3H0FA

Crystal structure of the human fyn sh3 r96w mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
VTLFVALYDYEAWTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title SH3 domain specificity
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Fyn
total genus 11
structure length 59
sequence length 59
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3h0fA00
2KEAA 3EHRA 4IIOA 2J6OA 2ABLA 4J9IA 2B86A 2JTEA 3EG2A 4HVVA 5GJVB 2GQIA 2J7IA 4OMOA 4DEXA 4AFSC 2VVKA 2RF0A 1CSKA 3SEMA 2JXBA 2LMJA 3TSWA 1WXUA 2AK5A 2LJ1A 1QCFA 2RNAA 2YT6A 4OMPA 1M27C 4D8DA 2C0TA 3NHNA 1BU1A 4F16A 4LUEA 2JS0A 3REBB 1SHGA 2RMOA 3VS6A 2EGAA 4E6RA 3FJ5A 3VRZA 2FEIA 4AG1C 1ZX6A 2PTKA 5I11A 4D8KA 2DE0X 1ZUKA 3M0PA 2KROA 2GNCA 1U06A 2XMFA 1BB9A 2RN8A 1PWTA 2H8HA 3NPFA 2LP5A 1CKBA 1YP5A 2C0OA 1ZLMA 2K2MA 2CUDA 3VS0A 2CH4A 3EG3A 5IHIA 2MIOA 2KR3A 1AOJA 1KSWA 5IXFA 2AKLA 3IQLA 1OPLA 2KXCA 1VYUA 2CREA 1LCKA 3UATA 1BBZA 2CSQA 2CH4W 2PZ1A 1AZGB 2DLPA 1Y0MA 2W0ZA 3VS4A 4JPBW 2O9VA 2M0YA 3I5RA 4CC4B 2W10A 2D1XA 2YUNA 2J6KA 3M0TA 1S1NA 2K7AA 1NM7A 1AD5A 1B07A 1W70A 1GFDA 4F14A 1X27A 1NLPC 2OJ2A 4LNPA 4FSSA 3GBQA 4J9FA 1SRMA 1VYVA 2ECZA 2DYBA 1FMKA 1WYXA 2EYWA 2ESWA 1WI7A 1Z9ZA 2KGTA 3REAB 2GTJA 2JS2A 2JM8A 1WX6A 2KT1A 2HDAA 2J06A 2DMOA 4RTWA 5FWCA 2EYXA 3RNJA 1PHTA 2RQTA 2L3SA 4RTUA 1A0NB 1H3HA 4AG2C 4LE9A 2CT3A 2DF6A 2DVJA 3EG1A 2P4RA 2EKHA 1B3QA 3I5SA 2C0IA 2K9GA 2HSPA 3H0HA 1U5SA 5IXBA 4JZ3A 4J9CA 2V1QA 1M3BA 2KXDA 1SEMA 3PVLA 2EVRA 2EQIA 1YWPA 2ED1A 3VS7A 1KFZA 1UECA 1ZUUA 2RQUA 1QWFA 2YSQA 2YDLA 2KBTA 1SHFA 2BTTA 5EC7A 4RTXA 1Y57A 1GFCA 1UHCA 1XOVA 2DX1A 2K6DA 4OMNA 2LJ3A 3EG0A 3VS1A 3SHWA 1UG1A 1YCSB 2KRNA 1MUZA 2DA9A 3A98A 2CUBA 2JMCA 1H8KA 1CKAA 2FPFA 4IIMA 4KRTA 1M3AA 4J9GA 2CSIA 4R0KA 1WLPB 1X2KA 5GJWB 3PE0A 2IIMA 4RTZA 1G83A 2ED0A 1T3LA 2EYYA 4JJCA 2A08A 3I35A 4HXJA 1YN8A 2VWFA 1HD3A 1JXMA 2CDTA 2LJ0A 2EYZA 2A28A 2I0NA 2O2OA 1GCQC 1NEGA 4RTVA 1KJWA 1PNJA 1SRLA 3QWXX 4QT7A 1VA7A 1QLYA 4HCKA 1VYTA 2LQNA 1UGVA 2DBMA 2QDLA 3TSZA 2KT8A 2CT4A 1TUDA 2L3PA 3PVQA 2DM1A 1FYNA 2KYBA 2G6FX 3H0FA 1SSHA 2KRMA 3H41A 2OAWA 1AVZC 1K9AA 3UA7A 4LN2A 4GBQA 1AEYA 4OMMA 1BK2A 2DNUA 1AWWA 2BZYA 4M4ZA 2K3BA 1TG0A 1H92A 3VS5A 2E5KA 2AZVA 3U23A 1X6GA 4ZNXA 2DRKA 1ZBJA 3TVTA 2FPEA 1NG2A 1X43A 4ORZA 3ZL7C 4Z88A 2ENMA 5HCKA 1X6BA 2LX7A 1U3OA 4RUGA 1IO6A 2JM9A 3M0RA 4HVWA 2ROTA 3LH5A 1E6HA 2JW4A 1JU5C 1NEBA 4JJDA 4Y92A 2GTOA 2KNBB 2DJQA 2EPDA 2K79A 1UJYA 1ZUYA 2J6FA 1K4US 2O9SA 3UF4A 2J05A 2SEMA 3M0UA 1AWXA 2DL4A 3UA6A 4HVUA 1ABOA 2A37A 4OMLA 2O88A 1E6GA 2JT4A 1I07A 4Z89A 2VKNA 1RI9A 2RPNA 2MOXA 2DL8A 4LUDA 3KFVA 2DL5A 1GCPA 1SPKA 1UTIA 2A36A 1JQQA 3EGUA 2M51A 2LNHB 2FRWA 5I22A 1JEGA 2LCSA 2AKKA 1OV3A 2PNIA 1ZSGA 4WCIA 2GGRA 1OPKA 1T0HA 4A63B 4Z8AA 2L2PA 2DILA 1UHFA 1WIEA 2SRCA 2JMAA 2D8JA 2NWMA 1HJDA 3H0IA 4JJBA 2OI3A 2DL3A 1QKXA 4AFQC 4J9BA 2DL7A 3QWYA 2LZ6B 2F2WA 2L3QA 1M30A 5IHNA 1K0SA 1UUEA 1WXTA 1AWJA 2YUOA 2KRSA 2EGCA 1X69A 2F2XA 4J9EA 5L23A 5IH2A 2FO0A 2RQRA 1W6XA 1WFWA 1YWOA 1K0XA 1TUCA 1WDXA 1PKTA 2KE9A 3ULRB 4K11A 2NUZA 2YUPA 1GBRA 4GLMA 1T0JA 1AZEA 1OOTA 2KYMA 3M0QA 2EBPA 2DRMA 2RQVA 1QKWA 3THKA 2HCKA 1UDLA 4RTYA 4J9DA 4OMQA 1NYFA 1HSQA 2MCNA 3VS2A 1JXOA 1NYGA 1T3SA 1W1FA 1QWEA 1UJ0A 4J9HA 5FW9A 1MV0B 3M0SA 4CC2A 2FPDA 3NGPA 2ROLA 4CC3A 5ECAA 2O31A 1X2QA 1WA7A 1K1ZA 3R6NA 3VRYA 2X3XD 1NLOC 1AWOA 1PRMC 4AFZC 2F2VA 3EHQA 1GBQA 2D0NA 4DEYA 1V1CA 4X1VA 3CQTA 2HBWA 1I1JA 2V1RA 2AZSA 2FRYA 1GCQA 4AFUC 2X3WD 1YNZA 2GBQA 4EIKA 1UE9A 1I0CA 2HEQA 2YUQA 1GRIA 1PKSA 1M8MA 1ARKA 1EFNA 1PRLC 1ABQA 2EW3A 3RBBB 2LQWA 1E7OA 1Z9QA 1MV3A 2D8HA 1RLPC 5FWBA 2L0AA 3C0CA 3NMZC 3O5ZA 4JZ4A 1UFFA 5IHKA 1GL5A 4RTTA 1JO8A 4ESRA 3VS3A 2DBKA 1N5ZA 2FG0A 1G2BA 1OEBA 3JV3A 1WXBA 1KIKA 2BZXA 1M3CA 2RQWA 3I9QA 1J3TA 1RUWA 2BZ8A 4CC7A 2EGEA 1RLQC 4F17A 1K76A
chains in the Genus database with same CATH superfamily
4X9DA 4D6WA 1WZOA 2RJEA 4J9IA 2B86A 3CCST 4HVVA 5GJVB 1S72T 2VGNA 4AFSC 5LJ5d 2LMJA 1X6OA 2OTLQ 1MHNA 1Y96A 3S3NA 2MPXC 2YLCA 1PC0A 2R5MA 3M57A 2YT6A 1M27C 1TXQA 4L59A 1KK7A 4F16A 3CCEA 3MHXA 3OS5A 4LUEA 4M77F 2P84A 5FU6C 1SHGA 2EGAA 3OSVA 2HAXA 1VQLT 3BE3A 2PTKA 2B8AA 1YJ9Q 3SWNA 4BY6C 1VQ6Q 1ZUKA 1U06A 2X9HA 1BB9A 1MNEA 1KQSP 1WHMA 4LXCA 2CZ1B 3NPFA 5A0GA 4M75A 2C0OA 1RACB 4C92A 2CUDA 5GAOr 2KR3A 1KSWA 2XD0A 3JCMb 3IQLA 1IHVA 1VQNT 2CP5A 4M7DC 1PSEA 3LX7A 1Y0MA 4R56A 1YITA 5DLQE 3HFOA 3I5RA 4DBQA 1YI2A 2K7AA 4WF2A 3RUXA 3DLLA 1D0ZA 3CC2Q 2HKQB 1GFDA 3OSSC 4NS5A 1LVKA 1O9SA 2OJ2A 1QVFA 4X9CA 1VQ7Q 4BY6B 1YBYA 4P5NA 1G5VA 2ZPGB 4KULA 1WI7A 2KGTA 3REAB 2JS2A 4PJNA 2E6ZA 4JRIA 2KT1A 4O5VA 3CMAA 4M78G 1IRXA 5FWCA 1OU8A 1A0NB 4M7DG 3C12A 2HBPA 5GMKl 2P4RA 2EKHA 3V7CA 1YITQ 3CXCA 3G4ST 1VQ4T 4PKCC 5IXBA 1M90U 2ZAEA 1ACMB 3S3MA 1SEMA 2DJZA 4F7UG 3H9NA 1M1KU 2EVRA 4KGVB 4PJMA 1K9MU 1M9SA 5KYYB 4E7HA 4Q5WA 3OYJA 4M75F 3META 1QVGP 4KH1B 5FLXE 4MZPA 2QG9B 2KBTA 1LNXA 2BTTA 5EC7A 3X26B 1Q81C 3HRSA 2IVWA 2K6DA 4OMNA 3EG0A 1K9MC 3L2RA 3MEAA 3FLGA 3JSCA 2COWA 3A98A 1UGPB 1RAHB 1VQ8Q 2OTJA 5GAMe 1M3AA 4EPCA 3OYEA 3A5ZB 4E7IA 1N6AA 3MEVA 2WSCE 4QQ6A 1KD1U 4R0KA 2RHXA 5GAMh 4FYVB 4C92E 1W2BS 3PE0A 2IIMA 1QP2A 2CP2A 2EYYA 2HMAA 2LQKA 4OF1A 3GNGA 3H8ZA 5GAN2 2CDTA 1FMVA 2DTOA 2LJ0A 4C5HA 1QQJA 2A28A 2QGFB 4BE1A 1VQPT 4RTVA 1NEGA 3PMTA 2NUPB 1PNJA 3EFSA 2HQEA 2DIGA 1QLYA 2DKGA 2K5IA 1DJ7B 1VQOT 1AT1B 1UGVA 2PVDB 2DBMA 2QDLA 3PMIA 1QCNA 4FIBA 1FMWA 1TUDA 3PVQA 4C5EA 2AT1B 4M75B 1FYNA 2KYBA 3H0FA 1YHQA 2KRMA 5LJ3j 5GAN7 1AVZC 2M1HA 3UA7A 4WTOB 2E41A 1BCMA 4C0DB 4JRPA 2K3XA 1YJ9T 1AWWA 2AHJB 4B9XA 2HD0A 2K3BA 2MAMA 3CCMA 1M8VA 3L2WA 4ANJA 2H3EB 3VS5A 1JJ2S 3QPHA 1PG5B 2Y90A 3OBYA 2CP3A 1X6GA 5KYXA 3CC4A 3RKWA 4MMLA 3CCUT 4XK8E 1X6BA 4FYWB 2JM9A 4ZN1A 2ROTA 2E65A 1E6HA 2JW4A 5KCHA 1NEBA 3FC3A 2R5AA 1KC8C 2F69A 1FXXA 1UJYA 2J6FA 3MCAB 2QA4Q 3MEWA 3M58A 3AHUA 2WACA 1VQLA 1PD1A 1AWXA 3QJYA 2JOYA 3JCMQ 2DL4A 4HVUA 4OMLA 2YLBA 1I5LA 4PNOA 4LUDA 2DL8A 1QP3A 1TOVA 3KFVA 2D9TA 2V8JA 1GCPA 1UTIA 1YJNA 3CPFA 2LNHB 1VQ9T 2JVVA 3OMGA 5I22A 1RAFB 1JEGA 1JJ2A 2MK5A 2PNIA 4J8OA 2GGRA 4Z8AA 