4X9CA

1.4a crystal structure of hfq from methanococcus jannaschii
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
PNFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDYIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of RNA-binding properties of the archaeal Hfq-like protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
molecule keywords Uncharacterized protein MJ1435
total genus 10
structure length 57
sequence length 57
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4x9cA00
1I5LA 5GAMd 5GAN6 3FJPA 4EMKC 1M5Q1 3JB9I 1I8FA 5GAN4 4M7AC 1JBMA 4N0AC 4XTUA 4XQ3A 5LJ3f 4DQ2A 4XU0A 1JRIA 5CAIA 3JCMX 1B34B 3FB9A 4N0AA 4M7AA 4PJOE 2DZCA 2E65A 1X01A 5GAOn 3HSBA 3SB2A 1YCYA 4M78E 3JB9J 5GAMj 5GAN2 4M7DE 2RA2A 4QVCA 3QUIA 4JLIA 2DZ9A 4M7AF 4XU3A 4M7DF 4J6WA 4NL3A 3RKXA 4F7UB 4XU2A 3V7CA 2VXFA 2DEQA 5LJ3d 1KQ2A 4C92B 5GANe 4MMLA 5GAMh 3JCMP 1D3BB 5GMKm 3JCMJ 3JCMc 4PJOD 3PGGA 4OP0A 4M7DC 2E41A 2JN0A 4M77E 4M78F 3L1AA 3HFOA 4XTXA 4JRIA 4PJOG 4M77F 4F7UA 3JB9G 4XU1A 3QSUA 4RCBA 3SWNB 4C92E 1U1SA 5GAMe 5I21A 3AHUA 3V7RA 4J5YA 3JB9D 3GIBA 1N9RA 4M78A 4C8QB 4C92A 2RM4A 4EMGA 5GMKi 1LNXA 5LJ5f 4M7DG 4C92G 3JCMd 4JRKA 3VU3C 5GANg 2E1HA 3BW1A 1H641 4M75C 4M77C 3RKWA 4M7DD 3SWNC 4EMKA 5GANf 4C8QF 2DTIA 3V7SA 4XTZA 4C92F 3RESA 4C92D 1MGQA 3EFSA 2E64A 1Y96A 1WPYA 4C8QE 2EJGA 2YLCA 1HK9A 2YHTA 2RB6A 4XTVA 4PJOF 4MMKA 4PJOB 3BY7A 3RUXA 3JCMg 5GANh 5GAN5 2VC8A 5GANd 4C8QC 3RIRA 5GAOp 2EWNA 2ZGWA 4XTYA 4HA8A 4XTWA 4M7AE 4A53A 4M77B 4J6XA 1B34A 4PJOC 2Y90A 3RKYA 3RERA 5LJ3g 5GANj 4M7AG 4JUVA 4J6YA 4QVDA 5GMKl 2EJFA 1WQWA 2K57A 3JCMb 4HT9A 3L2ZA 5GMKe 4X9CA 3EFRA 4M75E 2VXEA 5LJ3j 5GAOq 4M7AD 3JCMQ 5LJ5e 3JCMe 5GAN8 1I4K1 2DTOA 3JB9H 4Y91A 5LJ5h 5GAOm 5GAOr 1KQ1A 2DJZA 3V8LA 4RCCA 5GMKh 5GAN7 5GAN3 1BIBA 4WF2A 3INZA 3JCMW 1D3BA 1LOJA 5LJ3h 3HFNA 4M75F 2DKGA 2FYKA 1U1TA 3FIFA 1WQ7A 2DXUA 4F7UG 4HT8A 5LJ5j 4C8QD 3V8JA 4F7UE 5GMKj 4PJOA 4C92C 4M75A 4M77A 4F7UF 5LJ5g 5GAOl 4C8QG 4M77G 4M7DB 2DTHA 4NOYA 4M78B 2CGHA 3QO3A 4C8QA 2EJ9A 1HXDA 4M78C 4A54A 3M4GA 1Y96B 5GAMg 3JB9F 2HNIA 4M75B 3JCMh 1WNLA 1I81A 4M77D 4M75D 2DXTA 5DY9A 3JCMV 2E10A 4EMKB 5GAMf 5LJ3e 3V8KA 4M78D 1M8VA 4PNOA 4EMHA 2RD1A 4NL2A 1LJOA 4M75G 1N9SA 1BIAA 3BFMA 1TH7A 2FB7A 2QTXA 4M78G 2DVEA 4M7DA 3QHSA 3BDUA 4M7AB 2I2LA 4V2SA 5LJ5d 2EAYA 4X9DA 3JCMf 3SWNA 2YLBA
chains in the Genus database with same CATH superfamily
2CH4W 4DOVA 3ASKA 2XD0A 5I22A 3FJPA 4ATOA 1M5Q1 3QG1A 3EAEA 4ZTFA 2A08A 3J7AF 5KYNA 3I5SA 4JJNK 1FMKA 1X27A 3QPHA 2EGCA 1HD3A 1VQ5Q 4A4KA 3M53A 4M77E 4FW2A 4JZ4A 4F14A 2QA4T 4M77F 2YUNA 3FDRA 1RAIB 2MOXA 4XU1A 1M27C 2J7IA 3RNJA 1Y07A 1U8RA 3JB9D 1W6XA 1VYVA 4O6JA 2DK3A 2ZPGB 4QQGA 4XTZA 2DL5A 3REBB 2NLUA 1HK9A 8AT1B 2JM8A 4AMCA 4LDYA 1VQ4A 3PE0A 2JTFA 1VYUA 4RTXA 2DXBA 3VV0A 1BI3A 1W2BA 1NJIU 2DYBA 5FROA 1VQPA 1N6AA 2LNVA 1OEBA 2DPPB 2JMCA 2A37A 1NLOC 1XQHA 1BB9A 1NZ9A 2VYTA 4CC4B 2ZPBB 1ZUYA 2PZ1A 1QVFA 5M9OA 2DERA 5C0MA 1YJWA 1WQ7A 3E9FA 4Z8AA 1QWEA 1JO8A 4AFQC 1U3OA 3OBYA 4F7UF 3M0UA 3HTRA 3JB9F 1TG0A 2LX7A 2DD5A 3JCMV 4M75D 5FU6B 3QDFA 1OX9A 2FB7A 1D09B 2DVEA 3H6ZA 2CZ1B 3SWNA 3FRNA 4RTZA 3A98A 3CXCP 2OJ2A 1M1GA 1TWBA 1TTHB 3CC2T 3UDCA 4ANJA 1JRIA 2V8IA 1VQOA 5FW9A 3G7ZA 2FG0A 3GLXA 3OB9A 5DM7R 5GAMj 2DBKA 2JJ9A 4LDWA 3U23A 2JW4A 4E7JA 4MMLA 1KJWA 2CP2A 1D1AA 1R77A 1N27A 3L1AA 1IHWA 3VS0A 4JRQA 2RPNA 4J9BA 3RMQA 1A0NB 1LNXA 5I2SA 5KYYA 2MAMA 4OMFB 3VJPA 4HVVA 3LWIA 3RESA 3G4SQ 1M1KR 1NG2A 1UGPB 2DFUA 1ZSZC 1MMAA 1RABB 3EG3A 3S6WA 4Y28E 1QCFA 3CMAT 2QEXT 4JJCA 3I9QA 3G6ET 4LDXA 2HL3A 4PJOC 2GTOA 1M1KC 4OB0B 1G3YA 3OMCA 3CCJQ 2RJDA 2HCKA 5LJ5e 1G5VA 3R6OA 5GAOr 1QVFS 2QXFA 4R0KA 1QKWA 2AIRB 1D3BA 1R0BG 5LJ3h 3CCET 1QLYA 1G2BA 2CP0A 2LC4A 1NLPC 2PVOB 5CKBA 2RK1A 2QYZA 4M77A 5LJ5g 1PSEA 3GP8A 1YBYA 2HMAA 1GRIA 4A54A 3CCLT 4PFZA 1PCXA 1TH7A 4M78G 2VASA 1SRMA 2LQNA 1K9MC 4VUBA 1YCSB 3JB9I 3PTAA 4M7AC 3LH5A 4XTUA 4XU0A 4Y92A 2X35A 3VS3A 2DYIA 3TCJA 3DLMA 2YXYA 4FW1A 4QVCA 1UEBA 3G6EQ 1E6HA 3LX7A 3V7CA 1YITA 2VGNA 2LP5A 2K7AA 3MEWA 3OYBA 3JCMP 1FWZA 1KIKA 4ORZA 4JRPA 3CCSA 3UWNA 3CCST 1VQ6T 2FO0A 2CSQA 2QASA 1IXDA 4C8QB 1NPPA 1ZBXA 1X6GA 2AT1B 2RQVA 2KT8A 3RKWA 4GBQA 1RAEB 1OZ2A 1VQ9T 2E64A 2V8JA 1Y96A 1Q82U 1UHCA 2O01E 1O9SA 4IURA 1K8AU 1M2VB 2WSCE 2MYSA 2YUQA 3PMTA 3CCRT 1TSFA 5KH6A 5FU6C 3OSSC 4J6YA 4HT9A 3OYYA 3CCVT 1OYXA 2ZPEB 4A4EA 3OBWA 4M7AD 2RJCA 4K11A 1I4K1 2DTOA 1VQ4Q 2KBTA 1WFWA 5IAYA 1M1FA 2FPDA 2YT6A 2YWWA 3TSWA 3HFNA 2L3RA 1WGSA 2E5KA 4LE9A 3FIFA 3A8GB 1YHQA 2JMAA 1PC0A 3DKMA 4E7LA 1Z9QA 4PJOA 3VS6A 5GAOl 1QP3A 1UTIA 2ED0A 3X26B 3OYLA 3OYGA 4M78C 4PJMA 2P4TA 3OYIA 1QVGP 1WNLA 1KG1A 2XHCA 3L2WA 2E10A 5LJ3e 5LL6S 2IG0A 1M8VA 1ZSZA 3MP8A 2HKQB 4C5IA 2LT4A 1E6GA 2G3RA 2GNCA 4EMKC 5D6WA 1WA7A 3P8DA 1T3LA 1WLPB 2O4XB 2E12A 4LD9K 4DQ2A 5GAOn 5A2QE 2E6NA 1ZHIA 1K8AR 1PKTA 4LXCA 2QAZA 3JRZA 2DL4A 1ABOA 2ENMA 2MPXC 1M90U 1RAFB 1KQ2A 3SDZA 3JCMJ 1QW1A 2ROLA 3G71A 1WHHA 2DIGA 2HAXA 3MP1A 5KYWA 2RHUA 4PK4A 2QQRA 5I21A 1ARKA 2GCXA 2HZYA 3EFOB 2LQKA 1YWOA 2HEQA 3JCMd 3CBOA 2RHZA 2B8AA 3SWNC 2ECZA 3CPWA 1SRLA 1BK2A 3ZBDA 1UECA 2EJGA 1LCKA 2VUBA 2MI6A 4MMKA 1VQ6A 2PVGB 2J6FA 1QMCA 1JJ2S 3TEEA 4IUTA 2DXCA 1KQSS 2X4WA 2OTLT 2EWNA 4KBMB 3LW5E 2Y90A 1S72Q 3QYGB 1IZ6A 1T0JA 1NBEB 4M7AG 1WQWA 2QEXQ 5J39A 3L2ZA 4LN2A 3OYNA 2VXEA 4J9HA 3MEUA 3A8HB 3CCLQ 3L2VA 4R55A 1OOTA 1WJQA 2H8HA 2XDPA 3OW2P 5CK9A 4JZ3A 3TVTA 2BUDA 4HT8A 3C4SA 3TREA 5KYXA 5HY6A 1UHFA 4BDZA 3CCEQ 1GFDA 2F2WA 1XTDA 2KAFA 4M77D 2X4JA 4JJBA 2J6OA 4EMHA 1UFFA 3HKSA 2XIDA 2KVQG 1F1BB 2XMFA 3P8HA 1PHTA 1XNIA 2QQAA 4RTVA 5IHIA 1TUGB 4J9CA 4D8KA 1Q81U 1RI0A 1OPKA 1W4SA 2P4RA 4KH0B 2C0TA 2EGEA 2AZSA 4KT0E 3PNWC 1NEGA 1Y0MA 3M58A 4FSXA 5IXFA 2LCCA 2RHIA 1M1KU 3M57A 3WVDB 1JXMA 2F69A 3IQLA 1YIJT 4Q5WA 4E7IA 1TU0B 3PGGA 4HXJA 1RLQC 1GBRA 2E41A 3J81E 2IPOB 2EYZA 1N8RU 3JB9G 4RCBA 1I07A 2RQWA 1RADB 1ZLMA 4EMGA 4X34A 4FM4B 2KRNA 3CCVQ 4C8QF 1Q7YR 3H0HA 1ZSGA 3M59A 2DEUA 4FT2A 2LVMA 1ZBJA 2HQXA 1AWWA 1UGQB 3UF4A 2CT3A 3CEYA 4QW2A 3QWYA 2QDYB 3O5ZA 1Q82C 3QXEB 1Q81R 5GAOp 3OYMA 4XTYA 3PFSA 4HCKA 4J9EA 4RMOA 4J6XA 1R8OB 4EDUA 4JDSA 1EFNA 2JVVA 2XDBA 1QKXA 2BZXA 5DLOA 5HK0A 3I55T 2DLPA 2GBQA 3ZFJA 3I55A 1TXQA 3MHXA 1Q81C 5GAN7 1BIBA 2X9HA 2HBWA 2L89A 3TU4K 2DL3A 3V8JA 3VS1A 1H92A 4P5NA 3ER0A 3VRZA 4C8QA 1W2BP 3EGXB 4L59A 2QDLA 3CCJA 1K73C 4M78D 5KYXB 3CCJT 2J06A 2K6DA 3BFMA 4IUVA 4KGVB 5KYUA 3QKJA 1K76A 2KEAA 2YLBA 1I5LA 3CC7Q 1VQLQ 3NTKA 1WXUA 4IIOA 1RL2A 1BI2A 3HP9A 1I8FA 1G3TA 1VUBA 4XQ3A 4PJOE 1WZOA 4M7AA 1X01A 1KC8C 3FLGA 1MV3A 4C5EA 4NL3A 4MZMA 2DEQA 5D6YA 2MCNA 4PJOD 3CMAA 1SSHA 3VS4A 1MNEA 2FVUA 1BI1A 5GAMe 2YRDA 4FIBA 1S72A 1PNJA 2GF7A 