4X9CA

1.4a crystal structure of hfq from methanococcus jannaschii
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
PNFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDYIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ1435
publication title Characterization of RNA-binding properties of the archaeal Hfq-like protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
total genus 10
structure length 57
sequence length 57
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4x9cA00
5GAN8 2FB7A 4PJOG 3FIFA 2EJGA 2JN0A 4C8QA 5LJ3j 3JCMf 3SWNA 4M77C 3RKWA 4M75A 1MGQA 1Y96A 2E1HA 2EJ9A 5GMKj 4MMLA 1BIAA 2VXEA 1M5Q1 2Y90A 4RCCA 4EMKA 2K57A 4XU0A 2DZ9A 4JRKA 3SB2A 4F7UA 5GMKm 4V2SA 2VC8A 4M77E 4M77F 5GAOm 4HT9A 5LJ5f 4X9CA 5GANf 3L2ZA 3V7CA 4PJOA 4XTUA 2EWNA 5LJ3h 4XTWA 3RESA 2RD1A 2CGHA 3HSBA 2E41A 4PNOA 1B34A 2EJFA 3JCMX 3JB9J 5LJ3d 1I5LA 5GMKe 3GIBA 2DTHA 2E64A 5I21A 1U1SA 5GMKi 5GAN5 3INZA 3PGGA 3RUXA 3JCMV 4M78D 3RKXA 4A53A 4EMGA 3JCMb 4N0AA 4M77A 5GAN6 4N0AC 5GAMh 2DXUA 4J5YA 4JLIA 4JRIA 3RERA 3BDUA 3JCMh 3QO3A 4XU3A 4OP0A 5GAMd 3QHSA 1N9SA 1X01A 4NL2A 4J6XA 3QUIA 3JCMd 5GANg 4HT8A 2DTIA 1JRIA 2FYKA 1BIBA 4C92B 5GAMj 4M78B 4M78G 5LJ5h 1WQ7A 4MMKA 5GMKl 1D3BB 1WQWA 5LJ3e 5GANh 4J6WA 4XTZA 4NOYA 5GAOl 4M7AB 5LJ5d 4A54A 5GAN7 3V8KA 5GANd 3QSUA 2DZCA 3M4GA 4C92D 4DQ2A 5LJ5j 2E10A 4M7DB 2DEQA 5GAN4 4XU1A 1H641 5GANj 5GAMe 4XTXA 4M78C 4Y91A 3V8LA 3JCMP 3V7SA 4M7AD 4C8QB 4C8QG 2YLCA 4HA8A 5LJ3f 4QVDA 3JCMe 3JB9I 1WPYA 1YCYA 3BY7A 1WNLA 3RKYA 3SWNB 1TH7A 4M75B 1LJOA 1Y96B 5GAN2 5GAOp 1KQ2A 4C92F 2VXFA 4M78E 2HNIA 4M78F 4EMKB 5GAOr 3HFNA 4F7UB 4M7DD 1LNXA 5GAN3 4C92G 4EMHA 3FJPA 2DVEA 2RM4A 5LJ5e 3JB9H 4M7DC 5LJ3g 4M7AF 2DTOA 3JCMW 4C8QD 5GANe 4XTYA 1I81A 2QTXA 4M77D 5DY9A 3V8JA 5GAMf 4XQ3A 3AHUA 4M7AG 4PJOB 2DJZA 4M75D 3HFOA 1N9RA 4C8QC 3BFMA 3JCMJ 3FB9A 4XTVA 4M7DE 4RCBA 4M7DF 4WF2A 1HXDA 2ZGWA 1I8FA 3SWNC 4M75C 1B34B 2DXTA 4M7DG 1JBMA 2RA2A 4EMKC 4C92A 4M78A 4C8QE 3BW1A 2DKGA 2RB6A 3VU3C 4C92C 4C8QF 1D3BA 3JCMc 3JCMQ 5GAMg 3JB9D 4PJOD 1LOJA 2YLBA 4M75E 4M75F 3JCMg 5GAOq 3L1AA 4J6YA 4M77G 4M77B 4XU2A 4M7AA 4M7AC 4F7UE 1I4K1 2E65A 2I2LA 4M75G 4F7UF 4C92E 4PJOC 1M8VA 5CAIA 2YHTA 4F7UG 2EAYA 1KQ1A 3V7RA 5GAOn 5GMKh 4JUVA 3JB9F 4M7DA 4QVCA 5LJ5g 1U1TA 4M7AE 4NL3A 3EFSA 4PJOF 1HK9A 4PJOE 3RIRA 4X9DA 3JB9G 3EFRA
chains in the Genus database with same CATH superfamily
5DLQE 4BDYA 2V8JA 2O4XB 2AK5A 4C0FA 4F7UA 2DZ9A 3OSSC 2GF7A 1XTDA 4M77E 1QVGP 2DILA 4J9GA 3V7CA 2LQNA 1MNEA 2EWNA 3CCJT 2RD1A 4C5EA 2HSEB 3HSBA 1ZHIA 2KEAA 2J7IA 3EFOA 3GIBA 3I5RA 3QZ9B 3RUXA 2DL4A 2EKOA 1MV0B 1KIKA 1ABQA 3RERA 2L2PA 3QZ5B 4ME7A 2K5IA 2CH4W 1PSEA 3G4SA 3QKJA 3CPWP 5I2MA 2OTLA 2DX1A 2KAFA 4OMOA 1BI0A 1PRMC 4JJBA 2AZVA 5KYYB 2IVWA 1E6GA 5GAMe 1X43A 4J9EA 2LRQA 1J3TA 1OU8A 1D0XA 5I11A 1NEBA 4ZN1A 1YI2A 4M7AG 2DIQA 1N9RA 4FM4B 3FB9A 4M7DF 3I35A 1VQ4T 1I8FA 5KH6A 5AYFA 2ABLA 1Q7YU 3ZBDA 4A4EA 2RA2A 3BW1A 1AWOA 2CZ1B 1EFNA 3HTRA 1IZ6A 1RL2A 3NTKA 3JV3A 4BY6B 1VYUA 2RK2A 1QVFS 1VQ6A 3OYEA 1PHTA 3EFRA 4E7IA 2FB7A 4J9BA 5FU7B 4M4ZA 3JCMf 3TSZA 2EPDA 1QMCA 1XJWB 4BY6C 2DEUA 3TSWA 4JRPA 4JRKA 4V2SA 2X4JA 4M77F 4HVVA 2MAMA 3CCRA 1M2VA 1YWOA 2AHJB 1K73R 5FU7C 1UJYA 2RHIA 1BI1A 5KYUA 1TUCA 1MUZA 4HCCA 2NUPA 2K2VA 4M78D 4EMGA 3JRZA 4J5YA 3CCQA 3G71A 4FSXA 1VQ5Q 1NG2A 2ZPHB 1WJSA 4J6XA 2NUTA 4LE9A 2GGRA 2C0IA 2GFAA 3VRZA 4M78B 1YHQQ 3OA6A 1K8AR 2D0NA 3TVTA 1Q82U 3OQ5A 3OSVA 3EGDA 1AHJB 2LJ1A 5I2SA 2DZCA 3TCJA 1M8MA 3M4GA 2DIGA 2EYZA 2DMOA 3OYMA 1UGRB 1OI1A 3M0RA 3PE0A 4XU1A 4M78C 4C8QG 1AD5A 3SWNB 2XDBA 4D8KA 1YIJQ 2SRCA 3PMIA 4ELYC 1M1FA 3KBGA 2ZPEB 1WYXA 2WSFE 2QQ9A 1WLPB 1Q81U 4RMOA 3UA6A 3CCVQ 4C8QD 5ECAA 1SEMA 2QEXA 3NTHA 2A7YA 2OAUA 1HXDA 2XHCA 3SWNC 1N6AA 2R5MA 4K11A 4LD9K 1T0HA 4JJCA 1KFZA 1FX7A 5IH2A 1Y7XA 4ATOA 2F2XA 3META 1KHIA 3CMAQ 1YITA 2COZA 2K6DA 4II1A 1VQ9A 4OMLA 2M02A 3H0IA 1VQMQ 1BIAA 2ESWA 3F70A 1X27A 2RHXA 2JVVA 2ATCB 1X75C 1BB9A 3ASKA 1ZSZB 2E41A 3L2WA 3QIIA 4KH1B 2FPDA 3EG9B 4A53A 4DOVA 1WGSA 2EFIA 2H8HA 2LJ0A 2QXFA 4XU3A 1QVFA 1GBQA 1X01A 4FL6A 3HP9A 1FMKA 2NUZA 4QVZA 3VS1A 2KXCA 5LJ5h 1K0SA 1I07A 1M1KC 3VUZA 5LJ5d 3OYCA 2OTLT 2JNGA 3S3NA 2KDSA 3EAEA 3RR6A 4M7DB 3ZFJA 4OB2B 2OTJA 1S72A 2LCSA 2NWMA 1ZLMA 3V8LA 1F1BB 2E6NA 2HBWA 4E7SA 2EQKA 1MMDA 1LJOA 1WX6A 2K79A 2KE9A 4KBMB 1JXMA 4C92G 2E5QA 4M7DC 1WFWA 2XKOC 5GAMf 4M77D 2E12A 3MPUB 1TXQA 2KRMA 3ER0A 3TEEA 2DXTA 1T3SA 1G5VA 4J8OA 2I0NA 2ZPBB 4AFZC 4FSSA 2RMOA 4M77B 1FMVA 3CPFA 1I4K1 2I2LA 4M75G 2VGNA 4Y92A 1M8VA 1BBZA 1SKUB 3G6EQ 3CCUA 1YP5A 3L2QA 3EFSA 1VQ6T 4OF1A 4Q5WA 4TVRA 5KYWA 4PJOG 3CCLA 2PZ1A 4C8QA 2ROLA 1C6VX 2VV5A 2K3BA 4M77C 2MWPA 1Y96A 3CMEA 2KYBA 2Y90A 2EW3A 4D8DA 4O5VA 2QA4Q 3GOXA 2YUPA 2P4TA 2P0KA 3M0UA 3NHNA 2BZXA 4XTUA 2HQHA 4KGVB 1LPLA 2HKQB 1WXUA 2O9VA 2DYIA 3CCEA 2B8AA 5GAN5 1K8AU 1QVFP 1PSFA 1BCOA 1VQOA 1D1AA 3CCJQ 4N0AC 3CCMQ 1M90R 1IB8A 4IUUA 3G71T 1JJ2S 4HT8A 4E47A 3REAB 1UGPB 1AOJA 2QG9B 4GBQA 3I55A 2ENMA 4E7KA 2M0OA 2EBPA 1M3AA 2QQAA 1YHQT 4J7FA 2MPXC 4QKUA 1QCNA 3E19A 2DK3A 2L3PA 3A8GB 1LNXA 1RI0A 2AT1B 2W0ZA 2CP5A 1AZEA 3MP8A 2QTXA 3OYIA 1V29B 1KQSS 1D09B 1YIJT 4LN2A 1T3LA 2DA9A 4PJMA 4A63B 4BI3A 3CCVT 3A5ZB 5CKEA 4BE1A 1IO6A 4DBFA 1VQ4Q 4F7UG 3M9QA 3EG3A 4C5GA 1K73C 3LH0A 4R55A 2CYZB 4JUVA 3QXEB 4NL3A 1PCXA 3GLXA 1OZ2A 3H8ZA 1VQ9T 2JTMA 1MGQA 4PJJA 1C1AA 5CKHA 3X28B 3CMAT 1Z9QA 3I56Q 2VGMA 2VC8A 5GAOm 4HT9A 1GFCA 3CEYA 2RJDA 4X9CA 2CP0A 4E7LA 1ZUKA 2X4YA 1QP2A 1TG0A 1K8AC 1B34A 3JCMX 2DL3A 2A0FB 3JCMV 4IIOA 4N0AA 1YJNA 5GAN6 2DXUA 4KUIA 3CBOA 1D0ZA 1P92A 1WZOA 4KGXB 1ZSGA 1YCSB 4LUDA 1TS9A 1W1FA 1RAAB 3Q1JA 2ZPFB 3J7AF 3OYLA 4FYYB 5GANh 1QP3A 2O2OA 5EC7A 4AMCA 2W10A 5J39A 4A54A 5GANd 1NEGA 5L23A 4HCKA 4HVUA 3CQTA 6AT1B 1H641 2R58A 1OU9A 4AFQC 3JCMP 3V7SA 2HL3A 2YLCA 1W70A 3DB3A 4LDVA 1U06A 1TSFA 5GAN2 2HEQA 1SSHA 4UC4A 5GAOr 4PLIA 3GNFB 3M58A 2DNUA 4EMHA 5D7UA 3SD4A 4FIBA 3OS2A 4M7AF 3UPUA 4AG1C 3QPHA 3MP6A 2XDPA 2Y4YA 4PJLA 2EGCA 3BFMA 3CXCS 4WF2A 1JJ2A 3VKIA 5C0MA 3IQLA 1D3BA 3JCMc 3HRTA 5CVIA 1KHCA 2RHYA 4RTXA 1M1KR 1MV3A 2EAYA 3V7RA 3EH2A 1VQLA 2V1RA 4QVCA 9ATCB 1U1TA 2CDTA 4FYXB 1HK9A 3CCUT 3E1SA 2JOYA 1VIFA 1A0NB 1G3SA 2PVOB 2VASA 3CCLT 1IGQA 2D1XA 4B9XA 4E6RA 2YUNA 1ACMB 2GNCA 1NJIC 5LJ5f 3RMQA 3L2VA 3L2ZA 3CCSA 2GTOA 3LH5A 2WSCE 4LDUA 4QW2A 4DBHA 2EJFA 1MMAA 3NFCA 3PGGA 3EGXB 3MJXA 2YUOA 5GAMh 4JRIA 4IUTA 3EHRA 2IG0A 4RTTA 4AFUC 5GAMd 2DRKA 3QHSA 3FC3A 3VS3A 4DA4A 4LXCA 5A0DA 1M9SA 2L5QA 4MMKA 4QQ6A 3CCMT 4HCZA 2MWOA 4XTZA 2DXCA 3M54A 2NLUA 2QGGA 1M3CA 1U5SA 4PKCC 3M0PA 4ZN3A 3CBMA 3I55T 4DQ2A 5LJ5j 2YT6A 1KD1R 1S1NA 3G4SQ 2LX7A 2QAZA 2AKLA 2OTLQ 1WPYA 2V1QA 2CZ0B 2DERA 3LW5E 