1ZX6A

High-resolution crystal structure of yeast pin3 sh3 domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
b'EYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ypr154wp
publication title Structural genomics of yeast SH3 domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 10
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2005-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zx6A00
3JV3A 1WXTA 2LX7A 1WXBA 1AOJA 1A0NB 5IHNA 4AFSC 4OMQA 1KJWA 2LJ3A 1FYNA 1SHGA 1PRLC 2LQNA 1MV3A 2FG0A 4HVVA 1LCKA 2YSQA 3R6NA 1G83A 2KBTA 1YP5A 1SPKA 1MV0B 3U23A 2J05A 1GL5A 2BTTA 2KXDA 1K1ZA 3M0QA 2KRSA 2MOXA 2X3XD 1JXOA 4LUDA 2ROTA 2YDLA 1ABOA 2CSQA 3VS7A 2LZ6B 1AZGB 2CH4W 5IXBA 4Z88A 1NLOC 1QKXA 4J9IA 2CDTA 3LH5A 2X3WD 4WCIA 2K79A 1X6BA 4OMOA 3M0TA 2BZXA 1ZSGA 4JZ4A 1ZUKA 4AG2C 2DF6A 2VVKA 3I35A 3I5SA 4CC3A 1RUWA 2LQWA 2EKHA 2DYBA 2EGEA 2G6FX 1W70A 2B86A 4J9BA 1SHFA 1E6HA 1T3LA 2ENMA 1BBZA 2KROA 3UA6A 2RNAA 2YT6A 1Z9ZA 1K0SA 3EHQA 1UECA 2GGRA 2JM8A 1PKTA 2O2OA 3H41A 1ZLMA 2EPDA 4OMNA 2NWMA 1X43A 1YWOA 2IIMA 2JTEA 3H0HA 5EC7A 4ESRA 3M0UA 4E6RA 1T3SA 3PE0A 3NMZC 2DL4A 1KFZA 1JEGA 3EG1A 2ABLA 4J9DA 1NYGA 2JMAA 2DLPA 4LN2A 5IHIA 2RN8A 4K11A 2W10A 4LNPA 4RUGA 2L3SA 2BZ8A 1JQQA 1ZX6A 3EG3A 4QT7A 3IQLA 4OMMA 3REBB 1BB9A 2ED1A 2DE0X 1M8MA 3TSZA 1VYUA 2CT3A 2JS2A 1M3CA 2GTOA 2AZVA 1HD3A 1AD5A 1SRMA 2ECZA 2YUQA 4OMLA 3M0PA 2DL8A 2V1RA 1OOTA 2H8HA 3PVQA 2YUNA 5GJWB 2RPNA 2RQUA 3ULRB 2J06A 1K9AA 1VA7A 2C0TA 2M0YA 2V1QA 2CREA 1GFDA 2O31A 1GFCA 2DL5A 3SHWA 4CC2A 2JW4A 2KR3A 1KIKA 3EHRA 2BZYA 2OAWA 4JJCA 4EIKA 4IIOA 1UHFA 1I07A 3KFVA 1SSHA 2LP5A 4RTZA 3H0FA 1AWJA 1M3AA 2KXCA 1NYFA 2KEAA 4OMPA 2L0AA 1ARKA 1UGVA 2CSIA 2RQTA 1UFFA 2J7IA 1OV3A 1UJ0A 2DMOA 2L3QA 2OJ2A 4CC4B 1AWWA 2D1XA 2CUDA 3CQTA 1Y0MA 2KT8A 1YN8A 2D0NA 1Y57A 2F2VA 3UATA 4IIMA 1PWTA 2J6KA 2K7AA 3NHNA 2SRCA 4KRTA 1GBRA 3VS3A 4D8KA 4Z8AA 2J6FA 2ED0A 5HCKA 3FJ5A 1NEGA 1GCPA 1K0XA 3VS0A 4Y92A 2GQIA 2KYMA 1ABQA 4LUEA 1BU1A 2F2XA 1WIEA 1X6GA 1V1CA 3VRYA 2O9SA 1Z9QA 1WLPB 5ECAA 2JM9A 3THKA 1CKAA 2LJ1A 1UG1A 3EG0A 2EBPA 2DVJA 2RMOA 1CSKA 3SEMA 4CC7A 1W6XA 1QLYA 1TUCA 2GNCA 1X2KA 4JZ3A 4RTXA 2CUBA 4RTYA 2K6DA 3VS5A 1WX6A 1N5ZA 2KT1A 4ORZA 2K3BA 3TVTA 2JT4A 1U5SA 2MIOA 2PNIA 1WFWA 3VS4A 2YUPA 4M4ZA 4LE9A 1WXUA 2K2MA 3VRZA 1NG2A 1U3OA 1QCFA 1NLPC 2L3PA 5FWCA 3M0RA 1RLPC 1X69A 3M0SA 2OI3A 2C0IA 2J6OA 4FSSA 4F16A 1BK2A 2EVRA 4F14A 2QDLA 2FRWA 1T0JA 4RTWA 5FW9A 3NPFA 1GCQC 1JU5C 1AWXA 1ZBJA 5IH2A 1VYVA 1YNZA 2AZSA 4AG1C 4ZNXA 4HVUA 1QWFA 2LJ0A 2AKLA 1TUDA 4R0KA 1YWPA 5FWBA 1WYXA 3O5ZA 1QKWA 1ZUUA 2AK5A 5I11A 2EQIA 2C0OA 2O9VA 2KRMA 3VS2A 2KE9A 2RQRA 1B07A 2HDAA 1K4US 4RTVA 2RQVA 2LMJA 1U06A 1M3BA 1CKBA 1UE9A 1PKSA 5IHKA 3EGUA 1JXMA 1VYTA 1WA7A 2HBWA 2FPFA 2HSPA 2PZ1A 4GBQA 2A36A 3I5RA 4J9CA 5IXFA 1RI9A 1FMKA 1K76A 1MUZA 2EW3A 2FRYA 4X1VA 2A37A 2EGCA 3EG2A 4JJBA 3VS1A 2HCKA 3TSWA 2DRMA 2F2WA 1KSWA 2EGAA 1E7OA 4J9GA 4J9HA 3A98A 2GTJA 2M51A 3NGPA 2DJQA 2EYZA 2DNUA 1GCQA 1X27A 1UHCA 1WDXA 2FEIA 2CH4A 2CT4A 2PTKA 4RTUA 2ESWA 3H0IA 1JO8A 2MCNA 5L23A 2HEQA 2EYYA 1IO6A 1GRIA 4F17A 1M27C 2JS0A 1AVZC 3UF4A 4D8DA 2A08A 2AKKA 4DEYA 2XMFA 2ROLA 5I22A 1TG0A 2GBQA 4HCKA 2I0NA 3VS6A 4AFUC 1PHTA 1PRMC 3GBQA 2E5KA 1AEYA 1W1FA 1AWOA 4AFQC 3RBBB 1OPKA 2DM1A 2P4RA 1UDLA 1SRLA 2RF0A 1UTIA 1J3TA 4JJDA 1E6GA 2SEMA 1YCSB 2K9GA 3C0CA 2KYBA 1WI7A 2DL7A 2FPEA 1X2QA 2LNHB 1T0HA 3PVLA 3QWXX 2EYWA 2KRNA 2DRKA 4AFZC 1XOVA 2JXBA 4Z89A 2YUOA 2NUZA 2W0ZA 1SEMA 2DA9A 2DX1A 1OEBA 1UJYA 1H92A 4A63B 1HSQA 1ZUYA 3RNJA 2KNBB 2A28A 3REAB 2LCSA 1EFNA 1I1JA 2DBMA 1I0CA 4J9EA 2RQWA 5GJVB 2JMCA 4RTTA 1NM7A 2O88A 1G2BA 1PNJA 1HJDA 4DEXA 2VKNA 2D8HA 1UUEA 3UA7A 2DBKA 2L2PA 2KGTA 2EYXA 1QWEA 1M30A 1RLQC 3ZL7C 1GBQA 1NEBA 1H3HA 3QWYA 4JPBW 1OPLA 2DL3A 4HXJA 2DILA 2D8JA 2VWFA 1AZEA 4GLMA 1S1NA 1H8KA 2FPDA 2FO0A 3I9QA 4HVWA 4J9FA 1B3QA
chains in the Genus database with same CATH superfamily
1YBYA 3PIOA 3MCAB 1WGSA 4J83A 4C0GA 2QEXT 2F5KA 1YJ9Q 3VUBA 1N9SA 5IHNA 3JCMV 2LJ3A 2FG0A 3CCLQ 3A8GB 4QVCA 4BY6B 4L6V5 1SPKA 1MHNA 1N8RC 3OBYA 1Q95G 2BTTA 3PIPA 1YJ9T 4LUDA 3X28B 2YHTA 2RJDA 3A8MB 3EGDB 4E47A 2CS7A 4IUQA 3L2VA 2CDTA 3CCLT 5D6WA 1YJWQ 4M7AE 1X6BA 5LJ5j 3CMET 3M54A 3M0TA 3JCMP 2JNGA 4JZ4A 2RH2A 2LQ8A 1K9MR 3I5SA 3CXCS 1HK9A 4M75G 2DYBA 3A5ZB 4JRQA 2B86A 2XD0A 1YJWT 3GNFB 2KVQG 1Z9ZA 3WVDB 3EHQA 3G6EA 2E6NA 2GGRA 2O2OA 2XK0A 1ZLMA 2QDYB 3H41A 2A7YA 1YI2A 2EPDA 1M8VA 2NWMA 1X43A 1YWOA 2DD5A 5FRMA 1OX8A 3H0HA 5EC7A 3M58A 3QJ6A 3PE0A 1EZZB 5M9OA 4C5HA 4J9DA 4DOVA 2JMAA 4M77E 2DLPA 4LN2A 1M2OA 2MK5A 4K11A 2XG8D 1TU0B 1JQQA 5GAN7 4QT7A 4OMMA 2GFAA 2DE0X 1VYUA 2JS2A 5CKBA 2D0QB 4A53A 3RKYA 1AD5A 4OMLA 2K4YA 5CO7A 2QYZA 2YUNA 5GJWB 2J06A 1VA7A 2EJGA 2E41A 3JCMh 2CREA 1GFDA 4EPCA 3S3OA 3SHWA 2RA2A 2CP2A 3GNGA 4N0AC 2BZYA 2AIRB 1M4ZA 2E3IA 2OAWA 3FIFA 2Y4YA 4ATOA 3KFVA 3EAEA 1I5OB 3H0FA 2RI5A 2L0AA 4M75B 5KE3A 1ARKA 1R77A 3G4ST 1UFFA 2J7IA 1WHHA 4A4EA 2DMOA 4RMOA 4CC4B 3CQTA 2HQXA 1Y0MA 4XAXB 2H3EB 4FW2A 2B8AA 4A4HA 4M7AG 2QQBA 2GCXA 5GAMf 4ELYC 3E1SA 2L89A 2DXUA 2CP0A 4JRPA 5GANd 2V8JA 5CCAA 2FZCB 1FMVA 3VV0A 4JS5A 2QG9B 5LL6S 1DJ7B 1PM3A 1NE8A 1KD1C 3HP9A 1Z9QA 1WLPB 5ECAA 1CKAA 2LJ1A 1UG1A 3CPWS 2DVJA 4N0AA 3GF5A 1M5Q1 1K73C 2XIDA 5A0DA 3OSVA 3OW2A 4XTYA 2F5TX 1HYOA 4MZPA 3OYMA 1YCYA 4J5YA 3EGXB 1VQPQ 4A4FA 4M77G 5CIUA 2KT1A 2CZ6B 1QVFP 3L42A 1B34B 3SWNB 4M75D 1M1GA 1VQMA 1K8AR 1AT1B 1U5SA 3A1PA 1Q82R 4J6WA 4O6JA 2PNIA 1WFWA 1VQPT 2YUPA 1EX4A 2RHZA 4FYVB 3X25B 1NLPC 5FWCA 4RCCA 2YLBA 3M0SA 2OI3A 4EMKB 2HQHA 4YTLA 9ATCB 2PU9B 1IHVA 3DLMA 4F7UF 1VQ9A 2EVRA 4RTWA 4M7AB 3I55A 1I5LA 1VYVA 1YNZA 3G71Q 1KC8C 1M1KC 1VQNA 3P8BB 3P8DA 2LJ0A 3RMSA 2DXCA 1TUDA 1QVPA 2FL7A 3CBMA 4BDZA 1YWPA 1VQ8Q 1KK7A 1QKWA 2QAZA 3JCMQ 1W2BA 1F1BB 4RG2A 3ZFJA 2O9VA 2RB6A 2KRMA 4OB0B 2RQRA 3DB3A 2Y90A 3M4GA 3OS0A 1LPLA 2AT1B 5GANh 3PGGA 4VUBA 4MZMA 1Q86U 3G71T 2MWOA 3ASKA 4KULA 4AT1B 1VYTA 1MMGA 2HBWA 2PZ1A 2IVWA 1WQ7A 1VQ8T 1Q7YU 1KQSP 2HKQB 3I5RA 4M7AF 1RI9A 4E7JA 3C94A 1BCOA 1FMKA 5KYYA 4X1VA 2VGMA 2A37A 2WSEE 4ZGEB 2RHUA 2ZPEB 4JJBA 