5FU7C

Drosophila nanos nbr peptide bound to the not module of the human ccr4-not complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
148
structure length
148
Chain Sequence
GPHMLELTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 1
publication title Distinct Modes of Recruitment of the Ccr4-not Complex by Drosophila and Vertebrate Nanos
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 31
structure length 148
sequence length 148
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04153 NOT2_3_5 NOT2 / NOT3 / NOT5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5fu7C00
5FU6C 5FU7B 4C0FA 4BY6B 5FU6B 4C0DC 4C0GA 5FU7C 4BY6C 4C0DB
chains in the Genus database with same CATH superfamily
1IHWA 3GP8A 1N9SA 5I2SA 1JB0E 5GAMh 3CMAQ 2EGAA 2NYSA 1U06A 3PVLA 2QK0A 5KYWB 4M77D 4RTTA 4PJOC 2EYZA 4C92B 1WJSA 5GAOl 5A0GA 1NEBA 2EQJA 1NJIU 1D3BB 1NJIR 2EAYA 3NFCA 1WHMA 4JLGA 2BUDA 2A37A 2COWA 3PGGA 2HDAA 3P8DA 2E3HA 3SHWA 4JRQA 2QAZA 4AFZC 2RD1A 2ZCFB 2J6FA 1HD3A 3UF4A 4JJNK 4DEYA 1YITT 4J9BA 1J3TA 2ECZA 3G6EA 1IREB 1VQ9Q 3QPHA 1BIAA 3TCJA 4K11A 3MEWA 4JRKA 2RQUA 2LCCA 2FB7A 1M1KU 3VRYA 1O9SA 5LL6S 1VQMQ 1S1NA 5KE2A 3SWNB 2HKQB 4DOWA 1QKWA 1K0XA 3PNWC 3UA6A 1JRIA 3D7SB 1FMKA 3DLLA 1B34A 3J81E 4FL6A 1OZ2A 1LCKA 2QDYB 1MMAA 4IIMA 4QKUA 2OTLT 2VASA 4C92G 3CCLT 2CKKA 4F04B 1Q81U 5GAN7 1OOTA 4MMKA 3HTRA 3M0TA 2DJQA 4F7UF 1TG0A 1GXIE 3TQ7P 1TU0B 4X9DA 3CCUQ 2RJEA 1QVGP 4CC2A 3PIPA 2PTKA 1ZSGA 3M5AA 1PCXA 1KJWA 1AZEA 2KSSA 4C8QE 3QG1A 1AT1B 2VV5A 3T9NA 4DBHA 1VQOQ 4OB2B 1X01A 2M0YA 4ZNXA 3CCSA 1VQOT 1WXTA 4C8QA 4KGXB 4M78E 1M1GA 2E1HA 1E6HA 1JO8A 1JBMA 2DRKA 4LUDA 3HL8A 3CC7T 1R77A 3RIRA 1W1FA 2DVEA 2F69A 5AYFA 3CCVA 4XQ3A 1K73C 4R55A 4M78A 2OJ2A 1GBRA 2DAQA 5EC7A 3LH5A 4FYYB 3MP1A 4LNPA 2RI5A 2D0QB 3OA6A 4XTZA 3QWYA 2M9UA 5KYUA 4BE1A 3M4GA 3VS6A 3CC2T 5A0DA 3EGXA 3FDRA 1QP2A 2ZGWA 1N8RR 3RKWA 1BCMA 2K4YA 1N8RC 1QW1A 1M2OA 4IURA 4XTWA 1UGSB 2DLPA 3A5ZB 5LJ5j 3LLRA 1D09B 4D8KA 2C0IA 1XOVA 3MPUB 1AD5A 4RTXA 4J9FA 2XMFA 3FLGA 1AWWA 2FPDA 4ANJA 3JB9F 1XQHA 4LDVA 3FJ5A 3LWHA 1DJ7B 4F7UB 2FEIA 4C92D 1D1BA 3URGA 5FU7C 2LCLA 2VGNA 2DO3A 1JJ2P 1VQKT 1QKXA 2DTOA 3BE3A 2Y4YA 1XJWB 3QIIA 4HA8A 1Q82C 5IXFA 2L2PA 1QVFA 2YUPA 1YIJT 1BCOA 1FMVA 2QXFA 4J6YA 2OTJT 3HFOA 2FYKA 4Y28E 2GTJA 2AKLA 4JZ3A 3G6EQ 1YFNA 3CXCA 4A4HA 4ZN1A 4DOVA 4JS5A 3X24B 3A98A 2KRNA 2FVUA 1VQ4A 5LJ3e 2ESWA 5GAOr 2J06A 1RAHB 2A36A 4OMNA 3CD6T 4OB3B 4PJOA 1WPYA 2CT4A 3U23A 4M7AG 1JU5C 4HVVA 5CO7A 4B6MA 3QXEB 3S3MA 4M7DB 1KSWA 1PSEA 3VS3A 2KDSA 2E12A 3JCMh 2CT3A 3OS1A 3C0CA 3CCET 1PWTA 1OX8A 3G71A 1NE8A 3KXTA 4WCIA 3CCRA 1TUGB 1VQNA 2D9TA 1B3QA 3G4SQ 1AWXA 4BE2A 2KRSA 2ED1A 3EG9B 3HSBA 2KMTA 3G4ST 2VGMA 3KBGA 2K2VA 3OYHA 2V1QA 4M75C 2WSEE 3CCSQ 2P4RA 4M75F 1MMGA 1FXXA 1QWEA 2FRYA 5GAN5 5CKEA 1W2BA 2KROA 1RAAB 2XICA 2HSPA 1QCFA 3EH2A 4LD6A 1NZ9A 2LJ3A 1HK9A 3M0SA 1WIEA 4MDWA 1C0MA 4M7DG 3RERA 4IIOA 2QQRA 3PMIA 1KQSP 2O88A 3EH1A 4RG2A 2E5KA 3RUXA 2P0QA 4GLMA 3V8KA 2XDPA 1X69A 3PMTA 4PLLA 4QVZA 5CK9A 2PNIA 1MV0B 1K76A 2AIRB 2MYSA 3OYFA 1FX7A 5LJ3g 4C0DC 1Q7YR 3VJPA 1VUBA 2JS2A 5GAOm 4JPBW 4ELYC 2LP5A 2LZ6B 3E1SA 2XG8D 3REBB 1XNIA 2GFUA 2P0PA 5HK0A 2XI9A 1VQ6A 1I4K1 3N5BB 3RKXA 1TTHB 4ZGDB 4BD3A 5LJ5h 3OYGA 3CPWS 5GANg 3I5RA 2CSQA 3FRNA 2E65A 3FC3A 2F5TX 3QUIA 3E9FA 2NUTA 1EFNA 2P4TA 2CSIA 4JJDA 2FZGB 1T0JA 1M5Q1 2KNBB 1UE9A 1MMNA 2RQTA 4CRIA 3QKJA 2NUPB 1UECA 2BKDN 4AFSC 1PC0A 2X51A 4F17A 2HQHA 4J9CA 2P0KA 4KUIA 3BDUA 4PJNA 1Y07A 3OMCA 9ATCB 1UG1A 1T0HA 2HL3A 5GAOp 4E7KA 5CKDA 1I07A 4TVRA 1PKSA 2RA2A 4MDXA 5LJ5f 2A3LA 2DL7A 2LT4A 4LE9A 5GAMg 3CC4A 1M4ZA 3I56T 1YCSB 2HBPA 1BIBA 3REAB 1RI9A 5IHNA 3FEOA 5HY6A 2OAUA 2QEXA 2JT4A 4Q5WA 1OULA 3NPFA 2H3EB 3OYNA 1X27A 3S6WA 2QGFB 1VQ4Q 4XU0A 3R6NA 2J6KA 4C0GA 1X75C 1Q86U 2XDDA 2FPFA 4Z88A 4J6XA 4J8OA 4WF2A 4M7DD 2JMCA 5KYNA 2EWNA 3EGUA 2AK5A 1UGQB 4N4HA 4RTZA 1YI2T 1KHCA 1NPRA 4FW2A 3L2RA 2J6OA 4OGEA 3MCAB 4BY6B 3X20B 1M90U 2RO0A 1UGPB 2HKNA 4EDUA 4IUVA 3M53A 3C12A 1BI0A 1KC8C 2LQKA 4PJLA 4RTUA 4C8QC 2M51A 1YHQQ 2KI7A 4C8QF 1VQNQ 1PHTA 1K8AU 1AHJB 3VS0A 2FZCB 3AHUA 2AT1B 2EVRA 2SEMA 3FIFA 1MGQA 3MO8A 1QVPA 2OTLA 1VOMA 3VS4A 2EYQA 2DXUA 1IB8A 1BI1A 2O31A 1R0CB 2ZPHB 1W6XA 1SSHA 3GNGA 3EFSA 5FU6C 4M78F 1TXQA 3OSSC 2HCKA 3PIOA 2EPDA 4JUVA 3DB3A 1NYFA 2L3PA 1YJ9A 2YRCA 2HQXA 2AKKA 1BYMA 2DTHA 1QP3A 2HNIA 3V7CA 2B8AA 4FM4B 4L6V5 1YJNA 1I0CA 1AWOA 3QHSA 2K79A 3GBQA 2EQMA 5FW9A 4M75A 3BFMA 5HKCA 3THKA 2RQRA 2KXDA 1UHCA 4UC4A 3JCMW 2FO0A 4M77E 1KFZA 1G8XA 2LDMA 2D0NA 5GAN6 3ZFJA 4PJMA 5CR2A 2KBTA 1AVZC 2DMOA 4BACA 4HT8A 1RLQC 2EJ9A 2MK5A 1MUZA 3TSWA 5DLOA 2PVDB 1MV3A 2K5IA 1G83A 2B86A 2G3RA 1HYOA 2ZZDA 1VQ6Q 1ZUUA 1VQLQ 2MOXA 4OMOA 4OB1B 2RH2A 1VQLT 4KBMB 2MMPA 5D7UA 3CC2A 3OYYA 3LX7A 4QW2A 3RKYA 2CP6A 2O4XA 2QDLA 3M0PA 3CCJA 5AT1B 4C5EA 3WVEB 1OZ3A 1ZUYA 1MHNA 2PQWA 3GF5A 3L2UA 2QI2A 2I0NA 2X4XA 1SHFA 1M2VB 5GANf 1QCOA 4FT2A 2QG9B 4P5NA 4DBFA 4J9GA 1ZBJA 2JTEA 3M56A 2KE9A 4C5HA 1RLPC 5HK3A 1WHGA 3CMAT 1MMDA 2RK1A 3CC4Q 1HXDA 4PJOF 3J7AF 4CC4B 1NJIC 3OYDA 3H0IA 4M78B 3X26B 3OS0A 4E7SA 3H41A 4MZMA 4GLKA 4J6WA 2QEXQ 3L2QA 1VQKA 3MJXA 4FIBA 2QGGA 3HRSA 2QA4A 5KYUB 3R6OA 2Y90A 1VQ9T 4A4KA 3EGXB 2BZ8A 4QT7A 5GAMf 5IHKA 3OS2A 1M1KR 1UTIA 1PD1A 1N9RA 4RTYA 3JCMQ 5KYYA 3L1AA 5GMKj 2WACA 1VQMT 2F5KA 1OU9A 1E6GA 1LJOA 1Z9ZA 4ATOA 1VQPA 1N27A 1SSFA 3G7ZA 2JTMA 1CSKA 1KHIA 1LVKA 2JXBA 2ED0A 1Q81R 1VQ5A 1VYVA 5LJ5e 3JCMg 2LX9A 1D0ZA 3CPWP 3A8MB 2CP3A 4O5VA 3MKDA 2CZ6B 3M59A 3JB9J 1I5LA 1I81A 2EJFA 2XK0A 3CCUT 2YT6A 3SDZA 2JW4A 3CCEA 2DJZA 4M7AC 4QQGA 2DYBA 2LMJA 1QVFS 4FSXA 2E6ZA 3JCMc 2FHDA 5C6SA 5I2MA 3EHRA 1YJ9Q 2KVQG 3CXCS 2BIVA 5J39A 1NPPA 3JCMJ 1WHJA 1VQ7A 1IXDA 2ROLA 2KYMA 2DE0X 1VYTA 2CP2A 2FZKB 1JEGA 2K9GA 2LJ0A 1ABQA 2YWWA 1TSFA 4ORZA 3JB9H 2JJ9A 3LGFA 2COZA 4ZTJA 3ME9A 1NBEB 4C92E 2K5LA 4EMKC 3A8LB 3QZ9B 3OBYA 4PJOB 2MPXC 4RG8A 4A54A 2C0OA 1LOJA 2KR3A 3I9QA 1WYXA 2CP0A 4FYXB 2E41A 2VC8A 4C92A 2EYWA 2KYBA 1D3BA 1PG5B 1K73U 4CI0C 1WJRA 3IQLA 3VKIA 4BE0A 5I21A 1YJWA 3OW2A 2CS7A 4DBRA 5KCHA 2C06A 4E7ZA 4N0AA 4LD9K 2DXBA 1ZSZC 2JUFA 1S72A 1W2BS 2R5MA 4B9WA 2YSQA 