4X1VA 3VS5A 1WHGA 1VQNA 3H0FA 2RM4A 1JJ2P 2J6KA 2KSSA 2PNIA 3JCMW 2CSIA 2H3EB 2HKNA 3HFOA 4ZNXA 3JCMJ 3S3MA 1YBYA 3RNJA 5HKCA 2X3WD 1TU0B 3JB9D 4DBRA 3HKSA 4RTVA 1PKSA 4M75E 1PC0A 2K9GA 3C12A 4A4FA 1YI2Q 5I22A 4BUGA 2A28A 2FZKB 4ZGDB 4R0KA 1D1CA 4PJOE 3I5SA 1NLPC 3OS1A 2JN0A 3SDZA 2YRVA 2E1HA 3D7SB 2EJ9A 4EMKA 1M90C 2CREA 1VQ6Q 2LCLA 5CKBA 3M0QA 3X24B 3OW2S 3HRUA 2LQWA 3E2UA 2KY9A 3OBYA 4E2FB 1WI7A 2GTJA 3I56T 5GMKe 1RAGB 3EGUA 4JDSA 5GJWB 1NYGA 3CCRQ 1Q86R 1IGUA 2DL8A 2EGAA 4A4HA 4J9CA 3DLMA 2BE7D 3QJ6A 1GBRA 1X6BA 1EZZB 4IURA 2OAWA 1WDXA 4M78G 1RLQC 5FWCA 2O4XA 3EG2A 1U8RA 4M7AB 1QW1A 3QWXX 1BK2A 4A4GA 1FXXA 1RLPC 4JLGA 3CCQQ 3G71Q 2YUQA 4FW1A 4OMPA 1VQ7A 4ZTFA 2DXBA 2RJFA 4C0DB 3WVDB 2MK5A 4FW2A 4L5GA 1QCOA 4C92F 2DL5A 1K9MR 4RTUA 2QTVA 4O6JA 3M0TA 1NM7A 2BZ8A 1BCMA 1M1KU 4Z02A 4C0DC 2XI9A 2CUBA 4LDWA 1W2BS 4FYVB 3QDRB 1XQHA 3PFSA 4M75F 4WCIA 1RABB 4F7UE 3VS0A 2QEXQ 3A8OB 1AZGB 4IUPA 5KYYA 5HCKA 4PJOF 2EVRA 1VQLT 3M55A 4KUDK 3TQ7P 2MOXA 2JS0A 5A2QE 3OBWA 3NMZC 3RKWA 4C5IA 1ZBXA 1W4SA 2K5FA 2X51A 2K57A 2SEMA 1YITQ 1WHMA 1E6HA 2LNVA 3EG1A 2LDMA 1FYNA 5GANf 1VQ9Q 4OB1B 5KCOA 3CCST 2QGFB 3X26B 2D6FA 2P0QA 3LGFA 3PIOA 1Y07A 3WVEB 1H92A 4IUQA 4CC2A 5C6SA 2BTTA 1G3TA 1BKBA 3VV0A 3MP1A 2B86A 4NL2A 3OYKA 2HCKA 1KD1U 2EQUA 5IAYA 3P8HA 2ZPGB 3PVQA 5GAOl 1RAIB 4PK4A 2ZAEA 1B07A 3QSUA 1RADB 3J81E 3OYBA 3OW2A 5GANj 1UG1A 1NJIR 1ZSZC 1QWFA 3G1JA 1IREB 3ZEHA 2VXFA 5L8RE 2LQKA 2AZSA 1X2KA 4M7DD 1FMWA 4RTZA 4OVAA 2DVEA 1UFFA 1G8XA 3G4ST 4BACA 3GBQA 5HY6A 2OTJQ 1S72Q 1O9SA 4KRTA 4N4GA 2MCNA 3VS6A 1Y0MA 1QQJA 2MYSA 2A08A 1UECA 3HPWA 1VQPA 1JBMA 4M78A 4OB0B 3JCMg 4M77G 2K4YA 1UGQB 5FU6B 4F7UF 2CP6A 5CAIA 2PUOB 3PNWC 2DETA 1PD0A 2RNAA 2F5TX 3FEOA 1NBEB 1YI2T 2KRSA 3SWNA 1WIEA 3EH1A 3QJYA 5FU6C 3M4YA 3A8LB 2HQXA 5GMKm 3CC2A 4CC3A 4OGCA 2M16A 4P5NA 3PTAA 3CCUQ 1VQKA 1Q86U 4XK8E 3CCLQ 2LCCA 3OMGA 2F2WA 2J6OA 3CMEQ 2X9HA 1W2BA 3GP8A 1SRLA 5IHNA 1K73U 5M9OA 4PLLA 1I0CA 2HL5C 1GRIA 4L6V5 1KD1C 2HBPA 3CD6A 3SEMA 1G2BA 2WACA 3CCEQ 2HQEA 2DTIA 1BIBA 2JTFA 4C92B 5LL6S 5GAMj 2E4HA 3CCRT 1VQOQ 2FRWA 2P4RA 4B9WA 2LP5A 2O9SA 4MZTA 2XIDA 4JPBW 5CQYA 2E10A 1QVGS 3UDCA 3FJ5A 2JTEA 3VS7A 1ZSZA 3QWYA 2KMTA 2JMAA 3BY7A 3G7ZA 2EQJA 4M75B 3O5ZA 5GAOp 3CCQT 3CC4A 3I55Q 5KCHA 1ZBJA 2DAQA 2L3RA 1MMNA 5LJ3g 2DTOA 4PJOB 4IKFA 3MCAB 4RKUE 1GCQC 3NPFA 4M75C 2FZGB 4ELZC 2LX9A 3JCMQ 4DEYA 1MNDA 3WXMB 4PJOC 2E65A 1CKBA 1OPKA 2XMFA 2Y4XA 4M7DA 4CI0C 4M7AE 2EYYA 1K0XA 4J9IA 4AT1B 5GAN8 3FIFA 1PNJA 4BDZA 4FYWB 2QEXT 2RQWA 3M59A 1Q86C 2JW4A 4XU0A 5CO7A 1ARKA 3LX7A 2KI7A 4DBQA 2RI5A 2CS7A 1HYOA 2DPPB 2EKHA 2J06A 1XOVA 2VUBA 3JB9J 1YITT 5I21A 2F5KA 3INZA 1LCKA 5CIUA 3FDRA 3RKXA 3MHXA 4NS5A 4M77A 3KFVA 1CKAA 5CCAA 2RQUA 1UDLA 5KYXB 1N9SA 3OMCA 4EIKA 2L0AA 3UATA 3PMTA 1JRIA 2K3YA 3AT1B 1NJIU 4XAXB 1K9MC 2GQVA 2CT3A 1YJNQ 4FU6A 4Z88A 1PKTA 3HRSA 3QYGB 4RUGA 2M51A 2MF2A 7AT1B 2L3SA 1RUWA 3QG1A 4HVWA 4E7ZA 4LD6A 1W6XA 2IPOB 3JCMe 1TWBA 3M57A 1X6GA 1Y71A 4FCYA 3RKYA 4F7UB 2ZCFB 1UJ0A 5HK0A 2RJEA 2FO0A 4PFZA 4BD3A 1Q7YR 2X3XD 3O8VA 2KGTA 1GCQA 4RCBA 3CC7A 4KT0E 3EFOB 3RMSA 4MDXA 1R8OB 2PQWA 4C8QE 2DKGA 3VU3C 2V8IA 1G83A 4BB7A 3TREA 2OTJT 1S72T 1VOMA 1UHCA 2AKKA 1ZA2B 1QVGA 2EGEA 5IXFA 4X9DA 2MMPA 2LJ3A 2KRNA 2KYMA 4J9DA 4JS5A 2P0PA 1GL5A 2YSQA 2YRDA 3H6ZA 4DEXA 4MZPA 1M5Q1 4J7IA 3SB2A 1WA7A 2K5LA 1OULA 1VQLQ 2K7AA 1VQKT 1NPPA 1VQ8A 2X35A 2QDYB 3KXTA 3L2UA 3OY9A 2DTHA 2E64A 2LT4A 5CQXA 1G3WA 1RI9A 3R6NA 3GF5A 3UF4A 4CC4B 4OMQA 1ZA1B 1K4US 2DBKA 3CCSQ 1ABOA 2F2VA 2K2MA 2RJCA 1R0BG 3CMET 1OPLA 1NZ9A 1M90U 2YXYA 2QQRA 2FYKA 2DO3A 3KUFA 1KQSA 3X20B 1IHWA 2R57A 1WQ7A 5LJ3e 1YJ9A 2ZPIB 1QCFA 1XNIA 2XDDA 3REBB 2RQRA 2E70A 5DLOA 3CCET 1JEGA 5IHKA 5GAN4 1OV3A 1BYMA 4QQGA 4XTXA 1YN8A 1VQOT 4RTWA 2G3RA 3MKDA 2IIMA 4EDUA 5A0GA 1TH7A 3FRNA 1PG5B 4BE0A 2EIFA 2HNIA 2J6FA 1WJRA 1WHLA 2RO0A 3RDVA 1BI3A 3NGPA 4R56A 4ANJA 2GFUA 1M2VB 1NPRA 2EQIA 3P8DA 1OX8A 1SHFA 3OYFA 4MZMA 5KYUB 1YJWA 4N4IA 4J83A 1BU1A 1PWTA 2LTOA 3HHTB 3C95A 3LLRA 2G6FX 4C8QF 3EG0A 1VQNQ 1ZUUA 2NUPB 1VYTA 1TTHB 1LOJA 2JM8A 1OQKA 2YLBA 3M53A 2FRYA 2F69A 2RQVA 2KR3A 4C92E 1KSWA 1KC8R 3I9QA 1QKWA 5GMKh 3C4SA 2NUTB 3MEAA 1SSFA 1JQQA 2EYXA 3RIRA 3JB9G 5IHIA 5KE2A 5DM7R 3EGDB 2QASA 4RG8A 2RK1A 2BIVA 3E9FA 3P8BB 2C06A 1NLOC 2M1HA 2CP2A 2FPFA 2JUFA 4PNOA 1B7TA 4JJDA 2L89A 1IRXA 5FWBA 3ME9A 2VYTA 4JLIA 1KQSP 2E3IA 1V1CA 4X34A 2OI3A 1OOTA 2BE9B 5D6WA 2LQ8A 5FRNA 1TOVA 1Z9ZA 5FLXE 2CZ6B 3UA7A 1VUBA 5GMKl 4CC7A 3CXCA 4E7JA 4C5HA 4DOWA 2FHDA 1H3ZA 2GQIA 2JZ2A 2HD0A 2KROA 1SPKA 3ZL7C 3PIPA 3VJPA 2D8HA 1HD3A 1YJNT 4M7AD 1JXOA 3JB9I 3H9NA 3OYAA 1YCYA 3JSCA 3OYNA 2CP3A 5CK9A 2DM1A 2O31A 2OJ2A 3EGXA 1VQ7Q 2LC4A 1SHGA 3FJPA 1TUGB 2FEIA 2EQMA 4XQ3A 4JZ3A 2PU9B 8ATCB 4F16A 4LUEA 3CC7T 4BI4A 4ORZA 2DRMA 3LWHA 5GAOq 1OX9A 2KT1A 4M7AC 2COYA 1WXTA 5AT1B 1DJ7B 1HJDA 4IIMA 4MDWA 2C0TA 5LJ5g 3OYGA 4C0GA 4OMFB 1LVKA 2PVGB 4F04B 2PTKA 2KBTA 2WSEE 8AT1B 1UUEA 3THKA 2DE0X 2F1LA 5GJVB 3C0CA 1QVPA 4CRIA 2FG0A 2QQBA 4AG2C 2JXBA 2YRCA 5KYNA 1B3QA 4XTWA 3RESA 1OEBA 4D6WA 1VQ8T 1VQ5A 3MEVA 2BKDN 1M4ZA 2QYZA 4PJNA 1U1SA 2VB6A 1YHQA 4LDYA 3JCMb 1QKXA 3QDFA 2J05A 2RF0A 2JMCA 3L2RA 3CXCP 3PT9A 4VUBA 3EHQA 3QUIA 4FT4A 1ZUYA 4J9FA 3UT1A 2M9UA 3J80E 5CKDA 2LT1A 4BE2A 4QT7A 5GAN7 1YIJA 3V8KA 1YJ9T 1ZX6A 1Q7YC 2P84A 2DEQA 3CCVA 2DL7A 1SF9A 1UHFA 5KYWB 2CP7A 4C8QB 1WHKA 5LJ3f 3LGLA 3S3OA 3T9NA 1Y96B 2JS2A 1NE8A 5CR2A 4JRQA 1TUDA 1K76A 3RBBB 2CKKA 2OX7A 2K3XA 4C8QC 1KC8U 4ZGEB 3CMAA 4LNPA 2ZGWA 5HK3A 2ED1A 4F14A 4M7DG 1YJWT 2KK4A 3MEUA 4LDXA 2LZ6B 3VRYA 3M0SA 3JAME 4GLMA 4J6YA 4M7AA 4JJNK 1VQMA 5D6YA 2MI6A 2YHTA 5D6XA 1VQPQ 4KGZB 1SG5A 1VQNT 2HDAA 2RHZA 2QDLA 5A0LA 5LJ3j 2D9TA 1AWXA 2DYBA 2FVUA 1AWJA 1I5OB 2D8JA 4RG2A 4RCCA 2VXEA 1N8RR 2X4WA 2EYQA 1Q82C 3H41A 1JB0E 2FZCB 4ZGJB 2CSQA 2VVKA 3VUBA 2CGHA 2RQTA 2E6ZA 1CSKA 1M27C 3OS5A 3CC2Q 5GMKi 2YWWA 1VQKQ 2D0QB 3U23A 2BZYA 1T0JA 2C0OA 1E7OA 3QO3A 2PUKB 2YDLA 1WXBA 5EG2A 1GFDA 1Q81C 4J9HA 2KQWA 1ZQ1A 1JO8A 2EYWA 1Q95G 3TU4K 1G3YA 3BDLA 2H3JA 3ULRB 1AEYA 1RAHB 1H8KA 4JS4A 3CD6Q 2MIOA 2QK0A 4HCBA 1RAEB 4C92D 2CZ7B 3SHWA 2O01E 3HL8A 4Y91A 3DB4A 2ZZDA 1H3HA 4OMNA 1KK7A 1I1JA 3PVLA 5J26A 3HFNA 2RN8A 3UWNA 3OYDA 5LJ5e 3OW2P 3OS0A 1KC8C 3VYHB 3DLLA 2LNHB 1I81A 3V8JA 3AHUA 4M75D 1K9MU 4HXJA 1O75A 3M56A 1UEBA 1QLYA 4XTVA 3G6EA 2ROTA 2LVMA 3CC4Q 1B34B 2LMJA 1VQ7T 1OZ3A 3CBPA 1K9AA 4F17A 1M2OA 4C92C 3SFMA 1AWWA 4PJOD 2A36A 3URGA 3VS2A 3MEWA 1Y57A 3H0HA 3EG9A 1EX4A 5GAOn 4B6MA 2QA4A 5GANg 5IT9E 2ED0A 1UGSB 4C0ZA 2VWFA 2XU8A 3GPLA 1M30A 1GXIE 4BI8B 5GMKj 1RAFB 4MMLA 4OMMA 3BE3A 3CPWS 2DVJA 1WJQA 3CCJA 3CCMA 1AT1B 2E3HA 1GCPA 1I5LA 2ECZA 1VQ5T 3E9GA 3OYYA 1VYVA 2KT8A 1HSQA 