1GBRA

Orientation of peptide fragments from sos proteins bound to the n-terminal sh3 domain of grb2 determined by nmr spectroscopy
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
74
structure length
74
Chain Sequence
GSRRASVGSMEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPEFIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Orientation of peptide fragments from Sos proteins bound to the N-terminal SH3 domain of Grb2 determined by NMR spectroscopy.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signal transduction protein
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
total genus 7
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1994-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gbrA00
2O9VA 4J9GA 1HSQA 1KIKA 1H8KA 2BZ8A 4DEYA 1UFFA 1E6HA 2F2WA 2RNAA 2AKLA 1T0HA 2KRSA 4ORZA 1GFCA 2EGAA 2AZVA 2DL4A 5FW9A 2J05A 3NGPA 1WA7A 2GTOA 4RTZA 1PKSA 5EC7A 1X43A 2J6OA 2KT8A 2HSPA 2RQVA 4R0KA 3A98A 3IQLA 4F16A 2A37A 4AG1C 1UTIA 2JS2A 1ZX6A 2LMJA 4JJDA 3PVQA 2KYMA 2VKNA 2JMCA 2BZYA 1XOVA 5I22A 2HDAA 1PWTA 2DL7A 2A36A 2FRYA 4HCKA 4J9FA 4RTWA 3I9QA 1PKTA 1I0CA 2FPEA 4RUGA 1AWOA 1JEGA 4HVVA 2GGRA 4J9HA 2GNCA 4GBQA 2SRCA 3M0QA 3M0PA 4OMQA 2IIMA 2F2VA 1WXUA 5I11A 2MIOA 1GFDA 1Z9ZA 2A08A 5HCKA 2M0YA 2RN8A 4LUDA 2OJ2A 1HD3A 3U23A 2AK5A 1UHCA 2L3PA 1K1ZA 1SSHA 3EHQA 3GBQA 4EIKA 1WYXA 2CSIA 1TUCA 3NMZC 1OPKA 1KSWA 4Y92A 2KT1A 1RI9A 2FRWA 2KNBB 2JW4A 2QDLA 2C0TA 3REAB 1SRLA 4GLMA 4OMPA 5IHIA 1NLPC 1UGVA 2D0NA 4WCIA 2LZ6B 1ZUKA 3VS2A 1QWEA 2EKHA 1CKBA 1QWFA 1ARKA 2JT4A 1U06A 1CKAA 1PRLC 3UF4A 2ABLA 1YNZA 3VRYA 4JZ3A 3H0IA 2D8HA 2KGTA 2NUZA 2L0AA 4J9IA 2EVRA 1W6XA 2LJ3A 1AWXA 1M3BA 1X69A 4LE9A 4RTUA 3TSZA 4X1VA 2FPFA 2MCNA 3NPFA 2D1XA 2E5KA 2LCSA 1U3OA 2JM9A 1B3QA 3I5SA 4J9CA 1MV0B 2VVKA 2K79A 2CREA 1J3TA 1GL5A 1GBQA 2RQRA 2ECZA 1T3SA 2DRMA 5IHKA 4AFUC 4F14A 2YDLA 1ZBJA 3I35A 2K2MA 2YUQA 5FWBA 3VRZA 1X27A 2L2PA 2ENMA 1U5SA 3EG3A 1FYNA 4OMLA 1K76A 3VS6A 2X3WD 4DEXA 2DX1A 2X3XD 3H0FA 5L23A 4ESRA 1JXMA 1YP5A 2LX7A 1WDXA 2RQTA 2HEQA 2KEAA 2J06A 1H3HA 2W0ZA 1UJ0A 3RBBB 4J9BA 1SHGA 3REBB 4LNPA 3SEMA 1UECA 1Z9QA 4RTTA 2O9SA 1YCSB 2DBKA 2LJ0A 1WFWA 2J6FA 1OPLA 4AFSC 1K0XA 3RNJA 2C0OA 3THKA 2LJ1A 3C0CA 2GTJA 1ZSGA 1BBZA 5IXBA 1EFNA 2K7AA 2DMOA 2L3SA 2CUBA 3PVLA 1IO6A 1WIEA 2GBQA 2O31A 1E7OA 4OMMA 4LN2A 2DVJA 4J9DA 2HCKA 1AZEA 4A63B 2YUNA 1WI7A 2OI3A 3PE0A 1JXOA 1X6BA 1TUDA 2L3QA 1BB9A 1MUZA 2D8JA 1M30A 4JZ4A 1UE9A 3KFVA 1ZUYA 1ZLMA 2ED0A 2NWMA 4CC7A 2J6KA 3EG1A 1S1NA 3CQTA 1UHFA 2YT6A 1CSKA 4M4ZA 4Z89A 1QCFA 1MV3A 1SHFA 4FSSA 1K0SA 4AFZC 3ZL7C 1ZUUA 4CC4B 3EG0A 3EG2A 2KROA 2DLPA 2EYWA 2JM8A 2AKKA 2CUDA 1UJYA 1I07A 1E6GA 2EYXA 1OV3A 5GJWB 2I0NA 1WLPB 1JU5C 1V1CA 2DL3A 2C0IA 2DJQA 2P4RA 3O5ZA 1A0NB 1M3CA 1AWJA 2OAWA 3VS0A 1Y0MA 2RQWA 2ROLA 1AVZC 2EGEA 2EYZA 2EGCA 2KRMA 4D8KA 2EPDA 2DE0X 2EBPA 1WXTA 2K6DA 2DL5A 2FG0A 1RLQC 2DM1A 2RF0A 2JTEA 4Z8AA 1RLPC 1SEMA 1YWPA 3R6NA 1KFZA 4HVWA 2DL8A 1AOJA 1PNJA 1N5ZA 2GQIA 1NEGA 1NG2A 2CH4W 2RMOA 1X2KA 3M0TA 2PTKA 3LH5A 2DILA 2O2OA 4JJBA 2W10A 3UATA 2FO0A 5FWCA 1BK2A 1M3AA 2PZ1A 1YN8A 2LQNA 2DA9A 1VA7A 2F2XA 3QWXX 2KYBA 1TG0A 4JPBW 2A28A 5IXFA 1SRMA 4RTXA 4JJCA 1AWWA 2K3BA 3VS5A 4F17A 4K11A 2KXCA 2EYYA 2YUOA 1BU1A 4HXJA 3JV3A 4CC3A 2FEIA 1QLYA 2YUPA 2AZSA 1NEBA 1NYGA 3I5RA 1LCKA 2KXDA 3H0HA 1T3LA 4RTYA 3SHWA 1VYVA 1UDLA 1AD5A 2YSQA 1X6GA 4IIMA 1W70A 1W1FA 1AZGB 2JS0A 3UA6A 1G2BA 1ABOA 2O88A 1NYFA 2ESWA 2JXBA 2J7IA 1SPKA 4AFQC 2CT3A 4J9EA 2LQWA 3M0RA 2VWFA 1QKWA 1KJWA 2SEMA 3QWYA 3M0SA 1Y57A 1VYUA 2BTTA 1GCPA 1WX6A 4D8DA 1ABQA 3FJ5A 2ROTA 3TSWA 3VS1A 3ULRB 3VS4A 1K4US 5ECAA 4ZNXA 2H8HA 2DYBA 4CC2A 1UUEA 2JMAA 1UG1A 4LUEA 4RTVA 1JO8A 1FMKA 1NM7A 2KE9A 3TVTA 1PHTA 2EQIA 1G83A 2EW3A 5GJVB 3VS7A 1JQQA 2KR3A 2DRKA 1NLOC 1T0JA 3NHNA 5IHNA 2ED1A 2G6FX 1GCQA 3M0UA 2PNIA 1M8MA 2DF6A 2FPDA 2HBWA 4OMNA 4KRTA 4Z88A 2K9GA 1K9AA 4OMOA 2CDTA 1X2QA 2V1QA 2CT4A 1B07A 3EGUA 1GBRA 2KBTA 4AG2C 1RUWA 2B86A 1YWOA 4E6RA 1VYTA 4QT7A 1PRMC 3EHRA 2LNHB 4HVUA 3VS3A 1QKXA 1GCQC 2XMFA 1OOTA 1I1JA 5IH2A 1H92A 2KRNA 2RQUA 2BZXA 2DBMA 1OEBA 2CH4A 2M51A 3UA7A 2LP5A 1AEYA 1GRIA 2DNUA 1M27C 3H41A 2MOXA 4IIOA 2CSQA 1WXBA 2V1RA 1HJDA 2RPNA
chains in the Genus database with same CATH superfamily
1JB0E 4J9GA 1YJWQ 3CD6A 2BZ8A 4DEYA 4RCCA 1UFFA 1E6HA 2CYZB 2F2WA 2KAFA 2RNAA 3CCUA 1KQ2A 2CKKA 2HNIA 4ORZA 4M7AD 2GCXA 2DL4A 3A8GB 3CC7T 5FW9A 1O9SA 2J05A 3META 3NGPA 2VV5A 1X43A 2L3RA 1MNDA 4OB1B 4PJMA 4BE0A 4F16A 4JUVA 2A37A 2LMJA 2DYIA 1YITT 4M7DD 1XOVA 4V2SA 2HDAA 1UGSB 2QA4T 2FRYA 4J9FA 3I9QA 5CO7A 5GAOm 1I0CA 1WHMA 4QQDA 4RUGA 5LJ3e 1JEGA 3OS1A 3PT9A 4GBQA 2SRCA 1YBYA 3M0PA 3SDZA 2E6NA 1WXUA 3QKJA 2MIOA 5GAN5 3G6ET 1XQHA 4QVDA 5HCKA 2A08A 2Y90A 4N4GA 2NUTA 2K5IA 3A1PA 2DXBA 3U23A 1UHCA 5D6WA 4JRQA 3OYDA 1M5Q1 4EIKA 3JB9H 1TUCA 4DA4A 1KSWA 3VKIA 3WVEB 2LTOA 1I5LA 4N0AC 3OS2A 3DB3A 1H641 2C0TA 4RCBA 3OYMA 2L89A 3REAB 4MZPA 3RESA 2EFIA 5GAMg 1OI1A 2DJZA 2LT1A 4C92A 4E47A 4O6JA 2M0OA 3VS2A 1BYMA 1QWEA 4PFZA 2XK0A 2E3HA 5GAMe 3CPWP 2DAQA 1CKBA 2KVQG 4HT9A 1ARKA 5FU7C 4FSXA 2M16A 4WF2A 1YNZA 5GAN2 3H0IA 2QEXQ 2DZCA 3M56A 4LE9A 4L6V5 1X69A 1D3BB 2MCNA 3NPFA 3QDRB 2E5KA 2R5MA 2LCSA 1OYXA 4M78D 1U3OA 2JM9A 4J9CA 1OULA 4M7AE 2K79A 1D3BA 2CREA 1GL5A 1GBQA 2RQRA 1I8FA 3JCMV 4F14A 3I35A 1VQ8T 2F5KA 3CCVA 1FYNA 1LNXA 3VS6A 4DQ2A 4DEXA 4PJJA 5LJ5h 5FU7B 4ESRA 1JXMA 1B34A 5CCAA 2EJ9A 2LX7A 1RAEB 3GIBA 4PK4A 4QVZA 2EAYA 3QYHB 2YLBA 1H3HA 1K73U 1B34B 1YHQT 4QQGA 4J9BA 3V8LA 2RB6A 1QCNA 1UECA 4RTTA 5HY6A 2LJ0A 5CKBA 1K0XA 3THKA 2DTOA 3CMAQ 1Q81C 3G6EA 1FX7A 2COWA 2X4YA 1NPRA 1PC0A 5KYYB 2K7AA 2DMOA 1WIEA 2DK3A 3FLGA 2JUFA 3G7ZA 2RI3A 2DVJA 3RKYA 2XDPA 3RKXA 2HCKA 5A0GA 2QI2A 3M59A 1OU9A 3EAEA 2DFUA 2OI3A 1JXOA 3PE0A 2DXUA 1X6BA 3HRUA 5GANe 1BB9A 1F1BB 4F7UF 3CMEA 2C06A 2ED0A 1RACB 5KYYA 3A8LB 4IUUA 4A53A 3OS5A 4ZTJA 3ER0A 4EMKA 3CQTA 3CPWS 1UHFA 3MPUB 4M75G 4C92E 1CSKA 3OW2A 2K5FA 3TU4K 2DZ9A 3HRSA 1K0SA 4C8QE 4HKEA 1Q86U 4A4GA 3KXTA 3MEVA 2YLCA 3EG2A 2EYWA 2DXCA 1FMVA 3CMET 1QQJA 1UGRB 2KSSA 1UJYA 4FW2A 5CR2A 2RHXA 2DJQA 2P4RA 1AWJA 2OAWA 3LGFA 2RQWA 