3H6ZA 2YHTA 5LJ5g 3OB9A 1R0BG 1PSFA 4JRPA 3SWNA 2LJ1A 5A2QE 4PJOG 4ZTFA 3M55A 3CCMA 4DBQA 4LDUA 2ZPGB 4JRIA 1AWJA 2RHXA 4J5YA 1H3HA 3H0FA 2CZ1B 1O75A 4V2SA 2CP7A 4M78D 1UFFA 2RN8A 2OAWA 3M9QA 2P84A 2HL5C 3RESA 3RR6A 1BK2A 4JLIA 4RMOA 1RAEB 2XU8A 4J7FA 2IIMA 3NMZC 1KD1U 1V1CA 3X28B 5IH2A 1T3LA 2F1LA 3VUBA 4OB0B 5GMKm 3BY7A 2DA9A 1YP5A 2QA4Q 1Q82U 3G6ET 3P8BB 4ME7A 5KYXA 2MWPA 4HXJA 2X3XD 2YUQA 4J9HA 5GMKh 2JZ2A 5GAOq 3QYHB 4F7UG 3FB9A 2EQIA 2AZVA 4N4IA 2VXEA 1AEYA 1D1AA 2RHYA 4QQDA 1VQPQ 4DEXA 2DX1A 2HBWA 3NGPA 5GANe 1WXBA 3OYAA 2O01E 1UGRB 1VQ5Q 4OMLA 2A0FB 3VRZA 1X2QA 3PFSA 2LVMA 4MMLA 1YWPA 4KRTA 3RDVA 2DIGA 2GTOA 4OVAA 1TOVA 1HSQA 2CH4A 3KUFA 4HCKA 3MP6A 3JCMb 2D8HA 4BI4A 4ELZC 1OPKA 1NEGA 1UDLA 2GQIA 1OPLA 4XK8E 2O2OA 3MEUA 3VUZA 2DK3A 3JCMf 3CCST 3SEMA 4D8DA 3NHNA 5GAMe 4M7AE 3ZBDA 3UT1A 4HCBA 1QCNA 5HCKA 1UJYA 3E9GA 1A0NB 1Y0MA 4PJOD 3JCMV 3EHQA 1VQ8A 4M77C 4ZGEB 3CCVQ 3C94A 5FU7B 4OMPA 3CCQA 4M7AA 1WI7A 2MWOA 2PUOB 3CCVT 3SFMA 2K3BA 5GMKi 3EG3A 4HKEA 3QZ5B 1WGSA 3M0QA 3MEAA 1OQKA 4OMQA 4A4FA 2DILA 2XDBA 3LGLA 1Q7YC 3S3NA 2KRMA 3JCMX 4X34A 1GFCA 2EKHA 2FPEA 4BUGA 2L5QA 1YJWQ 2OX7A 2ZAEA 5CQYA 3I55A 3X25B 4EMKA 2X4JA 4LDXA 4MZTA 3SD4A 1X6BA 4PFZA 3JB9G 2X3WD 3PVQA 4M7DE 3I35A 3CMEA 4IKFA 2JNGA 2RMOA 4RCBA 8AT1B 4EMGA 3A8OB 5CCAA 2DD4A 4BI3A 3VS2A 5IHIA 1RI0A 1G2BA 4RCCA 4F16A 4ZN3A 5EG2A 3OYIA 2E6NA 1R8OB 2F2VA 2QASA 4M7DA 2K57A 3CCMQ 4E7JA 2C0TA 3FJPA 1QVFP 6AT1B 5I11A 1G3WA 2DBMA 3VS5A 4BB7A 3LYIA 2RJDA 1WX6A 1BI3A 2D8JA 3CXCP 3OQ5A 1ZSZA 2EYXA 2CGHA 2HZYA 4OGCA 2O9SA 2DVJA 4M75B 2CUDA 3GNFB 1M8MA 3UWNA 4CC3A 1V76A 1OV3A 2FRWA 2ROTA 3C4SA 2DXTA 1U8RA 3OMGA 1K9MU 2E70A 1EX4A 4NL2A 4HVWA 2CZ7B 2F2XA 1Q86R 4OP0A 1VQ4T 2EBPA 4BDZA 1RAGB 5GJWB 1YITA 3L2WA 1B07A 4II1A 5IXBA 4PKCC 1WNLA 1M90R 2QQBA 1Y57A 2W10A 2O4XB 4C0DB 1RAIB 3G71Q 1UHFA 1KQ2A 3CCRQ 2CYZB 2RB6A 3EG0A 2CREA 3EFOA 4J7IA 4M75G 3G71T 1K8AR 2DFUA 1YHQT 2L3RA 3CCRT 1W2BP 2A7YA 1VQNT 2K3YA 2V8IA 2GCXA 5GAOn 2EW3A 4ZGJB 1G3TA 3OYEA 3CCLA 1KC8U 2JMAA 5GMKl 1YN8A 1GL5A 2VVKA 3V7RA 4XTVA 1RABB 3JB9D 3HP9A 1Y96A 1GFDA 3DKMA 3LH0A 2CDTA 2QQSA 4C5IA 3J80E 1I8FA 3WVDB 3INZA 5LJ3d 4C92C 1IHVA 3UDCA 1W70A 2RK2A 4C92F 2HD0A 7AT1B 3V8LA 1VQ8Q 4A63B 3ER0A 3HRTA 3V8JA 4AG2C 3VYGA 4QQ6A 4KT0E 1VQOA 2HSEB 3CCQQ 1QVGA 3VS1A 2E10A 2IG0A 3E2UA 1IZ6A 4N0AC 2EGEA 4EPCA 2CP5A 4X9CA 4LXCA 2VYTA 3PE0A 5KYYB 3HRUA 1CKAA 1C6VX 5GANd 3CC7A 1CKBA 1B34B 1WZOA 3GIBA 2L0AA 2DL3A 4A53A 1QWFA 3SWNC 4FSSA 4A4GA 1Y71A 3OYBA 3NTKA 1LNXA 1SKUB 5DM7R 4DA4A 1Q95G 3I55Q 1MNDA 4M77A 4FYVB 1OX9A 3JCMe 3CMEQ 1GCPA 1VQ6T 2Y4XA 5GAN4 2KK4A 4DQ2A 1UJ0A 1UB4A 1VYUA 4FW1A 2K5FA 4Y92A 2YUOA 5GAMd 3QSUA 4A4EA 4M4ZA 4C0ZA 2LQNA 1F1BB 5DLQE 1X2KA 2D1XA 4JDSA 3OBWA 2NWMA 4C8QB 5FWCA 1JXMA 3LWIA 1WDXA 3EG2A 4NS5A 3EGDA 4M75D 1ZLMA 4OF1A 2G6FX 5ECAA 1ABOA 4QVDA 1RAFB 4RUGA 1BI2A 3JAME 4R56A 2WSCE 1M1FA 2BZYA 1YWOA 3CC4T 5FU6B 5CIUA 1K1ZA 1AOJA 4XTYA 4B9XA 3O8VA 2KAFA 2AZSA 1ZX6A 4AFQC 2QEXT 3JCMP 2EFIA 2PVGB 2EIFA 1KQSS 3JB9I 3OW2S 2DXCA 1YIJA 5D6YA 1NLOC 1X43A 1T3SA 2K3XA 2OTJA 2DERA 2LNVA 5FWBA 1YITQ 4FT4A 1IO6A 2ZPFB 3M57A 4LUEA 2RJFA 4GBQA 5I22A 1M1KC 1E7OA 1GBQA 2V8JA 5L23A 3JSCA 2HAXA 4C8QG 1JJ2A 8ATCB 3META 1N6AA 4YTLA 3M4YA 1VIEA 4IUUA 4X1VA 4KH1B 3OY9A 3CD6A 5CKHA 4E7HA 1OI1A 2EQUA 1KG1A 2EQKA 5CKBA 1WHLA 2HQEA 4OMMA 1M3CA 2DTIA 2LT1A 4KULA 1Q81C 1Y7XA 1K9AA 3UATA 3NTHA 5FROA 4M78G 3V7SA 3A8GB 2PVOB 2L3QA 2OTLQ 1RACB 3HKSA 3CCLQ 1I5OB 4CC7A 1K4US 3M0UA 4M7AF 3L2ZA 4JJBA 1YCYA 2LQWA 3VS7A 1M9SA 1GRIA 4LN2A 2ZPBB 3G4SA 2ZPEB 1SHGA 2QQAA 2A28A 1YJ9T 3O5ZA 4LDWA 2XIDA 1FWZA 4Z89A 4E7IA 1M30A 2F2WA 2HEQA 2LQ8A 3F70A 1XTDA 4RKUE 2R57A 3H9NA 4E6RA 3MEVA 1YJNQ 1QQJA 2QQ9A 1IGQA 2BE9B 2DBKA 5IN1A 5KYXB 1YJNT 4EMHA 1C1AA 2A08A 3CC7Q 1M2VA 3AT1B 3RMQA 4JZ4A 3GOXA 2PZ1A 1ARKA 5C0MA 4NL3A 3I5SA 5KYWA 1UGVA 1RUWA 4E47A 1K73R 2R5AA 3MP8A 2JM8A 4M7DC 1SRMA 5CKFA 1WHHA 4M7DF 2DL5A 4JS4A 2ATCB 3KFVA 1SF9A 1KQSA 2COYA 2XD0A 3EG1A 1Z9QA 5KH6A 4VUBA 1MNEA 3HPWA 3CC2Q 4FCYA 2ABLA 4PFPA 2HMAA 3CPFA 2KEAA 3A8HB 2YLCA 3CCJQ 1GCQA 3CBMA 1VIFA 1N8RU 4C8QD 2ZPIB 4PK4A 4FU6A 1RL2A 2LNHB 4NOYA 2DYIA 3CCJT 1UUEA 3GLXA 2BZXA 5CVIA 2DNUA 1YBYA 4J9EA 4Z8AA 4Y91A 3S3OA 2DPPB 2CZ0B 2MI6A 3CBPA 3H8ZA 2EGCA 3QBYA 2SRCA 1B7TA 2GBQA 5J3BA 4M7AB 1WQ7A 1PRMC 4LDYA 2DD5A 1WXUA 1KD1R 3JRZA 2XKOC 1KD1C 2EYYA 2MAMA 1VQKQ 3TVTA 1YIJQ 1Q82R 3TREA 3I56A 3OSVA 2OTJQ 1OYXA 1G3SA 1WLPB 3JCMd 4E7LA 2QA4T 3ASKA 1RADB 2LCSA 4R0KA 1WQWA 4KGVB 4RTWA 4XTXA 4PJOE 4EMKB 1ACMB 4Z02A 2E5QA 2RHZA 2DZCA 2DF6A 3CD6Q 3QYGB 5J26A 3A1PA 3QDFA 2QTVA 2QYZA 2NUTB 4BI8B 2ENMA 5GAN3 1VQPT 3SB2A 4AG1C 1YI2A 2MCNA 1BBZA 2YLBA 4XTUA 1VQ5T 1G3YA 1H8KA 2OI3A 2VKNA 4HVUA 2DM1A 3C95A 3EFRA 1ZUKA 2YRVA 3CCEQ 1PM3A 4KH0B 3BDLA 2DIQA 4AMCA 3UA7A 3DLMA 1U1TA 1WJQA 1ZSZB 2JOYA 1OEBA 2RM4A 4ESRA 1YHQA 3VV0A 2LTOA 4JJCA 2FG0A 2VXFA 3JV3A 2KXCA 1D0YA 1VQ7Q 4J9DA 3ULRB 5FRMA 2X9HA 4F7UE 2MF2A 3MHXA 1VQ7T 4D6WA 2DL8A 4C0FA 4WTOB 4RTVA 4M77F 1P92A 3H0HA 5FRNA 2DEQA 2QTXA 2O9VA 1QLYA 1YNZA 5IAYA 1JQQA 1X6GA 1SRLA 4F7UA 3HFNA 2VB6A 5L8RE 4HT9A 2RF0A 3OW2P 4KUDK 1WFWA 2NLUA 2V1RA 1TUDA 2VWFA 2J7IA 4XAXB 3RNJA 3WXMB 1NYGA 5LJ5d 2GQVA 1D1CA 3QJ6A 3OYMA 2IPOB 2RI3A 2X35A 4HCCA 3P8HA 4BY6C 1TUCA 3EFOB 1LPLA 2H3JA 1I1JA 2H8HA 5LJ3j 3Q1JA 1YJWT 2NUZA 1K0SA 2RI2A 1IRXA 1D0XA 1Q7YU 1S72Q 1EIFA 2LRQA 1H641 2CH4W 1BKBA 1OU8A 1BU1A 2KT1A 1N5ZA 2JVVA 2DL4A 5D6XA 1S72T 1M8VA 2E3IA 2K2MA 2RHIA 1Y96B 1PKTA 3OYCA 4QVCA 4E2FB 2Z0WA 3G1JA 1M3AA 1BB9A 3GPLA 1VQLA 5GANj 1HJDA 2DRMA 1X6OA 1NG2A 2RHUA 5CAIA 2DETA 4BDYA 2W0ZA 1QVGS 3CCMT 4M7AD 2YRDA 2DKGA 1ZA2B 2GFAA 2KGTA 4O6JA 4PNOA 5KE3A 3CEYA 3EG9A 1SPKA 2M1HA 2J05A 1M27C 3UPUA 5GAN8 3VU3C 5M9OA 2BTTA 1K9MR 3CMAA 1FMWA 5GAMj 1K9MC 3I56Q 2V26A 3BW1A 1EZZB 4HCZA 2DZ9A 2DEUA 1WA7A 4L5GA 2LX7A 2FL7A 1Q86C 1FYNA 4M77B 3ZEHA 1TS9A 2JN0A 2BE7D 4FYWB 2MIOA 3M0RA 1ZQ1A 3RBBB 5KCOA 1H92A 3QWXX 4MZPA 2KQWA 1VQ9A 1M90C 3OYJA 1KQ1A 3L42A 1YI2Q 5GJVB 2JS0A 5D6WA 2K7AA 1VA7A 1VQMA 2X4WA 3ZL7C 1K8AC 3QDRB 2M16A 1SEMA 3PTAA 1U5SA 1W4SA 3EGDB 1KC8R 2YXYA 4XU3A 2KY9A 4EIKA 1PD0A 3NTIA 2E4HA 2JTFA 4IUPA 4F14A 1JXOA 2YDLA 2RQVA 3OYLA 4M77G 1TH7A 2GNCA 5GAN2 3CCUA 1AZGB 3M58A 1ZA1B 2L8DA 1U1SA 4OMFB 1NM7A 2LC4A 3CBOA 4J9IA 4J83A 5DY9A 4M78C 3CPWA 2V8KA 4GY5A 3QO3A 1VQ8T 5FLXE 1JJ2S 2VUBA 2L3SA 2IVWA 1PNJA 2PUKB 3CQTA 3CCQT 2NUPA 1SG5A 4XU1A 3M54A 4M75E 1U3OA 1GCQC 3EAEA 3TU4K 4IUQA 2L89A 3LW5E 2GGRA 2AHJB 4XU2A 2K6DA 2X4YA 1QMCA 4PJJA 4AFUC 5GMKe 3RMSA 2RJCA 2I2LA 3VYHB 5LJ3h 2GF7A 5A0LA 4IUTA 3TEEA 1V29B 2RNAA 1IGUA 3I55T 1ZBXA 2WSFE 4L59A 2M0OA 3OS5A 2M02A 2PU9B 1NLPC 2RPNA 3CMET 1TWBA 2R58A 2XHCA 1G5VA 2CUBA 5GANh 1WHKA 4C5GA 4N4GA 1M3BA 4PFOA 3TSZA 4PL6A 1ZHIA 1PRLC 1KIKA 3HHTB 4AT1B 1UEBA 2KT8A 5LJ3f 5IT9E 4KGZB 2EKOA 3DB4A 2JM9A 3L2VA 2YUNA 3E19A 3QJYA 2RQWA 3OYKA 2E64A 2D6FA 1KK7A 3PT9A 1H3ZA 5CQXA 2EJGA 4PLIA
