1Q82R

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1q82R00
1YHQQ 1VQLQ 3CCQQ 1QVFP 3CCMQ 3CXCP 1K9MR 1S72Q 3CMAQ 1Q7YR 1JJ2P 1VQ8Q 1M90R 3CC4Q 1M1KR 1K73R 3CCEQ 1W2BP 1VQ6Q 3I56Q 3CCUQ 1VQ9Q 3CMEQ 3OW2P 1Q81R 3CC2Q 1VQ7Q 1VQOQ 1VQKQ 1Q82R 1YIJQ 1K8AR 3G4SQ 1YJ9Q 1KQSP 3I55Q 1QVGP 3CCRQ 1VQ5Q 1VQ4Q 1VQNQ 3CD6Q 2OTLQ 3CCVQ 2QEXQ 3CC7Q 1YJNQ 1Q86R 1KC8R 1N8RR 2OTJQ 1YI2Q 1YJWQ 1KD1R 3CPWP 3CCLQ 1NJIR 3CCJQ 3G71Q 3G6EQ 1YITQ 2QA4Q 3CCSQ 1VQMQ 1VQPQ
chains in the Genus database with same CATH superfamily
1NYGA 4YTLA 4XTZA 2EYWA 2FZKB 2QA4A 1S72Q 2QI2A 2YUNA 3MJXA 1YNZA 2WSCE 2RM4A 3VYHB 4CC3A 2HL3A 5GAMg 4AFSC 2J06A 1KG1A 2PVGB 2DETA 4C8QD 4OMQA 5GANd 1RAIB 3OB9A 2DBKA 4X34A 2X35A 3M57A 2PU9B 2QXFA 5GAN4 2DTOA 2DXBA 1HXDA 4ZTFA 2AZVA 3MEVA 3MHXA 4E7LA 1E6HA 4BD3A 1QWFA 1D0YA 2GGRA 5IN1A 1SPKA 3QZ5B 1E6GA 2C0OA 3TVTA 4OF1A 1IGQA 3G71Q 1MGQA 2K57A 1JJ2S 3J81E 1K8AU 4C92D 4F14A 3Q1JA 2NLUA 2QQBA 1MMDA 2ZPFB 4J8OA 4DBFA 4BY6B 3QDFA 3JCMP 5CAIA 2MWPA 4J9BA 3R6NA 3IQLA 1TUCA 3MKDA 3NTHA 4RCBA 4JPBW 2ED1A 3EAEA 3PIOA 2MYSA 3PIPA 2QEXT 2GTOA 3MEAA 4BY6C 1O9SA 4M7AD 2BIVA 4M78B 2DD4A 1K8AR 3OY9A 1RLQC 1D0ZA 3X24B 5GMKl 1D09B 2C06A 3E9FA 5GANj 2LX9A 4C8QE 1RUWA 5I2SA 4B6MA 3CXCP 1GRIA 3OYFA 1YCSB 3WVEB 4LUEA 1TXQA 4JUVA 2EIFA 2F2VA 1VQKQ 4C92C 2YRDA 4ZN3A 3EG0A 5DLOA 4M78E 1X6BA 4OMNA 2YWWA 3QWXX 2KRSA 4HCKA 3CPWP 4RTVA 3KXTA 1ABQA 3VS5A 3FRNA 2VYTA 1KD1C 3LH0A 1UGPB 2CS7A 1NPRA 2NUTB 2DXTA 1UGQB 1D1CA 1JQQA 3OYBA 3M9QA 3N5BB 1HYOA 1M3BA 2GQIA 2V26A 4EMGA 1K4US 4BE2A 4Z88A 2MOXA 1VQPA 1S72T 2DILA 3CMET 1X6OA 2EBPA 4CRIA 3P8HA 3CCLQ 2DL4A 3CC4T 4ZNXA 1VQ6T 1YIJT 4M77B 2PUOB 3OYMA 1X01A 2EGCA 4J5YA 3VS2A 1BKBA 1C6VX 4L5GA 3SWNA 4C8QG 3HFOA 1KQSP 1VQ4A 2FRWA 2M9UA 4CC4B 2O01E 1Q82C 4MMLA 1QP2A 1OV3A 5GMKj 5CKFA 4MZPA 1K9AA 5FU6B 4E7ZA 1CSKA 3OS1A 1D3BB 2AHJB 2X4JA 1UE9A 1IGUA 1VQPT 1OPKA 1Q82R 5CKBA 1S1NA 3GOXA 4JZ4A 1BI1A 3CD6Q 3A8MB 2HZYA 1GFCA 3HL8A 4EMKC 4AFZC 3GPLA 1VQ7T 4UC4A 2LVMA 3CC7T 3HKSA 4JS5A 1QVGS 2YDLA 3QG1A 1YITT 3RKXA 3EGUA 4E47A 3URGA 1IZ6A 3H8ZA 3PTAA 2GQVA 3QXEB 3SFMA 4EMHA 1Q95G 4O5VA 1K8AC 3RKYA 3CMAT 1YI2Q 2A7YA 2DD5A 3G6EQ 3VYGA 2RPNA 1MV3A 4LE9A 5KE2A 4E7SA 3PFSA 2CGHA 2EWNA 4C92F 3NFCA 1NE8A 2OTLT 2OTJT 2ZAEA 2KY9A 2G3RA 2KDSA 3C12A 3RERA 2A08A 1AZEA 1D1AA 4OMFB 2PVOB 1YJNQ 4KH0B 1VQ8T 4OGCA 2LJ0A 3LYIA 3PGGA 1OOTA 1VQKT 4DEYA 2OAWA 3FEOA 2D6FA 1UECA 1W70A 1X6GA 2K3XA 2DJZA 3CCQA 1GCQA 3JCMW 3L2ZA 1VQ4Q 4KBMB 3ZBDA 3RBBB 1X69A 2FPFA 4OB1B 3G4ST 3CBOA 1BI2A 4XU3A 2E3IA 3ZEHA 4EPCA 1QMCA 1WHJA 1I81A 3EH1A 2QQAA 3J80E 1SF9A 2KNBB 4C92A 3EFSA 4LDYA 4D6WA 1PM3A 4PL6A 1G3TA 1KFZA 2VV5A 5DY9A 1NLOC 4AFQC 2LQWA 3QSUA 2E3HA 4IUQA 3CCSQ 3CC2A 1M2VB 4NL2A 2D0NA 4KUIA 1K73C 3EG9A 2F2XA 1UHFA 4J9DA 4HKEA 1ZX6A 2RD1A 3V7SA 1PNJA 1WNLA 5J3BA 3L2VA 1ZSZC 5GAMj 5LJ5h 4EDUA 1SHGA 2M51A 2A36A 2L3QA 1M2VA 3I5RA 2E6ZA 3JV3A 2LRQA 2RHYA 3CBMA 2P4TA 4IIOA 4PJOC 3S3OA 2VGMA 4GY5A 1QQJA 2YLBA 3EFRA 1UTIA 2EVRA 2LCLA 1RADB 2ABLA 5D7UA 2YUPA 3CXCA 1PC0A 2RO0A 3PT9A 2KYBA 3FC3A 1I5LA 3DB3A 3CCMT 1KK7A 1IO6A 1YITQ 2E64A 3A98A 1VQ9T 3WXMB 3VS0A 2ESWA 2L2PA 1AEYA 5GAN3 4ORZA 4PJJA 2JM8A 5LJ3e 4XAXB 4BUGA 3EFOA 1EIFA 1YI2T 5C6SA 1RLPC 2GBQA 2CT3A 4FT4A 2EJFA 2CH4W 4LDUA 5GAN2 4RMOA 2SRCA 2H8HA 1M8MA 4M4ZA 3F70A 2HBWA 1VQLQ 4FL6A 3I35A 5IHIA 2NUPB 4E7IA 2DJQA 3UF4A 5GAOn 1VQ7A 2LDMA 3MP1A 3HPWA 1TWBA 3KBGA 3HFNA 1QKXA 5LJ5d 4HVVA 2YUOA 2R57A 1NJIR 2F1LA 3ER0A 3CCRT 2RHZA 3U23A 4DBRA 4ANJA 4DA4A 2D1XA 4QVCA 3CC4A 4BDZA 3M4GA 1VQ4T 3CCUA 3J7AF 3M0TA 2O31A 1C1AA 4A4GA 3G4SQ 4BDYA 4RG8A 2QQRA 4KULA 5J26A 4J9HA 3V7RA 4MZMA 2EW3A 5M9OA 3GF5A 4C5GA 4A53A 1M1KR 2ZPIB 4PJOE 2ZZDA 3ME9A 1RI9A 5GAN8 2ATCB 1OULA 4KH1B 1WZOA 4J6WA 1U8RA 4M75G 4OMLA 2L3PA 4ME7A 2FZGB 2B8AA 4X9CA 3CCVA 3CBPA 3OYAA 3CPFA 1R77A 2C0IA 3DLMA 3EG2A 3DLLA 1Q82U 1JJ2P 5ECAA 1FMVA 3OYLA 1UJYA 1UB4A 1YWPA 1HSQA 3MPUB 1VQ5A 3RKWA 1WLPB 3CQTA 2FZCB 1XNIA 1Q86R 1PWTA 3X20B 4M77A 2CUDA 4KGVB 2X4WA 1G83A 1VQKA 3RNJA 4BE0A 2M1HA 2XMFA 2DYIA 3L2UA 3QDRB 2FHDA 1WHGA 3S3MA 5LJ3d 3TSWA 2EQJA 8ATCB 4BE1A 4N4GA 1AWWA 5IHNA 1YBYA 1LNXA 4M78F 2CZ0B 