1Q82R

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1q82R00
1M90R 1VQ6Q 1YI2Q 1YHQQ 1Q82R 1NJIR 3CC7Q 1VQ7Q 1QVFP 1VQNQ 1Q7YR 1VQOQ 3CCRQ 1VQLQ 2QEXQ 1S72Q 1K8AR 1VQ5Q 3CCMQ 1K9MR 1KQSP 1VQKQ 2OTLQ 3CCJQ 2OTJQ 1KC8R 1M1KR 3G6EQ 3CCUQ 1VQPQ 1JJ2P 3OW2P 1QVGP 3CXCP 3CCLQ 1VQMQ 1YITQ 1KD1R 3CCQQ 3G71Q 3CCSQ 1YJNQ 1VQ4Q 3CCEQ 3CC4Q 1VQ8Q 1Q81R 1N8RR 3G4SQ 1K73R 1VQ9Q 3CC2Q 3I55Q 3CMEQ 3CCVQ 1YJWQ 1W2BP 3CMAQ 3CPWP 3CD6Q 1Q86R 1YIJQ 2QA4Q 3I56Q 1YJ9Q
chains in the Genus database with same CATH superfamily
4JPBW 1N27A 1RI0A 3EFRA 2FPFA 1K73U 2Y90A 2FZKB 3PTAA 1TOVA 2DF6A 1UEBA 4HT8A 4A4EA 3J80E 1I0CA 3I35A 1LCKA 1JB0E 3CCEA 1BCOA 3J81E 1TTHB 4QVDA 2D1XA 2DRKA 1NLOC 4JZ3A 3NTKA 3QHSA 1W2BP 3OB9A 2YWWA 3C12A 4R0KA 5KYWA 2YUNA 2LTOA 4KH0B 2AT1B 3T9NA 1D0ZA 2CSQA 3ME9A 4EMGA 2LJ3A 2CZ1B 4KGXB 1UGQB 3MKDA 3C94A 2C06A 2LX7A 1VQPT 1H641 2E70A 2QQSA 4DA4A 2FHDA 4C8QC 2GTJA 1X69A 2JT4A 4BI4A 3QKJA 2A28A 4ESRA 4Z02A 3OYJA 4J5YA 1JJ2S 4RCCA 1WQ7A 1X2KA 4J9GA 3JCMd 3BE3A 1VQLQ 3V8KA 1Q86U 3VUZA 4X9CA 2A37A 4PFZA 2CUBA 4JLGA 3LYIA 3LLRA 4FM4B 2BUDA 1XTDA 4L6V5 1D0YA 1X6GA 3CCVQ 3V7SA 8AT1B 4J9HA 1AEYA 4RG2A 1YCYA 3AHUA 1AD5A 2J6OA 2ZPGB 4HVWA 2LRQA 3M55A 1Q82U 1JJ2P 2GQVA 2ZGWA 1SSFA 2PU9B 4XAXB 4M7DG 1QVGA 3WVDB 3CMEQ 2K5IA 1WXTA 2DD5A 1U3OA 2FEIA 1FXXA 1U1SA 3TVTA 1GL5A 2BIVA 2NUTB 2CYZB 5CO7A 1W6XA 4BE1A 3SWNB 3CCLA 1NYGA 2DNUA 3RMSA 3QZ9B 2DXTA 2DVEA 3EHQA 2QGGA 5I22A 4ZGEB 1X2QA 2EQUA 1ZBJA 4EMHA 4P5NA 4JS4A 1QWEA 3VS3A 3ZBDA 3JCMQ 1Y96A 4PJJA 3RDVA 3H41A 2EQIA 4M77B 4IUPA 1M1GA 2DXUA 2HL3A 3EH1A 4C0GA 5GAN6 4RUGA 1M90U 3CCUQ 1SHGA 4XU0A 2RQVA 2EYWA 2ROLA 1M3BA 1WQWA 2RHUA 5GMKm 2FRYA 4J7IA 1R0BG 2X4YA 4M75C 1H3HA 2KEAA 2LJ0A 3MP6A 1KD1U 2PQWA 4FW2A 5FWCA 3FC3A 4MZPA 2QAZA 2RI3A 3GNFB 1SEMA 2RK1A 2M16A 4QVZA 3M4YA 2O4XA 4OVAA 4AT1B 2QQAA 2HKNA 1Q95G 2E64A 3CMET 3F70A 1UGVA 2DFUA 1VQOT 3CMAA 2CREA 3CCJT 1QKXA 1W2BA 4ATOA 2Y4YA 1X6OA 3NGPA 2K79A 2IIMA 2L3PA 3INZA 4C0ZA 1WI7A 4FSSA 2ZCFB 4ORZA 5LJ5e 2PUOB 4Y91A 5GAMh 3S3NA 1WLPB 4M75A 2V26A 2QI2A 4EMKB 3CPWP 5C0MA 1M1KR 2DTOA 1HK9A 1S1NA 2G3RA 2QASA 4A4FA 3EFOB 3OYCA 4Z8AA 2J6KA 3OYMA 3S3MA 1UHCA 5LJ5g 3OYBA 3R6OA 1WHMA 1C6VX 3H8ZA 4A4GA 3A8MB 2RJFA 4M77E 3CBOA 3TCJA 3CD6Q 3VS1A 2P4TA 2A0FB 2DO3A 2DL5A 1TUDA 2MF2A 2E5QA 3X24B 2JUFA 5LJ3d 1T3SA 2YSQA 2JM8A 1ZBXA 2RHIA 1AZEA 2FRWA 3VRZA 4A53A 1D1BA 2O01E 3CBPA 2JS2A 3QG1A 2EQJA 2X9HA 1ZX6A 4KH1B 1JJ2A 3LWIA 1PRMC 4TVRA 5AT1B 2LT4A 2OTLT 3PE0A 4MDWA 2H3JA 5AYFA 1YBYA 3NTIA 4J9EA 2LT1A 4BDYA 1VQOA 1G3WA 1WDXA 3TSWA 4E7JA 2XDPA 2VASA 2YRVA 2RI2A 2KDSA 1Q7YC 2QYZA 5KYXB 3RERA 1RACB 1XQHA 4FCYA 3PIPA 1LJOA 5I21A 4HT9A 3CCRT 3JCMJ 3FRNA 1YIJA 4R56A 4E7ZA 4OB3B 1ZSZB 1VQMT 4M77G 4NL2A 1WHGA 2M02A 3HRUA 4AG1C 2DMOA 4E6RA 1GCQC 2DL8A 1YJNQ 2E65A 3QPHA 3OYEA 1M2VB 2COZA 3QJ6A 1PC0A 1N9RA 2QG9B 1OI1A 5CKDA 1PSEA 3O8VA 4BACA 4KGVB 4DBFA 1Q7YR 2EAYA 4CC3A 2KI7A 4PLIA 5GAOn 3OYLA 1TU0B 3CC2T 4RTUA 1YJ9T 1MV3A 1PCXA 3UWNA 2CP6A 1NZ9A 2YHTA 2DTHA 3VU3C 3SEMA 3HHTB 3M0QA 4OGCA 3H0FA 1BCMA 2D8HA 4CI0C 1G8XA 1VQ5T 1QP3A 3QDFA 3MP8A 4WCIA 3M0UA 2QGFB 2DEUA 3GLXA 1PD0A 2RJCA 3I56T 2L0AA 1IZ6A 3G71Q 3OYYA 3CC4Q 5CKHA 3L2UA 2ESWA 1JEGA 1I5LA 4F7UB 2HZYA 1QWFA 2X4JA 4F04B 4O5VA 2XU8A 2V8JA 1UE9A 1KFZA 3PVLA 3CPWA 4ANJA 2ZPEB 2AHJB 1VOMA 5J39A 1UFFA 2F5KA 1BI1A 4EPCA 2RM4A 4AG2C 2OAUA 1YITQ 2QQ9A 1QQJA 4AFUC 3RR6A 3TSZA 4E7HA 2E3HA 3DKMA 4GLKA 3CC7A 4F17A 1YN8A 2KQWA 2F2XA 4B9WA 3Q1JA 1U8RA 3VKIA 2A3LA 4QVCA 3CCQA 5GAOr 3CCEQ 2RN8A 1VQ8Q 2LX9A 5GMKj 4XU3A 3EG2A 4C8QG 2MWOA 5DLQE 5IN1A 1UJ0A 5KYUB 1K4US 5A0DA 1S72A 1VQ4T 5FRMA 3A8OB 1B34B 3JB9H 4J9FA 4JJDA 4PFOA 2ZPIB 1N5ZA 2DXBA 2LDMA 1VQ9Q 2L5QA 4FYVB 4Z88A 3QYGB 3AT1B 1RLQC 4JRIA 4QKUA 2HQHA 4CRIA 2P84A 1MV0B 1R8OB 4MMLA 1ZA1B 4IURA 4X9DA 1ZLMA 4F7UE 5GAN4 3FJ5A 3BFMA 2EYQA 4IKFA 2FB7A 1EFNA 1WIEA 4ZTFA 3OY9A 4RTVA 3CCET 2R58A 4M77F 2ZZDA 2M9UA 2GF7A 3A8GB 3L2ZA 4N4HA 5LJ3j 5DY9A 2HEQA 4M7DB 3X20B 1WX6A 2RHYA 3MEWA 2OX7A 2XG8D 2K7AA 3E1SA 1YI2A 4ELZC 1C1AA 2V1QA 4XK8E 3EGDA 2QEXA 1FMKA 3I5RA 1Q81C 6AT1B 2K3YA 3BDUA 1RUWA 1V1CA 2M1HA 3CCLQ 5CAIA 5CKFA 2RHZA 3LH0A 