3H0FA

Crystal structure of the human fyn sh3 r96w mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
b'VTLFVALYDYEAWTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Fyn
publication title SH3 domain specificity
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 11
structure length 59
sequence length 59
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3h0fA00
4AFQC 2K79A 2ENMA 4CC2A 1B3QA 3FJ5A 4JZ3A 2CT3A 2FPDA 4HXJA 1BBZA 2O9VA 1FMKA 1UGVA 1PWTA 3REAB 4CC3A 2FRWA 1GRIA 2ROTA 1AWOA 1ZX6A 2DF6A 2YUPA 1I07A 4K11A 1OPLA 2GTJA 1E6HA 2KROA 4GLMA 5ECAA 3EGUA 1JXOA 1NLOC 2LCSA 2AK5A 2LZ6B 2YSQA 3VS4A 5I22A 1GBRA 1NEBA 1PKSA 1QKXA 4J9HA 2BZ8A 2HDAA 1V1CA 1G2BA 1QWEA 2K6DA 3VS7A 2JS2A 2A36A 1EFNA 2G6FX 4DEXA 2EVRA 2RQTA 2CUBA 1UJYA 1YNZA 1S1NA 1WI7A 4AG2C 2DL5A 1GBQA 1UHCA 4RTYA 1UECA 1TUDA 3TSZA 1UFFA 2LJ3A 2EYXA 1N5ZA 4HVUA 2M51A 2O31A 1A0NB 1M27C 1SHGA 1ZBJA 2JTEA 2XMFA 3UA7A 2BTTA 2PNIA 5GJVB 2L2PA 4F16A 2EBPA 2LQWA 2V1QA 4OMLA 3VS2A 2RQVA 2GGRA 3VS6A 5FWBA 2EGCA 4Y92A 5L23A 2KGTA 1AZGB 1YWPA 2RQUA 1WXTA 2F2XA 1JU5C 1UJ0A 1M3BA 1NYGA 2OI3A 4CC7A 4AFSC 2A28A 4AFZC 2CH4W 2J6KA 2KRNA 2D1XA 3CQTA 4AFUC 1JO8A 1UE9A 1PKTA 1UHFA 2FEIA 1NM7A 5IHIA 2KBTA 3RNJA 1HD3A 4M4ZA 4LNPA 1GL5A 1W1FA 1ZUUA 2CT4A 2KXCA 1WX6A 2DL4A 4F14A 5IHNA 2JMAA 1X2QA 4RTUA 1OEBA 2RF0A 1X6GA 3VS1A 2C0OA 2GQIA 2LNHB 4R0KA 4OMPA 4JJBA 1K9AA 2CREA 2E5KA 2I0NA 2YUOA 2AKLA 4RTWA 2O2OA 2EYYA 2K9GA 2DA9A 4DEYA 2DMOA 2VKNA 2K3BA 4ZNXA 1GFDA 4J9BA 2J05A 2VWFA 1TUCA 4LE9A 1MUZA 1SSHA 1RUWA 2DRMA 1WFWA 3H0FA 1FYNA 3H41A 2OAWA 1BK2A 1WLPB 1T0JA 4OMOA 3NHNA 1NLPC 2C0IA 1K76A 1NEGA 4OMMA 1VYVA 1TG0A 1Z9ZA 1U3OA 2CDTA 3QWXX 1AZEA 1WA7A 1PRMC 3VRZA 1AWXA 2DYBA 4JZ4A 5HCKA 1E6GA 2D8HA 1AD5A 2RNAA 1UDLA 3EG1A 1RI9A 1LCKA 4RTXA 4RTZA 2BZYA 3VS3A 2GNCA 1JXMA 2HBWA 2KYBA 3I9QA 4JJDA 2MCNA 2DLPA 3GBQA 1K4US 1Z9QA 3VS5A 2GBQA 1XOVA 4J9IA 1CKAA 3EHQA 2JMCA 1AWJA 2CUDA 1QLYA 2GTOA 1KIKA 1RLPC 1HSQA 4J9CA 3IQLA 2EQIA 1W6XA 1K0XA 2DX1A 1YN8A 4OMQA 2FRYA 3H0HA 4RTTA 2JM9A 2YDLA 4D8DA 2K2MA 1ZUKA 2L3SA 3UA6A 2RMOA 2RPNA 3U23A 2OJ2A 1T3SA 3A98A 2KR3A 2JXBA 5EC7A 2NUZA 3PVQA 2D0NA 2L3QA 1CSKA 1J3TA 4AG1C 1GCPA 1OV3A 2J6FA 4IIMA 1X69A 2FO0A 1BU1A 1VYUA 1IO6A 1UG1A 2JT4A 2JW4A 2AZSA 3M0PA 3I5SA 4E6RA 5I11A 2F2WA 3EG0A 5IXBA 1ZLMA 2CSIA 3THKA 4ESRA 1HJDA 1QKWA 1NG2A 4IIOA 2QDLA 4J9GA 1NYFA 1U5SA 2FG0A 2HEQA 3ULRB 2P4RA 5FW9A 2KRSA 1T3LA 1WYXA 1VA7A 4JJCA 2ED1A 4HVVA 1PRLC 1SRLA 2YUNA 2A37A 1M30A 1WXUA 2AKKA 2X3WD 2J6OA 2RQWA 3PVLA 2ED0A 3M0RA 2O88A 1X43A 1B07A 3H0IA 4J9DA 2DM1A 1SRMA 3VRYA 2ROLA 2DILA 2DJQA 1Y0MA 2LP5A 2ECZA 2K7AA 3VS0A 1X6BA 5FWCA 1MV0B 4CC4B 2EGAA 1VYTA 1KFZA 1W70A 2EPDA 2V1RA 2H8HA 2KT8A 1GCQA 1Y57A 2AZVA 1I0CA 2CSQA 1SHFA 1K0SA 3SHWA 2EYWA 1M3CA 1AEYA 2DNUA 1WDXA 2MIOA 1JEGA 1M3AA 3M0SA 1WIEA 3EG2A 2J7IA 2D8JA 2DVJA 1SEMA 4A63B 5GJWB 4F17A 3M0TA 4LUEA 2M0YA 1ABOA 2CH4A 5IXFA 2EGEA 2LJ0A 1JQQA 3M0QA 1H8KA 2DBKA 2FPEA 1H3HA 2NWMA 1QCFA 4GBQA 4HVWA 4RTVA 1G83A 2KNBB 4OMNA 5IH2A 2EYZA 1YWOA 1YP5A 1KJWA 2W0ZA 2KXDA 1MV3A 1YCSB 1SPKA 4J9EA 2X3XD 2B86A 2KRMA 3O5ZA 1RLQC 2DRKA 2LX7A 2LJ1A 3I5RA 2KE9A 2EW3A 4D8KA 3RBBB 2C0TA 2KEAA 3KFVA 3NMZC 2L0AA 1PNJA 2DL7A 3EHRA 4KRTA 4Z88A 1QWFA 1M8MA 3JV3A 2PTKA 1GFCA 2BZXA 2KYMA 4J9FA 3NGPA 2VVKA 1GCQC 2A08A 3EG3A 2RQRA 2LQNA 1AOJA 4FSSA 4LUDA 1ARKA 3M0UA 1BB9A 1UUEA 3R6NA 2JS0A 2JM8A 2LMJA 2HCKA 3UATA 3QWYA 2L3PA 4WCIA 4JPBW 3SEMA 1U06A 2SRCA 3UF4A 3NPFA 3ZL7C 1KSWA 1ABQA 2F2VA 2EKHA 1H92A 3LH5A 2HSPA 1ZSGA 4RUGA 2YT6A 1ZUYA 2DL8A 2MOXA 2DBMA 4QT7A 4ORZA 2ABLA 3TSWA 2J06A 4Z89A 1X2KA 4Z8AA 2RN8A 1PHTA 1OOTA 2KT1A 1X27A 2PZ1A 2IIMA 1T0HA 2DE0X 4HCKA 2ESWA 2SEMA 3TVTA 1K1ZA 1WXBA 1AVZC 3PE0A 3I35A 2W10A 2O9SA 3C0CA 1E7OA 1UTIA 2DL3A 2YUQA 4X1VA 4LN2A 5IHKA 1CKBA 4EIKA 3REBB 1OPKA 2FPFA 1I1JA 1AWWA
chains in the Genus database with same CATH superfamily
2V8KA 1AHJB 2ENMA 3CCQA 2VGMA 1VQ8T 1B3QA 4JZ3A 1Q82C 2FPDA 1D1CA 1RAIB 1MMNA 5GAOr 2EQKA 1UGVA 3HL8A 2CZ1B 1GRIA 1MGQA 4L5GA 4Z02A 5LJ5h 1AWOA 4HCBA 3M59A 2HKQB 3CCJA 4PK4A 2DJZA 2LT4A 1JXOA 5CQXA 3CC7T 2AK5A 4A54A 3G6EQ 2ZPBB 5I22A 1VQOT 1GBRA 1K73R 4BI8B 4TVRA 1TXQA 2M0OA 1G2BA 3TCJA 2A0FB 2KK4A 4PJOE 3RR6A 1EFNA 2G6FX 2RHZA 2RQTA 2LTOA 1RL2A 1N8RU 1S1NA 1WI7A 2XICA 1VQLA 4J7FA 3C94A 1M1FA 5D6XA 3V7RA 3HRTA 2H3JA 1ZQ1A 3PFSA 1N5ZA 4HVUA 2O31A 1NJIR 1A0NB 3Q1JA 2RI3A 3GF5A 5CKBA 2NUTA 2JTEA 3OY9A 2JN0A 3OYKA 2PNIA 1UGRB 2COWA 2OTLT 1IXDA 1PD1A 2EBPA 2LQWA 1FWZA 3N5BB 5KYWB 2QQBA 3LH0A 4RG8A 3OYBA 5FWBA 1ZHIA 3EFRA 1YWPA 2F2XA 1UJ0A 4DBHA 2DYIA 4CC7A 1Y7XA 2A28A 1K73C 5DLOA 2DERA 1Y07A 4J8OA 2LCCA 4AFZC 3UPUA 3CQTA 1IB8A 4AMCA 1WHMA 1BI2A 3UDCA 3OSSC 5GANh 2HQHA 1PKTA 4C92A 5D6WA 4QKUA 4Q5WA 3A8HB 3GNGA 4BDYA 1ZUUA 2CT4A 2XI9A 3MO8A 4Y28E 4CI0C 4M7DE 1M4ZA 1WX6A 3PMIA 4F14A 5GAN2 1OEBA 3LX7A 3CC2Q 1IGQA 2LNHB 1NJIC 2E6ZA 2E4HA 5GAMh 5GAOm 2O4XA 2E3HA 2AKLA 2X9HA 3A8LB 2K9GA 2B8AA 4BD3A 2VKNA 2MF2A 4R56A 3JSCA 1W2BP 5I21A 3CD6T 3MHXA 3CCEA 3CC4A 5GAN4 5CIUA 3H0FA 4M7DF 4RCBA 1OX8A 1M1KU 4OMOA 1QVFP 1NLPC 2C0IA 7AT1B 1YJ9A 4OMMA 2NLUA 1QW1A 1LNXA 3L2WA 5LJ3f 2BKDN 1BIBA 3A1PA 1VQ7Q 1E6GA 4JRKA 1UDLA 1YHQQ 3NFCA 2OX7A 2AHJB 2P84A 4NS5A 1RAFB 3OA6A 2HBWA 1FMWA 3CCVT 3I9QA 1VQMA 2RK2A 1BCMA 4EMGA 1Y96B 1JBMA 3ZFJA 2ZPFB 1VIEA 3G4ST 2I2LA 3CCMA 1PC0A 1WHHA 3ER0A 2HL5C 3MEWA 3MP8A 1QLYA 3P8BB 2LDMA 5LJ5e 2EIFA 1VQNQ 4QQ6A 1YCYA 2JM9A 1ZBXA 4D8DA 2K2MA 2QEXT 3VUBA 3V7SA 3UA6A 1YIJA 1KHCA 1TUGB 2OJ2A 3JB9G 1T3SA 3DLMA 4IUTA 2JXBA 2EJ9A 1WQWA 1U1SA 5FROA 3RUXA 2RHXA 3LGLA 5CQYA 2Y90A 1OV3A 2E64A 1X69A 1BU1A 1G3TA 1VYUA 2M02A 3JCMd 5GAN7 3M0PA 2F2WA 3M9QA 2DVEA 5IXBA 4ZTFA 1ZLMA 1IREB 2PVDB 3LWHA 2VXEA 1MHNA 1NG2A 3LGFA 3L2QA 4ANJA 1M2OA 5GMKi 1JJ2P 2HEQA 3ULRB 1G3SA 3DB3A 4JJCA 5A2QE 1OU9A 4F7UE 4XTXA 4ATOA 5KYWA 3ME9A 2X3WD 1VQPA 2J6OA 3E1SA 2ED0A 4ZTJA 3BW1A 2FL7A 2O88A 4MMLA 2CZ7B 3VRYA 2LX9A 1X6BA 5FU7C 2EGAA 1KFZA 5KCOA 4EPCA 2EPDA 4D6WA 4GY5A 4JRQA 4PJOB 1OZ3A 4XTVA 3EGXB 1GCQA 1Y57A 1RAEB 2AZVA 4FW2A 2CSQA 3L2RA 4F7UF 2GFAA 2OTJT 5GAMe 1JEGA 3VV0A 