1Q82R

Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights Into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1q82R00
1KC8R 1YIJQ 1S72Q 3CMAQ 3CCRQ 1QVFP 2QEXQ 1YJ9Q 1QVGP 1VQ8Q 1YJWQ 1M90R 1VQ9Q 1N8RR 3OW2P 1K8AR 1VQ7Q 1M1KR 1K9MR 3CCMQ 1YITQ 3CCSQ 3G71Q 3CXCP 3G4SQ 1YI2Q 1VQOQ 1VQ6Q 1Q86R 1YHQQ 1YJNQ 1W2BP 1VQMQ 1VQKQ 2OTJQ 1JJ2P 3G6EQ 1NJIR 3I56Q 2QA4Q 3I55Q 3CC7Q 1VQLQ 1Q7YR 1KD1R 3CCJQ 1VQ4Q 2OTLQ 3CPWP 1VQNQ 3CCUQ 3CCVQ 3CMEQ 3CCLQ 3CCEQ 1VQPQ 3CC4Q 3CD6Q 1KQSP 1VQ5Q 3CC2Q 1Q82R 1Q81R 3CCQQ 1K73R
chains in the Genus database with same CATH superfamily
2C0IA 1EFNA 1ABQA 2QYZA 1QKXA 3EGUA 3UDCA 3VV0A 1M2VA 3TU4K 1WHMA 3ER0A 1YJWT 3CC4A 5FRMA 1ACMB 1X6OA 2KQWA 5GAN7 2I2LA 4XU3A 1K73C 5CIUA 1VQ9A 2BE7D 1M90C 3P8HA 4J83A 1KG1A 3M0PA 3X24B 1VQ7Q 2QG9B 4AMCA 2K5LA 1B3QA 3VYGA 1W4SA 2DL8A 2HQXA 1CKAA 1NM7A 4C8QB 3J80E 2CP3A 1WJSA 5A2QE 3H8ZA 1D0XA 2AK5A 4Y91A 1ZQ1A 1QLYA 1U1SA 3EG0A 5GAN3 2L3QA 5HCKA 2E41A 3QBYA 1NEGA 3OB9A 2JTMA 1G3WA 3G4ST 4M75G 3OYKA 1AWWA 5D6YA 2DJQA 1G2BA 4KBMB 2DILA 4MZMA 3HSBA 2DL4A 4K11A 2QXFA 2V8IA 2K57A 5LJ3e 4JS5A 1VQKA 2CP6A 4ME7A 3JSCA 2DIGA 4FSXA 2X4WA 2LJ0A 4NL2A 4M7AE 2FZCB 3C94A 2QASA 3JCMc 4KGXB 4B9WA 3CCST 2K2MA 4C8QF 5GAMe 4KULA 5I2MA 5CQXA 3RR6A 1G3YA 5GAMg 4OB2B 3VS0A 4C92D 1ZUYA 2DNUA 3EGXA 3VUZA 1VQMA 2CGHA 3IQLA 2GFUA 1WQWA 5GMKh 2LX9A 2C0OA 4PK4A 2OTLA 2GQIA 2A3LA 3Q1JA 1MUZA 1C0MA 1RI0A 2L89A 2CKKA 1YNZA 4QQGA 4ZN1A 3TVTA 2RJDA 3OYGA 2DM1A 2FB7A 3OSVA 5HK3A 1YITA 3HTRA 3LYIA 3OY9A 3NHNA 1ZBXA 4OB3B 3EAEA 3M9QA 2E12A 1VQ5T 1WDXA 4CC4B 1M90R 1GBRA 2M51A 3I9QA 1RAFB 3V7SA 1XTDA 2VYTA 1I1JA 4HVUA 4MMLA 1U1TA 8AT1B 2CT4A 3QDFA 3I56T 1B07A 3GNGA 4XTVA 3UA7A 2A36A 2J7IA 3A8GB 2V26A 3OYYA 2DVEA 3CCRQ 2VB6A 1ZBJA 1VOMA 3CMEA 4FYWB 4C5GA 1VQ6Q 4M77D 4B6MA 4PJJA 1WXUA 4XU2A 3P8BB 3GOXA 1KC8C 2JTEA 5A0GA 3JCMb 2EKHA 2O31A 2NUPA 3CD6Q 3PTAA 2CSQA 5GJVB 2P4TA 1OI1A 4ELYC 4II1A 1I07A 1TXQA 3CCLA 2F2WA 3ULRB 1NJIU 1Z9ZA 2COYA 3JCMQ 4M7AB 1YJ9A 3QYGB 4BE1A 4BD3A 2O9VA 2DZCA 2QA4T 2FG0A 2CS7A 3V8LA 4FYXB 2XDDA 1ZA2B 3SWNA 5KE3A 2KI7A 2QDLA 4MZTA 3HP9A 3CCVA 4ZTJA 3PE0A 4N4GA 2YDLA 2VWFA 1NG2A 4E7ZA 1R0BG 3LGFA 4J9CA 5D6XA 1HXDA 2O01E 3E2UA 5ECAA 5IH2A 4LE9A 2JVVA 1UEBA 1PSFA 4FT2A 4KGVB 1M5Q1 1Y96B 4FW2A 3EG2A 5DY9A 2PNIA 3TSZA 1FXXA 2MWOA 2JTFA 5DLQE 4M7AF 1QW1A 2QQ9A 3L2VA 2QQSA 1ABOA 2DTIA 1T0JA 2EKOA 2LNHB 3GBQA 5GMKe 3CC2T 3F70A 4EMKC 5CKDA 2CUBA 4F7UA 3OYCA 4JUVA 2P0QA 3VS5A 2CZ0B 3BDUA 4PJOG 1X01A 3JCMJ 1GFCA 2KXCA 2KNBB 1R8OB 3CC7Q 2P0PA 1GBQA 1YJWA 1NE8A 2CP5A 4FSSA 3OYDA 4M78G 1E7OA 2K3XA 1QMCA 3JB9F 2EQIA 3QKJA 3FIFA 3EHQA 4BY6C 3JB9H 5GANg 1UJYA 2KRMA 3FLGA 3L2ZA 1VQ7T 1VQ9T 2OTJQ 3H0FA 4RTTA 3UATA 2R5AA 3M0UA 3CCEQ 3M0SA 2KRSA 4MZPA 1X6BA 1S72Q 3OSSC 1OQKA 4F16A 1D1CA 2AKKA 2EYXA 2EJGA 4N0AA 2ZPEB 3H0HA 1JB0E 3CBMA 4HVWA 2E64A 1QCFA 1WA7A 3VS3A 2V1RA 3A8HB 3G4SA 1N5ZA 3NMZC 3J81E 1XJWB 5CR2A 4IUUA 2EJ9A 4QVCA 4PFZA 2KYBA 4L59A 1SEMA 2X4XA 2DE0X 3TCJA 4IUVA 1K4US 3OW2A 2AIRB 5L8RE 2FRYA 4BDYA 3WXMB 3CCSA 1QVGP 1A0NB 2YHTA 2RI3A 2DL3A 3P8DA 2J05A 2YUOA 5KYYA 4KRTA 3ASKA 3RKXA 3FDRA 4MDXA 1SHFA 2DFUA 3TQ7P 3CCMQ 1JJ2S 4HCBA 4RCCA 2DXBA 5IXFA 2HNIA 3RIRA 3UT1A 2LT1A 4EMKB 4XTYA 1D3BB 2ROLA 2GTOA 2P84A 3CCQQ 1PKTA 3RBBB 1GCQC 2E10A 3JCMV 5FWCA 2ROTA 2QEXQ 1OPKA 5HKCA 2JOYA 3QWXX 2LQKA 2KSSA 2EJFA 1VQ5A 4Q5WA 2NUTA 2JUFA 2B8AA 3HKSA 2EGAA 3CPWS 4JRQA 3E19A 2MCNA 4ELZC 4HCCA 4DOVA 5KYUB 1OX9A 3LX7A 1KJWA 4X1VA 4BY6B 1AWOA 1SG5A 3ME9A 3QZ5B 2KVQG 2LCLA 1KK7A 3I35A 3I56A 3A98A 3M0QA 1RUWA 1HSQA 2KR3A 2DEQA 3CCRT 1LOJA 5GANd 1PD1A 1Q95G 2DRKA 2W10A 4NOYA 4M7DG 1MMDA 3RMSA 4J9IA 1VQ6T 2AZSA 3CQTA 3ZL7C 1W6XA 2LQNA 4DQ2A 2DEUA 1TS9A 2VKNA 2ZPFB 1ZHIA 1W1FA 3FB9A 3META 2QI2A 3CD6T 1VQ8Q 3M0TA 9ATCB 4WTOB 1XQHA 1QVGA 4LXCA 2SRCA 4D6WA 2QQAA 5I21A 5D7UA 4ZN3A 3LH0A 3RKYA 3KXTA 1BI0A 4KH0B 2E5QA 1R0CB 1YN8A 2KK4A 5CKBA 5KH6A 1VQPQ 1N6AA 1PM3A 1J3TA 1N8RC 2RMOA 2QAZA 2QDYB 3HRUA 2FYKA 2QA4A 1H3HA 5LJ5g 4C8QC 1KQ1A 2HBWA 3CXCS 4M75A 2EBPA 4RTYA 2KRNA 3ZEHA 2COWA 2RB6A 5CKEA 3VS6A 2JS0A 2E1HA 2IPOB 1UJ0A 3DB4A 1OU8A 4X34A 2EAYA 2VVKA 3CBOA 1CSKA 3PMIA 4HCZA 