1GBRA

Orientation of peptide fragments from sos proteins bound to the n-terminal sh3 domain of grb2 determined by nmr spectroscopy
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
74
structure length
74
Chain Sequence
GSRRASVGSMEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signal transduction protein
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Orientation of peptide fragments from Sos proteins bound to the N-terminal SH3 domain of Grb2 determined by NMR spectroscopy.
pubmed doi rcsb
source organism Mus musculus
total genus 7
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1994-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gbrA00
2I0NA 2M51A 1UG1A 1H8KA 3EG1A 1SSHA 2EYZA 1KFZA 1W1FA 1NYFA 1ABOA 2EBPA 2C0OA 3TSWA 3VRYA 2K9GA 1V1CA 2KYMA 2JXBA 2KNBB 2DRKA 2JM9A 2LQNA 1MUZA 4J9DA 4DEXA 1QLYA 1NLPC 2JW4A 2D8JA 1G2BA 4J9CA 5HCKA 2EGEA 4JJDA 1I1JA 3VS5A 2O9VA 1Y0MA 2NUZA 1KIKA 3NMZC 1OOTA 1ZUUA 2EW3A 2D0NA 1ZUYA 2KXDA 4JPBW 1QWEA 1M27C 2A08A 2DL8A 2AKKA 3I5RA 3EG2A 4AFZC 1GCQA 2F2XA 3QWYA 2ECZA 2HSPA 2KGTA 3TVTA 2JS2A 3VS6A 2J6OA 3H0FA 1AEYA 1FMKA 1ZBJA 4RUGA 1W6XA 2CSQA 1AWOA 3QWXX 2YSQA 4FSSA 2A28A 4AFUC 4Y92A 2DA9A 3U23A 2VWFA 1ZLMA 3EHRA 1X69A 4RTTA 2CUDA 2LJ3A 2ENMA 3UF4A 4D8DA 2D8HA 1T0JA 4GBQA 1K0XA 3RNJA 2H8HA 4OMLA 1UGVA 3SEMA 2HCKA 1TUDA 3VS0A 5IHIA 1K1ZA 2DVJA 1OPLA 2YUNA 2SRCA 3REBB 2JT4A 2KYBA 4RTXA 2LCSA 5GJVB 1KJWA 2P4RA 3M0SA 2RQWA 3R6NA 1SRMA 4RTZA 2KRNA 2LQWA 1H3HA 2L3PA 1YCSB 2FPFA 4ZNXA 2EYWA 4JZ3A 1WX6A 3GBQA 1PRMC 2YUQA 4IIOA 4RTVA 3UA7A 1WXUA 1BBZA 5EC7A 1ARKA 2K2MA 2AZVA 3PE0A 5IXFA 2O31A 2L3SA 1J3TA 2JMCA 5FWBA 3UATA 2DYBA 2O9SA 3I9QA 2FRWA 4OMPA 4AG2C 3I5SA 2RNAA 1X2QA 2J06A 1AOJA 5IH2A 2DNUA 2J05A 3ZL7C 3NPFA 1G83A 2C0IA 2DMOA 1SRLA 1W70A 1VYUA 2CSIA 2DILA 2DM1A 2GTOA 1UJ0A 2KRSA 1QCFA 2YT6A 2CREA 4OMNA 4LE9A 4J9IA 4HVWA 4J9GA 3PVLA 4J9EA 2RQTA 1SEMA 1PWTA 2CT3A 2J6KA 2EPDA 4IIMA 2KT8A 1NLOC 2HBWA 1UTIA 2EGCA 1GFCA 4HCKA 2GBQA 2RF0A 2EVRA 1M3AA 1EFNA 5I11A 4AFSC 1NEGA 1M30A 2X3XD 1PKTA 1TUCA 1ABQA 1T0HA 1Z9QA 5ECAA 3UA6A 2MIOA 2CT4A 4JJBA 4LNPA 4F16A 4LUDA 4HVVA 4RTWA 2V1RA 4Z8AA 2AKLA 2LP5A 2B86A 1U5SA 2DBMA 2JMAA 1QKXA 1RLPC 2RQUA 2K7AA 3O5ZA 4OMOA 2O88A 2E5KA 3JV3A 2ESWA 2LJ0A 2O2OA 2OJ2A 3TSZA 2BZ8A 1UE9A 2YDLA 1JQQA 2DL3A 5IXBA 2ROLA 3VS2A 1M3CA 2KBTA 2M0YA 3H41A 1BU1A 1JEGA 1T3LA 1WXTA 2ED0A 2JM8A 2DL5A 3H0IA 1PKSA 4JZ4A 2LJ1A 2LNHB 3VS4A 1WA7A 3EG3A 2KEAA 4JJCA 1Z9ZA 3EGUA 4ORZA 2ROTA 4CC7A 3M0PA 4F14A 1U3OA 1UHCA 1UUEA 1OPKA 1T3SA 2CDTA 3ULRB 1QWFA 1BK2A 1QKWA 2A36A 1LCKA 4F17A 2L3QA 3VRZA 2F2VA 2KR3A 2VKNA 2X3WD 1X2KA 2OAWA 4X1VA 3A98A 2YUOA 5GJWB 1ZSGA 1K4US 1MV3A 2DE0X 2EGAA 2F2WA 1YN8A 5IHNA 2OI3A 2MCNA 2K3BA 1NYGA 2XMFA 1SPKA 1AWJA 1FYNA 4GLMA 4AFQC 1TG0A 1X43A 2DLPA 1WXBA 2FPDA 4KRTA 2KXCA 3EG0A 1CKBA 4RTYA 4OMMA 4RTUA 1GFDA 1AD5A 1JXOA 1ZUKA 2HEQA 2YUPA 2W0ZA 2J6FA 1PRLC 1UHFA 2AZSA 2GQIA 3I35A 3VS7A 1AZEA 1GRIA 1K0SA 2KRMA 1RUWA 2GTJA 2D1XA 2K6DA 1PHTA 1BB9A 4Z89A 1YNZA 2J7IA 1RI9A 1HD3A 2KT1A 4AG1C 1GCPA 1X6GA 2DL4A 2EQIA 4J9FA 1GBQA 1B07A 3LH5A 2FPEA 3M0TA 2LZ6B 1OEBA 2W10A 3RBBB 3PVQA 1OV3A 1AVZC 1X6BA 1CKAA 3VS1A 2FO0A 5I22A 2DBKA 1JU5C 4CC3A 2AK5A 2EKHA 4R0KA 2FEIA 2BZXA 4E6RA 2KROA 3FJ5A 2A37A 1KSWA 1E6HA 4EIKA 4ESRA 1WFWA 3VS3A 1WLPB 2KE9A 3SHWA 2CH4W 2QDLA 1YWOA 3M0RA 2IIMA 1CSKA 2MOXA 2L0AA 2FRYA 1AWXA 1GCQC 1NG2A 2NWMA 2BZYA 1B3QA 3KFVA 4LUEA 1K76A 1SHFA 2RPNA 2LMJA 2EYXA 2GNCA 1RLQC 1GL5A 2ED1A 4M4ZA 1U06A 2LX7A 1A0NB 1N5ZA 2L2PA 2BTTA 2SEMA 1PNJA 5FWCA 2DX1A 2K79A 3EHQA 1UECA 4LN2A 1GBRA 1E6GA 2JTEA 4CC4B 5FW9A 4J9HA 2RQVA 4D8KA 3NHNA 4Z88A 3IQLA 1UDLA 4QT7A 3THKA 1E7OA 2DJQA 2EYYA 2FG0A 1WIEA 1IO6A 3M0UA 1VYTA 1WYXA 2G6FX 1M8MA 1WI7A 1YWPA 3M0QA 1M3BA 5L23A 3CQTA 1VYVA 2CH4A 1HSQA 1JXMA 4CC2A 1WDXA 1NEBA 2C0TA 1VA7A 1S1NA 1HJDA 1X27A 1Y57A 1UJYA 1ZX6A 1YP5A 1AWWA 3C0CA 4WCIA 4A63B 2V1QA 2VVKA 1H92A 2RQRA 1NM7A 1I07A 1K9AA 1SHGA 1UFFA 3NGPA 2CUBA 1MV0B 4J9BA 2JS0A 1JO8A 2PTKA 1AZGB 1XOVA 3H0HA 4DEYA 3REAB 1I0CA 2RMOA 2GGRA 2DL7A 2HDAA 4HXJA 4K11A 2ABLA 2RN8A 4HVUA 4OMQA 2PZ1A 2PNIA 2DF6A 5IHKA 2DRMA
chains in the Genus database with same CATH superfamily
3OQ5A 3ASKA 2E70A 5LJ3e 4C5GA 2EQJA 3V8KA 2OX7A 3EG1A 4VUBA 1M1KR 4M75F 1W1FA 1NYFA 2C0OA 2DXUA 4DOWA 3SFMA 1YJ9A 4N0AA 1V1CA 2R57A 2DRKA 1SF9A 1B7TA 5DM7R 1QLYA 2QGFB 1NLPC 4BE2A 5HCKA 4J9CA 4DQ2A 2EGEA 1BI1A 2FZCB 4JJDA 4L59A 3A5ZB 3VS5A 4HT8A 2NUZA 1PCXA 1NBEB 1KIKA 5GAN5 3NMZC 3I56A 1AT1B 2LX9A 3M57A 1ZUYA 3CC2Q 4C92F 2KXDA 4Y91A 2AKKA 3OY9A 1GCQA 1RAFB 2F2XA 3CCUQ 1TWBA 2KGTA 2J6OA 1M1FA 1QCOA 2DEQA 4N4GA 1EZZB 3QDRB 5I2MA 1Y71A 2KQWA 3MP8A 1X6OA 3G4SA 2QEXQ 4RTTA 4X9CA 2CUDA 2ENMA 3VKIA 2X9HA 3NTIA 3UF4A 2NUPB 3TREA 1BKBA 2E65A 4C8QA 4F7UF 2MMPA 1VQ7A 4PFPA 1KQ1A 3VS0A 5GAOm 2ZCFB 3CCLT 2YUNA 2SRCA 4C8QD 5GJVB 4HT9A 4ME7A 2F5TX 4RG2A 2RQWA 3R6NA 2QASA 2FHDA 2WSCE 2ZPGB 1W2BS 2QGGA 4JZ3A 5M9OA 3GBQA 1PRMC 4IIOA 3UA7A 3VYHB 3OYCA 1WXUA 1R77A 5KCOA 1JBMA 2O31A 1KHCA 2L3SA 1VQ6A 3CCJT 2JMCA 4ZN3A 1EIFA 1IZ6A 3CCVA 1I4K1 1LOJA 2DYBA 5GANd 1Q86U 2J06A 2EWNA 5CAIA 2DNUA 2J05A 3ZL7C 1VQKT 2ZPEB 2C0IA 4C5IA 2K5LA 2RJDA 4PJOA 1PG5B 3CMAQ 4A4FA 2ZPBB 2ZZDA 1QCFA 2CREA 1K9MC 3MJXA 4OMNA 3FLGA 4PJOD 5LJ3d 3JCMQ 2DVEA 2KVQG 2DKGA 2CT3A 5FLXE 3CPWP 4HKEA 1QVFP 2LNVA 5EG2A 3V7CA 3OYBA 1D0YA 2RF0A 2QXFA 3AHUA 2RO0A 1M3AA 5I11A 4HCCA 4AFSC 2JTMA 1VQNQ 3GNGA 1T0HA 1XTDA 3JCMW 4IUPA 5ECAA 1M90C 5AT1B 1QP3A 2CT4A 2E41A 4JJBA 4LNPA 4HVVA 3OSSC 5J3BA 1F1BB 3HP9A 3WXMB 3HRUA 2JMAA 5FRMA 4FL6A 4XQ3A 2O88A 2ESWA 2LJ0A 4QQDA 3TSZA 1BYMA 4FYYB 4DA4A 4M78A 1JQQA 3OS5A 1ZA2B 1M3CA 3H41A 1BU1A 1JEGA 3J7AF 1VQ5A 4M7AF 1LVKA 3CC4Q 4M78D 3CCRA 2LJ1A 2CP2A 4WTOB 5CCAA 2LT1A 1KD1C 1U3OA 2HSEB 1O75A 3T9NA 2CDTA 1YJ9Q 1YI2T 3UT1A 1QWFA 2HZYA 1BK2A 2LDMA 1R0CB 4MZPA 4EDUA 5KYYA 3VRZA 1LJOA 2KR3A 1WQWA 3I56Q 4PJOE 1X2KA 1RAHB 2D6FA 2FB7A 4M7DE 2EJGA 1Q81U 3A98A 1ZSGA 1K4US 2V8JA 3F70A 2E64A 1K9MR 2F2WA 4J83A 2EFIA 1NYGA 1WPYA 2YRVA 4AFQC 4RCBA 1X43A 2XI9A 3EGDB 3OMGA 3JB9I 2P84A 4M77E 1LNXA 3PNWC 4RTYA 3L2QA 1V29B 3G4SQ 1GFDA 