4C92G 4M77D 3OSSC 4GBQA 2R57A 2CP7A 3QUIA 4HCZA 2R5AA 1VQPQ 3SWNA 2LQWA 1VQ7A 1MMAA 3RUXA 4F14A 2DXCA 1N8RU 3OSVA 2M0YA 2DE0X 3TREA 3FEOA 4LD6A 1QCNA 3GF5A 1BIBA 1VIFA 1KQ1A 4XTVA 4JUVA 4E7SA 1TUCA 1YJWA 1KC8U 4WTOB 2KRSA 2YLCA 2XD0A 3QYHB 2D6FA 3UPUA 4XU1A 2K3BA 2JOYA 4FYXB 4OB1B 2KGTA 1M5Q1 3SDZA 5KE2A 1FX7A 2FYKA 2V8IA 3E19A 3M57A 4D8KA 4ZNXA 1PKTA 3OS0A 5KYYA 5D6XA 1T0HA 1VYVA 2DL7A 2HQEA 3GBQA 2EVRA 4BY6B 3BDLA 1AWWA 2X4WA 1D1CA 3VS7A 1TG0A 5GANh 3CCLT 2ZPFB 3URGA 1CSKA 3TU4K 4MZMA 4M7DE 1U1TA 3HFNA 1YP5A 4PJMA 2SRCA 3V7RA 1NLPC 1FMWA 1IGQA 5ECAA 2CP2A 3L2WA 5LJ3f 1M9SA 3OBWA 3PMIA 3G4SA 2K2VA 1WHJA 2IVWA 2DYIA 2GCXA 2K4YA 5I11A 1M3AA 4FW1A 3VV0A 1GBQA 2LMJA 1I07A 4ZGDB 3M5AA 3VYHB 5CQXA 4DOVA 2COWA 5HKCA 3EFOA 1JBMA 4PJOB 5D6WA 1A0NB 2G6FX 3JSCA 4B6MA 2NUPA 2AKLA 2KNBB 5GAMe 1W1FA 1SHFA 2HCKA 4E2FB 1RL2A 2MYSA 3M0RA 1FMVA 2RB6A 1TH7A 2OAWA 2R5MA 2Y4XA 4ELYC 2XDDA 1O9SA 2CDTA 3CMAT 2CGHA 4IUVA 1K8AU 1UJYA 1AOJA 4LN2A 2VXFA 2CZ0B 5GAMg 1G3YA 1D0XA 1ABQA 1JRIA 3FIFA 4AFQC 1MMDA 2X3WD 4JJCA 1KJWA 1BYMA 3UT1A 1E7OA 3TQ7P 1VQOQ 1IHWA 1X6BA 5GAN3 2MIOA 2L3RA 2OTJA 3CCJQ 1SPKA 2E12A 4F16A 2K57A 2MWPA 2FZCB 2PVGB 1K9MC 1IRXA 3SD4A 4BI8B 2F1LA 3OYDA 3E9GA 1AVZC 2XMFA 4M78B 2KT1A 1KQSS 4V2SA 5FU6B 4DEYA 1RABB 1Y57A 2HNIA 4RCBA 5KYXA 4LXCA 4OMOA 3P8BB 2X4XA 3SB2A 4M7AG 2VUBA 1UGPB 2BTTA 1OU8A 2DK3A 1YNZA 4JRQA 3JCMP 3L2RA 4E7IA 1NG2A 3VYGA 4PK4A 8ATCB 3CXCA 3NMZC 4BB7A 4C92F 2CS7A 3REAB 2HD0A 4J8OA 2GFAA 4F7UF 2VKNA 1M2VA 3C4SA 3M54A 1M3CA 1K76A 1TWBA 1K9MR 1TS9A 3SFMA 5GMKl 1M1KC 2HQXA 4FT2A 1KQSP 4PJOE 2VGMA 1MNDA 4LDYA 4C5EA 1SKUB 2O31A 5CKBA 2EW3A 4MDXA 1BI0A 3HRSA 3M53A 1ZHIA 2J05A 2EGAA 3GPLA 3D7SB 2HBWA 1ARKA 2OTLQ 2BZ8A 2YRDA 4JRKA 5KYWB 4C92D 1UGSB 3IQLA 1NJIU 4Y28E 1YIJT 1GBRA 5GAMf 5FROA 4J9CA 2VB6A 4BD3A 4LDWA 2RD1A 2RO0A 2CKKA 1AWXA 1HD3A 2DERA 3JCMb 3EAEA 4JJBA 5LJ5j 1YWPA 3CCRQ 1IGUA 2EKOA 5IT9E 1WPYA 4J9DA 4F7UA 2PVOB 4OGEA 1VQMQ 4M78E 3JAME 1GFCA 2CH4W 4NL3A 2XICA 2BZXA 2GBQA 4OMMA 1B3QA 2O9VA 4PJOG 1OV3A 5KE3A 3KBGA 5IHKA 3J7AF 2ED0A 1VQ6A 3M0TA 1NE8A 2RQRA 3HP9A 1MMNA 1VQLA 2D0QB 3OQ5A 2HDAA 3VS0A 1RAEB 5GJVB 3RIRA 3M58A 3M59A 1I4K1 3M56A 1WHHA 1RI9A 1GRIA 3CC2Q 5D7UA 2FZGB 1UECA 2H8HA 2ED1A 4QQGA 1YJ9Q 3C95A 2BKDN 3REBB 4C8QB 2JMAA 1KHCA 1BI3A 3RKYA 1AWJA 3H0HA 4LNPA 3ZFJA 1VQ5Q 3QIIA 1IO6A 1MNEA 2WACA 2ZPBB 3WXMB 2YUQA 1UG1A 2JVVA 3S3OA 4HVUA 1AZGB 3UF4A 2F2WA 1B34A 4M78G 4DBHA 5KYNA 3I5SA 3I56Q 3RBBB 4M7DF 1SF9A 1YHQA 1J3TA 1U5SA 1M8VA 9ATCB 4CC7A 3LGFA 3THKA 2RQUA 4JJNK 2A36A 2MMPA 2LNVA 1O75A 1QP2A 2YXYA 1LNXA 4Y92A 3MEUA 4NOYA 2V1RA 3CC7T 2M0OA 1XNIA 3JCMe 2KAFA 5M9OA 3L1AA 4JS5A 1KQ2A 3L2QA 3PIOA 3EG9A 1K73C 2EGEA 3CCQT 5LJ5f 1N9SA 1V29B 5IHNA 2X3XD 3CCUA 4M7DD 2AK5A 1KQSA 3RMQA 2WSEE 2PUKB 5I2SA 4M7AF 3JCMg 2C0OA 4CC2A 3EGXB 1S72T 1KG1A 1QKWA 2E41A 5CQYA 4DOWA 3CEYA 4M7DA 5KH6A 3ASKA 2DIGA 3E2UA 2BE9B 4K11A 5L23A 1VQ4Q 4EIKA 4AMCA 1I81A 2F5TX 2DX1A 4C8QE 1K73R 1VA7A 4C92B 1QMCA 3MEVA 4OMLA 3M0SA 3HKSA 4FT4A 5CKEA 1XJWB 3OYFA 4M7AD 2E3IA 7AT1B 4QQDA 1Q86C 1BK2A 3CCMA 5FU7B 1WHLA 4XTUA 4BY6C 4Q5WA 1RAAB 5CIUA 1T0JA 1RAIB 2ZAEA 3JB9J 3O5ZA 2NWMA 2MI6A 4BI3A 2L3QA 2JW4A 4J9IA 4LUEA 1E6GA 2DEQA 3EFSA 1K9AA 5GAMd 2JTMA 4QQ6A 4HVVA 1Q82C 4B9XA 3QZ5B 1GFDA 4J7FA 4OB2B 5HY6A 1IXDA 3OYHA 3PVQA 1D1AA 1YI2T 2DAQA 3PNWC 1EX4A 4XTYA 3FB9A 5GAN7 3QWXX 4FL6A 3A8HB 3CD6A 2QEXT 2CP5A 1Q86R 3LWHA 4PJOF 4RKUE 1NEGA 3ZEHA 4BDZA 2JTEA 1NEBA 3QO3A 1C0MA 2J06A 2PTKA 2EIFA 5HK3A 4BE2A 4FYYB 1M1KU 3JCMV 5A2QE 3JCMh 4J83A 4XQ3A 1VQ7T 2B86A 2E5KA 2LCLA 4KRTA 3NPFA 3I55A 3OYAA 1Y71A 1UUEA 4OMFB 3QDRB 5A0GA 3CBMA 1Q82R 4FSXA 2BZYA 2HL5C 1GCPA 4A4HA 4LDXA 1P92A 2KXDA 2DA9A 2QDLA 4PJOD 1M90C 1E6HA 5A0LA 3G6EA 3VUBA 4C92E 1YJWT 4A63B 2HMAA 3X28B 2RMOA 5GANe 2D0NA 4PFPA 2KYBA 1X75C 1ZUUA 2DRMA 3FDRA 3HTRA 1KD1C 2QA4A 3SWNC 2EWNA 3MP1A 4M78F 2CP0A 4JDSA 1XOVA 2COYA 3DB4A 4J9BA 2ABLA 3EG0A 5GMKi 5GANg 5FU6C 3ER0A 1YJNA 4JZ4A 4DBQA 1SSHA 2KT8A 4M77C 3JCMc 5IAYA 1OEBA 2LQNA 2CT3A 1M90R 2CZ6B 2B8AA 3TEEA 2HSPA 4DBRA 2KRMA 2VXEA 3FJPA 3HL8A 3G4ST 2DTIA 2RQWA 5L8RE 3X25B 2E10A 4M78D 1KD1R 4IUQA 2HBPA 