2CP0A

Solution structure of the 1st cap-gly domain in human clip-170-related protein clipr59
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
95
structure length
95
Chain Sequence
GSSGSSGGNLMLSALGLRLGDRVLLDGQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPKQGLFASVSKISKAVDASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords CLIPR-59 protein
publication title Solution structure of the 1st CAP-Gly domain in human CLIP-170-related protein CLIPR59
rcsb
source organism Homo sapiens
total genus 7
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cp0A00
1WHJA 3E2UA 4B6MA 2E3HA 2QK0A 1TOVA 1TXQA 2CP6A 2Z0WA 3TQ7P 2CP3A 2COWA 2CP5A 2HQHA 2HKNA 1WHLA 1LPLA 2CP0A 2E3IA 2CP7A 2HKQB 2HL3A 1WHHA 1IXDA 2COYA 1WHKA 2MPXC 2COZA 2HL5C 1WHGA 3RDVA 2CP2A 2E4HA 1WHMA 2M02A
chains in the Genus database with same CATH superfamily
2MCNA 2LT1A 2WSEE 4FCYA 1QP2A 1IREB 2DKGA 2E70A 3PE0A 2X4JA 4HA8A 3OYMA 1KQSP 5LJ3e 1Y7XA 2DMOA 1QVPA 2PVOB 3SDZA 4RTUA 2VGMA 4M75A 2HKQB 3ER0A 1QQJA 1Y96B 4M7DA 4HCKA 4O6JA 2RI5A 2E1HA 3L2ZA 1M8VA 1R0BG 4OMMA 2L5QA 4RTYA 1K8AU 4XU2A 5LJ5d 4N4GA 2AKLA 2J7IA 5ECAA 1GRIA 1KQSS 1ZSZC 4AG2C 2HD0A 2IPOB 5LJ5g 3NFCA 3G4ST 2B8AA 3H0IA 1W6XA 4F7UB 3G4SA 2FO0A 1D0ZA 2EQMA 3GIBA 1KIKA 4PFZA 1RADB 1UJYA 2D0QB 2YHTA 1G83A 2DAQA 3OMGA 1Q82U 2LCCA 4X1VA 4IUTA 1UGVA 2XG8D 4E7SA 1JXMA 2CGHA 2CP7A 2KVQG 1HXDA 2HMAA 2COZA 2MPXC 5KYWA 4M75C 2M0OA 4C92G 2GGRA 5KYUA 3JCMP 4M7DC 2PVGB 2V8JA 1OV3A 4OB2B 3G71Q 4J9EA 3X28B 4JRIA 3RNJA 4N4IA 2RHZA 1Z9ZA 5I22A 3GP8A 2F2VA 2HKNA 2K5FA 5LJ5j 4M78F 2QQBA 1N8RC 1G3TA 1I5OB 1NLPC 2ZPFB 4FW2A 1C1AA 1WFWA 1WQWA 2E4HA 4F14A 1NZ9A 1BI2A 2L3PA 3LW5E 2DTIA 4FT2A 5IHNA 4JS4A 2CP5A 4F17A 2X3WD 3PFSA 3OYEA 1SSFA 1WI7A 1YJNQ 5KYWB 5M9OA 2OX7A 3OYGA 3SB2A 5KYUB 3A5ZB 1E7OA 2A0FB 2JTMA 1B3QA 4N0AC 5IHIA 2BZXA 2JOYA 1CSKA 1TU0B 1W4SA 3X24B 2EGAA 5KYXB 2MMPA 1VQKQ 4C5IA 2HNIA 4OF1A 4QQDA 1VQ4Q 2PVDB 3G6ET 1VQ5Q 3E1SA 2QA4T 2JMAA 2X9HA 4A4FA 4FYWB 3M0TA 3BY7A 1VQNQ 2VXEA 3G6EA 3J81E 2QA4A 2K3YA 2BE7D 2XI9A 3R6OA 3H41A 4AT1B 4EPCA 1W1FA 1M90R 3CC2Q 2GFAA 4M77G 3CCQQ 2L0AA 3PVLA 1WHLA 1M3CA 2E3IA 2BTTA 1NJIU 1HSQA 1X69A 1D1BA 2LJ3A 1KK7A 3OS0A 4JUVA 4M78E 2VASA 4XTZA 4A4KA 4C92C 3CCMQ 1YJ9Q 2RJDA 3CMAQ 4CI0C 2FVUA 3ULRB 3LX7A 3OA6A 2RJEA 2LQKA 2LP5A 5GAOl 3AHUA 1TUGB 4MZPA 3CBPA 2MAMA 1SEMA 1U8RA 1WXTA 2KE9A 1U5SA 1NEBA 5GAN2 2QK0A 4CC7A 9ATCB 4PJOB 5J26A 3CCLT 2ED1A 2EQIA 4IUQA 3ZEHA 2K3XA 2VXFA 3CCLA 1KQ2A 3NGPA 3PIPA 1K9MC 2RQRA 3CCET 2OTJT 2JW4A 4Y28E 4ORZA 1BCOA 2EYZA 4IKFA 3QXEB 4EIKA 4CC4B 3CCEA 2EFIA 1YI2T 2H3JA 3SEMA 1CKBA 5IXFA 4MMKA 1O75A 1VQ6Q 1YI2A 4F04B 1YIJQ 3V7SA 1TUDA 2CUBA 4LNPA 3NHNA 4PNOA 4OMOA 3THKA 1NE8A 1MMNA 1WJSA 2CDTA 5FU7C 4LDUA 3VUZA 3M0PA 1SPKA 4PKCC 2G3RA 2DVEA 1BU1A 3VS4A 3QZ9B 1X75C 4QVDA 3QSUA 4M77C 4M7AG 2KI7A 2X51A 3CMET 1S72Q 4C92F 2DD4A 1BIBA 1C6VX 3JCMb 5GANh 1UGSB 3DLLA 3CMEA 2RF0A 1JO8A 2VGNA 1Q86U 1VQ8T 4J9BA 4LN2A 2RO0A 2GNCA 1EX4A 1V76A 1XJWB 1VQ8A 4HCZA 2L8DA 3VS0A 1JEGA 1VYTA 4RTZA 5GANf 1N5ZA 1QCFA 2EWNA 2L3SA 2CH4A 1QWFA 2RJCA 2V8KA 3CQTA 3FJ5A 2KRSA 3FDRA 3QWXX 2QXFA 3HTRA 1UHFA 1PSEA 1BI0A 3DKMA 3RKYA 2PTKA 1N6AA 4R55A 3HPWA 1UGPB 2DBKA 1WA7A 3EH1A 4GY5A 2FPDA 4FL6A 2G6FX 4BI8B 1XQHA 3M0SA 4E47A 3L1AA 3CCRQ 3T9NA 2B86A 2NUZA 2FZKB 2M02A 2D0NA 1WNLA 3N5BB 2YUPA 4MZMA 1MV0B 1D1AA 4L6V5 5IAYA 4Z8AA 1M2OA 3REAB 2NUPA 1M90U 4XTWA 5D6WA 4NL3A 1NLOC 1F1BB 4C0ZA 2AHJB 1KHCA 1WYXA 2FYKA 4EDUA 2R5MA 2JT4A 2BKDN 2FZCB 4LUDA 2PNIA 4C92E 1QVFA 2O9SA 3GPLA 2DBMA 2KK4A 1YJWQ 1OOTA 4AFUC 1JQQA 3OYDA 4II1A 3VYHB 2O31A 5FLXE 2K5LA 2L89A 4M7AC 5DLOA 4TVRA 4C5HA 3MHXA 2EJGA 5IH2A 3E9FA 2JM9A 1DJ7B 2L3QA 4ESRA 2EGEA 3EH2A 2DFUA 3P8BB 1PRMC 4C8QF 2Y4XA 4RTWA 1RAGB 1UHCA 2EQUA 2E12A 1AEYA 2VV5A 1OU8A 5LJ3j 1KQ1A 1GCQA 2JNGA 1OX9A 3G71T 2M16A 4M75D 4BY6C 3JCMX 4XQ3A 1N9SA 2C0TA 1BBZA 3G71A 2LC4A 3DB3A 3RMQA 1SHFA 1V29B 2XKOC 4OB0B 2ATCB 2EAYA 2P4TA 1NM7A 2Y90A 3INZA 5CVIA 4KBMB 2X4YA 1GCPA 5CKBA 4M78G 4OGCA 4IUVA 3KXTA 2LQWA 5LJ5h 3OMCA 1YJNT 3Q1JA 2HQEA 2KROA 4OB1B 4M77E 4Q5WA 