5I21A 1JXOA 2L3RA 1ZUKA 3G71A 1KC8R 2AZSA 2GQIA 3I35A 3VS7A 1M90R 1GRIA 1RUWA 2E6ZA 3E19A 2QA4T 3JCMg 1PHTA 1VQOA 3PMIA 1VQ7Q 4Z89A 1YNZA 4C8QG 2NLUA 1RI9A 1HD3A 1VQ4T 3MEWA 3JB9H 5FU7C 2DL4A 3JB9J 1YIJA 1WHLA 1N9RA 3M0TA 4A53A 4N0AC 3OBWA 2K3XA 1QW1A 1AHJB 2FO0A 5I22A 4KUDK 4IKFA 2DBKA 3QSUA 1VQLT 3CBOA 4Z02A 4LD6A 1WHMA 4C0DB 3CCET 5D6XA 4E6RA 3FJ5A 2A37A 4J6XA 4JLGA 5CK9A 1KSWA 2V8KA 2RHYA 1FX7A 5GAOn 1I81A 2CH4W 4EPCA 5J39A 4XTZA 1YWOA 3M0RA 2IIMA 5GAOq 2R58A 1GCQC 2BZYA 1B3QA 2JTFA 4LUEA 3GF5A 2LMJA 2EYXA 3CCVQ 1RLQC 4IUQA 1YHQA 1FWZA 2ED1A 3L2WA 4M4ZA 2RK1A 5A0LA 2LX7A 1D1AA 4E7LA 2SEMA 1PNJA 1TXQA 1UEBA 4LN2A 1YJWQ 2JTEA 5FW9A 2RQVA 4Z88A 4QT7A 1UDLA 4PFOA 4LD9K 1PC0A 4PJOG 1YJNT 1E7OA 1BIBA 2EYYA 2CP0A 5GANh 1WIEA 3JCMX 3M0UA 4BI8B 1WYXA 4C8QC 3M0QA 3CCQT 1M3BA 4QKUA 2X4JA 1VYVA 4CC2A 3V7SA 1NEBA 4O5VA 5KH6A 2C0TA 1S1NA 2E3IA 2P4TA 1X27A 1M9SA 2DJZA 2DTIA 2GF7A 2EQMA 1ACMB 1AWWA 1OZ3A 3EH2A 1H92A 1I07A 3NGPA 4J9BA 1YITT 2PTKA 3REAB 1JJ2P 1WHKA 2QQBA 2QG9B 2MI6A 1UGPB 2LCCA 4HXJA 3RMSA 3FB9A 5CQXA 5GAMg 3H9NA 3OW2A 5LJ5j 3CCJA 5GAOr 1H8KA 1SSHA 1KFZA 5DY9A 4GY5A 4M78G 3JCMP 4E7JA 1R8OB 2KYMA 1WJSA 2KNBB 4M75E 2JM9A 3EH1A 4PJOC 2LQNA 4J9DA 1VQ5Q 1N8RC 1KHIA 4PKCC 1G2BA 5GAOl 3CCRQ 4BD3A 3VUZA 1Y0MA 3LGLA 1Q7YC 3TEEA 1ZUUA 1MGQA 1K73U 2O4XB 1QWEA 3G6ET 4C92E 2F69A 2OTLT 2ECZA 4BDZA 3VS6A 2Z0WA 1AEYA 2D0QB 1WHJA 2K4YA 2DTHA 3EGXA 2XG8D 2RHIA 2GFAA 3CD6T 2K57A 4FW1A 2MK5A 4Y92A 1PSFA 3J81E 2VWFA 3QIIA 5GAN2 4BB7A 1WZOA 2PU9B 4QW2A 2BUDA 2YWWA 2H8HA 2E3HA 1UGVA 2HCKA 4M78C 2LT4A 5IHIA 4F7UE 2DVJA 1TU0B 1RAIB 2HKQB 2VXEA 5LJ5f 3REBB 4OB3B 4LDUA 2JT4A 2LC4A 3G71Q 2LCSA 2RI2A 2COZA 1KJWA 3OS0A 3LYIA 1IREB 2M0OA 3M0SA 3S3OA 1VQOQ 4FYVB 5GANe 2HQEA 3RERA 1H3HA 1I5LA 2YLCA 2VV5A 2FPFA 4ZNXA 2EYWA 3S3NA 2CZ7B 3CPWS 1YIJQ 2YUQA 4RTVA 2DZCA 1QVFS 3PE0A 2AZVA 5AYFA 2EQUA 2KY9A 5IXFA 2EIFA 3OYHA 1YI2A 5FWBA 3BE3A 2VXFA 3UATA 3CMET 4ZTJA 2O9SA 1K8AU 3OYYA 2A3LA 1D0XA 2K3YA 3EG9A 5IH2A 4C5EA 2CZ6B 4BY6C 3S3MA 2WSEE 4JS5A 5CKDA 1G83A 2EKOA 1BI3A 1SRLA 5IN1A 1W70A 1VYUA 3JCMh 4GLKA 4OP0A 5GAN6 4Y28E 2KRSA 3UPUA 4PLLA 2QQ9A 1YHQQ 1IHWA 3HRTA 3OS2A 2HMAA 4LE9A 1UGQB 4HVWA 3S6WA 4M7AB 4J9EA 4DBQA 4RMOA 1B34B 4ZN1A 4A4GA 3M53A 1XQHA 2RHXA 2EGCA 4FT2A 2RI5A 1Q86R 4HCKA 2O01E 2PVDB 2OTJA 2X51A 2EVRA 2CS7A 1NEGA 4WF2A 3ME9A 1PKTA 3A1PA 1RAAB 4L5GA 5J26A 4FT4A 2ATCB 1G3YA 2MIOA 2JOYA 2VUBA 3JCMb 4LUDA 3JCMc 1Q81C 2ZPFB 1SKUB 1V76A 3EFRA 1IGQA 2MYSA 4OVAA 1N27A 1Y96B 4QQ6A 3C4SA 1QKXA 1VQ8A 3QPHA 3HKSA 1IXDA 1P92A 3L42A 2BZ8A 3CC7T 2ROLA 3M54A 3VS2A 5FU7B 3L2UA 1VIFA 2BKDN 3LWHA 4DBHA 3CC2T 2ED0A 3H0IA 2QDYB 4XU2A 3TCJA 4ZGDB 3SB2A 4E7HA 4JZ4A 4A4EA 1RL2A 3CXCP 4AT1B 3VS4A 1N8RU 5GMKj 1WA7A 3EG3A 3BDUA 2KEAA 4JJCA 2ROTA 1C1AA 1RAEB 2GQVA 3M0PA 1Q7YU 2QK0A 1G3WA 1OPKA 1T3SA 3GNFB 5CR2A 2RK2A 4B9WA 2A36A 3RKYA 1LCKA 3L2ZA 2I2LA 3RR6A 2L3QA 2AHJB 2F2VA 2VKNA 1TSFA 1O9SA 1YJNA 2X3WD 3C12A 1M1KU 4JDSA 2V26A 4J7IA 4X1VA 1QQJA 4A4KA 5GJWB 3CCQA 2DAQA 1MV3A 4ELZC 2DE0X 2EGAA 2QQSA 4XTUA 4JJNK 2MCNA 3TU4K 5GAMh 3RUXA 4PK4A 2CZ1B 3EAEA 2XMFA 1SPKA 3JAME 1JRIA 4JS4A 1FYNA 2DTOA 4GLMA 5I2SA 5LJ3f 4C8QB 4DOVA 4M7DA 2DLPA 2X4XA 3PGGA 3EG0A 2K5IA 3E2UA 5CQYA 4IUVA 1IB8A 4N4HA 2HEQA 1MMDA 2J6FA 4M7DD 1AZEA 1M2OA 4EMKA 3OYIA 2D1XA 1VOMA 1Q81R 3JCMe 4M77A 2J7IA 1OX8A 3HFNA 1D3BB 3EFOA 1X6GA 2EQIA 3LH5A 2L5QA 3PVQA 1AVZC 1X6BA 3QO3A 4C0ZA 3BW1A 3VS1A 4M77D 3L2VA 3OYDA 1JU5C 4V2SA 1D0ZA 4R0KA 3CEYA 3MP6A 2FEIA 2E1HA 3BDLA 3TQ7P 5GAN8 3BY7A 2KROA 1VQMT 4E47A 4EIKA 2OAUA 4J5YA 2X35A 2BE9B 5GAOp 1WLPB 3GOXA 2WACA 3SHWA 4JRIA 2A0FB 1AWXA 4PJOB 3KFVA 1K76A 2RPNA 3WVDB 1YI2Q 1PM3A 2GNCA 3G6EA 1MHNA 1GL5A 5KYUA 1UGRB 2GFUA 2OTLA 1WJRA 1W4SA 1QMCA 2BTTA 2RJEA 4MDXA 1UECA 4ELYC 1GBRA 2GCXA 1M1GA 3JB9D 3CD6A 4CC4B 2JN0A 1WQ7A 2KDSA 4D8KA 3NHNA 3THKA 1M8VA 3FC3A 5LL6S 2VASA 5KE3A 2DJQA 2FG0A 4HA8A 1IO6A 1QVFA 1WI7A 1YWPA 4E7ZA 3CQTA 3R6OA 5C6SA 1JXMA 1K73C 8ATCB 4A4HA 1S72A 4ATOA 1VA7A 1HJDA 3VUBA 3QJYA 1BCMA 2OTJQ 1UJYA 1YP5A 2IVWA 1M4ZA 2MWOA 2V1QA 1C0MA 3X28B 2CUBA 5CKBA 1MV0B 1FMVA 3RIRA 3JSCA 4M78B 4B6MA 3QYGB 2XDBA 1XNIA 3OYLA 1YJ9T 1HYOA 3SWNA 1VQ8Q 4OMQA 2DF6A 5GAMe 2DRMA 2I0NA 3I55A 2M51A 4OB1B 1UG1A 3CMEA 5KE2A 1ABOA 2EBPA 3VRYA 1OYXA 3I56T 2E5QA 4JRKA 3OYFA 1I8FA 2PUKB 4L6V5 2BIVA 2D8JA 2DYIA 2O9VA 1NZ9A 1JB0E 3A8GB 3JCMd 4PL6A 4M75A 1OQKA 4BY6B 1M27C 4A54A 2A08A 8AT1B 4AFZC 4ZGJB 3QWYA 3M4YA 2HSPA 3X25B 3TVTA 2JS2A 3H0FA 4M75D 4C8QF 1FMKA 4RUGA 1K8AC 1W6XA 2DIQA 1VQ6Q 1YJNQ 3CCST 1EX4A 4DBFA 4XTWA 2CSQA 4J7FA 1KD1R 2YSQA 1AWOA 1NJIU 1OU8A 3AT1B 3G1JA 4AFUC 4C92A 2COWA 2DA9A 3U23A 3V8LA 3CCQQ 5KYXA 1X69A 2KK4A 2XKOC 2LJ3A 3URGA 4D8DA 4MDWA 1G5VA 1G8XA 2D8HA 2EYQA 1T0JA 4C92D 1K73R 1K0XA 4OMLA 4KGXB 3Q1JA 5KYWA 4OGEA 4FU6A 2EQKA 3SEMA 3OW2P 1W2BA 1OZ2A 4M7DG 3CBPA 2RH2A 4X9DA 2KYBA 3UDCA 4RTXA 3VV0A 3CC7A 1VIEA 3QKJA 1M2VA 1OI1A 2P4RA 4AMCA 2XU8A 3M56A 4DBRA 3CC2A 1ZSZA 1SRMA 4F7UA 3CCLA 3CCVT 5FRNA 1YCSB 2DK3A 4M77G 3CPFA 3L2RA 3JRZA 3VU3C 4BUGA 1BBZA 1KC8U 3PFSA 4LXCA 2YRCA 2K2MA 4PJOF 4OB2B 3FDRA 1YJWT 1J3TA 2LQ8A 4AG2C 3C94A 2L89A 2RNAA 1AOJA 1ZQ1A 3NPFA 1MNDA 3P8BB 2DMOA 1QCNA 2DILA 3ZEHA 3OB9A 1WNLA 4J6WA 2GTOA 5GAN3 1D1BA 4BI4A 2OTLQ 1VQKA 2HD0A 3JB9G 1PD0A 4M7DC 4J9IA 1Q82U 5GAMd 1NPPA 2RQTA 3FEOA 1SEMA 4BE1A 4NL2A 2NUTA 1PWTA 2J6KA 2EPDA 1VUBA 3X24B 2KT8A 1UTIA 1GFCA 1HK9A 3OMCA 3QZ9B 1ZBXA 4PJNA 2HBPA 1D09B 1Q95G 2JVVA 4EMKC 5GMKh 3CXCS 3M4GA 1ABQA 2LRQA 4M77C 1VQPT 4KULA 4M78F 5HK0A 3UA6A 4F04B 1M1KC 4F16A 2V8IA 2V1RA 1S72Q 2AKLA 2LVMA 4MMKA 4FSXA 1H641 3M5AA 1RLPC 3OS1A 2RQUA 2CKKA 1VQ5T 3O5ZA 4MMLA 1KQSP 3NFCA 3CCRT 2VYTA 1UE9A 2YDLA 5IXBA 1QVGP 2KAFA 1VQMA 5A2QE 5GMKm 2Y90A 3H8ZA 1WXTA 2JM8A 4JRPA 1PKSA 3MO8A 5D6WA 4XTVA 3I55Q 2JZ2A 1PD1A 3CMEQ 1FMWA 4J6YA 4F14A 1UHCA 4QVCA 3ULRB 5LJ5g 1U8RA 5CKHA 1QKWA 2DERA 4M7AA 1N6AA 3UWNA 3P8DA 4F17A 4LDXA 3EGXB 3OYJA 3ZBDA 2MPXC 2OAWA 4KH1B 1RACB 4XU3A 4HCBA 4N4IA 4M7AD 4M75G 3CCMT 1YN8A 5IHNA 4B9XA 2K3BA 1N8RR 2EJFA 3QG1A 1TOVA 2QTXA 5HY6A 1AWJA 4II1A 2XD0A 2MF2A 5GMKi 3E9GA 1Q7YR 5FU6C 3DB3A 4ANJA 1WXBA 2FPDA 2KXCA 