2RHIA 1RL2A 1UHFA 1NPRA 2RH2A 5HY6A 4FW1A 1YITT 2NWMA 4M7DD 1QVFP 4OVAA 3JB9D 5CKDA 3A8GB 3HFNA 1MMDA 3OYAA 4HCZA 3CCSQ 1EIFA 1Q82R 1S72Q 3QZ9B 2YUOA 1X69A 2EGCA 4M77C 3CMET 5CKEA 2DAQA 2DYIA 4A54A 2RQRA 3GOXA 1WFWA 3LGFA 4JLGA 4A4FA 2OTLT 1TUCA 3T9NA 3I56T 2NLUA 1PKTA 3VYHB 2E12A 2YRDA 4ZN3A 1OOTA 1N8RR 2EBPA 3G6EQ 3V8JA 1SF9A 2YXYA 2RK1A 1NYFA 2QQRA 1HSQA 5GAMg 2YRVA 1JXOA 3CCJT 1TUGB 4HCBA 5KYXB 2EQKA 1OQKA 1VQ4A 2X4JA 3PFSA 4M77A 2FPDA 2A0FB 2ROLA 1W2BA 2RI2A 4C0FA 5A0LA 1F1BB 5ECAA 2O31A 3L2QA 1X2QA 3CD6T 2EYQA 4M75G 4C92G 5LJ3d 3VRYA 5FU6B 1JJ2P 4M7AD 3VV0A 2QQBA 1NJIU 1TTHB 2DXCA 1AWOA 2F2VA 1GBQA 2D0NA 5GAOm 4DOWA 2RA2A 3CCQA 3J7AF 3G71A 1GCQA 4AFUC 1D0YA 1VQNQ 2HEQA 2COZA 4C92F 3OYIA 1PKSA 1M8MA 1OZ2A 3JCMc 3CCEQ 2LQWA 3ZEHA 4ZGDB 1MV3A 2D8HA 4M7DB 3C0CA 1KHCA 4QQGA 4RTTA 4FM4B 1JO8A 3PIOA 4ESRA 3VS3A 3M5AA 2QXFA 1N8RU 3SDZA 4M7AE 1G2BA 1BI0A 1W4SA 1KIKA 4JS5A 1M3CA 5KE3A 2WSEE 2EGEA 3CCRT 2EWNA 2HL5C 3TCJA 4FW2A 1I81A 2ABLA 2MWOA 3O8VA 2X4WA 2J7IA 3CCVT 1FX7A 3X25B 1CSKA 4OB3B 2LJ1A 3JCMf 5DLOA 5IT9E 2Y4YA 4L5GA 1I4K1 3PTAA 2E5QA 1VQ4Q 4YTLA 2JS0A 3REBB 3CCLT 3VS6A 5D6YA 4E6RA 2VUBA 2DFUA 3FJ5A 3MPUB 2FEIA 3JCMd 1WGSA 1ZX6A 3GPLA 3OYHA 1WHLA 2QTXA 2GFAA 3M54A 4F7UF 3QDRB 1MMNA 3OYKA 5IAYA 4XU3A 2X51A 4PFOA 2EFIA 4JDSA 5EG2A 2KXCA 1LCKA 3X28B 4LDUA 1BBZA 4DA4A 1SSFA 2W0ZA 3OBWA 5GANe 4HKEA 3KBGA 2O9VA 1KQ2A 5CKHA 2J6KA 1KD1C 1G3SA 2LCCA 3M0TA 5LJ3e 4RKUE 2H3JA 1W70A 3OYYA 2G3RA 5KCOA 2P0QA 5FU7B 4XU0A 4BACA 5CAIA 2V8KA 5FROA 2XKOC 2A3LA 1Q82C 4A4GA 4ZGEB 1D0XA 3H6ZA 2K4YA 4C8QF 1SRMA 2DYBA 2RHUA 2ESWA 1C0MA 2GTJA 4E2FB 1WX6A 3JRZA 7AT1B 4DOVA 5I21A 4XTYA 1P92A 4MZMA 1UB4A 2EYXA 1BCOA 1YJWT 3TEEA 4BDYA 4RTUA 1H3HA 4LE9A 2CT3A 2DF6A 3EG1A 3EFOA 1PCXA 3I5SA 4M7DF 4TVRA 3JB9H 3H0HA 3MP8A 4JZ3A 5D7UA 3PVLA 2EQIA 1YWPA 1VQ5T 2ED1A 3MO8A 3VKIA 1EX4A 1UECA 1QWFA 2YSQA 3RIRA 1YIJT 4FU6A 1XOVA 4PJOB 5AYFA 1Y96B 3NTKA 1B7TA 2BKDN 3CCUQ 2QA4T 2KI7A 2VASA 1MUZA 2DA9A 3JCMg 3J81E 4CI0C 2JMCA 1H8KA 3M56A 2FPFA 2K57A 2PUKB 3LYIA 4IIMA 3JB9J 3GP8A 4J9GA 2QEXQ 3DKMA 1WLPB 3DLMA 2IG0A 3HP9A 2WSFE 4XQ3A 3SWNB 5CKBA 3I35A 2XDPA 4QVZA 2VWFA 3CMAT 4PJOG 4LDYA 2BIVA 5GMKj 1V76A 1ZQ1A 2LNVA 3ZFJA 4M7AF 3S6WA 4EMKB 2FZCB 1VQNA 3QWXX 5C0MA 2QTVA 3QBYA 4PJLA 1K8AR 1HYOA 1VQPQ 1K73C 2DM1A 1ZA1B 2EAYA 1SSHA 3A8MB 3CBMA 3M55A 5GAN5 4IUPA 5CQYA 3MKDA 2RB6A 3CBOA 1WHJA 1K9AA 2YWWA 2LX9A 4M78A 3CMEQ 1WHHA 4E7SA 1Y07A 2KVQG 3TU4K 2AZVA 1X01A 1KHIA 1OULA 2GF7A 4JUVA 3U23A 4ZNXA 4F04B 3TVTA 2CS7A 3EGXA 2EJFA 3CCVA 1YI2Q 1K73R 3ZL7C 1W2BP 2ENMA 3UPUA 2CP0A 5KE2A 1U3OA 2DXUA 1IO6A 3M0RA 3C4SA 3JB9F 1BI1A 4BE2A 3JCMe 3FEOA 4JJDA 4CRIA 2KK4A 3OB9A 4N0AA 2KNBB 4XU2A 1KG1A 5CR2A 1K4US 1C1AA 2J05A 2ZPHB 2NUTB 1TU0B 1ABOA 2RK2A 2JT4A 2XU8A 1WQWA 4Z89A 1OX9A 1RI9A 3CC2T 3G6EA 2A36A 4OP0A 3HHTB 4LDWA 2LCSA 2AKKA 1OV3A 4J6WA 4PJOE 5DM7R 1VQ8A 2OTJQ 3EFRA 3G1JA 4N0AC 1OPKA 1T0HA 4A63B 1VQMA 8AT1B 2DILA 5AT1B 3I55Q 5J3BA 1VQ9Q 2ZCFB 2DVEA 1QKXA 1RAEB 2RJCA 4N4IA 5LJ5g 1B34B 2L3QA 2LZ6B 4XAXB 1K0SA 4JRQA 1R0CB 3CC4Q 1ZA2B 4QKUA 2CP6A 4IKFA 1Y7XA 2KRSA 3L2VA 5LL6S 1VQOA 1W6XA 2COYA 4IUQA 3ME9A 2E1HA 4PJOF 3EH1A 4PJOA 3ULRB 2YUPA 1M90R 1GBRA 1AZEA 3WVEB 1JRIA 1BYMA 4XTXA 3CXCP 2E3HA 2RQVA 2O4XB 4BI8B 2P4TA 4BUGA 1QKWA 1RAAB 2HCKA 4J9DA 3I56Q 2MCNA 3A8HB 3VS2A 2QK0A 1NYGA 2JTFA 1W1FA 1QWEA 4J9HA 2ZPFB 1MV0B 3CC7T 1MNDA 2OX7A 3QYHB 4XTZA 5GMKm 3QJ6A 3CC4T 3HKSA 4N4GA 1WA7A 2P0KA 3JCMJ 1BI3A 3X24B 2X3XD 3CCJQ 3VYGA 3NTHA 3I55A 2QYZA 1YHQQ 3PNWC 4PLIA 3OS0A 1D3BB 3QUIA 5GAN6 1V1CA 5LJ5e 3OYCA 2O4XA 3CD6Q 2HBWA 1Q86C 2V1RA 2DD5A 2X3WD 1YNZA 3S3OA 3INZA 3CCMQ 1UE9A 4QVCA 3CCSA 1IGUA 1S72A 4KUIA 1EFNA 2CGHA 2FZGB 1ABQA 2DTIA 2M02A 1E7OA 1Z9QA 1Q86U 1RLPC 5FWBA 3LGLA 1ZSZA 5LJ5j 5IHKA 3AT1B 2K3YA 3JB9G 3RMQA 4KBMB 3CCET 4ELZC 3JV3A 2VV5A 8ATCB 2VGMA 3I9QA 2RJFA 4KGZB 1RLQC 4XTUA 3E9FA 2M16A 4F17A 2KEAA 2VC8A 2J6OA 1OYXA 1QMCA 4O6JA 3EG2A 1N8RC 4DEXA 2VVKA 1Q81R 2RF0A 2NUTA 2C06A 2XI9A 3SEMA 2X4YA 1SG5A 3TSWA 1WXUA 1QCFA 2DO3A 2RNAA 4BI3A 2C0TA 2X4XA 3NHNA 2QQ9A 1NJIC 3KUFA 4IUUA 4A4KA 2M9UA 1M4ZA 2K2VA 5I2SA 3C95A 5I11A 5FU7C 2JTMA 3SFMA 4D8KA 3BDUA 1ZSZC 3CXCS 2F1LA 2XMFA 3RMSA 1KQSS 4M7AG 2QGGA 2GFUA 1PWTA 3WVDB 3DB4A 1CKBA 1YP5A 2K2MA 5GANd 2CH4A 3V8KA 1Q81U 1AOJA 3N5BB 5GAOq 3CPWP 2MYSA 1VYUA 3UATA 5I2MA 2CSQA 2CYZB 2CH4W 1H641 2PZ1A 2DLPA 4EMHA 1M2VA 3L2UA 3BFMA 2M0YA 3OYMA 2W10A 2D1XA 2R58A 2YUNA 3V8LA 1NM7A 1AD5A 5KH6A 1PD0A 3OYBA 1X27A 2BE7D 2BE9B 2IPOB 2JZ2A 1VYVA 1WYXA 2RD1A 4PJOC 4EMKC 3PIPA 2JNGA 2DD4A 1M5Q1 1Q82U 2DMOA 3M4YA 3RNJA 3LW5E 3QIIA 2RQTA 2FHDA 1HXDA 4ELYC 1WNLA 2ZPEB 4IUTA 4NL2A 3OW2S 2HQXA 2K9GA 3CCRA 1WPYA 1U5SA 2V1QA 2DK3A 3QG1A 3M59A 2D6FA 2KXDA 4PFPA 2RHYA 4E47A 3OMCA 2XDBA 3VS7A 1N27A 4J5YA 3J80E 1TS9A 2RQUA 2PVOB 1WHGA 1SHFA 1V29B 1D09B 4RTXA 1LOJA 1Y57A 1GFCA 2DX1A 1VQKA 3VS1A 3OYDA 3SHWA 1UG1A 1YCSB 2CUBA 3G4SQ 1CKAA 4KRTA 5CK9A 1U8RA 1TSFA 4J6XA 2CSIA 2XK0A 1LJOA 1VQOQ 2V26A 5GJWB 1G83A 3FB9A 2ED0A 1T3LA 3SD4A 2FYKA 4FYXB 2DPPB 5DY9A 5C6SA 1Q7YU 3WXMB 5GAN8 5GAOp 1JXMA 1QW1A 5CVIA 2KDSA 1U1SA 1BIAA 4RCCA 1GXIE 2I0NA 1GCQC 1YFNA 3ASKA 1G3TA 1M2VB 1Q7YC 4QT7A 3CCRQ 4HCKA 1Q86R 5L8RE 5GANg 4E7JA 2DIQA 3TSZA 4C0ZA 1G3YA 5GAOn 2CZ0B 4M77G 2CT4A 2KT8A 3BDLA 3CCVQ 2PUOB 4V2SA 4A4EA 2G6FX 4C5GA 1HK9A 2A7YA 2OAWA 5CIUA 3BY7A 4LN2A 4GBQA 4XU1A 4OMMA 3OYGA 5KYUA 1PM3A 2BZYA 2OAUA 4X34A 3CBPA 1TG0A 2XICA 2PVGB 1H92A 1D1BA 4M77B 1JBMA 1YJWA 1O75A 3R6OA 4QVDA 2DRKA 1ZBJA 5J26A 1NG2A 3OQ5A 5GAMj 4FYYB 1VQ9A 3E1SA 3HPWA 4ZGJB 1M1KR 3L1AA 4J7FA 4E7KA 4BI4A 3M9QA 4HVWA 1SKUB 3LH5A 2VXEA 1KC8R 1VQ5A 1KQ1A 5M9OA 3QO3A 2K79A 1ZUYA 3EG9A 2CP7A 2EQJA 2O9SA 1VQ7A 1MMAA 3UA6A 1YJNQ 2A37A 4FT4A 2O88A 1C6VX 4ATOA 4II1A 1JQQA 3EGUA 5KYWB 3X20B 1QVFS 3TREA 5LJ5h 3CPWS 1ZBXA 2KMTA 3L42A 5HK0A 2L2PA 1WIEA 2LDMA 2SRCA 1M90C 2D8JA 3OA6A 3KXTA 1VQ6T 2OI3A 2R57A 2D0QB 4E7ZA 4UC4A 2DL7A 4M78D 1M30A 5IHNA 3CCJA 4OB2B 1TWBA 5L23A 4J9EA 1YJNT 2HL3A 3A8LB 5IH2A 1WJQA 1YWOA 3CD6A 1VQ5Q 2LRQA 4KH0B 2DXTA 1WDXA 4K11A 2ZPIB 2E6NA 2NUZA 1B34A 2QQSA 