1Q82R

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1q82R00
3CXCP 3OW2P 3CC4Q 3I56Q 3G6EQ 1VQLQ 1VQ9Q 1VQMQ 1K9MR 1N8RR 2OTLQ 1VQPQ 1VQ7Q 1YI2Q 1KQSP 1YJWQ 3G4SQ 2QEXQ 3CCJQ 1Q81R 1K73R 3CCLQ 3CCUQ 1Q82R 3CC2Q 1Q7YR 3CCEQ 1YIJQ 1M90R 1YHQQ 2QA4Q 1KD1R 1VQ4Q 3CC7Q 1YITQ 1VQNQ 1QVFP 3CD6Q 1JJ2P 1NJIR 1S72Q 1VQKQ 3G71Q 3CCRQ 3CCQQ 1VQ6Q 1QVGP 3CMAQ 1W2BP 1VQ8Q 1KC8R 2OTJQ 1K8AR 3CPWP 1M1KR 3CCMQ 1VQ5Q 3CCVQ 1YJNQ 3I55Q 1Q86R 1YJ9Q 1VQOQ 3CCSQ 3CMEQ
chains in the Genus database with same CATH superfamily
2FO0A 4OP0A 3UDCA 1QWEA 2FRYA 2QDLA 3PGGA 5DY9A 5CO7A 4C92C 3QSUA 2QEXQ 4M77C 2M0YA 3JB9F 1G3YA 1TTHB 2OX7A 2VVKA 2E6ZA 2DMOA 3PMIA 2CREA 3ER0A 2GQIA 1WHJA 5FW9A 1T3LA 3EGUA 4J6WA 2RK1A 4ZN3A 4FM4B 1KSWA 2EQMA 2KE9A 4EMKA 3H0HA 2K9GA 2X4JA 1SHGA 4IUQA 1Q7YU 1YNZA 4AMCA 2LZ6B 3FJPA 2V8JA 4M78G 1TH7A 1YIJQ 1X01A 2MWPA 4KT0E 3CCRA 3AT1B 3S3NA 5HK0A 1YP5A 1KQSA 1NEGA 1K8AU 2DTOA 2M51A 4RTVA 4BDZA 4C5EA 5GAN3 1VQLA 1VQMA 3CPWP 5GMKm 3TSZA 4M7AA 1K9MR 2RJEA 1VIFA 1K0XA 5CKHA 2WSEE 3CC2T 2RQRA 3M0RA 2D8HA 4C5HA 3SB2A 1TUDA 4J9IA 1IGQA 3QDRB 5J39A 4M77E 1NJIR 1FXXA 2DZCA 1SHFA 2XICA 1YFNA 5LJ3j 1OPKA 4GLKA 1Q81C 3BY7A 3L1AA 3A8HB 3EG0A 4M7AD 2RHYA 2YUPA 1OX8A 4PFPA 3G4SQ 1K73R 1T0JA 3SDZA 2LQNA 2A36A 3CCQA 2CP7A 3MEWA 4P5NA 1N9RA 1I4K1 1PD1A 1JEGA 4M7DD 1QLYA 2GNCA 4ANJA 1VQ9A 2CSQA 2NUPA 1VQ5T 3GOXA 3CCJA 1RI9A 3JCMd 5IAYA 4C92G 1OPLA 1RAAB 1KQSP 1RLPC 1ZSZB 3VS4A 2EGAA 1N6AA 2LVMA 2JMCA 1GCQA 2RQTA 1X2QA 2P4RA 5FU6B 3BDUA 4E7ZA 2CSIA 1YJ9A 5CKDA 2F5KA 2LX9A 4ELYC 2RI5A 4BY6B 3NFCA 4PJJA 5I2MA 1WFWA 4L5GA 3CCMT 5GANf 2HZYA 4JJNK 4M7AF 1VQLQ 1VQMQ 2L3SA 2GQVA 2DVEA 2J6OA 1ZQ1A 3NTKA 2EVRA 2EYWA 4C8QD 1M8VA 5CK9A 1MNEA 4F7UE 1Q95G 2C0IA 4DOVA 1M1KU 2X4WA 2BKDN 2X51A 1ZUUA 3ZEHA 3HTRA 4JRPA 2ATCB 4BE1A 2LTOA 4BB7A 5I2SA 4M7DF 1XQHA 4OMFB 2O9SA 4JRQA 2HSEB 1UE9A 3RNJA 3MP8A 4KGVB 1D3BB 4HVUA 3H8ZA 2ECZA 2XK0A 3RKYA 2ED0A 2QTXA 1AHJB 3SFMA 3GBQA 5GAMe 2EYYA 2E64A 3DKMA 3CCQQ 2KY9A 4M77B 4ATOA 2DX1A 2A0FB 3OS0A 4Z89A 2L5QA 2LJ0A 3BW1A 1HSQA 1MMGA 3PMTA 4XK8E 1VQ9Q 1OQKA 4RTXA 5GAN2 3M4YA 3CCJQ 2ABLA 1E6HA 1KC8C 2F69A 4ORZA 1D1BA 3FEOA 1WJRA 2DNUA 2KMTA 4Y92A 1PHTA 2RJCA 3ZL7C 4C8QF 1AWWA 5GAOp 1G2BA 4AFZC 4KGZB 2KQWA 5GAN8 3V7CA 4MDWA 2NUTB 1YJ9Q 1M2VB 5A0GA 1VQPT 2CT3A 2KROA 1BK2A 2JTEA 1JU5C 1R0BG 3OYJA 3OSVA 2XDBA 4X9CA 1RUWA 1R0CB 4EMKC 2MAMA 2M1HA 2EJGA 1X75C 3CBMA 3CMAT 1N5ZA 3PFSA 1YI2A 2BZXA 1ZHIA 2RHUA 3CC2A 1TOVA 2FZGB 2XIDA 2PVDB 4AT1B 3RDVA 2EYZA 1I5LA 2A37A 2EW3A 3HP9A 5IHKA 4MZTA 4F7UB 4M75D 2EIFA 5CKFA 4GBQA 3REAB 2E6NA 3QUIA 4JRIA 3TSWA 1ZBJA 4F14A 1QMCA 4RG8A 4FU6A 1RADB 1VQOT 2W10A 2MPXC 3M53A 5IXFA 2QGFB 2XDPA 2KXDA 2KDSA 4PJOC 1YITT 1KC8U 1M27C 1WXBA 2M16A 3EH1A 2YLBA 1WA7A 3OMGA 2COYA 3VS1A 3M4GA 3O5ZA 4N0AC 2C06A 1ZSZA 1Q81R 1D1CA 1GFCA 2X3XD 2V1RA 2DTIA 4ZGEB 3E2UA 4M78D 1MMDA 2K2MA 4IURA 1AWOA 1SSHA 3FC3A 2DETA 3MEAA 4OMNA 5KYNA 3UT1A 4M75F 1PG5B 1AWXA 3GF5A 1VYTA 3REBB 5GAOl 1QCFA 3EFSA 4OMQA 2AZVA 1BU1A 4HXJA 5GAMg 1GCQC 2HMAA 1X69A 3CC2Q 4Z8AA 3TU4K 1D09B 2B8AA 5LJ5f 1IZ6A 4PFZA 7AT1B 1ARKA 3JCMV 4EPCA 2VYTA 4C0DC 2X35A 3VYHB 1D3BA 1OYXA 4DQ2A 2O31A 2RA2A 2YSQA 4PLIA 2ZPGB 1AWJA 4QVZA 4RCCA 4MMLA 4M77A 3GLXA 3C4SA 4B9XA 4M78F 5C0MA 3OYGA 3HPWA 1WHGA 1NE8A 1I07A 2DPPB 5GAN5 2JN0A 3L42A 3JB9I 3R6OA 1O9SA 2DJQA 5GAN4 1WHLA 1WQ7A 4C92D 1NZ9A 4PJOG 3R6NA 4HVWA 2CUBA 5GANh 2DRKA 4BI8B 4XTXA 1OV3A 1BIAA 3QZ5B 3CCMQ 4Z02A 4NL3A 1NJIC 4OMOA 5CAIA 2CZ7B 8ATCB 4XTVA 2COZA 4JS5A 4HT9A 1AVZC 4L6V5 5IT9E 3CMAA 2D8JA 2KRNA 2YHTA 3INZA 4LD9K 2QG9B 3WVDB 1WHHA 1KC8R 1H8KA 4R55A 1Y96B 2L0AA 1MV0B 4X9DA 4BE2A 1UJYA 3VUBA 4F17A 4C0ZA 2K5FA 4F7UA 5CKBA 1K1ZA 1R8OB 4C92F 1J3TA 4DBQA 1N9SA 1VQOA 2QXFA 1JXOA 1QVGS 2JVVA 4QQGA 4XTUA 4FT4A 2E3HA 4QVCA 4KUDK 3HRUA 1YITA 2YRVA 4ESRA 3QYGB 4FIBA 2K2VA 2XKOC 1W6XA 4DBRA 4DBHA 3A98A 1BBZA 3M54A 1JJ2S 4KBMB 2YUQA 1TUGB 5FU7B 1GFDA 2LJ3A 4J6YA 1VQ8T 1KK7A 4E7IA 2HKNA 4OB1B 2EYXA 5HK3A 3RR6A 5HY6A 3T9NA 1ZA2B 2RPNA 2YXYA 3OS5A 4FYYB 1NJIU 3VS6A 1NG2A 4CRIA 2MK5A 3JCMJ 4R0KA 2GF7A 3QJ6A 1EIFA 3JRZA 3CMAQ 2JXBA 2PNIA 1ZSZC 3M58A 2F2XA 1YJNT 2DF6A 