1NPPA 3EG2A 4PKCC 2CS7A 1VQ7A 3CCST 5GJWB 3G71T 4F17A 4C5EA 1WHGA 2M0YA 4OB3B 4QVZA 4O5VA 1VQ9A 1WZOA 3M0QA 1RI0A 2DXCA 3JB9I 2MMPA 2NWMA 2V26A 4GBQA 2KMTA 2KNBB 5IH2A 1B7TA 2DK3A 2EYZA 1YWOA 2XG8D 2KXDA 2RB6A 1M1GA 4J9EA 2CZ0B 2D6FA 3L2UA 2KRMA 3O5ZA 2AIRB 2RHIA 3I5RA 4ZGJB 4J83A 4D8KA 2VXFA 3CBPA 3QDRB 4M7DB 3QDFA 3L1AA 3CMET 2RO0A 1M8MA 2CYZB 2DXTA 4LXCA 3FIFA 1XNIA 3ZBDA 4E7ZA 2DTIA 3SDZA 3NGPA 2VVKA 2QDYB 1IZ6A 1GCQC 1Y96A 2RQRA 2LQNA 5C0MA 4FSSA 3OYLA 1ARKA 1P92A 1UUEA 2CKKA 2MWOA 3R6NA 4AT1B 4DOWA 2K5LA 3GNFB 2JS0A 2HCKA 4XU2A 1HYOA 3PMTA 1BI1A 2ZPGB 3EGDB 1KSWA 1ABQA 1I8FA 2F2VA 2M16A 2DAQA 5HK3A 4OGCA 2YT6A 5FU6B 4PLIA 4F04B 5I2MA 1I4K1 2ZCFB 4M7AE 3OB9A 1X2KA 2CP2A 1X27A 1G8XA 2EYQA 4L59A 4HCKA 2HMAA 3BE3A 1YFNA 1YI2Q 3JCMQ 1TTHB 1R8OB 1K1ZA 1WXBA 1AT1B 2RJFA 3I35A 1YJWT 3HTRA 4HCZA 4J6YA 4OP0A 1VQ6T 3HP9A 5IHKA 1CKBA 2DTOA 3OYAA 3CCQQ 4PJOG 4C0ZA 2AT1B 3LW5E 5DLQE 2FVUA 4AFQC 1UB4A 2K79A 4CC2A 2LCLA 3PIOA 3OMCA 4PFOA 2O9VA 5KCHA 4IUUA 2LT1A 3REAB 4KGXB 1OQKA 2V8IA 2QG9B 2CP0A 2JJ9A 1I07A 1KD1R 2GTJA 1RAGB 4KUIA 4DBFA 4GLMA 4OB1B 2YWWA 1B34B 4MZTA 5CCAA 1NLOC 4IUQA 3OMGA 2YSQA 3SFMA 3VS4A 4MZMA 1NEBA 1QKXA 2YLCA 4FSXA 1W2BA 4GLKA 1V1CA 1WQ7A 2K6DA 2K3YA 2HL3A 2A36A 3X20B 4PL6A 1VQLQ 2QA4T 4MZPA 1Q7YR 3CC2T 3HFNA 1UJYA 1YNZA 4PJOA 2DL5A 1WJQA 1UHCA 3EGXA 1UECA 3H9NA 1TUDA 4DBRA 3QYHB 4JRIA 2LJ3A 8ATCB 3MEVA 3E9GA 1VQ4T 5GMKl 2EYXA 1QP2A 1ZBJA 4E7SA 4M7DG 4M75E 3SWNB 1KQSP 2XMFA 5GANg 3UA7A 3VS6A 2GGRA 1KD1C 1OZ2A 4F7UB 2P0PA 1VQ5T 2RQUA 1M3BA 4NOYA 1M5Q1 1NYGA 2OI3A 2QI2A 4AFSC 5D7UA 1K8AR 1XTDA 3E19A 1RAHB 2D0QB 3HRUA 4M78F 1BYMA 4X9CA 3QHSA 1UE9A 5IHIA 3S6WA 2KBTA 1YHQT 3RNJA 1Q7YC 4M78D 4M4ZA 4LNPA 1GL5A 4BUGA 4N0AC 3J81E 1TSFA 1ZA1B 2LNVA 5HK0A 3GIBA 3J80E 4M7DA 3VS1A 2C0OA 4R0KA 4DOVA 1K9AA 2CREA 2E5KA 2I0NA 2YUOA 2O2OA 3CC4Q 3CCEQ 2DA9A 1QVGP 4PJOC 3OS1A 1GFDA 4J9BA 2XDDA 4LE9A 1MUZA 3JB9J 1RUWA 5GAN6 1YJNA 1WFWA 1FYNA 2OAWA 1N8RR 1K8AC 1WLPB 2VYTA 3NHNA 5FRNA 1KQ2A 3A8GB 2K5FA 1TG0A 3EGDA 1Z9ZA 1S72T 4XAXB 4KBMB 2CDTA 1TS9A 2BUDA 5AYFA 3RKYA 1JJ2A 1WHJA 2QYZA 2LC4A 1RI9A 1D09B 2E5QA 3CBMA 3I55Q 1VQMQ 4RTZA 1LVKA 2X35A 2VC8A 3CXCP 5IT9E 3CCMQ 4QW2A 2MCNA 3M4GA 2MI6A 2VUBA 4XU1A 2DLPA 3JCMV 1Z9QA 2EQMA 2ZPIB 3VS5A 5KYXB 4J9IA 4C92G 1YITQ 3M53A 3O8VA 4E7JA 1O9SA 1KG1A 4MMKA 2JMCA 1AWJA 3A8MB 3OYYA 1KIKA 3OS5A 1N8RC 3L2ZA 4M7DC 5EG2A 2HD0A 2KAFA 1K0XA 5LJ5f 4OMQA 1UGPB 4PJJA 1YIJQ 1TU0B 4RTTA 4Y91A 1K9MU 1R0BG 2QAZA 4LDVA 1D1BA 1QCOA 5D6YA 3CCRA 2X4XA 3LWIA 2L3SA 2RMOA 4C8QC 3FJPA 2RPNA 3U23A 3JCMh 5KH6A 2KSSA 3NTHA 3E9FA 1ZA2B 4M77D 4M7AB 1B34A 5EC7A 5AT1B 2L3QA 1CSKA 1J3TA 1M90U 4JUVA 4AG1C 4FYXB 2FO0A 3KUFA 3MPUB 4ZN3A 2KI7A 1M1KR 1UG1A 1UGQB 4HT8A 2AZSA 3I5SA 1HK9A 5FU6C 1JB0E 1N6AA 3E2UA 1HJDA 3C12A 3QJYA 1NYFA 4FIBA 4QVCA 4QQDA 4LDWA 1H3ZA 1FX7A 2EQUA 3CCUA 2FG0A 3SWNA 1T3LA 1VQPQ 1W2BS 2YUNA 3QYGB 1QQJA 1WXUA 1PCXA 4LDYA 2YHTA 3PVLA 1Q81U 4F7UA 1PSFA 2Y4YA 3H0IA 5GANf 4J9DA 1QVFS 2ROLA 2DJQA 2LP5A 2K7AA 2QGGA 4CC4B 2DTHA 1VYTA 1W70A 1M1KC 3V7CA 3FLGA 3BDLA 4XTYA 3WVDB 2FHDA 3QO3A 4EDUA 2MPXC 1PM3A 3OYEA 4O6JA 1I0CA 2EYWA 1AEYA 1M3AA 3M0SA 1LPLA 5GAMf 3M57A 3FDRA 5GMKj 2J7IA 2DVJA 3M55A 4XTZA 3KXTA 4JS5A 4A63B 1TWBA 1G3YA 1VQ9Q 3M0TA 3OQ5A 3SB2A 4LUEA 2LQKA 3V8LA 3I55A 4C92C 3RMQA 4M75B 1VQKA 5CKDA 5IXFA 2EJFA 2K3XA 3URGA 2F5KA 1D3BB 4HT9A 3WVEB 1H8KA 3JB9H 4C8QD 2A3LA 4BY6B 1YITA 4A4FA 5LJ3j 3JCMW 4ZGDB 1KJWA 3OYIA 3RESA 1MV3A 2X3XD 4JLIA 5GAMj 2B86A 1M8VA 4HA8A 4E7LA 2LJ1A 2P4TA 2KE9A 1G3WA 3RBBB 2F1LA 4PNOA 3QIIA 3CMAA 3NMZC 2DL7A 3EHRA 2DEQA 2IVWA 4M7AG 2PTKA 3CCQT 4PLLA 1VQ6A 2X4WA 4J9FA 1IHWA 1VQ8Q 3EG3A 3HFOA 1Q86U 3KBGA 3G7ZA 1AOJA 1BI0A 3QG1A 4BI4A 3OYHA 5KYXA 5DM7R 2KY9A 2IPOB 1QP3A 1OX9A 3CCJT 2JUFA 4FYYB 2L8DA 1JJ2S 1F1BB 4EMKB 2SRCA 3NPFA 2DXUA 1NBEB 1PD0A 3ZL7C 3TU4K 3LH5A 1MNDA 2PUKB 2PUOB 2PQWA 3HRSA 2MOXA 3GPLA 2ZGWA 2J06A 4FT2A 1KQSA 4FT4A 3DLLA 5GANe 1VQLT 2FZKB 2ATCB 4M7AA 3OBYA 2V8JA 2ESWA 2QQ9A 1VIFA 2F69A 5CVIA 3C0CA 4MDXA 1E7OA 2DL3A 4BE0A 5LJ3d 2K5IA 4OGEA 2XDPA 5GAOp 1PSEA 4EIKA 3CCLT 4FCYA 1WHKA 1IHVA 1I1JA 2FPFA 3JCMJ 1AWWA 5GAMd 1QVPA 1FMKA 1PWTA 2E3IA 3OW2P 2FRWA 3L42A 1Q95G 2DF6A 3TEEA 4C0DB 2WACA 2YUPA 2ZZDA 4K11A 1OPLA 2FB7A 4M75G 1E6HA 2KROA 3OYCA 3OS2A 2XD0A 2LZ6B 1WPYA 1PKSA 4J9HA 1KC8U 3QZ9B 2BZ8A 2HDAA 2DPPB 3HKSA 4RKUE 3VS7A 2JS2A 1XQHA 2YRDA 4DEXA 2EVRA 3I56A 1GBQA 4RTYA 2DETA 3VJPA 1U1TA 3CCET 3TSZA 4M7AC 3OYDA 2K4YA 1M27C 1QMCA 2BTTA 2VB6A 5L8RE 2L2PA 4F16A 1YJ9T 4M75A 3QJ6A 3VS2A 2RQVA 2CGHA 2EGCA 4Y92A 2HAXA 1D3BA 2KGTA 1MMGA 3CXCA 2R5MA 3M5AA 1VQ8A 2JTFA 5DY9A 4KGZB 2HQEA 3ASKA 4AFUC 1OI1A 1UHFA 2FEIA 3OYMA 4B9XA 1HD3A 1RADB 1SKUB 1X75C 3SD4A 3G6ET 1VQMT 2BIVA 5A0LA 3CC7A 4OMFB 1VQOA 2DL4A 4BACA 5IHNA 2JMAA 1X2QA 2RF0A 1X6GA 3G4SQ 3RKXA 3X25B 4DQ2A 2GQIA 4OMPA 4FM4B 1H641 5I2SA 5KE2A 2E10A 5CKEA 4DEYA 2DMOA 2K3BA 5GAOl 1YJNQ 3VYHB 3RKWA 3FRNA 2VWFA 1TUCA 3PNWC 1YIJT 3EH1A 4IUPA 1JRIA 2DRMA 3OS0A 2C06A 3X24B 1K76A 2OTLA 3OYNA 1C1AA 1VYVA 3QKJA 4EMKA 3JB9F 1U3OA 2DIQA 2RK1A 3QWXX 4M75C 1AZEA 2NUPB 4UC4A 1WA7A 1PRMC 1AWXA 4LD9K 4C5IA 2DYBA 2YRVA 3JB9D 2H3EB 4JZ4A 4X9DA 3UWNA 2D8HA 4P5NA 2KDSA 1AD5A 4X34A 2QASA 1GXIE 3META 3MP1A 4L6V5 1BCOA 2KYBA 5IN1A 1PG5B 3GBQA 1K4US 2GBQA 1IGUA 1XOVA 2JTMA 3JCMg 1CKAA 5CR2A 3EHQA 1QVFA 3A8OB 1EZZB 2RI2A 5LL6S 3VU3C 3MP6A 4J9CA 1VQPT 2EQIA 3QPHA 2DX1A 4M78E 2GFUA 2WSCE 5GAN3 3CCRQ 5J39A 1KQSS 2FRYA 1BIAA 3CPFA 1LJOA 3CPWP 2YDLA 3FEOA 3CD6A 2E12A 3M54A 3EFOB 3H8ZA 4JJNK 3PTAA 3JCMc 3F70A 3VUZA 3A98A 2KR3A 3VYGA 1FXXA 1YBYA 4KGVB 2NUZA 2RJDA 2E6NA 1C6VX 3JCMb 4EMKC 2BE9B 2OAUA 2OTJQ 1VQ7T 1DJ7B 1IO6A 3BFMA 1Y71A 2JT4A 3BY7A 3T9NA 1EX4A 3CCSQ 4E6RA 1UEBA 5I11A 3G71Q 1BKBA 5LJ3g 3NTIA 2CSIA 3THKA 4ESRA 4KH0B 1QKWA 3CCUQ 4IIOA 2XU8A 1NE8A 2FZGB 2HSEB 3CCVA 4N4GA 1OULA 5GAN8 3EAEA 4C0GA 3A5ZB 2MWPA 2P4RA 3G4SA 2KRSA 1QVGS 1WYXA 4HVVA 2DFUA 2PU9B 2X51A 8AT1B 2X4YA 1VQNT 5CK9A 5HY6A 2QGFB 1X43A 1B07A 1U8RA 2DM1A 2DILA 2CZ6B 1Y0MA 1OU8A 2ECZA 3OYGA 5FWCA 3GP8A 2QEXA 2EJGA 1V76A 5C6SA 4XU3A 4JRPA 5GAOn 3L2VA 