3TREA

Structure of a translation elongation factor p (efp) from coxiella burnetii
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
129
structure length
129
Chain Sequence
THSTNEFRGGLKVMVDGDPCSIIDNEFVKPGKGQAFNRVKFRNLKTGRVLERTFKSGETLPAADVVEVEMQYLYNDGEFWHFMTSENYEQHAASKEAVAEAKQWLKEEALCMVTMWNGVPLSVEPPNFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Translation
molecule keywords Elongation factor P
total genus 20
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3treA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3treA02
1S40A 4EQ5A 1PH8A 4ALPA 4DR2L 2LQ8A 4H02A 5JEAJ 1WOCA 4DV4Q 1Y1VG 4DR1L 1I6HH 4LWCA 4JV5L 2JOYA 3UDGA 4R4CA 4L5RC 2WAQG 1EIYB 3G6EA 3STBD 4YCVA 1PH5A 3JAME 4UP9A 4LF6L 4DV5Q 2IX0A 2PI2E 4JI4L 2JA8H 1JJ2A 3GTPH 4UY8C 1YJ9T 3J81E 1PFSA 5DLQE 2CQOA 4IJLA 2JA6H 3I56A 2KVQG 4RG2A 2CKZB 1M90U 1BBWA 1A8VA 1U5KA 3FKIG 4JI2L 1W2BS 3T1HL 2NVQH 5LMNW 1W2BA 1J5EL 3ULLA 1MKHA 1X56A 3NELA 5IP7H 1Q81C 2UXCQ 5C0XI 1X3FA 4HJ8A 4DR4Q 4DAMA 4B3SL 1Q82U 3PIPA 1N36L 2VUMH 3GTKH 1L2FA 5ELOA 1PVOA 3H0GG 1A63A 2JA9A 4BBSH 5IYBH 3CC2A 4OX9Q 3CC7T 5AJ3Q 3TEHB 3I4NG 4A3KG 2AMCB 1NPRA 4QQDA 1HH2P 1Q8KA 3CF5A 4QGUA 3E9IA 1NY4A 3L7ZC 1VQ9T 4MZ9A 4JI5Q 1VQ8T 3AFPA 3GTJH 2Q2IA 4IPDA 1JJGA 5HY6A 3PV0A 1VQPT 1MJEA 4UP8A 5JJIA 3HOZG 3M3YH 1SROA 3KOJA 1C7YA 4RMFA 3HFZB 3MEFA 3JAMc 1D8LA 4LFAQ 4DR2Q 2ZM6L 2JK8A 2MWPA 2NN6I 4DV3Q 2B63G 4JV5Q 2R93G 3J7AF 5FJ8H 1AH9A 3OYYA 1EUJA 4UP7A 5GAGC 4OXPA 1E1OA 3CCQT 1UE1A 4X34A 4LUVA 1VS0A 4QL5A 4R4IA 2MO1A 1XPRA 4A3EH 3PUZA 1M90C 1PH4A 2ALYB 4KHPQ 2VQEL 1V43A 2C35B 4DV1Q 3D0FA 3T1HQ 1QZGA 5IY0A 4UPAA 4DR5L 4LF8L 3CCQA 3CQZH 4LF4Q 3PO2H 2VS1A 4YHHL 1HZBA 1Q82C 2E8GA 2GVAA 1X55A 3GO5A 2F52A 3PGZA 4P73A 1C0AA 3TQYA 5J26A 1TXYA 3I7FA 4IO9A 4A3BH 1KC8U 2AWOA 2JA7H 2B3GA 4WJ4A 2DGYA 3J80E 4POGA 1KRTA 1VQFA 3S1QH 4GKKQ 2K5VA 5H1SE 4P74A 3J81c 3CMAA 1PYBA 3TRZA 3F2DA 4DV6L 3S1RH 5IYCG 5C44G 3CCET 2YU9H 4PG3A 1YNXA 1VQ6A 1EWIA 1K8GA 5M5YH 4POFA 1YHAA 2MQHA 1ASYA 1Q7YC 1SR3A 1CKNA 2NVXH 4X66Q 3J7A5 1I94Q 3S16H 3HOVH 4YCUA 3J80i 4B3TQ 3S1NH 3CCEA 1YHQT 1EQQA 4LFBQ 1SN8A 1PA6A 2XTIA 2Q2TA 1QUQB 4FDBA 4AYBG 2UXBQ 4PZ8A 2IG0A 1GVPA 4DV7Q 4DV5L 1NMFA 3AEVA 4DUZQ 3CAMA 1BKBA 2R7DA 3S24A 4GOPB 2E70A 5C4JH 3H15A 1XMQL 4X6AH 4IFDI 1DGSA 1IYJB 2PNHA 2LSSA 3RN5A 1PYSB 2E5LQ 4IPGA 2B63H 1IBKL 3CCMT 2AHOB 1XNQQ 2ASBA 5LMNL 1MIUA 4B3SQ 3PO2G 1L0WA 2NN6G 1JJ2S 5JEAG 1E1TA 3AYHB 3HOXG 1N33L 1VQ8A 3KJPA 2VQFQ 1FJGQ 1XNRQ 4GNXC 2F4VL 2NZOA 4JOIA 1YHQA 4HIMA 1YITT 3RLNA 2D62A 2ZJRA 1Q1BA 1YHBA 2H5XA 3BZCA 1N9WA 4GOPA 3ULPA 4L5SA 2L15A 2RCNA 3M4OH 3CCRA 1J6QA 5HGQA 4B3ML 1UE7A 4GNXB 3NENA 2GVBA 1HNWL 1PHJA 2JJQA 4JI3Q 3OTOL 4C2MH 5A2QE 1VQ7T 1UE6A 3CMEA 2UUBQ 5LMUL 4JI6L 3S14H 4DR1Q 1XTDA 1B7YB 2KCMA 2YTXA 1YIJT 1VQBA 4X65L 3E9HA 1OXUA 4DV2L 2N49A 4IOAA 2DUDA 3J80c 1CSQA 3I4NH 4JI0L 4KLKA 4DAYB 1YJ9A 2PMZE 2MWOA 3LGJA 5IYCH 1M1KC 2KENA 2A1AA 1K3RA 2ID0A 2XHCA 3CCSA 2BH2A 2UXCL 4JI7Q 3K0XA 1I3QH 2IHEA 2OTLA 2N3SA 1Y14B 5ELNA 2WAQE 4YHHQ 4JBKA 2LXKA 1XNQL 4BBRH 3U58A 2I5LX 4K0KQ 2CKKA 5GADC 4JYAQ 1NJIC 1KXLA 4AQYQ 1Z47A 1OXSC 4JG2A 3CCJT 1QUQA 4NXML 2ZJPA 3KLWA 4NPSA 3PO3G 2EQSA 2F4VQ 3CPWS 1D7QA 2KCTA 3L0OA 1WFQA 2ZTEA 5GQOA 2OTJT 1N34Q 3HOUH 4DR3Q 4JI5L 4AH6A 1IBML 2HHHQ 2NVYH 3NEMA 1PH2A 1NE3A 1V9PA 1KAWA 3G71A 4A3FG 3HOXH 1YJNT 2UUAQ 4EX5A 4Y7NH 1X65A 3BJUA 5M5XH 2OTJA 1J5EQ 1LUZA 4YY3Q 2YV5A 4JI6Q 4PMWA 4DUYQ 2I0QA 4JBWA 3F2CA 3EN2A 1VQMA 1K9MU 3B6YA 3K7AH 1A62A 2MFIA 4LF5Q 3H3VI 1X9NA 4XTCS 2NVTH 3CCLA 1O7IA 1PH6A 4KHPL 1I50H 3HKZG 2YTYA 4A3IG 2K5HA 3HOVG 2VL6A 3G4SA 1OXTA 4O2DA 2VUMG 1FGUA 2QA4A 1YZ6A 4TQUS 1HZ9A 1VQOA 4LF4L 4LF7Q 3CC2T 1IZ6A 2OTLT 1G51A 1X54A 3CCVT 3JC66 4ZN1A 3EIVA 3OW2S 3KF6A 4QY7A 4JI1L 5IWAQ 1QZHA 1UEBA 3HOWH 4R4OA 4DNIA 3RZDH 1AE3A 2JQOA 2EXDA 2CFMA 4BA2I 2WB1G 4BXXG 4A3CH 4A76A 1CSPA 4J15A 2JE6I 1MJCA 2ZM6Q 2B29A 2OQ0A 1VQIA 2JEBI 3ER0A 2K4KA 1VQ4T 1TWFH 4A75A 3PF5A 3CMET 2RHSB 1XPOA 3ERSX 4JI4Q 1VQLA 1OXVA 4O0AA 3GTGH 3CP0A 2JUFA 2D0OA 3RNUA 4AIMA 4X62L 2UU9Q 1KC8C 2MNAA 1Q1EA 4IPCA 4GOPC 3G71T 4OWWB 5K36G 1HR0L 4YCWA 3HKZE 5BR8Q 3PF4A 1XMOQ 1EYGA 2JNGA 2JA8G 1E22A 4GS3A 1N32Q 3E0EA 4WJ3M 2QEXT 1KRSA 4HIKA 3UDFA 3AFQA 4DV7L 1GM5A 5IAYA 3HOYH 4LFCL 3T1YQ 3KFUA 5JJKA 2KHIA 2OWOA 4IFDG 4B3RL 3KF6B 2PQAB 4DR7Q 1HNZQ 3P8BB 3LH0A 2VQFL 4GN3B 2WB1E 1QVFS 3STBC 1WYDA 3M4QA 1IBLL 3CPWA 2V1CC 1JJCB 1QVFA 1KHIA 2G3RA 3S17H 1JMCA 2BH8A 4BY1H 3TREA 3A74A 3M7NA 5GROA 5IP9G 3VDYA 5GAHC 2JVVA 2UUCL 1YEZA 4AYBE 4JI1Q 3K8AA 2AWNA 4BXXH 4LNQA 3PO3H 1HZAA 3HOWG 4YWKA 3GD7A 4A3JH 2WFWA 5FLMH 4C3IH 1QVCA 1E7ZA 1FVIA 4X66L 4A3CG 4A93G 1TWCH 4IOCA 1SFOH 4GKJQ 4A93H 4DR7L 2BA1A 2QA4T 3A0JA 4GNXA 4HJ5A 3W5OA 3IRBA 1K8AU 2MI6A 4C3JH 3CC7A 3L2PA 1PH1A 1SE8A 5EAYA 2UU9L 4B3MQ 4A3BG 4A3LG 3OTOQ 1JB7A 3GTMH 2KDSA 2IY5B 5C3EG 1L1OC 1VQHA 1VCIA 1YI2T 5IYDH 4MTNA 4TVRA 4YWMA 2OCEA 1X3EA 3KJOA 3CXCS 3KYHC 3UDXA 1Q81U 1UE5A 3ULJA 4APVA 2ZJQA 4BY7H 3LGFA 3S2HH 3CD6A 1WCMG 3OW2A 2VY3A 5IP7G 2VW9A 2CWAA 3J7ZC 4JYAL 3PCOB 3DLLA 3S1MH 