1GBRA

Orientation of peptide fragments from sos proteins bound to the n-terminal sh3 domain of grb2 determined by nmr spectroscopy
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
74
structure length
74
Chain Sequence
GSRRASVGSMEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Orientation of peptide fragments from Sos proteins bound to the N-terminal SH3 domain of Grb2 determined by NMR spectroscopy.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signal transduction protein
total genus 7
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1994-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gbrA00
2KYBA 2KNBB 4J9DA 2ENMA 1WLPB 1AWXA 2EYXA 1GCQA 1AVZC 4E6RA 1TG0A 3RNJA 2C0IA 2DRKA 2O9SA 1BU1A 2E5KA 2L0AA 3I9QA 2K79A 3LH5A 2IIMA 2OI3A 2DA9A 2DL4A 2D1XA 1M3CA 1KIKA 1RUWA 2OJ2A 4J9FA 3NHNA 1KJWA 3M0QA 4ZNXA 1H92A 1T3SA 2ROLA 1M3AA 1WX6A 1YN8A 1WA7A 2CUBA 2FEIA 4F14A 2C0OA 1AWOA 1HD3A 2DMOA 5FWCA 4J9CA 1UJYA 2JM9A 3NGPA 1AWWA 3QWYA 1I07A 1FYNA 1QKXA 1UTIA 1E6HA 2I0NA 1SRMA 1VA7A 1PKSA 1UDLA 2RQRA 2AZSA 2KR3A 1RLQC 1X43A 3VS7A 1T0HA 2DBMA 2C0TA 2GTJA 1AWJA 3KFVA 1ZSGA 2SEMA 2KXCA 2RQUA 2DYBA 1FMKA 5HCKA 3ULRB 2FPEA 1ZLMA 2CSQA 1PKTA 2JM8A 2K9GA 3CQTA 3EG3A 3JV3A 2GQIA 2RQWA 5ECAA 3VRZA 2AK5A 5I22A 1WXBA 1EFNA 3VS5A 1BK2A 4Z8AA 2JW4A 4RTVA 1W70A 1ABQA 1LCKA 2ABLA 2O31A 1QKWA 3EG0A 2CT3A 2F2VA 2DL7A 3PVQA 4J9BA 2CSIA 1K0XA 1UFFA 4LNPA 2FRYA 4D8DA 3ZL7C 1VYUA 1JXMA 1T0JA 2GGRA 4GBQA 2L3QA 2L2PA 1T3LA 1KFZA 2P4RA 2KT1A 4M4ZA 2DJQA 2YUNA 1H3HA 1ZBJA 2MOXA 1W1FA 1X6GA 4Z88A 5IHIA 2DRMA 4IIOA 4JZ3A 3EHRA 1QLYA 1WYXA 2LNHB 2X3WD 4ORZA 4Y92A 2J6OA 3VS6A 3I35A 1ZUUA 1ARKA 4J9HA 2RQVA 4F16A 1UUEA 2DL5A 1CKAA 1ZUKA 3I5SA 4HVUA 1Y0MA 2K7AA 2FO0A 1NLPC 3VS2A 1TUCA 1WXUA 2DILA 2EPDA 3M0SA 2QDLA 1GBQA 1QWFA 3UATA 2JMAA 2AKKA 2W10A 2BZ8A 1AOJA 2M51A 1NEGA 2RF0A 4J9GA 2GTOA 2BZYA 1AZEA 2V1QA 3UF4A 4AG2C 1GCPA 1SEMA 4IIMA 1HSQA 1UHCA 4CC7A 2CUDA 1H8KA 1GCQC 1BB9A 2JS0A 4D8KA 4RTTA 1MV3A 4CC3A 2VKNA 4AFSC 1M30A 1PRMC 2LJ0A 2LX7A 1I1JA 4CC4B 2F2XA 1YNZA 3VS0A 4LN2A 2VVKA 4X1VA 2K6DA 2HSPA 4HVVA 1PWTA 2DX1A 1RI9A 1YWOA 3UA6A 2DE0X 3NPFA 5IXBA 2EYYA 5FW9A 1M8MA 2DF6A 1AD5A 2B86A 2RQTA 2HCKA 1X2QA 1OV3A 3SHWA 1RLPC 2SRCA 3QWXX 1GFDA 1E6GA 2F2WA 2CDTA 2EBPA 2KT8A 1AEYA 2HBWA 1JEGA 2YUQA 1PRLC 2J06A 2O2OA 2J05A 2LCSA 2A36A 4HXJA 4EIKA 1VYTA 3GBQA 4FSSA 3THKA 1U06A 1OOTA 4AG1C 3FJ5A 2RMOA 1JXOA 2DM1A 3EHQA 2LJ1A 1WIEA 2KEAA 2ESWA 2AKLA 1JO8A 3REBB 1YP5A 1WXTA 2X3XD 1PNJA 2DLPA 2J6KA 1NLOC 1SHGA 4OMLA 2BZXA 1MUZA 1Z9ZA 2RN8A 1VYVA 2M0YA 3PVLA 2W0ZA 3PE0A 2DVJA 1B07A 1QWEA 5IXFA 1M3BA 1KSWA 2ECZA 3M0TA 2XMFA 2FPDA 1WI7A 1SRLA 2HDAA 2H8HA 3M0PA 1UE9A 3C0CA 1K1ZA 2KRSA 3TSZA 2EYWA 1NYGA 2A37A 1ZUYA 1PHTA 2FG0A 2L3SA 2EKHA 4RTWA 2A28A 2LMJA 1GFCA 1I0CA 3RBBB 2KROA 1X69A 2JT4A 4JJDA 1NM7A 1WFWA 2LJ3A 3H0HA 3R6NA 2K3BA 3A98A 2EW3A 4DEXA 4R0KA 2KGTA 2VWFA 2G6FX 2O9VA 1UECA 4CC2A 2LQWA 4JJCA 2D8JA 5EC7A 1WDXA 1Z9QA 2DNUA 2CREA 5IHNA 1SHFA 2YDLA 5GJVB 1K0SA 2KE9A 1MV0B 4RTYA 2CH4W 1X2KA 1SSHA 2JS2A 3REAB 2D0NA 4GLMA 2FRWA 1U3OA 5I11A 1X27A 2BTTA 4J9EA 1J3TA 1GBRA 2KRMA 1HJDA 1X6BA 1K9AA 2GNCA 3VS4A 5IHKA 2DL3A 2PZ1A 3H0FA 4LUDA 1JU5C 1V1CA 5GJWB 2O88A 2GBQA 4OMOA 1NEBA 2YUPA 2YUOA 1ABOA 1YWPA 4Z89A 3O5ZA 4RUGA 1UGVA 4OMQA 1GRIA 1S1NA 2ROTA 2EGAA 2MIOA 4OMPA 3TVTA 1XOVA 3NMZC 1YCSB 2ED0A 4F17A 1GL5A 1A0NB 4RTXA 5IH2A 2DL8A 2EYZA 2PNIA 1OEBA 3EG1A 1B3QA 1Y57A 1IO6A 1CKBA 2JTEA 4RTZA 2EQIA 1UHFA 2A08A 3VS3A 4JZ4A 2OAWA 1TUDA 3U23A 1QCFA 2J7IA 2YSQA 4LE9A 1K4US 2MCNA 3M0UA 3SEMA 2RPNA 2YT6A 4OMNA 4KRTA 1N5ZA 2EVRA 2LQNA 4AFUC 2CT4A 4AFZC 1G83A 2JXBA 2CH4A 1NG2A 3M0RA 2DBKA 1AZGB 4JJBA 1UG1A 2KYMA 2KXDA 3UA7A 3VS1A 1W6XA 2RNAA 3H0IA 1SPKA 4RTUA 1NYFA 2V1RA 1UJ0A 1M27C 3EG2A 2KRNA 1CSKA 2K2MA 4ESRA 1BBZA 1K76A 1G2BA 2D8HA 1OPLA 2FPFA 2JMCA 4DEYA 4K11A 2EGCA 1OPKA 1JQQA 2KBTA 3TSWA 2EGEA 2J6FA 3H41A 3VRYA 3IQLA 4AFQC 4J9IA 1U5SA 2NWMA 4OMMA 4LUEA 4HCKA 2AZVA 2PTKA 4JPBW 1E7OA 2LP5A 3I5RA 4HVWA 2HEQA 4WCIA 5L23A 2L3PA 1ZX6A 4A63B 3EGUA 5FWBA 2ED1A 2NUZA 2LZ6B 4QT7A
chains in the Genus database with same CATH superfamily
2VB6A 4B6MA 2CP3A 3S3OA 2ENMA 4IURA 4LDUA 3OYEA 2EYXA 4ELZC 1XQHA 1TG0A 2XU8A 2O9SA 2L3RA 4C92C 3ZEHA 4C5HA 1WJSA 2OTLQ 1M1FA 4FSXA 1QVFS 5KE3A 3OSSC 3BE3A 2OI3A 1RI0A 2DA9A 1YIJQ 2OJ2A 1W2BP 1OX8A 2PUOB 1H92A 3E19A 2MAMA 1R77A 3PT9A 1QVGS 1YN8A 2H3EB 4E7SA 3CCUA 4XQ3A 2R57A 1K9MR 1K8AU 2C0OA 2CZ7B 2EQMA 1WHLA 2ZZDA 2JM9A 4YTLA 1AWWA 4M78G 1I07A 1QKXA 3CMAA 4XTYA 2KMTA 3CCVQ 2RA2A 1JBMA 2AZSA 2CS7A 2KR3A 1X43A 3OW2P 1TOVA 1T0HA 2DBMA 1OU8A 4C0ZA 1ZSGA 4Q5WA 5C0MA 2KXCA 5CR2A 2DO3A 1FMKA 5D6YA 5HCKA 4HCZA 1HYOA 3EG3A 4M77E 2XICA 4A54A 5I22A 1WXBA 1EFNA 2OTLT 1KC8R 3FDRA 4LDVA 4B9WA 1BK2A 2JW4A 3EGDA 4RTVA 2JNGA 3CD6Q 4C8QE 2O31A 2ABLA 4OB2B 2CT3A 1YIJT 2DL7A 3PIOA 3QKJA 3MPUB 2QDYB 1K0XA 4WF2A 1UFFA 3OYGA 1OZ3A 3EG9A 4LNPA 3OMGA 4GBQA 2L3QA 1X75C 4LDWA 4N0AA 2KT1A 7AT1B 2JUFA 1ZBJA 1X6GA 3CPWS 1K73R 4IIOA 2BE7D 3G4ST 4BE1A 1Q86R 3CCVT 1XNIA 1QLYA 5KYXA 4Y92A 4O6JA 4M77B 3JB9J 3CC7A 1ARKA 3S3MA 1KHCA 2BIVA 1ZUKA 1KQ1A 1B7TA 1D0ZA 1Y0MA 4C5IA 2M0OA 4EMKB 2DILA 3M0SA 3OS1A 2QDLA 4L5GA 2MPXC 2QQBA 2AKKA 2BZ8A 1AOJA 4M7AG 4PFZA 3GNFB 2A7YA 3UF4A 3CD6T 4BI8B 5KE2A 4KUIA 3GOXA 2E1HA 4OGCA 4D8KA 1MV3A 4J8OA 2RK1A 3V7CA 2LX7A 3CMEA 4X1VA 1X6OA 2R58A 2DAQA 2QEXA 1D09B 4R56A 1RI9A 4PLLA 1ZSZC 2QA4Q 1NPRA 2DE0X 5IXBA 2L5QA 4RG2A 1M8MA 2DF6A 3QDFA 5KCHA 1AD5A 3CBMA 1YITQ 2SRCA 3QWXX 1BIAA 3OYCA 1GFDA 2EBPA 5LL6S 1VQ9Q 4C0FA 3L1AA 1I5LA 1IHWA 2HQXA 2LT4A 3CBPA 4EIKA 4JRPA 3GP8A 1W2BA 1OOTA 2P4TA 3ASKA 3FJ5A 2RMOA 2DXBA 2DM1A 2VC8A 3HTRA 2ESWA 3MO8A 3MHXA 2EQUA 4OB1B 3A8MB 4C8QC 1JRIA 4E7KA 4M77A 1YP5A 4PL6A 2RHUA 4A4HA 1PNJA 1NLOC 4FL6A 1N8RR 1I5OB 1N6AA 3TREA 2RN8A 1VYVA 3PVLA 3CCQQ 4EMKA 5CQXA 3OW2A 3G6EA 4OGEA 2RI3A 1QWEA 3A5ZB 1M90C 1KSWA 2ECZA 2FPDA 4Z02A 3A8HB 4F7UG 4A53A 1YITT 1K1ZA 3GNGA 1NYGA 4M75G 2EKHA 3JB9F 2ZPBB 1VQ9T 4XTUA 5C6SA 3OYDA 2EKOA 2LJ3A 4PJOD 3H0HA 5CKDA 5L8RE 3A98A 2EW3A 3V8LA 2YHTA 3M57A 4RKUE 1ZHIA 4M78E 2D8JA 2YXYA 5DY9A 