3H0FA

Crystal structure of the human fyn sh3 r96w mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
VTLFVALYDYEAWTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Fyn
publication title SH3 domain specificity
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 11
structure length 59
sequence length 59
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3h0fA00
2LX7A 1BB9A 1EFNA 3KFVA 3LH5A 2EGAA 2JS2A 1JU5C 4RTXA 4DEYA 1YCSB 1B07A 1X43A 1WXBA 2D0NA 4LN2A 4HXJA 2FRYA 4JZ3A 4GLMA 1E7OA 2EYXA 3REAB 2FPFA 3PVQA 1IO6A 2B86A 2O31A 3VS3A 1T3LA 2L3PA 2CUBA 3EHRA 3VS1A 4RTZA 4WCIA 2F2VA 3M0SA 1GFCA 4J9EA 2FG0A 1PKTA 1PRMC 1UE9A 2D8HA 2K6DA 4QT7A 3I5RA 4KRTA 1M8MA 2JT4A 1SRMA 1RUWA 1OEBA 4J9DA 1E6GA 3TVTA 5FWBA 2K2MA 4FSSA 4ESRA 2YDLA 4F17A 1UUEA 4CC3A 2I0NA 2W10A 4D8DA 4X1VA 4LE9A 1X2QA 1T0HA 2D8JA 2EPDA 3H0FA 4GBQA 1K4US 2ESWA 2RQWA 1TUDA 4HCKA 2O9SA 1WXTA 1WXUA 1M27C 1X6BA 2NWMA 1N5ZA 4CC7A 2J05A 3SEMA 2J6FA 1PRLC 2PZ1A 1PKSA 2YUNA 4D8KA 4AFQC 4HVVA 1B3QA 4E6RA 1QKWA 3M0QA 1YWPA 4OMMA 2KT1A 1I1JA 2KXDA 3QWXX 3UA6A 2O2OA 2CDTA 5L23A 2DL5A 2RQTA 4JJBA 2K9GA 2AKKA 2KEAA 1YP5A 1SSHA 2GQIA 4M4ZA 1KIKA 3FJ5A 4AG1C 3GBQA 1UGVA 1LCKA 1UJYA 2ECZA 1AWOA 2LJ1A 1ZSGA 1H3HA 1H8KA 3NPFA 1WIEA 1GCQC 1GFDA 2EYWA 2DL7A 2CT4A 1SRLA 5FWCA 2DA9A 2KRNA 1SHFA 1GCPA 1AZGB 2YUQA 2CUDA 1NLOC 2FRWA 5FW9A 2KT8A 1MUZA 1ZLMA 1CKBA 1X2KA 2LJ3A 2A36A 1TG0A 1WA7A 1GL5A 2HSPA 1I0CA 1WLPB 2HBWA 3SHWA 3I35A 1W1FA 2FO0A 1U06A 2KNBB 1KSWA 2JS0A 2JM9A 2V1QA 4J9GA 5I11A 2JMAA 2LQNA 1JXOA 1OPLA 1NYFA 1VYUA 2DE0X 3PVLA 2K7AA 1ZUUA 1Z9ZA 3VS2A 1PHTA 4JJDA 2G6FX 1T3SA 2HDAA 4JPBW 2RMOA 1I07A 3VRYA 1M30A 2GTOA 2J7IA 2GNCA 1QWFA 1MV0B 2RF0A 2VVKA 2DL8A 2LCSA 1HJDA 1JO8A 4J9HA 1NEBA 4HVWA 4HVUA 1VYTA 1S1NA 5GJWB 4CC2A 2DLPA 2DBKA 3RBBB 4DEXA 1E6HA 2J06A 3VS4A 2A28A 2W0ZA 4J9BA 1U3OA 2L0AA 1K0SA 4RUGA 4AG2C 1NYGA 1NLPC 2HEQA 2J6KA 2ED0A 1UDLA 4Z8AA 4OMLA 4LUDA 1G83A 1OOTA 1ABOA 2X3XD 1G2BA 1NEGA 1ABQA 2L3QA 1K76A 1WI7A 5ECAA 1BU1A 4RTVA 2ED1A 4F16A 4CC4B 4LNPA 1CKAA 2OAWA 5HCKA 2PNIA 4ZNXA 1RLPC 2F2WA 2DF6A 1SPKA 3C0CA 1AWXA 1UECA 1YWOA 3EG3A 3EHQA 1YNZA 4R0KA 1KJWA 3H0IA 3IQLA 1HSQA 2P4RA 2DYBA 2H8HA 2OI3A 1GBRA 2OJ2A 4AFZC 1Y57A 2K3BA 1ZBJA 1JQQA 4Y92A 1X69A 1PNJA 1M3AA 5I22A 1VYVA 3M0TA 1AD5A 2DRKA 1FMKA 2EYZA 1UFFA 2FPDA 3JV3A 3NMZC 3QWYA 2DM1A 1CSKA 1W70A 4JZ4A 2HCKA 4OMPA 1RLQC 3UATA 1BK2A 4RTWA 2L3SA 3PE0A 2DRMA 1BBZA 2ENMA 3CQTA 4AFSC 1AEYA 3NGPA 2KRSA 4K11A 1VA7A 2RNAA 1AWWA 3TSZA 1OPKA 2DBMA 3I5SA 1M3CA 5IH2A 4RTUA 3ULRB 2KYBA 2RQRA 2XMFA 1M3BA 5IHIA 2DNUA 2JM8A 2A37A 4RTYA 1X6GA 4ORZA 4IIMA 1W6XA 4A63B 1AZEA 2SRCA 2DILA 1FYNA 1AOJA 1H92A 3A98A 2RQVA 3U23A 4J9CA 1YN8A 1JXMA 2CREA 2EBPA 1HD3A 5IXBA 4F14A 3R6NA 2YT6A 2ROTA 3UA7A 3EG2A 3M0PA 2KBTA 4LUEA 2MOXA 2SEMA 3H0HA 1ZUYA 2DL3A 2D1XA 1K9AA 1V1CA 4OMNA 1WX6A 2CH4W 1AWJA 2BTTA 2C0IA 1MV3A 2CT3A 1KFZA 1GBQA 2F2XA 1K1ZA 2EYYA 4OMQA 1WDXA 3I9QA 2O9VA 2QDLA 2RN8A 3M0UA 2LMJA 1WYXA 2RQUA 2DL4A 1WFWA 2RPNA 4AFUC 4J9FA 3EG0A 2YUPA 2C0TA 1GRIA 1T0JA 1RI9A 2LZ6B 2BZYA 2EVRA 2BZ8A 1ZUKA 2AZSA 2KROA 5GJVB 2GGRA 1PWTA 5IHKA 4Z88A 2K79A 1QWEA 2LQWA 3O5ZA 2E5KA 2V1RA 1Z9QA 3NHNA 2KE9A 2LJ0A 2CSQA 2DJQA 2LP5A 1QLYA 1K0XA 2FEIA 1X27A 1U5SA 2KGTA 2MCNA 1OV3A 2CSIA 1NM7A 3H41A 2O88A 1UHCA 2GBQA 2EGEA 1UG1A 1QKXA 4JJCA 2KRMA 5IHNA 1AVZC 1QCFA 1GCQA 3M0RA 1A0NB 2EW3A 1Y0MA 3EG1A 2VKNA 2M0YA 3REBB 2AZVA 4J9IA 3TSWA 2DX1A 2NUZA 1SHGA 2ROLA 5EC7A 2AKLA 2DMOA 2C0OA 2CH4A 1UTIA 3EGUA 1SEMA 2EKHA 4EIKA 1ARKA 1XOVA 2AK5A 3VS7A 3UF4A 2L2PA 2KR3A 2EQIA 3THKA 2KXCA 2YSQA 2JW4A 1NG2A 2LNHB 2YUOA 4Z89A 1UHFA 3VS0A 2MIOA 2A08A 2GTJA 2DVJA 3ZL7C 2KYMA 2X3WD 5IXFA 3VS5A 1TUCA 1J3TA 2BZXA 4IIOA 4OMOA 3VRZA 2PTKA 2IIMA 2J6OA 2JMCA 2ABLA 2FPEA 1ZX6A 2M51A 2JTEA 1UJ0A 3RNJA 1JEGA 2EGCA 3VS6A 2JXBA 2VWFA 4RTTA
chains in the Genus database with same CATH superfamily
3L42A 4J7FA 4PLIA 1BB9A 1IXDA 2HAXA 1VQ4A 3P8BB 3G1JA 4A4FA 1B07A 4LN2A 2WSEE 5LJ5j 4JZ3A 3HP9A 5CO7A 3JRZA 1E7OA 2EYXA 2L89A 1S72A 2FPFA 4DBRA 1VQ7Q 3PNWC 1T3LA 5AYFA 2X9HA 1EX4A 1M1KC 2QG9B 1NJIR 3LGLA 1VQNT 4RTZA 3CBOA 4E7HA 1YHQQ 4WCIA 3M0SA 4PJJA 2YRCA 2E5QA 1Q86C 3QDRB 3CEYA 1IGQA 2MI6A 2VUBA 2VXFA 2MAMA 3HTRA 3I5RA 4TVRA 3GOXA 1K73C 1M8MA 2DIQA 1UEBA 1YIJA 2QTVA 1KQSP 1N9SA 1QVFA 5KCOA 1BCOA 4FSSA 4B6MA 4F17A 1D3BB 1UUEA 3CCRT 4QVDA 1QCOA 2GF7A 4HT9A 2YHTA 2D8JA 2MYSA 3QZ5B 3FDRA 3OW2A 1HXDA 1M9SA 2O9SA 2ZPBB 1WXUA 1PG5B 2ZGWA 4KUDK 5GAN7 3CCJT 3I56T 2DETA 4O5VA 1WHJA 2MK5A 4E6RA 1OULA 2KT1A 4BUGA 1QVFP 4WTOB 3A5ZB 2DIGA 2KXDA 3QWXX 3CCQQ 2CZ1B 2DL5A 1X75C 3VYHB 3CCVQ 2X4XA 1OU9A 3VJPA 2KEAA 4C92F 1VQ6T 1AHJB 2GQIA 1N27A 3FJ5A 5GAN6 4AG1C 3VU3C 1UGVA 3RIRA 1W4SA 2E64A 3JCMg 5CKHA 1M4ZA 1AWOA 4XTWA 5GANh 1H3HA 1H8KA 4M7AD 2DERA 1ZA1B 3L2ZA 3ZFJA 1YCYA 4FSXA 2VC8A 1SRLA 3OMGA 5FWCA 5CIUA 1IGUA 2FVUA 3EH1A 1WJSA 2L8DA 3OYAA 4ME7A 2HQXA 1CKBA 1YJNQ 2LJ3A 2A36A 2EQUA 2JNGA 1FXXA 2AIRB 1YI2T 1YITT 1I0CA 4BD3A 4C8QC 3V7CA 3I35A 1W1FA 1M2VA 4LXCA 1TUGB 1XNIA 4M7DF 2JM9A 3GIBA 2FZKB 4HT8A 2AT1B 5GMKe 3PVLA 4OB0B 5FU7B 3X26B 1Z9ZA 3VS2A 3EAEA 4PL6A 5A2QE 4JPBW 3FRNA 2GTOA 2J7IA 1VQLQ 4MDWA 4Q5WA 5CQYA 2GNCA 1I8FA 1MV0B 2DL8A 1MNDA 1JO8A 1M1GA 1NEBA 2QYZA 1JBMA 1VYTA 4N4GA 1S1NA 3CMEQ 1QW1A 1BI1A 4HCZA 3CCUA 4FT2A 1YHQA 5KYXA 1KD1R 1Q81R 2XK0A 2QA4Q 3VS4A 4LDYA 2GFUA 4J9BA 3LLRA 1U3OA 1Q7YR 3AT1B 2R5MA 2X4JA 2GFAA 1XQHA 2P4TA 4M77B 1VQ5T 5GAOr 3HRSA 1G83A 4F7UB 1G2BA 4M75B 1ABQA 4M7DC 1BU1A 3G6EQ 4RTVA 2E3HA 4F16A 4C0ZA 1M5Q1 3C0CA 1AWXA 3EG3A 1YJ9A 3EHQA 2EIFA 4Z02A 1OZ2A 5DLQE 4J5YA 4R0KA 2RHIA 4PJOF 1VIFA 4XTZA 1G3TA 1OZ3A 1UGSB 2JTFA 2OJ2A 4AFZC 2QI2A 2K3BA 2H3EB 1WPYA 1ZBJA 4Y92A 4JRIA 2V8JA 4C92G 1C6VX 4JDSA 3NMZC 3QWYA 1PD0A 3OSSC 3UATA 3PTAA 1BK2A 3PE0A 2ENMA 5KYYB 4EMKA 1F1BB 5EG2A 1O75A 4AFSC 1BIBA 1WHMA 1AEYA 4V2SA 4K11A 3SFMA 1AT1B 2E1HA 4OB2B 4FL6A 5I21A 2JVVA 1YJNA 1M3CA 4RTUA 4PNOA 3M56A 2FHDA 2RQRA 4A63B 4KGVB 7AT1B 3EGXB 3DLLA 5CKBA 2SRCA 1FYNA 3V7SA 3M4YA 4DOWA 4M7DG 3A98A 4L5GA 2RM4A 2I2LA 2QK0A 1YN8A 2CREA 2RI2A 5IXBA 4IURA 2KBTA 