3TREA

Structure of a translation elongation factor p (efp) from coxiella burnetii
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
129
structure length
129
Chain Sequence
b'THSTNEFRGGLKVMVDGDPCSIIDNEFVKPGKGQAFNRVKFRNLKTGRVLERTFKSGETLPAADVVEVEMQYLYNDGEFWHFMTSENYEQHAASKEAVAEAKQWLKEEALCMVTMWNGVPLSVEPPNFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor P
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Translation
total genus 20
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3treA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3treA02
2V1CC 2CWPA 3PUZA 1M90U 3BJUA 3E9IA 2VQFL 1FGUA 2N3SA 2WB1G 4IOCA 3HOUG 2VZAA 4LUZA 4IPHA 3GTQH 1VQ9T 3NBHB 2ID0A 1YIJT 2ZJQA 1MKHA 2QGQA 2YV5A 2OTLT 4A3LG 1VQIA 2JVVA 2Z0SA 3WWVA 4LUOA 4DR4Q 2E2JH 4AQYL 2DO3A 3RN2A 3HOUH 2HIXA 4GNXA 2ZTCA 3CCQT 3F2CA 2MWPA 2N49A 1FJGL 3M3YH 3G6EA 2WAQE 3ULLA 4A3IH 4BBRG 1VQBA 2DGYA 4QL5A 1K8AC 1PH3A 4OX9Q 4A3LH 3KF6A 4GN5A 2JA8H 2MNAA 4DV7Q 3GTMH 2XGTA 1QVFA 3CCMA 4JI3Q 3CMEA 2RHQB 4OWTB 1GO3E 1M1GA 4EX5A 3CCRA 1C0AA 4DR3L 1B70B 1EUJA 5AJ3L 4A3BG 4Y7NH 1K73U 1T9HA 3LGFA 3PV0A 3CC7A 5IYBH 3JAME 1VQCA 2PI2E 2R6GA 1HZAA 2JJQA 3PGZA 3PUVA 4GLAC 2ZM6Q 4P75A 2OCEA 1HR0Q 2XHCA 5LL6S 1UE6A 3DLLA 1JJCB 5LMNQ 1HZ9A 3JAMi 4DNIA 5FJ8G 1R9TH 4QJFA 4AYBG 4A3BH 1M1KU 3CCUT 1VQ8A 4X66Q 4IPDA 1GVPA 1J6QA 3M85A 4HJ5A 1Y14B 4LF4Q 4X34A 2R7ZH 1GKHA 2ATWA 4JI5L 2L3RA 3CCLT 3HKZE 1S3OA 1VQLA 4LFCL 3J80i 1PH6A 4POFA 4JI1L 5FJ8H 2I5HA 4HJ9A 1QUQB 2BH2A 2JEBI 2K14A 1NPPA 3HKZG 4O2DA 3EN2A 1HZCA 1X65A 5C3EG 4JI6L 2JA7G 3U50C 1N36L 4JI7L 1IBKQ 1YJ9T 1PFSA 4RMFA 3M7NA 1NPRA 2EQSA 4AH6A 1PH1A 5GQOA 2MI6A 4UP9A 1EFWA 1XNRQ 1VQ5T 5M5XH 4DV4Q 1N33L 1NJIC 5C3EH 4LF5Q 3PO2G 2JA7H 1V1QA 4X65L 4GLXA 2Z6KC 1I94L 2QA4T 5IT9E 4X62Q 4DV3Q 1L1OC 1VQEA 1OXVA 3UDXA 3CXCS 1TWCH 2MQHA 2GN5A 4TVRA 5M5YH 4HJ7A 1UE7A 1HNXL 1MIUA 3S16H 1VS0A 1Y1VG 3PO2H 1SSFA 3AFQA 1N34L 2CWAA 4P72A 3HOXG 1PH7A 1IBMQ 5J26A 1Q46A 2Q2IA 2DUDA 4JBWA 2MWOA 1TWAH 3KDFB 4A3EG 1CKNA 5K36G 1TXYA 4DAMA 1Y1VH 3ERSX 5M3MG 2K5NA 1KRTA 2K4KA 4BBSH 3E9HA 2IG0A 4DR4L 3CCST 2KENA 3AYHB 1PHJA 2UUAQ 1VQ7A 1X54A 4R4CA 1WCMG 1YJWT 1UWVA 3RNUA 1C9OA 1VQGA 4A3EH 4LF8L 4QQBX 1SR3A 2AKWB 4XTCS 4OX9L 4A4IA 3K7AH 3PUYA 1IYJB 2PQAA 5DM7R 4YCVA 5M3MH 4DV7L 3L0OA 4B3RL 3G4ST 1XPRA 1Q1BA 1V43A 1XMQQ 4JI3L 3CCVT 3GTPH 1WCMH 2MO0A 4GOPC 2R93G 2K75A 4DK6C 2OTJT 4TVAB 1VQDA 2E8GA 4P71A 4MZ9A 4YCUA 3L7ZC 4PMWA 3U4ZA 3UE1A 4JI2L 3J80c 3I56T 3J7AF 5C0XG 1VQHA 2H5XA 2YTXA 1YBYA 2ZM6L 3GTOH 1YEZA 3CCET 2JA9A 1VQ4T 3PCOB 1HR0L 4LF7Q 2R93H 1P8LA 5JJIA 3PF4A 5ELOA 1VQNA 4HJAA 4X66L 1NTGA 4DR7Q 4H02A 1YZ6A 4LF4L 5IAYA 2CKZB 4DKAC 3PO3G 4GNXB 2ZJPA 1Q81U 4GKJQ 5IP7H 1X6OA 2CQOA 1ASYA 1AE3A 3CXCA 3HOWG 3KF6B 5JEAG 2L15A 1KD1C 2I0QA 2G3RA 2UUBQ 1E1OA 2E70A 1N8RC 5C0XI 3JAMc 1A62A 1LYLA 1JMCA 4JBMA 4GS3A 4BY7G 3I55T 3S2HH 4JI0L 1VQJA 2LXKA 4DUZQ 1XNRL 3HOWH 3A0JA 4DV4L 4DV6Q 4LF5L 4WJ3M 4J15A 2LQ8A 4X62L 4DV3L 2WFWA 4BY7H 5IYDG 3PIOA 4YTLA 3TQYA 2F4VQ 1WI5A 3PSIA 1Q1EA 4A3KG 1XMOQ 4APVA 2EIFA 2Y0SE 4IPCA 2UXCQ 1G6PA 4GOPA 1XPOA 2A1AA 1EWIA 2AHOB 1D7QA 4A93G 1K83H 1WOCA 4UP7A 1U5KA 1B8AA 4O0AA 1IBML 4GN3B 1TWGH 3G48A 4BXXG 2I5MX 5JEAJ 3TEHB 3J7A5 4CRIA 4A3KH 3GTGH 2OWOA 3S15H 5GROA 3ER0A 5GAGC 1J5EQ 2YYZA 4AIMA 3D31A 1I5FA 2R7FA 4MNOA 4HIDA 4LF6Q 1XPUA 4A93H 2KCMA 2C35B 4BXXH 1LTLA 2WAQG 2NN6I 2QEXT 3PUWA 5IT9c 4R4OA 4DV1L 2Q2HA 3EIVA 5BR8Q 1VQMT 2D0PA 1KD1U 4GN4B 3S1NH 3CCQA 3RLOA 4JBJA 4MTNA 2K5VA 4BBRH 1XMQL 2ASBA 2JNGA 1Q7YC 1Y1WG 5C4XG 5C44G 1YHQT 4OONA 3CC2T 2CCZA 4A3DG 3S2DH 3DB4A 1JB7A 1EIYB 4DR6L 2K50A 3MEFA 1KC8U 3S1MH 2ZJRA 4LWCA 2OQKA 3RN5A 2PI2A 3AFPA 3CW2C 5GAEC 4QIWE 4B3TQ 1VQOT 1G51A 1OXSC 3F2DA 1I3QH 4PZ8A 4XIGS 5IYCG 5C44H 4A3MG 4B3SQ 4A3DH 1RL2A 1VQ6A 3P8BB 2KHIA 1EQQA 2OQ0A 2E2HH 1CKNB 3DB3A 4LW1A 1N32Q 4JOIC 1G291 3HOYG 4OXPA 1HNZQ 5FLXE 1OXXK 5JJLA 3A5ZB 4QGUA 1VQPT 5IYCH 4A3MH 3H3VH 1Q86C 4GKKQ 1A8VA 2LVMA 4YCWA 1SMXA 5J3BA 4DK3C 2RF4A 4GKJL 5ELNA 4EQ5A 1AE2A 3F8TA 5A2QE 4C2MH 3CPWS 2PQAB 3ULPA 3CCLA 3HOYH 1K8AU 1CUKA 2ZTDA 4DV2Q 2UUBL 1K0RA 3BZKA 1L2FA 4ALPA 1GM5A 1H95A 3A5UA 4RG1A 4L5TA 1QVGS 4OWXB 3S14H 4L5QA 3SGIA 3EBEA 3H3VI 1BVSA 4DR1Q 1IXRA 4DUYL 4DV6L 3CD6T 1YJ9A 2XTIA 4C3HH 1WJJA 3K0XA 2E5LL 3OYYA 2MFIA 3BZCA 1B7YB 1YHBA 3T1YQ 3ZJYC 1RIPA 3LGJA 1IZ6A 3PUXA 1KRSA 3TREA 4YWLA 5E7NA 1QZGA 4LNQA 2NZHA 4NXMQ 3UDIA 2F4VL 1XMOL 2QA4A 2UXCL 1CSQA 2RHSB 1X3EA 3CC4T 3AEVA 3F2BA 2UU9Q 1JT8A 4BY1G 1KQSS 3FP9A 4GLVB 1N9WA 3GTJH 3HOXH 4UP8A 1Q82C 1NBWA 3J81E 3TS0A 3KF8B 3LH0A 2HT1A 2VUMG 1FVIA 1NE3A 1OXUA 1XTDA 2NZOA 5DLQE 1NMGA 2KBNA 4BY1H 3J81i 1BBUA 2LXJA 3CP0A 4JG2A 4DR2Q 1XNQQ 3KOJA 4PZ6A 3CCSA 1QZHA 3M4PA 4B3MQ 3FHWA 2VUMH 3CMAT 2F52A 3S17H 1YJNT 3D0FA 4A3JG 1K8GA 1KAWA 2AWOA 1ASZA 1YJWA 1PH8A 1NJIU 4OO1I 3TRZA 2D0OA 1MJCA 1OTCA 3HOVG 3E0EA 1EIFA 2B3GA 1K9MC 2IHFA 4DAYB 1HNWQ 4KHZA 1QUQA 3G4SA 1NMFA 5LMNL 3CCVA 1YITT 2FXQA 4B3TL 4HIKA 1YI2A 2Z6KA 1HJPA 3T1HQ 2OTJA 1JE5A 3GDEA 3K8AA 3CPWA 1L1OA 5EAYA 4DR3Q 2HQLA 4B3SL 4A76A 3I4OA 1X9NA 