2K57A 1OI1A 1YHQA 1WDXA 3CXCP 3JCMe 1Q82U 4ELYC 2CREA 2FVUA 5GJVB 3L2WA 4RTYA 1MV0B 1SSHA 4KBMB 2X4WA 3CPFA 1U3OA 1MMGA 4PFOA 1VQOQ 2BTTA 1GBRA 4M77F 1HJDA 1X6BA 1K9AA 3CMAQ 3CCQT 2DL3A 3P8DA 4LUDA 2RH2A 1R0CB 1JU5C 1V1CA 5GJWB 5J3BA 3SDZA 1NEBA 1ABOA 2GQVA 3O5ZA 4Y28E 1LJOA 1UGVA 2EQJA 2HNIA 2V8JA 4OMQA 3AT1B 2LX9A 4O5VA 4F17A 1MNDA 1VIEA 1GL5A 4C92D 5GAN6 4M7DB 3OQ5A 1A0NB 2GF7A 2DL8A 2EYZA 3RKWA 1VIFA 3M4GA 3EG1A 2CZ6B 1B3QA 1Y57A 1WPYA 4HCBA 2A08A 5CKBA 1NJIR 2KK4A 4M75D 3CCUT 1MMAA 3JCMb 3U23A 2HAXA 2D9TA 3UWNA 4N4HA 4BACA 4LE9A 4ZTFA 3EFRA 2MCNA 3CCJA 1K4US 4FW2A 3OS0A 2YT6A 4QVDA 1N5ZA 1VQOT 1VQLA 1VQKA 5LJ3f 2LT1A 4AFZC 3OA6A 1FWZA 5IAYA 3CMAT 2X4YA 4FIBA 2NUPB 3QUIA 2RHXA 2MYSA 1YJNA 1M2VA 3PTAA 4OF1A 2KYMA 2QQSA 2KXDA 4KT0E 3VV0A 2D6FA 2K3XA 2V8IA 3H0IA 3JSCA 1SPKA 2MI6A 2GFUA 1WHKA 1R8OB 3LWHA 2V1RA 5CKEA 5GAN7 3GPLA 1M27C 2HQHA 3EG2A 3SWNA 4KGVB 2K2MA 1UGQB 2DD4A 5CKFA 3FC3A 4UC4A 2CZ0B 1B34B 4BE0A 4PJOE 2FPFA 3KUFA 4DA4A 2E3IA 2VV5A 2COYA 2DTHA 4M78C 1KC8U 5GMKh 1VQPA 3HFOA 3QDRB 4N4GA 4IUPA 2BUDA 3CMEQ 1OYXA 1OZ2A 2NWMA 3CCMA 1K8AC 2I2LA 2AZVA 4X9CA 1PSFA 3M54A 3I5RA 3LX7A 2HEQA 4FM4B 3EFOB 4M7DA 1ZX6A 1FMVA 3EGUA 3JCMV 5GAOp 3I55A 5LJ5g 3HRSA 4PLIA 2M16A 3CC7T 2KNBB 5IN1A 1XTDA 1AWXA 4PJOB 5GMKj 1WJQA 1SG5A 3Q1JA 1K73U 1AVZC 1OQKA 1Q86U 2C0IA 2QTVA 1BU1A 5M9OA 1N9SA 2QG9B 2E5KA 2L0AA 3I9QA 4C92E 3CXCA 1YJ9Q 4ZGDB 2RB6A 1H641 1X01A 2NUPA 3OBWA 2CGHA 1RUWA 5I2MA 2ROLA 4OB0B 4F7UE 1WA7A 1TS9A 1G5VA 2OAUA 2DEUA 2FEIA 3CMET 1Y96B 4M75E 1BIBA 2DVEA 4RG8A 5GAOl 1AWOA 2DMOA 5GAMd 5FWCA 3G6EQ 2E6ZA 3FJPA 3NGPA 2ZPFB 2Y90A 1FYNA 4QQDA 1E6HA 5J39A 1FMWA 4FYWB 4ZTJA 2RQRA 5LJ5e 2PVOB 2VYTA 5GAMe 3VS7A 4M7DF 4C92B 1VQNA 5D6XA 4V2SA 1RAAB 4M7AC 2DYBA 2LRQA 3EAEA 3MJXA 4J83A 1BI3A 4BDZA 2E6NA 1PKTA 2K9GA 3CQTA 3VRZA 2CP6A 1M8VA 2EJGA 4BUGA 4JLGA 5GANd 1LVKA 4B9XA 1YJ9T 3CCLA 2RJEA 1SF9A 6AT1B 4M75B 5GMKi 2JVVA 1LCKA 2HSEB 1TXQA 3EG0A 1RAEB 2F2VA 1KD1U 5CO7A 4QVCA 3PVQA 2KAFA 2XDPA 4KH1B 1T0JA 4PJOA 3PMIA 1IZ6A 4HKEA 5GAN4 3LGFA 1BI1A 1KFZA 2XHCA 1TU0B 3G6ET 4JRKA 1W1FA 4JZ3A 3CCSQ 2DETA 2O4XB 2QGFB 4J7IA 4MDWA 2LNHB 4ORZA 2F69A 2J6OA 3JB9H 4IUUA 1V76A 4MMLA 3VS6A 1ZUUA 3VKIA 4J9HA 4F16A 2DL5A 3I5SA 2QASA 4II1A 3NFCA 4J5YA 4NL2A 3CC4Q 2FO0A 1NLPC 2E65A 1O9SA 3VS2A 2EPDA 2RHYA 2ZCFB 3C4SA 2DEQA 1GBQA 1Y96A 5LJ3j 3UATA 2JMAA 2E4HA 4BI4A 3R6OA 4XU2A 1EIFA 2M51A 2RF0A 2GTOA 3H9NA 2BZYA 3X28B 2C06A 2DTIA 4EDUA 2DERA 1UHCA 3TQ7P 4CC7A 2CUDA 1H8KA 3OMCA 2GCXA 1W2BS 2JS0A 1JJ2P 2LDMA 1U1TA 2LJ0A 1YJWA 2Z0WA 3VS0A 3G1JA 2VVKA 2COZA 3VJPA 2K6DA 3META 3CCRA 2BE9B 4M75C 1YJNQ 4PJOF 3I56A 1MHNA 5FW9A 3OYFA 3CCST 5GAN5 2RQTA 3T9NA 2HCKA 1NBEB 3SHWA 1RLPC 4J7FA 1QVFP 1E6GA 3V7RA 3OW2S 2DZCA 1AEYA 3G4SQ 1XJWB 2HBWA 3JCMQ 1PSEA 2YUQA 2QQAA 3CC4T 2EJFA 2XK0A 2F5TX 3A1PA 4N4IA 4HXJA 3GBQA 3THKA 3L2ZA 5D6WA 3HRTA 3UPUA 1FXXA 2DIQA 2HKQB 2OTJA 1Q82C 1D3BA 1MMNA 3E9GA 1ZSZB 2X3XD 1WNLA 3CCJT 1RL2A 3QJ6A 1LNXA 2DLPA 1Q7YU 1PD0A 1I81A 1VQKT 1MUZA 1Y7XA 2M0YA 2W0ZA 3PE0A 1NJIU 4ZN1A 2VXFA 4C92F 1YJNT 3D7SB 1B07A 1M3BA 3EGXB 3EFSA 1WI7A 1SRLA 2HDAA 1Q81U 2XG8D 4MMKA 3M0PA 3C0CA 2WSFE 3TSZA 2EYWA 3V8JA 4J6YA 1RAIB 1ZUYA 4RTWA 2A28A 2RD1A 2LMJA 4XU1A 2E41A 1X69A 2KROA 4M75F 1O75A 3C95A 1SSFA 1WFWA 2E5QA 1TH7A 2X51A 3P8HA 4J6WA 4DEXA 2CZ1B 2XKOC 4E7JA 4R0KA 2KGTA 4C8QB 1LPLA 5LJ5h 4JJCA 5EC7A 2QTXA 3JRZA 5KH6A 3FB9A 1Z9QA 4M78D 2YDLA 1VQPT 1K0SA 4MZTA 1QP3A 3CPWP 2VUBA 2JTMA 1ZBXA 2CP0A 1YBYA 1WGSA 2KRMA 3H0FA 1IB8A 3MEWA 1I8FA 5LJ5j 1W4SA 3L2UA 1K9MC 2GBQA 3GLXA 2YUPA 4E7LA 4Z89A 1H3ZA 1VQNQ 1U8RA 4ANJA 2ROTA 4OMPA 2HKNA 3INZA 1QW1A 4PKCC 3WXMB 1YCSB 2ED0A 3E2UA 1ZSZA 4HT9A 2K5FA 3O8VA 5IT9E 4MZPA 3CCLQ 1IO6A 1JJ2A 1KD1R 1CKBA 1NE8A 2JTEA 3FIFA 4RTZA 5GAN3 1KC8C 3VS3A 4JZ4A 2E10A 2EYQA 2OAWA 4DBRA 1M1GA 3NTKA 2J7IA 4E47A 2YSQA 2COWA 3M0UA 2RPNA 2FZCB 2LQNA 4AFUC 3JCMg 2RJFA 2HBPA 1RABB 4KH0B 3LWIA 1QVFA 1AZGB 4JJBA 2KDSA 5CVIA 3ZFJA 1VQ8A 3LGLA 2PVDB 4C8QA 3VS1A 1W6XA 1KQ2A 1VQNT 4XTWA 1BCMA 4M7AD 2Y4XA 3VUBA 1K73C 3QJYA 1Q86C 2WACA 3QBYA 2ZGWA 4FT2A 3HHTB 4ZGEB 4JS5A 2XIDA 3CCLT 5FRMA 1C0MA 2RHIA 2EGCA 3G71A 1OPKA 2CYZB 3C94A 4GLKA 3H41A 3CXCS 5HY6A 4AFQC 4XAXB 4OP0A 1U5SA 3DB4A 4OMMA 1VQ4A 3OYIA 5KYUB 4JRQA 1E7OA 4KGXB 3CCUQ 3CBOA 3I56Q 2DK3A 4XK8E 1GXIE 1EX4A 4PJLA 2YWWA 3SFMA 3EH2A 3QSUA 2NUZA 1M2OA 1M1KR 3HL8A 5FLXE 2JTFA 2JOYA 8ATCB 4J9DA 2ZPIB 4CRIA 2YRDA 1ZQ1A 1WLPB 5GAOr 1BKBA 1GCQA 4C8QF 3OYBA 1G3TA 2DRKA 3JCMf 4HCCA 3QIIA 1RAHB 2K79A 1G3YA 3LH5A 4M78B 2XDDA 2DL4A 1UB4A 2D1XA 1DJ7B 3DB3A 3CPWA 1G3SA 4J9FA 1KJWA 4ZNXA 2NUTB 1M3AA 4OB3B 1R0BG 3G7ZA 3RERA 1AT1B 5KYWB 1Q7YR 1OX9A 5LJ3d 2YLCA 2NYSA 5D7UA 5KYNA 3AHUA 3CCRT 1HD3A 4J9CA 1UJYA 1RACB 2LQ8A 3I56T 1UTIA 4BE2A 3PNWC 1VA7A 5CIUA 1UGSB 1N8RC 3MCAB 1Q81R 2E64A 1RLQC 2VXEA 3L2VA 3MP8A 2C0TA 3KFVA 4QQGA 3RUXA 5GMKm 2RQUA 3QZ9B 1WQWA 3DKMA 4DOWA 2OTLA 4IUTA 4M7AE 2FZGB 3CC7Q 2KY9A 2JM8A 2GQIA 2RQWA 3JCMX 2YLBA 2AK5A 2HZYA 1YIJA 4BI3A 5KYUA 2M9UA 5I2SA 4Z8AA 4L59A 1ABQA 2OTJT 4NS5A 3V8KA 3QO3A 3S6WA 2MK5A 1C6VX 4D8DA 3ZL7C 4FW1A 2ATCB 2GGRA 4EMHA 2L2PA 4XU0A 2P4RA 3RKXA 1WHGA 2DJQA 3JB9G 2MOXA 3OB9A 2DFUA 2L89A 3RKYA 4Z88A 4M7AB 2RHZA 2VGNA 2E12A 4A4FA 2QEXQ 4A4GA 2HL5C 3EHRA 4M78A 1WYXA 4QW2A 2DPPB 4LDYA 3MEVA 3S3NA 3I35A 2RQVA 1UUEA 3VYHB 2F5KA 1WXUA 5GAMg 1QWFA 2P0PA 3EH1A 2EJ9A 1YFNA 1NEGA 2P0KA 4C0GA 5FRNA 3A8OB 4AG2C 4ZN3A 1SEMA 4M77G 2FZKB 1IREB 1HSQA 3BW1A 4JLIA 1BB9A 2HL3A 2FB7A 4RTTA 4X9DA 1PRMC 2RI5A 1TSFA 4JDSA 1I1JA 4C5EA 4CC4B 1KG1A 2F2XA 1YNZA 1M90U 4LN2A 2HSPA 4HVVA 2DX1A 1YWOA 1NJIC 3UA6A 3PIPA 5GANg 1QCOA 1RAFB 2QEXT 2JN0A 5A0GA 2FL7A 1ZA2B 5FU7C 3LH0A 1X2QA 1OV3A 2LCLA 2CDTA 3VUZA 1QCNA 4M78F 5EG2A 1B34A 1PRLC 3HSBA 2J06A 2O2OA 2LCSA 3JCMh 1VQ7A 2LTOA 2A36A 4EPCA 1S72A 1FX7A 1VYTA 1U06A 1QVPA 3JB9D 4AG1C 3JCMc 3OYKA 3G71Q 4HT8A 2EWNA 1JXOA 3EHQA 4KULA 2RO0A 2LJ1A 3PMTA 1WIEA 1RAGB 4RCBA 4F7UB 1QQJA 1WHJA 1JO8A 3REBB 5LJ5f 1WXTA 4L6V5 3EFOA 1YHQQ 4LD9K 2J6KA 4QVZA 4FU6A 5GAMf 3OYHA 2QA4A 4OMLA 1KQSP 1OU9A 2RJCA 2R5AA 5GAOq 3H8ZA 1Z9ZA 4HA8A 4BB7A 5GANe 2DVJA 1MGQA 2VASA 