2HSEB 2OTLA 1OZ3A 2HCKA 3HRTA 1OQKA 4M77B 4QW2A 1E7OA 2M51A 4X9DA 2DYIA 4OB3B 3QXEB 3CD6A 3JCMf 1VQ4Q 2CH4A 2ATCB 2MCNA 5D7UA 4F17A 4FIBA 3V7RA 3UF4A 2KDSA 4PJOC 3LWHA 4M7AD 1M1FA 2HNIA 2A08A 3J81E 2XMFA 4E7SA 2OTJA 2ZPIB 1VQ4T 1TG0A 2GBQA 2O4XA 2P0KA 2NUTB 3CCRT 3TU4K 2E5KA 2L3RA 3GP8A 2P4RA 1UDLA 3MP1A 3RIRA 2RF0A 1J3TA 1TUGB 2EWNA 4ZGDB 2SEMA 2K9GA 3UT1A 2BIVA 3JRZA 3CC4T 2LNHB 2K3YA 3QWXX 2RJFA 2HD0A 2KRNA 1VQ5Q 4FM4B 2K5LA 1VQKA 2XHCA 4MDWA 5GMKe 4M77D 4BE0A 1SEMA 3CCEA 3ER0A 1UJYA 1H92A 4PJOA 1HSQA 2E12A 8AT1B 1VQ5T 2F1LA 5GAN4 1RAFB 3KBGA 3L2UA 4RG8A 5CKEA 1I1JA 1QVGS 3FLGA 3PTAA 3EFOB 3NTKA 4XU2A 2RD1A 1HJDA 5KYUB 1K73U 4C0DC 2RI2A 4XU0A 2E4HA 2YRVA 1M30A 1UB4A 5GMKj 5HKCA 4XK8E 5FU7B 1VQ6Q 3QDFA 4HXJA 5IT9E 4LD6A 3META 3VJPA 2D8JA 5CQYA 3UWNA 3NTHA 5KYXB 2P0QA 2YRDA 2PQWA 4D6WA 1FXXA 3OBWA 2QA4A 5AYFA 3CMAQ 2XICA 2MI6A 3JB9F 4MDXA 2WACA 4OMQA 5GAMd 1VQ6T 1KJWA 1FYNA 1YIJA 1BI1A 1ACMB 2HL5C 3F70A 4HVVA 1LCKA 2QI2A 5KE2A 3R6NA 1G83A 1MV0B 5FROA 2J05A 1RADB 3CMAT 2VASA 2Z0WA 1RAIB 2KRSA 1KC8U 2X3XD 4LDVA 1W2BP 5AT1B 5FU6C 2CH4W 5EG2A 1GXIE 1QW1A 1QKXA 4J9IA 1VQ7A 3LH5A 3PMIA 2G3RA 2K79A 3JCMb 3JB9D 2WSCE 2EQKA 4QVDA 1RI0A 1TS9A 2LQWA 4NS5A 2EKHA 1YITA 3CC2A 4BDYA 3S6WA 4B9WA 1SHFA 2DTHA 1BYMA 2ENMA 1BBZA 3UA6A 2DAQA 4PKCC 5LJ5h 4M7DA 3VYHB 4V2SA 2JM8A 1N27A 3CXCA 2PVDB 3CCSQ 1VQOQ 4KUIA 4ESRA 2NLUA 2AHJB 2ZPFB 2COWA 1XTDA 3QKJA 2JTMA 2VV5A 5KYWA 1BB9A 4BACA 3DLLA 1M8MA 3TSZA 2CP6A 2DIGA 2GTOA 4B9XA 5GAMh 1HD3A 2YUQA 3M0PA 5CKDA 3VU3C 2DL8A 3HPWA 4OGEA 2FYKA 4OMFB 2O01E 1OI1A 2ZAEA 2KSSA 1K9AA 3BE3A 2C0TA 4LDWA 2HMAA 3AHUA 3RKWA 1OU8A 1XQHA 1GFCA 2DL5A 2DTOA 1Q7YR 1KIKA 2KR3A 7AT1B 1V29B 1BIAA 4XU3A 4DOWA 3OYCA 3OYNA 4J7IA 2EJ9A 5FLXE 1MMAA 2M02A 2V8IA 1UHFA 5CK9A 2KMTA 1SSHA 1AWJA 2E10A 1M3AA 2KXCA 3CCJA 2K2VA 4M78E 1UGVA 1JRIA 2XDDA 3URGA 1OV3A 1YHQQ 2L3QA 2LRQA 2OJ2A 1JJ2P 1AWWA 4WTOB 2CUDA 1BKBA 2MYSA 1Y57A 2F2VA 1VQLA 3CCQA 3MEAA 2KK4A 3JCMd 1YJNQ 1KHIA 1M9SA 1GBRA 4C8QA 3CMEQ 4C92C 3CCUA 2R58A 4Q5WA 4Z8AA 4D8KA 3QZ5B 4KT0E 1YHQT 4ZTFA 4RCBA 3FJ5A 1K0XA 3CBPA 2DKGA 1BIBA 4ZN1A 4LUEA 1BU1A 3M9QA 1X6GA 4C5EA 1YJNT 1Y71A 1RAEB 3LWIA 1LNXA 5LJ3e 2JM9A 1BI3A 3THKA 5IAYA 4IUPA 4PK4A 4HCCA 3E9FA 2RO0A 4CC7A 5CAIA 1W6XA 4E7KA 3MKDA 1QLYA 2V8KA 5CKHA 4RTXA 3I56A 3JB9H 4MMKA 1Q81C 2BUDA 2K6DA 1WNLA 4Y91A 3CPWA 3VS5A 4LXCA 1ZSZC 2EJFA 2EYQA 3QSUA 2YRCA 4HT8A 3RKXA 1VQ9Q 2JZ2A 2MIOA 5LJ3j 1RAGB 4IUUA 3VS4A 4LE9A 2K2MA 2E70A 1U3OA 1QCFA 3M0RA 1VQNQ 1X69A 2A3LA 1N9RA 1BK2A 1TOVA 1VQ9T 4EMHA 1T0JA 5FW9A 1GCQC 3S3MA 1SKUB 2AZSA 4AG1C 4DQ2A 1XNIA 1VQNT 4UC4A 4R0KA 5LJ5f 3QIIA 4M78G 4HCBA 3O5ZA 3G4SQ 1G3SA 3FEOA 3VS2A 4BY6C 1B07A 3RMQA 2RQVA 2DJZA 2LMJA 1LOJA 1M3BA 1UE9A 2LCCA 2X9HA 1ZSZA 1NJIU 2QTXA 5CQXA 1D3BA 1WJSA 1VIEA 2IPOB 2FPFA 1X75C 2RJEA 5KYYB 3GLXA 4GBQA 1NPRA 4GY5A 1FMWA 4PJOG 5IXFA 2RHXA 2EW3A 1QVFS 4M7DE 8ATCB 4LDXA 1TWBA 1K9MC 5GAN3 2OTLT 2QEXA 2R57A 1KSWA 4J9GA 3A98A 2GTJA 1Y7XA 3OA6A 2DJQA 3HSBA 4R56A 4FW1A 2DXTA 3A8LB 1GCQA 1X27A 1UHCA 2FEIA 2P0PA 2OTJQ 3CD6T 4RTUA 2M9UA 2K5FA 1AVZC 4M75F 5CVIA 1I81A 2MMPA 2AKKA 2FZKB 3TREA 2ROLA 4J8OA 2OTJT 3E2UA 5DLOA 3CCLA 1UGQB 3VS6A 4AFUC 1D09B 3GBQA 4FT4A 3V8JA 1W1FA 1AWOA 2E5QA 2ZZDA 3RBBB 1OPKA 1JB0E 5GMKi 4M78B 1D0YA 3INZA 5I21A 1QP2A 1YCSB 2JN0A 1WI7A 2DL7A 5GAN5 3EFRA 4QQ6A 1KQSS 1VIFA 2X4YA 1T0HA 2LT1A 3PVLA 4XTZA 2ZGWA 3OYKA 2K3XA 2EYWA 4AFZC 4BB7A 1N8RU 1XOVA 2K57A 2JXBA 2YUOA 4OP0A 4FU6A 1VQKT 5J3BA 2HL3A 5HK0A 2DA9A 4KUDK 1M90R 5C0MA 2L8DA 2DX1A 3CCET 2HAXA 1QQJA 2CZ1B 2VGNA 1OEBA 4X9CA 2BE7D 4C8QE 3LGFA 1ZUYA 3QYGB 2KNBB 3TQ7P 4M78F 5LJ3g 3JAME 2EQMA 2A28A 3QYHB 3REAB 4CRIA 1KG1A 2DO3A 2DBMA 4J9EA 2QTVA 2XDPA 3CCMQ 4FT2A 3DB4A 5GJVB 1NM7A 1G2BA 5A0LA 4M7DG 3OMGA 2L2PA 2KGTA 2EYXA 1RLQC 3ZL7C 1OU9A 5KYNA 4II1A 3CCMT 1MMNA 1H3HA 1QVGA 2X35A 3H8ZA 4M78D 2XDBA 2JOYA 3CCVQ 4OVAA 1KQ2A 4C0FA 1H8KA 1WHKA 1SG5A 4PFOA 3I9QA 3OY9A 1B3QA 2QA4T 4BE1A 4PFZA 4BI8B 2LX7A 3KXTA 1A0NB 4KH1B 4AFSC 1SHGA 4OB1B 2QQRA 4KGVB 3VKIA 3CCVT 2EQUA 1PRLC 2LQNA 3CCRQ 2I2LA 4PJMA 2YSQA 3JCMX 3U23A 1GL5A 1K1ZA 2MOXA 2ROTA 1ABOA 3VS7A 2LZ6B 1K8AC 1AZGB 2DERA 1Q82C 4Z88A 3OYYA 1PD1A 3CC2Q 2X3WD 3JSCA 4WCIA 3CC4Q 4M77F 1S72Q 4JJNK 2BZXA 1ZUKA 4AG2C 1SSFA 2DF6A 3I35A 2F69A 3EG9B 5KCOA 4CC3A 2KAFA 4E7LA 4M7AC 4M7DB 1YITT 3CC2T 2DETA 4C8QG 4J9BA 2CGHA 1E6HA 1S72T 1T3LA 5GANe 2CKKA 2RNAA 4ME7A 3UPUA 1K0SA 2H3JA 1UECA 3ME9A 4F7UA 1PKTA 5GAOr 3BY7A 1R8OB 5GAN6 4FSXA 2CP3A 2MF2A 2IIMA 1TXQA 1IRXA 3A8HB 1T3SA 3MP8A 5KYWB 1VQPA 1KD1U 1JEGA 1B34A 1IGUA 3H9NA 1NYGA 4OGCA 2X4XA 4LNPA 2R5AA 3OW2P 2BZ8A 3EG3A 1ZX6A 5LJ5d 4IURA 2P84A 5GAOl 1RL2A 5GANj 3P8HA 4JRKA 2MAMA 1SRMA 2ECZA 3M5AA 5GAN8 1OOTA 3RDVA 2FZGB 2HQEA 2RPNA 3ULRB 1WHLA 3OYHA 4C5GA 4M7AA 1NJIR 2V1QA 1IZ6A 1UGPB 4XTVA 2O31A 4CC2A 1X6OA 2JW4A 4BE2A 3MHXA 3G71A 5GAOn 3PFSA 4EIKA 4IIOA 4M7DD 1I07A 4EDUA 2NYSA 1VQ8A 2KEAA 4OMPA 1IXDA 2CSIA 2PVOB 2RQTA 5D6XA 1UJ0A 4JRIA 2KT8A 4C8QB 1YN8A 2D0NA 4TVRA 3OMCA 1WZOA 1VQLT 4IIMA 1OZ2A 3NHNA 2SRCA 4KGZB 4KRTA 3V7CA 2DVEA 3H6ZA 1M1KU 4KBMB 1HXDA 2J6FA 2ED0A 5HCKA 1NEGA 1GCPA 2GFUA 3VS0A 1IHWA 5A2QE 4Y92A 2EAYA 2VXEA 2MWPA 2GQIA 2DZ9A 1WJQA 1ABQA 2KYMA 2F2XA 2NUPA 4E7HA 4BD3A 3SDZA 1WIEA 2EKOA 3VRYA 2LT4A 4PNOA 1ZA1B 4OB2B 1LVKA 3QG1A 3EG0A 5GAN2 3G6EQ 1VQ4A 5D6YA 2E1HA 3L1AA 3WXMB 2CZ0B 2RJCA 3SD4A 1YI2Q 2R5MA 2JTFA 1H3ZA 3C95A 2GNCA 1X2KA 4JZ3A 3SB2A 2RK1A 2CUBA 1ZA2B 4RTYA 4C0ZA 2JUFA 3G6ET 5DM7R 1N5ZA 1N8RR 1PCXA 4XTUA 4BI3A 1Y96A 4ORZA 4ZN3A 1YI2T 2X51A 3FDRA 2JT4A 1JJ2S 4Z02A 3X20B 4DBRA 4C8QD 4OF1A 4M4ZA 1WXUA 3VRZA 4ANJA 3Q1JA 1U1SA 2L3PA 1G5VA 3M53A 1TSFA 1G3TA 4FSSA 3PMTA 3BDLA 1WHGA 3FRNA 4F14A 2FRWA 4A4GA 2KY9A 1VQ5A 4JDSA 1ZBJA 5LJ3h 5GMKl 4E7IA 5KH6A 1Q86R 3M55A 3HHTB 1NZ9A 1WYXA 4KGXB 1LJOA 2WSFE 5I11A 1UEBA 2C0OA 2KE9A 2KI7A 2HDAA 5GANg 1K4US 3QJYA 2ZPGB 4RTVA 1U06A 2QXFA 1CKBA 3EFOA 1PKSA 5IHKA 2LDMA 4ZTJA 1R0BG 5I2MA 3HRSA 3M57A 2HSPA 4N4HA 2A36A 4QVZA 1Y07A 4KH0B 2ZPBB 2FHDA 1MUZA 3V7SA 2EGCA 4NOYA 3TCJA 3EG2A 4F7UE 3HFNA 4FYYB 3JCMW 5LJ5e 4FL6A 2F2WA 4J9HA 1PD0A 