4X9CA

1.4a crystal structure of hfq from methanococcus jannaschii
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
PNFEYARRLNGKKVKIFLRNGEVLDAEVTGVSNYEIMVKVGDRNLLVFKHAIDYIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of RNA-binding properties of the archaeal Hfq-like protein from Methanococcus jannaschii.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Rna binding protein
molecule keywords Uncharacterized protein MJ1435
total genus 10
structure length 57
sequence length 57
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4x9cA00
3RIRA 1H641 2VC8A 4J6XA 2FB7A 4Y91A 5GAOm 5LJ3d 4PJOE 2CGHA 4DQ2A 3JCMV 3V8KA 5LJ5j 5LJ3h 5GANd 4F7UF 4M78E 5GANj 3JCMX 4M7AA 4M7AE 4M77F 4J6YA 1WNLA 5LJ5e 4PJOC 1X01A 2EWNA 3JCMb 4XTXA 3VU3C 3QO3A 5GMKe 5GAN5 4J5YA 5GAOn 3HSBA 4M78G 4M75B 5GAMg 4M7AD 5GAMe 4C92F 3RKXA 4JRIA 4XU2A 5GAN7 5GAOq 4OP0A 3RERA 4C8QC 5GAN2 3SWNA 1YCYA 4F7UG 5GANe 5LJ5h 3JCMW 4HA8A 3BFMA 4PNOA 3V7SA 3EFSA 4M78F 3L1AA 5LJ3e 1M8VA 4RCBA 2K57A 4M75A 1HXDA 2DEQA 4C92A 1I5LA 5GMKi 5LJ5d 1U1TA 2RD1A 5LJ3j 5GANh 5LJ3f 3JB9I 5GANg 4M77G 3AHUA 1LOJA 2YLCA 5GAMd 5GAOp 4XTWA 5GAMh 1LNXA 3FB9A 1I81A 4M75D 4XTVA 1HK9A 2YHTA 4A54A 4M75E 4C92D 4C92E 2E65A 2HNIA 2YLBA 5GMKj 4M7AG 2E64A 3BY7A 3QSUA 5GAMj 4M7DC 2DZ9A 4NL3A 4C92C 4PJOA 4HT8A 4M75C 3JB9H 1WPYA 4EMKA 4M7DG 1BIBA 3RUXA 1B34B 5LJ5g 4EMKC 2DTIA 5GAMf 5CAIA 4M7DB 3SWNC 3V7RA 3JCMQ 4F7UE 4M7AF 2DXTA 2JN0A 3JB9F 5GAN6 3RKWA 3EFRA 4XQ3A 1I8FA 1U1SA 3V7CA 4PJOD 4WF2A 2I2LA 1B34A 4C8QB 4QVCA 5GAN8 3JB9G 2FYKA 4V2SA 4PJOG 3JCMc 5GMKm 4QVDA 3SWNB 5GAN4 4JRKA 2VXFA 4X9CA 4C8QD 5LJ5f 2DVEA 3JCMf 5GAOr 1D3BA 1M5Q1 2E41A 5GAOl 3BW1A 1LJOA 1D3BB 3JCMe 4C92B 3L2ZA 3JCMg 4M7AC 3JCMh 4M7DA 4M75F 3PGGA 4M77A 2RA2A 3QUIA 4J6WA 3V8JA 4N0AC 3V8LA 1KQ2A 4XU1A 4C92G 4C8QA 4C8QG 4M75G 1JRIA 2RM4A 4EMGA 4M77B 4HT9A 3FIFA 2EJGA 2QTXA 3SB2A 3HFNA 4F7UB 3M4GA 4X9DA 1MGQA 2DTOA 4M77D 5DY9A 4F7UA 3HFOA 1TH7A 1WQWA 4M77E 2EAYA 4XTZA 5GMKh 5GMKl 3JCMJ 3FJPA 2EJ9A 4NOYA 3RESA 4C8QF 1Y96A 4M78B 2DKGA 4PJOF 4EMKB 5GAN3 3GIBA 1Y96B 1JBMA 1WQ7A 4M77C 4M78A 2ZGWA 2DXUA 4NL2A 4A53A 4M78C 5LJ3g 4JLIA 2Y90A 4XTYA 5GANf 2E1HA 4M7AB 2RB6A 4XU0A 3QHSA 1N9RA 4M7DE 4XTUA 2DTHA 1KQ1A 4JUVA 3JCMP 2DJZA 2E10A 4MMKA 3RKYA 3JCMd 4M7DD 4M78D 1N9SA 1I4K1 3INZA 3JB9J 2EJFA 2DZCA 5I21A 4M7DF 3BDUA 4MMLA 4PJOB 2VXEA 4EMHA 4C8QE 4N0AA 3JB9D 1BIAA 4RCCA 4XU3A
chains in the Genus database with same CATH superfamily
1H641 4PJOE 2XG8D 3UPUA 1NEGA 1MHNA 4M77F 4UC4A 2HMAA 2OTJT 1VQPT 2QK0A 4FYWB 1WA7A 4ESRA 3SHWA 4RTXA 1UECA 5A0GA 3QBYA 1B7TA 5IAYA 2H8HA 2K4YA 4AG1C 1VQ7T 3MEVA 2KBTA 5LJ3f 1BB9A 1Q86C 2FZGB 3A1PA 1QVPA 2QEXQ 3MKDA 4BI3A 1ZQ1A 2YLBA 3QWYA 2CUDA 1BKBA 3OA6A 3KUFA 1ACMB 3E9FA 3KXTA 4EMKC 2VWFA 3QDFA 1VYTA 4LDVA 1QVGP 2AKLA 2AK5A 3PVQA 4WF2A 3JB9G 3X28B 2K3XA 1VQPA 3CBPA 3UWNA 2GBQA 4C0ZA 2LQ8A 4EIKA 3CMEA 2DA9A 2YXYA 2RQTA 1TUDA 1YJ9A 4FT2A 1BI0A 3LLRA 1VIFA 5FW9A 3CCMA 3QIIA 4BY6C 3SB2A 3FLGA 1WHLA 2BIVA 3MHXA 3RESA 4R55A 2YRDA 4FU6A 2YRCA 1YJWA 2LC4A 3VYGA 2C06A 3QHSA 2LMJA 4AT1B 3L2UA 4JRPA 4JLGA 5I11A 1UG1A 2L3RA 1M3BA 1PD0A 1WI7A 2PNIA 2PUKB 1SPKA 2MK5A 3OYGA 2X4JA 1IGUA 1U3OA 4Y91A 1ZHIA 5GANj 1TG0A 3RDVA 4J9IA 1YI2Q 4KGVB 4L6V5 2M0OA 2HKNA 2K5FA 3RKXA 2K3YA 1IZ6A 3RERA 4JDSA 1R0BG 1SHFA 4J9DA 1GFCA 8ATCB 3X25B 2JM9A 3QDRB 1RAGB 5I2MA 2O4XA 4ELZC 3L2WA 2QXFA 2QDLA 1M3CA 1LOJA 2CP5A 2E12A 3G1JA 2KI7A 4AFQC 2KK4A 2YHTA 4ZGEB 3A98A 2AHJB 1UGRB 2DM1A 3A8LB 1MMDA 4EMKA 2PTKA 1D1BA 5CK9A 1K0XA 1WFWA 1EX4A 3U23A 2E6ZA 5GAN8 1B34A 4B6MA 1TWBA 2KDSA 3OW2P 2DILA 1QMCA 5J26A 2GF7A 1NLPC 3C4SA 3M59A 3QUIA 4JJCA 3V8JA 3CMAA 1LCKA 2EGAA 2KYMA 4BY6B 4C8QA 2ABLA 3S3MA 1AHJB 4JRQA 4F7UB 5GAOq 2HBPA 2EAYA 4RG8A 4C8QF 2DKGA 4F16A 4JS5A 1QLYA 4IIOA 1VQ9A 3H6ZA 1CKAA 1Q81R 1Q86U 3UATA 2DL7A 2J6FA 4Y92A 2YUPA 1YNZA 2ROTA 2P0KA 1BIAA 3CBMA 5GAOm 1BK2A 1NYGA 4M78E 1VA7A 1OZ2A 3RNJA 2HCKA 3UA7A 1WNLA 2HKQB 2RJCA 1RADB 1TUGB 1D0ZA 1M9SA 4K11A 3KBGA 1SHGA 2RI2A 3RMSA 3I56Q 4J5YA 2EKHA 5GAOn 4M7AD 2RO0A 2CUBA 2L8DA 2XI9A 1N8RU 4PFOA 3OYLA 3TREA 1SSHA 1D0YA 1YCSB 4FL6A 2DYIA 3OW2A 5GMKi 4AFSC 2K7AA 4M77G 1W4SA 2CP0A 2QTVA 2IVWA 2YWWA 4XTWA 5GAMh 2JOYA 1M3AA 3CD6Q 1D0XA 4GLMA 5I22A 2HSPA 4PJOA 3OW2S 3ER0A 4AFZC 1VQNQ 2F1LA 2ZPBB 2BZXA 2EYQA 3JCMQ 2HEQA 1UB4A 1S1NA 4IUUA 5CCAA 2O88A 1VQMA 1M90U 3JCMf 1TOVA 1VQMQ 1D1AA 5IXFA 3EHQA 3M4YA 3SEMA 1K8AC 4RTUA 1H8KA 3P8HA 5IHKA 4HT9A 2LJ1A 3CCRQ 1WDXA 1E7OA 2FRWA 2DYBA 2X51A 1GL5A 3CCRA 2RQWA 1VQ4A 4JS4A 1VQOA 4ME7A 2DF6A 1JXMA 2CP3A 1AWOA 1M1GA 4HVWA 1GRIA 4FT4A 2DZCA 4QQDA 2A37A 5EG2A 2NYSA 1VQLA 2ECZA 1KQSS 3DB3A 5DLOA 2DRKA 4KUIA 2F2VA 1VQOT 2IG0A 2G6FX 2D8HA 2RMOA 3H8ZA 1SRLA 4KGXB 2M1HA 3G71A 2PVDB 2IPOB 2E3HA 2C0IA 3BDLA 3M0PA 3R6NA 2CT3A 3LH5A 4C8QC 2ZPIB 5GANe 1KQSA 3BFMA 1I1JA 5L23A 3OYBA 3JRZA 3JB9I 1OPLA 2RJDA 1G8XA 4PJNA 2DL5A 3REBB 1OZ3A 3CPWP 2KNBB 2E6NA 2HNIA 1VQ6A 3CQTA 3CCLA 4OGCA 1IB8A 4RTWA 1EZZB 2JN0A 2ZAEA 4VUBA 3EFRA 1N27A 1MV3A 1AEYA 1G3TA 4OMLA 4OMFB 4QVCA 1YFNA 2EGCA 2W10A 4E7LA 1QCFA 5GAN4 3QJ6A 4C8QD 5GAOr 3LGLA 5GAOl 2QQBA 5CKFA 4C92B 2KRSA 2WSCE 3PGGA 3RR6A 2J6KA 2EGEA 2JS2A 1VQ8T 4EMGA 1Y71A 2ZZDA 1VQ8Q 3QZ5B 3HFNA 1XOVA 3M4GA 4M77D 4M7DG 1TH7A 2EQJA 3LYIA 3S6WA 3NPFA 5FWCA 4AG2C 4NL2A 1M1KC 1OX8A 5KYUB 5LJ3g 2KRNA 3CC7Q 3ZBDA 3OYNA 1HD3A 2YUQA 2CREA 4KGZB 2F5KA 3L2QA 4M7DF 1NJIR 1IRXA 4LUEA 2VC8A 3VUZA 2VKNA 1DJ7B 4BD3A 4M7AE 2EPDA 1AZEA 4E7IA 1HSQA 1UFFA 2PU9B 3QO3A 1E6HA 2DL3A 3CC2Q 2OX7A 2RPNA 3S3NA 3SFMA 1K4US 4F7UG 3I35A 1E6GA 4LDUA 5HCKA 3PIPA 5LJ3j 1M90C 2KXCA 1W2BP 1X75C 3P8DA 1ABQA 1VQKQ 3VS6A 2EYZA 5KYWA 4LE9A 2CH4W 4HCBA 3MJXA 1JJ2P 2LQWA 5J3BA 1ZBJA 4OGEA 1IREB 3SWNC 2BTTA 4RKUE 3VS7A 2EQUA 1P92A 1Z9QA 1N5ZA 2XMFA 5LL6S 1OQKA 1GBRA 3TSWA 5GMKm 1PKTA 3EG1A 3PT9A 3GPLA 3OYEA 2EQMA 1FWZA 1X43A 2FRYA 3BW1A 5FRNA 2LNVA 2E70A 3CMET 2NUTB 3EGUA 3G6EQ 1N8RC 4JJNK 2RM4A 2DERA 1KSWA 1X6GA 4M7DD 5GMKl 2MWOA 1JQQA 4F17A 6AT1B 1M8MA 1UGVA 2L3SA 4M77C 2JTMA 3HRUA 4A4KA 3CMAQ 1FX7A 2EQKA 4JLIA 4LDWA 2JMAA 3C12A 2DTHA 3EFOB 1ZA1B 1YBYA 4E7SA 1UE9A 4FCYA 2I0NA 1OPKA 4PJOB 2FL7A 2VXEA 4FM4B 1VQ9T 4XU3A 1TSFA 2EFIA 5GANd 1YWPA 4FYVB 4ZN3A 4PJOC 2RNAA 1Q7YC 1Q95G 4BI4A 3FC3A 3CMEQ 3P8BB 4GLKA 2DXBA 1BCOA 1M1KR 4ORZA 5GJVB 2LCLA 3HKSA 2AIRB 3A5ZB 1GCQA 1C1AA 1I5OB 3CC7A 3AHUA 2LJ0A 3EGDA 1K76A 2L89A 3THKA 5GAOp 2LP5A 1SSFA 4D8KA 1YITQ 2QA4T 1HK9A 4M7DB 5GMKj 3CCMQ 4CC2A 2DZ9A 2ZCFB 5KYXA 3J80E 4F7UE 1FXXA 1OU8A 2CKKA 5FU6C 3FRNA 2KAFA 3OYHA 2XDPA 4QVDA 4J9FA 2DRMA 1RAIB 3WVEB 1RAHB 3ME9A 1M5Q1 4DBQA 2QEXA 2XKOC 3QXEB 1KQ2A 2V8JA 1PM3A 4GBQA 2DIQA 2NUPB 3HRTA 4HT8A 2LRQA 4J7IA 3M53A 1JXOA 4A53A 