1Q82R

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1q82R00
3CCUQ 1VQMQ 1Q81R 1K8AR 1YIJQ 1K9MR 2QA4Q 3CCVQ 3CCLQ 1Q7YR 3I55Q 1JJ2P 1KQSP 1VQ5Q 1KD1R 1YJNQ 3CCJQ 3CCQQ 3CC4Q 1VQ9Q 1YJ9Q 1Q82R 3CC7Q 1VQPQ 1VQNQ 1YI2Q 3CMEQ 3CCMQ 1YITQ 1YJWQ 1QVFP 1VQLQ 3CC2Q 3I56Q 1W2BP 1NJIR 3G4SQ 1VQKQ 3CPWP 3CD6Q 1YHQQ 2QEXQ 1S72Q 1Q86R 1VQ7Q 1VQ8Q 1N8RR 1M90R 3G6EQ 2OTJQ 3CXCP 1VQ6Q 3CCRQ 2OTLQ 3CMAQ 3G71Q 3CCEQ 1K73R 1KC8R 3CCSQ 1VQOQ 3OW2P 1QVGP 1VQ4Q 1M1KR
chains in the Genus database with same CATH superfamily
3I56A 3LLRA 4L6V5 2L8DA 3GNFB 1UEBA 5KCOA 1M2VA 1MNDA 1H3ZA 3CCJT 4HKEA 4C92B 2I0NA 2JJ9A 3CBOA 2QA4A 3PTAA 5I2SA 1G5VA 5GAMd 4C8QF 4M4ZA 3PVQA 4M7DB 3GF5A 2YT6A 2DL5A 1SHFA 4KGXB 3A98A 2FEIA 1X6BA 2GFUA 3LH0A 4FYXB 4IUTA 4LDVA 1VQ9T 3CCQA 1U06A 1HXDA 2X4XA 3AHUA 1RL2A 2OAUA 2DL8A 5KYXA 4HCKA 1NYGA 2QTVA 3NMZC 3BY7A 2FL7A 1UJYA 4OB3B 4XAXB 4A4HA 1G83A 1V1CA 2AZVA 4A4KA 2F1LA 2DF6A 3M0UA 1KC8U 4OVAA 2X35A 4AFSC 1Q7YC 1IREB 5KCHA 2V8JA 4CC4B 3ASKA 1WA7A 3OQ5A 2RHIA 1U5SA 3J80E 2YUNA 3RBBB 3M57A 2BTTA 4M7DF 4AFUC 4C8QG 2MIOA 3PFSA 1NEBA 3OSSC 2K3BA 1QW1A 1RADB 2JS0A 3JCMc 1PSEA 4X1VA 3C94A 1K9MC 2DTIA 3L2VA 4CRIA 1N6AA 4CC3A 1OYXA 2XDPA 3HP9A 2WSCE 2EJFA 4F7UE 1FMKA 2QDYB 5HK3A 3OYMA 2EGEA 2YRDA 2JT4A 3X24B 1X43A 2HQEA 5AT1B 3PIOA 1JJ2A 1ABOA 2K5IA 1Q7YR 4PFPA 1GXIE 2RHXA 4IIMA 2GNCA 4J7FA 3H8ZA 3NPFA 2C06A 4M7DE 4D6WA 2DMOA 1UDLA 4OGEA 4JRPA 1YFNA 1R8OB 1TUDA 3EH2A 2X4JA 1PNJA 2BZXA 2PUOB 4PJOB 2D0NA 1W2BS 4ZGDB 2F69A 3OYDA 3CCST 1YIJQ 3REBB 3OBWA 3VRZA 2A36A 2YUPA 3CXCS 2DXCA 1AWOA 2ED0A 5M9OA 4FYWB 3KUFA 2E5KA 5D6YA 2FYKA 2EYZA 3CCLT 3RIRA 4J83A 3CC2Q 1TXQA 4PJMA 2RHUA 3JCMb 2HD0A 1SSHA 1WHJA 2DIGA 2RHYA 2XD0A 2XK0A 1M1KU 2AKLA 3TSWA 3J7AF 2K6DA 1PCXA 1NE8A 2EW3A 3HL8A 2OI3A 2KGTA 2ED1A 2YSQA 3CXCA 1OZ2A 4LUDA 1X2KA 4JLGA 2RJDA 4C8QE 2AK5A 1I81A 1AD5A 5A0LA 1WJSA 4E7IA 1N8RC 1EIFA 1B07A 4FIBA 1KHIA 2RHZA 4XTXA 1QCOA 4OB2B 1JQQA 4EDUA 2D1XA 1WIEA 2SEMA 4M77D 1K73U 1Z9ZA 1XQHA 2QQSA 1MMGA 4J9GA 4EMKC 1VQNQ 2YRVA 4PFOA 2LQKA 2QK0A 1LVKA 4Z89A 1YNZA 3QBYA 3NFCA 3QSUA 3BE3A 4PLIA 2KRSA 5LJ3e 3S3OA 3PMTA 3VS3A 4AMCA 4A54A 2ZPBB 3JB9H 2MYSA 2NUPB 4M75F 1E6GA 4OMLA 2L3RA 2OX7A 1VA7A 2I2LA 3CCQT 3REAB 4E47A 5GMKe 1XNIA 2HL3A 1VQMA 4BY6B 3JCMP 2KK4A 3UA6A 2ESWA 3JCMf 4DOVA 1S72Q 1B3QA 4X34A 3CCVA 2EQUA 4C5IA 3CBMA 3OMCA 3GOXA 4A4FA 2L2PA 1WHMA 3MP8A 8ATCB 2LZ6B 4C0ZA 1D1AA 4J9IA 3LWIA 4HA8A 3G1JA 4MDXA 2HAXA 5J3BA 1IB8A 5GAOq 3G4SA 1J3TA 3O5ZA 4KGVB 2JS2A 2ROLA 1BK2A 4IUUA 1D09B 1Y96A 4M75G 2LCSA 3RUXA 4IUVA 3MP1A 2A3LA 3P8DA 4X9DA 4LDXA 4DBRA 3EGDA 3ER0A 3C12A 1YJWA 2HQHA 2PVDB 3EG0A 1Q86R 2EQIA 1PD1A 4UC4A 2LT4A 1M8MA 3M58A 1VQ9A 3UWNA 4QW2A 4A4GA 4WCIA 3JB9D 3I55Q 5LJ5h 2EJ9A 4R56A 2LDMA 2FZKB 4IUQA 2EGAA 4JRQA 4LXCA 4KBMB 2HNIA 5J39A 2XIDA 2EYQA 5LJ5j 2DL4A 2ZPGB 4BB7A 1YJ9Q 5CO7A 4M78G 1WXTA 4R55A 2G6FX 4BD3A 2DRMA 4WTOB 3UPUA 2CP2A 2RI3A 3H41A 1YJNA 1VOMA 3NGPA 3MCAB 5FU7C 1IGUA 5IHKA 3VS4A 2QDLA 1YCSB 2Y4XA 4JDSA 1UGVA 1UGPB 3C0CA 5GMKm 1YJ9T 3CMET 1RLQC 3CMEQ 4JLIA 2KT1A 1JEGA 1CKAA 1F1BB 1I4K1 2DXBA 3GBQA 5GAN4 3LX7A 3KXTA 3OS0A 1K8AR 5HK0A 2VASA 2HKNA 3DB4A 1M8VA 3X25B 3M9QA 4FSXA 2FG0A 1QLYA 2MF2A 1M1KC 3C4SA 3MEAA 3RKWA 4XU2A 4BACA 4FT4A 3CCRQ 1WHLA 1LCKA 2K3XA 3GP8A 4BI8B 1R0CB 1N27A 2R5AA 1T0JA 2QAZA 2DILA 3A8LB 1I5OB 5GMKl 2RJFA 5KYUA 3ME9A 3SHWA 9ATCB 2CKKA 1N5ZA 4FU6A 1VIFA 1YHQQ 1I8FA 4F14A 3L2WA 1UJ0A 2J6FA 1U3OA 1IRXA 1M90C 5GAOm 3EFRA 1D3BA 3PT9A 3V8KA 1PD0A 2MMPA 1M4ZA 1ZSZB 1YWPA 3CCLQ 4XU0A 2XDBA 2H8HA 5GAMj 1VQ8T 2V8IA 4M78B 1TH7A 2CP0A 1BCMA 1M90U 2VWFA 2RJCA 4KH0B 4EMGA 4M7AC 2JMCA 3SWNA 1VQNT 2P4TA 1S72T 1W1FA 3EGUA 2DTOA 3WVDB 2K5FA 1OPLA 4XU3A 1I5LA 3UATA 2O4XA 3JCMW 4M77G 2KYMA 3CCMQ 1C0MA 1G8XA 4RG8A 5FW9A 3FIFA 4O6JA 1MV0B 2GTOA 1M30A 3EGDB 3NTIA 3G71T 4J9HA 2A0FB 4DBFA 4EMKB 1AWJA 3GNGA 2XI9A 3QIIA 1H641 2GFAA 1OQKA 4PJNA 5GANe 1M2OA 5FRNA 1VQMT 2DTHA 1DJ7B 4HT9A 2ZZDA 1QKWA 1JXOA 3VYHB 1W4SA 2OTJQ 1WQWA 2QGGA 3AT1B 1RAHB 3QDRB 3G6EQ 1M2VB 1FWZA 2DAQA 5LJ3f 5DY9A 1VYUA 3T9NA 5GAN3 3CCSA 1VQKA 4FL6A 1TS9A 2RQWA 4K11A 2G3RA 1D1CA 1WGSA 2CYZB 1FXXA 4EIKA 