3I56A 1QVGA 1QVCA 4X6AH 1N32L 4RG2A 3CCEA 3G71T 3CPFA 1VQ4A 4YWKA 1SRUA 3OTOQ 1E1TA 1S72T 1M90C 4R4IA 1HNZL 4L5RC 4A3CG 1A0IA 3Q8DA 2BA0A 1Q82U 3PO3H 3CCJT 1X3GA 4GNXC 1IBKL 2Q2UA 4QQDA 4IPGA 2NVXH 3BU2A 1EOVA 4X64Q 2CKKA 3TS2A 2RCNA 3RR5A 1XJVA 1PH5A 4DV2L 3U4VA 5C0XJ 2UXDQ 1HR0W 2WP8J 1V9PA 4A3CH 2A19A 3KDFA 1VQKA 2YTVA 1C7YA 4UY8C 1IBLQ 1PVOA 2NN6G 2VQEQ 1KQSA 4DR1L 3J81j 4ZN3A 4JI6Q 2JA6G 1NY4A 3RZDH 1YNXA 3I55A 4UPAA 3CF5A 2PNHA 1WYDA 5HGQA 3T1YL 1K9MU 2IT1A 1TWHH 2K52A 5FLXc 4HIMA 4NXML 4JI4Q 1K73C 1GD7A 3OW2S 1U0LA 1I6HH 1XNIA 2Y0SG 3KYHC 4DR5Q 2UUCQ 2VNUD 5IYDH 2IX0A 2JA6H 1BKBA 2VY3A 1I50H 1NZ9A 2KCTA 2UU9L 1DGSA 1SFOH 2UUAL 2WB1E 3L2PA 1VQ9A 1YIJA 4DPGA 1L0WA 2OTLA 3FKIG 1E3PA 3STBD 2EXDA 1N34Q 2NVYH 3G6ET 4DV0Q 1E24A 1SE8A 4NPSA 4C3IH 4KHPQ 4PZ7A 1W2BS 1N8RU 3NELA 3KLWA 4A3IG 2IHEA 4DR2L 3F1ZA 2GVBA 2JQOA 1XNQL 3GD7A 4NXNQ 2A8VA 3CCMT 3CMET 4FDBA 2JA8G 3FKIH 4B3ML 2NVTH 3CCRT 1KXLA 2JE6I 3DM3A 4NB3A 3GTLH 3S1RH 3K81C 2QEXA 3K7UC 3VDYA 1PH9A 1E22A 5C4JH 3CC7T 2HHHQ 1VQMA 4LF8Q 4P73A 3KBGA 5C4XH 1Y1WH 4JYAQ 3JC66 1CSPA 1X56A 4QY7A 5IYBG 4LF7L 3W1GA 1PYBA 3RLNA 4B3RQ 1UE5A 4LFAQ 3KJOA 1YHQA 4K0KQ 3CC2A 2UXBQ 4BA1I 3J81c 4YY3Q 3T1HL 1YHAA 4DR7L 1VQ8T 1VCIA 1PYSB 2CFMA 3A74A 4JC0A 1JJ2S 2VL6A 1HZBA 2ZTEA 3UE0A 4LF9Q 1VQOA 3GO5A 4JI8Q 1VQ6T 3CCUA 1Z47A 3CQZH 4JI2Q 4C3JH 3I4MG 3ICEA 2KDSA 1VQLT 1O7IA 4AYBE 3OTOL 2R7ZG 2AWNA 3AQQA 4A75A 4LFBQ 2R92G 3HFZB 5GAHC 3RZOH 1A63A 3STBC 1YVCA 2AMCB 4R4TA 4Y52H 3KJPA 3J80E 1SLJA 1EQRA 3I4MH 4X64L 3I7FA 1VQPA 2R7DA 3PIPA 2N8NA 3OW2A 1VQFA 5IWAQ 2UXDL 5LMUQ 3J7ZC 4DUZL 2R92H 3HOZG 2B29A 2HIVA 1Q7YU 1Z9FA 4L5SA 4JV5Q 3IRBA 1IBLL 1SROA 2VQEL 1VQ5A 3HKSA 2KHJA 1LUZA 1HNWL 2B63G 2GVAA 3HOZH 4YHHQ 5JJKA 4OWWB 1L1OB 4OO1G 2IX1A 1E7ZA 4JI0Q 3W5OA 2VS1A 3K80C 3M4QA 3CD6A 4JI4L 1WFQA 5FLMG 1W2BA 2E2IH 4DR5L 1LM0A 3H0GG 2UUCL 2MO1A 4TQUS 4DV5Q 2B63H 3S1QH 3W1BA 2JOYA 1J5EL 4JBKA 2VQFQ 5H1SE 4R1JA 4LF6L 1AH9A 1Q86U 1KHIA 3S24A 3CC4A 5FLMH 1VQ7T 4JOIA 3H0GH 4ME3A 2JA5G 5IY0A 1K3RA 1PH2A 5BR8L 1D8LA 5M3FG 4DV0L 2JEAI 1SN8A 1W3SA 3M9BA 4AQYQ 2NVQH 1Q81C 4A3GG 4KHPL 1CKMA 4IJLA 1IL2A 4NXNL 1FJGQ 1UE1A 4P74A 1BBWA 4HIOA 5HY6A 2JK8A 3B6YA 1JJ2A 1FL0A 3PF5A 1PV4A 2BH8A 2JA5H 2YU9H 3CAMA 5M3FH 4IO9A 3U58A 1PH4A 5IP9G 5GADC 4GOPB 4A3JH 4A3GH 2HHHL 3RLFA 4BA2I 4KLKA 3CMAA 4DV1Q 1YJNA 4PG3A 2F3IA 4HJ8A 3HOVH 4JYAL 4KI0A 5AJ3Q 2N78A 4LFAL 1P16A 4K0KL 2UXBL 1CKOA 4YY3L 1VQNT 4IFDG 5IP9H 1YI2T 5IE8A 3GTKH 3KFUA 4DR6Q 4JCVE 1YITA 4LF9L 4GKKL 1UEBA 4JI8L 1JJGA 1QVFS 2IY5B 1Q12A 4LFBL 3MXNB 4IOAA 1MJEA 2JUFA 1EYGA 4YWMA 3LGLA 3H15A 4JI5Q 2LCLA 4R4QA 5IP7G 2K5HA 4LFCQ 3G71A 3NENA 2D62A 5LMNW 1S72A 3UDGA 4JI1Q 1KIXA 2ES2A 4ZN1A 1X55A 4A3FG 1HH2P 2BA1A 2ALYB 5IWAL 2PMZE 3CCJA 5LMUL 4BBSG 2I5LX 4IFDI 1N36Q 4JI7Q 2LSSA 4WJ4A 3I4NG 4JV5L 1VQKT 4IFDJ 3I2ZA 4POGA 1N33Q 4A3FH 2KVQG 1Q8KA 2YTYA 1VQAA 4IJHA 3UDFA 4YHHL 4X65Q 1I94Q 3M4OH 3NEMA 1OXTA 1TWFH 1KL9A 3ULJA 3I4NH 1X3FA 4DUYQ 2E6ZA 1KC8C 2Q2TA 5M5WH 2VW9A 1HNXQ 1S40A 2E5LQ 4DV5L 1M1KC 4LUVA 1PA6A
chains in the Genus database with same CATH superfamily
2R92B 3LNNA 2D9UA 5IHNA 3MVVA 1T3LA 4ME5A 2VQFL 2JEAI 2FYKA 4WCIA 4MMLA 5DLOA 3P8DA 2E76C 4S3SA 1D3BB 1SYGA 4K8JA 1W6XA 4M77D 1I6HB 1M4VA 4KD4A 4CI0C 4A3LG 3NFCA 3BVGA 4E7JA 1EOTA 2JVVA 3A1PA 4F17A 1VQ9Q 3HSBA 1LABA 1XMQQ 1J9OA 2YRCA 2NYZD 3REAB 3M3YH 4CJ1B 4M7DF 1VQBA 4QL5A 4JK1C 2HQHA 4A3LH 4M7DE 2MNAA 4JRKA 2GFUA 2XMFA 1J3TA 2B2YC 4OWTB 4F8MA 3MEUA 2DNCA 1Q86R 4FYDA 1RADB 1OEBA 3VKIA 5AJ3L 3D6WA 4OELB 5CBAE 2RDHA 1T9HA 3JAME 2PI2E 3PGZA 1HZAA 2JJQA 3RMQA 1BYMA 2NVQB 1ML0D 2FPDA 1RF2D 4KGXB 2XHCA 5JAVA 4HMJA 2K1BA 4J6WA 1HZ9A 4CJ2C 1QG7A 4AYBG 1VYTA 1VQ8A 1U4RA 1GVPA 3PFSA 5M3FB 1Y14B 4IUNA 1RABB 1JXMA 4X34A 5D14A 3JCMg 4Z9CB 4KHVA 2ATWA 3QYGB 3NK9A 2KAFA 1JO8A 4F7UF 1KABA 1S3OA 2AQ2B 2QQBA 4LFCL 3J80i 1K3BC 3FVQA 2EYYA 4PJOD 1BCPB 1O7ZA 3V8LA 3K59A 3LLRA 4LDYA 4KTAA 3WDNA 3TEEA 3GOXA 3HKZG 2CUDA 1NPPA 5I2XA 4JI6L 1LPLA 2E4HA 3GTKB 3JCMf 1ENCA 1IBKQ 4RMFA 3JCMb 3I4LA 1G83A 1QP2A 5C4HA 1N6AA 1T5XD 2YUOA 3W3AA 1VQ5T 3MXPA 1R4QB 2Z6KC 2NWMA 2ENBA 1HA5A 3BY7A 3QOLA 3O13A 3CXCS 4XTVA 1I1JA 5M5YH 2DTOA 1UE7A 4C8QG 2EYOA 1ZA1B 4XTZA 1VS0A 4UAIA 5D6XA 1SSFA 2ZPFB 3JCMX 2XN9C 2K5IA 2CWAA 5IHIA 3K6OA 1OV3A 2Q2IA 3RESA 2D1XA 2RNAA 2DYIA 5CORA 1QWYA 3GQBA 3NBIA 5K36G 3K5OA 2MAMA 1RTOA 2P5ZX 5EBCA 2LT4A 4DR4L 1OX8A 1ARKA 2CS7A 3KUPA 1VIEA 2QYZA 4LF8L 3CCSQ 1C9OA 1W2BP 5K36H 1ZYRD 2EYWA 1MHNA 2LCSA 3FJPA 5A0LA 2FJ2A 3PMFA 5I6WA 1EX4A 3A98A 4R0KA 5GAMf 1QKXA 4JI3L 2Z6BA 3SK5A 2MO0A 4GOPC 3KFVA 2CREA 3G4SQ 4K5VA 4ZGJB 1VQDA 4TVAB 3JB9J 5LJ3d 3A54A 4YCUA 1Y96A 2JS0A 1A0NB 3VR4A 4YIJA 2QTVA 3I56T 3J7AF 1YBYA 3HOUB 2JA9A 3PCOB 1WTPA 2EQMA 5ELBA 2EYXA 3O8VA 2KVMA 2KRNA 1VQNA 1D0YA 2NUTA 3CCEQ 1GCPA 3TQ7P 5GMKh 3A8LB 4HCBA 5IGFA 2CP7A 4DK0A 5ELDA 4GNXB 1T0JA 4ZQ3A 4FF2A 4Y7NB 4V190 3META 1RD9D 2LJ0A 1WTWA 1YN8A 1WYXA 3GIBA 1N5ZA 2GF7A 4EIKA 1EU3A 2E70A 3C1FA 1SJED 5C0XI 4UC4A 1T0HA 5GANe 1LYLA 4BY7G 3S2HH 4M7DB 4LXCA 4A3BB 4FNFA 3WOEA 1XNRL 