5FU7C

Drosophila nanos nbr peptide bound to the not module of the human ccr4-not complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
148
structure length
148
Chain Sequence
GPHMLELTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Distinct Modes of Recruitment of the Ccr4-not Complex by Drosophila and Vertebrate Nanos
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1
total genus 31
structure length 148
sequence length 148
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04153 NOT2_3_5 NOT2 / NOT3 / NOT5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5fu7C00
5FU7B 4BY6B 4C0GA 4C0DC 4C0DB 4BY6C 5FU7C 5FU6C 5FU6B 4C0FA
chains in the Genus database with same CATH superfamily
4KUDK 2F1LA 1VQ6Q 2E65A 1Q86C 2D9TA 1RL2A 4RG2A 2AZVA 5CQYA 5GANf 3VV0A 5LJ5d 2LX9A 5J3BA 4KT0E 2LVMA 1QVGP 4J9FA 1FYNA 1X75C 1RI0A 3CQTA 2XG8D 2DVJA 4ZN1A 3V8LA 1Y96A 2H3EB 1PC0A 4M7AG 3A1PA 3I9QA 1VQOA 4TVRA 1OX9A 2EBPA 2VWFA 4KGXB 3RIRA 1YIJT 1IRXA 2J6KA 2ZPEB 5LJ5j 3TVTA 1M1KR 3A8OB 2HQHA 3OYYA 4RTZA 1ZHIA 3QYGB 4R56A 2HAXA 2LX7A 3MP6A 4M77A 5KYUB 1B34A 2C0IA 1A0NB 1E7OA 3CD6T 3RBBB 2X35A 1VYVA 2QDYB 4E47A 1Q82U 2J05A 1XTDA 1OEBA 1D0XA 2DD4A 5GMKi 1VQ9A 1H92A 1MMGA 2DZCA 2RJFA 1KJWA 1UG1A 1OZ2A 2RHYA 2JW4A 5CVIA 4A4GA 1M3CA 2XDBA 3G7ZA 2A7YA 4F14A 2LT4A 2NLUA 4XTZA 3UWNA 4Z89A 1BCMA 4FSXA 2OTLA 4DOWA 2CYZB 2X9HA 4A4FA 2OAUA 2D6FA 4EMKB 4JPBW 2P84A 4KULA 2Y90A 2RHXA 4EPCA 1X01A 2OI3A 3OYCA 1PD0A 1KG1A 3EG1A 3HRSA 2GTJA 1M1KU 3OS1A 5KYXA 3HHTB 2DIGA 1YJWQ 2OX7A 4J6WA 2NWMA 1D0YA 4OMOA 1CKBA 5GMKj 4LDXA 1GBRA 4ELZC 2QG9B 2DRKA 2AT1B 2KMTA 1H3HA 4PJJA 1VQLQ 1UUEA 2E10A 3BDLA 1X69A 2FPEA 1YCSB 3JCMb 2YHTA 1VQNA 4PJOB 1F1BB 2E5QA 5AT1B 2F69A 3ZFJA 4J9GA 4Z88A 2EJFA 3CMAT 1UFFA 3HKSA 4M78F 3VS7A 2CDTA 2RHZA 2KR3A 4OMLA 5CKEA 3A98A 1T0HA 1XNIA 4XU1A 4ZN3A 5DY9A 4E7JA 3ZBDA 4RTUA 2XDPA 2RHIA 3VYGA 1HD3A 2K6DA 3CCQA 1YHQA 3FRNA 1ARKA 1YITT 2F5TX 2K7AA 1MV0B 1NZ9A 4XTUA 4B9WA 1N5ZA 2LJ3A 1JRIA 5FU6C 2HMAA 5J26A 3H0HA 2DM1A 3RR6A 1O9SA 1V1CA 5GAN7 4J6YA 3CBMA 2CZ6B 3TCJA 2CT3A 3URGA 5HKCA 1I0CA 1ZBXA 4GBQA 4AFUC 1VQMA 4PK4A 3H0IA 1K73R 2RF0A 3QXEB 3A5ZB 1KC8R 4XU0A 3EHRA 3HL8A 2O31A 3P8HA 2JXBA 3O8VA 5GMKh 4HVWA 2LJ1A 3NGPA 3WVEB 3PTAA 2NUPB 3QJYA 3OMGA 5IH2A 1BIAA 4E6RA 3NTHA 2X3XD 3PGGA 4IUQA 2E5KA 2RQWA 1M2VB 1JB0E 4JUVA 4C0DC 1Q86U 2CZ7B 3VRYA 1QKWA 1UGPB 5KH6A 5GMKe 3H41A 5KYYB 3OW2A 1YI2A 5L8RE 1KHCA 4M77F 4DBFA 4PJMA 2JOYA 3JCMW 1NBEB 4JRPA 2PVGB 1H641 3VS0A 2PUOB 2LRQA 4M7AF 2EYZA 6AT1B 1AHJB 4J9EA 4BE2A 3NMZC 1I5LA 2GGRA 4FYYB 2CUBA 1KQSA 2F2WA 4LDYA 3CCST 2A08A 7AT1B 1QWFA 2LCCA 1WGSA 2M0YA 2JS2A 2O9SA 3FIFA 4JLGA 2HD0A 3QPHA 2M0OA 4BB7A 3L2RA 2EJGA 1C1AA 4Y92A 2QQAA 4M75D 1K8AU 4RTVA 3QJ6A 4MZMA 1W2BA 5HCKA 2L3PA 3U23A 1K8AC 1KD1C 1MGQA 4JJDA 4XTXA 1R0BG 3OS2A 3L42A 1TSFA 1U5SA 3GNFB 1RLPC 1Q81C 4R0KA 4AT1B 1GCPA 2XHCA 4C5GA 3FEOA 2WSEE 1G3SA 2PVDB 4LD6A 3D7SB 4BE0A 5I22A 3PMIA 1W1FA 4F7UB 4QVZA 5LJ3g 4JS4A 4KH1B 5IN1A 3OYHA 3JB9D 2MOXA 3OMCA 1X43A 2ED0A 4YTLA 2RQVA 3FB9A 3CCJT 1YITQ 4DEXA 2QA4Q 4C8QE 3OYDA 1ZUKA 3DB4A 1J3TA 2PU9B 2ZCFB 5GAOq 5GAOp 2DLPA 4MDXA 1RABB 4IUVA 3TQ7P 2YRDA 4E7LA 2QEXQ 2G6FX 4M75F 1OU8A 2V8KA 4O5VA 2GNCA 1VQ4A 1SHGA 2K5IA 1WHHA 3M58A 4OB1B 4Y28E 1KHIA 2JUFA 2PZ1A 4AG2C 1W70A 1YN8A 5FROA 2WACA 3CCRA 2RPNA 2MIOA 1VQOQ 2GQVA 2PNIA 1AZGB 4NL3A 3CCUQ 2Y4YA 1ZQ1A 2VC8A 2HDAA 4HXJA 1UJ0A 2RHUA 1K9AA 2AZSA 3A8MB 4GY5A 1Q81R 3TU4K 3C94A 3RNJA 1M90U 3E9FA 3CC4T 4BI4A 1FXXA 3NFCA 1EIFA 1UHCA 4F7UE 3UPUA 1K8AR 2RK1A 1HXDA 3I56A 3H8ZA 2LQKA 3OYKA 3CC2A 1MMNA 2RM4A 1PG5B 2LNHB 1EX4A 1G8XA 2YSQA 5GAOm 2EYWA 2XD0A 5IHKA 1PM3A 3I55Q 2VV5A 3A8LB 1G3WA 3QYHB 1K9MC 5GJVB 2VXFA 3T9NA 3CC4Q 4NOYA 1VOMA 1VQ8Q 3OYMA 4L6V5 3R6NA 4FCYA 2DILA 2K2VA 4ZGJB 4PJOG 5DM7R 3HRTA 1WYXA 4DEYA 2BUDA 4RUGA 1W4SA 1FMWA 2WSCE 5GAN3 2DZ9A 3MPUB 2CSQA 3OYBA 3V7CA 3OYLA 4DOVA 4RTTA 1GL5A 1N27A 1PCXA 3UA6A 2F2VA 4M78B 5LJ5h 4M77G 3M0QA 3OYJA 5GAN2 2KAFA 2KGTA 5KYWB 1BK2A 3L1AA 1YJNT 4M77B 5KYUA 2QASA 3VUZA 1QVGS 2A28A 5KYYA 2GFAA 2EQUA 4R55A 1JU5C 2ZPFB 2DNUA 4PL6A 4F7UF 2KI7A 2ED1A 2KT8A 2J06A 2DE0X 5GAN5 3BE3A 3JAME 1IO6A 4PJOA 1LPLA 3OA6A 2O01E 2YDLA 2EQIA 2KY9A 1LVKA 2HL3A 4QKUA 1H8KA 1D1BA 1VQMQ 1LOJA 2L2PA 3KFVA 4E2FB 1Q82R 4J7IA 4XTYA 1K0XA 4PLLA 2LDMA 3CCVT 3OSVA 1VQ4Q 1YBYA 4E7ZA 1GBQA 3EHQA 2MMPA 2VB6A 2DVEA 1NE8A 2E6ZA 1M90R 3LX7A 4F7UG 4ANJA 3L2ZA 1FMVA 3CC2T 4M75A 2ECZA 2RA2A 2ZPBB 1KQ2A 4A63B 2F2XA 2BZ8A 1WJRA 2DXTA 3P8BB 4N0AA 3EG3A 2YXYA 1QCNA 2GTOA 3M59A 2DL3A 5DLOA 2RQUA 1QP2A 1AZEA 1NLOC 2L3QA 2DBKA 3VS2A 1YJ9T 4C0FA 2ABLA 1B07A 2EGEA 1YNZA 1YWOA 2MYSA 2FZGB 2HQEA 3CBPA 4PJOE 2FHDA 3ZL7C 2XI9A 2HZYA 1YJNQ 2YUPA 2ESWA 4BI8B 3QO3A 3VS3A 1BI2A 4F16A 3ULRB 1N8RC 4A4EA 5C0MA 4ATOA 2SRCA 4M7DB 4MZTA 3UA7A 5LJ3h 3AHUA 1AWJA 2YLCA 2EGAA 1VQ9T 4M7DG 1WHKA 3GP8A 1G3YA 4F17A 2COYA 4N4IA 3VKIA 4BI3A 2JNGA 3EG2A 1EZZB 3JB9G 1UGSB 3CCLQ 5A0DA 1BIBA 3UDCA 2ZAEA 2L0AA 2W10A 3C0CA 1I8FA 1N9SA 4LXCA 4HCBA 3PVQA 3JB9H 2JN0A 4J9CA 5GANg 1XOVA 1WHMA 1TXQA 4D8KA 4FYWB 3CCMQ 1M1KC 1SPKA 4XQ3A 4M4ZA 3FC3A 5KYXB 1VQKT 2QA4A 2K3BA 2LMJA 5IT9E 2DEQA 5GAMf 1VA7A 3CCQQ 1YHQQ 1ABOA 1X6GA 3CBOA 2V8JA 2X51A 1N8RR 2M02A 3CCLA 1ZSGA 4KGVB 1MMAA 1NYFA 5D6XA 2EKHA 4C8QC 3CCET 4IURA 4OB0B 1M30A 3HRUA 2K79A 3VJPA 1JBMA 4PJOC 4IIOA 5A2QE 1N6AA 2KT1A 2RK2A 3H9NA 2LQWA 3G1JA 4OGEA 1E6HA 1HSQA 3CCVQ 1GRIA 1K4US 3EGXA 4J6XA 2AKLA 2V26A 2R57A 1EFNA 5GAN6 1OPKA 4ESRA 4BUGA 3TEEA 1ZA1B 4HT9A 2DKGA 2PUKB 2HL5C 4BACA 1AVZC 3VRZA 1Q7YU 3JCMQ 1JQQA 2DMOA 1R0CB 3G4ST 1VQNT 5CCAA 4M75E 4PFZA 3VS5A 2O9VA 1IGUA 4CRIA 2X4XA 2P4TA 3SD4A 5HY6A 3I56T 4FYXB 3M54A 2KXDA 2CZ0B 3I55T 1BYMA 1QCFA 4BY6B 3J81E 2V8IA 4FT2A 1WHLA 4N0AC 3J80E 1UTIA 2ATCB 2QQ9A 2DL7A 3X24B 4VUBA 5IAYA 3VYHB 2D0NA 2EYQA 4XU2A 3CCUT 1M90C 2KK4A 5GANd 3NHNA 3JCMc 4RCCA 2GQIA 4JZ3A 3JCMd 4RTWA 2NUPA 1W2BP 1M8VA 4NL2A 4M77D 1U1SA 2YRCA 3CC7A 2DBMA 1KQSS 4IUPA 2J6FA 1M2VA 2YUNA 5I2MA 1YJWA 1SHFA 2XICA 5L23A 2BZXA 2FZKB 1SEMA 3EGDA 3CCSA 3G4SA 3EGUA 1VQ6T 4WF2A 5LJ3f 3L2UA 1YJWT 2X4JA 3CC4A 3GF5A 3CCJQ 1YJNA 2FZCB 4DA4A 2DAQA 3M0PA 