1GBRA

Orientation of peptide fragments from sos proteins bound to the n-terminal sh3 domain of grb2 determined by nmr spectroscopy
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
74
structure length
74
Chain Sequence
b'GSRRASVGSMEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPEFIVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Orientation of peptide fragments from Sos proteins bound to the N-terminal SH3 domain of Grb2 determined by NMR spectroscopy.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signal transduction protein
total genus 7
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1994-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gbrA00
2YUOA 4CC7A 2I0NA 5HCKA 2SEMA 1YWOA 2L2PA 2LJ0A 2KYMA 2JW4A 2DL4A 1S1NA 2KEAA 1QKWA 1X2KA 2EGEA 2DBKA 1AD5A 3NHNA 1K0XA 2IIMA 2K2MA 3M0UA 2A28A 3I35A 3C0CA 2OI3A 3VS6A 2M0YA 5IXFA 1E6HA 1CKAA 1HSQA 1UTIA 2VVKA 2L3PA 1K76A 2DL8A 2JM8A 5GJVB 1SHGA 2FPFA 4FSSA 2CREA 4AFUC 1BBZA 3RBBB 1GCPA 4F14A 1PKSA 4J9DA 2RF0A 1AWOA 1K0SA 4AG1C 1AOJA 4ORZA 1NEBA 4F17A 2ROLA 4RTUA 3I5SA 3TVTA 2RQVA 1TG0A 1OEBA 4RTZA 2NWMA 2PZ1A 1BK2A 2EKHA 2C0OA 2XMFA 2ED0A 2DX1A 2HEQA 1M8MA 2ROTA 2PTKA 2L3SA 2RMOA 2C0IA 1MV0B 3VS1A 3RNJA 1JO8A 2FPDA 2DF6A 2LJ3A 3H0IA 3UATA 2RQUA 1WA7A 3EG2A 5IHKA 4JPBW 4CC2A 4HVWA 1NYGA 1ZSGA 5IHIA 2JS2A 2F2XA 2JM9A 1X69A 2HDAA 1AVZC 2M51A 2V1RA 2EGAA 2EPDA 1X27A 4DEXA 4J9HA 5IHNA 4GLMA 2DE0X 2LP5A 2J6OA 2YUPA 2J06A 2GBQA 1YN8A 1X6BA 1PHTA 2KNBB 5ECAA 2CUDA 1WXBA 4E6RA 2DMOA 4J9CA 3VS5A 1TUCA 4JZ4A 2G6FX 2RQTA 3VS0A 2KE9A 1M3AA 1TUDA 1E6GA 2DBMA 3EG3A 2EW3A 4JZ3A 1OOTA 1WXTA 4X1VA 1HD3A 2ENMA 5I22A 2BZXA 4AG2C 1LCKA 1WYXA 2KRNA 3SEMA 1M30A 2A08A 1NM7A 1UUEA 2KT1A 4GBQA 4OMNA 4R0KA 1AZEA 2EQIA 3IQLA 2LZ6B 3ULRB 4IIMA 2GTJA 1JU5C 1ZUYA 1JEGA 4RTYA 2YUNA 2J6KA 3H0HA 3VS4A 1W1FA 2O2OA 1ARKA 1BB9A 2X3WD 1K1ZA 5EC7A 4RUGA 3QWYA 1G83A 2CT4A 4HXJA 2NUZA 2F2VA 4ESRA 3NGPA 2KBTA 4JJDA 2DM1A 3REAB 2GGRA 2RQRA 2DNUA 1RI9A 2AZVA 2D0NA 2V1QA 1QWEA 1UECA 3SHWA 1U3OA 4IIOA 3THKA 4OMOA 1MUZA 2KROA 1T0JA 1Y57A 1GFDA 2PNIA 1FYNA 1WFWA 1JQQA 4DEYA 4EIKA 1ZUKA 4OMQA 3QWXX 3PVQA 2JTEA 5GJWB 2YUQA 1M3CA 5IH2A 1SRLA 1WDXA 1QLYA 3KFVA 2KGTA 4LE9A 2LQWA 4WCIA 1GBRA 3NMZC 1BU1A 2GNCA 2FPEA 2RNAA 4A63B 2DA9A 1SHFA 2GQIA 4J9IA 1AEYA 1KSWA 4J9FA 2EGCA 4OMPA 2H8HA 4Z88A 4M4ZA 1IO6A 3O5ZA 1WI7A 2AKLA 3FJ5A 3JV3A 2JS0A 4RTWA 1X6GA 3CQTA 2DRMA 2L0AA 2DJQA 2CH4A 4J9EA 2KXCA 3UA6A 2OJ2A 1RLQC 1ABQA 1CSKA 4HVUA 2LQNA 2LNHB 4Y92A 4AFSC 4CC3A 1KJWA 1QKXA 2MOXA 2DYBA 2CDTA 1GL5A 2DL5A 1WLPB 1OPLA 1RUWA 2K9GA 4OMMA 3M0QA 3REBB 1UJYA 4LN2A 1W70A 1NLPC 2DILA 2RQWA 4RTTA 1GCQC 3R6NA 1I1JA 2ECZA 1NEGA 1JXOA 1G2BA 2F2WA 5I11A 1UDLA 4JJBA 1UE9A 2AZSA 2SRCA 1GRIA 1N5ZA 2CSIA 3I5RA 2EYXA 3M0TA 2DL3A 2LJ1A 2HCKA 1NYFA 2X3XD 4HVVA 1UJ0A 4AFZC 2KRSA 4CC4B 4K11A 1I0CA 4QT7A 5FWBA 3PE0A 2FRWA 2MIOA 2W0ZA 1K4US 1KIKA 4F16A 2KXDA 2CUBA 1QCFA 2KR3A 1KFZA 1ZBJA 1ZLMA 1SSHA 1YP5A 2BTTA 1NLOC 5FWCA 2L3QA 2K3BA 3EGUA 2EYYA 4OMLA 1T3SA 1AZGB 2K7AA 3TSZA 2CT3A 2EVRA 4J9GA 1X43A 2HBWA 3M0PA 2O9SA 4HCKA 4RTVA 1OV3A 1GFCA 1PKTA 1Z9ZA 2CSQA 2AKKA 1UHCA 2BZYA 3EHRA 1SPKA 4JJCA 1U5SA 3A98A 2K79A 1H3HA 2YSQA 2A36A 1A0NB 1UGVA 2A37A 3M0SA 1AWXA 4Z8AA 5FW9A 1VYVA 1B3QA 2P4RA 1FMKA 2ED1A 1ZX6A 2FO0A 1YCSB 2LMJA 3VRZA 4Z89A 1JXMA 2QDLA 2D8JA 3EG1A 4LUDA 1K9AA 3U23A 2DVJA 1M27C 1Z9QA 1U06A 2VWFA 1PRLC 1SRMA 2HSPA 1AWWA 2O9VA 2VKNA 4D8KA 1B07A 1ZUUA 2E5KA 2AK5A 2JT4A 4KRTA 1VYUA 2FEIA 2DLPA 1X2QA 2J05A 2O31A 3VRYA 2CH4W 2KYBA 2BZ8A 1OPKA 2RN8A 1J3TA 1T3LA 2EYZA 4LNPA 3EHQA 1YNZA 2J6FA 3H0FA 1M3BA 1MV3A 2GTOA 4AFQC 2JXBA 1WX6A 2FG0A 5L23A 1ABOA 2D8HA 1WIEA 2J7IA 3EG0A 1RLPC 2OAWA 1PRMC 2FRYA 3LH5A 3ZL7C 2LX7A 2W10A 3NPFA 3PVLA 2KT8A 1AWJA 3TSWA 1CKBA 1VA7A 3H41A 5IXBA 4J9BA 1NG2A 1VYTA 3VS7A 1H92A 2JMAA 1GCQA 1WXUA 1EFNA 1XOVA 1I07A 1HJDA 3M0RA 1UG1A 3UA7A 2B86A 4D8DA 1E7OA 4ZNXA 2EYWA 1Y0MA 4RTXA 3GBQA 4LUEA 3I9QA 3VS3A 2DL7A 1H8KA 1UFFA 2LCSA 1UHFA 3UF4A 1PWTA 1SEMA 2EBPA 2YT6A 1GBQA 1PNJA 2C0TA 2JMCA 2D1XA 2DRKA 2YDLA 3VS2A 2ESWA 1V1CA 2MCNA 2ABLA 1T0HA 1W6XA 2RPNA 2O88A 2KRMA 2K6DA 1YWPA 1QWFA
chains in the Genus database with same CATH superfamily
4M77B 4CC7A 1WQWA 2LNVA 1FX7A 4PFPA 3CCSA 2JW4A 2LCLA 1G3SA 4C8QE 1MGQA 4J8OA 2E1HA 2A7YA 2IVWA 3TEEA 3EGDB 2M0YA 2I2LA 1JJ2A 1E6HA 4F7UG 3JSCA 3JCMJ 2RB6A 4OB0B 3L2WA 2HMAA 2LX9A 1NJIR 1D3BA 1K9MC 1VQMQ 5AYFA 2O4XB 1GCPA 4F14A 4J6YA 4J9DA 4HCCA 3CPWP 2RF0A 3QDFA 4MZPA 4M7DD 1N9SA 1NEBA 2KK4A 3I5SA 4Q5WA 4RTZA 2NWMA 5CKHA 3L2QA 2YXYA 1BK2A 1WHMA 1VQKT 3JB9G 2WACA 2DX1A 3G6ET 4PLIA 4C8QC 1PG5B 2CZ0B 1VQ5Q 3HKSA 1JBMA 2XG8D 5GAMd 4E7LA 2FPDA 2DF6A 2LJ3A 2L8DA 1VQ9Q 3VYHB 3OS5A 4M77G 4N4GA 4LD9K 4HVWA 5GMKe 3ZEHA 5IHIA 4QQ6A 3OW2A 4LDYA 2GCXA 2K57A 1WNLA 2EAYA 1RACB 1X27A 4DEXA 3E2UA 1R77A 2QXFA 2J6OA 5DLQE 2GBQA 1X6BA 1PHTA 3ME9A 3OSSC 2QQ9A 4JRIA 4RG8A 4L6V5 1JJ2S 5ECAA 1TOVA 4PJOB 1TTHB 1WXBA 1HK9A 1I8FA 5IT9E 2DMOA 1TUCA 2NYSA 1M2OA 5IAYA 4TVRA 1Q81R 3QZ9B 1TUDA 1VQ4T 1VQNQ 1NE8A 3EG3A 4M7AF 2L89A 4HT9A 4F04B 1O9SA 1X6OA 4OB2B 2KQWA 5GAN3 4AG2C 2PVGB 4FW1A 3SEMA 1NM7A 4R0KA 1K73U 3CC2A 3Q1JA 3X28B 2QG9B 1TWBA 2EKOA 2DIQA 4E7HA 2HBPA 3CCRQ 3LLRA 2F5TX 4V2SA 1U1TA 2AIRB 2YUNA 2J6KA 3G4SQ 1N27A 2O2OA 1ZA2B 2RK2A 5CVIA 2X3WD 5KYYB 2K3YA 3G71T 1G83A 3S3MA 4XTWA 3NGPA 4JJDA 2A3LA 2GGRA 4Z02A 3OW2S 3G1JA 2HAXA 2V1QA 3URGA 1UECA 1U3OA 5GAN4 4IIOA 1VQLA 4OMOA 2QQRA 2XKOC 2VB6A 3H6ZA 2PNIA 1FYNA 1K9MR 2VGNA 3HRTA 3OB9A 4PJOG 4XTUA 4EIKA 1VQMT 3MEWA 5GAOl 2YUQA 3OS0A 5LJ5e 2ZAEA 1KQSP 4OB3B 2CS7A 3HPWA 2COYA 4QVCA 3GOXA 3OS2A 4FW2A 4ZN1A 5M9OA 1AEYA 4M7DE 4RMOA 4PKCC 4JS4A 3SWNC 5D6YA 3GNGA 3M55A 2HNIA 4E7KA 1X6GA 2XDDA 2OTJT 1VQ5T 2DJQA 4J9EA 3WXMB 2KXCA 3SD4A 2OJ2A 1QW1A 1DJ7B 3OYHA 1RLQC 1YI2Q 2LC4A 2YRCA 3CPFA 1HYOA 4PNOA 4EMKB 2K9GA 1RUWA 1UGQB 2QAZA 5KYXB 4M77A 3REBB 1PC0A 3OYMA 1IB8A 1NLPC 1WJSA 4RTTA 4M7AG 4GLKA 3VYGA 2ECZA 1JXOA 3QHSA 5I11A 1ZSZB 3JRZA 4C0ZA 4KGXB 3HRUA 1UE9A 4QQDA 2RM4A 1IREB 1C0MA 2CSIA 2QGGA 3I5RA 2LQ8A 3OBWA 4C0GA 3FEOA 3CC7A 4FYYB 4JDSA 1VQNT 4HVVA 3RDVA 1Y71A 