2LDMA

Solution structure of human phf20 tudor2 domain bound to a p53 segment containing a dimethyllysine analog p53k370me2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
77
Chain Sequence
b'SSEFQINEQVLASWSDSRFYPAKVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFSKDQNIVGNARGSRAHSSHLSKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title PHF20 is an effector protein of p53 double lysine methylation that stabilizes and activates p53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
total genus 14
structure length 77
sequence length 78
ec nomenclature
pdb deposition date 2011-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ldmA01
4Z02A 2DAQA 3OYGA 3M9QA 4IUTA 4B9XA 4N4GA 2PQWA 3S3OA 3PFSA 4IUQA 5KCHA 2MWPA 5KE2A 5M9OA 2X4XA 4GY5A 3PMTA 4UC4A 1WJQA 2EQUA 4IURA 3FEOA 4BACA 2GFAA 4E7HA 3KUFA 4BE0A 1OZ2A 2R5AA 3DB4A 3P8DA 3O8VA 2QQSA 2RI2A 4FL6A 2BKDN 4II1A 3ME9A 4PLLA 3MEUA 1SSFA 2MWOA 4L59A 5D6YA 2X35A 1OYXA 2EQMA 3L2RA 4RG2A 2RI3A 4BE1A 2EQKA 2LDMA 3F70A 3UWNA 4QQGA 3ZEHA 3LGLA 2R57A 2P0KA 3H6ZA 2F5KA 3NTIA 3PNWC 2O4XB 3OYDA 2D9TA 3QBYA 3OMGA 3MEAA 4BE2A 3OQ5A 4CRIA 1MHNA 5IAYA 5IN1A 3MO8A 3OS1A 3LLRA 2B8AA 2X4WA 3OYFA 3OYKA 3OYIA 5FRMA 3META 4Q5WA 4IUPA 3MP6A 4B9WA 2LRQA 2HQEA 2LTOA 3LYIA 5D6WA 3LH0A 3ASKA 3QJ6A 4BD3A 4C5EA 4FU6A 2RJEA 1RI0A 3OS0A 3Q1JA 2LCCA 3C4SA 3FDRA 1H3ZA 2L8DA 2E6NA 2WACA 3L2WA 3OY9A 1OZ3A 2RJFA 3E9GA 3MP1A 3OA6A 2M1HA 3FC3A 5KH6A 3EAEA 4EDUA 3BDLA 4E7KA 4N4HA 1G5VA 1WJSA 4QQ6A 5FROA 4A4HA 3H8ZA 3FLGA 3MEVA 2M16A 5KE3A 2RHIA 2BIVA 1OI1A 2E5QA 3NTHA 4IKFA 2JZ2A 2RI5A 1N27A 2IG0A 2K3YA 3DB3A 4IUVA 4ZTJA 2JTFA 2XDPA 3QKJA 3S3NA 1WJRA 2DIQA 2FHDA 3OYLA 2NLUA 2EQJA 4QQDA 2RHYA 3CEYA 4A4FA 4E7IA 2L89A 4A4EA 3L42A 5FRNA 4C5IA 3OYBA 3UT1A 2BUDA 2HQXA 3P8HA 4C5GA 2GFUA 5KCOA 3S6WA 2GF7A 3L2VA 2RHZA 3E9FA 2EKOA 3L2QA 2RJCA 2YRVA 4PLIA 4C5HA 2M0OA 2RJDA 2CKKA 2RHUA 4OVAA 3NTKA 3LX7A 3S3MA 4LD6A 5C6SA 2RO0A 4IUUA 3OYHA 1WGSA 4NS5A 5D6XA 3OYMA 3OYNA 3LGFA 4QVZA 3DLMA 4X34A 2RHXA 5J39A 3PMIA 2O4XA 2EFIA 2R5MA 2LVMA 3OYJA 4BDYA 3MP8A 3OS2A 5J26A 3MEWA 1KHCA 2X4YA 1XNIA 2DIGA 2L3RA 3OYCA 4BDZA 2QQRA 3OMCA 3OB9A 4HCZA 4A4GA 5C0MA 3OYEA 2R58A 4QW2A 5CIUA 3QIIA 2XK0A 2K3XA 4N4IA 3GOXA 4E7JA 4ZTFA 3L2UA 2G3RA 4PL6A 3SD4A 3OYAA 2VYTA 4E7LA
chains in the Genus database with same CATH superfamily
3PIOA 3M9QA 5GAN3 3CCUT 4N4GA 3M5AA 4A63B 1RAHB 2LNHB 1K8AR 2CGHA 2DPPB 4FSXA 5FW9A 1NPPA 5GMKi 2CZ0B 2DF6A 2MWOA 4BY6C 2XI9A 2EQMA 3I55A 4J9FA 1KD1R 1ACMB 1KC8C 2KDSA 2QTVA 4J7IA 5GAN2 3RUXA 1XOVA 1QVFA 2MCNA 5IAYA 1QQJA 5CAIA 3OYIA 1KIKA 5GAOp 2NYSA 1RAIB 1G3WA 4FM4B 2GTJA 5CCAA 4BD3A 3ASKA 3QJ6A 1EZZB 4EMGA 4WCIA 5FU6C 2LCCA 1OX8A 3G6ET 1K9MU 1SRLA 1VQ9A 2O01E 3PGGA 5GAN8 1HJDA 4ZN3A 4JZ3A 2O9VA 4CC4B 2RHIA 1OI1A 3I5RA 3WXMB 4HVVA 4KBMB 1I0CA 1RAAB 4XK8E 4FYXB 4XQ3A 4C92A 1P92A 2EGEA 5GAOm 2DK3A 4FYVB 1JQQA 1RADB 2HL5C 3CCEQ 4F04B 3CMET 1WXTA 3VU3C 1PSFA 1VQOT 3EGDB 5CQYA 1OU8A 1N9SA 5EC7A 1U5SA 5IXFA 2DYIA 2QK0A 3L1AA 4OVAA 2DILA 3A8OB 1D0XA 2ROLA 1K8AC 5KYWA 4IUUA 1FMWA 2HEQA 1MV3A 2K4YA 4HVUA 2EBPA 1VUBA 3SWNC 1WNLA 4PNOA 2QEXT 4BY6B 2LVMA 4PJOF 4BDYA 1TXQA 1AEYA 3CCEA 2DIGA 1OULA 3OYEA 4JZ4A 5CIUA 1VQNA 1RABB 1X2KA 3CC7Q 1FXXA 2KGTA 1MUZA 4M7DD 2E64A 1BIBA 2JMAA 3QHSA 4R56A 5FU6B 4C8QC 4OMLA 4AFUC 3HRSA 2IIMA 3CCJT 2DEQA 1NEGA 3F70A 4ELZC 4BE2A 3OQ5A 4CRIA 2GQVA 3OYFA 3VS2A 5FRMA 1ZQ1A 3MKDA 4XU2A 1FX7A 3OA6A 2D8JA 1H641 1VYVA 4RTVA 4C8QE 1X6GA 3JB9J 2PVGB 2RJFA 5KH6A 4EMKA 3EFSA 2ROTA 3BDLA 2KXCA 4HT9A 2ZPFB 5I2SA 1PRMC 2DKGA 3JB9I 2LZ6B 1UECA 2KEAA 3M4GA 5DLOA 2EVRA 1UHFA 4JJCA 3EGDA 4XTZA 3RKWA 4DBRA 1LNXA 4A4EA 5FRNA 1X6OA 2LX9A 3FJ5A 1K9AA 2GF7A 2IVWA 3INZA 2QGGA 1M1GA 1X27A 5CKBA 4RTWA 3UATA 4M75G 3QYGB 1VQPA 2CP6A 1GCQA 4XAXB 1QVGP 2F5TX 1M1KU 1XTDA 2EFIA 5GAOl 1WHHA 2YXYA 5J26A 4M7AB 4JLIA 3EG9B 1X75C 3CCVQ 1YCSB 2LQWA 4E7LA 4MDXA 4M77D 4C0FA 2DETA 1Q7YR 4XTWA 1WA7A 4F7UF 2P4TA 1BBZA 2EQUA 2J05A 3PVQA 3PIPA 1VIFA 1UTIA 1KHIA 1YIJQ 1ZSZC 1IGQA 2XD0A 2HSEB 4HT8A 3CCVA 2FG0A 1GFDA 3TSZA 3CC4T 3TSWA 2AHJB 2F69A 2QXFA 1M5Q1 4M7DC 4M75B 2EGCA 1AZGB 2X51A 4Y28E 2A36A 4LXCA 1YJ9T 2AZVA 2JM8A 2QAZA 5IHIA 1YI2A 1YIJA 2E3IA 4PFPA 3CCQQ 2EWNA 3L2WA 2JOYA 5LL6S 4PJOG 2XMFA 2F2XA 4N4HA 2LJ1A 1Q86U 3PT9A 2YHTA 4XTVA 5DLQE 1Q82C 2BIVA 2A7YA 2FZGB 4QT7A 1H3HA 1N27A 1BCMA 4ZN1A 2MIOA 4M7DE 4KUDK 2FRWA 1WDXA 2BZ8A 3OBWA 3CCSQ 3CCQA 4LDXA 3TQ7P 2EKOA 1GBRA 3I56T 4PJMA 1K73R 3HFNA 2HZYA 2CSQA 1RLQC 4C0DC 1D3BA 3M53A 1YNZA 4CI0C 1ZSZB 2RHXA 2QA4A 1VQ7T 4JS4A 2E70A 5D7UA 3CC2Q 5FU7C 2R5MA 1BB9A 3CCSA 1K4US 2VC8A 1PHTA 2FPFA 5LJ3f 2Y4YA 5GANf 3RKXA 3L2UA 2C0IA 1UE9A 2D0QB 1Q81U 3CCLT 1JEGA 2AIRB 1AWWA 1M2OA 1NJIR 2EYZA 2K9GA 1M90R 4NL3A 3PMTA 4OF1A 4IURA 4C92D 1VOMA 1JJ2P 5KYXA 3JCMJ 1SG5A 1YBYA 3O8VA 2HDAA 2QQSA 1WX6A 1YJNT 2F2WA 1O75A 1U06A 4FSSA 4JJDA 1QVGS 5LJ3h 3D7SB 5GANh 3O5ZA 1K9MC 1ZA2B 5IN1A 4M78C 2B8AA 3JB9F 5CKDA 5GAN7 1PCXA 4IUPA 4GLMA 1E6HA 4DBQA 4MMLA 3CBPA 2E6NA 3VJPA 2LQ8A 1YN8A 2AKKA 2EQIA 4EDUA 1HK9A 2VXFA 4A4HA 3OBYA 1VQ8A 2FVUA 2JZ2A 2KYMA 3G71T 1QCFA 2K3YA 4OMNA 1QKXA 4M77E 4FW1A 3R6NA 1WXUA 2QQ9A 1WFWA 1YCYA 2LCSA 2CREA 2J6KA 4F7UG 4M78E 4KGZB 5I22A 3RBBB 3CPFA 1MMDA 2VASA 2ZPHB 5FWCA 1D1CA 3GNGA 3M0QA 1SEMA 1G83A 5GJVB 1G3YA 5I21A 4OB3B 2JUFA 2H3JA 2RNAA 4PJOA 1RLPC 2YUNA 3TCJA 2DZCA 4X34A 1I8FA 3A5ZB 3H0IA 3OYJA 3OS2A 2QTXA 4ELYC 3OYCA 4M77B 5GAOr 4HCZA 4RTUA 2DYBA 3OYAA 1ZA1B 1G3SA 2HL3A 2K6DA 1QLYA 2JTMA 4J6YA 4GY5A 4F14A 4BACA 1SPKA 1OX9A 1QP2A 1ZLMA 5LJ3j 4F7UB 5GAOn 3JRZA 3RERA 2O31A 1QVGA 3M55A 1LJOA 2YSQA 4J6XA 3CCUA 2OTLT 1D0YA 1MGQA 3H6ZA 2HQHA 1G8XA 3JCMh 3PVLA 5LJ3d 1WLPB 6AT1B 5GANd 1Q95G 2X4WA 1M8MA 2JN0A 2DEUA 3NHNA 1E7OA 5FWBA 3LWIA 4QVDA 1U3OA 1W1FA 1VQKT 1H3ZA 4LUDA 3TREA 4ANJA 2KT1A 2CZ1B 1YITQ 1RAGB 1JJ2S 3VS0A 3FLGA 2YWWA 4OP0A 1ZSGA 2E5QA 1OPLA 2RK2A 1VQ5Q 2ZZDA 4E47A 4HXJA 2JTFA 2M51A 1N8RU 3G6EA 1R8OB 3CEYA 3U23A 3J7AF 2HBWA 3VV0A 1M1KC 4OMOA 4JJNK 1U8RA 2RJCA 2A37A 1YITA 1WHJA 3S3MA 3LX7A 4JJBA 1RUWA 3QDRB 1KC8R 3E1SA 3OYMA 1GXIE 3CMEA 2D1XA 1M3BA 2O4XA 