1KFZA 2ENMA 1R0BG 2MCNA 1X69A 2DNUA 3JB9I 1A0NB 1VQLT 3OYGA 1VQ7A 1UECA 1Q95G 3EG3A 3TREA 1KC8R 1VQ6T 2DXTA 3X26B 1SRLA 4M7DD 3META 2O88A 1NEGA 3BDLA 1WJQA 4VUBA 2EQJA 2YLBA 1NLPC 2COWA 4JPBW 2A37A 2KY9A 2HSEB 3HRUA 4RTXA 1PRMC 3CCET 1O75A 4OMPA 2EVRA 2FVUA 4HVVA 2DXUA 1Q82C 3OYJA 1K8AC 2JTEA 4E7JA 1WNLA 4RG2A 3HRTA 5KYYB 4C8QC 3VS6A 4PJOF 2P0PA 3OS5A 2JUFA 3CCUA 3N5BB 2FRWA 5CKFA 2DPPB 1ZSZC 3S3MA 5GAOr 2IIMA 2O9VA 2JNGA 4BDZA 3JCMJ 3CXCP 2D8HA 2RN8A 3F70A 1S1NA 3FEOA 3H0IA 4YTLA 1VQ5T 3CC4A 2RB6A 4C0DB 2AIRB 2DBKA 8AT1B 4M7AB 2M0YA 3M0TA 4C8QD 4OMFB 2DEUA 4PJJA 2KXCA 4N4HA 1WX6A 1H92A 3TVTA 2PNIA 2PTKA 2KNBB 3NTKA 1G3TA 1TUGB 1UGSB 5AYFA 1M90R 1VQ5A 4M7AG 2K5LA 4A4EA 4PL6A 3G7ZA 3HKSA 3U23A 1GCQC 1VQ4A 1UFFA 3CCUT 3VS2A 4ANJA 1ZLMA 4RUGA 5EC7A 1BKBA 4JJCA 2KAFA 4ELYC 5GAMh 1VUBA 2YDLA 4QKUA 4JS5A 3M0QA 4OP0A 1RLPC 2JOYA 4FYYB 5IH2A 4ZN1A 5GAOn 1NBEB 3J81E 3CCVT 3CCEQ 4PJOG 4BY6C 3H0HA 1EFNA 4OB1B 5GMKh 2BE9B 1JJ2P 1ZBJA 2OJ2A 2V1QA 2YHTA 2JM8A 3VS1A 2IPOB 3D7SB 4KULA 2V8KA 4J9BA 2HSPA 2O2OA 5LJ3h 4N0AC 1ZUUA 3VRYA 1U8RA 1N8RR 5FWBA 5GAN8 1BBZA 2K57A 4A63B 3EFOB 1Q81R 4PJOE 2KBTA 1WPYA 3OY9A 3FJ5A 1VYTA 1KQSA 1YI2A 4XTVA 1VQLQ 4C5HA 4CI0C 5A2QE 3RMSA 2EJGA 1VQ8Q 2EYXA 1VQ6Q 2CUDA 1NJIU 2P4RA 3LH5A 2ZPIB 1M5Q1 1TTHB 4NL3A 3SWNC 1QVGP 1RAIB 2LQ8A 3TSZA 1M1KR 5I21A 3TCJA 2DK3A 1YHQT 4MMLA 3LYIA 4LNPA 1QCFA 4FW1A 2KT8A 4J5YA 2KSSA 5IN1A 1UGRB 3E19A 4IIOA 1ZUYA 3BDUA 4KT0E 2RQTA 1JU5C 2E10A 4LDWA 2COZA 1PRLC 3PMIA 4LDUA 2YUOA 3E9GA 4ATOA 3M55A 1TU0B 1OZ3A 1JB0E 1VQLA 2DD5A 1NJIC 4C0DC 2CH4W 4PJLA 3RKXA 3S6WA 3OBYA 2GQVA 5FU6C 4Z02A 5GANj 5FROA 4XTWA 4RTWA 2NYSA 1WJRA 2E4HA 5HKCA 4PJOD 1GFDA 5I2MA 1N9SA 2HMAA 5FU7B 2QI2A 1RUWA 5DLOA 2F2VA 1M27C 1YITA 1LOJA 3QG1A 3OYCA 2EPDA 2X9HA 3M5AA 2QEXQ 5GANh 2J6OA 4F04B 1BI1A 2OTLT 1V76A 5KYUB 1PHTA 2GTJA 3GPLA 1Y7XA 4JRKA 3E9FA 4MDWA 4M77C 2LVMA 2RK2A 1ZQ1A 3LWHA 2VGMA 2KVQG 4KUIA 3CC7A 2RI2A 1LNXA 1Y96B 2YLCA 1VIEA 2JMAA 3RDVA 5DM7R 4QT7A 2CP5A 3EG9B 1K73R 4AG2C 1UTIA 1Q7YU 4M7AE 2EYYA 1BIAA 1LJOA 1NLOC 2L3SA 5I11A 1SPKA 5C6SA 2PU9B 1YI2T 3RR6A 2WSFE 3CCJQ 1WYXA 2LJ1A 4LD6A 2LMJA 4RTVA 3JB9G 3RMQA 2R58A 3CPFA 1V29B 1ZA1B 2E41A 3OYAA 4Y91A 1ZA2B 1CKBA 4DBQA 1NPPA 3RESA 1ABQA 1K0XA 2JTFA 1D0ZA 2F5TX 4KRTA 5GMKj 4FSSA 2Z0WA 1K9MR 4OGCA 2XKOC 1B34B 4LE9A 3O8VA 1TUCA 2E12A 2LC4A 2XG8D 3R6NA 4M75C 3PE0A 1K73C 1MUZA 5GAN7 5LJ5e 1G3YA 4C92C 2LTOA 1X27A 3FC3A 1N8RU 4E7HA 4LD9K 1KQSP 1WFWA 1AHJB 3CCJA 3CC7T 2K7AA 1QCNA 2LRQA 1YITQ 3MJXA 3ZBDA 4NL2A 1PSFA 3I56T 1Q82U 4BE0A 2EQKA 5GAN5 2V26A 2F2WA 3OSVA 5IHNA 2QQBA 2K4YA 3HHTB 2A28A 2YRCA 2OTLQ 4GLMA 4M7AD 3OYFA 2VUBA 3VV0A 3L2QA 4DEXA 4J7IA 2O9SA 2E70A 2ZGWA 3JCMQ 2E1HA 2KI7A 2CSIA 1YBYA 4HCBA 1WHKA 3QWYA 1YWOA 2C0TA 3V7CA 1T3SA 1BYMA 4QVDA 1VQ7Q 1BI3A 1GCPA 4C92A 2GCXA 3A8MB 4HCCA 3CMEA 4JS4A 4J6WA 2LP5A 3R6OA 2HCKA 2OAWA 1FYNA 1PKSA 2J6KA 2ECZA 2KMTA 3FRNA 2QA4Q 3VUZA 3JCMX 1BI0A 2RJEA 1VYVA 2NUTA 1X6OA 5FRMA 3JCMV 1YJWQ 4M7AA 2BZ8A 1OULA 5GAN6 1JBMA 1JJ2S 3CD6Q 3VJPA 2F2XA 3VU3C 4X9CA 4JRIA 3WVEB 1BCOA 2RO0A 1QMCA 1GRIA 2JM9A 2PVOB 2CS7A 1K9MU 3CCMA 2RM4A 2AZSA 2RNAA 5LL6S 3JCMh 1AOJA 1HK9A 5IXBA 1NJIR 4Y92A 3JB9F 2WACA 4PJOA 2J7IA 1NYFA 5KYNA 2P0QA 2FHDA 3M4YA 1SRMA 2L89A 2CZ1B 4XTYA 1M3AA 3M4GA 1S72A 3NHNA 1UB4A 3EG1A 1RACB 3JB9J 1X2QA 3EGXB 3CC2T 1VQKT 1YJWT 1MMNA 3QZ9B 1KC8C 1W6XA 2NLUA 3CPWA 4JJDA 2VXFA 1LPLA 1UHCA 4M78F 1N9RA 1U1SA 4MZMA 3OB9A 4KGZB 2O4XB 4BI4A 3CCSQ 1YIJT 2QYZA 4RTUA 1VQ4Q 3OYNA 1VQ5Q 3SEMA 1OX8A 3QKJA 2EBPA 4L59A 3CC7Q 1NM7A 4ELZC 3QDFA 1SF9A 1RI0A 1KK7A 2RA2A 3G4ST 4DA4A 3JRZA 2CREA 3HTRA 2B8AA 2M02A 4F16A 1BIBA 2X3WD 3C95A 3CBPA 2E6NA 2CP6A 4RTYA 4C8QB 4Q5WA 1SG5A 2DZCA 3M0RA 1QKXA 2QQ9A 1BB9A 1PM3A 3H6ZA 1Q86C 1B34A 3OW2S 1Y71A 1XOVA 2MK5A 4M7AF 2C0OA 2DETA 5C0MA 2K2VA 1I0CA 5GAMe 3EFSA 4OB0B 5I22A 1NPRA 1W70A 3OYHA 2FB7A 2QASA 2L0AA 3E2UA 1OEBA 5KE3A 1KJWA 1YCYA 2NUZA 3EG2A 3FB9A 4BI3A 3VYGA 3DLMA 4O5VA 3ULRB 1YI2Q 5GANf 3VS7A 4M77B 5IXFA 1GCQA 2H3JA 1D0XA 2DE0X 2EGCA 1W2BA 2EWNA 2XHCA 1RAFB 2HEQA 3Q1JA 1BI2A 5A0GA 1YJ9A 3OS2A 3QHSA 4AFZC 2K9GA 3SFMA 3OW2P 1IHWA 2EFIA 4E7LA 