3TREA

Structure of a translation elongation factor p (efp) from coxiella burnetii
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
129
structure length
129
Chain Sequence
THSTNEFRGGLKVMVDGDPCSIIDNEFVKPGKGQAFNRVKFRNLKTGRVLERTFKSGETLPAADVVEVEMQYLYNDGEFWHFMTSENYEQHAASKEAVAEAKQWLKEEALCMVTMWNGVPLSVEPPNFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor P
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Translation
total genus 20
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3treA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3treA02
3IRBA 1V43A 2LQ8A 1NJIC 1L1OA 4JI7L 1X3FA 1W2BA 3I4OA 3UE0A 5JJKA 3H15A 4IFDG 4YWKA 3G4ST 1K9MU 2MQHA 3FHWA 2JA9A 1OTCA 1XPUA 1C0AA 2VW9A 1VQMT 1XMQQ 3L7ZC 3H3VH 3ICEA 3LH0A 3CCEA 5M5XH 3GO5A 3CCVT 4L5SA 2OWOA 2R93G 4A3KG 1K3RA 4GNXC 1UEBA 3TREA 5IE8A 4DV6L 2EQSA 1PA6A 1FJGQ 1NE3A 2ES2A 3GTOH 5J26A 4LF4L 2MWOA 5C4JH 3E0EA 1EWIA 1SSFA 4OWWB 2K50A 2YV5A 2PMZE 4P71A 4YWMA 2KBNA 1HJPA 5IYCH 1PH6A 4GN4B 1PH9A 4LFCQ 1N32L 1X54A 4UP7A 2OTLT 4LF8L 3U4ZA 5GROA 1B7YB 4XIGS 2UUAQ 4GS3A 3J80E 4X34A 1M1KU 4JI0L 1QVFA 4YTLA 2Z0SA 4JCVE 4LFAL 4BXXH 2NVXH 5JJIA 4A76A 3RZOH 1WI5A 1Q86C 2WB1E 3B6YA 5C3EG 2R7FA 4A3IG 3KJOA 2K5NA 2QA4A 4R4QA 4DV1Q 1XMOQ 1NMFA 2E8GA 2QEXT 1YJNA 1XJVA 4DR6L 1KQSS 1WJJA 5C0XJ 1WOCA 4POGA 1HNZL 4DV2Q 2JA7H 4BY7G 4JC0A 3S2HH 1XNRL 1AE3A 1VQNT 2BA0A 2Q2UA 3HOVG 4OONA 2ZTDA 1SN8A 4A3DH 5IT9E 3FKIH 1H95A 4RG2A 4LUOA 2ZM6Q 5LL6S 1S3OA 4P75A 4JBJA 4A3BH 1NJIU 2A1AA 1IBLQ 2GN5A 3AEVA 2MI6A 1VQAA 2IY5B 2I5MX 1Q7YC 1FL0A 4LFBQ 3GTGH 4QQBX 4JI5L 1TWFH 4C3JH 5LMNL 1YI2T 1VQGA 3S17H 3L0OA 4JI2Q 3UDFA 1N9WA 5IWAL 4DR3Q 1OXUA 1Q46A 2CCZA 3KLWA 5GAEC 4X64Q 2R92H 1KRSA 5FJ8G 1LTLA 1X55A 3J81c 1OXTA 4GKKL 1KL9A 1D8LA 2CKZB 3CD6A 5JEAJ 5GAGC 1IBMQ 2YU9H 4KHPL 3OTOL 4YHHL 4IOAA 5FLXc 3HOUH 3W5OA 1X3GA 3P8BB 4BBRG 5M5WH 4DR5L 4HJ8A 1X65A 1L2FA 2C35B 2ATWA 1J6QA 2A8VA 3L2PA 4EQ5A 3PCOB 4DUYL 1OXVA 2Q2HA 2R7ZG 1R9TH 1EUJA 2NVQH 1ASYA 3I56T 1UE5A 5M3MH 1Q1EA 2D0PA 2RCNA 4X65L 1J5EL 4APVA 2K4KA 2UXDL 5K36G 3PUWA 1CKOA 3K0XA 3PO3G 2VQEL 4DR7L 3HKZE 3KF6B 1Q86U 5AJ3L 4JYAQ 4Y7NH 1VQPA 2A19A 4LF5Q 2UXCQ 3CMAT 4K0KQ 5EAYA 3U50C 1YJWT 3UDXA 2IHFA 1Y1WG 3M3YH 2PNHA 5M5YH 2UUCQ 2JA6G 3CCLT 3J7ZC 4R4CA 1HNXL 4DKAC 3NEMA 1S72A 1GVPA 5ELOA 3GDEA 4C2MH 2UU9L 5LMNW 2K52A 5M3FG 3UDGA 3CF5A 1Y14B 3K81C 2MO0A 4DUZQ 3E9IA 4YCUA 4A3JG 3I55T 4X62L 1N34L 3CC7A 2LVMA 4DAMA 5IY0A 4IFDI 4IPHA 3CPWS 4P72A 4A93G 2K5VA 1Q7YU 1V1QA 1YHAA 1EIFA 1IYJB 4BA1I 4GOPA 3TEHB 5IP7H 1KAWA 3CCUT 3J81E 1K73C 1VQLA 4A3MH 4HIKA 2JQOA 3PUXA 2KCTA 4GN3B 1O7IA 1SRUA 3A5ZB 4IJHA 4QGUA 3J80c 3GTPH 4TVRA 4DR2Q 4FDBA 1VQ8T 2PQAA 1HR0Q 1GO3E 5LMUQ 4DV0L 3NBHB 2Y0SG 2E5LL 1K8AC 4DV3Q 4LF7L 1VQOT 3GD7A 3W1GA 1XPRA 1HZCA 3E9HA 3BJUA 4PZ7A 4X66L 1HZAA 3OW2S 5GADC 2CFMA 5IYDH 3AFPA 5GQOA 3G4SA 1E1TA 4JI3L 2ZJRA 2KHJA 4JI6L 2JNGA 4OWTB 3T1YL 4NXMQ 1VQMA 2R7DA 5IP9H 3T1HL 4BA2I 2HQLA 3GTKH 4JV5L 2NN6G 1HZBA 4B3SQ 5FLMH 4A75A 3CCVA 5IT9c 1KRTA 2NVYH 3I2ZA 1VQDA 4DR1Q 1K8GA 2UUCL 3OYYA 2ID0A 1I94L 3CXCS 2LXKA 1WYDA 1UE6A 1U5KA 3F8TA 2NVTH 2FXQA 4DR7Q 2N49A 4JI1L 4A3FG 4HJ7A 3ERSX 3I7FA 1KQSA 1EQRA 4IO9A 1IZ6A 4DV4L 1LUZA 2B3GA 1XPOA 2F4VL 4A3CH 3CC4T 3M4PA 2PI2E 2JEBI 4DV5Q 1VQ7A 3KYHC 2HIXA 2UUBL 4B3RQ 3J81i 1VQ6T 2OTLA 1E7ZA 4OXPA 4HJ5A 1N33Q 3F2CA 4DR4L 2IG0A 4JI8Q 5C3EH 1QUQB 2E70A 2RHSB 2VNUD 1VQBA 4LF6L 1G6PA 3PO2G 1VQ9T 2DGYA 3F1ZA 4MZ9A 2N78A 1QZHA 1X9NA 3PF5A 1YJ9T 4BY1H 1RIPA 1NZ9A 4YY3L 1BBUA 2QEXA 4R4TA 3F2BA 4HIDA 1EFWA 1K73U 4OX9Q 3I4MH 4BY7H 4A3EH 1Q12A 2XTIA 4DAYB 3FP9A 1Y1VG 3CCJA 5C44G 3EIVA 4O2DA 3AYHB 2B63H 1VQNA 4BBSG 1OXSC 1HNWQ 2OTJT 3CPFA 1QVGA 1A8VA 2OCEA 2VL6A 1YHBA 1TXYA 4P73A 4AQYL 1EYGA 1K8AU 4GKJL 1YBYA 1VQFA 4LF9Q 3HOYG 2RF4A 4L5QA 1PH8A 4KHZA 3J7AF 4JOIA 3CAMA 2EXDA 4NXNL 1XTDA 1P16A 1BVSA 3PIPA 4L5TA 3PF4A 4JI6Q 3LGFA 3CCQT 2LXJA 2KENA 4JI4L 5C0XG 3KJPA 5IYBH 3F2DA 1VQJA 4A3LH 2VUMG 2JOYA 1QZGA 1BKBA 1CKMA 2I5HA 4JI7Q 1E1OA 3ULPA 1SLJA 4QY7A 4AYBE 2R7ZH 2WAQG 4OWXB 1VQKT 3CCMT 3JAME 4ME3A 4UP9A 5GAHC 3HOWH 1CKNA 1YNXA 1Z47A 5IYCG 4DK3C 4DV7L 2E6ZA 1BBWA 3NELA 2VQFL 1YHQA 1MJEA 1VQHA 1IBKL 3K7UC 4YCWA 3TS2A 3TQYA 3H0GH 3S1QH 1N36L 1MKHA 2JK8A 3RLNA 5BR8L 2VZAA 1UWVA 4B3ML 3CCRA 3J80i 3CCSA 4DV6Q 1MJCA 4QL5A 4ALPA 3RLFA 3RN5A 4LF4Q 1L1OC 4DPGA 2MWPA 2K14A 4CRIA 1Q82C 1C9OA 5JEAG 2H5XA 3M4OH 2UXBL 5A2QE 4YCVA 2CWAA 3CMAA 3NENA 1N32Q 3G6ET 2BA1A 1IXRA 1XNQL 2JA7G 1EOVA 4LF8Q 3GTQH 4O0AA 4A3JH 1PYSB 2K5HA 2HHHL 1YIJT 4JI0Q 1I5FA 4LNQA 3DM3A 2IX1A 3FKIG 4MTNA 4LFAQ 2KDSA 4A93H 1VQ5T 3PGZA 4B3TL 4A3BG 3G71A 3I55A 2XHCA 1LYLA 1P8LA 1E24A 1EQQA 2JA5H 4GNXB 2LSSA 4A4IA 4AIMA 2R6GA 4DR6Q 1B8AA 2Q2IA 4NB3A 2NN6I 1HNZQ 1OXXK 1VQ4T 4RMFA 3HOXH 1TWHH 2AKWB 3KBGA 1XNRQ 3CCUA 3I4NH 4GLXA 1JJ2S 1A0IA 4R4OA 3STBC 2JA8H 1VQIA 4QIWE 2ASBA 1I6HH 1TWGH 1WCMG 4UPAA 4JBWA 1Z9FA 1VQ8A 2EIFA 3A0JA 1XMQL 3TRZA 2ZJQA 3RN2A 1HH2P 4JI5Q 4A3GG 4ZN3A 5J3BA 2B29A 4PG3A 1VQOA 5LMNQ 1PH4A 5IWAQ 2OQKA 3BZKA 1G51A 4POFA 1HZ9A 3KOJA 4JOIC 5H1SE 1FJGL 4UY8C 