2XU8A 1VQOA 2MF2A 4J6WA 3JB9G 1I5LA 3NMZC 2BZYA 1FMVA 2EKHA 4WF2A 4F7UA 1WHKA 4C92B 3VYHB 4KH1B 5M9OA 2CP2A 3J80E 3FEOA 3HRUA 4HVWA 4II1A 3X20B 5CKHA 2RB6A 1VQ4T 4KGVB 4X9DA 1I07A 5IHNA 5KYWB 4C8QF 1B3QA 2E1HA 1KQ2A 4Z88A 2NUZA 2P0KA 2CP0A 3MEAA 2RQUA 3M0UA 1YHQT 1BYMA 3LLRA 3CCJA 4EPCA 1Q86C 3JCMd 3C12A 3EH1A 2F2VA 2LTOA 1D0ZA 1M9SA 1RI0A 5L23A 1KQSS 2RMOA 2DXTA 1JJ2A 4F16A 2M1HA 1VQ9Q 2JNGA 3E19A 1WHMA 1JB0E 3CBOA 2JT4A 4J9HA 2KRMA 3N5BB 5A0LA 4PFZA 5GMKm 2P84A 4IKFA 2K5IA 1OPKA 2DXUA 1M8VA 1UJ0A 2GQIA 3QKJA 2EQJA 3JCMP 3CD6T 3A8LB 4M75D 2EGAA 4RKUE 3P8HA 2RHZA 5GAMe 2IPOB 1M30A 4YTLA 3DLLA 2L0AA 1WXBA 1YWPA 5C6SA 1WIEA 1U1SA 2YRDA 4HCCA 1Q81C 4NL2A 1ZUKA 4EMKB 1VQ6T 1KHCA 3AT1B 1JRIA 2VXEA 4MZMA 2VUBA 2SEMA 2FZCB 1M3CA 3V7RA 3MCAB 1VQNQ 1TUGB 2JJ9A 3CCRQ 1ARKA 2VYTA 2HBPA 2P4RA 2ED0A 1I4K1 4MDWA 3VS5A 2BE7D 2I0NA 2XG8D 4IUQA 4J9DA 1Y96A 2V26A 2GFAA 3FRNA 4P5NA 1IRXA 2DXCA 1FWZA 1GL5A 4FL6A 4LDWA 2KR3A 3MEUA 5HY6A 2HSPA 1PD0A 3H0HA 3UWNA 2M0YA 3CCRA 1YFNA 2KRNA 3NTIA 1YJ9Q 2RQVA 3QBYA 3TEEA 4A54A 4PJOD 1N6AA 2QQBA 2OTJQ 4RTYA 4TVRA 3MO8A 1KQSA 2HCKA 4Q5WA 5D6WA 2J06A 3THKA 1BI2A 3CC4A 2LNVA 2COYA 1YJWQ 3FC3A 1AWXA 4M7AC 1EIFA 1M3AA 3QSUA 1YJ9A 3CCMT 3VS7A 3NTHA 4OB2B 4RMOA 2OTJA 1WYXA 2DIQA 2FHDA 3OYLA 1VQLT 4J8OA 2NUTB 5IHKA 4M4ZA 2NWMA 3JCMW 3I56Q 1S1NA 2FRYA 1UHCA 1Y71A 2EW3A 2HQXA 2GFUA 1R0BG 4ME7A 5KCOA 1YJWA 1T3SA 1OU9A 1T0HA 2VGMA 5GMKl 1VQMQ 4BI8B 1TUCA 1VQ7Q 4C8QG 3I55T 1ZHIA 2VGNA 4M7AE 1VQPQ 3NPFA 2DJZA 4M75C 2E10A 1IHWA 3I56A 3TU4K 3CCLQ 2L3RA 2GTOA 3BE3A 3M54A 2K3XA 1QW1A 3VS6A 2BE9B 1SF9A 4J83A 3UA7A 2E65A 1VQMA 2EAYA 2PNIA 2WSEE 3QUIA 1VQ7A 3OYGA 4N0AC 4IUTA 4C0ZA 1QCOA 5HK0A 5KCHA 1WZOA 2X4XA 2DRMA 1Q82R 2A28A 1HD3A 3HHTB 3EGUA 3J81E 3UPUA 4J9IA 3CCLA 4M75E 5D6YA 1D3BB 4L6V5 3H41A 1M4ZA 2YUPA 4BE1A 3KBGA 2R57A 2YRCA 4OMPA 5CR2A 2XICA 2CZ6B 2RN8A 2LP5A 2EIFA 2LCLA 5GMKh 2KMTA 2CP5A 1Y07A 2LQKA 1YI2Q 2VKNA 3Q1JA 3NGPA 4M78F 1N8RC 1BK2A 1MNDA 3EHRA 1BU1A 2QASA 2NUTA 2GGRA 2Y4XA 3H8ZA 5KYXB 1ZUYA 2B86A 3C94A 4QKUA 2K7AA 2H3EB 1WI7A 2RHYA 1D1AA 1S72Q 1TWBA 1IZ6A 4Y91A 3UT1A 5J3BA 3JCMQ 3G71A 2CDTA 4FT2A 5GAN5 1KQ1A 3CPWP 2C0TA 3CBMA 5GAN6 1K76A 2RO0A 3EGXA 2HD0A 1I1JA 3EFOB 5D6XA 3CC7T 1AWOA 1K9MR 1W4SA 3SWNA 3NFCA 4RTTA 2QA4Q 1S72A 3MP8A 4V2SA 1OOTA 5KYNA 2X4YA 7AT1B 4BDZA 2LC4A 1Z9ZA 2PU9B 3WVEB 4B6MA 4N4IA 3LW5E 1Y7XA 2D8HA 2ZAEA 3PFSA 4D8DA 4PKCC 3BFMA 1WJQA 2XDBA 3DB4A 3P8DA 2OTLQ 4C8QA 4EMHA 3JB9H 3REAB 1IREB 3G1JA 1OYXA 1CKAA 5GMKj 4RG2A 2QDYB 4PJOB 2HNIA 2M9UA 3CMAQ 2DNUA 2MMPA 3ZBDA 1VQKQ 2BZXA 2ZPBB 1SHFA 2CT3A 2KXDA 3META 3RMSA 2OTLA 2LRQA 3LH0A 4RUGA 2RJEA 4JRPA 1UG1A 3FDRA 3OYYA 5IH2A 3HFOA 2DD5A 3UA6A 4BUGA 2DVJA 2EJFA 1X2QA 1WJSA 4M77C 2DD4A 2L3PA 3MEVA 2M16A 1VQ8Q 3CMAA 1B34A 3M0RA 2RA2A 1VQKA 4FT4A 2DVEA 1DJ7B 2ENMA 5ECAA 4OGCA 3MJXA 3PE0A 3G4SQ 3BY7A 3CQTA 3EFOA 2KVQG 1K8AU 2CUDA 3L2VA 3QG1A 2RJDA 3JB9D 1IGUA 2KT8A 2DL3A 3A8HB 5LJ5h 1RI9A 1X6BA 3VS1A 1KD1U 3EH2A 3GP8A 4QVZA 5CK9A 2O88A 4LNPA 2MI6A 5J39A 4E6RA 3V8LA 2MOXA 2E3HA 4ZGEB 2K79A 3G4SA 1YIJT 2QQRA 1T0JA 3ER0A 4ZTFA 4M78G 1ZUUA 4F7UE 4KULA 4DOWA 2DMOA 3QXEB 4NOYA 1SSHA 4IIOA 3CPWS 3GBQA 2ZPGB 3QZ5B 2MK5A 1OEBA 3H9NA 3GF5A 1UGQB 3CCUQ 1QKWA 1YHQQ 2FB7A 1JO8A 1NG2A 3JCMf 3ZEHA 2O4XB 1M1KR 1KQSP 2LJ0A 2X9HA 3HKSA 4DOVA 1I5OB 1MHNA 2GNCA 3V7CA 2CT4A 2PVDB 3OYKA 5GAMh 3MPUB 1VQ4A 5LJ3g 5GANg 5GAN4 3JCMb 4J7FA 3RDVA 1KG1A 2J6OA 3OS0A 5GANj 1K0SA 3E9GA 3CCST 1YHQA 3CXCP 3EG0A 3OSVA 2G6FX 1PSEA 3JAME 2IG0A 4IUVA 2EJGA 2JTEA 4C92C 3REBB 1TU0B 3VS4A 3G6EQ 2NLUA 1B7TA 2PUOB 1W70A 3DKMA 3CC2T 2QYZA 3EG3A 5FLXE 1PG5B 2D0NA 1M2VA 1RL2A 4BI4A 1PWTA 3CD6A 3G7ZA 4J9GA 2A0FB 2I2LA 5CQXA 2A3LA 2DTIA 2PTKA 2SRCA 1BCOA 4J5YA 4AFZC 3CMEQ 3URGA 5AYFA 2YT6A 1VQOQ 4C92E 2GCXA 1Q86R 2EPDA 1Y0MA 2AK5A 2H8HA 1KJWA 5C0MA 4A4GA 2JW4A 4X1VA 2OJ2A 1F1BB 1BI3A 2ED1A 4AG1C 2DM1A 2QEXQ 4XTUA 4MMKA 3CPWA 3HTRA 3M0SA 4E7ZA 2QGFB 1U1TA 5A0GA 2DA9A 1V29B 2ESWA 1B07A 3L2RA 1TH7A 2CUBA 3RIRA 2LDMA 1AVZC 2RPNA 3C0CA 5DM7R 1UGPB 1UGVA 3FJPA 1GFCA 2QEXA 4FYWB 2OAUA 2DL4A 4AFQC 4M78A 3CCJQ 3JCMg 5LJ3e 5GANe 1N5ZA 3ZL7C 2DXBA 1Q81R 3EFRA 3EHQA 4BI3A 2F1LA 4EMKC 4RCBA 1C6VX 4OB0B 4PFOA 4E7KA 1PRLC 1Y96B 3A1PA 5FROA 2DTOA 1E6GA 1VQLQ 4J9EA 4RCCA 2W0ZA 1AZEA 4M7AF 2KY9A 3M0TA 1V76A 4C8QD 4JS5A 4E7IA 1Q7YU 3M58A 4ZGJB 3OYBA 1PNJA 1W2BP 1T3LA 4HCKA 3SDZA 3CCMA 2E41A 3E9FA 3L2QA 1RACB 3JV3A 2JMCA 3L2ZA 3GNFB 3QWYA 2EYXA 4CC7A 1VQLA 4AMCA 1GCQC 1WQWA 3CXCS 4OMQA 2K5FA 5I11A 2DE0X 1PM3A 1GRIA 4LN2A 2XIDA 1XNIA 5A2QE 2KRSA 4M75F 3QIIA 2YDLA 4E7JA 3GOXA 1NBEB 2RQTA 2KYBA 4A53A 3RR6A 4DA4A 1X01A 4ORZA 3GLXA 2XDDA 1XQHA 1OV3A 2KQWA 4E7HA 4Z8AA 5HKCA 3BW1A 3WVDB 2BTTA 2O2OA 3ME9A 4PLLA 1FMKA 4HA8A 2DERA 4FCYA 2P0QA 1PKTA 1ZBJA 1QMCA 2RF0A 4XU0A 4DQ2A 2F5KA 4BB7A 2AZSA 2D9TA 1YITT 2X3WD 5EG2A 2CH4A 4JPBW 1K73U 3JCMV 3MP6A 3HRTA 4B9WA 1VQ5T 4OMFB 4FU6A 4PJNA 3CC4Q 4JLGA 2WACA 4KH0B 3A8GB 4Z89A 3JCMe 1D1BA 3EAEA 2VVKA 1LVKA 2KK4A 2L2PA 1I81A 4D8KA 2PVOB 2V1QA 2LJ3A 3JCMc 2JS2A 4A4KA 4E7SA 1ZBXA 1JXOA 3OS5A 1RAEB 3P8BB 3SB2A 2W10A 3ULRB 1AD5A 3HPWA 3OW2P 5KYYA 2NUPB 4QQDA 1NJIU 4M7DF 2KROA 5CKEA 2LX7A 1IXDA 1GBQA 3X26B 4PK4A 1KD1C 1H8KA 2BUDA 1M90U 5KYUB 2HAXA 1G3TA 2CZ7B 1LPLA 2KNBB 1BI0A 1TG0A 3RNJA 3LWHA 3NTKA 4LD6A 4LD9K 2EYQA 3CXCA 1VA7A 2DL7A 2XKOC 5HCKA 4R55A 4XU3A 1C1AA 2DJQA 2M02A 1BIAA 2K57A 5CKFA 2K5LA 2XK0A 3CC7A 4FYYB 1PC0A 2WSCE 1N8RR 1G2BA 5CO7A 4F17A 2QG9B 4Z02A 1KSWA 1UDLA 2PQWA 4KGXB 4XTYA 1Z9QA 1W2BS 3VYGA 1R77A 2WSFE 1WPYA 4LE9A 2YLBA 2RI2A 4M7AG 2VWFA 3QDFA 3EGXB 1UFFA 2XHCA 2RI3A 1FYNA 4OB1B 2DFUA 1EX4A 4QQGA 3I5SA 2FPEA 3SFMA 2J7IA 3SWNB 4JUVA 3OYDA 1ZX6A 1VQ9T 4CC2A 1NLOC 2RQWA 3OSSC 3SEMA 1YJNQ 4JRKA 4C5HA 1NYFA 2DZ9A 1TSFA 4HCBA 1JXMA 3VUBA 1NE8A 2LT4A 2NUPA 4C8QB 1QCNA 1NZ9A 1VYTA 3DB3A 5KYUA 1UB4A 4M77F 1YJNA 4CC3A 2COWA 1TS9A 5IT9E 2KE9A 2OX7A 3MHXA 4LDUA 2ZGWA 4A4FA 2FL7A 2JS0A 2VV5A 3FIFA 5GJWB 1QVPA 2X4JA 1QWEA 3S6WA 2L5QA 2ZPIB 4J9BA 3VRZA 2O9SA 4JDSA 3G71Q 2YRVA 3E2UA 2M0OA 4Y92A 3CCET 2LT1A 4XTXA 2DBMA 3OYHA 4PJOC 2FPDA 1VQNT 3CCRT 2HMAA 3OYNA 