2LDMA 3NPFA 4N0AA 3A55A 2V1RA 1WHGA 4BY7H 2ENMA 3PIOA 4KUDK 4VUBA 3VRYA 1STBA 3TQYA 3QBYA 5IYDG 1EYCA 1LT4D 4APVA 2Y0SE 1G6PA 3C95A 4DXGA 5GAN6 3GLXA 2AHOB 1WI7A 5CKEA 1WFWA 4UP7A 1B8AA 1TTHB 2DVEA 1WTRA 5JEAJ 4ZNXA 2PUOB 3TEHB 2YUPA 4CC2A 4JS4A 1SYFA 2HBWA 3ER0A 5C3EB 1J5EQ 2YYZA 5CV6A 4MNOA 4F7UB 2P4RA 3ASKA 4PFOA 1IKLA 2ROLA 1Q8IA 3PUWA 1ZKOA 5HK0A 2ED1A 4DV1L 5D7UA 3S16B 4GN4B 3KBXA 5FO9B 4DK1A 2VB2X 3S9WA 3FMCA 3FPPA 3G6EQ 1Y1WG 1B2TA 4A3DG 1PCXA 3OYLA 3S2DH 2F69A 4DR6L 2A6EC 2EY5A 2K50A 3T16A 3M0QA 5C6AA 4KBMB 2ZJRA 2JS2A 1HFGA 4QIWE 1VQOT 2NUPA 2J6OA 1WTXA 5J1ZA 1I3QH 5KYIA 1X43A 4A3DH 1I4GA 2SRCA 1RL2A 3H8ZA 2J4XA 8ATCB 2RSOA 3P8BB 1LO5D 2I0NA 1TOVA 3DB3A 3K7AB 4IN3A 4JOIC 2BE9B 4FYVB 4OXPA 2RPNA 4QGUA 4P5NA 4HSPA 2AKKA 4C1NI 1MI2A 5DAUA 1SMXA 1WHLA 5GANh 4DNTB 1E6GA 1OPKA 1I0CA 2E5QA 5GJWB 2PQAB 3OYIA 3MFGA 1CUKA 3BZKA 2QDYB 4XK8E 3A5UA 1KQ1A 4A4EA 4FF4A 4OWXB 1EIHA 1WD1A 1GFDA 4L5QA 3UPUA 1STNA 1GBRA 1IXRA 3VS5A 3I3CA 2KECA 2JN4A 2NTSA 5KH6A 2XTIA 3K0XA 2E5LL 3OYYA 5GANg 1RLQC 1B7YB 1SNMA 2I46A 1M2OA 4Y28E 4HCZA 3HGBA 4J1MA 1S5BD 3QWNA 1IYUA 3NPPA 2F4VL 1XMOL 4CHTB 4N4IA 1TY2A 1OX9A 2BDNA 2EXZA 3PVLA 1HFNA 3F2BA 2LMJA 2EYJA 3PO3B 2LFNA 3VS4A 3CC4Q 2V8IA 3CBPA 2CW0C 2W0ZA 1NBWA 2E64A 2XIDA 3BVZA 1JE4A 3KF8B 2Q8TA 1ZSZC 2NLUA 1NE8A 2CP5A 3MKDA 5EJWA 1OXUA 2E12A 4DOVA 4F87A 3PTAA 4V0BA 2QK0A 3J81i 2XIWA 1IL8A 1B7TA 1BBUA 1XTCD 4DR2Q 4AFZC 3KOJA 1HYOA 1PRTF 3QIIA 2PW5A 4PZ6A 5COYA 5IGGA 3OMCA 2L3QA 1DONA 1HQRD 2E3IA 1TWHB 3BYTB 2JTFA 2KR3A 4KT0E 3CMAQ 1F2MA 3VR6A 3IKJA 2L4NA 4C0DC 4KN4C 3FIFA 1LTAD 1HNWQ 5EPLA 1Z7TA 1OYXA 3L2WA 3OMGA 1NMFA 3QR8A 5KYLA 3S15B 3HPWA 2B2WC 4HIKA 4KJNA 4R55A 1I81A 3GDEA 3TBIB 3CPWA 1L1OA 5EAYA 1PFBA 4RCOA 3Q0AA 2A3LA 3ULRB 1FD7D 4FP5D 1OU8A 4Y91A 2A0FB 3F2UA 3I56A 1QVGA 2YRDA 1VDZA 4X6AH 1BIAA 3HP3A 3CPFA 3OTOQ 4L5RC 3S1NB 1E1TA 4IUTA 1EY7A 3R2TA 4A3CG 2CZ6B 3Q8DA 1G2TA 3G71Q 2XDBA 2BA0A 3BW1A 4DA4A 1Q82U 1S72Q 3CCJT 4J6YA 4ZLTF 1ENFA 2Q2UA 4IPGA 1SRMA 2X4WA 3H6ZA 1BI2A 1MV3A 1SRLA 1STEA 2RQRA 2CKKA 2DXBA 4QQGA 3NSWA 4DV2L 3J80L 5C0XJ 1HR0W 5C4XB 4A3CH 1ET6A 3ND8A 1VQKA 3EG9B 4HKEA 2A6ED 2YTVA 4LJZC 2GGRA 4JJBA 3TCJA 4UY8C 2F5TX 1CSKA 1BXTA 1EZ6A 2FZCB 4J9IA 1KDCA 2JA6G 3RZDH 1HXYD 1TH7A 1YNZA 4UPAA 5IGDA 2PNHA 5HGQA 1Y57A 1K9MU 4NXML 4O5VA 1BDOA 4XQQA 2NZ1D 2X4YA 1D6EC 1GD7A 2O5IC 2O4XB 3QOJA 3TZUA 5FRMA 4C2MB 2CGHA 1E7OA 5IIFA 2XKOC 2JA6H 3HOYB 4G7OC 3NUCA 1AWXA 2WKDA 2KCTA 3S14B 2YUQA 2UUAL 2ZZDA 1VF7A 2WB1E 1VQ9A 2BZXA 2LCCA 2J6FA 3FKIG 2FRWA 4NOYA 3STBD 4C3HB 1F9SA 1G6ZA 1Q7YR 3BDCA 3G6ET 4KKTA 3FLGA 3ZL7C 1IRXA 1SE8A 4PZ7A 3JCMJ 1W2BS 3NELA 4A3IG 2G5DA 3JCMP 2GVBA 1XNQL 1C0MA 1QVPA 2FZGB 2VXFA 2F5KA 3CMET 4FDBA 2JA8G 1ZA2B 3FKIH 2NVTH 1QB5D 1B07A 4QW2A 4C8QB 4H7BA 1SE3A 1T5EA 1YFNA 3VDYA 1CI3M 3MXUA 3GPLA 3CC7T 2DD5A 1HJDA 1F9RA 3RKWA 2EYFA 2HHHQ 2M16A 1CSPA 1X56A 1YNND 1SG5A 4LF7L 1HA6A 1PYBA 2J06A 1UE5A 1M8AA 3KJOA 2UXBQ 5LJ5d 4BA1I 1PTOC 4YY3Q 3T1HL 5LL6X 4M75A 4JC0A 1VCIA 1PYSB 3A74A 1RAEB 1GUTA 2R5MA 1UGQB 1HZBA 1M2VA 1VQOA 3GO5A 1VQ8Q 3EFXD 2KDSA 2EAYA 1AWWA 2ZAEA 4N4GA 1JWMD 1VQ6Q 5FKAC 2R92G 2PQEA 1G2BA 3OSOA 3RZOH 1A63A 1FMWA 4Q5WA 1YVCA 4Y52H 4R4TA 3J80E 1SLJA 4NW2A 2L9HA 4X64L 3I90A 4E7HA 4II1A 3J7YW 4A3JB 2DIGA 4BI3A 4C92C 4DUZL 2F0OA 2X69A 2R92H 2CZ7B 4MMKA 2B29A 3HOVB 1Z9FA 1X27A 4RG8A 4BDYA 1PRTB 5HK3A 1SYDA 4MZTA 5EKKA 4L5SA 4DBFA 1LUZA 3OY9A 1Y0MA 2GVAA 5GANj 2IPKD 5CKDA 1ZEQX 1DOKA 2IX1A 3X20B 1E7ZA 2HAXA 1Q82R 2DY7A 2J05A 4CDEC 3M4QA 3W2DA 4LDXA 2WINB 3HS0C 1KSWA 4K5XA 5CKFA 1Y71A 4BI8B 3W1BA 2K32A 1AT1B 2XK0A 4XTUA 1ICWA 3NQIA 5NUCA 1HRJA 1Y8NB 1O80A 2O88A 4O6JA 5H1SE 3HL8A 3NTHA 1AH9A 3RKYA 4KY5A 2WSCE 3OYNA 1KHIA 1ZUUA 1ZBXA 2F0KA 1RODA 3QKJA 1QILA 3MXGA 2DZCA 4ME7A 4BD3A 2A6HD 1PH2A 1D8LA 5M3FG 1VOMA 1K9MR 2NVQH 1M27C 1Q81C 3JCMd 2X3XD 1RKNA 4OMPA 2ESWA 3CBOA 1WLPB 4NXNL 1FJGQ 1WXTA 2Z8LA 5HY6A 4L8JA 4HIOA 3M4OB 1U1TA 1SNPA 5M3FH 4C92E 4RWSC 2P4TA 4N0AC 5C3XA 3NXWA 2KROA 4KMUC 2ZPGB 1SFOB 1LT5D 1U3OA 1AEYA 3V05A 2DZ9A 4LFAL 3VYSA 1GUOA 3A8OB 2KE9A 5IE8A 3GTKH 3V7SA 1Z9ZA 3PMIA 3KFUA 2O5JC 4JCVE 5GAN2 2VKNA 3MCAB 2CDTA 1VQNQ 2MGSA 2SEBD 2FO0A 4NKLA 1YI2Q 4JI8L 5D3DA 2H1EA 5CO7A 4ZYSA 2VXEA 4ZAIA 5KIXA 1CZGA 3MXNB 2K57A 4IOAA 4Z8AA 4EQOA 1EYGA 3LGLA 1JRIA 1L0XB 4GLMA 2JM9A 1SF9A 5I9PA 2O9VA 2K5HA 2F03A 5LMNW 4MIUA 3DUZA 1UHFA 4JI1Q 4A53A 4CC4B 1B9MA 3OW7A 4OB1B 1QCFA 4ZN1A 4CKEA 5CR3A 3VJPA 4D8DA 3M5AA 1HH2P 1D09B 3U9SA 3CCJA 3OYEA 4IFDI 4CC3A 3HFNA 1N36Q 2LSSA 4WJ4A 1UTIA 3BE3A 3TSWA 5ELFA 5JPMC 3CQZB 5C5LA 4NL2A 5IGCA 1N33Q 2EVRA 2KVQG 2YTYA 4X65Q 1OXTA 1TWFH 4O42A 1A15A 2FHTA 3ULJA 3N5BB 1X3FA 1KC8C 1H9KA 4KKUA 2VW9A 3I4MB 4MDXA 3A8IE 1G3TA 2D5DA 1S40A 1WTOA 1XYIA 3OSSC 3RERA 4LUVA 2YLCA 5C5MA 4BE0A 3MFYA 2R5AA 2IVWA 2CWPA 3PUZA 4N8X1 2IX3A 3BJUA 3E9IA 4IOCA 3HOUG 1JR0D 4M7AF 1PWTA 2VZAA 4K8IA 4LUZA 3NBHB 1WA7A 2Y4XA 1YIJT 2QGQA 2OTLT 1K28A 2O31A 3QDFA 1MHWC 2ZXOA 4AQYL 1WPYA 3HOUH 4QMGA 4GBQA 2HIXA 2LQWA 2ZTCA 2RO0A 4ULLA 2MWPA 2QDLA 1O9SA 3G6EA 2WAQE 2E2IB 1SXTA 1K8AC 