3H0FA

Crystal structure of the human fyn sh3 r96w mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
VTLFVALYDYEAWTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Fyn
publication title SH3 domain specificity
rcsb
source organism Homo sapiens
total genus 11
structure length 59
sequence length 59
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3h0fA00
2RNAA 2DX1A 4M4ZA 1H3HA 3ULRB 1H8KA 2RQWA 2ROLA 2KNBB 4ORZA 3VS2A 1U06A 2MIOA 2DF6A 2GQIA 1K0SA 1X6BA 4Z89A 1AWXA 2DBKA 4OMQA 2JM8A 1UG1A 1NYFA 4CC3A 3RBBB 2C0OA 4LUDA 1RLQC 4JZ4A 1K1ZA 1K9AA 2CSIA 1HSQA 1SHFA 4RTTA 2PTKA 1E7OA 2LQNA 5FW9A 3ZL7C 1PHTA 1X6GA 4RTUA 2A37A 2JW4A 2K3BA 2O2OA 1QWEA 3EG3A 2FG0A 4R0KA 4F14A 3REAB 4JZ3A 1AZEA 4ZNXA 4OMMA 2D8JA 4IIMA 4RTYA 2CSQA 3EHQA 2OI3A 1B07A 2YT6A 1BK2A 3M0RA 2GNCA 4FSSA 1OPLA 4E6RA 1WDXA 2ENMA 1WYXA 1ZX6A 2RQUA 3VS0A 2BZ8A 1K4US 2D1XA 2LCSA 1EFNA 1ZSGA 2J06A 2JMAA 2K6DA 2KE9A 2C0IA 4D8KA 3H41A 1UGVA 2ED0A 2YDLA 1PKTA 5IXBA 1WX6A 1S1NA 2G6FX 3SEMA 2LP5A 3EG1A 1QCFA 2EQIA 1WXUA 2RMOA 2M51A 1M27C 2RQTA 1UDLA 1TG0A 2DLPA 1SHGA 2VWFA 2KXCA 1UJYA 3M0SA 1WXBA 2RPNA 3UA7A 1GL5A 2CT4A 2X3XD 4GLMA 3VS3A 3M0UA 1GBRA 1KSWA 1NEBA 2LX7A 2RQVA 1AWWA 1UTIA 1SRMA 1Z9QA 1VYVA 3LH5A 2NWMA 2J7IA 2FPEA 1BB9A 2GTOA 4AG1C 2B86A 1ABQA 1QKXA 4J9BA 1SSHA 2DL3A 5FWCA 1M8MA 4JJCA 1ZUKA 1BU1A 5IH2A 4DEYA 3I5RA 4DEXA 5GJWB 1KFZA 1SRLA 1VYUA 1U5SA 3PE0A 1G2BA 1PRLC 1KJWA 2XMFA 5IHKA 4AFZC 1GCQC 2O31A 3VRZA 1LCKA 1YWPA 1JEGA 1RLPC 2X3WD 2J6FA 2FEIA 4A63B 2J05A 1K76A 3TSZA 2JS2A 1RUWA 2KRMA 1UE9A 1YNZA 4F16A 3EGUA 2RQRA 2YUOA 3SHWA 3VS7A 4J9HA 2FRWA 2EYZA 1I1JA 1AZGB 1Z9ZA 2E5KA 3UF4A 1T0HA 2DM1A 3EG2A 3U23A 1M30A 5I22A 1QLYA 2O9SA 4RUGA 4J9IA 4JJBA 1K0XA 2K2MA 2KRNA 3REBB 2JS0A 1MV0B 2CREA 3VRYA 1HJDA 1X2QA 4OMNA 2K9GA 2DMOA 2GGRA 3EG0A 4J9EA 2YUPA 1GRIA 1I07A 1GCPA 2L0AA 3VS1A 1E6HA 2AK5A 3QWXX 3IQLA 1GFCA 1XOVA 3KFVA 4RTZA 2CH4A 2W10A 2DRMA 2JMCA 2LJ0A 2K7AA 2JXBA 1W6XA 2KBTA 1WIEA 4J9GA 2DJQA 1X43A 4RTVA 2J6KA 4AFUC 1AD5A 2IIMA 3EHRA 3A98A 1PWTA 1W70A 3FJ5A 5GJVB 2LQWA 4ESRA 1YCSB 4CC4B 4RTWA 2JTEA 2EYXA 1ZLMA 1HD3A 1UUEA 5L23A 3I9QA 1X27A 2KRSA 4CC7A 1A0NB 1FMKA 3TVTA 2CH4W 2ED1A 2DRKA 2A36A 3VS6A 3JV3A 1UJ0A 1AWJA 1WFWA 2KXDA 2DA9A 2DL4A 2BZXA 1MV3A 2DVJA 2D0NA 2ROTA 1YP5A 1JQQA 1TUDA 2KGTA 1VA7A 2JT4A 4HCKA 3UA6A 2YSQA 1GBQA 2ECZA 2GTJA 2C0TA 1YN8A 2AZVA 2PNIA 2KROA 2W0ZA 2LJ3A 2CDTA 2EBPA 2HEQA 1B3QA 2KR3A 1SPKA 3I5SA 4AG2C 2D8HA 1NG2A 2V1RA 2HCKA 3H0IA 3O5ZA 3UATA 2LZ6B 3M0QA 3NHNA 2SEMA 1JXMA 2LMJA 1UECA 4HXJA 2EKHA 2QDLA 1NLOC 1VYTA 4CC2A 2AKLA 3H0HA 1PKSA 3R6NA 1AVZC 1WI7A 2DL8A 4LN2A 3GBQA 4LE9A 1NEGA 2DE0X 2EYYA 4OMPA 2F2WA 1J3TA 2RF0A 1OOTA 1KIKA 5FWBA 2A28A 1QKWA 4OMOA 4Z8AA 2EGEA 1X69A 3CQTA 3VS4A 5IXFA 1H92A 1CKAA 5ECAA 1UFFA 2ESWA 2HSPA 1JU5C 1ARKA 3NPFA 1GFDA 2DILA 2CT3A 2L3SA 3QWYA 4X1VA 3M0TA 2J6OA 1FYNA 1I0CA 3I35A 2KYBA 2MCNA 2DYBA 3PVLA 1CKBA 1M3CA 1PRMC 4D8DA 5EC7A 4WCIA 2I0NA 2EPDA 5IHNA 2KYMA 2O9VA 4LNPA 1OPKA 2BTTA 1M3BA 4Z88A 1Y0MA 2EYWA 1AOJA 3NMZC 2O88A 2DL7A 1G83A 2MOXA 1GCQA 3C0CA 2LNHB 1X2KA 4RTXA 2KT1A 1ZUUA 2L3QA 2FRYA 2FPDA 1AWOA 2HBWA 2F2VA 2JM9A 1N5ZA 4QT7A 2AKKA 1ZBJA 1W1FA 1CSKA 4IIOA 4AFQC 2EGCA 4OMLA 2DNUA 1QWFA 4J9CA 1OEBA 2K79A 4HVWA 4LUEA 4F17A 1SEMA 3THKA 4AFSC 2A08A 2EW3A 2KT8A 2OAWA 2M0YA 2L3PA 4JPBW 2PZ1A 4KRTA 3PVQA 1ZUYA 4J9DA 1UHCA 1BBZA 1ABOA 1IO6A 1OV3A 4HVVA 2VKNA 2SRCA 1T0JA 2HDAA 3H0FA 2KEAA 5IHIA 2GBQA 3VS5A 1MUZA 2CUBA 4GBQA 2DBMA 1E6GA 1WLPB 2AZSA 5I11A 2V1QA 1JXOA 2H8HA 1T3SA 2NUZA 4J9FA 2YUQA 2FO0A 1TUCA 1WA7A 2F2XA 2DL5A 2OJ2A 4Y92A 2P4RA 2LJ1A 1Y57A 1V1CA 1NM7A 5HCKA 4HVUA 3TSWA 2FPFA 3M0PA 1T3LA 2ABLA 2CUDA 3NGPA 1RI9A 1U3OA 2L2PA 2YUNA 4EIKA 2VVKA 2RN8A 1JO8A 1NYGA 4JJDA 2BZYA 1M3AA 1PNJA 1WXTA 1AEYA 4K11A 2EVRA 1NLPC 3RNJA 1UHFA 1YWOA 2EGAA
chains in the Genus database with same CATH superfamily
4M4ZA 3OS5A 3CCQT 3E1SA 2MIOA 3CEYA 2DF6A 1YJNT 1X6BA 1FWZA 4FM4B 5D6WA 4E47A 4M7DA 1AWXA 3MEVA 1VQPQ 4FYWB 2KAFA 2G3RA 3VUZA 1FMVA 1AHJB 4MMKA 4RTTA 4BDYA 3ZL7C 3PNWC 4PJOA 1ACMB 2DERA 4WTOB 1BIAA 4R55A 2A37A 1QVGS 2HBPA 3NTHA 4C92C 3A8HB 1QWEA 1RADB 3PTAA 1VQ7Q 3J7AF 3REAB 4RCCA 5CKFA 1VIFA 1ZBXA 1QCNA 4IUQA 4RCBA 4LDUA 4B9WA 2VV5A 4C8QF 2DTIA 2YRCA 1BK2A 4M77B 4E6RA 2ENMA 2DKGA 1ZX6A 2D1XA 2J06A 3GOXA 2KE9A 4BE2A 1VQLQ 2C0IA 1TS9A 3JCMd 1D0ZA 4D8KA 1WQWA 3F70A 4RKUE 2KY9A 1QP3A 1PSFA 2E4HA 3DB3A 3M55A 4B9XA 2ED0A 4RMOA 3L2QA 1MMGA 2HSEB 7AT1B 3SEMA 2LP5A 3EG1A 1QCFA 2QTXA 4C8QG 2E41A 1YJ9A 1Q82U 1VQ6T 3E9FA 2RQTA 2DTHA 2V8JA 4BI3A 4EDUA 1NBEB 4PJLA 4Y91A 4QVDA 4OB1B 2JUFA 4C5HA 2KXCA 1UJYA 2RI5A 2RPNA 2RI2A 2CZ1B 4HT8A 2X3XD 4KUIA 3I56A 2RQVA 1Q7YR 1NJIU 2GFUA 2RI3A 1SRMA 1Z9QA 1VYVA 1QCOA 2NWMA 1VQ9Q 3V8KA 4PLIA 5FWCA 2QEXT 1ZUKA 4LDWA 3CCQA 1BU1A 5IH2A 1V76A 3I5RA 1YJNA 1KFZA 2EKOA 1SRLA 1VYUA 2DPPB 3PE0A 1PRLC 3VV0A 5IHKA 2M0OA 1JEGA 4E7IA 1O9SA 1WPYA 3G4ST 1RI0A 2FEIA 2LT1A 3TSZA 4FT2A 2HQEA 1RUWA 4N4IA 1M9SA 1UE9A 3SHWA 2LVMA 1K8AU 2EYZA 3GIBA 5I21A 3UF4A 1U8RA 4PJMA 1Y7XA 3A8GB 3MHXA 3OB9A 3G1JA 4JS5A 1K0XA 2CREA 3VRYA 1X2QA 4F7UE 3TCJA 2RK1A 1HK9A 2A3LA 3X24B 3QBYA 4J9EA 1N8RR 3QIIA 3NTIA 5LJ5h 2IVWA 3VS1A 3QWXX 3A8LB 3IQLA 4MZTA 5GMKm 1ZQ1A 3KBGA 1Q86R 2P0KA 2A7YA 2ZAEA 1QP2A 3HRTA 4JLGA 2DRMA 2JMCA 5CQXA 1KC8U 5FRNA 3QZ5B 3HL8A 1VQ6A 2DVEA 3TU4K 2DJQA 4KGZB 4BE0A 1VUBA 2NLUA 4C8QC 2J6KA 2IIMA 3EHRA 4HCZA 4RG2A 1WHHA 1YJ9Q 1PWTA 1D3BB 1KQSP 5GJVB 4M7DB 4ESRA 4LDYA 3GNFB 3FIFA 4RG8A 4PJOD 3OYYA 2CZ0B 3JCMe 2E3HA 2DEUA 1X27A 2KRSA 4IUPA 4OB3B 2AT1B 1A0NB 4PJNA 3MPUB 3RDVA 5CKHA 3OMCA 1UGPB 1UJ0A 3URGA 4JDSA 2QEXA 3I56Q 1MV3A 5CR2A 2YWWA 6AT1B 2LNVA 1WQ7A 3RESA 3BY7A 4QW2A 1U1SA 3E19A 4JRQA 4A4HA 2ECZA 5KCHA 1YJNQ 2PQWA 3G4SA 2M16A 2I2LA 1M1KC 1D0XA 3M59A 4R56A 2ZPIB 2EBPA 1R0CB 4DBHA 2JZ2A 4AG2C 3M4GA 4C5GA 3M0QA 4ZGJB 4AT1B 3NHNA 1R77A 3CC2T 2YLBA 1JJ2S 4C0ZA 4HXJA 2LQ8A 3UDCA 2P84A 3QPHA 1PKSA 5LJ5f 1AVZC 2DL8A 2K3XA 4XTWA 1OZ3A 2CP0A 4LN2A 4WF2A 1Q95G 4C8QE 5KE3A 1NEGA 5GAN2 3MP8A 2F2WA 1J3TA 1Y71A 2V26A 5KYWB 3M9QA 4N4GA 1X69A 2KMTA 4A54A 3QKJA 