4M7DG 2LQNA 3SB2A 1QWFA 1AZEA 2FRYA 2CT3A 5DLQE 5GAOp 4V2SA 4QVCA 2CP7A 1PWTA 4EPCA 2RK1A 4WF2A 2LJ0A 2HZYA 2E5QA 5HCKA 4IKFA 4OF1A 3G6ET 1QVGS 2C0IA 2LQWA 4M77F 1RAEB 5GANg 4Y28E 1KSWA 4OMMA 3DB3A 3KBGA 2MOXA 1OU8A 4L5GA 4BE1A 5LJ3d 2KRMA 1VQMQ 3HFNA 4N4GA 3THKA 2GGRA 1OOTA 2QG9B 1G2BA 1Z9QA 3FJPA 1EZZB 4C92D 4MMKA 1OV3A 4NS5A 3I56Q 2M9UA 4FW2A 3I5RA 3SWNB 2CUBA 4M75D 1WZOA 4J8OA 1XTDA 3EAEA 4JZ4A 4ZTFA 1D1BA 1RABB 5CCAA 4QQ6A 1HSQA 5D6WA 1VQOQ 1Q81C 3V8JA 1AZGB 3MEUA 5L8RE 2JW4A 2DJQA 4F7UA 3A5ZB 2XDDA 2E3IA 3QJYA 2JN0A 5CKDA 4DBHA 1WXUA 1K4US 1Y0MA 1WI7A 3VS5A 4QQGA 3PIPA 2VYTA 1M3CA 1MMDA 1BU1A 1WHHA 2CZ6B 3TU4K 1YJNQ 1ARKA 2YWWA 4DEYA 2K3YA 1GL5A 4C92G 5FU6B 1K8AU 4A53A 4ZN3A 1QVFP 2L3QA 4JJNK 3CEYA 2EYWA 2MWOA 1JXMA 1PKTA 3EFOA 2D9TA 5CKEA 3JV3A 3ZL7C 2WSEE 1IGQA 2MAMA 5GJVB 2J06A 2PUKB 4AT1B 1SEMA 4N0AA 1TG0A 3OYYA 3QZ5B 4P5NA 1YIJA 2FPEA 5GMKi 1VQPT 3HSBA 4C92E 3A8OB 2VKNA 2F5KA 3QXEB 5CKBA 1VQPA 2CSQA 2DO3A 3CC2A 4M77A 3GIBA 3CPWP 2AKKA 4J9FA 2E3HA 4ZNXA 3RNJA 2DA9A 1HD3A 1M9SA 4B9WA 5EG2A 5FLXE 5GANd 2GF7A 5CR2A 4J9CA 2RI5A 1Y07A 4DOWA 3SDZA 1WLPB 1HJDA 2W10A 2O31A 1KG1A 4PKCC 4RMOA 1H3HA 2NUPA 4IURA 1SHGA 3ZFJA 2DVJA 2KE9A 1AEYA 2CP3A 4J6XA 1RI9A 3CCMT 4PNOA 4FYVB 1I1JA 5L23A 3OYBA 3CMAT 1OI1A 4TVRA 4ORZA 4M75B 2JXBA 3L1AA 3X20B 1UHFA 2EKHA 3OYKA 2VC8A 2DERA 5KYXB 3A1PA 2KQWA 2DZ9A 3OYIA 3V8LA 4ME7A 2KROA 3EH1A 3MPUB 3M0PA 4PJOC 3H9NA 2QQRA 4RKUE 1QVFA 1YITT 1ZSGA 2DYIA 2MPXC 3MEVA 5GJWB 1MHNA 2IG0A 3TQ7P 2PZ1A 3CMAQ 1MNEA 2EQMA 4AG1C 2FPDA 2DEQA 1ZSZA 1UUEA 4M7DC 3CC4Q 2QTXA 2QXFA 3V7RA 4HVWA 1KQ2A 3DKMA 3GLXA 4FCYA 1GBRA 3VUBA 2OTJA 3L2ZA 4DQ2A 3ZEHA 3VKIA 4FM4B 3L42A 2W0ZA 1WDXA 2HBPA 4KH1B 4E7KA 2A7YA 1WQ7A 1QP3A 2BIVA 1X75C 4MZTA 3G6EA 2JTMA 2X4YA 1OU9A 2IVWA 3EHQA 4JJBA 2KR3A 4M78D 3BFMA 4HCZA 1QQJA 2XU8A 3JCMd 2JVVA 2CGHA 2M16A 1TOVA 2LT1A 3G71A 2K79A 3L2UA 1KHCA 1C1AA 2DFUA 3OMGA 2Y4YA 3CPWS 5CK9A 4E7SA 3OS1A 4BDYA 2RQRA 1FMWA 1IXDA 2X4WA 2H3EB 1AWWA 1NZ9A 2FPFA 3BW1A 1QWEA 2KYBA 3M53A 4N4IA 3WXMB 1H8KA 5CIUA 2YUQA 4HT8A 5IAYA 3QPHA 3CCVQ 1MV3A 2XMFA 2LCCA 3S3NA 2CZ7B 2DJZA 4NOYA 2MWPA 3V7SA 4RTTA 3LGLA 1VQOT 1UGQB 1X01A 3I5SA 3G71Q 1X6GA 2DIQA 2XICA 4F7UG 1JO8A 3UT1A 3OW2A 3CQTA 1KD1R 3FDRA 2KDSA 2HKQB 2HQXA 2BUDA 3QYHB 3PNWC 1W2BP 1VQKQ 4M78E 3MKDA 3M56A 3CD6A 2RQUA 5LJ3j 3QUIA 3HPWA 3EHRA 4II1A 3QWXX 2NWMA 1KIKA 2DKGA 3KFVA 5CQXA 1C6VX 3JSCA 4BUGA 1VQ4T 3CCUQ 4BE2A 2VV5A 1K1ZA 2K2MA 4IUPA 4KUDK 5D6XA 5KYYA 5FWCA 1MGQA 2A08A 3H0FA 5KH6A 1OPKA 3MHXA 3MP6A 2D6FA 2BE7D 4OMNA 5LJ5g 2P84A 4GBQA 1KQSS 1UG1A 1QVPA 3P8HA 1QVFS 3OYEA 1KD1C 1IZ6A 1K0SA 4GY5A 2L5QA 3FLGA 2CH4A 4B9XA 2COYA 4FT2A 1OX9A 4HXJA 4J6YA 1D3BB 4PLLA 2RH2A 2EAYA 3M59A 4D8DA 3SD4A 2SRCA 4PFZA 2DD4A 4M78A 2HDAA 2ROTA 4R0KA 3EGXA 2QA4T 2PQWA 2VB6A 4C5GA 3UF4A 1AWXA 2FO0A 1M1GA 1QP2A 3NTHA 5IT9E 5HY6A 2ZCFB 2LJ3A 1FMVA 1Y57A 3E1SA 1PG5B 3G4SQ 4B6MA 4M77E 3QJ6A 4OMOA 1SSFA 4ZGJB 4J9EA 4XTZA 4QVZA 5LJ5f 1E6HA 1Q81U 2KRNA 3IQLA 3PVLA 2CDTA 5LJ3g 1TWBA 6AT1B 3CCLA 2QEXA 4PK4A 1R77A 3JAME 3OYLA 4C8QA 1QVGA 3HFOA 4CC2A 1VQ7T 5GAN2 4CC7A 2X51A 2V1RA 3PGGA 1JRIA 4ESRA 1FX7A 4Z8AA 1TSFA 3RERA 2ATCB 1YP5A 4F7UB 4E2FB 2LX9A 1VQOA 1VQNA 5D7UA 1M1FA 2KXDA 1MMAA 1I07A 5GAOl 4D8KA 4GLKA 3CCRA 4QQDA 1EX4A 2RMOA 3TEEA 5CKHA 1K76A 4XQ3A 1ZUKA 2RD1A 2B86A 2DM1A 4C0FA 4LUEA 4XTUA 5LJ5d 2AT1B 4HVUA 2E64A 4E7ZA 4J9DA 2EKOA 4M75E 2VVKA 2Y90A 1Q82R 2QGFB 3X28B 7AT1B 4M7DA 3CD6T 3I9QA 3QYGB 2VXEA 3L2RA 4F7UF 2ABLA 2HL5C 1PC0A 5CQYA 2PVGB 4JZ3A 1UE9A 2FZCB 4XU1A 1E7OA 2CT4A 1AVZC 4MZPA 1G3WA 1VQ9Q 2OTLA 1ZBXA 2DBMA 3VS0A 2R57A 2FZGB 1VQPQ 2M0OA 2R5MA 3INZA 2ZPEB 4F17A 2BZYA 5A0DA 5KYWA 1XJWB 5KYWB 2LCLA 2DRKA 1WHGA 3DLLA 2DYBA 2DLPA 2X3XD 1VQ8A 2ZAEA 1CSKA 4RTZA 3CCRT 3I55T 2DX1A 2NUTB 2OTJT 1G3SA 2LNVA 2KEAA 5GAMf 3LW5E 2M1HA 2LNHB 3P8BB 4C92F 5KE2A 3MEWA 3RKYA 3CC4T 2GQIA 2JZ2A 4RCBA 5GAMg 2RPNA 4E6RA 1ACMB 1ZHIA 3LGFA 1Q86U 4M75A 1O9SA 2CZ0B 2YXYA 2O01E 2D8JA 2HBWA 2QEXT 1GBQA 2RQVA 3URGA 1P92A 4LDYA 1YJNT 4OMQA 3UDCA 5CVIA 2AHJB 4ZGEB 2RF0A 1GFCA 1T3LA 3CCQQ 3I35A 2LX7A 2E6ZA 2P0KA 2M51A 2MI6A 2QQAA 3M54A 4LN2A 3CCEA 1YN8A 1RAGB 1YHQA 3JCMe 3M0SA 3CMAA 5IHIA 3EG9A 3A8GB 4RCCA 3QO3A 2ZPHB 1WXBA 3A8HB 1VQ6A 4EMKA 1K9AA 1NG2A 1T0HA 4EMHA 2GBQA 4JUVA 3HRSA 4AFQC 1HYOA 2DL3A 2L3PA 5ECAA 3UA7A 2E65A 2BKDN 1B7TA 1ZX6A 1KQ1A 1M3BA 1U1TA 1RAAB 4XK8E 2DL7A 4Z88A 2ZPFB 2DVEA 3I55A 4C0GA 1AT1B 3OA6A 1KD1U 5CAIA 2VGNA 1D0YA 2EIFA 3MO8A 4C5EA 1IHVA 5J26A 4M78C 4ZTJA 1IO6A 1SKUB 3JCMg 2J05A 2D0QB