4K11A 5FWBA 3QDRB 3OW2P 2MAMA 2O4XA 5GAMh 3NFCA 5HK3A 1K4US 1PD0A 4F16A 3X25B 3M54A 2KXDA 1KFZA 2KR3A 3JCMQ 3RMSA 1VQOA 1NLOC 3EG9A 5FWCA 4QVDA 2V26A 1KQ1A 3DLLA 2EYYA 3CC2T 4YTLA 3OYGA 2K7AA 3JB9D 3G4ST 2QQBA 3CCJQ 3JCMc 3CCLQ 2DXTA 2DD4A 2HKQB 3MO8A 2HL5C 1Z9ZA 2DXUA 1H3HA 4M77D 1TUGB 3M0SA 5DY9A 3CMEA 1VQPQ 1FMKA 2DPPB 2ED1A 4C92B 2KVQG 1YCSB 3VRZA 4A54A 4A4HA 2QDLA 2D8JA 3OYAA 1QCOA 1M27C 5GANg 4PJOA 3CCUT 2YLCA 1RAIB 2VWFA 2QASA 2KMTA 2KAFA 3DB3A 4XAXB 2E3HA 2JT4A 3LGLA 2FEIA 3M57A 2FZGB 5GANe 2EWNA 2DLPA 1YHQQ 4BD3A 1QP2A 1OPKA 2EJ9A 1J3TA 4DQ2A 1PM3A 1T3LA 3EHQA 3H0FA 1YNZA 2BKDN 1R0BG 2X9HA 4L59A 1Q86C 2JXBA 5L23A 1YI2T 2DEQA 1Y7XA 4Y91A 2V8JA 3FJPA 1RLPC 2K3XA 2E4HA 1Q82C 3LH5A 3OYFA 3QPHA 4OF1A 4PK4A 3OA6A 1AWJA 1OZ3A 1CKBA 3H41A 1NG2A 1JB0E 1M1KC 5KYYA 8AT1B 2CZ1B 3QBYA 4N4IA 2JMAA 3HP9A 1GCQA 1YJNQ 1WXUA 4II1A 1EFNA 1HJDA 2QQAA 3HRSA 4D8DA 2FZCB 2ZPEB 2EFIA 4RTXA 3QJYA 2RD1A 3CCEQ 1B7TA 1ACMB 4C92G 5FU6B 2LCSA 7AT1B 3EFSA 2EBPA 2RI3A 1IGQA 3F70A 2JUFA 4F7UE 3VS2A 2ESWA 5CCAA 4PJOD 3I56Q 4IUPA 1V1CA 2MCNA 3RKYA 1QVFP 1M8VA 2ABLA 2M1HA 1SSFA 1OI1A 1M5Q1 2O88A 3OBYA 2H3EB 2E70A 1K9MU 1YWOA 4ZGEB 4XK8E 4XU3A 2AHJB 2RHIA 3BE3A 3NHNA 2DBKA 2IIMA 1KK7A 1NPRA 3A8HB 2DZ9A 2VXFA 4BE1A 3MHXA 4M75B 4XTZA 1SF9A 1WHKA 2MPXC 4NS5A 5IXFA 1CKAA 2VVKA 2H3JA 2PVDB 1K76A 1XNIA 2EQMA 2JM8A 4MMLA 1Q95G 1RAAB 5GAN2 2FPFA 4FSSA 4M77E 4EMKA 2CREA 5KYXA 3ZBDA 1N9RA 3GNFB 5GMKj 2EJFA 2RI2A 3M5AA 4XTYA 1K0SA 4AG1C 4ORZA 3RIRA 8ATCB 3G6EQ 1PCXA 1N8RU 3M56A 2GQVA 4M78F 1S72Q 1TS9A 2KY9A 2E5QA 4R56A 4HA8A 3CMAA 4DOVA 2D0QB 2L3SA 2EIFA 2C0IA 1MV0B 4J5YA 1JO8A 3H0IA 1YIJA 3EG2A 3M53A 1YHQT 5GMKi 4JPBW 4CC2A 1VIFA 4JLGA 1ZSGA 5KE3A 3MEAA 5GAMf 3GPLA 2JM9A 2HDAA 1Q86R 3EGXB 4F7UB 2M51A 2EGAA 2EPDA 4M77C 4QW2A 2DE0X 3TQ7P 3CC4A 2ZPGB 1Q82R 5FRNA 3BFMA 4M75G 1RI0A 4FYWB 2QI2A 2DEUA 4FM4B 4IKFA 3PNWC 4M7DA 2CUDA 1M1KR 3LW5E 2QEXA 3BW1A 5AT1B 3VS5A 3MJXA 1YJNT 5LJ3g 2RQTA 3VUZA 1IGUA 1M3AA 3HL8A 2EJGA 3JB9H 1W2BA 1HXDA 3DKMA 3M59A 5LJ3e 4ZTJA 1HD3A 2LT4A 5I22A 3UWNA 2XICA 3MP8A 1QVGP 2DK3A 4C92A 2KRNA 3FC3A 3JCMb 3VV0A 1M30A 2P84A 4OMNA 1ZHIA 4PJOE 3CXCA 3G71Q 3ULRB 3JCMf 2GTJA 3J80E 3OYYA 4J7IA 4RTYA 4NL3A 3CCSQ 3KUFA 2L5QA 5LJ5j 1BB9A 3X24B 1WGSA 1WHGA 1OYXA 2CT4A 4HXJA 2QTXA 2F2VA 5KYUB 1VQ6A 3CBOA 2MMPA 4ESRA 3A8OB 2PUOB 1RABB 3P8BB 1K8AU 1RI9A 1YJWA 3CCVT 2CP5A 5A0DA 1QWEA 4MZMA 3M4GA 3SHWA 4BUGA 4ANJA 3THKA 4M78G 4FSXA 4HT8A 4WTOB 2C06A 1C6VX 3SFMA 4DEYA 3CEYA 3RKXA 1M90C 4PFOA 2QGFB 1M3CA 5IH2A 2LDMA 1WDXA 3PMIA 5D6XA 2LT1A 4B6MA 5LJ5f 1QLYA 3L2UA 4LE9A 2KGTA 3NTIA 2LQWA 3SDZA 4BDZA 3VUBA 1YJ9A 4KULA 4JS5A 2RNAA 4PJOC 1SHFA 2GQIA 3OYEA 2KSSA 1ZBXA 1W2BS 2EGCA 2OTJQ 1S72T 4ZGJB 2K5FA 4Z88A 4M4ZA 1EX4A 4M7AE 5DM7R 2CGHA 2AKLA 3JV3A 4C92D 4RTWA 1V76A 1KQSS 4B9WA 4QQGA 1N8RC 2L0AA 2CH4A 1IHVA 2FYKA 1YBYA 1WJQA 3CXCS 1VQ9A 4C8QF 3QUIA 3DLMA 2B8AA 2LQNA 4AFSC 4CC3A 1KJWA 4C0FA 2XI9A 1OPLA 3M0QA 3I55T 1OX8A 3RKWA 1W70A 3HTRA 4KBMB 4OMFB 4PJLA 2QDYB 1B34A 2CP2A 1GCQC 4A4EA 4ZN3A 3M58A 3L2RA 3DB4A 2R5AA 1ZQ1A 4DBHA 2DD5A 3PGGA 4M75A 1N5ZA 2YWWA 2RK1A 3FLGA 3M9QA 3UT1A 2OAUA 3MPUB 1NYFA 2L3RA 3JCMd 1H641 1JRIA 4JRPA 4LDVA 4BB7A 2KRSA 4CC4B 3CD6T 4KGVB 4QT7A 2FRWA 1LOJA 2FB7A 1U1SA 1RAHB 1QCFA 2CUBA 3A8LB 3CC2Q 5DLOA 1YP5A 1UGSB 2BTTA 2COZA 2DTOA 5KYNA 4R55A 2L3QA 5FU7C 2VYTA 1VQ7A 3EGUA 3CCRA 4XU0A 2X4XA 1T3SA 3CCST 1AZGB 2DETA 4J9GA 5FRMA 1MMGA 1AT1B 4HCKA 2F5KA 1OV3A 4M7AB 1PKTA 2CSQA 1M2VB 1R8OB 1SPKA 1W2BP 5LJ5d 1VQLQ 1UGVA 2A37A 5GANj 1AWXA 3EGXA 2JJ9A 4ME7A 4EMKC 4F7UA 1VYVA 1NBEB 4PJMA 1ZX6A 3LH0A 3CCUQ 4Z89A 1K8AC 3CXCP 1M90R 4CI0C 4O6JA 4M75D 3L2ZA 4LUDA 1K9AA 5C6SA 5GAN7 1Q86U 2WSCE 1ZSZC 2K4YA 4GY5A 1U06A 3VU3C 4A4GA 2CP6A 3H9NA 3OS1A 2BE9B 2VASA 1B07A 4D8KA 2AK5A 4KRTA 3QYHB 1VYUA 1Q82U 4E7ZA 3CCMA 3OY9A 3LWHA 1X2QA 2O31A 4LDWA 3CCQA 1M1KU 2E6NA 2AT1B 3EFRA 4Y28E 1N8RR 4C92E 1OQKA 2EYZA 5GAOp 1O75A 2LVMA 1QVFA 2DVEA 2GTOA 1VOMA 1WX6A 2D8HA 1UB4A 5A0LA 2EQJA 2YRDA 3MP1A 2EYQA 3P8HA 2Y90A 2OAWA 2VXEA 4E7SA 3ZL7C 2LX7A 3CBPA 1KHCA 2E10A 2YHTA 1XTDA 3D7SB 3ZFJA 1PSEA 1VA7A 3TREA 5GAOm 5IXBA 5GMKl 4J9BA 4ELZC 1VYTA 3VS7A 4M7DC 1XOVA 1I07A 3EGDA 3M0RA 4B9XA 1F1BB 2B86A 2OTLA 1E7OA 1KG1A 1NZ9A 1Y0MA 3VKIA 2MYSA 3GBQA 5CKEA 4LUEA 1LPLA 3I9QA 2DL7A 1H8KA 1Y96B 2RJEA 3UF4A 2YRVA 1PWTA 3SWNB 2CZ6B 3UPUA 3CC7Q 1WHJA 1G5VA 2JMCA 1BCOA 2D1XA 4C92C 3AHUA 2HQHA 5HK0A 1BKBA 1T0HA 1NPPA 2E64A 3MCAB 3QXEB 1VQOQ 1YWPA 1QWFA 1BI3A 4FCYA 2KDSA 3QJ6A 5HCKA 2MI6A 3QIIA 2KYMA 2HKNA 2KEAA 1X2KA 2EGEA 2K2MA 4RCCA 3M0UA 1QVFS 2K5LA 2OI3A 3VS6A 5GMKm 1HSQA 5J3BA 1U8RA 2X4YA 2L3PA 1GXIE 2OX7A 1SHGA 2ZPHB 1VQLT 4FU6A 3CMEQ 4DBQA 1BBZA 3RBBB 2IPOB 4MZTA 1PD1A 1PKSA 2HL3A 2JNGA 3JCMh 1VQPA 2D9TA 2DTIA 1AOJA 4ZTFA 1WHLA 1TH7A 1K8AR 3TVTA 1WHHA 4XQ3A 2RQVA 3RMQA 1Y07A 1OX9A 2PZ1A 1VQ8A 4M75E 2R57A 3OYJA 1N6AA 2ED0A 3G7ZA 5FU6C 1PSFA 2ROTA 5KYWB 5CIUA 3VS1A 3RNJA 3KXTA 3UATA 2RQUA 1WA7A 2FHDA 1YITA 1QVGA 1NYGA 2E12A 1W4SA 3WVDB 2RA2A 4BE0A 5LJ5h 2YLBA 2V1RA 5LJ3j 4LDXA 1FMWA 4J9HA 4GLMA 2YUPA 1UGRB 2CP7A 2J06A 5GAN8 2CP0A 3FDRA 1FXXA 2RHYA 1M1GA 2CZ7B 2KNBB 4HCZA 4E6RA 3T9NA 4J9CA 4M7AA 4JZ4A 2G6FX 4J6WA 4M75C 3JCMV 1AHJB 3V7SA 3S3OA 3VS0A 4CRIA 4IUQA 1MMAA 4NL2A 5J39A 3CCEA 4JZ3A 1OOTA 3VJPA 4C0DB 3H8ZA 5IN1A 4X1VA 2LRQA 5LJ3f 2ENMA 4HCBA 1FWZA 3CC7T 2BZXA 4BE2A 1LCKA 2X35A 2LTOA 4M78E 3EFOB 2A08A 2KT1A 3I56A 3X20B 2EQIA 3GLXA 2LZ6B 4IIMA 1YCYA 1JU5C 2ZPIB 1ZUYA 2DFUA 3P8DA 4IUUA 1VQOT 1KD1U 1JEGA 1W1FA 1BI1A 1C1AA 1ARKA 5A2QE 1I81A 1K1ZA 1SG5A 3OYIA 5EC7A 3CCVQ 1M90U 2K2VA 4RUGA 1QVGS 2PUKB 4J7FA 3FIFA 2NUZA 3S3NA 4X34A 2DM1A 2RQRA 2DNUA 4EPCA 3SB2A 3E9FA 2X51A 1MUZA 3RR6A 2VC8A 1T0JA 1Y57A 1G3TA 1GFDA 1UGPB 2E65A 3V8LA 4OGEA 2NUTB 1IXDA 5J26A 1ZUKA 2JTEA 3CMET 4M7AD 1SRLA 3BY7A 2XK0A 5KCOA 4WCIA 5KE2A 1GBRA 1BU1A 1ZSZA 2HQXA 2GNCA 2DXCA 2FPEA 1VQKA 3E9GA 1KSWA 4J9FA 3G6EA 1IHWA 2QA4A 4OMPA 5CKDA 3A8GB 2GF7A 3CMAQ 1WI7A 2F1LA 3R6OA 4BY6C 4KT0E 5CQYA 3NTKA 5I2SA 1BI2A 3CQTA 5FROA 2DRMA 1YIJQ 3PIPA 1ABQA 1CSKA 3QSUA 3I55Q 2Z0WA 5D6WA 2LCCA 2DYBA 2PVOB 2CDTA 3C94A 1KQ2A 2DL5A 2F69A 