2DTHA 1PKSA 1YJNA 1AWJA 1X27A 2JJ9A 4MDWA 4BE0A 4DBHA 2GBQA 1EIFA 2FG0A 4J9FA 2H8HA 1K0SA 1GCQC 1M27C 1OPKA 1KHIA 1VQKT 1WGSA 1VQ4T 1AWWA 1VQ5T 2ZPBB 4FT4A 1I4K1 2D8HA 5CKFA 5AT1B 1VQKA 1YNZA 1VQNT 3EGXB 3GNFB 1VQ4A 2AZVA 1AVZC 5IXBA 2HQHA 1VQNA 1X6BA 2YSQA 5LL6S 1X01A 4KUIA 4J8OA 3M5AA 1N8RR 3CC2T 1B34A 2DK3A 3CCQT 3EHQA 3PTAA 2JZ2A 3VUBA 2JMCA 5FU6B 4AG1C 3CC2A 3EG9B 5GAOr 4D8DA 3LH5A 3OSVA 4J83A 3REBB 1RAEB 2HSEB 3CCMT 1YJ9T 2GF7A 1Z9QA 3JCMd 3CMAT 3A98A 4ZGJB 3I5RA 3MP1A 3JCMc 3QHSA 5DLQE 4C92D 1D0XA 1YJ9A 1PM3A 4DBQA 3R6NA 4F7UG 4OMQA 3JCMg 2O88A 3E19A 3SWNC 5D7UA 4HT9A 3VS3A 1TS9A 4IUPA 1P92A 3X26B 1SKUB 2QDLA 3VRZA 3MJXA 3CCVQ 3L2WA 2QQSA 3MEWA 3AT1B 3TREA 2RQWA 3RERA 3OBWA 3LLRA 4M78C 4J9DA 2YUNA 1LVKA 2RK1A 2CH4W 2GQIA 4M7AE 4LD9K 2QAZA 2VC8A 5GAN8 3OS1A 3I55Q 1K8AC 2XHCA 1ZSZB 3MO8A 2DRMA 1RUWA 4LXCA 2ED0A 3L2RA 1VQ6T 5HK0A 2P0KA 3MEAA 1YIJT 2DILA 2KT8A 2DEUA 2SRCA 5CKEA 1VQ6A 2DXCA 2J05A 1YIJA 5A0LA 1XNIA 3JCMQ 3OYFA 4QKUA 1MMDA 1ABOA 5CIUA 1ABQA 2YRVA 5D6XA 1BKBA 1M3BA 3EGDB 3NTIA 4JJDA 1FMKA 1S72T 4LUEA 2LRQA 1PCXA 3EG0A 3NTHA 4M77D 3CCSQ 3MPUB 2RK2A 3JCMJ 1S72A 3QO3A 3GLXA 4M75B 2M51A 4QVZA 3V8LA 4ME7A 4DA4A 4M7DB 1M3AA 5J39A 4IIOA 3OYJA 4E7LA 4N0AA 4ZTJA 5A0DA 2F5KA 1K9MR 3QPHA 7AT1B 2DE0X 3PMIA 1KD1C 2DJQA 1ACMB 4J6XA 4JDSA 2RNAA 2YDLA 3A8HB 1M1KU 2Y4YA 2GCXA 4JLIA 2EJFA 4JZ4A 1QVFP 3TCJA 3TVTA 4OMPA 3U23A 1WHHA 2RMOA 1YCYA 2L2PA 3VRYA 2OTLQ 1MMAA 1Q7YC 2KEAA 2LQ8A 2JTFA 1VOMA 2J6KA 1V1CA 2XD0A 2KGTA 5FROA 5GANe 1SG5A 1OU9A 2KYMA 1G5VA 3CCRT 4KT0E 1WXBA 1Y07A 1QVFS 2NWMA 1X2QA 3FIFA 2WSFE 2LJ1A 5D6YA 4FSSA 4C92A 3UPUA 2ENMA 4JZ3A 3CBOA 8ATCB 2X35A 3C0CA 3PVQA 3MP8A 5GAMe 5IT9E 1TXQA 1YWOA 1BK2A 3GBQA 1KSWA 1K4US 1FMWA 1NYFA 2DJZA 1T0JA 1WPYA 1YJWT 4PJOG 3EFOA 5KCHA 3JAME 2K2MA 3KBGA 1YJWA 1FX7A 1SHGA 3S6WA 1M5Q1 1QVGA 4PJNA 4Y91A 2CUDA 1G2BA 2WSCE 2AK5A 5A0GA 2BZYA 2QGFB 2QQ9A 1NPRA 4M7AD 2RQUA 4J9IA 1NJIC 1LNXA 3QDFA 3QIIA 4F7UF 1D0YA 5HY6A 3OQ5A 2K6DA 1R77A 4A4GA 1EZZB 1RI0A 3RBBB 1I8FA 3EFOB 2R57A 2DNUA 3M0UA 4C8QG 1VIFA 1K1ZA 2FEIA 2ROLA 2RI3A 4L5GA 2NUTA 3JV3A 3HFNA 1H3ZA 5LJ3h 1GFDA 4PK4A 2RD1A 3C95A 2MI6A 1U1TA 4M77A 2HDAA 2KXCA 1VA7A 1RAFB 1NBEB 2GTOA 4J6WA 3I56Q 5GMKm 3HRSA 2XU8A 1J3TA 4A4EA 2CP0A 3OYAA 1U3OA 5LJ3f 2J06A 1YFNA 1GXIE 1T3LA 4A53A 1WJQA 2DO3A 1T0HA 1VQOQ 4DOVA 3NTKA 3VJPA 3NPFA 2CZ6B 4A63B 3CC7Q 5GAN3 4MZTA 2ZPIB 2DIGA 1W2BA 4L59A 2OTJA 4ZGDB 3V7RA 4KGZB 5GAN4 1TSFA 3RMSA 1B07A 3FC3A 3MEVA 1YITQ 5EG2A 2NUTB 3I5SA 1X6OA 1PNJA 4CRIA 2P84A 2BIVA 5CAIA 4F7UE 4BE1A 1K9MU 3VS5A 4M77B 3UA7A 3H6ZA 4JRKA 4QQ6A 1YBYA 4QVCA 2DVJA 3SFMA 5LJ5e 1ZQ1A 1X2KA 1AHJB 1UGQB 3OB9A 4OMFB 1EFNA 1Q86C 1SRLA 3VS6A 2EGCA 1D3BA 2KDSA 1M2VA 1KC8C 3JB9F 1MGQA 4XTUA 5GMKj 3OYNA 3EG1A 2CP3A 2X4XA 4XTXA 4DEXA 1X6GA 1ZA2B 2QASA 2KRNA 3RKXA 4XU1A 2LT4A 3ME9A 1Q81C 1IXDA 4C8QC 4QQGA 1G3SA 2HBPA 2YUOA 4E7IA 2MOXA 2RPNA 2D1XA 3PMTA 3A8OB 3CCVT 1VQ9Q 3MKDA 4X34A 1WX6A 2LDMA 4M7AA 1IHVA 2DM1A 3CCVA 3OSSC 3RR6A 2FHDA 2CZ0B 4C0DC 2DPPB 1OQKA 2JN0A 1AZEA 1D3BB 2QYZA 2YT6A 3M0QA 2MWPA 2O01E 4P5NA 4M78D 1O9SA 5LJ3d 2EVRA 1QP3A 4PJOF 2K3BA 3I55T 4PLIA 2LX9A 4N4HA 2CREA 1RL2A 4JS5A 4ATOA 1NG2A 2KMTA 2CKKA 5LJ3g 3I55A 2OAUA 5DM7R 3EFSA 1WLPB 4BI3A 2DXUA 2RQVA 3C4SA 3H8ZA 4XU3A 4JJBA 2ESWA 3V8KA 3QBYA 1ZBJA 4OP0A 1K73R 2YXYA 3OW2A 2FRWA 4M7AB 2AZSA 1H3HA 2L3RA 1JJ2A 3JB9J 2HSPA 1UFFA 3CCST 3JCMh 1MUZA 3ZL7C 4E7KA 2YRCA 4M4ZA 2O4XA 2RB6A 2RHUA 2KBTA 1R0CB 3VU3C 3CCSA 5A2QE 2DETA 3CD6Q 2DERA 4E7HA 2NUPB 4BY6B 4Z89A 3O8VA 3TU4K 4AMCA 1HD3A 3CXCA 2J6FA 2D9TA 1UG1A 3JCMf 1LPLA 2CSIA 3LGLA 1BYMA 2QG9B 4E7JA 2F2WA 1VQMQ 3C12A 2JS0A 4B9WA 4BB7A 2AIRB 4DEYA 1QMCA 5GJVB 2HCKA 2XDDA 2QEXQ 2VVKA 2OTLT 4OB3B 4WF2A 4PJOE 5CKDA 1XOVA 4FU6A 2OTLA 1KJWA 3SHWA 2RH2A 4PJLA 1CKAA 1IGUA 2ZPHB 1QVGP 1WHGA 3OYYA 2O4XB 4R0KA 5FWCA 1H92A 3QG1A 4C0FA 3BDLA 3EHRA 1JU5C 2EIFA 2RN8A 4C0GA 4E6RA 4ELZC 2GTJA 4HKEA 1IZ6A 4HCCA 3KUFA 5KH6A 3D7SB 2K9GA 1QVGS 4LDWA 3RUXA 3M9QA 3QUIA 3EAEA 2IVWA 1PRLC 1YHQQ 3SWNA 2YUQA 4AFQC 1KD1R 1U06A 4J9CA 1HJDA 5GAN5 5FRNA 4XU0A 2ZPGB 1VQ5A 