3TREA

Structure of a translation elongation factor p (efp) from coxiella burnetii
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
129
structure length
129
Chain Sequence
THSTNEFRGGLKVMVDGDPCSIIDNEFVKPGKGQAFNRVKFRNLKTGRVLERTFKSGETLPAADVVEVEMQYLYNDGEFWHFMTSENYEQHAASKEAVAEAKQWLKEEALCMVTMWNGVPLSVEPPNFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Elongation factor P
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
total genus 20
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3treA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3treA02
1VQPT 2R93G 4BY7G 1UE5A 3CCRT 1W3SA 1NMFA 2CCZA 2R92H 4HJ7A 1EQRA 4JI8Q 4JC0A 4UPAA 4DV6Q 3M4OH 4A3FG 4MZ9A 1D7QA 2HQLA 4JI0L 4JV5L 2YYZA 2PQAA 4IOCA 2R92G 1WCMH 1XMQQ 4EQ5A 2AHOB 2JA9A 3D0FA 1IZ6A 3G4SA 4YY3L 4Y7NH 2MWPA 2OWOA 3L2PA 1FGUA 3ULPA 4DV4Q 4JG2A 1YJ9T 2JE6I 2NZOA 2VZAA 3NEMA 1CKNB 1KL9A 4MNOA 4GLAC 3T1HQ 1WCMG 1IBML 1ASYA 2HT1A 1V1QA 5J3BA 3UE0A 2MNAA 4LF7Q 4C3JH 3S2HH 4DV0Q 2Q2HA 1E22A 4C3IH 5EAYA 3STBC 2UXBQ 2XTIA 4OWXB 2YU9H 2HHHL 4NB3A 3J80E 3J7ZC 4POGA 3HKSA 1YJWA 1X54A 1NJIU 1P8LA 1TWCH 2R7DA 4OX9L 2IG0A 1PH1A 1PH7A 1OTCA 1M90U 4YCUA 1Q1EA 2HIXA 2V1CC 1JJCB 4KLKA 3UDXA 3AQQA 4LF8L 1VQ9A 2KENA 3E0EA 1JT8A 2OTLT 1SE8A 1XNRQ 2E2JH 3PIPA 3HOVH 1K8AU 1K9MU 2NN6G 2RCNA 3JAMi 4DV1Q 3K80C 1C9OA 4X62L 1K8GA 3PO2H 3EIVA 5LMUQ 3DLLA 1UWVA 2K14A 1HR0Q 1G291 3PUVA 4J15A 4NXNL 2JA5G 2UUAL 3HOVG 1B7YB 1Q81U 5E7NA 3UDIA 4DR3L 1FJGQ 3GTMH 2CKKA 2MI6A 2I5MX 3S1NH 3PO2G 1N36L 1S3OA 2MO0A 4RG1A 3G4ST 3LGFA 4QQBX 2PMZE 2VY3A 2FXQA 4R4QA 5GROA 4QY7A 3CCSA 2NVTH 4A3GH 1C7YA 1X6OA 3I56A 1QVGA 5IY0A 2UUCL 4RMFA 3BJUA 1OXUA 1NZ9A 2UXCL 4O0AA 4DR1Q 2ES2A 2B29A 4NPSA 4JBKA 3OTOQ 4A3EH 3OW2S 3L0OA 2MFIA 3HOWH 3PF4A 1J6QA 5ELNA 2E5LQ 1YJWT 2VL6A 1YJNT 3F8TA 4O2DA 3UDFA 5IE8A 1EWIA 1YBYA 2KDSA 1W2BS 3CMAA 4IJHA 4A3IH 4BBSH 1SR3A 1X3FA 4ZN1A 2CQOA 4DV7L 2VUMH 1TWAH 3HOWG 3KFUA 2G3RA 1VQIA 5C4JH 4DUYQ 1VQ9T 3PIOA 3I2ZA 4X64Q 4GLXA 3CD6A 2AWNA 4GN4B 4R4CA 2KHJA 1Y14B 2K5VA 1N8RC 2N8NA 3M9BA 4IO9A 1DGSA 4L5TA 2VUMG 4BBSG 4DV2L 1L0WA 3CCVA 1PYBA 2LXJA 5JEAG 5GADC 4B3ML 1A63A 3K7AH 4R1JA 1IBKQ 1J5EQ 4BXXH 1QUQB 3KJPA 3KJOA 3KOJA 4LFAQ 4X66L 3DB4A 4DK3C 5IAYA 2JK8A 3H0GH 5FLMH 2D62A 1PH9A 4A3MG 5IYCH 2I5LX 3LGLA 4A76A 4BXXG 2N3SA 1WYDA 3CCST 2VQFL 4A3LH 3H0GG 4KHZA 5FLMG 5IYCG 3CCEA 2LQ8A 3CC7A 1UE7A 4R4OA 1S72T 1Q12A 3CCLA 4AQYQ 3G48A 1HR0W 3T1YL 4B3TL 3I4OA 3TEHB 3WWVA 2XHCA 2LVMA 1KQSA 1E1OA 4DAYB 4DV5L 5IP7H 1L2FA 2LXKA 4IPGA 4DV3Q 3RN2A 3I55A 4LF6Q 3CMAT 1M1KU 4HJ5A 1VQEA 4JOIA 4AIMA 1K3RA 1HZ9A 1A8VA 3I7FA 2OQ0A 5IP7G 2UUBQ 1CSQA 4HIKA 3KDFB 2VS1A 4A93H 3EBEA 1Q86C 3D31A 3H3VI 3RR5A 1VQHA 2NZHA 1PYSB 4JI8L 3OYYA 3CCVT 3F2CA 4DV6L 4JI5Q 4P72A 2DUDA 2IHEA 1KD1C 5IYBH 4LUVA 1MJEA 5IWAQ 3J7A5 3J7AF 2K50A 1Q86U 4A93G 4YHHQ 3UDGA 2OQKA 3F1ZA 1XMQL 2QEXA 1QZHA 1KD1U 4LFCQ 1PH3A 4YWLA 5JJKA 5IYBG 1KAWA 2JQOA 1I94L 4DV4L 2ZTCA 2AMCB 1RL2A 4LF4L 1A62A 3BZKA 1HH2P 1O7IA 1G6PA 1Q7YU 1N33Q 4EX5A 3CCET 4DV0L 2R7ZG 1BVSA 1MJCA 1QUQA 4X65Q 1PH4A 2UXBL 5LMNW 3CCLT 3CC4A 4DR4Q 2MWOA 1XMOQ 1XNQQ 2E2HH 1NE3A 4HIDA 4YCWA 4QGUA 1HNWL 3P8BB 2MO1A 3PUXA 4QJFA 3S1RH 3I55T 3DM3A 2RHQB 5DLQE 4HIMA 1KRSA 5C0XI 2KBNA 1IBLL 2Q2UA 1JJGA 3BZCA 1XNRL 2IHFA 3RLOA 3KF8B 3PUZA 1G51A 1YHBA 2WAQG 3NENA 4LUOA 4R4IA 2VQEL 5LMUL 4QQDA 4JI3Q 4IFDI 1HR0L 4JYAL 2GVBA 2A19A 4OWTB 3H15A 4JOIC 2IX1A 5BR8Q 2JA6H 1K73C 4YTLA 1EUJA 4IJLA 5M3MH 1AE2A 4JI7Q 1FJGL 2Q2IA 3Q8DA 4ZN3A 1FVIA 4TVAB 2RHSB 3CC2A 3GTJH 2QEXT 1VQLA 4HJ9A 2JA6G 3KDFA 5M3MG 3M7NA 2JOYA 4A75A 1YVCA 1SMXA 4DR5Q 1N34Q 3PV0A 3MEFA 2KCMA 3HOZG 1KHIA 3JAMc 1HNZL 2JA5H 3J81i 3S14H 2R7FA 4OO1I 4UY8C 4DR1L 1LYLA 2QGQA 4X6AH 2JA7H 3OTOL 3CC4T 1B70B 1CUKA 5C0XJ 4L5RC 1H95A 1YI2A 1JJ2S 1N32L 2JA8G 2EIFA 1E3PA 2IT1A 4A3BH 3G6EA 2UU9Q 4BA2I 2N78A 1I5FA 1VQMA 3CPWS 1VQGA 3AFQA 1Q1BA 2JA7G 3E9IA 4DR2Q 4DR6L 1PVOA 3HOXH 3CCQA 4DUYL 1UEBA 4IFDJ 4X64L 4JI0Q 4A3BG 1VQOA 1YHQA 2CFMA 2N49A 1PA6A 1ASZA 2A1AA 4LWCA 1BKBA 4B3SQ 1TWGH 3TS0A 2ZJRA 4GKKQ 4YY3Q 3HOXG 2R6GA 3UE1A 5LMNL 1XTDA 1PH2A 1VCIA 1X3GA 5GAHC 1IBKL 1J5EL 5DM7R 2B3GA 4LFAL 4GNXA 5C3EH 1Q8KA 2XGTA 1AE3A 2B63H 2JJQA 2MQHA 1QVGS 2Z6KA 1WOCA 4GN5A 4DUZQ 5IYDH 5GAGC 1VQLT 4XIGS 4HJ8A 2Y0SG 5JJLA 3KBGA 1N9WA 5C3EG 2B63G 1Q82C 3CAMA 5IYDG 3ULLA 2WAQE 4Y52H 3RLNA 2E6ZA 2C35B 4DKAC 2PI2A 2OCEA 2I0QA 3HFZB 1Q82U 2E8GA 1EYGA 3CCJA 1JE5A 4LFBQ 4P74A 3W1GA 4A3MH 5IT9c 2AWOA 1YI2T 3GD7A 1HNXQ 1N8RU 4JI4L 3G6ET 3J81j 4DV3L 4A3JH 1KC8C 4LF6L 3S1MH 5FLXc 4IOAA 4DK6C 4DR3Q 2UUBL 2NN6I 1VQOT 1YHQT 3CQZH 4A3JG 2JUFA 3I56T 2JVVA 2K4KA 5C44H 2F4VQ 3KLWA 3BU2A 3K8AA 4JI1Q 4JI5L 4LF9L 1X56A 1FL0A 3U4ZA 5GAEC 5HY6A 2D0PA 3LGJA 3U58A 4BY1H 1YITA 1YHAA 4R4TA 4YHHL 2E70A 3K81C 4POFA 4LFCL 4K0KL 2K75A 3AYHB 3VDYA 3PSIA 5H1SE 4BY1G 1IL2A 3GTPH 4KI0A 3B6YA 4MTNA 3AEVA 4X34A 1X55A 4PZ6A 3U4VA 1Y1WH 3A5ZB 1UE1A 3CD6T 1KQSS 4GNXC 2ZJPA 3S17H 1S40A 1QVFA 2Z6KC 2UXDQ 2EQSA 4IPHA 4X65L 2VW9A 3HKZG 3CCJT 4YWKA 1LUZA 3I4NG 4OXPA 4DR4L 1XNQL 1Y1WG 1WJJA 3K7UC 1U5KA 