4LUEA 2SEMA 2R5AA 5J3BA 2ZZDA 2BUDA 3AHUA 5GMKi 1AWJA 2C0IA 1MV3A 2LC4A 1VQ9Q 1K1ZA 1PCXA 1QVGS 4E7ZA 3I9QA 1K9MR 4HCCA 3JCMX 3M0UA 1Y7XA 2LQKA 4EPCA 1JJ2S 2QEXQ 4C0DB 4AFUC 1LPLA 4KT0E 2DAQA 3HL8A 1N8RC 2KQWA 3ZEHA 4EDUA 2H3JA 4F7UF 1RI9A 3OY9A 1KQ1A 2IVWA 1YJWT 2KROA 3A1PA 2GGRA 1PWTA 5IHKA 3G6EA 4IUVA 5GAN2 2KI7A 1Z9QA 3CC7A 4E7JA 2KE9A 4KUIA 2CSQA 3BFMA 2LP5A 1QLYA 4C5EA 2FEIA 1OYXA 2CSIA 2XIDA 1MNEA 4C0FA 3TQ7P 3JCMQ 1NM7A 2YLBA 3H41A 4OGEA 2EGEA 3PGGA 1WQ7A 1QKXA 1U1SA 2K4YA 2M9UA 2VYTA 1JJ2P 1VQMQ 1PM3A 1Y0MA 2DX1A 1SHGA 2EYQA 4ZGDB 1X01A 5EC7A 4M77C 4MMKA 3M55A 2XD0A 3ER0A 2CH4A 3EGUA 3QPHA 2RJFA 2MF2A 4M75C 3OYJA 4A4KA 2KK4A 5GAOp 3VKIA 4C92D 2OTLA 3CD6Q 2KXCA 3VV0A 2AHJB 5CCAA 1NG2A 2LNHB 4Z89A 3EFOA 3VS0A 4XU1A 3BE3A 3CCRQ 4PJOA 2QQSA 5CQXA 1M1KU 3VS5A 1TUCA 1Y71A 1QMCA 3FIFA 1J3TA 2KDSA 2BZXA 2YRVA 4XAXB 3VRZA 3EFSA 2IIMA 2JMCA 1Q86U 4ELZC 5D6XA 1H3ZA 2ABLA 3RKXA 1VQPQ 1TWBA 1K73U 1UJ0A 1UGQB 3RNJA 1JEGA 5GMKh 2EGCA 3VS6A 2VWFA 3JSCA 1VQ4Q 1RAFB 2Y90A 3KFVA 2DXCA 3G71Q 2XU8A 4RTXA 1YCSB 1WHHA 4N0AA 2D0NA 4OB3B 4HXJA 1VQ9A 4M7DD 5KYWB 4YTLA 3PT9A 5FRNA 2O31A 3VS1A 1MMAA 3DB3A 2QEXA 3ZBDA 2EQMA 3HRTA 2F2VA 2NUPA 3C94A 3MEUA 4N4IA 4M7AE 1GFCA 5LJ3j 5A0LA 1PKTA 2D8HA 4M77G 1BYMA 4QT7A 4KRTA 3OYBA 4F7UG 2EAYA 2KY9A 4M75G 1W2BS 4HA8A 5C0MA 2M1HA 1UB4A 4Y28E 3CCMT 3JB9J 8ATCB 2DZ9A 4CC3A 1TTHB 2LX9A 3X24B 2EKOA 4RG2A 2CGHA 3P8HA 4LE9A 1X2QA 3MEWA 2RQWA 2X4YA 4PFOA 2DKGA 1N5ZA 5HK0A 1JRIA 2J05A 4PFPA 3SEMA 4C8QB 2QQAA 2PZ1A 1PKSA 2YUNA 2PVDB 4AFQC 4HVVA 1B3QA 1QKWA 2HNIA 3FB9A 4OMMA 2GQVA 2LVMA 2CZ6B 4A54A 1VQMA 5GAMj 2DEQA 1RI0A 4C0DC 2DXBA 3J80E 1ZA2B 2RQTA 3S3MA 2X51A 3HHTB 1HK9A 1NZ9A 1WQWA 4FW1A 2K9GA 2AKKA 4PJOD 3QUIA 1YP5A 2Z0WA 1V29B 1W2BP 1KIKA 2FZGB 3GBQA 5KCHA 4KBMB 1LCKA 1EZZB 2RA2A 1UJYA 2RJCA 1VQ8T 2Y4YA 4WF2A 3NPFA 3CMAT 1I5LA 3TCJA 2QAZA 2CT4A 4C0GA 2LDMA 3J81E 3CCRA 1SHFA 1GCPA 2YUQA 3CCET 3HPWA 3FEOA 4NL2A 1H641 4BI4A 1MUZA 1ZLMA 3SWNA 3MCAB 2OX7A 1WA7A 3BDUA 2E41A 4JLGA 3CCJA 2LNVA 3I56A 1TU0B 2KNBB 1KSWA 1D1CA 3M54A 2NYSA 2PUOB 1LOJA 1KQSA 4BE2A 2PQWA 3CCST 1VYUA 3G71A 1ZUUA 4LDVA 1PHTA 2G6FX 5LJ5g 3HRUA 1LJOA 1VQ6A 1M30A 2XI9A 2YRDA 1QWFA 2VVKA 3CCUQ 4HVUA 2FB7A 2OAUA 3RR6A 4CC2A 1ACMB 1PSFA 2DBKA 3RBBB 1ZSZB 2E3IA 1E6HA 2O4XB 4M78B 4PJNA 1B7TA 3ASKA 2PU9B 1K0SA 2BE7D 3OYMA 1NLPC 5GAN8 5LJ5d 3CCLT 1YI2A 1YITA 2VASA 1ABOA 2X3XD 2DTOA 3EGDA 3OYDA 2K5LA 1NEGA 1K76A 1KC8C 2EJGA 3OW2S 1CKAA 2OAWA 4XK8E 3NTKA 5HCKA 2PNIA 4C8QF 4ZNXA 4PJLA 1YJ9Q 1MGQA 1ZHIA 2YLCA 2HKQB 3L2UA 3QYGB 3Q1JA 3LW5E 2RHZA 3MP6A 2DYBA 2OI3A 5CKDA 2RO0A 4XTUA 2HSEB 1X69A 4DOVA 2OTJT 1PNJA 3E19A 5I22A 1VYVA 1D0XA 1C1AA 1AD5A 2DRKA 1FMKA 2E70A 2P0QA 1VQKT 5L8RE 2HCKA 2MMPA 3M5AA 1RLQC 3CBPA 2O01E 3HSBA 1BBZA 3SDZA 1VQ5A 1FMWA 4E2FB 1R0BG 2ZPIB 1QQJA 1VA7A 4LD9K 1AWWA 4ATOA 1OPKA 2DBMA 2IG0A 4XTYA 5FRMA 1YFNA 2DNUA 2JM8A 1YIJT 3DLMA 1IRXA 2A37A 3JAME 2EJ9A 3JCMd 1N8RU 2A3LA 3I55T 3QSUA 1BI3A 1JXMA 2X4WA 5D7UA 2XDDA 3S3NA 2MOXA 3H0HA 3JB9H 5DM7R 2VXEA 1K9AA 1B34A 3JB9F 1C0MA 1KFZA 2EYYA 2DD5A 3URGA 2EJFA 1WDXA 5GAOm 2BKDN 1XTDA 2QDLA 3RKWA 1M1FA 2MWOA 2DD4A 1WYXA 4M78F 4F04B 5GANj 5KH6A 4C92E 3OA6A 1LNXA 4QQ6A 4FYXB 2JOYA 3JCMc 3LH0A 1RABB 3VUZA 2BIVA 2F1LA 2NUTA 2LZ6B 2BZYA 2EVRA 3NTIA 3A8LB 2RHXA 2AZSA 5HKCA 1NJIC 4BE0A 5GAOq 3C12A 3CC7Q 3OYKA 1OX9A 4X9CA 2COWA 3NHNA 4C8QG 1IB8A 4XU3A 1K0XA 3N5BB 1X27A 4E7LA 3OSVA 1OV3A 2RHYA 3CC4T 3EG9A 1N6AA 4BI8B 2O88A 2GBQA 1WHGA 3SD4A 4M7DE 2C06A 1X6OA 4JJCA 3KBGA 1ZSZC 5IHNA 5KYUA 2JTMA 1RAEB 3G4ST 4M78C 4ANJA 5LJ5e 2L5QA 4ZN3A 4J9IA 4X34A 4JS4A 1MHNA 1G3WA 2PVOB 2AKLA 2HD0A 4QKUA 2DZCA 2DMOA 3X25B 1UTIA 4A4HA 2EKHA 4EIKA 1VQ7T 4M7AB 2OTLQ 4ZTJA 2RI3A 1ARKA 4FM4B 2KR3A 4IUTA 2YSQA 1YJWA 4PKCC 5GAOl 1BI0A 5KE2A 4QW2A 2QGGA 2DVJA 3QJYA 3ZL7C 2X3WD 3L2RA 4OF1A 3NTHA 4C92A 2M16A 2D6FA 3MPUB 2PTKA 2J6OA 2M51A 1Y96A 1ZX6A 2JTEA 2CP7A 3MEAA 2M02A 1R8OB 4LDUA 2JXBA 4RTTA 5IT9E 3JCMb 1QP3A 2EWNA 1EFNA 1JU5C 4XTVA 4DEYA 3TU4K 5CAIA 3JB9G 2FRYA 4FYYB 1G8XA 3P8DA 3REAB 4PJOE 2CP5A 3PVQA 3E9GA 1RAGB 3H9NA 3UDCA 3V8LA 1NPRA 2L3PA 4J8OA 3EHRA 2RI5A 4M78G 3CCQT 1MMDA 1XJWB 2CP0A 1O9SA 4M7DA 1QVGA 3CCVT 3CMAQ 4M77F 2B8AA 3JCMe 1PRMC 2K6DA 1UE9A 2XHCA 5LJ3f 1JJ2A 4M75F 1SRMA 1RUWA 3CCEQ 3BDLA 4J9DA 2X35A 1E6GA 2D9TA 2K2MA 4HCBA 2I0NA 2W10A 4D8DA 2CS7A 1D09B 1RL2A 4OGCA 3L1AA 1T0HA 2EPDA 3H0FA 1K4US 1TUDA 2LT1A 1WXTA 4MMLA 1QVGP 1M27C 1X6BA 3CCSQ 2E6ZA 3PMTA 3INZA 3A8OB 3M0QA 1G5VA 2RB6A 3M59A 1D3BA 4C8QD 1KG1A 2DXUA 4OVAA 3V8KA 3UA6A 1VQNQ 2O2OA 3QYHB 5GAMf 2CDTA 2ZPGB 5L23A 2K5FA 2HKNA 1SSHA 2DO3A 3GNFB 1VQLT 2LTOA 1PC0A 1M2VB 2LJ1A 4MDXA 1ZBXA 3LX7A 1GFDA 1WIEA 1GCQC 2LT4A 3CMET 1M8VA 3CCMA 3LWIA 4C5IA 3CCLQ 2CKKA 2QA4T 1JB0E 2CUDA 1WHLA 1NLOC 4ZTFA 3CC2T 8AT1B 5FW9A 4QQDA 2KT8A 4DQ2A 4R55A 4IKFA 3CPWS 1X2KA 3WXMB 4J83A 4F7UE 4LDWA 3CCJQ 1IZ6A 3I56Q 2YWWA 3RERA 1KK7A 3SHWA 2FO0A 3LGFA 1U06A 3FC3A 2JS0A 4GLKA 4RKUE 2F5TX 4DBQA 1M1KR 1M90U 2V1QA 2JMAA 3G6ET 2LQNA 1JXOA 5KYXB 3CXCS 1OI1A 3MHXA 1Q86R 4JJDA 3META 1VQ6Q 2RMOA 1I07A 1K73R 5AT1B 1KC8U 4BACA 1VQKQ 4LDXA 4M7AC 2XICA 2QDYB 1HJDA 1UGPB 4HVWA 1VQ8A 4P5NA 5GJWB 4NOYA 3CMAA 5LJ3g 3JB9D 2JUFA 2J06A 5CK9A 2A7YA 2DJZA 4ELYC 1K8AC 2A28A 2W0ZA 2XDPA 3CPWP 3RMSA 4E7KA 4KGXB 2L0AA 3CCEA 4AG2C 1NYGA 2HEQA 4M78D 1YI2Q 2J6KA 1YITQ 4Z8AA 4OMLA 5D6YA 1K9MC 1OOTA 3MEVA 1W2BA 1WI7A 5ECAA 4II1A 1LVKA 3JCMV 4LNPA 3CCSA 3FJPA 5LJ3d 4A4GA 2F2WA 1SPKA 5GMKj 1RAHB 2XDBA 1YWOA 3GPLA 4M77A 5IN1A 4EMKB 2VGMA 5I2MA 4F7UA 2V26A 4RCBA 5GAMg 4M75A 3H0IA 3IQLA 2P4RA 1VQNA 1TS9A 1GBRA 2ZPFB 2D0QB 3KUFA 1Y57A 5LJ5h 5CR2A 1JQQA 4KULA 3M0TA 2EYZA 2FPDA 1UFFA 4JJNK 3JV3A 1VOMA 1W70A 2V8KA 4BI3A 1Y07A 4M7AG 4OMPA 4RTWA 1OQKA 2DRMA 4BB7A 1VQ5Q 4UC4A 3CQTA 1ZQ1A 4ZN1A 2XKOC 3CCLA 4PLLA 4A4EA 5GAMd 1D0YA 5GAN3 3TSZA 4R56A 3JCMP 2K3YA 5IH2A 1NPPA 4FT4A 4HKEA 1M3BA 3GF5A 5LL6S 2Y4XA 3JCMW 4ORZA 4IIMA 2DTIA 2CZ7B 5KYYA 2K2VA 1AZEA 3ME9A 4J6WA 3A8MB 1H92A 5C6SA 2RQVA 4JRKA 3U23A 2EBPA 1HD3A 2ROTA 3UA7A 3EG2A 3M0PA 1WJRA 4NL3A 2FZCB 5M9OA 2OTJA 1BIAA 1NJIU 2DL3A 3OYYA 