3TREA

Structure of a translation elongation factor p (efp) from coxiella burnetii
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
129
structure length
129
Chain Sequence
THSTNEFRGGLKVMVDGDPCSIIDNEFVKPGKGQAFNRVKFRNLKTGRVLERTFKSGETLPAADVVEVEMQYLYNDGEFWHFMTSENYEQHAASKEAVAEAKQWLKEEALCMVTMWNGVPLSVEPPNFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor P
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Translation
total genus 20
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3treA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3treA02
1HNXQ 3M9BA 3RLFA 1XMOL 2UU9L 2UXBL 5FLMG 3HKZG 1M1KU 2A8VA 4UP9A 1PH5A 2AKWB 3CMAT 3FHWA 3GTPH 5IT9E 1NJIU 1JB7A 1VQOT 1BBWA 3CC7A 3M4PA 4Y52H 2IT1A 4QIWE 1QUQB 3J81c 2QGQA 5LMNW 3AEVA 1NY4A 3NENA 1Q7YU 4AYBE 4MNOA 5IT9c 4GNXC 4TQUS 2L3RA 2LQ8A 3JAME 3CCJA 3CCUT 2PQAB 5IP9H 3OYYA 4QGUA 4JOIA 2MNAA 4GLVB 3CC7T 1X3GA 4DR1Q 5HGQA 1Y1VH 2UUAQ 4AQYQ 4DV2Q 4UPAA 4LFBL 3K7UC 1LYLA 4YHHQ 3PUVA 5IAYA 1HZBA 2AWNA 3AFQA 1VQ4A 1JJ2S 2HQLA 1K8AU 4YCWA 3KBGA 5IYBG 4A3JH 1A0IA 2FXQA 3TS2A 4DR6Q 4K0KQ 4EQ5A 1G6PA 3I4NG 3CCJT 1VQGA 4Y7NH 1IYJB 2D0OA 2CKZB 1K0RA 2YTXA 2MO1A 3GTJH 2R93G 3S24A 1Q1BA 5C44H 4DV3L 5GADC 4GOPA 1UE1A 3NELA 2MWPA 4A3BG 5JJKA 1WYDA 1VQ4T 3ERSX 4UY8C 1JJGA 2LSSA 1L1OB 3PUYA 4BXXG 1HJPA 1Z47A 3Q8DA 3KJPA 2LXJA 1UEBA 2A1AA 2UUBL 1QVFA 3HKSA 1SROA 5M3FG 3SGIA 1EUJA 2EXDA 4X66L 1VCIA 3M3YH 4LF7L 1EWIA 2BH8A 3PUWA 2K52A 3U50C 1EYGA 4B3SL 1YJ9T 1S3OA 3CAMA 4B3RQ 3OW2A 4GKJL 5E7NA 4KHZA 2ATWA 4LF9L 1XNIA 3CCST 1XPRA 2R7FA 3KYHC 4R4CA 4JI8L 2VQEQ 1Q12A 2OWOA 3MEFA 2IX1A 1BKBA 1QVCA 4OO1I 4KLKA 1EOVA 1Q86C 2YV5A 3PCOB 4J15A 4LUOA 4DUYL 3KFUA 3I55A 1T9HA 4JCVE 1VQHA 5IYBH 3OTOL 4BBSG 3ER0A 4YWLA 4YY3L 3T1YQ 4JI6L 4HJ8A 4L5RC 3I4NH 3RZOH 3D31A 1B8AA 4B3ML 3GTQH 1GKHA 4DV5L 2MO0A 3H3VI 3CD6A 1FL0A 1MIUA 1RIPA 3KF8B 4DV1Q 4PZ7A 5DM7R 4P72A 4GKKQ 2R93H 4IJLA 3MXNB 2QA4A 4A3BH 3I55T 1VQJA 2UUCL 4LF8L 1IBLQ 1IBMQ 2N78A 4BXXH 1I94Q 3CXCS 2VY3A 3UE1A 2IY5B 4POFA 3I4MG 5JEAG 5M3FH 1HR0Q 1JT8A 3CD6T 1TWCH 2ID0A 2WAQG 1N8RC 4KI0A 4YCVA 4OWWB 4A3GG 2QA4T 4OONA 2Q2TA 1N34L 1L2FA 1SSFA 2GVAA 2KENA 4P71A 3JAMi 1HZAA 4JI4Q 1EQRA 2RHSB 4GLAC 5IYDG 1PH6A 2PMZE 1KIXA 1XNQL 2CWAA 3BZKA 1Y1WG 2PNHA 1VQDA 3KF6A 4QQBX 4NXML 3RLNA 3I7FA 2NZOA 1L1OC 5C3EG 2JK8A 1X54A 1VQ7A 4POGA 4ZN3A 2BH2A 3CCVA 3J7AF 1K83H 1KAWA 3J7ZC 2VW9A 3S14H 4GNXB 3GTMH 4BBSH 3RLOA 4IFDJ 1KRTA 2JEBI 3CCEA 2Y0SE 4JBWA 1I5FA 3D0FA 1XMQQ 1HNZL 2E2HH 1PYSB 2G3RA 1K9MU 4L5QA 1HNWL 2OQKA 1Q1EA 1J5EL 3WWVA 5FLXc 3PF5A 2B63G 4O0AA 4DV7L 1M1GA 1PH4A 2NN6I 1VQ7T 3F1ZA 2Q2HA 3ULLA 1IL2A 1Q8KA 1X6OA 1VQ5A 2EQSA 1M1KC 2D0PA 4PZ6A 4YCUA 1BBUA 5IWAL 5C0XI 3CCET 4UP8A 5AJ3L 2VQFL 2ZJRA 2Q2IA 4AYBG 2HHHL 4JV5L 4C2MH 1ASZA 1VQPA 4LF6Q 3I4MH 4IPDA 1PVOA 4PZ8A 1TWGH 5M3MG 2KCMA 4MTNA 1UWVA 3M7NA 3CF5A 4A3GH 1JJCB 5EAYA 2WP8J 1JE5A 1PHJA 5ELNA 1KQSS 1C9OA 4DAMA 4BY7H 1EFWA 2JA6G 3G48A 1JJ2A 1W2BS 4TVAB 4IFDI 1VQPT 4IJHA 2CQOA 3H3VH 5DLQE 5C3EH 3DB4A 4LFAL 4DV0Q 1YBYA 4X64L 2VNUD 1SLJA 2XGTA 1VQBA 3BZCA 2D62A 1W3SA 2UXDQ 2F52A 4X65Q 3J81E 4DKAC 2E2IH 4A3DG 4BY7G 3KOJA 1OXXK 1SR3A 3CW2C 2B63H 2NZHA 4A75A 2F4VQ 1A63A 3HFZB 1NZ9A 3CCUA 2R7ZG 3S15H 5M5WH 3PV0A 3L0OA 2UXCQ 3ZJYC 1CKMA 1VQFA 2XHCA 4DK6C 4IFDG 4DR1L 1S72A 3GO5A 1KC8U 1X3EA 1DGSA 1IBKQ 2LVMA 2V1CC 5M3MH 3TRZA 4HIOA 2UUAL 4LUVA 3DLLA 1Q81U 2AWOA 2JA9A 1N9WA 2K14A 4H02A 1NPRA 4YHHL 4OXPA 4DV2L 2JA5H 1FJGQ 4B3RL 2JA6H 4OWXB 4DR6L 4K0KL 3GD7A 1OTCA 1S72T 2XTIA 2HT1A 1XMOQ 1V9PA 1R9TH 1PH3A 1VQ6T 5JEAJ 1YITA 4X62L 1N36L 3RN2A 1H95A 2ZM6L 1M90C 4JI2Q 1AE2A 4A3FH 5JJLA 4LFCQ 3HOWG 1YJ9A 4HIKA 4DAYB 2RF4A 4DR5Q 2Q2UA 4A3DH 3HOYG 4EX5A 5IYCG 3CXCA 1U5KA 3CCSA 2DGYA 1YITT 2R7ZH 4BY1G 1E24A 2L15A 2ASBA 1UE5A 4AH6A 2K4KA 3RZDH 1VQIA 5GAGC 1K73U 1PH7A 2YU9H 1NPPA 1VQNA 2ALYB 1MJEA 1HH2P 2H5XA 3PGZA 1YHBA 3UDXA 3CPWS 4RMFA 4DV6L 2K5NA 5BR8Q 4JI1Q 2E8GA 2VQEL 2CCZA 3EN2A 4CRIA 1Y14B 2K50A 4A4IA 1VQLA 5IE8A 1TWAH 3T1HQ 2E6ZA 5LMUL 5LL6S 1OXUA 1IZ6A 4NB3A 4DUZL 2JOYA 4DPGA 4LF5Q 2NVQH 1VQNT 2N49A 3P8BB 1EIFA 4IOAA 1PV4A 3HOUG 3UDFA 1EIYB 4A93G 3T1YL 4XIGS 3A5ZB 3E9IA 2E5LQ 4JI0Q 3HOXG 1YEZA 1VQLT 1GD7A 3G4SA 4DV1L 1MJCA 4A3CG 3KLWA 3PIOA 3L7ZC 4C3IH 3CP0A 1OXVA 3VDYA 4UP7A 1SRUA 3J81i 4GNXA 1IBLL 1IBML 3HOWH 3J81j 1I94L 1PFSA 1E1TA 1Q82U 1VQEA 2E2JH 3H15A 5IYCH 3KJOA 3ULPA 3HOYH 4NXNQ 3CCMA 2MQHA 1HR0L 3ICEA 4LF9Q 3G4ST 3J7A5 3DB3A 4BY1H 2CWPA 2PI2E 5GAHC 2JA7G 1N32L 4WJ4A 2R7DA 4GOPB 5C0XJ 1KQSA 2IX0A 4IO9A 3PO3G 3S1QH 1PH8A 4P73A 1KD1C 4IPGA 4X6AH 1W2BA 1I50H 1E22A 3CCMT 1FGUA 3STBD 4DR2Q 4JI7L 4YY3Q 1WOCA 2B29A 2WFWA 3M4OH 2OCEA 1E3PA 3EIVA 4DV5Q 1CSPA 5FLXE 2BA0A 3DM3A 3HOUH 1GVPA 3KDFA 4R4OA 3I4OA 4KHPL 1XMQL 3F2CA 1X3FA 2QEXA 3A0JA 3HOXH 4A3IG 1D8LA 3M85A 4LF8Q 5J3BA 2KVQG 3PSIA 4A3CH 4HJ7A 5JJIA 4YTLA 2HIVA 1C7YA 4L5SA 3CC4T 1KL9A 3BU2A 3F2DA 3LGLA 1YZ6A 3CCQA 1MKHA 2A19A 2GVBA 2OTJA 1SN8A 1Q86U 4NPSA 3F8TA 5GROA 1UE6A 4RG2A 2K5HA 4P75A 3UDIA 3RNUA 3S1RH 2QEXT 4LF6L 3E0EA 1N34Q 2BA1A 2F3IA 5LMNL 4HIDA 4APVA 