1YCYA 1QVGP 2ESWA 2KSSA 3N5BB 1GFDA 5CKDA 2DILA 2OTLT 2KDSA 1IGQA 4MMLA 3CCJQ 3QWYA 4M7AF 4VUBA 1I5LA 2J6OA 1BI3A 3FRNA 2DETA 2RJCA 3PVLA 1CKBA 1MMNA 2YLCA 1M3CA 2K5IA 2E5QA 1KHIA 5EC7A 4ZN1A 2K5LA 5IHNA 2BTTA 1VQ6Q 4Z88A 3CCUQ 1Y0MA 2RJDA 3SD4A 2QYZA 2X4YA 2DL7A 3QYGB 3TQ7P 1Y96B 1GCQA 4M7AG 4XK8E 5GMKj 4M75B 3CMET 2FPDA 2JM9A 3FLGA 3OQ5A 2AKKA 3UT1A 4IIOA 4FIBA 2K79A 1S72T 1SEMA 2FHDA 4AFSC 1VQKT 2QEXQ 2CZ6B 5J39A 2OAWA 3JCMh 2PZ1A 3OYHA 1WGSA 4XTYA 3QJ6A 1BBZA 2RJFA 3FB9A 4M77G 1IO6A 4J8OA 4HVVA 2VASA 2VKNA 3QO3A 1RAIB 3RERA 3G4SQ 5IHIA 1W2BA 3G7ZA 1WLPB 2AZSA 5FRMA 3Q1JA 2H8HA 3CC2A 1LVKA 1VQ4T 2YUQA 2F2XA 4Y92A 2OJ2A 5FU7C 3INZA 2CP2A 1OZ2A 3OS2A 2NUPB 2XIDA 1Y57A 3D7SB 1QMCA 3JB9G 5HCKA 1YITA 3TSWA 2FPFA 2VGNA 2VGMA 5DY9A 4C0DB 3NGPA 3M58A 4C5IA 3CMAT 2K4YA 4PLLA 4L6V5 2A0FB 2RHUA 2YUNA 4EIKA 2VVKA 2RN8A 4EMGA 1VQMT 1WXTA 4MZPA 2EJFA 5KYXB 1N9SA 1R8OB 2E10A 3M53A 3JCMP 2OTLA 2RNAA 3DLLA 3HTRA 3X28B 1H8KA 2ROLA 2O4XA 2KNBB 2DO3A 1U06A 2GQIA 4QQGA 1NYFA 3RMQA 4C92F 4CC3A 5LJ5d 3RBBB 4PFPA 1RLQC 4JZ4A 1K1ZA 3ASKA 2CSIA 3T9NA 3CCMT 2PTKA 2BIVA 4RTUA 5GAOp 3GP8A 3BDUA 3EGXB 4HT9A 2K5FA 2D6FA 3CMEA 4XTUA 1IGUA 3OYGA 2K3BA 2FG0A 4A4EA 1M90U 4ZNXA 3P8HA 2E12A 1Q82C 1S72A 1SSFA 4IIMA 3MEAA 4A4FA 1VQKA 3EH2A 2YT6A 5HKCA 3LH0A 3S6WA 1BI2A 1WDXA 3QHSA 1WYXA 3SFMA 3VS0A 2BZ8A 1EFNA 3S3OA 2K6DA 5IT9E 4QQ6A 2BUDA 3UPUA 3BFMA 1NJIC 8AT1B 4M77C 4QVCA 3QYHB 2LDMA 3H41A 2YDLA 1WX6A 1S1NA 2QQSA 4KGVB 3PT9A 1VQ4A 1M27C 4Q5WA 1WNLA 1UDLA 3QDRB 3JCMb 3CC2Q 1OX8A 3JB9I 2DLPA 2E3IA 3QG1A 3RKXA 2LCLA 2EJGA 1WHKA 2NUTA 3CMAA 4KULA 2HQHA 1WJSA 2VC8A 1YITQ 4GLMA 1QVFS 3M0UA 1VQMA 1GBRA 1KSWA 1AWWA 3OYAA 4JS4A 2WACA 4C92A 1K8AC 2YRVA 4N0AC 3G6ET 2J7IA 1BB9A 4BACA 1EIFA 1JB0E 1ABQA 1QKXA 4J9BA 3EFOA 4JJCA 4FT4A 4TVRA 1LOJA 4E7KA 4DEYA 1FX7A 1JJ2P 2HD0A 4M7AE 2QGFB 5GJWB 4QVZA 2OTLQ 4ZTJA 3V8LA 4XU3A 4AFZC 3VRZA 5CAIA 1RLPC 2Y90A 4A63B 4LD6A 3CCMA 2JS2A 3MP6A 3PGGA 2KRMA 3EH1A 4IURA 4M78B 2MMPA 4ATOA 4F16A 2DD4A 1QVPA 2QTVA 4X34A 3ZFJA 3S3NA 2AIRB 2AHJB 4NS5A 1M1KR 4EPCA 1Z9ZA 5GMKi 3JCMX 2DM1A 1KC8C 1M30A 4F7UA 3CMEQ 4J9IA 5LJ3j 2X4WA 5GAMj 1U1TA 4JJBA 1TSFA 2K2MA 4M7AD 1D1AA 3REBB 4J6WA 4HCCA 4OMNA 2K9GA 5LJ5e 3H8ZA 2B8AA 1S72Q 2YUPA 1QQJA 2VXFA 1VQKQ 4CRIA 2RJEA 1I07A 1GCPA 1YHQQ 1E6HA 3L2VA 2AK5A 3KXTA 2LRQA 1XOVA 4FYYB 5HK3A 2XD0A 3KFVA 2W10A 2VB6A 2LJ0A 1M90R 2K7AA 3QXEB 2XU8A 2JXBA 3CPWA 3PIPA 1W6XA 1WIEA 8ATCB 4PK4A 2JN0A 5GAOr 1X43A 4RTVA 3CCJT 1M1GA 3EFSA 4AFUC 4QQDA 3A98A 3SWNC 3P8BB 1VQ4Q 2JNGA 1W70A 3OW2S 1O75A 3FJ5A 1KK7A 1M2VA 1NPRA 3RIRA 2WSFE 1YJWQ 5GMKl 1FXXA 4DA4A 2D9TA 4E7ZA 3CCUT 3OS1A 4Z02A 4ELYC 3TEEA 1MMDA 3CMAQ 3TVTA 4OGCA 3G6EA 1GXIE 1YI2Q 3CCRT 4M7DC 3VS6A 4N4HA 1W4SA 3JB9H 1AWJA 1VQMQ 1K73U 1MNEA 2QA4T 5GAN6 3A5ZB 2D0NA 4M75G 2BE7D 1YP5A 3CD6Q 2HAXA 1VA7A 4PJOC 4HCKA 1EZZB 1GBQA 1LPLA 3CXCS 2E1HA 4C92E 2AZVA 2PNIA 2KROA 2XDDA 1HXDA 1B7TA 2M1HA 1B3QA 1UB4A 3I5SA 1XNIA 1XJWB 2D8HA 4A53A 3CCMQ 4XTVA 3UATA 2SEMA 4D6WA 3LGLA 2LMJA 3X20B 1OU9A 4C8QA 2EKHA 2QDLA 1VYTA 3QJYA 3CCLT 3R6NA 3JSCA 4ZN3A 1NZ9A 4FW2A 1Q81U 1N6AA 4BE1A 2MWOA 4J6YA 4UC4A 4LXCA 4E7LA 5FWBA 5GAOq 2EGEA 3CQTA 5GAN5 1VQ8T 4C92D 3EG9B 3CBOA 5ECAA 5LJ3g 5GAMg 3OBYA 1JU5C 1OQKA 1KQSA 4BI4A 2FZKB 2CT3A 3M0TA 2QK0A 5A0DA 1WZOA 2K2VA 3VU3C 2MCNA 3CCJA 2EAYA 3EFOB 1PRMC 2DIGA 4WCIA 4DBFA 4J7FA 2I0NA 2KK4A 2KYMA 1LNXA 3SWNB 2HL3A 5FLXE 2ZPEB 5L8RE 1SF9A 2XDBA 2QDYB 2KVQG 3NMZC 3CCUA 3C0CA 1PSEA 1IHVA 1X2KA 4RTXA 2X35A 1IZ6A 3CCRA 1AWOA 4XU1A 2EQMA 1N5ZA 2LCCA 1ZBJA 4AFQC 2EGCA 4OMLA 2DNUA 1QWFA 2QA4A 5GANj 4J9CA 3G6EQ 3OYCA 4J5YA 2MK5A 4LUEA 2HQXA 2A08A 4M75C 2EW3A 5GAN3 2M0YA 4F7UB 3OBWA 3G71T 4PJOB 1R0BG 3RUXA 4BD3A 1IRXA 1Q82R 4J83A 1NPPA 1QVFP 1BI0A 1OV3A 3BDLA 5GAOn 3H0FA 1IXDA 2CUBA 1V29B 2XK0A 3MKDA 3EFRA 3C12A 1UGRB 2LT4A 2DTOA 1JBMA 1VQOT 3HSBA 4NOYA 3LW5E 4DOVA 1NJIR 2LJ1A 3CCLA 1QVGA 2DJZA 2E65A 2CUDA 5KH6A 1RI9A 1U3OA 1LJOA 1MHNA 4JRKA 1NYGA 4JJDA 1VQ8A 3AHUA 1M3AA 2EVRA 1M2VB 1YITT 4C0DC 2K3YA 1YWOA 1IHWA 2DX1A 3P8DA 3ULRB 5GAN8 5DLQE 1M90C 3VUBA 3OY9A 1M1FA 3PMTA 4M78F 1K0SA 1ZA1B 2EFIA 1K8AR 2X9HA 4A4KA 4PL6A 5KYUA 2DBKA 4OMQA 2EIFA 4L59A 1UG1A 4M75E 4LUDA 1K9AA 1HSQA 1D1CA 1SHFA 2Y4YA 1E7OA 2LQNA 5KYYA 5FW9A 1PHTA 1X6GA 2V8KA 2OTJT 3FEOA 5GAOm 2JW4A 3JAME 2COWA 5IAYA 5M9OA 4IUVA 1DJ7B 2FB7A 4M78G 4F14A 4C8QD 1K9MU 1RAAB 2L89A 3CCRQ 4RTYA 2D8JA 2CSQA 1IB8A 2GQVA 4M77F 3G71A 2QA4Q 2CP7A 4XTZA 3OW2P 1RL2A 4FSSA 1OPLA 1KC8R 2YRDA 2RQUA 1WHJA 2LCSA 1VQNQ 1OX9A 2JTFA 2JMAA 4OGEA 4JJNK 3ME9A 5C0MA 1RAFB 4OF1A 5GANg 5HY6A 2OX7A 1YHQT 5IXBA 1KD1U 3JB9F 3KUFA 4ANJA 1VQOA 5J3BA 1WXUA 1D0YA 2M51A 3V7RA 2DXBA 2L3RA 2CGHA 5LJ3h 1BI1A 3CXCP 2VWFA 2QI2A 3A8OB 1WXBA 3CCLQ 1GL5A 2WSEE 1KQ2A 2CT4A 2PVDB 3JCMc 1JRIA 2LX7A 2GCXA 1UTIA 1YJWT 3LH5A 4M7AA 4AG1C 1VQ8Q 2DL3A 1M8MA 2ATCB 1YI2T 4BY6C 3CPWS 3JCMW 2P0PA 1KJWA 2XMFA 1GCQC 2E6ZA 2O31A 3O8VA 1EX4A 1TOVA 3CD6T 3OYLA 3L1AA 1K76A 3LYIA 1YNZA 2F69A 3M54A 1ZSZA 2OTJA 1TH7A 2R5MA 2FRWA 3J80E 3OMGA 1I1JA 2FL7A 1W2BP 2DFUA 4IUTA 2E5KA 4OB2B 1UEBA 3U23A 4M78C 1G3TA 5I22A 1WHGA 3NTKA 3HKSA 5D7UA 4EMKA 4HCBA 2EJ9A 1VQ5T 5FROA 2KRNA 1MV0B 2JS0A 2COYA 4XQ3A 2DMOA 2QQRA 3M57A 3EG0A 5A0GA 1BIBA 4DBRA 4DQ2A 1X6OA 4ME7A 5CKEA 1GRIA 1M2OA 3G71Q 2CP3A 2ZPGB 2YHTA 3S3MA 4N0AA 2JVVA 3SDZA 2EQKA 3HRSA 3GNGA 1GFCA 1YHQA 3OSVA 1VOMA 4XU2A 1N9RA 5LJ3f 1PC0A 5GAMf 1D09B 1I5OB 3AT1B 4C0FA 1K73C 5DM7R 2KBTA 3CCVQ 4ZGEB 2EQJA 1VQOQ 2D0QB 4M7DF 2RM4A 1JJ2A 1YCSB 3OS0A 3JCMQ 3MP1A 4CC4B 4RTWA 2JTEA 2EYXA 5L23A 3I9QA 4J7IA 2ZPFB 1YJWA 4FYVB 3MEWA 1ZHIA 1N27A 4PJOF 3ZEHA 2Z0WA 3GF5A 1MGQA 3JV3A 2DA9A 5CCAA 2DL4A 2QQBA 4IUUA 3PIOA 2BZXA 1YI2A 1G3SA 2ZPBB 3V8JA 1NE8A 1TXQA 2Y4XA 2ROTA 4BY6B 4M78E 4M7DG 1Q7YU 2KGTA 3L42A 2JT4A 3CD6A 2HMAA 3A1PA 2W0ZA 2FZCB 2LJ3A 2CDTA 1WJQA 2QQAA 4E7JA 3CCEQ 4PJOG 3LWIA 4XU0A 1SPKA 5GMKe 1NG2A 1H641 2V1RA 2XI9A 3H0IA 3O5ZA 4LD9K 2LZ6B 1G3YA 1X75C 3HFNA 1JXMA 2OTJQ 1NLOC 4CC2A 3LX7A 3HHTB 1VQ5A 1TTHB 1WI7A 2LC4A 3QZ9B 3V7SA 2CP6A 4LE9A 1TU0B 3MO8A 2RO0A 4M77E 2EYYA 4OMPA 1G8XA 1OOTA 