3G4SQ 4OMNA 1WX6A 2LRQA 1FWZA 5GAOn 1VQKA 3A8HB 2BTTA 1GBQA 2F2XA 2E12A 5DLOA 3EGXA 3C95A 1VQOT 4RCCA 2RN8A 1VQMT 2LMJA 5GAN5 5D6WA 1QP2A 1Q82C 2CP3A 3JCMh 2DTHA 3D7SB 1WFWA 4O6JA 1IREB 2R58A 1U1TA 3FLGA 4J9FA 1M90C 3EG0A 1QVFS 4DBHA 2QXFA 1TOVA 4XU0A 4OP0A 5GANf 2YUPA 2C0TA 1GRIA 1R77A 3A8GB 2COZA 3M58A 1T0JA 2R57A 1ZUKA 4M77D 1SF9A 4D6WA 5HY6A 4JLIA 5GJVB 4FIBA 4Z88A 3CD6T 4M75D 1QWEA 4JRQA 3I55A 2E5KA 2V1RA 3QKJA 1V76A 2DJQA 4BY6B 1SG5A 3QJ6A 3BY7A 1WJQA 2CYZB 4B9WA 2IPOB 3JCMJ 1RAAB 3SB2A 1VQPT 4XU2A 1BI2A 3M0RA 1QCFA 3PIOA 2QQRA 3OBYA 1KHIA 4CI0C 2PUKB 3OS0A 3EG1A 2K3XA 2RJDA 1VQ4T 3EFOB 3OYGA 2VKNA 4FYWB 3CBMA 3O8VA 3NFCA 2AZVA 1U8RA 4PJOB 1BCMA 4CRIA 3G71T 2KSSA 2NUZA 3RMQA 3OYFA 4PK4A 5FU6B 1S72T 3OYEA 3VYGA 2HL5C 3OYNA 1SEMA 2MPXC 4QQGA 3OW2P 1G3SA 1YJWQ 1XOVA 2AK5A 5LJ3e 3UT1A 3UF4A 4DBFA 3THKA 4KGZB 2VB6A 3DB4A 3H6ZA 2K57A 2MIOA 2A08A 2GTJA 2QQBA 2KYMA 4FYVB 3MP8A 5IXFA 2DEUA 2YXYA 3MP1A 4OMOA 4EMKC 2LCCA 3CC4A 4E7IA 3RESA 2PVGB 3E1SA 2NUPB 2LX7A 1EIFA 4C8QE 3LH5A 3RKYA 2EGAA 2HZYA 2JS2A 3G4SA 1N8RR 1X43A 1WXBA 3S6WA 3OYLA 1TXQA 4GLMA 3OB9A 1KD1U 1Q81U 5GAMe 4JS5A 3KXTA 4C92C 4BDYA 2EFIA 3MO8A 1IO6A 2B86A 3VS3A 1Q7YU 2CUBA 1VQ7A 5I2SA 1NBEB 2QASA 4LD6A 5GANg 1HYOA 4J9EA 2FG0A 4IUPA 3L2WA 1R0CB 2EQJA 2JT4A 2QGFB 6AT1B 4NS5A 1OEBA 5KYWA 3CC2Q 3L2QA 2A0FB 3TVTA 1SSFA 2HQEA 4JUVA 5FWBA 1RACB 2DYIA 2YDLA 4ESRA 1TSFA 4J6YA 4X1VA 3QG1A 4GBQA 2ESWA 1GXIE 1UGRB 3QXEB 4HCKA 2NWMA 5GANd 4J7IA 4VUBA 4CC7A 4FW2A 2J6FA 1PRLC 3JB9I 4D8KA 2ZAEA 1YWPA 4OB1B 4X9DA 2V8IA 1I1JA 3CPFA 1PSEA 4L6V5 3CCQA 5J26A 4JJBA 4GY5A 3CCVA 2DPPB 4M4ZA 3V7RA 3SWNB 2VGNA 4C8QA 4ZGJB 1YBYA 2FL7A 2MWPA 3QBYA 2VV5A 2ECZA 4BDZA 3CCMQ 1ZSGA 3CCUT 1YHQT 4MZPA 2EYWA 4JRPA 4M78E 2DL7A 1PD1A 1WHKA 2DA9A 2WSCE 2ZPEB 2KRNA 4FCYA 3QDFA 1AZGB 4BY6C 1SKUB 2FRWA 4MZMA 4QVZA 1TG0A 3UWNA 1GL5A 5GMKm 2HSPA 1WLPB 3J7AF 2HBWA 2FYKA 1K8AU 5KYNA 1D0ZA 5J39A 4J9GA 1FMVA 5I11A 1OPLA 5IAYA 1NYFA 4PJOC 2CZ0B 2DE0X 2K7AA 1K9MU 2CP2A 3X20B 5FU6C 1YJ9T 1T3SA 2HDAA 2KVQG 5DY9A 2HQHA 3VRYA 1K8AR 3C4SA 2P0KA 1VQ8Q 2RF0A 2F5KA 2LCSA 1VQLA 4J9HA 3MKDA 3EGDB 5KE3A 5CKFA 2E10A 3HFOA 2DLPA 3TREA 3CMEA 1KHCA 4DEXA 2ZCFB 2JN0A 4MZTA 2ZPHB 4N0AC 2QA4A 5GAN4 2WACA 5CKEA 4FU6A 3CC2A 4RUGA 4AMCA 2DXTA 4DA4A 2ED0A 1UDLA 5A0GA 1RADB 9ATCB 4LUDA 1KD1C 1Q81C 1IHWA 2L3QA 4Y91A 1TH7A 2RHUA 3E9FA 1ZSZA 1Q7YC 1YJNT 2ED1A 2O4XA 4CC4B 4M78A 5FU7C 4PJMA 1RLPC 3OS5A 2DF6A 4EMHA 1UECA 3PMIA 3DKMA 3PFSA 1YNZA 1OU8A 4PFZA 1KJWA 3PIPA 2CP6A 3OS2A 4L59A 5GMKl 1HSQA 2H8HA 4PJOG 2HMAA 3QZ9B 1VIEA 3M4GA 3S3OA 2LCLA 2JZ2A 1VQOQ 1M3AA 4M7AF 2DM1A 1CSKA 4JZ4A 3GP8A 2L3SA 1KQ2A 5LJ3h 4EMGA 1M2OA 4J6XA 2NLUA 3TEEA 5FROA 5GANe 3NGPA 2KRSA 4M77E 3UPUA 1G3YA 2KMTA 4ZGEB 2RNAA 4A53A 4AT1B 4M75E 1N9RA 3OYIA 3I5SA 2WSFE 3ULRB 2KYBA 2XMFA 1B34B 1MMNA 5IHIA 3LWHA 2EQKA 1Q82U 4RTYA 1X6GA 1W6XA 2K5IA 2QQ9A 3G7ZA 3HKSA 3CPWA 2M0OA 1I5OB 2DILA 2RK2A 1AOJA 2HBPA 5A0DA 3QHSA 3L2VA 4J9CA 3CC7T 4F14A 3MJXA 3R6NA 1BKBA 2YT6A 3E2UA 4E7SA 3OYHA 2OTJQ 3M53A 3V8JA 2G3RA 3SWNC 1Q82R 1ZUYA 2D1XA 1V1CA 2CH4W 5GAMh 3CXCA 1M90R 1VUBA 2CT3A 2NUTB 2DVEA 4OMQA 1D1BA 4KH0B 1S72Q 3EFRA 2O9VA 4RMOA 2GCXA 5LJ5f 4XTXA 2RK1A 2RQUA 3GNGA 2DL4A 3GLXA 1WGSA 1KC8R 2ATCB 2RPNA 3HFNA 4E47A 1IHVA 2COYA 5CVIA 2KAFA 1QVPA 3WVDB 3VUBA 1YIJQ 3EG9B 1D1AA 1I4K1 2P0PA 3R6OA 2BZ8A 3CXCP 2OTLT 4IUUA 3RUXA 4BE1A 3F70A 3OQ5A 3I55Q 2K79A 5KYUB 4OMFB 1FX7A 2LQWA 3O5ZA 1NE8A 4RG8A 2RJEA 1MMGA 2LJ0A 1Q95G 1U5SA 2KGTA 2MCNA 4IUQA 1OX8A 3WVEB 4QVCA 1UHCA 2DFUA 1UG1A 3X28B 2E65A 3M57A 3LYIA 2KRMA 1AVZC 1GCQA 2E6NA 1A0NB 2EW3A 3BW1A 4C5HA 1VQOA 2RD1A 3OMCA 2M0YA 3REBB 3TSWA 2LQ8A 1VQ9T 2XG8D 3QIIA 3OS1A 2ROLA 4C92B 3T9NA 1QCNA 2C0OA 2L3RA 2JJ9A 5FLXE 2QEXT 2F69A 1Y96B 3VS7A 1DJ7B 2E4HA 4KH1B 2L2PA 2EQIA 2BE9B 3JCMf 5HK3A 2HL3A 2JW4A 2YUOA 1UHFA 1WNLA 3CD6A 2QTXA 3EH2A 3QO3A 3H8ZA 1WZOA 3OYCA 2DK3A 2P84A 4C5GA 4IIOA 3CC4Q 3RDVA 3M9QA 4N4HA 1KQSS 2RH2A 4M7AA 2FPEA 4B9XA 4XQ3A 1VQPA 1I81A 1P92A 3OBWA 1RAIB 4M7DB
chains in the Genus database with same CATH topology
2LX7A 1BB9A 1EFNA 3KFVA 3LH5A 2EGAA 2JS2A 1JU5C 4RTXA 4DEYA 1YCSB 1B07A 1X43A 1WXBA 2D0NA 4LN2A 4HXJA 2FRYA 4JZ3A 4GLMA 1E7OA 2EYXA 3REAB 2FPFA 3PVQA 1IO6A 2B86A 2O31A 3VS3A 1T3LA 2L3PA 2CUBA 3EHRA 3VS1A 4RTZA 4WCIA 2F2VA 3M0SA 1GFCA 4J9EA 2FG0A 1PKTA 1PRMC 1UE9A 2D8HA 2K6DA 4QT7A 3I5RA 4KRTA 1M8MA 2JT4A 1SRMA 1RUWA 1OEBA 4J9DA 1E6GA 3TVTA 5FWBA 2K2MA 4FSSA 4ESRA 2YDLA 4F17A 1UUEA 4CC3A 2I0NA 2W10A 4D8DA 4X1VA 4LE9A 1X2QA 1T0HA 2D8JA 2EPDA 3H0FA 4GBQA 1K4US 2ESWA 2RQWA 1TUDA 4HCKA 2O9SA 1WXTA 1WXUA 1M27C 1X6BA 2NWMA 1N5ZA 4CC7A 2J05A 3SEMA 2J6FA 1PRLC 2PZ1A 1PKSA 2YUNA 4D8KA 4AFQC 4HVVA 1B3QA 4E6RA 1QKWA 3M0QA 1YWPA 4OMMA 2KT1A 1I1JA 2KXDA 3QWXX 3UA6A 2O2OA 2CDTA 5L23A 2DL5A 2RQTA 4JJBA 2K9GA 2AKKA 2KEAA 1YP5A 1SSHA 2GQIA 4M4ZA 1KIKA 3FJ5A 4AG1C 3GBQA 1UGVA 1LCKA 1UJYA 2ECZA 1AWOA 2LJ1A 1ZSGA 1H3HA 1H8KA 3NPFA 1WIEA 1GCQC 1GFDA 2EYWA 2DL7A 2CT4A 1SRLA 5FWCA 2DA9A 2KRNA 1SHFA 1GCPA 1AZGB 2YUQA 2CUDA 1NLOC 2FRWA 5FW9A 2KT8A 1MUZA 1ZLMA 1CKBA 1X2KA 2LJ3A 2A36A 1TG0A 1WA7A 1GL5A 2HSPA 1I0CA 1WLPB 2HBWA 3SHWA 3I35A 1W1FA 2FO0A 1U06A 2KNBB 1KSWA 2JS0A 2JM9A 2V1QA 4J9GA 5I11A 2JMAA 2LQNA 1JXOA 1OPLA 1NYFA 1VYUA 2DE0X 3PVLA 2K7AA 1ZUUA 1Z9ZA 3VS2A 1PHTA 4JJDA 2G6FX 1T3SA 2HDAA 4JPBW 2RMOA 1I07A 3VRYA 1M30A 2GTOA 2J7IA 2GNCA 1QWFA 1MV0B 2RF0A 2VVKA 2DL8A 2LCSA 1HJDA 1JO8A 4J9HA 1NEBA 4HVWA 4HVUA 1VYTA 1S1NA 5GJWB 4CC2A 2DLPA 2DBKA 3RBBB 4DEXA 1E6HA 2J06A 3VS4A 2A28A 2W0ZA 4J9BA 1U3OA 2L0AA 1K0SA 4RUGA 4AG2C 1NYGA 1NLPC 2HEQA 2J6KA 2ED0A 1UDLA 4Z8AA 4OMLA 4LUDA 1G83A 1OOTA 1ABOA 2X3XD 1G2BA 1NEGA 1ABQA 2L3QA 1K76A 1WI7A 5ECAA 1BU1A 4RTVA 2ED1A 4F16A 4CC4B 4LNPA 1CKAA 2OAWA 5HCKA 2PNIA 4ZNXA 1RLPC 2F2WA 2DF6A 1SPKA 3C0CA 1AWXA 1UECA 1YWOA 3EG3A 3EHQA 1YNZA 4R0KA 1KJWA 3H0IA 3IQLA 1HSQA 2P4RA 2DYBA 2H8HA 2OI3A 1GBRA 2OJ2A 4AFZC 1Y57A 2K3BA 1ZBJA 1JQQA 4Y92A 1X69A 1PNJA 1M3AA 5I22A 1VYVA 3M0TA 1AD5A 2DRKA 1FMKA 2EYZA 1UFFA 2FPDA 3JV3A 3NMZC 3QWYA 2DM1A 1CSKA 1W70A 4JZ4A 2HCKA 4OMPA 1RLQC 3UATA 