4X9CA

1.4a crystal structure of hfq from methanococcus jannaschii
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
PNFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDYIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Uncharacterized protein MJ1435
publication title Characterization of RNA-binding properties of the archaeal Hfq-like protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 10
structure length 57
sequence length 57
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4x9cA00
2EJFA 5GAN4 3QSUA 4M78E 4RCBA 4XU1A 4JRIA 3JCMP 3JCMQ 5GMKm 5GMKe 3QHSA 2RM4A 1N9RA 5GAMh 1U1TA 4C8QF 5LJ5h 3V7RA 4F7UE 4C92F 4OP0A 2DZ9A 2YLBA 2Y90A 3BY7A 4M7AD 1TH7A 4M75F 4C8QC 1I5LA 1WQWA 4MMLA 5GANf 4M7DD 2HNIA 3V7CA 4M7DG 1LNXA 3FJPA 4XU2A 4N0AA 3JCMc 4C92C 4NL3A 4M7AA 4M75C 5CAIA 4XTZA 1HXDA 2E10A 3V7SA 1B34A 2EAYA 5LJ3j 2JN0A 4JLIA 4JUVA 4M77D 1YCYA 3SWNA 3V8JA 4EMHA 4HT9A 5GAOq 4J6YA 4HT8A 5LJ3d 2EJ9A 1N9SA 4X9DA 4F7UF 4M77A 4QVCA 2ZGWA 3JCMb 3JCMh 1M8VA 3JB9D 3JCMf 3EFRA 4EMKA 5GAMf 5LJ5f 2DEQA 5GAN6 1HK9A 2RA2A 4XTVA 5GAN8 4M7AG 3L2ZA 1I8FA 2VXFA 5GAMj 5LJ3e 4XTYA 5LJ5j 2EWNA 4C8QD 5GAN5 3QO3A 3JCMJ 1B34B 4M7DB 2RD1A 2VC8A 3RERA 2DVEA 4C92D 2DXTA 3HFOA 5GAOp 4A54A 5GAMd 5GANj 4M75D 5LJ5d 1JRIA 4C8QA 3BDUA 3HFNA 2E65A 4XQ3A 4PJOD 3SB2A 1Y96A 4C92A 1I4K1 3JB9H 4M77G 5LJ3g 5GANd 1H641 4M75A 3PGGA 4M77B 5GMKh 2I2LA 1MGQA 3EFSA 3JCMW 4PJOA 4M78D 3RKWA 3AHUA 4M78G 4M7DF 1U1SA 3JB9J 2E64A 4J5YA 4A53A 1X01A 2DJZA 2E1HA 4M78A 3JB9G 2FB7A 3HSBA 4M7DC 4XTUA 1I81A 4HA8A 5DY9A 2DZCA 4V2SA 2YLCA 4M77F 4M7DE 1WNLA 4JRKA 4F7UA 5GANe 2EJGA 4M7AB 3VU3C 2DTHA 4C8QG 4M77C 3JCMV 4C8QB 3FIFA 2DKGA 3JCMd 3INZA 4J6WA 4C92G 5LJ5g 5GAMg 1WQ7A 1Y96B 3QUIA 4M77E 4C92B 3RIRA 4M75G 1LJOA 2K57A 3SWNB 5I21A 4J6XA 5GAOl 5GAN3 4M75B 5GAN7 4PJOG 1KQ2A 1D3BA 2VXEA 1LOJA 2QTXA 3RESA 5GANg 4PJOB 2DTIA 4XTWA 3RKYA 5GAOr 2RB6A 3BFMA 4X9CA 3BW1A 1KQ1A 2CGHA 1JBMA 3RUXA 4XTXA 4Y91A 2DTOA 5GMKl 3RKXA 2YHTA 1WPYA 4M78B 4N0AC 4WF2A 4DQ2A 4EMKB 3V8LA 5GAN2 4M7AC 4EMKC 2DXUA 5GMKj 3JCMe 3JB9I 5GANh 5GAMe 4NL2A 5LJ3h 2FYKA 4F7UG 4PJOF 5LJ5e 4M7AE 5LJ3f 4F7UB 3M4GA 3SWNC 4C8QE 4M7AF 3FB9A 5GMKi 4C92E 1BIAA 4NOYA 4XU3A 4MMKA 4M7DA 4M78F 4PJOC 3V8KA 4M75E 3JCMg 3JCMX 1BIBA 4EMGA 4PJOE 4XU0A 5GAOm 4QVDA 1D3BB 2E41A 3L1AA 4RCCA 4M78C 5GAOn 1M5Q1 3GIBA 3JB9F 4PNOA
chains in the Genus database with same CATH superfamily
4IIMA 3OQ5A 2C0TA 4B6MA 4BE2A 4F7UE 4C92F 1MMGA 3T9NA 3G4SA 3M0TA 3QDFA 3V7CA 1H3ZA 1VOMA 3CCQQ 2ECZA 4E7ZA 2JTEA 1MMDA 4EMHA 5GAOq 3CCVA 3G71A 4X9DA 1D0ZA 4BI3A 1ARKA 2HDAA 1U5SA 2DPPB 2K4YA 2XI9A 4BACA 2YUOA 3G1JA 3CCMQ 1I8FA 5GAMj 1VQ8T 4A4EA 3RERA 4C92D 2KXDA 3M5AA 4HVWA 2KRSA 3TVTA 3UPUA 3CC7T 3VS6A 3LWIA 3SB2A 4C92A 2EGAA 2KK4A 3CC4Q 1YJWT 3META 3EGXA 2BE7D 3QYGB 5J26A 3MCAB 5FRMA 3HHTB 4M77F 1FMKA 1M90R 2MAMA 5HK0A 1AZGB 4RTWA 2J6FA 3I56Q 3M4YA 4C8QB 2K2VA 5FRNA 5LJ5g 1IRXA 3QUIA 3CCRT 3EHQA 1KG1A 5GMKl 1WPYA 2X3XD 4EMKB 3G6ET 2YUNA 1IHVA 4M7AE 3I5SA 1K8AC 1YI2T 1WHJA 3PT9A 1VQ5A 2BE9B 2KR3A 3EH2A 1QCNA 4FYWB 2GBQA 2LP5A 4RCCA 2ZPGB 4CC2A 4B9WA 1VQ7Q 2QA4T 2ZPEB 2EPDA 2F5TX 2KGTA 5AT1B 1VQPQ 3VYHB 2LQWA 5GAMh 2YLBA 2L3PA 4C8QC 3ZEHA 1PSFA 2OAWA 4XK8E 1B34A 1WX6A 1HD3A 3QZ9B 3VS2A 4BD3A 4HT8A 4C5EA 2HCKA 1X6OA 2RJCA 1C1AA 2DJQA 3MEVA 3OS1A 1VQ8A 3M9QA 2OI3A 2Y4XA 3CC7A 2VGMA 3JRZA 5LJ5d 1KSWA 2E65A 3PE0A 2V26A 1QCOA 2Y4YA 5FROA 4JLGA 3SD4A 2EQIA 2VGNA 1YJWA 2KNBB 2FZCB 2KRNA 3G4SQ 5DY9A 1SPKA 2P0QA 1X6GA 1PSEA 2KBTA 2O2OA 1OV3A 5IHKA 4C5GA 2EQKA 1OZ2A 3CCRA 2RJDA 2X4WA 2LCSA 1O9SA 3HP9A 4M75G 2K5FA 4PJOG 2RHIA 1VQ4T 2EBPA 4M7AF 1MHNA 2FHDA 3C12A 2O4XA 3G6EA 4WF2A 5CQYA 3EAEA 5A0LA 2RK1A 1YI2A 5GAMe 1ZX6A 1WA7A 4PK4A 4C8QE 1OI1A 3H41A 4JS4A 4QW2A 1V29B 2KE9A 1KD1U 1VQKA 2QEXQ 3M0PA 1OYXA 5GAOm 1TWBA 3RKWA 2DL5A 1Y07A 3BDLA 2CYZB 4E7JA 1PRLC 3QJ6A 1WIEA 1SSHA 2FEIA 4MDXA 1K4US 4LDYA 2HL5C 4YTLA 4M7AD 1V76A 3FJ5A 3M53A 1I5LA 2D6FA 1KIKA 4LD9K 2K9GA 2RQUA 3JCMc 3OYKA 4M7AA 1SG5A 4RUGA 5KYWA 2GGRA 1K73R 2J6OA 2CUDA 1SF9A 1N9SA 2EQJA 1M3BA 4PL6A 3H0IA 1WXBA 1M2VB 3EFRA 5GAMf 4KBMB 3OYIA 2ZAEA 2EKOA 1NEBA 3L2ZA 1IHWA 3QO3A 4J9BA 1ZA2B 2R57A 2FVUA 3TQ7P 1BBZA 4CC3A 5FW9A 1Q82C 2I2LA 1SSFA 2DRKA 2IPOB 4LE9A 3OYGA 3AHUA 1XQHA 3LX7A 1Q86U 1IREB 4ZNXA 3F70A 2COWA 2O01E 4HA8A 1UUEA 1BI1A 3CPWP 1RLPC 3MO8A 4IUQA 2WACA 1ZQ1A 3OYDA 1EX4A 1IO6A 2YSQA 1LJOA 1K0XA 1KQ2A 3RESA 1K8AR 4FSXA 2C06A 3RKXA 3HRSA 1VQ8Q 4P5NA 2A28A 5KCHA 2FG0A 3SWNC 3CC7Q 4NOYA 4E7IA 4JRPA 2GCXA 4QVDA 2MK5A 4N4GA 1VQLA 2F2XA 2ZPHB 4PNOA 2EJFA 1N8RC 1YJWQ 4XU1A 4JRIA 1X75C 3I55T 1YIJT 1ACMB 2OTJT 2RM4A 2EYZA 1U1TA 4LXCA 5I2SA 2KSSA 1UHFA 1JO8A 4K11A 3BY7A 1K9AA 4F14A 4XAXB 1JJ2P 1AWXA 1JXOA 3CCRQ 2YRCA 2R58A 3TSZA 4C5IA 2DMOA 4ZGEB 3JAME 1KD1C 3G6EQ 5D6YA 3SFMA 1E6HA 4FSSA 3UDCA 3X24B 4EMKA 1YI2Q 2KEAA 2M51A 2VXFA 5KYNA 2LT1A 3WXMB 1VQKQ 3MHXA 2L89A 3Q1JA 5D6WA 3JB9H 4M77G 4J9IA 2QA4Q 1J3TA 3DB4A 4M78D 5CCAA 3E2UA 4LDVA 4CC7A 4M78A 1AVZC 1W2BS 2LX9A 3NTIA 2JS0A 4FYVB 4X34A 4Z8AA 2AKKA 1GXIE 2E3IA 3JSCA 2VB6A 2DKGA 2CDTA 1UG1A 3OYAA 2K57A 3E9FA 5AYFA 5GAOl 1NBEB 5CKFA 5GAN3 5KYYB 1D3BA 3DLLA 3I9QA 1HSQA 1U8RA 4F7UG 2JOYA 1Q7YU 1H8KA 1W2BA 2RI2A 2E3HA 5KE2A 1Q86C 2PQWA 1BI2A 2FZKB 4MZMA 2HBWA 1BIBA 4E7LA 4HXJA 1MV0B 4CI0C 3ZL7C 3DLMA 1WXUA 4AFUC 2J6KA 4MZTA 1M1GA 1M1FA 4M75F 2K5LA 2P84A 4ZTJA 1LNXA 3A8LB 1XJWB 2KDSA 3CCMA 4F04B 1YJNT 4J9CA 4DBQA 4J6YA 1GBQA 2ZGWA 4HKEA 3CC4A 2QQBA 4OGCA 2A36A 5KYXA 4QKUA 4JZ3A 4B9XA 1RADB 2RI5A 1I0CA 1JU5C 1X27A 2XDPA 1PM3A 2K7AA 3L2WA 2HBPA 4M75D 1LVKA 3HFNA 4PJOD 4NS5A 1FXXA 2BUDA 2KYBA 2H8HA 4FIBA 3WVDB 3OS0A 4M75A 2LNHB 2HMAA 1U06A 1VYVA 4PJOA 1U1SA 1AZEA 1PD0A 1M3AA 4EIKA 1V1CA 3HPWA 2PU9B 1M2OA 1YFNA 3PVQA 3ZFJA 3OA6A 4ANJA 1D1BA 4J9GA 2DL3A 3VJPA 1OEBA 3FLGA 1GCQC 2DBKA 1QVGS 3GBQA 1WJQA 1VQPA 3CCJT 2QYZA 4JS5A 2EQMA 1SRMA 4NL2A 2XHCA 2XG8D 1VQOT 2KMTA 4EPCA 1JB0E 1XOVA 4C0GA 1NPRA 3JCMg 2F2VA 2NUPB 4ATOA 1TTHB 1KHIA 1WDXA 2GTOA 1NYFA 1D0XA 1YITA 2PVOB 4J7IA 2DL4A 1OZ3A 4QQ6A 3JCMP 3X26B 1NM7A 1UDLA 2WSFE 1MUZA 3OMCA 4ZTFA 5KYUB 2YWWA 1TUCA 1WZOA 1RAEB 2LMJA 4PFPA 4M7DD 2DM1A 1G3YA 3GP8A 1F1BB 2ZPBB 1KD1R 4HVVA 5M9OA 1PRMC 2VWFA 1Q7YC 1WYXA 1TU0B 4HCCA 2CP5A 5IHIA 4AFZC 2EYWA 3HRTA 3PTAA 5LJ5j 4R56A 2DVEA 4PFOA 2HKNA 4A4FA 1Y96A 3I55Q 3OMGA 1YIJQ 2CUBA 4RG8A 3P8BB 2CP0A 1R8OB 2D0NA 3LGFA 1NLOC 2RJEA 3QXEB 4LUDA 1K73C 4PKCC 1OX9A 1WHLA 2FPEA 3VU3C 4C8QG 2DETA 3EH1A 5DM7R 3JCMd 1VQ6T 2LRQA 4PFZA 3P8DA 1VQ9T 2DE0X 2QEXA 4PJNA 2EGCA 4XTXA 4Y91A 1Q86R 2K3BA 3NHNA 3CCJA 2ENMA 4IUUA 4R0KA 3JCMe 3OSVA 1VQOA 2IIMA 2FRYA 1WI7A 2LZ6B 1AWWA 1M4ZA 4GLMA 2PZ1A 1NJIU 4IUTA 3QZ5B 2DERA 3UT1A 