2QK0A 1KD1C 4LDUA 2DE0X 2PVGB 2DIQA 2E4HA 2X4XA 3RR6A 2K6DA 2D6FA 2FZKB 1M2OA 2DM1A 3HTRA 2JTEA 3ME9A 1SEMA 4JLIA 2XHCA 1YWPA 2MWPA 3JCMf 4C92D 1KFZA 2PQWA 1DJ7B 3RKWA 2YRCA 1PNJA 1U1SA 1NG2A 4BDZA 3D7SB 2CH4W 4FYWB 2PTKA 2W10A 3UATA 2PUKB 4J6YA 1YN8A 2LQNA 2DA9A 3J7AF 4E7LA 4XTUA 3QWXX 4A4HA 4FL6A 4M75F 1V76A 2MYSA 2WSFE 1M90R 5IXFA 3M5AA 2K3BA 1R0CB 2QA4Q 4OB3B 4M78E 4HXJA 4M78A 1YJ9T 1K9MR 1RADB 4F7UA 2KXDA 4XQ3A 1MGQA 3H0HA 3NFCA 1T3LA 3SHWA 1VYVA 1UDLA 2X4JA 4IIMA 4J7IA 1VUBA 1AZGB 3UA6A 1VQ9A 4M75D 3CCQA 2O4XA 2JXBA 2LCLA 2VXEA 1YFNA 2IVWA 2BE7D 3GF5A 3LH0A 8ATCB 4ANJA 4LDWA 4NL3A 1QKWA 1EZZB 3RIRA 1KJWA 4PJOD 4LXCA 2SEMA 1NJIR 3M4GA 5GAOp 2RI2A 2NLUA 2QQ9A 1YJNA 4KH0B 4FT4A 3L1AA 1GCPA 4D8DA 3FJ5A 1YI2Q 3TSWA 5A0DA 3ULRB 1VQMA 3A5ZB 1LOJA 2DYBA 2VUBA 2OTJT 3WVDB 5GMKl 3I55A 1PHTA 4M7AG 4XTZA 2EQIA 3CCRT 5CK9A 4BE2A 1G83A 2EW3A 1C6VX 2FB7A 4L5GA 2DRKA 1VQPT 4C92G 3CCVQ 1RL2A 5KH6A 1TU0B 2DD5A 2Y4XA 2KI7A 2QASA 1KC8C 2HBWA 4OMNA 1Q86C 3OSVA 4O5VA 4C8QD 3OYCA 3CCMT 5GAOq 4OMOA 3SFMA 3CXCA 1YIJQ 3UPUA 5CIUA 4FYYB 2XI9A 1M9SA 4QT7A 1Y71A 1VQKT 1K73C 2HL3A 1QKXA 4M7AA 1GCQC 2R58A 1D0YA 4ZTFA 3CCSQ 1OEBA 5FRMA 3V7RA 4OMFB 4QQ6A 2LP5A 5LJ3g 1AEYA 2GFAA 4BACA 2QA4A 2NYSA 3OA6A 2E6ZA 3CC2T 1K8AR 3OYIA 2O9VA 3JCMX 4DOWA 1XJWB 3CCVT 2WSEE 2E5QA 1Q81U 3JCMg 3VU3C 1GFCA 1TOVA 2MAMA 3UT1A 4MZTA 5A2QE 1S72Q 4BY6C 4PJNA 1NJIU 3E9FA 2KQWA 1PD0A 3DKMA 1VQ5A 4R0KA 3A98A 3IQLA 4AG1C 3L42A 1EIFA 1IHVA 4E7IA 2JS2A 5LJ3f 3LW5E 2XKOC 2XDBA 2VKNA 4M77C 1Q7YR 5I22A 3NTKA 2E1HA 3E9GA 2A36A 4HCKA 3GLXA 2P4TA 5LJ3j 1AWOA 2JTFA 5GAN8 4HVVA 2LQKA 2GGRA 2RK1A 4C0ZA 1Y96B 4M78C 4XAXB 2YRVA 3RUXA 2IIMA 2F2VA 2QQAA 4Q5WA 5I11A 1M1KU 1RAGB 5IAYA 4C0DC 2E65A 1GFDA 1Z9ZA 4IUPA 2RN8A 5DY9A 2E3IA 2CP2A 2X4WA 4LUDA 4M7AB 2RHYA 3OQ5A 4J6WA 2COYA 3EHQA 3GBQA 1VQKQ 5GAMd 2HD0A 2MWOA 1OPKA 3EFOA 1VQ8Q 4Y92A 2KT1A 1TS9A 2KNBB 4ZGJB 2JW4A 2CZ7B 1QP3A 2YXYA 2L8DA 2ZPEB 4OMPA 4J7FA 1NLPC 2KY9A 3HSBA 1ZUKA 3H8ZA 5GAMj 4RMOA 2RA2A 3QJYA 4FIBA 3C95A 2ABLA 3VRYA 1JBMA 4JZ3A 2D8HA 1ZBXA 2L0AA 1G5VA 1RI0A 4RTUA 1AWXA 4PL6A 6AT1B 3TREA 4X1VA 1LJOA 3CCUQ 4OF1A 1WZOA 2DIGA 2LVMA 3HFOA 1IZ6A 2VVKA 2HBPA 1QVFP 2RM4A 4KGVB 1J3TA 3CC4A 4A4FA 4ATOA 3QG1A 1IGQA 1X27A 3EG3A 1K76A 1TWBA 2X3WD 4OB0B 3JCMQ 3L2QA 3G71T 4XTXA 4C8QF 1WQ7A 3SWNB 1R77A 3G4SA 3A8MB 3OYBA 1VQPA 2RQTA 3BDUA 2HEQA 2KEAA 2JOYA 1MMNA 2AIRB 2W0ZA 4M78B 2PVOB 4C5EA 1UJ0A 3BDLA 4ZGDB 2XICA 1SHGA 3MHXA 3SEMA 1YITA 2KMTA 2R57A 4F7UG 1YCSB 2CS7A 4AFSC 3E1SA 5KYUA 4FCYA 2F5TX 2CP7A 3C0CA 2GTJA 2RO0A 1BBZA 1XTDA 1Q81R 1EFNA 2MI6A 3C4SA 2L3SA 5KYXB 3QZ9B 4BB7A 3CCUT 4P5NA 2GBQA 3FRNA 2FYKA 2O31A 1PSEA 4OMMA 4LN2A 4J9DA 3CCQT 1XNIA 2XG8D 5GAN6 1TUDA 2DKGA 3HPWA 1VQOQ 1ZQ1A 4C5IA 3M4YA 1ZLMA 4KT0E 5KYNA 5GMKj 3OYEA 2NWMA 3MJXA 2QAZA 1PD1A 2J6KA 2ZCFB 4BD3A 2EJFA 4QW2A 2ZPGB 1LPLA 5GAN7 2YT6A 3A8OB 4M4ZA 4M7DG 4Z89A 1W4SA 1MV3A 4XTVA 3V8JA 1N8RC 4AFZC 4NS5A 3VV0A 4CC4B 4ELZC 3EG0A 2HKQB 4WTOB 1MNEA 1ZSZB 1Y07A 2CUDA 1E6GA 2D0QB 5GJWB 4M77F 1YHQA 1WLPB 3G4SQ 1JU5C 1V1CA 3X28B 2VGNA 4N0AA 3VS0A 1Y0MA 2ROLA 4TVRA 1QVFS 3ASKA 4XU1A 2EBPA 1M1KR 4C5GA 4AT1B 2FVUA 4M7DF 3OYHA 2DL5A 4AMCA 2FG0A 2CZ6B 1PG5B 1N27A 3EGDB 3EG9B 2DL8A 2JTMA 4XU0A 2JZ2A 5GMKm 3OS0A 5GAOl 3P8HA 1YITQ 3CXCP 4NOYA 2DTHA 2WACA 3M0TA 3ZFJA 3CCJQ 2DILA 2FO0A 5FWCA 1M3AA 2PZ1A 1HK9A 2RI5A 1BIAA 2E41A 4BI8B 2KYBA 1KQ1A 4JPBW 4PJLA 2P0PA 1AWWA 3CCRQ 3SD4A 1D1CA 3QJ6A 4F17A 5EG2A 1C1AA 3JV3A 5CVIA 2FEIA 1QLYA 1NYGA 2RHZA 1G8XA 5GMKi 2JN0A 1FWZA 3JCMd 4C8QG 5HK3A 2RH2A 4C0FA 1W1FA 3HKSA 3UWNA 3NTHA 1M8VA 1ABOA 2LNVA 2K5LA 1IXDA 3AT1B 1V29B 3LLRA 2CT3A 3F70A 3INZA 4J9EA 4E7HA 1HXDA 1VQ7A 3M0RA 2RJFA 1NE8A 1BI2A 4XTYA 3LYIA 4BE1A 3QWYA 3CC7A 1VYUA 1NJIC 4FYXB 5DLOA 2OTLA 1KHIA 1ABQA 4C8QA 1WHLA 4JJNK 3VS1A 3DLMA 1BI0A 1I81A 4JRKA 4CC2A 4EDUA 3CCMA 1UUEA 2JMAA 1IB8A 2H3EB 1UG1A 2K3YA 4RTVA 3CC7Q 1NM7A 1FMKA 3MP6A 1M2VB 2V8KA 4KUIA 5FLXE 5KE2A 4CI0C 5GJVB 4PJOF 1S72A 1NLOC 5GANh 1VQLT 5CKHA 3CMAA 3WXMB 2G6FX 1ACMB 4PLLA 1M8MA 2DF6A 2FPDA 2PVDB 3Q1JA 1KC8R 5AT1B 2K9GA 1K9AA 3FB9A 4LDXA 1X2QA 5LJ5j 4IURA 1B07A 3MEAA 3NTIA 3PNWC 2KBTA 2B86A 5CKEA 1D1AA 1YWOA 1VYTA 1WJQA 1OX9A 2Y4YA 3ZEHA 3CPFA 3JSCA 1PRMC 3JRZA 2LNHB 3CCLQ 3O8VA 1IGUA 3M54A 5LJ5f 1JJ2S 2PU9B 5KYWB 1K73R 2DD4A 2NUTB 5IH2A 1GXIE 3JCMb 2CH4A 2M51A 3UA7A 4BUGA 3CXCS 1GRIA 4C92F 3G6EQ 2IPOB 2HQHA 2MK5A 4D6WA 5D6YA 1M27C 4IKFA 2CSQA 3MP1A 1VQ9T 1WXBA 2V1RA 4DOVA 1HSQA 1KIKA 1TUGB 1K9MU 1VQMQ 1YJ9Q 2EQJA 2AKLA 2V8IA 1WPYA 3LWHA 2KRSA 1VQ5Q 4ZGEB 2JNGA 3OMCA 2RK2A 2HKNA 2IG0A 2VYTA 2GTOA 5LL6S 2MPXC 1ZA2B 4RTZA 1PKSA 4PFPA 2J6OA 3DB4A 2K2VA 2HSPA 2RQVA 2X51A 4N4HA 3E2UA 3CBPA 3GOXA 3X26B 1SSFA 4A54A 1ZX6A 2DTIA 3PVQA 3E19A 2DL7A 1D0XA 2RJCA 2KDSA 2LDMA 4RTWA 4OGCA 3JAME 4OVAA 1PKTA 2FPEA 2JJ9A 4XU2A 3CCQQ 4M7DE 2B8AA 3EH2A 1UB4A 3EH1A 1PM3A 3BFMA 2GNCA 4IUVA 4PFOA 4MMLA 4FM4B 4Z02A 3QPHA 4PJOE 3CCJT 4M77D 3OYLA 1D1BA 1Q82R 5GAN4 3CC4Q 2QXFA 2QGGA 2EQMA 2M0YA 3CEYA 2VASA 5GMKh 3HRTA 1WJSA 2AK5A 3CMEQ 1K1ZA 2K3XA 1BI3A 4C92C 1SSHA 1WYXA 2CSIA 3EG9A 3NMZC 3OW2S 2F69A 1RI9A 2FRWA 1G3SA 2P0KA 1RABB 3OBYA 1N9RA 1BKBA 3CCLA 2D0NA 1UGVA 3I55T 2FZCB 4RKUE 2LZ6B 1QP2A 3PIPA 2CGHA 2E70A 3I55Q 2QTXA 4OP0A 2ZAEA 3JCMJ 3P8BB 2JT4A 2G3RA 3UDCA 1U06A 1WHHA 2D9TA 1P92A 1NBEB 3C94A 1RAIB 1JJ2P 4E2FB 2NUZA 4J9IA 2L5QA 1W6XA 1M3BA 1K8AU 3QBYA 4BDYA 3KUFA 5CQXA 1WHJA 2VB6A 1B3QA 3I5SA 1VQ4A 1JRIA 4DBFA 1MV0B 4JRPA 5LJ3d 3OYKA 1T3SA 2DRMA 5IHKA 3FJPA 3PIOA 5LJ5g 2YUQA 5FWBA 4F04B 2V26A 3PTAA 2L2PA 4ZN3A 2ENMA 4M75B 4OMLA 1U5SA 3SB2A 5FRNA 4IUTA 3H0FA 2X3XD 1MHNA 3RDVA 1YP5A 4KH1B 3CBOA 3X25B 3CD6Q 4M77G 1IRXA 2J06A 5KYXA 3X24B 3CBMA 1KD1R 2A7YA 4KGZB 3RBBB 5KYWA 3REBB 2QEXA 4IUQA 2R5AA 2J6FA 1VQ5T 1OPLA 2E10A 2M1HA 1KHCA 1Q95G 2K4YA 4M77E 1TH7A 4M75E 4R55A 4E7SA 1NPPA 4QVCA 1ZSGA 5IXBA 4MDWA 5IN1A 3LGLA 1IO6A 4M77A 4BI3A 4MZMA 5D6XA 2QG9B 2ZPFB 3TQ7P 4R56A 1E7OA 3GPLA 4DBQA 1AHJB 2BE9B 1AZEA 1KG1A 1N9SA 4A63B 2YUNA 5I2SA 4LD9K 2CZ1B 3OW2P 1MUZA 1M1FA 2D8JA 1K9MC 3JB9F 3HFNA 1M30A 4LDVA 1X01A 3OYJA 3KFVA 1ZUYA 3CCSA 4GY5A 5GMKe 1VQNT 4CC7A 