4OMQA 3JCMg 3CCVT 1OZ3A 4DEXA 1IHWA 4QVDA 5GAMf 5L23A 1MV3A 6AT1B 2DRMA 1M1KU 2OJ2A 1K9MU 2K79A 3VJPA 2DYIA 4J6WA 5KCHA 2VUBA 2K7AA 4JLGA 4AFUC 1YCSB 3ZBDA 2J6FA 2ZZDA 4FCYA 4AFQC 1Q81U 2O4XA 1NYGA 1QVFS 1LJOA 3J7AF 1YIJQ 2LMJA 3JB9J 1K1ZA 1VYTA 1WYXA 2DMOA 2HL5C 2EPDA 3CC2A 2D6FA 2L8DA 1K0SA 1KD1U 2F2XA 2V1QA 3TSWA 3CCJQ 2BZ8A 2RI5A 3QXEB 3REAB 4M7AG 1OZ2A 3CC7T 2RH2A 3S3NA 4JJDA 3HPWA 1GXIE 1YCYA 2NUPB 3PIPA 4PLIA 4PFOA 4IIMA 5KYXB 1TG0A 3FC3A 3RUXA 3KBGA 5GAOm 2JT4A 2Y4YA 2FPEA 2M0OA 1ZX6A 2IVWA 1TUCA 1VQLQ 1E6HA 2KBTA 2OTJT 1TWBA 1O9SA 1VQ7A 1B7TA 3GP8A 1I0CA 1N9RA 1WFWA 5J3BA 4PFPA 2JNGA 3CCET 4BI4A 5C0MA 3JB9G 2XIDA 3VYHB 1N8RR 3E9GA 4BACA 1S72T 3L2QA 1MHNA 3LW5E 2E4HA 4HT8A 2EYZA 1MMNA 2JW4A 1X2QA 2YUPA 2EWNA 2J6OA 1PWTA 2DLPA 2RI2A 1ARKA 4LDXA 2KYMA 3NTHA 5LJ5d 1ZA1B 4M4ZA 1X43A 1QKWA 1V1CA 3HRTA 2A0FB 2O88A 3M5AA 2XU8A 1WXTA 2K4YA 2FO0A 2JMAA 1T3LA 2RJCA 4EIKA 3CPWP 1M1GA 1I81A 1ZLMA 1WHKA 3JCMd 1UE9A 3EG3A 2BZXA 4M7AC 5FU6B 5LJ3g 1OPLA 4OVAA 4DA4A 1WX6A 1X6GA 1Q86U 2D0QB 1BBZA 1YJNQ 1GCPA 3CCMT 2MWPA 2MOXA 3EGDA 3NTIA 2E3HA 5CVIA 3JCMP 1PC0A 2X3WD 2YLCA 3QJYA 2P0KA 1Q82U 1K8AC 2DK3A 2DD5A 1ZSZA 3EFSA 2QEXT 3VS7A 3NTKA 4CRIA 4XU1A 3HHTB 4C92E 4HA8A 2DBKA 3EFRA 4BB7A 2YSQA 1JRIA 2F69A 2A37A 3RESA 2L0AA 1JXMA 2BKDN 3PNWC 1K73R 3OS2A 3CMAQ 1K76A 4PJOA 1RAEB 1UGVA 3EH2A 3CXCP 3HRSA 3PT9A 3AHUA 1SKUB 2L2PA 4F7UF 1W2BP 4RG2A 2ZPHB 4PLLA 3N5BB 4M78A 5GANf 3CCRA 3PIOA 1NLPC 1PD0A 3EG9A 3CBPA 4LDVA 4A54A 1VQ6A 2H3EB 4PNOA 1BCMA 5KYWA 2EGEA 2RHZA 1G8XA 1E6GA 4AG2C 1BIAA 1T0HA 2KE9A 2OAUA 4QW2A 1KSWA 2DO3A 4QKUA 1VQ8T 2FPDA 3CD6A 2IIMA 2GCXA 5KE2A 1K9AA 1M3CA 2CZ1B 4OMFB 4M75D 1D09B 3KUFA 3V8KA 3JCMW 1BI2A 2GQVA 4PJNA 3QPHA 4P5NA 1RLPC 2M9UA 4A4GA 2YUNA 4M77E 1QVFP 2DYBA 1HK9A 1D0ZA 3U23A 3VU3C 2CP0A 1BCOA 1GRIA 5KYYB 1X75C 2DXUA 1IGQA 2D1XA 2RPNA 4ZTFA 1Q7YC 1WJRA 4EPCA 2V8KA 3L1AA 2XI9A 4E7IA 1QQJA 1YI2T 3I5RA 2H8HA 1VYUA 1XNIA 1M27C 1IGUA 3M56A 2R57A 7AT1B 4CC3A 5LJ3d 2HQHA 4ANJA 2LVMA 2RQWA 2G6FX 4A4KA 2D8JA 1SRMA 3DKMA 1PKSA 4A63B 2ATCB 2AHJB 1UECA 3HFNA 4C92B 3LWHA 4LDWA 3SHWA 4EDUA 2MAMA 5GAMd 1W2BA 3L42A 1KHIA 1VUBA 2LZ6B 3EFOB 4BE2A 3O5ZA 2YUQA 2GGRA 4EMGA 2XMFA 1BKBA 3RNJA 3TREA 3H9NA 3NGPA 1YIJT 2HQEA 3OS1A 3RMQA 1SF9A 3FJPA 2ZAEA 4ATOA 2VGMA 1DJ7B 2PQWA 2QGFB 4WF2A 2KXDA 1KQSS 1V76A 4OB1B 3JV3A 3CCJT 4OGCA 4JRKA 2WSEE 2FHDA 3CC7A 3BDLA 1WIEA 2L3SA 3X26B 1UGQB 4E7HA 4OMNA 2XDPA 1FYNA 3GLXA 5J39A 4C92F 4HKEA 4KH1B 1VQLT 4J9BA 1JQQA 2XDBA 3QWYA 2RN8A 1KC8R 2OTJA 4RTVA 4M7DA 1QP3A 4QT7A 4M77B 2K5IA 3CCEA 3M58A 5CAIA 1RAAB 2ZPIB 2JS2A 1UB4A 4ZGEB 3G6EQ 1S72A 2MF2A 1S1NA 4R55A 1QP2A 1MGQA 1K73U 2ED0A 4XK8E 2J06A 1PHTA 3BY7A 4E2FB 4LD9K 2E6NA 3A5ZB 2PVOB 3VRZA 5KCOA 1M90U 3CEYA 2CZ7B 3UF4A 4Y28E 2B86A 5LJ5f 2GF7A 1VQOQ 4LNPA 3UWNA 2JMCA 2QK0A 3R6NA 4D8DA 4WCIA 2HSEB 4PJLA 1GFDA 3I5SA 1H92A 4PJMA 1IRXA 3JCMf 2CREA 1TUDA 4C0ZA 4OF1A 3C12A 4M77F 2MMPA 5GAOl 5CO7A 3X25B 4M75F 5CCAA 3M57A 2C06A 4AFZC 1N9SA 4ESRA 2YRCA 1YJNT 3CCUQ 1NLOC 4RUGA 2VXFA 1IHVA 3CCMA 3QDRB 4RTZA 3V7RA 4C0DC 3FJ5A 2OI3A 4A53A 2DL7A 2BZYA 2DIQA 4RKUE 4GLKA 1VIEA 1MV0B 5AYFA 5GANj 1KIKA 1TH7A 4PJOD 3CCQA 2J6KA 1M2VB 1UGRB 2X35A 4E47A 3I55Q 4J6XA 4RTWA 2QEXA 4RTUA 1X69A 2PVGB 4C8QG 2EYQA 2NLUA 4M78D 1X27A 1M4ZA 2FPFA 1TTHB 1WXBA 4C5EA 3CMAT 3E1SA 1JBMA 2DTOA 4M7AA 2LJ1A 1SPKA 4JJNK 5LL6S 2AZVA 4J9FA 1HYOA 1B34A 2F5KA 5IHKA 1BI3A 4BI8B 1SHGA 4GLMA 1JXOA 5AT1B 4C5IA 4BE0A 4QQDA 1M3AA 3VS4A 4FYVB 2O2OA 4DBRA 2RD1A 4QVZA 1YWPA 1OV3A 2DJZA 2GBQA 3E9FA 4XAXB 2XHCA 3H0IA 3MP6A 4RCBA 1VQ8A 1Y0MA 2WSCE 5GMKm 1QCOA 1M3BA 1Y96A 1UGPB 2KAFA 2KROA 5IHNA 4OMLA 4DBQA 4KUIA 5J26A 3G71Q 3A1PA 2KT8A 1KHCA 1QWEA 3FRNA 4Z89A 1AWJA 2G3RA 4J8OA 4OP0A 2A28A 2CZ6B 1G3TA 1KQSP 1WQ7A 4N4IA 1YI2A 1WI7A 4O5VA 2I0NA 3OYMA 2PUKB 2DAQA 5I11A 3EGXB 3OBWA 3C4SA 4QQ6A 2DKGA 1NJIC 5D6WA 5LJ3f 2EQMA 4HT9A 2MK5A 4C0DB 4DOWA 2FZGB 2CP2A 2RA2A 2RK1A 2DVJA 4KT0E 3TEEA 2CH4W 4R56A 4AT1B 1D1BA 3MP1A 4CC2A 2X4JA 2O9SA 2CH4A 4PKCC 2P4RA 2M02A 4KUDK 4A4HA 1YHQQ 2QQBA 1M2OA 1SSHA 3OQ5A 5GAMh 1YIJA 4FW1A 5FU6C 4IUQA 3UPUA 3M54A 2LP5A 3SD4A 5KYWB 1NZ9A 2E6ZA 3CCJA 