chains in the Genus database with same CATH topology
3CCUQ 1VQMQ 1Q81R 1K8AR 1YIJQ 1K9MR 2QA4Q 3CCVQ 3CCLQ 1Q7YR 3I55Q 1JJ2P 1KQSP 1VQ5Q 1KD1R 1YJNQ 3CCJQ 3CCQQ 3CC4Q 1VQ9Q 1YJ9Q 1Q82R 3CC7Q 1VQPQ 1VQNQ 1YI2Q 3CMEQ 3CCMQ 1YITQ 1YJWQ 1QVFP 1VQLQ 3CC2Q 3I56Q 1W2BP 1NJIR 3G4SQ 1VQKQ 3CPWP 3CD6Q 1YHQQ 2QEXQ 1S72Q 1Q86R 1VQ7Q 1VQ8Q 1N8RR 1M90R 3G6EQ 2OTJQ 3CXCP 1VQ6Q 3CCRQ 2OTLQ 3CMAQ 3G71Q 3CCEQ 1K73R 1KC8R 3CCSQ 1VQOQ 3OW2P 1QVGP 1VQ4Q 1M1KR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU Q;  1VQM Q;  1Q81 R;  1K8A R;  1YIJ Q;  1K9M R;  2QA4 Q;  3CCV Q;  3CCL Q;  1Q7Y R;  3I55 Q;  1JJ2 P;  1KQS P;  1VQ5 Q;  1KD1 R;  1YJN Q;  3CCJ Q;  3CCQ Q;  3CC4 Q;  1VQ9 Q;  1YJ9 Q;  1Q82 R;  3CC7 Q;  1VQP Q;  1VQN Q;  1YI2 Q;  3CME Q;  3CCM Q;  1YIT Q;  1YJW Q;  1QVF P;  1VQL Q;  3CC2 Q;  3I56 Q;  1W2B P;  1NJI R;  3G4S Q;  1VQK Q;  3CPW P;  3CD6 Q;  1YHQ Q;  2QEX Q;  1S72 Q;  1Q86 R;  1VQ7 Q;  1VQ8 Q;  1N8R R;  1M90 R;  3G6E Q;  2OTJ Q;  3CXC P;  1VQ6 Q;  3CCR Q;  2OTL Q;  3CMA Q;  3G71 Q;  3CCE Q;  1K73 R;  1KC8 R;  3CCS Q;  1VQO Q;  3OW2 P;  1QVG P;  1VQ4 Q;  1M1K R; 
#chains in the Genus database with same CATH topology
 3I56 A;  3LLR A;  4L6V 5;  2L8D A;  3GNF B;  1UEB A;  5KCO A;  1M2V A;  1MND A;  1H3Z A;  3CCJ T;  4HKE A;  4C92 B;  2I0N A;  2JJ9 A;  3CBO A;  2QA4 A;  3PTA A;  5I2S A;  1G5V A;  5GAM d;  4C8Q F;  4M4Z A;  3PVQ A;  4M7D B;  3GF5 A;  2YT6 A;  2DL5 A;  1SHF A;  4KGX B;  3A98 A;  2FEI A;  1X6B A;  2GFU A;  3LH0 A;  4FYX B;  4IUT A;  4LDV A;  1VQ9 T;  3CCQ A;  1U06 A;  1HXD A;  2X4X A;  3AHU A;  1RL2 A;  2OAU A;  2DL8 A;  5KYX A;  4HCK A;  1NYG A;  2QTV A;  3NMZ C;  3BY7 A;  2FL7 A;  1UJY A;  4OB3 B;  4XAX B;  4A4H A;  1G83 A;  1V1C A;  2AZV A;  4A4K A;  2F1L A;  2DF6 A;  3M0U A;  1KC8 U;  4OVA A;  2X35 A;  4AFS C;  1Q7Y C;  1IRE B;  5KCH A;  2V8J A;  4CC4 B;  3ASK A;  1WA7 A;  3OQ5 A;  2RHI A;  1U5S A;  3J80 E;  2YUN A;  3RBB B;  3M57 A;  2BTT A;  4M7D F;  4AFU C;  4C8Q G;  2MIO A;  3PFS A;  1NEB A;  3OSS C;  2K3B A;  1QW1 A;  1RAD B;  2JS0 A;  3JCM c;  1PSE A;  4X1V A;  3C94 A;  1K9M C;  2DTI A;  3L2V A;  4CRI A;  1N6A A;  4CC3 A;  1OYX A;  2XDP A;  3HP9 A;  2WSC E;  2EJF A;  4F7U E;  1FMK A;  2QDY B;  5HK3 A;  3OYM A;  2EGE A;  2YRD A;  2JT4 A;  3X24 B;  1X43 A;  2HQE A;  5AT1 B;  3PIO A;  1JJ2 A;  1ABO A;  2K5I A;  1Q7Y R;  4PFP A;  1GXI E;  2RHX A;  4IIM A;  2GNC A;  4J7F A;  3H8Z A;  3NPF A;  2C06 A;  4M7D E;  4D6W A;  2DMO A;  1UDL A;  4OGE A;  4JRP A;  1YFN A;  1R8O B;  1TUD A;  3EH2 A;  2X4J A;  1PNJ A;  2BZX A;  2PUO B;  4PJO B;  2D0N A;  1W2B S;  4ZGD B;  2F69 A;  3OYD A;  3CCS T;  1YIJ Q;  3REB B;  3OBW A;  3VRZ A;  2A36 A;  2YUP A;  3CXC S;  2DXC A;  1AWO A;  2ED0 A;  5M9O A;  4FYW B;  3KUF A;  2E5K A;  5D6Y A;  2FYK A;  2EYZ A;  3CCL T;  3RIR A;  4J83 A;  3CC2 Q;  1TXQ A;  4PJM A;  2RHU A;  3JCM b;  2HD0 A;  1SSH A;  1WHJ A;  2DIG A;  2RHY A;  2XD0 A;  2XK0 A;  1M1K U;  2AKL A;  3TSW A;  3J7A F;  2K6D A;  1PCX A;  1NE8 A;  2EW3 A;  3HL8 A;  2OI3 A;  2KGT A;  2ED1 A;  2YSQ A;  3CXC A;  1OZ2 A;  4LUD A;  1X2K A;  4JLG A;  2RJD A;  4C8Q E;  2AK5 A;  1I81 A;  1AD5 A;  5A0L A;  1WJS A;  4E7I A;  1N8R C;  1EIF A;  1B07 A;  4FIB A;  1KHI A;  2RHZ A;  4XTX A;  1QCO A;  4OB2 B;  1JQQ A;  4EDU A;  2D1X A;  1WIE A;  2SEM A;  4M77 D;  1K73 U;  1Z9Z A;  1XQH A;  2QQS A;  1MMG A;  4J9G A;  4EMK C;  1VQN Q;  2YRV A;  4PFO A;  2LQK A;  2QK0 A;  1LVK A;  4Z89 A;  1YNZ A;  3QBY A;  3NFC A;  3QSU A;  3BE3 A;  4PLI A;  2KRS A;  5LJ3 e;  3S3O A;  3PMT A;  3VS3 A;  4AMC A;  4A54 A;  2ZPB B;  3JB9 H;  2MYS A;  2NUP B;  4M75 F;  1E6G A;  4OML A;  2L3R A;  2OX7 A;  1VA7 A;  2I2L A;  3CCQ T;  3REA B;  4E47 A;  5GMK e;  1XNI