chains in the Genus database with same CATH topology
3HPWA 3MCAB 3GP8A 4BY6B 3X20B 1N9SA 1M90U 5I2SA 1JB0E 5GAMh 2RO0A 1UGPB 3E9GA 3CPFA 4PJOD 3A8HB 4EDUA 4M77D 3JCMV 4PJOC 2YLCA 4IUVA 3M53A 4C92B 1WJSA 4M77C 4ZGEB 2EQJA 3CBMA 5A0GA 1D3BB 3C12A 2EAYA 1BI0A 3C94A 1VIFA 3NFCA 1KC8C 2LQKA 4JLGA 5FU7B 4C8QD 2ZPIB 1N8RU 3CCQA 2BUDA 4FU6A 1RL2A 4C8QC 4M7AA 4NOYA 2MWOA 3CCJT 3PGGA 2PUOB 4C8QF 3CCVT 3P8DA 3GLXA 4JRQA 5CVIA 2RD1A 2ZCFB 1AHJB 3SFMA 1K8AU 4HCBA 3AHUA 5GMKi 1YBYA 3FIFA 4HKEA 3QZ5B 1WGSA 4JJNK 1MGQA 3MO8A 4Y91A 1YITT 1QVPA 3S3OA 2OTLA 3G6EA 3MEAA 2DPPB 2EYQA 2DXUA 2CZ0B 1IREB 2MI6A 4A4FA 3CBPA 3H8ZA 3LGLA 3QPHA 2XDBA 1Q7YC 3S3NA 1BI1A 3JCMX 1BIAA 3TCJA 4X34A 2ZPHB 3QBYA 3GNGA 3EFSA 5FU6C 4M78F 3MEWA 4JRKA 4BUGA 2L5QA 3OSSC 2LCCA 2FB7A 5J3BA 5CQYA 4M7AB 3PIOA 1WQ7A 4JUVA 1M1KU 1O9SA 5LL6S 3DB3A 5KE2A 3SWNB 3I55A 4DOWA 1YJ9A 4LDYA 3PNWC 3JRZA 1JRIA 3X25B 2XKOC 4EMKA 2X4JA 4LDXA 4MZTA 2HQXA 1KD1C 3SD4A 3DLLA 3JB9G 1B34A 1BYMA 2MAMA 4FL6A 2DTHA 3J81E 3CMEA 4M7DE 1KHCA 1QP3A 2HNIA 4IKFA 1OZ2A 2QDYB 3V7CA 2JNGA 2B8AA 4RCBA 4FM4B 4L6V5 4EMGA 3A8OB 2OTLT 5CCAA 3TREA 1YJNA 3I56A 4C92G 2DD4A 4BI3A 2CKKA 3CCLT 3OSVA 1OYXA 1Q81U 5GAN7 3QHSA 1G3SA 1RI0A 4MMKA 4RCCA 3JCMd 4E7LA 2QA4T 2EQMA 4M75A 3BFMA 4F7UF 3ASKA 5EG2A 4ZN3A 5HKCA 2E6NA 1R8OB 3OYIA 1GXIE 4X9DA 1WQWA 1KD1U 4M7DA 2RJEA 2K57A 4UC4A 4XTXA 4PJOE 3JCMW 4EMKB 3PIPA 4M77E 4E7JA 3M5AA 2E5QA 3FJPA 4Z02A 2LDMA 5GAN6 2RHZA 2KSSA 4C8QE 2DZCA 3QG1A 1G3WA 4BB7A 3ZFJA 3LYIA 2RJDA 2VV5A 1BI3A 5CR2A 3T9NA 3QYGB 5J26A 3OQ5A 4OB2B 4BACA 1X01A 4HT8A 2CGHA 4BI8B 3CCSA 2EJ9A 5GAN3 1VQPT 4OGCA 3SB2A 1VQOT 5DLOA 2PVDB 1YI2A 4M75B 2K5IA 3GNFB 2G3RA 2ZZDA 2YLBA 4XTUA 1VQ5T 4C8QA 3UWNA 1G3YA 1M1GA 4M78E 2E1HA 4OB1B 2RH2A 3C4SA 4KBMB 1VQLT 2MMPA 3C95A 2DXTA 3EFRA 1U8RA 3OMGA 2YRVA 5GAOl 1JBMA 3OYYA 1K9MU 3CC2A 3LX7A 3BDLA 2DIQA 3HL8A 3CC7T 2E70A 4QW2A 3RKYA 3RIRA 4NL2A 2O4XA 2CZ7B 2DVEA 2F69A 3CCJA 3DLMA 1U1TA 1WJQA 5AYFA 3CCVA 4OP0A 1VQ4T 2JOYA 4XQ3A 4C5EA 4BDZA 2RM4A 3WVEB 4R55A 1YHQA 1K73C 3VV0A 4M78A 2LTOA 1OZ3A 2VXFA 1YITA 2DAQA 1MHNA 2PQWA 3GF5A 3L2UA 2QI2A 3MP1A 3L2WA 2X4XA 2RI5A 5FRMA 2D0QB 4II1A 3OA6A 4F7UE 5GANf 4PKCC 4XTZA 4FT2A 1WNLA 2MF2A 3MHXA 1VQ7T 2QQBA 4P5NA 4D6WA 4C0FA 1Q81C 2M9UA 3M56A 4C5HA 4BE1A 2O4XB 3M4GA 3CC2T 5HK3A 3CMAT 2RK1A 4C0DB 1HXDA 4PJOF 5A0DA 3FDRA 1QP2A 2ZGWA 4M77F 1P92A 3RKWA 5FRNA 3J7AF 1NJIC 2K4YA 3OYDA 2DEQA 2QTXA 1N8RC 1KQ2A 2CYZB 1QW1A 2RB6A 4M78B 3X26B 5IAYA 4J7IA 4IURA 4M75G 3OS0A 3G71T 4F7UA 3HFNA 4MZMA 4GLKA 4J6WA 4XTWA 1UGSB 2L3RA 5L8RE 3CCRT 1YHQT 4HT9A 2A7YA 1VQNT 2K3YA 2V8IA 2GCXA 4KUDK 3L2QA 5GAOn 3A5ZB 4ZGJB 1G3TA 2NLUA 5LJ5j 3LLRA 4XAXB 3WXMB 3OYEA 1KC8U 1VQKA 3CCLA 5GMKl 4FIBA 5LJ5d 3HRSA 2GQVA 2QA4A 3QJ6A 3OYMA 3R6OA 1XOVA 3V7RA 2RI3A 4XTVA 2X35A 2Y90A 1Y96A 3HP9A 4A4KA 3JB9D 1VQ9T 4HCCA 5GAMf 3FLGA 3DKMA 3P8HA 3LH0A 3JB9F 4BY6C 3OS2A 1XQHA 2QQSA 4LDVA 4C5IA 3JCMQ 1DJ7B 1N9RA 1I8FA 2H3JA 3J80E 3WVDB 3L1AA 5LJ3j 3LWHA 3INZA 3Q1JA 4F7UB 1YJWT 4C92D 5LJ3d 5GMKj 2RI2A 2WACA 1VQMT 4C92C 1Q7YU 2F5KA 3UDCA 3URGA 4C92F 1EIFA 2LRQA 2RK2A 1H641 5FU7C 1LJOA 1BKBA 2HD0A 4ATOA 2LCLA 3V8LA 2VGNA 3ER0A 3HRTA 2DO3A 1N27A 1SSFA 2JVVA 3V8JA 3VYGA 5D6XA 3G7ZA 1VQPA 2JTMA 4KT0E 4QQ6A 1VQOA 1S72T 1M8VA 1KHIA 1QVGA 1VQKT 4HA8A 2DTOA 2Y4YA 2E10A 2IG0A 2RHIA 1Y96B 3QIIA 1Q82C 3OYCA 4QVCA 1VQ5A 1IZ6A 4N0AC 4EPCA 1QVFA 4X9CA 5LJ5e 1YIJT 3JCMg 2LX9A 2VYTA 3A8MB 2QXFA 3GPLA 4J6YA 1VQLA 3HFOA 2FYKA 4O5VA 4Y28E 5GANj 2OTJT 3HRUA 2CZ6B 3M59A 3JB9J 1X6OA 1I5LA 5GANd 1I81A 2EJFA 3CC7A 2RHUA 3CXCA 5CAIA 4A4HA 4BDYA 2XK0A 3CCUT 1B34B 1QVGS 4ZN1A 3CCMT 3GIBA 3CCEA 3SDZA 4M7AD 4DOVA 2DKGA 2DJZA 3X24B 4JS5A 4M7AC 2GFAA 2FVUA 4QQGA 1VQ4A 5LJ3e 4A53A 1QVFS 4O6JA 3SWNC 4FSXA 5GAOr 4PNOA 2E6ZA 3JCMc 5KE3A 4A4GA 1Y71A 3CD6T 3OYBA 3NTKA 1LNXA 2FHDA 4OB3B 5I2MA 3ZBDA 5C6SA 5DM7R 4DA4A 4PJOA 1WPYA 4M77A 2KVQG 3CXCS 3CEYA 4M7AG 5CO7A 2BIVA 3QXEB 3S3MA 5J39A 2M1HA 4M7DB 1NPPA 3JCMJ 1VQ7A 3JCMe 1PSEA 3UPUA 5GAN8 3VU3C 1VQ6T 5M9OA 2Y4XA 5GAN4 3CMAA 2KDSA 2E12A 2KK4A 3JCMh 4DQ2A 1UB4A 5GAMj 1K9MC 2K5FA 3JB9H 3BW1A 3OS1A 3LGFA 5GAMd 4ZTJA 3CCET 3ME9A 3QSUA 4HCZA 2DZ9A 4C92E 2K5LA 4EMKC 4A4EA 3G71A 4L5GA 1NE8A 1Q86C 2FL7A 3A8LB 4C0ZA 3KXTA 3QZ9B 3OBYA 5DLQE 4PJOB 3CCRA 4M77B 3ZEHA 4RG8A 2D9TA 4A54A 1VQNA 2JN0A 4BE2A 1LOJA 4JDSA 1ZQ1A 3OBWA 4C8QB 3HSBA 2KMTA 3G4ST 2VGMA 5KCOA 3LWIA 2VC8A 2E41A 3KBGA 4MZPA 2KQWA 2K2VA 3OYHA 4NS5A 4M75D 4C92A 1NJIU 1VQ9A 1M90C 1D3BA 4M75C 4OF1A 1K73U 2WSEE 3OYJA 1KQ1A 3L42A 4M75F 1WJRA 4QVDA 4CI0C 1FXXA 5GAN5 5CKEA 3VKIA 1W2BA 4BE0A 5I21A 1BI2A 2XICA 3JAME 4R56A 1YJWA 3OW2A 2CS7A 5D6WA 5KCHA 2WSCE 1M1FA 3CC4T 4LD6A 1VQMA 1NZ9A 2X4WA 5FU6B 5CIUA 1HK9A 2C06A 4N0AA 4LD9K 4MDWA 4M7DG 4XTYA 2DXBA 3RERA 1K8AC 4B9XA 2QQRA 3PMIA 3O8VA 2KAFA 2M16A 3QDRB 2JUFA 1S72A 4RG2A 3PTAA 5KH6A 2QEXT 3JCMP 2EFIA 2PVGB 2P0QA 3RUXA 2EIFA 3V8KA 2XDPA 1W2BS 1W4SA 1KQSS 2R5MA 3JB9I 4B9WA 3OW2S 3H6ZA 2YHTA 4XU3A 2DXCA 5LJ5g 3PMTA 1YIJA 2KY9A 5D6YA 3OB9A 3NTIA 4PLLA 2K3XA 2OTJA 1PSFA 4QVZA 2JTFA 4IUPA 2LNVA 3SWNA 5CK9A 4JRPA 4FT4A 2ZPFB 3M57A 5A2QE 4PJOG 2RJFA 3OYLA 4ZTFA 4M77G 1TH7A 5GAN2 1M1KC 2V8JA 3CCUA 3M55A 3JSCA 3CCMA 2HAXA 4C8QG 4LDUA 1JJ2A 3OYFA 3M58A 1FX7A 5LJ3g 3META 4C0DC 2ZPGB 4JRIA 1N6AA 2RHXA 4J5YA 4YTLA 2L8DA 3VJPA 3M4YA 1U1SA 1VIEA 1O75A 2CZ1B 2LC4A 3CBOA 4IUUA 4J83A 4M78D 4OMFB 