2CP0A

Solution structure of the 1st cap-gly domain in human clip-170-related protein clipr59
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
95
structure length
95
Chain Sequence
GSSGSSGGNLMLSALGLRLGDRVLLDGQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPKQGLFASVSKISKAVDASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLIPR-59 protein
publication title Solution structure of the 1st CAP-Gly domain in human CLIP-170-related protein CLIPR59
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 7
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cp0A00
3E2UA 2CP3A 2CP2A 1TXQA 2CP0A 2HKQB 2HL5C 3RDVA 1WHHA 1IXDA 2E3IA 2E3HA 1TOVA 2M02A 2HL3A 2COYA 1WHKA 2CP6A 2COZA 1WHMA 2QK0A 3TQ7P 1WHGA 4B6MA 2E4HA 2HQHA 2Z0WA 2HKNA 2CP7A 2COWA 1WHLA 2MPXC 1LPLA 2CP5A 1WHJA
chains in the Genus database with same CATH superfamily
1WDXA 2YRDA 4BI3A 1K8AR 4F04B 1RL2A 1I5LA 1H641 2EW3A 4IUVA 2E3IA 4MZPA 1YITQ 4LDWA 1OPLA 1XJWB 2LNHB 4M7AD 3L2ZA 3KFVA 2MK5A 1ABQA 2HKNA 2EBPA 1WPYA 1YWPA 1IHWA 1VQ6T 2JN0A 1RAGB 1V1CA 1VQ5A 3M0TA 4V2SA 3SEMA 2XDPA 2OI3A 1VOMA 3MJXA 4AFSC 2HSEB 6AT1B 3EG3A 1YJ9A 4AMCA 4C8QF 5GAMf 4X34A 3CCUQ 3VKIA 2D0NA 3EG9A 3A8LB 3WVDB 2DYIA 1DJ7B 5GAMj 3RKXA 4QW2A 1LCKA 2FL7A 1LVKA 2E6NA 2MWOA 4M75C 5A2QE 3CCLT 1PSFA 2FG0A 2EGAA 4AT1B 9ATCB 3MCAB 4M78C 1YHQT 2ZPGB 3LWIA 2VASA 2DBKA 3OY9A 4FYXB 3V7RA 3L2WA 1UJYA 4F14A 5CKDA 2CZ0B 3HL8A 2HBPA 2KRSA 1YITA 2HKQB 2JJ9A 3VS7A 5L8RE 2A0FB 1T0JA 5KYXA 1M2OA 3NFCA 3VS6A 1TUDA 4OP0A 4XTVA 1VUBA 1KJWA 2DTHA 2JW4A 3CCEQ 3X24B 2LX7A 2FRYA 4M7DG 2D6FA 2C0TA 5HKCA 4RTYA 3UA7A 2VGNA 2DZCA 3S6WA 2RQRA 1QVFA 1NE8A 4EMKB 5GAN2 4A4FA 4RTTA 1G3WA 4ELZC 4BUGA 3CC2T 4IUUA 4F7UE 1KC8R 4M7DD 2HQXA 3CCUA 1UTIA 4PJLA 4II1A 4PLLA 1QVFS 1BB9A 1UGPB 1BIBA 1I81A 1TH7A 2L2PA 1T3SA 4M7DB 4ANJA 4M77C 3MEAA 5GAOr 1W1FA 3G71Q 2LCLA 5LJ5e 3BFMA 5J26A 3EH1A 2L3QA 3I56T 3CMAT 5HY6A 1YCSB 2DJZA 2V8JA 2QDYB 2M16A 5IT9E 5KYWA 1PD0A 2CYZB 5KE2A 3BW1A 2E5KA 2P0KA 1VQNT 4OMNA 1C1AA 2FPEA 1WQWA 3M53A 2LQKA 1GRIA 3X26B 3CCMT 3M58A 1X2QA 3M0SA 1D0YA 4GLMA 4D8DA 2RHYA 4JJDA 3AHUA 1SHFA 3M54A 2P4TA 2X3XD 2E64A 3SD4A 2HQHA 2O9VA 4CI0C 1H3ZA 2D8HA 5AT1B 4KUIA 4WCIA 1PSEA 1I5OB 2ZAEA 3FJ5A 4Z89A 2KQWA 3JV3A 3CPWA 1AVZC 4C92E 1SEMA 3TEEA 1VQLT 5GAOq 2DAQA 2DM1A 4FL6A 1PG5B 3EGXA 4YTLA 3QDRB 1OI1A 2CKKA 4X9CA 4E7ZA 3G71A 1BU1A 3J7AF 4HCKA 5GAN6 3CCQT 3CPWS 4JRQA 3H0FA 2AHJB 2O88A 2C0IA 4RCCA 1RI9A 1AWOA 2WSFE 3R6OA 2EVRA 4CC3A 3OW2A 1M4ZA 2RMOA 4DBRA 3JCMc 1UUEA 2NYSA 3X20B 1AZGB 5CKEA 2QEXT 3TVTA 4OMPA 1RUWA 4C5GA 4L5GA 4M78F 3JAME 1PM3A 2CP7A 2KK4A 4BY6C 4F7UA 1WHJA 3OW2S 4DBQA 4DA4A 2XDDA 2DLPA 3PVLA 4HCZA 2QQBA 1Q7YC 4WF2A 5FW9A 1CSKA 4N4GA 3F70A 1Q82U 1NYGA 1K73C 2YDLA 3CPFA 3LGFA 3TSWA 4J9CA 2K3BA 1U8RA 2RI2A 4DBHA 1HSQA 2LRQA 4HVUA 3FDRA 5LJ5g 1ZSGA 3ULRB 1VQ4T 2DL7A 1EZZB 1D0XA 2KRMA 3OYNA 5IN1A 4B9WA 3VS4A 3NTIA 5FRMA 3EG0A 1SHGA 1MV3A 1YN8A 4J6YA 1ZSZA 2X4YA 1Q81C 5LJ3e 1AEYA 2DFUA 2DXUA 2ATCB 1KG1A 3A98A 4EMHA 3HRSA 1Q86R 1IGQA 3OQ5A 1FMKA 2BZYA 2QASA 1M90R 1WHLA 4Y28E 4AFUC 1KHIA 5I2SA 4PLIA 5D6WA 4JLGA 3V7CA 1TSFA 4XTXA 1QKWA 4JZ3A 1W6XA 5GMKj 1GCPA 1WHKA 3SFMA 1M1KU 2VWFA 1NJIR 4OB1B 3CMEQ 2COZA 2CZ6B 1VQ4A 5LJ5h 3QO3A 1YIJA 4JRIA 5FU7B 4QVCA 3MEVA 4VUBA 1WX6A 4C92A 2PVGB 2OX7A 2DXBA 3G4SQ 7AT1B 1WJSA 3QWXX 3VUBA 2M02A 4RCBA 2ZPHB 1N8RC 2K5LA 2YT6A 4KGZB 1QKXA 1JRIA 1VQ8T 4PJOD 4M4ZA 3JCMV 4ZTJA 1MV0B 3M4YA 3X28B 4BI8B 3OBWA 1M5Q1 1U06A 1PWTA 3OMCA 2EFIA 2OJ2A 5C0MA 1WXTA 3RR6A 5D7UA 3UA6A 5GMKi 2EYYA 3GPLA 2RJEA 1WZOA 2VGMA 2MOXA 4XTUA 4IUPA 3OYEA 2K5FA 1VQMT 2HCKA 2CP2A 1Y71A 2ZPFB 3CC7Q 4LDUA 5EC7A 3CC4T 1CKBA 1IXDA 3CMEA 1SKUB 4R56A 3SHWA 3X25B 5GMKm 4CRIA 3QHSA 1I1JA 4IURA 4O6JA 3OYAA 2LNVA 2E4HA 2FEIA 2QGGA 1TS9A 1NG2A 3HRUA 3G4SA 2QI2A 2G6FX 4BI4A 3C4SA 1WXBA 2BE9B 4MDWA 4FYWB 2QGFB 2JVVA 2EKHA 4M77E 4RTXA 4XTZA 2WSEE 2JM9A 1N27A 3BY7A 2EAYA 2CZ7B 3HTRA 1ACMB 1D1CA 2YHTA 5LJ3g 3WXMB 1HD3A 5CO7A 1XNIA 4Z8AA 5IHNA 4XAXB 2K57A 1PRLC 3DLLA 4ORZA 2RJDA 1TUCA 5DM7R 3REAB 4DEXA 2XMFA 1AHJB 4ZNXA 1ARKA 1QVGS 