3G71T 1TG0A 1R8OB 2CZ7B 4F7UE 1VQNA 4M77G 1ARKA 2LZ6B 3QYHB 2V1QA 2R5AA 2EGEA 4RTYA 3LGLA 1I4K1 1BB9A 2HCKA 1K9MR 3CPWA 2BUDA 4M7DC 5GAOq 1WI7A 1IXDA 3OSVA 1WJRA 2QQSA 1VIEA 4R55A 4OMMA 3CCUQ 1IHVA 1PD0A 1RI0A 4C0ZA 2PQWA 5FROA 5GANe 1OZ2A 1T0HA 4M7AC 3CEYA 1RAHB 2KT1A 2XICA 1MMNA 5GAMh 4HCZA 4LN2A 2D0QB 1QVPA 1BK2A 2O9VA 2A3LA 2FG0A 1UG1A 1K9MU 2YRVA 2CP7A 4O6JA 3TSZA 4DQ2A 1VIFA 3QKJA 1X75C 2JMCA 4JS4A 2M16A 2DVEA 3ASKA 2K6DA 1EX4A 2LMJA 2EPDA 1YJ9T 2JTEA 2CH4A 1SSHA 3A8LB 2DNUA 2CSIA 2K5FA 3GP8A 1QCOA 3GNFB 3CCRA 2CSQA 5KYXB 1VQOQ 1YJNA 2AKKA 3FJPA 2RQRA 5LJ3f 5FLXE 4IUVA 2W0ZA 1P92A 4LDVA 5CKDA 2DM1A 2RJDA 4GBQA 2K9GA 1FYNA 1B34B 4J83A 1M1GA 1PG5B 2KXCA 1Y57A 3CMEQ 2KVQG 3CCLT 3JCMJ 1J3TA 4FYVB 4HT9A 3PNWC 2AKLA 1U06A 3JCMV 4F7UA 2L5QA 4AFUC 4XTWA 4Y28E 2COWA 2EKOA 1H641 2MPXC 5LJ5j 3JCMb 1XOVA 5GAMd 4RUGA 3OYDA 2XK0A 4J7IA 2GCXA 4JJCA 2FPDA 2K5LA 4OMPA 1JBMA 2K3BA 4XK8E 1YJWT 3BDUA 4XTYA 3M53A 1GL5A 4C92G 1N27A 3G7ZA 2EKHA 3WVDB 2P4RA 2NUZA 2MIOA 1VQMQ 1VQPQ 2YXYA 1TU0B 3LWHA 2VXEA 4RG2A 2KK4A 1ZSZB 2J6OA 1T3SA 2LC4A 3O5ZA 4Z89A 1RAEB 2HD0A 2K2MA 3OSSC 2L3RA 1ZUKA 3CCEA 1VQ5Q 2CP0A 3UWNA 2FB7A 3RMQA 5KYWA 4EIKA 2NUPA 4PKCC 1V76A 2HQEA 4FYYB 2GTJA 2DYBA 3L42A 3PVQA 2CP5A 3JB9F 2HQHA 1W2BS 2LQNA 2DEUA 1YWOA 1ZUYA 1Q86U 3CXCS 2YLCA 5KYUB 2XHCA 1VQ6A 1SKUB 2V1RA 1XTDA 2MF2A 2DX1A 1PKSA 1NPPA 2X51A 1QLYA 1BIAA 1WX6A 3JCMd 5L23A 1DJ7B 1N5ZA 2V8IA 2J6KA 1PKTA 1LPLA 2DK3A 2RF0A 4P5NA 2D8HA 4ZGEB 2RMOA 1YJ9Q 2VC8A 4M7AE 1AVZC 2JXBA 3QYGB 1V1CA 3EHQA 2A28A 1K9MC 3RESA 3OYEA 2FPEA 3M0PA 1YHQQ 1YI2A 2NWMA 2J05A 3NTKA 4N0AC 1BBZA 2K7AA 1Y96A 2DO3A 5FWCA 2XDBA 2DA9A 1WJQA 2DBMA 3M59A 4XU2A 3I56Q 5GMKm 1U1SA 2QQ9A 1M30A 3MP8A 4OB3B 2DL7A 3VRYA 2DRKA 2RH2A 3QUIA 3QBYA 1BIBA 2HKQB 3EG9B 2DRMA 1ACMB 2JZ2A 2GFUA 1QCFA 2CP6A 3OYNA 1TOVA 2LT1A 3OYKA 5LJ5g 2WACA 1AOJA 3JB9D 4IKFA 4C0DB 2Y4XA 3OS5A 5HK0A 1K73U 1WPYA 4WF2A 3E1SA 3EGXB 5IAYA 3CCSA 1AZGB 3CC7Q 1WHHA 3I9QA 3L2WA 3GLXA 2RI3A 1YJWQ 3JSCA 3OYGA 3X28B 4QQDA 2HKNA 3EFOB 4XTXA 3H41A 4NOYA 1NYFA 2MAMA 4OVAA 3E9GA 2GNCA 3H9NA 2Y4YA 2I2LA 5LJ3j 5CK9A 3CCVQ 4FU6A 5KCOA 4NL3A 3UA6A 3HRUA 3VS1A 3NTIA 5FU6C 2ZPEB 5IHKA 1KQ2A 4E6RA 3CCQQ 3SEMA 3PMIA 5CQXA 3VJPA 3CPWS 3QZ9B 1N6AA 2JNGA 3H0IA 3M0UA 3MEUA 2KMTA 3A5ZB 3M0SA 2DAQA 2DL5A 4R0KA 4D8KA 5LJ5f 2QG9B 1MV0B 3CCJA 1N8RC 1FXXA 2XDPA 5GMKe 1RAAB 3GNGA 9ATCB 5GAN7 1BCOA 1Y96B 5EC7A 5D6WA 2DFUA 2JOYA 4M77F 3AHUA 3JRZA 2K79A 4DOWA 3OYHA 2XDDA 2CKKA 2L3SA 1JB0E 4DEXA 2QA4Q 1S72A 1RAGB 2RI2A 2CZ1B 1F1BB 2ZGWA 4AT1B 4C92B 3LLRA 1W2BP 1UEBA 2GF7A 1AHJB 1QVFS 3CCRQ 2VXFA 1H3ZA 4JLIA 3JB9J 2O4XB 4OB2B 4VUBA 5CO7A 4LD6A 5GAMe 1NG2A 3OQ5A 3QHSA 4LD9K 5EG2A 1OX9A 1WXUA 1Q7YC 1XQHA 5D6XA 1OYXA 2CP3A 4PFPA 4J9EA 3QJ6A 5A0DA 4A4FA 3VRZA 7AT1B 1YITA 4M7DF 3LWIA 4M78G 4LUDA 2CYZB 5KYWB 1KD1R 4OP0A 3BE3A 4HA8A 2DKGA 2ECZA 3FB9A 2IPOB 4GLKA 1U3OA 5HY6A 3E19A 5IT9E 2R58A 3X25B 1FX7A 3CCJT 3M55A 1ZSZA 4HCCA 1A0NB 1KQ1A 1MHNA 4JDSA 3I55A 2X3WD 3AT1B 1M27C 4RTXA 2RNAA 4F17A 2P0QA 4WTOB 3OW2S 3VU3C 2L89A 4KGZB 1QP3A 2BE7D 2E6NA 5A0LA 4L6V5 2G6FX 1YIJQ 3ULRB 4M78D 4JJNK 1VOMA 5LJ3g 1B3QA 2QEXQ 1JXOA 2W10A 4F7UB 1EZZB 1WDXA 5GAOl 1VQOA 1OU8A 3SD4A 5KE3A 3JCMQ 3SHWA 2KRNA 1ZBJA 1UUEA 3OYCA 5GMKh 2LCCA 2JVVA 2RK1A 2DIGA 1YIJA 4XU1A 3JCMh 4HXJA 1B34A 3QWYA 1D3BA 2YRCA 4M78A 4MDXA 4FM4B 3OBYA 1WGSA 2HSPA 3VS7A 3I5SA 1OPLA 2E12A 2HAXA 2D8JA 2QDYB 2EQKA 1N9RA 2DXUA 2A0FB 1LVKA 1U5SA 3VUBA 2HBPA 2QAZA 3JB9I 1NJIU 4BB7A 4XTVA 4OMOA 2PNIA 5KYXA 2DXCA 2LNHB 1LCKA 4PJMA 2PVDB 3S6WA 3QO3A 4ZGDB 3JAME 3CMAA 2KGTA 4CI0C 4A63B 1SRLA 2JN0A 1UHCA 2YSQA 4J9GA 1RL2A 1SG5A 3QJYA 2ED0A 2FO0A 1TUDA 5LL6S 2QTVA 1KSWA 2COYA 2AK5A 2RA2A 3L2RA 3OW2A 1Q81U 2KRMA 1Y07A 4LDWA 1JEGA 1M3CA 1WHMA 2O88A 4IURA 2K3YA 1VQMA 1M90C 2COZA 3I55Q 3SDZA 2VWFA 1X27A 4KGXB 3INZA 5CVIA 3MO8A 1YN8A 2KI7A 1K76A 2E41A 3EHRA 2F2WA 3FDRA 4OB0B 2EJGA 1YJNT 2M02A 4RTWA 4J6XA 3BW1A 4M7DG 4F16A 1YJ9A 2EYQA 1KQSA 5CKEA 1Q81R 4ZTJA 1I5OB 1JRIA 1WHKA 1UGRB 3T9NA 5D6YA 4JJDA 2FVUA 4J9CA 1BCMA 3CC2T 4AMCA 4M7AG 3X26B 2XIDA 4B9XA 3LH5A 5KYYA 3VUZA 3CMEA 2KE9A 4A4EA 2RI5A 2ZPBB 2E65A 