4LNQA 1YHAA 1NJIC 1X65A 4DNIA 5C4JH 4HIMA 4X34A 4JYAQ 2JVVA 2JA7H 5HY6A 4NXMQ 2VUMG 3PUZA 3CCQT 1QUQA 2I5MX 4A3EH 2OTJT 3HOVG 1E7ZA 3PO3H 2IG0A 2MI6A 3G71A 2YTVA 2JA5G 4DK3C 1Q7YC 4JOIC 2NVTH 3AQQA 1NTGA 4DR7Q 2K5VA 1NE3A 4DR4L 4HJ9A 1YNXA 2PQAA 3CQZH 1Q81C 2ES2A 2K75A 4QL5A 1HNWQ 2NN6G 3S17H 3CC2T 2MWOA 3FKIG 2UXDL 1N8RU 1HNXL 3G71T 4GN5A 4X65L 4DR3Q 2OTLA 1K8AC 1SMXA 5C0XG 4A3FG 4B3TQ 1WFQA 4A3IH 4JI5Q 4AQYL 1XNRQ 1KXLA 2EIFA 4HJ5A 3LGJA 1QVGS 4IOCA 4GOPC 1YIJA 4OX9Q 1NMGA 2N8NA 4R4IA 2KDSA 2UXCL 2R92G 3CCLA 2IHEA 3J80E 2C35B 1RL2A 4LF4Q 4QQDA 1BVSA 1OXSC 5H1SE 5M5XH 1X9NA 2OTLT 3A74A 3CPWA 1P8LA 5IY0A 2VS1A 2WB1E 3A5UA 1NBWA 1L1OA 1IBKL 3I2ZA 3IRBA 3RN5A 1YIJT 1N33Q 3PUXA 2JE6I 1KRSA 4BA2I 3J80c 1AH9A 5FJ8G 1GM5A 3CCRA 1VQ6A 2JUFA 3CCLT 1NMFA 1FJGL 2VUMH 3HOVH 4BBRG 3S1MH 3GTLH 1X56A 1Q46A 4JI3Q 1A8VA 3JC66 4JBJA 1V43A 3K80C 4DV4Q 2ZTDA 1HZ9A 1G291 2IHFA 3GDEA 3S16H 2UU9Q 2UXBQ 1PYBA 5A2QE 2OQ0A 3CCRT 4YWKA 4PMWA 3TQYA 4JI2L 4YWMA 1TXYA 1WI5A 4MZ9A 4LFCL 3FKIH 1U0LA 2N3SA 4FDBA 1V1QA 4DR5L 4A93H 4JC0A 3PIPA 2I5HA 3H0GG 4QJFA 1CKNB 2KBNA 2I5LX 1AE3A 4IPCA 2B3GA 4LWCA 4R1JA 1XJVA 4LW1A 4GKKL 3G6EA 2R92H 2AHOB 2Z6KC 3CPFA 1Q82C 1B7YB 2GN5A 1E1OA 5ELOA 5BR8L 4JI1L 2JNGA 4P74A 5J26A 3JAMc 1YI2A 4LFBQ 1GO3E 3T1HL 2MFIA 4GLXA 3NEMA 5FJ8H 3G6ET 1ASYA 3S2DH 3NBHB 4LF5L 4X62Q 1N36Q 4BBRH 3F2BA 3HOZH 2ZM6Q 1Z9FA 4TVRA 3BJUA 1G51A 3K81C 2E5LL 5FLMH 4JI0L 4DV3Q 4C3HH 1YI2T 3U4ZA 3S2HH 3HKZE 2Y0SG 3CMEA 3GTOH 2NVXH 2ZJQA 5M5YH 3K7AH 3AYHB 3RR5A 2I0QA 3TEHB 2AMCB 2NVYH 1VQCA 3ULJA 1O7IA 2UUBQ 4ME3A 4X66Q 4NXNL 1C0AA 3H0GH 4B3SQ 1VQ9A 1PH1A 1K9MC 1TWHH 4DV6Q 1PH2A 4GKJQ 3CMET 3J80i 1K3RA 3M4QA 3I56A 1A62A 4A3MG 1YHQA 2PI2A 3PO2G 2RHQB 4LUZA 4WJ3M 2KCTA 1OXTA 4JI8Q 5LMUQ 1TWFH 3U4VA 1K8GA 5K36G 1VQ8A 2VZAA 1LTLA 1XTDA 1M90U 1P16A 2YYZA 4JG2A 2ZJPA 4DUZQ 4A3EG 4JI4L 2CKKA 1VQ9T 4DR2L 1VQMA 4DUYQ 4AIMA 4IPHA 3I56T 1YJWA 4GN3B 4C3JH 1YHQT 3OTOQ 4A76A 4JBMA 1CKOA 2JQOA 4JI6Q 1I6HH 1VQKA 2RCNA 4B3MQ 1UE7A 3CC4A 4PG3A 1VQ8T 4HJAA 3EBEA 2DO3A 1WJJA 4ALPA 4OWTB 4OO1G 3GTKH 1VQMT 1XPOA 2DUDA 3UE0A 2Z6KA 5C44G 2UUCQ 1YJWT 1QVGA 1WCMG 4XTCS 5IP7G 3TS0A 1VQKT 1QVFS 2JA8G 5C4XG 4JBKA 2R6GA 1PA6A 4LF7Q 1N32Q 4ZN1A 4A3LG 1D7QA 3TREA 3OW2S 2WB1G 4A3MH 4JYAL 3PO2H 1QZHA 4L5TA 4O2DA 1XNQQ 2JEAI 4JI7Q 4QY7A 4A3KG 3GTGH 4RG1A 1LUZA 1HZCA 1CSQA 1SE8A 2HIXA 3W1GA 3CC2A 1EQQA 3FP9A 1XPUA 4DR7L 2KHIA 4KHPQ 1KC8C 2LXKA 3UDGA 1S40A 3PF4A 1J6QA 1HNZQ 4DV0L 2E70A 5GQOA 1L0WA 3AFPA 1J5EQ 1SFOH 4DV7Q 3CCVT 4R4QA 4DR3L 4B3TL 1VQAA 4GS3A 4JI5L 1XNRL 3W1BA 3STBC 4GN4B 4OX9L 1HR0W 1LM0A 2F4VL 1YVCA 1WCMH 5IP7H 5IWAQ 1KD1U 5AJ3Q 2VQFQ 5LMNQ 1I3QH 1VS0A 4JV5Q 2HHHQ 2JA8H 4LF4L 3K8AA 3KF6B 5C4XH 5IP9G 2ZTEA 1QZGA 1YJNA 2WAQE 2CFMA 4A3LH 3KDFB 2LCLA 1VQ5T 3W5OA 1Y1VG 3K0XA 3L2PA 1CKNA 3LGFA 2KHJA 1N33L 1PH9A 5IYDH 4BA1I 1Y1WH 1KHIA 4A3JG 5GAEC 4R4TA 3S1NH 2VL6A 4DR4Q 3CMAA 1FVIA 4A3KH 1K73C 1IXRA 1CUKA 2Z0SA 3E9HA 1YJNT 2ZTCA 1VQOA 2YTYA 1JMCA 4JI3L 1B70B 3U58A 1X55A 3LH0A 3B6YA 4LFAQ 4DV4L 3HOZG 4X64Q 2JJQA
chains in the Genus database with same CATH superfamily
2J6FA 4JRKA 3RLFA 1YJWQ 4KGXB 3MA2B 2A8VA 5A0DA 2J05A 2YUOA 1MHNA 1VDZA 1YWOA 3MP1A 3SD4A 3GTPH 1K76A 4Q0FA 4N4HA 1IKMA 1HFNA 2CT3A 1BBZA 2ED0A 4FT2A 2LFNA 3RUZA 1X3PA 2NVTB 5LMNW 3AEVA 1OV3A 1B3AA 2YLBA 4CC4B 5CORA 2KQ3A 4MNOA 5FWCA 1ACMB 3MEWA 4ZGDB 1HYOA 2LQ8A 1K8MA 2PQAB 1NYGA 4M77E 1EYAA 4JOIA 3BW1A 4F17A 1X3GA 5HGQA 2UUAQ 3KXTA 4NL3A 1HZBA 2AWNA 1VQ4A 1K8AU 5IGCA 4ZKBB 4JJCA 4DBHA 1WIEA 1A0IA 4M7DD 4WF2A 4EQ5A 3I4NG 4Y7NH 4M7AC 2JA8B 1M9SA 3I4LA 1UE9A 3UF4A 4MZTA 1YCSB 1K0RA 3CC2Q 2V8KA 2MO1A 2R93G 5KNDA 3S24A 1QOHA 1Y96B 4E7JA 2BZYA 2WB1B 4CDCC 1HHVA 1I4QA 2F0GA 1VQ4T 2E75C 2L12A 3ERSX 3U23A 4BXXG 2FB7A 4BI8B 1VYTA 4K2LA 1D2BA 3FPUB 1BYMA 2CP5A 2DM1A 3A8GB 2LXJA 1UEBA 1RI9A 5M3FG 1TS3A 1C1AA 2X4JA 3HP3A 3HOZG 3EHQA 2K6DA 1S5BD 3U50C 1EYGA 1S3OA 2W10A 2CZ6B 2RH2A 4KGZB 4RTYA 2EY1A 1B07A 2ENMA 2RHZA 3KLSA 4Z9CB 4LF9L 1PRTD 2D0QB 1WTWA 5JPNC 2VQEQ 4FNFA 2JMCA 2KYBA 1QVCA 2WSFE 3M53A 1IHZA 4DXGA 3E19A 3RDVA 1EOVA 2X6GA 1OQKA 1EFID 4PJOE 2BE7D 2M51A 3MZ5A 5FK9C 4PJLA 3I55A 5FRMA 2F2VA 1T9HA 4JCVE 4OELB 2M16A 4J9CA 3ER0A 4PKCC 3T1YQ 3Q22A 4FP5D 2J7IA 3D31A 4B3ML 4PV1C 1M3CA 1VQOQ 5FO9B 4OB1B 3CD6A 1TKWB 3KF8B 4DV1Q 2VWFA 4IJLA 2QA4A 4M77D 3I55T 3JB9H 5C6SA 2EXZA 2OAUA 1VQJA 1EQVA 1IBLQ 1IBMQ 3G7LA 1I94Q 3CXCS 1NR2A 2IY5B 2COWA 3V7RA 1HR0Q 3OYIA 3CD6T 1TWCH 2K28A 1D5XC 3QWXX 3A8IE 2AQ3B 2CHBD 3QZ9B 2QA4T 3ERQA 4OONA 4M78A 1RAGB 3A8OB 2GVAA 4P71A 2KEAA 5GAOq 3VJPA 2K4YA 3CCJQ 3DXJC 1PH6A 1XNQL 2DBMA 5M5YB 1WXUA 5GAN8 3K7AB 4NXML 4FM4B 2NZOA 1Z7TA 5C3EG 2PYKA 2GF7A 2WKDA 5FU7B 3J7AF 1ZLMA 3J7ZC 2VW9A 2D9TA 3KLRA 2F5KA 3VUZA 1TWHB 2JEBI 2VXFA 4JBWA 3M0RA 1I5FA 2E1HA 3D0FA 1B4OA 1XMQQ 1K9MU 5GANd 3WWVA 5FLXc 4RUGA 5IGFA 1Y8PB 1TWFB 2HBPA 1S4ZA 2NN6I 4ZRZA 4E7ZA 3HG9A 3U9OA 4QT7A 1ILQA 1PMRA 4PZ6A 1BBUA 4O42A 5C0XI 1ENFA 2XICA 1PH1A 3RZOB 4JV5L 4PJOD 2HHHL 1IREB 3GTQB 1H9JA 3I4MH 4X9CA 4J6WA 2KRSA 5FRNA 1NLPC 5M3MG 2KCMA 2X6LA 