A;  2HL3 A;  1VQM A;  4BY6 B;  3JCM P;  2KK4 A;  3UA6 A;  2ESW A;  3JCM f;  4DOV A;  1S72 Q;  1B3Q A;  4X34 A;  3CCV A;  2EQU A;  4C5I A;  3CBM A;  3OMC A;  3GOX A;  4A4F A;  2L2P A;  1WHM A;  3MP8 A;  8ATC B;  2LZ6 B;  4C0Z A;  1D1A A;  4J9I A;  3LWI A;  4HA8 A;  3G1J A;  4MDX A;  2HAX A;  5J3B A;  1IB8 A;  5GAO q;  3G4S A;  1J3T A;  3O5Z A;  4KGV B;  2JS2 A;  2ROL A;  1BK2 A;  4IUU A;  1D09 B;  1Y96 A;  4M75 G;  2LCS A;  3RUX A;  4IUV A;  3MP1 A;  2A3L A;  3P8D A;  4X9D A;  4LDX A;  4DBR A;  3EGD A;  3ER0 A;  3C12 A;  1YJW A;  2HQH A;  2PVD B;  3EG0 A;  1Q86 R;  2EQI A;  1PD1 A;  4UC4 A;  2LT4 A;  1M8M A;  3M58 A;  1VQ9 A;  3UWN A;  4QW2 A;  4A4G A;  4WCI A;  3JB9 D;  3I55 Q;  5LJ5 h;  2EJ9 A;  4R56 A;  2LDM A;  2FZK B;  4IUQ A;  2EGA A;  4JRQ A;  4LXC A;  4KBM B;  2HNI A;  5J39 A;  2XID A;  2EYQ A;  5LJ5 j;  2DL4 A;  2ZPG B;  4BB7 A;  1YJ9 Q;  5CO7 A;  4M78 G;  1WXT A;  4R55 A;  2G6F X;  4BD3 A;  2DRM A;  4WTO B;  3UPU A;  2CP2 A;  2RI3 A;  3H41 A;  1YJN A;  1VOM A;  3NGP A;  3MCA B;  5FU7 C;  1IGU A;  5IHK A;  3VS4 A;  2QDL A;  1YCS B;  2Y4X A;  4JDS A;  1UGV A;  1UGP B;  3C0C A;  5GMK m;  1YJ9 T;  3CME T;  1RLQ C;  3CME Q;  4JLI A;  2KT1 A;  1JEG A;  1CKA A;  1F1B B;  1I4K 1;  2DXB A;  3GBQ A;  5GAN 4;  3LX7 A;  3KXT A;  3OS0 A;  1K8A R;  5HK0 A;  2VAS A;  2HKN A;  3DB4 A;  1M8V A;  3X25 B;  3M9Q A;  4FSX A;  2FG0 A;  1QLY A;  2MF2 A;  1M1K C;  3C4S A;  3MEA A;  3RKW A;  4XU2 A;  4BAC A;  4FT4 A;  3CCR Q;  1WHL A;  1LCK A;  2K3X A;  3GP8 A;  4BI8 B;  1R0C B;  1N27 A;  2R5A A;  1T0J A;  2QAZ A;  2DIL A;  3A8L B;  1I5O B;  5GMK l;  2RJF A;  5KYU A;  3ME9 A;  3SHW A;  9ATC B;  2CKK A;  1N5Z A;  4FU6 A;  1VIF A;  1YHQ Q;  1I8F A;  4F14 A;  3L2W A;  1UJ0 A;  2J6F A;  1U3O A;  1IRX A;  1M90 C;  5GAO m;  3EFR A;  1D3B A;  3PT9 A;  3V8K A;  1PD0 A;  2MMP A;  1M4Z A;  1ZSZ B;  1YWP A;  3CCL Q;  4XU0 A;  2XDB A;  2H8H A;  5GAM j;  1VQ8 T;  2V8I A;  4M78 B;  1TH7 A;  2CP0 A;  1BCM A;  1M90 U;  2VWF A;  2RJC A;  4KH0 B;  4EMG A;  4M7A C;  2JMC A;  3SWN A;  1VQN T;  2P4T A;  1S72 T;  1W1F A;  3EGU A;  2DTO A;  3WVD B;  2K5F A;  1OPL A;  4XU3 A;  1I5L A;  3UAT A;  2O4X A;  3JCM W;  4M77 G;  2KYM A;  3CCM Q;  1C0M A;  1G8X A;  4RG8 A;  5FW9 A;  3FIF A;  4O6J A;  1MV0 B;  2GTO A;  1M30 A;  3EGD B;  3NTI A;  3G71 T;  4J9H A;  2A0F B;  4DBF A;  4EMK B;  1AWJ A;  3GNG A;  2XI9 A;  3QII A;  1H64 1;  2GFA A;  1OQK A;  4PJN A;  5GAN e;  1M2O A;  5FRN A;  1VQM T;  2DTH A;  1DJ7 B;  4HT9 A;  2ZZD A;  1QKW A;  1JXO A;  3VYH B;  1W4S A;  2OTJ Q;  1WQW A;  2QGG A;  3AT1 B;  1RAH B;  3QDR B;  3G6E Q;  1M2V B;  1FWZ A;  2DAQ A;  5LJ3 f;  5DY9 A;  1VYU A;  3T9N A;  5GAN 3;  3CCS A;  1VQK A;  4FL6 A;  1TS9 A;  2RQW A;  4K11 A;  2G3R A;  1D1C A;  1WGS A;  2CYZ B;  1FXX A;  4EIK A;  1KFZ A;  2ENM A;  1R0B G;  2MCN A;  1X69 A;  2DNU A;  3JB9 I;  1A0N B;  1VQL T;  3OYG A;  1VQ7 A;  1UEC A;  1Q95 G;  3EG3 A;  3TRE A;  1KC8 R;  1VQ6 T;  2DXT A;  3X26 B;  1SRL A;  4M7D D;  3MET A;  2O88 A;  1NEG A;  3BDL A;  1WJQ A;  4VUB A;  2EQJ A;  2YLB A;  1NLP C;  2COW A;  4JPB W;  2A37 A;  2KY9 A;  2HSE B;  3HRU A;  4RTX A;  1PRM C;  3CCE T;  1O75 A;  4OMP A;  2EVR A;  2FVU A;  4HVV A;  2DXU A;  1Q82 C;  3OYJ A;  1K8A C;  2JTE A;  4E7J A;  1WNL A;  4RG2 A;  3HRT A;  5KYY B;  4C8Q C;  3VS6 A;  4PJO F;  2P0P A;  3OS5 A;  2JUF A;  3CCU A;  3N5B B;  2FRW A;  5CKF A;  2DPP B;  1ZSZ C;  3S3M A;  5GAO r;  2IIM A;  2O9V A;  2JNG A;  4BDZ A;  3JCM J;  3CXC P;  2D8H A;  2RN8 A;  3F70 A;  1S1N A;  3FEO A;  3H0I A;  4YTL A;  1VQ5 T;  3CC4 A;  2RB6 A;  4C0D B;  2AIR B;  2DBK A;  8AT1 B;  4M7A B;  2M0Y A;  3M0T A;  4C8Q D;  4OMF B;  2DEU A;  4PJJ A;  2KXC A;  4N4H A;  1WX6 A;  1H92 A;  3TVT A;  2PNI A;  2PTK A;  2KNB B;  3NTK A;  1G3T A;  1TUG B;  1UGS B;  5AYF A;  1M90 R;  1VQ5 A;  4M7A G;  2K5L A;  4A4E A;  4PL6 A;  3G7Z A;  3HKS A;  3U23 A;  1GCQ C;  1VQ4 A;  1UFF A;  3CCU T;  3VS2 A;  4ANJ A;  1ZLM A;  4RUG A;  5EC7 A;  1BKB A;  4JJC A;  2KAF A;  4ELY C;  5GAM h;  1VUB A;  2YDL A;  4QKU A;  4JS5 A;  3M0Q A;  4OP0 A;  1RLP C;  2JOY