4OMOA 1C0MA 1H3ZA 1MNDA 3J81E 5IXFA 3HFOA 1H92A 1CKAA 1D3BA 2QQ9A 1UFFA 1M5Q1 5AT1B 1AT1B 3TREA 5A2QE 1ARKA 3NPFA 4E7HA 3WXMB 2L3SA 4X1VA 3OYMA 2RHYA 1N8RU 1BCMA 2QASA 3NFCA 4M7AB 1FYNA 1I0CA 3I35A 2GF7A 2DYBA 5CKBA 3M56A 2RK2A 4D8DA 2QXFA 4J6XA 2ZPHB 4FYXB 2R58A 5IN1A 2FYKA 2EPDA 3SB2A 1WJRA 1XTDA 2DD5A 1Q86U 1YFNA 2HNIA 2EYWA 3QDFA 4NL2A 4M77D 3CC7T 2O88A 2RA2A 4NL3A 5LL6S 1KQ1A 5CIUA 2LNHB 2O4XB 4M75F 3RKYA 2V8IA 2L3QA 2XICA 4Y28E 2F2VA 3OYEA 4QT7A 1I81A 2VYTA 1ZSZB 3UWNA 1KG1A 1KHCA 5LJ3d 2DXUA 2XG8D 5GAMd 3E9GA 1OEBA 4HVWA 2DIQA 2PUKB 3JB9D 3THKA 1UGSB 2KT8A 3I55T 3V7CA 3CC4T 3META 4PFZA 3HPWA 3PVQA 1ZUYA 4EMKB 5FU6C 1ABOA 4BUGA 2SRCA 2PUOB 1VQNT 2HDAA 5CQYA 5KYWA 5GANf 3VS5A 4GBQA 1F1BB 2DBMA 5I11A 2V1QA 1JXOA 2X4JA 1T3SA 3RMSA 2F5TX 4J9FA 2FO0A 1TUCA 3CPWP 1VIEA 2DL5A 3MEUA 2P4RA 2ABLA 4QKUA 4DOWA 5GMKh 1OU8A 1UGQB 1VQ5Q 5D6YA 4DBQA 3VYGA 2DAQA 5HK0A 3CBMA 3CPFA 2R57A 1WHLA 3E2UA 4K11A 2MAMA 1NLPC 3RR6A 2WSCE 2XDPA 1I8FA 4KH0B 2EGAA 2RHZA 1D1BA 1H3HA 1Y96A 2RQWA 4ORZA 3VS2A 1K9MC 2RHXA 3WVDB 4M75A 2NUTB 4Z89A 1RAHB 5CO7A 5DLOA 2JM8A 1OULA 3LWHA 1W2BS 3JCMg 1RABB 2C0OA 3H6ZA 4X9DA 4C92B 2P0QA 4M7DE 3BW1A 3CC7A 1YIJT 3DLMA 4II1A 2HL5C 2MI6A 3M5AA 3ER0A 1SG5A 2O2OA 3EG3A 4PJOE 1KD1C 4R0KA 3FJPA 4JZ3A 1AZEA 1QVFA 2C06A 3L2UA 4JUVA 4OMMA 3EHQA 2OI3A 1BYMA 3I55A 3CC4A 1B07A 3JRZA 3M0RA 2GNCA 1B34A 3A8MB 2NUPA 2CZ7B 1K4US 5KE2A 2BE9B 2MPXC 5FU6B 1ZSGA 2O01E 2JTMA 5GAOl 9ATCB 4M7DD 3OYIA 1VQNA 4OVAA 3LLRA 4OP0A 1UGVA 2E6NA 1PKTA 2G6FX 3MCAB 5LJ3e 2EQIA 5GAMe 5KYXA 2RMOA 2CKKA 1TG0A 2IG0A 4FCYA 4LDVA 1RAEB 3CCVT 1SHGA 2LX9A 4EMHA 3M0SA 1K73R 4KBMB 2MF2A 3OYBA 3UA7A 3FDRA 3BE3A 3VJPA 3VS3A 1NEBA 3HP9A 4FL6A 1P92A 4MZMA 3CCQQ 3C4SA 2COZA 2FPEA 2GTOA 2B86A 1SSHA 5GANd 3OYKA 3EGXA 4KT0E 3R6OA 3OA6A 4DEXA 2X51A 3GLXA 2RH2A 3M4YA 1U5SA 1G2BA 3OYNA 1LCKA 1YWPA 3EGDA 1FMWA 2X3WD 3WVEB 2J6FA 1YIJA 4F04B 5KYNA 2J05A 3C95A 3CCST 4L5GA 1M8VA 3PMIA 3EGUA 2RQRA 2YUOA 3VS7A 4J9HA 3RKWA 3DB4A 1Q81R 3CC7Q 3CCET 3OW2A 4HKEA 1AZGB 3ZBDA 2RHIA 1T0HA 2QGGA 3EG2A 1QLYA 1M4ZA 5CK9A 2O9SA 4KUDK 4RUGA 2XHCA 2ZCFB 2H3EB 2RB6A 2ZGWA 1X01A 2JJ9A 2VXEA 4PNOA 1RACB 1HJDA 1OYXA 2KI7A 4BI8B 1WHMA 2GGRA 3CBPA 4FW1A 2M02A 2L8DA 2K57A 3I55Q 3CC4Q 2DXTA 2L0AA 3X26B 4PKCC 2M9UA 4C8QB 2EYQA 3C94A 3CXCA 4RTZA 2CH4A 2LQKA 2RD1A 4M75D 1VQPT 4PFOA 2NYSA 4J9GA 3OSSC 1AD5A 4XTXA 5A0LA 1Q7YC 3OYJA 3CCVA 2XKOC 4AMCA 4A4GA 2LQWA 2PVGB 4JRPA 2X4XA 1MMAA 1ZLMA 1VQ7T 2LTOA 1HD3A 1UUEA 4CC7A 1FMKA 5GAMh 5C6SA 2CH4W 2ED1A 2DRKA 2A36A 2MWPA 1WFWA 2F5KA 2KXDA 4M78A 2HKNA 1IREB 2DVJA 4E2FB 2PU9B 4X9CA 3FC3A 4E7SA 1JQQA 4IKFA 1TUDA 1BCOA 1Y07A 3UA6A 5J26A 2FZGB 2YSQA 3L2RA 1VQLT 5CVIA 4GLKA 2GTJA 5LJ5j 1I4K1 2C0TA 1YN8A 4ZTFA 5EG2A 3CCSA 3EAEA 4HA8A 2HEQA 1B34B 3JCMJ 2H3JA 3L2WA 2KR3A 2KQWA 2QAZA 2R5AA 2HCKA 2EWNA 4ELZC 3CCEA 1YIJQ 1G5VA 2L5QA 2QG9B 5GANe 1C1AA 1N8RC 2GFAA 1UECA 4M77A 1TUGB 5AYFA 1OI1A 1ZA2B 2AKLA 3H0HA 2EQUA 4JLIA 1PCXA 2HZYA 3GBQA 2F1LA 3X25B 2DE0X 2YXYA 3L2ZA 1Q86C 2RF0A 3VKIA 2FVUA 1M1KU 1KIKA 2A28A 4FSXA 1QKWA 4MDXA 4Z8AA 1VQ9T 2DXCA 2DEQA 3JCMV 3VS4A 3VYHB 1BKBA 5I2SA 2JOYA 5KCOA 1QW1A 2HSPA 2E70A 1SKUB 4OMFB 4V2SA 3QSUA 4B6MA 2CYZB 3H9NA 1VQPA 2BKDN 1PG5B 2KYBA 2DZCA 2O9VA 4LNPA 3GPLA 1OPKA 4BB7A 1M3BA 1C6VX 4M7AC 1AOJA 3JCMf 3OYFA 1K9MR 3QUIA 2CS7A 4JRIA 2VUBA 3EGDB 1VQ7A 1G83A 2MOXA 3JB9J 4C92G 4KH1B 2KT1A 1ZUUA 2FRYA 4P5NA 2HBWA 4LDXA 3MJXA 1XQHA 1RAGB 5KYUB 1W1FA 1CSKA 3PFSA 4YTLA 2IPOB 4F17A 1YBYA 2P4TA 3HRUA 4F7UF 5KYYB 1VQLA 2L3PA 4JPBW 1PM3A 1KD1R 1ZSZC 4OB0B 2DK3A 4KRTA 5D6XA 3LGFA 1KQSS 4J9DA 1PD1A 1UHCA 4FU6A 4C5EA 4O5VA 2E64A 5FU7B 1T0JA 5GAN4 2KEAA 5I2MA 2GBQA 1MUZA 5GAN7 4EMKC 4BDZA 1E6GA 2HKQB 1Q81C 3CCSQ 1G3WA 4KGXB 2NUZA 3EG9A 2CP5A 2PVOB 1WA7A 4F7UG 4ZGDB 4O6JA 1YJ9T 2MYSA 5LJ5g 2OAUA 1V1CA 1NM7A 4HVUA 1PD0A 2ZZDA 4XAXB 3M0PA 1T3LA 1TWBA 2L2PA 4GY5A 4CI0C 4C0GA 2DYIA 1HYOA 1VQ9A 1JO8A 2BZYA 2DZ9A 1PNJA 4PJJA 3SWNA 1AEYA 5GANh 4MDWA 3OYDA 3I56T 3DKMA 3RNJA 4M78D 1UHFA
chains in the Genus database with same CATH topology
2RNAA 2DX1A 4M4ZA 1H3HA 3ULRB 1H8KA 2RQWA 2ROLA 2KNBB 4ORZA 3VS2A 1U06A 2MIOA 2DF6A 2GQIA 1K0SA 1X6BA 4Z89A 1AWXA 2DBKA 4OMQA 2JM8A 1UG1A 1NYFA 4CC3A 3RBBB 2C0OA 4LUDA 1RLQC 4JZ4A 1K1ZA 1K9AA 2CSIA 1HSQA 1SHFA 4RTTA 2PTKA 1E7OA 2LQNA 5FW9A 3ZL7C 1PHTA 1X6GA 4RTUA 2A37A 2JW4A 2K3BA 2O2OA 1QWEA 3EG3A 2FG0A 4R0KA 4F14A 3REAB 4JZ3A 1AZEA 4ZNXA 4OMMA 2D8JA 4IIMA 4RTYA 2CSQA 3EHQA 2OI3A 1B07A 2YT6A 1BK2A 3M0RA 2GNCA 4FSSA 1OPLA 4E6RA 1WDXA 2ENMA 1WYXA 1ZX6A 2RQUA 3VS0A 2BZ8A 1K4US 2D1XA 2LCSA 1EFNA 1ZSGA 2J06A 2JMAA 2K6DA 2KE9A 2C0IA 4D8KA 3H41A 1UGVA 2ED0A 2YDLA 1PKTA 5IXBA 1WX6A 1S1NA 2G6FX 3SEMA 2LP5A 3EG1A 1QCFA 2EQIA 1WXUA 2RMOA 2M51A 1M27C 2RQTA 1UDLA 1TG0A 2DLPA 1SHGA 2VWFA 2KXCA 1UJYA 3M0SA 1WXBA 2RPNA 3UA7A 1GL5A 2CT4A 2X3XD 4GLMA 3VS3A 3M0UA 1GBRA 1KSWA 1NEBA 2LX7A 2RQVA 1AWWA 1UTIA 1SRMA 1Z9QA 1VYVA 3LH5A 2NWMA 2J7IA 2FPEA 1BB9A 2GTOA 4AG1C 2B86A 1ABQA 1QKXA 4J9BA 1SSHA 2DL3A 5FWCA 1M8MA 4JJCA 1ZUKA 1BU1A 5IH2A 4DEYA 3I5RA 4DEXA 5GJWB 1KFZA 1SRLA 1VYUA 1U5SA 3PE0A 1G2BA 1PRLC 1KJWA 2XMFA 5IHKA 4AFZC 1GCQC 2O31A 3VRZA 1LCKA 1YWPA 1JEGA 1RLPC 2X3WD 2J6FA 2FEIA 4A63B 2J05A 1K76A 3TSZA 2JS2A 1RUWA 2KRMA 1UE9A 1YNZA 4F16A 3EGUA 2RQRA 2YUOA 3SHWA 3VS7A 4J9HA 2FRWA 2EYZA 1I1JA 1AZGB 1Z9ZA 2E5KA 3UF4A 1T0HA 2DM1A 3EG2A 3U23A 1M30A 5I22A 1QLYA 2O9SA 4RUGA 4J9IA 4JJBA 1K0XA 2K2MA 2KRNA 3REBB 2JS0A 1MV0B 2CREA 3VRYA 1HJDA 1X2QA 4OMNA 2K9GA 2DMOA 2GGRA 3EG0A 4J9EA 2YUPA 1GRIA 1I07A 1GCPA 2L0AA 3VS1A 1E6HA 2AK5A 3QWXX 3IQLA 1GFCA 1XOVA 3KFVA 4RTZA 2CH4A 2W10A 2DRMA 2JMCA 2LJ0A 2K7AA 2JXBA 1W6XA 2KBTA 1WIEA 4J9GA 2DJQA 1X43A 4RTVA 2J6KA 4AFUC 1AD5A 2IIMA 3EHRA 3A98A 1PWTA 1W70A 3FJ5A 5GJVB 2LQWA 4ESRA 1YCSB 4CC4B 4RTWA 2JTEA 2EYXA 1ZLMA 1HD3A 1UUEA 5L23A 3I9QA 1X27A 2KRSA 4CC7A 1A0NB 1FMKA 3TVTA 2CH4W 2ED1A 2DRKA 2A36A 3VS6A 3JV3A 1UJ0A 1AWJA 1WFWA 2KXDA 2DA9A 2DL4A 2BZXA 1MV3A 2DVJA 2D0NA 2ROTA 1YP5A 1JQQA 1TUDA 2KGTA 1VA7A 2JT4A 4HCKA 3UA6A 2YSQA 1GBQA 2ECZA 2GTJA 2C0TA 1YN8A 2AZVA 2PNIA 2KROA 