2XN9C 4A3GH 3I90A 4MMKA 5EAYA 2E64A 5KRUA 5I2SA 5KYXB 2NUTA 1KQSS 2MOXA 4DOVA 4XQJA 1PHJA 4BY7H 3EJIA 3OYNA 3G48A 4EPCA 5ISRA 4XTVA 2LMCB 4HVUA 5KNCA 5DLQE 4AT1B 1F1BB 1RAAB 1QE6A 5E1FA 1GHKA 3ZYYX 5GANf 4ZTJA 3SK4A 2VNUD 2QQRA 1SLJA 2K2MA 1QCOA 1VQBA 2RSOA 3A55A 3BZCA 3KLSX 4K5WA 3V05A 4J9GA 2QI2A 3C1FA 2F1LA 2KBTA 3L2WA 1SEBD 4QQ6A 3SE0A 4A3MB 2Z4IA 3KOJA 1SR3A 3SWNB 4CC7A 2L1BA 2DZCA 4C0DC 1ZUUA 1H9RA 3NSWA 3MAQA 2KI7A 3A7AB 2EYLA 3SFMA 1MV0B 1TWBA 2PU9B 1IGQA 1I8FA 2ZPGB 3JCMJ 3GO5A 3E0JA 3GNGA 1RD9D 5HURA 1IBKQ 3TRZA 2EQKA 2LJ0A 1PHTA 1DCZA 2K79A 2Z4HA 3MTSA 1QCBD 2AWOA 3AB9A 4FO2A 4H02A 1UG1A 1NPRA 1YFNA 1SNOA 3G7ZA 5HKCA 1WHHA 1QJOA 3GD7A 3QZ5B 1WHGA 2H8HA 2XTIA 3QB3A 1XMOQ 1V9PA 3S3MA 2F2WA 2YUPA 4C1NK 5CC4A 1VQ7Q 3RN2A 1H95A 1DOKA 3A54A 2QYZA 4J7FA 5GAN3 4A3FH 3GOXA 3NHHA 5JJLA 3HOWG 5KYYB 4HIKA 3K6OA 4OGEA 2C5CA 1ONLA 3CXCP 4QVZA 4DAYB 2DXUA 3HOYG 4A3DH 3RIRA 3CCSA 2Z8LA 1STAA 2BUDA 4BY1G 1E24A 2ASBA 3TU4K 3VKIA 1UE5A 3RZDH 3GIBA 1VQ5Q 3MXNA 2YU9H 1VQNA 1BI3A 2RQUA 4J7IA 1HH2P 2EYJA 3UDXA 2I0NA 4RMFA 4IFDH 1VQPQ 2K5IA 4M78G 3D4WA 3EFOA 3OS2A 4A4IA 3WVDB 5HGTA 5KEEA 4AFZC 1CM9A 1KLGD 4ID6A 5IE8A 5LMUL 4RAUC 1XTCD 2QCPX 3RBBB 1IZ6A 1OXUA 5E3FA 4ELZC 4DUZL 4IOAA 1M3AA 1VQNT 2N49A 3F70A 4X3KA 1WHMA 3UDFA 1EIYB 3E9GA 3EHRA 3I8ZA 1XOVA 2EZVA 2DRMA 3A5ZB 2F3WA 2E2DC 4JI0Q 2HMAA 5DM63 1GD7A 3VYGA 3IFDA 4LXCA 2DK3A 4JDSA 1O7LA 3GP7A 1SPKA 4ATOA 3L2QA 1OXVA 2VVKA 2COZA 4GNXA 3UDCA 3TVTA 1BI1A 2A7YA 2O01E 1KC8R 1OO9B 5EJWA 1D5ZC 3JRZA 1ZHIA 4K5XA 3ICEA 3DB3A 2FVUA 3VYTA 4RTWA 2RCFA 1PSFA 2RJDA 2VB2X 1N32L 3VYHB 2B2VC 4WJ4A 3JAML 3EA6A 2H4OA 3S1QH 3NPPA 2HL5C 3I5SA 1SE3A 3M4YA 3STBD 3L2VA 1E22A 4DR2Q 1FGUA 3FLGA 1WYXA 1OULA 2E5KA 3A8MB 1CSPA 2BA0A 3KDFA 4R4OA 2VGMA 5F2DA 3I4OA 4F14A 2EW3A 5EPLA 1GFCA 1X3FA 2QEXA 3HS0C 3TP5A 2EYQA 1OYXA 1QP3A 2HBWA 2KQWA 5J3BA 1RDPD 3P7JA 2F0TA 5JJIA 4YTLA 5J1ZA 4HSVA 3CC4T 3BU2A 4MDXA 4QVDA 3LGLA 3CCQA 2A19A 4JVZA 2R58A 4OIKA 4P75A 4DOWA 1X6BA 2KEEA 1T5XD 1BQQT 2QEXT 2G9DA 1N34Q 2F3IA 1LV9A 5LMNL 2F69A 4X3UA 1W1FA 3WXMB 4HIMA 4KULA 4JYAQ 1UTIA 5HY6A 3PUZA 1MV3A 3H94A 3CCQT 5ELBA 4A3EH 2A6HC 2EYFA 1QKXA 3G71A 2N55A 3AQQA 4HJ9A 5CMDA 2YXYA 5GJWB 3F2UA 1Q81C 3NUCA 2K75A 1HNWQ 2DD4A 3LLRA 3M58A 2DJGC 4KK7A 4O1NA 1D1AA 1JWUD 1F2ZA 1Q82R 3G71T 4GN5A 4X65L 5E4XA 4A93G 4XAXB 1K8AC 2BZ8A 4JI5Q 3G4SQ 1Y0MA 1KXLA 2EIFA 2FO0A 3CBOA 2MCNA 1SSOA 1UGQB 4OX9Q 3MP8A 1IW7D 2N8NA 1LNXA 2FHDA 3CCLA 2R92G 1BO0A 1ZQ1A 3M0PA 4HCBA 2VKNA 1WXBA 5GMKi 3ND9A 5IY0A 2VS1A 3DMUA 1O9SA 2D2CC 2DL3A 3IRBA 4CDEC 2BE5D 4ZNXA 3JB9F 5TSSA 1IHVA 1WJSA 3CCLT 1FJGL 3OOCA 2VUMH 4RGNA 3C1EA 4XTXA 4BBRG 4RCNA 2LDMA 3S1MH 4XU1A 2XDDA 4JI3Q 2JYOA 1UGVA 3DEOA 3JC66 3K80C 2ZTDA 1VUBA 2P0QA 4WJWA 3LWEA 1HZ9A 1SRMA 4S3SA 3I4MB 3S16H 3GNFB 4PL6A 1F9PA 1PYBA 3PMFA 4YWKA 2NN6H 3TQYA 1TXYA 4A3GB 1IXDA 3FKIH 2ZAEA 4FVMA 2FZCB 4DAPA 2GTJA 2RK1A 1LT6D 2O4XB 2NWGA 2OXPA 3MFGA 3X3NA 1F9SA 1QP2A 1M8AA 1AWJA 2EFIA 2V26A 5GAN2 2B3GA 2I5LX 4R1JA 2LJ3A 4Y28E 3NHNA 4PJJA 2GA4B 1N9RA 5FO7B 3TSWA 4Z02A 2EYPA 3NTKA 5D7UA 2E41A 3V8LA 5FROA 4DNTB 2RQRA 5J26A 8ATCB 3QO3A 2DERA 5CQXA 2MFIA 2DYIA 1QQJA 2KCNA 3T1HL 5FJ8H 4LD9K 2F2XA 3TP8A 2F0EA 4C3JG 4DBQA 3X26B 2DAQA 4B9XA 1FGBD 4J1MA 3K59A 3QWYA 1LACA 3D4DA 3HOZH 1I4XA 4H7BA 4TVRA 2E5LL 3K81C 4AYBB 2DL7A 2OF1A 3NE5B 3S2HH 4JUVA 1EX4A 2A73B 3AYHB 4RGOS 2H3EB 4R56A 1K4US 2KRMA 3HOVB 2ECZA 3ZL7C 1VQCA 3ULJA 1O7IA 2DL5A 4ME3A 4F87A 4JLIA 3E6ZX 1Y8OB 3OMGA 2DEUA 1K9MC 4HT8A 1LTAD 1M2VB 5C4ZA 4DV6Q 4R55A 3I3CA 1YHQA 2PI2A 1OU8A 2ZXPA 2F1MA 1N6AA 2RHQB 4UAIA 2KK4A 1VQ8A 4A3FB 1LTRD 4JG2A 4K8IA 2CKKA 3FJPA 4II1A 5KYIA 4A3DB 1VQMA 2DF6A 2F0IA 1H8KA 1BK2A 1YJWA 4JBMA 2D0NA 1YHQT 1B1ZA 1TY2A 2EOTA 2JQOA 4A76A 4B3MQ 4A54A 2O88A 2NUPB 2YU9B 2P0KA 4MZPA 1VQ8T 3S14B 3VR6A 2YT6A 1ILPA 2A69C 5E4WC 4OO1G 2GBQA 1NEBA 1H3ZA 1VQMT 3VS0A 1SSHA 4J6XA 2NBFA 3UE0A 2K9GA 2R5AA 3S2DB 1YJWT 1WCMG 1AZGB 1LCKA 2K5FA 2KUMA 3VYRA 1NYFA 2MK5A 2MP1A 1PA6A 2K3XA 3TP6A 2PZUA 2A5HA 2L2PA 3K5NA 1HJDA 2MGSA 4DN4M 2ZPEB 2O5IC 3WOEA 1CTMA 3S3OA 3TP7A 3PO2H 3WDNA 4BE0A 2BIVA 1XNQQ 4A3KG 4F16A 3GTGH 4FIBA 4RG1A 1TUGB 2HIXA 3V2TA 1M27C 4M77C 3CC2A 4PFPA 1N9SA 3NTHA 2KHIA 1KTKA 2R3ZA 3H0GB 4HCZA 3Q23A 1BXTA 2XVSA 4KHPQ 3A8KE 2NLUA 4E47A 2EY2A 2DJQA 4F7XA 5AYFA 2VB3X 4GY5A 4NDXA 3ASKA 2E65A 5DEHA 4M7DA 4B3TL 2DL4A 1VQAA 3S1QB 2K1BA 3CMEQ 3RKYA 2PO4A 2CP2A 4JV5Q 2HHHQ 2JA8H 3KF6B 2K57A 5I2YA 3SHWA 2CFMA 3JV3A 4ILWA 1VQ9Q 1I1JA 4KKUA 3A1PA 1Y1VG 3OYJA 2Y0SB 1CKNA 3LGFA 2KHJA 1FYCA 2PW7A 3I56Q 4BA1I 3OS1A 4NOYA 2C0TA 2QGGA 1W4SA 1EOTA 1I5OB 4KTAA 1BB9A 3E9HA 4C8QC 2ZTCA 1VQOA 2YTYA 2JTMA 4XU0A 3QIIA 3M9BA 4DNRB 2EPBA 5IN1A 1XMOL 1X2KA 2UXBL 1UJ0A 1MGSA 3GLXA 3HKZG 3PTAA 1G8ZD 1RAIB 1VQKQ 1RLQC 2DPPB 5T1IA 5IGBA 3CC4Q 2X51A 1VQOT 3OPOA 5GAN7 2EYZA 3M4GA 1EWHA 2IT1A 4E7IA 1Q86R 2NTSA 2RSNA 4A3EB 3T16A 1T5EA 1HRJA 2QGQA 3QUIA 2K5LA 1K28A 3NENA 3INZA 3JB9I 1Q7YU 4AYBE 2G5DA 4M77A 5IT9c 4TQUS 2QASA 3JAME 3CCJA 1DJ7B 3CCUT 2MNAA 3MP6A 2OT2A 3DWQA 2YRVA 3TQ7P 4GLKA 3K7UC 2DX1A 