2CP0A

Solution structure of the 1st cap-gly domain in human clip-170-related protein clipr59
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
95
structure length
95
Chain Sequence
GSSGSSGGNLMLSALGLRLGDRVLLDGQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFICPPKQGLFASVSKISKAVDASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLIPR-59 protein
publication title Solution structure of the 1st CAP-Gly domain in human CLIP-170-related protein CLIPR59
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 7
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cp0A00
1TXQA 2CP5A 2CP0A 2COYA 2QK0A 2E4HA 3TQ7P 1WHGA 2E3HA 2HKNA 1TOVA 2COWA 2CP6A 1WHKA 2CP2A 2M02A 2HQHA 2CP7A 3RDVA 1LPLA 4B6MA 1WHLA 2HL3A 2COZA 1IXDA 2HL5C 1WHMA 1WHHA 3E2UA 2HKQB 1WHJA 2E3IA 2MPXC 2CP3A 2Z0WA
chains in the Genus database with same CATH superfamily
2RK2A 1MUZA 3F70A 5FU7B 1GXIE 1R0CB 2E65A 3CCQA 4PKCC 3M5AA 1M1KC 5IN1A 1VQ7T 2M0YA 3CC2T 3CPWS 4MZTA 4F7UE 2QXFA 4C8QA 1WHLA 2M9UA 2CUDA 3V7SA 2XMFA 2R5AA 1IREB 5IHIA 1WX6A 2YHTA 2GTJA 2OTLT 2JXBA 4PJOD 4BI8B 1M8VA 2HNIA 3G71T 2O01E 4BE1A 5GMKm 4L5GA 2K5IA 1QP2A 3CCET 5CCAA 1VQNT 1ABQA 1RABB 3FIFA 4QT7A 5LJ5j 1N9SA 1XOVA 1MNDA 2YUNA 1VQNA 4C92D 1IXDA 1H3HA 2DXTA 2F5TX 2X4YA 3GPLA 1VQLQ 5HY6A 2RA2A 2E4HA 3KUFA 1LOJA 3M0TA 5EC7A 3UDCA 2K2VA 4RCCA 3CC4Q 3JCMX 1VQOQ 1K73C 3EHQA 3LH5A 3VS6A 2NUTB 2LJ3A 2ZGWA 1M3CA 3CBOA 2OAWA 1XQHA 1PSFA 1UHFA 1IHVA 1BK2A 2BKDN 1QCFA 4DA4A 3VS1A 4ZN3A 4XU1A 4FCYA 4P5NA 1ACMB 3U23A 1LJOA 4GLMA 1D1CA 3RR6A 3CBPA 2Y4YA 4M77D 4K11A 5A2QE 1VQMQ 2KT8A 2MMPA 3TSZA 4OGEA 4M7AB 8AT1B 2AK5A 1V29B 3EG0A 1MHNA 1PNJA 1WFWA 2XIDA 2JJ9A 2XKOC 2Y90A 4AFUC 2W0ZA 1K8AC 3M53A 5FLXE 1K4US 1ZUUA 3M57A 1WHJA 2VXFA 3R6OA 3JCMV 1AWWA 4M7DC 3QKJA 5IHNA 4C8QE 3M4GA 3OYDA 2AKLA 3PNWC 3MP1A 3WVDB 4DOWA 3ASKA 1WXUA 2LX7A 2QG9B 1G3WA 2BZXA 4PFOA 4XU2A 4QVDA 1TUGB 1W4SA 3O8VA 1AOJA 3CCJT 1OPKA 1YI2Q 3ME9A 1T3LA 4AFQC 4M78B 3VS3A 1Y57A 3QWYA 1JRIA 4AG1C 1C0MA 1Q81C 4J7IA 1VQ6Q 4M75D 2PTKA 4Q5WA 1RAIB 4C5HA 3L2VA 2MAMA 2DXCA 1RI9A 2GQIA 3CCMA 3GF5A 4QQDA 5A0DA 4M7AG 2RB6A 3X28B 3DLMA 2CSQA 1QQJA 1KQSP 1G83A 3HSBA 3PGGA 1WA7A 3CD6T 4EIKA 3I56T 5GAN6 1QLYA 4DEXA 2VWFA 1TTHB 1LCKA 2KRMA 1WHGA 1Q86U 1SF9A 3JB9I 3EGDA 1M90C 1N8RC 5GMKl 5GJWB 1YITQ 1K0SA 4C5EA 1ZQ1A 3TU4K 1I0CA 1WHHA 1JB0E 1VIEA 1K9MC 2D1XA 3JCMd 4N4HA 2L3SA 3OYLA 2LNVA 1YBYA 4R55A 1MNEA 5GAN3 2I0NA 3QO3A 3MCAB 4KGXB 4D8DA 1NLPC 4M78G 3I55T 3KXTA 1Q82U 2K3YA 3I55A 1NE8A 2JVVA 1X01A 5I2SA 4ZGDB 1WJQA 4MZMA 4ESRA 2CKKA 1QVFA 2X4JA 5LJ3f 2DEQA 4MDXA 2CZ0B 4N4IA 2K79A 2COYA 2QK0A 4X1VA 3IQLA 3HTRA 1M30A 2K5FA 3RIRA 1KJWA 1W1FA 2RH2A 3G6EQ 2QYZA 1B34B 5GAMd 1FWZA 5KCHA 2EKHA 2HEQA 3X26B 2KBTA 4EMKA 2ENMA 1G5VA 2YRVA 2EGEA 4FU6A 4IIMA 4Y91A 4A53A 4JZ3A 2V8IA 2D9TA 2OI3A 4A54A 1VQ8T 2FPEA 3OBYA 4C8QC 1NZ9A 2D0NA 3RUXA 4HVUA 2JTMA 2X4XA 2KR3A 3SEMA 1YJNA 1NEBA 2GTOA 1VQ9T 4OF1A 3VUZA 2JW4A 1VQ9A 2DZ9A 2EVRA 3CCVT 4FSSA 4MZPA 4XTXA 3JB9G 2L3PA 3CCVA 2DTIA 2QEXA 3PE0A 5GAOm 3RKXA 5GANf 3CCUT 4EMHA 3CCUA 4OMOA 5LJ5f 3OSVA 1WPYA 2R57A 1ZBJA 1M9SA 2KRSA 1TSFA 4E7SA 4FIBA 2AT1B 1CKBA 1WJSA 3LGFA 3AHUA 3QUIA 3RERA 1ZSZA 3FEOA 3NGPA 4NOYA 4M7DB 3G4SQ 1IZ6A 2HKNA 1M1KU 5GMKh 2K5LA 3VS7A 1G3YA 1JO8A 3FLGA 1ZA1B 1M5Q1 1KK7A 3P8DA 2X3XD 1Q86R 2DRMA 2B8AA 4RTVA 2AHJB 2CP3A 4QVZA 3CMEQ 2ZPHB 3OQ5A 4CI0C 4F7UB 2K4YA 4J6WA 2L8DA 2MYSA 4C0FA 3LWIA 4LDXA 1W2BS 1NEGA 1PD0A 1TUCA 2BTTA 1KD1U 3V7RA 1SHFA 3M9QA 4KH0B 1UDLA 1QCNA 5GJVB 1N6AA 3LH0A 2DD5A 3UPUA 4LDVA 1Q82R 2GCXA 2ROLA 3FDRA 2E70A 1UFFA 3G1JA 2EPDA 4JRKA 4FYVB 2GFUA 1T0HA 5I22A 1GFCA 2XD0A 3NTIA 2FRYA 1YP5A 3JB9F 2O4XB 3CCRQ 3OS5A 4PJJA 4C5GA 2JS2A 1K73U 2FVUA 5KYYB 4M7DG 2O9SA 1I07A 1M2OA 1QVPA 1X69A 4OB0B 1KC8C 1J3TA 2LCCA 4X9CA 4EMGA 5KYWB 4LUDA 5D6YA 2QGGA 3CQTA 3GNGA 4PL6A 3CXCA 1SSHA 4FYWB 4N0AA 2O9VA 2H8HA 4ELZC 1VQLT 4PK4A 1RAAB 2X4WA 1EX4A 4ME7A 5AYFA 2GFAA 1VQLA 2C0OA 4F7UG 3CMAT 5LL6S 1U1TA 3RMSA 2J6OA 3CC4T 4LDYA 1AWJA 1VQOT 3CC4A 2RJDA 3VS0A 4ZTJA 1VQOA 1QVGS 1T3SA 5KH6A 4BDZA 5HKCA 2CS7A 2DILA 4HCCA 