2HQHA 4JS4A 2DRMA 2HZYA 2Y4XA 2FVUA 5CQXA 2DXBA 1KC8U 3UDCA 4OMQA 3G71T 1QVGS 2JUFA 3EH2A 3JCMX 4M77D 4M7DE 3FDRA 1UJ0A 3E19A 5FW9A 4M78E 3NGPA 3CMEA 5GAN4 4XTVA 4QW2A 4DBFA 4M7AA 1R8OB 2OTLA 1K1ZA 3R6NA 4JRKA 3V7RA 3QXEB 4NOYA 4MDWA 1NLOC 5KYNA 5FRNA 4AFZC 3LH0A 1XTDA 4AT1B 4DEYA 2L5QA 3CQTA 4X1VA 4FT2A 2NUPA 3HRUA 2FRYA 1M1GA 2ZGWA 1K73U 1QCOA 1AHJB 2FL7A 3JCMP 4RG2A 4DBHA 2YUQA 3G71Q 1UGSB 1PRLC 4ME7A 3RBBB 5GAMd 4M78B 4B9WA 3EGXB 3RKYA 4C8QG 4FSXA 2L0AA 3PGGA 3NMZC 5HKCA 3O5ZA 1UFFA 3JB9I 1GL5A 2YHTA 2DBKA 3D7SB 2QASA 2VYTA 1WXBA 2EQUA 2E3IA 1J3TA 3FIFA 4RMOA 3G4SA 1OX8A 2HSEB 1K76A 1ZSZB 4KUDK 1BIBA 4M7DA 1WJSA 3EHRA 4IIOA 3OW2P 2JTEA 2GQIA 4OMOA 1K8AC 3EGDB 1YI2T 1IHWA 3RESA 4DBRA 4F7UA 2XIDA 2JXBA 2QI2A 2AK5A 1BKBA 2E10A 1VQLQ 4M78C 1R0BG 4OMPA 4Y28E 4D8DA 4BD3A 1BU1A 1Q95G 4IUVA 2LT4A 5A2QE 2RMOA 5LJ3f 2OTJT 5CKFA 3VRZA 5CCAA 4AG1C 1OZ3A 5GANf 3TQ7P 2DZ9A 4MZTA 4PL6A 4Y91A 3GNFB 2DE0X 3M0PA 4RCBA 4M7AB 2KROA 2EIFA 2FB7A 2GNCA 1OU9A 1KD1R 2RN8A 4PK4A 2H8HA 1VIEA 2LP5A 2DETA 1ZLMA 3CC7A 1BI2A 4J7IA 3VS0A 1VQPA 4PLLA 1QVGA 3EG3A 5IHIA 2MIOA 4J83A 5IXFA 2AKLA 4N4HA 5D6WA 1OPLA 2CREA 2LC4A 1AZGB 3EGDA 3LWHA 2ATCB 1IB8A 4KGXB 4OMFB 2YRCA 3OS1A 4RG8A 3I55T 3VS4A 4JPBW 4OB1B 4CC4B 2KQWA 3LLRA 2XG8D 3NTIA 1YJWQ 1S1NA 2DEUA 1B07A 2VB6A 3OW2A 5LJ5f 3Q1JA 4C8QD 4F14A 3SWNC 3MEUA 1NLPC 5LJ3h 4LNPA 4ZTJA 1G3WA 4FSSA 3GBQA 4C8QC 1D1AA 1JB0E 4J9FA 2ECZA 2CZ6B 4MMKA 3E2UA 2P0PA 1FMKA 2EYWA 2F5KA 4M75E 1MGQA 4E7LA 1Z9ZA 3P8HA 4LD9K 2JM8A 2XDDA 2HDAA 2J06A 2MI6A 4C0GA 3QZ5B 4RTWA 3VUZA 1YIJQ 3OYNA 1PHTA 2JN0A 2L8DA 2L3SA 4PJJA 4AG2C 2VXFA 2DVJA 4XTWA 1B3QA 3PT9A 2C0IA 4HT9A 2HSPA 4Z02A 4J9CA 1M3BA 4C8QE 1XNIA 4F7UB 3CCQQ 2O01E 1KFZA 1NPPA 2RI5A 1ZUUA 4JLIA 1EZZB 5GAOl 4C8QB 2YDLA 3RERA 2RHZA 4EDUA 2GQVA 4M75D 3CMAQ 1UHCA 1X75C 4C92D 1N9SA 2LJ3A 2KRNA 2AIRB 1UEBA 2LT1A 3ER0A 1K9MR 3QKJA 3JCMV 4OB0B 2HNIA 2DEQA 3CCMT 3VJPA 5GANh 3EAEA 5CO7A 2JJ9A 2MMPA 1NJIR 1X2KA 2K5LA 3EG9B 4RTZA 2L3RA 4L6V5 4JJCA 1NE8A 2A08A 4HXJA 4F7UE 1YN8A 1HD3A 2K5FA 5HK3A 3CCUA 3P8DA 2EYZA 1YIJA 2QAZA 2LVMA 2O2OA 3DB3A 2I2LA 1KJWA 1M1FA 2F5TX 2QA4A 1SRLA 1I5OB 2DERA 1XQHA 1Q7YR 2QEXT 1VA7A 1VYTA 3QHSA 4LD6A 1R77A 1H3ZA 2LQNA 3RR6A 2CKKA 4HCCA 3GLXA 3I56A 2L3PA 1IGQA 2LTOA 3UT1A 4HA8A 3SB2A 3H41A 3A1PA 5GAMf 5IN1A 1VQKT 3OY9A 2XHCA 1AEYA 1BK2A 1ZHIA 1RAIB 2DNUA 2L89A 3V7SA 4M4ZA 3GF5A 5LJ3g 2E5KA 3G7ZA 2PU9B 2KSSA 1VUBA 4J6YA 3M4GA 4FCYA 3E9GA 1XJWB 3CC2A 2FPEA 3MP6A 1X43A 1WHKA 2E70A 4ORZA 4BE0A 4Z88A 2RM4A 5GANj 5HCKA 3JCMh 2LX7A 4RUGA 1RABB 9ATCB 1N9RA 4M75C 1VQ8T 2CZ7B 1JU5C 1I8FA 3M53A 4Y92A 3QSUA 1VOMA 3CCLQ 2GTOA 4FL6A 3P8BB 2DJQA 2EPDA 4PFZA 3NFCA 4VUBA 3VU3C 2KAFA 2BUDA 2E4HA 2ZPBB 3UF4A 1M2OA 2HKNA 2SEMA 3M0UA 4DQ2A 1OI1A 5GMKe 1UGRB 2X35A 5GAN3 1E6GA 1I07A 2M0OA 1D1CA 2VKNA 2RPNA 2MOXA 3A8OB 3CPWA 2DTHA 2DL5A 1SPKA 2RO0A 1WJRA 2M51A 2FRWA 5KYWA 4M78F 1TH7A 1VQMQ 4C8QA 3UWNA 1ZSGA 4WCIA 1MMGA 3C94A 2V8IA 3GIBA 2JMAA 2RI3A 1HJDA 1U1TA 3H0IA 4JJBA 4C0DC 1RAGB 3OS2A 1M1KC 5J39A 2DL3A 1IZ6A 2QQAA 4AFQC 3EFOB 4AMCA 1YCYA 2Z0WA 4J9BA 2FZKB 1NZ9A 3QWYA 2F2WA 3CCQT 1UUEA 1G8XA 2LQ8A 1WXTA 1AWJA 4KT0E 3G6ET 2F2XA 2RJDA 2FO0A 1IXDA 4OGEA 3FRNA 2LCLA 3CC7Q 1K0XA 2KE9A 3CCLA 1FWZA 2QDYB 4M77E 3JAME 4GLMA 1T0JA 1RADB 1Y71A 1VQ7T 2KYMA 3M0QA 4LDXA 4PJOD 3JCMW 1VQMT 1D3BA 3L2ZA 4LDVA 3THKA 1UDLA 4RTYA 1LPLA 4QQDA 3OYLA 4A53A 4GLKA 4JJNK 3HSBA 1T3SA 1VIFA 4C5IA 4B6MA 4GY5A 3M0SA 1KQSA 4HT8A 4CC2A 5GMKh 4CC3A 3OYFA 2PQWA 3URGA 2EJ9A 3BW1A 1WQ7A 4MDXA 2EJGA 4OGCA 4C92B 1VQ6A 3FJPA 5KYYA 1PRMC 4A4HA 1RI0A 3EHQA 2MF2A 3ZBDA 5GMKi 3VUBA 4ZTFA 4NL3A 1I1JA 3MJXA 4EMKA 2EQMA 2AZSA 1UGQB 3HRTA 5FRMA 2GBQA 4BB7A 4EIKA 1I0CA 1QVPA 3MP1A 1IREB 2E64A 2GCXA 2DZCA 3CEYA 1GRIA 1VQKQ 1ARKA 4IURA 2EW3A 3QYGB 5KYUB 1YHQT 3QDFA 6AT1B 3HTRA 2KY9A 4JZ4A 5A0DA 5D6XA 3LWIA 3F70A 4BDZA 3RDVA 3RKXA 3HL8A 2ZZDA 1N5ZA 2FG0A 1OEBA 1YJ9A 1NBEB 1K8AU 2BZXA 4C92C 2MWPA 2RQWA 1RUWA 2BZ8A 4CC7A 4EMGA 2NYSA 2QEXA 2EKOA 1PSFA 4R55A 4M7AC
chains in the Genus database with same CATH topology
2KEAA 3EHRA 4IIOA 2J6OA 2ABLA 4J9IA 2B86A 2JTEA 3EG2A 4HVVA 5GJVB 2GQIA 2J7IA 4OMOA 4DEXA 4AFSC 2VVKA 2RF0A 1CSKA 3SEMA 2JXBA 2LMJA 3TSWA 1WXUA 2AK5A 2LJ1A 1QCFA 2RNAA 2YT6A 4OMPA 1M27C 4D8DA 2C0TA 3NHNA 1BU1A 4F16A 4LUEA 2JS0A 3REBB 1SHGA 2RMOA 3VS6A 2EGAA 4E6RA 3FJ5A 3VRZA 2FEIA 4AG1C 1ZX6A 2PTKA 5I11A 4D8KA 2DE0X 1ZUKA 3M0PA 2KROA 2GNCA 1U06A 2XMFA 1BB9A 2RN8A 1PWTA 2H8HA 3NPFA 2LP5A 1CKBA 1YP5A 2C0OA 1ZLMA 2K2MA 2CUDA 3VS0A 2CH4A 3EG3A 5IHIA 2MIOA 2KR3A 1AOJA 1KSWA 5IXFA 2AKLA 3IQLA 1OPLA 2KXCA 1VYUA 2CREA 1LCKA 3UATA 1BBZA 2CSQA 2CH4W 2PZ1A 1AZGB 2DLPA 1Y0MA 2W0ZA 3VS4A 4JPBW 2O9VA 2M0YA 3I5RA 4CC4B 2W10A 2D1XA 2YUNA 2J6KA 3M0TA 1S1NA 2K7AA 1NM7A 1AD5A 1B07A 1W70A 1GFDA 4F14A 1X27A 1NLPC 2OJ2A 4LNPA 4FSSA 3GBQA 4J9FA 1SRMA 1VYVA 2ECZA 2DYBA 1FMKA 1WYXA 2EYWA 2ESWA 1WI7A 1Z9ZA 2KGTA 3REAB 2GTJA 2JS2A 2JM8A 1WX6A 2KT1A 2HDAA 2J06A 2DMOA 4RTWA 5FWCA 2EYXA 3RNJA 1PHTA 2RQTA 2L3SA 4RTUA 1A0NB 1H3HA 4AG2C 4LE9A 2CT3A 2DF6A 2DVJA 3EG1A 2P4RA 2EKHA 1B3QA 3I5SA 2C0IA 2K9GA 2HSPA 3H0HA 1U5SA 5IXBA 4JZ3A 4J9CA 2V1QA 1M3BA 2KXDA 1SEMA 3PVLA 2EVRA 2EQIA 1YWPA 2ED1A 3VS7A 1KFZA 1UECA 1ZUUA 2RQUA 1QWFA 2YSQA 2YDLA 2KBTA 1SHFA 2BTTA 5EC7A 4RTXA 1Y57A 1GFCA 1UHCA 1XOVA 2DX1A 2K6DA 4OMNA 2LJ3A 3EG0A 3VS1A 3SHWA 1UG1A 1YCSB 2KRNA 1MUZA 2DA9A 3A98A 2CUBA 2JMCA 1H8KA 1CKAA 2FPFA 4IIMA 4KRTA 1M3AA 4J9GA 2CSIA 4R0KA 1WLPB 1X2KA 5GJWB 3PE0A 2IIMA 4RTZA 1G83A 2ED0A 1T3LA 2EYYA 4JJCA 2A08A 3I35A 4HXJA 1YN8A 2VWFA 1HD3A 1JXMA 2CDTA 2LJ0A 2EYZA 2A28A 2I0NA 2O2OA 1GCQC 1NEGA 4RTVA 1KJWA 1PNJA 1SRLA 3QWXX 4QT7A 1VA7A 1QLYA 4HCKA 1VYTA 2LQNA 1UGVA 2DBMA 2QDLA 3TSZA 2KT8A 2CT4A 1TUDA 2L3PA 3PVQA 2DM1A 1FYNA 2KYBA 2G6FX 3H0FA 1SSHA 2KRMA 3H41A 2OAWA 1AVZC 1K9AA 3UA7A 4LN2A 4GBQA 1AEYA 4OMMA 1BK2A 2DNUA 1AWWA 2BZYA 4M4ZA 2K3BA 1TG0A 1H92A 3VS5A 2E5KA 2AZVA 3U23A 1X6GA 4ZNXA 2DRKA 1ZBJA 3TVTA 2FPEA 1NG2A 1X43A 4ORZA 3ZL7C 4Z88A 2ENMA 5HCKA 1X6BA 2LX7A 1U3OA 4RUGA 1IO6A 2JM9A 3M0RA 4HVWA 2ROTA 3LH5A 1E6HA 2JW4A 