4X9CA

1.4a crystal structure of hfq from methanococcus jannaschii
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
b'PNFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDYIEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ1435
publication title Characterization of RNA-binding properties of the archaeal Hfq-like protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
total genus 10
structure length 57
sequence length 57
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4x9cA00
4M77B 4M7DG 5GANh 3JCMJ 3JB9H 3HFNA 5GANd 5LJ3f 2DTIA 4XTXA 4C92C 3V7CA 4M7AG 5GAMj 4EMKB 3EFRA 3PGGA 1LNXA 4JUVA 5GANg 4QVDA 1D3BB 1LOJA 4M75B 4F7UE 3V8KA 2DXUA 3JCMV 5GAOr 5GAMh 4M78F 5LJ5e 4XTWA 5GAMd 2HNIA 3BFMA 3BDUA 5LJ3d 2VC8A 4M7DC 3GIBA 4F7UF 4M78D 4Y91A 3RUXA 3L2ZA 4C8QB 3RKYA 4EMKA 5GAMg 4M7AC 4PJOE 2DTOA 3JCMh 3JCMQ 4M75A 3FIFA 2E65A 2DZCA 4C8QE 5GMKh 4N0AA 4PNOA 3JCMW 4PJOF 5GAN2 5GAN4 3JCMg 4XU3A 3JB9F 4F7UB 5I21A 2FYKA 5GAN5 2EJGA 3QHSA 4C8QA 4WF2A 2JN0A 3V8LA 3EFSA 3INZA 3HSBA 5DY9A 4M75G 2RA2A 5LJ5f 3JCMb 3V7SA 4RCCA 3SWNB 3VU3C 5GAN6 4PJOB 3QO3A 4MMLA 4J6YA 4M78E 4EMGA 4OP0A 5LJ3j 2EJ9A 4F7UA 5LJ5j 5GAN3 1WPYA 3JCMP 4C92F 4C8QG 4XTYA 5GMKl 1KQ1A 1Y96B 1LJOA 4M77A 5LJ3h 4NL2A 4EMKC 1YCYA 4A53A 4C92D 2E64A 5LJ5h 5LJ5d 2DJZA 4M75C 3SWNA 4NL3A 4PJOA 2YLCA 4XQ3A 3RIRA 3L1AA 5GAN8 4N0AC 5LJ3g 1B34B 2VXFA 3BW1A 1D3BA 3JB9I 4F7UG 2DZ9A 4HT9A 4X9CA 5GMKm 4XU0A 4M78B 4M7DD 1Y96A 4C8QC 4M7AF 5GANe 4M77G 1HXDA 2E1HA 4NOYA 5GAN7 2YHTA 1BIAA 2EJFA 4XU1A 4M7AD 1N9RA 3JB9J 4PJOG 1WNLA 2EAYA 1B34A 3HFOA 4JLIA 3JCMc 3QUIA 2DEQA 4JRKA 1JBMA 4M78A 4J5YA 4C92E 2RB6A 1WQ7A 2E10A 4M77C 1H641 5GAOl 3SWNC 4QVCA 4PJOC 3JCMe 1I4K1 5GAOq 1WQWA 2E41A 4X9DA 4M7DE 5GMKe 2DXTA 4J6WA 4XU2A 2YLBA 3V8JA 1MGQA 4M77D 4M78G 1BIBA 4DQ2A 5GANf 4M7AE 1KQ2A 5LJ5g 4M7DF 2Y90A 2DKGA 5GAOm 3JCMX 1I5LA 4V2SA 4C92B 1U1TA 1M5Q1 4HT8A 3M4GA 2QTXA 4HA8A 4M75D 5GAOn 5GAMf 4XTUA 5CAIA 4A54A 3FB9A 1TH7A 4M78C 4C8QF 3JB9G 3BY7A 4M7DB 5GMKi 4C92A 4C8QD 3JCMf 1M8VA 5GAMe 4M7AB 1JRIA 3FJPA 5LJ3e 4MMKA 5GAOp 3RERA 3RESA 1I81A 2I2LA 4M77E 1X01A 4J6XA 1N9SA 2DTHA 4JRIA 5GMKj 4M7DA 3QSUA 4M77F 3RKWA 3JCMd 3SB2A 2VXEA 4M75E 3V7RA 4XTVA 4RCBA 4C92G 4XTZA 4M7AA 3RKXA 2CGHA 4EMHA 1U1SA 5GANj 1I8FA 2RD1A 4PJOD 2K57A 4M75F 2ZGWA 3AHUA 3JB9D 2DVEA 2EWNA 2RM4A 2FB7A 1HK9A
chains in the Genus database with same CATH superfamily
4M7DG 2CREA 2DF6A 1YWOA 3JB9H 4E6RA 3EH2A 1BB9A 3GNGA 3JCMV 1C1AA 1S72Q 1TSFA 3OS5A 2X4JA 5LJ3d 2P4TA 4ELYC 3CPWS 1M90C 1WJRA 1R0BG 3QPHA 4OMQA 5I2MA 2LZ6B 5GAN5 3EGDA 2OTJT 3QHSA 1KIKA 4BI3A 3EGXB 4JS5A 2HBPA 1X6BA 3E2UA 5DY9A 2X35A 3V7SA 3TQ7P 2HKQB 3SWNB 5HK0A 4J83A 2XDDA 4MMLA 2W0ZA 5CO7A 4IUUA 2ED1A 2R58A 2ZPBB 1YIJT 5LJ5h 1K73R 3CD6Q 1QWFA 4J7IA 4C92D 1HJDA 3PVQA 3PIPA 1X6OA 3BW1A 5DM7R 3OA6A 1HSQA 2JM9A 2VB6A 4J9EA 1N9RA 1B34A 3JCMc 3G71A 4BE1A 1FMKA 1UEBA 1PD1A 5IHKA 3VS3A 4X1VA 2KY9A 3PE0A 5KYWA 1E6GA 1QKXA 4EIKA 1C0MA 2BE7D 3OMGA 5GJWB 3JCMX 3HRSA 1PKTA 3QYHB 1O9SA 2OAWA 4FYWB 1WDXA 5FROA 5GMKi 3C12A 2P0KA 5IHIA 4FIBA 3CCJT 3FJPA 3URGA 1SSHA 3C95A 4D8DA 5KYNA 2DTHA 4M7DA 3EG2A 1QVPA 1VQMQ 3G4SA 4B9WA 4XTVA 2RI3A 2DPPB 1U5SA 1RLQC 2ROLA 1K1ZA 1QP3A 1NE8A 4M75F 1W1FA 4CC3A 1VQNQ 3VS0A 2XDBA 1OV3A 5LJ3f 1X43A 4C92C 1ZA1B 3EHQA 4M75B 1Q86R 1E7OA 2EGAA 2MI6A 1MMAA 2HMAA 1Y57A 3G6EQ 4XTWA 2HNIA 2KT1A 1TUCA 4EMKA 4FT2A 1HD3A 2DZCA 1VQ9Q 4ELZC 4IUTA 2NUTB 1OZ3A 2K7AA 2NUPB 3PIOA 4P5NA 4ZGJB 1UECA 2O9VA 4RCCA 2LDMA 5IAYA 4Y92A 5ECAA 4A4FA 2ESWA 4AFSC 4XTYA 4CI0C 1GRIA 4AG2C 1VQ5T 1FYNA 1IRXA 2LNVA 3CPWP 1YJ9T 1M8MA 1D3BA 2RJCA 1M90U 2YUQA 2EGEA 5J39A 1Q86U 1Z9ZA 1RAFB 4XU1A 4C0DB 4IIMA 1GXIE 1PCXA 3EG0A 4RTUA 3E1SA 1YI2A 3L2WA 3SHWA 1W2BP 4MZMA 1IGQA 2ENMA 2RQWA 3CCQT 1NG2A 4M7DE 1QQJA 4PJLA 2DXTA 1D0XA 1WXBA 3X26B 1K9MR 1ZSZB 3TSWA 1VQLQ 4RTWA 4IURA 2V1RA 4GY5A 3MP6A 3CC2T 1M8VA 1M1GA 3CCUT 2A0FB 2DX1A 4OB0B 4RTVA 1YJNT 5FRNA 4B6MA 2A37A 3CC4T 1VQKT 1OX9A 1JJ2P 2HCKA 1KQSA 4C92G 1ABQA 3MHXA 3RKXA 4C5GA 1N27A 1AOJA 2OTJA 3CC7Q 1UGSB 5GANd 2GTOA 2C0OA 2K4YA 2CZ0B 2RHUA 3M59A 4JUVA 2XI9A 2HZYA 3V8KA 3TSZA 1S72T 1RABB 2IVWA 1YIJA 1K9MU 4L6V5 3BDUA 1VQ4A 1VQOQ 3EGDB 3CCEA 3QYGB 2KEAA 2VWFA 1QLYA 2FZGB 4N4HA 1T0HA 5CKHA 1G3YA 2E65A 4VUBA 1KD1R 1SPKA 2DL4A 3EAEA 1OU8A 4PLLA 3EFSA 2QDYB 2XIDA 2MK5A 1K0SA 1LCKA 1A0NB 5FU7B 2QASA 3QZ5B 3M57A 2ZCFB 3QWXX 5GMKl 3DLMA 3J7AF 2FZKB 2RNAA 3RIRA 5GAN8 1B34B 1T3LA 4XU0A 2ZPEB 3MKDA 5DLOA 1OPLA 1ZSGA 1HXDA 2E1HA 1BIAA 1IREB 5KYWB 1UJYA 4RG2A 2KQWA 1NJIC 1D1BA 4ZNXA 2DETA 3CCJA 3CCMQ 1WQ7A 3IQLA 4IUPA 1KD1U 1ZLMA 4HVWA 1UHFA 4QVCA 3OYHA 2L89A 1SG5A 1ZUUA 2RI5A 2CDTA 2QAZA 2ED0A 1AHJB 4J6WA 1YHQQ 1MGQA 4DQ2A 4OMLA 1M1KR 4M7DF 3QWYA 3L42A 4RG8A 5CAIA 2E6ZA 1UGQB 3NTHA 2GF7A 4C8QF 4BDYA 2LQNA 4M7DB 2YRVA 1NYGA 2CYZB 2P4RA 4AG1C 4C92A 5GAMe 2QTVA 4MMKA 2DM1A 2CT3A 1C6VX 1N9SA 3O5ZA 2B8AA 2AZSA 1I0CA 2QA4Q 1GBRA 1X6GA 4DEYA 1I8FA 2QEXQ 1NBEB 4LUEA 4PFOA 3FC3A 1V76A 2K5LA 3MEWA 4EMKB 1M3AA 1LOJA 4HCZA 1M1KU 3G6ET 4C0DC 1GL5A 4B9XA 2XMFA 2EFIA 2LCSA 1BCMA 1VQ5A 4FW1A 4JJDA 1BI1A 1N5ZA 1LVKA 1FXXA 2CSIA 2X4XA 5A0GA 5I11A 2FVUA 4EPCA 2LJ0A 4BACA 3HTRA 1F1BB 3OYDA 1MNEA 1D1AA 3X24B 4EMGA 1G3WA 3A8LB 4OGCA 3OYIA 3CCRQ 1GFCA 2V26A 2X51A 3OYGA 1K0XA 4Q5WA 3CCQA 2NYSA 3P8HA 4XQ3A 1W6XA 3H0IA 3UDCA 2VXFA 7AT1B 1PD0A 2A36A 3I35A 1UUEA 1YITQ 4RKUE 1VQ7T 2A7YA 2MF2A 1SHGA 1G83A 3CC2A 4C92E 2RK2A 3CCUA 2CZ6B 4ZGEB 1YJNA 3CC4A 2OTLA 1VQKA 4XU2A 1X69A 2YLBA 4QKUA 1UB4A 1VQ8Q 1KQ2A 5LJ5g 1TU0B 1Q81C 3M4GA 4HA8A 2QYZA 2XD0A 4JRPA 1TH7A 2V8KA 4LDVA 2CS7A 3M55A 4C8QD 3M0RA 2YDLA 2PVGB 3U23A 2I2LA 2FHDA 5I22A 2L2PA 1Q7YC 3OYFA 3SB2A 3CXCP 2L3PA 3EGUA 2PU9B 1ZA2B 2XK0A 2LQKA 2EWNA 2RM4A 2LC4A 3OB9A 3JCMJ 2DILA 2J6KA 2YT6A 2EBPA 3V7CA 3G7ZA 3EFRA 1LNXA 1XJWB 2EPDA 1NM7A 2ABLA 2LTOA 3ULRB 1WA7A 3OW2A 4ZN1A 5GAMd 4TVRA 1WHJA 2CUBA 2NUZA 2O01E 4KBMB 1WFWA 2V8JA 3CMAA 5GMKh 3JCMW 9ATCB 1VQ6A 2DXBA 2KSSA 3V8LA 3S6WA 2DBMA 5LL6S 4Z8AA 4OGEA 1SHFA 1AWWA 3LH0A 5HKCA 1G8XA 1VQPA 4NL2A 4N4IA 4BDZA 1NEGA 2O9SA 2AT1B 3GBQA 1K4US 1UJ0A 1KFZA 2R5AA 4R55A 4C8QC 2DE0X 3A8GB 2RH2A 2E3HA 4KT0E 3CBOA 3VV0A 1UTIA 3O8VA 3I56Q 3UA6A 3I55Q 2GFAA 2K2MA 2VVKA 4J9FA 4O5VA 2WSEE 2HBWA 5GMKe 2QXFA 2GBQA 5CIUA 2Y90A 4A63B 2HQXA 4C92B 3OYJA 1QVFA 3BE3A 3M0SA 2PUKB 2L3RA 3OS2A 1KC8R 3QKJA 1OYXA 4DBFA 4FYYB 4J7FA 1KQSS 2R5MA 4A4EA 2EW3A 3G6EA 1ZBJA 1PRLC 1UDLA 3NMZC 1WYXA 3M53A 3L2RA 4HCCA 3SD4A 4A4HA 3V7RA 3HRUA 4E2FB 4CC2A 1T0JA 3ER0A 2VYTA 1RAIB 2M0YA 3WVEB 1VUBA 3AHUA 2EYZA 2PVDB 2C0TA 3I5RA 1Q81U 2F1LA 3HFNA 3CBPA 2VASA 3X20B 2FZCB 4C5IA 5DLQE 2MYSA 4M78F 3PMIA 2LNHB 3RUXA 3HL8A 2YSQA 3VYHB 1Q7YU 1OU9A 