3A8GB 2PUKB 2LNVA 4C8QE 4LD6A 3UATA 1WXUA 2FPFA 2JXBA 2A36A 2NYSA 2ZGWA 3MP6A 4ZGEB 1Q7YR 1D1CA 5I2SA 4M78A 3WVDB 2DLPA 2LNHB 1PSFA 3CCQA 1B7TA 3FLGA 1VQ7Q 2E41A 1TTHB 3I35A 2XICA 4HXJA 3FB9A 4HVVA 2DL5A 2BE9B 2KT1A 1ZUYA 1OPLA 4K11A 5CO7A 3CPWA 1JXOA 1UB4A 5CQYA 2MWOA 1Y0MA 2RQTA 1BB9A 1SSHA 4R56A 3CCMA 1U1SA 1WHJA 4EMKA 1W2BP 3CMAA 4DOWA 5GAMj 1VQPQ 5KCOA 2XK0A 1VUBA 2JM8A 4YTLA 5FU6C 6AT1B 2V1RA 3GNGA 2EQJA 4JRQA 1GBQA 1OZ3A 1B34B 1ZUUA 2HL5C 1C0MA 2K7AA 5L23A 4M78B 1Y96A 3OYKA 4M7DG 1W2BS 2GFUA 3RDVA 1QKWA 3I56T 3M57A 1A0NB 5HKCA 3LWHA 1K73U 1TUCA 3LH0A 3I56A 2MF2A 4A54A 3TQ7P 4CC3A 1WIEA 4OMLA 2E5KA 2IG0A 4FYYB 2EYWA 1VQOT 3HRUA 2KYBA 1QW1A 1NJIR 4RTXA 2CSQA 3CC7T 2R5AA 4RKUE 1VQOA 2DL3A 5KE2A 4QT7A 3JSCA 3CC7A 2ABLA 3WVEB 1WDXA 4F7UA 1RACB 2YRDA 3S3MA 1YITT 3QWYA 2P0PA 1G8XA 1NYGA 5L8RE 4EMKC 1VQLQ 2CT3A 4PJOD 1UECA 1YITA 1AZGB 4B9XA 4Z02A 2MIOA 3TSWA 5KYNA 1XTDA 2RI2A 2EBPA 3KFVA 1PWTA 2LJ0A 2AT1B 1HYOA 1E6GA 2DZ9A 5IN1A 1TWBA 2XDPA 4NL2A 2IIMA 2HAXA 1Q82C 5FWBA 3VS1A 1IO6A 3LYIA 4F16A 3JRZA 2W10A 3O5ZA 2EYXA 4HT8A 2RHYA 2FL7A 4CC2A 1QCOA 2C0IA 2COYA 4BE2A 2MK5A 2QGGA 1ZSGA 1WJRA 5GJWB 2CT4A 3JCMW 1IRXA 1K0XA 5C0MA 2CP2A 1UGRB 2HZYA 2VUBA 4OGEA 3UWNA 1M1KC 4HCBA 3UDCA 4A4HA 4J7IA 3H9NA 3S3NA 1K9AA 4HVWA 5GAN6 5CR2A 4C8QD 1X43A 3JB9G 2FB7A 4BD3A 4XAXB 2I0NA 2E64A 2ZCFB 1VQ9T 3GF5A 5GMKh 2PQWA 3OW2P 1VQ9A 1JRIA 2ZZDA 2KY9A 2DZCA 1I1JA 1JJ2P 3FEOA 4J9GA 2LMJA 2A08A 1KD1U 2CP6A 2JTEA 4RCCA 2LVMA 3OS2A 3ASKA 5KYXA 4HVUA 1RABB 3CCRA 4JLGA 3OW2S 2JVVA 4RUGA 4EMHA 1N8RU 3PIOA 3GOXA 1Q7YU 1Q86R 4GLMA 1M30A 1JJ2S 2DXBA 5GAN7 2LTOA 4DBFA 5IHKA 1KC8R 4ZN3A 2OJ2A 3CXCP 2ZPEB 2VWFA 2QTXA 2XIDA 1ZUKA 1M9SA 2E65A 2LQNA 3JB9H 2E6NA 1UUEA 1W70A 3CBMA 2FZGB 4D6WA 4FYXB 1UTIA 1Q81R 2MYSA 1RAHB 1KG1A 1H8KA 1YN8A 2QI2A 2LCSA 3CXCS 1YCSB 2EYQA 4PLLA 2ECZA 2SEMA 2VYTA 2V26A 1MHNA 3TEEA 4FIBA 2RA2A 5GMKl 2E10A 3TSZA 2V1QA 4XTYA 4O5VA 3JB9I 3CD6T 1ZLMA 3M55A 1BIAA 4C92B 2EPDA 2W0ZA 3X20B 3OS5A 1FYNA 3CD6A 1WHMA 1LOJA 4JRPA 1VQMT 2J6OA 5C6SA 4M75F 3M54A 1GBRA 1R8OB 4PJOA 4M7DF 1FXXA 2D8JA 3CCUQ 1VQMA 3MCAB 1AWOA 3LGFA 2QEXT 3EFRA 3A8LB 2LCLA 1OX8A 3H0FA 2EKOA 2QQAA 4FYVB 2F2XA 5KYYA 2A3LA 4BUGA 2QEXA 2C0OA 3JCMe 2K5IA 2P4RA 4PFOA 1RAAB 1PC0A 3BDUA 4BDZA 1RLPC 3QZ5B 3J80E 2OAWA 3G1JA 2O9VA 4AFSC 2XDBA 3CC4Q 2HQXA 1VYUA 4D8KA 2CS7A 3L2VA 4V2SA 2FPEA 1YP5A 1FWZA 2CZ7B 2KRMA 2EJ9A 3CCJQ 4MMLA 1T3SA 1RLQC 2EKHA 3F70A 4PJMA 2BUDA 1QLYA 3S3OA 3L2QA 3CPWP 4WCIA 2COWA 2PU9B 3OYBA 4FSXA 4KRTA 1OULA 2DYIA 4C8QA 3QYHB 1YHQT 4VUBA 2K57A 3E9GA 1M1GA 2DL7A 5FU7B 5KYYB 4PJOC 1KFZA 4OVAA 3VS2A 2H3EB 1YHQA 2GQVA 3ZFJA 3CPWS 4FW1A 5FW9A 3ZBDA 1ZA1B 3HRTA 4EMGA 2K2VA 3M56A 2F69A 3JCMV 2DD5A 4M75E 1AT1B 3LWIA 1G3WA 5GAOn 1VQ7T 3I9QA 4M7DE 5GAOm 4JJNK 3A1PA 3BW1A 1K76A 2RM4A 1VQ7A 2WACA 1ZBXA 2DF6A 3G4SQ 2EW3A 3QKJA 5I11A 1UDLA 3CPFA 1H641 4C8QB 4J7FA 3RIRA 3UT1A 2EYYA 5HK3A 4Y92A 1KQSA 1VQPT 3DB4A 2RHXA 4KH0B 2KNBB 2AKKA 1VQPA 2DYBA 3HKSA 4B6MA 3EGUA 1M8MA 2LX7A 3V8JA 1KC8U 1PG5B 4UC4A 4DBRA 4C0DB 1E6HA 8AT1B 2CYZB 3OYHA 4FM4B 4RG8A 2JS2A 3M53A 1M1FA 4KH1B 1I5LA 3L42A 1Q81U 2DEQA 5GAMh 4E7ZA 1M2VB 5AYFA 4AFZC 5KE3A 2DX1A 1Y71A 1ARKA 5EC7A 1PD0A 1SRMA 3RESA 4LDYA 2KSSA 1BI1A 1M90C 2Z0WA 5I21A 3QJ6A 1OYXA 1OI1A 4GBQA 2A28A 5HCKA 1Y57A 5GAMf 2DA9A 2V8IA 4IIMA 1OEBA 1S1NA 2P0QA 1Q95G 1VQLT 2HBWA 5GAOq 1PHTA 2DXTA 1GFCA 1UEBA 1VIEA 2E5QA 3OYIA 1VQLA 2K79A 1TH7A 4DQ2A 4RTTA 4QW2A 3OBYA 4J5YA 2RJFA 2NLUA 2C06A 1PD1A 5FRMA 3QJYA 2X4WA 1IB8A 3HP9A 3X25B 5J3BA 3WXMB 1I81A 3OYLA 4M77F 4IURA 2VB6A 1AWXA 3G6EQ 2QA4Q 1ZX6A 3PT9A 3VV0A 2QDYB 2YWWA 4ZN1A 4ZTFA 3SD4A 1I0CA 1UJ0A 2BZ8A 2CZ1B 3IQLA 1D09B 4LDVA 3VKIA 4BI4A 2QTVA 1M4ZA 2M0YA 2A7YA 1PKTA 2VKNA 1ZHIA 1LCKA 4J9HA 1HK9A 1K8AR 2XMFA 4C5GA 4LE9A 2E3HA 2ZAEA 1LJOA 4RG2A 2PUOB 5I2MA 3PGGA 1MMGA 1WZOA 1VYVA 4MDXA 4XTVA 1QWEA 1AOJA 2DTOA 3UA6A 1MNDA 5GANd 4M7DD 2QQRA 2X3XD 3BFMA 1IGQA 2JUFA 4LDXA 4BDYA 3J7AF 4ELYC 3OYCA 4Z88A 2OI3A 4ANJA 1JBMA 3NMZC 2KAFA 1AD5A 3G7ZA 4X9DA 5GAOp 3P8HA 2RHIA 5GANg 4IUUA 5CK9A 1Q82R 3EGXA 5CQXA 3QYGB 