1JU5C 1NEBA 4JJDA 4Y92A 2GTOA 2KNBB 2DJQA 2EPDA 2K79A 1UJYA 1ZUYA 2J6FA 1K4US 2O9SA 3UF4A 2J05A 2SEMA 3M0UA 1AWXA 2DL4A 3UA6A 4HVUA 1ABOA 2A37A 4OMLA 2O88A 1E6GA 2JT4A 1I07A 4Z89A 2VKNA 1RI9A 2RPNA 2MOXA 2DL8A 4LUDA 3KFVA 2DL5A 1GCPA 1SPKA 1UTIA 2A36A 1JQQA 3EGUA 2M51A 2LNHB 2FRWA 5I22A 1JEGA 2LCSA 2AKKA 1OV3A 2PNIA 1ZSGA 4WCIA 2GGRA 1OPKA 1T0HA 4A63B 4Z8AA 2L2PA 2DILA 1UHFA 1WIEA 2SRCA 2JMAA 2D8JA 2NWMA 1HJDA 3H0IA 4JJBA 2OI3A 2DL3A 1QKXA 4AFQC 4J9BA 2DL7A 3QWYA 2LZ6B 2F2WA 2L3QA 1M30A 5IHNA 1K0SA 1UUEA 1WXTA 1AWJA 2YUOA 2KRSA 2EGCA 1X69A 2F2XA 4J9EA 5L23A 5IH2A 2FO0A 2RQRA 1W6XA 1WFWA 1YWOA 1K0XA 1TUCA 1WDXA 1PKTA 2KE9A 3ULRB 4K11A 2NUZA 2YUPA 1GBRA 4GLMA 1T0JA 1AZEA 1OOTA 2KYMA 3M0QA 2EBPA 2DRMA 2RQVA 1QKWA 3THKA 2HCKA 1UDLA 4RTYA 4J9DA 4OMQA 1NYFA 1HSQA 2MCNA 3VS2A 1JXOA 1NYGA 1T3SA 1W1FA 1QWEA 1UJ0A 4J9HA 5FW9A 1MV0B 3M0SA 4CC2A 2FPDA 3NGPA 2ROLA 4CC3A 5ECAA 2O31A 1X2QA 1WA7A 1K1ZA 3R6NA 3VRYA 2X3XD 1NLOC 1AWOA 1PRMC 4AFZC 2F2VA 3EHQA 1GBQA 2D0NA 4DEYA 1V1CA 4X1VA 3CQTA 2HBWA 1I1JA 2V1RA 2AZSA 2FRYA 1GCQA 4AFUC 2X3WD 1YNZA 2GBQA 4EIKA 1UE9A 1I0CA 2HEQA 2YUQA 1GRIA 1PKSA 1M8MA 1ARKA 1EFNA 1PRLC 1ABQA 2EW3A 3RBBB 2LQWA 1E7OA 1Z9QA 1MV3A 2D8HA 1RLPC 5FWBA 2L0AA 3C0CA 3NMZC 3O5ZA 4JZ4A 1UFFA 5IHKA 1GL5A 4RTTA 1JO8A 4ESRA 3VS3A 2DBKA 1N5ZA 2FG0A 1G2BA 1OEBA 3JV3A 1WXBA 1KIKA 2BZXA 1M3CA 2RQWA 3I9QA 1J3TA 1RUWA 2BZ8A 4CC7A 2EGEA 1RLQC 4F17A 1K76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEA A;  3EHR A;  4IIO A;  2J6O A;  2ABL A;  4J9I A;  2B86 A;  2JTE A;  3EG2 A;  4HVV A;  5GJV B;  2GQI A;  2J7I A;  4OMO A;  4DEX A;  4AFS C;  2VVK A;  2RF0 A;  1CSK A;  3SEM A;  2JXB A;  2LMJ A;  3TSW A;  1WXU A;  2AK5 A;  2LJ1 A;  1QCF A;  2RNA A;  2YT6 A;  4OMP A;  1M27 C;  4D8D A;  2C0T A;  3NHN A;  1BU1 A;  4F16 A;  4LUE A;  2JS0 A;  3REB B;  1SHG A;  2RMO A;  3VS6 A;  2EGA A;  4E6R A;  3FJ5 A;  3VRZ A;  2FEI A;  4AG1 C;  1ZX6 A;  2PTK A;  5I11 A;  4D8K A;  2DE0 X;  1ZUK A;  3M0P A;  2KRO A;  2GNC A;  1U06 A;  2XMF A;  1BB9 A;  2RN8 A;  1PWT A;  2H8H A;  3NPF A;  2LP5 A;  1CKB A;  1YP5 A;  2C0O A;  1ZLM A;  2K2M A;  2CUD A;  3VS0 A;  2CH4 A;  3EG3 A;  5IHI A;  2MIO A;  2KR3 A;  1AOJ A;  1KSW A;  5IXF A;  2AKL A;  3IQL A;  1OPL A;  2KXC A;  1VYU A;  2CRE A;  1LCK A;  3UAT A;  1BBZ A;  2CSQ A;  2CH4 W;  2PZ1 A;  1AZG B;  2DLP A;  1Y0M A;  2W0Z A;  3VS4 A;  4JPB W;  2O9V A;  2M0Y A;  3I5R A;  4CC4 B;  2W10 A;  2D1X A;  2YUN A;  2J6K A;  3M0T A;  1S1N A;  2K7A A;  1NM7 A;  1AD5 A;  1B07 A;  1W70 A;  1GFD A;  4F14 A;  1X27 A;  1NLP C;  2OJ2 A;  4LNP A;  4FSS A;  3GBQ A;  4J9F A;  1SRM A;  1VYV A;  2ECZ A;  2DYB A;  1FMK A;  1WYX A;  2EYW A;  2ESW A;  1WI7 A;  1Z9Z A;  2KGT A;  3REA B;  2GTJ A;  2JS2 A;  2JM8 A;  1WX6 A;  2KT1 A;  2HDA A;  2J06 A;  2DMO A;  4RTW A;  5FWC A;  2EYX A;  3RNJ A;  1PHT A;  2RQT A;  2L3S A;  4RTU A;  1A0N B;  1H3H A;  4AG2 C;  4LE9 A;  2CT3 A;  2DF6 A;  2DVJ A;  3EG1 A;  2P4R A;  2EKH A;  1B3Q A;  3I5S A;  2C0I A;  2K9G A;  2HSP A;  3H0H A;  1U5S A;  5IXB A;  4JZ3 A;  4J9C A;  2V1Q A;  1M3B A;  2KXD A;  1SEM A;  3PVL A;  2EVR A;  2EQI A;  1YWP A;  2ED1 A;  3VS7 A;  1KFZ A;  1UEC A;  1ZUU A;  2RQU A;  1QWF A;  2YSQ A;  2YDL A;  2KBT A;  1SHF A;  2BTT A;  5EC7 A;  4RTX A;  1Y57 A;  1GFC A;  1UHC A;  1XOV A;  2DX1 A;  2K6D A;  4OMN A;  2LJ3 A;  3EG0 A;  3VS1 A;  3SHW A;  1UG1 A;  1YCS B;  2KRN A;  1MUZ A;  2DA9 A;  3A98 A;  2CUB A;  2JMC A;  1H8K A;  1CKA A;  2FPF A;  4IIM A;  4KRT A;  1M3A A;  4J9G A;  2CSI A;  4R0K A;  1WLP B;  1X2K A;  5GJW B;  3PE0 A;  2IIM A;  4RTZ A;  1G83 A;  2ED0 A;  1T3L A;  2EYY A;  4JJC A;  2A08 A;  3I35 A;  4HXJ A;  1YN8 A;  2VWF A;  1HD3 A;  1JXM A;  2CDT A;  2LJ0 A;  2EYZ A;  2A28 A;  2I0N A;  2O2O A;  1GCQ C;  1NEG A;  4RTV A;  1KJW A;  1PNJ A;  1SRL A;  3QWX X;  4QT7 A;  1VA7 A;  1QLY A;  4HCK A;  1VYT A;  2LQN A;  1UGV A;  2DBM A;  2QDL A;  3TSZ A;  2KT8 A;  2CT4 A;  1TUD A;  2L3P A;  3PVQ A;  2DM1 A;  1FYN A;  2KYB A;  2G6F X;  3H0F A;  1SSH A;  2KRM A;  3H41 A;  2OAW A;  1AVZ C;  1K9A A;  3UA7 A;  4LN2 A;  4GBQ A;  1AEY A;  4OMM A;  1BK2 A;  2DNU A;  1AWW A;  2BZY A;  4M4Z A;  2K3B A;  1TG0 A;  1H92 A;  3VS5 A;  2E5K A;  2AZV A;  3U23 A;  1X6G A;  4ZNX A;  2DRK A;  1ZBJ A;  3TVT A;  2FPE A;  1NG2 A;  1X43 A;  4ORZ A;  3ZL7 C;  4Z88 A;  2ENM A;  5HCK A;  1X6B A;  2LX7 A;  1U3O A;  4RUG A;  1IO6 A;  2JM9 A;  3M0R A;  4HVW A;  2ROT A;  3LH5 A;  1E6H A;  2JW4 A;  1JU5 C;  1NEB A;  4JJD A;  4Y92 A;  2GTO A;  2KNB B;  2DJQ A;  2EPD A;  2K79 A;  1UJY A;  1ZUY A;  2J6F A;  1K4U S;  2O9S A;  3UF4 A;  2J05 A;  2SEM A;  3M0U A;  1AWX A;  2DL4 A;  3UA6 A;  4HVU A;  1ABO A;  2A37 A;  4OML A;  2O88 A;  1E6G A;  2JT4 A;  1I07 A;  4Z89 A;  2VKN A;  1RI9 A;  2RPN A;  2MOX A;  2DL8 A;  4LUD A;  3KFV A;  2DL5 A;  1GCP A;  1SPK A;  1UTI A;  2A36 A;  1JQQ A;  3EGU A;  2M51 A;  2LNH B;  2FRW A;  5I22 A;  1JEG A;  2LCS A;  2AKK A;  1OV3 A;  2PNI A;  1ZSG A;  4WCI A;  2GGR A;  1OPK A;  1T0H A;  4A63 B;  4Z8A A;  2L2P A;  2DIL A;  1UHF A;  1WIE A;  2SRC A;  2JMA A;  2D8J A;  2NWM A;  1HJD A;  3H0I A;  4JJB A;  2OI3 A;  2DL3 A;  1QKX A;  4AFQ C;  4J9B A;  2DL7 A;  3QWY A;  2LZ6 B;  2F2W A;  2L3Q A;  1M30 A;  5IHN A;  1K0S A;  1UUE A;  1WXT A;  1AWJ A;  2YUO A;  2KRS A;  2EGC A;  1X69 A;  2F2X A;  4J9E A;  5L23 A;  5IH2 A;  2FO0 A;  2RQR A;  1W6X A;  1WFW A;  1YWO A;  1K0X A;  1TUC A;  1WDX A;  1PKT A;  2KE9 A;  3ULR B;  4K11 A;  2NUZ A;  2YUP A;  1GBR A;  4GLM A;  1T0J A;  1AZE A;  1OOT A;  2KYM A;  3M0Q A;  2EBP A;  2DRM A;  2RQV A;  1QKW A;  3THK A;  2HCK A;  1UDL A;  4RTY A;  4J9D A;  4OMQ A;  1NYF A;  1HSQ A;  2MCN A;  3VS2 A;  1JXO A;  1NYG A;  1T3S A;  1W1F A;  1QWE A;  1UJ0 A;  4J9H A;  5FW9 A;  1MV0 B;  3M0S A;  4CC2 A;  2FPD A;  3NGP A;  2ROL A;  4CC3 A;  5ECA A;  2O31 A;  1X2Q A;  1WA7 A;  1K1Z A;  3R6N A;  3VRY A;  2X3X D;  1NLO C;  1AWO A;  1PRM C;  4AFZ C;  2F2V A;  3EHQ A;  1GBQ A;  2D0N A;  4DEY A;  1V1C A;  4X1V A;  3CQT A;  2HBW A;  1I1J A;  2V1R A;  2AZS A;  2FRY A;  1GCQ A;  4AFU C;  2X3W D;  1YNZ A;  2GBQ A;  4EIK A;  1UE9 A;  1I0C A;  2HEQ A;  2YUQ A;  1GRI A;  1PKS A;  1M8M A;  1ARK A;  1EFN A;  1PRL C;  1ABQ A;  2EW3 A;  3RBB B;  2LQW A;  1E7O A;  1Z9Q A;  1MV3 A;  2D8H A;  1RLP C;  5FWB A;  2L0A A;  3C0C A;  3NMZ C;  3O5Z A;  4JZ4 A;  1UFF A;  5IHK A;  1GL5 A;  4RTT A;  1JO8 A;  4ESR A;  3VS3 A;  2DBK A;  1N5Z A;  2FG0 A;  1G2B A;  1OEB A;  3JV3 A;  1WXB A;  1KIK A;  2BZX A;  1M3C A;  2RQW A;  3I9Q A;  1J3T A;  1RUW A;  2BZ8 A;  4CC7 A;  2EGE A;  1RLQ C;  4F17 A;  1K76 A; 