4M78B 4OMMA 2GFAA 3GF5A 3CC4Q 2RQWA 3QKJA 3X26B 4EMHA 3JB9J 5LJ3d 1I1JA 4M77F 1NEGA 1WQ7A 1G2BA 2QEXQ 3OYDA 1VQ4A 2VGMA 3CD6Q 4JJNK 1GRIA 2EYXA 3C95A 3A1PA 2DL3A 2LJ1A 2GFUA 2M9UA 2HCKA 4KH0B 1UJ0A 3PE0A 3EAEA 6AT1B 2W0ZA 5GAOn 1KIKA 1Q7YU 4O5VA 4VUBA 2ATCB 1SSHA 2BUDA 3OYLA 4KUDK 3G71A 1LNXA 4EMGA 5C0MA 4OMLA 3FB9A 1MNDA 3QYGB 4KUIA 3TSZA 2CT3A 2EVRA 1X43A 3TCJA 3INZA 5KYWA 2HBWA 3M0PA 3HFNA 4RTVA 1GFCA 1VQ6Q 4ZGDB 4A4KA 2AKKA 3EHRA 4LD6A 1U5SA 3A98A 3PTAA 5CKFA 2K79A 1YJWQ 3ER0A 4JLIA 3WVEB 1KD1C 4FYXB 2HSEB 1G8XA 1SKUB 2VUBA 3M4YA 1VQMA 2M16A 5FW9A 1B3QA 2P4RA 5A0GA 4MDXA 2QYZA 2FO0A 2LMJA 3A5ZB 2R5MA 4N0AA 2CYZB 3EG1A 1YJ9Q 2DVJA 1Z9QA 2P0KA 1PRLC 2HSPA 2XD0A 4RG2A 1AWWA 2VKNA 3EG9B 3S6WA 2E5KA 3TU4K 2JTFA 2Y4YA 1BIAA 2OTJA 1VQ5A 4PJOF 3CMAT 1P92A 1G3YA 4KH1B 2QA4T 2ZZDA 4PJNA 1WPYA 5GAMg 1YIJT 3HFOA 3OSVA 4LNPA 4XTVA 3LYIA 2JOYA 4DBRA 3EFOA 2IG0A 2XU8A 5GAMe 2FRYA 2O01E 2VV5A 3NPFA 4RCBA 3CC4T 2KI7A 2CP3A 4ATOA 2DXBA 4XU2A 1RL2A 4M7AC 1UG1A 3UA7A 1M9SA 2EYWA 1EZZB 2QEXT 3QG1A 3V7CA 1BIBA 1UFFA 1VQNA 4C8QB 2EQKA 1G3WA 1UHFA 1SEMA 2YT6A 2JTMA 1GBQA 3HHTB 2X4WA 2RJFA 4OGCA 1PNJA 3JCMW 2C0TA 3A8MB 3BDLA 4FIBA 4E7JA 2YDLA 2NUTA 4DOWA 3JCMg 1W6XA 2RPNA 1VIEA 2KRMA 1D1CA 2YUOA 1MMDA 2COWA 4XU1A 4X9CA 2I0NA 2SEMA 3OYKA 3G4SA 1D0YA 2L2PA 2LJ0A 3JCMe 1VQ7Q 3QO3A 2DL4A 1S1NA 4FL6A 1QKWA 1AD5A 1Q7YC 1K0XA 1D09B 3NTHA 2A28A 1QVPA 3I35A 3C0CA 1VQ6T 2RHUA 1MNEA 1VUBA 5LJ3h 3MEVA 5L8RE 1IZ6A 1UTIA 1YJWT 1KD1R 2DL8A 3MKDA 4BI8B 5GJVB 4AMCA 4C5IA 2HZYA 2XDPA 3OQ5A 2ZPBB 9ATCB 2E41A 5LJ5g 4WF2A 4AFUC 1V29B 2V8IA 4JUVA 4M78A 3EH2A 3KBGA 4OVAA 4JRKA 1AWOA 4DBFA 3PMTA 4F17A 4RTUA 3CCUA 3OYBA 1TG0A 5D7UA 4C8QG 1OEBA 3BDUA 5HY6A 4E2FB 1I5OB 1YJ9T 2EKHA 4XTXA 4D6WA 2C0OA 2E3IA 2XMFA 3OMCA 5GANf 2HEQA 4NOYA 1M8MA 2PTKA 2RMOA 5FU7B 3CCMQ 3L1AA 1BYMA 3CCQQ 3META 1LVKA 1OU9A 1TXQA 5IHKA 1QQJA 5CO7A 1I5LA 1YI2A 4IUTA 1JJ2P 4UC4A 2D6FA 1QMCA 1H3ZA 3JAME 2JS2A 2F2XA 4IUVA 1VQ9T 3OMGA 1X69A 2DTHA 4LXCA 3OYCA 3EH1A 1AVZC 2BE7D 4ELYC 2MF2A 2BIVA 4RKUE 5IHNA 2FZKB 2LP5A 3J81E 5HKCA 1YN8A 1KC8U 2G3RA 5KYUA 2DIGA 4QKUA 5GAOr 3LGFA 4FT2A 2OTLQ 2JZ2A 4OB1B 2X4JA 2DZCA 2ZCFB 1R0CB 5GMKh 2KE9A 4M7DF 4M78D 2M02A 1E6GA 2DBMA 3FRNA 2EW3A 1WXTA 3N5BB 3UDCA 3HSBA 1IRXA 2DERA 1WYXA 1D0XA 4QVZA 4IURA 2ZGWA 4GBQA 1UUEA 1AZEA 2QK0A 3IQLA 4MMKA 4C92F 2QQSA 5I21A 3H0HA 3VS4A 3ASKA 1NJIU 2HD0A 2DJZA 3CCJA 1VQ7T 3CCRT 3CCLA 3QWYA 2KBTA 1D0ZA 5GAN5 1Q7YR 3PT9A 4M7DB 3REAB 1K73C 2AZVA 2D0NA 3PIOA 3V7RA 5CR2A 4PLLA 1YFNA 2P0PA 4A4FA 4AT1B 2KROA 1QCNA 1OU8A 2NUPB 1WFWA 3L2VA 1JQQA 4OMQA 3RUXA 3QWXX 3PVQA 5GANd 5GJWB 2PQWA 4FT4A 4PL6A 4N0AC 3KFVA 1D1AA 4J83A 5EG2A 3NMZC 2XIDA 4C5GA 3PFSA 4OP0A 4A63B 2DA9A 2V8KA 4J9IA 4BACA 1XQHA 4A53A 2H8HA 1VQ8Q 1IO6A 1MHNA 2A0FB 3O5ZA 3FJ5A 1X01A 2JS0A 4C8QA 4C0DC 1YHQA 2WSFE 2FVUA 3CCMT 5I2MA 3MP6A 1YITQ 3UA6A 3CCQT 4HVUA 3JB9I 1M4ZA 3O8VA 2LNHB 2RJDA 4Y92A 1D3BB 1QKXA 2MOXA 2LQKA 1GL5A 1KHIA 1WLPB 1WZOA 1Q81U 3RERA 4M7DG 1UJYA 4LN2A 2DILA 2M0OA 3CBMA 4BDYA 1RAFB 3R6NA 1YJNA 1WJRA 1M2VA 4N4HA 3AT1B 2F2WA 1UDLA 4JJBA 4BI4A 2AZSA 2SRCA 2OTLT 3M0TA 1KC8C 2EQUA 5CK9A 4JRQA 3C12A 2X3XD 1D1BA 4PFZA 2RJCA 4AFZC 4X9DA 4M75F 1X75C 1QP3A 1I0CA 4E7IA 3LWIA 2RO0A 3V8KA 2MIOA 3MEUA 2CKKA 4P5NA 2P4TA 5GAN6 4C5EA 1ZBJA 1ZA1B 3CPWA 1ZLMA 1RAGB 4L5GA 4C8QD 2K3BA 2XDBA 3V8JA 1RAEB 3GIBA 1UEBA 1B34B 2O9SA 3E19A 1LJOA 3CCVA 2BZYA 1UHCA 4BI3A 4JJCA 2PU9B 4J6XA 4C5HA 3CCJT 3CCLT 1XJWB 1K73R 2YSQA 2A36A 1NJIC 2JN0A 1A0NB 4Z8AA 2MWOA 2HQEA 3QZ5B 3LX7A 1OZ2A 2FL7A 1EIFA 2QTVA 4M78C 4DA4A 3JCMP 3JCMX 2JVVA 5GAOq 1JXMA 4F7UF 5FLXE 1VQPT 3U23A 1S72A 5GAMj 1VQKQ 5CQXA 1TSFA 1BI0A 1SRMA 2O9VA 1Y96A 2QA4Q 4HKEA 2MWPA 3E1SA 1ZUUA 3SWNA 1BCMA 1I4K1 4E47A 1TU0B 1VQ8T 2J05A 3VRYA 2CH4W 2KYBA 2BZ8A 2RN8A 2MK5A 5CAIA 3CPWS 5KH6A 2J6FA 3RESA 1M3BA 1YITT 1MV3A 4AFQC 2RI5A 2FG0A 3JB9F 1ABOA 1WIEA 2DAQA 2J7IA 3EG0A 3I55A 2E6ZA 1OULA 1PRMC 1MMNA 2W10A 2R58A 3PVLA 3L42A 2KT8A 4FYVB 3TSWA 2NLUA 2ZPFB 1M1FA 3OYNA 1H92A 5GANh 2DYIA 2DO3A 5KCHA 4MDWA 4ZNXA 1Q81C 1VQ4Q 2P0QA 5CKBA 3VS3A 2RH2A 5LL6S 3CD6A 4LDUA 4KGZB 1KC8R 3GP8A 4BY6B 2K5IA 3CCET 2NUPA 2DRKA 2WSEE 1FMVA 2XHCA 2RHZA 4PJJA 2DKGA 3J7AF 3C4SA 2Y4XA 4EDUA 2RHXA 1KQSA 2K6DA 2ROLA 3I56T 1RADB
chains in the Genus database with same CATH topology
2YUOA 4CC7A 2I0NA 5HCKA 2SEMA 1YWOA 2L2PA 2LJ0A 2KYMA 2JW4A 2DL4A 1S1NA 2KEAA 1QKWA 1X2KA 2EGEA 2DBKA 1AD5A 3NHNA 1K0XA 2IIMA 2K2MA 3M0UA 2A28A 3I35A 3C0CA 2OI3A 3VS6A 2M0YA 5IXFA 1E6HA 1CKAA 1HSQA 1UTIA 2VVKA 2L3PA 1K76A 2DL8A 2JM8A 5GJVB 1SHGA 2FPFA 4FSSA 2CREA 4AFUC 1BBZA 3RBBB 1GCPA 4F14A 1PKSA 4J9DA 2RF0A 1AWOA 1K0SA 4AG1C 1AOJA 4ORZA 1NEBA 4F17A 2ROLA 4RTUA 3I5SA 3TVTA 2RQVA 1TG0A 1OEBA 4RTZA 2NWMA 2PZ1A 1BK2A 2EKHA 2C0OA 2XMFA 2ED0A 2DX1A 2HEQA 1M8MA 2ROTA 2PTKA 2L3SA 2RMOA 2C0IA 1MV0B 3VS1A 3RNJA 1JO8A 2FPDA 2DF6A 2LJ3A 3H0IA 3UATA 2RQUA 1WA7A 3EG2A 5IHKA 4JPBW 4CC2A 4HVWA 1NYGA 1ZSGA 5IHIA 2JS2A 2F2XA 2JM9A 1X69A 2HDAA 1AVZC 2M51A 2V1RA 2EGAA 2EPDA 1X27A 4DEXA 4J9HA 5IHNA 4GLMA 2DE0X 2LP5A 2J6OA 2YUPA 2J06A 2GBQA 1YN8A 1X6BA 1PHTA 2KNBB 5ECAA 2CUDA 1WXBA 4E6RA 2DMOA 4J9CA 3VS5A 1TUCA 4JZ4A 2G6FX 2RQTA 3VS0A 2KE9A 1M3AA 1TUDA 1E6GA 2DBMA 3EG3A 2EW3A 4JZ3A 1OOTA 1WXTA 4X1VA 1HD3A 2ENMA 5I22A 2BZXA 4AG2C 1LCKA 1WYXA 2KRNA 3SEMA 1M30A 2A08A 1NM7A 1UUEA 2KT1A 4GBQA 4OMNA 4R0KA 1AZEA 2EQIA 3IQLA 2LZ6B 3ULRB 4IIMA 2GTJA 1JU5C 1ZUYA 1JEGA 4RTYA 2YUNA 2J6KA 3H0HA 3VS4A 1W1FA 2O2OA 1ARKA 1BB9A 2X3WD 1K1ZA 5EC7A 4RUGA 3QWYA 1G83A 2CT4A 4HXJA 2NUZA 2F2VA 4ESRA 3NGPA 2KBTA 4JJDA 2DM1A 3REAB 2GGRA 2RQRA 2DNUA 1RI9A 2AZVA 2D0NA 2V1QA 1QWEA 1UECA 3SHWA 1U3OA 4IIOA 3THKA 4OMOA 1MUZA 2KROA 1T0JA 1Y57A 1GFDA 2PNIA 1FYNA 1WFWA 1JQQA 4DEYA 4EIKA 1ZUKA 4OMQA 3QWXX 3PVQA 2JTEA 5GJWB 2YUQA 1M3CA 5IH2A 1SRLA 1WDXA 1QLYA 3KFVA 2KGTA 4LE9A 2LQWA 4WCIA 1GBRA 3NMZC 1BU1A 2GNCA 2FPEA 2RNAA 4A63B 2DA9A 1SHFA 2GQIA 4J9IA 1AEYA 1KSWA 4J9FA 2EGCA 4OMPA 2H8HA 4Z88A 4M4ZA 1IO6A 3O5ZA 1WI7A 2AKLA 3FJ5A 3JV3A 2JS0A 4RTWA 1X6GA 3CQTA 2DRMA 2L0AA 2DJQA 2CH4A 4J9EA 2KXCA 3UA6A 2OJ2A 1RLQC 1ABQA 1CSKA 4HVUA 2LQNA 2LNHB 4Y92A 