4GKKQ 4HIOA 5DLQE 1Q8KA 1KC8C 4KHPQ 3OTOQ 4YHHQ 1QVCA 4HJ9A 2K75A 5E7NA 4DR5Q 2HT1A 4LFCL 2AHOB 3KDFB 2MFIA 3PUZA 1S40A 1YITT 4EX5A 1Q82U 3A74A 4DUYQ 2R93H 2G3RA 2N3SA 1S72T 1U0LA 4C3IH 1E3PA 4DNIA 4A3KH 1K0RA 3ZJYC 2UUAL 1D7QA 1Q1BA 4ZN1A 3EN2A 2UXDQ 4X65Q 3HOZG 2CKKA 1J5EQ 2D0OA 2MO1A 1M90C 1XNIA 1X56A 1A62A 2PQAB 4DV1L 1XMOL 3K7AH 3CMET 2VQEQ 4RG1A 5C4XG 1YZ6A 1L0WA 5AJ3Q 3PIOA 1JMCA 1GD7A 3JAMc 1NY4A 4DV2L 1VQLT 5DM7R 2F52A 3CW2C 2I5LX 3HKZG 4IPGA 3VDYA 1SFOH 3RR5A 4R1JA 3H3VI 1YJ9A 3KFUA 4IFDJ 5IP7G 1TWCH 2WP8J 4H02A 3ULLA 5C44H 4A3MG 2ZM6L 2ZJPA 5C0XI 1KIXA 1HNXQ 1ASZA 1L1OB 1N8RC 2HIVA 2WAQE 2GVAA 2NZHA 3HFZB 3LGJA 4A3IH 1IBLL 2UU9Q 4LFBL 4X62Q 1N34Q 1JJGA 1QUQA 2ALYB 3CC2T 2OTJA 3HOYH 4DR3L 4JI2L 3RNUA 1UE7A 3S1NH 3K8AA 4QJFA 4OO1G 2UXCL 4X64L 3HOVH 4TVAB 5IYDG 3G48A 1IBML 1JT8A 1MIUA 3CQZH 3UE1A 1LM0A 3TS0A 5IP9G 4C3HH 2CWPA 1PH7A 3SGIA 1KC8U 2Q2TA 5FLMG 4HJAA 3M9BA 1CSPA 2VUMH 3CCQA 1CSQA 4Y52H 1V9PA 4GN5A 1NMGA 2Z6KA 1PH5A 3S16H 2BH2A 1TWAH 4DV0Q 3CCET 4YWLA 2E5LQ 3DLLA 1IL2A 4LF7Q 2ZTCA 5FJ8H 4X66Q 1YI2A 1VQEA 3S1MH 1VQ7T 1VQKA 3CCMA 4GOPC 4JI3Q 1PH2A 4WJ3M 1A63A 4A3CG 1PFSA 2L15A 3T1YQ 1FGUA 2V1CC 1PV4A 3T1HQ 4LWCA 4BBRH 4JV5Q 3BZCA 1M90U 4JYAL 3M4QA 4LF5L 2LCLA 4IJLA 1W2BS 4R4IA 2CQOA 4K0KL 1I94Q 4AH6A 3J81j 1PVOA 4LUVA 4JI1Q 2JEAI 2JJQA 3JC66 3DB4A 3MXNB 4BY1G 2I0QA 2VS1A 2IT1A 2JVVA 1DGSA 4PZ8A 4DV4Q 3PO3H 3CCJT 3RLOA 3I56A 4DUZL 2F4VQ 3I4MG 4A3EG 3G6EA 2UUBQ 1N8RU 1JJ2A 2QA4T 1YEZA 4BXXG 3CPWA 1Q81C 1JJCB 1VQCA 1YJNT 1UE1A 2B63G 4DR4Q 2E2HH 5IAYA 3AQQA 4TQUS 1YIJA 1Y1WH 1NPPA 5IYBG 2AWNA 2N8NA 4LF6Q 3GTMH 1KHIA 2IHEA 2OQ0A 1VQ5A 2RHQB 2JA6H 1CKNB 3WWVA 3S24A 3GTLH 4JG2A 1YJWA 1K83H 4HIMA 4JBMA 1AE2A 4YY3Q 5M3FH 4IOCA 1KD1C 1SMXA 1I50H 3CCLA 2Y0SE 3ER0A 5JJLA 3PV0A 2JUFA 4DK6C 4PMWA 4DR2L 2BH8A 4A3DG 1QVFS 1VQ4A 2E2IH 1HR0L 4WJ4A 5LMUL 1GKHA 1PH3A 3S15H 3KF6A 4DV3L 1WCMH 1QVGS 3U4VA 4KLKA 2YTXA 4UP8A 2F3IA 3STBD 1VCIA 2AWOA 3D31A 3OW2A 1SR3A 2WFWA 4AQYQ 4A3LG 4A3GH 4KI0A 4GKJQ 4LUZA 4GNXA 1YHQT 2WB1G 4NXML 3CD6T 3JAMi 2E2JH 3Q8DA 1GM5A 3HOWG 1AH9A 4X6AH 4B3SL 4NXNQ 2R92G 3PUVA 5HY6A 2XGTA 3PSIA 4GLAC 1M1GA 3CCRT 1NTGA 3UDIA 3CCST 5HGQA 4DR1L 1PH1A 2KHIA 3H0GG 2YTVA 3CXCA 1PYBA 1X6OA 3BU2A 1T9HA 4JI4Q 3HOUG 3S14H 2YTYA 4NPSA 2DO3A 1K9MC 1JE5A 1EIYB 4L5RC 4QQDA 4GLVB 1FVIA 3ULJA 1RL2A 2Z6KC 3LGLA 1YITA 3D0FA 4DV5L 4B3RL 1E22A 5ELNA 5M3MG 4DV7Q 3HOZH 1N33L 2VQFQ 1IBKQ 4JI8L 4AYBG 1G291 1VQPT 1NPRA 1N36Q 3U58A 1Q81U 5BR8Q 4B3MQ 3G71T 4A3FH 5C4XH 3A5UA 4JBKA 2GVBA 1WFQA 3J7A5 1B70B 4GOPB 4OO1I 1HR0W 3W1BA 3CMEA 2KCMA 1C7YA 2ZTEA 3KF8B 3GTJH 4OX9L 2JA5G 3AFQA 3KDFA 3M85A 2NZOA 3PO2H 2UXBQ 2JE6I 4J15A 1KD1U 1I3QH 3MEFA 3M7NA 3CC4A 1YVCA 4P74A 1JB7A 3CC7T 1XNQQ 1X3EA 1M1KC 1W3SA 3HOXG 1HNWL 4IPDA 2L3RA 3PUYA 3S1RH 1PHJA 5FLXE 1VQ6A 2DUDA 1CUKA 2AMCB 2YYZA 2QGQA 4IPCA 2PI2A 1SE8A 4MNOA 2HHHQ 3I4NG 2JA8G 1KXLA 4LF9L 4LW1A 4B3TQ 1VQ9A 1SROA 3DB3A 3K80C 2KVQG 2MNAA 3CC2A 2D62A 1VS0A 3RZDH 4PZ6A 2IX0A 1Y1VH 3CP0A 4XTCS 2VY3A 3S2DH 1NBWA 4BBSH 3HKSA 3EBEA
chains in the Genus database with same CATH superfamily
4XK8E 2EYLA 3DUZA 1JXOA 2EDGA 4CJ1B 1SNCA 5LJ3g 1BCPC 2XRQD 4YWKA 3FHWA 2KXCA 5FU6C 2GFUA 2PO4A 3S2HB 4HCZA 3I91A 4AFUC 5COYA 1AVZC 1BR9A 1Y7XA 2OWOA 3EFOA 1K3RA 5CKEA 4A3DB 1STYA 1UEBA 3RKXA 2H4OA 3DMUA 4X3TA 1GXIE 2LP5A 5IXFA 1IYVA 1DD2A 4Z88A 2JP1A 1TWFB 2K50A 2OEOA 4OMNA 2PMZE 2YV5A 4P71A 2D8HA 2JXBA 4OMLA 3HL8A 3T16A 2R92B 5ELCA 4MIUA 4UP7A 1LTTD 1VQPQ 1B7YB 2L8DA 2M2LA 2EKOA 4X34A 5HK3A 3J80E 1M1KU 1QVFA 3NUCA 5CV5A 3HOUB 4BXXH 4K2KA 2K32A 4A76A 5GAOq 3QBYA 2HQHA 1GCQA 1M2OA 3NHHA 4R4QA 5JEAH 1U06A 2CP7A 2E8GA 4DR6L 4J9HA 1R9TB 2NVQB 1AZQA 3N6RA 2MIOA 4POGA 2KEAA 1HNZL 2NYSA 4DV2Q 4BY7G 4DN4M 1AE3A 2BA0A 3VA7A 4FU6A 4AFQC 2ZTDA 4FW1A 1JC7A 1RCVD 1SN8A 1WTQA 5IGGA 4P2CB 1XTCD 1GL5A 1S3OA 3OQ5A 4P75A 1NJIU 1NBEB 2GN5A 1OX8A 3UWNA 4X3SA 2B2UA 2GNCA 4C3JH 4XXEA 4C92G 1CA5A 3M3YB 3GV3A 1I4QA 4E7HA 3S17H 1WTHA 4JI2Q 3G7ZA 2M9VA 3KLWA 3KLSA 4X64Q 5HCKA 1RADB 4RTTA 5GAN6 4E2FB 5GAGC 1UJ0A 4KY5A 3I4NB 4KHPL 1O7LA 3VU3C 1X3GA 5LJ5h 1JEGA 4DR5L 3G4SQ 1X65A 1TS4A 2O4XA 5IH2A 1J6QA 3VS3A 3L2PA 4EQ5A 1KSWA 1HJDA 1HCZA 3VYSA 4A3MB 1ASYA 3CRLC 3HRUA 3VS6A 4ZKCB 4LUEA 1AWOA 1STHA 2L12A 5M3MH 2UXDL 1AWJA 1NEGA 2EJGA 3GTPB 5K36G 1Y07A 2P4RA 3VR4A 3SVMA 1HYOA 3A8OB 3EFRA 1Q86U 5AJ3L 2L2PA 4Y7NH 4XU2A 1VQPA 2RHUA 1JB3A 4FF1A 2JA6G 3FDRA 3IKJA 2SNMA 1FGBD 3EAEA 1B1ZA 2AUKA 3LLRA 4C2MH 4DKAC 5LMNW 3UDGA 3L3OC 5IN1A 3OYFA 4C0ZA 5KYWB 1ET6A 4YCUA 4A3JG 3M0PA 1QQJA 1H92A 2LVMA 3FRNA 1A3VA 4DAMA 5IY0A 4P72A 2NVTB 3C1EA 3H94A 3KFVA 1QP2A 1Q7YU 5C5MA 1TH7A 3CBOA 1B4OA 4GOPA 4ZGEB 5IP7H 3CCUT 4DXFA 1VQLA 4PJNA 3BDLA 2JQOA 3G7LA 2DN8A 1U1SA 3J80c 4IJHA 2F2WA 2KGTA 4QGUA 4DR2Q 4GLMA 2KNBB 3URGA 2ZPIB 3VR5A 2DYIA 4FF2A 1GFCA 1HR0Q 2DJGC 5AYFA 1FYCA 3NBHB 3PMIA 4HCEA 4BY1B 1HZCA 3E9HA 4X66L 3I4MB 2CFMA 4PJOG 4AT1B 3G4SA 1E1TA 4A3EB 1BCPD 2JNGA 1ZUYA 3OY9A 5CORA 4M7AC 3T1YL 4C1NI 2R7DA 4BA2I 3GTKH 1CQVA 1E0BA 4DK0A 2AKLA 1KRTA 2NVYH 4DF7A 2I2LA 1K8GA 