4D8KA 2LT1A 1TUGB 2LQWA 2KDSA 2L3SA 3JCMd 2EQMA 1S72T 2XI9A 3CC7A 2VV5A 3FRNA 2B8AA 2EYQA 3ASKA 3PFSA 5LJ3h 1NBEB 2DF6A 4E7JA 2BZXA 2RPNA 4A4EA 3FJPA 3L2RA 4PJOE 2ECZA 3RMQA 1D09B 1YBYA 2FZGB 2FPDA 1X6GA 5HK3A 1KC8C 3E9FA 1RADB 1VYUA 4LE9A 3BDUA 5IHIA 1QWFA 3CBMA 4RKUE 2J6OA 3OB9A 2LX9A 3FLGA 4OGEA 1YJWT 1KIKA 5GANj 2E70A 2DZ9A 4FW1A 3PMTA 4J7IA 2YXYA 2HQEA 1VYTA 2EGCA 2QQSA 2X4WA 3INZA 2M0OA 3CCVT 3H0HA 3ME9A 2AKLA 4J5YA 3OYMA 5IXFA 4KGXB 2LC4A 1OU9A 3NTHA 2E12A 3QWYA 4PJJA 3JCMf 4LDYA 1GCQA 4RTUA 2QA4Q 4WTOB 4ME7A 3OSVA 3MPUB 1OV3A 1QCFA 2XD0A 1UGVA 3EGXB 2V8KA 4M77A 2DX1A 1BI3A 4F7UG 4NS5A 4QT7A 4ZGJB 3SWNB 4EMKC 1ZLMA 4Y91A 3JCMW 2RO0A 3S3OA 1TXQA 1SRMA 3NGPA 5GAMd 3CCRT 2ZCFB 3P8DA 4IUTA 5J39A 2D9TA 1WJQA 2GTOA 1NPRA 2DTOA 3VYHB 2EYXA 3JRZA 1VQ6Q 2QG9B 1SG5A 3M0PA 1R77A 4F17A 4M7DC 1KSWA 2COWA 2FB7A 1LPLA 4HKEA 1JEGA 4F7UB 3I55A 2KGTA 1IHVA 1NEBA 4N0AC 4KH1B 4QKUA 2K2MA 3OS1A 1W2BA 1QVGP 4C0FA 5KCHA 2DXCA 3ZEHA 1FYNA 4XU1A 4KGVB 1RI0A 2MMPA 2PVDB 4JZ4A 1V29B 2FVUA 1VQOT 1NLPC 2DD5A 2GNCA 4DOVA 3OBYA 3VJPA 2GBQA 4M7AB 1W2BS 4C0ZA 2HAXA 2R5AA 3V8JA 2YSQA 2QA4A 3RERA 3GIBA 4BDYA 2EIFA 4PJOA 4HT9A 3HPWA 4C0DB 3CCLQ 4KRTA 2FZKB 3BDLA 2E10A 2RH2A 2DKGA 1ZSZB 3M55A 2LDMA 4C92G 5I22A 1J3TA 2JT4A 2CH4A 1JJ2P 1G2BA 2PTKA 3MHXA 4M7AF 2CP3A 1QCOA 2DL3A 2HL5C 4C5HA 4MDXA 4JLIA 3JB9H 3FIFA 1UB4A 1TTHB 3SDZA 3C12A 3R6NA 2DD4A 1VQ6A 4C92D 4J9DA 2RHZA 3RUXA 2I2LA 3DB3A 1BI1A 3TCJA 4OB0B 4XQ3A 1D3BA 3A8MB 2IVWA 1R0CB 2RM4A 3O8VA 2K79A 1W70A 3ZFJA 4E7LA 2O2OA 2V1RA 3PE0A 4C92B 4DQ2A 3CC2Q 1OU8A 2DERA 1PKSA 5GAOm 3LYIA 3VS2A 2DJQA 1Q86C 1M90C 2DNUA 2GGRA 3NMZC 2GFUA 1JXMA 4AFZC 3QBYA 1AWXA 4PKCC 1OPKA 2DBMA 2IPOB 1Q82R 4HCBA 1RLPC 1UG1A 2ABLA 3J81E 3CXCA 1NJIC 3I56Q 3CCLA 5CKFA 2PU9B 3CMAQ 1YNZA 3OYJA 1VQPT 4KULA 1YHQA 2H3JA 2F5TX 2OTJT 4DEYA 2E6ZA 1WHMA 2DETA 1YP5A 1VQNQ 4XU3A 1D0ZA 1GBRA 3OMGA 1K9MU 3G7ZA 1ZBJA 4PFZA 3CCMQ 3CXCS 4AG2C 2RB6A 4HXJA 4UC4A 3L2VA 2DL4A 2RA2A 3MEWA 3PGGA 2KY9A 4FT2A 2KYMA 4HCCA 5GAN4 3CCET 4OB3B 1G83A 4C8QE 3CC2A 1K1ZA 2L3RA 2CH4W 1ZHIA 2FO0A 4Q5WA 4M7DF 2OTJA 2F2WA 3CCJT 4L6V5 3OYLA 1WGSA 1WHHA 2M9UA 3CBOA 1VQLQ 3ZBDA 4EMGA 2XG8D 4RUGA 4XU2A 3MP6A 2LQ8A 2VKNA 3H0IA 2GTJA 3MP1A 2ZGWA 3CCQQ 1KD1U 2YUQA 5FU7C 3OYGA 3I56A 2VC8A 2BZ8A 4N4IA 2A28A 3CMAA 2LCCA 2QTVA 2D0QB 4M75G 4FSXA 2XHCA 5GAN7 2GCXA 1FWZA 2E3HA 1VQNA 1X6OA 2QEXQ 3CCMA 2P84A 3PIPA 2LCSA 2AKKA 3UPUA 3CCJA 1YI2T 4E47A 3RMSA 4QVDA 1PCXA 3P8BB 4M75D 3A5ZB 3M56A 3GNFB 3OSSC 2A36A 2RF0A 1YJNT 1UGSB 2QAZA 1OULA 2DIQA 2K2VA 4IUQA 1K76A 2MAMA 1TOVA 3QPHA 8ATCB 3UATA 4L59A 2OAUA 2WACA 3UWNA 4MZMA 1N9RA 1U1SA 5FROA 3V7SA 3G6ET 1I0CA 1VQ4Q 2P0PA 1AOJA 4J9GA 1VQLA 1YIJQ 2CP0A 2CS7A 2SEMA 4LXCA 3A8HB 3CCQA 4M77G 1QVFP 2A08A 3QYHB 4FM4B 1RAEB 1N6AA 2HMAA 4XTWA 4GBQA 8AT1B 4OMOA 3E2UA 4F16A 1NZ9A 2V1QA 1ZA1B 4QQGA 4NOYA 2QEXA 3PMIA 4M77D 3RNJA 3A8OB 1B34A 2CUDA 4C8QA 2VXFA 1M1GA 1WJRA 4BE0A 2K4YA 1KQ1A 3TSZA 1UECA 3RBBB 1NLOC 2QQAA 2JM8A 1PRMC 3LH0A 5GAN5 5CAIA 3LW5E 5KCOA 5LJ5j 3L2QA 2EQUA 2K3YA 1E7OA 3QZ5B 1WI7A 3M4GA 1JBMA 4LD9K 1LJOA 3H9NA 2HDAA 2ESWA 4K11A 3VRZA 1JQQA 2HSPA 4BE2A 1AT1B 3CCST 1UE9A 2GF7A 4B6MA 2DIGA 1VQ8Q 4PL6A 2V8IA 2MYSA 1OZ2A 4LN2A 3A1PA 1O75A 1EFNA 4JRPA 4J9IA 3VU3C 1ABOA 4PJOG 3DB4A 1WXUA 2CT3A 3C94A 1M8VA 1QCNA 2NLUA 1OYXA 1V76A 5ECAA 1TG0A 2K7AA 5CIUA 4LNPA 2K3XA 3MO8A 3RESA 4M75E 1RACB 4LUDA 4CC2A 3OYKA 3PVQA 2KSSA 2E1HA 3BE3A 1VQMQ 3U23A 4M78E 1W4SA 3CPWP 2AT1B 1RABB 2OTLT 2YRCA 4N4HA 1VQKT 3CC4Q 3GBQA 5GAOn 1Z9QA 3JCMQ 1CKAA 1XOVA 1D1AA 4A4HA 2YLCA 2G3RA 3O5ZA 4PJOB 4OMLA 1R8OB 2X4JA 5KYUA 2RD1A 2RNAA 5L23A 4NL2A 4EMKA 2AIRB 1K8AC 2EGEA 4O5VA 5CCAA 1RAAB 3LX7A 2YUPA 1D1BA 5EG2A 3EG2A 3EG9B 3OW2P 2DVJA 5CKHA 1QQJA 2CZ1B 1TWBA 2H3EB 2LP5A 2JMCA 2X3WD 1VQ8A 2F1LA 2CGHA 1IB8A 1NYFA 2OTLA 4JS5A 1VQKA 1QWEA 1KQSA 2YRVA 3PNWC 1VIEA 1UGRB 3JCMe 1ZQ1A 3SWNC 2JXBA 3NTKA 1D3BB 3QSUA 2A37A 4IKFA 2EYWA 1AWWA 4J9FA 5M9OA 1YWOA 1B07A 1SSFA 2J05A 1KQSS 1FMWA 5GANd 5KYXB 4OF1A 4LDXA 2RJCA 2ROTA 1K0SA 2PUOB 5CQYA 3V8KA 3QIIA 1VQMA 2EPDA 1S72Q 2RI3A 1VQ9T 1Y57A 