2WSFE 3U23A 1JO8A 2MK5A 1WHKA 5LJ5d 4E47A 2NUTA 3MEAA 2GGRA 3P8HA 1OQKA 2KY9A 2RK2A 1MMGA 4M75G 4KT0E 3QBYA 1M30A 1I5OB 2EFIA 1PM3A 4RTTA 5IH2A 4M7AB 2L89A 3G71A 2RNAA 1Q7YU 3CC4A 1ZQ1A 1V76A 2DD4A 4BE0A 4Z89A 4M77A 5GMKh 3EGUA 3R6NA 2JZ2A 2IPOB 2DZ9A 1DJ7B 2RH2A 4RTWA 5GAOl 2ROTA 4C5GA 1KK7A 3M4GA 5EC7A 4KUDK 2GNCA 4EMKC 2L3SA 4HKEA 1R0CB 2LCCA 2KVQG 1YITA 5GJWB 2KXCA 1TXQA 3OS5A 2D9TA 2K3XA 3CCSA 3MO8A 4XTZA 2DBMA 3H9NA 1R77A 2KROA 3CMAQ 2OTJT 1Y7XA 2AZVA 2DVJA 5C6SA 1LOJA 4RMOA 1D3BB 1JXOA 1JQQA 2RJEA 5GANf 2K9GA 1LPLA 3A5ZB 3OMGA 4N4GA 1VQ8A 2P0QA 2MCNA 3QSUA 1TUGB 4AFZC 2GFUA 2E4HA 2DLPA 4J6XA 2EYYA 3RNJA 3V7CA 3OBYA 1VQKA 4C8QF 5LJ3h 4EMKA 3PT9A 2OJ2A 2VVKA 2ECZA 2P0PA 1VQ9A 1UGRB 3DLLA 3JRZA 1Y0MA 3C0CA 4C0DB 1VQ6Q 2DJQA 2VGNA 3PMTA 2YLBA 1IHVA 3VS4A 3OW2S 1VQNA 4M7AE 2CP3A 3FLGA 1OX8A 2ENMA 3UATA 5EG2A 2C0TA 2VYTA 1WFWA 3ULRB 1K1ZA 3JCMX 1QW1A 5GAMj 1ZSZC 3VRYA 4C8QD 2PVDB 1W70A 1H92A 2NLUA 1NPRA 4BUGA 2LQ8A 4RTXA 1H8KA 3HPWA 1NYFA 5DLOA 3GOXA 3N5BB 3OW2P 1ZA2B 4XU2A 4C8QA 3EGDB 4R55A 2V8KA 4J6WA 1WNLA 1PG5B 2O9SA 1QVFS 2JS0A 2J6FA 3CQTA 2DKGA 4DQ2A 1YIJQ 2L2PA 1YHQQ 2EYZA 2X51A 3MPUB 1X43A 5CVIA 1EIFA 1VQ6T 1ZSZA 2F69A 3MJXA 5IHIA 1OX9A 1QCOA 2MPXC 3G1JA 1VQLT 1VQPA 3SHWA 3PFSA 3MHXA 1G5VA 2HSEB 1QVFP 1QVPA 3VS6A 2L8DA 1SRMA 3I9QA 4C92C 2YUOA 2NUZA 4M75F 4JRPA 1BU1A 3CCVT 5GAOq 3JB9G 1OOTA 3LH5A 1WXUA 2DJZA 4XTXA 5HK0A 2O2OA 1ABOA 5FU7C 1BKBA 3BY7A 2DM1A 2JN0A 3A8LB 1B7TA 2LNHB 4HXJA 5KYYB 1ZUYA 1NM7A 2KE9A 4IUUA 2H3EB 2LZ6B 1PSFA 4KULA 2DL4A 3EGXA 1MUZA 3CPWS 4LDVA 1AHJB 1IB8A 5I2MA 4EDUA 1YHQT 1SRLA 1B07A 4M75D 1I8FA 4DEXA 3VS2A 3QWYA 2GTOA 1F1BB 2JJ9A 5J3BA 2JTFA 2DILA 3CCMQ 4X1VA 2VWFA 4C92A 2LC4A 3META 2P0KA 4QT7A 1Q81U 2KSSA 2MAMA 4E7LA 1EZZB 4OMNA 1M1FA 2LCSA 2FO0A 3VS5A 5GANd 5FRNA 2I0NA 3CC7Q 3CCUT 4C5IA 1FWZA 4IUTA 3KFVA 3HFOA 4A54A 5KCOA 3OS1A 4L5GA 2AKKA 2NUPB 3V8LA 4XTWA 1PRLC 4FU6A 3M0PA 4OF1A 1K0SA 3CCQQ 2EBPA 3BW1A 2XKOC 2K5LA 2QQBA 4CC4B 2YUPA 3QJYA 1G83A 3CCVA 1OYXA 1VIEA 2XHCA 1X01A 1BBZA 1M4ZA 1AWOA 2RI5A 4OB0B 4L59A 1VYTA 1N6AA 1S72Q 4ZGJB 2DL3A 4YTLA 1H3ZA 2XIDA 3M9QA 4HCCA 3RESA 1RAHB 3OMCA 2QK0A 3X26B 2RHXA 3H6ZA 2W10A 4WF2A 5KYUA 3OW2A 1WZOA 3I55Q 3CMEA 1MGQA 1OPKA 3CCMT 2EQKA 1CKAA 4JLIA 2DBKA 1ZUKA 1N8RC 1UB4A 1WJRA 3CCJA 2Z0WA 2E6NA 4M7DC 3G6EQ 2RPNA 3NTHA 3GIBA 5FLXE 1Y96B 5CCAA 4OMPA 1QCFA 2LP5A 2FVUA 2VC8A 3JB9I 1KC8C 1RAGB 5IXFA 2JMCA 3G7ZA 3UA6A 2QA4Q 1G3SA 1HXDA 3RKXA 5DM7R 1KHIA 2J7IA 3EHRA 4PLLA 1W4SA 5GAOp 5J26A 1NPPA 2CSIA 4FYWB 1QVFA 2RA2A 4ZN3A 2AIRB 3KXTA 3CD6T 4O6JA 4IIOA 1WXBA 2FPDA 2FPEA 3DLMA 1N8RR 2VV5A 3EG1A 1U06A 2DZCA 2O88A 2O4XB 2EQMA 2LJ1A 5LJ5h 1MHNA 4QW2A 4M7AC 1YI2Q 2AZSA 4X34A 4MMKA 1YCSB 2E1HA 2QEXQ 1M27C 2KMTA 5CK9A 1HYOA 1KC8R 2KBTA 2K6DA 3P8DA 3I55T 1ACMB 2KR3A 3VJPA 1Z9ZA 2HKQB 4LD9K 5LL6S 3JB9F 2A7YA 1KSWA 1X27A 4LDUA 2ZPHB 3G6ET 1VQ7Q 4HA8A 4M75B 2OTLA 2JXBA 2QQRA 1I1JA 4C5HA 2E6ZA 1K0XA 1GCQA 2C0IA 2QA4T 2MOXA 2XI9A 2EJ9A 2QDYB 1K9MU 1NBEB 2K5FA 1G3TA 4GLMA 4RG8A 1YJWQ 2DPPB 2LQKA 1HJDA 3JV3A 4M7AA 3JB9D 2A08A 3CCRA 5HCKA 1IREB 3LX7A 1YJNT 2QTXA 4J6YA 4C0FA 2FG0A 2YDLA 4UC4A 3GNGA 2XDBA 1UDLA 2KK4A 5GAN2 1VQMA 4RTZA 4HCBA 1QLYA 3CCSQ 1K8AC 4VUBA 3WVEB 4PNOA 1RAFB 4KUIA 1TSFA 1RADB 3OA6A 3LGLA 4IIMA 3KUFA 5KCHA 1OULA 2YRCA 1PHTA 2KRNA 1T3LA 3OS2A 2QXFA 2EGCA 1WA7A 5GMKe 1WJSA 1SG5A 3NFCA 4PJOC 3NHNA 3L42A 4II1A 3A1PA 4C0DC 1WGSA 3ZL7C 2SEMA 3JCMf 1AT1B 2RJDA 3CC2A 3G4SQ 2ATCB 2RQTA 4GY5A 1D3BA 3EG3A 3OYGA 1YJ9A 2CT4A 4N4IA 4RTYA 5FW9A 4KBMB 3DB3A 1BB9A 1PNJA 1WYXA 2I2LA 3S6WA 2NYSA 3G71T 2PZ1A 1K8AR 3CC4T 1VQ5A 1VQKQ 1OZ3A 1OZ2A 2X35A 4PJLA 2QTVA 3HSBA 4ZN1A 1Z9QA 4M75E 4D8DA 3I56A 2HAXA 3OYNA 4FIBA 3A98A 4LUDA 4N0AC 1OPLA 1UTIA 1QVGS 2DYBA 4LE9A 1VQNQ 2EKHA 1G2BA 1YITT 1YFNA 3GP8A 2CUDA 4PJOA 3CCST 1UHFA 2LVMA 2DETA 2EJFA 5GANj 2BE7D 3EG9B 1PD1A 4M78C 3RKWA 1PWTA 3E9FA 3EH2A 3QXEB 2EJGA 1KIKA 5LJ3e 4HCKA 1CKBA 2PNIA 4M4ZA 2K2MA 2WSCE 1BIAA 2YT6A 1VQ8T 2JNGA 3CPFA 2OTJQ 3L2VA 1NJIC 1QVGP 1VYUA 3LW5E 1OU9A 5GAN5 3HRTA 1HSQA 1VUBA 5LJ3g 2KYMA 3OYKA 5FWBA 4OMQA 4ME7A 3UDCA 1VQKT 3V8JA 2DIQA 2EYXA 1ZSGA 2W0ZA 4MZTA 4N0AA 1FYNA 2GQIA 3CXCS 1M2OA 1Y07A 1PKSA 2OI3A 4OP0A 1VQ9T 2CZ7B 4D6WA 2P4RA 4M78A 1VQ4A 1RLPC 4KGZB 3PGGA 4NS5A 2M51A 2EPDA 2XK0A 1WJQA 2IG0A 1VQNT 3OYIA 2CH4A 1M8MA 4F7UG 4PKCC 1JXMA 1NJIR 1BI2A 5GAN8 2D8JA 2RF0A 4AFSC 1GXIE 1YWOA 4E7KA 3MCAB 2FL7A 3UA7A 5GAOm 1JU5C 2JM9A 3H0IA 5CR2A 5D6YA 1W2BS 3CXCP 4PL6A 4ZTJA 3JCMW 1D09B 4PJNA 4A4KA 1LVKA 2F2VA 1Q81R 5IXBA