A;  4FYY B;  5IH2 A;  4ZN1 A;  5GAO n;  1NBE B;  3J81 E;  3CCV T;  3CCE Q;  4PJO G;  4BY6 C;  3H0H A;  1EFN A;  4OB1 B;  5GMK h;  2BE9 B;  1JJ2 P;  1ZBJ A;  2OJ2 A;  2V1Q A;  2YHT A;  2JM8 A;  3VS1 A;  2IPO B;  3D7S B;  4KUL A;  2V8K A;  4J9B A;  2HSP A;  2O2O A;  5LJ3 h;  4N0A C;  1ZUU A;  3VRY A;  1U8R A;  1N8R R;  5FWB A;  5GAN 8;  1BBZ A;  2K57 A;  4A63 B;  3EFO B;  1Q81 R;  4PJO E;  2KBT A;  1WPY A;  3OY9 A;  3FJ5 A;  1VYT A;  1KQS A;  1YI2 A;  4XTV A;  1VQL Q;  4C5H A;  4CI0 C;  5A2Q E;  3RMS A;  2EJG A;  1VQ8 Q;  2EYX A;  1VQ6 Q;  2CUD A;  1NJI U;  2P4R A;  3LH5 A;  2ZPI B;  1M5Q 1;  1TTH B;  4NL3 A;  3SWN C;  1QVG P;  1RAI B;  2LQ8 A;  3TSZ A;  1M1K R;  5I21 A;  3TCJ A;  2DK3 A;  1YHQ T;  4MML A;  3LYI A;  4LNP A;  1QCF A;  4FW1 A;  2KT8 A;  4J5Y A;  2KSS A;  5IN1 A;  1UGR B;  3E19 A;  4IIO A;  1ZUY A;  3BDU A;  4KT0 E;  2RQT A;  1JU5 C;  2E10 A;  4LDW A;  2COZ A;  1PRL C;  3PMI A;  4LDU A;  2YUO A;  3E9G A;  4ATO A;  3M55 A;  1TU0 B;  1OZ3 A;  1JB0 E;  1VQL A;  2DD5 A;  1NJI C;  4C0D C;  2CH4 W;  4PJL A;  3RKX A;  3S6W A;  3OBY A;  2GQV A;  5FU6 C;  4Z02 A;  5GAN j;  5FRO A;  4XTW A;  4RTW A;  2NYS A;  1WJR A;  2E4H A;  5HKC A;  4PJO D;  1GFD A;  5I2M A;  1N9S A;  2HMA A;  5FU7 B;  2QI2 A;  1RUW A;  5DLO A;  2F2V A;  1M27 C;  1YIT A;  1LOJ A;  3QG1 A;  3OYC A;  2EPD A;  2X9H A;  3M5A A;  2QEX Q;  5GAN h;  2J6O A;  4F04 B;  1BI1 A;  2OTL T;  1V76 A;  5KYU B;  1PHT A;  2GTJ A;  3GPL A;  1Y7X A;  4JRK A;  3E9F A;  4MDW A;  4M77 C;  2LVM A;  2RK2 A;  1ZQ1 A;  3LWH A;  2VGM A;  2KVQ G;  4KUI A;  3CC7 A;  2RI2 A;  1LNX A;  1Y96 B;  2YLC A;  1VIE A;  2JMA A;  3RDV A;  5DM7 R;  4QT7 A;  2CP5 A;  3EG9 B;  1K73 R;  4AG2 C;  1UTI A;  1Q7Y U;  4M7A E;  2EYY A;  1BIA A;  1LJO A;  1NLO C;  2L3S A;  5I11 A;  1SPK A;  5C6S A;  2PU9 B;  1YI2 T;  3RR6 A;  2WSF E;  3CCJ Q;  1WYX A;  2LJ1 A;  4LD6 A;  2LMJ A;  4RTV A;  3JB9 G;  3RMQ A;  2R58 A;  3CPF A;  1V29 B;  1ZA1 B;  2E41 A;  3OYA A;  4Y91 A;  1ZA2 B;  1CKB A;  4DBQ A;  1NPP A;  3RES A;  1ABQ A;  1K0X A;  2JTF A;  1D0Z A;  2F5T X;  4KRT A;  5GMK j;  4FSS A;  2Z0W A;  1K9M R;  4OGC A;  2XKO C;  1B34 B;  4LE9 A;  3O8V A;  1TUC A;  2E12 A;  2LC4 A;  2XG8 D;  3R6N A;  4M75 C;  3PE0 A;  1K73 C;  1MUZ A;  5GAN 7;  5LJ5 e;  1G3Y A;  4C92 C;  2LTO A;  1X27 A;  3FC3 A;  1N8R U;  4E7H A;  4LD9 K;  1KQS P;  1WFW A;  1AHJ B;  3CCJ A;  3CC7 T;  2K7A A;  1QCN A;  2LRQ A;  1YIT Q;  3MJX A;  3ZBD A;  4NL2 A;  1PSF A;  3I56 T;  1Q82 U;  4BE0 A;  2EQK A;  5GAN 5;  2V26 A;  2F2W A;  3OSV A;  5IHN A;  2QQB A;  2K4Y A;  3HHT B;  2A28 A;  2YRC A;  2OTL Q;  4GLM A;  4M7A D;  3OYF A;  2VUB A;  3VV0 A;  3L2Q A;  4DEX A;  4J7I A;  2O9S A;  2E70 A;  2ZGW A;  3JCM Q;  2E1H A;  2KI7 A;  2CSI A;  1YBY A;  4HCB A;  1WHK A;  3QWY A;  1YWO A;  2C0T A;  3V7C A;  1T3S A;  1BYM A;  4QVD A;  1VQ7 Q;  1BI3 A;  1GCP A;  4C92 A;  2GCX A;  3A8M B;  4HCC A;  3CME A;  4JS4 A;  4J6W A;  2LP5 A;  3R6O A;  2HCK A;  2OAW A;  1FYN A;  1PKS A;  2J6K A;  2ECZ A;  2KMT A;  3FRN A;  2QA4 Q;  3VUZ A;  3JCM X;  1BI0 A;  2RJE A;  1VYV A;  2NUT A;  1X6O A;  5FRM A;  3JCM V;  1YJW Q;  4M7A A;  2BZ8 A;  1OUL A;  5GAN 6;  1JBM A;  1JJ2 S;  3CD6 Q;  3VJP A;  2F2X A;  3VU3 C;  4X9C A;  4JRI A;  3WVE B;  1BCO A;  2RO0 A;  1QMC A;  1GRI A;  2JM9 A;  2PVO B;  2CS7 A;  1K9M U;  3CCM A;  2RM4 A;  2AZS A;  2RNA A;  5LL6 S;  3JCM h;  1AOJ A;  1HK9 A;  5IXB A;  1NJI R;  4Y92 A;  3JB9 F;  2WAC A;  4PJO A;  2J7I A;  1NYF A;  5KYN A;  2P0Q A;  2FHD A;  3M4Y A;  1SRM A;  2L89 A;  2CZ1 B;  4XTY A;  1M3A A;  3M4G A;  1S72 A;  3NHN A;  1UB4 A;  3EG1 A;  1RAC B;  3JB9 J;  1X2Q A;  3EGX B;  3CC2 T;  1VQK T;  1YJW T;  1MMN A;  3QZ9 B;  1KC8 C;  1W6X A;  2NLU A;  3CPW A;  4JJD A;  2VXF A;  1LPL A;  1UHC A;  4M78 F;  1N9R A;  1U1S A;  4MZM A;  3OB9 A;  4KGZ B;  2O4X B;  4BI4 A;  3CCS Q;  1YIJ T;  2QYZ A;  4RTU A;  1VQ4 Q;  3OYN A;  1VQ5 Q;  3SEM A;  1OX8 A;  3QKJ A;  2EBP A;  4L59 A;  3CC7 Q;  1NM7 A;  4ELZ C;  3QDF A;  1SF9 A;  1RI0 A;  1KK7 A;  2RA2 A;  3G4S T;  4DA4 A;  3JRZ A;  2CRE A;  3HTR A;  2B8A A;  2M02 