5EBCA 3OS1A 3OW2P 2G5DA 3O5ZA 3HS0C 3CXCS 2LXKA 1WYDA 1UE6A 2FXQA 2N49A 4J8QA 1GCPA 1DOMA 1B07A 1OO9B 2Q8IB 3M0TA 4RGNA 3SEBA 1SRMA 1B34A 3X20B 1XWEA 2B3GA 3NPPA 5C3XA 4FYDA 1QG7A 3QHSA 3QXEB 4K11A 2DK3A 3A7AB 4DV5Q 2UUBL 2HIXA 4C5GA 2H8HA 2EQUA 4DK1A 3J81i 3EG0A 1N8RR 4DR4L 2IG0A 1HTPA 1MSHA 5C3EH 2RHSB 2L9HA 2R7ZB 3N5BB 1H9KA 1WTPA 3E1SA 4KK7A 2IIMA 4L5GA 2V4DA 4PJMA 5C0MA 1UTIA 2ZPBB 3A7LA 2FPEA 1LT5D 1EY7A 2XI9A 2XTIA 4LDWA 5GANh 3PMTA 3FP9A 2JW4A 3G71Q 1OV3A 3EIVA 1AZGB 2KRNA 3TU4K 1SDFA 4O2DA 1AOJA 4DGZA 4JDSA 1HNWQ 3ZEHA 3CPFA 4P73A 3TP6A 2SDFA 4AQYL 4HN7A 1RLPC 4A4HA 4HAEA 1B44D 1SF9A 4LF9Q 1A6XA 2PNIA 4NXNL 1FXXA 1XTDA 2NUPA 3WOEA 1P16A 4J9IA 4L5TA 3LGFA 3RIRA 3WVEB 4E7IA 2E75C 3CCQT 1M27C 1ESRA 3X28B 5C0XG 1HA5A 5IYBH 3DM1A 1R77A 4FYWB 4Z8AA 2I5HA 2VB2X 4KKSA 4ME3A 4N9PA 3EGDA 1YNXA 4K6LA 3V2TA 5IYCG 3R6NA 3OYLA 3HOXB 4G7OC 3P8DA 3BG3A 2NLUA 4RTUA 5GMKi 1MKHA 5BR8L 4B3ML 3JV3A 2EXZA 4DV6Q 2XDBA 2TMPA 5I2XA 3L1AA 1KNAA 1SNDA 4CRIA 3DXJC 5LJ5j 2UXBL 2H5XA 1EZ8A 2XSCA 4RA8A 2F0OA 1AZEA 2SRCA 2K6AA 2M02A 3IAYA 2QAZA 1ZBJA 3BW1A 3G6ET 4HT8A 1IXRA 1SNQA 3OW7A 1CKAA 2JXMB 2F0PA 3GTQH 2CZ6B 2RN8A 1U9RA 2K5HA 2HHHL 3VYHB 1OQKA 2DL5A 1HFGA 2OAWA 4OL7A 3R2TA 4A93H 4QT7A 3PGZA 1YCYA 3LX7A 1RTNA 3G71A 1P8LA 2FG0A 1I4GA 1YJ9Q 2JA5H 1MMGA 2HDMA 2H3EB 2LSSA 2D6FA 4QUCA 4QIWB 2X4WA 4R55A 2DL4A 2VXFA 2Q2IA 4IUTA 4DNTB 2LX7A 3EH1A 1KAAA 2NN6I 1BNZA 4RGMA 4JJDA 4K8JA 5IGFA 3KBGA 4LE9A 3QKJA 4HCSA 4C56C 3I4NH 3E2UA 2OTJQ 5EC7A 1A0IA 2DF6A 2RD1A 3K7AB 4E7KA 2KBTA 1HXYD 1KFZA 1DJRD 2PW7A 1WYXA 2ASBA 1TWGH 1WCMG 1LT3D 3WDNA 3RMHA 4HCBA 3TRZA 3VA5A 2DD5A 2ZJQA 1ENCA 3H91A 3K58A 4JI5Q 2B29A 2GFAA 5J3BA 2K1BA 5LMNQ 2TSSA 3DWQA 2OQKA 1IRXA 4FIBA 1G51A 3BY7A 1HQRD 1TY0A 3BZKA 4ZRZA 2NN6H 5C44B 5L8RE 4A4GA 1YCSB 4A3IB 1IL8A 4HIOA 4M7AD 4J9GA 4C92F 3MC0B 4QMGA 3V8KA 1KC8C 2V8IA 3OTOQ 1EWCA 4PLLA 5I22A 1BB9A 2B8FA 3HOYB 2K75A 3NK9A 1WQ7A 3CCMQ 1VQKQ 5E7NA 2AHOB 2MFIA 3OYHA 3KLRA 4EX5A 1Q82U 5GAN2 4LAAA 3H6ZA 1KQ2A 2C5CA 4DUYQ 1XOVA 1E2ZA 2FVUA 2N3SA 1U0LA 3EFSA 1D1KA 1AEXA 2EJFC 2R93H 3CQZB 1G6ZA 3Q0AA 3GP7A 2CP0A 4ZN1A 4LN2A 4C3HB 2CKKA 4JS4A 4CKBA 2BE5C 4LDXA 2HKQB 1OOTA 3FEWX 2WSEE 4RG1A 4UHVA 3ZFJA 2WAQB 4CDFC 1KNEA 4IUQA 4EIKA 3J7AV 2ATCB 4C8QG 3GIBA 1JMCA 2DVJA 2EYWA 2EQJA 2FZGB 1VQLT 1LTSD 1TIID 2BOSA 4JW0A 5L37A 4IKFA 4OGQC 3JCMV 2L3SA 1YJ9A 4RHRA 5CYUA 2RA2A 1LTAD 2ICIA 2R61A 2WP8J 4H02A 1TU2B 1W70A 4UAIA 2RI3A 4C92E 1YIJQ 1QNUA 1PZKD 4BBRB 2ZM6L 1KIXA 2GTOA 2UU9Q 2GVAA 1OEBA 3KUPA 2GTJA 1C0MA 5BN4A 2B2YC 5GJVB 5CO7A 2L1BA 1JJGA 1LT4D 2MGSA 3Q23A 2OTJA 3S1NH 2CP2A 4PNOA 4OO1G 1YNNC 5EQ0A 2K5QA 3S3NA 2J6FA 1IBML 1RAIB 2MJ8A 3UE1A 3V05A 5IHNA 1ZSZC 5IP9G 2CDTA 4DAYA 1RABB 2VUMH 4Y52H 1CSPA 4RTZA 5GANj 4KY7A 4R9WA 3I3CA 1V9PA 1BI2A 2Z6BA 3TCJA 2YUQA 3CCET 4YWLA 5I9OA 3GTLB 3DWAA 2YLBA 4K5VA 5M3FB 3QIIA 3QZ9B 4JZ3A 1VQKA 3CCMA 3NPFA 1U4PA 1SYFA 2E2IB 4DV5L 3L2ZA 2MP1A 4CGYB 1QCBD 4JV5Q 3S15B 4JYAL 1MGQA 2B2WC 4QW2A 3QO2A 4A3MG 4LF5L 4IJLA 1JXMA 2BZYA 4PJOF 1X3PA 1W2BS 3RMQA 4JJNK 1I94Q 4XT3B 1OYXA 2V8KA 2F0QA 4G7HC 5KYUA 4LUVA 8AT1B 3JC66 2E2JB 3C1FA 2YWWA 4ID6A 4BY1G 2VS1A 5BN5A 1DGSA 3NMZC 2F4VQ 3I4MG 1BI3A 1CI3M 2RJEA 2X3XD 4A3EG 1DONA 3EJIA 2FHDA 3CPWA 1T5XD 1D5ZC 2PZUA 4NL2A 4E47A 3K5NA 4OGEA 5L23A 2SEBD 3R2IA 4CI0C 1YIJA 4EQNA 3GTMH 1NPPA 1EL0A 2PYKA 2RHQB 3GQBA 3WWVA 4DXGA 4M7AA 1CQFA 1K83H 4WCIA 4M8AA 5C4HA 3AMUA 1G5VA 4N0AC 3HOZB 3REAB 2F0NA 4MHEA 2JUFA 1BF4A 1I0CA 2LRQA 4J9DA 3MZ5A 4RTWA 4PJOE 4WJ4A 4ORZA 3H0HA 4KGXB 4PK4A 5HKCA 1KQ1A 2O4XB 4A3FB 4DAPA 4DV3L 2CREA 3CC2Q 3Q22A 2E4HA 4M78C 4PMBA 4A3GH 2EY1A 1QMCA 1L0XB 2AQ2B 1QJOA 3E19A 4GKJQ 2HQEA 4GNXA 4M77A 1I3QB 1B50A 3W3AA 1GXDC 4B3SL 2JTEA 3PUVA 1CHPD 1PFBA 2QTVA 1ARKA 2QTXA 2P4TA 3PSIA 3E5SA 2L0CA 4D6WA 4XU3A 5KYWA 5KE3A 4K6DA 2F0GA 3EFXD 5LJ3f 1JE5A 2F0DA 5CV4A 4QQDA 2RF0A 1V29B 3NTIA 3HP9A 3I35A 2KK4A 3GLXA 1RL2A 2P0KA 1FVIA 1GUNA 1CM9A 1A3UA 3LGLA 4B3RL 2FYKA 5CGKA 5HURA 2DNUA 4DV7Q 1VMPA 1N33L 1IBKQ 2YRVA 4JI8L 5GAMg 1G3TA 1NPRA 2AQ1B 1QCNA 4RFBA 1Q81U 4M75F 2F1MA 2L5TA 1WTWA 3G71T 3BE3A 5JVG3 2BE5D 2VB3X 4GOPB 5G3LF 3ZYYX 2N55A 1U4MA 2KCMA 2VGNA 2FO0A 1SJHD 4OX9L 2EPDA 4DOVA 2DXCA 1PCXA 2F03A 3M85A 1D3BB 4C5EA 3QSUA 1V1PA 1K73R 1KD1U 3MEFA 3UI2A 1WHJA 3CC4A 1M3CA 1YVCA 4P74A 3CC7T 3CPWP 2QA4Q 3CHBD 2G9DA 4NP5A 3GPLA 3HOXG 1HUNA 2VKNA 1Y8NB 5FLXE 1HUMA 2DUDA 2EFIA 2AMCB 2BDOA 2PI2A 1NYFA 4NOYA 3SK5A 1PHTA 2QXFA 5M9OA 2DBKA 4TRDA 1K8AR 4ME5A 4B3TQ 1SROA 3K80C 3QWNA 2QQSA 3SK4A 5GAMd 3CC2A 3I70A 1AT1B 2WSCE 3RZDH 1Y1VH 4XTCS 4A4KA 2VY3A 1NBWA 1YNND 3MHXA 1MMAA 5KGUA 4M75E 3HKSA 5TSSA 1ZSGA 2A74C 2F0UA 2AIRB 2LQ8A 4V0BA 4JI7L 1W2BA 1KLUD 5JJKA 3H15A 1WXUA 4IFDG 3SDZA 1K9MU 1PTOC 2MQHA 1B34B 4JRQA 3R3OA 2M0YA 1YHQQ 3MP6A 3CD6Q 2EYZA 2B8GA 2K33A 4IZ8A 1XPUA 1XMQQ 5GAMe 3H3VH 4KY6A 2PQWA 5M5XH 4CKEA 2HMAA 2R58A 3QOJA 1IXDA 2PQEA 5KEEA 4M7DC 1E7OA 3TREA 2EQSA 2PZWA 1FJGQ 2PZTA 3GTOH 4WJWA 4LF4L 5LL6X 4OWWB 4C3JB 4X3KA 3UA7A 3S17B 2WB1B 3OB9A 5A35A 3FJ5A 4GN4B 1PH9A 1KHCA 3HOWB 3HGBA 4BY6B 