1M5Q1 1YNZA 2XICA 4EDUA 3D7SB 2JMAA 2K3YA 1K1ZA 3REAB 5LJ5h 4J8OA 2HQEA 1WQWA 2V8KA 1G3TA 2JVVA 2M1HA 3MEUA 4XTZA 2P0PA 4JUVA 4M77D 4HT9A 3M57A 2MCNA 5CKEA 2EJ9A 2X9HA 4F7UF 4M77A 3CEYA 1WXTA 4QVZA 2DXCA 4C0ZA 2X3WD 1FMVA 3JCMf 1PKSA 1UECA 2X4JA 4GBQA 1KHCA 2QASA 1TXQA 1VQNT 2RD1A 3OYLA 2HKQB 2DK3A 1YITQ 1TOVA 3ASKA 3PGGA 3NTKA 4BI4A 4QT7A 4FYYB 1RI0A 4J5YA 2JJ9A 2ROTA 3UWNA 2HQXA 4IIOA 3JB9G 3VYGA 2ZCFB 2YUPA 2OX7A 4F7UA 1M27C 1M30A 4F17A 1VQMT 2LJ0A 3RIRA 1T3LA 5LL6S 4AG2C 1WFWA 5GANg 1K9MU 1S1NA 3L2RA 2DTOA 3A5ZB 3M0RA 2LQKA 1OU8A 1QW1A 1IZ6A 5GANh 2GFUA 3RDVA 2P4TA 4Y28E 5LJ5e 1QVFS 1ZUYA 8AT1B 3CC2T 4CRIA 2DX1A 1ZBJA 2DD4A 3I35A 3QBYA 3GIBA 4M78C 4D6WA 1YJ9T 3M59A 1PHTA 1W2BP 4O5VA 4C0DB 3VRZA 1Q7YR 3EG3A 4N0AA 4LD6A 2NYSA 3PIPA 2BZXA 5A0GA 4HCBA 1YWOA 2PVGB 1CKBA 1PCXA 2CREA 1GFCA 2QG9B 1PG5B 5HK3A 1AOJA 1NJIC 2QA4A 2E12A 3CCJQ 1M8VA 1TUGB 2E6NA 4M4ZA 5CR2A 4GLKA 5LJ5f 1AD5A 1VQOQ 1ZBXA 9ATCB 2DIQA 4OMQA 4RTYA 2RHYA 4J9FA 4HVUA 4XTYA 3GOXA 5C6SA 5GAN5 4KUIA 3M0UA 1R0CB 1FYNA 2HL3A 2RN8A 2NUPA 5IN1A 2LQNA 2RHUA 2DBMA 5GANd 4A4HA 3CCST 1MGQA 5DLOA 1N5ZA 4C0DC 2FO0A 3JB9J 1WJRA 2C0IA 1X69A 2AZSA 2F5KA 2FB7A 1I81A 1LPLA 2YXYA 5CKBA 1WNLA 1UFFA 5GANe 2A0FB 1VQMA 2KROA 3RNJA 1AWOA 2PUKB 4E7HA 3SWNB 2LDMA 3CXCP 2RK2A 1LOJA 4JJDA 1FX7A 4QQGA 4AFQC 2DXUA 2M02A 2QDYB 3NGPA 1ABQA 3M4GA 2D1XA 1X43A 1BIAA 4XU3A 4MMKA 4PJOC 1AT1B 2EGEA 3V8KA 3JCMX 1QKWA 4PLLA 3J80E 3OW2P 3LWHA 3QG1A 3S3OA 2O31A 2A7YA 1YJ9A 1VQ4A 2RI3A 1ZSZB 1QKXA 5GMKe 3MJXA 3A8OB 1T0JA 4C8QF 4FT2A 4MZPA 4D8DA 1BI0A 1TH7A 1NG2A 2BIVA 3AT1B 1K9MC 2LQ8A 5GANf 4XU2A 3REBB 1VQ6Q 2KT1A 2DYBA 2NUTB 1H92A 4J9EA 1VQ9Q 2JN0A 4FT4A 1N6AA 1A0NB 5A0DA 3QDRB 2EYQA 3PIOA 3RBBB 2KRMA 2NUZA 1EIFA 1W1FA 5GJVB 3IQLA 2JT4A 3QWXX 4E2FB 2XD0A 3FRNA 2XDDA 2XU8A 2X4YA 2W0ZA 3GF5A 4C8QD 2OTLT 2KY9A 3KXTA 1TUDA 3CCQT 1QLYA 5KE3A 5FU7B 2BTTA 2HSPA 4C8QA 2V8JA 1ZSZC 4RMOA 2B86A 3CCSA 5LJ3g 1LCKA 4KGVB 1EFNA 2ATCB 2F2WA 4RTVA 1NEGA 4M7DC 1ZUUA 4V2SA 3OYCA 5IHNA 1YN8A 2CZ1B 3C95A 1ZHIA 3JV3A 4DOVA 1Y0MA 3TREA 4C92B 2LNVA 4Z89A 4RG2A 2QQAA 3RKYA 3RMQA 3EGXB 1HJDA 1TG0A 1UHCA 3C0CA 3CMAT 2A08A 4KGXB 2D8HA 5KCOA 3N5BB 5CQXA 2JM8A 5FU7C 1QP3A 5ECAA 2AHJB 4Z02A 3NTHA 4JPBW 3LGLA 3I56T 2CP7A 2RF0A 4LUEA 2J7IA 2O9VA 1GFDA 3L1AA 3JB9F 2D9TA 2CSQA 1D1CA 1OPLA 1W70A 1GBRA 3M0QA 2DF6A 1N9RA 2LX7A 5FU6C 1VIFA 2DZ9A 5CKHA 1JXMA 1GL5A 4C92C 1R0BG 1VQMQ 1AHJB 1NJIR 2A37A 3KUFA 2LTOA 3OY9A 2CT4A 3L42A 3VS3A 2EVRA 2DNUA 2MPXC 4BI8B 2AK5A 5LJ3d 4OB1B 2R5MA 2O9SA 3VUBA 2NWMA 1VQ7T 3I55A 1M9SA 1YIJA 2ED1A 2OTJA 5IXBA 4IUPA 3JCMb 3JB9D 1RL2A 1BI3A 2MIOA 3GNFB 3CC2Q 3J7AF 2RA2A 3A8GB 5GAN8 1K0SA 2MYSA 5LJ3e 2OTLA 2EWNA 1B34B 2H3JA 1D0YA 2DXTA 2JW4A 5FWBA 4A54A 3BDUA 5GJWB 4E7KA 1YJ9Q 1WHHA 1VQ4Q 3TEEA 1RAAB 3A1PA 3JCMW 2GQVA 1NZ9A 3EGDB 2VV5A 4E47A 4A53A 2KAFA 2XK0A 2E5KA 3RR6A 3UF4A 2L3QA 2YUQA 1QP2A 2VVKA 3GLXA 2DTHA 4FYXB 4M77C 1QVPA 3OYMA 1B3QA 2G3RA 1C6VX 2F1LA 5GAN7 2QQRA 1Z9QA 2JUFA 3WVEB 2DLPA 2DTIA 2QTVA 4XTWA 1Q81U 3EFOB 2QQSA 4J83A 3CMAA 2ROLA 4DQ2A 3V8LA 2X35A 3HL8A 2FYKA 1UGRB 5LJ3f 2GQIA 1XTDA 4C92E 3R6OA 1ZSGA 2RQWA 2AIRB 4EMGA 3O5ZA 1SHFA 3CCSQ 2PNIA 3CCVT 3G71T 2DEUA 1K9MR 2VKNA 1GCPA 1S72T 1MV3A 4AFSC 1I5OB 4UC4A 1BYMA 1UE9A 3VS0A 1TSFA 1M2VA 2C0OA 1D09B 2VUBA 3FJPA 1M1KU 2RO0A 2CZ0B 4RTUA 2DXBA 3BE3A 5IH2A 3SWNA 4BE0A 3VS5A 2OAUA 2E70A 3C4SA 4QVCA 4N4HA 3M0SA 4J7FA 3JCMh 1WJSA 2X4XA 2DO3A 2JTFA 1QVGA 2DL8A 1Y71A 4PLIA 1XNIA 3NFCA 4J9DA 1JJ2S 4A4GA 2CS7A 5KYWB 2HSEB 1YJNA 1H641 4ZN3A 2QDLA 3UA6A 4FW2A 3L2QA 1RAIB 2IVWA 1RAFB 1VYUA 2V1RA 2CH4W 3HSBA 4XTUA 1Q95G 3R6NA 7AT1B 3TSWA 1VQ5T 2M9UA 3S6WA 3PMIA 3LH5A 4IUVA 4JRQA 1B07A 2RJFA 1BB9A 1JJ2A 1ZUKA 1WQ7A 2L5QA 4ZGJB 2JTMA 3G7ZA 3MP1A 3JCMJ 2DD5A 2DVJA 2FZGB 3M54A 2F69A 3UA7A 2OTJQ 3BW1A 1KQ1A 1JBMA 3EHRA 2M16A 3EG9B 2LJ3A 4M7AC 4BY6C 5CVIA 3CBMA 4DBRA 4OMNA 1G8XA 2OTLQ 1H3HA 1QWEA 1JEGA 2ED0A 3O8VA 2JS2A 2YRDA 1MMAA 2RNAA 2VASA 2P0KA 3LYIA 3I5RA 1S72A 3PVLA 3MP6A 4OB0B 2E4HA 2JM9A 3UATA 1CKAA 3V7RA 1WGSA 3H9NA 1KQSS 2Y90A 1MNEA 4ORZA 3EGUA 1Q81C 4WTOB 1BCMA 1RAGB 5J3BA 2CT3A 3QWYA 4KULA 4DBHA 3DB3A 1RUWA 3V8JA 2KVQG 4FM4B 4QQDA 3CMAQ 4E6RA 4LNPA 1E7OA 2CKKA 1K76A 1Y57A 3MP8A 5L23A 3RMSA 3VS7A 1HK9A 1MNDA 5HKCA 2JMCA 1KQSA 2V1QA 1YHQT 2DL7A 2PVDB 5GAOp 5GANj 4OGEA 1TS9A 1VIEA 3EG1A 4DBFA 1SEMA 1I4K1 3TU4K 2HAXA 4OMMA 1U3OA 5KYYA 1M1KC 2M0OA 5I11A 2LC4A 4M78G 4OVAA 4BE1A 5D7UA 2IG0A 3SDZA 4MDWA 2DYIA 2DZCA 3M58A 2D8JA 2K79A 4FCYA 1OULA 3GPLA 3ER0A 5I2MA 3JCMV 1VQKT 5GAMg 3INZA 2CP6A 2DAQA 1I07A 4L59A 1VA7A 5GAOr 2RHXA 4AT1B 2CSIA 1WHGA 3HTRA 4Q5WA 4M78B 4IURA 2AZVA 1IGUA 5GMKj 2QK0A 1Q82U 4BDZA 2EYYA 3SHWA 4DOWA 1YJNQ 1VQ6A 2LT4A 4OMOA 3ZBDA 1D3BB 2E41A 5GAOn 1VQ9A 4JJNK 4EMKC 5GAN4 2XKOC 2AKLA 4RCBA 3MEAA 3A98A 3FC3A 3EGDA 4OB3B 1PD1A 3H0FA 4DEXA 1GCQA 1WLPB 2LCLA 3H6ZA 1NPPA 4ZN1A 1NYGA 3X25B 3OYFA 2E10A 2SRCA 2EAYA 3GNGA 2FL7A 4WCIA 4KT0E 3MKDA 3EFOA 3E19A 2BZYA 3EG2A 2HZYA 1E6GA 3DKMA 2DEQA 1CSKA 1W6XA 4XTVA 4ME7A 1N8RU 4KH0B 2MI6A 1YHQA 5IXFA 1AWJA 3L2UA 1QVFA 1N27A 4AG1C 5GAMd 3CCVQ 3G71Q 2K3XA 4Z88A 1S72Q 3OBWA 5GMKh 2HEQA 4DEYA 1PC0A 5CO7A 4F16A 1RACB 1G2BA 3VV0A 3CD6T 5KYXB 2KQWA 3CBOA 3A8MB 2YLCA 4O6JA 3CCUT 4LDWA 3OB9A 2EJGA 1KC8U 1G3WA 1RI9A 8ATCB 1VQNA 2L3SA 4D8KA 2RQVA 2K6DA 3PFSA 4J6WA 4M75B 1VQLT 3CMET 4PJOB 3BFMA 1RABB 3THKA 2A3LA 2KT8A 1D1AA 2YHTA 3QJYA 3OYJA 1BCOA 3QPHA 3CCET 2DILA 2YRVA 5KYUA 1QWFA 2XIDA 1MMNA 3A8HB 4C5HA 2CP3A 2MWOA 4Y92A 5EG2A 1RAHB 2BKDN 3KFVA 4RTTA 2JZ2A 4M78E 2HQHA 3CCLT 1Q81R 1VUBA 1KJWA 3S3MA 1IXDA 3OYBA 1UGQB 5CKDA 1VQ5Q 4MMLA 2PUOB 1UB4A 2HNIA 3CC2A 4M7DG 2QI2A 2LJ1A 2LVMA 4M75C 5CAIA 4OF1A 5LJ3j 4DA4A 4X1VA 3ME9A 4R55A 2DA9A 5CK9A 3M55A 3EG9A 2FPFA 2W10A 2E6ZA 1FWZA 3LH0A 1M90U 3FEOA 2Z0WA 1M1KR 3OYHA 2GFAA 4M7DB 1OOTA 1OPKA 1G83A 2QQ9A 5FLXE 2HD0A 1KFZA 3OYNA 4C0FA 1O75A 4FU6A 1QVGP 5C0MA 1AEYA 4BDYA 3CD6A 2DJZA 3QIIA 2XMFA 2CH4A 3CCUA 5HY6A 4OMLA 2RH2A 1IB8A 3PMTA 1M3CA 4PJMA 1Z9ZA 4C92G 1Y96B 2DRMA 3QSUA 4J6XA 3CMEA 2QAZA 2VXEA 3EG0A 4RTZA 2L2PA 1WHMA 2EQUA 4AMCA 3H0HA 3CCEA 4OB2B 4LDXA 3VKIA 3JB9I 3ULRB 4JJBA 5LJ3h 4ZGDB 1IGQA 4A4KA 1YHQQ 3U23A 2X51A 2JXBA 2SEMA 1OU9A 2EFIA 5FU6B 2JNGA 3FB9A 2KXCA 5GMKi 2H3EB 3OS2A 3CCMT 3E9GA 2I0NA 2GTJA 4M78F 1UGVA 4J9HA 4M75E 3VUZA 4PJOE 2CP2A 3OSSC 5L8RE 2G6FX 3CCLA 1T3SA 1KC8C 2RMOA 2CZ7B 3JCMQ 1WHKA 3M56A 3QHSA 1YP5A 4KRTA 3CC4T 2J06A 2D0QB 4OP0A 1HYOA 3L2VA 3LLRA 1VQNQ 3TCJA 1HXDA 3V7SA 2ESWA 4JLIA 1YCYA 2E5QA 3NPFA 1OX8A 1P92A 4JZ4A 3H8ZA 1R77A 1SKUB 4RKUE 3OYYA 1T0HA 2DIGA 1X2KA 5GAN6 2COZA 2V8IA 2BZ8A 1B7TA 4KUDK 2VC8A 3HFOA 3OS5A 4PJLA 3OYEA 4XQ3A 5KH6A 4BUGA 2K2MA 4GY5A 4IKFA 