2JM9A 2EQUA 1WHMA 5DM7R 2CDTA 2HQEA 3L2ZA 4IUUA 2RQWA 2A7YA 2JM8A 1U1SA 1MMAA 2A0FB 4DEYA 1VQKA 2ZPFB 1D09B 2FL7A 1GBRA 1TWBA 2IIMA 3VJPA 3HRSA 2CP2A 2M02A 3H0IA 1PWTA 2NYSA 1VQMA 3A8LB 1UGQB 4C8QB 4Z8AA 1NBEB 1SRLA 5HCKA 1YJ9Q 1M1KR 2EJGA 5FRNA 1YJNQ 2ATCB 1XJWB 1AT1B 1BI2A 3C0CA 1AVZC 5L8RE 2J6KA 2YUOA 1Y0MA 1Q81U 3OW2A 2KVQG 4JS5A 4MDWA 3G7ZA 2JOYA 5CKBA 2A36A 4LXCA 4BUGA 2RI5A 4RTZA 1AZEA 3UA7A 2VGNA 4RTUA 4KULA 3SD4A 1BCOA 5CKFA 2XDDA 1B7TA 1ZBXA 4FL6A 3LWHA 4BDYA 1YI2T 5GANd 3X24B 4F7UF 5IT9E 3QZ9B 4PJLA 1YI2A 1M90U 1N8RU 2X51A 1I4K1 2EGAA 1I5LA 5LJ5d 1D1AA 1H92A 1QWEA 4JDSA 3PVLA 5KE3A 2RQVA 3A8MB 2XU8A 1VQ6A 1K9MU 3CCLQ 4C0DC 4J8OA 1K73R 3GLXA 3L2RA 5IXBA 4C8QG 8ATCB 1HD3A 4LE9A 2KE9A 3EG9A 3H9NA 4OMNA 1GRIA 5GAOp 2XDBA 4ORZA 2EQMA 2DYIA 5GAN5 3TREA 1CSKA 4X9DA 1JXOA 1BIBA 4XTWA 1Q7YC 4DBFA 3OS2A 4II1A 1TH7A 3NTHA 5CO7A 4IUTA 1OU8A 3PVQA 4TVRA 3TSWA 3EG1A 1OOTA 3JCMg 1IRXA 1VA7A 1UHCA 4J9IA 3PIPA 2DX1A 4PLLA 2L0AA 3CCQT 4X34A 2CREA 4JPBW 3ULRB 1YITA 3QIIA 1OU9A 2KT1A 4F14A 1HSQA 2DMOA 5M9OA 2RMOA 3LGLA 1BI1A 4J9EA 3OYIA 2GF7A 1QVFP 3EFOA 4YTLA 3EH1A 3UATA 2YT6A 3META 1BB9A 2DE0X 2P84A 5FU6C 1ZSZC 3LX7A 2EJFA 4B9XA 2G6FX 1K8AR 2H3EB 3OYMA 2ZPGB 3Q1JA 1BCMA 1ZUYA 4JJBA 2KNBB 3FJPA 3JV3A 2YXYA 2JTFA 4LD6A 2LQNA 5D7UA 1NLOC 1SG5A 2X3WD 2MI6A 5GAMg 2DXBA 1IO6A 2V8KA 4M78D 2F2VA 3C12A 2E41A 1KQ2A 5FROA 4HKEA 2EW3A 2RJEA 3G6EA 4OMPA 2MWOA 4D8KA 2JMCA 2EWNA 2JTEA 4BI3A 2F2WA 1NM7A 4Z89A 1Y07A 1Q81R 2V8JA 3PMIA 4C8QF 4BY6C 1PHTA 1I1JA 1UGRB 3LW5E 1QVFS 2K3XA 1PC0A 4FYYB 2VXEA 5GAN2 4N4GA 3RKWA 3ER0A 5LJ3h 1TUDA 2LX9A 3GIBA 2CP6A 3JCMW 3EGDB 3V7CA 1VQKQ 2KMTA 4JLIA 4B6MA 3PIOA 3MO8A 4FW2A 2HDAA 1V1CA 4OGCA 3JCMe 2FZKB 1M90R 1VQ5Q 1N8RR 3P8HA 1KFZA 1OX9A 4N0AC 4L6V5 1YWPA 4KRTA 4RMOA 2D8HA 1LNXA 2XHCA 3JB9D 1D0YA 5GAN4 1K9MR 1KHCA 4PJNA 4R56A 1U5SA 4IUQA 2K9GA 3CPFA 4JLGA 1C6VX 1NJIC 3GNFB 2GQVA 3CEYA 4V2SA 2NLUA 2XG8D 2QQAA 3G4ST 3JAME 4OMQA 2HAXA 3X20B 3G4SA 3RBBB 1G3SA 2LRQA 2DBMA 3JCMP 5DLOA 1JU5C 3REAB 4CC7A 5GAMe 4A4EA 2EAYA 4XU3A 4FSXA 4IURA 4AG2C 3OMCA 5GANh 1JXMA 4KH1B 3HFOA 1M8MA 3CMEA 2FZCB 5LJ5h 1RADB 2FPDA 3X25B 2DIGA 2HD0A 1D3BA 1VQ4A 4ZGJB 4DBHA 2DA9A 4JS4A 1KC8U 2NUPB 2BE9B 1JBMA 1VUBA 4C0DB 4EPCA 5KYUA 3V8LA 2H3JA 3CCMT 2MIOA 1FYNA 1DJ7B 1MGQA 4DBQA 3HHTB 2DL7A 4FT2A 3M55A 4RG8A 2QI2A 2KYMA 2SRCA 2QQSA 1GCQA 3CXCP 1SHGA 2FEIA 1K1ZA 3I5RA 3NPFA 1HXDA 2EGCA 4JRPA 2ZZDA 1GFDA 3OYCA 2LC4A 1G3TA 2ROTA 3CCRT 3I5SA 4PNOA 1SEMA 3TQ7P 3CCRA 1QMCA 2E3HA 1MMNA 2DERA 7AT1B 4XTZA 5IXFA 2QASA 5GAN8 2NUTA 3FJ5A 1V76A 5FWBA 2RNAA 3PTAA 3BDLA 2CH4A 4KGZB 1OX8A 3M58A 5FU6B 2GGRA 2NUZA 1ZSZB 2P0KA 4LDUA 1G8XA 4LD9K 2F2XA 4M7DD 2RPNA 3MEUA 2HZYA 5I11A 2RJCA 4VUBA 5GAN7 2EYXA 2FPFA 1VQ7Q 2ZAEA 3DLLA 3CC2Q 4ATOA 3HL8A 4M7AA 1FMVA 4A4FA 3I35A 3SWNC 4PJMA 2A28A 3BY7A 2QTVA 3JB9J 1MMGA 1X6BA 1UB4A 1ABOA 1U3OA 1H641 2OTLQ 1KQSS 2FRWA 2DPPB 3QBYA 4LN2A 4QKUA 1FMKA 4PLIA 1U06A 2FG0A 2DXUA 4HA8A 4OVAA 2COZA 4OB1B 1WI7A 4HCKA 3A98A 3CCEQ 2RQTA 3A8OB 2MWPA 1M2VB 2KXDA 3OW2P 3EGUA 5CIUA 5CVIA 1ZHIA 4PJOA 3SB2A 5J26A 1TS9A 1K76A 2C0IA 2DNUA 1Y96A 3JCMb 3QXEB 1YJ9T 5KYXB 4QQGA 1YJNT 3QG1A 1YJ9A 3EGXA 2KGTA 2AKKA 4RUGA 4C92A 1SPKA 2HBPA 4QQ6A 1QW1A 3JB9H 2IG0A 4M78A 2DL4A 2KDSA 4OMLA 1WXTA 2MPXC 2P4RA 3GBQA 2QEXT 3TVTA 1IGUA 5CR2A 4B9WA 4CRIA 3HRUA 2RF0A 4F17A 1PCXA 2AZVA 5A0GA 5GANg 4E7ZA 3CCSQ 4OMFB 1KC8R 3H0HA 3ZFJA 3E9FA 2LT1A 3MEWA 3OB9A 4BB7A 2GBQA 2BZ8A 4JJCA 1BBZA 1PKTA 2LQKA 4KGVB 1AEYA 2K3BA 2DD4A 2MF2A 4Y28E 3M0PA 3SFMA 4PJOF 2KXCA 2COWA 2V1QA 3OW2S 2CZ1B 2M0OA 4PFPA 1ZSGA 2KYBA 3CCLT 4M77A 4JJDA 3CCLA 3SDZA 2VV5A 2QA4Q 4C92F 1YIJQ 3H0FA 4CC4B 1S1NA 3T9NA 5AT1B 2BE7D 4E7JA 2XICA 4J7FA 4RTTA 1VQ4Q 1X27A 4J9CA 2FZGB 5GAMj 2LTOA 5CQYA 1W70A 2HSPA 2MK5A 4C8QD 3VS4A 2BZYA 5HK3A 1E6HA 2K6DA 1VQPQ 4J9DA 2KSSA 3QWXX 1H8KA 3CCJQ 2FB7A 4RTXA 1FXXA 3HFNA 1PG5B 4HT9A 1BI3A 4PJOE 1PM3A 2ED0A 1Y7XA 1N27A 6AT1B 1UGPB 2XK0A 1GL5A 4M77F 2KQWA 2PNIA 2OAUA 3M0QA 4C92E 2L5QA 1TXQA 2DEUA 4M75A 1FMWA 1ARKA 5GANe 1NPPA 2MOXA 2E6NA 3HRTA 1BU1A 2FYKA 1VIFA 2QQRA 