4M78D 2QDLA 2K3BA 2V8JA 3MEWA 1XJWB 2QQAA 2V8KA 3QO3A 4C0GA 1B34B 2CP7A 4PJJA 5AT1B 4IIMA 3SD4A 3OW2S 1RAFB 1W2BA 1HSQA 4MZTA 2DLPA 1H92A 1WHLA 3A98A 3KUFA 4PJOE 4D6WA 2L3QA 2OTJT 4DBFA 1OQKA 3EG2A 1IB8A 2LMJA 1J3TA 2JXBA 4ZNXA 4PJLA 4M7DG 3M59A 3V8KA 3M57A 1YJWT 3PTAA 4FIBA 2DO3A 3OS1A 1UGRB 1PD1A 4J9CA 1VIEA 9ATCB 1AOJA 3M4YA 3T9NA 4ESRA 4C5EA 5IXBA 1KC8U 3JCMX 2MAMA 1AT1B 1Q7YC 1M1FA 1G5VA 2EYWA 4QQ6A 2YUOA 4M7AA 5KE3A 1KFZA 4E2FB 4L5GA 3EG9A 4JRIA 4KT0E 1VQMT 2FZKB 4R0KA 3S3NA 1X69A 1BI1A 2DL5A 3AHUA 3RKYA 4JRQA 4RG8A 1K1ZA 1VYUA 1HXDA 1YWOA 2ATCB 2X3XD 3HSBA 1VQPT 5HK3A 2J6FA 2L89A 3BDUA 4C92F 2C06A 3FB9A 2A08A 2JVVA 2OI3A 4M7DB 1TTHB 4WTOB 3QJYA 4O6JA 5DY9A 4PLIA 5LJ5f 2CP3A 1JBMA 1M27C 3CC2A 1Y57A 3PMIA 3I35A 3UDCA 2LQNA 1N9RA 4M75A 4EIKA 5GAOq 4KUIA 1BKBA 3OW2A 1C0MA 1QVFP 3TVTA 2G3RA 2KBTA 1IHVA 2K2MA 3CCVT 4X9CA 1YP5A 4N0AA 1IO6A 4QVCA 2MWPA 4UC4A 2PZ1A 2ECZA 3X24B 1OZ2A 1M2VB 2R5AA 1HYOA 3HL8A 1TOVA 2DX1A 2GBQA 1NLPC 4M77G 1MV0B 1YI2T 1K73C 1A0NB 4C0DB 1UEBA 3UF4A 3VRYA 4GLKA 3LGLA 3PNWC 4HKEA 4RTZA 5GAMf 2CSIA 5FU7B 4DEXA 1R0CB 4ATOA 8ATCB 1ABOA 1VQ4Q 2L8DA 1TUDA 1ZSZA 3VS3A 4AT1B 2ABLA 3OY9A 3I9QA 3MP1A 2DL8A 1S72T 1NJIC 2YLCA 4XU1A 5GMKe 3GIBA 3ZFJA 2FYKA 3CCQT 2HKNA 5I2MA 1M90C 2RI5A 2P0PA 2C0OA 2RQRA 1LCKA 4M7DA 4ZTJA 2XDPA 4DBHA 1WJRA 5L8RE 2HKQB 1D09B 4C5IA 2ZCFB 3QWXX 4AG2C 2DTHA 2COZA 2QA4T 2E6ZA 3LH5A 4M78B 2RHUA 2PUKB 2L3SA 4VUBA 1K0XA 2V8IA 4DEYA 3CD6Q 3LGFA 4KRTA 4MZPA 3DLMA 3SHWA 5LJ5g 2CYZB 2EJ9A 2RH2A 5A0DA 3H0FA 2E12A 5LJ5j 2FO0A 3OMCA 2DBKA 2RD1A 3OB9A 1MMAA 4QW2A 2JM9A 1NYGA 4PL6A 3RESA 5CVIA 3QZ9B 1WQ7A 2DAQA 2Y90A 4LUEA 2FEIA 4B9XA 3S3OA 1JU5C 2OAWA 1VQ6Q 5KE2A 2AT1B 1KK7A 4O5VA 1EFNA 5LJ5d 4BE0A 3V8JA 3HP9A 1SRMA 1QWFA 3CMAT 2BKDN 1SSFA 4L59A 2X35A 2DRKA 2KAFA 2EQKA 4C92G 2RM4A 2CH4W 3R6OA 2ZPEB 3OMGA 4LDYA 1UGSB 1VQ6A 2RK1A 1SKUB 4RTXA 4GBQA 1V1CA 2AKLA 1VQ8T 1QVFS 2HQEA 3LYIA 1UUEA 3JSCA 2CS7A 3C4SA 4K11A 1NEBA 5GAMg 1O9SA 1MMGA 1OZ3A 3KFVA 4ZGDB 3GPLA 3X28B 5GAMj 2Z0WA 1QP3A 2VB6A 1AHJB 8AT1B 2EYYA 1SHGA 3G4ST 4FW2A 1NPRA 4M77A 3KXTA 1VQ5A 1MNEA 2MYSA 2KSSA 3EG1A 4OGEA 1W6XA 3X25B 4AFSC 2QI2A 5GAMd 3L42A 1CKBA 4C5GA 1LOJA 3M56A 1Q82U 1UJYA 1AWJA 3CCMQ 1GCPA 2E5KA 3V7SA 2CKKA 1WHGA 1ABQA 2YUQA 1CSKA 3A8MB 2V1RA 3IQLA 2E4HA 1WGSA 1PKSA 4NS5A 2MPXC 4OMMA 2KI7A 3M0PA 3QPHA 4LDVA 3VKIA 2K2VA 1X43A 2D6FA 1NM7A 3QYHB 5LJ5e 3RMQA 3C95A 1MMNA 2R58A 3I55Q 3VUZA 4M7AD 5KYYB
chains in the Genus database with same CATH topology
1G3SA 4Z02A 3PIOA 3M9QA 5GAN3 1Y7XA 3CCUT 4N4GA 2PQWA 3M5AA 3PFSA 4PKCC 2JTMA 3BFMA 4GY5A 4J6YA 4XTYA 1WJQA 3VYGA 4BACA 1W2BS 1QP2A 2WSFE 2CGHA 1WPYA 2DPPB 2XDBA 4FSXA 2YLBA 3DB4A 3P8DA 4C8QA 5LJ3j 4EMHA 3JB9H 4F7UB 1NPPA 2RI2A 5GMKi 5GAOn 2CZ0B 4M7AG 3JRZA 1IREB 3RERA 2MWOA 4BY6C 2XI9A 3M55A 1QVGA 1LJOA 1OYXA 2EQMA 4J6XA 3I55A 2XHCA 4RG2A 2RI3A 5GMKj 3CCUA 2QDYB 2OTLT 4PJOB 4OB1B 2HNIA 1KC8C 1MGQA 2KDSA 4QQGA 3SFMA 3H6ZA 3SWNB 4J7IA 4JUVA 3OYDA 5GAN2 1VQ9T 2M9UA 3RUXA 3JCMh 1XOVA 5LJ3d 2MMPA 3ZBDA 5GANd 5IAYA 1QVFA 2ZPBB 3OSSC 5CAIA 2X4WA 3OYIA 3META 5GAOp 2JN0A 4JRKA 3RMSA 1G3WA 2OTLA 4FM4B 2LRQA 4C5HA 5CCAA 4BD3A 3LH0A 3ASKA 3QJ6A 4QVDA 4EMGA 3LWIA 2RJEA 4JRPA 5FU6C 2DZ9A 2LCCA 1VQKT 3FDRA 3OYYA 4HCBA 1H3ZA 3HFOA 3TREA 3G6ET 2DD5A 1K9MU 4BUGA 1VQ9A 2O01E 3VUBA 3PGGA 1NE8A 5GAN8 2LT4A 2CZ1B 2EJFA 4ZN3A 1WJSA 1JJ2S 4M77C 2DD4A 3FLGA 3MEVA 2M16A 4OP0A 2RHIA 4C8QB 1OI1A 2E5QA 2RK2A 3WXMB 1NZ9A 1B34A 3CMAA 3DB3A 2ZZDA 2RA2A 4E47A 1VQKA 1UB4A 2JTFA 4KBMB 1N8RU 4FT4A 3G6EA 2DVEA 1R8OB 4M77F 4XK8E 4XQ3A 4C92A 1YJNA 1P92A 5IT9E 1DJ7B 3CEYA 3MHXA 4LDUA 2ZGWA 4A4FA 2FL7A 5GAOm 4OGCA 2DK3A 2VV5A 3BY7A 3FIFA 1QVPA 3J7AF 2KVQG 2X4JA 3CMET 1K8AU 3S6WA 2L5QA 3VV0A 3L2VA 3VU3C 1M1KC 2ZPIB 1PSFA 4JJNK 1VQOT 2RJCA 1U8RA 4JDSA 1YITA 5CQYA 1N9SA 2YRVA 2M0OA 2RJDA 3QG1A 3L1AA 3CCET 3JB9D 4OVAA 2LT1A 4XTXA 3LX7A 3S3MA 3A8OB 3A8HB 3QDRB 5LJ5h 1K8AC 4IUUA 3OYHA 4PJOC 1VQNT 3E1SA 3OYMA 3CCRT 2K4YA 3OYNA 1KD1U 1GXIE 4M78D 3SWNC 1VUBA 3GP8A 4QVZA 1WNLA 5CK9A 3CMEA 4PNOA 2QEXT 2MI6A 5J39A 2O4XA 2XU8A 4BY6B 2LVMA 3V8LA 4PJOF 4BDYA 1VQOA 4ZGEB 2MF2A 2V8JA 3MEWA 4J6WA 3JB9G 2QQAA 3CCEA 3G4SA 1I5LA 2DIGA 2V8KA 1YIJT 2QQRA 3QO3A 3OYEA 4C0GA 1B34B 5CIUA 1VQNA 3ER0A 4ZTFA 3SD4A 4M78G 4WF2A 1FXXA 4F7UA 4C92B 3OW2S 1W2BA 3VYHB 4MZTA 4F7UE 4KULA 4M7DD 2E64A 4DOWA 5M9OA 3QXEB 4NOYA 1BIBA 3QHSA 3J80E 3FEOA 4R56A 5FU6B 3KUFA 4C8QC 4PJOE 3CPWS 4D6WA 2ZPGB 2OTJT 3HRUA 3HRSA 4II1A 3X20B 5CKHA 2RB6A 3QZ5B 3CCJT 1VQ4T 2DEQA 4X9DA 4C8QF 2E1HA 3GF5A 3M59A 3V8KA 4M7DG 1UGQB 1KQ2A 3F70A 2FB7A 3M57A 3JCMf 3ZEHA 2P0KA 4ELZC 2O4XB 1YJWT 3PTAA 4FIBA 3MEAA 4BE2A 3OQ5A 2DO3A 4CRIA 1YHQT 2GQVA 3HKSA 4DOVA 1MHNA 1BYMA 3V7CA 3OS1A 2PVDB 3LLRA 3OYFA 1UGRB 5GAMh 4EPCA 5LJ3g 3JCMd 3OYKA 3CCJA 1VQ4A 5GANg 5GAN4 1VIEA 1ZQ1A 3C12A 4XU2A 5FRMA 2LTOA 3M4YA 3JCMb 3T9NA 4J7FA 1FX7A 4C5EA 3OA6A 1KG1A 1M9SA 1KC8U 1RI0A 3OS0A 5GANj 1KQSS 2DXTA 1H641 3JCMX 4C8QE 2MAMA 3JB9J 1JJ2A 2PVGB 2RJFA 3E9GA 3CCST 2M1HA 5KH6A 2JNGA 4EMKA 3E19A 3EFSA 1YHQA 1M1FA 1Q7YC 3BDLA 1G5VA 1JB0E 3CBOA 4HT9A 2ZPFB 3N5BB 3OSVA 4QQ6A 5A0LA 2DKGA 5I2SA 5GMKm 3JB9I 4M7AA 5KE3A 4L5GA 3M4GA 1PSEA 4IKFA 4JRIA 2K5IA 3JAME 2DXUA 5DLOA 2IG0A 1M8VA 4IUVA 4KT0E 2EJGA 1VQMT 4C92C 3QKJA 3S3NA 1BI1A 3AHUA 3RKYA 4XTZA 4RG8A 4JRQA 2NLUA 2EQJA 3RKWA 1HXDA 3JCMP 3A8LB 3CD6T 2PUOB 4M75D 3HSBA 1VQPT 5HK3A 1LNXA 2L89A 3BDUA 4A4EA 1X6OA 5FRNA 4C92F 3DKMA 2C06A 2LX9A 3FB9A 3P8HA 4RKUE 3CC2T 2JVVA 2GF7A 5FLXE 4M7DB 2RHZA 2IVWA 3INZA 3QJYA 5GAMe 4O6JA 5DY9A 1M1GA 4PLIA 5CKBA 1RL2A 5LJ5f 4YTLA 3DLLA 4BI4A 5C6SA 3CD6A 3G7ZA 4M75G 5CQXA 2I2LA 3QYGB 1VQPA 2A3LA 1JBMA 1U1SA 2DTIA 4HCCA 1Q81C 4NL2A 4XAXB 3CC2A 2F5TX 3PMIA 4J5YA 1XTDA 2EFIA 4EMKB 1M1KU 3UDCA 3URGA 5GAOl 1VQ6T 4M75A 1N9RA 5AYFA 5J26A 4C92E 2GCXA 4M7AB 1KHCA 5GAOq 4KUIA 1JRIA 1BKBA 4JLIA 5C0MA 3OW2A 1X75C 2VXEA 2VUBA 4MZMA 4A4GA 3V7RA 3MCAB 2G3RA 2VYTA 2HBPA 4E7LA 1BI3A 4MDXA 4M77D 1I4K1 4MDWA 3CCVT 4C0FA 4X9CA 4XTUA 4N0AA 4XTWA 4MMKA 2XG8D 4IUQA 4F7UF 2MWPA 4QVCA 2P4TA 3CPWA 4UC4A 2EQUA 1Y96A 2GFAA 1U1TA 3FRNA 3PIPA 