4X9CA

1.4a crystal structure of hfq from methanococcus jannaschii
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
PNFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDYIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of RNA-binding properties of the archaeal Hfq-like protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
molecule keywords Uncharacterized protein MJ1435
total genus 10
structure length 57
sequence length 57
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4x9cA00
4C8QB 4C8QF 4MMKA 3RKXA 1HK9A 2DZCA 2FYKA 2ZGWA 2DXUA 5GAN2 4XU0A 3RUXA 3SB2A 1LNXA 4M77F 4EMGA 1H641 4RCCA 2RD1A 4M7DA 2E64A 4M75A 4HA8A 5GAN3 5GAOl 3RKYA 3JB9I 5GAN4 1N9SA 1TH7A 3JB9G 4C8QE 4M75F 4C92C 4JUVA 1D3BA 5GAMd 4XQ3A 5GAOq 4C8QG 3INZA 4PJOD 2VC8A 2I2LA 5GMKe 4C92A 2E1HA 3JCMf 2DTHA 4JRIA 5GAMe 4M7AF 5LJ5e 3JCMc 4C92B 3RIRA 4PJOB 4WF2A 4M7AG 4PJOF 1M8VA 4NOYA 4C8QC 4A53A 4M77A 1I5LA 3JCMQ 2VXFA 4HT9A 4C92D 1U1TA 5GAN7 4C8QD 4F7UF 5LJ3j 3FB9A 3JB9F 1Y96A 1WQWA 4F7UA 2EJ9A 1N9RA 5GANf 5GANh 1YCYA 3JCMd 5LJ3d 1I4K1 2DJZA 2E41A 3JB9D 5GANg 2DTOA 2JN0A 1I8FA 4M78F 4M77G 3FIFA 4X9CA 4XU2A 5DY9A 4M7DG 4M7AD 4XTVA 3SWNA 1I81A 3JCMg 5GAMh 3PGGA 3JCMe 3V7RA 4JLIA 3RESA 2E65A 3L1AA 3QSUA 4V2SA 3JCMX 1HXDA 2E10A 1B34B 3FJPA 3SWNC 4J6YA 1WNLA 4M77B 3JCMW 2HNIA 4MMLA 4XU1A 3M4GA 3HFOA 4XTZA 4EMHA 4M77D 4DQ2A 3HFNA 5I21A 4M75B 4M78D 5GAN6 1WQ7A 5GANe 3RKWA 2RA2A 5LJ5j 5GAN8 3HSBA 1BIBA 1LOJA 5GAN5 4M7DC 2EJGA 4X9DA 4XTXA 4EMKB 4M78A 4EMKA 1BIAA 4XTWA 3EFSA 5LJ5g 2QTXA 4C92G 2EAYA 4M7AB 4M7DD 1MGQA 2EJFA 4RCBA 4C92F 5GAMj 5GMKj 4M7AA 4M78C 4EMKC 1M5Q1 5LJ5f 3V8LA 4M75C 5GMKl 3QHSA 2DEQA 2EWNA 4M7AC 4C8QA 2DZ9A 2DTIA 2DXTA 4Y91A 2VXEA 5CAIA 4XU3A 3AHUA 4J6XA 3V7SA 4PJOE 4M75D 4M78B 5GANj 2DKGA 2YHTA 1X01A 3JCMh 5GAMg 3JB9J 4J5YA 4NL2A 2YLCA 4PJOG 3GIBA 5LJ5d 5GMKi 5LJ3e 5GAMf 5GAOn 1B34A 5LJ3g 2K57A 3BFMA 2RM4A 1KQ2A 4M7AE 3QUIA 4M77C 3SWNB 2YLBA 5LJ3h 4HT8A 4M7DF 4M7DB 4M78G 3JCMV 4XTYA 4XTUA 1LJOA 4N0AA 3BDUA 5GAOr 3BW1A 4JRKA 1KQ1A 4M78E 4M75G 3L2ZA 4A54A 2FB7A 1JRIA 4PJOA 1Y96B 4QVDA 2Y90A 3QO3A 1JBMA 4N0AC 4M75E 5GMKh 3JB9H 4F7UB 3JCMJ 3V8JA 4OP0A 4F7UE 3BY7A 5LJ5h 2RB6A 2DVEA 4M77E 4PJOC 4M7DE 1U1SA 3VU3C 5GANd 4F7UG 5GAOm 1D3BB 1WPYA 3EFRA 2CGHA 5LJ3f 3V8KA 3JCMP 5GAOp 4PNOA 3JCMb 3RERA 4QVCA 4C92E 5GMKm 4NL3A 4J6WA 3V7CA
chains in the Genus database with same CATH superfamily
4L6V5 2XKOC 3CEYA 2J6OA 4A4HA 1H641 1R77A 3G6EQ 2DL4A 3CCQQ 1TWBA 2JS2A 3TVTA 2RO0A 1KIKA 1Y0MA 4J9CA 4DA4A 3S3OA 1WI7A 1AVZC 5A0LA 2X4YA 5GMKe 3ER0A 2F1LA 5LJ5e 3JCMc 2LX9A 2HMAA 3CXCA 1K9MR 2VXFA 1IB8A 1WLPB 5HK0A 4J9EA 2G3RA 3KUFA 1OZ3A 4BI3A 1WXTA 2EYXA 2F5KA 1VQ6T 3JCMd 3CC7T 4HXJA 3CCUA 4FL6A 1R8OB 2DD5A 1HD3A 2DMOA 1IHVA 3V7RA 1VQ6A 4PFPA 1JXMA 3JCMW 4MZPA 2R57A 1X2QA 5HKCA 2K79A 3OQ5A 1K8AC 4PKCC 1D0XA 1MV3A 2IG0A 2EGAA 1QCNA 1U5SA 1BB9A 2E70A 4MDXA 3FEOA 1A0NB 2RI5A 1X69A 5FLXE 3G6ET 4N4GA 2COWA 4ZGDB 3OSSC 3EG3A 2M16A 1VQKA 2X4XA 5I2SA 2GBQA 5KYWA 2K7AA 3JV3A 3G6EA 1RLPC 2L2PA 1WZOA 2VUBA 2K3YA 3A8GB 2GF7A 4LUDA 3JCMV 3CBMA 2JZ2A 2CZ0B 2YUQA 1G3YA 2DAQA 1NLPC 3KXTA 4PJOA 2M0OA 4ME7A 3JB9H 2QQRA 3M0UA 4PFOA 2NWMA 4M7DE 4JJCA 5KE3A 3CCVQ 1X2KA 1C1AA 5LJ3f 1IZ6A 3M5AA 4AG1C 3JSCA 3EGDA 1WHHA 4C8QF 4FT2A 4E7JA 2DZCA 1OQKA 1SF9A 3DLLA 1LNXA 4M77F 4F14A 4EMGA 1IRXA 2LT1A 2MCNA 4C92C 2EKHA 1AWXA 4C5HA 1I0CA 1VIFA 4PJOD 3QZ9B 1VQPT 1B7TA 2LDMA 2QA4T 3CCRA 2HBPA 4WF2A 2HQEA 3CPWP 2OAUA 2DYIA 2M9UA 3QIIA 2VASA 1N9RA 1NPPA 5A0GA 1C6VX 2C0IA 5GANg 3JAME 4M7AD 4HKEA 3LLRA 1W70A 1AZGB 1JO8A 3A8LB 1W2BP 1HXDA 2EPDA 4M77B 1H3HA 2P4RA 4KH1B 4FCYA 2AZVA 4OGEA 3LWHA 1NJIR 3VUZA 3CBPA 1UHFA 1LOJA 2CDTA 2RPNA 4Y28E 2DBKA 4JS5A 3L2WA 2DL7A 5KYUB 5GAMj 2EJFA 2J06A 2C0TA 2AZSA 1M1FA 2COZA 1H3ZA 2E5KA 3NTKA 2O9SA 3QPHA 1B3QA 2HKNA 4BD3A 2XDPA 1G3TA 2EYQA 4RG2A 1PC0A 1TG0A 2YLCA 3GIBA 1QVGP 2DL5A 3I9QA 4HT8A 4J9GA 4N0AA 3CMAA 4J9BA 2KDSA 1JRIA 1VQ6Q 1YJ9A 4N0AC 3V8JA 2CS7A 5IHIA 4AFUC 3VYGA 3MP1A 2NUZA 3M0TA 4F7UG 2Y4XA 1QCFA 1NYGA 2OTLT 1YJ9T 4IUTA 2PQWA 5GAOp 5HY6A 2PUKB 5GMKm 4GLKA 1RAIB 4J6WA 1K73C 3QZ5B 1QVFA 3I56Q 2ZZDA 4QKUA 3NMZC 1VIEA 2K5FA 3OYBA 1KFZA 2BZ8A 4OMPA 1UTIA 4IUPA 1M1KU 1K9MU 1GBRA 3GP8A 1Q7YR 4XAXB 4M7AF 1I07A 1SPKA 4IUQA 4C92B 4PJOB 3JCMQ 5IXBA 1U1TA 1X75C 2JXBA 4HVWA 2DF6A 1OPKA 2WACA 1K73U 1VQMT 1VQNQ 2RJFA 2BZYA 1JJ2A 5KYXA 1FXXA 1F1BB 4FM4B 3RESA 2E65A 3JCMX 1WGSA 4BY6C 1VQMA 2DD4A 1VQ8A 1YIJT 2RHIA 4RTTA 1YJNT 2B86A 1BYMA 2LVMA 4M77D 3A5ZB 5ECAA 1GBQA 2RA2A 4B9XA 5GAN5 4DEXA 2E3IA 5KCHA 2JTEA 4XTWA 1SSFA 4M7DD 1VQ9A 2PNIA 3V8LA 3OS1A 4KULA 1AHJB 4HCKA 1E6GA 4Y91A 2MK5A 1PRLC 3JCMh 3FDRA 2MI6A 3CCUQ 1NZ9A 2OTJT 4BACA 4E7HA 4C5GA 5L8RE 1DJ7B 3P8DA 1KQ1A 3OMGA 2BTTA 5KYWB 4F7UB 3TCJA 1HSQA 2KMTA 3OYMA 5LJ5h 3FC3A 2EKOA 3OYFA 1VQOA 2OAWA 3WXMB 1M90C 2EYYA 1OYXA 4E47A 2AHJB 4ZGJB 1UFFA 1ABOA 2FHDA 3SB2A 4QW2A 3PFSA 1YJWT 4NS5A 4BUGA 1KJWA 1KK7A 5GAN4 4IURA 2ZPIB 1QQJA 2QQ9A 3ZBDA 1D3BA 3TQ7P 2E5QA 2NYSA 3IQLA 1MNEA 3JCMf 2YWWA 2QEXA 2QDYB 1VQNA 2WSCE 5CKBA 2YT6A 1XNIA 3CCMT 4C92D 1Z9ZA 1BBZA 4F17A 4E7ZA 2RHUA 4C8QD 4F7UF 1SG5A 1Y96A 1WQWA 2DJZA 2DTOA 2JN0A 3META 4BDZA 2V8IA 3SWNA 1O75A 3JCMg 2R5AA 2COYA 1LCKA 2L3QA 4E2FB 4XU1A 2LC4A 1PSFA 5IHKA 4M78D 2EGEA 2OX7A 1PCXA 4GBQA 1OEBA 3OBYA 1OX8A 1N8RU 2A3LA 2EYZA 2JOYA 3M53A 1JEGA 1MMGA 3OS5A 2IVWA 1PD0A 1ZUKA 4DBFA 2EWNA 1QKWA 1PSEA 1UECA 4J6XA 4PJNA 3MEAA 3CXCS 2ESWA 5GAMg 1N27A 2DILA 1RADB 1J3TA 3S3MA 2BUDA 2M1HA 1UGSB 2H3JA 1XTDA 2AKKA 2YRCA 2LRQA 5GMKh 1XOVA 3MEWA 3I5RA 5GAOm 3UATA 3EFOA 2RK1A 1BI3A 3LWIA 3I55T 4PNOA 1UGPB 4OVAA 1JJ2S 1NEBA 1NE8A 2QQBA 3ZEHA 5D6WA 4BI4A 2LQ8A 2GNCA 3MPUB 1N9SA 1TUCA 3QJYA 1K0XA 2K3XA 2RHZA 1WHKA 3X28B 5CQYA 1NM7A 3M0SA 1KQSP 1WHGA 3E9FA 4CC3A 1EZZB 3NTHA 3WVDB 1VQ4Q 2E41A 5DY9A 3FIFA 5CKHA 4JLIA 1YHQT 2KRSA 2PU9B 3G4SA 1OZ2A 2CZ1B 2EQKA 2R5MA 3CCEA 1V29B 4AFQC 3AT1B 2KAFA 5LJ5j 1Y71A 1E6HA 1D0ZA 1BCMA 2MWPA 1YITQ 3X24B 4A4EA 1AZEA 2XI9A 2V8KA 2QQAA 2ZPBB 4QVZA 4HVUA 4MDWA 4RG8A 4E7IA 1MMDA 2CUDA 3H41A 4IUUA 4LDYA 5KH6A 3CMEQ 1VQ8Q 1YCSB 3G71A 5IAYA 2JVVA 2KYMA 4M75D 3JB9J 1X01A 4J7IA 3GNGA 5GAOn 4ELZC 4BI8B 3R6OA 1KQSA 3QUIA 1K1ZA 4M7DF 4RTYA 3P8BB 4J8OA 2CT4A 4M75G 1PWTA 1YWOA 4OP0A 5FU6B 2D9TA 2RHYA 2JMAA 2HQXA 2WSEE 2DFUA 2CYZB 3J81E 1UJYA 3RMSA 3OY9A 2CP6A 1SKUB 2DXUA 4JPBW 4DOWA 1Q95G 3CCEQ 1VYTA 1B07A 1Y07A 5GAN3 1WJRA 3I56T 3OYCA 3EHQA 4JJDA 2MWOA 2CP0A 5CKDA 5GAOq 4PFZA 1QW1A 2O01E 1ACMB 4M7AG 4NOYA 2KXDA 4M77A 4N4HA 2JJ9A 4OMMA 2DK3A 1M3AA 4KGVB 4BE2A 2XMFA 2GQIA 3E1SA 4L5GA 1Y57A 1ZSZB 1BK2A 1ZBXA 1WDXA 2HL3A 2P4TA 5J3BA 1NJIC 1T0HA 6AT1B 1ZA1B 4R0KA 3M9QA 1CKAA 4OB0B 2O9VA 2EJGA 