4FYXB 5C6SA 3I56Q 2WACA 4ZN1A 4A4KA 3QZ5B 3CC7Q 1RAFB 2DLPA 1B07A 1UUEA 1P92A 2V1RA 3RESA 3MHXA 3DB4A 2DKGA 2PUKB 2V26A 1AWOA 2JMAA 2DL8A 3SWNB 1I5OB 3EG2A 3NHNA 2BUDA 2EYZA 2M16A 3VRYA 3QYHB 2KY9A 1ZUKA 2RQUA 1GCQC 3M54A 1K8AU 2YSQA 2A3LA 1NJIU 5KE2A 5J3BA 1LVKA 3URGA 4NS5A 2D6FA 1VYUA 2RJFA 5GMKi 4JUVA 1UE9A 1SKUB 4M77E 3O5ZA 2QDLA 1A0NB 1VQKT 1Q7YR 5LJ3d 1I81A 4J5YA 5GAOl 4M75F 4J6XA 3THKA 1VQMT 1VQ5T 3EFRA 1OV3A 5L23A 1U8RA 1VQ5A 3C95A 4KUIA 4QVCA 2F5KA 2DM1A 2YUPA 2AIRB 2OTJQ 2DBKA 2BIVA 4RG2A 1YJWQ 4A4HA 1M27C 1MMDA 2DRKA 2YRDA 4ELYC 2RK1A 2EYQA 5GAOr 3MKDA 3JRZA 2DJQA 1WLPB 1VQ8Q 2LDMA 1G2BA 4M7AC 1NG2A 3EHRA 5FRMA 1Q95G 4J9FA 2CH4W 1PRMC 3TCJA 4Y92A 1RACB 3L2WA 2VYTA 1PKSA 2HSEB 2KK4A 4A63B 4HCZA 2O88A 1S72Q 2O4XA 1VYTA 4IKFA 4M75E 2HMAA 2J6FA 2KRNA 2DAQA 2WSCE 4EMKC 3OS0A 3M4YA 2EQIA 4MMKA 5KYYA 4PJOC 3RNJA 1VQ6T 1HK9A 1WIEA 1Z9ZA 3INZA 4HVWA 1RLPC 2X9HA 4NL3A 3CPWP 2LJ1A 2G3RA 1BYMA 1W2BA 1RI0A 4XTUA 3C94A 4C92C 2Y4XA 2ECZA 1JJ2A 3E19A 3VUBA 3JCMc 2EKOA 3E9GA 3VKIA 4XTVA 3QSUA 4JZ4A 4DQ2A 1GCPA 2QQBA 1YITT 3A8HB 4KUDK 2RI2A 3ZBDA 4AFSC 3UF4A 2J06A 2DYBA 3BE3A 5CQXA 4E7HA 3JCMf 4KBMB 3E2UA 4R0KA 2YLCA 1C1AA 1WXBA 1R8OB 1OPLA 1NJIR 2DZCA 3NFCA 3QDRB 1UEBA 3MEAA 5GMKe 1BKBA 3FRNA 4M77C 1VQ7A 3RDVA 3CC2A 3R6NA 2L3QA 2VUBA 4FW1A 2LMJA 4E7KA 3OY9A 1D3BB 2CSIA 1NYFA 1XNIA 5FW9A 1EZZB 2OTLA 2LQ8A 1QVGA 3A5ZB 3G6ET 1SSFA 3EH2A 5GANj 2AZSA 5GAMf 4WF2A 1VYVA 5KYUB 3G71A 1KD1C 3S3MA 2D0QB 2KAFA 1AZGB 3CCEA 3KBGA 4XTYA 5KCOA 1X6OA 3KFVA 2LZ6B 1FX7A 4XU0A 1JEGA 1PRLC 3WXMB 2K7AA 2E1HA 2X35A 3WVEB 2RQRA 4O5VA 2RD1A 2M51A 3CMAQ 2ABLA 2A37A 2P0PA 4F04B 3NMZC 9ATCB 1WHKA 4HVVA 5ECAA 1AD5A 2JN0A 2EBPA 3VS2A 3HPWA 4J83A 3VRZA 3EG3A 1QCOA 4ZGEB 1NYGA 2HKQB 4M75C 2JZ2A 2L89A 3MP8A 2DVEA 3CCST 4JRIA 1ZX6A 1F1BB 3CCSA 1WDXA 3OYYA 5CKHA 1WQ7A 2I2LA 2PZ1A 3QPHA 4Z02A 2DTOA 2CGHA 1YHQQ 1Z9QA 3OYEA 3M0SA 4OP0A 4Z88A 4XK8E 1X2KA 5DLQE 4AMCA 2VVKA 4RKUE 4BACA 2DL3A 2IPOB 3J80E 2QGFB 3D7SB 4IIOA 4WTOB 2QA4T 1YIJT 3GP8A 2QA4A 4C0GA 2DETA 1YIJA 3CMET 2PVOB 1WGSA 4D6WA 1RAEB 3BDUA 5HK0A 1VQ4T 3C4SA 2DVJA 4EMKB 5IAYA 1JQQA 2RHYA 4PJOB 4FT4A 4GBQA 2DL5A 1Y96B 2DF6A 1H3ZA 2PVDB 1VQPT 3EGXB 1VQPA 2ZPEB 4C92B 1R77A 1M1GA 2RHIA 3H8ZA 3N5BB 2DO3A 3CCJA 3OMGA 3LLRA 2VKNA 3S3OA 2YLBA 4OMMA 3VV0A 5IHKA 2P4TA 2OX7A 1UJYA 2CZ6B 4IUPA 5CKEA 1OZ3A 2KI7A 4C0ZA 4GLKA 2DFUA 2O31A 3CPWA 3REBB 2QQ9A 2RHXA 4O6JA 2CT3A 4CC3A 2DTHA 5FWCA 3L1AA 2B86A 1KIKA 2M1HA 3CD6A 4OB2B 3I56A 1MV0B 4AFZC 3QDFA 4KT0E 3CC7T 1RLQC 3ZEHA 3CC7A 3CCQQ 4LNPA 1HYOA 4M77B 4PJOG 2LCLA 1I8FA 2PU9B 3PT9A 3VYHB 5KYNA 4LDWA 4FM4B 3A8GB 1OULA 4F16A 1YWOA 1EFNA 4IUVA 3OYHA 5GMKj 2E10A 3I9QA 5LJ3g 4C92G 1RAHB 3CXCS 3QHSA 2DIQA 2PUOB 2VASA 3G71Q 3DKMA 3NTKA 4A4GA 4JJNK 2YUQA 1OZ2A 3M0UA 1VQNQ 2D8JA 2DJZA 2FHDA 3DB3A 1YNZA 5J39A 1X75C 4BY6B 1QKXA 3OYFA 2VGMA 2E64A 3P8BB 3JCMJ 3MP6A 4DOVA 3M59A 4BD3A 1LPLA 1NPRA 2OJ2A 3EAEA 2OTJT 2HL5C 1KSWA 3QJYA 1AWXA 1YJWT 2OTJA 1QKWA 1YJWA 3HKSA 2EJ9A 2CP5A 2NUPA 2RM4A 4M75B 4M7AF 1RUWA 4M77G 3UWNA 5C0MA 1VQ8A 3UA6A 2LJ0A 1OQKA 1KG1A 4J9GA 1WZOA 4BE0A 2RHZA 2L2PA 3OYNA 1WJRA 4CC2A 1UECA 5LJ5g 1Q7YU 1TU0B 2EYYA 1W2BP 1UGSB 1S72T 2LT4A 1JJ2P 3UT1A 4E47A 2L3RA 1S72A 2E6ZA 1CKAA 3MPUB 2EYWA 1BI0A 2VC8A 2QTXA 2XDPA 5LJ3e 1AHJB 4M78F 2KEAA 4ANJA 1XTDA 2XI9A 3M0RA 5DY9A 3QYGB 2JT4A 4M7AE 1IB8A 3OYJA 2LNHB 2J05A 2RO0A 2EIFA 1B3QA 4M75G 3CBMA 2EQKA 1D0ZA 3OBWA 3EFSA 3RKYA 1YFNA 1OEBA 3ZL7C 4E2FB 2ESWA 2LCSA 4BE2A 1T0JA 2E5QA 3QJ6A 4EDUA 1PD1A 4E6RA 2CP0A 4XQ3A 4HXJA 3L42A 2PVGB 3PFSA 2PQWA 2NWMA 2O2OA 2EQJA 3FC3A 4NL2A 1WNLA 1JJ2S 1B34A 3OYBA 1WQWA 2JNGA 3A1PA 4ZNXA 4HCBA 1QVGP 1KQ1A 1OI1A 1M2VA 2HQXA 2RHUA 3CCMQ 5FU7C 2HCKA 4RTWA 3OSSC 4PFZA 3S6WA 2MCNA 4GY5A 3JSCA 4HT8A 4M78E 5D6WA 5KYXA 3VS5A 2LVMA 3CD6Q 2FO0A 2J7IA 2RI3A 5LJ5e 1RL2A 4WCIA 1O9SA 1YCYA 3BW1A 2KROA 1OYXA 1MV3A 1GBQA 5I2MA 1VOMA 3OS1A 1YCSB 4C5IA 3OYAA 3SHWA 4OB3B 1Y71A 3JCMh 4L59A 2LP5A 2SEMA 3PMTA 1X6GA 1N9RA 2GNCA 2ZPIB 2RN8A 2QDYB 1KQSA 1M3AA 4E7LA 3VYGA 3J7AF 2WSFE 1ZLMA 1HJDA 3EG9B 3S3NA 3V8JA 4UC4A 3V8KA 2C06A 