1UGVA 4BI4A 1ARKA 4PNOA 2FRWA 2K2VA 1MNDA 4XU3A 2ZPFB 3C4SA 1VQ7A 1CKAA 1QVGA 3TVTA 2LVMA 1XTDA 3JCMb 4FCYA 3CCRT 4OP0A 3E19A 2EJ9A 1YCSB 1WPYA 2LRQA 4YTLA 4C8QG 1RUWA 4L59A 2ZPGB 5HCKA 1ZQ1A 2DVJA 2LT4A 2ZAEA 1N8RR 2LMJA 4X9CA 2RO0A 3MEAA 5C0MA 1PNJA 2YHTA 1BI0A 4IUVA 1JXMA 2KVQG 3VS6A 1O75A 3OBYA 4JRKA 4IUQA 2DYIA 2E10A 4LDYA 1W2BS 1GFDA 4X9DA 4KUDK 1B3QA 4QQDA 4M77D 1OI1A 1WHHA 2KROA 3MCAB 1P92A 5J26A 4NS5A 5M9OA 4PFPA 2ROTA 4XTUA 3CMEQ 2GQIA 1N6AA 1N8RU 1K76A 2JW4A 5CVIA 2KRSA 5KE3A 2KE9A 5EG2A 4X34A 5IN1A 2JUFA 1B7TA 1JJ2S 1RI0A 2DIQA 2SRCA 4JRQA 1U8RA 2DD5A 1EX4A 1GBQA 4E7HA 2VKNA 2L3SA 1WIEA 4AFQC 4GLMA 4A4KA 2CT4A 3ZFJA 5A0LA 2COZA 2WSCE 4AT1B 3GOXA 1ZUKA 1KQSP 3LGFA 1TOVA 5LJ5e 4ANJA 2JZ2A 4M78D 1X27A 3F70A 2A08A 4Z88A 1NLOC 1IHVA 3CCLQ 5A0DA 2LX7A 4C8QA 4WF2A 3HSBA 2JOYA 3TREA 1M90R 1TWBA 2QQ9A 2GGRA 2RQRA 2J6FA 2DNUA 2CP6A 2HKNA 3H0FA 5IHNA 2JVVA 1RACB 1YN8A 3KBGA 3VUZA 4LDWA 4II1A 2DO3A 4J5YA 1WZOA 3CCVQ 1AEYA 1VA7A 2KYMA 1TUGB 3I56T 1T3SA 2E4HA 4FM4B 4OMFB 1IB8A 2X4WA 3JAME 3FRNA 1I07A 1YFNA 1I5OB 4JZ4A 2K9GA 1BYMA 2LQWA 2AIRB 5GAOn 3BDLA 3WXMB 4M78C 4KULA 2IG0A 5IT9E 1K9AA 1I1JA 2E70A 4EDUA 2RQVA 1YJWA 4JRIA 2DRKA 1MUZA 3EG9A 3CCSQ 4RTZA 1PG5B 3QBYA 4LD9K 4C8QE 2MMPA 5I2SA 3MEUA 3S3NA 2LCCA 2HL3A 1JU5C 2JTMA 4LXCA 4DEXA 2F2WA 1KK7A 1YWPA 1BU1A 1WHKA 3MP8A 3RMQA 4PKCC 4E47A 1WJSA 2G6FX 2FYKA 1BI2A 2VGNA 2M1HA 3INZA 1FMWA 2BZYA 3VKIA 2FPEA 3Q1JA 2J05A 2PQWA 2BKDN 5LJ5d 1MHNA 2XKOC 4AMCA 1Z9QA 5KCHA 4N0AC 1NEBA 3M0UA 3UATA 2M9UA 2KGTA 2DL3A 8AT1B 1PWTA 2EAYA 3G71Q 2X3XD 4BB7A 5IXFA 2DEQA 3S3OA 3VS2A 4RTYA 3PNWC 2RB6A 5D6WA 1UG1A 2DJQA 3CD6T 1XOVA 3KXTA 4M78G 5CKFA 2OAUA 1I5LA 3J80E 1B07A 1M4ZA 4OB1B 2D0NA 2E5KA 2DMOA 5L23A 2DL7A 4GLKA 3BY7A 3ZL7C 3L2VA 2O4XA 3GNFB 1K8AC 2DIGA 4PJNA 3QSUA 3CXCS 5KYXA 3G4SQ 1H3ZA 1H3HA 4E7LA 1H92A 4Y28E 4BE2A 3FEOA 3JB9D 1M2OA 1RADB 1HK9A 3CPWA 4AFZC 3RR6A 2RI2A 3LH5A 5CKDA 4QVDA 4J8OA 4J9BA 8ATCB 4HVVA 4KH1B 1EZZB 4C8QB 3LLRA 3UPUA 1VQMT 4E7IA 1AVZC 1MMDA 2W10A 1WX6A 1VQNT 3OW2P 4C0FA 4KGVB 2HEQA 1OX8A 2C0IA 4KGZB 5CCAA 5LJ5f 3QO3A 1PM3A 1PC0A 3HPWA 2CP5A 2GFUA 4HXJA 3TU4K 1NLPC 3OYLA 3LGLA 1NPPA 1JO8A 2COWA 2F2XA 2FL7A 4HT9A 1YJ9A 1VQ9T 2YUNA 1Y96A 2IPOB 1SRMA 4FW2A 3LW5E 2MAMA 3HFOA 4LN2A 3VRZA 1WXUA 4CC4B 4M78A 3CCVT 1YI2Q 3H0HA 4ATOA 2JMCA 2D8HA 1R8OB 3PT9A 5GAOq 1PHTA 1JQQA 1BK2A 4JJCA 5KYUA 4DOWA 3A8HB 1NJIR 3VS1A 2QTXA 4F04B 3ASKA 2GNCA 3NFCA 4C0ZA 2XU8A 2WACA 2LQ8A 3DB4A 3EG9B 3GP8A 1SSFA 2BIVA 2RJDA 3RERA 3EHRA 1I81A 4M77E 4RMOA 1RAEB 2KDSA 2VUBA 2EVRA 2CGHA 4EMHA 1U1SA 3OYKA 4PJOD 3RDVA 2BTTA 4E7ZA 2OTJQ 1VQLT 3REBB 2DTIA 1VYVA 2CKKA 3RBBB 4BE0A 4D6WA 5GANg 1NJIU 2YRCA 4RUGA 1S72A 1YIJQ 5D6YA 1XNIA 1VQ4Q 5CKBA 4HVUA 3CCEQ 3NTIA 3E9FA 2H3JA 1JXOA 3EH1A 1Q82C 1QP2A 4N0AA 2V8IA 2D9TA 2M0OA 4ORZA 1IHWA 4LUDA 2RK1A 2DBKA 2EJGA 1AWJA 3CC7T 2AK5A 3OSVA 1AT1B 3QG1A 1PRMC 3L2QA 4M78E 3JV3A 3M4YA 2RQTA 5D7UA 3D7SB 2D6FA 2NWMA 1VIFA 4M4ZA 4QQGA 3KFVA 1VQOT 3CD6A 4JJBA 2Z0WA 3DKMA 5KE2A 1QVGP 4F7UG 2WSFE 3AT1B 3JRZA 3R6NA 1NYFA 3G71T 4J9IA 4LDUA 1KHCA 2MOXA 3CCJQ 4BUGA 2KBTA 3QJYA 4PJOC 1M27C 1YP5A 4O6JA 3OYBA 1QCNA 1NZ9A 2PNIA 5GAOm 2CZ1B 2O4XB 2JT4A 2BE9B 5AYFA 4A54A 5C6SA 1KJWA 2F2VA 1DJ7B 4JLGA 5CQXA 5KYXB 4C5EA 1OZ2A 3CEYA 3CCMT 1MMGA 1W70A 3OYNA 3OBWA 1QCFA 4J6XA 4OVAA 4QW2A 1RI9A 1V1CA 1Q81R 3G1JA 5CKEA 3G4ST 4M77F 1YHQT 4FT4A 1VQMA 4D8KA 2SEMA 5GANj 2VV5A 1VQNA 4M77B 4J9GA 3OYCA 4QQ6A 4ZTJA 3PGGA 1Q7YR 3EFOA 2BZXA 2JS2A 1VQ5Q 3L2ZA 2DEUA 5GJVB 2QA4T 1VQ9A 1K73C 2QQAA 2QEXT 4OMMA 3DLLA 2DXCA 4Z02A 3EG1A 4J6YA 3MJXA 3R6OA 4F7UA 5GAN3 1J3TA 3UWNA 2B86A 1Y96B 2JXBA 1VIEA 3CCQQ 4NL3A 2DFUA 1SKUB 3OMCA 3WVDB 1CSKA 2KI7A 4QT7A 1Q82U 4M78B 2X4YA 4M7AF 4NOYA 1BI3A 4CRIA 4PJOG 4OB3B 1WNLA 4AFUC 4R56A 2EYYA 1IO6A 3CC2Q 5KYUB 2L0AA 5FU6C 2QQBA 3CCUQ 2DRMA 4PJJA 2QGGA 1YJNQ 1WQWA 3CC4Q 2EQIA 2P0QA 5D6XA 1M9SA 4E7KA 2OTLQ 2JNGA 2EYQA 1FWZA 2MPXC 1BIBA 2MCNA 1Y07A 3LYIA 1YITT 3ME9A 1VQLA 3OYYA 4FSXA 1OOTA 2O2OA 2HQHA 1FX7A 2CH4A 1WHLA 3VYGA 1H8KA 1QCOA 2QQRA 1D0YA 1IXDA 4HCKA 2LX9A 5GAOp 3DB3A 4FSSA 1Y7XA 4CC7A 2Y4XA 5KH6A 1VYUA 3OSSC 1OPKA 4HKEA 1WXTA 1Q86C 3GPLA 3GLXA 1VQ8T 2ZZDA 2K57A 2V1QA 2RA2A 2FB7A 5GANh 3CC7A 1AZGB 4A4GA 2E5QA 2AKKA 2DL8A 4F7UE 1AZEA 1KG1A 1VQ4T 2VC8A 3MEVA 1UFFA 3CCET 3TCJA 1VQOA 3N5BB 2F5TX 5GAMg 4LD6A 3FIFA 3CMAQ 4IKFA 3KUFA 3JCMg 3H41A 4OMPA 1S1NA 1VQ6Q 2BZ8A 2E6NA 6AT1B 3H9NA 2RF0A 3QJ6A 2OI3A 3JCMP 2HSEB 5HY6A 2JTFA 1VQPQ 4JPBW 4PJOA 2YLCA 3L1AA 2EQKA 1TTHB 2ZPIB 2KYBA 3PFSA 5GANe 1M1FA 3E9GA 2K5IA 4M7AD 1K73U 4BD3A 2DD4A 1G3TA 2KAFA 3M0TA 1K9MC 1JBMA 2EQUA 4PLIA 1AWOA 5HK3A 1PSEA 4M77C 2YRDA 3CCMA 2E41A 2QG9B 2EKHA 2F69A 1YHQA 4DA4A 3VS4A 4F16A 3I9QA 2ECZA 2HDAA 4HT8A 2M02A 2XG8D 3A8MB 4N4GA 2PZ1A 2QK0A 5A2QE 1GCPA 2PTKA 1SRLA 1ZUYA 4FYXB 3QDRB 1D0ZA 5AT1B 2OJ2A 1JRIA 2DA9A 2EYXA 1X01A 3I55T 3HKSA 3A5ZB 1ABOA 2GQVA 2VXEA 2A28A 1GCQC 2XHCA 4RCBA 2QA4A 5FRMA 2LJ3A 4BY6B 4JS4A 2QEXA 4J9CA 2DVEA 2AZVA 1CKBA 1VOMA 3TEEA 2F5KA 3EFOB 1PSFA 4OMNA 4DBHA 4XTXA 2YUOA 5GAMj 1LPLA 1KD1C 3M9QA 3UT1A 2DXUA 3OYEA 2CP3A 2RN8A 4F7UF 4Y91A 4M7AC 4PJOE 2K3BA 4DBQA 4L5GA 3L2UA 5GAN2 5GAN4 3JB9F 4F7UB 3HHTB 5I21A 3OW2S 1VQ7Q 2J06A 1RAHB 5FLXE 3VU3C 1RL2A 2M51A 3M58A 3CCRA 1U06A 1WHMA 4A53A 4KGXB 4Z89A 1X75C 1BCOA 2CUDA 5FW9A 5LJ3g 2QGFB 2K5FA 1OULA 1IGUA 2YWWA 3NHNA 3OQ5A 2L3QA 4M77G 2FEIA 2EJFA 1YITA 2LCLA 1TG0A 3JB9J 3CQTA 1M1KC 4QVZA 2X3WD 3SDZA 4HCBA 2RHXA 4OMOA 3P8DA 2RQUA 1MV3A 2FRYA 3SWNC 2DERA 4C5HA 2NLUA 2OTLT 1M3BA 3V8JA 3UA7A 2KRNA 2K3XA 1VQ8A 2HL5C 4OB2B 4V2SA 1WJQA 1M2VA 1M5Q1 1VYTA 4M75D 2FG0A 3H6ZA 3RNJA 4PK4A 2E3IA 2BUDA 1MMNA 3VUBA 2QDLA 1QVFS 3PMTA 3GF5A 5EC7A 1QKWA 3FDRA 1EIFA 2L8DA 4ZGDB 1PKSA 2RD1A 2D0QB 1E6HA 2KNBB 1G3SA 3CMET 1UGRB 4M7AG 5L8RE 3M54A 2CH4W 2MWPA 5GAMh 2DK3A 3BFMA 3GIBA 3OS0A 2JTEA 2DYBA 3JCMh 3CMAT 2P84A 2KXDA 4J9HA 4XAXB 4ESRA 3VS5A 1ZBXA 2LT1A 4PJOF 2HAXA 2LP5A 3PTAA 1VQ6T 1D1CA 2YUPA 2AKLA 1WI7A 4FL6A 4PJOB 3S3MA 4FYVB 3SEMA 5LJ3j 5KCOA 1YNZA 2G3RA 2YXYA 3ZEHA 1VQPT 2CP2A 4M77A 3HRTA 1LJOA 1YCYA 1TXQA 2JMAA 4M75C 2EKOA 4ZN3A 1QVGS 3JB9I 3UF4A 3X28B 1W2BA 2K79A 3M0PA 5CQYA 5GAN7 3CCLT 1SF9A 4LDXA 2K3YA 4JLIA 3A8OB 4BY6C 3QUIA 2J6OA 2RHIA 2EQJA 2KT8A 3A98A 2HSPA 2O88A 2DL5A 1BKBA 3I56A 2JJ9A 5GAOl 3I55A 1AD5A 2RJEA 5KYYA 3JCMe 1MV0B 4XK8E 2KXCA 5GANf 4ME7A 3VRYA 1GCQA 1QMCA 1U1TA 3QDFA 1G5VA 1JJ2A 3OYAA 2RMOA 1Y0MA 1OQKA 4RTTA 2L5QA 1R0CB 3RESA 1YJWQ 4FU6A 5GMKj 3LWHA 4M7AA 1AWXA 1RLPC 1TS9A 3M56A 4E7JA 5FWCA 2COYA 1W4SA 1KHIA 3OYMA 5CK9A 1K8AR 2LJ1A 3EG3A 1ZSZC 1G2BA 4KRTA 1D3BB 4WCIA 2RPNA 3C0CA 2DAQA 4UC4A 1TUDA 2KK4A 1X2QA 1QVFP 3RKYA 1HYOA 2D1XA 3JCMQ 2EQMA 3CCST 