1UGVA 2ZGWA 1KG1A 3KF6A 3SWNC 4DV7Q 4OP0A 1QVFA 1F9PA 4J8QA 1TWCB 1DJRD 3CMEA 2RHQB 2QASA 1M1GA 4BUGA 2K6AA 4DR3L 1B70B 4M7DG 4A3BG 1ZHIA 4Y7NH 1GHKA 2G6FX 3H0GB 4XAXB 5IYBH 3CC7A 1A6XA 2L0CA 1VF5C 2E3HA 4GLAC 2CUBA 4IURA 2QF7A 1VUBA 4M78F 3V8JA 2Z4IA 3MPUB 1TQOA 3LWUA 1JJCB 5LMNQ 5CV9A 4A3BH 1R9TH 4QJFA 1M4ZA 4C0FA 3OB9A 3CCUT 2K7VA 4J9EA 4MDWA 5GMKm 2K03A 2R7ZH 4M77C 4ZGDB 3TSZA 3R93A 4JI5L 2L3RA 2DJGC 6AT1B 3MAQA 1SEMA 2RMOA 3C12A 3G6JB 4PLIA 2I5HA 4HJ9A 1DOLA 5IH2A 2LT1A 4FVMA 1RAHB 5C3EG 1AHJB 1HZCA 1X65A 1Q90A 4F7UG 2LQNA 4JI7L 4LK1C 2LX7A 1PFSA 4RGMA 3JSCA 1NPRA 2EQSA 4ZUIA 1PH1A 2B39A 2WACA 4UP9A 4I7ZC 2ZPEB 2R3ZA 4DV4Q 5C3EH 4LF5Q 1LNXA 1V1QA 1CHQD 2F0UA 3H0IA 3JB9F 1FXXA 4WJWA 1PM3A 1VQ5Q 3C0CA 1L1OC 4DV3Q 2DL4A 3TDQA 1UGSB 2KYBA 2MQHA 1CTMA 2GN5A 2HDLA 2HDAA 1WGSA 4N8FA 5GMKi 2XRSD 1HNXL 4C8QA 3M54A 1RACB 3S16H 3SD4A 3EH1A 1NR4A 5I9OA 4P72A 2QGFB 1IBMQ 3UATA 4C5GA 1RJTA 2MWOA 1QE6A 5GAOm 5A0DA 1CHPD 4QF4A 1CKNA 1CQVA 1TXYA 4J5YA 4OB2B 2PZTA 4DEXA 3ERSX 3IL8A 3KLRA 4DAMA 5IGEA 4LUDA 4A3FB 4BBSB 4M77E 4PJOC 2KENA 3AYHB 1B4OA 2X3WD 1OPLA 1YJWT 1EWHA 4XTCS 5K5PA 3K7AH 2TSSA 2CSQA 3KLSA 3PUYA 5E4XA 2JW4A 3L0OA 4FM4B 5DNFA 3SK8A 3JB9I 2V4DA 4IZ8A 4ELZC 4NP5A 2DMOA 4XU2A 4DK6C 2OTJT 4L6V5 4ZUJA 3L7ZC 1KNAA 4JI2L 2HNIA 3GTOH 1WIEA 5C0XG 2H5XA 2D8JA 1BU1A 2LQKA 2K05A 3NWTA 5ELOA 4AG2C 1D5ZC 3GTGB 4NL3A 1EWCA 2QQRA 3VA7A 1JBMA 2EWNA 1H9JA 1NTGA 2DE0X 2JA8B 4HCEA 3GTMB 5IAYA 5IGBA 2CKZB 3PO3G 4M7AB 2ZJPA 1LT6D 1KDBA 2A5HA 1Q81U 3HFOA 4NMZA 1V1PA 3P7JA 5IP7H 4BBRB 1ASYA 1RDPD 3CXCA 1TS4A 2L15A 2NUZA 5EPJA 4EGVA 2G3RA 2I0QA 2UUBQ 4PJOE 1E1OA 3NMZC 3MA2B 1SAPA 5A2QL 1ZYRC 2WIIB 1JMCA 4GS3A 2FMMA 1NLPC 3I55T 5EBDA 5IHKA 5FU7C 4JI0L 2Q8RE 3A8HB 1D5XC 4ZRZA 4GLKA 4E7LA 2IWHA 1ABQA 3T56B 5LJ5f 3J7AV 4QUFA 4RTTA 2WFWA 1AZPA 2L3SA 4M75C 3ME9A 4RUGA 4DAYA 3A8KE 1WI5A 3PSIA 4XTWA 1Q1EA 2ZXPA 3EGXB 2UXCQ 4IPCA 1XPOA 2CH4W 3D6CA 3EA6A 5JVG3 1SKUB 2EZVA 1D7QA 2AK5A 2RI3A 4M78B 3S3NA 4O0AA 4KULA 3G48A 1AOJA 4BXXG 2CSIA 2KXCA 3J7A5 3A7AB 3SEBA 4XTYA 3S15H 5GROA 1AEXA 4HVUA 1TS3A 3QIAA 2JA7B 1TT2A 4LF6Q 1XPUA 1STAA 4MZMA 2PVOB 4E7SA 1O7YA 2DNEA 2F3WA 4BXXH 2NN6I 3JCMV 2P0QA 5GAMe 4DBHA 1FNWA 5BR8Q 4F7XA 1ZBJA 2DF6A 2ASBA 1F9QA 4JBJA 3S1NH 2DILA 1Q7YC 5C4XG 2HL5C 2AQ3B 4OONA 3CC2T 5TSSA 3I35A 1WZOA 3DB4A 1ILQA 1EIYB 4PL6A 2D0NA 1KC8U 4BWGB 3RBBB 3UI2A 1Y1VB 3AFPA 2CZ0B 1LVKA 5GAEC 3CCRQ 4B3TQ 3GTJB 3HOXB 3F2DA 2VYTA 5IYCG 3MC0B 4FXGC 1VQOQ 3EGDB 1JOKA 1VQ6A 2OF1A 2KHIA 2OQ0A 4LW1A 3QSUA 2LJ3A 5M3MB 1TWBA 5IXBA 1G291 3K57A 3HOYG 2M02A 3GF5A 2QQAA 1QWEA 5JJLA 4C0ZA 3A5ZB 1VQPT 5IYCH 3GTPB 4GKKQ 5GMKe 3UDCA 4YCWA 5KE3A 2X6LA 3LX7A 5ELNA 4EQ5A 2XI9A 1AE2A 1PMRA 5A2QE 3OIQA 4B08A 4C2MH 3ULPA 2QG9B 4C3HG 1K8AU 3HOYH 4JUVA 1K0RA 4RCBA 1GM5A 4IQZA 1B9NA 2E65A 1GUWA 4XU0A 2KI7A 3S14H 3DM1A 3NBHA 3H3VI 3NTIA 4J6XA 4DR1Q 4DUYL 1AW7A 5KCOA 1K8OA 2DVJA 3CD6T 4C3HH 4FSSA 2MOXA 1WJJA 5AFWA 1JWSD 3BZCA 1K4US 5CAIA 3ZYYX 2ZXRA 4Y92A 1IZ6A 1Q81R 2PU9B 3TREA 4YWLA 4LNQA 4F16A 5KNBA 1BF4A 1GCQA 5CKBA 4JRIA 1C8CA 1HXDA 3VYGA 4OMQA 2RHSB 2DRMA 2LTOA 1X3EA 3AEVA 2EQIA 3OQ5A 2UU9Q 2QCPX 3AB9A 4JJNK 3FP9A 1N9WA 2AT1B 2Y90A 3PT9A 1KTKA 4UP8A 1Q82C 3SDZA 3ZEHA 3QB3A 3TS0A 1WTHA 5GAMh 2DRKA 1FVIA 2PMZB 1NE3A 1ABOA 2KBTA 3JCMW 3BZDB 1XTDA 3GNFB 5DLQE 1R77A 4ATOA 1NMGA 3T53B 2KBNA 4X3SA 4J9DA 3PMTA 1FGBD 2K4YA 3QDRB 3T51B 1QKWA 4WF2A 4B3MQ 3FHWA 1YP5A 2KY9A 3M4GA 2LJ1A 4PJJA 1KAWA 4A3JG 1YJWA 4OO1I 3DEOA 4M75D 2D0OA 1X01A 3PGGA 4LDUA 3VU3C 1MJCA 4KY6A 5BN5A 1OTCA 1EIFA 3E1SA 1K9MC 1TWGB 1Q95G 1K0XA 1RAIB 1W6KA 1QLYA 2IW3A 4B9WA 3HG9A 2EE1A 1YITT 4RH6A 1YI2A 2EKHA 2OTJA 1JE5A 4A93B 4R8IA 1F77A 4A76A 1HUNA 2LZ6B 2EYHA 5AYFA 2EYQA 1HQMC 4EMKA 1X9NA 2LP5A 1QVCA 4BDZA 4KV6A 1N8RR 1OULA 2L8DA 2XRQD 4DN4M 1X3GA 2KSSA 1KC8R 2YRVA 1EOVA 2DXTA 1XWEA 3OPOA 2A36A 3S1MB 3TS2A 1B3QA 3CCJQ 2RHYA 2PO4A 1PH5A 2MF2A 1C4QA 3U4VA 2UXDQ 4OGQC 2F0QA 2A08A 2OEOA 2WP8J 5C44B 5CV5A 2DAQA 2L11A 1IBLQ 4KRTA 2VQEQ 2M1HA 4XTXA 1LACA 4N4HA 2E2HB 4JI6Q 2JZ2A 4ZN3A 2ZPHB 2KK4A 2H4OA 3I55A 1BBZA 3CF5A 1WYDA 5L37A 3C3LA 3E3XA 2BOSA 1JB3A 5FLXc 4HIMA 4DBRA 4E2FB 1K73C 1U1SA 1LTID 1SMYD 5IYDH 4DR5Q 2VNUD 4GY5A 2COWA 1K8AR 1JOOA 2CT4A 4KH0B 2PW7A 2E5KA 5E4WC 3VR2A 1A2UA 1DGSA 2RVLA 3E0JA 4FW1A 1SFOH 3INZA 5GJVB 3L2PA 4PV1C 4KKSA 4K2LA 4RKBA 4HEDA 1AWOA 4PQXA 2DFUA 2NVYH 3I70A 4DV0Q 1I4PA 1E24A 2EY1A 4DQ2A 3WXMB 3DXJC 1WXUA 3KLWA 4C1NK 4DR2L 1GXDC 2JQOA 3GD7A 5FWBA 1KXLA 1KLUD 2BE5D 5CV8A 3H94A 3CCRT 3SE0A 1D1KA 1M9SA 4OEMB 2JXBA 4BACA 4ZGEB 4M7AA 2MUYA 1GBQA 2KEDA 4EMGA 3L2QA 3FDRA 3CMEQ 3K81C 5E3FA 4LF8Q 2BE7D 2ATCB 2H8HA 4OB0B 1B1ZA 3KBGA 1BR9A 1Z6HA 2EJMA 3JC66 2RDGA 4P73A 1Y1WH 1HNWL 3CC7Q 2EYPA 3RLNA 4C56C 3DHQA 3CC2A 4OL7A 3J81c 1G3SA 1YHAA 4DR7L 4FIBA 4BY1B 1ZUKA 2ZTEA 2VL6A 3UE0A 4LF9Q 3I4MG 3CQZH 3ICEA 4EDUA 3S17B 1YWPA 1VQLT 4UHVA 4JLIA 4AYBE 3OTOL 4TKOB 3AQQA 2VUMB 5CC4A 1Y8OB 1JORA 2GQVA 2F0PA 3R3OA 3AHUA 3TZDA 3STBC 1NUCA 2HSEB 2RF0A 1M8VA 2W10A 2AMCB 4FCYA 2E74C 3KJPA 4IUUA 3GTOB 1D3BA 1R8OB 1WVLA 3I4MH 