1QVGP 3EG1A 2KK4A 2RD1A 5D7UA 1OZ2A 2V8JA 3J81E 4JS4A 2CP0A 2P0QA 3KBGA 3OYAA 5HKCA 1ZUUA 3QIIA 5GANd 1VQ4Q 1VQNA 2DLPA 4A4KA 1WGSA 2JM8A 2AKKA 4ME7A 3S3OA 4YTLA 2OTJQ 1QCOA 1YI2T 4ZN1A 1M3CA 2CP3A 1AVZC 5M9OA 2EGCA 2KRMA 2EPDA 3MCAB 3FEOA 4EMKC 2RF0A 1RAFB 4M75A 5J26A 4HVWA 1Q7YU 4X34A 2XU8A 1N5ZA 1VIFA 2GQIA 3CC4T 2QQRA 4M77B 1X2KA 3J80E 3LH5A 2O2OA 4HA8A 1BI1A 4E7KA 4EMKB 2CP5A 2GFUA 4PJOB 5GAN3 3CMAT 5DM7R 2XIDA 1IREB 1VA7A 1EX4A 4C5HA 3BE3A 2EJGA 1TG0A 3QO3A 3I56Q 5L8RE 1VQPQ 4L59A 2E12A 4RTXA 4LDYA 3VS5A 3S6WA 4K11A 2EYYA 1BU1A 1QVGA 4PJOG 2AZSA 1NEBA 3VUZA 4RTYA 1YJ9A 1AD5A 2YSQA 1W70A 1NZ9A 1VQ6T 2JS0A 1G2BA 4GLKA 2ESWA 4UC4A 2O01E 4JDSA 4AFQC 1SPKA 4B6MA 3JCMc 3VUBA 1UEBA 1Y7XA 4A4EA 2PUOB 5KCHA 4XK8E 4PJOA 1LVKA 3CC2Q 1Y57A 2BTTA 3OYGA 1QVGS 1WX6A 4M78G 2ROTA 4BI4A 2DERA 3VS4A 1K4US 3OBWA 1Q7YC 3RMSA 4F7UB 4LUEA 5J39A 2KE9A 3DLLA 2RJDA 3CCLT 4N4IA 3JB9J 2BUDA 1WNLA 1JQQA 2KR3A 1QVPA 2XDDA 2EWNA 3NHNA 2ED1A 3TCJA 2K57A 1GCQA 4X9DA 3M0UA 4PNOA 1N8RU 5C0MA 4KRTA 3HHTB 2CDTA 3GNGA 5LJ5e 2DVEA 2RHIA 1BCMA 3EGUA 2OTLT 1G3YA 1GBRA 4AG2C 4E6RA 1KC8U 1KK7A 3EHRA 1QMCA 3QSUA 4HVUA 3VS3A 1M90C 2QEXT 3PFSA 2XMFA 1I1JA 1H92A 2RQUA 2BZXA 2DBMA 1QW1A 2ATCB 2HAXA 1AT1B 2LT4A 3CCRA 3M55A 3L2WA 2DNUA 3H41A 2ZGWA 1X75C 2COZA 4IIOA 3QUIA 4FW1A 3VYGA 1HJDA 5GAOn 2AT1B 1FXXA 2OX7A 1H8KA 4JLGA 1VQLQ 4Y91A 3SWNA 1T0HA 1VQOT 3OYYA 2Z0WA 4JS5A 2EGAA 2AZVA 1VQ7Q 1VQKA 1OX8A 4RG8A 5KCOA 1YHQQ 1WA7A 4PKCC 3G1JA 2OAUA 1RAAB 3OYNA 5EC7A 2KT8A 4II1A 3AHUA 1MMGA 4VUBA 1UTIA 1TXQA 2DPPB 4JJDA 2KYMA 2JMCA 2BZYA 4EPCA 1VOMA 1ZSZC 1PWTA 4M7AF 2FZGB 2DXTA 5J3BA 2HQEA 1UGPB 1MMDA 1YJWT 4J9HA 2EIFA 3M0QA 4OMQA 2HSEB 3MKDA 3QYGB 1SG5A 5GAMf 4J6XA 4MMKA 3GP8A 5FU6B 2OJ2A 3C12A 4QKUA 1YCYA 1HD3A 1G3TA 1MMAA 4OB2B 2L3PA 3EFSA 5LJ3h 4C0DB 1VQ4T 3QXEB 3I56T 4KBMB 2QDLA 4X9CA 1SRLA 4GLMA 4M75C 4M7AC 5IHIA 4WCIA 2EYQA 3G4ST 3P8DA 5CKFA 2JVVA 4OGEA 4XTWA 1VQNQ 1K8AC 2EKHA 1N6AA 1QWFA 2ZPHB 3A8HB 2EKOA 1CKAA 1PRLC 3UF4A 4EMHA 1M2VA 1WQWA 2KGTA 5AYFA 4E7JA 2EVRA 2LJ3A 3CCEA 3TSZA 2FPFA 1G3WA 2YHTA 3M9QA 2D1XA 2GF7A 5CAIA 2OTLQ 1D0ZA 2BKDN 3RMQA 3L2RA 3MEUA 3CCET 2ZPBB 4KGXB 1N8RR 2ECZA 3V8KA 4Y28E 4AFUC 3EGXB 2YDLA 2A3LA 4PLIA 1ZBJA 2K2MA 3VRZA 4DBHA 3M53A 3ZBDA 5GAMh 2DX1A 1TSFA 5L23A 9ATCB 2MF2A 2VC8A 4KULA 1OQKA 1ZA1B 3JCMW 3QHSA 4M78F 2HMAA 1WDXA 1YIJA 3QDFA 4C92B 1YI2A 1D09B 2QQSA 1I4K1 3HP9A 5GANf 3RERA 3T9NA 1FMWA 1X6OA 1KQSP 4LNPA 1Z9QA 2MMPA 2O9SA 3V7SA 2DBKA 1WHGA 1WFWA 5DLQE 4C8QC 1ZHIA 2I2LA 3RNJA 3JB9D 2C0OA 3QZ5B 1M90U 2LJ1A 2O4XB 2EQKA 4FYVB 2P84A 2CUBA 3PVLA 5I2MA 1W2BS 1SKUB 5CQYA 1YJWA 4HCBA 2E64A 1VQLA 1B7TA 1S72T 3VJPA 2DETA 2LRQA 1U1TA 3CCST 3CPWA 3L2ZA 1WI7A 5GANj 2L3QA 4HCCA 5CKDA 2CP6A 4JZ4A 1UE9A 4J8OA 5C6SA 4J83A 1VQ8A 3OSSC 4F7UE 4PJOC 2VXFA 5GAOr 1VQ9Q 1S1NA 1PSFA 1KQSA 5KYUB 3G71Q 2LCCA 2LC4A 1Q82U 1ZSZA 1QCFA 1SHFA 2FL7A 4FSSA 1M1GA 1VQ7T 3ZL7C 4C0GA 5I21A 4J5YA 1BIBA 5A0LA 2KROA 3I56A 3JB9I 4DBRA 1R8OB 4ELYC 1WJRA 3CC2A 1I07A 2EYXA 2HL5C 3OYFA 1OV3A 2I0NA 2ZZDA 2DL3A 2C0IA 3O5ZA 1A0NB 3X20B 2YRDA 1BCOA 2EGEA 2EYZA 4D8KA 3SWNC 4XU3A 1WXTA 1SF9A 3PMTA 4B9WA 2HZYA 1RLQC 4Z8AA 3H9NA 1RLPC 2WSCE 4CRIA 1C0MA 2DO3A 5HK0A 1RAHB 3R6NA 4M7DA 4KUDK 8AT1B 3JCMh 2YWWA 3JB9G 1AOJA 3BY7A 1VIEA 1NEGA 2F1LA 3V7CA 3L2UA 2RMOA 4LD6A 1JJ2A 3MO8A 1HYOA 4JJBA 2FHDA 1YJNQ 1BK2A 3M57A 2DEUA 2XD0A 3JCMP 2F2XA 1OU8A 2QQBA 1H3ZA 1KQSS 2A28A 3GNFB 2ZPIB 3H6ZA 1KD1U 3LX7A 1SRMA 4JJCA 1O75A 3PGGA 3OMGA 2LQ8A 2AHJB 2KXCA 4FT2A 2YUOA 2OTJA 3PMIA 5KE3A 4CC3A 1VQOA 2M02A 2YUPA 1VQMT 3I5RA 1LCKA 4JRIA 3S3NA 1X6GA 2EQUA 1YJNT 3L2VA 1W2BP 1U8RA 2NUPB 2BIVA 2O88A 2H3JA 1NYFA 1M4ZA 2J7IA 4HT8A 4FU6A 7AT1B 4NL2A 2X35A 3S3MA 2LQWA 2VWFA 4E7ZA 3VYHB 3MEWA 1WHKA 3EFOB 3LWIA 1I5OB 1PCXA 4MDXA 2QDYB 2VGMA 1UGQB 3M0SA 3CCEQ 3R6OA 3M58A 1IHWA 1VQ6Q 2NUPA 4M7DC 3CD6T 3CCJA 4BY6B 2QYZA 2GQVA 5ECAA 4ZNXA 2H8HA 3EGDA 1OZ3A 3FIFA 1JO8A 1Y96A 3TVTA 1M1KC 2DEQA 3TEEA 2QGFB 3G71A 5IT9E 3FDRA 1TTHB 3HL8A 3VS7A 4RG2A 1T0JA 3MP8A 3URGA 5IHNA 1Q86R 2RJEA 3EGXA 5GANg 2PNIA 4C8QB 4B9XA 1Q82C 4Z88A 3OB9A 2QTVA 2V1QA 2CT4A 3JCMe 2CZ0B 2LX9A 3EFRA 1RUWA 1R0BG 2X9HA 4M7DB 5FU6C 5FROA 1W2BA 2HQXA 3OY9A 3N5BB 3FC3A 1OOTA 2KRNA 2M9UA 2A0FB 3BW1A 2RHUA 1QVFA 1YIJT 3CCMQ 2MOXA 4HCZA 4EMGA 1VQ6A 5LJ5d 2RPNA
chains in the Genus database with same CATH topology
2O9VA 4J9GA 1HSQA 1KIKA 1H8KA 2BZ8A 4DEYA 1UFFA 1E6HA 2F2WA 2RNAA 2AKLA 1T0HA 2KRSA 4ORZA 1GFCA 2EGAA 2AZVA 2DL4A 5FW9A 2J05A 3NGPA 1WA7A 2GTOA 4RTZA 1PKSA 5EC7A 1X43A 2J6OA 2KT8A 2HSPA 2RQVA 4R0KA 3A98A 3IQLA 4F16A 2A37A 4AG1C 1UTIA 2JS2A 1ZX6A 2LMJA 4JJDA 3PVQA 2KYMA 2VKNA 2JMCA 2BZYA 1XOVA 5I22A 2HDAA 1PWTA 2DL7A 2A36A 2FRYA 4HCKA 4J9FA 4RTWA 3I9QA 1PKTA 1I0CA 2FPEA 4RUGA 1AWOA 1JEGA 4HVVA 2GGRA 4J9HA 2GNCA 4GBQA 2SRCA 3M0QA 3M0PA 4OMQA 2IIMA 2F2VA 1WXUA 5I11A 2MIOA 1GFDA 1Z9ZA 2A08A 5HCKA 2M0YA 2RN8A 4LUDA 2OJ2A 1HD3A 3U23A 2AK5A 1UHCA 2L3PA 1K1ZA 1SSHA 3EHQA 3GBQA 4EIKA 1WYXA 2CSIA 1TUCA 3NMZC 1OPKA 1KSWA 4Y92A 2KT1A 1RI9A 2FRWA 2KNBB 2JW4A 2QDLA 2C0TA 3REAB 1SRLA 4GLMA 4OMPA 5IHIA 1NLPC 1UGVA 2D0NA 4WCIA 2LZ6B 1ZUKA 3VS2A 1QWEA 2EKHA 1CKBA 1QWFA 1ARKA 2JT4A 1U06A 1CKAA 1PRLC 3UF4A 2ABLA 1YNZA 3VRYA 4JZ3A 3H0IA 2D8HA 2KGTA 2NUZA 2L0AA 4J9IA 2EVRA 1W6XA 2LJ3A 1AWXA 1M3BA 1X69A 4LE9A 4RTUA 3TSZA 4X1VA 2FPFA 2MCNA 3NPFA 2D1XA 2E5KA 2LCSA 1U3OA 2JM9A 1B3QA 3I5SA 4J9CA 1MV0B 2VVKA 2K79A 2CREA 1J3TA 1GL5A 1GBQA 2RQRA 2ECZA 1T3SA 2DRMA 5IHKA 4AFUC 4F14A 2YDLA 1ZBJA 3I35A 2K2MA 2YUQA 5FWBA 3VRZA 1X27A 2L2PA 2ENMA 1U5SA 3EG3A 1FYNA 4OMLA 1K76A 3VS6A 2X3WD 4DEXA 2DX1A 2X3XD 3H0FA 5L23A 4ESRA 1JXMA 1YP5A 2LX7A 1WDXA 2RQTA 2HEQA 2KEAA 2J06A 1H3HA 2W0ZA 1UJ0A 3RBBB 4J9BA 1SHGA 3REBB 4LNPA 3SEMA 1UECA 1Z9QA 4RTTA 2O9SA 1YCSB 2DBKA 2LJ0A 1WFWA 2J6FA 1OPLA 4AFSC 1K0XA 3RNJA 2C0OA 3THKA 2LJ1A 3C0CA 2GTJA 1ZSGA 1BBZA 5IXBA 1EFNA 2K7AA 2DMOA 2L3SA 2CUBA 3PVLA 1IO6A 1WIEA 2GBQA 2O31A 1E7OA 4OMMA 4LN2A 2DVJA 4J9DA 2HCKA 1AZEA 4A63B 2YUNA 1WI7A 2OI3A 3PE0A 1JXOA 1X6BA 1TUDA 2L3QA 1BB9A 1MUZA 2D8JA 1M30A 4JZ4A 1UE9A 3KFVA 1ZUYA 1ZLMA 2ED0A 2NWMA 4CC7A 2J6KA 3EG1A 1S1NA 3CQTA 