3OS5A 3BY7A 3M0TA 2XMFA 3J7AF 2DXTA 1F1BB 2H8HA 1VQ9A 1UE9A 3VYGA 3RR6A 2KRSA 2A37A 3E9FA 1GFCA 1I0CA 5GAN2 1IXDA 5A0LA 1NM7A 1PG5B 2QYZA 2L8DA 3X25B 4F04B 1M9SA 2G6FX 1UECA 4CC2A 3G71T 1I4K1 1IRXA 3EGDB 4FCYA 2HD0A 3GF5A 2JS2A 1X2KA 3REAB 4DBFA 3CCQA 4M7AF 4GLMA 1YHQT 3HFNA 4WTOB 4ME7A 1J3TA 4FYVB 2DD5A 3EG9B 3VS4A 1TTHB 5IHKA 1BI0A 1VOMA 4AMCA 3CCJQ 1NZ9A 2RM4A 4C92A 3A8LB 2O88A 1VQLQ 1VQKQ 1VQ5A 4RUGA 1S1NA 3RMSA 3CCEA 2MIOA 1UGPB 5CKHA 3TVTA 1XOVA 3FRNA 4F7UA 8AT1B 3QYGB 3QG1A 1C1AA 5KYXB 1M1KU 4M75A 2K5IA 5A0DA 3CEYA 5IH2A 2PNIA 2K5LA 4FYYB 2QAZA 3KBGA 2E3HA 3X26B 3UT1A 2DIGA 4EMGA 1Y07A 3MP6A 1JB0E 1QVGP 1UHFA 4XTXA 1MNEA 3PGGA 1VQOA 1TUDA 4JRIA 1KHIA 2OX7A 4LXCA 3TEEA 3SEMA 4BDYA 4M7DG 2O4XA 1VQPQ 4MDXA 2RI2A 2EVRA 2CT4A 4C5GA 2V8KA 3CCMQ 2CP2A 3ME9A 2JXBA 2WSCE 1NG2A 2VGMA 2DBKA 2CP7A 2KQWA 1VQLT 3UA7A 4BY6B 1YI2A 4RTUA 1D0XA 1NYFA 1UJ0A 4OMFB 3I55Q 2KRNA 1CSKA 2A3LA 1MMDA 5GAN8 2YRCA 1BBZA 3RIRA 1IGQA 1K76A 4F7UF 1G2BA 2D8HA 1OPLA 3SB2A 2JMCA 4N0AC 2B8AA 3RESA 2H3JA 2KBTA 3TSWA 1KQSA 3VRYA 3E1SA 2EFIA 4J9IA 1V29B 5GAMh 1VQ6A 1M90R 2PTKA 4JPBW 1QMCA 2DZ9A 1BI2A 3OYYA 3QZ5B 4OVAA 4WCIA 2L3PA 3OYNA 3CCMT 4A63B 2ED1A 1WHHA 3LLRA 2K3YA 2LZ6B 2KYBA 3SD4A 2IG0A 2DXUA 4JUVA 4QQ6A 1UEBA 1VQ7Q 2X35A 4LD6A 3I55T 4E6RA 1VQMA 1S72Q 5GAMj 3RNJA 4P5NA 4M7DD 5GANh 1NPPA 1G3WA 4E7IA 2NLUA 2IIMA 3RMQA 4BY6C 4FYXB 1M3CA 3RDVA 1KIKA 3X20B 9ATCB 2P84A 1QP2A 2Y4YA 1PD1A 3NHNA 4IKFA 3M0QA 1T3SA 4DQ2A 4TVRA 4PJOG 5HK3A 1WX6A 2CUBA 3OYAA 4F14A 3OY9A 5GANj 5HKCA 3EGXA 4PJMA 5J26A 3VU3C 4X34A 2BKDN 3QWYA 2I0NA 1SRMA 1PKSA 1UDLA 5GMKe 2F1LA 1U1SA 3FEOA 4RMOA 3KXTA 1TWBA 4PFPA 2GTJA 1AWJA 1OULA 2SEMA 2GFAA 4J6XA 2JJ9A 3ULRB 3JCMP 1VQ7T 3HKSA 2FPEA 1ZLMA 1YJ9A 4M77C 1S72T 2CSQA 2DJZA 1WJRA 3JV3A 2MWOA 3JAME 5ECAA 4KUDK 1IHVA 3VS5A 1QVGA 3UDCA 3P8BB 2AHJB 3L42A 1W70A 4EMKC 2LVMA 2D0QB 2M02A 1QKWA 4NOYA 2XI9A 2JZ2A 1RADB 2AT1B 4C92G 4J9BA 3CC2A 2CSIA 4E7ZA 4XU3A 2FRYA 1D1CA 1ACMB 3MKDA 1VYUA 1JXMA 2QA4T 3LYIA 2HMAA 4XTZA 3M9QA 3MP1A 2IPOB 1T3LA 3LW5E 2MF2A 2LC4A 1YJWQ 2QK0A 4M4ZA 2YUNA 1H3HA 3ZBDA 5IHIA 3M55A 2DRMA 3QXEB 3CCRQ 1VQ5Q 2K2VA 2X3WD 3CCEQ 4KGZB 2DXCA 3JCMd 1CKAA 1M2VB 4HVUA 5LJ3g 2K7AA 3QHSA 4GY5A 4E7HA 1TUCA 1PM3A 3FLGA 4M7DE 2W10A 3SWNB 4J9GA 1WQ7A 5FU6B 1VUBA 5GMKl 1AZEA 3M59A 2V1QA 1TUGB 1HK9A 1G8XA 3M4YA 1K8AR 4A4EA 1GCPA 4IIMA 2EQKA 2O01E 3HRUA 3HP9A 1GCQC 4Y91A 2LCCA 4CC3A 2VKNA 4AFSC 1M30A 5HK0A 1WHMA 2OTJQ 1KD1C 4DOVA 3L2RA 3JCMW 1UGRB 4BD3A 3M5AA 3CCSA 1PWTA 1YJWT 3NPFA 2RJDA 2EYYA 1KK7A 3DLMA 3M56A 1PC0A 1YI2Q 1VQ5T 2B86A 2XD0A 5KYYB 2WSEE 3BFMA 3OYJA 3CC4A 3JCMJ 3CCET 2F2WA 2KT8A 2ZPGB 3ER0A 1AHJB 1PCXA 5LJ3e 2EAYA 2KSSA 1JEGA 4D6WA 2J05A 3MEAA 4JJNK 2CP5A 1SKUB 4QKUA 3N5BB 4FSSA 3WVEB 2HQEA 2FHDA 2YRVA 2EIFA 2KEAA 3OYLA 1Q95G 3A8GB 2AKLA 2FYKA 1N9RA 2ZPEB 1VQ6Q 1SHGA 1K9MU 3F70A 2BZXA 3SWNC 2V26A 5FU6C 5A2QE 2DYIA 5FU7B 5I21A 1D0YA 1ZA1B 5CCAA 2PQWA 1BYMA 3OBYA 5IXFA 5DLQE 4NL3A 2P0QA 2RK2A 5CAIA 3G4SA 3CCVA 1IGUA 1YI2T 1D1BA 3J80E 2LQKA 4PNOA 2X4XA 4ATOA 2X9HA 1VQMQ 4DBHA 1PHTA 2E70A 2FG0A 2K4YA 2L3SA 1M1KC 3RBBB 3NTHA 2LNVA 2JT4A 3BDLA 4JJDA 3R6NA 2K3BA 3OYMA 4IUVA 2PU9B 2NUTA 2VWFA 2QXFA 2O9VA 5CQYA 1P92A 2LQWA 1EZZB 1LOJA 5KYWA 2A0FB 4M7DC 2KVQG 3CD6A 3TCJA 2PUKB 3J81E 2DNUA 5IHNA 1SHFA 3OSVA 2KE9A 3M58A 4DBQA 1M4ZA 5KYYA 2CH4W 2D0NA 3HPWA 2KI7A 1VQ6T 3TU4K 2AIRB 4XTVA 2FRWA 5I11A 1X27A 2QI2A 2PVGB 1M5Q1 4J9EA 2IVWA 4VUBA 4FT4A 2GNCA 2MWPA 2PZ1A 4C8QG 4E2FB 1Q7YC 4PJJA 1N27A 3M53A 4LDXA 3JB9I 4OMOA 4JS4A 2YUOA 1D1AA 1YWPA 3PFSA 3GIBA 1GRIA 2EGAA 2MMPA 2DTOA 1VQ8Q 4RCCA 2QQ9A 3NMZC 1VQMT 3BDUA 1Q81C 2QQRA 5FROA 4RTXA 4C0DB 3NTIA 1WZOA 1OEBA 3X24B 1HXDA 2EQIA 3V7SA 5LJ5d 3CC2Q 3OS2A 1Y71A 3WVDB 1QCFA 3URGA 4M7AA 4OMNA 4KRTA 1KQSS 4ZGJB 1G83A 3H6ZA 2XDBA 1VQ4Q 2CH4A 3M0RA 2CKKA 5DM7R 1UG1A 2ZPHB 4IUQA 2RNAA 2M1HA 2X4JA 4AT1B 3DLLA 1YITA 5KCOA 3QYHB 1VQ8T 5AYFA 4M77D 4ESRA 4R55A 1Q82R 4PJOC 5DLOA 4MZMA 4C8QD 3C12A 4A4KA 4DEYA 5GAOm 4K11A 4CI0C 5GANf 2QGGA 1JQQA 3CC2T 2EGEA 2J6FA 5LJ3h 3IQLA 3QPHA 2ZAEA 2R5MA 3MEUA 5CK9A 1BCOA 4PJNA 4LUEA 1YCYA 4HCKA 1D3BB 2DKGA 5GAOn 1N8RU 5AT1B 4PK4A 4C0DC 2LP5A 4HVWA 3L2QA 5L23A 1JJ2S 1VQ4T 5FWBA 4QT7A 2G3RA
chains in the Genus database with same CATH topology
2KYBA 2KNBB 4J9DA 2ENMA 1WLPB 1AWXA 2EYXA 1GCQA 1AVZC 4E6RA 1TG0A 3RNJA 2C0IA 2DRKA 2O9SA 1BU1A 2E5KA 2L0AA 3I9QA 2K79A 3LH5A 2IIMA 2OI3A 2DA9A 2DL4A 2D1XA 1M3CA 1KIKA 1RUWA 2OJ2A 4J9FA 3NHNA 1KJWA 3M0QA 4ZNXA 1H92A 1T3SA 2ROLA 1M3AA 1WX6A 1YN8A 1WA7A 2CUBA 2FEIA 4F14A 2C0OA 1AWOA 1HD3A 2DMOA 5FWCA 4J9CA 1UJYA 2JM9A 3NGPA 1AWWA 3QWYA 1I07A 1FYNA 1QKXA 1UTIA 1E6HA 2I0NA 1SRMA 1VA7A 1PKSA 1UDLA 2RQRA 2AZSA 2KR3A 1RLQC 1X43A 3VS7A 1T0HA 2DBMA 2C0TA 2GTJA 1AWJA 3KFVA 1ZSGA 2SEMA 2KXCA 2RQUA 2DYBA 1FMKA 5HCKA 3ULRB 2FPEA 1ZLMA 2CSQA 1PKTA 2JM8A 2K9GA 3CQTA 3EG3A 3JV3A 2GQIA 2RQWA 5ECAA 3VRZA 2AK5A 5I22A 1WXBA 1EFNA 3VS5A 1BK2A 4Z8AA 2JW4A 4RTVA 1W70A 1ABQA 1LCKA 2ABLA 2O31A 1QKWA 3EG0A 2CT3A 2F2VA 2DL7A 3PVQA 4J9BA 2CSIA 1K0XA 1UFFA 4LNPA 2FRYA 4D8DA 3ZL7C 1VYUA 1JXMA 1T0JA 2GGRA 4GBQA 2L3QA 2L2PA 1T3LA 1KFZA 2P4RA 2KT1A 4M4ZA 2DJQA 2YUNA 1H3HA 1ZBJA 2MOXA 1W1FA 1X6GA 4Z88A 5IHIA 2DRMA 4IIOA 4JZ3A 3EHRA 1QLYA 1WYXA 2LNHB 2X3WD 4ORZA 4Y92A 2J6OA 3VS6A 3I35A 1ZUUA 1ARKA 4J9HA 2RQVA 4F16A 1UUEA 2DL5A 1CKAA 1ZUKA 3I5SA 4HVUA 1Y0MA 2K7AA 2FO0A 1NLPC 3VS2A 1TUCA 1WXUA 2DILA 2EPDA 3M0SA 2QDLA 1GBQA 1QWFA 3UATA 2JMAA 2AKKA 2W10A 2BZ8A 1AOJA 2M51A 1NEGA 2RF0A 4J9GA 2GTOA 2BZYA 1AZEA 2V1QA 3UF4A 4AG2C 1GCPA 1SEMA 4IIMA 1HSQA 1UHCA 4CC7A 2CUDA 1H8KA 1GCQC 1BB9A 2JS0A 4D8KA 4RTTA 1MV3A 4CC3A 2VKNA 4AFSC 1M30A 1PRMC 2LJ0A 2LX7A 1I1JA 4CC4B 2F2XA 1YNZA 3VS0A 4LN2A 2VVKA 4X1VA 2K6DA 2HSPA 4HVVA 1PWTA 2DX1A 1RI9A 1YWOA 3UA6A 2DE0X 3NPFA 5IXBA 2EYYA 5FW9A 1M8MA 2DF6A 1AD5A 2B86A 2RQTA 2HCKA 1X2QA 1OV3A 3SHWA 1RLPC 2SRCA 3QWXX 1GFDA 1E6GA 2F2WA 2CDTA 2EBPA 2KT8A 1AEYA 2HBWA 1JEGA 2YUQA 1PRLC 2J06A 2O2OA 2J05A 2LCSA 2A36A 4HXJA 4EIKA 1VYTA 3GBQA 4FSSA 3THKA 1U06A 1OOTA 4AG1C 3FJ5A 2RMOA 1JXOA 2DM1A 3EHQA 2LJ1A 1WIEA 2KEAA 2ESWA 2AKLA 1JO8A 3REBB 1YP5A 