2EGCA 5IAYA 1YNND 3AFQA 1RLPC 2HQLA 2SEBD 5IYBG 2QEJC 5CKDA 3HGBA 1G6PA 3CCJT 3V8JA 2YTXA 5EKKA 2EJGA 2AK5A 4GOPA 1JB0E 4XU3A 2L5TA 4TRDA 5GADC 5KYWB 3OYCA 1UE1A 2MWPA 4A4FA 1KD1R 2LSSA 1L1OB 3PFSA 3PUYA 3MCAB 3MHBA 1U1SA 1RF2D 3MXUA 1UUPA 4CKBA 3KJPA 2VUMB 4GKKQ 2A1AA 2CVRA 1ZBXA 2RHUA 1D1CA 1IRXA 2LRQA 2ZGWA 2KECA 3SGIA 3I9QA 4X66L 3S1MB 1GUWA 1EWIA 4N4IA 4GKJL 1YJ9T 1BU1A 3VS3A 2P4RA 4PNOA 1A2UA 1VMPA 1WTXA 1XNIA 3C0CA 2F03A 3S16B 2A6ED 2QTVA 3OYKA 2HDLA 4R4CA 2OWOA 1YJNQ 3SR1A 3DEPA 1BKBA 4PJOA 4KLKA 1D0XA 3NXWA 2FHTA 3PMTA 5CCAA 2CW0D 3QSUA 4UDUC 1M1KR 1SXTA 3EGXA 1CHQD 1VQHA 4RGMA 4BBSG 2YSQA 4JI6L 3RZOH 1HUNA 1B8AA 1D0YA 1HTLD 3GTQH 2LX9A 1EY5A 3EFXD 1HA5A 2LT1A 3HRTA 3JCMW 4HCEA 1ZUKA 1FL0A 1ENCA 4DA4A 1MIUA 4FW1A 4H44C 4PZ7A 1AW7A 5KGUA 1SYGA 3VYUA 1DONA 1X3QA 3HZXA 3FEOA 4A3BH 3BYTB 4M7DG 4G7ZC 3RESA 2UUCL 1UGSB 5I6WA 4C8QB 2VY3A 1Q95G 2RDHA 3BFMA 3CC7Q 4C92B 5JEAG 1JT8A 3VR4A 4CJ1B 1G6ZA 1YCYA 2M02A 2ID0A 4KI0A 3HOZB 1RAEB 3A8LB 1X75C 4N0AC 1T0JA 1N34L 1W2BP 3JAMi 3NBIA 4KN4C 1KIXA 3S2HB 4OGQC 4JJDA 2AQ1B 4LD6A 5IYDG 1E6HA 3BZKA 3L2UA 1FYNA 1OX9A 5FWBA 1WQ7A 2J0TD 2RB6A 1VQ7A 3ZBDA 4BB7A 4BI3A 2DJZA 5A35A 3R2TA 5BN3A 2BH2A 1OI1A 1AP0A 1UGRB 2X4XA 3RLOA 1PFMA 1HNZL 2Y0SE 2QAZA 4BWGB 3M0UA 3RKWA 1B9NA 4JJBA 3IL8A 1XYIA 1HNWL 4R9WA 2PVOB 4O0AA 2DIQA 1GXIE 4ZTFA 4O6JA 1PZKD 1VQ7T 1QG7A 2HDMA 3F1ZA 4EVOA 5I2XA 2LZ6B 1C8CA 2A74C 4C8QF 4I65A 2JTEA 4OP0A 2FRYA 4QVCA 4HEDA 1VQ5A 2D0PA 3W3AA 5IWAL 1CA6A 2AUJD 4HA8A 1JOQA 1ZSZB 2XSCA 3N52A 1AOJA 4JZ4A 1VQPA 1TS2A 4IPDA 1TWGH 4M77G 4MTNA 1D1IA 3FVQA 1JJCB 2K2VA 1JE5A 2WP8J 5ELNA 2KE9A 1E7OA 5I6YA 1EFWA 2JA6G 2K03A 4Z88A 1LOJA 3GPLA 1FNUA 1EQTA 2XNAC 4KMUC 4IFDI 1VQPT 5M3FB 4CDFC 2BOSA 1YBYA 5GAOl 2LC4A 4ORZA 4DEYA 2J4XA 3VS5A 1BR9A 4V190 2YUQA 1EZ6A 1CQFA 1F77A 2JTFA 3GP8A 4IUUA 4X65Q 3DHQA 3PO2B 2B63H 2JXBA 1O75A 3NBHA 1A63A 1M3BA 4HMIA 1NZ9A 3OYLA 3E9FA 2R7ZG 3S15H 3GTGB 5M5WH 3VA7A 1Y96A 3CPWP 1EU3A 1JICA 3ZJYC 2KSSA 4C0ZA 3G6JB 2XHCA 4MZMA 5IOCA 5FU7C 1DGSA 2QQ9A 5D65A 1PC0A 1PWTA 3TMEA 1Q81U 1OOTA 1FR3A 2F0HA 1N9WA 2JA9A 4YHHL 4DV2L 2DFUA 2VUBA 4PJOG 4NKLA 2PVGB 1FJGQ 4B3RL 2O9VA 3I70A 4OWXB 4KJNA 4K0KL 5I9OA 3I5RA 2PNRC 1IW7C 3SK8A 2MAMA 1TS5A 2HCIA 4RTTA 1KQ2A 3X28B 4C3IG 2RHXA 2E5QA 2DNEA 4HAEA 1EY9A 1M4VA 3FRNA 1A3TA 2WKCA 2KNBB 1XQHA 4OF1A 2BE5C 3R93A 4VUBA 4EX5A 5C3EB 1AWOA 3QO2A 1LT4D 2DN8A 1VQIA 5GAGC 1K73U 3M0SA 2HL3A 4IQZA 1MJEA 2NUZA 1I4GA 3OW7A 5I9PA 4DV6L 1YN8A 3MEAA 5KYNA 2A69D 2K5NA 2WV6D 2E8GA 4XYOA 3PMIA 3VV0A 4CRIA 2B2WC 1BF4A 4HCKA 2F0QA 3PVQA 4C8QE 2GFUA 3K5OA 3T1HQ 2J6OA 1M1FA 4TKOB 5CV9A 5LL6S 1TS9A 4C92E 4AFQC 3NP8A 2L55A 4NB3A 3HHTB 3SWNC 1I5LA 2NVQH 1PV4A 3HOUG 1O7YA 3H41A 1SJHD 1M8VA 1D09B 2E5LQ 3LX0A 3HOXG 4WORA 2VGNA 1RI0A 2EJ9A 5M3MB 2F0WA 3G4SA 1ENAA 1NJIR 1MJCA 4A3CG 2I2LA 1Z9ZA 3CP0A 4MIUA 1SRUA 4CHTB 5COYA 3L3OC 1B2TA 3T9NA 3H15A 2DNUA 1X6GA 1OZ3A 3QR8A 5IYCH 3KJOA 3ULPA 1M2OA 2PPBC 3CCUQ 1R9TB 1V76A 3QYGB 3G4ST 5LJ3d 2CUDA 2GTOA 2CWPA 1T3LA 5GAHC 5FW9A 4IUTA 1TTHB 2F4IA 4J9DA 5IIFA 4J9IA 2IX0A 4PMBA 4M7AA 3DWAA 4IO9A 1VA7A 4IPGA 3KFVA 1W2BA 3VR3A 2DZ9A 2W0ZA 1ESRA 3T53B 2DXBA 4YY3Q 1JXMA 2B29A 1QWYA 5FOBB 3UT1A 1WLPB 2PUKB 1E3PA 3EIVA 2CH4W 4DV5Q 2FPDA 5KYXA 3QWNA 2DXCA 4KHPL 1WTRA 2EQMA 4IN3A 3OYFA 1STBA 3A0JA 5CVIA 3I72A 3M85A 4LF8Q 1YITQ 4FW2A 3PSIA 3HTRA 2D6FA 1EIGA 2DA9A 3NFCA 2HIVA 4L5SA 4O5VA 3F2DA 2LMJA 5LJ3f 3M56A 4C8QD 1YZ6A 1MKHA 2GVBA 1YJ9Q 1G3WA 3PIP3 1C7YA 1Q86U 3UDIA 4C92D 3RNUA 2CSIA 3FC3A 1ARKA 3V8KA 4PQXA 4HIDA 1HFGA 5GJVB 4EMHA 2JA7H 1SG5A 1V1CA 1QUQA 2I5MX 4Z89A 4A3BB 1E7ZA 3PO3H 3A7LA 2JA5G 2YTVA 2CUBA 1Q7YC 4F8MA 1NTGA 1WNLA 1VQLQ 3X20B 1G83A 4IIMA 2K5VA 4IALA 1J3TA 1VF5C 3FPPA 1O7ZA 2N88A 2ATCB 2IW3A 3S17H 5CKFA 4L5GA 3CBMA 4OO1H 2DILA 2UXDL 2HQEA 4M78B 1SMXA 4B3TQ 1VYVA 3UI2A 4RCOA 4A3IH 1WFWA 4CJ2C 4MDWA 3LGJA 2KXDA 1GUGA 3EG0A 4R4IA 2UXCL 2K01A 3IQLA 4LUDA 3J80E 1CZWA 2IIMA 2VB6A 1KK7A 4FT4A 4ZGEB 4N8FA 2F0UA 5HK3A 1WTVA 4IZ8A 4DAYA 3CPWA 2WB1E 2O9SA 2P0PA 4CC3A 3RNJA 4ZUIA 1SYBA 3I2ZA 3IKJA 5GAMd 1SAPA 1UUEA 3L2ZA 2BTTA 1NMFA 2JUFA 1SYEA 2FINB 5A0LA 2RMOA 3R6OA 3QPHA 2RDFA 3HOVH 1Q46A 1UDLA 2B2TC 3LWIA 4DA2A 3BY7A 3C4SA 2XK0A 1G291 2SOBA 2JN4A 5LJ5d 2UXBQ 3OYHA 2QG9B 1TWGB 3CBPA 4M78F 3TDQA 2WAQB 4JI2L 1AT1B 3AU7A 4F7UB 4LFCL 2K05A 2N3SA 4FDBA 2EGAA 3E3XA 1WTPA 4DR5L 4JC0A 3DKMA 5GANj 2X3WD 1WJRA 2I5HA 2RA2A 2OJ2A 5GMKm 2KBNA 3EVQA 4E7LA 4IPCA 5IODA 1F9RA 4LW1A 4GKKL 5BN4A 1IB8A 1IL8A 2RDGA 5GAMf 2KY9A 4OB3B 2OTJQ 3CPFA 1Q82C 1U1TA 1NSNS 4XXEA 5BR8L 4JS5A 4E6IA 4JI1L 4JW0A 4PFOA 2GQIA 4P74A 3M59A 5J22A 3C94A 3JAMc 1QWFA 2LP5A 4M7AG 1GO3E 2A37A 3MHXA 2ZT9C 4GLXA 2B63B 3S2DH 1ASYA 4AG1C 2EY5A 4LF5L 3THKA 5LJ5f 2ZZDA 2QQBA 1V1PB 1YNJC 1SMYD 4X62Q 5M5WB 3S15B 3HRUA 2Y4XA 4IUQA 3F2BA 1JXOA 2LT4A 2ROTA 3BE3A 4ULLA 4PNYA 4ZYSA 5EKIA 4M8AA 4C3HH 1STGA 4RCCA 2JJ9A 2KAFA 4RHRA 1GUOA 4F7UF 3CMEA 2A36A 2QDYB 3RR5A 4E2FB 4FSXA 3J81L 2I46A 3TEHB 2AMCB 2I0QA 4A63B 2RJFA 2OTLQ 1AN8A 3R3OA 3FRPB 4X66Q 1C0AA 4NXNL 1ZA1B 1YNNC 2K7AA 1CT1D 