2FYKA 2G3RA 2JVVA 2KT8A 3CMEQ 1K9MR 5J26A 2RJEA 4E7HA 1Q82U 1K0SA 3SHWA 1M3CA 4J5YA 2DNUA 2MIOA 4PJNA 3RMSA 2L89A 2D8JA 3M56A 1RACB 1SEMA 3CXCS 5FU7B 1VQKQ 3WXMB 1ABOA 2QQRA 1WGSA 4M77E 4E47A 1M90R 2CH4A 3PT9A 4N4HA 2QK0A 2LJ0A 2VGNA 1JQQA 1SF9A 2DBKA 3M58A 2FPEA 4PFPA 5KYUB 3P8HA 4IKFA 1QCNA 4HVWA 1G83A 2M1HA 2ZPEB 3FC3A 1O75A 5HKCA 1YCSB 2EAYA 5KYYB 1IRXA 3G1JA 4M77F 4II1A 2NUPA 2R5AA 1K9MC 2JNGA 3CMAQ 2LX7A 4A4GA 2C0TA 1MMAA 5CO7A 3OW2A 1YJWQ 4YTLA 4E7KA 1VQ6Q 4F7UG 2RHUA 3KFVA 2L0AA 1BI3A 1W4SA 2PVOB 4KRTA 5IAYA 1Q81R 1QWFA 3CEYA 4RMOA 2JOYA 1GFCA 2DZCA 2BZXA 2KYMA 4PJOF 1M90C 3CCLA 2XDBA 2K57A 2HBPA 2OTJA 2HNIA 5GMKh 5LJ5j 1K73U 1ACMB 1BB9A 4PJOD 4BI3A 2ZAEA 3QUIA 2JM8A 2QQSA 3CCSA 3GOXA 3G71A 2L3PA 3LYIA 4WCIA 4JPBW 3SEMA 1U06A 3UF4A 2XHCA 4ELZC 2E41A 3VKIA 2DXBA 1H92A 3JCMf 2HSPA 2QTXA 1ZSZB 3HHTB 2X4JA 1ZUYA 3LLRA 2DL8A 3EFOA 4C5GA 2EWNA 1EIFA 4QT7A 4ORZA 5LJ3h 3TSWA 1NJIU 5KE3A 2M9UA 1PHTA 2JZ2A 1OOTA 2PZ1A 2QA4Q 2IIMA 5CKFA 4IUVA 2CP7A 4N4IA 2DE0X 1Q81C 2SEMA 1FMVA 1I81A 4C8QE 1X01A 1XJWB 3TVTA 2P0KA 2XIDA 2O9SA 1VQ4Q 2DKGA 3V8JA 4LN2A 5CKHA 3H6ZA 1RAAB 4A4EA 3CMEA 2LRQA 3S3OA 3FJ5A 1LOJA 2CT3A 4HXJA 1BBZA 4M7DD 2RM4A 1VQ5Q 4M78B 2P0QA 4CC3A 4C8QF 2GQVA 3DB4A 3QXEB 4VUBA 2ROTA 3OYFA 4MDWA 1ZX6A 4OB0B 5GANj 3P8DA 3JCMX 2NYSA 5ECAA 3EGUA 1Q86R 2LCSA 3S3MA 2MK5A 1MNEA 3MCAB 4FL6A 4LD6A 1QWEA 3G6EA 5LJ5d 3I56Q 3SWNC 3X28B 2DD4A 3EG9B 2CUBA 2RH2A 4AG2C 3EH2A 4WF2A 2YXYA 1YI2T 5GMKm 4R55A 1UFFA 5A0GA 2PVGB 1YJNT 2QQAA 2M51A 3HPWA 1SHGA 5J3BA 1YJWA 3MEUA 5GJVB 1OYXA 5KYNA 2V1QA 3HSBA 3JRZA 4OMLA 1R77A 1R0CB 2DO3A 5L23A 1AZGB 1I5LA 1S72Q 1WXTA 1JU5C 1Q86C 1SSFA 2RJCA 1VOMA 5KYUA 3JCMP 4C92E 2CH4W 2J6KA 2KRNA 2D1XA 1JO8A 1RABB 3AHUA 2EKOA 3JCMe 5M9OA 1NM7A 4KULA 3CC7Q 3MJXA 2EQJA 1VQOQ 3INZA 5KYYA 1W1FA 4XTWA 4JDSA 2L3RA 2KXCA 3CPWA 4RTUA 1N9RA 1WHLA 5GANd 4JJBA 4C92F 2QA4A 5GMKe 1WJSA 4RTWA 3CC2A 2EYYA 1KC8R 3NTKA 4C92D 4M77B 4ZNXA 1M2VB 2J05A 4NL3A 3CCRT 4OF1A 1SSHA 1VQ4A 2CP3A 2COYA 2GCXA 3H41A 3TREA 2OTLQ 1HXDA 1VUBA 4ME7A 4J6XA 2Z0WA 1BK2A 1T0JA 1NEGA 2KVQG 3OW2S 5LJ3e 4BB7A 4PFZA 4EMHA 3M4YA 3QZ5B 2RHYA 4ZGEB 4M78G 1ZSZA 1VQ5A 3VRZA 4DBQA 2GF7A 1WJRA 5HCKA 4XU0A 2RNAA 2LVMA 4KT0E 3EG1A 1LCKA 4RTXA 2D9TA 1KHIA 2BZYA 1QVGA 3VS3A 1YHQA 2DIGA 4A4KA 2GNCA 4A53A 4PJLA 5GAOq 1JXMA 4JJDA 3CCUT 4OB2B 1KC8C 3C95A 4BDZA 3EFSA 2LQ8A 1KQ1A 3PIPA 4XQ3A 2CUDA 2GTOA 2MAMA 3GLXA 1RLPC 3RIRA 1HSQA 3CC4T 3IQLA 1N9SA 4B9WA 2WSEE 1W6XA 3CD6Q 2EFIA 1YN8A 2L5QA 3H0HA 4QQGA 4M78A 1VQNA 1ZUKA 4E2FB 2Y4XA 4NL2A 4CRIA 2DZ9A 3PVQA 2D0NA 4IURA 1S72A 1GCPA 2J6FA 4FYWB 4IIMA 3C4SA 2E1HA 2JW4A 4C8QB 1ZSZC 1TOVA 3I55T 3EG0A 3EG9A 2F5TX 1VQKT 3V8KA 3CCVQ 2A7YA 4RG2A 3CCMT 2QTVA 2QDLA 3JAME 4J9GA 2CP6A 3J7AF 2QXFA 1YITT 2DD5A 1U5SA 2HZYA 4LDUA 5FW9A 1VA7A 2ED1A 4XK8E 1PRLC 1SRLA 3PGGA 2A37A 1M30A 4XTUA 2AKKA 1NZ9A 2RQWA 4M77G 3M0RA 2XK0A 2BE7D 2QEXQ 2IG0A 4OVAA 1SRMA 1D1AA 3X26B 1NPRA 2WSFE 1D0XA 3VS0A 3CBOA 1MV0B 3CMAT 4ELYC 2VASA 4M78C 5LJ5g 2V1RA 2K2VA 4JS4A 2H8HA 4C0FA 1SHFA 1UGSB 4M7AF 2FZCB 1WDXA 1M9SA 1X6OA 2XKOC 1WIEA 4BY6C 3RDVA 4FYVB 2NUTB 4M7AD 4B6MA 1V29B 5CAIA 3CCJQ 1TH7A 4KUDK 4PJMA 2EGEA 4N0AA 4M77A 2E65A 3FB9A 3OYJA 1M2VA 1H3HA 3QSUA 1QCFA 4RTVA 4OMNA 4KH1B 5FRMA 2VV5A 3CPWS 1YP5A 4C92B 2W0ZA 4J6WA 3AT1B 1SPKA 3RERA 1G5VA 4FU6A 5A0DA 1RLQC 2DRKA 4BE1A 1D0ZA 2RD1A 2EW3A 4E7IA 4V2SA 1WNLA 4A4HA 2KEAA 2HKNA 1PNJA 2O4XB 4Z88A 3JV3A 3CCLQ 9ATCB 1KD1U 2YLBA 3UT1A 3MKDA 2A08A 1D0YA 1MMDA 1I5OB 2COZA 4FW1A 4LUDA 3M0UA 4C8QG 2YRCA 2RI5A 1VQ9T 2LMJA 5GAN5 3S3NA 3BDUA 3UATA 3QWYA 2HQXA 3R6OA 4WTOB 1KK7A 4QVDA 1Q82R 3OBWA 1C0MA 5GAMg 1Q7YU 2MYSA 2EKHA 2RA2A 4M75F 6AT1B 3ZEHA 1ZSGA 4RUGA 4C5HA 4LDXA 4ZN1A 2DBMA 3QBYA 4M77C 4M75D 2KQWA 4Z89A 2ABLA 4J7IA 3I56T 4Z8AA 2RN8A 4HKEA 2KT1A 4RCCA 1T0HA 2CP5A 5FLXE 3D7SB 2R57A 1SG5A 2DEUA 2E70A 3DKMA 4BE2A 4HCCA 3OSVA 1N27A 3MEAA 1AVZC 3PE0A 2W10A 1YI2A 1UTIA 4C8QA 2YUQA 4X1VA 2ZPHB 4C0DC 2R58A 4DA4A 1K8AU 3REBB 2O01E 1OPKA 4JLGA 3TQ7P 1YJ9Q
chains in the Genus database with same CATH topology
4AFQC 2K79A 2ENMA 4CC2A 1B3QA 3FJ5A 4JZ3A 2CT3A 2FPDA 4HXJA 1BBZA 2O9VA 1FMKA 1UGVA 1PWTA 3REAB 4CC3A 2FRWA 1GRIA 2ROTA 1AWOA 1ZX6A 2DF6A 2YUPA 1I07A 4K11A 1OPLA 2GTJA 1E6HA 2KROA 4GLMA 5ECAA 3EGUA 1JXOA 1NLOC 2LCSA 2AK5A 2LZ6B 2YSQA 3VS4A 5I22A 1GBRA 1NEBA 1PKSA 1QKXA 4J9HA 2BZ8A 2HDAA 1V1CA 1G2BA 1QWEA 2K6DA 3VS7A 2JS2A 2A36A 1EFNA 2G6FX 4DEXA 2EVRA 2RQTA 2CUBA 1UJYA 1YNZA 1S1NA 1WI7A 4AG2C 2DL5A 1GBQA 1UHCA 4RTYA 1UECA 1TUDA 3TSZA 1UFFA 2LJ3A 2EYXA 1N5ZA 4HVUA 2M51A 2O31A 1A0NB 1M27C 1SHGA 1ZBJA 2JTEA 2XMFA 3UA7A 2BTTA 2PNIA 5GJVB 2L2PA 4F16A 2EBPA 2LQWA 2V1QA 4OMLA 3VS2A 2RQVA 2GGRA 3VS6A 5FWBA 2EGCA 4Y92A 5L23A 2KGTA 1AZGB 1YWPA 2RQUA 1WXTA 2F2XA 1JU5C 1UJ0A 1M3BA 1NYGA 2OI3A 4CC7A 4AFSC 2A28A 4AFZC 2CH4W 2J6KA 2KRNA 2D1XA 3CQTA 4AFUC 1JO8A 1UE9A 1PKTA 1UHFA 2FEIA 1NM7A 5IHIA 2KBTA 3RNJA 1HD3A 4M4ZA 4LNPA 1GL5A 1W1FA 1ZUUA 2CT4A 2KXCA 1WX6A 2DL4A 4F14A 5IHNA 2JMAA 1X2QA 4RTUA 1OEBA 2RF0A 1X6GA 3VS1A 2C0OA 2GQIA 2LNHB 4R0KA 4OMPA 4JJBA 1K9AA 2CREA 2E5KA 2I0NA 2YUOA 2AKLA 4RTWA 2O2OA 2EYYA 2K9GA 2DA9A 4DEYA 2DMOA 2VKNA 2K3BA 4ZNXA 1GFDA 4J9BA 2J05A 2VWFA 1TUCA 4LE9A 1MUZA 1SSHA 1RUWA 2DRMA 1WFWA 3H0FA 1FYNA 3H41A 2OAWA 1BK2A 1WLPB 1T0JA 4OMOA 3NHNA 1NLPC 2C0IA 1K76A 1NEGA 4OMMA 1VYVA 1TG0A 1Z9ZA 1U3OA 2CDTA 3QWXX 1AZEA 1WA7A 1PRMC 3VRZA 1AWXA 2DYBA 4JZ4A 5HCKA 1E6GA 2D8HA 1AD5A 2RNAA 1UDLA 3EG1A 1RI9A 1LCKA 4RTXA 4RTZA 2BZYA 3VS3A 2GNCA 1JXMA 2HBWA 2KYBA 3I9QA 4JJDA 2MCNA 2DLPA 3GBQA 1K4US 1Z9QA 3VS5A 2GBQA 1XOVA 4J9IA 1CKAA 3EHQA 2JMCA 1AWJA 2CUDA 1QLYA 2GTOA 1KIKA 1RLPC 1HSQA 4J9CA 3IQLA 2EQIA 1W6XA 1K0XA 2DX1A 1YN8A 4OMQA 2FRYA 3H0HA 4RTTA 2JM9A 2YDLA 4D8DA 2K2MA 1ZUKA 2L3SA 3UA6A 2RMOA 2RPNA 3U23A 2OJ2A 1T3SA 3A98A 2KR3A 2JXBA 5EC7A 2NUZA 3PVQA 2D0NA 2L3QA 1CSKA 1J3TA 4AG1C 1GCPA 1OV3A 2J6FA 4IIMA 1X69A 2FO0A 1BU1A 1VYUA 1IO6A 1UG1A 2JT4A 2JW4A 2AZSA 3M0PA 3I5SA 4E6RA 5I11A 2F2WA 3EG0A 5IXBA 1ZLMA 2CSIA 3THKA 4ESRA 1HJDA 1QKWA 1NG2A 4IIOA 2QDLA 4J9GA 1NYFA 1U5SA 2FG0A 2HEQA 