1VUBA 4V2SA 5DY9A 3OY9A 3CD6A 4M78C 3M9QA 5CKHA 4OGEA 3CPWA 5GAOm 4E7HA 1OI1A 2V8KA 2EQUA 3RESA 4ELYC 1KG1A 2EQKA 4JLIA 4GY5A 3QO3A 5CKBA 4RMOA 1VQ8T 2XU8A 2HQEA 3E1SA 5FLXE 4J7FA 2XG8D 1XNIA 1JJ2S 2VUBA 2DTIA 2IVWA 2GFUA 2LT1A 2P0PA 1Y7XA 2PUKB 4KULA 3CCQT 3NTHA 5FROA 3X28B 5HK0A 4M78G 2XI9A 4XU1A 3V7SA 3A8GB 3M54A 4M75E 1I4K1 3N5BB 2PVOB 1VQ6A 3RKXA 1VQ8A 4ZGDB 4BD3A 5LJ5h 3VUBA 3OYGA 3CPWS 5GANg 4OB0B 3EAEA 3FRNA 3HKSA 3TU4K 4IUQA 2E65A 5GMKm 3BY7A 2L89A 3LW5E 3FC3A 2AHJB 2F5TX 3QUIA 1Q82U 3G6ET 4XU2A 2X4YA 3E9FA 4M7AF 3L2ZA 1YCYA 2P4TA 5GMKe 3P8BB 3RMSA 2RJCA 4ME7A 2I2LA 3VYHB 2MWPA 1M9SA 5LJ3h 1M5Q1 2GF7A 5A0LA 2ZPBB 4IUTA 4CRIA 5GMKh 2JZ2A 3QKJA 5GAOq 3G4SA 2ZPEB 2BKDN 1V29B 3TEEA 2QQAA 3I55T 2P0KA 3QYHB 4KUIA 4F7UG 3BDUA 3FB9A 1YJ9T 1Y07A 1ZBXA 2WSFE 1FWZA 2XIDA 2VXEA 3OMCA 4L59A 4LDWA 4N4IA 5GAOp 4E7IA 4E7KA 2M0OA 2RHYA 5CKDA 4QQDA 2LQ8A 3F70A 3OS5A 4TVRA 1XTDA 2PU9B 4RKUE 3L2RA 2R57A 3CMET 2RA2A 5GANe 3MEVA 3OYAA 5LJ5f 2O01E 4MDXA 2R58A 2QQ9A 2XHCA 2A3LA 1UGRB 2LT4A 5GAMg 1G5VA 3CC4A 5IN1A 1M4ZA 5GANh 3I56T 1YJNT 3PFSA 2HBPA 1BIBA 4C5GA 2LVMA 4N4GA 4MMLA 4EMHA 4PL6A 1ZHIA 2DIGA 3FEOA 3HHTB 4OVAA 5HY6A 2OAUA 2QEXA 1UEBA 4Q5WA 3RMQA 5LJ3f 3GOXA 5IT9E 3OYNA 3KUFA 3S6WA 2EKOA 5C0MA 3DB4A 4NL3A 4XU0A 3MP6A 3JCMb 3L2VA 4C0GA 1X75C 3E19A 1Q86U 4E47A 2XDDA 4BI4A 3QJYA 4ELZC 2R5AA 4J6XA 3MP8A 4J8OA 4WF2A 4M7DD 3OYKA 4M7DC 2EWNA 5CKFA 4XK8E 3MEUA 2E64A 1UGQB 4N4HA 3VUZA 4JS4A 1KQSA 2D6FA 2DK3A 4M7DF 3JCMf 3CCST 2XD0A 2EJGA 3PT9A 1H3ZA 5GAMe 5CQXA 4M7AE 1YI2T 1NPRA 3UT1A 4VUBA 2DD5A 4PLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FU6 C;  5FU7 B;  4C0F A;  4BY6 B;  5FU6 B;  4C0D C;  4C0G A;  5FU7 C;  4BY6 C;  4C0D B; 
#chains in the Genus database with same CATH topology
 1IHW A;  3GP8 A;  1N9S A;  5I2S A;  1JB0 E;  5GAM h;  3CMA Q;  2EGA A;  2NYS A;  1U06 A;  3PVL A;  2QK0 A;  5KYW B;  4M77 D;  4RTT A;  4PJO C;  2EYZ A;  4C92 B;  1WJS A;  5GAO l;  5A0G A;  1NEB A;  2EQJ A;  1NJI U;  1D3B B;  1NJI R;  2EAY A;  3NFC A;  1WHM A;  4JLG A;  2BUD A;  2A37 A;  2COW A;  3PGG A;  2HDA A;  3P8D A;  2E3H A;  3SHW A;  4JRQ A;  2QAZ A;  4AFZ C;  2RD1 A;  2ZCF B;  2J6F A;  1HD3 A;  3UF4 A;  4JJN K;  4DEY A;  1YIT T;  4J9B A;  1J3T A;  2ECZ A;  3G6E A;  1IRE B;  1VQ9 Q;  3QPH A;  1BIA A;  3TCJ A;  4K11 A;  3MEW A;  4JRK A;  2RQU A;  2LCC A;  2FB7 A;  1M1K U;  3VRY A;  1O9S A;  5LL6 S;  1VQM Q;  1S1N A;  5KE2 A;  3SWN B;  2HKQ B;  4DOW A;  1QKW A;  1K0X A;  3PNW C;  3UA6 A;  1JRI A;  3D7S B;  1FMK A;  3DLL A;  1B34 A;  3J81 E;  4FL6 A;  1OZ2 A;  1LCK A;  2QDY B;  1MMA A;  4IIM A;  4QKU A;  2OTL T;  2VAS A;  4C92 G;  3CCL T;  2CKK A;  4F04 B;  1Q81 U;  5GAN 7;  1OOT A;  4MMK A;  3HTR A;  3M0T A;  2DJQ A;  4F7U F;  1TG0 A;  1GXI E;  3TQ7 P;  1TU0 B;  4X9D A;  3CCU Q;  2RJE A;  1QVG P;  4CC2 A;  3PIP A;  2PTK A;  1ZSG A;  3M5A A;  1PCX A;  1KJW A;  1AZE A;  2KSS A;  4C8Q E;  3QG1 A;  1AT1 B;  2VV5 A;  3T9N A;  4DBH A;  1VQO Q;  4OB2 B;  1X01 A;  2M0Y A;  4ZNX A;  3CCS A;  1VQO T;  1WXT A;  4C8Q A;  4KGX B;  4M78 E;  1M1G A;  2E1H A;  1E6H A;  1JO8 A;  1JBM A;  2DRK A;  4LUD A;  3HL8 A;  3CC7 T;  1R77 A;  3RIR A;  1W1F A;  2DVE A;  2F69 A;  5AYF A;  3CCV A;  4XQ3 A;  1K73 C;  4R55 A;  4M78 A;  2OJ2 A;  1GBR A;  2DAQ A;  5EC7 A;  3LH5 A;  4FYY B;  3MP1 A;  4LNP A;  2RI5 A;  2D0Q B;  3OA6 A;  4XTZ A;  3QWY A;  2M9U A;  5KYU A;  4BE1 A;  3M4G A;  3VS6 A;  3CC2 T;  5A0D A;  3EGX A;  3FDR A;  1QP2 A;  2ZGW A;  1N8R R;  3RKW A;  1BCM A;  2K4Y A;  1N8R C;  1QW1 A;  1M2O A;  4IUR A;  4XTW A;  1UGS B;  2DLP A;  3A5Z B;  5LJ5 j;  3LLR A;  1D09 B;  4D8K A;  2C0I A;  1XOV A;  3MPU B;  1AD5 A;  4RTX A;  4J9F A;  2XMF A;  3FLG A;  1AWW A;  2FPD A;  4ANJ A;  3JB9 F;  1XQH A;  4LDV A;  3FJ5 A;  3LWH A;  1DJ7 B;  4F7U B;  2FEI A;  4C92 D;  1D1B A;  3URG A;  5FU7 C;  2LCL A;  2VGN A;  2DO3 A;  1JJ2 P;  1VQK T;  1QKX A;  2DTO A;  3BE3 A;  2Y4Y A;  1XJW B;  3QII A;  4HA8 A;  1Q82 C;  5IXF A;  2L2P A;  1QVF A;  2YUP A;  1YIJ T;  1BCO A;  1FMV A;  2QXF A;  4J6Y A;  2OTJ T;  3HFO A;  2FYK A;  4Y28 E;  2GTJ A;  2AKL A;  4JZ3 A;  3G6E Q;  1YFN A;  3CXC A;  4A4H A;  4ZN1 A;  4DOV A;  4JS5 A;  3X24 B;  3A98 A;  2KRN A;  2FVU A;  1VQ4 A;  5LJ3 e;  2ESW A;  5GAO r;  2J06 A;  1RAH B;  2A36 A;  4OMN A;  3CD6 T;  4OB3 B;  4PJO A;  1WPY A;  2CT4 A;  3U23 A;  4M7A G;  1JU5 C;  4HVV A;  5CO7 A;  4B6M A;  3QXE B;  3S3M A;  4M7D B;  1KSW A;  1PSE A;  3VS3 A;  2KDS A;  2E12 A;  3JCM h;  2CT3 A;  3OS1 A;  3C0C A;  3CCE T;  1PWT A;  1OX8 A;  3G71 A;  1NE8 A;  3KXT A;  4WCI A;  3CCR A;  1TUG B;  1VQN A;  2D9T A;  1B3Q A;  3G4S Q;  1AWX A;  4BE2 A;  2KRS A;  2ED1 A;  3EG9 B;  3HSB A;  2KMT A;  3G4S T;  2VGM A;  3KBG A;  2K2V A;  3OYH A;  2V1Q A;  4M75 C;  2WSE E;  3CCS Q;  2P4R A;  4M75 F;  1MMG A;  1FXX A;  1QWE A;  2FRY A;  5GAN 5;  5CKE A;  1W2B A;  2KRO A;  1RAA B;  2XIC A;  2HSP A;  1QCF A;  3EH2 A;  4LD6 A;  1NZ9 A;  2LJ3 A;  1HK9 A;  3M0S A;  1WIE A;  4MDW A;  1C0M A;  4M7D G;  3RER A;  4IIO A;  2QQR A;  3PMI A;  1KQS P;  2O88 A;  3EH1 A;  4RG2 A;  2E5K A;  3RUX A;  2P0Q A;  4GLM A;  3V8K A;  2XDP A;  1X69 A;  3PMT A;  4PLL A;  4QVZ A;  5CK9 A;  2PNI A;  1MV0 B;  1K76 A;  2AIR B;  2MYS A;  3OYF A;  1FX7 A;  5LJ3 g;  4C0D C;  1Q7Y R;  3VJP A;  1VUB A;  2JS2 A;  5GAO m;  4JPB W;  4ELY C;  2LP5 A;  2LZ6 B;  3E1S A;  2XG8 D;  3REB B;  1XNI A;  2GFU A;  2P0P A;  5HK0 A;  2XI9 A;  1VQ6 A;  1I4K 1;  3N5B B;  3RKX A;  1TTH B;  4ZGD B;  4BD3 A;  5LJ5 h;  3OYG A;  3CPW S;  5GAN g;  3I5R A;  2CSQ A;  3FRN A;  2E65 A;  3FC3 A;  2F5T X;  3QUI A;  3E9F A;  2NUT A;  1EFN A;  2P4T A;  2CSI A;  4JJD A;  2FZG B;  1T0J A;  1M5Q 1;  2KNB B;  1UE9 A;  1MMN A;  2RQT A;  4CRI A;  3QKJ A;  2NUP B;  1UEC A;  2BKD N;  4AFS C;  1PC0 A;  2X51 A;  4F17 A;  2HQH A;  4J9C A;  2P0K A;  4KUI A;  3BDU A;  4PJN A;  1Y07 A;  3OMC A;  9ATC B;  1UG1 A;  1T0H A;  2HL3 A;  5GAO p;  4E7K A;  5CKD A;  1I07 A;  4TVR A;  1PKS A;  2RA2 A;  4MDX A;  5LJ5 f;  2A3L A;  2DL7 A;  2LT4 A;  4LE9 A;  5GAM g;  3CC4 A;  1M4Z A;  3I56 T;  1YCS