3CC4A 2J7IA 5FRNA 3VS3A 3RDVA 1HXDA 3RIRA 1G5VA 4AFQC 2KVQG 1X2KA 2XICA 3J80E 2XK0A 1M2VA 2L8DA 5LJ3j 3FC3A 3OYBA 2M51A 3A8GB 1E6HA 2KXDA 4X1VA 1UHCA 2EQKA 3E9GA 2P4RA 4M7AC 1X43A 1MNDA 4PK4A 1YJWQ 2KXCA 1VQ7T 3EGDA 4E7HA 4M75A 5KYYA 1HK9A 2MF2A 5HK0A 4C0DC 2E41A 2XU8A 4RTWA 4C5IA 3OYIA 1ZA2B 4M78A 3OYFA 4FYVB 3CCVQ 5KYWB 4HVVA 1ZSZC 5GANf 2KYBA 2CSIA 1WYXA 4MZTA 2EQJA 2BE7D 2BUDA 3PT9A 2KROA 4P5NA 5GAMe 3JB9G 1EIFA 3I55Q 4J7FA 2RQUA 1U3OA 1S72A 2VYTA 1B7TA 3LH5A 1UJ0A 1Y7XA 4E7SA 1A0NB 3CQTA 1WNLA 2SRCA 4J6XA 2DMOA 1HYOA 3JB9D 1G3YA 4C92C 3CCRQ 5FU6B 2R5MA 2KRNA 3GNGA 4A63B 5CK9A 5IHKA 1FMVA 5GAN8 5HCKA 3ER0A 2KEAA 3JCMg 1RAFB 1M3CA 4OMMA 1YJWA 2JTFA 3OS0A 3REBB 4J8OA 3CD6T 2NUTA 3JCMb 4IIOA 1E6GA 2V26A 1K9MR 3SB2A 2L0AA 4PJNA 4E7KA 1I4K1 3CCVA 4FT4A 5CVIA 1VQOQ 1PKTA 3EFOA 2LTOA 3JCMX 3L1AA 3VRYA 2J6FA 3H41A 4C8QG 3D7SB 5CQXA 4C0GA 5GMKl 2A3LA 1VQ5T 4Z02A 3JCMh 2E5QA 2WSCE 4JRKA 5IAYA 1PC0A 1UFFA 5KE3A 4X9DA 3C95A 1ZUUA 3S3MA 2HD0A 5FWBA 5D6XA 1YJ9T 5CKBA 2DK3A 1M1FA 3CCRA 4C8QD 3M0RA 4XU0A 2O4XA 3VUZA 4R0KA 1WIEA 1NPPA 4F7UF 2KE9A 2OAWA 2X9HA 2MCNA 1KD1R 3EFRA 3UDCA 2COYA 1B34B 2JMAA 4C8QB 2DYBA 1M3BA 2YLBA 3Q1JA 4RG8A 1YHQQ 2RHUA 2RHIA 3N5BB 1IGUA 2DILA 1OEBA 1KQ2A 3I35A 2LJ0A 4ELYC 3M0QA 4PFPA 1MMGA 1BKBA 4Y92A 5GAMg 4CC7A 2W10A 1Q7YU 4KBMB 2IG0A 1VQOA 4FU6A 3QJYA 5GJWB 1K73U 1AZEA 1YITT 4JJCA 3OYYA 2HNIA 2QK0A 2VUBA 4RTVA 1M27C 3CEYA 3HFOA 4J9EA 3PTAA 4QQ6A 1G3SA 1X75C 3H8ZA 5GAOp 2RK2A 4OGCA 2O01E 4QVZA 1VQPQ 2A7YA 1X01A 4FIBA 4DOWA 2OTJQ 4Z88A 3TU4K 2L89A 3THKA 5AYFA 1JO8A 2RN8A 2RJFA 4RMOA 1Q81U 3LWHA 2F2VA 2KT1A 3EHQA 2RQWA 1H3HA 3CCUT 2X35A 4JPBW 5GAMh 2YUOA 2RQVA 2HL3A 1R0BG 5A0LA 1P92A 1BI2A 4KT0E 4OB2B 3L42A 3HP9A 2JOYA 2Y4YA 4C92F 2FPFA 1HJDA 2W0ZA 4IIMA 2H8HA 5C6SA 1C6VX 2FHDA 2KI7A 5KYNA 2F2XA 3P8HA 2Z0WA 3KUFA 5KYUB 2EJFA 1T3LA 2NUPA 1QVPA 2VXEA 3CCJQ 1SPKA 4HA8A 4EIKA 1MMAA 4J9BA 5I11A 2DXTA 2LJ1A 1N8RU 1Y96A 1UGQB 3I9QA 4A4GA 1GCQC 1UDLA 2L5QA 3JB9J 1FX7A 1QP3A 1BYMA 1I07A 2DEQA 3TQ7P 3VS5A 5GAN3 2DA9A 1VQPA 4ZTFA 1W2BP 5CR2A 3C0CA 2ED0A 1M1KR 5I2MA 4M7AE 5A0DA 2J06A 4FYYB 2C06A 3UT1A 2AK5A 1NM7A 2CUBA 1WFWA 1BCOA 1QP2A 5GMKe 3META 1YI2Q 4KUDK 1TU0B 1K8AU 1H8KA 4D6WA 1MUZA 1QMCA 2K9GA 1AWJA 1Q95G 1ZUKA 1M3AA 2DO3A 1N9SA 2GQVA 1OOTA 4BDZA 1YJNQ 2DL8A 1IREB 2JTMA 1KFZA 3G71T 1XQHA 3CCEA 1XTDA 3GP8A 1SF9A 1PD1A 2X4XA 4J83A 4M78G 1MHNA 3HFNA 4ATOA 1M2VB 4JS4A 3EG1A 3G6EQ 2NUZA 3EH2A 5A0GA 1Y0MA 4JDSA 2DVEA 1JB0E 2EWNA 1F1BB 1IRXA 2QDLA 4E2FB 1GL5A 5LJ5d 1BK2A 5DLQE 5I21A 4M78D 3I5RA 4LD6A 3EGDB 4BD3A 2RI5A 4M75B 5KYYB 4PJOC 3S3NA 2DE0X 1QLYA 4M78B 3SWNA 1MGQA 4KH0B 5J3BA 4FW2A 2J6KA 2P0QA 1OZ3A 3DLMA 1I8FA 1VA7A 5IH2A 4JJNK 1RAIB 2MIOA 3M0UA 4XTYA 2JS0A 1NEGA 4FCYA 1YI2A 3LLRA 4HT8A 2XKOC 3FB9A 4M75F 3UF4A 2D1XA 2RHXA 1GBQA 1YJNA 3CXCP 2DRMA 3ZL7C 3HSBA 2KAFA 4M7DE 2QQRA 2PVOB 5FWCA 5GAOl 1ZBXA 2JUFA 3JSCA 1O9SA 1GXIE 3CCSQ 3EFSA 2KR3A 3G6EA 5LJ5f 2M1HA 3OYHA 1WHGA 4BB7A 5DY9A 2ED1A 4M7AA 1KC8U 3OYDA 1QW1A 2BKDN 3OYCA 4M77B 2GQIA 2L3PA 1FXXA 3RKWA 1U5SA 2PQWA 1KK7A 2Y90A 1YIJT 1H92A 3QDFA 2HBWA 1G3TA 2XDBA 2NUTB 2ZPIB 1VIFA 2CP6A 2FYKA 2R58A 1RLQC 3URGA 3VV0A 2OTLQ 2LQNA 2PZ1A 3EFOB 4M77F 1OX8A 3E19A 4OMQA 1VQKQ 2B86A 2IIMA 3HKSA 2JZ2A 3QJ6A 3FEOA 4R55A 2I0NA 2JS2A 3NPFA 2YWWA 2LMJA 5LL6S 1ZX6A 2ENMA 4J6WA 1K9MC 1K4US 4XK8E 4BACA 3V8LA 2VB6A 2LZ6B 1JXOA 2ZPBB 5GMKh 2NWMA 2C0OA 2KNBB 3CCSA 3IQLA 2O4XB 3NHNA 3I5SA 1MMNA 4RG2A 5GANe 2CSQA 3MEUA 2EJGA 2PUKB 4ZN3A 3HRTA 5GJVB 1S1NA 1WA7A 2EYZA 2LT4A 5LJ3d 1YCYA 2O31A 3CMET 1C0MA 2EQIA 4ZGDB 3QG1A 4NL3A 3JCMJ 2XIDA 2QXFA 3RKYA 3G4ST 4RTZA 5FU6C 1WLPB 2X51A 3MP8A 2FRWA 2FZCB 3QYGB 2D8JA 1WQ7A 1T0HA 1Y07A 4PJOF 1VYVA 1N5ZA 1VQ9Q 4CC4B 1PNJA 3KBGA 2DRKA 4M7DA 2DPPB 1KD1C 4BY6B 1X69A 3QUIA 1AD5A 3M59A 4N0AA 4E7IA 4OMFB 4HVWA 1K9AA 3QKJA 4DBFA 4ZGEB 2K6DA 4QQDA 3VYGA 1UHFA 1X27A 3LGLA 3JB9I 4PNOA 3E1SA 2E65A 2RQTA 2M0YA 4LUEA 1RAHB 4AG1C 2LVMA 3OA6A 4GY5A 4PJMA 3QZ9B 1VQ7Q 5LJ3f 1M30A 1BI0A 2RK1A 4EDUA 2HZYA 3PIOA 3CC7T 2JTEA 1Z9ZA 1JU5C 4PFOA 2O9SA 1QVGA 1IO6A 2Y4XA 2CREA 