1WXTA 2X3XD 1PNJA 2DLPA 2J6KA 1NLOC 1SHGA 4OMLA 2BZXA 1MUZA 1Z9ZA 2RN8A 1VYVA 2M0YA 3PVLA 2W0ZA 3PE0A 2DVJA 1B07A 1QWEA 5IXFA 1M3BA 1KSWA 2ECZA 3M0TA 2XMFA 2FPDA 1WI7A 1SRLA 2HDAA 2H8HA 3M0PA 1UE9A 3C0CA 1K1ZA 2KRSA 3TSZA 2EYWA 1NYGA 2A37A 1ZUYA 1PHTA 2FG0A 2L3SA 2EKHA 4RTWA 2A28A 2LMJA 1GFCA 1I0CA 3RBBB 2KROA 1X69A 2JT4A 4JJDA 1NM7A 1WFWA 2LJ3A 3H0HA 3R6NA 2K3BA 3A98A 2EW3A 4DEXA 4R0KA 2KGTA 2VWFA 2G6FX 2O9VA 1UECA 4CC2A 2LQWA 4JJCA 2D8JA 5EC7A 1WDXA 1Z9QA 2DNUA 2CREA 5IHNA 1SHFA 2YDLA 5GJVB 1K0SA 2KE9A 1MV0B 4RTYA 2CH4W 1X2KA 1SSHA 2JS2A 3REAB 2D0NA 4GLMA 2FRWA 1U3OA 5I11A 1X27A 2BTTA 4J9EA 1J3TA 1GBRA 2KRMA 1HJDA 1X6BA 1K9AA 2GNCA 3VS4A 5IHKA 2DL3A 2PZ1A 3H0FA 4LUDA 1JU5C 1V1CA 5GJWB 2O88A 2GBQA 4OMOA 1NEBA 2YUPA 2YUOA 1ABOA 1YWPA 4Z89A 3O5ZA 4RUGA 1UGVA 4OMQA 1GRIA 1S1NA 2ROTA 2EGAA 2MIOA 4OMPA 3TVTA 1XOVA 3NMZC 1YCSB 2ED0A 4F17A 1GL5A 1A0NB 4RTXA 5IH2A 2DL8A 2EYZA 2PNIA 1OEBA 3EG1A 1B3QA 1Y57A 1IO6A 1CKBA 2JTEA 4RTZA 2EQIA 1UHFA 2A08A 3VS3A 4JZ4A 2OAWA 1TUDA 3U23A 1QCFA 2J7IA 2YSQA 4LE9A 1K4US 2MCNA 3M0UA 3SEMA 2RPNA 2YT6A 4OMNA 4KRTA 1N5ZA 2EVRA 2LQNA 4AFUC 2CT4A 4AFZC 1G83A 2JXBA 2CH4A 1NG2A 3M0RA 2DBKA 1AZGB 4JJBA 1UG1A 2KYMA 2KXDA 3UA7A 3VS1A 1W6XA 2RNAA 3H0IA 1SPKA 4RTUA 1NYFA 2V1RA 1UJ0A 1M27C 3EG2A 2KRNA 1CSKA 2K2MA 4ESRA 1BBZA 1K76A 1G2BA 2D8HA 1OPLA 2FPFA 2JMCA 4DEYA 4K11A 2EGCA 1OPKA 1JQQA 2KBTA 3TSWA 2EGEA 2J6FA 3H41A 3VRYA 3IQLA 4AFQC 4J9IA 1U5SA 2NWMA 4OMMA 4LUEA 4HCKA 2AZVA 2PTKA 4JPBW 1E7OA 2LP5A 3I5RA 4HVWA 2HEQA 4WCIA 5L23A 2L3PA 1ZX6A 4A63B 3EGUA 5FWBA 2ED1A 2NUZA 2LZ6B 4QT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KYB A;  2KNB B;  4J9D A;  2ENM A;  1WLP B;  1AWX A;  2EYX A;  1GCQ A;  1AVZ C;  4E6R A;  1TG0 A;  3RNJ A;  2C0I A;  2DRK A;  2O9S A;  1BU1 A;  2E5K A;  2L0A A;  3I9Q A;  2K79 A;  3LH5 A;  2IIM A;  2OI3 A;  2DA9 A;  2DL4 A;  2D1X A;  1M3C A;  1KIK A;  1RUW A;  2OJ2 A;  4J9F A;  3NHN A;  1KJW A;  3M0Q A;  4ZNX A;  1H92 A;  1T3S A;  2ROL A;  1M3A A;  1WX6 A;  1YN8 A;  1WA7 A;  2CUB A;  2FEI A;  4F14 A;  2C0O A;  1AWO A;  1HD3 A;  2DMO A;  5FWC A;  4J9C A;  1UJY A;  2JM9 A;  3NGP A;  1AWW A;  3QWY A;  1I07 A;  1FYN A;  1QKX A;  1UTI A;  1E6H A;  2I0N A;  1SRM A;  1VA7 A;  1PKS A;  1UDL A;  2RQR A;  2AZS A;  2KR3 A;  1RLQ C;  1X43 A;  3VS7 A;  1T0H A;  2DBM A;  2C0T A;  2GTJ A;  1AWJ A;  3KFV A;  1ZSG A;  2SEM A;  2KXC A;  2RQU A;  2DYB A;  1FMK A;  5HCK A;  3ULR B;  2FPE A;  1ZLM A;  2CSQ A;  1PKT A;  2JM8 A;  2K9G A;  3CQT A;  3EG3 A;  3JV3 A;  2GQI A;  2RQW A;  5ECA A;  3VRZ A;  2AK5 A;  5I22 A;  1WXB A;  1EFN A;  3VS5 A;  1BK2 A;  4Z8A A;  2JW4 A;  4RTV A;  1W70 A;  1ABQ A;  1LCK A;  2ABL A;  2O31 A;  1QKW A;  3EG0 A;  2CT3 A;  2F2V A;  2DL7 A;  3PVQ A;  4J9B A;  2CSI A;  1K0X A;  1UFF A;  4LNP A;  2FRY A;  4D8D A;  3ZL7 C;  1VYU A;  1JXM A;  1T0J A;  2GGR A;  4GBQ A;  2L3Q A;  2L2P A;  1T3L A;  1KFZ A;  2P4R A;  2KT1 A;  4M4Z A;  2DJQ A;  2YUN A;  1H3H A;  1ZBJ A;  2MOX A;  1W1F A;  1X6G A;  4Z88 A;  5IHI A;  2DRM A;  4IIO A;  4JZ3 A;  3EHR A;  1QLY A;  1WYX A;  2LNH B;  2X3W D;  4ORZ A;  4Y92 A;  2J6O A;  3VS6 A;  3I35 A;  1ZUU A;  1ARK A;  4J9H A;  2RQV A;  4F16 A;  1UUE A;  2DL5 A;  1CKA A;  1ZUK A;  3I5S A;  4HVU A;  1Y0M A;  2K7A A;  2FO0 A;  1NLP C;  3VS2 A;  1TUC A;  1WXU A;  2DIL A;  2EPD A;  3M0S A;  2QDL A;  1GBQ A;  1QWF A;  3UAT A;  2JMA A;  2AKK A;  2W10 A;  2BZ8 A;  1AOJ A;  2M51 A;  1NEG A;  2RF0 A;  4J9G A;  2GTO A;  2BZY A;  1AZE A;  2V1Q A;  3UF4 A;  4AG2 C;  1GCP A;  1SEM A;  4IIM A;  1HSQ A;  1UHC A;  4CC7 A;  2CUD A;  1H8K A;  1GCQ C;  1BB9 A;  2JS0 A;  4D8K A;  4RTT A;  1MV3 A;  4CC3 A;  2VKN A;  4AFS C;  1M30 A;  1PRM C;  2LJ0 A;  2LX7 A;  1I1J A;  4CC4 B;  2F2X A;  1YNZ A;  3VS0 A;  4LN2 A;  2VVK A;  4X1V A;  2K6D A;  2HSP A;  4HVV A;  1PWT A;  2DX1 A;  1RI9 A;  1YWO A;  3UA6 A;  2DE0 X;  3NPF A;  5IXB A;  2EYY A;  5FW9 A;  1M8M A;  2DF6 A;  1AD5 A;  2B86 A;  2RQT A;  2HCK A;  1X2Q A;  1OV3 A;  3SHW A;  1RLP C;  2SRC A;  3QWX X;  1GFD A;  1E6G A;  2F2W A;  2CDT A;  2EBP A;  2KT8 A;  1AEY A;  2HBW A;  1JEG A;  2YUQ A;  1PRL C;  2J06 A;  2O2O A;  2J05 A;  2LCS A;  2A36 A;  4HXJ A;  4EIK A;  1VYT A;  3GBQ A;  4FSS A;  3THK A;  1U06 A;  1OOT A;  4AG1 C;  3FJ5 A;  2RMO A;  1JXO A;  2DM1 A;  3EHQ A;  2LJ1 A;  1WIE A;  2KEA A;  2ESW A;  2AKL A;  1JO8 A;  3REB B;  1YP5 A;  1WXT A;  2X3X D;  1PNJ A;  2DLP A;  2J6K A;  1NLO C;  1SHG A;  4OML A;  2BZX A;  1MUZ A;  1Z9Z A;  2RN8 A;  1VYV A;  2M0Y A;  3PVL A;  2W0Z A;  3PE0 A;  2DVJ A;  1B07 A;  1QWE A;  5IXF A;  1M3B A;  1KSW A;  2ECZ A;  3M0T A;  2XMF A;  2FPD A;  1WI7 A;  1SRL A;  2HDA A;  2H8H A;  3M0P A;  1UE9 A;  3C0C A;  1K1Z A;  2KRS A;  3TSZ A;  2EYW A;  1NYG A;  2A37 A;  1ZUY A;  1PHT A;  2FG0 A;  2L3S A;  2EKH A;  4RTW A;  2A28 A;  2LMJ A;  1GFC A;  1I0C A;  3RBB B;  2KRO A;  1X69 A;  2JT4 A;  4JJD A;  1NM7 A;  1WFW A;  2LJ3 A;  3H0H A;  3R6N A;  2K3B A;  3A98 A;  2EW3 A;  4DEX A;  4R0K A;  2KGT A;  2VWF A;  2G6F X;  2O9V A;  1UEC A;  4CC2 A;  2LQW A;  4JJC A;  2D8J A;  5EC7 A;  1WDX A;  1Z9Q A;  2DNU A;  2CRE A;  5IHN A;  1SHF A;  2YDL A;  5GJV B;  1K0S A;  2KE9 A;  1MV0 B;  4RTY A;  2CH4 W;  1X2K A;  1SSH A;  2JS2 A;  3REA B;  2D0N A;  4GLM A;  2FRW A;  1U3O A;  5I11 A;  1X27 A;  2BTT A;  4J9E A;  1J3T A;  1GBR A;  2KRM A;  1HJD A;  1X6B A;  1K9A A;  2GNC A;  3VS4 A;  5IHK A;  2DL3 A;  2PZ1 A;  3H0F A;  4LUD A;  1JU5 C;  1V1C A;  5GJW B;  2O88 A;  2GBQ A;  4OMO A;  1NEB A;  2YUP A;  2YUO A;  1ABO A;  1YWP A;  4Z89 A;  3O5Z A;  4RUG A;  1UGV A;  4OMQ A;  1GRI A;  1S1N A;  2ROT A;  2EGA A;  2MIO A;  4OMP A;  3TVT A;  1XOV A;  3NMZ C;  1YCS B;  2ED0 A;  4F17 A;  1GL5 A;  1A0N B;  4RTX A;  5IH2 A;  2DL8 A;  2EYZ A;  2PNI A;  1OEB A;  3EG1 A;  1B3Q A;  1Y57 A;  1IO6 A;  1CKB A;  2JTE A;  4RTZ A;  2EQI A;  1UHF A;  2A08 A;  3VS3 A;  4JZ4 A;  2OAW A;  1TUD A;  3U23 A;  1QCF A;  2J7I A;  2YSQ A;  4LE9 A;  1K4U S;  2MCN A;  3M0U A;  3SEM A;  2RPN A;  2YT6 A;  4OMN A;  4KRT A;  1N5Z A;  2EVR A;  2LQN A;  4AFU C;  2CT4 A;  4AFZ C;  1G83 A;  2JXB A;  2CH4 A;  1NG2 A;  3M0R A;  2DBK A;  1AZG B;  4JJB A;  1UG1 A;  2KYM A;  2KXD A;  3UA7 A;  3VS1 A;  1W6X A;  2RNA A;  3H0I A;  1SPK A;  4RTU A;  1NYF A;  2V1R A;  1UJ0 A;  1M27 C;  3EG2 A;  2KRN A;  1CSK A;  2K2M A;  4ESR A;  1BBZ A;  1K76 A;  1G2B A;  2D8H A;  1OPL A;  2FPF A;  2JMC A;  4DEY A;  4K11 A;  2EGC A;  1OPK A;  1JQQ A;  2KBT A;  3TSW A;  2EGE A;  2J6F A;  3H41 A;  3VRY A;  3IQL A;  4AFQ C;  4J9I A;  1U5S A;  2NWM A;  4OMM A;  4LUE A;  4HCK A;  2AZV A;  2PTK A;  4JPB W;  1E7O A;  2LP5 A;  3I5R A;  4HVW A;  2HEQ A;  4WCI A;  5L23 A;  2L3P A;  1ZX6 A;  4A63 B;  3EGU A;  5FWB A;  2ED1 A;  2NUZ A;  2LZ6 B;  4QT7 A; 