4CRIA 4DR6L 1L1OB 1HZCA 1N33Q 3CCRT 3U4VA 1HNZL 1CKOA 1VQMT 1YJWA 3M9BA 3SGIA 2Q2UA 4OX9L 2DO3A 3TS2A 5DM7R 4JI8Q 1SLJA 1K83H 4R4TA 1ASZA 2PQAA 4DR3L 3CC4A 5M3MG 1BBUA 2UXDL 5AJ3L 1EFWA 1JT8A 3BZKA 1IBMQ 2HHHL 1VQEA 2QGQA 2GN5A 3RLOA 4KHZA 3UE0A 2NZHA 1S3OA 5M5WH 3GTQH 1YJNA 3U4ZA 2ATWA 2K75A 2UUBL 4HIOA 2R7ZH 1GO3E 1LYLA 1QVGS 3CCUA 4DV0Q 3W1BA 1XPUA 3H3VH 4DUYL 1HR0W 1SRUA 2E6ZA 1TWAH 2Y0SE 1VQJA 1KD1C 5C4XG 3CCST 1K8AC 5M3FH 4OWXB 1VQPA 3H0GH 3I4MG 1YJWT 1OXXK 3EBEA 2VQEQ 4DV1L 4NB3A 1NTGA 2N78A 2E2IH 2UUAL 2R6GA 3KDFA 4PZ7A 3I55T 4A4IA 4YY3L 4DV4L 4DR5Q 4A3KH 1PH9A 4B3TL 2LXJA 2F3IA 5C0XJ 4LF9L 3ICEA 2RF4A 5IT9c 4BY7G 1N36Q 4DKAC 4LF6Q 4RG1A 1JE5A 3T1YL 1HNXQ 4LFCQ 1IXRA 3DB3A 4P71A 2ZTDA 3I56T 1IBLQ 3G6ET 3CMAT 1Q12A 3F2BA 2R92H 5M3FG 3NBHB 4JI8L 3I4MH 4DK6C 4GKKL 2VNUD 4P72A 2K50A 1TWGH 1PH3A 2N8NA 1KD1U 3K7UC 3A5UA 1V1QA 1IL2A 1EQRA 1UWVA 5IWAL 4HJAA 4DK3C 5FLMG 3PUXA 2R7ZG 2PI2A 2A19A 1HR0Q 3WWVA 4NXNQ 1XNRL 2IX1A 3HOUG 1N8RU 1W3SA 4DV3L 4HJ7A 5C4XH 2R7FA 4GKJL 3S2DH 2HQLA 4IFDJ 3PUVA 1N34L 2Z6KC 5M3MH 1OTCA 4A3GG 3MXNB 4GLXA 4LF5L 3HOZH 4LUOA 4L5TA 4JBMA 3KF8B 3UDIA 1Y1WG 1YVCA 2HIXA 1Q7YU 1NZ9A 1BVSA 1E24A 1X3GA 5FJ8G 3I4OA 5IT9E 1U0LA 2IT1A 1C9OA 1FL0A 4JCVE 1N8RC 2I5MX 1N32L 2Q2HA 4X64L 1EIFA 1K73C 1VQNA 4K0KL 2MO0A 1XJVA 5IE8A 4A3MG 1VQCA 3TS0A 2RHQB 4BBSG 1YI2A 2ZTCA 4B3RQ 4QJFA 4JI2Q 4BBRG 1VQLT 4BA1I 2E2HH 3CCVA 1FJGL 3CD6T 2BA0A 3GTLH 1H95A 3LGLA 1QVGA 5FLXE 1VQ4A 3M4PA 3JAMi 4A3DG 1Q86U 3CPFA 2LVMA 1IBKQ 1VQ9A 4DV6Q 5FLXc 3RN2A 5C3EH 2JEAI 1KL9A 1VQ5T 1RL2A 1KQSS 1P8LA 2CWPA 1NJIU 2Y0SG 1S72T 3FP9A 3CXCA 1HNWQ 1E3PA 1T9HA 1VQGA 4HIDA 4OO1I 1X6OA 2XGTA 3K81C 4LFAL 1XNIA 1SMXA 4A3MH 1XMOL 1PV4A 4X65Q 4DV2Q 5C44H 1HJPA 2LCLA 1VQ5A 2I5HA 1VQNT 4A3IH 2KHJA 1K73U 3S15H 1A0IA 4ME3A 4YTLA 1B8AA 3U50C 5IP9H 2JA5G 4P75A 4QIWE 4OO1G 4JI0Q 1SSFA 4R4QA 4A3FH 4DUZL 3CCUT 1Y1WH 4DR6Q 4KI0A 1R9TH 1XMQQ 3KDFB 3HOYG 3CCLT 1GD7A 2Z6KA 2ES2A 3RR5A 2JA6G 1Q46A 2HT1A 3DM3A 1B70B 2FXQA 2L3RA 5LMUQ 2E5LL 4OWTB 1I94L 1CKNB 1I5FA 1NMGA 4LF7L 2A8VA 4HJ9A 3I2ZA 5LMNQ 4LFBL 2UXDQ 3CC4T 1G6PA 3A5ZB 3F1ZA 4Y52H 1G291 3KBGA 2K5NA 4BY1G 1WJJA 3CCJA 2K14A 2WP8J 2YTVA 2IHFA 1RIPA 3G48A 3PSIA 5E7NA 1GKHA 1TWHH 1HNXL 2E2JH 3RZOH 4QQBX 4R1JA 1M1KU 3RLFA 4DPGA 3J81i 3HKSA 1KIXA 1CUKA 3AQQA 2AKWB 1Q86C 2CCZA 4IJHA 1YBYA 4OONA 5LL6S 1PH7A 1P16A 3W1GA 2EIFA 3CCMA 3J81j 1NBWA 2VZAA 2JA7G 3PUYA 4X62Q 3M85A 1S72A 4AQYL 1WCMH 3D31A 3ZJYC 2YYZA 5C0XG 4NXMQ 1Z9FA 1VQOT 4A3LH 2OQKA 4TVAB 2HIVA 4DV0L 3DB4A 2JA5H 2Z0SA 5IYDG 4LF9Q 5J3BA 5IYBG 1VQ7A 1VQKA 3BU2A 3G4ST 3CW2C 2R92G 5GAEC 4A3DH 5JJLA 1VQ6T 4GN5A 4C3HH 4GLAC 4MNOA 3PIOA 4A3JG 3FKIH 1AE2A 5BR8L 4LF8Q 1NPPA 3I55A 1VQKT 4XIGS 4YWLA 3GTOH 4GLVB 4X64Q 3UE1A 1EOVA 1L1OA 2K52A 1KQSA 1YIJA 1LTLA 3F8TA 4JOIC 2KBNA 4LUZA 2UXBL 3K80C 1WI5A 1Y1VH 3FHWA 3GDEA 1K0RA 1M1GA 4ZN3A 4PZ6A 4A3GH 4LW1A 4NXNL 2QEXA 4GN4B 4JBJA 1VQDA 1YITA 1VQAA 3PUWA 2R93H 4JI7L 1CKMA 4DR4L 1LM0A 4IPHA 1K9MC 4JC0A 2UUCQ 2D0PA 4A3EG 3Q8DA 4JI3L 4L5QA
chains in the Genus database with same CATH superfamily
2DJGC 1V1PB 1GBQA 2D0QB 4RGNA 3GNGA 1ZSZC 4DV4Q 4JV5L 4A63B 1EIYB 2A6HC 4UP9A 1TY2A 4JI4L 1WHKA 1BYMA 4RGTA 2COZA 5CR3A 2GFAA 2P0QA 1YJ9T 2DL3A 5C0MA 1PFSA 3SK5A 1M4VA 4RG2A 2A5HA 2JA6H 1MMDA 4PJOF 3GQBA 2R7ZB 2HUGA 5LMNW 3DMUA 1W2BA 5CQXA 4DU9A 4M7DG 1F77A 2X9HA 3NELA 4LMQD 2UXCQ 4A93B 1PH4A 1WLPB 5C0XI 4HJ8A 1TWFB 1A6XA 4B3SL 2LQKA 4J9IA 3K7AB 1NNXA 2VUMH 4JLIA 3ASKA 5M3FB 2KCNA 1L2FA 2K01A 5ELOA 4F8MA 4KULA 4JLGA 4JRIA 1QVGP 1HSQA 1V29B 4XTXA 4OX9Q 4CKEA 1UUPA 2SOBA 1O9SA 4M4ZA 5GAMg 1EYCA 2ABLA 1NPRA 1Q8KA 2A6HD 4C92D 4QGUA 4XAXB 4M78C 5I22A 4ZCKA 2WKDA 2K6AA 5HY6A 3FEOA 3SFMA 2NUPB 1JWSD 1O7YA 3O13A 3M3YH 3F70A 5CR2A 1SROA 1WTVA 5IGBA 3AU7A 3MHBA 3HFZB 4DR2Q 5IOCA 4DV3Q 2R93G 2RI2A 3J7AF 1AH9A 3OYYA 5LJ3h 3T56B 4EQNA 4FW2A 4ULLA 3T9NA 5CK9A 4X34A 1T5XD 4ORZA 4R4IA 4QL5A 1GOZA 3ZEHA 4DXFA 5I4DA 4MN3A 2FZGB 1V43A 1PTOB 2L5QA 3CCQA 3CQZH 4DFAA 4QUFA 2J7IA 3R3OA 4EQPA 4QVZA 2E8GA 3R6NA 1X55A 2F52A 4P73A 1TXYA 4IO9A 1GUOA 4A3BH 3IFTA 3OSVA 1PRMC 2NWMA 3G6EQ 2DGYA 3S9WA 1VQFA 2MGSA 3LWEA 3FRNA 3J81c 2I0NA 4BY7B 3TRZA 4DV6L 3S1RH 4ID6A 1SMYD 5C44G 1AFPA 3VR6A 5HURA 1EWIA 5LJ5g 1I81A 2HBPA 1YHAA 5C5MA 2MQHA 3L2WA 1ASYA 3UDCA 5COYA 2CUDA 2WSEE 4KY6A 3CD6Q 3JSCA 1KC8R 3J80i 2COWA 3CCEA 3NPFA 1EQQA 2KRSA 1SN8A 4M7DE 2HBWA 4FDBA 4K8IA 4C92B 4DV7Q 5I2MA 2RQTA 5CORA 2D2CC 1Y7XA 3W2DA 2QQBA 5FU7C 1NMFA 4DUZQ 1BKBA 1PD0A 2F5KA 1XMQL 2Y4XA 4N8FA 1SKUB 1TS9A 1Y96A 2DKGA 4E47A 5CKDA 1IYJB 1CTMA 1LT5D 2NYZD 2O2LD 3RUZA 1EWCA 2E5LQ 1STNA 1Q95G 4X3TA 4IUUA 1CKBA 2IX3A 2M16A 1NLOC 4FF2A 2NUTA 1JJ2S 1AWOA 5A0GA 4RGMA 5CC4A 2BE9B 2KNBB 3K57A 2VYTA 3KJPA 4HR7B 2B8GA 2F0QA 1FJGQ 4MZPA 4JOIA 2F4VL 2CW0D 1YHQA 1PHTA 4HIMA 3D8GA 2HDAA 2D62A 3RKYA 1QCNA 4LUDA 4KTAA 3AEVA 4L5SA 4J8OA 1QCOA 1M8AA 4L6TB 4M75A 4B3ML 2WSCE 2F1MA 2GVBA 3CRLC 4CDDC 1WIEA 1PHJA 1P92A 5A2QE 4EDUA 2LNHB 2UUBQ 4ANJA 1ZX6A 3HFNA 1FR3A 3D6CA 4C3HG 4IOAA 3ZFJA 3HG9A 5BN5A 2KCMA 1D0YA 2YTXA 2B86A 