1ABQA 2C0OA 4KUIA 3GNGA 3VUZA 4GY5A 3BW1A 1H641 2OTLA 2YRCA 2OTJA 2KK4A 1U06A 1MGQA 1WPYA 4N4GA 4OB3B 2CSIA 2DAQA 3Q1JA 1WIEA 4D8DA 3M5AA 2JS2A 1GXIE 4A53A 1BKBA 2L8DA 3CC4Q 4QVDA 3CCRA 1JJ2A 1GCQC 3F70A 1KD1R 2VKNA 1YJ9A 1VQ8A 5GAN8 4Y91A 2KYBA 1ZQ1A 2L0AA 4M75F 4OF1A 2RF0A 2E3IA 3P8BB 1AHJB 1YJWQ 1MMNA 3L2UA 1N8RC 4PLIA 1Z9ZA 2K3YA 1H3ZA 4J9IA 3G6EA 2A3LA 2LQWA 4N4HA 2EQKA 2PQWA 1VQKQ 4LUDA 2D8JA 5FWCA 3BDUA 2CUBA 2NWMA 1K0SA 4BI4A 5FRMA 3E19A 1BU1A 4E47A 3VS5A 4A63B 3OYKA 3OYAA 1Q7YC 2R5AA 3HRSA 5CAIA 3SFMA 1VQPT 4BUGA 2EBPA 4M78E 1M4ZA 2OI3A 1OI1A 4M7DE 4PJNA 3QUIA 4F7UB 2X51A 1G8XA 4DEXA 4C92B 3H0FA 4GLMA 1AZEA 4AFZC 1C6VX 2JOYA 1UJ0A 2AK5A 1JU5C 1NJIR 4JLGA 4JRIA 3PVLA 1BCOA 3NMZC 2YUPA 1PSFA 4F16A 1X6OA 2HL5C 4C92G 1VQ8Q 1I1JA 3MPUB 3CC4A 4KH1B 3I5RA 4HCCA 2M51A 3EFSA 2EYXA 2EQIA 3M9QA 2RB6A 2LX9A 1Y57A 1Q95G 1FMWA 2L3PA 4ZN3A 4KULA 5ECAA 1BCMA 4CC2A 1PD1A 3RERA 3RKYA 3E2UA 5LJ3g 5CKHA 1ZUKA 3JCMb 2OTJT 2KGTA 2GFUA 2SRCA 2GQVA 2V26A 2KY9A 5GMKh 3OYHA 5GAN3 1WJSA 1WHMA 4F17A 3VYGA 2RQRA 1S1NA 1X43A 1LVKA 7AT1B 3OYDA 2AKKA 1WX6A 2L5QA 1U5SA 2YSQA 3CPWP 3EHQA 4FYWB 4J9GA 1YJ9T 3H41A 4M75G 1N9SA 4XK8E 2F5TX 2M0YA 3QHSA 3FJ5A 3OSVA 1MMDA 1QVFP 3NTIA 5GAN6 3PVQA 4BB7A 2DRMA 5CQYA 1M30A 3OS1A 1GBQA 2DIQA 4KGZB 5FU7C 3MEVA 4MZPA 2OTJQ 3GPLA 4XU3A 4M7DF 5EC7A 2RHYA 4C0DB 3A8OB 3LH0A 5IN1A 4J7FA 3UT1A 2CH4A 4OMLA 2EYWA 3TSZA 4PJOG 4F7UA 2MMPA 4C92E 4BDYA 5IH2A 2D0NA 5GMKi 1Q7YU 3QZ9B 2BZYA 2P0PA 2P0QA 2RHXA 1ACMB 1WHGA 3CMAQ 4KUDK 1R0CB 3BY7A 3FC3A 2KRMA 3CCMQ 2QTVA 2HBPA 1YJWT 4C0DC 3DB3A 1YFNA 5IT9E 5GANj 2G6FX 1I5OB 2JT4A 1VQKA 5GAOq 3JCMe 5A0DA 2DD4A 3VKIA 2GQIA 3GF5A 3OYCA 4UC4A 4ZGJB 5KCOA 1CKAA 3LGFA 4QT7A 2X4YA 4C8QG 2LMJA 1VQOT 4PL6A 2EKHA 2EJ9A 4C0ZA 3JCMh 4PKCC 2O2OA 3MO8A 4NS5A 4BE1A 4NL2A 1LJOA 4OMOA 2V8KA 4N4IA 1NJIC 2AZVA 3EHRA 4PJLA 4CRIA 2EQUA 4OGEA 2CP5A 4R56A 3QJ6A 2SEMA 3C94A 4N0AC 1VQ7T 2BE9B 2I0NA 4FU6A 3MJXA 3SB2A 1YCYA 3JB9J 1K73R 2D1XA 2A28A 1VIFA 4J9DA 5GANe 1AD5A 3BE3A 1X69A 3G71Q 2L2PA 4F04B 1Q86C 4FT4A 2RQUA 3V7RA 1ZA1B 4M7DG 2KE9A 2PVDB 2RM4A 2GGRA 3VU3C 2BE7D 5GANg 4M77C 1OV3A 2DTIA 4HKEA 2X3XD 2O9VA 4E6RA 2VV5A 2FPFA 5CKFA 3OY9A 3PMIA 2R5MA 1KQSP 5GANd 1D1CA 3EGXA 3L2QA 3HL8A 2P0KA 1TUCA 2QG9B 3EH1A 1B34A 1VQNT 2LDMA 2IVWA 2DILA 3HRUA 2OTLQ 3M0RA 1W2BS 2YRVA 2EIFA 2DMOA 4KRTA 1KQSA 3UPUA 3I56Q 3M55A 4ZGDB 5CIUA 3CCUA 1JQQA 4L6V5 1D1BA 4DBFA 1YI2Q 1IRXA 2DXUA 4ELYC 4F7UG 5LJ5j 4QQDA 5GMKj 2J05A 5FWBA 3QO3A 3JSCA 3KBGA 2FRWA 3I56T 2K79A 1I81A 4BE2A 1YJ9Q 2BKDN 3SEMA 4BY6B 3O8VA 1KC8R 2D0QB 4PFOA 4LD6A 1QP2A 5DLQE 1PRMC 5GAMd 3X24B 2LZ6B 2DF6A 4E7ZA 4AFUC 1RI9A 4A4GA 5GAN4 1JBMA 3AT1B 3JCMX 3EG9B 3GNFB 5IHNA 2E6ZA 2A36A 5GAN2 2F1LA 3I35A 2KXDA 4XU2A 2RN8A 2R57A 5FRNA 2LTOA 3M56A 3TQ7P 1X6BA 2DX1A 1ZA2B 3HFOA 3CCSQ 3QIIA 2E5QA 5L23A 1WDXA 5J3BA 1HYOA 2D9TA 2RO0A 1RACB 2QK0A 4M7DD 2XDDA 5GANf 2P84A 2HKNA 5CQXA 3CCVA 5CKEA 3R6NA 1FX7A 1HSQA 5KE3A 4PJOF 3JCMg 4IIMA 2QA4Q 3M4YA 3CCUQ 2VC8A 2PU9B 2JM9A 3EFOA 1JB0E 2GFAA 2K4YA 4RUGA 2XK0A 2PUOB 2JTMA 2XI9A 4EIKA 3EFRA 3OW2A 2L3QA 1QCOA 3OS5A 3RDVA 1MUZA 1OU9A 5KCHA 1U1TA 4CC7A 6AT1B 1SG5A 4F7UE 1VQMA 2LCLA 2KXCA 1VQNQ 2K5IA 3NGPA 3N5BB 2HNIA 3NFCA 2AKLA 4D6WA 1WJRA 1K9MU 1BIAA 4J8OA 1M3CA 1IREB 2EAYA 5GMKm 4FCYA 5A0LA 1VQ6Q 1NYFA 1EZZB 3G71T 4AG1C 5LJ3f 5KYYB 1JEGA 2E65A 4JS5A 1IGUA 1VOMA 2RA2A 1TS9A 4M7AF 2C0IA 4J6WA 2EYQA 1M8MA 3H8ZA 2X4XA 2CS7A 2A7YA 2KROA 5KE2A 5GJWB 2K9GA 4OP0A 1AOJA 4C5GA 3VS2A 1K0XA 4OMQA 1PKSA 3OA6A 4HVWA 2CZ0B 3H0IA 4J5YA 1N9RA 3FEOA 1XJWB 2O4XA 1RAGB 5IHKA 1KD1C 1T0HA 2RMOA 2DL8A 4B9WA 3CCQQ 1YP5A 4C8QE 1M90R 2RK2A 1MV0B 4XTVA 5CKDA 3S3OA 2AHJB 2L3SA 5GAN5 4DBRA 3VUBA 3CC7A 2OX7A 4ESRA 1N8RR 1BYMA 3G1JA 3RIRA 1V29B 2HQEA 3M0SA 3GOXA 1Q86R 1VQ9Q 1M90C 3A8LB 2EFIA 2K57A 1SSFA 1T3SA 5GMKe 2KRSA 5LJ5h 4BACA 3RR6A 1AWJA 4PFPA 1PWTA 1UUEA 3CBPA 1GCPA 2D6FA 2K5FA 1YHQT 4DBHA 1K9MR 4C92C 2W10A 2YUOA 1EX4A 1KC8U 3T9NA 2KNBB 4EMKB 4XAXB 3EG0A 3ZEHA 4PNOA 2RD1A 3CXCS 2CZ7B 1AWXA 4OVAA 1VQ4T 2LQ8A 2DO3A 2QGGA 1J3TA 4YTLA 5I2MA 4IUPA 2LCSA 4HVUA 3QJYA 1BI0A 1B34B 5KYUB 1UE9A 1VQOQ 1XOVA 1WHKA 2B86A 3CCLA 2DZ9A 2EKOA 4ZGEB 3WVEB 1WHLA 2NUTB 1X2KA 1M2VA 2COZA 4OMPA 1OQKA 1PRLC 4OMNA 1QVPA 4MDWA 4LDUA 1U1SA 2PNIA 2FL7A 1GCQA 1MNDA 3GIBA 4M78A 2EVRA 2HSPA 4M75C 5AYFA 4IKFA 2COWA 1M3BA 2YLCA 3ZL7C 2EYYA 2MWPA 2QQSA 3KFVA 3OS2A 4PJOB 4C8QC 1VQMQ 3X25B 2KSSA 4M77B 3C0CA 1Q86U 4C5HA 2EJFA 5C6SA 3OYEA 1VQ7Q 3LWHA 3M0PA 2MIOA 3UA7A 1M9SA 1KQ1A 3L42A 3V8LA 1KFZA 1NYGA 1QWFA 3EH2A 1YJNA 2XU8A 2DKGA 4BD3A 2JS0A 1D0XA 3CC7T 1AWOA 2CP6A 1D0ZA 3BDLA 3HHTB 3QZ5B 3CCMT 2O9SA 3PT9A 1V76A 2FHDA 3NPFA 1KD1U 3G4SA 2ZAEA 1IGQA 3E9GA 3I56A 3PIOA 1V1CA 3NTHA 3EGDA 2EQJA 4ZTJA 2CP3A 2LRQA 4KGXB 3OQ5A 2RJFA 4LNPA 2F2VA 2ZPHB 2M9UA 3CD6T 1AT1B 4BY6C 3LGLA 3L2RA 3EG1A 1B3QA 4FSSA 3I55Q 2DBMA 3DLLA 1WXTA 2RH2A 4Z02A 2MK5A 4DA4A 2F5KA 1YN8A 3UA6A 2DL7A 2EW3A 3QYHB 4XTXA 1O75A 2NUTA 3J80E 5HK3A 4BI3A 2RJEA 1QVGA 1JXOA 4C92A 3A1PA 2ZPFB 3HRTA 1OX8A 1G3WA 1VQ7A 2E1HA 2DNUA 4OB2B 1TUDA 1VIEA 2OAUA 3JAME 1WYXA 3V7SA 1VA7A 1IB8A 1YNZA 3CCUT 3DB4A 2ED1A 2M16A 4M4ZA 3S3MA 2ZZDA 1LPLA 2QQBA 4TVRA 5AT1B 3RUXA 1YJNQ 2E3HA 4IUQA 3VS7A 1NE8A 4HA8A 3M0QA 2CYZB 4RG8A 1DJ7B 3MCAB 5GMKl 2QEXA 3CCRQ 3CC2Q 2M02A 3CBMA 3LYIA 3JB9H 2RNAA 4RCCA 1C0MA 2JXBA 4QVZA 1LOJA 4QKUA 1KSWA 1AZGB 1YHQQ 5CCAA 1ZSZB 4C8QD 1ZX6A 2WSEE 4QQ6A 2FPEA 3CCEA 3EG2A 3QWXX 4MZTA 2Y4XA 3M4GA 1VQMT 2ESWA 2DXTA 5GAMf 3QDRB 2EQMA 2VVKA 4DBQA 3CCQT 4DOWA 4DEYA 4ELZC 5L8RE 3JCMf 2VB6A 2YDLA 3C95A 2BTTA 3WXMB 1NEBA 5KYWB 4RTYA 1VQ8T 2RQTA 1PD0A 5IXBA 1OU8A 1RLPC 4OMMA 3FB9A 2DZCA 3CD6Q 3HSBA 2KDSA 1Y7XA 2ROTA 1SF9A 4JLIA 1YITQ 1UDLA 1IHVA 3M54A 2DETA 3KUFA 1K4US 2LJ1A 2EPDA 3JCMc 3NHNA 1GL5A 2JN0A 3A5ZB 3MKDA 5I11A 1UJYA 2IIMA 1Q82R 3SWNB 2V1QA 2FEIA 3CD6A 4Z89A 2DE0X 2ABLA 2LT1A 1S72T 4X1VA 3CC2A 2KMTA 4E7SA 4EMKA 1VQ5T 3EGUA 3SD4A 2C06A 2BIVA 1K1ZA 2YHTA 1SHFA 2DJQA 1YIJA 1MMGA 4PLLA 1K73U 2JNGA 2DA9A 3THKA 3QBYA 5GANh 4AT1B 1G3SA 1VQLA 2Y4YA 3H9NA 2ZGWA 3X28B 1WXBA 1IO6A 2O31A 4OGCA 2X3WD 1PM3A 4JUVA 2HDAA 5HKCA 2LJ0A 3JCMQ 1HJDA 3ULRB 2WACA 2MWOA 3A8MB 5D7UA 2O88A 3OYFA 2M0OA 4WF2A 2QI2A 5GJVB 4C0GA 1WI7A 3URGA 3G4ST 2JUFA 4C0FA 5D6XA 2DVJA 5CO7A 3CC4T 2KYMA 4M7DB 2WSFE 1BBZA 4ZNXA 4M78B 1HXDA 1M3AA 5DY9A 3D7SB 2XG8D 2LJ3A 5FU7B 4FL6A 1SKUB 1PG5B 3LLRA 3META 4GLKA 1B07A 2I2LA 5LJ5d 3ME9A 1YWPA 1WHJA 4JJDA 1QQJA 1W70A 3CMEQ 2HD0A 2LNHB 1VQ5A 1UGSB 2NYSA 4WTOB 3GBQA 5CR2A 1D0YA 1I0CA 1NPRA 1VYTA 2KQWA 1SEMA 3CCQA 4JS4A 1VQ9A 5A0GA 3CQTA 4RKUE 1M2OA 4LDVA 4ZN1A 5J26A 3PIPA 3RBBB 3CXCA 8ATCB 4EPCA 2CP7A 2CUDA 3RMSA 4IUUA 1RAAB 1UB4A 3AHUA 3HPWA 