2W0ZA 2LJ3A 2CDTA 2EBPA 2HEQA 1B3QA 2KR3A 1SPKA 3I5SA 4AG2C 2D8HA 1NG2A 2V1RA 2HCKA 3H0IA 3O5ZA 3UATA 2LZ6B 3M0QA 3NHNA 2SEMA 1JXMA 2LMJA 1UECA 4HXJA 2EKHA 2QDLA 1NLOC 1VYTA 4CC2A 2AKLA 3H0HA 1PKSA 3R6NA 1AVZC 1WI7A 2DL8A 4LN2A 3GBQA 4LE9A 1NEGA 2DE0X 2EYYA 4OMPA 2F2WA 1J3TA 2RF0A 1OOTA 1KIKA 5FWBA 2A28A 1QKWA 4OMOA 4Z8AA 2EGEA 1X69A 3CQTA 3VS4A 5IXFA 1H92A 1CKAA 5ECAA 1UFFA 2ESWA 2HSPA 1JU5C 1ARKA 3NPFA 1GFDA 2DILA 2CT3A 2L3SA 3QWYA 4X1VA 3M0TA 2J6OA 1FYNA 1I0CA 3I35A 2KYBA 2MCNA 2DYBA 3PVLA 1CKBA 1M3CA 1PRMC 4D8DA 5EC7A 4WCIA 2I0NA 2EPDA 5IHNA 2KYMA 2O9VA 4LNPA 1OPKA 2BTTA 1M3BA 4Z88A 1Y0MA 2EYWA 1AOJA 3NMZC 2O88A 2DL7A 1G83A 2MOXA 1GCQA 3C0CA 2LNHB 1X2KA 4RTXA 2KT1A 1ZUUA 2L3QA 2FRYA 2FPDA 1AWOA 2HBWA 2F2VA 2JM9A 1N5ZA 4QT7A 2AKKA 1ZBJA 1W1FA 1CSKA 4IIOA 4AFQC 2EGCA 4OMLA 2DNUA 1QWFA 4J9CA 1OEBA 2K79A 4HVWA 4LUEA 4F17A 1SEMA 3THKA 4AFSC 2A08A 2EW3A 2KT8A 2OAWA 2M0YA 2L3PA 4JPBW 2PZ1A 4KRTA 3PVQA 1ZUYA 4J9DA 1UHCA 1BBZA 1ABOA 1IO6A 1OV3A 4HVVA 2VKNA 2SRCA 1T0JA 2HDAA 3H0FA 2KEAA 5IHIA 2GBQA 3VS5A 1MUZA 2CUBA 4GBQA 2DBMA 1E6GA 1WLPB 2AZSA 5I11A 2V1QA 1JXOA 2H8HA 1T3SA 2NUZA 4J9FA 2YUQA 2FO0A 1TUCA 1WA7A 2F2XA 2DL5A 2OJ2A 4Y92A 2P4RA 2LJ1A 1Y57A 1V1CA 1NM7A 5HCKA 4HVUA 3TSWA 2FPFA 3M0PA 1T3LA 2ABLA 2CUDA 3NGPA 1RI9A 1U3OA 2L2PA 2YUNA 4EIKA 2VVKA 2RN8A 1JO8A 1NYGA 4JJDA 2BZYA 1M3AA 1PNJA 1WXTA 1AEYA 4K11A 2EVRA 1NLPC 3RNJA 1UHFA 1YWOA 2EGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNA A;  2DX1 A;  4M4Z A;  1H3H A;  3ULR B;  1H8K A;  2RQW A;  2ROL A;  2KNB B;  4ORZ A;  3VS2 A;  1U06 A;  2MIO A;  2DF6 A;  2GQI A;  1K0S A;  1X6B A;  4Z89 A;  1AWX A;  2DBK A;  4OMQ A;  2JM8 A;  1UG1 A;  1NYF A;  4CC3 A;  3RBB B;  2C0O A;  4LUD A;  1RLQ C;  4JZ4 A;  1K1Z A;  1K9A A;  2CSI A;  1HSQ A;  1SHF A;  4RTT A;  2PTK A;  1E7O A;  2LQN A;  5FW9 A;  3ZL7 C;  1PHT A;  1X6G A;  4RTU A;  2A37 A;  2JW4 A;  2K3B A;  2O2O A;  1QWE A;  3EG3 A;  2FG0 A;  4R0K A;  4F14 A;  3REA B;  4JZ3 A;  1AZE A;  4ZNX A;  4OMM A;  2D8J A;  4IIM A;  4RTY A;  2CSQ A;  3EHQ A;  2OI3 A;  1B07 A;  2YT6 A;  1BK2 A;  3M0R A;  2GNC A;  4FSS A;  1OPL A;  4E6R A;  1WDX A;  2ENM A;  1WYX A;  1ZX6 A;  2RQU A;  3VS0 A;  2BZ8 A;  1K4U S;  2D1X A;  2LCS A;  1EFN A;  1ZSG A;  2J06 A;  2JMA A;  2K6D A;  2KE9 A;  2C0I A;  4D8K A;  3H41 A;  1UGV A;  2ED0 A;  2YDL A;  1PKT A;  5IXB A;  1WX6 A;  1S1N A;  2G6F X;  3SEM A;  2LP5 A;  3EG1 A;  1QCF A;  2EQI A;  1WXU A;  2RMO A;  2M51 A;  1M27 C;  2RQT A;  1UDL A;  1TG0 A;  2DLP A;  1SHG A;  2VWF A;  2KXC A;  1UJY A;  3M0S A;  1WXB A;  2RPN A;  3UA7 A;  1GL5 A;  2CT4 A;  2X3X D;  4GLM A;  3VS3 A;  3M0U A;  1GBR A;  1KSW A;  1NEB A;  2LX7 A;  2RQV A;  1AWW A;  1UTI A;  1SRM A;  1Z9Q A;  1VYV A;  3LH5 A;  2NWM A;  2J7I A;  2FPE A;  1BB9 A;  2GTO A;  4AG1 C;  2B86 A;  1ABQ A;  1QKX A;  4J9B A;  1SSH A;  2DL3 A;  5FWC A;  1M8M A;  4JJC A;  1ZUK A;  1BU1 A;  5IH2 A;  4DEY A;  3I5R A;  4DEX A;  5GJW B;  1KFZ A;  1SRL A;  1VYU A;  1U5S A;  3PE0 A;  1G2B A;  1PRL C;  1KJW A;  2XMF A;  5IHK A;  4AFZ C;  1GCQ C;  2O31 A;  3VRZ A;  1LCK A;  1YWP A;  1JEG A;  1RLP C;  2X3W D;  2J6F A;  2FEI A;  4A63 B;  2J05 A;  1K76 A;  3TSZ A;  2JS2 A;  1RUW A;  2KRM A;  1UE9 A;  1YNZ A;  4F16 A;  3EGU A;  2RQR A;  2YUO A;  3SHW A;  3VS7 A;  4J9H A;  2FRW A;  2EYZ A;  1I1J A;  1AZG B;  1Z9Z A;  2E5K A;  3UF4 A;  1T0H A;  2DM1 A;  3EG2 A;  3U23 A;  1M30 A;  5I22 A;  1QLY A;  2O9S A;  4RUG A;  4J9I A;  4JJB A;  1K0X A;  2K2M A;  2KRN A;  3REB B;  2JS0 A;  1MV0 B;  2CRE A;  3VRY A;  1HJD A;  1X2Q A;  4OMN A;  2K9G A;  2DMO A;  2GGR A;  3EG0 A;  4J9E A;  2YUP A;  1GRI A;  1I07 A;  1GCP A;  2L0A A;  3VS1 A;  1E6H A;  2AK5 A;  3QWX X;  3IQL A;  1GFC A;  1XOV A;  3KFV A;  4RTZ A;  2CH4 A;  2W10 A;  2DRM A;  2JMC A;  2LJ0 A;  2K7A A;  2JXB A;  1W6X A;  2KBT A;  1WIE A;  4J9G A;  2DJQ A;  1X43 A;  4RTV A;  2J6K A;  4AFU C;  1AD5 A;  2IIM A;  3EHR A;  3A98 A;  1PWT A;  1W70 A;  3FJ5 A;  5GJV B;  2LQW A;  4ESR A;  1YCS B;  4CC4 B;  4RTW A;  2JTE A;  2EYX A;  1ZLM A;  1HD3 A;  1UUE A;  5L23 A;  3I9Q A;  1X27 A;  2KRS A;  4CC7 A;  1A0N B;  1FMK A;  3TVT A;  2CH4 W;  2ED1 A;  2DRK A;  2A36 A;  3VS6 A;  3JV3 A;  1UJ0 A;  1AWJ A;  1WFW A;  2KXD A;  2DA9 A;  2DL4 A;  2BZX A;  1MV3 A;  2DVJ A;  2D0N A;  2ROT A;  1YP5 A;  1JQQ A;  1TUD A;  2KGT A;  1VA7 A;  2JT4 A;  4HCK A;  3UA6 A;  2YSQ A;  1GBQ A;  2ECZ A;  2GTJ A;  2C0T A;  1YN8 A;  2AZV A;  2PNI A;  2KRO A;  2W0Z A;  2LJ3 A;  2CDT A;  2EBP A;  2HEQ A;  1B3Q A;  2KR3 A;  1SPK A;  3I5S A;  4AG2 C;  2D8H A;  1NG2 A;  2V1R A;  2HCK A;  3H0I A;  3O5Z A;  3UAT A;  2LZ6 B;  3M0Q A;  3NHN A;  2SEM A;  1JXM A;  2LMJ A;  1UEC A;  4HXJ A;  2EKH A;  2QDL A;  1NLO C;  1VYT A;  4CC2 A;  2AKL A;  3H0H A;  1PKS A;  3R6N A;  1AVZ C;  1WI7 A;  2DL8 A;  4LN2 A;  3GBQ A;  4LE9 A;  1NEG A;  2DE0 X;  2EYY A;  4OMP A;  2F2W A;  1J3T A;  2RF0 A;  1OOT A;  1KIK A;  5FWB A;  2A28 A;  1QKW A;  4OMO A;  4Z8A A;  2EGE A;  1X69 A;  3CQT A;  3VS4 A;  5IXF A;  1H92 A;  1CKA A;  5ECA A;  1UFF A;  2ESW A;  2HSP A;  1JU5 C;  1ARK A;  3NPF A;  1GFD A;  2DIL A;  2CT3 A;  2L3S A;  3QWY A;  4X1V A;  3M0T A;  2J6O A;  1FYN A;  1I0C A;  3I35 A;  2KYB A;  2MCN A;  2DYB A;  3PVL A;  1CKB A;  1M3C A;  1PRM C;  4D8D A;  5EC7 A;  4WCI A;  2I0N A;  2EPD A;  5IHN A;  2KYM A;  2O9V A;  4LNP A;  1OPK A;  2BTT A;  1M3B A;  4Z88 A;  1Y0M A;  2EYW A;  1AOJ A;  3NMZ C;  2O88 A;  2DL7 A;  1G83 A;  2MOX A;  1GCQ A;  3C0C A;  2LNH B;  1X2K A;  4RTX A;  2KT1 A;  1ZUU A;  2L3Q A;  2FRY A;  2FPD A;  1AWO A;  2HBW A;  2F2V A;  2JM9 A;  1N5Z A;  4QT7 A;  2AKK A;  1ZBJ A;  1W1F A;  1CSK A;  4IIO A;  4AFQ C;  2EGC A;  4OML A;  2DNU A;  1QWF A;  4J9C A;  1OEB A;  2K79 A;  4HVW A;  4LUE A;  4F17 A;  1SEM A;  3THK A;  4AFS C;  2A08 A;  2EW3 A;  2KT8 A;  2OAW A;  2M0Y A;  2L3P A;  4JPB W;  2PZ1 A;  4KRT A;  3PVQ A;  1ZUY A;  4J9D A;  1UHC A;  1BBZ A;  1ABO A;  1IO6 A;  1OV3 A;  4HVV A;  2VKN A;  2SRC A;  1T0J A;  2HDA A;  3H0F A;  2KEA A;  5IHI A;  2GBQ A;  3VS5 A;  1MUZ A;  2CUB A;  4GBQ A;  2DBM A;  1E6G A;  1WLP B;  2AZS A;  5I11 A;  2V1Q A;  1JXO A;  2H8H A;  1T3S A;  2NUZ A;  4J9F A;  2YUQ A;  2FO0 A;  1TUC A;  1WA7 A;  2F2X A;  2DL5 A;  2OJ2 A;  4Y92 A;  2P4R A;  2LJ1 A;  1Y57 A;  1V1C A;  1NM7 A;  5HCK A;  4HVU A;  3TSW A;  2FPF A;  3M0P A;  1T3L A;  2ABL A;  2CUD A;  3NGP A;  1RI9 A;  1U3O A;  2L2P A;  2YUN A;  4EIK A;  2VVK A;  2RN8 A;  1JO8 A;  1NYG A;  4JJD A;  2BZY A;  1M3A A;  1PNJ A;  1WXT A;  1AEY A;  4K11 A;  2EVR A;  1NLP C;  3RNJ A;  1UHF A;  1YWO A;  2EGA A; 
