Z A;  2CUB A;  3VS5 A;  1WLP B;  2RF0 A;  3GBQ A;  4CC2 A;  4J9C A;  4OMP A;  2HBW A;  1QLY A;  2FRY A;  3EGU A;  1PRM C;  4LE9 A;  2B86 A;  2KT1 A;  3VS4 A;  2AKK A;  2LZ6 B;  5FWC A;  2LQN A;  2KRO A;  1SPK A; 
#chains in the Genus database with same CATH topology
 2D8J A;  4M78 F;  2LMJ A;  2O4X A;  3CD6 T;  2R58 A;  3LLR A;  2DL7 A;  2QTV A;  4JLI A;  4C8Q E;  3NFC A;  2PVG B;  3CMA T;  1G2B A;  1BBZ A;  4NS5 A;  3EG0 A;  2DRM A;  2BUD A;  4OVA A;  1ZLM A;  1KC8 U;  2EWN A;  1BIA A;  1YIT A;  3LX7 A;  3QHS A;  1BCO A;  3R6N A;  4EMH A;  1OEB A;  1MMD A;  2EIF A;  3JV3 A;  2F5T X;  3VV0 A;  2EQM A;  4BI8 B;  5GAN 4;  5GAM d;  1VQN T;  3I9Q A;  2DYB A;  4IUQ A;  4M7D G;  1E7O A;  4GLM A;  1QP2 A;  1R0B G;  2CP5 A;  2QDL A;  5KYX B;  1H3H A;  2XU8 A;  1K0S A;  1QW1 A;  2R5A A;  5CKH A;  4LNP A;  5EC7 A;  4FYV B;  4KRT A;  2D1X A;  2GQI A;  2LX7 A;  2COY A;  1IZ6 A;  1CKA A;  5IN1 A;  4A4E A;  3CPW P;  4M77 F;  2K3B A;  1SRL A;  2KVQ G;  1WXU A;  4V2S A;  3TQ7 P;  1GCQ A;  5GAN 2;  3QYH B;  1VQ9 T;  3G6E Q;  3OSV A;  1VQ7 T;  3UF4 A;  3CCQ Q;  1PSE A;  1BIB A;  1X6B A;  4PFO A;  2CSQ A;  5LJ5 h;  1KK7 A;  1VYT A;  4VUB A;  3CCJ A;  1WQ7 A;  1EZZ B;  3V7R A;  1M8V A;  3M57 A;  2NWM A;  1WGS A;  2H3E B;  4J8O A;  2HMA A;  1NG2 A;  2OI3 A;  3ZBD A;  3HRS A;  4M4Z A;  4RTZ A;  2H8H A;  3EFR A;  1K8A U;  3KUF A;  3GP8 A;  4LXC A;  3G4S A;  3M55 A;  3M4Y A;  5IHI A;  5CAI A;  1X2K A;  3A8H B;  2FZC B;  3TRE A;  2RD1 A;  1LCK A;  4PJO G;  1VQ4 T;  3E2U A;  1QKX A;  2PU9 B;  2DTH A;  4JRK A;  3BFM A;  1JJ2 P;  1KFZ A;  4JJC A;  5LJ3 e;  1RAG B;  3JCM X;  3CCE Q;  3L2U A;  3GOX A;  3OS0 A;  4HA8 A;  2BE9 B;  3JSC A;  1VQM A;  3VRY A;  2FVU A;  2NLU A;  4Y28 E;  1Y07 A;  2E12 A;  5L23 A;  2X4X A;  4J6W A;  2CH4 A;  2ENM A;  2LP5 A;  1U3O A;  3MET A;  4PJO F;  3CCJ Q;  2A08 A;  1O9S A;  1WZO A;  3L1A A;  2RK1 A;  2IVW A;  2I0N A;  3OYY A;  1AWO A;  4F7U A;  1GCP A;  3CD6 A;  3UWN A;  2JJ9 A;  4DBF A;  1B7T A;  1T0H A;  2OTL A;  4E7I A;  1D1C A;  2JMA A;  1Q95 G;  4PJJ A;  2EQJ A;  1ZUU A;  3MEV A;  1NLP C;  3VS7 A;  2KXD A;  4BI3 A;  2X35 A;  3JAM E;  2DPP B;  1YN8 A;  3JB9 D;  1ZSG A;  2EJF A;  4F7U F;  2DD4 A;  2GGR A;  2M1H A;  3MP6 A;  1PKS A;  4PJM A;  1WQW A;  4Y92 A;  2PUK B;  2YRD A;  4DA4 A;  1X69 A;  1HYO A;  1QVF A;  1Q86 U;  2DJZ A;  4FYX B;  2CUD A;  3JB9 J;  4L5G A;  2ABL A;  1B34 A;  1VIF A;  2FPD A;  4ZGJ B;  1VQK T;  4AFZ C;  1VQ6 Q;  2E64 A;  3MJX A;  1WA7 A;  5EG2 A;  4BY6 B;  1RUW A;  1FMV A;  3CCM Q;  3EGX A;  4A54 A;  2BZ8 A;  3A8G B;  5IT9 E;  4C5E A;  1ZSZ B;  2DIG A;  2EYZ A;  1UG1 A;  4ATO A;  3RMQ A;  4OB1 B;  4JRP A;  1UGV A;  4IUR A;  4GLK A;  1YNZ A;  1VQ5 A;  3G4S Q;  1VQL Q;  1WHM A;  3OYI A;  2LJ1 A;  1YIJ Q;  5KCH A;  3M58 A;  2YUP A;  4MMK A;  1AD5 A;  4II1 A;  2MI6 A;  3CCJ T;  4M77 G;  2F2W A;  2K5L A;  3A5Z B;  2HL3 A;  2EKO A;  3OS2 A;  1QCO A;  2ZGW A;  2F1L A;  1VUB A;  5CQX