4EMKB 2BIVA 2KSSA 2KEAA 2KNBB 2P0PA 3A98A 3U23A 1S72Q 4EMKA 1Q82U 2HZYA 4P5NA 2EIFA 2PZ1A 2J05A 4M7AA 2JTMA 4LD9K 2JNGA 5CIUA 3CMEA 2LMJA 2E6NA 2X9HA 1ABQA 1GFDA 3PMIA 4KRTA 4AT1B 4ZGEB 3CMAT 4C0FA 2E4HA 1YITA 4RTVA 4M7AE 1SHGA 4BY6B 4M78G 4XTUA 5KYYB 3OW2P 4FW1A 1FMKA 1G2BA 1YITT 2OTLA 4Y92A 1VYUA 4PJJA 4M75E 2D8JA 2EQMA 2GTOA 2FPDA 2JM8A 2LTOA 3PIOA 3G7ZA 2DVEA 3EHRA 4OB1B 1TXQA 5GANd 2KGTA 2F2XA 1ZUYA 3PNWC 2KBTA 1GCPA 4B6MA 3V7CA 1VYVA 4IIOA 2YUNA 4XU0A 5GJWB 3QKJA 2B8AA 4Z8AA 1C0MA 4M75A 4RMOA 3H0FA 2EVRA 4FYVB 3CD6A 1TH7A 2KI7A 2P0KA 3OB9A 3MCAB 3QDRB 3VS6A 2DA9A 1PG5B 2I2LA 1WHLA 2E1HA 1K0SA 5CO7A 4PJOF 3TEEA 1D1CA 1W4SA 1G3SA 1Q7YC 5GAN7 3ULRB 4PL6A 3L2QA 4J9IA 3CCLQ 4M78F 1I8FA 2QEXQ 4M77G 5DM7R 1BI0A 3NGPA 1YJNA 1NJIU 1S72T 1RAEB 3L1AA 3CXCP 4J6YA 5DLOA 3VRZA 1D1BA 3M4GA 4O6JA 1KC8C 3S6WA 3GLXA 1KC8R 4QQ6A 1Q82C 2LP5A 4QQGA 5D7UA 5GAN6 2BKDN 2LNVA 4LDWA 3CC7Q 2X3XD 3HRUA 1Q7YU 4C92F 1VQKT 2RJEA 1UE9A 2LCSA 1SSHA 2VYTA 3CD6Q 2M51A 2ZCFB 4EIKA 5CVIA 4ORZA 1VQ4A 2YHTA 1SHFA 3EG9A 2EW3A 1YWPA 4C5EA 1UHCA 5LJ3g 2XDBA 2ROLA 2K57A 1OPLA 4IIMA 3SDZA 4M77C 5A2QE 4J83A 4AG2C 5LJ3h 1MNDA 2G6FX 5FW9A 2RH2A 2DLPA 3BW1A 4OMQA 3L2ZA 1ZBJA 2RB6A 4LDVA 5KCOA 1TUGB 1NG2A 1ZQ1A 5CR2A 1VQ9Q 3MO8A 2LQKA 4EPCA 1YJWA 2ECZA 2LX7A 4IKFA 5GAN2 4M4ZA 1K9AA 1MHNA 1VQPA 2E64A 5IH2A 3JB9I 3RKYA 2DBMA 2L3RA 1QWFA 4OB3B 3LGFA 8ATCB 2NUTA 1K76A 4C8QG 2LQWA 2RN8A 4J9DA 5CKFA 3CCJA 1IREB 1OULA 1M8VA 4OMLA 2V1RA 3TSZA 4BE0A 2LJ0A 1S1NA 3CC2A 1QVFS 1FYNA 2QA4A 1I4K1 2XICA 3M0QA 4M7DG 4JZ4A 3A8HB 3HL8A 1OI1A 3QJ6A 4ZN1A 3A8MB 1PRMC 2YUOA 3CPWS 2XDDA 1KHIA 5FWBA 4EMHA 3HFNA 4FIBA 2KRMA 2BE9B 3OS2A 1M27C 3CCSA 2CH4W 2YRDA 3EFSA 2ZAEA 2LJ1A 5GMKj 5D6XA 2O4XB 3PMTA 4BDYA 4EMKC 2FZKB 1G3WA 5GMKl 2L3PA 4BB7A 3N5BB 3EH2A 1TS9A 4MZTA 2YUPA 3E9GA 4D6WA 3ASKA 3EG0A 1ZSZC 5KYYA 3BFMA 3SFMA 1IGUA 4KUDK 4JRKA 4CC4B 1KD1U 1GFCA 1TUDA 1BCOA 1FMWA 1TSFA 2HQHA 1VQKQ 2OJ2A 1ZX6A 3L42A 1N8RR 5FROA 1VA7A 1D3BB 2J6KA 1K8AR 1Q82R 3O8VA 1M2OA 2DM1A 3RERA 3RKXA 2NUPA 3NHNA 4RCCA 1V1CA 4GY5A 3GF5A 5GAOl 1WIEA 1HJDA 4JUVA 2EYWA 2RQWA 2X51A 3VRYA 3VS4A 4E7LA 3X25B 4AFSC 1PHTA 4C0GA 5L23A 1UB4A 1WJQA 1T0JA 2FVUA 1QVGS 4PK4A 2D0NA 4DBQA 4XK8E 4HT9A 2ZPEB 2QGFB 4WCIA 1UGQB 3A1PA 5GANf 3CCSQ 3OYGA 4JJBA 2EGCA 3JB9D 1VQ8T 3OYLA 2F5TX 1YIJA 1QP3A 3JCMe 1TTHB 2W10A 3L2RA 4DEYA 1WYXA 2L8DA 2HNIA 4HCZA 9ATCB 2CSIA 4DQ2A 3FLGA 1VQ9T 4JDSA 1Q86U 4M78A 3EGUA 2AK5A 4M7AB 1QVGA 4RCBA 1JQQA 3CCVA 4M78C 2P0QA 1U3OA 2MAMA 3GOXA 3SD4A 1XJWB 5KE2A 1QMCA 3PIPA 2KRNA 3CC4T 5IT9E 4D8KA 2QG9B 2JS0A 3PTAA 5GANj 2LQNA 1LVKA 2VKNA 1H92A 3MEUA 4RUGA 1TOVA 1VQLQ 3VS3A 1CKBA 2M02A 1P92A 3C95A 2VV5A 1YJWQ 1WA7A 2QGGA 1UG1A 2F69A 4F7UE 2XK0A 3ZL7C 1U1SA 4EDUA 2L5QA 1YBYA 1WJSA 3EG1A 3RBBB 3I56A 2V8JA 4C8QB 2DPPB 2LCCA 1M4ZA 2ZGWA 4HCBA 4TVRA 3E2UA 1QWEA 3OS0A 1IO6A 4LXCA 3CCLT 3O5ZA 2W0ZA 1JJ2P 4C92A 4FYWB 1AWJA 1X27A 3RIRA 2O31A 2PTKA 3CBOA 2BE7D 4OF1A 3QBYA 3SHWA 1M2VA 4CC2A 5LJ3j 3M54A 4KT0E 3OBWA 2BZXA 1JU5C 2A36A 4Q5WA 3PGGA 4OMOA 4HVVA 1WNLA 3THKA 2DVJA 2DEUA 1VQ7T 2LNHB 4PJLA 3HSBA 1WQ7A 1SRLA 2RJDA 4M7DC 2NLUA 4C92G 3VYHB 3J7AF 5AYFA 3UWNA 3REAB 3CMET 3H0IA 2X3WD 4FYXB 1M8MA 2HCKA 2DZ9A 2LZ6B 2RQRA 3QXEB 2HSPA 2DKGA 4Z88A 5A0DA 4J5YA 1W1FA 4JRQA 1Q81R 2KE9A 2X4JA 1D1AA 2YLBA 4M7DB 1VQOQ 4RTWA 4LDUA 1LJOA 4XTYA 2RI3A 1ARKA 4DOVA 2Y4YA 1GCQC 3BY7A 2DXCA 1M90R 3GBQA 3EFRA 4HCCA 2CZ6B 2CGHA 3V8KA 4NL3A 1ZHIA 1NPRA 4X1VA 3OYIA 4N4IA 4OB2B 1E7OA 3HP9A 2RMOA 3BDLA 3QYGB 3I55A 1IHWA 1R0CB 1JXOA 3S3NA 2FRYA 2NUTB 2YSQA 4FSSA 1N5ZA 1RAHB 2VB6A 4MZMA 1M1KC 2AT1B 2YDLA 3EAEA 3CC7A 2RQTA 3CCQA 4E6RA 1YHQQ 3T9NA 1PNJA 2KYBA 3PT9A 3HRTA 1S72A 2DIQA 5GANh 4F7UA 3CPFA 2VGNA 2XU8A 1YCYA 1YHQA 2RHXA 1RABB 1Q86R 3H9NA 4XTVA 1I81A 2A08A 2HAXA 3CCET 3D7SB 4V2SA 5LL6S 1CSKA 1X43A 1B34B 3CCUT 2X35A 3VV0A 1NBEB 3QG1A 2RI2A 4JZ3A 3MKDA 5I21A 2QXFA 4GLMA 4FYYB 3CC4Q 3I55Q 3G4ST 1ZSGA 3C4SA 2K2MA 4KGXB 4AMCA 1M3CA 1W2BS 2KQWA 2O88A 3EGDB 3OYKA 3JRZA 3R6NA 1W6XA 2RF0A 1ZUUA 3DLMA 3Q1JA 5FRNA 2DXTA 2HSEB 1PKSA 4OMNA 4M78B 5I2MA 2EBPA 3G1JA 1AT1B 5GMKi 1B34A 3G71T 4C0ZA 5GAOr 5DLQE 4QVDA 3H0HA 2YRVA 2CZ7B 3FJ5A 1YI2T 1YJ9Q 3OYDA 4LDXA 4PJOC 3VU3C 4UC4A 1K73R 3CMAQ 3JCMb 4QVCA 4C92E 2KT1A 1YI2A 3QDFA 2O2OA 3CC2Q 4JS4A 3J80E 1H8KA 1X6GA 1MUZA 2JW4A 1D0YA 1QCOA 4A4GA 2DNUA 1MMNA 4QQDA 3QWXX 4ZNXA 3KBGA 2VC8A 4R56A 2DTHA 4JRIA 4WTOB 1WFWA 2V26A 4E7SA 1ZA2B 3M4YA 4OGCA 3OYNA 4DBHA 2L0AA 3QWYA 1LPLA 2DYBA 3CCRT 2JUFA 2ZPGB 3BE3A 1AWOA 1ZSZA 2SEMA 4KBMB 1M1GA 2LCLA 3RNJA 3C12A 1KC8U 5I22A 2E10A 4FW2A 1I1JA 3SWNC 1FMVA 2D1XA 4ANJA 3GNFB 2SRCA 2HD0A 4C0DB 3PVQA 2F2VA 2R58A 4LN2A 2QTXA 5M9OA 2H3EB 2P84A 1X6OA 1M5Q1 2CP5A 4LUEA 1MMAA 1RACB 1GL5A 1KD1R 2L89A 4C8QA 3OW2S 2DTIA 2ZPFB 3UA6A 4XU3A 3AHUA 1NLOC 2X4WA 2RJCA 4RKUE 3MEVA 4K11A 5LJ3e 3TSWA 3NPFA 4LE9A 3DKMA 2PVDB 3M55A 2CKKA 2LT4A 4A54A 3X26B 3P8HA 1VQLT 2Y90A 3JCMJ 2F2WA 2ZPHB 1EIFA 1YJNQ 5CQXA 4CI0C 3NFCA 3LH0A 1N6AA 2DO3A 7AT1B 3PVLA 3SEMA 2C06A 2QK0A 2FYKA 4KGZB 5CK9A 2KXCA 4RTUA 3M0PA 2KT8A 5GAMd 3VJPA 2A28A 3INZA 2K3BA 1W2BA 1VQ5Q 3OYYA 1YIJQ 2YXYA 3VS5A 5HK3A 1KHCA 1WHMA 1VQ5T 3LH5A 1QLYA 2PVOB 2EJ9A 4JRPA 1BI1A 1QP2A 4CC7A 3EFOB 3G4SQ 1VQ5A 5GAMh 2FPEA 1YN8A 3QYHB 1UDLA 2EQUA 2OTLQ 2GCXA 5FWCA 2HKQB 4XTZA 3EGXB 2VWFA 2LJ3A 3RKWA 4A4KA 2KY9A 2EAYA 1Q86C 3CC4A 2K4YA 3ZFJA 1MV0B 1TU0B 2HEQA 1VQ4T 2NUPB 4E7KA 4ESRA 2MYSA 3CPWA 2QQSA 2A7YA 3LYIA 1AEYA 3LGLA 1BKBA 4PLLA 1GXIE 1M1KR 2DL8A 1UUEA 4L59A 4C0DC 2DRMA 2QI2A 1IXDA 1RUWA 2K2VA 1KD1C 2DRKA 3SWNB 1WXUA 2CH4A 1K8AU 3BDUA 3LW5E 3OMCA 2JTFA 1Y96B 1YFNA 5KYNA 2CT3A 4LD6A 1VQOT 3A8OB 2DXBA 2RK2A 1VOMA 2JMCA 4M77E 3F70A 2XHCA 3LX7A 3VS1A 1O9SA 3JCMP 2DX1A 1YNZA 2C0OA 2E12A 3OA6A 1YP5A 1OOTA 2GQVA 1WHJA 2RD1A 3CCRQ 4M7DA 4HA8A 3PE0A 1V76A 1QVPA 2CUBA 3JB9G 4M75F 1VQNT 1FX7A 3HKSA 5FU6C 3UT1A 2ED1A 4ZTFA 1Q81C 1WXBA 3CC2T 2E3HA 4F04B 2EFIA 2ABLA 2D8HA 3VS0A 1BI2A 1WX6A 3CCJT 2DE0X 3FRNA 2MOXA 3CQTA 3FB9A 1GRIA 1RL2A 5EC7A 3EGXA 2RQUA 1KSWA 3M57A 1RAFB 3OSVA 4XU2A 2QAZA 1VQMQ 3QSUA 1VQ7Q 2HDAA 2FEIA 1QVFP 2IIMA 4MMLA 3CCMQ 3HFOA 2QASA 3NTIA 4M75B 4VUBA 2KVQG 5GANe 5IN1A 2GFAA 4XTXA 2J7IA 1EX4A 1BIAA 1AD5A 2DERA 3M56A 1MGQA 4J7FA 1YI2Q 4DBRA 3M0RA 3MP8A 4QT7A 3G71Q 1M2VB 3CCST 3I5SA 5J26A 2KROA 3MP6A 1KQSS 2VXEA 3VS2A 1G5VA 1ZLMA 1NEGA 4OMFB 4PLIA 3HPWA 3UF4A 2RM4A 2K5IA 2J6FA 3OYEA 3REBB 5IXFA 5FU7C 2DL3A 1JBMA 2FO0A 2KR3A 2K6DA 8AT1B 3TREA 2OTJQ 2FL7A 2A0FB 1WPYA 2M0YA 1OV3A 3C94A 1FWZA 2MF2A 1UJ0A 4CRIA 4MMKA 1HK9A 3RUXA 4LNPA 2D6FA 2V1QA 4JLGA 4B9WA 2RNAA 3HHTB 4Z02A 5KYXB 4C8QE 1Q81U 5C0MA 3DB4A 1KG1A 2I0NA 2QTVA 3CCQT 1OU8A 1UGRB 4R55A 5FRMA 5GAMe 3HRSA 