#chains in the Genus database with same CATH topology
 4M4Z A;  3OS5 A;  3CCQ T;  3E1S A;  2MIO A;  3CEY A;  2DF6 A;  1YJN T;  1X6B A;  1FWZ A;  4FM4 B;  5D6W A;  4E47 A;  4M7D A;  1AWX A;  3MEV A;  1VQP Q;  4FYW B;  2KAF A;  2G3R A;  3VUZ A;  1FMV A;  1AHJ B;  4MMK A;  4RTT A;  4BDY A;  3ZL7 C;  3PNW C;  4PJO A;  1ACM B;  2DER A;  4WTO B;  1BIA A;  4R55 A;  2A37 A;  1QVG S;  2HBP A;  3NTH A;  4C92 C;  3A8H B;  1QWE A;  1RAD B;  3PTA A;  1VQ7 Q;  3J7A F;  3REA B;  4RCC A;  5CKF A;  1VIF A;  1ZBX A;  1QCN A;  4IUQ A;  4RCB A;  4LDU A;  4B9W A;  2VV5 A;  4C8Q F;  2DTI A;  2YRC A;  1BK2 A;  4M77 B;  4E6R A;  2ENM A;  2DKG A;  1ZX6 A;  2D1X A;  2J06 A;  3GOX A;  2KE9 A;  4BE2 A;  1VQL Q;  2C0I A;  1TS9 A;  3JCM d;  1D0Z A;  4D8K A;  1WQW A;  3F70 A;  4RKU E;  2KY9 A;  1QP3 A;  1PSF A;  2E4H A;  3DB3 A;  3M55 A;  4B9X A;  2ED0 A;  4RMO A;  3L2Q A;  1MMG A;  2HSE B;  7AT1 B;  3SEM A;  2LP5 A;  3EG1 A;  1QCF A;  2QTX A;  4C8Q G;  2E41 A;  1YJ9 A;  1Q82 U;  1VQ6 T;  3E9F A;  2RQT A;  2DTH A;  2V8J A;  4BI3 A;  4EDU A;  1NBE B;  4PJL A;  4Y91 A;  4QVD A;  4OB1 B;  2JUF A;  4C5H A;  2KXC A;  1UJY A;  2RI5 A;  2RPN A;  2RI2 A;  2CZ1 B;  4HT8 A;  2X3X D;  4KUI A;  3I56 A;  2RQV A;  1Q7Y R;  1NJI U;  2GFU A;  2RI3 A;  1SRM A;  1Z9Q A;  1VYV A;  1QCO A;  2NWM A;  1VQ9 Q;  3V8K A;  4PLI A;  5FWC A;  2QEX T;  1ZUK A;  4LDW A;  3CCQ A;  1BU1 A;  5IH2 A;  1V76 A;  3I5R A;  1YJN A;  1KFZ A;  2EKO A;  1SRL A;  1VYU A;  2DPP B;  3PE0 A;  1PRL C;  3VV0 A;  5IHK A;  2M0O A;  1JEG A;  4E7I A;  1O9S A;  1WPY A;  3G4S T;  1RI0 A;  2FEI A;  2LT1 A;  3TSZ A;  4FT2 A;  2HQE A;  1RUW A;  4N4I A;  1M9S A;  1UE9 A;  3SHW A;  2LVM A;  1K8A U;  2EYZ A;  3GIB A;  5I21 A;  3UF4 A;  1U8R A;  4PJM A;  1Y7X A;  3A8G B;  3MHX A;  3OB9 A;  3G1J A;  4JS5 A;  1K0X A;  2CRE A;  3VRY A;  1X2Q A;  4F7U E;  3TCJ A;  2RK1 A;  1HK9 A;  2A3L A;  3X24 B;  3QBY A;  4J9E A;  1N8R R;  3QII A;  3NTI A;  5LJ5 h;  2IVW A;  3VS1 A;  3QWX X;  3A8L B;  3IQL A;  4MZT A;  5GMK m;  1ZQ1 A;  3KBG A;  1Q86 R;  2P0K A;  2A7Y A;  2ZAE A;  1QP2 A;  3HRT A;  4JLG A;  2DRM A;  2JMC A;  5CQX A;  1KC8 U;  5FRN A;  3QZ5 B;  3HL8 A;  1VQ6 A;  2DVE A;  3TU4 K;  2DJQ A;  4KGZ B;  4BE0 A;  1VUB A;  2NLU A;  4C8Q C;  2J6K A;  2IIM A;  3EHR A;  4HCZ A;  4RG2 A;  1WHH A;  1YJ9 Q;  1PWT A;  1D3B B;  1KQS P;  5GJV B;  4M7D B;  4ESR A;  4LDY A;  3GNF B;  3FIF A;  4RG8 A;  4PJO D;  3OYY A;  2CZ0 B;  3JCM e;  2E3H A;  2DEU A;  1X27 A;  2KRS A;  4IUP A;  4OB3 B;  2AT1 B;  1A0N B;  4PJN A;  3MPU B;  3RDV A;  5CKH A;  3OMC A;  1UGP B;  1UJ0 A;  3URG A;  4JDS A;  2QEX A;  3I56 Q;  1MV3 A;  5CR2 A;  2YWW A;  6AT1 B;  2LNV A;  1WQ7 A;  3RES A;  3BY7 A;  4QW2 A;  1U1S A;  3E19 A;  4JRQ A;  4A4H A;  2ECZ A;  5KCH A;  1YJN Q;  2PQW A;  3G4S A;  2M16 A;  2I2L A;  1M1K C;  1D0X A;  3M59 A;  4R56 A;  2ZPI B;  2EBP A;  1R0C B;  4DBH A;  2JZ2 A;  4AG2 C;  3M4G A;  4C5G A;  3M0Q A;  4ZGJ B;  4AT1 B;  3NHN A;  1R77 A;  3CC2 T;  2YLB A;  1JJ2 S;  4C0Z A;  4HXJ A;  2LQ8 A;  3UDC A;  2P84 A;  3QPH A;  1PKS A;  5LJ5 f;  1AVZ C;  2DL8 A;  2K3X A;  4XTW A;  1OZ3 A;  2CP0 A;  4LN2 A;  4WF2 A;  1Q95 G;  4C8Q E;  5KE3 A;  1NEG A;  5GAN 2;  3MP8 A;  2F2W A;  1J3T A;  1Y71 A;  2V26 A;  5KYW B;  3M9Q A;  4N4G A;  1X69 A;  2KMT A;  4A54 A;  3QKJ A;  1YCY A;  1QVG P;  2ESW A;  2KSS A;  3N5B B;  1GFD A;  5CKD A;  2DIL A;  2OTL T;  2KDS A;  1IGQ A;  4MML A;  3CCJ Q;  3QWY A;  4M7A F;  4VUB A;  1I5L A;  2J6O A;  1BI3 A;  3FRN A;  2DET A;  2RJC A;  3PVL A;  1CKB A;  1MMN A;  2YLC A;  1M3C A;  2K5I A;  2E5Q A;  1KHI A;  5EC7 A;  4ZN1 A;  2K5L A;  5IHN A;  2BTT A;  1VQ6 Q;  4Z88 A;  3CCU Q;  1Y0M A;  2RJD A;  3SD4 A;  2QYZ A;  2X4Y A;  2DL7 A;  3QYG B;  3TQ7 P;  1Y96 B;  1GCQ A;  4M7A G;  4XK8 E;  5GMK j;  4M75 B;  3CME T;  2FPD A;  2JM9 A;  3FLG A;  3OQ5 A;  2AKK A;  3UT1 A;  4IIO A;  4FIB A;  2K79 A;  1S72 T;  1SEM A;  2FHD A;  4AFS C;  1VQK T;  2QEX Q;  2CZ6 B;  5J39 A;  2OAW A;  3JCM h;  2PZ1 A;  3OYH A;  1WGS A;  4XTY A;  3QJ6 A;  1BBZ A;  2RJF A;  3FB9 A;  4M77 G;  1IO6 A;  4J8O A;  4HVV A;  2VAS A;  2VKN A;  3QO3 A;  1RAI B;  3RER A;  3G4S Q;  5IHI A;  1W2B A;  3G7Z A;  1WLP B;  2AZS A;  5FRM A;  3Q1J A;  2H8H A;  3CC2 A;  1LVK A;  1VQ4 T;  2YUQ A;  2F2X A;  4Y92 A;  2OJ2 A;  5FU7 C;  3INZ A;  2CP2 A;  1OZ2 A;  3OS2 A;  2NUP B;  2XID A;  1Y57 A;  3D7S B;  1QMC A;  3JB9 G;  5HCK A;  1YIT A;  3TSW A;  2FPF A;  2VGN A;  2VGM A;  5DY9 A;  4C0D B;  3NGP A;  3M58 A;  4C5I A;  3CMA T;  2K4Y A;  4PLL A;  4L6V 5;  2A0F B;  2RHU A;  2YUN A;  4EIK A;  2VVK A;  2RN8 A;  4EMG A;  1VQM T;  1WXT A;  4MZP A;  2EJF A;  5KYX B;  1N9S A;  1R8O B;  2E10 A;  3M53 A;  3JCM P;  2OTL A;  2RNA A;  3DLL A;  3HTR A;  3X28 B;  1H8K A;  2ROL A;  2O4X A;  2KNB B;  2DO3 A;  1U06 A;  2GQI A;  4QQG A;  1NYF A;  3RMQ A;  4C92 F;  4CC3 A;  5LJ5 d;  3RBB B;  4PFP A;  1RLQ C;  4JZ4 A;  1K1Z A;  3ASK A;  2CSI A;  3T9N A;  3CCM T;  2PTK A;  2BIV A;  4RTU A;  5GAO p;  3GP8 A;  3BDU A;  3EGX B;  4HT9 A;  2K5F A;  2D6F A;  3CME A;  4XTU A;  1IGU A;  3OYG A;  2K3B A;  2FG0 A;  4A4E A;  1M90 U;  4ZNX A;  3P8H A;  2E12 A;  1Q82 C;  1S72 A;  1SSF A;  4IIM A;  3MEA A;  4A4F A;  1VQK A;  3EH2 A;  2YT6 A;  5HKC A;  3LH0 A;  3S6W A;  1BI2 A;  1WDX A;  3QHS A;  1WYX A;  3SFM A;  3VS0 A;  2BZ8 A;  1EFN A;  3S3O A;  2K6D A;  5IT9 E;  4QQ6 A;  2BUD A;  3UPU A;  3BFM A;  1NJI C;  8AT1 B;  4M77 C;  4QVC A;  3QYH B;  2LDM A;  3H41 