B;  2HBP A;  1BIB A;  3REA B;  1RI9 A;  5IHN A;  3FEO A;  5HY6 A;  2OAU A;  2QEX A;  2JT4 A;  4Q5W A;  1OUL A;  3NPF A;  2H3E B;  3OYN A;  1X27 A;  3S6W A;  2QGF B;  1VQ4 Q;  4XU0 A;  3R6N A;  2J6K A;  4C0G A;  1X75 C;  1Q86 U;  2XDD A;  2FPF A;  4Z88 A;  4J6X A;  4J8O A;  4WF2 A;  4M7D D;  2JMC A;  5KYN A;  2EWN A;  3EGU A;  2AK5 A;  1UGQ B;  4N4H A;  4RTZ A;  1YI2 T;  1KHC A;  1NPR A;  4FW2 A;  3L2R A;  2J6O A;  4OGE A;  3MCA B;  4BY6 B;  3X20 B;  1M90 U;  2RO0 A;  1UGP B;  2HKN A;  4EDU A;  4IUV A;  3M53 A;  3C12 A;  1BI0 A;  1KC8 C;  2LQK A;  4PJL A;  4RTU A;  4C8Q C;  2M51 A;  1YHQ Q;  2KI7 A;  4C8Q F;  1VQN Q;  1PHT A;  1K8A U;  1AHJ B;  3VS0 A;  2FZC B;  3AHU A;  2AT1 B;  2EVR A;  2SEM A;  3FIF A;  1MGQ A;  3MO8 A;  1QVP A;  2OTL A;  1VOM A;  3VS4 A;  2EYQ A;  2DXU A;  1IB8 A;  1BI1 A;  2O31 A;  1R0C B;  2ZPH B;  1W6X A;  1SSH A;  3GNG A;  3EFS A;  5FU6 C;  4M78 F;  1TXQ A;  3OSS C;  2HCK A;  3PIO A;  2EPD A;  4JUV A;  3DB3 A;  1NYF A;  2L3P A;  1YJ9 A;  2YRC A;  2HQX A;  2AKK A;  1BYM A;  2DTH A;  1QP3 A;  2HNI A;  3V7C A;  2B8A A;  4FM4 B;  4L6V 5;  1YJN A;  1I0C A;  1AWO A;  3QHS A;  2K79 A;  3GBQ A;  2EQM A;  5FW9 A;  4M75 A;  3BFM A;  5HKC A;  3THK A;  2RQR A;  2KXD A;  1UHC A;  4UC4 A;  3JCM W;  2FO0 A;  4M77 E;  1KFZ A;  1G8X A;  2LDM A;  2D0N A;  5GAN 6;  3ZFJ A;  4PJM A;  5CR2 A;  2KBT A;  1AVZ C;  2DMO A;  4BAC A;  4HT8 A;  1RLQ C;  2EJ9 A;  2MK5 A;  1MUZ A;  3TSW A;  5DLO A;  2PVD B;  1MV3 A;  2K5I A;  1G83 A;  2B86 A;  2G3R A;  1HYO A;  2ZZD A;  1VQ6 Q;  1ZUU A;  1VQL Q;  2MOX A;  4OMO A;  4OB1 B;  2RH2 A;  1VQL T;  4KBM B;  2MMP A;  5D7U A;  3CC2 A;  3OYY A;  3LX7 A;  4QW2 A;  3RKY A;  2CP6 A;  2O4X A;  2QDL A;  3M0P A;  3CCJ A;  5AT1 B;  4C5E A;  3WVE B;  1OZ3 A;  1ZUY A;  1MHN A;  2PQW A;  3GF5 A;  3L2U A;  2QI2 A;  2I0N A;  2X4X A;  1SHF A;  1M2V B;  5GAN f;  1QCO A;  4FT2 A;  2QG9 B;  4P5N A;  4DBF A;  4J9G A;  1ZBJ A;  2JTE A;  3M56 A;  2KE9 A;  4C5H A;  1RLP C;  5HK3 A;  1WHG A;  3CMA T;  1MMD A;  2RK1 A;  3CC4 Q;  1HXD A;  4PJO F;  3J7A F;  4CC4 B;  1NJI C;  3OYD A;  3H0I A;  4M78 B;  3X26 B;  3OS0 A;  4E7S A;  3H41 A;  4MZM A;  4GLK A;  4J6W A;  2QEX Q;  3L2Q A;  1VQK A;  3MJX A;  4FIB A;  2QGG A;  3HRS A;  2QA4 A;  5KYU B;  3R6O A;  2Y90 A;  1VQ9 T;  4A4K A;  3EGX B;  2BZ8 A;  4QT7 A;  5GAM f;  5IHK A;  3OS2 A;  1M1K R;  1UTI A;  1PD1 A;  1N9R A;  4RTY A;  3JCM Q;  5KYY A;  3L1A A;  5GMK j;  2WAC A;  1VQM T;  2F5K A;  1OU9 A;  1E6G A;  1LJO A;  1Z9Z A;  4ATO A;  1VQP A;  1N27 A;  1SSF A;  3G7Z A;  2JTM A;  1CSK A;  1KHI A;  1LVK A;  2JXB A;  2ED0 A;  1Q81 R;  1VQ5 A;  1VYV A;  5LJ5 e;  3JCM g;  2LX9 A;  1D0Z A;  3CPW P;  3A8M B;  2CP3 A;  4O5V A;  3MKD A;  2CZ6 B;  3M59 A;  3JB9 J;  1I5L A;  1I81 A;  2EJF A;  2XK0 A;  3CCU T;  2YT6 A;  3SDZ A;  2JW4 A;  3CCE A;  2DJZ A;  4M7A C;  4QQG A;  2DYB A;  2LMJ A;  1QVF S;  4FSX A;  2E6Z A;  3JCM c;  2FHD A;  5C6S A;  5I2M A;  3EHR A;  1YJ9 Q;  2KVQ G;  3CXC S;  2BIV A;  5J39 A;  1NPP A;  3JCM J;  1WHJ A;  1VQ7 A;  1IXD A;  2ROL A;  2KYM A;  2DE0 X;  1VYT A;  2CP2 A;  2FZK B;  1JEG A;  2K9G A;  2LJ0 A;  1ABQ A;  2YWW A;  1TSF A;  4ORZ A;  3JB9 H;  2JJ9 A;  3LGF A;  2COZ A;  4ZTJ A;  3ME9 A;  1NBE B;  4C92 E;  2K5L A;  4EMK C;  3A8L B;  3QZ9 B;  3OBY A;  4PJO B;  2MPX C;  4RG8 A;  4A54 A;  2C0O A;  1LOJ A;  2KR3 A;  3I9Q A;  1WYX A;  2CP0 A;  4FYX B;  2E41 A;  2VC8 A;  4C92 A;  2EYW A;  2KYB A;  1D3B A;  1PG5 B;  1K73 U;  4CI0 C;  1WJR A;  3IQL A;  3VKI A;  4BE0 A;  5I21 A;  1YJW A;  3OW2 A;  2CS7 A;  4DBR A;  5KCH A;  2C06 A;  4E7Z A;  4N0A A;  4LD9 K;  2DXB A;  1ZSZ C;  2JUF A;  1S72 A;  1W2B S;  2R5M A;  4B9W A;  2YSQ A;  3H6Z A;  2YHT A;  5LJ5 g;  3OB9 A;  1R0B G;  1PSF A;  4JRP A;  3SWN A;  2LJ1 A;  5A2Q E;  4PJO G;  4ZTF A;  3M55 A;  3CCM A;  4DBQ A;  4LDU A;  2ZPG B;  4JRI A;  1AWJ A;  2RHX A;  4J5Y A;  1H3H A;  3H0F A;  2CZ1 B;  1O75 A;  4V2S A;  2CP7 A;  4M78 D;  1UFF A;  2RN8 A;  2OAW A;  3M9Q A;  2P84 A;  2HL5 C;  3RES A;  3RR6 A;  1BK2 A;  4JLI A;  4RMO A;  1RAE B;  2XU8 A;  4J7F A;  2IIM A;  3NMZ C;  1KD1 U;  1V1C A;  3X28 B;  5IH2 A;  1T3L A;  2F1L A;  3VUB A;  4OB0 B;  5GMK m;  3BY7 A;  2DA9 A;  1YP5 A;  2QA4 Q;  1Q82 U;  3G6E T;  3P8B B;  4ME7 A;  5KYX A;  2MWP A;  4HXJ A;  2X3X D;  2YUQ A;  4J9H A;  5GMK h;  2JZ2 A;  5GAO q;  3QYH B;  4F7U G;  3FB9 A;  2EQI A;  2AZV A;  4N4I A;  2VXE A;  1AEY A;  1D1A A;  2RHY A;  4QQD A;  1VQP Q;  4DEX A;  2DX1 A;  2HBW A;  3NGP A;  5GAN e;  1WXB A;  3OYA A;  2O01 E;  1UGR B;  1VQ5 Q;  4OML A;  2A0F B;  3VRZ A;  1X2Q A;  3PFS A;  2LVM A;  4MML A;  1YWP A;  4KRT A;  3RDV A;  2DIG A;  2GTO A;  4OVA A;  1TOV A;  1HSQ A;  2CH4 A;  3KUF A;  4HCK A;  3MP6 A;  3JCM b;  2D8H A;  4BI4 A;  4ELZ C;  1OPK A;  1NEG A;  1UDL A;  2GQI A;  1OPL A;  4XK8 E;  2O2O A;  3MEU A;  3VUZ A;  2DK3 A;  3JCM f;  3CCS T;  3SEM A;  4D8D A;  3NHN A;  5GAM e;  4M7A E;  3ZBD A;  3UT1 A;  4HCB A;  1QCN A;  5HCK A;  1UJY A;  3E9G A;  1A0N B;  1Y0M A;  4PJO D;  3JCM V;  3EHQ A;  1VQ8 A;  4M77 C;  4ZGE B;  3CCV Q;  3C94 A;  5FU7 B;  4OMP A;  3CCQ A;  4M7A A;  1WI7 A;  2MWO A;  2PUO B;  3CCV T;  3SFM A;  2K3B A;  5GMK i;  3EG3 A;  4HKE A;  3QZ5 B;  1WGS A;  3M0Q A;  3MEA A;  1OQK A;  4OMQ A;  4A4F A;  2DIL A;  2XDB A;  3LGL A;  1Q7Y C;  3S3N A;  2KRM A;  3JCM X;  4X34 A;  1GFC A;  2EKH A;  2FPE A;  4BUG A;  2L5Q A;  1YJW Q;  2OX7 A;  2ZAE A;  5CQY A;  3I55 A;  3X25 B;  4EMK A;  2X4J A;  4LDX A;  4MZT A;  3SD4 A;  1X6B A;  4PFZ A;  3JB9 G;  2X3W D;  3PVQ A;  4M7D E;  3I35 A;  3CME A;  4IKF A;  2JNG A;  2RMO A;  4RCB A;  8AT1 B;  4EMG A;  3A8O B;  5CCA A;  2DD4 A;  4BI3 A;  3VS2 A;  5IHI A;  1RI0 A;  1G2B A;  4RCC A;  4F16 A;  4ZN3 A;  5EG2 A;  3OYI A;  2E6N A;  1R8O B;  2F2V A;  2QAS A;  4M7D A;  2K57 A;  3CCM Q;  4E7J A;  2C0T A;  3FJP A;  1QVF P;  6AT1 B;  5I11 A;  1G3W A;  2DBM A;  3VS5 A;  4BB7 A;  3LYI A;  2RJD A;  1WX6 A;  1BI3 A;  2D8J A;  3CXC P;  3OQ5 A;  1ZSZ A;  2EYX A;  2CGH A;  2HZY A;  4OGC A;  2O9S A;  2DVJ A;  4M75 B;  2CUD A;  3GNF B;  1M8M