1IXDA 5IXBA 2JT4A 1D0YA 1N27A 2RI3A 3BDUA 3JCMh 2CH4A 4YTLA 3OYHA 4OP0A 1C0MA 3L42A 1X69A 1YWPA 5KE3A 1W2BP 3JCMd 1X6OA 2A3LA 4OB3B 3VYGA 4QQDA 2RI2A 2M0YA 3A8MB 1D3BB 4HKEA 2A37A 4J6WA 2XICA 3LYIA 2V8KA 1WHHA 3A98A 1VIEA 4PL6A 1RACB 4L59A 5CKFA 2DF6A 3C94A 4HA8A 3NTIA 4GLKA 1WNLA 4Y28E 1VA7A 4M78E 1YNZA 1NYFA 4RTYA 1YFNA 2R5AA 5GAN3 1WHJA 1OYXA 4PFOA 2KNBB 3JB9H 2XK0A 1IHVA 4XTYA 5J3BA 2DJZA 1VQ4A 2BUDA 1PM3A 3FLGA 1JU5C 4ESRA 4C92A 5GAMg 5IN1A 4GY5A 1BI2A 3N5BB 4XU2A 1KG1A 2E5KA 2XG8D 1FWZA 1N8RU 2CUDA 3S6WA 3I56A 2DD5A 4Z89A 1VQMT 1V76A 1KQ1A 3CC7Q 4IUVA 3M5AA 3JB9F 2XD0A 2RH2A 3QYHB 5FW9A 2EJGA 2Z0WA 3A8HB 2DLPA 4M75A 1EIFA 3OYJA 3MO8A 1VQPT 4Z8AA 2NYSA 2RHUA 2O88A 4EPCA 4E7HA 1MMGA 1UTIA 4PJOA 3DKMA 5LJ3h 5LJ3d 3VS4A 1QWEA 5FROA 1PD1A 2DFUA 1U3OA 4JZ4A 4AFSC 4PFPA 2HMAA 1VQ8Q 2AIRB 1SRMA 1X2QA 4FT2A 4N4HA 1UB4A 3CC2T 1R0CB 3LWIA 1UGVA 2CT4A 3GNGA 3X25B 1WQWA 2DD4A 2KXDA 3A1PA 4NOYA 2PVDB 1D1BA 3CPWA 3OB9A 1MHNA 1M3BA 2L3QA 2L8DA 1K1ZA 4QVDA 1YJ9Q 4KULA 1Q82R 2HAXA 2QQSA 2FL7A 1KQ2A 4A4KA 3CD6T 1AVZC 4M78F 2JM9A 4EMKB 2HSPA 2DJQA 5GANe 5DY9A 5FRMA 1M1GA 4KH0B 2KVQG 2JJ9A 5KYXA 4OGEA 2V26A 2RPNA 4M7DE 2VKNA 2FPEA 3G6ET 4EMKC 4WTOB 1PRLC 2RB6A 4ZTJA 1N8RC 1Q81R 2DBMA 2X4XA 1UE9A 2COWA 3L1AA 2QI2A 2GBQA 2GCXA 1R77A 2HZYA 3CC4T 3QBYA 3R6OA 1YJWQ 1KJWA 1N5ZA 2QA4T
chains in the Genus database with same CATH topology
3GLXA 3H8ZA 1OZ2A 4OMFB 2F5TX 3FEOA 5DLQE 1VQ9T 2JTMA 2PVGB 1YI2T 3SWNA 4BDYA 2V8JA 3QJYA 2O4XB 1MGQA 2WSEE 5FU6C 3M4YA 3A8LB 5CKHA 3X28B 4C0FA 3CMAT 2HQXA 4F7UA 5GMKm 3CC2A 2DZ9A 4OGCA 2M16A 2VGMA 3OSSC 2GF7A 4P5NA 3PTAA 1XTDA 2VC8A 4M77E 5GAOm 1Q86U 1VQKA 4XK8E 3CEYA 4HT9A 1QVPA 2RJDA 2QQBA 4CRIA 4X9CA 3V7CA 4E7LA 2X4YA 1QP2A 2EWNA 2LCCA 4XTWA 3CCJT 3RESA 2RD1A 4C5EA 4D6WA 1VQ8T 3OMGA 1VQ5A 3HSBA 3MEVA 1ZHIA 2BKDN 1K8AC 1W2BA 1B34A 1M4ZA 3JCMX 3GIBA 3GP8A 1U1SA 1K73U 5M9OA 4PLLA 1YHQA 3QZ9B 3RUXA 3JCMV 4LDYA 2EKOA 3JCMb 4N0AA 1YJNA 5GAN6 2DXUA 4KUIA 4L6V5 1KD1C 3CBOA 3QZ5B 3RERA 2HBPA 4ME7A 3CD6A 1P92A 3L2RA 2K5IA 3PT9A 4VUBA 3QUIA 1PSEA 4FT4A 2WACA 3Q1JA 2HQEA 2DTIA 3G4SA 1BIBA 3QKJA 2JTFA 3UT1A 5LL6S 2M9UA 2ZPFB 4C92B 5GAMj 3J80E 3CCRT 3J7AF 3OYLA 5I2MA 5GANh 5CKDA 1QP3A 2OTLA 4B9WA 2LT1A 4BE2A 5J39A 4A54A 5GAN7 1YIJA 3V8KA 2KAFA 5GANd 1YJ9T 1Q7YC 1BI0A 4MZTA 2XIDA 5CQYA 2E10A 1QVGS 2DEQA 3CCVA 3UDCA 2IVWA 1H641 2R58A 5GAMe 3JCMP 3V7SA 4C8QB 2YLCA 5LJ3f 2KMTA 3LGLA 3S3OA 3T9NA 3DB3A 3BY7A 4LDVA 3G7ZA 2EQJA 1Y96B 2LRQA 4M75B 5GAN2 5GAOp 3CCQT 3CC4A 4UC4A 5GAOr 5KCHA 4PLIA 1NE8A 3GNFB 3M58A 4EMHA 3SD4A 2DAQA 4FIBA 3OS2A 2L3RA 5CR2A 4JRQA 4M7AF 5LJ3g 2DTOA 3UPUA 4ZN1A 1YI2A 4M7AG 2CKKA 3QPHA 4PJOB 3MP6A 2XDPA 2DIQA 2Y4YA 2K3XA 4C8QC 1N9RA 3BFMA 4FM4B 3FB9A 4ZGEB 3MCAB 1KC8U 3CMAA 4IKFA 4M7DF 3CXCS 4RKUE 4WF2A 2ZGWA 1I8FA 3VKIA 4M75C 5HK3A 5KH6A 1VQ4T 5AYFA 5C0MA 1JJ2A 4M7DG 1Q7YU 3ZBDA 4A4EA 2RA2A 1YJWT 2KK4A 4ELZC 2LX9A 3BW1A 3MEUA 3JCMQ 1D3BA 2CZ1B 3JCMc 4LDXA 3HRTA 3JAME 5CVIA 1KHCA 1IZ6A 1RL2A 3NTKA 4J6YA 2RHYA 4M7AA 3WXMB 4BY6B 4PJOC 2E65A 4JJNK 1VQMA 5D6YA 2MI6A 2YHTA 5D6XA 2EAYA 3V7RA 2Y4XA 2RK2A 1VQLA 1QVFS 1VQ6A 4QVCA 4M7DA 4CI0C 1U1TA 3OYEA 4M7AE 1HK9A 3CCUT 1VQNT 3E1SA 3EFRA 2RHZA 5GAN8 4E7IA 2JOYA 1VIFA 2FB7A 1G3SA 3FIFA 5A0LA 5FU7B 5LJ3j 4BDZA 2D9TA 2PVOB 3JCMf 3CCLT 2FVUA 2QEXT 4B9XA 4BY6C 3M59A 4RG2A 4RCCA 2VXEA 1Q86C 4JRPA 4XU0A 4JRKA 2X4WA 4V2SA 5CO7A 2X4JA 2EYQA 4M77F 1NJIC 5LJ5f 3RMQA 2MAMA 3LX7A 3L2VA 3CCRA 1JB0E 2AHJB 1Q82C 4ZGJB 3L2ZA 3CCSA 2RI5A 2CS7A 2DPPB 5FU7C 3VUBA 2RHIA 1BI1A 2CGHA 2WSCE 4LDUA 1XOVA 2VUBA 4QW2A 2EJFA 3NFCA 3JB9J 2E6ZA 1YITT 4HCCA 3OS5A 5I21A 5GMKi 2F5KA 3INZA 3PGGA 5CIUA 2K2VA 3FDRA 4M78D 3JRZA 3MHXA 2D0QB 4NS5A 3RKXA 4M77A 4EMGA 5GAMh 4J5YA 4JRIA 4IUTA 5CCAA 2IG0A 3QO3A 3CCQA 2PUKB 3G71A 4FSXA 5GAMd 5EG2A 3QHSA 1N9SA 3FC3A 2ZPHB 1WJSA 4J6XA 4DA4A 3OMCA 1Q81C 5A0DA 1M9SA 2GFAA 2L5QA 3PMTA 1JRIA 2KQWA 1ZQ1A 2K3YA 4M78B 3OA6A 4MMKA 4XAXB 1NJIU 4QQ6A 3CCMT 4HCZA 1Q82U 2GQVA 1K9MC 3OQ5A 2MWOA 4FU6A 3OSVA 1G3YA 2DXCA 2H3JA 3BDLA 3M54A 1AHJB 2NLUA 3HRSA 3QYGB 5I2SA 4PKCC 4JS4A 2DZCA 4ZN3A 3CBMA 3TCJA 2MF2A 3I55T 3M4GA 4HCBA 4C92D 2CZ7B 2DIGA 4DQ2A 5LJ5j 3QG1A 2O01E 3OYMA 1UGRB 1OI1A 4XU1A 4LD6A 3HL8A 4M78C 4Y91A 3DB4A 4C8QG 3JCMe 2ZZDA 3M57A 1WPYA 1Y71A 3RKYA 3SWNB 2CZ0B 2XDBA 3PMIA 5J26A 1M1FA 3LW5E 4ELYC 3HFNA 4F7UB 2ZCFB 3KBGA 5HK0A 2ZPEB 3UWNA 2WSFE 2RJEA 2QQ9A 2RM4A 1VQNA 1Q81U 2KSSA 3OYDA 5LJ5e 4RMOA 3OS0A 3JCMW 1KC8C 3VYHB 4C8QD 3DLLA 4BD3A 1I81A 3O8VA 3V8JA 3AHUA 2QEXA 3NTHA 4M75D 1K9MU 3HFOA 1O75A 3M56A 3JCMJ 1UEBA 4XTVA 2A7YA 4RCBA 3G6EA 3CC7A 2OAUA 1HXDA 2XHCA 3SWNC 2LVMA 1YBYA 4KT0E 1B34B 1N6AA 3RMSA 5HKCA 1VQ7T 4MDXA 1OZ3A 3CBPA 1R8OB 2PQWA 4C8QE 2DKGA 4C92C 3VU3C 2R5MA 3JB9D 2V8IA 4BB7A 3SFMA 4LD9K 3HKSA 3TREA 4PJOD 2OTJT 1S72T 4M75E 4A4FA 3C12A 3URGA 3MEWA 1FX7A 4BUGA 1Y7XA 4ATOA 3META 1KHIA 1YITA 5GAOn 4ZGDB 1QVGA 2QA4A 4II1A 4PJOE 4X9DA 5GANg 1VQ9A 2MMPA 3OS1A 2JN0A 5IT9E 3SDZA 1UGSB 2P0PA 4C0ZA 2YRVA 4JS5A 2XU8A 3GPLA 2E1HA 2EJ9A 1GXIE 3H6ZA 4MZPA 4BI8B 4MMLA 1BIAA 4EMKA 1M5Q1 5GMKj 4J7IA 1M90C 3SB2A 2K5LA 3F70A 2RHXA 2LCLA 2JVVA 1WJQA 5CKBA 3CPWS 3X24B 3CCJA 3HRUA 3CCMA 3OW2S 1VQKT 1NPPA 1VQ8A 2X35A 1X75C 2QDYB 3ASKA 3KXTA 2E41A 2KY9A 3OBYA 1I5LA 3L2WA 3QIIA 3I56T 3L2UA 3OY9A 5GMKe 1VQ5T 2DTHA 2E64A 2LT4A 3E9GA 3OYYA 5CQXA 1G3WA 4JDSA 4A53A 3GF5A 4DOVA 1WGSA 2EFIA 1N27A 4A4HA 2RI3A 2QXFA 3BDUA 3JCMh 4YTLA 3OYHA 4XU3A 2RJCA 3DLMA 3L42A 4OP0A 3CMET 1QVFA 3QJ6A 1X01A 1NZ9A 5KE3A 4FL6A 3JCMd 4IURA 3HP9A 1X6OA 2A3LA 4OB3B 1M90U 2QQRA 4QVZA 2FYKA 3VYGA 2DO3A 3KUFA 4QQDA 2RI2A 4M78G 3X20B 5LJ5h 2R57A 1WQ7A 3A8MB 4HKEA 1D3BB 1M1KC 5LJ3e 4J6WA 2XICA 3VUZA 1YJ9A 2ZPIB 2O4XA 1XNIA 3LYIA 2V8KA 4XTZA 1QW1A 4M7AB 5LJ5d 2XDDA 3OYCA 4A4GA 1U8RA 2OTLT 1FXXA 4JLGA 2E70A 2JNGA 1VIEA 3S3NA 2KDSA 1VQ7A 3EAEA 4PL6A 5DLOA 4ZTFA 3CCET 4M7DB 2DXBA 4L59A 5CKFA 4OB2B 3ZFJA 5GAN4 2OTJA 1S72A 4QQGA 1BYMA 3C94A 4XTXA 3V8LA 1VQOT 2RJFA 2E6NA 4C0DB 4HA8A 2G3RA 3NTIA 4EDUA 2EQKA 4GLKA 1WNLA 5A0GA 1TH7A 3WVDB 1LJOA 3FRNA 4L5GA 4Y28E 4C92F 2EIFA 4M78E 2HNIA 4BE0A 1WJRA 2RO0A 4KBMB 5GAN3 2R5AA 4O6JA 4C92G 1BI3A 1OYXA 2E5QA 4R56A 3JB9H 4M7DC 2XK0A 2GFUA 2XKOC 3TU4K 4XTYA 5J3BA 1NPRA 4M77D 5GAMf 1M1KU 4Z02A 2DJZA 3P8DA 2BUDA 2E12A 4C0DC 2XI9A 1VQ4A 3FLGA 3OYFA 4MZMA 1YJWA 4N4IA 3TEEA 3ER0A 4J83A 2DXTA 4LDWA 1W2BS 1G5VA 4J8OA 2LTOA 2ZPBB 3HHTB 3QDRB 4C92A 3C95A 3LLRA 4C8QF 5GAMg 5IN1A 1XQHA 3PFSA 4GY5A 1BI2A 1LOJA 2YLBA 3N5BB 4M75F 3M53A 4M77B 4XU2A 1KG1A 2F69A 3CPFA 4F7UE 1I4K1 2I2LA 4M75G 2VGNA 1M8VA 2XG8D 4C92E 1FWZA 3A8OB 1N8RU 3S6WA 3I56A 2DD5A 1VQMT 1KQ1A 4IUPA 4IUVA 3CCUA 3M5AA 5GMKh 3JB9F 3C4SA 3L2QA 3MEAA 