#chains in the Genus database with same CATH topology
 2VB6 A;  4B6M A;  2CP3 A;  3S3O A;  2ENM A;  4IUR A;  4LDU A;  3OYE A;  2EYX A;  4ELZ C;  1XQH A;  1TG0 A;  2XU8 A;  2O9S A;  2L3R A;  4C92 C;  3ZEH A;  4C5H A;  1WJS A;  2OTL Q;  1M1F A;  4FSX A;  1QVF S;  5KE3 A;  3OSS C;  3BE3 A;  2OI3 A;  1RI0 A;  2DA9 A;  1YIJ Q;  2OJ2 A;  1W2B P;  1OX8 A;  2PUO B;  1H92 A;  3E19 A;  2MAM A;  1R77 A;  3PT9 A;  1QVG S;  1YN8 A;  2H3E B;  4E7S A;  3CCU A;  4XQ3 A;  2R57 A;  1K9M R;  1K8A U;  2C0O A;  2CZ7 B;  2EQM A;  1WHL A;  2ZZD A;  2JM9 A;  4YTL A;  1AWW A;  4M78 G;  1I07 A;  1QKX A;  3CMA A;  4XTY A;  2KMT A;  3CCV Q;  2RA2 A;  1JBM A;  2AZS A;  2CS7 A;  2KR3 A;  1X43 A;  3OW2 P;  1TOV A;  1T0H A;  2DBM A;  1OU8 A;  4C0Z A;  1ZSG A;  4Q5W A;  5C0M A;  2KXC A;  5CR2 A;  2DO3 A;  1FMK A;  5D6Y A;  5HCK A;  4HCZ A;  1HYO A;  3EG3 A;  4M77 E;  2XIC A;  4A54 A;  5I22 A;  1WXB A;  1EFN A;  2OTL T;  1KC8 R;  3FDR A;  4LDV A;  4B9W A;  1BK2 A;  2JW4 A;  3EGD A;  4RTV A;  2JNG A;  3CD6 Q;  4C8Q E;  2O31 A;  2ABL A;  4OB2 B;  2CT3 A;  1YIJ T;  2DL7 A;  3PIO A;  3QKJ A;  3MPU B;  2QDY B;  1K0X A;  4WF2 A;  1UFF A;  3OYG A;  1OZ3 A;  3EG9 A;  4LNP A;  3OMG A;  4GBQ A;  2L3Q A;  1X75 C;  4LDW A;  4N0A A;  2KT1 A;  7AT1 B;  2JUF A;  1ZBJ A;  1X6G A;  3CPW S;  1K73 R;  4IIO A;  2BE7 D;  3G4S T;  4BE1 A;  1Q86 R;  3CCV T;  1XNI A;  1QLY A;  5KYX A;  4Y92 A;  4O6J A;  4M77 B;  3JB9 J;  3CC7 A;  1ARK A;  3S3M A;  1KHC A;  2BIV A;  1ZUK A;  1KQ1 A;  1B7T A;  1D0Z A;  1Y0M A;  4C5I A;  2M0O A;  4EMK B;  2DIL A;  3M0S A;  3OS1 A;  2QDL A;  4L5G A;  2MPX C;  2QQB A;  2AKK A;  2BZ8 A;  1AOJ A;  4M7A G;  4PFZ A;  3GNF B;  2A7Y A;  3UF4 A;  3CD6 T;  4BI8 B;  5KE2 A;  4KUI A;  3GOX A;  2E1H A;  4OGC A;  4D8K A;  1MV3 A;  4J8O A;  2RK1 A;  3V7C A;  2LX7 A;  3CME A;  4X1V A;  1X6O A;  2R58 A;  2DAQ A;  2QEX A;  1D09 B;  4R56 A;  1RI9 A;  4PLL A;  1ZSZ C;  2QA4 Q;  1NPR A;  2DE0 X;  5IXB A;  2L5Q A;  4RG2 A;  1M8M A;  2DF6 A;  3QDF A;  5KCH A;  1AD5 A;  3CBM A;  1YIT Q;  2SRC A;  3QWX X;  1BIA A;  3OYC A;  1GFD A;  2EBP A;  5LL6 S;  1VQ9 Q;  4C0F A;  3L1A A;  1I5L A;  1IHW A;  2HQX A;  2LT4 A;  3CBP A;  4EIK A;  4JRP A;  3GP8 A;  1W2B A;  1OOT A;  2P4T A;  3ASK A;  3FJ5 A;  2RMO A;  2DXB A;  2DM1 A;  2VC8 A;  3HTR A;  2ESW A;  3MO8 A;  3MHX A;  2EQU A;  4OB1 B;  3A8M B;  4C8Q C;  1JRI A;  4E7K A;  4M77 A;  1YP5 A;  4PL6 A;  2RHU A;  4A4H A;  1PNJ A;  1NLO C;  4FL6 A;  1N8R R;  1I5O B;  1N6A A;  3TRE A;  2RN8 A;  1VYV A;  3PVL A;  3CCQ Q;  4EMK A;  5CQX A;  3OW2 A;  3G6E A;  4OGE A;  2RI3 A;  1QWE A;  3A5Z B;  1M90 C;  1KSW A;  2ECZ A;  2FPD A;  4Z02 A;  3A8H B;  4F7U G;  4A53 A;  1YIT T;  1K1Z A;  3GNG A;  1NYG A;  4M75 G;  2EKH A;  3JB9 F;  2ZPB B;  1VQ9 T;  4XTU A;  5C6S A;  3OYD A;  2EKO A;  2LJ3 A;  4PJO D;  3H0H A;  5CKD A;  5L8R E;  3A98 A;  2EW3 A;  3V8L A;  2YHT A;  3M57 A;  4RKU E;  1ZHI A;  4M78 E;  2D8J A;  2YXY A;  5DY9 A;  2K57 A;  1OI1 A;  1YHQ A;  1WDX A;  3CXC P;  3JCM e;  1Q82 U;  4ELY C;  2CRE A;  2FVU A;  5GJV B;  3L2W A;  4RTY A;  1MV0 B;  1SSH A;  4KBM B;  2X4W A;  3CPF A;  1U3O A;  1MMG A;  4PFO A;  1VQO Q;  2BTT A;  1GBR A;  4M77 F;  1HJD A;  1X6B A;  1K9A A;  3CMA Q;  3CCQ T;  2DL3 A;  3P8D A;  4LUD A;  2RH2 A;  1R0C B;  1JU5 C;  1V1C A;  5GJW B;  5J3B A;  3SDZ A;  1NEB A;  1ABO A;  2GQV A;  3O5Z A;  4Y28 E;  1LJO A;  1UGV A;  2EQJ A;  2HNI A;  2V8J A;  4OMQ A;  3AT1 B;  2LX9 A;  4O5V A;  4F17 A;  1MND A;  1VIE A;  1GL5 A;  4C92 D;  5GAN 6;  4M7D B;  3OQ5 A;  1A0N B;  2GF7 A;  2DL8 A;  2EYZ A;  3RKW A;  1VIF A;  3M4G A;  3EG1 A;  2CZ6 B;  1B3Q A;  1Y57 A;  1WPY A;  4HCB A;  2A08 A;  5CKB A;  1NJI R;  2KK4 A;  4M75 D;  3CCU T;  1MMA A;  3JCM b;  3U23 A;  2HAX A;  2D9T A;  3UWN A;  4N4H A;  4BAC A;  4LE9 A;  4ZTF A;  3EFR A;  2MCN A;  3CCJ A;  1K4U S;  4FW2 A;  3OS0 A;  2YT6 A;  4QVD A;  1N5Z A;  1VQO T;  1VQL A;  1VQK A;  5LJ3 f;  2LT1 A;  4AFZ C;  3OA6 A;  1FWZ A;  5IAY A;  3CMA T;  2X4Y A;  4FIB A;  2NUP B;  3QUI A;  2RHX A;  2MYS A;  1YJN A;  1M2V A;  3PTA A;  4OF1 A;  2KYM A;  2QQS A;  2KXD A;  4KT0 E;  3VV0 A;  2D6F A;  2K3X A;  2V8I A;  3H0I A;  3JSC A;  1SPK A;  2MI6 A;  2GFU A;  1WHK A;  1R8O B;  3LWH A;  2V1R A;  5CKE A;  5GAN 7;  3GPL A;  1M27 C;  2HQH A;  3EG2 A;  3SWN A;  4KGV B;  2K2M A;  1UGQ B;  2DD4 A;  5CKF A;  3FC3 A;  4UC4 A;  2CZ0 B;  1B34 B;  4BE0 A;  4PJO E;  2FPF A;  3KUF A;  4DA4 A;  2E3I A;  2VV5 A;  2COY A;  2DTH A;  4M78 C;  1KC8 U;  5GMK h;  1VQP A;  3HFO A;  3QDR B;  4N4G A;  4IUP A;  2BUD A;  3CME Q;  1OYX A;  1OZ2 A;  2NWM A;  3CCM A;  1K8A C;  2I2L A;  2AZV A;  4X9C A;  1PSF A;  3M54 A;  3I5R A;  3LX7 A;  2HEQ A;  4FM4 B;  3EFO B;  4M7D A;  1ZX6 A;  1FMV A;  3EGU A;  3JCM V;  5GAO p;  3I55 A;  5LJ5 g;  3HRS A;  4PLI A;  2M16 A;  3CC7 T;  2KNB B;  5IN1 A;  1XTD A;  1AWX A;  4PJO B;  5GMK j;  1WJQ A;  1SG5 A;  3Q1J A;  1K73 U;  1AVZ C;  1OQK A;  1Q86 U;  2C0I A;  2QTV A;  1BU1 A;  5M9O A;  1N9S A;  2QG9 B;  2E5K A;  2L0A A;  3I9Q A;  4C92 E;  3CXC A;  1YJ9 Q;  4ZGD B;  2RB6 A;  1H64 1;  1X01 A;  2NUP A;  3OBW A;  2CGH A;  1RUW A;  5I2M A;  2ROL A;  4OB0 B;  4F7U E;  1WA7 A;  1TS9 A;  1G5V A;  2OAU A;  2DEU A;  2FEI A;  3CME T;  1Y96 B;  4M75 E;  1BIB A;  2DVE A;  4RG8 A;  5GAO l;  1AWO A;  2DMO A;  5GAM d;  5FWC A;  3G6E Q;  2E6Z A;  3FJP A;  3NGP