A;  2YDL A;  1WX6 A;  1S1N A;  2QQS A;  4KGV B;  3PT9 A;  1VQ4 A;  1M27 C;  4Q5W A;  1WNL A;  1UDL A;  3QDR B;  3JCM b;  3CC2 Q;  1OX8 A;  3JB9 I;  2DLP A;  2E3I A;  3QG1 A;  3RKX A;  2LCL A;  2EJG A;  1WHK A;  2NUT A;  3CMA A;  4KUL A;  2HQH A;  1WJS A;  2VC8 A;  1YIT Q;  4GLM A;  1QVF S;  3M0U A;  1VQM A;  1GBR A;  1KSW A;  1AWW A;  3OYA A;  4JS4 A;  2WAC A;  4C92 A;  1K8A C;  2YRV A;  4N0A C;  3G6E T;  2J7I A;  1BB9 A;  4BAC A;  1EIF A;  1JB0 E;  1ABQ A;  1QKX A;  4J9B A;  3EFO A;  4JJC A;  4FT4 A;  4TVR A;  1LOJ A;  4E7K A;  4DEY A;  1FX7 A;  1JJ2 P;  2HD0 A;  4M7A E;  2QGF B;  5GJW B;  4QVZ A;  2OTL Q;  4ZTJ A;  3V8L A;  4XU3 A;  4AFZ C;  3VRZ A;  5CAI A;  1RLP C;  2Y90 A;  4A63 B;  4LD6 A;  3CCM A;  2JS2 A;  3MP6 A;  3PGG A;  2KRM A;  3EH1 A;  4IUR A;  4M78 B;  2MMP A;  4ATO A;  4F16 A;  2DD4 A;  1QVP A;  2QTV A;  4X34 A;  3ZFJ A;  3S3N A;  2AIR B;  2AHJ B;  4NS5 A;  1M1K R;  4EPC A;  1Z9Z A;  5GMK i;  3JCM X;  2DM1 A;  1KC8 C;  1M30 A;  4F7U A;  3CME Q;  4J9I A;  5LJ3 j;  2X4W A;  5GAM j;  1U1T A;  4JJB A;  1TSF A;  2K2M A;  4M7A D;  1D1A A;  3REB B;  4J6W A;  4HCC A;  4OMN A;  2K9G A;  5LJ5 e;  3H8Z A;  2B8A A;  1S72 Q;  2YUP A;  1QQJ A;  2VXF A;  1VQK Q;  4CRI A;  2RJE A;  1I07 A;  1GCP A;  1YHQ Q;  1E6H A;  3L2V A;  2AK5 A;  3KXT A;  2LRQ A;  1XOV A;  4FYY B;  5HK3 A;  2XD0 A;  3KFV A;  2W10 A;  2VB6 A;  2LJ0 A;  1M90 R;  2K7A A;  3QXE B;  2XU8 A;  2JXB A;  3CPW A;  3PIP A;  1W6X A;  1WIE A;  8ATC B;  4PK4 A;  2JN0 A;  5GAO r;  1X43 A;  4RTV A;  3CCJ T;  1M1G A;  3EFS A;  4AFU C;  4QQD A;  3A98 A;  3SWN C;  3P8B B;  1VQ4 Q;  2JNG A;  1W70 A;  3OW2 S;  1O75 A;  3FJ5 A;  1KK7 A;  1M2V A;  1NPR A;  3RIR A;  2WSF E;  1YJW Q;  5GMK l;  1FXX A;  4DA4 A;  2D9T A;  4E7Z A;  3CCU T;  3OS1 A;  4Z02 A;  4ELY C;  3TEE A;  1MMD A;  3CMA Q;  3TVT A;  4OGC A;  3G6E A;  1GXI E;  1YI2 Q;  3CCR T;  4M7D C;  3VS6 A;  4N4H A;  1W4S A;  3JB9 H;  1AWJ A;  1VQM Q;  1K73 U;  1MNE A;  2QA4 T;  5GAN 6;  3A5Z B;  2D0N A;  4M75 G;  2BE7 D;  1YP5 A;  3CD6 Q;  2HAX A;  1VA7 A;  4PJO C;  4HCK A;  1EZZ B;  1GBQ A;  1LPL A;  3CXC S;  2E1H A;  4C92 E;  2AZV A;  2PNI A;  2KRO A;  2XDD A;  1HXD A;  1B7T A;  2M1H A;  1B3Q A;  1UB4 A;  3I5S A;  1XNI A;  1XJW B;  2D8H A;  4A53 A;  3CCM Q;  4XTV A;  3UAT A;  2SEM A;  4D6W A;  3LGL A;  2LMJ A;  3X20 B;  1OU9 A;  4C8Q A;  2EKH A;  2QDL A;  1VYT A;  3QJY A;  3CCL T;  3R6N A;  3JSC A;  4ZN3 A;  1NZ9 A;  4FW2 A;  1Q81 U;  1N6A A;  4BE1 A;  2MWO A;  4J6Y A;  4UC4 A;  4LXC A;  4E7L A;  5FWB A;  5GAO q;  2EGE A;  3CQT A;  5GAN 5;  1VQ8 T;  4C92 D;  3EG9 B;  3CBO A;  5ECA A;  5LJ3 g;  5GAM g;  3OBY A;  1JU5 C;  1OQK A;  1KQS A;  4BI4 A;  2FZK B;  2CT3 A;  3M0T A;  2QK0 A;  5A0D A;  1WZO A;  2K2V A;  3VU3 C;  2MCN A;  3CCJ A;  2EAY A;  3EFO B;  1PRM C;  2DIG A;  4WCI A;  4DBF A;  4J7F A;  2I0N A;  2KK4 A;  2KYM A;  1LNX A;  3SWN B;  2HL3 A;  5FLX E;  2ZPE B;  5L8R E;  1SF9 A;  2XDB A;  2QDY B;  2KVQ G;  3NMZ C;  3CCU A;  3C0C A;  1PSE A;  1IHV A;  1X2K A;  4RTX A;  2X35 A;  1IZ6 A;  3CCR A;  1AWO A;  4XU1 A;  2EQM A;  1N5Z A;  2LCC A;  1ZBJ A;  4AFQ C;  2EGC A;  4OML A;  2DNU A;  1QWF A;  2QA4 A;  5GAN j;  4J9C A;  3G6E Q;  3OYC A;  4J5Y A;  2MK5 A;  4LUE A;  2HQX A;  2A08 A;  4M75 C;  2EW3 A;  5GAN 3;  2M0Y A;  4F7U B;  3OBW A;  3G71 T;  4PJO B;  1R0B G;  3RUX A;  4BD3 A;  1IRX A;  1Q82 R;  4J83 A;  1NPP A;  1QVF P;  1BI0 A;  1OV3 A;  3BDL A;  5GAO n;  3H0F A;  1IXD A;  2CUB A;  1V29 B;  2XK0 A;  3MKD A;  3EFR A;  3C12 A;  1UGR B;  2LT4 A;  2DTO A;  1JBM A;  1VQO T;  3HSB A;  4NOY A;  3LW5 E;  4DOV A;  1NJI R;  2LJ1 A;  3CCL A;  1QVG A;  2DJZ A;  2E65 A;  2CUD A;  5KH6 A;  1RI9 A;  1U3O A;  1LJO A;  1MHN A;  4JRK A;  1NYG A;  4JJD A;  1VQ8 A;  3AHU A;  1M3A A;  2EVR A;  1M2V B;  1YIT T;  4C0D C;  2K3Y A;  1YWO A;  1IHW A;  2DX1 A;  3P8D A;  3ULR B;  5GAN 8;  5DLQ E;  1M90 C;  3VUB A;  3OY9 A;  1M1F A;  3PMT A;  4M78 F;  1K0S A;  1ZA1 B;  2EFI A;  1K8A R;  2X9H A;  4A4K A;  4PL6 A;  5KYU A;  2DBK A;  4OMQ A;  2EIF A;  4L59 A;  1UG1 A;  4M75 E;  4LUD A;  1K9A A;  1HSQ A;  1D1C A;  1SHF A;  2Y4Y A;  1E7O A;  2LQN A;  5KYY A;  5FW9 A;  1PHT A;  1X6G A;  2V8K A;  2OTJ T;  3FEO A;  5GAO m;  2JW4 A;  3JAM E;  2COW A;  5IAY A;  5M9O A;  4IUV A;  1DJ7 B;  2FB7 A;  4M78 G;  4F14 A;  4C8Q D;  1K9M U;  1RAA B;  2L89 A;  3CCR Q;  4RTY A;  2D8J A;  2CSQ A;  1IB8 A;  2GQV A;  4M77 F;  3G71 A;  2QA4 Q;  2CP7 A;  4XTZ A;  3OW2 P;  1RL2 A;  4FSS A;  1OPL A;  1KC8 R;  2YRD A;  2RQU A;  1WHJ A;  2LCS A;  1VQN Q;  1OX9 A;  2JTF A;  2JMA A;  4OGE A;  4JJN K;  3ME9 A;  5C0M A;  1RAF B;  4OF1 A;  5GAN g;  5HY6 A;  2OX7 A;  1YHQ T;  5IXB A;  1KD1 U;  3JB9 F;  3KUF A;  4ANJ A;  1VQO A;  5J3B A;  1WXU A;  1D0Y A;  2M51 A;  3V7R A;  2DXB A;  2L3R A;  2CGH A;  5LJ3 h;  1BI1 A;  3CXC P;  2VWF A;  2QI2 A;  3A8O B;  1WXB A;  3CCL Q;  1GL5 A;  2WSE E;  1KQ2 A;  2CT4 A;  2PVD B;  3JCM c;  1JRI A;  2LX7 A;  2GCX A;  1UTI A;  1YJW T;  3LH5 A;  4M7A A;  4AG1 C;  1VQ8 Q;  2DL3 A;  1M8M A;  2ATC B;  1YI2 T;  4BY6 C;  3CPW S;  3JCM W;  2P0P A;  1KJW A;  2XMF A;  1GCQ C;  2E6Z A;  2O31 A;  3O8V A;  1EX4 A;  1TOV A;  3CD6 T;  3OYL A;  3L1A A;  1K76 A;  3LYI A;  1YNZ A;  2F69 A;  3M54 A;  1ZSZ A;  2OTJ A;  1TH7 A;  2R5M A;  2FRW A;  3J80 E;  3OMG A;  1I1J A;  2FL7 A;  1W2B P;  2DFU A;  4IUT A;  2E5K A;  4OB2 B;  1UEB A;  3U23 A;  4M78 C;  1G3T A;  5I22 A;  1WHG A;  3NTK A;  3HKS A;  5D7U A;  4EMK A;  4HCB A;  2EJ9 A;  1VQ5 T;  5FRO A;  2KRN A;  1MV0 B;  2JS0 A;  2COY A;  4XQ3 A;  2DMO A;  2QQR A;  3M57 A;  3EG0 A;  5A0G A;  1BIB A;  4DBR A;  4DQ2 A;  1X6O A;  4ME7 A;  5CKE A;  1GRI A;  1M2O A;  3G71 Q;  2CP3 A;  2ZPG B;  2YHT A;  3S3M A;  4N0A A;  2JVV A;  3SDZ A;  2EQK A;  3HRS A;  3GNG A;  1GFC A;  1YHQ A;  3OSV A;  1VOM A;  4XU2 A;  1N9R A;  5LJ3 f;  1PC0 A;  5GAM f;  1D09 B;  1I5O B;  3AT1 B;  4C0F A;  1K73 C;  5DM7 R;  2KBT A;  3CCV Q;  4ZGE B;  2EQJ A;  1VQO Q;  2D0Q B;  4M7D F;  2RM4 A;  1JJ2 A;  1YCS B;  3OS0 