5KYYB 1VQPA 2F0IA 3I7FA 4C0GA 4MZPA 1PG5B 4M78A 3PIPA 1GHJA 2QGGA 3MP8A 1VQFA 5IWAQ 5LMUQ 4JLGA 1Q7YU 1G91A 5A0GA 3CCLQ 4JV5Q 3QJYA 4WTOB 4A63B 4OGEA 3SHWA 3L1AA 1H641 3HKSA 1VQ5A 1L0YB 4B9XA 1HPCA 2DPPB 1YNNC 1X6BA 4YHHQ 4OWWB 5JJKA 2KEEA 4KUIA 5D6YA 2F0EA 3PQIA 3W5OA 2B2VA 5GANf 3CD6A 2NVXB 5FLMG 1W2BA 2E2IH 3H0GG 1QCBD 4MHEA 4TQUS 3TP8A 4HT8A 1WX6A 1EIGA 2DKGA 4JBKA 4R1JA 1G8XA 3S24A 4FXDA 5FLMH 1VQ7T 4PJNA 3H0GH 1I4QA 1K3RA 1O78A 3OA6A 1S5DD 3IFTA 1CFMA 1W3SA 4LDWA 2B2UA 4Q5VA 2TMPA 4OMOA 4J9GA 1CA5A 1BBWA 1F1BB 2L89A 1BI3A 5I2MA 2IL8A 2JK8A 4J9BA 4V2SA 1S5FD 2BH8A 3MWYW 3CAMA 1WTQA 1WJQA 1LT3D 1EY6A 3MTSA 4E7ZA 1I50B 4GOPB 2P84A 2F0LA 5GAMj 2HHHL 1J8IA 5M5WB 3CBMA 4DV1Q 2F3VA 3SFMA 4JJCA 2FL7A 4HJ8A 1UJYA 4KI0A 1Y8PB 1BB9A 4QKUA 4IKFA 1HD3A 2Y0SB 1ACMB 4RTUA 3RMHA 2UXBL 1G8ZD 4YY3L 4IFDG 5FU6C 1V29B 5GAOr 1MSGA 1I5LA 3PE0A 4DR6Q 2EBPA 4QT7A 3CCVQ 1YITA 1F2LA 2LRQA 4FT4A 4B6MA 2Z0WA 2G9DA 2D2CC 4B3TL 1V1OA 4HCCA 2M2LA 2IY5B 1GFCA 3X28B 1STGA 4PFPA 1ZX6A 2O2OA 4IFDH 3GTLB 4YWMA 3S1RB 3H15A 3CEYA 3DWQA 4R4QA 2A6HC 2K33A 1PLFA 3NENA 3UDGA 1MMGA 1KIXA 2C0IA 3G7ZA 2ICEC 3KK7A 2DXCA 3R2IA 2MK5A 5GMKj 4A3FG 1MMAA 2ALYB 1YCSB 3RIRA 4BBSG 3VYRA 4E7IA 1UUPA 3NP8A 4HA8A 1VMPA 2RKSA 3P20A 5LJ3e 3L9AX 2HL3A 2RD1A 3M56A 3VUBA 4C8QD 4ID6A 1TUGB 2A28A 2ED0A 4QIWB 3KXTA 3RMSA 3C1EA 1MD2D 1TVXA 1U4MA 1Q8KA 4A3FH 3OYGA 1SNQA 4IJHA 5I6YA 4BBSH 1I94Q 1OI1A 3D4WA 1GRIA 3NEMA 4UDUC 1ZLMA 2QKIC 1KL9A 2XDDA 1BUVT 3PVQA 2Q2TA 1HUMA 3EG0A 2QQ9A 2E5LQ 1UFFA 3ONAB 2QTXA 1MGSA 1ZXTA 1M30A 2N3SA 1BI1A 2LNVA 5DY9A 5CVIA 4IPHA 1JEGA 3TN2A 2KQWA 1KQSP 2HEQA 3X3NA 2ZJQA 1MKHA 2YV5A 2VWFA 2KCNA 1MMNA 1VQIA 3WWVA 4LUOA 3SR1A 1UHCA 3RN2A 1YIJQ 1ZUYA 4M7AG 2HDMA 2OTLQ 1OZ2A 3CCQT 3L3OC 5T1GA 4GNXA 2XG8D 2N49A 1FJGL 3GV3A 3WVEB 3ULLA 4A3IH 4BBRG 4OX9Q 2DGYA 2MPMA 2B63B 3K58A 3LYIA 2JA8H 3GTMH 3F70A 1WHMA 1I4RA 1PRTD 1CZWA 1II3A 2J7ZA 2EJFA 1C0AA 5M5YB 3CCRA 1VMCA 1EUJA 4M7DA 1S4ZA 4PJLA 2RHXA 3EHRA 1K73U 2VASA 2V26A 3LGFA 1NYGA 1CKBA 1PDQA 1PFMA 3TVTA 2M0OA 2FMCA 1EQTA 2K2MA 3BG3A 2ZM6Q 2OCEA 1HR0Q 4IIMA 2KGTA 2K2VA 1UE6A 3ERQA 1M1FA 1QCOA 2FFKB 1LTTD 2O2LD 4N9TA 3LH5A 2M9UA 2ZCFB 3PNWC 5CKHA 3JAMi 4X66Q 4HJ5A 4N9PA 4LF4Q 3E2UA 1IKMA 4M78G 3CKIB 3CCUQ 3P1HA 5JOBA 4A3GB 3CCLT 2A74C 1VQLA 3MHBA 4DEYA 1V8QA 4JI1L 5LJ3h 1QUQB 2BH2A 3CU7A 2L12A 4O2DA 1I6HH 3EN2A 2JA7G 1D1BA 1AZEA 3U50C 4F7UA 1N36L 3V7RA 3VS3A 1DZ1A 2CH4A 1YJ9T 3M7NA 2KT8A 4XU3A 4RCCA 3S3MA 3M58A 4AH6A 1JB0E 4OMFB 2MI6A 2RQVA 5EC7A 1N33L 3E6ZX 4I65A 1PTOF 2JA7H 4X65L 4GLXA 3MP1A 3QHSA 4LD9K 4X62Q 1BCOA 1M3BA 1MBYA 1OXVA 4F88A 3QPHA 1HTLD 4TVRA 4HJ7A 2KOLA 4EMKC 5GAN3 3EJIA 1D0ZA 1Y1VG 2B2YA 1RI9A 3QYHB 3OW2P 3BDOA 3VS7A 4PK4A 1G3WA 3JB9G 1LTRD 4G4KA 4K6LA 3HOXG 1N34L 4RTXA 3D4DA 1PH7A 1M3CA 2DEQA 1Q46A 5HURA 1RAAB 4QCLA 3UF4A 1ZSZB 2EYZA 1Y1VH 5M3MG 1KRTA 4XQJA 2K4KA 1W1FA 4C92F 1JWUD 2IG0A 5KCHA 3JB9H 1SSHA 1TY0A 2EFIA 3CHBD 2AZVA 2UUAQ 1VQ7A 4R4CA 3M53A 1DOMA 4HN7A 1QNKA 1UWVA 1B3AA 2AKWB 3BS1A 4AMCA 4A4IA 2YWWA 1IYJB 2PQAA 5DM7R 1YJWQ 5M3MH 4DV7L 4B3RL 2EJGA 1Q1BA 1EYDA 3MHXA 2BIVA 1V43A 4FL6A 4C0DB 4C5HA 1RLPC 5GAOq 3CCVT 3GTPH 2K75A 4J7FA 2EPBA 5KYYA 1WQ7A 3GTQB 1A2TA 4P71A 3M0RA 3U4ZA 3FDTA 1E2ZA 2EOTA 3UE1A 2OTJQ 4CBVA 2F0JA 3J80c 2YLBA 4EQNA 2E2JB 3URYA 2HQEA 3H91A 1YEZA 1K76A 2WB1B 3RUZA 3O5ZA 2JSOA 1P8LA 4LF7Q 4FU6A 2RA2A 1OU9A 3H0HA 1GUSA 1D5MC 1IB8A 1JJ2P 4EQPA 3HRZC 4H02A 4HJAA 3HP9A 1YZ6A 5DEHA 3QUIA 1H8KA 5I2SA 2BCOA 4CDDC 1FNVA 5ELEA 2RJDA 5FLXL 4GKJQ 1K73R 1H3HA 4JDSA 2B8GA 2CQOA 1AE3A 2YDLA 3CQTA 1D1AA 1STYA 3KF8A 5KRUA 1E0BA 2I07B 5A35A 5JEAG 1Y07A 3R6NA 1R0CB 1EY8A 1N8RC 1IO6A 1SBBB 3NE5B 1XQHA 5CK9A 1A62A 4JBMA 3OYAA 3FRNA 3L42A 1OO9B 2K5WA 1B44D 3TP6A 4KGVB 4DUZQ 5JEAH 1PC0A 3I55Q 1EZZB 4DV4L 4DV6Q 1I4K1 4LF5L 4WJ3M 4KH1B 4J15A 4IUPA 3NWSA 2PPBC 1WDXA 2SNSA 1WJRA 2IJ0A 3KUFA 1LTSD 4DV3L 2V8JA 4HTHA 5CBEE 3Q23A 4ODGA 5KGUA 1NEGA 2V1QA 4GOPA 5G3LF 5CQYA 4A93G 1WOCA 1U5KA 1IBML 1AVZC 1I6VC 1TWGH 4GN3B 3QZ9B 3TP7A 4CRIA 1KDAA 3K5MA 3I73A 5GAN4 5M5XB 5GAGC 2OWOA 2HZYA 2QEJC 3D31A 1I5FA 2R7FA 4HCSA 2F4IA 3J81L 4HIDA 1IREB 4A93H 1PZID 3K0YA 2C35B 2KJXA 2K5DA 2QEXT 3OS2A 5IT9c 2Q2HA 4C5EA 3EIVA 1VQMT 2D0PA 3BVMA 1KD1U 2OAUA 5EKIA 2AIRB 1KAAA 5EPKA 3PO2B 4IIOA 3CCQA 1E2WA 4MTNA 1VA7A 3M0PA 2XWBB 3RLOA 2JNGA 1X6GA 2I2LA 3EFRA 1YHQT 9ATCB 2N88A 2RA4A 5C44G 3EG9A 1IHVA 1TWAB 2VUBA 2GNCA 4RCNA 4E6RA 1JB7A 2B2VC 4U68A 1KHCA 2KCCA 3S1MH 1WXBA 3CC2Q 3CCMQ 4LWCA 1PTOB 2YT6A 3RN5A 3CW2C 1JOQA 2F0DA 5CR2A 1H9MA 1OXSC 1PRLC 4DA2A 2DLPA 5C44H 4B3SQ 3OS1A 3AMUA 3OOCA 2K01A 4A3EB 5HCKA 2O01E 4A4FA 2O4XA 2E2HH 2OI3A 4JW0A 1N32Q 3VV0A 4FYXB 1HNZQ 5FLXE 2LS01 1FMVA 2EW3A 2BDOA 2OJ2A 2ZM6L 3H3VH 2K5LA 2DK3A 3RR6A 1WCMB 1AFPA 2B2UC 2EQKA 5J3BA 4DK3C 1AZGB 2RF4A 1PSFA 1VQPQ 2GTOA 1C48A 4BB7A 1TSFA 4C92B 1BCPC 3CCLA 4HMIA 4E47A 2UUBL 2KT1A 4ALPA 3QO2A 1H95A 2EGEA 4RG1A 2BKDN 2E10A 4FSXA 3SGIA 2R93B 3FC3A 3EBEA 2OAWA 3QO3A 1BVSA 4RKLA 5LJ5e 2K3YA 3P8HA 2SEMA 1YJ9A 3A56A 2X9HA 2MFIA 5LJ3j 1YHBA 4OIJA 2E1HA 2JM8A 