1XNIA 4CC3A 2DIGA 2DXUA 2AZVA 2E1HA 4M7AB 4L5GA 1N9RA 1PSFA 1U06A 1K73R 1NG2A 1Y07A 3JCMP 4MZPA 5KH6A 3DB4A 3CCUQ 4Q5WA 2RK2A 2KQWA 4RCCA 3CCJT 4BB7A 4DOWA 4RTYA 3OYCA 2R5AA 5KYYB 1S72T 4J9EA 1X01A 1ZBXA 2F2WA 2M9UA 3CCSQ 3CCVQ 1BU1A 1WYXA 2DXCA 5GAMg 5C0MA 5KYYA 4OP0A 3GBQA 3A8MB 4RCBA 1NYFA 1XQHA 1HXDA 2DEQA 4O5VA 1S72A 7AT1B 2BZ8A 2CP6A 4DA4A 1BBZA 3HHTB 2FZKB 4IKFA 4A54A 4KT0E 2YDLA 3E19A 2R5MA 3MCAB 4M7AG 3EGXB 2SEMA 4DBFA 4A4HA 2MMPA 4KUDK 1RUWA 4NS5A 3HL8A 1ZSZC 5DM7R 2DD4A 2RK1A 3M0TA 1TS9A 1ZX6A 4V2SA 2SRCA 2LCSA 4MDWA 1U8RA 3F70A 3GF5A 1AZGB 3VUBA 2OTLT 1PSEA 3OSVA 3REAB 4R0KA 3JCMe 3CC2T 2G3RA 2QGFB 4CI0C 4M7DA 2CYZB 1TUCA 3OYDA 3V8LA 5A0DA 1R77A 2HBWA 4DBRA 2VGMA 3E9GA 3X20B 1VOMA 1KC8R 1G3WA 5KE2A 4J9CA 4F7UA 5FRMA 1YITA 1AD5A 4NOYA 1K8AR 2DL8A 4IUPA 2XU8A 3EH2A 1JBMA 1WQ7A 1Q81C 1V29B 4XTYA 3OYMA 3CCQT 1QWEA 4HVUA 3JCMd 1UJ0A 2CP7A 1BI2A 4HCCA 1K0SA 1WIEA 1ZA2B 1W1FA 1VQ7Q 4M7AA 3V8KA 5LJ5j 2P0PA 1WXTA 2RJEA 2OTLA 4E47A 3G4ST 1MUZA 2QEXT 4CRIA 2B8AA 2GQVA 2OTLQ 3VU3C 1BI1A 2XIDA 1VQNA 2BE9B 1G3SA 2AKKA 4JRIA 3ZFJA 1M1FA 1NPPA 4ZGDB 5GAN2 3CXCP 5LJ5h 4HA8A 2DL4A 4J83A 3V7SA 4ZN1A 2EYWA 2K57A 2Z0WA 2DLPA 1KIKA 3M0SA 2V26A 5KYUA 3NHNA 2F5TX 1M27C 4OMQA 1YI2T 2CZ0B 3S3OA 2CZ1B 1PRMC 5CO7A 4M75E 3CC4T 3EG2A 1VQPQ 1R0CB 3CCUA 3BY7A 3LWIA 1ZSGA 3C95A 5IH2A 3CC4Q 3MEUA 3NTKA 3CC4A 4RTZA 1Q82U 4BE2A 4RMOA 3OBWA 3OY9A 2L3PA 3I55T 2LVMA 1SG5A 3I55Q 5LJ5f 2DVEA 5A0LA 3CCET 3I9QA 3CCJA 1QVFS 1D3BA 4N4HA 1FMWA 4FYXB 1G2BA 4PJMA 5CR2A 1YJWQ 2GFAA 4XU1A 4BE0A 4LNPA 5KE3A 2QG9B 1KD1C 1T3LA 2DK3A 1KG1A 4EMKB 3VJPA 1QVGA 4M7DC 2RB6A 5FWBA 1O9SA 1D09B 4XTUA 1AT1B 1PHTA 2DJZA 4PJLA 2A36A 2CDTA 3JB9J 4PLIA 3VV0A 1VQ9Q 3CCLQ 3Q1JA 5A2QE 1YIJA 3JB9D 1QVGS 3CCLT 1N6AA 1YHQA 2KY9A 3JCMX 1O75A 1B07A 5FROA 2J7IA 5GAN5 5FLXE 1KC8U 1VQ5Q 4ATOA 2MF2A 5J39A 1YJWT 3KFVA 1K8AU 2HL5C 3CPWA 1UGSB 4Z89A 1RI0A 4HXJA 2FPEA 3C94A 1WHKA 4QT7A 2JT4A 2DX1A 2QA4A 2MPXC 5FU7B 2O31A 5GANh 1X2KA 2QGGA 2QA4Q 2D9TA 2EYXA 4C92D 4A4GA 3CPWS 3NTIA 3QSUA 1UDLA 4QKUA 5CVIA 1QVFP 3CD6A 2FHDA 2RQVA 1VQ8A 1WPYA 1K9MR 1JJ2S 1BIBA 2O9SA 2Y4XA 4A4FA 5IT9E 1OU9A 4OMOA 4EPCA 2DXTA 3UA6A 1AWXA 1TXQA 1PG5B 3OMCA 2CP2A 3M5AA 4PJOG 4L59A 3CCQA 2L3QA 3PNWC 1CSKA 2WSFE 2DETA 3CD6T 1JJ2A 2GFUA 4M77A 1MMNA 3N5BB 3CPFA 5D6XA 2CS7A 2KXDA 4N4GA 1W2BA 2X4XA 2YUOA 1WQWA 1K73C 4II1A 3QWXX 1YJNT 3OYKA 2J6OA 3OQ5A 1Y96A 4M78B 3GIBA 4MDXA 3I5RA 1TTHB 4J8OA 2VB6A 2QQAA 1FYNA 1KHCA 1VQKA 4MMKA 2E3IA 2LTOA 2VASA 4M78D 1VUBA 1YWOA 5L8RE 4FYYB 3RIRA 3VYHB 4J6XA 1Y7XA 2GQIA 1MNEA 5LJ3h 3PMIA 2H3EB 1RL2A 2ENMA 2K79A 1QCOA 3PVLA 3H0HA 1KK7A 3OMGA 2MAMA 3A8GB 4FW1A 4C0DC 2KT1A 2X9HA 4XU2A 2LZ6B 3G71Q 2A0FB 2J05A 1PD1A 1GCQC 3G71T 2CZ7B 5LJ3e 4DEYA 5AYFA 1Q7YR 2WSEE 3CCSA 3CCVA 2JTEA 2YT6A 2GGRA 4ZTFA 1UGPB 4F04B 1UJYA 1R8OB 4HCZA 4E7HA 2ZPFB 2FZCB 1NZ9A 1U5SA 1T3SA 4WCIA 2Y4YA 2OI3A 4ZGJB 3O5ZA 2CSQA 4PK4A 1Q82R 3MEWA 2LT1A 3V7CA 3G4SQ 4D8DA 1AWWA 2VUBA 2XDDA 1G5VA 2X4WA 3GNGA 1LJOA 5D6YA 2PVOB 1RABB 4ANJA 2EQIA 2NUZA 4N0AC 1VQ4Q 2M02A 2DO3A 4M75G 1WZOA 1K9AA 3A8OB 4M77E 1I0CA 2HL3A 3FJPA 4IUVA 2LX9A 1RAAB 2OTJQ 1YJ9Q 1NJIC 2Y90A 1FMVA 1YJ9T 3NFCA 2K5IA 4JUVA 2D0NA 1QQJA 2KGTA 5IN1A 3TSZA 2L2PA 2NWMA 2PUOB 4C5EA 3MO8A 1GBQA 4OF1A 8AT1B 3EG0A 3VRYA 3JCMb 3J81E 2RHXA 5CKDA 5HKCA 1KC8C 3HPWA 3LH0A 3NTHA 1UUEA 2XK0A 4M4ZA 4ZNXA 2FPFA 3A8HB 1VQ6T 1B3QA 1VQ4T 1VQ7A 4HVVA 3AT1B 2FG0A 3M0QA 1ZUYA 2XD0A 1VQ6Q 2QYZA 1QP3A 4IIMA 3WXMB 1PRLC 3CCUT 1YI2A 1M8VA 3FEOA 3NMZC 1IO6A 3M54A 2VVKA 3G7ZA 5CQXA 5GANg 2RQRA 3EGDB 4F14A 3FB9A 1I81A 1Y0MA 2YRVA 3OS5A 2ZPHB 3CXCA 1RAFB 4QVZA 2YSQA 4E7ZA 4A4EA 4M75C 2V1QA 1X2QA 2PVGB 4KH1B 2GTJA 1J3TA 1WXBA 2EKOA 1AWJA 2M0YA 4C8QB 2HQHA 1WJQA 4PLLA 3BE3A 3SWNB 3UDCA 2W0ZA 2K9GA 2BZYA 3ULRB 3FDRA 1XJWB 2RHUA 4OB2B 3RMQA 3L2ZA 4M7AC 4C0FA 2X35A 1T0HA 4C5HA 2PQWA 1OX9A 2DD5A 2VGNA 1HJDA 2NUTA 4OB0B 2K2MA 2LDMA 3OB9A 1WLPB 2NUPA 3MPUB 2L5QA 1M2VA 5CQYA 3TEEA 2RQUA 4XU0A 2CH4A 2X3XD 1MNDA 3OS1A 4BDYA 1HYOA 1GCPA 1N9SA 1I4K1 2P0QA 2ED1A 2V8KA 3D7SB 1W70A 3I5SA 1M30A 5LJ3d 2KT8A 2RH2A 1ZSZB 2A7YA 2CZ6B 5HY6A 4J6YA 1VQ5T 4X34A 1SF9A 4EDUA 4C92F 1YIJQ 5I2SA 1LVKA 4E6RA 1MMGA 3L2VA 1YCYA 2KMTA 1UTIA 2DAQA 3L1AA 2MI6A 1GXIE 1PCXA 3DKMA 1I5LA 1TU0B 3EFOA 1N8RR 1T0JA 1YJNQ 3SD4A 4E2FB 1M1KU 1H92A 3T9NA 3UT1A 3HTRA 4KBMB 1EIFA 1VIEA 1YJNA 4C92E 2KEAA 3PTAA 2FEIA 1Y57A 2FVUA 4KULA 2QI2A 1QVFA 1WHHA 3UF4A 3RUXA 1OI1A 4R56A 1B34B 5CAIA 4BDZA 4BACA 3G6EA 5GAN6 4LD9K 4XQ3A 2BE7D 5C6SA 2X4YA 2X3WD 3EG3A 2KR3A 3CMAT 2JS0A 3M57A 2BUDA 2MYSA 2IIMA 1UHCA 1M90R 3JCMh 1SKUB 1Q82C 4J6WA 2HZYA 4RG2A 4C8QG 1VQNT 2KE9A 2EJGA 3HFOA 1UHFA 4ELYC 3JCMJ 4OB1B 2JVVA 2BKDN 5CKEA 1OYXA 3JB9F 5GANf 1X27A 1WX6A 5KCOA 3J7AF 2ZPEB 3RKYA 1PC0A 5KYNA 2DJQA 3OYAA 3INZA 3G6ET 2EJFA 5I21A 4LDXA 3BDUA 4EMHA 3OYYA 2FB7A 4OB3B 3CCRT 3EG9A 3TCJA 2P4TA 3L42A 4DOVA 2ED0A 2A08A 1A0NB 2LQKA 4J9HA 5GMKe 4LUDA 3EAEA 3M58A 2DE0X 3QPHA 3FJ5A 1JEGA 5GAMe 3VS5A 3M0UA 2A28A 4PKCC 1ZSZA 4PFPA 3I55A 2O4XB 4C0GA 1IGQA 1LPLA 3CCJQ 5LJ5d 1M2VB 3NGPA 1S72Q 2M16A 1VQMT 5CKBA 5M9OA 5ECAA 2NLUA 4M75D 2LNHB 4LN2A 4NL3A 1SEMA 3O8VA 3GNFB 3VKIA 1X69A 2KROA 3DLLA 4M7AF 2DFUA 3RKWA 4OVAA 3LGFA 2ZPGB 2I2LA 3QYHB 1Q7YU 2EW3A 1JU5C 3QKJA 1W2BS 1WHGA 2EBPA 4MZMA 2R58A 4JRKA 1EFNA 2VXFA 1AOJA 1D3BB 4LXCA 2MWPA 4Z02A 2J06A 3JCMg 1YITT 3QYGB 3EHRA 3LWHA 1V1CA 5CKHA 4JJDA 1VQ5A 2QAZA 4OMNA 3G4SA 5HK0A 1SRMA 1X6OA 2QTXA 4RTVA 4X9DA 4D6WA 4XTZA 2JJ9A 4DBHA 2LX7A 1UGQB 1VQOQ 1WJSA 3LX7A 2MCNA 2ZGWA 1H3ZA 3JSCA 2KSSA 1G83A 5FU7C 1Q81U 1Q86R 2DBKA 2LT4A 3M56A 4LDYA 3E1SA 3MP1A 4C8QE 4N0AA 1ARKA 4IUTA 4DQ2A 2GCXA 2MIOA 2C0TA 4F7UF 1VQKT 2OAWA 3C0CA 3DLMA 3X24B 1AVZC 2D6FA 3OS0A 4AMCA 4CC7A 3CCQQ 1MMAA 2XHCA 4M78G 2K6DA 3QJYA 4FSSA 1G3YA 4CC4B 1C6VX 2A3LA 2FPDA 4PNOA 4M78F 4AFUC 4OMMA 4C92A 1QW1A 1U1TA 2RD1A 2JTFA 3VS1A 3CEYA 2YLCA 4IUQA 2V8IA 1LNXA 2EIFA 2QQSA 2KRMA 1W6XA 1GFDA 2H3JA 3M55A 2E64A 2RN8A 2OAUA 3MP8A 4Y28E 4B9WA 2JM8A 2JZ2A 4TVRA 2DBMA 5LJ5g 3JV3A 4KH0B 1I8FA 4XK8E 4JPBW 4PJOD 4B9XA 3JCMc 3I56A 1H3HA 1YHQT 3CC7T 2E41A 1ZLMA 1RACB 4HKEA 4M75F 4WTOB 1VQLQ 4X1VA 1IHWA 1Z9ZA 1FMKA 4C92G 1VQLT 4J7FA 2E4HA 2COWA 2ROLA 4RUGA 2D1XA 5GMKh 2CT4A 2D8JA 4P5NA 1OULA 2C0OA 2XDBA 4FW2A 2HQXA 1Y96B 4M78A 4M78C 3CCEQ 3L2RA 2F2XA 3WVDB 2XICA 3VRZA 2E10A 4QQGA 3HRSA 3OSSC 2FO0A 4JJBA 1ABOA 3TVTA 1JO8A 2D0QB 2M51A 2VV5A 2COYA 2KVQG 2O9VA 1ZUKA 2JXBA 3JAME 2HDAA 3VS0A 3ZEHA 5LJ5e 2EWNA 3CC2A 2YUNA 1YHQQ 4DEXA 1NEBA 1UEBA 4M75B 3LW5E 2E5KA 2LCCA 3CXCS 3X26B 4C0DB 2DPPB 4JZ4A 5IHIA 3SWNA 3JCMW 4RTTA 4A63B 1OV3A 1D1CA 1OEBA 2K3BA 3EFSA 2K2VA 3OYIA 4M75A 4PFZA 1I07A 2AZSA 2HSEB 1K9MC 3M9QA 1KFZA 5GAMd 1RAEB 