A;  2P4R A;  1WXB A;  2E3H A;  2DL4 A;  4M78 C;  4PJO A;  1UGR B;  2PUO B;  1MMG A;  2M51 A;  2ZPH B;  3EH1 A;  2O9V A;  1BK2 A;  4ZGE B;  1PKT A;  4OMN A;  5FW9 A;  3S3N A;  4KGZ B;  3OYK A;  2KI7 A;  4MDW A;  1X6G A;  3CCU T;  3CCV Q;  1M30 A;  4E7J A;  4ELZ C;  3OYC A;  3DLL A;  4E7Z A;  4KUI A;  2DXT A;  2QAS A;  2X4W A;  2HSP A;  4AG1 C;  3KFV A;  2EQI A;  1MMA A;  1VQP A;  2GBQ A;  4M75 F;  3SDZ A;  5GAN j;  3DLM A;  3CBP A;  5GAN 6;  2CRE A;  2AT1 B;  1MV3 A;  3VKI A;  4JJB A;  2CZ6 B;  5GAN 3;  2RQV A;  4ORZ A;  4KH1 B;  2YDL A;  3BDL A;  3CBO A;  1WYX A;  1K73 R;  3CCM T;  3HRU A;  3A1P A;  1YI2 T;  1NBE B;  4FW1 A;  5LJ5 e;  2F2V A;  4XU0 A;  4M7D B;  3ME9 A;  5GAM h;  5KYY B;  3C94 A;  3OYE A;  4F14 A;  1WFW A;  4MDX A;  5GAM f;  2LT4 A;  1K1Z A;  4JUV A;  1KD1 U;  2E6N A;  3BDU A;  1D1A A;  4A53 A;  2EAY A;  1SSF A;  4BI4 A;  1UGQ B;  3D7S B;  1VQM Q;  1BI0 A;  2CZ0 B;  1GFD A;  1SHG A;  4HT8 A;  1SF9 A;  1XOV A;  4F7U B;  2XDP A;  4BE2 A;  4JZ3 A;  1U8R A;  3CCE A;  2DMO A;  2JM9 A;  4NL3 A;  5CQY A;  4B6M A;  3OYG A;  3LYI A;  5FRO A;  1Q7Y R;  4LDX A;  3H6Z A;  3G71 T;  3CCL T;  1RAI B;  5HY6 A;  3CME T;  1K73 C;  1AWW A;  1YHQ Q;  4FW2 A;  1X2Q A;  4QW2 A;  1TUD A;  2AZV A;  1Y96 A;  3C4S A;  1VQK A;  2DVE A;  1K9M U;  4XTZ A;  3G71 Q;  5FRM A;  2E41 A;  4XTU A;  2HL5 C;  2KQW A;  1MHN A;  3RER A;  2JVV A;  3CCQ A;  1X27 A;  2LCC A;  3G6E A;  3TVT A;  1OX9 A;  2XID A;  5CKE A;  5J39 A;  1MMN A;  4M77 D;  1TTH B;  1ZUK A;  2XKO C;  4WTO B;  4ZTF A;  1YI2 Q;  2K7A A;  2LQ8 A;  2MCN A;  2G6F X;  5GAN d;  3X20 B;  3JB9 I;  1PG5 B;  2VGM A;  1ABQ A;  3V8L A;  3J80 E;  1RAE B;  3M56 A;  4OF1 A;  3CC7 T;  3OYN A;  3H8Z A;  4M75 G;  1M4Z A;  1VQ8 A;  4BUG A;  4M7A G;  1UGP B;  1MGQ A;  1TSF A;  1LNX A;  3VS5 A;  3PIP A;  1SG5 A;  1Y7X A;  3WVD B;  3CBM A;  1LJO A;  2RJE A;  4OMP A;  4M7A A;  4F04 B;  3GNF B;  5GMK m;  3HPW A;  5I2S A;  3VS4 A;  4C5G A;  3CCS T;  4JRI A;  4E47 A;  4EMK B;  3CEY A;  1SPK A;  1C1A A;  2JN0 A;  2RHY A;  2KEA A;  2O2O A;  1KQ2 A;  4FIB A;  5KYU A;  1Z9Q A;  4OGE A;  1UTI A;  5KYN A;  5I21 A;  2Y90 A;  5DM7 R;  1U1S A;  2FG0 A;  2DJQ A;  5CO7 A;  1AOJ A;  1RI9 A;  2RHX A;  3BY7 A;  4PJO B;  1LOJ A;  2QA4 A;  3PTA A;  4KGV B;  4JJN K;  1OQK A;  4QQD A;  3VU3 C;  3AT1 B;  2A37 A;  2J6O A;  1JEG A;  2Y4X A;  4C8Q F;  8ATC B;  3HTR A;  4RG8 A;  1QQJ A;  3I55 Q;  3VYH B;  2L3P A;  2RJF A;  1H8K A;  3CXC S;  4AMC A;  1PSF A;  3G1J A;  2R57 A;  3CCR T;  3THK A;  3G4S T;  2CP0 A;  3FJ5 A;  2M0O A;  4AFU C;  1WDX A;  1NYF A;  4A4G A;  3A98 A;  1WJS A;  3EG3 A;  2PTK A;  4GBQ A;  3VS1 A;  4RTU A;  3CCV A;  2WSE E;  4KGX B;  5FU6 C;  5KH6 A;  2P4T A;  1ZHI A;  3UDC A;  2L89 A;  2LQK A;  4RCC A;  2SRC A;  4M78 A;  5GMK i;  1Y96 B;  2K2M A;  3CCE T;  1FXX A;  4N4G A;  2AK5 A;  1YIJ A;  1D1B A;  3H0F A;  3EG9 B;  5GAO p;  4D8D A;  5FU7 C;  2D9T A;  3M4G A;  2EVR A;  2VXF A;  5KYW B;  1UEB