4O5VA 1K9MC 2KK4A 1M30A 1I5LA 4KUIA 4RTZA 2DIGA 2L3SA 2MIOA 3MJXA 2QDLA 1RI9A 3JB9F 2JM9A 3OYAA 1GCQA 4X9CA 2FPFA 5D6YA 2XD0A 2HBWA 2DETA 1RI0A 1Z9QA 2CP7A 2WSFE 3FJPA 1G83A 2GFUA 2AKLA 1R0BG 4IUVA 3CCVT 4J9FA 3VS7A 4X9DA 4YTLA 2AIRB 1AWWA 4A4FA 1BU1A 1OX9A 5LJ5f 1EFNA 2E6ZA 5GJVB 3E19A 1I5OB 5AT1B 3QHSA 2DEQA 1U8RA 1M3BA 2PUOB 3M58A 1QKXA 2ENMA 5EG2A 3HTRA 4PJOE 4II1A 3I35A 3H6ZA 3VUBA 2GTJA 1KQ2A 3GPLA 2GGRA 1RLQC 1X6BA 2PVGB 2Z0WA 4M78E 3X20B 2OTJA 1PM3A 1SRMA 2O4XA 1M9SA 2K9GA 3QO3A 2K5LA 4X34A 2XG8D 4FT4A 5KYUA 1RAAB 3EH1A 2VVKA 1T3SA 2DJQA 1N8RC 3H8ZA 4PJMA 2ATCB 2RQVA 3KFVA 1AOJA 3L2VA 4Z89A 1HYOA 2JT4A 3UA7A 5I11A 2ED0A 1D09B 1PKTA 3DB3A 4FSXA 2XIDA 2OI3A 2EQIA 4XQ3A 4ZN3A 3OYHA 1RAGB 1T3LA 5HCKA 3WVEB 3CCLA 2CREA 2CP2A 4C8QC 4A53A 2A37A 3ME9A 5FU7B 4RTXA 2MMPA 5CKEA 2CP3A 2QEXT 2H8HA 5LJ3d 3CCMA 3VKIA 4KH0B 1M90U 3M59A 2FZGB 1VQ7A 2EQJA 1IGQA 3EG2A 2HL5C 4A63B 2FZCB 2QYZA 3URGA 3TU4K 4AFZC 2D0QB 2FRWA 3UDCA 5GAN8 4ELYC 1BIBA 1Y7XA 3RDVA 4JJNK 1UGVA 1VUBA 5LJ5g 4BE1A 3RR6A 1G8XA 3C0CA 3OYJA 3L2UA 3OW2A 4M75C 1SEMA 3MHXA 4M7AC 5CAIA 4D8DA 4ZTJA 3V7SA 5C6SA 2MPXC 4ATOA 2CSQA 2QA4Q 4NL2A 4PJOG 5LJ5d 5GAMf 5J39A 1K4US 4FU6A 1VQLA 5IHNA 1NYFA 1PD1A 4C5IA 4J9HA 4F16A 2FB7A 2VGMA 1UEBA 2IPOB 3UPUA 1OU9A 2ROTA 2FG0A 1JB0E 3CCJQ 3RMQA 3EG9B 5CCAA 1XQHA 1VQPQ 1U06A 3CD6T
chains in the Genus database with same CATH topology
2C06A 4L6V5 1NE8A 3RKXA 2QQBA 2FYKA 2XKOC 3CEYA 3ZEHA 5D6WA 4A4HA 1H641 4RCCA 4BI4A 4GY5A 2LQ8A 5CK9A 3GF5A 5GAOl 1N9SA 3QJYA 2K3XA 4JUVA 2RO0A 5GAMd 3VJPA 2RHZA 4E7LA 3X25B 4C0GA 3INZA 4DA4A 3S3OA 5A0LA 2X4YA 5GMKe 1UB4A 3ER0A 3X28B 5CQYA 1W2BA 5LJ5e 3JCMc 1WJQA 2LX9A 3E9FA 3OYYA 3CXCA 2FVUA 1QVGS 5HK3A 4XK8E 2VXFA 3NTHA 4HT9A 2ZPEB 5HK0A 1KHCA 2G3RA 3KUFA 1OZ3A 1VQ5T 1UGQB 3WVDB 4BI3A 5GANf 2PVOB 2EJ9A 4JRPA 3OYGA 2F5KA 1VQ6T 3JCMd 1BI1A 3CC7T 2E41A 3JB9D 3CCUA 1QP2A 1VQ8T 3OYLA 5DY9A 2F5TX 3FIFA 5CKHA 1YIJA 1QP3A 4FL6A 1VQ5A 1R8OB 2DD5A 5GAMh 3JCMe 3QYHB 3V7RA 2EQUA 4JLIA 1VQ6A 1YHQT 2PU9B 2GCXA 3G4SA 3L2RA 1OZ2A 3JCMW 2CZ1B 2EQKA 4MZPA 2R5MA 2L8DA 2R57A 2HNIA 4HCZA 5HKCA 3CCEA 4XTZA 1V29B 3OQ5A 4DQ2A 2KAFA 4PKCC 3FLGA 1VQ9T 5LJ5j 1Y71A 1K8AC 3RKWA 2IG0A 4A4KA 4JDSA 1Q86U 4M78A 2MWPA 2KY9A 3X24B 4A4EA 2EAYA 1Q86C 4M7AB 2E70A 2XI9A 1QVGA 4RCBA 3CC4A 2K4YA 3ZFJA 4MDXA 3FEOA 2V8KA 3CCVA 4M78C 2P0QA 2RI5A 5FLXE 2MAMA 2QQAA 4N4GA 3G6ET 1VQ4T 3GOXA 2ZPBB 4QVZA 4MDWA 4RG8A 3SD4A 5KE2A 4E7KA 4E7IA 3PIPA 4IUUA 4LDYA 4ZGDB 3CPWA 5KH6A 2QQSA 3CC4T 3OSSC 2M16A 3G71A 1VQKA 5IAYA 2X4XA 2A7YA 3LYIA 5IT9E 5I2SA 3LGLA 2JVVA 3G6EA 1BKBA 3PTAA 4M75D 5GANj 3JB9J 1X01A 4J7IA 3GNGA 4PLLA 1GXIE 4L59A 4C0DC 2VUBA 2QI2A 3MEUA 5GAOn 2K3YA 4ELZC 3A8GB 2K2VA 3R6OA 2GF7A 4BI8B 1KD1C 3QUIA 1KQSA 3SWNB 4M7DF 3JCMV 3C95A 1P92A 1K8AU 3BDUA 3CBMA 3P8BB 2JZ2A 2CZ0B 2VV5A 3LW5E 4J8OA 1G3YA 2DAQA 2JTFA 3OMCA 4M75G 3KXTA 4PJOA 1Y96B 2M0OA 4LD6A 1VQOT 2F69A 2DXBA 3A8OB 2RK2A 4ME7A 3JB9H 2QQRA 4OP0A 5FU6B 2D9TA 2RHYA 4F7UE 2XK0A 4M77E 3F70A 4M7DE 1U1SA 5KE3A 2XHCA 3LX7A 4EDUA 2HQXA 5LJ3f 1IZ6A 1O9SA 1YBYA 2L5QA 2WSEE 3JCMP 2CYZB 1WJSA 3M5AA 3J81E 3RMSA 3OY9A 3JSCA 3I56A 2V8JA 4C8QB 2DPPB 4FT2A 4C8QF 4E7JA 2LCCA 1M4ZA 2ZGWA 2DZCA 2E12A 4TVRA 2DXUA 3OA6A 4HCBA 3DLLA 1LNXA 4M77F 4DOWA 3OS0A 2GQVA 4EMGA 2RD1A 2LT1A 4M7DA 5GAN3 1Y07A 4HA8A 1WJRA 3I56T 3OYCA 1QVPA 3JB9G 4M75F 2MWOA 3CCLT 1VQNT 4C92C 5CKDA 1FX7A 3HKSA 4C5HA 5GAOq 5FU6C 3UT1A 1QW1A 1VIFA 4ZTFA 4PJOD 3QZ9B 1Q81C 2O01E 1VQPT 3CC2T 4C92A 2LDMA 2EFIA 2QA4T 3RIRA 3CCRA 2HBPA 4WF2A 4M7AG 2HQEA 1BI2A 3CBOA 4NOYA 4M77A 4N4HA 3CCJT 2OAUA 3FRNA 3QBYA 4OF1A 5LJ3j 3M54A 3FB9A 4KT0E 2M9UA 1RL2A 3QIIA 2DK3A 1N9RA 1NPPA 5A0GA 3OBWA 4BE2A 5GANg 3JAME 4M7AD 3M57A 4XU2A 3OSVA 3E1SA 4HKEA 3LLRA 4L5GA 4Q5WA 1BYMA 1ZBXA 3A8LB 3PGGA 3QSUA 1HXDA 2P4TA 5J3BA 1NJIC 1WNLA 4M77B 4MMLA 3M9QA 1VQ7T 3HFOA 4OGEA 3NTIA 4M75B 3HSBA 1WQ7A 2KVQG 4VUBA 5GANe 3LWHA 2RJDA 3VUZA 3CBPA 4OB0B 1LOJA 5IN1A 4M7DC 2EJGA 2GFAA 2NLUA 4XTXA 4Y28E 2BIVA 2KSSA 2P0PA 4EMKB 1Q82U 4EMKA 4JS5A 1BIAA 3L2WA 4P5NA 4C92G 3VYHB 2EIFA 3J7AF 3M56A 5AYFA 1MGQA 2EJFA 4J7FA 3UWNA 5GAMj 3CMET 4M7AA 3MP8A 2JTMA 1M1FA 3CCST 1H3ZA 5J26A 4LD9K 2JNGA 5CIUA 3MP6A 3NTKA 1KQSS 2DZ9A 3QPHA 2VXEA 3CMEA 2E6NA 4BD3A 2XDPA 1G5VA 1G3TA 2EYQA 3QXEB 4RG2A 3PMIA 2DKGA 4ZGEB 3CMAT 4C0FA 4J5YA 5A0DA 2YLCA 3GIBA 4OMFB 4JRQA 4PLIA 3HPWA 1YITA 2X4JA 2RM4A 2K5IA 4M7AE 4HT8A 2YLBA 4BY6B 4M7DB 4M78G 3OYEA 4XTYA 4LDUA 1LJOA 4N0AA 4XTUA 3CMAA 2KDSA 2RI3A 5FU7C 1JRIA 4DOVA 1YITT 2OTLA 2Y4YA 1YJ9A 1JBMA 4N0AC 4M75E 2EQMA 2LTOA 3V8JA 2CS7A 3PIOA 3BY7A 3G7ZA 2DVEA 2DXCA 3TREA 2FL7A 3MP1A 4OB1B 3VYGA 5GANd 4F7UG 2Y4XA 1WPYA 3EFRA 4HCCA 2CZ6B 2CGHA 3V8KA 2OTLT 1YJ9T 3C94A 2PQWA 4IUTA 3PNWC 5GAOp 1FWZA 5HY6A 2PUKB 5GMKm 4NL3A 1ZHIA 2MF2A 1NPRA 4GLKA 4J6WA 3V7CA 4CRIA 3OYIA 1K73C 3QZ5B 4MMKA 4N4IA 4OB2B 1HK9A 1QVFA 4XU0A 3RUXA 2D6FA 2ZZDA 3QKJA 4JLGA 3HP9A 3QYGB 3BDLA 3HHTB 1VIEA 4B9WA 2B8AA 2K5FA 3OYBA 3I55A 4Z02A 4M75A 4RMOA 3S3NA 3CD6A 1TH7A 4C8QE 2P0KA 1Q81U 3OB9A 3MCAB 3DB4A 5C0MA 3QDRB 1KG1A 4IUPA 3CCQT 1M1KU 1UGRB 1K9MU 4R55A 4MZMA 2I2LA 3GP8A 5FRMA 2E1HA 4XAXB 5GAMe 4M7AF 1M1KC 3HRSA 5CO7A 4IUQA 4O5VA 4C92B 1K9MC 4PJOF 2KK4A 4PJOB 3TEEA 1W4SA 1I5LA 3EAEA 1G3SA 4KUIA 3JCMQ 3CC7A 1Q7YC 3CCQA 1U1TA 5GAN7 2DIGA 3T9NA 3PT9A 1X75C 3HRTA 1S72A 2DIQA 4PL6A 3JB9F 5GANh 4F7UA 3CPFA 2VGNA 3L2QA 2WACA 3OYAA 2XU8A 1YCYA 1YHQA 1K73U 1VQMT 2RHXA 4M78F 1I8FA 4X9CA 2RJFA 4M77G 5DM7R 1BI0A 5D6YA 4XTVA 1YJNA 1I81A 1JJ2A 2XD0A 1NJIU 2HAXA 3CCET 1RI0A 1S72T 1FXXA 4FM4B 3RESA 2E65A 3L1AA 4V2SA 2WSFE 5LL6S 3JCMX 1WGSA 4BY6C 1VQMA 1B34B 2DD4A 3FJPA 4J6YA 3CCUT 1VQ8A 5DLOA 2X35A 1YIJT 2RHIA 2GFUA 3VV0A 3M4GA 3QG1A 2RI2A 4O6JA 2LVMA 3GLXA 3S6WA 1YJNT 4QQ6A 1KC8C 4M77D 1Q82C 4QQGA 5I21A 3A5ZB 2QXFA 4IUVA 5GAN6 3CCVT 2RA2A 4B9XA 3G4ST 5GAN5 4X9DA 4YTLA 2BKDN 3C4SA 5KCHA 2LNVA 4LDWA 4XTWA 4A4FA 1W2BS 1SSFA 2KQWA 4M7DD 3OYKA 3HRUA 3JRZA 4C92F 1Q7YU 1VQ9A 1VQKT 2RJEA 5LJ5f 3DLMA 3V8LA 2E6ZA 3OS1A 3E19A 3Q1JA 4KULA 3QHSA 2DEQA 1U8RA 1AHJB 5FRNA 2DXTA 4Y91A 2PUOB 2VYTA 3M58A 2ZCFB 5EG2A 5CVIA 4PJOE 4M78B 1VQ4A 4II1A 2YHTA 3JCMh 3FDRA 5I2MA 2MI6A 3H6ZA 1NZ9A 4C5EA 5GMKi 2OTJT 1B34A 5LJ3g 3G71T 4BACA 2XDBA 2K57A 3VUBA 4E7HA 4C0ZA 3SDZA 4C5GA 4M77C 5A2QE 1KQ2A 4J83A 3GPLA 5LJ3h 2RH2A 5L8RE 5GAOr 1DJ7B 3BW1A 3P8DA 2PVGB 1KQ1A 4M78E 3X20B 3L2ZA 2OTJA 3OMGA 5DLQE 4QVDA 2O4XA 2YRVA 1M9SA 3QO3A 2K5LA 4X34A 2CZ7B 2XG8D 4F7UB 3TCJA 1YI2T 2KMTA 4FT4A 3OYMA 5LJ5h 2RB6A 3OYDA 3FC3A 4LDVA 5KCOA 2EKOA 3VU3C 4UC4A 4LDXA 4PJOC 1ZQ1A 5CR2A 3MO8A 3OYFA 2LQKA 4EPCA 1VQOA 3JCMb 1YJWA 4QVCA 4C92E 1YI2A 3WXMB 1N8RC 1M90C 4IKFA 3H8ZA 1OYXA 4JS4A 4E47A 