#chains in the Genus database with same CATH topology
 4X9D A;  4D6W A;  1WZO A;  2RJE A;  4J9I A;  2B86 A;  3CCS T;  4HVV A;  5GJV B;  1S72 T;  2VGN A;  4AFS C;  5LJ5 d;  2LMJ A;  1X6O A;  2OTL Q;  1MHN A;  1Y96 A;  3S3N A;  2MPX C;  2YLC A;  1PC0 A;  2R5M A;  3M57 A;  2YT6 A;  1M27 C;  1TXQ A;  4L59 A;  1KK7 A;  4F16 A;  3CCE A;  3MHX A;  3OS5 A;  4LUE A;  4M77 F;  2P84 A;  5FU6 C;  1SHG A;  2EGA A;  3OSV A;  2HAX A;  1VQL T;  3BE3 A;  2PTK A;  2B8A A;  1YJ9 Q;  3SWN A;  4BY6 C;  1VQ6 Q;  1ZUK A;  1U06 A;  2X9H A;  1BB9 A;  1MNE A;  1KQS P;  1WHM A;  4LXC A;  2CZ1 B;  3NPF A;  5A0G A;  4M75 A;  2C0O A;  1RAC B;  4C92 A;  2CUD A;  5GAO r;  2KR3 A;  1KSW A;  2XD0 A;  3JCM b;  3IQL A;  1IHV A;  1VQN T;  2CP5 A;  4M7D C;  1PSE A;  3LX7 A;  1Y0M A;  4R56 A;  1YIT A;  5DLQ E;  3HFO A;  3I5R A;  4DBQ A;  1YI2 A;  2K7A A;  4WF2 A;  3RUX A;  3DLL A;  1D0Z A;  3CC2 Q;  2HKQ B;  1GFD A;  3OSS C;  4NS5 A;  1LVK A;  1O9S A;  2OJ2 A;  1QVF A;  4X9C A;  1VQ7 Q;  4BY6 B;  1YBY A;  4P5N A;  1G5V A;  2ZPG B;  4KUL A;  1WI7 A;  2KGT A;  3REA B;  2JS2 A;  4PJN A;  2E6Z A;  4JRI A;  2KT1 A;  4O5V A;  3CMA A;  4M78 G;  1IRX A;  5FWC A;  1OU8 A;  1A0N B;  4M7D G;  3C12 A;  2HBP A;  5GMK l;  2P4R A;  2EKH A;  3V7C A;  1YIT Q;  3CXC A;  3G4S T;  1VQ4 T;  4PKC C;  5IXB A;  1M90 U;  2ZAE A;  1ACM B;  3S3M A;  1SEM A;  2DJZ A;  4F7U G;  3H9N A;  1M1K U;  2EVR A;  4KGV B;  4PJM A;  1K9M U;  1M9S A;  5KYY B;  4E7H A;  4Q5W A;  3OYJ A;  4M75 F;  3MET A;  1QVG P;  4KH1 B;  5FLX E;  4MZP A;  2QG9 B;  2KBT A;  1LNX A;  2BTT A;  5EC7 A;  3X26 B;  1Q81 C;  3HRS A;  2IVW A;  2K6D A;  4OMN A;  3EG0 A;  1K9M C;  3L2R A;  3MEA A;  3FLG A;  3JSC A;  2COW A;  3A98 A;  1UGP B;  1RAH B;  1VQ8 Q;  2OTJ A;  5GAM e;  1M3A A;  4EPC A;  3OYE A;  3A5Z B;  4E7I A;  1N6A A;  3MEV A;  2WSC E;  4QQ6 A;  1KD1 U;  4R0K A;  2RHX A;  5GAM h;  4FYV B;  4C92 E;  1W2B S;  3PE0 A;  2IIM A;  1QP2 A;  2CP2 A;  2EYY A;  2HMA A;  2LQK A;  4OF1 A;  3GNG A;  3H8Z A;  5GAN 2;  2CDT A;  1FMV A;  2DTO A;  2LJ0 A;  4C5H A;  1QQJ A;  2A28 A;  2QGF B;  4BE1 A;  1VQP T;  4RTV A;  1NEG A;  3PMT A;  2NUP B;  1PNJ A;  3EFS A;  2HQE A;  2DIG A;  1QLY A;  2DKG A;  2K5I A;  1DJ7 B;  1VQO T;  1AT1 B;  1UGV A;  2PVD B;  2DBM A;  2QDL A;  3PMI A;  1QCN A;  4FIB A;  1FMW A;  1TUD A;  3PVQ A;  4C5E A;  2AT1 B;  4M75 B;  1FYN A;  2KYB A;  3H0F A;  1YHQ A;  2KRM A;  5LJ3 j;  5GAN 7;  1AVZ C;  2M1H A;  3UA7 A;  4WTO B;  2E41 A;  1BCM A;  4C0D B;  4JRP A;  2K3X A;  1YJ9 T;  1AWW A;  2AHJ B;  4B9X A;  2HD0 A;  2K3B A;  2MAM A;  3CCM A;  1M8V A;  3L2W A;  4ANJ A;  2H3E B;  3VS5 A;  1JJ2 S;  3QPH A;  1PG5 B;  2Y90 A;  3OBY A;  2CP3 A;  1X6G A;  5KYX A;  3CC4 A;  3RKW A;  4MML A;  3CCU T;  4XK8 E;  1X6B A;  4FYW B;  2JM9 A;  4ZN1 A;  2ROT A;  2E65 A;  1E6H A;  2JW4 A;  5KCH A;  1NEB A;  3FC3 A;  2R5A A;  1KC8 C;  2F69 A;  1FXX A;  1UJY A;  2J6F A;  3MCA B;  2QA4 Q;  3MEW A;  3M58 A;  3AHU A;  2WAC A;  1VQL A;  1PD1 A;  1AWX A;  3QJY A;  2JOY A;  3JCM Q;  2DL4 A;  4HVU A;  4OML A;  2YLB A;  1I5L A;  4PNO A;  4LUD A;  2DL8 A;  1QP3 A;  1TOV A;  3KFV A;  2D9T A;  2V8J A;  1GCP A;  1UTI A;  1YJN A;  3CPF A;  2LNH B;  1VQ9 T;  2JVV A;  3OMG A;  5I22 A;  1RAF B;  1JEG A;  1JJ2 A;  2MK5 A;  2PNI A;  4J8O A;  2GGR A;  4Z8A A;  2RHI A;  1RL2 A;  1UHF A;  1NPR A;  2RH2 A;  5HY6 A;  4FW1 A;  1YIT T;  2NWM A;  4M7D D;  1QVF P;  4OVA A;  3JB9 D;  5CKD A;  3A8G B;  3HFN A;  1MMD A;  3OYA A;  4HCZ A;  3CCS Q;  1EIF A;  1Q82 R;  1S72 Q;  3QZ9 B;  2YUO A;  1X69 A;  2EGC A;  4M77 C;  3CME T;  5CKE A;  2DAQ A;  2DYI A;  4A54 A;  2RQR A;  3GOX A;  1WFW A;  3LGF A;  4JLG A;  4A4F A;  2OTL T;  1TUC A;  3T9N A;  3I56 T;  2NLU A;  1PKT A;  3VYH B;  2E12 A;  2YRD A;  4ZN3 A;  1OOT A;  1N8R R;  2EBP A;  3G6E Q;  3V8J A;  1SF9 A;  2YXY A;  2RK1 A;  1NYF A;  2QQR A;  1HSQ A;  5GAM g;  2YRV A;  1JXO A;  3CCJ T;  1TUG B;  4HCB A;  5KYX B;  2EQK A;  1OQK A;  1VQ4 A;  2X4J A;  3PFS A;  4M77 A;  2FPD A;  2A0F B;  2ROL A;  1W2B A;  2RI2 A;  4C0F A;  5A0L A;  1F1B B;  5ECA A;  2O31 A;  3L2Q A;  1X2Q A;  3CD6 T;  2EYQ A;  4M75 G;  4C92 G;  5LJ3 d;  3VRY A;  5FU6 B;  1JJ2 P;  4M7A D;  3VV0 A;  2QQB A;  1NJI U;  1TTH B;  2DXC A;  1AWO A;  2F2V A;  1GBQ A;  2D0N A;  5GAO m;  4DOW A;  2RA2 A;  3CCQ A;  3J7A F;  3G71 A;  1GCQ A;  4AFU C;  1D0Y A;  1VQN Q;  2HEQ A;  2COZ A;  4C92 F;  3OYI A;  1PKS A;  1M8M A;  1OZ2 A;  3JCM c;  3CCE Q;  2LQW A;  3ZEH A;  4ZGD B;  1MV3 A;  2D8H A;  4M7D B;  3C0C A;  1KHC A;  4QQG A;  4RTT A;  4FM4 B;  1JO8 A;  3PIO A;  4ESR A;  3VS3 A;  3M5A A;  2QXF A;  1N8R U;  3SDZ A;  4M7A E;  1G2B A;  1BI0 A;  1W4S A;  1KIK A;  4JS5 A;  1M3C A;  5KE3 A;  2WSE E;  2EGE A;  3CCR T;  2EWN A;  2HL5 C;  3TCJ A;  4FW2 A;  1I81 A;  2ABL A;  2MWO A;  3O8V A;  2X4W A;  2J7I A;  3CCV T;  1FX7 A;  3X25 B;  1CSK A;  4OB3 B;  2LJ1 A;  3JCM f;  5DLO A;  5IT9 E;  2Y4Y A;  4L5G A;  1I4K 1;  3PTA A;  2E5Q A;  1VQ4 Q;  4YTL A;  2JS0 A;  3REB B;  3CCL T;  3VS6 A;  5D6Y A;  4E6R A;  2VUB A;  2DFU A;  3FJ5 A;  3MPU B;  2FEI A;  3JCM d;  1WGS A;  1ZX6 A;  3GPL A;  3OYH A;  1WHL A;  2QTX A;  2GFA A;  3M54 A;  4F7U F;  3QDR B;  1MMN A;  3OYK A;  5IAY A;  4XU3 A;  2X51 A;  4PFO A;  2EFI A;  4JDS A;  5EG2 A;  2KXC A;  1LCK A;  3X28 B;  4LDU A;  1BBZ A;  4DA4 A;  1SSF A;  2W0Z A;  3OBW A;  5GAN e;  4HKE A;  3KBG A;  2O9V A;  1KQ2 A;  5CKH A;  2J6K A;  1KD1 C;  1G3S A;  2LCC A;  3M0T A;  5LJ3 e;  