2M02A 1VQOT 3HHTB 4OMMA 1AD5A 1GXIE 5DLOA 2DZ9A 4C92G 2YUPA 2VGNA 1YIJT 5GANj 1N9SA 3X20B 2NUPA 4IUTA 3M58A 2KRMA 3SWNC 1BB9A 3LH0A 3PIOA 3GLXA 4RKUE 1SSFA 3A8MB 4FYXB 1DJ7B 1B07A 2FPEA 3PTAA 2CP6A 3RBBB 3OYEA 1VQ9T 3CC7Q 2QA4A 3JCMJ 2ZPHB 2Y4YA 3INZA 4CC3A 1VQ4A 5LJ3j 2BZXA 4KH0B 3CCLQ 1E6HA 5GMKe 2XIDA 2M9UA 4ESRA 1TS9A 3EG9B 1YHQT 1WFWA 4F7UG 3V8JA 1TTHB 4M75C 3VS3A 3LGFA 2KE9A 3DKMA 2F5KA 1VQLA 2L0AA 1ZA1B 1BI0A 1NG2A 2XHCA 3ZFJA 3CCEA 3KUFA 3DLLA 1IHVA 4PJMA 3RESA 1Y7XA 1U06A 1KQ2A 1A0NB 1N5ZA 2L2PA 5FWCA 2MWPA 4C92C 2K79A 3CCUT 2IPOB 4E7IA 4M7AE 3SDZA 2HQXA 4R56A 1E6GA 3CCJQ 3CCSA 2RJFA 5C0MA 3QZ5B 2QQRA 5A0GA 4FW2A 2YRDA 1VQKQ 2G6FX 2HAXA 1XJWB 5GANf 4JUVA 4KGZB 2QEXT 2CH4A 4NL3A 2DIGA 6AT1B 1WDXA 2LCLA 4ZGEB 4PFZA 3RKWA 4C0FA 3KBGA 1YFNA 3LX7A 3V7RA 5GANg 3C0CA 1D3BA 2VVKA 3OYGA 3GPLA 1NM7A 1SHGA 2VC8A 1ZSZC 2JS0A 1JO8A 3C95A 1AZGB 1NJIC 1RI0A 4BDYA 4C5HA 1Y07A 1UGSB 5D6YA 5DLQE 2GGRA 3KXTA 2DL7A 1MNEA 2YXYA 1WHGA 1YITA 2AT1B 5LJ3g 4CI0C 2ZAEA 1YJWA 2P0KA 2Y4XA 2KI7A 4X34A 1NPRA 4E7KA 2EYZA 3TSWA 4EMGA 3CXCA 2K9GA 5D7UA 1VQMQ 2KMTA 1TUGB 2JXBA 3META 2BE7D 3OYMA 1MUZA 4DEXA 3OYAA 1BCOA 3P8HA 3M55A 4TVRA 2JW4A 1I1JA 3RMQA 3OW2S 2RHZA 1OOTA 2EW3A 2D0NA 2FVUA 3EFSA 3CMAT 4JPBW 3WVEB 4FM4B 2DL8A 3DLMA 3OA6A 2C06A 3I5RA 3EG2A 1KC8C 2DD4A 1I5OB 4NS5A 5A0DA 4M7AG 1RABB 3HPWA 2CP5A 1ZBJA 2RA2A 4O6JA 4M7DB 1HXDA 3QWXX 4C8QE 4FSSA 2A28A 3LWIA 2JUFA 5HK3A 1ZLMA 3EHRA 3QXEB 1IRXA 1VQPA 2K2VA 1VQNT 1KG1A 2L8DA 1JJ2S 5CKEA 2E6NA 2E10A 4EMKB 3OSVA 4GBQA 4P5NA 2FZKB 3RNJA 2ZGWA 2HNIA 3EGDA 2RM4A 3M9QA 4M77B 4EMHA 1Q82C 1TUDA 4KGVB 3CPWA 5LJ5h 1K1ZA 4XK8E 3EFOB 1OPLA 5HKCA 4OMFB 2JJ9A 4UC4A 2M1HA 5IT9E 1SG5A 5CKFA 1NJIR 1RADB 3H6ZA 2YHTA 1QVPA 4R55A 4RTZA 2H3JA 2KRNA 3JCMV 2LQWA 2H3EB 2L3PA 1WX6A 4JRQA 2JNGA 3CC4T 5EC7A 1ARKA 2LQKA 2QI2A 1TH7A 2QA4Q 1MMAA 4FIBA 1RAGB 2LTOA 4M7AC 3MEUA 2PVOB 4PJJA 1VQ4Q 3I9QA 4OMPA 2FRWA 5KYUB 3DB4A 7AT1B 2CP7A 2KSSA 3I5SA 1X2QA 3VYGA 1WGSA 2YLBA 3FRNA 1VQLQ 3QDFA 2CGHA 2CSIA 3CCEQ 2DM1A 2EAYA 1UJ0A 3CCMA 2HKNA 2YT6A 4PLIA 3SD4A 3JCMf 2OTJT 1KQSS 1KK7A 5FROA 4J8OA 5GMKl 4J9GA 3PVLA 3OYKA 1H3ZA 2FZGB 2D9TA 2DXCA 1QVGS 1W2BP 5KYYB 5IAYA 2RB6A 3CCSQ 2QAZA 4IIMA 1NLOC 2HBWA 3X26B 2GBQA 1UB4A 2A7YA 1EFNA 3A8OB 3ER0A 1X01A 1M30A 3OBYA 2X3XD 1TUCA 5CIUA 3G4ST 1Z9QA 2QTVA 2HL3A 5FU6B 3NTHA 1VQ8T 2DXTA 2RD1A 4LDYA 2RHUA 4RTWA 3O8VA 4M78E 4Z8AA 5GAMj 5GAN7 2LP5A 2PQWA 4MZTA 2B86A 1VQ7T 1U5SA 2DBMA 1Q82R 1WJQA 1NE8A 3SWNB 2K7AA 3A8HB 1VQ9A 4OMOA 2E5KA 3JV3A 1U1SA 2O2OA 2OJ2A 4KT0E 2DL3A 4OB0B 2WSFE 4E2FB 2KBTA 2M0YA 2X4WA 3BFMA 1T3LA 1ZHIA 2DL5A 3MCAB 4PNOA 1MMGA 2DD5A 2COYA 2K5FA 2VGMA 1YITQ 1K9MU 4OF1A 2LNHB 1IGUA 4MZMA 1Z9ZA 3EGUA 4ORZA 4CC7A 2R5AA 4BI3A 1VQ6T 4M75B 1UUEA 4RCCA 2FYKA 5LJ5e 5GAN4 3RKXA 2QYZA 3FIFA 3J80E 3CCUA 2DXBA 3QBYA 1BI2A 5KYNA 4M7DF 5CVIA 1M90U 4E7SA 5KCHA 3NTKA 2O4XA 2E12A 3HTRA 2E4HA 2YUOA 4C92B 2CZ0B 4HCZA 5KYXB 2B8AA 2QEXA 2IG0A 1D1CA 2HQHA 2OI3A 3PT9A 5LJ3h 3FJPA 1OU9A 5GAMf 4XU0A 4XTXA 1U1TA 1R0BG 1TG0A 4KBMB 4M77F 4LDVA 4PJLA 5KYWB 4KRTA 3RDVA 3G6EQ 3LLRA 3MKDA 3L1AA 1CKBA 3M59A 1FXXA 4RTUA 2XDPA 1VQPQ 1WHHA 2W0ZA 1PRLC 1UHFA 4YTLA 2DPPB 1K0SA 1M2VB 3CD6Q 4ZTFA 1QP2A 2GTJA 2M16A 1K8AR 2K6DA 2DETA 1ZSZB 4D6WA 1KD1U 4F7UB 2P0QA 2KT1A 4AG1C 1GCPA 2QQAA 2RI3A 4J9FA 1GBQA 2LZ6B 1OEBA 2W10A 1OV3A 3LW5E 1CKAA 3A8LB 4LDWA 4IURA 3G7ZA 3MEVA 2XICA 3JB9F 2AK5A 2EKHA 2RJCA 2R5MA 1YBYA 3E1SA 4QVZA 5CO7A 1YCYA 1JJ2A 5L8RE 2QDLA 1CSKA 2MOXA 2FRYA 4JLIA 2NWMA 3CMAA 4KUIA 3HRSA 3MHXA 1Q86C 1SHFA 1X75C 3MP1A 4C0GA 2DFUA 3GP8A 2PUOB 3VJPA 3MPUB 3OYNA 1LPLA 2PVGB 2F1LA 2DX1A 2CYZB 3EHQA 2NUTB 3QUIA 4XTYA 4J9HA 3IQLA 3QJ6A 4FYWB 3N5BB 1S72T 3E9FA 3D7SB 2G3RA 3HL8A 3CCMQ 2NYSA 1C6VX 1VQNA 3QHSA 1VYTA 4XU1A 4BE0A 1OX9A 1M8MA 2XK0A 5L23A 4QQGA 1MMNA 4XAXB 1M5Q1 3PMTA 1B34A 3MEAA 2CP3A 1HSQA 4IUUA 1BIAA 2X4YA 2VB6A 4BACA 1Y57A 2AIRB 3PIPA 3CBMA 5LJ5d 1ZX6A 4WCIA 4A63B 2RQRA 1K9AA 3GIBA 1UFFA 1PSEA 2ZPIB 4Q5WA 4CRIA 4OGCA 1G3TA 3QYHB 3G71T 1XOVA 3H0HA 4DEYA 3I55T 2HL5C 2MAMA 4RG8A 1I0CA 2RMOA 2DEUA 1G3SA 1KQSA 2HDAA 1Y96A 2ABLA 2P0PA 2RN8A 1OULA 4K11A 3HFOA 9ATCB 4NOYA 4FCYA 3CC4A 3HSBA 1QVGA 2FL7A 2DO3A 2EJ9A 4HVUA 4C0DC 2PZ1A 2PNIA 2XDDA 1VQ9Q 5IHKA 4QVDA
chains in the Genus database with same CATH topology
2I0NA 2M51A 1UG1A 1H8KA 3EG1A 1SSHA 2EYZA 1KFZA 1W1FA 1NYFA 1ABOA 2EBPA 2C0OA 3TSWA 3VRYA 2K9GA 1V1CA 2KYMA 2JXBA 2KNBB 2DRKA 2JM9A 2LQNA 1MUZA 4J9DA 4DEXA 1QLYA 1NLPC 2JW4A 2D8JA 1G2BA 4J9CA 5HCKA 2EGEA 4JJDA 1I1JA 3VS5A 2O9VA 1Y0MA 2NUZA 1KIKA 3NMZC 1OOTA 1ZUUA 2EW3A 2D0NA 1ZUYA 2KXDA 4JPBW 1QWEA 1M27C 2A08A 2DL8A 2AKKA 3I5RA 3EG2A 4AFZC 1GCQA 2F2XA 3QWYA 2ECZA 2HSPA 2KGTA 3TVTA 2JS2A 3VS6A 2J6OA 3H0FA 1AEYA 1FMKA 1ZBJA 4RUGA 1W6XA 2CSQA 1AWOA 3QWXX 2YSQA 4FSSA 2A28A 4AFUC 4Y92A 2DA9A 3U23A 2VWFA 1ZLMA 3EHRA 1X69A 4RTTA 2CUDA 2LJ3A 2ENMA 3UF4A 4D8DA 2D8HA 1T0JA 4GBQA 1K0XA 3RNJA 2H8HA 4OMLA 1UGVA 3SEMA 2HCKA 1TUDA 3VS0A 5IHIA 1K1ZA 2DVJA 1OPLA 2YUNA 2SRCA 3REBB 2JT4A 2KYBA 4RTXA 2LCSA 5GJVB 1KJWA 2P4RA 3M0SA 2RQWA 3R6NA 1SRMA 4RTZA 2KRNA 2LQWA 1H3HA 2L3PA 1YCSB 2FPFA 4ZNXA 2EYWA 4JZ3A 1WX6A 3GBQA 1PRMC 2YUQA 4IIOA 4RTVA 3UA7A 1WXUA 1BBZA 5EC7A 1ARKA 2K2MA 2AZVA 3PE0A 5IXFA 2O31A 2L3SA 1J3TA 2JMCA 5FWBA 3UATA 2DYBA 2O9SA 3I9QA 2FRWA 4OMPA 4AG2C 3I5SA 2RNAA 1X2QA 2J06A 1AOJA 5IH2A 2DNUA 2J05A 3ZL7C 3NPFA 1G83A 2C0IA 2DMOA 1SRLA 1W70A 1VYUA 2CSIA 2DILA 2DM1A 2GTOA 1UJ0A 2KRSA 1QCFA 2YT6A 2CREA 4OMNA 4LE9A 4J9IA 4HVWA 4J9GA 3PVLA 4J9EA 2RQTA 1SEMA 1PWTA 2CT3A 2J6KA 2EPDA 4IIMA 2KT8A 1NLOC 2HBWA 1UTIA 2EGCA 1GFCA 4HCKA 2GBQA 2RF0A 2EVRA 1M3AA 1EFNA 5I11A 4AFSC 1NEGA 1M30A 2X3XD 1PKTA 1TUCA 1ABQA 1T0HA 1Z9QA 5ECAA 3UA6A 2MIOA 2CT4A 4JJBA 4LNPA 4F16A 4LUDA 4HVVA 4RTWA 2V1RA 4Z8AA 2AKLA 2LP5A 2B86A 1U5SA 2DBMA 2JMAA 1QKXA 1RLPC 2RQUA 2K7AA 3O5ZA 4OMOA 2O88A 2E5KA 3JV3A 2ESWA 2LJ0A 2O2OA 2OJ2A 3TSZA 2BZ8A 1UE9A 2YDLA 1JQQA 2DL3A 5IXBA 2ROLA 3VS2A 1M3CA 2KBTA 2M0YA 3H41A 1BU1A 1JEGA 1T3LA 1WXTA 2ED0A 2JM8A 2DL5A 3H0IA 1PKSA 4JZ4A 2LJ1A 2LNHB 3VS4A 1WA7A 3EG3A 2KEAA 4JJCA 1Z9ZA 3EGUA 4ORZA 2ROTA 4CC7A 3M0PA 