4HCKA 2VUBA 1GFCA 1M3AA 3QG1A 3JB9J 4FT4A 4DQ2A 1PSEA 2JVVA 1OX8A 2M9UA 2GBQA 4FYVB 4JJBA 3JCMV 2QQBA 2O88A 1NPRA 2CP2A 1QWEA 3GOXA 3CD6A 2LP5A 4JRQA 3EAEA 1S72T 4HVUA 3DB3A 3LWHA 4OVAA 1NPPA 4ZGEB 5GANe 3JCMg 3JCMe 3DKMA 1PWTA 3X28B 4E7IA 3QHSA 3JCMh 3CCLT 2NUZA 2P0QA 3LH0A 3JB9F 2MF2A 1TH7A 4O6JA 3V8JA 1RACB 3CCUA 3CPFA 2OTJQ 2KXCA 4LUEA 2CP0A 1I81A 2DERA 4QQ6A 4HKEA 1NEGA 3GIBA 4CC4B 3PMTA 1JXMA 1JJ2P 4F7UA 3THKA 1G83A 3CD6Q 4DBRA 1TUCA 2LTOA 3V8KA 1ZSZB 2FVUA 2DL5A 4E7HA 2A3LA 2CP3A 2K3YA 1QW1A 5CO7A 1VQ5T 1XJWB 2CH4A 1UHFA 1OPLA 4CC7A 2DEUA 2D8JA 4PFOA 1D1AA 2FEIA 1QQJA 1WQ7A 2DFUA 3LYIA 1YIJQ 3HSBA 3NTIA 3OB9A 1YJ9A 4J83A 4M78A 3CPWS 3UF4A 2MWOA 3I56Q 1KFZA 2C06A 1Q81U 4M7AB 2BE9B 1OZ3A 1X2QA 1M1FA 4UC4A 2XKOC 1NEBA 3M56A 3OS0A 1UGRB 2E41A 5A0GA 2YUQA 4OP0A 3CMAQ 3GBQA 2I2LA 2E1HA 2BE7D 3GLXA 5M9OA 4EMHA 2HCKA 1V29B 4FSSA 2MPXC 3S3MA 3CMAA 1ZBJA 4QVDA 4KUIA 2V1RA 2WSFE 2KNBB 3R6OA 4X34A 4XTVA 4C5IA 2VASA 3I35A 3OYIA 1BB9A 3CCRT 4ELYC 3MKDA 1OV3A 4C5HA 4KGZB 2HSEB 2CZ1B 2K4YA 1YITA 2FYKA 2HKQB 3SHWA 2YT6A 2DTOA 2KBTA 5IHIA 5CKBA 1FMKA 1M2OA 4CC2A 1K0SA 1NLPC 3CCMT 1X6OA 1JJ2S 3DLMA 2G3RA 2K5LA 1VQ7Q 2MI6A 2QTXA 4JS5A 2AIRB 3VS1A 2D0QB 3P8DA 3G6EA 3HFOA 4JRIA 1AD5A 5LJ3d 2J7IA 1WI7A 3RERA 2VXEA 4FIBA 3Q1JA 3RMQA 4PFPA 5GAOn 3JB9I 2A36A 1VQOT 2DTIA 1NG2A 2KEAA 1RAAB 4X9DA 2KROA 2CGHA 5KYWA 2E64A 4M7DA 3CCRQ 5KE3A 1ZX6A 2EKOA 2ROTA 2R5AA 1MNEA 2FG0A 5GAN4 4OMFB 1KIKA 4IKFA 2NYSA 2M51A 3HPWA 2HBPA 1OU9A 5CKFA 3O5ZA 1CKAA 2DJZA 3KBGA 2LCLA 3CMET 2Y4XA 1S1NA 4FU6A 3G71T 1VQPA 1VQKQ 5CKHA 1D1CA 2COZA 4KBMB 2HKNA 1VIFA 3VS6A 1V76A 2QI2A 1TUGB 3CC7Q 3J7AF 4EMGA 2JM9A 4PJLA 2XK0A 2QA4T 3HTRA 1ZA2B 1C6VX 3C95A 5FU6B 1IB8A 4OF1A 2MK5A 4P5NA 2MAMA 1VQ8A 3MO8A 2L8DA 4C92E 4C92B 1VUBA 2DJQA 2KRNA 4LD9K 4M7DC 1G3TA 5C6SA 5FLXE 4M7AC 4JZ4A 2QEXT 2SEMA 2D8HA 3NTKA 1PHTA 4K11A 1T0JA 3M9QA 3CXCA 4OGCA 3MEVA 1VQMT 2K3XA 1TS9A 4BDYA 3EH2A 4WTOB 4CI0C 1AT1B 1SRMA 3CCSQ 4C92F 1NYGA 3LGLA 1E6GA 4LDUA 5AYFA 3X20B 2RI3A 3BW1A 4OMNA 4CC3A 4AG1C 5IXBA 2EYXA 5CAIA 1PNJA 2GCXA 3OYEA 3QDRB 2M1HA 4C0ZA 4GLKA 1WJQA 3QZ9B 2C0OA 1M27C 2FO0A 2RJEA 1SKUB 3QKJA 2F5KA 2RI5A 3CMEA 2K5FA 3DLLA 2YUOA 3G6ET 4OMPA 2XIDA 4C92A 1G5VA 2X4YA 1S72Q 2DF6A 5KE2A 1RAHB 2RQRA 4QT7A 8AT1B 5KCOA 4PJOD 3CXCS 1NJIC 5IXFA 1BI0A 1YFNA 1FWZA 1Z9ZA 2JTMA 2DTHA 1VQ7A 1WA7A 3CC2Q 3S3OA 1WPYA 5GAMh 2DRMA 5FW9A 1HYOA 1N8RU 2IVWA 5GMKm 5DLQE 5GAMe 5GAMg 1BCOA 1VQ4T 1VQPQ 1WIEA 4RTYA 4C92D 2IPOB 1VIEA 4M78G 3V7SA 4LDWA 3SDZA 2LQ8A 3CCEQ 2CSIA 1I5OB 4M75C 2KRSA 4J9IA 5LL6S 3H6ZA 2OTLQ 3QZ5B 2RH2A 3SEMA 1XQHA 3SFMA 1D3BA 2OTLT 4M7DE 4L5GA 4II1A 3OS5A 1W2BS 5CIUA 2PTKA 1ZUUA 2JT4A 3G71Q 1PRMC 2L3SA 1BU1A 3META 1KQSP 4M77C 3INZA 4HT8A 2VYTA 3JCMX 2I0NA 2L89A 2YLBA 2KRMA 2L3RA 4JJNK 1BI3A 3ER0A 1OOTA 1RAFB 1X6BA 3KUFA 2X4WA 1Y71A 1GCQC 2O4XB 3CC7T 4LE9A 2RD1A 1TWBA 3M0TA 1T3SA 1BBZA 4DBQA 2CS7A 2JM8A 5GAMd 5FRMA 1C0MA 1Q86R 2RO0A 5HK0A 2VGMA 4MMKA 1VQ6A 3JCMJ 4JRKA 5CQXA 3WXMB 5FU7C 3OY9A 3CMEQ 2YRVA 2JTEA 3FJ5A 3CXCP 1UB4A 1IREB 4ZNXA 1AWOA 1GFDA 2L5QA 1ZSZC 3RKWA 1WX6A 2A0FB 2AHJB 3QWXX 4ZTFA 1UE9A 3MEUA 4PJNA 4BE1A 1VQLA 4ZGDB 9ATCB 5GAMj 5CR2A 3EGXB 3OYFA 1LJOA 2HQXA 3VU3C 1Q7YC 3OW2S 2X3WD 2E3HA 3FLGA 1PSFA 3CCVA 1OI1A 1RADB 2BTTA 2OTJA 2EWNA 4DBHA 5GANh 1M5Q1 1N9RA 3ME9A 1Y57A 2E70A 1Y7XA 3AT1B 1T3LA 4C0GA 3PT9A 1QCOA 1RI9A 1YP5A 3JRZA 3RUXA 1NJIU 4AFZC 1WHJA 1Q82C 2EYYA 2V1QA 2JTFA 4A4KA 1WFWA 3IQLA 3OBYA 2HNIA 1PKTA 5GAOr 1QVPA 1U8RA 1M9SA 2EQMA 2DX1A 1R8OB 5I11A 3MEWA 2B8AA 4BDZA 1UDLA 4GLMA 3JCMf 1WXBA 2P0PA 3QIIA 5ECAA 4C0DB 4OMQA 3CPWP 2ZGWA 1P92A 2QQRA 1ABQA 2P0KA 3F70A 3HFNA 2M16A 2QGGA 4M7AE 1FX7A 1YIJA 4JJCA 2E3IA 4OB3B 4EIKA 2LZ6B 2IIMA 3FDRA 1WQWA 1ACMB 1M1GA 2DK3A 2E4HA 2QXFA 3SWNA 4QW2A 3ASKA 2DXBA 2DD5A 4E7SA 2EGCA 1LCKA 1QVFS 5FWCA 2RJDA 3OYAA 2JS0A 1Y96B 4M75G 2CKKA 4D6WA 1U1TA 2HBWA 4C8QA 2DA9A 4EMKA 3QWYA 4EDUA 2DL4A 1K9MR 1KC8U 1Q7YR 4BY6C 1KSWA 3G4SQ 1OYXA 3QUIA 3MJXA 3MHXA 2FRWA 1LNXA 3N5BB 1QP3A 1SSFA 2DETA 4QQDA 4IUTA 4PKCC 3M4GA 1GCQA 3CPWA 4QVCA 2K57A 1TG0A 2DXUA 2K2MA 3OBWA 3GNGA 2DIQA 1Z9QA 5GJWB 1NJIR 4J9BA 3SB2A 4WCIA 3C4SA 1ZUYA 3PFSA 1PRLC 1WJSA 2ZPIB 4RMOA 3EFRA 1VQ7T 2BIVA 2W0ZA 4QQGA 1SRLA 2XU8A 4KH0B 1S72A 2B86A 2IG0A 4C8QG 1YWPA 1RAEB 1ZSZA 2VGNA 4OMMA 1Q95G 5FU7B 1MV3A 2E12A 1QLYA 4C8QB 2J6OA 4A54A 2EFIA 2KYMA 4J9DA 2OTJT 2R58A 2XDDA 2OJ2A 4XAXB 1AEYA 1TU0B 3FJPA 2RMOA 2RNAA 3OYNA 4HA8A 2JMCA 4MZPA 2CT4A 2PQWA 2NUTB 2P4RA 3M0RA 3S3NA 4B6MA 2KVQG 1MMDA 3I5RA 1I4K1 5LJ5f 1IZ6A 1K1ZA 3RDVA 5GMKl 3CCQT 1YHQT 2KDSA 2EQJA 1IHVA 1WNLA 5CK9A 2AKKA 4Q5WA 3VUBA 2QGFB 3M4YA 1MNDA 1K9MU 4N4GA 4XK8E 3C12A 4N4HA 2E6NA 4RTXA 3LH5A 3QDFA 1PKSA 1K73C 1QVFA 3BFMA 3SWNC 4ZTJA 3VS4A 3GPLA 3G71A 3CCEA 4V2SA 3L2WA 2EPDA 3E9GA 4Y91A 4IIMA 1PD1A 3I55A 2PVOB 4M78C 4M78D 3A8GB 1KD1R 2NUTA 1JEGA 1NM7A 2DL8A 2CP7A 2XMFA 4M75B 2LCSA 1ZLMA 2HEQA 1M3BA 2EJ9A 1QVGA 1Y07A 1VQNQ 3EFOA 1UGQB 1VQLT 4HVVA 5IHNA 3UT1A 1KQ1A 3KXTA 1JJ2A 4J5YA 2JZ2A 1D0ZA 1TUDA 2JJ9A 4LDVA 3TSWA 4EMKC 8ATCB 5KYNA 2DYIA 1JO8A 4C8QF 2KSSA 2CREA 2H3JA 5FRNA 4M7DF 4KRTA 2LC4A 4JDSA 4F04B 1HJDA 3CCJA 3WVDB 1RAIB 3HP9A 4E7KA 1M8MA 1CSKA 3QBYA 3RKYA 5D6WA 2RQTA 3A8HB 2MWPA 3MCAB 1IXDA 4BD3A 2ZPHB 3M57A 3SWNB 4J8OA 1HK9A 3X26B 3L2VA 1R77A 1VYUA 1D3BB 5EC7A 2CP6A 1KC8C 4FW1A 4PLIA 4RG8A 3S6WA 2QAZA 3M5AA 1OULA 3CCMA 3PNWC 4XU3A 2QDLA 2CUDA 4L59A 4B9XA 4M7AD 4ME7A 2EIFA 1YI2T 1Y0MA 3EGDB 1YI2Q 2R5MA 3E1SA 4PJOF 3E2UA 4ORZA 1RUWA 5HK3A 4C8QD 4IUUA 1VQ9Q 3OSSC 3EG9B 3BDUA 4M7DD 2H8HA 4AMCA 1WDXA 2MCNA 2YWWA 3EH1A 3PVLA 1WLPB 2DPPB 1UECA 2VVKA 3REBB 1WXTA 3I5SA 1AWXA 4M77E 3PIPA 1I07A 3MEAA 2QQSA 4FM4B 1G2BA 4X1VA 5EG2A 2GF7A 3JSCA 4NS5A 3X25B 1I1JA 1MHNA 5I2SA 2FB7A 3M55A 1X27A 4Z02A 4FW2A 2RB6A 1YJ9Q 3TREA 1BI1A 1MUZA 1OQKA 2EW3A 2FPFA 4RCBA 3LWIA 2JMAA 1RAGB 5FWBA 4LN2A 2KYBA 1AWWA 1VQ8T 1B34B 1TTHB 1B3QA 1DJ7B 2ZPGB 3ZEHA 1D09B 5J39A 2D1XA 3EG9A 4A53A 3PIOA 2KQWA 4LUDA 2QYZA 2ZZDA 2A37A 4FL6A 1IHWA 5LJ3j 1K76A 5A0LA 5KCHA 2DXCA 2AK5A 3EFSA 3OYGA 3M0UA 4AFSC 2LT1A 2COWA 1QKXA 1SSHA 4HCZA 3OW2P 2HSPA 1WXUA 2LJ0A 3JCMP 5GAOl 4C92C 3H0FA 2DYBA 4JLIA 2QEXA 1SG5A 3UATA 2RI2A 2O4XA 2LNVA 3MP1A 2O2OA 2QK0A 2RJCA 4M7AA 4J9HA 2EAYA 3EG0A 1SF9A 3RESA 4M78E 3EFOB 2ROLA 3RKXA 2DO3A 4D8DA 1JXOA 1WZOA 2EQKA 1QMCA 2OAWA 1K73U 2LQNA 3E19A 1YCYA 2FPDA 2CP5A 1O75A 3RMSA 5GAN8 4MDWA 4A4HA 3MP8A 1RLQC 3V7RA 2VKNA 4RKUE 4C92G 4C5EA 2EVRA 1AOJA 2Z0WA 3TSZA 3LGFA 1VYTA 2FRYA 1IGQA 5LJ5e 1WHGA 5LJ5g 4LNPA 1KD1U 2ENMA 2CH4W 1VQPT 1VQ5A 1VQKA 4PNOA 3CEYA 3LLRA 5D6YA 3OQ5A 2QTVA 2C0TA 2BZYA 2BKDN 2K9GA 1U3OA 2KE9A 3JV3A 2RN8A 1BKBA 1VQ5Q 1UGVA 5LJ3e 4Z8AA 4XTWA 1QVFP 1X2KA 3BY7A 4AFQC 1KK7A 3NPFA 4J7FA 5D7UA 3LW5E 1TOVA 3QSUA 2GFUA 4X9CA 3M53A 1M4ZA 5GANj 4OB2B 3M0SA 3G6EQ 4MMLA 3L2QA 5CKDA 1UEBA 1H3ZA 1W6XA 3PE0A 1UJYA 1GXIE 4HCCA 3REAB 5I21A 1B7TA 1U06A 2FL7A