1UHFA 2YT6A 1CSKA 4M4ZA 4Z89A 1QCFA 1MV3A 1SHFA 4FSSA 1K0SA 4AFZC 3ZL7C 1ZUUA 4CC4B 3EG0A 3EG2A 2KROA 2DLPA 2EYWA 2JM8A 2AKKA 2CUDA 1UJYA 1I07A 1E6GA 2EYXA 1OV3A 5GJWB 2I0NA 1WLPB 1JU5C 1V1CA 2DL3A 2C0IA 2DJQA 2P4RA 3O5ZA 1A0NB 1M3CA 1AWJA 2OAWA 3VS0A 1Y0MA 2RQWA 2ROLA 1AVZC 2EGEA 2EYZA 2EGCA 2KRMA 4D8KA 2EPDA 2DE0X 2EBPA 1WXTA 2K6DA 2DL5A 2FG0A 1RLQC 2DM1A 2RF0A 2JTEA 4Z8AA 1RLPC 1SEMA 1YWPA 3R6NA 1KFZA 4HVWA 2DL8A 1AOJA 1PNJA 1N5ZA 2GQIA 1NEGA 1NG2A 2CH4W 2RMOA 1X2KA 3M0TA 2PTKA 3LH5A 2DILA 2O2OA 4JJBA 2W10A 3UATA 2FO0A 5FWCA 1BK2A 1M3AA 2PZ1A 1YN8A 2LQNA 2DA9A 1VA7A 2F2XA 3QWXX 2KYBA 1TG0A 4JPBW 2A28A 5IXFA 1SRMA 4RTXA 4JJCA 1AWWA 2K3BA 3VS5A 4F17A 4K11A 2KXCA 2EYYA 2YUOA 1BU1A 4HXJA 3JV3A 4CC3A 2FEIA 1QLYA 2YUPA 2AZSA 1NEBA 1NYGA 3I5RA 1LCKA 2KXDA 3H0HA 1T3LA 4RTYA 3SHWA 1VYVA 1UDLA 1AD5A 2YSQA 1X6GA 4IIMA 1W70A 1W1FA 1AZGB 2JS0A 3UA6A 1G2BA 1ABOA 2O88A 1NYFA 2ESWA 2JXBA 2J7IA 1SPKA 4AFQC 2CT3A 4J9EA 2LQWA 3M0RA 2VWFA 1QKWA 1KJWA 2SEMA 3QWYA 3M0SA 1Y57A 1VYUA 2BTTA 1GCPA 1WX6A 4D8DA 1ABQA 3FJ5A 2ROTA 3TSWA 3VS1A 3ULRB 3VS4A 1K4US 5ECAA 4ZNXA 2H8HA 2DYBA 4CC2A 1UUEA 2JMAA 1UG1A 4LUEA 4RTVA 1JO8A 1FMKA 1NM7A 2KE9A 3TVTA 1PHTA 2EQIA 1G83A 2EW3A 5GJVB 3VS7A 1JQQA 2KR3A 2DRKA 1NLOC 1T0JA 3NHNA 5IHNA 2ED1A 2G6FX 1GCQA 3M0UA 2PNIA 1M8MA 2DF6A 2FPDA 2HBWA 4OMNA 4KRTA 4Z88A 2K9GA 1K9AA 4OMOA 2CDTA 1X2QA 2V1QA 2CT4A 1B07A 3EGUA 1GBRA 2KBTA 4AG2C 1RUWA 2B86A 1YWOA 4E6RA 1VYTA 4QT7A 1PRMC 3EHRA 2LNHB 4HVUA 3VS3A 1QKXA 1GCQC 2XMFA 1OOTA 1I1JA 5IH2A 1H92A 2KRNA 2RQUA 2BZXA 2DBMA 1OEBA 2CH4A 2M51A 3UA7A 2LP5A 1AEYA 1GRIA 2DNUA 1M27C 3H41A 2MOXA 4IIOA 2CSQA 1WXBA 2V1RA 1HJDA 2RPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9V A;  4J9G A;  1HSQ A;  1KIK A;  1H8K A;  2BZ8 A;  4DEY A;  1UFF A;  1E6H A;  2F2W A;  2RNA A;  2AKL A;  1T0H A;  2KRS A;  4ORZ A;  1GFC A;  2EGA A;  2AZV A;  2DL4 A;  5FW9 A;  2J05 A;  3NGP A;  1WA7 A;  2GTO A;  4RTZ A;  1PKS A;  5EC7 A;  1X43 A;  2J6O A;  2KT8 A;  2HSP A;  2RQV A;  4R0K A;  3A98 A;  3IQL A;  4F16 A;  2A37 A;  4AG1 C;  1UTI A;  2JS2 A;  1ZX6 A;  2LMJ A;  4JJD A;  3PVQ A;  2KYM A;  2VKN A;  2JMC A;  2BZY A;  1XOV A;  5I22 A;  2HDA A;  1PWT A;  2DL7 A;  2A36 A;  2FRY A;  4HCK A;  4J9F A;  4RTW A;  3I9Q A;  1PKT A;  1I0C A;  2FPE A;  4RUG A;  1AWO A;  1JEG A;  4HVV A;  2GGR A;  4J9H A;  2GNC A;  4GBQ A;  2SRC A;  3M0Q A;  3M0P A;  4OMQ A;  2IIM A;  2F2V A;  1WXU A;  5I11 A;  2MIO A;  1GFD A;  1Z9Z A;  2A08 A;  5HCK A;  2M0Y A;  2RN8 A;  4LUD A;  2OJ2 A;  1HD3 A;  3U23 A;  2AK5 A;  1UHC A;  2L3P A;  1K1Z A;  1SSH A;  3EHQ A;  3GBQ A;  4EIK A;  1WYX A;  2CSI A;  1TUC A;  3NMZ C;  1OPK A;  1KSW A;  4Y92 A;  2KT1 A;  1RI9 A;  2FRW A;  2KNB B;  2JW4 A;  2QDL A;  2C0T A;  3REA B;  1SRL A;  4GLM A;  4OMP A;  5IHI A;  1NLP C;  1UGV A;  2D0N A;  4WCI A;  2LZ6 B;  1ZUK A;  3VS2 A;  1QWE A;  2EKH A;  1CKB A;  1QWF A;  1ARK A;  2JT4 A;  1U06 A;  1CKA A;  1PRL C;  3UF4 A;  2ABL A;  1YNZ A;  3VRY A;  4JZ3 A;  3H0I A;  2D8H A;  2KGT A;  2NUZ A;  2L0A A;  4J9I A;  2EVR A;  1W6X A;  2LJ3 A;  1AWX A;  1M3B A;  1X69 A;  4LE9 A;  4RTU A;  3TSZ A;  4X1V A;  2FPF A;  2MCN A;  3NPF A;  2D1X A;  2E5K A;  2LCS A;  1U3O A;  2JM9 A;  1B3Q A;  3I5S A;  4J9C A;  1MV0 B;  2VVK A;  2K79 A;  2CRE A;  1J3T A;  1GL5 A;  1GBQ A;  2RQR A;  2ECZ A;  1T3S A;  2DRM A;  5IHK A;  4AFU C;  4F14 A;  2YDL A;  1ZBJ A;  3I35 A;  2K2M A;  2YUQ A;  5FWB A;  3VRZ A;  1X27 A;  2L2P A;  2ENM A;  1U5S A;  3EG3 A;  1FYN A;  4OML A;  1K76 A;  3VS6 A;  2X3W D;  4DEX A;  2DX1 A;  2X3X D;  3H0F A;  5L23 A;  4ESR A;  1JXM A;  1YP5 A;  2LX7 A;  1WDX A;  2RQT A;  2HEQ A;  2KEA A;  2J06 A;  1H3H A;  2W0Z A;  1UJ0 A;  3RBB B;  4J9B A;  1SHG A;  3REB B;  4LNP A;  3SEM A;  1UEC A;  1Z9Q A;  4RTT A;  2O9S A;  1YCS B;  2DBK A;  2LJ0 A;  1WFW A;  2J6F A;  1OPL A;  4AFS C;  1K0X A;  3RNJ A;  2C0O A;  3THK A;  2LJ1 A;  3C0C A;  2GTJ A;  1ZSG A;  1BBZ A;  5IXB A;  1EFN A;  2K7A A;  2DMO A;  2L3S A;  2CUB A;  3PVL A;  1IO6 A;  1WIE A;  2GBQ A;  2O31 A;  1E7O A;  4OMM A;  4LN2 A;  2DVJ A;  4J9D A;  2HCK A;  1AZE A;  4A63 B;  2YUN A;  1WI7 A;  2OI3 A;  3PE0 A;  1JXO A;  1X6B A;  1TUD A;  2L3Q A;  1BB9 A;  1MUZ A;  2D8J A;  1M30 A;  4JZ4 A;  1UE9 A;  3KFV A;  1ZUY A;  1ZLM A;  2ED0 A;  2NWM A;  4CC7 A;  2J6K A;  3EG1 A;  1S1N A;  3CQT A;  1UHF A;  2YT6 A;  1CSK A;  4M4Z A;  4Z89 A;  1QCF A;  1MV3 A;  1SHF A;  4FSS A;  1K0S A;  4AFZ C;  3ZL7 C;  1ZUU A;  4CC4 B;  3EG0 A;  3EG2 A;  2KRO A;  2DLP A;  2EYW A;  2JM8 A;  2AKK A;  2CUD A;  1UJY A;  1I07 A;  1E6G A;  2EYX A;  1OV3 A;  5GJW B;  2I0N A;  1WLP B;  1JU5 C;  1V1C A;  2DL3 A;  2C0I A;  2DJQ A;  2P4R A;  3O5Z A;  1A0N B;  1M3C A;  1AWJ A;  2OAW A;  3VS0 A;  1Y0M A;  2RQW A;  2ROL A;  1AVZ C;  2EGE A;  2EYZ A;  2EGC A;  2KRM A;  4D8K A;  2EPD A;  2DE0 X;  2EBP A;  1WXT A;  2K6D A;  2DL5 A;  2FG0 A;  1RLQ C;  2DM1 A;  2RF0 A;  2JTE A;  4Z8A A;  1RLP C;  1SEM A;  1YWP A;  3R6N A;  1KFZ A;  4HVW A;  2DL8 A;  1AOJ A;  1PNJ A;  1N5Z A;  2GQI A;  1NEG A;  1NG2 A;  2CH4 W;  2RMO A;  1X2K A;  3M0T A;  2PTK A;  3LH5 A;  2DIL A;  2O2O A;  4JJB A;  2W10 A;  3UAT A;  2FO0 A;  5FWC A;  1BK2 A;  1M3A A;  2PZ1 A;  1YN8 A;  2LQN A;  2DA9 A;  1VA7 A;  2F2X A;  3QWX X;  2KYB A;  1TG0 A;  4JPB W;  2A28 A;  5IXF A;  1SRM A;  4RTX A;  4JJC A;  1AWW A;  2K3B A;  3VS5 A;  4F17 A;  4K11 A;  2KXC A;  2EYY A;  2YUO A;  1BU1 A;  4HXJ A;  3JV3 A;  4CC3 A;  2FEI A;  1QLY A;  2YUP A;  2AZS A;  1NEB A;  1NYG A;  3I5R A;  1LCK A;  2KXD A;  3H0H A;  1T3L A;  4RTY A;  3SHW A;  1VYV A;  1UDL A;  1AD5 A;  2YSQ A;  1X6G A;  4IIM A;  1W70 A;  1W1F A;  1AZG B;  2JS0 A;  3UA6 A;  1G2B A;  1ABO A;  2O88 A;  1NYF A;  2ESW A;  2JXB A;  2J7I A;  1SPK A;  4AFQ C;  2CT3 A;  4J9E A;  2LQW A;  3M0R A;  2VWF A;  1QKW A;  1KJW A;  2SEM A;  3QWY A;  3M0S A;  1Y57 A;  1VYU A;  2BTT A;  1GCP A;  1WX6 A;  4D8D A;  1ABQ A;  3FJ5 A;  2ROT A;  3TSW A;  3VS1 A;  3ULR B;  3VS4 A;  1K4U S;  5ECA A;  4ZNX A;  2H8H A;  2DYB A;  4CC2 A;  1UUE A;  2JMA A;  1UG1 A;  4LUE A;  4RTV A;  1JO8 A;  1FMK A;  1NM7 A;  2KE9 A;  3TVT A;  1PHT A;  2EQI A;  1G83 A;  2EW3 A;  5GJV B;  3VS7 A;  1JQQ A;  2KR3 A;  2DRK A;  1NLO C;  1T0J A;  3NHN A;  5IHN A;  2ED1 A;  2G6F X;  1GCQ A;  3M0U A;  2PNI A;  1M8M A;  2DF6 A;  2FPD A;  2HBW A;  4OMN A;  4KRT A;  4Z88 A;  2K9G A;  1K9A A;  4OMO A;  2CDT A;  1X2Q A;  2V1Q A;  2CT4 A;  1B07 A;  3EGU A;  1GBR A;  2KBT A;  4AG2 C;  1RUW A;  2B86 A;  1YWO A;  4E6R A;  1VYT A;  4QT7 A;  1PRM C;  3EHR A;  2LNH B;  4HVU A;  3VS3 A;  1QKX A;  1GCQ C;  2XMF A;  1OOT A;  1I1J A;  5IH2 A;  1H92 A;  2KRN A;  2RQU A;  2BZX A;  2DBM A;  1OEB A;  2CH4 A;  2M51 A;  3UA7 A;  2LP5 A;  1AEY A;  1GRI A;  2DNU A;  1M27 C;  3H41 A;  2MOX A;  4IIO A;  2CSQ A;  1WXB A;  2V1R A;  1HJD A;  2RPN A; 