3HKSA 3NGPA 1I8FA 2EYZA 5KYXA 4PFPA 1VQ6A 4PJOE 3N5BB 4E7ZA 3WVEB 2CT4A 2PTKA 2ESWA 3H0IA 1JO8A 1QVFA 2HEQA 3OYJA 4XQ3A 2C06A 3CMAA 1M2VA 4CI0C 4D8DA 5L8RE 4DEYA 2A0FB 2COZA 5IN1A 2DFUA 4N4IA 5I22A 3CC7A 3FB9A 4HCKA 3BDUA 2BKDN 3RESA 4IUVA 3S3NA 1EIFA 1N6AA 2PUOB 1VQMQ 2DM1A 5GAMe 1SRLA 4JS4A 3E19A 4JJDA 3HL8A 3KUFA 3QO3A 2RM4A 4PJJA 3D7SB 4C92A 1Q86C 3M59A 1VQMT 3I55Q 2DRKA 2LNVA 2RI3A 1G3WA 1Q7YC 1KD1R 3HTRA 2ZCFB 2PUKB 1D1BA 3OS5A 1BI0A 2W0ZA 4GLKA 1KQSA 5GAMj 3RNJA 4DA4A 4IUTA 3I55T 4FYXB 4L59A 1K73R 1EFNA 3OSSC 2RQWA 3CCSA 1VQOA 2VB6A 1D1AA 3C4SA 4RTTA 3LH0A 3LX7A 3HRUA 2D8HA 1UUEA 3UA7A 1PG5B 2DBKA 5J26A 5CR2A 1QWEA 4F7UG 1KQ1A 2OTLQ 2HBPA 1NEBA 3CXCP 2XI9A 4PJLA 3V8KA 2DL3A 5A0GA 2RHYA 4HKEA 2DILA 1PSFA 3CD6Q 1AZEA 3MEUA 2GQVA 4J9FA 2DXBA 2GF7A 4L5GA 5LJ3f 2HZYA 2DEQA 3JV3A 1WXTA 4J6YA 1ZQ1A 1WXBA 1AOJA 4LDUA 1KC8R 2M16A 1M1KR 1MV3A 1D1CA 3EFSA 3AT1B 5C6SA 2FVUA 1RAAB 3PNWC 1R0CB 4C5IA 3G7ZA 2KBTA 1YP5A 1YJ9A 2O4XB 2E65A 1MMDA 2KXDA 3M0QA 1V76A 1JXOA 2YDLA 1YHQA 2CSQA 3LLRA 3OYAA 5IXBA 3X24B 1OX9A 1NLOC 5I2SA 1QCNA 2DTIA 1IREB 1YJNA 1QMCA 2QQ9A 4FYWB 3CMEA 4JUVA 3EGDA 5HY6A 3R6OA 4OMOA 1ZSGA 3M4YA 4N4GA 2D6FA 4P5NA 1MNEA 2VVKA 1VQKQ 1RUWA 2XKOC 3JCMe 1ZHIA 4XTWA 2EGEA 2G6FX 2CP7A 1W70A 2M1HA 1YJWA 3CCEQ 4F7UB 6AT1B 2KROA 5LJ5g 5GAOq 2YT6A 2FB7A 2D9TA 1D0XA 2EFIA 3RERA 4PJOB 4QQDA 3VYGA 4OMNA 3NTIA 4XTXA 1RACB 4J7FA 2JTEA 3JB9I 3M0UA 4E6RA 1YFNA 2YXYA 3NMZC 2DL4A 1P92A 1KFZA 3EG1A 2ABLA 4M75C 4EMGA 3OS2A 1H641 5IHIA 2RN8A 2W10A 4RUGA 2L3SA 2CYZB 3REBB 3IQLA 2ED1A 4HCZA 2CT3A 1M3CA 3CEYA 5GAMg 2IG0A 2AZVA 3SFMA 3OQ5A 4PJOF 3CPWP 4X34A 3DKMA 2V1RA 2H8HA 3PVQA 2RQUA 4J6XA 4FCYA 2M0YA 2QA4Q 1Q81U 2DPPB 3MPUB 3L2WA 2ZPHB 2VC8A 3OB9A 2CP5A 3EH2A 3TEEA 1G3YA 3EHRA 1YIJQ 4DBFA 4JJCA 1IGQA 3L2QA 2LP5A 4RTZA 3X26B 1NYFA 3G4SA 3OYIA 1NPPA 5GMKh 4C92E 3G1JA 2E6ZA 2D1XA 4ZGJB 5KCHA 4PJOD 1WQWA 1YIJT 4M75A 3MP6A 3A8OB 3UATA 1VQ7Q 1PWTA 2J6KA 2K7AA 4M78C 4C0DB 3PT9A 3VS3A 1IB8A 5GAOm 1QCOA 2NUPB 2XU8A 4NL2A 4QQGA 3SWNC 2X4JA 3OW2S 1AHJB 1YITQ 3MO8A 3JB9G 1U1TA 1VQ7T 1V1CA 4DBHA 2O9SA 1WHJA 4Y28E 2QGFB 1M90C 2YWWA 4EMKC 4A54A 1G8XA 2EBPA 1W4SA 2RMOA 1CSKA 1O75A 4JLGA 3SEMA 1PSEA 3J7AF 1FWZA 1NBEB 2E64A 3T9NA 4QKUA 2V26A 1TUCA 2DZCA 1Y96B 3LW5E 4IKFA 1K9MU 1UGSB 2LCLA 1WX6A 4RKUE 1C6VX 5FU6B 3FJPA 2K3BA 3EGXA 3LYIA 4M78A 4LDYA 3TVTA 4ELZC 1U8RA 3CPFA 3MEWA 3SWNA 1NG2A 5GAOp 1RLPC 5CKFA 4M7DF 2C0IA 2K5IA 4BUGA 2RK2A 1MGQA 2J6OA 4F16A 2Y4XA 3J80E 1W2BS 5HK3A 2QQAA 2QDLA 2QGGA 1JJ2A 5DLQE 3GOXA 1B7TA 3NPFA 3QHSA 3L2RA 3RR6A 4EMKA 1JU5C 1AWXA 5IH2A 4M77C 2DK3A 4ZNXA 4HVUA 3GIBA 1QWFA 1QP3A 1WJRA 2AKLA 3V8LA 4MMLA 5FWBA 3JCMg 2P4TA 3CCJQ 2QQSA 4C92G 1ZUUA 2AK5A 2EQIA 3MEVA 4LD9K 4MZTA 3CBOA 3L2ZA 1PC0A 1TTHB 3UDCA 1ZBXA 1MNDA 1VQLQ 3CCQQ 1BI2A 1RAHB 1WHMA 1JXMA 3EGUA 3VUZA 3CCMA 3JCMJ 1KHCA 1WA7A 3BW1A 1OULA 4WF2A 1D0ZA 1JBMA 3CCJT 3CCUQ 2KQWA 2VXFA 1OYXA 5LJ3d 4J9CA 2COYA 4XU1A 4PLLA 1VUBA 3OYBA 4DBQA 1K76A 2VYTA 4BI4A 2FRYA 3QPHA 3OYEA 3CCQT 3VS1A 2DIQA 3TSWA 2DRMA 3MJXA 2EGAA 3CCUT 2EQJA 2EIFA 2QASA 5J39A 4M7DC 3RUXA 3CCVA 2DNUA 1XJWB 1WDXA 4M77A 5GMKm 1M2VB 2DD4A 2RHIA 3CC7Q 4AMCA 5L23A 2VUBA 2EYYA 2LQKA 1IO6A 1GRIA 1QVGP 5GANf 1M27C 2JS0A 4B6MA 4HT9A 3QZ9B 3I56Q 3HFOA 3NFCA 4C8QF 3OS1A 2OAUA 4PLIA 3CCRA 3GPLA 2MPXC 2DEUA 2I0NA 3CC7T 1PHTA 1PRMC 3EH1A 1AEYA 2YLCA 4AFQC 3E9GA 1O9SA 2LX9A 3QDRB 2NUTA 4O5VA 3I56T 1UTIA 3C12A 1E6GA 4C92B 2CZ7B 5DY9A 2PVGB 2LTOA 3C0CA 1FX7A 2KYBA 1BCMA 2FPEA 1VOMA 3CC4A 1X2QA 1S72A 4E2FB 3EG9A 1TH7A 1NJIC 4JLIA 3O8VA 3FC3A 4Z89A 3OYGA 3ZEHA 2HKNA 2NUZA 5FU7C 2X4WA 4M75E 3OYLA 2JJ9A 1K8AU 3LGLA 1RABB 1Q82U 2OX7A 1UGRB 4A63B 5FRNA 4HA8A 3ZBDA 1WPYA 4C92F 2JVVA 4PJNA 1X01A 2LCSA 1I0CA 4NL3A 1M90U 4A4KA 3BFMA 2QK0A 4C8QC 2LVMA 2JMCA 3CCST 1VQOT 1I4K1 1ZSZB 4F04B 1Q81R 2O88A 1PNJA 1D3BB 2L5QA 4DEXA 3QBYA 2VKNA 3JB9J 3M56A 3JCMc 1GBQA 2BE9B 5KYUA 3OYDA 1C0MA 2QEXQ 3QWYA 2M0OA 2E3HA 4JPBW 1OPLA 3QUIA 4PL6A 4C92D 1C1AA 2VWFA 4GLMA 2LC4A 4R55A 1S1NA 2FPDA 2FO0A 4HVWA 3OYFA 1SF9A
chains in the Genus database with same CATH topology
3JV3A 1WXTA 2LX7A 1WXBA 1AOJA 1A0NB 5IHNA 4AFSC 4OMQA 1KJWA 2LJ3A 1FYNA 1SHGA 1PRLC 2LQNA 1MV3A 2FG0A 4HVVA 1LCKA 2YSQA 3R6NA 1G83A 2KBTA 1YP5A 1SPKA 1MV0B 3U23A 2J05A 1GL5A 2BTTA 2KXDA 1K1ZA 3M0QA 2KRSA 2MOXA 2X3XD 1JXOA 4LUDA 2ROTA 2YDLA 1ABOA 2CSQA 3VS7A 2LZ6B 1AZGB 2CH4W 5IXBA 4Z88A 1NLOC 1QKXA 4J9IA 2CDTA 3LH5A 2X3WD 4WCIA 2K79A 1X6BA 4OMOA 3M0TA 2BZXA 1ZSGA 4JZ4A 1ZUKA 4AG2C 2DF6A 2VVKA 3I35A 3I5SA 4CC3A 1RUWA 2LQWA 2EKHA 2DYBA 2EGEA 2G6FX 1W70A 2B86A 4J9BA 1SHFA 1E6HA 1T3LA 2ENMA 1BBZA 2KROA 3UA6A 2RNAA 2YT6A 1Z9ZA 1K0SA 3EHQA 1UECA 2GGRA 2JM8A 1PKTA 2O2OA 3H41A 1ZLMA 2EPDA 4OMNA 2NWMA 1X43A 1YWOA 2IIMA 2JTEA 3H0HA 5EC7A 4ESRA 3M0UA 4E6RA 1T3SA 3PE0A 3NMZC 2DL4A 1KFZA 1JEGA 3EG1A 2ABLA 4J9DA 1NYGA 2JMAA 2DLPA 4LN2A 5IHIA 2RN8A 4K11A 2W10A 4LNPA 4RUGA 2L3SA 2BZ8A 1JQQA 1ZX6A 3EG3A 4QT7A 3IQLA 4OMMA 3REBB 1BB9A 2ED1A 2DE0X 1M8MA 3TSZA 1VYUA 2CT3A 2JS2A 1M3CA 2GTOA 2AZVA 1HD3A 1AD5A 1SRMA 2ECZA 2YUQA 4OMLA 3M0PA 2DL8A 2V1RA 1OOTA 2H8HA 3PVQA 2YUNA 5GJWB 2RPNA 2RQUA 3ULRB 2J06A 1K9AA 1VA7A 2C0TA 2M0YA 2V1QA 2CREA 1GFDA 2O31A 1GFCA 2DL5A 3SHWA 4CC2A 2JW4A 2KR3A 1KIKA 3EHRA 2BZYA 2OAWA 4JJCA 4EIKA 4IIOA 1UHFA 1I07A 3KFVA 1SSHA 2LP5A 4RTZA 3H0FA 1AWJA 1M3AA 2KXCA 1NYFA 2KEAA 4OMPA 2L0AA 1ARKA 1UGVA 2CSIA 2RQTA 1UFFA 2J7IA 1OV3A 1UJ0A 2DMOA 2L3QA 2OJ2A 4CC4B 1AWWA 2D1XA 2CUDA 3CQTA 1Y0MA 2KT8A 1YN8A 2D0NA 1Y57A 2F2VA 3UATA 4IIMA 1PWTA 2J6KA 2K7AA 3NHNA 2SRCA 4KRTA 1GBRA 3VS3A 4D8KA 4Z8AA 2J6FA 2ED0A 5HCKA 3FJ5A 1NEGA 1GCPA 1K0XA 3VS0A 4Y92A 2GQIA 2KYMA 1ABQA 4LUEA 1BU1A 2F2XA 1WIEA 1X6GA 1V1CA 3VRYA 2O9SA 1Z9QA 1WLPB 5ECAA 2JM9A 3THKA 1CKAA 2LJ1A 1UG1A 3EG0A 2EBPA 2DVJA 2RMOA 1CSKA 3SEMA 4CC7A 1W6XA 1QLYA 1TUCA 2GNCA 1X2KA 4JZ3A 4RTXA 2CUBA 4RTYA 2K6DA 3VS5A 1WX6A 1N5ZA 2KT1A 4ORZA 2K3BA 3TVTA 2JT4A 1U5SA 2MIOA 2PNIA 1WFWA 3VS4A 2YUPA 4M4ZA 4LE9A 1WXUA 2K2MA 3VRZA 1NG2A 1U3OA 1QCFA 1NLPC 2L3PA 5FWCA 3M0RA 1RLPC 1X69A 3M0SA 2OI3A 2C0IA 2J6OA 4FSSA 4F16A 1BK2A 2EVRA 