1X2QA 5LJ5f 5FLXE 4FYVB 1EIFA 4JRKA 1C1AA 4O5VA 1OZ3A 4B9XA 4ME7A 4C92F 4C92D 1KK7A 1Y71A 1N5ZA 4HCZA 1OULA 2CREA 2V1RA 2ATCB 4LUEA 2FZKB 1YITT 2NUPB 4RTWA 2RI3A 1UGRB 1JJ2P 4WCIA 2NUPA 4XTWA 4M7AE 2GTJA 2CZ6B 3MEAA 4FYYB 2E70A 1AVZC 2JZ2A 2HQHA 4AFSC 2XICA 4M75E 3VRYA 2DRKA 1H8KA 2K3XA 3CPFA 5GAOm 2JTEA 3S3NA 4HCBA 3OMGA 3INZA 1YIJQ 1FYNA 2FRYA 2K5LA 1YI2A 3JV3A 1VQLT 1NM7A 1YI2T 1TOVA 2J6KA 3CMEA 3SHWA 4M75A 1GFCA 4M77G 2CGHA 5GAMg 1Y96B 2OAWA 4M75B 2K2MA 1CSKA 2COYA 1H3HA 1B7TA 1FMVA 2PUKB 4RG2A 2QTXA 4M7DA 1P92A 2CKKA 2D8HA 4M7AB 4BE0A 2ZCFB 4X9DA 3CPWS 1SPKA 2W0ZA 2RI2A 2KI7A 2QQ9A 4A4HA 2RI5A 2QA4A 3KXTA 3C12A 2FZCB 4RTUA 1K9AA 4JPBW 2ZPIB 2MF2A 4N0AA 1MHNA 4OB1B 3X20B 1CKBA 5CVIA 3RKXA 3M0TA 2VXFA 5LJ3d 3EG9A 2BZ8A 5GAMh 1D3BB 2KR3A 4A4FA 3VYHB 4M7DC 4CI0C 4M78F 1SHGA 1E7OA 2H3EB 2QGFB 2HSEB 2Z0WA 1W1FA 1KHIA 3QSUA 2FZGB 4B6MA 2CDTA 1VQNA 2XKOC 2K2VA 2F2XA 2M1HA 2H3JA 3OS0A 9ATCB 1YJNT 2R58A 3E1SA 4E7KA 4BI8B 1X75C 4AG2C 3OW2S 2CT4A 1OPLA 4II1A 1FXXA 3UATA 4E7HA 3CCMA 2E4HA 1QCNA 4J7IA 2NUZA 3REAB 1AEYA 4Z88A 2DM1A 2KT1A 4X9CA 5HCKA 5LJ3j 5EG2A 1VQKT 3EGDB 4L5GA 2PTKA 2DJZA 3MP6A 2EGAA 3JCMW 4MDXA 4J83A 3OYJA 2FYKA 2K3BA 2VWFA 1KHCA 4E2FB 1RAHB 4PJJA 2DTHA 4RTTA 4NOYA 4FYXB 1G83A 1VQPQ 1QVGS 4J9FA 3V8KA 1K8AC 2A0FB 1RUWA 1UGVA 4CC3A 2VGMA 4V2SA 1UG1A 3CMET 1ZUUA
chains in the Genus database with same CATH topology
4DOVA 3P8HA 3ASKA 4CRIA 1XNIA 2LRQA 2EQUA 2XD0A 2QQAA 3FJPA 3OQ5A 2RJFA 4OGEA 1M5Q1 4R56A 4ATOA 3QJ6A 2ZPHB 3C94A 2M9UA 4N0AC 3QG1A 1RI0A 1Q81U 1VQ7T 3EAEA 4ZTFA 3CD6T 1W4SA 4FU6A 4BY6C 3SB2A 1YCYA 3J7AF 3LGLA 3L2RA 3JB9J 4KT0E 3PNWC 3M58A 3DLLA 4FSXA 2LCCA 2RHIA 2RH2A 1M1KU 1VIFA 3M57A 4Z02A 4JJNK 3WVDB 2F69A 3QPHA 5GANe 1YIJT 4DA4A 4Q5WA 4E7IA 2F5KA 3PGGA 2E41A 3M53A 4M77E 4A4KA 3J81E 3QYHB 4XTXA 1N8RU 2QA4T 1O75A 3JB9G 4M77F 3FDRA 4XU1A 1Q86C 4FT4A 5HK3A 4RCBA 3J80E 4BI3A 2RJEA 1QVGA 1Y07A 3V7RA 1U8RA 3JB9D 4M7DG 4EMGA 4C92A 2PVDB 2RM4A 2ZPFB 3HRTA 4X34A 4FM4B 1G3WA 4O6JA 3VU3C 1VQ7A 2DK3A 5GANg 2E1HA 2ZPGB 4M77C 4OB2B 4QQGA 1VIEA 2OAUA 3JAME 4C8QF 2DTIA 4HKEA 4XTZA 3V7SA 3M59A 4FT2A 3CCUT 2NLUA 1HK9A 2VV5A 2LVMA 3DB4A 5CKFA 2M16A 4LDYA 3OY9A 1VQ4A 3S3MA 2HQXA 2ZZDA 3PMIA 1UGQB 2JTFA 2QQBA 3CEYA 4QW2A 2R5MA 4TVRA 2DXBA 3RUXA 3VV0A 5GANd 1BI3A 2QDYB 1W2BA 1NJIU 3L2QA 3HL8A 1Q82C 3QXEB 4IUQA 5GAOp 3OYMA 4XTYA 1NE8A 3PFSA 2P0KA 4HA8A 4RMOA 5FROA 1VQPA 1N6AA 1B34A 4J6XA 1R8OB 1VQNT 2LDMA 2CYZB 2LNVA 4EDUA 2IVWA 4JDSA 4RG8A 2DPPB 1DJ7B 2JVVA 3MCAB 5GMKl 5DLOA 3HRUA 2QEXA 2XDBA 5HK0A 3I55T 1W2BS 1XQHA 2YRVA 2EIFA 1NZ9A 2VYTA 3CBMA 3ZFJA 2ZPBB 3I55A 1KQSA 3LYIA 3UPUA 5M9OA 1QVFA 3JB9H 3MHXA 3M55A 4ZGDB 4RCCA 1Q81C 5C0MA 5GAN7 1BIBA 5CIUA 3CCUA 4QVZA 1LOJA 4L6V5 2L89A 1YJWA 1WQ7A 3E9FA 3TU4K 2DXUA 4ELYC 4F7UG 5CCAA 5LJ5j 4C8QD 2WSEE 3V8JA 4QQDA 4QQ6A 5GMKj 3CCEA 3OBYA 4F7UF 4MZTA 4P5NA 3ER0A 4C8QA 3QO3A 3JSCA 2Y4XA 3KBGA 3JB9F 3M4GA 4L59A 2DD5A 3I56T 1VQMT 3JCMV 1I81A 4M75D 5GAMf 2DXTA 4BE2A 5FU6B 3CCJA 1K73C 3QDRB 4M78D 2BKDN 4BY6B 2EQMA 3CCJT 3CCQT 3BFMA 3O8VA 2FB7A 2DVEA 4IUVA 4DOWA 2D0QB 3QKJA 4ELZC 3H6ZA 5L8RE 2CZ1B 3JCMf 4LD6A 3SWNA 2YLBA 1QP2A 3C95A 3FRNA 5DLQE 1I5LA 5GAMd 3WXMB 3X24B 3NTKA 1RL2A 1VQ8T 1BI2A 1M1GA 4A4GA 3HP9A 1I8FA 5GAN4 1JBMA 1G3TA 3UDCA 1VUBA 4XQ3A 3JCMX 3CC2T 1JRIA 4PJOE 3FB9A 2V8IA 3GNFB 1VQOA 2DZCA 4M7AA 3G7ZA 1X01A 3HSBA 3GLXA 3OB9A 5DM7R 1KC8C 2KDSA 2E6ZA 1Y7XA 5GAMj 3FLGA 5GAN2 4JLIA 4C5EA 4NL3A 4LDWA 4XU2A 4MZMA 3M54A 4E7JA 3KUFA 2DEQA 2R57A 5FRNA 2LTOA 3M56A 4MMLA 5D6YA 3JCMc 4PJOD 2JN0A 3A5ZB 3CMAA 1N27A 3HFOA 3L1AA 2FVUA 1BI1A 3QIIA 2E5QA 4JRQA 3SWNB 5GAMe 5J3BA 4FIBA 3RMQA 1S72A 2GF7A 3CD6A 2D9TA 2RO0A 1LNXA 2LT1A 1S72T 4KUIA 3GNGA 3CC2A 5I2SA 2KMTA 4GY5A 3BW1A 1H641 3VUZA 2MAMA 4OMFB 2OTLA 4M7DD 2XDDA 4EMKA 5GANf 3VJPA 2OTJA 3LWIA 2KK4A 1VQ5T 3RESA 3SD4A 5CQXA 2C06A 1MGQA 5CKEA 3CCVA 1WPYA 2BIVA 4N4GA 1UGPB 4OB3B 1FX7A 2YHTA 5KE3A 1YIJA 4PLLA 1K73U 2JNGA 2DAQA 4PJOF 3QBYA 3Q1JA 3JCMg 5GANh 3S6WA 3M4YA 2VC8A 1G3SA 1VQLA 2PU9B 2Y4YA 1Q7YC 4Y28E 3M5AA 3CMAT 2ZGWA 2QEXT 3X28B 1GXIE 3G6ET 4A53A 1BKBA 4LDXA 4PJOC 2L8DA 4OGCA 1M1KC 4OB0B 4JUVA 1JB0E 2GFAA 2K4YA 4QVDA 3CCRA 2XK0A 2PUOB 1G3YA 2JTMA 2XI9A 1JJ2A 3F70A 3EFRA 3OMCA 5HKCA 3OW2A 2RJDA 1YJ9A 1VQ8A 3JCMQ 5LJ5e 5GAN8 1G5VA 2WACA 3R6OA 4Y91A 3OS5A 2MWOA 5GAOr 3A8MB 1QVFS 2QXFA 3OYFA 1ZQ1A 2M0OA 4WF2A 1D3BA 5LJ3h 2QI2A 4C0GA 4M75F 5KCHA 4OF1A 3CCET 3URGA 1U1TA 3G4ST 2JUFA 4C0FA 2LC4A 5D6XA 3P8BB 2PVOB 1AHJB 5CKBA 5CO7A 3CC4T 3L2UA 1N8RC 2RK1A 4F7UE 1VQMA 4PLIA 2LCLA 4M77A 5LJ5g 1PSEA 3GP8A 2K5IA 4M7DB 2K3YA 1YBYA 2WSFE 1H3ZA 4M78B 1HXDA 3N5BB 4A54A 3G6EA 2A3LA 2HNIA 5DY9A 4N4HA 2XG8D 2EQKA 2PQWA 3CCLT 5FU7B 3NFCA 4FL6A 4D6WA 1WJRA 1K9MU 1BIAA 1TH7A 4M78G 4J8OA 3LLRA 3META 4GLKA 3BDUA 2I2LA 5LJ5d 1IREB 3ME9A 2EAYA 5GMKm 5A0LA 4BI4A 2HD0A 1VQ5A 1UGSB 5FRMA 1K9MC 3E19A 3G71T 4VUBA 3JB9I 4E47A 3PTAA 4M7AC 4XTUA 3OYAA 3OYKA 5LJ3f 2R5AA 3HRSA 4XU0A 5CAIA 3SFMA 5CR2A 1VQPT 2E65A 2X35A 4JS5A 1NPRA 2KQWA 4BUGA 3TCJA 4M78E 3DLMA 3CCQA 1M4ZA 4JS4A 1VQ9A 5A0GA 1OI1A 4M7DE 2RA2A 4QVCA 1UEBA 3QUIA 4M7AF 4J6WA 4RKUE 2EYQA 4F7UB 3H8ZA 3LX7A 3V7CA 1YITA 4LDVA 2X4XA 2CS7A 2A7YA 4ZN1A 2VGNA 4C92B 5J26A 3MEWA 3PIPA 5KE2A 3OYBA 3JCMP 1FWZA 2JOYA 3CXCA 4OP0A 4JRPA 4C5GA 4EPCA 3CCSA 3RMSA 4IUUA 4JLGA 3UWNA 4JRIA 3CCST 1VQ6T 1UB4A 3AHUA 3HPWA 1PSFA 3OA6A 2CZ0B 4J5YA 1N9RA 1X6OA 3FEOA 1NPPA 4C8QB 2O4XA 1ZBXA 5FLXE 5LJ5f 4C92G 1EIFA 4JRKA 4O5VA 3RKWA 1OZ3A 1KD1C 4B9XA 3CC4A 4ME7A 1OZ2A 4B9WA 4C92F 4C92D 1Y71A 4HCCA 1VQ9T 2E64A 3EFSA 2V8JA 1Y96A 4HCZA 4C8QE 2RK2A 1Q82U 3M9QA 2RB6A 4XTVA 2O01E 5CKDA 1O9SA 3S3OA 2LX9A 4IURA 1YITT 1K8AU 2AHJB 5GAN5 2RI3A 2WSCE 4ZN3A 4KULA 3VUBA 3CC7A 1UGRB 1BYMA 3RIRA 1V29B 3PMTA 3CCRT 4XTWA 4M7AE 2HQEA 2CZ6B 3MEAA 5KH6A 3GOXA 3RERA 5FU6C 3RKYA 2E70A 5LJ3g 1M90C 5CKHA 3A8LB 3OSSC 4J6YA 2EFIA 2JZ2A 2K57A 3OYYA 3JCMb 2XICA 1SSFA 3CCVT 4HT9A 5GMKe 1OYXA 4M75E 2ZPEB 4A4EA 3OBWA 4M7AD 2OTJT 2RJCA 2K3XA 1I4K1 3CPFA 2DTOA 2GFUA 5LJ5h 5GAOm 4BACA 2GQVA 3S3NA 5IAYA 4HCBA 2KY9A 5GMKh 3OMGA 1M1FA 3OYHA 5GAN3 3INZA 1WJSA 3HFNA 2L3RA 3CBPA 1WGSA 2K5LA 3A8GB 3FIFA 3VYGA 1YI2A 1YHQA 2D6FA 2K5FA 1VQLT 3DKMA 4E7LA 1YHQT 1YI2T 3CMEA 4PJOA 3OYDA 4C92C 4M75A 5GAOl 2L5QA 4M77G 1QP3A 3OYGA 3X26B 3OYLA 2CGHA 1KC8U 4M78C 5GAMg 1Y96B 3T9NA 3OYIA 2P4TA 4M75B 1KG1A 1WNLA 2XHCA 3L2WA 4EMKB 4XAXB 2E10A 5LJ3e 3ZEHA 2IG0A 5LL6S 4PNOA 1YJ9T 1M8VA 2RD1A 3CXCS 3MP8A 2CZ7B 2PUKB 4M75G 4C5IA 1N9SA 4XK8E 2F5TX 2QTXA 2LT4A 4OVAA 4RG2A 1P92A 2CKKA 2DO3A 2LQ8A 3QHSA 4M7AB 1VQ4T 4M7DA 4BE0A 4YTLA 2G3RA 2ZCFB 3OSVA 4X9DA 4IUPA 5I2MA 4EMKC 3CPWS 3NTIA 5D6WA 2RI2A 3QJYA 5GAN6 2QQ9A 3P8DA 