3EFSA 4PJOF 1SSFA 3RIRA 2XD0A 1VQLT 4OF1A 3M55A 2RH2A 3JB9G 4Q5WA 4TVRA 4KUDK 3QYHB 1VQ6T 4PJOG 3CCLA 2EJGA 4C8QA 5KE2A 3A8HB 5A2QE 5DM7R 2VV5A 3OBWA 4M77C 3RKWA 2MWPA 4M75A 1Y96A 3CMEA 4C5IA 1EIFA 1ZBXA 1W4SA 2K5FA 2Y90A 2K57A 4RG8A 3OYJA 3MO8A 1VQPT 2RK1A 4O5VA 2BIVA 2RHUA 2LNVA 3E9FA 2P4TA 3P8BB 4EPCA 3GOXA 4E7HA 3S3MA 2P0KA 2LDMA 2C06A 5GANf 2M1HA 4PJOA 3DKMA 4OB1B 4XTUA 5LJ3h 2JUFA 5KCOA 3CCST 4PNOA 3X26B 2D6FA 5LJ3d 2P0QA 3CCEA 2B8AA 3LGFA 2L89A 5GAN5 1Y07A 3WVEB 5FROA 3PIOA 1K8AU 4IUQA 5C6SA 1PSFA 3ME9A 1VQOA 1G3TA 2VYTA 4N0AC 4JLIA 1BKBA 3VV0A 4IUUA 4FT2A 4N4HA 3MP1A 4X34A 4NL2A 3OYKA 1UB4A 3G71T 1KD1U 3CC2T 1JJ2S 5D6WA 2LQ8A 3LWIA 5FRNA 4HT8A 2EQUA 4E47A 3GNGA 5FLXE 5IAYA 2CZ6B 3P8HA 1VUBA 1WQWA 2DD4A 2ZPGB 3X25B 5GMKl 3CXCA 4E7JA 4NOYA 4C5HA 4DOWA 5GAOl 2FHDA 1UGPB 2PVDB 1H3ZA 3I55A 2JZ2A 3QSUA 2HD0A 4E7KA 2M0OA 3J81E 3OYBA 3CPWA 3OB9A 1MHNA 3OW2A 3PIPA 3VJPA 2QQAA 5GANj 1YHQT 1YJNT 4M7AD 4J7FA 2L8DA 4QVDA 3JB9I 3OYAA 4KULA 2HAXA 1YCYA 3JSCA 2QQSA 1IREB 3OYNA 2FL7A 3ZEHA 5CK9A 4A4KA 1KQ2A 3CD6T 3E19A 2VXFA 2DK3A 2LQKA 4M78F 5L8RE 4EMKB 4M7DD 3A8GB 1LNXA 4OVAA 2LC4A 1RI0A 3FJPA 2DVEA 3G4ST 4BACA 5HY6A 5GANe 3MP8A 2QTXA 3OYIA 1V29B 1O9SA 5DY9A 2EQMA 1M1GA 4XQ3A 4N4GA 2KVQG 1KQSS 5FRMA 4OGEA 2PU9B 4M7DE 1YIJT 3HPWA 1VQPA 3G6ET 1JBMA 3CC7T 4BI4A 4EMKC 4M78A 2RB6A 4BI3A 3CCVT 3A5ZB 4OB0B 5CKEA 3JCMg 3LWHA 4BE1A 5GAOq 2X4XA 4ZTJA 3L1AA 4M77G 1N8RC 2K4YA 1UGQB 4M7AC 5FU6B 4F7UF 2QI2A 2GCXA 5CAIA 1DJ7B 3M9QA 3QBYA 3R6OA 4F7UG 3CC4T 4C5GA 1K73C 1KQSA 3LH0A 4R55A 2CYZB 4JUVA 4MDWA 5LJ5g 2PUOB 3OYGA 3PNWC 3QXEB 4NL3A 2QA4T 4C0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN 8;  2FB7 A;  4PJO G;  3FIF A;  2EJG A;  2JN0 A;  4C8Q A;  5LJ3 j;  3JCM f;  3SWN A;  4M77 C;  3RKW A;  4M75 A;  1MGQ A;  1Y96 A;  2E1H A;  2EJ9 A;  5GMK j;  4MML A;  1BIA A;  2VXE A;  1M5Q 1;  2Y90 A;  4RCC A;  4EMK A;  2K57 A;  4XU0 A;  2DZ9 A;  4JRK A;  3SB2 A;  4F7U A;  5GMK m;  4V2S A;  2VC8 A;  4M77 E;  4M77 F;  5GAO m;  4HT9 A;  5LJ5 f;  4X9C A;  5GAN f;  3L2Z A;  3V7C A;  4PJO A;  4XTU A;  2EWN A;  5LJ3 h;  4XTW A;  3RES A;  2RD1 A;  2CGH A;  3HSB A;  2E41 A;  4PNO A;  1B34 A;  2EJF A;  3JCM X;  3JB9 J;  5LJ3 d;  1I5L A;  5GMK e;  3GIB A;  2DTH A;  2E64 A;  5I21 A;  1U1S A;  5GMK i;  5GAN 5;  3INZ A;  3PGG A;  3RUX A;  3JCM V;  4M78 D;  3RKX A;  4A53 A;  4EMG A;  3JCM b;  4N0A A;  4M77 A;  5GAN 6;  4N0A C;  5GAM h;  2DXU A;  4J5Y A;  4JLI A;  4JRI A;  3RER A;  3BDU A;  3JCM h;  3QO3 A;  4XU3 A;  4OP0 A;  5GAM d;  3QHS A;  1N9S A;  1X01 A;  4NL2 A;  4J6X A;  3QUI A;  3JCM d;  5GAN g;  4HT8 A;  2DTI A;  1JRI A;  2FYK A;  1BIB A;  4C92 B;  5GAM j;  4M78 B;  4M78 G;  5LJ5 h;  1WQ7 A;  4MMK A;  5GMK l;  1D3B B;  1WQW A;  5LJ3 e;  5GAN h;  4J6W A;  4XTZ A;  4NOY A;  5GAO l;  4M7A B;  5LJ5 d;  4A54 A;  5GAN 7;  3V8K A;  5GAN d;  3QSU A;  2DZC A;  3M4G A;  4C92 D;  4DQ2 A;  5LJ5 j;  2E10 A;  4M7D B;  2DEQ A;  5GAN 4;  4XU1 A;  1H64 1;  5GAN j;  5GAM e;  4XTX A;  4M78 C;  4Y91 A;  3V8L A;  3JCM P;  3V7S A;  4M7A D;  4C8Q B;  4C8Q G;  2YLC A;  4HA8 A;  5LJ3 f;  4QVD A;  3JCM e;  3JB9 I;  1WPY A;  1YCY A;  3BY7 A;  1WNL A;  3RKY A;  3SWN B;  1TH7 A;  4M75 B;  1LJO A;  1Y96 B;  5GAN 2;  5GAO p;  1KQ2 A;  4C92 F;  2VXF A;  4M78 E;  2HNI A;  4M78 F;  4EMK B;  5GAO r;  3HFN A;  4F7U B;  4M7D D;  1LNX A;  5GAN 3;  4C92 G;  4EMH A;  3FJP A;  2DVE A;  2RM4 A;  5LJ5 e;  3JB9 H;  4M7D C;  5LJ3 g;  4M7A F;  2DTO A;  3JCM W;  4C8Q D;  5GAN e;  4XTY A;  1I81 A;  2QTX A;  4M77 D;  5DY9 A;  3V8J A;  5GAM f;  4XQ3 A;  3AHU A;  4M7A G;  4PJO B;  2DJZ A;  4M75 D;  3HFO A;  1N9R A;  4C8Q C;  3BFM A;  3JCM J;  3FB9 A;  4XTV A;  4M7D E;  4RCB A;  4M7D F;  4WF2 A;  1HXD A;  2ZGW A;  1I8F A;  3SWN C;  4M75 C;  1B34 B;  2DXT A;  4M7D G;  1JBM A;  2RA2 A;  4EMK C;  4C92 A;  4M78 A;  4C8Q E;  3BW1 A;  2DKG A;  2RB6 A;  3VU3 C;  4C92 C;  4C8Q F;  1D3B A;  3JCM c;  3JCM Q;  5GAM g;  3JB9 D;  4PJO D;  1LOJ A;  2YLB A;  4M75 E;  4M75 F;  3JCM g;  5GAO q;  3L1A A;  4J6Y A;  4M77 G;  4M77 B;  4XU2 A;  4M7A A;  4M7A C;  4F7U E;  1I4K 1;  2E65 A;  2I2L A;  4M75 G;  4F7U F;  4C92 E;  4PJO C;  1M8V A;  5CAI A;  2YHT A;  4F7U G;  2EAY A;  1KQ1 A;  3V7R A;  5GAO n;  5GMK h;  4JUV A;  3JB9 F;  4M7D A;  4QVC A;  5LJ5 g;  1U1T A;  4M7A E;  4NL3 A;  3EFS A;  4PJO F;  1HK9 A;  4PJO E;  3RIR A;  4X9D A;  3JB9 G;  3EFR A; 
#chains in the Genus database with same CATH topology
 5DLQ E;  4BDY A;  2V8J A;  2O4X B;  2AK5 A;  4C0F A;  4F7U A;  2DZ9 A;  3OSS C;  2GF7 A;  1XTD A;  4M77 E;  1QVG P;  2DIL A;  4J9G A;  3V7C A;  2LQN A;  1MNE A;  2EWN A;  3CCJ T;  2RD1 A;  4C5E A;  2HSE B;  3HSB A;  1ZHI A;  2KEA A;  2J7I A;  3EFO A;  3GIB A;  3I5R A;  3QZ9 B;  3RUX A;  2DL4 A;  2EKO A;  1MV0 B;  1KIK A;  1ABQ A;  3RER A;  2L2P A;  3QZ5 B;  4ME7 A;  2K5I A;  2CH4 W;  1PSE A;  3G4S A;  3QKJ A;  3CPW P;  5I2M A;  2OTL A;  2DX1 A;  2KAF A;  4OMO A;  1BI0 A;  1PRM C;  4JJB A;  2AZV A;  5KYY B;  2IVW A;  1E6G A;  5GAM e;  1X43 A;  4J9E A;  2LRQ A;  1J3T A;  1OU8 A;  1D0X A;  5I11 A;  1NEB A;  4ZN1 A;  1YI2 A;  4M7A G;  2DIQ A;  1N9R A;  4FM4 B;  3FB9 A;  4M7D F;  3I35 A;  1VQ4 T;  1I8F A;  5KH6 A;  5AYF A;  2ABL A;  1Q7Y U;  3ZBD A;  4A4E A;  2RA2 A;  3BW1 A;  1AWO A;  2CZ1 B;  1EFN A;  3HTR A;  1IZ6 A;  1RL2 A;  3NTK A;  3JV3 A;  4BY6 B;  1VYU A;  2RK2 A;  1QVF S;  1VQ6 A;  3OYE A;  1PHT A;  3EFR A;  4E7I A;  2FB7 A;  4J9B A;  5FU7 B;  4M4Z A;  3JCM f;  3TSZ A;  2EPD A;  1QMC A;  1XJW B;  4BY6 C;  2DEU A;  3TSW A;  4JRP A;  4JRK A;  4V2S A;  2X4J A;  4M77 F;  4HVV A;  2MAM A;  3CCR A;  1M2V A;  1YWO A;  2AHJ B;  1K73 R;  5FU7 C;  1UJY A;  2RHI A;  1BI1 A;  5KYU A;  1TUC A;  1MUZ A;  4HCC A;  2NUP A;  2K2V A;  4M78 D;  4EMG A;  3JRZ A;  4J5Y A;  3CCQ A;  3G71 A;  4FSX A;  1VQ5 Q;  1NG2 A;  2ZPH B;  1WJS A;  4J6X A;  2NUT A;  4LE9 A;  2GGR A;  2C0I A;  2GFA A;  3VRZ A;  4M78 B;  1YHQ Q;  3OA6 A;  1K8A R;  2D0N A;  3TVT A;  1Q82 U;  3OQ5 A;  3OSV A;  3EGD A;  1AHJ B;  2LJ1 A;  5I2S A;  2DZC A;  3TCJ A;  1M8M A;  3M4G A;  2DIG A;  2EYZ A;  2DMO A;  3OYM A;  1UGR B;  1OI1 A;  3M0R A;  3PE0 A;  4XU1 A;  4M78 C;  4C8Q G;  1AD5 A;  3SWN B;  2XDB A;  4D8K A;  1YIJ Q;  2SRC A;  3PMI A;  4ELY C;  1M1F A;  3KBG A;  2ZPE B;  1WYX A;  2WSF E;  2QQ9 A;  1WLP B;  1Q81 U;  4RMO A;  3UA6 A;  3CCV Q;  4C8Q D;  5ECA A;  1SEM A;  2QEX A;  3NTH A;  2A7Y A;  2OAU A;  1HXD A;  2XHC A;  3SWN C;  1N6A A;  2R5M A;  4K11 A;  4LD9 K;  1T0H A;  4JJC A;  1KFZ A;  1FX7 A;  5IH2 A;  1Y7X A;  4ATO A;  2F2X A;  3MET A;  1KHI A;  3CMA Q;  1YIT A;  2COZ A;  2K6D A;  4II1 