3CXCS 2JS0A 4BD3A 3CC7A 1N8RR 2A7YA 2KRMA 1A0NB 1SKUB 1UGVA 2D0NA 3VKIA 2BUDA 3M56A 3O8VA 5LJ3d 4BY6C 1FMWA 1V76A 3ZFJA 2VXEA 4J9CA 5LJ5e 2DL8A 3CCSA 4PL6A 1T0HA 2YLCA 2CP6A 1BI0A 1JQQA 3MCAB 1MMNA 1UTIA 1U1TA 3UATA 2DD5A 2G6FX 1VQOQ 1SEMA 5KCOA 2D6FA 4LUDA 1PKTA 1XTDA 1AZGB 2EQIA 3OMCA 3VS5A 1WHKA 1YJWT 3GP8A 5KYYA 2KGTA 1K0SA 1MGQA 1YITQ 1FX7A 3HRSA 5GAMf 2XG8D 2ZPIB 1QP2A 3FIFA 2YUOA 4E2FB 1EZZB 5KYXB 4OMPA 3VRZA 4LDXA 4X1VA 2PTKA 3H0IA 1SPKA 1VQNA 2EJ9A 2YDLA 2YWWA 1OX9A 2DA9A 2X4XA 4RKUE 3GNGA 4JLGA 4N4GA 3JCMf 2RI2A 3VV0A 2M02A 3DB4A 1UJ0A 2L3QA 1ABQA 1ABOA 5EC7A 2YUNA 2VV5A 1WXTA 4KULA 2MWOA 5LJ5h 2RHXA 1Y7XA 2J6FA 1ZX6A 1BI3A 3QKJA 4QQDA 3CCLT 4XTYA 3CC7Q 5D6XA 3OYIA 2LCCA 3GNFB 2KYBA 5C6SA 4X34A 4RTTA 3OYCA 3G1JA 1JRIA 3CMEA 1PSEA 5KYUA 3RBBB 4XU2A 2A08A 2PQWA 2FB7A 2KSSA 4C5GA 1RLQC 5L8RE 3RKWA 5CR2A 3I55T 1PKSA 5LJ3e 1IB8A 3CCSQ 1IHWA 2WSCE 1AZEA 3TREA 3M0UA 2KT1A 3HSBA 2DO3A 2VXFA 2KYMA 4E7HA 1W1FA 5GJVB 3OYEA 3CCET 2JNGA 1UHCA 2E1HA 2DAQA 5A0DA 5AT1B 4ZTJA 2FPFA 4BUGA 2JZ2A 2FYKA 2QTVA 4PJOA 2DERA 4HT8A 2JT4A 1Y0MA 4JZ4A 3PNWC 4J6XA 4VUBA 4N0AA 1RL2A 2DYBA 1VQNQ 4J9FA 4PJOD 3GPLA 1VOMA 3MHXA 4ZN1A 4E7JA 4J9EA 1NEBA 2EYQA 3H41A 2OTJT 1IXDA 2E70A 2K3YA 2DIGA 2RF0A 5LJ5g 4M77G 4EMHA 4LD6A 1WYXA 3PIOA 1WHMA 4DA4A 2K79A 3OBYA 1YJNA 1B3QA 5CCAA 3QG1A 2ZPBB 1GL5A 2CP0A 2HCKA 1K9AA 2D1XA 3M0SA 3CMEQ 4Y28E 1VQ4A 2ROLA 3I56T 5A2QE 3LGFA 1ZUYA 2HQEA 4E47A 1MNDA 3TCJA 4RG2A 2GFUA 2HQHA 3L2QA 2LP5A 2GFAA 1UGQB 4PJOF 2DK3A 2BZ8A 1VQ7A 1YJWA 1Q81U 3PT9A 4PKCC 4V2SA 2DE0X 1UGPB 1NYGA 2DL5A 1TUCA 2L2PA 4Z88A 3EHRA 1VQ6A 1KG1A 5L23A 3A1PA 3VS0A 3QJYA 2E12A 1AOJA 2EKOA 2VKNA 2FPDA 2J6KA 4CC2A 3PIPA 4CC3A 3CBOA 3JCMX 5CQXA 4J8OA 5KE2A 3LWHA 3NTHA 1MHNA 3QWXX 4F7UG 2A28A 1JBMA 1M30A 2GCXA 3LH5A 4KRTA 2W0ZA 2EFIA 2DILA 3SD4A 3JCMe 4PFOA 2BE9B 4PNOA 2YT6A 1YJNQ 1XJWB 2K3BA 3J80E 1QVGA 1DJ7B 2AT1B 3S3MA 1U06A 1RAGB 2LQKA 1M3CA 5GAOq 1VQ4Q 1B34B 4QT7A 2AHJB 2J06A 2LX7A 2ESWA 3I55A 2DEUA 1YN8A 2EPDA 5HCKA 2Y4XA 1FYNA 1CSKA 1JJ2A 3CQTA 3CCEA 4RTZA 2KT8A 5GAMh 2HSPA 4OVAA 1HJDA 3CC4T 2CUDA 5IHIA 2AKLA 2GTOA 1VQ7Q 1YJWQ 2QQSA 1RAFB 2D9TA 2OJ2A 3DLMA 4IUTA 3UA7A 3L2ZA 5I11A 5GANd 1I8FA 3CD6T 3OYHA 3QZ9B 5GJWB 1S1NA 4D8KA 3HRTA 2HAXA 3V8KA 2E3IA 1Y07A 1VQ6Q 5CKEA 1FMKA 3C94A 8AT1B 3JCMh 4NOYA 3U23A 3UA6A 4B6MA 2V1QA 1O75A 2LT4A 5GMKl 2HDAA 3OYAA 1TXQA 4CC4B 2JS2A 3ZBDA 3CXCA 2JTFA 2OTJA 2FG0A 5M9OA 1VQ5A 2RN8A 2F2VA 1N8RC 1Z9QA 2RJDA 4A4FA 2MI6A 1QVGP 5A0LA 1OU9A 3JB9J 4JRKA 5KYWB 2HL5C 9ATCB 1LPLA 5FU7C 2QQRA 4OGEA 3CCUT 2JW4A 4R56A 2QA4T 4XTWA 1JJ2P 1NM7A 3CCMA 1HYOA 2SEMA 3EG9B 1H641 1SG5A 1U1SA 1UHFA 3KUFA 2DXTA 3I55Q 4J7FA 2ZPFB 3SWNB 4B9WA 1UDLA 1WJSA 2XD0A 2AIRB 4XU0A 5KE3A 3CCEQ 1OULA 1PWTA 4FYWB 2ZPHB 1G8XA 3ME9A 2AKKA 4MMKA 3GIBA 2MYSA 4IUUA 4YTLA 2RH2A 4D6WA 1PNJA 3V7RA 3G71T 2NLUA 1P92A 5FWCA 4J9GA 3CXCP 5ECAA 3WXMB 2AK5A 1HD3A 1Z9ZA 4GLMA 2EQKA 2C0OA 3JCMg 4WF2A 1M90R 2BE7D 1V29B 2FVUA 1QVFS 2E41A 2DBMA 1KJWA 1G3WA 4RCBA 5GANj 4M7DE 3OS1A 2OTJQ 3FJ5A 3KBGA 1IGUA 2O01E 1VQ5Q 1N8RU 2ROTA 3FLGA 4AG2C 3OQ5A 4DEXA 3MP1A 3LW5E 2LNHB 1KIKA 5GMKe 2E10A 4LDVA 2RMOA 1LVKA 3I9QA 4M77D 3DB3A 2FPEA 4AFUC 2VUBA 4JDSA 4OMLA 1UECA 4OB3B 3OYDA 3E1SA 1HXDA 3EG1A 4RTWA 1OU8A 1YCYA 2NUTA 2JM9A 1VQPA 1TSFA 1AEYA 1M1GA 1M2VA 2E5QA 2Y90A 2P84A 4HCKA 3V8JA 1GXIE 4PJNA 1WX6A 5AYFA 3I56Q 2K7AA 3J7AF 2HBWA 4JS4A 1X6OA 1B34A 1M1FA 4HVVA 1U3OA 3A8MB 2RQWA 1QVPA 1N27A 1QKXA 4IIMA 2CP2A 3X24B 4C8QE 1KQ2A 2OAWA 4GY5A 1PRMC 5CQYA 3CC4A 4E7KA 2OAUA 4AFQC 5LJ3f 1TG0A 2LT1A 3I5RA 3CD6A 2KAFA 5DLQE 1K76A 3JV3A 1WXUA 2DJZA 3URGA 3M0PA 1EX4A 2O88A 2QQAA 4D8DA 3JCMW 3VYGA 4ZGDB 3QWYA 2E65A 1KHCA 2M0OA 5GMKh 2CDTA 2P0PA 3HKSA 4M77F 2EQUA 3CCRT 3CPFA 1MUZA 1FMVA 1X6GA 3A8GB 2JJ9A 5IXBA 1BKBA 1WDXA 1D0XA 4FW2A 3A8LB 3EGDB 3EH2A 4IUVA 2DD4A 1XNIA 3TQ7P 4M7DB 2X9HA 1VYVA 3CCUA 5CIUA 2QA4A 1VUBA 3EGXB 1VQPQ 1ZBXA 3NGPA 1LJOA 1W4SA 3A8OB 2H3JA 2FRWA 1VQKT 1X27A 1BYMA 2DKGA 2RO0A 5IHNA 3CC4Q 3CCVT 1TS9A 2NUPB 3EG2A 2DXCA 1ZUKA 1BI1A 2CYZB 2DXBA 1WZOA 1PD0A 4M78C 5FWBA 4MDXA 3G71A 3CD6Q 1GRIA 1PC0A 4TVRA 4F7UF 4C8QB 3L2WA 2DLPA 1YCSB 4M75E 2LDMA 4KH0B 1SRLA 2FL7A 2G3RA 3S6WA 4A54A 1YJ9T 4XU3A 4LDUA 1YWOA 1KFZA 3LLRA 1OI1A 5D6WA 2ZZDA 3MKDA 1K8AC 3ASKA 3NMZC 2LQWA 2CZ0B 3LGLA 2EWNA 2RQUA 3EHQA 3LWIA 1Q86R 3LX7A 1QW1A 3P8BB 4LXCA 3META 3RMQA 2EQJA 2MCNA 3VUZA 4AFSC 1FWZA 5LJ5j 3CCUQ 1G3TA 2QA4Q 4FCYA 2CZ1B 3VU3C 1MV3A 5D6YA 2BTTA 4WTOB 4M78E 2JUFA 1RACB 4JJBA 1GBQA 2DL3A 1QCOA 1H3ZA 2DM1A 1AD5A 1KQ1A 2I2LA 3H6ZA 4FSSA 4N4IA 4AG1C 2X4YA 3TEEA 3PVLA 3OY9A 1AT1B 4KH1B 3LYIA 1RI0A 2QQ9A 4IUPA 3J81E 4FSXA 2HKQB 3L2UA 3TVTA 2R57A 3G71Q 4EDUA 3QYHB 1YBYA 1IHVA 4OGCA 5CVIA 2ED1A 1W2BS 1Y96A 1SRMA 2DL4A 3HL8A 1M2OA 2F5TX 3C0CA 1WPYA 2LQ8A 1PRLC 3JCMb 3D7SB 3E9FA 5I22A 2JM8A 4JPBW 1PCXA 2DZ9A 4E7LA 5GAN6 3OYYA 4ME7A 2HBPA 2J05A 2VGMA 4M75B 1I1JA 3RKXA 4M4ZA 2JTMA 3VRYA 3EGDA 2P0QA 5FLXE 3F70A 3SEMA 1YI2T 1WNLA 1M1KC 2KBTA 2RNAA 1G83A 2R5MA 4C92E 1QKWA 3M9QA 2JMAA 1VQ8A 3BDLA 1SF9A 3H0FA 4M7DA 3RERA 1C1AA 1NBEB 3X26B 2KI7A 1WIEA 2IVWA 5GAMd 3EGXA 2ZCFB 2RJFA 4LUEA 2JOYA 1M3AA 4FL6A 3G6ET 1UGRB 3EAEA 4FT2A 1VQKA 3M55A 2LMJA 5IN1A 5LJ3h 1YHQT 2VWFA 3CCVA 4OB2B 3X25B 3NPFA 2QQBA 2K5LA 4M78B 5GMKi 5GAOm 5HKCA 1QVFA 1D0YA 3HHTB 3OYBA 1M90C 3UF4A 1X6BA 3VJPA 3UWNA 2EKHA 3OW2S 2MMPA 4OB0B 1B7TA 2Z0WA 4O6JA 4HA8A 2BIVA 4C8QA 1C6VX 2VGNA 1V1CA 2QYZA 3SWNC 3CCRQ 1RABB 4PLLA 2V8IA 1LOJA 3OS2A 1BCOA 4BACA 5GAN7 1GCPA 4C0FA 4A63B 1S72T 1ZA1B 2CH4W 3JCMc 4K11A 5DM7R 2FEIA 1PM3A 3NTIA 2O4XB 2RHIA 4QVDA 2H8HA 1OZ2A 4Q5WA 1WGSA 3MP6A 1NYFA 4E7SA 1M8MA 5KYXA 1VQ8Q 1RAEB 2NYSA 2KXCA 3EFOB 2LNVA 4HCCA 2EAYA 1I81A 3C12A 1M9SA 4EIKA 3M59A 2QAZA 1YWPA 4A4EA 2CP5A 2J7IA 2PUKB 1Q7YR 1QVFP 2RI3A 4C92B 1VQKQ 1WLPB 2DTHA 4IIOA 5LJ3g 2KR3A 3QXEB 3OYLA 1K8AR 3MEUA 3CCVQ 3JSCA 1M3BA 4XU1A 3CCLA 1E7OA 2XU8A 3MPUB 4A53A 1M90U 5GAMj 3PE0A 1VIEA 2F1LA 1QP3A 3JB9H 2HL3A 1UGSB 3JCMP 1NLOC 2DL7A 2WSFE 4ZTFA 1G3SA 1IREB 1QCNA 1XOVA 2GGRA 3VS3A 2QASA 4QKUA 4UC4A 3CPWS 2D0QB 2DEQA 2RM4A 3OYKA 4XAXB 3NHNA 1W70A 1NPPA 3QHSA 3JCMQ 4QW2A 1K4US 1I0CA 3M0TA 2DBKA 3OYNA 4CI0C 1M4ZA 2IIMA 4LDYA 4WCIA 4M75A 3OYMA 4A4KA 3X28B 1BCMA 2COWA 1I5OB 1HK9A 1B07A 1WQWA 3OSSC 3JB9G 4PK4A 4FW1A 2PVGB 1WI7A 5EG2A 4RMOA 2OTLT 2CP3A 3KFVA 4DOWA 1RAIB 2HD0A 4LN2A 2F2WA 1LCKA 4A4GA 3MEVA 4RUGA 2V8KA 4J83A 3E9GA 4M7AC 3UPUA 3G6EA 1ACMB 3Q1JA 1BB9A 1KD1C 1EFNA 5IH2A 2YRDA 3BE3A 4O5VA 2CT4A 1YHQA 1ZSGA 3VS7A 4BI3A 2LC4A 1KQSS 2YRCA 2XDDA 3CCLQ 4ZNXA 4MZPA 2GTJA 1U8RA 2RB6A 2VC8A 1MMAA 2K6DA 4M7DC 1D1AA 4M78A 3FRNA 3QIIA 2HQXA 3QPHA 3I56A 1M1KR 4KGXB 2GBQA 4KUIA 5I21A 2PVOB 2R58A 2RQVA 2O9VA 6AT1B 1JB0E 2QEXT 4IKFA 1Q86C 2LRQA 4LE9A 2P4TA 4Y91A 4C0GA 2MF2A 5DLOA 3V8LA 1S72A 1UEBA 3LH0A 4QQ6A 2XMFA 2OI3A 3E19A 1Q82C 2L8DA 1BIBA 1U5SA 4JZ3A 4M7AE 2QDYB 2K57A 5GANe 2C0TA 1NPRA 2MOXA 3RIRA 2K4YA 1ZLMA 2DYIA 3MO8A 1CKAA 4C8QC 1YI2Q 2O4XA 2DXUA 3QO3A 3RESA 4XTZA 3CC7T 1YIJT 1IO6A 3S3OA 4RTYA 4PJOE 1JXMA 3EFOA 2DFUA 1RAHB 1OEBA 2XI9A 1D0ZA 4DEYA 2KRSA 1UFFA 3CCST 5D7UA 3OBWA 1KD1U 4LNPA 3G6EQ 1W2BA 3SHWA 4NL2A 2RK2A 3V7SA 4HCBA 1YHQQ 2HEQA 4C92A 4ZGJB 5KYYB 5J3BA 3X20B 2FZCB 5J26A 2CKKA 3H9NA 3WVEB 2ZPEB 2I0NA 4M7AG 4F04B 3L2RA 3N5BB 3DLLA 4OMMA 4HKEA 2ENMA 1QQJA 2VB6A 2L89A 1BI2A 2R5AA 3ULRB 2WACA 4BI4A 1UG1A 3G4ST 2FHDA 2IPOB 1VQNT 4J9BA 1Y57A 4M7DG 3RUXA 1K9MC 3HFNA 1Q86U 4DBFA 2MIOA 2CS7A 2ZGWA 2RD1A 5GMKj 3OB9A 2DRMA 2IG0A 1S72Q 1Q82U 3OA6A 3CBPA 4EMKB 4L59A 2E4HA 1T3SA 2A3LA 2EGCA 2EGEA 2KK4A 2SRCA 3PVQA 4F16A 3QBYA 1H3HA 3OYFA 4BE0A 3M0QA 2CH4A 1K73C 3M57A 2LJ1A 3JAME 1W2BP 2OTLA 2NWMA 2KVQG 3CEYA 2XHCA 4FYVB 5KYUB 3THKA 3EFRA 3EG3A 5LJ5d 2QK0A 4LDWA 3CMET 2DIQA 4M7AB 1F1BB 3G7ZA 1VQLT 4C8QG 1VQMT 4C5IA 2QGGA 2LCSA 2V26A 2BZYA 3IQLA 3OW2A 5LL6S 2L3RA 4M75C 3M5AA 1UUEA 2KNBB 1NLPC 4PJOB 3VS2A 5KCHA 5KYWA 2X3WD 2LCLA 2E5KA 2EBPA 4NS5A 5FRMA 5GAOr 2CZ6B 2P0KA 4ELZC 5GAOn 1IRXA 2PU9B 1PSFA 4XQ3A 2H3EB 4JUVA 4II1A 4JJCA 4J7IA 1G5VA 3P8DA 5FRNA 3EG9A 1Y71A 2AZSA 5GANg 1GBRA 3CCQT 1K9MU 3SWNA 2DVJA 2QEXA 1CKBA 1TWBA 1TU0B 3RMSA 1VQ9T 1JO8A 3CCJT 1KD1R 4RTUA 2CGHA 2FZKB 2PUOB 1WJQA 1R77A 1UB4A 2HNIA 3QDFA 2K5IA 3BFMA 4PJLA 2RHZA 1Q7YC 1H92A 4EMGA 1K73U 4PJMA 3OW2P 1YIJA 4J9HA 5FU6C 1OZ3A 2K3XA 3JB9D 2OTLQ 1VA7A 3FDRA 2B86A 4C0DB 2NUZA 2L3PA 4JJDA 2KEAA 1VQ4T 4N4HA 2O2OA 4J5YA 1LNXA 4JLIA 1C0MA 1OOTA 1KHIA 3MJXA 2VASA 3A5ZB 2ZAEA 3PTAA 4OF1A 2M9UA 2QI2A 3C95A 3L2VA 3HFOA 1X43A 1SSFA 1X2KA 3AHUA 1E6GA 4E6RA 1VYUA 4CC7A 1QWFA 5FROA 3CPWA 1VQ7T 3P8HA 1Q82R 3I35A 4BDYA 4M75G 4HCZA 2Y4YA 4J9DA 4A4HA 4MZMA 3FB9A 1VQ6T 2PZ1A 5KH6A 3G4SA 2EJFA 3I5SA 1M5Q1 4FYXB 3KXTA