2E70A 2QTXA 1UGSB 3OMCA 3M0RA 4F7UE 3M59A 2RJEA 3S6WA 4CC7A 4E7JA 2AKLA 1YP5A 4M7DD 3MEAA 2MI6A 3QG1A 2QTVA 2DTHA 1FMKA 1WHHA 1LCKA 3RERA 1MNEA 4D8KA 4UC4A 2VXEA 4OMPA 5FW9A 4E7KA 4M7DE 1MMAA 2D9TA 4DEYA 2YXYA 1AHJB 3THKA 2CP7A 5LJ5j 1VQLA 4PJOF 2DXCA 1KQSA 4E7LA 3QIIA 2K3YA 1YWOA 4X9CA 2BIVA 4EMHA 3VKIA 2LQWA 1VQ4Q 2RF0A 4KGZB 1VQNQ 4VUBA 1X2KA 1UHFA 4M78F 1RADB 1U06A 2VC8A 3BE3A 4IUTA 3G6ET 4C92G 3MEVA 4N0AC 3PMTA 2LT4A 3VS1A 1GL5A 1BIBA 3SWNB 2K2VA 2Y4XA 3S3MA 3OYLA 1HJDA 2M1HA 3VRYA 1SRLA 1JJ2P 1NBEB 1NJIR 3G7ZA 4EMKA 4C0FA 4XU0A 3X20B 1VQOT 2DX1A 1D3BA 2R5MA 1BB9A 3CC4Q 1MNDA 3V8JA 1ZUUA 2X3XD 3BFMA 4J9EA 3OYAA 4R0KA 3DLMA 1VQ9Q 5A0DA 3EH1A 4TVRA 2A08A 4F17A 2ENMA 5KYUA 1AEYA 4OB0B 4J7FA 1P92A 1M30A 4JJBA 4RTXA 2HMAA 3RKWA 1N27A 2GTJA 3SEMA 5EG2A 4AFSC 3C0CA 3CCUT 1YJNA 4FL6A 1AVZC 3OW2S 1BI1A 3GIBA 2D8HA 5GAOn 2JZ2A 4LUDA 5FRNA 3R6OA 2RNAA 4M77G 4F7UB 2NUZA 1WHLA 1YFNA 2GNCA 2LCSA 1K0XA 4IKFA 4V2SA 3PVLA 4FIBA 2RHYA 2KT1A 4M7AD 2FL7A 4HXJA 3REBB 3I55T 5IN1A 5C6SA 1MMGA 2HKNA 2PU9B 3G1JA 3NFCA 1RABB 5M9OA 3CCQT 4C92C 4M7DB 5DM7R 3M4YA 2NYSA 2HKQB 3EG1A 5GAN2 4PL6A 1M8MA 1VQKQ 3CMAA 4J7IA 1CKBA 2EQUA 3RDVA 2RM4A 4J9GA 1U8RA 4ORZA 1JJ2A 1F1BB 1PRLC 3JB9D 5GJWB 1IO6A 1LVKA 1TOVA 2PVDB 1JU5C 3MEUA 4JS4A 1BYMA 1G5VA 1VQMQ 1AWXA 1AZGB 3QO3A 2OTLQ 1G83A 2FEIA 2HSPA 2F2VA 5FROA 2XG8D 4XQ3A 2KMTA 1PSEA 4OMMA 5FU7C 2RHIA 5GANh 5LJ3j 3CPWA 1UFFA 2H3JA 4M7DF 4GY5A 1YITQ 2KEAA 1NPPA 4OMOA 1NEBA 4IIOA 4Z8AA 1GCQA 2ZPBB 2PUOB 3UA6A 4JPBW 2F1LA 4JRIA 2L5QA 3MJXA 3G71T 3HL8A 3VS2A 1QVGS 2F5TX 4M77C 2C0TA 4Z02A 5GAN6 5GAMj 2DETA 4M75C 1ZSGA 5IT9E 3OYJA 3OMGA 1VQPT 2ZCFB 1AD5A 2RO0A 3PGGA 1R77A 3QJ6A 4M75E 2RHUA 4E6RA 1TU0B 1UG1A 2VASA 1T3SA 2ZPGB 1OU9A 3OYEA 1TSFA 3OYBA 8ATCB 3GF5A 2JM9A 2Y90A 3CMEQ 1RL2A 3M4GA 4L5GA 1U5SA 3C95A 5KYXA 2MIOA 2LTOA 4X9DA 4JDSA 1SSFA 5DLOA 3URGA 1C1AA 2K9GA 1N8RU 1D0YA 1K8AR 4LUEA 1WHGA 2Z0WA 2RHXA 1NYFA 2EYWA 3MP8A 1PRMC 3OYFA 2YRDA 2NUTB 2HD0A 1YHQT 4IUPA 5GMKl 3CCLQ 1W70A 1TUGB 1B34B 3CXCA 4F04B 1WLPB 4ZGJB 1M1KC 4YTLA 1K9MC 2K5FA 1FX7A 1YJ9Q 5HY6A 5KYNA 2EIFA 2K6DA 2XD0A 4Z88A 3SDZA 3QZ9B 3KFVA 4RMOA 4FT4A 2HDAA 3MEWA 3VUBA 4C8QA 1QCNA 2EW3A 2X9HA 2BE9B 2EFIA 2L3RA 3CCVQ 1Q81C 1XOVA 4LN2A 3M55A 1D1AA 2WSFE 4A4FA 1M8VA 1VIFA 2RQTA 4O6JA 3OYHA 4XTXA 4MMKA 1H641 5I2SA 2QQRA 4ZGDB 2XICA 1KD1C 2JN0A 3JB9I 1QVFA 5FU7B 3QHSA 3L2UA 1JO8A 5CKHA 2JM8A 2LNVA 3DB3A 1VQ4T 2LC4A 1NPRA 1VQNT 1I5OB 5FLXE 2W0ZA 1Y57A 1M9SA 5HK0A 2KDSA 3LLRA 4C0GA 3LWIA 3G6EA 1WJQA 4J5YA 2RQUA 5CKFA 3OW2P 2YT6A 3AT1B 3T9NA 2FRWA 5GAOq 3ZFJA 3GPLA 1RAGB 4M75B 1WHJA 1Q7YR 2CT3A 1M1FA 2PTKA 3QYHB 4OGEA 1VQOA 5CK9A 2ED1A 3LGLA 3CC4T 1IREB 3OS5A 4HVVA 1YJWQ 5GANe 1EZZB 1IZ6A 3O8VA 3H41A 3PFSA 3QUIA 2DA9A 4CI0C 1PNJA 3FEOA 2RQRA 3A8LB 1RI9A 2YLBA 5I22A 2LDMA 4FM4B 5LJ5h 1RAHB 3JCMX 2LCCA 2O4XB 2K3BA 2DF6A 3MO8A 3CCUA 1QWFA 1M1KR 1K9MR 5GMKj 2A7YA 1U3OA 3CPFA 2X4YA 1OYXA 2GFAA 1UUEA 2MYSA 4JJCA 1I8FA 4RG8A 1I4K1 2NWMA 3MHXA 1YBYA 1FMWA 3JCMh 5CQYA 1ZSZC 2CSIA 2LJ3A 1RLQC 3EHRA 4J6YA 1Q81R 1KQ2A 4LD6A 2D0NA 3I55A 3H6ZA 3MCAB 4B9XA 1Q86C 4GBQA 2L3PA 1G3SA 4XTUA 1Z9QA 2HCKA 2CDTA 3G4SQ 3DLLA 4E7SA 2VGNA 1WPYA 4N4HA 2COZA 1BU1A 3X28B 1KD1R 2ESWA 2RQVA 1Q82C 2KY9A 2V8JA 1VQKT 4PJOC 3LH5A 2EQJA 2DBMA 2E3IA 2ZGWA 3OA6A 4JLIA 5EC7A 4PJOE 1K8AU 2QGGA 1RAIB 2OAWA 3NPFA 4M78C 3OS0A 3CCSQ 1WZOA 1RACB 2DL5A 2ABLA 2MPXC 2KGTA 4M78E 4DBHA 4Y92A 4AG1C 2CUDA 1VQMT 2HZYA 4J9HA 1OX8A 3QSUA 2RJFA 2OTLT 5GMKi 4LDYA 2BUDA 1AOJA 3INZA 1LPLA 3A8OB 1VA7A 1H3ZA 3MKDA 4BDZA 1Y07A 2OX7A 2DERA 2DZ9A 2M16A 4C92A 1YITT 1Y7XA 2EVRA 4JZ3A 4XTWA 4F7UG 2SEMA 4ZNXA 1EX4A 2RK2A 3EFOA 2R58A 5IAYA 3G71A 1VQ5Q 4FU6A 4MDWA 4NS5A 4HCKA 1FWZA 1AZEA 4C5HA 2E65A 1BK2A 1Y71A 2AT1B 3OYIA 2DD4A 2VV5A 4FYYB 1VQPA 1WGSA 2PZ1A 3WVEB 1EIFA 3I56Q 1PCXA 1UDLA 2E5KA 1IB8A 2DXTA 2YWWA 1LNXA 3SWNC 2FVUA 2WACA 3EGDB 1IXDA 3CMET 5GAOr 5GAOp 1KC8U 1HD3A 2HEQA 4BI3A 1I5LA 4IURA 1FMVA 3L2WA 1ZSZB 1Q86R 2JXBA 2ECZA 2HL3A 5FWBA 4NL3A 1Q7YU 2EGCA 2BTTA 3JRZA 4C8QD 5LJ3h 1Q82R 4F14A 5LJ5e 3S3OA 1YHQA 3D7SB 3CCLT 1VYVA 3OYNA 4M77A 1JEGA 5GAN5 3SFMA 4L6V5 3OBYA 3SB2A 1W2BS 4PJOB 1YJ9T 1KFZA 1YI2Q 1AT1B 4C8QE 1O75A 5IHIA 2JJ9A 2QA4Q 2HAXA 1OULA 3A8MB 1C6VX 3JCMe 4M78B 2HBPA 1V29B 3PVQA 2FZKB 2LRQA 1OOTA 3EG9B 3MPUB 5GAN8 2EYYA 2LX7A 1ZUKA 4LDUA 1UHCA 4A4EA 3V7CA 5GAN4 1PG5B 3GNFB 2M0YA 4J9DA 4M7DC 3L2RA 4XTZA 2LQ8A 4BUGA 2YRVA 5IXBA 2XKOC 1UTIA 4JRPA 1VQ4A 1VQNA 3HFOA 3JAME 2IG0A 2X51A 2EQKA 4JZ4A 1OEBA 3BW1A 2XK0A 5A0LA 2DPPB 1WNLA 3M53A 3WVDB 2CYZB 4DBFA 1H8KA 3CC2Q 1QVPA