3X25B 1V29B 2GCXA 3M5AA 1KSWA 1EFNA 2HD0A 4KH0B 4LE9A 2RHYA 5FU6B 4M75G 5GAN6 2C06A 3JSCA 4MDXA 3RMSA 5J3BA 4IIOA 5IXBA 3FLGA 3MPUB 1KQ1A 5LJ3h 3EGXA 5IH2A 1D09B 1K8AU 3SWNA 3CPFA 2O31A 1Y71A 5GMKm 4M7DD 4PJMA 2MIOA 1ZX6A 4J9DA 2K6DA 4WTOB 2H3EB 3QXEB 2AHJB 2FPDA 4MZPA 4JJNK 4JDSA 2EGCA 1KC8C 2X9HA 2E12A 1M2VB 2D8JA 1XQHA 5FU7C 2M16A 2DLPA 4M7AE 2KMTA 2HQEA 5CR2A 2J7IA 1U3OA 1R77A 4RTXA 2JS0A 3LWIA 3CMEA 3FJ5A 3META 2MWOA 1Q95G 3A1PA 3JB9G 2PUOB 1ZHIA 2PVOB 4BI8B 2VGMA 5LJ3e 4PL6A 2H8HA 3LX7A 1OEBA 1UE9A 2A3LA 1JEGA 3QIIA 3MP1A 3RKWA 3JCMd 1NPRA 4XTZA 2P0PA 1YBYA 4MDWA 1QWEA 2ZGWA 2Y4YA 2I0NA 3HP9A 2CP7A 4ZTFA 2IIMA 2RHZA 3OS1A 1UGPB 4R0KA 5GAOr 2XICA 4C0GA 4M7DC 4LNPA 2DTOA 4F14A 3OY9A 4M75A 2FO0A 3CBMA 4KUIA 1JB0E 4JZ3A 3VJPA 3M0QA 3CCLA 2JN0A 1N8RC 2QI2A 2NUTA 2RJFA 3T9NA 5LJ5j 3J81E 1Q82R 2QQSA 1X2KA 4C92F 2NUPA 4EMKC 2E64A 3QZ9B 2DJZA 1M3CA 3PVLA 1RAGB 1YJ9Q 2CSQA 2DZ9A 2GTJA 1BBZA 2XDPA 5KYYB 1WGSA 1WHGA 3NTKA 2ATCB 3P8BB 4DBRA 3CCVA 2ZPHB 4PFZA 3REAB 1H641 5FWBA 2KR3A 2EYWA 1I4K1 3VS7A 2OX7A 1RAAB 3MO8A 3C94A 2R57A 2JM8A 3I5SA 2EIFA 1IZ6A 2DKGA 4K11A 1UHCA 5GAMf 4E7SA 1FMVA 1WLPB 3FB9A 3SFMA 3NGPA 3CXCA 2KRMA 1ACMB 4MZTA 1QW1A 3JCMf 4M7AB 1ZSZA 1YI2T 1YJWT 1M30A 2CP0A 3THKA 1KC8U 4OF1A 4DOVA 1VQKQ 1SEMA 2FPFA 4M75E 4F17A 3CCSA 3ZBDA 3H8ZA 4GBQA 2CZ7B 3NPFA
chains in the Genus database with same CATH topology
4M7DG 2F5KA 3JCMJ 3JB9H 1PSFA 2RI2A 4XTXA 3V7CA 3G7ZA 5GAMj 3EFRA 1KD1C 1LNXA 5CKDA 4QVDA 2LTOA 3M9QA 4J8OA 3UT1A 2DXUA 3GNGA 3JCMV 3OYEA 3OW2A 4ZN1A 5GAMd 3OS5A 2X4JA 5LJ3d 2P4TA 4TVRA 4F7UF 4Y91A 4ELYC 3CPWS 2O01E 4C8QB 4KBMB 1M90C 4M7AC 4PJOE 1WJRA 3LLRA 3UPUA 2V8JA 1VQMT 3QPHA 4L5GA 3CMAA 4E7IA 5GMKh 3L2UA 3JCMW 5GAN2 5GAN4 3JB9F 1HK9A 3HHTB 5I2MA 4F7UB 5I21A 5GAN5 1VQ6A 2OTJT 3OW2S 3QHSA 1VQNT 2DXBA 2KSSA 3V8LA 4BI3A 5FLXE 3S6WA 4C0FA 4JS5A 2HBPA 5DY9A 5LL6S 5LJ5f 2X35A 5CCAA 3V7SA 3SWNB 3VU3C 5HK0A 4J83A 4OGEA 3QO3A 4MMLA 2XDDA 1RL2A 3HPWA 3M58A 3CCRA 5CO7A 4IUUA 2GFUA 2R58A 2ZPBB 1YIJT 3LH0A 5HKCA 5LJ5h 1VQPA 4NL2A 4J7IA 4N4IA 4A53A 4C92D 3TU4K 1X75C 3OYLA 3LGLA 1NPPA 3PIPA 4BDZA 1X6OA 5LJ3g 3BW1A 5DM7R 2FL7A 4HT9A 1YJ9A 2R5AA 1VQ9T 2K5FA 4R55A 3OA6A 1Y96A 4C8QC 3OQ5A 4M77G 3A8GB 2RH2A 2EJFA 4KT0E 1YITA 2LCLA 2MAMA 1N9RA 3LW5E 3JB9J 4ELZC 3HFOA 1B34A 3JCMc 1M1KC 4QVZA 3G71A 3CBOA 4BE1A 3VV0A 1UEBA 4M78A 3SDZA 4HCBA 2RHXA 3CCVT 3P8DA 4ATOA 2KY9A 3O8VA 1R8OB 3SWNC 4C5HA 2GFAA 2NLUA 3PT9A 5GAOq 4O5VA 2OTLT 2WSEE 5GMKe 2QXFA 3V8JA 4DOWA 2K3XA 3OMGA 3A8HB 1VQ8A 5CIUA 2Y90A 2HQXA 4OB2B 3JCMX 3HRSA 4V2SA 4C92B 3OYJA 1WJQA 1QVFA 1M5Q1 2PUKB 2QTXA 3QYHB 1O9SA 4M75D 3H6ZA 3ASKA 2L3RA 3OS2A 3NFCA 3QKJA 5FROA 1OYXA 2XU8A 2WACA 4C0ZA 4J7FA 2LQ8A 5GMKi 3C12A 1KQSS 2BUDA 3DB4A 2P0KA 2R5MA 3TEEA 3VUBA 3GP8A 4A4EA 1SSFA 2BIVA 2RJDA 3FJPA 4FIBA 3URGA 3G6EA 3CCJT 3RERA 1I81A 3C95A 4M77E 1QVFS 3PMTA 3GF5A 2DTHA 3M53A 4RMOA 3L2RA 4HCCA 4M7DA 3SD4A 4A4HA 2KDSA 1QVPA 2VUBA 3G4SA 4B9WA 3V7RA 3FDRA 4XTVA 1EIFA 2RI3A 3HRUA 2DPPB 2CGHA 2L8DA 4EMHA 4ZGDB 1QP3A 1U1SA 3ER0A 3OYKA 2VYTA 2RD1A 2D0QB 4PJOD 1NE8A 4M75F 1VUBA 3WVEB 3AHUA 2PVDB 1G3SA 1Q81U 1VQLT 3HFNA 3CMET 2XDBA 5LJ3f 2DTIA 2CKKA 3CBPA 4C92C 1UGRB 4M7AG 5L8RE 3X20B 4BE0A 4D6WA 3M54A 5GANg 4M75B 4C5IA 5DLQE 1NJIU 2MWPA 2MI6A 5GAMh 1S72A 4M78F 2DK3A 4XTWA 5D6YA 2HNIA 3BFMA 1XNIA 3PMIA 5CKBA 3GIBA 3RUXA 3NTIA 3E9FA 2H3JA 3HL8A 3OS0A 4EMKA 4FT2A 3JCMh 1Q82C 1QP2A 3CMAT 3VYHB 1Q7YU 4XAXB 4BI4A 2DZCA 4N0AA 2V8IA 4PNOA 1ZBXA 2D9TA 2LT1A 2M0OA 2K2VA 4IUTA 4PJOF 2HAXA 4XU3A 3PTAA 1VQ6T 1OZ3A 2RK1A 2ZPFB 3C4SA 2EJGA 1VQ7A 3PIOA 3CC7T 1QVGA 4P5NA 4ZGJB 2LVMA 1XTDA 3OSVA 4FL6A 3JCMb 3QG1A 4RCCA 4PJOB 3L2QA 2LDMA 4M78E 5IAYA 3S3MA 3CCRT 4OP0A 3E19A 2EJ9A 4A4FA 5KCOA 5LJ3j 1WPYA 2LRQA 3M4YA 2G3RA 4YTLA 2D6FA 3ZEHA 4C8QG 4XTYA 1VQPT 4L59A 4M77A 3HRTA 1LJOA 2ZPGB 1VIFA 4CI0C 1YCYA 4QQGA 1VQOT 1ZQ1A 3CD6A 1VQ5T 4M75C 2EKOA 2LT4A 4ZN3A 1QVGS 2LNVA 1YJ9T 3DKMA 5KE2A 1D3BA 2RJCA 4F7UG 3JB9I 1M90U 4X9CA 2WSFE 3JRZA 3X28B 1W2BA 5J39A 2RO0A 1Q86U 3MEAA 5CQYA 5C0MA 5GAN7 3CCLT 2YHTA 1BI0A 4XU1A 4C0DB 4IUVA 4LDXA 3G71T 2KVQG 1GXIE 2K3YA 4JLIA 3A8OB 4BY6C 3QUIA 4LDUA 1O75A 3OBYA 4JRKA 1KHCA 2EQJA 2RHIA 3E1SA 4IUQA 1YI2A 3L2WA 4BUGA 2E10A 4LDYA 1W2BS 1BKBA 3I56A 5GAOl 3QJYA 3I55A 2RJEA 4MZMA 4PJOC 3JCMe 3CCQT 4X9DA 4M7DE 4KUDK 4XK8E 4O6JA 2DXTA 5GANf 3OYBA 4QQDA 4M77D 1OI1A 3MCAB 1NZ9A 4ME7A 1P92A 5J26A 5GAOm 4NS5A 2CZ1B 5M9OA 3X26B 2O4XB 1U1TA 1G5VA 5AYFA 1JJ2A 4XTUA 3OYAA 4A54A 5C6SA 4IURA 1DJ7B 4GY5A 3MP6A 1N6AA 4JLGA 5CQXA 3CC2T 1M1GA 1N8RU 4C5EA 1M8VA 5CVIA 1OZ2A 3CEYA 2L5QA 3CCMT 3CCUT 3RESA 5KE3A 3OYNA 3OBWA 4J6XA 5EG2A 4OVAA 4QW2A 4FU6A 4X34A 5IN1A 4OB0B 5GMKj 2JUFA 1YJNT 5CKEA 1JJ2S 3CC4T 5FRNA 1RI0A 2DIQA 3G4ST 4JRQA 4M77F 1VQKT 3LWHA 1YHQT 4FT4A 2DD5A 1VQMA 1U8RA 4C92G 1KQSA 4E7HA 4M7AA 3MHXA 3RKXA 5GANj 4C5GA 3M56A 4E7JA 1N27A 2VV5A 1W4SA 1KHIA 4A4KA 2OTJA 3OYMA 5CK9A 1VQNA 4M77B 3OYCA 1UGSB 3ZFJA 5GANd 4QQ6A 4ZTJA 2K4YA 2CZ0B 5A0LA 3PGGA 2RHUA 2WSCE 3M59A 4JUVA 2XI9A 1D3BB 3V8KA 3GOXA 1S72T 3LGFA 5LJ5e 2IVWA 2DAQA 4UC4A 4L6V5 1YIJA 1K9MU 3BDUA 2JZ2A 1VQ4A 2KK4A 4M78D 3CCEA 3L2ZA 3QYGB 3RKYA 3F70A 2EQMA 4N4HA 5CKHA 3JCMQ 1G3YA 2E65A 3X25B 3CCST 4VUBA 2QA4T 1V29B 1VQ9A 2GCXA 1K73C 2QQAA 2HD0A 3EAEA 3M5AA 2QEXT 2RHYA 5A0DA 4PLLA 5FU6B 4C8QA 4WF2A 3EFSA 2DXCA 2QDYB 3DLLA 2XIDA 3HSBA 4M75G 4Z02A 5GAN6 2C06A 2JOYA 3TREA 4J6YA 3JSCA 5FU7B 3RMSA 3R6OA 5J3BA 4F7UA 5GAN3 3QZ5B 4MDXA 3M57A 2ZCFB 2QQ9A 3FLGA 3UWNA 5GMKl 1KQ1A 1Y96B 5LJ3h 3DLMA 1VIEA 3J7AF 4NL3A 3SWNA 1K8AU 3RIRA 3OMCA 5GAN8 3WVDB 1B34B 2JVVA 3CPFA 1Y71A 5GMKm 4XU0A 1Q82U 4M78B 2X4YA 3KBGA 2ZPEB 5DLOA 4M7DD 3VUZA 4M7AF 1HXDA 2E1HA 4LDWA 4NOYA 1BIAA 1IREB 4II1A 1BI3A 4RG2A 2KQWA 4OB3B 4PJOG 1WNLA 4CRIA 1NJIC 3QXEB 2AHJB 4R56A 4MZPA 2DO3A 4J5YA 4JJNK 5FU6C 2QQBA 3CCJA 4JDSA 1WQ7A 4IUPA 3I56T 1KC8C 1KD1U 4FM4B 4OMFB 2E12A 2X4WA 3JAME 4QVCA 3OYHA 1XQHA 2L89A 1WQWA 3FRNA 5D6XA 2P0QA 5FU7C 1M9SA 4E7KA 2JNGA 2RI5A 2M16A 1AHJB 2EYQA 4J6WA 1FWZA 1MGQA 4DQ2A 1BIBA 4M7AE 2KMTA 2HQEA 5CR2A 4M7DF 1BYMA 1Y07A 3L42A 3LWIA 4RG8A 3LYIA 5GAOn 5CAIA 1YITT 2E6ZA 3BDLA 3ME9A 1UGQB 3NTHA 3OYYA 4FSXA 3CMEA 1VQLA 3WXMB 1FX7A 2MWOA 2GF7A 3META 4M78C 3VYGA 4C8QF 4BDYA 3JB9G 2YRVA 2PUOB 4M7DB 1ZHIA 2QQRA 2CYZB 2PVOB 4KULA 4C92A 2IG0A 5GAMe 5IT9E 4BI8B 2VGMA 5LJ3e 5GAOp 2E70A 2LX9A 3DB3A 4MMKA 4EDUA 1YJWA 1Y7XA 1N9SA 4PL6A 3LX7A 4JRIA 2A3LA 2Y4XA 5KH6A 2B8AA 3OSSC 3QIIA 4HKEA 3MP1A 3RKWA 3JCMd 1Q86C 1NPRA 3GPLA 3GLXA 1VQ8T 4XTZA 2P0PA 1YBYA 4MDWA 2ZZDA 1I8FA 3QBYA 2K57A 2ZGWA 2Y4YA 2RA2A 4LD9K 2FB7A 4C8QE 2MMPA 5I2SA 3MEUA 5GANh 3FC3A 3CC7A 4A4GA 3HP9A 3S3NA 2E5QA 2LCCA 2K5LA 3MEWA 