4PL6A 4XK8E 1QKXA 2I2LA 3M0RA 1MV3A 1BI3A 5DY9A 4PJJA 2A37A 1N27A 3V7CA 2F5TX 5GAMd 2KQWA 3EG2A 4KGXB 2KR3A 3M58A 3META 4RTVA 3L2UA 2HEQA 3CCLQ 4GLKA 5GMKe 4BACA 3OY9A 4C5EA 4RMOA 1TOVA 1M1KR 2DIQA 3EG9A 5CCAA 2F1LA 5GAMg 1G3YA 2YLCA 2YLBA 4X9CA 3CCEQ 3M59A 4E2FB 1QCNA 2OTJQ 1JB0E 4WTOB 3C94A 3P8DA 3FRNA 3HSBA 5LJ5f 1YI2Q 2K4YA 1MNEA 1NEGA 3E2UA 4M7AF 4RCBA 4PFPA 1N9RA 5GANj 1BCMA 2DL8A 2DL4A 3DLMA 2DRKA 3VYGA 1FMVA 3VS7A 4KULA 3HFOA 2ROTA 1WQ7A 3MEUA 3URGA 1WHKA 2R58A 3HHTB 3CEYA 3CCUT 3QDRB 3SWNB 3A8MB 3CMEQ 3H0HA 3FJPA 2EQKA 4ZNXA 1OZ2A 2M9UA 3CCUA 1TG0A 2KXDA 3JB9D 1IHWA 1VQ8Q 2HL3A 4JPBW 1NPPA 4M75G 4OMNA 1ZSZA 1RAIB 2LZ6B 3EG3A 1K73C 3HL8A 3CC4T 3M4GA 4JJCA 4KUDK 3UF4A 3BE3A 1SF9A 2E6ZA 1YWPA 3CC4A 2D6FA 2PZ1A 5CKHA 4J6YA 3PNWC 1GL5A 3CCJT 5GMKi 3M4YA 4NOYA 2M1HA 1UE9A 2FRYA 3CCJA 1RI9A 1I07A 4NS5A 2O2OA 3EGDA 4KGVB 4EMKB 3RKWA
chains in the Genus database with same CATH topology
1WHJA 3E2UA 4B6MA 2E3HA 2QK0A 1TOVA 1TXQA 2CP6A 2Z0WA 3TQ7P 2CP3A 2COWA 2CP5A 2HQHA 2HKNA 1WHLA 1LPLA 2CP0A 2E3IA 2CP7A 2HKQB 2HL3A 1WHHA 1IXDA 2COYA 1WHKA 2MPXC 2COZA 2HL5C 1WHGA 3RDVA 2CP2A 2E4HA 1WHMA 2M02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHJ A;  3E2U A;  4B6M A;  2E3H A;  2QK0 A;  1TOV A;  1TXQ A;  2CP6 A;  2Z0W A;  3TQ7 P;  2CP3 A;  2COW A;  2CP5 A;  2HQH A;  2HKN A;  1WHL A;  1LPL A;  2CP0 A;  2E3I A;  2CP7 A;  2HKQ B;  2HL3 A;  1WHH A;  1IXD A;  2COY A;  1WHK A;  2MPX C;  2COZ A;  2HL5 C;  1WHG A;  3RDV A;  2CP2 A;  2E4H A;  1WHM A;  2M02 A; 
#chains in the Genus database with same CATH topology
 2MCN A;  2LT1 A;  2WSE E;  4FCY A;  1QP2 A;  1IRE B;  2DKG A;  2E70 A;  3PE0 A;  2X4J A;  4HA8 A;  3OYM A;  1KQS P;  5LJ3 e;  1Y7X A;  2DMO A;  1QVP A;  2PVO B;  3SDZ A;  4RTU A;  2VGM A;  4M75 A;  2HKQ B;  3ER0 A;  1QQJ A;  1Y96 B;  4M7D A;  4HCK A;  4O6J A;  2RI5 A;  2E1H A;  3L2Z A;  1M8V A;  1R0B G;  4OMM A;  2L5Q A;  4RTY A;  1K8A U;  4XU2 A;  5LJ5 d;  4N4G A;  2AKL A;  2J7I A;  5ECA A;  1GRI A;  1KQS S;  1ZSZ C;  4AG2 C;  2HD0 A;  2IPO B;  5LJ5 g;  3NFC A;  3G4S T;  2B8A A;  3H0I A;  1W6X A;  4F7U B;  3G4S A;  2FO0 A;  1D0Z A;  2EQM A;  3GIB A;  1KIK A;  4PFZ A;  1RAD B;  1UJY A;  2D0Q B;  2YHT A;  1G83 A;  2DAQ A;  3OMG A;  1Q82 U;  2LCC A;  4X1V A;  4IUT A;  1UGV A;  2XG8 D;  4E7S A;  1JXM A;  2CGH A;  2CP7 A;  2KVQ G;  1HXD A;  2HMA A;  2COZ A;  2MPX C;  5KYW A;  4M75 C;  2M0O A;  4C92 G;  2GGR A;  5KYU A;  3JCM P;  4M7D C;  2PVG B;  2V8J A;  1OV3 A;  4OB2 B;  3G71 Q;  4J9E A;  3X28 B;  4JRI A;  3RNJ A;  4N4I A;  2RHZ A;  1Z9Z A;  5I22 A;  3GP8 A;  2F2V A;  2HKN A;  2K5F A;  5LJ5 j;  4M78 F;  2QQB A;  1N8R C;  1G3T A;  1I5O B;  1NLP C;  2ZPF B;  4FW2 A;  1C1A A;  1WFW A;  1WQW A;  2E4H A;  4F14 A;  1NZ9 A;  1BI2 A;  2L3P A;  3LW5 E;  2DTI A;  4FT2 A;  5IHN A;  4JS4 A;  2CP5 A;  4F17 A;  2X3W D;  3PFS A;  3OYE A;  1SSF A;  1WI7 A;  1YJN Q;  5KYW B;  5M9O A;  2OX7 A;  3OYG A;  3SB2 A;  5KYU B;  3A5Z B;  1E7O A;  2A0F B;  2JTM A;  1B3Q A;  4N0A C;  5IHI A;  2BZX A;  2JOY A;  1CSK A;  1TU0 B;  1W4S A;  3X24 B;  2EGA A;  5KYX B;  2MMP A;  1VQK Q;  4C5I A;  2HNI A;  4OF1 A;  4QQD A;  1VQ4 Q;  2PVD B;  3G6E T;  1VQ5 Q;  3E1S A;  2QA4 T;  2JMA A;  2X9H A;  4A4F A;  4FYW B;  3M0T A;  3BY7 A;  1VQN Q;  2VXE A;  3G6E A;  3J81 E;  2QA4 A;  2K3Y A;  2BE7 D;  2XI9 A;  3R6O A;  3H41 A;  4AT1 B;  4EPC A;  1W1F A;  1M90 R;  3CC2 Q;  2GFA A;  4M77 G;  3CCQ Q;  2L0A A;  3PVL A;  1WHL A;  1M3C A;  2E3I A;  2BTT A;  1NJI U;  1HSQ A;  1X69 A;  1D1B A;  2LJ3 A;  1KK7 A;  3OS0 A;  4JUV A;  4M78 E;  2VAS A;  4XTZ A;  4A4K A;  4C92 C;  3CCM Q;  1YJ9 Q;  2RJD A;  3CMA Q;  4CI0 C;  2FVU A;  3ULR B;  3LX7 A;  3OA6 A;  2RJE A;  2LQK A;  2LP5 A;  5GAO l;  3AHU A;  1TUG B;  4MZP A;  3CBP A;  2MAM A;  1SEM A;  1U8R A;  1WXT A;  2KE9 A;  1U5S A;  1NEB A;  5GAN 2;  2QK0 A;  4CC7 A;  9ATC B;  4PJO B;  5J26 A;  3CCL T;  2ED1 A;  2EQI A;  4IUQ A;  3ZEH A;  2K3X A;  2VXF A;  3CCL A;  1KQ2 A;  3NGP A;  3PIP A;  1K9M C;  2RQR A;  3CCE T;  2OTJ T;  2JW4 A;  4Y28 E;  