chains in the Genus database with same CATH topology
1KC8R 1YIJQ 1S72Q 3CMAQ 3CCRQ 1QVFP 2QEXQ 1YJ9Q 1QVGP 1VQ8Q 1YJWQ 1M90R 1VQ9Q 1N8RR 3OW2P 1K8AR 1VQ7Q 1M1KR 1K9MR 3CCMQ 1YITQ 3CCSQ 3G71Q 3CXCP 3G4SQ 1YI2Q 1VQOQ 1VQ6Q 1Q86R 1YHQQ 1YJNQ 1W2BP 1VQMQ 1VQKQ 2OTJQ 1JJ2P 3G6EQ 1NJIR 3I56Q 2QA4Q 3I55Q 3CC7Q 1VQLQ 1Q7YR 1KD1R 3CCJQ 1VQ4Q 2OTLQ 3CPWP 1VQNQ 3CCUQ 3CCVQ 3CMEQ 3CCLQ 3CCEQ 1VQPQ 3CC4Q 3CD6Q 1KQSP 1VQ5Q 3CC2Q 1Q82R 1Q81R 3CCQQ 1K73R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 R;  1YIJ Q;  1S72 Q;  3CMA Q;  3CCR Q;  1QVF P;  2QEX Q;  1YJ9 Q;  1QVG P;  1VQ8 Q;  1YJW Q;  1M90 R;  1VQ9 Q;  1N8R R;  3OW2 P;  1K8A R;  1VQ7 Q;  1M1K R;  1K9M R;  3CCM Q;  1YIT Q;  3CCS Q;  3G71 Q;  3CXC P;  3G4S Q;  1YI2 Q;  1VQO Q;  1VQ6 Q;  1Q86 R;  1YHQ Q;  1YJN Q;  1W2B P;  1VQM Q;  1VQK Q;  2OTJ Q;  1JJ2 P;  3G6E Q;  1NJI R;  3I56 Q;  2QA4 Q;  3I55 Q;  3CC7 Q;  1VQL Q;  1Q7Y R;  1KD1 R;  3CCJ Q;  1VQ4 Q;  2OTL Q;  3CPW P;  1VQN Q;  3CCU Q;  3CCV Q;  3CME Q;  3CCL Q;  3CCE Q;  1VQP Q;  3CC4 Q;  3CD6 Q;  1KQS P;  1VQ5 Q;  3CC2 Q;  1Q82 R;  1Q81 R;  3CCQ Q;  1K73 R; 
#chains in the Genus database with same CATH topology
 2C0I A;  1EFN A;  1ABQ A;  2QYZ A;  1QKX A;  3EGU A;  3UDC A;  3VV0 A;  1M2V A;  3TU4 K;  1WHM A;  3ER0 A;  1YJW T;  3CC4 A;  5FRM A;  1ACM B;  1X6O A;  2KQW A;  5GAN 7;  2I2L A;  4XU3 A;  1K73 C;  5CIU A;  1VQ9 A;  2BE7 D;  1M90 C;  3P8H A;  4J83 A;  1KG1 A;  3M0P A;  3X24 B;  1VQ7 Q;  2QG9 B;  4AMC A;  2K5L A;  1B3Q A;  3VYG A;  1W4S A;  2DL8 A;  2HQX A;  1CKA A;  1NM7 A;  4C8Q B;  3J80 E;  2CP3 A;  1WJS A;  5A2Q E;  3H8Z A;  1D0X A;  2AK5 A;  4Y91 A;  1ZQ1 A;  1QLY A;  1U1S A;  3EG0 A;  5GAN 3;  2L3Q A;  5HCK A;  2E41 A;  3QBY A;  1NEG A;  3OB9 A;  2JTM A;  1G3W A;  3G4S T;  4M75 G;  3OYK A;  1AWW A;  5D6Y A;  2DJQ A;  1G2B A;  4KBM B;  2DIL A;  4MZM A;  3HSB A;  2DL4 A;  4K11 A;  2QXF A;  2V8I A;  2K57 A;  5LJ3 e;  4JS5 A;  1VQK A;  2CP6 A;  4ME7 A;  3JSC A;  2DIG A;  4FSX A;  2X4W A;  2LJ0 A;  4NL2 A;  4M7A E;  2FZC B;  3C94 A;  2QAS A;  3JCM c;  4KGX B;  4B9W A;  3CCS T;  2K2M A;  4C8Q F;  5GAM e;  4KUL A;  5I2M A;  5CQX A;  3RR6 A;  1G3Y A;  5GAM g;  4OB2 B;  3VS0 A;  4C92 D;  1ZUY A;  2DNU A;  3EGX A;  3VUZ A;  1VQM A;  2CGH A;  3IQL A;  2GFU A;  1WQW A;  5GMK h;  2LX9 A;  2C0O A;  4PK4 A;  2OTL A;  2GQI A;  2A3L A;  3Q1J A;  1MUZ A;  1C0M A;  1RI0 A;  2L89 A;  2CKK A;  1YNZ A;  4QQG A;  4ZN1 A;  3TVT A;  2RJD A;  3OYG A;  2DM1 A;  2FB7 A;  3OSV A;  5HK3 A;  1YIT A;  3HTR A;  3LYI A;  3OY9 A;  3NHN A;  1ZBX A;  4OB3 B;  3EAE A;  3M9Q A;  2E12 A;  1VQ5 T;  1WDX A;  4CC4 B;  1M90 R;  1GBR A;  2M51 A;  3I9Q A;  1RAF B;  3V7S A;  1XTD A;  2VYT A;  1I1J A;  4HVU A;  4MML A;  1U1T A;  8AT1 B;  2CT4 A;  3QDF A;  3I56 T;  1B07 A;  3GNG A;  4XTV A;  3UA7 A;  2A36 A;  2J7I A;  3A8G B;  2V26 A;  3OYY A;  2DVE A;  3CCR Q;  2VB6 A;  1ZBJ A;  1VOM A;  3CME A;  4FYW B;  4C5G A;  1VQ6 Q;  4M77 D;  4B6M A;  4PJJ A;  1WXU A;  4XU2 A;  3P8B B;  3GOX A;  1KC8 C;  2JTE A;  5A0G A;  3JCM b;  2EKH A;  2O31 A;  2NUP A;  3CD6 Q;  3PTA A;  2CSQ A;  5GJV B;  2P4T A;  1OI1 A;  4ELY C;  4II1 A;  1I07 A;  1TXQ A;  3CCL A;  2F2W A;  3ULR B;  1NJI U;  1Z9Z A;  2COY A;  3JCM Q;  4M7A B;  1YJ9 A;  3QYG B;  4BE1 A;  4BD3 A;  2O9V A;  2DZC A;  2QA4 T;  2FG0 A;  2CS7 A;  3V8L A;  4FYX B;  2XDD A;  1ZA2 B;  3SWN A;  5KE3 A;  2KI7 A;  2QDL A;  4MZT A;  3HP9 A;  3CCV A;  4ZTJ A;  3PE0 A;  4N4G A;  2YDL A;  2VWF A;  1NG2 A;  4E7Z A;  1R0B G;  3LGF A;  4J9C A;  5D6X A;  1HXD A;  2O01 E;  3E2U A;  5ECA A;  5IH2 A;  4LE9 A;  2JVV A;  1UEB A;  1PSF A;  4FT2 A;  4KGV B;  1M5Q 1;  1Y96 B;  4FW2 A;  3EG2 A;  5DY9 A;  