3J80E 5GAN2 3L2VA 2AHJB 4ZGJB 2FHDA 3SB2A 4QW2A 1MHNA 3PFSA 1YJWT 1VQPA 2E64A 3JB9I 3DB3A 4FSXA 3RKYA 4NS5A 4BUGA 5GAN4 2XIDA 4IURA 2ZPIB 2QQ9A 2L3RA 3ZBDA 1D3BA 4OB3B 4XQ3A 3LGFA 4A4GA 2E5QA 4C8QG 3CCJA 5CKFA 4QQDA 4ZN3A 3OYHA 3KBGA 1IREB 2VC8A 3JCMf 3WVEB 2DTHA 4JRIA 4R56A 2QEXA 2QDYB 3CCLA 1VQNA 1M8VA 2WSCE 5CKBA 4C8QC 4A53A 1XNIA 3CCMT 4C92D 4BE0A 3ME9A 3M4YA 3CC2A 2RHUA 4OGCA 5CKEA 2MMPA 5FU7B 4C8QD 4F7UF 3OYNA 2QEXT 1QVFS 2QA4A 1Y96A 1WQWA 2JUFA 2ZPGB 3CCRT 5LJ3d 1I4K1 2DJZA 3VKIA 3CCMA 2DTOA 2JN0A 2XICA 1M90U 3META 3M59A 4BDZA 2V8IA 3A8HB 4M7DG 3HL8A 4KBMB 3SWNA 1OI1A 1O75A 1M1GA 3QJ6A 2R5AA 3JCMg 2EQJA 3A8MB 4ZN1A 2LCLA 1VQ7A 3CPWS 3C12A 1KC8U 3URGA 3TU4K 2E10A 3SWNC 3GNFB 2XDDA 2D0QB 4XU1A 2LC4A 1KHIA 4EMHA 1PSFA 2HD0A 3UDCA 4C0DB 3HFNA 4M78D 5GAN8 4FIBA 4ELYC 1BIBA 3OS2A 1Y7XA 3CCSA 4JJNK 1VUBA 3EFSA 3OBYA 2R58A 5LJ5g 2QTXA 5M9OA 4BE1A 1N8RU 2A3LA 2JOYA 5GMKj 3M53A 5D6XA 3OYJA 1X6OA 2O4XB 3OS5A 3PMTA 1M5Q1 4EMKC 4BDYA 2IVWA 3L2UA 3OW2A 1G3WA 4M75C 5GMKl 3MHXA 2EWNA 2L89A 4C8QA 4M7AC 3OW2S 2DTIA 4BB7A 5CAIA 2ZPFB 3N5BB 1PSEA 4MZTA 4ZTJA 4XU3A 3AHUA 4J6XA 3E9GA 3V7SA 3MEAA 3CXCS 2X4WA 2RJCA 4RKUE 4D6WA 3ASKA 5C6SA 5GAMg 4ATOA 4NL2A 1N27A 3MEVA 4PJOG 5LJ5d 5LJ3e 5GAMf 5J39A 4FU6A 1VQLA 3BFMA 3SFMA 3S3MA 3DKMA 4KUDK 2PVDB 2BUDA 3M55A 2M1HA 4JRKA 4C5IA 1KD1U 1UGSB 2CKKA 2H3JA 2LT4A 4A54A 1XTDA 2FB7A 3X26B 2VGMA 3P8HA 1VQLT 2Y90A 2LRQA 5GMKh 1XOVA 1UEBA 3JCMJ 3UPUA 3MEWA 2ZPHB 1EIFA 3L42A 1JB0E 5CQXA 5GAOm 3RMQA 5FROA 4CI0C 3NFCA 1D3BB 3LH0A 5CCAA 1XQHA 3O8VA 2RK1A 1BI3A 1N6AA 3I55T 2DO3A 4PNOA 3LWIA 3RERA 1UGPB 4OVAA 1JJ2S 3CD6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q B;  4C8Q F;  4MMK A;  3RKX A;  1HK9 A;  2DZC A;  2FYK A;  2ZGW A;  2DXU A;  5GAN 2;  4XU0 A;  3RUX A;  3SB2 A;  1LNX A;  4M77 F;  4EMG A;  1H64 1;  4RCC A;  2RD1 A;  4M7D A;  2E64 A;  4M75 A;  4HA8 A;  5GAN 3;  5GAO l;  3RKY A;  3JB9 I;  5GAN 4;  1N9S A;  1TH7 A;  3JB9 G;  4C8Q E;  4M75 F;  4C92 C;  4JUV A;  1D3B A;  5GAM d;  4XQ3 A;  5GAO q;  4C8Q G;  3INZ A;  4PJO D;  2VC8 A;  2I2L A;  5GMK e;  4C92 A;  2E1H A;  3JCM f;  2DTH A;  4JRI A;  5GAM e;  4M7A F;  5LJ5 e;  3JCM c;  4C92 B;  3RIR A;  4PJO B;  4WF2 A;  4M7A G;  4PJO F;  1M8V A;  4NOY A;  4C8Q C;  4A53 A;  4M77 A;  1I5L A;  3JCM Q;  2VXF A;  4HT9 A;  4C92 D;  1U1T A;  5GAN 7;  4C8Q D;  4F7U F;  5LJ3 j;  3FB9 A;  3JB9 F;  1Y96 A;  1WQW A;  4F7U A;  2EJ9 A;  1N9R A;  5GAN f;  5GAN h;  1YCY A;  3JCM d;  5LJ3 d;  1I4K 1;  2DJZ A;  2E41 A;  3JB9 D;  5GAN g;  2DTO A;  2JN0 A;  1I8F A;  4M78 F;  4M77 G;  3FIF A;  4X9C A;  4XU2 A;  5DY9 A;  4M7D G;  4M7A D;  4XTV A;  3SWN A;  1I81 A;  3JCM g;  5GAM h;  3PGG A;  3JCM e;  3V7R A;  4JLI A;  3RES A;  2E65 A;  3L1A A;  3QSU A;  4V2S A;  3JCM X;  1HXD A;  2E10 A;  1B34 B;  3FJP A;  3SWN C;  4J6Y A;  1WNL A;  4M77 B;  3JCM W;  2HNI A;  4MML A;  4XU1 A;  3M4G A;  3HFO A;  4XTZ A;  4EMH A;  4M77 D;  4DQ2 A;  3HFN A;  5I21 A;  4M75 B;  4M78 D;  5GAN 6;  1WQ7 A;  5GAN e;  3RKW A;  2RA2 A;  5LJ5 j;  5GAN 8;  3HSB A;  1BIB A;  1LOJ A;  5GAN 5;  4M7D C;  2EJG A;  4X9D A;  4XTX A;  4EMK B;  4M78 A;  4EMK A;  1BIA A;  4XTW A;  3EFS A;  5LJ5 g;  2QTX A;  4C92 G;  2EAY A;  4M7A B;  4M7D D;  1MGQ A;  2EJF A;  4RCB A;  4C92 F;  5GAM j;  5GMK j;  4M7A A;  4M78 C;  4EMK C;  1M5Q 1;  5LJ5 f;  3V8L A;  4M75 C;  5GMK l;  3QHS A;  2DEQ A;  2EWN A;  4M7A C;  4C8Q A;  2DZ9 A;  2DTI A;  2DXT A;  4Y91 A;  2VXE A;  5CAI A;  4XU3 A;  3AHU A;  4J6X A;  3V7S A;  4PJO E;  4M75 D;  4M78 B;  5GAN j;  2DKG A;  2YHT A;  1X01 A;  3JCM h;  5GAM g;  3JB9 J;  4J5Y A;  4NL2 A;  2YLC A;  4PJO G;  3GIB A;  5LJ5 d;  5GMK i;  5LJ3 e;  5GAM f;  5GAO n;  1B34 A;  5LJ3 g;  2K57 A;  3BFM A;  2RM4 A;  1KQ2 A;  4M7A E;  3QUI A;  4M77 C;  3SWN B;  2YLB A;  5LJ3 h;  4HT8 A;  4M7D F;  4M7D B;  4M78 G;  3JCM V;  4XTY A;  4XTU A;  1LJO A;  4N0A A;  3BDU A;  5GAO r;  3BW1 A;  4JRK A;  1KQ1 A;  4M78 E;  4M75 G;  3L2Z A;  4A54 A;  2FB7 A;  1JRI A;  4PJO A;  1Y96 B;  4QVD A;  2Y90 A;  3QO3 A;  1JBM A;  4N0A C;  4M75 E;  5GMK h;  3JB9 H;  4F7U B;  3JCM J;  3V8J A;  4OP0 A;  4F7U E;  3BY7 A;  5LJ5 h;  2RB6 A;  2DVE A;  4M77 E;  4PJO C;  4M7D E;  1U1S A;  3VU3 C;  5GAN d;  4F7U G;  5GAO m;  1D3B B;  1WPY A;  3EFR A;  2CGH A;  5LJ3 f;  3V8K A;  3JCM P;  5GAO p;  4PNO A;  3JCM b;  3RER A;  4QVC A;  4C92 E;  5GMK m;  4NL3 A;  4J6W A;  3V7C A; 
#chains in the Genus database with same CATH topology
 4L6V 5;  2XKO C;  3CEY A;  2J6O A;  4A4H A;  1H64 1;  1R77 A;  3G6E Q;  2DL4 A;  3CCQ Q;  1TWB A;  2JS2 A;  3TVT A;  2RO0 A;  1KIK A;  1Y0M A;  4J9C A;  4DA4 A;  3S3O A;  1WI7 A;  1AVZ C;  5A0L A;  2X4Y A;  5GMK e;  3ER0 A;  2F1L A;  5LJ5 e;  3JCM c;  2LX9 A;  2HMA A;  3CXC A;  1K9M R;  2VXF A;  1IB8 A;  1WLP B;  5HK0 A;  4J9E A;  2G3R A;  3KUF A;  1OZ3 A;  4BI3 A;  1WXT A;  2EYX A;  2F5K A;  1VQ6 T;  3JCM d;  3CC7 T;  4HXJ A;  3CCU A;  4FL6 A;  1R8O B;  2DD5 A;  1HD3 A;  2DMO A;  1IHV A;  3V7R A;  1VQ6 A;  4PFP A;  1JXM A;  3JCM W;  4MZP A;  2R57 A;  1X2Q A;  5HKC A;  2K79 A;  3OQ5 A;  1K8A C;  4PKC C;  1D0X A;  1MV3 A;  2IG0 A;  2EGA A;  1QCN A;  1U5S A;  1BB9 A;  2E70 A;  4MDX A;  3FEO A;  1A0N B;  2RI5 A;  1X69 A;  5FLX E;  3G6E T;  4N4G A;  2COW A;  4ZGD B;  3OSS C;  3EG3 A;  2M16 A;  1VQK A;  2X4X A;  5I2S A;  2GBQ A;  5KYW A;  2K7A A;  3JV3 A;  3G6E A;  1RLP C;  2L2P A;  1WZO A;  2VUB A;  2K3Y A;  3A8G B;  2GF7 A;  4LUD A;  3JCM V;  3CBM A;  2JZ2 A;  2CZ0 B;  2YUQ A;  1G3Y A;  2DAQ A;  1NLP C;  3KXT A;  4PJO A;  2M0O A;  4ME7 A;  3JB9 H;  2QQR A;  3M0U A;  4PFO A;  2NWM A;  4M7D E;  4JJC A;  5KE3 A;  3CCV Q;  1X2K A;  1C1A A;  5LJ3 f;  1IZ6 A;  3M5A A;  4AG1 C;  3JSC A;  3EGD A;  1WHH A;  4C8Q F;  4FT2 A;  4E7J A;  2DZC A;  1OQK A;  1SF9 A;  3DLL A;  1LNX A;  4M77 F;  4F14 A;  4EMG A;  1IRX A;  2LT1 A;  2MCN A;  4C92 C;  2EKH A;  1AWX A;  4C5H A;  1I0C A;  1VIF A;  4PJO D;  3QZ9 B;  1VQP T;  1B7T A;  2LDM A;  2QA4 T;  3CCR A;  2HBP A;  4WF2 A;  2HQE A;  3CPW P;  2OAU A;  2DYI A;  2M9U A;  3QII A;  2VAS A;  1N9R A;  1NPP A;  5A0G A;  1C6V X;  2C0I A;  5GAN g;  3JAM E;  4M7A D;  4HKE A;  3LLR A;  1W70 A;  1AZG B;  1JO8 A;  3A8L B;  1W2B P;  1HXD A;  2EPD A;  4M77 B;  1H3H A;  2P4R A;  4KH1 B;  4FCY A;  2AZV A;  4OGE A;  3LWH A;  1NJI R;  3VUZ A;  3CBP A;  1UHF A;  1LOJ A;  2CDT A;  2RPN A;  4Y28 E;  2DBK A;  4JS5 A;  3L2W A;  2DL7 A;  5KYU B;  5GAM j;  2EJF A;  2J06 A;  2C0T A;  2AZS A;  1M1F A;  2COZ A;  1H3Z A;  2E5K A;  3NTK A;  2O9S A;  3QPH A;  1B3Q A;  2HKN A;  4BD3 A;  2XDP A;  1G3T A;  2EYQ A;  4RG2 A;  1PC0 A;  1TG0 A;  2YLC A;  