4F14A 1U3OA 1UHCA 1UUEA 1OPKA 1T3SA 2CDTA 3ULRB 1QWFA 1BK2A 1QKWA 2A36A 1LCKA 4F17A 2L3QA 3VRZA 2F2VA 2KR3A 2VKNA 2X3WD 1X2KA 2OAWA 4X1VA 3A98A 2YUOA 5GJWB 1ZSGA 1K4US 1MV3A 2DE0X 2EGAA 2F2WA 1YN8A 5IHNA 2OI3A 2MCNA 2K3BA 1NYGA 2XMFA 1SPKA 1AWJA 1FYNA 4GLMA 4AFQC 1TG0A 1X43A 2DLPA 1WXBA 2FPDA 4KRTA 2KXCA 3EG0A 1CKBA 4RTYA 4OMMA 4RTUA 1GFDA 1AD5A 1JXOA 1ZUKA 2HEQA 2YUPA 2W0ZA 2J6FA 1PRLC 1UHFA 2AZSA 2GQIA 3I35A 3VS7A 1AZEA 1GRIA 1K0SA 2KRMA 1RUWA 2GTJA 2D1XA 2K6DA 1PHTA 1BB9A 4Z89A 1YNZA 2J7IA 1RI9A 1HD3A 2KT1A 4AG1C 1GCPA 1X6GA 2DL4A 2EQIA 4J9FA 1GBQA 1B07A 3LH5A 2FPEA 3M0TA 2LZ6B 1OEBA 2W10A 3RBBB 3PVQA 1OV3A 1AVZC 1X6BA 1CKAA 3VS1A 2FO0A 5I22A 2DBKA 1JU5C 4CC3A 2AK5A 2EKHA 4R0KA 2FEIA 2BZXA 4E6RA 2KROA 3FJ5A 2A37A 1KSWA 1E6HA 4EIKA 4ESRA 1WFWA 3VS3A 1WLPB 2KE9A 3SHWA 2CH4W 2QDLA 1YWOA 3M0RA 2IIMA 1CSKA 2MOXA 2L0AA 2FRYA 1AWXA 1GCQC 1NG2A 2NWMA 2BZYA 1B3QA 3KFVA 4LUEA 1K76A 1SHFA 2RPNA 2LMJA 2EYXA 2GNCA 1RLQC 1GL5A 2ED1A 4M4ZA 1U06A 2LX7A 1A0NB 1N5ZA 2L2PA 2BTTA 2SEMA 1PNJA 5FWCA 2DX1A 2K79A 3EHQA 1UECA 4LN2A 1GBRA 1E6GA 2JTEA 4CC4B 5FW9A 4J9HA 2RQVA 4D8KA 3NHNA 4Z88A 3IQLA 1UDLA 4QT7A 3THKA 1E7OA 2DJQA 2EYYA 2FG0A 1WIEA 1IO6A 3M0UA 1VYTA 1WYXA 2G6FX 1M8MA 1WI7A 1YWPA 3M0QA 1M3BA 5L23A 3CQTA 1VYVA 2CH4A 1HSQA 1JXMA 4CC2A 1WDXA 1NEBA 2C0TA 1VA7A 1S1NA 1HJDA 1X27A 1Y57A 1UJYA 1ZX6A 1YP5A 1AWWA 3C0CA 4WCIA 4A63B 2V1QA 2VVKA 1H92A 2RQRA 1NM7A 1I07A 1K9AA 1SHGA 1UFFA 3NGPA 2CUBA 1MV0B 4J9BA 2JS0A 1JO8A 2PTKA 1AZGB 1XOVA 3H0HA 4DEYA 3REAB 1I0CA 2RMOA 2GGRA 2DL7A 2HDAA 4HXJA 4K11A 2ABLA 2RN8A 4HVUA 4OMQA 2PZ1A 2PNIA 2DF6A 5IHKA 2DRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0N A;  2M51 A;  1UG1 A;  1H8K A;  3EG1 A;  1SSH A;  2EYZ A;  1KFZ A;  1W1F A;  1NYF A;  1ABO A;  2EBP A;  2C0O A;  3TSW A;  3VRY A;  2K9G A;  1V1C A;  2KYM A;  2JXB A;  2KNB B;  2DRK A;  2JM9 A;  2LQN A;  1MUZ A;  4J9D A;  4DEX A;  1QLY A;  1NLP C;  2JW4 A;  2D8J A;  1G2B A;  4J9C A;  5HCK A;  2EGE A;  4JJD A;  1I1J A;  3VS5 A;  2O9V A;  1Y0M A;  2NUZ A;  1KIK A;  3NMZ C;  1OOT A;  1ZUU A;  2EW3 A;  2D0N A;  1ZUY A;  2KXD A;  4JPB W;  1QWE A;  1M27 C;  2A08 A;  2DL8 A;  2AKK A;  3I5R A;  3EG2 A;  4AFZ C;  1GCQ A;  2F2X A;  3QWY A;  2ECZ A;  2HSP A;  2KGT A;  3TVT A;  2JS2 A;  3VS6 A;  2J6O A;  3H0F A;  1AEY A;  1FMK A;  1ZBJ A;  4RUG A;  1W6X A;  2CSQ A;  1AWO A;  3QWX X;  2YSQ A;  4FSS A;  2A28 A;  4AFU C;  4Y92 A;  2DA9 A;  3U23 A;  2VWF A;  1ZLM A;  3EHR A;  1X69 A;  4RTT A;  2CUD A;  2LJ3 A;  2ENM A;  3UF4 A;  4D8D A;  2D8H A;  1T0J A;  4GBQ A;  1K0X A;  3RNJ A;  2H8H A;  4OML A;  1UGV A;  3SEM A;  2HCK A;  1TUD A;  3VS0 A;  5IHI A;  1K1Z A;  2DVJ A;  1OPL A;  2YUN A;  2SRC A;  3REB B;  2JT4 A;  2KYB A;  4RTX A;  2LCS A;  5GJV B;  1KJW A;  2P4R A;  3M0S A;  2RQW A;  3R6N A;  1SRM A;  4RTZ A;  2KRN A;  2LQW A;  1H3H A;  2L3P A;  1YCS B;  2FPF A;  4ZNX A;  2EYW A;  4JZ3 A;  1WX6 A;  3GBQ A;  1PRM C;  2YUQ A;  4IIO A;  4RTV A;  3UA7 A;  1WXU A;  1BBZ A;  5EC7 A;  1ARK A;  2K2M A;  2AZV A;  3PE0 A;  5IXF A;  2O31 A;  2L3S A;  1J3T A;  2JMC A;  5FWB A;  3UAT A;  2DYB A;  2O9S A;  3I9Q A;  2FRW A;  4OMP A;  4AG2 C;  3I5S A;  2RNA A;  1X2Q A;  2J06 A;  1AOJ A;  5IH2 A;  2DNU A;  2J05 A;  3ZL7 C;  3NPF A;  1G83 A;  2C0I A;  2DMO A;  1SRL A;  1W70 A;  1VYU A;  2CSI A;  2DIL A;  2DM1 A;  2GTO A;  1UJ0 A;  2KRS A;  1QCF A;  2YT6 A;  2CRE A;  4OMN A;  4LE9 A;  4J9I A;  4HVW A;  4J9G A;  3PVL A;  4J9E A;  2RQT A;  1SEM A;  1PWT A;  2CT3 A;  2J6K A;  2EPD A;  4IIM A;  2KT8 A;  1NLO C;  2HBW A;  1UTI A;  2EGC A;  1GFC A;  4HCK A;  2GBQ A;  2RF0 A;  2EVR A;  1M3A A;  1EFN A;  5I11 A;  4AFS C;  1NEG A;  1M30 A;  2X3X D;  1PKT A;  1TUC A;  1ABQ A;  1T0H A;  1Z9Q A;  5ECA A;  3UA6 A;  2MIO A;  2CT4 A;  4JJB A;  4LNP A;  4F16 A;  4LUD A;  4HVV A;  4RTW A;  2V1R A;  4Z8A A;  2AKL A;  2LP5 A;  2B86 A;  1U5S A;  2DBM A;  2JMA A;  1QKX A;  1RLP C;  2RQU A;  2K7A A;  3O5Z A;  4OMO A;  2O88 A;  2E5K A;  3JV3 A;  2ESW A;  2LJ0 A;  2O2O A;  2OJ2 A;  3TSZ A;  2BZ8 A;  1UE9 A;  2YDL A;  1JQQ A;  2DL3 A;  5IXB A;  2ROL A;  3VS2 A;  1M3C A;  2KBT A;  2M0Y A;  3H41 A;  1BU1 A;  1JEG A;  1T3L A;  1WXT A;  2ED0 A;  2JM8 A;  2DL5 A;  3H0I A;  1PKS A;  4JZ4 A;  2LJ1 A;  2LNH B;  3VS4 A;  1WA7 A;  3EG3 A;  2KEA A;  4JJC A;  1Z9Z A;  3EGU A;  4ORZ A;  2ROT A;  4CC7 A;  3M0P A;  4F14 A;  1U3O A;  1UHC A;  1UUE A;  1OPK A;  1T3S A;  2CDT A;  3ULR B;  1QWF A;  1BK2 A;  1QKW A;  2A36 A;  1LCK A;  4F17 A;  2L3Q A;  3VRZ A;  2F2V A;  2KR3 A;  2VKN A;  2X3W D;  1X2K A;  2OAW A;  4X1V A;  3A98 A;  2YUO A;  5GJW B;  1ZSG A;  1K4U S;  1MV3 A;  2DE0 X;  2EGA A;  2F2W A;  1YN8 A;  5IHN A;  2OI3 A;  2MCN A;  2K3B A;  1NYG A;  2XMF A;  1SPK A;  1AWJ A;  1FYN A;  4GLM A;  4AFQ C;  1TG0 A;  1X43 A;  2DLP A;  1WXB A;  2FPD A;  4KRT A;  2KXC A;  3EG0 A;  1CKB A;  4RTY A;  4OMM A;  4RTU A;  1GFD A;  1AD5 A;  1JXO A;  1ZUK A;  2HEQ A;  2YUP A;  2W0Z A;  2J6F A;  1PRL C;  1UHF A;  2AZS A;  2GQI A;  3I35 A;  3VS7 A;  1AZE A;  1GRI A;  1K0S A;  2KRM A;  1RUW A;  2GTJ A;  2D1X A;  2K6D A;  1PHT A;  1BB9 A;  4Z89 A;  1YNZ A;  2J7I A;  1RI9 A;  1HD3 A;  2KT1 A;  4AG1 C;  1GCP A;  1X6G A;  2DL4 A;  2EQI A;  4J9F A;  1GBQ A;  1B07 A;  3LH5 A;  2FPE A;  3M0T A;  2LZ6 B;  1OEB A;  2W10 A;  3RBB B;  3PVQ A;  1OV3 A;  1AVZ C;  1X6B A;  1CKA A;  3VS1 A;  2FO0 A;  5I22 A;  2DBK A;  1JU5 C;  4CC3 A;  2AK5 A;  2EKH A;  4R0K A;  2FEI A;  2BZX A;  4E6R A;  2KRO A;  3FJ5 A;  2A37 A;  1KSW A;  1E6H A;  4EIK A;  4ESR A;  1WFW A;  3VS3 A;  1WLP B;  2KE9 A;  3SHW A;  2CH4 W;  2QDL A;  1YWO A;  3M0R A;  2IIM A;  1CSK A;  2MOX A;  2L0A A;  2FRY A;  1AWX A;  1GCQ C;  1NG2 A;  2NWM A;  2BZY A;  1B3Q A;  3KFV A;  4LUE A;  1K76 A;  1SHF A;  2RPN A;  2LMJ A;  2EYX A;  2GNC A;  1RLQ C;  1GL5 A;  2ED1 A;  4M4Z A;  1U06 A;  2LX7 A;  1A0N B;  1N5Z A;  2L2P A;  2BTT A;  2SEM A;  1PNJ A;  5FWC A;  2DX1 A;  2K79 A;  3EHQ A;  1UEC A;  4LN2 A;  1GBR A;  1E6G A;  2JTE A;  4CC4 B;  5FW9 A;  4J9H A;  2RQV A;  4D8K A;  3NHN A;  4Z88 A;  3IQL A;  1UDL A;  4QT7 A;  3THK A;  1E7O A;  2DJQ A;  2EYY A;  2FG0 A;  1WIE A;  1IO6 A;  3M0U A;  1VYT A;  1WYX A;  2G6F X;  1M8M A;  1WI7 A;  1YWP A;  3M0Q A;  1M3B A;  5L23 A;  3CQT A;  1VYV A;  2CH4 A;  1HSQ A;  1JXM A;  4CC2 A;  1WDX A;  1NEB A;  2C0T A;  1VA7 A;  1S1N A;  1HJD A;  1X27 A;  1Y57 A;  1UJY A;  1ZX6 A;  1YP5 A;  1AWW A;  3C0C A;  4WCI A;  4A63 B;  2V1Q A;  2VVK A;  1H92 A;  2RQR A;  1NM7 A;  1I07 A;  1K9A A;  1SHG A;  1UFF A;  3NGP A;  2CUB A;  1MV0 B;  4J9B A;  2JS0 A;  1JO8 A;  2PTK A;  1AZG B;  1XOV A;  3H0H A;  4DEY A;  3REA B;  1I0C A;  2RMO A;  2GGR A;  2DL7 A;  2HDA A;  4HXJ A;  4K11 A;  2ABL A;  2RN8 A;  4HVU A;  4OMQ A;  2PZ1 A;  2PNI A;  2DF6 A;  5IHK A;  2DRM A; 