A;  4B9X A;  2MOX A;  2E10 A;  4J6Y A;  4Z02 A;  4XAX B;  1MV0 B;  3LW5 E;  2HKN A;  4D6W A;  3EAE A;  3MP1 A;  4M7A F;  4C0D B;  1VQN A;  5CR2 A;  1VQL A;  1EFN A;  1VQ5 Q;  3QYG B;  2FYK A;  2QGF B;  2QQA A;  2VGN A;  2KXC A;  5I2M A;  2JTF A;  3CCU Q;  2GFA A;  4JLG A;  2CT3 A;  4HCB A;  1M2O A;  2VXE A;  2WSC E;  3CC2 A;  2K3Y A;  1OPK A;  1VIE A;  4R0K A;  3CC4 Q;  1ZBX A;  3JCM g;  1ZX6 A;  2RA2 A;  1QMC A;  4BY6 C;  2K5F A;  3UT1 A;  1X43 A;  2KYB A;  2L0A A;  2JS0 A;  3OMC A;  4FT2 A;  3Q1J A;  4M75 E;  1G3W A;  4RTW A;  1D0Y A;  2DEU A;  1BYM A;  2COW A;  3FEO A;  1NPP A;  4J9B A;  1W6X A;  3CCS A;  4RMO A;  3QDR B;  1GCQ C;  4AG2 C;  2LDM A;  3VYG A;  1V76 A;  4DBH A;  4B9W A;  4HKE A;  2D0N A;  2PZ1 A;  1RL2 A;  2VWF A;  2V1Q A;  1E6G A;  3M59 A;  3OYB A;  3CMA Q;  2DZC A;  4PJO E;  2H3J A;  1ACM B;  3OBW A;  1OZ2 A;  2XD0 A;  2WSF E;  1D0Z A;  1VQ5 T;  2QA4 T;  2VAS A;  1S72 A;  1PD1 A;  1FMK A;  2ZPI B;  4L59 A;  1OZ3 A;  3CPW S;  1M2V A;  1W2B S;  4LUD A;  3JB9 G;  1PRL C;  1M90 R;  1QVG S;  3GF5 A;  3CC4 A;  2JNG A;  2C06 A;  5IXB A;  2O88 A;  2DXU A;  3CXC P;  3HRT A;  4CC7 A;  2E6Z A;  2V8K A;  3FIF A;  2GTO A;  3M9Q A;  1YJ9 Q;  1OU9 A;  2EJ9 A;  2MMP A;  1I5O B;  2KRN A;  3JCM P;  4IKF A;  3NPF A;  2GCX A;  2OAU A;  2EYX A;  2LQW A;  2RHI A;  2OAW A;  3EFS A;  3QSU A;  3A8L B;  1JJ2 A;  3LGL A;  2C0O A;  1YJW Q;  4X34 A;  2HQH A;  1YIJ T;  2CSI A;  4BD3 A;  1BU1 A;  3QJ6 A;  4RTV A;  2XG8 D;  3T9N A;  1YJN Q;  1RAC B;  1M27 C;  1B07 A;  2WAC A;  2NUP B;  3EHQ A;  3CME Q;  3CCM A;  2VYT A;  2EFI A;  4PKC C;  4M78 B;  3TU4 K;  5LJ3 j;  4J7F A;  1FYN A;  4R56 A;  1QVF P;  3QO3 A;  1SEM A;  1J3T A;  3QKJ A;  4EPC A;  2OTJ A;  4AFS C;  5HK0 A;  2KY9 A;  2KYM A;  3QWX X;  1ZSZ A;  1VQ8 Q;  2EYQ A;  2E65 A;  3FB9 A;  4JDS A;  3JB9 F;  4PFP A;  2HDA A;  2M16 A;  2JM8 A;  3SD4 A;  3E9F A;  3OMG A;  1YCS B;  2EQU A;  2EYY A;  3DB4 A;  3RKX A;  2QGG A;  5DLQ E;  4M7D D;  2MYS A;  4CC3 A;  1AT1 B;  1I1J A;  3U23 A;  1VQ7 Q;  1X01 A;  3LWH A;  3CC7 Q;  5J26 A;  2VV5 A;  1PCX A;  2YXY A;  2FZG B;  5D7U A;  2O31 A;  1PHT A;  3CCQ T;  2CP3 A;  2L3R A;  2FHD A;  4QKU A;  4E7K A;  2YWW A;  2QI2 A;  4N4H A;  2L8D A;  2LCS A;  5D6W A;  3OY9 A;  1TWB A;  4JS5 A;  2MWO A;  1XQH A;  2QEX T;  1D09 B;  2LTO A;  5GAO l;  2L5Q A;  4HCK A;  4N0A C;  3VS0 A;  2MIO A;  1U5S A;  2KSS A;  1K9M C;  4BAC A;  3EG9 A;  3HHT B;  4FYY B;  1NE8 A;  2NYS A;  3CCL Q;  1O75 A;  1BI3 A;  1G83 A;  1VQ4 Q;  1UJY A;  1K73 U;  4J5Y A;  2MF2 A;  2JS2 A;  2FO0 A;  1AWX A;  2DL5 A;  3FJP A;  4AT1 B;  2KMT A;  2HAX A;  1Y0M A;  4HVU A;  3X26 B;  5GAM j;  3V8K A;  2DA9 A;  2ECZ A;  5LJ5 f;  3PGG A;  4Z88 A;  3RR6 A;  3EGX B;  1KD1 C;  1N8R R;  3JCM e;  2HZY A;  5AYF A;  1XJW B;  4C92 G;  2MWP A;  1BI1 A;  5GAN g;  1W2B A;  2X4Y A;  4DBQ A;  3GPL A;  2OTJ Q;  4OGC A;  2FL7 A;  2JMC A;  3JCM f;  1V1C A;  3DB3 A;  5ECA A;  4KBM B;  2Z0W A;  