3MKDA 1SRLA 4ESRA 3VS0A 2ZPEB 2MI6A 4A4KA 4LDVA 1PHTA 2F69A 2NUPB 2CT4A 2ROLA 2PNIA 5DLOA 3AT1B 1Q86U 2QTXA 1M90U 1MMDA 3EAEA 1VQ9A 1Y96B 2CDTA 4BE1A 4C8QC 3QXEB 4E6RA 5FLXE 1Q82C 3M9QA 1Q7YR 2HEQA 4C5EA 2MWPA 3GOXA 1K73R 1NJIU 3T9NA 1JJ2A 5GANg 2KBTA 3KXTA 2KMTA 4ZN1A 3OS2A 1GFDA 1YFNA 2LJ3A 2K5IA 1BBZA 1VQ7A 4B9XA 1JJ2S 1IZ6A 2CP5A 2KT8A 4EPCA 3CD6Q 3TREA 1Q81R 3M57A 3G1JA 2QYZA 3M5AA 1G8XA 1KHCA 3CBPA 2BTTA 3GF5A 1B3QA 3GLXA 4A54A 1M1KC 1LNXA 3DKMA 5KH6A 1EX4A 3OS5A 4MMLA 5D6YA 1UEBA 2GFAA 2AZSA 3L2UA 5GANh 1BIAA 1ZUYA 3EGUA 1BCMA 4GLKA 3VS1A 2BIVA 2EJ9A 1GFCA 4TVRA 1OQKA 3H6ZA 4OVAA 1VQ5Q 2JNGA 1M8MA 1KQSP 2R57A 1LOJA 1SSHA 4MMKA 2DEUA 3I55T 1U1TA 2EKOA 1K0XA 2QQ9A 1M9SA 3JB9F 1YJ9Q 1N8RR 3WVEB 4A53A 2AZVA 4J9HA 2YUNA 2DL5A 5IXBA 1MNEA 1X6BA 4JJBA 4FSSA 3EHRA 2QA4T 1OX9A 3HHTB 4JUVA 4M7AG 2F5KA 3JCMP 2VVKA 3CD6A 2ZZDA 2DTIA 2MPXC
chains in the Genus database with same CATH topology
3E2UA 2CP3A 2CP2A 1TXQA 2CP0A 2HKQB 2HL5C 3RDVA 1WHHA 1IXDA 2E3IA 2E3HA 1TOVA 2M02A 2HL3A 2COYA 1WHKA 2CP6A 2COZA 1WHMA 2QK0A 3TQ7P 1WHGA 4B6MA 2E4HA 2HQHA 2Z0WA 2HKNA 2CP7A 2COWA 1WHLA 2MPXC 1LPLA 2CP5A 1WHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E2U A;  2CP3 A;  2CP2 A;  1TXQ A;  2CP0 A;  2HKQ B;  2HL5 C;  3RDV A;  1WHH A;  1IXD A;  2E3I A;  2E3H A;  1TOV A;  2M02 A;  2HL3 A;  2COY A;  1WHK A;  2CP6 A;  2COZ A;  1WHM A;  2QK0 A;  3TQ7 P;  1WHG A;  4B6M A;  2E4H A;  2HQH A;  2Z0W A;  2HKN A;  2CP7 A;  2COW A;  1WHL A;  2MPX C;  1LPL A;  2CP5 A;  1WHJ A; 
#chains in the Genus database with same CATH topology
 1WDX A;  2YRD A;  4BI3 A;  1K8A R;  4F04 B;  1RL2 A;  1I5L A;  1H64 1;  2EW3 A;  4IUV A;  2E3I A;  4MZP A;  1YIT Q;  4LDW A;  1OPL A;  1XJW B;  2LNH B;  4M7A D;  3L2Z A;  3KFV A;  2MK5 A;  1ABQ A;  2HKN A;  2EBP A;  1WPY A;  1YWP A;  1IHW A;  1VQ6 T;  2JN0 A;  1RAG B;  1V1C A;  1VQ5 A;  3M0T A;  4V2S A;  3SEM A;  2XDP A;  2OI3 A;  1VOM A;  3MJX A;  4AFS C;  2HSE B;  6AT1 B;  3EG3 A;  1YJ9 A;  4AMC A;  4C8Q F;  5GAM f;  4X34 A;  3CCU Q;  3VKI A;  2D0N A;  3EG9 A;  3A8L B;  3WVD B;  2DYI A;  1DJ7 B;  5GAM j;  3RKX A;  4QW2 A;  1LCK A;  2FL7 A;  1LVK A;  2E6N A;  2MWO A;  4M75 C;  5A2Q E;  3CCL T;  1PSF A;  2FG0 A;  2EGA A;  4AT1 B;  9ATC B;  3MCA B;  4M78 C;  1YHQ T;  2ZPG B;  3LWI A;  2VAS A;  2DBK A;  3OY9 A;  4FYX B;  3V7R A;  3L2W A;  1UJY A;  4F14 A;  5CKD A;  2CZ0 B;  3HL8 A;  2HBP A;  2KRS A;  1YIT A;  2HKQ B;  2JJ9 A;  3VS7 A;  5L8R E;  2A0F B;  1T0J A;  5KYX A;  1M2O A;  3NFC A;  3VS6 A;  1TUD A;  4OP0 A;  4XTV A;  1VUB A;  1KJW A;  2DTH A;  2JW4 A;  3CCE Q;  3X24 B;  2LX7 A;  2FRY A;  4M7D G;  2D6F A;  2C0T A;  5HKC A;  4RTY A;  3UA7 A;  2VGN A;  2DZC A;  3S6W A;  2RQR A;  1QVF A;  1NE8 A;  4EMK B;  5GAN 2;  4A4F A;  4RTT A;  1G3W A;  4ELZ C;  4BUG A;  3CC2 T;  4IUU A;  4F7U E;  1KC8 R;  4M7D D;  2HQX A;  3CCU A;  1UTI A;  4PJL A;  4II1 A;  4PLL A;  1QVF S;  1BB9 A;  1UGP B;  1BIB A;  1I81 A;  1TH7 A;  2L2P A;  1T3S A;  4M7D B;  4ANJ A;  4M77 C;  3MEA A;  5GAO r;  1W1F A;  3G71 Q;  2LCL A;  5LJ5 e;  3BFM A;  5J26 A;  3EH1 A;  2L3Q A;  3I56 T;  3CMA T;  5HY6 A;  1YCS B;  2DJZ A;  2V8J A;  2QDY B;  2M16 A;  5IT9 E;  5KYW A;  1PD0 A;  2CYZ B;  5KE2 A;  3BW1 A;  2E5K A;  2P0K A;  1VQN T;  4OMN A;  1C1A A;  2FPE A;  1WQW A;  3M53 A;  2LQK A;  1GRI A;  3X26 B;  3CCM T;  3M58 A;  1X2Q A;  3M0S A;  1D0Y A;  4GLM A;  4D8D A;  2RHY A;  4JJD A;  3AHU A;  1SHF A;  3M54 A;  2P4T A;  2X3X D;  2E64 A;  3SD4 A;  2HQH A;  2O9V A;  4CI0 C;  1H3Z A;  2D8H A;  5AT1 B;  4KUI A;  4WCI A;  1PSE A;  1I5O B;  2ZAE A;  3FJ5 A;  4Z89 A;  2KQW A;  3JV3 A;  3CPW A;  1AVZ C;  4C92 E;  1SEM A;  3TEE A;  1VQL T;  5GAO q;  2DAQ A;  2DM1 A;  4FL6 A;  1PG5 B;  3EGX A;  4YTL A;  3QDR B;  1OI1 A;  2CKK A;  4X9C A;  4E7Z A;  3G71 A;  1BU1 A;  3J7A F;  4HCK A;  5GAN 6;  3CCQ T;  3CPW S;  4JRQ A;  3H0F A;  2AHJ B;  2O88 A;  2C0I A;  4RCC A;  1RI9 A;  1AWO A;  2WSF E;  3R6O A;  2EVR A;  4CC3 A;  3OW2 A;  1M4Z A;  2RMO A;  4DBR A;  3JCM c;  1UUE A;  2NYS A;  3X20 B;  