1BK2A 4RTWA 2L3SA 3PE0A 2DRMA 1BBZA 2ENMA 3CQTA 4AFSC 1AEYA 3NGPA 2KRSA 4K11A 1VA7A 2RNAA 1AWWA 3TSZA 1OPKA 2DBMA 3I5SA 1M3CA 5IH2A 4RTUA 3ULRB 2KYBA 2RQRA 2XMFA 1M3BA 5IHIA 2DNUA 2JM8A 2A37A 4RTYA 1X6GA 4ORZA 4IIMA 1W6XA 4A63B 1AZEA 2SRCA 2DILA 1FYNA 1AOJA 1H92A 3A98A 2RQVA 3U23A 4J9CA 1YN8A 1JXMA 2CREA 2EBPA 1HD3A 5IXBA 4F14A 3R6NA 2YT6A 2ROTA 3UA7A 3EG2A 3M0PA 2KBTA 4LUEA 2MOXA 2SEMA 3H0HA 1ZUYA 2DL3A 2D1XA 1K9AA 1V1CA 4OMNA 1WX6A 2CH4W 1AWJA 2BTTA 2C0IA 1MV3A 2CT3A 1KFZA 1GBQA 2F2XA 1K1ZA 2EYYA 4OMQA 1WDXA 3I9QA 2O9VA 2QDLA 2RN8A 3M0UA 2LMJA 1WYXA 2RQUA 2DL4A 1WFWA 2RPNA 4AFUC 4J9FA 3EG0A 2YUPA 2C0TA 1GRIA 1T0JA 1RI9A 2LZ6B 2BZYA 2EVRA 2BZ8A 1ZUKA 2AZSA 2KROA 5GJVB 2GGRA 1PWTA 5IHKA 4Z88A 2K79A 1QWEA 2LQWA 3O5ZA 2E5KA 2V1RA 1Z9QA 3NHNA 2KE9A 2LJ0A 2CSQA 2DJQA 2LP5A 1QLYA 1K0XA 2FEIA 1X27A 1U5SA 2KGTA 2MCNA 1OV3A 2CSIA 1NM7A 3H41A 2O88A 1UHCA 2GBQA 2EGEA 1UG1A 1QKXA 4JJCA 2KRMA 5IHNA 1AVZC 1QCFA 1GCQA 3M0RA 1A0NB 2EW3A 1Y0MA 3EG1A 2VKNA 2M0YA 3REBB 2AZVA 4J9IA 3TSWA 2DX1A 2NUZA 1SHGA 2ROLA 5EC7A 2AKLA 2DMOA 2C0OA 2CH4A 1UTIA 3EGUA 1SEMA 2EKHA 4EIKA 1ARKA 1XOVA 2AK5A 3VS7A 3UF4A 2L2PA 2KR3A 2EQIA 3THKA 2KXCA 2YSQA 2JW4A 1NG2A 2LNHB 2YUOA 4Z89A 1UHFA 3VS0A 2MIOA 2A08A 2GTJA 2DVJA 3ZL7C 2KYMA 2X3WD 5IXFA 3VS5A 1TUCA 1J3TA 2BZXA 4IIOA 4OMOA 3VRZA 2PTKA 2IIMA 2J6OA 2JMCA 2ABLA 2FPEA 1ZX6A 2M51A 2JTEA 1UJ0A 3RNJA 1JEGA 2EGCA 3VS6A 2JXBA 2VWFA 4RTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LX7 A;  1BB9 A;  1EFN A;  3KFV A;  3LH5 A;  2EGA A;  2JS2 A;  1JU5 C;  4RTX A;  4DEY A;  1YCS B;  1B07 A;  1X43 A;  1WXB A;  2D0N A;  4LN2 A;  4HXJ A;  2FRY A;  4JZ3 A;  4GLM A;  1E7O A;  2EYX A;  3REA B;  2FPF A;  3PVQ A;  1IO6 A;  2B86 A;  2O31 A;  3VS3 A;  1T3L A;  2L3P A;  2CUB A;  3EHR A;  3VS1 A;  4RTZ A;  4WCI A;  2F2V A;  3M0S A;  1GFC A;  4J9E A;  2FG0 A;  1PKT A;  1PRM C;  1UE9 A;  2D8H A;  2K6D A;  4QT7 A;  3I5R A;  4KRT A;  1M8M A;  2JT4 A;  1SRM A;  1RUW A;  1OEB A;  4J9D A;  1E6G A;  3TVT A;  5FWB A;  2K2M A;  4FSS A;  4ESR A;  2YDL A;  4F17 A;  1UUE A;  4CC3 A;  2I0N A;  2W10 A;  4D8D A;  4X1V A;  4LE9 A;  1X2Q A;  1T0H A;  2D8J A;  2EPD A;  3H0F A;  4GBQ A;  1K4U S;  2ESW A;  2RQW A;  1TUD A;  4HCK A;  2O9S A;  1WXT A;  1WXU A;  1M27 C;  1X6B A;  2NWM A;  1N5Z A;  4CC7 A;  2J05 A;  3SEM A;  2J6F A;  1PRL C;  2PZ1 A;  1PKS A;  2YUN A;  4D8K A;  4AFQ C;  4HVV A;  1B3Q A;  4E6R A;  1QKW A;  3M0Q A;  1YWP A;  4OMM A;  2KT1 A;  1I1J A;  2KXD A;  3QWX X;  3UA6 A;  2O2O A;  2CDT A;  5L23 A;  2DL5 A;  2RQT A;  4JJB A;  2K9G A;  2AKK A;  2KEA A;  1YP5 A;  1SSH A;  2GQI A;  4M4Z A;  1KIK A;  3FJ5 A;  4AG1 C;  3GBQ A;  1UGV A;  1LCK A;  1UJY A;  2ECZ A;  1AWO A;  2LJ1 A;  1ZSG A;  1H3H A;  1H8K A;  3NPF A;  1WIE A;  1GCQ C;  1GFD A;  2EYW A;  2DL7 A;  2CT4 A;  1SRL A;  5FWC A;  2DA9 A;  2KRN A;  1SHF A;  1GCP A;  1AZG B;  2YUQ A;  2CUD A;  1NLO C;  2FRW A;  5FW9 A;  2KT8 A;  1MUZ A;  1ZLM A;  1CKB A;  1X2K A;  2LJ3 A;  2A36 A;  1TG0 A;  1WA7 A;  1GL5 A;  2HSP A;  1I0C A;  1WLP B;  2HBW A;  3SHW A;  3I35 A;  1W1F A;  2FO0 A;  1U06 A;  2KNB B;  1KSW A;  2JS0 A;  2JM9 A;  2V1Q A;  4J9G A;  5I11 A;  2JMA A;  2LQN A;  1JXO A;  1OPL A;  1NYF A;  1VYU A;  2DE0 X;  3PVL A;  2K7A A;  1ZUU A;  1Z9Z A;  3VS2 A;  1PHT A;  4JJD A;  2G6F X;  1T3S A;  2HDA A;  4JPB W;  2RMO A;  1I07 A;  3VRY A;  1M30 A;  2GTO A;  2J7I A;  2GNC A;  1QWF A;  1MV0 B;  2RF0 A;  2VVK A;  2DL8 A;  2LCS A;  1HJD A;  1JO8 A;  4J9H A;  1NEB A;  4HVW A;  4HVU A;  1VYT A;  1S1N A;  5GJW B;  4CC2 A;  2DLP A;  2DBK A;  3RBB B;  4DEX A;  1E6H A;  2J06 A;  3VS4 A;  2A28 A;  2W0Z A;  4J9B A;  1U3O A;  2L0A A;  1K0S A;  4RUG A;  4AG2 C;  1NYG A;  1NLP C;  2HEQ A;  2J6K A;  2ED0 A;  1UDL A;  4Z8A A;  4OML A;  4LUD A;  1G83 A;  1OOT A;  1ABO A;  2X3X D;  1G2B A;  1NEG A;  1ABQ A;  2L3Q A;  1K76 A;  1WI7 A;  5ECA A;  1BU1 A;  4RTV A;  2ED1 A;  4F16 A;  4CC4 B;  4LNP A;  1CKA A;  2OAW A;  5HCK A;  2PNI A;  4ZNX A;  1RLP C;  2F2W A;  2DF6 A;  1SPK A;  3C0C A;  1AWX A;  1UEC A;  1YWO A;  3EG3 A;  3EHQ A;  1YNZ A;  4R0K A;  1KJW A;  3H0I A;  3IQL A;  1HSQ A;  2P4R A;  2DYB A;  2H8H A;  2OI3 A;  1GBR A;  2OJ2 A;  4AFZ C;  1Y57 A;  2K3B A;  1ZBJ A;  1JQQ A;  4Y92 A;  1X69 A;  1PNJ A;  1M3A A;  5I22 A;  1VYV A;  3M0T A;  1AD5 A;  2DRK A;  1FMK A;  2EYZ A;  1UFF A;  2FPD A;  3JV3 A;  3NMZ C;  3QWY A;  2DM1 A;  1CSK A;  1W70 A;  4JZ4 A;  2HCK A;  4OMP A;  1RLQ C;  3UAT A;  1BK2 A;  4RTW A;  2L3S A;  3PE0 A;  2DRM A;  1BBZ A;  2ENM A;  3CQT A;  4AFS C;  1AEY A;  3NGP A;  2KRS A;  4K11 A;  1VA7 A;  2RNA A;  1AWW A;  3TSZ A;  1OPK A;  2DBM A;  3I5S A;  1M3C A;  5IH2 A;  4RTU A;  3ULR B;  2KYB A;  2RQR A;  2XMF A;  1M3B A;  5IHI A;  2DNU A;  2JM8 A;  2A37 A;  4RTY A;  1X6G A;  4ORZ A;  4IIM A;  1W6X A;  4A63 B;  1AZE A;  2SRC A;  2DIL A;  1FYN A;  1AOJ A;  1H92 A;  3A98 A;  2RQV A;  3U23 A;  4J9C A;  1YN8 A;  1JXM A;  2CRE A;  2EBP A;  1HD3 A;  5IXB A;  4F14 A;  3R6N A;  2YT6 A;  2ROT A;  3UA7 A;  3EG2 A;  3M0P A;  2KBT A;  4LUE A;  2MOX A;  2SEM A;  3H0H A;  1ZUY A;  2DL3 A;  2D1X A;  1K9A A;  1V1C A;  4OMN A;  1WX6 A;  2CH4 W;  1AWJ A;  2BTT A;  2C0I A;  1MV3 A;  2CT3 A;  1KFZ A;  1GBQ A;  2F2X A;  1K1Z A;  2EYY A;  4OMQ A;  1WDX A;  3I9Q A;  2O9V A;  2QDL A;  2RN8 A;  3M0U A;  2LMJ A;  1WYX A;  2RQU A;  2DL4 A;  1WFW A;  2RPN A;  4AFU C;  4J9F A;  3EG0 A;  2YUP A;  2C0T A;  1GRI A;  1T0J A;  1RI9 A;  2LZ6 B;  2BZY A;  2EVR A;  2BZ8 A;  1ZUK A;  2AZS A;  2KRO A;  5GJV B;  2GGR A;  1PWT A;  5IHK A;  4Z88 A;  2K79 A;  1QWE A;  2LQW A;  3O5Z A;  2E5K A;  2V1R A;  1Z9Q A;  3NHN A;  2KE9 A;  2LJ0 A;  2CSQ A;  2DJQ A;  2LP5 A;  1QLY A;  1K0X A;  2FEI A;  1X27 A;  1U5S A;  2KGT A;  2MCN A;  1OV3 A;  2CSI A;  1NM7 A;  3H41 A;  2O88 A;  1UHC A;  2GBQ A;  2EGE A;  1UG1 A;  1QKX A;  4JJC A;  2KRM A;  5IHN A;  1AVZ C;  1QCF A;  1GCQ A;  3M0R A;  1A0N B;  2EW3 A;  1Y0M A;  3EG1 A;  2VKN A;  2M0Y A;  3REB B;  2AZV A;  4J9I A;  3TSW A;  2DX1 A;  2NUZ A;  1SHG A;  2ROL A;  5EC7 A;  2AKL A;  2DMO A;  2C0O A;  2CH4 A;  1UTI A;  3EGU A;  1SEM A;  2EKH A;  4EIK A;  1ARK A;  1XOV A;  2AK5 A;  3VS7 A;  3UF4 A;  2L2P A;  2KR3 A;  2EQI A;  3THK A;  2KXC A;  2YSQ A;  2JW4 A;  1NG2 A;  2LNH B;  2YUO A;  4Z89 A;  1UHF A;  3VS0 A;  2MIO A;  2A08 A;  2GTJ A;  2DVJ A;  3ZL7 C;  2KYM A;  2X3W D;  5IXF A;  3VS5 A;  1TUC A;  1J3T A;  2BZX A;  4IIO A;  4OMO A;  3VRZ A;  2PTK A;  2IIM A;  2J6O A;  2JMC A;  2ABL A;  2FPE A;  1ZX6 A;  2M51 A;  2JTE A;  1UJ0 A;  3RNJ A;  1JEG A;  2EGC A;  3VS6 A;  2JXB A;  2VWF A;  4RTT A; 