2O88A 1ZA1B 1BU1A 4M77B 3EFSA 4BB7A 2RQRA 2B8AA 1UGPB 2E64A 1DJ7B 2PTKA 1X01A 4LN2A 2E1HA 1VQPT 1KQSP 3NMZC 2EIFA 1ZLMA 2K5IA 4M7DE 1NE8A 4OMFB 5I22A 3X28B 1I1JA 4ESRA 3X20B 3CCQA 1OQKA 4ELYC 3FIFA 4II1A 3MEWA 3KBGA 3S3NA 1G3SA 2DFUA 2MOXA 5D6XA 1M90C 1YITT 1SRLA 4X9CA 3E1SA 3RUXA 5EC7A 1SHGA 1NLPC 2MWPA 2NLUA 2EKHA 2FRWA 4PJOF 4F7UB 1M8MA 2J05A 4L6V5 5FWCA 2COYA 3MPUB 3C94A 1EZZB 5J39A 4LDUA 1YWPA 4XU0A 1YBYA 3CXCS 2RQTA 1K73U 3J81E 2R5AA 5DLQE 1BKBA 2GNCA 3URGA 1UJ0A 5GMKm 4VUBA 4E7SA 2L0AA 3CD6Q 1UEBA 2QGFB 2QXFA 4OMPA 1QMCA 4PJJA 3CCUQ 4CC4B 3G4ST 1Q82R 4TVRA 3CPWS 2YT6A 1PNJA 4NL3A 1UGSB 3I56A 6AT1B 4ELZC 1KK7A 1Y7XA 2MF2A 2OJ2A 2XDBA 1VQLQ 3QYHB 3CPFA 3CMEQ 5IAYA 3OW2S 1QCFA 3HKSA 4A63B 5CIUA 2LCCA 1ABOA 3CXCA 3VS4A 3CCEQ 4HCKA 2O4XB 1YCSB 2EYXA 1UJYA 3HRUA 4M7AG 1X2QA 1C0MA 2M0YA 3VS1A 3CPWA 4N4IA 1W4SA 2MMPA 3PNWC 2L8DA 2WSEE 1JRIA 1JQQA 4KGZB 3CCLQ 2RHZA 2QEXT 3OW2A 1K8AU 4FL6A 2CZ6B 1VQ7A 1VYTA 1PKTA 4M7DF 3OBYA 3CQTA 1UTIA 1BK2A 1RLQC 4L5GA 3FDRA 4FW1A 2EW3A 2VYTA 5HCKA 1QVFP 4JRKA 1N8RR 4JDSA 3P8HA 4M7AB 1PWTA 4BY6B 2FPDA 2ZPFB 2ABLA 2YDLA 2ZZDA 2L3RA 5IT9E 4M77E 5I21A 1X6BA 2QTXA 1G5VA 2ZPIB 2RB6A 3CBPA 3QKJA 1FMWA 2CGHA 2RPNA 1ZSZA 4RTXA 4N0AC 2KYMA 4KH1B 5GAN2 5A2QE 4JJCA 1GRIA 2KI7A 3LW5E 2QGGA 3SEMA 4HCZA 2GF7A 1KC8R 3VRYA 4M7DA 2NUTA 2AT1B 2P4RA 1QQJA 2WSCE
chains in the Genus database with same CATH topology
2A7YA 5GAN4 1YJ9A 2XKOC 3OQ5A 1VQ4A 4RCBA 3DLMA 2RI3A 3MEAA 4BE2A 5GMKe 3FC3A 3A8OB 4C8QF 4FT2A 4OB3B 4MZPA 4MZTA 4F7UE 4C92F 1M1GA 1M1FA 3T9NA 1BI0A 1TH7A 2BIVA 4M75F 3G4SA 2LCLA 3H6ZA 1NPPA 2K5LA 2LQ8A 5GANf 4ZTJA 1K9MC 3V7CA 1H3ZA 1LNXA 3A8LB 4XU2A 4ZN1A 3X25B 3OYFA 2KDSA 3CCMA 2E10A 2EAYA 2JN0A 4FT4A 3GNGA 1YJNT 1N6AA 4EMHA 2FL7A 3QDRB 4J6YA 5A0DA 5GAOq 2EYQA 3PIOA 3G71A 3CCVA 4X9DA 4BI3A 4KT0E 1EIFA 3E19A 2DPPB 2K4YA 2XI9A 2ZGWA 4HKEA 4BACA 1YJ9T 3CC4A 2XD0A 3FRNA 2XDDA 3DKMA 2XU8A 2QQBA 4OGCA 2DEQA 2X4YA 4XTVA 4ME7A 1N8RU 1I8FA 2MI6A 4B9XA 5GAMj 1YHQA 2RI5A 3GF5A 4C8QD 4A4EA 2XDPA 3L2UA 2OTLT 2KY9A 3KXTA 1QVFA 1N27A 3RERA 4C92D 3L2WA 3CCQT 3M5AA 5KE3A 5GAMd 5FU7B 2HBPA 4M75D 3UPUA 4C8QA 3HFNA 3CC7T 2K3XA 2V8JA 3LWIA 4PJOD 3SB2A 4NS5A 4RMOA 4C92A 1FXXA 2BUDA 4FIBA 3WVDB 5LJ3g 3OS0A 3CCSA 3OBWA 4M75A 5GMKh 2KK4A 4PJOA 1U1SA 1YJWT 3META 5CO7A 3QYGB 5J26A 3MCAB 3HPWA 3VV0A 4M7DC 3CD6T 2PU9B 2KQWA 5FRMA 4V2SA 3CBOA 3HHTB 3A8MB 3OYCA 2YLCA 3ZFJA 4M77F 4O6JA 3CCUT 2MAMA 5HK0A 4LDWA 2CZ1B 3C95A 3OB9A 3OA6A 1ZHIA 2EJGA 1KC8U 1G3WA 1VQNA 3M4YA 4DOVA 4C8QB 2K2VA 3TREA 5FRNA 3PFSA 4J6WA 5LJ5g 3QUIA 2LNVA 4C92B 3CCRT 3VJPA 4M75B 1VQLT 3CMET 4PJOB 4RG2A 2QQAA 3FLGA 3RKYA 3BFMA 3RMQA 2A3LA 1KG1A 5GMKl 1QVGS 2YHTA 3QJYA 3CMAT 1WPYA 3OYJA 3QPHA 1WJQA 4EMKB 3G6ET 1VQPA 3CCET 3CCJT 5KCOA 2YRVA 3N5BB 4JS5A 2EQMA 5CQXA 4NL2A 2XHCA 1K8AC 4M7AE 1YI2T 2XG8D 1QP3A 5FU7C 1VQOT 2AHJB 2KMTA 3PT9A 1JB0E 1XOVA 4EPCA 1VQ5A 4Z02A 3NTHA 2XIDA 3LGLA 4C0GA 3I56T 3A8HB 4C5HA 1NPRA 2MWOA 3JCMg 5EG2A 4ATOA 1KHIA 3L1AA 4RCCA 3JB9F 1YITA 2BKDN 2ZPGB 2D9TA 4B9WA 2JZ2A 2PVOB 4J7IA 4M78E 3CCLT 1OZ3A 4QQ6A 2QA4T 3JCMP 1VUBA 2ZPEB 2F5TX 3X26B 3S3MA 1N9RA 3VYHB 5GAMh 5FU6C 2WSFE 3OMCA 1VIFA 1UGQB 3OYBA 5CKDA 4ZTFA 2DZ9A 2YLBA 5CKHA 4C8QC 4MMLA 2PUOB 4M7DD 1UB4A 2HNIA 3ZEHA 3CC2A 4C92C 4M7DG 1AHJB 1PSFA 2QI2A 1G3YA 2LVMA 4XK8E 3GP8A 4M75C 2ZPBB 5CAIA 1B34A 3KUFA 2LTOA 4OF1A 5LJ3j 4DA4A 3OY9A 3L42A 3QZ9B 5M9OA 1Q7YC 1NJIU 4BD3A 4BI8B 4HT8A 5LJ3d 4OB1B 2R5MA 4C5EA 3VUBA 3ME9A 4R55A 1VQ7T 1X6OA 3I55A 1M9SA 1YIJA 2RJCA 4HCCA 2OTJA 4IUPA 5CK9A 3JCMb 3M55A 3JB9D 1RL2A 1BI3A 3GNFB 2E6ZA 3MEVA 3OS1A 3J7AF 1FWZA 2RA2A 3A8GB 3LH0A 3FEOA 3M9QA 2Y4XA 5GAN8 1M90U 1VQ8A 3HRTA 3PTAA 5LJ3e 5LJ5j 2OTLA 2EWNA 3OYHA 2GFAA 1B34B 2H3JA 4M7DB 4R56A 2DVEA 2DXTA 4A4FA 3CC7A 2VGMA 4A54A 3JRZA 5LJ5d 3BDUA 2E65A 4E7KA 1Y96A 2QQ9A 2Y4YA 3OMGA 5FLXE 2HD0A 4RG8A 4JLGA 5FROA 3TEEA 3SD4A 3P8BB 3OYNA 3JCMW 4C0FA 2VGNA 1YJWA 2GQVA 1O75A 1NZ9A 4FU6A 2VV5A 1R8OB 5C0MA 3LGFA 4E47A 4A53A 4BDYA 3CD6A 2DJZA 3QIIA 2KAFA 2RJEA 2XK0A 3QXEB 5DY9A 3CCUA 1K73C 4PKCC 2P0QA 5HY6A 1PSEA 2RH2A 1QP2A 3GLXA 3PMTA 2DTHA 3VU3C 4C8QG 4M77C 4C5GA 2EQKA 1OZ2A 3JCMd 5DM7R 4C92G 3CCRA 2RJDA 1QVPA 2X4WA 3OYMA 1Y96B 2LRQA 1VQ6T 2G3RA 1O9SA 3HP9A 3P8DA 4M75G 3QSUA 4J6XA 3CMEA 1VQ9T 2K5FA 5GAN7 4PJOG 2QQRA 2JUFA 2RHIA 2VXEA 2QEXA 3WVEB 2DTIA 4XTWA 1VQ4T 1Q81U 4M7AF 2EQUA 2QQSA 4J83A 1MHNA 4XTXA 4Y91A 2FHDA 3C12A 3CMAA 2O4XA 3G6EA 3CCEA 4WF2A 4OB2B 5CQYA 4DQ2A 3CCJA 3V8LA 4IUUA 4LDXA 3VKIA 3EAEA 5A0LA 3JCMe 3JB9I 2X35A 2RK1A 1YI2A 3OSVA 5GAMe 3HL8A 5LJ3h 2FYKA 4A4KA 1UGRB 4ZGDB 1VQOA 5LJ3f 2EFIA 5FU6B 1OI1A 1XTDA 4C8QE 4JS4A 2JNGA 3FB9A 1M4ZA 4QW2A 5GMKi 4C92E 3R6OA 1V29B 4IUTA 3OS2A 3E9GA 4M78F 3CCMT 1KD1U 1VQKA 3VUZA 3QZ5B 4M75E 4EMGA 4PJOE 3UT1A 1OYXA 5GAOm 3OSSC 5L8RE 1M5Q1 2XICA 4EDUA 3G71T 3CCVT 3RKWA 2K3YA 3CCLA 1KC8C 1S72T 1Y07A 2CZ7B 3BDLA 3JCMQ 2CYZB 4E7JA 3M56A 3QHSA 3QJ6A 4UC4A 5LJ5h 1BYMA 3CC4T 4MDXA 2D0QB 4J8OA 4OP0A 2HQEA 4LDYA 4YTLA 4M7AD 3L2VA 3M53A 1I5LA 2D6FA 1WQWA 2VUBA 4LD9K 3LLRA 3FJPA 3JCMc 1M1KU 2V8KA 3OYKA 1G3TA 2JVVA 2M1HA 3TCJA 4M7AA 3MEUA 1HXDA 4XTZA 3V7SA 2RO0A 2P0PA 2CZ0B 4JLIA 2DXBA 4JUVA 4M77D 1YCYA 3SWNA 4BE0A 2E5QA 3M57A 4HT9A 2OAUA 5CKEA 2EJ9A 1P92A 1N9SA 2EQJA 4F7UF 3H8ZA 4RKUE 4PL6A 2E70A 3C4SA 3CEYA 4M77A 4QVCA 4QVZA 2DXCA 3OYYA 4J7FA 4N4HA 4C0ZA 2DIGA 3JCMh 1WJSA 2X4XA 2DO3A 3JCMf 2JTFA 3EFRA 5GAMf 1QVGA 2X4JA 5GAN6 4KBMB 3OYIA 1KHCA 2EKOA 1Y71A 3L2ZA 4PLIA 2V8IA 1XNIA 3NFCA 1JJ2S 4KUDK 3QO3A 4A4GA 1VQNT 2RD1A 2VC8A 2CS7A 3HFOA 3OYLA 2R57A 3OS5A 3OYEA 4XQ3A 2FVUA 1YJNA 2DK3A 5KH6A 4BUGA 3ASKA 4GY5A 4IKFA 1H641 4ZN3A 3PGGA 4M77B 1Q82C 2I2LA 1SSFA 3EFSA 4BB7A 3OYGA 3NTKA 4BI4A 1XQHA 3LX7A 3L2QA 1Q86U 1IREB 2B8AA 3AHUA 2IVWA 1UGPB 2E64A 3F70A 1DJ7B 1RI0A 4J5YA 1X01A 3UWNA 2E1HA 2HQXA 3JB9G 1VQPT 3HSBA 2O01E 4HA8A 4XTUA 3VYGA 1BI1A 2EIFA 2K5IA 4M7DE 1NE8A 2ZCFB 4OMFB 3X28B 4F7UA 2M9UA 3S6WA 3MO8A 3PMIA 1VQ5T 4IUVA 4JRQA 2RJFA 2WACA 4IUQA 3X20B 3CCQA 1VQMT 4ELYC 1JJ2A 1ZQ1A 3FIFA 3OYDA 4II1A 3MEWA 1WQ7A 2L5QA 4ZGJB 2JTMA 3G7ZA 3KBGA 3MP1A 3RIRA 1LJOA 3JCMJ 3S3NA 1G3SA 2DD5A 5D6XA 5LL6S 1M90C 1YITT 1KQ2A 3RESA 5GANg 1K9MU 3M54A 2F69A 4FSXA 3L2RA 4X9CA 3BW1A 1KQ1A 3E1SA 1JBMA 3RUXA 2C06A 2DTOA 3RKXA 3A5ZB 3HRSA 2M16A 2MWPA 2NLUA 2LQKA 4M7AC 1QW1A 1IZ6A 4BY6C 5CVIA 3CBMA 5GANh 4P5NA 2GFUA 5LJ5e 2P4TA 4Y28E 4PJOF 1QVFS 5KCHA 4F7UB 3SWNC 3CC2T 4L6V5 4CRIA 3O8VA 4NOYA 4E7IA 1VQ8T 4JRPA 3C94A 2DD4A 5J39A 2P0KA 4LDUA 2GCXA 3LYIA 3QBYA 4XU0A 1YBYA 4QVDA 4N4GA 3CXCS 3GIBA 4M78C 4D6WA 1K73U 3J81E 2R5AA 1VQLA 2ZPHB 4PNOA 5DLQE 2EJFA 1S72A 1N8RC 3MP6A 1BKBA 4OB0B 4XU1A 4JRIA 1X75C 3M59A 3I55T 1YIJT 3URGA 5GMKm 