3CF5A 1K83H 4GOPB 3RZDH 3RN5A 3E9HA 1L1OA 2Y0SE 3A5UA 3HOUH 2RF4A 3KF6B 1I6HH 3PUWA 1NPRA 1Z9FA 2R7ZH 1XNIA 1IYJB 3J81E 3JAME 1V43A 4NXMQ 3T1HL 2VNUD 1MIUA 1GKHA 3CMEA 1VQ7A 3HOUG 2GN5A 2Z0SA 4JI3L 3I4MH 4LW1A 4HJAA 4LF7L 3CC7T 3PO3G 1VQCA 5BR8L 2ID0A 4ME3A 3CXCA 1YITT 4A3DG 4KHPQ 5M5YH 3ERSX 3I4MG 4IPDA 4JBJA 3NELA 5ELOA 4GKJQ 1HZBA 1C0AA 4OWWB 2BH2A 5K36G 4BA1I 4GNXB 3RLFA 3TS2A 4DR7Q 4DV5Q 4L5QA 1XPOA 1SLJA 4DR5L 3NBHB 4A3KH 1N34L 2ZJQA 2BH8A 4APVA 4B3RQ 4JCVE 1VQ5A 2I5HA 4LF5Q 4DV1L 1VQJA 4DPGA 4ALPA 1JB7A 4JBMA 1AH9A 4A3KG 1XPRA 1Y1VG 2K52A 3CP0A 4LNQA 4HIOA 2UU9L 1WFQA 4JI2Q 2ALYB 1VQ4A 1I3QH 3U50C 4JBWA 4DR2L 2D0OA 3HOZH 1GVPA 1Z47A 5AJ3Q 4PG3A 1K73U 3TREA 1OXXK 5JEAJ 1YIJA 1RIPA 4L5SA 4IPCA 3S2DH 4P73A 1VQ8A 1KIXA 1M1GA 1B8AA 1T9HA 3CMET 1VQ7T 4P75A 3TQYA 4B3SL 1X65A 4GKKL 3HKZE 4GN3B 4DAMA 3J81c 1X9NA 1I94Q 2F52A 2JA8H 5IT9E 1TWFH 1L1OC 1V9PA 4UP9A 3A74A 2ZM6Q 4JI6Q 4LF4Q 4GOPA 2WFWA 4AH6A 5FLXE 1NTGA 4DUZL 3KF6A 1A0IA 2WP8J 2E5LL 1NJIC 1VQKA 1XPUA 1M90C 4XTCS 1NMGA 4QIWE 4C2MH 2KCTA 5A2QE 2CKZB 2PNHA 1YJNA 3GDEA 3MXNB 3M4PA 3A0JA 4OONA 1HNWQ 3RNUA 3M4QA 4FDBA 4JV5Q 1VQ5T 1K8AC 1K9MC 2K5HA 3CW2C 1VQ6A 1IBLQ 2A8VA 1OXTA 3GTLH 1JJ2A 1YZ6A 1EQQA 3CCUA 1BBUA 2NVYH 1GO3E 2KHIA 2K5NA 4YWMA 4LFBL 5JJIA 1U0LA 3CPWA 3CCMA 4UP8A 1IBMQ 4JYAQ 1HNXL 1Q81C 2VQEQ 5HGQA 1MKHA 1VQNA 1VQ4T 1SROA 3CC2T 1KXLA 5FJ8H 4P71A 2HHHQ 2YTXA 1YIJT 3FP9A 1PH6A 1L1OB 1NBWA 3W1BA 3ULJA 3PF5A 1PH5A 1VQ8T 1JMCA 5M5WH 1E24A 4OX9Q 1CKMA 2CWPA 2F4VL 1I50H 3M3YH 4TQUS 5FJ8G 3JC66 1BBWA 2GVAA 3LH0A 1X3EA 2ZTDA 3G71A 3OW2A 2JEBI 4JI1L 3EN2A 4LF8Q 3RZOH 1EIFA 4AQYL 3H3VH 4WJ3M 3GTQH 3GO5A 3F2DA 4LUZA 1W2BA 1QZGA 3F2BA 1HNZQ 4PZ7A 2JEAI 4X62Q 1S72A 1E7ZA 2L3RA 1VS0A 1VQKT 1YNXA 4UP7A 5C44G 1R9TH 2ASBA 3GTGH 4A3GG 1VQMT 2E2IH 1E1TA 1PFSA 4PMWA 1SRUA 1VQAA 4DNIA 3KYHC 2UUAQ 4NXNQ 3CCQT 1YEZA 1N32Q 2CWAA 1TWHH 4A3LG 2WB1G 1KC8U 1SN8A 5C4XH 1LM0A 4GOPC 3J80c 3M85A 3GTOH 3HOYH 3J80i 4A3EG 1VQ6T 3DB3A 1CKOA 1CKNA 1VQBA 1N36Q 3PGZA 1EFWA 4DR6Q 5IP9H 2UXDL 3CCUT 2DO3A 4GLVB 1Q46A 4AYBG 5C4XG 3CCMT 2QA4A 2OTJA 3FKIH 4A3IG 1SFOH 3HOYG 3S15H 5IWAL 2UUCQ 5LMNQ 2HIVA 5IP9G 1VQNT 2NVQH 2UXCQ 2IX0A 4TVRA 4BBRH 3FKIG 2YTVA 1XJVA 4NXML 4A4IA 3I4NH 5M3FH 1UE6A 3PUYA 1OXSC 4BBRG 1N33L 5GQOA 5J26A 2EXDA 5M5XH 2PQAB 4DV7Q 3SGIA 2ATWA 3G71T 3TRZA 3AFPA 5LL6S 5C0XG 1EIYB 1NY4A 1GM5A 1PH8A 5M3FG 2YTYA 1VQPA 4H02A 4KHPL 1XMOL 1CSPA 4PZ8A 3STBD 1PV4A 2LCLA 4GKJL 3CCRA 4DV2Q 4DR7L 4A3CH 3CPFA 1KRTA 1M1KC 2YV5A 3L7ZC 1QVFS 4B3MQ 4IFDG 2H5XA 1OXVA 3GTKH 1IXRA 2Q2TA 1VQDA 4JI4Q 2AKWB 1HZCA 1PHJA 3ICEA 3PO3H 4B3RL 1QVCA 4X66Q 2DGYA 4CRIA 1NPPA 4LF5L 4A3CG 3S24A 2L15A 1P16A 1YJ9A 2NVXH 2OTJT 2QA4T 1HZAA 4YCVA 2VQFQ 4A3FH 2LSSA 4JI7L 4JI2L 3IRBA 4LF9Q 1LTLA 1HJPA 1VQFA 5AJ3L 3PCOB 3ER0A 2BA0A 1K0RA 3S1QH 4OO1G 1SSFA 3T1YQ 4WJ4A 1D8LA 4B3TQ 4C3HH 2WB1E 3K0XA 4QL5A 3S16H 1GD7A 2PI2E 1Q7YC 4A3DH 4K0KQ 3CXCS 1Y1VH 4RG2A 1EOVA 2F3IA 1WI5A 3FHWA 2BA1A 2KVQG 4BY7H 2R93H 1TXYA 2JNGA 4AYBE 2ZM6L 4JI6L 2IY5B 2OTLA 3W5OA 4GS3A 3ZJYC 2ZTEA
chains in the Genus database with same CATH superfamily
2N88A 1TUCA 2DJGC 1WJRA 3VKIA 2F0DA 1SSHA 4KUDK 3G4SQ 1JWUD 4LN2A 1EQRA 1HCZA 1K73R 2COZA 2RJFA 4EMHA 1NEBA 4M75A 1NUCA 1HQMC 4DNTB 5FO9B 4IOCA 4M7DA 1WCMH 3VYHB 2ABLA 3G4SA 2MWPA 3L2PA 3OYKA 3SWNC 4JG2A 3HRUA 1PH1A 3NHHA 1ASYA 1BXTA 1WCMG 3BZDB 5J3BA 5GANj 2PCFB 1STHA 2Q2HA 5EAYA 1UGPB 1D3BA 2HHHL 4NB3A 1BU1A 1SYGA 1JB3A 4POGA 1PXUA 1P8LA 4OX9L 4XU2A 1PD0A 1PRTD 2E3HA 1TVXA 1M90U 3VYSA 2CS7A 2COYA 4D6WA 2V1CC 3I91A 4KLKA 2YLBA 2KENA 2F3WA 1Y8NB 1TR5A 3O13A 4JZ3A 3EA6A 3PO2H 3EG9B 2EYYA 1BNZA 5COYA 4PK4A 2ESWA 2XK0A 2JA5G 1TQOA 3UDIA 1I5OB 1KTKA 2MHVA 4DR3L 1FJGQ 3GTMH 3PO2G 3KBXA 1SYDA 2C0OA 5EPKA 3S17B 1S72Q 1Y07A 4C8QD 1YCSB 2EYXA 2O9SA 2B2TA 2EDGA 2O4XB 2FXQA 4R4QA 4QY7A 2SEMA 5KYYA 3I56A 5DNFA 5IY0A 4LD9K 4FM4B 2IW3A 5D6YA 1TS3A 1A15A 4CJ1B 2IX3A 3K57A 1NZ9A 2UXCL 4HSVA 1SAPA 2ES2A 1ET9A 2LJ0A 2P4TA 5ELEA 3WOEA 4JBKA 4N4IA 3L0OA 1PMRA 2E5LQ 1W6KA 1YJNT 1VMPA 1MUZA 3JRZA 5C0MA 4OIJA 1EWIA 3UDFA 1W2BS 4A3IH 2LT4A 2CQOA 4ZN1A 4DV7L 3NPFA 4E7HA 1VQIA 4DUYQ 1D2BA 4GLXA 2A6HC 1GUWA 3CD6A 4OB2B 3OS5A 4KGVB 2VASA 1C4QA 3OSOA 3OS2A 1WTVA 1H9MA 5CR2A 3IQLA 3TSZA 5GANe 4AFZC 3K7AH 4ZAIA 1J5EQ 1QUQB 3KJPA 3KJOA 4ELZC 2V8JA 4CKEA 4X66L 3CCEQ 5IAYA 5EJWA 4EDUA 3G7LA 2I5LX 2J4XA 3CCLQ 3H94A 2L3SA 3J7A5 3NQIA 3RUZA 2A68D 1QCOA 3CCST 1BI2A 2RK1A 2JTMA 5DM73 2IIMA 2O2OA 3CCEA 2BIVA 2JN0A 3CC7A 2ZZDA 1H9JA 2FRYA 1I3QB 3CCLA 2D5DA 4AQYQ 4QUFA 2E4HA 2LXKA 4A4FA 2KAFA 2XRQD 5IGDA 4KJNA 2Y90A 4DV3Q 4IALA 2NLUA 2DIQA 2F2XA 2KXCA 3KXTA 4C92A 2RF0A 5GAN6 1WHGA 2EW3A 2VXWA 1ESFA 1H9KA 1NYFA 1LT3D 1CSQA 4KKTA 5AT1B 1EEID 2KECA 3QOJA 2KE9A 1WVLA 4IUVA 1O80A 2VS1A 1WTQA 1CT1D 3EBEA 4M78B 1XQHA 3H3VI 2KBTA 1VQHA 2IPKD 1PYSB 2NZHA 2EPBA 4P72A 3REAB 2EOTA 1SF9A 2CUDA 1LLRD 3DWPA 5IYBH 4U673 3J7AF 1G8ZD 4GOPC 3H6MA 5LJ5f 5GAN7 5KYWB 2RPNA 3F1ZA 2IPOB 1ENFA 1B3QA 1H3ZA 1PFMA 4C5IA 1PH3A 4DGZA 5IYBG 1BYMA 1TG0A 4QF4A 4N0AA 1I0CA 2ZTCA 1KQ2A 2QQBA 1AWWA 