#chains in the Genus database with same CATH topology
 3L42 A;  4J7F A;  4PLI A;  1BB9 A;  1IXD A;  2HAX A;  1VQ4 A;  3P8B B;  3G1J A;  4A4F A;  1B07 A;  4LN2 A;  2WSE E;  5LJ5 j;  4JZ3 A;  3HP9 A;  5CO7 A;  3JRZ A;  1E7O A;  2EYX A;  2L89 A;  1S72 A;  2FPF A;  4DBR A;  1VQ7 Q;  3PNW C;  1T3L A;  5AYF A;  2X9H A;  1EX4 A;  1M1K C;  2QG9 B;  1NJI R;  3LGL A;  1VQN T;  4RTZ A;  3CBO A;  4E7H A;  1YHQ Q;  4WCI A;  3M0S A;  4PJJ A;  2YRC A;  2E5Q A;  1Q86 C;  3QDR B;  3CEY A;  1IGQ A;  2MI6 A;  2VUB A;  2VXF A;  2MAM A;  3HTR A;  3I5R A;  4TVR A;  3GOX A;  1K73 C;  1M8M A;  2DIQ A;  1UEB A;  1YIJ A;  2QTV A;  1KQS P;  1N9S A;  1QVF A;  5KCO A;  1BCO A;  4FSS A;  4B6M A;  4F17 A;  1D3B B;  1UUE A;  3CCR T;  4QVD A;  1QCO A;  2GF7 A;  4HT9 A;  2YHT A;  2D8J A;  2MYS A;  3QZ5 B;  3FDR A;  3OW2 A;  1HXD A;  1M9S A;  2O9S A;  2ZPB B;  1WXU A;  1PG5 B;  2ZGW A;  4KUD K;  5GAN 7;  3CCJ T;  3I56 T;  2DET A;  4O5V A;  1WHJ A;  2MK5 A;  4E6R A;  1OUL A;  2KT1 A;  4BUG A;  1QVF P;  4WTO B;  3A5Z B;  2DIG A;  2KXD A;  3QWX X;  3CCQ Q;  2CZ1 B;  2DL5 A;  1X75 C;  3VYH B;  3CCV Q;  2X4X A;  1OU9 A;  3VJP A;  2KEA A;  4C92 F;  1VQ6 T;  1AHJ B;  2GQI A;  1N27 A;  3FJ5 A;  5GAN 6;  4AG1 C;  3VU3 C;  1UGV A;  3RIR A;  1W4S A;  2E64 A;  3JCM g;  5CKH A;  1M4Z A;  1AWO A;  4XTW A;  5GAN h;  1H3H A;  1H8K A;  4M7A D;  2DER A;  1ZA1 B;  3L2Z A;  3ZFJ A;  1YCY A;  4FSX A;  2VC8 A;  1SRL A;  3OMG A;  5FWC A;  5CIU A;  1IGU A;  2FVU A;  3EH1 A;  1WJS A;  2L8D A;  3OYA A;  4ME7 A;  2HQX A;  1CKB A;  1YJN Q;  2LJ3 A;  2A36 A;  2EQU A;  2JNG A;  1FXX A;  2AIR B;  1YI2 T;  1YIT T;  1I0C A;  4BD3 A;  4C8Q C;  3V7C A;  3I35 A;  1W1F A;  1M2V A;  4LXC A;  1TUG B;  1XNI A;  4M7D F;  2JM9 A;  3GIB A;  2FZK B;  4HT8 A;  2AT1 B;  5GMK e;  3PVL A;  4OB0 B;  5FU7 B;  3X26 B;  1Z9Z A;  3VS2 A;  3EAE A;  4PL6 A;  5A2Q E;  4JPB W;  3FRN A;  2GTO A;  2J7I A;  1VQL Q;  4MDW A;  4Q5W A;  5CQY A;  2GNC A;  1I8F A;  1MV0 B;  2DL8 A;  1MND A;  1JO8 A;  1M1G A;  1NEB A;  2QYZ A;  1JBM A;  1VYT A;  4N4G A;  1S1N A;  3CME Q;  1QW1 A;  1BI1 A;  4HCZ A;  3CCU A;  4FT2 A;  1YHQ A;  5KYX A;  1KD1 R;  1Q81 R;  2XK0 A;  2QA4 Q;  3VS4 A;  4LDY A;  2GFU A;  4J9B A;  3LLR A;  1U3O A;  1Q7Y R;  3AT1 B;  2R5M A;  2X4J A;  2GFA A;  1XQH A;  2P4T A;  4M77 B;  1VQ5 T;  5GAO r;  3HRS A;  1G83 A;  4F7U B;  1G2B A;  4M75 B;  1ABQ A;  4M7D C;  1BU1 A;  3G6E Q;  4RTV A;  2E3H A;  4F16 A;  4C0Z A;  1M5Q 1;  3C0C A;  1AWX A;  3EG3 A;  1YJ9 A;  3EHQ A;  2EIF A;  4Z02 A;  1OZ2 A;  5DLQ E;  4J5Y A;  4R0K A;  2RHI A;  4PJO F;  1VIF A;  4XTZ A;  1G3T A;  1OZ3 A;  1UGS B;  2JTF A;  2OJ2 A;  4AFZ C;  2QI2 A;  2K3B A;  2H3E B;  1WPY A;  1ZBJ A;  4Y92 A;  4JRI A;  2V8J A;  4C92 G;  1C6V X;  4JDS A;  3NMZ C;  3QWY A;  1PD0 A;  3OSS C;  3UAT A;  3PTA A;  1BK2 A;  3PE0 A;  2ENM A;  5KYY B;  4EMK A;  1F1B B;  5EG2 A;  1O75 A;  4AFS C;  1BIB A;  1WHM A;  1AEY A;  4V2S A;  4K11 A;  3SFM A;  1AT1 B;  2E1H A;  4OB2 B;  4FL6 A;  5I21 A;  2JVV A;  1YJN A;  1M3C A;  4RTU A;  4PNO A;  3M56 A;  2FHD A;  2RQR A;  4A63 B;  4KGV B;  7AT1 B;  3EGX B;  3DLL A;  5CKB A;  2SRC A;  1FYN A;  3V7S A;  3M4Y A;  4DOW A;  4M7D G;  3A98 A;  4L5G A;  2RM4 A;  2I2L A;  2QK0 A;  1YN8 A;  2CRE A;  2RI2 A;  5IXB A;  4IUR A;  2KBT A;  4LUE A;  2SEM A;  2R5A A;  5J3B A;  2ZZD A;  2BUD A;  3AHU A;  5GMK i;  1AWJ A;  2C0I A;  1MV3 A;  2LC4 A;  1VQ9 Q;  1K1Z A;  1PCX A;  1QVG S;  4E7Z A;  3I9Q A;  1K9M R;  4HCC A;  3JCM X;  3M0U A;  1Y7X A;  2LQK A;  4EPC A;  1JJ2 S;  2QEX Q;  4C0D B;  4AFU C;  1LPL A;  4KT0 E;  2DAQ A;  3HL8 A;  1N8R C;  2KQW A;  3ZEH A;  4EDU A;  2H3J A;  4F7U F;  1RI9 A;  3OY9 A;  1KQ1 A;  2IVW A;  1YJW T;  2KRO A;  3A1P A;  2GGR A;  1PWT A;  5IHK A;  3G6E A;  4IUV A;  5GAN 2;  2KI7 A;  1Z9Q A;  3CC7 A;  4E7J A;  2KE9 A;  4KUI A;  2CSQ A;  3BFM A;  2LP5 A;  1QLY A;  4C5E A;  2FEI A;  1OYX A;  2CSI A;  2XID A;  1MNE A;  4C0F A;  3TQ7 P;  3JCM Q;  1NM7 A;  2YLB A;  3H41 A;  4OGE A;  2EGE A;  3PGG A;  1WQ7 A;  1QKX A;  1U1S A;  2K4Y A;  2M9U A;  2VYT A;  1JJ2 P;  1VQM Q;  1PM3 A;  1Y0M A;  2DX1 A;  1SHG A;  2EYQ A;  4ZGD B;  1X01 A;  5EC7 A;  4M77 C;  4MMK A;  3M55 A;  2XD0 A;  3ER0 A;  2CH4 A;  3EGU A;  3QPH A;  2RJF A;  2MF2 A;  4M75 C;  3OYJ A;  4A4K A;  2KK4 A;  5GAO p;  3VKI A;  4C92 D;  2OTL A;  3CD6 Q;  2KXC A;  3VV0 A;  2AHJ B;  5CCA A;  1NG2 A;  2LNH B;  4Z89 A;  3EFO A;  3VS0 A;  4XU1 A;  3BE3 A;  3CCR Q;  4PJO A;  2QQS A;  5CQX A;  1M1K U;  3VS5 A;  1TUC A;  1Y71 A;  1QMC A;  3FIF A;  1J3T A;  2KDS A;  2BZX A;  2YRV A;  4XAX B;  3VRZ A;  3EFS A;  2IIM A;  2JMC A;  1Q86 U;  4ELZ C;  5D6X A;  1H3Z A;  2ABL A;  3RKX A;  1VQP Q;  1TWB A;  1K73 U;  1UJ0 A;  1UGQ B;  3RNJ A;  1JEG A;  5GMK h;  2EGC A;  3VS6 A;  2VWF A;  3JSC A;  1VQ4 Q;  1RAF B;  2Y90 A;  3KFV A;  2DXC A;  3G71 Q;  2XU8 A;  4RTX A;  1YCS B;  1WHH A;  4N0A A;  2D0N A;  4OB3 B;  4HXJ A;  1VQ9 A;  4M7D D;  5KYW B;  4YTL A;  3PT9 A;  5FRN A;  2O31 A;  3VS1 A;  1MMA A;  3DB3 A;  2QEX A;  3ZBD A;  2EQM A;  3HRT A;  2F2V A;  2NUP A;  3C94 A;  3MEU A;  4N4I A;  4M7A E;  1GFC A;  5LJ3 j;  5A0L A;  1PKT A;  2D8H A;  4M77 G;  1BYM A;  4QT7 A;  4KRT A;  3OYB A;  4F7U G;  2EAY A;  2KY9 A;  4M75 G;  1W2B S;  4HA8 A;  5C0M A;  2M1H A;  1UB4 A;  4Y28 E;  3CCM T;  3JB9 J;  8ATC B;  2DZ9 A;  4CC3 A;  1TTH B;  2LX9 A;  3X24 B;  2EKO A;  4RG2 A;  2CGH A;  3P8H A;  4LE9 A;  1X2Q A;  3MEW A;  2RQW A;  2X4Y A;  