4QQ6A 4YTLA 2PZ1A 4XTVA 3VS3A 3SDZA 1CKBA 1KD1R 2OTJA 2LQNA 2QDYB 4C92C 1WHMA 3VS2A 5KCHA 1NPRA 3OYFA 4Z8AA 1M2OA 1RI9A 3V7RA 1KD1U 3META 1M4ZA 1BCMA 1WJRA 5GJWB 3URGA 3MP6A 2DVJA 3PFSA 2JW4A 3PE0A 4BI8B 1KHIA 2DEUA 4QW2A 3EG9B 4E7JA 4PJJA 1X6BA 3GP8A 3HP9A 4J9GA 5CIUA 1BI3A 2OJ2A 1JRIA 3OYJA 2EYYA 1K9MU 4M77B 3OBYA 3FIFA 3PMTA 1WGSA 1MGQA 2DTOA 1NM7A 1MV0B 5GAN3 3ZL7C 2ATCB 1V76A 4M7DE 4C5GA 1YP5A 1KQ1A 4GY5A 2QASA 4J9BA 5AT1B 4HCKA 2RF0A 3PIOA 3H41A 3QZ9B 4FIBA 1QWFA 2JUFA 1K1ZA 1QCNA 2O2OA 2RHIA 4MMLA 2GTOA 4O6JA 5GAMj 3E2UA 3GLXA 2CGHA 3JCMV 4BE1A 4Z88A 5KYXB 2WACA 2B86A 2HD0A 4XTXA 3CCMT 2RJFA 9ATCB 3H0FA 1KQSP 1IHVA 5IHNA 3HSBA 3TU4K 3I56T 5GAN7 1NJIU 4MZTA 1WHJA 4FSXA 2V1RA 3EGXA 3H0IA 5DLQE 3RBBB 3CBOA 2QQRA 1ZUUA 2RHZA 3MEAA 3QG1A 2F69A 3CCEA 4KRTA 2R57A 3M0RA 2GNCA 3EH1A 2E65A 3CCST 3CCVT 1VYVA 5FU6B 2JNGA 5HK3A 1C0MA 4N4IA 3JB9H 2HQEA 1YIJT 4ZTJA 5D6WA 1OOTA 1YN8A 2DTIA 5D7UA 2P4RA 1PNJA 1QKXA 4PL6A 1VYUA 1F1BB 1U1SA 1PKSA 2AT1B 3R6OA 1RLQC 2FYKA 4BUGA 2DNUA 2E5QA 2RHYA 1K73U 4X9CA 4E7KA 1BYMA 4JZ3A 5EC7A 3GOXA 5KYWB 2RA2A 2DMOA 2ESWA 2L0AA 2LJ3A 3IQLA 2JMCA 1NBEB 1NLOC 4IURA 1JB0E 5IXBA 1WXUA 1QP2A 2QQ9A 5DY9A 1IXDA 4LD6A 1KJWA 2EJ9A 4PJOF 2HAXA 2MOXA 3OS2A 3ASKA 4C5IA 2VYTA 2RI3A 1PWTA 2EVRA 1XTDA 2COZA 2K5LA 4OMPA 2KYBA 1NE8A 1QKWA 3VS4A 2O01E 2RI5A 4XAXB 3H9NA 1RLPC 3TQ7P 2CSIA 5GAMf 2P84A
chains in the Genus database with same CATH topology
1H641 2VC8A 3CCLT 1N6AA 2FB7A 2XG8D 3VUZA 3UPUA 4PJOE 4OB3B 3CCRT 1DJ7B 4BD3A 1YHQA 1MHNA 3TCJA 2KY9A 2P4TA 3JCMX 4M7AE 1O75A 3L42A 4M77F 4DOVA 4UC4A 5FROA 4E7IA 2LQKA 2OTJT 2PU9B 1VQPT 3QO3A 5GMKe 3EAEA 5GAN5 5FLXE 1KC8U 3M58A 3QPHA 4ATOA 2MF2A 5J39A 5GAMe 4PKCC 3S3NA 3SFMA 1YJWT 4F7UG 1K8AU 3CPWA 1UGSB 1RI0A 5A0GA 3I55A 3C94A 4LDUA 3QBYA 2O4XB 4C0GA 5IAYA 2QA4A 2K4YA 5LJ5d 3PIPA 1VQ7T 3L2VA 3MEVA 5FU7B 5LJ3j 1M90C 5GANh 5LJ3f 1Q86C 1X75C 1QVPA 3P8DA 2M16A 1VQMT 5CKBA 2D9TA 5M9OA 2NLUA 4M75D 4BI3A 4C92D 1ZQ1A 2YLBA 4A4GA 4HCBA 3CPWS 3NTIA 1BKBA 3OA6A 3QSUA 5CVIA 4NL3A 3KUFA 3CD6A 2FHDA 1VQ8A 3O8VA 5J3BA 3GNFB 1WPYA 4OGEA 1IREB 1BIBA 3VKIA 1JJ2S 3E9FA 3KXTA 2Y4XA 4A4FA 4EMKC 5IT9E 3SWNC 3DLLA 4M7AF 4EPCA 2DXTA 4LDVA 3RKWA 4OVAA 4RKUE 2EQUA 3OMCA 1P92A 3LGFA 2ZPGB 2I2LA 3QYHB 4WF2A 5LL6S 3X28B 2K3XA 3JB9G 1Q7YU 3M5AA 4PJOG 3QKJA 1VQPA 4L59A 5GMKm 1W2BS 3CBPA 3CCQA 3UWNA 4MZMA 2R58A 3PNWC 3PT9A 4JRKA 2VXFA 4C0ZA 3OYEA 2LQ8A 3GPLA 2EQMA 3CMEA 2WSFE 1FWZA 3CD6T 3BW1A 1D3BB 4Z02A 2MWPA 1JJ2A 5FRNA 3JCMg 1YITT 2LNVA 2E70A 3QYGB 3CMET 2GFUA 4M77A 3LWHA 1YJ9A 5CKHA 3N5BB 1N8RC 4JJNK 1VQ5A 4FT2A 1BI0A 3LLRA 3CPFA 1VIFA 3CCMA 5D6XA 3G4SA 2CS7A 5HK0A 2RM4A 1X6OA 3QIIA 4N4GA 4BY6C 1W2BA 3SB2A 2QTXA 3FLGA 4M7DD 4X9DA 2X4XA 4D6WA 2BIVA 5GMKl 1WQWA 1K73C 2MWOA 4II1A 4XTZA 3MHXA 3OYKA 1YJNT 3OQ5A 3RESA 1UGQB 1Y96A 4M78B 4A4KA 4R55A 3GIBA 4MDXA 1WJSA 3LX7A 4M77C 4J8OA 2ZGWA 2JTMA 3HRUA 3JSCA 1FX7A 2EQKA 2KSSA 4FU6A 4JLIA 2LC4A 2QQAA 3VYGA 1YJWA 4LDWA 2C06A 3QHSA 1KHCA 4JRPA 3C12A 2DTHA 5FU7C 3L2UA 4JLGA 1VQKA 1YBYA 4MMKA 1Q81U 2LTOA 2L3RA 2LT4A 4M78D 3M56A 4LDYA 3E1SA 1VUBA 4PJOB 3MP1A 2PUKB 2FL7A 2VXEA 4FM4B 5L8RE 4C8QE 4N0AA 3OYGA 2X4JA 1VQ9T 4XU3A 3RIRA 3VYHB 4J6XA 4IUTA 4Y91A 1ZHIA 1Y7XA 4DQ2A 2EFIA 2GCXA 5GANd 5GANj 5LJ3h 3PMIA 4F7UF 1RL2A 1VQKT 4ZN3A 4PJOC 3DLMA 3X24B 1Q7YC 4L6V5 2D6FA 3OS0A 3OMGA 2XHCA 2M0OA 4M78G 2MAMA 2K5FA 3A8GB 3QJYA 4BI4A 4C0DC 1G3YA 3FC3A 3P8BB 4GLKA 4XU2A 3RKXA 2DXBA 2K3YA 1IZ6A 3RERA 2A3LA 4JDSA 3G71T 4PNOA 2CZ7B 4M78F 5LJ3e 3X25B 3QDRB 5AYFA 2LCLA 3HKSA 5I2MA 4C92A 1QW1A 2O4XA 3A5ZB 1U1TA 2RD1A 2WSEE 4ELZC 3L2WA 2JTFA 3CCSA 2QXFA 3CCVA 3CC7A 3CEYA 3AHUA 1LOJA 2YLCA 2L89A 5GAOp 2E12A 4IUQA 2V8IA 1LNXA 2EIFA 2QQSA 1UGPB 1SSFA 4ZTFA 2KK4A 2QA4T 1HK9A 2YHTA 5GMKj 4M7DB 1R8OB 2H3JA 3M55A 4ZGEB 2E64A 2AHJB 1UGRB 2OAUA 3MP8A 2DZ9A 4HCZA 4Y28E 4B9WA 4E7HA 2ZPFB 3A8LB 1NZ9A 2ZCFB 4EMKA 2JZ2A 4TVRA 2Y4YA 3J80E 5LJ5g 5CK9A 4ZGJB 4F7UE 1FXXA 2CKKA 5FU6C 1I8FA 3FRNA 3MEWA 4XK8E 2LT1A 2E6ZA 3V7CA 5GAN8 2KAFA 1B34A 4B9XA 4PJOD 3JCMc 3OYHA 2XDPA 2KDSA 4QVDA 3I56A 2VUBA 2XDDA 5J26A 1YHQT 3CC7T 3WVEB 2GF7A 1G5VA 3ME9A 2X4WA 1M5Q1 2E41A 3GNGA 1LJOA 5D6YA 2PVOB 3C4SA 4HKEA 4M75F 2QEXA 3M59A 3QUIA 5GAN2 2XKOC 3V8JA 3CMAA 4N0AC 3QXEB 1KQ2A 4BY6B 2DO3A 4C92G 2V8JA 4C8QA 1VQLT 4M75G 3S3MA 2DIQA 4J7FA 1AHJB 4JRQA 4F7UB 3HRTA 4HT8A 5GAOq 2LRQA 2HBPA 5GMKh 3A8OB 4M77E 2EAYA 4RG8A 4P5NA 3FJPA 4IUVA 4C8QF 2LX9A 4J7IA 3M53A 2XDBA 2DKGA 2HQXA 1Y96B 4M78A 1XNIA 4A53A 2DIGA 1NJIC 2DXUA 4M78C 2Y90A 2E1HA 4M7AB 4L5GA 3L2RA 1YJ9T 1N9RA 1PSFA 3WVDB 2XICA 3NFCA 4JS5A 2K5IA 1Y07A 4JUVA 3JCMP 2E10A 1VQ9A 3H6ZA 4QQGA 3HRSA 5KH6A 1Q86U 3DB4A 3OSSC 5IN1A 4Q5WA 2RK2A 2PUOB 2KQWA 4C5EA 2P0KA 1BIAA 3CBMA 3MO8A 2VV5A 2D0QB 4RCCA 3CCJT 2KVQG 5GAOm 4BB7A 4DOWA 4OF1A 3JAME 4M78E 1OZ2A 3OYCA 3ZEHA 2R5AA 5LJ5e 1WNLA 1S72T 2RJCA 1M9SA 1X01A 2EWNA 3JCMb 3J81E 3CC2A 3KBGA 2RHXA 5CKDA 1ZBXA 2RI2A 2M9UA 3RMSA 4J5YA 5HKCA 5GAOn 2DXCA 3HPWA 3LH0A 1KC8C 1UEBA 3NTHA 4M75B 3LW5E 2XK0A 5GAMg 4M7AD 5C0MA 2RO0A 2L8DA 2LCCA 2XI9A 5A2QE 3CXCS 4OP0A 3A8HB 3X26B 4C0DB 1VQ6T 2DPPB 1VQ4T 1N8RU 3SWNA 1VQ7A 3JCMW 2XD0A 3OYLA 3TREA 3A8MB 3EFSA 1QP3A 3CCUT 3WXMB 1YI2A 4RCBA 1M8VA 2K2VA 3OYIA 4M75A 1XQHA 1HXDA 2DEQA 4FL6A 4O5VA 3FEOA 3OW2A 5GMKi 1S72A 4DA4A 1K9MC 3M54A 3M9QA 3G7ZA 5CQXA 5GANg 4M77G 1W4SA 3HHTB 5GAMd 2IVWA 4XTWA 4IKFA 5GAMh 3FB9A 1I81A 2JOYA 2YRVA 3OS5A 4QQ6A 4YTLA 2ZPHB 4XTVA 4KT0E 4QVZA 3SDZA 4A54A 3CXCA 3MCAB 3E19A 2R5MA 4A4EA 4M7AG 2OTJA 2QDYB 4C92C 4PJOA 4M75C 4A4HA 2MMPA 4KUDK 2PVGB 5KCHA 4NS5A 3HL8A 1NPRA 3OYFA 3OW2S 5DM7R 3ER0A 2ZPBB 2EYQA 3JCMQ 3V7RA 1KD1U 3META 1M4ZA 1UB4A 2DD4A 2EKOA 2RK1A 4IUUA 5CCAA 1WJRA 4C8QB 3URGA 3MP6A 4V2SA 4MDWA 1WJQA 4PLLA 1U8RA 3PFSA 1VQMA 3F70A 3GF5A 1M90U 3SWNB 3UDCA 3VUBA 4BI8B 2OTLT 1KHIA 3FDRA 4QW2A 3JCMf 4E7JA 1PSEA 2RHUA 3OSVA 3JCMe 4OB2B 3RMQA 3GP8A 2G3RA 3L2ZA 3CC2T 3HP9A 3M4YA 4CI0C 4M7AC 4M7DA 2CYZB 2X35A 4C0FA 1K8AC 4C5HA 3OYDA 1YIJA 3V8LA 5A0DA 2PQWA 5CIUA 1BI3A 2DD5A 2VGNA 2VGMA 3E9GA 3P8HA 1JRIA 3OYJA 3X20B 1K9MU 4M77B 3OBYA 4HT9A 4OB0B 1G3WA 3FIFA 5KE2A 2LDMA 3PMTA 1WGSA 3OB9A 1MGQA 2DTOA 4F7UA 5FRMA 1YITA 4NOYA 2L5QA 5GAN3 4IUPA 2XU8A 3CCRA 1JBMA 1WQ7A 5CQYA 1Q81C 1V29B 4XTYA 4JS4A 1VQ4A 3TEEA 3OYMA 4M7DE 4XU0A 3CCQT 4C5GA 1VQOA 4ME7A 1KQ1A 4GY5A 3JCMd 1M1GA 3OS1A 4BDYA 3PIOA 3QZ9B 4FIBA 1N9SA 1I4K1 4FT4A 2P0QA 1BI2A 2DZCA 2JUFA 2V8KA 4HCCA 4QQDA 2RHIA 4MMLA 5EG2A 4O6JA 5GAMj 1VQLA 1KQSS 5LJ3d 3GLXA 2CGHA 3DB3A 3JCMV 3V8KA 5LJ5j 4M7AA 2P0PA 2RH2A 2RJEA 5DLOA 4BE1A 4E47A 2A7YA 2CZ6B 3G4ST 2OTLA 5HY6A 1H3ZA 2QEXT 4J6YA 4KUIA 4CRIA 1VQOT 2WACA 2B8AA 2IG0A 1VQ5T 2HD0A 2GQVA 4XTXA 3VU3C 1BI1A 