#chains in the Genus database with same CATH topology
 3OQ5 A;  3ASK A;  2E70 A;  5LJ3 e;  4C5G A;  2EQJ A;  3V8K A;  2OX7 A;  3EG1 A;  4VUB A;  1M1K R;  4M75 F;  1W1F A;  1NYF A;  2C0O A;  2DXU A;  4DOW A;  3SFM A;  1YJ9 A;  4N0A A;  1V1C A;  2R57 A;  2DRK A;  1SF9 A;  1B7T A;  5DM7 R;  1QLY A;  2QGF B;  1NLP C;  4BE2 A;  5HCK A;  4J9C A;  4DQ2 A;  2EGE A;  1BI1 A;  2FZC B;  4JJD A;  4L59 A;  3A5Z B;  3VS5 A;  4HT8 A;  2NUZ A;  1PCX A;  1NBE B;  1KIK A;  5GAN 5;  3NMZ C;  3I56 A;  1AT1 B;  2LX9 A;  3M57 A;  1ZUY A;  3CC2 Q;  4C92 F;  2KXD A;  4Y91 A;  2AKK A;  3OY9 A;  1GCQ A;  1RAF B;  2F2X A;  3CCU Q;  1TWB A;  2KGT A;  2J6O A;  1M1F A;  1QCO A;  2DEQ A;  4N4G A;  1EZZ B;  3QDR B;  5I2M A;  1Y71 A;  2KQW A;  3MP8 A;  1X6O A;  3G4S A;  2QEX Q;  4RTT A;  4X9C A;  2CUD A;  2ENM A;  3VKI A;  2X9H A;  3NTI A;  3UF4 A;  2NUP B;  3TRE A;  1BKB A;  2E65 A;  4C8Q A;  4F7U F;  2MMP A;  1VQ7 A;  4PFP A;  1KQ1 A;  3VS0 A;  5GAO m;  2ZCF B;  3CCL T;  2YUN A;  2SRC A;  4C8Q D;  5GJV B;  4HT9 A;  4ME7 A;  2F5T X;  4RG2 A;  2RQW A;  3R6N A;  2QAS A;  2FHD A;  2WSC E;  2ZPG B;  1W2B S;  2QGG A;  4JZ3 A;  5M9O A;  3GBQ A;  1PRM C;  4IIO A;  3UA7 A;  3VYH B;  3OYC A;  1WXU A;  1R77 A;  5KCO A;  1JBM A;  2O31 A;  1KHC A;  2L3S A;  1VQ6 A;  3CCJ T;  2JMC A;  4ZN3 A;  1EIF A;  1IZ6 A;  3CCV A;  1I4K 1;  1LOJ A;  2DYB A;  5GAN d;  1Q86 U;  2J06 A;  2EWN A;  5CAI A;  2DNU A;  2J05 A;  3ZL7 C;  1VQK T;  2ZPE B;  2C0I A;  4C5I A;  2K5L A;  2RJD A;  4PJO A;  1PG5 B;  3CMA Q;  4A4F A;  2ZPB B;  2ZZD A;  1QCF A;  2CRE A;  1K9M C;  3MJX A;  4OMN A;  3FLG A;  4PJO D;  5LJ3 d;  3JCM Q;  2DVE A;  2KVQ G;  2DKG A;  2CT3 A;  5FLX E;  3CPW P;  4HKE A;  1QVF P;  2LNV A;  5EG2 A;  3V7C A;  3OYB A;  1D0Y A;  2RF0 A;  2QXF A;  3AHU A;  2RO0 A;  1M3A A;  5I11 A;  4HCC A;  4AFS C;  2JTM A;  1VQN Q;  3GNG A;  1T0H A;  1XTD A;  3JCM W;  4IUP A;  5ECA A;  1M90 C;  5AT1 B;  1QP3 A;  2CT4 A;  2E41 A;  4JJB A;  4LNP A;  4HVV A;  3OSS C;  5J3B A;  1F1B B;  3HP9 A;  3WXM B;  3HRU A;  2JMA A;  5FRM A;  4FL6 A;  4XQ3 A;  2O88 A;  2ESW A;  2LJ0 A;  4QQD A;  3TSZ A;  1BYM A;  4FYY B;  4DA4 A;  4M78 A;  1JQQ A;  3OS5 A;  1ZA2 B;  1M3C A;  3H41 A;  1BU1 A;  1JEG A;  3J7A F;  1VQ5 A;  4M7A F;  1LVK A;  3CC4 Q;  4M78 D;  3CCR A;  2LJ1 A;  2CP2 A;  4WTO B;  5CCA A;  2LT1 A;  1KD1 C;  1U3O A;  2HSE B;  1O75 A;  3T9N A;  2CDT A;  1YJ9 Q;  1YI2 T;  3UT1 A;  1QWF A;  2HZY A;  1BK2 A;  2LDM A;  1R0C B;  4MZP A;  4EDU A;  5KYY A;  3VRZ A;  1LJO A;  2KR3 A;  1WQW A;  3I56 Q;  4PJO E;  1X2K A;  1RAH B;  2D6F A;  2FB7 A;  4M7D E;  2EJG A;  1Q81 U;  3A98 A;  1ZSG A;  1K4U S;  2V8J A;  3F70 A;  2E64 A;  1K9M R;  2F2W A;  4J83 A;  2EFI A;  1NYG A;  1WPY A;  2YRV A;  4AFQ C;  4RCB A;  1X43 A;  2XI9 A;  3EGD B;  3OMG A;  3JB9 I;  2P84 A;  4M77 E;  1LNX A;  3PNW C;  4RTY A;  3L2Q A;  1V29 B;  3G4S Q;  1GFD A;  5I21 A;  1JXO A;  2L3R A;  1ZUK A;  3G71 A;  1KC8 R;  2AZS A;  2GQI A;  3I35 A;  3VS7 A;  1M90 R;  1GRI A;  1RUW A;  2E6Z A;  3E19 A;  2QA4 T;  3JCM g;  1PHT A;  1VQO A;  3PMI A;  1VQ7 Q;  4Z89 A;  1YNZ A;  4C8Q G;  2NLU A;  1RI9 A;  1HD3 A;  1VQ4 T;  3MEW A;  3JB9 H;  5FU7 C;  2DL4 A;  3JB9 J;  1YIJ A;  1WHL A;  1N9R A;  3M0T A;  4A53 A;  4N0A C;  3OBW A;  2K3X A;  1QW1 A;  1AHJ B;  2FO0 A;  5I22 A;  4KUD K;  4IKF A;  2DBK A;  3QSU A;  1VQL T;  3CBO A;  4Z02 A;  4LD6 A;  1WHM A;  4C0D B;  3CCE T;  5D6X A;  4E6R A;  3FJ5 A;  2A37 A;  4J6X A;  4JLG A;  5CK9 A;  1KSW A;  2V8K A;  2RHY A;  1FX7 A;  5GAO n;  1I81 A;  2CH4 W;  4EPC A;  5J39 A;  4XTZ A;  1YWO A;  3M0R A;  2IIM A;  5GAO q;  2R58 A;  1GCQ C;  2BZY A;  1B3Q A;  2JTF A;  4LUE A;  3GF5 A;  2LMJ A;  2EYX A;  3CCV Q;  1RLQ C;  4IUQ A;  1YHQ A;  1FWZ A;  2ED1 A;  3L2W A;  4M4Z A;  2RK1 A;  5A0L A;  2LX7 A;  1D1A A;  4E7L A;  2SEM A;  1PNJ A;  1TXQ A;  1UEB A;  4LN2 A;  1YJW Q;  2JTE A;  5FW9 A;  2RQV A;  4Z88 A;  4QT7 A;  1UDL A;  4PFO A;  4LD9 K;  1PC0 A;  4PJO G;  1YJN T;  1E7O A;  1BIB A;  2EYY A;  2CP0 A;  5GAN h;  1WIE A;  3JCM X;  3M0U A;  4BI8 B;  1WYX A;  4C8Q C;  3M0Q A;  3CCQ T;  1M3B A;  4QKU A;  2X4J A;  1VYV A;  4CC2 A;  3V7S A;  1NEB A;  4O5V A;  5KH6 A;  2C0T A;  1S1N A;  2E3I A;  2P4T A;  1X27 A;  1M9S A;  2DJZ A;  2DTI A;  2GF7 A;  2EQM A;  1ACM B;  1AWW A;  1OZ3 A;  3EH2 A;  1H92 A;  1I07 A;  3NGP A;  4J9B A;  1YIT T;  2PTK A;  3REA B;  1JJ2 P;  1WHK A;  2QQB A;  2QG9 B;  2MI6 A;  1UGP B;  2LCC A;  4HXJ A;  3RMS A;  3FB9 A;  5CQX A;  5GAM g;  3H9N A;  3OW2 A;  5LJ5 j;  3CCJ A;  5GAO r;  1H8K A;  1SSH A;  1KFZ A;  5DY9 A;  4GY5 A;  4M78 G;  3JCM P;  4E7J A;  1R8O B;  2KYM A;  1WJS A;  2KNB B;  4M75 E;  2JM9 A;  3EH1 A;  4PJO C;  2LQN A;  4J9D A;  1VQ5 Q;  1N8R C;  1KHI A;  4PKC C;  1G2B A;  5GAO l;  3CCR Q;  4BD3 A;  3VUZ A;  1Y0M A;  3LGL A;  1Q7Y C;  3TEE A;  1ZUU A;  1MGQ A;  1K73 U;  2O4X B;  1QWE A;  3G6E T;  4C92 E;  2F69 A;  2OTL T;  2ECZ A;  4BDZ A;  3VS6 A;  2Z0W A;  1AEY A;  2D0Q B;  1WHJ A;  2K4Y A;  2DTH A;  3EGX A;  2XG8 D;  2RHI A;  2GFA A;  3CD6 T;  2K57 A;  4FW1 A;  2MK5 A;  4Y92 A;  1PSF A;  3J81 E;  2VWF A;  3QII A;  5GAN 2;  4BB7 A;  1WZO A;  2PU9 B;  4QW2 A;  2BUD A;  2YWW A;  2H8H A;  2E3H A;  1UGV A;  2HCK A;  4M78 C;  2LT4 A;  5IHI A;  4F7U E;  2DVJ A;  1TU0 B;  1RAI B;  2HKQ B;  2VXE A;  5LJ5 f;  3REB B;  4OB3 B;  4LDU