chains in the Genus database with same CATH topology
1M90R 1VQ6Q 1YI2Q 1YHQQ 1Q82R 1NJIR 3CC7Q 1VQ7Q 1QVFP 1VQNQ 1Q7YR 1VQOQ 3CCRQ 1VQLQ 2QEXQ 1S72Q 1K8AR 1VQ5Q 3CCMQ 1K9MR 1KQSP 1VQKQ 2OTLQ 3CCJQ 2OTJQ 1KC8R 1M1KR 3G6EQ 3CCUQ 1VQPQ 1JJ2P 3OW2P 1QVGP 3CXCP 3CCLQ 1VQMQ 1YITQ 1KD1R 3CCQQ 3G71Q 3CCSQ 1YJNQ 1VQ4Q 3CCEQ 3CC4Q 1VQ8Q 1Q81R 1N8RR 3G4SQ 1K73R 1VQ9Q 3CC2Q 3I55Q 3CMEQ 3CCVQ 1YJWQ 1W2BP 3CMAQ 3CPWP 3CD6Q 1Q86R 1YIJQ 2QA4Q 3I56Q 1YJ9Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 R;  1VQ6 Q;  1YI2 Q;  1YHQ Q;  1Q82 R;  1NJI R;  3CC7 Q;  1VQ7 Q;  1QVF P;  1VQN Q;  1Q7Y R;  1VQO Q;  3CCR Q;  1VQL Q;  2QEX Q;  1S72 Q;  1K8A R;  1VQ5 Q;  3CCM Q;  1K9M R;  1KQS P;  1VQK Q;  2OTL Q;  3CCJ Q;  2OTJ Q;  1KC8 R;  1M1K R;  3G6E Q;  3CCU Q;  1VQP Q;  1JJ2 P;  3OW2 P;  1QVG P;  3CXC P;  3CCL Q;  1VQM Q;  1YIT Q;  1KD1 R;  3CCQ Q;  3G71 Q;  3CCS Q;  1YJN Q;  1VQ4 Q;  3CCE Q;  3CC4 Q;  1VQ8 Q;  1Q81 R;  1N8R R;  3G4S Q;  1K73 R;  1VQ9 Q;  3CC2 Q;  3I55 Q;  3CME Q;  3CCV Q;  1YJW Q;  1W2B P;  3CMA Q;  3CPW P;  3CD6 Q;  1Q86 R;  1YIJ Q;  2QA4 Q;  3I56 Q;  1YJ9 Q; 
#chains in the Genus database with same CATH topology
 4JPB W;  1N27 A;  1RI0 A;  3EFR A;  2FPF A;  1K73 U;  2Y90 A;  2FZK B;  3PTA A;  1TOV A;  2DF6 A;  1UEB A;  4HT8 A;  4A4E A;  3J80 E;  1I0C A;  3I35 A;  1LCK A;  1JB0 E;  3CCE A;  1BCO A;  3J81 E;  1TTH B;  4QVD A;  2D1X A;  2DRK A;  1NLO C;  4JZ3 A;  3NTK A;  3QHS A;  1W2B P;  3OB9 A;  2YWW A;  3C12 A;  4R0K A;  5KYW A;  2YUN A;  2LTO A;  4KH0 B;  2AT1 B;  3T9N A;  1D0Z A;  2CSQ A;  3ME9 A;  4EMG A;  2LJ3 A;  2CZ1 B;  4KGX B;  1UGQ B;  3MKD A;  3C94 A;  2C06 A;  2LX7 A;  1VQP T;  1H64 1;  2E70 A;  2QQS A;  4DA4 A;  2FHD A;  4C8Q C;  2GTJ A;  1X69 A;  2JT4 A;  4BI4 A;  3QKJ A;  2A28 A;  4ESR A;  4Z02 A;  3OYJ A;  4J5Y A;  1JJ2 S;  4RCC A;  1WQ7 A;  1X2K A;  4J9G A;  3JCM d;  3BE3 A;  1VQL Q;  3V8K A;  1Q86 U;  3VUZ A;  4X9C A;  2A37 A;  4PFZ A;  2CUB A;  4JLG A;  3LYI A;  3LLR A;  4FM4 B;  2BUD A;  1XTD A;  4L6V 5;  1D0Y A;  1X6G A;  3CCV Q;  3V7S A;  8AT1 B;  4J9H A;  1AEY A;  4RG2 A;  1YCY A;  3AHU A;  1AD5 A;  2J6O A;  2ZPG B;  4HVW A;  2LRQ A;  3M55 A;  1Q82 U;  1JJ2 P;  2GQV A;  2ZGW A;  1SSF A;  2PU9 B;  4XAX B;  4M7D G;  1QVG A;  3WVD B;  3CME Q;  2K5I A;  1WXT A;  2DD5 A;  1U3O A;  2FEI A;  1FXX A;  1U1S A;  3TVT A;  1GL5 A;  2BIV A;  2NUT B;  2CYZ B;  5CO7 A;  1W6X A;  4BE1 A;  3SWN B;  3CCL A;  1NYG A;  2DNU A;  3RMS A;  3QZ9 B;  2DXT A;  2DVE A;  3EHQ A;  2QGG A;  5I22 A;  4ZGE B;  1X2Q A;  2EQU A;  1ZBJ A;  4EMH A;  4P5N A;  4JS4 A;  1QWE A;  3VS3 A;  3ZBD A;  3JCM Q;  1Y96 A;  4PJJ A;  3RDV A;  3H41 A;  2EQI A;  4M77 B;  4IUP A;  1M1G A;  2DXU A;  2HL3 A;  3EH1 A;  4C0G A;  5GAN 6;  4RUG A;  1M90 U;  3CCU Q;  1SHG A;  4XU0 A;  2RQV A;  2EYW A;  2ROL A;  1M3B A;  1WQW A;  2RHU A;  5GMK m;  2FRY A;  4J7I A;  1R0B G;  2X4Y A;  4M75 C;  1H3H A;  2KEA A;  2LJ0 A;  3MP6 A;  1KD1 U;  2PQW A;  4FW2 A;  5FWC A;  3FC3 A;  4MZP A;  2QAZ A;  2RI3 A;  3GNF B;  1SEM A;  2RK1 A;  2M16 A;  4QVZ A;  3M4Y A;  2O4X A;  4OVA A;  4AT1 B;  2QQA A;  2HKN A;  1Q95 G;  2E64 A;  3CME T;  3F70 A;  1UGV A;  2DFU A;  1VQO T;  3CMA A;  2CRE A;  3CCJ T;  1QKX A;  1W2B A;  4ATO A;  2Y4Y A;  1X6O A;  3NGP A;  2K79 A;  2IIM A;  2L3P A;  3INZ A;  4C0Z A;  1WI7 A;  4FSS A;  2ZCF B;  4ORZ A;  5LJ5 e;  2PUO B;  4Y91 A;  5GAM h;  3S3N A;  1WLP B;  4M75 A;  2V26 A;  2QI2 A;  4EMK B;  3CPW P;  5C0M A;  1M1K R;  2DTO A;  1HK9 A;  1S1N A;  2G3R A;  2QAS A;  4A4F A;  3EFO B;  3OYC A;  4Z8A A;  2J6K A;  3OYM A;  3S3M A;  1UHC A;  5LJ5 g;  3OYB A;  3R6O A;  1WHM A;  1C6V X;  3H8Z A;  4A4G A;  3A8M B;  2RJF A;  4M77 E;  3CBO A;  3TCJ A;  3CD6 