1A62A 1BDOA 2DXBA 1O7IA 3BZKA 3OTOL 3OSVA 1LTGD 2EQKA 2R7ZG 1DJRD 1E2WA 2ZPFB 4X1VA 4R8IA 1SNCA 4C0DC 4XXEA 2BE5D 5LMNW 5LJ3h 1B3AA 4WTOB 1DZ1A 1RCVD 4PJOE 4ZKBB 4YCWA 1XXGA 1EZ8A 2DNCA 1STAA 2VV5A 4C8QB 3I55T 1E6GA 3DM3A 2RHQB 5DLQE 1F1BB 2HAXA 3V96A 5M5WB 1I50B 2Q2UA 3GTPB 3BZCA 1QJOA 2GFAA 2XICA 2IHFA 3JCMh 1HA6A 2X3XD 1GUOA 1QW1A 4DA4A 1CM9A 1FNVA 1YHBA 2WAQG 4R4IA 4JI3Q 4IFDI 1R9TB 1Y96B 2IVWA 2CZ0B 3FLGA 3R8BA 5JVH3 2NUTA 4JOIC 3H15A 2IX1A 2OX7A 4D8KA 5IGEA 3VS3A 5D7UA 1VQ9Q 3QSUA 1I4XA 2FMCA 5M3MH 3X26B 1EU4A 3K5MA 1FJGL 2NUPA 2VB2X 3GTJH 5C3WA 1GJXA 3RERA 3JB9J 4VUBA 1GXIE 2ZPHB 2QEXT 3HOYB 4HJ9A 2FO0A 5CKBA 1PG5B 5M3MG 3M7NA 2PUKB 3GPLA 2I0NA 4A75A 2F0QA 2YUNA 3QPHA 2XSCA 1SFOB 4HMIA 2ROTA 1D1CA 1KHIA 4EGVA 1MI2A 3JAMc 3J81i 4P5NA 2R7FA 2K2MA 3UPUA 1N27A 4UY8C 3EGXA 4X6AH 2KRNA 4DOWA 1GFDA 1B70B 1VQOQ 1CUKA 2CW0C 4O1NA 3ULRB 3WDNA 1R0CB 4ZGDB 2R5MA 2EIFA 2IT1A 3J7AV 4A3BH 3G6EA 3TBIB 5CORA 2DJQA 4M8AA 3CPWS 3E9IA 4DR2Q 1PVOA 5FU6B 3HOXH 3CU7A 3CCQA 1IRXA 1JB0E 4DUYL 4JI0Q 1OX8A 4A3BG 2PQEA 2EJFC 1VQOA 4K14A 1KLGD 2A1AA 1KLUD 4LWCA 1BKBA 1X43A 1BUVT 1JICA 2L0AA 3HOXG 1PH2A 1XTDA 3QHSA 3MHBA 1VCIA 5GAMg 3RDVA 1UUEA 3FDRA 4DBQA 1J5EL 2K32A 1OULA 2DY7A 3L42A 2K57A 2DEUA 2MK5A 4JRPA 2JJQA 1PKTA 2MQHA 4GN5A 4M77A 1M5Q1 2H4OA 3SE0A 2A0FB 4ZGEB 2QGGA 3N5BB 4BUGA 4H7BA 4XIGS 5C5MA 4EQOA 2IL8A 3KBGA 3ONAB 1N9WA 2DJFC 3VUZA 1SKUB 2MYSA 2VC8A 5KYXA 3A56A 2HBPA 2CUBA 3CAMA 3M0UA 3ULLA 2NVXB 4PJJA 2C35B 4DKAC 3GQBA 2Y4XA 3REBB 2KXDA 1JE5A 4J7IA 2A37A 3M0TA 3S1QB 2ENMA 3VYRA 4DK0A 1HNXQ 2R57A 4JI4L 2LCSA 2K5FA 2RJEA 4DV3L 4M78C 3MKDA 2K6DA 4M7AE 4HN7A 4A3DB 5CV5A 1Y1VB 1GHKA 2CREA 2KGTA 3V8JA 2EKHA 2PVGB 1YHQT 4RTUA 4BE0A 1NCVA 4OMMA 1MNDA 1D0YA 4UDUC 3I56T 1DOKA 2F4VQ 2F2WA 1QP3A 3JCMc 4CDEC 1B53A 3K8AA 2F0UA 1FL0A 2A69D 2EJGA 4KJOA 3O5ZA 5HY6A 4M7AF 2NB0A 4ZYSA 3OHXC 1PTOD 1YHAA 4R4TA 4H0LC 4AFQC 1BIBA 5A0GA 2F0PA 3TCJA 1PM3A 1U3OA 2RH2A 1KQ1A 3IFTA 2EYJA 1PFBA 1AWJA 1M1KR 5NUCA 3VDYA 4AG1C 2WV6D 5H1SE 2CH4W 4Y7NB 1IL2A 1BCOA 2DY8A 5KYNA 4KI0A 2LX7A 4PZ6A 1ZBJA 2JW4A 1UE1A 2K28A 3CD6T 3S17H 2XKOC 1CSKA 4JJNK 4K2LA 2Z6KC 2UXDQ 4IPHA 1EYCA 1B34A 1D0ZA 5I6WA 1NAPA 1OOTA 3A8HB 4XTVA 4YWKA 3I4NG 1ABOA 1ILQA 4OXPA 3CF5A 4A4KA 2YU9B 3CBPA 3QIIA 1B50A 2QQSA 1JR0D 2V4DA 3PIP3 2RF4A 1SNQA 3M4YA 3PUWA 1QWYA 3N6RA 1I4PA 5CV4A 1XNIA 5GAMh 3MA2B 1V43A 3T1HL 2E5QA 1TT2A 2DERA 2WINB 2Z0SA 1AVZC 2FB7A 3SXHA 3MAQA 4JI3L 4LW1A 4LF7L 3VYUA 2DX1A 3CC7T 3PO3G 2HNIA 1Z9ZA 2EFIA 4HCSA 4CDFC 2E41A 4RHRA 5JAVA 2EAYA 4RUGA 4DNRB 2OT2A 1L0XB 3ERSX 1KJWA 2XDBA 1QP2A 2AT1B 3H0IA 4PFPA 1S5CD 3S1NB 1NNXA 3K59A 3E6ZX 4BA1I 3TS2A 3QKJA 3K0YA 1UGRB 3M3YB 2RO0A 1AD5A 1WXTA 1F9QA 1ZEQX 4MZMA 2RI2A 1I4GA 5GMKm 2BH8A 3NBIA 3SEBA 4APVA 5I9PA 3IFDA 4DV1L 4LF5Q 3G7ZA 1PZKD 3CC2Q 3E5SA 4CBVA 2D0QB 1JB7A 1GOZA 4JBMA 2F0JA 1A3VA 3GTGB 3HG9A 1ZQ1A 4A4EA 4OGQC 4ZNXA 4N4HA 1R8OB 3HOWB 4HIOA 1GRIA 1AZEA 1WFQA 4V190 4RKLA 2ALYB 1VYVA 4BY6B 1I3QH 4DR2L 3NK9A 1GVPA 2KYMA 4BBSB 2F1LA 4PG3A 3TREA 1EYAA 5JEAJ 1TWAB 1STBA 3A98A 1M8AA 2B2YC 4QT7A 1TY0A 3D6CA 1X75C 1KIXA 1T9HA 3TQYA 1NEGA 3HKZE 4GN3B 2HMAA 2IWHA 4ID6A 2CZ6B 5IT9E 3A74A 2ZM6Q 1O7ZA 2DN8A 5FLXE 4QQ6A 2SOBA 2RA2A 4DBRA 1CZWA 4R55A 1A0IA 1Q81R 2ZXRA 3MHXA 3RMHA 1XPUA 4PJMA 2J7ZA 1P92A 3H0GB 3BDLA 3CCUQ 1VA7A 3KFUA 1C0MA 3FEOA 3AHUA 2KCTA 4EPCA 3QB3A 4M78G 4J9HA 2EVBA 3OS0A 1HNWQ 3RNUA 2CT3A 3NWTA 1K9MC 2A8VA 1K76A 3PTAA 2RQRA 3GTLH 1M8MA 2F1MA 3MP1A 2EYZA 3L2VA 1UHCA 3CCUA 1BBUA 4OB3B 1KDCA 2KHIA 1JCKB 4FF3A 1LT6D 3L9AX 1IBMQ 3C1EA 2O88A 1HNXL 4JYAQ 1Q81C 2LP5A 2VQEQ 1W4SA 5HGQA 3GV3A 1MKHA 1W6XA 1X01A 3LLRA 1VQ4T 3EQLC 4XQQA 3GLXA 3NBHA 4C0ZA 2C0TA 3QWYA 5DY9A 3KLRA 3S3OA 5I22A 1YIJT 4OMLA 1QCFA 3OW7A 4FNFA 1V1PA 5IT9L 1VQ8T 5M5WH 2JJ9A 4R56A 1E24A 2FVUA 2JS2A 4B08A 2F4VL 1WHJA 1M1FA 1I50H 1ASZA 3GTPH 5FLXL 4FCYA 3E3XA 2D9TA 5A35A 4IUTA 3EN2A 1EYDA 1M2VA 1CA6A 2M0YA 1QZGA 2JEAI 1RTOA 3AMUA 1R9TH 1VS0A 4R9WA 3BY7A 1VQKT 4N8FA 4A3GG 3BVZA 2DK3A 3TP5A 5IH2A 3I72A 3VS2A 1SSOA 2E5KA 1S5BD 4NXNQ 2UUAQ 3CCQT 2DRMA 1YEZA 1TWHH 3GV6A 1S4ZA 5IHKA 3M85A 3HOYH 4A3EG 2G6FX 1VQ6T 1VQBA 1EFWA 2JM8A 4FSSA 3PGZA 3H0FA 2UXDL 5IP9H 2M1HA 2DO3A 4IUUA 1RABB 1RDPD 1EFID 1SFOH 2WKDA 4KKSA 2A7YA 4KULA 3HOYG 5A0DA 2DVJA 1SNMA 1XOVA 5IP9G 3MXNA 1UDLA 4TVRA 2X4YA 4FSXA 2LX9A 1ML0D 1QCBD 4A4IA 2KRMA 2RBMA 1GXDC 1JQQA 5FW9A 5AYFA 3M57A 1KHCA 1F9RA 1FMWA 4NS5A 2KSSA 3MCAB 2PQAB 3EFRA 4KRTA 3DXJC 5LL6S 1QMCA 2JM9A 2K79A 3EG9A 4AFSC 4FO2A 1EIYB 5FRMA 1NLPC 1WYXA 4M7AB 1FNUA 2MF2A 1EY9A 1RAFB 2E12A 2MJ8A 1GCPA 5IHIA 3NMZC 1JQYD 2M9VA 3OA6A 4DV2Q 2CSQA 1KRTA 4Y92A 4A4HA 1T5EA 2QDBA 3L7ZC 1KD1R 2H5XA 4B3MQ 1A2TA 1JE4A 1OXVA 3MFGA 2L1BA 4DBFA 1PLFA 1FR3A 5FU7B 1WTXA 2O4XA 5E4XA 3C95A 2DGYA 4LF5L 1NPPA 1VMCA 2JA5B 2DL8A 4JJDA 2HCCA 2L12A 1ZSZA 1D6EC 1P16A 4GLMA 1VOMA 2NVXH 1KNEA 5G3LD 3TMEA 1U1SA 4A54A 2QA4T 1F2MA 1HZAA 2KCCA 4OO1H 4JI7L 1SYBA 3FRNA 3IRBA 3EG3A 1RODA 1VQFA 3QWXX 2LTOA 4PJOC 4HVWA 3ER0A 4F7UA 1F2LA 1D1KA 5KYIA 3UDCA 4N9PA 1TKWB 1D8LA 3S1QH 4OO1G 2WB1E 