4VUBA 2OTJT 2RM4A 1UEBA 1U1TA 2QXFA 5I2SA 3V7RA 1WGSA 2KSSA 4O5VA 4C0DB 1KQSS 2Y90A 3BY7A 3G4ST 1Q81C 4TVRA 3CPWS 4NL3A 4N0AA 4XAXB 4LD6A 1UGSB 5J3BA 3I56A 3PIPA 4ELZC 5A0GA 2R58A 4HCBA 1Y7XA 2MF2A 4KULA 3S3OA 2PVGB 2XDBA 3QYHB 3CPFA 3DB3A 5IAYA 3OW2S 3V8JA 4C5IA 2KVQG 3HKSA 4FM4B 4ZGEB 5HK3A 5CIUA 2LCCA 3CXCA 3JAME 4QQDA 1NJIC 2QA4A 1KD1C 2CKKA 2E12A 5D6YA 3SFMA 2O4XB 1M8VA 2E6NA 5CR2A 3MP8A 4GLKA 3UDCA 3X24B 4EMKA 5LJ5f 3RMSA 3HRUA 1HK9A 1ZBXA 2DIQA 5HKCA 1KQSA 4M7AG 2RHYA 2VXFA 4XTYA 3GOXA 5C6SA 2LT1A 5GAN5 3WXMB 1YHQT 4KUIA 3CPWA 4N4IA 1W4SA 2PVDB 2MMPA 3PNWC 5GAOp 5GANj 2L8DA 2WSEE 4OGEA 1JRIA 3MHXA 2L89A 3Q1JA 5D6WA 5IN1A 1VIEA 2RHUA 1I4K1 3TU4K 2RHZA 4M77G 2QEXT 3OW2A 2HAXA 5GANd 3JB9H 1K8AU 1M1KC 4FL6A 4A4HA 2CZ6B 1MGQA 2M0OA 5DLOA 3CCST 2LC4A 1VQ7A 3DB4A 4M78D 4C0DC 4M78G 4M7DF 5CCAA 4OVAA 3OBYA 1WJRA 4BE1A 3JB9J 4LDVA 2IG0A 3SDZA 4MDWA 2F5KA 4M78A 2FB7A 1W2BS 4L5GA 2LX9A 3NTIA 1I81A 3FDRA 2DZCA 2VYTA 4X34A 3M58A 5CKBA 1WNLA 4JRKA 5GANe 4JDSA 3P8HA 3ER0A 4M7AB 3GPLA 4BY6B 1VQMA 1GXIE 3JSCA 2ZPFB 5I2MA 3JCMV 2ZZDA 1VQKT 2PUKB 2DKGA 5GAMg 3INZA 4E7HA 2L3RA 5IT9E 4M77E 3OYAA 3SWNB 2K57A 3E9FA 2DAQA 5AYFA 5I21A 5GAOl 5CKFA 5GAN3 2LDMA 1D3BA 2RK2A 1LOJA 2QTXA 1FX7A 1G5VA 2ZPIB 4QQGA 4L59A 3DLLA 5GAOr 2RB6A 2RHXA 3CBPA 3QKJA 2CGHA 4Q5WA 1U8RA 4M78B 4IURA 4N0AC 5GAN2 5A2QE 5GMKj 2DXUA 4F7UG 2JOYA 2QDYB 1Q7YU 1W2BA 2RI2A 3LW5E 1Q82U 3M4GA 5KE2A 1Q86C 2PQWA 1BI2A 4HCZA 2GF7A 4BDZA 1BIAA 4MZMA 4XU3A 4MMKA 4M7DA 4PJOC 4DOWA 3V8KA 3JCMX 1BIBA 4PLLA 1VQ6A 2LT4A 3J80E 4E7LA 3ZBDA 1D3BB 2E41A 5GAOn 4CI0C 3LWHA 3QG1A 4JJNK 1VQ9A 2WSCE 4EMKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJF A;  5GAN 4;  3QSU A;  4M78 E;  4RCB A;  4XU1 A;  4JRI A;  3JCM P;  3JCM Q;  5GMK m;  5GMK e;  3QHS A;  2RM4 A;  1N9R A;  5GAM h;  1U1T A;  4C8Q F;  5LJ5 h;  3V7R A;  4F7U E;  4C92 F;  4OP0 A;  2DZ9 A;  2YLB A;  2Y90 A;  3BY7 A;  4M7A D;  1TH7 A;  4M75 F;  4C8Q C;  1I5L A;  1WQW A;  4MML A;  5GAN f;  4M7D D;  2HNI A;  3V7C A;  4M7D G;  1LNX A;  3FJP A;  4XU2 A;  4N0A A;  3JCM c;  4C92 C;  4NL3 A;  4M7A A;  4M75 C;  5CAI A;  4XTZ A;  1HXD A;  2E10 A;  3V7S A;  1B34 A;  2EAY A;  5LJ3 j;  2JN0 A;  4JLI A;  4JUV A;  4M77 D;  1YCY A;  3SWN A;  3V8J A;  4EMH A;  4HT9 A;  5GAO q;  4J6Y A;  4HT8 A;  5LJ3 d;  2EJ9 A;  1N9S A;  4X9D A;  4F7U F;  4M77 A;  4QVC A;  2ZGW A;  3JCM b;  3JCM h;  1M8V A;  3JB9 D;  3JCM f;  3EFR A;  4EMK A;  5GAM f;  5LJ5 f;  2DEQ A;  5GAN 6;  1HK9 A;  2RA2 A;  4XTV A;  5GAN 8;  4M7A G;  3L2Z A;  1I8F A;  2VXF A;  5GAM j;  5LJ3 e;  4XTY A;  5LJ5 j;  2EWN A;  4C8Q D;  5GAN 5;  3QO3 A;  3JCM J;  1B34 B;  4M7D B;  2RD1 A;  2VC8 A;  3RER A;  2DVE A;  4C92 D;  2DXT A;  3HFO A;  5GAO p;  4A54 A;  5GAM d;  5GAN j;  4M75 D;  5LJ5 d;  1JRI A;  4C8Q A;  3BDU A;  3HFN A;  2E65 A;  4XQ3 A;  4PJO D;  3SB2 A;  1Y96 A;  4C92 A;  1I4K 1;  3JB9 H;  4M77 G;  5LJ3 g;  5GAN d;  1H64 1;  4M75 A;  3PGG A;  4M77 B;  5GMK h;  2I2L A;  1MGQ A;  3EFS A;  3JCM W;  4PJO A;  4M78 D;  3RKW A;  3AHU A;  4M78 G;  4M7D F;  1U1S A;  3JB9 J;  2E64 A;  4J5Y A;  4A53 A;  1X01 A;  2DJZ A;  2E1H A;  4M78 A;  3JB9 G;  2FB7 A;  3HSB A;  4M7D C;  4XTU A;  1I81 A;  4HA8 A;  5DY9 A;  2DZC A;  4V2S A;  2YLC A;  4M77 F;  4M7D E;  1WNL A;  4JRK A;  4F7U A;  5GAN e;  2EJG A;  4M7A B;  3VU3 C;  2DTH A;  4C8Q G;  4M77 C;  3JCM V;  4C8Q B;  3FIF A;  2DKG A;  3JCM d;  3INZ A;  4J6W A;  4C92 G;  5LJ5 g;  5GAM g;  1WQ7 A;  1Y96 B;  3QUI A;  4M77 E;  4C92 B;  3RIR A;  4M75 G;  1LJO A;  2K57 A;  3SWN B;  5I21 A;  4J6X A;  5GAO l;  5GAN 3;  4M75 B;  5GAN 7;  4PJO G;  1KQ2 A;  1D3B A;  2VXE A;  1LOJ A;  2QTX A;  3RES A;  5GAN g;  4PJO B;  2DTI A;  4XTW A;  3RKY A;  5GAO r;  2RB6 A;  3BFM A;  4X9C A;  3BW1 A;  1KQ1 A;  2CGH A;  1JBM A;  3RUX A;  4XTX A;  4Y91 A;  2DTO A;  5GMK l;  3RKX A;  2YHT A;  1WPY A;  4M78 B;  4N0A C;  4WF2 A;  4DQ2 A;  4EMK B;  3V8L A;  5GAN 2;  4M7A C;  4EMK C;  2DXU A;  5GMK j;  3JCM e;  3JB9 I;  5GAN h;  5GAM e;  4NL2 A;  5LJ3 h;  2FYK A;  4F7U G;  4PJO F;  5LJ5 e;  4M7A E;  5LJ3 f;  4F7U B;  3M4G A;  3SWN C;  4C8Q E;  4M7A F;  3FB9 A;  5GMK i;  4C92 E;  1BIA A;  4NOY A;  4XU3 A;  4MMK A;  4M7D A;  4M78 F;  4PJO C;  3V8K A;  4M75 E;  3JCM g;  3JCM X;  1BIB A;  4EMG A;  4PJO E;  4XU0 A;  5GAO m;  4QVD A;  1D3B B;  2E41 A;  3L1A A;  4RCC A;  4M78 C;  5GAO n;  1M5Q 1;  3GIB A;  3JB9 F;  4PNO A; 
#chains in the Genus database with same CATH topology
 4IIM A;  3OQ5 A;  2C0T A;  4B6M A;  4BE2 A;  4F7U E;  4C92 F;  1MMG A;  3T9N A;  3G4S A;  3M0T A;  3QDF A;  3V7C A;  1H3Z A;  1VOM A;  3CCQ Q;  2ECZ A;  4E7Z A;  2JTE A;  1MMD A;  4EMH A;  5GAO q;  3CCV A;  3G71 A;  4X9D A;  1D0Z A;  4BI3 A;  1ARK A;  2HDA A;  1U5S A;  2DPP B;  2K4Y A;  2XI9 A;  4BAC A;  2YUO A;  3G1J A;  3CCM Q;  1I8F A;  5GAM j;  1VQ8 T;  4A4E A;  3RER A;  4C92 D;  2KXD A;  3M5A A;  4HVW A;  2KRS A;  3TVT A;  3UPU A;  3CC7 T;  3VS6 A;  3LWI A;  3SB2 A;  4C92 A;  2EGA A;  2KK4 A;  3CC4 Q;  1YJW T;  3MET A;  3EGX A;  2BE7 D;  3QYG B;  5J26 A;  3MCA B;  5FRM A;  3HHT B;  4M77 F;  1FMK A;  1M90 R;  2MAM A;  5HK0 A;  1AZG B;  4RTW A;  2J6F A;  3I56 Q;  3M4Y A;  4C8Q B;  2K2V A;  5FRN A;  5LJ5 g;  1IRX A;  3QUI A;  3CCR T;  3EHQ A;  1KG1 A;  5GMK l;  1WPY A;  2X3X D;  4EMK B;  3G6E T;  2YUN A;  1IHV A;  4M7A E;  3I5S A;  1K8A C;  1YI2 T;  1WHJ A;  3PT9 A;  1VQ5 A;  2BE9 B;  2KR3 A;  3EH2 A;  1QCN A;  4FYW B;  2GBQ A;  2LP5 A;  4RCC A;  2ZPG B;  4CC2 A;  4B9W A;  1VQ7 Q;  2QA4 T;  2ZPE B;  2EPD A;  2F5T X;  2KGT A;  5AT1 B;  1VQP Q;  3VYH B;  2LQW A;  5GAM h;  2YLB A;  2L3P A;  4C8Q C;  3ZEH A;  1PSF A;  2OAW A;  4XK8 E;  1B34 A;  1WX6 A;  1HD3 A;  3QZ9 B;  3VS2 A;  4BD3 A;  4HT8 A;  4C5E A;  2HCK A;  1X6O A;  2RJC A;  1C1A A;  2DJQ A;  3MEV A;  3OS1 A;  1VQ8 A;  3M9Q A;  2OI3 A;  2Y4X A;  3CC7 A;  2VGM A;  3JRZ A;  5LJ5 d;  1KSW A;  2E65 A;  3PE0 A;  2V26 A;  1QCO A;  2Y4Y A;  5FRO A;  4JLG A;  3SD4 A;  2EQI A;  2VGN A;  1YJW A;  2KNB B;  2FZC B;  2KRN A;  3G4S Q;  5DY9 A;  1SPK A;  2P0Q A;  1X6G A;  1PSE A;  2KBT A;  2O2O A;  1OV3 A;  5IHK A;  4C5G A;  2EQK A;  1OZ2 A;  3CCR A;  2RJD A;  2X4W A;  2LCS A;  1O9S A;  3HP9 A;  4M75 G;  2K5F A;  4PJO G;  2RHI A;  1VQ4 T;  2EBP A;  4M7A F;  1MHN A;  2FHD A;  3C12 A;  2O4X A;  3G6E A;  4WF2 A;  5CQY A;  3EAE A;  5A0L A;  2RK1 A;  1YI2 A;  5GAM e;  1ZX6 A;  1WA7 A;  4PK4 A;  4C8Q E;  1OI1 A;  3H41 A;  4JS4 A;  4QW2 A;  1V29 B;  2KE9 A;  1KD1 U;  1VQK A;  2QEX Q;  3M0P A;  1OYX A;  5GAO m;  1TWB A;  3RKW A;  2DL5 A;  1Y07 A;  3BDL A;  2CYZ B;  4E7J A;  1PRL C;  3QJ6 A;  1WIE A;  1SSH