4EMKB 4ZTFA 2RHZA 1LOJA 3OS1A 4F7UE 4HCZA 1UGPB 5GAOr 3G6ET 4C0DC 1M1KU 2JTMA 4B9XA 1VQ4T 1KG1A 2XICA 4C0GA 4M7DC 2VC8A 2EFIA 3MEVA 3CCET 3TCJA 1VQOA 3N5BB 2F5TX 3MP8A 5GAMg 1VQ5A 2DTOA 3RMQA 1BI1A 4LD6A 4M75A 3FIFA 3OY9A 4PKCC 4E47A 3CBMA 2X4XA 1FXXA 4IKFA 1WJSA 4KUIA 5A0GA 2FVUA 1JB0E 4EPCA 3KUFA 3JCMg 4BACA 3VJPA 2FYKA 1BI2A 3CCLA 2E6NA 2JN0A 2VGNA 1N8RC 2M1HA 3INZA 3OYDA 3QJ6A 3X24B 4EMGA 2QI2A 1G3WA 2RJFA 3A8LB 4OGCA 3T9NA 3VKIA 5LJ5j 3J81E 3OYIA 3JCMP 2QQSA 5HY6A 2JTFA 4C92F 3OYGA 3Q1JA 2PQWA 2BKDN 4EMKC 4Q5WA 5LJ5d 2E64A 3QZ9B 1MHNA 2XKOC 3CCQA 2DJZA 3P8HA 4PJOA 2YLCA 4XQ3A 3L1AA 5KCHA 4N0AC 2EQKA 3UDCA 2VXFA 2DZ9A 2ZPIB 3PFSA 5GANe 1M1FA 2M9UA 3E9GA 2K5IA 4M7AD 1K73U 4RKUE 1VQ7T 4BD3A 2DD4A 2A7YA 2MF2A 1G3TA 2XDPA 2EAYA 2KAFA 1WGSA 4BB7A 2DEQA 1K9MC 1JBMA 3S3OA 2EQUA 4PLIA 4C92E 3NTKA 3P8BB 3PNWC 2RB6A 5HK3A 3CC2A 2RK2A 2ZPHB 5D6WA 1PSEA 4M77C 3CCUA 3CCVA 3CCMA 1H641 2CZ6B 4ZGEB 1I4K1 3CD6T 1YJNA 2E41A 2F69A 1XOVA 2R57A 3C94A 3MO8A 1VQKA 2OTLA 3CC4A 4XU2A 2YLBA 3KXTA 4DA4A 4M78G 1YHQA 1UB4A 5CKFA 2EIFA 1KQ2A 5LJ5g 2OAUA 1IZ6A 2DKGA 1I5LA 3J80E 1M4ZA 4OB1B 1Q81C 4HT8A 3M4GA 2XG8D 3A8MB 4HA8A 4N4GA 5GAMf 5A2QE 3FB9A 3SFMA 3CXCA 2XD0A 4JRPA 1TH7A 2V8KA 4GLKA 4LDVA 4MZTA 3BY7A 1QW1A 2CS7A 3QDRB 3M55A 2O4XA 3GNFB 3JCMf 4C8QD 3L2VA 4M7AB 1YI2T 1JRIA 1YJWT 1K8AC 2PVGB 2DIGA 2I2LA 2FHDA 1X01A 3I55T 3HKSA 3A5ZB 1KC8U 1Q7YC 4OF1A 3QSUA 4DOVA 3OYFA 3CXCS 3SB2A 2GQVA 2VXEA 4M75E 3CCSA 1H3ZA 4RCBA 2XHCA 2QA4A 3ZBDA 4E7LA 5FRMA 3H8ZA 4BY6B 2CZ7B 2PU9B 4Y28E 2XK0A 4JS4A 4BE2A 2QEXA 3FEOA 2LQKA 2DVEA 2EWNA 2RM4A 3JB9D 2LC4A 3CPWA 3OB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M77 B;  4M7D G;  5GAN h;  3JCM J;  3JB9 H;  3HFN A;  5GAN d;  5LJ3 f;  2DTI A;  4XTX A;  4C92 C;  3V7C A;  4M7A G;  5GAM j;  4EMK B;  3EFR A;  3PGG A;  1LNX A;  4JUV A;  5GAN g;  4QVD A;  1D3B B;  1LOJ A;  4M75 B;  4F7U E;  3V8K A;  2DXU A;  3JCM V;  5GAO r;  5GAM h;  4M78 F;  5LJ5 e;  4XTW A;  5GAM d;  2HNI A;  3BFM A;  3BDU A;  5LJ3 d;  2VC8 A;  4M7D C;  3GIB A;  4F7U F;  4M78 D;  4Y91 A;  3RUX A;  3L2Z A;  4C8Q B;  3RKY A;  4EMK A;  5GAM g;  4M7A C;  4PJO E;  2DTO A;  3JCM h;  3JCM Q;  4M75 A;  3FIF A;  2E65 A;  2DZC A;  4C8Q E;  5GMK h;  4N0A A;  4PNO A;  3JCM W;  4PJO F;  5GAN 2;  5GAN 4;  3JCM g;  4XU3 A;  3JB9 F;  4F7U B;  5I21 A;  2FYK A;  5GAN 5;  2EJG A;  3QHS A;  4C8Q A;  4WF2 A;  2JN0 A;  3V8L A;  3EFS A;  3INZ A;  3HSB A;  5DY9 A;  4M75 G;  2RA2 A;  5LJ5 f;  3JCM b;  3V7S A;  4RCC A;  3SWN B;  3VU3 C;  5GAN 6;  4PJO B;  3QO3 A;  4MML A;  4J6Y A;  4M78 E;  4EMG A;  4OP0 A;  5LJ3 j;  2EJ9 A;  4F7U A;  5LJ5 j;  5GAN 3;  1WPY A;  3JCM P;  4C92 F;  4C8Q G;  4XTY A;  5GMK l;  1KQ1 A;  1Y96 B;  1LJO A;  4M77 A;  5LJ3 h;  4NL2 A;  4EMK C;  1YCY A;  4A53 A;  4C92 D;  2E64 A;  5LJ5 h;  5LJ5 d;  2DJZ A;  4M75 C;  3SWN A;  4NL3 A;  4PJO A;  2YLC A;  4XQ3 A;  3RIR A;  3L1A A;  5GAN 8;  4N0A C;  5LJ3 g;  1B34 B;  2VXF A;  3BW1 A;  1D3B A;  3JB9 I;  4F7U G;  2DZ9 A;  4HT9 A;  4X9C A;  5GMK m;  4XU0 A;  4M78 B;  4M7D D;  1Y96 A;  4C8Q C;  4M7A F;  5GAN e;  4M77 G;  1HXD A;  2E1H A;  4NOY A;  5GAN 7;  2YHT A;  1BIA A;  2EJF A;  4XU1 A;  4M7A D;  1N9R A;  3JB9 J;  4PJO G;  1WNL A;  2EAY A;  1B34 A;  3HFO A;  4JLI A;  3JCM c;  3QUI A;  2DEQ A;  4JRK A;  1JBM A;  4M78 A;  4J5Y A;  4C92 E;  2RB6 A;  1WQ7 A;  2E10 A;  4M77 C;  1H64 1;  5GAO l;  3SWN C;  4QVC A;  4PJO C;  3JCM e;  1I4K 1;  5GAO q;  1WQW A;  2E41 A;  4X9D A;  4M7D E;  5GMK e;  2DXT A;  4J6W A;  4XU2 A;  2YLB A;  3V8J A;  1MGQ A;  4M77 D;  4M78 G;  1BIB A;  4DQ2 A;  5GAN f;  4M7A E;  1KQ2 A;  5LJ5 g;  4M7D F;  2Y90 A;  2DKG A;  5GAO m;  3JCM X;  1I5L A;  4V2S A;  4C92 B;  1U1T A;  1M5Q 1;  4HT8 A;  3M4G A;  2QTX A;  4HA8 A;  4M75 D;  5GAO n;  5GAM f;  4XTU A;  5CAI A;  4A54 A;  3FB9 A;  1TH7 A;  4M78 C;  4C8Q F;  3JB9 G;  3BY7 A;  4M7D B;  5GMK i;  4C92 A;  4C8Q D;  3JCM f;  1M8V A;  5GAM e;  4M7A B;  1JRI A;  3FJP A;  5LJ3 e;  4MMK A;  5GAO p;  3RER A;  3RES A;  1I81 A;  2I2L A;  4M77 E;  1X01 A;  4J6X A;  1N9S A;  2DTH A;  4JRI A;  5GMK j;  4M7D A;  3QSU A;  4M77 F;  3RKW A;  3JCM d;  3SB2 A;  2VXE A;  4M75 E;  3V7R A;  4XTV A;  4RCB A;  4C92 G;  4XTZ A;  4M7A A;  3RKX A;  2CGH A;  4EMH A;  1U1S A;  5GAN j;  1I8F A;  2RD1 A;  4PJO D;  2K57 A;  4M75 F;  2ZGW A;  3AHU A;  3JB9 D;  2DVE A;  2EWN A;  2RM4 A;  2FB7 A;  1HK9 A; 
#chains in the Genus database with same CATH topology
 4M7D G;  2CRE A;  2DF6 A;  1YWO A;  3JB9 H;  4E6R A;  3EH2 A;  1BB9 A;  3GNG A;  3JCM V;  1C1A A;  1S72 Q;  1TSF A;  3OS5 A;  2X4J A;  5LJ3 d;  2P4T A;  4ELY C;  3CPW S;  1M90 C;  1WJR A;  1R0B G;  3QPH A;  4OMQ A;  5I2M A;  2LZ6 B;  5GAN 5;  3EGD A;  2OTJ T;  3QHS A;  1KIK A;  4BI3 A;  3EGX B;  4JS5 A;  2HBP A;  1X6B A;  3E2U A;  5DY9 A;  2X35 A;  3V7S A;  3TQ7 P;  2HKQ B;  3SWN B;  5HK0 A;  4J83 A;  2XDD A;  4MML A;  2W0Z A;  5CO7 A;  4IUU A;  2ED1 A;  2R58 A;  2ZPB B;  1YIJ T;  5LJ5 h;  1K73 R;  3CD6 Q;  1QWF A;  4J7I A;  4C92 D;  1HJD A;  3PVQ A;  3PIP A;  1X6O A;  3BW1 A;  5DM7 R;  3OA6 A;  1HSQ A;  2JM9 A;  2VB6 A;  4J9E A;  1N9R A;  1B34 A;  3JCM c;  3G71 A;  4BE1 A;  1FMK A;  1UEB A;  1PD1 A;  5IHK A;  3VS3 A;  4X1V A;  2KY9 A;  3PE0 A;  5KYW A;  1E6G A;  1QKX A;  4EIK A;  1C0M A;  2BE7 D;  3OMG A;  5GJW B;  3JCM X;  3HRS A;  1PKT A;  3QYH B;  1O9S A;  2OAW A;  4FYW B;  1WDX A;  5FRO A;  5GMK i;  3C12 A;  2P0K A;  5IHI A;  4FIB A;  3CCJ T;  3FJP A;  3URG A;  1SSH A;  3C95 A;  4D8D A;  5KYN A;  2DTH A;  4M7D A;  3EG2 A;  1QVP A;  1VQM Q;  3G4S A;  4B9W A;  4XTV A;  2RI3 A;  2DPP B;  1U5S A;  1RLQ C;  2ROL A;  1K1Z A;  1QP3 A;  1NE8 A;  4M75 F;  1W1F A;  4CC3 A;  1VQN Q;  3VS0 A;  2XDB A;  1OV3 A;  5LJ3 f;  1X43 A;  4C92 C;  1ZA1 B;  3EHQ A;  4M75 B;  1Q86 R;  1E7O A;  2EGA A;  2MI6 A;  1MMA A;  2HMA A;  1Y57 A;  3G6E Q;  4XTW A;  2HNI A;  2KT1 A;  1TUC A;  4EMK A;  4FT2 A;  1HD3 A;  2DZC A;  1VQ9 Q;  4ELZ C;  4IUT A;  2NUT B;  1OZ3 A;  2K7A A;  2NUP B;  3PIO A;  4P5N A;  4ZGJ B;  1UEC A;  2O9V A;  4RCC A;  2LDM A;  5IAY A;  4Y92 A;  5ECA A;  4A4F A;  2ESW A;  4AFS C;  4XTY A;  4CI0 C;  1GRI A;  4AG2 C;  1VQ5 T;  1FYN A;  1IRX A;  2LNV A;  3CPW P;  1YJ9 T;  1M8M A;  1D3B A;  2RJC A;  1M90 U;  2YUQ A;  2EGE A;  5J39 A;  1Q86 U;  1Z9Z A;  1RAF B;  4XU1 A;  4C0D B;  4IIM A;  1GXI E;  1PCX A;  3EG0 A;  4RTU A;  3E1S A;  1YI2 A;  3L2W A;  3SHW A;  1W2B P;  4MZM A;  1IGQ A;  2ENM A;  2RQW A;  3CCQ T;  1NG2 A;  4M7D E;  1QQJ A;  4PJL A;  2DXT A;  1D0X A;  1WXB A;  3X26 B;  1K9M R;  1ZSZ B;  3TSW A;  1VQL Q;  4RTW A;  4IUR A;  2V1R A;  4GY5 A;  