1M4ZA 1I8FA 4OGEA 2RN8A 4M7AA 4JRPA 4PJLA 2LQKA 3EG1A 4FYWB 4M77E 3GIBA 2EJ9A 4K11A 4V2SA 5A0GA 1B07A 1BI3A 3CCUT 1G2BA 1YCYA 1W1FA 2F5TX 2P0KA 3A8OB 4MZTA 2DL8A 3CCST 1HJDA 1CKBA 4X1VA 4BI8B 1IREB 1VUBA 3NHNA 5IXBA 2V8KA 3NPFA 2F5KA 1MUZA 2E1HA 2JS0A 1LOJA 5FRNA 5AT1B 4XQ3A 3M56A 2CP2A 3META 2IG0A 2K4YA 3C94A 4FSXA 1VQ5T 4A4HA 3H0HA 4RCCA 1QVGA 1X43A 2LNVA 5DM7R 4X9DA 2DMOA 1LJOA 2DTHA 2VGNA 4FT2A 1IHWA 2HNIA 2E5KA 1GXIE 3QPHA 2DZ9A 2RJCA 1PRLC 4JZ3A 4E7HA 1I0CA 3JCMX 4PJOF 2X4XA 4RTTA 3UDCA 5GANh 1Y71A 3CCLA 1NEBA 3KUFA 4Y92A 1D0XA 1VQ9A 1TH7A 2H3EB 1SSFA 3ZFJA 2ROTA 4J9IA 3EH2A 3VS3A 1AD5A 4FCYA 4BI4A 3G6EA 2RHIA 4PFOA 2HSEB 2YT6A 2XU8A 2JMAA 2RB6A 5LJ3h 3RMSA 1SEMA 1RAFB 1VQLT 1NLPC 4F7UG 1WQWA 1AWJA 4FIBA 4RKUE 1YHQT 1Q81C 1M8VA 2OAUA 3L1AA 5IXFA 1VYVA 3DB4A 3V8LA 2EGAA 3MCAB 5FU7C 1K0SA 4PK4A 4QVDA 4M75D 1M90U 2PZ1A 4HT8A 2SEMA 1VQLA 4PFZA 1MMAA 3CCEQ 5GAN6 2AIRB 1M1KU 4EMKB 2FYKA 3PVLA 1VQMT 4PNOA 4M7DB 3HHTB 2AZSA 2FEIA 2OJ2A 2QDLA 1M5Q1 1ZBXA 3JCMe 3CD6A 4FYXB 1H92A 1Q86C 5FWBA 2MI6A 5GJVB 2JW4A 5GANf 4LXCA 1FMWA 3HP9A 2DEQA 3NGPA 3V8JA 5I11A 2EYYA 1D1BA 1YJWA 2CZ6B 2OTLA 2OTJA 3M0RA 2NYSA 2QTXA 1PRMC 5KYYB 2BZYA 3CCMA 4M75F 3HRSA 2JTMA 2XD0A 3TU4K 2ROLA 4C8QB 2VKNA 1FWZA 3CCVT 1Y0MA 3M58A 1JJ2A 5AYFA 2H3JA 5IH2A 4B9WA 1WHLA 2K2VA 2B86A 4DOVA 1TSFA 4XU0A 3THKA 2HL5C 1QCNA 4JRKA 4FW2A 2EYXA 4WCIA 2DL3A 2P84A 2RK2A 1T0JA 3RR6A 1G8XA 3M4YA 2ENMA 5DLQE 4BACA 2BKDN 3VKIA 1CKAA 1G5VA 1GBRA 2JTFA 4MDWA 5I2MA 2FL7A 5GJWB 4IUPA 5LJ5e 4RTZA 4QQ6A 4RTUA 3I56T 3HTRA 2QGGA 4M75A 4J6YA 2O9SA 2ZPGB 4IUUA 4D8DA 5GAOr 1TTHB 2J7IA 1SHFA 1UGVA 2E10A 1PCXA 3DKMA 1OI1A 1AT1B 4C8QC 3BFMA 4C92E 1SRMA 3JCMg 2F69A 3REAB 3MEWA 4II1A 1HD3A 4M7DD 1I1JA 4QVZA 5CCAA 4QT7A 1KC8R 2KAFA 2CREA 3P8DA 1GBQA 1IB8A 3OMCA 1IRXA 4PJOD 1XJWB 2O2OA 4R56A 3CMAQ 1H8KA 2LX7A 3G6ET 4ELYC 4PLLA 3E2UA 1OU9A 1QW1A 2KBTA 2EYZA 2RHUA 4NS5A 4M77D 2KR3A 3RIRA 2LTOA 1UFFA 3A1PA 2OTLQ 2OTJQ 1WXTA 3VV0A 2RQWA 2YUQA 1K1ZA 4PJOA 3CCET 3EGDA 3MP6A 2I0NA 3M0QA 2HEQA 2A37A 4J7FA 3JCMc 1K0XA 3CC4Q 1MNEA 1VQ6Q 4C0GA 1MMGA 1VQNT 1RACB 4AG2C 3TEEA 4DBQA 1OZ3A 3REBB 1PD1A 3M5AA 2RHXA 2QYZA 3G4SA 2E5QA 1G3WA 3CCQT 4ZN1A 2KSSA 4HVWA 1W4SA 4MMKA 3HRTA 1X2KA 4C5HA 1EFNA 4PJNA 5GAOp 3G1JA 3EGDB 4PJOB 3EG3A 4KT0E 2JM9A 5I21A 4C0DC 3PMTA 2VVKA 2X9HA 4ELZC 1AWOA 1KC8U 2KROA 5C0MA 5HKCA 4KUDK 2L0AA 5KCHA 2LT4A 3LGFA 2HMAA 5CQYA 3C4SA 3SB2A 2QK0A 3UATA 1Q7YU 2K5IA 1E7OA 1TUGB 3RUXA 3SWNB 3CD6T 1Q7YR 1BU1A 1NZ9A 2QEXA 5CR2A 3OYIA 2WSEE 3OYYA 3OW2P 1VQ7Q 4E7KA 1KD1U 4TVRA 2DF6A 4C0FA 2KYMA 4M78C 3GBQA 2MMPA 5GAN5 2E4HA 4A4KA 1AWXA 4E2FB 1ZQ1A 2QGFB 3FLGA 3P8BB 3OYJA 1QVFP 2O4XA 1BI0A 4PLIA 2KXDA 1BYMA 1QWEA 4JRIA 1GFDA 1PSFA 3OMGA 3TQ7P 1WIEA 3CC7A 3PE0A 2RQUA 2NUTA 2WSFE 3M54A 1NM7A 3TREA 5HK3A 2JS2A 2FRYA 2CT4A 4QW2A 1ZSGA 3BDLA 3OA6A 3V7CA 3FJ5A 2ZCFB 1YP5A 4IIMA 2DVJA 1VQOT 5A2QE 4A54A 3C0CA 1VQ8Q 2IVWA 2MK5A 1PHTA 3UPUA 4CC2A 1K73R 4QKUA 2X4YA 1N9SA 1VQ9Q 3JB9G 1WFWA 2KQWA 4C8QA 4N4HA 1GCQC 2DZCA 4J9FA 1C0MA 2LQ8A 1HK9A 3OS0A 3H0FA 2AT1B 1ZHIA 3CCJQ 2XG8D 3OBWA 1VQ8A 3L2QA 3LX7A 4PJOG 1Z9QA 2DERA 2OX7A 4DBHA 1R0BG 1M2OA 4M75E 1W2BA 1WXBA 2QASA 2LCSA 1N8RU 2EFIA 2L8DA 1R0CB 4JRQA 3JB9H 2P0PA 1N8RR 4IUTA 5FU7B 1ZLMA 1G3SA 1Z9ZA 1JU5C 1JO8A 1UJ0A 1VQNQ 4FW1A 5KYNA 4LDXA 3TCJA 2PTKA 2V8JA 1TS9A 1G3YA 3CC2Q 4C5IA 4F04B 5FRMA 2BE9B 4M75B 2ZPHB 4AG1C 1ZUUA 2E70A 1NJIC 1KQSS 1M1FA 8AT1B 1KHCA 4C8QF 2OI3A 2Z0WA 5CKHA 5FW9A 2HQXA 1KJWA 3LW5E 3D7SB 4N0AA 2C0TA 1M1KC 2XKOC 1GCPA 4FSSA 2R5MA 1QKWA 4QQGA 1UDLA 1OEBA 2EQUA 1W6XA 3EGXA 2RQTA 3BY7A 2Y90A 2DIQA 2KT8A 1WQ7A 2VASA 3OS2A 5CIUA 4Z02A 3ZL7C 4JLGA 4E7JA 4CC7A 4Z8AA 3RDVA 1KC8C 1OX8A 3CCMQ 5GAOm 1KHIA 2JT4A 4GLMA 3HSBA 2RQVA 1JXMA 1PSEA 2RJEA 1ZA1B 5KH6A 2CDTA 3R6OA 4HVUA 4Q5WA 4BI3A 3NMZC 6AT1B 2LP5A 1KIKA 5GAMf 1QVFA 2JJ9A 2JUFA 3SWNC 2EQIA 5I22A 1VA7A 2J6FA 4KRTA 4F7UF 1RABB 1YHQA 5HCKA 1H3HA 2MWOA 1O75A 4Y91A 2RJFA 1ZA2B 3V8KA 2VUBA 3I55T 3I56A 2KEAA 1I07A 5L8RE 3KFVA 2GFAA 2LJ3A 2DLPA 2BZXA 4L59A 2IIMA 1VYUA 1M9SA 2LJ1A 2MCNA 1X2QA 1WYXA 3A8HB 1UGSB 2BTTA 4M75C 3G71A 2X3XD 1T3LA 4M7DA 2DTIA 1WA7A 2D9TA 4LNPA 2VB6A 2M0YA 1Y7XA 4EMKA 1MNDA 1U1TA 2HDAA 3UA7A 4ATOA 1VYTA 2CUBA 5KYUA 2DE0X 1OQKA 4M7AF 1NBEB 3VS6A 2PUKB 2BZ8A 1V29B 3JCMf 2EQMA 1M3AA 1QVGP 1WJSA 3C95A 5GMKi 1FMKA 4ZGJB 2EAYA 3H6ZA 1M90R 3VS4A 3S3NA 5J39A 1NEGA 3QIIA 4M7AB 2QA4T 1ABOA 4N4IA 4ESRA 5GANg 4XTUA 1B7TA 4M77C 4C5EA 4JJBA 2YHTA 1YFNA 3O8VA 4HCBA 2M0OA 2XI9A 2DPPB 3UT1A 3A8GB 4M7DE 3FIFA