2EYFA 4MMKA 1X54A 1HA6A 2OTLT 1GUTA 3JB9F 3BVMA 3Q24A 1TS5A 3NTKA 1EY5A 4GS3A 4YTLA 1AW7A 1F9PA 2VB6A 4JCVE 1SMYC 2ZAEA 4RTYA 4RGTA 4LFAL 2CSQA 1UNSA 3RZOH 3B6YA 4A3IG 3F70A 4DV1Q 2QA4A 1NMFA 1LJOA 1D1BA 2QEXT 4N4HA 1S72Q 1KQSS 1BUVT 4I65A 5C0XJ 2QI2A 3M4OB 1ENFA 3M54A 1UUEA 5M3MB 2R57A 1NUCA 4XTVA 2JA7H 4JC0A 1NSNS 2K7VA 1VQNT 4JZ4A 1KIKA 2A73B 3SHWA 1JB7A 2A68C 5IT9E 3FKIH 2A36A 4RG2A 1SE4A 4LUOA 3L2QA 5LL6S 3BYTB 3OYGA 3OHXC 4Y7NB 2A1AA 1YP5A 4C3HG 1R8OB 4IUPA 3AEVA 1UECA 1RAEB 2I5MX 4LFBQ 3EGXB 5ELBA 2X4YA 2RI2A 2B2TA 4C5IA 5IWAL 2CCZA 2ED1A 4M78D 1Q46A 4C2MB 4FNFA 1V8QA 4GKKL 4RH6A 1SXTA 3J81c 4AG2C 1OXTA 1KL9A 2K5IA 3CD6A 2YDLA 1XJWB 3HRZC 3SXHA 1M3BA 5EG2A 2RMOA 1OULA 5FLXc 4YHHL 4IOAA 2MUYA 4LNPA 1ZUKA 3P8BB 3OYCA 1RJTA 4BBRG 4BE2A 3OWEB 4OIKA 2RQWA 3MXUA 1O9SA 3HKZB 2A8VA 1VQMQ 2ATWA 1PKTA 2CSIA 1OXVA 2K79A 3CCVQ 2F0KA 4NW2A 4ZTFA 2RCNA 2K4KA 2QQ9A 1GUWA 1YNZA 2OXPA 1BCPB 2CW0C 3H09A 1CT1D 2A6HD 2VQEL 5FU6B 4DR7L 1AFPA 2DRMA 4MTKA 3URYA 2A19A 2QDLA 4LDUA 5KYYB 1RD9D 3SK6A 2AZVA 2HAXA 3X26B 5F2DA 5EAYA 4PNYA 2CT3A 2IHFA 5KRUA 3A8GB 3I9QA 4A3KB 2QDBA 3J7ZC 3PNWC 1S72A 1GVPA 1ZX6A 5ELOA 5M3FG 2K52A 2NVYB 4IUVA 4GY5A 1Y14B 2D0NA 3K81C 1GOZA 4XU0A 4OEMB 3OS5A 3NHNA 1EQVA 4XTXA 2JJ9A 3RBBB 1V1QA 2D1XA 3JCMg 5ELDA 1C0AA 4DEXA 1SYDA 1IYJB 3TEHB 2YT6A 1KAWA 3OBWA 1H9RA 1AWXA 2KROA 4JRPA 1HNXQ 3BDOA 4KBMB 3LH5A 4EPCA 1UE9A 1O7IA 1SRUA 2BE9B 4KJNA 5C3EB 3OSVA 2K5FA 1SYEA 2K3YA 1GO3E 3FLGA 2FFKB 1F2ZA 1LO5D 4F87A 1K0XA 1VQOT 2QKIC 2DPPB 4PZ7A 5CMDA 1HZAA 3OW2S 5JAVA 3PMFA 4P5NA 5GADC 3AFPA 4JI3L 1HK9A 2VV5A 1PTOD 2ZJRA 3SR1A 4MMLA 4J9BA 1VQMA 4PJOC 4J9FA 2XDPA 1WD0A 5FLMH 3CCVA 5IT9c 3JCMd 2QQAA 1EY6A 3I2ZA 2XKOC 4O5VA 1M90R 1X32A 3BVZA 2NB0A 2BE7D 2PVGB 3OMCA 3OYYA 4OF1A 4M7DD 3RKWA 1STAA 2F0FA 4RKLA 4NKLA 5DM73 1SRLA 3V7CA 4DR7Q 5LHY1 4A3FG 4FSSA 1KQSA 2C9OA 2OJ2A 3KBXA 2A69C 2EZVA 1LUZA 2F0LA 1E2VA 4A3CH 3CC4T 3M4PA 2LQNA 4II1A 2PI2E 1WZOA 2HDAA 4A4EA 3JCMe 2K9GA 1LT6D 4CKCA 2K2MA 2X4JA 2E70A 5JPMC 2VNUD 4LF6L 4X1VA 3CMAQ 2K04A 1SMYD 2D5DA 3PO2G 1YJWQ 1ICWA 1QZHA 2N78A 2DL8A 1X9NA 3CCLQ 1MBYA 1RIPA 3WVDB 1NZ9A 4YY3L 3F2BA 2RHYA 2K4YA 1EFWA 4BY7H 2HBWA 5D65A 4FYVB 2EYOA 1EU3A 2PCFB 3EGUA 4DAYB 5LJ3d 3CCJA 3I55Q 2KHSA 2NTSA 3MJXA 1BIBA 3C4SA 4Y92A 2VASA 2UUCL 2A68D 2VL6A 2WIIB 4WRDA 1TXYA 1BCMA 4J6XA 2CP3A 2EGCA 5IHIA 5GAN4 1G2TA 5CBAE 3DWPA 1X6BA 4XT1B 1IO6A 2RF4A 1PH8A 4JOIA 2LKVA 3CAMA 1KTKA 2CH4W 4XTWA 1VF5C 2RHZA 1NYGA 5A0DA 3HHTB 2OAUA 1BVSA 3PIPA 2RVLA 3GTQB 1NLOC 4OMFB 5LJ3e 4RKBA 2LXJA 4FF4A 1VQ8Q 4A93B 3F2DA 2RK2A 1VQJA 4A3LH 5D6YA 2VGMA 2RQVA 2JOYA 5KYUB 4N8X1 1CKMA 2JA5B 3D6WA 2KMTA 3OYJA 4QY7A 1TS2A 4CJ0B 2CP5A 2HKNA 5CAIA 4RMOA 1O7ZA 4OWXB 3HOWH 1Z47A 4Q5VA 4FXKC 2KSSA 1MJEA 1FNUA 2VQFL 5E4WC 5K36H 2GQIA 1HPCA 2LMCB 2MK5A 1WX6A 3RLNA 2JK8A 3MFGA 1N36L 1QKWA 4M1UB 4K2LA 5CK9A 5CBEE 1TWGB 4QL5A 3S14B 4ZTJA 1EZ6A 2CW0D 1L1OC 4M7AB 3JAML 4JUVA 2F4IA 2E6NA 5JEAG 3JCMX 3M4OH 2DXTA 2J7IA 5A2QE 1EWHA 3M0UA 3CMAA 4Z9CB 1XNQL 2EQMA 4DQ2A 5IGDA 2COZA 1VQ6Q 2QW7A 4F8MA 1EOVA 3EA6A 4A3JH 1IYUA 1JRIA 4D8DA 2BCOA 3K6OA 2ED0A 3BS1A 3QDFA 2I46A 1WNLA 1VQ5T 2E1HA 1RAGB 1I4K1 3I55A 1E24A 4BWGB 1AD5A 2VXEA 1F9QA 4M77B 4GNXB 4KN7C 2R93B 4DR6Q 1D1AA 4RUGA 1CTMA 4OHJA 1QVFP 4M7DA 1HNZQ 1PLFA 2XIWA 3OSOA 3P75A 2AKWB 3I5RA 2AHJB 4F7UA 2EOTA 1JJ2S 3VUBA 2JA8H 2B39A 2RHIA 1VUBA 1SEBD 1VQIA 4Q5WA 4KV6A 4L63B 2WINB 4QIWE 2LJ0A 3M59A 2EBPA 3ND8A 1I6HH 1VDZA 1VQ8A 3A0JA 1VOMA 1ZXTA 4CJ2C 1UHFA 2RDHA 4PG3A 2DXBA 3ZL7C 1D3BA 1RI9A 4POFA 4HXJA 1HZ9A 1J3TA 5H1SE 4CDCC 3MAQA 4UY8C 1Y71A 4HVWA 4XQQA 5DLQE 4PJOD 2J05A 4FCYA 2MCNA 3OA6A 4KHPQ 1QVCA 4HJ9A 2D0QB 1N27A 2RJFA 5FOBB 1SE2A 3S1NB 4DR5Q 2HT1A 4LFCL 1YITT 1Y0MA 4QVZA 1V1PB 2PVOB 1C4QA 4A3KH 2YUPA 1S72T 2QQRA 4FP5D 4C3IH 4DNIA 2UUAL 1Q1BA 2A69D 1Z6HA 2UXDQ 2FMMA 4HSVA 3I4LA 3TBIB 5CCAA 1JQQA 1M1KR 1U8RA 2VUMB 3BVGA 2GBQA 2PQAB 3H41A 1XMOL 2GQVA 5C4JB 5C4XG 2J6KA 1CZGA 5AJ3Q 2L3QA 5A0GA 3I56Q 3PIOA 4OB1B 1NY4A 3EROA 5DM7R 1M3AA 1R4PB 4C8QC 3VS1A 3HKZG 1BYMA 3RR5A 1U4LA 2IPKD 4R1JA 3V96A 1SFOH 1M9SA 2KQWA 3M0SA 5IP7G 1TWCH 3KFUA 4IFDJ 4PQXA 5CC4A 5C0XI 3M58A 5C6SA 5FLXL 1N8RC 1IGUA 2FPDA 2HIVA 1E6GA 2WAQE 3LGJA 5C4JH 1IBLL 3A8HB 1NJIR 2M51A 3SEMA 2C06A 2R5MA 1HTLD 2D9UA 4MN3A 4GZYC 3H0IA 4DR3L 2VWFA 4QJFA 2ECZA 5IHKA 3GV6A 3T1YQ 4ZAIA 1VQ4Q 3HOVH 2UXCL 1BDOA 5KCHA 5D14A 1QKXA 1G3YA 4N4IA 4NS5A 4LK1C 4RAUC 4DBQA 1KJWA 4S3SA 2RK1A 3TP8A 2Y4YA 4VUBA 5EBDA 5C0XH 1PH7A 1KC8U 4XYQA 1JICA 2Q2TA 1TTHB 2V26A 2PUKB 3M9BA 2V1QA 1MMNA 1CSQA 3GTMB 2YUOA 2F5KA 4MZMA 2Y4XA 3M4GA 1NMGA 2Z6KA 3LWEA 3S16H 4ODGA 1RHPA 1MV3A 3SWNC 1IL2A 1K83B 2CQAA 2ZTCA 5FJ8H 4X66Q 3TSSA 1EZZB 4H7BA 5ISRA 3S1MH 1PRTC 3QYGB 1H8KA 1LOJA 2DMOA 4RTXA 1PFSA 2L15A 5FRMA 1G2SA 2R3ZA 1LCKA 2CP6A 4GBQA 4MDWA 2Z4IA 3MEHA 2AKKA 3GNFB 3ULLA 4K14A 2E3IA 1Q86R 1MUZA 1TVXA 4K0KL 2KI7A 1K0SA 4A3GB 4LUDA 4M75G 1GUSA 3EGXA 3PE0A 2JMAA 3DB4A 3T9NA 2K6DA 2IT1A 1JCKB 4PZ8A 4ELZC 3PO3H 3CCJT 1O7YA 3I56A 4DUZL 1G2BA 2LC4A 2IX3A 1HHVA 2UUBQ 3L2VA 3HTRA 5GAMf 1JJ2A 