4AFSC 4CC3A 1KJWA 1QKXA 2MOXA 2DYBA 2CDTA 1GL5A 2DL5A 1WLPB 1OPLA 1RUWA 2K9GA 4OMMA 3M0QA 3REBB 1UJYA 4LN2A 1W70A 1NLPC 2DILA 2RQWA 4RTTA 1GCQC 3R6NA 1I1JA 2ECZA 1NEGA 1JXOA 1G2BA 2F2WA 5I11A 1UDLA 4JJBA 1UE9A 2AZSA 2SRCA 1GRIA 1N5ZA 2CSIA 3I5RA 2EYXA 3M0TA 2DL3A 2LJ1A 2HCKA 1NYFA 2X3XD 4HVVA 1UJ0A 4AFZC 2KRSA 4CC4B 4K11A 1I0CA 4QT7A 5FWBA 3PE0A 2FRWA 2MIOA 2W0ZA 1K4US 1KIKA 4F16A 2KXDA 2CUBA 1QCFA 2KR3A 1KFZA 1ZBJA 1ZLMA 1SSHA 1YP5A 2BTTA 1NLOC 5FWCA 2L3QA 2K3BA 3EGUA 2EYYA 4OMLA 1T3SA 1AZGB 2K7AA 3TSZA 2CT3A 2EVRA 4J9GA 1X43A 2HBWA 3M0PA 2O9SA 4HCKA 4RTVA 1OV3A 1GFCA 1PKTA 1Z9ZA 2CSQA 2AKKA 1UHCA 2BZYA 3EHRA 1SPKA 4JJCA 1U5SA 3A98A 2K79A 1H3HA 2YSQA 2A36A 1A0NB 1UGVA 2A37A 3M0SA 1AWXA 4Z8AA 5FW9A 1VYVA 1B3QA 2P4RA 1FMKA 2ED1A 1ZX6A 2FO0A 1YCSB 2LMJA 3VRZA 4Z89A 1JXMA 2QDLA 2D8JA 3EG1A 4LUDA 1K9AA 3U23A 2DVJA 1M27C 1Z9QA 1U06A 2VWFA 1PRLC 1SRMA 2HSPA 1AWWA 2O9VA 2VKNA 4D8KA 1B07A 1ZUUA 2E5KA 2AK5A 2JT4A 4KRTA 1VYUA 2FEIA 2DLPA 1X2QA 2J05A 2O31A 3VRYA 2CH4W 2KYBA 2BZ8A 1OPKA 2RN8A 1J3TA 1T3LA 2EYZA 4LNPA 3EHQA 1YNZA 2J6FA 3H0FA 1M3BA 1MV3A 2GTOA 4AFQC 2JXBA 1WX6A 2FG0A 5L23A 1ABOA 2D8HA 1WIEA 2J7IA 3EG0A 1RLPC 2OAWA 1PRMC 2FRYA 3LH5A 3ZL7C 2LX7A 2W10A 3NPFA 3PVLA 2KT8A 1AWJA 3TSWA 1CKBA 1VA7A 3H41A 5IXBA 4J9BA 1NG2A 1VYTA 3VS7A 1H92A 2JMAA 1GCQA 1WXUA 1EFNA 1XOVA 1I07A 1HJDA 3M0RA 1UG1A 3UA7A 2B86A 4D8DA 1E7OA 4ZNXA 2EYWA 1Y0MA 4RTXA 3GBQA 4LUEA 3I9QA 3VS3A 2DL7A 1H8KA 1UFFA 2LCSA 1UHFA 3UF4A 1PWTA 1SEMA 2EBPA 2YT6A 1GBQA 1PNJA 2C0TA 2JMCA 2D1XA 2DRKA 2YDLA 3VS2A 2ESWA 1V1CA 2MCNA 2ABLA 1T0HA 1W6XA 2RPNA 2O88A 2KRMA 2K6DA 1YWPA 1QWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUO A;  4CC7 A;  2I0N A;  5HCK A;  2SEM A;  1YWO A;  2L2P A;  2LJ0 A;  2KYM A;  2JW4 A;  2DL4 A;  1S1N A;  2KEA A;  1QKW A;  1X2K A;  2EGE A;  2DBK A;  1AD5 A;  3NHN A;  1K0X A;  2IIM A;  2K2M A;  3M0U A;  2A28 A;  3I35 A;  3C0C A;  2OI3 A;  3VS6 A;  2M0Y A;  5IXF A;  1E6H A;  1CKA A;  1HSQ A;  1UTI A;  2VVK A;  2L3P A;  1K76 A;  2DL8 A;  2JM8 A;  5GJV B;  1SHG A;  2FPF A;  4FSS A;  2CRE A;  4AFU C;  1BBZ A;  3RBB B;  1GCP A;  4F14 A;  1PKS A;  4J9D A;  2RF0 A;  1AWO A;  1K0S A;  4AG1 C;  1AOJ A;  4ORZ A;  1NEB A;  4F17 A;  2ROL A;  4RTU A;  3I5S A;  3TVT A;  2RQV A;  1TG0 A;  1OEB A;  4RTZ A;  2NWM A;  2PZ1 A;  1BK2 A;  2EKH A;  2C0O A;  2XMF A;  2ED0 A;  2DX1 A;  2HEQ A;  1M8M A;  2ROT A;  2PTK A;  2L3S A;  2RMO A;  2C0I A;  1MV0 B;  3VS1 A;  3RNJ A;  1JO8 A;  2FPD A;  2DF6 A;  2LJ3 A;  3H0I A;  3UAT A;  2RQU A;  1WA7 A;  3EG2 A;  5IHK A;  4JPB W;  4CC2 A;  4HVW A;  1NYG A;  1ZSG A;  5IHI A;  2JS2 A;  2F2X A;  2JM9 A;  1X69 A;  2HDA A;  1AVZ C;  2M51 A;  2V1R A;  2EGA A;  2EPD A;  1X27 A;  4DEX A;  4J9H A;  5IHN A;  4GLM A;  2DE0 X;  2LP5 A;  2J6O A;  2YUP A;  2J06 A;  2GBQ A;  1YN8 A;  1X6B A;  1PHT A;  2KNB B;  5ECA A;  2CUD A;  1WXB A;  4E6R A;  2DMO A;  4J9C A;  3VS5 A;  1TUC A;  4JZ4 A;  2G6F X;  2RQT A;  3VS0 A;  2KE9 A;  1M3A A;  1TUD A;  1E6G A;  2DBM A;  3EG3 A;  2EW3 A;  4JZ3 A;  1OOT A;  1WXT A;  4X1V A;  1HD3 A;  2ENM A;  5I22 A;  2BZX A;  4AG2 C;  1LCK A;  1WYX A;  2KRN A;  3SEM A;  1M30 A;  2A08 A;  1NM7 A;  1UUE A;  2KT1 A;  4GBQ A;  4OMN A;  4R0K A;  1AZE A;  2EQI A;  3IQL A;  2LZ6 B;  3ULR B;  4IIM A;  2GTJ A;  1JU5 C;  1ZUY A;  1JEG A;  4RTY A;  2YUN A;  2J6K A;  3H0H A;  3VS4 A;  1W1F A;  2O2O A;  1ARK A;  1BB9 A;  2X3W D;  1K1Z A;  5EC7 A;  4RUG A;  3QWY A;  1G83 A;  2CT4 A;  4HXJ A;  2NUZ A;  2F2V A;  4ESR A;  3NGP A;  2KBT A;  4JJD A;  2DM1 A;  3REA B;  2GGR A;  2RQR A;  2DNU A;  1RI9 A;  2AZV A;  2D0N A;  2V1Q A;  1QWE A;  1UEC A;  3SHW A;  1U3O A;  4IIO A;  3THK A;  4OMO A;  1MUZ A;  2KRO A;  1T0J A;  1Y57 A;  1GFD A;  2PNI A;  1FYN A;  1WFW A;  1JQQ A;  4DEY A;  4EIK A;  1ZUK A;  4OMQ A;  3QWX X;  3PVQ A;  2JTE A;  5GJW B;  2YUQ A;  1M3C A;  5IH2 A;  1SRL A;  1WDX A;  1QLY A;  3KFV A;  2KGT A;  4LE9 A;  2LQW A;  4WCI A;  1GBR A;  3NMZ C;  1BU1 A;  2GNC A;  2FPE A;  2RNA A;  4A63 B;  2DA9 A;  1SHF A;  2GQI A;  4J9I A;  1AEY A;  1KSW A;  4J9F A;  2EGC A;  4OMP A;  2H8H A;  4Z88 A;  4M4Z A;  1IO6 A;  3O5Z A;  1WI7 A;  2AKL A;  3FJ5 A;  3JV3 A;  2JS0 A;  4RTW A;  1X6G A;  3CQT A;  2DRM A;  2L0A A;  2DJQ A;  2CH4 A;  4J9E A;  2KXC A;  3UA6 A;  2OJ2 A;  1RLQ C;  1ABQ A;  1CSK A;  4HVU A;  2LQN A;  2LNH B;  4Y92 A;  4AFS C;  4CC3 A;  1KJW A;  1QKX A;  2MOX A;  2DYB A;  2CDT A;  1GL5 A;  2DL5 A;  1WLP B;  1OPL A;  1RUW A;  2K9G A;  4OMM A;  3M0Q A;  3REB B;  1UJY A;  4LN2 A;  1W70 A;  1NLP C;  2DIL A;  2RQW A;  4RTT A;  1GCQ C;  3R6N A;  1I1J A;  2ECZ A;  1NEG A;  1JXO A;  1G2B A;  2F2W A;  5I11 A;  1UDL A;  4JJB A;  1UE9 A;  2AZS A;  2SRC A;  1GRI A;  1N5Z A;  2CSI A;  3I5R A;  2EYX A;  3M0T A;  2DL3 A;  2LJ1 A;  2HCK A;  1NYF A;  2X3X D;  4HVV A;  1UJ0 A;  4AFZ C;  2KRS A;  4CC4 B;  4K11 A;  1I0C A;  4QT7 A;  5FWB A;  3PE0 A;  2FRW A;  2MIO A;  2W0Z A;  1K4U S;  1KIK A;  4F16 A;  2KXD A;  2CUB A;  1QCF A;  2KR3 A;  1KFZ A;  1ZBJ A;  1ZLM A;  1SSH A;  1YP5 A;  2BTT A;  1NLO C;  5FWC A;  2L3Q A;  2K3B A;  3EGU A;  2EYY A;  4OML A;  1T3S A;  1AZG B;  2K7A A;  3TSZ A;  2CT3 A;  2EVR A;  4J9G A;  1X43 A;  2HBW A;  3M0P A;  2O9S A;  4HCK A;  4RTV A;  1OV3 A;  1GFC A;  1PKT A;  1Z9Z A;  2CSQ A;  2AKK A;  1UHC A;  2BZY A;  3EHR A;  1SPK A;  4JJC A;  1U5S A;  3A98 A;  2K79 A;  1H3H A;  2YSQ A;  2A36 A;  1A0N B;  1UGV A;  2A37 A;  3M0S A;  1AWX A;  4Z8A A;  5FW9 A;  1VYV A;  1B3Q A;  2P4R A;  1FMK A;  2ED1 A;  1ZX6 A;  2FO0 A;  1YCS B;  2LMJ A;  3VRZ A;  4Z89 A;  1JXM A;  2QDL A;  2D8J A;  3EG1 A;  4LUD A;  1K9A A;  3U23 A;  2DVJ A;  1M27 C;  1Z9Q A;  1U06 A;  2VWF A;  1PRL C;  1SRM A;  2HSP A;  1AWW A;  2O9V A;  2VKN A;  4D8K A;  1B07 A;  1ZUU A;  2E5K A;  2AK5 A;  2JT4 A;  4KRT A;  1VYU A;  2FEI A;  2DLP A;  1X2Q A;  2J05 A;  2O31 A;  3VRY A;  2CH4 W;  2KYB A;  2BZ8 A;  1OPK A;  2RN8 A;  1J3T A;  1T3L A;  2EYZ A;  4LNP A;  3EHQ A;  1YNZ A;  2J6F A;  3H0F A;  1M3B A;  1MV3 A;  2GTO A;  4AFQ C;  2JXB A;  1WX6 A;  2FG0 A;  5L23 A;  1ABO A;  2D8H A;  1WIE A;  2J7I A;  3EG0 A;  1RLP C;  2OAW A;  1PRM C;  2FRY A;  3LH5 A;  3ZL7 C;  2LX7 A;  2W10 A;  3NPF A;  3PVL A;  2KT8 A;  1AWJ A;  3TSW A;  1CKB A;  1VA7 A;  3H41 A;  5IXB A;  4J9B A;  1NG2 A;  1VYT A;  3VS7 A;  1H92 A;  2JMA A;  1GCQ A;  1WXU A;  1EFN A;  1XOV A;  1I07 A;  1HJD A;  3M0R A;  1UG1 A;  3UA7 A;  2B86 A;  4D8D A;  1E7O A;  4ZNX A;  2EYW A;  1Y0M A;  4RTX A;  3GBQ A;  4LUE A;  3I9Q A;  3VS3 A;  2DL7 A;  1H8K A;  1UFF A;  2LCS A;  1UHF A;  3UF4 A;  1PWT A;  1SEM A;  2EBP A;  2YT6 A;  1GBQ A;  1PNJ A;  2C0T A;  2JMC A;  2D1X A;  2DRK A;  2YDL A;  3VS2 A;  2ESW A;  1V1C A;  2MCN A;  2ABL A;  1T0H A;  1W6X A;  2RPN A;  2O88 A;  2KRM A;  2K6D A;  1YWP A;  1QWF A; 