1E6GA 4AT1B 3CMAA 2K57A 1D0XA 2ZPBB 4DBRA 3I55Q 2E12A 3FB9A 1W6XA 4M7DA 1Q86C 2CT4A 1TOVA 4JRQA 5A0LA 1QP3A 1K0XA 3HP9A 3RMQA 3VU3C 5GAMh 2WSEE 3EFOB 1M4ZA 5EG2A 1PSEA 3TEEA 1BIAA 4F7UA 3M56A 1YHQT 1UTIA 4LUEA 2CYZB 1YHQA 2DK3A 4MMLA 2HQHA 1Q82C 3OYGA 5GAOq 1K9AA 3J81E 4E7IA 1M1FA 2F69A 1SRMA 2CUBA 2YWWA 2ZCFB 1YN8A 1E7OA 1VQ9Q 1RAGB 5IH2A 1UGVA 1N5ZA 2QAZA 3CCVQ 4J6YA 1M3BA 1QWFA 2QEXQ 4M7DF 3H6ZA 2JUFA 2A08A 2ED1A 1O75A 3CCUQ 2EFIA 3OA6A 2C0TA 5CKDA 2W10A 2E3IA 1TG0A 2K2MA 5D6XA 3MEVA 4J9BA 1X43A 2CZ7B 1KD1R 2Z0WA 1D1BA 5CAIA 3L2UA 5KYWA 3H41A 4J9HA 1WYXA 1UG1A 4QW2A 4RTYA 3E1SA 2CP7A 2P0QA 2VB6A 3MJXA 4M78C 2HL3A 5I21A 2R5MA 2YRCA 1X2QA 2YDLA 3OYKA 1IHWA 4ZTFA 4M4ZA 2IVWA 5GAOn 1KHIA 5CK9A 5LJ3j 1ZA2B 3L2QA 3BFMA 4XAXB 1UJ0A 2F1LA 3SWNA 2E5KA 1R0BG 1EIFA 3AT1B 3LYIA 4M7DE 2JS0A 2HBWA 2LQWA 2R58A 3JCMQ 4BI4A 1IGQA 4RCBA 3GOXA 4M7AD
chains in the Genus database with same CATH topology
1TXQA 2CP5A 2CP0A 2COYA 2QK0A 2E4HA 3TQ7P 1WHGA 2E3HA 2HKNA 1TOVA 2COWA 2CP6A 1WHKA 2CP2A 2M02A 2HQHA 2CP7A 3RDVA 1LPLA 4B6MA 1WHLA 2HL3A 2COZA 1IXDA 2HL5C 1WHMA 1WHHA 3E2UA 2HKQB 1WHJA 2E3IA 2MPXC 2CP3A 2Z0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXQ A;  2CP5 A;  2CP0 A;  2COY A;  2QK0 A;  2E4H A;  3TQ7 P;  1WHG A;  2E3H A;  2HKN A;  1TOV A;  2COW A;  2CP6 A;  1WHK A;  2CP2 A;  2M02 A;  2HQH A;  2CP7 A;  3RDV A;  1LPL A;  4B6M A;  1WHL A;  2HL3 A;  2COZ A;  1IXD A;  2HL5 C;  1WHM A;  1WHH A;  3E2U A;  2HKQ B;  1WHJ A;  2E3I A;  2MPX C;  2CP3 A;  2Z0W A; 
#chains in the Genus database with same CATH topology
 2RK2 A;  1MUZ A;  3F70 A;  5FU7 B;  1GXI E;  1R0C B;  2E65 A;  3CCQ A;  4PKC C;  3M5A A;  1M1K C;  5IN1 A;  1VQ7 T;  2M0Y A;  3CC2 T;  3CPW S;  4MZT A;  4F7U E;  2QXF A;  4C8Q A;  1WHL A;  2M9U A;  2CUD A;  3V7S A;  2XMF A;  2R5A A;  1IRE B;  5IHI A;  1WX6 A;  2YHT A;  2GTJ A;  2OTL T;  2JXB A;  4PJO D;  4BI8 B;  1M8V A;  2HNI A;  3G71 T;  2O01 E;  4BE1 A;  5GMK m;  4L5G A;  2K5I A;  1QP2 A;  3CCE T;  5CCA A;  1VQN T;  1ABQ A;  1RAB B;  3FIF A;  4QT7 A;  5LJ5 j;  1N9S A;  1XOV A;  1MND A;  2YUN A;  1VQN A;  4C92 D;  1IXD A;  1H3H A;  2DXT A;  2F5T X;  2X4Y A;  3GPL A;  1VQL Q;  5HY6 A;  2RA2 A;  2E4H A;  3KUF A;  1LOJ A;  3M0T A;  5EC7 A;  3UDC A;  2K2V A;  4RCC A;  3CC4 Q;  3JCM X;  1VQO Q;  1K73 C;  3EHQ A;  3LH5 A;  3VS6 A;  2NUT B;  2LJ3 A;  2ZGW A;  1M3C A;  3CBO A;  2OAW A;  1XQH A;  1PSF A;  1UHF A;  1IHV A;  1BK2 A;  2BKD N;  1QCF A;  4DA4 A;  3VS1 A;  4ZN3 A;  4XU1 A;  4FCY A;  4P5N A;  1ACM B;  3U23 A;  1LJO A;  4GLM A;  1D1C A;  3RR6 A;  3CBP A;  2Y4Y A;  4M77 D;  4K11 A;  5A2Q E;  1VQM Q;  2KT8 A;  2MMP A;  3TSZ A;  4OGE A;  4M7A B;  8AT1 B;  2AK5 A;  1V29 B;  3EG0 A;  1MHN A;  1PNJ A;  1WFW A;  2XID A;  2JJ9 A;  2XKO C;  2Y90 A;  4AFU C;  2W0Z A;  1K8A C;  3M53 A;  5FLX E;  1K4U S;  1ZUU A;  3M57 A;  1WHJ A;  2VXF A;  3R6O A;  3JCM V;  1AWW A;  4M7D C;  3QKJ A;  5IHN A;  4C8Q E;  3M4G A;  3OYD A;  2AKL A;  3PNW C;  3MP1 A;  3WVD B;  4DOW A;  3ASK A;  1WXU A;  2LX7 A;  2QG9 B;  1G3W A;  2BZX A;  4PFO A;  4XU2 A;  4QVD A;  1TUG B;  1W4S A;  3O8V A;  1AOJ A;  3CCJ T;  1OPK A;  1YI2 Q;  3ME9 A;  1T3L A;  4AFQ C;  4M78 B;  3VS3 A;  1Y57 A;  3QWY A;  1JRI A;  4AG1 C;  1C0M A;  1Q81 C;  4J7I A;  1VQ6 Q;  4M75 D;  2PTK A;  4Q5W A;  1RAI B;  4C5H A;  3L2V A;  2MAM A;  2DXC A;  1RI9 A;  2GQI A;  3CCM A;  3GF5 A;  4QQD A;  5A0D A;  4M7A G;  2RB6 A;  3X28 B;  3DLM A;  2CSQ A;  1QQJ A;  1KQS P;  1G83 A;  3HSB A;  3PGG A;  1WA7 A;  3CD6 T;  4EIK A;  3I56 T;  5GAN 6;  1QLY A;  4DEX A;  2VWF A;  1TTH B;  1LCK A;  2KRM A;  1WHG A;  1Q86 U;  1SF9 A;  3JB9 I;  3EGD A;  1M90 C;  1N8R C;  5GMK l;  5GJW B;  1YIT Q;  1K0S A;  4C5E A;  1ZQ1 A;  3TU4 K;  1I0C A;  1WHH A;  1JB0 E;  1VIE A;  1K9M C;  2D1X A;  3JCM d;  4N4H A;  2L3S A;  3OYL A;  2LNV A;  1YBY A;  4R55 A;  1MNE A;  5GAN 3;  2I0N A;  3QO3 A;  3MCA B;  4KGX B;  4D8D A;  1NLP C;  4M78 G;  3I55 T;  3KXT A;  1Q82 U;  2K3Y A;  3I55 A;  1NE8 A;  2JVV A;  1X01 A;  5I2S A;  4ZGD B;  1WJQ A;  