4PFO A;  2DKG A;  1N5Z A;  5HK0 A;  1JRI A;  2J05 A;  4PFP A;  3SEM A;  4C8Q B;  2QQA A;  2PZ1 A;  1PKS A;  2YUN A;  2PVD B;  4AFQ C;  4HVV A;  1B3Q A;  1QKW A;  2HNI A;  3FB9 A;  4OMM A;  2GQV A;  2LVM A;  2CZ6 B;  4A54 A;  1VQM A;  5GAM j;  2DEQ A;  1RI0 A;  4C0D C;  2DXB A;  3J80 E;  1ZA2 B;  2RQT A;  3S3M A;  2X51 A;  3HHT B;  1HK9 A;  1NZ9 A;  1WQW A;  4FW1 A;  2K9G A;  2AKK A;  4PJO D;  3QUI A;  1YP5 A;  2Z0W A;  1V29 B;  1W2B P;  1KIK A;  2FZG B;  3GBQ A;  5KCH A;  4KBM B;  1LCK A;  1EZZ B;  2RA2 A;  1UJY A;  2RJC A;  1VQ8 T;  2Y4Y A;  4WF2 A;  3NPF A;  3CMA T;  1I5L A;  3TCJ A;  2QAZ A;  2CT4 A;  4C0G A;  2LDM A;  3J81 E;  3CCR A;  1SHF A;  1GCP A;  2YUQ A;  3CCE T;  3HPW A;  3FEO A;  4NL2 A;  1H64 1;  4BI4 A;  1MUZ A;  1ZLM A;  3SWN A;  3MCA B;  2OX7 A;  1WA7 A;  3BDU A;  2E41 A;  4JLG A;  3CCJ A;  2LNV A;  3I56 A;  1TU0 B;  2KNB B;  1KSW A;  1D1C A;  3M54 A;  2NYS A;  2PUO B;  1LOJ A;  1KQS A;  4BE2 A;  2PQW A;  3CCS T;  1VYU A;  3G71 A;  1ZUU A;  4LDV A;  1PHT A;  2G6F X;  5LJ5 g;  3HRU A;  1LJO A;  1VQ6 A;  1M30 A;  2XI9 A;  2YRD A;  1QWF A;  2VVK A;  3CCU Q;  4HVU A;  2FB7 A;  2OAU A;  3RR6 A;  4CC2 A;  1ACM B;  1PSF A;  2DBK A;  3RBB B;  1ZSZ B;  2E3I A;  1E6H A;  2O4X B;  4M78 B;  4PJN A;  1B7T A;  3ASK A;  2PU9 B;  1K0S A;  2BE7 D;  3OYM A;  1NLP C;  5GAN 8;  5LJ5 d;  3CCL T;  1YI2 A;  1YIT A;  2VAS A;  1ABO A;  2X3X D;  2DTO A;  3EGD A;  3OYD A;  2K5L A;  1NEG A;  1K76 A;  1KC8 C;  2EJG A;  3OW2 S;  1CKA A;  2OAW A;  4XK8 E;  3NTK A;  5HCK A;  2PNI A;  4C8Q F;  4ZNX A;  4PJL A;  1YJ9 Q;  1MGQ A;  1ZHI A;  2YLC A;  2HKQ B;  3L2U A;  3QYG B;  3Q1J A;  3LW5 E;  2RHZ A;  3MP6 A;  2DYB A;  2OI3 A;  5CKD A;  2RO0 A;  4XTU A;  2HSE B;  1X69 A;  4DOV A;  2OTJ T;  1PNJ A;  3E19 A;  5I22 A;  1VYV A;  1D0X A;  1C1A A;  1AD5 A;  2DRK A;  1FMK A;  2E70 A;  2P0Q A;  1VQK T;  5L8R E;  2HCK A;  2MMP A;  3M5A A;  1RLQ C;  3CBP A;  2O01 E;  3HSB A;  1BBZ A;  3SDZ A;  1VQ5 A;  1FMW A;  4E2F B;  1R0B G;  2ZPI B;  1QQJ A;  1VA7 A;  4LD9 K;  1AWW A;  4ATO A;  1OPK A;  2DBM A;  2IG0 A;  4XTY A;  5FRM A;  1YFN A;  2DNU A;  2JM8 A;  1YIJ T;  3DLM A;  1IRX A;  2A37 A;  3JAM E;  2EJ9 A;  3JCM d;  1N8R U;  2A3L A;  3I55 T;  3QSU A;  1BI3 A;  1JXM A;  2X4W A;  5D7U A;  2XDD A;  3S3N A;  2MOX A;  3H0H A;  3JB9 H;  5DM7 R;  2VXE A;  1K9A A;  1B34 A;  3JB9 F;  1C0M A;  1KFZ A;  2EYY A;  2DD5 A;  3URG A;  2EJF A;  1WDX A;  5GAO m;  2BKD N;  1XTD A;  2QDL A;  3RKW A;  1M1F A;  2MWO A;  2DD4 A;  1WYX A;  4M78 F;  4F04 B;  5GAN j;  5KH6 A;  4C92 E;  3OA6 A;  1LNX A;  4QQ6 A;  4FYX B;  2JOY A;  3JCM c;  3LH0 A;  1RAB B;  3VUZ A;  2BIV A;  2F1L A;  2NUT A;  2LZ6 B;  2BZY A;  2EVR A;  3NTI A;  3A8L B;  2RHX A;  2AZS A;  5HKC A;  1NJI C;  4BE0 A;  5GAO q;  3C12 A;  3CC7 Q;  3OYK A;  1OX9 A;  4X9C A;  2COW A;  3NHN A;  4C8Q G;  1IB8 A;  4XU3 A;  1K0X A;  3N5B B;  1X27 A;  4E7L A;  3OSV A;  1OV3 A;  2RHY A;  3CC4 T;  3EG9 A;  1N6A A;  4BI8 B;  2O88 A;  2GBQ A;  1WHG A;  3SD4 A;  4M7D E;  2C06 A;  1X6O A;  4JJC A;  3KBG A;  1ZSZ C;  5IHN A;  5KYU A;  2JTM A;  1RAE B;  3G4S T;  4M78 C;  4ANJ A;  5LJ5 e;  2L5Q A;  4ZN3 A;  4J9I A;  4X34 A;  4JS4 A;  1MHN A;  1G3W A;  2PVO B;  2AKL A;  2HD0 A;  4QKU A;  2DZC A;  2DMO A;  3X25 B;  1UTI A;  4A4H A;  2EKH A;  4EIK A;  1VQ7 T;  4M7A B;  2OTL Q;  4ZTJ A;  2RI3 A;  1ARK A;  4FM4 B;  2KR3 A;  4IUT A;  2YSQ A;  1YJW A;  4PKC C;  5GAO l;  1BI0 A;  5KE2 A;  4QW2 A;  2QGG A;  2DVJ A;  3QJY A;  3ZL7 C;  2X3W D;  3L2R A;  4OF1 A;  3NTH A;  4C92 A;  2M16 A;  2D6F A;  3MPU B;  2PTK A;  2J6O A;  2M51 A;  1Y96 A;  1ZX6 A;  2JTE A;  2CP7 A;  3MEA A;  2M02 A;  1R8O B;  4LDU A;  2JXB A;  4RTT A;  5IT9 E;  3JCM b;  1QP3 A;  2EWN A;  1EFN A;  1JU5 C;  4XTV A;  4DEY A;  3TU4 K;  5CAI A;  3JB9 G;  2FRY A;  4FYY B;  1G8X A;  3P8D A;  3REA B;  4PJO E;  2CP5 A;  3PVQ A;  3E9G A;  1RAG B;  3H9N A;  3UDC A;  3V8L A;  1NPR A;  2L3P A;  4J8O A;  3EHR A;  2RI5 A;  4M78 G;  3CCQ T;  1MMD A;  1XJW B;  2CP0 A;  1O9S A;  4M7D A;  1QVG A;  3CCV T;  3CMA Q;  4M77 F;  2B8A A;  3JCM e;  1PRM C;  2K6D A;  1UE9 A;  2XHC A;  5LJ3 f;  1JJ2 A;  4M75 F;  1SRM A;  1RUW A;  3CCE Q;  3BDL A;  4J9D A;  2X35 A;  1E6G A;  2D9T A;  2K2M A;  4HCB A;  2I0N A;  2W10 A;  4D8D A;  2CS7 A;  1D09 B;  1RL2 A;  4OGC A;  3L1A A;  1T0H A;  2EPD A;  3H0F A;  1K4U S;  1TUD A;  2LT1 A;  1WXT A;  4MML A;  1QVG P;  1M27 C;  1X6B A;  3CCS Q;  2E6Z A;  3PMT A;  3INZ A;  3A8O B;  3M0Q A;  1G5V A;  2RB6 A;  3M59 A;  1D3B A;  4C8Q D;  1KG1 A;  2DXU A;  4OVA A;  3V8K A;  3UA6 A;  1VQN Q;  2O2O A;  3QYH B;  5GAM f;  2CDT A;  2ZPG B;  5L23 A;  2K5F A;  2HKN A;  1SSH A;  2DO3 A;  3GNF B;  1VQL T;  2LTO A;  1PC0 A;  1M2V B;  2LJ1 A;  4MDX A;  1ZBX A;  3LX7 A;  1GFD A;  1WIE A;  1GCQ C;  2LT4 A;  3CME T;  1M8V A;  3CCM A;  3LWI A;  4C5I A;  3CCL Q;  2CKK A;  2QA4 T;  1JB0 E;  2CUD A;  1WHL A;  1NLO C;  4ZTF A;  3CC2 T;  8AT1 B;  5FW9 A;  4QQD A;  2KT8 A;  4DQ2 A;  4R55 A;  4IKF A;  3CPW S;  1X2K A;  3WXM B;  4J83 A;  4F7U E;  4LDW A;  3CCJ Q;  1IZ6 A;  3I56 Q;  2YWW A;  3RER A;  1KK7 A;  3SHW A;  2FO0 A;  3LGF A;  1U06 A;  3FC3 A;  2JS0 A;  4GLK A;  4RKU E;  2F5T X;  4DBQ A;  1M1K R;  1M90 U;  2V1Q A;  2JMA A;  3G6E T;  2LQN A;  1JXO A;  5KYX B;  3CXC S;  1OI1 A;  3MHX A;  1Q86 R;  4JJD A;  3MET A;  1VQ6 Q;  2RMO A;  1I07 A;  1K73 R;  5AT1 B;  1KC8 U;  4BAC A;  1VQK Q;  4LDX A;  4M7A C;  2XIC A;  2QDY B;  1HJD A;  1UGP B;  4HVW A;  1VQ8 A;  4P5N A;  5GJW B;  4NOY A;  3CMA A;  5LJ3 g;  3JB9 D;  2JUF A;  2J06 A;  5CK9 A;  2A7Y A;  2DJZ A;  4ELY C;  1K8A C;  2A28 A;  2W0Z A;  2XDP A;  3CPW P;  3RMS A;  4E7K A;  4KGX B;  2L0A A;  3CCE A;  4AG2 C;  1NYG A;  2HEQ A;  4M78 D;  1YI2 Q;  2J6K A;  1YIT Q;  4Z8A A;  4OML A;  5D6Y A;  1K9M C;  1OOT A;  3MEV A;  1W2B A;  1WI7 A;  5ECA A;  4II1 A;  1LVK A;  3JCM V;  4LNP A;  3CCS A;  3FJP A;  5LJ3 d;  4A4G A;  2F2W A;  1SPK A;  5GMK j;  1RAH B;  2XDB A;  1YWO A;  3GPL A;  4M77 A;  5IN1 A;  4EMK B;  2VGM A;  