2VKN A;  4M7D A;  2JTE A;  5GAN h;  3JCM Q;  3QZ5 B;  4FSS A;  5DY9 A;  3OYA A;  2FB7 A;  4RTY A;  1BCM A;  3PMI A;  3JB9 H;  4XTW A;  4FYW B;  1M1K R;  3I56 A;  2HBW A;  1QLY A;  3FC3 A;  3RIR A;  2KT1 A;  1YJ9 T;  2RH2 A;  5FWC A;  2LQN A;  3CCV T;  1D3B A;  2DTO A;  1RAA B;  5LJ5 d;  4J7I A;  4JZ4 A;  2OTL T;  4XU3 A;  3I55 T;  3E19 A;  1AWJ A;  1YJN A;  4XU2 A;  5CIU A;  2FPF A;  2C0T A;  1XNI A;  4Y91 A;  2RJC A;  1OU8 A;  1YJW A;  1VQP Q;  1NPR A;  2DIL A;  5DLO A;  5A0D A;  3QDF A;  1R8O B;  1GBQ A;  1ABO A;  1I81 A;  3SWN B;  1EIF A;  2QQB A;  2ZCF B;  4FU6 A;  2E4H A;  2HQE A;  4M78 G;  4PJL A;  3H0H A;  2QDY B;  2M9U A;  4PK4 A;  3TCJ A;  4M7A E;  1VQ6 A;  3QWY A;  1VQL T;  4HVW A;  2VVK A;  3REB B;  5LL6 S;  2JW4 A;  1D0X A;  2EGA A;  1WJR A;  2FEI A;  1WHJ A;  3HFO A;  1U06 A;  4IUP A;  2EBP A;  2QQR A;  2DX1 A;  2QAZ A;  1G3S A;  2KT8 A;  2CKK A;  4E2F B;  4QVD A;  2CT4 A;  3S6W A;  4YTL A;  1KHC A;  3X24 B;  3OBY A;  2DL8 A;  2P0P A;  1KQS P;  1FMW A;  1QP3 A;  2IIM A;  4KUD K;  2DIQ A;  3UA7 A;  4M7D F;  1Q86 C;  4ELY C;  3SWN C;  2X51 A;  4RCB A;  2EKH A;  2HCK A;  2PVD B;  3VUZ A;  2E70 A;  4FT4 A;  1E6H A;  2IPO B;  4GY5 A;  3A8M B;  5A0L A;  3L2Z A;  2BZX A;  5CKD A;  4HT9 A;  1H92 A;  2OTL Q;  4ANJ A;  3LH0 A;  4LDV A;  1K8A R;  1ARK A;  1VOM A;  3JCM h;  2FRW A;  5IXF A;  2ZPF B;  2DF6 A;  3S3O A;  1AHJ B;  4RUG A;  4CC4 B;  3VUB A;  1MND A;  4PNO A;  2HSE B;  1S72 T;  2K9G A;  3C12 A;  3M5A A;  4XK8 E;  3EG2 A;  3JCM J;  4N0A A;  3L2Q A;  3IQL A;  1GBR A;  2ZAE A;  1D3B B;  3FLG A;  5LJ3 f;  2O9S A;  3VS2 A;  3UPU A;  4OB0 B;  4EDU A;  1KSW A;  5LJ3 h;  3V8J A;  5IHN A;  1G5V A;  5FLX E;  1VYU A;  1KIK A;  1GL5 A;  4M7A B;  4C92 D;  2DXB A;  1T3L A;  1HD3 A;  4CRI A;  2DE0 X;  3MEA A;  2F5K A;  3H9N A;  1RAB B;  1UHF A;  1GXI E;  5GMK l;  5J3B A;  3I5S A;  1YI2 A;  2YLB A;  2DXC A;  4QVC A;  5KYU B;  4M77 A;  1UB4 A;  3I5R A;  4LD6 A;  4LDY A;  3ZFJ A;  4C92 B;  2OJ2 A;  1QVF S;  3TEE A;  4E6R A;  1I5L A;  1C0M A;  1TUC A;  2QYZ A;  3SHW A;  3HKS A;  2AHJ B;  1OPL A;  1K8A C;  4J6X A;  3LWI A;  3MPU B;  2XDB A;  3JCM c;  1KG1 A;  5AT1 B;  1I8F A;  3NTI A;  1W2B P;  3RMS A;  1IGU A;  1JJ2 S;  1Q86 R;  1TU0 B;  4IIO A;  3RDV A;  3WVE B;  1VQ9 Q;  1RAD B;  1VQO T;  3RNJ A;  4RG2 A;  1M2V B;  3JRZ A;  2W10 A;  4M77 E;  4XTV A;  2ESW A;  1SRM A;  4R55 A;  2BZY A;  1K9A A;  3P8B B;  4F7U G;  2EYW A;  2YLC A;  4XTY A;  3G6E T;  1TS9 A;  4DEX A;  2YSQ A;  2D0Q B;  2X3W D;  4O5V A;  1IRE B;  1TUG B;  1DJ7 B;  3HL8 A;  1YIT Q;  2BE7 D;  2J05 A;  5IHK A;  1IB8 A;  3MKD A;  1WNL A;  1VQ7 A;  2PQW A;  1Q81 R;  5GJV B;  5M9O A;  1UEC A;  1K9M R;  2DK3 A;  2JZ2 A;  3UA6 A;  3OYM A;  2VC8 A;  3KXT A;  2EGC A;  2CDT A;  2R5M A;  3VRZ A;  3L2W A;  1ZBJ A;  1PM3 A;  5GAO m;  3CC7 A;  2P0Q A;  4QQG A;  4WF2 A;  4DEY A;  2PNI A;  1VQ8 T;  4J9H A;  2DD5 A;  1WJQ A;  1YWO A;  2KNB B;  3EGD B;  2EQK A;  3OW2 