3H0GH 1VQ9A 3H6MA 1PH2A 4GKJQ 3CMET 3J80i 2KMTA 3I56A 1A62A 1JQYD 1SBBB 2L0AA 2ZPFB 2KOLA 2HNIA 4A3MG 4WJ3M 4IUNA 3QOJA 1GJXA 1OXTA 5L23A 4E7HA 2TMPA 2IVWA 1FMWA 4A4GA 1FD7D 5K36G 2F5TX 2HSEB 1M90U 1GOZA 1VQ9T 5ELCA 3LH5A 3VUBA 3T56B 3WVEB 2V1QA 2XKOC 3I56T 4GN3B 3RUXA 4JI6Q 1I6HH 4DFAA 1VQKA 1B9MA 1X01A 1UE7A 2LKVA 2QDBA 3CC4A 1O78A 1JCKB 3EG9B 1YWPA 2DO3A 4OWTB 3CRLC 2R57A 3GTKH 1UEAB 1WHLA 3K57A 2A6EC 4XQQA 3EFOB 2UUCQ 3ONAB 2EKOA 5IP7G 2EQIA 3H6ZA 1T0HA 1ZKOA 4BE2A 1WA7A 1VQKT 3L9AX 3TS0A 4HTHA 2NVQB 5C4XG 2HKNA 4BUGA 3D4RA 3HSBA 3UA7A 4ZN1A 2CW0C 2ZXRA 5EKLA 3OSSC 5KYUA 4A3LG 1D7QA 4AG2C 4M78E 1U06A 1HK9A 2NVXB 4J8OA 5IGEA 4L5TA 1SE2A 4XTUA 1TY0A 2JMAA 4QY7A 2CGHA 4C0FA 1CSQA 1SE8A 2GNCA 2DETA 1PTOH 2DEQA 3FP9A 1S5FD 3KBXA 1YI2Q 1JOOA 4J9FA 1EIHA 1I0CA 2LXKA 3UDGA 1S40A 2JZ2A 1TR5A 4IKFA 2QDLA 1HNZQ 2RJEA 1CSKA 1UFFA 2HD0A 3JCMd 3AFPA 5CBAE 1SFOH 1KHCA 3ZEHA 4KBMB 3CCVT 3FDTA 5C3XA 2DYBA 1XNRL 2FRWA 5AFWA 3W1BA 2J06A 4GN4B 1ZX6A 4OMLA 3TSSA 1LM0A 1HD3A 2HSPA 1MD2D 2B2VA 5IWAQ 2K3BA 1I3QH 2ZPIB 3BDOA 4LF4L 4A4KA 1PLFA 4BY6B 3K8AA 3TCJA 2ZTEA 1YJNA 1WQWA 2WAQE 4P2CB 3K5LA 1EZ8A 2E12A 4F7UE 3KDFB 3W5OA 1JJ2P 3PVLA 5IYDH 3UA6A 1CQVA 1PH9A 1N33L 4XU2A 4EMKC 4R4TA 5GAEC 3S1NH 2YLCA 3T4AC 4DR4Q 4QCLA 1MMNA 2LQNA 1K73C 1IXRA 4KD4A 5IXBA 3VRYA 1YJNT 2RA4A 5KCHA 3JCMf 1EY4A 3B6YA 3RN5A 1QLYA 1JWMD 1HNXQ 2UU9L 4LUEA 3QJYA 5FLMG 1GCQC 4UP9A 2AKWB 2EBPA 2PZWA 2M9UA 5I11A 3MEHA 4M78D 3H0FA 3META 3BS1A 1NJIU 2JA7B 3HL8A 3CC7A 4Y52H 2VV5A 2P84A 3HFOA 3M0TA 4OMOA 5C4HA 3PO3B 3C46A 1D3BA 2RK2A 1NY4A 1FMKA 5CK9A 3SB2A 2L3RA 3ZFJA 5IP9H 3OYYA 2PNIA 4GLVB 4C1NI 4A53A 3CC7T 3S17B 1MHWC 1BOSA 6AT1B 4DV2Q 2ICIA 4LFBL 4YHHQ 3PUVA 4B3RQ 4A3IB 4HVWA 3TS2A 3QYHB 1WJQA 3KBGA 3TZDA 2ESWA 2FXQA 4CGYB 4A3JH 4K0KQ 1VQGA 2CKZB 4KKSA 1LT3D 1KLUD 2WACA 4C5HA 1N8RR 2ENBA 1TUDA 5C44H 4DV3L 4KY7A 1X69A 2M0OA 5JJKA 2EYOA 2FL7A 3JB9G 1WYDA 2M9VA 4UHVA 1BCMA 3BVZA 1RADB 4RTXA 1HJPA 1Z47A 4I7ZC 4CJ0B 1I07A 2M0YA 1SYCA 2RI5A 3EFRA 2F0VA 4DK1A 1QW1A 3A8HB 3MKDA 3HKSA 1I4RA 5CIUA 1CI3M 4KH1B 2EXDA 3UWNA 1ET6A 1VCIA 5C6AA 3JCMX 3PUWA 1SNCA 1BCOA 2K52A 2E10A 1KSWA 2Y4YA 3QHSA 2K32A 3D6CA 4ZLTF 2KEDA 1XPRA 2R7FA 1GXDC 1LLRD 4UC4A 3I73A 1Q12A 3MEFA 3DWPA 1Q86C 1H92A 2PCFB 2YV5A 2A68C 4HSPA 4J15A 1FMVA 4LUOA 3KFUA 1FWZA 2D8HA 3REAB 2RKSA 4M75B 3EGDB 3U9SA 3OTOL 2JM9A 3VR2A 3CMAQ 1A3VA 1SF9A 1ML0D 3MXPA 5CV4A 4YWLA 4YY3L 3QDFA 3I4NH 3MO8A 1EU4A 1GKHA 4DV5L 4RWSC 1RIPA 4Q5WA 2R93H 1PYWD 5DM7R 4P72A 1Y1VB 4KKTA 5A2QL 5DAUA 4XT3B 4EMKB 3OYDA 1S5CD 2F0JA 4LF8L 4BXXH 2N78A 1IHWA 5I21A 4IUVA 1OEBA 1QKWA 4POFA 3I4MG 4KY5A 2MMPA 3A98A 1AD5A 2RHYA 4AFUC 5M3FH 2HCCA 1LO5D 3GTJB 3OYMA 4YCVA 3SEMA 4DK0A 4OWWB 1FNVA 1XXGA 4A3GG 2Z6BA 2QK0A 2Q2TA 4BY7G 4C3HB 2RHSB 4A4EA 4GLAC 3ND8A 5D14A 1Y1WG 3KF6A 2PQEA 5IHNA 1RKNA 3EG3A 1ZSGA 4NMZA 3RLNA 5M9OA 2DJFC 4QQBX 4M75F 1L1OC 2EPDA 1JQQA 1X54A 2JK8A 3M3YB 4ZN3A 2MPXC 5DY9A 2RM4A 2HAXA 3S14H 2HUGA 3GTMH 1KRTA 2GCXA 5GANg 2DVJA 4JRQA 5BN5A 1Q1EA 2WIIB 4F04B 4DV7L 1M1GA 1RCVD 3V7SA 1QCFA 1G3SA 5D3DA 3ULLA 2AZSA 4LDVA 1U9RA 5A0GA 1B34A 1M1KC 1EYDA 3SHLA 5AJ3L 4UP8A 2ZJRA 1VIFA 4QKUA 3MEVA 2D5DA 2Q2IA 1R8OB 4AYBG 1ASZA 1PKSA 1LTID 4FXGC 1PVOA 1I6HB 5G3LD 2XMFA 1LTSD 1UWVA 4G7HC 3CF5A 2C9OA 2RBMA 2QF7A 4I7AA 4JRIA 1C9OA 2X69A 2ZPHB 2NYSA 3GTKB 2KVMA 1JJ2A 1W2BS 2AZVA 5JAVA 4HVVA 4IJHA 2EDGA 3H3VH 1PM3A 1M5Q1 3VRZA 4LE9A 1TXQA 3MPUB 5C3EH 3K0YA 3DB4A 1UHCA 4X64L 3OBWA 1D5MC 1C4QA 4IURA 4C92C 2PVDB 1N5ZA 5GAN6 2SNMA 1KABA 2D62A 2UXDQ 3J81E 4DKAC 4A3DG 1NNXA 2BDNA 1OXXK 3CW2C 2NZHA 4PK4A 2E3IA 3PIO3 1RTOA 2CP6A 1I4HA 2KYMA 3CCUA 1Q3LA 2ZPBB 3FMCA 1PFNA 2LS01 4OVAA 3IAYA 1G2TA 1YNJD 3PV0A 3L0OA 1PTOB 5I4DA 2UXCQ 3I91A 2NZ1D 4HT9A 2TSSA 5KNBA 4BBSB 1VQFA 4DK6C 3VU3C 4IFDG 4DR1L 1KC8U 5D3IB 2JS2A 2LVMA 2V1CC 5M3MH 2CDTA 3E2UA 3D7SB 1SFOB 4LUVA 3PNWC 3DLLA 2EJMA 1EY0A 2K14A 4AQYL 2PQWA 2JA5H 4N4GA 3P20A 4JRPA 2HQHA 1H9SA 3REBB 4DR6L 2ZXOA 1OTCA 3OIQA 4C2MB 2HT1A 4NW2A 1I3QB 3MJXA 1DM0B 1R9TH 1PH3A 1VQ6T 3NK9A 1YITA 4L8JA 4X62L 2FMMA 1ZSZC 3DLMA 1LJOA 3CCVQ 2XWJB 3QIAA 1M90C 2RVLA 1D0ZA 4JI2Q 1AE2A 2Z1CA 3JCMQ 3CCEQ 1RHPA 4LFCQ 1YJ9A 1VOMA 4HCSA 1S5ED 2RF4A 4DR5Q 4M75E 3D8GA 4D6WA 1PTOF 2KA7A 1STEA 1AZEA 1LTTD 1R0BG 1H641 1TUCA 2DGYA 1YITT 3S1NB 1JOKA 2CQAA 1OX8A 2K4KA 1DOMA 1TT2A 1CKBA 2MJ8A 1WTQA 1NPPA 1LABA 2ALYB 2A3LA 2H5XA 3CPWS 5CV6A 3J80L 2O31A 3GF5A 4FL6A 5EC7A 1E2VA 4C8QA 4JI1Q 5BR8Q 2CCZA 1K8OA 1Y14B 1VQLA 2QILA 2CZ7B 1ET9A 1IYVA 3E5SA 4LF5Q 2A28A 2JOYA 4J83A 1PZJD 1V8QA 4J6HA 1PCXA 3P8BB 1EIFA 2XU8A 1C48A 4XIGS 1NUCA 3E9IA 3D3RA 3EG1A 5GANe 5KCOA 2RQWA 2F0OA 1XJWB 1VQLT 1BBXC 4R8NA 1EL0A 3TSZA 4OHJA 4MMLA 4QUFA 2XIWA 3L7ZC 5C5LA 2HZYA 4UP7A 5CO7A 1K1ZA 1SDFA 3J81i 1B44D 3HOWH 4EMGA 2EJFC 4LF7Q 1Q82U 1E1TA 4OO1I 4KHVA 4E6RA 3HOYH 4EQNA 4A3JB 4NXNQ 2V8JA 2YRCA 2MQHA 3J7A5 4BY1H 1SMYC 4ZKCB 2EVBA 2PI2E 4KY6A 2VASA 5C44B 5D6XA 4GOPB 2SRCA 1S72Q 3KK7A 1PH8A 4KUDK 3QXEB 5GAOp 2E6NA 1W6JA 4CKEA 2RI3A 2WFWA 4LNPA 1R77A 4M75D 1V1OA 1RUWA 1Y7XA 4B6MA 4LDXA 3DM3A 