1VIFA 4P5NA 3X24B 1OZ2A 1KHIA 2DXCA 1FWZA 2R5AA 5A0GA 1V29B 4FL6A 3HL8A 4LDWA 2XD0A 3MEUA 5HY6A 4M77G 4HT8A 3CCVA 1YI2T 1K73C 3L2RA 4C0DB 1UEBA 1TH7A 3RIRA 2LDMA 3UWNA 3CC4T 3CCRA 2AHJB 2F69A 4GLKA 3LGLA 3PNWC 5DM7R 2QXFA 1UGPB 3FJPA 3NTIA 1M5Q1 4M7DC 3QBYA 4HKEA 3TEEA 4M75B 2QEXA 5GAMf 4A54A 5FU7B 4Y28E 4PJOD 1N6AA 2QQBA 4TVRA 3MO8A 2OAUA 4ATOA 1KQSA 1YJ9T 4M78A 4Q5WA 1YI2A 1YIJA 5D6WA 3JCMg 5LJ3e 5GANe 1BI2A 3CC4A 2DXBA 3EFRA 2LNVA 2L8DA 2EWNA 4BI3A 3L2WA 3OY9A 4EMKC 2JOYA 4RCBA 3MP1A 3FC3A 5LL6S 1NJIC 4PJOG 1S72T 2YLCA 4XU1A 5GMKe 4OB0B 3GIBA 3ZFJA 4M7AC 4E7KA 4N4HA 1Y96B 2FYKA 1EIFA 1Q86U 3CCQT 3QSUA 3PT9A 5FROA 2YHTA 2DTOA 5I2MA 1YJ9A 1M90C 4XTVA 3CCMT 5DLQE 1Q82C 2BIVA 2A7YA 3NTHA 4RCCA 2RI5A 2P0PA 4OB2B 4RMOA 1N27A 4ZN1A 4M7DA 2OTJA 4M7AF 4ZTJA 2XDPA 2KY9A 3OYAA 1WJRA 4M7DE 2DIQA 2FHDA 4KUDK 3OYLA 5L8RE 3OBWA 4C8QD 4JS5A 1VQLT 4J8OA 4E7IA 1Q7YU 3M58A 3JCMW 4ZGJB 4C5IA 3OYBA 3CCQA 1Y71A 4LDXA 2ZCFB 2HQXA 2DTHA 2GFUA 4ME7A 3SDZA 5KCOA 2E41A 3CCMA 2QA4T 1YJWA 3E9FA 2E6ZA 2EKOA 3L2QA 3I56T 2VGMA 3L2ZA 5GMKl 3GNFB 4M78B 4BI8B 2RHUA 3HFNA 2PUKB 4VUBA 4C8QG 1VQLA 4C0DC 3I55T 1ZHIA 2V8IA 2VGNA 1D3BA 3M53A 4M7AE 4CI0C 1Q86C 3LGFA 4MZPA 3DLMA 2DJZA 2RHXA 2QA4A 1VQ7T 4M75C 4JS4A 1WQWA 2E70A 5LJ5g 2E10A 2CYZB 2R5MA 2EJ9A 5FU7C 3CXCS 3CCSA 2RH2A 2K5FA 5A0DA 3I56A 3TU4K 2XIDA 2E12A 5LJ5j 1XNIA 2VC8A 2L3RA 5A2QE 3OMCA 2RD1A 3OB9A 4M75F 4QW2A 5LJ3f 2Y4YA 3QIIA 5GANf 3M54A 2K3XA 3RKXA 1QW1A 3GOXA 4E7JA 3L2UA 4PL6A 4J83A 3RESA 5CVIA 2E65A 2D0QB 1VQMA 1Q81U 2EAYA 3QUIA 2WSEE 1WQ7A 3QZ9B 2DAQA 4A53A 3OYGA 4N0AC 2Y90A 3CCLT 4IUTA 4DA4A 1VQ7A 1X01A 4B9XA 4C0ZA 5HK0A 3S3OA 5KCHA 5KE2A 2X4XA 3GLXA 3PMTA 4NL3A 4IURA 1XQHA 4OF1A 4C92D 4O5VA 2KQWA 5LJ5d 2XDDA 4E7HA 4BE0A 3HHTB 3JCMJ 3V8JA 3HP9A 3J81E 3UPUA 3CMAT 1YBYA 5HKCA 3BW1A 3O8VA 3WVDB 2QQSA 2BKDN 3ME9A 4PLLA 3CCLA 1SSFA 4HA8A 4L59A 1YJNT 4M75E 5D6YA 2X35A 1D3BB 1O75A 2KAFA 4L6V5 2P0QA 1M4ZA 4BE1A 2EQKA 4XU0A 4C92G 1QVGS 4DQ2A 3KBGA 2R57A 2RM4A 2F5KA 5LJ3h 4BB7A 5GANh 3R6OA 1K9MC 2D9TA 2ZPEB 3OMGA 4LDYA 5CR2A 1UGSB 1YITT 2XICA 5EG2A 2CZ6B 1VQ6A 2RK1A 5IN1A 4M78C 2B8AA 2EIFA 3JB9F 2LCLA 5CKDA 5GMKh 2KMTA 5GAN7 1K73U 1VQ8T 4IUPA 3JCMV 1Y07A 3HRTA 3MP6A 2LQKA 4B9WA 2HQEA 3LYIA 1VQ5T 1QVFS 4OMFB 3JSCA 4FU6A 3Q1JA 4MMLA 2CS7A 3C4SA 3CBPA 4M78F 5GAMg 4JLGA 2WACA 2E6NA 3A8GB 3JCMe 1N8RC 1O9SA 3VJPA 4ZGDB 1OZ3A 2LQ8A 3GPLA 3X28B 3EAEA 4EDUA 1QP3A 5GAMj 1AHJB 1HK9A 2KK4A 2VXFA 3G4ST 2Y4XA 1I81A 1NPRA 4A4HA 3H8ZA 3OBYA 1VQ8A 4M77A 2PVOB 3JCMc 3KXTA 2FVUA 2JZ2A 4A4KA 1VQ5A 1ZBXA 3G71T 2K3YA 4M77E 3C94A 3OS5A 2KSSA 3P8BB 3SB2A 2QQ9A 3HPWA 4OGEA 1YCYA 4QQDA 3X25B 1NJIU 2RHYA 4M7DF 5CKEA 2QI2A 4F7UG 3X26B 4M78E 5GAMd 3L42A 1KD1C 3CPFA 1IZ6A 4Y91A 2BUDA 3UT1A 1M90U 4C5GA 1LOJA 2ZPHB 3M56A 5J3BA 1Q82U 3GNGA 2HAXA 3JCMQ 1G3TA 2CZ7B 3G71A 4FT2A 1G3YA 5GAN5 1KQ1A 5I21A 3V7SA 1BI0A 2CKKA 3LWHA 3CBMA 5GAN6 3NTKA 4OB3B 4LD6A 2JUFA 3A8MB 2RO0A 4LD9K 1WGSA 2HD0A 2H3JA 4NS5A 2EYQA 5D6XA 3CXCA 3CC7T 4PJOA 3TCJA 2DZCA 4X34A 1W4SA 1I8FA 2XKOC 3A5ZB 3SWNA 3NFCA 3QPHA 4LDVA 4XU3A 3VKIA 4R55A 2K2VA 3OYJA 1S72A 2D6FA 3MP8A 3OS2A 4V2SA 3QYHB 5LJ5e 2QTXA 2X4YA 3RMQA 4ELYC 1BIAA 2K57A 3C95A 2LC4A 4M77B 4HCZA 5CKFA 3OYCA 4BDZA 5GAOr 2R58A 2K5LA 2PU9B 2XK0A 3WVEB 4N4IA 3CC7A 3VUZA 4M7AD 2WSCE 3LW5E 5CO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z02 A;  2DAQ A;  3OYG A;  3M9Q A;  4IUT A;  4B9X A;  4N4G A;  2PQW A;  3S3O A;  3PFS A;  4IUQ A;  5KCH A;  2MWP A;  5KE2 A;  5M9O A;  2X4X A;  4GY5 A;  3PMT A;  4UC4 A;  1WJQ A;  2EQU A;  4IUR A;  3FEO A;  4BAC A;  2GFA A;  4E7H A;  3KUF A;  4BE0 A;  1OZ2 A;  2R5A A;  3DB4 A;  3P8D A;  3O8V A;  2QQS A;  2RI2 A;  4FL6 A;  2BKD N;  4II1 A;  3ME9 A;  4PLL A;  3MEU A;  1SSF A;  2MWO A;  4L59 A;  5D6Y A;  2X35 A;  1OYX A;  2EQM A;  3L2R A;  4RG2 A;  2RI3 A;  4BE1 A;  2EQK A;  2LDM A;  3F70 A;  3UWN A;  4QQG A;  3ZEH A;  3LGL A;  2R57 A;  2P0K A;  3H6Z A;  2F5K A;  3NTI A;  3PNW C;  2O4X B;  3OYD A;  2D9T A;  3QBY A;  3OMG A;  3MEA A;  4BE2 A;  3OQ5 A;  4CRI A;  1MHN A;  5IAY A;  5IN1 A;  3MO8 A;  3OS1 A;  3LLR A;  2B8A A;  2X4W A;  3OYF A;  3OYK A;  3OYI A;  5FRM A;  3MET A;  4Q5W A;  4IUP A;  3MP6 A;  4B9W A;  2LRQ A;  2HQE A;  2LTO A;  3LYI A;  5D6W A;  3LH0 A;  3ASK A;  3QJ6 A;  4BD3 A;  4C5E A;  4FU6 A;  2RJE A;  1RI0 A;  3OS0 A;  3Q1J A;  2LCC A;  3C4S A;  3FDR A;  1H3Z A;  2L8D A;  2E6N A;  2WAC A;  3L2W A;  3OY9 A;  1OZ3 A;  2RJF A;  3E9G A;  3MP1 A;  3OA6 A;  2M1H A;  3FC3 A;  5KH6 A;  3EAE A;  4EDU A;  3BDL A;  4E7K A;  4N4H A;  1G5V A;  1WJS A;  4QQ6 A;  5FRO A;  4A4H A;  3H8Z A;  3FLG A;  3MEV A;  2M16 A;  5KE3 A;  2RHI A;  2BIV A;  1OI1 A;  2E5Q A;  3NTH A;  4IKF A;  2JZ2 A;  2RI5 A;  1N27 A;  2IG0 A;  2K3Y A;  3DB3 A;  4IUV A;  4ZTJ A;  2JTF A;  2XDP A;  3QKJ A;  3S3N A;  1WJR A;  2DIQ A;  2FHD A;  3OYL A;  2NLU A;  2EQJ A;  4QQD A;  2RHY A;  3CEY A;  4A4F A;  4E7I A;  2L89 A;  4A4E A;  3L42 A;  5FRN A;  4C5I A;  3OYB A;  3UT1 A;  2BUD A;  2HQX A;  3P8H A;  4C5G A;  2GFU A;  5KCO A;  3S6W A;  2GF7 A;  3L2V A;  2RHZ A;  3E9F A;  2EKO A;  3L2Q A;  2RJC A;  2YRV A;  4PLI A;  4C5H A;  2M0O A;  2RJD A;  2CKK A;  2RHU A;  4OVA A;  3NTK A;  3LX7 A;  3S3M A;  4LD6 A;  5C6S A;  2RO0 A;  4IUU A;  3OYH A;  1WGS A;  4NS5 A;  5D6X A;  3OYM A;  3OYN A;  3LGF A;  4QVZ A;  3DLM A;  4X34 A;  2RHX A;  5J39 A;  3PMI A;  2O4X A;  2EFI A;  2R5M A;  2LVM A;  3OYJ A;  4BDY A;  3MP8 A;  3OS2 A;  5J26 A;  3MEW A;  1KHC A;  2X4Y A;  1XNI A;  2DIG A;  2L3R A;  3OYC A;  4BDZ A;  2QQR A;  3OMC A;  3OB9 A;  4HCZ A;  4A4G A;  5C0M A;  3OYE A;  2R58 A;  4QW2 A;  5CIU A;  3QII A;  2XK0 A;  2K3X A;  4N4I A;  3GOX A;  4E7J A;  4ZTF A;  3L2U A;  2G3R A;  4PL6 A;  3SD4 A;  3OYA A;  2VYT A;  4E7L A; 
#chains in the Genus database with same CATH topology