1QILA 3CMEQ 2Y0SB 1ILQA 2L11A 3EG9B 1U4RA 4DR4Q 3REBB 1Y1WH 1Q7YR 2RCFA 3NSWA 2N8NA 5ELEA 1J8IA 1KHIA 2IHEA 3S24A 4A54A 1MV0B 1EYCA 3A54A 2QK0A 4JBMA 1A15A 1SMXA 5CV7A 4IURA 4G4KA 5CV6A 3UT1A 2HD3A 6AT1B 5IT9L 2DYBA 4QCLA 4A3DG 1VQ4A 1RF2D 1VQ9Q 5I2MA 2XIDA 3RDVA 5LMUL 1BXTA 3M0QA 1PH3A 4OGCA 4V190 1WCMH 4F14A 1QVGS 3U4VA 5IYBG 1ZUUA 2DILA 1DXMA 1VCIA 5KYYA 1SR3A 2AWOA 2F3IA 3D31A 1RAFB 2X4XA 3DHQA 3M4YA 4PV1C 1T0HA 5E4XA 1E2WA 1EY9A 3LWIA 4NXML 3VR2A 1F2MA 4IIOA 4X6AH 4NXNQ 2R92G 5HY6A 3JSCA 4C0DC 4DR1L 2F0SA 4CC4B 3UDIA 1PH1A 1SYCA 5IXBA 4PLIA 3QWXX 3CXCA 1LTBD 1PD0A 1X6OA 1KDAA 1T9HA 3HOUG 3S14H 4NPSA 1QCFA 2G9HD 1PFMA 2E41A 3I8ZA 1TS9A 4LDVA 2X6GA 3LX0A 3K5LA 4KD4A 2DFUA 3QIAA 4KUIA 1GFDA 1VQ7Q 3RZDB 1Y1VB 5I2SA 1E22A 2HZYA 2CH4A 1B3AA 2DZ9A 3D7SB 1MHNA 1G291 1VQPT 1NR4A 3K0YA 1Q95G 4E6RA 3JB9G 1ESFA 1RDPD 3U58A 5BR8Q 4B3MQ 3FPPA 4JJCA 3A5UA 2GVBA 3HFNA 1WFQA 4DBRA 4OO1I 2K03A 2JMCA 3CMEA 3E6ZX 2ZTEA 1SNPA 2R5AA 2JA5G 2SOBA 3KDFA 5M5XB 2GA4B 2NZOA 1OPLA 1ONLA 2UXBQ 1GBQA 2F0JA 2J0TD 2JE6I 4QVCA 2XG8D 1F2LA 3PIP3 2G6FX 3MP1A 4C8QD 2RQXA 2ROTA 4BDZA 2CS7A 3GTOB 1YJNQ 1K8OA 3S1RH 2IY5B 1J9OA 2QGQA 4IPCA 2HHHQ 2ZPEB 3I4NG 2K3XA 4R56A 1H9JA 4LW1A 4XQNA 2QG9B 3L9AX 1VQ9A 3DB3A 2JT4A 3TQ7P 2DA9A 2D62A 2BTTA 1KDBA 4TKOB 2IX0A 3LNNA 2PPBC 1C48A 3S2DH 2KA7A 4BBSH 1Y96A 4QQGA 2PNRC 3EBEA 4J6YA 2BDNA 3RZOB 5GAMj 1L1OA 1W1FA 3JCMh 1OPKA 1QE6A 3I4OA 2KOLA 4LD6A 5E1FA 1JOQA 3G4ST 3S9WA 2JA9A 2EPBA 4OELB 1F9SA 1OTCA 2JA7B 3L7ZC 3ICEA 3PFSA 4LXCA 5J1ZA 4M77G 2NUTA 3GO5A 4L5SA 2R93G 4Z02A 2JN0A 2RA4A 3CXCP 3FKIB 1PA6A 5GAN3 1D5MC 5IE8A 4M78B 4HKEA 3MO8A 1PRTD 5I9PA 1NE3A 4NDXA 4EMKC 5FROA 2HSPA 3LYIA 2LTOA 3PVLA 3E0EA 4OB3B 4C5HA 1SSFA 1EWIA 5AFWA 3R93A 1IHVA 1EQTA 5FO9B 4YWMA 3JRZA 2KBNA 3Q6SA 1WI7A 1N32L 2CZ0B 3OOCA 4J8OA 4HA8A 4LF8L 3U4ZA 1X01A 1N6AA 3H0GB 2LCCA 1RODA 4JI0L 1I6VC 2Z0SA 5LJ3h 4HSPA 4LJZC 1WTVA 5JJIA 2VVKA 2MYSA 1Y8OB 1WI5A 2WB1E 3CU7A 2RM4A 2AZSA 1FMWA 2K5NA 1GHJA 2XWJB 3KJOA 2UUAQ 1H9SA 1XJVA 1YJNA 3TZDA 1WJJA 5D3DA 5HK0A 1WA7A 3OS0A 1S5BD 3P20A 1W6KA 1F77A 1BK2A 1S5ED 4DNRB 1XNRL 3J80L 2BZXA 2Q2UA 4OONA 4XU1A 2ZT9C 2FMCA 2YSQA 2F0MA 4RHSA 2ZM6Q 1H95A 2O5IC 3FVQA 4AMCA 4A3BH 2KAFA 2FB7A 1VQAA 3CKIB 2NVQH 1K4US 5KCOA 2SNSA 3GTGH 3JCMf 3WXMB 1PRLC 3TZUA 2ZPHB 4N8FA 1STEA 3UDFA 1NLPC 2RJDA 1UGPB 1FR3A 1OXUA 5CV8A 1T0JA 1TUDA 4FW2A 4JRKA 1KRSA 2AUJD 4HVVA 4JJBA 1X55A 2VUBA 2XK0A 5A0LA 1BCPF 1D8LA 2D2CC 2KECA 5JEAJ 1IBMQ 2YU9H 1NE8A 4KUDK 3W5OA 4CC3A 3D8GA 3L2RA 5M5WH 4HJ8A 4BB7A 4RCCA 1TWBA 1Y8PB 4FYYB 1VYTA 1GBRA 2HSEB 2OT2A 2Q2HA 1PYSB 1Q82R 2R7ZG 1PSEA 1WLPB 4BI3A 3E9FA 1BO0A 3I56T 3EVQA 1UE5A 1Q1EA 4X65L 1J5EL 4XTYA 2NTTA 3S6WA 3CEYA 4DBHA 2DJQA 1AHJB 3PUWA 2D8JA 1LVKA 2FRWA 2ENBA 1PTOB 1WDXA 1WJQA 3META 2CZ1B 3HPWA 4K5WA 2RJCA 3HKZE 3KF6B 5E3FA 4JYAQ 1X6GA 1JOOA 4LF5Q 3CRKC 4H44C 1C1AA 2Z9HA 2F5TX 2XMFA 3U50C 5A2QL 3ME9A 2J06A 4M7DB 2PNHA 5M5YH 3U9SA 4DEYA 4R4CA 1BIAA 4F7UB 1D0XA 4I7AA 3CF5A 2M9UA 3VJPA 4BD3A 2C0IA 1YWPA 4QB4A 4X62L 1N34L 2P84A 4IFDI 4IPHA 1D0YA 1SHGA 3SWNA 1TQOA 4HT9A 5EGTA 1GUGA 4A4FA 1EIFA 1YHAA 4J6HA 4BA1I 5GAN8 3QUIA 2Q8TA 3JCMJ 1K73C 3J81E 3KF8A 4HIKA 3PUXA 4MZPA 4B9WA 3A5ZB 1I8FA 4J5YA 5D6XA 3OYDA 1UDLA 2YRCA 2KXDA 5CKBA 3G6JB 2PQAA 3ERQA 4PFPA 1MGSA 1YWOA 1UUPA 4DV0L 2Y0SG 2E5LL 1K8AC 3MVVA 4DV3Q 3SE0A 3W1GA 3GD7A 4LF7L 1PKSA 5EPKA 2EYXA 1JWSD 4OVAA 4BY7B 5IYDH 3RUZA 3VS4A 2B2UC 1V1OA 2KHJA 1SSHA 1ZLMA 5CR3A 2PW5A 3VYGA 2P0PA 1Y57A 3T1HL 3FDTA 2ESWA 2YRDA 2K28A 2DRKA 1HZBA 4A75A 4B3SQ 3PQIA 1I81A 2F0IA 2K7AA 2ID0A 5GANg 4E6IA 4XQ3A 1TKWB 3LWHA 2EE1A 4LD9K 4JI1L 5KYXA 4HJ7A 3X24B 1TWAB 3I7FA 4IO9A 2J7ZA 1IZ6A 2E74C 5I6YA 2YU9B 1LACA 4DV4L 2JS2A 1XPOA 2DVEA 1JU5C 4XAXB 2JEBI 1YN8A 4B3RQ 1E7ZA 2Q8RE 1SHFA 4OXPA 4EMGA 1N33Q 4JI8Q 1FX7A 4KGVB 4XTUA 3H9NA 1VQBA 1G6PA 4V2SA 2EQKA 5EKLA 4XYOA 1VQ9T 2DGYA 3F1ZA 1BI0A 4MZ9A 3C46A 3OWFA 2COWA 3GOXA 1NG2A 5CKFA 1YJ9T 5KNDA 1B7TA 1BBUA 4R4TA 2C0TA 3NP8A 4KN4C 4OX9Q 4RKUE 2XWBB 1JB0E 1EY0A 1Q12A 2LY7A 4JVZA 1Y1VG 1S1NA 2ROLA 1O80A 5C44G 3AYHB 2YUNA 2B63H 1NNXA 1OXSC 2FEIA 1NM7A 2QASA 2OTJT 1A8VA 1Q8IA 1S5FD 2P5ZX 1UGRB 3VUZA 1YHBA 4BS9A 3OYIA 1LPLA 2Z4HA 5IODA 3C0CA 5LJ3j 1YBYA 3HOYG 1M8AA 1TT2A 3QR8A 2L4NA 2K05A 3CCUQ 4KHZA 5IGCA 2LQWA 5GAN7 2EXDA 1VYVA 5T1GA 4AYBB 1JE4A 1RTOA 3NWSA 4U673 1IREB 3FIFA 4A3JB 3C12A 3EG1A 3V7SA 4UDUC 4J1MA 2KENA 3A98A 2E2DC 3D3RA 4JI4L 3O13A 1MHWC 2WKDA 2QCPX 4M4ZA 5IOCA 4M7AF 1D2BA 3EG9A 1QZGA 3NGPA 4JI7Q 1H9MA 3K59A 2EJFA 1C8CA 1M2VA 2WAQG 2COYA 1VQKT 3CCMT 5GAHC 3GF5A 4RCBA 2X35A 4C92C 2M16A 3H0FA 3NFCA 4ZGJB 2LFNA 4DK3C 1CHQD 3UATA 2E6ZA 5D7UA 1B9MA 1BBWA 1YHQA 3S1QH 2PTKA 4KD3A 1VIEA 3TQYA 3H0GH 1WGSA 1W2BP 2KRSA 1UJYA 2VZAA 1U1TA 3QZ5B 5GMKm 1UWVA 1WVLA 2JA8B 1EIHA 2MAMA 4MZTA 1Q81R 4ZYSA 1I6HB 5JJZA 3RLFA 4QF4A 4M77F 2DEUA 3RN5A 4LF4Q 1EIGA 3T53B 1UB4A 2K14A 1QW1A 1WHGA 3S3OA 3VKIA 1DM0B 1XXGA 2RSNA 4HTHA 1WIEA 2CWAA 4YCVA 1FYNA 5KH6A 2HD0A 2BA1A 3OMGA 1KD1R 1I5LA 4OIJA 3Q1JA 1MMDA 2JA7G 4ELYC 2IW3A 2B2YA 1UEAB 2OF1A 3KLSX 2EGAA 