A;  1VQ9 A;  4OML A;  2M02 A;  3H0I A;  1VQM Q;  1BIA A;  2ESW A;  3F70 A;  1X27 A;  2RHX A;  2JVV A;  2ATC B;  1X75 C;  1BB9 A;  3ASK A;  1ZSZ B;  2E41 A;  3L2W A;  3QII A;  4KH1 B;  2FPD A;  3EG9 B;  4A53 A;  4DOV A;  1WGS A;  2EFI A;  2H8H A;  2LJ0 A;  2QXF A;  4XU3 A;  1QVF A;  1GBQ A;  1X01 A;  4FL6 A;  3HP9 A;  1FMK A;  2NUZ A;  4QVZ A;  3VS1 A;  2KXC A;  5LJ5 h;  1K0S A;  1I07 A;  1M1K C;  3VUZ A;  5LJ5 d;  3OYC A;  2OTL T;  2JNG A;  3S3N A;  2KDS A;  3EAE A;  3RR6 A;  4M7D B;  3ZFJ A;  4OB2 B;  2OTJ A;  1S72 A;  2LCS A;  2NWM A;  1ZLM A;  3V8L A;  1F1B B;  2E6N A;  2HBW A;  4E7S A;  2EQK A;  1MMD A;  1LJO A;  1WX6 A;  2K79 A;  2KE9 A;  4KBM B;  1JXM A;  4C92 G;  2E5Q A;  4M7D C;  1WFW A;  2XKO C;  5GAM f;  4M77 D;  2E12 A;  3MPU B;  1TXQ A;  2KRM A;  3ER0 A;  3TEE A;  2DXT A;  1T3S A;  1G5V A;  4J8O A;  2I0N A;  2ZPB B;  4AFZ C;  4FSS A;  2RMO A;  4M77 B;  1FMV A;  3CPF A;  1I4K 1;  2I2L A;  4M75 G;  2VGN A;  4Y92 A;  1M8V A;  1BBZ A;  1SKU B;  3G6E Q;  3CCU A;  1YP5 A;  3L2Q A;  3EFS A;  1VQ6 T;  4OF1 A;  4Q5W A;  4TVR A;  5KYW A;  4PJO G;  3CCL A;  2PZ1 A;  4C8Q A;  2ROL A;  1C6V X;  2VV5 A;  2K3B A;  4M77 C;  2MWP A;  1Y96 A;  3CME A;  2KYB A;  2Y90 A;  2EW3 A;  4D8D A;  4O5V A;  2QA4 Q;  3GOX A;  2YUP A;  2P4T A;  2P0K A;  3M0U A;  3NHN A;  2BZX A;  4XTU A;  2HQH A;  4KGV B;  1LPL A;  2HKQ B;  1WXU A;  2O9V A;  2DYI A;  3CCE A;  2B8A A;  5GAN 5;  1K8A U;  1QVF P;  1PSF A;  1BCO A;  1VQO A;  1D1A A;  3CCJ Q;  4N0A C;  3CCM Q;  1M90 R;  1IB8 A;  4IUU A;  3G71 T;  1JJ2 S;  4HT8 A;  4E47 A;  3REA B;  1UGP B;  1AOJ A;  2QG9 B;  4GBQ A;  3I55 A;  2ENM A;  4E7K A;  2M0O A;  2EBP A;  1M3A A;  2QQA A;  1YHQ T;  4J7F A;  2MPX C;  4QKU A;  1QCN A;  3E19 A;  2DK3 A;  2L3P A;  3A8G B;  1LNX A;  1RI0 A;  2AT1 B;  2W0Z A;  2CP5 A;  1AZE A;  3MP8 A;  2QTX A;  3OYI A;  1V29 B;  1KQS S;  1D09 B;  1YIJ T;  4LN2 A;  1T3L A;  2DA9 A;  4PJM A;  4A63 B;  4BI3 A;  3CCV T;  3A5Z B;  5CKE A;  4BE1 A;  1IO6 A;  4DBF A;  1VQ4 Q;  4F7U G;  3M9Q A;  3EG3 A;  4C5G A;  1K73 C;  3LH0 A;  4R55 A;  2CYZ B;  4JUV A;  3QXE B;  4NL3 A;  1PCX A;  3GLX A;  1OZ2 A;  3H8Z A;  1VQ9 T;  2JTM A;  1MGQ A;  4PJJ A;  1C1A A;  5CKH A;  3X28 B;  3CMA T;  1Z9Q A;  3I56 Q;  2VGM A;  2VC8 A;  5GAO m;  4HT9 A;  1GFC A;  3CEY A;  2RJD A;  4X9C A;  2CP0 A;  4E7L A;  1ZUK A;  2X4Y A;  1QP2 A;  1TG0 A;  1K8A C;  1B34 A;  3JCM X;  2DL3 A;  2A0F B;  3JCM V;  4IIO A;  4N0A A;  1YJN A;  5GAN 6;  2DXU A;  4KUI A;  3CBO A;  1D0Z A;  1P92 A;  1WZO A;  4KGX B;  1ZSG A;  1YCS B;  4LUD A;  1TS9 A;  1W1F A;  1RAA B;  3Q1J A;  2ZPF B;  3J7A F;  3OYL A;  4FYY B;  5GAN h;  1QP3 A;  2O2O A;  5EC7 A;  4AMC A;  2W10 A;  5J39 A;  4A54 A;  5GAN d;  1NEG A;  5L23 A;  4HCK A;  4HVU A;  3CQT A;  6AT1 B;  1H64 1;  2R58 A;  1OU9 A;  4AFQ C;  3JCM P;  3V7S A;  2HL3 A;  2YLC A;  1W70 A;  3DB3 A;  4LDV A;  1U06 A;  1TSF A;  5GAN 2;  2HEQ A;  1SSH A;  4UC4 A;  5GAO r;  4PLI A;  3GNF B;  3M58 A;  2DNU A;  4EMH A;  5D7U A;  3SD4 A;  4FIB A;  3OS2 A;  4M7A F;  3UPU A;  4AG1 C;  3QPH A;  3MP6 A;  2XDP A;  2Y4Y A;  4PJL A;  2EGC A;  3BFM A;  3CXC S;  4WF2 A;  1JJ2 A;  3VKI A;  5C0M A;  3IQL A;  1D3B A;  3JCM c;  3HRT A;  5CVI A;  1KHC A;  2RHY A;  4RTX A;  1M1K R;  1MV3 A;  2EAY A;  3V7R A;  3EH2 A;  1VQL A;  2V1R A;  4QVC A;  9ATC B;  1U1T A;  2CDT A;  4FYX B;  1HK9 A;  3CCU T;  3E1S A;  2JOY A;  1VIF A;  1A0N B;  1G3S A;  2PVO B;  2VAS A;  3CCL T;  1IGQ A;  2D1X A;  4B9X A;  4E6R A;  2YUN A;  1ACM B;  2GNC A;  1NJI C;  5LJ5 f;  3RMQ A;  3L2V A;  3L2Z A;  3CCS A;  2GTO A;  3LH5 A;  2WSC E;  4LDU A;  4QW2 A;  4DBH A;  2EJF A;  1MMA A;  3NFC A;  3PGG A;  3EGX B;  3MJX A;  2YUO A;  5GAM h;  4JRI A;  4IUT A;  3EHR A;  2IG0 A;  4RTT A;  4AFU C;  5GAM d;  2DRK A;  3QHS A;  3FC3 A;  3VS3 A;  4DA4 A;  4LXC A;  5A0D A;  1M9S A;  2L5Q A;  4MMK A;  4QQ6 A;  3CCM T;  4HCZ A;  2MWO A;  4XTZ A;  2DXC A;  3M54 A;  2NLU A;  2QGG A;  1M3C A;  1U5S A;  4PKC C;  3M0P A;  4ZN3 A;  3CBM A;  3I55 T;  4DQ2 A;  5LJ5 j;  2YT6 A;  1KD1 R;  1S1N A;  3G4S Q;  2LX7 A;  2QAZ A;  2AKL A;  2OTL Q;  1WPY A;  2V1Q A;  2CZ0 B;  2DER A;  3LW5 E;  4X1V A;  3VS5 A;  1WHG A;  1VQN A;  3H0F A;  2RM4 A;  1JJ2 P;  2J6K A;  2KSS A;  2PNI A;  3JCM W;  2CSI A;  2H3E B;  2HKN A;  3HFO A;  4ZNX A;  3JCM J;  3S3M A;  1YBY A;  3RNJ A;  5HKC A;  2X3W D;  1TU0 B;  3JB9 D;  4DBR A;  3HKS A;  4RTV A;  1PKS A;  4M75 E;  1PC0 A;  2K9G A;  3C12 A;  4A4F A;  1YI2 Q;  5I22 A;  4BUG A;  2A28 A;  2FZK B;  4ZGD B;  4R0K A;  1D1C A;  4PJO E;  3I5S A;  1NLP C;  3OS1 A;  2JN0 A;  3SDZ A;  2YRV A;  2E1H A;  3D7S B;  2EJ9 A;  4EMK A;  1M90 C;  2CRE A;  1VQ6 Q;  2LCL A;  5CKB A;  3M0Q A;  3X24 B;  3OW2 S;  3HRU A;  2LQW A;  3E2U A;  2KY9 A;  3OBY A;  4E2F B;  1WI7 A;  2GTJ A;  3I56 T;  5GMK e;  1RAG B;  3EGU A;  4JDS A;  5GJW B;  1NYG A;  3CCR Q;  1Q86 R;  1IGU A;  2DL8 A;  2EGA A;  4A4H A;  4J9C A;  3DLM A;  2BE7 D;  3QJ6 A;  1GBR A;  1X6B A;  1EZZ B;  4IUR A;  2OAW A;  1WDX A;  4M78 G;  1RLQ C;  5FWC A;  2O4X A;  3EG2 A;  1U8R A;  4M7A B;  1QW1 A;  3QWX X;  1BK2 A;  4A4G A;  1FXX A;  1RLP C;  4JLG A;  3CCQ Q;  3G71 Q;  2YUQ A;  4FW1 A;  4OMP A;  1VQ7 A;  4ZTF A;  2DXB A;  2RJF A;  4C0D B;  3WVD B;  2MK5 A;  4FW2 A;  4L5G A;  1QCO A;  4C92 F;  2DL5 A;  1K9M R;  4RTU A;  2QTV A;  4O6J A;  3M0T A;  1NM7 A;  2BZ8 A;  1BCM A;  1M1K U;  4Z02 A;  4C0D C;  2XI9 A;  2CUB A;  4LDW A;  1W2B S;  4FYV B;  3QDR B;  1XQH A;  3PFS A;  4M75 F;  4WCI A;  1RAB B;  4F7U E;  3VS0 A;  2QEX Q;  3A8O B;  1AZG B;  4IUP A;  5KYY A;  5HCK A;  4PJO F;  2EVR A;  1VQL T;  3M55 A;  4KUD K;  3TQ7 P;  2MOX A;  2JS0 A;  5A2Q E;  3OBW A;  3NMZ C;  3RKW A;  4C5I A;  1ZBX A;  1W4S A;  2K5F A;  2X51 A;  2K57 A;  2SEM A;  1YIT Q;  1WHM A;  1E6H A;  2LNV A;  3EG1 A;  2LDM A;  1FYN A;  5GAN f;  1VQ9 Q;  4OB1 B;  5KCO A;  3CCS T;  2QGF B;  3X26 B;  2D6F A;  2P0Q A;  3LGF A;  3PIO A;  1Y07 A;  3WVE B;  1H92 A;  4IUQ A;  4CC2 A;  5C6S A;  2BTT A;  1G3T A;  1BKB A;  3VV0 A;  3MP1 A;  2B86 A;  4NL2 A;  3OYK A;  2HCK A;  1KD1 U;  2EQU A;  5IAY A;  3P8H A;  2ZPG B;  3PVQ A;  5GAO l;  1RAI B;  4PK4 A;  2ZAE A;  1B07 A;  3QSU A;  1RAD B;  3J81 E;  3OYB A;  3OW2 A;  5GAN j;  1UG1 A;  1NJI R;  1ZSZ C;  1QWF A;  3G1J A;  1IRE B;  3ZEH A;  2VXF A;  5L8R E;  2LQK A;  2AZS A;  1X2K A;  4M7D D;  1FMW A;  4RTZ A;  4OVA A;  2DVE A;  1UFF A;  1G8X A;  3G4S T;  4BAC A;  3GBQ A;  5HY6 A;  2OTJ Q;  1S72 Q;  1O9S A;  4KRT A;  4N4G A;  2MCN A;  3VS6 A;  1Y0M A;  1QQJ A;  2MYS A;  2A08 A;  1UEC A;  3HPW A;  1VQP A;  1JBM A;  4M78 A;  4OB0 B;  3JCM