#chains in the Genus database with same CATH topology
 4M77 B;  4CC7 A;  1WQW A;  2LNV A;  1FX7 A;  4PFP A;  3CCS A;  2JW4 A;  2LCL A;  1G3S A;  4C8Q E;  1MGQ A;  4J8O A;  2E1H A;  2A7Y A;  2IVW A;  3TEE A;  3EGD B;  2M0Y A;  2I2L A;  1JJ2 A;  1E6H A;  4F7U G;  3JSC A;  3JCM J;  2RB6 A;  4OB0 B;  3L2W A;  2HMA A;  2LX9 A;  1NJI R;  1D3B A;  1K9M C;  1VQM Q;  5AYF A;  2O4X B;  1GCP A;  4F14 A;  4J6Y A;  4J9D A;  4HCC A;  3CPW P;  2RF0 A;  3QDF A;  4MZP A;  4M7D D;  1N9S A;  1NEB A;  2KK4 A;  3I5S A;  4Q5W A;  4RTZ A;  2NWM A;  5CKH A;  3L2Q A;  2YXY A;  1BK2 A;  1WHM A;  1VQK T;  3JB9 G;  2WAC A;  2DX1 A;  3G6E T;  4PLI A;  4C8Q C;  1PG5 B;  2CZ0 B;  1VQ5 Q;  3HKS A;  1JBM A;  2XG8 D;  5GAM d;  4E7L A;  2FPD A;  2DF6 A;  2LJ3 A;  2L8D A;  1VQ9 Q;  3VYH B;  3OS5 A;  4M77 G;  4N4G A;  4LD9 K;  4HVW A;  5GMK e;  3ZEH A;  5IHI A;  4QQ6 A;  3OW2 A;  4LDY A;  2GCX A;  2K57 A;  1WNL A;  2EAY A;  1RAC B;  1X27 A;  4DEX A;  3E2U A;  1R77 A;  2QXF A;  2J6O A;  5DLQ E;  2GBQ A;  1X6B A;  1PHT A;  3ME9 A;  3OSS C;  2QQ9 A;  4JRI A;  4RG8 A;  4L6V 5;  1JJ2 S;  5ECA A;  1TOV A;  4PJO B;  1TTH B;  1WXB A;  1HK9 A;  1I8F A;  5IT9 E;  2DMO A;  1TUC A;  2NYS A;  1M2O A;  5IAY A;  4TVR A;  1Q81 R;  3QZ9 B;  1TUD A;  1VQ4 T;  1VQN Q;  1NE8 A;  3EG3 A;  4M7A F;  2L89 A;  4HT9 A;  4F04 B;  1O9S A;  1X6O A;  4OB2 B;  2KQW A;  5GAN 3;  4AG2 C;  2PVG B;  4FW1 A;  3SEM A;  1NM7 A;  4R0K A;  1K73 U;  3CC2 A;  3Q1J A;  3X28 B;  2QG9 B;  1TWB A;  2EKO A;  2DIQ A;  4E7H A;  2HBP A;  3CCR Q;  3LLR A;  2F5T X;  4V2S A;  1U1T A;  2AIR B;  2YUN A;  2J6K A;  3G4S Q;  1N27 A;  2O2O A;  1ZA2 B;  2RK2 A;  5CVI A;  2X3W D;  5KYY B;  2K3Y A;  3G71 T;  1G83 A;  3S3M A;  4XTW A;  3NGP A;  4JJD A;  2A3L A;  2GGR A;  4Z02 A;  3OW2 S;  3G1J A;  2HAX A;  2V1Q A;  3URG A;  1UEC A;  1U3O A;  5GAN 4;  4IIO A;  1VQL A;  4OMO A;  2QQR A;  2XKO C;  2VB6 A;  3H6Z A;  2PNI A;  1FYN A;  1K9M R;  2VGN A;  3HRT A;  3OB9 A;  4PJO G;  4XTU A;  4EIK A;  1VQM T;  3MEW A;  5GAO l;  2YUQ A;  3OS0 A;  5LJ5 e;  2ZAE A;  1KQS P;  4OB3 B;  2CS7 A;  3HPW A;  2COY A;  4QVC A;  3GOX A;  3OS2 A;  4FW2 A;  4ZN1 A;  5M9O A;  1AEY A;  4M7D E;  4RMO A;  4PKC C;  4JS4 A;  3SWN C;  5D6Y A;  3GNG A;  3M55 A;  2HNI A;  4E7K A;  1X6G A;  2XDD A;  2OTJ T;  1VQ5 T;  2DJQ A;  4J9E A;  3WXM B;  2KXC A;  3SD4 A;  2OJ2 A;  1QW1 A;  1DJ7 B;  3OYH A;  1RLQ C;  1YI2 Q;  2LC4 A;  2YRC A;  3CPF A;  1HYO A;  4PNO A;  4EMK B;  2K9G A;  1RUW A;  1UGQ B;  2QAZ A;  5KYX B;  4M77 A;  3REB B;  1PC0 A;  3OYM A;  1IB8 A;  1NLP C;  1WJS A;  4RTT A;  4M7A G;  4GLK A;  3VYG A;  2ECZ A;  1JXO A;  3QHS A;  5I11 A;  1ZSZ B;  3JRZ A;  4C0Z A;  4KGX B;  3HRU A;  1UE9 A;  4QQD A;  2RM4 A;  1IRE B;  1C0M A;  2CSI A;  2QGG A;  3I5R A;  2LQ8 A;  3OBW A;  4C0G A;  3FEO A;  3CC7 A;  4FYY B;  4JDS A;  1VQN T;  4HVV A;  3RDV A;  1Y71 A;  4K11 A;  5FWB A;  3QDR B;  3OW2 P;  2MAM A;  2O4X A;  5GAM h;  3NFC A;  5HK3 A;  1K4U S;  1PD0 A;  4F16 A;  3X25 B;  3M54 A;  2KXD A;  1KFZ A;  2KR3 A;  3JCM Q;  3RMS A;  1VQO A;  1NLO C;  3EG9 A;  5FWC A;  4QVD A;  2V26 A;  1KQ1 A;  3DLL A;  2EYY A;  3CC2 T;  4YTL A;  3OYG A;  2K7A A;  3JB9 D;  3G4S T;  2QQB A;  3CCJ Q;  3JCM c;  3CCL Q;  2DXT A;  2DD4 A;  2HKQ B;  3MO8 A;  2HL5 C;  1Z9Z A;  2DXU A;  1H3H A;  4M77 D;  1TUG B;  3M0S A;  5DY9 A;  3CME A;  1VQP Q;  1FMK A;  2DPP B;  2ED1 A;  4C92 B;  2KVQ G;  1YCS B;  3VRZ A;  4A54 A;  4A4H A;  2QDL A;  2D8J A;  3OYA A;  1QCO A;  1M27 C;  5GAN g;  4PJO A;  3CCU T;  2YLC A;  1RAI B;  2VWF A;  2QAS A;  2KMT A;  2KAF A;  3DB3 A;  4XAX B;  2E3H A;  2JT4 A;  3LGL A;  2FEI A;  3M57 A;  2FZG B;  5GAN e;  2EWN A;  2DLP A;  1YHQ Q;  4BD3 A;  1QP2 A;  1OPK A;  2EJ9 A;  1J3T A;  4DQ2 A;  1PM3 A;  1T3L A;  3EHQ A;  3H0F A;  1YNZ A;  2BKD N;  1R0B G;  2X9H A;  4L59 A;  1Q86 C;  2JXB A;  5L23 A;  1YI2 T;  2DEQ A;  1Y7X A;  4Y91 A;  2V8J A;  3FJP A;  1RLP C;  2K3X A;  2E4H A;  1Q82 C;  3LH5 A;  3OYF A;  3QPH A;  4OF1 A;  4PK4 A;  3OA6 A;  1AWJ A;  1OZ3 A;  1CKB A;  3H41 A;  1NG2 A;  1JB0 E;  1M1K C;  5KYY A;  8AT1 B;  2CZ1 B;  3QBY A;  4N4I A;  2JMA A;  3HP9 A;  1GCQ A;  1YJN Q;  1WXU A;  4II1 A;  1EFN A;  1HJD A;  2QQA A;  3HRS A;  4D8D A;  2FZC B;  2ZPE B;  2EFI A;  4RTX A;  3QJY A;  2RD1 A;  3CCE Q;  1B7T A;  1ACM B;  4C92 G;  5FU6 B;  2LCS A;  7AT1 B;  3EFS A;  2EBP A;  2RI3 A;  1IGQ A;  3F70 A;  2JUF A;  4F7U E;  3VS2 A;  2ESW A;  5CCA A;  4PJO D;  3I56 Q;  4IUP A;  1V1C A;  2MCN A;  3RKY A;  1QVF P;  1M8V A;  2ABL A;  2M1H A;  1SSF A;  1OI1 A;  1M5Q 1;  2O88 A;  3OBY A;  2H3E B;  2E70 A;  1K9M U;  1YWO A;  4ZGE B;  4XK8 E;  4XU3 A;  2AHJ B;  2RHI A;  3BE3 A;  3NHN A;  2DBK A;  2IIM A;  1KK7 A;  1NPR A;  3A8H B;  2DZ9 A;  2VXF A;  4BE1 A;  3MHX A;  4M75 B;  4XTZ A;  1SF9 A;  1WHK A;  2MPX C;  4NS5 A;  5IXF A;  1CKA A;  2VVK A;  2H3J A;  2PVD B;  1K76 A;  1XNI A;  2EQM A;  2JM8 A;  4MML A;  1Q95 G;  1RAA B;  5GAN 2;  2FPF A;  4FSS A;  4M77 E;  4EMK A;  2CRE A;  5KYX A;  3ZBD A;  1N9R A;  3GNF B;  5GMK j;  2EJF A;  2RI2 A;  3M5A A;  4XTY A;  1K0S A;  4AG1 C;  4ORZ A;  3RIR A;  8ATC B;  3G6E Q;  1PCX A;  1N8R U;  3M56 A;  2GQV A;  4M78 F;  1S72 Q;  1TS9 A;  2KY9 A;  2E5Q A;  4R56 A;  4HA8 A;  3CMA A;  4DOV A;  2D0Q B;  2L3S A;  2EIF A;  2C0I A;  1MV0 B;  4J5Y A;  1JO8 A;  3H0I A;  1YIJ A;  