chains in the Genus database with same CATH topology
3CXCP 3OW2P 3CC4Q 3I56Q 3G6EQ 1VQLQ 1VQ9Q 1VQMQ 1K9MR 1N8RR 2OTLQ 1VQPQ 1VQ7Q 1YI2Q 1KQSP 1YJWQ 3G4SQ 2QEXQ 3CCJQ 1Q81R 1K73R 3CCLQ 3CCUQ 1Q82R 3CC2Q 1Q7YR 3CCEQ 1YIJQ 1M90R 1YHQQ 2QA4Q 1KD1R 1VQ4Q 3CC7Q 1YITQ 1VQNQ 1QVFP 3CD6Q 1JJ2P 1NJIR 1S72Q 1VQKQ 3G71Q 3CCRQ 3CCQQ 1VQ6Q 1QVGP 3CMAQ 1W2BP 1VQ8Q 1KC8R 2OTJQ 1K8AR 3CPWP 1M1KR 3CCMQ 1VQ5Q 3CCVQ 1YJNQ 3I55Q 1Q86R 1YJ9Q 1VQOQ 3CCSQ 3CMEQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC P;  3OW2 P;  3CC4 Q;  3I56 Q;  3G6E Q;  1VQL Q;  1VQ9 Q;  1VQM Q;  1K9M R;  1N8R R;  2OTL Q;  1VQP Q;  1VQ7 Q;  1YI2 Q;  1KQS P;  1YJW Q;  3G4S Q;  2QEX Q;  3CCJ Q;  1Q81 R;  1K73 R;  3CCL Q;  3CCU Q;  1Q82 R;  3CC2 Q;  1Q7Y R;  3CCE Q;  1YIJ Q;  1M90 R;  1YHQ Q;  2QA4 Q;  1KD1 R;  1VQ4 Q;  3CC7 Q;  1YIT Q;  1VQN Q;  1QVF P;  3CD6 Q;  1JJ2 P;  1NJI R;  1S72 Q;  1VQK Q;  3G71 Q;  3CCR Q;  3CCQ Q;  1VQ6 Q;  1QVG P;  3CMA Q;  1W2B P;  1VQ8 Q;  1KC8 R;  2OTJ Q;  1K8A R;  3CPW P;  1M1K R;  3CCM Q;  1VQ5 Q;  3CCV Q;  1YJN Q;  3I55 Q;  1Q86 R;  1YJ9 Q;  1VQO Q;  3CCS Q;  3CME Q; 
#chains in the Genus database with same CATH topology
 2FO0 A;  4OP0 A;  3UDC A;  1QWE A;  2FRY A;  2QDL A;  3PGG A;  5DY9 A;  5CO7 A;  4C92 C;  3QSU A;  2QEX Q;  4M77 C;  2M0Y A;  3JB9 F;  1G3Y A;  1TTH B;  2OX7 A;  2VVK A;  2E6Z A;  2DMO A;  3PMI A;  2CRE A;  3ER0 A;  2GQI A;  1WHJ A;  5FW9 A;  1T3L A;  3EGU A;  4J6W A;  2RK1 A;  4ZN3 A;  4FM4 B;  1KSW A;  2EQM A;  2KE9 A;  4EMK A;  3H0H A;  2K9G A;  2X4J A;  1SHG A;  4IUQ A;  1Q7Y U;  1YNZ A;  4AMC A;  2LZ6 B;  3FJP A;  2V8J A;  4M78 G;  1TH7 A;  1YIJ Q;  1X01 A;  2MWP A;  4KT0 E;  3CCR A;  3AT1 B;  3S3N A;  5HK0 A;  1YP5 A;  1KQS A;  1NEG A;  1K8A U;  2DTO A;  2M51 A;  4RTV A;  4BDZ A;  4C5E A;  5GAN 3;  1VQL A;  1VQM A;  3CPW P;  5GMK m;  3TSZ A;  4M7A A;  1K9M R;  2RJE A;  1VIF A;  1K0X A;  5CKH A;  2WSE E;  3CC2 T;  2RQR A;  3M0R A;  2D8H A;  4C5H A;  3SB2 A;  1TUD A;  4J9I A;  1IGQ A;  3QDR B;  5J39 A;  4M77 E;  1NJI R;  1FXX A;  2DZC A;  1SHF A;  2XIC A;  1YFN A;  5LJ3 j;  1OPK A;  4GLK A;  1Q81 C;  3BY7 A;  3L1A A;  3A8H B;  3EG0 A;  4M7A D;  2RHY A;  2YUP A;  1OX8 A;  4PFP A;  3G4S Q;  1K73 R;  1T0J A;  3SDZ A;  2LQN A;  2A36 A;  3CCQ A;  2CP7 A;  3MEW A;  4P5N A;  1N9R A;  1I4K 1;  1PD1 A;  1JEG A;  4M7D D;  1QLY A;  2GNC A;  4ANJ A;  1VQ9 A;  2CSQ A;  2NUP A;  1VQ5 T;  3GOX A;  3CCJ A;  1RI9 A;  3JCM d;  5IAY A;  4C92 G;  1OPL A;  1RAA B;  1KQS P;  1RLP C;  1ZSZ B;  3VS4 A;  2EGA A;  1N6A A;  2LVM A;  2JMC A;  1GCQ A;  2RQT A;  1X2Q A;  2P4R A;  5FU6 B;  3BDU A;  4E7Z A;  2CSI A;  1YJ9 A;  5CKD A;  2F5K A;  2LX9 A;  4ELY C;  2RI5 A;  4BY6 B;  3NFC A;  4PJJ A;  5I2M A;  1WFW A;  4L5G A;  3CCM T;  5GAN f;  2HZY A;  4JJN K;  4M7A F;  1VQL Q;  1VQM Q;  2L3S A;  2GQV A;  2DVE A;  2J6O A;  1ZQ1 A;  3NTK A;  2EVR A;  2EYW A;  4C8Q D;  1M8V A;  5CK9 A;  1MNE A;  4F7U E;  1Q95 G;  2C0I A;  4DOV A;  1M1K U;  2X4W A;  2BKD N;  2X51 A;  1ZUU A;  3ZEH A;  3HTR A;  4JRP A;  2ATC B;  4BE1 A;  2LTO A;  4BB7 A;  5I2S A;  4M7D F;  1XQH A;  4OMF B;  2O9S A;  4JRQ A;  2HSE B;  1UE9 A;  3RNJ A;  3MP8 A;  4KGV B;  1D3B B;  4HVU A;  3H8Z A;  2ECZ A;  2XK0 A;  3RKY A;  2ED0 A;  2QTX A;  1AHJ B;  3SFM A;  3GBQ A;  5GAM e;  2EYY A;  2E64 A;  3DKM A;  3CCQ Q;  2KY9 A;  4M77 B;  4ATO A;  2DX1 A;  2A0F B;  3OS0 A;  4Z89 A;  2L5Q A;  2LJ0 A;  3BW1 A;  1HSQ A;  1MMG A;  3PMT A;  4XK8 E;  1VQ9 Q;  1OQK A;  4RTX A;  5GAN 2;  3M4Y A;  3CCJ Q;  2ABL A;  1E6H A;  1KC8 C;  2F69 A;  4ORZ A;  1D1B A;  3FEO A;  1WJR A;  2DNU A;  2KMT A;  4Y92 A;  1PHT A;  2RJC A;  3ZL7 C;  4C8Q F;  1AWW A;  5GAO p;  1G2B A;  4AFZ C;  4KGZ B;  2KQW A;  