4MZM A;  4ESR A;  2CKK A;  1QVF A;  2X4J A;  5LJ3 f;  2DEQ A;  4MDX A;  2CZ0 B;  4N4I A;  2K79 A;  2COY A;  2QK0 A;  4X1V A;  3IQL A;  3HTR A;  1M30 A;  2K5F A;  3RIR A;  1KJW A;  1W1F A;  2RH2 A;  3G6E Q;  2QYZ A;  1B34 B;  5GAM d;  1FWZ A;  5KCH A;  2EKH A;  2HEQ A;  3X26 B;  2KBT A;  4EMK A;  2ENM A;  1G5V A;  2YRV A;  2EGE A;  4FU6 A;  4IIM A;  4Y91 A;  4A53 A;  4JZ3 A;  2V8I A;  2D9T A;  2OI3 A;  4A54 A;  1VQ8 T;  2FPE A;  3OBY A;  4C8Q C;  1NZ9 A;  2D0N A;  3RUX A;  4HVU A;  2JTM A;  2X4X A;  2KR3 A;  3SEM A;  1YJN A;  1NEB A;  2GTO A;  1VQ9 T;  4OF1 A;  3VUZ A;  2JW4 A;  1VQ9 A;  2DZ9 A;  2EVR A;  3CCV T;  4FSS A;  4MZP A;  4XTX A;  3JB9 G;  2L3P A;  3CCV A;  2DTI A;  2QEX A;  3PE0 A;  5GAO m;  3RKX A;  5GAN f;  3CCU T;  4EMH A;  3CCU A;  4OMO A;  5LJ5 f;  3OSV A;  1WPY A;  2R57 A;  1ZBJ A;  1M9S A;  2KRS A;  1TSF A;  4E7S A;  4FIB A;  2AT1 B;  1CKB A;  1WJS A;  3LGF A;  3AHU A;  3QUI A;  3RER A;  1ZSZ A;  3FEO A;  3NGP A;  4NOY A;  4M7D B;  3G4S Q;  1IZ6 A;  2HKN A;  1M1K U;  5GMK h;  2K5L A;  3VS7 A;  1G3Y A;  1JO8 A;  3FLG A;  1ZA1 B;  1M5Q 1;  1KK7 A;  3P8D A;  2X3X D;  1Q86 R;  2DRM A;  2B8A A;  4RTV A;  2AHJ B;  2CP3 A;  4QVZ A;  3CME Q;  2ZPH B;  3OQ5 A;  4CI0 C;  4F7U B;  2K4Y A;  4J6W A;  2L8D A;  2MYS A;  4C0F A;  3LWI A;  4LDX A;  1W2B S;  1NEG A;  1PD0 A;  1TUC A;  2BTT A;  1KD1 U;  3V7R A;  1SHF A;  3M9Q A;  4KH0 B;  1UDL A;  1QCN A;  5GJV B;  1N6A A;  3LH0 A;  2DD5 A;  3UPU A;  4LDV A;  1Q82 R;  2GCX A;  2ROL A;  3FDR A;  2E70 A;  1UFF A;  3G1J A;  2EPD A;  4JRK A;  4FYV B;  2GFU A;  1T0H A;  5I22 A;  1GFC A;  2XD0 A;  3NTI A;  2FRY A;  1YP5 A;  3JB9 F;  2O4X B;  3CCR Q;  3OS5 A;  4PJJ A;  4C5G A;  2JS2 A;  1K73 U;  2FVU A;  5KYY B;  4M7D G;  2O9S A;  1I07 A;  1M2O A;  1QVP A;  1X69 A;  4OB0 B;  1KC8 C;  1J3T A;  2LCC A;  4X9C A;  4EMG A;  5KYW B;  4LUD A;  5D6Y A;  2QGG A;  3CQT A;  3GNG A;  4PL6 A;  3CXC A;  1SSH A;  4FYW B;  4N0A A;  2O9V A;  2H8H A;  4ELZ C;  1VQL T;  4PK4 A;  1RAA B;  2X4W A;  1EX4 A;  4ME7 A;  5AYF A;  2GFA A;  1VQL A;  2C0O A;  4F7U G;  3CMA T;  5LL6 S;  1U1T A;  3RMS A;  2J6O A;  3CC4 T;  4LDY A;  1AWJ A;  1VQO T;  3CC4 A;  2RJD A;  3VS0 A;  4ZTJ A;  1VQO A;  1QVG S;  1T3S A;  5KH6 A;  4BDZ A;  5HKC A;  2CS7 A;  2DIL A;  4HCC A;  2JM9 A;  2EQU A;  1WHM A;  5DM7 R;  2CDT A;  2HQE A;  3L2Z A;  4IUU A;  2RQW A;  2A7Y A;  2JM8 A;  1U1S A;  1MMA A;  2A0F B;  4DEY A;  1VQK A;  2ZPF B;  1D09 B;  2FL7 A;  1GBR A;  1TWB A;  2IIM A;  3VJP A;  3HRS A;  2CP2 A;  2M02 A;  3H0I A;  1PWT A;  2NYS A;  1VQM A;  3A8L B;  1UGQ B;  4C8Q B;  4Z8A A;  1NBE B;  1SRL A;  5HCK A;  1YJ9 Q;  1M1K R;  2EJG A;  5FRN A;  1YJN Q;  2ATC B;  1XJW B;  1AT1 B;  1BI2 A;  3C0C A;  1AVZ C;  5L8R E;  2J6K A;  2YUO A;  1Y0M A;  1Q81 U;  3OW2 A;  2KVQ G;  4JS5 A;  4MDW A;  3G7Z A;  2JOY A;  5CKB A;  2A36 A;  4LXC A;  4BUG A;  2RI5 A;  4RTZ A;  1AZE A;  3UA7 A;  2VGN A;  4RTU A;  4KUL A;  3SD4 A;  1BCO A;  5CKF A;  2XDD A;  1B7T A;  1ZBX A;  4FL6 A;  3LWH A;  4BDY A;  1YI2 T;  5GAN d;  3X24 B;  4F7U F;  5IT9 E;  3QZ9 B;  4PJL A;  1YI2 A;  1M90 U;  1N8R U;  2X51 A;  1I4K 1;  2EGA A;  1I5L A;  5LJ5 d;  1D1A A;  1H92 A;  1QWE A;  4JDS A;  3PVL A;  5KE3 A;  2RQV A;  3A8M B;  2XU8 A;  1VQ6 A;  1K9M U;  3CCL Q;  4C0D C;  4J8O A;  1K73 R;  3GLX A;  3L2R A;  5IXB A;  4C8Q G;  8ATC B;  1HD3 A;  4LE9 A;  2KE9 A;  3EG9 A;  3H9N A;  4OMN A;  1GRI A;  5GAO p;  2XDB A;  4ORZ A;  2EQM A;  2DYI A;  5GAN 5;  3TRE A;  1CSK A;  4X9D A;  1JXO A;  1BIB A;  4XTW A;  1Q7Y C;  4DBF A;  3OS2 A;  4II1 A;  1TH7 A;  3NTH A;  5CO7 A;  4IUT A;  1OU8 A;  3PVQ A;  4TVR A;  3TSW A;  3EG1 A;  1OOT A;  3JCM g;  1IRX A;  1VA7 A;  1UHC A;  4J9I A;  3PIP A;  2DX1 A;  4PLL A;  2L0A A;  3CCQ T;  4X34 A;  2CRE A;  4JPB W;  3ULR B;  1YIT A;  3QII A;  1OU9 A;  2KT1 A;  4F14 A;  1HSQ A;  2DMO A;  5M9O A;  2RMO A;  3LGL A;  1BI1 A;  4J9E A;  3OYI A;  2GF7 A;  1QVF P;  3EFO A;  4YTL A;  3EH1 A;  3UAT A;  2YT6 A;  3MET A;  1BB9 A;  2DE0 X;  2P84 A;  5FU6 C;  1ZSZ C;  3LX7 