3EG2 A;  3M53 A;  1YHQ T;  5GMK i;  4JPB W;  4CC2 A;  1VIF A;  4JLG A;  1ZSG A;  5KE3 A;  3MEA A;  5GAM f;  3GPL A;  2JM9 A;  2HDA A;  1Q86 R;  3EGX B;  4F7U B;  2M51 A;  2EGA A;  2EPD A;  4M77 C;  4QW2 A;  2DE0 X;  3TQ7 P;  3CC4 A;  2ZPG B;  1Q82 R;  5FRN A;  3BFM A;  4M75 G;  1RI0 A;  4FYW B;  2QI2 A;  2DEU A;  4FM4 B;  4IKF A;  3PNW C;  4M7D A;  2CUD A;  1M1K R;  3LW5 E;  2QEX A;  3BW1 A;  5AT1 B;  3VS5 A;  3MJX A;  1YJN T;  5LJ3 g;  2RQT A;  3VUZ A;  1IGU A;  1M3A A;  3HL8 A;  2EJG A;  3JB9 H;  1W2B A;  1HXD A;  3DKM A;  3M59 A;  5LJ3 e;  4ZTJ A;  1HD3 A;  2LT4 A;  5I22 A;  3UWN A;  2XIC A;  3MP8 A;  1QVG P;  2DK3 A;  4C92 A;  2KRN A;  3FC3 A;  3JCM b;  3VV0 A;  1M30 A;  2P84 A;  4OMN A;  1ZHI A;  4PJO E;  3CXC A;  3G71 Q;  3ULR B;  3JCM f;  2GTJ A;  3J80 E;  3OYY A;  4J7I A;  4RTY A;  4NL3 A;  3CCS Q;  3KUF A;  2L5Q A;  5LJ5 j;  1BB9 A;  3X24 B;  1WGS A;  1WHG A;  1OYX A;  2CT4 A;  4HXJ A;  2QTX A;  2F2V A;  5KYU B;  1VQ6 A;  3CBO A;  2MMP A;  4ESR A;  3A8O B;  2PUO B;  1RAB B;  3P8B B;  1K8A U;  1RI9 A;  1YJW A;  3CCV T;  2CP5 A;  5A0D A;  1QWE A;  4MZM A;  3M4G A;  3SHW A;  4BUG A;  4ANJ A;  3THK A;  4M78 G;  4FSX A;  4HT8 A;  4WTO B;  2C06 A;  1C6V X;  3SFM A;  4DEY A;  3CEY A;  3RKX A;  1M90 C;  4PFO A;  2QGF B;  1M3C A;  5IH2 A;  2LDM A;  1WDX A;  3PMI A;  5D6X A;  2LT1 A;  4B6M A;  5LJ5 f;  1QLY A;  3L2U A;  4LE9 A;  2KGT A;  3NTI A;  2LQW A;  3SDZ A;  4BDZ A;  3VUB A;  1YJ9 A;  4KUL A;  4JS5 A;  2RNA A;  4PJO C;  1SHF A;  2GQI A;  3OYE A;  2KSS A;  1ZBX A;  1W2B S;  2EGC A;  2OTJ Q;  1S72 T;  4ZGJ B;  2K5F A;  4Z88 A;  4M4Z A;  1EX4 A;  4M7A E;  5DM7 R;  2CGH A;  2AKL A;  3JV3 A;  4C92 D;  4RTW A;  1V76 A;  1KQS S;  4B9W A;  4QQG A;  1N8R C;  2L0A A;  2CH4 A;  1IHV A;  2FYK A;  1YBY A;  1WJQ A;  3CXC S;  1VQ9 A;  4C8Q F;  3QUI A;  3DLM A;  2B8A A;  2LQN A;  4AFS C;  4CC3 A;  1KJW A;  4C0F A;  2XI9 A;  1OPL A;  3M0Q A;  3I55 T;  1OX8 A;  3RKW A;  1W70 A;  3HTR A;  4KBM B;  4OMF B;  4PJL A;  2QDY B;  1B34 A;  2CP2 A;  1GCQ C;  4A4E A;  4ZN3 A;  3M58 A;  3L2R A;  3DB4 A;  2R5A A;  1ZQ1 A;  4DBH A;  2DD5 A;  3PGG A;  4M75 A;  1N5Z A;  2YWW A;  2RK1 A;  3FLG A;  3M9Q A;  3UT1 A;  2OAU A;  3MPU B;  1NYF A;  2L3R A;  3JCM d;  1H64 1;  1JRI A;  4JRP A;  4LDV A;  4BB7 A;  2KRS A;  4CC4 B;  3CD6 T;  4KGV B;  4QT7 A;  2FRW A;  1LOJ A;  2FB7 A;  1U1S A;  1RAH B;  1QCF A;  2CUB A;  3A8L B;  3CC2 Q;  5DLO A;  1YP5 A;  1UGS B;  2BTT A;  2COZ A;  2DTO A;  5KYN A;  4R55 A;  2L3Q A;  5FU7 C;  2VYT A;  1VQ7 A;  3EGU A;  3CCR A;  4XU0 A;  2X4X A;  1T3S A;  3CCS T;  1AZG B;  2DET A;  4J9G A;  5FRM A;  1MMG A;  1AT1 B;  4HCK A;  2F5K A;  1OV3 A;  4M7A B;  1PKT A;  2CSQ A;  1M2V B;  1R8O B;  1SPK A;  1W2B P;  5LJ5 d;  1VQL Q;  1UGV A;  2A37 A;  5GAN j;  1AWX A;  3EGX A;  2JJ9 A;  4ME7 A;  4EMK C;  4F7U A;  1VYV A;  1NBE B;  4PJM A;  1ZX6 A;  3LH0 A;  3CCU Q;  4Z89 A;  1K8A C;  3CXC P;  1M90 R;  4CI0 C;  4O6J A;  4M75 D;  3L2Z A;  4LUD A;  1K9A A;  5C6S A;  5GAN 7;  1Q86 U;  2WSC E;  1ZSZ C;  2K4Y A;  4GY5 A;  1U06 A;  3VU3 C;  4A4G A;  2CP6 A;  3H9N A;  3OS1 A;  2BE9 B;  2VAS A;  1B07 A;  4D8K A;  2AK5 A;  4KRT A;  3QYH B;  1VYU A;  1Q82 U;  4E7Z A;  3CCM A;  3OY9 A;  3LWH A;  1X2Q A;  2O31 A;  4LDW A;  3CCQ A;  1M1K U;  2E6N A;  2AT1 B;  3EFR A;  4Y28 E;  1N8R R;  4C92 E;  1OQK A;  2EYZ A;  5GAO p;  1O75 A;  2LVM A;  1QVF A;  2DVE A;  2GTO A;  1VOM A;  1WX6 A;  2D8H A;  1UB4 A;  5A0L A;  2EQJ A;  2YRD A;  3MP1 A;  2EYQ A;  3P8H A;  2Y90 A;  2OAW A;  2VXE A;  4E7S A;  3ZL7 C;  2LX7 A;  3CBP A;  1KHC A;  2E10 A;  2YHT A;  1XTD A;  3D7S B;  3ZFJ A;  1PSE A;  1VA7 A;  3TRE A;  5GAO m;  5IXB A;  5GMK l;  4J9B A;  4ELZ C;  1VYT A;  3VS7 A;  4M7D C;  1XOV A;  1I07 A;  3EGD A;  3M0R A;  4B9X A;  1F1B B;  2B86 A;  2OTL A;  1E7O A;  1KG1 A;  1NZ9 A;  1Y0M A;  3VKI A;  2MYS A;  3GBQ A;  5CKE A;  4LUE A;  1LPL A;  3I9Q A;  2DL7 A;  1H8K A;  1Y96 B;  2RJE A;  3UF4 A;  2YRV A;  1PWT A;  3SWN B;  2CZ6 B;  3UPU A;  3CC7 Q;  1WHJ A;  1G5V A;  2JMC A;  1BCO A;  2D1X A;  4C92 C;  3AHU A;  2HQH A;  5HK0 A;  1BKB A;  1T0H A;  1NPP A;  2E64 A;  3MCA B;  3QXE B;  1VQO Q;  1YWP A;  1QWF A;  1BI3 A;  4FCY A;  2KDS A;  3QJ6 A;  5HCK A;  2MI6 A;  3QII A;  2KYM A;  2HKN A;  2KEA A;  1X2K A;  2EGE A;  2K2M A;  4RCC A;  3M0U A;  1QVF S;  2K5L A;  2OI3 A;  3VS6 A;  5GMK m;  1HSQ A;  5J3B A;  1U8R A;  2X4Y A;  2L3P A;  1GXI E;  2OX7 A;  1SHG A;  2ZPH B;  1VQL T;  4FU6 A;  3CME Q;  4DBQ A;  1BBZ A;  3RBB B;  2IPO B;  4MZT A;  1PD1 A;  1PKS A;  2HL3 A;  2JNG A;  3JCM h;  1VQP A;  2D9T A;  2DTI A;  1AOJ A;  4ZTF A;  1WHL A;  1TH7 A;  1K8A R;  3TVT A;  1WHH A;  4XQ3 A;  2RQV A;  3RMQ A;  1Y07 A;  1OX9 A;  2PZ1 A;  1VQ8 A;  4M75 E;  2R57 A;  3OYJ A;  1N6A A;  2ED0 A;  3G7Z A;  5FU6 C;  1PSF A;  2ROT A;  5KYW B;  5CIU A;  3VS1 A;  3RNJ A;  3KXT A;  3UAT A;  2RQU A;  1WA7 A;  2FHD A;  1YIT A;  1QVG A;  1NYG A;  2E12 A;  1W4S A;  3WVD B;  2RA2 A;  4BE0 A;  5LJ5 h;  2YLB A;  2V1R A;  5LJ3 j;  4LDX A;  1FMW A;  4J9H A;  4GLM A;  2YUP A;  1UGR B;  2CP7 A;  2J06 A;  5GAN 8;  2CP0 A;  3FDR A;  1FXX A;  2RHY A;  1M1G A;  2CZ7 B;  2KNB B;  4HCZ A;  4E6R A;  3T9N A;  4J9C A;  4M7A A;  4JZ4 A;  2G6F X;  4J6W A;  4M75 C;  3JCM V;  1AHJ B;  3V7S A;  3S3O A;  3VS0 A;  4CRI A;  4IUQ A;  1MMA A;  4NL2 A;  5J39 A;  3CCE A;  4JZ3 A;  1OOT A;  3VJP A;  4C0D B;  3H8Z A;  5IN1 A;  4X1V A;  2LRQ A;  5LJ3 f;  2ENM A;  4HCB A;  1FWZ A;  3CC7 T;  2BZX A;  4BE2 A;  1LCK A;  2X35 A;  2LTO A;  4M78 E;  3EFO B;  2A08 A;  2KT1 A;  3I56 A;  3X20 B;  2EQI A;  3GLX A;  2LZ6 B;  4IIM A;  1YCY A;  1JU5 C;  2ZPI B;  1ZUY A;  2DFU A;  3P8D A;  4IUU A;  1VQO T;  1KD1 U;  1JEG A;  1W1F A;  1BI1 A;  1C1A A;  1ARK A;  5A2Q E;  1I81 A;  1K1Z A;  1SG5 A;  3OYI A;  5EC7 A;  3CCV Q;  1M90 U;  2K2V A;  4RUG A;  1QVG S;  2PUK B;  4J7F A;  3FIF A;  2NUZ A;  3S3N A;  4X34 A;  2DM1 A;  2RQR A;  2DNU A;  4EPC A;  3SB2 A;  3E9F A;  2X51 A;  1MUZ A;  3RR6 A;  2VC8 A;  1T0J A;  1Y57 A;  1G3T A;  1GFD A;  1UGP B;  2E65 A;  3V8L