chains in the Genus database with same CATH topology
2KAFA 4C5HA 4KUDK 3M4GA 2CZ1B 3CPWA 4QVCA 2K4YA 1YJNT 3L1AA 1YITA 2E65A 4M77B 1Q86C 2D9TA 1RL2A 2DXUA 2FYKA 2K57A 3OBWA 4RG2A 5CQYA 3VUZA 5GANf 1QVGS 3GNGA 3VV0A 2DIQA 5LJ5d 2DTOA 2GFAA 2LX9A 5J3BA 2EQUA 4KT0E 4R55A 2LVMA 5CKBA 2ZPFB 4PL6A 1X75C 3SB2A 3C4SA 4F7UF 3CCMT 1X6OA 3PFSA 1RI0A 4RMOA 1WJSA 2ZPIB 2XG8D 3DLMA 2G3RA 3EFRA 5GAN5 3JAME 1JJ2S 1VQ7T 2BIVA 2K5LA 2MI6A 2QTXA 4JS5A 4PJOA 4QQGA 4ZN1A 3V8LA 3OA6A 2D0QB 2XU8A 3P8DA 3G6EA 2O01E 1Y96A 3HFOA 1S72A 2IG0A 2KY9A 4JRIA 5LJ3d 4C8QG 4M7AG 1VQOA 4TVRA 1LOJA 2VGNA 5FU7B 2E12A 3RIRA 1YIJT 3RERA 2VXEA 4C8QB 4A54A 2EFIA 4J7IA 2ZPEB 5LJ5j 2OTJT 4FIBA 2R58A 4XTYA 2XDDA 4PLLA 3Q1JA 4XAXB 2LDMA 3A8OB 3CCVT 3OSVA 1YBYA 3OYYA 3FJPA 3RMQA 2MMPA 1ZHIA 2DVEA 5GAOn 3JB9I 1VQOT 3QYGB 4R56A 1NE8A 3OYNA 2DTIA 2E6ZA 2HAXA 4HA8A 3LX7A 4X9DA 4F7UG 4MZPA 2CGHA 3L2ZA 2PQWA 3MP6A 4M77A 1B34A 2E64A 3CC2T 3CD6T 3S3NA 4M75A 4M7DA 2KVQG 2X35A 5KE3A 2QDYB 2RA2A 2EKOA 2ZPBB 2R5AA 1I4K1 1KQ2A 5LJ5f 4E47A 1Q82U 1IZ6A 5GAN4 1WJRA 1XTDA 2DXTA 3P8BB 4N0AA 4OMFB 5GMKl 4IKFA 3CCQT 2DD4A 5GMKi 1YHQT 1VQ9A 2DZCA 2KDSA 2RJFA 3HPWA 2EQJA 1WNLA 2RHYA 1OZ2A 5CK9A 2HBPA 3M59A 5CVIA 4Q5WA 3VUBA 5CKFA 4A4GA 2XDBA 2DJZA 3G7ZA 2A7YA 3M4YA 5DLOA 1QP2A 1K9MU 4N4GA 3KBGA 2LT4A 2NLUA 3C12A 4XK8E 4XTZA 2LCLA 4N4HA 3UWNA 4FSXA 3CMET 2OTLA 4DOWA 2Y4XA 1YJ9T 2E6NA 4C0FA 2CYZB 4FU6A 3G71T 4A4FA 2OAUA 1VQPA 2D6FA 4EMKB 2HQEA 3CBPA 4PJOE 1K73C 2FHDA 5CKHA 3BFMA 4KULA 1QVFA 2XI9A 2Y90A 1VIFA 4KBMB 3SWNC 4ZTJA 2RHXA 4EPCA 3GPLA 3G71A 3CCEA 2QI2A 4V2SA 1X01A 3L2WA 3E9GA 4Y91A 3OYCA 4BI8B 3QO3A 1KG1A 1BI2A 3J7AF 4EMGA 3I55A 1N8RC 3HRSA 1M1KU 2XK0A 2PVOB 4M78C 4M78D 4A4EA 3HHTB 5C0MA 3OS1A 3A8GB 2QA4T 4ATOA 2DIGA 4M7DB 4MZTA 3C95A 5FU6B 5LJ3h 4J6WA 3AHUA 2YLCA 4M75B 4OF1A 4P5NA 1VQ9T 2EJ9A 4M7DG 1QVGA 2MAMA 3GP8A 1VQ8A 1G3YA 3MO8A 5GMKj 1Y07A 4LDXA 2L8DA 4C92E 4C92B 4ELZC 1VUBA 4N4IA 2KMTA 3VKIA 4BI3A 1UGQB 2JNGA 1VQLT 4LD9K 4M7DC 1G3TA 5C6SA 3JB9G 2E10A 5FLXE 4M7AC 1UGSB 2QEXT 3BDLA 3JCMb 2YHTA 3UT1A 5A0DA 1VQNA 2E5QA 4PJOB 2F69A 3NTKA 1KQ1A 3ZFJA 1BIBA 3UDCA 2EJFA 3M9QA 3CMAT 4M78F 3HKSA 3KXTA 4OGCA 3MEVA 3CXCA 2RHZA 1VQMT 2K3XA 4BDYA 5CKEA 1JJ2A 1I8FA 4CI0C 4J5YA 2JZ2A 1N9SA 1XNIA 4XU1A 4ZN3A 5DY9A 4C92F 4HCBA 3JB9H 4LDVA 4EMKC 4E7JA 2JN0A 3LGLA 3ZBDA 2XDPA 4LDUA 5AYFA 2RHIA 3X20B 5GANg 2RI3A 1XOVA 2KSSA 4C8QF 3VYGA 3BW1A 2H3JA 5FRNA 4M7DF 3CCQA 1YHQA 1M1KC 3FRNA 4XQ3A 2LC4A 4JDSA 3FC3A 1YITT 5CAIA 2GCXA 2F5TX 3WVDB 3CCJA 2QA4A 1NZ9A 4XTUA 3OYEA 1VQKT 3QDRB 2M1HA 5IT9E 3HP9A 4B9WA 4E7KA 2DEQA 1JRIA 4GLKA 4C0ZA 5GAMf 1WJQA 3QZ9B 3QBYA 5FU6C 3RKYA 5J26A 2RJEA 3QKJA 2F5KA 2RI5A 3CMEA 3CBOA 2V8JA 5D6WA 2K5FA 3A8HB 2MWPA 3MCAB 3CCLA 3DLLA 1O9SA 5GAN7 3G6ET 4BD3A 4J6YA 3CBMA 2CZ6B 2XIDA 2ZPHB 3TCJA 4C92A 2X4YA 1G5VA 5KE2A 3M57A 5D6XA 3URGA 4C8QC 5HKCA 3CCET 3SWNB 4J8OA 4IURA 1HK9A 4OB0B 1ZBXA 3HRUA 1VQMA 3VJPA 3X26B 5KCOA 1JBMA 3QXEB 3L2VA 3A5ZB 4PJOC 4XU0A 1D3BB 5A2QE 3CXCS 4PJOD 1N6AA 2RK2A 3HL8A 1NJIC 3P8HA 3O8VA 1KC8C 1BI0A 5GMKh 4PLIA 4RG8A 3S6WA 4OGEA 1FWZA 2JTMA 2DTHA 1VQ7A 3M5AA 3S3OA 3WVEB 3PTAA 4J6XA 3CCMA 3PNWC 4XU3A 1WPYA 3QJYA 3OMGA 2R57A 5GAN6 5GAMh 4L59A 4B9XA 1BIAA 4M7AD 4BUGA 4ME7A 3NTHA 1N8RU 2EIFA 2IVWA 5GMKm 5DLQE 3TEEA 3PGGA 5GAMe 4IUQA 5GAMg 1VQ4T 1JB0E 4JUVA 4C0DC 1YI2T 2DKGA 1Q86U 4HT9A 2PUKB 4BACA 2CZ7B 2R5MA 3E1SA 1Q7YU 4C92D 3JCMQ 1UGPB 4PJOF 3G4ST 1VIEA 5KH6A 4M78G 5GMKe 1VQNT 5CCAA 4M75E 4CRIA 5HK3A 4C8QD 2X4XA 4IUUA 2P4TA 3V7SA 3OW2A 1YI2A 4LDWA 3SDZA 2LQ8A 5L8RE 3OSSC 5HY6A 3SD4A 4M75C 3I56T 1KHCA 3M54A 3BDUA 4M7DD 4M77F 2JOYA 2CZ0B 3JCMW 3I55T 4JRPA 1BYMA 5LL6S 2PVGB 1H641 3H6ZA 4BY6B 2DPPB 2PUOB 2LRQA 2V8IA 3QZ5B 3J81E 2RH2A 4FT2A 4M7AF 4N0AC 3J80E 1AHJB 4BE2A 1XQHA 3SFMA 2QQ9A 1I5LA 3X24B 1D3BA 4VUBA 2OTLT 4M77E 4M7DE 3PIPA 4L5GA 5IAYA 3VYHB 3MEAA 1KQSA 4LDYA 2QQSA 4FM4B 4II1A 5EG2A 3CCST 2GF7A 3OS5A 2EYQA 4XU2A 3CCUT 1M90C 3JSCA 4NS5A 3X25B 1W2BS 5CIUA 2KK4A 2LCCA 1WGSA 5GANd 1MHNA 3JCMc 4RCCA 3FIFA 4JLGA 2HD0A 2FB7A 5I2SA 3JCMd 3M55A 3QPHA 2M0OA 3META 4BB7A 4Z02A 3L2RA 4NL2A 4M77D 1M8VA 4M77C 2EJGA 2RB6A 3INZA 3TREA 1U1SA 4HT8A 1BI1A 3CC7A 1KQSS 2QQAA 4M75D 1K8AU 2VYTA 4IUPA 3JCMX 2L89A 2YLBA 3LWIA 4RCBA 5I2MA 2L3RA 3QJ6A 4MZMA 4JJNK 1BI3A 3ER0A 2XICA 1YJWA 1W2BA 3KUFA 2X4WA 3CCSA 1Y71A 1K8AC 1MGQA 2O4XB 3G4SA 1KD1C 2RD1A 3CC7T 1VQ8T 1B34B 1VQ6T 4XTXA 4WF2A 5LJ3f 3OS2A 3L42A 3L2UA 5GAMd 2CS7A 1DJ7B 5FRMA 1YJWT 2X4JA 3GNFB 3CC4A 3GF5A 2ZPGB 3ZEHA 1Q81C 5J39A 2RO0A 1YJNA 5HK0A 4DA4A 2VGMA 4MMKA 1VQ6A 4A53A 2DAQA 3JCMJ 2XHCA 4JRKA 5CQXA 3WXMB 2VUBA 5FU7C 4C5GA 3OY9A 3PIOA 3FEOA 2KQWA 2WSEE 2YRVA 3QG1A 3JB9J 1G3SA 4FT4A 2PVDB 4DQ2A 4LD6A 1PSEA 2JVVA 1UB4A 1IREB 2M9UA 4BE0A 3PMIA 2ZZDA 4FL6A 4F7UB 2L5QA 5LJ3j 3JCMV 4QVZA 3RKWA 5LJ3g 4JS4A 5A0LA 2QQBA 5IN1A 5KCHA 2DXCA 2AHJB 3EFSA 3OYHA 1NPRA 3OYGA 3OMCA 3JB9D 4ZTFA 2LT1A 3MEUA 4BE1A 3GOXA 1VQLA 4ZGDB 3CD6A 5GAMj 5CR2A 4JRQA 3EAEA 4HCZA 4YTLA 1S72T 3OYFA 3JCMP 1LJOA 3FB9A 3CCJT 3DB3A 3LWHA 5GAOl 2HQXA 4OVAA 3VU3C 4C92C 3OW2S 1NPPA 4ZGEB 1Q7YC 4JLIA 2QEXA 4C8QE 5GANe 3OYDA 3DB4A 2PU9B 2ZCFB 3JCMg 2RI2A 3FLGA 3JCMe 3DKMA 5GAOp 5GAOq 1PSFA 3CCVA 4MDXA 2O4XA 3X28B 4E7IA 2LNVA 4IUVA 1OI1A 3QHSA 2OTJA 2EWNA 3JCMh 4E7LA 3CCLT 3MP1A 5GANh 2RJCA 1M5Q1 1N9RA 3ME9A 2V8KA 4M75F 2E70A 1Y7XA 2P0QA 3LH0A 4O5VA 4M7AA 1VQ4A 3JB9F 