3E9HA 2F5TX 4FU6A 5GMKh 2L12A 3J80c 4X3UA 1XX8A 3I4NH 4DAYB 4A54A 4DOVA 3K5LA 2PUOB 4LD6A 1YJ9A 1WTPA 4XU2A 5IYCH 1YWPA 1UJYA 3G7LA 2KENA 4N9PA 1AEXA 2EY2A 4F7UA 1FMWA 2XVSA 3QOJA 5I2YA 4C8QF 2IHEA 5BN4A 2OTLA 1XNQL 4YHHQ 2EGCA 3S15B 4OGEA 4BBRH 2W10A 3U58A 2PMZB 4RHRA 4BI4A 2EQJA 2DXCA 3LX0A 2X4XA 3FB9A 3PO3G 2QDBA 2EQSA 3CPWS 1ZA1B 2E1HA 4H44C 2KCTA 1I0CA 1HPCA 1AT1B 4HCCA 2YSQA 4E7JA 5GANd 2OTJT 1TWGB 4K5XA 4DR3Q 1JQQA 5ELFA 3S3MA 2VKNA 1B3AA 2HHHQ 2JA8B 4KBMB 4E6RA 5C6SA 1Y1VB 2B8AA 3MJXA 3RZOB 4DBHA 3OIQA 3JCMf 1IGQA 1YJNT 2BCOA 3L9AX 1EIGA 3GOXA 4L6V5 4YY3Q 2ENBA 3NQIA 3C94A 1ONLA 2L9HA 2XRQD 1FX7A 2JTFA 1K9MU 1DCZA 1A62A 1RODA 3HOZB 2X3WD 1MD2D 2NVTH 1R0CB 4M77F 1RABB 3WOEA 3CBPA 5KYXB 1I4PA 7AT1B 3EGXA 2DXTA 1GRIA 3G4SA 4J9EA 1GCPA 4LF7Q 3JCMc 2DXUA 4JI1L 3CCVT 4ZN1A 1TSFA 1VYUA 2YT6A 3GTJB 4BBSG 4FXKC 3NMZC 4C3JG 4J8QA 4RTZA 2JQOA 4BA2I 4ZTJA 2CFMA 2WB1G 1QWEA 1EWHA 5FU7B 4A76A 1CSPA 3JV3A 2HD3A 4J15A 1MJCA 1WJRA 4KKSA 2ZM6Q 2DL5A 1EZZB 4XQJA 1UGPB 2PU9B 4M75B 1B9NA 2QDLA 2RHSB 1B1ZA 2FEIA 2A28A 2EXZA 2PQEA 1KC8C 5FLXL 4GOPC 1A3VA 4YCWA 4MMLA 3HKZE 1S5ED 1B3QA 3FVQA 1XMOQ 4JRKA 2VVKA 5HK3A 2CSQA 3Q23A 3BE3A 5GMKl 5AFWA 4CHTB 3UDFA 1GM5A 3HOYH 1WHLA 3N52A 4XXEA 4K8JA 3S3OA 4DR7Q 1HNZQ 3P8BB 3LH0A 1QVFS 1WYDA 1CI3M 4RCOA 2I2LA 3CCRQ 2FHTA 3S17H 3L3OC 2A0FB 2C06A 2ZXRA 3JB9F 2JXMB 3DWQA 2BDOA 2PZUA 3VDYA 1ENAA 2F0PA 2MMPA 4BXXH 2EWNA 2YU9B 4BY6C 3GD7A 2NVQB 2CDTA 5FLMH 4X66L 4A3CG 3NTHA 3QHSA 1FNWA 1STGA 1X32A 3C0CA 1WTQA 5GMKj 4P5NA 1SFOH 4J9GA 1S1NA 1KDBA 2E75C 3I90A 1GFCA 4EVOA 3VS5A 5IHNA 1D1AA 1SAPA 1RI9A 2MI6A 1NR4A 4C3JH 1SEMA 4BI8B 3IFDA 3ONAB 1PH1A 2B39A 2UU9L 4A3LG 1UJ0A 2CP6A 1BI2A 1YI2T 3R93A 2QTXA 3BZDB 2XMFA 3K0YA 1X3EA 3QO2A 4APVA 1BCOA 1H9RA 2ZJQA 4G7OC 1MNEA 5EJWA 1EY8A 1F1BB 1KQ1A 1OEBA 2KYMA 3I8ZA 5CBAE 3DLLA 5CIUA 1L1OB 1PLFA 1LNXA 1QE6A 2PCFB 3OY9A 2X51A 3GBQA 2A6ED 2NVXB 1I4XA 3M9BA 4G4KA 5D14A 4D8KA 5DM7R 1PMRA 2LDMA 2KECA 3CCLQ 1KDAA 3HOWH 1ASZA 3VS4A 5FO7B 5AJ3L 1JT8A 1IBMQ 2HQHA 3O8VA 3C12A 2PZ1A 3UE0A 2EY1A 1AP0A 3D4WA 4KY5A 4DNTB 2E10A 4J9FA 5KNBA 2K75A 1MGQA 3NE5B 2A68D 3QWXX 1WYXA 4NL3A 1QVGS 2F0HA 1G2SA 3W1BA 1XPUA 1HR0W 1KIKA 3PTAA 5NUCA 4C8QB 1Z9QA 4RKBA 1KD1C 3CCST 4MDWA 4PKCC 2B2UC 3OS1A 2FRWA 1IW7D 5GMKm 4HSVA 2NVTB 2KQWA 2CYZB 3E1SA 4QVDA 3S1QB 2H4OA 1O80A 4DR5Q 1GCQC 3VU3C 3KBXA 4YY3L 3TS2A 4IFDI 2K3XA 2RHUA 1YNJD 2F3IA 2DD5A 2LXJA 1GHKA 2RF4A 4E7IA 4BY7G 1RKNA 4DKAC 4LF6Q 1U1TA 2FPFA 3RIRA 5FU6C 1VF7A 2TMPA 4RG1A 3T1YL 1HNXQ 4FYDA 3MEVA 1ZA2B 4ZGDB 2KY9A 4IUQA 4Q5VA 1IBLQ 3SEMA 1Q12A 3F2BA 3S14B 4DOWA 4DK0A 4DK6C 1M2VB 1U4RA 1KK7A 2K50A 2CP5A 2SEBD 1F2ZA 3E5SA 1HRJA 2O01E 4PJNA 2Z0WA 3R6OA 1V1QA 3DXJC 3A5UA 5IWAL 1IL2A 1ZSZB 2NUCA 3TSWA 3PUXA 3FEWX 5LJ3g 3L2RA 5I6WA 1DD2A 2V26A 3HOXB 3CCMQ 3FLGA 2IX1A 4KUIA 1W3SA 4E2FB 3QYGB 2R7FA 1JE4A 3PO2B 2HQLA 4GKJL 1N34L 3OQ5A 4DEXA 1ICFB 4GLXA 4PJOE 1MUZA 4L5TA 4ME7A 5KYUA 1V76A 4AG2C 2KA7A 1WHJA 4OGCA 1K28A 1U0LA 2IT1A 3K59A 1N8RC 5GAMj 3CKIB 4C0DB 4OELB 5EKLA 4DN4M 5JPMC 1ICWA 2Q2HA 3A8OB 1U9RA 4WFN3 4A3MG 1NAPA 4FM4B 4F87A 1YI2A 4XQNA 2X3XD 2E2HH 1VQLT 3CCVA 1FJGL 3CD6T 2BA0A 1QP3A 3AHUA 1C6VX 2AIRB 1VQ4A 4M7DD 3M4PA 1VQ7Q 4RWSC 3CPFA 4N4HA 2V1QA 4HCZA 4IQZA 4CGYB 4DA2A 2EQMA 2O9VA 5C3EH 1YITQ 4G7ZC 1VQ5T 1RL2A 2CWPA 1P8LA 1S72T 3CXCA 5EQ0A 1LTGD 1E3PA 1T9HA 3MC0B 4Z88A 2RDFA 4OO1I 2CP3A 3O5ZA 4MIUA 4LFAL 2KMTA 4A3IH 2F3WA 2LCLA 2RI3A 1VQNT 2K7AA 2CZ1B 2K9GA 3VKIA 4ZGEB 3S15H 4IUNA 2MHVA 2GF7A 5IHKA 4ELZC 1MGSA 1B34A 3M0QA 3RBBB 2IL8A 2M9UA 4A53A 4DUZL 3RZDB 1XMQQ 5GJWB 2MPXC 3RR5A 4C56C 5A0LA 2HT1A 4LDVA 2KAFA 1PFNA 3SWNB 2EPDA 3JCMd 2E5LL 4C0DC 1CKNB 1MSHA 3EROA 3H6MA 2F2XA 4HJ9A 3KF8A 3E9FA 2XDDA 1G6PA 1D0ZA 3F1ZA 1EQTA 2K5NA 1UGRB 3ERQA 3L2UA 3CCJA 2K14A 5FWBA 2DIQA 1A3UA 3PSIA 1CKAA 4A4EA 4J9HA 2EYYA 1K9MR 3RZOH 4R1JA 1W4SA 1M2VA 1M1KU 4BE2A 2K79A 3RLFA 3TP6A 2QQ9A 4DBQA 3VS3A 8AT1B 3G71Q 5EPKA 1TOVA 2AK5A 2CCZA 4IJHA 1BI1A 4C8QC 4WORA 4CKCA 1PH7A 3W1GA 2KUMA 3CCMA 4LDYA 2QEXQ 1K73R 2HSEB 3PFSA 2ICIA 2KQ3A 5ELDA 4AQYL 1QOHA 1BDOA 3ZJYC 5C0XG 3IQLA 1IL8A 1SNMA 2LJ3A 2HKQB 4R8NA 5CYUA 1RAEB 3NBIA 4E7ZA 5IYDG 4LF9Q 2EYXA 2AUJD 5GAMe 5GANe 3E6ZX 3E2UA 3QDFA 1QCFA 4DNRB 2R92G 5GAEC 2KGTA 1G91A 4GN5A 2ZGWA 1KSWA 2QDYB 5FWCA 1EY7A 4A3JG 2E65A 2HEQA 4LF8Q 1NPPA 2KI7A 1VQKT 4C8QD 3M7GA 1DOKA 1SNQA 3UE1A 4X64Q 2K52A 1YIJA 2V8JA 1U3OA 5KYLA 3UWNA 2B2VC 3H09A 1M1GA 4ZN3A 5HK0A 2TSSA 4DAPA 3GV6A 1VQPQ 1M5Q1 2Q8IB 4RKLA 1SYCA 1W6JA 2DBMA 3E9GA 1CA6A 3QKJA 5IODA 1B44D 3RKXA 1LM0A 2UUCQ 2EYPA 3HSBA 2DVEA 5C4HA 3OYBA 1SEBD 2LQWA 2EYWA 1S40A 1PH8A 3S17B 1K3BC 3MP1A 3GPLA 1WOCA 4DR1L 2DTHA 1G3SA 5GAMh 2M51A 4R4CA 2JA8H 2IX0A 2PI2E 1I4GA 4IJLA 3BYYB 5DLQE 3CCQQ 3I91A 2XD0A 1AZQA 1QVPA 3FKIG 2IVWA 4DR7L 1BBWA 5GAN2 1A8VA 1STYA 1NCVA 1W2BS 1U5KA 3FPUB 3TZDA 2NVQH 2GQVA 1BIBA 4IIOA 1JXMA 1D5ZC 3ND8A 2Y4YA 1X6GA 1J5EL 1X56A 1SFOB 1X3FA 4PLLA 2QTVA 4PMCA 3EGUA 1VQ6Q 4DAMA 2QYZA 3GTKH 2CSIA 4F04B 2JA9A 1STAA 5IYBH 1A0NB 3CC2A 3PVQA 1GUTA 2AMCB 1ET9A 4A3IB 4XYOA 1HH2P 