2RI5A 4A4HA 3KXTA 2QA4A 3C12A 4BB7A 2O4XB 2E12A 5CQYA 4LD9K 4DQ2A 1BI0A 2ZPIB 1B34B 2MF2A 1MHNA 2DIQA 4N0AA 3OS1A 4OB1B 3X20B 5GAOn 5FU7C 3MEVA 2E6NA 5CVIA 1XOVA 1ZHIA 5A2QE 4MZPA 3CCLA 2DZ9A 3GPLA 4XU3A 4M7DF 2EKOA 3JRZA 2RHYA 3RKXA 3WVEB 4C0DB 4ZGEB 1M90U 3A8OB 2VXFA 5LJ3d 3LH0A 1KQ2A 5IN1A 4J7FA 5GAMh 1D3BB 3SDZA 3UT1A 1QW1A 4A4FA 3JCMJ 3VYHB 3G71A 2DIGA 2HAXA 4M7DC 1QVPA 3MP1A 4CI0C 4M78F 4PJOG 4MDWA 4F7UA 2RHUA 2QQRA 4LDUA 1KHIA 2MMPA 4C92E 4BDYA 1U1SA 3QSUA 5I21A 2FL7A 2GCXA 1VQNA 2XKOC 4M78A 5GMKi 3GIBA 2K2VA 2M1HA 3JCMd 2LQKA 2H3JA 3CBOA 4M75C 2RHZA 3OS0A 2B8AA 3SWNC 5AYFA 3CPWA 1Q7YU 4IKFA 3QZ9B 2P0PA 3ZBDA 2P0QA 2RHXA 1YJNT 2EJGA 2YLCA 2R58A 3E1SA 4E7KA 2QQSA 2MWPA 2VUBA 4KUDK 2MI6A 4BI8B 4MMKA 1X75C 3OS2A 1VQ6A 3BY7A 4PJOB 3FC3A 3OW2S 2PVGB 1JJ2S 3TEEA 4IUTA 2DXCA 1KQSS 2X4WA 4C8QC 4II1A 1FXXA 2KSSA 2HBPA 2EWNA 3X25B 1YJWT 2OTLT 4E7HA 4KBMB 4C0DC 3DB3A 3CCMA 4M77B 1Q86U 3LW5E 2Y90A 5IT9E 3QYGB 1IZ6A 4J7IA 4C5HA 5GANj 4M7AG 2EJFA 1WQWA 5C6SA 1VQKA 5J39A 3L2ZA 5LJ3j 4X9CA 3OYNA 3OYEA 2VXEA 5GAOq 3MEUA 3A8HB 3LWHA 5EG2A 1VQKT 3JCMe 3L2VA 4R55A 5A0DA 2DD4A 4L5GA 1M9SA 1KQ1A 2DJZA 1WJQA 3GF5A 3L42A 3MP6A 3V8LA 3VKIA 3OYCA 2XDPA 4UC4A 4ZGJB 3JCMW 4MDXA 5CK9A 4J83A 1YJNA 2XU8A 3OYJA 2DKGA 2FYKA 4BD3A 5KCOA 2BUDA 3LGFA 3CC7T 3C4SA 4HT8A 1KHCA 3TREA 5HY6A 4BDZA 2X4YA 4C8QG 1VQOT 2DTHA 4NOYA 4PL6A 4C0ZA 1XTDA 2EJ9A 2KAFA 3BDLA 3HHTB 3QZ5B 3JCMh 3CCMT 4PKCC 4M77D 3PT9A 1QVGS 2X4JA 3MO8A 4NS5A 3V8KA 2FHDA 1K8AC 4EMHA 4BE1A 1KD1U 3G4SA 4NL2A 1LJOA 3HKSA 2V8KA 3E9GA 4N4IA 2XIDA 3I56A 1NJIC 2KVQG 2VGMA 4V2SA 3PIOA 3NTHA 2EQJA 4ZTJA 3CMET
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5L A;  5GAM d;  5GAN 6;  3FJP A;  4EMK C;  1M5Q 1;  3JB9 I;  1I8F A;  5GAN 4;  4M7A C;  1JBM A;  4N0A C;  4XTU A;  4XQ3 A;  5LJ3 f;  4DQ2 A;  4XU0 A;  1JRI A;  5CAI A;  3JCM X;  1B34 B;  3FB9 A;  4N0A A;  4M7A A;  4PJO E;  2DZC A;  2E65 A;  1X01 A;  5GAO n;  3HSB A;  3SB2 A;  1YCY A;  4M78 E;  3JB9 J;  5GAM j;  5GAN 2;  4M7D E;  2RA2 A;  4QVC A;  3QUI A;  4JLI A;  2DZ9 A;  4M7A F;  4XU3 A;  4M7D F;  4J6W A;  4NL3 A;  3RKX A;  4F7U B;  4XU2 A;  3V7C A;  2VXF A;  2DEQ A;  5LJ3 d;  1KQ2 A;  4C92 B;  5GAN e;  4MML A;  5GAM h;  3JCM P;  1D3B B;  5GMK m;  3JCM J;  3JCM c;  4PJO D;  3PGG A;  4OP0 A;  4M7D C;  2E41 A;  2JN0 A;  4M77 E;  4M78 F;  3L1A A;  3HFO A;  4XTX A;  4JRI A;  4PJO G;  4M77 F;  4F7U A;  3JB9 G;  4XU1 A;  3QSU A;  4RCB A;  3SWN B;  4C92 E;  1U1S A;  5GAM e;  5I21 A;  3AHU A;  3V7R A;  4J5Y A;  3JB9 D;  3GIB A;  1N9R A;  4M78 A;  4C8Q B;  4C92 A;  2RM4 A;  4EMG A;  5GMK i;  1LNX A;  5LJ5 f;  4M7D G;  4C92 G;  3JCM d;  4JRK A;  3VU3 C;  5GAN g;  2E1H A;  3BW1 A;  1H64 1;  4M75 C;  4M77 C;  3RKW A;  4M7D D;  3SWN C;  4EMK A;  5GAN f;  4C8Q F;  2DTI A;  3V7S A;  4XTZ A;  4C92 F;  3RES A;  4C92 D;  1MGQ A;  3EFS A;  2E64 A;  1Y96 A;  1WPY A;  4C8Q E;  2EJG A;  2YLC A;  1HK9 A;  2YHT A;  2RB6 A;  4XTV A;  4PJO F;  4MMK A;  4PJO B;  3BY7 A;  3RUX A;  3JCM g;  5GAN h;  5GAN 5;  2VC8 A;  5GAN d;  4C8Q C;  3RIR A;  5GAO p;  2EWN A;  2ZGW A;  4XTY A;  4HA8 A;  4XTW A;  4M7A E;  4A53 A;  4M77 B;  4J6X A;  1B34 A;  4PJO C;  2Y90 A;  3RKY A;  3RER A;  5LJ3 g;  5GAN j;  4M7A G;  4JUV A;  4J6Y A;  4QVD A;  5GMK l;  2EJF A;  1WQW A;  2K57 A;  3JCM b;  4HT9 A;  3L2Z A;  5GMK e;  4X9C A;  3EFR A;  4M75 E;  2VXE A;  5LJ3 j;  5GAO q;  4M7A D;  3JCM Q;  5LJ5 e;  3JCM e;  5GAN 8;  1I4K 1;  2DTO A;  3JB9 H;  4Y91 A;  5LJ5 h;  5GAO m;  5GAO r;  1KQ1 A;  2DJZ A;  3V8L A;  4RCC A;  5GMK h;  5GAN 7;  5GAN 3;  1BIB A;  4WF2 A;  3INZ A;  3JCM W;  1D3B A;  1LOJ A;  5LJ3 h;  3HFN A;  4M75 F;  2DKG A;  2FYK A;  1U1T A;  3FIF A;  1WQ7 A;  2DXU A;  4F7U G;  4HT8 A;  5LJ5 j;  4C8Q D;  3V8J A;  4F7U E;  5GMK j;  4PJO A;  4C92 C;  4M75 A;  4M77 A;  4F7U F;  5LJ5 g;  5GAO l;  4C8Q G;  4M77 G;  4M7D B;  2DTH A;  4NOY A;  4M78 B;  2CGH A;  3QO3 A;  4C8Q A;  2EJ9 A;  1HXD A;  4M78 C;  4A54 A;  3M4G A;  1Y96 B;  5GAM g;  3JB9 F;  2HNI A;  4M75 B;  3JCM h;  1WNL A;  1I81 A;  4M77 D;  4M75 D;  2DXT A;  5DY9 A;  3JCM V;  2E10 A;  4EMK B;  5GAM f;  5LJ3 e;  3V8K A;  4M78 D;  1M8V A;  4PNO A;  4EMH A;  2RD1 A;  4NL2 A;  1LJO A;  4M75 G;  1N9S A;  1BIA A;  3BFM A;  1TH7 A;  2FB7 A;  2QTX A;  4M78 G;  2DVE A;  4M7D A;  3QHS A;  3BDU A;  4M7A B;  2I2L A;  4V2S A;  5LJ5 d;  2EAY A;  4X9D A;  3JCM f;  3SWN A;  2YLB A; 
#chains in the Genus database with same CATH topology
 2CH4 W;  4DOV A;  3ASK A;  2XD0 A;  5I22 A;  3FJP A;  4ATO A;  1M5Q 1;  3QG1 A;  3EAE A;  4ZTF A;  2A08 A;  3J7A F;  5KYN A;  3I5S A;  4JJN K;  1FMK A;  1X27 A;  3QPH A;  2EGC A;  1HD3 A;  1VQ5 Q;  4A4K A;  3M53 A;  4M77 E;  4FW2 A;  4JZ4 A;  4F14 A;  2QA4 T;  4M77 F;  2YUN A;  3FDR A;  1RAI B;  2MOX A;  4XU1 A;  1M27 C;  2J7I A;  3RNJ A;  1Y07 A;  1U8R A;  3JB9 D;  1W6X A;  1VYV A;  4O6J A;  2DK3 A;  2ZPG B;  4QQG A;  4XTZ A;  2DL5 A;  3REB B;  2NLU A;  1HK9 A;  8AT1 B;  2JM8 A;  4AMC A;  4LDY A;  1VQ4 A;  3PE0 A;  2JTF A;  1VYU A;  4RTX A;  2DXB A;  3VV0 A;  1BI3 A;  1W2B A;  1NJI U;  2DYB A;  5FRO A;  1VQP A;  1N6A A;  2LNV A;  1OEB A;  2DPP B;  2JMC A;  2A37 A;  1NLO C;  1XQH A;  1BB9 A;  1NZ9 A;  2VYT A;  4CC4 B;  2ZPB B;  1ZUY A;  2PZ1 A;  1QVF A;  5M9O A;  2DER A;  5C0M A;  1YJW A;  1WQ7 A;  3E9F A;  4Z8A A;  1QWE A;  1JO8 A;  4AFQ C;  1U3O A;  3OBY A;  4F7U F;  3M0U A;  3HTR A;  3JB9 F;  1TG0 A;  2LX7 A;  2DD5 A;  3JCM V;  4M75 D;  5FU6 B;  3QDF A;  1OX9 A;  2FB7 A;  1D09 B;  2DVE A;  3H6Z A;  2CZ1 B;  3SWN A;  3FRN A;  4RTZ A;  3A98 A;  3CXC P;  2OJ2 A;  1M1G A;  1TWB A;  1TTH B;  3CC2 T;  3UDC A;  4ANJ A;  1JRI A;  2V8I A;  1VQO A;  5FW9 A;  3G7Z A;  2FG0 A;  3GLX A;  3OB9 A;  5DM7 R;  5GAM j;  2DBK A;  2JJ9 A;  4LDW A;  3U23 A;  2JW4 A;  4E7J A;  4MML A;  1KJW A;  2CP2 A;  1D1A A;  1R77 A;  1N27 A;  3L1A A;  1IHW A;  3VS0 A;  4JRQ A;  2RPN A;  4J9B A;  3RMQ A;  1A0N B;  1LNX A;  5I2S A;  5KYY A;  2MAM A;  4OMF B;  3VJP A;  4HVV A;  3LWI A;  3RES A;  3G4S Q;  1M1K R;  1NG2 A;  1UGP B;  2DFU A;  1ZSZ C;  1MMA A;  1RAB B;  3EG3 A;  3S6W A;  4Y28 E;  1QCF A;  3CMA T;  2QEX T;  4JJC A;  3I9Q A;  3G6E T;  4LDX A;  2HL3 A;  4PJO C;  2GTO A;  1M1K C;  4OB0 B;  1G3Y A;  3OMC A;  3CCJ Q;  2RJD A;  2HCK A;  5LJ5 e;  1G5V A;  3R6O A;  5GAO r;  1QVF S;  2QXF A;  4R0K A;  1QKW A;  2AIR B;  1D3B A;  1R0B G;  5LJ3 h;  3CCE T;  1QLY A;  1G2B A;  2CP0 A;  2LC4 A;  1NLP C;  2PVO B;  5CKB A;  2RK1 A;  2QYZ A;  4M77 A;  5LJ5 g;  1PSE A;  3GP8 A;  1YBY A;  2HMA A;  1GRI A;  4A54 A;  3CCL T;  4PFZ A;  1PCX A;  1TH7 A;  4M78 G;  2VAS A;  1SRM A;  2LQN