1NR2A 1OO9B 5K5PA 3TU4K 1MGSA 3EHQA 4RKUE 1GL5A 4J9EA 4A3DH 1Y1VH 4RG2A 2R5AA 4AT1B 2ROLA 2KVQG 4BY7H 4MMKA 3RR6A 1EIGA 2JNGA 2ENBA 4X3UA 2ZM6L 1CKAA 5KNBA 1AZGB 3W5OA 3SVMA 4A3DG 1MBYA 4Q0FA 3EG2A 1LT4D 4KUIA 4BY7G 2RQVA 1WFWA 1KIKA 5ELDA 4JI8Q 3DMUA 2EYHA 4IUNA 4UPAA 2FZKB 3Q1JA 2F0LA 3DUZA 4MZ9A 2D1XA 4IIMA 1QWFA 1IXDA 2HQLA 4P2CB 2YYZA 2EYQA 1XMQQ 4EQ5A 2AHOB 3PVQA 2A6HD 1U4RA 2JA9A 4YY3L 4Y7NH 1VIEA 4RCOA 2DETA 1QKXA 5LJ3d 1OU8A 4MNOA 2NZOA 3D4DA 2QYZA 4XU3A 1ABQA 1IBML 2HT1A 4JYAL 1YJNQ 4FXGC 4C0GA 1V1QA 1IGQA 3UE0A 1V29B 2B2VC 4DV0Q 5J22A 3JV3A 2YU9H 2LNHB 1Q95G 3BDUA 3HKSA 1X54A 3JCMd 1NJIU 2R7DA 5GAOq 2OF1A 1OTCA 1IHZA 1CK1A 3AQQA 1ICWA 4FIBA 2PNIA 1N6AA 1K8AU 4BY1B 2BCOA 3EIVA 1JC7A 3DLLA 3VRZA 2K14A 1HR0Q 4BD3A 3PUVA 4NXNL 3EH2A 3CCSQ 2UUAL 1B7YB 2R58A 2CKKA 3S1NH 3KLSA 3UATA 4FF1A 3QDRB 4LE9A 2L4NA 3LGFA 4PFZA 4BDZA 5CQYA 4QQBX 1K8OA 2VY3A 5KYUB 2HL3A 2KNBB 1QILA 1DONA 3CCSA 1X6OA 3KUPA 2K5IA 1OZ3A 1N8RR 3BVGA 3OYCA 3MFYA 4MZTA 4WORA 2DL5A 2FEIA 4DR1Q 1A6XA 1I6HB 5FWBA 1WQ7A 4C8QA 4OIKA 3HOWH 4RKBA 2R7ZB 2QASA 5ELNA 5IE8A 5CKEA 2LJ3A 2RKSA 1YBYA 2OEOA 4BBSH 2VUMH 2CZ7B 3I4MB 1TWAH 3HOWG 1GCQC 2G3RA 2PQWA 2JTEA 3OBWA 3PNWC 4L59A 4HCCA 1R4QB 5EG2A 5JEAH 3TDQA 1Y96A 3EFOB 4E7LA 5FU7C 2AWNA 3MXUA 1Y14B 2AHJB 3RKXA 1N8RC 2Y4YA 2N8NA 3H09A 4L5TA 2VUMG 4BBSG 4DV2L 1PYBA 3OYLA 5JEAG 5GADC 4B3ML 1ZX6A 4BXXH 3D4WA 3P8DA 2V26A 3QXEB 3NFCA 4OGCA 5BN4A 2DA9A 2M0OA 3VS5A 3DB4A 1UTIA 1VQPQ 4PJOG 2JK8A 3H0GH 4DK3C 1IKMA 5IYCH 3LGLA 1STNA 4A76A 4BXXG 2N3SA 1RKNA 2J0TD 9ATCB 2E74C 2DAQA 1QNKA 2B2WC 2SNSA 1UECA 3H0GG 4KHZA 3EAEA 4GY5A 1TUDA 5IYCG 3I55Q 2A5HA 4M78F 1YNZA 2A28A 1ENCA 1Q12A 4CHTB 4JZ4A 5JJZA 3G48A 3EJIA 3WWVA 2LVMA 1KQSA 3I5RA 1E1OA 1SYEA 2F03A 1L2FA 4C56C 2K5DA 4IPGA 3S2DB 3I55A 4LD6A 3JCMQ 3CMAT 4HJ5A 3T56B 1VQEA 2VXEA 3FEWX 4I65A 1K3RA 1HZ9A 1A8VA 1SXTA 1TWFB 2UUBQ 5CAIA 3KDFB 1WLPB 3VA5A 2GF7A 3MEWA 3NTKA 1OZ2A 2R61A 2CW0D 2BOSA 3OOCA 1Q86C 1L0YB 5CVIA 4JI8L 1M4ZA 1JO8A 2NYZD 1B44D 4FP5D 1KG1A 4WF2A 2LDMA 1VIFA 1UG1A 1BI3A 1Q86U 4MIUA 4C2MB 2OXPA 4YHHQ 3M59A 4G7HC 2CHBD 3UDGA 4LUEA 1K3BC 2OQKA 2QEXA 1STEA 1XMQL 1IYVA 1IKLA 1M30A 1BBZA 3NSWA 1G3SA 3LWUA 1TXQA 1SMYC 2Z6BA 4KTAA 1RL2A 2NVYB 1B7TA 5LJ3j 3SK5A 4LF4L 2YRDA 1Q7YU 1RF2D 2BKDN 1X32A 2B8GA 2L89A 3RKWA 1N33Q 2XI9A 3E1SA 5E4WC 2GA4B 4DV0L 2J6FA 1R4PB 3S3NA 2KROA 4PNYA 4F7XA 1Y69U 3ND8A 1ZBXA 2MWOA 5GAMd 2NWGA 1XMOQ 2F69A 2DJZA 4QGUA 5I11A 3PUXA 2CZ1B 5LJ5h 2KT8A 3W3AA 2HEQA 1IBLL 2D6FA 1KRSA 5CBEE 4J1MA 1JJGA 3V7CA 5CV7A 3JB9F 2CP7A 4RFBA 2D2CC 3A8GB 2B39A 3T13A 3FIFA 3KF8B 3PUZA 1G51A 2P84A 3ZL7C 3GTQB 4CC7A 3HGBA 3VR4A 2WB1B 1T3LA 1IHWA 4DAYA 1HR0L 3BW1A 4M78D 1H3HA 2E2IB 1K73C 1EUJA 1NG2A 1U9RA 2DLPA 3JAML 2RHSB 2EWNA 3HFOA 2KI7A 3A7AB 4KD4A 2COWA 4M7AG 1SYCA 5CCAA 4TKOB 4E7KA 5A0LA 1HTPA 4C0DB 1SMXA 4DXGA 1WD1A 3PV0A 5E1FA 1SRMA 1U4MA 3S15B 3FKIB 2JA5H 1HNZL 1Z7TA 4LXCA 1KQSP 2RDGA 4OO1I 4DR1L 2QGQA 2BE7D 3ASKA 3CC4T 3TSWA 3MZ5A 1YHQQ 3DHQA 3SHWA 1Z6HA 4R8NA 3I56Q 2FRWA 2N78A 3I4NB 1EZZB 3U9SA 3EG0A 5GAOr 3BS1A 4DR6L 4DXFA 1UEBA 5M5XB 4A63B 1TUGB 2ECZA 3JCMP 1YHQA 5KGUA 1ENAA 4J8QA 1OX9A 2V1RA 5LJ3e 4GKKQ 3QDFA 3MXGA 1PRLC 1M3CA 2X3WD 1TY2A 4QIWB 2RHIA 4DEYA 2W10A 2L5TA 3JSCA 4F17A 2DL4A 1Q8KA 3CD6Q 1AE3A 2XGTA 2DTOA 1S5ED 4FXKC 1WOCA 2NTSA 1PZJD 3PO3B 5IYDH 5GAGC 1KC8R 3BDCA 5C5LA 2HKNA 3J7YW 3JCMe 4IUQA 2EXZA 2QG9B 1GUNA 4HKEA 4H13C 3JB9D 1S5DD 5IYDG 2K6AA 3MP8A 3RBBB 2AZSA 4Y52H 2OAUA 4RGMA 2PI2A 2BUDA 3OIPA 4EIKA 5GMKh 4M75E 2K2VA 4O5VA 4LFBQ 4P74A 2CP3A 4M7DE 1CQFA 2O5IC 2SRCA 4FF2A 3I3CA 4LNPA 2L8DA 1KC8C 4RCNA 4X3SA 3CC7Q 1IREB 2R93B 1A3UA 4DK6C 4G57A 1M9SA 2UUBL 1GUSA 4C5EA 4F88A 2MCNA 2KCNA 4E2FB 2DPPB 2MMPA 5CQXA 2ICIA 3EGDA 5GAOm 3BU2A 5IODA 4LF9L 1OV3A 3L1AA 1K1ZA 2K04A 5GAEC 2YWWA 1CA5A 2R92B 4BY1H 2FHTA 2NZ1D 1IYUA 1I1JA 2YSQA 4YHHL 1BI0A 1YNND 5J1ZA 2M51A 1VDZA 4HCEA 4K0KL 3AYHB 2FMMA 3PSIA 1JXMA 4BE2A 4BY1G 3MJXA 4GLKA 1KSWA 4HT9A 1RLQC 2HQXA 5F2DA 4BWGB 2HZYA 1J9OA 1RACB 4RCCA 3OYFA 1OYXA 1KQSS 2ZXPA 1LOJA 4GNXC 4BI8B 1UGSB 1HQRD 3M5AA 2EQSA 5LL6X 3S2HB 3HKZG 5GANg 1LUZA 1BI1A 1MHNA 3K7UC 5CYUA 3WOFA 3R2TA 3RMSA 3S3MA 4GOPB 1WXUA 1FMKA 3T16A 2Y0SE 1I6HH 1MMAA 1NPRA 1YNJC 4NP5A 2K05A 2R7ZH 3GTLB 4C1NI 4NXMQ 1GKHA 4GKKL 1G3YA 3URGA 4E7ZA 2E2JB 3I4MH 1HPCA 4RAUC 1IB8A 3OPOA 5GJVB 4HJAA 4II1A 3QO3A 5FRNA 3A1PA 1UGVA 1WGSA 4JS4A 5K36H 4KY6A 4K5WA 3VS1A 1YITT 1WI7A 1YWPA 1GUTA 3W2DA 5CIUA 3I4MG 4FXDA 2EYFA 3NELA 4K6DA 5ELOA 1V8QA 4FT4A 4GKJQ 5KE2A 2BH2A 5K36G 4DR7Q 3RLFA 3JCMb 2F0HA 4DV5Q 1C48A 2L3PA 2RQUA 3UT1A 1LTBD 4PLLA 2ZJQA 3T9NA 2NVTB 4JCVE 4A3GB 1IO6A 4IURA 2F0KA 4KN7C 1CI3M 1AH9A 3LWEA 1O9SA 1MV3A 4PJOF 3CP0A 1DCZA 1Q3LA 4A3EB 1VQ8Q 2YUOA 2I07B 5GMKi 3PIO3 2Z8LA 2BZ8A 4PL6A 1VQ4A 2ICEC 1TWHB 4ZGJB 4EMKA 1Z47A 2RD1A 2DL3A 1HSQA 1YIJA 1RIPA 3CEYA 2J7IA 5FROA 3S2DH 5GAOp 5J39A 3OYAA 1VQ8A 3V7SA 3M0RA 1AW7A 4FW1A 3CMET 2LC4A 1VQKQ 2JTFA 3G6EQ 1WTHA 3H0HA 1V1OA 2HBWA 2PW5A 4P75A 4DAMA 3J81c 1IW7C 4FL6A 1X9NA 1I94Q 1TWFH 1L1OC 4HTHA 4RGNA 3LNNA 