3GIB A;  1QVG P;  2DL5 A;  3I9Q A;  4HT8 A;  4J9G A;  4N0A A;  3CMA A;  4J9B A;  2KDS A;  1JRI A;  1VQ6 Q;  1YJ9 A;  4N0A C;  3V8J A;  2CS7 A;  5IHI A;  4AFU C;  3VYG A;  3MP1 A;  2NUZ A;  3M0T A;  4F7U G;  2Y4X A;  1QCF A;  1NYG A;  2OTL T;  1YJ9 T;  4IUT A;  2PQW A;  5GAO p;  5HY6 A;  2PUK B;  5GMK m;  4GLK A;  1RAI B;  4J6W A;  1K73 C;  3QZ5 B;  1QVF A;  3I56 Q;  2ZZD A;  4QKU A;  3NMZ C;  1VIE A;  2K5F A;  3OYB A;  1KFZ A;  2BZ8 A;  4OMP A;  1UTI A;  4IUP A;  1M1K U;  1K9M U;  1GBR A;  3GP8 A;  1Q7Y R;  4XAX B;  4M7A F;  1I07 A;  1SPK A;  4IUQ A;  4C92 B;  4PJO B;  3JCM Q;  5IXB A;  1U1T A;  1X75 C;  2JXB A;  4HVW A;  2DF6 A;  1OPK A;  2WAC A;  1K73 U;  1VQM T;  1VQN Q;  2RJF A;  2BZY A;  1JJ2 A;  5KYX A;  1FXX A;  1F1B B;  4FM4 B;  3RES A;  2E65 A;  3JCM X;  1WGS A;  4BY6 C;  1VQM A;  2DD4 A;  1VQ8 A;  1YIJ T;  2RHI A;  4RTT A;  1YJN T;  2B86 A;  1BYM A;  2LVM A;  4M77 D;  3A5Z B;  5ECA A;  1GBQ A;  2RA2 A;  4B9X A;  5GAN 5;  4DEX A;  2E3I A;  5KCH A;  2JTE A;  4XTW A;  1SSF A;  4M7D D;  1VQ9 A;  2PNI A;  3V8L A;  3OS1 A;  4KUL A;  1AHJ B;  4HCK A;  1E6G A;  4Y91 A;  2MK5 A;  1PRL C;  3JCM h;  3FDR A;  2MI6 A;  3CCU Q;  1NZ9 A;  2OTJ T;  4BAC A;  4E7H A;  4C5G A;  5L8R E;  1DJ7 B;  3P8D A;  1KQ1 A;  3OMG A;  2BTT A;  5KYW B;  4F7U B;  3TCJ A;  1HSQ A;  2KMT A;  3OYM A;  5LJ5 h;  3FC3 A;  2EKO A;  3OYF A;  1VQO A;  2OAW A;  3WXM B;  1M90 C;  2EYY A;  1OYX A;  4E47 A;  2AHJ B;  4ZGJ B;  1UFF A;  1ABO A;  2FHD A;  3SB2 A;  4QW2 A;  3PFS A;  1YJW T;  4NS5 A;  4BUG A;  1KJW A;  1KK7 A;  5GAN 4;  4IUR A;  2ZPI B;  1QQJ A;  2QQ9 A;  3ZBD A;  1D3B A;  3TQ7 P;  2E5Q A;  2NYS A;  3IQL A;  1MNE A;  3JCM f;  2YWW A;  2QEX A;  2QDY B;  1VQN A;  2WSC E;  5CKB A;  2YT6 A;  1XNI A;  3CCM T;  4C92 D;  1Z9Z A;  1BBZ A;  4F17 A;  4E7Z A;  2RHU A;  4C8Q D;  4F7U F;  1SG5 A;  1Y96 A;  1WQW A;  2DJZ A;  2DTO A;  2JN0 A;  3MET A;  4BDZ A;  2V8I A;  3SWN A;  1O75 A;  3JCM g;  2R5A A;  2COY A;  1LCK A;  2L3Q A;  4E2F B;  4XU1 A;  2LC4 A;  1PSF A;  5IHK A;  4M78 D;  2EGE A;  2OX7 A;  1PCX A;  4GBQ A;  1OEB A;  3OBY A;  1OX8 A;  1N8R U;  2A3L A;  2EYZ A;  2JOY A;  3M53 A;  1JEG A;  1MMG A;  3OS5 A;  2IVW A;  1PD0 A;  1ZUK A;  4DBF A;  2EWN A;  1QKW A;  1PSE A;  1UEC A;  4J6X A;  4PJN A;  3MEA A;  3CXC S;  2ESW A;  5GAM g;  1N27 A;  2DIL A;  1RAD B;  1J3T A;  3S3M A;  2BUD A;  2M1H A;  1UGS B;  2H3J A;  1XTD A;  2AKK A;  2YRC A;  2LRQ A;  5GMK h;  1XOV A;  3MEW A;  3I5R A;  5GAO m;  3UAT A;  3EFO A;  2RK1 A;  1BI3 A;  3LWI A;  3I55 T;  4PNO A;  1UGP B;  4OVA A;  1JJ2 S;  1NEB A;  1NE8 A;  2QQB A;  3ZEH A;  5D6W A;  4BI4 A;  2LQ8 A;  2GNC A;  3MPU B;  1N9S A;  1TUC A;  3QJY A;  1K0X A;  2K3X A;  2RHZ A;  1WHK A;  3X28 B;  5CQY A;  1NM7 A;  3M0S A;  1KQS P;  1WHG A;  3E9F A;  4CC3 A;  1EZZ B;  3NTH A;  3WVD B;  1VQ4 Q;  2E41 A;  5DY9 A;  3FIF A;  5CKH A;  4JLI A;  1YHQ T;  2KRS A;  2PU9 B;  3G4S A;  1OZ2 A;  2CZ1 B;  2EQK A;  2R5M A;  3CCE A;  1V29 B;  4AFQ C;  3AT1 B;  2KAF A;  5LJ5 j;  1Y71 A;  1E6H A;  1D0Z A;  1BCM A;  2MWP A;  1YIT Q;  3X24 B;  4A4E A;  1AZE A;  2XI9 A;  2V8K A;  2QQA A;  2ZPB B;  4QVZ A;  4HVU A;  4MDW A;  4RG8 A;  4E7I A;  1MMD A;  2CUD A;  3H41 A;  4IUU A;  4LDY A;  5KH6 A;  3CME Q;  1VQ8 Q;  1YCS B;  3G71 A;  5IAY A;  2JVV A;  2KYM A;  4M75 D;  3JB9 J;  1X01 A;  4J7I A;  3GNG A;  5GAO n;  4ELZ C;  4BI8 B;  3R6O A;  1KQS A;  3QUI A;  1K1Z A;  4M7D F;  4RTY A;  3P8B B;  4J8O A;  2CT4 A;  4M75 G;  1PWT A;  1YWO A;  4OP0 A;  5FU6 B;  2D9T A;  2RHY A;  2JMA A;  2HQX A;  2WSE E;  2DFU A;  2CYZ B;  3J81 E;  1UJY A;  3RMS A;  3OY9 A;  2CP6 A;  1SKU B;  2DXU A;  4JPB W;  4DOW A;  1Q95 G;  3CCE Q;  1VYT A;  1B07 A;  1Y07 A;  5GAN 3;  1WJR A;  3I56 T;  3OYC A;  3EHQ A;  4JJD A;  2MWO A;  2CP0 A;  5CKD A;  5GAO q;  4PFZ A;  1QW1 A;  2O01 E;  1ACM B;  4M7A G;  4NOY A;  2KXD A;  4M77 A;  4N4H A;  2JJ9 A;  4OMM A;  2DK3 A;  1M3A A;  4KGV B;  4BE2 A;  2XMF A;  2GQI A;  3E1S A;  4L5G A;  1Y57 A;  1ZSZ B;  1BK2 A;  1ZBX A;  1WDX A;  2HL3 A;  2P4T A;  5J3B A;  1NJI C;  1T0H A;  6AT1 B;  1ZA1 B;  4R0K A;  3M9Q A;  1CKA A;  4OB0 B;  2O9V A;  2EJG A;  4EMK B;  2BIV A;  2KSS A;  2KEA A;  2KNB B;  2P0P A;  3A98 A;  3U23 A;  1S72 Q;  4EMK A;  1Q82 U;  2HZY A;  4P5N A;  2EIF A;  2PZ1 A;  2J05 A;  4M7A A;  2JTM A;  4LD9 K;  2JNG A;  5CIU A;  3CME A;  2LMJ A;  2E6N A;  2X9H A;  1ABQ A;  1GFD A;  3PMI A;  4KRT A;  4AT1 B;  4ZGE B;  3CMA T;  4C0F A;  2E4H A;  1YIT A;  4RTV A;  4M7A E;  1SHG A;  4BY6 B;  4M78 G;  4XTU A;  5KYY B;  3OW2 P;  4FW1 A;  1FMK A;  1G2B A;  1YIT T;  2OTL A;  4Y92 A;  1VYU A;  4PJJ A;  4M75 E;  2D8J A;  2EQM A;  2GTO A;  2FPD A;  2JM8 A;  2LTO A;  3PIO A;  3G7Z A;  2DVE A;  3EHR A;  4OB1 B;  1TXQ A;  5GAN d;  2KGT A;  2F2X A;  1ZUY A;  3PNW C;  2KBT A;  1GCP A;  4B6M A;  3V7C A;  1VYV A;  4IIO A;  2YUN A;  4XU0 A;  5GJW B;  3QKJ A;  2B8A A;  4Z8A A;  1C0M A;  4M75 A;  4RMO A;  3H0F A;  2EVR A;  4FYV B;  3CD6 A;  1TH7 A;  2KI7 A;  2P0K A;  3OB9 A;  3MCA B;  3QDR B;  3VS6 A;  2DA9 A;  1PG5 B;  2I2L A;  1WHL A;  2E1H A;  1K0S A;  5CO7 A;  4PJO F;  3TEE A;  1D1C A;  1W4S A;  1G3S A;  1Q7Y C;  5GAN 7;  3ULR B;  4PL6 A;  3L2Q A;  4J9I A;  3CCL Q;  4M78 F;  1I8F A;  2QEX Q;  4M77 G;  5DM7 R;  1BI0 A;  3NGP A;  1YJN A;  1NJI U;  1S72 T;  1RAE B;  3L1A A;  3CXC P;  4J6Y A;  5DLO A;  3VRZ A;  1D1B A;  3M4G A;  4O6J A;  1KC8 C;  3S6W A;  3GLX A;  1KC8 R;  4QQ6 A;  1Q82 C;  2LP5 A;  4QQG A;  5D7U A;  5GAN 6;  2BKD N;  2LNV A;  4LDW A;  3CC7 Q;  2X3X D;  3HRU A;  1Q7Y U;  4C92 F;  1VQK T;  2RJE A;  1UE9 A;  2LCS A;  1SSH A;  2VYT A;  3CD6 Q;  2M51 A;  2ZCF B;  4EIK A;  5CVI A;  4ORZ A;  1VQ4 A;  2YHT A;  1SHF A;  3EG9 A;  2EW3 A;  1YWP A;  4C5E A;  1UHC A;  5LJ3 g;  2XDB A;  2ROL A;  2K57 A;  1OPL A;  4IIM A;  3SDZ A;  4M77 C;  5A2Q E;  4J83 A;  4AG2 C;  5LJ3 h;  1MND A;  2G6F X;  5FW9 A;  2RH2 A;  2DLP A;  3BW1 A;  4OMQ A;  3L2Z A;  1ZBJ A;  2RB6 A;  4LDV A;  5KCO A;  1TUG B;  1NG2 A;  1ZQ1 A;  5CR2 A;  1VQ9 Q;  3MO8 A;  2LQK A;  4EPC A;  1YJW A;  2ECZ A;  2LX7 A;  4IKF A;  5GAN 2;  4M4Z A;  1K9A A;  1MHN A;  1VQP A;  2E64 A;  5IH2 A;  3JB9 I;  3RKY A;  2DBM A;  2L3R A;  1QWF A;  4OB3 B;  3LGF A;  8ATC B;  2NUT A;  1K76 A;  4C8Q G;  2LQW A;  2RN8 A;  4J9D A;  5CKF A;  3CCJ A;  1IRE B;  1OUL A;  1M8V A;  4OML A;  2V1R A;  3TSZ A;  4BE0 A;  2LJ0 A;  1S1N A;  3CC2 A;  1QVF S;  1FYN A;  2QA4 A;  1I4K 1;  2XIC A;  3M0Q A;  4M7D G;  4JZ4 A;  3A8H B;  3HL8 A;  1OI1 A;  3QJ6 A;  4ZN1 A;  3A8M B;  1PRM C;  2YUO A;  3CPW S;  2XDD A;  1KHI A;  5FWB A;  4EMH A;  3HFN A;  4FIB