3H8ZA 3CCMT 2XIDA 4X34A 2RJFA 2M1HA 3G71A 4EDUA 1VQNA 3HSBA 2PVDB 3TU4K 3BDLA 3I56T 1G3SA 4C92F 4JRIA 5GAN7 3ZFJA 5I2SA 1NJIU 4C8QC 1M1FA 1NPPA 2ZPIB 1YCYA 5GANe 2KMTA 4ZGDB 5LJ5h 4HA8A 4MZTA 3BFMA 1KQSA 4FSXA 4J83A 3V7SA 4ZN1A 2DAQA 3L1AA 5DLQE 2MI6A 1GXIE 2K57A 3DKMA 1I5LA 3CBOA 2QQRA 3OYBA 3JRZA 3SD4A 2RHZA 3MEAA 2F5TX 3QG1A 2F69A 3JB9I 3CCEA 1M1KU 3T9NA 2RJDA 3UT1A 4KBMB 1EIFA 1YI2T 2CZ0B 2R57A 1VIEA 1YJNA 1OZ3A 3S3OA 2CZ1B 2E6NA 5CO7A 4C92E 4M75E 2E65A 2HNIA 3PTAA 3CC4T 3CCST 3CCVT 1VQ6A 3CCUA 3BY7A 5FU6B 2JNGA 3LWIA 2FVUA 3C95A 4KULA 5HK3A 2QI2A 4N4IA 3CCLA 4OGCA 3MEUA 1QVFA 3JB9H 2HQEA 3NTKA 1OI1A 3RUXA 4R56A 4ZTJA 1B34B 5D6WA 1YIJT 2DTIA 5CAIA 4BDZA 3CC4A 4BACA 1Q82U 2JN0A 4VUBA 3G6EA 5GAN6 4BE2A 3EFRA 1N27A 4PL6A 4XQ3A 4RMOA 3OBWA 5C6SA 1G3TA 2X4YA 4LD9K 1U1SA 4OMFB 3OY9A 3I55T 4QVCA 3R6OA 4E7LA 2FYKA 4BUGA 2LVMA 2E5QA 2RHYA 3CMAT 5GAN4 3QJ6A 1K73U 4X9CA 3M57A 4C8QD 5LJ5f 2DVEA 2BUDA 5A0LA 4E7KA 3CCET 3CCJA 5GAOr 3LGLA 1D3BA 1QVFS 1BYMA 5GAOl 2QQBA 4N4HA 5CKFA 4C92B 3GOXA 3JCMh 1Q82C 2WSCE 3PGGA 2RA2A 4J6WA 5CR2A 2GFAA 4XU1A 4RG2A 4C8QG 1VQ8T 4BE0A 1VQNT 4IURA 4EMGA 1JB0E 1Y71A 2ZZDA 2EJGA 3QZ5B 3HFNA 2QQ9A 1QP2A 1XOVA 3M4GA 5DY9A 4M77D 5KE3A 1KD1C 3HFOA 1TH7A 4LD6A 4ELYC 4M7DG 2DK3A 2EQJA 4OB1B 3JCMJ 1KG1A 3LYIA 3S6WA 2EJ9A 2JVVA 2BKDN 3VJPA 4EMKB 4PJOF 1QVGA 2HAXA 5CKEA 4NL2A 1OYXA 1M1KC 3JB9F 5GANf 3OS2A 3ASKA 5LJ3g 4M7DC 4C5IA 5KCOA 3J7AF 2VYTA 2RB6A 2RI3A 3ZBDA 1O9SA 3OYNA 4XTUA 2ZPEB 1XTDA 2DJZA 2K5LA 3RKYA 3OYAA 2F5KA 3JB9J 4PLIA 3INZA 3G6ET 1NE8A 2EJFA 2O01E 3VV0A 5I21A 4LDXA 3L2QA 2RI5A 4XAXB 4M7DF 3BDUA 4EMHA 3Q1JA 4MZPA 3JB9D 3OYYA 5GAMf 1QVGS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIR A;  1H64 1;  2VC8 A;  4J6X A;  2FB7 A;  4Y91 A;  5GAO m;  5LJ3 d;  4PJO E;  2CGH A;  4DQ2 A;  3JCM V;  3V8K A;  5LJ5 j;  5LJ3 h;  5GAN d;  4F7U F;  4M78 E;  5GAN j;  3JCM X;  4M7A A;  4M7A E;  4M77 F;  4J6Y A;  1WNL A;  5LJ5 e;  4PJO C;  1X01 A;  2EWN A;  3JCM b;  4XTX A;  3VU3 C;  3QO3 A;  5GMK e;  5GAN 5;  4J5Y A;  5GAO n;  3HSB A;  4M78 G;  4M75 B;  5GAM g;  4M7A D;  5GAM e;  4C92 F;  3RKX A;  4JRI A;  4XU2 A;  5GAN 7;  5GAO q;  4OP0 A;  3RER A;  4C8Q C;  5GAN 2;  3SWN A;  1YCY A;  4F7U G;  5GAN e;  5LJ5 h;  3JCM W;  4HA8 A;  3BFM A;  4PNO A;  3V7S A;  3EFS A;  4M78 F;  3L1A A;  5LJ3 e;  1M8V A;  4RCB A;  2K57 A;  4M75 A;  1HXD A;  2DEQ A;  4C92 A;  1I5L A;  5GMK i;  5LJ5 d;  1U1T A;  2RD1 A;  5LJ3 j;  5GAN h;  5LJ3 f;  3JB9 I;  5GAN g;  4M77 G;  3AHU A;  1LOJ A;  2YLC A;  5GAM d;  5GAO p;  4XTW A;  5GAM h;  1LNX A;  3FB9 A;  1I81 A;  4M75 D;  4XTV A;  1HK9 A;  2YHT A;  4A54 A;  4M75 E;  4C92 D;  4C92 E;  2E65 A;  2HNI A;  2YLB A;  5GMK j;  4M7A G;  2E64 A;  3BY7 A;  3QSU A;  5GAM j;  4M7D C;  2DZ9 A;  4NL3 A;  4C92 C;  4PJO A;  4HT8 A;  4M75 C;  3JB9 H;  1WPY A;  4EMK A;  4M7D G;  1BIB A;  3RUX A;  1B34 B;  5LJ5 g;  4EMK C;  2DTI A;  5GAM f;  5CAI A;  4M7D B;  3SWN C;  3V7R A;  3JCM Q;  4F7U E;  4M7A F;  2DXT A;  2JN0 A;  3JB9 F;  5GAN 6;  3RKW A;  3EFR A;  4XQ3 A;  1I8F A;  1U1S A;  3V7C A;  4PJO D;  4WF2 A;  2I2L A;  1B34 A;  4C8Q B;  4QVC A;  5GAN 8;  3JB9 G;  2FYK A;  4V2S A;  4PJO G;  3JCM c;  5GMK m;  4QVD A;  3SWN B;  5GAN 4;  4JRK A;  2VXF A;  4X9C A;  4C8Q D;  5LJ5 f;  2DVE A;  3JCM f;  5GAO r;  1D3B A;  1M5Q 1;  2E41 A;  5GAO l;  3BW1 A;  1LJO A;  1D3B B;  3JCM e;  4C92 B;  3L2Z A;  3JCM g;  4M7A C;  3JCM h;  4M7D A;  4M75 F;  3PGG A;  4M77 A;  2RA2 A;  3QUI A;  4J6W A;  3V8J A;  4N0A C;  3V8L A;  1KQ2 A;  4XU1 A;  4C92 G;  4C8Q A;  4C8Q G;  4M75 G;  1JRI A;  2RM4 A;  4EMG A;  4M77 B;  4HT9 A;  3FIF A;  2EJG A;  2QTX A;  3SB2 A;  3HFN A;  4F7U B;  3M4G A;  4X9D A;  1MGQ A;  2DTO A;  4M77 D;  5DY9 A;  4F7U A;  3HFO A;  1TH7 A;  1WQW A;  4M77 E;  2EAY A;  4XTZ A;  5GMK h;  5GMK l;  3JCM J;  3FJP A;  2EJ9 A;  4NOY A;  3RES A;  4C8Q F;  1Y96 A;  4M78 B;  2DKG A;  4PJO F;  4EMK B;  5GAN 3;  3GIB A;  1Y96 B;  1JBM A;  1WQ7 A;  4M77 C;  4M78 A;  2ZGW A;  2DXU A;  4NL2 A;  4A53 A;  4M78 C;  5LJ3 g;  4JLI A;  2Y90 A;  4XTY A;  5GAN f;  2E1H A;  4M7A B;  2RB6 A;  4XU0 A;  3QHS A;  1N9R A;  4M7D E;  4XTU A;  2DTH A;  1KQ1 A;  4JUV A;  3JCM P;  2DJZ A;  2E10 A;  4MMK A;  3RKY A;  3JCM d;  4M7D D;  4M78 D;  1N9S A;  1I4K 1;  3INZ A;  3JB9 J;  2EJF A;  2DZC A;  5I21 A;  4M7D F;  3BDU A;  4MML A;  4PJO B;  2VXE A;  4EMH A;  4C8Q E;  4N0A A;  3JB9 D;  1BIA A;  4RCC A;  4XU3 A; 
#chains in the Genus database with same CATH topology
 1H64 1;  4PJO E;  2XG8 D;  3UPU A;  1NEG A;  1MHN A;  4M77 F;  4UC4 A;  2HMA A;  2OTJ T;  1VQP T;  2QK0 A;  4FYW B;  1WA7 A;  4ESR A;  3SHW A;  4RTX A;  1UEC A;  5A0G A;  3QBY A;  1B7T A;  5IAY A;  2H8H A;  2K4Y A;  4AG1 C;  1VQ7 T;  3MEV A;  2KBT A;  5LJ3 f;  1BB9 A;  1Q86 C;  2FZG B;  3A1P A;  1QVP A;  2QEX Q;  3MKD A;  4BI3 A;  1ZQ1 A;  2YLB A;  3QWY A;  2CUD A;  1BKB A;  3OA6 A;  3KUF A;  1ACM B;  3E9F A;  3KXT A;  4EMK C;  2VWF A;  3QDF A;  1VYT A;  4LDV A;  1QVG P;  2AKL A;  2AK5 A;  3PVQ A;  4WF2 A;  3JB9 G;  3X28 B;  2K3X A;  1VQP A;  3CBP A;  3UWN A;  2GBQ A;  4C0Z A;  2LQ8 A;  4EIK A;  3CME A;  2DA9 A;  2YXY A;  2RQT A;  1TUD A;  1YJ9 A;  4FT2 A;  1BI0 A;  3LLR A;  1VIF A;  5FW9 A;  3CCM A;  3QII A;  4BY6 C;  3SB2 A;  3FLG A;  1WHL A;  2BIV A;  3MHX A;  3RES A;  4R55 A;  2YRD A;  4FU6 A;  2YRC A;  1YJW A;  2LC4 A;  3VYG A;  2C06 A;  3QHS A;  2LMJ A;  4AT1 B;  3L2U A;  4JRP A;  4JLG A;  5I11 A;  1UG1 A;  2L3R A;  1M3B A;  1PD0 A;  1WI7 A;  2PNI A;  2PUK B;  1SPK A;  2MK5 A;  3OYG A;  2X4J A;  1IGU A;  1U3O A;  4Y91 A;  1ZHI A;  5GAN j;  1TG0 A;  3RDV A;  4J9I A;  1YI2 Q;  4KGV B;  4L6V 5;  2M0O A;  2HKN A;  2K5F A;  3RKX A;  2K3Y A;  1IZ6 A;  3RER A;  4JDS A;  1R0B G;  1SHF A;  4J9D A;  1GFC A;  8ATC B;  3X25 B;  2JM9 A;  3QDR B;  1RAG B;  5I2M A;  2O4X A;  4ELZ C;  3L2W A;  2QXF A;  2QDL A;  1M3C A;  1LOJ A;  2CP5 A;  2E12 A;  3G1J A;  2KI7 A;  4AFQ C;  2KK4 A;  2YHT A;  4ZGE B;  3A98 A;  2AHJ B;  1UGR B;  2DM1 A;  3A8L B;  1MMD A;  4EMK A;  2PTK A;  1D1B A;  5CK9 A;  1K0X A;  1WFW A;  1EX4 A;  3U23 A;  2E6Z A;  5GAN 8;  1B34 A;  4B6M A;  1TWB A;  2KDS A;  3OW2 P;  2DIL A;  1QMC A;  5J26 A;  2GF7 A;  1NLP C;  3C4S A;  3M59 A;  3QUI A;  4JJC A;  3V8J A;  3CMA A;  1LCK A;  2EGA A;  2KYM A;  4BY6 B;  4C8Q A;  2ABL A;  3S3M A;  1AHJ B;  4JRQ A;  4F7U B;  5GAO q;  2HBP A;  2EAY A;  4RG8 A;  4C8Q F;  2DKG A;  4F16 A;  4JS5 A;  1QLY A;  4IIO A;  1VQ9 A;  3H6Z A;  1CKA A;  1Q81 R;  1Q86 U;  3UAT A;  2DL7 A;  2J6F A;  4Y92 A;  2YUP A;  1YNZ A;  2ROT A;  2P0K A;  1BIA A;  3CBM A;  5GAO m;  1BK2 A;  1NYG A;  4M78 E;  