2DXUA 3CCQQ 2BDNA 1T0HA 3KF6A 2E5LL 3VU3C 1VQKA 4C92E 1A2UA 5GAMe 1I4K1 4HSPA 4UC4A 2YUQA 3I35A 4XTCS 4EQNA 4C2MH 2L11A 5A2QE 3M4PA 4OONA 3M4QA 4C3IG 3MEAA 1VQ5T 4XTXA 2K5HA 3CW2C 1VQ6A 5HKCA 1FYCA 2AQ3B 3OQ5A 1JJ2A 1O7YA 1EQQA 2NVYH 4TRDA 4YWMA 1HHVA 1F2ZA 4LFBL 2XDPA 1G5VA 4C92F 2DD4A 4UP8A 4J6WA 3FJPA 3CRKC 2PW7A 4XQ3A 4IKFA 3DM1A 1G2BA 1D5ZC 4L5GA 4FU6A 4QQGA 1SROA 5CO7A 5GAN4 3SDZA 1I5LA 5HGTA 4XQNA 2YTXA 1NBWA 3QYHB 1U1TA 3ULJA 3THKA 1PH5A 1M8VA 2A6EC 1LACA 3F2UA 4A93B 3JC66 1BBWA 2GVAA 3LH0A 3OW2A 2JEBI 4LF8Q 1NYGA 3Q0AA 1X6BA 4AQYL 3GTQH 3FRPB 4PJOD 2RA4A 1SNDA 4PZ7A 3RD4A 1YNXA 4BI4A 5A2QL 3AT1B 2HSEB 2RSNA 4LMQD 4OMPA 2E2IH 5EQ0A 3I70A 4DNIA 1SRUA 5CR3A 4J9BA 2L5QA 2QA4Q 3KYHC 5FO8B 2HSPA 3OYMA 1TS4A 2CWAA 4BY7B 2WB1G 1SN8A 2CP0A 3HRTA 1NE8A 2VVKA 2L0CA 3DWQA 3LWIA 4S3SA 3EHRA 1CKOA 1N36Q 3MO8A 1WNLA 2DL7A 2F0SA 2M2LA 5FKAC 1DD2A 1VF7A 5FWCA 2B2UC 2QA4A 3S15H 3FKIH 1XX8A 4CKBA 2W0ZA 3M4GA 2UUCQ 2DM1A 5LMNQ 2HIVA 2BTTA 1VQNT 2PNRC 2NVQH 3TQ7P 5EKKA 2A08A 4L8JA 2GQVA 1EU3A 2E10A 2YTVA 3FKIG 4E6RA 2KY9A 3FPPA 5IOCA 1XJVA 4NXML 4XU0A 2DVEA 4V0BA 2E6NA 1K4US 3I4NH 2ZPGB 4HCZA 1MD2D 1OXSC 5GQOA 5J26A 2ATWA 5M5XH 3TRZA 5C6SA 4FVMA 1EL0A 3OYGA 3BVMA 2G9DA 2YTYA 2PTKA 1QCNA 3V8KA 3VS6A 4GKJL 1N9SA 2IJ0A 3LX0A 1WTRA 2GGRA 8AT1B 2TSSA 4DR7L 3SWNA 3CPFA 3NHNA 1M1KC 4PQXA 4A3CH 2GNCA 1IXRA 1JJ2P 3GOXA 1H92A 3ICEA 1D3BB 4Z88A 3PO3H 1OEBA 1EY0A 1FX7A 5CMDA 2RHYA 4A3CG 3S24A 4C1NK 4NDXA 1V1CA 4RH6A 1EEFD 1G8XA 4CC3A 2DIGA 2EQUA 2OTJT 4M77E 2FG0A 1E0BA 4MMLA 2JSOA 5T1GA 2VQFQ 5DAUA 5EBCA 1QG7A 1SPKA 3ZFJA 1DJ7B 4R0KA 2C06A 1LTLA 1OPLA 1LTSD 2RDFA 3PCOB 4PJLA 1XYIA 4B3TQ 4Z89A 2MPMA 3S16H 4L5RC 2WSFE 3QZ9B 4Z02A 2QAZA 3OW2P 1GD7A 3PQIA 4QMGA 1KDAA 3EFOA 3FHWA 4M77F 1HA5A 2R93H 4IN3A 5KNCA 4AYBE 1SE3A 2EYLA 5ISRA 3ZJYC 2Y0SB 2R93G 5KYYB 1BCPF 3EROA 2EJ9A 3CCRT 4M7AD 3MEVA 2R92H 1LVKA 4FYYB 4OMFB 4G7ZC 1II3A 1D7QA 1JWMD 1I4QA 2VUMB 5GANf 4JI0L 1EZ6A 3OYEA 2E1HA 3H6ZA 2R92G 1Q8IA 4OMQA 2XIWA 3D0FA 5L37A 3PFSA 1SEBD 1FGUA 3K5OA 4DV4Q 4Y91A 4PJOB 4XU1A 1CKNB 4J6XA 1KL9A 4PFOA 2EKOA 2PZUA 2MNAA 4C3JH 3S2HH 5LJ5d 5IGFA 4A3JB 1E22A 1UGQB 1PKSA 3OYJA 1WJSA 3UA6A 4KK7A 5D3IB 3STBC 4OWXB 4WCIA 3VS4A 2K9GA 3J80E 5DLOA 3X3NA 4C3JG 1HFNA 3CQZB 1FXXA 2RN8A 2X4XA 2IG0A 2NN6H 3DKMA 1Q1EA 2HIXA 4LF8L 1JJCB 1MMDA 2RHXA 2K03A 3E0EA 1SE8A 2F0TA 1W6JA 2E2JH 3PIPA 3SK8A 1K9MU 2NN6G 4XYQA 3K80C 1K8GA 3MEHA 5LMUQ 1R0BG 2HDMA 1UWVA 2O2LD 1G291 4FW2A 3BDOA 4CJ0B 2RM4A 2BZYA 1Q81U 5E7NA 1V76A 2MI6A 2LMJA 2I5MX 3FMCA 3MVVA 1RAEB 1UJ0A 2QXFA 1SJHD 1Y1WB 2FPDA 1N36L 2LY7A 1S3OA 2MO0A 3C2PA 4FYVB 2DZCA 1RTNA 2PMZE 5GROA 5KH6A 6AT1B 4ZCKA 1Q82R 2JZ2A 1JWSD 2NVTH 4KY7A 4C92B 4A3GH 1RADB 3E19A 3D7SB 2UUCL 4M75C 3KLSX 4E47A 3CMAQ 3A8JE 5LHY1 2CH4A 1ZYRC 4PMCA 3J80L 4M7DC 3RZDB 2EY2A 1BIAA 4J8OA 4K5VA 4BI3A 2QEJC 4O0AA 4NPSA 4A3EH 3OW2S 1J6QA 1YJWT 2O9VA 3X25B 1SMYD 2KDSA 3CMAA 4A53A 1SR3A 1X3FA 1D09B 3KF8A 3JB9H 2ED0A 1VQ9T 4X64Q 2CP2A 2MGSA 2RB6A 4BB7A 1K0SA 1LABA 4R4CA 2RJCA 4QB4A 3V8LA 2K5VA 3M9BA 4IO9A 5M5YB 2QKIC 4J6HA 1T0JA 3JB9G 2AZVA 1L0WA 4PKCC 4LDXA 1FMVA 1A63A 4R1JA 1IBKQ 3SHLA 2X69A 4HR7B 3KOJA 3BYTB 2LNVA 4XTYA 1PH9A 2D62A 3WVEB 3GIBA 3C12A 4X3TA 4A3MG 2XIDA 4ZQ3A 5CGKA 4ZUJA 2K5WA 1NM7A 2FHDA 4N4GA 4OB0B 2LFNA 2VQFL 4OMOA 4ZKCB 2YLCA 2AUKA 1NSNS 1DXMA 2ZPEB 2KT1A 1PDQA 4R4OA 3QJYA 2RCFA 4RGOS 1W1FA 1HR0W 2GFUA 4B3TL 2P0QA 2B2TC 2NUTB 1I4RA 1LNXA 1QWEA 4Q5WA 2DTIA 2NUPB 4JOIA 4TSSA 2DMOA 1F9PA 3I7FA 2M16A 4ZK9B 4HIKA 2HCIA 2RK2A 1TS2A 2AKKA 3EFXD 4A93H 1E6HA 3Q24A 3E9FA 3CCVT 3F2CA 2DUDA 2IHEA 1KD1C 5D65A 1STYA 4LUVA 5IWAQ 2F2VA 3EGXB 4A93G 1B07A 1NLOC 2F0FA 4WRDA 2ZT9C 3IL8A 2EE1A 1QZHA 4J9DA 1KD1U 4LFCQ 2V8KA 1KAWA 3CC4Q 4NMZA 5KCHA 1SE4A 4DV4L 1G6PA 3P8HA 1C6VX 3CQTA 5FK9C 2D9UA 2HL5C 5DM63 5LJ5j 4QUCA 1QUQA 4X65Q 4NL2A 1PH4A 2PU9B 2EJFA 2KEDA 3CC4A 1WTWA 3QJ6A 4Z8AA 4DR4Q 1HTLD 2FJ2A 1XNQQ 1ICFB 2XRSD 2JXBA 1WHHA 1HNWL 2MO1A 3LX7A 4NOYA 4QJFA 2AIRB 2Z4HA 2BE9B 4NL3A 2KBNA 4M77B 1H9RA 1PFNA 2DD5A 1JBMA 1K9AA 3CBOA 5CBAE 5JPNC 1RAGB 1RUWA 2XG8D 4RTZA 1SDFA 2VQEL 2WSEE 1G2TA 1BCPB 5LMUL 4QQDA 2GVBA 2A19A 2MP1A 1KABA 4OWTB 5C4HA 2F0OA 2AKLA 2JMCA 3NTIA 4M75G 4YTLA 4C92C 4IJLA 1AE2A 4ME7A 1ESRA 2Q2IA 4ZN3A 1NJIR 1F2YA 4AYBB 1PTOC 3GTOB 1BK2A 3C4SA 4MDWA 3HRZC 3OS1A 3EVQA 2PUOB 3RMQA 3SK4A 1YVCA 3HSBA 1B9NA 4DR5Q 1N34Q 4M78A 2KCMA 3UI2A 3HOZG 1CZGA 3RNJA 2Z9HA 3R6OA 4ZTJA 4BDYA 2AUJD 2ZPIB 1LYLA 3K58A 4DK1A 2O31A 4KT0E 4BBRB 4JLIA 5C0XJ 5KYWA 1Y57A 4N0AC 1S5FD 3BE3A 1E3PA 1TTHB 3MTSA 4A4GA 2JA8G 2DBKA 3HKZB 1VQMA 2DYBA 1G83A 1PV4A 1QVFP 4XK8E 1RD9D 1K28A 4X64L 4HCBA 3BFMA 3HP9A 5GMKl 4C5HA 1PCXA 2N49A 3TS0A 1PNJA 1PRMC 4F7UE 2F0IA 4RA8A 1ZKOA 2M02A 2P0PA 3TP7A 3UE1A 2RQTA 1IBKL 3QYGB 5LJ5e 1B34B 5DM7R 4G7OC 2B3GA 1T3SA 5C3EH 1YNJD 3GTKB 2Z6KA 4K8JA 3CBMA 2GBQA 1BO0A 1VQLT 4HJ8A 2G9HD 2RI5A 2F5KA 2Y0SG 4E7JA 1HYOA 5JJLA 3PMIA 5C3EG 2AK5A 4JUVA 1GBQA 4LK1C 4JW0A 2DBMA 2E6ZA 3RESA 1M3BA 1LTAD 1ZUUA 2OCEA 1Y7XA 1TS5A 2DFUA 2E8GA 4EVOA 2I0QA 3OMGA 4EMKC 1TIID 1MMGA 2X6GA 