A;  2KRM A;  2BE9 B;  3OS2 A;  1M27 C;  3CCS A;  2CH4 W;  2YRD A;  3EFS A;  2ZAE A;  2LJ1 A;  5GMK j;  5D6X A;  2O4X B;  3PMT A;  4BDY A;  4EMK C;  2FZK B;  1G3W A;  5GMK l;  2L3P A;  4BB7 A;  3N5B B;  3EH2 A;  1TS9 A;  4MZT A;  2YUP A;  3E9G A;  4D6W A;  3ASK A;  3EG0 A;  1ZSZ C;  5KYY A;  3BFM A;  3SFM A;  1IGU A;  4KUD K;  4JRK A;  4CC4 B;  1KD1 U;  1GFC A;  1TUD A;  1BCO A;  1FMW A;  1TSF A;  2HQH A;  1VQK Q;  2OJ2 A;  1ZX6 A;  3L42 A;  1N8R R;  5FRO A;  1VA7 A;  1D3B B;  2J6K A;  1K8A R;  1Q82 R;  3O8V A;  1M2O A;  2DM1 A;  3RER A;  3RKX A;  2NUP A;  3NHN A;  4RCC A;  1V1C A;  4GY5 A;  3GF5 A;  5GAO l;  1WIE A;  1HJD A;  4JUV A;  2EYW A;  2RQW A;  2X51 A;  3VRY A;  3VS4 A;  4E7L A;  3X25 B;  4AFS C;  1PHT A;  4C0G A;  5L23 A;  1UB4 A;  1WJQ A;  1T0J A;  2FVU A;  1QVG S;  4PK4 A;  2D0N A;  4DBQ A;  4XK8 E;  4HT9 A;  2ZPE B;  2QGF B;  4WCI A;  1UGQ B;  3A1P A;  5GAN f;  3CCS Q;  3OYG A;  4JJB A;  2EGC A;  3JB9 D;  1VQ8 T;  3OYL A;  2F5T X;  1YIJ A;  1QP3 A;  3JCM e;  1TTH B;  2W10 A;  3L2R A;  4DEY A;  1WYX A;  2L8D A;  2HNI A;  4HCZ A;  9ATC B;  2CSI A;  4DQ2 A;  3FLG A;  1VQ9 T;  4JDS A;  1Q86 U;  4M78 A;  3EGU A;  2AK5 A;  4M7A B;  1QVG A;  4RCB A;  1JQQ A;  3CCV A;  4M78 C;  2P0Q A;  1U3O A;  2MAM A;  3GOX A;  3SD4 A;  1XJW B;  5KE2 A;  1QMC A;  3PIP A;  2KRN A;  3CC4 T;  5IT9 E;  4D8K A;  2QG9 B;  2JS0 A;  3PTA A;  5GAN j;  2LQN A;  1LVK A;  2VKN A;  1H92 A;  3MEU A;  4RUG A;  1TOV A;  1VQL Q;  3VS3 A;  1CKB A;  2M02 A;  1P92 A;  3C95 A;  2VV5 A;  1YJW Q;  1WA7 A;  2QGG A;  1UG1 A;  2F69 A;  4F7U E;  2XK0 A;  3ZL7 C;  1U1S A;  4EDU A;  2L5Q A;  1YBY A;  1WJS A;  3EG1 A;  3RBB B;  3I56 A;  2V8J A;  4C8Q B;  2DPP B;  2LCC A;  1M4Z A;  2ZGW A;  4HCB A;  4TVR A;  3E2U A;  1QWE A;  3OS0 A;  1IO6 A;  4LXC A;  3CCL T;  3O5Z A;  2W0Z A;  1JJ2 P;  4C92 A;  4FYW B;  1AWJ A;  1X27 A;  3RIR A;  2O31 A;  2PTK A;  3CBO A;  2BE7 D;  4OF1 A;  3QBY A;  3SHW A;  1M2V A;  4CC2 A;  5LJ3 j;  3M54 A;  4KT0 E;  3OBW A;  2BZX A;  1JU5 C;  2A36 A;  4Q5W A;  3PGG A;  4OMO A;  4HVV A;  1WNL A;  3THK A;  2DVJ A;  2DEU A;  1VQ7 T;  2LNH B;  4PJL A;  3HSB A;  1WQ7 A;  1SRL A;  2RJD A;  4M7D C;  2NLU A;  4C92 G;  3VYH B;  3J7A F;  5AYF A;  3UWN A;  3REA B;  3CME T;  3H0I A;  2X3W D;  4FYX B;  1M8M A;  2HCK A;  2DZ9 A;  2LZ6 B;  2RQR A;  3QXE B;  2HSP A;  2DKG A;  4Z88 A;  5A0D A;  4J5Y A;  1W1F A;  4JRQ A;  1Q81 R;  2KE9 A;  2X4J A;  1D1A A;  2YLB A;  4M7D B;  1VQO Q;  4RTW A;  4LDU A;  1LJO A;  4XTY A;  2RI3 A;  1ARK A;  4DOV A;  2Y4Y A;  1GCQ C;  3BY7 A;  2DXC A;  1M90 R;  3GBQ A;  3EFR A;  4HCC A;  2CZ6 B;  2CGH A;  3V8K A;  4NL3 A;  1ZHI A;  1NPR A;  4X1V A;  3OYI A;  4N4I A;  4OB2 B;  1E7O A;  3HP9 A;  2RMO A;  3BDL A;  3QYG B;  3I55 A;  1IHW A;  1R0C B;  1JXO A;  3S3N A;  2FRY A;  2NUT B;  2YSQ A;  4FSS A;  1N5Z A;  1RAH B;  2VB6 A;  4MZM A;  1M1K C;  2AT1 B;  2YDL A;  3EAE A;  3CC7 A;  2RQT A;  3CCQ A;  4E6R A;  1YHQ Q;  3T9N A;  1PNJ A;  2KYB A;  3PT9 A;  3HRT A;  1S72 A;  2DIQ A;  5GAN h;  4F7U A;  3CPF A;  2VGN A;  2XU8 A;  1YCY A;  1YHQ A;  2RHX A;  1RAB B;  1Q86 R;  3H9N A;  4XTV A;  1I81 A;  2A08 A;  2HAX A;  3CCE T;  3D7S B;  4V2S A;  5LL6 S;  1CSK A;  1X43 A;  1B34 B;  3CCU T;  2X35 A;  3VV0 A;  1NBE B;  3QG1 A;  2RI2 A;  4JZ3 A;  3MKD A;  5I21 A;  2QXF A;  4GLM A;  4FYY B;  3CC4 Q;  3I55 Q;  3G4S T;  1ZSG A;  3C4S A;  2K2M A;  4KGX B;  4AMC A;  1M3C A;  1W2B S;  2KQW A;  2O88 A;  3EGD B;  3OYK A;  3JRZ A;  3R6N A;  1W6X A;  2RF0 A;  1ZUU A;  3DLM A;  3Q1J A;  5FRN A;  2DXT A;  2HSE B;  1PKS A;  4OMN A;  4M78 B;  5I2M A;  2EBP A;  3G1J A;  1AT1 B;  5GMK i;  1B34 A;  3G71 T;  4C0Z A;  5GAO r;  5DLQ E;  4QVD A;  3H0H A;  2YRV A;  2CZ7 B;  3FJ5 A;  1YI2 T;  1YJ9 Q;  3OYD A;  4LDX A;  4PJO C;  3VU3 C;  4UC4 A;  1K73 R;  3CMA Q;  3JCM b;  4QVC A;  4C92 E;  2KT1 A;  1YI2 A;  3QDF A;  2O2O A;  3CC2 Q;  4JS4 A;  3J80 E;  1H8K A;  1X6G A;  1MUZ A;  2JW4 A;  1D0Y A;  1QCO A;  4A4G A;  2DNU A;  1MMN A;  4QQD A;  3QWX X;  4ZNX A;  3KBG A;  2VC8 A;  4R56 A;  2DTH A;  4JRI A;  4WTO B;  1WFW A;  2V26 A;  4E7S A;  1ZA2 B;  3M4Y A;  4OGC A;  3OYN A;  4DBH A;  2L0A A;  3QWY A;  1LPL A;  2DYB A;  3CCR T;  2JUF A;  2ZPG B;  3BE3 A;  1AWO A;  1ZSZ A;  2SEM A;  4KBM B;  1M1G A;  2LCL A;  3RNJ A;  3C12 A;  1KC8 U;  5I22 A;  2E10 A;  4FW2 A;  1I1J A;  3SWN C;  1FMV A;  2D1X A;  4ANJ A;  3GNF B;  2SRC A;  2HD0 A;  4C0D B;  3PVQ A;  2F2V A;  2R58 A;  4LN2 A;  2QTX A;  5M9O A;  2H3E B;  2P84 A;  1X6O A;  1M5Q 1;  2CP5 A;  4LUE A;  1MMA A;  1RAC B;  1GL5 A;  1KD1 R;  2L89 A;  4C8Q A;  3OW2 S;  2DTI A;  2ZPF B;  3UA6 A;  4XU3 A;  3AHU A;  1NLO C;  2X4W A;  2RJC A;  4RKU E;  3MEV A;  4K11 A;  5LJ3 e;  3TSW A;  3NPF A;  4LE9 A;  3DKM A;  2PVD B;  3M55 A;  2CKK A;  2LT4 A;  4A54 A;  3X26 B;  3P8H A;  1VQL T;  2Y90 A;  3JCM J;  2F2W A;  2ZPH B;  1EIF A;  1YJN Q;  5CQX A;  4CI0 C;  3NFC A;  3LH0 A;  1N6A A;  2DO3 A;  7AT1 B;  3PVL A;  3SEM A;  2C06 A;  2QK0 A;  2FYK A;  4KGZ B;  5CK9 A;  2KXC A;  4RTU A;  3M0P A;  2KT8 A;  5GAM d;  3VJP A;  2A28 A;  3INZ A;  2K3B A;  1W2B A;  1VQ5 Q;  3OYY A;  1YIJ Q;  2YXY A;  3VS5 A;  5HK3 A;  1KHC A;  1WHM A;  1VQ5 T;  3LH5 A;  1QLY A;  2PVO B;  2EJ9 A;  4JRP A;  1BI1 A;  1QP2 A;  4CC7 A;  3EFO B;  3G4S Q;  1VQ5 A;  5GAM h;  2FPE A;  1YN8 A;  3QYH B;  1UDL A;  2EQU A;  2OTL Q;  2GCX A;  5FWC A;  2HKQ B;  4XTZ A;  3EGX B;  2VWF A;  2LJ3 A;  3RKW A;  4A4K A;  2KY9 A;  2EAY A;  1Q86 C;  3CC4 A;  2K4Y A;  3ZFJ A;  1MV0 B;  1TU0 B;  2HEQ A;  1VQ4 T;  2NUP B;  4E7K A;  4ESR A;  2MYS A;  3CPW A;  2QQS A;  2A7Y A;  3LYI A;  1AEY A;  3LGL A;  1BKB A;  4PLL A;  1GXI E;  1M1K R;  2DL8 A;  1UUE A;  4L59 A;  4C0D C;  2DRM A;  2QI2 A;  1IXD A;  1RUW A;  2K2V A;  1KD1 C;  2DRK A;  3SWN B;  1WXU A;  2CH4 A;  1K8A U;  3BDU A;  3LW5 E;  3OMC A;  2JTF A;  1Y96 B;  1YFN A;  5KYN A;  2CT3 A;  4LD6 A;  1VQO T;  3A8O B;  2DXB A;  2RK2 A;  1VOM A;  2JMC A;  4M77 E;  3F70 A;  2XHC A;  3LX7 A;  3VS1 A;  1O9S A;  3JCM P;  2DX1 A;  1YNZ A;  2C0O A;  2E12 A;  3OA6 A;  1YP5 A;  1OOT A;  2GQV A;  1WHJ A;  2RD1 A;  3CCR Q;  4M7D A;  4HA8 A;  3PE0 A;  1V76 A;  1QVP A;  2CUB A;  3JB9 G;  4M75 F;  1VQN T;  1FX7 A;  3HKS A;  5FU6 C;  3UT1 A;  2ED1 A;  4ZTF A;  1Q81 C;  1WXB A;  3CC2 T;  2E3H A;  4F04 B;  2EFI A;  2ABL A;  2D8H A;  3VS0 A;  1BI2 A;  1WX6 A;  3CCJ T;  2DE0 X;  3FRN A;  2MOX A;  3CQT A;  3FB9 A;  1GRI A;  1RL2 A;  5EC7 A;  3EGX A;  2RQU A;  1KSW A;  3M57 A;  1RAF B;  3OSV A;  4XU2 A;  2QAZ A;  1VQM Q;  3QSU A;  1VQ7 Q;  2HDA A;  2FEI A;  1QVF P;  2IIM A;  4MML A;  3CCM Q;  