4ORZ A;  1BCO A;  2EYZ A;  4IKF A;  3QXE B;  4EIK A;  4CC4 B;  3CCE A;  2EFI A;  1YI2 T;  2H3J A;  3SEM A;  1CKB A;  5IXF A;  4MMK A;  1O75 A;  1VQ6 Q;  1YI2 A;  4F04 B;  1YIJ Q;  3V7S A;  1TUD A;  2CUB A;  4LNP A;  3NHN A;  4PNO A;  4OMO A;  3THK A;  1NE8 A;  1MMN A;  1WJS A;  2CDT A;  5FU7 C;  4LDU A;  3VUZ A;  3M0P A;  1SPK A;  4PKC C;  2G3R A;  2DVE A;  1BU1 A;  3VS4 A;  3QZ9 B;  1X75 C;  4QVD A;  3QSU A;  4M77 C;  4M7A G;  2KI7 A;  2X51 A;  3CME T;  1S72 Q;  4C92 F;  2DD4 A;  1BIB A;  1C6V X;  3JCM b;  5GAN h;  1UGS B;  3DLL A;  3CME A;  2RF0 A;  1JO8 A;  2VGN A;  1Q86 U;  1VQ8 T;  4J9B A;  4LN2 A;  2RO0 A;  2GNC A;  1EX4 A;  1V76 A;  1XJW B;  1VQ8 A;  4HCZ A;  2L8D A;  3VS0 A;  1JEG A;  1VYT A;  4RTZ A;  5GAN f;  1N5Z A;  1QCF A;  2EWN A;  2L3S A;  2CH4 A;  1QWF A;  2RJC A;  2V8K A;  3CQT A;  3FJ5 A;  2KRS A;  3FDR A;  3QWX X;  2QXF A;  3HTR A;  1UHF A;  1PSE A;  1BI0 A;  3DKM A;  3RKY A;  2PTK A;  1N6A A;  4R55 A;  3HPW A;  1UGP B;  2DBK A;  1WA7 A;  3EH1 A;  4GY5 A;  2FPD A;  4FL6 A;  2G6F X;  4BI8 B;  1XQH A;  3M0S A;  4E47 A;  3L1A A;  3CCR Q;  3T9N A;  2B86 A;  2NUZ A;  2FZK B;  2M02 A;  2D0N A;  1WNL A;  3N5B B;  2YUP A;  4MZM A;  1MV0 B;  1D1A A;  4L6V 5;  5IAY A;  4Z8A A;  1M2O A;  3REA B;  2NUP A;  1M90 U;  4XTW A;  5D6W A;  4NL3 A;  1NLO C;  1F1B B;  4C0Z A;  2AHJ B;  1KHC A;  1WYX A;  2FYK A;  4EDU A;  2R5M A;  2JT4 A;  2BKD N;  2FZC B;  4LUD A;  2PNI A;  4C92 E;  1QVF A;  2O9S A;  3GPL A;  2DBM A;  2KK4 A;  1YJW Q;  1OOT A;  4AFU C;  1JQQ A;  3OYD A;  4II1 A;  3VYH B;  2O31 A;  5FLX E;  2K5L A;  2L89 A;  4M7A C;  5DLO A;  4TVR A;  4C5H A;  3MHX A;  2EJG A;  5IH2 A;  3E9F A;  2JM9 A;  1DJ7 B;  2L3Q A;  4ESR A;  2EGE A;  3EH2 A;  2DFU A;  3P8B B;  1PRM C;  4C8Q F;  2Y4X A;  4RTW A;  1RAG B;  1UHC A;  2EQU A;  2E12 A;  1AEY A;  2VV5 A;  1OU8 A;  5LJ3 j;  1KQ1 A;  1GCQ A;  2JNG A;  1OX9 A;  3G71 T;  2M16 A;  4M75 D;  4BY6 C;  3JCM X;  4XQ3 A;  1N9S A;  2C0T A;  1BBZ A;  3G71 A;  2LC4 A;  3DB3 A;  3RMQ A;  1SHF A;  1V29 B;  2XKO C;  4OB0 B;  2ATC B;  2EAY A;  2P4T A;  1NM7 A;  2Y90 A;  3INZ A;  5CVI A;  4KBM B;  2X4Y A;  1GCP A;  5CKB A;  4M78 G;  4OGC A;  4IUV A;  3KXT A;  2LQW A;  5LJ5 h;  3OMC A;  1YJN T;  3Q1J A;  2HQE A;  2KRO A;  4OB1 B;  4M77 E;  4Q5W A;  2DTH A;  1PKS A;  1YJN A;  1AWJ A;  1X27 A;  2JJ9 A;  4MDW A;  4BE0 A;  4DBH A;  2GBQ A;  1EIF A;  2FG0 A;  4J9F A;  2H8H A;  1K0S A;  1GCQ C;  1M27 C;  1OPK A;  1KHI A;  1VQK T;  1WGS A;  1VQ4 T;  1AWW A;  1VQ5 T;  2ZPB B;  4FT4 A;  1I4K 1;  2D8H A;  5CKF A;  5AT1 B;  1VQK A;  1YNZ A;  1VQN T;  3EGX B;  3GNF B;  1VQ4 A;  2AZV A;  1AVZ C;  5IXB A;  2HQH A;  1VQN A;  1X6B A;  2YSQ A;  5LL6 S;  1X01 A;  4KUI A;  4J8O A;  3M5A A;  1N8R R;  3CC2 T;  1B34 A;  2DK3 A;  3CCQ T;  3EHQ A;  3PTA A;  2JZ2 A;  3VUB A;  2JMC A;  5FU6 B;  4AG1 C;  3CC2 A;  3EG9 B;  5GAO r;  4D8D A;  3LH5 A;  3OSV A;  4J83 A;  3REB B;  1RAE B;  2HSE B;  3CCM T;  1YJ9 T;  2GF7 A;  1Z9Q A;  3JCM d;  3CMA T;  3A98 A;  4ZGJ B;  3I5R A;  3MP1 A;  3JCM c;  3QHS A;  5DLQ E;  4C92 D;  1D0X A;  1YJ9 A;  1PM3 A;  4DBQ A;  3R6N A;  4F7U G;  4OMQ A;  3JCM g;  2O88 A;  3E19 A;  3SWN C;  5D7U A;  4HT9 A;  3VS3 A;  1TS9 A;  4IUP A;  1P92 A;  3X26 B;  1SKU B;  2QDL A;  3VRZ A;  3MJX A;  3CCV Q;  3L2W A;  2QQS A;  3MEW A;  3AT1 B;  3TRE A;  2RQW A;  3RER A;  3OBW A;  3LLR A;  4M78 C;  4J9D A;  2YUN A;  1LVK A;  2RK1 A;  2CH4 W;  2GQI A;  4M7A E;  4LD9 K;  2QAZ A;  2VC8 A;  5GAN 8;  3OS1 A;  3I55 Q;  1K8A C;  2XHC A;  1ZSZ B;  3MO8 A;  2DRM A;  1RUW A;  4LXC A;  2ED0 A;  3L2R A;  1VQ6 T;  5HK0 A;  2P0K A;  3MEA A;  1YIJ T;  2DIL A;  2KT8 A;  2DEU A;  2SRC A;  5CKE A;  1VQ6 A;  2DXC A;  2J05 A;  1YIJ A;  5A0L A;  1XNI A;  3JCM Q;  3OYF A;  4QKU A;  1MMD A;  1ABO A;  5CIU A;  1ABQ A;  2YRV A;  5D6X A;  1BKB A;  1M3B A;  3EGD B;  3NTI A;  4JJD A;  1FMK A;  1S72 T;  4LUE A;  2LRQ A;  1PCX A;  3EG0 A;  3NTH A;  4M77 D;  3CCS Q;  3MPU B;  2RK2 A;  3JCM J;  1S72 A;  3QO3 A;  3GLX A;  4M75 B;  2M51 A;  4QVZ A;  3V8L A;  