4F14A 2QDLA 2FRWA 1T0JA 4RTWA 5FW9A 3NPFA 1GCQC 1JU5C 1AWXA 1ZBJA 5IH2A 1VYVA 1YNZA 2AZSA 4AG1C 4ZNXA 4HVUA 1QWFA 2LJ0A 2AKLA 1TUDA 4R0KA 1YWPA 5FWBA 1WYXA 3O5ZA 1QKWA 1ZUUA 2AK5A 5I11A 2EQIA 2C0OA 2O9VA 2KRMA 3VS2A 2KE9A 2RQRA 1B07A 2HDAA 1K4US 4RTVA 2RQVA 2LMJA 1U06A 1M3BA 1CKBA 1UE9A 1PKSA 5IHKA 3EGUA 1JXMA 1VYTA 1WA7A 2HBWA 2FPFA 2HSPA 2PZ1A 4GBQA 2A36A 3I5RA 4J9CA 5IXFA 1RI9A 1FMKA 1K76A 1MUZA 2EW3A 2FRYA 4X1VA 2A37A 2EGCA 3EG2A 4JJBA 3VS1A 2HCKA 3TSWA 2DRMA 2F2WA 1KSWA 2EGAA 1E7OA 4J9GA 4J9HA 3A98A 2GTJA 2M51A 3NGPA 2DJQA 2EYZA 2DNUA 1GCQA 1X27A 1UHCA 1WDXA 2FEIA 2CH4A 2CT4A 2PTKA 4RTUA 2ESWA 3H0IA 1JO8A 2MCNA 5L23A 2HEQA 2EYYA 1IO6A 1GRIA 4F17A 1M27C 2JS0A 1AVZC 3UF4A 4D8DA 2A08A 2AKKA 4DEYA 2XMFA 2ROLA 5I22A 1TG0A 2GBQA 4HCKA 2I0NA 3VS6A 4AFUC 1PHTA 1PRMC 3GBQA 2E5KA 1AEYA 1W1FA 1AWOA 4AFQC 3RBBB 1OPKA 2DM1A 2P4RA 1UDLA 1SRLA 2RF0A 1UTIA 1J3TA 4JJDA 1E6GA 2SEMA 1YCSB 2K9GA 3C0CA 2KYBA 1WI7A 2DL7A 2FPEA 1X2QA 2LNHB 1T0HA 3PVLA 3QWXX 2EYWA 2KRNA 2DRKA 4AFZC 1XOVA 2JXBA 4Z89A 2YUOA 2NUZA 2W0ZA 1SEMA 2DA9A 2DX1A 1OEBA 1UJYA 1H92A 4A63B 1HSQA 1ZUYA 3RNJA 2KNBB 2A28A 3REAB 2LCSA 1EFNA 1I1JA 2DBMA 1I0CA 4J9EA 2RQWA 5GJVB 2JMCA 4RTTA 1NM7A 2O88A 1G2BA 1PNJA 1HJDA 4DEXA 2VKNA 2D8HA 1UUEA 3UA7A 2DBKA 2L2PA 2KGTA 2EYXA 1QWEA 1M30A 1RLQC 3ZL7C 1GBQA 1NEBA 1H3HA 3QWYA 4JPBW 1OPLA 2DL3A 4HXJA 2DILA 2D8JA 2VWFA 1AZEA 4GLMA 1S1NA 1H8KA 2FPDA 2FO0A 3I9QA 4HVWA 4J9FA 1B3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JV3 A;  1WXT A;  2LX7 A;  1WXB A;  1AOJ A;  1A0N B;  5IHN A;  4AFS C;  4OMQ A;  1KJW A;  2LJ3 A;  1FYN A;  1SHG A;  1PRL C;  2LQN A;  1MV3 A;  2FG0 A;  4HVV A;  1LCK A;  2YSQ A;  3R6N A;  1G83 A;  2KBT A;  1YP5 A;  1SPK A;  1MV0 B;  3U23 A;  2J05 A;  1GL5 A;  2BTT A;  2KXD A;  1K1Z A;  3M0Q A;  2KRS A;  2MOX A;  2X3X D;  1JXO A;  4LUD A;  2ROT A;  2YDL A;  1ABO A;  2CSQ A;  3VS7 A;  2LZ6 B;  1AZG B;  2CH4 W;  5IXB A;  4Z88 A;  1NLO C;  1QKX A;  4J9I A;  2CDT A;  3LH5 A;  2X3W D;  4WCI A;  2K79 A;  1X6B A;  4OMO A;  3M0T A;  2BZX A;  1ZSG A;  4JZ4 A;  1ZUK A;  4AG2 C;  2DF6 A;  2VVK A;  3I35 A;  3I5S A;  4CC3 A;  1RUW A;  2LQW A;  2EKH A;  2DYB A;  2EGE A;  2G6F X;  1W70 A;  2B86 A;  4J9B A;  1SHF A;  1E6H A;  1T3L A;  2ENM A;  1BBZ A;  2KRO A;  3UA6 A;  2RNA A;  2YT6 A;  1Z9Z A;  1K0S A;  3EHQ A;  1UEC A;  2GGR A;  2JM8 A;  1PKT A;  2O2O A;  3H41 A;  1ZLM A;  2EPD A;  4OMN A;  2NWM A;  1X43 A;  1YWO A;  2IIM A;  2JTE A;  3H0H A;  5EC7 A;  4ESR A;  3M0U A;  4E6R A;  1T3S A;  3PE0 A;  3NMZ C;  2DL4 A;  1KFZ A;  1JEG A;  3EG1 A;  2ABL A;  4J9D A;  1NYG A;  2JMA A;  2DLP A;  4LN2 A;  5IHI A;  2RN8 A;  4K11 A;  2W10 A;  4LNP A;  4RUG A;  2L3S A;  2BZ8 A;  1JQQ A;  1ZX6 A;  3EG3 A;  4QT7 A;  3IQL A;  4OMM A;  3REB B;  1BB9 A;  2ED1 A;  2DE0 X;  1M8M A;  3TSZ A;  1VYU A;  2CT3 A;  2JS2 A;  1M3C A;  2GTO A;  2AZV A;  1HD3 A;  1AD5 A;  1SRM A;  2ECZ A;  2YUQ A;  4OML A;  3M0P A;  2DL8 A;  2V1R A;  1OOT A;  2H8H A;  3PVQ A;  2YUN A;  5GJW B;  2RPN A;  2RQU A;  3ULR B;  2J06 A;  1K9A A;  1VA7 A;  2C0T A;  2M0Y A;  2V1Q A;  2CRE A;  1GFD A;  2O31 A;  1GFC A;  2DL5 A;  3SHW A;  4CC2 A;  2JW4 A;  2KR3 A;  1KIK A;  3EHR A;  2BZY A;  2OAW A;  4JJC A;  4EIK A;  4IIO A;  1UHF A;  1I07 A;  3KFV A;  1SSH A;  2LP5 A;  4RTZ A;  3H0F A;  1AWJ A;  1M3A A;  2KXC A;  1NYF A;  2KEA A;  4OMP A;  2L0A A;  1ARK A;  1UGV A;  2CSI A;  2RQT A;  1UFF A;  2J7I A;  1OV3 A;  1UJ0 A;  2DMO A;  2L3Q A;  2OJ2 A;  4CC4 B;  1AWW A;  2D1X A;  2CUD A;  3CQT A;  1Y0M A;  2KT8 A;  1YN8 A;  2D0N A;  1Y57 A;  2F2V A;  3UAT A;  4IIM A;  1PWT A;  2J6K A;  2K7A A;  3NHN A;  2SRC A;  4KRT A;  1GBR A;  3VS3 A;  4D8K A;  4Z8A A;  2J6F A;  2ED0 A;  5HCK A;  3FJ5 A;  1NEG A;  1GCP A;  1K0X A;  3VS0 A;  4Y92 A;  2GQI A;  2KYM A;  1ABQ A;  4LUE A;  1BU1 A;  2F2X A;  1WIE A;  1X6G A;  1V1C A;  3VRY A;  2O9S A;  1Z9Q A;  1WLP B;  5ECA A;  2JM9 A;  3THK A;  1CKA A;  2LJ1 A;  1UG1 A;  3EG0 A;  2EBP A;  2DVJ A;  2RMO A;  1CSK A;  3SEM A;  4CC7 A;  1W6X A;  1QLY A;  1TUC A;  2GNC A;  1X2K A;  4JZ3 A;  4RTX A;  2CUB A;  4RTY A;  2K6D A;  3VS5 A;  1WX6 A;  1N5Z A;  2KT1 A;  4ORZ A;  2K3B A;  3TVT A;  2JT4 A;  1U5S A;  2MIO A;  2PNI A;  1WFW A;  3VS4 A;  2YUP A;  4M4Z A;  4LE9 A;  1WXU A;  2K2M A;  3VRZ A;  1NG2 A;  1U3O A;  1QCF A;  1NLP C;  2L3P A;  5FWC A;  3M0R A;  1RLP C;  1X69 A;  3M0S A;  2OI3 A;  2C0I A;  2J6O A;  4FSS A;  4F16 A;  1BK2 A;  2EVR A;  4F14 A;  2QDL A;  2FRW A;  1T0J A;  4RTW A;  5FW9 A;  3NPF A;  1GCQ C;  1JU5 C;  1AWX A;  1ZBJ A;  5IH2 A;  1VYV A;  1YNZ A;  2AZS A;  4AG1 C;  4ZNX A;  4HVU A;  1QWF A;  2LJ0 A;  2AKL A;  1TUD A;  4R0K A;  1YWP A;  5FWB A;  1WYX A;  3O5Z A;  1QKW A;  1ZUU A;  2AK5 A;  5I11 A;  2EQI A;  2C0O A;  2O9V A;  2KRM A;  3VS2 A;  2KE9 A;  2RQR A;  1B07 A;  2HDA A;  1K4U S;  4RTV A;  2RQV A;  2LMJ A;  1U06 A;  1M3B A;  1CKB A;  1UE9 A;  1PKS A;  5IHK A;  3EGU A;  1JXM A;  1VYT A;  1WA7 A;  2HBW A;  2FPF A;  2HSP A;  2PZ1 A;  4GBQ A;  2A36 A;  3I5R A;  4J9C A;  5IXF A;  1RI9 A;  1FMK A;  1K76 A;  1MUZ A;  2EW3 A;  2FRY A;  4X1V A;  2A37 A;  2EGC A;  3EG2 A;  4JJB A;  3VS1 A;  2HCK A;  3TSW A;  2DRM A;  2F2W A;  1KSW A;  2EGA A;  1E7O A;  4J9G A;  4J9H A;  3A98 A;  2GTJ A;  2M51 A;  3NGP A;  2DJQ A;  2EYZ A;  2DNU A;  1GCQ A;  1X27 A;  1UHC A;  1WDX A;  2FEI A;  2CH4 A;  2CT4 A;  2PTK A;  4RTU A;  2ESW A;  3H0I A;  1JO8 A;  2MCN A;  5L23 A;  2HEQ A;  2EYY A;  1IO6 A;  1GRI A;  4F17 A;  1M27 C;  2JS0 A;  1AVZ C;  3UF4 A;  4D8D A;  2A08 A;  2AKK A;  4DEY A;  2XMF A;  2ROL A;  5I22 A;  1TG0 A;  2GBQ A;  4HCK A;  2I0N A;  3VS6 A;  4AFU C;  1PHT A;  1PRM C;  3GBQ A;  2E5K A;  1AEY A;  1W1F A;  1AWO A;  4AFQ C;  3RBB B;  1OPK A;  2DM1 A;  2P4R A;  1UDL A;  1SRL A;  2RF0 A;  1UTI A;  1J3T A;  4JJD A;  1E6G A;  2SEM A;  1YCS B;  2K9G A;  3C0C A;  2KYB A;  1WI7 A;  2DL7 A;  2FPE A;  1X2Q A;  2LNH B;  1T0H A;  3PVL A;  3QWX X;  2EYW A;  2KRN A;  2DRK A;  4AFZ C;  1XOV A;  2JXB A;  4Z89 A;  2YUO A;  2NUZ A;  2W0Z A;  1SEM A;  2DA9 A;  2DX1 A;  1OEB A;  1UJY A;  1H92 A;  4A63 B;  1HSQ A;  1ZUY A;  3RNJ A;  2KNB B;  2A28 A;  3REA B;  2LCS A;  1EFN A;  1I1J A;  2DBM A;  1I0C A;  4J9E A;  2RQW A;  5GJV B;  2JMC A;  4RTT A;  1NM7 A;  2O88 A;  1G2B A;  1PNJ A;  1HJD A;  4DEX A;  2VKN A;  2D8H A;  1UUE A;  3UA7 A;  2DBK A;  2L2P A;  2KGT A;  2EYX A;  1QWE A;  1M30 A;  1RLQ C;  3ZL7 C;  1GBQ A;  1NEB A;  1H3H A;  3QWY A;  4JPB W;  1OPL A;  2DL3 A;  4HXJ A;  2DIL A;  2D8J A;  2VWF A;  1AZE A;  4GLM A;  1S1N A;  1H8K A;  2FPD A;  2FO0 A;  3I9Q A;  4HVW A;  4J9F A;  1B3Q A; 