 3PIO A;  3M9Q A;  5GAN 3;  3CCU T;  4N4G A;  3M5A A;  4A63 B;  1RAH B;  2LNH B;  1K8A R;  2CGH A;  2DPP B;  4FSX A;  5FW9 A;  1NPP A;  5GMK i;  2CZ0 B;  2DF6 A;  2MWO A;  4BY6 C;  2XI9 A;  2EQM A;  3I55 A;  4J9F A;  1KD1 R;  1ACM B;  1KC8 C;  2KDS A;  2QTV A;  4J7I A;  5GAN 2;  3RUX A;  1XOV A;  1QVF A;  2MCN A;  5IAY A;  1QQJ A;  5CAI A;  3OYI A;  1KIK A;  5GAO p;  2NYS A;  1RAI B;  1G3W A;  4FM4 B;  2GTJ A;  5CCA A;  4BD3 A;  3ASK A;  3QJ6 A;  1EZZ B;  4EMG A;  4WCI A;  5FU6 C;  2LCC A;  1OX8 A;  3G6E T;  1K9M U;  1SRL A;  1VQ9 A;  2O01 E;  3PGG A;  5GAN 8;  1HJD A;  4ZN3 A;  4JZ3 A;  2O9V A;  4CC4 B;  2RHI A;  1OI1 A;  3I5R A;  3WXM B;  4HVV A;  4KBM B;  1I0C A;  1RAA B;  4XK8 E;  4FYX B;  4XQ3 A;  4C92 A;  1P92 A;  2EGE A;  5GAO m;  2DK3 A;  4FYV B;  1JQQ A;  1RAD B;  2HL5 C;  3CCE Q;  4F04 B;  3CME T;  1WXT A;  3VU3 C;  1PSF A;  1VQO T;  3EGD B;  5CQY A;  1OU8 A;  1N9S A;  5EC7 A;  1U5S A;  5IXF A;  2DYI A;  2QK0 A;  3L1A A;  4OVA A;  2DIL A;  3A8O B;  1D0X A;  2ROL A;  1K8A C;  5KYW A;  4IUU A;  1FMW A;  2HEQ A;  1MV3 A;  2K4Y A;  4HVU A;  2EBP A;  1VUB A;  3SWN C;  1WNL A;  4PNO A;  2QEX T;  4BY6 B;  2LVM A;  4PJO F;  4BDY A;  1TXQ A;  1AEY A;  3CCE A;  2DIG A;  1OUL A;  3OYE A;  4JZ4 A;  5CIU A;  1VQN A;  1RAB B;  1X2K A;  3CC7 Q;  1FXX A;  2KGT A;  1MUZ A;  4M7D D;  2E64 A;  1BIB A;  2JMA A;  3QHS A;  4R56 A;  5FU6 B;  4C8Q C;  4OML A;  4AFU C;  3HRS A;  2IIM A;  3CCJ T;  2DEQ A;  1NEG A;  3F70 A;  4ELZ C;  4BE2 A;  3OQ5 A;  4CRI A;  2GQV A;  3OYF A;  3VS2 A;  5FRM A;  1ZQ1 A;  3MKD A;  4XU2 A;  1FX7 A;  3OA6 A;  2D8J A;  1H64 1;  1VYV A;  4RTV A;  4C8Q E;  1X6G A;  3JB9 J;  2PVG B;  2RJF A;  5KH6 A;  4EMK A;  3EFS A;  2ROT A;  3BDL A;  2KXC A;  4HT9 A;  2ZPF B;  5I2S A;  1PRM C;  2DKG A;  3JB9 I;  2LZ6 B;  1UEC A;  2KEA A;  3M4G A;  5DLO A;  2EVR A;  1UHF A;  4JJC A;  3EGD A;  4XTZ A;  3RKW A;  4DBR A;  1LNX A;  4A4E A;  5FRN A;  1X6O A;  2LX9 A;  3FJ5 A;  1K9A A;  2GF7 A;  2IVW A;  3INZ A;  2QGG A;  1M1G A;  1X27 A;  5CKB A;  4RTW A;  3UAT A;  4M75 G;  3QYG B;  1VQP A;  2CP6 A;  1GCQ A;  4XAX B;  1QVG P;  2F5T X;  1M1K U;  1XTD A;  2EFI A;  5GAO l;  1WHH A;  2YXY A;  5J26 A;  4M7A B;  4JLI A;  3EG9 B;  1X75 C;  3CCV Q;  1YCS B;  2LQW A;  4E7L A;  4MDX A;  4M77 D;  4C0F A;  2DET A;  1Q7Y R;  4XTW A;  1WA7 A;  4F7U F;  2P4T A;  1BBZ A;  2EQU A;  2J05 A;  3PVQ A;  3PIP A;  1VIF A;  1UTI A;  1KHI A;  1YIJ Q;  1ZSZ C;  1IGQ A;  2XD0 A;  2HSE B;  4HT8 A;  3CCV A;  2FG0 A;  1GFD A;  3TSZ A;  3CC4 T;  3TSW A;  2AHJ B;  2F69 A;  2QXF A;  1M5Q 1;  4M7D C;  4M75 B;  2EGC A;  1AZG B;  2X51 A;  4Y28 E;  2A36 A;  4LXC A;  1YJ9 T;  2AZV A;  2JM8 A;  2QAZ A;  5IHI A;  1YI2 A;  1YIJ A;  2E3I A;  4PFP A;  3CCQ Q;  2EWN A;  3L2W A;  2JOY A;  5LL6 S;  4PJO G;  2XMF A;  2F2X A;  4N4H A;  2LJ1 A;  1Q86 U;  3PT9 A;  2YHT A;  4XTV A;  5DLQ E;  1Q82 C;  2BIV A;  2A7Y A;  2FZG B;  4QT7 A;  1H3H A;  1N27 A;  1BCM A;  4ZN1 A;  2MIO A;  4M7D E;  4KUD K;  2FRW A;  1WDX A;  2BZ8 A;  3OBW A;  3CCS Q;  3CCQ A;  4LDX A;  3TQ7 P;  2EKO A;  1GBR A;  3I56 T;  4PJM A;  1K73 R;  3HFN A;  2HZY A;  2CSQ A;  1RLQ C;  4C0D C;  1D3B A;  3M53 A;  1YNZ A;  4CI0 C;  1ZSZ B;  2RHX A;  2QA4 A;  1VQ7 T;  4JS4 A;  2E70 A;  5D7U A;  3CC2 Q;  5FU7 C;  2R5M A;  1BB9 A;  3CCS A;  1K4U S;  2VC8 A;  1PHT A;  2FPF A;  5LJ3 f;  2Y4Y A;  5GAN f;  3RKX A;  3L2U A;  2C0I A;  1UE9 A;  2D0Q B;  1Q81 U;  3CCL T;  1JEG A;  2AIR B;  1AWW A;  1M2O A;  1NJI R;  2EYZ A;  2K9G A;  1M90 R;  4NL3 A;  3PMT A;  4OF1 A;  4IUR A;  4C92 D;  1VOM A;  1JJ2 P;  5KYX A;  3JCM J;  1SG5 A;  1YBY A;  3O8V A;  2HDA A;  2QQS A;  1WX6 A;  1YJN T;  2F2W A;  1O75 A;  1U06 A;  4FSS A;  4JJD A;  1QVG S;  5LJ3 h;  3D7S B;  5GAN h;  3O5Z A;  1K9M C;  1ZA2 B;  5IN1 A;  4M78 C;  2B8A A;  3JB9 F;  5CKD A;  5GAN 7;  1PCX A;  4IUP A;  4GLM A;  1E6H A;  4DBQ A;  4MML A;  3CBP A;  2E6N A;  3VJP A;  2LQ8 A;  1YN8 A;  2AKK A;  2EQI A;  4EDU A;  1HK9 A;  2VXF A;  4A4H A;  3OBY A;  1VQ8 A;  2FVU A;  2JZ2 A;  2KYM A;  3G71 T;  1QCF A;  2K3Y A;  4OMN A;  1QKX A;  4M77 E;  4FW1 A;  3R6N A;  1WXU A;  2QQ9 A;  1WFW A;  1YCY A;  2LCS A;  2CRE A;  2J6K A;  4F7U G;  4M78 E;  4KGZ B;  5I22 A;  3RBB B;  3CPF A;  1MMD A;  2VAS A;  2ZPH B;  5FWC A;  1D1C A;  3GNG A;  3M0Q A;  1SEM A;  1G83 A;  5GJV B;  1G3Y A;  5I21 A;  4OB3 B;  2JUF A;  2H3J A;  2RNA A;  4PJO A;  1RLP C;  2YUN A;  3TCJ A;  2DZC A;  4X34 A;  1I8F A;  3A5Z B;  3H0I A;  3OYJ A;  3OS2 A;  2QTX A;  4ELY C;  3OYC A;  4M77 B;  5GAO r;  4HCZ A;  4RTU A;  2DYB A;  3OYA A;  1ZA1 B;  1G3S A;  2HL3 A;  2K6D A;  1QLY A;  2JTM A;  4J6Y A;  4GY5 A;  4F14 A;  4BAC A;  1SPK A;  1OX9 A;  1QP2 A;  1ZLM A;  5LJ3 j;  4F7U B;  5GAO n;  3JRZ A;  3RER A;  2O31 A;  1QVG A;  3M55 A;  1LJO A;  2YSQ A;  4J6X A;  3CCU A;  2OTL T;  1D0Y A;  1MGQ A;  3H6Z A;  2HQH A;  1G8X A;  3JCM h;  3PVL A;  5LJ3 d;  1WLP B;  6AT1 B;  5GAN d;  1Q95 G;  2X4W A;  1M8M A;  2JN0 A;  2DEU A;  3NHN A;  1E7O A;  5FWB A;  3LWI A;  4QVD A;  1U3O A;  1W1F A;  1VQK T;  1H3Z A;  4LUD A;  3TRE A;  4ANJ A;  2KT1 A;  2CZ1 B;  1YIT Q;  1RAG B;  1JJ2 S;  3VS0 A;  3FLG A;  2YWW A;  4OP0 A;  1ZSG A;  2E5Q A;  1OPL A;  2RK2 A;  1VQ5 Q;  2ZZD A;  4E47 A;  4HXJ A;  2JTF A;  2M51 A;  1N8R U;  3G6E A;  1R8O B;  3CEY A;  3U23 A;  3J7A F;  2HBW A;  3VV0 A;  1M1K C;  4OMO A;  4JJN K;  1U8R A;  2RJC A;  2A37 A;  1YIT A;  1WHJ A;  3S3M A;  3LX7 A;  4JJB A;  1RUW A;  3QDR B;  1KC8 R;  3E1S A;  3OYM A;  1GXI E;  3CME A;  2D1X A;  1M3B A;  2O4X A;  2XU8 A;  1VQO A;  2MF2 A;  4J6W A;  3JB9 G;  1I5L A;  3NMZ C;  2BZY A;  1FMV A;  2EKH A;  4WF2 A;  4F7U A;  1WHK A;  4C92 B;  3VYH B;  4KH1 B;  5M9O A;  2CP2 A;  3J80 E;  3FEO A;  3HRU A;  4HVW A;  4II1 A;  3X20 B;  5CKH A;  2RB6 A;  1VQ4 T;  4KGV B;  4X9D A;  1I07 A;  5IHN A;  5KYW B;  4C8Q F;  1B3Q A;  2E1H A;  1KQ2 A;  4Z88 A;  2NUZ A;  2P0K A;  2CP0 A;  3MEA A;  2RQU A;  3M0U A;  1YHQ T;  1BYM A;  3LLR A;  3CCJ A;  4EPC A;  1Q86 C;  3JCM d;  3C12 A;  3EH1 A;  2F2V A;  2LTO A;  1D0Z A;  1M9S A;  1RI0 A;  5L23 A;  1KQS S;  2RMO A;  2DXT A;  1JJ2 A;  4F16 A;  2M1H A;  1VQ9 Q;  2JNG A;  3E19 A;  1WHM A;  1JB0 E;  3CBO A;  2JT4 A;  4J9H A;  2KRM A;  3N5B B;  5A0L A;  4PFZ A;  5GMK m;  2P84 A;  4IKF A;  2K5I