2PNI A;  3TSZ A;  1FXX A;  2MWO A;  2JTF A;  5DLQ E;  4M7A F;  1QW1 A;  2QQ9 A;  3L2V A;  2QQS A;  1ABO A;  2DTI A;  1T0J A;  2EKO A;  2LNH B;  3GBQ A;  5GMK e;  3CC2 T;  3F70 A;  4EMK C;  5CKD A;  2CUB A;  4F7U A;  3OYC A;  4JUV A;  2P0Q A;  3VS5 A;  2CZ0 B;  3BDU A;  4PJO G;  1X01 A;  3JCM J;  1GFC A;  2KXC A;  2KNB B;  1R8O B;  3CC7 Q;  2P0P A;  1GBQ A;  1YJW A;  1NE8 A;  2CP5 A;  4FSS A;  3OYD A;  4M78 G;  1E7O A;  2K3X A;  1QMC A;  3JB9 F;  2EQI A;  3QKJ A;  3FIF A;  3EHQ A;  4BY6 C;  3JB9 H;  5GAN g;  1UJY A;  2KRM A;  3FLG A;  3L2Z A;  1VQ7 T;  1VQ9 T;  2OTJ Q;  3H0F A;  4RTT A;  3UAT A;  2R5A A;  3M0U A;  3CCE Q;  3M0S A;  2KRS A;  4MZP A;  1X6B A;  1S72 Q;  3OSS C;  1OQK A;  4F16 A;  1D1C A;  2AKK A;  2EYX A;  2EJG A;  4N0A A;  2ZPE B;  3H0H A;  1JB0 E;  3CBM A;  4HVW A;  2E64 A;  1QCF A;  1WA7 A;  3VS3 A;  2V1R A;  3A8H B;  3G4S A;  1N5Z A;  3NMZ C;  3J81 E;  1XJW B;  5CR2 A;  4IUU A;  2EJ9 A;  4QVC A;  4PFZ A;  2KYB A;  4L59 A;  1SEM A;  2X4X A;  2DE0 X;  3TCJ A;  4IUV A;  1K4U S;  3OW2 A;  2AIR B;  5L8R E;  2FRY A;  4BDY A;  3WXM B;  3CCS A;  1QVG P;  1A0N B;  2YHT A;  2RI3 A;  2DL3 A;  3P8D A;  2J05 A;  2YUO A;  5KYY A;  4KRT A;  3ASK A;  3RKX A;  3FDR A;  4MDX A;  1SHF A;  2DFU A;  3TQ7 P;  3CCM Q;  1JJ2 S;  4HCB A;  4RCC A;  2DXB A;  5IXF A;  2HNI A;  3RIR A;  3UT1 A;  2LT1 A;  4EMK B;  4XTY A;  1D3B B;  2ROL A;  2GTO A;  2P84 A;  3CCQ Q;  1PKT A;  3RBB B;  1GCQ C;  2E10 A;  3JCM V;  5FWC A;  2ROT A;  2QEX Q;  1OPK A;  5HKC A;  2JOY A;  3QWX X;  2LQK A;  2KSS A;  2EJF A;  1VQ5 A;  4Q5W A;  2NUT A;  2JUF A;  2B8A A;  3HKS A;  2EGA A;  3CPW S;  4JRQ A;  3E19 A;  2MCN A;  4ELZ C;  4HCC A;  4DOV A;  5KYU B;  1OX9 A;  3LX7 A;  1KJW A;  4X1V A;  4BY6 B;  1AWO A;  1SG5 A;  3ME9 A;  3QZ5 B;  2KVQ G;  2LCL A;  1KK7 A;  3I35 A;  3I56 A;  3A98 A;  3M0Q A;  1RUW A;  1HSQ A;  2KR3 A;  2DEQ A;  3CCR T;  1LOJ A;  5GAN d;  1PD1 A;  1Q95 G;  2DRK A;  2W10 A;  4NOY A;  4M7D G;  1MMD A;  3RMS A;  4J9I A;  1VQ6 T;  2AZS A;  3CQT A;  3ZL7 C;  1W6X A;  2LQN A;  4DQ2 A;  2DEU A;  1TS9 A;  2VKN A;  2ZPF B;  1ZHI A;  1W1F A;  3FB9 A;  3MET A;  2QI2 A;  3CD6 T;  1VQ8 Q;  3M0T A;  9ATC B;  4WTO B;  1XQH A;  1QVG A;  4LXC A;  2SRC A;  4D6W A;  2QQA A;  5I21 A;  5D7U A;  4ZN3 A;  3LH0 A;  3RKY A;  3KXT A;  1BI0 A;  4KH0 B;  2E5Q A;  1R0C B;  1YN8 A;  2KK4 A;  5CKB A;  5KH6 A;  1VQP Q;  1N6A A;  1PM3 A;  1J3T A;  1N8R C;  2RMO A;  2QAZ A;  2QDY B;  3HRU A;  2FYK A;  2QA4 A;  1H3H A;  5LJ5 g;  4C8Q C;  1KQ1 A;  2HBW A;  3CXC S;  4M75 A;  2EBP A;  4RTY A;  2KRN A;  3ZEH A;  2COW A;  2RB6 A;  5CKE A;  3VS6 A;  2JS0 A;  2E1H A;  2IPO B;  1UJ0 A;  3DB4 A;  1OU8 A;  4X34 A;  2EAY A;  2VVK A;  3CBO A;  1CSK A;  3PMI A;  4HCZ A;  4OMQ A;  3JCM g;  3CCV T;  1OZ3 A;  4DEX A;  1IHW A;  4QVD A;  5GAM f;  5L23 A;  1MV3 A;  6AT1 B;  2DRM A;  1M1K U;  2OJ2 A;  1K9M U;  2K79 A;  3VJP A;  2DYI A;  4J6W A;  5KCH A;  2VUB A;  2K7A A;  4JLG A;  4AFU C;  1YCS B;  3ZBD A;  2J6F A;  2ZZD A;  4FCY A;  4AFQ C;  1Q81 U;  2O4X A;  1NYG A;  1QVF S;  1LJO A;  3J7A F;  1YIJ Q;  2LMJ A;  3JB9 J;  1K1Z A;  1VYT A;  1WYX A;  2DMO A;  2HL5 C;  2EPD A;  3CC2 A;  2D6F A;  2L8D A;  1K0S A;  1KD1 U;  2F2X A;  2V1Q A;  3TSW A;  3CCJ Q;  2BZ8 A;  2RI5 A;  3QXE B;  3REA B;  4M7A G;  1OZ2 A;  3CC7 T;  2RH2 A;  3S3N A;  4JJD A;  3HPW A;  1GXI E;  1YCY A;  2NUP B;  3PIP A;  4PLI A;  4PFO A;  4IIM A;  5KYX B;  1TG0 A;  3FC3 A;  3RUX A;  3KBG A;  5GAO m;  2JT4 A;  2Y4Y A;  2FPE A;  2M0O A;  1ZX6 A;  2IVW A;  1TUC A;  1VQL Q;  1E6H A;  2KBT A;  2OTJ T;  1TWB A;  1O9S A;  1VQ7 A;  1B7T A;  3GP8 A;  1I0C A;  1N9R A;  1WFW A;  5J3B A;  4PFP A;  2JNG A;  3CCE T;  4BI4 A;  5C0M A;  3JB9 G;  2XID A;  3VYH B;  1N8R R;  3E9G A;  4BAC A;  1S72 T;  3L2Q A;  1MHN A;  3LW5 E;  2E4H A;  4HT8 A;  2EYZ A;  1MMN A;  2JW4 A;  1X2Q A;  2YUP A;  2EWN A;  2J6O A;  1PWT A;  2DLP A;  2RI2 A;  1ARK A;  4LDX A;  2KYM A;  3NTH A;  5LJ5 d;  1ZA1 B;  4M4Z A;  1X43 A;  1QKW A;  1V1C A;  3HRT A;  2A0F B;  2O88 A;  3M5A A;  2XU8 A;  1WXT A;  2K4Y A;  2FO0 A;  2JMA A;  1T3L A;  