#chains in the Genus database with same CATH topology
 1YBY A;  3PIO A;  3MCA B;  1WGS A;  4J83 A;  4C0G A;  2QEX T;  2F5K A;  1YJ9 Q;  3VUB A;  1N9S A;  5IHN A;  3JCM V;  2LJ3 A;  2FG0 A;  3CCL Q;  3A8G B;  4QVC A;  4BY6 B;  4L6V 5;  1SPK A;  1MHN A;  1N8R C;  3OBY A;  1Q95 G;  2BTT A;  3PIP A;  1YJ9 T;  4LUD A;  3X28 B;  2YHT A;  2RJD A;  3A8M B;  3EGD B;  4E47 A;  2CS7 A;  4IUQ A;  3L2V A;  2CDT A;  3CCL T;  5D6W A;  1YJW Q;  4M7A E;  1X6B A;  5LJ5 j;  3CME T;  3M54 A;  3M0T A;  3JCM P;  2JNG A;  4JZ4 A;  2RH2 A;  2LQ8 A;  1K9M R;  3I5S A;  3CXC S;  1HK9 A;  4M75 G;  2DYB A;  3A5Z B;  4JRQ A;  2B86 A;  2XD0 A;  1YJW T;  3GNF B;  2KVQ G;  1Z9Z A;  3WVD B;  3EHQ A;  3G6E A;  2E6N A;  2GGR A;  2O2O A;  2XK0 A;  1ZLM A;  2QDY B;  3H41 A;  2A7Y A;  1YI2 A;  2EPD A;  1M8V A;  2NWM A;  1X43 A;  1YWO A;  2DD5 A;  5FRM A;  1OX8 A;  3H0H A;  5EC7 A;  3M58 A;  3QJ6 A;  3PE0 A;  1EZZ B;  5M9O A;  4C5H A;  4J9D A;  4DOV A;  2JMA A;  4M77 E;  2DLP A;  4LN2 A;  1M2O A;  2MK5 A;  4K11 A;  2XG8 D;  1TU0 B;  1JQQ A;  5GAN 7;  4QT7 A;  4OMM A;  2GFA A;  2DE0 X;  1VYU A;  2JS2 A;  5CKB A;  2D0Q B;  4A53 A;  3RKY A;  1AD5 A;  4OML A;  2K4Y A;  5CO7 A;  2QYZ A;  2YUN A;  5GJW B;  2J06 A;  1VA7 A;  2EJG A;  2E41 A;  3JCM h;  2CRE A;  1GFD A;  4EPC A;  3S3O A;  3SHW A;  2RA2 A;  2CP2 A;  3GNG A;  4N0A C;  2BZY A;  2AIR B;  1M4Z A;  2E3I A;  2OAW A;  3FIF A;  2Y4Y A;  4ATO A;  3KFV A;  3EAE A;  1I5O B;  3H0F A;  2RI5 A;  2L0A A;  4M75 B;  5KE3 A;  1ARK A;  1R77 A;  3G4S T;  1UFF A;  2J7I A;  1WHH A;  4A4E A;  2DMO A;  4RMO A;  4CC4 B;  3CQT A;  2HQX A;  1Y0M A;  4XAX B;  2H3E B;  4FW2 A;  2B8A A;  4A4H A;  4M7A G;  2QQB A;  2GCX A;  5GAM f;  4ELY C;  3E1S A;  2L89 A;  2DXU A;  2CP0 A;  4JRP A;  5GAN d;  2V8J A;  5CCA A;  2FZC B;  1FMV A;  3VV0 A;  4JS5 A;  2QG9 B;  5LL6 S;  1DJ7 B;  1PM3 A;  1NE8 A;  1KD1 C;  3HP9 A;  1Z9Q A;  1WLP B;  5ECA A;  1CKA A;  2LJ1 A;  1UG1 A;  3CPW S;  2DVJ A;  4N0A A;  3GF5 A;  1M5Q 1;  1K73 C;  2XID A;  5A0D A;  3OSV A;  3OW2 A;  4XTY A;  2F5T X;  1HYO A;  4MZP A;  3OYM A;  1YCY A;  4J5Y A;  3EGX B;  1VQP Q;  4A4F A;  4M77 G;  5CIU A;  2KT1 A;  2CZ6 B;  1QVF P;  3L42 A;  1B34 B;  3SWN B;  4M75 D;  1M1G A;  1VQM A;  1K8A R;  1AT1 B;  1U5S A;  3A1P A;  1Q82 R;  4J6W A;  4O6J A;  2PNI A;  1WFW A;  1VQP T;  2YUP A;  1EX4 A;  2RHZ A;  4FYV B;  3X25 B;  1NLP C;  5FWC A;  4RCC A;  2YLB A;  3M0S A;  2OI3 A;  4EMK B;  2HQH A;  4YTL A;  9ATC B;  2PU9 B;  1IHV A;  3DLM A;  4F7U F;  1VQ9 A;  2EVR A;  4RTW A;  4M7A B;  3I55 A;  1I5L A;  1VYV A;  1YNZ A;  3G71 Q;  1KC8 C;  1M1K C;  1VQN A;  3P8B B;  3P8D A;  2LJ0 A;  3RMS A;  2DXC A;  1TUD A;  1QVP A;  2FL7 A;  3CBM A;  4BDZ A;  1YWP A;  1VQ8 Q;  1KK7 A;  1QKW A;  2QAZ A;  3JCM Q;  1W2B A;  1F1B B;  4RG2 A;  3ZFJ A;  2O9V A;  2RB6 A;  2KRM A;  4OB0 B;  2RQR A;  3DB3 A;  2Y90 A;  3M4G A;  3OS0 A;  1LPL A;  2AT1 B;  5GAN h;  3PGG A;  4VUB A;  4MZM A;  1Q86 U;  3G71 T;  2MWO A;  3ASK A;  4KUL A;  4AT1 B;  1VYT A;  1MMG A;  2HBW A;  2PZ1 A;  2IVW A;  1WQ7 A;  1VQ8 T;  1Q7Y U;  1KQS P;  2HKQ B;  3I5R A;  4M7A F;  1RI9 A;  4E7J A;  3C94 A;  1BCO A;  1FMK A;  5KYY A;  4X1V A;  2VGM A;  2A37 A;  2WSE E;  4ZGE B;  2RHU A;  2ZPE B;  4JJB A;  2HSE B;  2OTL A;  1OZ3 A;  2HCK A;  3HRT A;  1OQK A;  4M77 B;  4QW2 A;  1E7O A;  2M51 A;  4X9D A;  2DYI A;  4OB3 B;  3QXE B;  3CD6 A;  3JCM f;  1VQ4 Q;  2CH4 A;  2ATC B;  2MCN A;  5D7U A;  4F17 A;  4FIB A;  3V7R A;  3UF4 A;  2KDS A;  4PJO C;  3LWH A;  4M7A D;  1M1F A;  2HNI A;  2A08 A;  3J81 E;  2XMF A;  4E7S A;  2OTJ A;  2ZPI B;  1VQ4 T;  1TG0 A;  2GBQ A;  2O4X A;  2P0K A;  2NUT B;  3CCR T;  3TU4 K;  2E5K A;  2L3R A;  3GP8 A;  2P4R A;  1UDL A;  3MP1 A;  3RIR A;  2RF0 A;  1J3T A;  1TUG B;  2EWN A;  4ZGD B;  2SEM A;  2K9G A;  3UT1 A;  2BIV A;  3JRZ A;  3CC4 T;  2LNH B;  2K3Y A;  3QWX X;  2RJF A;  2HD0 A;  2KRN A;  1VQ5 Q;  4FM4 B;  2K5L A;  1VQK A;  2XHC A;  4MDW A;  5GMK e;  4M77 D;  4BE0 A;  1SEM A;  3CCE A;  3ER0 A;  1UJY A;  1H92 A;  4PJO A;  1HSQ A;  2E12 A;  8AT1 B;  1VQ5 T;  2F1L A;  5GAN 4;  1RAF B;  3KBG A;  3L2U A;  4RG8 A;  5CKE A;  1I1J A;  1QVG S;  3FLG A;  3PTA A;  3EFO B;  3NTK A;  4XU2 A;  2RD1 A;  1HJD A;  5KYU B;  1K73 U;  4C0D C;  2RI2 A;  4XU0 A;  2E4H A;  2YRV A;  1M30 A;  1UB4 A;  5GMK j;  5HKC A;  4XK8 E;  5FU7 B;  1VQ6 Q;  3QDF A;  4HXJ A;  5IT9 E;  4LD6 A;  3MET A;  3VJP A;  2D8J A;  5CQY A;  3UWN A;  3NTH A;  5KYX B;  2P0Q A;  2YRD A;  2PQW A;  4D6W A;  1FXX A;  3OBW A;  2QA4 A;  5AYF A;  3CMA Q;  2XIC A;  2MI6 A;  3JB9 F;  4MDX A;  2WAC A;  4OMQ A;  5GAM d;  1VQ6 T;  1KJW A;  1FYN A;  1YIJ A;  1BI1 A;  1ACM B;  2HL5 C;  3F70 A;  4HVV A;  1LCK A;  2QI2 A;  5KE2 A;  3R6N A;  1G83 A;  1MV0 B;  5FRO A;  2J05 A;  1RAD B;  3CMA T;  2VAS A;  2Z0W A;  1RAI B;  2KRS A;  1KC8 U;  2X3X D;  4LDV A;  1W2B P;  5AT1 B;  5FU6 C;  2CH4 W;  5EG2 A;  1GXI E;  1QW1 A;  1QKX A;  4J9I A;  1VQ7 A;  3LH5 A;  3PMI A;  2G3R A;  2K79 A;  3JCM b;  3JB9 D;  2WSC E;  2EQK A;  4QVD A;  1RI0 A;  1TS9 A;  2LQW A;  4NS5 A;  2EKH A;  1YIT A;  3CC2 A;  4BDY A;  3S6W A;  4B9W A;  1SHF A;  2DTH A;  1BYM A;  2ENM A;  1BBZ A;  3UA6 A;  2DAQ A;  4PKC C;  5LJ5 h;  4M7D A;  3VYH B;  4V2S A;  2JM8 A;  1N27 A;  3CXC A;  2PVD B;  3CCS Q;  1VQO Q;  4KUI A;  4ESR A;  2NLU A;  2AHJ B;  2ZPF B;  2COW A;  1XTD A;  3QKJ A;  2JTM A;  2VV5 A;  5KYW A;  1BB9 A;  4BAC A;  3DLL A;  1M8M A;  3TSZ A;  2CP6 