3MP6 A;  3CC2 T;  1M8V A;  1M1G A;  3CCU T;  2A0F B;  2DX1 A;  4OB0 B;  4RTV A;  1YJN T;  5FRN A;  4B6M A;  2A37 A;  3CC4 T;  1VQK T;  1OX9 A;  1JJ2 P;  2HCK A;  1KQS A;  4C92 G;  1ABQ A;  3MHX A;  3RKX A;  4C5G A;  1N27 A;  1AOJ A;  2OTJ A;  3CC7 Q;  1UGS B;  5GAN d;  2GTO A;  2C0O A;  2K4Y A;  2CZ0 B;  2RHU A;  3M59 A;  4JUV A;  2XI9 A;  2HZY A;  3V8K A;  3TSZ A;  1S72 T;  1RAB B;  2IVW A;  1YIJ A;  1K9M U;  4L6V 5;  3BDU A;  1VQ4 A;  1VQO Q;  3EGD B;  3CCE A;  3QYG B;  2KEA A;  2VWF A;  1QLY A;  2FZG B;  4N4H A;  1T0H A;  5CKH A;  1G3Y A;  2E65 A;  4VUB A;  1KD1 R;  1SPK A;  2DL4 A;  3EAE A;  1OU8 A;  4PLL A;  3EFS A;  2QDY B;  2XID A;  2MK5 A;  1K0S A;  1LCK A;  1A0N B;  5FU7 B;  2QAS A;  3QZ5 B;  3M57 A;  2ZCF B;  3QWX X;  5GMK l;  3DLM A;  3J7A F;  2FZK B;  2RNA A;  3RIR A;  5GAN 8;  1B34 B;  1T3L A;  4XU0 A;  2ZPE B;  3MKD A;  5DLO A;  1OPL A;  1ZSG A;  1HXD A;  2E1H A;  1BIA A;  1IRE B;  5KYW B;  1UJY A;  4RG2 A;  2KQW A;  1NJI C;  1D1B A;  4ZNX A;  2DET A;  3CCJ A;  3CCM Q;  1WQ7 A;  3IQL A;  4IUP A;  1KD1 U;  1ZLM A;  4HVW A;  1UHF A;  4QVC A;  3OYH A;  2L89 A;  1SG5 A;  1ZUU A;  2RI5 A;  2CDT A;  2QAZ A;  2ED0 A;  1AHJ B;  4J6W A;  1YHQ Q;  1MGQ A;  4DQ2 A;  4OML A;  1M1K R;  4M7D F;  3QWY A;  3L42 A;  4RG8 A;  5CAI A;  2E6Z A;  1UGQ B;  3NTH A;  2GF7 A;  4C8Q F;  4BDY A;  2LQN A;  4M7D B;  2YRV A;  1NYG A;  2CYZ B;  2P4R A;  4AG1 C;  4C92 A;  5GAM e;  2QTV A;  4MMK A;  2DM1 A;  2CT3 A;  1C6V X;  1N9S A;  3O5Z A;  2B8A A;  2AZS A;  1I0C A;  2QA4 Q;  1GBR A;  1X6G A;  4DEY A;  1I8F A;  2QEX Q;  1NBE B;  4LUE A;  4PFO A;  3FC3 A;  1V76 A;  2K5L A;  3MEW A;  4EMK B;  1M3A A;  1LOJ A;  4HCZ A;  1M1K U;  3G6E T;  4C0D C;  1GL5 A;  4B9X A;  2XMF A;  2EFI A;  2LCS A;  1BCM A;  1VQ5 A;  4FW1 A;  4JJD A;  1BI1 A;  1N5Z A;  1LVK A;  1FXX A;  2CSI A;  2X4X A;  5A0G A;  5I11 A;  2FVU A;  4EPC A;  2LJ0 A;  4BAC A;  3HTR A;  1F1B B;  3OYD A;  1MNE A;  1D1A A;  3X24 B;  4EMG A;  1G3W A;  3A8L B;  4OGC A;  3OYI A;  3CCR Q;  1GFC A;  2V26 A;  2X51 A;  3OYG A;  1K0X A;  4Q5W A;  3CCQ A;  2NYS A;  3P8H A;  4XQ3 A;  1W6X A;  3H0I A;  3UDC A;  2VXF A;  7AT1 B;  1PD0 A;  2A36 A;  3I35 A;  1UUE A;  1YIT Q;  4RKU E;  1VQ7 T;  2A7Y A;  2MF2 A;  1SHG A;  1G83 A;  3CC2 A;  4C92 E;  2RK2 A;  3CCU A;  2CZ6 B;  4ZGE B;  1YJN A;  3CC4 A;  2OTL A;  1VQK A;  4XU2 A;  1X69 A;  2YLB A;  4QKU A;  1UB4 A;  1VQ8 Q;  1KQ2 A;  5LJ5 g;  1TU0 B;  1Q81 C;  3M4G A;  4HA8 A;  2QYZ A;  2XD0 A;  4JRP A;  1TH7 A;  2V8K A;  4LDV A;  2CS7 A;  3M55 A;  4C8Q D;  3M0R A;  2YDL A;  2PVG B;  3U23 A;  2I2L A;  2FHD A;  5I22 A;  2L2P A;  1Q7Y C;  3OYF A;  3SB2 A;  3CXC P;  2L3P A;  3EGU A;  2PU9 B;  1ZA2 B;  2XK0 A;  2LQK A;  2EWN A;  2RM4 A;  2LC4 A;  3OB9 A;  3JCM J;  2DIL A;  2J6K A;  2YT6 A;  2EBP A;  3V7C A;  3G7Z A;  3EFR A;  1LNX A;  1XJW B;  2EPD A;  1NM7 A;  2ABL A;  2LTO A;  3ULR B;  1WA7 A;  3OW2 A;  4ZN1 A;  5GAM d;  4TVR A;  1WHJ A;  2CUB A;  2NUZ A;  2O01 E;  4KBM B;  1WFW A;  2V8J A;  3CMA A;  5GMK h;  3JCM W;  9ATC B;  1VQ6 A;  2DXB A;  2KSS A;  3V8L A;  3S6W A;  2DBM A;  5LL6 S;  4Z8A A;  4OGE A;  1SHF A;  1AWW A;  3LH0 A;  5HKC A;  1G8X A;  1VQP A;  4NL2 A;  4N4I A;  4BDZ A;  1NEG A;  2O9S A;  2AT1 B;  3GBQ A;  1K4U S;  1UJ0 A;  1KFZ A;  2R5A A;  4R55 A;  4C8Q C;  2DE0 X;  3A8G B;  2RH2 A;  2E3H A;  4KT0 E;  3CBO A;  3VV0 A;  1UTI A;  3O8V A;  3I56 Q;  3UA6 A;  3I55 Q;  2GFA A;  2K2M A;  2VVK A;  4J9F A;  4O5V A;  2WSE E;  2HBW A;  5GMK e;  2QXF A;  2GBQ A;  5CIU A;  2Y90 A;  4A63 B;  2HQX A;  4C92 B;  3OYJ A;  1QVF A;  3BE3 A;  3M0S A;  2PUK B;  2L3R A;  3OS2 A;  1KC8 R;  3QKJ A;  1OYX A;  4DBF A;  4FYY B;  4J7F A;  1KQS S;  2R5M A;  4A4E A;  2EW3 A;  3G6E A;  1ZBJ A;  1PRL C;  1UDL A;  3NMZ C;  1WYX A;  3M53 A;  3L2R A;  4HCC A;  3SD4 A;  4A4H A;  3V7R A;  3HRU A;  4E2F B;  4CC2 A;  1T0J A;  3ER0 A;  2VYT A;  1RAI B;  2M0Y A;  3WVE B;  1VUB A;  3AHU A;  2EYZ A;  2PVD B;  2C0T A;  3I5R A;  1Q81 U;  2F1L A;  3HFN A;  3CBP A;  2VAS A;  3X20 B;  2FZC B;  4C5I A;  5DLQ E;  2MYS A;  4M78 F;  3PMI A;  2LNH B;  3RUX A;  3HL8 A;  2YSQ A;  3VYH B;  1Q7Y U;  1OU9 A;  1UGV A;  4BI4 A;  1ARK A;  4PNO A;  2FRW A;  2K2V A;  1MND A;  4XU3 A;  2ZPF B;  3C4S A;  1VQ7 A;  1CKA A;  1QVG A;  3TVT A;  2LVM A;  1XTD A;  3JCM b;  4FCY A;  3CCR T;  4OP0 A;  3E19 A;  2EJ9 A;  1YCS B;  1WPY A;  2LRQ A;  4YTL A;  4C8Q G;  1RUW A;  4L59 A;  2ZPG B;  5HCK A;  1ZQ1 A;  2DVJ A;  2LT4 A;  2ZAE A;  1N8R R;  2LMJ A;  4X9C A;  2RO0 A;  3MEA A;  5C0M A;  1PNJ A;  2YHT A;  1BI0 A;  4IUV A;  1JXM A;  2KVQ G;  3VS6 A;  1O75 A;  3OBY A;  4JRK A;  4IUQ A;  2DYI A;  2E10 A;  4LDY A;  1W2B S;  1GFD A;  4X9D A;  4KUD K;  1B3Q A;  4QQD A;  4M77 D;  1OI1 A;  1WHH A;  2KRO A;  3MCA B;  1P92 A;  5J26 A;  4NS5 A;  5M9O A;  4PFP A;  2ROT A;  4XTU A;  3CME Q;  2GQI A;  1N6A A;  1N8R U;  1K76 A;  2JW4 A;  5CVI A;  2KRS A;  5KE3 A;  2KE9 A;  5EG2 A;  4X34 A;  5IN1 A;  2JUF A;  1B7T A;  1JJ2 S;  1RI0 A;  2DIQ A;  2SRC A;  4JRQ A;  1U8R A;  2DD5 A;  1EX4 A;  1GBQ A;  4E7H A;  2VKN A;  2L3S A;  1WIE A;  4AFQ C;  4GLM A;  4A4K A;  2CT4 A;  3ZFJ A;  5A0L A;  2COZ A;  2WSC E;  4AT1 B;  3GOX A;  1ZUK A;  1KQS P;  3LGF A;  1TOV A;  5LJ5 e;  4ANJ A;  2JZ2 A;  4M78 D;  1X27 A;  3F70 A;  2A08 A;  4Z88 A;  1NLO C;  1IHV A;  3CCL Q;  5A0D A;  2LX7 A;  4C8Q A;  4WF2 A;  3HSB A;  2JOY A;  3TRE A;  1M90 R;  1TWB A;  2QQ9 A;  2GGR A;  2RQR A;  2J6F A;  2DNU A;  2CP6 A;  2HKN A;  3H0F A;  5IHN A;  2JVV A;  1RAC B;  1YN8 A;  3KBG A;  3VUZ A;  4LDW A;  4II1 A;  2DO3 A;  4J5Y A;  1WZO A;  3CCV Q;  1AEY A;  1VA7 A;  2KYM A;  1TUG B;  3I56 T;  1T3S A;  2E4H A;  4FM4 B;  4OMF B;  1IB8 A;  2X4W A;  3JAM E;  3FRN A;  1I07 A;  1YFN A;  1I5O B;  4JZ4 A;  2K9G A;  1BYM A;  2LQW A;  2AIR B;  5GAO n;  3BDL A;  3WXM B;  4M78 C;  4KUL A;  2IG0 A;  5IT9 E;  1K9A A;  1I1J A;  2E70 A;  4EDU A;  2RQV A;  1YJW A;  4JRI A;  2DRK A;  1MUZ A;  3EG9 A;  3CCS Q;  4RTZ A;  1PG5 B;  3QBY A;  4LD9 K;  4C8Q E;  2MMP A;  5I2S A;  3MEU A;  3S3N A;  2LCC A;  2HL3 A;  1JU5 C;  2JTM A;  4LXC A;  4DEX A;  2F2W A;  1KK7 A;  1YWP A;  1BU1 A;  1WHK A;  3MP8 A;  3RMQ A;  4PKC C;  4E47 A;  1WJS A;  2G6F X;  2FYK A;  1BI2 A;  2VGN A;  2M1H A;  3INZ A;  1FMW A;  2BZY A;  3VKI A;  2FPE A;  3Q1J A;  2J05 A;  2PQW A;  2BKD N;  5LJ5 d;  1MHN A;  2XKO C;  4AMC A;  1Z9Q A;  5KCH A;  4N0A C;  1NEB A;  3M0U A;  3UAT A;  2M9U A;  2KGT A;  2DL3 A;  8AT1 B;  1PWT A;  2EAY A;  3G71 Q;  2X3X D;  4BB7 A;  5IXF A;  2DEQ A;  3S3O A;  3VS2 A;  4RTY A;  3PNW C;  2RB6 A;  5D6W A;  1UG1 A;  2DJQ A;  3CD6 