A;  1K9M C;  4VUB A;  1YCS B;  3JB9 I;  3PTA A;  4M7A C;  3LH5 A;  4XTU A;  4XU0 A;  4Y92 A;  2X35 A;  3VS3 A;  2DYI A;  3TCJ A;  3DLM A;  2YXY A;  4FW1 A;  4QVC A;  1UEB A;  3G6E Q;  1E6H A;  3LX7 A;  3V7C A;  1YIT A;  2VGN A;  2LP5 A;  2K7A A;  3MEW A;  3OYB A;  3JCM P;  1FWZ A;  1KIK A;  4ORZ A;  4JRP A;  3CCS A;  3UWN A;  3CCS T;  1VQ6 T;  2FO0 A;  2CSQ A;  2QAS A;  1IXD A;  4C8Q B;  1NPP A;  1ZBX A;  1X6G A;  2AT1 B;  2RQV A;  2KT8 A;  3RKW A;  4GBQ A;  1RAE B;  1OZ2 A;  1VQ9 T;  2E64 A;  2V8J A;  1Y96 A;  1Q82 U;  1UHC A;  2O01 E;  1O9S A;  4IUR A;  1K8A U;  1M2V B;  2WSC E;  2MYS A;  2YUQ A;  3PMT A;  3CCR T;  1TSF A;  5KH6 A;  5FU6 C;  3OSS C;  4J6Y A;  4HT9 A;  3OYY A;  3CCV T;  1OYX A;  2ZPE B;  4A4E A;  3OBW A;  4M7A D;  2RJC A;  4K11 A;  1I4K 1;  2DTO A;  1VQ4 Q;  2KBT A;  1WFW A;  5IAY A;  1M1F A;  2FPD A;  2YT6 A;  2YWW A;  3TSW A;  3HFN A;  2L3R A;  1WGS A;  2E5K A;  4LE9 A;  3FIF A;  3A8G B;  1YHQ A;  2JMA A;  1PC0 A;  3DKM A;  4E7L A;  1Z9Q A;  4PJO A;  3VS6 A;  5GAO l;  1QP3 A;  1UTI A;  2ED0 A;  3X26 B;  3OYL A;  3OYG A;  4M78 C;  4PJM A;  2P4T A;  3OYI A;  1QVG P;  1WNL A;  1KG1 A;  2XHC A;  3L2W A;  2E10 A;  5LJ3 e;  5LL6 S;  2IG0 A;  1M8V A;  1ZSZ A;  3MP8 A;  2HKQ B;  4C5I A;  2LT4 A;  1E6G A;  2G3R A;  2GNC A;  4EMK C;  5D6W A;  1WA7 A;  3P8D A;  1T3L A;  1WLP B;  2O4X B;  2E12 A;  4LD9 K;  4DQ2 A;  5GAO n;  5A2Q E;  2E6N A;  1ZHI A;  1K8A R;  1PKT A;  4LXC A;  2QAZ A;  3JRZ A;  2DL4 A;  1ABO A;  2ENM A;  2MPX C;  1M90 U;  1RAF B;  1KQ2 A;  3SDZ A;  3JCM J;  1QW1 A;  2ROL A;  3G71 A;  1WHH A;  2DIG A;  2HAX A;  3MP1 A;  5KYW A;  2RHU A;  4PK4 A;  2QQR A;  5I21 A;  1ARK A;  2GCX A;  2HZY A;  3EFO B;  2LQK A;  1YWO A;  2HEQ A;  3JCM d;  3CBO A;  2RHZ A;  2B8A A;  3SWN C;  2ECZ A;  3CPW A;  1SRL A;  1BK2 A;  3ZBD A;  1UEC A;  2EJG A;  1LCK A;  2VUB A;  2MI6 A;  4MMK A;  1VQ6 A;  2PVG B;  2J6F A;  1QMC A;  1JJ2 S;  3TEE A;  4IUT A;  2DXC A;  1KQS S;  2X4W A;  2OTL T;  2EWN A;  4KBM B;  3LW5 E;  2Y90 A;  1S72 Q;  3QYG B;  1IZ6 A;  1T0J A;  1NBE B;  4M7A G;  1WQW A;  2QEX Q;  5J39 A;  3L2Z A;  4LN2 A;  3OYN A;  2VXE A;  4J9H A;  3MEU A;  3A8H B;  3CCL Q;  3L2V A;  4R55 A;  1OOT A;  1WJQ A;  2H8H A;  2XDP A;  3OW2 P;  5CK9 A;  4JZ3 A;  3TVT A;  2BUD A;  4HT8 A;  3C4S A;  3TRE A;  5KYX A;  5HY6 A;  1UHF A;  4BDZ A;  3CCE Q;  1GFD A;  2F2W A;  1XTD A;  2KAF A;  4M77 D;  2X4J A;  4JJB A;  2J6O A;  4EMH A;  1UFF A;  3HKS A;  2XID A;  2KVQ G;  1F1B B;  2XMF A;  3P8H A;  1PHT A;  1XNI A;  2QQA A;  4RTV A;  5IHI A;  1TUG B;  4J9C A;  4D8K A;  1Q81 U;  1RI0 A;  1OPK A;  1W4S A;  2P4R A;  4KH0 B;  2C0T A;  2EGE A;  2AZS A;  4KT0 E;  3PNW C;  1NEG A;  1Y0M A;  3M58 A;  4FSX A;  5IXF A;  2LCC A;  2RHI A;  1M1K U;  3M57 A;  3WVD B;  1JXM A;  2F69 A;  3IQL A;  1YIJ T;  4Q5W A;  4E7I A;  1TU0 B;  3PGG A;  4HXJ A;  1RLQ C;  1GBR A;  2E41 A;  3J81 E;  2IPO B;  2EYZ A;  1N8R U;  3JB9 G;  4RCB A;  1I07 A;  2RQW A;  1RAD B;  1ZLM A;  4EMG A;  4X34 A;  4FM4 B;  2KRN A;  3CCV Q;  4C8Q F;  1Q7Y R;  3H0H A;  1ZSG A;  3M59 A;  2DEU A;  4FT2 A;  2LVM A;  1ZBJ A;  2HQX A;  1AWW A;  1UGQ B;  3UF4 A;  2CT3 A;  3CEY A;  4QW2 A;  3QWY A;  2QDY B;  3O5Z A;  1Q82 C;  3QXE B;  1Q81 R;  5GAO p;  3OYM A;  4XTY A;  3PFS A;  4HCK A;  4J9E A;  4RMO A;  4J6X A;  1R8O B;  4EDU A;  4JDS A;  1EFN A;  2JVV A;  2XDB A;  1QKX A;  2BZX A;  5DLO A;  5HK0 A;  3I55 T;  2DLP A;  2GBQ A;  3ZFJ A;  3I55 A;  1TXQ A;  3MHX A;  1Q81 C;  5GAN 7;  1BIB A;  2X9H A;  2HBW A;  2L89 A;  3TU4 K;  2DL3 A;  3V8J A;  3VS1 A;  1H92 A;  4P5N A;  3ER0 A;  3VRZ A;  4C8Q A;  1W2B P;  3EGX B;  4L59 A;  2QDL A;  3CCJ A;  1K73 C;  4M78 D;  5KYX B;  3CCJ T;  2J06 A;  2K6D A;  3BFM A;  4IUV A;  4KGV B;  5KYU A;  3QKJ A;  1K76 A;  2KEA A;  2YLB A;  1I5L A;  3CC7 Q;  1VQL Q;  3NTK A;  1WXU A;  4IIO A;  1RL2 A;  1BI2 A;  3HP9 A;  1I8F A;  1G3T A;  1VUB A;  4XQ3 A;  4PJO E;  1WZO A;  4M7A A;  1X01 A;  1KC8 C;  3FLG A;  1MV3 A;  4C5E A;  4NL3 A;  4MZM A;  2DEQ A;  5D6Y A;  2MCN A;  4PJO D;  3CMA A;  1SSH A;  3VS4 A;  1MNE A;  2FVU A;  1BI1 A;  5GAM e;  2YRD A;  4FIB A;  1S72 A;  1PNJ A;  2GF7 A;  1ABQ A;  2C0O A;  4KUI A;  3GNG A;  3VUZ A;  4GY5 A;  3BW1 A;  1H64 1;  2OTL A;  2YRC A;  2OTJ A;  2KK4 A;  1U06 A;  1MGQ A;  1WPY A;  4N4G A;  4OB3 B;  2CSI A;  2DAQ A;  3Q1J A;  1WIE A;  4D8D A;  3M5A A;  2JS2 A;  1GXI E;  4A53 A;  1BKB A;  2L8D A;  3CC4 Q;  4QVD A;  3CCR A;  1JJ2 A;  1GCQ C;  3F70 A;  1KD1 R;  2VKN A;  1YJ9 A;  1VQ8 A;  5GAN 8;  4Y91 A;  2KYB A;  1ZQ1 A;  2L0A A;  4M75 F;  4OF1 A;  2RF0 A;  2E3I A;  3P8B B;  1AHJ B;  1YJW Q;  1MMN A;  3L2U A;  1N8R C;  4PLI A;  1Z9Z A;  2K3Y A;  1H3Z A;  4J9I A;  3G6E A;  2A3L A;  2LQW A;  4N4H A;  2EQK A;  2PQW A;  1VQK Q;  4LUD A;  2D8J A;  5FWC A;  3BDU A;  2CUB A;  2NWM A;  1K0S A;  4BI4 A;  5FRM A;  3E19 A;  1BU1 A;  4E47 A;  3VS5 A;  4A63 B;  3OYK A;  3OYA A;  1Q7Y C;  2R5A A;  3HRS A;  5CAI A;  3SFM A;  1VQP T;  4BUG A;  2EBP A;  4M78 E;  1M4Z A;  2OI3 A;  1OI1 A;  4M7D E;  4PJN A;  3QUI A;  4F7U B;  2X51 A;  1G8X A;  4DEX A;  4C92 B;  3H0F A;  4GLM A;  1AZE A;  4AFZ C;  1C6V X;  2JOY A;  1UJ0 A;  2AK5 A;  1JU5 C;  1NJI R;  4JLG A;  4JRI A;  3PVL A;  1BCO A;  3NMZ C;  2YUP A;  1PSF A;  4F16 A;  1X6O A;  2HL5 C;  4C92 G;  1VQ8 Q;  1I1J A;  3MPU B;  3CC4 A;  4KH1 B;  3I5R A;  4HCC A;  2M51 A;  3EFS A;  2EYX A;  2EQI A;  3M9Q A;  2RB6 A;  2LX9 A;  1Y57 A;  1Q95 G;  1FMW A;  2L3P A;  4ZN3 A;  4KUL A;  5ECA A;  1BCM A;  4CC2 A;  1PD1 A;  3RER A;  3RKY A;  3E2U A;  5LJ3 g;  5CKH A;  1ZUK A;  3JCM b;  2OTJ T;  2KGT A;  2GFU A;  2SRC A;  2GQV A;  2V26 A;  2KY9 A;  5GMK h;  3OYH A;  5GAN 3;  1WJS A;  1WHM A;  4F17 A;  3VYG A;  2RQR A;  1S1N A;  1X43 A;  1LVK A;  7AT1 B;  3OYD A;  2AKK A;  1WX6 A;  2L5Q A;  1U5S A;  2YSQ A;  3CPW P;  3EHQ A;  4FYW B;  4J9G A;  1YJ9 T;  3H41 A;  4M75 G;  1N9S A;  4XK8 E;  2F5T X;  2M0Y A;  3QHS A;  3FJ5 A;  3OSV A;  1MMD A;  1QVF P;  3NTI A;  5GAN 6;  3PVQ A;  4BB7 A;  2DRM A;  5CQY A;  1M30 A;  3OS1 A;  1GBQ A;  2DIQ A;  4KGZ B;  5FU7 C;  3MEV A;  4MZP A;  2OTJ Q;  3GPL A;  4XU3 A;  4M7D F;  5EC7 A;  2RHY A;  4C0D B;  3A8O B;  3LH0 A;  5IN1 A;  4J7F A;  3UT1 A;  2CH4 A;  4OML A;  2EYW A;  3TSZ A;  4PJO G;  4F7U A;  2MMP A;  4C92 E;  4BDY A;  5IH2 A;  2D0N A;  5GMK i;  1Q7Y U;  3QZ9 B;  2BZY A;  2P0P A;  2P0Q A;  2RHX A;  1ACM B;  1WHG A;  3CMA Q;  4KUD K;  1R0C B;  3BY7 A;  3FC3 A;  2KRM A;  3CCM Q;  2QTV A;  2HBP A;  1YJW T;  4C0D C;  3DB3 A;  1YFN A;  5IT9 E;  5GAN j;  2G6F X;  1I5O B;  2JT4 A;  1VQK A;  5GAO q;  3JCM e;  5A0D A;  2DD4 