A;  2DIG A;  2GTO A;  4B9X A;  5GAM h;  1HD3 A;  2YUQ A;  3M0P A;  5CKD A;  3VU3 C;  2DL8 A;  3HPW A;  4OGE A;  2FYK A;  4OMF B;  2O01 E;  1OI1 A;  2ZAE A;  2KSS A;  1K9A A;  3BE3 A;  2C0T A;  4LDW A;  2HMA A;  3AHU A;  3RKW A;  1OU8 A;  1XQH A;  1GFC A;  2DL5 A;  2DTO A;  1Q7Y R;  1KIK A;  2KR3 A;  7AT1 B;  1V29 B;  1BIA A;  4XU3 A;  4DOW A;  3OYC A;  3OYN A;  4J7I A;  2EJ9 A;  5FLX E;  1MMA A;  2M02 A;  2V8I A;  1UHF A;  5CK9 A;  2KMT A;  1SSH A;  1AWJ A;  2E10 A;  1M3A A;  2KXC A;  3CCJ A;  2K2V A;  4M78 E;  1UGV A;  1JRI A;  2XDD A;  3URG A;  1OV3 A;  1YHQ Q;  2L3Q A;  2LRQ A;  2OJ2 A;  1JJ2 P;  1AWW A;  4WTO B;  2CUD A;  1BKB A;  2MYS A;  1Y57 A;  2F2V A;  1VQL A;  3CCQ A;  3MEA A;  2KK4 A;  3JCM d;  1YJN Q;  1KHI A;  1M9S A;  1GBR A;  4C8Q A;  3CME Q;  4C92 C;  3CCU A;  2R58 A;  4Q5W A;  4Z8A A;  4D8K A;  3QZ5 B;  4KT0 E;  1YHQ T;  4ZTF A;  4RCB A;  3FJ5 A;  1K0X A;  3CBP A;  2DKG A;  1BIB A;  4ZN1 A;  4LUE A;  1BU1 A;  3M9Q A;  1X6G A;  4C5E A;  1YJN T;  1Y71 A;  1RAE B;  3LWI A;  1LNX A;  5LJ3 e;  2JM9 A;  1BI3 A;  3THK A;  5IAY A;  4IUP A;  4PK4 A;  4HCC A;  3E9F A;  2RO0 A;  4CC7 A;  5CAI A;  1W6X A;  4E7K A;  3MKD A;  1QLY A;  2V8K A;  5CKH A;  4RTX A;  3I56 A;  3JB9 H;  4MMK A;  1Q81 C;  2BUD A;  2K6D A;  1WNL A;  4Y91 A;  3CPW A;  3VS5 A;  4LXC A;  1ZSZ C;  2EJF A;  2EYQ A;  3QSU A;  2YRC A;  4HT8 A;  3RKX A;  1VQ9 Q;  2JZ2 A;  2MIO A;  5LJ3 j;  1RAG B;  4IUU A;  3VS4 A;  4LE9 A;  2K2M A;  2E70 A;  1U3O A;  1QCF A;  3M0R A;  1VQN Q;  1X69 A;  2A3L A;  1N9R A;  1BK2 A;  1TOV A;  1VQ9 T;  4EMH A;  1T0J A;  5FW9 A;  1GCQ C;  3S3M A;  1SKU B;  2AZS A;  4AG1 C;  4DQ2 A;  1XNI A;  1VQN T;  4UC4 A;  4R0K A;  5LJ5 f;  3QII A;  4M78 G;  4HCB A;  3O5Z A;  3G4S Q;  1G3S A;  3FEO A;  3VS2 A;  4BY6 C;  1B07 A;  3RMQ A;  2RQV A;  2DJZ A;  2LMJ A;  1LOJ A;  1M3B A;  1UE9 A;  2LCC A;  2X9H A;  1ZSZ A;  1NJI U;  2QTX A;  5CQX A;  1D3B A;  1WJS A;  1VIE A;  2IPO B;  2FPF A;  1X75 C;  2RJE A;  5KYY B;  3GLX A;  4GBQ A;  1NPR A;  4GY5 A;  1FMW A;  4PJO G;  5IXF A;  2RHX A;  2EW3 A;  1QVF S;  4M7D E;  8ATC B;  4LDX A;  1TWB A;  1K9M C;  5GAN 3;  2OTL T;  2QEX A;  2R57 A;  1KSW A;  4J9G A;  3A98 A;  2GTJ A;  1Y7X A;  3OA6 A;  2DJQ A;  3HSB A;  4R56 A;  4FW1 A;  2DXT A;  3A8L B;  1GCQ A;  1X27 A;  1UHC A;  2FEI A;  2P0P A;  2OTJ Q;  3CD6 T;  4RTU A;  2M9U A;  2K5F A;  1AVZ C;  4M75 F;  5CVI A;  1I81 A;  2MMP A;  2AKK A;  2FZK B;  3TRE A;  2ROL A;  4J8O A;  2OTJ T;  3E2U A;  5DLO A;  3CCL A;  1UGQ B;  3VS6 A;  4AFU C;  1D09 B;  3GBQ A;  4FT4 A;  3V8J A;  1W1F A;  1AWO A;  2E5Q A;  2ZZD A;  3RBB B;  1OPK A;  1JB0 E;  5GMK i;  4M78 B;  1D0Y A;  3INZ A;  5I21 A;  1QP2 A;  1YCS B;  2JN0 A;  1WI7 A;  2DL7 A;  5GAN 5;  3EFR A;  4QQ6 A;  1KQS S;  1VIF A;  2X4Y A;  1T0H A;  2LT1 A;  3PVL A;  4XTZ A;  2ZGW A;  3OYK A;  2K3X A;  2EYW A;  4AFZ C;  4BB7 A;  1N8R U;  1XOV A;  2K57 A;  2JXB A;  2YUO A;  4OP0 A;  4FU6 A;  1VQK T;  5J3B A;  2HL3 A;  5HK0 A;  2DA9 A;  4KUD K;  1M90 R;  5C0M A;  2L8D A;  2DX1 A;  3CCE T;  2HAX A;  1QQJ A;  2CZ1 B;  2VGN A;  1OEB A;  4X9C A;  2BE7 D;  4C8Q E;  3LGF A;  1ZUY A;  3QYG B;  2KNB B;  3TQ7 P;  4M78 F;  5LJ3 g;  3JAM E;  2EQM A;  2A28 A;  3QYH B;  3REA B;  4CRI A;  1KG1 A;  2DO3 A;  2DBM A;  4J9E A;  2QTV A;  2XDP A;  3CCM Q;  4FT2 A;  3DB4 A;  5GJV B;  1NM7 A;  1G2B A;  5A0L A;  4M7D G;  3OMG A;  2L2P A;  2KGT A;  2EYX A;  1RLQ C;  3ZL7 C;  1OU9 A;  5KYN A;  4II1 A;  3CCM T;  1MMN A;  1H3H A;  1QVG A;  2X35 A;  3H8Z A;  4M78 D;  2XDB A;  2JOY A;  3CCV Q;  4OVA A;  1KQ2 A;  4C0F A;  1H8K A;  1WHK A;  1SG5 A;  4PFO A;  3I9Q A;  3OY9 A;  1B3Q A;  2QA4 T;  4BE1 A;  4PFZ A;  4BI8 B;  2LX7 A;  3KXT A;  1A0N B;  4KH1 B;  4AFS C;  1SHG A;  4OB1 B;  2QQR A;  4KGV B;  3VKI A;  3CCV T;  2EQU A;  1PRL C;  2LQN A;  3CCR Q;  2I2L A;  4PJM A;  2YSQ A;  3JCM X;  3U23 A;  1GL5 A;  1K1Z A;  2MOX A;  2ROT A;  1ABO A;  3VS7 A;  2LZ6 B;  1K8A C;  1AZG B;  2DER A;  1Q82 C;  4Z88 A;  3OYY A;  1PD1 A;  3CC2 Q;  2X3W D;  3JSC A;  4WCI A;  3CC4 Q;  4M77 F;  1S72 Q;  4JJN K;  2BZX A;  1ZUK A;  4AG2 C;  1SSF A;  2DF6 A;  3I35 A;  2F69 A;  3EG9 B;  5KCO A;  4CC3 A;  2KAF A;  4E7L A;  4M7A C;  4M7D B;  1YIT T;  3CC2 T;  2DET A;  4C8Q G;  4J9B A;  2CGH A;  1E6H A;  1S72 T;  1T3L A;  5GAN e;  2CKK A;  2RNA A;  4ME7 A;  3UPU A;  1K0S A;  2H3J A;  1UEC A;  3ME9 A;  4F7U A;  1PKT A;  5GAO r;  3BY7 A;  1R8O B;  5GAN 6;  4FSX A;  2CP3 A;  2MF2 A;  2IIM A;  1TXQ A;  1IRX A;  3A8H B;  1T3S A;  3MP8 A;  5KYW B;  1VQP A;  1KD1 U;  1JEG A;  1B34 A;  1IGU A;  3H9N A;  1NYG A;  4OGC A;  2X4X A;  4LNP A;  2R5A A;  3OW2 P;  2BZ8 A;  3EG3 A;  1ZX6 A;  5LJ5 d;  4IUR A;  2P84 A;  5GAO l;  1RL2 A;  5GAN j;  3P8H A;  4JRK A;  2MAM A;  1SRM A;  2ECZ A;  3M5A A;  5GAN 8;  1OOT A;  3RDV A;  2FZG B;  2HQE A;  2RPN A;  3ULR B;  1WHL A;  3OYH A;  4C5G A;  4M7A A;  1NJI R;  2V1Q A;  1IZ6 A;  1UGP B;  4XTV A;  2O31 A;  4CC2 A;  1X6O A;  2JW4 A;  4BE2 A;  3MHX A;  3G71 A;  5GAO n;  3PFS A;  4EIK A;  4IIO A;  4M7D D;  1I07 A;  4EDU A;  2NYS A;  1VQ8 A;  2KEA A;  4OMP A;  1IXD A;  2CSI A;  2PVO B;  2RQT A;  5D6X A;  1UJ0 A;  4JRI A;  2KT8 A;  4C8Q B;  1YN8 A;  2D0N A;  4TVR A;  3OMC A;  1WZO A;  1VQL T;  4IIM A;  1OZ2 A;  3NHN A;  2SRC A;  4KGZ B;  4KRT A;  3V7C A;  2DVE A;  3H6Z A;  1M1K U;  4KBM B;  1HXD A;  2J6F A;  2ED0 A;  5HCK A;  1NEG A;  1GCP A;  2GFU A;  3VS0 A;  1IHW A;  5A2Q E;  4Y92 A;  2EAY A;  2VXE A;  2MWP A;  2GQI A;  2DZ9 A;  1WJQ A;  1ABQ A;  2KYM A;  2F2X A;  2NUP A;  4E7H A;  4BD3 A;  3SDZ A;  1WIE A;  2EKO A;  3VRY A;  2LT4 A;  4PNO A;  1ZA1 B;  4OB2 B;  1LVK A;  3QG1 A;  3EG0 A;  5GAN 2;  3G6E Q;  1VQ4 A;  5D6Y A;  2E1H A;  3L1A A;  3WXM B;  2CZ0 B;  2RJC A;  3SD4 A;  1YI2 Q;  2R5M A;  2JTF A;  1H3Z A;  3C95 A;  2GNC A;  1X2K A;  4JZ3 A;  3SB2 A;  2RK1 A;  2CUB A;  1ZA2 B;  4RTY A;  4C0Z A;  2JUF A;  3G6E T;  5DM7 R;  1N5Z A;  1N8R R;  1PCX A;  4XTU A;  4BI3 A;  1Y96 A;  4ORZ A;  4ZN3 A;  1YI2 T;  2X51 A;  3FDR A;  