A;  2JT4 A;  2LC4 A;  3G71 Q;  2LCS A;  2RI2 A;  2COZ A;  1KJW A;  3OS0 A;  3LYI A;  1IRE B;  2M0O A;  3M0S A;  3S3O A;  1VQO Q;  4FYV B;  5GAN e;  2HQE A;  3RER A;  1H3H A;  1I5L A;  2YLC A;  2VV5 A;  2FPF A;  4ZNX A;  2EYW A;  3S3N A;  2CZ7 B;  3CPW S;  1YIJ Q;  2YUQ A;  4RTV A;  2DZC A;  1QVF S;  3PE0 A;  2AZV A;  5AYF A;  2EQU A;  2KY9 A;  5IXF A;  2EIF A;  3OYH A;  1YI2 A;  5FWB A;  3BE3 A;  2VXF A;  3UAT A;  3CME T;  4ZTJ A;  2O9S A;  1K8A U;  3OYY A;  2A3L A;  1D0X A;  2K3Y A;  3EG9 A;  5IH2 A;  4C5E A;  2CZ6 B;  4BY6 C;  3S3M A;  2WSE E;  4JS5 A;  5CKD A;  1G83 A;  2EKO A;  1BI3 A;  1SRL A;  5IN1 A;  1W70 A;  1VYU A;  3JCM h;  4GLK A;  4OP0 A;  5GAN 6;  4Y28 E;  2KRS A;  3UPU A;  4PLL A;  2QQ9 A;  1YHQ Q;  1IHW A;  3HRT A;  3OS2 A;  2HMA A;  4LE9 A;  1UGQ B;  4HVW A;  3S6W A;  4M7A B;  4J9E A;  4DBQ A;  4RMO A;  1B34 B;  4ZN1 A;  4A4G A;  3M53 A;  1XQH A;  2RHX A;  2EGC A;  4FT2 A;  2RI5 A;  1Q86 R;  4HCK A;  2O01 E;  2PVD B;  2OTJ A;  2X51 A;  2EVR A;  2CS7 A;  1NEG A;  4WF2 A;  3ME9 A;  1PKT A;  3A1P A;  1RAA B;  4L5G A;  5J26 A;  4FT4 A;  2ATC B;  1G3Y A;  2MIO A;  2JOY A;  2VUB A;  3JCM b;  4LUD A;  3JCM c;  1Q81 C;  2ZPF B;  1SKU B;  1V76 A;  3EFR A;  1IGQ A;  2MYS A;  4OVA A;  1N27 A;  1Y96 B;  4QQ6 A;  3C4S A;  1QKX A;  1VQ8 A;  3QPH A;  3HKS A;  1IXD A;  1P92 A;  3L42 A;  2BZ8 A;  3CC7 T;  2ROL A;  3M54 A;  3VS2 A;  5FU7 B;  3L2U A;  1VIF A;  2BKD N;  3LWH A;  4DBH A;  3CC2 T;  2ED0 A;  3H0I A;  2QDY B;  4XU2 A;  3TCJ A;  4ZGD B;  3SB2 A;  4E7H A;  4JZ4 A;  4A4E A;  1RL2 A;  3CXC P;  4AT1 B;  3VS4 A;  1N8R U;  5GMK j;  1WA7 A;  3EG3 A;  3BDU A;  2KEA A;  4JJC A;  2ROT A;  1C1A A;  1RAE B;  2GQV A;  3M0P A;  1Q7Y U;  2QK0 A;  1G3W A;  1OPK A;  1T3S A;  3GNF B;  5CR2 A;  2RK2 A;  4B9W A;  2A36 A;  3RKY A;  1LCK A;  3L2Z A;  2I2L A;  3RR6 A;  2L3Q A;  2AHJ B;  2F2V A;  2VKN A;  1TSF A;  1O9S A;  1YJN A;  2X3W D;  3C12 A;  1M1K U;  4JDS A;  2V26 A;  4J7I A;  4X1V A;  1QQJ A;  4A4K A;  5GJW B;  3CCQ A;  2DAQ A;  1MV3 A;  4ELZ C;  2DE0 X;  2EGA A;  2QQS A;  4XTU A;  4JJN K;  2MCN A;  3TU4 K;  5GAM h;  3RUX A;  4PK4 A;  2CZ1 B;  3EAE A;  2XMF A;  1SPK A;  3JAM E;  1JRI A;  4JS4 A;  1FYN A;  2DTO A;  4GLM A;  5I2S A;  5LJ3 f;  4C8Q B;  4DOV A;  4M7D A;  2DLP A;  2X4X A;  3PGG A;  3EG0 A;  2K5I A;  3E2U A;  5CQY A;  4IUV A;  1IB8 A;  4N4H A;  2HEQ A;  1MMD A;  2J6F A;  4M7D D;  1AZE A;  1M2O A;  4EMK A;  3OYI A;  2D1X A;  1VOM A;  1Q81 R;  3JCM e;  4M77 A;  2J7I A;  1OX8 A;  3HFN A;  1D3B B;  3EFO A;  1X6G A;  2EQI A;  3LH5 A;  2L5Q A;  3PVQ A;  1AVZ C;  1X6B A;  3QO3 A;  4C0Z A;  3BW1 A;  3VS1 A;  4M77 D;  3L2V A;  3OYD A;  1JU5 C;  4V2S A;  1D0Z A;  4R0K A;  3CEY A;  3MP6 A;  2FEI A;  2E1H A;  3BDL A;  3TQ7 P;  5GAN 8;  3BY7 A;  2KRO A;  1VQM T;  4E47 A;  4EIK A;  2OAU A;  4J5Y A;  2X35 A;  2BE9 B;  5GAO p;  1WLP B;  3GOX A;  2WAC A;  3SHW A;  4JRI A;  2A0F B;  1AWX A;  4PJO B;  3KFV A;  1K76 A;  2RPN A;  3WVD B;  1YI2 Q;  1PM3 A;  2GNC A;  3G6E A;  1MHN A;  1GL5 A;  5KYU A;  1UGR B;  2GFU A;  2OTL A;  1WJR A;  1W4S A;  1QMC A;  2BTT A;  2RJE A;  4MDX A;  1UEC A;  4ELY C;  1GBR A;  2GCX A;  1M1G A;  3JB9 D;  3CD6 A;  4CC4 B;  2JN0 A;  1WQ7 A;  2KDS A;  4D8K A;  3NHN A;  3THK A;  1M8V A;  3FC3 A;  5LL6 S;  2VAS A;  5KE3 A;  2DJQ A;  2FG0 A;  4HA8 A;  1IO6 A;  1QVF A;  1WI7 A;  1YWP A;  4E7Z A;  3CQT A;  3R6O A;  5C6S A;  1JXM A;  1K73 C;  8ATC B;  4A4H A;  1S72 A;  4ATO A;  1VA7 A;  1HJD A;  3VUB A;  3QJY A;  1BCM A;  2OTJ Q;  1UJY A;  1YP5 A;  2IVW A;  1M4Z A;  2MWO A;  2V1Q A;  1C0M A;  3X28 B;  2CUB A;  5CKB A;  1MV0 B;  1FMV A;  3RIR A;  3JSC A;  4M78 B;  4B6M A;  3QYG B;  2XDB A;  1XNI A;  3OYL A;  1YJ9 T;  1HYO A;  3SWN A;  1VQ8 Q;  4OMQ A;  2DF6 A;  5GAM e;  2DRM A;  2I0N A;  3I55 A;  2M51 A;  4OB1 B;  1UG1 A;  3CME A;  5KE2 A;  1ABO A;  2EBP A;  3VRY A;  1OYX A;  3I56 T;  2E5Q A;  4JRK A;  3OYF A;  1I8F A;  2PUK B;  4L6V 5;  2BIV A;  2D8J A;  2DYI A;  2O9V A;  1NZ9 A;  1JB0 E;  3A8G B;  3JCM d;  4PL6 A;  4M75 A;  1OQK A;  4BY6 B;  1M27 C;  4A54 A;  2A08 A;  8AT1 B;  4AFZ C;  4ZGJ B;  3QWY A;  3M4Y A;  2HSP A;  3X25 B;  3TVT A;  2JS2 A;  3H0F A;  4M75 D;  4C8Q F;  1FMK A;  4RUG A;  1K8A C;  1W6X A;  2DIQ A;  1VQ6 Q;  1YJN Q;  3CCS T;  1EX4 A;  4DBF A;  4XTW A;  2CSQ A;  4J7F A;  1KD1 R;  2YSQ A;  1AWO A;  1NJI U;  1OU8 A;  3AT1 B;  3G1J A;  4AFU C;  4C92 A;  2COW A;  2DA9 A;  3U23 A;  3V8L A;  3CCQ Q;  5KYX A;  1X69 A;  2KK4 A;  2XKO C;  2LJ3 A;  3URG A;  4D8D A;  4MDW A;  1G5V A;  1G8X A;  2D8H A;  2EYQ A;  1T0J A;  4C92 D;  1K73 R;  1K0X A;  4OML A;  4KGX B;  3Q1J A;  5KYW A;  4OGE A;  4FU6 A;  2EQK A;  3SEM A;  3OW2 P;  1W2B A;  1OZ2 A;  4M7D G;  3CBP A;  2RH2 A;  4X9D A;  2KYB A;  3UDC A;  4RTX A;  3VV0 A;  3CC7 A;  1VIE A;  3QKJ A;  1M2V A;  1OI1 A;  2P4R A;  4AMC A;  2XU8 A;  3M56 A;  4DBR A;  3CC2 A;  1ZSZ A;  1SRM A;  4F7U A;  3CCL A;  3CCV T;  5FRN A;  1YCS B;  2DK3 A;  4M77 G;  3CPF A;  3L2R A;  3JRZ A;  3VU3 C;  4BUG A;  1BBZ A;  1KC8 U;  3PFS A;  4LXC A;  2YRC A;  2K2M A;  4PJO F;  4OB2 B;  3FDR A;  1YJW T;  1J3T A;  2LQ8 A;  4AG2 C;  3C94 A;  2L89 A;  2RNA A;  1AOJ A;  1ZQ1 A;  3NPF A;  1MND A;  3P8B B;  2DMO A;  1QCN A;  2DIL A;  3ZEH A;  3OB9 A;  1WNL A;  4J6W A;  2GTO A;  5GAN 3;  1D1B A;  4BI4 A;  2OTL Q;  1VQK A;  2HD0 A;  3JB9 G;  1PD0 A;  4M7D C;  4J9I A;  1Q82 U;  5GAM d;  1NPP A;  2RQT A;  3FEO A;  1SEM A;  4BE1 A;  4NL2 A;  2NUT A;  1PWT A;  2J6K A;  2EPD A;  1VUB A;  3X24 B;  2KT8 A;  1UTI A;  1GFC A;  1HK9 A;  3OMC A;  3QZ9 B;  1ZBX A;  4PJN A;  2HBP A;  1D09 B;  1Q95 G;  2JVV A;  4EMK C;  5GMK h;  3CXC S;  3M4G A;  1ABQ A;  2LRQ A;  4M77 C;  1VQP T;  4KUL A;  4M78 F;  5HK0 A;  3UA6 A;  4F04 B;  1M1K C;  4F16 A;  2V8I A;  2V1R A;  1S72 Q;  2AKL A;  2LVM A;  4MMK A;  4FSX A;  1H64 1;  3M5A A;  1RLP C;  3OS1 A;  2RQU A;  2CKK A;  1VQ5 T;  3O5Z A;  4MML A;  1KQS P;  3NFC A;  3CCR T;  2VYT A;  1UE9 A;  2YDL A;  5IXB A;  1QVG P;  2KAF A;  1VQM A;  5A2Q E;  5GMK m;  2Y90 A;  3H8Z A;  1WXT A;  