A;  3JCM Q;  3MP1 A;  4CC4 B;  4RTW A;  2JTE A;  2EYX A;  5L23 A;  3I9Q A;  4J7I A;  2ZPF B;  1YJW A;  4FYV B;  3MEW A;  1ZHI A;  1N27 A;  4PJO F;  3ZEH A;  2Z0W A;  3GF5 A;  1MGQ A;  3JV3 A;  2DA9 A;  5CCA A;  2DL4 A;  2QQB A;  4IUU A;  3PIO A;  2BZX A;  1YI2 A;  1G3S A;  2ZPB B;  3V8J A;  1NE8 A;  1TXQ A;  2Y4X A;  2ROT A;  4BY6 B;  4M78 E;  4M7D G;  1Q7Y U;  2KGT A;  3L42 A;  2JT4 A;  3CD6 A;  2HMA A;  3A1P A;  2W0Z A;  2FZC B;  2LJ3 A;  2CDT A;  1WJQ A;  2QQA A;  4E7J A;  3CCE Q;  4PJO G;  3LWI A;  4XU0 A;  1SPK A;  5GMK e;  1NG2 A;  1H64 1;  2V1R A;  2XI9 A;  3H0I A;  3O5Z A;  4LD9 K;  2LZ6 B;  1G3Y A;  1X75 C;  3HFN A;  1JXM A;  2OTJ Q;  1NLO C;  4CC2 A;  3LX7 A;  3HHT B;  1VQ5 A;  1TTH B;  1WI7 A;  2LC4 A;  3QZ9 B;  3V7S A;  2CP6 A;  4LE9 A;  1TU0 B;  3MO8 A;  2RO0 A;  4M77 E;  2EYY A;  4OMP A;  1G8X A;  1OOT A;  4OMO A;  1C0M A;  1H3Z A;  1MND A;  3J81 E;  5IXF A;  3HFO A;  1H92 A;  1CKA A;  1D3B A;  2QQ9 A;  1UFF A;  1M5Q 1;  5AT1 B;  1AT1 B;  3TRE A;  5A2Q E;  1ARK A;  3NPF A;  4E7H A;  3WXM B;  2L3S A;  4X1V A;  3OYM A;  2RHY A;  1N8R U;  1BCM A;  2QAS A;  3NFC A;  4M7A B;  1FYN A;  1I0C A;  3I35 A;  2GF7 A;  2DYB A;  5CKB A;  3M56 A;  2RK2 A;  4D8D A;  2QXF A;  4J6X A;  2ZPH B;  4FYX B;  2R58 A;  5IN1 A;  2FYK A;  2EPD A;  3SB2 A;  1WJR A;  1XTD A;  2DD5 A;  1Q86 U;  1YFN A;  2HNI A;  2EYW A;  3QDF A;  4NL2 A;  4M77 D;  3CC7 T;  2O88 A;  2RA2 A;  4NL3 A;  5LL6 S;  1KQ1 A;  5CIU A;  2LNH B;  2O4X B;  4M75 F;  3RKY A;  2V8I A;  2L3Q A;  2XIC A;  4Y28 E;  2F2V A;  3OYE A;  4QT7 A;  1I81 A;  2VYT A;  1ZSZ B;  3UWN A;  1KG1 A;  1KHC A;  5LJ3 d;  2DXU A;  2XG8 D;  5GAM d;  3E9G A;  1OEB A;  4HVW A;  2DIQ A;  2PUK B;  3JB9 D;  3THK A;  1UGS B;  2KT8 A;  3I55 T;  3V7C A;  3CC4 T;  3MET A;  4PFZ A;  3HPW A;  3PVQ A;  1ZUY A;  4EMK B;  5FU6 C;  1ABO A;  4BUG A;  2SRC A;  2PUO B;  1VQN T;  2HDA A;  5CQY A;  5KYW A;  5GAN f;  3VS5 A;  4GBQ A;  1F1B B;  2DBM A;  5I11 A;  2V1Q A;  1JXO A;  2X4J A;  1T3S A;  3RMS A;  2F5T X;  4J9F A;  2FO0 A;  1TUC A;  3CPW P;  1VIE A;  2DL5 A;  3MEU A;  2P4R A;  2ABL A;  4QKU A;  4DOW A;  5GMK h;  1OU8 A;  1UGQ B;  1VQ5 Q;  5D6Y A;  4DBQ A;  3VYG A;  2DAQ A;  5HK0 A;  3CBM A;  3CPF A;  2R57 A;  1WHL A;  3E2U A;  4K11 A;  2MAM A;  1NLP C;  3RR6 A;  2WSC E;  2XDP A;  1I8F A;  4KH0 B;  2EGA A;  2RHZ A;  1D1B A;  1H3H A;  1Y96 A;  2RQW A;  4ORZ A;  3VS2 A;  1K9M C;  2RHX A;  3WVD B;  4M75 A;  2NUT B;  4Z89 A;  1RAH B;  5CO7 A;  5DLO A;  2JM8 A;  1OUL A;  3LWH A;  1W2B S;  3JCM g;  1RAB B;  2C0O A;  3H6Z A;  4X9D A;  4C92 B;  2P0Q A;  4M7D E;  3BW1 A;  3CC7 A;  1YIJ T;  3DLM A;  4II1 A;  2HL5 C;  2MI6 A;  3M5A A;  3ER0 A;  1SG5 A;  2O2O A;  3EG3 A;  4PJO E;  1KD1 C;  4R0K A;  3FJP A;  4JZ3 A;  1AZE A;  1QVF A;  2C06 A;  3L2U A;  4JUV A;  4OMM A;  3EHQ A;  2OI3 A;  1BYM A;  3I55 A;  3CC4 A;  1B07 A;  3JRZ A;  3M0R A;  2GNC A;  1B34 A;  3A8M B;  2NUP A;  2CZ7 B;  1K4U S;  5KE2 A;  2BE9 B;  2MPX C;  5FU6 B;  1ZSG A;  2O01 E;  2JTM A;  5GAO l;  9ATC B;  4M7D D;  3OYI A;  1VQN A;  4OVA A;  3LLR A;  4OP0 A;  1UGV A;  2E6N A;  1PKT A;  2G6F X;  3MCA B;  5LJ3 e;  2EQI A;  5GAM e;  5KYX A;  2RMO A;  2CKK A;  1TG0 A;  2IG0 A;  4FCY A;  4LDV A;  1RAE B;  3CCV T;  1SHG A;  2LX9 A;  4EMH A;  3M0S A;  1K73 R;  4KBM B;  2MF2 A;  3OYB A;  3UA7 A;  3FDR A;  3BE3 A;  3VJP A;  3VS3 A;  1NEB A;  3HP9 A;  4FL6 A;  1P92 A;  4MZM A;  3CCQ Q;  3C4S A;  2COZ A;  2FPE A;  2GTO A;  2B86 A;  1SSH A;  5GAN d;  3OYK A;  3EGX A;  4KT0 E;  3R6O A;  3OA6 A;  4DEX A;  2X51 A;  3GLX A;  2RH2 A;  3M4Y A;  1U5S A;  1G2B A;  3OYN A;  1LCK A;  1YWP A;  3EGD A;  1FMW A;  2X3W D;  3WVE B;  2J6F A;  1YIJ A;  4F04 B;  5KYN A;  2J05 A;  3C95 A;  3CCS T;  4L5G A;  1M8V A;  3PMI A;  3EGU A;  2RQR A;  2YUO A;  3VS7 A;  4J9H A;  3RKW A;  3DB4 A;  1Q81 R;  3CC7 Q;  3CCE T;  3OW2 A;  4HKE A;  1AZG B;  3ZBD A;  2RHI A;  1T0H A;  2QGG A;  3EG2 A;  1QLY A;  1M4Z A;  5CK9 A;  2O9S A;  4KUD K;  4RUG A;  2XHC A;  2ZCF B;  2H3E B;  2RB6 A;  2ZGW A;  1X01 A;  2JJ9 A;  2VXE A;  4PNO A;  1RAC B;  1HJD A;  1OYX A;  2KI7 A;  4BI8 B;  1WHM A;  2GGR A;  3CBP A;  4FW1 A;  2M02 A;  2L8D A;  2K57 A;  3I55 Q;  3CC4 Q;  2DXT A;  2L0A A;  3X26 B;  4PKC C;  2M9U A;  4C8Q B;  2EYQ A;  3C94 A;  3CXC A;  4RTZ A;  2CH4 A;  2LQK A;  2RD1 A;  4M75 D;  1VQP T;  4PFO A;  2NYS A;  4J9G A;  3OSS C;  1AD5 A;  4XTX A;  5A0L A;  1Q7Y C;  3OYJ A;  3CCV A;  2XKO C;  4AMC A;  4A4G A;  2LQW A;  2PVG B;  4JRP A;  2X4X A;  1MMA A;  1ZLM A;  1VQ7 T;  2LTO A;  1HD3 A;  1UUE A;  4CC7 A;  1FMK A;  5GAM h;  5C6S A;  2CH4 W;  2ED1 A;  2DRK A;  2A36 A;  2MWP A;  1WFW A;  2F5K A;  2KXD A;  4M78 A;  2HKN A;  1IRE B;  2DVJ A;  4E2F B;  2PU9 B;  4X9C A;  3FC3 A;  4E7S A;  1JQQ A;  4IKF A;  1TUD A;  1BCO A;  1Y07 A;  3UA6 A;  5J26 A;  2FZG B;  2YSQ A;  3L2R A;  1VQL T;  5CVI A;  4GLK A;  2GTJ A;  5LJ5 j;  1I4K 1;  2C0T A;  1YN8 A;  4ZTF A;  5EG2 A;  3CCS A;  3EAE A;  4HA8 A;  2HEQ A;  1B34 B;  3JCM J;  2H3J A;  3L2W A;  2KR3 A;  2KQW A;  2QAZ A;  2R5A A;  2HCK A;  2EWN A;  4ELZ C;  3CCE A;  1YIJ Q;  1G5V A;  2L5Q A;  2QG9 B;  5GAN e;  1C1A A;  1N8R C;  2GFA A;  1UEC A;  4M77 A;  1TUG B;  5AYF A;  1OI1 A;  1ZA2 B;  2AKL A;  3H0H A;  2EQU A;  4JLI A;  1PCX A;  2HZY A;  3GBQ A;  2F1L A;  3X25 B;  2DE0 X;  2YXY A;  3L2Z A;  1Q86 C;  2RF0 A;  3VKI A;  2FVU A;  1M1K U;  1KIK A;  2A28 A;  4FSX A;  1QKW A;  4MDX A;  4Z8A A;  1VQ9 T;  2DXC A;  2DEQ A;  3JCM V;  3VS4 A;  3VYH B;  1BKB A;  5I2S A;  2JOY A;  5KCO A;  1QW1 A;  2HSP A;  2E70 A;  1SKU B;  4OMF B;  4V2S A;  3QSU A;  4B6M A;  2CYZ B;  3H9N A;  1VQP A;  2BKD N;  1PG5 B;  2KYB A;  2DZC A;  2O9V A;  4LNP A;  3GPL A;  1OPK A;  4BB7 A;  1M3B A;  1C6V X;  4M7A C;  1AOJ A;  3JCM f;  3OYF A;  1K9M R;  3QUI A;  2CS7 A;  4JRI A;  2VUB A;  3EGD B;  1VQ7 A;  1G83 A;  2MOX A;  3JB9 J;  4C92 G;  4KH1 B;  2KT1 A;  1ZUU A;  2FRY A;  4P5N A;  2HBW A;  4LDX A;  3MJX A;  1XQH A;  1RAG B;  5KYU B;  1W1F A;  1CSK A;  3PFS A;  4YTL A;  2IPO B;  4F17 A;  1YBY A;  2P4T A;  3HRU A;  4F7U F;  5KYY B;  1VQL A;  2L3P A;  4JPB W;  1PM3 A;  1KD1 R;  1ZSZ C;  4OB0 B;  2DK3 A;  4KRT A;  5D6X A;  3LGF A;  1KQS S;  4J9D A;  1PD1 A;  1UHC A;  4FU6 A;  4C5E A;  4O5V A;  2E64 A;  5FU7 B;  1T0J A;  5GAN 4;  2KEA A;  5I2M A;  2GBQ A;  1MUZ A;  5GAN 7;  4EMK C;  4BDZ A;  1E6G A;  2HKQ B;  1Q81 C;  3CCS Q;  1G3W A;  4KGX B;  2NUZ A;  3EG9 A;  2CP5 A;  2PVO B;  1WA7 A;  4F7U G;  4ZGD B;  4O6J A;  1YJ9 T;  2MYS A;  5LJ5 g;  2OAU A;  1V1C A;  1NM7 A;  4HVU A;  1PD0 A;  2ZZD A;  4XAX B;  3M0P A;  1T3L A;  1TWB A;  2L2P A;  4GY5 A;  4CI0 C;  4C0G A;  2DYI A;  1HYO A;  1VQ9 A;  1JO8 A;  2BZY A;  2DZ9 A;  1PNJ A;  4PJJ A;  3SWN A;  1AEY A;  5GAN h;  4MDW A;  3OYD A;  3I56 T;  3DKM A;  3RNJ A;  4M78 D;  1UHF A; 