A;  2ZPF B;  2Y90 A;  1FYN A;  4QQD A;  1E6H A;  5J39 A;  1FMW A;  4FYW B;  4ZTJ A;  2RQR A;  5LJ5 e;  2PVO B;  2VYT A;  5GAM e;  3VS7 A;  4M7D F;  4C92 B;  1VQN A;  5D6X A;  4V2S A;  1RAA B;  4M7A C;  2DYB A;  2LRQ A;  3EAE A;  3MJX A;  4J83 A;  1BI3 A;  4BDZ A;  2E6N A;  1PKT A;  2K9G A;  3CQT A;  3VRZ A;  2CP6 A;  1M8V A;  2EJG A;  4BUG A;  4JLG A;  5GAN d;  1LVK A;  4B9X A;  1YJ9 T;  3CCL A;  2RJE A;  1SF9 A;  6AT1 B;  4M75 B;  5GMK i;  2JVV A;  1LCK A;  2HSE B;  1TXQ A;  3EG0 A;  1RAE B;  2F2V A;  1KD1 U;  5CO7 A;  4QVC A;  3PVQ A;  2KAF A;  2XDP A;  4KH1 B;  1T0J A;  4PJO A;  3PMI A;  1IZ6 A;  4HKE A;  5GAN 4;  3LGF A;  1BI1 A;  1KFZ A;  2XHC A;  1TU0 B;  3G6E T;  4JRK A;  1W1F A;  4JZ3 A;  3CCS Q;  2DET A;  2O4X B;  2QGF B;  4J7I A;  4MDW A;  2LNH B;  4ORZ A;  2F69 A;  2J6O A;  3JB9 H;  4IUU A;  1V76 A;  4MML A;  3VS6 A;  1ZUU A;  3VKI A;  4J9H A;  4F16 A;  2DL5 A;  3I5S A;  2QAS A;  4II1 A;  3NFC A;  4J5Y A;  4NL2 A;  3CC4 Q;  2FO0 A;  1NLP C;  2E65 A;  1O9S A;  3VS2 A;  2EPD A;  2RHY A;  2ZCF B;  3C4S A;  2DEQ A;  1GBQ A;  1Y96 A;  5LJ3 j;  3UAT A;  2JMA A;  2E4H A;  4BI4 A;  3R6O A;  4XU2 A;  1EIF A;  2M51 A;  2RF0 A;  2GTO A;  3H9N A;  2BZY A;  3X28 B;  2C06 A;  2DTI A;  4EDU A;  2DER A;  1UHC A;  3TQ7 P;  4CC7 A;  2CUD A;  1H8K A;  3OMC A;  2GCX A;  1W2B S;  2JS0 A;  1JJ2 P;  2LDM A;  1U1T A;  2LJ0 A;  1YJW A;  2Z0W A;  3VS0 A;  3G1J A;  2VVK A;  2COZ A;  3VJP A;  2K6D A;  3MET A;  3CCR A;  2BE9 B;  4M75 C;  1YJN Q;  4PJO F;  3I56 A;  1MHN A;  5FW9 A;  3OYF A;  3CCS T;  5GAN 5;  2RQT A;  3T9N A;  2HCK A;  1NBE B;  3SHW A;  1RLP C;  4J7F A;  1QVF P;  1E6G A;  3V7R A;  3OW2 S;  2DZC A;  1AEY A;  3G4S Q;  1XJW B;  2HBW A;  3JCM Q;  1PSE A;  2YUQ A;  2QQA A;  3CC4 T;  2EJF A;  2XK0 A;  2F5T X;  3A1P A;  4N4I A;  4HXJ A;  3GBQ A;  3THK A;  3L2Z A;  5D6W A;  3HRT A;  3UPU A;  1FXX A;  2DIQ A;  2HKQ B;  2OTJ A;  1Q82 C;  1D3B A;  1MMN A;  3E9G A;  1ZSZ B;  2X3X D;  1WNL A;  3CCJ T;  1RL2 A;  3QJ6 A;  1LNX A;  2DLP A;  1Q7Y U;  1PD0 A;  1I81 A;  1VQK T;  1MUZ A;  1Y7X A;  2M0Y A;  2W0Z A;  3PE0 A;  1NJI U;  4ZN1 A;  2VXF A;  4C92 F;  1YJN T;  3D7S B;  1B07 A;  1M3B A;  3EGX B;  3EFS A;  1WI7 A;  1SRL A;  2HDA A;  1Q81 U;  2XG8 D;  4MMK A;  3M0P A;  3C0C A;  2WSF E;  3TSZ A;  2EYW A;  3V8J A;  4J6Y A;  1RAI B;  1ZUY A;  4RTW A;  2A28 A;  2RD1 A;  2LMJ A;  4XU1 A;  2E41 A;  1X69 A;  2KRO A;  4M75 F;  1O75 A;  3C95 A;  1SSF A;  1WFW A;  2E5Q A;  1TH7 A;  2X51 A;  3P8H A;  4J6W A;  4DEX A;  2CZ1 B;  2XKO C;  4E7J A;  4R0K A;  2KGT A;  4C8Q B;  1LPL A;  5LJ5 h;  4JJC A;  5EC7 A;  2QTX A;  3JRZ A;  5KH6 A;  3FB9 A;  1Z9Q A;  4M78 D;  2YDL A;  1VQP T;  1K0S A;  4MZT A;  1QP3 A;  3CPW P;  2VUB A;  2JTM A;  1ZBX A;  2CP0 A;  1YBY A;  1WGS A;  2KRM A;  3H0F A;  1IB8 A;  3MEW A;  1I8F A;  5LJ5 j;  1W4S A;  3L2U A;  1K9M C;  2GBQ A;  3GLX A;  2YUP A;  4E7L A;  4Z89 A;  1H3Z A;  1VQN Q;  1U8R A;  4ANJ A;  2ROT A;  4OMP A;  2HKN A;  3INZ A;  1QW1 A;  4PKC C;  3WXM B;  1YCS B;  2ED0 A;  3E2U A;  1ZSZ A;  4HT9 A;  2K5F A;  3O8V A;  5IT9 E;  4MZP A;  3CCL Q;  1IO6 A;  1JJ2 A;  1KD1 R;  1CKB A;  1NE8 A;  2JTE A;  3FIF A;  4RTZ A;  5GAN 3;  1KC8 C;  3VS3 A;  4JZ4 A;  2E10 A;  2EYQ A;  2OAW A;  4DBR A;  1M1G A;  3NTK A;  2J7I A;  4E47 A;  2YSQ A;  2COW A;  3M0U A;  2RPN A;  2FZC B;  2LQN A;  4AFU C;  3JCM g;  2RJF A;  2HBP A;  1RAB B;  4KH0 B;  3LWI A;  1QVF A;  1AZG B;  4JJB A;  2KDS A;  5CVI A;  3ZFJ A;  1VQ8 A;  3LGL A;  2PVD B;  4C8Q A;  3VS1 A;  1W6X A;  1KQ2 A;  1VQN T;  4XTW A;  1BCM A;  4M7A D;  2Y4X A;  3VUB A;  1K73 C;  3QJY A;  1Q86 C;  2WAC A;  3QBY A;  2ZGW A;  4FT2 A;  3HHT B;  4ZGE B;  4JS5 A;  2XID A;  3CCL T;  5FRM A;  1C0M A;  2RHI A;  2EGC A;  3G71 A;  1OPK A;  2CYZ B;  3C94 A;  4GLK A;  3H41 A;  3CXC S;  5HY6 A;  4AFQ C;  4XAX B;  4OP0 A;  1U5S A;  3DB4 A;  4OMM A;  1VQ4 A;  3OYI A;  5KYU B;  4JRQ A;  1E7O A;  4KGX B;  3CCU Q;  3CBO A;  3I56 Q;  2DK3 A;  4XK8 E;  1GXI E;  1EX4 A;  4PJL A;  2YWW A;  3SFM A;  3EH2 A;  3QSU A;  2NUZ A;  1M2O A;  1M1K R;  3HL8 A;  5FLX E;  2JTF A;  2JOY A;  8ATC B;  4J9D A;  2ZPI B;  4CRI A;  2YRD A;  1ZQ1 A;  1WLP B;  5GAO r;  1BKB A;  1GCQ A;  4C8Q F;  3OYB A;  1G3T A;  2DRK A;  3JCM f;  4HCC A;  3QII A;  1RAH B;  2K79 A;  1G3Y A;  3LH5 A;  4M78 B;  2XDD A;  2DL4 A;  1UB4 A;  2D1X A;  1DJ7 B;  3DB3 A;  3CPW A;  1G3S A;  4J9F A;  1KJW A;  4ZNX A;  2NUT B;  1M3A A;  4OB3 B;  1R0B G;  3G7Z A;  3RER A;  1AT1 B;  5KYW B;  1Q7Y R;  1OX9 A;  5LJ3 d;  2YLC A;  2NYS A;  5D7U A;  5KYN A;  3AHU A;  3CCR T;  1HD3 A;  4J9C A;  1UJY A;  1RAC B;  2LQ8 A;  3I56 T;  1UTI A;  4BE2 A;  3PNW C;  1VA7 A;  5CIU A;  1UGS B;  1N8R C;  3MCA B;  1Q81 R;  2E64 A;  1RLQ C;  2VXE A;  3L2V A;  3MP8 A;  2C0T A;  3KFV A;  4QQG A;  3RUX A;  5GMK m;  2RQU A;  3QZ9 B;  1WQW A;  3DKM A;  4DOW A;  2OTL A;  4IUT A;  4M7A E;  2FZG B;  3CC7 Q;  2KY9 A;  2JM8 A;  2GQI A;  2RQW A;  3JCM X;  2YLB A;  2AK5 A;  2HZY A;  1YIJ A;  4BI3 A;  5KYU A;  2M9U A;  5I2S A;  4Z8A A;  4L59 A;  1ABQ A;  2OTJ T;  4NS5 A;  3V8K A;  3QO3 A;  3S6W A;  2MK5 A;  1C6V X;  4D8D A;  3ZL7 C;  4FW1 A;  2ATC B;  2GGR A;  4EMH A;  2L2P A;  4XU0 A;  2P4R A;  3RKX A;  1WHG A;  2DJQ A;  3JB9 G;  2MOX A;  3OB9 A;  2DFU A;  2L89 A;  3RKY A;  4Z88 A;  4M7A B;  2RHZ A;  2VGN A;  2E12 A;  4A4F A;  2QEX Q;  4A4G A;  2HL5 C;  3EHR A;  4M78 A;  1WYX A;  4QW2 A;  2DPP B;  4LDY A;  3MEV A;  3S3N A;  3I35 A;  2RQV A;  1UUE A;  3VYH B;  2F5K A;  1WXU A;  5GAM g;  1QWF A;  2P0P A;  3EH1 A;  2EJ9 A;  1YFN A;  1NEG A;  2P0K A;  4C0G A;  5FRN A;  3A8O B;  4AG2 C;  4ZN3 A;  1SEM A;  4M77 G;  2FZK B;  1IRE B;  1HSQ A;  3BW1 A;  4JLI A;  1BB9 A;  2HL3 A;  2FB7 A;  4RTT A;  4X9D A;  1PRM C;  2RI5 A;  1TSF A;  4JDS A;  1I1J A;  4C5E A;  4CC4 B;  1KG1 A;  2F2X A;  1YNZ A;  1M90 U;  4LN2 A;  2HSP A;  4HVV A;  2DX1 A;  1YWO A;  1NJI C;  3UA6 A;  3PIP A;  5GAN g;  1QCO A;  1RAF B;  2QEX T;  2JN0 A;  5A0G A;  2FL7 A;  1ZA2 B;  5FU7 C;  3LH0 A;  1X2Q A;  1OV3 A;  2LCL A;  2CDT A;  