4ME7 A;  4DA4 A;  4M7D B;  1M3A A;  5J39 A;  4IIO A;  3OYJ A;  4E7L A;  4N0A A;  4ZTJ A;  5A0D A;  2F5K A;  1K9M R;  3QPH A;  7AT1 B;  2DE0 X;  3PMI A;  1KD1 C;  2DJQ A;  1ACM B;  4J6X A;  4JDS A;  2RNA A;  2YDL A;  3A8H B;  1M1K U;  2Y4Y A;  2GCX A;  4JLI A;  2EJF A;  4JZ4 A;  1QVF P;  3TCJ A;  3TVT A;  4OMP A;  3U23 A;  1WHH A;  2RMO A;  1YCY A;  2L2P A;  3VRY A;  2OTL Q;  1MMA A;  1Q7Y C;  2KEA A;  2LQ8 A;  2JTF A;  1VOM A;  2J6K A;  1V1C A;  2XD0 A;  2KGT A;  5FRO A;  5GAN e;  1SG5 A;  1OU9 A;  2KYM A;  1G5V A;  3CCR T;  4KT0 E;  1WXB A;  1Y07 A;  1QVF S;  2NWM A;  1X2Q A;  3FIF A;  2WSF E;  2LJ1 A;  5D6Y A;  4FSS A;  4C92 A;  3UPU A;  2ENM A;  4JZ3 A;  3CBO A;  8ATC B;  2X35 A;  3C0C A;  3PVQ A;  3MP8 A;  5GAM e;  5IT9 E;  1TXQ A;  1YWO A;  1BK2 A;  3GBQ A;  1KSW A;  1K4U S;  1FMW A;  1NYF A;  2DJZ A;  1T0J A;  1WPY A;  1YJW T;  4PJO G;  3EFO A;  5KCH A;  3JAM E;  2K2M A;  3KBG A;  1YJW A;  1FX7 A;  1SHG A;  3S6W A;  1M5Q 1;  1QVG A;  4PJN A;  4Y91 A;  2CUD A;  1G2B A;  2WSC E;  2AK5 A;  5A0G A;  2BZY A;  2QGF B;  2QQ9 A;  1NPR A;  4M7A D;  2RQU A;  4J9I A;  1NJI C;  1LNX A;  3QDF A;  3QII A;  4F7U F;  1D0Y A;  5HY6 A;  3OQ5 A;  2K6D A;  1R77 A;  4A4G A;  1EZZ B;  1RI0 A;  3RBB B;  1I8F A;  3EFO B;  2R57 A;  2DNU A;  3M0U A;  4C8Q G;  1VIF A;  1K1Z A;  2FEI A;  2ROL A;  2RI3 A;  4L5G A;  2NUT A;  3JV3 A;  3HFN A;  1H3Z A;  5LJ3 h;  1GFD A;  4PK4 A;  2RD1 A;  3C95 A;  2MI6 A;  1U1T A;  4M77 A;  2HDA A;  2KXC A;  1VA7 A;  1RAF B;  1NBE B;  2GTO A;  4J6W A;  3I56 Q;  5GMK m;  3HRS A;  2XU8 A;  1J3T A;  4A4E A;  2CP0 A;  3OYA A;  1U3O A;  5LJ3 f;  2J06 A;  1YFN A;  1GXI E;  1T3L A;  4A53 A;  1WJQ A;  2DO3 A;  1T0H A;  1VQO Q;  4DOV A;  3NTK A;  3VJP A;  3NPF A;  2CZ6 B;  4A63 B;  3CC7 Q;  5GAN 3;  4MZT A;  2ZPI B;  2DIG A;  1W2B A;  4L59 A;  2OTJ A;  4ZGD B;  3V7R A;  4KGZ B;  5GAN 4;  1TSF A;  3RMS A;  1B07 A;  3FC3 A;  3MEV A;  1YIT Q;  5EG2 A;  2NUT B;  3I5S A;  1X6O A;  1PNJ A;  4CRI A;  2P84 A;  2BIV A;  5CAI A;  4F7U E;  4BE1 A;  1K9M U;  3VS5 A;  4M77 B;  3UA7 A;  3H6Z A;  4JRK A;  4QQ6 A;  1YBY A;  4QVC A;  2DVJ A;  3SFM A;  5LJ5 e;  1ZQ1 A;  1X2K A;  1AHJ B;  1UGQ B;  3OB9 A;  4OMF B;  1EFN A;  1Q86 C;  1SRL A;  3VS6 A;  2EGC A;  1D3B A;  2KDS A;  1M2V A;  1KC8 C;  3JB9 F;  1MGQ A;  4XTU A;  5GMK j;  3OYN A;  3EG1 A;  2CP3 A;  2X4X A;  4XTX A;  4DEX A;  1X6G A;  1ZA2 B;  2QAS A;  2KRN A;  3RKX A;  4XU1 A;  2LT4 A;  3ME9 A;  1Q81 C;  1IXD A;  4C8Q C;  4QQG A;  1G3S A;  2HBP A;  2YUO A;  4E7I A;  2MOX A;  2RPN A;  2D1X A;  3PMT A;  3A8O B;  3CCV T;  1VQ9 Q;  3MKD A;  4X34 A;  1WX6 A;  2LDM A;  4M7A A;  1IHV A;  2DM1 A;  3CCV A;  3OSS C;  3RR6 A;  2FHD A;  2CZ0 B;  4C0D C;  2DPP B;  1OQK A;  2JN0 A;  1AZE A;  1D3B B;  2QYZ A;  2YT6 A;  3M0Q A;  2MWP A;  2O01 E;  4P5N A;  4M78 D;  1O9S A;  5LJ3 d;  2EVR A;  1QP3 A;  4PJO F;  2K3B A;  3I55 T;  4PLI A;  2LX9 A;  4N4H A;  2CRE A;  1RL2 A;  4JS5 A;  4ATO A;  1NG2 A;  2KMT A;  2CKK A;  5LJ3 g;  3I55 A;  2OAU A;  5DM7 R;  3EFS A;  1WLP B;  4BI3 A;  2DXU A;  2RQV A;  3C4S A;  3H8Z A;  4XU3 A;  4JJB A;  2ESW A;  3V8K A;  3QBY A;  1ZBJ A;  4OP0 A;  1K73 R;  2YXY A;  3OW2 A;  2FRW A;  4M7A B;  2AZS A;  1H3H A;  2L3R A;  1JJ2 A;  3JB9 J;  2HSP A;  1UFF A;  3CCS T;  3JCM h;  1MUZ A;  3ZL7 C;  4E7K A;  2YRC A;  4M4Z A;  2O4X A;  2RB6 A;  2RHU A;  2KBT A;  1R0C B;  3VU3 C;  3CCS A;  5A2Q E;  2DET A;  3CD6 Q;  2DER A;  4E7H A;  2NUP B;  4BY6 B;  4Z89 A;  3O8V A;  3TU4 K;  4AMC A;  1HD3 A;  3CXC A;  2J6F A;  2D9T A;  1UG1 A;  3JCM f;  1LPL A;  2CSI A;  3LGL A;  1BYM A;  2QG9 B;  4E7J A;  2F2W A;  1VQM Q;  3C12 A;  2JS0 A;  4B9W A;  4BB7 A;  2AIR B;  4DEY A;  1QMC A;  5GJV B;  2HCK A;  2XDD A;  2QEX Q;  2VVK A;  2OTL T;  4OB3 B;  4WF2 A;  4PJO E;  5CKD A;  1XOV A;  4FU6 A;  2OTL A;  1KJW A;  3SHW A;  2RH2 A;  4PJL A;  1CKA A;  1IGU A;  2ZPH B;  1QVG P;  1WHG A;  3OYY A;  2O4X B;  4R0K A;  5FWC A;  1H92 A;  3QG1 A;  4C0F A;  3BDL A;  3EHR A;  1JU5 C;  2EIF A;  2RN8 A;  4C0G A;  4E6R A;  4ELZ C;  2GTJ A;  4HKE A;  1IZ6 A;  4HCC A;  3KUF A;  5KH6 A;  3D7S B;  2K9G A;  1QVG S;  4LDW A;  3RUX A;  3M9Q A;  3QUI A;  3EAE A;  2IVW A;  1PRL C;  1YHQ Q;  3SWN A;  2YUQ A;  4AFQ C;  1KD1 R;  1U06 A;  4J9C A;  1HJD A;  5GAN 5;  5FRN A;  4XU0 A;  2ZPG B;  1VQ5 A;  3A8G B;  2PUK B;  2LNV A;  4C8Q E;  4LD6 A;  3UAT A;  1WXU A;  2FPF A;  2JXB A;  2A36 A;  2NYS A;  2ZGW A;  3MP6 A;  4ZGE B;  1Q7Y R;  1D1C A;  5I2S A;  4M78 A;  3WVD B;  2DLP A;  2LNH B;  1PSF A;  3CCQ A;  1B7T A;  3FLG A;  1VQ7 Q;  2E41 A;  1TTH B;  3I35 A;  2XIC A;  4HXJ A;  3FB9 A;  4HVV A;  2DL5 A;  2BE9 B;  2KT1 A;  1ZUY A;  1OPL A;  4K11 A;  5CO7 A;  3CPW A;  1JXO A;  1UB4 A;  5CQY A;  2MWO A;  1Y0M A;  2RQT A;  1BB9 A;  1SSH A;  4R56 A;  3CCM A;  1U1S A;  1WHJ A;  4EMK A;  1W2B P;  3CMA A;  4DOW A;  5GAM j;  1VQP Q;  5KCO A;  2XK0 A;  1VUB A;  2JM8 A;  4YTL A;  5FU6 C;  6AT1 B;  2V1R A;  3GNG A;  2EQJ A;  4JRQ A;  1GBQ A;  1OZ3 A;  1B34 B;  1ZUU A;  2HL5 C;  1C0M A;  2K7A A;  5L23 A;  4M78 B;  1Y96 A;  3OYK A;  4M7D G;  1W2B S;  2GFU A;  3RDV A;  1QKW A;  3I56 T;  3M57 A;  1A0N B;  5HKC A;  3LWH A;  1K73 U;  1TUC A;  3LH0 A;  3I56 A;  2MF2 A;  4A54 A;  3TQ7 P;  4CC3 A;  1WIE A;  4OML A;  2E5K A;  2IG0 A;  4FYY B;  2EYW A;  1VQO T;  3HRU A;  2KYB A;  1QW1 A;  1NJI R;  4RTX A;  2CSQ A;  3CC7 T;  2R5A A;  4RKU E;  1VQO A;  2DL3 A;  5KE2 A;  4QT7 A;  3JSC A;  3CC7 A;  2ABL A;  3WVE B;  1WDX A;  4F7U A;  1RAC B;  2YRD A;  3S3M A;  1YIT T;  3QWY A;  2P0P A;  1G8X A;  1NYG A;  5L8R E;  4EMK C;  1VQL Q;  2CT3 A;  4PJO D;  1UEC A;  1YIT A;  1AZG B;  4B9X A;  4Z02 A;  2MIO A;  3TSW A;  5KYN A;  1XTD A;  2RI2 A;  2EBP A;  3KFV A;  1PWT A;  2LJ0 A;  2AT1 B;  1HYO A;  1E6G A;  2DZ9 A;  5IN1 A;  1TWB A;  2XDP A;  4NL2 A;  2IIM A;  2HAX A;  1Q82 C;  5FWB A;  3VS1 A;  1IO6 A;  3LYI A;  4F16 A;  3JRZ A;  2W10 A;  3O5Z A;  2EYX A;  4HT8 A;  2RHY A;  2FL7 A;  4CC2 A;  1QCO A;  2C0I A;  2COY A;  4BE2 A;  2MK5 A;  2QGG A;  1ZSG A;  1WJR A;  5GJW B;  2CT4 A;  3JCM W;  1IRX A;  1K0X A;  5C0M A;  2CP2 A;  1UGR B;  2HZY A;  2VUB A;  4OGE A;  3UWN A;  1M1K C;  4HCB A;  3UDC A;  4A4H A;  4J7I A;  3H9N A;  3S3N A;  1K9A A;  4HVW A;  5GAN 6;  5CR2 A;  4C8Q D;  1X43 A;  3JB9 G;  2FB7 A;  4BD3 A;  4XAX B;  2I0N A;  2E64 A;  2ZCF B;  1VQ9 T;  3GF5 A;  5GMK h;  2PQW A;  3OW2 P;  1VQ9 A;  1JRI A;  2ZZD A;  2KY9 A;  2DZC A;  1I1J A;  1JJ2 P;  3FEO A;  4J9G A;  2LMJ A;  2A08 A;  1KD1 U;  2CP6 A;  2JTE A;  4RCC A;  2LVM A;  3OS2 A;  3ASK A;  5KYX A;  4HVU A;  1RAB B;  3CCR A;  4JLG A;  3OW2 S;  2JVV A;  4RUG A;  4EMH A;  1N8R U;  3PIO A;  3GOX A;  1Q7Y U;  1Q86 R;  4GLM A;  1M30 A;  1JJ2 S;  2DXB A;  5GAN 7;  2LTO A;  4DBF A;  5IHK A;  1KC8 R;  4ZN3 A;  2OJ2 A;  3CXC P;  2ZPE B;  2VWF A;  2QTX A;  2XID A;  1ZUK A;  1M9S A;  2E65 A;  2LQN A;  3JB9 H;  2E6N A;  1UUE A;  1W70 A;  3CBM A;  2FZG B;  4D6W A;  4FYX B;  1UTI A;  1Q81 R;  2MYS A;  1RAH B;  1KG1 A;  1H8K A;  1YN8 A;  2QI2 A;  2LCS A;  3CXC S;  1YCS B;  2EYQ A;  4PLL A;  2ECZ A;  2SEM A;  2VYT A;  2V26 A;  1MHN A;  3TEE A;  4FIB A;  2RA2 A;  5GMK l;  2E10 A;  3TSZ A;  2V1Q A;  4XTY A;  4O5V A;  3JB9 I;  3CD6 T;  1ZLM A;  3M55 A;  1BIA A;  4C92 B;  2EPD A;  2W0Z A;  3X20 B;  3OS5 A;  1FYN A;  3CD6 A;  1WHM A;  1LOJ A;  4JRP A;  1VQM T;  2J6O A;  5C6S A;  4M75 F;  3M54 A;  1GBR A;  1R8O B;  4PJO A;  4M7D F;  1FXX A;  2D8J A;  3CCU Q;  1VQM A;  3MCA B;  1AWO A;  3LGF A;  2QEX T;  3EFR A;  3A8L B;  2LCL A;  1OX8 A;  3H0F A;  2EKO A;  2QQA A;  4FYV B;  2F2X A;  5KYY A;  2A3L A;  4BUG A;  2QEX A;  2C0O A;  3JCM e;  2K5I A;  2P4R A;  4PFO A;  1RAA B;  1PC0 A;  3BDU A;  4BDZ A;  1RLP C;  3QZ5 B;  3J80 E;  2OAW A;  3G1J A;  2O9V A;  4AFS C;  2XDB A;  3CC4 Q;  2HQX A;  1VYU A;  4D8K A;  2CS7 A;  3L2V A;  4V2S A;  2FPE A;  1YP5 A;  1FWZ A;  2CZ7 B;  2KRM A;  2EJ9 A;  3CCJ Q;  4MML A;  1T3S A;  1RLQ C;  2EKH A;  3F70 A;  4PJM A;  2BUD A;  1QLY A;  3S3O A;  3L2Q A;  3CPW P;  4WCI A;  2COW A;  2PU9 B;  3OYB A;  4FSX A;  4KRT A;  1OUL A;  2DYI A;  4C8Q A;  