5I2M A;  4F7U A;  2V26 A;  4RCB A;  5GAM g;  4M75 A;  3H0I A;  3IQL A;  2P4R A;  1VQN A;  1TS9 A;  1GBR A;  2ZPF B;  2D0Q B;  3KUF A;  1Y57 A;  5LJ5 h;  5CR2 A;  1JQQ A;  4KUL A;  3M0T A;  2EYZ A;  2FPD A;  1UFF A;  4JJN K;  3JV3 A;  1VOM A;  1W70 A;  2V8K A;  4BI3 A;  1Y07 A;  4M7A G;  4OMP A;  4RTW A;  1OQK A;  2DRM A;  4BB7 A;  1VQ5 Q;  4UC4 A;  3CQT A;  1ZQ1 A;  4ZN1 A;  2XKO C;  3CCL A;  4PLL A;  4A4E A;  5GAM d;  1D0Y A;  5GAN 3;  3TSZ A;  4R56 A;  3JCM P;  2K3Y A;  5IH2 A;  1NPP A;  4FT4 A;  4HKE A;  1M3B A;  3GF5 A;  5LL6 S;  2Y4X A;  3JCM W;  4ORZ A;  4IIM A;  2DTI A;  2CZ7 B;  5KYY A;  2K2V A;  1AZE A;  3ME9 A;  4J6W A;  3A8M B;  1H92 A;  5C6S A;  2RQV A;  4JRK A;  3U23 A;  2EBP A;  1HD3 A;  2ROT A;  3UA7 A;  3EG2 A;  3M0P A;  1WJR A;  4NL3 A;  2FZC B;  5M9O A;  2OTJ A;  1BIA A;  1NJI U;  2DL3 A;  3OYY A;  3G4S Q;  4OMN A;  1WX6 A;  2LRQ A;  1FWZ A;  5GAO n;  1VQK A;  3A8H B;  2BTT A;  1GBQ A;  2F2X A;  2E12 A;  5DLO A;  3EGX A;  3C95 A;  1VQO T;  4RCC A;  2RN8 A;  1VQM T;  2LMJ A;  5GAN 5;  5D6W A;  1QP2 A;  1Q82 C;  2CP3 A;  3JCM h;  2DTH A;  3D7S B;  1WFW A;  4O6J A;  1IRE B;  2R58 A;  1U1T A;  3FLG A;  4J9F A;  1M90 C;  3EG0 A;  1QVF S;  4DBH A;  2QXF A;  1TOV A;  4XU0 A;  4OP0 A;  5GAN f;  2YUP A;  2C0T A;  1GRI A;  1R77 A;  3A8G B;  2COZ A;  3M58 A;  1T0J A;  2R57 A;  1ZUK A;  4M77 D;  1SF9 A;  4D6W A;  5HY6 A;  4JLI A;  5GJV B;  4FIB A;  4Z88 A;  3CD6 T;  4M75 D;  1QWE A;  4JRQ A;  3I55 A;  2E5K A;  2V1R A;  3QKJ A;  1V76 A;  2DJQ A;  4BY6 B;  1SG5 A;  3QJ6 A;  3BY7 A;  1WJQ A;  2CYZ B;  4B9W A;  2IPO B;  3JCM J;  1RAA B;  3SB2 A;  1VQP T;  4XU2 A;  1BI2 A;  3M0R A;  1QCF A;  3PIO A;  2QQR A;  3OBY A;  1KHI A;  4CI0 C;  2PUK B;  3OS0 A;  3EG1 A;  2K3X A;  2RJD A;  1VQ4 T;  3EFO B;  3OYG A;  2VKN A;  4FYW B;  3CBM A;  3O8V A;  3NFC A;  2AZV A;  1U8R A;  4PJO B;  1BCM A;  4CRI A;  3G71 T;  2KSS A;  2NUZ A;  3RMQ A;  3OYF A;  4PK4 A;  5FU6 B;  1S72 T;  3OYE A;  3VYG A;  2HL5 C;  3OYN A;  1SEM A;  2MPX C;  4QQG A;  3OW2 P;  1G3S A;  1YJW Q;  1XOV A;  2AK5 A;  5LJ3 e;  3UT1 A;  3UF4 A;  4DBF A;  3THK A;  4KGZ B;  2VB6 A;  3DB4 A;  3H6Z A;  2K57 A;  2MIO A;  2A08 A;  2GTJ A;  2QQB A;  2KYM A;  4FYV B;  3MP8 A;  5IXF A;  2DEU A;  2YXY A;  3MP1 A;  4OMO A;  4EMK C;  2LCC A;  3CC4 A;  4E7I A;  3RES A;  2PVG B;  3E1S A;  2NUP B;  2LX7 A;  1EIF A;  4C8Q E;  3LH5 A;  3RKY A;  2EGA A;  2HZY A;  2JS2 A;  3G4S A;  1N8R R;  1X43 A;  1WXB A;  3S6W A;  3OYL A;  1TXQ A;  4GLM A;  3OB9 A;  1KD1 U;  1Q81 U;  5GAM e;  4JS5 A;  3KXT A;  4C92 C;  4BDY A;  2EFI A;  3MO8 A;  1IO6 A;  2B86 A;  3VS3 A;  1Q7Y U;  2CUB A;  1VQ7 A;  5I2S A;  1NBE B;  2QAS A;  4LD6 A;  5GAN g;  1HYO A;  4J9E A;  2FG0 A;  4IUP A;  3L2W A;  1R0C B;  2EQJ A;  2JT4 A;  2QGF B;  6AT1 B;  4NS5 A;  1OEB A;  5KYW A;  3CC2 Q;  3L2Q A;  2A0F B;  3TVT A;  1SSF A;  2HQE A;  4JUV A;  5FWB A;  1RAC B;  2DYI A;  2YDL A;  4ESR A;  1TSF A;  4J6Y A;  4X1V A;  3QG1 A;  4GBQ A;  2ESW A;  1GXI E;  1UGR B;  3QXE B;  4HCK A;  2NWM A;  5GAN d;  4J7I A;  4VUB A;  4CC7 A;  4FW2 A;  2J6F A;  1PRL C;  3JB9 I;  4D8K A;  2ZAE A;  1YWP A;  4OB1 B;  4X9D A;  2V8I A;  1I1J A;  3CPF A;  1PSE A;  4L6V 5;  3CCQ A;  5J26 A;  4JJB A;  4GY5 A;  3CCV A;  2DPP B;  4M4Z A;  3V7R A;  3SWN B;  2VGN A;  4C8Q A;  4ZGJ B;  1YBY A;  2FL7 A;  2MWP A;  3QBY A;  2VV5 A;  2ECZ A;  4BDZ A;  3CCM Q;  1ZSG A;  3CCU T;  1YHQ T;  4MZP A;  2EYW A;  4JRP A;  4M78 E;  2DL7 A;  1PD1 A;  1WHK A;  2DA9 A;  2WSC E;  2ZPE B;  2KRN A;  4FCY A;  3QDF A;  1AZG B;  4BY6 C;  1SKU B;  2FRW A;  4MZM A;  4QVZ A;  1TG0 A;  3UWN A;  1GL5 A;  5GMK m;  2HSP A;  1WLP B;  3J7A F;  2HBW A;  2FYK A;  1K8A U;  5KYN A;  1D0Z A;  5J39 A;  4J9G A;  1FMV A;  5I11 A;  1OPL A;  5IAY A;  1NYF A;  4PJO C;  2CZ0 B;  2DE0 X;  2K7A A;  1K9M U;  2CP2 A;  3X20 B;  5FU6 C;  1YJ9 T;  1T3S A;  2HDA A;  2KVQ G;  5DY9 A;  2HQH A;  3VRY A;  1K8A R;  3C4S A;  2P0K A;  1VQ8 Q;  2RF0 A;  2F5K A;  2LCS A;  1VQL A;  4J9H A;  3MKD A;  3EGD B;  5KE3 A;  5CKF A;  2E10 A;  3HFO A;  2DLP A;  3TRE A;  3CME A;  1KHC A;  4DEX A;  2ZCF B;  2JN0 A;  4MZT A;  2ZPH B;  4N0A C;  2QA4 A;  5GAN 4;  2WAC A;  5CKE A;  4FU6 A;  3CC2 A;  4RUG A;  4AMC A;  2DXT A;  4DA4 A;  2ED0 A;  1UDL A;  5A0G A;  1RAD B;  9ATC B;  4LUD A;  1KD1 C;  1Q81 C;  1IHW A;  2L3Q A;  4Y91 A;  1TH7 A;  2RHU A;  3E9F A;  1ZSZ A;  1Q7Y C;  1YJN T;  2ED1 A;  2O4X A;  4CC4 B;  4M78 A;  5FU7 C;  4PJM A;  1RLP C;  3OS5 A;  2DF6 A;  4EMH A;  1UEC A;  3PMI A;  3DKM A;  3PFS A;  1YNZ A;  1OU8 A;  4PFZ A;  1KJW A;  3PIP A;  2CP6 A;  3OS2 A;  4L59 A;  5GMK l;  1HSQ A;  2H8H A;  4PJO G;  2HMA A;  3QZ9 B;  1VIE A;  3M4G A;  3S3O A;  2LCL A;  2JZ2 A;  1VQO Q;  1M3A A;  4M7A F;  2DM1 A;  1CSK A;  4JZ4 A;  3GP8 A;  2L3S A;  1KQ2 A;  5LJ3 h;  4EMG A;  1M2O A;  4J6X A;  2NLU A;  3TEE A;  5FRO A;  5GAN e;  3NGP A;  2KRS A;  4M77 E;  3UPU A;  1G3Y A;  2KMT A;  4ZGE B;  2RNA A;  4A53 A;  4AT1 B;  4M75 E;  1N9R A;  3OYI A;  3I5S A;  2WSF E;  3ULR B;  2KYB A;  2XMF A;  1B34 B;  1MMN A;  5IHI A;  3LWH A;  2EQK A;  1Q82 U;  4RTY A;  1X6G A;  1W6X A;  2K5I A;  2QQ9 A;  3G7Z A;  3HKS A;  3CPW A;  2M0O A;  1I5O B;  2DIL A;  2RK2 A;  1AOJ A;  2HBP A;  5A0D A;  3QHS A;  3L2V A;  4J9C A;  3CC7 T;  4F14 A;  3MJX A;  3R6N A;  1BKB A;  2YT6 A;  3E2U A;  4E7S A;  3OYH A;  2OTJ Q;  3M53 A;  3V8J A;  2G3R A;  3SWN C;  1Q82 R;  1ZUY A;  2D1X A;  1V1C A;  2CH4 W;  5GAM h;  3CXC A;  1M90 R;  1VUB A;  2CT3 A;  2NUT B;  2DVE A;  4OMQ A;  1D1B A;  4KH0 B;  1S72 Q;  3EFR A;  2O9V A;  4RMO A;  2GCX A;  5LJ5 f;  4XTX A;  2RK1 A;  2RQU A;  3GNG A;  2DL4 A;  3GLX A;  1WGS A;  1KC8 R;  2ATC B;  2RPN A;  3HFN A;  4E47 A;  1IHV A;  2COY A;  5CVI A;  2KAF A;  1QVP A;  3WVD B;  3VUB A;  1YIJ Q;  3EG9 B;  1D1A A;  1I4K 1;  2P0P A;  3R6O A;  2BZ8 A;  3CXC P;  2OTL T;  4IUU A;  3RUX A;  4BE1 A;  3F70 A;  3OQ5 A;  3I55 Q;  2K79 A;  5KYU B;  4OMF B;  1FX7 A;  2LQW A;  3O5Z A;  1NE8 A;  4RG8 A;  2RJE A;  1MMG A;  2LJ0 A;  1Q95 G;  1U5S A;  2KGT A;  2MCN A;  4IUQ A;  1OX8 A;  3WVE B;  4QVC A;  1UHC A;  2DFU A;  1UG1 A;  3X28 B;  2E65 A;  3M57 A;  3LYI A;  2KRM A;  1AVZ C;  1GCQ A;  2E6N A;  1A0N B;  2EW3 A;  3BW1 A;  4C5H A;  1VQO A;  2RD1 A;  3OMC A;  2M0Y A;  3REB B;  3TSW A;  2LQ8 A;  1VQ9 T;  2XG8 D;  3QII A;  3OS1 A;  2ROL A;  4C92 B;  3T9N A;  1QCN A;  2C0O A;  2L3R A;  2JJ9 A;  5FLX E;  2QEX T;  2F69 A;  1Y96 B;  3VS7 A;  1DJ7 B;  2E4H A;  4KH1 B;  2L2P A;  2EQI A;  2BE9 B;  3JCM f;  5HK3 A;  2HL3 A;  2JW4 A;  2YUO A;  1UHF A;  1WNL A;  3CD6 A;  2QTX A;  3EH2 A;  3QO3 A;  3H8Z A;  1WZO A;  3OYC A;  2DK3 A;  2P84 A;  4C5G A;  4IIO A;  3CC4 Q;  3RDV A;  3M9Q A;  4N4H A;  1KQS S;  2RH2 A;  4M7A A;  2FPE A;  4B9X A;  4XQ3 A;  1VQP A;  1I81 A;  1P92 A;  3OBW A;  1RAI B;  4M7D B; 