2RB6A 4E7LA 3L42A 1SYFA 2DERA 1I6VC 4XU1A 1VQ8T 2EPBA 5C6AA 3GTJH 2DPPB 3ITPA 4JI5Q 2WSFE 2RK2A 4KH1B 4N0AA 4HMIA 3EH1A 3VR3A 1ABQA 1WI7A 1WQWA 3G6JB 3KOJA 4M7AD 4RMFA 1I4HA 2YWWA 1D8LA 3KFVA 3QYHB 1G3TA 1PRTD 1UNSA 1TS4A 1Y96B 4FNFA 2ZM6L 5FJ8H 3A7LA 5GAGC 1EFNA 5D3IB 1LTSD 1PCXA 1UGSB 2LCCA 1VS0A 2A68C 3EG3A 4NMZA 1XPRA 2MJ8A 4P2CB 1QJOA 2D5DA 4KKTA 3C1EA 2L11A 2EYZA 5GAMd 3I55Q 2ALYB 4DV1Q 5KEEA 3D0FA 5FROA 1BXTA 3T1HQ 3EHQA 5IY0A 1TWCB 1CQVA 2ZCFB 1O78A 1HTLD 2GVAA 3KLSX 3HOYB 3TQYA 1J3TA 1W1FA 3QR8A 2EJ9A 1H9SA 4N8X1 1UGVA 2R58A 1KC8U 2AWOA 2B3GA 4FXGC 4WJ4A 5IGCA 1B07A 4POGA 1KRTA 2GA4B 3A8LB 3S1QH 1PRTC 1HJDA 1LTAD 4GKKQ 2K5VA 2RNAA 3EG2A 1PDQA 1YNNC 2WKCA 1MMAA 2YU9H 1K8GA 1DJ7B 3MFGA 3OA6A 1Q7YC 1QILA 3H6ZA 1SR3A 4LD9K 4HXJA 3S16H 4YCUA 4B3TQ 3S1NH 3JCMe 2NUPA 4HTHA 1YHQT 1TS2A 2Q2TA 2B2TA 2RVLA 3PT9A 3A7AB 4PZ8A 3NGPA 2VUBA 1I07A 3JB9I 1PZKD 1S5DD 2EY5A 3MHXA 2A08A 3BW1A 3EG1A 5C4JH 3ZL7C 4NP5A 2LSSA 4QCLA 2JS2A 3D7SB 3JRZA 3QWNA 4GBQA 1RI0A 1EEFD 1PYSB 2A69D 1IBKL 1RAHB 3X20B 1OV3A 3PO2G 3D4RA 4KGZB 3M9QA 2Z8LA 1E1TA 3HOXG 4XK8E 4F7UF 2CREA 2Z6BA 5DM63 3BFMA 3EQLC 4F16A 1QW1A 2B2VA 4LAAA 2ZJRA 3TSZA 1YHBA 4OMMA 2RCNA 4CBVA 1Y1WH 3QZ9B 5HGQA 3T4AC 3JB9J 2ROLA 2GTJA 3NENA 2EGAA 1EU3A 3OTOL 1WHMA 2C0OA 2F0UA 3ULRB 2QQAA 3WVEB 1RAAB 2J05A 4A4FA 4FF4A 1G6ZA 5C3WA 5LMUL 5FO9B 4DR1Q 1B7YB 4X65L 3ME9A 1VQBA 4C0FA 2G9DA 4RFBA 4CKBA 4B9XA 3L2QA 4JI0L 5GAN6 2FINB 2E74C 2O4XA 2MWOA 1W2BP 3LGJA 4M7AA 3OIPA 5JJZA 1JB0E 2DLPA 1N6AA 3VJPA 3ZBDA 2BH2A 2RQRA 3CCSA 2UXCL 4DR4Q 5C4XB 2AKKA 5ELNA 2RM4A 4PLIA 2LXKA 2JJ9A 2I5LX 2XDPA 5J39A 1Y07A 4JYAQ 1NJIC 2BKDN 1KXLA 2C0TA 1OXSC 2DE0X 3REBB 2JM8A 3UT1A 3CCJT 1QUQA 4JG2A 3X28B 3TBIB 4O1NA 1BCPF 3FKIB 1QZHA 4Z02A 2RA4A 4X9DA 2RQXA 2ZTEA 1N34Q 1E6GA 4JI5L 4JVZA 2EGEA 3JCMb 2DAQA 4AH6A 2A73B 1VQ9Q 3PIO3 1IBML 1PH2A 1NE3A 4FT2A 1FMVA 1V9PA 4PV1C 2XKOC 4DEYA 1D1KA 4R55A 3HOXH 5CO7A 3VS1A 4A3FG 1LT4D 2F03A 1JCKB 2UUAQ 4Y7NH 1X65A 3BJUA 3GTLB 5GAOq 4EGVA 4IKFA 3MVVA 3VS7A 2I0QA 3QPHA 2CHBD 3EN2A 5I2XA 1M3BA 5LHY1 1QWFA 1NYFA 3H3VI 2KR3A 2QW7A 4XTCS 2AKLA 3BVZA 3A8GB 3DWAA 3CCLA 4KUDK 4PJOB 2PYKA 3HRUA 5D65A 3HOVG 4M7DB 3H91A 3ICEA 2HNIA 2VUMG 3VRYA 1FGUA 1FYNA 1NEBA 1SSHA 4QQ6A 1VQOA 1HZ9A 2PVGB 3CC2T 1WTOA 1G51A 2X4WA 3KF6A 1BBXC 3VUBA 1PVOA 1UEBA 4R4OA 1AE3A 2DNEA 2EXDA 3OWFA 3NWSA 3WDNA 4BXXG 4FYYB 3QXEB 3TQ7P 2L3SA 4B9WA 3S16B 2JEBI 2K4KA 1TWFH 1I4RA 4OEMB 3CMET 1XPOA 2QILA 4JI4Q 2VUMB 1VQLA 3CP0A 4A3KG 1QQJA 2D0OA 5FRNA 4A3EB 1WTWA 2FPDA 2HCIA 1RTNA 3G71T 3E19A 3OYJA 5KNCA 1HR0L 5A0DA 5GANj 1I8FA 5GANh 3PF4A 3HHTB 1X3QA 2JNGA 1Q7YR 2JA8G 1N32Q 3OYMA 3E0EA 3BY7A 2QEXT 4HIKA 3URYA 3NTIA 1B9MA 3AFQA 5J1ZA 1OULA 5IAYA 4DV7L 5EPLA 1XOVA 3KFUA 4AFQC 2GCXA 3H9NA 3CC4Q 2PUKB 3QZ5B 1QNUA 1S5CD 2VXEA 3P8DA 1ZEQX 4IFDG 4B3RL 3VYGA 2WB1E 3H8ZA 4XU3A 1M27C 2YHTA 3M4QA 4M7DA 4HEDA 2V1CC 4N9TA 1RAGB 1WFWA 3TSSA 2JA5B 5D7UA 3TREA 2RBMA 3A74A 4ZTFA 2B2YA 4NW2A 2K5WA 3K8AA 4XQQA 2FB7A 4A3JH 1JICA 1F9RA 1FVIA 1VQKQ 3KXTA 5DM73 4G7HC 3CU7A 4M7AF 3HOVB 3DWPA 1M3AA 2YRDA 3DM1A 4FT4A 2QA4T 2BA1A 3A0JA 1TY0A 4Z9CB 2Z9HA 4B3MQ 3CC7A 4A3BG 1SE8A 5GMKi 5EAYA 2YXYA 3VS6A 4OB1B 3Q6SA 4FCYA 4M78D 1VCIA 1CHQD 5IYDH 2JM9A 3AMUA 1JOOA 1K8MA 3NTKA 4A3MB 2B2WC 2OCEA 3KJOA 1GHJA 4BY7H 1WXTA 2VB6A 3S1RB 3FMCA 4PJOG 3CD6A 3OW2A 3TP7A 2CW0C 5IP7G 1EIHA 2CWAA 1JO8A 3J7ZC 4FF3A 4JYAL 4AYBE 3P1HA 2DZ9A 3CPWP 3N5BB 1N33Q 3U4VA 4F17A 4C0ZA 4OX9L 3SGIA 1Y8PB 2IPOB 2DO3A 3A55A 2K04A 1SLJA 2ZPHB 1TUDA 2K6DA 3CC7Q 2Y90A 4UHVA 1ILQA 4RA8A 1UG1A 2L3QA 2D9UA 5LJ3j 4J6XA 1D1BA 5ECAA 1Q81R 2Z4IA 2R3ZA 3NFCA 5IN1A 3U4ZA 4QVCA 4HIOA 4LJZC 4Y7NB 1E6HA 2X4JA 1QB5D 3E0JA 2PZWA 1VIEA 2LC4A 3H3VH 4XDXA 1SRUA 4CDEC 1U4LA 2CS7A 5C4XG 1VQJA 1WXUA 2FRYA 2F0GA 2FG0A 4J7IA 4PJJA 1VQPA 1E2VA 1VMPA 3FPPA 3OSSC 3MXGA 1WQ7A 1YJWT 1ZKOA 3BDCA 5KRUA 3K5NA 1YCYA 4NB3A 1ZSGA 1HCZA 4QW2A 1NTGA 4KN7C 3EGXB 2UUAL 4PZ7A 3OBYA 4DV4L 3TDQA 4UC4A 1IHWA 4DAVA 4XT3B 1I3QB 5I11A 5I21A 2F1LA 2O31A 3M59A 5HKCA 4H0LC 1ML0D 4LF9L 4JS5A 1UTIA 2L5TA 5E4WC 3MP6A 4L8JA 3GP8A 4LFCQ 1C0MA 3JCMX 2NWGA 5M5YB 3DB3A 1D6EC 1DXMA 1SXTA 5IIFA 2K7VA 3I56T 1LTRD 2XI9A 2R92H 5M3FG 4HA8A 4JI8L 3I4MH 4GKKL 2VNUD 2QASA 4F7UG 1MV0B 2RHYA 4WTOB 1KD1U 2H3EB 2RHZA 4O6JA 4HMJA 2NVYB 2HMAA 1D3BB 5CKHA 1JR0D 4DK3C 1WHHA 1G3WA 2R7ZG 1KTKA 1H8KA 2HL3A 2PI2A 2LRQA 3CXCP 1HR0Q 2F0TA 4U68A 1XNRL 4AFSC 1Q8IA 1VMCA 1N8RU 4N4IA 1MSGA 4HJ7A 1WTXA 4RTUA 3JB9D 1OQKA 3MWYW 1W70A 1OPLA 3KUFA 1KQ2A 2MUYA 2X69A 1QCBD 3FRPB 3NXWA 4LDUA 4LF5L 2ZAEA 1OU8A 4JBMA 3FJ5A 5IHIA 4M77D 5GANf 2HIXA 3M4YA 1Y1WG 1X2QA 1NZ9A 1CHPD 1LVKA 2J6OA 1I50B 5FJ8G 1QLYA 1I1JA 2XN9C 2BE5C 3BVGA 2Z1CA 3HFOA 1PM3A 1LT3D 1N32L 1V8QA 2F0SA 3LWIA 2GTOA 1VQNA 3S3NA 3E3XA 3M0PA 5CV8A 2LX9A 4RTXA 3VS0A 2RHQB 2ZTCA 4C8QA 4JI2Q 1ZQ1A 2NZ1D 1H95A 5GMKe 3NBHA 1AVZC 3MZ5A 5FLXE 2RH2A 3QO3A 3C1FA 3JAMi 2YRVA 1Q86U 1QKWA 2LVMA 3J7YW 1VQ9A 5LJ3f 5FLXc 1GFDA 4KHPQ 2NYSA 1KL9A 1DOLA 4OMPA 2YUQA 1KQSS 1SE4A 1UECA 1I4QA 1VYVA 4BB7A 2LCSA 2SDFA 2AUKA 1PXUA 1VQGA 