g;  4M77 G;  2K4Y A;  1UGQ B;  5FU6 B;  4F7U F;  2CP6 A;  5CAI A;  2PUO B;  3PNW C;  2DET A;  1PD0 A;  2RNA A;  2F5T X;  3FEO A;  1NBE B;  1YI2 T;  2KRS A;  3SWN A;  1WIE A;  3EH1 A;  3QJY A;  5FU6 C;  3M4Y A;  3A8L B;  2HQX A;  5GMK m;  3CC2 A;  4CC3 A;  4OGC A;  2M16 A;  4P5N A;  3PTA A;  3CCU Q;  1VQK A;  1Q86 U;  4XK8 E;  3CCL Q;  2LCC A;  3OMG A;  2F2W A;  2J6O A;  3CME Q;  2X9H A;  1W2B A;  3GP8 A;  1SRL A;  5IHN A;  1K73 U;  5M9O A;  4PLL A;  1I0C A;  2HL5 C;  1GRI A;  4L6V 5;  1KD1 C;  2HBP A;  3CD6 A;  3SEM A;  1G2B A;  2WAC A;  3CCE Q;  2HQE A;  2DTI A;  1BIB A;  2JTF A;  4C92 B;  5LL6 S;  5GAM j;  2E4H A;  3CCR T;  1VQO Q;  2FRW A;  2P4R A;  4B9W A;  2LP5 A;  2O9S A;  4MZT A;  2XID A;  4JPB W;  5CQY A;  2E10 A;  1QVG S;  3UDC A;  3FJ5 A;  2JTE A;  3VS7 A;  1ZSZ A;  3QWY A;  2KMT A;  2JMA A;  3BY7 A;  3G7Z A;  2EQJ A;  4M75 B;  3O5Z A;  5GAO p;  3CCQ T;  3CC4 A;  3I55 Q;  5KCH A;  1ZBJ A;  2DAQ A;  2L3R A;  1MMN A;  5LJ3 g;  2DTO A;  4PJO B;  4IKF A;  3MCA B;  4RKU E;  1GCQ C;  3NPF A;  4M75 C;  2FZG B;  4ELZ C;  2LX9 A;  3JCM Q;  4DEY A;  1MND A;  3WXM B;  4PJO C;  2E65 A;  1CKB A;  1OPK A;  2XMF A;  2Y4X A;  4M7D A;  4CI0 C;  4M7A E;  2EYY A;  1K0X A;  4J9I A;  4AT1 B;  5GAN 8;  3FIF A;  1PNJ A;  4BDZ A;  4FYW B;  2QEX T;  2RQW A;  3M59 A;  1Q86 C;  2JW4 A;  4XU0 A;  5CO7 A;  1ARK A;  3LX7 A;  2KI7 A;  4DBQ A;  2RI5 A;  2CS7 A;  1HYO A;  2DPP B;  2EKH A;  2J06 A;  1XOV A;  2VUB A;  3JB9 J;  1YIT T;  5I21 A;  2F5K A;  3INZ A;  1LCK A;  5CIU A;  3FDR A;  3RKX A;  3MHX A;  4NS5 A;  4M77 A;  3KFV A;  1CKA A;  5CCA A;  2RQU A;  1UDL A;  5KYX B;  1N9S A;  3OMC A;  4EIK A;  2L0A A;  3UAT A;  3PMT A;  1JRI A;  2K3Y A;  3AT1 B;  1NJI U;  4XAX B;  1K9M C;  2GQV A;  2CT3 A;  1YJN Q;  4FU6 A;  4Z88 A;  1PKT A;  3HRS A;  3QYG B;  4RUG A;  2M51 A;  2MF2 A;  7AT1 B;  2L3S A;  1RUW A;  3QG1 A;  4HVW A;  4E7Z A;  4LD6 A;  1W6X A;  2IPO B;  3JCM e;  1TWB A;  3M57 A;  1X6G A;  1Y71 A;  4FCY A;  3RKY A;  4F7U B;  2ZCF B;  1UJ0 A;  5HK0 A;  2RJE A;  2FO0 A;  4PFZ A;  4BD3 A;  1Q7Y R;  2X3X D;  3O8V A;  2KGT A;  1GCQ A;  4RCB A;  3CC7 A;  4KT0 E;  3EFO B;  3RMS A;  4MDX A;  1R8O B;  2PQW A;  4C8Q E;  2DKG A;  3VU3 C;  2V8I A;  1G83 A;  4BB7 A;  3TRE A;  2OTJ T;  1S72 T;  1VOM A;  1UHC A;  2AKK A;  1ZA2 B;  1QVG A;  2EGE A;  5IXF A;  4X9D A;  2MMP A;  2LJ3 A;  2KRN A;  2KYM A;  4J9D A;  4JS5 A;  2P0P A;  1GL5 A;  2YSQ A;  2YRD A;  3H6Z A;  4DEX A;  4MZP A;  1M5Q 1;  4J7I A;  3SB2 A;  1WA7 A;  2K5L A;  1OUL A;  1VQL Q;  2K7A A;  1VQK T;  1NPP A;  1VQ8 A;  2X35 A;  2QDY B;  3KXT A;  3L2U A;  3OY9 A;  2DTH A;  2E64 A;  2LT4 A;  5CQX A;  1G3W A;  1RI9 A;  3R6N A;  3GF5 A;  3UF4 A;  4CC4 B;  4OMQ A;  1ZA1 B;  1K4U S;  2DBK A;  3CCS Q;  1ABO A;  2F2V A;  2K2M A;  2RJC A;  1R0B G;  3CME T;  1OPL A;  1NZ9 A;  1M90 U;  2YXY A;  2QQR A;  2FYK A;  2DO3 A;  3KUF A;  1KQS A;  3X20 B;  1IHW A;  2R57 A;  1WQ7 A;  5LJ3 e;  1YJ9 A;  2ZPI B;  1QCF A;  1XNI A;  2XDD A;  3REB B;  2RQR A;  2E70 A;  5DLO A;  3CCE T;  1JEG A;  5IHK A;  5GAN 4;  1OV3 A;  1BYM A;  4QQG A;  4XTX A;  1YN8 A;  1VQO T;  4RTW A;  2G3R A;  3MKD A;  2IIM A;  4EDU A;  5A0G A;  1TH7 A;  3FRN A;  1PG5 B;  4BE0 A;  2EIF A;  2HNI A;  2J6F A;  1WJR A;  1WHL A;  2RO0 A;  3RDV A;  1BI3 A;  3NGP A;  4R56 A;  4ANJ A;  2GFU A;  1M2V B;  1NPR A;  2EQI A;  3P8D A;  1OX8 A;  1SHF A;  3OYF A;  4MZM A;  5KYU B;  1YJW A;  4N4I A;  4J83 A;  1BU1 A;  1PWT A;  2LTO A;  3HHT B;  3C95 A;  3LLR A;  2G6F X;  4C8Q F;  3EG0 A;  1VQN Q;  1ZUU A;  2NUP B;  1VYT A;  1TTH B;  1LOJ A;  2JM8 A;  1OQK A;  2YLB A;  3M53 A;  2FRY A;  2F69 A;  2RQV A;  2KR3 A;  4C92 E;  1KSW A;  1KC8 R;  3I9Q A;  1QKW A;  5GMK h;  3C4S A;  2NUT B;  3MEA A;  1SSF A;  1JQQ A;  2EYX A;  3RIR A;  3JB9 G;  5IHI A;  5KE2 A;  5DM7 R;  3EGD B;  2QAS A;  4RG8 A;  2RK1 A;  2BIV A;  3E9F A;  3P8B B;  2C06 A;  1NLO C;  2M1H A;  2CP2 A;  2FPF A;  2JUF A;  4PNO A;  1B7T A;  4JJD A;  2L89 A;  1IRX A;  5FWB A;  3ME9 A;  2VYT A;  4JLI A;  1KQS P;  2E3I A;  1V1C A;  4X34 A;  2OI3 A;  1OOT A;  2BE9 B;  5D6W A;  2LQ8 A;  5FRN A;  1TOV A;  1Z9Z A;  5FLX E;  2CZ6 B;  3UA7 A;  1VUB A;  5GMK l;  4CC7 A;  3CXC A;  4E7J A;  4C5H A;  4DOW A;  2FHD A;  1H3Z A;  2GQI A;  2JZ2 A;  2HD0 A;  2KRO A;  1SPK A;  3ZL7 C;  3PIP A;  3VJP A;  2D8H A;  1HD3 A;  1YJN T;  4M7A D;  1JXO A;  3JB9 I;  3H9N A;  3OYA A;  1YCY A;  3JSC A;  3OYN A;  2CP3 A;  5CK9 A;  2DM1 A;  2O31 A;  2OJ2 A;  3EGX A;  1VQ7 Q;  2LC4 A;  1SHG A;  3FJP A;  1TUG B;  2FEI A;  2EQM A;  4XQ3 A;  4JZ3 A;  2PU9 B;  8ATC B;  4F16 A;  4LUE A;  3CC7 T;  4BI4 A;  4ORZ A;  2DRM A;  3LWH A;  5GAO q;  1OX9 A;  2KT1 A;  4M7A C;  2COY A;  1WXT A;  5AT1 B;  1DJ7 B;  1HJD A;  4IIM A;  4MDW A;  2C0T A;  5LJ5 g;  3OYG A;  4C0G A;  4OMF B;  1LVK A;  2PVG B;  4F04 B;  2PTK A;  2KBT A;  2WSE E;  8AT1 B;  1UUE A;  3THK A;  2DE0 X;  2F1L A;  5GJV B;  3C0C A;  1QVP A;  4CRI A;  2FG0 A;  2QQB A;  4AG2 C;  2JXB A;  2YRC A;  5KYN A;  1B3Q A;  4XTW A;  3RES A;  1OEB A;  4D6W A;  1VQ8 T;  1VQ5 A;  3MEV A;  2BKD N;  1M4Z A;  2QYZ A;  4PJN A;  1U1S A;  2VB6 A;  1YHQ A;  4LDY A;  3JCM b;  1QKX A;  3QDF A;  2J05 A;  2RF0 A;  2JMC A;  3L2R A;  3CXC P;  3PT9 A;  4VUB A;  3EHQ A;  3QUI A;  4FT4 A;  1ZUY A;  4J9F A;  3UT1 A;  2M9U A;  3J80 E;  5CKD A;  2LT1 A;  4BE2 A;  4QT7 A;  5GAN 7;  1YIJ A;  3V8K A;  1YJ9 T;  1ZX6 A;  1Q7Y C;  2P84 A;  2DEQ A;  3CCV A;  2DL7 A;  1SF9 A;  1UHF A;  5KYW B;  2CP7 A;  4C8Q B;  1WHK A;  5LJ3 f;  3LGL A;  3S3O A;  3T9N A;  1Y96 B;  2JS2 A;  1NE8 A;  5CR2 A;  4JRQ A;  1TUD A;  1K76 A;  3RBB B;  2CKK A;  2OX7 A;  2K3X A;  4C8Q C;  1KC8 U;  4ZGE B;  3CMA A;  4LNP A;  2ZGW A;  5HK3 A;  2ED1 A;  4F14 A;  4M7D G;  1YJW T;  2KK4 A;  3MEU A;  4LDX A;  2LZ6 B;  3VRY A;  3M0S A;  3JAM E;  4GLM A;  4J6Y A;  4M7A A;  4JJN K;  1VQM A;  5D6Y A;  2MI6 A;  2YHT A;  5D6X A;  1VQP Q;  4KGZ B;  1SG5 A;  1VQN T;  2HDA A;  2RHZ A;  2QDL A;  5A0L A;  5LJ3 j;  2D9T A;  1AWX A;  2DYB A;  2FVU A;  1AWJ A;  1I5O B;  2D8J A;  4RG2 A;  4RCC A;  2VXE A;  1N8R R;  2X4W A;  2EYQ A;  1Q82 C;  3H41 A;  1JB0 E;  2FZC B;  4ZGJ B;  2CSQ A;  2VVK A;  3VUB A;  2CGH A;  2RQT A;  2E6Z A;  1CSK A;  1M27 C;  3OS5 A;  3CC2 Q;  5GMK i;  2YWW A;  1VQK Q;  2D0Q B;  3U23 A;  2BZY A;  1T0J A;  2C0O A;  1E7O A;  3QO3 A;  2PUK B;  2YDL A;  1WXB A;  5EG2 A;  1GFD A;  1Q81 C;  4J9H A;  2KQW A;  1ZQ1 A;  1JO8 A;  2EYW A;  1Q95 G;  3TU4 K;  1G3Y A;  3BDL A;  2H3J A;  3ULR B;  1AEY A;  1RAH B;  1H8K A;  4JS4 A;  3CD6 Q;  2MIO A;  2QK0 A;  4HCB A;  1RAE B;  4C92 D;  2CZ7 B;  3SHW A;  