2JT4 A;  1JJ2 S;  4Z02 A;  3X20 B;  4DBR A;  4C8Q D;  4OF1 A;  4M4Z A;  1WXU A;  3VRZ A;  4ANJ A;  3Q1J A;  1U1S A;  2L3P A;  1G5V A;  3M53 A;  1TSF A;  1G3T A;  4FSS A;  3PMT A;  3BDL A;  1WHG A;  3FRN A;  4F14 A;  2FRW A;  4A4G A;  2KY9 A;  1VQ5 A;  4JDS A;  1ZBJ A;  5LJ3 h;  5GMK l;  4E7I A;  5KH6 A;  1Q86 R;  3M55 A;  3HHT B;  1NZ9 A;  1WYX A;  4KGX B;  1LJO A;  2WSF E;  5I11 A;  1UEB A;  2C0O A;  2KE9 A;  2KI7 A;  2HDA A;  5GAN g;  1K4U S;  3QJY A;  2ZPG B;  4RTV A;  1U06 A;  2QXF A;  1CKB A;  3EFO A;  1PKS A;  5IHK A;  2LDM A;  4ZTJ A;  1R0B G;  5I2M A;  3HRS A;  3M57 A;  2HSP A;  4N4H A;  2A36 A;  4QVZ A;  1Y07 A;  4KH0 B;  2ZPB B;  2FHD A;  1MUZ A;  3V7S A;  2EGC A;  4NOY A;  3TCJ A;  3EG2 A;  4F7U E;  3HFN A;  4FYY B;  3JCM W;  5LJ5 e;  4FL6 A;  2F2W A;  4J9H A;  1PD0 A;  3HKS A;  3NGP A;  1I8F A;  2EYZ A;  5KYX A;  4PFP A;  1VQ6 A;  4PJO E;  3N5B B;  4E7Z A;  3WVE B;  2CT4 A;  2PTK A;  2ESW A;  3H0I A;  1JO8 A;  1QVF A;  2HEQ A;  3OYJ A;  4XQ3 A;  2C06 A;  3CMA A;  1M2V A;  4CI0 C;  4D8D A;  5L8R E;  4DEY A;  2A0F B;  2COZ A;  5IN1 A;  2DFU A;  4N4I A;  5I22 A;  3CC7 A;  3FB9 A;  4HCK A;  3BDU A;  2BKD N;  3RES A;  4IUV A;  3S3N A;  1EIF A;  1N6A A;  2PUO B;  1VQM Q;  2DM1 A;  5GAM e;  1SRL A;  4JS4 A;  3E19 A;  4JJD A;  3HL8 A;  3KUF A;  3QO3 A;  2RM4 A;  4PJJ A;  3D7S B;  4C92 A;  1Q86 C;  3M59 A;  1VQM T;  3I55 Q;  2DRK A;  2LNV A;  2RI3 A;  1G3W A;  1Q7Y C;  1KD1 R;  3HTR A;  2ZCF B;  2PUK B;  1D1B A;  3OS5 A;  1BI0 A;  2W0Z A;  4GLK A;  1KQS A;  5GAM j;  3RNJ A;  4DA4 A;  4IUT A;  3I55 T;  4FYX B;  4L59 A;  1K73 R;  1EFN A;  3OSS C;  2RQW A;  3CCS A;  1VQO A;  2VB6 A;  1D1A A;  3C4S A;  4RTT A;  3LH0 A;  3LX7 A;  3HRU A;  2D8H A;  1UUE A;  3UA7 A;  1PG5 B;  2DBK A;  5J26 A;  5CR2 A;  1QWE A;  4F7U G;  1KQ1 A;  2OTL Q;  2HBP A;  1NEB A;  3CXC P;  2XI9 A;  4PJL A;  3V8K A;  2DL3 A;  5A0G A;  2RHY A;  4HKE A;  2DIL A;  1PSF A;  3CD6 Q;  1AZE A;  3MEU A;  2GQV A;  4J9F A;  2DXB A;  2GF7 A;  4L5G A;  5LJ3 f;  2HZY A;  2DEQ A;  3JV3 A;  1WXT A;  4J6Y A;  1ZQ1 A;  1WXB A;  1AOJ A;  4LDU A;  1KC8 R;  2M16 A;  1M1K R;  1MV3 A;  1D1C A;  3EFS A;  3AT1 B;  5C6S A;  2FVU A;  1RAA B;  3PNW C;  1R0C B;  4C5I A;  3G7Z A;  2KBT A;  1YP5 A;  1YJ9 A;  2O4X B;  2E65 A;  1MMD A;  2KXD A;  3M0Q A;  1V76 A;  1JXO A;  2YDL A;  1YHQ A;  2CSQ A;  3LLR A;  3OYA A;  5IXB A;  3X24 B;  1OX9 A;  1NLO C;  5I2S A;  1QCN A;  2DTI A;  1IRE B;  1YJN A;  1QMC A;  2QQ9 A;  4FYW B;  3CME A;  4JUV A;  3EGD A;  5HY6 A;  3R6O A;  4OMO A;  1ZSG A;  3M4Y A;  4N4G A;  2D6F A;  4P5N A;  1MNE A;  2VVK A;  1VQK Q;  1RUW A;  2XKO C;  3JCM e;  1ZHI A;  4XTW A;  2EGE A;  2G6F X;  2CP7 A;  1W70 A;  2M1H A;  1YJW A;  3CCE Q;  4F7U B;  6AT1 B;  2KRO A;  5LJ5 g;  5GAO q;  2YT6 A;  2FB7 A;  2D9T A;  1D0X A;  2EFI A;  3RER A;  4PJO B;  4QQD A;  3VYG A;  4OMN A;  3NTI A;  4XTX A;  1RAC B;  4J7F A;  2JTE A;  3JB9 I;  3M0U A;  4E6R A;  1YFN A;  2YXY A;  3NMZ C;  2DL4 A;  1P92 A;  1KFZ A;  3EG1 A;  2ABL A;  4M75 C;  4EMG A;  3OS2 A;  1H64 1;  5IHI A;  2RN8 A;  2W10 A;  4RUG A;  2L3S A;  2CYZ B;  3REB B;  3IQL A;  2ED1 A;  4HCZ A;  2CT3 A;  1M3C A;  3CEY A;  5GAM g;  2IG0 A;  2AZV A;  3SFM A;  3OQ5 A;  4PJO F;  3CPW P;  4X34 A;  3DKM A;  2V1R A;  2H8H A;  3PVQ A;  2RQU A;  4J6X A;  4FCY A;  2M0Y A;  2QA4 Q;  1Q81 U;  2DPP B;  3MPU B;  3L2W A;  2ZPH B;  2VC8 A;  3OB9 A;  2CP5 A;  3EH2 A;  3TEE A;  1G3Y A;  3EHR A;  1YIJ Q;  4DBF A;  4JJC A;  1IGQ A;  3L2Q A;  2LP5 A;  4RTZ A;  3X26 B;  1NYF A;  3G4S A;  3OYI A;  1NPP A;  5GMK h;  4C92 E;  3G1J A;  2E6Z A;  2D1X A;  4ZGJ B;  5KCH A;  4PJO D;  1WQW A;  1YIJ T;  4M75 A;  3MP6 A;  3A8O B;  3UAT A;  1VQ7 Q;  1PWT A;  2J6K A;  2K7A A;  4M78 C;  4C0D B;  3PT9 A;  3VS3 A;  1IB8 A;  5GAO m;  1QCO A;  2NUP B;  2XU8 A;  4NL2 A;  4QQG A;  3SWN C;  2X4J A;  3OW2 S;  1AHJ B;  1YIT Q;  3MO8 A;  3JB9 G;  1U1T A;  1VQ7 T;  1V1C A;  4DBH A;  2O9S A;  1WHJ A;  4Y28 E;  2QGF B;  1M90 C;  2YWW A;  4EMK C;  4A54 A;  1G8X A;  2EBP A;  1W4S A;  2RMO A;  1CSK A;  1O75 A;  4JLG A;  3SEM A;  1PSE A;  3J7A F;  1FWZ A;  1NBE B;  2E64 A;  3T9N A;  4QKU A;  2V26 A;  1TUC A;  2DZC A;  1Y96 B;  3LW5 E;  4IKF A;  1K9M U;  1UGS B;  2LCL A;  1WX6 A;  4RKU E;  1C6V X;  5FU6 B;  3FJP A;  2K3B A;  3EGX A;  3LYI A;  4M78 A;  4LDY A;  3TVT A;  4ELZ C;  1U8R A;  3CPF A;  3MEW A;  3SWN A;  1NG2 A;  5GAO p;  1RLP C;  5CKF A;  4M7D F;  2C0I A;  2K5I A;  4BUG A;  2RK2 A;  1MGQ A;  2J6O A;  4F16 A;  2Y4X A;  3J80 E;  1W2B S;  5HK3 A;  2QQA A;  2QDL A;  2QGG A;  1JJ2 A;  5DLQ E;  3GOX A;  1B7T A;  3NPF A;  3QHS A;  3L2R A;  3RR6 A;  4EMK A;  1JU5 C;  1AWX A;  5IH2 A;  4M77 C;  2DK3 A;  4ZNX A;  4HVU A;  3GIB A;  1QWF A;  1QP3 A;  1WJR A;  2AKL A;  3V8L A;  4MML A;  5FWB A;  3JCM g;  2P4T A;  3CCJ Q;  2QQS A;  4C92 G;  1ZUU A;  2AK5 A;  2EQI A;  3MEV A;  4LD9 K;  4MZT A;  3CBO A;  3L2Z A;  1PC0 A;  1TTH B;  3UDC A;  1ZBX A;  1MND A;  1VQL Q;  3CCQ Q;  1BI2 A;  1RAH B;  1WHM A;  1JXM A;  3EGU A;  3VUZ A;  3CCM A;  3JCM J;  1KHC A;  1WA7 A;  3BW1 A;  1OUL A;  4WF2 A;  1D0Z A;  1JBM A;  3CCJ T;  3CCU Q;  2KQW A;  2VXF A;  1OYX A;  5LJ3 d;  4J9C A;  2COY A;  4XU1 A;  4PLL A;  1VUB A;  3OYB A;  4DBQ A;  1K76 A;  2VYT A;  4BI4 A;  2FRY A;  3QPH A;  3OYE A;  3CCQ T;  3VS1 A;  2DIQ A;  3TSW A;  2DRM A;  3MJX A;  2EGA A;  3CCU T;  2EQJ A;  2EIF A;  2QAS A;  5J39 A;  4M7D C;  3RUX A;  3CCV A;  2DNU A;  1XJW B;  1WDX A;  4M77 A;  5GMK m;  1M2V B;  2DD4 A;  2RHI A;  3CC7 Q;  4AMC A;  5L23 A;  2VUB A;  2EYY A;  2LQK A;  1IO6 A;  1GRI A;  1QVG P;  5GAN f;  1M27 C;  2JS0 A;  4B6M A;  4HT9 A;  3QZ9 B;  3I56 Q;  3HFO A;  3NFC A;  4C8Q F;  3OS1 A;  2OAU A;  4PLI A;  3CCR A;  3GPL A;  2MPX C;  2DEU A;  2I0N A;  3CC7 T;  1PHT A;  1PRM C;  3EH1 A;  1AEY A;  2YLC A;  4AFQ C;  3E9G A;  1O9S A;  2LX9 A;  3QDR B;  2NUT A;  4O5V A;  3I56 T;  1UTI A;  3C12 A;  1E6G A;  4C92 B;  2CZ7 B;  5DY9 A;  2PVG B;  2LTO A;  3C0C A;  1FX7 A;  2KYB A;  1BCM A;  2FPE A;  1VOM A;  3CC4 A;  1X2Q A;  1S72 A;  4E2F B;  3EG9 A;  1TH7 A;  1NJI C;  4JLI A;  3O8V A;  3FC3 A;  4Z89 A;  3OYG A;  3ZEH A;  2HKN A;  2NUZ A;  5FU7 C;  2X4W A;  4M75 E;  3OYL A;  2JJ9 A;  1K8A U;  3LGL A;  1RAB B;  1Q82 U;  2OX7 A;  1UGR B;  4A63 B;  5FRN A;  4HA8 A;  3ZBD A;  1WPY A;  4C92 F;  2JVV A;  4PJN A;  1X01 A;  2LCS A;  1I0C A;  4NL3 A;  1M90 U;  4A4K A;  3BFM A;  2QK0 A;  4C8Q C;  2LVM A;  2JMC A;  3CCS T;  1VQO T;  1I4K 1;  1ZSZ B;  4F04 B;  1Q81 R;  2O88 A;  1PNJ A;  1D3B B;  2L5Q A;  4DEX A;  3QBY A;  2VKN A;  3JB9 J;  3M56 A;  3JCM c;  1GBQ A;  2BE9 B;  5KYU A;  3OYD A;  1C0M A;  2QEX Q;  3QWY A;  2M0O A;  2E3H A;  4JPB W;  1OPL A;  3QUI A;  4PL6 A;  4C92 D;  1C1A A;  2VWF A;  4GLM A;  2LC4 A;  4R55 A;  1S1N A;  2FPD A;  2FO0 A;  4HVW A;  3OYF A;  1SF9 A; 