1X6OA 1PKTA 2CH4W 3VA7A 3V8LA 1MHWC 4OIKA 3OB9A 4A3MH 3ZYYX 1HD3A 1NJIR 1K8AR 3U50C 3G7ZA 2JA5G 1SSFA 4R4QA 3OHXC 2RQVA 4A3FH 4DR6Q 4CJ2C 4C92A 1J9OA 1UHFA 3JCMP 3HOYG 2Z6KA 3MFYA 1PTOD 5TSSA 2ES2A 4E7SA 3QSUA 2RJEA 1Q46A 2JA6G 2WAQB 2A8VA 3S1NB 4OWTB 3A8KE 4LF7L 5LMNQ 5KYUB 1E2WA 2UXDQ 2ZPEB 3A5ZB 4Y52H 1PKSA 3VUZA 3KBGA 4BY1G 4PNOA 1X69A 2EVRA 5EBDA 2WP8J 4M77E 2YTVA 2IHFA 3G48A 4F7XA 3Q22A 1K8OA 1TWHH 5C4JB 2MCNA 2DJFC 4C2MB 3J81i 1KIXA 4II1A 2AQ2B 3QBYA 3VYSA 2KK4A 3A1PA 2CP7A 4RGOS 2DD4A 1SYBA 1YBYA 4K2KA 5LL6S 1P16A 3AB9A 1NBWA 2VZAA 4EMGA 4J1MA 5C5LA 1WX6A 2JA7G 4X62Q 5EKIA 1IB8A 2EAYA 3OYFA 3D31A 2YYZA 2X35A 3M7NA 2HL5C 1T3SA 4A3LH 2OQKA 3QJYA 4TVAB 2J6FA 1KABA 4XT1B 5F2DA 4J9CA 1PYWD 1QG7A 1U5SA 1AHJB 4HAEA 4MHEA 1CA5A 1BK2A 4J9BA 5AT1B 4ELYC 3G4ST 1JU5C 2EYOA 3CW2C 2HDMA 4A3DH 4KD3A 4FSSA 4MNOA 4KGVB 1WZOA 4LXCA 4CC7A 3PIOA 2DY8A 2FJ2A 2PW7A 2VGNA 2B2UA 1K1ZA 5CAIA 5GAN4 3OYCA 2R92B 2M02A 2RF0A 3UPUA 4K6DA 1SYEA 4GLVB 4YWLA 5LJ5f 3UA7A 4M77G 1VOMA 2UXBL 4LUZA 3C2PA 3PMFA 2XICA 2KHSA 1WI5A 2B2WA 4PK4A 3S6WA 2K57A 1EY6A 3LLRA 1FNVA 1W6KA 4PZ6A 1MMNA 2BZXA 1RACB 2FZKB 2D1XA 1HXDA 1R77A 1LTID 1II3A 2HDLA 2R93H 2KROA 2JSOA 2PW5A 4A4GA 1RJTA 3TMEA 1M4ZA 1K9MC 3SWNC 2OJ2A 2HCCA 1RD9D 2D0PA 2M0OA 4JI3L 3FDTA 4KJNA 4L5QA 4UAIA 2EKHA 2DYIA 4ALPA 4DR2L 4H02A 1CQFA 1Y1VG 3MEAA 1DM0B 5J22A 3UDGA 1D5XC 2F0WA 4BY1B 1NG2A 3SDZA 1A2UA 3G6EA 1SJHD 2XWBB 4YCVA 3STBD 4L5RC 4J6WA 4DV5Q 4ZNXA 2WB1B 1FMKA 2F0IA 3MP8A 3J81E 1EY5A 5JOBA 3EFXD 2F0LA 4EMHA 1Q82R 4JI2L 3PO3B 1M90U 2EY6A 4A3JB 2CZ6B 4JZ3A 3BYTB 3TEEA 2ED0A 1H9JA 1VDZA 1G8XA 3X24B 2EYHA 3DLMA 1MKHA 1EU4A 5IP7H 3H3VC 4PJOA 4HCBA 3OSOA 3MCAB 2PQWA 1Q82U 3PIPA 1N36L 1JRIA 3GP7A 4LDXA 2VXFA 4HVWA 1ESFA 1AEYA 2RSNA 2A36A 1L0YB 4J7FA 1KHCA 1I5OB 1PWTA 4KT0E 1VQ8Q 1V1PA 2DIGA 3I56Q 4CJ1B 5FO8B 3CF5A 1H9SB 3E9IA 4MZ9A 3S2DB 1VQ9T 2KJXA 2ATCB 2RJDA 4FW1A 3OYIA 3OBWA 4IPDA 1RDPD 1JJGA 4J83A 3PV0A 2ZT9C 3S1MB 5CKFA 4K2LA 4BWGB 4JJDA 2FL7A 4AT1B 5JJIA 3TCJA 2EFIA 1C7YA 5CV4A 5L37A 2DL7A 1AZGB 1EFID 4LFAQ 5A2QL 2NN6I 4JV5Q 3M0UA 1K4US 2KVMA 1EUJA 3D3RA 3I5SA 4UP7A 4OXPA 2RJCA 3CCQT 2NBFA 4LUVA 1OYXA 2P4RA 4OMNA 4XTYA 5D6XA 3U23A 4A3EH 5CKBA 1HA6A 1BI3A 3NHNA 2VQEL 4IFDH 4EMKB 4UPAA 5GAOm 4M78F 3H0FA 3OS0A 4LF8L 4C92C 3PO2H 4YHHL 4D8DA 1Q82C 2RHXA 4CDFC 3I7FA 1ARKA 5GAOr 2L89A 1M9SA 4X3SA 3J80E 1Y69U 2E5KA 2JXBA 2O2OA 2QGGA 1FNUA 2DZCA 2LS01 4Y28E 4OMQA 3DEPA 3T51B 3OWEB 4C1NI 4KN4C 2KSSA 1VA7A 1SE2A 5C3XA 5I9OA 5IYCG 2FPEA 2K1BA 2HKNA 1F2YA 3CCET 2KEDA 2L0CA 1S5FD 4PG3A 3RUXA 5M5YH 2E2HB 5E1FA 5IGFA 4KRTA 4HVVA 1EQVA 3J7A5 2J06A 4X66Q 2NUZA 2AHJB 1O7ZA 2EJGC 1I94Q 3I4MB 4X9CA 3HOVH 3A8MB 2E3HA 1WJSA 5DY9A 2ECZA 5IXFA 2ZXOA 1IRXA 4PQXA 5CVIA 3NQTA 2UXBQ 1DOMA 2IG0A 2XNAC 3V2TA 2L0AA 4GZYC 2K5QA 1MMGA 1RAIB 1ZSZA 1STHA 1I4K1 2F0EA 3EJIA 4E6IA 3C3LA 2R7DA 4GOPB 2E70A 3H15A 4X6AH 2ESWA 3TU4K 1H9KA 3P7JA 4IALA 1FD7D 2PNHA 1UHCA 3H0HA 4KH0B 3K5OA 2DL8A 1ZYRC 3M4GA 3CCMT 1XNQQ 2ASBA 2K5DA 5LMNL 5KYYA 1E2ZA 2IJ0A 4B3SQ 3HP3A 4MDXA 1L0WA 4ZK9B 1WNLA 2F0KA 5DAUA 5JEAG 2DEQA 4L5GA 1UDLA 2QAZA 1N33L 3BDLA 4IIMA 4ZLTF 1XNRQ 2NZOA 1OX8A 5GAN3 3V8KA 5GAN7 3T53B 4DGZA 2DA9A 4GOPA 3ULPA 2H5XA 3BZCA 3T16A 3OYNA 3EFSA 2L15A 3OYKA 4BI3A 1SRLA 4PJLA 1UE7A 2SNMA 4O42A 2DX1A 4GNXB 1CZGA 3D4DA 4JI3Q 4Q0FA 4OO1H 4M78A 2K3BA 1UE6A 5JVG3 1PG5B 2MIOA 4IUTA 4Z8AA 1XTDA 2BTTA 3TP8A 3VV0A 1AOJA 1YIJT 4DV2L 3QIAA 1OXUA 1X01A 4LNPA 2N49A 3OPOA 2DUDA 4ABNA 2A74C 2FZCB 1CSQA 3EGDA 3MXPA 1WTRA 4KLKA 4OWXB 2PMZE 2E2DC 2E76C 3M55A 2DMOA 2KRMA 4HN7A 1VQLQ 5HGTA 1PNJA 4Q5WA 1K3RA 2A1AA 2XHCA 4HKEA 1OU9A 2ID0A 5JPNC 1U1SA 3K0XA 3PVLA 1I3QH 4JI7Q 4JBKA 2F0OA 1DONA 4RCNA 4L63B 4K0KQ 2CKKA 1ZXTA 5GADC 4OMLA 2R61A 2DF6A 1VQ5Q 4AQYQ 1Z47A 2NN6H 1SYDA 4NXML 2ZJPA 5KE2A 3KLWA 3L2ZA 2F4VQ 1D7QA 5KGUA 3M53A 4QIWB 5EPJA 1TH7A 3W3AA 2JA7B 4DF7A 2LTOA 4N4GA 3HOUH 1Y8OB 1HA5A 1B34B 2OXPA 3BVMA 4CI0C 1LABA 2NVYH 1GUWA 5CGKA 2DJZA 2QXFA 3GTQB 2OAWA 4V0BA 1DZ1A 3SWNA 4C92G 4EX5A 2PVOB 3M56A 5GAOp 5CMDA 3VYRA 2OTJA 2P84A 4JI6Q 1VQMQ 4M75C 4ZUIA 2DFUA 1F9SA 4PMWA 2RD1A 2H3JA 1N5ZA 2DILA 5GAOn 4JBWA 4DUYQ 3URGA 1D1IA 4DR6L 1B53A 2LT1A 5ELEA 3P75A 2KEEA 1U8RA 4LF5Q 2AQ3B 1D1CA 5LJ5d 3SXHA 1O7IA 1SHFA 4KHPL 3HP9A 1I50H 3HKZG 2YTYA 1OOTA 4R9WA 1KNEA 1TR5A 1G3YA 2K5HA 4O2DA 1OXTA 4M77A 1YZ6A 2QA4A 5AJ3Q 1IZ6A 1C1AA 4J6YA 3SHWA 2OTLT 1PA6A 3OW2S 4LE9A 2K28A 2DK3A 1ENFA 2XRSD 2VC8A 3BDOA 4AMCA 4F14A 2BE5D 3HS0C 5AYFA 4K5WA 4DNIA 1YFNA 1R9TB 3HPWA 3LW5E 2MYSA 1U06A 2JE6I 2B29A 2PNIA 2QK0A 3V7CA 2WINB 4A75A 5EKKA 3GTKB 1Z6HA 2VV5A 1OXVA 4KY7A 3GTGH 1STBA 3RNUA 2LJ0A 4AIMA 2UU9Q 2MNAA 2A6EC 2COYA 1RADB 3META 5I2SA 5CV5A 2X6GA 4HVUA 4WJ3M 1EYGA 2PZTA 2NLUA 1E22A 1OPKA 4GS3A 4MMKA 1KRSA 5CV7A 2ZPGB 3KUPA 1IXDA 4A3FB 3RD4A 1HUMA 1Z9ZA 5KH6A 4YIJA 3T1YQ 2F4IA 2KHIA 2DBKA 2E6NA 2XG8D 1BF4A 5JJKA 2PQAB 2K5LA 3JCMV 3NWTA 1PZJD 1Y0MA 1TS3A 4QMGA 5EGTA 4ZRZA 1IBLL 3M57A 1PZID 4M75G 3CPWA 1UFFA 2N88A 4HCEA 1KHIA 2N55A 5DLOA 3OW7A 3Q24A 4M75D 3JCMJ 4BY1H 4M78G 2SNSA 1G2BA 