2V1QA 5GAN3 2A74C 5IT9c 1YI2T 1N8RU 2GTOA 4C3HB 4F8MA 1H9SB 3J81j 4V2SA 1GUGA 1HXYD 2PMZB 3Q6SA 4A3JH 5FLXc 1HRJA 3V05A 2K7AA 4XAXB 1EY8A 3C1FA 1ZA1B 3HP3A 1CHQD 4DR3Q 2NN6I 2SDFA 1O75A 1YITQ 3CQZH 3NTHA 4A3JG 1TOVA 5HK0A 2JUFA 2QCPX 3L3OC 4A3FB 2JVVA 2K4KA 5EBDA 3KLWA 1B9MA 2QW7A 3MWYW 1X56A 3MEUA 3U4ZA 4XYOA 4ME5A 3TN2A 4DU9A 3LGJA 3PVLA 3DEOA 3U58A 2VB6A 1YITA 3M4OB 1DOMA 2E70A 3FJ5A 4POFA 3VS7A 4LFCL 2H1EA 2HD3A 2K75A 3M0PA 1STGA 2QDLA 1CQVA 7AT1B 5GAN2 1X3PA 3B6YA 1IW7D 3AEVA 4X34A 1Y1WH 4QW2A 1D0XA 4N8X1 2ZJPA 4JJCA 3VRYA 4X65L 4M77C 2QEXQ 2VW9A 2K5LA 4CKCA 3CCJT 4CJ2C 4DR4L 4C3IB 2JMAA 1Y1WG 5L23A 5KEEA 1U5KA 1BF4A 1XNQL 1JOOA 2RNAA 3CMEQ 3GF5A 3RZDH 1BCPC 1LPLA 3TEEA 1TWCB 3RN5A 4E7IA 4C92G 1SE2A 2CT4A 2K1BA 1Z9FA 1IYJB 3J81E 3JAME 3ME9A 4EQPA 2VNUD 1MIUA 2HDLA 2X6LA 3CMEA 5GMKe 3JB9I 2XVSA 2GN5A 5I4DA 2PYKA 3NWSA 4C8QE 2WSCE 4OP0A 1VQCA 1UAPA 1PSEA 2NTTA 8ATCB 2ID0A 2KOLA 3CXCA 1VQ5Q 4KHPQ 5M5YH 3SD4A 3I8ZA 2DZ9A 2EQIA 1HZBA 1C0AA 3SB2A 1YCYA 4GNXB 2EGEA 3QUIA 2QILA 3C94A 4AG2C 1SLJA 1E2VA 2QI2A 3NBHB 4DR5L 1N34L 2EJGC 4B3RQ 3EH1A 1WHLA 1VQ5A 2NUCA 5CK9A 3EG1A 1X2QA 1VQJA 1V1PB 4DPGA 3C0CA 1D1BA 1M27C 2YXYA 4X9DA 1XPRA 3LH5A 2QQ9A 4DOVA 2K52A 3I73A 2PZWA 1M2VB 1LO5D 2D0NA 1U8RA 5ELCA 3R93A 1AEYA 3J81L 1MGQA 4HCKA 3MPUB 4C5GA 4JBWA 4J9IA 1HUNA 1K73U 3M0QA 5D6WA 1RAHB 1M90R 3NPPA 5C4JB 2RHUA 4IPCA 3QG1A 1M1GA 2VUBA 1VQ7T 2DRKA 2VGNA 3M55A 4RG8A 4DQ2A 1ZHIA 1X65A 3A8OB 3HZXA 5DEHA 2F52A 1FYNA 2K3XA 5GJWB 1V9PA 4UP9A 2NVQB 1WHMA 2RHZA 1ONLA 2WFWA 4AH6A 1NTGA 5I9OA 2WP8J 2EYMA 1U06A 2EY6A 4L6V5 2Q8IB 3UF4A 2RSOA 1M90C 3HL8A 2NBFA 1NMGA 4CDCC 3SK6A 1G6ZA 3TZUA 2CKZB 2PNHA 1W70A 3MXNB 3GDEA 3C46A 4FDBA 4JV5Q 2X9HA 4FYXB 1H8KA 1VQNQ 1HXDA 2EPDA 3OMCA 2KQWA 1AHJB 3HEJA 2K5NA 3FB9A 4RCBA 3IAYA 2KJXA 3CPWA 2K4YA 4ANJA 2L9HA 3VUBA 3VR2A 1EQVA 2L3QA 1VQNA 3GNGA 3K5LA 3DLMA 4XDXA 5FJ8H 4P71A 3T51B 4KH1B 2D8JA 1SNPA 1L1OB 1PH6A 2JA7H 4OF1A 3PF5A 1QLYA 3SR1A 4TQUS 5I2YA 1R77A 3CXCP 5FJ8G 2ZTDA 1WHKA 3E9GA 1X6GA 3X20B 4DAPA 2J06A 4ILWA 1EIFA 3M54A 4WJ3M 1ZSZB 2A73B 3F2DA 1WTOA 1AFPA 4M77G 3I90A 1S72A 1E7ZA 2L3RA 2E2DC 4X62Q 3S16B 4A3LH 4NW2A 2JT4A 1VQMT 1CKBA 2E76C 2QGFB 2BDOA 3Q22A 4PMWA 1VQAA 1PWTA 2OTJQ 5D14A 1QQJA 4F7UB 4A3LG 3CKIB 1KC8U 1Q90A 1WXBA 3MP6A 5LJ3g 5C4XH 3GTOH 3LW5E 1D5MC 4PJOA 3T4AC 1CKNA 3DB3A 4M75F 2EYPA 1B2TA 3OYHA 1G91A 4M7DF 3BYYB 4GLVB 1D1AA 3EFSA 5CKHA 1Q46A 4AYBG 3D6WA 3CCMT 2OTJA 5C4XG 4A3IG 2B63B 2E2HB 3PE0A 1T5XD 2NWMA 2X4JA 4HXJA 3JCMg 4BBRH 3S1RB 1X27A 3OBYA 2F0MA 1RAIB 1RLPC 5C0XH 3HFNA 3A8LB 1U5SA 1UE6A 3I9QA 3CCRQ 2VKNA 4BBRG 1N33L 3L2RA 3U9OA 1I81A 3G71T 3M7GA 5C0XG 4C3JB 1PH8A 3A7LA 2LS01 2JA6B 5HK3A 1XMOL 4KHPL 3STBD 5C6AA 5GAMj 1OQKA 4Z9CB 3CCRA 3URYA 4L6TB 1X2KA 3JCMV 3GTKH 2Q2TA 1VQDA 4JI4Q 1HZCA 4IIOA 4B3RL 1QVCA 2B2VA 3CPWP 4KGXB 3S14B 1AP0A 1A0NB 2K7VA 2L15A 3ZEHA 1YP5A 1PC0A 2C0IA 2BZXA 4QVCA 2XDDA 1EY7A 2JA7B 3MXPA 3L2ZA 4MN3A 5KIXA 4LAAA 3LYIA 1HJPA 2XD0A 4NKLA 2YUPA 2BA0A 1K0RA 4WJ4A 3AB9A 4RTTA 3T1YQ 4C3HH 4QL5A 1PRTB 2PI2E 4K6LA 5CV9A 3L2QA 3CXCS 1EQTA 2EVRA 5I2MA 1EOVA 1LV9A 1TWGB 4DAVA 2BA1A 1VQ4Q 1O78A 5TSSA 4C3HG 4M75D 1ZYRD 4M7DD 4A3FH 1YIJQ 1VQPT 2DXCA 3RKYA 4RMOA 1LTRD 2F5TX 2C9OA 2HDAA 2MIOA 2RMOA 3H41A 4BACA 1UE5A 1W3SA 1VYUA 1NMFA 2CCZA 4K11A 4FF4A 2P4RA 4HJ7A 1EIHA 2F4IA 4JC0A 4DV6Q 3X24B 4J9FA 4JRIA 2KYBA 4A3FG 4J9GA 3M4OH 3HHTB 4JRKA 4B9XA 3A8MB 1TU0B 1JXOA 4JV5L 2PQAA 1Y71A 1ZUYA 2VWFA 1IZ6A 2OWOA 1SBBB 4M7AA 1PHTA 4PLIA 3ULPA 3SFMA 1YJ9T 1LJOA 2JE6I 2VZAA 3NEMA 3T1HQ 1IHVA 4GLAC 1YJWQ 1EY4A 2WKCA 4A3MB 2QDYB 4CC4B 2YRVA 2L2PA 4LF7Q 1QOHA 1GCQA 1VQ6Q 3S1MB 4C3IH 2UXBQ 2CP6A 2XTIA 1ZSZC 1UEAB 3J7ZC 3K5NA 1YJWA 1MHWC 2YHTA 5GANh 1TWCH 3VR6A 4OMNA 3GBQA 2Q8RE 1PH7A 4YCUA 3UDXA 2EY5A 2WACA 2QK0A 1A3TA 1VQ9A 4JLGA 1JT8A 2OTLT 1XNRQ 2QQAA 3HOVH 2RCNA 2CDTA 4JDSA 3JAMi 5EPLA 5C4ZA 4X62L 1C9OA 3ERQA 4DV1Q 3VV0A 3X3MA 1RHPA 1WPYA 1JRIA 1PTOF 1SJED 2FFKB 1UNSA 3M9QA 2B2WA 4J15A 3HPWA 2QTVA 5D3DA 3HOVG 4RHSA 1WX6A 1VF5C 5IN1A 2E3IA 1XJWB 3X28B 5IGBA 2NYSA 4IUPA 2SNMA 4RG1A 1SG5A 2KR3A 3NGPA 4QVDA 3G4ST 4HVUA 4DF7A 2FZGB 1BCMA 5CKFA 5I6YA 1AOJA 1LT5D 3OYNA 1C7YA 2ZGWA 3M53A 1QVGA 2DKGA 2DF6A 3D4RA 4KMUC 1MNEA 3A8IE 1Z9QA 4RMFA 1FD7D 1K83B 4ESRA 1X69A 3BJUA 1OXUA 5E3FA 3JCMJ 2GTJA 3HOUB 2B29A 3OTOQ 4QVZA 4XT3B 3PF4A 2MFIA 2XNAC 2PZTA 2XWBB 1Y8PB 1AZPA 5FOBB 2JN4A 2VL6A 4O2DA 3F8TA 3P1HA 2F0WA 5EGTA 5IIFA 4IJHA 2LCCA 3CCVQ 1N9RA 1SHGA 3D8GA 4BS9A 5C4JH 1VYTA 3I2ZA 3PIOA 2FPEA 4GN4B 4ABNA 2KHJA 4AFUC 1DGSA 4HEDA 3TSSA 4XTWA 2HD0A 3CCVA 2KUMA 2LXJA 2PO4A 3OWFA 1QNUA 1JORA 2FPFA 4LFAQ 2O01E 4A3KB 1LTTD 1LCKA 1UFFA 5FLMH 1H641 1M2OA 2E64A 4KH0B 2K3YA 4F87A 4M75B 1WYDA 1I6VC 1PYWD 3ITPA 4M7DB 3GP8A 1PRTC 3INZA 2N55A 3AU7A 3K6OA 5FLMG 1K8MA 3HS0C 4HAEA 3GNFB 2EGAA 4I7AA 2LQ8A 4C92D 1UE7A 1S72T 4QCLA 3TZDA 3T1YL 4G4KA 3HOZB 4JJBA 3I4OA 1UUPA 4F14A 2XHCA 3TEHB 4DAYB 4DV5L 2RQWA 5IP7H 5KCOA 3FC3A 3OWEB 1N32Q 3RN2A 1KAAA 4LF6Q 1Y8OB 5KYUA 1M1KU 2M9UA 4AIMA 2DXTA 4F16A 2JA8B 1WJQA 4J7FA 2OQ0A 2D8HA 5IP7G 