S;  3UAT A;  4HCZ A;  4X9C A;  2DET A;  3QJY A;  1B34 B;  1KC8 C;  2DTI A;  3BE3 A;  2GNC A;  3URG A;  2D8H A;  2DL3 A;  1N9R A;  1GRI A;  1CKB A;  3RUX A;  2QEX A;  4RKU E;  5CKB A;  4C0D C;  2RI2 A;  4PL6 A;  1OI1 A;  1R0C B;  4C0F A;  1NEB A;  2DZ9 A;  2GQV A;  4JRQ A;  4N4I A;  3MO8 A;  5GMK h;  2DBM A;  1QWF A;  1Q81 C;  2FZK B;  4WCI A;  1JXO A;  5A0G A;  1NYG A;  1M1K C;  2YHT A;  4M7A C;  3X25 B;  2K3X A;  3SWN A;  3V7C A;  4EMG A;  2LNH B;  2RQR A;  3HFN A;  2P84 A;  1MNE A;  2DM1 A;  1M3C A;  1HXD A;  2LT1 A;  1I4K 1;  2LRQ A;  2GFU A;  1AEY A;  2RPN A;  2KRM A;  2RQW A;  5I22 A;  2RM4 A;  2DER A;  1UDL A;  2IG0 A;  2COZ A;  2RI5 A;  5KYX A;  3V7S A;  1VQO Q;  1JB0 E;  3ASK A;  5I11 A;  1M9S A;  2W0Z A;  4C0G A;  2HBP A;  4OMO A;  2XHC A;  1KD1 R;  2AIR B;  1JXM A;  1N5Z A;  4LDW A;  2A28 A;  5GAM e;  2LJ0 A;  4Z89 A;  4E7H A;  2J6F A;  1W1F A;  4C5H A;  1YHQ T;  2DO3 A;  3N5B B;  1AZG B;  1OX8 A;  2EGE A;  2DLP A;  3INZ A;  2J7I A;  2VB6 A;  2ED0 A;  2DEQ A;  4OMQ A;  1WIE A;  2RB6 A;  1SHF A;  4F7U E;  1RLP C;  5IAY A;  4EMK A;  1WX6 A;  3L42 A;  1X6O A;  2RNA A;  2K79 A;  4MML A;  3SB2 A;  3J7A F;  1KQS A;  4HVV A;  1S1N A;  3CCS Q;  1YJN T;  1YP5 A;  1RAH B;  3CMA A;  3GNG A;  2DVJ A;  3REA B;  1Y71 A;  4OMM A;  3SFM A;  4MZM A;  1YJW T;  1QVP A;  1YIT T;  1N27 A;  3PVL A;  1UUE A;  5L8R E;  4C92 F;  4M7D E;  4XTX A;  1A0N B;  2LVM A;  5FU7 B;  1T0J A;  1QVG A;  4JJD A;  2CUB A;  3CPF A;  2A3L A;  2RF0 A;  2NUP A;  3GBQ A;  1NJI R;  4M77 C;  4J9C A;  3OW2 P;  2FRY A;  4QVZ A;  1PRM C;  3RES A;  4C8Q D;  2B86 A;  2GF7 A;  2AKK A;  2DFU A;  1TOV A;  3PMT A;  5A2Q E;  2E5Q A;  1VQN Q;  1WI7 A;  1WXT A;  1YCY A;  2DAQ A;  4PFZ A;  2NUT B;  1IHV A;  1N8R C;  4NOY A;  3OYL A;  1OOT A;  5FWB A;  2QTX A;  1U1T A;  3GLX A;  1WHL A;  1JQQ A;  2MPX C;  4C8Q G;  3OYD A;  3EGD A;  1LPL A;  2GTJ A;  3KBG A;  2RK2 A;  2XK0 A;  5D6Y A;  4PLI A;  3NGP A;  3H0I A;  2HQX A;  3MEW A;  1G3Y A;  3M0Q A;  1YWP A;  2QK0 A;  2RQT A;  3MEU A;  3HP9 A;  2MK5 A;  1PC0 A;  1H64 1;  2ROT A;  3SEM A;  4DBR A;  3QII A;  4M75 B;  4J9F A;  2E3I A;  3OS5 A;  5GAO r;  4KT0 E;  4ZN1 A;  5GAM g;  2QEX Q;  2FPE A;  4OMF B;  4IUU A;  3I56 T;  4FL6 A;  1VA7 A;  2DNU A;  4X1V A;  1JBM A;  3OW2 A;  1M3B A;  5FRN A;  2F2X A;  3LGF A;  3M53 A;  3I56 Q;  3O8V A;  1Q7Y U;  3CCR Q;  1NJI C;  3PIO A;  4TVR A;  4J9G A;  1PNJ A;  1JRI A;  2A0F B;  2KE9 A;  3JCM d;  4FSX A;  1QCN A;  3I55 A;  3EFO A;  2ATC B;  3VJP A;  1CSK A;  2BIV A;  4BDY A;  4J9I A;  4ZTJ A;  1NLO C;  3JCM b;  5KE2 A;  2D6F A;  2KDS A;  3MP8 A;  2LCL A;  2L3Q A;  1M90 U;  3CME A;  3OYH A;  1TXQ A;  1Q82 C;  1ZQ1 A;  4E7L A;  1N6A A;  4LUE A;  4M75 C;  1YFN A;  1KQS S;  3PFS A;  2RI3 A;  2X4J A;  2F69 A;  2DKG A;  2BTT A;  3EH2 A;  2V8I A;  4UC4 A;  2ZPE B;  4A63 B;  1UHC A;  4QQ6 A;  3CD6 Q;  3E1S A;  2JOY A;  2YT6 A;  4OP0 A;  3G7Z A;  2AZS A;  2CYZ B;  2I2L A;  1WHH A;  