2O01 E;  3HL8 A;  4Y91 A;  3DB4 A;  2ZZD A;  1H3H A;  4OMN A;  1KK7 A;  1I1J A;  3PVL A;  5J26 A;  3HFN A;  2RN8 A;  3UWN A;  3OYD A;  5LJ5 e;  3OW2 P;  3OS0 A;  1KC8 C;  3VYH B;  3DLL A;  2LNH B;  1I81 A;  3V8J A;  3AHU A;  4M75 D;  1K9M U;  4HXJ A;  1O75 A;  3M56 A;  1UEB A;  1QLY A;  4XTV A;  3G6E A;  2ROT A;  2LVM A;  3CC4 Q;  1B34 B;  2LMJ A;  1VQ7 T;  1OZ3 A;  3CBP A;  1K9A A;  4F17 A;  1M2O A;  4C92 C;  3SFM A;  1AWW A;  4PJO D;  2A36 A;  3URG A;  3VS2 A;  3MEW A;  1Y57 A;  3H0H A;  3EG9 A;  1EX4 A;  5GAO n;  4B6M A;  2QA4 A;  5GAN g;  5IT9 E;  2ED0 A;  1UGS B;  4C0Z A;  2VWF A;  2XU8 A;  3GPL A;  1M30 A;  1GXI E;  4BI8 B;  5GMK j;  1RAF B;  4MML A;  4OMM A;  3BE3 A;  3CPW S;  2DVJ A;  1WJQ A;  3CCJ A;  3CCM A;  1AT1 B;  2E3H A;  1GCP A;  1I5L A;  2ECZ A;  1VQ5 T;  3E9G A;  3OYY A;  1VYV A;  2KT8 A;  1HSQ A;  1IXD A;  5IXB A;  2JT4 A;  1D0Y A;  1N27 A;  2RI3 A;  3BDU A;  3JCM h;  2CH4 A;  4YTL A;  3OYH A;  4OP0 A;  1C0M A;  3L42 A;  1X69 A;  1YWP A;  5KE3 A;  1W2B P;  3JCM d;  1X6O A;  2A3L A;  4OB3 B;  3VYG A;  4QQD A;  2RI2 A;  2M0Y A;  3A8M B;  1D3B B;  4HKE A;  2A37 A;  4J6W A;  2XIC A;  3LYI A;  2V8K A;  1WHH A;  3A98 A;  1VIE A;  4PL6 A;  1RAC B;  4L59 A;  5CKF A;  2DF6 A;  3C94 A;  4HA8 A;  3NTI A;  4GLK A;  1WNL A;  4Y28 E;  1VA7 A;  4M78 E;  1YNZ A;  1NYF A;  4RTY A;  1YFN A;  2R5A A;  5GAN 3;  1WHJ A;  1OYX A;  4PFO A;  2KNB B;  3JB9 H;  2XK0 A;  1IHV A;  4XTY A;  5J3B A;  2DJZ A;  1VQ4 A;  2BUD A;  1PM3 A;  3FLG A;  1JU5 C;  4ESR A;  4C92 A;  5GAM g;  5IN1 A;  4GY5 A;  1BI2 A;  3N5B B;  4XU2 A;  1KG1 A;  2E5K A;  2XG8 D;  1FWZ A;  1N8R U;  2CUD A;  3S6W A;  3I56 A;  2DD5 A;  4Z89 A;  1VQM T;  1V76 A;  1KQ1 A;  3CC7 Q;  4IUV A;  3M5A A;  3JB9 F;  2XD0 A;  2RH2 A;  3QYH B;  5FW9 A;  2EJG A;  2Z0W A;  3A8H B;  2DLP A;  4M75 A;  1EIF A;  3OYJ A;  3MO8 A;  1VQP T;  4Z8A A;  2NYS A;  2RHU A;  2O88 A;  4EPC A;  4E7H A;  1MMG A;  1UTI A;  4PJO A;  3DKM A;  5LJ3 h;  5LJ3 d;  3VS4 A;  1QWE A;  5FRO A;  1PD1 A;  2DFU A;  1U3O A;  4JZ4 A;  4AFS C;  4PFP A;  2HMA A;  1VQ8 Q;  2AIR B;  1SRM A;  1X2Q A;  4FT2 A;  4N4H A;  1UB4 A;  3CC2 T;  1R0C B;  3LWI A;  1UGV A;  2CT4 A;  3GNG A;  3X25 B;  1WQW A;  2DD4 A;  2KXD A;  3A1P A;  4NOY A;  2PVD B;  1D1B A;  3CPW A;  3OB9 A;  1MHN A;  1M3B A;  2L3Q A;  2L8D A;  1K1Z A;  4QVD A;  1YJ9 Q;  4KUL A;  1Q82 R;  2HAX A;  2QQS A;  2FL7 A;  1KQ2 A;  4A4K A;  3CD6 T;  1AVZ C;  4M78 F;  2JM9 A;  4EMK B;  2HSP A;  2DJQ A;  5GAN e;  5DY9 A;  5FRM A;  1M1G A;  4KH0 B;  2KVQ G;  2JJ9 A;  5KYX A;  4OGE A;  2V26 A;  2RPN A;  4M7D E;  2VKN A;  2FPE A;  3G6E T;  4EMK C;  4WTO B;  1PRL C;  2RB6 A;  4ZTJ A;  1N8R C;  1Q81 R;  2DBM A;  2X4X A;  1UE9 A;  2COW A;  3L1A A;  2QI2 A;  2GBQ A;  2GCX A;  1R77 A;  2HZY A;  3CC4 T;  3QBY A;  3R6O A;  1YJW Q;  1KJW A;  1N5Z A;  2QA4 T; 
#chains in the Genus database with same CATH homology
 3GLX A;  3H8Z A;  1OZ2 A;  4OMF B;  2F5T X;  3FEO A;  5DLQ E;  1VQ9 T;  2JTM A;  2PVG B;  1YI2 T;  3SWN A;  4BDY A;  2V8J A;  3QJY A;  2O4X B;  1MGQ A;  2WSE E;  5FU6 C;  3M4Y A;  3A8L B;  5CKH A;  3X28 B;  4C0F A;  3CMA T;  2HQX A;  4F7U A;  5GMK m;  3CC2 A;  2DZ9 A;  4OGC A;  2M16 A;  2VGM A;  3OSS C;  2GF7 A;  4P5N A;  3PTA A;  1XTD A;  2VC8 A;  4M77 E;  5GAO m;  1Q86 U;  1VQK A;  4XK8 E;  3CEY A;  4HT9 A;  1QVP A;  2RJD A;  2QQB A;  4CRI A;  4X9C A;  3V7C A;  4E7L A;  2X4Y A;  1QP2 A;  2EWN A;  2LCC A;  4XTW A;  3CCJ T;  3RES A;  2RD1 A;  4C5E A;  4D6W A;  1VQ8 T;  3OMG A;  1VQ5 A;  3HSB A;  3MEV A;  1ZHI A;  2BKD N;  1K8A C;  1W2B A;  1B34 A;  1M4Z A;  3JCM X;  3GIB A;  3GP8 A;  1U1S A;  1K73 U;  5M9O A;  4PLL A;  1YHQ A;  3QZ9 B;  3RUX A;  3JCM V;  4LDY A;  2EKO A;  3JCM b;  4N0A A;  1YJN A;  5GAN 6;  2DXU A;  4KUI A;  4L6V 5;  1KD1 C;  3CBO A;  3QZ5 B;  3RER A;  2HBP A;  4ME7 A;  3CD6 A;  1P92 A;  3L2R A;  2K5I A;  3PT9 A;  4VUB A;  3QUI A;  1PSE A;  4FT4 A;  2WAC A;  3Q1J A;  2HQE A;  2DTI A;  3G4S A;  1BIB A;  3QKJ A;  2JTF A;  3UT1 A;  5LL6 S;  2M9U A;  2ZPF B;  4C92 B;  5GAM j;  3J80 E;  3CCR T;  3J7A F;  3OYL A;  5I2M A;  5GAN h;  5CKD A;  1QP3 A;  2OTL A;  4B9W A;  2LT1 A;  4BE2 A;  5J39 A;  4A54 A;  5GAN 7;  1YIJ A;  3V8K A;  2KAF A;  5GAN d;  1YJ9 T;  1Q7Y C;  1BI0 A;  4MZT A;  2XID A;  5CQY A;  2E10 A;  1QVG S;  2DEQ A;  3CCV A;  3UDC A;  2IVW A;  1H64 1;  2R58 A;  5GAM e;  3JCM P;  3V7S A;  4C8Q B;  2YLC A;  5LJ3 f;  2KMT A;  3LGL A;  3S3O A;  3T9N A;  3DB3 A;  3BY7 A;  4LDV A;  3G7Z A;  2EQJ A;  1Y96 B;  2LRQ A;  4M75 B;  5GAN 2;  5GAO p;  3CCQ T;  3CC4 A;  4UC4 A;  5GAO r;  5KCH A;  4PLI A;  1NE8 A;  3GNF B;  3M58 A;  4EMH A;  3SD4 A;  2DAQ A;  4FIB A;  3OS2 A;  2L3R A;  5CR2 A;  4JRQ A;  4M7A F;  5LJ3 g;  2DTO A;  3UPU A;  4ZN1 A;  1YI2 A;  4M7A G;  2CKK A;  3QPH A;  4PJO B;  3MP6 A;  2XDP A;  2DIQ A;  2Y4Y A;  2K3X A;  4C8Q C;  1N9R A;  3BFM A;  4FM4 B;  3FB9 A;  4ZGE B;  3MCA B;  1KC8 U;  3CMA A;  4IKF A;  4M7D F;  3CXC S;  4RKU E;  4WF2 A;  2ZGW A;  1I8F A;  3VKI A;  4M75 C;  5HK3 A;  5KH6 A;  1VQ4 T;  5AYF A;  5C0M A;  1JJ2 A;  4M7D G;  1Q7Y U;  3ZBD A;  4A4E A;  2RA2 A;  1YJW T;  2KK4 A;  4ELZ C;  2LX9 A;  3BW1 A;  3MEU A;  3JCM Q;  1D3B A;  2CZ1 B;  3JCM c;  4LDX A;  3HRT A;  3JAM E;  5CVI A;  1KHC A;  1IZ6 A;  1RL2 A;  3NTK A;  4J6Y A;  2RHY A;  4M7A A;  3WXM B;  4BY6 B;  4PJO C;  2E65 A;  4JJN K;  1VQM A;  5D6Y A;  2MI6 A;  2YHT A;  5D6X A;  2EAY A;  3V7R A;  2Y4X A;  2RK2 A;  1VQL A;  1QVF S;  1VQ6 A;  4QVC A;  4M7D A;  4CI0 C;  1U1T A;  3OYE A;  4M7A E;  1HK9 A;  3CCU T;  1VQN T;  3E1S A;  3EFR A;  2RHZ A;  5GAN 8;  4E7I A;  2JOY A;  1VIF A;  2FB7 A;  1G3S A;  3FIF A;  5A0L A;  5FU7 B;  5LJ3 j;  4BDZ A;  2D9T A;  2PVO B;  3JCM f;  3CCL T;  2FVU A;  2QEX T;  4B9X A;  4BY6 C;  3M59 A;  4RG2 A;  4RCC A;  2VXE A;  1Q86 C;  4JRP A;  4XU0 A;  4JRK A;  2X4W A;  4V2S A;  5CO7 A;  2X4J A;  2EYQ A;  4M77 F;  1NJI C;  5LJ5 f;  3RMQ A;  2MAM A;  3LX7 A;  3L2V A;  3CCR A;  1JB0 E;  2AHJ B;  1Q82 C;  4ZGJ B;  3L2Z A;  3CCS A;  2RI5 A;  2CS7 A;  2DPP B;  5FU7 C;  3VUB A;  2RHI A;  1BI1 A;  2CGH A;  2WSC E;  4LDU A;  1XOV A;  2VUB A;  4QW2 A;  2EJF A;  3NFC A;  3JB9 J;  2E6Z A;  1YIT T;  4HCC A;  3OS5 A;  5I21 A;  5GMK i;  2F5K A;  3INZ A;  3PGG A;  5CIU A;  2K2V A;  3FDR A;  4M78 D;  3JRZ A;  3MHX A;  2D0Q B;  4NS5 A;  3RKX A;  4M77 A;  4EMG A;  5GAM h;  4J5Y A;  4JRI A;  4IUT A;  5CCA A;  2IG0 A;  3QO3 A;  3CCQ A;  2PUK B;  3G71 A;  4FSX A;  5GAM d;  5EG2 A;  3QHS A;  1N9S A;  3FC3 A;  2ZPH B;  1WJS A;  4J6X A;  4DA4 A;  3OMC A;  1Q81 C;  5A0D A;  1M9S A;  2GFA A;  2L5Q A;  