3HFO A;  2QAS A;  3NTI A;  4M75 B;  4VUB A;  2KVQ G;  5GAN e;  5IN1 A;  2GFA A;  4XTX A;  2J7I A;  1EX4 A;  1BIA A;  1AD5 A;  2DER A;  3M56 A;  1MGQ A;  4J7F A;  1YI2 Q;  4DBR A;  3M0R A;  3MP8 A;  4QT7 A;  3G71 Q;  1M2V B;  3CCS T;  3I5S A;  5J26 A;  2KRO A;  3MP6 A;  1KQS S;  2VXE A;  3VS2 A;  1G5V A;  1ZLM A;  1NEG A;  4OMF B;  4PLI A;  3HPW A;  3UF4 A;  2RM4 A;  2K5I A;  2J6F A;  3OYE A;  3REB B;  5IXF A;  5FU7 C;  2DL3 A;  1JBM A;  2FO0 A;  2KR3 A;  2K6D A;  8AT1 B;  3TRE A;  2OTJ Q;  2FL7 A;  2A0F B;  1WPY A;  2M0Y A;  1OV3 A;  3C94 A;  1FWZ A;  2MF2 A;  1UJ0 A;  4CRI A;  4MMK A;  1HK9 A;  3RUX A;  4LNP A;  2D6F A;  2V1Q A;  4JLG A;  4B9W A;  2RNA A;  3HHT B;  4Z02 A;  5KYX B;  4C8Q E;  1Q81 U;  5C0M A;  3DB4 A;  1KG1 A;  2I0N A;  2QTV A;  3CCQ T;  1OU8 A;  1UGR B;  4R55 A;  5FRM A;  5GAM e;  3HRS A;  4O5V A;  1K9M C;  2KK4 A;  1M30 A;  1I5L A;  4KUI A;  4RTZ A;  2DIG A;  2L3S A;  2MIO A;  3MJX A;  2QDL A;  1RI9 A;  3JB9 F;  2JM9 A;  3OYA A;  1GCQ A;  4X9C A;  2FPF A;  5D6Y A;  2XD0 A;  2HBW A;  2DET A;  1RI0 A;  1Z9Q A;  2CP7 A;  2WSF E;  3FJP A;  1G83 A;  2GFU A;  2AKL A;  1R0B G;  4IUV A;  3CCV T;  4J9F A;  3VS7 A;  4X9D A;  4YTL A;  2AIR B;  1AWW A;  4A4F A;  1BU1 A;  1OX9 A;  5LJ5 f;  1EFN A;  2E6Z A;  5GJV B;  3E19 A;  1I5O B;  5AT1 B;  3QHS A;  2DEQ A;  1U8R A;  1M3B A;  2PUO B;  3M58 A;  1QKX A;  2ENM A;  5EG2 A;  3HTR A;  4PJO E;  4II1 A;  3I35 A;  3H6Z A;  3VUB A;  2GTJ A;  1KQ2 A;  3GPL A;  2GGR A;  1RLQ C;  1X6B A;  2PVG B;  2Z0W A;  4M78 E;  3X20 B;  2OTJ A;  1PM3 A;  1SRM A;  2O4X A;  1M9S A;  2K9G A;  3QO3 A;  2K5L A;  4X34 A;  2XG8 D;  4FT4 A;  5KYU A;  1RAA B;  3EH1 A;  2VVK A;  1T3S A;  2DJQ A;  1N8R C;  3H8Z A;  4PJM A;  2ATC B;  2RQV A;  3KFV A;  1AOJ A;  3L2V A;  4Z89 A;  1HYO A;  2JT4 A;  3UA7 A;  5I11 A;  2ED0 A;  1D09 B;  1PKT A;  3DB3 A;  4FSX A;  2XID A;  2OI3 A;  2EQI A;  4XQ3 A;  4ZN3 A;  3OYH A;  1RAG B;  1T3L A;  5HCK A;  3WVE B;  3CCL A;  2CRE A;  2CP2 A;  4C8Q C;  4A53 A;  2A37 A;  3ME9 A;  5FU7 B;  4RTX A;  2MMP A;  5CKE A;  2CP3 A;  2QEX T;  2H8H A;  5LJ3 d;  3CCM A;  3VKI A;  4KH0 B;  1M90 U;  3M59 A;  2FZG B;  1VQ7 A;  2EQJ A;  1IGQ A;  3EG2 A;  2HL5 C;  4A63 B;  2FZC B;  2QYZ A;  3URG A;  3TU4 K;  4AFZ C;  2D0Q B;  2FRW A;  3UDC A;  5GAN 8;  4ELY C;  1BIB A;  1Y7X A;  3RDV A;  4JJN K;  1UGV A;  1VUB A;  5LJ5 g;  4BE1 A;  3RR6 A;  1G8X A;  3C0C A;  3OYJ A;  3L2U A;  3OW2 A;  4M75 C;  1SEM A;  3MHX A;  4M7A C;  5CAI A;  4D8D A;  4ZTJ A;  3V7S A;  5C6S A;  2MPX C;  4ATO A;  2CSQ A;  2QA4 Q;  4NL2 A;  4PJO G;  5LJ5 d;  5GAM f;  5J39 A;  1K4U S;  4FU6 A;  1VQL A;  5IHN A;  1NYF A;  1PD1 A;  4C5I A;  4J9H A;  4F16 A;  2FB7 A;  2VGM A;  1UEB A;  2IPO B;  3UPU A;  1OU9 A;  2ROT A;  2FG0 A;  1JB0 E;  3CCJ Q;  3RMQ A;  3EG9 B;  5CCA A;  1XQH A;  1VQP Q;  1U06 A;  3CD6 T; 
#chains in the Genus database with same CATH homology
 2C06 A;  4L6V 5;  1NE8 A;  3RKX A;  2QQB A;  2FYK A;  2XKO C;  3CEY A;  3ZEH A;  5D6W A;  4A4H A;  1H64 1;  4RCC A;  4BI4 A;  4GY5 A;  2LQ8 A;  5CK9 A;  3GF5 A;  5GAO l;  1N9S A;  3QJY A;  2K3X A;  4JUV A;  2RO0 A;  5GAM d;  3VJP A;  2RHZ A;  4E7L A;  3X25 B;  4C0G A;  3INZ A;  4DA4 A;  3S3O A;  5A0L A;  2X4Y A;  5GMK e;  1UB4 A;  3ER0 A;  3X28 B;  5CQY A;  1W2B A;  5LJ5 e;  3JCM c;  1WJQ A;  2LX9 A;  3E9F A;  3OYY A;  3CXC A;  2FVU A;  1QVG S;  5HK3 A;  4XK8 E;  2VXF A;  3NTH A;  4HT9 A;  2ZPE B;  5HK0 A;  1KHC A;  2G3R A;  3KUF A;  1OZ3 A;  1VQ5 T;  1UGQ B;  3WVD B;  4BI3 A;  5GAN f;  2PVO B;  2EJ9 A;  4JRP A;  3OYG A;  2F5K A;  1VQ6 T;  3JCM d;  1BI1 A;  3CC7 T;  2E41 A;  3JB9 D;  3CCU A;  1QP2 A;  1VQ8 T;  3OYL A;  5DY9 A;  2F5T X;  3FIF A;  5CKH A;  1YIJ A;  1QP3 A;  4FL6 A;  1VQ5 A;  1R8O B;  2DD5 A;  5GAM h;  3JCM e;  3QYH B;  3V7R A;  2EQU A;  4JLI A;  1VQ6 A;  1YHQ T;  2PU9 B;  2GCX A;  3G4S A;  3L2R A;  1OZ2 A;  3JCM W;  2CZ1 B;  2EQK A;  4MZP A;  2R5M A;  2L8D A;  2R57 A;  2HNI A;  4HCZ A;  5HKC A;  3CCE A;  4XTZ A;  1V29 B;  3OQ5 A;  4DQ2 A;  2KAF A;  4PKC C;  3FLG A;  1VQ9 T;  5LJ5 j;  1Y71 A;  1K8A C;  3RKW A;  2IG0 A;  4A4K A;  4JDS A;  1Q86 U;  4M78 A;  2MWP A;  2KY9 A;  3X24 B;  4A4E A;  2EAY A;  1Q86 C;  4M7A B;  2E70 A;  2XI9 A;  1QVG A;  4RCB A;  3CC4 A;  2K4Y A;  3ZFJ A;  4MDX A;  3FEO A;  2V8K A;  3CCV A;  4M78 C;  2P0Q A;  2RI5 A;  5FLX E;  2MAM A;  2QQA A;  4N4G A;  3G6E T;  1VQ4 T;  3GOX A;  2ZPB B;  4QVZ A;  4MDW A;  4RG8 A;  3SD4 A;  5KE2 A;  4E7K A;  4E7I A;  3PIP A;  4IUU A;  4LDY A;  4ZGD B;  3CPW A;  5KH6 A;  2QQS A;  3CC4 T;  3OSS C;  2M16 A;  3G71 A;  1VQK A;  5IAY A;  2X4X A;  2A7Y A;  3LYI A;  5IT9 E;  5I2S A;  3LGL A;  2JVV A;  3G6E A;  1BKB A;  3PTA A;  4M75 D;  5GAN j;  3JB9 J;  1X01 A;  4J7I A;  3GNG A;  4PLL A;  1GXI E;  4L59 A;  4C0D C;  2VUB A;  2QI2 A;  3MEU A;  5GAO n;  2K3Y A;  4ELZ C;  3A8G B;  2K2V A;  3R6O A;  2GF7 A;  4BI8 B;  1KD1 C;  3QUI A;  1KQS A;  3SWN B;  4M7D F;  3JCM V;  3C95 A;  1P92 A;  1K8A U;  3BDU A;  3CBM A;  3P8B B;  2JZ2 A;  2CZ0 B;  2VV5 A;  3LW5 E;  4J8O A;  1G3Y A;  2DAQ A;  2JTF A;  3OMC A;  4M75 G;  3KXT A;  4PJO A;  1Y96 B;  2M0O A;  4LD6 A;  1VQO T;  2F69 A;  2DXB A;  3A8O B;  2RK2 A;  4ME7 A;  3JB9 H;  2QQR A;  4OP0 A;  5FU6 B;  2D9T A;  2RHY A;  4F7U E;  2XK0 A;  4M77 E;  3F70 A;  4M7D E;  1U1S A;  5KE3 A;  2XHC A;  3LX7 A;  4EDU A;  2HQX A;  5LJ3 f;  1IZ6 A;  1O9S A;  1YBY A;  2L5Q A;  2WSE E;  3JCM P;  2CYZ B;  1WJS A;  3M5A A;  3J81 E;  3RMS A;  3OY9 A;  3JSC A;  3I56 A;  2V8J A;  4C8Q B;  2DPP B;  4FT2 A;  4C8Q F;  4E7J A;  2LCC A;  1M4Z A;  2ZGW A;  2DZC A;  2E12 A;  4TVR A;  2DXU A;  3OA6 A;  4HCB A;  3DLL A;  1LNX A;  4M77 F;  4DOW A;  3OS0 A;  2GQV A;  4EMG A;  2RD1 A;  2LT1 A;  4M7D A;  5GAN 3;  1Y07 A;  4HA8 A;  1WJR A;  3I56 T;  3OYC A;  1QVP A;  3JB9 G;  4M75 F;  2MWO A;  3CCL T;  1VQN T;  4C92 C;  5CKD A;  1FX7 A;  3HKS A;  4C5H A;  5GAO q;  5FU6 C;  3UT1 A;  1QW1 A;  1VIF A;  4ZTF A;  4PJO D;  3QZ9 B;  1Q81 C;  2O01 E;  1VQP T;  3CC2 T;  4C92 A;  2LDM A;  2EFI A;  2QA4 T;  3RIR A;  3CCR A;  2HBP A;  4WF2 A;  4M7A G;  2HQE A;  1BI2 A;  3CBO A;  4NOY A;  4M77 A;  4N4H A;  3CCJ T;  2OAU A;  3FRN A;  3QBY A;  4OF1 A;  5LJ3 j;  3M54 A;  3FB9 A;  4KT0 E;  2M9U A;  1RL2 A;  3QII A;  2DK3 A;  1N9R A;  1NPP A;  5A0G A;  3OBW A;  4BE2 A;  5GAN g;  3JAM E;  4M7A D;  3M57 A;  4XU2 A;  3OSV A;  3E1S A;  4HKE A;  3LLR A;  4L5G A;  4Q5W A;  1BYM A;  1ZBX A;  3A8L B;  3PGG A;  3QSU A;  1HXD A;  2P4T A;  5J3B A;  1NJI C;  1WNL A;  4M77 B;  4MML A;  3M9Q A;  1VQ7 T;  3HFO A;  4OGE A;  3NTI A;  4M75 B;  3HSB A;  1WQ7 A;  