T;  1XOV A;  3KXT A;  4M78 G;  5CKF A;  2OAU A;  1I5L A;  3J80 E;  1B07 A;  1M4Z A;  4OB1 B;  2D0N A;  2E5K A;  2DMO A;  5L23 A;  2DL7 A;  4GLK A;  3BY7 A;  3ZL7 C;  3L2V A;  2O4X A;  3GNF B;  1K8A C;  2DIG A;  4PJN A;  3QSU A;  3CXC S;  5KYX A;  3G4S Q;  1H3Z A;  1H3H A;  4E7L A;  1H92 A;  4Y28 E;  4BE2 A;  3FEO A;  3JB9 D;  1M2O A;  1RAD B;  1HK9 A;  3CPW A;  4AFZ C;  3RR6 A;  2RI2 A;  3LH5 A;  5CKD A;  4QVD A;  4J8O A;  4J9B A;  8ATC B;  4HVV A;  4KH1 B;  1EZZ B;  4C8Q B;  3LLR A;  3UPU A;  1VQM T;  4E7I A;  1AVZ C;  1MMD A;  2W10 A;  1WX6 A;  1VQN T;  3OW2 P;  4C0F A;  4KGV B;  2HEQ A;  1OX8 A;  2C0I A;  4KGZ B;  5CCA A;  5LJ5 f;  3QO3 A;  1PM3 A;  1PC0 A;  3HPW A;  2CP5 A;  2GFU A;  4HXJ A;  3TU4 K;  1NLP C;  3OYL A;  3LGL A;  1NPP A;  1JO8 A;  2COW A;  2F2X A;  2FL7 A;  4HT9 A;  1YJ9 A;  1VQ9 T;  2YUN A;  1Y96 A;  2IPO B;  1SRM A;  4FW2 A;  3LW5 E;  2MAM A;  3HFO A;  4LN2 A;  3VRZ A;  1WXU A;  4CC4 B;  4M78 A;  3CCV T;  1YI2 Q;  3H0H A;  4ATO A;  2JMC A;  2D8H A;  1R8O B;  3PT9 A;  5GAO q;  1PHT A;  1JQQ A;  1BK2 A;  4JJC A;  5KYU A;  4DOW A;  3A8H B;  1NJI R;  3VS1 A;  2QTX A;  4F04 B;  3ASK A;  2GNC A;  3NFC A;  4C0Z A;  2XU8 A;  2WAC A;  2LQ8 A;  3DB4 A;  3EG9 B;  3GP8 A;  1SSF A;  2BIV A;  2RJD A;  3RER A;  3EHR A;  1I81 A;  4M77 E;  4RMO A;  1RAE B;  2KDS A;  2VUB A;  2EVR A;  2CGH A;  4EMH A;  1U1S A;  3OYK A;  4PJO D;  3RDV A;  2BTT A;  4E7Z A;  2OTJ Q;  1VQL T;  3REB B;  2DTI A;  1VYV A;  2CKK A;  3RBB B;  4BE0 A;  4D6W A;  5GAN g;  1NJI U;  2YRC A;  4RUG A;  1S72 A;  1YIJ Q;  5D6Y A;  1XNI A;  1VQ4 Q;  5CKB A;  4HVU A;  3CCE Q;  3NTI A;  3E9F A;  2H3J A;  1JXO A;  3EH1 A;  1Q82 C;  1QP2 A;  4N0A A;  2V8I A;  2D9T A;  2M0O A;  4ORZ A;  1IHW A;  4LUD A;  2RK1 A;  2DBK A;  2EJG A;  1AWJ A;  3CC7 T;  2AK5 A;  3OSV A;  1AT1 B;  3QG1 A;  1PRM C;  3L2Q A;  4M78 E;  3JV3 A;  3M4Y A;  2RQT A;  5D7U A;  3D7S B;  2D6F A;  2NWM A;  1VIF A;  4M4Z A;  4QQG A;  3KFV A;  1VQO T;  3CD6 A;  4JJB A;  2Z0W A;  3DKM A;  5KE2 A;  1QVG P;  4F7U G;  2WSF E;  3AT1 B;  3JRZ A;  3R6N A;  1NYF A;  3G71 T;  4J9I A;  4LDU A;  1KHC A;  2MOX A;  3CCJ Q;  4BUG A;  2KBT A;  3QJY A;  4PJO C;  1M27 C;  1YP5 A;  4O6J A;  3OYB A;  1QCN A;  1NZ9 A;  2PNI A;  5GAO m;  2CZ1 B;  2O4X B;  2JT4 A;  2BE9 B;  5AYF A;  4A54 A;  5C6S A;  1KJW A;  2F2V A;  1DJ7 B;  4JLG A;  5CQX A;  5KYX B;  4C5E A;  1OZ2 A;  3CEY A;  3CCM T;  1MMG A;  1W70 A;  3OYN A;  3OBW A;  1QCF A;  4J6X A;  4OVA A;  4QW2 A;  1RI9 A;  1V1C A;  1Q81 R;  3G1J A;  5CKE A;  3G4S T;  4M77 F;  1YHQ T;  4FT4 A;  1VQM A;  4D8K A;  2SEM A;  5GAN j;  2VV5 A;  1VQN A;  4M77 B;  4J9G A;  3OYC A;  4QQ6 A;  4ZTJ A;  3PGG A;  1Q7Y R;  3EFO A;  2BZX A;  2JS2 A;  1VQ5 Q;  3L2Z A;  2DEU A;  5GJV B;  2QA4 T;  1VQ9 A;  1K73 C;  2QQA A;  2QEX T;  4OMM A;  3DLL A;  2DXC A;  4Z02 A;  3EG1 A;  4J6Y A;  3MJX A;  3R6O A;  4F7U A;  5GAN 3;  1J3T A;  3UWN A;  2B86 A;  1Y96 B;  2JXB A;  1VIE A;  3CCQ Q;  4NL3 A;  2DFU A;  1SKU B;  3OMC A;  3WVD B;  1CSK A;  2KI7 A;  4QT7 A;  1Q82 U;  4M78 B;  2X4Y A;  4M7A F;  4NOY A;  1BI3 A;  4CRI A;  4PJO G;  4OB3 B;  1WNL A;  4AFU C;  4R56 A;  2EYY A;  1IO6 A;  3CC2 Q;  5KYU B;  2L0A A;  5FU6 C;  2QQB A;  3CCU Q;  2DRM A;  4PJJ A;  2QGG A;  1YJN Q;  1WQW A;  3CC4 Q;  2EQI A;  2P0Q A;  5D6X A;  1M9S A;  4E7K A;  2OTL Q;  2JNG A;  2EYQ A;  1FWZ A;  2MPX C;  1BIB A;  2MCN A;  1Y07 A;  3LYI A;  1YIT T;  3ME9 A;  1VQL A;  3OYY A;  4FSX A;  1OOT A;  2O2O A;  2HQH A;  1FX7 A;  2CH4 A;  1WHL A;  3VYG A;  1H8K A;  1QCO A;  2QQR A;  1D0Y A;  1IXD A;  4HCK A;  2LX9 A;  5GAO p;  3DB3 A;  4FSS A;  1Y7X A;  4CC7 A;  2Y4X A;  5KH6 A;  1VYU A;  3OSS C;  1OPK A;  4HKE A;  1WXT A;  1Q86 C;  3GPL A;  3GLX A;  1VQ8 T;  2ZZD A;  2K57 A;  2V1Q A;  2RA2 A;  2FB7 A;  5GAN h;  3CC7 A;  1AZG B;  4A4G A;  2E5Q A;  2AKK A;  2DL8 A;  4F7U E;  1AZE A;  1KG1 A;  1VQ4 T;  2VC8 A;  3MEV A;  1UFF A;  3CCE T;  3TCJ A;  1VQO A;  3N5B B;  2F5T X;  5GAM g;  4LD6 A;  3FIF A;  3CMA Q;  4IKF A;  3KUF A;  3JCM g;  3H41 A;  4OMP A;  1S1N A;  1VQ6 Q;  2BZ8 A;  2E6N A;  6AT1 B;  3H9N A;  2RF0 A;  3QJ6 A;  2OI3 A;  3JCM P;  2HSE B;  5HY6 A;  2JTF A;  1VQP Q;  4JPB W;  4PJO A;  2YLC A;  3L1A A;  2EQK A;  1TTH B;  2ZPI B;  2KYB A;  3PFS A;  5GAN e;  1M1F A;  3E9G A;  2K5I A;  4M7A D;  1K73 U;  4BD3 A;  2DD4 A;  1G3T A;  2KAF A;  3M0T A;  1K9M C;  1JBM A;  2EQU A;  4PLI A;  1AWO A;  5HK3 A;  1PSE A;  4M77 C;  2YRD A;  3CCM A;  2E41 A;  2QG9 B;  2EKH A;  2F69 A;  1YHQ A;  4DA4 A;  3VS4 A;  4F16 A;  3I9Q A;  2ECZ A;  2HDA A;  4HT8 A;  2M02 A;  2XG8 D;  3A8M B;  4N4G A;  2PZ1 A;  2QK0 A;  5A2Q E;  1GCP A;  2PTK A;  1SRL A;  1ZUY A;  4FYX B;  3QDR B;  1D0Z A;  5AT1 B;  2OJ2 A;  1JRI A;  2DA9 A;  2EYX A;  1X01 A;  3I55 T;  3HKS A;  3A5Z B;  1ABO A;  2GQV A;  2VXE A;  2A28 A;  1GCQ C;  2XHC A;  4RCB A;  2QA4 A;  5FRM A;  2LJ3 A;  4BY6 B;  4JS4 A;  2QEX A;  4J9C A;  2DVE A;  2AZV A;  1CKB A;  1VOM A;  3TEE A;  2F5K A;  3EFO B;  1PSF A;  4OMN A;  4DBH A;  4XTX A;  2YUO A;  5GAM j;  1LPL A;  1KD1 C;  3M9Q A;  3UT1 A;  2DXU A;  3OYE A;  2CP3 A;  2RN8 A;  4F7U F;  4Y91 A;  4M7A C;  4PJO E;  2K3B A;  4DBQ A;  4L5G A;  3L2U A;  5GAN 2;  5GAN 4;  3JB9 F;  4F7U B;  3HHT B;  5I21 A;  3OW2 S;  1VQ7 Q;  2J06 A;  1RAH B;  5FLX E;  3VU3 C;  1RL2 A;  2M51 A;  3M58 A;  3CCR A;  1U06 A;  1WHM A;  4A53 A;  4KGX B;  4Z89 A;  1X75 C;  1BCO A;  2CUD A;  5FW9 A;  5LJ3 g;  2QGF B;  2K5F A;  1OUL A;  1IGU A;  2YWW A;  3NHN A;  3OQ5 A;  2L3Q A;  4M77 G;  2FEI A;  2EJF A;  1YIT A;  2LCL A;  1TG0 A;  3JB9 J;  3CQT A;  1M1K C;  4QVZ A;  2X3W D;  3SDZ A;  4HCB A;  2RHX A;  4OMO A;  3P8D A;  2RQU A;  1MV3 A;  2FRY A;  3SWN C;  2DER A;  4C5H A;  2NLU A;  2OTL T;  1M3B A;  3V8J A;  3UA7 A;  2KRN A;  2K3X A;  1VQ8 A;  2HL5 C;  4OB2 B;  4V2S A;  1WJQ A;  1M2V A;  1M5Q 1;  1VYT A;  4M75 D;  2FG0 A;  3H6Z A;  3RNJ A;  4PK4 A;  2E3I A;  2BUD A;  1MMN A;  3VUB A;  2QDL A;  1QVF S;  3PMT A;  3GF5 A;  5EC7 A;  1QKW A;  3FDR A;  1EIF A;  2L8D A;  4ZGD B;  1PKS A;  2RD1 A;  2D0Q B;  1E6H A;  2KNB B;  1G3S A;  3CME T;  1UGR B;  4M7A G;  5L8R E;  3M54 A;  2CH4 W;  2MWP A;  5GAM h;  2DK3 A;  3BFM A;  3GIB A;  3OS0 A;  2JTE A;  2DYB A;  3JCM h;  3CMA T;  2P84 A;  2KXD A;  4J9H A;  4XAX B;  4ESR A;  3VS5 A;  1ZBX A;  2LT1 A;  4PJO F;  2HAX A;  2LP5 A;  3PTA A;  1VQ6 T;  1D1C A;  2YUP A;  2AKL A;  1WI7 A;  4FL6 A;  4PJO B;  3S3M A;  4FYV B;  3SEM A;  5LJ3 j;  5KCO A;  1YNZ A;  2G3R A;  2YXY A;  3ZEH A;  1VQP T;  2CP2 A;  4M77 A;  3HRT A;  1LJO A;  1YCY A;  1TXQ A;  2JMA A;  4M75 C;  2EKO A;  4ZN3 A;  