A;  4OGE A;  2NUT B;  1IXD A;  5J26 A;  1ZUK A;  2JTE A;  3CME T;  4M7A D;  1SRL A;  3BY7 A;  2XK0 A;  5KCO A;  4WCI A;  5KE2 A;  1GBR A;  1BU1 A;  1ZSZ A;  2HQX A;  2GNC A;  2DXC A;  2FPE A;  1VQK A;  3E9G A;  1KSW A;  4J9F A;  3G6E A;  1IHW A;  2QA4 A;  4OMP A;  5CKD A;  3A8G B;  2GF7 A;  3CMA Q;  1WI7 A;  2F1L A;  3R6O A;  4BY6 C;  4KT0 E;  5CQY A;  3NTK A;  5I2S A;  1BI2 A;  3CQT A;  5FRO A;  2DRM A;  1YIJ Q;  3PIP A;  1ABQ A;  1CSK A;  3QSU A;  3I55 Q;  2Z0W A;  5D6W A;  2LCC A;  2DYB A;  2PVO B;  2CDT A;  3C94 A;  1KQ2 A;  2DL5 A;  2F69 A;  4M78 B;  4OMM A;  2GFA A;  3GF5 A;  3CC4 Q;  2RQW A;  3QKJ A;  3X26 B;  4EMH A;  3JB9 J;  5LJ3 d;  1I1J A;  4M77 F;  1NEG A;  1WQ7 A;  1G2B A;  2QEX Q;  3OYD A;  1VQ4 A;  2VGM A;  3CD6 Q;  4JJN K;  1GRI A;  2EYX A;  3C95 A;  3A1P A;  2DL3 A;  2LJ1 A;  2GFU A;  2M9U A;  2HCK A;  4KH0 B;  1UJ0 A;  3PE0 A;  3EAE A;  6AT1 B;  2W0Z A;  5GAO n;  1KIK A;  1Q7Y U;  4O5V A;  4VUB A;  2ATC B;  1SSH A;  2BUD A;  3OYL A;  4KUD K;  3G71 A;  1LNX A;  4EMG A;  5C0M A;  4OML A;  3FB9 A;  1MND A;  3QYG B;  4KUI A;  3TSZ A;  2CT3 A;  2EVR A;  1X43 A;  3TCJ A;  3INZ A;  5KYW A;  2HBW A;  3M0P A;  3HFN A;  4RTV A;  1GFC A;  1VQ6 Q;  4ZGD B;  4A4K A;  2AKK A;  3EHR A;  4LD6 A;  1U5S A;  3A98 A;  3PTA A;  5CKF A;  2K79 A;  1YJW Q;  3ER0 A;  4JLI A;  3WVE B;  1KD1 C;  4FYX B;  2HSE B;  1G8X A;  1SKU B;  2VUB A;  3M4Y A;  1VQM A;  2M16 A;  5FW9 A;  1B3Q A;  2P4R A;  5A0G A;  4MDX A;  2QYZ A;  2FO0 A;  2LMJ A;  3A5Z B;  2R5M A;  4N0A A;  2CYZ B;  3EG1 A;  1YJ9 Q;  2DVJ A;  1Z9Q A;  2P0K A;  1PRL C;  2HSP A;  2XD0 A;  4RG2 A;  1AWW A;  2VKN A;  3EG9 B;  3S6W A;  2E5K A;  3TU4 K;  2JTF A;  2Y4Y A;  1BIA A;  2OTJ A;  1VQ5 A;  4PJO F;  3CMA T;  1P92 A;  1G3Y A;  4KH1 B;  2QA4 T;  2ZZD A;  4PJN A;  1WPY A;  5GAM g;  1YIJ T;  3HFO A;  3OSV A;  4LNP A;  4XTV A;  3LYI A;  2JOY A;  4DBR A;  3EFO A;  2IG0 A;  2XU8 A;  5GAM e;  2FRY A;  2O01 E;  2VV5 A;  3NPF A;  4RCB A;  3CC4 T;  2KI7 A;  2CP3 A;  4ATO A;  2DXB A;  4XU2 A;  1RL2 A;  4M7A C;  1UG1 A;  3UA7 A;  1M9S A;  2EYW A;  1EZZ B;  2QEX T;  3QG1 A;  3V7C A;  1BIB A;  1UFF A;  1VQN A;  4C8Q B;  2EQK A;  1G3W A;  1UHF A;  1SEM A;  2YT6 A;  2JTM A;  1GBQ A;  3HHT B;  2X4W A;  2RJF A;  4OGC A;  1PNJ A;  3JCM W;  2C0T A;  3A8M B;  3BDL A;  4FIB A;  4E7J A;  2YDL A;  2NUT A;  4DOW A;  3JCM g;  1W6X A;  2RPN A;  1VIE A;  2KRM A;  1D1C A;  2YUO A;  1MMD A;  2COW A;  4XU1 A;  4X9C A;  2I0N A;  2SEM A;  3OYK A;  3G4S A;  1D0Y A;  2L2P A;  2LJ0 A;  3JCM e;  1VQ7 Q;  3QO3 A;  2DL4 A;  1S1N A;  4FL6 A;  1QKW A;  1AD5 A;  1Q7Y C;  1K0X A;  1D09 B;  3NTH A;  2A28 A;  1QVP A;  3I35 A;  3C0C A;  1VQ6 T;  2RHU A;  1MNE A;  1VUB A;  5LJ3 h;  3MEV A;  5L8R E;  1IZ6 A;  1UTI A;  1YJW T;  1KD1 R;  2DL8 A;  3MKD A;  4BI8 B;  5GJV B;  4AMC A;  4C5I A;  2HZY A;  2XDP A;  3OQ5 A;  2ZPB B;  9ATC B;  2E41 A;  5LJ5 g;  4WF2 A;  4AFU C;  1V29 B;  2V8I A;  4JUV A;  4M78 A;  3EH2 A;  3KBG A;  4OVA A;  4JRK A;  1AWO A;  4DBF A;  3PMT A;  4F17 A;  4RTU A;  3CCU A;  3OYB A;  1TG0 A;  5D7U A;  4C8Q G;  1OEB A;  3BDU A;  5HY6 A;  4E2F B;  1I5O B;  1YJ9 T;  2EKH A;  4XTX A;  4D6W A;  2C0O A;  2E3I A;  2XMF A;  3OMC A;  5GAN f;  2HEQ A;  4NOY A;  1M8M A;  2PTK A;  2RMO A;  5FU7 B;  3CCM Q;  3L1A A;  1BYM A;  3CCQ Q;  3MET A;  1LVK A;  1OU9 A;  1TXQ A;  5IHK A;  1QQJ A;  5CO7 A;  1I5L A;  1YI2 A;  4IUT A;  1JJ2 P;  4UC4 A;  2D6F A;  1QMC A;  1H3Z A;  3JAM E;  2JS2 A;  2F2X A;  4IUV A;  1VQ9 T;  3OMG A;  1X69 A;  2DTH A;  4LXC A;  3OYC A;  3EH1 A;  1AVZ C;  2BE7 D;  4ELY C;  2MF2 A;  2BIV A;  4RKU E;  5IHN A;  2FZK B;  2LP5 A;  3J81 E;  5HKC A;  1YN8 A;  1KC8 U;  2G3R A;  5KYU A;  2DIG A;  4QKU A;  5GAO r;  3LGF A;  4FT2 A;  2OTL Q;  2JZ2 A;  4OB1 B;  2X4J A;  2DZC A;  2ZCF B;  1R0C B;  5GMK h;  2KE9 A;  4M7D F;  4M78 D;  2M02 A;  1E6G A;  2DBM A;  3FRN A;  2EW3 A;  1WXT A;  3N5B B;  3UDC A;  3HSB A;  1IRX A;  2DER A;  1WYX A;  1D0X A;  4QVZ A;  4IUR A;  2ZGW A;  4GBQ A;  1UUE A;  1AZE A;  2QK0 A;  3IQL A;  4MMK A;  4C92 F;  2QQS A;  5I21 A;  3H0H A;  3VS4 A;  3ASK A;  1NJI U;  2HD0 A;  2DJZ A;  3CCJ A;  1VQ7 T;  3CCR T;  3CCL A;  3QWY A;  2KBT A;  1D0Z A;  5GAN 5;  1Q7Y R;  3PT9 A;  4M7D B;  3REA B;  1K73 C;  2AZV A;  2D0N A;  3PIO A;  3V7R A;  5CR2 A;  4PLL A;  1YFN A;  2P0P A;  4A4F A;  4AT1 B;  2KRO A;  1QCN A;  1OU8 A;  2NUP B;  1WFW A;  3L2V A;  1JQQ A;  4OMQ A;  3RUX A;  3QWX X;  3PVQ A;  5GAN d;  5GJW B;  2PQW A;  4FT4 A;  4PL6 A;  4N0A C;  3KFV A;  1D1A A;  4J83 A;  5EG2 A;  3NMZ C;  2XID A;  4C5G A;  3PFS A;  4OP0 A;  4A63 B;  2DA9 A;  2V8K A;  4J9I A;  4BAC A;  1XQH A;  4A53 A;  2H8H A;  1VQ8 Q;  1IO6 A;  1MHN A;  2A0F B;  3O5Z A;  3FJ5 A;  1X01 A;  2JS0 A;  4C8Q A;  4C0D C;  1YHQ A;  2WSF E;  2FVU A;  3CCM T;  5I2M A;  3MP6 A;  1YIT Q;  3UA6 A;  3CCQ T;  4HVU A;  3JB9 I;  1M4Z A;  3O8V A;  2LNH B;  2RJD A;  4Y92 A;  1D3B B;  1QKX A;  2MOX A;  2LQK A;  1GL5 A;  1KHI A;  1WLP B;  1WZO A;  1Q81 U;  3RER A;  4M7D G;  1UJY A;  4LN2 A;  2DIL A;  2M0O A;  3CBM A;  4BDY A;  1RAF B;  3R6N A;  1YJN A;  1WJR A;  1M2V A;  4N4H A;  3AT1 B;  2F2W A;  1UDL A;  4JJB A;  4BI4 A;  2AZS A;  2SRC A;  2OTL T;  3M0T A;  1KC8 C;  2EQU A;  5CK9 A;  4JRQ A;  3C12 A;  2X3X D;  1D1B A;  4PFZ A;  2RJC A;  4AFZ C;  4X9D A;  4M75 F;  1X75 C;  1QP3 A;  1I0C A;  4E7I A;  3LWI A;  2RO0 A;  3V8K A;  2MIO A;  3MEU A;  2CKK A;  4P5N A;  2P4T A;  5GAN 6;  4C5E A;  1ZBJ A;  1ZA1 B;  3CPW A;  1ZLM A;  1RAG B;  4L5G A;  4C8Q D;  2K3B A;  2XDB A;  3V8J A;  1RAE B;  3GIB A;  1UEB A;  1B34 B;  2O9S A;  3E19 A;  1LJO A;  3CCV A;  2BZY A;  1UHC A;  4BI3 A;  4JJC A;  2PU9 B;  4J6X A;  4C5H A;  3CCJ T;  3CCL T;  1XJW B;  1K73 R;  2YSQ A;  2A36 A;  1NJI C;  2JN0 A;  1A0N B;  4Z8A A;  2MWO A;  2HQE A;  3QZ5 B;  3LX7 A;  1OZ2 A;  2FL7 A;  1EIF A;  2QTV A;  4M78 C;  4DA4 A;  3JCM P;  3JCM X;  2JVV A;  5GAO q;  1JXM A;  4F7U F;  5FLX E;  1VQP T;  3U23 A;  1S72 A;  5GAM j;  1VQK Q;  5CQX A;  1TSF A;  1BI0 A;  1SRM A;  2O9V A;  1Y96 A;  2QA4 Q;  4HKE A;  2MWP A;  3E1S A;  1ZUU A;  3SWN A;  1BCM A;  1I4K 1;  4E47 A;  1TU0 B;  1VQ8 T;  2J05 A;  3VRY A;  2CH4 W;  2KYB A;  2BZ8 A;  2RN8 A;  2MK5 A;  5CAI A;  3CPW S;  5KH6 A;  2J6F A;  3RES A;  1M3B A;  1YIT T;  1MV3 A;  4AFQ C;  2RI5 A;  2FG0 A;  3JB9 F;  1ABO A;  1WIE A;  2DAQ A;  2J7I A;  3EG0 A;  3I55 A;  2E6Z A;  1OUL A;  1PRM C;  1MMN A;  2W10 A;  2R58 A;  3PVL A;  3L42 A;  2KT8 A;  4FYV B;  3TSW A;  2NLU A;  2ZPF B;  1M1F A;  3OYN A;  1H92 A;  5GAN h;  2DYI A;  2DO3 A;  5KCH A;  4MDW A;  4ZNX A;  1Q81 C;  1VQ4 Q;  2P0Q A;  5CKB A;  3VS3 A;  2RH2 A;  5LL6 S;  3CD6 A;  4LDU A;  4KGZ B;  1KC8 R;  3GP8 A;  4BY6 B;  2K5I A;  3CCE T;  2NUP A;  2DRK A;  2WSE E;  1FMV A;  2XHC A;  2RHZ A;  4PJJ A;  2DKG A;  3J7A F;  3C4S A;  2Y4X A;  4EDU A;  2RHX A;  1KQS A;  2K6D A;  2ROL A;  3I56 T;  1RAD B; 