2C0I A;  2PVO B;  2V1R A;  1FWZ A;  4ESR A;  1IGQ A;  4J83 A;  2XI9 A;  3GIB A;  2RO0 A;  3P8H A;  4LN2 A;  3ZEH A;  2YUN A;  3CC2 Q;  1ZA1 B;  4HXJ A;  3QXE B;  4M78 E;  3QPH A;  4K11 A;  2J6K A;  1UFF A;  9ATC B;  1PD0 A;  4J9D A;  4X9D A;  5CVI A;  1M1F A;  1G8X A;  2RN8 A;  1VQ9 A;  4IUT A;  4C8Q A;  4BB7 A;  1F1B B;  1WHK A;  1C6V X;  1KC8 R;  3OQ5 A;  4AFQ C;  4NL2 A;  2LNV A;  3QZ9 B;  5KYW A;  5GAO n;  2RHZ A;  4P5N A;  3TSZ A;  5GJW B;  2X3X D;  1VQO A;  4HCC A;  1IHW A;  1K4U S;  5GAO q;  4XQ3 A;  2HD0 A;  1T3S A;  2V26 A;  4EIK A;  4XU1 A;  1UGS B;  5KE3 A;  5LJ3 g;  4OB3 B;  3OA6 A;  2J06 A;  4RTT A;  4M78 D;  3OYF A;  2XDD A;  1VQK Q;  1QKW A;  2JXB A;  2P0K A;  1Q82 R;  3M54 A;  1I07 A;  3MHX A;  1BB9 A;  2KRS A;  4PJO C;  4L6V 5;  4A4F A;  3L2R A;  4OB2 B;  1AZE A;  2JT4 A;  2M0Y A;  1BI2 A;  2ED1 A;  5HKC A;  1VQM T;  1HJD A;  3PVQ A;  5GAN 8;  3AHU A;  2B8A A;  1W4S A;  4BE0 A;  2EW3 A;  1Y57 A;  4M77 B;  5CKF A;  4C5I A;  1IRX A;  2EJG A;  3CCR A;  1HK9 A;  2DRK A;  1I0C A;  1H3Z A;  1R77 A;  3BW1 A;  4C92 A;  1Q82 U;  1M90 C;  1SKU B;  2MAM A;  3EFO B;  1M3A A;  2VUB A;  1LVK A;  3RKY A;  4DQ2 A;  4A4H A;  2QG9 B;  2RMO A;  5D6X A;  3VS3 A;  1KHI A;  1KQ1 A;  3ZL7 C;  2CGH A;  2AKL A;  2V8J A;  4C92 C;  1QVG P;  3H41 A;  2QA4 Q;  1OV3 A;  1M8M A;  3NTH A;  4RTX A;  1GFC A;  3NTK A;  1OUL A;  2E5K A;  1VYV A;  1UE9 A;  4ZNX A;  3OSS C;  1NJI U;  1ZUY A;  1Q7Y C;  2ZZD A;  3MCA B;  2L2P A;  3P8D A;  1M5Q 1;  2CH4 W;  2DYI A;  3TSW A;  3L2V A;  3EHR A;  3JCM V;  1M1G A;  4LD9 K;  8AT1 B;  1WHG A;  2O4X B;  3OS1 A;  2K4Y A;  1P92 A;  1B3Q A;  4M75 D;  1NEG A;  5GAN f;  1RAF B;  4Z8A A;  1JU5 C;  5LJ5 j;  3PE0 A;  1G3T A;  4A4K A;  3M0S A;  4KUL A;  2XMF A;  5FU6 B;  3CQT A;  3QUI A;  1ZA2 B;  2KR3 A;  3CXC A;  5GAN e;  3I35 A;  3ULR B;  4IIM A;  1YJ9 A;  4D8K A;  4C8Q B;  2K2V A;  4F17 A;  1KJW A;  2NUT A;  3X28 B;  5GMK j;  3LH5 A;  2CS7 A;  5KYY A;  3J81 E;  3OYJ A;  1S72 Q;  5CK9 A;  3CC2 T;  3OB9 A;  1RLQ C;  3EG1 A;  3QG1 A;  4ZN3 A;  7AT1 B;  2X9H A;  1N8R U;  5GMK e;  5LJ5 g;  5GAN 7;  4CI0 C;  2YRV A;  4PJN A;  4M7D C;  2A7Y A;  2DBK A;  4ZGD B;  3PT9 A;  2YRC A;  2OX7 A;  1WPY A;  3QBY A;  4JS4 A;  1HSQ A;  3G71 A;  3RKW A;  1V29 B;  3WXM B;  1MUZ A;  2ZPB B;  1UJ0 A;  2L3S A;  4M75 A;  1IXD A;  1NZ9 A;  2HKQ B;  3C0C A;  4QT7 A;  2M02 A;  6AT1 B;  3HSB A;  3FDR A;  3FRN A;  1FX7 A;  2G3R A;  2KAF A;  4MZP A;  1RI0 A;  4BE1 A;  1VQ6 T;  4OML A;  3CPW A;  1EX4 A;  5IH2 A;  4C92 E;  2LC4 A;  4JPB W;  2KBT A;  3S3M A;  1W70 A;  2ZPG B;  1OYX A;  1IO6 A;  5HK3 A;  2YUQ A;  3JCM W;  2A36 A;  1JO8 A;  3CCU A;  4E7S A;  4J9E A;  4ME7 A;  4PLL A;  1K76 A;  3M0U A;  1SSH A;  3ER0 A;  2CP7 A;  2RQU A;  2O01 E;  4IUV A;  1VQP T;  1AVZ C;  3VS6 A;  2CZ1 B;  3CC4 T;  2JTM A;  2YUO A;  1QCF A;  1K0X A;  2CP6 A;  4LDU A;  2K6D A;  1NM7 A;  2EPD A;  4KH0 B;  3A8O B;  2RJD A;  5C6S A;  2K5I A;  2QQS