A;  2EJF A;  4B9X A;  2G6F X;  1K8A R;  2H3E B;  3OYM A;  2ZPG B;  3Q1J A;  1BCM A;  1ZUY A;  4JJB A;  2KNB B;  3FJP A;  3JV3 A;  2YXY A;  2JTF A;  4LD6 A;  2LQN A;  5D7U A;  1NLO C;  1SG5 A;  2X3W D;  2MI6 A;  5GAM g;  2DXB A;  1IO6 A;  2V8K A;  4M78 D;  2F2V A;  3C12 A;  2E41 A;  1KQ2 A;  5FRO A;  4HKE A;  2EW3 A;  2RJE A;  3G6E A;  4OMP A;  2MWO A;  4D8K A;  2JMC A;  2EWN A;  2JTE A;  4BI3 A;  2F2W A;  1NM7 A;  4Z89 A;  1Y07 A;  1Q81 R;  2V8J A;  3PMI A;  4C8Q F;  4BY6 C;  1PHT A;  1I1J A;  1UGR B;  3LW5 E;  1QVF S;  2K3X A;  1PC0 A;  4FYY B;  2VXE A;  5GAN 2;  4N4G A;  3RKW A;  3ER0 A;  5LJ3 h;  1TUD A;  2LX9 A;  3GIB A;  2CP6 A;  3JCM W;  3EGD B;  3V7C A;  1VQK Q;  2KMT A;  4JLI A;  4B6M A;  3PIO A;  3MO8 A;  4FW2 A;  2HDA A;  1V1C A;  4OGC A;  3JCM e;  2FZK B;  1M90 R;  1VQ5 Q;  1N8R R;  3P8H A;  1KFZ A;  1OX9 A;  4N0A C;  4L6V 5;  1YWP A;  4KRT A;  4RMO A;  2D8H A;  1LNX A;  2XHC A;  3JB9 D;  1D0Y A;  5GAN 4;  1K9M R;  1KHC A;  4PJN A;  4R56 A;  1U5S A;  4IUQ A;  2K9G A;  3CPF A;  4JLG A;  1C6V X;  1NJI C;  3GNF B;  2GQV A;  3CEY A;  4V2S A;  2NLU A;  2XG8 D;  2QQA A;  3G4S T;  3JAM E;  4OMQ A;  2HAX A;  3X20 B;  3G4S A;  3RBB B;  1G3S A;  2LRQ A;  2DBM A;  3JCM P;  5DLO A;  1JU5 C;  3REA B;  4CC7 A;  5GAM e;  4A4E A;  2EAY A;  4XU3 A;  4FSX A;  4IUR A;  4AG2 C;  3OMC A;  5GAN h;  1JXM A;  4KH1 B;  3HFO A;  1M8M A;  3CME A;  2FZC B;  5LJ5 h;  1RAD B;  2FPD A;  3X25 B;  2DIG A;  2HD0 A;  1D3B A;  1VQ4 A;  4ZGJ B;  4DBH A;  2DA9 A;  4JS4 A;  1KC8 U;  2NUP B;  2BE9 B;  1JBM A;  1VUB A;  4C0D B;  4EPC A;  5KYU A;  3V8L A;  2H3J A;  3CCM T;  2MIO A;  1FYN A;  1DJ7 B;  1MGQ A;  4DBQ A;  3HHT B;  2DL7 A;  4FT2 A;  3M55 A;  4RG8 A;  2QI2 A;  2KYM A;  2SRC A;  2QQS A;  1GCQ A;  3CXC P;  1SHG A;  2FEI A;  1K1Z A;  3I5R A;  3NPF A;  1HXD A;  2EGC A;  4JRP A;  2ZZD A;  1GFD A;  3OYC A;  2LC4 A;  1G3T A;  2ROT A;  3CCR T;  3I5S A;  4PNO A;  1SEM A;  3TQ7 P;  3CCR A;  1QMC A;  2E3H A;  1MMN A;  2DER A;  7AT1 B;  4XTZ A;  5IXF A;  2QAS A;  5GAN 8;  2NUT A;  3FJ5 A;  1V76 A;  5FWB A;  2RNA A;  3PTA A;  3BDL A;  2CH4 A;  4KGZ B;  1OX8 A;  3M58 A;  5FU6 B;  2GGR A;  2NUZ A;  1ZSZ B;  2P0K A;  4LDU A;  1G8X A;  4LD9 K;  2F2X A;  4M7D D;  2RPN A;  3MEU A;  2HZY A;  5I11 A;  2RJC A;  4VUB A;  5GAN 7;  2EYX A;  2FPF A;  1VQ7 Q;  2ZAE A;  3DLL A;  3CC2 Q;  4ATO A;  3HL8 A;  4M7A A;  1FMV A;  4A4F A;  3I35 A;  3SWN C;  4PJM A;  2A28 A;  3BY7 A;  2QTV A;  3JB9 J;  1MMG A;  1X6B A;  1UB4 A;  1ABO A;  1U3O A;  1H64 1;  2OTL Q;  1KQS S;  2FRW A;  2DPP B;  3QBY A;  4LN2 A;  4QKU A;  1FMK A;  4PLI A;  1U06 A;  2FG0 A;  2DXU A;  4HA8 A;  4OVA A;  2COZ A;  4OB1 B;  1WI7 A;  4HCK A;  3A98 A;  3CCE Q;  2RQT A;  3A8O B;  2MWP A;  1M2V B;  2KXD A;  3OW2 P;  3EGU A;  5CIU A;  5CVI A;  1ZHI A;  4PJO A;  3SB2 A;  5J26 A;  1TS9 A;  1K76 A;  2C0I A;  2DNU A;  1Y96 A;  3JCM b;  3QXE B;  1YJ9 T;  5KYX B;  4QQG A;  1YJN T;  3QG1 A;  1YJ9 A;  3EGX A;  2KGT A;  2AKK A;  4RUG A;  4C92 A;  1SPK A;  2HBP A;  4QQ6 A;  1QW1 A;  3JB9 H;  2IG0 A;  4M78 A;  2DL4 A;  2KDS A;  4OML A;  1WXT A;  2MPX C;  2P4R A;  3GBQ A;  2QEX T;  3TVT A;  1IGU A;  5CR2 A;  4B9W A;  4CRI A;  3HRU A;  2RF0 A;  4F17 A;  1PCX A;  2AZV A;  5A0G A;  5GAN g;  4E7Z A;  3CCS Q;  4OMF B;  1KC8 R;  3H0H A;  3ZFJ A;  3E9F A;  2LT1 A;  3MEW A;  3OB9 A;  4BB7 A;  2GBQ A;  2BZ8 A;  4JJC A;  1BBZ A;  1PKT A;  2LQK A;  4KGV B;  1AEY A;  2K3B A;  2DD4 A;  2MF2 A;  4Y28 E;  3M0P A;  3SFM A;  4PJO F;  2KXC A;  2COW A;  2V1Q A;  3OW2 S;  2CZ1 B;  2M0O A;  4PFP A;  1ZSG A;  2KYB A;  3CCL T;  4M77 A;  4JJD A;  3CCL A;  3SDZ A;  2VV5 A;  2QA4 Q;  4C92 F;  1YIJ Q;  3H0F A;  4CC4 B;  1S1N A;  3T9N A;  5AT1 B;  2BE7 D;  4E7J A;  2XIC A;  4J7F A;  4RTT A;  1VQ4 Q;  1X27 A;  4J9C A;  2FZG B;  5GAM j;  2LTO A;  5CQY A;  1W70 A;  2HSP A;  2MK5 A;  4C8Q D;  3VS4 A;  2BZY A;  5HK3 A;  1E6H A;  2K6D A;  1VQP Q;  4J9D A;  2KSS A;  3QWX X;  1H8K A;  3CCJ Q;  2FB7 A;  4RTX A;  1FXX A;  3HFN A;  1PG5 B;  4HT9 A;  1BI3 A;  4PJO E;  