3VUZ A;  1QCN A;  4M78 F;  5EG2 A;  1B34 A;  1PRL C;  3HSB A;  2J06 A;  2O2O A;  2LCS A;  3JCM h;  1VQ7 A;  2LTO A;  2A36 A;  4EPC A;  1S72 A;  1FX7 A;  1VYT A;  1U06 A;  1QVP A;  3JB9 D;  4AG1 C;  3JCM c;  3OYK A;  3G71 Q;  4HT8 A;  2EWN A;  1JXO A;  3EHQ A;  4KUL A;  2RO0 A;  2LJ1 A;  3PMT A;  1WIE A;  1RAG B;  4RCB A;  4F7U B;  1QQJ A;  1WHJ A;  1JO8 A;  3REB B;  5LJ5 f;  1WXT A;  4L6V 5;  3EFO A;  1YHQ Q;  4LD9 K;  2J6K A;  4QVZ A;  4FU6 A;  5GAM f;  3OYH A;  2QA4 A;  4OML A;  1KQS P;  1OU9 A;  2RJC A;  2R5A A;  5GAO q;  3H8Z A;  1Z9Z A;  4HA8 A;  4BB7 A;  5GAN e;  2DVJ A;  1MGQ A;  2VAS A;  3OS5 A;  3BY7 A;  3M0T A;  2XMF A;  3J7A F;  2DXT A;  1F1B B;  2H8H A;  1VQ9 A;  1UE9 A;  3VYG A;  3RR6 A;  2KRS A;  2A37 A;  3E9F A;  1GFC A;  1I0C A;  5GAN 2;  1IXD A;  5A0L A;  1NM7 A;  1PG5 B;  2QYZ A;  2L8D A;  3X25 B;  4F04 B;  1M9S A;  2G6F X;  1UEC A;  4CC2 A;  3G71 T;  1I4K 1;  1IRX A;  3EGD B;  4FCY A;  2HD0 A;  3GF5 A;  2JS2 A;  1X2K A;  3REA B;  4DBF A;  3CCQ A;  4M7A F;  4GLM A;  1YHQ T;  3HFN A;  4WTO B;  4ME7 A;  1J3T A;  4FYV B;  2DD5 A;  3EG9 B;  3VS4 A;  1TTH B;  5IHK A;  1BI0 A;  1VOM A;  4AMC A;  3CCJ Q;  1NZ9 A;  2RM4 A;  4C92 A;  3A8L B;  2O88 A;  1VQL Q;  1VQK Q;  1VQ5 A;  4RUG A;  1S1N A;  3RMS A;  3CCE A;  2MIO A;  1UGP B;  5CKH A;  3TVT A;  1XOV A;  3FRN A;  4F7U A;  8AT1 B;  3QYG B;  3QG1 A;  1C1A A;  5KYX B;  1M1K U;  4M75 A;  2K5I A;  5A0D A;  3CEY A;  5IH2 A;  2PNI A;  2K5L A;  4FYY B;  2QAZ A;  3KBG A;  2E3H A;  3X26 B;  3UT1 A;  2DIG A;  4EMG A;  1Y07 A;  3MP6 A;  1JB0 E;  1QVG P;  1UHF A;  4XTX A;  1MNE A;  3PGG A;  1VQO A;  1TUD A;  4JRI A;  1KHI A;  2OX7 A;  4LXC A;  3TEE A;  3SEM A;  4BDY A;  4M7D G;  2O4X A;  1VQP Q;  4MDX A;  2RI2 A;  2EVR A;  2CT4 A;  4C5G A;  2V8K A;  3CCM Q;  2CP2 A;  3ME9 A;  2JXB A;  2WSC E;  1NG2 A;  2VGM A;  2DBK A;  2CP7 A;  2KQW A;  1VQL T;  3UA7 A;  4BY6 B;  1YI2 A;  4RTU A;  1D0X A;  1NYF A;  1UJ0 A;  4OMF B;  3I55 Q;  2KRN A;  1CSK A;  2A3L A;  1MMD A;  5GAN 8;  2YRC A;  1BBZ A;  3RIR A;  1IGQ A;  1K76 A;  4F7U F;  1G2B A;  2D8H A;  1OPL A;  3SB2 A;  2JMC A;  4N0A C;  2B8A A;  3RES A;  2H3J A;  2KBT A;  3TSW A;  1KQS A;  3VRY A;  3E1S A;  2EFI A;  4J9I A;  1V29 B;  5GAM h;  1VQ6 A;  1M90 R;  2PTK A;  4JPB W;  1QMC A;  2DZ9 A;  1BI2 A;  3OYY A;  3QZ5 B;  4OVA A;  4WCI A;  2L3P A;  3OYN A;  3CCM T;  4A63 B;  2ED1 A;  1WHH A;  3LLR A;  2K3Y A;  2LZ6 B;  2KYB A;  3SD4 A;  2IG0 A;  2DXU A;  4JUV A;  4QQ6 A;  1UEB A;  1VQ7 Q;  2X35 A;  4LD6 A;  3I55 T;  4E6R A;  1VQM A;  1S72 Q;  5GAM j;  3RNJ A;  4P5N A;  4M7D D;  5GAN h;  1NPP A;  1G3W A;  4E7I A;  2NLU A;  2IIM A;  3RMQ A;  4BY6 C;  4FYX B;  1M3C A;  3RDV A;  1KIK A;  3X20 B;  9ATC B;  2P84 A;  1QP2 A;  2Y4Y A;  1PD1 A;  3NHN A;  4IKF A;  3M0Q A;  1T3S A;  4DQ2 A;  4TVR A;  4PJO G;  5HK3 A;  1WX6 A;  2CUB A;  3OYA A;  4F14 A;  3OY9 A;  5GAN j;  5HKC A;  3EGX A;  4PJM A;  5J26 A;  3VU3 C;  4X34 A;  2BKD N;  3QWY A;  2I0N A;  1SRM A;  1PKS A;  1UDL A;  5GMK e;  2F1L A;  1U1S A;  3FEO A;  4RMO A;  3KXT A;  1TWB A;  4PFP A;  2GTJ A;  1AWJ A;  1OUL A;  2SEM A;  2GFA A;  4J6X A;  2JJ9 A;  3ULR B;  3JCM P;  1VQ7 T;  3HKS A;  2FPE A;  1ZLM A;  1YJ9 A;  4M77 C;  1S72 T;  2CSQ A;  2DJZ A;  1WJR A;  3JV3 A;  2MWO A;  3JAM E;  5ECA A;  4KUD K;  1IHV A;  3VS5 A;  1QVG A;  3UDC A;  3P8B B;  2AHJ B;  3L42 A;  1W70 A;  4EMK C;  2LVM A;  2D0Q B;  2M02 A;  1QKW A;  4NOY A;  2XI9 A;  2JZ2 A;  1RAD B;  2AT1 B;  4C92 G;  4J9B A;  3CC2 A;  2CSI A;  4E7Z A;  4XU3 A;  2FRY A;  1D1C A;  1ACM B;  3MKD A;  1VYU A;  1JXM A;  2QA4 T;  3LYI A;  2HMA A;  4XTZ A;  3M9Q A;  3MP1 A;  2IPO B;  1T3L A;  3LW5 E;  2MF2 A;  2LC4 A;  1YJW Q;  2QK0 A;  4M4Z A;  2YUN A;  1H3H A;  3ZBD A;  5IHI A;  3M55 A;  2DRM A;  3QXE B;  3CCR Q;  1VQ5 Q;  2K2V A;  2X3W D;  3CCE Q;  4KGZ B;  2DXC A;  3JCM d;  1CKA A;  1M2V B;  4HVU A;  5LJ3 g;  2K7A A;  3QHS A;  4GY5 A;  4E7H A;  1TUC A;  1PM3 A;  3FLG A;  4M7D E;  2W10 A;  3SWN B;  4J9G A;  1WQ7 A;  5FU6 B;  1VUB A;  5GMK l;  1AZE A;  3M59 A;  2V1Q A;  1TUG B;  1HK9 A;  1G8X A;  3M4Y A;  1K8A R;  4A4E A;  1GCP A;  4IIM A;  2EQK A;  2O01 E;  3HRU A;  3HP9 A;  1GCQ C;  4Y91 A;  2LCC A;  4CC3 A;  2VKN A;  4AFS C;  1M30 A;  5HK0 A;  1WHM A;  2OTJ Q;  1KD1 C;  4DOV A;  3L2R A;  3JCM W;  1UGR B;  4BD3 A;  3M5A A;  3CCS A;  1PWT A;  1YJW T;  3NPF A;  2RJD A;  2EYY A;  1KK7 A;  3DLM A;  3M56 A;  1PC0 A;  1YI2 Q;  1VQ5 T;  2B86 A;  2XD0 A;  5KYY B;  2WSE E;  3BFM A;  3OYJ A;  3CC4 A;  3JCM J;  3CCE T;  2F2W A;  2KT8 A;  2ZPG B;  3ER0 A;  1AHJ B;  1PCX A;  5LJ3 e;  2EAY A;  2KSS A;  1JEG A;  4D6W A;  2J05 A;  3MEA A;  4JJN K;  2CP5 A;  1SKU B;  4QKU A;  3N5B B;  4FSS A;  3WVE B;  2HQE A;  2FHD A;  2YRV A;  2EIF A;  2KEA A;  3OYL A;  1Q95 G;  3A8G B;  2AKL A;  2FYK A;  1N9R A;  2ZPE B;  1VQ6 Q;  1SHG A;  1K9M U;  3F70 A;  2BZX A;  3SWN C;  2V26 A;  5FU6 C;  5A2Q E;  2DYI A;  5FU7 B;  5I21 A;  1D0Y A;  1ZA1 B;  5CCA A;  2PQW A;  1BYM A;  3OBY A;  5IXF A;  5DLQ E;  4NL3 A;  2P0Q A;  2RK2 A;  5CAI A;  3G4S A;  3CCV A;  1IGU A;  1YI2 T;  1D1B A;  3J80 E;  2LQK A;  4PNO A;  2X4X A;  4ATO A;  2X9H A;  1VQM Q;  4DBH A;  1PHT A;  2E70 A;  2FG0 A;  2K4Y A;  2L3S A;  1M1K C;  3RBB B;  3NTH A;  2LNV A;  2JT4 A;  3BDL A;  4JJD A;  3R6N A;  2K3B A;  3OYM A;  4IUV A;  2PU9 B;  2NUT A;  2VWF A;  2QXF A;  2O9V A;  5CQY A;  1P92 A;  2LQW A;  1EZZ B;  1LOJ A;  5KYW A;  2A0F B;  4M7D C;  2KVQ G;  3CD6 A;  3TCJ A;  2PUK B;  3J81 E;  2DNU A;  5IHN A;  1SHF A;  3OSV A;  2KE9 A;  3M58 A;  4DBQ A;  1M4Z A;  5KYY A;  2CH4 W;  2D0N A;  3HPW A;  2KI7 A;  1VQ6 T;  3TU4 K;  2AIR B;  4XTV A;  2FRW A;  5I11 A;  1X27 A;  2QI2 A;  2PVG B;  1M5Q 1;  4J9E A;  2IVW A;  4VUB A;  4FT4 A;  2GNC A;  2MWP A;  2PZ1 A;  4C8Q G;  4E2F B;  1Q7Y C;  4PJJ A;  1N27 A;  3M53 A;  4LDX A;  3JB9 I;  4OMO A;  4JS4 A;  2YUO A;  1D1A A;  1YWP A;  3PFS A;  3GIB A;  1GRI A;  2EGA A;  2MMP A;  2DTO A;  1VQ8 Q;  4RCC A;  2QQ9 A;  3NMZ C;  1VQM T;  3BDU A;  1Q81 C;  2QQR A;  5FRO A;  4RTX A;  4C0D B;  3NTI A;  1WZO A;  1OEB A;  3X24 B;  1HXD A;  2EQI A;  3V7S A;  5LJ5 d;  3CC2 Q;  3OS2 A;  1Y71 A;  3WVD B;  1QCF A;  3URG A;  4M7A A;  4OMN A;  4KRT A;  1KQS S;  4ZGJ B;  1G83 A;  3H6Z A;  2XDB A;  1VQ4 Q;  2CH4 A;  3M0R A;  2CKK A;  5DM7 R;  1UG1 A;  2ZPH B;  4IUQ A;  2RNA A;  2M1H A;  2X4J A;  4AT1 B;  3DLL A;  1YIT A;  5KCO A;  3QYH B;  1VQ8 T;  5AYF A;  4M77 D;  4ESR A;  4R55 A;  1Q82 R;  4PJO C;  5DLO A;  4MZM A;  4C8Q D;  3C12 A;  4A4K A;  4DEY A;  5GAO m;  4K11 A;  4CI0 C;  5GAN f;  2QGG A;  1JQQ A;  3CC2 T;  2EGE A;  2J6F A;  5LJ3 h;  3IQL A;  3QPH A;  2ZAE A;  2R5M A;  3MEU A;  5CK9 A;  1BCO A;  4PJN A;  4LUE A;  1YCY A;  4HCK A;  1D3B B;  2DKG A;  5GAO n;  1N8R U;  5AT1 B;  4PK4 A;  4C0D C;  2LP5 A;  4HVW A;  3L2Q A;  5L23 A;  1JJ2 S;  1VQ4 T;  5FWB A;  4QT7 A;  2G3R A; 