4RKU E;  2H3J A;  1W70 A;  3OYY A;  2G3R A;  5KCO A;  2P0Q A;  5FU7 B;  4XU0 A;  4BAC A;  5CAI A;  2V8K A;  5FRO A;  2XKO C;  2A3L A;  1Q82 C;  4A4G A;  4ZGE B;  1D0X A;  3H6Z A;  2K4Y A;  4C8Q F;  1SRM A;  2DYB A;  2RHU A;  2ESW A;  1C0M A;  2GTJ A;  4E2F B;  1WX6 A;  3JRZ A;  7AT1 B;  4DOV A;  5I21 A;  4XTY A;  1P92 A;  4MZM A;  1UB4 A;  2EYX A;  1BCO A;  1YJW T;  3TEE A;  4BDY A;  4RTU A;  1H3H A;  4LE9 A;  2CT3 A;  2DF6 A;  3EG1 A;  3EFO A;  1PCX A;  3I5S A;  4M7D F;  4TVR A;  3JB9 H;  3H0H A;  3MP8 A;  4JZ3 A;  5D7U A;  3PVL A;  2EQI A;  1YWP A;  1VQ5 T;  2ED1 A;  3MO8 A;  3VKI A;  1EX4 A;  1UEC A;  1QWF A;  2YSQ A;  3RIR A;  1YIJ T;  4FU6 A;  1XOV A;  4PJO B;  5AYF A;  1Y96 B;  3NTK A;  1B7T A;  2BKD N;  3CCU Q;  2QA4 T;  2KI7 A;  2VAS A;  1MUZ A;  2DA9 A;  3JCM g;  3J81 E;  4CI0 C;  2JMC A;  1H8K A;  3M56 A;  2FPF A;  2K57 A;  2PUK B;  3LYI A;  4IIM A;  3JB9 J;  3GP8 A;  4J9G A;  2QEX Q;  3DKM A;  1WLP B;  3DLM A;  2IG0 A;  3HP9 A;  2WSF E;  4XQ3 A;  3SWN B;  5CKB A;  3I35 A;  2XDP A;  4QVZ A;  2VWF A;  3CMA T;  4PJO G;  4LDY A;  2BIV A;  5GMK j;  1V76 A;  1ZQ1 A;  2LNV A;  3ZFJ A;  4M7A F;  3S6W A;  4EMK B;  2FZC B;  1VQN A;  3QWX X;  5C0M A;  2QTV A;  3QBY A;  4PJL A;  1K8A R;  1HYO A;  1VQP Q;  1K73 C;  2DM1 A;  1ZA1 B;  2EAY A;  1SSH A;  3A8M B;  3CBM A;  3M55 A;  5GAN 5;  4IUP A;  5CQY A;  3MKD A;  2RB6 A;  3CBO A;  1WHJ A;  1K9A A;  2YWW A;  2LX9 A;  4M78 A;  3CME Q;  1WHH A;  4E7S A;  1Y07 A;  2KVQ G;  3TU4 K;  2AZV A;  1X01 A;  1KHI A;  1OUL A;  2GF7 A;  4JUV A;  3U23 A;  4ZNX A;  4F04 B;  3TVT A;  2CS7 A;  3EGX A;  2EJF A;  3CCV A;  1YI2 Q;  1K73 R;  3ZL7 C;  1W2B P;  2ENM A;  3UPU A;  2CP0 A;  5KE2 A;  1U3O A;  2DXU A;  1IO6 A;  3M0R A;  3C4S A;  3JB9 F;  1BI1 A;  4BE2 A;  3JCM e;  3FEO A;  4JJD A;  4CRI A;  2KK4 A;  3OB9 A;  4N0A A;  2KNB B;  4XU2 A;  1KG1 A;  5CR2 A;  1K4U S;  1C1A A;  2J05 A;  2ZPH B;  2NUT B;  1TU0 B;  1ABO A;  2RK2 A;  2JT4 A;  2XU8 A;  1WQW A;  4Z89 A;  1OX9 A;  1RI9 A;  3CC2 T;  3G6E A;  2A36 A;  4OP0 A;  3HHT B;  4LDW A;  2LCS A;  2AKK A;  1OV3 A;  4J6W A;  4PJO E;  5DM7 R;  1VQ8 A;  2OTJ Q;  3EFR A;  3G1J A;  4N0A C;  1OPK A;  1T0H A;  4A63 B;  1VQM A;  8AT1 B;  2DIL A;  5AT1 B;  3I55 Q;  5J3B A;  1VQ9 Q;  2ZCF B;  2DVE A;  1QKX A;  1RAE B;  2RJC A;  4N4I A;  5LJ5 g;  1B34 B;  2L3Q A;  2LZ6 B;  4XAX B;  1K0S A;  4JRQ A;  1R0C B;  3CC4 Q;  1ZA2 B;  4QKU A;  2CP6 A;  4IKF A;  1Y7X A;  2KRS A;  3L2V A;  5LL6 S;  1VQO A;  1W6X A;  2COY A;  4IUQ A;  3ME9 A;  2E1H A;  4PJO F;  3EH1 A;  4PJO A;  3ULR B;  2YUP A;  1M90 R;  1GBR A;  1AZE A;  3WVE B;  1JRI A;  1BYM A;  4XTX A;  3CXC P;  2E3H A;  2RQV A;  2O4X B;  4BI8 B;  2P4T A;  4BUG A;  1QKW A;  1RAA B;  2HCK A;  4J9D A;  3I56 Q;  2MCN A;  3A8H B;  3VS2 A;  2QK0 A;  1NYG A;  2JTF A;  1W1F A;  1QWE A;  4J9H A;  2ZPF B;  1MV0 B;  3CC7 T;  1MND A;  2OX7 A;  3QYH B;  4XTZ A;  5GMK m;  3QJ6 A;  3CC4 T;  3HKS A;  4N4G A;  1WA7 A;  2P0K A;  3JCM J;  1BI3 A;  3X24 B;  2X3X D;  3CCJ Q;  3VYG A;  3NTH A;  3I55 A;  2QYZ A;  1YHQ Q;  3PNW C;  4PLI A;  3OS0 A;  1D3B B;  3QUI A;  5GAN 6;  1V1C A;  5LJ5 e;  3OYC A;  2O4X A;  3CD6 Q;  2HBW A;  1Q86 C;  2V1R A;  2DD5 A;  2X3W D;  1YNZ A;  3S3O A;  3INZ A;  3CCM Q;  1UE9 A;  4QVC A;  3CCS A;  1IGU A;  1S72 A;  4KUI A;  1EFN A;  2CGH A;  2FZG B;  1ABQ A;  2DTI A;  2M02 A;  1E7O A;  1Z9Q A;  1Q86 U;  1RLP C;  5FWB A;  3LGL A;  1ZSZ A;  5LJ5 j;  5IHK A;  3AT1 B;  2K3Y A;  3JB9 G;  3RMQ A;  4KBM B;  3CCE T;  4ELZ C;  3JV3 A;  2VV5 A;  8ATC B;  2VGM A;  3I9Q A;  2RJF A;  4KGZ B;  1RLQ C;  4XTU A;  3E9F A;  2M16 A;  4F17 A;  2KEA A;  2VC8 A;  2J6O A;  1OYX A;  1QMC A;  4O6J A;  3EG2 A;  1N8R C;  4DEX A;  2VVK A;  1Q81 R;  2RF0 A;  2NUT A;  2C06 A;  2XI9 A;  3SEM A;  2X4Y A;  1SG5 A;  3TSW A;  1WXU A;  1QCF A;  2DO3 A;  2RNA A;  4BI3 A;  2C0T A;  2X4X A;  3NHN A;  2QQ9 A;  1NJI C;  3KUF A;  4IUU A;  4A4K A;  2M9U A;  1M4Z A;  2K2V A;  5I2S A;  3C95 A;  5I11 A;  5FU7 C;  2JTM A;  3SFM A;  4D8K A;  3BDU A;  1ZSZ C;  3CXC S;  2F1L A;  2XMF A;  3RMS A;  1KQS S;  4M7A G;  2QGG A;  2GFU A;  1PWT A;  3WVD B;  3DB4 A;  1CKB A;  1YP5 A;  2K2M A;  5GAN d;  2CH4 A;  3V8K A;  1Q81 U;  1AOJ A;  3N5B B;  5GAO q;  3CPW P;  2MYS A;  1VYU A;  3UAT A;  5I2M A;  2CSQ A;  2CYZ B;  2CH4 W;  1H64 1;  2PZ1 A;  2DLP A;  4EMH A;  1M2V A;  3L2U A;  3BFM A;  2M0Y A;  3OYM A;  2W10 A;  2D1X A;  2R58 A;  2YUN A;  3V8L A;  1NM7 A;  1AD5 A;  5KH6 A;  1PD0 A;  3OYB A;  1X27 A;  2BE7 D;  2BE9 B;  2IPO B;  2JZ2 A;  1VYV A;  1WYX A;  2RD1 A;  4PJO C;  4EMK C;  3PIP A;  2JNG A;  2DD4 A;  1M5Q 1;  1Q82 U;  2DMO A;  3M4Y A;  3RNJ A;  3LW5 E;  3QII A;  2RQT A;  2FHD A;  1HXD A;  4ELY C;  1WNL A;  2ZPE B;  4IUT A;  4NL2 A;  3OW2 S;  2HQX A;  2K9G A;  3CCR A;  1WPY A;  1U5S A;  2V1Q A;  2DK3 A;  3QG1 A;  3M59 A;  2D6F A;  2KXD A;  4PFP A;  2RHY A;  4E47 A;  3OMC A;  2XDB A;  3VS7 A;  1N27 A;  4J5Y A;  3J80 E;  1TS9 A;  2RQU A;  2PVO B;  1WHG A;  1SHF A;  1V29 B;  1D09 B;  4RTX A;  1LOJ A;  1Y57 A;  1GFC A;  2DX1 A;  1VQK A;  3VS1 A;  3OYD A;  3SHW A;  1UG1 A;  1YCS B;  2CUB A;  3G4S Q;  1CKA A;  4KRT A;  5CK9 A;  1U8R A;  1TSF A;  4J6X A;  2CSI A;  2XK0 A;  1LJO A;  1VQO Q;  2V26 A;  5GJW B;  1G83 A;  3FB9 A;  2ED0 A;  1T3L A;  3SD4 A;  2FYK A;  4FYX B;  2DPP B;  5DY9 A;  5C6S A;  1Q7Y U;  3WXM B;  5GAN 8;  5GAO p;  1JXM A;  1QW1 A;  5CVI A;  2KDS A;  1U1S A;  1BIA A;  4RCC A;  1GXI E;  2I0N A;  1GCQ C;  1YFN A;  3ASK A;  1G3T A;  1M2V B;  1Q7Y C;  4QT7 A;  3CCR Q;  4HCK A;  1Q86 R;  5L8R E;  5GAN g;  4E7J A;  2DIQ A;  3TSZ A;  4C0Z A;  1G3Y A;  5GAO n;  2CZ0 B;  4M77 G;  2CT4 A;  2KT8 A;  3BDL A;  3CCV Q;  2PUO B;  4V2S A;  4A4E A;  2G6F X;  4C5G A;  1HK9 A;  2A7Y A;  2OAW A;  5CIU A;  3BY7 A;  4LN2 A;  4GBQ A;  4XU1 A;  4OMM A;  3OYG A;  5KYU A;  1PM3 A;  2BZY A;  2OAU A;  4X34 A;  3CBP A;  1TG0 A;  2XIC A;  2PVG B;  1H92 A;  1D1B A;  4M77 B;  1JBM A;  1YJW A;  1O75 A;  3R6O A;  4QVD A;  2DRK A;  1ZBJ A;  5J26 A;  1NG2 