#chains in the Genus database with same CATH topology
 1JB0 E;  4J9G A;  1YJW Q;  3CD6 A;  2BZ8 A;  4DEY A;  4RCC A;  1UFF A;  1E6H A;  2CYZ B;  2F2W A;  2KAF A;  2RNA A;  3CCU A;  1KQ2 A;  2CKK A;  2HNI A;  4ORZ A;  4M7A D;  2GCX A;  2DL4 A;  3A8G B;  3CC7 T;  5FW9 A;  1O9S A;  2J05 A;  3MET A;  3NGP A;  2VV5 A;  1X43 A;  2L3R A;  1MND A;  4OB1 B;  4PJM A;  4BE0 A;  4F16 A;  4JUV A;  2A37 A;  2LMJ A;  2DYI A;  1YIT T;  4M7D D;  1XOV A;  4V2S A;  2HDA A;  1UGS B;  2QA4 T;  2FRY A;  4J9F A;  3I9Q A;  5CO7 A;  5GAO m;  1I0C A;  1WHM A;  4QQD A;  4RUG A;  5LJ3 e;  1JEG A;  3OS1 A;  3PT9 A;  4GBQ A;  2SRC A;  1YBY A;  3M0P A;  3SDZ A;  2E6N A;  1WXU A;  3QKJ A;  2MIO A;  5GAN 5;  3G6E T;  1XQH A;  4QVD A;  5HCK A;  2A08 A;  2Y90 A;  4N4G A;  2NUT A;  2K5I A;  3A1P A;  2DXB A;  3U23 A;  1UHC A;  5D6W A;  4JRQ A;  3OYD A;  1M5Q 1;  4EIK A;  3JB9 H;  1TUC A;  4DA4 A;  1KSW A;  3VKI A;  3WVE B;  2LTO A;  1I5L A;  4N0A C;  3OS2 A;  3DB3 A;  1H64 1;  2C0T A;  4RCB A;  3OYM A;  2L89 A;  3REA B;  4MZP A;  3RES A;  2EFI A;  5GAM g;  1OI1 A;  2DJZ A;  2LT1 A;  4C92 A;  4E47 A;  4O6J A;  2M0O A;  3VS2 A;  1BYM A;  1QWE A;  4PFZ A;  2XK0 A;  2E3H A;  5GAM e;  3CPW P;  2DAQ A;  1CKB A;  2KVQ G;  4HT9 A;  1ARK A;  5FU7 C;  4FSX A;  2M16 A;  4WF2 A;  1YNZ A;  5GAN 2;  3H0I A;  2QEX Q;  2DZC A;  3M56 A;  4LE9 A;  4L6V 5;  1X69 A;  1D3B B;  2MCN A;  3NPF A;  3QDR B;  2E5K A;  2R5M A;  2LCS A;  1OYX A;  4M78 D;  1U3O A;  2JM9 A;  4J9C A;  1OUL A;  4M7A E;  2K79 A;  1D3B A;  2CRE A;  1GL5 A;  1GBQ A;  2RQR A;  1I8F A;  3JCM V;  4F14 A;  3I35 A;  1VQ8 T;  2F5K A;  3CCV A;  1FYN A;  1LNX A;  3VS6 A;  4DQ2 A;  4DEX A;  4PJJ A;  5LJ5 h;  5FU7 B;  4ESR A;  1JXM A;  1B34 A;  5CCA A;  2EJ9 A;  2LX7 A;  1RAE B;  3GIB A;  4PK4 A;  4QVZ A;  2EAY A;  3QYH B;  2YLB A;  1H3H A;  1K73 U;  1B34 B;  1YHQ T;  4QQG A;  4J9B A;  3V8L A;  2RB6 A;  1QCN A;  1UEC A;  4RTT A;  5HY6 A;  2LJ0 A;  5CKB A;  1K0X A;  3THK A;  2DTO A;  3CMA Q;  1Q81 C;  3G6E A;  1FX7 A;  2COW A;  2X4Y A;  1NPR A;  1PC0 A;  5KYY B;  2K7A A;  2DMO A;  1WIE A;  2DK3 A;  3FLG A;  2JUF A;  3G7Z A;  2RI3 A;  2DVJ A;  3RKY A;  2XDP A;  3RKX A;  2HCK A;  5A0G A;  2QI2 A;  3M59 A;  1OU9 A;  3EAE A;  2DFU A;  2OI3 A;  1JXO A;  3PE0 A;  2DXU A;  1X6B A;  3HRU A;  5GAN e;  1BB9 A;  1F1B B;  4F7U F;  3CME A;  2C06 A;  2ED0 A;  1RAC B;  5KYY A;  3A8L B;  4IUU A;  4A53 A;  3OS5 A;  4ZTJ A;  3ER0 A;  4EMK A;  3CQT A;  3CPW S;  1UHF A;  3MPU B;  4M75 G;  4C92 E;  1CSK A;  3OW2 A;  2K5F A;  3TU4 K;  2DZ9 A;  3HRS A;  1K0S A;  4C8Q E;  4HKE A;  1Q86 U;  4A4G A;  3KXT A;  3MEV A;  2YLC A;  3EG2 A;  2EYW A;  2DXC A;  1FMV A;  3CME T;  1QQJ A;  1UGR B;  2KSS A;  1UJY A;  4FW2 A;  5CR2 A;  2RHX A;  2DJQ A;  2P4R A;  1AWJ A;  2OAW A;  3LGF A;  2RQW A;  2QK0 A;  1KD1 C;  4LDU A;  2DE0 X;  2PVG B;  2DIQ A;  2E4H A;  2X4X A;  3RR6 A;  2K6D A;  2D6F A;  2FZK B;  1M2O A;  2DM1 A;  3HTR A;  2JTE A;  3ME9 A;  1SEM A;  4JLI A;  2XHC A;  1YWP A;  2MWP A;  3JCM f;  4C92 D;  1KFZ A;  2PQW A;  1DJ7 B;  3RKW A;  2YRC A;  1PNJ A;  1U1S A;  1NG2 A;  4BDZ A;  3D7S B;  2CH4 W;  4FYW B;  2PTK A;  2W10 A;  3UAT A;  2PUK B;  4J6Y A;  1YN8 A;  2LQN A;  2DA9 A;  3J7A F;  4E7L A;  4XTU A;  3QWX X;  4A4H A;  4FL6 A;  4M75 F;  1V76 A;  2MYS A;  2WSF E;  1M90 R;  5IXF A;  3M5A A;  2K3B A;  1R0C B;  2QA4 Q;  4OB3 B;  4M78 E;  4HXJ A;  4M78 A;  1YJ9 T;  1K9M R;  1RAD B;  4F7U A;  2KXD A;  4XQ3 A;  1MGQ A;  3H0H A;  3NFC A;  1T3L A;  3SHW A;  1VYV A;  1UDL A;  2X4J A;  4IIM A;  4J7I A;  1VUB A;  1AZG B;  3UA6 A;  1VQ9 A;  4M75 D;  3CCQ A;  2O4X A;  2JXB A;  2LCL A;  2VXE A;  1YFN A;  2IVW A;  2BE7 D;  3GF5 A;  3LH0 A;  8ATC B;  4ANJ A;  4LDW A;  4NL3 A;  1QKW A;  1EZZ B;  3RIR A;  1KJW A;  4PJO D;  4LXC A;  2SEM A;  1NJI R;  3M4G A;  5GAO p;  2RI2 A;  2NLU A;  2QQ9 A;  1YJN A;  4KH0 B;  4FT4 A;  3L1A A;  1GCP A;  4D8D A;  3FJ5 A;  1YI2 Q;  3TSW A;  5A0D A;  3ULR B;  1VQM A;  3A5Z B;  1LOJ A;  2DYB A;  2VUB A;  2OTJ T;  3WVD B;  5GMK l;  3I55 A;  1PHT A;  4M7A G;  4XTZ A;  2EQI A;  3CCR T;  5CK9 A;  4BE2 A;  1G83 A;  2EW3 A;  1C6V X;  2FB7 A;  4L5G A;  2DRK A;  1VQP T;  4C92 G;  3CCV Q;  1RL2 A;  5KH6 A;  1TU0 B;  2DD5 A;  2Y4X A;  2KI7 A;  2QAS A;  1KC8 C;  2HBW A;  4OMN A;  1Q86 C;  3OSV A;  4O5V A;  4C8Q D;  3OYC A;  3CCM T;  5GAO q;  4OMO A;  3SFM A;  3CXC A;  1YIJ Q;  3UPU A;  5CIU A;  4FYY B;  2XI9 A;  1M9S A;  4QT7 A;  1Y71 A;  1VQK T;  1K73 C;  2HL3 A;  1QKX A;  4M7A A;  1GCQ C;  2R58 A;  1D0Y A;  4ZTF A;  3CCS Q;  1OEB A;  5FRM A;  3V7R A;  4OMF B;  4QQ6 A;  2LP5 A;  5LJ3 g;  1AEY A;  2GFA A;  4BAC A;  2QA4 A;  2NYS A;  3OA6 A;  2E6Z A;  3CC2 T;  1K8A R;  3OYI A;  2O9V A;  3JCM X;  4DOW A;  1XJW B;  3CCV T;  2WSE E;  2E5Q A;  1Q81 U;  3JCM g;  3VU3 C;  1GFC A;  1TOV A;  2MAM A;  3UT1 A;  4MZT A;  5A2Q E;  1S72 Q;  4BY6 C;  4PJN A;  1NJI U;  3E9F A;  2KQW A;  1PD0 A;  3DKM A;  1VQ5 A;  4R0K A;  3A98 A;  3IQL A;  4AG1 C;  3L42 A;  1EIF A;  1IHV A;  4E7I A;  2JS2 A;  5LJ3 f;  3LW5 E;  2XKO C;  2XDB A;  2VKN A;  4M77 C;  1Q7Y R;  5I22 A;  3NTK A;  2E1H A;  3E9G A;  2A36 A;  4HCK A;  3GLX A;  2P4T A;  5LJ3 j;  1AWO A;  2JTF A;  5GAN 8;  4HVV A;  2LQK A;  2GGR A;  2RK1 A;  4C0Z A;  1Y96 B;  4M78 C;  4XAX B;  2YRV A;  3RUX A;  2IIM A;  2F2V A;  