chains in the Genus database with same CATH topology
1YHQQ 1VQLQ 3CCQQ 1QVFP 3CCMQ 3CXCP 1K9MR 1S72Q 3CMAQ 1Q7YR 1JJ2P 1VQ8Q 1M90R 3CC4Q 1M1KR 1K73R 3CCEQ 1W2BP 1VQ6Q 3I56Q 3CCUQ 1VQ9Q 3CMEQ 3OW2P 1Q81R 3CC2Q 1VQ7Q 1VQOQ 1VQKQ 1Q82R 1YIJQ 1K8AR 3G4SQ 1YJ9Q 1KQSP 3I55Q 1QVGP 3CCRQ 1VQ5Q 1VQ4Q 1VQNQ 3CD6Q 2OTLQ 3CCVQ 2QEXQ 3CC7Q 1YJNQ 1Q86R 1KC8R 1N8RR 2OTJQ 1YI2Q 1YJWQ 1KD1R 3CPWP 3CCLQ 1NJIR 3CCJQ 3G71Q 3G6EQ 1YITQ 2QA4Q 3CCSQ 1VQMQ 1VQPQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ Q;  1VQL Q;  3CCQ Q;  1QVF P;  3CCM Q;  3CXC P;  1K9M R;  1S72 Q;  3CMA Q;  1Q7Y R;  1JJ2 P;  1VQ8 Q;  1M90 R;  3CC4 Q;  1M1K R;  1K73 R;  3CCE Q;  1W2B P;  1VQ6 Q;  3I56 Q;  3CCU Q;  1VQ9 Q;  3CME Q;  3OW2 P;  1Q81 R;  3CC2 Q;  1VQ7 Q;  1VQO Q;  1VQK Q;  1Q82 R;  1YIJ Q;  1K8A R;  3G4S Q;  1YJ9 Q;  1KQS P;  3I55 Q;  1QVG P;  3CCR Q;  1VQ5 Q;  1VQ4 Q;  1VQN Q;  3CD6 Q;  2OTL Q;  3CCV Q;  2QEX Q;  3CC7 Q;  1YJN Q;  1Q86 R;  1KC8 R;  1N8R R;  2OTJ Q;  1YI2 Q;  1YJW Q;  1KD1 R;  3CPW P;  3CCL Q;  1NJI R;  3CCJ Q;  3G71 Q;  3G6E Q;  1YIT Q;  2QA4 Q;  3CCS Q;  1VQM Q;  1VQP Q; 
#chains in the Genus database with same CATH topology
 1NYG A;  4YTL A;  4XTZ A;  2EYW A;  2FZK B;  2QA4 A;  1S72 Q;  2QI2 A;  2YUN A;  3MJX A;  1YNZ A;  2WSC E;  2RM4 A;  3VYH B;  4CC3 A;  2HL3 A;  5GAM g;  4AFS C;  2J06 A;  1KG1 A;  2PVG B;  2DET A;  4C8Q D;  4OMQ A;  5GAN d;  1RAI B;  3OB9 A;  2DBK A;  4X34 A;  2X35 A;  3M57 A;  2PU9 B;  2QXF A;  5GAN 4;  2DTO A;  2DXB A;  1HXD A;  4ZTF A;  2AZV A;  3MEV A;  3MHX A;  4E7L A;  1E6H A;  4BD3 A;  1QWF A;  1D0Y A;  2GGR A;  5IN1 A;  1SPK A;  3QZ5 B;  1E6G A;  2C0O A;  3TVT A;  4OF1 A;  1IGQ A;  3G71 Q;  1MGQ A;  2K57 A;  1JJ2 S;  3J81 E;  1K8A U;  4C92 D;  4F14 A;  3Q1J A;  2NLU A;  2QQB A;  1MMD A;  2ZPF B;  4J8O A;  4DBF A;  4BY6 B;  3QDF A;  3JCM P;  5CAI A;  2MWP A;  4J9B A;  3R6N A;  3IQL A;  1TUC A;  3MKD A;  3NTH A;  4RCB A;  4JPB W;  2ED1 A;  3EAE A;  3PIO A;  2MYS A;  3PIP A;  2QEX T;  2GTO A;  3MEA A;  4BY6 C;  1O9S A;  4M7A D;  2BIV A;  4M78 B;  2DD4 A;  1K8A R;  3OY9 A;  1RLQ C;  1D0Z A;  3X24 B;  5GMK l;  1D09 B;  2C06 A;  3E9F A;  5GAN j;  2LX9 A;  4C8Q E;  1RUW A;  5I2S A;  4B6M A;  3CXC P;  1GRI A;  3OYF A;  1YCS B;  3WVE B;  4LUE A;  1TXQ A;  4JUV A;  2EIF A;  2F2V A;  1VQK Q;  4C92 C;  2YRD A;  4ZN3 A;  3EG0 A;  5DLO A;  4M78 E;  1X6B A;  4OMN A;  2YWW A;  3QWX X;  2KRS A;  4HCK A;  3CPW P;  4RTV A;  3KXT A;  1ABQ A;  3VS5 A;  3FRN A;  2VYT A;  1KD1 C;  3LH0 A;  1UGP B;  2CS7 A;  1NPR A;  2NUT B;  2DXT A;  1UGQ B;  1D1C A;  1JQQ A;  3OYB A;  3M9Q A;  3N5B B;  1HYO A;  1M3B A;  2GQI A;  2V26 A;  4EMG A;  1K4U S;  4BE2 A;  4Z88 A;  2MOX A;  1VQP A;  1S72 T;  2DIL A;  3CME T;  1X6O A;  2EBP A;  4CRI A;  3P8H A;  3CCL Q;  2DL4 A;  3CC4 T;  4ZNX A;  1VQ6 T;  1YIJ T;  4M77 B;  2PUO B;  3OYM A;  1X01 A;  2EGC A;  4J5Y A;  3VS2 A;  1BKB A;  1C6V X;  4L5G A;  3SWN A;  4C8Q G;  3HFO A;  1KQS P;  1VQ4 A;  2FRW A;  2M9U A;  4CC4 B;  2O01 E;  1Q82 C;  4MML A;  1QP2 A;  1OV3 A;  5GMK j;  5CKF A;  4MZP A;  1K9A A;  5FU6 B;  4E7Z A;  1CSK A;  3OS1 A;  1D3B B;  2AHJ B;  2X4J A;  1UE9 A;  1IGU A;  1VQP T;  1OPK A;  1Q82 R;  5CKB A;  1S1N A;  3GOX A;  4JZ4 A;  1BI1 A;  3CD6 Q;  3A8M B;  2HZY A;  1GFC A;  3HL8 A;  4EMK C;  4AFZ C;  3GPL A;  1VQ7 T;  4UC4 A;  2LVM A;  3CC7 T;  3HKS A;  4JS5 A;  1QVG S;  2YDL A;  3QG1 A;  1YIT T;  3RKX A;  3EGU A;  4E47 A;  3URG A;  1IZ6 A;  3H8Z A;  3PTA A;  2GQV A;  3QXE B;  3SFM A;  4EMH A;  1Q95 G;  4O5V A;  1K8A C;  3RKY A;  3CMA T;  1YI2 Q;  2A7Y A;  2DD5 A;  3G6E Q;  3VYG A;  2RPN A;  1MV3 A;  4LE9 A;  5KE2 A;  4E7S A;  3PFS A;  2CGH A;  2EWN A;  4C92 F;  3NFC A;  1NE8 A;  2OTL