A;  3UWN A;  4CC3 A;  1V76 A;  1OV3 A;  2FRW A;  2ROT A;  3C4S A;  2DXT A;  1U8R A;  3OMG A;  1K9M U;  2E70 A;  1EX4 A;  4NL2 A;  4HVW A;  2CZ7 B;  2F2X A;  1Q86 R;  4OP0 A;  1VQ4 T;  2EBP A;  4BDZ A;  1RAG B;  5GJW B;  1YIT A;  3L2W A;  1B07 A;  4II1 A;  5IXB A;  4PKC C;  1WNL A;  1M90 R;  2QQB A;  1Y57 A;  2W10 A;  2O4X B;  4C0D B;  1RAI B;  3G71 Q;  1UHF A;  1KQ2 A;  3CCR Q;  2CYZ B;  2RB6 A;  3EG0 A;  2CRE A;  3EFO A;  4J7I A;  4M75 G;  3G71 T;  1K8A R;  2DFU A;  1YHQ T;  2L3R A;  3CCR T;  1W2B P;  2A7Y A;  1VQN T;  2K3Y A;  2V8I A;  2GCX A;  5GAO n;  2EW3 A;  4ZGJ B;  1G3T A;  3OYE A;  3CCL A;  1KC8 U;  2JMA A;  5GMK l;  1YN8 A;  1GL5 A;  2VVK A;  3V7R A;  4XTV A;  1RAB B;  3JB9 D;  3HP9 A;  1Y96 A;  1GFD A;  3DKM A;  3LH0 A;  2CDT A;  2QQS A;  4C5I A;  3J80 E;  1I8F A;  3WVD B;  3INZ A;  5LJ3 d;  4C92 C;  1IHV A;  3UDC A;  1W70 A;  2RK2 A;  4C92 F;  2HD0 A;  7AT1 B;  3V8L A;  1VQ8 Q;  4A63 B;  3ER0 A;  3HRT A;  3V8J A;  4AG2 C;  3VYG A;  4QQ6 A;  4KT0 E;  1VQO A;  2HSE B;  3CCQ Q;  1QVG A;  3VS1 A;  2E10 A;  2IG0 A;  3E2U A;  1IZ6 A;  4N0A C;  2EGE A;  4EPC A;  2CP5 A;  4X9C A;  4LXC A;  2VYT A;  3PE0 A;  5KYY B;  3HRU A;  1CKA A;  1C6V X;  5GAN d;  3CC7 A;  1CKB A;  1B34 B;  1WZO A;  3GIB A;  2L0A A;  2DL3 A;  4A53 A;  1QWF A;  3SWN C;  4FSS A;  4A4G A;  1Y71 A;  3OYB A;  3NTK A;  1LNX A;  1SKU B;  5DM7 R;  4DA4 A;  1Q95 G;  3I55 Q;  1MND A;  4M77 A;  4FYV B;  1OX9 A;  3JCM e;  3CME Q;  1GCP A;  1VQ6 T;  2Y4X A;  5GAN 4;  2KK4 A;  4DQ2 A;  1UJ0 A;  1UB4 A;  1VYU A;  4FW1 A;  2K5F A;  4Y92 A;  2YUO A;  5GAM d;  3QSU A;  4A4E A;  4M4Z A;  4C0Z A;  2LQN A;  1F1B B;  5DLQ E;  1X2K A;  2D1X A;  4JDS A;  3OBW A;  2NWM A;  4C8Q B;  5FWC A;  1JXM A;  3LWI A;  1WDX A;  3EG2 A;  4NS5 A;  3EGD A;  4M75 D;  1ZLM A;  4OF1 A;  2G6F X;  5ECA A;  1ABO A;  4QVD A;  1RAF B;  4RUG A;  1BI2 A;  3JAM E;  4R56 A;  2WSC E;  1M1F A;  2BZY A;  1YWO A;  3CC4 T;  5FU6 B;  5CIU A;  1K1Z A;  1AOJ A;  4XTY A;  4B9X A;  3O8V A;  2KAF A;  2AZS A;  1ZX6 A;  4AFQ C;  2QEX T;  3JCM P;  2EFI A;  2PVG B;  2EIF A;  1KQS S;  3JB9 I;  3OW2 S;  2DXC A;  1YIJ A;  5D6Y A;  1NLO C;  1X43 A;  1T3S A;  2K3X A;  2OTJ A;  2DER A;  2LNV A;  5FWB A;  1YIT Q;  4FT4 A;  1IO6 A;  2ZPF B;  3M57 A;  4LUE A;  2RJF A;  4GBQ A;  5I22 A;  1M1K C;  1E7O A;  1GBQ A;  2V8J A;  5L23 A;  3JSC A;  2HAX A;  4C8Q G;  1JJ2 A;  8ATC B;  3MET A;  1N6A A;  4YTL A;  3M4Y A;  1VIE A;  4IUU A;  4X1V A;  4KH1 B;  3OY9 A;  3CD6 A;  5CKH A;  4E7H A;  1OI1 A;  2EQU A;  1KG1 A;  2EQK A;  5CKB A;  1WHL A;  2HQE A;  4OMM A;  1M3C A;  2DTI A;  2LT1 A;  4KUL A;  1Q81 C;  1Y7X A;  1K9A A;  3UAT A;  3NTH A;  5FRO A;  4M78 G;  3V7S A;  3A8G B;  2PVO B;  2L3Q A;  2OTL Q;  1RAC B;  3HKS A;  3CCL Q;  1I5O B;  4CC7 A;  1K4U S;  3M0U A;  4M7A F;  3L2Z A;  4JJB A;  1YCY A;  2LQW A;  3VS7 A;  1M9S A;  1GRI A;  4LN2 A;  2ZPB B;  3G4S A;  2ZPE B;  1SHG A;  2QQA A;  2A28 A;  1YJ9 T;  3O5Z A;  4LDW A;  2XID A;  1FWZ A;  4Z89 A;  4E7I A;  1M30 A;  2F2W A;  2HEQ A;  2LQ8 A;  3F70 A;  1XTD A;  4RKU E;  2R57 A;  3H9N A;  4E6R A;  3MEV A;  1YJN Q;  1QQJ A;  2QQ9 A;  1IGQ A;  2BE9 B;  2DBK A;  5IN1 A;  5KYX B;  1YJN T;  4EMH A;  1C1A A;  2A08 A;  3CC7 Q;  1M2V A;  3AT1 B;  3RMQ A;  4JZ4 A;  3GOX A;  2PZ1 A;  1ARK A;  5C0M A;  4NL3 A;  3I5S A;  5KYW A;  1UGV A;  1RUW A;  4E47 A;  1K73 R;  2R5A A;  3MP8 A;  2JM8 A;  4M7D C;  1SRM A;  5CKF A;  1WHH A;  4M7D F;  2DL5 A;  4JS4 A;  2ATC B;  3KFV A;  1SF9 A;  1KQS A;  2COY A;  2XD0 A;  3EG1 A;  1Z9Q A;  5KH6 A;  4VUB A;  1MNE A;  3HPW A;  3CC2 Q;  4FCY A;  2ABL A;  4PFP A;  2HMA A;  3CPF A;  2KEA A;  3A8H B;  2YLC A;  3CCJ Q;  1GCQ A;  3CBM A;  1VIF A;  1N8R U;  4C8Q D;  2ZPI B;  4PK4 A;  4FU6 A;  1RL2 A;  2LNH B;  4NOY A;  2DYI A;  3CCJ T;  1UUE A;  3GLX A;  2BZX A;  5CVI A;  2DNU A;  1YBY A;  4J9E A;  4Z8A A;  4Y91 A;  3S3O A;  2DPP B;  2CZ0 B;  2MI6 A;  3CBP A;  3H8Z A;  2EGC A;  3QBY A;  2SRC A;  1B7T A;  2GBQ A;  5J3B A;  4M7A B;  1WQ7 A;  1PRM C;  4LDY A;  2DD5 A;  1WXU A;  1KD1 R;  3JRZ A;  2XKO C;  1KD1 C;  2EYY A;  2MAM A;  1VQK Q;  3TVT A;  1YIJ Q;  1Q82 R;  3TRE A;  3I56 A;  3OSV A;  2OTJ Q;  1OYX A;  1G3S A;  1WLP B;  3JCM d;  4E7L A;  2QA4 T;  3ASK A;  1RAD B;  2LCS A;  4R0K A;  1WQW A;  4KGV B;  4RTW A;  4XTX A;  4PJO E;  4EMK B;  1ACM B;  4Z02 A;  2E5Q A;  2RHZ A;  2DZC A;  2DF6 A;  3CD6 Q;  3QYG B;  5J26 A;  3A1P A;  3QDF A;  2QTV A;  2QYZ A;  2NUT B;  4BI8 B;  2ENM A;  5GAN 3;  1VQP T;  3SB2 A;  4AG1 C;  1YI2 A;  2MCN A;  1BBZ A;  2YLB A;  4XTU A;  1VQ5 T;  1G3Y A;  1H8K A;  2OI3 A;  2VKN A;  4HVU A;  2DM1 A;  3C95 A;  3EFR A;  1ZUK A;  2YRV A;  3CCE Q;  1PM3 A;  4KH0 B;  3BDL A;  2DIQ A;  4AMC A;  3UA7 A;  3DLM A;  1U1T A;  1WJQ A;  1ZSZ B;  2JOY A;  1OEB A;  2RM4 A;  4ESR A;  1YHQ A;  3VV0 A;  2LTO A;  4JJC A;  2FG0 A;  2VXF A;  3JV3 A;  2KXC A;  1D0Y A;  1VQ7 Q;  4J9D A;  3ULR B;  5FRM A;  2X9H A;  4F7U E;  2MF2 A;  3MHX A;  1VQ7 T;  4D6W A;  2DL8 A;  4C0F A;  4WTO B;  4RTV A;  4M77 F;  1P92 A;  3H0H A;  5FRN A;  2DEQ A;  2QTX A;  2O9V A;  1QLY A;  1YNZ A;  5IAY A;  1JQQ A;  1X6G A;  1SRL A;  4F7U A;  3HFN A;  2VB6 A;  5L8R E;  4HT9 A;  2RF0 A;  3OW2 P;  4KUD K;  1WFW A;  2NLU A;  2V1R A;  1TUD A;  2VWF A;  2J7I A;  4XAX B;  3RNJ A;  3WXM B;  1NYG A;  5LJ5 d;  2GQV A;  1D1C A;  3QJ6 A;  3OYM A;  2IPO B;  2RI3 A;  2X35 A;  4HCC A;  3P8H A;  4BY6 C;  1TUC A;  3EFO B;  1LPL A;  2H3J A;  1I1J A;  2H8H A;  5LJ3 j;  3Q1J A;  1YJW T;  2NUZ A;  1K0S A;  2RI2 A;  1IRX A;  1D0X A;  1Q7Y U;  1S72 Q;  1EIF A;  2LRQ A;  1H64 1;  2CH4 W;  1BKB A;  1OU8 A;  1BU1 A;  2KT1 A;  1N5Z A;  2JVV A;  2DL4 A;  5D6X A;  1S72 T;  1M8V A;  2E3I A;  2K2M A;  2RHI A;  1Y96 B;  1PKT A;  3OYC A;  4QVC A;  4E2F B;  2Z0W A;  3G1J A;  1M3A A;  1BB9 A;  3GPL A;  1VQL A;  5GAN j;  1HJD A;  2DRM A;  1X6O A;  1NG2 A;  2RHU A;  5CAI A;  2DET A;  4BDY A;  2W0Z A;  1QVG S;  3CCM T;  4M7A D;  2YRD A;  2DKG A;  1ZA2 B;  2GFA A;  2KGT A;  4O6J A;  4PNO A;  5KE3 A;  3CEY A;  3EG9 A;  1SPK A;  2M1H A;  2J05 A;  1M27 