3UWNA 1RIPA 4MTKA 1U5SA 3T1YQ 1R0BG 1WQWA 1PNJA 3CD6Q 5E7NA 2NZHA 2KHSA 3UDIA 2NUTB 5KEEA 3OWEB 2UXCL 1AZQA 3FPUB 3LWIA 4X3TA 4OB3B 4AFUC 4M77F 1QQJA 4XQNA 4DV0L 1JT8A 4BY1G 3IFDA 3EAEA 5KYWB 1KQSS 4GLVB 1O75A 4M8AA 3M0TA 3J81E 3A8MB 4JVZA 1M5Q1 3GP8A 3LH0A 2L55A 2DL7A 4JZ4A 4IUVA 4Z89A 3M7GA 4KN7C 2VUMG 3HOWB 4M7AD 2FVUA 2F0SA 4TRDA 3OYDA 3THKA 3D4RA 1MNEA 3FEWX 4BY1H 2GFAA 2LXJA 4K14A 4X3UA 3CP0A 3M9QA 1QZHA 2VV5A 2VUMH 3S17H 3VS2A 2F52A 1YJNT 4Z88A 3D0FA 2LNHB 2FG0A 4FYWB 2C06A 1NM7A 4WFN3 1K83B 4L5GA 3TRZA 1W4SA 3C4SA 2B3GA 3EFSA 2IHFA 2RCFA 4KHZA 2M51A 4OMNA 5GANd 1QUQA 4A3KB 2ECZA 4LNPA 3CCVA 1B53A 2CYZB 2FXQA 2HCCA 3E5SA 2F2XA 3VUZA 4AG1C 5C6SA 1RAGB 1CT1D 1HJPA 4DOWA 3HRUA 1NBEB 1PRMC 4KGZB 3K8AA 3NQTA 4L59A 4BE1A 1YITQ 1UECA 4HT9A 5C0XH 3I4OA 2M9VA 5EQ0A 3UA7A 1TS5A 4J6HA 1KD1R 4YWKA 4M78D 2L1BA 1SRUA 4ORZA 1M90C 4PJOF 4R4IA 2A7YA 3JCMe 4X9DA 2HQXA 5FRNA 1QJOA 1RCVD 1A3TA 3IQLA 3PO3H 4GNXC 2B2TA 2WAQB 4WORA 1IBKL 4QQDA 2NVXH 5JVH3 2ABLA 2RCNA 2H3EB 5LJ5h 1EFID 3RR5A 1XJVA 2RI2A 1LLRD 3RD4A 1V9PA 1P92A 2E41A 2EJFC 3U9OA 1C7YA 1HHVA 3H0FA 4RMOA 1PVOA 5CQXA 4DR1L 1QWFA 3FB9A 2PCFB 4CKCA 1DD2A 1KJWA 3DKMA 3J81j 4XU1A 2NUPB 3UA6A 2OT2A 1YNXA 4LD6A 2VGMA 4A3MB 1S1NA 5I11A 2IT1A 1TWHH 2K52A 1TS9A 1XX8A 1NNXA 2RDFA 2DEUA 2L5QA 4JI4Q 3OW2S 2DERA 2Y0SG 3QJ6A 3JB9D 2UUCQ 1BQQT 1X2KA 4ZTJA 2IX0A 5L23A 1BKBA 2MCNA 1I50H 2UU9L 4K11A 1LV9A 4MN3A 1AWJA 2EPDA 3I5RA 1YIJA 1BCPD 5EKLA 2OTLA 4DPGA 4G7ZC 4FF3A 1E3PA 2R58A 2EXDA 3MXNA 1CKAA 4XYQA 5I22A 4KHPQ 2ZPBB 1N8RU 2EGCA 2AKLA 1GXIE 1C1AA 3M0UA 3CCMT 7AT1B 2CZ1B 5GAN8 1K0SA 5CMDA 4B3ML 2JTEA 3SWNB 1UEAB 2KQ3A 3DM3A 1LTGD 4OVAA 3T13A 3GTLH 3S1RH 2QEXA 3K7UC 4ZTFA 1PH9A 4J83A 4M75F 1VQMA 4L63B 3OHXC 5HKCA 3MEAA 5C4XH 4JYAQ 4M75E 3EG1A 3QWXX 1TKWB 3BYYB 4QY7A 5C3WA 3W1GA 4DBQA 2OX7A 1F2YA 1YHQA 2VB3X 2G9HD 4K0KQ 3D3RA 2D8HA 3C2PA 1SMYC 1TU0B 2XICA 3JCMh 4XYOA 1JJ2S 1NCVA 1WD0A 4ZKBB 3MO8A 1PXUA 2EKOA 3CCUA 4JI2Q 3SB2A 1CM9A 5GMKl 3GP7A 4C5IA 4M77B 2AWNA 4NDXA 3NHHA 4A75A 4LFBQ 1FWZA 3HFZB 2SNMA 3VS6A 5GAHC 2Z9HA 1VQLQ 2PZ1A 1QOHA 2J0TD 1VYUA 5F2DA 2EY6A 2F2WA 4ZCKA 2KUMA 2DL5A 2L5TA 3P75A 4XT1B 1B50A 3OYKA 1GL5A 3U23A 2R7DA 4FF1A 2UXDL 1SJHD 3J7ZC 4R8NA 3UT1A 1EY9A 2BE5C 4K5WA 1YCYA 2EJGC 4F7UE 5FW9A 1H9SB 5I4DA 2RJFA 1IBLL 3EGUA 1SROA 2VQEL 2HCKA 1A3UA 2CP0A 4I7AA 4DAVA 2B63G 2HUGA 4DGZA 1K9AA 3HTRA 4XQ3A 3Q1JA 3FRPB 1L1OB 3HOVG 1QP3A 3R6OA 3L2UA 1YNJD 3LX0A 4JI0Q 2VS1A 2WSEE 3DMUA 2JTMA 1WFQA 1SYEA 4DR5L 2B63H 4DV5Q 1M8MA 2JOYA 1J5EL 5ISRA 2VQFQ 2X35A 2JMCA 2QA4Q 4KD3A 3VR5A 5GAOl 2NYSA 2Z4HA 3SK4A 4ME3A 3M0SA 5IY0A 5I2YA 1G3YA 4PJOB 3JRZA 3D7SB 1VQ7Q 2XVSA 1SN8A 2R61A 1U8RA 1EY5A 3X26B 3M9BA 1U06A 2RHUA 3MP6A 4A3GG 1CKMA 4IJLA 2QAZA 5IN1A 1YWOA 3BDLA 4M7DD 2F0TA 1EFNA 2Y4YA 5GAMg 2VXWA 1TUDA 4KY7A 1FL0A 4P74A 1PV4A 4XT3B 1TWFB 3EHQA 4J8OA 1SE4A 2E2DC 4IO9A 2DL8A 1R4PB 3U58A 1PH4A 5GADC 2HCIA 4A3JH 4A3GH 1X2QA 2K7AA 2Z1CA 1IYVA 1YJNA 3L2ZA 4PG3A 3HOVH 4M4ZA 4C92A 5AJ3Q 2BTTA 2N78A 2PZWA 3N6RA 1G2SA 4DXFA 1CKOA 1CK1A 1BNZA 2ZPIB 5EGTA 1SSOA 4C3IB 1QW1A 4PMBA 3H41A 4HXJA 4EVOA 4LF9L 1TR5A 1UEBA 4QUCA 5J22A 4BS9A 1X3QA 4GZYC 3EFOB 3A8JE 1JJGA 1U4LA 1Q12A 4RGNA 2DD4A 2A37A 2JUFA 4R56A 2K9GA 4DNRB 1I8FA 4X1VA 1NR2A 2M00A 4PMCA 5BN4A 5C4JB 2LCLA 2AHJB 2D0QB 4LFCQ 1VQ4Q 3GBQA 5CYUA 2O9SA 2DJZA 4PLLA 4A4HA 1EYAA 2F0NA 1D2BA 3RKXA 3G7LA 1X55A 4CGYB 2JT4A 2VVKA 3MJXA 5IWAL 5LMUL 3S3OA 4OMLA 5KYWA 1U9RA 1I07A 1KFZA 1FYCA 3NTKA 3CPWP 2I5LX 4DR3Q 4LDVA 1S5CD 2AZSA 5FU7B 4AFQC 2DETA 1SYBA 2F0MA 1VQKT 5JJZA 3G1JA 4JV5L 4C3JB 1QVGP 1EL0A 5C0MA 1JU5C 3EQLC 2B86A 3I2ZA 1EU4A 1PKSA 2JJ9A 1VQAA 2QW7A 2K04A 4YHHL 1XJWB 3M4OH 4M75B 1SEBD 3JCMQ 3NHNA 1LOJA 4PJMA 5LJ5j 1E2VA 1R9TB 4P2CB 4DUYQ 1SYCA 1M2VB 2E6ZA 1UUEA 1IHZA 5IT9L 2R7ZB 3JV3A 4HVWA 5CV4A 2V1CC 5C4ZA 1MMDA 1M90U 1FGUA 2CHBD 2WB1G 2L0AA 3V8KA 2X6GA 4ILWA 3S6WA 1X3PA 4DAPA 3GTQH 2DIQA 4RTVA 1VQ9T 2ID0A 2HKQB 1ESRA 1MSHA 1ESFA 2Z0SA 1EEFD 3HOZB 3RDVA 2PQWA 2P0KA 4BY6C 2DO3A 2E2JH 4DR4Q 2YHTA 2CP2A 3F2CA 4KK7A 5FO7B 1TG0A 1AP0A 2RQTA 1B34B 1PH3A 2VGNA 1IGQA 3CCQQ 3S1QB 2SOBA 2DXUA 4GN5A 1UDLA 1W70A 2XGTA 8AT1B 5FO8B 4C8QC 3CCMA 2XD0A 3BDUA 3TSSA 4EX5A 4JI3Q 1GO3E 1UGRB 2JN0A 1RTNA 3E9FA 3KLSX 1TXQA 1KLGD 2DTHA 1SPKA 2K5FA 3Q6SA 3X24B 3PV0A 1VQCA 2R6GA 2RBMA 4R9WA 4EMHA 1G5VA 3PUVA 3OS5A 2J7IA 4J9CA 4P75A 2DJQA 2A68C 2NWGA 1ILPA 2PUKB 5LL6S 1RI0A 1EZ8A 3DLLA 4RHRA 4DNIA 5FJ8G 3VR3A 2N55A 2YU9B 2GTJA 3EGXA 1M1KU 3M85A 2JA5B 4IPDA 2MJ8A 1J6QA 5GAOn 2F2VA 4OF1A 2X51A 4Z02A 1GKHA 3HKZE 4JPBW 1BCMA 1X69A 5GAN5 2WV6D 3SHLA 1PH6A 4POFA 5FJ8H 1GJXA 4A4GA 3AT1B 3M59A 2AQ1B 3TP5A 5FROA 2JEBI 2K14A 3SK6A 3E9GA 1IW7C 2CP6A 3SEMA 2MP1A 5GQOA 2FEIA 4E7KA 1PRTC 2OXPA 1EFWA 1YJ9Q 1XNRQ 4C8QF 4M1UB 5M5XH 3PO2G 1NJIC 3WVDB 1SE2A 4FXKC 4IALA 4C8QE 1I94L 2QA4T 4FW2A 1CA6A 5IT9E 2CT3A 2CVRA 2NTTA 3D8GA 1VQEA 3UDXA 3ITPA 2RB6A 1TWCH 3SWNA 2CQAA 3M4YA 2XU8A 1EQVA 1MIUA 5DM73 3PO2H 4J9FA 4RHSA 2DTIA 2X4JA 4ABNA 3AFQA 5DM63 5J26A 4JBWA 2DUDA 3I91A 3EGDA 2BZYA 1TWAH 3KDFB 4A3EG 2K3BA 