1VA7 A;  1OZ2 A;  3RNJ A;  2HCK A;  3UA7 A;  1WNL A;  2HKQ B;  2RJC A;  1RAD B;  1TUG B;  1D0Z A;  1M9S A;  4K11 A;  3KBG A;  1SHG A;  2RI2 A;  3RMS A;  3I56 Q;  4J5Y A;  2EKH A;  5GAO n;  4M7A D;  2RO0 A;  2CUB A;  2L8D A;  2XI9 A;  1N8R U;  4PFO A;  3OYL A;  3TRE A;  1SSH A;  1D0Y A;  1YCS B;  4FL6 A;  2DYI A;  3OW2 A;  5GMK i;  4AFS C;  2K7A A;  4M77 G;  1W4S A;  2CP0 A;  2QTV A;  2IVW A;  2YWW A;  4XTW A;  5GAM h;  2JOY A;  1M3A A;  3CD6 Q;  1D0X A;  4GLM A;  5I22 A;  2HSP A;  4PJO A;  3OW2 S;  3ER0 A;  4AFZ C;  1VQN Q;  2F1L A;  2ZPB B;  2BZX A;  2EYQ A;  3JCM Q;  2HEQ A;  1UB4 A;  1S1N A;  4IUU A;  5CCA A;  2O88 A;  1VQM A;  1M90 U;  3JCM f;  1TOV A;  1VQM Q;  1D1A A;  5IXF A;  3EHQ A;  3M4Y A;  3SEM A;  1K8A C;  4RTU A;  1H8K A;  3P8H A;  5IHK A;  4HT9 A;  2LJ1 A;  3CCR Q;  1WDX A;  1E7O A;  2FRW A;  2DYB A;  2X51 A;  1GL5 A;  3CCR A;  2RQW A;  1VQ4 A;  4JS4 A;  1VQO A;  4ME7 A;  2DF6 A;  1JXM A;  2CP3 A;  1AWO A;  1M1G A;  4HVW A;  1GRI A;  4FT4 A;  2DZC A;  4QQD A;  2A37 A;  5EG2 A;  2NYS A;  1VQL A;  2ECZ A;  1KQS S;  3DB3 A;  5DLO A;  2DRK A;  4KUI A;  2F2V A;  1VQO T;  2IG0 A;  2G6F X;  2D8H A;  2RMO A;  3H8Z A;  1SRL A;  4KGX B;  2M1H A;  3G71 A;  2PVD B;  2IPO B;  2E3H A;  2C0I A;  3BDL A;  3M0P A;  3R6N A;  2CT3 A;  3LH5 A;  4C8Q C;  2ZPI B;  5GAN e;  1KQS A;  3BFM A;  1I1J A;  5L23 A;  3OYB A;  3JRZ A;  3JB9 I;  1OPL A;  2RJD A;  1G8X A;  4PJN A;  2DL5 A;  3REB B;  1OZ3 A;  3CPW P;  2KNB B;  2E6N A;  2HNI A;  1VQ6 A;  3CQT A;  3CCL A;  4OGC A;  1IB8 A;  4RTW A;  1EZZ B;  2JN0 A;  2ZAE A;  4VUB A;  3EFR A;  1N27 A;  1MV3 A;  1AEY A;  1G3T A;  4OML A;  4OMF B;  4QVC A;  1YFN A;  2EGC A;  2W10 A;  4E7L A;  1QCF A;  5GAN 4;  3QJ6 A;  4C8Q D;  5GAO r;  3LGL A;  5GAO l;  2QQB A;  5CKF A;  4C92 B;  2KRS A;  2WSC E;  3PGG A;  3RR6 A;  2J6K A;  2EGE A;  2JS2 A;  1VQ8 T;  4EMG A;  1Y71 A;  2ZZD A;  1VQ8 Q;  3QZ5 B;  3HFN A;  1XOV A;  3M4G A;  4M77 D;  4M7D G;  1TH7 A;  2EQJ A;  3LYI A;  3S6W A;  3NPF A;  5FWC A;  4AG2 C;  4NL2 A;  1M1K C;  1OX8 A;  5KYU B;  5LJ3 g;  2KRN A;  3CC7 Q;  3ZBD A;  3OYN A;  1HD3 A;  2YUQ A;  2CRE A;  4KGZ B;  2F5K A;  3L2Q A;  4M7D F;  1NJI R;  1IRX A;  4LUE A;  2VC8 A;  3VUZ A;  2VKN A;  1DJ7 B;  4BD3 A;  4M7A E;  2EPD A;  1AZE A;  4E7I A;  1HSQ A;  1UFF A;  2PU9 B;  3QO3 A;  1E6H A;  2DL3 A;  3CC2 Q;  2OX7 A;  2RPN A;  3S3N A;  3SFM A;  1K4U S;  4F7U G;  3I35 A;  1E6G A;  4LDU A;  5HCK A;  3PIP A;  5LJ3 j;  1M90 C;  2KXC A;  1W2B P;  1X75 C;  3P8D A;  1ABQ A;  1VQK Q;  3VS6 A;  2EYZ A;  5KYW A;  4LE9 A;  2CH4 W;  4HCB A;  3MJX A;  1JJ2 P;  2LQW A;  5J3B A;  1ZBJ A;  4OGE A;  1IRE B;  3SWN C;  2BTT A;  4RKU E;  3VS7 A;  2EQU A;  1P92 A;  1Z9Q A;  1N5Z A;  2XMF A;  5LL6 S;  1OQK A;  1GBR A;  3TSW A;  5GMK m;  1PKT A;  3EG1 A;  3PT9 A;  3GPL A;  3OYE A;  2EQM A;  1FWZ A;  1X43 A;  2FRY A;  3BW1 A;  5FRN A;  2LNV A;  2E70 A;  3CME T;  2NUT B;  3EGU A;  3G6E Q;  1N8R C;  4JJN K;  2RM4 A;  2DER A;  1KSW A;  1X6G A;  4M7D D;  5GMK l;  2MWO A;  1JQQ A;  4F17 A;  6AT1 B;  1M8M A;  1UGV A;  2L3S A;  4M77 C;  2JTM A;  3HRU A;  4A4K A;  3CMA Q;  1FX7 A;  2EQK A;  4JLI A;  4LDW A;  2JMA A;  3C12 A;  2DTH A;  3EFO B;  1ZA1 B;  1YBY A;  4E7S A;  1UE9 A;  4FCY A;  2I0N A;  1OPK A;  4PJO B;  2FL7 A;  2VXE A;  4FM4 B;  1VQ9 T;  4XU3 A;  1TSF A;  2EFI A;  5GAN d;  1YWP A;  4FYV B;  4ZN3 A;  4PJO C;  2RNA A;  1Q7Y C;  1Q95 G;  4BI4 A;  3FC3 A;  3CME Q;  3P8B B;  4GLK A;  2DXB A;  1BCO A;  1M1K R;  4ORZ A;  5GJV B;  2LCL A;  3HKS A;  2AIR B;  3A5Z B;  1GCQ A;  1C1A A;  1I5O B;  3CC7 A;  3AHU A;  2LJ0 A;  3EGD A;  1K76 A;  2L89 A;  3THK A;  5GAO p;  2LP5 A;  1SSF A;  4D8K A;  1YIT Q;  2QA4 T;  1HK9 A;  4M7D B;  5GMK j;  3CCM Q;  4CC2 A;  2DZ9 A;  2ZCF B;  5KYX A;  3J80 E;  4F7U E;  1FXX A;  1OU8 A;  2CKK A;  5FU6 C;  3FRN A;  2KAF A;  3OYH A;  2XDP A;  4QVD A;  4J9F A;  2DRM A;  1RAI B;  3WVE B;  1RAH B;  3ME9 A;  1M5Q 1;  4DBQ A;  2QEX A;  2XKO C;  3QXE B;  1KQ2 A;  2V8J A;  1PM3 A;  4GBQ A;  2DIQ A;  2NUP B;  3HRT A;  4HT8 A;  2LRQ A;  4J7I A;  3M53 A;  1JXO A;  4A53 A;  1XNI A;  4CC3 A;  2DIG A;  2DXU A;  2AZV A;  2E1H A;  4M7A B;  4L5G A;  1N9R A;  1PSF A;  1U06 A;  1K73 R;  1NG2 A;  1Y07 A;  3JCM P;  4MZP A;  5KH6 A;  3DB4 A;  3CCU Q;  4Q5W A;  2RK2 A;  2KQW A;  4RCC A;  3CCJ T;  4BB7 A;  4DOW A;  4RTY A;  3OYC A;  2R5A A;  5KYY B;  1S72 T;  4J9E A;  1X01 A;  1ZBX A;  2F2W A;  2M9U A;  3CCS Q;  3CCV Q;  1BU1 A;  1WYX A;  2DXC A;  5GAM g;  5C0M A;  5KYY A;  4OP0 A;  3GBQ A;  3A8M B;  4RCB A;  1NYF A;  1XQH A;  1HXD A;  2DEQ A;  4O5V A;  1S72 A;  7AT1 B;  2BZ8 A;  2CP6 A;  4DA4 A;  1BBZ A;  3HHT B;  2FZK B;  4IKF A;  4A54 A;  4KT0 E;  2YDL A;  3E19 A;  2R5M A;  3MCA B;  4M7A G;  3EGX B;  2SEM A;  4DBF A;  4A4H A;  2MMP A;  4KUD K;  1RUW A;  4NS5 A;  3HL8 A;  1ZSZ C;  5DM7 R;  2DD4 A;  2RK1 A;  3M0T A;  1TS9 A;  1ZX6 A;  4V2S A;  2SRC A;  2LCS A;  4MDW A;  1U8R A;  3F70 A;  3GF5 A;  1AZG B;  3VUB A;  2OTL T;  1PSE A;  3OSV A;  3REA B;  4R0K A;  3JCM e;  3CC2 T;  2G3R A;  2QGF B;  4CI0 C;  4M7D A;  2CYZ B;  1TUC A;  3OYD A;  3V8L A;  5A0D A;  1R77 A;  2HBW A;  4DBR A;  2VGM A;  3E9G A;  3X20 B;  1VOM A;  1KC8 R;  1G3W A;  5KE2 A;  4J9C A;  4F7U A;  5FRM A;  1YIT A;  1AD5 A;  4NOY A;  1K8A R;  2DL8 A;  4IUP A;  2XU8 A;  3EH2 A;  1JBM A;  1WQ7 A;  1Q81 C;  1V29 B;  4XTY A;  3OYM A;  3CCQ T;  1QWE A;  4HVU A;  3JCM d;  1UJ0 A;  2CP7 A;  1BI2 A;  4HCC A;  1K0S A;  1WIE A;  1ZA2 B;  1W1F A;  1VQ7 Q;  4M7A A;  3V8K A;  5LJ5 j;  2P0P A;  1WXT A;  2RJE A;  2OTL A;  4E47 A;  3G4S T;  1MUZ A;  2QEX T;  4CRI A;  2B8A A;  2GQV A;  2OTL Q;  3VU3 C;  1BI1 A;  2XID A;  1VQN A;  2BE9 B;  1G3S A;  2AKK A;  4JRI A;  3ZFJ A;  1M1F A;  1NPP A;  4ZGD B;  5GAN 2;  3CXC P;  5LJ5 h;  4HA8 A;  2DL4 A;  4J83 A;  3V7S A;  4ZN1 A;  2EYW A;  2K57 A;  2Z0W A;  2DLP A;  1KIK A;  3M0S A;  2V26 A;  5KYU A;  3NHN A;  2F5T X;  1M27 C;  4OMQ A;  1YI2 T;  2CZ0 B;  3S3O A;  2CZ1 B;  1PRM C;  5CO7 A;  4M75 E;  3CC4 T;  3EG2 A;  1VQP Q;  1R0C B;  3CCU A;  3BY7 A;  3LWI A;  1ZSG A;  3C95 A;  5IH2 A;  3CC4 Q;  3MEU A;  3NTK A;  3CC4 A;  4RTZ A;  1Q82 U;  4BE2 A;  4RMO A;  3OBW A;  3OY9 A;  2L3P A;  3I55 T;  2LVM A;  1SG5 A;  3I55 Q;  5LJ5 f;  2DVE A;  5A0L A;  3CCE T;  3I9Q A;  3CCJ A;  1QVF S;  1D3B A;  4N4H A;  1FMW A;  4FYX B;  1G2B A;  4PJM A;  5CR2 A;  1YJW Q;  2GFA A;  4XU1 A;  4BE0 A;  4LNP A;  5KE3 A;  2QG9 B;  1KD1 C;  1T3L A;  2DK3 A;  1KG1 A;  4EMK B;  3VJP A;  1QVG A;  4M7D C;  2RB6 A;  5FWB A;  1O9S A;  1D09 B;  4XTU A;  1AT1 B;  1PHT A;  2DJZ A;  4PJL A;  2A36 A;  2CDT