2RJC A;  4EIK A;  3CPW P;  1M1G A;  1I81 A;  1ZLM A;  1WHK A;  3JCM d;  1UE9 A;  3EG3 A;  2BZX A;  4M7A C;  5FU6 B;  5LJ3 g;  1OPL A;  4OVA A;  4DA4 A;  1WX6 A;  1X6G A;  1Q86 U;  2D0Q B;  1BBZ A;  1YJN Q;  1GCP A;  3CCM T;  2MWP A;  2MOX A;  3EGD A;  3NTI A;  2E3H A;  5CVI A;  3JCM P;  1PC0 A;  2X3W D;  2YLC A;  3QJY A;  2P0K A;  1Q82 U;  1K8A C;  2DK3 A;  2DD5 A;  1ZSZ A;  3EFS A;  2QEX T;  3VS7 A;  3NTK A;  4CRI A;  4XU1 A;  3HHT B;  4C92 E;  4HA8 A;  2DBK A;  3EFR A;  4BB7 A;  2YSQ A;  1JRI A;  2F69 A;  2A37 A;  3RES A;  2L0A A;  1JXM A;  2BKD N;  3PNW C;  1K73 R;  3OS2 A;  3CMA Q;  1K76 A;  4PJO A;  1RAE B;  1UGV A;  3EH2 A;  3CXC P;  3HRS A;  3PT9 A;  3AHU A;  1SKU B;  2L2P A;  4F7U F;  1W2B P;  4RG2 A;  2ZPH B;  4PLL A;  3N5B B;  4M78 A;  5GAN f;  3CCR A;  3PIO A;  1NLP C;  1PD0 A;  3EG9 A;  3CBP A;  4LDV A;  4A54 A;  1VQ6 A;  2H3E B;  4PNO A;  1BCM A;  5KYW A;  2EGE A;  2RHZ A;  1G8X A;  1E6G A;  4AG2 C;  1BIA A;  1T0H A;  2KE9 A;  2OAU A;  4QW2 A;  1KSW A;  2DO3 A;  4QKU A;  1VQ8 T;  2FPD A;  3CD6 A;  2IIM A;  2GCX A;  5KE2 A;  1K9A A;  1M3C A;  2CZ1 B;  4OMF B;  4M75 D;  1D09 B;  3KUF A;  3V8K A;  3JCM W;  1BI2 A;  2GQV A;  4PJN A;  3QPH A;  4P5N A;  1RLP C;  2M9U A;  4A4G A;  2YUN A;  4M77 E;  1QVF P;  2DYB A;  1HK9 A;  1D0Z A;  3U23 A;  3VU3 C;  2CP0 A;  1BCO A;  1GRI A;  5KYY B;  1X75 C;  2DXU A;  1IGQ A;  2D1X A;  2RPN A;  4ZTF A;  1Q7Y C;  1WJR A;  4EPC A;  2V8K A;  3L1A A;  2XI9 A;  4E7I A;  1QQJ A;  1YI2 T;  3I5R A;  2H8H A;  1VYU A;  1XNI A;  1M27 C;  1IGU A;  3M56 A;  2R57 A;  7AT1 B;  4CC3 A;  5LJ3 d;  2HQH A;  4ANJ A;  2LVM A;  2RQW A;  2G6F X;  4A4K A;  2D8J A;  1SRM A;  3DKM A;  1PKS A;  4A63 B;  2ATC B;  2AHJ B;  1UEC A;  3HFN A;  4C92 B;  3LWH A;  4LDW A;  3SHW A;  4EDU A;  2MAM A;  5GAM d;  1W2B A;  3L42 A;  1KHI A;  1VUB A;  2LZ6 B;  3EFO B;  4BE2 A;  3O5Z A;  2YUQ A;  2GGR A;  4EMG A;  2XMF A;  1BKB A;  3RNJ A;  3TRE A;  3H9N A;  3NGP A;  1YIJ T;  2HQE A;  3OS1 A;  3RMQ A;  1SF9 A;  3FJP A;  2ZAE A;  4ATO A;  2VGM A;  1DJ7 B;  2PQW A;  2QGF B;  4WF2 A;  2KXD A;  1KQS S;  1V76 A;  4OB1 B;  3JV3 A;  3CCJ T;  4OGC A;  4JRK A;  2WSE E;  2FHD A;  3CC7 A;  3BDL A;  1WIE A;  2L3S A;  3X26 B;  1UGQ B;  4E7H A;  4OMN A;  2XDP A;  1FYN A;  3GLX A;  5J39 A;  4C92 F;  4HKE A;  4KH1 B;  1VQL T;  4J9B A;  1JQQ A;  2XDB A;  3QWY A;  2RN8 A;  1KC8 R;  2OTJ A;  4RTV A;  4M7D A;  1QP3 A;  4QT7 A;  4M77 B;  2K5I A;  3CCE A;  3M58 A;  5CAI A;  1RAA B;  2ZPI B;  2JS2 A;  1UB4 A;  4ZGE B;  3G6E Q;  1S72 A;  2MF2 A;  1S1N A;  4R55 A;  1QP2 A;  1MGQ A;  1K73 U;  2ED0 A;  4XK8 E;  2J06 A;  1PHT A;  3BY7 A;  4E2F B;  4LD9 K;  2E6N A;  3A5Z B;  2PVO B;  3VRZ A;  5KCO A;  1M90 U;  3CEY A;  2CZ7 B;  3UF4 A;  4Y28 E;  2B86 A;  5LJ5 f;  2GF7 A;  1VQO Q;  4LNP A;  3UWN A;  2JMC A;  2QK0 A;  3R6N A;  4D8D A;  4WCI A;  2HSE B;  4PJL A;  1GFD A;  3I5S A;  1H92 A;  4PJM A;  1IRX A;  3JCM f;  2CRE A;  1TUD A;  4C0Z A;  4OF1 A;  3C12 A;  4M77 F;  2MMP A;  5GAO l;  5CO7 A;  3X25 B;  4M75 F;  5CCA A;  3M57 A;  2C06 A;  4AFZ C;  1N9S A;  4ESR A;  2YRC A;  1YJN T;  3CCU Q;  1NLO C;  4RUG A;  2VXF A;  1IHV A;  3CCM A;  3QDR B;  4RTZ A;  3V7R A;  4C0D C;  3FJ5 A;  2OI3 A;  4A53 A;  2DL7 A;  2BZY A;  2DIQ A;  4RKU E;  4GLK A;  1VIE A;  1MV0 B;  5AYF A;  5GAN j;  1KIK A;  1TH7 A;  4PJO D;  3CCQ A;  2J6K A;  1M2V B;  1UGR B;  2X35 A;  4E47 A;  3I55 Q;  4J6X A;  4RTW A;  2QEX A;  4RTU A;  1X69 A;  2PVG B;  4C8Q G;  2EYQ A;  2NLU A;  4M78 D;  1X27 A;  1M4Z A;  2FPF A;  1TTH B;  1WXB A;  4C5E A;  3CMA T;  3E1S A;  1JBM A;  2DTO A;  4M7A A;  2LJ1 A;  1SPK A;  4JJN K;  5LL6 S;  2AZV A;  4J9F A;  1HYO A;  1B34 A;  2F5K A;  5IHK A;  1BI3 A;  4BI8 B;  1SHG A;  4GLM A;  1JXO A;  5AT1 B;  4C5I A;  4BE0 A;  4QQD A;  1M3A A;  3VS4 A;  4FYV B;  2O2O A;  4DBR A;  2RD1 A;  4QVZ A;  1YWP A;  1OV3 A;  2DJZ A;  2GBQ A;  3E9F A;  4XAX B;  2XHC A;  3H0I A;  3MP6 A;  4RCB A;  1VQ8 A;  1Y0M A;  2WSC E;  5GMK m;  1QCO A;  1M3B A;  1Y96 A;  1UGP B;  2KAF A;  2KRO A;  5IHN A;  4OML A;  4DBQ A;  4KUI A;  5J26 A;  3G71 Q;  3A1P A;  