2EAYA 4C0GA 2MF2A 1TH7A 4O6JA 3V8JA 2K5IA 3PT9A 3CPFA 3CCUA 3M58A 3RESA 4OB1B 4Y28E 3JRZA 1KHIA 3RUXA 2JUFA 1NJIU 1I81A 5FROA 4QQ6A 2WACA 4M78E 4HKEA 3CCRA 3GIBA 1Q82C 2GQVA 4NL3A 2JTFA 3RKXA 2DO3A 2Y4YA 4A4KA 1ZQ1A 3PMTA 2VC8A 3OBYA 2HNIA 2EQKA 4F7UA 5GAOr 1QVPA 2RHUA 1U8RA 1M9SA 2EQMA 1K73U 2LTOA 1YCYA 3E19A 3V8KA 3A8MB 2FVUA 4GY5A 3TU4K 1R8OB 3C94A 1M90U 3E9FA 4E7HA 3MEWA 3CC4T 2B8AA 4BI4A 2A3LA 4BDZA 1FXXA 1O75A 2K3YA 1QW1A 3NFCA 5CO7A 3RMSA 1EIFA 3JCMf 5GAN8 4MDWA 1VQ5T 4F7UE 2P0PA 3QIIA 4A4HA 3UPUA 3MP8A 2RK1A 3V7RA 4RKUE 4C92G 4C5EA 4C0DB 1HXDA 3I56A 1WQ7A 3LYIA 3H8ZA 3HSBA 2ZGWA 3NTIA 1P92A 3LGFA 3OB9A 2LQKA 1YJ9A 3OYKA 5LJ5e 3CC2A 4J83A 2QQRA 4M78A 5LJ5g 3CPWS 2P0KA 2RM4A 1KD1U 3F70A 2MWOA 3HFNA 2M16A 1VQPT 1VQ5A 1VQKA 4PNOA 4M7AE 3CEYA 1FX7A 1YIJA 3LLRA 4OB3B 5D6YA 3OQ5A 2C06A 1Q81U 4M7AB 3FDRA 5GAOm 2XD0A 1WQWA 1OZ3A 2BKDN 1M1GA 2DK3A 1M1FA 4UC4A 2VV5A 1BKBA 2QXFA 2XKOC 3A8LB 1G3WA 3QYHB 5LJ3e 3SWNA 1K9MC 4QW2A 3M56A 3OS0A 2VXFA 1UGRB 2DXBA 2E41A 3ASKA 4XTWA 3T9NA 5A0GA 4OP0A 2DD5A 3BY7A 4NOYA 2I2LA 2E1HA 4J7FA 3OYMA 4L6V5 3LW5E 1QVFS 2K2VA 4ZGJB 2RJDA 4PJOG 5DM7R 3GLXA 3OYAA 3HRTA 3QSUA 1Y96B 2GFUA 5M9OA 4M75G 4EMHA 2BUDA 4X9CA 2CKKA 1V29B 3M53A 4D6WA 1M4ZA 1U1TA 1W4SA 2WSCE 5GANj 5GAN3 4C8QA 4OB2B 4EMKA 3S3MA 3CMAA 2DZ9A 4QVDA 4MMLA 4EDUA 3L2QA 4KUIA 1KC8U 5CKDA 2WSFE 3OYBA 1UEBA 3V7CA 3OYLA 4DOVA 4BY6C 3R6OA 4X34A 1H3ZA 1N27A 1OYXA 4XTVA 4C5IA 3QUIA 3MHXA 1GXIE 1LNXA 3OYIA 3N5BB 4M78B 4HCCA 3CCRT 4ELYC 5I21A 5LJ5h 1QP3A 1SSFA 4M77G 3OYJA 4QQDA 4IUTA 5GAN2 4PKCC 2FL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FU7 B;  4BY6 B;  4C0G A;  4C0D C;  4C0D B;  4BY6 C;  5FU7 C;  5FU6 C;  5FU6 B;  4C0F A; 
#chains in the Genus database with same CATH topology
 4KUD K;  2F1L A;  1VQ6 Q;  2E65 A;  1Q86 C;  2D9T A;  1RL2 A;  4RG2 A;  2AZV A;  5CQY A;  5GAN f;  3VV0 A;  5LJ5 d;  2LX9 A;  5J3B A;  4KT0 E;  2LVM A;  1QVG P;  4J9F A;  1FYN A;  1X75 C;  1RI0 A;  3CQT A;  2XG8 D;  2DVJ A;  4ZN1 A;  3V8L A;  1Y96 A;  2H3E B;  1PC0 A;  4M7A G;  3A1P A;  3I9Q A;  1VQO A;  4TVR A;  1OX9 A;  2EBP A;  2VWF A;  4KGX B;  3RIR A;  1YIJ T;  1IRX A;  2J6K A;  2ZPE B;  5LJ5 j;  3TVT A;  1M1K R;  3A8O B;  2HQH A;  3OYY A;  4RTZ A;  1ZHI A;  3QYG B;  4R56 A;  2HAX A;  2LX7 A;  3MP6 A;  4M77 A;  5KYU B;  1B34 A;  2C0I A;  1A0N B;  1E7O A;  3CD6 T;  3RBB B;  2X35 A;  1VYV A;  2QDY B;  4E47 A;  1Q82 U;  2J05 A;  1XTD A;  1OEB A;  1D0X A;  2DD4 A;  5GMK i;  1VQ9 A;  1H92 A;  1MMG A;  2DZC A;  2RJF A;  1KJW A;  1UG1 A;  1OZ2 A;  2RHY A;  2JW4 A;  5CVI A;  4A4G A;  1M3C A;  2XDB A;  3G7Z A;  2A7Y A;  4F14 A;  2LT4 A;  2NLU A;  4XTZ A;  3UWN A;  4Z89 A;  1BCM A;  4FSX A;  2OTL A;  4DOW A;  2CYZ B;  2X9H A;  4A4F A;  2OAU A;  2D6F A;  4EMK B;  4JPB W;  2P84 A;  4KUL A;  2Y90 A;  2RHX A;  4EPC A;  1X01 A;  2OI3 A;  3OYC A;  1PD0 A;  1KG1 A;  3EG1 A;  3HRS A;  2GTJ A;  1M1K U;  3OS1 A;  5KYX A;  3HHT B;  2DIG A;  1YJW Q;  2OX7 A;  4J6W A;  2NWM A;  1D0Y A;  4OMO A;  1CKB A;  5GMK j;  4LDX A;  1GBR A;  4ELZ C;  2QG9 B;  2DRK A;  2AT1 B;  2KMT A;  1H3H A;  4PJJ A;  1VQL Q;  1UUE A;  2E10 A;  3BDL A;  1X69 A;  2FPE A;  1YCS B;  3JCM b;  2YHT A;  1VQN A;  4PJO B;  1F1B B;  2E5Q A;  5AT1 B;  2F69 A;  3ZFJ A;  4J9G A;  4Z88 A;  2EJF A;  3CMA T;  1UFF A;  3HKS A;  4M78 F;  3VS7 A;  2CDT A;  2RHZ A;  2KR3 A;  4OML A;  5CKE A;  3A98 A;  1T0H A;  1XNI A;  4XU1 A;  4ZN3 A;  5DY9 A;  4E7J A;  3ZBD A;  4RTU A;  2XDP A;  2RHI A;  3VYG A;  1HD3 A;  2K6D A;  3CCQ A;  1YHQ A;  3FRN A;  1ARK A;  1YIT T;  2F5T X;  2K7A A;  1MV0 B;  1NZ9 A;  4XTU A;  4B9W A;  1N5Z A;  2LJ3 A;  1JRI A;  5FU6 C;  2HMA A;  5J26 A;  3H0H A;  2DM1 A;  3RR6 A;  1O9S A;  1V1C A;  5GAN 7;  4J6Y A;  3CBM A;  2CZ6 B;  3TCJ A;  2CT3 A;  3URG A;  5HKC A;  1I0C A;  1ZBX A;  4GBQ A;  4AFU C;  1VQM A;  4PK4 A;  3H0I A;  1K73 R;  2RF0 A;  3QXE B;  3A5Z B;  1KC8 R;  4XU0 A;  3EHR A;  3HL8 A;  2O31 A;  3P8H A;  2JXB A;  3O8V A;  5GMK h;  4HVW A;  2LJ1 A;  3NGP A;  3WVE B;  3PTA A;  2NUP B;  3QJY A;  3OMG A;  5IH2 A;  1BIA A;  4E6R A;  3NTH A;  2X3X D;  3PGG A;  4IUQ A;  2E5K A;  2RQW A;  1M2V B;  1JB0 E;  4JUV A;  4C0D C;  1Q86 U;  2CZ7 B;  3VRY A;  1QKW A;  1UGP B;  5KH6 A;  5GMK e;  3H41 A;  5KYY B;  3OW2 A;  1YI2 A;  5L8R E;  1KHC A;  4M77 F;  4DBF A;  4PJM A;  2JOY A;  3JCM W;  1NBE B;  4JRP A;  2PVG B;  1H64 1;  3VS0 A;  2PUO B;  2LRQ A;  4M7A F;  2EYZ A;  6AT1 B;  1AHJ B;  4J9E A;  4BE2 A;  3NMZ C;  1I5L A;  2GGR A;  4FYY B;  2CUB A;  1KQS A;  2F2W A;  4LDY A;  3CCS T;  2A08 A;  7AT1 B;  1QWF A;  2LCC A;  1WGS A;  2M0Y A;  2JS2 A;  2O9S A;  3FIF A;  4JLG A;  2HD0 A;  3QPH A;  2M0O A;  4BB7 A;  3L2R A;  2EJG A;  1C1A A;  4Y92 A;  2QQA A;  4M75 D;  1K8A U;  4RTV A;  3QJ6 A;  4MZM A;  1W2B A;  5HCK A;  2L3P A;  3U23 A;  1K8A C;  1KD1 C;  1MGQ A;  4JJD A;  4XTX A;  1R0B G;  3OS2 A;  3L42 A;  1TSF A;  1U5S A;  3GNF B;  1RLP C;  1Q81 C;  4R0K A;  4AT1 B;  1GCP A;  2XHC A;  4C5G A;  3FEO A;  2WSE E;  1G3S A;  2PVD B;  4LD6 A;  3D7S B;  4BE0 A;  5I22 A;  3PMI A;  1W1F A;  4F7U B;  4QVZ A;  5LJ3 g;  4JS4 A;  4KH1 B;  5IN1 A;  3OYH A;  3JB9 D;  2MOX A;  3OMC A;  1X43 A;  2ED0 A;  4YTL A;  2RQV A;  3FB9 A;  3CCJ T;  1YIT Q;  4DEX A;  2QA4 Q;  4C8Q E;  3OYD A;  1ZUK A;  3DB4 A;  1J3T A;  2PU9 B;  2ZCF B;  5GAO q;  5GAO p;  2DLP A;  4MDX A;  1RAB B;  4IUV A;  3TQ7 P;  2YRD A;  4E7L A;  2QEX Q;  2G6F X;  4M75 F;  1OU8 A;  2V8K A;  4O5V A;  2GNC A;  1VQ4 A;  1SHG A;  2K5I A;  1WHH A;  3M58 A;  4OB1 B;  4Y28 E;  1KHI A;  2JUF A;  2PZ1 A;  4AG2 C;  1W70 A;  1YN8 A;  5FRO A;  2WAC A;  3CCR A;  2RPN A;  2MIO A;  1VQO Q;  2GQV A;  2PNI A;  1AZG B;  4NL3 A;  3CCU Q;  2Y4Y A;  1ZQ1 A;  2VC8 A;  2HDA A;  4HXJ A;  1UJ0 A;  2RHU A;  1K9A A;  2AZS A;  3A8M B;  4GY5 A;  1Q81 R;  3TU4 K;  3C94 A;  3RNJ A;  1M90 U;  3E9F A;  3CC4 T;  4BI4 A;  1FXX A;  3NFC A;  1EIF A;  1UHC A;  4F7U E;  3UPU A;  1K8A R;  2RK1 A;  1HXD A;  3I56 A;  3H8Z A;  2LQK A;  3OYK A;  3CC2 A;  1MMN A;  2RM4 A;  1PG5 B;  2LNH B;  1EX4 A;  1G8X A;  2YSQ A;  5GAO m;  