5GAN 8;  3V7C A;  4MDW A;  2NUT B;  1YJ9 Q;  1M2V B;  5A0G A;  1VQP T;  2CT3 A;  2KRO A;  1BK2 A;  2JTE A;  1JU5 C;  1R0B G;  3OYJ A;  3OSV A;  2XDB A;  4X9C A;  1RUW A;  1R0C B;  4EMK C;  2MAM A;  2M1H A;  2EJG A;  1X75 C;  3CBM A;  3CMA T;  1N5Z A;  3PFS A;  1YI2 A;  2BZX A;  1ZHI A;  2RHU A;  3CC2 A;  1TOV A;  2FZG B;  2XID A;  2PVD B;  4AT1 B;  3RDV A;  2EYZ A;  1I5L A;  2A37 A;  2EW3 A;  3HP9 A;  5IHK A;  4MZT A;  4F7U B;  4M75 D;  2EIF A;  5CKF A;  4GBQ A;  3REA B;  2E6N A;  3QUI A;  4JRI A;  3TSW A;  1ZBJ A;  4F14 A;  1QMC A;  4RG8 A;  4FU6 A;  1RAD B;  1VQO T;  2W10 A;  2MPX C;  3M53 A;  5IXF A;  2QGF B;  2XDP A;  2KXD A;  2KDS A;  4PJO C;  1YIT T;  1KC8 U;  1M27 C;  1WXB A;  2M16 A;  3EH1 A;  2YLB A;  1WA7 A;  3OMG A;  2COY A;  3VS1 A;  3M4G A;  3O5Z A;  4N0A C;  2C06 A;  1ZSZ A;  1Q81 R;  1D1C A;  1GFC A;  2X3X D;  2V1R A;  2DTI A;  4ZGE B;  3E2U A;  4M78 D;  1MMD A;  2K2M A;  4IUR A;  1AWO A;  1SSH A;  3FC3 A;  2DET A;  3MEA A;  4OMN A;  5KYN A;  3UT1 A;  4M75 F;  1PG5 B;  1AWX A;  3GF5 A;  1VYT A;  3REB B;  5GAO l;  1QCF A;  3EFS A;  4OMQ A;  2AZV A;  1BU1 A;  4HXJ A;  5GAM g;  1GCQ C;  2HMA A;  1X69 A;  3CC2 Q;  4Z8A A;  3TU4 K;  1D09 B;  2B8A A;  5LJ5 f;  1IZ6 A;  4PFZ A;  7AT1 B;  1ARK A;  3JCM V;  4EPC A;  2VYT A;  4C0D C;  2X35 A;  3VYH B;  1D3B A;  1OYX A;  4DQ2 A;  2O31 A;  2RA2 A;  2YSQ A;  4PLI A;  2ZPG B;  1AWJ A;  4QVZ A;  4RCC A;  4MML A;  4M77 A;  3GLX A;  3C4S A;  4B9X A;  4M78 F;  5C0M A;  3OYG A;  3HPW A;  1WHG A;  1NE8 A;  1I07 A;  2DPP B;  5GAN 5;  2JN0 A;  3L42 A;  3JB9 I;  3R6O A;  1O9S A;  2DJQ A;  5GAN 4;  1WHL A;  1WQ7 A;  4C92 D;  1NZ9 A;  4PJO G;  3R6N A;  4HVW A;  2CUB A;  5GAN h;  2DRK A;  4BI8 B;  4XTX A;  1OV3 A;  1BIA A;  3QZ5 B;  3CCM Q;  4Z02 A;  4NL3 A;  1NJI C;  4OMO A;  5CAI A;  2CZ7 B;  8ATC B;  4XTV A;  2COZ A;  4JS5 A;  4HT9 A;  1AVZ C;  4L6V 5;  5IT9 E;  3CMA A;  2D8J A;  2KRN A;  2YHT A;  3INZ A;  4LD9 K;  2QG9 B;  3WVD B;  1WHH A;  1KC8 R;  1H8K A;  4R55 A;  1Y96 B;  2L0A A;  1MV0 B;  4X9D A;  4BE2 A;  1UJY A;  3VUB A;  4F17 A;  4C0Z A;  2K5F A;  4F7U A;  5CKB A;  1K1Z A;  1R8O B;  4C92 F;  1J3T A;  4DBQ A;  1N9S A;  1VQO A;  2QXF A;  1JXO A;  1QVG S;  2JVV A;  4QQG A;  4XTU A;  4FT4 A;  2E3H A;  4QVC A;  4KUD K;  3HRU A;  1YIT A;  2YRV A;  4ESR A;  3QYG B;  4FIB A;  2K2V A;  2XKO C;  1W6X A;  4DBR A;  4DBH A;  3A98 A;  1BBZ A;  3M54 A;  1JJ2 S;  4KBM B;  2YUQ A;  1TUG B;  5FU7 B;  1GFD A;  2LJ3 A;  4J6Y A;  1VQ8 T;  1KK7 A;  4E7I A;  2HKN A;  4OB1 B;  2EYX A;  5HK3 A;  3RR6 A;  5HY6 A;  3T9N A;  1ZA2 B;  2RPN A;  2YXY A;  3OS5 A;  4FYY B;  1NJI U;  3VS6 A;  1NG2 A;  4CRI A;  2MK5 A;  3JCM J;  4R0K A;  2GF7 A;  3QJ6 A;  1EIF A;  3JRZ A;  3CMA Q;  2JXB A;  2PNI A;  1ZSZ C;  3M58 A;  2F2X A;  1YJN T;  2DF6 A;  3CXC S;  2JS0 A;  4BD3 A;  3CC7 A;  1N8R R;  2A7Y A;  2KRM A;  1A0N B;  1SKU B;  1UGV A;  2D0N A;  3VKI A;  2BUD A;  3M56 A;  3O8V A;  5LJ3 d;  4BY6 C;  1FMW A;  1V76 A;  3ZFJ A;  2VXE A;  4J9C A;  5LJ5 e;  2DL8 A;  3CCS A;  4PL6 A;  1T0H A;  2YLC A;  2CP6 A;  1BI0 A;  1JQQ A;  3MCA B;  1MMN A;  1UTI A;  1U1T A;  3UAT A;  2DD5 A;  2G6F X;  1VQO Q;  1SEM A;  5KCO A;  2D6F A;  4LUD A;  1PKT A;  1XTD A;  1AZG B;  2EQI A;  3OMC A;  3VS5 A;  1WHK A;  1YJW T;  3GP8 A;  5KYY A;  2KGT A;  1K0S A;  1MGQ A;  1YIT Q;  1FX7 A;  3HRS A;  5GAM f;  2XG8 D;  2ZPI B;  1QP2 A;  3FIF A;  2YUO A;  4E2F B;  1EZZ B;  5KYX B;  4OMP A;  3VRZ A;  4LDX A;  4X1V A;  2PTK A;  3H0I A;  1SPK A;  1VQN A;  2EJ9 A;  2YDL A;  2YWW A;  1OX9 A;  2DA9 A;  2X4X A;  4RKU E;  3GNG A;  4JLG A;  4N4G A;  3JCM f;  2RI2 A;  3VV0 A;  2M02 A;  3DB4 A;  1UJ0 A;  2L3Q A;  1ABQ A;  1ABO A;  5EC7 A;  2YUN A;  2VV5 A;  1WXT A;  4KUL A;  2MWO A;  5LJ5 h;  2RHX A;  1Y7X A;  2J6F A;  1ZX6 A;  1BI3 A;  3QKJ A;  4QQD A;  3CCL T;  4XTY A;  3CC7 Q;  5D6X A;  3OYI A;  2LCC A;  3GNF B;  2KYB A;  5C6S A;  4X34 A;  4RTT A;  3OYC A;  3G1J A;  1JRI A;  3CME A;  1PSE A;  5KYU A;  3RBB B;  4XU2 A;  2A08 A;  2PQW A;  2FB7 A;  2KSS A;  4C5G A;  1RLQ C;  5L8R E;  3RKW A;  5CR2 A;  3I55 T;  1PKS