2KT8 A;  1KHC A;  1QWE A;  3FRN A;  4Z89 A;  1AWJ A;  2G3R A;  4J8O A;  4OP0 A;  2A28 A;  2CZ6 B;  1G3T A;  1KQS P;  1WQ7 A;  4N4I A;  1YI2 A;  1WI7 A;  4O5V A;  2I0N A;  3OYM A;  2PUK B;  2DAQ A;  5I11 A;  3EGX B;  3OBW A;  3C4S A;  4QQ6 A;  2DKG A;  1NJI C;  5D6W A;  5LJ3 f;  2EQM A;  4HT9 A;  2MK5 A;  4C0D B;  4DOW A;  2FZG B;  2CP2 A;  2RA2 A;  2RK1 A;  2DVJ A;  4KT0 E;  3TEE A;  2CH4 W;  4R56 A;  4AT1 B;  1D1B A;  3MP1 A;  4CC2 A;  2X4J A;  2O9S A;  2CH4 A;  4PKC C;  2P4R A;  2M02 A;  4KUD K;  4A4H A;  1YHQ Q;  2QQB A;  1M2O A;  1SSH A;  3OQ5 A;  5GAM h;  1YIJ A;  4FW1 A;  5FU6 C;  4IUQ A;  3UPU A;  3M54 A;  2LP5 A;  3SD4 A;  5KYW B;  1NZ9 A;  2E6Z A;  3CCJ A;  2E70 A;  2QTX A;  1UGS B;  3OMC A;  3M0R A;  4F7U E;  3M59 A;  2RJE A;  3S6W A;  4CC7 A;  4E7J A;  2AKL A;  1YP5 A;  4M7D D;  3MEA A;  2MI6 A;  3QG1 A;  2QTV A;  2DTH A;  1FMK A;  1WHH A;  1LCK A;  3RER A;  1MNE A;  4D8K A;  4UC4 A;  2VXE A;  4OMP A;  5FW9 A;  4E7K A;  4M7D E;  1MMA A;  2D9T A;  4DEY A;  2YXY A;  1AHJ B;  3THK A;  2CP7 A;  5LJ5 j;  1VQL A;  4PJO F;  2DXC A;  1KQS A;  4E7L A;  3QII A;  2K3Y A;  1YWO A;  4X9C A;  2BIV A;  4EMH A;  3VKI A;  2LQW A;  1VQ4 Q;  2RF0 A;  4KGZ B;  1VQN Q;  4VUB A;  1X2K A;  1UHF A;  4M78 F;  1RAD B;  1U06 A;  2VC8 A;  3BE3 A;  4IUT A;  3G6E T;  4C92 G;  3MEV A;  4N0A C;  3PMT A;  2LT4 A;  3VS1 A;  1GL5 A;  1BIB A;  3SWN B;  2K2V A;  2Y4X A;  3S3M A;  3OYL A;  1HJD A;  2M1H A;  3VRY A;  1SRL A;  1JJ2 P;  1NBE B;  1NJI R;  3G7Z A;  4EMK A;  4C0F A;  4XU0 A;  3X20 B;  1VQO T;  2DX1 A;  1D3B A;  2R5M A;  1BB9 A;  3CC4 Q;  1MND A;  3V8J A;  1ZUU A;  2X3X D;  3BFM A;  4J9E A;  3OYA A;  4R0K A;  3DLM A;  1VQ9 Q;  5A0D A;  3EH1 A;  4TVR A;  2A08 A;  4F17 A;  2ENM A;  5KYU A;  1AEY A;  4OB0 B;  4J7F A;  1P92 A;  1M30 A;  4JJB A;  4RTX A;  2HMA A;  3RKW A;  1N27 A;  2GTJ A;  3SEM A;  5EG2 A;  4AFS C;  3C0C A;  3CCU T;  1YJN A;  4FL6 A;  1AVZ C;  3OW2 S;  1BI1 A;  3GIB A;  2D8H A;  5GAO n;  2JZ2 A;  4LUD A;  5FRN A;  3R6O A;  2RNA A;  4M77 G;  4F7U B;  2NUZ A;  1WHL A;  1YFN A;  2GNC A;  2LCS A;  1K0X A;  4IKF A;  4V2S A;  3PVL A;  4FIB A;  2RHY A;  2KT1 A;  4M7A D;  2FL7 A;  4HXJ A;  3REB B;  3I55 T;  5IN1 A;  5C6S A;  1MMG A;  2HKN A;  2PU9 B;  3G1J A;  3NFC A;  1RAB B;  5M9O A;  3CCQ T;  4C92 C;  4M7D B;  5DM7 R;  3M4Y A;  2NYS A;  2HKQ B;  3EG1 A;  5GAN 2;  4PL6 A;  1M8M A;  1VQK Q;  3CMA A;  4J7I A;  1CKB A;  2EQU A;  3RDV A;  2RM4 A;  4J9G A;  1U8R A;  4ORZ A;  1JJ2 A;  1F1B B;  1PRL C;  3JB9 D;  5GJW B;  1IO6 A;  1LVK A;  1TOV A;  2PVD B;  1JU5 C;  3MEU A;  4JS4 A;  1BYM A;  1G5V A;  1VQM Q;  1AWX A;  1AZG B;  3QO3 A;  2OTL Q;  1G83 A;  2FEI A;  2HSP A;  2F2V A;  5FRO A;  2XG8 D;  4XQ3 A;  2KMT A;  1PSE A;  4OMM A;  5FU7 C;  2RHI A;  5GAN h;  5LJ3 j;  3CPW A;  1UFF A;  2H3J A;  4M7D F;  4GY5 A;  1YIT Q;  2KEA A;  1NPP A;  4OMO A;  1NEB A;  4IIO A;  4Z8A A;  1GCQ A;  2ZPB B;  2PUO B;  3UA6 A;  4JPB W;  2F1L A;  4JRI A;  2L5Q A;  3MJX A;  3G71 T;  3HL8 A;  3VS2 A;  1QVG S;  2F5T X;  4M77 C;  2C0T A;  4Z02 A;  5GAN 6;  5GAM j;  2DET A;  4M75 C;  1ZSG A;  5IT9 E;  3OYJ A;  3OMG A;  1VQP T;  2ZCF B;  1AD5 A;  2RO0 A;  3PGG A;  1R77 A;  3QJ6 A;  4M75 E;  2RHU A;  4E6R A;  1TU0 B;  1UG1 A;  2VAS A;  1T3S A;  2ZPG B;  1OU9 A;  3OYE A;  1TSF A;  3OYB A;  8ATC B;  3GF5 A;  2JM9 A;  2Y90 A;  3CME Q;  1RL2 A;  3M4G A;  4L5G A;  1U5S A;  3C95 A;  5KYX A;  2MIO A;  2LTO A;  4X9D A;  4JDS A;  1SSF A;  5DLO A;  3URG A;  1C1A A;  2K9G A;  1N8R U;  1D0Y A;  1K8A R;  4LUE A;  1WHG A;  2Z0W A;  2RHX A;  1NYF A;  2EYW A;  3MP8 A;  1PRM C;  3OYF A;  2YRD A;  2NUT B;  2HD0 A;  1YHQ T;  4IUP A;  5GMK l;  3CCL Q;  1W70 A;  1TUG B;  1B34 B;  3CXC A;  4F04 B;  1WLP B;  4ZGJ B;  1M1K C;  4YTL A;  1K9M C;  2K5F A;  1FX7 A;  1YJ9 Q;  5HY6 A;  5KYN A;  2EIF A;  2K6D A;  2XD0 A;  4Z88 A;  3SDZ A;  3QZ9 B;  3KFV A;  4RMO A;  4FT4 A;  2HDA A;  3MEW A;  3VUB A;  4C8Q A;  1QCN A;  2EW3 A;  2X9H A;  2BE9 B;  2EFI A;  2L3R A;  3CCV Q;  1Q81 C;  1XOV A;  4LN2 A;  3M55 A;  1D1A A;  2WSF E;  4A4F A;  1M8V A;  1VIF A;  2RQT A;  