Q;  3VS1 A;  2P4T A;  2A0F B;  2DO3 A;  2DL5 A;  1TUD A;  2MF2 A;  2E5Q A;  3X24 B;  2JUF A;  5LJ3 d;  1T3S A;  2YSQ A;  2JM8 A;  1ZBX A;  2RHI A;  1AZE A;  2FRW A;  3VRZ A;  4A53 A;  1D1B A;  2O01 E;  3CBP A;  2JS2 A;  3QG1 A;  2EQJ A;  2X9H A;  1ZX6 A;  4KH1 B;  1JJ2 A;  3LWI A;  1PRM C;  4TVR A;  5AT1 B;  2LT4 A;  2OTL T;  3PE0 A;  4MDW A;  2H3J A;  5AYF A;  1YBY A;  3NTI A;  4J9E A;  2LT1 A;  4BDY A;  1VQO A;  1G3W A;  1WDX A;  3TSW A;  4E7J A;  2XDP A;  2VAS A;  2YRV A;  2RI2 A;  2KDS A;  1Q7Y C;  2QYZ A;  5KYX B;  3RER A;  1RAC B;  1XQH A;  4FCY A;  3PIP A;  1LJO A;  5I21 A;  4HT9 A;  3CCR T;  3JCM J;  3FRN A;  1YIJ A;  4R56 A;  4E7Z A;  4OB3 B;  1ZSZ B;  1VQM T;  4M77 G;  4NL2 A;  1WHG A;  2M02 A;  3HRU A;  4AG1 C;  2DMO A;  4E6R A;  1GCQ C;  2DL8 A;  1YJN Q;  2E65 A;  3QPH A;  3OYE A;  1M2V B;  2COZ A;  3QJ6 A;  1PC0 A;  1N9R A;  2QG9 B;  1OI1 A;  5CKD A;  1PSE A;  3O8V A;  4BAC A;  4KGV B;  4DBF A;  1Q7Y R;  2EAY A;  4CC3 A;  2KI7 A;  4PLI A;  5GAO n;  3OYL A;  1TU0 B;  3CC2 T;  4RTU A;  1YJ9 T;  1MV3 A;  1PCX A;  3UWN A;  2CP6 A;  1NZ9 A;  2YHT A;  2DTH A;  3VU3 C;  3SEM A;  3HHT B;  3M0Q A;  4OGC A;  3H0F A;  1BCM A;  2D8H A;  4CI0 C;  1G8X A;  1VQ5 T;  1QP3 A;  3QDF A;  3MP8 A;  4WCI A;  3M0U A;  2QGF B;  2DEU A;  3GLX A;  1PD0 A;  2RJC A;  3I56 T;  2L0A A;  1IZ6 A;  3G71 Q;  3OYY A;  3CC4 Q;  5CKH A;  3L2U A;  2ESW A;  1JEG A;  1I5L A;  4F7U B;  2HZY A;  1QWF A;  2X4J A;  4F04 B;  4O5V A;  2XU8 A;  2V8J A;  1UE9 A;  1KFZ A;  3PVL A;  3CPW A;  4ANJ A;  2ZPE B;  2AHJ B;  1VOM A;  5J39 A;  1UFF A;  2F5K A;  1BI1 A;  4EPC A;  2RM4 A;  4AG2 C;  2OAU A;  1YIT Q;  2QQ9 A;  1QQJ A;  4AFU C;  3RR6 A;  3TSZ A;  4E7H A;  2E3H A;  3DKM A;  4GLK A;  3CC7 A;  4F17 A;  1YN8 A;  2KQW A;  2F2X A;  4B9W A;  3Q1J A;  1U8R A;  3VKI A;  2A3L A;  4QVC A;  3CCQ A;  5GAO r;  3CCE Q;  2RN8 A;  1VQ8 Q;  2LX9 A;  5GMK j;  4XU3 A;  3EG2 A;  4C8Q G;  2MWO A;  5DLQ E;  5IN1 A;  1UJ0 A;  5KYU B;  1K4U S;  5A0D A;  1S72 A;  1VQ4 T;  5FRM A;  3A8O B;  1B34 B;  3JB9 H;  4J9F A;  4JJD A;  4PFO A;  2ZPI B;  1N5Z A;  2DXB A;  2LDM A;  1VQ9 Q;  2L5Q A;  4FYV B;  4Z88 A;  3QYG B;  3AT1 B;  1RLQ C;  4JRI A;  4QKU A;  2HQH A;  4CRI A;  2P84 A;  1MV0 B;  1R8O B;  4MML A;  1ZA1 B;  4IUR A;  4X9D A;  1ZLM A;  4F7U E;  5GAN 4;  3FJ5 A;  3BFM A;  2EYQ A;  4IKF A;  2FB7 A;  1EFN A;  1WIE A;  4ZTF A;  3OY9 A;  4RTV A;  3CCE T;  2R58 A;  4M77 F;  2ZZD A;  2M9U A;  2GF7 A;  3A8G B;  3L2Z A;  4N4H A;  5LJ3 j;  5DY9 A;  2HEQ A;  4M7D B;  3X20 B;  1WX6 A;  2RHY A;  3MEW A;  2OX7 A;  2XG8 D;  2K7A A;  3E1S A;  1YI2 A;  4ELZ C;  1C1A A;  2V1Q A;  4XK8 E;  3EGD A;  2QEX A;  1FMK A;  3I5R A;  1Q81 C;  6AT1 B;  2K3Y A;  3BDU A;  1RUW A;  1V1C A;  2M1H A;  3CCL Q;  5CAI A;  5CKF A;  2RHZ A;  3LH0 A;  4C92 G;  4M77 D;  3OSS C;  4GBQ A;  2R57 A;  2CP7 A;  3QUI A;  4HCZ A;  2R5A A;  1VQP Q;  3SWN A;  2LQW A;  1VQ7 A;  1MMA A;  3RUX A;  4F14 A;  2DXC A;  1N8R U;  3OSV A;  2M0Y A;  2DE0 X;  3TRE A;  3FEO A;  4LD6 A;  1QCN A;  3GF5 A;  1BIB A;  1VIF A;  1KQ1 A;  4XTV A;  4JUV A;  4E7S A;  1TUC A;  1YJW A;  1KC8 U;  4WTO B;  2KRS A;  2YLC A;  2XD0 A;  3QYH B;  2D6F A;  3UPU A;  4XU1 A;  2K3B A;  2JOY A;  4FYX B;  4OB1 B;  2KGT A;  1M5Q 1;  3SDZ A;  5KE2 A;  1FX7 A;  2FYK A;  2V8I A;  3E19 A;  3M57 A;  4D8K A;  4ZNX A;  1PKT A;  3OS0 A;  5KYY A;  5D6X A;  1T0H A;  1VYV A;  2DL7 A;  2HQE A;  3GBQ A;  2EVR A;  4BY6 B;  3BDL A;  1AWW A;  2X4W A;  1D1C A;  3VS7 A;  1TG0 A;  5GAN h;  3CCL T;  2ZPF B;  3URG A;  1CSK A;  3TU4 K;  4MZM A;  4M7D E;  1U1T A;  3HFN A;  1YP5 A;  4PJM A;  2SRC A;  3V7R A;  1NLP C;  1FMW A;  1IGQ A;  5ECA A;  2CP2 A;  3L2W A;  5LJ3 f;  1M9S A;  3OBW A;  3PMI A;  3G4S A;  2K2V A;  1WHJ A;  2IVW A;  2DYI A;  2GCX A;  2K4Y A;  5I11 A;  1M3A A;  4FW1 A;  3VV0 A;  1GBQ A;  2LMJ A;  1I07 A;  4ZGD B;  3M5A A;  3VYH B;  5CQX A;  4DOV A;  2COW A;  5HKC A;  3EFO A;  1JBM A;  4PJO B;  5D6W A;  1A0N B;  2G6F X;  3JSC A;  4B6M A;  2NUP A;  2AKL A;  2KNB B;  5GAM e;  1W1F A;  1SHF A;  2HCK A;  4E2F B;  1RL2 A;  2MYS A;  3M0R