A;  3VKI A;  2GQI A;  3GF5 A;  3OYC A;  4UC4 A;  4ZGJ B;  5KCO A;  1CKA A;  3LGF A;  4QT7 A;  2X4Y A;  4C8Q G;  2LMJ A;  1VQO T;  4PL6 A;  2EKH A;  2EJ9 A;  4C0Z A;  3JCM h;  4PKC C;  2O2O A;  3MO8 A;  4NS5 A;  4BE1 A;  4NL2 A;  1LJO A;  4OMO A;  2V8K A;  4N4I A;  1NJI C;  2AZV A;  3EHR A;  4PJL A;  4CRI A;  2EQU A;  4OGE A;  2CP5 A;  4R56 A;  3QJ6 A;  2SEM A;  3C94 A;  4N0A C;  1VQ7 T;  2BE9 B;  2I0N A;  4FU6 A;  3MJX A;  3SB2 A;  1YCY A;  3JB9 J;  1K73 R;  2D1X A;  2A28 A;  1VIF A;  4J9D A;  5GAN e;  1AD5 A;  3BE3 A;  1X69 A;  3G71 Q;  2L2P A;  4F04 B;  1Q86 C;  4FT4 A;  2RQU A;  3V7R A;  1ZA1 B;  4M7D G;  2KE9 A;  2PVD B;  2RM4 A;  2GGR A;  3VU3 C;  2BE7 D;  5GAN g;  4M77 C;  1OV3 A;  2DTI A;  4HKE A;  2X3X D;  2O9V A;  4E6R A;  2VV5 A;  2FPF A;  5CKF A;  3OY9 A;  3PMI A;  2R5M A;  1KQS P;  5GAN d;  1D1C A;  3EGX A;  3L2Q A;  3HL8 A;  2P0K A;  1TUC A;  2QG9 B;  3EH1 A;  1B34 A;  1VQN T;  2LDM A;  2IVW A;  2DIL A;  3HRU A;  2OTL Q;  3M0R A;  1W2B S;  2YRV A;  2EIF A;  2DMO A;  4KRT A;  1KQS A;  3UPU A;  3I56 Q;  3M55 A;  4ZGD B;  5CIU A;  3CCU A;  1JQQ A;  4L6V 5;  1D1B A;  4DBF A;  1YI2 Q;  1IRX A;  2DXU A;  4ELY C;  4F7U G;  5LJ5 j;  4QQD A;  5GMK j;  2J05 A;  5FWB A;  3QO3 A;  3JSC A;  3KBG A;  2FRW A;  3I56 T;  2K79 A;  1I81 A;  4BE2 A;  1YJ9 Q;  2BKD N;  3SEM A;  4BY6 B;  3O8V A;  1KC8 R;  2D0Q B;  4PFO A;  4LD6 A;  1QP2 A;  5DLQ E;  1PRM C;  5GAM d;  3X24 B;  2LZ6 B;  2DF6 A;  4E7Z A;  4AFU C;  1RI9 A;  4A4G A;  5GAN 4;  1JBM A;  3AT1 B;  3JCM X;  3EG9 B;  3GNF B;  5IHN A;  2E6Z A;  2A36 A;  5GAN 2;  2F1L A;  3I35 A;  2KXD A;  4XU2 A;  2RN8 A;  2R57 A;  5FRN A;  2LTO A;  3M56 A;  3TQ7 P;  1X6B A;  2DX1 A;  1ZA2 B;  3HFO A;  3CCS Q;  3QII A;  2E5Q A;  5L23 A;  1WDX A;  5J3B A;  1HYO A;  2D9T A;  2RO0 A;  1RAC B;  2QK0 A;  4M7D D;  2XDD A;  5GAN f;  2P84 A;  2HKN A;  5CQX A;  3CCV A;  5CKE A;  3R6N A;  1FX7 A;  1HSQ A;  5KE3 A;  4PJO F;  3JCM g;  4IIM A;  2QA4 Q;  3M4Y A;  3CCU Q;  2VC8 A;  2PU9 B;  2JM9 A;  3EFO A;  1JB0 E;  2GFA A;  2K4Y A;  4RUG A;  2XK0 A;  2PUO B;  2JTM A;  2XI9 A;  4EIK A;  3EFR A;  3OW2 A;  2L3Q A;  1QCO A;  3OS5 A;  3RDV A;  1MUZ A;  1OU9 A;  5KCH A;  1U1T A;  4CC7 A;  6AT1 B;  1SG5 A;  4F7U E;  1VQM A;  2LCL A;  2KXC A;  1VQN Q;  2K5I A;  3NGP A;  3N5B B;  2HNI A;  3NFC A;  2AKL A;  4D6W A;  1WJR A;  1K9M U;  1BIA A;  4J8O A;  1M3C A;  1IRE B;  2EAY A;  5GMK m;  4FCY A;  5A0L A;  1VQ6 Q;  1NYF A;  1EZZ B;  3G71 T;  4AG1 C;  5LJ3 f;  5KYY B;  1JEG A;  2E65 A;  4JS5 A;  1IGU A;  1VOM A;  2RA2 A;  1TS9 A;  4M7A F;  2C0I A;  4J6W A;  2EYQ A;  1M8M A;  3H8Z A;  2X4X A;  2CS7 A;  2A7Y A;  2KRO A;  5KE2 A;  5GJW B;  2K9G A;  4OP0 A;  1AOJ A;  4C5G A;  3VS2 A;  1K0X A;  4OMQ A;  1PKS A;  3OA6 A;  4HVW A;  2CZ0 B;  3H0I A;  4J5Y A;  1N9R A;  3FEO A;  1XJW B;  2O4X A;  1RAG B;  5IHK A;  1KD1 C;  1T0H A;  2RMO A;  2DL8 A;  4B9W A;  3CCQ Q;  1YP5 A;  4C8Q E;  1M90 R;  2RK2 A;  1MV0 B;  4XTV A;  5CKD A;  3S3O A;  2AHJ B;  2L3S A;  5GAN 5;  4DBR A;  3VUB A;  3CC7 A;  2OX7 A;  4ESR A;  1N8R R;  1BYM A;  3G1J A;  3RIR A;  1V29 B;  2HQE A;  3M0S A;  3GOX A;  1Q86 R;  1VQ9 Q;  1M90 C;  3A8L B;  2EFI A;  2K57 A;  1SSF A;  1T3S A;  5GMK e;  2KRS A;  5LJ5 h;  4BAC A;  3RR6 A;  1AWJ A;  4PFP A;  1PWT A;  1UUE A;  3CBP A;  1GCP A;  2D6F A;  2K5F A;  1YHQ T;  4DBH A;  1K9M R;  4C92 C;  2W10 A;  2YUO A;  1EX4 A;  1KC8 U;  3T9N A;  2KNB B;  4EMK B;  4XAX B;  3EG0 A;  3ZEH A;  4PNO A;  2RD1 A;  3CXC S;  2CZ7 B;  1AWX A;  4OVA A;  1VQ4 T;  2LQ8 A;  2DO3 A;  2QGG A;  1J3T A;  4YTL A;  5I2M A;  4IUP A;  2LCS A;  4HVU A;  3QJY A;  1BI0 A;  1B34 B;  5KYU B;  1UE9 A;  1VQO Q;  1XOV A;  1WHK A;  2B86 A;  3CCL A;  2DZ9 A;  2EKO A;  4ZGE B;  3WVE B;  1WHL A;  2NUT B;  1X2K A;  1M2V A;  2COZ A;  4OMP A;  1OQK A;  1PRL C;  4OMN A;  1QVP A;  4MDW A;  4LDU A;  1U1S A;  2PNI A;  2FL7 A;  1GCQ A;  1MND A;  3GIB A;  4M78 A;  2EVR A;  2HSP A;  4M75 C;  5AYF A;  4IKF A;  2COW A;  1M3B A;  2YLC A;  3ZL7 C;  2EYY A;  2MWP A;  2QQS A;  3KFV A;  3OS2 A;  4PJO B;  4C8Q C;  1VQM Q;  3X25 B;  2KSS A;  4M77 B;  3C0C A;  1Q86 U;  4C5H A;  2EJF A;  5C6S A;  3OYE A;  1VQ7 Q;  3LWH A;  3M0P A;  2MIO A;  3UA7 A;  1M9S A;  1KQ1 A;  3L42 A;  3V8L A;  1KFZ A;  1NYG A;  1QWF A;  3EH2 A;  1YJN A;  2XU8 A;  2DKG A;  4BD3 A;  2JS0 A;  1D0X A;  3CC7 T;  1AWO A;  2CP6 A;  1D0Z A;  3BDL A;  3HHT B;  3QZ5 B;  3CCM T;  2O9S A;  3PT9 A;  1V76 A;  2FHD A;  3NPF A;  1KD1 U;  3G4S A;  2ZAE A;  1IGQ A;  3E9G A;  3I56 A;  3PIO A;  1V1C A;  3NTH A;  3EGD A;  2EQJ A;  4ZTJ A;  2CP3 A;  2LRQ A;  4KGX B;  3OQ5 A;  2RJF A;  4LNP A;  2F2V A;  2ZPH B;  2M9U A;  3CD6 T;  1AT1 B;  4BY6 C;  3LGL A;  3L2R A;  3EG1 A;  1B3Q A;  4FSS A;  3I55 Q;  2DBM A;  3DLL A;  1WXT A;  2RH2 A;  4Z02 A;  2MK5 A;  4DA4 A;  2F5K A;  1YN8 A;  3UA6 A;  2DL7 A;  2EW3 A;  3QYH B;  4XTX A;  1O75 A;  2NUT A;  3J80 E;  5HK3 A;  4BI3 A;  2RJE A;  1QVG A;  1JXO A;  4C92 A;  3A1P A;  2ZPF B;  3HRT A;  1OX8 A;  1G3W A;  1VQ7 A;  2E1H A;  2DNU A;  4OB2 B;  1TUD A;  1VIE A;  2OAU A;  3JAM E;  1WYX A;  3V7S A;  1VA7 A;  1IB8 A;  1YNZ A;  3CCU T;  3DB4 A;  2ED1 A;  2M16 A;  4M4Z A;  3S3M A;  2ZZD A;  1LPL A;  2QQB A;  4TVR A;  5AT1 B;  3RUX A;  1YJN Q;  2E3H A;  4IUQ A;  3VS7 A;  1NE8 A;  4HA8 A;  3M0Q A;  2CYZ B;  4RG8 A;  1DJ7 B;  3MCA B;  5GMK l;  2QEX A;  3CCR Q;  3CC2 Q;  2M02 A;  3CBM A;  3LYI A;  3JB9 H;  2RNA A;  4RCC A;  1C0M A;  2JXB A;  4QVZ A;  1LOJ A;  4QKU A;  1KSW A;  1AZG B;  1YHQ Q;  5CCA A;  1ZSZ B;  4C8Q D;  1ZX6 A;  2WSE E;  4QQ6 A;  2FPE A;  3CCE A;  3EG2 A;  3QWX X;  4MZT A;  2Y4X A;  3M4G A;  1VQM T;  2ESW A;  2DXT A;  5GAM f;  3QDR B;  2EQM A;  2VVK A;  4DBQ A;  3CCQ T;  4DOW A;  4DEY A;  4ELZ C;  5L8R E;  3JCM f;  2VB6 A;  2YDL A;  3C95 A;  2BTT A;  3WXM B;  1NEB A;  5KYW B;  4RTY A;  1VQ8 T;  2RQT A;  1PD0 A;  5IXB A;  1OU8 A;  1RLP C;  4OMM A;  3FB9 A;  2DZC A;  3CD6 Q;  3HSB A;  2KDS A;  1Y7X A;  2ROT A;  1SF9 A;  4JLI A;  1YIT Q;  1UDL A;  1IHV A;  3M54 A;  2DET A;  3KUF A;  1K4U S;  2LJ1 A;  2EPD A;  3JCM c;  3NHN A;  1GL5 A;  2JN0 A;  3A5Z B;  3MKD A;  5I11 A;  1UJY A;  2IIM A;  1Q82 R;  3SWN B;  2V1Q A;  2FEI A;  3CD6 A;  4Z89 A;  2DE0 X;  2ABL A;  2LT1 A;  1S72 T;  4X1V A;  3CC2 A;  2KMT A;  4E7S A;  4EMK A;  1VQ5 T;  3EGU A;  3SD4 A;  2C06 A;  2BIV A;  1K1Z A;  2YHT A;  1SHF A;  2DJQ A;  1YIJ A;  1MMG A;  4PLL A;  1K73 U;  2JNG A;  2DA9 A;  3THK A;  3QBY A;  5GAN h;  4AT1 B;  1G3S A;  1VQL A;  2Y4Y A;  3H9N A;  2ZGW A;  3X28 B;  1WXB A;  1IO6 A;  2O31 A;  4OGC A;  2X3W D;  1PM3 A;  4JUV A;  2HDA A;  