#chains in the Genus database with same CATH homology
 2KYB A;  2KNB B;  4J9D A;  2ENM A;  1WLP B;  1AWX A;  2EYX A;  1GCQ A;  1AVZ C;  4E6R A;  1TG0 A;  3RNJ A;  2C0I A;  2DRK A;  2O9S A;  1BU1 A;  2E5K A;  2L0A A;  3I9Q A;  2K79 A;  3LH5 A;  2IIM A;  2OI3 A;  2DA9 A;  2DL4 A;  2D1X A;  1M3C A;  1KIK A;  1RUW A;  2OJ2 A;  4J9F A;  3NHN A;  1KJW A;  3M0Q A;  4ZNX A;  1H92 A;  1T3S A;  2ROL A;  1M3A A;  1WX6 A;  1YN8 A;  1WA7 A;  2CUB A;  2FEI A;  4F14 A;  2C0O A;  1AWO A;  1HD3 A;  2DMO A;  5FWC A;  4J9C A;  1UJY A;  2JM9 A;  3NGP A;  1AWW A;  3QWY A;  1I07 A;  1FYN A;  1QKX A;  1UTI A;  1E6H A;  2I0N A;  1SRM A;  1VA7 A;  1PKS A;  1UDL A;  2RQR A;  2AZS A;  2KR3 A;  1RLQ C;  1X43 A;  3VS7 A;  1T0H A;  2DBM A;  2C0T A;  2GTJ A;  1AWJ A;  3KFV A;  1ZSG A;  2SEM A;  2KXC A;  2RQU A;  2DYB A;  1FMK A;  5HCK A;  3ULR B;  2FPE A;  1ZLM A;  2CSQ A;  1PKT A;  2JM8 A;  2K9G A;  3CQT A;  3EG3 A;  3JV3 A;  2GQI A;  2RQW A;  5ECA A;  3VRZ A;  2AK5 A;  5I22 A;  1WXB A;  1EFN A;  3VS5 A;  1BK2 A;  4Z8A A;  2JW4 A;  4RTV A;  1W70 A;  1ABQ A;  1LCK A;  2ABL A;  2O31 A;  1QKW A;  3EG0 A;  2CT3 A;  2F2V A;  2DL7 A;  3PVQ A;  4J9B A;  2CSI A;  1K0X A;  1UFF A;  4LNP A;  2FRY A;  4D8D A;  3ZL7 C;  1VYU A;  1JXM A;  1T0J A;  2GGR A;  4GBQ A;  2L3Q A;  2L2P A;  1T3L A;  1KFZ A;  2P4R A;  2KT1 A;  4M4Z A;  2DJQ A;  2YUN A;  1H3H A;  1ZBJ A;  2MOX A;  1W1F A;  1X6G A;  4Z88 A;  5IHI A;  2DRM A;  4IIO A;  4JZ3 A;  3EHR A;  1QLY A;  1WYX A;  2LNH B;  2X3W D;  4ORZ A;  4Y92 A;  2J6O A;  3VS6 A;  3I35 A;  1ZUU A;  1ARK A;  4J9H A;  2RQV A;  4F16 A;  1UUE A;  2DL5 A;  1CKA A;  1ZUK A;  3I5S A;  4HVU A;  1Y0M A;  2K7A A;  2FO0 A;  1NLP C;  3VS2 A;  1TUC A;  1WXU A;  2DIL A;  2EPD A;  3M0S A;  2QDL A;  1GBQ A;  1QWF A;  3UAT A;  2JMA A;  2AKK A;  2W10 A;  2BZ8 A;  1AOJ A;  2M51 A;  1NEG A;  2RF0 A;  4J9G A;  2GTO A;  2BZY A;  1AZE A;  2V1Q A;  3UF4 A;  4AG2 C;  1GCP A;  1SEM A;  4IIM A;  1HSQ A;  1UHC A;  4CC7 A;  2CUD A;  1H8K A;  1GCQ C;  1BB9 A;  2JS0 A;  4D8K A;  4RTT A;  1MV3 A;  4CC3 A;  2VKN A;  4AFS C;  1M30 A;  1PRM C;  2LJ0 A;  2LX7 A;  1I1J A;  4CC4 B;  2F2X A;  1YNZ A;  3VS0 A;  4LN2 A;  2VVK A;  4X1V A;  2K6D A;  2HSP A;  4HVV A;  1PWT A;  2DX1 A;  1RI9 A;  1YWO A;  3UA6 A;  2DE0 X;  3NPF A;  5IXB A;  2EYY A;  5FW9 A;  1M8M A;  2DF6 A;  1AD5 A;  2B86 A;  2RQT A;  2HCK A;  1X2Q A;  1OV3 A;  3SHW A;  1RLP C;  2SRC A;  3QWX X;  1GFD A;  1E6G A;  2F2W A;  2CDT A;  2EBP A;  2KT8 A;  1AEY A;  2HBW A;  1JEG A;  2YUQ A;  1PRL C;  2J06 A;  2O2O A;  2J05 A;  2LCS A;  2A36 A;  4HXJ A;  4EIK A;  1VYT A;  3GBQ A;  4FSS A;  3THK A;  1U06 A;  1OOT A;  4AG1 C;  3FJ5 A;  2RMO A;  1JXO A;  2DM1 A;  3EHQ A;  2LJ1 A;  1WIE A;  2KEA A;  2ESW A;  2AKL A;  1JO8 A;  3REB B;  1YP5 A;  1WXT A;  2X3X D;  1PNJ A;  2DLP A;  2J6K A;  1NLO C;  1SHG A;  4OML A;  2BZX A;  1MUZ A;  1Z9Z A;  2RN8 A;  1VYV A;  2M0Y A;  3PVL A;  2W0Z A;  3PE0 A;  2DVJ A;  1B07 A;  1QWE A;  5IXF A;  1M3B A;  1KSW A;  2ECZ A;  3M0T A;  2XMF A;  2FPD A;  1WI7 A;  1SRL A;  2HDA A;  2H8H A;  3M0P A;  1UE9 A;  3C0C A;  1K1Z A;  2KRS A;  3TSZ A;  2EYW A;  1NYG A;  2A37 A;  1ZUY A;  1PHT A;  2FG0 A;  2L3S A;  2EKH A;  4RTW A;  2A28 A;  2LMJ A;  1GFC A;  1I0C A;  3RBB B;  2KRO A;  1X69 A;  2JT4 A;  4JJD A;  1NM7 A;  1WFW A;  2LJ3 A;  3H0H A;  3R6N A;  2K3B A;  3A98 A;  2EW3 A;  4DEX A;  4R0K A;  2KGT A;  2VWF A;  2G6F X;  2O9V A;  1UEC A;  4CC2 A;  2LQW A;  4JJC A;  2D8J A;  5EC7 A;  1WDX A;  1Z9Q A;  2DNU A;  2CRE A;  5IHN A;  1SHF A;  2YDL A;  5GJV B;  1K0S A;  2KE9 A;  1MV0 B;  4RTY A;  2CH4 W;  1X2K A;  1SSH A;  2JS2 A;  3REA B;  2D0N A;  4GLM A;  2FRW A;  1U3O A;  5I11 A;  1X27 A;  2BTT A;  4J9E A;  1J3T A;  1GBR A;  2KRM A;  1HJD A;  1X6B A;  1K9A A;  2GNC A;  3VS4 A;  5IHK A;  2DL3 A;  2PZ1 A;  3H0F A;  4LUD A;  1JU5 C;  1V1C A;  5GJW B;  2O88 A;  2GBQ A;  4OMO A;  1NEB A;  2YUP A;  2YUO A;  1ABO A;  1YWP A;  4Z89 A;  3O5Z A;  4RUG A;  1UGV A;  4OMQ A;  1GRI A;  1S1N A;  2ROT A;  2EGA A;  2MIO A;  4OMP A;  3TVT A;  1XOV A;  3NMZ C;  1YCS B;  2ED0 A;  4F17 A;  1GL5 A;  1A0N B;  4RTX A;  5IH2 A;  2DL8 A;  2EYZ A;  2PNI A;  1OEB A;  3EG1 A;  1B3Q A;  1Y57 A;  1IO6 A;  1CKB A;  2JTE A;  4RTZ A;  2EQI A;  1UHF A;  2A08 A;  3VS3 A;  4JZ4 A;  2OAW A;  1TUD A;  3U23 A;  1QCF A;  2J7I A;  2YSQ A;  4LE9 A;  1K4U S;  2MCN A;  3M0U A;  3SEM A;  2RPN A;  2YT6 A;  4OMN A;  4KRT A;  1N5Z A;  2EVR A;  2LQN A;  4AFU C;  2CT4 A;  4AFZ C;  1G83 A;  2JXB A;  2CH4 A;  1NG2 A;  3M0R A;  2DBK A;  1AZG B;  4JJB A;  1UG1 A;  2KYM A;  2KXD A;  3UA7 A;  3VS1 A;  1W6X A;  2RNA A;  3H0I A;  1SPK A;  4RTU A;  1NYF A;  2V1R A;  1UJ0 A;  1M27 C;  3EG2 A;  2KRN A;  1CSK A;  2K2M A;  4ESR A;  1BBZ A;  1K76 A;  1G2B A;  2D8H A;  1OPL A;  2FPF A;  2JMC A;  4DEY A;  4K11 A;  2EGC A;  1OPK A;  1JQQ A;  2KBT A;  3TSW A;  2EGE A;  2J6F A;  3H41 A;  3VRY A;  3IQL A;  4AFQ C;  4J9I A;  1U5S A;  2NWM A;  4OMM A;  4LUE A;  4HCK A;  2AZV A;  2PTK A;  4JPB W;  1E7O A;  2LP5 A;  3I5R A;  4HVW A;  2HEQ A;  4WCI A;  5L23 A;  2L3P A;  1ZX6 A;  4A63 B;  3EGU A;  5FWB A;  2ED1 A;  2NUZ A;  2LZ6 B;  4QT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...