1QMCA 2B2TC 2HBPA 1PTOH 2K5NA 1PFNA 3E9HA 4L6TB 2JMAA 3BFMA 3CCST 3X3MA 1PHJA 1C6VX 1X54A 2X4XA 2HKNA 4J7IA 1WCMG 3I4NB 3I5SA 2EGAA 1KIKA 1DYQA 1W6JA 1VQGA 3RNUA 4A3EH 4QQBX 1SR3A 4OX9L 4M77A 2RM4A 2F0GA 4C92G 4YCVA 3G4ST 1XPRA 1M90R 3Q24A 1WTVA 4H44C 1WNLA 1IXDA 1WCMH 2R93G 2EJ9A 2C0OA 2HD0A 4OIKA 2E8GA 4MZ9A 4PMWA 1EEID 2GBQA 1VQHA 1H9SA 3NGPA 1I4HA 2YTXA 4XXEA 3DWPA 3E19A 3CCET 1MGQA 1VQ4T 3WOFA 3V96A 1HR0L 2R93H 5JJIA 3PF4A 3M3YB 3Q22A 2YUNA 2K3XA 4JJDA 3EVQA 4DR7Q 4X66L 5I21A 4LF4L 1UAPA 5KYUB 4DKAC 4BE2A 1FMKA 4QVZA 1T3SA 2LKVA 1X6OA 3L2VA 1OOTA 2E75C 3L2RA 3HOWG 2RJCA 3KF6B 4Q0FA 1KD1C 4CC7A 2SDFA 1N9SA 3C46A 2EYLA 3JAMc 2XNAC 1ZSGA 3HRTA 1NLOC 2DY8A 4DFAA 1VQJA 4PJOA 1M1KR 2LXKA 1Q3LA 2QXFA 4OMMA 3HOWH 3A0JA 3HHTB 4RTZA 1HTPA 5JPNC 3RNJA 2A68D 4NS5A 2LQ8A 3SVMA 4X62L 4RKUE 2EQUA 4JZ3A 1D1IA 4PKCC 5KYXB 2QI2A 4YTLA 2F4VQ 1ET9A 1UB4A 4AYBB 4A3KG 1XMOQ 2EIFA 1PYWD 4G57A 1BIBA 2CP3A 1DXMA 1EWIA 2A1AA 1K83H 3OIPA 2R57A 4O1NA 4ZK9B 2I5MX 5GAN7 2DX1A 4A3KH 2QQSA 4U673 3GTGH 3HKZB 2ICIA 3H09A 4AIMA 1IW7D 2PYKA 4HVVA 3VRZA 2KCMA 3EFOA 1Z9QA 1LTLA 2WAQG 4FO2A 4QB4A 4R4OA 4RGTA 4BY6B 1A3VA 2F0HA 2LMCB 2EY2A 3DLMA 1GCQC 4BBRH 2QEXQ 2K5VA 2KEAA 1O7LA 1XMQL 2Q8IB 1VQMQ 2KA7A 1EY0A 4HSVA 4CKBA 2CCZA 1UG1A 2DL3A 4LMQD 5CIUA 4ELYC 3MEFA 2C0TA 1EY4A 1YHQQ 1GUNA 2OQKA 2PI2A 5J39A 1G51A 1HCZA 4WRDA 4PZ8A 4XIGS 4A3MG 4A54A 1ENAA 2PNRC 1EQQA 2HMAA 1CKNB 1DCZA 2MYSA 3LW5E 2AUJD 2P0PA 1AN8A 1I4XA 1OXXK 1QVFP 2CW0D 4CDFC 4E6IA 4A3MH 1Q86C 1A8VA 2LVMA 1OZ3A 4GKJL 1E6HA 1BI0A 3F8TA 3LWEA 3CPWS 1DJ7B 4RAUC 1FX7A 4D8KA 2ZTDA 4DV2Q 3IAYA 1L2FA 2PVGB 1QVGS 4L5TA 1FR3A 1NEBA 4AT1B 5LJ3g 2PTKA 5KNDA 2RJEA 1AD5A 2K6DA 2XDPA 1BO0A 2AUKA 4DV6L 2BUDA 1JXOA 1MUZA 1X75C 4JRPA 1JC7A 1Y7XA 3T9NA 2F0FA 3LGJA 3ZJYC 3PUXA 1KRSA 1QZGA 4NXMQ 1B34A 1RAFB 1QNUA 4TSSA 2EVBA 5LJ3f 2RHZA 2QA4A 3OS0A 2C9OA 1CSQA 2D6FA 1JQYD 5FOBB 3CRKC 4RA8A 3CC4T 5IODA 2RK2A 1F2ZA 3GTJH 3HOXH 3S2HB 2RQWA 1V1PB 2JXMB 1OQKA 3AU7A 3LWHA 2HT1A 4OHJA 2KXDA 4M77G 1PSEA 2DN8A 2DM1A 2NZOA 2WKCA 4J9HA 3CRLC 1D1CA 3JCMc 4HCKA 2JYOA 5D65A 1IGUA 1RHPA 4DF7A 5KNCA 3RUXA 4BY7B 2B8AA 2NB0A 4JG2A 1XNQQ 2RH2A 3CCSA 4QVCA 3M4PA 4K6DA 3CMAT 4X3KA 1K8GA 3TMEA 2AWOA 1ASZA 2MMPA 1PH8A 1NJIU 2LY7A 1H3ZA 4AFSC 3E0EA 1YJNQ 2RI5A 5T1IA 4DAYB 3OYMA 2NUCA 3X25B 1SNCA 3G4SA 1PZKD 1TU2B 5LMNL 1MV0B 1M3AA 5FU6B 4A4KA 4JS5A 3OYFA 1WHJA 2Z6KA 3T1HQ 2J6KA 5CCAA 3OBYA 1IHWA 3K5LA 2HQLA 3OWFA 1FNUA 4B3SL 1H92A 1PD0A 2B8FA 4X9CA 4PFZA 3H6MA 1N9RA 1UGPB 2NVYB 2LX9A 5EG2A 4RG2A 2DYBA 5L8RE 3G71T 3CCEA 1VQ4A 1N32L 4BI4A 1UE9A 1S72T 2HD3A 2M0YA 1HNZL 1XOVA 5CV7A 2PZUA 1A0IA 5LHY1 1ONLA 2RK1A 2QILA 3S2DB 4M7AC 3HZXA 1KK7A 3BU2A 1TUCA 3I9QA 4X64Q 4EPCA 1UJ0A 2E6NA 4PJOG 2NBFA 2PNIA 3MEVA 1I3QB 2IIMA 1Y1WB 2A19A 1KNEA 3KDFA 5BN3A 1XXGA 4A3DB 3GNGA 1GOZA 2NN6G 1KQSA 2EDGA 4LAAA 2JP1A 2IPOB 5IXFA 5GAMd 1NG2A 1NY4A 5D3IB 4RFBA 2XWJB 3T1YL 2F1LA 5KE2A 2RQUA 2KYMA 2YSQA 1PTOD 2K5QA 1U0LA 2NN6H 3QZ5B 1XNIA 2RQXA 3KYHC 1BBXC 2L3PA 3CXCP 4HAEA 1Y69U 2VY3A 1NYFA 1NZ9A 4FYYB 3DEPA 1NAPA 3EH2A 4C3IG 4M78C 1HSQA 2A69C 4OGCA 3VS0A 4RTWA 1L0WA 2K28A 3OYHA 5FWCA 1N34Q 3ZBDA 2DJFC 1X32A 2RN8A 4D6WA 4NPSA 4C3IH 2FPEA 1S5ED 2C5CA 4M7AE 2A8VA 2IHEA 2COYA 3F1ZA 1LJOA 3GV6A 4NXNQ 2KNBB 4C92D 3A8GB 4LE9A 1SDFA 1MNDA 2VC8A 5GAOp 2JE6I 2MHVA 5KYUA 2ZT9C 4NB3A 1U4PA 1JICA 4IUQA 1E22A 1SNDA 1JQQA 5C4JH 5IYBG 1LTBD 4C3JG 4ZKCB 3DWAA 4B3RQ 4LFAQ 1KQ2A 2K79A 2KRSA 1HK9A 4M75G 1VQ8T 1UNSA 3R8BA 2CFMA 3I8ZA 4LN2A 4JI8Q 1VQ6T 1Z47A 4C3JH 1O7IA 2R7ZG 3HRSA 1V1CA 1NJIR 1FYNA 1SNOA 2WSFE 5KYXA 2FB7A 4M78E 3VS1A 3VYUA 3SXHA 1EQRA 1SHFA 1V76A 1ZQ1A 3OYBA 4CJ0B 3PIO3 2N8NA 3OW2A 1GUGA 3HOZG 3VYTA 1Y96B 3M57A 4RGOS 2HIVA 3C94A 5AT1B 2DNUA 2FINB 3IRBA 5KYNA 1D0XA 2KHJA 4F14A 4RTYA 2DA9A 4QVDA 4LUEA 4H13C 4QQ6A 3HOZH 2EYMA 4OO1G 2A73B 1BK2A 1SHGA 4ESRA 4ANJA 4XDXA 3K80C 4JI4L 3V2TA 4EMKB 4K2KA 1LM0A 2UUCL 1VYVA 4CDCC 2MO1A 3S1QH 1STHA 3FEOA 2LC4A 2QDBA 4OO1H 4F04B 1QCNA 4LF6L 3V7CA 2COZA 1Q86U 1PZJD 3H9NA 3ZFJA 3VYHB 3CC4A 5G3LD 3MZ5A 1TS2A 1H9RA 4JOIA 2GCXA 2JA5G 3URGA 1BCPF 5BR8L 3RZDB 3M55A 4KJOA 4PNOA 3MEWA 3T4AC 4AQYQ 4KHPL 1RUWA 5FK9C 3EG3A 1CQFA 1IL2A 2V8KA 1UE1A 2MIOA 2FHDA 3B6YA 1JJ2A 3QWYA 5ECAA 3EG2A 3PF5A 2JA5H 2YU9H 2HSPA 2YXYA 3OBWA 1WHKA 2JA6B 1NSNS 1K8MA 3OYCA 5IP9G 1VIFA 2D9TA 3RLFA 4BA2I 3QXEB 4KLKA 3CMAA 4JYAL 1WJSA 2F3IA 2VB6A 1YNJC 1P16A 4K0KL 2F0WA 2F1MA 1VQNT 2PVDB 3FJ5A 3K5NA 5IP9H 1YI2T 2XSCA 2EQJA 1WHHA 2A69D 3JAML 5IOCA 1JCKB 3HEJA 5ELCA 4GKKL 1DM0B 5HGTA 3FKIB 2NVTB 2DBMA 1QVFS 3OYJA 1ICFB 4FT2A 4LFBL 2BZ8A 3PIP3 1MJEA 5D6WA 1K1ZA 3I56Q 4JI5Q 2ROTA 5IP7G 4A3IB 4H0LC 4DU9A 3G71A 3QG1A 2D62A 1S72A 1ZSZA 4PNYA 2ES2A 3REBB 1PHTA 2FPFA 2H3JA 1PKTA 4M7DC 2BA1A 2PMZE 2KMTA 3EROA 4JI7Q 4JRQA 3I4NG 1N27A 4IFDJ 3VA5A 4DV5L 2KRMA 5LJ5g 5CGKA 4G7HC 3MEHA 4POGA 5M9OA 3ND9A 1VQKQ 2RHIA 3TU4K 3UDFA 2DBKA 1LCKA 3OSVA 3RZOB 3I72A 2MPXC 1BOSA 2RSNA 5E1FA 2L2PA 2GA4B 3I4NH 2F0VA 4HR7B 1PD1A 3H3VC 5M5WH 3N52A 1I5OB 2FRYA 2B2WA 1HNXQ 3A7LA 2GQIA 1M1KC 1TIID 2FZKB 1PA6A