5HKC A;  2LJ0 A;  3JCM Q;  1HJD A;  3ULR B;  2WAC A;  2MWO A;  3A8M B;  5D7U A;  2O88 A;  3OYF A;  2M0O A;  4WF2 A;  2QI2 A;  5GJV B;  4C0G A;  1WI7 A;  3URG A;  3G4S T;  2JUF A;  4C0F A;  5D6X A;  2DVJ A;  5CO7 A;  3CC4 T;  2KYM A;  4M7D B;  2WSF E;  1BBZ A;  4ZNX A;  4M78 B;  1HXD A;  1M3A A;  5DY9 A;  3D7S B;  2XG8 D;  2LJ3 A;  5FU7 B;  4FL6 A;  1SKU B;  1PG5 B;  3LLR A;  3MET A;  4GLK A;  1B07 A;  2I2L A;  5LJ5 d;  3ME9 A;  1YWP A;  1WHJ A;  4JJD A;  1QQJ A;  1W70 A;  3CME Q;  2HD0 A;  2LNH B;  1VQ5 A;  1UGS B;  2NYS A;  4WTO B;  3GBQ A;  5CR2 A;  1D0Y A;  1I0C A;  1NPR A;  1VYT A;  2KQW A;  1SEM A;  3CCQ A;  4JS4 A;  1VQ9 A;  5A0G A;  3CQT A;  4RKU E;  1M2O A;  4LDV A;  4ZN1 A;  5J26 A;  3PIP A;  3RBB B;  3CXC A;  8ATC B;  4EPC A;  2CP7 A;  2CUD A;  3RMS A;  4IUU A;  1RAA B;  1UB4 A;  3AHU A;  3HPW A;  1X2Q A;  5LJ5 f;  5FLX E;  4FYV B;  1EIF A;  4JRK A;  1C1A A;  4O5V A;  1OZ3 A;  4B9X A;  4ME7 A;  4C92 F;  4C92 D;  1KK7 A;  1Y71 A;  1N5Z A;  4HCZ A;  1OUL A;  2CRE A;  2V1R A;  2ATC B;  4LUE A;  2FZK B;  1YIT T;  2NUP B;  4RTW A;  2RI3 A;  1UGR B;  1JJ2 P;  4WCI A;  2NUP A;  4XTW A;  4M7A E;  2GTJ A;  2CZ6 B;  3MEA A;  4FYY B;  2E70 A;  1AVZ C;  2JZ2 A;  2HQH A;  4AFS C;  2XIC A;  4M75 E;  3VRY A;  2DRK A;  1H8K A;  2K3X A;  3CPF A;  5GAO m;  2JTE A;  3S3N A;  4HCB A;  3OMG A;  3INZ A;  1YIJ Q;  1FYN A;  2FRY A;  2K5L A;  1YI2 A;  3JV3 A;  1VQL T;  1NM7 A;  1YI2 T;  1TOV A;  2J6K A;  3CME A;  3SHW A;  4M75 A;  1GFC A;  4M77 G;  2CGH A;  5GAM g;  1Y96 B;  2OAW A;  4M75 B;  2K2M A;  1CSK A;  2COY A;  1H3H A;  1B7T A;  1FMV A;  2PUK B;  4RG2 A;  2QTX A;  4M7D A;  1P92 A;  2CKK A;  2D8H A;  4M7A B;  4BE0 A;  2ZCF B;  4X9D A;  3CPW S;  1SPK A;  2W0Z A;  2RI2 A;  2KI7 A;  2QQ9 A;  4A4H A;  2RI5 A;  2QA4 A;  3KXT A;  3C12 A;  2FZC B;  4RTU A;  1K9A A;  4JPB W;  2ZPI B;  2MF2 A;  4N0A A;  1MHN A;  4OB1 B;  3X20 B;  1CKB A;  5CVI A;  3RKX A;  3M0T A;  2VXF A;  5LJ3 d;  3EG9 A;  2BZ8 A;  5GAM h;  1D3B B;  2KR3 A;  4A4F A;  3VYH B;  4M7D C;  4CI0 C;  4M78 F;  1SHG A;  1E7O A;  2H3E B;  2QGF B;  2HSE B;  2Z0W A;  1W1F A;  1KHI A;  3QSU A;  2FZG B;  4B6M A;  2CDT A;  1VQN A;  2XKO C;  2K2V A;  2F2X A;  2M1H A;  2H3J A;  3OS0 A;  9ATC B;  1YJN T;  2R58 A;  3E1S A;  4E7K A;  4BI8 B;  1X75 C;  4AG2 C;  3OW2 S;  2CT4 A;  1OPL A;  4II1 A;  1FXX A;  3UAT A;  4E7H A;  3CCM A;  2E4H A;  1QCN A;  4J7I A;  2NUZ A;  3REA B;  1AEY A;  4Z88 A;  2DM1 A;  2KT1 A;  4X9C A;  5HCK A;  5LJ3 j;  5EG2 A;  1VQK T;  3EGD B;  4L5G A;  2PTK A;  2DJZ A;  3MP6 A;  2EGA A;  3JCM W;  4MDX A;  4J83 A;  3OYJ A;  2FYK A;  2K3B A;  2VWF A;  1KHC A;  4E2F B;  1RAH B;  4PJJ A;  2DTH A;  4RTT A;  4NOY A;  4FYX B;  1G83 A;  1VQP Q;  1QVG S;  4J9F A;  3V8K A;  1K8A C;  2A0F B;  1RUW A;  1UGV A;  4CC3 A;  2VGM A;  4V2S A;  1UG1 A;  3CME T;  1ZUU A; 
#chains in the Genus database with same CATH homology
 4DOV A;  3P8H A;  3ASK A;  4CRI A;  1XNI A;  2LRQ A;  2EQU A;  2XD0 A;  2QQA A;  3FJP A;  3OQ5 A;  2RJF A;  4OGE A;  1M5Q 1;  4R56 A;  4ATO A;  3QJ6 A;  2ZPH B;  3C94 A;  2M9U A;  4N0A C;  3QG1 A;  1RI0 A;  1Q81 U;  1VQ7 T;  3EAE A;  4ZTF A;  3CD6 T;  1W4S A;  4FU6 A;  4BY6 C;  3SB2 A;  1YCY A;  3J7A F;  3LGL A;  3L2R A;  3JB9 J;  4KT0 E;  3PNW C;  3M58 A;  3DLL A;  4FSX A;  2LCC A;  2RHI A;  2RH2 A;  1M1K U;  1VIF A;  3M57 A;  4Z02 A;  4JJN K;  3WVD B;  2F69 A;  3QPH A;  5GAN e;  1YIJ T;  4DA4 A;  4Q5W A;  4E7I A;  2F5K A;  3PGG A;  2E41 A;  3M53 A;  4M77 E;  4A4K A;  3J81 E;  3QYH B;  4XTX A;  1N8R U;  2QA4 T;  1O75 A;  3JB9 G;  4M77 F;  3FDR A;  4XU1 A;  1Q86 C;  4FT4 A;  5HK3 A;  4RCB A;  3J80 E;  4BI3 A;  2RJE A;  1QVG A;  1Y07 A;  3V7R A;  1U8R A;  3JB9 D;  4M7D G;  4EMG A;  4C92 A;  2PVD B;  2RM4 A;  2ZPF B;  3HRT A;  4X34 A;  4FM4 B;  1G3W A;  4O6J A;  3VU3 C;  1VQ7 A;  2DK3 A;  5GAN g;  2E1H A;  2ZPG B;  4M77 C;  4OB2 B;  4QQG A;  1VIE A;  2OAU A;  3JAM E;  4C8Q F;  2DTI A;  4HKE A;  4XTZ A;  3V7S A;  3M59 A;  4FT2 A;  3CCU T;  2NLU A;  1HK9 A;  2VV5 A;  2LVM A;  3DB4 A;  5CKF A;  2M16 A;  4LDY A;  3OY9 A;  1VQ4 A;  3S3M A;  2HQX A;  2ZZD A;  3PMI A;  1UGQ B;  2JTF A;  2QQB A;  3CEY A;  4QW2 A;  2R5M A;  4TVR A;  2DXB A;  3RUX A;  3VV0 A;  5GAN d;  1BI3 A;  2QDY B;  1W2B A;  1NJI U;  3L2Q A;  3HL8 A;  1Q82 C;  3QXE B;  4IUQ A;  5GAO p;  3OYM A;  4XTY A;  1NE8 A;  3PFS A;  2P0K A;  4HA8 A;  4RMO A;  5FRO A;  1VQP A;  1N6A A;  1B34 A;  4J6X A;  1R8O B;  1VQN T;  2LDM A;  2CYZ B;  2LNV A;  4EDU A;  2IVW A;  4JDS A;  4RG8 A;  2DPP B;  1DJ7 B;  2JVV A;  3MCA B;  5GMK l;  5DLO A;  3HRU A;  2QEX A;  2XDB A;  5HK0 A;  3I55 T;  1W2B S;  1XQH A;  2YRV A;  2EIF A;  1NZ9 A;  2VYT A;  3CBM A;  3ZFJ A;  2ZPB B;  3I55 A;  1KQS A;  3LYI A;  3UPU A;  5M9O A;  1QVF A;  3JB9 H;  3MHX A;  3M55 A;  4ZGD B;  4RCC A;  1Q81 C;  5C0M A;  5GAN 7;  1BIB A;  5CIU A;  3CCU A;  4QVZ A;  1LOJ A;  4L6V 5;  2L89 A;  1YJW A;  1WQ7 A;  3E9F A;  3TU4 K;  2DXU A;  4ELY C;  4F7U G;  5CCA A;  5LJ5 j;  4C8Q D;  2WSE E;  3V8J A;  4QQD A;  4QQ6 A;  5GMK j;  3CCE A;  3OBY A;  4F7U F;  4MZT A;  4P5N A;  3ER0 A;  4C8Q A;  3QO3 A;  3JSC A;  2Y4X A;  3KBG A;  3JB9 F;  3M4G A;  4L59 A;  2DD5 A;  3I56 T;  1VQM T;  3JCM V;  1I81 A;  4M75 D;  5GAM f;  2DXT A;  4BE2 A;  5FU6 B;  3CCJ A;  1K73 C;  3QDR B;  4M78 D;  2BKD N;  4BY6 B;  2EQM A;  3CCJ T;  3CCQ T;  3BFM A;  3O8V A;  2FB7 A;  2DVE A;  4IUV A;  4DOW A;  2D0Q B;  3QKJ A;  4ELZ C;  3H6Z A;  5L8R E;  2CZ1 B;  3JCM f;  4LD6 A;  3SWN A;  2YLB A;  1QP2 A;  3C95 A;  3FRN A;  5DLQ E;  1I5L A;  5GAM d;  3WXM B;  3X24 B;  3NTK A;  1RL2 A;  1VQ8 T;  1BI2 A;  1M1G A;  4A4G A;  3HP9 A;  1I8F A;  5GAN 4;  1JBM A;  1G3T A;  3UDC A;  1VUB A;  4XQ3 A;  3JCM X;  3CC2 T;  1JRI A;  4PJO E;  3FB9 A;  2V8I A;  3GNF B;  1VQO A;  2DZC A;  4M7A A;  3G7Z A;  1X01 A;  3HSB A;  3GLX A;  3OB9 A;  5DM7 R;  1KC8 C;  2KDS A;  2E6Z A;  1Y7X A;  5GAM j;  3FLG A;  5GAN 2;  4JLI A;  4C5E A;  4NL3 A;  4LDW A;  4XU2 A;  4MZM A;  3M54 A;  4E7J A;  3KUF A;  2DEQ A;  2R57 A;  5FRN A;  2LTO A;  3M56 A;  4MML A;  5D6Y A;  3JCM c;  4PJO D;  2JN0 A;  3A5Z B;  3CMA A;  1N27 A;  3HFO A;  3L1A A;  2FVU A;  1BI1 A;  3QII A;  2E5Q A;  4JRQ A;  3SWN B;  5GAM e;  5J3B A;  4FIB A;  3RMQ A;  1S72 A;  2GF7 A;  3CD6 A;  2D9T A;  2RO0 A;  1LNX A;  2LT1 A;  1S72 T;  4KUI A;  3GNG A;  3CC2 A;  5I2S A;  2KMT A;  4GY5 A;  3BW1 A;  1H64 1;  3VUZ A;  2MAM A;  4OMF B;  2OTL A;  4M7D D;  2XDD A;  4EMK A;  5GAN f;  3VJP A;  2OTJ A;  3LWI A;  2KK4 A;  1VQ5 T;  3RES A;  3SD4 A;  5CQX A;  2C06 A;  1MGQ A;  5CKE A;  3CCV A;  1WPY A;  2BIV A;  4N4G