2MF2A 4AG1C 2DNCA 5IP9G 2UUCL 2JVVA 1PD1A 1IREB 1PTOC 3KK7A 1Y57A 3A8JE 1EY9A 2AWNA 4D6WA 4LNQA 1SPKA 1JWUD 1TWHB 3PO3H 2YUNA 2P5ZX 4M77B 1QVCA 1E7ZA 2IPKD 2R57A 4C92E 4ESRA 5FKAC 1TWCH 4TKOB 4F7UE 3CCVQ 1R4PB 1HYOA 2C0IA 4IOCA 4GLKA 1VF5C 2DETA 4RTWA 1WHGA 4HJ5A 3IRBA 3L2PA 1WD0A 3MEUA 2E64A 3F2UA 3OTOQ 2RQUA 1JB7A 2ENMA 2KDSA 3V8JA 4BBSB 1XYIA 1SNPA 2QI2A 4Y91A 4M1UB 3SHLA 4MTNA 2KBTA 2EOTA 4JZ4A 2V8KA 4IUVA 1BR9A 1D5MC 4JRQA 1Q81U 1UE5A 3KYHC 3ULJA 3S2HH 5C0XH 4M75F 2VY3A 4U673 4A3DB 1SJED 3PCOB 2XU8A 4CRIA 4H7BA 4J6HA 1K9AA 1EZ6A 4F88A 2DY7A 1HZCA 2YLCA 4XTVA 4Y92A 1D09B 1BU1A 3CCRT 1QVFP 2FHDA 1VQMT 1YJWA 1Q3LA 4BDZA 2RQWA 3BDUA 4JI8Q 4I65A 3GF5A 3OYDA 5D3DA 3PNWC 3I70A 5M3MG 2P4TA 4PFZA 2R5MA 2D8HA 1EFWA 2UXDL 3BZKA 4EPCA 4C8QE 1BIAA 1VQEA 1DYQA 3RLOA 2XIDA 3EGDB 4KHZA 2NZHA 5CBEE 5M5WH 1EEID 2CGHA 1B50A 2YLBA 3CCUQ 3GTQH 1TU0B 2UUBL 1M8VA 2L4NA 2R7ZH 1GO3E 3RKWA 2OI3A 4DV0Q 5K5PA 1M2OA 2LMJA 4DUYL 1PRTB 1D3BA 3MEWA 2XSCA 4BY6B 3LWUA 1K8AC 1RHPA 5M3FH 3I4MG 5CV6A 2MP1A 1V1CA 1OXXK 4NDXA 2J0TD 4DV1L 1UEAB 2LKVA 1EY4A 1YIJQ 2N78A 2K2VA 4ZYSA 2F2VA 1PSFA 3QOLA 4A4IA 1PH9A 4M75E 5EG2A 1OX9A 1HTPA 1N36Q 1YNZA 2C5CA 4KMUC 4K6LA 2JMCA 2QA4Q 5D6WA 4ODGA 5KCHA 1SMYC 2ZTDA 1YNND 3G6ET 3CMAT 1T0JA 3NBHB 4K5VA 3RMQA 4P72A 2DL4A 4C8QG 1PH3A 3K7UC 1M8MA 1TUGB 1UWVA 3TP5A 1JOQA 2NUTB 4C5IA 1IW7C 2C9OA 1ZYRD 2RKSA 3P20A 5FLMG 3NPPA 3SR1A 3LNNA 1UUEA 2EJFC 3QWYA 4WF2A 4BACA 1ABOA 5GJVB 5C4XH 4B6MA 3S2DH 4IFDJ 5M3MH 1OTCA 3P8HA 3K6OA 4A3GG 3RERA 3EVQA 4JUVA 3MXNB 1AZEA 4WRDA 4FF1A 4LUOA 2EYMA 1VQOQ 3UDIA 1YVCA 4UY8C 2HCKA 5IGEA 2PNRC 4HT9A 1X3GA 4V190 1CT1D 4FO2A 5IT9E 1C9OA 2IIMA 2JS0A 4LK1C 2I5MX 2J7ZA 3HEJA 5GAN5 4OF1A 1YWOA 2ED1A 1GL5A 1EIFA 2AQ1B 2JN4A 2MO0A 2CT3A 1XJVA 4QQGA 3TS0A 3LX7A 2D6FA 1Z7TA 3M0SA 1D0XA 2CUBA 1QWYA 1TXQA 4QJFA 4BBRG 4B3RQ 3GTLH 2LZ6B 2WIIB 3LGLA 5CKEA 4IZ8A 4EMKA 1MHNA 1VYTA 3L2VA 3RN2A 2V1RA 1BB9A 1RUWA 2GGRA 2CP2A 3NHHA 2Y0SG 2E4HA 1QKXA 5D6YA 5L8RE 4M77C 3SK8A 2WV6D 1F9QA 3EG0A 5KIXA 5LJ5j 2XGTA 3K81C 3PQIA 1XNIA 1R4QB 4X65Q 5C44H 1LT6D 1VQ5A 4C92F 1ZLMA 4FVMA 4ME3A 5IP9H 1B8AA 4P75A 2FFKB 4JI0Q 2MOXA 5IH2A 3CCUT 2OTLQ 1OO9B 1SYGA 1IHVA 3Q1JA 3Q0AA 1KNAA 1ZBXA 2XK0A 1YCSB 3CCLT 3A8IE 2MAMA 2CZ7B 2JMAA 2BZ8A 1B70B 3CCJQ 2L3RA 4KJOA 5LMUQ 1I94L 3GV3A 2JA7H 1NMGA 4R8IA 2O5JC 2BUDA 2GNCA 2FO0A 3CC4T 3HGBA 1G291 4ATOA 2I46A 1WJJA 1RIPA 1HNXL 2K4YA 4MZTA 1GKHA 2E2JH 4QQBX 3M5AA 4PJOD 4Z89A 3R2TA 2XWJB 2VWFA 4DPGA 3MPUB 1CUKA 2JYOA 3AQQA 2AKWB 1Q86C 3LWHA 2YDLA 3NUCA 2EIFA 3J81j 4XTWA 3I4NB 2QQRA 3PUYA 4OL7A 4WJWA 1S72A 4I7ZC 2RPNA 1B4OA 3GTMB 1Z9FA 4FYVB 1M3CA 1JEGA 2E5QA 4DV0L 3PGGA 3DB4A 2JA5H 1SHGA 5J3BA 1WVLA 5IYBG 1VQ7A 1VQKA 3HOWB 3QUIA 3CCSQ 1G83A 4C3HH 4JJBA 1Q90A 3KLSA 1VQNQ 4FYXB 1H9MA 2GBQA 1BCMA 4BDYA 3OOCA 4M78B 4JS4A 5BR8L 4IURA 2RHIA 1EYAA 2E2IB 4A4KA 4ZAIA 2G9HD 1K83B 3GTOH 1PRTF 1NEGA 1EOVA 5I6YA 1LTLA 2EBPA 2DYBA 4JOIC 3K80C 4MZMA 2P0KA 2HSPA 3HL8A 3CCEQ 1QNKA 2MK5A 2SEMA 1EOTA 1K0RA 1Y1VH 3GDEA 3X3MA 1ZHIA 1UE9A 3M0TA 2NTSA 2ICEC 4E7HA 4GN4B 4N0AC 1VQDA 1YITA 2B63B 2JP1A 1YP5A 1CSKA 2K3YA 4DR4L 4IPHA 4JC0A 5DEHA 1JBMA 2QKIC 2RMOA 4OHJA 5FK9C 3SK6A 1GUGA 1FWZA 1BCPD 2XDBA 3UF4A 2B2TC 1QMCA 3VYTA 4EQ5A 1JORA 3MA2B 1GUNA 2LQ8A 5JEAJ 1I6HH 4WCIA 3WVDB 4LWCA 1ZBJA 2JOYA 6AT1B 4ZUJA 4A3KB 2WAQG 2RO0A 1G5VA 2HAXA 2JZ2A 4BD3A 3JAME 1PH5A 4LF6L 1YJWQ 3GTPH 3M54A 3EHRA 1JJ2A 2PPBC 1JB3A 2CQOA 3I56A 1OI1A 2KVQG 2CKZB 1G8ZD 5IGDA 2F0MA 3T1HL 1IKMA 2D9TA 2MPMA 4M7AB 1I5LA 3ULLA 1U4PA 1GJXA 1KQSP 1Q81C 3JCMg 1TT2A 1R8OB 1RLQC 2PTKA 4BUGA 1PFMA 1K76A 2EJMA 4FYWB 1KLUD 4RCCA 2W0ZA 3H0GG 1A63A 3CMAQ 1YN8A 2LP5A 2L55A 4BBSH 2CZ0B 3IAYA 4OMOA 4L59A 3CC7T 4A3KH 1PSEA 3TEHB 3I4NG 2F0NA 2DJQA 2J4XA 2KEAA 1KFZA 4QQDA 3OS2A 1SNOA 2G5DA 5I9PA 5C44B 1WPYA 1NY4A 3L7ZC 3HRSA 4HT8A 3AFPA 2EQKA 2EJGA 2Q2IA 3R8BA 1GBRA 2L2PA 3U9OA 1VQPT 4QUCA 1NM7A 1MJEA 4UP8A 4OMFB 3HOZG 3OYGA 4G57A 3HZXA 3MEFA 2RK1A 3JAMc 4RTYA 3UA6A 2JK8A 2MWPA 2JN0A 2B63G 3DUZA 4M8AA 1TKWB 2EKOA 3SK4A 1E1OA 1M30A 4PJMA 1UE1A 1HFGA 2EJFA 2DRKA 1T3LA 2XIWA 1SBBB 2MO1A 1XWEA 4KGXB 1TQOA 3PUZA 1M90C 4C0GA 2EVBA 4JJNK 4IUPA 2C35B 1QZGA 2E12A 2OEOA 3G1JA 4DR5L 2A37A 5KCOA 4LF4Q 2VS1A 3L1AA 1HZBA 1C0AA 4DQ2A 2F0VA 3GO5A 3PGZA 1TWAB 1AWWA 1MNDA 4JJCA 5J26A 1KLGD 2ROTA 4C3JB 5LJ5e 1ENCA 3I3CA 1JC7A 1T5EA 2CQAA 1K0XA 1M1FA 2BIVA 2NTTA 5KYXA 1EY0A 5GANg 2Y0SB 4TRDA 1SF9A 5H1SE 4P74A 3CMAA 1PYBA 4GY5A 1UGQB 4J5YA 3VA5A 3F2DA 4QKUA 5LJ3d 1HQMC 1YNXA 1VQ6A 1AWXA 1X2KA 1U4MA 4POFA 3EH2A 4DK1A 4KHVA 3JCMh 3THKA 4J9DA 3SEBA 4ZKBB 1CKNA 3QG1A 2NVXH 4PFOA 2HQXA 1WXBA 2EQIA 4JW0A 1GXDC 1TU2B 4LFBQ 2XTIA 1QUQB 5E4XA 4AYBG 1JQYD 1GVPA 1UAPA 4DV5L 3TVTA 4A4HA 3CAMA 1O75A 3S24A 1ILPA 3QDRB 2NB0A 1SRMA 4KD4A 3OYEA 1DGSA 3FDRA 3NSWA 3CBOA 3RN5A 2ZPIB 4IPGA 2QG9B 5IT9L 2RDGA 4OP0A 2AHOB 2B63H 5ELBA 5M3MB 1M90R 1MIUA 2IW3A 2R5AA 2K5IA 2KOLA 1ZUKA 4NL2A 2NN6G 1HQRD 2O88A 5EBCA 1ZUYA 1S5BD 1PFBA 3J80L 3AYHB 5GAOl 4DXGA 1QP2A 3VR5A 1VQ8A 4UDUC 2VQFQ 4RHSA 4GNXC 3BG3A 2EYJA 2V4DA 2RCFA 5L23A 