#chains in the Genus database with same CATH homology
 2LX7 A;  1BB9 A;  1EFN A;  3KFV A;  3LH5 A;  2EGA A;  2JS2 A;  1JU5 C;  4RTX A;  4DEY A;  1YCS B;  1B07 A;  1X43 A;  1WXB A;  2D0N A;  4LN2 A;  4HXJ A;  2FRY A;  4JZ3 A;  4GLM A;  1E7O A;  2EYX A;  3REA B;  2FPF A;  3PVQ A;  1IO6 A;  2B86 A;  2O31 A;  3VS3 A;  1T3L A;  2L3P A;  2CUB A;  3EHR A;  3VS1 A;  4RTZ A;  4WCI A;  2F2V A;  3M0S A;  1GFC A;  4J9E A;  2FG0 A;  1PKT A;  1PRM C;  1UE9 A;  2D8H A;  2K6D A;  4QT7 A;  3I5R A;  4KRT A;  1M8M A;  2JT4 A;  1SRM A;  1RUW A;  1OEB A;  4J9D A;  1E6G A;  3TVT A;  5FWB A;  2K2M A;  4FSS A;  4ESR A;  2YDL A;  4F17 A;  1UUE A;  4CC3 A;  2I0N A;  2W10 A;  4D8D A;  4X1V A;  4LE9 A;  1X2Q A;  1T0H A;  2D8J A;  2EPD A;  3H0F A;  4GBQ A;  1K4U S;  2ESW A;  2RQW A;  1TUD A;  4HCK A;  2O9S A;  1WXT A;  1WXU A;  1M27 C;  1X6B A;  2NWM A;  1N5Z A;  4CC7 A;  2J05 A;  3SEM A;  2J6F A;  1PRL C;  2PZ1 A;  1PKS A;  2YUN A;  4D8K A;  4AFQ C;  4HVV A;  1B3Q A;  4E6R A;  1QKW A;  3M0Q A;  1YWP A;  4OMM A;  2KT1 A;  1I1J A;  2KXD A;  3QWX X;  3UA6 A;  2O2O A;  2CDT A;  5L23 A;  2DL5 A;  2RQT A;  4JJB A;  2K9G A;  2AKK A;  2KEA A;  1YP5 A;  1SSH A;  2GQI A;  4M4Z A;  1KIK A;  3FJ5 A;  4AG1 C;  3GBQ A;  1UGV A;  1LCK A;  1UJY A;  2ECZ A;  1AWO A;  2LJ1 A;  1ZSG A;  1H3H A;  1H8K A;  3NPF A;  1WIE A;  1GCQ C;  1GFD A;  2EYW A;  2DL7 A;  2CT4 A;  1SRL A;  5FWC A;  2DA9 A;  2KRN A;  1SHF A;  1GCP A;  1AZG B;  2YUQ A;  2CUD A;  1NLO C;  2FRW A;  5FW9 A;  2KT8 A;  1MUZ A;  1ZLM A;  1CKB A;  1X2K A;  2LJ3 A;  2A36 A;  1TG0 A;  1WA7 A;  1GL5 A;  2HSP A;  1I0C A;  1WLP B;  2HBW A;  3SHW A;  3I35 A;  1W1F A;  2FO0 A;  1U06 A;  2KNB B;  1KSW A;  2JS0 A;  2JM9 A;  2V1Q A;  4J9G A;  5I11 A;  2JMA A;  2LQN A;  1JXO A;  1OPL A;  1NYF A;  1VYU A;  2DE0 X;  3PVL A;  2K7A A;  1ZUU A;  1Z9Z A;  3VS2 A;  1PHT A;  4JJD A;  2G6F X;  1T3S A;  2HDA A;  4JPB W;  2RMO A;  1I07 A;  3VRY A;  1M30 A;  2GTO A;  2J7I A;  2GNC A;  1QWF A;  1MV0 B;  2RF0 A;  2VVK A;  2DL8 A;  2LCS A;  1HJD A;  1JO8 A;  4J9H A;  1NEB A;  4HVW A;  4HVU A;  1VYT A;  1S1N A;  5GJW B;  4CC2 A;  2DLP A;  2DBK A;  3RBB B;  4DEX A;  1E6H A;  2J06 A;  3VS4 A;  2A28 A;  2W0Z A;  4J9B A;  1U3O A;  2L0A A;  1K0S A;  4RUG A;  4AG2 C;  1NYG A;  1NLP C;  2HEQ A;  2J6K A;  2ED0 A;  1UDL A;  4Z8A A;  4OML A;  4LUD A;  1G83 A;  1OOT A;  1ABO A;  2X3X D;  1G2B A;  1NEG A;  1ABQ A;  2L3Q A;  1K76 A;  1WI7 A;  5ECA A;  1BU1 A;  4RTV A;  2ED1 A;  4F16 A;  4CC4 B;  4LNP A;  1CKA A;  2OAW A;  5HCK A;  2PNI A;  4ZNX A;  1RLP C;  2F2W A;  2DF6 A;  1SPK A;  3C0C A;  1AWX A;  1UEC A;  1YWO A;  3EG3 A;  3EHQ A;  1YNZ A;  4R0K A;  1KJW A;  3H0I A;  3IQL A;  1HSQ A;  2P4R A;  2DYB A;  2H8H A;  2OI3 A;  1GBR A;  2OJ2 A;  4AFZ C;  1Y57 A;  2K3B A;  1ZBJ A;  1JQQ A;  4Y92 A;  1X69 A;  1PNJ A;  1M3A A;  5I22 A;  1VYV A;  3M0T A;  1AD5 A;  2DRK A;  1FMK A;  2EYZ A;  1UFF A;  2FPD A;  3JV3 A;  3NMZ C;  3QWY A;  2DM1 A;  1CSK A;  1W70 A;  4JZ4 A;  2HCK A;  4OMP A;  1RLQ C;  3UAT A;  1BK2 A;  4RTW A;  2L3S A;  3PE0 A;  2DRM A;  1BBZ A;  2ENM A;  3CQT A;  4AFS C;  1AEY A;  3NGP A;  2KRS A;  4K11 A;  1VA7 A;  2RNA A;  1AWW A;  3TSZ A;  1OPK A;  2DBM A;  3I5S A;  1M3C A;  5IH2 A;  4RTU A;  3ULR B;  2KYB A;  2RQR A;  2XMF A;  1M3B A;  5IHI A;  2DNU A;  2JM8 A;  2A37 A;  4RTY A;  1X6G A;  4ORZ A;  4IIM A;  1W6X A;  4A63 B;  1AZE A;  2SRC A;  2DIL A;  1FYN A;  1AOJ A;  1H92 A;  3A98 A;  2RQV A;  3U23 A;  4J9C A;  1YN8 A;  1JXM A;  2CRE A;  2EBP A;  1HD3 A;  5IXB A;  4F14 A;  3R6N A;  2YT6 A;  2ROT A;  3UA7 A;  3EG2 A;  3M0P A;  2KBT A;  4LUE A;  2MOX A;  2SEM A;  3H0H A;  1ZUY A;  2DL3 A;  2D1X A;  1K9A A;  1V1C A;  4OMN A;  1WX6 A;  2CH4 W;  1AWJ A;  2BTT A;  2C0I A;  1MV3 A;  2CT3 A;  1KFZ A;  1GBQ A;  2F2X A;  1K1Z A;  2EYY A;  4OMQ A;  1WDX A;  3I9Q A;  2O9V A;  2QDL A;  2RN8 A;  3M0U A;  2LMJ A;  1WYX A;  2RQU A;  2DL4 A;  1WFW A;  2RPN A;  4AFU C;  4J9F A;  3EG0 A;  2YUP A;  2C0T A;  1GRI A;  1T0J A;  1RI9 A;  2LZ6 B;  2BZY A;  2EVR A;  2BZ8 A;  1ZUK A;  2AZS A;  2KRO A;  5GJV B;  2GGR A;  1PWT A;  5IHK A;  4Z88 A;  2K79 A;  1QWE A;  2LQW A;  3O5Z A;  2E5K A;  2V1R A;  1Z9Q A;  3NHN A;  2KE9 A;  2LJ0 A;  2CSQ A;  2DJQ A;  2LP5 A;  1QLY A;  1K0X A;  2FEI A;  1X27 A;  1U5S A;  2KGT A;  2MCN A;  1OV3 A;  2CSI A;  1NM7 A;  3H41 A;  2O88 A;  1UHC A;  2GBQ A;  2EGE A;  1UG1 A;  1QKX A;  4JJC A;  2KRM A;  5IHN A;  1AVZ C;  1QCF A;  1GCQ A;  3M0R A;  1A0N B;  2EW3 A;  1Y0M A;  3EG1 A;  2VKN A;  2M0Y A;  3REB B;  2AZV A;  4J9I A;  3TSW A;  2DX1 A;  2NUZ A;  1SHG A;  2ROL A;  5EC7 A;  2AKL A;  2DMO A;  2C0O A;  2CH4 A;  1UTI A;  3EGU A;  1SEM A;  2EKH A;  4EIK A;  1ARK A;  1XOV A;  2AK5 A;  3VS7 A;  3UF4 A;  2L2P A;  2KR3 A;  2EQI A;  3THK A;  2KXC A;  2YSQ A;  2JW4 A;  1NG2 A;  2LNH B;  2YUO A;  4Z89 A;  1UHF A;  3VS0 A;  2MIO A;  2A08 A;  2GTJ A;  2DVJ A;  3ZL7 C;  2KYM A;  2X3W D;  5IXF A;  3VS5 A;  1TUC A;  1J3T A;  2BZX A;  4IIO A;  4OMO A;  3VRZ A;  2PTK A;  2IIM A;  2J6O A;  2JMC A;  2ABL A;  2FPE A;  1ZX6 A;  2M51 A;  2JTE A;  1UJ0 A;  3RNJ A;  1JEG A;  2EGC A;  3VS6 A;  2JXB A;  2VWF A;  4RTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...