A;  2FEI A;  4MDX A;  1K4U S;  4LDY A;  2HL5 C;  4YTL A;  4M7A D;  1V76 A;  3FJ5 A;  3M53 A;  1I5L A;  2D6F A;  1KIK A;  4LD9 K;  2K9G A;  2RQU A;  3JCM c;  3OYK A;  4M7A A;  1SG5 A;  4RUG A;  5KYW A;  2GGR A;  1K73 R;  2J6O A;  2CUD A;  1SF9 A;  1N9S A;  2EQJ A;  1M3B A;  4PL6 A;  3H0I A;  1WXB A;  1M2V B;  3EFR A;  5GAM f;  4KBM B;  3OYI A;  2ZAE A;  2EKO A;  1NEB A;  3L2Z A;  1IHW A;  3QO3 A;  4J9B A;  1ZA2 B;  2R57 A;  2FVU A;  3TQ7 P;  1BBZ A;  4CC3 A;  5FW9 A;  1Q82 C;  2I2L A;  1SSF A;  2DRK A;  2IPO B;  4LE9 A;  3OYG A;  3AHU A;  1XQH A;  3LX7 A;  1Q86 U;  1IRE B;  4ZNX A;  3F70 A;  2COW A;  2O01 E;  4HA8 A;  1UUE A;  1BI1 A;  3CPW P;  1RLP C;  3MO8 A;  4IUQ A;  2WAC A;  1ZQ1 A;  3OYD A;  1EX4 A;  1IO6 A;  2YSQ A;  1LJO A;  1K0X A;  1KQ2 A;  3RES A;  1K8A R;  4FSX A;  2C06 A;  3RKX A;  3HRS A;  1VQ8 Q;  4P5N A;  2A28 A;  5KCH A;  2FG0 A;  3SWN C;  3CC7 Q;  4NOY A;  4E7I A;  4JRP A;  2GCX A;  4QVD A;  2MK5 A;  4N4G A;  1VQL A;  2F2X A;  2ZPH B;  4PNO A;  2EJF A;  1N8R C;  1YJW Q;  4XU1 A;  4JRI A;  1X75 C;  3I55 T;  1YIJ T;  1ACM B;  2OTJ T;  2RM4 A;  2EYZ A;  1U1T A;  4LXC A;  5I2S A;  2KSS A;  1UHF A;  1JO8 A;  4K11 A;  3BY7 A;  1K9A A;  4F14 A;  4XAX B;  1JJ2 P;  1AWX A;  1JXO A;  3CCR Q;  2YRC A;  2R58 A;  3TSZ A;  4C5I A;  2DMO A;  4ZGE B;  3JAM E;  1KD1 C;  3G6E Q;  5D6Y A;  3SFM A;  1E6H A;  4FSS A;  3UDC A;  3X24 B;  4EMK A;  1YI2 Q;  2KEA A;  2M51 A;  2VXF A;  5KYN A;  2LT1 A;  3WXM B;  1VQK Q;  3MHX A;  2L89 A;  3Q1J A;  5D6W A;  3JB9 H;  4M77 G;  4J9I A;  2QA4 Q;  1J3T A;  3DB4 A;  4M78 D;  5CCA A;  3E2U A;  4LDV A;  4CC7 A;  4M78 A;  1AVZ C;  1W2B S;  2LX9 A;  3NTI A;  2JS0 A;  4FYV B;  4X34 A;  4Z8A A;  2AKK A;  1GXI E;  2E3I A;  3JSC A;  2VB6 A;  2DKG A;  2CDT A;  1UG1 A;  3OYA A;  2K57 A;  3E9F A;  5AYF A;  5GAO l;  1NBE B;  5CKF A;  5GAN 3;  5KYY B;  1D3B A;  3DLL A;  3I9Q A;  1HSQ A;  1U8R A;  4F7U G;  2JOY A;  1Q7Y U;  1H8K A;  1W2B A;  2RI2 A;  2E3H A;  5KE2 A;  1Q86 C;  2PQW A;  1BI2 A;  2FZK B;  4MZM A;  2HBW A;  1BIB A;  4E7L A;  4HXJ A;  1MV0 B;  4CI0 C;  3ZL7 C;  3DLM A;  1WXU A;  4AFU C;  2J6K A;  4MZT A;  1M1G A;  1M1F A;  4M75 F;  2K5L A;  2P84 A;  4ZTJ A;  1LNX A;  3A8L B;  1XJW B;  2KDS A;  3CCM A;  4F04 B;  1YJN T;  4J9C A;  4DBQ A;  4J6Y A;  1GBQ A;  2ZGW A;  4HKE A;  3CC4 A;  2QQB A;  4OGC A;  2A36 A;  5KYX A;  4QKU A;  4JZ3 A;  4B9X A;  1RAD B;  2RI5 A;  1I0C A;  1JU5 C;  1X27 A;  2XDP A;  1PM3 A;  2K7A A;  3L2W A;  2HBP A;  4M75 D;  1LVK A;  3HFN A;  4PJO D;  4NS5 A;  1FXX A;  2BUD A;  2KYB A;  2H8H A;  4FIB A;  3WVD B;  3OS0 A;  4M75 A;  2LNH B;  2HMA A;  1U06 A;  1VYV A;  4PJO A;  1U1S A;  1AZE A;  1PD0 A;  1M3A A;  4EIK A;  1V1C A;  3HPW A;  2PU9 B;  1M2O A;  1YFN A;  3PVQ A;  3ZFJ A;  3OA6 A;  4ANJ A;  1D1B A;  4J9G A;  2DL3 A;  3VJP A;  1OEB A;  3FLG A;  1GCQ C;  2DBK A;  1QVG S;  3GBQ A;  1WJQ A;  1VQP A;  3CCJ T;  2QYZ A;  4JS5 A;  2EQM A;  1SRM A;  4NL2 A;  2XHC A;  2XG8 D;  1VQO T;  2KMT A;  4EPC A;  1JB0 E;  1XOV A;  4C0G A;  1NPR A;  3JCM g;  2F2V A;  2NUP B;  4ATO A;  1TTH B;  1KHI A;  1WDX A;  2GTO A;  1NYF A;  1D0X A;  1YIT A;  2PVO B;  4J7I A;  2DL4 A;  1OZ3 A;  4QQ6 A;  3JCM P;  3X26 B;  1NM7 A;  1UDL A;  2WSF E;  1MUZ A;  3OMC A;  4ZTF A;  5KYU B;  2YWW A;  1TUC A;  1WZO A;  1RAE B;  2LMJ A;  4PFP A;  4M7D D;  2DM1 A;  1G3Y A;  3GP8 A;  1F1B B;  2ZPB B;  1KD1 R;  4HVV A;  5M9O A;  1PRM C;  2VWF A;  1Q7Y C;  1WYX A;  1TU0 B;  4HCC A;  2CP5 A;  5IHI A;  4AFZ C;  2EYW A;  3HRT A;  3PTA A;  5LJ5 j;  4R56 A;  2DVE A;  4PFO A;  2HKN A;  4A4F A;  1Y96 A;  3I55 Q;  3OMG A;  1YIJ Q;  2CUB A;  4RG8 A;  3P8B B;  2CP0 A;  1R8O B;  2D0N A;  3LGF A;  1NLO C;  2RJE A;  3QXE B;  4LUD A;  1K73 C;  4PKC C;  1OX9 A;  1WHL A;  2FPE A;  3VU3 C;  4C8Q G;  2DET A;  3EH1 A;  5DM7 R;  3JCM d;  1VQ6 T;  2LRQ A;  4PFZ A;  3P8D A;  1VQ9 T;  2DE0 X;  2QEX A;  4PJN A;  2EGC A;  4XTX A;  4Y91 A;  1Q86 R;  2K3B A;  3NHN A;  3CCJ A;  2ENM A;  4IUU A;  4R0K A;  3JCM e;  3OSV A;  1VQO A;  2IIM A;  2FRY A;  1WI7 A;  2LZ6 B;  1AWW A;  1M4Z A;  4GLM A;  2PZ1 A;  1NJI U;  4IUT A;  3QZ5 B;  2DER A;  3UT1 A;  1M5Q 1;  1YNZ A;  2XIC A;  4EDU A;  3D7S B;  2JMA A;  2K3Y A;  1K1Z A;  3REA B;  5LJ5 h;  4J8O A;  2HQE A;  1WQW A;  2V8K A;  1G3T A;  2JVV A;  2M1H A;  3MEU A;  4XTZ A;  2P0P A;  4JUV A;  4M77 D;  4HT9 A;  3M57 A;  2MCN A;  5CKE A;  2EJ9 A;  2X9H A;  4F7U F;  4M77 A;  3CEY A;  1WXT A;  4QVZ A;  2DXC A;  4C0Z A;  2X3W D;  1FMV A;  3JCM f;  1PKS A;  1UEC A;  2X4J A;  4GBQ A;  1KHC A;  2QAS A;  1TXQ A;  1VQN T;  2RD1 A;  3OYL A;  2HKQ B;  2DK3 A;  1YIT Q;  1TOV A;  3ASK A;  3PGG A;  3NTK A;  4BI4 A;  4QT7 A;  4FYY B;  1RI0 A;  4J5Y A;  2JJ9 A;  2ROT A;  3UWN A;  2HQX A;  4IIO A;  3JB9 G;  3VYG A;  2ZCF B;  2YUP A;  2OX7 A;  4F7U A;  1M27 C;  1M30 A;  4F17 A;  1VQM T;  2LJ0 A;  3RIR A;  1T3L A;  5LL6 S;  4AG2 C;  1WFW A;  5GAN g;  1K9M U;  1S1N A;  3L2R A;  2DTO A;  3A5Z B;  3M0R A;  2LQK A;  1OU8 A;  1QW1 A;  1IZ6 A;  5GAN h;  2GFU A;  3RDV A;  2P4T A;  4Y28 E;  5LJ5 e;  1QVF S;  1ZUY A;  8AT1 B;  3CC2 T;  4CRI A;  2DX1 A;  1ZBJ A;  2DD4 A;  3I35 A;  3QBY A;  3GIB A;  4M78 C;  4D6W A;  1YJ9 T;  3M59 A;  1PHT A;  1W2B P;  4O5V A;  4C0D B;  3VRZ A;  1Q7Y R;  3EG3 A;  4N0A A;  4LD6 A;  2NYS A;  3PIP A;  2BZX A;  5A0G A;  4HCB A;  1YWO A;  2PVG B;  1CKB A;  1PCX A;  2CRE A;  1GFC A;  2QG9 B;  1PG5 B;  5HK3 A;  1AOJ A;  1NJI C;  2QA4 A;  2E12 A;  3CCJ Q;  1M8V A;  1TUG B;  2E6N A;  4M4Z A;  5CR2 A;  4GLK A;  5LJ5 f;  1AD5 A;  1VQO Q;  1ZBX A;  9ATC B;  2DIQ A;  4OMQ A;  4RTY A;  2RHY A;  4J9F A;  4HVU A;  4XTY A;  3GOX A;  5C6S A;  5GAN 5;  4KUI A;  3M0U A;  1R0C B;  1FYN A;  2HL3 A;  2RN8 A;  2NUP A;  5IN1 A;  2LQN A;  2RHU A;  2DBM A;  5GAN d;  4A4H A;  3CCS T;  1MGQ A;  5DLO A;  1N5Z A;  4C0D C;  2FO0 A;  3JB9 J;  1WJR A;  2C0I A;  1X69 A;  2AZS A;  2F5K A;  2FB7 A;  1I81 A;  1LPL A;  2YXY A;  5CKB A;  1WNL A;  1UFF A;  5GAN e;  2A0F B;  1VQM A;  2KRO A;  3RNJ A;  1AWO A;  2PUK B;  4E7H A;  3SWN B;  2LDM A;  3CXC P;  2RK2 A;  1LOJ A;  4JJD A;  1FX7 A;  4QQG A;  4AFQ C;  2DXU A;  2M02 A;  2QDY B;  3NGP A;  1ABQ A;  3M4G A;  2D1X A;  1X43 A;  1BIA A;  4XU3 A;  4MMK A;  4PJO C;  1AT1 B;  2EGE A;  3V8K A;  3JCM X;  1QKW A;  4PLL A;  3J80 E;  3OW2 P;  3LWH A;  3QG1 A;  3S3O A;  2O31 A;  2A7Y A;  1YJ9 A;  1VQ4 A;  2RI3 A;  1ZSZ B;  1QKX A;  5GMK e;  3MJX A;  3A8O B;  1T0J A;  4C8Q F;  4FT2 A;  4MZP A;  4D8D A;  1BI0 A;  1TH7 A;  1NG2 A;  2BIV A;  3AT1 B;  1K9M C;  2LQ8 A;  5GAN f;  4XU2 A;  3REB B;  1VQ6 Q;  2KT1 A;  2DYB A;  2NUT B;  