A;  5LJ3 e;  1IB8 A;  3CCS Q;  1IHW A;  2WSC E;  1AZE A;  3TRE A;  3M0U A;  2KT1 A;  3HSB A;  2DO3 A;  2VXF A;  2KYM A;  4E7H A;  1W1F A;  5GJV B;  3OYE A;  3CCE T;  2JNG A;  1UHC A;  2E1H A;  2DAQ A;  5A0D A;  5AT1 B;  4ZTJ A;  2FPF A;  4BUG A;  2JZ2 A;  2FYK A;  2QTV A;  4PJO A;  2DER A;  4HT8 A;  2JT4 A;  1Y0M A;  4JZ4 A;  3PNW C;  4J6X A;  4VUB A;  4N0A A;  1RL2 A;  2DYB A;  1VQN Q;  4J9F A;  4PJO D;  3GPL A;  1VOM A;  3MHX A;  4ZN1 A;  4E7J A;  4J9E A;  1NEB A;  2EYQ A;  3H41 A;  2OTJ T;  1IXD A;  2E70 A;  2K3Y A;  2DIG A;  2RF0 A;  5LJ5 g;  4M77 G;  4EMH A;  4LD6 A;  1WYX A;  3PIO A;  1WHM A;  4DA4 A;  2K79 A;  3OBY A;  1YJN A;  1B3Q A;  5CCA A;  3QG1 A;  2ZPB B;  1GL5 A;  2CP0 A;  2HCK A;  1K9A A;  2D1X A;  3M0S A;  3CME Q;  4Y28 E;  1VQ4 A;  2ROL A;  3I56 T;  5A2Q E;  3LGF A;  1ZUY A;  2HQE A;  4E47 A;  1MND A;  3TCJ A;  4RG2 A;  2GFU A;  2HQH A;  3L2Q A;  2LP5 A;  2GFA A;  1UGQ B;  4PJO F;  2DK3 A;  2BZ8 A;  1VQ7 A;  1YJW A;  1Q81 U;  3PT9 A;  4PKC C;  4V2S A;  2DE0 X;  1UGP B;  1NYG A;  2DL5 A;  1TUC A;  2L2P A;  4Z88 A;  3EHR A;  1VQ6 A;  1KG1 A;  5L23 A;  3A1P A;  3VS0 A;  3QJY A;  2E12 A;  1AOJ A;  2EKO A;  2VKN A;  2FPD A;  2J6K A;  4CC2 A;  3PIP A;  4CC3 A;  3CBO A;  3JCM X;  5CQX A;  4J8O A;  5KE2 A;  3LWH A;  3NTH A;  1MHN A;  3QWX X;  4F7U G;  2A28 A;  1JBM A;  1M30 A;  2GCX A;  3LH5 A;  4KRT A;  2W0Z A;  2EFI A;  2DIL A;  3SD4 A;  3JCM e;  4PFO A;  2BE9 B;  4PNO A;  2YT6 A;  1YJN Q;  1XJW B;  2K3B A;  3J80 E;  1QVG A;  1DJ7 B;  2AT1 B;  3S3M A;  1U06 A;  1RAG B;  2LQK A;  1M3C A;  5GAO q;  1VQ4 Q;  1B34 B;  4QT7 A;  2AHJ B;  2J06 A;  2LX7 A;  2ESW A;  3I55 A;  2DEU A;  1YN8 A;  2EPD A;  5HCK A;  2Y4X A;  1FYN A;  1CSK A;  1JJ2 A;  3CQT A;  3CCE A;  4RTZ A;  2KT8 A;  5GAM h;  2HSP A;  4OVA A;  1HJD A;  3CC4 T;  2CUD A;  5IHI A;  2AKL A;  2GTO A;  1VQ7 Q;  1YJW Q;  2QQS A;  1RAF B;  2D9T A;  2OJ2 A;  3DLM A;  4IUT A;  3UA7 A;  3L2Z A;  5I11 A;  5GAN d;  1I8F A;  3CD6 T;  3OYH A;  3QZ9 B;  5GJW B;  1S1N A;  4D8K A;  3HRT A;  2HAX A;  3V8K A;  2E3I A;  1Y07 A;  1VQ6 Q;  5CKE A;  1FMK A;  3C94 A;  8AT1 B;  3JCM h;  4NOY A;  3U23 A;  3UA6 A;  4B6M A;  2V1Q A;  1O75 A;  2LT4 A;  5GMK l;  2HDA A;  3OYA A;  1TXQ A;  4CC4 B;  2JS2 A;  3ZBD A;  3CXC A;  2JTF A;  2OTJ A;  2FG0 A;  5M9O A;  1VQ5 A;  2RN8 A;  2F2V A;  1N8R C;  1Z9Q A;  2RJD A;  4A4F A;  2MI6 A;  1QVG P;  5A0L A;  1OU9 A;  3JB9 J;  4JRK A;  5KYW B;  2HL5 C;  9ATC B;  1LPL A;  5FU7 C;  2QQR A;  4OGE A;  3CCU T;  2JW4 A;  4R56 A;  2QA4 T;  4XTW A;  1JJ2 P;  1NM7 A;  3CCM A;  1HYO A;  2SEM A;  3EG9 B;  1H64 1;  1SG5 A;  1U1S A;  1UHF A;  3KUF A;  2DXT A;  3I55 Q;  4J7F A;  2ZPF B;  3SWN B;  4B9W A;  1UDL A;  1WJS A;  2XD0 A;  2AIR B;  4XU0 A;  5KE3 A;  3CCE Q;  1OUL A;  1PWT A;  4FYW B;  2ZPH B;  1G8X A;  3ME9 A;  2AKK A;  4MMK A;  3GIB A;  2MYS A;  4IUU A;  4YTL A;  2RH2 A;  4D6W A;  1PNJ A;  3V7R A;  3G71 T;  2NLU A;  1P92 A;  5FWC A;  4J9G A;  3CXC P;  5ECA A;  3WXM B;  2AK5 A;  1HD3 A;  1Z9Z A;  4GLM A;  2EQK A;  2C0O A;  3JCM g;  4WF2 A;  1M90 R;  2BE7 D;  1V29 B;  2FVU A;  1QVF S;  2E41 A;  2DBM A;  1KJW A;  1G3W A;  4RCB A;  5GAN j;  4M7D E;  3OS1 A;  2OTJ Q;  3FJ5 A;  3KBG A;  1IGU A;  2O01 E;  1VQ5 Q;  1N8R U;  2ROT A;  3FLG A;  4AG2 C;  3OQ5 A;  4DEX A;  3MP1 A;  3LW5 E;  2LNH B;  1KIK A;  5GMK e;  2E10 A;  4LDV A;  2RMO A;  1LVK A;  3I9Q A;  4M77 D;  3DB3 A;  2FPE A;  4AFU C;  2VUB A;  4JDS A;  4OML A;  1UEC A;  4OB3 B;  3OYD A;  3E1S A;  1HXD A;  3EG1 A;  4RTW A;  1OU8 A;  1YCY A;  2NUT A;  2JM9 A;  1VQP A;  1TSF A;  1AEY A;  1M1G A;  1M2V A;  2E5Q A;  2Y90 A;  2P84 A;  4HCK A;  3V8J A;  1GXI E;  4PJN A;  1WX6 A;  5AYF A;  3I56 Q;  2K7A A;  3J7A F;  2HBW A;  4JS4 A;  1X6O A;  1B34 A;  1M1F A;  4HVV A;  1U3O A;  3A8M B;  2RQW A;  1QVP A;  1N27 A;  1QKX A;  4IIM A;  2CP2 A;  3X24 B;  4C8Q E;  1KQ2 A;  2OAW A;  4GY5 A;  1PRM C;  5CQY A;  3CC4 A;  4E7K A;  2OAU A;  4AFQ C;  5LJ3 f;  1TG0 A;  2LT1 A;  3I5R A;  3CD6 A;  2KAF A;  5DLQ E;  1K76 A;  3JV3 A;  1WXU A;  2DJZ A;  3URG A;  3M0P A;  1EX4 A;  2O88 