A;  3OQ5 A;  5GAM j;  4FYY B;  1VQ9 A;  3E1S A;  3HPW A;  4ZGJ B;  1M1K R;  3L1A A;  4J7F A;  4E7K A;  4BI4 A;  3M9Q A;  4HVW A;  1SKU B;  3LH5 A;  2VXE A;  1KC8 R;  1VQ5 A;  1KQ1 A;  5M9O A;  3QO3 A;  2K79 A;  1ZUY A;  3EG9 A;  2CP7 A;  2EQJ A;  2O9S A;  1VQ7 A;  1MMA A;  3UA6 A;  1YJN Q;  2A37 A;  4FT4 A;  2O88 A;  1C6V X;  4ATO A;  4II1 A;  1JQQ A;  3EGU A;  5KYW B;  3X20 B;  1QVF S;  3TRE A;  5LJ5 h;  3CPW S;  1ZBX A;  2KMT A;  3L42 A;  5HK0 A;  2L2P A;  1WIE A;  2LDM A;  2SRC A;  1M90 C;  2D8J A;  3OA6 A;  3KXT A;  1VQ6 T;  2OI3 A;  2R57 A;  2D0Q B;  4E7Z A;  4UC4 A;  2DL7 A;  4M78 D;  1M30 A;  5IHN A;  3CCJ A;  4OB2 B;  1TWB A;  5L23 A;  4J9E A;  1YJN T;  2HL3 A;  3A8L B;  5IH2 A;  1WJQ A;  1YWO A;  3CD6 A;  1VQ5 Q;  2LRQ A;  4KH0 B;  2DXT A;  1WDX A;  4K11 A;  2ZPI B;  2E6N A;  2NUZ A;  1B34 A;  2QQS A;  2HQH A;  4JS4 A;  2DRM A;  2HZY A;  2Y4X A;  2FVU A;  5CQX A;  2DXB A;  1KC8 U;  3UDC A;  4OMQ A;  3G71 T;  1QVG S;  2JUF A;  3EH2 A;  3JCM X;  4M77 D;  4M7D E;  3FDR A;  1UJ0 A;  3E19 A;  5FW9 A;  4M78 E;  3NGP A;  3CME A;  5GAN 4;  4XTV A;  4QW2 A;  4DBF A;  4M7A A;  1R8O B;  2OTL A;  1K1Z A;  3R6N A;  4JRK A;  3V7R A;  3QXE B;  4NOY A;  4MDW A;  1NLO C;  5KYN A;  5FRN A;  4AFZ C;  3LH0 A;  1XTD A;  4AT1 B;  4DEY A;  2L5Q A;  3CQT A;  4X1V A;  4FT2 A;  2NUP A;  3HRU A;  2FRY A;  1M1G A;  2ZGW A;  1K73 U;  1QCO A;  1AHJ B;  2FL7 A;  3JCM P;  4RG2 A;  4DBH A;  2YUQ A;  3G71 Q;  1UGS B;  1PRL C;  4ME7 A;  3RBB B;  5GAM d;  4M78 B;  4B9W A;  3EGX B;  3RKY A;  4C8Q G;  4FSX A;  2L0A A;  3PGG A;  3NMZ C;  5HKC A;  3O5Z A;  1UFF A;  3JB9 I;  1GL5 A;  2YHT A;  2DBK A;  3D7S B;  2QAS A;  2VYT A;  1WXB A;  2EQU A;  2E3I A;  1J3T A;  3FIF A;  4RMO A;  3G4S A;  1OX8 A;  2HSE B;  1K76 A;  1ZSZ B;  4KUD K;  1BIB A;  4M7D A;  1WJS A;  3EHR A;  4IIO A;  3OW2 P;  2JTE A;  2GQI A;  4OMO A;  1K8A C;  3EGD B;  1YI2 T;  1IHW A;  3RES A;  4DBR A;  4F7U A;  2XID A;  2JXB A;  2QI2 A;  2AK5 A;  1BKB A;  2E10 A;  1VQL Q;  4M78 C;  1R0B G;  4OMP A;  4Y28 E;  4D8D A;  4BD3 A;  1BU1 A;  1Q95 G;  4IUV A;  2LT4 A;  5A2Q E;  2RMO A;  5LJ3 f;  2OTJ T;  5CKF A;  3VRZ A;  5CCA A;  4AG1 C;  1OZ3 A;  5GAN f;  3TQ7 P;  2DZ9 A;  4MZT A;  4PL6 A;  4Y91 A;  3GNF B;  2DE0 X;  3M0P A;  4RCB A;  4M7A B;  2KRO A;  2EIF A;  2FB7 A;  2GNC A;  1OU9 A;  1KD1 R;  2RN8 A;  4PK4 A;  2H8H A;  1VIE A;  2LP5 A;  2DET A;  1ZLM A;  3CC7 A;  1BI2 A;  4J7I A;  3VS0 A;  1VQP A;  4PLL A;  1QVG A;  3EG3 A;  5IHI A;  2MIO A;  4J83 A;  5IXF A;  2AKL A;  4N4H A;  5D6W A;  1OPL A;  2CRE A;  2LC4 A;  1AZG B;  3EGD A;  3LWH A;  2ATC B;  1IB8 A;  4KGX B;  4OMF B;  2YRC A;  3OS1 A;  4RG8 A;  3I55 T;  3VS4 A;  4JPB W;  4OB1 B;  4CC4 B;  2KQW A;  3LLR A;  2XG8 D;  3NTI A;  1YJW Q;  1S1N A;  2DEU A;  1B07 A;  2VB6 A;  3OW2 A;  5LJ5 f;  3Q1J A;  4C8Q D;  4F14 A;  3SWN C;  3MEU A;  1NLP C;  5LJ3 h;  4LNP A;  4ZTJ A;  1G3W A;  4FSS A;  3GBQ A;  4C8Q C;  1D1A A;  1JB0 E;  4J9F A;  2ECZ A;  2CZ6 B;  4MMK A;  3E2U A;  2P0P A;  1FMK A;  2EYW A;  2F5K A;  4M75 E;  1MGQ A;  4E7L A;  1Z9Z A;  3P8H A;  4LD9 K;  2JM8 A;  2XDD A;  2HDA A;  2J06 A;  2MI6 A;  4C0G A;  3QZ5 B;  4RTW A;  3VUZ A;  1YIJ Q;  3OYN A;  1PHT A;  2JN0 A;  2L8D A;  2L3S A;  4PJJ A;  4AG2 C;  2VXF A;  2DVJ A;  4XTW A;  1B3Q A;  3PT9 A;  2C0I A;  4HT9 A;  2HSP A;  4Z02 A;  4J9C A;  1M3B A;  4C8Q E;  1XNI A;  4F7U B;  3CCQ Q;  2O01 E;  1KFZ A;  1NPP A;  2RI5 A;  1ZUU A;  4JLI A;  1EZZ B;  5GAO l;  4C8Q B;  2YDL A;  3RER A;  2RHZ A;  4EDU A;  2GQV A;  4M75 D;  3CMA Q;  1UHC A;  1X75 C;  4C92 D;  1N9S A;  2LJ3 A;  2KRN A;  2AIR B;  1UEB A;  2LT1 A;  3ER0 A;  1K9M R;  3QKJ A;  3JCM V;  4OB0 B;  2HNI A;  2DEQ A;  3CCM T;  3VJP A;  5GAN h;  3EAE A;  5CO7 A;  2JJ9 A;  2MMP A;  1NJI R;  1X2K A;  2K5L A;  3EG9 B;  4RTZ A;  2L3R A;  4L6V 5;  4JJC A;  1NE8 A;  2A08 A;  4HXJ A;  4F7U E;  1YN8 A;  1HD3 A;  2K5F A;  5HK3 A;  3CCU A;  3P8D A;  2EYZ A;  1YIJ A;  2QAZ A;  2LVM A;  2O2O A;  3DB3 A;  2I2L A;  1KJW A;  1M1F A;  2F5T X;  2QA4 A;  1SRL A;  1I5O B;  2DER A;  1XQH A;  1Q7Y R;  2QEX T;  1VA7 A;  1VYT A;  3QHS A;  4LD6 A;  1R77 A;  1H3Z A;  2LQN A;  3RR6 A;  2CKK A;  4HCC A;  3GLX A;  3I56 A;  2L3P A;  1IGQ A;  2LTO A;  3UT1 A;  4HA8 A;  3SB2 A;  3H41 A;  3A1P A;  5GAM f;  5IN1 A;  1VQK T;  3OY9 A;  2XHC A;  1AEY A;  1BK2 A;  1ZHI A;  1RAI B;  2DNU A;  2L89 A;  3V7S A;  4M4Z A;  3GF5 A;  5LJ3 g;  2E5K A;  3G7Z A;  2PU9 B;  2KSS A;  1VUB A;  4J6Y A;  3M4G A;  4FCY A;  3E9G A;  1XJW B;  3CC2 A;  2FPE A;  3MP6 A;  1X43 A;  1WHK A;  2E70 A;  4ORZ A;  4BE0 A;  4Z88 A;  2RM4 A;  5GAN j;  5HCK A;  3JCM h;  2LX7 A;  4RUG A;  1RAB B;  9ATC B;  1N9R A;  4M75 C;  1VQ8 T;  2CZ7 B;  1JU5 C;  1I8F A;  3M53 A;  4Y92 A;  3QSU A;  1VOM A;  3CCL Q;  2GTO A;  4FL6 A;  3P8B B;  2DJQ A;  2EPD A;  4PFZ A;  3NFC A;  4VUB A;  3VU3 C;  2KAF A;  2BUD A;  2E4H A;  2ZPB B;  3UF4 A;  1M2O A;  2HKN A;  2SEM A;  3M0U A;  4DQ2 A;  1OI1 A;  5GMK e;  1UGR B;  2X35 A;  5GAN 3;  1E6G A;  1I07 A;  2M0O A;  1D1C A;  2VKN A;  2RPN A;  2MOX A;  3A8O B;  3CPW A;  2DTH A;  2DL5 A;  1SPK A;  2RO0 A;  1WJR A;  2M51 A;  2FRW A;  5KYW A;  4M78 F;  1TH7 A;  1VQM Q;  4C8Q A;  3UWN A;  1ZSG A;  4WCI A;  1MMG A;  3C94 A;  2V8I A;  3GIB A;  2JMA A;  2RI3 A;  1HJD A;  1U1T A;  3H0I A;  4JJB A;  4C0D C;  1RAG B;  3OS2 A;  1M1K C;  5J39 A;  2DL3 A;  1IZ6 A;  2QQA A;  4AFQ C;  3EFO B;  4AMC A;  1YCY A;  2Z0W A;  4J9B A;  2FZK B;  1NZ9 A;  3QWY A;  2F2W A;  3CCQ T;  1UUE A;  1G8X A;  2LQ8 A;  1WXT A;  1AWJ A;  4KT0 E;  3G6E T;  2F2X A;  2RJD A;  2FO0 A;  1IXD A;  4OGE A;  3FRN A;  2LCL A;  3CC7 Q;  1K0X A;  2KE9 A;  3CCL A;  1FWZ A;  2QDY B;  4M77 E;  3JAM E;  4GLM A;  1T0J A;  1RAD B;  1Y71 A;  1VQ7 T;  2KYM A;  3M0Q A;  4LDX A;  4PJO D;  3JCM W;  1VQM T;  1D3B A;  3L2Z A;  4LDV A;  3THK A;  1UDL A;  4RTY A;  1LPL A;  4QQD A;  3OYL A;  4A53 A;  4GLK A;  4JJN K;  3HSB A;  1T3S A;  1VIF A;  4C5I A;  4B6M A;  4GY5 A;  3M0S A;  1KQS A;  4HT8 A;  4CC2 A;  5GMK h;  4CC3 A;  3OYF A;  2PQW A;  3URG A;  2EJ9 A;  3BW1 A;  1WQ7 A;  4MDX A;  2EJG A;  4OGC A;  4C92 B;  1VQ6 A;  3FJP A;  5KYY A;  1PRM C;  4A4H A;  1RI0 A;  3EHQ A;  2MF2 A;  3ZBD A;  5GMK i;  3VUB A;  4ZTF A;  4NL3 A;  1I1J A;  3MJX A;  4EMK A;  2EQM A;  2AZS A;  1UGQ B;  3HRT A;  5FRM A;  2GBQ A;  4BB7 A;  4EIK A;  1I0C A;  1QVP A;  3MP1 A;  1IRE B;  2E64 A;  2GCX A;  2DZC A;  3CEY A;  1GRI A;  1VQK Q;  1ARK A;  4IUR A;  2EW3 A;  3QYG B;  5KYU B;  1YHQ T;  3QDF A;  6AT1 B;  3HTR A;  2KY9 A;  4JZ4 A;  5A0D A;  5D6X A;  3LWI A;  3F70 A;  4BDZ A;  3RDV A;  3RKX A;  3HL8 A;  2ZZD A;  1N5Z A;  2FG0 A;  1OEB A;  1YJ9 A;  1NBE B;  1K8A U;  2BZX A;  4C92 C;  2MWP A;  2RQW A;  1RUW A;  2BZ8 A;  4CC7 A;  4EMG A;  2NYS A;  2QEX A;  2EKO A;  1PSF A;  4R55 A;  4M7A C; 