A;  2XIC A;  3F70 A;  4O6J A;  4M7A D;  5HCK A;  1N9S A;  2HEQ A;  4Q5W A;  2KK4 A;  3M0T A;  2RHU A;  2KGT A;  2JUF A;  2HNI A;  2Y4Y A;  1XTD A;  4C8Q C;  1X75 C;  4C0Z A;  3C95 A;  4F16 A;  2BKD N;  3RBB B;  4DOV A;  2ROL A;  3PNW C;  2E1H A;  2LJ3 A;  4DOW A;  2NUZ A;  4FM4 B;  2QXF A;  1PWT A;  3M0R A;  1VQ4 A;  1Z9Z A;  4BDZ A;  1TG0 A;  2SEM A;  2LX9 A;  3NMZ C;  5C0M A;  1QWE A;  3NHN A;  1YHQ A;  4PJO D;  3M0P A;  2CZ7 B;  2QQ9 A;  1TH7 A;  2CP2 A;  3O5Z A;  4MZT A;  1WLP B;  2K57 A;  3CCL A;  1M1K U;  4CC2 A;  3E9G A;  5CCA A;  5KCO A;  5GAN 5;  3EGU A;  4LE9 A;  4EMK C;  3R6O A;  1ZSZ C;  5LJ3 d;  3DKM A;  1Q81 U;  2LZ6 B;  1BKB A;  2OTJ T;  1YBY A;  2KRO A;  4FCY A; 
#chains in the Genus database with same CATH homology
 1WI7 A;  1WXT A;  2D8J A;  2LMJ A;  2KEA A;  2O2O A;  4JZ4 A;  1OOT A;  2DL7 A;  5FWB A;  1AWJ A;  1Z9Q A;  1JQQ A;  1UTI A;  2GTJ A;  2FG0 A;  2DJQ A;  1AOJ A;  2FPF A;  1RI9 A;  1G2B A;  2C0T A;  1BBZ A;  3EG0 A;  3NGP A;  3H0I A;  2DRM A;  2A37 A;  1ZLM A;  2J6O A;  3M0Q A;  1YWP A;  2RQT A;  1JEG A;  2DIL A;  1GBQ A;  1ABO A;  2ROT A;  3SEM A;  4J9F A;  3R6N A;  1OEB A;  2L3P A;  3JV3 A;  1H8K A;  3H0H A;  3THK A;  2FPE A;  3QWY A;  3I9Q A;  4HVW A;  2DYB A;  1VA7 A;  2DNU A;  4X1V A;  3FJ5 A;  2VVK A;  4AFU C;  1WDX A;  1E7O A;  1NYF A;  4GLM A;  3REB B;  3A98 A;  1M3B A;  2QDL A;  2JW4 A;  3EG3 A;  1H3H A;  2F2X A;  1K0S A;  2PTK A;  2EGA A;  2FEI A;  4LNP A;  5EC7 A;  4GBQ A;  4KRT A;  3VS1 A;  4RTU A;  2D1X A;  2GQI A;  2LX7 A;  1U06 A;  4J9G A;  1CKA A;  2EBP A;  1PNJ A;  2DX1 A;  2K3B A;  1SRL A;  1WXU A;  2KE9 A;  2KT8 A;  2CT4 A;  2SRC A;  1GCQ A;  2K2M A;  1CSK A;  2DL8 A;  3UF4 A;  4J9I A;  1NLO C;  2AK5 A;  1X6B A;  3H0F A;  4D8D A;  2CSQ A;  2L3Q A;  2IIM A;  1VYT A;  3UA7 A;  2EVR A;  4LUE A;  2MOX A;  2EKH A;  2HCK A;  2NWM A;  1E6H A;  1MV0 B;  2BTT A;  2BZX A;  1NG2 A;  2OI3 A;  1H92 A;  4A63 B;  1UHC A;  2YT6 A;  4M4Z A;  4RTZ A;  2H8H A;  1ARK A;  2AZS A;  2C0I A;  2V1R A;  1EFN A;  2FRW A;  5IHI A;  4ESR A;  5IXF A;  1X2K A;  2DF6 A;  2KXC A;  4RUG A;  4CC4 B;  4LN2 A;  2CT3 A;  1LCK A;  2YUN A;  4HXJ A;  2K9G A;  1QKX A;  1OPK A;  4K11 A;  1KFZ A;  4R0K A;  2J6K A;  4JJC A;  1UFF A;  4J9D A;  1ZX6 A;  3EG2 A;  2RN8 A;  3VRY A;  1X43 A;  3IQL A;  2KYB A;  1GBR A;  2L0A A;  2JS0 A;  5L23 A;  2O9S A;  3VS2 A;  4AFQ C;  1KSW A;  4RTW A;  2CH4 A;  2ENM A;  5IHN A;  3TSZ A;  5GJW B;  2LP5 A;  1U3O A;  2X3X D;  4J9B A;  1VYU A;  1KIK A;  1GL5 A;  1K4U S;  1W6X A;  2A08 A;  1GCQ C;  1T3L A;  4AG2 C;  2I0N A;  1HD3 A;  1AWO A;  2DE0 X;  1T3S A;  1GCP A;  2D0N A;  4EIK A;  2PZ1 A;  1T0H A;  2VWF A;  1UHF A;  2V1Q A;  1E6G A;  2JMA A;  3I5S A;  2J06 A;  4RTT A;  1ZUU A;  1QKW A;  2JXB A;  3I5R A;  1NLP C;  1I07 A;  2OJ2 A;  3VS7 A;  1BB9 A;  2KXD A;  2KRS A;  4E6R A;  1FMK A;  1YN8 A;  1TUC A;  3SHW A;  1ZSG A;  1AZE A;  1OPL A;  4LUD A;  1PRL C;  2GGR A;  2JT4 A;  