2EYW A;  2XD0 A;  5IHK A;  1PM3 A;  3I55 Q;  2VV5 A;  3A8L B;  1G3W A;  3QYH B;  1K9M C;  5GJV B;  2VXF A;  3T9N A;  3CC4 Q;  4NOY A;  1VOM A;  1VQ8 Q;  3OYM A;  4L6V 5;  3R6N A;  4FCY A;  2DIL A;  2K2V A;  4ZGJ B;  4PJO G;  5DM7 R;  3HRT A;  1WYX A;  4DEY A;  2BUD A;  4RUG A;  1W4S A;  1FMW A;  2WSC E;  5GAN 3;  2DZ9 A;  3MPU B;  2CSQ A;  3OYB A;  3V7C A;  3OYL A;  4DOV A;  4RTT A;  1GL5 A;  1N27 A;  1PCX A;  3UA6 A;  2F2V A;  4M78 B;  5LJ5 h;  4M77 G;  3M0Q A;  3OYJ A;  5GAN 2;  2KAF A;  2KGT A;  5KYW B;  1BK2 A;  3L1A A;  1YJN T;  4M77 B;  5KYU A;  2QAS A;  3VUZ A;  1QVG S;  2A28 A;  5KYY A;  2GFA A;  2EQU A;  4R55 A;  1JU5 C;  2ZPF B;  2DNU A;  4PL6 A;  4F7U F;  2KI7 A;  2ED1 A;  2KT8 A;  2J06 A;  2DE0 X;  5GAN 5;  3BE3 A;  3JAM E;  1IO6 A;  4PJO A;  1LPL A;  3OA6 A;  2O01 E;  2YDL A;  2EQI A;  2KY9 A;  1LVK A;  2HL3 A;  4QKU A;  1H8K A;  1D1B A;  1VQM Q;  1LOJ A;  2L2P A;  3KFV A;  4E2F B;  1Q82 R;  4J7I A;  4XTY A;  1K0X A;  4PLL A;  2LDM A;  3CCV T;  3OSV A;  1VQ4 Q;  1YBY A;  4E7Z A;  1GBQ A;  3EHQ A;  2MMP A;  2VB6 A;  2DVE A;  1NE8 A;  2E6Z A;  1M90 R;  3LX7 A;  4F7U G;  4ANJ A;  3L2Z A;  1FMV A;  3CC2 T;  4M75 A;  2ECZ A;  2RA2 A;  2ZPB B;  1KQ2 A;  4A63 B;  2F2X A;  2BZ8 A;  1WJR A;  2DXT A;  3P8B B;  4N0A A;  3EG3 A;  2YXY A;  1QCN A;  2GTO A;  3M59 A;  2DL3 A;  5DLO A;  2RQU A;  1QP2 A;  1AZE A;  1NLO C;  2L3Q A;  2DBK A;  3VS2 A;  1YJ9 T;  4C0F A;  2ABL A;  1B07 A;  2EGE A;  1YNZ A;  1YWO A;  2MYS A;  2FZG B;  2HQE A;  3CBP A;  4PJO E;  2FHD A;  3ZL7 C;  2XI9 A;  2HZY A;  1YJN Q;  2YUP A;  2ESW A;  4BI8 B;  3QO3 A;  3VS3 A;  1BI2 A;  4F16 A;  3ULR B;  1N8R C;  4A4E A;  5C0M A;  4ATO A;  2SRC A;  4M7D B;  4MZT A;  3UA7 A;  5LJ3 h;  3AHU A;  1AWJ A;  2YLC A;  2EGA A;  1VQ9 T;  4M7D G;  1WHK A;  3GP8 A;  1G3Y A;  4F17 A;  2COY A;  4N4I A;  3VKI A;  4BI3 A;  2JNG A;  3EG2 A;  1EZZ B;  3JB9 G;  1UGS B;  3CCL Q;  5A0D A;  1BIB A;  3UDC A;  2ZAE A;  2L0A A;  2W10 A;  3C0C A;  1I8F A;  1N9S A;  4LXC A;  4HCB A;  3PVQ A;  3JB9 H;  2JN0 A;  4J9C A;  5GAN g;  1XOV A;  1WHM A;  1TXQ A;  4D8K A;  4FYW B;  3CCM Q;  1M1K C;  1SPK A;  4XQ3 A;  4M4Z A;  3FC3 A;  5KYX B;  1VQK T;  2QA4 A;  2K3B A;  2LMJ A;  5IT9 E;  2DEQ A;  5GAM f;  1VA7 A;  3CCQ Q;  1YHQ Q;  1ABO A;  1X6G A;  3CBO A;  2V8J A;  2X51 A;  1N8R R;  2M02 A;  3CCL A;  1ZSG A;  4KGV B;  1MMA A;  1NYF A;  5D6X A;  2EKH A;  4C8Q C;  3CCE T;  4IUR A;  4OB0 B;  1M30 A;  3HRU A;  2K79 A;  3VJP A;  1JBM A;  4PJO C;  4IIO A;  5A2Q E;  1N6A A;  2KT1 A;  2RK2 A;  3H9N A;  2LQW A;  3G1J A;  4OGE A;  1E6H A;  1HSQ A;  3CCV Q;  1GRI A;  1K4U S;  3EGX A;  4J6X A;  2AKL A;  2V26 A;  2R57 A;  1EFN A;  5GAN 6;  1OPK A;  4ESR A;  4BUG A;  3TEE A;  1ZA1 B;  4HT9 A;  2DKG A;  2PUK B;  2HL5 C;  4BAC A;  1AVZ C;  3VRZ A;  1Q7Y U;  3JCM Q;  1JQQ A;  2DMO A;  1R0C B;  3G4S T;  1VQN T;  5CCA A;  4M75 E;  4PFZ A;  3VS5 A;  2O9V A;  1IGU A;  4CRI A;  2X4X A;  2P4T A;  3SD4 A;  5HY6 A;  3I56 T;  4FYX B;  3M54 A;  2KXD A;  2CZ0 B;  3I55 T;  1BYM A;  1QCF A;  4BY6 B;  3J81 E;  2V8I A;  4FT2 A;  1WHL A;  4N0A C;  3J80 E;  1UTI A;  2ATC B;  2QQ9 A;  2DL7 A;  3X24 B;  4VUB A;  5IAY A;  3VYH B;  2D0N A;  2EYQ A;  4XU2 A;  3CCU T;  1M90 C;  2KK4 A;  5GAN d;  3NHN A;  3JCM c;  4RCC A;  2GQI A;  4JZ3 A;  3JCM d;  4RTW A;  2NUP A;  1W2B P;  1M8V A;  4NL2 A;  4M77 D;  1U1S A;  2YRC A;  3CC7 A;  2DBM A;  1KQS S;  4IUP A;  2J6F A;  1M2V A;  2YUN A;  5I2M A;  1YJW A;  1SHF A;  2XIC A;  5L23 A;  2BZX A;  2FZK B;  1SEM A;  3EGD A;  3CCS A;  3G4S A;  3EGU A;  1VQ6 T;  4WF2 A;  5LJ3 f;  3L2U A;  1YJW T;  2X4J A;  3CC4 A;  3GF5 A;  3CCJ Q;  1YJN A;  2FZC B;  4DA4 A;  2DAQ A;  3M0P A;  4HCK A;  2VUB A;  1GFC A;  1M3A A;  3QG1 A;  3JB9 J;  4FT4 A;  4DQ2 A;  1PSE A;  2JVV A;  1OX8 A;  2M9U A;  2GBQ A;  4FYV B;  4JJB A;  3JCM V;  2QQB A;  2O88 A;  1NPR A;  2CP2 A;  1QWE A;  3GOX A;  3CD6 A;  2LP5 A;  4JRQ A;  3EAE A;  1S72 T;  4HVU A;  3DB3 A;  3LWH A;  4OVA A;  1NPP A;  4ZGE B;  5GAN e;  3JCM g;  3JCM e;  3DKM A;  1PWT A;  3X28 B;  4E7I A;  3QHS A;  3JCM h;  3CCL T;  2NUZ A;  2P0Q A;  3LH0 A;  3JB9 F;  2MF2 A;  1TH7 A;  4O6J A;  3V8J A;  1RAC B;  3CCU A;  3CPF A;  2OTJ Q;  2KXC A;  4LUE A;  2CP0 A;  1I81 A;  2DER A;  4QQ6 A;  4HKE A;  1NEG A;  3GIB A;  4CC4 B;  3PMT A;  1JXM A;  1JJ2 P;  4F7U A;  3THK A;  1G83 A;  3CD6 Q;  4DBR A;  1TUC A;  2LTO A;  3V8K A;  1ZSZ B;  2FVU A;  2DL5 A;  4E7H A;  2A3L A;  2CP3 A;  2K3Y A;  1QW1 A;  5CO7 A;  1VQ5 T;  1XJW B;  2CH4 A;  1UHF A;  1OPL A;  4CC7 A;  2DEU A;  2D8J A;  4PFO A;  1D1A A;  2FEI A;  1QQJ A;  1WQ7 A;  2DFU A;  3LYI A;  1YIJ Q;  3HSB A;  3NTI A;  3OB9 A;  1YJ9 A;  4J83 A;  4M78 A;  3CPW S;  3UF4 A;  2MWO A;  3I56 Q;  1KFZ A;  2C06 A;  1Q81 U;  4M7A B;  2BE9 B;  1OZ3 A;  1X2Q A;  1M1F A;  4UC4 A;  2XKO C;  1NEB A;  3M56 A;  3OS0 A;  1UGR B;  2E41 A;  5A0G A;  2YUQ A;  4OP0 A;  3CMA Q;  3GBQ A;  2I2L A;  2E1H A;  2BE7 D;  3GLX A;  5M9O A;  4EMH A;  2HCK A;  1V29 B;  4FSS A;  2MPX C;  3S3M A;  3CMA A;  1ZBJ A;  4QVD A;  4KUI A;  2V1R A;  2WSF E;  2KNB B;  3R6O A;  4X34 A;  4XTV A;  4C5I A;  2VAS A;  3I35 A;  3OYI A;  1BB9 A;  3CCR T;  4ELY C;  3MKD A;  1OV3 A;  4C5H A;  4KGZ B;  2HSE B;  2CZ1 B;  2K4Y A;  1YIT A;  2FYK A;  2HKQ B;  3SHW A;  2YT6 A;  2DTO A;  2KBT A;  5IHI A;  5CKB A;  1FMK A;  1M2O A;  4CC2 A;  1K0S A;  1NLP C;  3CCM T;  1X6O A;  1JJ2 S;  3DLM A;  2G3R A;  2K5L A;  1VQ7 Q;  2MI6 A;  2QTX A;  4JS5 A;  2AIR B;  3VS1 A;  2D0Q B;  3P8D A;  3G6E A;  3HFO A;  4JRI A;  1AD5 A;  5LJ3 d;  2J7I A;  1WI7 A;  3RER A;  2VXE A;  4FIB A;  3Q1J A;  3RMQ A;  4PFP A;  5GAO n;  3JB9 I;  2A36 A;  1VQO T;  2DTI A;  1NG2 A;  2KEA A;  1RAA B;  4X9D A;  2KRO A;  2CGH A;  5KYW A;  2E64 A;  4M7D A;  3CCR Q;  5KE3 A;  1ZX6 A;  2EKO A;  2ROT A;  2R5A A;  1MNE A;  2FG0 A;  5GAN 4;  4OMF B;  1KIK A;  4IKF A;  2NYS A;  2M51 A;  3HPW A;  2HBP A;  1OU9 A;  5CKF A;  3O5Z A;  1CKA A;  2DJZ A;  3KBG A;  2LCL A;  3CME T;  2Y4X A;  1S1N A;  4FU6 A;  3G71 T;  1VQP A;  1VQK Q;  5CKH A;  1D1C A;  2COZ A;  