3OSSC 5I21A 4C8QC 1B4OA 4RWSC 1YN8A 3D31A 1EX4A 3RR5A 5LJ3f 3VYTA 4ZLTF 1HD3A 3OYYA 4JI5Q 2HCKA 4DV6L 2LRQA 3PT9A 3G6JB 1HJDA 1MJEA 2NUZA 2K50A 4MHEA 2A3LA 2CSIA 4Q5VA 2E75C 1C1AA 5CV8A 1QVGP 4YWLA 5JJKA 1TU2B 1E7OA 2JQOA 1I94L 2K5QA 4J5YA 2AMCB 3SEMA 2KEAA 3JCMf 1HUMA 1HH2P 5I2SA 3VYGA 3E0JA 1WDXA 5GAOl 4LDUA 3D3RA 4EX5A 3CCET 4RGTA 1TSFA 4WJWA 5ELBA 1BVSA 4AMCA 1F77A 1MJCA 5C3EB 1Y0MA 2EGCA 4F7UG 1G3WA 1H9SA 3P7JA 3CCLT 2UXBL 3EGUA 1JEGA 2DTHA 2E2HH 1NE3A 4O6JA 4HIDA 1AT1B 3P8BB 1KNAA 2QQRA 4CDDC 3S1RH 1CFMA 3MC0B 5C0XI 4HIMA 1KFZA 1I07A 3QBYA 3O8VA 5C44B 3RZOB 1XNRL 5C3XA 3RLOA 4GZYC 1CTMA 2LJ1A 2YT6A 3F70A 1QB5D 2XWJB 5FU6C 3NENA 3WXMB 3DWAA 1VQLQ 2A68C 2EY1A 4LUOA 2E65A 3ZBDA 5IXFA 2TMPA 5ELFA 3L2UA 5FO7B 5BR8Q 5EPJA 1B1ZA 2JA6H 2DNUA 4JI7Q 1ZLMA 1WA7A 2B86A 3PMTA 3Q8DA 1FVIA 4TVAB 3CC2A 4XTZA 4MDXA 1VQLA 1YNNC 4J83A 1J8IA 2JA6G 3KDFA 2JOYA 1MSGA 1YI2Q 2RQXA 2H8HA 4HMJA 1BB9A 3MEFA 4O42A 1K9MR 2J05A 2Z1CA 3S14H 2PVDB 2CVRA 1WD0A 4XT1B 2JS0A 2EYWA 3OY9A 4KHVA 1ZA2B 3UWNA 2KRSA 3EGDB 1AWOA 4LDWA 4JK1C 3OYBA 5EKLA 4ZUIA 1E2ZA 4WFN3 1YI2A 1EOTA 1JJ2S 1N32L 1H95A 2UU9Q 1ACMB 4BA2I 1I5FA 1SEMA 4C0FA 1VQGA 3AFQA 3VR5A 3V7RA 1Q1BA 4OEMB 5M3FB 1ARKA 2VB3X 2JA7G 2X35A 4IFDJ 5GAOn 3NQTA 3CHBD 2EZVA 2CFMA 4M77D 1PA6A 2K01A 1TWGH 2JYOA 2ZJRA 4B3SQ 4YY3Q 2KA7A 5CKDA 3TP8A 2R6GA 5LMNL 1X3GA 5GAHC 1PTOB 1BCPD 3NXWA 1OU9A 1AWXA 2RVLA 4GNXA 4LFAL 2A36A 1VUBA 2B63H 2BE5C 2EQJA 4DUZQ 1QVGS 4ORZA 1SYFA 4X3KA 1X3QA 5IGGA 3CCJQ 2RDHA 4KN4C 3NUCA 4OELB 3A55A 2LT1A 3KK7A 3A8KE 1BBXC 5HCKA 4UHVA 4E7SA 1KK7A 1Q82C 2B63G 3PMFA 2WIIB 2M00A 2MAMA 1G2SA 1OI1A 2WAQE 2JXMB 4KV6A 4ZRZA 1S1NA 5GAN8 2I46A 3RLNA 5G3LF 3R6NA 1M3AA 1Q82U 3HFZB 1EYGA 3CCJA 2OAWA 4X9CA 4C8QG 1K0XA 3W1GA 4A3MH 2AWOA 3S9WA 1TWBA 2YRCA 3GD7A 4QKUA 3TVTA 3M58A 3G6ET 4LF6L 3S1MH 4F04B 5CV6A 2HQHA 4IOAA 1ZSGA 3META 1JOKA 2P5ZX 4JRQA 4IQZA 2LKVA 1VQOT 2GQIA 2PZ1A 4PMBA 4CGYB 2AQ2B 1FWZA 4ZTFA 3A54A 3M56A 4PJNA 4RTYA 4JI1Q 4JI5L 1F9SA 2QF7A 4KY5A 2D0PA 1PD1A 2F0NA 2MUYA 1U4LA 4M1UB 3BG3A 2DE0X 3C3LA 3K81C 4LDVA 1WCMB 1JOQA 4RTWA 2VYTA 5GAMf 4M4ZA 1FGBD 4EMKB 2ZXOA 4MTNA 1X55A 3IKJA 4JS5A 3U4VA 3A5ZB 5JOBA 5KRUA 2FL7A 1S40A 1QVFA 2X4WA 1QVPA 1UJYA 1XTCD 3LWHA 1PSFA 4B9WA 1GBRA 2R3ZA 4JPBW 1WJJA 3OIQA 4XQJA 3H3VC 1K83H 3G1JA 4LDYA 1VQ7Q 4HA8A 4MTKA 3E9HA 1L1OA 1NBEB 3A5UA 3HOUH 3KF6B 1JU5C 2QTXA 2DILA 2HKQB 3JCMX 1SRLA 2H3JA 3VR3A 4BY6C 1VQ7A 3HOUG 1XWEA 4MZPA 4RTXA 3PO2B 5I2XA 1D5XC 1U4PA 3I5SA 5BR8L 2Q8TA 3PGGA 2OJ2A 4ME3A 1ZUKA 1J3TA 2OI3A 1WTPA 4YIJA 4IPDA 4JBJA 4KD3A 4DEXA 1AN8A 3NE5B 3GTMB 4OWWB 1DM0B 2GCXA 1EWCA 3TP6A 3HRSA 1EY5A 1PZID 4K5XA 1YWOA 4L5QA 1AZQA 2KK4A 1XPOA 1MV0B 4A3KH 2RJDA 1BR9A 2I5HA 5JVG3 4RTVA 5KYXB 1FNWA 2DNEA 4ALPA 1C8CA 3S6WA 4A3KG 1BQQT 3R3OA 2YDLA 2EQMA 1Y1VG 5BN5A 2LZ6B 4LNQA 4HVVA 1YFNA 2UU9L 3KFVA 2A69C 4JI2Q 3U50C 4M7DG 5HURA 4I7ZC 2SEBD 4KGZB 2VXFA 4OB1B 2D0OA 5AJ3Q 4A3IB 3HOZH 5C4XB 4N9TA 1OXXK 3JCMW 2FYKA 4L5SA 4P73A 2KEEA 1I4HA 3FDTA 1B8AA 1NR4A 4B3SL 3QWNA 3RIRA 2PPBC 2LQNA 1K8AR 1N5ZA 1VQMQ 2JA8H 4LF4Q 4JI6Q 1LTID 4L63B 4B6MA 4FYDA 4ATOA 3K7AB 4GOPA 2EBPA 4OGEA 4DUZL 2PVOB 1NJIC 2CYZB 1QE6A 1ET6A 4K2KA 2ZPBB 2B2UA 1SHFA 2ZCFB 3V2TA 4EMGA 3VS0A 2CQAA 3QO2A 5D6XA 4QIWE 3CCMQ 3QIAA 1BOSA 1YJNA 4OHJA 5CC4A 3A0JA 1UB4A 1AEXA 2Z4IA 2F3VA 1K8AC 4LUDA 1IBLQ 5ECAA 3VJPA 1OXTA 5BN3A 2KHSA 3VA7A 4CI0C 1YZ6A 4KKUA 1GO3E 5JJIA 2LQKA 1U0LA 3R2IA 4D8DA 5M9OA 3CCMA 5AFWA 2KQ3A 1RI0A 2J6KA 5GANd 3M0SA 3T53B 1D1IA 2XU8A 3QR8A 3G71Q 3CC2T 4H44C 1KXLA 2MOXA 4XTUA 3I4LA 1WQWA 4J6YA 4ELYC 3NP8A 3FP9A 3SWNB 4UAIA 2HHHQ 3W1BA 5GMKj 1EFNA 4F7UF 2ED1A 2G5DA 1JMCA 4OX9Q 1WZOA 1CKMA 2CWPA 2EJMA 3GP7A 2XMFA 3M3YH 2P0KA 4Y28E 4JI1L 1X3EA 2FINB 1WIEA 3G71A 5C44H 3RZOH 2LMCB 5GAN5 3H3VH 2CGHA 3GO5A 3P75A 4LUZA 1W2BA 1HNZQ 3F2BA 1QKWA 3L2WA 1EWHA 5C44G 2AQ1B 3QOLA 4UP7A 3GTGH 2ASBA 2ATCB 4J9CA 3OB9A 1E1TA 4M7AC 2KVMA 4GBQA 1PFSA 3U23A 1RJTA 4DA2A 1O7LA 2XN9C 2EYOA 1LM0A 3J80c 4LJZC 2F0VA 3P20A 3J80i 3H8ZA 4DR6Q 3OYIA 2F0EA 3HTRA 3CCUT 4BE1A 5LJ5g 1OPKA 1TH7A 1EY6A 3DEPA 2JP1A 5IWAL 4DN4M 4PNOA 3WVDB 2VGMA 4FYWB 4DBHA 2DYIA 2X51A 2UXCQ 2IX0A 3H91A 4M78E 2WAQB 3QZ5B 1SNOA 5KNDA 2DEQA 4OL7A 5M3FH 2KMTA 5IXBA 3FVQA 3PUYA 2EXDA 1I8FA 2C5CA 4DV7Q 3SGIA 2I2LA 3AFPA 1IGUA 1ILPA 1NY4A 5EKIA 1GM5A 4IFDH 2CP5A 1G3TA 4E6IA 2B2YA 5M3FG 5EC7A 1VQPA 4H02A 1CSPA 4PZ8A 5M3MB 1DOLA 1RI9A 2LCLA 2LQWA 4DFAA 3UA7A 1HK9A 1Q86R 4IZ8A 1RAAB 5JPMC 3GTJB 1PTOH 4JVZA 1TS9A 1UE9A 2HUGA 2YV5A 1QVFS 1ZXTA 3RUXA 1YJ9Q 5IGCA 4IFDG 2FZCB 3Q23A 2AKWB 1PRTF 1GFCA 1GHJA 1KDBA 3ND9A 1PHJA 4U68A 4K8IA 4X66Q 2O5JC 4CRIA 3CRLC 1Q7YR 5T1IA 3HOVB 2ZAEA 4PV1C 2B8FA 5KYLA 1YJ9A 4YCVA 4ODGA 1MSHA 2LSSA 3H9NA 1MMNA 4JI2L 2RI3A 4FT2A 2L55A 4LF9Q 4A3BB 5AJ3L 3ZYYX 2B8AA 1SSFA 2OTLQ 3HOXB 3N52A 3K0XA 2K3BA 4CC2A 2A6ED 2J6OA 3FPUB 2H3EB 4KBMB 1Q7YC 1CHPD 4C8QF 1DYQA 2F0GA 3OYDA 1IL8A 5KE3A 2F3IA 4K0KQ 2V8IA 3KUFA 1WI5A 1UHFA 5L8RE 4HT8A 1M4VA 1W2BP 2K33A 1TXYA 4JI6L 4ULLA 2IY5B 2MPXC 2Z0WA 3E2UA 2OTLA 4OVAA 4GS3A 2HQEA 1HFGA 5IHNA 2ZTEA