1PM3 A;  2ED0 A;  1Y7X A;  1N27 A;  6AT1 B;  1UGP B;  2XK0 A;  1GL5 A;  4M77 F;  2KQW A;  2PNI A;  2OAU A;  3M0Q A;  4C92 E;  2L5Q A;  1TXQ A;  2DEU A;  4M75 A;  1FMW A;  1ARK A;  5GAN e;  1NPP A;  2MOX A;  2E6N A;  3HRT A;  1BU1 A;  2FYK A;  1VIF A;  2QQR A;  4FYX B;  5C6S A;  3I56 Q;  2WAC A;  4ZN1 A;  4A4K A;  3QZ5 B;  3CC7 Q;  1RAF B;  2DLP A;  1B07 A;  1UUE A;  1P92 A;  2V1R A;  3RES A;  3MHX A;  3DB4 A;  2DKG A;  2PUK B;  2V26 A;  1AWO A;  2JMA A;  2DL8 A;  3SWN B;  1I5O B;  3EG2 A;  3NHN A;  2BUD A;  2EYZ A;  2M16 A;  3VRY A;  3QYH B;  2KY9 A;  1ZUK A;  2RQU A;  1GCQ C;  3M54 A;  1K8A U;  2YSQ A;  2A3L A;  1NJI U;  5KE2 A;  5J3B A;  1LVK A;  3URG A;  4NS5 A;  2D6F A;  1VYU A;  2RJF A;  5GMK i;  4JUV A;  1UE9 A;  1SKU B;  4M77 E;  3O5Z A;  2QDL A;  1A0N B;  1VQK T;  1Q7Y R;  5LJ3 d;  1I81 A;  4J5Y A;  5GAO l;  4M75 F;  4J6X A;  3THK A;  1VQM T;  1VQ5 T;  3EFR A;  1OV3 A;  5L23 A;  1U8R A;  1VQ5 A;  3C95 A;  4KUI A;  4QVC A;  2F5K A;  2DM1 A;  2YUP A;  2AIR B;  2OTJ Q;  2DBK A;  2BIV A;  4RG2 A;  1YJW Q;  4A4H A;  1M27 C;  1MMD A;  2DRK A;  2YRD A;  4ELY C;  2RK1 A;  2EYQ A;  5GAO r;  3MKD A;  3JRZ A;  2DJQ A;  1WLP B;  1VQ8 Q;  2LDM A;  1G2B A;  4M7A C;  1NG2 A;  3EHR A;  5FRM A;  1Q95 G;  4J9F A;  2CH4 W;  1PRM C;  3TCJ A;  4Y92 A;  1RAC B;  3L2W A;  2VYT A;  1PKS A;  2HSE B;  2KK4 A;  4A63 B;  4HCZ A;  2O88 A;  1S72 Q;  2O4X A;  1VYT A;  4IKF A;  4M75 E;  2HMA A;  2J6F A;  2KRN A;  2DAQ A;  2WSC E;  4EMK C;  3OS0 A;  3M4Y A;  2EQI A;  4MMK A;  5KYY A;  4PJO C;  3RNJ A;  1VQ6 T;  1HK9 A;  1WIE A;  1Z9Z A;  3INZ A;  4HVW A;  1RLP C;  2X9H A;  4NL3 A;  3CPW P;  2LJ1 A;  2G3R A;  1BYM A;  1W2B A;  1RI0 A;  4XTU A;  3C94 A;  4C92 C;  2Y4X A;  2ECZ A;  1JJ2 A;  3E19 A;  3VUB A;  3JCM c;  2EKO A;  3E9G A;  3VKI A;  4XTV A;  3QSU A;  4JZ4 A;  4DQ2 A;  1GCP A;  2QQB A;  1YIT T;  3A8H B;  4KUD K;  2RI2 A;  3ZBD A;  4AFS C;  3UF4 A;  2J06 A;  2DYB A;  3BE3 A;  5CQX A;  4E7H A;  3JCM f;  4KBM B;  3E2U A;  4R0K A;  2YLC A;  1C1A A;  1WXB A;  1R8O B;  1OPL A;  1NJI R;  2DZC A;  3NFC A;  3QDR B;  1UEB A;  3MEA A;  5GMK e;  1BKB A;  3FRN A;  4M77 C;  1VQ7 A;  3RDV A;  3CC2 A;  3R6N A;  2L3Q A;  2VUB A;  4FW1 A;  2LMJ A;  4E7K A;  3OY9 A;  1D3B B;  2CSI A;  1NYF A;  1XNI A;  5FW9 A;  1EZZ B;  2OTL A;  2LQ8 A;  1QVG A;  3A5Z B;  3G6E T;  1SSF A;  3EH2 A;  5GAN j;  2AZS A;  5GAM f;  4WF2 A;  1VYV A;  5KYU B;  3G71 A;  1KD1 C;  3S3M A;  2D0Q B;  2KAF A;  1AZG B;  3CCE A;  3KBG A;  4XTY A;  5KCO A;  1X6O A;  3KFV A;  2LZ6 B;  1FX7 A;  4XU0 A;  1JEG A;  1PRL C;  3WXM B;  2K7A A;  2E1H A;  2X35 A;  3WVE B;  2RQR A;  4O5V A;  2RD1 A;  2M51 A;  3CMA Q;  2ABL A;  2A37 A;  2P0P A;  4F04 B;  3NMZ C;  9ATC B;  1WHK A;  4HVV A;  5ECA A;  1AD5 A;  2JN0 A;  2EBP A;  3VS2 A;  3HPW A;  4J83 A;  3VRZ A;  3EG3 A;  1QCO A;  4ZGE B;  1NYG A;  2HKQ B;  4M75 C;  2JZ2 A;  2L89 A;  3MP8 A;  2DVE A;  3CCS T;  4JRI A;  1ZX6 A;  1F1B B;  3CCS A;  1WDX A;  3OYY A;  5CKH A;  1WQ7 A;  2I2L A;  2PZ1 A;  3QPH A;  4Z02 A;  2DTO A;  2CGH A;  1YHQ Q;  1Z9Q A;  3OYE A;  3M0S A;  4OP0 A;  4Z88 A;  4XK8 E;  1X2K A;  5DLQ E;  4AMC A;  2VVK A;  4RKU E;  4BAC A;  2DL3 A;  2IPO B;  3J80 E;  2QGF B;  3D7S B;  4IIO A;  4WTO B;  2QA4 T;  1YIJ T;  3GP8 A;  2QA4 A;  4C0G A;  2DET A;  1YIJ A;  3CME T;  2PVO B;  1WGS A;  4D6W A;  1RAE B;  3BDU A;  5HK0 A;  1VQ4 T;  3C4S A;  2DVJ A;  4EMK B;  5IAY A;  1JQQ A;  2RHY A;  4PJO B;  4FT4 A;  4GBQ A;  2DL5 A;  1Y96 B;  2DF6 A;  1H3Z A;  2PVD B;  1VQP T;  3EGX B;  1VQP A;  2ZPE B;  4C92 B;  1R77 A;  1M1G A;  2RHI A;  3H8Z A;  3N5B B;  2DO3 A;  3CCJ A;  3OMG A;  3LLR A;  2VKN A;  3S3O A;  2YLB A;  4OMM A;  3VV0 A;  5IHK A;  2P4T A;  2OX7 A;  1UJY A;  2CZ6 B;  4IUP A;  5CKE A;  1OZ3 A;  2KI7 A;  4C0Z A;  4GLK A;  2DFU A;  2O31 A;  3CPW A;  3REB B;  2QQ9 A;  2RHX A;  4O6J A;  2CT3 A;  4CC3 A;  2DTH A;  5FWC A;  3L1A A;  2B86 A;  1KIK A;  2M1H A;  3CD6 A;  4OB2 B;  3I56 A;  1MV0 B;  4AFZ C;  3QDF A;  4KT0 E;  3CC7 T;  1RLQ C;  3ZEH A;  3CC7 A;  3CCQ Q;  