2KVQ G;  4VUB A;  5GAN e;  3LWH A;  2RJD A;  3VUZ A;  3CBP A;  4OB0 B;  1LOJ A;  5IN1 A;  4M7D C;  2EJG A;  2GFA A;  2NLU A;  4XTX A;  4Y28 E;  2BIV A;  2KSS A;  2P0P A;  4EMK B;  1Q82 U;  4EMK A;  4JS5 A;  1BIA A;  3L2W A;  4P5N A;  4C92 G;  3VYH B;  2EIF A;  3J7A F;  3M56 A;  5AYF A;  1MGQ A;  2EJF A;  4J7F A;  3UWN A;  5GAM j;  3CME T;  4M7A A;  3MP8 A;  2JTM A;  1M1F A;  3CCS T;  1H3Z A;  5J26 A;  4LD9 K;  2JNG A;  5CIU A;  3MP6 A;  3NTK A;  1KQS S;  2DZ9 A;  3QPH A;  2VXE A;  3CME A;  2E6N A;  4BD3 A;  2XDP A;  1G5V A;  1G3T A;  2EYQ A;  3QXE B;  4RG2 A;  3PMI A;  2DKG A;  4ZGE B;  3CMA T;  4C0F A;  4J5Y A;  5A0D A;  2YLC A;  3GIB A;  4OMF B;  4JRQ A;  4PLI A;  3HPW A;  1YIT A;  2X4J A;  2RM4 A;  2K5I A;  4M7A E;  4HT8 A;  2YLB A;  4BY6 B;  4M7D B;  4M78 G;  3OYE A;  4XTY A;  4LDU A;  1LJO A;  4N0A A;  4XTU A;  3CMA A;  2KDS A;  2RI3 A;  5FU7 C;  1JRI A;  4DOV A;  1YIT T;  2OTL A;  2Y4Y A;  1YJ9 A;  1JBM A;  4N0A C;  4M75 E;  2EQM A;  2LTO A;  3V8J A;  2CS7 A;  3PIO A;  3BY7 A;  3G7Z A;  2DVE A;  2DXC A;  3TRE A;  2FL7 A;  3MP1 A;  4OB1 B;  3VYG A;  5GAN d;  4F7U G;  2Y4X A;  1WPY A;  3EFR A;  4HCC A;  2CZ6 B;  2CGH A;  3V8K A;  2OTL T;  1YJ9 T;  3C94 A;  2PQW A;  4IUT A;  3PNW C;  5GAO p;  1FWZ A;  5HY6 A;  2PUK B;  5GMK m;  4NL3 A;  1ZHI A;  2MF2 A;  1NPR A;  4GLK A;  4J6W A;  3V7C A;  4CRI A;  3OYI A;  1K73 C;  3QZ5 B;  4MMK A;  4N4I A;  4OB2 B;  1HK9 A;  1QVF A;  4XU0 A;  3RUX A;  2D6F A;  2ZZD A;  3QKJ A;  4JLG A;  3HP9 A;  3QYG B;  3BDL A;  3HHT B;  1VIE A;  4B9W A;  2B8A A;  2K5F A;  3OYB A;  3I55 A;  4Z02 A;  4M75 A;  4RMO A;  3S3N A;  3CD6 A;  1TH7 A;  4C8Q E;  2P0K A;  1Q81 U;  3OB9 A;  3MCA B;  3DB4 A;  5C0M A;  3QDR B;  1KG1 A;  4IUP A;  3CCQ T;  1M1K U;  1UGR B;  1K9M U;  4R55 A;  4MZM A;  2I2L A;  3GP8 A;  5FRM A;  2E1H A;  4XAX B;  5GAM e;  4M7A F;  1M1K C;  3HRS A;  5CO7 A;  4IUQ A;  4O5V A;  4C92 B;  1K9M C;  4PJO F;  2KK4 A;  4PJO B;  3TEE A;  1W4S A;  1I5L A;  3EAE A;  1G3S A;  4KUI A;  3JCM Q;  3CC7 A;  1Q7Y C;  3CCQ A;  1U1T A;  5GAN 7;  2DIG A;  3T9N A;  3PT9 A;  1X75 C;  3HRT A;  1S72 A;  2DIQ A;  4PL6 A;  3JB9 F;  5GAN h;  4F7U A;  3CPF A;  2VGN A;  3L2Q A;  2WAC A;  3OYA A;  2XU8 A;  1YCY A;  1YHQ A;  1K73 U;  1VQM T;  2RHX A;  4M78 F;  1I8F A;  4X9C A;  2RJF A;  4M77 G;  5DM7 R;  1BI0 A;  5D6Y A;  4XTV A;  1YJN A;  1I81 A;  1JJ2 A;  2XD0 A;  1NJI U;  2HAX A;  3CCE T;  1RI0 A;  1S72 T;  1FXX A;  4FM4 B;  3RES A;  2E65 A;  3L1A A;  4V2S A;  2WSF E;  5LL6 S;  3JCM X;  1WGS A;  4BY6 C;  1VQM A;  1B34 B;  2DD4 A;  3FJP A;  4J6Y A;  3CCU T;  1VQ8 A;  5DLO A;  2X35 A;  1YIJ T;  2RHI A;  2GFU A;  3VV0 A;  3M4G A;  3QG1 A;  2RI2 A;  4O6J A;  2LVM A;  3GLX A;  3S6W A;  1YJN T;  4QQ6 A;  1KC8 C;  4M77 D;  1Q82 C;  4QQG A;  5I21 A;  3A5Z B;  2QXF A;  4IUV A;  5GAN 6;  3CCV T;  2RA2 A;  4B9X A;  3G4S T;  5GAN 5;  4X9D A;  4YTL A;  2BKD N;  3C4S A;  5KCH A;  2LNV A;  4LDW A;  4XTW A;  4A4F A;  1W2B S;  1SSF A;  2KQW A;  4M7D D;  3OYK A;  3HRU A;  3JRZ A;  4C92 F;  1Q7Y U;  1VQ9 A;  1VQK T;  2RJE A;  5LJ5 f;  3DLM A;  3V8L A;  2E6Z A;  3OS1 A;  3E19 A;  3Q1J A;  4KUL A;  3QHS A;  2DEQ A;  1U8R A;  1AHJ B;  5FRN A;  2DXT A;  4Y91 A;  2PUO B;  2VYT A;  3M58 A;  2ZCF B;  5EG2 A;  5CVI A;  4PJO E;  4M78 B;  1VQ4 A;  4II1 A;  2YHT A;  3JCM h;  3FDR A;  5I2M A;  2MI6 A;  3H6Z A;  1NZ9 A;  4C5E A;  5GMK i;  2OTJ T;  1B34 A;  5LJ3 g;  3G71 T;  4BAC A;  2XDB A;  2K57 A;  3VUB A;  4E7H A;  4C0Z A;  3SDZ A;  4C5G A;  4M77 C;  5A2Q E;  1KQ2 A;  4J83 A;  3GPL A;  5LJ3 h;  2RH2 A;  5L8R E;  5GAO r;  1DJ7 B;  3BW1 A;  3P8D A;  2PVG B;  1KQ1 A;  4M78 E;  3X20 B;  3L2Z A;  2OTJ A;  3OMG A;  5DLQ E;  4QVD A;  2O4X A;  2YRV A;  1M9S A;  3QO3 A;  2K5L A;  4X34 A;  2CZ7 B;  2XG8 D;  4F7U B;  3TCJ A;  1YI2 T;  2KMT A;  4FT4 A;  3OYM A;  5LJ5 h;  2RB6 A;  3OYD A;  3FC3 A;  4LDV A;  5KCO A;  2EKO A;  3VU3 C;  4UC4 A;  4LDX A;  4PJO C;  1ZQ1 A;  5CR2 A;  3MO8 A;  3OYF A;  2LQK A;  4EPC A;  1VQO A;  3JCM b;  1YJW A;  4QVC A;  4C92 E;  1YI2 A;  3WXM B;  1N8R C;  1M90 C;  4IKF A;  3H8Z A;  1OYX A;  4JS4 A;  4E47 A;  3J80 E;  5GAN 2;  3L2V A;  2AHJ B;  4ZGJ B;  2FHD A;  3SB2 A;  4QW2 A;  1MHN A;  3PFS A;  1YJW T;  1VQP A;  2E64 A;  3JB9 I;  3DB3 A;  4FSX A;  3RKY A;  4NS5 A;  4BUG A;  5GAN 4;  2XID A;  4IUR A;  2ZPI B;  2QQ9 A;  2L3R A;  3ZBD A;  1D3B A;  4OB3 B;  4XQ3 A;  3LGF A;  4A4G A;  2E5Q A;  4C8Q G;  3CCJ A;  5CKF A;  4QQD A;  4ZN3 A;  3OYH A;  3KBG A;  1IRE B;  2VC8 A;  3JCM f;  3WVE B;  2DTH A;  4JRI A;  4R56 A;  2QEX A;  2QDY B;  3CCL A;  1VQN A;  1M8V A;  2WSC E;  5CKB A;  4C8Q C;  4A53 A;  1XNI A;  3CCM T;  4C92 D;  4BE0 A;  3ME9 A;  3M4Y A;  3CC2 A;  2RHU A;  4OGC A;  5CKE A;  2MMP A;  5FU7 B;  4C8Q D;  4F7U F;  3OYN A;  2QEX T;  1QVF S;  2QA4 A;  1Y96 A;  1WQW A;  2JUF A;  2ZPG B;  3CCR T;  5LJ3 d;  1I4K 1;  2DJZ A;  3VKI A;  3CCM A;  2DTO A;  2JN0 A;  2XIC A;  1M90 U;  3MET A;  3M59 A;  4BDZ A;  2V8I A;  3A8H B;  4M7D G;  3HL8 A;  4KBM B;  3SWN A;  1OI1 A;  1O75 A;  1M1G A;  3QJ6 A;  2R5A A;  3JCM g;  2EQJ A;  3A8M B;  4ZN1 A;  2LCL A;  1VQ7 A;  3CPW S;  3C12 A;  1KC8 U;  3URG A;  3TU4 K;  2E10 A;  3SWN C;  3GNF B;  2XDD A;  2D0Q B;  4XU1 A;  2LC4 A;  1KHI A;  4EMH A;  1PSF A;  2HD0 A;  3UDC A;  4C0D B;  3HFN A;  4M78 D;  5GAN 8;  4FIB A;  4ELY C;  1BIB A;  3OS2 A;  1Y7X A;  3CCS A;  4JJN K;  1VUB A;  3EFS A;  3OBY A;  2R58 A;  5LJ5 g;  2QTX A;  5M9O A;  4BE1 A;  1N8R U;  2A3L A;  2JOY A;  5GMK j;  3M53 A;  5D6X A;  3OYJ A;  1X6O A;  2O4X B;  3OS5 A;  3PMT A;  1M5Q 1;  4EMK C;  4BDY A;  2IVW A;  3L2U A;  3OW2 A;  1G3W A;  4M75 C;  5GMK l;  3MHX A;  2EWN A;  2L89 A;  4C8Q A;  4M7A C;  3OW2 S;  2DTI A;  4BB7 A;  5CAI A;  2ZPF B;  3N5B B;  1PSE A;  4MZT A;  4ZTJ A;  4XU3 A;  3AHU A;  4J6X A;  3E9G A;  3V7S A;  3MEA A;  3CXC S;  2X4W A;  2RJC A;  4RKU E;  4D6W A;  3ASK A;  5C6S A;  5GAM g;  4ATO A;  4NL2 A;  1N27 A;  3MEV A;  4PJO G;  5LJ5 d;  5LJ3 e;  5GAM f;  5J39 A;  4FU6 A;  1VQL A;  3BFM A;  3SFM A;  3S3M A;  3DKM A;  4KUD K;  2PVD B;  2BUD A;  3M55 A;  2M1H A;  4JRK A;  4C5I A;  1KD1 U;  1UGS B;  2CKK A;  2H3J A;  2LT4 A;  4A54 A;  1XTD A;  2FB7 A;  3X26 B;  2VGM A;  3P8H A;  1VQL T;  2Y90 A;  2LRQ A;  5GMK h;  1XOV A;  1UEB A;  3JCM J;  3UPU A;  3MEW A;  2ZPH B;  1EIF A;  3L42 A;  1JB0 E;  5CQX A;  5GAO m;  3RMQ A;  5FRO A;  4CI0 C;  3NFC A;  1D3B B;  3LH0 A;  5CCA A;  1XQH A;  3O8V A;  2RK1 A;  1BI3 A;  1N6A A;  3I55 T;  2DO3 A;  4PNO A;  3LWI A;  3RER A;  1UGP B;  4OVA A;  1JJ2 S;  3CD6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...