A;  2QQA A;  4D8D A;  3JCM W;  3VYG A;  4ZGD B;  3QWY A;  2E65 A;  1KHC A;  2M0O A;  5GMK h;  2CDT A;  2P0P A;  3HKS A;  4M77 F;  2EQU A;  3CCR T;  3CPF A;  1MUZ A;  1FMV A;  1X6G A;  3A8G B;  2JJ9 A;  5IXB A;  1BKB A;  1WDX A;  1D0X A;  4FW2 A;  3A8L B;  3EGD B;  3EH2 A;  4IUV A;  2DD4 A;  1XNI A;  3TQ7 P;  4M7D B;  2X9H A;  1VYV A;  3CCU A;  5CIU A;  2QA4 A;  1VUB A;  3EGX B;  1VQP Q;  1ZBX A;  3NGP A;  1LJO A;  1W4S A;  3A8O B;  2H3J A;  2FRW A;  1VQK T;  1X27 A;  1BYM A;  2DKG A;  2RO0 A;  5IHN A;  3CC4 Q;  3CCV T;  1TS9 A;  2NUP B;  3EG2 A;  2DXC A;  1ZUK A;  1BI1 A;  2CYZ B;  2DXB A;  1WZO A;  1PD0 A;  4M78 C;  5FWB A;  4MDX A;  3G71 A;  3CD6 Q;  1GRI A;  1PC0 A;  4TVR A;  4F7U F;  4C8Q B;  3L2W A;  2DLP A;  1YCS B;  4M75 E;  2LDM A;  4KH0 B;  1SRL A;  2FL7 A;  2G3R A;  3S6W A;  4A54 A;  1YJ9 T;  4XU3 A;  4LDU A;  1YWO A;  1KFZ A;  3LLR A;  1OI1 A;  5D6W A;  2ZZD A;  3MKD A;  1K8A C;  3ASK A;  3NMZ C;  2LQW A;  2CZ0 B;  3LGL A;  2EWN A;  2RQU A;  3EHQ A;  3LWI A;  1Q86 R;  3LX7 A;  1QW1 A;  3P8B B;  4LXC A;  3MET A;  3RMQ A;  2EQJ A;  2MCN A;  3VUZ A;  4AFS C;  1FWZ A;  5LJ5 j;  3CCU Q;  1G3T A;  2QA4 Q;  4FCY A;  2CZ1 B;  3VU3 C;  1MV3 A;  5D6Y A;  2BTT A;  4WTO B;  4M78 E;  2JUF A;  1RAC B;  4JJB A;  1GBQ A;  2DL3 A;  1QCO A;  1H3Z A;  2DM1 A;  1AD5 A;  1KQ1 A;  2I2L A;  3H6Z A;  4FSS A;  4N4I A;  4AG1 C;  2X4Y A;  3TEE A;  3PVL A;  3OY9 A;  1AT1 B;  4KH1 B;  3LYI A;  1RI0 A;  2QQ9 A;  4IUP A;  3J81 E;  4FSX A;  2HKQ B;  3L2U A;  3TVT A;  2R57 A;  3G71 Q;  4EDU A;  3QYH B;  1YBY A;  1IHV A;  4OGC A;  5CVI A;  2ED1 A;  1W2B S;  1Y96 A;  1SRM A;  2DL4 A;  3HL8 A;  1M2O A;  2F5T X;  3C0C A;  1WPY A;  2LQ8 A;  1PRL C;  3JCM b;  3D7S B;  3E9F A;  5I22 A;  2JM8 A;  4JPB W;  1PCX A;  2DZ9 A;  4E7L A;  5GAN 6;  3OYY A;  4ME7 A;  2HBP A;  2J05 A;  2VGM A;  4M75 B;  1I1J A;  3RKX A;  4M4Z A;  2JTM A;  3VRY A;  3EGD A;  2P0Q A;  5FLX E;  3F70 A;  3SEM A;  1YI2 T;  1WNL A;  1M1K C;  2KBT A;  2RNA A;  1G83 A;  2R5M A;  4C92 E;  1QKW A;  3M9Q A;  2JMA A;  1VQ8 A;  3BDL A;  1SF9 A;  3H0F A;  4M7D A;  3RER A;  1C1A A;  1NBE B;  3X26 B;  2KI7 A;  1WIE A;  2IVW A;  5GAM d;  3EGX A;  2ZCF B;  2RJF A;  4LUE A;  2JOY A;  1M3A A;  4FL6 A;  3G6E T;  1UGR B;  3EAE A;  4FT2 A;  1VQK A;  3M55 A;  2LMJ A;  5IN1 A;  5LJ3 h;  1YHQ T;  2VWF A;  3CCV A;  4OB2 B;  3X25 B;  3NPF A;  2QQB A;  2K5L A;  4M78 B;  5GMK i;  5GAO m;  5HKC A;  1QVF A;  1D0Y A;  3HHT B;  3OYB A;  1M90 C;  3UF4 A;  1X6B A;  3VJP A;  3UWN A;  2EKH A;  3OW2 S;  2MMP A;  4OB0 B;  1B7T A;  2Z0W A;  4O6J A;  4HA8 A;  2BIV A;  4C8Q A;  1C6V X;  2VGN A;  1V1C A;  2QYZ A;  3SWN C;  3CCR Q;  1RAB B;  4PLL A;  2V8I A;  1LOJ A;  3OS2 A;  1BCO A;  4BAC A;  5GAN 7;  1GCP A;  4C0F A;  4A63 B;  1S72 T;  1ZA1 B;  2CH4 W;  3JCM c;  4K11 A;  5DM7 R;  2FEI A;  1PM3 A;  3NTI A;  2O4X B;  2RHI A;  4QVD A;  2H8H A;  1OZ2 A;  4Q5W A;  1WGS A;  3MP6 A;  1NYF A;  4E7S A;  1M8M A;  5KYX A;  1VQ8 Q;  1RAE B;  2NYS A;  2KXC A;  3EFO B;  2LNV A;  4HCC A;  2EAY A;  1I81 A;  3C12 A;  1M9S A;  4EIK A;  3M59 A;  2QAZ A;  1YWP A;  4A4E A;  2CP5 A;  2J7I A;  2PUK B;  1Q7Y R;  1QVF P;  2RI3 A;  4C92 B;  1VQK Q;  1WLP B;  2DTH A;  4IIO A;  5LJ3 g;  2KR3 A;  3QXE B;  3OYL A;  1K8A R;  3MEU A;  3CCV Q;  3JSC A;  1M3B A;  4XU1 A;  3CCL A;  1E7O A;  2XU8 A;  3MPU B;  4A53 A;  1M90 U;  5GAM j;  3PE0 A;  1VIE A;  2F1L A;  1QP3 A;  3JB9 H;  2HL3 A;  1UGS B;  3JCM P;  1NLO C;  2DL7 A;  2WSF E;  4ZTF A;  1G3S A;  1IRE B;  1QCN A;  1XOV A;  2GGR A;  3VS3 A;  2QAS A;  4QKU A;  4UC4 A;  3CPW S;  2D0Q B;  2DEQ A;  2RM4 A;  3OYK A;  4XAX B;  3NHN A;  1W70 A;  1NPP A;  3QHS A;  3JCM Q;  4QW2 A;  1K4U S;  1I0C A;  3M0T A;  2DBK A;  3OYN A;  4CI0 C;  1M4Z A;  2IIM A;  4LDY A;  4WCI A;  4M75 A;  3OYM A;  4A4K A;  3X28 B;  1BCM A;  2COW A;  1I5O B;  1HK9 A;  1B07 A;  1WQW A;  3OSS C;  3JB9 G;  4PK4 A;  4FW1 A;  2PVG B;  1WI7 A;  5EG2 A;  4RMO A;  2OTL T;  2CP3 A;  3KFV A;  4DOW A;  1RAI B;  2HD0 A;  4LN2 A;  2F2W A;  1LCK A;  4A4G A;  3MEV A;  4RUG A;  2V8K A;  4J83 A;  3E9G A;  4M7A