A;  1UGP B;  4OB3 B;  1FX7 A;  2YHT A;  5KE3 A;  1YIJ A;  4PLL A;  1K73 U;  2JNG A;  2DAQ A;  4PJO F;  3QBY A;  3Q1J A;  3JCM g;  5GAN h;  3S6W A;  3M4Y A;  2VC8 A;  1G3S A;  1VQL A;  2PU9 B;  2Y4Y A;  1Q7Y C;  4Y28 E;  3M5A A;  3CMA T;  2ZGW A;  2QEX T;  3X28 B;  1GXI E;  3G6E T;  4A53 A;  1BKB A;  4LDX A;  4PJO C;  2L8D A;  4OGC A;  1M1K C;  4OB0 B;  4JUV A;  1JB0 E;  2GFA A;  2K4Y A;  4QVD A;  3CCR A;  2XK0 A;  2PUO B;  1G3Y A;  2JTM A;  2XI9 A;  1JJ2 A;  3F70 A;  3EFR A;  3OMC A;  5HKC A;  3OW2 A;  2RJD A;  1YJ9 A;  1VQ8 A;  3JCM Q;  5LJ5 e;  5GAN 8;  1G5V A;  2WAC A;  3R6O A;  4Y91 A;  3OS5 A;  2MWO A;  5GAO r;  3A8M B;  1QVF S;  2QXF A;  3OYF A;  1ZQ1 A;  2M0O A;  4WF2 A;  1D3B A;  5LJ3 h;  2QI2 A;  4C0G A;  4M75 F;  5KCH A;  4OF1 A;  3CCE T;  3URG A;  1U1T A;  3G4S T;  2JUF A;  4C0F A;  2LC4 A;  5D6X A;  3P8B B;  2PVO B;  1AHJ B;  5CKB A;  5CO7 A;  3CC4 T;  3L2U A;  1N8R C;  2RK1 A;  4F7U E;  1VQM A;  4PLI A;  2LCL A;  4M77 A;  5LJ5 g;  1PSE A;  3GP8 A;  2K5I A;  4M7D B;  2K3Y A;  1YBY A;  2WSF E;  1H3Z A;  4M78 B;  1HXD A;  3N5B B;  4A54 A;  3G6E A;  2A3L A;  2HNI A;  5DY9 A;  4N4H A;  2XG8 D;  2EQK A;  2PQW A;  3CCL T;  5FU7 B;  3NFC A;  4FL6 A;  4D6W A;  1WJR A;  1K9M U;  1BIA A;  1TH7 A;  4M78 G;  4J8O A;  3LLR A;  3MET A;  4GLK A;  3BDU A;  2I2L A;  5LJ5 d;  1IRE B;  3ME9 A;  2EAY A;  5GMK m;  5A0L A;  4BI4 A;  2HD0 A;  1VQ5 A;  1UGS B;  5FRM A;  1K9M C;  3E19 A;  3G71 T;  4VUB A;  3JB9 I;  4E47 A;  3PTA A;  4M7A C;  4XTU A;  3OYA A;  3OYK A;  5LJ3 f;  2R5A A;  3HRS A;  4XU0 A;  5CAI A;  3SFM A;  5CR2 A;  1VQP T;  2E65 A;  2X35 A;  4JS5 A;  1NPR A;  2KQW A;  4BUG A;  3TCJ A;  4M78 E;  3DLM A;  3CCQ A;  1M4Z A;  4JS4 A;  1VQ9 A;  5A0G A;  1OI1 A;  4M7D E;  2RA2 A;  4QVC A;  1UEB A;  3QUI A;  4M7A F;  4J6W A;  4RKU E;  2EYQ A;  4F7U B;  3H8Z A;  3LX7 A;  3V7C A;  1YIT A;  4LDV A;  2X4X A;  2CS7 A;  2A7Y A;  4ZN1 A;  2VGN A;  4C92 B;  5J26 A;  3MEW A;  3PIP A;  5KE2 A;  3OYB A;  3JCM P;  1FWZ A;  2JOY A;  3CXC A;  4OP0 A;  4JRP A;  4C5G A;  4EPC A;  3CCS A;  3RMS A;  4IUU A;  4JLG A;  3UWN A;  4JRI A;  3CCS T;  1VQ6 T;  1UB4 A;  3AHU A;  3HPW A;  1PSF A;  3OA6 A;  2CZ0 B;  4J5Y A;  1N9R A;  1X6O A;  3FEO A;  1NPP A;  4C8Q B;  2O4X A;  1ZBX A;  5FLX E;  5LJ5 f;  4C92 G;  1EIF A;  4JRK A;  4O5V A;  3RKW A;  1OZ3 A;  1KD1 C;  4B9X A;  3CC4 A;  4ME7 A;  1OZ2 A;  4B9W A;  4C92 F;  4C92 D;  1Y71 A;  4HCC A;  1VQ9 T;  2E64 A;  3EFS A;  2V8J A;  1Y96 A;  4HCZ A;  4C8Q E;  2RK2 A;  1Q82 U;  3M9Q A;  2RB6 A;  4XTV A;  2O01 E;  5CKD A;  1O9S A;  3S3O A;  2LX9 A;  4IUR A;  1YIT T;  1K8A U;  2AHJ B;  5GAN 5;  2RI3 A;  2WSC E;  4ZN3 A;  4KUL A;  3VUB A;  3CC7 A;  1UGR B;  1BYM A;  3RIR A;  1V29 B;  3PMT A;  3CCR T;  4XTW A;  4M7A E;  2HQE A;  2CZ6 B;  3MEA A;  5KH6 A;  3GOX A;  3RER A;  5FU6 C;  3RKY A;  2E70 A;  5LJ3 g;  1M90 C;  5CKH A;  3A8L B;  3OSS C;  4J6Y A;  2EFI A;  2JZ2 A;  2K57 A;  3OYY A;  3JCM b;  2XIC A;  1SSF A;  3CCV T;  4HT9 A;  5GMK e;  1OYX A;  4M75 E;  2ZPE B;  4A4E A;  3OBW A;  4M7A D;  2OTJ T;  2RJC A;  2K3X A;  1I4K 1;  3CPF A;  2DTO A;  2GFU A;  5LJ5 h;  5GAO m;  4BAC A;  2GQV A;  3S3N A;  5IAY A;  4HCB A;  2KY9 A;  5GMK h;  3OMG A;  1M1F A;  3OYH A;  5GAN 3;  3INZ A;  1WJS A;  3HFN A;  2L3R A;  3CBP A;  1WGS A;  2K5L A;  3A8G B;  3FIF A;  3VYG A;  1YI2 A;  1YHQ A;  2D6F A;  2K5F A;  1VQL T;  3DKM A;  4E7L A;  1YHQ T;  1YI2 T;  3CME A;  4PJO A;  3OYD A;  4C92 C;  4M75 A;  5GAO l;  2L5Q A;  4M77 G;  1QP3 A;  3OYG A;  3X26 B;  3OYL A;  2CGH A;  1KC8 U;  4M78 C;  5GAM g;  1Y96 B;  3T9N A;  3OYI A;  2P4T A;  4M75 B;  1KG1 A;  1WNL A;  2XHC A;  3L2W A;  4EMK B;  4XAX B;  2E10 A;  5LJ3 e;  3ZEH A;  2IG0 A;  5LL6 S;  4PNO A;  1YJ9 T;  1M8V A;  2RD1 A;  3CXC S;  3MP8 A;  2CZ7 B;  2PUK B;  4M75 G;  4C5I A;  1N9S A;  4XK8 E;  2F5T X;  2QTX A;  2LT4 A;  4OVA A;  4RG2 A;  1P92 A;  2CKK A;  2DO3 A;  2LQ8 A;  3QHS A;  4M7A B;  1VQ4 T;  4M7D A;  4BE0 A;  4YTL A;  2G3R A;  2ZCF B;  3OSV A;  4X9D A;  4IUP A;  5I2M A;  4EMK C;  3CPW S;  3NTI A;  5D6W A;  2RI2 A;  3QJY A;  5GAN 6;  2QQ9 A;  3P8D A;  2RI5 A;  4A4H A;  3KXT A;  2QA4 A;  3C12 A;  4BB7 A;  2O4X B;  2E12 A;  5CQY A;  4LD9 K;  4DQ2 A;  1BI0 A;  2ZPI B;  1B34 B;  2MF2 A;  1MHN A;  2DIQ A;  4N0A A;  3OS1 A;  4OB1 B;  3X20 B;  5GAO n;  5FU7 C;  3MEV A;  2E6N A;  5CVI A;  1XOV A;  1ZHI A;  5A2Q E;  4MZP A;  3CCL A;  2DZ9 A;  3GPL A;  4XU3 A;  4M7D F;  2EKO A;  3JRZ A;  2RHY A;  3RKX A;  3WVE B;  4C0D B;  4ZGE B;  1M90 U;  3A8O B;  2VXF A;  5LJ3 d;  3LH0 A;  1KQ2 A;  5IN1 A;  4J7F A;  5GAM h;  1D3B B;  3SDZ A;  3UT1 A;  1QW1 A;  4A4F A;  3JCM J;  3VYH B;  3G71 A;  2DIG A;  2HAX A;  4M7D C;  1QVP A;  3MP1 A;  4CI0 C;  4M78 F;  4PJO G;  4MDW A;  4F7U A;  2RHU A;  2QQR A;  4LDU A;  1KHI A;  2MMP A;  4C92 E;  4BDY A;  1U1S A;  3QSU A;  5I21 A;  2FL7 A;  2GCX A;  1VQN A;  2XKO C;  4M78 A;  5GMK i;  3GIB A;  2K2V A;  2M1H A;  3JCM d;  2LQK A;  2H3J A;  3CBO A;  4M75 C;  2RHZ A;  3OS0 A;  2B8A A;  3SWN C;  5AYF A;  3CPW A;  1Q7Y U;  4IKF A;  3QZ9 B;  2P0P A;  3ZBD A;  2P0Q A;  2RHX A;  1YJN T;  2EJG A;  2YLC A;  2R58 A;  3E1S A;  4E7K A;  2QQS A;  2MWP A;  2VUB A;  4KUD K;  2MI6 A;  4BI8 B;  4MMK A;  1X75 C;  3OS2 A;  1VQ6 A;  3BY7 A;  4PJO B;  3FC3 A;  3OW2 S;  2PVG B;  1JJ2 S;  3TEE A;  4IUT A;  2DXC A;  1KQS S;  2X4W A;  4C8Q C;  4II1 A;  1FXX A;  2KSS A;  2HBP A;  2EWN A;  3X25 B;  1YJW T;  2OTL T;  4E7H A;  4KBM B;  4C0D C;  3DB3 A;  3CCM A;  4M77 B;  1Q86 U;  3LW5 E;  2Y90 A;  5IT9 E;  3QYG B;  1IZ6 A;  4J7I A;  4C5H A;  5GAN j;  4M7A G;  2EJF A;  1WQW A;  5C6S A;  1VQK A;  5J39 A;  3L2Z A;  5LJ3 j;  4X9C A;  3OYN A;  3OYE A;  2VXE A;  5GAO q;  3MEU A;  3A8H B;  3LWH A;  5EG2 A;  1VQK T;  3JCM e;  3L2V A;  4R55 A;  5A0D A;  2DD4 A;  4L5G A;  1M9S A;  1KQ1 A;  2DJZ A;  1WJQ A;  3GF5 A;  3L42 A;  3MP6 A;  3V8L A;  3VKI A;  3OYC A;  2XDP A;  4UC4 A;  4ZGJ B;  3JCM W;  4MDX A;  5CK9 A;  4J83 A;  1YJN A;  2XU8 A;  3OYJ A;  2DKG A;  2FYK A;  4BD3 A;  5KCO A;  2BUD A;  3LGF A;  3CC7 T;  3C4S A;  4HT8 A;  1KHC A;  3TRE A;  5HY6 A;  4BDZ A;  2X4Y A;  4C8Q G;  1VQO T;  2DTH A;  4NOY A;  4PL6 A;  4C0Z A;  1XTD A;  2EJ9 A;  2KAF A;  3BDL A;  3HHT B;  3QZ5 B;  3JCM h;  3CCM T;  4PKC C;  4M77 D;  3PT9 A;  1QVG S;  2X4J A;  3MO8 A;  4NS5 A;  3V8K A;  2FHD A;  1K8A C;  4EMH A;  4BE1 A;  1KD1 U;  3G4S A;  4NL2 A;  1LJO A;  3HKS A;  2V8K A;  3E9G A;  4N4I A;  2XID A;  3I56 A;  1NJI C;  2KVQ G;  2VGM A;  4V2S A;  3PIO A;  3NTH A;  2EQJ A;  4ZTJ A;  3CME T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...