A;  3JB9 J;  4PLI A;  3VV0 A;  1VQ9 Q;  3CCL Q;  3Q1J A;  5A2Q E;  1YIJ A;  3JB9 D;  1QVG S;  3CCL T;  1N6A A;  1YHQ A;  2KY9 A;  3JCM X;  1O75 A;  1B07 A;  5FRO A;  2J7I A;  5GAN 5;  5FLX E;  1KC8 U;  1VQ5 Q;  4ATO A;  2MF2 A;  5J39 A;  1YJW T;  3KFV A;  1K8A U;  2HL5 C;  3CPW A;  1UGS B;  4Z89 A;  1RI0 A;  4HXJ A;  2FPE A;  3C94 A;  1WHK A;  4QT7 A;  2JT4 A;  2DX1 A;  2QA4 A;  2MPX C;  5FU7 B;  2O31 A;  5GAN h;  1X2K A;  2QGG A;  2QA4 Q;  2D9T A;  2EYX A;  4C92 D;  4A4G A;  3CPW S;  3NTI A;  3QSU A;  1UDL A;  4QKU A;  5CVI A;  1QVF P;  3CD6 A;  2FHD A;  2RQV A;  1VQ8 A;  1WPY A;  1K9M R;  1JJ2 S;  1BIB A;  2O9S A;  2Y4X A;  4A4F A;  5IT9 E;  1OU9 A;  4OMO A;  4EPC A;  2DXT A;  3UA6 A;  1AWX A;  1TXQ A;  1PG5 B;  3OMC A;  2CP2 A;  3M5A A;  4PJO G;  4L59 A;  3CCQ A;  2L3Q A;  3PNW C;  1CSK A;  2WSF E;  2DET A;  3CD6 T;  1JJ2 A;  2GFU A;  4M77 A;  1MMN A;  3N5B B;  3CPF A;  5D6X A;  2CS7 A;  2KXD A;  4N4G A;  1W2B A;  2X4X A;  2YUO A;  1WQW A;  1K73 C;  4II1 A;  3QWX X;  1YJN T;  3OYK A;  2J6O A;  3OQ5 A;  1Y96 A;  4M78 B;  3GIB A;  4MDX A;  3I5R A;  1TTH B;  4J8O A;  2VB6 A;  2QQA A;  1FYN A;  1KHC A;  1VQK A;  4MMK A;  2E3I A;  2LTO A;  2VAS A;  4M78 D;  1VUB A;  1YWO A;  5L8R E;  4FYY B;  3RIR A;  3VYH B;  4J6X A;  1Y7X A;  2GQI A;  1MNE A;  5LJ3 h;  3PMI A;  2H3E B;  1RL2 A;  2ENM A;  2K79 A;  1QCO A;  3PVL A;  3H0H A;  1KK7 A;  3OMG A;  2MAM A;  3A8G B;  4FW1 A;  4C0D C;  2KT1 A;  2X9H A;  4XU2 A;  2LZ6 B;  3G71 Q;  2A0F B;  2J05 A;  1PD1 A;  1GCQ C;  3G71 T;  2CZ7 B;  5LJ3 e;  4DEY A;  5AYF A;  1Q7Y R;  2WSE E;  3CCS A;  3CCV A;  2JTE A;  2YT6 A;  2GGR A;  4ZTF A;  1UGP B;  4F04 B;  1UJY A;  1R8O B;  4HCZ A;  4E7H A;  2ZPF B;  2FZC B;  1NZ9 A;  1U5S A;  1T3S A;  4WCI A;  2Y4Y A;  2OI3 A;  4ZGJ B;  3O5Z A;  2CSQ A;  4PK4 A;  1Q82 R;  3MEW A;  2LT1 A;  3V7C A;  3G4S Q;  4D8D A;  1AWW A;  2VUB A;  2XDD A;  1G5V A;  2X4W A;  3GNG A;  1LJO A;  5D6Y A;  2PVO B;  1RAB B;  4ANJ A;  2EQI A;  2NUZ A;  4N0A C;  1VQ4 Q;  2M02 A;  2DO3 A;  4M75 G;  1WZO A;  1K9A A;  3A8O B;  4M77 E;  1I0C A;  2HL3 A;  3FJP A;  4IUV A;  2LX9 A;  1RAA B;  2OTJ Q;  1YJ9 Q;  1NJI C;  2Y90 A;  1FMV A;  1YJ9 T;  3NFC A;  2K5I A;  4JUV A;  2D0N A;  1QQJ A;  2KGT A;  5IN1 A;  3TSZ A;  2L2P A;  2NWM A;  2PUO B;  4C5E A;  3MO8 A;  1GBQ A;  4OF1 A;  8AT1 B;  3EG0 A;  3VRY A;  3JCM b;  3J81 E;  2RHX A;  5CKD A;  5HKC A;  1KC8 C;  3HPW A;  3LH0 A;  3NTH A;  1UUE A;  2XK0 A;  4M4Z A;  4ZNX A;  2FPF A;  3A8H B;  1VQ6 T;  1B3Q A;  1VQ4 T;  1VQ7 A;  4HVV A;  3AT1 B;  2FG0 A;  3M0Q A;  1ZUY A;  2XD0 A;  1VQ6 Q;  2QYZ A;  1QP3 A;  4IIM A;  3WXM B;  1PRL C;  3CCU T;  1YI2 A;  1M8V A;  3FEO A;  3NMZ C;  1IO6 A;  3M54 A;  2VVK A;  3G7Z A;  5CQX A;  5GAN g;  2RQR A;  3EGD B;  4F14 A;  3FB9 A;  1I81 A;  1Y0M A;  2YRV A;  3OS5 A;  2ZPH B;  3CXC A;  1RAF B;  4QVZ A;  2YSQ A;  4E7Z A;  4A4E A;  4M75 C;  2V1Q A;  1X2Q A;  2PVG B;  4KH1 B;  2GTJ A;  1J3T A;  1WXB A;  2EKO A;  1AWJ A;  2M0Y A;  4C8Q B;  2HQH A;  1WJQ A;  4PLL A;  3BE3 A;  3SWN B;  3UDC A;  2W0Z A;  2K9G A;  2BZY A;  3ULR B;  3FDR A;  1XJW B;  2RHU A;  4OB2 B;  3RMQ A;  3L2Z A;  4M7A C;  4C0F A;  2X35 A;  1T0H A;  4C5H A;  2PQW A;  1OX9 A;  2DD5 A;  2VGN A;  1HJD A;  2NUT A;  4OB0 B;  2K2M A;  2LDM A;  3OB9 A;  1WLP B;  2NUP A;  3MPU B;  2L5Q A;  1M2V A;  5CQY A;  3TEE A;  2RQU A;  4XU0 A;  2CH4 A;  2X3X D;  1MND A;  3OS1 A;  4BDY A;  1HYO A;  1GCP A;  1N9S A;  1I4K 1;  2P0Q A;  2ED1 A;  2V8K A;  3D7S B;  1W70 A;  3I5S A;  1M30 A;  5LJ3 d;  2KT8 A;  2RH2 A;  1ZSZ B;  2A7Y A;  2CZ6 B;  5HY6 A;  4J6Y A;  1VQ5 T;  4X34 A;  1SF9 A;  4EDU A;  4C92 F;  1YIJ Q;  5I2S A;  1LVK A;  4E6R A;  1MMG A;  3L2V A;  1YCY A;  2KMT A;  1UTI A;  2DAQ A;  3L1A A;  2MI6 A;  1GXI E;  1PCX A;  3DKM A;  1I5L A;  1TU0 B;  3EFO A;  1N8R R;  1T0J A;  1YJN Q;  3SD4 A;  4E2F B;  1M1K U;  1H92 A;  3T9N A;  3UT1 A;  3HTR A;  4KBM B;  1EIF A;  1VIE A;  1YJN A;  4C92 E;  2KEA A;  3PTA A;  2FEI A;  1Y57 A;  2FVU A;  4KUL A;  2QI2 A;  1QVF A;  1WHH A;  3UF4 A;  3RUX A;  1OI1 A;  4R56 A;  1B34 B;  5CAI A;  4BDZ A;  4BAC A;  3G6E A;  5GAN 6;  4LD9 K;  4XQ3 A;  2BE7 D;  5C6S A;  2X4Y A;  2X3W D;  3EG3 A;  2KR3 A;  3CMA T;  2JS0 A;  3M57 A;  2BUD A;  2MYS A;  2IIM A;  1UHC A;  1M90 R;  3JCM h;  1SKU B;  1Q82 C;  4J6W A;  2HZY A;  4RG2 A;  4C8Q G;  1VQN T;  2KE9 A;  2EJG A;  3HFO A;  1UHF A;  4ELY C;  3JCM J;  4OB1 B;  2JVV A;  2BKD N;  5CKE A;  1OYX A;  3JB9 F;  5GAN f;  1X27 A;  1WX6 A;  5KCO A;  3J7A F;  2ZPE B;  3RKY A;  1PC0 A;  5KYN A;  2DJQ A;  3OYA A;  3INZ A;  3G6E T;  2EJF A;  5I21 A;  4LDX A;  3BDU A;  4EMH A;  3OYY A;  2FB7 A;  4OB3 B;  3CCR T;  3EG9 A;  3TCJ A;  2P4T A;  3L42 A;  4DOV A;  2ED0 A;  2A08 A;  1A0N B;  2LQK A;  4J9H A;  5GMK e;  4LUD A;  3EAE A;  3M58 A;  2DE0 X;  3QPH A;  3FJ5 A;  1JEG A;  5GAM e;  3VS5 A;  3M0U A;  2A28 A;  4PKC C;  1ZSZ A;  4PFP A;  3I55 A;  2O4X B;  4C0G A;  1IGQ A;  1LPL A;  3CCJ Q;  5LJ5 d;  1M2V B;  3NGP A;  1S72 Q;  2M16 A;  1VQM T;  5CKB A;  5M9O A;  5ECA A;  2NLU A;  4M75 D;  2LNH B;  4LN2 A;  4NL3 A;  1SEM A;  3O8V A;  3GNF B;  3VKI A;  1X69 A;  2KRO A;  3DLL A;  4M7A F;  2DFU A;  3RKW A;  4OVA A;  3LGF A;  2ZPG B;  2I2L A;  3QYH B;  1Q7Y U;  2EW3 A;  1JU5 C;  3QKJ A;  1W2B S;  1WHG A;  2EBP A;  4MZM A;  2R58 A;  4JRK A;  1EFN A;  2VXF A;  1AOJ A;  1D3B B;  4LXC A;  2MWP A;  4Z02 A;  2J06 A;  3JCM g;  1YIT T;  3QYG B;  3EHR A;  3LWH A;  1V1C A;  5CKH A;  4JJD A;  1VQ5 A;  2QAZ A;  4OMN A;  3G4S A;  5HK0 A;  1SRM A;  1X6O A;  2QTX A;  4RTV A;  4X9D A;  4D6W A;  4XTZ A;  2JJ9 A;  4DBH A;  2LX7 A;  1UGQ B;  1VQO Q;  1WJS A;  3LX7 A;  2MCN A;  2ZGW A;  1H3Z A;  3JSC A;  2KSS A;  1G83 A;  5FU7 C;  1Q81 U;  1Q86 R;  2DBK A;  2LT4 A;  3M56 A;  4LDY A;  3E1S A;  3MP1 A;  4C8Q E;  4N0A A;  1ARK A;  4IUT A;  4DQ2 A;  2GCX A;  2MIO A;  2C0T A;  4F7U F;  1VQK T;  2OAW A;  3C0C A;  3DLM A;  3X24 B;  1AVZ C;  2D6F A;  3OS0 A;  4AMC A;  4CC7 A;  3CCQ Q;  1MMA A;  2XHC A;  4M78 G;  2K6D A;  3QJY A;  4FSS A;  1G3Y A;  4CC4 B;  1C6V X;  2A3L A;  2FPD A;  4PNO A;  4M78 F;  4AFU C;  4OMM A;  4C92 A;  1QW1 A;  1U1T A;  2RD1 A;  2JTF A;  3VS1 A;  3CEY A;  2YLC A;  4IUQ A;  2V8I A;  1LNX A;  2EIF A;  2QQS A;  2KRM A;  1W6X A;  1GFD A;  2H3J A;  3M55 A;  2E64 A;  2RN8 A;  2OAU A;  3MP8 A;  4Y28 E;  4B9W A;  2JM8 A;  2JZ2 A;  4TVR A;  2DBM A;  5LJ5 g;  3JV3 A;  4KH0 B;  1I8F A;  4XK8 E;  4JPB W;  4PJO D;  4B9X A;  3JCM c;  3I56 A;  1H3H A;  1YHQ T;  3CC7 T;  2E41 A;  1ZLM A;  1RAC B;  4HKE A;  4M75 F;  4WTO B;  1VQL Q;  4X1V A;  1IHW A;  1Z9Z A;  1FMK