T;  2OTJ T;  2ZAE A;  2KY9 A;  2G3R A;  2KDS A;  3C12 A;  3RER A;  2A08 A;  1AZE A;  1D1A A;  4OMF B;  2PVO B;  1YJN Q;  4KH0 B;  1VQ8 T;  4OGC A;  2LJ0 A;  3LYI A;  3PGG A;  1OOT A;  1VQK T;  4DEY A;  2OAW A;  3FEO A;  2D6F A;  1UEC A;  1W70 A;  1X6G A;  2K3X A;  2DJZ A;  3CCQ A;  1GCQ A;  3JCM W;  3L2Z A;  1VQ4 Q;  4KBM B;  3ZBD A;  3RBB B;  1X69 A;  2FPF A;  4OB1 B;  3G4S T;  3CBO A;  1BI2 A;  4XU3 A;  2E3I A;  3ZEH A;  4EPC A;  1QMC A;  1WHJ A;  1I81 A;  3EH1 A;  2QQA A;  3J80 E;  1SF9 A;  2KNB B;  4C92 A;  3EFS A;  4LDY A;  4D6W A;  1PM3 A;  4PL6 A;  1G3T A;  1KFZ A;  2VV5 A;  5DY9 A;  1NLO C;  4AFQ C;  2LQW A;  3QSU A;  2E3H A;  4IUQ A;  3CCS Q;  3CC2 A;  1M2V B;  4NL2 A;  2D0N A;  4KUI A;  1K73 C;  3EG9 A;  2F2X A;  1UHF A;  4J9D A;  4HKE A;  1ZX6 A;  2RD1 A;  3V7S A;  1PNJ A;  1WNL A;  5J3B A;  3L2V A;  1ZSZ C;  5GAM j;  5LJ5 h;  4EDU A;  1SHG A;  2M51 A;  2A36 A;  2L3Q A;  1M2V A;  3I5R A;  2E6Z A;  3JV3 A;  2LRQ A;  2RHY A;  3CBM A;  2P4T A;  4IIO A;  4PJO C;  3S3O A;  2VGM A;  4GY5 A;  1QQJ A;  2YLB A;  3EFR A;  1UTI A;  2EVR A;  2LCL A;  1RAD B;  2ABL A;  5D7U A;  2YUP A;  3CXC A;  1PC0 A;  2RO0 A;  3PT9 A;  2KYB A;  3FC3 A;  1I5L A;  3DB3 A;  3CCM T;  1KK7 A;  1IO6 A;  1YIT Q;  2E64 A;  3A98 A;  1VQ9 T;  3WXM B;  3VS0 A;  2ESW A;  2L2P A;  1AEY A;  5GAN 3;  4ORZ A;  4PJJ A;  2JM8 A;  5LJ3 e;  4XAX B;  4BUG A;  3EFO A;  1EIF A;  1YI2 T;  5C6S A;  1RLP C;  2GBQ A;  2CT3 A;  4FT4 A;  2EJF A;  2CH4 W;  4LDU A;  5GAN 2;  4RMO A;  2SRC A;  2H8H A;  1M8M A;  4M4Z A;  3F70 A;  2HBW A;  1VQL Q;  4FL6 A;  3I35 A;  5IHI A;  2NUP B;  4E7I A;  2DJQ A;  3UF4 A;  5GAO n;  1VQ7 A;  2LDM A;  3MP1 A;  3HPW A;  1TWB A;  3KBG A;  3HFN A;  1QKX A;  5LJ5 d;  4HVV A;  2YUO A;  2R57 A;  1NJI R;  2F1L A;  3ER0 A;  3CCR T;  2RHZ A;  3U23 A;  4DBR A;  4ANJ A;  4DA4 A;  2D1X A;  4QVC A;  3CC4 A;  4BDZ A;  3M4G A;  1VQ4 T;  3CCU A;  3J7A F;  3M0T A;  2O31 A;  1C1A A;  4A4G A;  3G4S Q;  4BDY A;  4RG8 A;  2QQR A;  4KUL A;  5J26 A;  4J9H A;  3V7R A;  4MZM A;  2EW3 A;  5M9O A;  3GF5 A;  4C5G A;  4A53 A;  1M1K R;  2ZPI B;  4PJO E;  2ZZD A;  3ME9 A;  1RI9 A;  5GAN 8;  2ATC B;  1OUL A;  4KH1 B;  1WZO A;  4J6W A;  1U8R A;  4M75 G;  4OML A;  2L3P A;  4ME7 A;  2FZG B;  2B8A A;  4X9C A;  3CCV A;  3CBP A;  3OYA A;  3CPF A;  1R77 A;  2C0I A;  3DLM A;  3EG2 A;  3DLL A;  1Q82 U;  1JJ2 P;  5ECA A;  1FMV A;  3OYL A;  1UJY A;  1UB4 A;  1YWP A;  1HSQ A;  3MPU B;  1VQ5 A;  3RKW A;  1WLP B;  3CQT A;  2FZC B;  1XNI A;  1Q86 R;  1PWT A;  3X20 B;  4M77 A;  2CUD A;  4KGV B;  2X4W A;  1G83 A;  1VQK A;  3RNJ A;  4BE0 A;  2M1H A;  2XMF A;  2DYI A;  3L2U A;  3QDR B;  2FHD A;  1WHG A;  3S3M A;  5LJ3 d;  3TSW A;  2EQJ A;  8ATC B;  4BE1 A;  4N4G A;  1AWW A;  5IHN A;  1YBY A;  1LNX A;  4M78 F;  2CZ0 B;  3G71 T;  1TG0 A;  1R8O B;  2CZ7 B;  4F7U E;  1VQN A;  4M77 G;  1ARK A;  2LZ6 B;  3QYH B;  2V1Q A;  2R5A A;  2EGE A;  4RTY A;  3LGL A;  1I4K 1;  1BB9 A;  2HCK A;  1K9M R;  3CPW A;  2BUD A;  4M7D C;  5GAO q;  1WI7 A;  1IXD A;  3OSV A;  1WJR A;  2QQS A;  1VIE A;  4R55 A;  4OMM A;  3CCU Q;  1IHV A;  1PD0 A;  1RI0 A;  4C0Z A;  2PQW A;  5FRO A;  5GAN e;  1OZ2 A;  1T0H A;  4M7A C;  3CEY A;  1RAH B;  2KT1 A;  2XIC A;  1MMN A;  5GAM h;  4HCZ A;  4LN2 A;  2D0Q B;  1QVP A;  1BK2 A;  2O9V A;  2A3L A;  2FG0 A;  1UG1 A;  1K9M U;  2YRV A;  2CP7 A;  4O6J A;  3TSZ A;  4DQ2 A;  1VIF A;  3QKJ A;  1X75 C;  2JMC A;  4JS4 A;  2M16 A;  2DVE A;  3ASK A;  2K6D A;  1EX4 A;  2LMJ A;  2EPD A;  1YJ9 T;  2JTE A;  2CH4 A;  1SSH A;  3A8L B;  2DNU A;  2CSI A;  2K5F A;  3GP8 A;  1QCO A;  3GNF B;  3CCR A;  2CSQ A;  5KYX B;  1VQO Q;  1YJN A;  2AKK A;  3FJP A;  2RQR A;  5LJ3 f;  5FLX E;  4IUV A;  2W0Z A;  1P92 A;  4LDV A;  5CKD A;  2DM1 A;  2RJD A;  4GBQ A;  2K9G A;  1FYN A;  1B34 B;  4J83 A;  1M1G A;  1PG5 B;  2KXC A;  1Y57 A;  3CME Q;  2KVQ G;  3CCL T;  3JCM J;  1J3T A;  4FYV B;  4HT9 A;  3PNW C;  2AKL A;  1U06 A;  3JCM V;  4F7U A;  2L5Q A;  4AFU C;  4XTW A;  4Y28 E;  2COW A;  2EKO A;  1H64 1;  2MPX C;  5LJ5 j;  3JCM b;  1XOV A;  5GAM d;  4RUG A;  3OYD A;  2XK0 