#chains in the Genus database with same CATH homology
 2KEA A;  3EHR A;  4IIO A;  2J6O A;  2ABL A;  4J9I A;  2B86 A;  2JTE A;  3EG2 A;  4HVV A;  5GJV B;  2GQI A;  2J7I A;  4OMO A;  4DEX A;  4AFS C;  2VVK A;  2RF0 A;  1CSK A;  3SEM A;  2JXB A;  2LMJ A;  3TSW A;  1WXU A;  2AK5 A;  2LJ1 A;  1QCF A;  2RNA A;  2YT6 A;  4OMP A;  1M27 C;  4D8D A;  2C0T A;  3NHN A;  1BU1 A;  4F16 A;  4LUE A;  2JS0 A;  3REB B;  1SHG A;  2RMO A;  3VS6 A;  2EGA A;  4E6R A;  3FJ5 A;  3VRZ A;  2FEI A;  4AG1 C;  1ZX6 A;  2PTK A;  5I11 A;  4D8K A;  2DE0 X;  1ZUK A;  3M0P A;  2KRO A;  2GNC A;  1U06 A;  2XMF A;  1BB9 A;  2RN8 A;  1PWT A;  2H8H A;  3NPF A;  2LP5 A;  1CKB A;  1YP5 A;  2C0O A;  1ZLM A;  2K2M A;  2CUD A;  3VS0 A;  2CH4 A;  3EG3 A;  5IHI A;  2MIO A;  2KR3 A;  1AOJ A;  1KSW A;  5IXF A;  2AKL A;  3IQL A;  1OPL A;  2KXC A;  1VYU A;  2CRE A;  1LCK A;  3UAT A;  1BBZ A;  2CSQ A;  2CH4 W;  2PZ1 A;  1AZG B;  2DLP A;  1Y0M A;  2W0Z A;  3VS4 A;  4JPB W;  2O9V A;  2M0Y A;  3I5R A;  4CC4 B;  2W10 A;  2D1X A;  2YUN A;  2J6K A;  3M0T A;  1S1N A;  2K7A A;  1NM7 A;  1AD5 A;  1B07 A;  1W70 A;  1GFD A;  4F14 A;  1X27 A;  1NLP C;  2OJ2 A;  4LNP A;  4FSS A;  3GBQ A;  4J9F A;  1SRM A;  1VYV A;  2ECZ A;  2DYB A;  1FMK A;  1WYX A;  2EYW A;  2ESW A;  1WI7 A;  1Z9Z A;  2KGT A;  3REA B;  2GTJ A;  2JS2 A;  2JM8 A;  1WX6 A;  2KT1 A;  2HDA A;  2J06 A;  2DMO A;  4RTW A;  5FWC A;  2EYX A;  3RNJ A;  1PHT A;  2RQT A;  2L3S A;  4RTU A;  1A0N B;  1H3H A;  4AG2 C;  4LE9 A;  2CT3 A;  2DF6 A;  2DVJ A;  3EG1 A;  2P4R A;  2EKH A;  1B3Q A;  3I5S A;  2C0I A;  2K9G A;  2HSP A;  3H0H A;  1U5S A;  5IXB A;  4JZ3 A;  4J9C A;  2V1Q A;  1M3B A;  2KXD A;  1SEM A;  3PVL A;  2EVR A;  2EQI A;  1YWP A;  2ED1 A;  3VS7 A;  1KFZ A;  1UEC A;  1ZUU A;  2RQU A;  1QWF A;  2YSQ A;  2YDL A;  2KBT A;  1SHF A;  2BTT A;  5EC7 A;  4RTX A;  1Y57 A;  1GFC A;  1UHC A;  1XOV A;  2DX1 A;  2K6D A;  4OMN A;  2LJ3 A;  3EG0 A;  3VS1 A;  3SHW A;  1UG1 A;  1YCS B;  2KRN A;  1MUZ A;  2DA9 A;  3A98 A;  2CUB A;  2JMC A;  1H8K A;  1CKA A;  2FPF A;  4IIM A;  4KRT A;  1M3A A;  4J9G A;  2CSI A;  4R0K A;  1WLP B;  1X2K A;  5GJW B;  3PE0 A;  2IIM A;  4RTZ A;  1G83 A;  2ED0 A;  1T3L A;  2EYY A;  4JJC A;  2A08 A;  3I35 A;  4HXJ A;  1YN8 A;  2VWF A;  1HD3 A;  1JXM A;  2CDT A;  2LJ0 A;  2EYZ A;  2A28 A;  2I0N A;  2O2O A;  1GCQ C;  1NEG A;  4RTV A;  1KJW A;  1PNJ A;  1SRL A;  3QWX X;  4QT7 A;  1VA7 A;  1QLY A;  4HCK A;  1VYT A;  2LQN A;  1UGV A;  2DBM A;  2QDL A;  3TSZ A;  2KT8 A;  2CT4 A;  1TUD A;  2L3P A;  3PVQ A;  2DM1 A;  1FYN A;  2KYB A;  2G6F X;  3H0F A;  1SSH A;  2KRM A;  3H41 A;  2OAW A;  1AVZ C;  1K9A A;  3UA7 A;  4LN2 A;  4GBQ A;  1AEY A;  4OMM A;  1BK2 A;  2DNU A;  1AWW A;  2BZY A;  4M4Z A;  2K3B A;  1TG0 A;  1H92 A;  3VS5 A;  2E5K A;  2AZV A;  3U23 A;  1X6G A;  4ZNX A;  2DRK A;  1ZBJ A;  3TVT A;  2FPE A;  1NG2 A;  1X43 A;  4ORZ A;  3ZL7 C;  4Z88 A;  2ENM A;  5HCK A;  1X6B A;  2LX7 A;  1U3O A;  4RUG A;  1IO6 A;  2JM9 A;  3M0R A;  4HVW A;  2ROT A;  3LH5 A;  1E6H A;  2JW4 A;  1JU5 C;  1NEB A;  4JJD A;  4Y92 A;  2GTO A;  2KNB B;  2DJQ A;  2EPD A;  2K79 A;  1UJY A;  1ZUY A;  2J6F A;  1K4U S;  2O9S A;  3UF4 A;  2J05 A;  2SEM A;  3M0U A;  1AWX A;  2DL4 A;  3UA6 A;  4HVU A;  1ABO A;  2A37 A;  4OML A;  2O88 A;  1E6G A;  2JT4 A;  1I07 A;  4Z89 A;  2VKN A;  1RI9 A;  2RPN A;  2MOX A;  2DL8 A;  4LUD A;  3KFV A;  2DL5 A;  1GCP A;  1SPK A;  1UTI A;  2A36 A;  1JQQ A;  3EGU A;  2M51 A;  2LNH B;  2FRW A;  5I22 A;  1JEG A;  2LCS A;  2AKK A;  1OV3 A;  2PNI A;  1ZSG A;  4WCI A;  2GGR A;  1OPK A;  1T0H A;  4A63 B;  4Z8A A;  2L2P A;  2DIL A;  1UHF A;  1WIE A;  2SRC A;  2JMA A;  2D8J A;  2NWM A;  1HJD A;  3H0I A;  4JJB A;  2OI3 A;  2DL3 A;  1QKX A;  4AFQ C;  4J9B A;  2DL7 A;  3QWY A;  2LZ6 B;  2F2W A;  2L3Q A;  1M30 A;  5IHN A;  1K0S A;  1UUE A;  1WXT A;  1AWJ A;  2YUO A;  2KRS A;  2EGC A;  1X69 A;  2F2X A;  4J9E A;  5L23 A;  5IH2 A;  2FO0 A;  2RQR A;  1W6X A;  1WFW A;  1YWO A;  1K0X A;  1TUC A;  1WDX A;  1PKT A;  2KE9 A;  3ULR B;  4K11 A;  2NUZ A;  2YUP A;  1GBR A;  4GLM A;  1T0J A;  1AZE A;  1OOT A;  2KYM A;  3M0Q A;  2EBP A;  2DRM A;  2RQV A;  1QKW A;  3THK A;  2HCK A;  1UDL A;  4RTY A;  4J9D A;  4OMQ A;  1NYF A;  1HSQ A;  2MCN A;  3VS2 A;  1JXO A;  1NYG A;  1T3S A;  1W1F A;  1QWE A;  1UJ0 A;  4J9H A;  5FW9 A;  1MV0 B;  3M0S A;  4CC2 A;  2FPD A;  3NGP A;  2ROL A;  4CC3 A;  5ECA A;  2O31 A;  1X2Q A;  1WA7 A;  1K1Z A;  3R6N A;  3VRY A;  2X3X D;  1NLO C;  1AWO A;  1PRM C;  4AFZ C;  2F2V A;  3EHQ A;  1GBQ A;  2D0N A;  4DEY A;  1V1C A;  4X1V A;  3CQT A;  2HBW A;  1I1J A;  2V1R A;  2AZS A;  2FRY A;  1GCQ A;  4AFU C;  2X3W D;  1YNZ A;  2GBQ A;  4EIK A;  1UE9 A;  1I0C A;  2HEQ A;  2YUQ A;  1GRI A;  1PKS A;  1M8M A;  1ARK A;  1EFN A;  1PRL C;  1ABQ A;  2EW3 A;  3RBB B;  2LQW A;  1E7O A;  1Z9Q A;  1MV3 A;  2D8H A;  1RLP C;  5FWB A;  2L0A A;  3C0C A;  3NMZ C;  3O5Z A;  4JZ4 A;  1UFF A;  5IHK A;  1GL5 A;  4RTT A;  1JO8 A;  4ESR A;  3VS3 A;  2DBK A;  1N5Z A;  2FG0 A;  1G2B A;  1OEB A;  3JV3 A;  1WXB A;  1KIK A;  2BZX A;  1M3C A;  2RQW A;  3I9Q A;  1J3T A;  1RUW A;  2BZ8 A;  4CC7 A;  2EGE A;  1RLQ C;  4F17 A;  1K76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...