4KBM B;  2HKN A;  1VIF A;  3VS6 A;  1V76 A;  2QI2 A;  1TUG B;  3CC7 Q;  3J7A F;  4EMG A;  2JM9 A;  4PJL A;  2XK0 A;  2QA4 T;  3HTR A;  1ZA2 B;  1C6V X;  3C95 A;  5FU6 B;  1IB8 A;  4OF1 A;  2MK5 A;  4P5N A;  2MAM A;  1VQ8 A;  3MO8 A;  2L8D A;  4C92 E;  4C92 B;  1VUB A;  2DJQ A;  2KRN A;  4LD9 K;  4M7D C;  1G3T A;  5C6S A;  5FLX E;  4M7A C;  4JZ4 A;  2QEX T;  2SEM A;  2D8H A;  3NTK A;  1PHT A;  4K11 A;  1T0J A;  3M9Q A;  3CXC A;  4OGC A;  3MEV A;  1VQM T;  2K3X A;  1TS9 A;  4BDY A;  3EH2 A;  4WTO B;  4CI0 C;  1AT1 B;  1SRM A;  3CCS Q;  4C92 F;  1NYG A;  3LGL A;  1E6G A;  4LDU A;  5AYF A;  3X20 B;  2RI3 A;  3BW1 A;  4OMN A;  4CC3 A;  4AG1 C;  5IXB A;  2EYX A;  5CAI A;  1PNJ A;  2GCX A;  3OYE A;  3QDR B;  2M1H A;  4C0Z A;  4GLK A;  1WJQ A;  3QZ9 B;  2C0O A;  1M27 C;  2FO0 A;  2RJE A;  1SKU B;  3QKJ A;  2F5K A;  2RI5 A;  3CME A;  2K5F A;  3DLL A;  2YUO A;  3G6E T;  4OMP A;  2XID A;  4C92 A;  1G5V A;  2X4Y A;  1S72 Q;  2DF6 A;  5KE2 A;  1RAH B;  2RQR A;  4QT7 A;  8AT1 B;  5KCO A;  4PJO D;  3CXC S;  1NJI C;  5IXF A;  1BI0 A;  1YFN A;  1FWZ A;  1Z9Z A;  2JTM A;  2DTH A;  1VQ7 A;  1WA7 A;  3CC2 Q;  3S3O A;  1WPY A;  5GAM h;  2DRM A;  5FW9 A;  1HYO A;  1N8R U;  2IVW A;  5GMK m;  5DLQ E;  5GAM e;  5GAM g;  1BCO A;  1VQ4 T;  1VQP Q;  1WIE A;  4RTY A;  4C92 D;  2IPO B;  1VIE A;  4M78 G;  3V7S A;  4LDW A;  3SDZ A;  2LQ8 A;  3CCE Q;  2CSI A;  1I5O B;  4M75 C;  2KRS A;  4J9I A;  5LL6 S;  3H6Z A;  2OTL Q;  3QZ5 B;  2RH2 A;  3SEM A;  1XQH A;  3SFM A;  1D3B A;  2OTL T;  4M7D E;  4L5G A;  4II1 A;  3OS5 A;  1W2B S;  5CIU A;  2PTK A;  1ZUU A;  2JT4 A;  3G71 Q;  1PRM C;  2L3S A;  1BU1 A;  3MET A;  1KQS P;  4M77 C;  3INZ A;  4HT8 A;  2VYT A;  3JCM X;  2I0N A;  2L89 A;  2YLB A;  2KRM A;  2L3R A;  4JJN K;  1BI3 A;  3ER0 A;  1OOT A;  1RAF B;  1X6B A;  3KUF A;  2X4W A;  1Y71 A;  1GCQ C;  2O4X B;  3CC7 T;  4LE9 A;  2RD1 A;  1TWB A;  3M0T A;  1T3S A;  1BBZ A;  4DBQ A;  2CS7 A;  2JM8 A;  5GAM d;  5FRM A;  1C0M A;  1Q86 R;  2RO0 A;  5HK0 A;  2VGM A;  4MMK A;  1VQ6 A;  3JCM J;  4JRK A;  5CQX A;  3WXM B;  5FU7 C;  3OY9 A;  3CME Q;  2YRV A;  2JTE A;  3FJ5 A;  3CXC P;  1UB4 A;  1IRE B;  4ZNX A;  1AWO A;  1GFD A;  2L5Q A;  1ZSZ C;  3RKW A;  1WX6 A;  2A0F B;  2AHJ B;  3QWX X;  4ZTF A;  1UE9 A;  3MEU A;  4PJN A;  4BE1 A;  1VQL A;  4ZGD B;  9ATC B;  5GAM j;  5CR2 A;  3EGX B;  3OYF A;  1LJO A;  2HQX A;  3VU3 C;  1Q7Y C;  3OW2 S;  2X3W D;  2E3H A;  3FLG A;  1PSF A;  3CCV A;  1OI1 A;  1RAD B;  2BTT A;  2OTJ A;  2EWN A;  4DBH A;  5GAN h;  1M5Q 1;  1N9R A;  3ME9 A;  1Y57 A;  2E70 A;  1Y7X A;  3AT1 B;  1T3L A;  4C0G A;  3PT9 A;  1QCO A;  1RI9 A;  1YP5 A;  3JRZ A;  3RUX A;  1NJI U;  4AFZ C;  1WHJ A;  1Q82 C;  2EYY A;  2V1Q A;  2JTF A;  4A4K A;  1WFW A;  3IQL A;  3OBY A;  2HNI A;  1PKT A;  5GAO r;  1QVP A;  1U8R A;  1M9S A;  2EQM A;  2DX1 A;  1R8O B;  5I11 A;  3MEW A;  2B8A A;  4BDZ A;  1UDL A;  4GLM A;  3JCM f;  1WXB A;  2P0P A;  3QII A;  5ECA A;  4C0D B;  4OMQ A;  3CPW P;  2ZGW A;  1P92 A;  2QQR A;  1ABQ A;  2P0K A;  3F70 A;  3HFN A;  2M16 A;  2QGG A;  4M7A E;  1FX7 A;  1YIJ A;  4JJC A;  2E3I A;  4OB3 B;  4EIK A;  2LZ6 B;  2IIM A;  3FDR A;  1WQW A;  1ACM B;  1M1G A;  2DK3 A;  2E4H A;  2QXF A;  3SWN A;  4QW2 A;  3ASK A;  2DXB A;  2DD5 A;  4E7S A;  2EGC A;  1LCK A;  1QVF S;  5FWC A;  2RJD A;  3OYA A;  2JS0 A;  1Y96 B;  4M75 G;  2CKK A;  4D6W A;  1U1T A;  2HBW A;  4C8Q A;  2DA9 A;  4EMK A;  3QWY A;  4EDU A;  2DL4 A;  1K9M R;  1KC8 U;  1Q7Y R;  4BY6 C;  1KSW A;  3G4S Q;  1OYX A;  3QUI A;  3MJX A;  3MHX A;  2FRW A;  1LNX A;  3N5B B;  1QP3 A;  1SSF A;  2DET A;  4QQD A;  4IUT A;  4PKC C;  3M4G A;  1GCQ A;  3CPW A;  4QVC A;  2K57 A;  1TG0 A;  2DXU A;  2K2M A;  3OBW A;  3GNG A;  2DIQ A;  1Z9Q A;  5GJW B;  1NJI R;  4J9B A;  3SB2 A;  4WCI A;  3C4S A;  1ZUY A;  3PFS A;  1PRL C;  1WJS A;  2ZPI B;  4RMO A;  3EFR A;  1VQ7 T;  2BIV A;  2W0Z A;  4QQG A;  1SRL A;  2XU8 A;  4KH0 B;  1S72 A;  2B86 A;  2IG0 A;  4C8Q G;  1YWP A;  1RAE B;  1ZSZ A;  2VGN A;  4OMM A;  1Q95 G;  5FU7 B;  1MV3 A;  2E12 A;  1QLY A;  4C8Q B;  2J6O A;  4A54 A;  2EFI A;  2KYM A;  4J9D A;  2OTJ T;  2R58 A;  2XDD A;  2OJ2 A;  4XAX B;  1AEY A;  1TU0 B;  3FJP A;  2RMO A;  2RNA A;  3OYN A;  4HA8 A;  2JMC A;  4MZP A;  2CT4 A;  2PQW A;  2NUT B;  2P4R A;  3M0R A;  3S3N A;  4B6M A;  2KVQ G;  1MMD A;  3I5R A;  1I4K 1;  5LJ5 f;  1IZ6 A;  1K1Z A;  3RDV A;  5GMK l;  3CCQ T;  1YHQ T;  2KDS A;  2EQJ A;  1IHV A;  1WNL A;  5CK9 A;  2AKK A;  4Q5W A;  3VUB A;  2QGF B;  3M4Y A;  1MND A;  1K9M U;  4N4G A;  4XK8 E;  3C12 A;  4N4H A;  2E6N A;  4RTX A;  3LH5 A;  3QDF A;  1PKS A;  1K73 C;  1QVF A;  3BFM A;  3SWN C;  4ZTJ A;  3VS4 A;  3GPL A;  3G71 A;  3CCE A;  4V2S A;  3L2W A;  2EPD A;  3E9G A;  4Y91 A;  4IIM A;  1PD1 A;  3I55 A;  2PVO B;  4M78 C;  4M78 D;  3A8G B;  1KD1 R;  2NUT A;  1JEG A;  1NM7 A;  2DL8 A;  2CP7 A;  2XMF A;  4M75 B;  2LCS A;  1ZLM A;  2HEQ A;  1M3B A;  2EJ9 A;  1QVG A;  1Y07 A;  1VQN Q;  3EFO A;  1UGQ B;  1VQL T;  4HVV A;  5IHN A;  3UT1 A;  1KQ1 A;  3KXT A;  1JJ2 A;  4J5Y A;  2JZ2 A;  1D0Z A;  1TUD A;  2JJ9 A;  4LDV A;  3TSW A;  4EMK C;  8ATC B;  5KYN A;  2DYI A;  1JO8 A;  4C8Q F;  2KSS A;  2CRE A;  2H3J A;  5FRN A;  4M7D F;  4KRT A;  2LC4 A;  4JDS A;  4F04 B;  1HJD A;  3CCJ A;  3WVD B;  1RAI B;  3HP9 A;  4E7K A;  1M8M A;  1CSK A;  3QBY A;  3RKY A;  5D6W A;  2RQT A;  3A8H B;  2MWP A;  3MCA B;  1IXD A;  4BD3 A;  2ZPH B;  3M57 A;  3SWN B;  4J8O A;  1HK9 A;  3X26 B;  3L2V A;  1R77 A;  1VYU A;  1D3B B;  5EC7 A;  2CP6 A;  1KC8 C;  4FW1 A;  4PLI A;  4RG8 A;  3S6W A;  2QAZ A;  3M5A A;  1OUL A;  3CCM A;  3PNW C;  4XU3 A;  2QDL A;  2CUD A;  4L59 A;  4B9X A;  4M7A D;  4ME7 A;  2EIF A;  1YI2 T;  1Y0M A;  3EGD B;  1YI2 Q;  2R5M A;  3E1S A;  4PJO F;  3E2U A;  4ORZ A;  1RUW A;  5HK3 A;  4C8Q D;  4IUU A;  1VQ9 Q;  3OSS C;  3EG9 B;  3BDU A;  4M7D D;  2H8H A;  4AMC A;  1WDX A;  2MCN A;  2YWW A;  3EH1 A;  3PVL A;  1WLP B;  2DPP B;  1UEC A;  2VVK A;  3REB B;  1WXT A;  3I5S A;  1AWX A;  4M77 E;  3PIP A;  1I07 A;  3MEA A;  2QQS A;  4FM4 B;  1G2B A;  4X1V A;  