A;  4J7I A;  2GCX A;  4JJC A;  2FPD A;  2K5L A;  4OMP A;  1JBM A;  2K3B A;  4XK8 E;  1YJW T;  3BDU A;  4XTY A;  3M53 A;  1GL5 A;  4C92 G;  1N27 A;  3G7Z A;  2EKH A;  3WVD B;  2P4R A;  2NUZ A;  2MIO A;  1VQM Q;  1VQP Q;  2YXY A;  1TU0 B;  3LWH A;  2VXE A;  4RG2 A;  2KK4 A;  1ZSZ B;  2J6O A;  1T3S A;  2LC4 A;  3O5Z A;  4Z89 A;  1RAE B;  2HD0 A;  2K2M A;  3OSS C;  2L3R A;  1ZUK A;  3CCE A;  1VQ5 Q;  2CP0 A;  3UWN A;  2FB7 A;  3RMQ A;  5KYW A;  4EIK A;  2NUP A;  4PKC C;  1V76 A;  2HQE A;  4FYY B;  2GTJ A;  2DYB A;  3L42 A;  3PVQ A;  2CP5 A;  3JB9 F;  2HQH A;  1W2B S;  2LQN A;  2DEU A;  1YWO A;  1ZUY A;  1Q86 U;  3CXC S;  2YLC A;  5KYU B;  2XHC A;  1VQ6 A;  1SKU B;  2V1R A;  1XTD A;  2MF2 A;  2DX1 A;  1PKS A;  1NPP A;  2X51 A;  1QLY A;  1BIA A;  1WX6 A;  3JCM d;  5L23 A;  1DJ7 B;  1N5Z A;  2V8I A;  2J6K A;  1PKT A;  1LPL A;  2DK3 A;  2RF0 A;  4P5N A;  2D8H A;  4ZGE B;  2RMO A;  1YJ9 Q;  2VC8 A;  4M7A E;  1AVZ C;  2JXB A;  3QYG B;  1V1C A;  3EHQ A;  2A28 A;  1K9M C;  3RES A;  3OYE A;  2FPE A;  3M0P A;  1YHQ Q;  1YI2 A;  2NWM A;  2J05 A;  3NTK A;  4N0A C;  1BBZ A;  2K7A A;  1Y96 A;  2DO3 A;  5FWC A;  2XDB A;  2DA9 A;  1WJQ A;  2DBM A;  3M59 A;  4XU2 A;  3I56 Q;  5GMK m;  1U1S A;  2QQ9 A;  1M30 A;  3MP8 A;  4OB3 B;  2DL7 A;  3VRY A;  2DRK A;  2RH2 A;  3QUI A;  3QBY A;  1BIB A;  2HKQ B;  3EG9 B;  2DRM A;  1ACM B;  2JZ2 A;  2GFU A;  1QCF A;  2CP6 A;  3OYN A;  1TOV A;  2LT1 A;  3OYK A;  5LJ5 g;  2WAC A;  1AOJ A;  3JB9 D;  4IKF A;  4C0D B;  2Y4X A;  3OS5 A;  5HK0 A;  1K73 U;  1WPY A;  4WF2 A;  3E1S A;  3EGX B;  5IAY A;  3CCS A;  1AZG B;  3CC7 Q;  1WHH A;  3I9Q A;  3L2W A;  3GLX A;  2RI3 A;  1YJW Q;  3JSC A;  3OYG A;  3X28 B;  4QQD A;  2HKN A;  3EFO B;  4XTX A;  3H41 A;  4NOY A;  1NYF A;  2MAM A;  4OVA A;  3E9G A;  2GNC A;  3H9N A;  2Y4Y A;  2I2L A;  5LJ3 j;  5CK9 A;  3CCV Q;  4FU6 A;  5KCO A;  4NL3 A;  3UA6 A;  3HRU A;  3VS1 A;  3NTI A;  5FU6 C;  2ZPE B;  5IHK A;  1KQ2 A;  4E6R A;  3CCQ Q;  3SEM A;  3PMI A;  5CQX A;  3VJP A;  3CPW S;  3QZ9 B;  1N6A A;  2JNG A;  3H0I A;  3M0U A;  3MEU A;  2KMT A;  3A5Z B;  3M0S A;  2DAQ A;  2DL5 A;  4R0K A;  4D8K A;  5LJ5 f;  2QG9 B;  1MV0 B;  3CCJ A;  1N8R C;  1FXX A;  2XDP A;  5GMK e;  1RAA B;  3GNG A;  9ATC B;  5GAN 7;  1BCO A;  1Y96 B;  5EC7 A;  5D6W A;  2DFU A;  2JOY A;  4M77 F;  3AHU A;  3JRZ A;  2K79 A;  4DOW A;  3OYH A;  2XDD A;  2CKK A;  2L3S A;  1JB0 E;  4DEX A;  2QA4 Q;  1S72 A;  1RAG B;  2RI2 A;  2CZ1 B;  1F1B B;  2ZGW A;  4AT1 B;  4C92 B;  3LLR A;  1W2B P;  1UEB A;  2GF7 A;  1AHJ B;  1QVF S;  3CCR Q;  2VXF A;  1H3Z A;  4JLI A;  3JB9 J;  2O4X B;  4OB2 B;  4VUB A;  5CO7 A;  4LD6 A;  5GAM e;  1NG2 A;  3OQ5 A;  3QHS A;  4LD9 K;  5EG2 A;  1OX9 A;  1WXU A;  1Q7Y C;  1XQH A;  5D6X A;  1OYX A;  2CP3 A;  4PFP A;  4J9E A;  3QJ6 A;  5A0D A;  4A4F A;  3VRZ A;  7AT1 B;  1YIT A;  4M7D F;  3LWI A;  4M78 G;  4LUD A;  2CYZ B;  5KYW B;  1KD1 R;  4OP0 A;  3BE3 A;  4HA8 A;  2DKG A;  2ECZ A;  3FB9 A;  2IPO B;  4GLK A;  1U3O A;  5HY6 A;  3E19 A;  5IT9 E;  2R58 A;  3X25 B;  1FX7 A;  3CCJ T;  3M55 A;  1ZSZ A;  4HCC A;  1A0N B;  1KQ1 A;  1MHN A;  4JDS A;  3I55 A;  2X3W D;  3AT1 B;  1M27 C;  4RTX A;  2RNA A;  4F17 A;  2P0Q A;  4WTO B;  3OW2 S;  3VU3 C;  2L89 A;  4KGZ B;  1QP3 A;  2BE7 D;  2E6N A;  5A0L A;  4L6V 5;  2G6F X;  1YIJ Q;  3ULR B;  4M78 D;  4JJN K;  1VOM A;  5LJ3 g;  1B3Q A;  2QEX Q;  1JXO A;  2W10 A;  4F7U B;  1EZZ B;  1WDX A;  5GAO l;  1VQO A;  1OU8 A;  3SD4 A;  5KE3 A;  3JCM Q;  3SHW A;  2KRN A;  1ZBJ A;  1UUE A;  3OYC A;  5GMK h;  2LCC A;  2JVV A;  2RK1 A;  2DIG A;  1YIJ A;  4XU1 A;  3JCM h;  4HXJ A;  1B34 A;  3QWY A;  1D3B A;  2YRC A;  4M78 A;  4MDX A;  4FM4 B;  3OBY A;  1WGS A;  2HSP A;  3VS7 A;  3I5S A;  1OPL A;  2E12 A;  2HAX A;  2D8J A;  2QDY B;  2EQK A;  1N9R A;  2DXU A;  2A0F B;  1LVK A;  1U5S A;  3VUB A;  2HBP A;  2QAZ A;  3JB9 I;  1NJI U;  4BB7 A;  4XTV A;  4OMO A;  2PNI A;  5KYX A;  2DXC A;  2LNH B;  1LCK A;  4PJM A;  2PVD B;  3S6W A;  3QO3 A;  4ZGD B;  3JAM E;  3CMA A;  2KGT A;  4CI0 C;  4A63 B;  1SRL A;  2JN0 A;  1UHC A;  2YSQ A;  4J9G A;  1RL2 