2JZ2A 5DY9A 3RUXA 3UDCA 1YIJT 3ZBDA 1WFWA 4M7AE 1I5FA 1ML0D 1VF7A 3E3XA 3IFTA 3FKIG 4MTNA 4RCOA 2KDSA 3A8LB 2E64A 1EEID 4DOWA 4LFAQ 1LYLA 2EJMA 2A08A 1EQQA 4DBFA 3NWTA 4A4IA 1Z9QA 4LDYA 4K8IA 4C3IB 2XVSA 1B8AA 1TG0A 3NQIA 4NB3A 1ZSZA 2LX9A 4PFOA 1VMCA 1IKLA 4RMFA 1SNOA 8ATCB 1TWHH 1V76A 3DLMA 3CCUA 5FU7C 2HQXA 2KT1A 4EMKA 2QQBA 3M9QA 1TR5A 2LMJA 3E9GA 4R4OA 3V8JA 1Q90A 4BY6C 3AT1B 4M77E 1UAPA 2X9HA 2KCCA 4UPAA 4JBWA 1Z9FA 2IVWA 2O2LD 1K9MR 3K5OA 3R8BA 4O1NA 3MP8A 3JB9J 3A55A 3T56B 3P1HA 4X3UA 1IHZA 2MMPA 2NWGA 4DAVA 2RO0A 3TN2A 1SFOB 3RD4A 1B3QA 1TWCB 3OPOA 5IWAQ 2B2WA 3CCQQ 3KOJA 4GKKQ 4AFZC 1EYDA 1F2YA 3FEOA 3VYTA 5CIUA 1PTOH 4WTOB 4YHHQ 1YI2Q 3K5MA 3PUZA 3KDFB 2F0HA 2O2OA 3HOVB 4XTZA 3D6CA 4AFSC 3A74A 5KNBA 1G8XA 2G3RA 3VR3A 1JT8A 2FRYA 3MFYA 3UPUA 2Z1CA 1VA7A 3A8JE 3EN2A 4FT2A 5DLOA 4N4GA 4IUNA 3VYUA 3HOZG 2MO1A 1RAAB 2BIVA 1NCVA 2QGGA 1M90C 1XNIA 2EYQA 3NQTA 3I73A 3JCMW 5CKDA 2K5DA 2XNAC 2VQEQ 4EQOA 3S16B 4X9DA 3JCMb 5CQYA 1UGQB 4ABNA 1SEMA 4N0AA 2RQRA 4WORA 3QDRB 1GD7A 1RACB 4DV2L 3G6EQ 2F52A 3S1MB 3CW2C 2DX1A 2I5LX 3PVQA 4ANJA 1ACMB 2DLPA 1Y96B 4JRIA 1D09B 5CVIA 2A5HA 4FXGC 2GCXA 3SB2A 2ZJPA 3QPHA 2ICEC 1SNMA 1EFNA 1L1OB 5JVH3 2NZHA 7AT1B 1QNKA 4M78A 3EG2A 2BZ8A 1LTRD 1QUQA 3KK7A 2O9VA 2L0AA 3CC2T 3OIPA 1OU8A 4C0FA 3RNUA 1UE7A 4JI2L 2NUTB 1AZPA 2VYTA 1OZ2A 1KABA 4X64L 1ZEQX 3NXWA 1OI1A 3PO3B 3VR6A 3G48A 2GF7A 2KEDA 5CKHA 4M7DG 1MIUA 2ABLA 3WOFA 5HGTA 3EHRA 1TXQA 4F7UG 3SGIA 1ZYRC 3AB9A 5FLMG 3BZDB 2F1LA 4HJAA 1UFFA 3CCQA 2HCCA 5GAOr 1Y1WB 1CKBA 1JORA 4JLGA 1U5SA 1BI1A 3KUFA 3VS2A 1CFMA 1KDCA 1TWAH 2BH2A 1EEFD 3SHLA 1R4QB 2BUDA 2HEQA 1S5CD 1SYGA 4JK1C 1YI2A 3M57A 1KK7A 1G91A 4JI3Q 3QWYA 1QWYA 4C92D 4A3CG 5D3IB 5DNFA 2M0OA 1NAPA 2EY6A 2NYZD 3RKYA 1HNWL 3BZCA 3M4QA 4ZNXA 2LCLA 1WCMB 1H9SB 1GJXA 1WTRA 2KUMA 1ZKOA 4R4IA 2PUOB 3VV0A 2FZCB 1PVOA 1G83A 1ENAA 2JEAI 4F88A 4M75C 2JVVA 4OP0A 3RLOA 2F69A 2W10A 5KIXA 4F16A 3G6EA 3LW5E 4ILWA 1N8RU 2LJ1A 2QA4T 1YEZA 3IFDA 4BXXG 1VQCA 1KQSP 3CQTA 5I2YA 1PD1A 1UE1A 4YIJA 4KH0B 5IAYA 2E2HH 4RG8A 3AQQA 4TQUS 1TOVA 3S3MA 2HCKA 3AHUA 2RH2A 4LF6Q 1VQLQ 4J7IA 1II3A 2JA6H 4H13C 1CKNB 4FO2A 2QDYB 2V1RA 2RHXA 1YJWA 4HIMA 1HXDA 3ND9A 1FWZA 4BE1A 1O78A 4YY3Q 2WKCA 1I50H 3VS5A 2QYZA 3CCLA 2EYPA 2Y0SE 2XU8A 3HFOA 3OYNA 4DK6C 4PMWA 4DR2L 5EKKA 2MOXA 2BH8A 2F2XA 2IPOB 1ABOA 4BACA 5C4ZA 1HR0L 1QWFA 1GKHA 3KF6A 2OX7A 4C8QB 5CR2A 2UUCQ 1WHMA 4UP8A 4A3LG 3U23A 3OW2A 2CUDA 2ZPFB 2WFWA 2BKDN 4EGVA 1F1BB 2ZXOA 4C3JG 4KI0A 1EX4A 4LUZA 1X43A 1WD1A 1YHQT 2WB1G 3CD6T 2E5QA 1BOSA 3JAMi 1W6XA 3P7JA 3HOWG 1AH9A 1YFNA 4QQ6A 1ABQA 1N9RA 2A28A 1TS3A 2XGTA 3A56A 4GLAC 2RB6A 3RESA 3S1RB 2HUGA 3I90A 3IQLA 4KKTA 1R0BG 3UF4A 2YTVA 4ESRA 1PYBA 3BU2A 1S5DD 1ILPA 3D4RA 2YTYA 2L5QA 3CCEQ 1FMKA 4CC7A 4L5RC 5GMKl 2EKHA 2DNCA 3MCAB 4FVMA 3A8MB 2XDDA 2JYOA 2HL5C 2EY2A 3D0FA 3FMCA 1GUOA 5I4DA 5M3MG 3M55A 3S2DB 4BBSB 5GMKe 2VQFQ 1X27A 1EY4A 4AYBG 2P0QA 3SWNB 1N36Q 2O31A 3OYEA 1JQYD 5C4XH 2A6EC 2NUCA 1PRTB 1H3ZA 3R6OA 3EG3A 1KLGD 3RR6A 1C7YA 1D5XC 1YNJC 3KF8B 2N88A 4U68A 1SAPA 3GTJH 1D1CA 1S4ZA 1DYQA 2E65A 3MEWA 3QB3A 4J15A 1IGQA 3M7NA 4UC4A 1XNQQ 3TDQA 1PYWD 2EAYA 2KEEA 1M1KC 1W3SA 2JS0A 4C0GA 1X2QA 1MI2A 3PUYA 4IPDA 4J7FA 4ULLA 3M0RA 1VQ6A 3ITPA 2YYZA 5EKIA 3HG9A 3J7YW 1R0CB 1WHLA 4KGZB 2JA8G 1IKMA 5FRNA 4K5XA 5DAUA 2EQIA 4LF9L 4C92A 1MSGA 5IIFA 1JR0D 5LJ5f 2DTHA 3J81L 5GAMh 1VS0A 4CDDC 4EVOA 5FO7B 4M78F 3JCMQ 1XYIA 2RQUA 3NE5B 3TP7A 5BN3A 2L3PA 4I7ZC 3IRBA 1V43A 1NJIC 5KYXB 1B9NA 1X3FA 3UE0A 1EOTA 4PFZA 2LJ3A 1ZYRD 2V8JA 1HFNA 3NTHA 2E12A 1SG5A 4C1NK 2VW9A 1VQMT 1ZA2B 2SEMA 3LH0A 3CCEA 2HCIA 2FL7A 2PMZB 3CCVT 1AN8A 4A3KG 4C3IG 3SD4A 3P8HA 4GNXC 2KE9A 4M77C 1A3TA 3OYBA 4DV6L 2MF2A 2MPXC 2RKSA 4A3BB 2ES2A 3M7GA 3FC3A 3H6MA 5J26A 3HRTA 1GRIA 2MWOA 3I72A 3PTAA 3GTGB 1QP3A 5KNCA 4KJOA 1HRJA 1HJPA 5IYCH 4C0DB 2YHTA 1PH6A 4LFCQ 2DL3A 4M78E 5GROA 2QILA 4XIGS 5CV9A 1ICFB 4M75D 2KQ3A 5JOBA 5DM63 4AQYQ 1LTGD 2F3WA 2WSFE 5JPNC 4PMCA 2NVXH 5M5WB 2RNAA 1JOKA 1Q86C 2X6LA 5G3LD 5C3EG 2R7FA 1FD7D 4R0KA 1XMOQ 2EYYA 3SK8A 1WHHA 2QGFB 2LNHB 4OMPA 3GNGA 1WOCA 5EPLA 4KHVA 3CC7Q 4XQJA 1WXTA 5GAOp 3K57A 3HOVG 2H3JA 3MXNA 3S2HH 2DETA 1F9RA 1CSKA 4A3DH 4ME7A 5ELFA 5KYIA 5JJLA 1RI0A 3C94A 1PFNA 4JBJA 3OYAA 1IBLQ 1K76A 2RI5A 4ATOA 3VRZA 1M2VB 2MI6A 5KYNA 2CHBD 2DNEA 2JN4A 1M5Q1 1Q7YC 1FL0A 4QQBX 4JI5L 1RAHB 3MEUA 1TWFH 4NMZA 5M5YB 1PM3A 4PJOA 1YI2T 2DBMA 1VQGA 5LMNL 3L0OA 4DR3Q 5CQXA 1N9WA 3T51B 2R92H 5GAEC 2UXCQ 4JLIA 5FJ8G 1LTLA 4RGOS 1PTOF 3MXPA 2CKZB 2X3WD 3L42A 4J83A 3JB9I 3OTOL 4E7LA 1N9SA 2O9SA 4ZKBB 3HOUH 2L55A 2NBFA 3FB9A 3OYMA 3TSZA 1AWWA 1L2FA 3A8IE 2C35B 2DKGA 4M7DF 2DEQA 3PCOB 4DUYL 3TVTA 5GAOm 1EUJA 2QEJC 1R9TH 1X69A 4KT0E 4F7UF 2M00A 3K0XA 4FXDA 1N5ZA 2A37A 2D0PA 4OMMA 3U9OA 4APVA 1FMVA 1X75C 3PO3G 4A63B 1K9AA 2YXYA 1CKOA 3JB9H 4R8NA 1M4VA 4FM4B 4B08A 1LV9A 4O6JA 4IALA 4KULA 1OZ3A 2EJ9A 5GANf 4FL6A 1MNEA 3OSSC 2DL7A 2KYBA 3CMAT 1NR2A 2CVRA 4K0KQ 1ZSZB 4ZUIA 1YJWT 3UDXA 1Y1WG 3BDUA 3JB9D 2A6ED 2OTLQ 3M3YH 3CCLT 3RMSA 1HNXL 1LTID 1DZ1A 4EMKB 1YNJD 