1QVG S;  3JB9 I;  3UF4 A;  3X28 B;  1W2B A;  2K79 A;  3M0P A;  5CQY A;  5GAN 7;  3CCL T;  1SF9 A;  4LDX A;  2K3Y A;  4JLI A;  3A8O B;  4BY6 C;  3QUI A;  2J6O A;  2RHI A;  2EQJ A;  2KT8 A;  3A98 A;  2HSP A;  2O88 A;  2DL5 A;  1BKB A;  3I56 A;  2JJ9 A;  5GAO l;  3I55 A;  1AD5 A;  2RJE A;  5KYY A;  3JCM e;  1MV0 B;  4XK8 E;  2KXC A;  5GAN f;  4ME7 A;  3VRY A;  1GCQ A;  1QMC A;  1U1T A;  3QDF A;  1G5V A;  1JJ2 A;  3OYA A;  2RMO A;  1Y0M A;  1OQK A;  4RTT A;  2L5Q A;  1R0C B;  3RES A;  1YJW Q;  4FU6 A;  5GMK j;  3LWH A;  4M7A A;  1AWX A;  1RLP C;  1TS9 A;  3M56 A;  4E7J A;  5FWC A;  2COY A;  1W4S A;  1KHI A;  3OYM A;  5CK9 A;  1K8A R;  2LJ1 A;  3EG3 A;  1ZSZ C;  1G2B A;  4KRT A;  1D3B B;  4WCI A;  2RPN A;  3C0C A;  2DAQ A;  4UC4 A;  1TUD A;  2KK4 A;  1X2Q A;  1QVF P;  3RKY A;  1HYO A;  2D1X A;  3JCM Q;  2EQM A;  3CCS T;  3X25 B;  1V29 B;  2GCX A;  3M5A A;  1KSW A;  1EFN A;  2HD0 A;  4KH0 B;  4LE9 A;  2RHY A;  5FU6 B;  4M75 G;  5GAN 6;  2C06 A;  3JSC A;  4MDX A;  3RMS A;  5J3B A;  4IIO A;  5IXB A;  3FLG A;  3MPU B;  1KQ1 A;  5LJ3 h;  3EGX A;  5IH2 A;  1D09 B;  1K8A U;  3SWN A;  3CPF A;  2O31 A;  1Y71 A;  5GMK m;  4M7D D;  4PJM A;  2MIO A;  1ZX6 A;  4J9D A;  2K6D A;  4WTO B;  2H3E B;  3QXE B;  2AHJ B;  2FPD A;  4MZP A;  4JJN K;  4JDS A;  2EGC A;  1KC8 C;  2X9H A;  2E12 A;  1M2V B;  2D8J A;  1XQH A;  5FU7 C;  2M16 A;  2DLP A;  4M7A E;  2KMT A;  2HQE A;  5CR2 A;  2J7I A;  1U3O A;  1R77 A;  4RTX A;  2JS0 A;  3LWI A;  3CME A;  3FJ5 A;  3MET A;  2MWO A;  1Q95 G;  3A1P A;  3JB9 G;  2PUO B;  1ZHI A;  2PVO B;  4BI8 B;  2VGM A;  5LJ3 e;  4PL6 A;  2H8H A;  3LX7 A;  1OEB A;  1UE9 A;  2A3L A;  1JEG A;  3QII A;  3MP1 A;  3RKW A;  3JCM d;  1NPR A;  4XTZ A;  2P0P A;  1YBY A;  4MDW A;  1QWE A;  2ZGW A;  2Y4Y A;  2I0N A;  3HP9 A;  2CP7 A;  4ZTF A;  2IIM A;  2RHZ A;  3OS1 A;  1UGP B;  4R0K A;  5GAO r;  2XIC A;  4C0G A;  4M7D C;  4LNP A;  2DTO A;  4F14 A;  3OY9 A;  4M75 A;  2FO0 A;  3CBM A;  4KUI A;  1JB0 E;  4JZ3 A;  3VJP A;  3M0Q A;  3CCL A;  2JN0 A;  1N8R C;  2QI2 A;  2NUT A;  2RJF A;  3T9N A;  5LJ5 j;  3J81 E;  1Q82 R;  2QQS A;  1X2K A;  4C92 F;  2NUP A;  4EMK C;  2E64 A;  3QZ9 B;  2DJZ A;  1M3C A;  3PVL A;  1RAG B;  1YJ9 Q;  2CSQ A;  2DZ9 A;  2GTJ A;  1BBZ A;  2XDP A;  5KYY B;  1WGS A;  1WHG A;  3NTK A;  2ATC B;  3P8B B;  4DBR A;  3CCV A;  2ZPH B;  4PFZ A;  3REA B;  1H64 1;  5FWB A;  2KR3 A;  2EYW A;  1I4K 1;  3VS7 A;  2OX7 A;  1RAA B;  3MO8 A;  3C94 A;  2R57 A;  2JM8 A;  3I5S A;  2EIF A;  1IZ6 A;  2DKG A;  4K11 A;  1UHC A;  5GAM f;  4E7S A;  1FMV A;  1WLP B;  3FB9 A;  3SFM A;  3NGP A;  3CXC A;  2KRM A;  1ACM B;  4MZT A;  1QW1 A;  3JCM f;  4M7A B;  1ZSZ A;  1YI2 T;  1YJW T;  1M30 A;  2CP0 A;  3THK A;  1KC8 U;  4OF1 A;  4DOV A;  1VQK Q;  1SEM A;  2FPF A;  4M75 E;  4F17 A;  3CCS A;  3ZBD A;  3H8Z A;  4GBQ A;  2CZ7 B;  3NPF A; 
#chains in the Genus database with same CATH homology
 4M7D G;  2F5K A;  3JCM J;  3JB9 H;  1PSF A;  2RI2 A;  4XTX A;  3V7C A;  3G7Z A;  5GAM j;  3EFR A;  1KD1 C;  1LNX A;  5CKD A;  4QVD A;  2LTO A;  3M9Q A;  4J8O A;  3UT1 A;  2DXU A;  3GNG A;  3JCM V;  3OYE A;  3OW2 A;  4ZN1 A;  5GAM d;  3OS5 A;  2X4J A;  5LJ3 d;  2P4T A;  4TVR A;  4F7U F;  4Y91 A;  4ELY C;  3CPW S;  2O01 E;  4C8Q B;  4KBM B;  1M90 C;  4M7A C;  4PJO E;  1WJR A;  3LLR A;  3UPU A;  2V8J A;  1VQM T;  3QPH A;  4L5G A;  3CMA A;  4E7I A;  5GMK h;  3L2U A;  3JCM W;  5GAN 2;  5GAN 4;  3JB9 F;  1HK9 A;  3HHT B;  5I2M A;  4F7U B;  5I21 A;  5GAN 5;  1VQ6 A;  2OTJ T;  3OW2 S;  3QHS A;  1VQN T;  2DXB A;  2KSS A;  3V8L A;  4BI3 A;  5FLX E;  3S6W A;  4C0F A;  4JS5 A;  2HBP A;  5DY9 A;  5LL6 S;  5LJ5 f;  2X35 A;  5CCA A;  3V7S A;  3SWN B;  3VU3 C;  5HK0 A;  4J83 A;  4OGE A;  3QO3 A;  4MML A;  2XDD A;  1RL2 A;  3HPW A;  3M58 A;  3CCR A;  5CO7 A;  4IUU A;  2GFU A;  2R58 A;  2ZPB B;  1YIJ T;  3LH0 A;  5HKC A;  5LJ5 h;  1VQP A;  4NL2 A;  4J7I A;  4N4I A;  4A53 A;  4C92 D;  3TU4 K;  1X75 C;  3OYL A;  3LGL A;  1NPP A;  3PIP A;  4BDZ A;  1X6O A;  5LJ3 g;  3BW1 A;  5DM7 R;  2FL7 A;  4HT9 A;  1YJ9 A;  2R5A A;  1VQ9 T;  2K5F A;  4R55 A;  3OA6 A;  1Y96 A;  4C8Q C;  3OQ5 A;  4M77 G;  3A8G B;  2RH2 A;  2EJF A;  4KT0 E;  1YIT A;  2LCL A;  2MAM A;  1N9R A;  3LW5 E;  3JB9 J;  4ELZ C;  3HFO A;  1B34 A;  3JCM c;  1M1K C;  4QVZ A;  3G71 A;  3CBO A;  4BE1 A;  3VV0 A;  1UEB A;  4M78 A;  3SDZ A;  4HCB A;  2RHX A;  3CCV T;  3P8D A;  4ATO A;  2KY9 A;  3O8V A;  1R8O B;  3SWN C;  4C5H A;  2GFA A;  2NLU A;  3PT9 A;  5GAO q;  4O5V A;  2OTL T;  2WSE E;  5GMK e;  2QXF A;  3V8J A;  4DOW A;  2K3X A;  3OMG A;  3A8H B;  1VQ8 A;  5CIU A;  2Y90 A;  2HQX A;  4OB2 B;  3JCM X;  3HRS A;  4V2S A;  4C92 B;  3OYJ A;  1WJQ A;  1QVF A;  1M5Q 1;  2PUK B;  2QTX A;  3QYH B;  1O9S A;  4M75 D;  3H6Z A;  3ASK A;  2L3R A;  3OS2 A;  3NFC A;  3QKJ A;  5FRO A;  1OYX A;  2XU8 A;  2WAC A;  4C0Z A;  4J7F A;  2LQ8 A;  5GMK i;  3C12 A;  1KQS S;  2BUD A;  3DB4 A;  2P0K A;  2R5M A;  3TEE A;  3VUB A;  3GP8 A;  4A4E A;  1SSF A;  2BIV A;  2RJD A;  3FJP A;  4FIB A;  3URG A;  3G6E A;  3CCJ T;  3RER A;  1I81 A;  3C95 A;  4M77 E;  1QVF S;  3PMT A;  3GF5 A;  2DTH A;  3M53 A;  4RMO A;  3L2R A;  4HCC A;  4M7D A;  3SD4 A;  4A4H A;  2KDS A;  1QVP A;  2VUB A;  3G4S A;  4B9W A;  3V7R A;  3FDR A;  4XTV A;  1EIF A;  2RI3 A;  3HRU A;  2DPP B;  2CGH A;  2L8D A;  4EMH A;  4ZGD B;  1QP3 A;  1U1S A;  3ER0 A;  3OYK A;  2VYT A;  2RD1 A;  2D0Q B;  4PJO D;  1NE8 A;  4M75 F;  1VUB A;  3WVE B;  3AHU A;  2PVD B;  1G3S A;  1Q81 U;  1VQL T;  3HFN A;  3CME T;  2XDB A;  5LJ3 f;  2DTI A;  2CKK A;  3CBP A;  4C92 C;  1UGR B;  4M7A G;  5L8R E;  3X20 B;  4BE0 A;  4D6W A;  3M54 A;  5GAN g;  4M75 B;  4C5I A;  5DLQ E;  1NJI U;  2MWP A;  2MI6 A;  5GAM h;  1S72 A;  4M78 F;  2DK3 A;  4XTW A;  5D6Y A;  2HNI A;  3BFM A;  1XNI A;  3PMI A;  5CKB A;  3GIB A;  3RUX A;  3NTI A;  3E9F A;  2H3J A;  3HL8 A;  3OS0 A;  4EMK A;  4FT2 A;  3JCM h;  1Q82 C;  1QP2 A;  3CMA T;  3VYH B;  1Q7Y U;  4XAX B;  4BI4 A;  2DZC A;  4N0A A;  2V8I A;  4PNO A;  1ZBX A;  2D9T A;  2LT1 A;  2M0O A;  2K2V A;  4IUT A;  4PJO F;  2HAX A;  4XU3 A;  3PTA A;  1VQ6 T;  1OZ3 A;  2RK1 A;  2ZPF B;  3C4S A;  2EJG A;  1VQ7 A;  3PIO A;  3CC7 T;  1QVG A;  4P5N A;  4ZGJ B;  2LVM A;  1XTD A;  3OSV A;  4FL6 A;  3JCM b;  3QG1 A;  4RCC A;  4PJO B;  3L2Q A;  2LDM A;  4M78 E;  5IAY A;  3S3M A;  3CCR T;  4OP0 A;  3E19 A;  2EJ9 A;  4A4F A;  5KCO A;  5LJ3 j;  1WPY A;  2LRQ A;  3M4Y A;  2G3R A;  4YTL A;  2D6F A;  3ZEH A;  4C8Q G;  4XTY A;  1VQP T;  4L59 A;  4M77 A;  3HRT A;  1LJO A;  2ZPG B;  1VIF A;  4CI0 C;  1YCY A;  4QQG A;  1VQO T;  1ZQ1 A;  3CD6 A;  