3ULRB 2P4RA 5FW9A 2KRSA 1T3LA 1WYXA 1VA7A 4JJCA 2ED1A 4HVVA 1PRLC 1SRLA 2YUNA 2A37A 1M30A 1WXUA 2AKKA 2X3WD 2J6OA 2RQWA 3PVLA 2ED0A 3M0RA 2O88A 1X43A 1B07A 3H0IA 4J9DA 2DM1A 1SRMA 3VRYA 2ROLA 2DILA 2DJQA 1Y0MA 2LP5A 2ECZA 2K7AA 3VS0A 1X6BA 5FWCA 1MV0B 4CC4B 2EGAA 1VYTA 1KFZA 1W70A 2EPDA 2V1RA 2H8HA 2KT8A 1GCQA 1Y57A 2AZVA 1I0CA 2CSQA 1SHFA 1K0SA 3SHWA 2EYWA 1M3CA 1AEYA 2DNUA 1WDXA 2MIOA 1JEGA 1M3AA 3M0SA 1WIEA 3EG2A 2J7IA 2D8JA 2DVJA 1SEMA 4A63B 5GJWB 4F17A 3M0TA 4LUEA 2M0YA 1ABOA 2CH4A 5IXFA 2EGEA 2LJ0A 1JQQA 3M0QA 1H8KA 2DBKA 2FPEA 1H3HA 2NWMA 1QCFA 4GBQA 4HVWA 4RTVA 1G83A 2KNBB 4OMNA 5IH2A 2EYZA 1YWOA 1YP5A 1KJWA 2W0ZA 2KXDA 1MV3A 1YCSB 1SPKA 4J9EA 2X3XD 2B86A 2KRMA 3O5ZA 1RLQC 2DRKA 2LX7A 2LJ1A 3I5RA 2KE9A 2EW3A 4D8KA 3RBBB 2C0TA 2KEAA 3KFVA 3NMZC 2L0AA 1PNJA 2DL7A 3EHRA 4KRTA 4Z88A 1QWFA 1M8MA 3JV3A 2PTKA 1GFCA 2BZXA 2KYMA 4J9FA 3NGPA 2VVKA 1GCQC 2A08A 3EG3A 2RQRA 2LQNA 1AOJA 4FSSA 4LUDA 1ARKA 3M0UA 1BB9A 1UUEA 3R6NA 2JS0A 2JM8A 2LMJA 2HCKA 3UATA 3QWYA 2L3PA 4WCIA 4JPBW 3SEMA 1U06A 2SRCA 3UF4A 3NPFA 3ZL7C 1KSWA 1ABQA 2F2VA 2EKHA 1H92A 3LH5A 2HSPA 1ZSGA 4RUGA 2YT6A 1ZUYA 2DL8A 2MOXA 2DBMA 4QT7A 4ORZA 2ABLA 3TSWA 2J06A 4Z89A 1X2KA 4Z8AA 2RN8A 1PHTA 1OOTA 2KT1A 1X27A 2PZ1A 2IIMA 1T0HA 2DE0X 4HCKA 2ESWA 2SEMA 3TVTA 1K1ZA 1WXBA 1AVZC 3PE0A 3I35A 2W10A 2O9SA 3C0CA 1E7OA 1UTIA 2DL3A 2YUQA 4X1VA 4LN2A 5IHKA 1CKBA 4EIKA 3REBB 1OPKA 2FPFA 1I1JA 1AWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AFQ C;  2K79 A;  2ENM A;  4CC2 A;  1B3Q A;  3FJ5 A;  4JZ3 A;  2CT3 A;  2FPD A;  4HXJ A;  1BBZ A;  2O9V A;  1FMK A;  1UGV A;  1PWT A;  3REA B;  4CC3 A;  2FRW A;  1GRI A;  2ROT A;  1AWO A;  1ZX6 A;  2DF6 A;  2YUP A;  1I07 A;  4K11 A;  1OPL A;  2GTJ A;  1E6H A;  2KRO A;  4GLM A;  5ECA A;  3EGU A;  1JXO A;  1NLO C;  2LCS A;  2AK5 A;  2LZ6 B;  2YSQ A;  3VS4 A;  5I22 A;  1GBR A;  1NEB A;  1PKS A;  1QKX A;  4J9H A;  2BZ8 A;  2HDA A;  1V1C A;  1G2B A;  1QWE A;  2K6D A;  3VS7 A;  2JS2 A;  2A36 A;  1EFN A;  2G6F X;  4DEX A;  2EVR A;  2RQT A;  2CUB A;  1UJY A;  1YNZ A;  1S1N A;  1WI7 A;  4AG2 C;  2DL5 A;  1GBQ A;  1UHC A;  4RTY A;  1UEC A;  1TUD A;  3TSZ A;  1UFF A;  2LJ3 A;  2EYX A;  1N5Z A;  4HVU A;  2M51 A;  2O31 A;  1A0N B;  1M27 C;  1SHG A;  1ZBJ A;  2JTE A;  2XMF A;  3UA7 A;  2BTT A;  2PNI A;  5GJV B;  2L2P A;  4F16 A;  2EBP A;  2LQW A;  2V1Q A;  4OML A;  3VS2 A;  2RQV A;  2GGR A;  3VS6 A;  5FWB A;  2EGC A;  4Y92 A;  5L23 A;  2KGT A;  1AZG B;  1YWP A;  2RQU A;  1WXT A;  2F2X A;  1JU5 C;  1UJ0 A;  1M3B A;  1NYG A;  2OI3 A;  4CC7 A;  4AFS C;  2A28 A;  4AFZ C;  2CH4 W;  2J6K A;  2KRN A;  2D1X A;  3CQT A;  4AFU C;  1JO8 A;  1UE9 A;  1PKT A;  1UHF A;  2FEI A;  1NM7 A;  5IHI A;  2KBT A;  3RNJ A;  1HD3 A;  4M4Z A;  4LNP A;  1GL5 A;  1W1F A;  1ZUU A;  2CT4 A;  2KXC A;  1WX6 A;  2DL4 A;  4F14 A;  5IHN A;  2JMA A;  1X2Q A;  4RTU A;  1OEB A;  2RF0 A;  1X6G A;  3VS1 A;  2C0O A;  2GQI A;  2LNH B;  4R0K A;  4OMP A;  4JJB A;  1K9A A;  2CRE A;  2E5K A;  2I0N A;  2YUO A;  2AKL A;  4RTW A;  2O2O A;  2EYY A;  2K9G A;  2DA9 A;  4DEY A;  2DMO A;  2VKN A;  2K3B A;  4ZNX A;  1GFD A;  4J9B A;  2J05 A;  2VWF A;  1TUC A;  4LE9 A;  1MUZ A;  1SSH A;  1RUW A;  2DRM A;  1WFW A;  3H0F A;  1FYN A;  3H41 A;  2OAW A;  1BK2 A;  1WLP B;  1T0J A;  4OMO A;  3NHN A;  1NLP C;  2C0I A;  1K76 A;  1NEG A;  4OMM A;  1VYV A;  1TG0 A;  1Z9Z A;  1U3O A;  2CDT A;  3QWX X;  1AZE A;  1WA7 A;  1PRM C;  3VRZ A;  1AWX A;  2DYB A;  4JZ4 A;  5HCK A;  1E6G A;  2D8H A;  1AD5 A;  2RNA A;  1UDL A;  3EG1 A;  1RI9 A;  1LCK A;  4RTX A;  4RTZ A;  2BZY A;  3VS3 A;  2GNC A;  1JXM A;  2HBW A;  2KYB A;  3I9Q A;  4JJD A;  2MCN A;  2DLP A;  3GBQ A;  1K4U S;  1Z9Q A;  3VS5 A;  2GBQ A;  1XOV A;  4J9I A;  1CKA A;  3EHQ A;  2JMC A;  1AWJ A;  2CUD A;  1QLY A;  2GTO A;  1KIK A;  1RLP C;  1HSQ A;  4J9C A;  3IQL A;  2EQI A;  1W6X A;  1K0X A;  2DX1 A;  1YN8 A;  4OMQ A;  2FRY A;  3H0H A;  4RTT A;  2JM9 A;  2YDL A;  4D8D A;  2K2M A;  1ZUK A;  2L3S A;  3UA6 A;  2RMO A;  2RPN A;  3U23 A;  2OJ2 A;  1T3S A;  3A98 A;  2KR3 A;  2JXB A;  5EC7 A;  2NUZ A;  3PVQ A;  2D0N A;  2L3Q A;  1CSK A;  1J3T A;  4AG1 C;  1GCP A;  1OV3 A;  2J6F A;  4IIM A;  1X69 A;  2FO0 A;  1BU1 A;  1VYU A;  1IO6 A;  1UG1 A;  2JT4 A;  2JW4 A;  2AZS A;  3M0P A;  3I5S A;  4E6R A;  5I11 A;  2F2W A;  3EG0 A;  5IXB A;  1ZLM A;  2CSI A;  3THK A;  4ESR A;  1HJD A;  1QKW A;  1NG2 A;  4IIO A;  2QDL A;  4J9G A;  1NYF A;  1U5S A;  2FG0 A;  2HEQ A;  3ULR B;  2P4R A;  5FW9 A;  2KRS A;  1T3L A;  1WYX A;  1VA7 A;  4JJC A;  2ED1 A;  4HVV A;  1PRL C;  1SRL A;  2YUN A;  2A37 A;  1M30 A;  1WXU A;  2AKK A;  2X3W D;  2J6O A;  2RQW A;  3PVL A;  2ED0 A;  3M0R A;  2O88 A;  1X43 A;  1B07 A;  3H0I A;  4J9D A;  2DM1 A;  1SRM A;  3VRY A;  2ROL A;  2DIL A;  2DJQ A;  1Y0M A;  2LP5 A;  2ECZ A;  2K7A A;  3VS0 A;  1X6B A;  5FWC A;  1MV0 B;  4CC4 B;  2EGA A;  1VYT A;  1KFZ A;  1W70 A;  2EPD A;  2V1R A;  2H8H A;  2KT8 A;  1GCQ A;  1Y57 A;  2AZV A;  1I0C A;  2CSQ A;  1SHF A;  1K0S A;  3SHW A;  2EYW A;  1M3C A;  1AEY A;  2DNU A;  1WDX A;  2MIO A;  1JEG A;  1M3A A;  3M0S A;  1WIE A;  3EG2 A;  2J7I A;  2D8J A;  2DVJ A;  1SEM A;  4A63 B;  5GJW B;  4F17 A;  3M0T A;  4LUE A;  2M0Y A;  1ABO A;  2CH4 A;  5IXF A;  2EGE A;  2LJ0 A;  1JQQ A;  3M0Q A;  1H8K A;  2DBK A;  2FPE A;  1H3H A;  2NWM A;  1QCF A;  4GBQ A;  4HVW A;  4RTV A;  1G83 A;  2KNB B;  4OMN A;  5IH2 A;  2EYZ A;  1YWO A;  1YP5 A;  1KJW A;  2W0Z A;  2KXD A;  1MV3 A;  1YCS B;  1SPK A;  4J9E A;  2X3X D;  2B86 A;  2KRM A;  3O5Z A;  1RLQ C;  2DRK A;  2LX7 A;  2LJ1 A;  3I5R A;  2KE9 A;  2EW3 A;  4D8K A;  3RBB B;  2C0T A;  2KEA A;  3KFV A;  3NMZ C;  2L0A A;  1PNJ A;  2DL7 A;  3EHR A;  4KRT A;  4Z88 A;  1QWF A;  1M8M A;  3JV3 A;  2PTK A;  1GFC A;  2BZX A;  2KYM A;  4J9F A;  3NGP A;  2VVK A;  1GCQ C;  2A08 A;  3EG3 A;  2RQR A;  2LQN A;  1AOJ A;  4FSS A;  4LUD A;  1ARK A;  3M0U A;  1BB9 A;  1UUE A;  3R6N A;  2JS0 A;  2JM8 A;  2LMJ A;  2HCK A;  3UAT A;  3QWY A;  2L3P A;  4WCI A;  4JPB W;  3SEM A;  1U06 A;  2SRC A;  3UF4 A;  3NPF A;  3ZL7 C;  1KSW A;  1ABQ A;  2F2V A;  2EKH A;  1H92 A;  3LH5 A;  2HSP A;  1ZSG A;  4RUG A;  2YT6 A;  1ZUY A;  2DL8 A;  2MOX A;  2DBM A;  4QT7 A;  4ORZ A;  2ABL A;  3TSW A;  2J06 A;  4Z89 A;  1X2K A;  4Z8A A;  2RN8 A;  1PHT A;  1OOT A;  2KT1 A;  1X27 A;  2PZ1 A;  2IIM A;  1T0H A;  2DE0 X;  4HCK A;  2ESW A;  2SEM A;  3TVT A;  1K1Z A;  1WXB A;  1AVZ C;  3PE0 A;  3I35 A;  2W10 A;  2O9S A;  3C0C A;  1E7O A;  1UTI A;  2DL3 A;  2YUQ A;  4X1V A;  4LN2 A;  5IHK A;  1CKB A;  4EIK A;  3REB B;  1OPK A;  2FPF A;  1I1J A;  1AWW A; 