C;  3UPU A;  5GAN 8;  3VU3 C;  5M9O A;  2BTT A;  1K9M R;  3CMA A;  1FMW A;  5GAM j;  1K9M C;  3I56 Q;  2V26 A;  3BW1 A;  1EZZ B;  4HCZ A;  2DZ9 A;  2DEU A;  1WA7 A;  4L5G A;  2LX7 A;  2FL7 A;  1Q86 C;  1FYN A;  4M77 B;  3ZEH A;  1TS9 A;  2JN0 A;  2BE7 D;  4FYW B;  2MIO A;  3M0R A;  1ZQ1 A;  3RBB B;  5KCO A;  1H92 A;  3QWX X;  4MZP A;  2KQW A;  1VQ9 A;  1M90 C;  3OYJ A;  1KQ1 A;  3L42 A;  1YI2 Q;  5GJV B;  2JS0 A;  5D6W A;  2K7A A;  1VA7 A;  1VQM A;  2X4W A;  3ZL7 C;  1K8A C;  3QDR B;  2M16 A;  1SEM A;  3PTA A;  1U5S A;  1W4S A;  3EGD B;  1KC8 R;  2YXY A;  4XU3 A;  2KY9 A;  4EIK A;  1PD0 A;  3NTI A;  2E4H A;  2JTF A;  4IUP A;  4F14 A;  1JXO A;  2YDL A;  2RQV A;  3OYL A;  4M77 G;  1TH7 A;  2GNC A;  5GAN 2;  3CCU A;  1AZG B;  3M58 A;  1ZA1 B;  2L8D A;  1U1S A;  4OMF B;  1NM7 A;  2LC4 A;  3CBO A;  4J9I A;  4J83 A;  5DY9 A;  4M78 C;  3CPW A;  2V8K A;  4GY5 A;  3QO3 A;  1VQ8 T;  5FLX E;  1JJ2 S;  2VUB A;  2L3S A;  2IVW A;  1PNJ A;  2PUK B;  3CQT A;  3CCQ T;  2NUP A;  1SG5 A;  4XU1 A;  3M54 A;  4M75 E;  1U3O A;  1GCQ C;  3EAE A;  3TU4 K;  4IUQ A;  2L89 A;  3LW5 E;  2GGR A;  2AHJ B;  4XU2 A;  2K6D A;  2X4Y A;  1QMC A;  4PJJ A;  4AFU C;  5GMK e;  3RMS A;  2RJC A;  2I2L A;  3VYH B;  5LJ3 h;  2GF7 A;  5A0L A;  4IUT A;  3TEE A;  1V29 B;  2RNA A;  1IGU A;  3I55 T;  1ZBX A;  2WSF E;  4L59 A;  2M0O A;  3OS5 A;  2M02 A;  2PU9 B;  1NLP C;  2RPN A;  3CME T;  1TWB A;  2R58 A;  2XHC A;  1G5V A;  2CUB A;  5GAN h;  1WHK A;  4C5G A;  4N4G A;  1M3B A;  4PFO A;  3TSZ A;  4PL6 A;  1ZHI A;  1PRL C;  1KIK A;  3HHT B;  4AT1 B;  1UEB A;  2KT8 A;  5LJ3 f;  5IT9 E;  4KGZ B;  2EKO A;  3DB4 A;  2JM9 A;  3L2V A;  2YUN A;  3E19 A;  3QJY A;  2RQW A;  3OYK A;  2E64 A;  2D6F A;  1KK7 A;  3PT9 A;  1H3Z A;  5CQX A;  2EJG A;  4PLI A; 
#chains in the Genus database with same CATH homology
 3HPW A;  3MCA B;  3GP8 A;  4BY6 B;  3X20 B;  1N9S A;  1M90 U;  5I2S A;  1JB0 E;  5GAM h;  2RO0 A;  1UGP B;  3E9G A;  3CPF A;  4PJO D;  3A8H B;  4EDU A;  4M77 D;  3JCM V;  4PJO C;  2YLC A;  4IUV A;  3M53 A;  4C92 B;  1WJS A;  4M77 C;  4ZGE B;  2EQJ A;  3CBM A;  5A0G A;  1D3B B;  3C12 A;  2EAY A;  1BI0 A;  3C94 A;  1VIF A;  3NFC A;  1KC8 C;  2LQK A;  4JLG A;  5FU7 B;  4C8Q D;  2ZPI B;  1N8R U;  3CCQ A;  2BUD A;  4FU6 A;  1RL2 A;  4C8Q C;  4M7A A;  4NOY A;  2MWO A;  3CCJ T;  3PGG A;  2PUO B;  4C8Q F;  3CCV T;  3P8D A;  3GLX A;  4JRQ A;  5CVI A;  2RD1 A;  2ZCF B;  1AHJ B;  3SFM A;  1K8A U;  4HCB A;  3AHU A;  5GMK i;  1YBY A;  3FIF A;  4HKE A;  3QZ5 B;  1WGS A;  4JJN K;  1MGQ A;  3MO8 A;  4Y91 A;  1YIT T;  1QVP A;  3S3O A;  2OTL A;  3G6E A;  3MEA A;  2DPP B;  2EYQ A;  2DXU A;  2CZ0 B;  1IRE B;  2MI6 A;  4A4F A;  3CBP A;  3H8Z A;  3LGL A;  3QPH A;  2XDB A;  1Q7Y C;  3S3N A;  1BI1 A;  3JCM X;  1BIA A;  3TCJ A;  4X34 A;  2ZPH B;  3QBY A;  3GNG A;  3EFS A;  5FU6 C;  4M78 F;  3MEW A;  4JRK A;  4BUG A;  2L5Q A;  3OSS C;  2LCC A;  2FB7 A;  5J3B A;  5CQY A;  4M7A B;  3PIO A;  1WQ7 A;  4JUV A;  1M1K U;  1O9S A;  5LL6 S;  3DB3 A;  5KE2 A;  3SWN B;  3I55 A;  4DOW A;  1YJ9 A;  4LDY A;  3PNW C;  3JRZ A;  1JRI A;  3X25 B;  2XKO C;  4EMK A;  2X4J A;  4LDX A;  4MZT A;  2HQX A;  1KD1 C;  3SD4 A;  3DLL A;  3JB9 G;  1B34 A;  1BYM A;  2MAM A;  4FL6 A;  2DTH A;  3J81 E;  3CME A;  4M7D E;  1KHC A;  1QP3 A;  2HNI A;  4IKF A;  1OZ2 A;  2QDY B;  3V7C A;  2JNG A;  2B8A A;  4RCB A;  4FM4 B;  4L6V 5;  4EMG A;  3A8O B;  2OTL T;  5CCA A;  3TRE A;  1YJN A;  3I56 A;  4C92 G;  2DD4 A;  4BI3 A;  2CKK A;  3CCL T;  3OSV A;  1OYX A;  1Q81 U;  5GAN 7;  3QHS A;  1G3S A;  1RI0 A;  4MMK A;  4RCC A;  3JCM d;  4E7L A;  2QA4 T;  2EQM A;  4M75 A;  3BFM A;  4F7U F;  3ASK A;  5EG2 A;  4ZN3 A;  5HKC A;  2E6N A;  1R8O B;  3OYI A;  1GXI E;  4X9D A;  1WQW A;  1KD1 U;  4M7D A;  2RJE A;  2K57 A;  4UC4 A;  4XTX A;  4PJO E;  3JCM W;  4EMK B;  3PIP A;  4M77 E;  4E7J A;  3M5A A;  2E5Q A;  3FJP A;  4Z02 A;  2LDM A;  5GAN 6;  2RHZ A;  2KSS A;  4C8Q E;  2DZC A;  3QG1 A;  1G3W A;  4BB7 A;  3ZFJ A;  3LYI A;  2RJD A;  2VV5 A;  1BI3 A;  5CR2 A;  3T9N A;  3QYG B;  5J26 A;  3OQ5 A;  4OB2 B;  4BAC A;  1X01 A;  4HT8 A;  2CGH A;  4BI8 B;  3CCS A;  2EJ9 A;  5GAN 3;  1VQP T;  4OGC A;  3SB2 A;  1VQO T;  5DLO A;  2PVD B;  1YI2 A;  4M75 B;  2K5I A;  3GNF B;  2G3R A;  2ZZD A;  2YLB A;  4XTU A;  1VQ5 T;  4C8Q A;  3UWN A;  1G3Y A;  1M1G A;  4M78 E;  2E1H A;  4OB1 B;  2RH2 A;  3C4S A;  4KBM B;  1VQL T;  2MMP A;  3C95 A;  2DXT A;  3EFR A;  1U8R A;  3OMG A;  2YRV A;  5GAO l;  1JBM A;  3OYY A;  1K9M U;  3CC2 A;  3LX7 A;  3BDL A;  2DIQ A;  3HL8 A;  3CC7 T;  2E70 A;  4QW2 A;  3RKY A;  3RIR A;  4NL2 A;  2O4X A;  2CZ7 B;  2DVE A;  2F69 A;  3CCJ A;  3DLM A;  1U1T A;  1WJQ A;  5AYF A;  3CCV A;  4OP0 A;  1VQ4 T;  2JOY A;  4XQ3 A;  4C5E A;  4BDZ A;  2RM4 A;  3WVE B;  4R55 A;  1YHQ A;  1K73 C;  3VV0 A;  4M78 A;  2LTO A;  1OZ3 A;  2VXF A;  1YIT A;  2DAQ A;  1MHN A;  2PQW A;  3GF5 A;  3L2U A;  2QI2 A;  3MP1 A;  3L2W A;  2X4X A;  2RI5 A;  5FRM A;  2D0Q B;  4II1 A;  3OA6 A;  4F7U E;  5GAN f;  4PKC C;  4XTZ A;  4FT2 A;  1WNL A;  2MF2 A;  3MHX A;  1VQ7 T;  2QQB A;  4P5N A;  4D6W A;  4C0F A;  1Q81 C;  2M9U A;  3M56 A;  4C5H A;  4BE1 A;  2O4X B;  3M4G A;  3CC2 T;  5HK3 A;  3CMA T;  2RK1 A;  4C0D B;  1HXD A;  4PJO F;  5A0D A;  3FDR A;  1QP2 A;  2ZGW A;  4M77 F;  1P92 A;  3RKW A;  5FRN A;  3J7A F;  1NJI C;  2K4Y A;  3OYD A;  2DEQ A;  2QTX A;  1N8R C;  1KQ2 A;  2CYZ B;  1QW1 A;  2RB6 A;  4M78 B;  3X26 B;  5IAY A;  4J7I A;  4IUR A;  4M75 G;  3OS0 A;  3G71 T;  4F7U A;  3HFN A;  4MZM A;  4GLK A;  4J6W A;  4XTW A;  1UGS B;  2L3R A;  5L8R E;  3CCR T;  1YHQ T;  4HT9 A;  2A7Y A;  1VQN T;  2K3Y A;  2V8I A;  2GCX A;  4KUD K;  3L2Q A;  5GAO n;  3A5Z B;  4ZGJ B;  1G3T A;  2NLU A;  5LJ5 j;  3LLR A;  4XAX B;  3WXM B;  3OYE A;  1KC8 U;  1VQK A;  3CCL A;  5GMK l;  4FIB A;  5LJ5 d;  3HRS A;  2GQV A;  2QA4 A;  3QJ6 A;  3OYM A;  3R6O A;  1XOV A;  3V7R A;  2RI3 A;  4XTV A;  2X35 A;  2Y90 A;  1Y96 A;  3HP9 A;  4A4K A;  3JB9 D;  1VQ9 T;  4HCC A;  5GAM f;  3FLG A;  3DKM A;  3P8H A;  3LH0 A;  3JB9 F;  4BY6 C;  3OS2 A;  1XQH