1VQ5 T;  4M75 C;  2EKO A;  2LT4 A;  4ZN3 A;  1QVG S;  2LNV A;  1YJ9 T;  3DKM A;  5KE2 A;  1D3B A;  2RJC A;  4F7U G;  3JB9 I;  1M90 U;  4X9C A;  2WSF E;  3JRZ A;  3X28 B;  1W2B A;  5J39 A;  2RO0 A;  1Q86 U;  3MEA A;  5CQY A;  5C0M A;  5GAN 7;  3CCL T;  2YHT A;  1BI0 A;  4XU1 A;  4C0D B;  4IUV A;  4LDX A;  3G71 T;  2KVQ G;  1GXI E;  2K3Y A;  4JLI A;  3A8O B;  4BY6 C;  3QUI A;  4LDU A;  1O75 A;  3OBY A;  4JRK A;  1KHC A;  2EQJ A;  2RHI A;  3E1S A;  4IUQ A;  1YI2 A;  3L2W A;  4BUG A;  2E10 A;  4LDY A;  1W2B S;  1BKB A;  3I56 A;  5GAO l;  3QJY A;  3I55 A;  2RJE A;  4MZM A;  4PJO C;  3JCM e;  3CCQ T;  4X9D A;  4M7D E;  4KUD K;  4XK8 E;  4O6J A;  2DXT A;  5GAN f;  3OYB A;  4QQD A;  4M77 D;  1OI1 A;  3MCA B;  1NZ9 A;  4ME7 A;  1P92 A;  5J26 A;  5GAO m;  4NS5 A;  2CZ1 B;  5M9O A;  3X26 B;  2O4X B;  1U1T A;  1G5V A;  5AYF A;  1JJ2 A;  4XTU A;  3OYA A;  4A54 A;  5C6S A;  4IUR A;  1DJ7 B;  4GY5 A;  3MP6 A;  1N6A A;  4JLG A;  5CQX A;  3CC2 T;  1M1G A;  1N8R U;  4C5E A;  1M8V A;  5CVI A;  1OZ2 A;  3CEY A;  2L5Q A;  3CCM T;  3CCU T;  3RES A;  5KE3 A;  3OYN A;  3OBW A;  4J6X A;  5EG2 A;  4OVA A;  4QW2 A;  4FU6 A;  4X34 A;  5IN1 A;  4OB0 B;  5GMK j;  2JUF A;  1YJN T;  5CKE A;  1JJ2 S;  3CC4 T;  5FRN A;  1RI0 A;  2DIQ A;  3G4S T;  4JRQ A;  4M77 F;  1VQK T;  3LWH A;  1YHQ T;  4FT4 A;  2DD5 A;  1VQM A;  1U8R A;  4C92 G;  1KQS A;  4E7H A;  4M7A A;  3MHX A;  3RKX A;  5GAN j;  4C5G A;  3M56 A;  4E7J A;  1N27 A;  2VV5 A;  1W4S A;  1KHI A;  4A4K A;  2OTJ A;  3OYM A;  5CK9 A;  1VQN A;  4M77 B;  3OYC A;  1UGS B;  3ZFJ A;  5GAN d;  4QQ6 A;  4ZTJ A;  2K4Y A;  2CZ0 B;  5A0L A;  3PGG A;  2RHU A;  2WSC E;  3M59 A;  4JUV A;  2XI9 A;  1D3B B;  3V8K A;  3GOX A;  1S72 T;  3LGF A;  5LJ5 e;  2IVW A;  2DAQ A;  4UC4 A;  4L6V 5;  1YIJ A;  1K9M U;  3BDU A;  2JZ2 A;  1VQ4 A;  2KK4 A;  4M78 D;  3CCE A;  3L2Z A;  3QYG B;  3RKY A;  3F70 A;  2EQM A;  4N4H A;  5CKH A;  3JCM Q;  1G3Y A;  2E65 A;  3X25 B;  3CCS T;  4VUB A;  2QA4 T;  1V29 B;  1VQ9 A;  2GCX A;  1K73 C;  2QQA A;  2HD0 A;  3EAE A;  3M5A A;  2QEX T;  2RHY A;  5A0D A;  4PLL A;  5FU6 B;  4C8Q A;  4WF2 A;  3EFS A;  2DXC A;  2QDY B;  3DLL A;  2XID A;  3HSB A;  4M75 G;  4Z02 A;  5GAN 6;  2C06 A;  2JOY A;  3TRE A;  4J6Y A;  3JSC A;  5FU7 B;  3RMS A;  3R6O A;  5J3B A;  4F7U A;  5GAN 3;  3QZ5 B;  4MDX A;  3M57 A;  2ZCF B;  2QQ9 A;  3FLG A;  3UWN A;  5GMK l;  1KQ1 A;  1Y96 B;  5LJ3 h;  3DLM A;  1VIE A;  3J7A F;  4NL3 A;  3SWN A;  1K8A U;  3RIR A;  3OMC A;  5GAN 8;  3WVD B;  1B34 B;  2JVV A;  3CPF A;  1Y71 A;  5GMK m;  4XU0 A;  1Q82 U;  4M78 B;  2X4Y A;  3KBG A;  2ZPE B;  5DLO A;  4M7D D;  3VUZ A;  4M7A F;  1HXD A;  2E1H A;  4LDW A;  4NOY A;  1BIA A;  1IRE B;  4II1 A;  1BI3 A;  4RG2 A;  2KQW A;  4OB3 B;  4PJO G;  1WNL A;  4CRI A;  1NJI C;  3QXE B;  2AHJ B;  4R56 A;  4MZP A;  2DO3 A;  4J5Y A;  4JJN K;  5FU6 C;  2QQB A;  3CCJ A;  4JDS A;  1WQ7 A;  4IUP A;  3I56 T;  1KC8 C;  1KD1 U;  4FM4 B;  4OMF B;  2E12 A;  2X4W A;  3JAM E;  4QVC A;  3OYH A;  1XQH A;  2L89 A;  1WQW A;  3FRN A;  5D6X A;  2P0Q A;  5FU7 C;  1M9S A;  4E7K A;  2JNG A;  2RI5 A;  2M16 A;  1AHJ B;  2EYQ A;  4J6W A;  1FWZ A;  1MGQ A;  4DQ2 A;  1BIB A;  4M7A E;  2KMT A;  2HQE A;  5CR2 A;  4M7D F;  1BYM A;  1Y07 A;  3L42 A;  3LWI A;  4RG8 A;  3LYI A;  5GAO n;  5CAI A;  1YIT T;  2E6Z A;  3BDL A;  3ME9 A;  1UGQ B;  3NTH A;  3OYY A;  4FSX A;  3CME A;  1VQL A;  3WXM B;  1FX7 A;  2MWO A;  2GF7 A;  3MET A;  4M78 C;  3VYG A;  4C8Q F;  4BDY A;  3JB9 G;  2YRV A;  2PUO B;  4M7D B;  1ZHI A;  2QQR A;  2CYZ B;  2PVO B;  4KUL A;  4C92 A;  2IG0 A;  5GAM e;  5IT9 E;  4BI8 B;  2VGM A;  5LJ3 e;  5GAO p;  2E70 A;  2LX9 A;  3DB3 A;  4MMK A;  4EDU A;  1YJW A;  1Y7X A;  1N9S A;  4PL6 A;  3LX7 A;  4JRI A;  2A3L A;  2Y4X A;  5KH6 A;  2B8A A;  3OSS C;  3QII A;  4HKE A;  3MP1 A;  3RKW A;  3JCM d;  1Q86 C;  1NPR A;  3GPL A;  3GLX A;  1VQ8 T;  4XTZ A;  2P0P A;  1YBY A;  4MDW A;  2ZZD A;  1I8F A;  3QBY A;  2K57 A;  2ZGW A;  2Y4Y A;  2RA2 A;  4LD9 K;  2FB7 A;  4C8Q E;  2MMP A;  5I2S A;  3MEU A;  5GAN h;  3FC3 A;  3CC7 A;  4A4G A;  3HP9 A;  3S3N A;  2E5Q A;  2LCC A;  2K5L A;  3MEW A;  4EMK B;  4ZTF A;  2RHZ A;  1LOJ A;  3OS1 A;  4F7U E;  4HCZ A;  1UGP B;  5GAO r;  3G6E T;  4C0D C;  1M1K U;  2JTM A;  4B9X A;  1VQ4 T;  1KG1 A;  2XIC A;  4C0G A;  4M7D C;  2VC8 A;  2EFI A;  3MEV A;  3CCE T;  3TCJ A;  1VQO A;  3N5B B;  2F5T X;  3MP8 A;  5GAM g;  1VQ5 A;  2DTO A;  3RMQ A;  1BI1 A;  4LD6 A;  4M75 A;  3FIF A;  3OY9 A;  4PKC C;  4E47 A;  3CBM A;  2X4X A;  1FXX A;  4IKF A;  1WJS A;  4KUI A;  5A0G A;  2FVU A;  1JB0 E;  4EPC A;  3KUF A;  3JCM g;  4BAC A;  3VJP A;  2FYK A;  1BI2 A;  3CCL A;  2E6N A;  2JN0 A;  2VGN A;  1N8R C;  2M1H A;  3INZ A;  3OYD A;  3QJ6 A;  3X24 B;  4EMG A;  2QI2 A;  1G3W A;  2RJF A;  3A8L B;  4OGC A;  3T9N A;  3VKI A;  5LJ5 j;  3J81 E;  3OYI A;  3JCM P;  2QQS A;  5HY6 A;  2JTF A;  4C92 F;  3OYG A;  3Q1J A;  2PQW A;  2BKD N;  4EMK C;  4Q5W A;  5LJ5 d;  2E64 A;  3QZ9 B;  1MHN A;  2XKO C;  3CCQ A;  2DJZ A;  3P8H A;  4PJO A;  2YLC A;  4XQ3 A;  3L1A A;  5KCH A;  4N0A C;  2EQK A;  3UDC A;  2VXF A;  2DZ9 A;  2ZPI B;  3PFS A;  5GAN e;  1M1F A;  2M9U A;  3E9G A;  2K5I A;  4M7A D;  1K73 U;  4RKU E;  1VQ7 T;  4BD3 A;  2DD4 A;  2A7Y A;  2MF2 A;  1G3T A;  2XDP A;  2EAY A;  2KAF A;  1WGS A;  4BB7 A;  2DEQ A;  1K9M C;  1JBM A;  3S3O A;  2EQU A;  4PLI A;  4C92 E;  3NTK A;  3P8B B;  3PNW C;  2RB6 A;  5HK3 A;  3CC2 A;  2RK2 A;  2ZPH B;  5D6W A;  1PSE A;  4M77 C;  3CCU A;  3CCV A;  3CCM A;  1H64 1;  2CZ6 B;  4ZGE B;  1I4K 1;  3CD6 T;  1YJN A;  2E41 A;  2F69 A;  1XOV A;  2R57 A;  3C94 A;  3MO8 A;  1VQK A;  2OTL A;  3CC4 A;  4XU2 A;  2YLB A;  3KXT A;  4DA4 A;  4M78 G;  1YHQ A;  1UB4 A;  5CKF A;  2EIF A;  1KQ2 A;  5LJ5 g;  2OAU A;  1IZ6 A;  2DKG A;  1I5L A;  3J80 E;  1M4Z A;  4OB1 B;  1Q81 C;  4HT8 A;  3M4G A;  2XG8 D;  3A8M B;  4HA8 A;  4N4G A;  5GAM f;  5A2Q E;  3FB9 A;  3SFM A;  3CXC A;  2XD0 A;  4JRP A;  1TH7 A;  2V8K A;  4GLK A;  4LDV A;  4MZT A;  3BY7 A;  1QW1 A;  2CS7 A;  3QDR B;  3M55 A;  2O4X A;  3GNF B;  3JCM f;  4C8Q D;  3L2V A;  4M7A B;  1YI2 T;  1JRI A;  1YJW T;  1K8A C;  2PVG B;  2DIG A;  2I2L A;  2FHD A;  1X01 A;  3I55 T;  3HKS A;  3A5Z B;  1KC8 U;  1Q7Y C;  4OF1 A;  3QSU A;  4DOV A;  3OYF A;  3CXC S;  3SB2 A;  2GQV A;  2VXE A;  4M75 E;  3CCS A;  1H3Z A;  4RCB A;  2XHC A;  2QA4 A;  3ZBD A;  4E7L A;  5FRM A;  3H8Z A;  4BY6 B;  2CZ7 B;  2PU9 B;  4Y28 E;  2XK0 A;  4JS4 A;  4BE2 A;  2QEX A;  3FEO A;  2LQK A;  2DVE A;  2EWN A;  2RM4 A;  3JB9 D;  2LC4 A;  3CPW A;  3OB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...