#chains in the Genus database with same CATH topology
 2V8K A;  1AHJ B;  2ENM A;  3CCQ A;  2VGM A;  1VQ8 T;  1B3Q A;  4JZ3 A;  1Q82 C;  2FPD A;  1D1C A;  1RAI B;  1MMN A;  5GAO r;  2EQK A;  1UGV A;  3HL8 A;  2CZ1 B;  1GRI A;  1MGQ A;  4L5G A;  4Z02 A;  5LJ5 h;  1AWO A;  4HCB A;  3M59 A;  2HKQ B;  3CCJ A;  4PK4 A;  2DJZ A;  2LT4 A;  1JXO A;  5CQX A;  3CC7 T;  2AK5 A;  4A54 A;  3G6E Q;  2ZPB B;  5I22 A;  1VQO T;  1GBR A;  1K73 R;  4BI8 B;  4TVR A;  1TXQ A;  2M0O A;  1G2B A;  3TCJ A;  2A0F B;  2KK4 A;  4PJO E;  3RR6 A;  1EFN A;  2G6F X;  2RHZ A;  2RQT A;  2LTO A;  1RL2 A;  1N8R U;  1S1N A;  1WI7 A;  2XIC A;  1VQL A;  4J7F A;  3C94 A;  1M1F A;  5D6X A;  3V7R A;  3HRT A;  2H3J A;  1ZQ1 A;  3PFS A;  1N5Z A;  4HVU A;  2O31 A;  1NJI R;  1A0N B;  3Q1J A;  2RI3 A;  3GF5 A;  5CKB A;  2NUT A;  2JTE A;  3OY9 A;  2JN0 A;  3OYK A;  2PNI A;  1UGR B;  2COW A;  2OTL T;  1IXD A;  1PD1 A;  2EBP A;  2LQW A;  1FWZ A;  3N5B B;  5KYW B;  2QQB A;  3LH0 A;  4RG8 A;  3OYB A;  5FWB A;  1ZHI A;  3EFR A;  1YWP A;  2F2X A;  1UJ0 A;  4DBH A;  2DYI A;  4CC7 A;  1Y7X A;  2A28 A;  1K73 C;  5DLO A;  2DER A;  1Y07 A;  4J8O A;  2LCC A;  4AFZ C;  3UPU A;  3CQT A;  1IB8 A;  4AMC A;  1WHM A;  1BI2 A;  3UDC A;  3OSS C;  5GAN h;  2HQH A;  1PKT A;  4C92 A;  5D6W A;  4QKU A;  4Q5W A;  3A8H B;  3GNG A;  4BDY A;  1ZUU A;  2CT4 A;  2XI9 A;  3MO8 A;  4Y28 E;  4CI0 C;  4M7D E;  1M4Z A;  1WX6 A;  3PMI A;  4F14 A;  5GAN 2;  1OEB A;  3LX7 A;  3CC2 Q;  1IGQ A;  2LNH B;  1NJI C;  2E6Z A;  2E4H A;  5GAM h;  5GAO m;  2O4X A;  2E3H A;  2AKL A;  2X9H A;  3A8L B;  2K9G A;  2B8A A;  4BD3 A;  2VKN A;  2MF2 A;  4R56 A;  3JSC A;  1W2B P;  5I21 A;  3CD6 T;  3MHX A;  3CCE A;  3CC4 A;  5GAN 4;  5CIU A;  3H0F A;  4M7D F;  4RCB A;  1OX8 A;  1M1K U;  4OMO A;  1QVF P;  1NLP C;  2C0I A;  7AT1 B;  1YJ9 A;  4OMM A;  2NLU A;  1QW1 A;  1LNX A;  3L2W A;  5LJ3 f;  2BKD N;  1BIB A;  3A1P A;  1VQ7 Q;  1E6G A;  4JRK A;  1UDL A;  1YHQ Q;  3NFC A;  2OX7 A;  2AHJ B;  2P84 A;  4NS5 A;  1RAF B;  3OA6 A;  2HBW A;  1FMW A;  3CCV T;  3I9Q A;  1VQM A;  2RK2 A;  1BCM A;  4EMG A;  1Y96 B;  1JBM A;  3ZFJ A;  2ZPF B;  1VIE A;  3G4S T;  2I2L A;  3CCM A;  1PC0 A;  1WHH A;  3ER0 A;  2HL5 C;  3MEW A;  3MP8 A;  1QLY A;  3P8B B;  2LDM A;  5LJ5 e;  2EIF A;  1VQN Q;  4QQ6 A;  1YCY A;  2JM9 A;  1ZBX A;  4D8D A;  2K2M A;  2QEX T;  3VUB A;  3V7S A;  3UA6 A;  1YIJ A;  1KHC A;  1TUG B;  2OJ2 A;  3JB9 G;  1T3S A;  3DLM A;  4IUT A;  2JXB A;  2EJ9 A;  1WQW A;  1U1S A;  5FRO A;  3RUX A;  2RHX A;  3LGL A;  5CQY A;  2Y90 A;  1OV3 A;  2E64 A;  1X69 A;  1BU1 A;  1G3T A;  1VYU A;  2M02 A;  3JCM d;  5GAN 7;  3M0P A;  2F2W A;  3M9Q A;  2DVE A;  5IXB A;  4ZTF A;  1ZLM A;  1IRE B;  2PVD B;  3LWH A;  2VXE A;  1MHN A;  1NG2 A;  3LGF A;  3L2Q A;  4ANJ A;  1M2O A;  5GMK i;  1JJ2 P;  2HEQ A;  3ULR B;  1G3S A;  3DB3 A;  4JJC A;  5A2Q E;  1OU9 A;  4F7U E;  4XTX A;  4ATO A;  5KYW A;  3ME9 A;  2X3W D;  1VQP A;  2J6O A;  3E1S A;  2ED0 A;  4ZTJ A;  3BW1 A;  2FL7 A;  2O88 A;  4MML A;  2CZ7 B;  3VRY A;  2LX9 A;  1X6B A;  5FU7 C;  2EGA A;  1KFZ A;  5KCO A;  4EPC A;  2EPD A;  4D6W A;  4GY5 A;  4JRQ A;  4PJO B;  1OZ3 A;  4XTV A;  3EGX B;  1GCQ A;  1Y57 A;  1RAE B;  2AZV A;  4FW2 A;  2CSQ A;  3L2R A;  4F7U F;  2GFA A;  2OTJ T;  5GAM e;  1JEG A;  3VV0 A;  1NPP A;  3EG2 A;  4PKC C;  2CS7 A;  1VQ7 A;  3CCS T;  5GJW B;  3G71 T;  4F17 A;  4C5E A;  1WHG A;  2M0Y A;  4OB3 B;  4QVZ A;  4O5V A;  1VQ9 A;  1WZO A;  3M0Q A;  1RI0 A;  2DXC A;  3JB9 I;  2MMP A;  2NWM A;  2V26 A;  4GBQ A;  2KMT A;  2KNB B;  5IH2 A;  1B7T A;  2DK3 A;  2EYZ A;  1YWO A;  2XG8 D;  2KXD A;  2RB6 A;  1M1G A;  4J9E A;  2CZ0 B;  2D6F A;  3L2U A;  2KRM A;  3O5Z A;  2AIR B;  2RHI A;  3I5R A;  4ZGJ B;  4J83 A;  4D8K A;  2VXF A;  3CBP A;  3QDR B;  4M7D B;  3QDF A;  3L1A A;  3CME T;  2RO0 A;  1M8M A;  2CYZ B;  2DXT A;  4LXC A;  3FIF A;  1XNI A;  3ZBD A;  4E7Z A;  2DTI A;  3SDZ A;  3NGP A;  2VVK A;  2QDY B;  1IZ6 A;  1GCQ C;  1Y96 A;  2RQR A;  2LQN A;  5C0M A;  4FSS A;  3OYL A;  1ARK A;  1P92 A;  1UUE A;  2CKK A;  2MWO A;  3R6N A;  4AT1 B;  4DOW A;  2K5L A;  3GNF B;  2JS0 A;  2HCK A;  4XU2 A;  1HYO A;  3PMT A;  1BI1 A;  2ZPG B;  3EGD B;  1KSW A;  1ABQ A;  1I8F A;  2F2V A;  2M16 A;  2DAQ A;  5HK3 A;  4OGC A;  2YT6 A;  5FU6 B;  4PLI A;  4F04 B;  5I2M A;  1I4K 1;  2ZCF B;  4M7A E;  3OB9 A;  1X2K A;  2CP2 A;  1X27 A;  1G8X A;  2EYQ A;  4L59 A;  4HCK A;  2HMA A;  3BE3 A;  1YFN A;  1YI2 Q;  3JCM Q;  1TTH B;  1R8O B;  1K1Z A;  1WXB A;  1AT1 B;  2RJF A;  3I35 A;  1YJW T;  3HTR A;  4HCZ A;  4J6Y A;  4OP0 A;  1VQ6 T;  3HP9 A;  5IHK A;  1CKB A;  2DTO A;  3OYA A;  3CCQ Q;  4PJO G;  4C0Z A;  2AT1 B;  3LW5 E;  5DLQ E;  2FVU A;  4AFQ C;  1UB4 A;  2K79 A;  4CC2 A;  2LCL A;  3PIO A;  3OMC A;  4PFO A;  2O9V A;  5KCH A;  4IUU A;  2LT1 A;  3REA B;  4KGX B;  1OQK A;  2V8I A;  2QG9 B;  2CP0 A;  2JJ9 A;  1I07 A;  1KD1 R;  2GTJ A;  1RAG B;  4KUI A;  4DBF A;  4GLM A;  4OB1 B;  2YWW A;  1B34 B;  4MZT A;  5CCA A;  1NLO C;  4IUQ A;  3OMG A;  2YSQ A;  3SFM A;  3VS4 A;  4MZM A;  1NEB A;  1QKX A;  2YLC A;  4FSX A;  1W2B A;  4GLK A;  1V1C A;  1WQ7 A;  2K6D A;  2K3Y A;  2HL3 A;  2A36 A;  3X20 B;  4PL6 A;  1VQL Q;  2QA4 T;  4MZP A;  1Q7Y R;  3CC2 T;  3HFN A;  1UJY A;  1YNZ A;  4PJO A;  2DL5 A;  1WJQ A;  1UHC A;  3EGX A;  1UEC A;  3H9N A;  1TUD A;  4DBR A;  3QYH B;  4JRI A;  2LJ3 A;  8ATC B;  3MEV A;  3E9G A;  1VQ4 T;  5GMK l;  2EYX A;  1QP2 A;  1ZBJ A;  4E7S A;  4M7D G;  