1H92 A;  4J9E A;  1VQ9 Q;  2JN0 A;  4FT4 A;  1N6A A;  1A0N B;  5A0D A;  3QDR B;  2EYQ A;  3PIO A;  3RBB B;  2KRM A;  2NUZ A;  1EIF A;  1W1F A;  5GJV B;  3IQL A;  2JT4 A;  3QWX X;  4E2F B;  2XD0 A;  3FRN A;  2XDD A;  2XU8 A;  2X4Y A;  2W0Z A;  3GF5 A;  4C8Q D;  2OTL T;  2KY9 A;  3KXT A;  1TUD A;  3CCQ T;  1QLY A;  5KE3 A;  5FU7 B;  2BTT A;  2HSP A;  4C8Q A;  2V8J A;  1ZSZ C;  4RMO A;  2B86 A;  3CCS A;  5LJ3 g;  1LCK A;  4KGV B;  1EFN A;  2ATC B;  2F2W A;  4RTV A;  1NEG A;  4M7D C;  1ZUU A;  4V2S A;  3OYC A;  5IHN A;  1YN8 A;  2CZ1 B;  3C95 A;  1ZHI A;  3JV3 A;  4DOV A;  1Y0M A;  3TRE A;  4C92 B;  2LNV A;  4Z89 A;  4RG2 A;  2QQA A;  3RKY A;  3RMQ A;  3EGX B;  1HJD A;  1TG0 A;  1UHC A;  3C0C A;  3CMA T;  2A08 A;  4KGX B;  2D8H A;  5KCO A;  3N5B B;  5CQX A;  2JM8 A;  5FU7 C;  1QP3 A;  5ECA A;  2AHJ B;  4Z02 A;  3NTH A;  4JPB W;  3LGL A;  3I56 T;  2CP7 A;  2RF0 A;  4LUE A;  2J7I A;  2O9V A;  1GFD A;  3L1A A;  3JB9 F;  2D9T A;  2CSQ A;  1D1C A;  1OPL A;  1W70 A;  1GBR A;  3M0Q A;  2DF6 A;  1N9R A;  2LX7 A;  5FU6 C;  1VIF A;  2DZ9 A;  5CKH A;  1JXM A;  1GL5 A;  4C92 C;  1R0B G;  1VQM Q;  1AHJ B;  1NJI R;  2A37 A;  3KUF A;  2LTO A;  3OY9 A;  2CT4 A;  3L42 A;  3VS3 A;  2EVR A;  2DNU A;  2MPX C;  4BI8 B;  2AK5 A;  5LJ3 d;  4OB1 B;  2R5M A;  2O9S A;  3VUB A;  2NWM A;  1VQ7 T;  3I55 A;  1M9S A;  1YIJ A;  2ED1 A;  2OTJ A;  5IXB A;  4IUP A;  3JCM b;  3JB9 D;  1RL2 A;  1BI3 A;  2MIO A;  3GNF B;  3CC2 Q;  3J7A F;  2RA2 A;  3A8G B;  5GAN 8;  1K0S A;  2MYS A;  5LJ3 e;  2OTL A;  2EWN A;  1B34 B;  2H3J A;  1D0Y A;  2DXT A;  2JW4 A;  5FWB A;  4A54 A;  3BDU A;  5GJW B;  4E7K A;  1YJ9 Q;  1WHH A;  1VQ4 Q;  3TEE A;  1RAA B;  3A1P A;  3JCM W;  2GQV A;  1NZ9 A;  3EGD B;  2VV5 A;  4E47 A;  4A53 A;  2KAF A;  2XK0 A;  2E5K A;  3RR6 A;  3UF4 A;  2L3Q A;  2YUQ A;  1QP2 A;  2VVK A;  3GLX A;  2DTH A;  4FYX B;  4M77 C;  1QVP A;  3OYM A;  1B3Q A;  2G3R A;  1C6V X;  2F1L A;  5GAN 7;  2QQR A;  1Z9Q A;  2JUF A;  3WVE B;  2DLP A;  2DTI A;  2QTV A;  4XTW A;  1Q81 U;  3EFO B;  2QQS A;  4J83 A;  3CMA A;  2ROL A;  4DQ2 A;  3V8L A;  2X35 A;  3HL8 A;  2FYK A;  1UGR B;  5LJ3 f;  2GQI A;  1XTD A;  4C92 E;  3R6O A;  1ZSG A;  2RQW A;  2AIR B;  4EMG A;  3O5Z A;  1SHF A;  3CCS Q;  2PNI A;  3CCV T;  3G71 T;  2DEU A;  1K9M R;  2VKN A;  1GCP A;  1S72 T;  1MV3 A;  4AFS C;  1I5O B;  4UC4 A;  1BYM A;  1UE9 A;  3VS0 A;  1TSF A;  1M2V A;  2C0O A;  1D09 B;  2VUB A;  3FJP A;  1M1K U;  2RO0 A;  2CZ0 B;  4RTU A;  2DXB A;  3BE3 A;  5IH2 A;  3SWN A;  4BE0 A;  3VS5 A;  2OAU A;  2E70 A;  3C4S A;  4QVC A;  4N4H A;  3M0S A;  4J7F A;  3JCM h;  1WJS A;  2X4X A;  2DO3 A;  2JTF A;  1QVG A;  2DL8 A;  1Y71 A;  4PLI A;  1XNI A;  3NFC A;  4J9D A;  1JJ2 S;  4A4G A;  2CS7 A;  5KYW B;  2HSE B;  1YJN A;  1H64 1;  4ZN3 A;  2QDL A;  3UA6 A;  4FW2 A;  3L2Q A;  1RAI B;  2IVW A;  1RAF B;  1VYU A;  2V1R A;  2CH4 W;  3HSB A;  4XTU A;  1Q95 G;  3R6N A;  7AT1 B;  3TSW A;  1VQ5 T;  2M9U A;  3S6W A;  3PMI A;  3LH5 A;  4IUV A;  4JRQ A;  1B07 A;  2RJF A;  1BB9 A;  1JJ2 A;  1ZUK A;  1WQ7 A;  2L5Q A;  4ZGJ B;  2JTM A;  3G7Z A;  3MP1 A;  3JCM J;  2DD5 A;  2DVJ A;  2FZG B;  3M54 A;  2F69 A;  3UA7 A;  2OTJ Q;  3BW1 A;  1KQ1 A;  1JBM A;  3EHR A;  2M16 A;  3EG9 B;  2LJ3 A;  4M7A C;  4BY6 C;  5CVI A;  3CBM A;  4DBR A;  4OMN A;  1G8X A;  2OTL Q;  1H3H A;  1QWE A;  1JEG A;  2ED0 A;  3O8V A;  2JS2 A;  2YRD A;  1MMA A;  2RNA A;  2VAS A;  2P0K A;  3LYI A;  3I5R A;  1S72 A;  3PVL A;  3MP6 A;  4OB0 B;  2E4H A;  2JM9 A;  3UAT A;  1CKA A;  3V7R A;  1WGS A;  3H9N A;  1KQS S;  2Y90 A;  1MNE A;  4ORZ A;  3EGU A;  1Q81 C;  4WTO B;  1BCM A;  1RAG B;  5J3B A;  2CT3 A;  3QWY A;  4KUL A;  4DBH A;  3DB3 A;  1RUW A;  3V8J A;  2KVQ G;  4FM4 B;  4QQD A;  3CMA Q;  4E6R A;  4LNP A;  1E7O A;  2CKK A;  1K76 A;  1Y57 A;  3MP8 A;  5L23 A;  3RMS A;  3VS7 A;  1HK9 A;  1MND A;  5HKC A;  2JMC A;  1KQS A;  2V1Q A;  1YHQ T;  2DL7 A;  2PVD B;  5GAO p;  5GAN j;  4OGE A;  1TS9 A;  1VIE A;  3EG1 A;  4DBF A;  1SEM A;  1I4K 1;  3TU4 K;  2HAX A;  4OMM A;  1U3O A;  5KYY A;  1M1K C;  2M0O A;  5I11 A;  2LC4 A;  4M78 G;  4OVA A;  4BE1 A;  5D7U A;  2IG0 A;  3SDZ A;  4MDW A;  2DYI A;  2DZC A;  3M58 A;  2D8J A;  2K79 A;  4FCY A;  1OUL A;  3GPL A;  3ER0 A;  5I2M A;  3JCM V;  1VQK T;  5GAM g;  3INZ A;  2CP6 A;  2DAQ A;  1I07 A;  4L59 A;  1VA7 A;  5GAO r;  2RHX A;  4AT1 B;  2CSI A;  1WHG A;  3HTR A;  4Q5W A;  4M78 B;  4IUR A;  2AZV A;  1IGU A;  5GMK j;  2QK0 A;  1Q82 U;  4BDZ A;  2EYY A;  3SHW A;  4DOW A;  1YJN Q;  1VQ6 A;  2LT4 A;  4OMO A;  3ZBD A;  1D3B B;  2E41 A;  5GAO n;  1VQ9 A;  4JJN K;  4EMK C;  5GAN 4;  2XKO C;  2AKL A;  4RCB A;  3MEA A;  3A98 A;  3FC3 A;  3EGD A;  4OB3 B;  1PD1 A;  3H0F A;  4DEX A;  1GCQ A;  1WLP B;  2LCL A;  3H6Z A;  1NPP A;  4ZN1 A;  1NYG A;  3X25 B;  3OYF A;  2E10 A;  2SRC A;  2EAY A;  3GNG A;  2FL7 A;  4WCI A;  4KT0 E;  3MKD A;  3EFO A;  3E19 A;  2BZY A;  3EG2 A;  2HZY A;  1E6G A;  3DKM A;  2DEQ A;  1CSK A;  1W6X A;  4XTV A;  4ME7 A;  1N8R U;  4KH0 B;  2MI6 A;  1YHQ A;  5IXF A;  1AWJ A;  3L2U A;  1QVF A;  1N27 A;  4AG1 C;  5GAM d;  3CCV Q;  3G71 Q;  2K3X A;  4Z88 A;  1S72 Q;  3OBW A;  5GMK h;  2HEQ A;  4DEY A;  1PC0 A;  5CO7 A;  4F16 A;  1RAC B;  1G2B A;  3VV0 A;  3CD6 T;  5KYX B;  2KQW A;  3CBO A;  3A8M B;  2YLC A;  4O6J A;  3CCU T;  4LDW A;  3OB9 A;  2EJG A;  1KC8 U;  1G3W A;  1RI9 A;  8ATC B;  1VQN A;  2L3S A;  4D8K A;  2RQV A;  2K6D A;  3PFS A;  4J6W A;  4M75 B;  1VQL T;  3CME T;  4PJO B;  3BFM A;  1RAB B;  3THK A;  2A3L A;  2KT8 A;  1D1A A;  2YHT A;  3QJY A;  3OYJ A;  1BCO A;  3QPH A;  3CCE T;  2DIL A;  2YRV A;  5KYU A;  1QWF A;  2XID A;  1MMN A;  3A8H B;  4C5H A;  2CP3 A;  2MWO A;  4Y92 A;  5EG2 A;  1RAH B;  2BKD N;  3KFV A;  4RTT A;  2JZ2 A;  4M78 E;  2HQH A;  3CCL T;  1Q81 R;  1VUB A;  1KJW A;  3S3M A;  1IXD A;  3OYB A;  1UGQ B;  5CKD A;  1VQ5 Q;  4MML A;  2PUO B;  1UB4 A;  2HNI A;  3CC2 A;  4M7D G;  2QI2 A;  2LJ1 A;  2LVM A;  4M75 C;  5CAI A;  4OF1 A;  5LJ3 j;  4DA4 A;  4X1V A;  3ME9 A;  4R55 A;  2DA9 A;  5CK9 A;  3M55 A;  3EG9 A;  2FPF A;  2W10 A;  2E6Z A;  1FWZ A;  3LH0 A;  1M90 U;  3FEO A;  2Z0W A;  1M1K R;  3OYH A;  2GFA A;  4M7D B;  1OOT A;  1OPK A;  1G83 A;  2QQ9 A;  5FLX E;  2HD0 A;  1KFZ A;  3OYN A;  4C0F A;  1O75 A;  4FU6 A;  1QVG P;  5C0M A;  1AEY A;  4BDY A;  3CD6 A;  2DJZ A;  3QII A;  2XMF A;  2CH4 A;  3CCU A;  5HY6 A;  4OML A;  2RH2 A;  1IB8 A;  3PMT A;  1M3C A;  4PJM A;  1Z9Z A;  4C92 G;  1Y96 B;  2DRM A;  3QSU A;  4J6X A;  3CME A;  2QAZ A;  2VXE A;  3EG0 A;  4RTZ A;  2L2P A;  1WHM A;  2EQU A;  4AMC A;  3H0H A;  3CCE A;  4OB2 B;  4LDX A;  3VKI