A;  1SG5 A;  3QJY A;  2ED0 A;  2FO0 A;  1TUD A;  5LL6 S;  2QTV A;  1KSW A;  2COY A;  2AK5 A;  2RA2 A;  3L2R A;  3OW2 A;  1Q81 U;  2KRM A;  1Y07 A;  4LDW A;  1JEG A;  1M3C A;  1WHM A;  2O88 A;  4IUR A;  2K3Y A;  1VQM A;  1M90 C;  2COZ A;  3I55 Q;  3SDZ A;  2VWF A;  1X27 A;  4KGX B;  3INZ A;  5CVI A;  3MO8 A;  1YN8 A;  2KI7 A;  1K76 A;  2E41 A;  3EHR A;  2F2W A;  3FDR A;  4OB0 B;  2EJG A;  1YJN T;  2M02 A;  4RTW A;  4J6X A;  3BW1 A;  4M7D G;  4F16 A;  1YJ9 A;  2EYQ A;  1KQS A;  5CKE A;  1Q81 R;  4ZTJ A;  1I5O B;  1JRI A;  1WHK A;  1UGR B;  3T9N A;  5D6Y A;  4JJD A;  2FVU A;  4J9C A;  1BCM A;  3CC2 T;  4AMC A;  4M7A G;  3X26 B;  2XID A;  4B9X A;  3LH5 A;  5KYY A;  3VUZ A;  3CME A;  2KE9 A;  4A4E A;  2RI5 A;  2ZPB B;  2E65 A;  1M4Z A;  1I8F A;  4OGE A;  2RN8 A;  4M7A A;  4JRP A;  4PJL A;  2LQK A;  3EG1 A;  4FYW B;  4M77 E;  3GIB A;  2EJ9 A;  4K11 A;  4V2S A;  5A0G A;  1B07 A;  1BI3 A;  3CCU T;  1G2B A;  1YCY A;  1W1F A;  2F5T X;  2P0K A;  3A8O B;  4MZT A;  2DL8 A;  3CCS T;  1HJD A;  1CKB A;  4X1V A;  4BI8 B;  1IRE B;  1VUB A;  3NHN A;  5IXB A;  2V8K A;  3NPF A;  2F5K A;  1MUZ A;  2E1H A;  2JS0 A;  1LOJ A;  5FRN A;  5AT1 B;  4XQ3 A;  3M56 A;  2CP2 A;  3MET A;  2IG0 A;  2K4Y A;  3C94 A;  4FSX A;  1VQ5 T;  4A4H A;  3H0H A;  4RCC A;  1QVG A;  1X43 A;  2LNV A;  5DM7 R;  4X9D A;  2DMO A;  1LJO A;  2DTH A;  2VGN A;  4FT2 A;  1IHW A;  2HNI A;  2E5K A;  1GXI E;  3QPH A;  2DZ9 A;  2RJC A;  1PRL C;  4JZ3 A;  4E7H A;  1I0C A;  3JCM X;  4PJO F;  2X4X A;  4RTT A;  3UDC A;  5GAN h;  1Y71 A;  3CCL A;  1NEB A;  3KUF A;  4Y92 A;  1D0X A;  1VQ9 A;  1TH7 A;  2H3E B;  1SSF A;  3ZFJ A;  2ROT A;  4J9I A;  3EH2 A;  3VS3 A;  1AD5 A;  4FCY A;  4BI4 A;  3G6E A;  2RHI A;  4PFO A;  2HSE B;  2YT6 A;  2XU8 A;  2JMA A;  2RB6 A;  5LJ3 h;  3RMS A;  1SEM A;  1RAF B;  1VQL T;  1NLP C;  4F7U G;  1WQW A;  1AWJ A;  4FIB A;  4RKU E;  1YHQ T;  1Q81 C;  1M8V A;  2OAU A;  3L1A A;  5IXF A;  1VYV A;  3DB4 A;  3V8L A;  2EGA A;  3MCA B;  5FU7 C;  1K0S A;  4PK4 A;  4QVD A;  4M75 D;  1M90 U;  2PZ1 A;  4HT8 A;  2SEM A;  1VQL A;  4PFZ A;  1MMA A;  3CCE Q;  5GAN 6;  2AIR B;  1M1K U;  4EMK B;  2FYK A;  3PVL A;  1VQM T;  4PNO A;  4M7D B;  3HHT B;  2AZS A;  2FEI A;  2OJ2 A;  2QDL A;  1M5Q 1;  1ZBX A;  3JCM e;  3CD6 A;  4FYX B;  1H92 A;  1Q86 C;  5FWB A;  2MI6 A;  5GJV B;  2JW4 A;  5GAN f;  4LXC A;  1FMW A;  3HP9 A;  2DEQ A;  3NGP A;  3V8J A;  5I11 A;  2EYY A;  1D1B A;  1YJW A;  2CZ6 B;  2OTL A;  2OTJ A;  3M0R A;  2NYS A;  2QTX A;  1PRM C;  5KYY B;  2BZY A;  3CCM A;  4M75 F;  3HRS A;  2JTM A;  2XD0 A;  3TU4 K;  2ROL A;  4C8Q B;  2VKN A;  1FWZ A;  3CCV T;  1Y0M A;  3M58 A;  1JJ2 A;  5AYF A;  2H3J A;  5IH2 A;  4B9W A;  1WHL A;  2K2V A;  2B86 A;  4DOV A;  1TSF A;  4XU0 A;  3THK A;  2HL5 C;  1QCN A;  4JRK A;  4FW2 A;  2EYX A;  4WCI A;  2DL3 A;  2P84 A;  2RK2 A;  1T0J A;  3RR6 A;  1G8X A;  3M4Y A;  2ENM A;  5DLQ E;  4BAC A;  2BKD N;  3VKI A;  1CKA A;  1G5V A;  1GBR A;  2JTF A;  4MDW A;  5I2M A;  2FL7 A;  5GJW B;  4IUP A;  5LJ5 e;  4RTZ A;  4QQ6 A;  4RTU A;  3I56 T;  3HTR A;  2QGG A;  4M75 A;  4J6Y A;  2O9S A;  2ZPG B;  4IUU A;  4D8D A;  5GAO r;  1TTH B;  2J7I A;  1SHF A;  1UGV A;  2E10 A;  1PCX A;  3DKM A;  1OI1 A;  1AT1 B;  4C8Q C;  3BFM A;  4C92 E;  1SRM A;  3JCM g;  2F69 A;  3REA B;  3MEW A;  4II1 A;  1HD3 A;  4M7D D;  1I1J A;  4QVZ A;  5CCA A;  4QT7 A;  1KC8 R;  2KAF A;  2CRE A;  3P8D A;  1GBQ A;  1IB8 A;  3OMC A;  1IRX A;  4PJO D;  1XJW B;  2O2O A;  4R56 A;  3CMA Q;  1H8K A;  2LX7 A;  3G6E T;  4ELY C;  4PLL A;  3E2U A;  1OU9 A;  1QW1 A;  2KBT A;  2EYZ A;  2RHU A;  4NS5 A;  4M77 D;  2KR3 A;  3RIR A;  2LTO A;  1UFF A;  3A1P A;  2OTL Q;  2OTJ Q;  1WXT A;  3VV0 A;  2RQW A;  2YUQ A;  1K1Z A;  4PJO A;  3CCE T;  3EGD A;  3MP6 A;  2I0N A;  3M0Q A;  2HEQ A;  2A37 A;  4J7F A;  3JCM c;  1K0X A;  3CC4 Q;  1MNE A;  1VQ6 Q;  4C0G A;  1MMG A;  1VQN T;  1RAC B;  4AG2 C;  3TEE A;  4DBQ A;  1OZ3 A;  3REB B;  1PD1 A;  3M5A A;  2RHX A;  2QYZ A;  3G4S A;  2E5Q A;  1G3W A;  3CCQ T;  4ZN1 A;  2KSS A;  4HVW A;  1W4S A;  4MMK A;  3HRT A;  1X2K A;  4C5H A;  1EFN