A;  1OPK A;  2DXU A;  1M8V A;  1UJ0 A;  2GQI A;  3QKJ A;  2EQJ A;  3JCM P;  3CD6 T;  3A8L B;  4M75 D;  2EGA A;  4RKU E;  3P8H A;  2RHZ A;  5GAM e;  2IPO B;  1M30 A;  4YTL A;  3DLL A;  2L0A A;  1WXB A;  1YWP A;  5C6S A;  1WIE A;  1U1S A;  2YRD A;  4HCC A;  1Q81 C;  4NL2 A;  1ZUK A;  4EMK B;  1VQ6 T;  1KHC A;  3AT1 B;  1JRI A;  2VXE A;  4MZM A;  2VUB A;  2SEM A;  2FZC B;  1M3C A;  3V7R A;  3MCA B;  1VQN Q;  1TUG B;  2JJ9 A;  3CCR Q;  1ARK A;  2VYT A;  2HBP A;  2P4R A;  2ED0 A;  1I4K 1;  4MDW A;  3VS5 A;  2BE7 D;  2I0N A;  2XG8 D;  4IUQ A;  4J9D A;  1Y96 A;  2V26 A;  2GFA A;  3FRN A;  4P5N A;  1IRX A;  2DXC A;  1FWZ A;  1GL5 A;  4FL6 A;  4LDW A;  2KR3 A;  3MEU A;  5HY6 A;  2HSP A;  1PD0 A;  3H0H A;  3UWN A;  2M0Y A;  3CCR A;  1YFN A;  2KRN A;  3NTI A;  1YJ9 Q;  2RQV A;  3QBY A;  3TEE A;  4A54 A;  4PJO D;  1N6A A;  2QQB A;  2OTJ Q;  4RTY A;  4TVR A;  3MO8 A;  1KQS A;  2HCK A;  4Q5W A;  5D6W A;  2J06 A;  3THK A;  1BI2 A;  3CC4 A;  2LNV A;  2COY A;  1YJW Q;  3FC3 A;  1AWX A;  4M7A C;  1EIF A;  1M3A A;  3QSU A;  1YJ9 A;  3CCM T;  3VS7 A;  3NTH A;  4OB2 B;  4RMO A;  2OTJ A;  1WYX A;  2DIQ A;  2FHD A;  3OYL A;  1VQL T;  4J8O A;  2NUT B;  5IHK A;  4M4Z A;  2NWM A;  3JCM W;  3I56 Q;  1S1N A;  2FRY A;  1UHC A;  1Y71 A;  2EW3 A;  2HQX A;  2GFU A;  1R0B G;  4ME7 A;  5KCO A;  1YJW A;  1T3S A;  1OU9 A;  1T0H A;  2VGM A;  5GMK l;  1VQM Q;  4BI8 B;  1TUC A;  1VQ7 Q;  4C8Q G;  3I55 T;  1ZHI A;  2VGN A;  4M7A E;  1VQP Q;  3NPF A;  2DJZ A;  4M75 C;  2E10 A;  1IHW A;  3I56 A;  3TU4 K;  3CCL Q;  2L3R A;  2GTO A;  3BE3 A;  3M54 A;  2K3X A;  1QW1 A;  3VS6 A;  2BE9 B;  1SF9 A;  4J83 A;  3UA7 A;  2E65 A;  1VQM A;  2EAY A;  2PNI A;  2WSE E;  3QUI A;  1VQ7 A;  3OYG A;  4N0A C;  4IUT A;  4C0Z A;  1QCO A;  5HK0 A;  5KCH A;  1WZO A;  2X4X A;  2DRM A;  1Q82 R;  2A28 A;  1HD3 A;  3HHT B;  3EGU A;  3J81 E;  3UPU A;  4J9I A;  3CCL A;  4M75 E;  5D6Y A;  1D3B B;  4L6V 5;  3H41 A;  1M4Z A;  2YUP A;  4BE1 A;  3KBG A;  2R57 A;  2YRC A;  4OMP A;  5CR2 A;  2XIC A;  2CZ6 B;  2RN8 A;  2LP5 A;  2EIF A;  2LCL A;  5GMK h;  2KMT A;  2CP5 A;  1Y07 A;  2LQK A;  1YI2 Q;  2VKN A;  3Q1J A;  3NGP A;  4M78 F;  1N8R C;  1BK2 A;  1MND A;  3EHR A;  1BU1 A;  2QAS A;  2NUT A;  2GGR A;  2Y4X A;  3H8Z A;  5KYX B;  1ZUY A;  2B86 A;  3C94 A;  4QKU A;  2K7A A;  2H3E B;  1WI7 A;  2RHY A;  1D1A A;  1S72 Q;  1TWB A;  1IZ6 A;  4Y91 A;  3UT1 A;  5J3B A;  3JCM Q;  3G71 A;  2CDT A;  4FT2 A;  5GAN 5;  1KQ1 A;  3CPW P;  2C0T A;  3CBM A;  5GAN 6;  1K76 A;  2RO0 A;  3EGX A;  2HD0 A;  1I1J A;  3EFO B;  5D6X A;  3CC7 T;  1AWO A;  1K9M R;  1W4S A;  3SWN A;  3NFC A;  4RTT A;  2QA4 Q;  1S72 A;  3MP8 A;  4V2S A;  1OOT A;  5KYN A;  2X4Y A;  7AT1 B;  4BDZ A;  2LC4 A;  1Z9Z A;  2PU9 B;  3WVE B;  4B6M A;  4N4I A;  3LW5 E;  1Y7X A;  2D8H A;  2ZAE A;  3PFS A;  4D8D A;  4PKC C;  3BFM A;  1WJQ A;  2XDB A;  3DB4 A;  3P8D A;  2OTL Q;  4C8Q A;  4EMH A;  3JB9 H;  3REA B;  1IRE B;  3G1J A;  1OYX A;  1CKA A;  5GMK j;  4RG2 A;  2QDY B;  4PJO B;  2HNI A;  2M9U A;  3CMA Q;  2DNU A;  2MMP A;  3ZBD A;  1VQK Q;  2BZX A;  2ZPB B;  1SHF A;  2CT3 A;  2KXD A;  3MET A;  3RMS A;  2OTL A;  2LRQ A;  3LH0 A;  4RUG A;  2RJE A;  4JRP A;  1UG1 A;  3FDR A;  3OYY A;  5IH2 A;  3HFO A;  2DD5 A;  3UA6 A;  4BUG A;  2DVJ A;  2EJF A;  1X2Q A;  1WJS A;  4M77 C;  2DD4 A;  2L3P A;  3MEV A;  2M16 A;  1VQ8 Q;  3CMA A;  1B34 A;  3M0R A;  2RA2 A;  1VQK A;  4FT4 A;  2DVE A;  1DJ7 B;  2ENM A;  5ECA A;  4OGC A;  3MJX A;  3PE0 A;  3G4S Q;  3BY7 A;  3CQT A;  3EFO A;  2KVQ G;  1K8A U;  2CUD A;  3L2V A;  3QG1 A;  2RJD A;  3JB9 D;  1IGU A;  2KT8 A;  2DL3 A;  3A8H B;  5LJ5 h;  1RI9 A;  1X6B A;  3VS1 A;  1KD1 U;  3EH2 A;  3GP8 A;  4QVZ A;  5CK9 A;  2O88 A;  4LNP A;  2MI6 A;  5J39 A;  4E6R A;  3V8L A;  2MOX A;  2E3H A;  4ZGE B;  2K79 A;  3G4S A;  1YIJ T;  2QQR A;  1T0J A;  3ER0 A;  4ZTF A;  4M78 G;  1ZUU A;  4F7U E;  4KUL A;  4DOW A;  2DMO A;  3QXE B;  4NOY A;  1SSH A;  4IIO A;  3CPW S;  3GBQ A;  2ZPG B;  3QZ5 B;  2MK5 A;  1OEB A;  3H9N A;  3GF5 A;  1UGQ B;  3CCU Q;  1QKW A;  1YHQ Q;  2FB7 A;  1JO8 A;  1NG2 A;  3JCM f;  3ZEH A;  2O4X B;  1M1K R;  1KQS P;  2LJ0 A;  2X9H A;  3HKS A;  4DOV A;  1I5O B;  1MHN A;  2GNC A;  3V7C A;  2CT4 A;  2PVD B;  3OYK A;  5GAM h;  3MPU B;  1VQ4 A;  5LJ3 g;  5GAN g;  5GAN 4;  3JCM b;  4J7F A;  3RDV A;  1KG1 A;  2J6O A;  3OS0 A;  5GAN j;  1K0S A;  3E9G A;  3CCS T;  1YHQ A;  3CXC P;  3EG0 A;  3OSV A;  2G6F X;  1PSE A;  3JAM E;  2IG0 A;  4IUV A;  2EJG A;  2JTE A;  4C92 C;  3REB B;  1TU0 B;  3VS4 A;  3G6E Q;  2NLU A;  1B7T A;  2PUO B;  1W70 A;  3DKM A;  3CC2 T;  2QYZ A;  3EG3 A;  5FLX E;  1PG5 B;  2D0N A;  1M2V A;  1RL2 A;  4BI4 A;  1PWT A;  3CD6 A;  3G7Z A;  4J9G A;  2A0F B;  2I2L A;  5CQX A;  2A3L A;  2DTI A;  2PTK A;  2SRC A;  1BCO A;  4J5Y A;  4AFZ C;  3CME Q;  3URG A;  5AYF A;  2YT6 A;  1VQO Q;  4C92 E;  2GCX A;  1Q86 R;  2EPD A;  1Y0M A;  2AK5 A;  2H8H A;  1KJW A;  5C0M A;  4A4G A;  2JW4 A;  4X1V A;  2OJ2 A;  1F1B B;  1BI3 A;  2ED1 A;  4AG1 C;  2DM1 A;  2QEX Q;  4XTU A;  4MMK A;  3CPW A;  3HTR A;  3M0S A;  4E7Z A;  2QGF B;  1U1T A;  5A0G A;  2DA9 A;  1V29 B;  2ESW A;  1B07 A;  3L2R A;  1TH7 A;  2CUB A;  3RIR A;  2LDM A;  1AVZ C;  2RPN A;  3C0C A;  5DM7 R;  1UGP B;  1UGV A;  3FJP A;  1GFC A;  2QEX A;  4FYW B;  2OAU A;  2DL4 A;  4AFQ C;  4M78 A;  3CCJ Q;  3JCM g;  5LJ3 e;  5GAN e;  1N5Z A;  3ZL7 C;  2DXB A;  1Q81 R;  3EFR A;  3EHQ A;  4BI3 A;  2F1L A;  4EMK C;  4RCB A;  1C6V X;  4OB0 B;  4PFO A;  4E7K A;  1PRL C;  1Y96 B;  3A1P A;  5FRO A;  2DTO A;  1E6G A;  1VQL Q;  4J9E A;  4RCC A;  2W0Z A;  1AZE A;  4M7A F;  2KY9 A;  3M0T A;  1V76 A;  4C8Q D;  4JS5 A;  4E7I A;  1Q7Y U;  3M58 A;  4ZGJ B;  3OYB A;  1PNJ A;  1W2B P;  1T3L A;  4HCK A;  3SDZ A;  3CCM A;  2E41 A;  3E9F A;  3L2Q A;  1RAC B;  3JV3 A;  2JMC A;  3L2Z A;  3GNF B;  3QWY A;  2EYX A;  4CC7 A;  1VQL A;  4AMC A;  1GCQ C;  1WQW A;  3CXC S;  4OMQ A;  2K5F A;  5I11 A;  2DE0 X;  1PM3 A;  1GRI A;  4LN2 A;  2XID A;  1XNI A;  5A2Q E;  2KRS A;  4M75 F;  3QII A;  2YDL