4PJNA 1GVPA 1UECA 2LTOA 5EG2A 4ANJA 2DMOA 3F2CA 4OMFB 1QVGP 2WSCE 2NB0A 3S3NA 2KVQG 1Z6HA 2QTXA 4HJ7A 1E6GA 1Y8NB 4BS9A 2H3JA 2DBKA 4U68A 1P92A 1R0CB 2L8DA 1KL9A 1ZEQX 3BDLA 4KGVB 3BVMA 1PD1A 2OTJA 1MMDA 5I22A 1A0NB 3F8TA 3S1RH 2L3PA 4RG2A 4X1VA 2I07B 4C92F 4LF6L 4CC2A 2SDFA 3EGXB 5C5MA 3I4NB 4XTYA 2JXMB 1YHAA 1NJIC 5C4JH 2R5MA 2ZCFB 4X34A 2JVVA 1U4LA 2R93B 2VUMG 2M1HA 2O2OA 4RG8A 3LX7A 1AWWA 2OTJT 3H9NA 2MI6A 4QW2A 2E2JB 4JOIC 1KQ1A 1TS4A 4BDYA 1NE3A 1WGSA 4DR4L 2L0CA 1YNXA 2PQAA 3CQZH 1VQMQ 2ES2A 5DNFA 4QL5A 3PE0A 2NN6G 2MWOA 1S1NA 3FKIG 1N8RU 2PTKA 1HNXL 4WRDA 2EQJA 2OTLA 2MIOA 1YNZA 2RHIA 5GAN5 5C0XG 2EKHA 1KAAA 1CZGA 1I50B 4X9DA 1WFQA 3RD4A 4J9HA 2DVEA 3LYIA 3VS6A 3DM1A 1UGPB 1EY6A 4N0AA 1BCPC 1G3YA 2KDSA 4EIKA 4DU9A 2ICEC 2IHEA 4K8JA 4LK1C 2B8GA 4LF4Q 4GBQA 1J8IA 1BVSA 1OXSC 1VIEA 2CT4A 1W6KA 5H1SE 5M5XH 2OTLT 3A74A 2Z9HA 1X9NA 3GTMB 3CCMQ 4K6DA 1NBWA 1BNZA 7AT1B 3HEJA 3C12A 1MNEA 4D8KA 3CKIB 1N33Q 2JE6I 1KRSA 4C8QG 1KIKA 3RMQA 3GBQA 4DQ2A 3LNNA 2Q8TA 5FJ8G 4WTOB 1EY8A 1HXYD 3JCMb 2NYZD 4EDUA 2GFAA 1V43A 1MSHA 3EG2A 2IHFA 1AWXA 2CS7A 4DBFA 4E7KA 3GDEA 2UU9Q 5A2QE 4V2SA 4YWMA 1AZPA 1ZXTA 1WI5A 4MZ9A 2QQAA 1U0LA 1V1QA 4V0BA 4ME7A 1T3SA 4A93H 1TG0A 2A68D 4ZGJB 3PIPA 2KR3A 1PTOD 4AMCA 5FU6B 2LCSA 4G57A 2R92H 2AHOB 3KF8A 1UNSA 4WCIA 2Z6KC 2IPOB 2GN5A 1FNWA 1NCVA 2D9UA 2L3QA 2EVRA 1YI2A 2FFKB 4LFBQ 5LHY1 2F0MA 4BE1A 3IFTA 3NEMA 4M78C 2C06A 3NBHB 3TBIB 2P4TA 2XRSD 1E0BA 2RF0A 2MUYA 1N36Q 2K3YA 4QIWB 4BBRH 2ZM6Q 5EPKA 1BUVT 2AQ2B 1Z9FA 3BJUA 3N5BB 1KNAA 5FLMH 4K5VA 4DV3Q 2KGTA 1YI2T 1SRLA 3PGGA 1PDQA 3U4ZA 4G4KA 3GTOH 1MMAA 2NVXH 1QVFP 1K0SA 3EAEA 2E74C 2F0LA 5ELDA 2PUOB 1SNMA 1EEID 2NVYH 2BKDN 5IGDA 2X35A 3M54A 3GTLB 2FPEA 4L6V5 2EQUA 3OW2P 1QILA 2JA5B 1YIJQ 1ABOA 3RKXA 1JRIA 3O5ZA 1KNEA 1K3RA 1L0XB 3M4QA 2JSOA 3PO2G 3RR6A 4QMGA 1M30A 1QNKA 3ME9A 1NEGA 5LJ3h 3MFYA 4CDDC 2ZJPA 5GMKh 1LTLA 3QBYA 4FYWB 1BCPB 1W6XA 1PNJA 4K2KA 1JORA 1ESFA 2V1RA 3P8HA 3CCRQ 1VQ6Q 3JCMe 2CP3A 2RQTA 4IPHA 4C3JH 3OTOQ 1GUNA 2OX7A 1CKOA 3GV6A 2F3VA 4NS5A 4OMPA 1LPLA 1PRMC 3FIFA 4PG3A 4HJAA 4IIOA 1WJJA 5D6YA 4M4ZA 1WVLA 1F9QA 2MPMA 2CP0A 1KDAA 2Z6KA 2B2YC 4X3TA 4FF3A 1QVGA 4OB2B 1VF7A 4XTCS 1Z9QA 3RMHA 4PJMA 1HUMA 3S9WA 5IHKA 1CKAA 4A4HA 4C5EA 1Q8IA 2JA8G 2XDBA 4JBKA 2R6GA 5CYUA 2B2WA 5GANh 2HD3A 2CYZB 1TU2B 4BDZA 2K5WA 1WD0A 1CHPD 2WB1G 2BE9B 2EGEA 2NWMA 3G6EQ 1IKLA 1EY7A 3SWNA 2XG8D 1QZHA 3NTIA 5ECAA 4JI7Q 2E4HA 1BCPF 2EY6A 2VYTA 2K7VA 2L4NA 2D8JA 1HZCA 3R2IA 4CBVA 3HOWB 4DR7L 3JCMP 1DD2A 1BI0A 3H0IA 4Z8AA 1JBMA 1PRLC 2AKKA 2NTTA 1KC8C 3DUZA 3HOYB 1PXUA 3PF4A 5J39A 4BY1B 3H09A 2K5QA 4LAAA 5GQOA 3OSVA 2EYHA 4QB4A 4EQOA 4DV7Q 3C2PA 4DR3L 3D6WA 2XDPA 4GLMA 1AFPA 2XWBB 2X4YA 4M7AB 3JCMc 1HSQA 2PMZB 3K5MA 1HR0W 3A8JE 1QB5D 3L2RA 1WCMH 5HCKA 2P5ZX 1KD1U 1IYUA 4BD3A 5CV8A 1VS0A 5IGGA 4KRTA 5AJ3Q 3R6NA 4BI4A 4F7UA 1QZGA 1A2TA 2J7ZA 3OIPA 2LCLA 5IH2A 3JB9J 1OPLA 2EYXA 5AT1B 3FJ5A 5KYYA 5GMKj 5LJ3j 1QWEA 3OA6A 3K0XA 1Y1WH 3TZUA 2L11A 3HRZC 4KV6A 2VL6A 4PLLA 2KROA 4XTWA 3CMAA 1BDOA 1ZYRC 4DGZA 4A3KH 3X3MA 5KIXA 1CUKA 2Z0SA 3NWSA 5GAMh 1JMCA 4J9EA 1B70B 3BDUA 2B2YA 1AZQA 3LH0A 4DV4L 3S1RB 1II3A 4X64Q 2E76C 2JJQA 5FLXL 1QNUA 2D1XA 1D1BA 1M1KU 2RN8A 3M55A 1PH5A 2LQWA 3TN2A 4C56C 3CMAT 1V1PA 5C4JB 2F0KA 3FHWA 5IT9E 4M7AF 1SYFA 5LJ5h 1JB7A 1BBWA 3M4PA 1GHJA 2QQSA 4QIWE 2XIDA 3EFSA 1QUQB 2FZGB 3J81c 3X24B 2NUTB 1TH7A 1GBQA 3BZDB 1QMCA 4J9BA 4RKLA 4GNXC 4OMMA 5HK0A 2HDAA 3CQZB 4DR1Q 4QGUA 3NGPA 3UATA 4ZK9B 1SHFA 3OHXC 3W2DA 4IUPA 1Y1VH 3SEBA 5CBEE 5JVH3 4AQYQ 2H1EA 4UPAA 1LYLA 4BACA 1UAPA 4YCWA 5FKAC 1JJ2S 1GFDA 1ZA2B 4DR6Q 2RQXA 3HPWA 1HTPA 3ULRB 3QDRB 5C4XB 3C3LA 1IYJB 2D0OA 4A75A 1Q90A 3MWYW 1U3OA 3GTJH 2EWNA 3QOLA 4Y91A 1Q1BA 3CU7A 5M5XB 3Q6SA 1G91A 2JS0A 4BY6C 5KYLA 3KUFA 1H9MA 2AT1B 3VS7A 1SYDA 3NELA 4HN7A 1BIAA 4UY8C 4A3BG 1JJGA 3Q8DA 1FXXA 4QQGA 3URYA 5IXFA 2UUBL 1QVFA 1SROA 2WINB 3EG9A 2E3HA 3LWHA 1EUJA 1WZOA 1GUSA 4XQ3A 1JWSD 3AT1B 2BH8A 4ODGA 4QUCA 3VYSA 4B3SL 4LF7L 4FXKC 3M3YH 3CAMA 5EPJA 5CKEA 3S6WA 3OW2A 5E7NA 5CKBA 4KHZA 3MC0B 5GAN4 2ATWA 4K14A 4LDUA 3CCST 4JI8L 3KYHC 2KT8A 5CV5A 2KRNA 1TVXA 2DNCA 4TSSA 1LTGD 2B2TA 2IX1A 3GTPB 4YIJA 3OS0A 3MVVA 4DAVA 1RODA 5GAMj 3PCOB 4A93B 4DUYL 1STYA 1SNQA 5IYBH 4JJNK 4HJ8A 4L5RC 1PKTA 4XDXA 2CREA 3M5AA 1R4QB 2R92B 1UB4A 4NL2A 4ZUJA 2MO0A 3H3VI 2B39A 4N9PA 2DL8A 5LJ5j 3MXNB 1EYCA 1Q7YR 2YWWA 1JEGA 1W70A 2DXTA 2EYMA 2VXWA 4LDYA 4D8DA 4FF4A 3UE1A 4Y7NB 2AKLA 4R0KA 5CAIA 1TU0B 2Q8IB 1AVZC 3C95A 3OQ5A 4RFBA 4JK1C 2VC8A 2WAQG 1N8RC 1KQSP 4BBRB 2HEQA 4F7UG 1ABQA 1U4RA 4DXFA 1L2FA 1SSFA 2KENA 4JI4Q 1HZAA 1EQRA 4M7AE 4C0DB 3OYEA 2PMZE 4R8IA 2CWAA 3GTOB 2PNHA 3P75A 2DRKA 2HCKA 1VQDA 5JOBA 3NQIA 1BCPD 2AIRB 3I7FA 2F0PA 2NVYB 4POGA 4EGVA 2JP1A 3T13A 2F0FA 4FSSA 1WTOA 2JW4A 2MYSA 3CCVA 3AMUA 4F88A 3EH2A 4KH0B 4OMNA 1VQ4Q 3L42A 1K83H 1KAWA 4GNXB 4BBSH 1M4ZA 2L89A 4IFDJ 1PZID 3CCEA 3SDZA 2E2HH 2G3RA 1PYSB 4L5QA 2OQKA 1J5EL 3PF5A 2B63G 1PH4A 2PZTA 4RKBA 4FF2A 3NMZC 1CFMA 2RNAA 2Q2HA 2ABLA 4KN7C 2PW5A 1IL2A 1Q8KA 3H91A 1PG5B 3JCMh 1X6OA 