chains in the Genus database with same CATH topology
2VQFL 2FYKA 4MMLA 5DLOA 3P8DA 1D3BB 4M77D 4CI0C 4A3LG 3NFCA 4E7JA 2JVVA 3HSBA 3M3YH 4M7DF 1VQBA 4QL5A 4A3LH 4M7DE 2MNAA 4JRKA 2GFUA 4OWTB 3MEUA 3VKIA 5AJ3L 1T9HA 3JAME 2PI2E 3PGZA 1HZAA 2JJQA 3RMQA 1BYMA 2XHCA 4J6WA 1HZ9A 4AYBG 1VQ8A 1GVPA 3PFSA 1Y14B 4X34A 3JCMg 2ATWA 3QYGB 2KAFA 4F7UF 1S3OA 4LFCL 2QQBA 3J80i 4PJOD 3V8LA 3LLRA 4LDYA 3TEEA 3GOXA 3HKZG 1NPPA 4JI6L 3JCMf 1IBKQ 4RMFA 3JCMb 1QP2A 1N6AA 1VQ5T 2Z6KC 3BY7A 3CXCS 4XTVA 5M5YH 2DTOA 1UE7A 4C8QG 1VS0A 4XTZA 5D6XA 1SSFA 2ZPFB 3JCMX 2K5IA 2CWAA 2Q2IA 3RESA 5K36G 2MAMA 2LT4A 4DR4L 2CS7A 1VIEA 4LF8L 1C9OA 1MHNA 3FJPA 5A0LA 5GAMf 4JI3L 2MO0A 4GOPC 4TVAB 4ZGJB 1VQDA 3JB9J 5LJ3d 4YCUA 1Y96A 3I56T 3J7AF 1YBYA 2JA9A 3PCOB 2EQMA 3O8VA 1VQNA 5GMKh 3A8LB 4HCBA 4GNXB 3META 3GIBA 2GF7A 2E70A 5C0XI 4UC4A 1LYLA 5GANe 4BY7G 3S2HH 4M7DB 1XNRL 2LDMA 4N0AA 4BY7H 5IYDG 3PIOA 4KUDK 4VUBA 3TQYA 3QBYA 4APVA 2Y0SE 1G6PA 3C95A 5GAN6 3GLXA 2AHOB 5CKEA 4UP7A 1B8AA 2DVEA 5JEAJ 2PUOB 3TEHB 4JS4A 3ER0A 1J5EQ 2YYZA 4MNOA 4F7UB 3ASKA 3PUWA 5HK0A 4DV1L 4GN4B 1Y1WG 4A3DG 3S2DH 3OYLA 2F69A 4DR6L 2K50A 4KBMB 2ZJRA 4QIWE 1VQOT 1I3QH 4A3DH 1RL2A 3H8ZA 3P8BB 3DB3A 4JOIC 4OXPA 4QGUA 4P5NA 1SMXA 5GANh 2E5QA 2PQAB 3OYIA 1CUKA 3BZKA 2QDYB 4XK8E 3A5UA 1KQ1A 4A4EA 4OWXB 4L5QA 3UPUA 1IXRA 5KH6A 2XTIA 3K0XA 2E5LL 3OYYA 5GANg 1B7YB 4Y28E 4HCZA 2F4VL 1XMOL 4N4IA 3F2BA 2V8IA 3CBPA 1NBWA 2E64A 2XIDA 3KF8B 2NLUA 1NE8A 1OXUA 2E12A 4DOVA 3PTAA 3J81i 1BBUA 4DR2Q 3KOJA 4PZ6A 3QIIA 3OMCA 2JTFA 4KT0E 4C0DC 3FIFA 1HNWQ 1OYXA 3L2WA 3OMGA 1NMFA 3HPWA 4HIKA 4R55A 1I81A 3GDEA 3CPWA 1L1OA 5EAYA 2A3LA 4Y91A 3I56A 1QVGA 4X6AH 1BIAA 3CPFA 3OTOQ 4L5RC 1E1TA 4IUTA 4A3CG 2CZ6B 3Q8DA 2XDBA 2BA0A 3BW1A 4DA4A 1Q82U 3CCJT 4J6YA 2Q2UA 4IPGA 1BI2A 2X4WA 3H6ZA 2CKKA 2DXBA 4QQGA 4DV2L 5C0XJ 1HR0W 4A3CH 1VQKA 4HKEA 2YTVA 4UY8C 3TCJA 2F5TX 2JA6G 3RZDH 1TH7A 4UPAA 2PNHA 5HGQA 1K9MU 4NXML 4O5VA 2X4YA 1GD7A 2O4XB 5FRMA 2CGHA 2JA6H 2XKOC 2KCTA 2UUAL 2ZZDA 2WB1E 1VQ9A 2LCCA 3FKIG 3STBD 4NOYA 3G6ET 3FLGA 1SE8A 4PZ7A 3JCMJ 1W2BS 3NELA 4A3IG 3JCMP 2GVBA 1XNQL 1QVPA 2VXFA 2F5KA 3CMET 4FDBA 2JA8G 3FKIH 2NVTH 4QW2A 4C8QB 3VDYA 3CC7T 3GPLA 2DD5A 2HHHQ 3RKWA 2M16A 1CSPA 1X56A 4LF7L 1PYBA 1UE5A 3KJOA 2UXBQ 5LJ5d 4BA1I 4YY3Q 3T1HL 4M75A 4JC0A 1VCIA 1PYSB 3A74A 2R5MA 1UGQB 1HZBA 1VQOA 3GO5A 2KDSA 2EAYA 4N4GA 2R92G 3RZOH 1A63A 4Q5WA 1YVCA 4Y52H 4R4TA 3J80E 1SLJA 4X64L 4E7HA 4II1A 2DIGA 4BI3A 4C92C 4DUZL 2R92H 2CZ7B 4MMKA 2B29A 1Z9FA 4RG8A 4BDYA 4L5SA 5HK3A 4MZTA 1LUZA 3OY9A 2GVAA 5GANj 5CKDA 2IX1A 3X20B 1E7ZA 2HAXA 3M4QA 4LDXA 5CKFA 1Y71A 4BI8B 3W1BA 2XK0A 4XTUA 4O6JA 5H1SE 3HL8A 3NTHA 1AH9A 3RKYA 2WSCE 3OYNA 1KHIA 1ZBXA 3QKJA 2DZCA 4ME7A 4BD3A 1PH2A 1D8LA 5M3FG 2NVQH 1Q81C 3JCMd 4NXNL 3CBOA 1FJGQ 4HIOA 5HY6A 1U1TA 5M3FH 4C92E 2P4TA 4N0AC 2ZPGB 2DZ9A 4LFAL 3A8OB 5IE8A 3GTKH 3V7SA 3KFUA 3PMIA 4JCVE 5GAN2 3MCAB 4JI8L 5CO7A 2VXEA 3MXNB 2K57A 4IOAA 1EYGA 3LGLA 1JRIA 2K5HA 5LMNW 4JI1Q 4A53A 4OB1B 4ZN1A 3VJPA 3M5AA 1HH2P 3CCJA 3OYEA 4IFDI 3HFNA 1N36Q 2LSSA 4WJ4A 4NL2A 1N33Q 2KVQG 2YTYA 4X65Q 1OXTA 1TWFH 3ULJA 3N5BB 1X3FA 1KC8C 2VW9A 4MDXA 1G3TA 1S40A 3OSSC 3RERA 4LUVA 2YLCA 4BE0A 2R5AA 2IVWA 2CWPA 3PUZA 3BJUA 3E9IA 4IOCA 3HOUG 4M7AF 2VZAA 4LUZA 3NBHB 2Y4XA 1YIJT 2QGQA 2OTLT 4AQYL 1WPYA 3HOUH 2HIXA 2ZTCA 2RO0A 2MWPA 1O9SA 3G6EA 2WAQE 1K8AC 2ZGWA 1KG1A 3KF6A 3SWNC 4DV7Q 4OP0A 1QVFA 3CMEA 2RHQB 1M1GA 4BUGA 4DR3L 1B70B 4M7DG 4A3BG 1ZHIA 4Y7NH 4XAXB 5IYBH 3CC7A 4GLAC 4IURA 1VUBA 4M78F 3V8JA 1JJCB 5LMNQ 4A3BH 1R9TH 4QJFA 1M4ZA 4C0FA 3OB9A 3CCUT 4MDWA 5GMKm 2R7ZH 4M77C 4ZGDB 4JI5L 2L3RA 3C12A 4PLIA 2I5HA 4HJ9A 2LT1A 5C3EG 1AHJB 1HZCA 1X65A 4F7UG 4JI7L 1PFSA 3JSCA 1NPRA 2EQSA 1PH1A 2WACA 4UP9A 2ZPEB 4DV4Q 5C3EH 4LF5Q 1LNXA 1V1QA 3JB9F 1FXXA 4DV3Q 1L1OC 1UGSB 2MQHA 2GN5A 1WGSA 5GMKi 1HNXL 4C8QA 3M54A 3S16H 3SD4A 4P72A 1IBMQ 4C5GA 2MWOA 5GAOm 5A0DA 1CKNA 1TXYA 4J5YA 4OB2B 4DAMA 3ERSX 4M77E 4PJOC 2KENA 3AYHB 1YJWT 4XTCS 3K7AH 3PUYA 3L0OA 4FM4B 3JB9I 4ELZC 4DK6C 4XU2A 2OTJT 4L6V5 3L7ZC 4JI2L 2HNIA 5C0XG 2H5XA 2LQKA 5ELOA 4NL3A 2QQRA 1JBMA 2EWNA 1NTGA 5IAYA 2CKZB 3PO3G 4M7AB 2ZJPA 1Q81U 3HFOA 5IP7H 1ASYA 3CXCA 2L15A 2I0QA 2G3RA 2UUBQ 4PJOE 1E1OA 1JMCA 4GS3A 3I55T 4JI0L 5FU7C 3A8HB 4GLKA 4E7LA 5LJ5f 2WFWA 4M75C 3ME9A 1WI5A 3PSIA 4XTWA 1Q1EA 2UXCQ 4IPCA 1XPOA 1D7QA 2RI3A 4M78B 3S3NA 4O0AA 4KULA 3G48A 4BXXG 3J7A5 4XTYA 3S15H 5GROA 4LF6Q 1XPUA 4MZMA 2PVOB 4BXXH 2NN6I 3JCMV 2P0QA 5GAMe 5BR8Q 3S1NH 2ASBA 4JBJA 1Q7YC 5C4XG 4OONA 3CC2T 3DB4A 1EIYB 4PL6A 1KC8U 3AFPA 2CZ0B 5GAEC 4B3TQ 3F2DA 2VYTA 5IYCG 1VQ6A 2KHIA 2OQ0A 4LW1A 3QSUA 1G291 3HOYG 3GF5A 2QQAA 5JJLA 4C0ZA 3A5ZB 1VQPT 5IYCH 4GKKQ 5GMKe 3UDCA 4YCWA 5KE3A 3LX7A 5ELNA 4EQ5A 2XI9A 1AE2A 5A2QE 4C2MH 3ULPA 3HOYH 1K8AU 4JUVA 1K0RA 4RCBA 1GM5A 2E65A 4XU0A 3S14H 3H3VI 3NTIA 4J6XA 4DR1Q 4DUYL 5KCOA 3CD6T 4C3HH 1WJJA 3BZCA 5CAIA 1IZ6A 4LNQA 2PU9B 3TREA 4YWLA 5CKBA 4JRIA 1HXDA 3VYGA 2RHSB 2LTOA 1X3EA 3AEVA 3OQ5A 2UU9Q 4JJNK 3FP9A 1N9WA 2Y90A 3PT9A 4UP8A 1Q82C 3SDZA 3ZEHA 3TS0A 5GAMh 1FVIA 1NE3A 3JCMW