A;  1FMV A;  2RB6 A;  1TH7 A;  2OAW A;  2R5M A;  2Y4X A;  4ELY C;  2XDD A;  1O9S A;  2CDT A;  3CMA T;  2CGH A;  4IUV A;  1K8A U;  1UJY A;  1AOJ A;  4LN2 A;  2VXF A;  2CZ0 B;  5GAM g;  1G3Y A;  1D0X A;  1ABQ A;  1JRI A;  3FIF A;  4AFQ C;  1MMD A;  2X3W D;  4JJC A;  1KJW A;  1BYM A;  3UT1 A;  1E7O A;  3TQ7 P;  1VQO Q;  1IHW A;  1X6B A;  5GAN 3;  2MIO A;  2L3R A;  2OTJ A;  3CCJ Q;  1SPK A;  2E12 A;  4F16 A;  2K57 A;  2MWP A;  2FZC B;  2PVG B;  1K9M C;  1IRX A;  3SD4 A;  4BI8 B;  2F1L A;  3OYD A;  3E9G A;  1AVZ C;  2XMF A;  4M78 B;  2KT1 A;  1KQS S;  4V2S A;  5FU6 B;  4DEY A;  1RAB B;  1Y57 A;  2HNI A;  4RCB A;  5KYX A;  4LXC A;  4OMO A;  3P8B B;  2X4X A;  3SB2 A;  4M7A G;  2VUB A;  1UGP B;  2BTT A;  1OU8 A;  2DK3 A;  1YNZ A;  4JRQ A;  3JCM P;  3L2R A;  4E7I A;  1NG2 A;  3VYG A;  4PK4 A;  8ATC B;  3CXC A;  3NMZ C;  4BB7 A;  4C92 F;  2CS7 A;  3REA B;  2HD0 A;  4J8O A;  2GFA A;  4F7U F;  2VKN A;  1M2V A;  3C4S A;  3M54 A;  1M3C A;  1K76 A;  1TWB A;  1K9M R;  1TS9 A;  3SFM A;  5GMK l;  1M1K C;  2HQX A;  4FT2 A;  1KQS P;  4PJO E;  2VGM A;  1MND A;  4LDY A;  4C5E A;  1SKU B;  2O31 A;  5CKB A;  2EW3 A;  4MDX A;  1BI0 A;  3HRS A;  3M53 A;  1ZHI A;  2J05 A;  2EGA A;  3GPL A;  3D7S B;  2HBW A;  1ARK A;  2OTL Q;  2BZ8 A;  2YRD A;  4JRK A;  5KYW B;  4C92 D;  1UGS B;  3IQL A;  1NJI U;  4Y28 E;  1YIJ T;  1GBR A;  5GAM f;  5FRO A;  4J9C A;  2VB6 A;  4BD3 A;  4LDW A;  2RD1 A;  2RO0 A;  2CKK A;  1AWX A;  1HD3 A;  2DER A;  3JCM b;  3EAE A;  4JJB A;  5LJ5 j;  1YWP A;  3CCR Q;  1IGU A;  2EKO A;  5IT9 E;  1WPY A;  4J9D A;  4F7U A;  2PVO B;  4OGE A;  1VQM Q;  4M78 E;  3JAM E;  1GFC A;  2CH4 W;  4NL3 A;  2XIC A;  2BZX A;  2GBQ A;  4OMM A;  1B3Q A;  2O9V A;  4PJO G;  1OV3 A;  5KE3 A;  3KBG A;  5IHK A;  3J7A F;  2ED0 A;  1VQ6 A;  3M0T A;  1NE8 A;  2RQR A;  3HP9 A;  1MMN A;  1VQL A;  2D0Q B;  3OQ5 A;  2HDA A;  3VS0 A;  1RAE B;  5GJV B;  3RIR A;  3M58 A;  3M59 A;  1I4K 1;  3M56 A;  1WHH A;  1RI9 A;  1GRI A;  3CC2 Q;  5D7U A;  2FZG B;  1UEC A;  2H8H A;  2ED1 A;  4QQG A;  1YJ9 Q;  3C95 A;  2BKD N;  3REB B;  4C8Q B;  2JMA A;  1KHC A;  1BI3 A;  3RKY A;  1AWJ A;  3H0H A;  4LNP A;  3ZFJ A;  1VQ5 Q;  3QII A;  1IO6 A;  1MNE A;  2WAC A;  2ZPB B;  3WXM B;  2YUQ A;  1UG1 A;  2JVV A;  3S3O A;  4HVU A;  1AZG B;  3UF4 A;  2F2W A;  1B34 A;  4M78 G;  4DBH A;  5KYN A;  3I5S A;  3I56 Q;  3RBB B;  4M7D F;  1SF9 A;  1YHQ A;  1J3T A;  1U5S A;  1M8V A;  9ATC B;  4CC7 A;  3LGF A;  3THK A;  2RQU A;  4JJN K;  2A36 A;  2MMP A;  2LNV A;  1O75 A;  1QP2 A;  2YXY A;  1LNX A;  4Y92 A;  3MEU A;  4NOY A;  2V1R A;  3CC7 T;  2M0O A;  1XNI A;  3JCM e;  2KAF A;  5M9O A;  3L1A A;  4JS5 A;  1KQ2 A;  3L2Q A;  3PIO A;  3EG9 A;  1K73 C;  2EGE A;  3CCQ T;  5LJ5 f;  1N9S A;  1V29 B;  5IHN A;  2X3X D;  3CCU A;  4M7D D;  2AK5 A;  1KQS A;  3RMQ A;  2WSE E;  2PUK B;  5I2S A;  4M7A F;  3JCM g;  2C0O A;  4CC2 A;  3EGX B;  1S72 T;  1KG1 A;  1QKW A;  2E41 A;  5CQY A;  4DOW A;  3CEY A;  4M7D A;  5KH6 A;  3ASK A;  2DIG A;  3E2U A;  2BE9 B;  4K11 A;  5L23 A;  1VQ4 Q;  4EIK A;  4AMC A;  1I81 A;  2F5T X;  2DX1 A;  4C8Q E;  1K73 R;  1VA7 A;  4C92 B;  1QMC A;  3MEV A;  4OML A;  3M0S A;  3HKS A;  4FT4 A;  5CKE A;  1XJW B;  3OYF A;  4M7A D;  2E3I A;  7AT1 B;  4QQD A;  1Q86 C;  1BK2 A;  3CCM A;  5FU7 B;  1WHL A;  4XTU A;  4BY6 C;  4Q5W A;  1RAA B;  5CIU A;  1T0J A;  1RAI B;  2ZAE A;  3JB9 J;  3O5Z A;  2NWM A;  2MI6 A;  4BI3 A;  2L3Q A;  2JW4 A;  4J9I A;  4LUE A;  1E6G A;  2DEQ A;  3EFS A;  1K9A A;  5GAM d;  2JTM A;  4QQ6 A;  4HVV A;  1Q82 C;  4B9X A;  3QZ5 B;  1GFD A;  4J7F A;  4OB2 B;  5HY6 A;  1IXD A;  3OYH A;  3PVQ A;  1D1A A;  1YI2 T;  2DAQ A;  3PNW C;  1EX4 A;  4XTY A;  3FB9 A;  5GAN 7;  3QWX X;  4FL6 A;  3A8H B;  3CD6 A;  2QEX T;  2CP5 A;  1Q86 R;  3LWH A;  4PJO F;  4RKU E;  1NEG A;  3ZEH A;  4BDZ A;  2JTE A;  1NEB A;  3QO3 A;  1C0M A;  2J06 A;  2PTK A;  2EIF A;  5HK3 A;  4BE2 A;  4FYY B;  1M1K U;  3JCM V;  5A2Q E;  3JCM h;  4J83 A;  4XQ3 A;  1VQ7 T;  2B86 A;  2E5K A;  2LCL A;  4KRT A;  3NPF A;  3I55 A;  3OYA A;  1Y71 A;  1UUE A;  4OMF B;  3QDR B;  5A0G A;  3CBM