A;  4F16 A;  1BIB A;  2X3W D;  3C95 A;  3CBP A;  2E6N A;  2CP6 A;  4RTY A;  4C8Q B;  4Q5W A;  1SG5 A;  2DZC A;  3M0R A;  1QKX A;  2QQ9 A;  1BB9 A;  1PM3 A;  3H6Z A;  1Q86 C;  1B34 A;  3OW2 S;  1Y71 A;  1XOV A;  2MK5 A;  4M7A F;  2C0O A;  2DET A;  5C0M A;  2K2V A;  1I0C A;  5GAM e;  3EFS A;  4OB0 B;  5I22 A;  1NPR A;  1W70 A;  3OYH A;  2FB7 A;  2QAS A;  2L0A A;  3E2U A;  1OEB A;  5KE3 A;  1KJW A;  1YCY A;  2NUZ A;  3EG2 A;  3FB9 A;  4BI3 A;  3VYG A;  3DLM A;  4O5V A;  3ULR B;  1YI2 Q;  5GAN f;  3VS7 A;  4M77 B;  5IXF A;  1GCQ A;  2H3J A;  1D0X A;  2DE0 X;  2EGC A;  1W2B A;  2EWN A;  2XHC A;  1RAF B;  2HEQ A;  3Q1J A;  1BI2 A;  5A0G A;  1YJ9 A;  3OS2 A;  3QHS A;  4AFZ C;  2K9G A;  3SFM A;  3OW2 P;  1IHW A;  2EFI A;  4E7L A;  4M7D G;  2LQN A;  3SB2 A;  1QWF A;  1AZE A;  2FRY A;  2CT3 A;  5DLQ E;  5GAO p;  4V2S A;  4QVC A;  2CP7 A;  1PWT A;  4EPC A;  2RK1 A;  4WF2 A;  2LJ0 A;  2HZY A;  2E5Q A;  5HCK A;  4IKF A;  4OF1 A;  3G6E T;  1QVG S;  2C0I A;  2LQW A;  4M77 F;  1RAE B;  5GAN g;  4Y28 E;  1KSW A;  4OMM A;  3DB3 A;  3KBG A;  2MOX A;  1OU8 A;  4L5G A;  4BE1 A;  5LJ3 d;  2KRM A;  1VQM Q;  3HFN A;  4N4G A;  3THK A;  2GGR A;  1OOT A;  2QG9 B;  1G2B A;  1Z9Q A;  3FJP A;  1EZZ B;  4C92 D;  4MMK A;  1OV3 A;  4NS5 A;  3I56 Q;  2M9U A;  4FW2 A;  3I5R A;  3SWN B;  2CUB A;  4M75 D;  1WZO A;  4J8O A;  1XTD A;  3EAE A;  4JZ4 A;  4ZTF A;  1D1B A;  1RAB B;  5CCA A;  4QQ6 A;  1HSQ A;  5D6W A;  1VQO Q;  1Q81 C;  3V8J A;  1AZG B;  3MEU A;  5L8R E;  2JW4 A;  2DJQ A;  4F7U A;  3A5Z B;  2XDD A;  2E3I A;  3QJY A;  2JN0 A;  5CKD A;  4DBH A;  1WXU A;  1K4U S;  1Y0M A;  1WI7 A;  3VS5 A;  4QQG A;  3PIP A;  2VYT A;  1M3C A;  1MMD A;  1BU1 A;  1WHH A;  2CZ6 B;  3TU4 K;  1YJN Q;  1ARK A;  2YWW A;  4DEY A;  2K3Y A;  1GL5 A;  4C92 G;  5FU6 B;  1K8A U;  4A53 A;  4ZN3 A;  1QVF P;  2L3Q A;  4JJN K;  3CEY A;  2EYW A;  2MWO A;  1JXM A;  1PKT A;  3EFO A;  2D9T A;  5CKE A;  3JV3 A;  3ZL7 C;  2WSE E;  1IGQ A;  2MAM A;  5GJV B;  2J06 A;  2PUK B;  4AT1 B;  1SEM A;  4N0A A;  1TG0 A;  3OYY A;  3QZ5 B;  4P5N A;  1YIJ A;  2FPE A;  5GMK i;  1VQP T;  3HSB A;  4C92 E;  3A8O B;  2VKN A;  2F5K A;  3QXE B;  5CKB A;  1VQP A;  2CSQ A;  2DO3 A;  3CC2 A;  4M77 A;  3GIB A;  3CPW P;  2AKK A;  4J9F A;  2E3H A;  4ZNX A;  3RNJ A;  2DA9 A;  1HD3 A;  1M9S A;  4B9W A;  5EG2 A;  5FLX E;  5GAN d;  2GF7 A;  5CR2 A;  4J9C A;  2RI5 A;  1Y07 A;  4DOW A;  3SDZ A;  1WLP B;  1HJD A;  2W10 A;  2O31 A;  1KG1 A;  4PKC C;  4RMO A;  1H3H A;  2NUP A;  4IUR A;  1SHG A;  3ZFJ A;  2DVJ A;  2KE9 A;  1AEY A;  2CP3 A;  4J6X A;  1RI9 A;  3CCM T;  4PNO A;  4FYV B;  1I1J A;  5L23 A;  3OYB A;  3CMA T;  1OI1 A;  4TVR A;  4ORZ A;  4M75 B;  2JXB A;  3L1A A;  3X20 B;  1UHF A;  2EKH A;  3OYK A;  2VC8 A;  2DER A;  5KYX B;  3A1P A;  2KQW A;  2DZ9 A;  3OYI A;  3V8L A;  4ME7 A;  2KRO A;  3EH1 A;  3MPU B;  3M0P A;  4PJO C;  3H9N A;  2QQR A;  4RKU E;  1QVF A;  1YIT T;  1ZSG A;  2DYI A;  2MPX C;  3MEV A;  5GJW B;  1MHN A;  2IG0 A;  3TQ7 P;  2PZ1 A;  3CMA Q;  1MNE A;  2EQM A;  4AG1 C;  2FPD A;  2DEQ A;  1ZSZ A;  1UUE A;  4M7D C;  3CC4 Q;  2QTX A;  2QXF A;  3V7R A;  4HVW A;  1KQ2 A;  3DKM A;  3GLX A;  4FCY A;  1GBR A;  3VUB A;  2OTJ A;  3L2Z A;  4DQ2 A;  3ZEH A;  3VKI A;  4FM4 B;  3L42 A;  2W0Z A;  1WDX A;  2HBP A;  4KH1 B;  4E7K A;  2A7Y A;  1WQ7 A;  1QP3 A;  2BIV A;  1X75 C;  4MZT A;  3G6E A;  2JTM A;  2X4Y A;  1OU9 A;  2IVW A;  3EHQ A;  4JJB A;  2KR3 A;  4M78 D;  3BFM A;  4HCZ A;  1QQJ A;  2XU8 A;  3JCM d;  2JVV A;  2CGH A;  2M16 A;  1TOV A;  2LT1 A;  3G71 A;  2K79 A;  3L2U A;  1KHC A;  1C1A A;  2DFU A;  3OMG A;  2Y4Y A;  3CPW S;  5CK9 A;  4E7S A;  3OS1 A;  4BDY A;  2RQR A;  1FMW A;  1IXD A;  2X4W A;  2H3E B;  1AWW A;  1NZ9 A;  2FPF A;  3BW1 A;  1QWE A;  2KYB A;  3M53 A;  4N4I A;  3WXM B;  1H8K A;  5CIU A;  2YUQ A;  4HT8 A;  5IAY A;  3QPH A;  3CCV Q;  1MV3 A;  2XMF A;  2LCC A;  3S3N A;  2CZ7 B;  2DJZ A;  4NOY A;  2MWP A;  3V7S A;  4RTT A;  3LGL A;  1VQO T;  1UGQ B;  1X01 A;  3I5S A;  3G71 Q;  1X6G A;  2DIQ A;  2XIC A;  4F7U G;  1JO8 A;  3UT1 A;  3OW2 A;  3CQT A;  1KD1 R;  3FDR A;  