C;  3UPU A;  3G6E A;  1ACM B;  3Q1J A;  1BB9 A;  1KD1 C;  1EFN A;  5IH2 A;  2YRD A;  3BE3 A;  4O5V A;  2CT4 A;  1YHQ A;  1ZSG A;  3VS7 A;  4BI3 A;  2LC4 A;  1KQS S;  2YRC A;  2XDD A;  3CCL Q;  4ZNX A;  4MZP A;  2GTJ A;  1U8R A;  2RB6 A;  2VC8 A;  1MMA A;  2K6D A;  4M7D C;  1D1A A;  4M78 A;  3FRN A;  3QII A;  2HQX A;  3QPH A;  3I56 A;  1M1K R;  4KGX B;  2GBQ A;  4KUI A;  5I21 A;  2PVO B;  2R58 A;  2RQV A;  2O9V A;  6AT1 B;  1JB0 E;  2QEX T;  4IKF A;  1Q86 C;  2LRQ A;  4LE9 A;  2P4T A;  4Y91 A;  4C0G A;  2MF2 A;  5DLO A;  3V8L A;  1S72 A;  1UEB A;  3LH0 A;  4QQ6 A;  2XMF A;  2OI3 A;  3E19 A;  1Q82 C;  2L8D A;  1BIB A;  1U5S A;  4JZ3 A;  4M7A E;  2QDY B;  2K57 A;  5GAN e;  2C0T A;  1NPR A;  2MOX A;  3RIR A;  2K4Y A;  1ZLM A;  2DYI A;  3MO8 A;  1CKA A;  4C8Q C;  1YI2 Q;  2O4X A;  2DXU A;  3QO3 A;  3RES A;  4XTZ A;  3CC7 T;  1YIJ T;  1IO6 A;  3S3O A;  4RTY A;  4PJO E;  1JXM A;  3EFO A;  2DFU A;  1RAH B;  1OEB A;  2XI9 A;  1D0Z A;  4DEY A;  2KRS A;  1UFF A;  3CCS T;  5D7U A;  3OBW A;  1KD1 U;  4LNP A;  3G6E Q;  1W2B A;  3SHW A;  4NL2 A;  2RK2 A;  3V7S A;  4HCB A;  1YHQ Q;  2HEQ A;  4C92 A;  4ZGJ B;  5KYY B;  5J3B A;  3X20 B;  2FZC B;  5J26 A;  2CKK A;  3H9N A;  3WVE B;  2ZPE B;  2I0N A;  4M7A G;  4F04 B;  3L2R A;  3N5B B;  3DLL A;  4OMM A;  4HKE A;  2ENM A;  1QQJ A;  2VB6 A;  2L89 A;  1BI2 A;  2R5A A;  3ULR B;  2WAC A;  4BI4 A;  1UG1 A;  3G4S T;  2FHD A;  2IPO B;  1VQN T;  4J9B A;  1Y57 A;  4M7D G;  3RUX A;  1K9M C;  3HFN A;  1Q86 U;  4DBF A;  2MIO A;  2CS7 A;  2ZGW A;  2RD1 A;  5GMK j;  3OB9 A;  2DRM A;  2IG0 A;  1S72 Q;  1Q82 U;  3OA6 A;  3CBP A;  4EMK B;  4L59 A;  2E4H A;  1T3S A;  2A3L A;  2EGC A;  2EGE A;  2KK4 A;  2SRC A;  3PVQ A;  4F16 A;  3QBY A;  1H3H A;  3OYF A;  4BE0 A;  3M0Q A;  2CH4 A;  1K73 C;  3M57 A;  2LJ1 A;  3JAM E;  1W2B P;  2OTL A;  2NWM A;  2KVQ G;  3CEY A;  2XHC A;  4FYV B;  5KYU B;  3THK A;  3EFR A;  3EG3 A;  5LJ5 d;  2QK0 A;  4LDW A;  3CME T;  2DIQ A;  4M7A B;  1F1B B;  3G7Z A;  1VQL T;  4C8Q G;  1VQM T;  4C5I A;  2QGG A;  2LCS A;  2V26 A;  2BZY A;  3IQL A;  3OW2 A;  5LL6 S;  2L3R A;  4M75 C;  3M5A A;  1UUE A;  2KNB B;  1NLP C;  4PJO B;  3VS2 A;  5KCH A;  5KYW A;  2X3W D;  2LCL A;  2E5K A;  2EBP A;  4NS5 A;  5FRM A;  5GAO r;  2CZ6 B;  2P0K A;  4ELZ C;  5GAO n;  1IRX A;  2PU9 B;  1PSF A;  4XQ3 A;  2H3E B;  4JUV A;  4II1 A;  4JJC A;  4J7I A;  1G5V A;  3P8D A;  5FRN A;  3EG9 A;  1Y71 A;  2AZS A;  5GAN g;  1GBR A;  3CCQ T;  1K9M U;  3SWN A;  2DVJ A;  2QEX A;  1CKB A;  1TWB A;  1TU0 B;  3RMS A;  1VQ9 T;  1JO8 A;  3CCJ T;  1KD1 R;  4RTU A;  2CGH A;  2FZK B;  2PUO B;  1WJQ A;  1R77 A;  1UB4 A;  2HNI A;  3QDF A;  2K5I A;  3BFM A;  4PJL A;  2RHZ A;  1Q7Y C;  1H92 A;  4EMG A;  1K73 U;  4PJM A;  3OW2 P;  1YIJ A;  4J9H A;  5FU6 C;  1OZ3 A;  2K3X A;  3JB9 D;  2OTL Q;  1VA7 A;  3FDR A;  2B86 A;  4C0D B;  2NUZ A;  2L3P A;  4JJD A;  2KEA A;  1VQ4 T;  4N4H A;  2O2O A;  4J5Y A;  1LNX A;  4JLI A;  1C0M A;  1OOT A;  1KHI A;  3MJX A;  2VAS A;  3A5Z B;  2ZAE A;  3PTA A;  4OF1 A;  2M9U A;  2QI2 A;  3C95 A;  3L2V A;  3HFO A;  1X43 A;  1SSF A;  1X2K A;  3AHU A;  1E6G A;  4E6R A;  1VYU A;  4CC7 A;  1QWF A;  5FRO A;  3CPW A;  1VQ7 T;  3P8H A;  1Q82 R;  3I35 A;  4BDY A;  4M75 G;  4HCZ A;  2Y4Y A;  4J9D A;  4A4H A;  4MZM A;  3FB9 A;  1VQ6 T;  2PZ1 A;  5KH6 A;  3G4S A;  2EJF A;  3I5S A;  1M5Q 1;  4FYX B;  3KXT A; 
#chains in the Genus database with same CATH homology
 3CXC P;  3OW2 P;  3CC4 Q;  3I56 Q;  3G6E Q;  1VQL Q;  1VQ9 Q;  1VQM Q;  1K9M R;  1N8R R;  2OTL Q;  1VQP Q;  1VQ7 Q;  1YI2 Q;  1KQS P;  1YJW Q;  3G4S Q;  2QEX Q;  3CCJ Q;  1Q81 R;  1K73 R;  3CCL Q;  3CCU Q;  1Q82 R;  3CC2 Q;  1Q7Y R;  3CCE Q;  1YIJ Q;  1M90 R;  1YHQ Q;  2QA4 Q;  1KD1 R;  1VQ4 Q;  3CC7 Q;  1YIT Q;  1VQN Q;  1QVF P;  3CD6 Q;  1JJ2 P;  1NJI R;  1S72 Q;  1VQK Q;  3G71 Q;  3CCR Q;  3CCQ Q;  1VQ6 Q;  1QVG P;  3CMA Q;  1W2B P;  1VQ8 Q;  1KC8 R;  2OTJ Q;  1K8A R;  3CPW P;  1M1K R;  3CCM Q;  1VQ5 Q;  3CCV Q;  1YJN Q;  3I55 Q;  1Q86 R;  1YJ9 Q;  1VQO Q;  3CCS Q;  3CME Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...