A;  4E7J A;  3GOX A;  1NBE B;  2RQT A;  2KYB A;  4A53 A;  3RR6 A;  4DA4 A;  1X01 A;  4ORZ A;  3GLX A;  2XDD A;  1XQH A;  1OV3 A;  2KQW A;  4E7H A;  4Z8A A;  5HKC A;  3BW1 A;  3WVD B;  2BTT A;  2O2O A;  3ME9 A;  4PLL A;  1FMK A;  4HA8 A;  2DER A;  4FCY A;  2P0Q A;  1PKT A;  1ZBJ A;  1QMC A;  2RF0 A;  4XU0 A;  4DQ2 A;  2F5K A;  4BB7 A;  2AZS A;  2D9T A;  1YIT T;  2X3W D;  5EG2 A;  2CH4 A;  4JPB W;  1K73 U;  3JCM V;  3MP6 A;  3HRT A;  4B9W A;  1VQ5 T;  4OMF B;  4FU6 A;  4PJN A;  3CC4 Q;  4JLG A;  2WAC A;  4KH0 B;  3A8G B;  4Z89 A;  3JCM e;  1D1B A;  3EAE A;  2VVK A;  1LVK A;  2KK4 A;  2L2P A;  1I81 A;  4D8K A;  2PVO B;  2V1Q A;  2LJ3 A;  3JCM c;  2JS2 A;  4A4K A;  4E7S A;  1ZBX A;  1JXO A;  3OS5 A;  1RAE B;  3P8B B;  3SB2 A;  2W10 A;  3ULR B;  1AD5 A;  3HPW A;  3OW2 P;  5KYY A;  2NUP B;  4QQD A;  1NJI U;  4M7D F;  2KRO A;  5CKE A;  2LX7 A;  1IXD A;  1GBQ A;  3X26 B;  4PK4 A;  1KD1 C;  1H8K A;  2BUD A;  1M90 U;  5KYU B;  2HAX A;  1G3T A;  2CZ7 B;  1LPL A;  2KNB B;  1BI0 A;  1TG0 A;  3RNJ A;  3LWH A;  3NTK A;  4LD6 A;  4LD9 K;  2EYQ A;  3CXC A;  1VA7 A;  2DL7 A;  2XKO C;  5HCK A;  4R55 A;  4XU3 A;  1C1A A;  2DJQ A;  2M02 A;  1BIA A;  2K57 A;  5CKF A;  2K5L A;  2XK0 A;  3CC7 A;  4FYY B;  1PC0 A;  2WSC E;  1N8R R;  1G2B A;  5CO7 A;  4F17 A;  2QG9 B;  4Z02 A;  1KSW A;  1UDL A;  2PQW A;  4KGX B;  4XTY A;  1Z9Q A;  1W2B S;  3VYG A;  1R77 A;  2WSF E;  1WPY A;  4LE9 A;  2YLB A;  2RI2 A;  4M7A G;  2VWF A;  3QDF A;  3EGX B;  1UFF A;  2XHC A;  2RI3 A;  1FYN A;  4OB1 B;  2DFU A;  1EX4 A;  4QQG A;  3I5S A;  2FPE A;  3SFM A;  2J7I A;  3SWN B;  4JUV A;  3OYD A;  1ZX6 A;  1VQ9 T;  4CC2 A;  1NLO C;  2RQW A;  3OSS C;  3SEM A;  1YJN Q;  4JRK A;  4C5H A;  1NYF A;  2DZ9 A;  1TSF A;  4HCB A;  1JXM A;  3VUB A;  1NE8 A;  2LT4 A;  2NUP A;  4C8Q B;  1QCN A;  1NZ9 A;  1VYT A;  3DB3 A;  5KYU A;  1UB4 A;  4M77 F;  1YJN A;  4CC3 A;  2COW A;  1TS9 A;  5IT9 E;  2KE9 A;  2OX7 A;  3MHX A;  4LDU A;  2ZGW A;  4A4F A;  2FL7 A;  2JS0 A;  2VV5 A;  3FIF A;  5GJW B;  1QVP A;  2X4J A;  1QWE A;  3S6W A;  2L5Q A;  2ZPI B;  4J9B A;  3VRZ A;  2O9S A;  4JDS A;  3G71 Q;  2YRV A;  3E2U A;  2M0O A;  4Y92 A;  3CCE T;  2LT1 A;  4XTX A;  2DBM A;  3OYH A;  4PJO C;  2FPD A;  1VQN T;  3CCR T;  2HMA A;  3OYN A;  4M78 D;  2QDL A;  2K3B A;  2V8J A;  3MEW A;  1XJW B;  2QQA A;  2V8K A;  3QO3 A;  4C0G A;  1B34 B;  2CP7 A;  4PJJ A;  5AT1 B;  4IIM A;  3SD4 A;  3OW2 S;  1RAF B;  1W2B A;  1HSQ A;  4MZT A;  2DLP A;  1H92 A;  1WHL A;  3A98 A;  3KUF A;  4PJO E;  4D6W A;  2L3Q A;  2OTJ T;  4DBF A;  1OQK A;  3EG2 A;  1IB8 A;  2LMJ A;  1J3T A;  2JXB A;  4ZNX A;  4PJL A;  4M7D G;  3M59 A;  3V8K A;  3M57 A;  1YJW T;  3PTA A;  4FIB A;  2DO3 A;  3OS1 A;  1UGR B;  1PD1 A;  4J9C A;  1VIE A;  9ATC B;  1AOJ A;  3M4Y A;  3T9N A;  4ESR A;  4C5E A;  5IXB A;  1KC8 U;  3JCM X;  2MAM A;  1AT1 B;  1Q7Y C;  1M1F A;  1G5V A;  2EYW A;  4QQ6 A;  2YUO A;  4M7A A;  5KE3 A;  1KFZ A;  4E2F B;  4L5G A;  3EG9 A;  4JRI A;  4KT0 E;  1VQM T;  2FZK B;  4R0K A;  3S3N A;  1X69 A;  1BI1 A;  2DL5 A;  3AHU A;  3RKY A;  4JRQ A;  4RG8 A;  1K1Z A;  1VYU A;  1HXD A;  1YWO A;  2ATC B;  2X3X D;  3HSB A;  1VQP T;  5HK3 A;  2J6F A;  2L89 A;  3BDU A;  4C92 F;  2C06 A;  3FB9 A;  2A08 A;  2JVV A;  2OI3 A;  4M7D B;  1TTH B;  4WTO B;  3QJY A;  4O6J A;  5DY9 A;  4PLI A;  5LJ5 f;  2CP3 A;  1JBM A;  1M27 C;  3CC2 A;  1Y57 A;  3PMI A;  3I35 A;  3UDC A;  2LQN A;  1N9R A;  4M75 A;  4EIK A;  5GAO q;  4KUI A;  1BKB A;  3OW2 A;  1C0M A;  1QVF P;  3TVT A;  2G3R A;  2KBT A;  1IHV A;  2K2M A;  3CCV T;  4X9C A;  1YP5 A;  4N0A A;  1IO6 A;  4QVC A;  2MWP A;  4UC4 A;  2PZ1 A;  2ECZ A;  3X24 B;  1OZ2 A;  1M2V B;  2R5A A;  1HYO A;  3HL8 A;  1TOV A;  2DX1 A;  2GBQ A;  1NLP C;  4M77 G;  1MV0 B;  1YI2 T;  1K73 C;  1A0N B;  4C0D B;  1UEB A;  3UF4 A;  3VRY A;  4GLK A;  3LGL A;  3PNW C;  4HKE A;  4RTZ A;  5GAM f;  2CSI A;  5FU7 B;  4DEX A;  1R0C B;  4ATO A;  8ATC B;  1ABO A;  1VQ4 Q;  2L8D A;  1TUD A;  1ZSZ A;  3VS3 A;  4AT1 B;  2ABL A;  3OY9 A;  3I9Q A;  3MP1 A;  2DL8 A;  1S72 T;  1NJI C;  2YLC A;  4XU1 A;  5GMK e;  3GIB A;  3ZFJ A;  2FYK A;  3CCQ T;  2HKN A;  5I2M A;  1M90 C;  2RI5 A;  2P0P A;  2C0O A;  2RQR A;  1LCK A;  4M7D A;  4ZTJ A;  2XDP A;  4DBH A;  1WJR A;  5L8R E;  2HKQ B;  1D09 B;  4C5I A;  2ZCF B;  3QWX X;  4AG2 C;  2DTH A;  2COZ A;  2QA4 T;  2E6Z A;  3LH5 A;  4M78 B;  2RHU A;  2PUK B;  2L3S A;  4VUB A;  1K0X A;  2V8I A;  4DEY A;  3CD6 Q;  3LGF A;  4KRT A;  4MZP A;  3DLM A;  3SHW A;  5LJ5 g;  2CYZ B;  2EJ9 A;  2RH2 A;  5A0D A;  3H0F A;  2E12 A;  5LJ5 j;  2FO0 A;  3OMC A;  2DBK A;  2RD1 A;  3OB9 A;  1MMA A;  4QW2 A;  2JM9 A;  1NYG A;  4PL6 A;  3RES A;  5CVI A;  3QZ9 B;  1WQ7 A;  2DAQ A;  2Y90 A;  4LUE A;  2FEI A;  4B9X A;  3S3O A;  1JU5 C;  2OAW A;  1VQ6 Q;  5KE2 A;  2AT1 B;  1KK7 A;  4O5V A;  1EFN A;  5LJ5 d;  4BE0 A;  3V8J A;  3HP9 A;  1SRM A;  1QWF A;  3CMA T;  2BKD N;  1SSF A;  4L59 A;  2X35 A;  2DRK A;  2KAF A;  2EQK A;  4C92 G;  2RM4 A;  2CH4 W;  3R6O A;  2ZPE B;  3OMG A;  4LDY A;  1UGS B;  1VQ6 A;  2RK1 A;  1SKU B;  4RTX A;  4GBQ A;  1V1C A;  2AKL A;  1VQ8 T;  1QVF S;  2HQE A;  3LYI A;  1UUE A;  3JSC A;  2CS7 A;  3C4S A;  4K11 A;  1NEB A;  5GAM g;  1O9S A;  1MMG A;  1OZ3 A;  3KFV A;  4ZGD B;  3GPL A;  3X28 B;  5GAM j;  2Z0W A;  1QP3 A;  2VB6 A;  1AHJ B;  8AT1 B;  2EYY A;  1SHG A;  3G4S T;  4FW2 A;  1NPR A;  4M77 A;  3KXT A;  1VQ5 A;  1MNE A;  2MYS A;  2KSS A;  3EG1 A;  4OGE A;  1W6X A;  3X25 B;  4AFS C;  2QI2 A;  5GAM d;  3L42 A;  1CKB A;  4C5G A;  1LOJ A;  3M56 A;  1Q82 U;  1UJY A;  1AWJ A;  3CCM Q;  1GCP A;  2E5K A;  3V7S A;  2CKK A;  1WHG A;  1ABQ A;  2YUQ A;  1CSK A;  3A8M B;  2V1R A;  3IQL A;  2E4H A;  1WGS A;  1PKS A;  4NS5 A;  2MPX C;  4OMM A;  2KI7 A;  3M0P A;  3QPH A;  4LDV A;  3VKI A;  2K2V A;  1X43 A;  2D6F A;  1NM7 A;  3QYH B;  5LJ5 e;  3RMQ A;  3C95 A;  1MMN A;  2R58 A;  3I55 Q;  3VUZ A;  4M7A D;  5KYY B; 
#chains in the Genus database with same CATH homology