3NEMA 1UHCA 3GDEA 2UU9L 1DOLA 4DUZQ 2JTMA 5D6WA 2MO0A 3E9IA 2C0OA 3I55T 1JBMA 2KT8A 3CC7A 4WFN3 3CPWS 3GP8A 2QEXQ 2DTIA 4J9CA 4M7DE 2K5VA 4A93G 1JWMD 2JM8A 2K5LA 1C6VX 4F7UE 3GBQA 4RTVA 3QYHB 2LQKA 4HCKA 1VQNQ 4A3MH 3A1PA 3ONAB 1JJ2P 4CHTB 5I6WA 1SE3A 2LDMA 1XX8A 3A8KE 1G3SA 1TU0B 2A7YA 3THKA 2KCTA 4GN3B 3GTPH 2B86A 4Z89A 4TVRA 3JCMP 1WHKA 1KC8R 4FDBA 1P92A 3RERA 4ZLTF 2PU9B 4L59A 1G3WA 2DAQA 1VQ8T 5LMUQ 4PL6A 2J6OA 3HP3A 4KRTA 1PDQA 1XPRA 4OO1H 1Y69U 4M75A 1V1CA 3BJUA 4M7AG 5GQOA 2A3LA 4JI6L 2X51A 2FHTA 4OWTB 2B2TC 1VYUA 4NXMQ 2B8AA 1QOHA 5IP9H 1I1JA 2HQLA 4JV5L 2B63B 9ATCB 2B2VC 2NN6G 1PG5B 1STBA 4IQZA 4QKUA 1W4SA 1VQDA 1PZID 4DR1Q 1I94L 4M77D 5FWBA 3F8TA 1U5KA 3C2PA 2NVTH 4BE0A 3ERSX 5T1IA 5J39A 1EQRA 5AT1B 2NWMA 2DIQA 2I07B 2ENMA 4HMIA 2F4VL 3CCRQ 5FW9A 3CCSQ 5I11A 1I4XA 2KY9A 1VQ7A 2KVMA 1EU4A 3KYHC 4HJ5A 1VQ6T 2OTLA 3F2CA 4DFAA 4DA2A 3PGGA 1ZBXA 1QUQB 1Z9ZA 4X9CA 3BYYB 2HDLA 4OMOA 3QO3A 5KYLA 3PF5A 1M30A 4LMQD 4BY1H 5ECAA 4HIDA 2QEXA 3I4MH 1VIFA 1K73U 1WQWA 3S1QB 3EFOB 4A3EH 1BBZA 1Q3LA 1M8MA 1I07A 4EDUA 1LNXA 1VQNA 2ZXPA 3OIQA 5EPJA 3X3MA 4BBSG 1SJED 1QVGA 2OCEA 1EYGA 5C5LA 2KCNA 2ZZDA 4IN3A 2LNVA 5LJ5g 1K8AU 4GKJL 2DTOA 2AK5A 4HCCA 1VQFA 3CBMA 4L5QA 2Z0WA 4EQPA 3J7AF 4G57A 4RCNA 3QOLA 5FWCA 4FYXB 4MDXA 3PF4A 1ZQ1A 4JI6Q 2F0TA 2DZCA 3MWYW 5DEHA 1ZA1B 3H3VC 1BCOA 2HNIA 1D0ZA 2PVDB 3KJPA 1STGA 1SPKA 2LT4A 1T5EA 2VUMG 4BUGA 1VQOQ 1BKBA 1E1OA 2H1EA 1OU9A 3ULPA 1SLJA 2DY8A 3INZA 2IWHA 4AYBE 2ZCFB 2R7ZH 3JAME 4UP9A 2NUZA 1CKNA 4BI4A 3M5AA 4CC2A 1KG1A 4HR7B 2A0FB 1I4RA 5IGBA 4DV7L 3NELA 1TWHB 3MTSA 1IBKL 4JPBW 1VQHA 3K7UC 4YCWA 3TS2A 1SYBA 4ZUJA 5LJ5d 2DIGA 3C3LA 3CCRA 3J80i 3CCSA 1MJCA 4ALPA 4E7SA 3MKDA 2GGRA 1E6HA 2E3HA 4WF2A 3ASKA 4C8QA 3TEEA 3PIO3 4DPGA 1O75A 2MWPA 3EQLC 1Q82C 1C9OA 2FPFA 3CC4Q 2RSOA 1UG1A 1CA6A 3NENA 1N32Q 3QJYA 1D6EC 2I0NA 3EH2A 5KE2A 1JO8A 2XN9C 3IL8A 2KR3A 1I5OB 5LJ5e 4O0AA 4LF8Q 2EY5A 2EVRA 4F04B 2AT1B 1BQQT 4JI0Q 4LNQA 3DM3A 2IX1A 3FJPA 2LT1A 1QB5D 4A53A 3HRSA 5GAOn 1M4ZA 4F7XA 4B3TL 4A3BG 2XHCA 1WJSA 4Y91A 4G7ZC 4AIMA 2R6GA 1LABA 1SSOA 2DXUA 4HVUA 1OXXK 1VQ4T 3HOXH 3L2WA 2IJ0A 3DEOA 1Z7TA 1XNRQ 1QVGP 3TSWA 2EYMA 4GLXA 3BFMA 5GMKh 3STBC 3W2DA 1QLYA 4H0LC 1XQHA 1IW7C 2NZ1D 2QF7A 3PO2B 4B6MA 2DE0X 3MXGA 4N9TA 1FNWA 3CBPA 1I4HA 1TUGB 1GCQC 1RLQC 2L89A 2EIFA 1XMQL 5C3WA 3RN2A 1HH2P 4A3GG 4ZN3A 1PH4A 4BI8B 1VQOA 2EW3A 2HBPA 1PMRA 4Y28E 2K57A 4IUUA 4BDYA 5I21A 4JOIC 1FJGL 2A6HC 1GHKA 3RNJA 1U3OA 4AG1C 5GAOl 2XD0A 1Q8KA 4XDXA 2DD4A 2J4XA 2XRSD 4IFDH 3VS0A 1AP0A 2ZXRA 3N52A 1WXBA 2LS01 1TSFA 4B9XA 1S40A 3NBHA 2F2VA 1G8ZD 3PT9A 3TP5A 4TSSA 4R8IA 1D7QA 1E3PA 2M1HA 1K0RA 3ZJYC 4ZK9B 2E5KA 2F3VA 1L0YB 4X65Q 1STNA 1J5EQ 3G1JA 2D0OA 3HZXA 1PXUA 1A62A 1X56A 4DV1L 3T4AC 4C92B 3K7AH 3CMET 3D4WA 4GLKA 1YZ6A 1L0WA 5GAN5 1PSFA 1K1ZA 3QJ6A 4EMHA 4J6WA 2F0WA 4NL3A 3TMEA 3JAMc 5FKAC 3H3VI 2DERA 4IPGA 3VDYA 2RDFA 4E7ZA 1PC0A 5C44H 4RWSC 2WV6D 1ASZA 2O88A 3HSBA 2AQ3B 4J9EA 2E76C 2K2VA 2EJGC 3HFZB 1VQ5Q 2CGHA 2EWNA 4A3IH 1DOKA 4LFBL 1PZJD 4X62Q 2CZ7B 2YLCA 1N34Q 2ALYB 3HOYH 2D9TA 5FK9C 3K8AA 3C95A 4FT4A 1MD2D 1K28A 4KKUA 3DEPA 1WTXA 5GANd 3D4DA 4TVAB 5IYDG 3MPUB 4F17A 1BBXC 3CQZH 3JCMc 4HMJA 1LM0A 3TS0A 4C3HH 2CWPA 2ZGWA 1QWEA 2E2HB 2JM9A 3L2UA 4DU9A 4GN5A 1MNDA 2JSOA 2FJ2A 1RKNA 1ZHIA 3M53A 1PH5A 2JA6B 4DV0Q 2O01E 2E5LQ 3DLLA 1PWTA 2F0VA 4LF7Q 5FU7B 1TUCA 1IHWA 2MHVA 1M8VA 5GANe 1VQEA 1I50B 3MHBA 2DJFC 4O42A 1VQ7T 1HSQA 4GOPC 3I5SA 4WJ3M 1PH2A 3H8ZA 1A63A 5NUCA 4KH1B 3V8LA 1UGVA 1FGUA 2V1CC 1PV4A 3T1HQ 1UGSB 4LWCA 2K3BA 3OYKA 1X3QA 1M90U 4BBRH 2K5WA 1AEYA 4PJLA 1H3HA 3M56A 1DJ7B 2CQOA 1YITQ 1CK1A 4AH6A 3J81j 4KMUC 2LZ6B 1NEBA 1CZWA 4JI1Q 2JJQA 2NUPB 3MXNB 5IGEA 2WACA 1I4PA 2I0QA 3QG1A 3FRPB 4DV4Q 1A2TA 4KTAA 1EYAA 3EHQA 4PKCC 1Q81C 4C8QF 2FZKB 1JJCB 1YJNT 1JWUD 3T13A 2B63G 1ET9A 3FPUB 4IIMA 3LWUA 3NBIA 4PJOB 2AWNA 1TY2A 2OQ0A 1A0NB 3O8VA 1VQ5A 2EGEA 3EGDB 2MPMA 1K8MA 1PNJA 2RDGA 3GTLH 4JG2A 2W0ZA 2F0EA 1T3LA 1AE2A 2B2VA 4CBVA 5C6AA 1KD1C 5M3FH 1D1IA 4IOCA 3ER0A 3PV0A 4JS5A 4L8JA 4ZQ3A 2FINB 2O5JC 2XICA 1LLRD 1H641 4OMQA 1QVFS 2RBMA 2E2IH 2RQTA 4CDEC 5C4XB 3S15H 4M78G 1B2TA 2X69A 4HEDA 4KLKA 2YTXA 5GJWB 3STBD 1SBBB 4D8KA 1IW7D 3GTJB 4FSXA 3X25B 1WJRA 1WTOA 1X2KA 4QVDA 3VRYA 2KJXA 2PZ1A 3Q8DA 1GM5A 2K01A 2E2JH 2CT4A 1QVPA 2KYMA 2Z8LA 1M1GA 3CCRT 1NTGA 5HGQA 3CCST 4C8QE 2KHIA 4L6V5 3H0GG 4ZCKA 4DA4A 1HQMC 3DKMA 1HD3A 4JI4Q 4E7JA 1PRTF 2KRMA 1OX9A 2HL3A 2CYZB 2DO3A 2EYJA 3BDCA 1K9MC 5GMKj 1EIYB 1T3SA 4GLVB 1K3BC 2DY7A 4PJJA 1QCOA 4OB0B 4Q0FA 3ULJA 3MEVA 2Z6KC 1YITA 3V7RA 5ELNA 3X3NA 2JTFA 3HOZH 3GTKB 1M1FA 3KXTA 2DJZA 3OBYA 3VYRA 3OS2A 4FF3A 4A3FH 1DCZA 1EFID 4JBKA 3J7A5 1B70B 1PRMC 1HR0W 3W1BA 1BU1A 2VXWA 2ZPGB 1RUWA 1WPYA 1A2UA 3AFQA 3CCJQ 2EVBA 3MEAA 3F2UA 2LCSA 4OB2B 2DM1A 2VC8A 5K5PA 1I3QH 2CUBA 1IB8A 1X3EA 3AU7A 2L3RA 5J22A 1PHJA 3ULRB 1CUKA 4MNOA 3PO2H 1SE8A 2RPNA 4M75B 1KXLA 1W6JA 4QUFA 2OI3A 1B53A 2Y90A 5EJWA 2E10A 2KVQG 1EY8A 2MNAA 3HEJA 5FO8B 4PZ6A 3CP0A 4ZGDB 1FNVA 2IL8A 2EYHA 3UA6A 3SFMA 3VS7A 4L6TB 1SKUB 3MA2B 3E0JA 2NVXB