3VS2A 4XK8E 2EQSA 2EAYA 2HKQB 1LTBD 4K6LA 4YCUA 1NBEB 3CCET 1ICWA 2VQFL 5JPMC 1ICFB 4C2MH 4C3JB 5EBCA 1PSEA 1A15A 1JB3A 4LF6Q 5JEAH 2FEIA 4PZ8A 4M75C 2O2LD 5G3LF 3V7CA 3M7NA 3CRKC 4KT0E 4DAMA 2O4XA 1SHGA 2SEMA 4MTKA 4TVAB 4GZYC 1WX6A 1MNDA 2VXEA 1V29B 2CQOA 1A3UA 1J9OA 1TWCB 1NE8A 4LFAL 4DV0Q 1Y69U 3I55Q 2KCCA 1I81A 2XGTA 5KYUB 4C5IA 1W3SA 4HMJA 3OBYA 4B9WA 2Z0WA 2XD0A 4Y92A 2F52A 1Y57A 1KFZA 2E2IH 3H0HA 2F4VQ 1EFNA 3CD6Q 3HFZB 1WHJA 3CQTA 2LQKA 4M7AD 1E2WA 1L0YB 3OSOA 4OL7A 5L37A 4L6TB 2X9HA 2QA4Q 2IX3A 1UJYA 3HRSA 1R4PB 1CKMA 3NQTA 1CK1A 3VR5A 3FDRA 2LNVA 1S72A 1X3EA 3P8DA 4ESRA 4PMCA 4FF1A 4HIOA 2UUAL 1N27A 4WFN3 5NUCA 1WPYA 4FYXB 1H3HA 4LN2A 1UHFA 1DYQA 1BIBA 1G5VA 4OXPA 1G2SA 2JA6H 3VA5A 1XNRQ 1M2VA 1K0XA 1U4PA 1S72T 1WCMB 2RJCA 1AEXA 1JR0D 4C5GA 5CR3A 5JEAJ 1N36L 5C0MA 1B7TA 2DY7A 2FZKB 2ZM6L 4BY7B 5C0XH 4M75A 2BCOA 3EGDA 2B2UC 5EBDA 2Q2UA 1Y1WB 5IYCG 5CV7A 3HFNA 2KXCA 3CXCA 4Q5VA 1U5KA 4P5NA 1GRIA 2CZ1B 4J6YA 5D6WA 4AFSC 5C3WA 4A3KB 2R7ZH 2L15A 4AH6A 2NUPA 3EH1A 2DLPA 1PH7A 1E2ZA 2RPNA 5GMKl 1WDXA 4EMKA 1ZBJA 4KD3A 4QF4A 1HXDA 3PGZA 1TOVA 1YHBA 3CEYA 1H9KA 2A0FB 3J7YW 2A08A 1O80A 2VQEL 3EN2A 4HKEA 4ZCKA 2K50A 3NPFA 3V96A 4ME5A 3N6RA 1TWAH 3J7AV 2E6ZA 1KG1A 5FO8B 4RH6A 4ABNA 1A6XA 3BDCA 4DPGA 1GCQA 3QJ6A 4L59A 1F2YA 2IL8A 3T1YL 1D3BB 1X2QA 4XYQA 1CA5A 1PTOC 5JVG3 1SNDA 1DXMA 5CR2A 1YEZA 2L3SA 3O8VA 1MBYA 2M2LA 3OWFA 2JN0A 5JJZA 4DV1L 3KLWA 3K58A 4G7OC 1GCPA 3PIOA 2L9HA 2CZ0B 2DD5A 2SNSA 4C3IH 2YHTA 1MGQA 3VDYA 1EZZB 1IBLL 1IBML 3J81j 1I94L 1PFSA 1VQEA 2O5JC 2E2JH 3VS4A 2K6AA 4M7DC 2FPFA 5LJ3g 1Y07A 1U8RA 3RERA 3L1AA 3CCMA 1KDBA 1HR0L 3OYGA 4LF9Q 1DZ1A 4CI0C 1Q81R 2JA7G 4OB0B 1X32A 1STNA 5CQYA 1MSGA 2R7DA 1NAPA 1KQSA 5C0XJ 3PT9A 3PO3G 1LT5D 2F0SA 1K8AR 3HKZB 4P73A 5KE2A 1KD1C 3FEWX 1SJED 1NM7A 1I50H 3CCMT 1C6VX 4X6AH 4JI7L 3WOFA 1WOCA 3M4OH 2B2UA 2K5DA 3RZDB 2OCEA 2QW7A 4EQPA 4RA8A 1MUZA 5FLXE 3HOUH 1XMQL 2V4DA 2EYYA 1HA6A 3ITPA 2LJ1A 3HOXH 1PRTC 2CP7A 4A3IG 1D8LA 5LL6X 4E7SA 3E1SA 4OMQA 1F2LA 1VMCA 4A3CH 5L8RE 4RMOA 2QGFB 3SXHA 1K73R 5GAOn 1ZYRD 3MEUA 3EGUA 4NPSA 3P1HA 4HXJA 1SN8A 5GROA 2EYWA 1GL5A 1RTNA 1UE6A 2DY8A 2K5HA 5DM73 1G2BA 4RKUE 3E0EA 3CCSQ 1PFBA 2BA1A 1DOLA 4APVA 4RCBA 4LNQA 1NG2A 1WD1A 1X65A 4DNIA 4B08A 1JO8A 1VQNQ 1B3QA 3EQLC 3LWUA 4HR7B 2QKIC 4N9TA 4NXMQ 2J6KA 2PZ1A 1NLOC 5CGKA 4RTVA 1WI7A 3R8BA 2IG0A 3HOVG 5KE3A 5GAOm 4DK3C 2NVTH 1ZUYA 4DR7Q 1G3TA 4RGTA 2KJXA 1HQRD 2CH4A 5CKHA 2F0DA 5DLOA 2BZXA 2LNHB 4ZQ3A 1K9AA 2B86A 4FYVB 2C0IA 2YDLA 2KT1A 2K04A 2C0OA 1B50A 3CC2T 1XWEA 4DR3Q 2ROLA 4A3FG 2IJ0A 2EJGC 4M75G 1HCZA 1IO6A 3Q0AA 4HJ5A 1QVGS 4IOCA 4GOPC 1YIJA 4MHEA 4FXDA 1NMGA 4JLGA 3GV3A 2C35B 1RL2A 1TIID 1RJTA 2LCCA 3BG3A 4QQDA 3SK6A 5KYWA 1K83B 5ELFA 3LW5E 1P8LA 5GAMg 3CHBD 3A5UA 4JZ3A 1IBKL 3T51B 1L1OA 2E2HB 3TEEA 4ELYC 1YIJT 2B8AA 3JB9D 3PUXA 4BA2I 3J80c 1AH9A 2DTHA 1GM5A 3CCRA 1VQ6A 4LDWA 1HPCA 2OI3A 1RACB 2LX7A 4M7DB 3GTLH 3HP9A 1X56A 1AHJB 1SKUB 1B34B 5LJ5g 4DEXA 4PJOC 1A8VA 4JBJA 4DV4Q 2XI9A 2DE0X 4C3HG 1K9MR 4OIJA 4PLIA 4J8QA 1JU5C 2OQ0A 2ED1A 3CCRT 3VS1A 2NUCA 4K11A 9ATCB 2LY7A 3UPUA 4LJZC 4PMWA 3OYAA 2JT4A 2QEXQ 1MI2A 4KJOA 3SVMA 2Q8RE 2F0NA 3H0GG 1CKNB 4QJFA 3RMSA 4LWCA 1AE3A 5LJ3e 3QG1A 1XJVA 4ZAIA 5GMKe 1OU9A 3G6EA 2HQXA 3CCQQ 4FU6A 3M57A 4HCCA 1D1KA 1B7YB 4FCYA 1WXTA 1E1OA 1PRTB 3GQBA 4H13C 1GUTA 1U4MA 2JNGA 5ELOA 3KUPA 2WSEE 1PD0A 2E2IB 3PQIA 1X27A 3MXGA 1KJWA 4M7DF 3G6ET 4CKCA 2OAWA 2YUNA 4C92A 1IGUA 1WHKA 1I4PA 1RAHB 2RD1A 2DKGA 3G71Q 3JSCA 1G8XA 1G51A 4JI0L 1FX7A 5T1GA 3HKZE 2Y0SG 2IWHA 5K5PA 2AUKA 2ZJQA 4FYYB 5M5YH 3K7AH 2G9HD 4M77B 3M7GA 2RQVA 2MF2A 1BI2A 3I35A 3G1JA 1SEMA 2G6FX 2UUBQ 4FYDA 2JA6B 5IT9L 1H9SB 2CSQA 2JM8A 3OB9A 4B3SQ 1TWHH 1QVPA 3URGA 2RI2A 3CCLQ 1PRTF 4JS4A 2FJ2A 2M00A 1TQOA 8AT1B 4LUZA 2KCTA 4JI8Q 3M9QA 3FKIB 4OEMB 1TWFH 3U4VA 5LMUQ 1K8GA 4OGCA 1I6VC 1P16A 1XTDA 2VZAA 2IPKD 2R61A 2V8IA 2YYZA 4DUZQ 4A3EG 4JI4L 4DR2L 2B8FA 3NWTA 1ZSZA 4JPBW 4X3SA 5EGTA 4DUYQ 1YP5A 2XRQD 4AIMA 1TSFA 2R7ZB 1B53A 4U673 2RCNA 4PFZA 4KUIA 3H3VC 5FU6C 1SNPA 1AEYA 3EBEA 4ALPA 2A6HD 4NP5A 4M77F 3BYYB 5IHIA 1NR4A 1XPOA 2DUDA 1DJRD 1EEFD 4MN3A 4H0LC 2QXFA 5C44G 4XQNA 1TWAB 2X3XD 1QVFS 4LMQD 4XT1B 4RTUA 2RO0A 4PJOB 2Y90A 1N32Q 2K33A 2BDOA 1Y71A 3TREA 3OW2S 2OEOA 4M1UB 5GAMe 1F2MA 3M0QA 1U5SA 2MHVA 1M8MA 1C0MA 4A3MH 3QKJA 1EWCA 4O2DA 4JYAL 1RABB 2DTIA 3FB9A 2JEAI 1RAFB 2L5QA 4C3IB 1LUZA 5K36H 2FG0A 1WTHA 3W1GA 4RTZA 2GQVA 3Q24A 1EQQA 1XPUA 2FYKA 3OY9A 5LJ5e 2KHSA 3OWEB 3JCMg 1J6QA 4XTZA 2X4WA 4DV0L 2E70A 1L0WA 2EJFA 1XX8A 1J5EQ 1X43A 3EROA 2AHJB 2YRDA 5I2MA 1JE4A 4R4QA 1D6EC 1KDCA 4GS3A 4JI5L 2COYA 4M7DE 1HQMC 3SK5A 3STBC 4OX9L 3H8ZA 2F4VL 1S5DD 1YVCA 4PJOF 1LVKA 3JCMV 5IP7H 5LMNQ 2VQFQ 3M4OB 4J5YA 2FMCA 3OS5A 1OZ2A 3AHUA 5C4XH 5IP9G 1M90R 3O13A 3HOUB 4L63B 5GAOr 2DIGA 4A3LH 1VQ5T 5ELEA 2GGRA 3L2PA 4RHSA 1OPKA 1GBRA 3HOXB 1KHIA 1YHQQ 4N8X1 4A3JG 3A56A 5EQ0A 1FVIA 1K3BC 3X25B 1JC7A 3OYBA 2EE1A 3BVGA 3OMCA 2DTOA 4C0GA 1VQ8Q 4DF7A 4C92G 4DBRA 4JI3L 3U58A 1MMGA 1STHA 1X55A 1VYUA 5KH6A 4LFAQ 3Q1JA 1I4K1 1SE4A 1QCNA