3PMT A;  1JRI A;  2KQW A;  1ZQ1 A;  2K3Y A;  4M78 B;  3OA6 A;  4MMK A;  4XAX B;  1NJI U;  4QQ6 A;  3CCM T;  4HCZ A;  1Q82 U;  2GQV A;  1K9M C;  3OQ5 A;  2MWO A;  4FU6 A;  3OSV A;  1G3Y A;  2DXC A;  2H3J A;  3BDL A;  3M54 A;  1AHJ B;  2NLU A;  3HRS A;  3QYG B;  5I2S A;  4PKC C;  4JS4 A;  2DZC A;  4ZN3 A;  3CBM A;  3TCJ A;  2MF2 A;  3I55 T;  3M4G A;  4HCB A;  4C92 D;  2CZ7 B;  2DIG A;  4DQ2 A;  5LJ5 j;  3QG1 A;  2O01 E;  3OYM A;  1UGR B;  1OI1 A;  4XU1 A;  4LD6 A;  3HL8 A;  4M78 C;  4Y91 A;  3DB4 A;  4C8Q G;  3JCM e;  2ZZD A;  3M57 A;  1WPY A;  1Y71 A;  3RKY A;  3SWN B;  2CZ0 B;  2XDB A;  3PMI A;  5J26 A;  1M1F A;  3LW5 E;  4ELY C;  3HFN A;  4F7U B;  2ZCF B;  3KBG A;  5HK0 A;  2ZPE B;  3UWN A;  2WSF E;  2RJE A;  2QQ9 A;  2RM4 A;  1VQN A;  1Q81 U;  2KSS A;  3OYD A;  5LJ5 e;  4RMO A;  3OS0 A;  3JCM W;  1KC8 C;  3VYH B;  4C8Q D;  3DLL A;  4BD3 A;  1I81 A;  3O8V A;  3V8J A;  3AHU A;  2QEX A;  3NTH A;  4M75 D;  1K9M U;  3HFO A;  1O75 A;  3M56 A;  3JCM J;  1UEB A;  4XTV A;  2A7Y A;  4RCB A;  3G6E A;  3CC7 A;  2OAU A;  1HXD A;  2XHC A;  3SWN C;  2LVM A;  1YBY A;  4KT0 E;  1B34 B;  1N6A A;  3RMS A;  5HKC A;  1VQ7 T;  4MDX A;  1OZ3 A;  3CBP A;  1R8O B;  2PQW A;  4C8Q E;  2DKG A;  4C92 C;  3VU3 C;  2R5M A;  3JB9 D;  2V8I A;  4BB7 A;  3SFM A;  4LD9 K;  3HKS A;  3TRE A;  4PJO D;  2OTJ T;  1S72 T;  4M75 E;  4A4F A;  3C12 A;  3URG A;  3MEW A;  1FX7 A;  4BUG A;  1Y7X A;  4ATO A;  3MET A;  1KHI A;  1YIT A;  5GAO n;  4ZGD B;  1QVG A;  2QA4 A;  4II1 A;  4PJO E;  4X9D A;  5GAN g;  1VQ9 A;  2MMP A;  3OS1 A;  2JN0 A;  5IT9 E;  3SDZ A;  1UGS B;  2P0P A;  4C0Z A;  2YRV A;  4JS5 A;  2XU8 A;  3GPL A;  2E1H A;  2EJ9 A;  1GXI E;  3H6Z A;  4MZP A;  4BI8 B;  4MML A;  1BIA A;  4EMK A;  1M5Q 1;  5GMK j;  4J7I A;  1M90 C;  3SB2 A;  2K5L A;  3F70 A;  2RHX A;  2LCL A;  2JVV A;  1WJQ A;  5CKB A;  3CPW S;  3X24 B;  3CCJ A;  3HRU A;  3CCM A;  3OW2 S;  1VQK T;  1NPP A;  1VQ8 A;  2X35 A;  1X75 C;  2QDY B;  3ASK A;  3KXT A;  2E41 A;  2KY9 A;  3OBY A;  1I5L A;  3L2W A;  3QII A;  3I56 T;  3L2U A;  3OY9 A;  5GMK e;  1VQ5 T;  2DTH A;  2E64 A;  2LT4 A;  3E9G A;  3OYY A;  5CQX A;  1G3W A;  4JDS A;  4A53 A;  3GF5 A;  4DOV A;  1WGS A;  2EFI A;  1N27 A;  4A4H A;  2RI3 A;  2QXF A;  3BDU A;  3JCM h;  4YTL A;  3OYH A;  4XU3 A;  2RJC A;  3DLM A;  3L42 A;  4OP0 A;  3CME T;  1QVF A;  3QJ6 A;  1X01 A;  1NZ9 A;  5KE3 A;  4FL6 A;  3JCM d;  4IUR A;  3HP9 A;  1X6O A;  2A3L A;  4OB3 B;  1M90 U;  2QQR A;  4QVZ A;  2FYK A;  3VYG A;  2DO3 A;  3KUF A;  4QQD A;  2RI2 A;  4M78 G;  3X20 B;  5LJ5 h;  2R57 A;  1WQ7 A;  3A8M B;  4HKE A;  1D3B B;  1M1K C;  5LJ3 e;  4J6W A;  2XIC A;  3VUZ A;  1YJ9 A;  2ZPI B;  2O4X A;  1XNI A;  3LYI A;  2V8K A;  4XTZ A;  1QW1 A;  4M7A B;  5LJ5 d;  2XDD A;  3OYC A;  4A4G A;  1U8R A;  2OTL T;  1FXX A;  4JLG A;  2E70 A;  2JNG A;  1VIE A;  3S3N A;  2KDS A;  1VQ7 A;  3EAE A;  4PL6 A;  5DLO A;  4ZTF A;  3CCE T;  4M7D B;  2DXB A;  4L59 A;  5CKF A;  4OB2 B;  3ZFJ A;  5GAN 4;  2OTJ A;  1S72 A;  4QQG A;  1BYM A;  3C94 A;  4XTX A;  3V8L A;  1VQO T;  2RJF A;  2E6N A;  4C0D B;  4HA8 A;  2G3R A;  3NTI A;  4EDU A;  2EQK A;  4GLK A;  1WNL A;  5A0G A;  1TH7 A;  3WVD B;  1LJO A;  3FRN A;  4L5G A;  4Y28 E;  4C92 F;  2EIF A;  4M78 E;  2HNI A;  4BE0 A;  1WJR A;  2RO0 A;  4KBM B;  5GAN 3;  2R5A A;  4O6J A;  4C92 G;  1BI3 A;  1OYX A;  2E5Q A;  4R56 A;  3JB9 H;  4M7D C;  2XK0 A;  2GFU A;  2XKO C;  3TU4 K;  4XTY A;  5J3B A;  1NPR A;  4M77 D;  5GAM f;  1M1K U;  4Z02 A;  2DJZ A;  3P8D A;  2BUD A;  2E12 A;  4C0D C;  2XI9 A;  1VQ4 A;  3FLG A;  3OYF A;  4MZM A;  1YJW A;  4N4I A;  3TEE A;  3ER0 A;  4J83 A;  2DXT A;  4LDW A;  1W2B S;  1G5V A;  4J8O A;  2LTO A;  2ZPB B;  3HHT B;  3QDR B;  4C92 A;  3C95 A;  3LLR A;  4C8Q F;  5GAM g;  5IN1 A;  1XQH A;  3PFS A;  4GY5 A;  1BI2 A;  1LOJ A;  2YLB A;  3N5B B;  4M75 F;  3M53 A;  4M77 B;  4XU2 A;  1KG1 A;  2F69 A;  3CPF A;  4F7U E;  1I4K 1;  2I2L A;  4M75 G;  2VGN A;  1M8V A;  2XG8 D;  4C92 E;  1FWZ A;  3A8O B;  1N8R U;  3S6W A;  3I56 A;  2DD5 A;  1VQM T;  1KQ1 A;  4IUP A;  4IUV A;  3CCU A;  3M5A A;  5GMK h;  3JB9 F;  3C4S A;  3L2Q A;  3MEA A;  3EFS A;  4PJO F;  1SSF A;  3RIR A;  2XD0 A;  1VQL T;  4OF1 A;  3M55 A;  2RH2 A;  3JB9 G;  4Q5W A;  4TVR A;  4KUD K;  3QYH B;  1VQ6 T;  4PJO G;  3CCL A;  2EJG A;  4C8Q A;  5KE2 A;  3A8H B;  5A2Q E;  5DM7 R;  2VV5 A;  3OBW A;  4M77 C;  3RKW A;  2MWP A;  4M75 A;  1Y96 A;  3CME A;  4C5I A;  1EIF A;  1ZBX A;  1W4S A;  2K5F A;  2Y90 A;  2K57 A;  4RG8 A;  3OYJ A;  3MO8 A;  1VQP T;  2RK1 A;  4O5V A;  2BIV A;  2RHU A;  2LNV A;  3E9F A;  2P4T A;  3P8B B;  4EPC A;  3GOX A;  4E7H A;  3S3M A;  2P0K A;  2LDM A;  2C06 A;  5GAN f;  2M1H A;  4PJO A;  3DKM A;  4OB1 B;  4XTU A;  5LJ3 h;  2JUF A;  5KCO A;  3CCS T;  4PNO A;  3X26 B;  2D6F A;  5LJ3 d;  2P0Q A;  3CCE A;  2B8A A;  3LGF A;  2L89 A;  5GAN 5;  1Y07 A;  3WVE B;  5FRO A;  3PIO A;  1K8A U;  4IUQ A;  5C6S A;  1PSF A;  3ME9 A;  1VQO A;  1G3T A;  2VYT A;  4N0A C;  4JLI A;  1BKB A;  3VV0 A;  4IUU A;  4FT2 A;  4N4H A;  3MP1 A;  4X34 A;  4NL2 A;  3OYK A;  1UB4 A;  3G71 T;  1KD1 U;  3CC2 T;  1JJ2 S;  5D6W A;  2LQ8 A;  3LWI A;  5FRN A;  4HT8 A;  2EQU A;  4E47 A;  3GNG A;  5FLX E;  5IAY A;  2CZ6 B;  3P8H A;  1VUB A;  1WQW A;  2DD4 A;  2ZPG B;  3X25 B;  5GMK l;  3CXC A;  4E7J A;  4NOY A;  4C5H A;  4DOW A;  5GAO l;  2FHD A;  1UGP B;  2PVD B;  1H3Z A;  3I55 A;  2JZ2 A;  3QSU A;  2HD0 A;  4E7K A;  2M0O A;  3J81 E;  3OYB A;  3CPW A;  3OB9 A;  1MHN A;  3OW2 A;  3PIP A;  3VJP A;  2QQA A;  5GAN j;  1YHQ T;  1YJN T;  4M7A D;  4J7F A;  2L8D A;  4QVD A;  3JB9 I;  3OYA A;  4KUL A;  2HAX A;  1YCY A;  3JSC A;  2QQS A;  1IRE B;  3OYN A;  2FL7 A;  3ZEH A;  5CK9 A;  4A4K A;  1KQ2 A;  3CD6 T;  3E19 A;  2VXF A;  2DK3 A;  2LQK A;  4M78 F;  5L8R E;  4EMK B;  4M7D D;  3A8G B;  1LNX A;  4OVA A;  2LC4 A;  1RI0 A;  3FJP A;  2DVE A;  3G4S T;  4BAC A;  5HY6 A;  5GAN e;  3MP8 A;  2QTX A;  3OYI A;  1V29 B;  1O9S A;  5DY9 A;  2EQM A;  1M1G A;  4XQ3 A;  4N4G A;  2KVQ G;  1KQS S;  5FRM A;  4OGE A;  2PU9 B;  4M7D E;  1YIJ T;  3HPW A;  1VQP A;  3G6E T;  1JBM A;  3CC7 T;  4BI4 A;  4EMK C;  4M78 A;  2RB6 A;  4BI3 A;  3CCV T;  3A5Z B;  4OB0 B;  5CKE A;  3JCM g;  3LWH A;  4BE1 A;  5GAO q;  2X4X A;  4ZTJ A;  3L1A A;  4M77 G;  1N8R C;  2K4Y A;  1UGQ B;  4M7A C;  5FU6 B;  4F7U F;  2QI2 A;  2GCX A;  5CAI A;  1DJ7 B;  3M9Q A;  3QBY A;  3R6O A;  4F7U G;  3CC4 T;  4C5G A;  1K73 C;  1KQS A;  3LH0 A;  4R55 A;  2CYZ B;  4JUV A;  4MDW A;  5LJ5 g;  2PUO B;  3OYG A;  3PNW C;  3QXE B;  4NL3 A;  2QA4 T;  4C0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...