A;  3JB9 I;  3ULR B;  4JJB A;  5LJ3 h;  4ZGD B;  1IGQ A;  4A4K A;  1YHQ Q;  3U23 A;  2X51 A;  2JXB A;  2SEM A;  1OU9 A;  2EFI A;  5FU6 B;  2JNG A;  3FB9 A;  2KXC A;  5GMK i;  2H3E B;  3OS2 A;  3CCM T;  3E9G A;  2I0N A;  2GTJ A;  4M78 F;  1UGV A;  4J9H A;  4M75 E;  3VUZ A;  4PJO E;  2CP2 A;  3OSS C;  5L8R E;  2G6F X;  3CCL A;  1T3S A;  1KC8 C;  2RMO A;  2CZ7 B;  3JCM Q;  1WHK A;  3M56 A;  3QHS A;  1YP5 A;  4KRT A;  3CC4 T;  2J06 A;  2D0Q B;  4OP0 A;  1HYO A;  3L2V A;  3LLR A;  1VQN Q;  3TCJ A;  1HXD A;  3V7S A;  2ESW A;  4JLI A;  1YCY A;  2E5Q A;  3NPF A;  1OX8 A;  1P92 A;  4JZ4 A;  3H8Z A;  1R77 A;  1SKU B;  4RKU E;  3OYY A;  1T0H A;  2DIG A;  1X2K A;  5GAN 6;  2COZ A;  2V8I A;  2BZ8 A;  1B7T A;  4KUD K;  2VC8 A;  3HFO A;  3OS5 A;  4PJL A;  3OYE A;  4XQ3 A;  5KH6 A;  4BUG A;  2K2M A;  4GY5 A;  4IKF A;  2O88 A;  1ZA1 B;  1BU1 A;  4M77 B;  3EFS A;  4BB7 A;  2RQR A;  2B8A A;  1UGP B;  2E64 A;  1DJ7 B;  2PTK A;  1X01 A;  4LN2 A;  2E1H A;  1VQP T;  1KQS P;  3NMZ C;  2EIF A;  1ZLM A;  2K5I A;  4M7D E;  1NE8 A;  4OMF B;  5I22 A;  3X28 B;  1I1J A;  4ESR A;  3X20 B;  3CCQ A;  1OQK A;  4ELY C;  3FIF A;  4II1 A;  3MEW A;  3KBG A;  3S3N A;  1G3S A;  2DFU A;  2MOX A;  5D6X A;  1M90 C;  1YIT T;  1SRL A;  4X9C A;  3E1S A;  3RUX A;  5EC7 A;  1SHG A;  1NLP C;  2MWP A;  2NLU A;  2EKH A;  2FRW A;  4PJO F;  4F7U B;  1M8M A;  2J05 A;  4L6V 5;  5FWC A;  2COY A;  3MPU B;  3C94 A;  1EZZ B;  5J39 A;  4LDU A;  1YWP A;  4XU0 A;  1YBY A;  3CXC S;  2RQT A;  1K73 U;  3J81 E;  2R5A A;  5DLQ E;  1BKB A;  2GNC A;  3URG A;  1UJ0 A;  5GMK m;  4VUB A;  4E7S A;  2L0A A;  3CD6 Q;  1UEB A;  2QGF B;  2QXF A;  4OMP A;  1QMC A;  4PJJ A;  3CCU Q;  4CC4 B;  3G4S T;  1Q82 R;  4TVR A;  3CPW S;  2YT6 A;  1PNJ A;  4NL3 A;  1UGS B;  3I56 A;  6AT1 B;  4ELZ C;  1KK7 A;  1Y7X A;  2MF2 A;  2OJ2 A;  2XDB A;  1VQL Q;  3QYH B;  3CPF A;  3CME Q;  5IAY A;  3OW2 S;  1QCF A;  3HKS A;  4A63 B;  5CIU A;  2LCC A;  1ABO A;  3CXC A;  3VS4 A;  3CCE Q;  4HCK A;  2O4X B;  1YCS B;  2EYX A;  1UJY A;  3HRU A;  4M7A G;  1X2Q A;  1C0M A;  2M0Y A;  3VS1 A;  3CPW A;  4N4I A;  1W4S A;  2MMP A;  3PNW C;  2L8D A;  2WSE E;  1JRI A;  1JQQ A;  4KGZ B;  3CCL Q;  2RHZ A;  2QEX T;  3OW2 A;  1K8A U;  4FL6 A;  2CZ6 B;  1VQ7 A;  1VYT A;  1PKT A;  4M7D F;  3OBY A;  3CQT A;  1UTI A;  1BK2 A;  1RLQ C;  4L5G A;  3FDR A;  4FW1 A;  2EW3 A;  2VYT A;  5HCK A;  1QVF P;  4JRK A;  1N8R R;  4JDS A;  3P8H A;  4M7A B;  1PWT A;  4BY6 B;  2FPD A;  2ZPF B;  2ABL A;  2YDL A;  2ZZD A;  2L3R A;  5IT9 E;  4M77 E;  5I21 A;  1X6B A;  2QTX A;  1G5V A;  2ZPI B;  2RB6 A;  3CBP A;  3QKJ A;  1FMW A;  2CGH A;  2RPN A;  1ZSZ A;  4RTX A;  4N0A C;  2KYM A;  4KH1 B;  5GAN 2;  5A2Q E;  4JJC A;  1GRI A;  2KI7 A;  3LW5 E;  2QGG A;  3SEM A;  4HCZ A;  2GF7 A;  1KC8 R;  3VRY A;  4M7D A;  2NUT A;  2AT1 B;  2P4R A;  1QQJ A;  2WSC E; 
#chains in the Genus database with same CATH homology
 2A7Y A;  5GAN 4;  1YJ9 A;  2XKO C;  3OQ5 A;  1VQ4 A;  4RCB A;  3DLM A;  2RI3 A;  3MEA A;  4BE2 A;  5GMK e;  3FC3 A;  3A8O B;  4C8Q F;  4FT2 A;  4OB3 B;  4MZP A;  4MZT A;  4F7U E;  4C92 F;  1M1G A;  1M1F A;  3T9N A;  1BI0 A;  1TH7 A;  2BIV A;  4M75 F;  3G4S A;  2LCL A;  3H6Z A;  1NPP A;  2K5L A;  2LQ8 A;  5GAN f;  4ZTJ A;  1K9M C;  3V7C A;  1H3Z A;  1LNX A;  3A8L B;  4XU2 A;  4ZN1 A;  3X25 B;  3OYF A;  2KDS A;  3CCM A;  2E10 A;  2EAY A;  2JN0 A;  4FT4 A;  3GNG A;  1YJN T;  1N6A A;  4EMH A;  2FL7 A;  3QDR B;  4J6Y A;  5A0D A;  5GAO q;  2EYQ A;  3PIO A;  3G71 A;  3CCV A;  4X9D A;  4BI3 A;  4KT0 E;  1EIF A;  3E19 A;  2DPP B;  2K4Y A;  2XI9 A;  2ZGW A;  4HKE A;  4BAC A;  1YJ9 T;  3CC4 A;  2XD0 A;  3FRN A;  2XDD A;  3DKM A;  2XU8 A;  2QQB A;  4OGC A;  2DEQ A;  2X4Y A;  4XTV A;  4ME7 A;  1N8R U;  1I8F A;  2MI6 A;  4B9X A;  5GAM j;  1YHQ A;  2RI5 A;  3GF5 A;  4C8Q D;  4A4E A;  2XDP A;  3L2U A;  2OTL T;  2KY9 A;  3KXT A;  1QVF A;  1N27 A;  3RER A;  4C92 D;  3L2W A;  3CCQ T;  3M5A A;  5KE3 A;  5GAM d;  5FU7 B;  2HBP A;  4M75 D;  3UPU A;  4C8Q A;  3HFN A;  3CC7 T;  2K3X A;  2V8J A;  3LWI A;  4PJO D;  3SB2 A;  4NS5 A;  4RMO A;  4C92 A;  1FXX A;  2BUD A;  4FIB A;  3WVD B;  5LJ3 g;  3OS0 A;  3CCS A;  3OBW A;  4M75 A;  5GMK h;  2KK4 A;  4PJO A;  1U1S A;  1YJW T;  3MET A;  5CO7 A;  3QYG B;  5J26 A;  3MCA B;  3HPW A;  3VV0 A;  4M7D C;  3CD6 T;  2PU9 B;  2KQW A;  5FRM A;  4V2S A;  3CBO A;  3HHT B;  3A8M B;  3OYC A;  2YLC A;  3ZFJ A;  4M77 F;  4O6J A;  3CCU T;  2MAM A;  5HK0 A;  4LDW A;  2CZ1 B;  3C95 A;  3OB9 A;  3OA6 A;  1ZHI A;  2EJG A;  1KC8 U;  1G3W A;  1VQN A;  3M4Y A;  4DOV A;  4C8Q B;  2K2V A;  3TRE A;  5FRN A;  3PFS A;  4J6W A;  5LJ5 g;  3QUI A;  2LNV A;  4C92 B;  3CCR T;  3VJP A;  4M75 B;  1VQL T;  3CME T;  4PJO B;  4RG2 A;  2QQA A;  3FLG A;  3RKY A;  3BFM A;  3RMQ A;  2A3L A;  1KG1 A;  5GMK l;  1QVG S;  2YHT A;  3QJY A;  3CMA T;  1WPY A;  3OYJ A;  3QPH A;  1WJQ A;  4EMK B;  3G6E T;  1VQP A;  3CCE T;  3CCJ T;  5KCO A;  2YRV A;  3N5B B;  4JS5 A;  2EQM A;  5CQX A;  4NL2 A;  2XHC A;  1K8A C;  4M7A E;  1YI2 T;  2XG8 D;  1QP3 A;  5FU7 C;  1VQO T;  2AHJ B;  2KMT A;  3PT9 A;  1JB0 E;  1XOV A;  4EPC A;  1VQ5 A;  4Z02 A;  3NTH A;  2XID A;  3LGL A;  4C0G A;  3I56 T;  3A8H B;  4C5H A;  1NPR A;  2MWO A;  3JCM g;  5EG2 A;  4ATO A;  1KHI A;  3L1A A;  4RCC A;  3JB9 F;  1YIT A;  2BKD N;  2ZPG B;  2D9T A;  4B9W A;  2JZ2 A;  2PVO B;  4J7I A;  4M78 E;  3CCL T;  1OZ3 A;  4QQ6 A;  2QA4 T;  3JCM P;  1VUB A;  2ZPE B;  2F5T X;  3X26 B;  3S3M A;  1N9R A;  3VYH B;  5GAM h;  5FU6 C;  2WSF E;  3OMC A;  1VIF A;  1UGQ B;  3OYB A;  5CKD A;  4ZTF A;  2DZ9 A;  2YLB A;  5CKH A;  4C8Q C;  4MML A;  2PUO B;  4M7D D;  1UB4 A;  2HNI A;  3ZEH A;  3CC2 A;  4C92 C;  4M7D G;  1AHJ B;  1PSF A;  2QI2 A;  1G3Y A;  2LVM A;  4XK8 E;  3GP8 A;  4M75 C;  2ZPB B;  5CAI A;  1B34 A;  3KUF A;  2LTO A;  4OF1 A;  5LJ3 j;  4DA4 A;  3OY9 A;  3L42 A;  3QZ9 B;  5M9O A;  1Q7Y C;  1NJI U;  4BD3 A;  4BI8 B;  4HT8 A;  5LJ3 d;  4OB1 B;  2R5M A;  4C5E A;  3VUB A;  3ME9 A;  4R55 A;  1VQ7 T;  1X6O A;  3I55 A;  1M9S A;  1YIJ A;  2RJC A;  4HCC A;  2OTJ A;  4IUP A;  5CK9 A;  3JCM b;  3M55 A;  3JB9 D;  1RL2 A;  1BI3 A;  3GNF B;  2E6Z A;  3MEV A;  3OS1 A;  3J7A F;  1FWZ A;  2RA2 A;  3A8G B;  3LH0 A;  3FEO A;  3M9Q A;  2Y4X A;  5GAN 8;  1M90 U;  1VQ8 A;  3HRT A;  3PTA A;  5LJ3 e;  5LJ5 j;  2OTL A;  2EWN A;  3OYH A;  2GFA A;  1B34 B;  2H3J A;  4M7D B;  4R56 A;  2DVE A;  2DXT A;  4A4F A;  3CC7 A;  2VGM A;  4A54 A;  3JRZ A;  5LJ5 d;  3BDU A;  2E65 A;  4E7K A;  1Y96 A;  2QQ9 A;  2Y4Y A;  3OMG A;  5FLX E;  2HD0 A;  4RG8 A;  4JLG A;  5FRO A;  3TEE A;  3SD4 A;  3P8B B;  3OYN A;  