chains in the Genus database with same CATH topology
4JRKA 3RLFA 2A8VA 5A0DA 1MHNA 3MP1A 3SD4A 3GTPH 4N4HA 4FT2A 5LMNW 3AEVA 2YLBA 4MNOA 3MEWA 4ZGDB 2LQ8A 2PQAB 4M77E 4JOIA 3BW1A 1X3GA 5HGQA 2UUAQ 3KXTA 4NL3A 1HZBA 2AWNA 1VQ4A 1K8AU 1A0IA 4M7DD 4WF2A 4EQ5A 3I4NG 4Y7NH 4M7AC 1M9SA 4MZTA 1K0RA 2V8KA 2MO1A 2R93G 3S24A 1Y96B 4E7JA 1VQ4T 3ERSX 4BXXG 2FB7A 4BI8B 1BYMA 3A8GB 2LXJA 1UEBA 5M3FG 2X4JA 3HOZG 3U50C 1EYGA 1S3OA 2CZ6B 2RH2A 4LF9L 2RHZA 2D0QB 2VQEQ 1QVCA 2WSFE 3M53A 3E19A 1EOVA 4PJOE 3I55A 5FRMA 1T9HA 4JCVE 2M16A 3ER0A 4PKCC 3T1YQ 3D31A 4B3ML 4OB1B 3CD6A 3KF8B 4DV1Q 4IJLA 2QA4A 4M77D 3I55T 3JB9H 5C6SA 2OAUA 1VQJA 1IBLQ 1IBMQ 1I94Q 3CXCS 2IY5B 3V7RA 1HR0Q 3OYIA 3CD6T 1TWCH 3QZ9B 2QA4T 4OONA 4M78A 3A8OB 2GVAA 4P71A 5GAOq 3VJPA 2K4YA 1PH6A 1XNQL 5GAN8 4NXML 4FM4B 2NZOA 5C3EG 2GF7A 5FU7B 3J7AF 3J7ZC 2VW9A 2D9TA 2F5KA 3VUZA 2JEBI 2VXFA 4JBWA 1I5FA 3D0FA 2E1HA 1XMQQ 1K9MU 5GANd 3WWVA 5FLXc 2NN6I 2HBPA 4PZ6A 1BBUA 5C0XI 1PH1A 2XICA 4JV5L 4PJOD 2HHHL 1IREB 3I4MH 4X9CA 4J6WA 5FRNA 5M3MG 2KCMA 4A3GH 4MMKA 5EAYA 2E64A 5I2SA 1PHJA 1KQSS 4DOVA 4BY7H 3OYNA 3G48A 4EPCA 4XTVA 5DLQE 5GANf 4ZTJA 2VNUD 2QQRA 1SLJA 1VQBA 3BZCA 2QI2A 3L2WA 4QQ6A 3KOJA 1SR3A 3SWNB 2DZCA 4C0DC 3SFMA 2PU9B 1I8FA 2ZPGB 3JCMJ 3GO5A 3GNGA 1IBKQ 3TRZA 2EQKA 2AWOA 4H02A 1NPRA 3G7ZA 5HKCA 3GD7A 3QZ5B 2XTIA 1XMOQ 1V9PA 3S3MA 3RN2A 1H95A 4J7FA 5GAN3 4A3FH 3GOXA 5JJLA 3HOWG 4HIKA 4OGEA 4DAYB 4A3DH 4QVZA 3HOYG 2DXUA 3RIRA 3CCSA 2BUDA 4BY1G 1E24A 2ASBA 3TU4K 3VKIA 1UE5A 3RZDH 3GIBA 2YU9H 1VQNA 1BI3A 1HH2P 4J7IA 3UDXA 4RMFA 2K5IA 4M78G 3OS2A 4A4IA 3WVDB 5IE8A 5LMUL 1OXUA 1IZ6A 4DUZL 4ELZC 4IOAA 1VQNT 2N49A 3F70A 3UDFA 1EIYB 3E9GA 1XOVA 3A5ZB 4JI0Q 1GD7A 3VYGA 2DK3A 4JDSA 4ATOA 3L2QA 1OXVA 4GNXA 3UDCA 1BI1A 2A7YA 2O01E 3JRZA 1ZHIA 3ICEA 3DB3A 2FVUA 1PSFA 2RJDA 1N32L 3VYHB 4WJ4A 3S1QH 3M4YA 3STBD 3L2VA 1E22A 4DR2Q 1FGUA 3FLGA 1CSPA 2BA0A 3A8MB 3KDFA 4R4OA 2VGMA 3I4OA 1X3FA 2QEXA 2EYQA 1OYXA 1QP3A 2KQWA 5J3BA 5JJIA 4YTLA 3CC4T 3BU2A 4MDXA 4QVDA 3LGLA 3CCQA 2A19A 2R58A 4P75A 4DOWA 2QEXT 1N34Q 2F3IA 5LMNL 2F69A 3WXMB 4HIMA 4KULA 4JYAQ 5HY6A 3PUZA 3CCQT 4A3EH 3G71A 3AQQA 4HJ9A 1Q81C 2K75A 1HNWQ 2DD4A 3LLRA 3M58A 3G71T 4GN5A 4X65L 4A93G 4XAXB 1K8AC 4JI5Q 1KXLA 2EIFA 3CBOA 4OX9Q 1UGQB 3MP8A 2N8NA 1LNXA 2FHDA 3CCLA 2R92G 1ZQ1A 4HCBA 5GMKi 5IY0A 2VS1A 1O9SA 3IRBA 3JB9F 1WJSA 3CCLT 2VUMH 1FJGL 4XTXA 4BBRG 3S1MH 2LDMA 4XU1A 2XDDA 4JI3Q 3JC66 3K80C 2ZTDA 1VUBA 2P0QA 1HZ9A 3S16H 3GNFB 4PL6A 1PYBA 4YWKA 3TQYA 1TXYA 3FKIH 2RK1A 2O4XB 1QP2A 2EFIA 5GAN2 2I5LX 2B3GA 4R1JA 4Y28E 1N9RA 4Z02A 3NTKA 3V8LA 2E41A 5FROA 5J26A 3QO3A 3T1HL 5CQXA 2MFIA 5FJ8H 4LD9K 3X26B 2DAQA 4B9XA 3HOZH 4TVRA 2E5LL 3K81C 3S2HH 4JUVA 3AYHB 4R56A 1VQCA 3ULJA 1O7IA 4ME3A 4JLIA 3OMGA 1K9MC 4HT8A 4DV6Q 4R55A 1YHQA 2PI2A 1N6AA 2RHQB 2KK4A 1VQ8A 4JG2A 2CKKA 3FJPA 4II1A 1VQMA 1YJWA 4JBMA 1YHQT 4A76A 2JQOA 4B3MQ 4A54A 2P0KA 4MZPA 1VQ8T 4OO1G 1H3ZA 1VQMT 4J6XA 3UE0A 2R5AA 1YJWT 1WCMG 2K5FA 1PA6A 2K3XA 2ZPEB 3S3OA 3PO2H 4BE0A 2BIVA 1XNQQ 4A3KG 3GTGH 4FIBA 4RG1A 2HIXA 4M77C 3CC2A 1N9SA 3NTHA 2KHIA 4HCZA 4KHPQ 2NLUA 4E47A 5AYFA 4GY5A 3ASKA 2E65A 4M7DA 4B3TL 1VQAA 3RKYA 4JV5Q 2HHHQ 2JA8H 3KF6B 2K57A 2CFMA 1Y1VG 3OYJA 1CKNA 3LGFA 2KHJA 4BA1I 3OS1A 4NOYA 1W4SA 3E9HA 4C8QC 2ZTCA 1VQOA 2YTYA 2JTMA 4XU0A 3QIIA 3M9BA 1XMOL 2UXBL 5IN1A 3HKZG 3GLXA 3PTAA 2DPPB 1VQOT 5GAN7 3M4GA 2IT1A 4E7IA 2QGQA 3QUIA 2K5LA 3NENA 3INZA 3JB9I 1Q7YU 4AYBE 4M77A 5IT9c 4TQUS 3JAME 3CCJA 1DJ7B 3CCUT 2MNAA 3MP6A 2YRVA 4GLKA 3K7UC 5IAYA 3AFQA 2HQLA 5IYBG 5CKDA 1G6PA 3CCJT 3V8JA 2YTXA 2EJGA 4GOPA 1JB0E 4XU3A 5GADC 3OYCA 1UE1A 2MWPA 4A4FA 2LSSA 1L1OB 3PFSA 3PUYA 3MCAB 1U1SA 3KJPA 4GKKQ 2A1AA 1ZBXA 2RHUA 2LRQA 2ZGWA 3SGIA 4X66L 1EWIA 4N4IA 4GKJL 1YJ9T 4PNOA 1XNIA 3OYKA 4R4CA 2OWOA 1BKBA 4PJOA 4KLKA 3PMTA 5CCAA 3QSUA 1VQHA 4BBSG 4JI6L 3RZOH 1B8AA 3GTQH 2LX9A 2LT1A 3HRTA 3JCMW 1FL0A 1MIUA 4DA4A 4PZ7A 3FEOA 4A3BH 4M7DG 3RESA 2UUCL 1UGSB 4C8QB 2VY3A 3BFMA 4C92B 5JEAG 1JT8A 1YCYA 2ID0A 4KI0A 3A8LB 1X75C 4N0AC 1N34L 3JAMi 1KIXA 5IYDG 4LD6A 3BZKA 3L2UA 1WQ7A 2RB6A 1VQ7A 3ZBDA 4BB7A 4BI3A 2DJZA 2BH2A 1OI1A 1UGRB 2X4XA 3RLOA 1HNZL 2Y0SE 3RKWA 1HNWL 2PVOB 4O0AA 2DIQA 1GXIE 4ZTFA 4O6JA 1VQ7T 3F1ZA 4C8QF 4OP0A 4QVCA 1VQ5A 2D0PA 5IWAL 4HA8A 1VQPA 4IPDA 1TWGH 4M77G 4MTNA 1JJCB 2K2VA 1JE5A 2WP8J 5ELNA 1EFWA 2JA6G 3GPLA 1LOJA 4IFDI 1VQPT 1YBYA 5GAOl 2LC4A 2JTFA 3GP8A 4IUUA 4X65Q 2B63H 1A63A 1O75A 1NZ9A 3OYLA 3E9FA 2R7ZG 3S15H 5M5WH 1Y96A 3ZJYC 2KSSA 4C0ZA 2XHCA 4MZMA 5FU7C 1DGSA 2QQ9A 1Q81U 2JA9A 4DV2L 1N9WA 4YHHL 1FJGQ 2VUBA 4PJOG 4B3RL 2PVGB 4OWXB 4K0KL 2MAMA 1KQ2A 3X28B 2RHXA 2E5QA 3FRNA 4OF1A 1XQHA 4EX5A 4VUBA 1VQIA 5GAGC 1K73U 1MJEA 4DV6L 3MEAA 2K5NA 2E8GA 3PMIA 3VV0A 4CRIA 4C8QE 2GFUA 3T1HQ 1M1FA 5LL6S 4C92E 4NB3A 2NVQH 3HHTB 3SWNC 1I5LA 1PV4A 3HOUG 1M8VA 2E5LQ 3HOXG 2VGNA 1RI0A 2EJ9A 3G4SA 1MJCA 4A3CG 2I2LA 3CP0A 1SRUA 3T9NA 3H15A 5IYCH 3KJOA 1OZ3A 3ULPA 3QYGB 3G4ST 5LJ3d 2CWPA 5GAHC 4IUTA 2IX0A 4M7AA 4IO9A 4IPGA 1W2BA 2DZ9A 2DXBA 4YY3Q 2B29A 3UT1A 1E3PA 2PUKB 3EIVA 4DV5Q 2DXCA 4KHPL