1YITT 3RLNA 1H92A 1Q1BA 2AT1B 5CCAA 2L1BA 4K11A 1N9WA 3MXNA 1S72Q 3M4OH 3V7RA 3IKJA 3CCRA 1J6QA 3GTPB 3I5RA 3WXMB 2RSOA 5M5WB 2DEUA 1HNWL 2JJQA 1RTOA 2BE7D 4C2MH 1VQ7T 3H41A 2DN8A 4C3IB 3CMEA 3GLXA 3HTRA 1R0BG 3JB9G 5ELCA 3SVMA 4JI6L 3S14H 2RI5A 1BO0A 2A69C 4RCBA 1JJ2P 1ESRA 2M9VA 4ME5A 4ZKCB 2AZVA 1ACMB 1TIID 4M7DC 1UB4A 1IYUA 3CEYA 3FIFA 2M2LA 2E3IA 1M1KC 2B2YC 4ILWA 1F2LA 3VYHB 2WACA 1STEA 2J6KA 1X43A 2N3SA 1X3PA 4HSPA 1Y14B 5G3LF 2WAQE 1HHVA 1Y1WB 3GIBA 5C4ZA 3CMEQ 1NUCA 3I9QA 4FIBA 1Y71A 3MKDA 4NPSA 4QT7A 1N9RA 1LTTD 2EYLA 5GAMf 2FMCA 1D2BA 4HCSA 3L0OA 1M1KR 2DRMA 2H8HA 1WFQA 5GQOA 1KG1A 1AD5A 4OB0B 2LY7A 2H1EA 2VGMA 3HRTA 3C46A 3OMCA 3EFRA 1GCQA 3NEMA 3LYIA 1KJWA 4NS5A 2GFUA 5LJ3e 1KAWA 3REAB 2SRCA 3G71A 2K5FA 4JRPA 5M5XH 5A35A 1J5EQ 1LUZA 1TS5A 2YV5A 2R93B 2EYQA 3X25B 1IHZA 1XJWB 3F2CA 2ZZDA 1VQMA 5C3EB 3B6YA 3K7AH 5DNFA 1E7OA 2OTJQ 4RTVA 2BOSA 2MFIA 3V96A 3K5MA 4VUBA 3H0GB 1X9NA 4EMKC 3RMHA 2QEJC 1PH6A 1IYVA 1WCMB 1N8RR 4CC2A 1J8IA 4A3IG 2VL6A 1EL0A 2JTEA 2O4XB 4TQUS 3SE0A 4LF4L 1FXXA 4M7AC 1X54A 4M78E 3JB9H 3JC66 3MTSA 4QY7A 3EIVA 3UI2A 5IWAQ 3OS5A 3DHQA 2EZVA 1B7TA 5IGGA 3RZDH 4A3CH 1BQQT 2RDHA 3A54A 4BE0A 3VR4A 1F2MA 2M0YA 2VB3X 1SSOA 4QF4A 2OQ0A 4JPBW 1VQIA 5JAVA 3ER0A 3GTOB 1VQ4T 3PF5A 3H0IA 3RR6A 3ERSX 1KDCA 1YHQQ 4O0AA 2JT4A 2JUFA 1AWJA 5JEAH 4X62L 2EW3A 2E41A 1Q1EA 3PMIA 5CQYA 4IPCA 4OWWB 5K36G 1Q86R 3I4LA 1W6XA 5BR8Q 2Q8TA 2FYKA 3HRZC 1YI2Q 1X27A 2K32A 1SDFA 3OMGA 2OF1A 2BDNA 2BZYA 1T0HA 2DTIA 3OYLA 2HD0A 1LLRD 1RCVD 4ZQ3A 4LFCL 3TN2A 2OWOA 4XTZA 1OZ2A 1H641 3KF6B 2KYBA 4QB4A 3JCMQ 4GN3B 3X3NA 1HK9A 3STBC 2VQFL 1FGBD 5KYIA 3NP8A 1JJCB 1QVFA 3KLRA 2G3RA 4TSSA 1JMCA 2BH8A 3V7SA 4KK7A 5KNDA 3EFOA 2KXCA 1XXGA 5GROA 1BUVT 2F3VA 5GAHC 3M4OB 3SB2A 2K2MA 2JTMA 1HXYD 1YEZA 4OGQC 4JI1Q 1MV3A 5FW9A 2X6LA 2HZYA 3MEHA 1KD1R 2E2JB 4FXDA 3QB3A 1HZAA 2JA6B 3HOWG 1SNCA 1NR2A 4YWKA 2WFWA 1CFMA 3N6RA 4C3IH 1ET6A 4A93G 3VRZA 2LX7A 5FRMA 4GKJQ 4M7AG 4A93H 2D8JA 1RAFB 4AYBB 3H94A 3QIIA 5E3FA 4GNXA 2KT8A 2ZPFB 3W5OA 5LL6X 1K8AU 3A98A 2PVDB 3CC2Q 2IY5B 3GTMH 2F0DA 9ATCB 1IKLA 1L1OC 1VQHA 2LMCB 5C3EG 3LH5A 5LJ5h 1X6BA 4TVRA 4YWMA 3CXCS 5T1IA 3UDXA 1PC0A 1BNZA 3LGFA 4IN3A 1TG0A 1WCMG 2VW9A 1V1OA 4E7KA 1A3TA 5KYNA 1CK1A 5KYWB 1C4QA 1F9PA 4C3HB 3VYUA 1BCPB 2L8DA 1TVXA 3V05A 1HNZL 1CKOA 2Q2UA 3X26B 5ISRA 3INZA 1NE8A 1DJRD 4B08A 1N9SA 1K83H 1TWBA 2FMMA 4R4TA 2PQAA 4DR3L 3CC4A 3FJPA 1BBUA 1LACA 5K36H 4XQ3A 2RN8A 2HHHL 1NYGA 2V8IA 3I72A 2QGQA 2GN5A 4BE1A 1LJOA 1VUBA 1S3OA 2CT4A 4MTKA 1L0XB 2GQIA 1YJNA 4OIJA 2ATWA 1XQHA 2OT2A 3CRKC 1LYLA 5M5XB 1X75C 3GNFB 3CCUA 3I35A 2LNVA 2E6ZA 1TWAH 2Y0SE 1IO6A 1LOJA 2EE1A 4RMOA 2VXWA 3H0GH 1ZUUA 4C5HA 3EBEA 2DXBA 2VQEQ 3J81L 2E2IH 2KE9A 2L3PA 5T1GA 1I6HB 4M7DF 1EX4A 3OYAA 3I55T 3FC3A 3JCMW 1EYDA 2R6GA 2OX7A 3RMSA 3OW2P 3I73A 5C0XJ 4B3TL 1BI0A 2F2WA 5IT9c 4C3IG 2F69A 4PFPA 3NK9A 4BBRB 1JE5A 4DBFA 2K33A 2DVJA 1IXRA 2P0PA 1GUSA 1LTBD 2K05A 3ND9A 4R0KA 3KDFA 4P71A 4S3SA 4RH6A 2HQEA 4RG8A 2A3LA 2DNUA 1PTOF 2QGFB 1WD1A 1EZ8A 4PL6A 5KYWA 1WJQA 1CZWA 1TWGH 4M7AE 4V2SA 2N8NA 1TTHB 1B2TA 5M9OA 1EQRA 4JK1C 2JW4A 3WOFA 4HJAA 4K14A 1LO5D 2VB2X 3TZUA 4RTTA 4A3GB 2A19A 1BBZA 2PO4A 1AZPA 3WWVA 4NXNQ 2LT4A 3HOUG 4DV3L 1G2TA 1SE3A 3RDVA 1YNJC 4OB2B 1AN8A 3PUVA 2Z6KC 3C4SA 4DAYA 3HOZH 3DKMA 4HCKA 3DEOA 3IL8A 3KF8B 4RUGA 1WDXA 2RA2A 1Q7YU 3PIP3 1BVSA 1OZ3A 4R56A 4F7UB 2AZSA 1E24A 2LFNA 3I4OA 4JCVE 1FL0A 2FVUA 3RNJA 1NLPC 1LPLA 5FOBB 3HOUB 4X64L 2M00A 1K73C 4RAUC 3S1MH 4K0KL 5IE8A 1VQCA 4EIKA 4FSXA 2A7YA 3C95A 2QQSA 2EDGA 4BA1I 3RESA 4BS9A 4RKUE 1QVGA 1C48A 4X3KA 1VIFA 2G6FX 2Q8RE 4A3DG 2O5IC 2DM1A 1HUNA 2EQUA 1IBKQ 4O5VA 3MO8A 2ZXPA 1A15A 1GXIE 4DV6Q 2JEAI 3EAEA 1NJIU 4LUEA 3FP9A 1HNWQ 2X4YA 1O7LA 2F0FA 4AFZC 3EFOB 5GAN8 4HIDA 1WTHA 5KE3A 2KXDA 5FU6B 1SMXA 1XMOL 1PV4A 4DV2Q 4CC4B 1HJPA 4GLMA 2B8FA 2I5HA 4FP5D 2KHJA 1K73U 1A0IA 4DA4A 4YTLA 3J7AV 2CP0A 4QIWE 4XU0A 4H13C 3U9SA 5BN3A 4OO1G 3EG9B 2D0NA 1VQ4Q 3MXUA 4NKLA 4KI0A 3G4SQ 3CQTA 2ZPBB 3EA6A 2I07B 3KDFB 2QCPX 2RJFA 1GD7A 4CDCC 1R9TH 3M3YB 4ZGJB 4X1VA 1IGUA 1Y8NB 3DM3A 2FXQA 1LV9A 5G3LD 4XYQA 3MAQA 1I5FA 4KV6A 5EC7A 3I2ZA 4LFBL 1RF2D 1H3ZA 2O9SA 3M0RA 1YJ9Q 1E0BA 1JOKA 3GTGB 1RLPC 2KRNA 4XTUA 1JXOA 4C5GA 1BCPC 1MI2A 4PNYA 5E7NA 3K58A 4LN2A 5JVH3 3T13A 3HKSA 1WGSA 1K0SA 1PTOH 4KKUA 1MBYA 1CM9A 1S4ZA 3A8HB 3CQZB 1N27A 4JDSA 2VASA 4OONA 3BS1A 3VS2A 4EQOA 4PMBA 1SG5A 4CJ0B 3VR2A 5KYYB 2LQNA 2YUPA 1BOSA 4A3BB 3M85A 2LJ1A 4C5EA 8ATCB 1NSNS 2OAUA 1SNDA 1WCMH 4NXMQ 1VQOT 3R2IA 3AT1B 4NOYA 1XTCD 2HIVA 2KT1A 4OVAA 4OB3B 4FL6A 4LDWA 1AW7A 2Z0SA 1C8CA 3EG9A 1H3HA 3BU2A 4AFUC 5JJLA 3JAML 1VQ6T 1PRLC 2YRCA 4PJOC 2QF7A 2DTOA 4GLAC 3CBMA 3UATA 3OYHA 2CVRA 5CV9A 3FKIH 1HFNA 4CC3A 1FYCA 1AE2A 1NBEB 2YUOA 5HCKA 2F0JA 3I55A 2IWHA 2M1HA 1TUCA 4XIGS 3QJ6A 3HKZB 1L1OA 3F8TA 1KQSA 2KBNA 1LCKA 1WA7A 3M58A 3FHWA 2CH4A 3PMTA 3A56A 1JWMD 4LW1A 3PE0A 3D6WA 4NXNL 2QEXA 1A2TA 2Z4HA 4A3GH 4JBJA 1VQAA 3SD4A 1KAAA 2K03A 2KCCA 3PUWA 4DBRA 4JI7L 1CKMA 3S2HB 4I7AA 4C1NK 1YJNQ 4A3EG 3Q8DA 2EYFA 3CHBD 5IXBA