#chains in the Genus database with same CATH homology
 2YUO A;  4CC7 A;  2I0N A;  5HCK A;  2SEM A;  1YWO A;  2L2P A;  2LJ0 A;  2KYM A;  2JW4 A;  2DL4 A;  1S1N A;  2KEA A;  1QKW A;  1X2K A;  2EGE A;  2DBK A;  1AD5 A;  3NHN A;  1K0X A;  2IIM A;  2K2M A;  3M0U A;  2A28 A;  3I35 A;  3C0C A;  2OI3 A;  3VS6 A;  2M0Y A;  5IXF A;  1E6H A;  1CKA A;  1HSQ A;  1UTI A;  2VVK A;  2L3P A;  1K76 A;  2DL8 A;  2JM8 A;  5GJV B;  1SHG A;  2FPF A;  4FSS A;  2CRE A;  4AFU C;  1BBZ A;  3RBB B;  1GCP A;  4F14 A;  1PKS A;  4J9D A;  2RF0 A;  1AWO A;  1K0S A;  4AG1 C;  1AOJ A;  4ORZ A;  1NEB A;  4F17 A;  2ROL A;  4RTU A;  3I5S A;  3TVT A;  2RQV A;  1TG0 A;  1OEB A;  4RTZ A;  2NWM A;  2PZ1 A;  1BK2 A;  2EKH A;  2C0O A;  2XMF A;  2ED0 A;  2DX1 A;  2HEQ A;  1M8M A;  2ROT A;  2PTK A;  2L3S A;  2RMO A;  2C0I A;  1MV0 B;  3VS1 A;  3RNJ A;  1JO8 A;  2FPD A;  2DF6 A;  2LJ3 A;  3H0I A;  3UAT A;  2RQU A;  1WA7 A;  3EG2 A;  5IHK A;  4JPB W;  4CC2 A;  4HVW A;  1NYG A;  1ZSG A;  5IHI A;  2JS2 A;  2F2X A;  2JM9 A;  1X69 A;  2HDA A;  1AVZ C;  2M51 A;  2V1R A;  2EGA A;  2EPD A;  1X27 A;  4DEX A;  4J9H A;  5IHN A;  4GLM A;  2DE0 X;  2LP5 A;  2J6O A;  2YUP A;  2J06 A;  2GBQ A;  1YN8 A;  1X6B A;  1PHT A;  2KNB B;  5ECA A;  2CUD A;  1WXB A;  4E6R A;  2DMO A;  4J9C A;  3VS5 A;  1TUC A;  4JZ4 A;  2G6F X;  2RQT A;  3VS0 A;  2KE9 A;  1M3A A;  1TUD A;  1E6G A;  2DBM A;  3EG3 A;  2EW3 A;  4JZ3 A;  1OOT A;  1WXT A;  4X1V A;  1HD3 A;  2ENM A;  5I22 A;  2BZX A;  4AG2 C;  1LCK A;  1WYX A;  2KRN A;  3SEM A;  1M30 A;  2A08 A;  1NM7 A;  1UUE A;  2KT1 A;  4GBQ A;  4OMN A;  4R0K A;  1AZE A;  2EQI A;  3IQL A;  2LZ6 B;  3ULR B;  4IIM A;  2GTJ A;  1JU5 C;  1ZUY A;  1JEG A;  4RTY A;  2YUN A;  2J6K A;  3H0H A;  3VS4 A;  1W1F A;  2O2O A;  1ARK A;  1BB9 A;  2X3W D;  1K1Z A;  5EC7 A;  4RUG A;  3QWY A;  1G83 A;  2CT4 A;  4HXJ A;  2NUZ A;  2F2V A;  4ESR A;  3NGP A;  2KBT A;  4JJD A;  2DM1 A;  3REA B;  2GGR A;  2RQR A;  2DNU A;  1RI9 A;  2AZV A;  2D0N A;  2V1Q A;  1QWE A;  1UEC A;  3SHW A;  1U3O A;  4IIO A;  3THK A;  4OMO A;  1MUZ A;  2KRO A;  1T0J A;  1Y57 A;  1GFD A;  2PNI A;  1FYN A;  1WFW A;  1JQQ A;  4DEY A;  4EIK A;  1ZUK A;  4OMQ A;  3QWX X;  3PVQ A;  2JTE A;  5GJW B;  2YUQ A;  1M3C A;  5IH2 A;  1SRL A;  1WDX A;  1QLY A;  3KFV A;  2KGT A;  4LE9 A;  2LQW A;  4WCI A;  1GBR A;  3NMZ C;  1BU1 A;  2GNC A;  2FPE A;  2RNA A;  4A63 B;  2DA9 A;  1SHF A;  2GQI A;  4J9I A;  1AEY A;  1KSW A;  4J9F A;  2EGC A;  4OMP A;  2H8H A;  4Z88 A;  4M4Z A;  1IO6 A;  3O5Z A;  1WI7 A;  2AKL A;  3FJ5 A;  3JV3 A;  2JS0 A;  4RTW A;  1X6G A;  3CQT A;  2DRM A;  2L0A A;  2DJQ A;  2CH4 A;  4J9E A;  2KXC A;  3UA6 A;  2OJ2 A;  1RLQ C;  1ABQ A;  1CSK A;  4HVU A;  2LQN A;  2LNH B;  4Y92 A;  4AFS C;  4CC3 A;  1KJW A;  1QKX A;  2MOX A;  2DYB A;  2CDT A;  1GL5 A;  2DL5 A;  1WLP B;  1OPL A;  1RUW A;  2K9G A;  4OMM A;  3M0Q A;  3REB B;  1UJY A;  4LN2 A;  1W70 A;  1NLP C;  2DIL A;  2RQW A;  4RTT A;  1GCQ C;  3R6N A;  1I1J A;  2ECZ A;  1NEG A;  1JXO A;  1G2B A;  2F2W A;  5I11 A;  1UDL A;  4JJB A;  1UE9 A;  2AZS A;  2SRC A;  1GRI A;  1N5Z A;  2CSI A;  3I5R A;  2EYX A;  3M0T A;  2DL3 A;  2LJ1 A;  2HCK A;  1NYF A;  2X3X D;  4HVV A;  1UJ0 A;  4AFZ C;  2KRS A;  4CC4 B;  4K11 A;  1I0C A;  4QT7 A;  5FWB A;  3PE0 A;  2FRW A;  2MIO A;  2W0Z A;  1K4U S;  1KIK A;  4F16 A;  2KXD A;  2CUB A;  1QCF A;  2KR3 A;  1KFZ A;  1ZBJ A;  1ZLM A;  1SSH A;  1YP5 A;  2BTT A;  1NLO C;  5FWC A;  2L3Q A;  2K3B A;  3EGU A;  2EYY A;  4OML A;  1T3S A;  1AZG B;  2K7A A;  3TSZ A;  2CT3 A;  2EVR A;  4J9G A;  1X43 A;  2HBW A;  3M0P A;  2O9S A;  4HCK A;  4RTV A;  1OV3 A;  1GFC A;  1PKT A;  1Z9Z A;  2CSQ A;  2AKK A;  1UHC A;  2BZY A;  3EHR A;  1SPK A;  4JJC A;  1U5S A;  3A98 A;  2K79 A;  1H3H A;  2YSQ A;  2A36 A;  1A0N B;  1UGV A;  2A37 A;  3M0S A;  1AWX A;  4Z8A A;  5FW9 A;  1VYV A;  1B3Q A;  2P4R A;  1FMK A;  2ED1 A;  1ZX6 A;  2FO0 A;  1YCS B;  2LMJ A;  3VRZ A;  4Z89 A;  1JXM A;  2QDL A;  2D8J A;  3EG1 A;  4LUD A;  1K9A A;  3U23 A;  2DVJ A;  1M27 C;  1Z9Q A;  1U06 A;  2VWF A;  1PRL C;  1SRM A;  2HSP A;  1AWW A;  2O9V A;  2VKN A;  4D8K A;  1B07 A;  1ZUU A;  2E5K A;  2AK5 A;  2JT4 A;  4KRT A;  1VYU A;  2FEI A;  2DLP A;  1X2Q A;  2J05 A;  2O31 A;  3VRY A;  2CH4 W;  2KYB A;  2BZ8 A;  1OPK A;  2RN8 A;  1J3T A;  1T3L A;  2EYZ A;  4LNP A;  3EHQ A;  1YNZ A;  2J6F A;  3H0F A;  1M3B A;  1MV3 A;  2GTO A;  4AFQ C;  2JXB A;  1WX6 A;  2FG0 A;  5L23 A;  1ABO A;  2D8H A;  1WIE A;  2J7I A;  3EG0 A;  1RLP C;  2OAW A;  1PRM C;  2FRY A;  3LH5 A;  3ZL7 C;  2LX7 A;  2W10 A;  3NPF A;  3PVL A;  2KT8 A;  1AWJ A;  3TSW A;  1CKB A;  1VA7 A;  3H41 A;  5IXB A;  4J9B A;  1NG2 A;  1VYT A;  3VS7 A;  1H92 A;  2JMA A;  1GCQ A;  1WXU A;  1EFN A;  1XOV A;  1I07 A;  1HJD A;  3M0R A;  1UG1 A;  3UA7 A;  2B86 A;  4D8D A;  1E7O A;  4ZNX A;  2EYW A;  1Y0M A;  4RTX A;  3GBQ A;  4LUE A;  3I9Q A;  3VS3 A;  2DL7 A;  1H8K A;  1UFF A;  2LCS A;  1UHF A;  3UF4 A;  1PWT A;  1SEM A;  2EBP A;  2YT6 A;  1GBQ A;  1PNJ A;  2C0T A;  2JMC A;  2D1X A;  2DRK A;  2YDL A;  3VS2 A;  2ESW A;  1V1C A;  2MCN A;  2ABL A;  1T0H A;  1W6X A;  2RPN A;  2O88 A;  2KRM A;  2K6D A;  1YWP A;  1QWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...