1AZG B;  5CKE A;  2QEX T;  3TVT A;  4OMP A;  1RUW A;  4C5G A;  4L5G A;  4M78 F;  3JAM E;  1PM3 A;  2CP7 A;  2KK4 A;  4BY6 C;  4F7U A;  1WHJ A;  3OW2 S;  4DBQ A;  4DA4 A;  2XDD A;  2DLP A;  3PVL A;  4HCZ A;  2QQB A;  1Q7Y C;  4WF2 A;  5FW9 A;  1CSK A;  4N4G A;  3F70 A;  1Q82 U;  1NYG A;  1K73 C;  2YDL A;  3CPF A;  3LGF A;  3TSW A;  4J9C A;  2K3B A;  1U8R A;  2RI2 A;  4DBH A;  1HSQ A;  2LRQ A;  4HVU A;  3FDR A;  5LJ5 g;  1ZSG A;  3ULR B;  1VQ4 T;  2DL7 A;  1EZZ B;  1D0X A;  2KRM A;  3OYN A;  5IN1 A;  4B9W A;  3VS4 A;  3NTI A;  5FRM A;  3EG0 A;  1SHG A;  1MV3 A;  1YN8 A;  4J6Y A;  1ZSZ A;  2X4Y A;  1Q81 C;  5LJ3 e;  1AEY A;  2DFU A;  2DXU A;  2ATC B;  1KG1 A;  3A98 A;  4EMH A;  3HRS A;  1Q86 R;  1IGQ A;  3OQ5 A;  1FMK A;  2BZY A;  2QAS A;  1M90 R;  1WHL A;  4Y28 E;  4AFU C;  1KHI A;  5I2S A;  4PLI A;  5D6W A;  4JLG A;  3V7C A;  1TSF A;  4XTX A;  1QKW A;  4JZ3 A;  1W6X A;  5GMK j;  1GCP A;  1WHK A;  3SFM A;  1M1K U;  2VWF A;  1NJI R;  4OB1 B;  3CME Q;  2COZ A;  2CZ6 B;  1VQ4 A;  5LJ5 h;  3QO3 A;  1YIJ A;  4JRI A;  5FU7 B;  4QVC A;  3MEV A;  4VUB A;  1WX6 A;  4C92 A;  2PVG B;  2OX7 A;  2DXB A;  3G4S Q;  7AT1 B;  1WJS A;  3QWX X;  3VUB A;  2M02 A;  4RCB A;  2ZPH B;  1N8R C;  2K5L A;  2YT6 A;  4KGZ B;  1QKX A;  1JRI A;  1VQ8 T;  4PJO D;  4M4Z A;  3JCM V;  4ZTJ A;  1MV0 B;  3M4Y A;  3X28 B;  4BI8 B;  3OBW A;  1M5Q 1;  1U06 A;  1PWT A;  3OMC A;  2EFI A;  2OJ2 A;  5C0M A;  1WXT A;  3RR6 A;  5D7U A;  3UA6 A;  5GMK i;  2EYY A;  3GPL A;  2RJE A;  1WZO A;  2VGM A;  2MOX A;  4XTU A;  4IUP A;  3OYE A;  2K5F A;  1VQM T;  2HCK A;  2CP2 A;  1Y71 A;  2ZPF B;  3CC7 Q;  4LDU A;  5EC7 A;  3CC4 T;  1CKB A;  1IXD A;  3CME A;  1SKU B;  4R56 A;  3SHW A;  3X25 B;  5GMK m;  4CRI A;  3QHS A;  1I1J A;  4IUR A;  4O6J A;  3OYA A;  2LNV A;  2E4H A;  2FEI A;  2QGG A;  1TS9 A;  1NG2 A;  3HRU A;  3G4S A;  2QI2 A;  2G6F X;  4BI4 A;  3C4S A;  1WXB A;  2BE9 B;  4MDW A;  4FYW B;  2QGF B;  2JVV A;  2EKH A;  4M77 E;  4RTX A;  4XTZ A;  2WSE E;  2JM9 A;  1N27 A;  3BY7 A;  2EAY A;  2CZ7 B;  3HTR A;  1ACM B;  1D1C A;  2YHT A;  5LJ3 g;  3WXM B;  1HD3 A;  5CO7 A;  1XNI A;  4Z8A A;  5IHN A;  4XAX B;  2K57 A;  1PRL C;  3DLL A;  4ORZ A;  2RJD A;  1TUC A;  5DM7 R;  3REA B;  4DEX A;  2XMF A;  1AHJ B;  4ZNX A;  1ARK A;  1QVG S;  4D8K A;  2LT1 A;  1TUG B;  2LQW A;  2KDS A;  2L3S A;  3JCM d;  2EQM A;  1S72 T;  2XI9 A;  3CC7 A;  2VV5 A;  3FRN A;  2B8A A;  2EYQ A;  3ASK A;  3PFS A;  5LJ3 h;  1NBE B;  2DF6 A;  4E7J A;  2BZX A;  2RPN A;  4A4E A;  3FJP A;  3L2R A;  4PJO E;  2ECZ A;  3RMQ A;  1D09 B;  1YBY A;  2FZG B;  2FPD A;  1X6G A;  5HK3 A;  1KC8 C;  3E9F A;  1RAD B;  1VYU A;  4LE9 A;  3BDU A;  5IHI A;  1QWF A;  3CBM A;  4RKU E;  2J6O A;  3OB9 A;  2LX9 A;  3FLG A;  4OGE A;  1YJW T;  1KIK A;  5GAN j;  2E70 A;  2DZ9 A;  4FW1 A;  3PMT A;  4J7I A;  2YXY A;  2HQE A;  1VYT A;  2EGC A;  2QQS A;  2X4W A;  3INZ A;  2M0O A;  3CCV T;  3H0H A;  3ME9 A;  2AKL A;  4J5Y A;  3OYM A;  5IXF A;  4KGX B;  2LC4 A;  1OU9 A;  3NTH A;  2E12 A;  3QWY A;  4PJJ A;  3JCM f;  4LDY A;  1GCQ A;  4RTU A;  2QA4 Q;  4WTO B;  4ME7 A;  3OSV A;  3MPU B;  1OV3 A;  1QCF A;  2XD0 A;  1UGV A;  3EGX B;  2V8K A;  4M77 A;  2DX1 A;  1BI3 A;  4F7U G;  4NS5 A;  4QT7 A;  4ZGJ B;  3SWN B;  4EMK C;  1ZLM A;  4Y91 A;  3JCM W;  2RO0 A;  3S3O A;  1TXQ A;  1SRM A;  3NGP A;  5GAM d;  3CCR T;  2ZCF B;  3P8D A;  4IUT A;  5J39 A;  2D9T A;  1WJQ A;  2GTO A;  1NPR A;  2DTO A;  3VYH B;  2EYX A;  3JRZ A;  1VQ6 Q;  2QG9 B;  1SG5 A;  3M0P A;  1R77 A;  4F17 A;  4M7D C;  1KSW A;  2COW A;  2FB7 A;  1LPL A;  4HKE A;  1JEG A;  4F7U B;  3I55 A;  2KGT A;  1IHV A;  1NEB A;  4N0A C;  4KH1 B;  4QKU A;  2K2M A;  3OS1 A;  1W2B A;  1QVG P;  4C0F A;  5KCH A;  2DXC A;  3ZEH A;  1FYN A;  4XU1 A;  4KGV B;  1RI0 A;  2MMP A;  2PVD B;  4JZ4 A;  1V29 B;  2FVU A;  1VQO T;  1NLP C;  2DD5 A;  2GNC A;  4DOV A;  3OBY A;  3VJP A;  2GBQ A;  4M7A B;  1W2B S;  4C0Z A;  2HAX A;  2R5A A;  3V8J A;  2YSQ A;  2QA4 A;  3RER A;  3GIB A;  4BDY A;  2EIF A;  4PJO A;  4HT9 A;  3HPW A;  4C0D