A;  4C92 G;  1VQL T;  4J7F A;  2E4H A;  2COW A;  2ROL A;  4RUG A;  2D1X A;  5GMK h;  2CT4 A;  2D8J A;  4P5N A;  1OUL A;  2C0O A;  2XDB A;  4FW2 A;  2HQX A;  1Y96 B;  4M78 A;  4M78 C;  3CCE Q;  3L2R A;  2F2X A;  3WVD B;  2XIC A;  3VRZ A;  2E10 A;  4QQG A;  3HRS A;  3OSS C;  2FO0 A;  4JJB A;  1ABO A;  3TVT A;  1JO8 A;  2D0Q B;  2M51 A;  2VV5 A;  2COY A;  2KVQ G;  2O9V A;  1ZUK A;  2JXB A;  3JAM E;  2HDA A;  3VS0 A;  3ZEH A;  5LJ5 e;  2EWN A;  3CC2 A;  2YUN A;  1YHQ Q;  4DEX A;  1NEB A;  1UEB A;  4M75 B;  3LW5 E;  2E5K A;  2LCC A;  3CXC S;  3X26 B;  4C0D B;  2DPP B;  4JZ4 A;  5IHI A;  3SWN A;  3JCM W;  4RTT A;  4A63 B;  1OV3 A;  1D1C A;  1OEB A;  2K3B A;  3EFS A;  2K2V A;  3OYI A;  4M75 A;  4PFZ A;  1I07 A;  2AZS A;  2HSE B;  1K9M C;  3M9Q A;  1KFZ A;  5GAM d;  1RAE B;  4QQ6 A;  4YTL A;  2PZ1 A;  4XTV A;  3VS3 A;  3SDZ A;  1CKB A;  1KD1 R;  2OTJ A;  2LQN A;  2QDY B;  4C92 C;  1WHM A;  3VS2 A;  5KCH A;  1NPR A;  3OYF A;  4Z8A A;  1M2O A;  1RI9 A;  3V7R A;  1KD1 U;  3MET A;  1M4Z A;  1BCM A;  1WJR A;  5GJW B;  3URG A;  3MP6 A;  2DVJ A;  3PFS A;  2JW4 A;  3PE0 A;  4BI8 B;  1KHI A;  2DEU A;  4QW2 A;  3EG9 B;  4E7J A;  4PJJ A;  1X6B A;  3GP8 A;  3HP9 A;  4J9G A;  5CIU A;  1BI3 A;  2OJ2 A;  1JRI A;  3OYJ A;  2EYY A;  1K9M U;  4M77 B;  3OBY A;  3FIF A;  3PMT A;  1WGS A;  1MGQ A;  2DTO A;  1NM7 A;  1MV0 B;  5GAN 3;  3ZL7 C;  2ATC B;  1V76 A;  4M7D E;  4C5G A;  1YP5 A;  1KQ1 A;  4GY5 A;  2QAS A;  4J9B A;  5AT1 B;  4HCK A;  2RF0 A;  3PIO A;  3H41 A;  3QZ9 B;  4FIB A;  1QWF A;  2JUF A;  1K1Z A;  1QCN A;  2O2O A;  2RHI A;  4MML A;  2GTO A;  4O6J A;  5GAM j;  3E2U A;  3GLX A;  2CGH A;  3JCM V;  4BE1 A;  4Z88 A;  5KYX B;  2WAC A;  2B86 A;  2HD0 A;  4XTX A;  3CCM T;  2RJF A;  9ATC B;  3H0F A;  1KQS P;  1IHV A;  5IHN A;  3HSB A;  3TU4 K;  3I56 T;  5GAN 7;  1NJI U;  4MZT A;  1WHJ A;  4FSX A;  2V1R A;  3EGX A;  3H0I A;  5DLQ E;  3RBB B;  3CBO A;  2QQR A;  1ZUU A;  2RHZ A;  3MEA A;  3QG1 A;  2F69 A;  3CCE A;  4KRT A;  2R57 A;  3M0R A;  2GNC A;  3EH1 A;  2E65 A;  3CCS T;  3CCV T;  1VYV A;  5FU6 B;  2JNG A;  5HK3 A;  1C0M A;  4N4I A;  3JB9 H;  2HQE A;  1YIJ T;  4ZTJ A;  5D6W A;  1OOT A;  1YN8 A;  2DTI A;  5D7U A;  2P4R A;  1PNJ A;  1QKX A;  4PL6 A;  1VYU A;  1F1B B;  1U1S A;  1PKS A;  2AT1 B;  3R6O A;  1RLQ C;  2FYK A;  4BUG A;  2DNU A;  2E5Q A;  2RHY A;  1K73 U;  4X9C A;  4E7K A;  1BYM A;  4JZ3 A;  5EC7 A;  3GOX A;  5KYW B;  2RA2 A;  2DMO A;  2ESW A;  2L0A A;  2LJ3 A;  3IQL A;  2JMC A;  1NBE B;  1NLO C;  4IUR A;  1JB0 E;  5IXB A;  1WXU A;  1QP2 A;  2QQ9 A;  5DY9 A;  1IXD A;  4LD6 A;  1KJW A;  2EJ9 A;  4PJO F;  2HAX A;  2MOX A;  3OS2 A;  3ASK A;  4C5I A;  2VYT A;  2RI3 A;  1PWT A;  2EVR A;  1XTD A;  2COZ A;  2K5L A;  4OMP A;  2KYB A;  1NE8 A;  1QKW A;  3VS4 A;  2O01 E;  2RI5 A;  4XAX B;  3H9N A;  1RLP C;  3TQ7 P;  2CSI A;  5GAM f;  2P84 A; 
#chains in the Genus database with same CATH homology
 1H64 1;  2VC8 A;  3CCL T;  1N6A A;  2FB7 A;  2XG8 D;  3VUZ A;  3UPU A;  4PJO E;  4OB3 B;  3CCR T;  1DJ7 B;  4BD3 A;  1YHQ A;  1MHN A;  3TCJ A;  2KY9 A;  2P4T A;  3JCM X;  4M7A E;  1O75 A;  3L42 A;  4M77 F;  4DOV A;  4UC4 A;  5FRO A;  4E7I A;  2LQK A;  2OTJ T;  2PU9 B;  1VQP T;  3QO3 A;  5GMK e;  3EAE A;  5GAN 5;  5FLX E;  1KC8 U;  3M58 A;  3QPH A;  4ATO A;  2MF2 A;  5J39 A;  5GAM e;  4PKC C;  3S3N A;  3SFM A;  1YJW T;  4F7U G;  1K8A U;  3CPW A;  1UGS B;  1RI0 A;  5A0G A;  3I55 A;  3C94 A;  4LDU A;  3QBY A;  2O4X B;  4C0G A;  5IAY A;  2QA4 A;  2K4Y A;  5LJ5 d;  3PIP A;  1VQ7 T;  3L2V A;  3MEV A;  5FU7 B;  5LJ3 j;  1M90 C;  5GAN h;  5LJ3 f;  1Q86 C;  1X75 C;  1QVP A;  3P8D A;  2M16 A;  1VQM T;  5CKB A;  2D9T A;  5M9O A;  2NLU A;  4M75 D;  4BI3 A;  4C92 D;  1ZQ1 A;  2YLB A;  4A4G A;  4HCB A;  3CPW S;  3NTI A;  1BKB A;  3OA6 A;  3QSU A;  5CVI A;  4NL3 A;  3KUF A;  3CD6 A;  2FHD A;  1VQ8 A;  3O8V A;  5J3B A;  3GNF B;  1WPY A;  4OGE A;  1IRE B;  1BIB A;  3VKI A;  1JJ2 S;  3E9F A;  3KXT A;  2Y4X A;  4A4F A;  4EMK C;  5IT9 E;  3SWN C;  3DLL A;  4M7A F;  4EPC A;  2DXT A;  4LDV A;  3RKW A;  4OVA A;  4RKU E;  2EQU A;  3OMC A;  1P92 A;  3LGF A;  2ZPG B;  2I2L A;  3QYH B;  4WF2 A;  5LL6 S;  3X28 B;  2K3X A;  3JB9 G;  1Q7Y U;  3M5A A;  4PJO G;  3QKJ A;  1VQP A;  4L59 A;  5GMK m;  1W2B S;  3CBP A;  3CCQ A;  3UWN A;  4MZM A;  2R58 A;  3PNW C;  3PT9 A;  4JRK A;  2VXF A;  4C0Z A;  3OYE A;  2LQ8 A;  3GPL A;  2EQM A;  3CME A;  2WSF E;  1FWZ A;  3CD6 T;  3BW1 A;  1D3B B;  4Z02 A;  2MWP A;  1JJ2 A;  5FRN A;  3JCM g;  1YIT T;  2LNV A;  2E70 A;  3QYG B;  3CME T;  2GFU A;  4M77 A;  3LWH A;  1YJ9 A;  5CKH A;  3N5B B;  1N8R C;  4JJN K;  1VQ5 A;  4FT2 A;  1BI0 A;  3LLR A;  3CPF A;  1VIF A;  3CCM A;  5D6X A;  3G4S A;  2CS7 A;  5HK0 A;  2RM4 A;  1X6O A;  3QII A;  4N4G A;  4BY6 C;  1W2B A;  3SB2 A;  2QTX A;  3FLG A;  4M7D D;  4X9D A;  2X4X A;  4D6W A;  2BIV A;  5GMK l;  1WQW A;  1K73 C;  2MWO A;  4II1 A;  4XTZ A;  3MHX A;  3OYK A;  1YJN T;  3OQ5 A;  3RES A;  1UGQ B;  1Y96 A;  4M78 B;  4A4K A;  4R55 A;  3GIB A;  4MDX A;  1WJS A;  3LX7 A;  4M77 C;  4J8O A;  2ZGW A;  2JTM A;  3HRU A;  3JSC A;  1FX7 A;  2EQK A;  2KSS A;  4FU6 A;  4JLI A;  2LC4 A;  2QQA A;  3VYG A;  1YJW A;  4LDW A;  2C06 A;  3QHS A;  1KHC A;  4JRP A;  3C12 A;  2DTH A;  5FU7 C;  3L2U A;  4JLG A;  1VQK A;  1YBY A;  4MMK A;  1Q81 U;  2LTO A;  2L3R A;  2LT4 A;  4M78 D;  3M56 A;  4LDY A;  3E1S A;  1VUB A;  4PJO B;  3MP1 A;  2PUK B;  2FL7 A;  2VXE A;  4FM4 B;  5L8R E;  4C8Q E;  4N0A A;  3OYG A;  2X4J A;  1VQ9 T;  4XU3 A;  3RIR A;  3VYH B;  4J6X A;  4IUT A;  4Y91 A;  1ZHI A;  1Y7X A;  4DQ2 A;  2EFI A;  2GCX A;  5GAN d;  5GAN j;  5LJ3 h;  3PMI A;  4F7U F;  1RL2 A;  1VQK T;  4ZN3 A;  4PJO C;  3DLM A;  3X24 B;  1Q7Y C;  4L6V 5;  2D6F A;  3OS0 A;  3OMG A;  2XHC A;  2M0O A;  4M78 G;  2MAM A;  2K5F A;  3A8G B;  3QJY A;  4BI4 A;  4C0D C;  1G3Y A;  3FC3 A;  3P8B B;  4GLK A;  4XU2 A;  3RKX A;  2DXB A;  2K3Y A;  1IZ6 A;  3RER A;  2A3L A;  4JDS A;  3G71 T;  4PNO A;  2CZ7 B;  4M78 F;  5LJ3 e;  3X25 B;  3QDR B;  5AYF A;  2LCL A;  3HKS A;  5I2M A;  4C92 A;  1QW1 A;  2O4X A;  3A5Z B;  1U1T A;  2RD1 A;  2WSE E;  4ELZ C;  3L2W A;  2JTF A;  3CCS A;  2QXF A;  3CCV A;  3CC7 A;  3CEY A;  3AHU A;  1LOJ A;  2YLC A;  2L89 A;  5GAO p;  2E12 A;  4IUQ A;  2V8I A;  1LNX A;  2EIF A;  2QQS A;  1UGP B;  1SSF A;  4ZTF A;  2KK4 A;  2QA4 T;  1HK9 A;  2YHT A;  5GMK j;  4M7D B;  1R8O B;  2H3J A;  3M55 A;  4ZGE B;  2E64 A;  2AHJ B;  1UGR B;  2OAU A;  3MP8 A;  2DZ9 A;  4HCZ A;  4Y28 E;  4B9W A;  4E7H A;  2ZPF B;  3A8L B;  1NZ9 A;  2ZCF B;  4EMK A;  2JZ2 A;  4TVR A;  2Y4Y A;  3J80 E;  5LJ5 g;  5CK9 