A;  2QQS A;  4LDV A;  4C5I A;  3JCM Q;  1DJ7 B;  1N9R A;  1I8F A;  2H3J A;  3J80 E;  3WVD B;  3L1A A;  5LJ3 j;  3LWH A;  3INZ A;  3Q1J A;  4F7U B;  1YJW T;  4C92 D;  5LJ3 d;  5GMK j;  2RI2 A;  2WAC A;  1VQM T;  4C92 C;  1Q7Y U;  2F5K A;  3UDC A;  3URG A;  4C92 F;  1EIF A;  2LRQ A;  2RK2 A;  1H64 1;  5FU7 C;  1LJO A;  1BKB A;  2HD0 A;  4ATO A;  2LCL A;  3V8L A;  2VGN A;  3ER0 A;  3HRT A;  2DO3 A;  1N27 A;  1SSF A;  2JVV A;  3V8J A;  3VYG A;  5D6X A;  3G7Z A;  1VQP A;  2JTM A;  4KT0 E;  4QQ6 A;  1VQO A;  1S72 T;  1M8V A;  1KHI A;  1QVG A;  1VQK T;  4HA8 A;  2DTO A;  2Y4Y A;  2E10 A;  2IG0 A;  2RHI A;  1Y96 B;  3QII A;  1Q82 C;  3OYC A;  4QVC A;  1VQ5 A;  1IZ6 A;  4N0A C;  4EPC A;  1QVF A;  4X9C A;  5LJ5 e;  1YIJ T;  3JCM g;  2LX9 A;  2VYT A;  3A8M B;  2QXF A;  3GPL A;  4J6Y A;  1VQL A;  3HFO A;  2FYK A;  4O5V A;  4Y28 E;  5GAN j;  2OTJ T;  3HRU A;  2CZ6 B;  3M59 A;  3JB9 J;  1X6O A;  1I5L A;  5GAN d;  1I81 A;  2EJF A;  3CC7 A;  2RHU A;  3CXC A;  5CAI A;  4A4H A;  4BDY A;  2XK0 A;  3CCU T;  1B34 B;  1QVG S;  4ZN1 A;  3CCM T;  3GIB A;  3CCE A;  3SDZ A;  4M7A D;  4DOV A;  2DKG A;  2DJZ A;  3X24 B;  4JS5 A;  4M7A C;  2GFA A;  2FVU A;  4QQG A;  1VQ4 A;  5LJ3 e;  4A53 A;  1QVF S;  4O6J A;  3SWN C;  4FSX A;  5GAO r;  4PNO A;  2E6Z A;  3JCM c;  5KE3 A;  4A4G A;  1Y71 A;  3CD6 T;  3OYB A;  3NTK A;  1LNX A;  2FHD A;  4OB3 B;  5I2M A;  3ZBD A;  5C6S A;  5DM7 R;  4DA4 A;  4PJO A;  1WPY A;  4M77 A;  2KVQ G;  3CXC S;  3CEY A;  4M7A G;  5CO7 A;  2BIV A;  3QXE B;  3S3M A;  5J39 A;  2M1H A;  4M7D B;  1NPP A;  3JCM J;  1VQ7 A;  3JCM e;  1PSE A;  3UPU A;  5GAN 8;  3VU3 C;  1VQ6 T;  5M9O A;  2Y4X A;  5GAN 4;  3CMA A;  2KDS A;  2E12 A;  2KK4 A;  3JCM h;  4DQ2 A;  1UB4 A;  5GAM j;  1K9M C;  2K5F A;  3JB9 H;  3BW1 A;  3OS1 A;  3LGF A;  5GAM d;  4ZTJ A;  3CCE T;  3ME9 A;  3QSU A;  4HCZ A;  2DZ9 A;  4C92 E;  2K5L A;  4EMK C;  4A4E A;  3G71 A;  4L5G A;  1NE8 A;  1Q86 C;  2FL7 A;  3A8L B;  4C0Z A;  3KXT A;  3QZ9 B;  3OBY A;  5DLQ E;  4PJO B;  3CCR A;  4M77 B;  3ZEH A;  4RG8 A;  2D9T A;  4A54 A;  1VQN A;  2JN0 A;  4BE2 A;  1LOJ A;  4JDS A;  1ZQ1 A;  3OBW A;  4C8Q B;  3HSB A;  2KMT A;  3G4S T;  2VGM A;  5KCO A;  3LWI A;  2VC8 A;  2E41 A;  3KBG A;  4MZP A;  2KQW A;  2K2V A;  3OYH A;  4NS5 A;  4M75 D;  4C92 A;  1NJI U;  1VQ9 A;  1M90 C;  1D3B A;  4M75 C;  4OF1 A;  1K73 U;  2WSE E;  3OYJ A;  1KQ1 A;  3L42 A;  4M75 F;  1WJR A;  4QVD A;  4CI0 C;  1FXX A;  5GAN 5;  5CKE A;  3VKI A;  1W2B A;  4BE0 A;  5I21 A;  1BI2 A;  2XIC A;  3JAM E;  4R56 A;  1YJW A;  3OW2 A;  2CS7 A;  5D6W A;  5KCH A;  2WSC E;  1M1F A;  3CC4 T;  4LD6 A;  1VQM A;  1NZ9 A;  2X4W A;  5FU6 B;  5CIU A;  1HK9 A;  2C06 A;  4N0A A;  4LD9 K;  4MDW A;  4M7D G;  4XTY A;  2DXB A;  3RER A;  1K8A C;  4B9X A;  2QQR A;  3PMI A;  3O8V A;  2KAF A;  2M16 A;  3QDR B;  2JUF A;  1S72 A;  4RG2 A;  3PTA A;  5KH6 A;  2QEX T;  3JCM P;  2EFI A;  2PVG B;  2P0Q A;  3RUX A;  2EIF A;  3V8K A;  2XDP A;  1W2B S;  1W4S A;  1KQS S;  2R5M A;  3JB9 I;  4B9W A;  3OW2 S;  3H6Z A;  2YHT A;  4XU3 A;  2DXC A;  5LJ5 g;  3PMT A;  1YIJ A;  2KY9 A;  5D6Y A;  3OB9 A;  3NTI A;  4PLL A;  2K3X A;  2OTJ A;  1PSF A;  4QVZ A;  2JTF A;  4IUP A;  2LNV A;  3SWN A;  5CK9 A;  4JRP A;  4FT4 A;  2ZPF B;  3M57 A;  5A2Q E;  4PJO G;  2RJF A;  3OYL A;  4ZTF A;  4M77 G;  1TH7 A;  5GAN 2;  1M1K C;  2V8J A;  3CCU A;  3M55 A;  3JSC A;  3CCM A;  2HAX A;  4C8Q G;  4LDU A;  1JJ2 A;  3OYF A;  3M58 A;  1FX7 A;  5LJ3 g;  3MET A;  4C0D C;  2ZPG B;  4JRI A;  1N6A A;  2RHX A;  4J5Y A;  4YTL A;  2L8D A;  3VJP A;  3M4Y A;  1U1S A;  1VIE A;  1O75 A;  2CZ1 B;  2LC4 A;  3CBO A;  4IUU A;  4J83 A;  4M78 D;  4OMF B;  1VUB A;  4V2S A;  5DY9 A;  3OY9 A;  3CD6 A;  4M78 C;  3M9Q A;  5CKH A;  4OGE A;  3CPW A;  5GAO m;  4E7H A;  1OI1 A;  2V8K A;  2EQU A;  3RES A;  4ELY C;  1KG1 A;  2EQK A;  4JLI A;  4GY5 A;  3QO3 A;  5CKB A;  4RMO A;  1VQ8 T;  2XU8 A;  2HQE A;  3E1S A;  5FLX E;  4J7F A;  2XG8 D;  1XNI A;  1JJ2 S;  2VUB A;  2DTI A;  2IVW A;  2GFU A;  2LT1 A;  2P0P A;  1Y7X A;  2PUK B;  4KUL A;  3CCQ T;  3NTH A;  5FRO A;  3X28 B;  5HK0 A;  4M78 G;  2XI9 A;  4XU1 A;  3V7S A;  3A8G B;  3M54 A;  4M75 E;  1I4K 1;  3N5B B;  2PVO B;  1VQ6 A;  3RKX A;  1VQ8 A;  4ZGD B;  4BD3 A;  5LJ5 h;  3VUB A;  3OYG A;  3CPW S;  5GAN g;  4OB0 B;  3EAE A;  3FRN A;  3HKS A;  3TU4 K;  4IUQ A;  2E65 A;  5GMK m;  3BY7 A;  2L89 A;  3LW5 E;  3FC3 A;  2AHJ B;  2F5T X;  3QUI A;  1Q82 U;  3G6E T;  4XU2 A;  2X4Y A;  3E9F A;  4M7A F;  3L2Z A;  1YCY A;  2P4T A;  5GMK e;  3P8B B;  3RMS A;  2RJC A;  4ME7 A;  2I2L A;  3VYH B;  2MWP A;  1M9S A;  5LJ3 h;  1M5Q 1;  2GF7 A;  5A0L A;  2ZPB B;  4IUT A;  4CRI A;  5GMK h;  2JZ2 A;  3QKJ A;  5GAO q;  3G4S A;  2ZPE B;  2BKD N;  1V29 B;  3TEE A;  2QQA A;  3I55 T;  2P0K A;  3QYH B;  4KUI A;  4F7U G;  3BDU A;  3FB9 A;  1YJ9 T;  1Y07 A;  1ZBX A;  2WSF E;  1FWZ A;  2XID A;  2VXE A;  3OMC A;  4L59 A;  4LDW A;  4N4I A;  5GAO p;  4E7I A;  4E7K A;  2M0O A;  2RHY A;  5CKD A;  4QQD A;  2LQ8 A;  3F70 A;  3OS5 A;  4TVR A;  1XTD A;  2PU9 B;  4RKU E;  3L2R A;  2R57 A;  3CME T;  2RA2 A;  5GAN e;  3MEV A;  3OYA A;  5LJ5 f;  2O01 E;  4MDX A;  2R58 A;  2QQ9 A;  2XHC A;  2A3L A;  1UGR B;  2LT4 A;  5GAM g;  1G5V A;  3CC4 A;  5IN1 A;  1M4Z A;  5GAN h;  3I56 T;  1YJN T;  3PFS A;  2HBP A;  1BIB A;  4C5G A;  2LVM A;  4N4G A;  4MML A;  4EMH A;  4PL6 A;  1ZHI A;  2DIG A;  3FEO A;  3HHT B;  4OVA A;  5HY6 A;  2OAU A;  2QEX A;  1UEB A;  4Q5W A;  3RMQ A;  5LJ3 f;  3GOX A;  5IT9 E;  3OYN A;  3KUF A;  3S6W A;  2EKO A;  5C0M A;  3DB4 A;  4NL3 A;  4XU0 A;  3MP6 A;  3JCM b;  3L2V A;  4C0G A;  1X75 C;  3E19 A;  1Q86 U;  4E47 A;  2XDD A;  4BI4 A;  3QJY A;  4ELZ C;  2R5A A;  4J6X A;  3MP8 A;  4J8O A;  4WF2 A;  4M7D D;  3OYK A;  4M7D C;  2EWN A;  5CKF A;  4XK8 E;  3MEU A;  2E64 A;  1UGQ B;  4N4H A;  3VUZ A;  4JS4 A;  1KQS A;  2D6F A;  2DK3 A;  4M7D F;  3JCM f;  3CCS T;  2XD0 A;  2EJG A;  3PT9 A;  1H3Z A;  5GAM e;  5CQX A;  4M7A E;  1YI2 T;  1NPR A;  3UT1 A;  4VUB A;  2DD5 A;  4PLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...