chains in the Genus database with same CATH topology
4XK8E 4YWKA 5LJ3g 3FHWA 5FU6C 2GFUA 4HCZA 1Y7XA 2OWOA 1K3RA 5CKEA 1UEBA 3RKXA 1GXIE 2K50A 2YV5A 2PMZE 4P71A 3HL8A 4UP7A 1B7YB 2L8DA 2EKOA 4X34A 5HK3A 3J80E 1M1KU 1QVFA 4BXXH 4A76A 5GAOq 3QBYA 4R4QA 2E8GA 4DR6L 4POGA 1HNZL 4DV2Q 4BY7G 1AE3A 2BA0A 4FU6A 2ZTDA 1SN8A 1S3OA 3OQ5A 4P75A 1NJIU 2GN5A 3UWNA 4C3JH 4C92G 4E7HA 3S17H 4JI2Q 3G7ZA 3KLWA 4X64Q 5GAN6 5GAGC 4KHPL 3VU3C 1X3GA 5LJ5h 4DR5L 1X65A 2O4XA 1J6QA 3L2PA 4EQ5A 1ASYA 3HRUA 2UXDL 5M3MH 5K36G 2EJGA 1Y07A 3A8OB 3EFRA 1Q86U 5AJ3L 4Y7NH 4XU2A 1VQPA 2RHUA 2JA6G 3FDRA 4DKAC 3EAEA 4C2MH 3LLRA 5LMNW 3UDGA 5IN1A 3OYFA 4C0ZA 4YCUA 4A3JG 2LVMA 3FRNA 4DAMA 5IY0A 4P72A 1QP2A 1Q7YU 1TH7A 3CBOA 4GOPA 4ZGEB 5IP7H 3CCUT 1VQLA 3BDLA 2JQOA 1U1SA 3J80c 4IJHA 4QGUA 4DR2Q 3URGA 2ZPIB 1HR0Q 5AYFA 3NBHB 3PMIA 1HZCA 3E9HA 4X66L 2CFMA 4PJOG 3G4SA 1E1TA 2JNGA 3OY9A 3T1YL 4M7AC 2R7DA 4BA2I 3GTKH 1KRTA 2NVYH 2I2LA 1K8GA 3OS1A 3CXCS 2LXKA 1WYDA 1UE6A 2FXQA 2N49A 1B34A 3X20B 2B3GA 3QHSA 3QXEB 2DK3A 4DV5Q 2UUBL 2HIXA 4C5GA 3J81i 2EQUA 4DR4L 2IG0A 5C3EH 2RHSB 3N5BB 3E1SA 4L5GA 5C0MA 2ZPBB 2XI9A 2XTIA 4LDWA 5GANh 3PMTA 3FP9A 3EIVA 3TU4K 4O2DA 4JDSA 1HNWQ 3ZEHA 3CPFA 4P73A 4AQYL 4A4HA 4LF9Q 4NXNL 1FXXA 1XTDA 1P16A 4L5TA 3LGFA 3RIRA 3WVEB 4E7IA 3CCQT 3X28B 5C0XG 5IYBH 2I5HA 4ME3A 1YNXA 5IYCG 3OYLA 3P8DA 2NLUA 5GMKi 1MKHA 5BR8L 4B3ML 4DV6Q 2XDBA 3L1AA 4CRIA 5LJ5j 2UXBL 2H5XA 3BW1A 3G6ET 4HT8A 1IXRA 3GTQH 2CZ6B 2K5HA 2HHHL 3VYHB 4A93H 3PGZA 1YCYA 3LX7A 3G71A 1P8LA 2JA5H 2LSSA 2D6FA 2X4WA 4R55A 2VXFA 2Q2IA 4IUTA 2NN6I 3KBGA 3QKJA 3I4NH 1A0IA 2RD1A 4E7KA 2ASBA 1TWGH 1WCMG 4HCBA 3TRZA 2DD5A 2ZJQA 4JI5Q 2B29A 2GFAA 5J3BA 5LMNQ 2OQKA 4FIBA 1G51A 3BY7A 3BZKA 5L8RE 4A4GA 4HIOA 4M7AD 4C92F 3V8KA 1KC8C 2V8IA 3OTOQ 4PLLA 2K75A 5E7NA 1WQ7A 2AHOB 2MFIA 3OYHA 4EX5A 1Q82U 5GAN2 3H6ZA 1KQ2A 4DUYQ 1XOVA 2R93H 2FVUA 2N3SA 1U0LA 3EFSA 4ZN1A 2CKKA 4JS4A 4LDXA 4RG1A 2WSEE 3ZFJA 4IUQA 4C8QG 3GIBA 1JMCA 2EQJA 1VQLT 4IKFA 3JCMV 1YJ9A 2RA2A 2WP8J 4H02A 3ULLA 4A3MG 1KIXA 2ZM6L 2RI3A 4C92E 1HNXQ 2UU9Q 2GVAA 5CO7A 1JJGA 2OTJA 3S1NH 4PNOA 4OO1G 3S3NA 1IBML 3UE1A 5IP9G 2VUMH 4Y52H 1CSPA 5GANj 1V9PA 1BI2A 3TCJA 3CCET 4YWLA 2YLBA 3QIIA 3QZ9B 1VQKA 3CCMA 3L2ZA 4JV5Q 4JYAL 1MGQA 4QW2A 4LF5L 4IJLA 4PJOF 1W2BS 3RMQA 4JJNK 1I94Q 1OYXA 2V8KA 4LUVA 3JC66 4BY1G 2VS1A 1DGSA 2F4VQ 3I4MG 1BI3A 2RJEA 4A3EG 2FHDA 3CPWA 4NL2A 4E47A 4OGEA 4CI0C 1YIJA 3GTMH 1NPPA 2RHQB 3WWVA 4M7AA 1K83H 1G5VA 4N0AC 2JUFA 2LRQA 4PJOE 4WJ4A 5HKCA 1KQ1A 2O4XB 4DV3L 4M78C 4A3GH 4GKJQ 3E19A 2HQEA 4GNXA 4M77A 4B3SL 3PUVA 3PSIA 2QTXA 2P4TA 4D6WA 4XU3A 5KE3A 5LJ3f 1JE5A 4QQDA 1V29B 3HP9A 3NTIA 1FVIA 2KK4A 3GLXA 1RL2A 2P0KA 3LGLA 4B3RL 2FYKA 4DV7Q 1N33L 1IBKQ 2YRVA 4JI8L 5GAMg 1G3TA 1NPRA 1Q81U 4M75F 3G71T 4GOPB 2KCMA 2VGNA 4OX9L 4DOVA 2DXCA 3M85A 1D3BB 4C5EA 3QSUA 1KD1U 3MEFA 3CC4A 1YVCA 4P74A 1JB7A 3CC7T 3HOXG 3GPLA 5FLXE 2DUDA 2EFIA 2AMCB 2PI2A 4NOYA 2QXFA 5M9OA 4B3TQ 1SROA 3K80C 2QQSA 5GAMd 3CC2A 2WSCE 3RZDH 1Y1VH 4XTCS 4A4KA 2VY3A 1NBWA 3MHXA 4M75E 3HKSA 2LQ8A 4JI7L 1W2BA 5JJKA 3H15A 4IFDG 3SDZA 1K9MU 2MQHA 1B34B 4JRQA 1XPUA 1C0AA 3MP6A 1XMQQ 5GAMe 3H3VH 2PQWA 5M5XH 2R58A 4M7DC 3TREA 2EQSA 1FJGQ 3GTOH 4LF4L 4OWWB 3OB9A 4GN4B 1PH9A 1KHCA 4BY6B 4MMKA 1X54A 2OTLT 3JB9F 3NTKA 4GS3A 4YTLA 4JCVE 4LFAL 3RZOH 3B6YA 4A3IG 3F70A 4DV1Q 2QA4A 1NMFA 1LJOA 2QEXT 4N4HA 1KQSS 5C0XJ 2QI2A 3M54A 2R57A 4XTVA 2JA7H 4JC0A 1VQNT 5IT9E 3FKIH 4RG2A 4LUOA 3L2QA 5LL6S 3OYGA 2A1AA 1R8OB 4IUPA 3AEVA 2I5MX 4LFBQ 2X4YA 2RI2A 4C5IA 5IWAL 2CCZA 4M78D 1Q46A 4GKKL 3J81c 1OXTA 1KL9A 2K5IA 3CD6A 5EG2A 4YHHL 5FLXc 4IOAA 3OYCA 3P8BB 4BBRG 4BE2A 2ATWA 2A8VA 1O9SA 1OXVA 4ZTFA 2RCNA 2K4KA 2QQ9A 2VQEL 4DR7L 5FU6B 2A19A 4LDUA 2HAXA 3X26B 5EAYA 2IHFA 3A8GB 3J7ZC 3PNWC 1S72A 1GVPA 5ELOA 5M3FG 2K52A 4IUVA 4GY5A 1Y14B 3K81C 4XU0A 3OS5A 4XTXA 1V1QA 3JCMg 1IYJB 3TEHB 1KAWA 3OBWA 4JRPA 4KBMB 4EPCA 1O7IA 1SRUA 3OSVA 2K5FA 2K3YA 1GO3E 3FLGA 1VQOT 2DPPB 4PZ7A 5GADC 1HZAA 3OW2S 4P5NA 3AFPA 4JI3L 1HK9A 2VV5A 2ZJRA 4MMLA 1VQMA 4PJOC 2XDPA 5FLMH 3CCVA 5IT9c 3JCMd 2QQAA 3I2ZA 2XKOC 4O5VA 2PVGB 3OMCA 3OYYA 4OF1A 4M7DD 3RKWA 3V7CA 4DR7Q 4A3FG 1KQSA 1LUZA 4A3CH 3CC4T 3M4PA 4II1A 2PI2E 4A4EA 3JCMe 2X4JA 2E70A 2VNUD 4LF6L 3PO2G 1QZHA 2N78A 1X9NA 1RIPA 3WVDB 1NZ9A 4YY3L 3F2BA 2RHYA 2K4YA 1EFWA 4BY7H 4DAYB 5LJ3d 3CCJA 1BIBA 3C4SA 2UUCL 2VL6A 1TXYA 4J6XA 5GAN4 2RF4A 1PH8A 4JOIA 3CAMA 4XTWA 2RHZA 5A0DA 3HHTB 2OAUA 1BVSA 3PIPA 4OMFB 5LJ3e 2LXJA 3F2DA 2RK2A 1VQJA 4A3LH 5D6YA 2VGMA 2JOYA 1CKMA 2KMTA 3OYJA 4QY7A 5CAIA 4OWXB 4RMOA 3HOWH 1Z47A 2KSSA 1MJEA 2VQFL 1N36L 3RLNA 2JK8A 5CK9A 4QL5A 4ZTJA 1L1OC 4M7AB 4JUVA 2E6NA 5JEAG 3JCMX 3M4OH 2DXTA 5A2QE 3CMAA 1XNQL 2EQMA 4DQ2A 1EOVA 4A3JH 1JRIA 1WNLA 1VQ5T 2E1HA 1I4K1 3I55A 1E24A 2VXEA 4GNXB 4M77B 4DR6Q 4M7DA 1HNZQ 2AKWB 2AHJB 4F7UA 1JJ2S 3VUBA 2JA8H 2RHIA 1VUBA 1VQIA 4Q5WA 4QIWE 1I6HH 3M59A 1VQ8A 3A0JA 4PG3A 2DXBA 1D3BA 4POFA 1HZ9A 5H1SE 4UY8C 1Y71A 5DLQE 4PJOD 3OA6A 4KHPQ 1QVCA 4HJ9A 2D0QB 1N27A 2RJFA 4DR5Q 2HT1A 4LFCL 1YITT 4QVZA 2PVOB 4A3KH 4C3IH 1S72T