A;  1Q82 R;  4FSX A;  2BZY A;  2HL5 C;  1GCP A;  4A4H A;  4LDX A;  1P92 A;  2KXD A;  2DA9 A;  2QDL A;  4PJO D;  1M90 C;  1E6H A;  5A0L A;  3G6E A;  3VUB A;  4C92 E;  1YJW T;  4A63 B;  2HMA A;  3X28 B;  2RMO A;  5GAN e;  2D0N A;  4PFP A;  2KYB A;  1X75 C;  1ZUU A;  2DRM A;  3FDR A;  3HTR A;  1KD1 C;  2QA4 A;  3SWN C;  2EWN A;  3MP1 A;  4M78 F;  2CP0 A;  4JDS A;  1XOV A;  2COY A;  3DB4 A;  4J9B A;  2ABL A;  3EG0 A;  5GMK i;  5GAN g;  5FU6 C;  3ER0 A;  1YJN A;  4JZ4 A;  4DBQ A;  1SSH A;  2KT8 A;  4M77 C;  3JCM c;  5IAY A;  1OEB A;  2LQN A;  2CT3 A;  1M90 R;  2CZ6 B;  2B8A A;  3TEE A;  2HSP A;  4DBR A;  2KRM A;  2VXE A;  3FJP A;  3HL8 A;  3G4S T;  2DTI A;  2RQW A;  5L8R E;  3X25 B;  2E10 A;  4M78 D;  1KD1 R;  4IUQ A;  2HBP A;  2WSF E;  3U23 A;  1JO8 A;  2MK5 A;  1WHK A;  5LJ5 d;  4E47 A;  2NUT A;  3MEA A;  2GGR A;  3P8H A;  1OQK A;  2KY9 A;  2RK2 A;  1MMG A;  4M75 G;  4KT0 E;  3QBY A;  1M30 A;  1I5O B;  2EFI A;  1PM3 A;  4RTT A;  5IH2 A;  4M7A B;  2L89 A;  3G71 A;  2RNA A;  1Q7Y U;  3CC4 A;  1ZQ1 A;  1V76 A;  2DD4 A;  4BE0 A;  4Z89 A;  4M77 A;  5GMK h;  3EGU A;  3R6N A;  2JZ2 A;  2IPO B;  2DZ9 A;  1DJ7 B;  2RH2 A;  4RTW A;  5GAO l;  2ROT A;  4C5G A;  1KK7 A;  3M4G A;  5EC7 A;  4KUD K;  2GNC A;  4EMK C;  2L3S A;  4HKE A;  1R0C B;  2LCC A;  2KVQ G;  1YIT A;  5GJW B;  2KXC A;  1TXQ A;  3OS5 A;  2D9T A;  2K3X A;  3CCS A;  3MO8 A;  4XTZ A;  2DBM A;  3H9N A;  1R77 A;  2KRO A;  3CMA Q;  2OTJ T;  1Y7X A;  2AZV A;  2DVJ A;  5C6S A;  1LOJ A;  4RMO A;  1D3B B;  1JXO A;  1JQQ A;  2RJE A;  5GAN f;  2K9G A;  1LPL A;  3A5Z B;  3OMG A;  4N4G A;  1VQ8 A;  2P0Q A;  2MCN A;  3QSU A;  1TUG B;  4AFZ C;  2GFU A;  2E4H A;  2DLP A;  4J6X A;  2EYY A;  3RNJ A;  3V7C A;  3OBY A;  1VQK A;  4C8Q F;  5LJ3 h;  4EMK A;  3PT9 A;  2OJ2 A;  2VVK A;  2ECZ A;  2P0P A;  1VQ9 A;  1UGR B;  3DLL A;  3JRZ A;  1Y0M A;  3C0C A;  4C0D B;  1VQ6 Q;  2DJQ A;  2VGN A;  3PMT A;  2YLB A;  1IHV A;  3VS4 A;  3OW2 S;  1VQN A;  4M7A E;  2CP3 A;  3FLG A;  1OX8 A;  2ENM A;  3UAT A;  5EG2 A;  2C0T A;  2VYT A;  1WFW A;  3ULR B;  1K1Z A;  3JCM X;  1QW1 A;  5GAM j;  1ZSZ C;  3VRY A;  4C8Q D;  2PVD B;  1W70 A;  1H92 A;  2NLU A;  1NPR A;  4BUG A;  2LQ8 A;  4RTX A;  1H8K A;  3HPW A;  1NYF A;  5DLO A;  3GOX A;  3N5B B;  3OW2 P;  1ZA2 B;  4XU2 A;  4C8Q A;  3EGD B;  4R55 A;  2V8K A;  4J6W A;  1WNL A;  1PG5 B;  2O9S A;  1QVF S;  2JS0 A;  2J6F A;  3CQT A;  2DKG A;  4DQ2 A;  1YIJ Q;  2L2P A;  1YHQ Q;  2EYZ A;  2X51 A;  3MPU B;  1X43 A;  5CVI A;  1EIF A;  1VQ6 T;  1ZSZ A;  2F69 A;  3MJX A;  5IHI A;  1OX9 A;  1QCO A;  2MPX C;  3G1J A;  1VQL T;  1VQP A;  3SHW A;  3PFS A;  3MHX A;  1G5V A;  2HSE B;  1QVF P;  1QVP A;  3VS6 A;  2L8D A;  1SRM A;  3I9Q A;  4C92 C;  2YUO A;  2NUZ A;  4M75 F;  4JRP A;  1BU1 A;  3CCV T;  5GAO q;  3JB9 G;  1OOT A;  3LH5 A;  1WXU A;  2DJZ A;  4XTX A;  5HK0 A;  2O2O A;  1ABO A;  5FU7 C;  1BKB A;  3BY7 A;  2DM1 A;  2JN0 A;  3A8L B;  1B7T A;  2LNH B;  4HXJ A;  5KYY B;  1ZUY A;  1NM7 A;  2KE9 A;  4IUU A;  2H3E B;  2LZ6 B;  1PSF A;  4KUL A;  2DL4 A;  3EGX A;  1MUZ A;  3CPW S;  4LDV A;  1AHJ B;  1IB8 A;  5I2M A;  4EDU A;  1YHQ T;  1SRL A;  1B07 A;  4M75 D;  1I8F A;  4DEX A;  3VS2 A;  3QWY A;  2GTO A;  1F1B B;  2JJ9 A;  5J3B A;  2JTF A;  2DIL A;  3CCM Q;  4X1V A;  2VWF A;  4C92 A;  2LC4 A;  3MET A;  2P0K A;  4QT7 A;  1Q81 U;  2KSS A;  2MAM A;  4E7L A;  1EZZ B;  4OMN A;  1M1F A;  2LCS A;  2FO0 A;  3VS5 A;  5GAN d;  5FRN A;  2I0N A;  3CC7 Q;  3CCU T;  4C5I A;  1FWZ A;  4IUT A;  3KFV A;  3HFO A;  4A54 A;  5KCO A;  3OS1 A;  4L5G A;  2AKK A;  2NUP B;  3V8L A;  4XTW A;  1PRL C;  4FU6 A;  3M0P A;  4OF1 A;  1K0S A;  3CCQ Q;  2EBP A;  3BW1 A;  2XKO C;  2K5L A;  2QQB A;  4CC4 B;  2YUP A;  3QJY A;  1G83 A;  3CCV A;  1OYX A;  1VIE A;  2XHC A;  1X01 A;  1BBZ A;  1M4Z A;  1AWO A;  2RI5 A;  4OB0 B;  4L59 A;  1VYT A;  1N6A A;  1S72 Q;  4ZGJ B;  2DL3 A;  4YTL A;  1H3Z A;  2XID A;  3M9Q A;  4HCC A;  3RES A;  1RAH B;  3OMC A;  2QK0 A;  3X26 B;  2RHX A;  3H6Z A;  2W10 A;  4WF2 A;  5KYU A;  3OW2 A;  1WZO A;  3I55 Q;  3CME A;  1MGQ A;  1OPK A;  3CCM T;  2EQK