chains in the Genus database with same CATH topology
1WJRA 3VKIA 4KUDK 1EQRA 2RJFA 4EMHA 4M75A 4IOCA 4M7DA 1WCMH 3VYHB 3G4SA 2MWPA 3L2PA 3OYKA 3SWNC 4JG2A 3HRUA 1PH1A 1ASYA 1WCMG 5J3BA 5GANj 2Q2HA 5EAYA 1UGPB 1D3BA 2HHHL 4NB3A 4POGA 1P8LA 4OX9L 4XU2A 1M90U 2CS7A 2V1CC 4D6WA 4KLKA 2YLBA 2KENA 3PO2H 2XK0A 2JA5G 3UDIA 4DR3L 1FJGQ 3GTMH 3PO2G 1Y07A 4C8QD 2O4XB 2FXQA 4R4QA 4QY7A 3I56A 5IY0A 4LD9K 4FM4B 5D6YA 1NZ9A 2UXCL 2ES2A 2P4TA 4JBKA 4N4IA 3L0OA 2E5LQ 1YJNT 3UDFA 3JRZA 5C0MA 1EWIA 1W2BS 4A3IH 2LT4A 2CQOA 4ZN1A 4DV7L 4E7HA 1VQIA 4DUYQ 4GLXA 3CD6A 4OB2B 3OS5A 3OS2A 5CR2A 5GANe 3K7AH 1J5EQ 1QUQB 3KJPA 3KJOA 4ELZC 2V8JA 4X66L 5IAYA 4EDUA 2I5LX 3CCST 1BI2A 2RK1A 2JTMA 3CCEA 2BIVA 2JN0A 3CC7A 2ZZDA 3CCLA 4AQYQ 2LXKA 4A4FA 2KAFA 4DV3Q 2Y90A 2NLUA 2DIQA 3KXTA 4C92A 5GAN6 1CSQA 4IUVA 2VS1A 3EBEA 4M78B 1XQHA 3H3VI 1VQHA 2NZHA 1PYSB 4P72A 5IYBH 3J7AF 5LJ5f 5GAN7 3F1ZA 1H3ZA 1PH3A 4C5IA 5IYBG 1BYMA 4N0AA 2ZTCA 1KQ2A 2QQBA 1A62A 3BZKA 2DXBA 1O7IA 3OSVA 2EQKA 2R7ZG 2ZPFB 4C0DC 5LMNW 5LJ3h 4PJOE 4YCWA 2VV5A 4C8QB 3I55T 3DM3A 2RHQB 5DLQE 2HAXA 2Q2UA 3BZCA 2GFAA 2XICA 2IHFA 3JCMh 1QW1A 4DA4A 1YHBA 2WAQG 4R4IA 4JI3Q 4IFDI 1Y96B 2IVWA 2CZ0B 3FLGA 3H15A 4JOIC 2IX1A 3QSUA 5M3MH 1FJGL 3X26B 3GTJH 3RERA 1GXIE 3JB9J 4VUBA 2ZPHB 2QEXT 4HJ9A 5CKBA 5M3MG 3M7NA 2PUKB 3GPLA 4A75A 3QPHA 1KHIA 3JAMc 3J81i 4P5NA 2R7FA 3UPUA 1N27A 4UY8C 4X6AH 4DOWA 1B70B 1CUKA 4L5RC 4ZGDB 2R5MA 2EIFA 2IT1A 4A3BH 3G6EA 3CPWS 3E9IA 4DR2Q 1PVOA 5FU6B 3HOXH 3CCQA 1JB0E 4DUYL 4JI0Q 4A3BG 1VQOA 2A1AA 4LWCA 1BKBA 3HOXG 1PH2A 1XTDA 3QHSA 1VCIA 5GAMg 3FDRA 1J5EL 3L42A 2K57A 4JRPA 2JJQA 2MQHA 4GN5A 4M77A 1M5Q1 4ZGEB 3N5BB 4BUGA 4XIGS 3KBGA 1N9WA 3VUZA 2VC8A 2HBPA 3CAMA 3ULLA 2C35B 4DKAC 2Y4XA 1JE5A 4J7IA 1HNXQ 2R57A 4JI4L 2K5FA 2RJEA 4DV3L 4M78C 4M7AE 3V8JA 2PVGB 1YHQT 4BE0A 3I56T 2F4VQ 1QP3A 3JCMc 3K8AA 1FL0A 2EJGA 5HY6A 4M7AF 1YHAA 4R4TA 1BIBA 5A0GA 3TCJA 2RH2A 1KQ1A 3VDYA 5H1SE 1IL2A 4KI0A 4PZ6A 1UE1A 3S17H 3CD6T 2XKOC 4JJNK 2Z6KC 2UXDQ 4IPHA 1B34A 4XTVA 3A8HB 4YWKA 3I4NG 4OXPA 3CF5A 4A4KA 3CBPA 3QIIA 2QQSA 2RF4A 3M4YA 3PUWA 1XNIA 5GAMh 1V43A 3T1HL 2E5QA 2Z0SA 2FB7A 4JI3L 4LW1A 4LF7L 3CC7T 3PO3G 2HNIA 2EFIA 2E41A 2EAYA 3ERSX 2XDBA 1QP2A 4BA1I 3TS2A 3QKJA 1UGRB 2RO0A 2BH8A 4APVA 4MZMA 2RI2A 5GMKm 4LF5Q 4DV1L 3G7ZA 2D0QB 1JB7A 4JBMA 1ZQ1A 4A4EA 4N4HA 1R8OB 4HIOA 1WFQA 2ALYB 4BY6B 1I3QH 4DR2L 1GVPA 4PG3A 3TREA 5JEAJ 1X75C 1KIXA 1T9HA 3TQYA 3HKZE 4GN3B 2CZ6B 5IT9E 3A74A 2ZM6Q 5FLXE 4QQ6A 2RA2A 4R55A 1A0IA 1XPUA 3MHXA 1P92A 3BDLA 3FEOA 3AHUA 2KCTA 4EPCA 4M78G 3OS0A 1HNWQ 3RNUA 1K9MC 2A8VA 3PTAA 3GTLH 3MP1A 3L2VA 3CCUA 1BBUA 4OB3B 2KHIA 1IBMQ 4JYAQ 1HNXL 1Q81C 2VQEQ 1W4SA 5HGQA 1MKHA 3LLRA 1X01A 1VQ4T 3GLXA 4C0ZA 5DY9A 3S3OA 1YIJT 1VQ8T 5M5WH 4R56A 1E24A 2F4VL 2FVUA 1I50H 1M1FA 1ASZA 3GTPH 2D9TA 4IUTA 3EN2A 1QZGA 2JEAI 1R9TH 1VS0A 3BY7A 1VQKT 4A3GG 2DK3A 4NXNQ 2UUAQ 3CCQT 1YEZA 1TWHH 3M85A 3HOYH 4A3EG 1VQ6T 1VQBA 1EFWA 2UXDL 3PGZA 5IP9H 2M1HA 2DO3A 4IUUA 1SFOH 3HOYG 2A7YA 4KULA 5A0DA 1XOVA 5IP9G 4TVRA 2X4YA 4FSXA 2LX9A 4A4IA 5AYFA 3M57A 1KHCA 4NS5A 2KSSA 3MCAB 2PQAB 3EFRA 5LL6S 1EIYB 5FRMA 4M7AB 2MF2A 2E12A 4DV2Q 3OA6A 1KRTA 3L7ZC 4A4HA 4B3MQ 2H5XA 1OXVA 5FU7B 2O4XA 3C95A 2DGYA 4LF5L 1NPPA 1P16A 2NVXH 1U1SA 4A54A 2QA4T 1HZAA 4JI7L 3FRNA 3IRBA 1VQFA 4PJOC 2LTOA 3ER0A 4F7UA 3S1QH 4OO1G 3UDCA 1D8LA 2WB1E 3TU4K 4RKUE 4A3DH 1Y1VH 4RG2A 2R5AA 4BY7H 2KVQG 4MMKA 2JNGA 2ZM6L 3W5OA 4A3DG 4KUIA 4BY7G 4JI8Q 4UPAA 3Q1JA 4MZ9A 2HQLA 2YYZA 2EYQA 1XMQQ 4EQ5A 2AHOB 2JA9A 4Y7NH 4YY3L 1VIEA 5LJ3d 4MNOA 2NZOA 2HT1A 4XU3A 1IBML 4JYAL 4C0GA 1V1QA 3UE0A 1V29B 4DV0Q 2YU9H 3BDUA 3HKSA 1X54A 3JCMd 1NJIU 2R7DA 5GAOq 1OTCA 3AQQA 4FIBA 1N6AA 1K8AU 3EIVA 3DLLA 2K14A 1HR0Q 4BD3A 3PUVA 4NXNL 2UUAL 1B7YB 2R58A 2CKKA 3S1NH 3QDRB 3LGFA 4BDZA 5CQYA 4QQBX 2VY3A 3CCSA 1X6OA 2K5IA 1OZ3A 3OYCA 4MZTA 4DR1Q 1WQ7A 4C8QA 3HOWH 5ELNA 5IE8A 5CKEA 1YBYA 4BBSH 2VUMH 2CZ7B 1TWAH 3HOWG 2PQWA 2G3RA 4L59A 3PNWC 3OBWA 3KFUA 4HCCA 5EG2A 1Y96A 4E7LA 2AWNA 5FU7C 1Y14B 2AHJB 3RKXA 1N8RC 2Y4YA 2N8NA 4L5TA 2VUMG 4BBSG 4DV2L 1PYBA 3OYLA 5JEAG 5GADC 4B3ML 4BXXH 3P8DA 3QXEB 3NFCA 4OGCA 2M0OA 3DB4A 4DK3C 4PJOG 2JK8A 3H0GH 5IYCH 3LGLA 4A76A 4BXXG 2N3SA 2DAQA 3H0GG 4KHZA 3EAEA 4GY5A 5IYCG 4M78F 1Q12A 3G48A 3WWVA 2LVMA 1KQSA 1E1OA 1L2FA 4IPGA 3I55A 4LD6A 3JCMQ 3CMAT 4HJ5A 1VQEA 2VXEA 1K3RA 1HZ9A 1A8VA 2UUBQ 5CAIA 3KDFB 2GF7A 3MEWA 3NTKA 1OZ2A 1Q86C 5CVIA 4JI8L 1M4ZA 3J7A5 1KG1A 4WF2A 2LDMA 1VIFA 1Q86U 1BI3A 4YHHQ 3M59A 3UDGA 2OQKA 1XMQL 2QEXA 1G3SA 1RL2A 4LF4L 5LJ3j 1Q7YU 2BKDN 2L89A 3RKWA 1N33Q 2XI9A 3E1SA 4DV0L 3S3NA 1ZBXA 2MWOA 5GAMd 1XMOQ 2F69A 2DJZA 4QGUA 3PUXA 2CZ1B 5LJ5h 1IBLL 2D6FA 1KRSA 1JJGA 3V7CA 3JB9F 3A8GB 3FIFA 3KF8B 3PUZA 1G51A 1HR0L 3BW1A 4M78D 1K73C 1EUJA 2RHSB 2EWNA 3HFOA 4M7AG 5CCAA 4E7KA 5A0LA 4C0DB 1SMXA 3PV0A 2JA5H 1HNZL 4OO1I 4DR1L 2QGQA 3ASKA 3CC4T 2N78A 5GAOr 4DR6L 1UEBA 3JCMP 1YHQA 5LJ3e 4GKKQ 2RHIA 3JSCA 1Q8KA 2XGTA 1AE3A 2DTOA 1WOCA 5IYDH 5GAGC 3JCMe 4IUQA 4HKEA 3JB9D 5IYDG 3MP8A 4Y52H 2OAUA 2PI2A 2BUDA 5GMKh 4M75E 2K2VA 4O5VA 4LFBQ