2QQA A;  4Q5W A;  5I11 A;  1M1K U;  1RAG B;  5IAY A;  4C0D C;  2E65 A;  1GFD A;  1Z9Z A;  4IUP A;  2RN8 A;  5DY9 A;  2E3I A;  2CP2 A;  2X4W A;  4LUD A;  4M7A B;  2RHY A;  3OQ5 A;  4J6W A;  2COY A;  3EHQ A;  3GBQ A;  1VQK Q;  5GAM d;  2HD0 A;  2MWO A;  1OPK A;  3EFO A;  1VQ8 Q;  4Y92 A;  2KT1 A;  1TS9 A;  2KNB B;  4ZGJ B;  2JW4 A;  2CZ7 B;  1QP3 A;  2YXY A;  2L8D A;  2ZPE B;  4OMP A;  4J7F A;  1NLP C;  2KY9 A;  3HSB A;  1ZUK A;  3H8Z A;  5GAM j;  4RMO A;  2RA2 A;  3QJY A;  4FIB A;  3C95 A;  2ABL A;  3VRY A;  1JBM A;  4JZ3 A;  2D8H A;  1ZBX A;  2L0A A;  1G5V A;  1RI0 A;  4RTU A;  1AWX A;  4PL6 A;  6AT1 B;  3TRE A;  4X1V A;  1LJO A;  3CCU Q;  4OF1 A;  1WZO A;  2DIG A;  2LVM A;  3HFO A;  1IZ6 A;  2VVK A;  2HBP A;  1QVF P;  2RM4 A;  4KGV B;  1J3T A;  3CC4 A;  4A4F A;  4ATO A;  3QG1 A;  1IGQ A;  1X27 A;  3EG3 A;  1K76 A;  1TWB A;  2X3W D;  4OB0 B;  3JCM Q;  3L2Q A;  3G71 T;  4XTX A;  4C8Q F;  1WQ7 A;  3SWN B;  1R77 A;  3G4S A;  3A8M B;  3OYB A;  1VQP A;  2RQT A;  3BDU A;  2HEQ A;  2KEA A;  2JOY A;  1MMN A;  2AIR B;  2W0Z A;  4M78 B;  2PVO B;  4C5E A;  1UJ0 A;  3BDL A;  4ZGD B;  2XIC A;  1SHG A;  3MHX A;  3SEM A;  1YIT A;  2KMT A;  2R57 A;  4F7U G;  1YCS B;  2CS7 A;  4AFS C;  3E1S A;  5KYU A;  4FCY A;  2F5T X;  2CP7 A;  3C0C A;  2GTJ A;  2RO0 A;  1BBZ A;  1XTD A;  1Q81 R;  1EFN A;  2MI6 A;  3C4S A;  2L3S A;  5KYX B;  3QZ9 B;  4BB7 A;  3CCU T;  4P5N A;  2GBQ A;  3FRN A;  2FYK A;  2O31 A;  1PSE A;  4OMM A;  4LN2 A;  4J9D A;  3CCQ T;  1XNI A;  2XG8 D;  5GAN 6;  1TUD A;  2DKG A;  3HPW A;  1VQO Q;  1ZQ1 A;  4C5I A;  3M4Y A;  1ZLM A;  4KT0 E;  5KYN A;  5GMK j;  3OYE A;  2NWM A;  3MJX A;  2QAZ A;  1PD1 A;  2J6K A;  2ZCF B;  4BD3 A;  2EJF A;  4QW2 A;  2ZPG B;  1LPL A;  5GAN 7;  2YT6 A;  3A8O B;  4M4Z A;  4M7D G;  4Z89 A;  1W4S A;  1MV3 A;  4XTV A;  3V8J A;  1N8R C;  4AFZ C;  4NS5 A;  3VV0 A;  4CC4 B;  4ELZ C;  3EG0 A;  2HKQ B;  4WTO B;  1MNE A;  1ZSZ B;  1Y07 A;  2CUD A;  1E6G A;  2D0Q B;  5GJW B;  4M77 F;  1YHQ A;  1WLP B;  3G4S Q;  1JU5 C;  1V1C A;  3X28 B;  2VGN A;  4N0A A;  3VS0 A;  1Y0M A;  2ROL A;  4TVR A;  1QVF S;  3ASK A;  4XU1 A;  2EBP A;  1M1K R;  4C5G A;  4AT1 B;  2FVU A;  4M7D F;  3OYH A;  2DL5 A;  4AMC A;  2FG0 A;  2CZ6 B;  1PG5 B;  1N27 A;  3EGD B;  3EG9 B;  2DL8 A;  2JTM A;  4XU0 A;  2JZ2 A;  5GMK m;  3OS0 A;  5GAO l;  3P8H A;  1YIT Q;  3CXC P;  4NOY A;  2DTH A;  2WAC A;  3M0T A;  3ZFJ A;  3CCJ Q;  2DIL A;  2FO0 A;  5FWC A;  1M3A A;  2PZ1 A;  1HK9 A;  2RI5 A;  1BIA A;  2E41 A;  4BI8 B;  2KYB A;  1KQ1 A;  4JPB W;  4PJL A;  2P0P A;  1AWW A;  3CCR Q;  3SD4 A;  1D1C A;  3QJ6 A;  4F17 A;  5EG2 A;  1C1A A;  3JV3 A;  5CVI A;  2FEI A;  1QLY A;  1NYG A;  2RHZ A;  1G8X A;  5GMK i;  2JN0 A;  1FWZ A;  3JCM d;  4C8Q G;  5HK3 A;  2RH2 A;  4C0F A;  1W1F A;  3HKS A;  3UWN A;  3NTH A;  1M8V A;  1ABO A;  2LNV A;  2K5L A;  1IXD A;  3AT1 B;  1V29 B;  3LLR A;  2CT3 A;  3F70 A;  3INZ A;  4J9E A;  4E7H A;  1HXD A;  1VQ7 A;  3M0R A;  2RJF A;  1NE8 A;  1BI2 A;  4XTY A;  3LYI A;  4BE1 A;  3QWY A;  3CC7 A;  1VYU A;  1NJI C;  4FYX B;  5DLO A;  2OTL A;  1KHI A;  1ABQ A;  4C8Q A;  1WHL A;  4JJN K;  3VS1 A;  3DLM A;  1BI0 A;  1I81 A;  4JRK A;  4CC2 A;  4EDU A;  3CCM A;  1UUE A;  2JMA A;  1IB8 A;  2H3E B;  1UG1 A;  2K3Y A;  4RTV A;  3CC7 Q;  1NM7 A;  1FMK A;  3MP6 A;  1M2V B;  2V8K A;  4KUI A;  5FLX E;  5KE2 A;  4CI0 C;  5GJV B;  4PJO F;  1S72 A;  1NLO C;  5GAN h;  1VQL T;  5CKH A;  3CMA A;  3WXM B;  2G6F X;  1ACM B;  4PLL A;  1M8M A;  2DF6 A;  2FPD A;  2PVD B;  3Q1J A;  1KC8 R;  5AT1 B;  2K9G A;  1K9A A;  3FB9 A;  4LDX A;  1X2Q A;  5LJ5 j;  4IUR A;  1B07 A;  3MEA A;  3NTI A;  3PNW C;  2KBT A;  2B86 A;  5CKE A;  1D1A A;  1YWO A;  1VYT A;  1WJQ A;  1OX9 A;  2Y4Y A;  3ZEH A;  3CPF A;  3JSC A;  1PRM C;  3JRZ A;  2LNH B;  3CCL Q;  3O8V A;  1IGU A;  3M54 A;  5LJ5 f;  1JJ2 S;  2PU9 B;  5KYW B;  1K73 R;  2DD4 A;  2NUT B;  5IH2 A;  1GXI E;  3JCM b;  2CH4 A;  2M51 A;  3UA7 A;  4BUG A;  3CXC S;  1GRI A;  4C92 F;  3G6E Q;  2IPO B;  2HQH A;  2MK5 A;  4D6W A;  5D6Y A;  1M27 C;  4IKF A;  2CSQ A;  3MP1 A;  1VQ9 T;  1WXB A;  2V1R A;  4DOV A;  1HSQ A;  1KIK A;  1TUG B;  1K9M U;  1VQM Q;  1YJ9 Q;  2EQJ A;  2AKL A;  2V8I A;  1WPY A;  3LWH A;  2KRS A;  1VQ5 Q;  4ZGE B;  2JNG A;  3OMC A;  2RK2 A;  2HKN A;  2IG0 A;  2VYT A;  2GTO A;  5LL6 S;  2MPX C;  1ZA2 B;  4RTZ A;  1PKS A;  4PFP A;  2J6O A;  3DB4 A;  2K2V A;  2HSP A;  2RQV A;  2X51 A;  4N4H A;  3E2U A;  3CBP A;  3GOX A;  3X26 B;  1SSF A;  4A54 A;  1ZX6 A;  2DTI A;  3PVQ A;  3E19 A;  2DL7 A;  1D0X A;  2RJC A;  2KDS A;  2LDM A;  4RTW A;  4OGC A;  3JAM E;  4OVA A;  1PKT A;  2FPE A;  2JJ9 A;  4XU2 A;  3CCQ Q;  4M7D E;  2B8A A;  3EH2 A;  1UB4 A;  3EH1 A;  1PM3 A;  3BFM A;  2GNC A;  4IUV A;  4PFO A;  4MML A;  4FM4 B;  4Z02 A;  3QPH A;  4PJO E;  3CCJ T;  4M77 D;  3OYL A;  1D1B A;  1Q82 R;  5GAN 4;  3CC4 Q;  2QXF A;  2QGG A;  2EQM A;  2M0Y A;  3CEY A;  2VAS A;  5GMK h;  3HRT A;  1WJS A;  2AK5 A;  3CME Q;  1K1Z A;  2K3X A;  1BI3 A;  4C92 C;  1SSH A;  1WYX A;  2CSI A;  3EG9 A;  3NMZ C;  3OW2 S;  2F69 A;  1RI9 A;  2FRW A;  1G3S A;  2P0K A;  1RAB B;  3OBY A;  1N9R A;  1BKB A;  3CCL A;  2D0N A;  1UGV A;  3I55 T;  2FZC B;  4RKU E;  2LZ6 B;  1QP2 A;  3PIP A;  2CGH A;  2E70 A;  3I55 Q;  2QTX A;  4OP0 A;  2ZAE A;  3JCM J;  3P8B B;  2JT4 A;  2G3R A;  3UDC A;  1U06 A;  1WHH A;  2D9T A;  1P92 A;  1NBE B;  3C94 A;  1RAI B;  1JJ2 P;  4E2F B;  2NUZ A;  4J9I A;  2L5Q A;  1W6X A;  1M3B A;  1K8A U;  3QBY A;  4BDY A;  3KUF A;  5CQX A;  1WHJ A;  2VB6 A;  1B3Q A;  3I5S A;  1VQ4 A;  1JRI A;  4DBF A;  1MV0 B;  4JRP A;  5LJ3 d;  3OYK A;  1T3S A;  2DRM A;  5IHK A;  3FJP A;  3PIO A;  5LJ5 g;  2YUQ A;  5FWB A;  4F04 B;  2V26 A;  3PTA A;  2L2P A;  4ZN3 A;  2ENM A;  4M75 B;  4OML A;  1U5S A;  3SB2 A;  5FRN A;  4IUT A;  3H0F A;  2X3X D;  1MHN A;  3RDV A;  1YP5 A;  4KH1 B;  3CBO A;  3X25 B;  3CD6 Q;  4M77 G;  1IRX A;  2J06 A;  5KYX A;  3X24 B;  3CBM A;  1KD1 R;  2A7Y A;  4KGZ B;  3RBB B;  5KYW A;  3REB B;  2QEX A;  4IUQ A;  2R5A A;  2J6F A;  1VQ5 T;  1OPL A;  2E10 A;  