3QYH B;  1YHQ T;  4VUB A;  2K57 A;  3E9G A;  1M1G A;  2DL7 A;  5FU7 B;  5KYY B;  4PJO C;  1KFZ A;  4OVA A;  3VS2 A;  2H3E B;  1YHQ A;  2GQV A;  3ZFJ A;  3CPW S;  4FW1 A;  5FW9 A;  3ZBD A;  1ZA1 B;  3HRT A;  4EMG A;  2K2V A;  3M56 A;  2F69 A;  3JCM V;  2DD5 A;  4M75 E;  1AT1 B;  3LWI A;  1G3W A;  5GAO n;  1VQ7 T;  3I9Q A;  4M7D E;  5GAO m;  4JJN K;  3A1P A;  3BW1 A;  1K76 A;  2RM4 A;  1VQ7 A;  2WAC A;  1ZBX A;  2DF6 A;  3G4S Q;  2EW3 A;  3QKJ A;  5I11 A;  1UDL A;  3CPF A;  1H64 1;  4C8Q B;  4J7F A;  3RIR A;  3UT1 A;  2EYY A;  5HK3 A;  4Y92 A;  1KQS A;  1VQP T;  3DB4 A;  2RHX A;  4KH0 B;  2KNB B;  2AKK A;  1VQP A;  2DYB A;  3HKS A;  4B6M A;  3EGU A;  1M8M A;  2LX7 A;  3V8J A;  1KC8 U;  1PG5 B;  4UC4 A;  4DBR A;  4C0D B;  1E6H A;  8AT1 B;  2CYZ B;  3OYH A;  4FM4 B;  4RG8 A;  2JS2 A;  3M53 A;  1M1F A;  4KH1 B;  1I5L A;  3L42 A;  1Q81 U;  2DEQ A;  5GAM h;  4E7Z A;  1M2V B;  5AYF A;  4AFZ C;  5KE3 A;  2DX1 A;  1Y71 A;  1ARK A;  5EC7 A;  1PD0 A;  1SRM A;  3RES A;  4LDY A;  2KSS A;  1BI1 A;  1M90 C;  2Z0W A;  5I21 A;  3QJ6 A;  1OYX A;  1OI1 A;  4GBQ A;  2A28 A;  5HCK A;  1Y57 A;  5GAM f;  2DA9 A;  2V8I A;  4IIM A;  1OEB A;  1S1N A;  2P0Q A;  1Q95 G;  1VQL T;  2HBW A;  5GAO q;  1PHT A;  2DXT A;  1GFC A;  1UEB A;  1VIE A;  2E5Q A;  3OYI A;  1VQL A;  2K79 A;  1TH7 A;  4DQ2 A;  4RTT A;  4QW2 A;  3OBY A;  4J5Y A;  2RJF A;  2NLU A;  2C06 A;  1PD1 A;  5FRM A;  3QJY A;  2X4W A;  1IB8 A;  3HP9 A;  3X25 B;  5J3B A;  3WXM B;  1I81 A;  3OYL A;  4M77 F;  4IUR A;  2VB6 A;  1AWX A;  3G6E Q;  2QA4 Q;  1ZX6 A;  3PT9 A;  3VV0 A;  2QDY B;  2YWW A;  4ZN1 A;  4ZTF A;  3SD4 A;  1I0C A;  1UJ0 A;  2BZ8 A;  2CZ1 B;  3IQL A;  1D09 B;  4LDV A;  3VKI A;  4BI4 A;  2QTV A;  1M4Z A;  2M0Y A;  2A7Y A;  1PKT A;  2VKN A;  1ZHI A;  1LCK A;  4J9H A;  1HK9 A;  1K8A R;  2XMF A;  4C5G A;  4LE9 A;  2E3H A;  2ZAE A;  1LJO A;  4RG2 A;  2PUO B;  5I2M A;  3PGG A;  1MMG A;  1WZO A;  1VYV A;  4MDX A;  4XTV A;  1QWE A;  1AOJ A;  2DTO A;  3UA6 A;  1MND A;  5GAN d;  4M7D D;  2QQR A;  2X3X D;  3BFM A;  1IGQ A;  2JUF A;  4LDX A;  4BDY A;  3J7A F;  4ELY C;  3OYC A;  4Z88 A;  2OI3 A;  4ANJ A;  1JBM A;  3NMZ C;  2KAF A;  1AD5 A;  3G7Z A;  4X9D A;  5GAO p;  3P8H A;  2RHI A;  5GAN g;  4IUU A;  5CK9 A;  1Q82 R;  3EGX A;  5CQX A;  3QYG B;  4PL6 A;  4XK8 E;  1QKX A;  2I2L A;  3M0R A;  1MV3 A;  1BI3 A;  5DY9 A;  4PJJ A;  2A37 A;  1N27 A;  3V7C A;  2F5T X;  5GAM d;  2KQW A;  3EG2 A;  4KGX B;  2KR3 A;  3M58 A;  3MET A;  4RTV A;  3L2U A;  2HEQ A;  3CCL Q;  4GLK A;  5GMK e;  4BAC A;  3OY9 A;  4C5E A;  4RMO A;  1TOV A;  1M1K R;  2DIQ A;  3EG9 A;  5CCA A;  2F1L A;  5GAM g;  1G3Y A;  2YLC A;  2YLB A;  4X9C A;  3CCE Q;  3M59 A;  4E2F B;  1QCN A;  2OTJ Q;  1JB0 E;  4WTO B;  3C94 A;  3P8D A;  3FRN A;  3HSB A;  5LJ5 f;  1YI2 Q;  2K4Y A;  1MNE A;  1NEG A;  3E2U A;  4M7A F;  4RCB A;  4PFP A;  1N9R A;  5GAN j;  1BCM A;  2DL8 A;  2DL4 A;  3DLM A;  2DRK A;  3VYG A;  1FMV A;  3VS7 A;  4KUL A;  3HFO A;  2ROT A;  1WQ7 A;  3MEU A;  3URG A;  1WHK A;  2R58 A;  3HHT B;  3CEY A;  3CCU T;  3QDR B;  3SWN B;  3A8M B;  3CME Q;  3H0H A;  3FJP A;  2EQK A;  4ZNX A;  1OZ2 A;  2M9U A;  3CCU A;  1TG0 A;  2KXD A;  3JB9 D;  1IHW A;  1VQ8 Q;  2HL3 A;  4JPB W;  1NPP A;  4M75 G;  4OMN A;  1ZSZ A;  1RAI B;  2LZ6 B;  3EG3 A;  1K73 C;  3HL8 A;  3CC4 T;  3M4G A;  4JJC A;  4KUD K;  3UF4 A;  3BE3 A;  1SF9 A;  2E6Z A;  1YWP A;  3CC4 A;  2D6F A;  2PZ1 A;  5CKH A;  4J6Y A;  3PNW C;  1GL5 A;  3CCJ T;  5GMK i;  3M4Y A;  4NOY A;  2M1H A;  1UE9 A;  2FRY A;  3CCJ A;  1RI9 A;  1I07 A;  4NS5 A;  2O2O A;  3EGD A;  4KGV B;  4EMK B;  3RKW A; 
#chains in the Genus database with same CATH homology
 1WHJ A;  3E2U A;  4B6M A;  2E3H A;  2QK0 A;  1TOV A;  1TXQ A;  2CP6 A;  2Z0W A;  3TQ7 P;  2CP3 A;  2COW A;  2CP5 A;  2HQH A;  2HKN A;  1WHL A;  1LPL A;  2CP0 A;  2E3I A;  2CP7 A;  2HKQ B;  2HL3 A;  1WHH A;  1IXD A;  2COY A;  1WHK A;  2MPX C;  2COZ A;  2HL5 C;  1WHG A;  3RDV A;  2CP2 A;  2E4H A;  1WHM A;  2M02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...