5EG2 A;  2GF7 A;  3JSC A;  4NS5 A;  3X25 B;  1I1J A;  1MHN A;  5I2S A;  2FB7 A;  3M55 A;  1X27 A;  4Z02 A;  4FW2 A;  2RB6 A;  1YJ9 Q;  3TRE A;  1BI1 A;  1MUZ A;  1OQK A;  2EW3 A;  2FPF A;  4RCB A;  3LWI A;  2JMA A;  1RAG B;  5FWB A;  4LN2 A;  2KYB A;  1AWW A;  1VQ8 T;  1B34 B;  1TTH B;  1B3Q A;  1DJ7 B;  2ZPG B;  3ZEH A;  1D09 B;  5J39 A;  2D1X A;  3EG9 A;  4A53 A;  3PIO A;  2KQW A;  4LUD A;  2QYZ A;  2ZZD A;  2A37 A;  4FL6 A;  1IHW A;  5LJ3 j;  1K76 A;  5A0L A;  5KCH A;  2DXC A;  2AK5 A;  3EFS A;  3OYG A;  3M0U A;  4AFS C;  2LT1 A;  2COW A;  1QKX A;  1SSH A;  4HCZ A;  3OW2 P;  2HSP A;  1WXU A;  2LJ0 A;  3JCM P;  5GAO l;  4C92 C;  3H0F A;  2DYB A;  4JLI A;  2QEX A;  1SG5 A;  3UAT A;  2RI2 A;  2O4X A;  2LNV A;  3MP1 A;  2O2O A;  2QK0 A;  2RJC A;  4M7A A;  4J9H A;  2EAY A;  3EG0 A;  1SF9 A;  3RES A;  4M78 E;  3EFO B;  2ROL A;  3RKX A;  2DO3 A;  4D8D A;  1JXO A;  1WZO A;  2EQK A;  1QMC A;  2OAW A;  1K73 U;  2LQN A;  3E19 A;  1YCY A;  2FPD A;  2CP5 A;  1O75 A;  3RMS A;  5GAN 8;  4MDW A;  4A4H A;  3MP8 A;  1RLQ C;  3V7R A;  2VKN A;  4RKU E;  4C92 G;  4C5E A;  2EVR A;  1AOJ A;  2Z0W A;  3TSZ A;  3LGF A;  1VYT A;  2FRY A;  1IGQ A;  5LJ5 e;  1WHG A;  5LJ5 g;  4LNP A;  1KD1 U;  2ENM A;  2CH4 W;  1VQP T;  1VQ5 A;  1VQK A;  4PNO A;  3CEY A;  3LLR A;  5D6Y A;  3OQ5 A;  2QTV A;  2C0T A;  2BZY A;  2BKD N;  2K9G A;  1U3O A;  2KE9 A;  3JV3 A;  2RN8 A;  1BKB A;  1VQ5 Q;  1UGV A;  5LJ3 e;  4Z8A A;  4XTW A;  1QVF P;  1X2K A;  3BY7 A;  4AFQ C;  1KK7 A;  3NPF A;  4J7F A;  5D7U A;  3LW5 E;  1TOV A;  3QSU A;  2GFU A;  4X9C A;  3M53 A;  1M4Z A;  5GAN j;  4OB2 B;  3M0S A;  3G6E Q;  4MML A;  3L2Q A;  5CKD A;  1UEB A;  1H3Z A;  1W6X A;  3PE0 A;  1UJY A;  1GXI E;  4HCC A;  3REA B;  5I21 A;  1B7T A;  1U06 A;  2FL7 A; 
#chains in the Genus database with same CATH homology
 2KAF A;  4C5H A;  4KUD K;  3M4G A;  2CZ1 B;  3CPW A;  4QVC A;  2K4Y A;  1YJN T;  3L1A A;  1YIT A;  2E65 A;  4M77 B;  1Q86 C;  2D9T A;  1RL2 A;  2DXU A;  2FYK A;  2K57 A;  3OBW A;  4RG2 A;  5CQY A;  3VUZ A;  5GAN f;  1QVG S;  3GNG A;  3VV0 A;  2DIQ A;  5LJ5 d;  2DTO A;  2GFA A;  2LX9 A;  5J3B A;  2EQU A;  4KT0 E;  4R55 A;  2LVM A;  5CKB A;  2ZPF B;  4PL6 A;  1X75 C;  3SB2 A;  3C4S A;  4F7U F;  3CCM T;  1X6O A;  3PFS A;  1RI0 A;  4RMO A;  1WJS A;  2ZPI B;  2XG8 D;  3DLM A;  2G3R A;  3EFR A;  5GAN 5;  3JAM E;  1JJ2 S;  1VQ7 T;  2BIV A;  2K5L A;  2MI6 A;  2QTX A;  4JS5 A;  4PJO A;  4QQG A;  4ZN1 A;  3V8L A;  3OA6 A;  2D0Q B;  2XU8 A;  3P8D A;  3G6E A;  2O01 E;  1Y96 A;  3HFO A;  1S72 A;  2IG0 A;  2KY9 A;  4JRI A;  5LJ3 d;  4C8Q G;  4M7A G;  1VQO A;  4TVR A;  1LOJ A;  2VGN A;  5FU7 B;  2E12 A;  3RIR A;  1YIJ T;  3RER A;  2VXE A;  4C8Q B;  4A54 A;  2EFI A;  4J7I A;  2ZPE B;  5LJ5 j;  2OTJ T;  4FIB A;  2R58 A;  4XTY A;  2XDD A;  4PLL A;  3Q1J A;  4XAX B;  2LDM A;  3A8O B;  3CCV T;  3OSV A;  1YBY A;  3OYY A;  3FJP A;  3RMQ A;  2MMP A;  1ZHI A;  2DVE A;  5GAO n;  3JB9 I;  1VQO T;  3QYG B;  4R56 A;  1NE8 A;  3OYN A;  2DTI A;  2E6Z A;  2HAX A;  4HA8 A;  3LX7 A;  4X9D A;  4F7U G;  4MZP A;  2CGH A;  3L2Z A;  2PQW A;  3MP6 A;  4M77 A;  1B34 A;  2E64 A;  3CC2 T;  3CD6 T;  3S3N A;  4M75 A;  4M7D A;  2KVQ G;  2X35 A;  5KE3 A;  2QDY B;  2RA2 A;  2EKO A;  2ZPB B;  2R5A A;  1I4K 1;  1KQ2 A;  5LJ5 f;  4E47 A;  1Q82 U;  1IZ6 A;  5GAN 4;  1WJR A;  1XTD A;  2DXT A;  3P8B B;  4N0A A;  4OMF B;  5GMK l;  4IKF A;  3CCQ T;  2DD4 A;  5GMK i;  1YHQ T;  1VQ9 A;  2DZC A;  2KDS A;  2RJF A;  3HPW A;  2EQJ A;  1WNL A;  2RHY A;  1OZ2 A;  5CK9 A;  2HBP A;  3M59 A;  5CVI A;  4Q5W A;  3VUB A;  5CKF A;  4A4G A;  2XDB A;  2DJZ A;  3G7Z A;  2A7Y A;  3M4Y A;  5DLO A;  1QP2 A;  1K9M U;  4N4G A;  3KBG A;  2LT4 A;  2NLU A;  3C12 A;  4XK8 E;  4XTZ A;  2LCL A;  4N4H A;  3UWN A;  4FSX A;  3CME T;  2OTL A;  4DOW A;  2Y4X A;  1YJ9 T;  2E6N A;  4C0F A;  2CYZ B;  4FU6 A;  3G71 T;  4A4F A;  2OAU A;  1VQP A;  2D6F A;  4EMK B;  2HQE A;  3CBP A;  4PJO E;  1K73 C;  2FHD A;  5CKH A;  3BFM A;  4KUL A;  1QVF A;  2XI9 A;  2Y90 A;  1VIF A;  4KBM B;  3SWN C;  4ZTJ A;  2RHX A;  4EPC A;  3GPL A;  3G71 A;  3CCE A;  2QI2 A;  4V2S A;  1X01 A;  3L2W A;  3E9G A;  4Y91 A;  3OYC A;  4BI8 B;  3QO3 A;  1KG1 A;  1BI2 A;  3J7A F;  4EMG A;  3I55 A;  1N8R C;  3HRS A;  1M1K U;  2XK0 A;  2PVO B;  4M78 C;  4M78 D;  4A4E A;  3HHT B;  5C0M A;  3OS1 A;  3A8G B;  2QA4 T;  4ATO A;  2DIG A;  4M7D B;  4MZT A;  3C95 A;  5FU6 B;  5LJ3 h;  4J6W A;  3AHU A;  2YLC A;  4M75 B;  4OF1 A;  4P5N A;  1VQ9 T;  2EJ9 A;  4M7D G;  1QVG A;  2MAM A;  3GP8 A;  1VQ8 A;  1G3Y A;  3MO8 A;  5GMK j;  1Y07 A;  4LDX A;  2L8D A;  4C92 E;  4C92 B;  4ELZ C;  1VUB A;  4N4I A;  2KMT A;  3VKI A;  4BI3 A;  1UGQ B;  2JNG A;  1VQL T;  4LD9 K;  4M7D C;  1G3T A;  5C6S A;  3JB9 G;  2E10 A;  5FLX E;  4M7A C;  1UGS B;  2QEX T;  3BDL A;  3JCM b;  2YHT A;  3UT1 A;  5A0D A;  1VQN A;  2E5Q A;  4PJO B;  2F69 A;  3NTK A;  1KQ1 A;  3ZFJ A;  1BIB A;  3UDC A;  2EJF A;  3M9Q A;  3CMA T;  4M78 F;  3HKS A;  3KXT A;  4OGC A;  3MEV A;  3CXC A;  2RHZ A;  1VQM T;  2K3X A;  4BDY A;  5CKE A;  1JJ2 A;  1I8F A;  4CI0 C;  4J5Y A;  2JZ2 A;  1N9S A;  1XNI A;  4XU1 A;  4ZN3 A;  5DY9 A;  4C92 F;  4HCB A;  3JB9 H;  4LDV A;  4EMK C;  4E7J A;  2JN0 A;  3LGL A;  3ZBD A;  2XDP A;  4LDU A;  5AYF A;  2RHI A;  3X20 B;  5GAN g;  2RI3 A;  1XOV A;  2KSS A;  4C8Q F;  3VYG A;  3BW1 A;  2H3J A;  5FRN A;  4M7D F;  3CCQ A;  1YHQ A;  1M1K C;  3FRN A;  4XQ3 A;  2LC4 A;  4JDS A;  3FC3 A;  1YIT T;  5CAI A;  2GCX A;  2F5T X;  3WVD B;  3CCJ A;  2QA4 A;  1NZ9 A;  4XTU A;  3OYE A;  1VQK T;  3QDR B;  2M1H A;  5IT9 E;  3HP9 A;  4B9W A;  4E7K A;  2DEQ A;  1JRI A;  4GLK A;  4C0Z A;  5GAM f;  1WJQ A;  3QZ9 B;  3QBY A;  5FU6 C;  3RKY A;  5J26 A;  2RJE A;  3QKJ A;  2F5K A;  2RI5 A;  3CME A;  3CBO A;  2V8J A;  5D6W A;  2K5F A;  3A8H B;  2MWP A;  3MCA B;  3CCL A;  3DLL A;  1O9S A;  5GAN 7;  3G6E T;  4BD3 A;  4J6Y A;  3CBM A;  2CZ6 B;  2XID A;  2ZPH B;  3TCJ A;  4C92 A;  2X4Y A;  1G5V A;  5KE2 A;  3M57 A;  5D6X A;  3URG A;  4C8Q C;  5HKC A;  3CCE T;  3SWN B;  4J8O A;  4IUR A;  1HK9 