#chains in the Genus database with same CATH homology
 3JV3 A;  1WXT A;  2LX7 A;  1WXB A;  1AOJ A;  1A0N B;  5IHN A;  4AFS C;  4OMQ A;  1KJW A;  2LJ3 A;  1FYN A;  1SHG A;  1PRL C;  2LQN A;  1MV3 A;  2FG0 A;  4HVV A;  1LCK A;  2YSQ A;  3R6N A;  1G83 A;  2KBT A;  1YP5 A;  1SPK A;  1MV0 B;  3U23 A;  2J05 A;  1GL5 A;  2BTT A;  2KXD A;  1K1Z A;  3M0Q A;  2KRS A;  2MOX A;  2X3X D;  1JXO A;  4LUD A;  2ROT A;  2YDL A;  1ABO A;  2CSQ A;  3VS7 A;  2LZ6 B;  1AZG B;  2CH4 W;  5IXB A;  4Z88 A;  1NLO C;  1QKX A;  4J9I A;  2CDT A;  3LH5 A;  2X3W D;  4WCI A;  2K79 A;  1X6B A;  4OMO A;  3M0T A;  2BZX A;  1ZSG A;  4JZ4 A;  1ZUK A;  4AG2 C;  2DF6 A;  2VVK A;  3I35 A;  3I5S A;  4CC3 A;  1RUW A;  2LQW A;  2EKH A;  2DYB A;  2EGE A;  2G6F X;  1W70 A;  2B86 A;  4J9B A;  1SHF A;  1E6H A;  1T3L A;  2ENM A;  1BBZ A;  2KRO A;  3UA6 A;  2RNA A;  2YT6 A;  1Z9Z A;  1K0S A;  3EHQ A;  1UEC A;  2GGR A;  2JM8 A;  1PKT A;  2O2O A;  3H41 A;  1ZLM A;  2EPD A;  4OMN A;  2NWM A;  1X43 A;  1YWO A;  2IIM A;  2JTE A;  3H0H A;  5EC7 A;  4ESR A;  3M0U A;  4E6R A;  1T3S A;  3PE0 A;  3NMZ C;  2DL4 A;  1KFZ A;  1JEG A;  3EG1 A;  2ABL A;  4J9D A;  1NYG A;  2JMA A;  2DLP A;  4LN2 A;  5IHI A;  2RN8 A;  4K11 A;  2W10 A;  4LNP A;  4RUG A;  2L3S A;  2BZ8 A;  1JQQ A;  1ZX6 A;  3EG3 A;  4QT7 A;  3IQL A;  4OMM A;  3REB B;  1BB9 A;  2ED1 A;  2DE0 X;  1M8M A;  3TSZ A;  1VYU A;  2CT3 A;  2JS2 A;  1M3C A;  2GTO A;  2AZV A;  1HD3 A;  1AD5 A;  1SRM A;  2ECZ A;  2YUQ A;  4OML A;  3M0P A;  2DL8 A;  2V1R A;  1OOT A;  2H8H A;  3PVQ A;  2YUN A;  5GJW B;  2RPN A;  2RQU A;  3ULR B;  2J06 A;  1K9A A;  1VA7 A;  2C0T A;  2M0Y A;  2V1Q A;  2CRE A;  1GFD A;  2O31 A;  1GFC A;  2DL5 A;  3SHW A;  4CC2 A;  2JW4 A;  2KR3 A;  1KIK A;  3EHR A;  2BZY A;  2OAW A;  4JJC A;  4EIK A;  4IIO A;  1UHF A;  1I07 A;  3KFV A;  1SSH A;  2LP5 A;  4RTZ A;  3H0F A;  1AWJ A;  1M3A A;  2KXC A;  1NYF A;  2KEA A;  4OMP A;  2L0A A;  1ARK A;  1UGV A;  2CSI A;  2RQT A;  1UFF A;  2J7I A;  1OV3 A;  1UJ0 A;  2DMO A;  2L3Q A;  2OJ2 A;  4CC4 B;  1AWW A;  2D1X A;  2CUD A;  3CQT A;  1Y0M A;  2KT8 A;  1YN8 A;  2D0N A;  1Y57 A;  2F2V A;  3UAT A;  4IIM A;  1PWT A;  2J6K A;  2K7A A;  3NHN A;  2SRC A;  4KRT A;  1GBR A;  3VS3 A;  4D8K A;  4Z8A A;  2J6F A;  2ED0 A;  5HCK A;  3FJ5 A;  1NEG A;  1GCP A;  1K0X A;  3VS0 A;  4Y92 A;  2GQI A;  2KYM A;  1ABQ A;  4LUE A;  1BU1 A;  2F2X A;  1WIE A;  1X6G A;  1V1C A;  3VRY A;  2O9S A;  1Z9Q A;  1WLP B;  5ECA A;  2JM9 A;  3THK A;  1CKA A;  2LJ1 A;  1UG1 A;  3EG0 A;  2EBP A;  2DVJ A;  2RMO A;  1CSK A;  3SEM A;  4CC7 A;  1W6X A;  1QLY A;  1TUC A;  2GNC A;  1X2K A;  4JZ3 A;  4RTX A;  2CUB A;  4RTY A;  2K6D A;  3VS5 A;  1WX6 A;  1N5Z A;  2KT1 A;  4ORZ A;  2K3B A;  3TVT A;  2JT4 A;  1U5S A;  2MIO A;  2PNI A;  1WFW A;  3VS4 A;  2YUP A;  4M4Z A;  4LE9 A;  1WXU A;  2K2M A;  3VRZ A;  1NG2 A;  1U3O A;  1QCF A;  1NLP C;  2L3P A;  5FWC A;  3M0R A;  1RLP C;  1X69 A;  3M0S A;  2OI3 A;  2C0I A;  2J6O A;  4FSS A;  4F16 A;  1BK2 A;  2EVR A;  4F14 A;  2QDL A;  2FRW A;  1T0J A;  4RTW A;  5FW9 A;  3NPF A;  1GCQ C;  1JU5 C;  1AWX A;  1ZBJ A;  5IH2 A;  1VYV A;  1YNZ A;  2AZS A;  4AG1 C;  4ZNX A;  4HVU A;  1QWF A;  2LJ0 A;  2AKL A;  1TUD A;  4R0K A;  1YWP A;  5FWB A;  1WYX A;  3O5Z A;  1QKW A;  1ZUU A;  2AK5 A;  5I11 A;  2EQI A;  2C0O A;  2O9V A;  2KRM A;  3VS2 A;  2KE9 A;  2RQR A;  1B07 A;  2HDA A;  1K4U S;  4RTV A;  2RQV A;  2LMJ A;  1U06 A;  1M3B A;  1CKB A;  1UE9 A;  1PKS A;  5IHK A;  3EGU A;  1JXM A;  1VYT A;  1WA7 A;  2HBW A;  2FPF A;  2HSP A;  2PZ1 A;  4GBQ A;  2A36 A;  3I5R A;  4J9C A;  5IXF A;  1RI9 A;  1FMK A;  1K76 A;  1MUZ A;  2EW3 A;  2FRY A;  4X1V A;  2A37 A;  2EGC A;  3EG2 A;  4JJB A;  3VS1 A;  2HCK A;  3TSW A;  2DRM A;  2F2W A;  1KSW A;  2EGA A;  1E7O A;  4J9G A;  4J9H A;  3A98 A;  2GTJ A;  2M51 A;  3NGP A;  2DJQ A;  2EYZ A;  2DNU A;  1GCQ A;  1X27 A;  1UHC A;  1WDX A;  2FEI A;  2CH4 A;  2CT4 A;  2PTK A;  4RTU A;  2ESW A;  3H0I A;  1JO8 A;  2MCN A;  5L23 A;  2HEQ A;  2EYY A;  1IO6 A;  1GRI A;  4F17 A;  1M27 C;  2JS0 A;  1AVZ C;  3UF4 A;  4D8D A;  2A08 A;  2AKK A;  4DEY A;  2XMF A;  2ROL A;  5I22 A;  1TG0 A;  2GBQ A;  4HCK A;  2I0N A;  3VS6 A;  4AFU C;  1PHT A;  1PRM C;  3GBQ A;  2E5K A;  1AEY A;  1W1F A;  1AWO A;  4AFQ C;  3RBB B;  1OPK A;  2DM1 A;  2P4R A;  1UDL A;  1SRL A;  2RF0 A;  1UTI A;  1J3T A;  4JJD A;  1E6G A;  2SEM A;  1YCS B;  2K9G A;  3C0C A;  2KYB A;  1WI7 A;  2DL7 A;  2FPE A;  1X2Q A;  2LNH B;  1T0H A;  3PVL A;  3QWX X;  2EYW A;  2KRN A;  2DRK A;  4AFZ C;  1XOV A;  2JXB A;  4Z89 A;  2YUO A;  2NUZ A;  2W0Z A;  1SEM A;  2DA9 A;  2DX1 A;  1OEB A;  1UJY A;  1H92 A;  4A63 B;  1HSQ A;  1ZUY A;  3RNJ A;  2KNB B;  2A28 A;  3REA B;  2LCS A;  1EFN A;  1I1J A;  2DBM A;  1I0C A;  4J9E A;  2RQW A;  5GJV B;  2JMC A;  4RTT A;  1NM7 A;  2O88 A;  1G2B A;  1PNJ A;  1HJD A;  4DEX A;  2VKN A;  2D8H A;  1UUE A;  3UA7 A;  2DBK A;  2L2P A;  2KGT A;  2EYX A;  1QWE A;  1M30 A;  1RLQ C;  3ZL7 C;  1GBQ A;  1NEB A;  1H3H A;  3QWY A;  4JPB W;  1OPL A;  2DL3 A;  4HXJ A;  2DIL A;  2D8J A;  2VWF A;  1AZE A;  4GLM A;  1S1N A;  1H8K A;  2FPD A;  2FO0 A;  3I9Q A;  4HVW A;  4J9F A;  1B3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...