4M75 E;  3SWN B;  1KQS P;  2XMF A;  5GAN g;  3UA7 A;  3VS6 A;  2GGR A;  1KD1 C;  1OZ2 A;  4F7U B;  2P0P A;  1VQ5 T;  2RQU A;  1M3B A;  4NOY A;  1M5Q 1;  1NYG A;  2OI3 A;  2QI2 A;  4AFS C;  5D7U A;  1K8A R;  1XTD A;  3E19 A;  1RAH B;  2D0Q B;  3HRU A;  4M78 F;  1BYM A;  4X9C A;  3QHS A;  1UE9 A;  5IHI A;  3S6W A;  2KBT A;  1YHQ T;  3RNJ A;  1Q7Y C;  4M78 D;  4M4Z A;  4LNP A;  1GL5 A;  4BUG A;  4N0A C;  3J81 E;  1TSF A;  1ZA1 B;  2LNV A;  5HK0 A;  3GIB A;  3J80 E;  4M7D A;  3VS1 A;  2C0O A;  4R0K A;  4DOV A;  1K9A A;  2CRE A;  2E5K A;  2I0N A;  2YUO A;  2O2O A;  3CC4 Q;  3CCE Q;  2DA9 A;  1QVG P;  4PJO C;  3OS1 A;  1GFD A;  4J9B A;  2XDD A;  4LE9 A;  1MUZ A;  3JB9 J;  1RUW A;  5GAN 6;  1YJN A;  1WFW A;  1FYN A;  2OAW A;  1N8R R;  1K8A C;  1WLP B;  2VYT A;  3NHN A;  5FRN A;  1KQ2 A;  3A8G B;  2K5F A;  1TG0 A;  3EGD A;  1Z9Z A;  1S72 T;  4XAX B;  4KBM B;  2CDT A;  1TS9 A;  2BUD A;  5AYF A;  3RKY A;  1JJ2 A;  1WHJ A;  2QYZ A;  2LC4 A;  1RI9 A;  1D09 B;  2E5Q A;  3CBM A;  3I55 Q;  1VQM Q;  4RTZ A;  1LVK A;  2X35 A;  2VC8 A;  3CXC P;  5IT9 E;  3CCM Q;  4QW2 A;  2MCN A;  3M4G A;  2MI6 A;  2VUB A;  4XU1 A;  2DLP A;  3JCM V;  1Z9Q A;  2EQM A;  2ZPI B;  3VS5 A;  5KYX B;  4J9I A;  4C92 G;  1YIT Q;  3M53 A;  3O8V A;  4E7J A;  1O9S A;  1KG1 A;  4MMK A;  2JMC A;  1AWJ A;  3A8M B;  3OYY A;  1KIK A;  3OS5 A;  1N8R C;  3L2Z A;  4M7D C;  5EG2 A;  2HD0 A;  2KAF A;  1K0X A;  5LJ5 f;  4OMQ A;  1UGP B;  4PJJ A;  1YIJ Q;  1TU0 B;  4RTT A;  4Y91 A;  1K9M U;  1R0B G;  2QAZ A;  4LDV A;  1D1B A;  1QCO A;  5D6Y A;  3CCR A;  2X4X A;  3LWI A;  2L3S A;  2RMO A;  4C8Q C;  3FJP A;  2RPN A;  3U23 A;  3JCM h;  5KH6 A;  2KSS A;  3NTH A;  3E9F A;  1ZA2 B;  4M77 D;  4M7A B;  1B34 A;  5EC7 A;  5AT1 B;  2L3Q A;  1CSK A;  1J3T A;  1M90 U;  4JUV A;  4AG1 C;  4FYX B;  2FO0 A;  3KUF A;  3MPU B;  4ZN3 A;  2KI7 A;  1M1K R;  1UG1 A;  1UGQ B;  4HT8 A;  2AZS A;  3I5S A;  1HK9 A;  5FU6 C;  1JB0 E;  1N6A A;  3E2U A;  1HJD A;  3C12 A;  3QJY A;  1NYF A;  4FIB A;  4QVC A;  4QQD A;  4LDW A;  1H3Z A;  1FX7 A;  2EQU A;  3CCU A;  2FG0 A;  3SWN A;  1T3L A;  1VQP Q;  1W2B S;  2YUN A;  3QYG B;  1QQJ A;  1WXU A;  1PCX A;  4LDY A;  2YHT A;  3PVL A;  1Q81 U;  4F7U A;  1PSF A;  2Y4Y A;  3H0I A;  5GAN f;  4J9D A;  1QVF S;  2ROL A;  2DJQ A;  2LP5 A;  2K7A A;  2QGG A;  4CC4 B;  2DTH A;  1VYT A;  1W70 A;  1M1K C;  3V7C A;  3FLG A;  3BDL A;  4XTY A;  3WVD B;  2FHD A;  3QO3 A;  4EDU A;  2MPX C;  1PM3 A;  3OYE A;  4O6J A;  1I0C A;  2EYW A;  1AEY A;  1M3A A;  3M0S A;  1LPL A;  5GAM f;  3M57 A;  3FDR A;  5GMK j;  2J7I A;  2DVJ A;  3M55 A;  4XTZ A;  3KXT A;  4JS5 A;  4A63 B;  1TWB A;  1G3Y A;  1VQ9 Q;  3M0T A;  3OQ5 A;  3SB2 A;  4LUE A;  2LQK A;  3V8L A;  3I55 A;  4C92 C;  3RMQ A;  4M75 B;  1VQK A;  5CKD A;  5IXF A;  2EJF A;  2K3X A;  3URG A;  2F5K A;  1D3B B;  4HT9 A;  3WVE B;  1H8K A;  3JB9 H;  4C8Q D;  2A3L A;  4BY6 B;  1YIT A;  4A4F A;  5LJ3 j;  3JCM W;  4ZGD B;  1KJW A;  3OYI A;  3RES A;  1MV3 A;  2X3X D;  4JLI A;  5GAM j;  2B86 A;  1M8V A;  4HA8 A;  4E7L A;  2LJ1 A;  2P4T A;  2KE9 A;  1G3W A;  3RBB B;  2F1L A;  4PNO A;  3QII A;  3CMA A;  3NMZ C;  2DL7 A;  3EHR A;  2DEQ A;  2IVW A;  4M7A G;  2PTK A;  3CCQ T;  4PLL A;  1VQ6 A;  2X4W A;  4J9F A;  1IHW A;  1VQ8 Q;  3EG3 A;  3HFO A;  1Q86 U;  3KBG A;  3G7Z A;  1AOJ A;  1BI0 A;  3QG1 A;  4BI4 A;  3OYH A;  5KYX A;  5DM7 R;  2KY9 A;  2IPO B;  1QP3 A;  1OX9 A;  3CCJ T;  2JUF A;  4FYY B;  2L8D A;  1JJ2 S;  1F1B B;  4EMK B;  2SRC A;  3NPF A;  2DXU A;  1NBE B;  1PD0 A;  3ZL7 C;  3TU4 K;  3LH5 A;  1MND A;  2PUK B;  2PUO B;  2PQW A;  3HRS A;  2MOX A;  3GPL A;  2ZGW A;  2J06 A;  4FT2 A;  1KQS A;  4FT4 A;  3DLL A;  5GAN e;  1VQL T;  2FZK B;  2ATC B;  4M7A A;  3OBY A;  2V8J A;  2ESW A;  2QQ9 A;  1VIF A;  2F69 A;  5CVI A;  3C0C A;  4MDX A;  1E7O A;  2DL3 A;  4BE0 A;  5LJ3 d;  2K5I A;  4OGE A;  2XDP A;  5GAO p;  1PSE A;  4EIK A;  3CCL T;  4FCY A;  1WHK A;  1IHV A;  1I1J A;  2FPF A;  3JCM J;  1AWW A;  5GAM d;  1QVP A;  1FMK A;  1PWT A;  2E3I A;  3OW2 P;  2FRW A;  3L42 A;  1Q95 G;  2DF6 A;  3TEE A;  4C0D B;  2WAC A;  2YUP A;  2ZZD A;  4K11 A;  1OPL A;  2FB7 A;  4M75 G;  1E6H A;  2KRO A;  3OYC A;  3OS2 A;  2XD0 A;  2LZ6 B;  1WPY A;  1PKS A;  4J9H A;  1KC8 U;  3QZ9 B;  2BZ8 A;  2HDA A;  2DPP B;  3HKS A;  4RKU E;  3VS7 A;  2JS2 A;  1XQH A;  2YRD A;  4DEX A;  2EVR A;  3I56 A;  1GBQ A;  4RTY A;  2DET A;  3VJP A;  1U1T A;  3CCE T;  3TSZ A;  4M7A C;  3OYD A;  2K4Y A;  1M27 C;  1QMC A;  2BTT A;  2VB6 A;  5L8R E;  2L2P A;  4F16 A;  1YJ9 T;  4M75 A;  3QJ6 A;  3VS2 A;  2RQV A;  2CGH A;  2EGC A;  4Y92 A;  2HAX A;  1D3B A;  2KGT A;  1MMG A;  3CXC A;  2R5M A;  3M5A A;  1VQ8 A;  2JTF A;  5DY9 A;  4KGZ B;  2HQE A;  3ASK A;  4AFU C;  1OI1 A;  1UHF A;  2FEI A;  3OYM A;  4B9X A;  1HD3 A;  1RAD B;  1SKU B;  1X75 C;  3SD4 A;  3G6E T;  1VQM T;  2BIV A;  5A0L A;  3CC7 A;  4OMF B;  1VQO A;  2DL4 A;  4BAC A;  5IHN A;  2JMA A;  1X2Q A;  2RF0 A;  1X6G A;  3G4S Q;  3RKX A;  3X25 B;  4DQ2 A;  2GQI A;  4OMP A;  4FM4 B;  1H64 1;  5I2S A;  5KE2 A;  2E10 A;  5CKE A;  4DEY A;  2DMO A;  2K3B A;  5GAO l;  1YJN Q;  3VYH B;  3RKW A;  3FRN A;  2VWF A;  1TUC A;  3PNW C;  1YIJ T;  3EH1 A;  4IUP A;  1JRI A;  2DRM A;  3OS0 A;  2C06 A;  3X24 B;  1K76 A;  2OTL A;  3OYN A;  1C1A A;  1VYV A;  3QKJ A;  4EMK A;  3JB9 F;  1U3O A;  2DIQ A;  2RK1 A;  3QWX X;  4M75 C;  1AZE A;  2NUP B;  4UC4 A;  1WA7 A;  1PRM C;  1AWX A;  4LD9 K;  4C5I A;  2DYB A;  2YRV A;  3JB9 D;  2H3E B;  4JZ4 A;  4X9D A;  3UWN A;  2D8H A;  4P5N A;  2KDS A;  1AD5 A;  4X34 A;  2QAS A;  1GXI E;  3MET A;  3MP1 A;  4L6V 5;  1BCO A;  2KYB A;  5IN1 A;  1PG5 B;  3GBQ A;  1K4U S;  2GBQ A;  1IGU A;  1XOV A;  2JTM A;  3JCM g;  1CKA A;  5CR2 A;  3EHQ A;  1QVF A;  3A8O B;  1EZZ B;  2RI2 A;  5LL6 S;  3VU3 C;  3MP6 A;  4J9C A;  1VQP T;  2EQI A;  3QPH A;  2DX1 A;  4M78 E;  2GFU A;  2WSC E;  5GAN 3;  3CCR Q;  5J39 A;  1KQS S;  2FRY A;  1BIA A;  3CPF A;  1LJO A;  3CPW P;  2YDL A;  3FEO A;  3CD6 A;  2E12 A;  3M54 A;  3EFO B;  