A;  4ZGJ B;  4F7U E;  1FXX A;  2CKK A;  5FU6 C;  1I8F A;  3FRN A;  3MEW A;  4XK8 E;  2LT1 A;  2E6Z A;  3V7C A;  5GAN 8;  2KAF A;  1B34 A;  4B9X A;  4PJO D;  3JCM c;  3OYH A;  2XDP A;  2KDS A;  4QVD A;  3I56 A;  2VUB A;  2XDD A;  5J26 A;  1YHQ T;  3CC7 T;  3WVE B;  2GF7 A;  1G5V A;  3ME9 A;  2X4W A;  1M5Q 1;  2E41 A;  3GNG A;  1LJO A;  5D6Y A;  2PVO B;  3C4S A;  4HKE A;  4M75 F;  2QEX A;  3M59 A;  3QUI A;  5GAN 2;  2XKO C;  3V8J A;  3CMA A;  4N0A C;  3QXE B;  1KQ2 A;  4BY6 B;  2DO3 A;  4C92 G;  2V8J A;  4C8Q A;  1VQL T;  4M75 G;  3S3M A;  2DIQ A;  4J7F A;  1AHJ B;  4JRQ A;  4F7U B;  3HRT A;  4HT8 A;  5GAO q;  2LRQ A;  2HBP A;  5GMK h;  3A8O B;  4M77 E;  2EAY A;  4RG8 A;  4P5N A;  3FJP A;  4IUV A;  4C8Q F;  2LX9 A;  4J7I A;  3M53 A;  2XDB A;  2DKG A;  2HQX A;  1Y96 B;  4M78 A;  1XNI A;  4A53 A;  2DIG A;  1NJI C;  2DXU A;  4M78 C;  2Y90 A;  2E1H A;  4M7A B;  4L5G A;  3L2R A;  1YJ9 T;  1N9R A;  1PSF A;  3WVD B;  2XIC A;  3NFC A;  4JS5 A;  2K5I A;  1Y07 A;  4JUV A;  3JCM P;  2E10 A;  1VQ9 A;  3H6Z A;  4QQG A;  3HRS A;  5KH6 A;  1Q86 U;  3DB4 A;  3OSS C;  5IN1 A;  4Q5W A;  2RK2 A;  2PUO B;  2KQW A;  4C5E A;  2P0K A;  1BIA A;  3CBM A;  3MO8 A;  2VV5 A;  2D0Q B;  4RCC A;  3CCJ T;  2KVQ G;  5GAO m;  4BB7 A;  4DOW A;  4OF1 A;  3JAM E;  4M78 E;  1OZ2 A;  3OYC A;  3ZEH A;  2R5A A;  5LJ5 e;  1WNL A;  1S72 T;  2RJC A;  1M9S A;  1X01 A;  2EWN A;  3JCM b;  3J81 E;  3CC2 A;  3KBG A;  2RHX A;  5CKD A;  1ZBX A;  2RI2 A;  2M9U A;  3RMS A;  4J5Y A;  5HKC A;  5GAO n;  2DXC A;  3HPW A;  3LH0 A;  1KC8 C;  1UEB A;  3NTH A;  4M75 B;  3LW5 E;  2XK0 A;  5GAM g;  4M7A D;  5C0M A;  2RO0 A;  2L8D A;  2LCC A;  2XI9 A;  5A2Q E;  3CXC S;  4OP0 A;  3A8H B;  3X26 B;  4C0D B;  1VQ6 T;  2DPP B;  1VQ4 T;  1N8R U;  3SWN A;  1VQ7 A;  3JCM W;  2XD0 A;  3OYL A;  3TRE A;  3A8M B;  3EFS A;  1QP3 A;  3CCU T;  3WXM B;  1YI2 A;  4RCB A;  1M8V A;  2K2V A;  3OYI A;  4M75 A;  1XQH A;  1HXD A;  2DEQ A;  4FL6 A;  4O5V A;  3FEO A;  3OW2 A;  5GMK i;  1S72 A;  4DA4 A;  1K9M C;  3M54 A;  3M9Q A;  3G7Z A;  5CQX A;  5GAN g;  4M77 G;  1W4S A;  3HHT B;  5GAM d;  2IVW A;  4XTW A;  4IKF A;  5GAM h;  3FB9 A;  1I81 A;  2JOY A;  2YRV A;  3OS5 A;  4QQ6 A;  4YTL A;  2ZPH B;  4XTV A;  4KT0 E;  4QVZ A;  3SDZ A;  4A54 A;  3CXC A;  3MCA B;  3E19 A;  2R5M A;  4A4E A;  4M7A G;  2OTJ A;  2QDY B;  4C92 C;  4PJO A;  4M75 C;  4A4H A;  2MMP A;  4KUD K;  2PVG B;  5KCH A;  4NS5 A;  3HL8 A;  1NPR A;  3OYF A;  3OW2 S;  5DM7 R;  3ER0 A;  2ZPB B;  2EYQ A;  3JCM Q;  3V7R A;  1KD1 U;  3MET A;  1M4Z A;  1UB4 A;  2DD4 A;  2EKO A;  2RK1 A;  4IUU A;  5CCA A;  1WJR A;  4C8Q B;  3URG A;  3MP6 A;  4V2S A;  4MDW A;  1WJQ A;  4PLL A;  1U8R A;  3PFS A;  1VQM A;  3F70 A;  3GF5 A;  1M90 U;  3SWN B;  3UDC A;  3VUB A;  4BI8 B;  2OTL T;  1KHI A;  3FDR A;  4QW2 A;  3JCM f;  4E7J A;  1PSE A;  2RHU A;  3OSV A;  3JCM e;  4OB2 B;  3RMQ A;  3GP8 A;  2G3R A;  3L2Z A;  3CC2 T;  3HP9 A;  3M4Y A;  4CI0 C;  4M7A C;  4M7D A;  2CYZ B;  2X35 A;  4C0F A;  1K8A C;  4C5H A;  3OYD A;  1YIJ A;  3V8L A;  5A0D A;  2PQW A;  5CIU A;  1BI3 A;  2DD5 A;  2VGN A;  2VGM A;  3E9G A;  3P8H A;  1JRI A;  3OYJ A;  3X20 B;  1K9M U;  4M77 B;  3OBY A;  4HT9 A;  4OB0 B;  1G3W A;  3FIF A;  5KE2 A;  2LDM A;  3PMT A;  1WGS A;  3OB9 A;  1MGQ A;  2DTO A;  4F7U A;  5FRM A;  1YIT A;  4NOY A;  2L5Q A;  5GAN 3;  4IUP A;  2XU8 A;  3CCR A;  1JBM A;  1WQ7 A;  5CQY A;  1Q81 C;  1V29 B;  4XTY A;  4JS4 A;  1VQ4 A;  3TEE A;  3OYM A;  4M7D E;  4XU0 A;  3CCQ T;  4C5G A;  1VQO A;  4ME7 A;  1KQ1 A;  4GY5 A;  3JCM d;  1M1G A;  3OS1 A;  4BDY A;  3PIO A;  3QZ9 B;  4FIB A;  1N9S A;  1I4K 1;  4FT4 A;  2P0Q A;  1BI2 A;  2DZC A;  2JUF A;  2V8K A;  4HCC A;  4QQD A;  2RHI A;  4MML A;  5EG2 A;  4O6J A;  5GAM j;  1VQL A;  1KQS S;  5LJ3 d;  3GLX A;  2CGH A;  3DB3 A;  3JCM V;  3V8K A;  5LJ5 j;  4M7A A;  2P0P A;  2RH2 A;  2RJE A;  5DLO A;  4BE1 A;  4E47 A;  2A7Y A;  2CZ6 B;  3G4S T;  2OTL A;  5HY6 A;  1H3Z A;  2QEX T;  4J6Y A;  4KUI A;  4CRI A;  1VQO T;  2WAC A;  2B8A A;  2IG0 A;  1VQ5 T;  2HD0 A;  2GQV A;  4XTX A;  3VU3 C;  1BI1 A;  3H8Z A;  3CCM T;  2XID A;  4X34 A;  2RJF A;  2M1H A;  3G71 A;  4EDU A;  1VQN A;  3HSB A;  2PVD B;  3TU4 K;  3BDL A;  3I56 T;  1G3S A;  4C92 F;  4JRI A;  5GAN 7;  3ZFJ A;  5I2S A;  1NJI U;  4C8Q C;  1M1F A;  1NPP A;  2ZPI B;  1YCY A;  5GAN e;  2KMT A;  4ZGD B;  5LJ5 h;  4HA8 A;  4MZT A;  3BFM A;  1KQS A;  4FSX A;  4J83 A;  3V7S A;  4ZN1 A;  2DAQ A;  3L1A A;  5DLQ E;  2MI6 A;  1GXI E;  2K57 A;  3DKM A;  1I5L A;  3CBO A;  2QQR A;  3OYB A;  3JRZ A;  3SD4 A;  2RHZ A;  3MEA A;  2F5T X;  3QG1 A;  2F69 A;  3JB9 I;  3CCE A;  1M1K U;  3T9N A;  2RJD A;  3UT1 A;  4KBM B;  1EIF A;  1YI2 T;  2CZ0 B;  2R57 A;  1VIE A;  1YJN A;  1OZ3 A;  3S3O A;  2CZ1 B;  2E6N A;  5CO7 A;  4C92 E;  4M75 E;  2E65 A;  2HNI A;  3PTA A;  3CC4 T;  3CCS T;  3CCV T;  1VQ6 A;  3CCU A;  3BY7 A;  5FU6 B;  2JNG A;  3LWI A;  2FVU A;  3C95 A;  4KUL A;  5HK3 A;  2QI2 A;  4N4I A;  3CCL A;  4OGC A;  3MEU A;  1QVF A;  3JB9 H;  2HQE A;  3NTK A;  1OI1 A;  3RUX A;  4R56 A;  4ZTJ A;  1B34 B;  5D6W A;  1YIJ T;  2DTI A;  5CAI A;  4BDZ A;  3CC4 A;  4BAC A;  1Q82 U;  2JN0 A;  4VUB A;  3G6E A;  5GAN 6;  4BE2 A;  3EFR A;  1N27 A;  4PL6 A;  4XQ3 A;  4RMO A;  3OBW A;  5C6S A;  1G3T A;  2X4Y A;  4LD9 K;  1U1S A;  4OMF B;  3OY9 A;  3I55 T;  4QVC A;  3R6O A;  4E7L A;  2FYK A;  4BUG A;  2LVM A;  2E5Q A;  2RHY A;  3CMA T;  5GAN 4;  3QJ6 A;  1K73 U;  4X9C A;  3M57 A;  4C8Q D;  5LJ5 f;  2DVE A;  2BUD A;  5A0L A;  4E7K A;  3CCE T;  3CCJ A;  5GAO r;  3LGL A;  1D3B A;  1QVF S;  1BYM A;  5GAO l;  2QQB A;  4N4H A;  5CKF A;  4C92 B;  3GOX A;  3JCM h;  1Q82 C;  2WSC E;  3PGG A;  2RA2 A;  4J6W A;  5CR2 A;  2GFA A;  4XU1 A;  4RG2 A;  4C8Q G;  1VQ8 T;  4BE0 A;  1VQN T;  4IUR A;  4EMG A;  1JB0 E;  1Y71 A;  2ZZD A;  2EJG A;  3QZ5 B;  3HFN A;  2QQ9 A;  1QP2 A;  1XOV A;  3M4G A;  5DY9 A;  4M77 D;  5KE3 A;  1KD1 C;  3HFO A;  1TH7 A;  4LD6 A;  4ELY C;  4M7D G;  2DK3 A;  2EQJ A;  4OB1 B;  3JCM J;  1KG1 A;  3LYI A;  3S6W A;  2EJ9 A;  2JVV A;  2BKD N;  3VJP A;  4EMK B;  4PJO F;  1QVG A;  2HAX A;  5CKE A;  4NL2 A;  1OYX A;  1M1K C;  3JB9 F;  5GAN f;  3OS2 A;  3ASK A;  5LJ3 g;  4M7D C;  4C5I A;  5KCO A;  3J7A F;  2VYT A;  2RB6 A;  2RI3 A;  3ZBD A;  1O9S A;  3OYN A;  4XTU A;  2ZPE B;  1XTD A;  2DJZ A;  2K5L A;  3RKY A;  3OYA A;  2F5K A;  3JB9 J;  4PLI A;  3INZ A;  3G6E T;  1NE8 A;  2EJF A;  2O01 E;  3VV0 A;  5I21 A;  4LDX A;  3L2Q A;  2RI5 A;  4XAX B;  4M7D F;  3BDU A;  4EMH A;  3Q1J A;  4MZP A;  3JB9 D;  3OYY A;  5GAM f;  1QVG S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...