2KDS A;  2HKQ B;  2HQX A;  2BUD A;  3QYH B;  3PNW C;  1W2B P;  1VQK Q;  4M78 E;  3MKD A;  3M56 A;  3CD6 A;  2RQU A;  5LJ3 j;  3QUI A;  3HPW A;  3EHR A;  4II1 A;  3QWX X;  2NWM A;  1KIK A;  2DKG A;  3KFV A;  5CQX A;  1C6V X;  3JSC A;  4BUG A;  1VQ4 T;  3CCU Q;  4BE2 A;  2VV5 A;  1K1Z A;  2K2M A;  4IUP A;  4KUD K;  5D6X A;  5KYY A;  5FWC A;  1MGQ A;  2A08 A;  3H0F A;  5KH6 A;  1OPK A;  3MHX A;  3MP6 A;  2D6F A;  2BE7 D;  4OMN A;  5LJ5 g;  2P84 A;  4GBQ A;  1KQS S;  1UG1 A;  1QVP A;  3P8H A;  1QVF S;  3OYE A;  1KD1 C;  1IZ6 A;  1K0S A;  4GY5 A;  2L5Q A;  3FLG A;  2CH4 A;  4B9X A;  2COY A;  4FT2 A;  1OX9 A;  4HXJ A;  4J6Y A;  1D3B B;  4PLL A;  2RH2 A;  2EAY A;  3M59 A;  4D8D A;  3SD4 A;  2SRC A;  4PFZ A;  2DD4 A;  4M78 A;  2HDA A;  2ROT A;  4R0K A;  3EGX A;  2QA4 T;  2PQW A;  2VB6 A;  4C5G A;  3UF4 A;  1AWX A;  2FO0 A;  1M1G A;  1QP2 A;  3NTH A;  5IT9 E;  5HY6 A;  2ZCF B;  2LJ3 A;  1FMV A;  1Y57 A;  3E1S A;  1PG5 B;  3G4S Q;  4B6M A;  4M77 E;  3QJ6 A;  4OMO A;  1SSF A;  4ZGJ B;  4J9E A;  4XTZ A;  4QVZ A;  5LJ5 f;  1E6H A;  1Q81 U;  2KRN A;  3IQL A;  3PVL A;  2CDT A;  5LJ3 g;  1TWB A;  6AT1 B;  3CCL A;  2QEX A;  4PK4 A;  1R77 A;  3JAM E;  3OYL A;  4C8Q A;  1QVG A;  3HFO A;  4CC2 A;  1VQ7 T;  5GAN 2;  4CC7 A;  2X51 A;  2V1R A;  3PGG A;  1JRI A;  4ESR A;  1FX7 A;  4Z8A A;  1TSF A;  3RER A;  2ATC B;  1YP5 A;  4F7U B;  4E2F B;  2LX9 A;  1VQO A;  1VQN A;  5D7U A;  1M1F A;  2KXD A;  1MMA A;  1I07 A;  5GAO l;  4D8K A;  4GLK A;  3CCR A;  4QQD A;  1EX4 A;  2RMO A;  3TEE A;  5CKH A;  1K76 A;  4XQ3 A;  1ZUK A;  2RD1 A;  2B86 A;  2DM1 A;  4C0F A;  4LUE A;  4XTU A;  5LJ5 d;  2AT1 B;  4HVU A;  2E64 A;  4E7Z A;  4J9D A;  2EKO A;  4M75 E;  2VVK A;  2Y90 A;  1Q82 R;  2QGF B;  3X28 B;  7AT1 B;  4M7D A;  3CD6 T;  3I9Q A;  3QYG B;  2VXE A;  3L2R A;  4F7U F;  2ABL A;  2HL5 C;  1PC0 A;  5CQY A;  2PVG B;  4JZ3 A;  1UE9 A;  2FZC B;  4XU1 A;  1E7O A;  2CT4 A;  1AVZ C;  4MZP A;  1G3W A;  1VQ9 Q;  2OTL A;  1ZBX A;  2DBM A;  3VS0 A;  2R57 A;  2FZG B;  1VQP Q;  2M0O A;  2R5M A;  3INZ A;  2ZPE B;  4F17 A;  2BZY A;  5A0D A;  5KYW A;  1XJW B;  5KYW B;  2LCL A;  2DRK A;  1WHG A;  3DLL A;  2DYB A;  2DLP A;  2X3X D;  1VQ8 A;  2ZAE A;  1CSK A;  4RTZ A;  3CCR T;  3I55 T;  2DX1 A;  2NUT B;  2OTJ T;  1G3S A;  2LNV A;  2KEA A;  5GAM f;  3LW5 E;  2M1H A;  2LNH B;  3P8B B;  4C92 F;  5KE2 A;  3MEW A;  3RKY A;  3CC4 T;  2GQI A;  2JZ2 A;  4RCB A;  5GAM g;  2RPN A;  4E6R A;  1ACM B;  1ZHI A;  3LGF A;  1Q86 U;  4M75 A;  1O9S A;  2CZ0 B;  2YXY A;  2O01 E;  2D8J A;  2HBW A;  2QEX T;  1GBQ A;  2RQV A;  3URG A;  1P92 A;  4LDY A;  1YJN T;  4OMQ A;  3UDC A;  5CVI A;  2AHJ B;  4ZGE B;  2RF0 A;  1GFC A;  1T3L A;  3CCQ Q;  3I35 A;  2LX7 A;  2E6Z A;  2P0K A;  2M51 A;  2MI6 A;  2QQA A;  3M54 A;  4LN2 A;  3CCE A;  1YN8 A;  1RAG B;  1YHQ A;  3JCM e;  3M0S A;  3CMA A;  5IHI A;  3EG9 A;  3A8G B;  4RCC A;  3QO3 A;  2ZPH B;  1WXB A;  3A8H B;  1VQ6 A;  4EMK A;  1K9A A;  1NG2 A;  1T0H A;  4EMH A;  2GBQ A;  4JUV A;  3HRS A;  4AFQ C;  1HYO A;  2DL3 A;  2L3P A;  5ECA A;  3UA7 A;  2E65 A;  2BKD N;  1B7T A;  1ZX6 A;  1KQ1 A;  1M3B A;  1U1T A;  1RAA B;  4XK8 E;  2DL7 A;  4Z88 A;  2ZPF B;  2DVE A;  3I55 A;  4C0G A;  1AT1 B;  3OA6 A;  1KD1 U;  5CAI A;  2VGN A;  1D0Y A;  2EIF A;  3MO8 A;  4C5E A;  1IHV A;  5J26 A;  4M78 C;  4ZTJ A;  1IO6 A;  1SKU B;  3JCM g;  2J05 A;  2D0Q B; 
#chains in the Genus database with same CATH homology
 3CCU Q;  1VQM Q;  1Q81 R;  1K8A R;  1YIJ Q;  1K9M R;  2QA4 Q;  3CCV Q;  3CCL Q;  1Q7Y R;  3I55 Q;  1JJ2 P;  1KQS P;  1VQ5 Q;  1KD1 R;  1YJN Q;  3CCJ Q;  3CCQ Q;  3CC4 Q;  1VQ9 Q;  1YJ9 Q;  1Q82 R;  3CC7 Q;  1VQP Q;  1VQN Q;  1YI2 Q;  3CME Q;  3CCM Q;  1YIT Q;  1YJW Q;  1QVF P;  1VQL Q;  3CC2 Q;  3I56 Q;  1W2B P;  1NJI R;  3G4S Q;  1VQK Q;  3CPW P;  3CD6 Q;  1YHQ Q;  2QEX Q;  1S72 Q;  1Q86 R;  1VQ7 Q;  1VQ8 Q;  1N8R R;  1M90 R;  3G6E Q;  2OTJ Q;  3CXC P;  1VQ6 Q;  3CCR Q;  2OTL Q;  3CMA Q;  3G71 Q;  3CCE Q;  1K73 R;  1KC8 R;  3CCS Q;  1VQO Q;  3OW2 P;  1QVG P;  1VQ4 Q;  1M1K R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...