2M1H A;  1KHC A;  1Q95 G;  2K4Y A;  4M77 E;  1TH7 A;  4M75 E;  4R55 A;  4E7S A;  1NPP A;  4QVC A;  1ZSG A;  5IXB A;  4MDW A;  5IN1 A;  3LGL A;  1IO6 A;  4M77 A;  4BI3 A;  4MZM A;  5D6X A;  2QG9 B;  2ZPF B;  3TQ7 P;  4R56 A;  1E7O A;  3GPL A;  4DBQ A;  1AHJ B;  2BE9 B;  1AZE A;  1KG1 A;  1N9S A;  4A63 B;  2YUN A;  5I2S A;  4LD9 K;  2CZ1 B;  3OW2 P;  1MUZ A;  1M1F A;  2D8J A;  1K9M C;  3JB9 F;  3HFN A;  1M30 A;  4LDV A;  1X01 A;  3OYJ A;  3KFV A;  1ZUY A;  3CCS A;  4GY5 A;  5GMK e;  1VQN T;  4CC7 A;  1QVG P;  3EG1 A;  2KK4 A;  2RD1 A;  5D7U A;  1OZ2 A;  2V8J A;  3J81 E;  4JS4 A;  2CP0 A;  2P0Q A;  3KBG A;  3OYA A;  5HKC A;  1ZUU A;  3QII A;  5GAN d;  1VQ4 Q;  1VQN A;  2DLP A;  4A4K A;  1WGS A;  2JM8 A;  2AKK A;  4ME7 A;  3S3O A;  4YTL A;  2OTJ Q;  1QCO A;  1YI2 T;  4ZN1 A;  1M3C A;  2CP3 A;  1AVZ C;  5M9O A;  2EGC A;  2KRM A;  2EPD A;  3MCA B;  3FEO A;  4EMK C;  2RF0 A;  1RAF B;  4M75 A;  5J26 A;  4HVW A;  1Q7Y U;  4X34 A;  2XU8 A;  1N5Z A;  1VIF A;  2GQI A;  3CC4 T;  2QQR A;  4M77 B;  1X2K A;  3J80 E;  3LH5 A;  2O2O A;  4HA8 A;  1BI1 A;  4E7K A;  4EMK B;  2CP5 A;  2GFU A;  4PJO B;  5GAN 3;  3CMA T;  5DM7 R;  2XID A;  1IRE B;  1VA7 A;  1EX4 A;  4C5H A;  3BE3 A;  2EJG A;  1TG0 A;  3QO3 A;  3I56 Q;  5L8R E;  1VQP Q;  4L59 A;  2E12 A;  4RTX A;  4LDY A;  3VS5 A;  3S6W A;  4K11 A;  2EYY A;  1BU1 A;  1QVG A;  4PJO G;  2AZS A;  1NEB A;  3VUZ A;  4RTY A;  1YJ9 A;  1AD5 A;  2YSQ A;  1W70 A;  1NZ9 A;  1VQ6 T;  2JS0 A;  1G2B A;  4GLK A;  2ESW A;  4UC4 A;  2O01 E;  4JDS A;  4AFQ C;  1SPK A;  4B6M A;  3JCM c;  3VUB A;  1UEB A;  1Y7X A;  4A4E A;  2PUO B;  5KCH A;  4XK8 E;  4PJO A;  1LVK A;  3CC2 Q;  1Y57 A;  2BTT A;  3OYG A;  1QVG S;  1WX6 A;  4M78 G;  2ROT A;  4BI4 A;  2DER A;  3VS4 A;  1K4U S;  3OBW A;  1Q7Y C;  3RMS A;  4F7U B;  4LUE A;  5J39 A;  2KE9 A;  3DLL A;  2RJD A;  3CCL T;  4N4I A;  3JB9 J;  2BUD A;  1WNL A;  1JQQ A;  2KR3 A;  1QVP A;  2XDD A;  2EWN A;  3NHN A;  2ED1 A;  3TCJ A;  2K57 A;  1GCQ A;  4X9D A;  3M0U A;  4PNO A;  1N8R U;  5C0M A;  4KRT A;  3HHT B;  2CDT A;  3GNG A;  5LJ5 e;  2DVE A;  2RHI A;  1BCM A;  3EGU A;  2OTL T;  1G3Y A;  1GBR A;  4AG2 C;  4E6R A;  1KC8 U;  1KK7 A;  3EHR A;  1QMC A;  3QSU A;  4HVU A;  3VS3 A;  1M90 C;  2QEX T;  3PFS A;  2XMF A;  1I1J A;  1H92 A;  2RQU A;  2BZX A;  2DBM A;  1QW1 A;  2ATC B;  2HAX A;  1AT1 B;  2LT4 A;  3CCR A;  3M55 A;  3L2W A;  2DNU A;  3H41 A;  2ZGW A;  1X75 C;  2COZ A;  4IIO A;  3QUI A;  4FW1 A;  3VYG A;  1HJD A;  5GAO n;  2AT1 B;  1FXX A;  2OX7 A;  1H8K A;  4JLG A;  1VQL Q;  4Y91 A;  3SWN A;  1T0H A;  1VQO T;  3OYY A;  2Z0W A;  4JS5 A;  2EGA A;  2AZV A;  1VQ7 Q;  1VQK A;  1OX8 A;  4RG8 A;  5KCO A;  1YHQ Q;  1WA7 A;  4PKC C;  3G1J A;  2OAU A;  1RAA B;  3OYN A;  5EC7 A;  2KT8 A;  4II1 A;  3AHU A;  1MMG A;  4VUB A;  1UTI A;  1TXQ A;  2DPP B;  4JJD A;  2KYM A;  2JMC A;  2BZY A;  4EPC A;  1VOM A;  1ZSZ C;  1PWT A;  4M7A F;  2FZG B;  2DXT A;  5J3B A;  2HQE A;  1UGP B;  1MMD A;  1YJW T;  4J9H A;  2EIF A;  3M0Q A;  4OMQ A;  2HSE B;  3MKD A;  3QYG B;  1SG5 A;  5GAM f;  4J6X A;  4MMK A;  3GP8 A;  5FU6 B;  2OJ2 A;  3C12 A;  4QKU A;  1YCY A;  1HD3 A;  1G3T A;  1MMA A;  4OB2 B;  2L3P A;  3EFS A;  5LJ3 h;  4C0D B;  1VQ4 T;  3QXE B;  3I56 T;  4KBM B;  2QDL A;  4X9C A;  1SRL A;  4GLM A;  4M75 C;  4M7A C;  5IHI A;  4WCI A;  2EYQ A;  3G4S T;  3P8D A;  5CKF A;  2JVV A;  4OGE A;  4XTW A;  1VQN Q;  1K8A C;  2EKH A;  1N6A A;  1QWF A;  2ZPH B;  3A8H B;  2EKO A;  1CKA A;  1PRL C;  3UF4 A;  4EMH A;  1M2V A;  1WQW A;  2KGT A;  5AYF A;  4E7J A;  2EVR A;  2LJ3 A;  3CCE A;  3TSZ A;  2FPF A;  1G3W A;  2YHT A;  3M9Q A;  2D1X A;  2GF7 A;  5CAI A;  2OTL Q;  1D0Z A;  2BKD N;  3RMQ A;  3L2R A;  3MEU A;  3CCE T;  2ZPB B;  4KGX B;  1N8R R;  2ECZ A;  3V8K A;  4Y28 E;  4AFU C;  3EGX B;  2YDL A;  2A3L A;  4PLI A;  1ZBJ A;  2K2M A;  3VRZ A;  4DBH A;  3M53 A;  3ZBD A;  5GAM h;  2DX1 A;  1TSF A;  5L23 A;  9ATC B;  2MF2 A;  2VC8 A;  4KUL A;  1OQK A;  1ZA1 B;  3JCM W;  3QHS A;  4M78 F;  2HMA A;  1WDX A;  1YIJ A;  3QDF A;  4C92 B;  1YI2 A;  1D09 B;  2QQS A;  1I4K 1;  3HP9 A;  5GAN f;  3RER A;  3T9N A;  1FMW A;  1X6O A;  1KQS P;  4LNP A;  1Z9Q A;  2MMP A;  2O9S A;  3V7S A;  2DBK A;  1WHG A;  1WFW A;  5DLQ E;  4C8Q C;  1ZHI A;  2I2L A;  3RNJ A;  3JB9 D;  2C0O A;  3QZ5 B;  1M90 U;  2LJ1 A;  2O4X B;  2EQK A;  4FYV B;  2P84 A;  2CUB A;  3PVL A;  5I2M A;  1W2B S;  1SKU B;  5CQY A;  1YJW A;  4HCB A;  2E64 A;  1VQL A;  1B7T A;  1S72 T;  3VJP A;  2DET A;  2LRQ A;  1U1T A;  3CCS T;  3CPW A;  3L2Z A;  1WI7 A;  5GAN j;  2L3Q A;  4HCC A;  5CKD A;  2CP6 A;  4JZ4 A;  1UE9 A;  4J8O A;  5C6S A;  4J83 A;  1VQ8 A;  3OSS C;  4F7U E;  4PJO C;  2VXF A;  5GAO r;  1VQ9 Q;  1S1N A;  1PSF A;  1KQS A;  5KYU B;  3G71 Q;  2LCC A;  2LC4 A;  1Q82 U;  1ZSZ A;  1QCF A;  1SHF A;  2FL7 A;  4FSS A;  1M1G A;  1VQ7 T;  3ZL7 C;  4C0G A;  5I21 A;  4J5Y A;  1BIB A;  5A0L A;  2KRO A;  3I56 A;  3JB9 I;  4DBR A;  1R8O B;  4ELY C;  1WJR A;  3CC2 A;  1I07 A;  2EYX A;  2HL5 C;  3OYF A;  1OV3 A;  2I0N A;  2ZZD A;  2DL3 A;  2C0I A;  3O5Z A;  1A0N B;  3X20 B;  2YRD A;  1BCO A;  2EGE A;  2EYZ A;  4D8K A;  3SWN C;  4XU3 A;  1WXT A;  1SF9 A;  3PMT A;  4B9W A;  2HZY A;  1RLQ C;  4Z8A A;  3H9N A;  1RLP C;  2WSC E;  4CRI A;  1C0M A;  2DO3 A;  5HK0 A;  1RAH B;  3R6N A;  4M7D A;  4KUD K;  8AT1 B;  3JCM h;  2YWW A;  3JB9 G;  1AOJ A;  3BY7 A;  1VIE A;  1NEG A;  2F1L A;  3V7C A;  3L2U A;  2RMO A;  4LD6 A;  1JJ2 A;  3MO8 A;  1HYO A;  4JJB A;  2FHD A;  1YJN Q;  1BK2 A;  3M57 A;  2DEU A;  2XD0 A;  3JCM P;  2F2X A;  1OU8 A;  2QQB A;  1H3Z A;  1KQS S;  2A28 A;  3GNF B;  2ZPI B;  3H6Z A;  1KD1 U;  3LX7 A;  1SRM A;  4JJC A;  1O75 A;  3PGG A;  3OMG A;  2LQ8 A;  2AHJ B;  2KXC A;  4FT2 A;  2YUO A;  2OTJ A;  3PMI A;  5KE3 A;  4CC3 A;  1VQO A;  2M02 A;  2YUP A;  1VQM T;  3I5R A;  1LCK A;  4JRI A;  3S3N A;  1X6G A;  2EQU A;  1YJN T;  3L2V A;  1W2B P;  1U8R A;  2NUP B;  2BIV A;  2O88 A;  2H3J A;  1NYF A;  1M4Z A;  2J7I A;  4HT8 A;  4FU6 A;  7AT1 B;  4NL2 A;  2X35 A;  3S3M A;  2LQW A;  2VWF A;  4E7Z A;  3VYH B;  3MEW A;  1WHK A;  3EFO B;  3LWI A;  1I5O B;  1PCX A;  4MDX A;  2QDY B;  2VGM A;  1UGQ B;  3M0S A;  3CCE Q;  3R6O A;  3M58 A;  1IHW A;  1VQ6 Q;  2NUP A;  4M7D C;  3CD6 T;  3CCJ A;  4BY6 B;  2QYZ A;  2GQV A;  5ECA A;  4ZNX A;  2H8H A;  3EGD A;  1OZ3 A;  3FIF A;  1JO8 A;  1Y96 A;  3TVT A;  1M1K C;  2DEQ A;  3TEE A;  2QGF B;  3G71 A;  5IT9 E;  3FDR A;  1TTH B;  3HL8 A;  3VS7 A;  4RG2 A;  1T0J A;  3MP8 A;  3URG A;  5IHN A;  1Q86 R;  2RJE A;  3EGX A;  5GAN g;  2PNI A;  4C8Q B;  4B9X A;  1Q82 C;  4Z88 A;  3OB9 A;  2QTV A;  2V1Q A;  2CT4 A;  3JCM e;  2CZ0 B;  2LX9 A;  3EFR A;  1RUW A;  1R0B G;  2X9H A;  4M7D B;  5FU6 C;  5FRO A;  1W2B A;  2HQX A;  3OY9 A;  3N5B B;  3FC3 A;  1OOT A;  2KRN A;  2M9U A;  2A0F B;  3BW1 A;  2RHU A;  1QVF A;  1YIJ T;  3CCM Q;  2MOX A;  4HCZ A;  4EMG A;  1VQ6 A;  5LJ5 d;  2RPN A; 