4O6J A;  3OYH A;  4XTX A;  4MMK A;  1H64 1;  5I2S A;  2QQR A;  4ZGD B;  2XIC A;  1KD1 C;  2JN0 A;  3JB9 I;  1QVF A;  5FU7 B;  3QHS A;  3L2U A;  1JO8 A;  5CKH A;  2JM8 A;  2LNV A;  3DB3 A;  1VQ4 T;  2LC4 A;  1NPR A;  1VQN T;  1I5O B;  5FLX E;  2W0Z A;  1Y57 A;  1M9S A;  5HK0 A;  2KDS A;  3LLR A;  4C0G A;  3LWI A;  3G6E A;  1WJQ A;  4J5Y A;  2RQU A;  5CKF A;  3OW2 P;  2YT6 A;  3AT1 B;  3T9N A;  2FRW A;  5GAO q;  3ZFJ A;  3GPL A;  1RAG B;  4M75 B;  1WHJ A;  1Q7Y R;  2CT3 A;  1M1F A;  2PTK A;  3QYH B;  4OGE A;  1VQO A;  5CK9 A;  2ED1 A;  3LGL A;  3CC4 T;  1IRE B;  3OS5 A;  4HVV A;  1YJW Q;  5GAN e;  1EZZ B;  1IZ6 A;  3O8V A;  3H41 A;  3PFS A;  3QUI A;  2DA9 A;  4CI0 C;  1PNJ A;  3FEO A;  2RQR A;  3A8L B;  1RI9 A;  2YLB A;  5I22 A;  2LDM A;  4FM4 B;  5LJ5 h;  1RAH B;  3JCM X;  2LCC A;  2O4X B;  2K3B A;  2DF6 A;  3MO8 A;  3CCU A;  1QWF A;  1M1K R;  1K9M R;  5GMK j;  2A7Y A;  1U3O A;  3CPF A;  2X4Y A;  1OYX A;  2GFA A;  1UUE A;  2MYS A;  4JJC A;  1I8F A;  4RG8 A;  1I4K 1;  2NWM A;  3MHX A;  1YBY A;  1FMW A;  3JCM h;  5CQY A;  1ZSZ C;  2CSI A;  2LJ3 A;  1RLQ C;  3EHR A;  4J6Y A;  1Q81 R;  1KQ2 A;  4LD6 A;  2D0N A;  3I55 A;  3H6Z A;  3MCA B;  4B9X A;  1Q86 C;  4GBQ A;  2L3P A;  1G3S A;  4XTU A;  1Z9Q A;  2HCK A;  2CDT A;  3G4S Q;  3DLL A;  4E7S A;  2VGN A;  1WPY A;  4N4H A;  2COZ A;  1BU1 A;  3X28 B;  1KD1 R;  2ESW A;  2RQV A;  1Q82 C;  2KY9 A;  2V8J A;  1VQK T;  4PJO C;  3LH5 A;  2EQJ A;  2DBM A;  2E3I A;  2ZGW A;  3OA6 A;  4JLI A;  5EC7 A;  4PJO E;  1K8A U;  2QGG A;  1RAI B;  2OAW A;  3NPF A;  4M78 C;  3OS0 A;  3CCS Q;  1WZO A;  1RAC B;  2DL5 A;  2ABL A;  2MPX C;  2KGT A;  4M78 E;  4DBH A;  4Y92 A;  4AG1 C;  2CUD A;  1VQM T;  2HZY A;  4J9H A;  1OX8 A;  3QSU A;  2RJF A;  2OTL T;  5GMK i;  4LDY A;  2BUD A;  1AOJ A;  3INZ A;  1LPL A;  3A8O B;  1VA7 A;  1H3Z A;  3MKD A;  4BDZ A;  1Y07 A;  2OX7 A;  2DER A;  2DZ9 A;  2M16 A;  4C92 A;  1YIT T;  1Y7X A;  2EVR A;  4JZ3 A;  4XTW A;  4F7U G;  2SEM A;  4ZNX A;  1EX4 A;  2RK2 A;  3EFO A;  2R58 A;  5IAY A;  3G71 A;  1VQ5 Q;  4FU6 A;  4MDW A;  4NS5 A;  4HCK A;  1FWZ A;  1AZE A;  4C5H A;  2E65 A;  1BK2 A;  1Y71 A;  2AT1 B;  3OYI A;  2DD4 A;  2VV5 A;  4FYY B;  1VQP A;  1WGS A;  2PZ1 A;  3WVE B;  1EIF A;  3I56 Q;  1PCX A;  1UDL A;  2E5K A;  1IB8 A;  2DXT A;  2YWW A;  1LNX A;  3SWN C;  2FVU A;  2WAC A;  3EGD B;  1IXD A;  3CME T;  5GAO r;  5GAO p;  1KC8 U;  1HD3 A;  2HEQ A;  4BI3 A;  1I5L A;  4IUR A;  1FMV A;  3L2W A;  1ZSZ B;  1Q86 R;  2JXB A;  2ECZ A;  2HL3 A;  5FWB A;  4NL3 A;  1Q7Y U;  2EGC A;  2BTT A;  3JRZ A;  4C8Q D;  5LJ3 h;  1Q82 R;  4F14 A;  5LJ5 e;  3S3O A;  1YHQ A;  3D7S B;  3CCL T;  1VYV A;  3OYN A;  4M77 A;  1JEG A;  5GAN 5;  3SFM A;  4L6V 5;  3OBY A;  3SB2 A;  1W2B S;  4PJO B;  1YJ9 T;  1KFZ A;  1YI2 Q;  1AT1 B;  4C8Q E;  1O75 A;  5IHI A;  2JJ9 A;  2QA4 Q;  2HAX A;  1OUL A;  3A8M B;  1C6V X;  3JCM e;  4M78 B;  2HBP A;  1V29 B;  3PVQ A;  2FZK B;  2LRQ A;  1OOT A;  3EG9 B;  3MPU B;  5GAN 8;  2EYY A;  2LX7 A;  1ZUK A;  4LDU A;  1UHC A;  4A4E A;  3V7C A;  5GAN 4;  1PG5 B;  3GNF B;  2M0Y A;  4J9D A;  4M7D C;  3L2R A;  4XTZ A;  2LQ8 A;  4BUG A;  2YRV A;  5IXB A;  2XKO C;  1UTI A;  4JRP A;  1VQ4 A;  1VQN A;  3HFO A;  3JAM E;  2IG0 A;  2X51 A;  2EQK A;  4JZ4 A;  1OEB A;  3BW1 A;  2XK0 A;  5A0L A;  2DPP B;  1WNL A;  3M53 A;  3WVD B;  2CYZ B;  4DBF A;  1H8K A;  3CC2 Q;  1QVP A; 
#chains in the Genus database with same CATH homology
 1KC8 R;  1YIJ Q;  1S72 Q;  3CMA Q;  3CCR Q;  1QVF P;  2QEX Q;  1YJ9 Q;  1QVG P;  1VQ8 Q;  1YJW Q;  1M90 R;  1VQ9 Q;  1N8R R;  3OW2 P;  1K8A R;  1VQ7 Q;  1M1K R;  1K9M R;  3CCM Q;  1YIT Q;  3CCS Q;  3G71 Q;  3CXC P;  3G4S Q;  1YI2 Q;  1VQO Q;  1VQ6 Q;  1Q86 R;  1YHQ Q;  1YJN Q;  1W2B P;  1VQM Q;  1VQK Q;  2OTJ Q;  1JJ2 P;  3G6E Q;  1NJI R;  3I56 Q;  2QA4 Q;  3I55 Q;  3CC7 Q;  1VQL Q;  1Q7Y R;  1KD1 R;  3CCJ Q;  1VQ4 Q;  2OTL Q;  3CPW P;  1VQN Q;  3CCU Q;  3CCV Q;  3CME Q;  3CCL Q;  3CCE Q;  1VQP Q;  3CC4 Q;  3CD6 Q;  1KQS P;  1VQ5 Q;  3CC2 Q;  1Q82 R;  1Q81 R;  3CCQ Q;  1K73 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...