A;  4OB0 B;  1ZBX A;  3HRU A;  1VQM A;  3VJP A;  3X26 B;  5KCO A;  1JBM A;  3QXE B;  3L2V A;  3A5Z B;  4PJO C;  4XU0 A;  1D3B B;  5A2Q E;  3CXC S;  4PJO D;  1N6A A;  2RK2 A;  3HL8 A;  1NJI C;  3P8H A;  3O8V A;  1KC8 C;  1BI0 A;  5GMK h;  4PLI A;  4RG8 A;  3S6W A;  4OGE A;  1FWZ A;  2JTM A;  2DTH A;  1VQ7 A;  3M5A A;  3S3O A;  3WVE B;  3PTA A;  4J6X A;  3CCM A;  3PNW C;  4XU3 A;  1WPY A;  3QJY A;  3OMG A;  2R57 A;  5GAN 6;  5GAM h;  4L59 A;  4B9X A;  1BIA A;  4M7A D;  4BUG A;  4ME7 A;  3NTH A;  1N8R U;  2EIF A;  2IVW A;  5GMK m;  5DLQ E;  3TEE A;  3PGG A;  5GAM e;  4IUQ A;  5GAM g;  1VQ4 T;  1JB0 E;  4JUV A;  4C0D C;  1YI2 T;  2DKG A;  1Q86 U;  4HT9 A;  2PUK B;  4BAC A;  2CZ7 B;  2R5M A;  3E1S A;  1Q7Y U;  4C92 D;  3JCM Q;  1UGP B;  4PJO F;  3G4S T;  1VIE A;  5KH6 A;  4M78 G;  5GMK e;  1VQN T;  5CCA A;  4M75 E;  4CRI A;  5HK3 A;  4C8Q D;  2X4X A;  4IUU A;  2P4T A;  3V7S A;  3OW2 A;  1YI2 A;  4LDW A;  3SDZ A;  2LQ8 A;  5L8R E;  3OSS C;  5HY6 A;  3SD4 A;  4M75 C;  3I56 T;  1KHC A;  3M54 A;  3BDU A;  4M7D D;  4M77 F;  2JOY A;  2CZ0 B;  3JCM W;  3I55 T;  4JRP A;  1BYM A;  5LL6 S;  2PVG B;  1H64 1;  3H6Z A;  4BY6 B;  2DPP B;  2PUO B;  2LRQ A;  2V8I A;  3QZ5 B;  3J81 E;  2RH2 A;  4FT2 A;  4M7A F;  4N0A C;  3J80 E;  1AHJ B;  4BE2 A;  1XQH A;  3SFM A;  2QQ9 A;  1I5L A;  3X24 B;  1D3B A;  4VUB A;  2OTL T;  4M77 E;  4M7D E;  3PIP A;  4L5G A;  5IAY A;  3VYH B;  3MEA A;  1KQS A;  4LDY A;  2QQS A;  4FM4 B;  4II1 A;  5EG2 A;  3CCS T;  2GF7 A;  3OS5 A;  2EYQ A;  4XU2 A;  3CCU T;  1M90 C;  3JSC A;  4NS5 A;  3X25 B;  1W2B S;  5CIU A;  2KK4 A;  2LCC A;  1WGS A;  5GAN d;  1MHN A;  3JCM c;  4RCC A;  3FIF A;  4JLG A;  2HD0 A;  2FB7 A;  5I2S A;  3JCM d;  3M55 A;  3QPH A;  2M0O A;  3MET A;  4BB7 A;  4Z02 A;  3L2R A;  4NL2 A;  4M77 D;  1M8V A;  4M77 C;  2EJG A;  2RB6 A;  3INZ A;  3TRE A;  1U1S A;  4HT8 A;  1BI1 A;  3CC7 A;  1KQS S;  2QQA A;  4M75 D;  1K8A U;  2VYT A;  4IUP A;  3JCM X;  2L89 A;  2YLB A;  3LWI A;  4RCB A;  5I2M A;  2L3R A;  3QJ6 A;  4MZM A;  4JJN K;  1BI3 A;  3ER0 A;  2XIC A;  1YJW A;  1W2B A;  3KUF A;  2X4W A;  3CCS A;  1Y71 A;  1K8A C;  1MGQ A;  2O4X B;  3G4S A;  1KD1 C;  2RD1 A;  3CC7 T;  1VQ8 T;  1B34 B;  1VQ6 T;  4XTX A;  4WF2 A;  5LJ3 f;  3OS2 A;  3L42 A;  3L2U A;  5GAM d;  2CS7 A;  1DJ7 B;  5FRM A;  1YJW T;  2X4J A;  3GNF B;  3CC4 A;  3GF5 A;  2ZPG B;  3ZEH A;  1Q81 C;  5J39 A;  2RO0 A;  1YJN A;  5HK0 A;  4DA4 A;  2VGM A;  4MMK A;  1VQ6 A;  4A53 A;  2DAQ A;  3JCM J;  2XHC A;  4JRK A;  5CQX A;  3WXM B;  2VUB A;  5FU7 C;  4C5G A;  3OY9 A;  3PIO A;  3FEO A;  2KQW A;  2WSE E;  2YRV A;  3QG1 A;  3JB9 J;  1G3S A;  4FT4 A;  2PVD B;  4DQ2 A;  4LD6 A;  1PSE A;  2JVV A;  1UB4 A;  1IRE B;  2M9U A;  4BE0 A;  3PMI A;  2ZZD A;  4FL6 A;  4F7U B;  2L5Q A;  5LJ3 j;  3JCM V;  4QVZ A;  3RKW A;  5LJ3 g;  4JS4 A;  5A0L A;  2QQB A;  5IN1 A;  5KCH A;  2DXC A;  2AHJ B;  3EFS A;  3OYH A;  1NPR A;  3OYG A;  3OMC A;  3JB9 D;  4ZTF A;  2LT1 A;  3MEU A;  4BE1 A;  3GOX A;  1VQL A;  4ZGD B;  3CD6 A;  5GAM j;  5CR2 A;  4JRQ A;  3EAE A;  4HCZ A;  4YTL A;  1S72 T;  3OYF A;  3JCM P;  1LJO A;  3FB9 A;  3CCJ T;  3DB3 A;  3LWH A;  5GAO l;  2HQX A;  4OVA A;  3VU3 C;  4C92 C;  3OW2 S;  1NPP A;  4ZGE B;  1Q7Y C;  4JLI A;  2QEX A;  4C8Q E;  5GAN e;  3OYD A;  3DB4 A;  2PU9 B;  2ZCF B;  3JCM g;  2RI2 A;  3FLG A;  3JCM e;  3DKM A;  5GAO p;  5GAO q;  1PSF A;  3CCV A;  4MDX A;  2O4X A;  3X28 B;  4E7I A;  2LNV A;  4IUV A;  1OI1 A;  3QHS A;  2OTJ A;  2EWN A;  3JCM h;  4E7L A;  3CCL T;  3MP1 A;  5GAN h;  2RJC A;  1M5Q 1;  1N9R A;  3ME9 A;  2V8K A;  4M75 F;  2E70 A;  1Y7X A;  2P0Q A;  3LH0 A;  4O5V A;  4M7A A;  1VQ4 A;  3JB9 F;  2EAY A;  4C0G A;  2MF2 A;  1TH7 A;  4O6J A;  3V8J A;  2K5I A;  3PT9 A;  3CPF A;  3CCU A;  3M58 A;  3RES A;  4OB1 B;  4Y28 E;  3JRZ A;  1KHI A;  3RUX A;  2JUF A;  1NJI U;  1I81 A;  5FRO A;  4QQ6 A;  2WAC A;  4M78 E;  4HKE A;  3CCR A;  3GIB A;  1Q82 C;  2GQV A;  4NL3 A;  2JTF A;  3RKX A;  2DO3 A;  2Y4Y A;  4A4K A;  1ZQ1 A;  3PMT A;  2VC8 A;  3OBY A;  2HNI A;  2EQK A;  4F7U A;  5GAO r;  1QVP A;  2RHU A;  1U8R A;  1M9S A;  2EQM A;  1K73 U;  2LTO A;  1YCY A;  3E19 A;  3V8K A;  3A8M B;  2FVU A;  4GY5 A;  3TU4 K;  1R8O B;  3C94 A;  1M90 U;  3E9F A;  4E7H A;  3MEW A;  3CC4 T;  2B8A A;  4BI4 A;  2A3L A;  4BDZ A;  1FXX A;  1O75 A;  2K3Y A;  1QW1 A;  3NFC A;  5CO7 A;  3RMS A;  1EIF A;  3JCM f;  5GAN 8;  4MDW A;  1VQ5 T;  4F7U E;  2P0P A;  3QII A;  4A4H A;  3UPU A;  3MP8 A;  2RK1 A;  3V7R A;  4RKU E;  4C92 G;  4C5E A;  4C0D B;  1HXD A;  3I56 A;  1WQ7 A;  3LYI A;  3H8Z A;  3HSB A;  2ZGW A;  3NTI A;  1P92 A;  3LGF A;  3OB9 A;  2LQK A;  1YJ9 A;  3OYK A;  5LJ5 e;  3CC2 A;  4J83 A;  2QQR A;  4M78 A;  5LJ5 g;  3CPW S;  2P0K A;  2RM4 A;  1KD1 U;  3F70 A;  2MWO A;  3HFN A;  2M16 A;  1VQP T;  1VQ5 A;  1VQK A;  4PNO A;  4M7A E;  3CEY A;  1FX7 A;  1YIJ A;  3LLR A;  4OB3 B;  5D6Y A;  3OQ5 A;  2C06 A;  1Q81 U;  4M7A B;  3FDR A;  5GAO m;  2XD0 A;  1WQW A;  1OZ3 A;  2BKD N;  1M1G A;  2DK3 A;  1M1F A;  4UC4 A;  2VV5 A;  1BKB A;  2QXF A;  2XKO C;  3A8L B;  1G3W A;  3QYH B;  5LJ3 e;  3SWN A;  1K9M C;  4QW2 A;  3M56 A;  3OS0 A;  2VXF A;  1UGR B;  2DXB A;  2E41 A;  3ASK A;  4XTW A;  3T9N A;  5A0G A;  4OP0 A;  2DD5 A;  3BY7 A;  4NOY A;  2I2L A;  2E1H A;  4J7F A;  3OYM A;  4L6V 5;  3LW5 E;  1QVF S;  2K2V A;  4ZGJ B;  2RJD A;  4PJO G;  5DM7 R;  3GLX A;  3OYA A;  3HRT A;  3QSU A;  1Y96 B;  2GFU A;  5M9O A;  4M75 G;  4EMH A;  2BUD A;  4X9C A;  2CKK A;  1V29 B;  3M53 A;  4D6W A;  1M4Z A;  1U1T A;  1W4S A;  2WSC E;  5GAN j;  5GAN 3;  4C8Q A;  4OB2 B;  4EMK A;  3S3M A;  3CMA A;  2DZ9 A;  4QVD A;  4MML A;  4EDU A;  3L2Q A;  4KUI A;  1KC8 U;  5CKD A;  2WSF E;  3OYB A;  1UEB A;  3V7C A;  3OYL A;  4DOV A;  4BY6 C;  3R6O A;  4X34 A;  1H3Z A;  1N27 A;  1OYX A;  4XTV A;  4C5I A;  3QUI A;  3MHX A;  1GXI E;  1LNX A;  3OYI A;  3N5B B;  4M78 B;  4HCC A;  3CCR T;  4ELY C;  5I21 A;  5LJ5 h;  1QP3 A;  1SSF A;  4M77 G;  3OYJ A;  4QQD A;  4IUT A;  5GAN 2;  4PKC C;  2FL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...