#chains in the Genus database with same CATH homology
 2O9V A;  4J9G A;  1HSQ A;  1KIK A;  1H8K A;  2BZ8 A;  4DEY A;  1UFF A;  1E6H A;  2F2W A;  2RNA A;  2AKL A;  1T0H A;  2KRS A;  4ORZ A;  1GFC A;  2EGA A;  2AZV A;  2DL4 A;  5FW9 A;  2J05 A;  3NGP A;  1WA7 A;  2GTO A;  4RTZ A;  1PKS A;  5EC7 A;  1X43 A;  2J6O A;  2KT8 A;  2HSP A;  2RQV A;  4R0K A;  3A98 A;  3IQL A;  4F16 A;  2A37 A;  4AG1 C;  1UTI A;  2JS2 A;  1ZX6 A;  2LMJ A;  4JJD A;  3PVQ A;  2KYM A;  2VKN A;  2JMC A;  2BZY A;  1XOV A;  5I22 A;  2HDA A;  1PWT A;  2DL7 A;  2A36 A;  2FRY A;  4HCK A;  4J9F A;  4RTW A;  3I9Q A;  1PKT A;  1I0C A;  2FPE A;  4RUG A;  1AWO A;  1JEG A;  4HVV A;  2GGR A;  4J9H A;  2GNC A;  4GBQ A;  2SRC A;  3M0Q A;  3M0P A;  4OMQ A;  2IIM A;  2F2V A;  1WXU A;  5I11 A;  2MIO A;  1GFD A;  1Z9Z A;  2A08 A;  5HCK A;  2M0Y A;  2RN8 A;  4LUD A;  2OJ2 A;  1HD3 A;  3U23 A;  2AK5 A;  1UHC A;  2L3P A;  1K1Z A;  1SSH A;  3EHQ A;  3GBQ A;  4EIK A;  1WYX A;  2CSI A;  1TUC A;  3NMZ C;  1OPK A;  1KSW A;  4Y92 A;  2KT1 A;  1RI9 A;  2FRW A;  2KNB B;  2JW4 A;  2QDL A;  2C0T A;  3REA B;  1SRL A;  4GLM A;  4OMP A;  5IHI A;  1NLP C;  1UGV A;  2D0N A;  4WCI A;  2LZ6 B;  1ZUK A;  3VS2 A;  1QWE A;  2EKH A;  1CKB A;  1QWF A;  1ARK A;  2JT4 A;  1U06 A;  1CKA A;  1PRL C;  3UF4 A;  2ABL A;  1YNZ A;  3VRY A;  4JZ3 A;  3H0I A;  2D8H A;  2KGT A;  2NUZ A;  2L0A A;  4J9I A;  2EVR A;  1W6X A;  2LJ3 A;  1AWX A;  1M3B A;  1X69 A;  4LE9 A;  4RTU A;  3TSZ A;  4X1V A;  2FPF A;  2MCN A;  3NPF A;  2D1X A;  2E5K A;  2LCS A;  1U3O A;  2JM9 A;  1B3Q A;  3I5S A;  4J9C A;  1MV0 B;  2VVK A;  2K79 A;  2CRE A;  1J3T A;  1GL5 A;  1GBQ A;  2RQR A;  2ECZ A;  1T3S A;  2DRM A;  5IHK A;  4AFU C;  4F14 A;  2YDL A;  1ZBJ A;  3I35 A;  2K2M A;  2YUQ A;  5FWB A;  3VRZ A;  1X27 A;  2L2P A;  2ENM A;  1U5S A;  3EG3 A;  1FYN A;  4OML A;  1K76 A;  3VS6 A;  2X3W D;  4DEX A;  2DX1 A;  2X3X D;  3H0F A;  5L23 A;  4ESR A;  1JXM A;  1YP5 A;  2LX7 A;  1WDX A;  2RQT A;  2HEQ A;  2KEA A;  2J06 A;  1H3H A;  2W0Z A;  1UJ0 A;  3RBB B;  4J9B A;  1SHG A;  3REB B;  4LNP A;  3SEM A;  1UEC A;  1Z9Q A;  4RTT A;  2O9S A;  1YCS B;  2DBK A;  2LJ0 A;  1WFW A;  2J6F A;  1OPL A;  4AFS C;  1K0X A;  3RNJ A;  2C0O A;  3THK A;  2LJ1 A;  3C0C A;  2GTJ A;  1ZSG A;  1BBZ A;  5IXB A;  1EFN A;  2K7A A;  2DMO A;  2L3S A;  2CUB A;  3PVL A;  1IO6 A;  1WIE A;  2GBQ A;  2O31 A;  1E7O A;  4OMM A;  4LN2 A;  2DVJ A;  4J9D A;  2HCK A;  1AZE A;  4A63 B;  2YUN A;  1WI7 A;  2OI3 A;  3PE0 A;  1JXO A;  1X6B A;  1TUD A;  2L3Q A;  1BB9 A;  1MUZ A;  2D8J A;  1M30 A;  4JZ4 A;  1UE9 A;  3KFV A;  1ZUY A;  1ZLM A;  2ED0 A;  2NWM A;  4CC7 A;  2J6K A;  3EG1 A;  1S1N A;  3CQT A;  1UHF A;  2YT6 A;  1CSK A;  4M4Z A;  4Z89 A;  1QCF A;  1MV3 A;  1SHF A;  4FSS A;  1K0S A;  4AFZ C;  3ZL7 C;  1ZUU A;  4CC4 B;  3EG0 A;  3EG2 A;  2KRO A;  2DLP A;  2EYW A;  2JM8 A;  2AKK A;  2CUD A;  1UJY A;  1I07 A;  1E6G A;  2EYX A;  1OV3 A;  5GJW B;  2I0N A;  1WLP B;  1JU5 C;  1V1C A;  2DL3 A;  2C0I A;  2DJQ A;  2P4R A;  3O5Z A;  1A0N B;  1M3C A;  1AWJ A;  2OAW A;  3VS0 A;  1Y0M A;  2RQW A;  2ROL A;  1AVZ C;  2EGE A;  2EYZ A;  2EGC A;  2KRM A;  4D8K A;  2EPD A;  2DE0 X;  2EBP A;  1WXT A;  2K6D A;  2DL5 A;  2FG0 A;  1RLQ C;  2DM1 A;  2RF0 A;  2JTE A;  4Z8A A;  1RLP C;  1SEM A;  1YWP A;  3R6N A;  1KFZ A;  4HVW A;  2DL8 A;  1AOJ A;  1PNJ A;  1N5Z A;  2GQI A;  1NEG A;  1NG2 A;  2CH4 W;  2RMO A;  1X2K A;  3M0T A;  2PTK A;  3LH5 A;  2DIL A;  2O2O A;  4JJB A;  2W10 A;  3UAT A;  2FO0 A;  5FWC A;  1BK2 A;  1M3A A;  2PZ1 A;  1YN8 A;  2LQN A;  2DA9 A;  1VA7 A;  2F2X A;  3QWX X;  2KYB A;  1TG0 A;  4JPB W;  2A28 A;  5IXF A;  1SRM A;  4RTX A;  4JJC A;  1AWW A;  2K3B A;  3VS5 A;  4F17 A;  4K11 A;  2KXC A;  2EYY A;  2YUO A;  1BU1 A;  4HXJ A;  3JV3 A;  4CC3 A;  2FEI A;  1QLY A;  2YUP A;  2AZS A;  1NEB A;  1NYG A;  3I5R A;  1LCK A;  2KXD A;  3H0H A;  1T3L A;  4RTY A;  3SHW A;  1VYV A;  1UDL A;  1AD5 A;  2YSQ A;  1X6G A;  4IIM A;  1W70 A;  1W1F A;  1AZG B;  2JS0 A;  3UA6 A;  1G2B A;  1ABO A;  2O88 A;  1NYF A;  2ESW A;  2JXB A;  2J7I A;  1SPK A;  4AFQ C;  2CT3 A;  4J9E A;  2LQW A;  3M0R A;  2VWF A;  1QKW A;  1KJW A;  2SEM A;  3QWY A;  3M0S A;  1Y57 A;  1VYU A;  2BTT A;  1GCP A;  1WX6 A;  4D8D A;  1ABQ A;  3FJ5 A;  2ROT A;  3TSW A;  3VS1 A;  3ULR B;  3VS4 A;  1K4U S;  5ECA A;  4ZNX A;  2H8H A;  2DYB A;  4CC2 A;  1UUE A;  2JMA A;  1UG1 A;  4LUE A;  4RTV A;  1JO8 A;  1FMK A;  1NM7 A;  2KE9 A;  3TVT A;  1PHT A;  2EQI A;  1G83 A;  2EW3 A;  5GJV B;  3VS7 A;  1JQQ A;  2KR3 A;  2DRK A;  1NLO C;  1T0J A;  3NHN A;  5IHN A;  2ED1 A;  2G6F X;  1GCQ A;  3M0U A;  2PNI A;  1M8M A;  2DF6 A;  2FPD A;  2HBW A;  4OMN A;  4KRT A;  4Z88 A;  2K9G A;  1K9A A;  4OMO A;  2CDT A;  1X2Q A;  2V1Q A;  2CT4 A;  1B07 A;  3EGU A;  1GBR A;  2KBT A;  4AG2 C;  1RUW A;  2B86 A;  1YWO A;  4E6R A;  1VYT A;  4QT7 A;  1PRM C;  3EHR A;  2LNH B;  4HVU A;  3VS3 A;  1QKX A;  1GCQ C;  2XMF A;  1OOT A;  1I1J A;  5IH2 A;  1H92 A;  2KRN A;  2RQU A;  2BZX A;  2DBM A;  1OEB A;  2CH4 A;  2M51 A;  3UA7 A;  2LP5 A;  1AEY A;  1GRI A;  2DNU A;  1M27 C;  3H41 A;  2MOX A;  4IIO A;  2CSQ A;  1WXB A;  2V1R A;  1HJD A;  2RPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...