A;  1CKA A;  4JLI A;  2DBK A;  1ZUK A;  1N8R C;  1UB4 A;  1WJR A;  3CCJ A;  2Z0W A;  2E6N A;  4M7D C;  3G6E Q;  2RPN A;  3NTH A;  3GIB A;  5FLX E;  1Y96 B;  5CCA A;  4OMP A;  1QCF A;  2LP5 A;  2FVU A;  2VC8 A;  3JB9 I;  1KC8 C;  1RAG B;  5IXF A;  2JMC A;  3G7Z A;  3UA6 A;  2QA4 Q;  1G3S A;  1HXD A;  3RKX A;  5DM7 R;  1KHI A;  2J7I A;  3EHR A;  4PLL A;  1W4S A;  5GAO p;  5J26 A;  1NPP A;  2CSI A;  4FYW B;  1QVF A;  2RA2 A;  4ZN3 A;  2AIR B;  3KXT A;  3CD6 T;  4O6J A;  4IIO A;  1WXB A;  2FPD A;  2FPE A;  3DLM A;  1N8R R;  2VV5 A;  3EG1 A;  1U06 A;  2DZC A;  2O88 A;  2O4X B;  2EQM A;  2LJ1 A;  5LJ5 h;  1MHN A;  4QW2 A;  4M7A C;  1YI2 Q;  2AZS A;  4X34 A;  4MMK A;  1YCS B;  2E1H A;  2QEX Q;  1M27 C;  2KMT A;  5CK9 A;  1HYO A;  1KC8 R;  2KBT A;  2K6D A;  3P8D A;  3I55 T;  1ACM B;  2KR3 A;  3VJP A;  1Z9Z A;  2HKQ B;  4LD9 K;  5LL6 S;  3JB9 F;  2A7Y A;  1KSW A;  1X27 A;  4LDU A;  2ZPH B;  3G6E T;  1VQ7 Q;  4HA8 A;  4M75 B;  2OTL A;  2JXB A;  2QQR A;  1I1J A;  4C5H A;  2E6Z A;  1K0X A;  1GCQ A;  2C0I A;  2QA4 T;  2MOX A;  2XI9 A;  2EJ9 A;  2QDY B;  1K9M U;  1NBE B;  2K5F A;  1G3T A;  4GLM A;  4RG8 A;  1YJW Q;  2DPP B;  2LQK A;  1HJD A;  3JV3 A;  4M7A A;  3JB9 D;  2A08 A;  3CCR A;  5HCK A;  1IRE B;  3LX7 A;  1YJN T;  2QTX A;  4J6Y A;  4C0F A;  2FG0 A;  2YDL A;  4UC4 A;  3GNG A;  2XDB A;  1UDL A;  2KK4 A;  5GAN 2;  1VQM A;  4RTZ A;  4HCB A;  1QLY A;  3CCS Q;  1K8A C;  4VUB A;  3WVE B;  4PNO A;  1RAF B;  4KUI A;  1TSF A;  1RAD B;  3OA6 A;  3LGL A;  4IIM A;  3KUF A;  5KCH A;  1OUL A;  2YRC A;  1PHT A;  2KRN A;  1T3L A;  3OS2 A;  2QXF A;  2EGC A;  1WA7 A;  5GMK e;  1WJS A;  1SG5 A;  3NFC A;  4PJO C;  3NHN A;  3L42 A;  4II1 A;  3A1P A;  4C0D C;  1WGS A;  3ZL7 C;  2SEM A;  3JCM f;  1AT1 B;  2RJD A;  3CC2 A;  3G4S Q;  2ATC B;  2RQT A;  4GY5 A;  1D3B A;  3EG3 A;  3OYG A;  1YJ9 A;  2CT4 A;  4N4I A;  4RTY A;  5FW9 A;  4KBM B;  3DB3 A;  1BB9 A;  1PNJ A;  1WYX A;  2I2L A;  3S6W A;  2NYS A;  3G71 T;  2PZ1 A;  1K8A R;  3CC4 T;  1VQ5 A;  1VQK Q;  1OZ3 A;  1OZ2 A;  2X35 A;  4PJL A;  2QTV A;  3HSB A;  4ZN1 A;  1Z9Q A;  4M75 E;  4D8D A;  3I56 A;  2HAX A;  3OYN A;  4FIB A;  3A98 A;  4LUD A;  4N0A C;  1OPL A;  1UTI A;  1QVG S;  2DYB A;  4LE9 A;  1VQN Q;  2EKH A;  1G2B A;  1YIT T;  1YFN A;  3GP8 A;  2CUD A;  4PJO A;  3CCS T;  1UHF A;  2LVM A;  2DET A;  2EJF A;  5GAN j;  2BE7 D;  3EG9 B;  1PD1 A;  4M78 C;  3RKW A;  1PWT A;  3E9F A;  3EH2 A;  3QXE B;  2EJG A;  1KIK A;  5LJ3 e;  4HCK A;  1CKB A;  2PNI A;  4M4Z A;  2K2M A;  2WSC E;  1BIA A;  2YT6 A;  1VQ8 T;  2JNG A;  3CPF A;  2OTJ Q;  3L2V A;  1NJI C;  1QVG P;  1VYU A;  3LW5 E;  1OU9 A;  5GAN 5;  3HRT A;  1HSQ A;  1VUB A;  5LJ3 g;  2KYM A;  3OYK A;  5FWB A;  4OMQ A;  4ME7 A;  3UDC A;  1VQK T;  3V8J A;  2DIQ A;  2EYX A;  1ZSG A;  2W0Z A;  4MZT A;  4N0A A;  1FYN A;  2GQI A;  3CXC S;  1M2O A;  1Y07 A;  1PKS A;  2OI3 A;  4OP0 A;  1VQ9 T;  2CZ7 B;  4D6W A;  2P4R A;  4M78 A;  1VQ4 A;  1RLP C;  4KGZ B;  3PGG A;  4NS5 A;  2M51 A;  2EPD A;  2XK0 A;  1WJQ A;  2IG0 A;  1VQN T;  3OYI A;  2CH4 A;  1M8M A;  4F7U G;  4PKC C;  1JXM A;  1NJI R;  1BI2 A;  5GAN 8;  2D8J A;  2RF0 A;  4AFS C;  1GXI E;  1YWO A;  4E7K A;  3MCA B;  2FL7 A;  3UA7 A;  5GAO m;  1JU5 C;  2JM9 A;  3H0I A;  5CR2 A;  5D6Y A;  1W2B S;  3CXC P;  4PL6 A;  4ZTJ A;  3JCM W;  1D09 B;  4PJN A;  4A4K A;  1LVK A;  2F2V A;  1Q81 R;  5IXB A; 
#chains in the Genus database with same CATH homology
 1M90 R;  1VQ6 Q;  1YI2 Q;  1YHQ Q;  1Q82 R;  1NJI R;  3CC7 Q;  1VQ7 Q;  1QVF P;  1VQN Q;  1Q7Y R;  1VQO Q;  3CCR Q;  1VQL Q;  2QEX Q;  1S72 Q;  1K8A R;  1VQ5 Q;  3CCM Q;  1K9M R;  1KQS P;  1VQK Q;  2OTL Q;  3CCJ Q;  2OTJ Q;  1KC8 R;  1M1K R;  3G6E Q;  3CCU Q;  1VQP Q;  1JJ2 P;  3OW2 P;  1QVG P;  3CXC P;  3CCL Q;  1VQM Q;  1YIT Q;  1KD1 R;  3CCQ Q;  3G71 Q;  3CCS Q;  1YJN Q;  1VQ4 Q;  3CCE Q;  3CC4 Q;  1VQ8 Q;  1Q81 R;  1N8R R;  3G4S Q;  1K73 R;  1VQ9 Q;  3CC2 Q;  3I55 Q;  3CME Q;  3CCV Q;  1YJW Q;  1W2B P;  3CMA Q;  3CPW P;  3CD6 Q;  1Q86 R;  1YIJ Q;  2QA4 Q;  3I56 Q;  1YJ9 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...