3H8Z A;  4JJN K;  3PTA A;  3JCM c;  3F70 A;  3VUZ A;  3A98 A;  2KR3 A;  3VYG A;  1FXX A;  1YBY A;  4KGV B;  2NUZ A;  2RJD A;  2E6N A;  1C6V X;  3JCM b;  4EMK C;  2BE9 B;  2OAU A;  2OTJ Q;  1VQ7 T;  1DJ7 B;  1IO6 A;  3BFM A;  1Y71 A;  2JT4 A;  3BY7 A;  3T9N A;  1EX4 A;  3CCS Q;  4E6R A;  1UEB A;  5I11 A;  3G71 Q;  1BKB A;  5LJ3 g;  3NTI A;  2CSI A;  3THK A;  4ESR A;  4KH0 B;  1QKW A;  3CCU Q;  4IIO A;  2XU8 A;  1NE8 A;  2FZG B;  2HSE B;  3CCV A;  4N4G A;  1OUL A;  5GAN 8;  3EAE A;  4C0G A;  3A5Z B;  2MWP A;  2P4R A;  3G4S A;  2KRS A;  1QVG S;  1WYX A;  4HVV A;  2DFU A;  2PU9 B;  2X51 A;  8AT1 B;  2X4Y A;  1VQN T;  5CK9 A;  5HY6 A;  2QGF B;  1X43 A;  1B07 A;  1U8R A;  2DM1 A;  2DIL A;  2CZ6 B;  1Y0M A;  1OU8 A;  2ECZ A;  3OYG A;  5FWC A;  3GP8 A;  2QEX A;  2EJG A;  1V76 A;  5C6S A;  4XU3 A;  4JRP A;  5GAO n;  3L2V A;  2FYK A;  2G3R A;  2JVV A;  2KT8 A;  3CME Q;  1K9M R;  5J26 A;  2RJE A;  4E7H A;  1Q82 U;  1K0S A;  3SHW A;  1M3C A;  4J5Y A;  2DNU A;  2MIO A;  4PJN A;  3RMS A;  2L89 A;  2D8J A;  3M56 A;  1RAC B;  1SEM A;  3CXC S;  5FU7 B;  1VQK Q;  3WXM B;  1ABO A;  2QQR A;  1WGS A;  4M77 E;  4E47 A;  1M90 R;  2CH4 A;  3PT9 A;  4N4H A;  2QK0 A;  2LJ0 A;  2VGN A;  1JQQ A;  1SF9 A;  2DBK A;  3M58 A;  2FPE A;  4PFP A;  5KYU B;  3P8H A;  4IKF A;  1QCN A;  4HVW A;  1G83 A;  2M1H A;  2ZPE B;  3FC3 A;  1O75 A;  5HKC A;  1YCS B;  2EAY A;  5KYY B;  1IRX A;  3G1J A;  4M77 F;  4II1 A;  2NUP A;  2R5A A;  1K9M C;  2JNG A;  3CMA Q;  2LX7 A;  4A4G A;  2C0T A;  1MMA A;  5CO7 A;  3OW2 A;  1YJW Q;  4YTL A;  4E7K A;  1VQ6 Q;  4F7U G;  2RHU A;  3KFV A;  2L0A A;  1BI3 A;  1W4S A;  2PVO B;  4KRT A;  5IAY A;  1Q81 R;  1QWF A;  3CEY A;  4RMO A;  2JOY A;  1GFC A;  2DZC A;  2BZX A;  2KYM A;  4PJO F;  1M90 C;  3CCL A;  2XDB A;  2K57 A;  2HBP A;  2OTJ A;  2HNI A;  5GMK h;  5LJ5 j;  1K73 U;  1ACM B;  1BB9 A;  4PJO D;  4BI3 A;  2ZAE A;  3QUI A;  2JM8 A;  2QQS A;  3CCS A;  3GOX A;  3G71 A;  2L3P A;  3LYI A;  4WCI A;  4JPB W;  3SEM A;  1U06 A;  3UF4 A;  2XHC A;  4ELZ C;  2E41 A;  3VKI A;  2DXB A;  1H92 A;  3JCM f;  2HSP A;  2QTX A;  1ZSZ B;  3HHT B;  2X4J A;  1ZUY A;  3LLR A;  2DL8 A;  3EFO A;  4C5G A;  2EWN A;  1EIF A;  4QT7 A;  4ORZ A;  5LJ3 h;  3TSW A;  1NJI U;  5KE3 A;  2M9U A;  1PHT A;  2JZ2 A;  1OOT A;  2PZ1 A;  2QA4 Q;  2IIM A;  5CKF A;  4IUV A;  2CP7 A;  4N4I A;  2DE0 X;  1Q81 C;  2SEM A;  1FMV A;  1I81 A;  4C8Q E;  1X01 A;  1XJW B;  3TVT A;  2P0K A;  2XID A;  2O9S A;  1VQ4 Q;  2DKG A;  3V8J A;  4LN2 A;  5CKH A;  3H6Z A;  1RAA B;  4A4E A;  3CME A;  2LRQ A;  3S3O A;  3FJ5 A;  1LOJ A;  2CT3 A;  4HXJ A;  1BBZ A;  4M7D D;  2RM4 A;  1VQ5 Q;  4M78 B;  2P0Q A;  4CC3 A;  4C8Q F;  2GQV A;  3DB4 A;  3QXE B;  4VUB A;  2ROT A;  3OYF A;  4MDW A;  1ZX6 A;  4OB0 B;  5GAN j;  3P8D A;  3JCM X;  2NYS A;  5ECA A;  3EGU A;  1Q86 R;  2LCS A;  3S3M A;  2MK5 A;  1MNE A;  3MCA B;  4FL6 A;  4LD6 A;  1QWE A;  3G6E A;  5LJ5 d;  3I56 Q;  3SWN C;  3X28 B;  2DD4 A;  3EG9 B;  2CUB A;  2RH2 A;  4AG2 C;  3EH2 A;  4WF2 A;  2YXY A;  1YI2 T;  5GMK m;  4R55 A;  1UFF A;  5A0G A;  2PVG B;  1YJN T;  2QQA A;  2M51 A;  3HPW A;  1SHG A;  5J3B A;  1YJW A;  3MEU A;  5GJV B;  1OYX A;  5KYN A;  2V1Q A;  3HSB A;  3JRZ A;  4OML A;  1R77 A;  1R0C B;  2DO3 A;  5L23 A;  1AZG B;  1I5L A;  1S72 Q;  1WXT A;  1JU5 C;  1Q86 C;  1SSF A;  2RJC A;  1VOM A;  5KYU A;  3JCM P;  4C92 E;  2CH4 W;  2J6K A;  2KRN A;  2D1X A;  1JO8 A;  1RAB B;  3AHU A;  2EKO A;  3JCM e;  5M9O A;  1NM7 A;  4KUL A;  3CC7 Q;  3MJX A;  2EQJ A;  1VQO Q;  3INZ A;  5KYY A;  1W1F A;  4XTW A;  4JDS A;  2L3R A;  2KXC A;  3CPW A;  4RTU A;  1N9R A;  1WHL A;  5GAN d;  4JJB A;  4C92 F;  2QA4 A;  5GMK e;  1WJS A;  4RTW A;  3CC2 A;  2EYY A;  1KC8 R;  3NTK A;  4C92 D;  4M77 B;  4ZNX A;  1M2V B;  2J05 A;  4NL3 A;  3CCR T;  4OF1 A;  1SSH A;  1VQ4 A;  2CP3 A;  2COY A;  2GCX A;  3H41 A;  3TRE A;  2OTL Q;  1HXD A;  1VUB A;  4ME7 A;  4J6X A;  2Z0W A;  1BK2 A;  1T0J A;  1NEG A;  2KVQ G;  3OW2 S;  5LJ3 e;  4BB7 A;  4PFZ A;  4EMH A;  3M4Y A;  3QZ5 B;  2RHY A;  4ZGE B;  4M78 G;  1ZSZ A;  1VQ5 A;  3VRZ A;  4DBQ A;  2GF7 A;  1WJR A;  5HCK A;  4XU0 A;  2RNA A;  2LVM A;  4KT0 E;  3EG1 A;  1LCK A;  4RTX A;  2D9T A;  1KHI A;  2BZY A;  1QVG A;  3VS3 A;  1YHQ A;  2DIG A;  4A4K A;  2GNC A;  4A53 A;  4PJL A;  5GAO q;  1JXM A;  4JJD A;  3CCU T;  4OB2 B;  1KC8 C;  3C95 A;  4BDZ A;  3EFS A;  2LQ8 A;  1KQ1 A;  3PIP A;  4XQ3 A;  2CUD A;  2GTO A;  2MAM A;  3GLX A;  1RLP C;  3RIR A;  1HSQ A;  3CC4 T;  3IQL A;  1N9S A;  4B9W A;  2WSE E;  1W6X A;  3CD6 Q;  2EFI A;  1YN8 A;  2L5Q A;  3H0H A;  4QQG A;  4M78 A;  1VQN A;  1ZUK A;  4E2F B;  2Y4X A;  4NL2 A;  4CRI A;  2DZ9 A;  3PVQ A;  2D0N A;  4IUR A;  1S72 A;  1GCP A;  2J6F A;  4FYW B;  4IIM A;  3C4S A;  2E1H A;  2JW4 A;  4C8Q B;  1ZSZ C;  1TOV A;  3I55 T;  3EG0 A;  3EG9 A;  2F5T X;  1VQK T;  3V8K A;  3CCV Q;  2A7Y A;  4RG2 A;  3CCM T;  2QTV A;  2QDL A;  3JAM E;  4J9G A;  2CP6 A;  3J7A F;  2QXF A;  1YIT T;  2DD5 A;  1U5S A;  2HZY A;  4LDU A;  5FW9 A;  1VA7 A;  2ED1 A;  4XK8 E;  1PRL C;  1SRL A;  3PGG A;  2A37 A;  1M30 A;  4XTU A;  2AKK A;  1NZ9 A;  2RQW A;  4M77 G;  3M0R A;  2XK0 A;  2BE7 D;  2QEX Q;  2IG0 A;  4OVA A;  1SRM A;  1D1A A;  3X26 B;  1NPR A;  2WSF E;  1D0X A;  3VS0 A;  3CBO A;  1MV0 B;  3CMA T;  4ELY C;  2VAS A;  4M78 C;  5LJ5 g;  2V1R A;  2K2V A;  4JS4 A;  2H8H A;  4C0F A;  1SHF A;  1UGS B;  4M7A F;  2FZC B;  1WDX A;  1M9S A;  1X6O A;  2XKO C;  1WIE A;  4BY6 C;  3RDV A;  4FYV B;  2NUT B;  4M7A D;  4B6M A;  1V29 B;  5CAI A;  3CCJ Q;  1TH7 A;  4KUD K;  4PJM A;  2EGE A;  4N0A A;  4M77 A;  2E65 A;  3FB9 A;  3OYJ A;  1M2V A;  1H3H A;  3QSU A;  1QCF A;  4RTV A;  4OMN A;  4KH1 B;  5FRM A;  2VV5 A;  3CPW S;  1YP5 A;  4C92 B;  2W0Z A;  4J6W A;  3AT1 B;  1SPK A;  3RER A;  1G5V A;  4FU6 A;  5A0D A;  1RLQ C;  2DRK A;  4BE1 A;  1D0Z A;  2RD1 A;  2EW3 A;  4E7I A;  4V2S A;  1WNL A;  4A4H A;  2KEA A;  2HKN A;  1PNJ A;  2O4X B;  4Z88 A;  3JV3 A;  3CCL Q;  9ATC B;  1KD1 U;  2YLB A;  3UT1 A;  3MKD A;  2A08 A;  1D0Y A;  1MMD A;  1I5O B;  2COZ A;  4FW1 A;  4LUD A;  3M0U A;  4C8Q G;  2YRC A;  2RI5 A;  1VQ9 T;  2LMJ A;  5GAN 5;  3S3N A;  3BDU A;  3UAT A;  3QWY A;  2HQX A;  3R6O A;  4WTO B;  1KK7 A;  4QVD A;  1Q82 R;  3OBW A;  1C0M A;  5GAM g;  1Q7Y U;  2MYS A;  2EKH A;  2RA2 A;  4M75 F;  6AT1 B;  3ZEH A;  1ZSG A;  4RUG A;  4C5H A;  4LDX A;  4ZN1 A;  2DBM A;  3QBY A;  4M77 C;  4M75 D;  2KQW A;  4Z89 A;  2ABL A;  4J7I A;  3I56 T;  4Z8A A;  2RN8 A;  4HKE A;  2KT1 A;  4RCC A;  1T0H A;  2CP5 A;  5FLX E;  3D7S B;  2R57 A;  1SG5 A;  2DEU A;  2E70 A;  3DKM A;  4BE2 A;  4HCC A;  3OSV A;  1N27 A;  3MEA A;  1AVZ C;  3PE0 A;  2W10 A;  1YI2 A;  1UTI A;  4C8Q A;  2YUQ A;  4X1V A;  2ZPH B;  4C0D C;  2R58 A;  4DA4 A;  1K8A U;  3REB B;  2O01 E;  1OPK A;  4JLG A;  3TQ7 P;  1YJ9 Q; 