B;  3CCL Q;  4KRT A;  2FZK B;  3BDL A;  2E10 A;  2RH2 A;  2DKG A;  1ZSZ B;  3M55 A;  2LDM A;  4C92 G;  5I22 A;  1J3T A;  2JT4 A;  2CH4 A;  1JJ2 P;  1G2B A;  2PTK A;  3MHX A;  4M7A F;  2CP3 A;  1QCO A;  2DL3 A;  2HL5 C;  4C5H A;  4MDX A;  4JLI A;  3JB9 H;  3FIF A;  1UB4 A;  1TTH B;  3SDZ A;  3C12 A;  3R6N A;  2DD4 A;  1VQ6 A;  4C92 D;  4J9D A;  2RHZ A;  3RUX A;  2I2L A;  3DB3 A;  1BI1 A;  3TCJ A;  4OB0 B;  4XQ3 A;  1D3B A;  3A8M B;  2IVW A;  1R0C B;  2RM4 A;  3O8V A;  2K79 A;  1W70 A;  3ZFJ A;  4E7L A;  2O2O A;  2V1R A;  3PE0 A;  4C92 B;  4DQ2 A;  3CC2 Q;  1OU8 A;  2DER A;  1PKS A;  5GAO m;  3LYI A;  3VS2 A;  2DJQ A;  1Q86 C;  1M90 C;  2DNU A;  2GGR A;  3NMZ C;  2GFU A;  1JXM A;  4AFZ C;  3QBY A;  1AWX A;  4PKC C;  1OPK A;  2DBM A;  2IPO B;  1Q82 R;  4HCB A;  1RLP C;  1UG1 A;  2ABL A;  3J81 E;  3CXC A;  1NJI C;  3I56 Q;  3CCL A;  5CKF A;  2PU9 B;  3CMA Q;  1YNZ A;  3OYJ A;  1VQP T;  4KUL A;  1YHQ A;  2H3J A;  2F5T X;  2OTJ T;  4DEY A;  2E6Z A;  1WHM A;  2DET A;  1YP5 A;  1VQN Q;  4XU3 A;  1D0Z A;  1GBR A;  3OMG A;  1K9M U;  3G7Z A;  1ZBJ A;  4PFZ A;  3CCM Q;  3CXC S;  4AG2 C;  2RB6 A;  4HXJ A;  4UC4 A;  3L2V A;  2DL4 A;  2RA2 A;  3MEW A;  3PGG A;  2KY9 A;  4FT2 A;  2KYM A;  4HCC A;  5GAN 4;  3CCE T;  4OB3 B;  1G83 A;  4C8Q E;  3CC2 A;  1K1Z A;  2L3R A;  2CH4 W;  1ZHI A;  2FO0 A;  4Q5W A;  4M7D F;  2OTJ A;  2F2W A;  3CCJ T;  4L6V 5;  3OYL A;  1WGS A;  1WHH A;  2M9U A;  3CBO A;  1VQL Q;  3ZBD A;  4EMG A;  2XG8 D;  4RUG A;  4XU2 A;  3MP6 A;  2LQ8 A;  2VKN A;  3H0I A;  2GTJ A;  3MP1 A;  2ZGW A;  3CCQ Q;  1KD1 U;  2YUQ A;  5FU7 C;  3OYG A;  3I56 A;  2VC8 A;  2BZ8 A;  4N4I A;  2A28 A;  3CMA A;  2LCC A;  2QTV A;  2D0Q B;  4M75 G;  4FSX A;  2XHC A;  5GAN 7;  2GCX A;  1FWZ A;  2E3H A;  1VQN A;  1X6O A;  2QEX Q;  3CCM A;  2P84 A;  3PIP A;  2LCS A;  2AKK A;  3UPU A;  3CCJ A;  1YI2 T;  4E47 A;  3RMS A;  4QVD A;  1PCX A;  3P8B B;  4M75 D;  3A5Z B;  3M56 A;  3GNF B;  3OSS C;  2A36 A;  2RF0 A;  1YJN T;  1UGS B;  2QAZ A;  1OUL A;  2DIQ A;  2K2V A;  4IUQ A;  1K76 A;  2MAM A;  1TOV A;  3QPH A;  8ATC B;  3UAT A;  4L59 A;  2OAU A;  2WAC A;  3UWN A;  4MZM A;  1N9R A;  1U1S A;  5FRO A;  3V7S A;  3G6E T;  1I0C A;  1VQ4 Q;  2P0P A;  1AOJ A;  4J9G A;  1VQL A;  1YIJ Q;  2CP0 A;  2CS7 A;  2SEM A;  4LXC A;  3A8H B;  3CCQ A;  4M77 G;  1QVF P;  2A08 A;  3QYH B;  4FM4 B;  1RAE B;  1N6A A;  2HMA A;  4XTW A;  4GBQ A;  8AT1 B;  4OMO A;  3E2U A;  4F16 A;  1NZ9 A;  2V1Q A;  1ZA1 B;  4QQG A;  4NOY A;  2QEX A;  3PMI A;  4M77 D;  3RNJ A;  3A8O B;  1B34 A;  2CUD A;  4C8Q A;  2VXF A;  1M1G A;  1WJR A;  4BE0 A;  2K4Y A;  1KQ1 A;  3TSZ A;  1UEC A;  3RBB B;  1NLO C;  2QQA A;  2JM8 A;  1PRM C;  3LH0 A;  5GAN 5;  5CAI A;  3LW5 E;  5KCO A;  5LJ5 j;  3L2Q A;  2EQU A;  2K3Y A;  1E7O A;  3QZ5 B;  1WI7 A;  3M4G A;  1JBM A;  4LD9 K;  1LJO A;  3H9N A;  2HDA A;  2ESW A;  4K11 A;  3VRZ A;  1JQQ A;  2HSP A;  4BE2 A;  1AT1 B;  3CCS T;  1UE9 A;  2GF7 A;  4B6M A;  2DIG A;  1VQ8 Q;  4PL6 A;  2V8I A;  2MYS A;  1OZ2 A;  4LN2 A;  3A1P A;  1O75 A;  1EFN A;  4JRP A;  4J9I A;  3VU3 C;  1ABO A;  4PJO G;  3DB4 A;  1WXU A;  2CT3 A;  3C94 A;  1M8V A;  1QCN A;  2NLU A;  1OYX A;  1V76 A;  5ECA A;  1TG0 A;  2K7A A;  5CIU A;  4LNP A;  2K3X A;  3MO8 A;  3RES A;  4M75 E;  1RAC B;  4LUD A;  4CC2 A;  3OYK A;  3PVQ A;  2KSS A;  2E1H A;  3BE3 A;  1VQM Q;  3U23 A;  4M78 E;  1W4S A;  3CPW P;  2AT1 B;  1RAB B;  2OTL T;  2YRC A;  4N4H A;  1VQK T;  3CC4 Q;  3GBQ A;  5GAO n;  1Z9Q A;  3JCM Q;  1CKA A;  1XOV A;  1D1A A;  4A4H A;  2YLC A;  2G3R A;  3O5Z A;  4PJO B;  4OML A;  1R8O B;  2X4J A;  5KYU A;  2RD1 A;  2RNA A;  5L23 A;  4NL2 A;  4EMK A;  2AIR B;  1K8A C;  2EGE A;  4O5V A;  5CCA A;  1RAA B;  3LX7 A;  2YUP A;  1D1B A;  5EG2 A;  3EG2 A;  3EG9 B;  3OW2 P;  2DVJ A;  5CKH A;  1QQJ A;  2CZ1 B;  1TWB A;  2H3E B;  2LP5 A;  2JMC A;  2X3W D;  1VQ8 A;  2F1L A;  2CGH A;  1IB8 A;  1NYF A;  2OTL A;  4JS5 A;  1VQK A;  1QWE A;  1KQS A;  2YRV A;  3PNW C;  1VIE A;  1UGR B;  3JCM e;  1ZQ1 A;  3SWN C;  2JXB A;  3NTK A;  1D3B B;  3QSU