4LNP A;  1HYO A;  4M77 B;  4PJO G;  2LCL A;  1I8F A;  2PU9 B;  3PT9 A;  3VYH B;  5KYN A;  4LDW A;  4FM4 B;  3A8G B;  1OUL A;  4F16 A;  1YWO A;  1EFN A;  4IUV A;  3OYH A;  5GMK j;  2E10 A;  3I9Q A;  5LJ3 g;  4C92 G;  1RAH B;  3CXC S;  3QHS A;  2DIQ A;  2PUO B;  2VAS A;  3G71 Q;  3DKM A;  3NTK A;  4A4G A;  4JJN K;  2YUQ A;  1OZ2 A;  3M0U A;  1VQN Q;  2D8J A;  2DJZ A;  2FHD A;  3DB3 A;  1YNZ A;  5J39 A;  1X75 C;  4BY6 B;  1QKX A;  3OYF A;  2VGM A;  2E64 A;  3P8B B;  3JCM J;  3MP6 A;  4DOV A;  3M59 A;  4BD3 A;  1LPL A;  1NPR A;  2OJ2 A;  3EAE A;  2OTJ T;  2HL5 C;  1KSW A;  3QJY A;  1AWX A;  1YJW T;  2OTJ A;  1QKW A;  1YJW A;  3HKS A;  2EJ9 A;  2CP5 A;  2NUP A;  2RM4 A;  4M75 B;  4M7A F;  1RUW A;  4M77 G;  3UWN A;  5C0M A;  1VQ8 A;  3UA6 A;  2LJ0 A;  1OQK A;  1KG1 A;  4J9G A;  1WZO A;  4BE0 A;  2RHZ A;  2L2P A;  3OYN A;  1WJR A;  4CC2 A;  1UEC A;  5LJ5 g;  1Q7Y U;  1TU0 B;  2EYY A;  1W2B P;  1UGS B;  1S72 T;  2LT4 A;  1JJ2 P;  3UT1 A;  4E47 A;  2L3R A;  1S72 A;  2E6Z A;  1CKA A;  3MPU B;  2EYW A;  1BI0 A;  2VC8 A;  2QTX A;  2XDP A;  5LJ3 e;  1AHJ B;  4M78 F;  2KEA A;  4ANJ A;  1XTD A;  2XI9 A;  3M0R A;  5DY9 A;  3QYG B;  2JT4 A;  4M7A E;  1IB8 A;  3OYJ A;  2LNH B;  2J05 A;  2RO0 A;  2EIF A;  1B3Q A;  4M75 G;  3CBM A;  2EQK A;  1D0Z A;  3OBW A;  3EFS A;  3RKY A;  1YFN A;  1OEB A;  3ZL7 C;  4E2F B;  2ESW A;  2LCS A;  4BE2 A;  1T0J A;  2E5Q A;  3QJ6 A;  4EDU A;  1PD1 A;  4E6R A;  2CP0 A;  4XQ3 A;  4HXJ A;  3L42 A;  2PVG B;  3PFS A;  2PQW A;  2NWM A;  2O2O A;  2EQJ A;  3FC3 A;  4NL2 A;  1WNL A;  1JJ2 S;  1B34 A;  3OYB A;  1WQW A;  2JNG A;  3A1P A;  4ZNX A;  4HCB A;  1QVG P;  1KQ1 A;  1OI1 A;  1M2V A;  2HQX A;  2RHU A;  3CCM Q;  5FU7 C;  2HCK A;  4RTW A;  3OSS C;  4PFZ A;  3S6W A;  2MCN A;  4GY5 A;  3JSC A;  4HT8 A;  4M78 E;  5D6W A;  5KYX A;  3VS5 A;  2LVM A;  3CD6 Q;  2FO0 A;  2J7I A;  2RI3 A;  5LJ5 e;  1RL2 A;  4WCI A;  1O9S A;  1YCY A;  3BW1 A;  2KRO A;  1OYX A;  1MV3 A;  1GBQ A;  5I2M A;  1VOM A;  3OS1 A;  1YCS B;  4C5I A;  3OYA A;  3SHW A;  4OB3 B;  1Y71 A;  3JCM h;  4L59 A;  2LP5 A;  2SEM A;  3PMT A;  1X6G A;  1N9R A;  2GNC A;  2ZPI B;  2RN8 A;  2QDY B;  1KQS A;  1M3A A;  4E7L A;  3VYG A;  3J7A F;  2WSF E;  1ZLM A;  1HJD A;  3EG9 B;  3S3N A;  3V8J A;  4UC4 A;  3V8K A;  2C06 A;  1E6G A;  4AT1 B;  3CMA A;  2K57 A;  1D0X A;  2ZPB B;  4DBR A;  3I55 Q;  2E12 A;  3FB9 A;  1W6X A;  4M7D A;  1Q86 C;  2CT4 A;  1TOV A;  4JRQ A;  5A0L A;  1QP3 A;  1K0X A;  3HP9 A;  3RMQ A;  3VU3 C;  5GAM h;  2WSE E;  3EFO B;  1M4Z A;  5EG2 A;  1PSE A;  3TEE A;  1BIA A;  4F7U A;  3M56 A;  1YHQ T;  1UTI A;  4LUE A;  2CYZ B;  1YHQ A;  2DK3 A;  4MML A;  2HQH A;  1Q82 C;  3OYG A;  5GAO q;  1K9A A;  3J81 E;  4E7I A;  1M1F A;  2F69 A;  1SRM A;  2CUB A;  2YWW A;  2ZCF B;  1YN8 A;  1E7O A;  1VQ9 Q;  1RAG B;  5IH2 A;  1UGV A;  1N5Z A;  2QAZ A;  3CCV Q;  4J6Y A;  1M3B A;  1QWF A;  2QEX Q;  4M7D F;  3H6Z A;  2JUF A;  2A08 A;  2ED1 A;  1O75 A;  3CCU Q;  2EFI A;  3OA6 A;  2C0T A;  5CKD A;  2W10 A;  2E3I A;  1TG0 A;  2K2M A;  5D6X A;  3MEV A;  4J9B A;  1X43 A;  2CZ7 B;  1KD1 R;  2Z0W A;  1D1B A;  5CAI A;  3L2U A;  5KYW A;  3H41 A;  4J9H A;  1WYX A;  1UG1 A;  4QW2 A;  4RTY A;  3E1S A;  2CP7 A;  2P0Q A;  2VB6 A;  3MJX A;  4M78 C;  2HL3 A;  5I21 A;  2R5M A;  2YRC A;  1X2Q A;  2YDL A;  3OYK A;  1IHW A;  4ZTF A;  4M4Z A;  2IVW A;  5GAO n;  1KHI A;  5CK9 A;  5LJ3 j;  1ZA2 B;  3L2Q A;  3BFM A;  4XAX B;  1UJ0 A;  2F1L A;  3SWN A;  2E5K A;  1R0B G;  1EIF A;  3AT1 B;  3LYI A;  4M7D E;  2JS0 A;  2HBW A;  2LQW A;  2R58 A;  3JCM Q;  4BI4 A;  1IGQ A;  4RCB A;  3GOX A;  4M7A D; 
#chains in the Genus database with same CATH homology
 1TXQ A;  2CP5 A;  2CP0 A;  2COY A;  2QK0 A;  2E4H A;  3TQ7 P;  1WHG A;  2E3H A;  2HKN A;  1TOV A;  2COW A;  2CP6 A;  1WHK A;  2CP2 A;  2M02 A;  2HQH A;  2CP7 A;  3RDV A;  1LPL A;  4B6M A;  1WHL A;  2HL3 A;  2COZ A;  1IXD A;  2HL5 C;  1WHM A;  1WHH A;  3E2U A;  2HKQ B;  1WHJ A;  2E3I A;  2MPX C;  2CP3 A;  2Z0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...