#chains in the Genus database with same CATH homology
 2RNA A;  2DX1 A;  4M4Z A;  1H3H A;  3ULR B;  1H8K A;  2RQW A;  2ROL A;  2KNB B;  4ORZ A;  3VS2 A;  1U06 A;  2MIO A;  2DF6 A;  2GQI A;  1K0S A;  1X6B A;  4Z89 A;  1AWX A;  2DBK A;  4OMQ A;  2JM8 A;  1UG1 A;  1NYF A;  4CC3 A;  3RBB B;  2C0O A;  4LUD A;  1RLQ C;  4JZ4 A;  1K1Z A;  1K9A A;  2CSI A;  1HSQ A;  1SHF A;  4RTT A;  2PTK A;  1E7O A;  2LQN A;  5FW9 A;  3ZL7 C;  1PHT A;  1X6G A;  4RTU A;  2A37 A;  2JW4 A;  2K3B A;  2O2O A;  1QWE A;  3EG3 A;  2FG0 A;  4R0K A;  4F14 A;  3REA B;  4JZ3 A;  1AZE A;  4ZNX A;  4OMM A;  2D8J A;  4IIM A;  4RTY A;  2CSQ A;  3EHQ A;  2OI3 A;  1B07 A;  2YT6 A;  1BK2 A;  3M0R A;  2GNC A;  4FSS A;  1OPL A;  4E6R A;  1WDX A;  2ENM A;  1WYX A;  1ZX6 A;  2RQU A;  3VS0 A;  2BZ8 A;  1K4U S;  2D1X A;  2LCS A;  1EFN A;  1ZSG A;  2J06 A;  2JMA A;  2K6D A;  2KE9 A;  2C0I A;  4D8K A;  3H41 A;  1UGV A;  2ED0 A;  2YDL A;  1PKT A;  5IXB A;  1WX6 A;  1S1N A;  2G6F X;  3SEM A;  2LP5 A;  3EG1 A;  1QCF A;  2EQI A;  1WXU A;  2RMO A;  2M51 A;  1M27 C;  2RQT A;  1UDL A;  1TG0 A;  2DLP A;  1SHG A;  2VWF A;  2KXC A;  1UJY A;  3M0S A;  1WXB A;  2RPN A;  3UA7 A;  1GL5 A;  2CT4 A;  2X3X D;  4GLM A;  3VS3 A;  3M0U A;  1GBR A;  1KSW A;  1NEB A;  2LX7 A;  2RQV A;  1AWW A;  1UTI A;  1SRM A;  1Z9Q A;  1VYV A;  3LH5 A;  2NWM A;  2J7I A;  2FPE A;  1BB9 A;  2GTO A;  4AG1 C;  2B86 A;  1ABQ A;  1QKX A;  4J9B A;  1SSH A;  2DL3 A;  5FWC A;  1M8M A;  4JJC A;  1ZUK A;  1BU1 A;  5IH2 A;  4DEY A;  3I5R A;  4DEX A;  5GJW B;  1KFZ A;  1SRL A;  1VYU A;  1U5S A;  3PE0 A;  1G2B A;  1PRL C;  1KJW A;  2XMF A;  5IHK A;  4AFZ C;  1GCQ C;  2O31 A;  3VRZ A;  1LCK A;  1YWP A;  1JEG A;  1RLP C;  2X3W D;  2J6F A;  2FEI A;  4A63 B;  2J05 A;  1K76 A;  3TSZ A;  2JS2 A;  1RUW A;  2KRM A;  1UE9 A;  1YNZ A;  4F16 A;  3EGU A;  2RQR A;  2YUO A;  3SHW A;  3VS7 A;  4J9H A;  2FRW A;  2EYZ A;  1I1J A;  1AZG B;  1Z9Z A;  2E5K A;  3UF4 A;  1T0H A;  2DM1 A;  3EG2 A;  3U23 A;  1M30 A;  5I22 A;  1QLY A;  2O9S A;  4RUG A;  4J9I A;  4JJB A;  1K0X A;  2K2M A;  2KRN A;  3REB B;  2JS0 A;  1MV0 B;  2CRE A;  3VRY A;  1HJD A;  1X2Q A;  4OMN A;  2K9G A;  2DMO A;  2GGR A;  3EG0 A;  4J9E A;  2YUP A;  1GRI A;  1I07 A;  1GCP A;  2L0A A;  3VS1 A;  1E6H A;  2AK5 A;  3QWX X;  3IQL A;  1GFC A;  1XOV A;  3KFV A;  4RTZ A;  2CH4 A;  2W10 A;  2DRM A;  2JMC A;  2LJ0 A;  2K7A A;  2JXB A;  1W6X A;  2KBT A;  1WIE A;  4J9G A;  2DJQ A;  1X43 A;  4RTV A;  2J6K A;  4AFU C;  1AD5 A;  2IIM A;  3EHR A;  3A98 A;  1PWT A;  1W70 A;  3FJ5 A;  5GJV B;  2LQW A;  4ESR A;  1YCS B;  4CC4 B;  4RTW A;  2JTE A;  2EYX A;  1ZLM A;  1HD3 A;  1UUE A;  5L23 A;  3I9Q A;  1X27 A;  2KRS A;  4CC7 A;  1A0N B;  1FMK A;  3TVT A;  2CH4 W;  2ED1 A;  2DRK A;  2A36 A;  3VS6 A;  3JV3 A;  1UJ0 A;  1AWJ A;  1WFW A;  2KXD A;  2DA9 A;  2DL4 A;  2BZX A;  1MV3 A;  2DVJ A;  2D0N A;  2ROT A;  1YP5 A;  1JQQ A;  1TUD A;  2KGT A;  1VA7 A;  2JT4 A;  4HCK A;  3UA6 A;  2YSQ A;  1GBQ A;  2ECZ A;  2GTJ A;  2C0T A;  1YN8 A;  2AZV A;  2PNI A;  2KRO A;  2W0Z A;  2LJ3 A;  2CDT A;  2EBP A;  2HEQ A;  1B3Q A;  2KR3 A;  1SPK A;  3I5S A;  4AG2 C;  2D8H A;  1NG2 A;  2V1R A;  2HCK A;  3H0I A;  3O5Z A;  3UAT A;  2LZ6 B;  3M0Q A;  3NHN A;  2SEM A;  1JXM A;  2LMJ A;  1UEC A;  4HXJ A;  2EKH A;  2QDL A;  1NLO C;  1VYT A;  4CC2 A;  2AKL A;  3H0H A;  1PKS A;  3R6N A;  1AVZ C;  1WI7 A;  2DL8 A;  4LN2 A;  3GBQ A;  4LE9 A;  1NEG A;  2DE0 X;  2EYY A;  4OMP A;  2F2W A;  1J3T A;  2RF0 A;  1OOT A;  1KIK A;  5FWB A;  2A28 A;  1QKW A;  4OMO A;  4Z8A A;  2EGE A;  1X69 A;  3CQT A;  3VS4 A;  5IXF A;  1H92 A;  1CKA A;  5ECA A;  1UFF A;  2ESW A;  2HSP A;  1JU5 C;  1ARK A;  3NPF A;  1GFD A;  2DIL A;  2CT3 A;  2L3S A;  3QWY A;  4X1V A;  3M0T A;  2J6O A;  1FYN A;  1I0C A;  3I35 A;  2KYB A;  2MCN A;  2DYB A;  3PVL A;  1CKB A;  1M3C A;  1PRM C;  4D8D A;  5EC7 A;  4WCI A;  2I0N A;  2EPD A;  5IHN A;  2KYM A;  2O9V A;  4LNP A;  1OPK A;  2BTT A;  1M3B A;  4Z88 A;  1Y0M A;  2EYW A;  1AOJ A;  3NMZ C;  2O88 A;  2DL7 A;  1G83 A;  2MOX A;  1GCQ A;  3C0C A;  2LNH B;  1X2K A;  4RTX A;  2KT1 A;  1ZUU A;  2L3Q A;  2FRY A;  2FPD A;  1AWO A;  2HBW A;  2F2V A;  2JM9 A;  1N5Z A;  4QT7 A;  2AKK A;  1ZBJ A;  1W1F A;  1CSK A;  4IIO A;  4AFQ C;  2EGC A;  4OML A;  2DNU A;  1QWF A;  4J9C A;  1OEB A;  2K79 A;  4HVW A;  4LUE A;  4F17 A;  1SEM A;  3THK A;  4AFS C;  2A08 A;  2EW3 A;  2KT8 A;  2OAW A;  2M0Y A;  2L3P A;  4JPB W;  2PZ1 A;  4KRT A;  3PVQ A;  1ZUY A;  4J9D A;  1UHC A;  1BBZ A;  1ABO A;  1IO6 A;  1OV3 A;  4HVV A;  2VKN A;  2SRC A;  1T0J A;  2HDA A;  3H0F A;  2KEA A;  5IHI A;  2GBQ A;  3VS5 A;  1MUZ A;  2CUB A;  4GBQ A;  2DBM A;  1E6G A;  1WLP B;  2AZS A;  5I11 A;  2V1Q A;  1JXO A;  2H8H A;  1T3S A;  2NUZ A;  4J9F A;  2YUQ A;  2FO0 A;  1TUC A;  1WA7 A;  2F2X A;  2DL5 A;  2OJ2 A;  4Y92 A;  2P4R A;  2LJ1 A;  1Y57 A;  1V1C A;  1NM7 A;  5HCK A;  4HVU A;  3TSW A;  2FPF A;  3M0P A;  1T3L A;  2ABL A;  2CUD A;  3NGP A;  1RI9 A;  1U3O A;  2L2P A;  2YUN A;  4EIK A;  2VVK A;  2RN8 A;  1JO8 A;  1NYG A;  4JJD A;  2BZY A;  1M3A A;  1PNJ A;  1WXT A;  1AEY A;  4K11 A;  2EVR A;  1NLP C;  3RNJ A;  1UHF A;  1YWO A;  2EGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...