A;  2A37 A;  4IKF A;  2EYW A;  1AWW A;  4J9F A;  5M9O A;  1YWO A;  1B07 A;  1SSF A;  2J05 A;  1KQS S;  1FMW A;  5GAN d;  5KYX B;  4OF1 A;  4LDX A;  2RJC A;  2ROT A;  1K0S A;  2PUO B;  5CQY A;  3V8K A;  3QII A;  1VQM A;  2EPD A;  1S72 Q;  2RI3 A;  1VQ9 T;  1Y57 A;  3CC4 A;  2J7I A;  5FRN A;  3VS3 A;  3RDV A;  1HXD A;  3RIR A;  1G5V A;  4AFQ C;  2KVQ G;  1X2K A;  2XIC A;  3J80 E;  2XK0 A;  1M2V A;  2L8D A;  5LJ3 j;  3FC3 A;  3OYB A;  2M51 A;  3A8G B;  1E6H A;  2KXD A;  4X1V A;  1UHC A;  2EQK A;  3E9G A;  2P4R A;  4M7A C;  1X43 A;  1MND A;  4PK4 A;  1YJW Q;  2KXC A;  1VQ7 T;  3EGD A;  4E7H A;  4M75 A;  5KYY A;  1HK9 A;  2MF2 A;  5HK0 A;  4C0D C;  2E41 A;  2XU8 A;  4RTW A;  4C5I A;  3OYI A;  1ZA2 B;  4M78 A;  3OYF A;  4FYV B;  3CCV Q;  5KYW B;  4HVV A;  1ZSZ C;  5GAN f;  2KYB A;  2CSI A;  1WYX A;  4MZT A;  2EQJ A;  2BE7 D;  2BUD A;  3PT9 A;  2KRO A;  4P5N A;  5GAM e;  3JB9 G;  1EIF A;  3I55 Q;  4J7F A;  2RQU A;  1U3O A;  1S72 A;  2VYT A;  1B7T A;  3LH5 A;  1UJ0 A;  1Y7X A;  4E7S A;  1A0N B;  3CQT A;  1WNL A;  2SRC A;  4J6X A;  2DMO A;  1HYO A;  3JB9 D;  1G3Y A;  4C92 C;  3CCR Q;  5FU6 B;  2R5M A;  2KRN A;  3GNG A;  4A63 B;  5CK9 A;  5IHK A;  1FMV A;  5GAN 8;  5HCK A;  3ER0 A;  2KEA A;  3JCM g;  1RAF B;  1M3C A;  4OMM A;  1YJW A;  2JTF A;  3OS0 A;  3REB B;  4J8O A;  3CD6 T;  2NUT A;  3JCM b;  4IIO A;  1E6G A;  2V26 A;  1K9M R;  3SB2 A;  2L0A A;  4PJN A;  4E7K A;  1I4K 1;  3CCV A;  4FT4 A;  5CVI A;  1VQO Q;  1PKT A;  3EFO A;  2LTO A;  3JCM X;  3L1A A;  3VRY A;  2J6F A;  3H41 A;  4C8Q G;  3D7S B;  5CQX A;  4C0G A;  5GMK l;  2A3L A;  1VQ5 T;  4Z02 A;  3JCM h;  2E5Q A;  2WSC E;  4JRK A;  5IAY A;  1PC0 A;  1UFF A;  5KE3 A;  4X9D A;  3C95 A;  1ZUU A;  3S3M A;  2HD0 A;  5FWB A;  5D6X A;  1YJ9 T;  5CKB A;  2DK3 A;  1M1F A;  3CCR A;  4C8Q D;  3M0R A;  4XU0 A;  2O4X A;  3VUZ A;  4R0K A;  1WIE A;  1NPP A;  4F7U F;  2KE9 A;  2OAW A;  2X9H A;  2MCN A;  1KD1 R;  3EFR A;  3UDC A;  2COY A;  1B34 B;  2JMA A;  4C8Q B;  2DYB A;  1M3B A;  2YLB A;  3Q1J A;  4RG8 A;  1YHQ Q;  2RHU A;  2RHI A;  3N5B B;  1IGU A;  2DIL A;  1OEB A;  1KQ2 A;  3I35 A;  2LJ0 A;  4ELY C;  3M0Q A;  4PFP A;  1MMG A;  1BKB A;  4Y92 A;  5GAM g;  4CC7 A;  2W10 A;  1Q7Y U;  4KBM B;  2IG0 A;  1VQO A;  4FU6 A;  3QJY A;  5GJW B;  1K73 U;  1AZE A;  1YIT T;  4JJC A;  3OYY A;  2HNI A;  2QK0 A;  2VUB A;  4RTV A;  1M27 C;  3CEY A;  3HFO A;  4J9E A;  3PTA A;  4QQ6 A;  1G3S A;  1X75 C;  3H8Z A;  5GAO p;  2RK2 A;  4OGC A;  2O01 E;  4QVZ A;  1VQP Q;  2A7Y A;  1X01 A;  4FIB A;  4DOW A;  2OTJ Q;  4Z88 A;  3TU4 K;  2L89 A;  3THK A;  5AYF A;  1JO8 A;  2RN8 A;  2RJF A;  4RMO A;  1Q81 U;  3LWH A;  2F2V A;  2KT1 A;  3EHQ A;  2RQW A;  1H3H A;  3CCU T;  2X35 A;  4JPB W;  5GAM h;  2YUO A;  2RQV A;  2HL3 A;  1R0B G;  5A0L A;  1P92 A;  1BI2 A;  4KT0 E;  4OB2 B;  3L42 A;  3HP9 A;  2JOY A;  2Y4Y A;  4C92 F;  2FPF A;  1HJD A;  2W0Z A;  4IIM A;  2H8H A;  5C6S A;  1C6V X;  2FHD A;  2KI7 A;  5KYN A;  2F2X A;  3P8H A;  2Z0W A;  3KUF A;  5KYU B;  2EJF A;  1T3L A;  2NUP A;  1QVP A;  2VXE A;  3CCJ Q;  1SPK A;  4HA8 A;  4EIK A;  1MMA A;  4J9B A;  5I11 A;  2DXT A;  2LJ1 A;  1N8R U;  1Y96 A;  1UGQ B;  3I9Q A;  4A4G A;  1GCQ C;  1UDL A;  2L5Q A;  3JB9 J;  1FX7 A;  1QP3 A;  1BYM A;  1I07 A;  2DEQ A;  3TQ7 P;  3VS5 A;  5GAN 3;  2DA9 A;  1VQP A;  4ZTF A;  1W2B P;  5CR2 A;  3C0C A;  2ED0 A;  1M1K R;  5I2M A;  4M7A E;  5A0D A;  2J06 A;  4FYY B;  2C06 A;  3UT1 A;  2AK5 A;  1NM7 A;  2CUB A;  1WFW A;  1BCO A;  1QP2 A;  5GMK e;  3MET A;  1YI2 Q;  4KUD K;  1TU0 B;  1K8A U;  1H8K A;  4D6W A;  1MUZ A;  1QMC A;  2K9G A;  1AWJ A;  1Q95 G;  1ZUK A;  1M3A A;  2DO3 A;  1N9S A;  2GQV A;  1OOT A;  4BDZ A;  1YJN Q;  2DL8 A;  1IRE B;  2JTM A;  1KFZ A;  3G71 T;  1XQH A;  3CCE A;  1XTD A;  3GP8 A;  1SF9 A;  1PD1 A;  2X4X A;  4J83 A;  4M78 G;  1MHN A;  3HFN A;  4ATO A;  1M2V B;  4JS4 A;  3EG1 A;  3G6E Q;  2NUZ A;  3EH2 A;  5A0G A;  1Y0M A;  4JDS A;  2DVE A;  1JB0 E;  2EWN A;  1F1B B;  1IRX A;  2QDL A;  4E2F B;  1GL5 A;  5LJ5 d;  1BK2 A;  5DLQ E;  