A;  4PJN A;  5GAO p;  3G1J A;  3EGD B;  4PJO B;  3EG3 A;  4KT0 E;  2JM9 A;  5I21 A;  4C0D C;  3PMT A;  2VVK A;  2X9H A;  4ELZ C;  1AWO A;  1KC8 U;  2KRO A;  5C0M A;  5HKC A;  4KUD K;  2L0A A;  5KCH A;  2LT4 A;  3LGF A;  2HMA A;  5CQY A;  3C4S A;  3SB2 A;  2QK0 A;  3UAT A;  1Q7Y U;  2K5I A;  1E7O A;  1TUG B;  3RUX A;  3SWN B;  3CD6 T;  1Q7Y R;  1BU1 A;  1NZ9 A;  2QEX A;  5CR2 A;  3OYI A;  2WSE E;  3OYY A;  3OW2 P;  1VQ7 Q;  4E7K A;  1KD1 U;  4TVR A;  2DF6 A;  4C0F A;  2KYM A;  4M78 C;  3GBQ A;  2MMP A;  5GAN 5;  2E4H A;  4A4K A;  1AWX A;  4E2F B;  1ZQ1 A;  2QGF B;  3FLG A;  3P8B B;  3OYJ A;  1QVF P;  2O4X A;  1BI0 A;  4PLI A;  2KXD A;  1BYM A;  1QWE A;  4JRI A;  1GFD A;  1PSF A;  3OMG A;  3TQ7 P;  1WIE A;  3CC7 A;  3PE0 A;  2RQU A;  2NUT A;  2WSF E;  3M54 A;  1NM7 A;  3TRE A;  5HK3 A;  2JS2 A;  2FRY A;  2CT4 A;  4QW2 A;  1ZSG A;  3BDL A;  3OA6 A;  3V7C A;  3FJ5 A;  2ZCF B;  1YP5 A;  4IIM A;  2DVJ A;  1VQO T;  5A2Q E;  4A54 A;  3C0C A;  1VQ8 Q;  2IVW A;  2MK5 A;  1PHT A;  3UPU A;  4CC2 A;  1K73 R;  4QKU A;  2X4Y A;  1N9S A;  1VQ9 Q;  3JB9 G;  1WFW A;  2KQW A;  4C8Q A;  4N4H A;  1GCQ C;  2DZC A;  4J9F A;  1C0M A;  2LQ8 A;  1HK9 A;  3OS0 A;  3H0F A;  2AT1 B;  1ZHI A;  3CCJ Q;  2XG8 D;  3OBW A;  1VQ8 A;  3L2Q A;  3LX7 A;  4PJO G;  1Z9Q A;  2DER A;  2OX7 A;  4DBH A;  1R0B G;  1M2O A;  4M75 E;  1W2B A;  1WXB A;  2QAS A;  2LCS A;  1N8R U;  2EFI A;  2L8D A;  1R0C B;  4JRQ A;  3JB9 H;  2P0P A;  1N8R R;  4IUT A;  5FU7 B;  1ZLM A;  1G3S A;  1Z9Z A;  1JU5 C;  1JO8 A;  1UJ0 A;  1VQN Q;  4FW1 A;  5KYN A;  4LDX A;  3TCJ A;  2PTK A;  2V8J A;  1TS9 A;  1G3Y A;  3CC2 Q;  4C5I A;  4F04 B;  5FRM A;  2BE9 B;  4M75 B;  2ZPH B;  4AG1 C;  1ZUU A;  2E70 A;  1NJI C;  1KQS S;  1M1F A;  8AT1 B;  1KHC A;  4C8Q F;  2OI3 A;  2Z0W A;  5CKH A;  5FW9 A;  2HQX A;  1KJW A;  3LW5 E;  3D7S B;  4N0A A;  2C0T A;  1M1K C;  2XKO C;  1GCP A;  4FSS A;  2R5M A;  1QKW A;  4QQG A;  1UDL A;  1OEB A;  2EQU A;  1W6X A;  3EGX A;  2RQT A;  3BY7 A;  2Y90 A;  2DIQ A;  2KT8 A;  1WQ7 A;  2VAS A;  3OS2 A;  5CIU A;  4Z02 A;  3ZL7 C;  4JLG A;  4E7J A;  4CC7 A;  4Z8A A;  3RDV A;  1KC8 C;  1OX8 A;  3CCM Q;  5GAO m;  1KHI A;  2JT4 A;  4GLM A;  3HSB A;  2RQV A;  1JXM A;  1PSE A;  2RJE A;  1ZA1 B;  5KH6 A;  2CDT A;  3R6O A;  4HVU A;  4Q5W A;  4BI3 A;  3NMZ C;  6AT1 B;  2LP5 A;  1KIK A;  5GAM f;  1QVF A;  2JJ9 A;  2JUF A;  3SWN C;  2EQI A;  5I22 A;  1VA7 A;  2J6F A;  4KRT A;  4F7U F;  1RAB B;  1YHQ A;  5HCK A;  1H3H A;  2MWO A;  1O75 A;  4Y91 A;  2RJF A;  1ZA2 B;  3V8K A;  2VUB A;  3I55 T;  3I56 A;  2KEA A;  1I07 A;  5L8R E;  3KFV A;  2GFA A;  2LJ3 A;  2DLP A;  2BZX A;  4L59 A;  2IIM A;  1VYU A;  1M9S A;  2LJ1 A;  2MCN A;  1X2Q A;  1WYX A;  3A8H B;  1UGS B;  2BTT A;  4M75 C;  3G71 A;  2X3X D;  1T3L A;  4M7D A;  2DTI A;  1WA7 A;  2D9T A;  4LNP A;  2VB6 A;  2M0Y A;  1Y7X A;  4EMK A;  1MND A;  1U1T A;  2HDA A;  3UA7 A;  4ATO A;  1VYT A;  2CUB A;  5KYU A;  2DE0 X;  1OQK A;  4M7A F;  1NBE B;  3VS6 A;  2PUK B;  2BZ8 A;  1V29 B;  3JCM f;  2EQM A;  1M3A A;  1QVG P;  1WJS A;  3C95 A;  5GMK i;  1FMK A;  4ZGJ B;  2EAY A;  3H6Z A;  1M90 R;  3VS4 A;  3S3N A;  5J39 A;  1NEG A;  3QII A;  4M7A B;  2QA4 T;  1ABO A;  4N4I A;  4ESR A;  5GAN g;  4XTU A;  1B7T A;  4M77 C;  4C5E A;  4JJB A;  2YHT A;  1YFN A;  3O8V A;  4HCB A;  2M0O A;  2XI9 A;  2DPP B;  3UT1 A;  3A8G B;  4M7D E;  3FIF A; 
#chains in the Genus database with same CATH homology
 1YHQ Q;  1VQL Q;  3CCQ Q;  1QVF P;  3CCM Q;  3CXC P;  1K9M R;  1S72 Q;  3CMA Q;  1Q7Y R;  1JJ2 P;  1VQ8 Q;  1M90 R;  3CC4 Q;  1M1K R;  1K73 R;  3CCE Q;  1W2B P;  1VQ6 Q;  3I56 Q;  3CCU Q;  1VQ9 Q;  3CME Q;  3OW2 P;  1Q81 R;  3CC2 Q;  1VQ7 Q;  1VQO Q;  1VQK Q;  1Q82 R;  1YIJ Q;  1K8A R;  3G4S Q;  1YJ9 Q;  1KQS P;  3I55 Q;  1QVG P;  3CCR Q;  1VQ5 Q;  1VQ4 Q;  1VQN Q;  3CD6 Q;  2OTL Q;  3CCV Q;  2QEX Q;  3CC7 Q;  1YJN Q;  1Q86 R;  1KC8 R;  1N8R R;  2OTJ Q;  1YI2 Q;  1YJW Q;  1KD1 R;  3CPW P;  3CCL Q;  1NJI R;  3CCJ Q;  3G71 Q;  3G6E Q;  1YIT Q;  2QA4 Q;  3CCS Q;  1VQM Q;  1VQP Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...