chains in the Genus database with same CATH topology
2D0QB 3GNGA 4DV4Q 4JV5L 1EIYB 4UP9A 4JI4L 1BYMA 4UY8C 2GFAA 2P0QA 1YJ9T 5C0MA 1PFSA 2JA6H 4RG2A 4PJOF 5LMNW 1W2BA 5CQXA 4M7DG 3NELA 2UXCQ 5C0XI 4HJ8A 4B3SL 2LQKA 2VUMH 4JLIA 3ASKA 1L2FA 5ELOA 4KULA 4JLGA 4JRIA 4XTXA 1V29B 4OX9Q 1O9SA 5GAMg 1NPRA 1Q8KA 4C92D 4QGUA 4XAXB 4M78C 5HY6A 3FEOA 3SFMA 3M3YH 3F70A 5CR2A 1SROA 3HFZB 4DR2Q 4DV3Q 2R93G 2RI2A 3J7AF 1AH9A 3OYYA 5LJ3h 3T9NA 5CK9A 4X34A 4R4IA 4QL5A 3ZEHA 1V43A 2L5QA 3CCQA 3CQZH 4QVZA 2E8GA 1X55A 2F52A 4P73A 1TXYA 4IO9A 4A3BH 3OSVA 2DGYA 1VQFA 3FRNA 3J81c 3TRZA 4DV6L 3S1RH 5C44G 1EWIA 5LJ5g 1I81A 2HBPA 1YHAA 2MQHA 3L2WA 1ASYA 3UDCA 2WSEE 3JSCA 3J80i 3CCEA 1EQQA 1SN8A 4M7DE 4FDBA 4C92B 4DV7Q 5I2MA 1Y7XA 2QQBA 5FU7C 1NMFA 4DUZQ 1BKBA 2F5KA 1XMQL 2Y4XA 2DKGA 1Y96A 4E47A 5CKDA 1IYJB 2E5LQ 4IUUA 2M16A 1JJ2S 5A0GA 2VYTA 3KJPA 1FJGQ 4MZPA 4JOIA 2F4VL 1YHQA 4HIMA 2D62A 3RKYA 3AEVA 4L5SA 4J8OA 4B3ML 4M75A 2WSCE 2GVBA 1PHJA 1P92A 5A2QE 4EDUA 2UUBQ 3HFNA 3ZFJA 2KCMA 2YTXA 3E9HA 2F5TX 4FU6A 5GMKh 3J80c 3I4NH 4DAYB 4A54A 4DOVA 2PUOB 4LD6A 1YJ9A 4XU2A 5IYCH 2KENA 4F7UA 4C8QF 2IHEA 1XNQL 2OTLA 4YHHQ 4OGEA 4BBRH 3U58A 4BI4A 2EQJA 2DXCA 2X4XA 3FB9A 3PO3G 2EQSA 3CPWS 2E1HA 2KCTA 4HCCA 4E7JA 2OTJT 5GANd 4DR3Q 3S3MA 2HHHQ 4KBMB 5C6SA 2B8AA 3JCMf 1YJNT 3GOXA 4L6V5 4YY3Q 3C94A 1FX7A 2JTFA 1K9MU 1A62A 2NVTH 4M77F 3CBPA 2DXTA 3G4SA 4LF7Q 3JCMc 2DXUA 4JI1L 3CCVT 4ZN1A 4BBSG 2JQOA 4BA2I 4ZTJA 2CFMA 2WB1G 4A76A 5FU7B 1CSPA 4J15A 1MJCA 1WJRA 2ZM6Q 1UGPB 2PU9B 4M75B 2RHSB 1KC8C 4GOPC 4YCWA 4MMLA 3HKZE 1XMOQ 4JRKA 5HK3A 5GMKl 3UDFA 1GM5A 3HOYH 3S3OA 4DR7Q 1HNZQ 3P8BB 3LH0A 1QVFS 1WYDA 2I2LA 3S17H 2C06A 3JB9F 3VDYA 2MMPA 4BXXH 2EWNA 4BY6C 3GD7A 5FLMH 4X66L 4A3CG 3NTHA 3QHSA 5GMKj 4P5NA 1SFOH 2MI6A 4C3JH 4BI8B 1PH1A 4A3LG 2UU9L 1BI2A 1YI2T 2QTXA 1X3EA 4APVA 2ZJQA 1KQ1A 3DLLA 5CIUA 1L1OB 1LNXA 3OY9A 3M9BA 5DM7R 2LDMA 1ASZA 5AJ3L 1JT8A 1IBMQ 3O8VA 3C12A 3UE0A 2E10A 2K75A 1MGQA 4NL3A 1QVGS 3W1BA 1XPUA 1HR0W 3PTAA 4C8QB 1KD1C 3CCST 4MDWA 4PKCC 3OS1A 5GMKm 2KQWA 2CYZB 3E1SA 4QVDA 4DR5Q 4IFDI 3VU3C 4YY3L 3TS2A 2K3XA 2RHUA 2F3IA 2LXJA 2DD5A 2RF4A 4E7IA 4BY7G 4DKAC 4LF6Q 1U1TA 3RIRA 5FU6C 4RG1A 1HNXQ 3T1YL 3MEVA 4ZGDB 2KY9A 4IUQA 1IBLQ 1Q12A 3F2BA 4DOWA 4DK6C 2K50A 2O01E 3R6OA 1V1QA 3A5UA 1IL2A 5IWAL 3PUXA 5LJ3g 3L2RA 3FLGA 2IX1A 4KUIA 1W3SA 3QYGB 2R7FA 4GKJL 2HQLA 1N34L 3OQ5A 4GLXA 4PJOE 4L5TA 4ME7A 4OGCA 1U0LA 2IT1A 1N8RC 5GAMj 4C0DB 2Q2HA 3A8OB 4A3MG 4FM4B 1YI2A 2E2HH 1VQLT 3CCVA 1FJGL 3CD6T 2BA0A 1QP3A 3AHUA 4M7DD 1VQ4A 3M4PA 3CPFA 4N4HA 4HCZA 2EQMA 5C3EH 1VQ5T 1RL2A 2CWPA 1P8LA 1S72T 3CXCA 1E3PA 1T9HA 4OO1I 4LFAL 2KMTA 4A3IH 2LCLA 2RI3A 1VQNT 2CZ1B 4ZGEB 3VKIA 3S15H 2GF7A 4ELZC 4DUZL 1B34A 2M9UA 4A53A 1XMQQ 3RR5A 5A0LA 2HT1A 4LDVA 2KAFA 3SWNB 3JCMd 2E5LL 4C0DC 1CKNB 4HJ9A 3E9FA 2XDDA 1G6PA 3F1ZA 2K5NA 1UGRB 2K14A 3L2UA 3CCJA 2DIQA 3PSIA 4A4EA 3RZOH 4R1JA 1W4SA 1M1KU 3RLFA 4BE2A 2QQ9A 2CCZA 4IJHA 1BI1A 4C8QC 1PH7A 3W1GA 3CCMA 4LDYA 3PFSA 4AQYL 3ZJYC 5C0XG 5IYDG 4LF9Q 5GAMe 5GANe 2R92G 5GAEC 4GN5A 2ZGWA 2QDYB 4A3JG 2E65A 4LF8Q 1NPPA 1VQKT 4C8QD 4X64Q 3UE1A 2K52A 1YIJA 2V8JA 3UWNA 1M1GA 4ZN3A 5HK0A 1M5Q1 3E9GA 3QKJA 3RKXA 1LM0A 2UUCQ 3HSBA 2DVEA 3OYBA 1S40A 1PH8A 3MP1A 3GPLA 1WOCA 4DR1L 2DTHA 1G3SA 5GAMh 4R4CA 2JA8H 2IX0A 2PI2E 4IJLA 5DLQE 2XD0A 4DR7L 1QVPA 3FKIG 2IVWA 1BBWA 5GAN2 1A8VA 1U5KA 2NVQH 1W2BS 2GQVA 1BIBA 2Y4YA 1J5EL 1X56A 1X3FA 4PLLA 4DAMA 3GTKH 2JA9A 5IYBH 3CC2A 2AMCB 1HH2P 2RB6A 4E7LA 3L42A 4XU1A 1VQ8T 4JI5Q 3GTJH 2DPPB 2WSFE 2RK2A 4N0AA 1WQWA 3KOJA 4M7AD 4RMFA 1D8LA 3QYHB 2ZM6L 1G3TA 1Y96B 5FJ8H 5GAGC 1UGSB 2LCCA 1VS0A 1XPRA 1PH4A 5GAMd 2ALYB 4DV1Q 4KHPQ 3T1HQ 3D0FA 5FROA 5IY0A 2ZCFB 2GVAA 3TQYA 2EJ9A 2R58A 1KC8U 2AWOA 2B3GA 4WJ4A 4POGA 1KRTA 3S1QH 3A8LB 4GKKQ 2K5VA 2YU9H 1K8GA 1DJ7B 3OA6A 1Q7YC 1SR3A 3H6ZA 4LD9K 3S16H 4YCUA 4B3TQ 3S1NH 3JCMe 1YHQT 2Q2TA 3PT9A 4PZ8A 2VUBA 3JB9I 3MHXA 3BW1A 5C4JH 2LSSA 3JRZA 1RI0A 1PYSB 1IBKL 3X20B 3PO2G 3M9QA 1E1TA 3HOXG 4XK8E 4F7UF 3BFMA 1QW1A 2ZJRA 1YHBA 2RCNA 3QZ9B 5HGQA 3JB9J 3NENA 3OTOL 3WVEB 2QQAA 4A4FA 5LMUL 4DR1Q 1B7YB 4X65L 3ME9A 1VQBA 4C0FA 4B9XA 3L2QA 4JI0L 5GAN6 2O4XA 2MWOA 3LGJA 4M7AA 1JB0E 1N6AA 3VJPA 3ZBDA 2BH2A 3CCSA 2UXCL 4DR4Q 5ELNA 2RM4A 4PLIA 2LXKA 2I5LX 2XDPA 5J39A 1Y07A 4JYAQ 1NJIC 2BKDN 1KXLA 1OXSC 4JG2A 3UT1A 3CCJT 1QUQA 3X28B 4Z02A 4X9DA 2ZTEA 1N34Q 4JI5L 3JCMb 4AH6A 2DAQA 1IBML 1PH2A 1NE3A 4FT2A 1V9PA 2XKOC 4R55A 3HOXH 5CO7A 4A3FG 2UUAQ 4Y7NH 1X65A 3BJUA 5GAOq 4IKFA 2I0QA 3QPHA 3EN2A 3H3VI 4XTCS 3A8GB 3CCLA 4KUDK 4PJOB 3HRUA 3HOVG 4M7DB 2HNIA 2VUMG 1FGUA 4QQ6A 1HZ9A 1VQOA 2PVGB 3CC2T 1G51A 2X4WA 3KF6A 3VUBA 1PVOA 1UEBA 4R4OA 1AE3A 2EXDA 4BXXG 3QXEB 4B9WA 2JEBI 2K4KA 1TWFH 3CMET 1XPOA 4JI4Q 1VQLA 3CP0A 2D0OA 5FRNA 3G71T 3E19A 3OYJA 1HR0L 5A0DA 5GANj 1I8FA 5GANh 3PF4A 3HHTB 2JNGA 2JA8G 1N32Q 3OYMA 3E0EA 3BY7A 2QEXT 4HIKA 3NTIA 3AFQA 4DV7L 5IAYA 3KFUA 1XOVA 2GCXA 2PUKB 3QZ5B 4IFDG 4B3RL 2VXEA 3P8DA 3VYGA 2WB1E 3H8ZA 4XU3A 3M4QA 2YHTA 4M7DA 2V1CC 3TREA 3A74A 4ZTFA 3K8AA 2FB7A 4A3JH 1FVIA 3KXTA 4M7AF 4FT4