5I21 A;  4M78 D;  3I5R A;  4LD6 A;  3EGD B;  4BD3 A;  2RI5 A;  4M75 B;  5KYY B;  4PJO C;  3S3N A;  2DE0 X;  1QLY A;  4M78 B;  3SWN A;  1MGQ A;  4KH0 B;  5J3B A;  4FW2 A;  2J6K A;  2P0Q A;  1OZ3 A;  3DLM A;  1I8F A;  1VA7 A;  5IH2 A;  4JJN K;  1RAI B;  2MIO A;  3M0U A;  4XTY A;  2JS0 A;  1NEG A;  4FCY A;  1YI2 A;  3LLR A;  4HT8 A;  2XKO C;  3FB9 A;  4M75 F;  3UF4 A;  2D1X A;  2RHX A;  1GBQ A;  1YJN A;  3CXC P;  2DRM A;  3ZL7 C;  3HSB A;  2KAF A;  4M7D E;  2QQR A;  2PVO B;  5FWC A;  5GAO l;  1ZBX A;  2JUF A;  3JSC A;  1O9S A;  1GXI E;  3CCS Q;  3EFS A;  2KR3 A;  3G6E A;  5LJ5 f;  2M1H A;  3OYH A;  1WHG A;  4BB7 A;  5DY9 A;  2ED1 A;  4M7A A;  1KC8 U;  3OYD A;  1QW1 A;  2BKD N;  3OYC A;  4M77 B;  2GQI A;  2L3P A;  1FXX A;  3RKW A;  1U5S A;  2PQW A;  1KK7 A;  2Y90 A;  1YIJ T;  1H92 A;  3QDF A;  2HBW A;  1G3T A;  2XDB A;  2NUT B;  2ZPI B;  1VIF A;  2CP6 A;  2FYK A;  2R58 A;  1RLQ C;  3URG A;  3VV0 A;  2OTL Q;  2LQN A;  2PZ1 A;  3EFO B;  4M77 F;  1OX8 A;  3E19 A;  4OMQ A;  1VQK Q;  2B86 A;  2IIM A;  3HKS A;  2JZ2 A;  3QJ6 A;  3FEO A;  4R55 A;  2I0N A;  2JS2 A;  3NPF A;  2YWW A;  2LMJ A;  5LL6 S;  1ZX6 A;  2ENM A;  4J6W A;  1K9M C;  1K4U S;  4XK8 E;  4BAC A;  3V8L A;  2VB6 A;  2LZ6 B;  1JXO A;  2ZPB B;  5GMK h;  2NWM A;  2C0O A;  2KNB B;  3CCS A;  3IQL A;  2O4X B;  3NHN A;  3I5S A;  1MMN A;  4RG2 A;  5GAN e;  2CSQ A;  3MEU A;  2EJG A;  2PUK B;  4ZN3 A;  3HRT A;  5GJV B;  1S1N A;  1WA7 A;  2EYZ A;  2LT4 A;  5LJ3 d;  1YCY A;  2O31 A;  3CME T;  1C0M A;  2EQI A;  4ZGD B;  3QG1 A;  4NL3 A;  3JCM J;  2XID A;  2QXF A;  3RKY A;  3G4S T;  4RTZ A;  5FU6 C;  1WLP B;  2X51 A;  3MP8 A;  2FRW A;  2FZC B;  3QYG B;  2D8J A;  1WQ7 A;  1T0H A;  1Y07 A;  4PJO F;  1VYV A;  1N5Z A;  1VQ9 Q;  4CC4 B;  1PNJ A;  3KBG A;  2DRK A;  4M7D A;  2DPP B;  1KD1 C;  4BY6 B;  1X69 A;  3QUI A;  1AD5 A;  3M59 A;  4N0A A;  4E7I A;  4OMF B;  4HVW A;  1K9A A;  3QKJ A;  4DBF A;  4ZGE B;  2K6D A;  4QQD A;  3VYG A;  1UHF A;  1X27 A;  3LGL A;  3JB9 I;  4PNO A;  3E1S A;  2E65 A;  2RQT A;  2M0Y A;  4LUE A;  1RAH B;  4AG1 C;  2LVM A;  3OA6 A;  4GY5 A;  4PJM A;  3QZ9 B;  1VQ7 Q;  5LJ3 f;  1M30 A;  1BI0 A;  2RK1 A;  4EDU A;  2HZY A;  3PIO A;  3CC7 T;  2JTE A;  1Z9Z A;  1JU5 C;  4PFO A;  2O9S A;  1QVG A;  1IO6 A;  2Y4X A;  2CRE A;  3MKD A;  1SRL A;  4ESR A;  3VS0 A;  2ZPE B;  2MI6 A;  4A4K A;  4LDV A;  1PHT A;  2F69 A;  2NUP B;  2CT4 A;  2ROL A;  2PNI A;  5DLO A;  3AT1 B;  1Q86 U;  2QTX A;  1M90 U;  1MMD A;  3EAE A;  1VQ9 A;  1Y96 B;  2CDT A;  4BE1 A;  4C8Q C;  3QXE B;  4E6R A;  5FLX E;  1Q82 C;  3M9Q A;  1Q7Y R;  2HEQ A;  4C5E A;  2MWP A;  3GOX A;  1K73 R;  1NJI U;  3T9N A;  1JJ2 A;  5GAN g;  2KBT A;  3KXT A;  2KMT A;  4ZN1 A;  3OS2 A;  1GFD A;  1YFN A;  2LJ3 A;  2K5I A;  1BBZ A;  1VQ7 A;  4B9X A;  1JJ2 S;  1IZ6 A;  2CP5 A;  2KT8 A;  4EPC A;  3CD6 Q;  3TRE A;  1Q81 R;  3M57 A;  3G1J A;  2QYZ A;  3M5A A;  1G8X A;  1KHC A;  3CBP A;  2BTT A;  3GF5 A;  1B3Q A;  3GLX A;  4A54 A;  1M1K C;  1LNX A;  3DKM A;  5KH6 A;  1EX4 A;  3OS5 A;  4MML A;  5D6Y A;  1UEB A;  2GFA A;  2AZS A;  3L2U A;  5GAN h;  1BIA A;  1ZUY A;  3EGU A;  1BCM A;  4GLK A;  3VS1 A;  2BIV A;  2EJ9 A;  1GFC A;  4TVR A;  1OQK A;  3H6Z A;  4OVA A;  1VQ5 Q;  2JNG A;  1M8M A;  1KQS P;  2R57 A;  1LOJ A;  1SSH A;  4MMK A;  2DEU A;  3I55 T;  1U1T A;  2EKO A;  1K0X A;  2QQ9 A;  1M9S A;  3JB9 F;  1YJ9 Q;  1N8R R;  3WVE B;  4A53 A;  2AZV A;  4J9H A;  2YUN A;  2DL5 A;  5IXB A;  1MNE A;  1X6B A;  4JJB A;  4FSS A;  3EHR A;  2QA4 T;  1OX9 A;  3HHT B;  4JUV A;  4M7A G;  2F5K A;  3JCM P;  2VVK A;  3CD6 A;  2ZZD A;  2DTI A;  2MPX C; 
#chains in the Genus database with same CATH homology
 3E2U A;  2CP3 A;  2CP2 A;  1TXQ A;  2CP0 A;  2HKQ B;  2HL5 C;  3RDV A;  1WHH A;  1IXD A;  2E3I A;  2E3H A;  1TOV A;  2M02 A;  2HL3 A;  2COY A;  1WHK A;  2CP6 A;  2COZ A;  1WHM A;  2QK0 A;  3TQ7 P;  1WHG A;  4B6M A;  2E4H A;  2HQH A;  2Z0W A;  2HKN A;  2CP7 A;  2COW A;  1WHL A;  2MPX C;  1LPL A;  2CP5 A;  1WHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...