2JM8 A;  4JRP A;  1PKS A;  3MO8 A;  5D6W A;  4XTV A;  3I55 Q;  2JZ2 A;  1PD1 A;  3CME Q;  1FMW A;  4J6Y A;  4F14 A;  1UHC A;  4QVC A;  3ULR B;  5LJ5 g;  1U8R A;  5CKH A;  1QKW A;  2DER A;  4M7A A;  1N6A A;  3UWN A;  3P8D A;  4F17 A;  4LDX A;  3EGX B;  3OYJ A;  3ZBD A;  2MPX C;  2OAW A;  4KH1 B;  1RAC B;  4XU3 A;  4HCB A;  4N4I A;  4M7A D;  4M75 G;  3CCM T;  1YN8 A;  5IHN A;  4B9X A;  2K3B A;  1N8R R;  2EJF A;  3QG1 A;  1TOV A;  2QTX A;  5HY6 A;  1AWJ A;  4II1 A;  2XD0 A;  2MF2 A;  5GMK i;  3E9G A;  1Q7Y R;  5FU6 C;  3DB3 A;  4ANJ A;  1WXB A;  2FPD A;  2KXC A;  2M02 A;  1VQO T;  3HHT B;  4OMM A;  1AD5 A;  1GXI E;  5DLO A;  2DZ9 A;  4C92 G;  2YUP A;  2VGN A;  1YIJ T;  5GAN j;  1N9S A;  3X20 B;  2NUP A;  4IUT A;  3M58 A;  2KRM A;  3SWN C;  1BB9 A;  3LH0 A;  3PIO A;  3GLX A;  4RKU E;  1SSF A;  3A8M B;  4FYX B;  1DJ7 B;  1B07 A;  2FPE A;  3PTA A;  2CP6 A;  3RBB B;  3OYE A;  1VQ9 T;  3CC7 Q;  2QA4 A;  3JCM J;  2ZPH B;  2Y4Y A;  3INZ A;  4CC3 A;  1VQ4 A;  5LJ3 j;  2BZX A;  4KH0 B;  3CCL Q;  1E6H A;  5GMK e;  2XID A;  2M9U A;  4ESR A;  1TS9 A;  3EG9 B;  1YHQ T;  1WFW A;  4F7U G;  3V8J A;  1TTH B;  4M75 C;  3VS3 A;  3LGF A;  2KE9 A;  3DKM A;  2F5K A;  1VQL A;  2L0A A;  1ZA1 B;  1BI0 A;  1NG2 A;  2XHC A;  3ZFJ A;  3CCE A;  3KUF A;  3DLL A;  1IHV A;  4PJM A;  3RES A;  1Y7X A;  1U06 A;  1KQ2 A;  1A0N B;  1N5Z A;  2L2P A;  5FWC A;  2MWP A;  4C92 C;  2K79 A;  3CCU T;  2IPO B;  4E7I A;  4M7A E;  3SDZ A;  2HQX A;  4R56 A;  1E6G A;  3CCJ Q;  3CCS A;  2RJF A;  5C0M A;  3QZ5 B;  2QQR A;  5A0G A;  4FW2 A;  2YRD A;  1VQK Q;  2G6F X;  2HAX A;  1XJW B;  5GAN f;  4JUV A;  4KGZ B;  2QEX T;  2CH4 A;  4NL3 A;  2DIG A;  6AT1 B;  1WDX A;  2LCL A;  4ZGE B;  4PFZ A;  3RKW A;  4C0F A;  3KBG A;  1YFN A;  3LX7 A;  3V7R A;  5GAN g;  3C0C A;  1D3B A;  2VVK A;  3OYG A;  3GPL A;  1NM7 A;  1SHG A;  2VC8 A;  1ZSZ C;  2JS0 A;  1JO8 A;  3C95 A;  1AZG B;  1NJI C;  1RI0 A;  4BDY A;  4C5H A;  1Y07 A;  1UGS B;  5D6Y A;  5DLQ E;  2GGR A;  3KXT A;  2DL7 A;  1MNE A;  2YXY A;  1WHG A;  1YIT A;  2AT1 B;  5LJ3 g;  4CI0 C;  2ZAE A;  1YJW A;  2P0K A;  2Y4X A;  2KI7 A;  4X34 A;  1NPR A;  4E7K A;  2EYZ A;  3TSW A;  4EMG A;  3CXC A;  2K9G A;  5D7U A;  1VQM Q;  2KMT A;  1TUG B;  2JXB A;  3MET A;  2BE7 D;  3OYM A;  1MUZ A;  4DEX A;  3OYA A;  1BCO A;  3P8H A;  3M55 A;  4TVR A;  2JW4 A;  1I1J A;  3RMQ A;  3OW2 S;  2RHZ A;  1OOT A;  2EW3 A;  2D0N A;  2FVU A;  3EFS A;  3CMA T;  4JPB W;  3WVE B;  4FM4 B;  2DL8 A;  3DLM A;  3OA6 A;  2C06 A;  3I5R A;  3EG2 A;  1KC8 C;  2DD4 A;  1I5O B;  4NS5 A;  5A0D A;  4M7A G;  1RAB B;  3HPW A;  2CP5 A;  1ZBJ A;  2RA2 A;  4O6J A;  4M7D B;  1HXD A;  3QWX X;  4C8Q E;  4FSS A;  2A28 A;  3LWI A;  2JUF A;  5HK3 A;  1ZLM A;  3EHR A;  3QXE B;  1IRX A;  1VQP A;  2K2V A;  1VQN T;  1KG1 A;  2L8D A;  1JJ2 S;  5CKE A;  2E6N A;  2E10 A;  4EMK B;  3OSV A;  4GBQ A;  4P5N A;  2FZK B;  3RNJ A;  2ZGW A;  2HNI A;  3EGD A;  2RM4 A;  3M9Q A;  4M77 B;  4EMH A;  1Q82 C;  1TUD A;  4KGV B;  3CPW A;  5LJ5 h;  1K1Z A;  4XK8 E;  3EFO B;  1OPL A;  5HKC A;  4OMF B;  2JJ9 A;  4UC4 A;  2M1H A;  5IT9 E;  1SG5 A;  5CKF A;  1NJI R;  1RAD B;  3H6Z A;  2YHT A;  1QVP A;  4R55 A;  4RTZ A;  2H3J A;  2KRN A;  3JCM V;  2LQW A;  2H3E B;  2L3P A;  1WX6 A;  4JRQ A;  2JNG A;  3CC4 T;  5EC7 A;  1ARK A;  2LQK A;  2QI2 A;  1TH7 A;  2QA4 Q;  1MMA A;  4FIB A;  1RAG B;  2LTO A;  4M7A C;  3MEU A;  2PVO B;  4PJJ A;  1VQ4 Q;  3I9Q A;  4OMP A;  2FRW A;  5KYU B;  3DB4 A;  7AT1 B;  2CP7 A;  2KSS A;  3I5S A;  1X2Q A;  3VYG A;  1WGS A;  2YLB A;  3FRN A;  1VQL Q;  3QDF A;  2CGH A;  2CSI A;  3CCE Q;  2DM1 A;  2EAY A;  1UJ0 A;  3CCM A;  2HKN A;  2YT6 A;  4PLI A;  3SD4 A;  3JCM f;  2OTJ T;  1KQS S;  1KK7 A;  5FRO A;  4J8O A;  5GMK l;  4J9G A;  3PVL A;  3OYK A;  1H3Z A;  2FZG B;  2D9T A;  2DXC A;  1QVG S;  1W2B P;  5KYY B;  5IAY A;  2RB6 A;  3CCS Q;  2QAZ A;  4IIM A;  1NLO C;  2HBW A;  3X26 B;  2GBQ A;  1UB4 A;  2A7Y A;  1EFN A;  3A8O B;  3ER0 A;  1X01 A;  1M30 A;  3OBY A;  2X3X D;  1TUC A;  5CIU A;  3G4S T;  1Z9Q A;  2QTV A;  2HL3 A;  5FU6 B;  3NTH A;  1VQ8 T;  2DXT A;  2RD1 A;  4LDY A;  2RHU A;  4RTW A;  3O8V A;  4M78 E;  4Z8A A;  5GAM j;  5GAN 7;  2LP5 A;  2PQW A;  4MZT A;  2B86 A;  1VQ7 T;  1U5S A;  2DBM A;  1Q82 R;  1WJQ A;  1NE8 A;  3SWN B;  2K7A A;  3A8H B;  1VQ9 A;  4OMO A;  2E5K A;  3JV3 A;  1U1S A;  2O2O A;  2OJ2 A;  4KT0 E;  2DL3 A;  4OB0 B;  2WSF E;  4E2F B;  2KBT A;  2M0Y A;  2X4W A;  3BFM A;  1T3L A;  1ZHI A;  2DL5 A;  3MCA B;  4PNO A;  1MMG A;  2DD5 A;  2COY A;  2K5F A;  2VGM A;  1YIT Q;  1K9M U;  4OF1 A;  2LNH B;  1IGU A;  4MZM A;  1Z9Z A;  3EGU A;  4ORZ A;  4CC7 A;  2R5A A;  4BI3 A;  1VQ6 T;  4M75 B;  1UUE A;  4RCC A;  2FYK A;  5LJ5 e;  5GAN 4;  3RKX A;  2QYZ A;  3FIF A;  3J80 E;  3CCU A;  2DXB A;  3QBY A;  1BI2 A;  5KYN A;  4M7D F;  5CVI A;  1M90 U;  4E7S A;  5KCH A;  3NTK A;  2O4X A;  2E12 A;  3HTR A;  2E4H A;  2YUO A;  4C92 B;  2CZ0 B;  4HCZ A;  5KYX B;  2B8A A;  2QEX A;  2IG0 A;  1D1C A;  2HQH A;  2OI3 A;  3PT9 A;  5LJ3 h;  3FJP A;  1OU9 A;  5GAM f;  4XU0 A;  4XTX A;  1U1T A;  1R0B G;  1TG0 A;  4KBM B;  4M77 F;  4LDV A;  4PJL A;  5KYW B;  4KRT A;  3RDV A;  3G6E Q;  3LLR A;  3MKD A;  3L1A A;  1CKB A;  3M59 A;  1FXX A;  4RTU A;  2XDP A;  1VQP Q;  1WHH A;  2W0Z A;  1PRL C;  1UHF A;  4YTL A;  2DPP B;  1K0S A;  1M2V B;  3CD6 Q;  4ZTF A;  1QP2 A;  2GTJ A;  2M16 A;  1K8A R;  2K6D A;  2DET A;  1ZSZ B;  4D6W A;  1KD1 U;  4F7U B;  2P0Q A;  2KT1 A;  4AG1 C;  1GCP A;  2QQA A;  2RI3 A;  4J9F A;  1GBQ A;  2LZ6 B;  1OEB A;  2W10 A;  1OV3 A;  3LW5 E;  1CKA A;  3A8L B;  4LDW A;  4IUR A;  3G7Z A;  3MEV A;  2XIC A;  3JB9 F;  2AK5 A;  2EKH A;  2RJC A;  2R5M A;  1YBY A;  3E1S A;  4QVZ A;  5CO7 A;  1YCY A;  1JJ2 A;  5L8R E;  2QDL A;  1CSK A;  2MOX A;  2FRY A;  4JLI A;  2NWM A;  3CMA A;  4KUI A;  3HRS A;  3MHX A;  1Q86 C;  1SHF A;  1X75 C;  3MP1 A;  4C0G A;  2DFU A;  3GP8 A;  2PUO B;  3VJP A;  3MPU B;  3OYN A;  1LPL A;  2PVG B;  2F1L A;  2DX1 A;  2CYZ B;  3EHQ A;  2NUT B;  3QUI A;  4XTY A;  4J9H A;  3IQL A;  3QJ6 A;  4FYW B;  3N5B B;  1S72 T;  3E9F A;  3D7S B;  2G3R A;  3HL8 A;  3CCM Q;  2NYS A;  1C6V X;  1VQN A;  3QHS A;  1VYT A;  4XU1 A;  4BE0 A;  1OX9 A;  1M8M A;  2XK0 A;  5L23 A;  4QQG A;  1MMN A;  4XAX B;  1M5Q 1;  3PMT A;  1B34 A;  3MEA A;  2CP3 A;  1HSQ A;  4IUU A;  1BIA A;  2X4Y A;  2VB6 A;  4BAC A;  1Y57 A;  2AIR B;  3PIP A;  3CBM A;  5LJ5 d;  1ZX6 A;  4WCI A;  4A63 B;  2RQR A;  1K9A A;  3GIB A;  1UFF A;  1PSE A;  2ZPI B;  4Q5W A;  4CRI A;  4OGC A;  1G3T A;  3QYH B;  3G71 T;  1XOV A;  3H0H A;  4DEY A;  3I55 T;  2HL5 C;  2MAM A;  4RG8 A;  1I0C A;  2RMO A;  2DEU A;  1G3S A;  1KQS A;  2HDA A;  1Y96 A;  2ABL A;  2P0P A;  2RN8 A;  1OUL A;  4K11 A;  3HFO A;  9ATC B;  4NOY A;  4FCY A;  3CC4 A;  3HSB A;  1QVG A;  2FL7 A;  2DO3 A;  2EJ9 A;  4HVU A;  4C0D C;  2PZ1 A;  2PNI A;  2XDD A;  1VQ9 Q;  5IHK A;  4QVD A; 