3JCM W;  4C0F A;  2VGN A;  1YJW A;  2GQV A;  1O75 A;  1NZ9 A;  4FU6 A;  2VV5 A;  1R8O B;  5C0M A;  3LGF A;  4E47 A;  4A53 A;  4BDY A;  3CD6 A;  2DJZ A;  3QII A;  2KAF A;  2RJE A;  2XK0 A;  3QXE B;  5DY9 A;  3CCU A;  1K73 C;  4PKC C;  2P0Q A;  5HY6 A;  1PSE A;  2RH2 A;  1QP2 A;  3GLX A;  3PMT A;  2DTH A;  3VU3 C;  4C8Q G;  4M77 C;  4C5G A;  2EQK A;  1OZ2 A;  3JCM d;  5DM7 R;  4C92 G;  3CCR A;  2RJD A;  1QVP A;  2X4W A;  3OYM A;  1Y96 B;  2LRQ A;  1VQ6 T;  2G3R A;  1O9S A;  3HP9 A;  3P8D A;  4M75 G;  3QSU A;  4J6X A;  3CME A;  1VQ9 T;  2K5F A;  5GAN 7;  4PJO G;  2QQR A;  2JUF A;  2RHI A;  2VXE A;  2QEX A;  3WVE B;  2DTI A;  4XTW A;  1VQ4 T;  1Q81 U;  4M7A F;  2EQU A;  2QQS A;  4J83 A;  1MHN A;  4XTX A;  4Y91 A;  2FHD A;  3C12 A;  3CMA A;  2O4X A;  3G6E A;  3CCE A;  4WF2 A;  4OB2 B;  5CQY A;  4DQ2 A;  3CCJ A;  3V8L A;  4IUU A;  4LDX A;  3VKI A;  3EAE A;  5A0L A;  3JCM e;  3JB9 I;  2X35 A;  2RK1 A;  1YI2 A;  3OSV A;  5GAM e;  3HL8 A;  5LJ3 h;  2FYK A;  4A4K A;  1UGR B;  4ZGD B;  1VQO A;  5LJ3 f;  2EFI A;  5FU6 B;  1OI1 A;  1XTD A;  4C8Q E;  4JS4 A;  2JNG A;  3FB9 A;  1M4Z A;  4QW2 A;  5GMK i;  4C92 E;  3R6O A;  1V29 B;  4IUT A;  3OS2 A;  3E9G A;  4M78 F;  3CCM T;  1KD1 U;  1VQK A;  3VUZ A;  3QZ5 B;  4M75 E;  4EMG A;  4PJO E;  3UT1 A;  1OYX A;  5GAO m;  3OSS C;  5L8R E;  1M5Q 1;  2XIC A;  4EDU A;  3G71 T;  3CCV T;  3RKW A;  2K3Y A;  3CCL A;  1KC8 C;  1S72 T;  1Y07 A;  2CZ7 B;  3BDL A;  3JCM Q;  2CYZ B;  4E7J A;  3M56 A;  3QHS A;  3QJ6 A;  4UC4 A;  5LJ5 h;  1BYM A;  3CC4 T;  4MDX A;  2D0Q B;  4J8O A;  4OP0 A;  2HQE A;  4LDY A;  4YTL A;  4M7A D;  3L2V A;  3M53 A;  1I5L A;  2D6F A;  1WQW A;  2VUB A;  4LD9 K;  3LLR A;  3FJP A;  3JCM c;  1M1K U;  2V8K A;  3OYK A;  1G3T A;  2JVV A;  2M1H A;  3TCJ A;  4M7A A;  3MEU A;  1HXD A;  4XTZ A;  3V7S A;  2RO0 A;  2P0P A;  2CZ0 B;  4JLI A;  2DXB A;  4JUV A;  4M77 D;  1YCY A;  3SWN A;  4BE0 A;  2E5Q A;  3M57 A;  4HT9 A;  2OAU A;  5CKE A;  2EJ9 A;  1P92 A;  1N9S A;  2EQJ A;  4F7U F;  3H8Z A;  4RKU E;  4PL6 A;  2E70 A;  3C4S A;  3CEY A;  4M77 A;  4QVC A;  4QVZ A;  2DXC A;  3OYY A;  4J7F A;  4N4H A;  4C0Z A;  2DIG A;  3JCM h;  1WJS A;  2X4X A;  2DO3 A;  3JCM f;  2JTF A;  3EFR A;  5GAM f;  1QVG A;  2X4J A;  5GAN 6;  4KBM B;  3OYI A;  1KHC A;  2EKO A;  1Y71 A;  3L2Z A;  4PLI A;  2V8I A;  1XNI A;  3NFC A;  1JJ2 S;  4KUD K;  3QO3 A;  4A4G A;  1VQN T;  2RD1 A;  2VC8 A;  2CS7 A;  3HFO A;  3OYL A;  2R57 A;  3OS5 A;  3OYE A;  4XQ3 A;  2FVU A;  1YJN A;  2DK3 A;  5KH6 A;  4BUG A;  3ASK A;  4GY5 A;  4IKF A;  1H64 1;  4ZN3 A;  3PGG A;  4M77 B;  1Q82 C;  2I2L A;  1SSF A;  3EFS A;  4BB7 A;  3OYG A;  3NTK A;  4BI4 A;  1XQH A;  3LX7 A;  3L2Q A;  1Q86 U;  1IRE B;  2B8A A;  3AHU A;  2IVW A;  1UGP B;  2E64 A;  3F70 A;  1DJ7 B;  1RI0 A;  4J5Y A;  1X01 A;  3UWN A;  2E1H A;  2HQX A;  3JB9 G;  1VQP T;  3HSB A;  2O01 E;  4HA8 A;  4XTU A;  3VYG A;  1BI1 A;  2EIF A;  2K5I A;  4M7D E;  1NE8 A;  2ZCF B;  4OMF B;  3X28 B;  4F7U A;  2M9U A;  3S6W A;  3MO8 A;  3PMI A;  1VQ5 T;  4IUV A;  4JRQ A;  2RJF A;  2WAC A;  4IUQ A;  3X20 B;  3CCQ A;  1VQM T;  4ELY C;  1JJ2 A;  1ZQ1 A;  3FIF A;  3OYD A;  4II1 A;  3MEW A;  1WQ7 A;  2L5Q A;  4ZGJ B;  2JTM A;  3G7Z A;  3KBG A;  3MP1 A;  3RIR A;  1LJO A;  3JCM J;  3S3N A;  1G3S A;  2DD5 A;  5D6X A;  5LL6 S;  1M90 C;  1YIT T;  1KQ2 A;  3RES A;  5GAN g;  1K9M U;  3M54 A;  2F69 A;  4FSX A;  3L2R A;  4X9C A;  3BW1 A;  1KQ1 A;  3E1S A;  1JBM A;  3RUX A;  2C06 A;  2DTO A;  3RKX A;  3A5Z B;  3HRS A;  2M16 A;  2MWP A;  2NLU A;  2LQK A;  4M7A C;  1QW1 A;  1IZ6 A;  4BY6 C;  5CVI A;  3CBM A;  5GAN h;  4P5N A;  2GFU A;  5LJ5 e;  2P4T A;  4Y28 E;  4PJO F;  1QVF S;  5KCH A;  4F7U B;  3SWN C;  3CC2 T;  4L6V 5;  4CRI A;  3O8V A;  4NOY A;  4E7I A;  1VQ8 T;  4JRP A;  3C94 A;  2DD4 A;  5J39 A;  2P0K A;  4LDU A;  2GCX A;  3LYI A;  3QBY A;  4XU0 A;  1YBY A;  4QVD A;  4N4G A;  3CXC S;  3GIB A;  4M78 C;  4D6W A;  1K73 U;  3J81 E;  2R5A A;  1VQL A;  2ZPH B;  4PNO A;  5DLQ E;  2EJF A;  1S72 A;  1N8R C;  3MP6 A;  1BKB A;  4OB0 B;  4XU1 A;  4JRI A;  1X75 C;  3M59 A;  3I55 T;  1YIJ T;  3URG A;  5GMK m;  4VUB A;  2OTJ T;  2RM4 A;  1UEB A;  1U1T A;  2QXF A;  5I2S A;  3V7R A;  1WGS A;  2KSS A;  4O5V A;  4C0D B;  1KQS S;  2Y90 A;  3BY7 A;  3G4S T;  1Q81 C;  4TVR A;  3CPW S;  4NL3 A;  4N0A A;  4XAX B;  4LD6 A;  1UGS B;  5J3B A;  3I56 A;  3PIP A;  4ELZ C;  5A0G A;  2R58 A;  4HCB A;  1Y7X A;  2MF2 A;  4KUL A;  3S3O A;  2PVG B;  2XDB A;  3QYH B;  3CPF A;  3DB3 A;  5IAY A;  3OW2 S;  3V8J A;  4C5I A;  2KVQ G;  3HKS A;  4FM4 B;  4ZGE B;  5HK3 A;  5CIU A;  2LCC A;  3CXC A;  3JAM E;  4QQD A;  1NJI C;  2QA4 A;  1KD1 C;  2CKK A;  2E12 A;  5D6Y A;  3SFM A;  2O4X B;  1M8V A;  2E6N A;  5CR2 A;  3MP8 A;  4GLK A;  3UDC A;  3X24 B;  4EMK A;  5LJ5 f;  3RMS A;  3HRU A;  1HK9 A;  1ZBX A;  2DIQ A;  5HKC A;  1KQS A;  4M7A G;  2RHY A;  2VXF A;  4XTY A;  3GOX A;  5C6S A;  2LT1 A;  5GAN 5;  3WXM B;  1YHQ T;  4KUI A;  3CPW A;  4N4I A;  1W4S A;  2PVD B;  2MMP A;  3PNW C;  5GAO p;  5GAN j;  2L8D A;  2WSE E;  4OGE A;  1JRI A;  3MHX A;  2L89 A;  3Q1J A;  5D6W A;  5IN1 A;  1VIE A;  2RHU A;  1I4K 1;  3TU4 K;  2RHZ A;  4M77 G;  2QEX T;  3OW2 A;  2HAX A;  5GAN d;  3JB9 H;  1K8A U;  1M1K C;  4FL6 A;  4A4H A;  2CZ6 B;  1MGQ A;  2M0O A;  5DLO A;  3CCS T;  2LC4 A;  1VQ7 A;  3DB4 A;  4M78 D;  4C0D C;  4M78 G;  4M7D F;  5CCA A;  4OVA A;  3OBY A;  1WJR A;  4BE1 A;  3JB9 J;  4LDV A;  2IG0 A;  3SDZ A;  4MDW A;  2F5K A;  4M78 A;  2FB7 A;  1W2B S;  4L5G A;  2LX9 A;  3NTI A;  1I81 A;  3FDR A;  2DZC A;  2VYT A;  4X34 A;  3M58 A;  5CKB A;  1WNL A;  4JRK A;  5GAN e;  4JDS A;  3P8H A;  3ER0 A;  4M7A B;  3GPL A;  4BY6 B;  1VQM A;  1GXI E;  3JSC A;  2ZPF B;  5I2M A;  3JCM V;  2ZZD A;  1VQK T;  2PUK B;  2DKG A;  5GAM g;  3INZ A;  4E7H A;  2L3R A;  5IT9 E;  4M77 E;  3OYA A;  3SWN B;  2K57 A;  3E9F A;  2DAQ A;  5AYF A;  5I21 A;  5GAO l;  5CKF A;  5GAN 3;  2LDM A;  1D3B A;  2RK2 A;  1LOJ A;  2QTX A;  1FX7 A;  1G5V A;  2ZPI B;  4QQG A;  4L59 A;  3DLL A;  5GAO r;  2RB6 A;  2RHX A;  3CBP A;  3QKJ A;  2CGH A;  4Q5W A;  1U8R A;  4M78 B;  4IUR A;  4N0A C;  5GAN 2;  5A2Q E;  5GMK j;  2DXU A;  4F7U G;  2JOY A;  2QDY B;  1Q7Y U;  1W2B A;  2RI2 A;  3LW5 E;  1Q82 U;  3M4G A;  5KE2 A;  1Q86 C;  2PQW A;  1BI2 A;  4HCZ A;  2GF7 A;  4BDZ A;  1BIA A;  4MZM A;  4XU3 A;  4MMK A;  4M7D A;  4PJO C;  4DOW A;  3V8K A;  3JCM X;  1BIB A;  4PLL A;  1VQ6 A;  2LT4 A;  3J80 E;  4E7L A;  3ZBD A;  1D3B B;  2E41 A;  5GAO n;  4CI0 C;  3LWH A;  3QG1 A;  4JJN K;  1VQ9 A;  2WSC E;  4EMK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...