#chains in the Genus database with same CATH homology
 4AFQ C;  2K79 A;  2ENM A;  4CC2 A;  1B3Q A;  3FJ5 A;  4JZ3 A;  2CT3 A;  2FPD A;  4HXJ A;  1BBZ A;  2O9V A;  1FMK A;  1UGV A;  1PWT A;  3REA B;  4CC3 A;  2FRW A;  1GRI A;  2ROT A;  1AWO A;  1ZX6 A;  2DF6 A;  2YUP A;  1I07 A;  4K11 A;  1OPL A;  2GTJ A;  1E6H A;  2KRO A;  4GLM A;  5ECA A;  3EGU A;  1JXO A;  1NLO C;  2LCS A;  2AK5 A;  2LZ6 B;  2YSQ A;  3VS4 A;  5I22 A;  1GBR A;  1NEB A;  1PKS A;  1QKX A;  4J9H A;  2BZ8 A;  2HDA A;  1V1C A;  1G2B A;  1QWE A;  2K6D A;  3VS7 A;  2JS2 A;  2A36 A;  1EFN A;  2G6F X;  4DEX A;  2EVR A;  2RQT A;  2CUB A;  1UJY A;  1YNZ A;  1S1N A;  1WI7 A;  4AG2 C;  2DL5 A;  1GBQ A;  1UHC A;  4RTY A;  1UEC A;  1TUD A;  3TSZ A;  1UFF A;  2LJ3 A;  2EYX A;  1N5Z A;  4HVU A;  2M51 A;  2O31 A;  1A0N B;  1M27 C;  1SHG A;  1ZBJ A;  2JTE A;  2XMF A;  3UA7 A;  2BTT A;  2PNI A;  5GJV B;  2L2P A;  4F16 A;  2EBP A;  2LQW A;  2V1Q A;  4OML A;  3VS2 A;  2RQV A;  2GGR A;  3VS6 A;  5FWB A;  2EGC A;  4Y92 A;  5L23 A;  2KGT A;  1AZG B;  1YWP A;  2RQU A;  1WXT A;  2F2X A;  1JU5 C;  1UJ0 A;  1M3B A;  1NYG A;  2OI3 A;  4CC7 A;  4AFS C;  2A28 A;  4AFZ C;  2CH4 W;  2J6K A;  2KRN A;  2D1X A;  3CQT A;  4AFU C;  1JO8 A;  1UE9 A;  1PKT A;  1UHF A;  2FEI A;  1NM7 A;  5IHI A;  2KBT A;  3RNJ A;  1HD3 A;  4M4Z A;  4LNP A;  1GL5 A;  1W1F A;  1ZUU A;  2CT4 A;  2KXC A;  1WX6 A;  2DL4 A;  4F14 A;  5IHN A;  2JMA A;  1X2Q A;  4RTU A;  1OEB A;  2RF0 A;  1X6G A;  3VS1 A;  2C0O A;  2GQI A;  2LNH B;  4R0K A;  4OMP A;  4JJB A;  1K9A A;  2CRE A;  2E5K A;  2I0N A;  2YUO A;  2AKL A;  4RTW A;  2O2O A;  2EYY A;  2K9G A;  2DA9 A;  4DEY A;  2DMO A;  2VKN A;  2K3B A;  4ZNX A;  1GFD A;  4J9B A;  2J05 A;  2VWF A;  1TUC A;  4LE9 A;  1MUZ A;  1SSH A;  1RUW A;  2DRM A;  1WFW A;  3H0F A;  1FYN A;  3H41 A;  2OAW A;  1BK2 A;  1WLP B;  1T0J A;  4OMO A;  3NHN A;  1NLP C;  2C0I A;  1K76 A;  1NEG A;  4OMM A;  1VYV A;  1TG0 A;  1Z9Z A;  1U3O A;  2CDT A;  3QWX X;  1AZE A;  1WA7 A;  1PRM C;  3VRZ A;  1AWX A;  2DYB A;  4JZ4 A;  5HCK A;  1E6G A;  2D8H A;  1AD5 A;  2RNA A;  1UDL A;  3EG1 A;  1RI9 A;  1LCK A;  4RTX A;  4RTZ A;  2BZY A;  3VS3 A;  2GNC A;  1JXM A;  2HBW A;  2KYB A;  3I9Q A;  4JJD A;  2MCN A;  2DLP A;  3GBQ A;  1K4U S;  1Z9Q A;  3VS5 A;  2GBQ A;  1XOV A;  4J9I A;  1CKA A;  3EHQ A;  2JMC A;  1AWJ A;  2CUD A;  1QLY A;  2GTO A;  1KIK A;  1RLP C;  1HSQ A;  4J9C A;  3IQL A;  2EQI A;  1W6X A;  1K0X A;  2DX1 A;  1YN8 A;  4OMQ A;  2FRY A;  3H0H A;  4RTT A;  2JM9 A;  2YDL A;  4D8D A;  2K2M A;  1ZUK A;  2L3S A;  3UA6 A;  2RMO A;  2RPN A;  3U23 A;  2OJ2 A;  1T3S A;  3A98 A;  2KR3 A;  2JXB A;  5EC7 A;  2NUZ A;  3PVQ A;  2D0N A;  2L3Q A;  1CSK A;  1J3T A;  4AG1 C;  1GCP A;  1OV3 A;  2J6F A;  4IIM A;  1X69 A;  2FO0 A;  1BU1 A;  1VYU A;  1IO6 A;  1UG1 A;  2JT4 A;  2JW4 A;  2AZS A;  3M0P A;  3I5S A;  4E6R A;  5I11 A;  2F2W A;  3EG0 A;  5IXB A;  1ZLM A;  2CSI A;  3THK A;  4ESR A;  1HJD A;  1QKW A;  1NG2 A;  4IIO A;  2QDL A;  4J9G A;  1NYF A;  1U5S A;  2FG0 A;  2HEQ A;  3ULR B;  2P4R A;  5FW9 A;  2KRS A;  1T3L A;  1WYX A;  1VA7 A;  4JJC A;  2ED1 A;  4HVV A;  1PRL C;  1SRL A;  2YUN A;  2A37 A;  1M30 A;  1WXU A;  2AKK A;  2X3W D;  2J6O A;  2RQW A;  3PVL A;  2ED0 A;  3M0R A;  2O88 A;  1X43 A;  1B07 A;  3H0I A;  4J9D A;  2DM1 A;  1SRM A;  3VRY A;  2ROL A;  2DIL A;  2DJQ A;  1Y0M A;  2LP5 A;  2ECZ A;  2K7A A;  3VS0 A;  1X6B A;  5FWC A;  1MV0 B;  4CC4 B;  2EGA A;  1VYT A;  1KFZ A;  1W70 A;  2EPD A;  2V1R A;  2H8H A;  2KT8 A;  1GCQ A;  1Y57 A;  2AZV A;  1I0C A;  2CSQ A;  1SHF A;  1K0S A;  3SHW A;  2EYW A;  1M3C A;  1AEY A;  2DNU A;  1WDX A;  2MIO A;  1JEG A;  1M3A A;  3M0S A;  1WIE A;  3EG2 A;  2J7I A;  2D8J A;  2DVJ A;  1SEM A;  4A63 B;  5GJW B;  4F17 A;  3M0T A;  4LUE A;  2M0Y A;  1ABO A;  2CH4 A;  5IXF A;  2EGE A;  2LJ0 A;  1JQQ A;  3M0Q A;  1H8K A;  2DBK A;  2FPE A;  1H3H A;  2NWM A;  1QCF A;  4GBQ A;  4HVW A;  4RTV A;  1G83 A;  2KNB B;  4OMN A;  5IH2 A;  2EYZ A;  1YWO A;  1YP5 A;  1KJW A;  2W0Z A;  2KXD A;  1MV3 A;  1YCS B;  1SPK A;  4J9E A;  2X3X D;  2B86 A;  2KRM A;  3O5Z A;  1RLQ C;  2DRK A;  2LX7 A;  2LJ1 A;  3I5R A;  2KE9 A;  2EW3 A;  4D8K A;  3RBB B;  2C0T A;  2KEA A;  3KFV A;  3NMZ C;  2L0A A;  1PNJ A;  2DL7 A;  3EHR A;  4KRT A;  4Z88 A;  1QWF A;  1M8M A;  3JV3 A;  2PTK A;  1GFC A;  2BZX A;  2KYM A;  4J9F A;  3NGP A;  2VVK A;  1GCQ C;  2A08 A;  3EG3 A;  2RQR A;  2LQN A;  1AOJ A;  4FSS A;  4LUD A;  1ARK A;  3M0U A;  1BB9 A;  1UUE A;  3R6N A;  2JS0 A;  2JM8 A;  2LMJ A;  2HCK A;  3UAT A;  3QWY A;  2L3P A;  4WCI A;  4JPB W;  3SEM A;  1U06 A;  2SRC A;  3UF4 A;  3NPF A;  3ZL7 C;  1KSW A;  1ABQ A;  2F2V A;  2EKH A;  1H92 A;  3LH5 A;  2HSP A;  1ZSG A;  4RUG A;  2YT6 A;  1ZUY A;  2DL8 A;  2MOX A;  2DBM A;  4QT7 A;  4ORZ A;  2ABL A;  3TSW A;  2J06 A;  4Z89 A;  1X2K A;  4Z8A A;  2RN8 A;  1PHT A;  1OOT A;  2KT1 A;  1X27 A;  2PZ1 A;  2IIM A;  1T0H A;  2DE0 X;  4HCK A;  2ESW A;  2SEM A;  3TVT A;  1K1Z A;  1WXB A;  1AVZ C;  3PE0 A;  3I35 A;  2W10 A;  2O9S A;  3C0C A;  1E7O A;  1UTI A;  2DL3 A;  2YUQ A;  4X1V A;  4LN2 A;  5IHK A;  1CKB A;  4EIK A;  3REB B;  1OPK A;  2FPF A;  1I1J A;  1AWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...