#chains in the Genus database with same CATH homology
 2I0N A;  2M51 A;  1UG1 A;  1H8K A;  3EG1 A;  1SSH A;  2EYZ A;  1KFZ A;  1W1F A;  1NYF A;  1ABO A;  2EBP A;  2C0O A;  3TSW A;  3VRY A;  2K9G A;  1V1C A;  2KYM A;  2JXB A;  2KNB B;  2DRK A;  2JM9 A;  2LQN A;  1MUZ A;  4J9D A;  4DEX A;  1QLY A;  1NLP C;  2JW4 A;  2D8J A;  1G2B A;  4J9C A;  5HCK A;  2EGE A;  4JJD A;  1I1J A;  3VS5 A;  2O9V A;  1Y0M A;  2NUZ A;  1KIK A;  3NMZ C;  1OOT A;  1ZUU A;  2EW3 A;  2D0N A;  1ZUY A;  2KXD A;  4JPB W;  1QWE A;  1M27 C;  2A08 A;  2DL8 A;  2AKK A;  3I5R A;  3EG2 A;  4AFZ C;  1GCQ A;  2F2X A;  3QWY A;  2ECZ A;  2HSP A;  2KGT A;  3TVT A;  2JS2 A;  3VS6 A;  2J6O A;  3H0F A;  1AEY A;  1FMK A;  1ZBJ A;  4RUG A;  1W6X A;  2CSQ A;  1AWO A;  3QWX X;  2YSQ A;  4FSS A;  2A28 A;  4AFU C;  4Y92 A;  2DA9 A;  3U23 A;  2VWF A;  1ZLM A;  3EHR A;  1X69 A;  4RTT A;  2CUD A;  2LJ3 A;  2ENM A;  3UF4 A;  4D8D A;  2D8H A;  1T0J A;  4GBQ A;  1K0X A;  3RNJ A;  2H8H A;  4OML A;  1UGV A;  3SEM A;  2HCK A;  1TUD A;  3VS0 A;  5IHI A;  1K1Z A;  2DVJ A;  1OPL A;  2YUN A;  2SRC A;  3REB B;  2JT4 A;  2KYB A;  4RTX A;  2LCS A;  5GJV B;  1KJW A;  2P4R A;  3M0S A;  2RQW A;  3R6N A;  1SRM A;  4RTZ A;  2KRN A;  2LQW A;  1H3H A;  2L3P A;  1YCS B;  2FPF A;  4ZNX A;  2EYW A;  4JZ3 A;  1WX6 A;  3GBQ A;  1PRM C;  2YUQ A;  4IIO A;  4RTV A;  3UA7 A;  1WXU A;  1BBZ A;  5EC7 A;  1ARK A;  2K2M A;  2AZV A;  3PE0 A;  5IXF A;  2O31 A;  2L3S A;  1J3T A;  2JMC A;  5FWB A;  3UAT A;  2DYB A;  2O9S A;  3I9Q A;  2FRW A;  4OMP A;  4AG2 C;  3I5S A;  2RNA A;  1X2Q A;  2J06 A;  1AOJ A;  5IH2 A;  2DNU A;  2J05 A;  3ZL7 C;  3NPF A;  1G83 A;  2C0I A;  2DMO A;  1SRL A;  1W70 A;  1VYU A;  2CSI A;  2DIL A;  2DM1 A;  2GTO A;  1UJ0 A;  2KRS A;  1QCF A;  2YT6 A;  2CRE A;  4OMN A;  4LE9 A;  4J9I A;  4HVW A;  4J9G A;  3PVL A;  4J9E A;  2RQT A;  1SEM A;  1PWT A;  2CT3 A;  2J6K A;  2EPD A;  4IIM A;  2KT8 A;  1NLO C;  2HBW A;  1UTI A;  2EGC A;  1GFC A;  4HCK A;  2GBQ A;  2RF0 A;  2EVR A;  1M3A A;  1EFN A;  5I11 A;  4AFS C;  1NEG A;  1M30 A;  2X3X D;  1PKT A;  1TUC A;  1ABQ A;  1T0H A;  1Z9Q A;  5ECA A;  3UA6 A;  2MIO A;  2CT4 A;  4JJB A;  4LNP A;  4F16 A;  4LUD A;  4HVV A;  4RTW A;  2V1R A;  4Z8A A;  2AKL A;  2LP5 A;  2B86 A;  1U5S A;  2DBM A;  2JMA A;  1QKX A;  1RLP C;  2RQU A;  2K7A A;  3O5Z A;  4OMO A;  2O88 A;  2E5K A;  3JV3 A;  2ESW A;  2LJ0 A;  2O2O A;  2OJ2 A;  3TSZ A;  2BZ8 A;  1UE9 A;  2YDL A;  1JQQ A;  2DL3 A;  5IXB A;  2ROL A;  3VS2 A;  1M3C A;  2KBT A;  2M0Y A;  3H41 A;  1BU1 A;  1JEG A;  1T3L A;  1WXT A;  2ED0 A;  2JM8 A;  2DL5 A;  3H0I A;  1PKS A;  4JZ4 A;  2LJ1 A;  2LNH B;  3VS4 A;  1WA7 A;  3EG3 A;  2KEA A;  4JJC A;  1Z9Z A;  3EGU A;  4ORZ A;  2ROT A;  4CC7 A;  3M0P A;  4F14 A;  1U3O A;  1UHC A;  1UUE A;  1OPK A;  1T3S A;  2CDT A;  3ULR B;  1QWF A;  1BK2 A;  1QKW A;  2A36 A;  1LCK A;  4F17 A;  2L3Q A;  3VRZ A;  2F2V A;  2KR3 A;  2VKN A;  2X3W D;  1X2K A;  2OAW A;  4X1V A;  3A98 A;  2YUO A;  5GJW B;  1ZSG A;  1K4U S;  1MV3 A;  2DE0 X;  2EGA A;  2F2W A;  1YN8 A;  5IHN A;  2OI3 A;  2MCN A;  2K3B A;  1NYG A;  2XMF A;  1SPK A;  1AWJ A;  1FYN A;  4GLM A;  4AFQ C;  1TG0 A;  1X43 A;  2DLP A;  1WXB A;  2FPD A;  4KRT A;  2KXC A;  3EG0 A;  1CKB A;  4RTY A;  4OMM A;  4RTU A;  1GFD A;  1AD5 A;  1JXO A;  1ZUK A;  2HEQ A;  2YUP A;  2W0Z A;  2J6F A;  1PRL C;  1UHF A;  2AZS A;  2GQI A;  3I35 A;  3VS7 A;  1AZE A;  1GRI A;  1K0S A;  2KRM A;  1RUW A;  2GTJ A;  2D1X A;  2K6D A;  1PHT A;  1BB9 A;  4Z89 A;  1YNZ A;  2J7I A;  1RI9 A;  1HD3 A;  2KT1 A;  4AG1 C;  1GCP A;  1X6G A;  2DL4 A;  2EQI A;  4J9F A;  1GBQ A;  1B07 A;  3LH5 A;  2FPE A;  3M0T A;  2LZ6 B;  1OEB A;  2W10 A;  3RBB B;  3PVQ A;  1OV3 A;  1AVZ C;  1X6B A;  1CKA A;  3VS1 A;  2FO0 A;  5I22 A;  2DBK A;  1JU5 C;  4CC3 A;  2AK5 A;  2EKH A;  4R0K A;  2FEI A;  2BZX A;  4E6R A;  2KRO A;  3FJ5 A;  2A37 A;  1KSW A;  1E6H A;  4EIK A;  4ESR A;  1WFW A;  3VS3 A;  1WLP B;  2KE9 A;  3SHW A;  2CH4 W;  2QDL A;  1YWO A;  3M0R A;  2IIM A;  1CSK A;  2MOX A;  2L0A A;  2FRY A;  1AWX A;  1GCQ C;  1NG2 A;  2NWM A;  2BZY A;  1B3Q A;  3KFV A;  4LUE A;  1K76 A;  1SHF A;  2RPN A;  2LMJ A;  2EYX A;  2GNC A;  1RLQ C;  1GL5 A;  2ED1 A;  4M4Z A;  1U06 A;  2LX7 A;  1A0N B;  1N5Z A;  2L2P A;  2BTT A;  2SEM A;  1PNJ A;  5FWC A;  2DX1 A;  2K79 A;  3EHQ A;  1UEC A;  4LN2 A;  1GBR A;  1E6G A;  2JTE A;  4CC4 B;  5FW9 A;  4J9H A;  2RQV A;  4D8K A;  3NHN A;  4Z88 A;  3IQL A;  1UDL A;  4QT7 A;  3THK A;  1E7O A;  2DJQ A;  2EYY A;  2FG0 A;  1WIE A;  1IO6 A;  3M0U A;  1VYT A;  1WYX A;  2G6F X;  1M8M A;  1WI7 A;  1YWP A;  3M0Q A;  1M3B A;  5L23 A;  3CQT A;  1VYV A;  2CH4 A;  1HSQ A;  1JXM A;  4CC2 A;  1WDX A;  1NEB A;  2C0T A;  1VA7 A;  1S1N A;  1HJD A;  1X27 A;  1Y57 A;  1UJY A;  1ZX6 A;  1YP5 A;  1AWW A;  3C0C A;  4WCI A;  4A63 B;  2V1Q A;  2VVK A;  1H92 A;  2RQR A;  1NM7 A;  1I07 A;  1K9A A;  1SHG A;  1UFF A;  3NGP A;  2CUB A;  1MV0 B;  4J9B A;  2JS0 A;  1JO8 A;  2PTK A;  1AZG B;  1XOV A;  3H0H A;  4DEY A;  3REA B;  1I0C A;  2RMO A;  2GGR A;  2DL7 A;  2HDA A;  4HXJ A;  4K11 A;  2ABL A;  2RN8 A;  4HVU A;  4OMQ A;  2PZ1 A;  2PNI A;  2DF6 A;  5IHK A;  2DRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...