2M0Y A;  2ED1 A;  1PKS A;  1HJD A;  3PVQ A;  2EW3 A;  4Y92 A;  1Y57 A;  5IXB A;  2O88 A;  1X69 A;  2DRK A;  1I0C A;  4CC7 A;  4IIO A;  1M3A A;  2CUD A;  2GTO A;  2ABL A;  2RMO A;  3VS3 A;  2FPD A;  3RNJ A;  2W10 A;  4AFZ C;  3ZL7 C;  2KRN A;  2ESW A;  1WA7 A;  3NPF A;  1SRM A;  2AKL A;  2BZY A;  1K9A A;  2EYX A;  3H41 A;  1RUW A;  1OV3 A;  1M8M A;  2BZ8 A;  2EYW A;  1GFC A;  2LQW A;  4RTX A;  4DEX A;  2YSQ A;  2X3W D;  2OAW A;  2E5K A;  1VYV A;  1UE9 A;  4ZNX A;  2EYZ A;  1UG1 A;  2C0O A;  2J05 A;  5IHK A;  1ZUY A;  1UGV A;  2L2P A;  1YNZ A;  5GJV B;  1UEC A;  2CH4 W;  2CSI A;  2LJ1 A;  1BU1 A;  3UA6 A;  3TSW A;  2YUP A;  2EGC A;  4RTV A;  2CDT A;  3EHR A;  3VRZ A;  1AD5 A;  1ZBJ A;  2F2W A;  1B3Q A;  1M27 C;  1NEG A;  1B07 A;  1JU5 C;  4Z8A A;  4DEY A;  2PNI A;  3EHQ A;  2P4R A;  1WXB A;  3PE0 A;  2DL4 A;  3M0S A;  4J9H A;  2XMF A;  1YWO A;  2KNB B;  3CQT A;  2KR3 A;  3UAT A;  2M51 A;  1FYN A;  2O9V A;  3I35 A;  1BK2 A;  3ULR B;  4IIM A;  2GNC A;  2D8H A;  4D8K A;  1SEM A;  2DL3 A;  1PKT A;  1J3T A;  4F17 A;  4OMN A;  5FW9 A;  1KJW A;  4AFS C;  1GRI A;  1CKB A;  3LH5 A;  2KYM A;  3QWX X;  1X6G A;  1M30 A;  1RLQ C;  3EG1 A;  2HDA A;  1NEB A;  2HSP A;  2JM8 A;  4AG1 C;  3KFV A;  2EQI A;  2DBM A;  1QWF A;  2GBQ A;  2DBK A;  1YCS B;  4WCI A;  1JXO A;  1HSQ A;  2EYY A;  2CRE A;  1MUZ A;  4CC3 A;  1NYG A;  1I1J A;  1UJ0 A;  3U23 A;  1MV3 A;  2L3S A;  4JJB A;  2LNH B;  2RQR A;  2RQV A;  2DM1 A;  1M3C A;  4ORZ A;  2YDL A;  3C0C A;  4QT7 A;  1WYX A;  1AEY A;  2RPN A;  2KRM A;  2RQW A;  5I22 A;  2O31 A;  1PHT A;  1UDL A;  4OML A;  5IH2 A;  2F2V A;  4JPB W;  2KBT A;  5I11 A;  2LCS A;  1W70 A;  4F14 A;  1WFW A;  2W0Z A;  1K1Z A;  1IO6 A;  4OMO A;  2YUQ A;  2A36 A;  1JO8 A;  4J9E A;  1JXM A;  1N5Z A;  1K76 A;  3M0U A;  1SSH A;  1GFD A;  4HCK A;  1SHG A;  2A28 A;  1XOV A;  2LJ0 A;  3VS0 A;  4Z89 A;  2MIO A;  1U5S A;  2J6F A;  4JZ3 A;  1W1F A;  2RQU A;  2DMO A;  1AVZ C;  2JM9 A;  3VS6 A;  2YUO A;  1AZG B;  1QCF A;  2EGE A;  1K0X A;  2DLP A;  2K6D A;  2J7I A;  1NM7 A;  2ED0 A;  1G83 A;  2EPD A;  1UJY A;  4OMQ A;  1AWW A;  2JS2 A;  1X2Q A;  2FO0 A;  1AWX A;  2DL5 A;  1TUD A;  2AZV A;  5HCK A;  1WIE A;  1SHF A;  1RLP C;  2HEQ A;  1Y0M A;  4HVU A;  3M0T A;  1WX6 A;  2DA9 A;  2KGT A;  2RNA A;  2ECZ A;  4Z88 A;  1X27 A;  2K79 A;  3TVT A;  4HVV A;  1S1N A;  4F16 A;  3RBB B;  1YP5 A;  2ROL A;  1ZUK A;  2LJ3 A;  2NUZ A;  1PWT A;  3M0R A;  2K7A A;  2DVJ A;  2MCN A;  2G6F X;  3REA B;  1Z9Z A;  4OMM A;  1TG0 A;  1ABQ A;  2JMC A;  1V1C A;  2SEM A;  5ECA A;  3NMZ C;  3PVL A;  1UUE A;  2VKN A;  1QWE A;  3NHN A;  2JTE A;  3M0P A;  1A0N B;  4FSS A;  4RTY A;  1T0J A;  4JJD A;  3O5Z A;  2CUB A;  3VS5 A;  1WLP B;  2RF0 A;  3GBQ A;  4CC2 A;  4J9C A;  4OMP A;  2HBW A;  1QLY A;  2FRY A;  3EGU A;  1PRM C;  4LE9 A;  2B86 A;  2KT1 A;  3VS4 A;  2AKK A;  2LZ6 B;  5FWC A;  2LQN A;  2KRO A;  1SPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...