 1G3S A;  4Z02 A;  3PIO A;  3M9Q A;  5GAN 3;  1Y7X A;  3CCU T;  4N4G A;  2PQW A;  3M5A A;  3PFS A;  4PKC C;  2JTM A;  3BFM A;  4GY5 A;  4J6Y A;  4XTY A;  1WJQ A;  3VYG A;  4BAC A;  1W2B S;  1QP2 A;  2WSF E;  2CGH A;  1WPY A;  2DPP B;  2XDB A;  4FSX A;  2YLB A;  3DB4 A;  3P8D A;  4C8Q A;  5LJ3 j;  4EMH A;  3JB9 H;  4F7U B;  1NPP A;  2RI2 A;  5GMK i;  5GAO n;  2CZ0 B;  4M7A G;  3JRZ A;  1IRE B;  3RER A;  2MWO A;  4BY6 C;  2XI9 A;  3M55 A;  1QVG A;  1LJO A;  1OYX A;  2EQM A;  4J6X A;  3I55 A;  2XHC A;  4RG2 A;  2RI3 A;  5GMK j;  3CCU A;  2QDY B;  2OTL T;  4PJO B;  4OB1 B;  2HNI A;  1KC8 C;  1MGQ A;  2KDS A;  4QQG A;  3SFM A;  3H6Z A;  3SWN B;  4J7I A;  4JUV A;  3OYD A;  5GAN 2;  1VQ9 T;  2M9U A;  3RUX A;  3JCM h;  1XOV A;  5LJ3 d;  2MMP A;  3ZBD A;  5GAN d;  5IAY A;  1QVF A;  2ZPB B;  3OSS C;  5CAI A;  2X4W A;  3OYI A;  3MET A;  5GAO p;  2JN0 A;  4JRK A;  3RMS A;  1G3W A;  2OTL A;  4FM4 B;  2LRQ A;  4C5H A;  5CCA A;  4BD3 A;  3LH0 A;  3ASK A;  3QJ6 A;  4QVD A;  4EMG A;  3LWI A;  2RJE A;  4JRP A;  5FU6 C;  2DZ9 A;  2LCC A;  1VQK T;  3FDR A;  3OYY A;  4HCB A;  1H3Z A;  3HFO A;  3TRE A;  3G6E T;  2DD5 A;  1K9M U;  4BUG A;  1VQ9 A;  2O01 E;  3VUB A;  3PGG A;  1NE8 A;  5GAN 8;  2LT4 A;  2CZ1 B;  2EJF A;  4ZN3 A;  1WJS A;  1JJ2 S;  4M77 C;  2DD4 A;  3FLG A;  3MEV A;  2M16 A;  4OP0 A;  2RHI A;  4C8Q B;  1OI1 A;  2E5Q A;  2RK2 A;  3WXM B;  1NZ9 A;  1B34 A;  3CMA A;  3DB3 A;  2ZZD A;  2RA2 A;  4E47 A;  1VQK A;  1UB4 A;  2JTF A;  4KBM B;  1N8R U;  4FT4 A;  3G6E A;  2DVE A;  1R8O B;  4M77 F;  4XK8 E;  4XQ3 A;  4C92 A;  1YJN A;  1P92 A;  5IT9 E;  1DJ7 B;  3CEY A;  3MHX A;  4LDU A;  2ZGW A;  4A4F A;  2FL7 A;  5GAO m;  4OGC A;  2DK3 A;  2VV5 A;  3BY7 A;  3FIF A;  1QVP A;  3J7A F;  2KVQ G;  2X4J A;  3CME T;  1K8A U;  3S6W A;  2L5Q A;  3VV0 A;  3L2V A;  3VU3 C;  1M1K C;  2ZPI B;  1PSF A;  4JJN K;  1VQO T;  2RJC A;  1U8R A;  4JDS A;  1YIT A;  5CQY A;  1N9S A;  2YRV A;  2M0O A;  2RJD A;  3QG1 A;  3L1A A;  3CCE T;  3JB9 D;  4OVA A;  2LT1 A;  4XTX A;  3LX7 A;  3S3M A;  3A8O B;  3A8H B;  3QDR B;  5LJ5 h;  1K8A C;  4IUU A;  3OYH A;  4PJO C;  1VQN T;  3E1S A;  3OYM A;  3CCR T;  2K4Y A;  3OYN A;  1KD1 U;  1GXI E;  4M78 D;  3SWN C;  1VUB A;  3GP8 A;  4QVZ A;  1WNL A;  5CK9 A;  3CME A;  4PNO A;  2QEX T;  2MI6 A;  5J39 A;  2O4X A;  2XU8 A;  4BY6 B;  2LVM A;  3V8L A;  4PJO F;  4BDY A;  1VQO A;  4ZGE B;  2MF2 A;  2V8J A;  3MEW A;  4J6W A;  3JB9 G;  2QQA A;  3CCE A;  3G4S A;  1I5L A;  2DIG A;  2V8K A;  1YIJ T;  2QQR A;  3QO3 A;  3OYE A;  4C0G A;  1B34 B;  5CIU A;  1VQN A;  3ER0 A;  4ZTF A;  3SD4 A;  4M78 G;  4WF2 A;  1FXX A;  4F7U A;  4C92 B;  3OW2 S;  1W2B A;  3VYH B;  4MZT A;  4F7U E;  4KUL A;  4M7D D;  2E64 A;  4DOW A;  5M9O A;  3QXE B;  4NOY A;  1BIB A;  3QHS A;  3J80 E;  3FEO A;  4R56 A;  5FU6 B;  3KUF A;  4C8Q C;  4PJO E;  3CPW S;  4D6W A;  2ZPG B;  2OTJ T;  3HRU A;  3HRS A;  4II1 A;  3X20 B;  5CKH A;  2RB6 A;  3QZ5 B;  3CCJ T;  1VQ4 T;  2DEQ A;  4X9D A;  4C8Q F;  2E1H A;  3GF5 A;  3M59 A;  3V8K A;  4M7D G;  1UGQ B;  1KQ2 A;  3F70 A;  2FB7 A;  3M57 A;  3JCM f;  3ZEH A;  2P0K A;  4ELZ C;  2O4X B;  1YJW T;  3PTA A;  4FIB A;  3MEA A;  4BE2 A;  3OQ5 A;  2DO3 A;  4CRI A;  1YHQ T;  2GQV A;  3HKS A;  4DOV A;  1MHN A;  1BYM A;  3V7C A;  3OS1 A;  2PVD B;  3LLR A;  3OYF A;  1UGR B;  5GAM h;  4EPC A;  5LJ3 g;  3JCM d;  3OYK A;  3CCJ A;  1VQ4 A;  5GAN g;  5GAN 4;  1VIE A;  1ZQ1 A;  3C12 A;  4XU2 A;  5FRM A;  2LTO A;  3M4Y A;  3JCM b;  3T9N A;  4J7F A;  1FX7 A;  4C5E A;  3OA6 A;  1KG1 A;  1M9S A;  1KC8 U;  1RI0 A;  3OS0 A;  5GAN j;  1KQS S;  2DXT A;  1H64 1;  3JCM X;  4C8Q E;  2MAM A;  3JB9 J;  1JJ2 A;  2PVG B;  2RJF A;  3E9G A;  3CCS T;  2M1H A;  5KH6 A;  2JNG A;  4EMK A;  3E19 A;  3EFS A;  1YHQ A;  1M1F A;  1Q7Y C;  3BDL A;  1G5V A;  1JB0 E;  3CBO A;  4HT9 A;  2ZPF B;  3N5B B;  3OSV A;  4QQ6 A;  5A0L A;  2DKG A;  5I2S A;  5GMK m;  3JB9 I;  4M7A A;  5KE3 A;  4L5G A;  3M4G A;  1PSE A;  4IKF A;  4JRI A;  2K5I A;  3JAM E;  2DXU A;  5DLO A;  2IG0 A;  1M8V A;  4IUV A;  4KT0 E;  2EJG A;  1VQM T;  4C92 C;  3QKJ A;  3S3N A;  1BI1 A;  3AHU A;  3RKY A;  4XTZ A;  4RG8 A;  4JRQ A;  2NLU A;  2EQJ A;  3RKW A;  1HXD A;  3JCM P;  3A8L B;  3CD6 T;  2PUO B;  4M75 D;  3HSB A;  1VQP T;  5HK3 A;  1LNX A;  2L89 A;  3BDU A;  4A4E A;  1X6O A;  5FRN A;  4C92 F;  3DKM A;  2C06 A;  2LX9 A;  3FB9 A;  3P8H A;  4RKU E;  3CC2 T;  2JVV A;  2GF7 A;  5FLX E;  4M7D B;  2RHZ A;  2IVW A;  3INZ A;  3QJY A;  5GAM e;  4O6J A;  5DY9 A;  1M1G A;  4PLI A;  5CKB A;  1RL2 A;  5LJ5 f;  4YTL A;  3DLL A;  4BI4 A;  5C6S A;  3CD6 A;  3G7Z A;  4M75 G;  5CQX A;  2I2L A;  3QYG B;  1VQP A;  2A3L A;  1JBM A;  1U1S A;  2DTI A;  4HCC A;  1Q81 C;  4NL2 A;  4XAX B;  3CC2 A;  2F5T X;  3PMI A;  4J5Y A;  1XTD A;  2EFI A;  4EMK B;  1M1K U;  3UDC A;  3URG A;  5GAO l;  1VQ6 T;  4M75 A;  1N9R A;  5AYF A;  5J26 A;  4C92 E;  2GCX A;  4M7A B;  1KHC A;  5GAO q;  4KUI A;  1JRI A;  1BKB A;  4JLI A;  5C0M A;  3OW2 A;  1X75 C;  2VXE A;  2VUB A;  4MZM A;  4A4G A;  3V7R A;  3MCA B;  2G3R A;  2VYT A;  2HBP A;  4E7L A;  1BI3 A;  4MDX A;  4M77 D;  1I4K 1;  4MDW A;  3CCV T;  4C0F A;  4X9C A;  4XTU A;  4N0A A;  4XTW A;  4MMK A;  2XG8 D;  4IUQ A;  4F7U F;  2MWP A;  4QVC A;  2P4T A;  3CPW A;  4UC4 A;  2EQU A;  1Y96 A;  2GFA A;  1U1T A;  3FRN A;  3PIP A;  1VIF A;  4P5N A;  3X24 B;  1OZ2 A;  1KHI A;  2DXC A;  1FWZ A;  2R5A A;  5A0G A;  1V29 B;  4FL6 A;  3HL8 A;  4LDW A;  2XD0 A;  3MEU A;  5HY6 A;  4M77 G;  4HT8 A;  3CCV A;  1YI2 T;  1K73 C;  3L2R A;  4C0D B;  1UEB A;  1TH7 A;  3RIR A;  2LDM A;  3UWN A;  3CC4 T;  3CCR A;  2AHJ B;  2F69 A;  4GLK A;  3LGL A;  3PNW C;  5DM7 R;  2QXF A;  1UGP B;  3FJP A;  3NTI A;  1M5Q 1;  4M7D C;  3QBY A;  4HKE A;  3TEE A;  4M75 B;  2QEX A;  5GAM f;  4A54 A;  5FU7 B;  4Y28 E;  4PJO D;  1N6A A;  2QQB A;  4TVR A;  3MO8 A;  2OAU A;  4ATO A;  1KQS A;  1YJ9 T;  4M78 A;  4Q5W A;  1YI2 A;  1YIJ A;  5D6W A;  3JCM g;  5LJ3 e;  5GAN e;  1BI2 A;  3CC4 A;  2DXB A;  3EFR A;  2LNV A;  2L8D A;  2EWN A;  4BI3 A;  3L2W A;  3OY9 A;  4EMK C;  2JOY A;  4RCB A;  3MP1 A;  3FC3 A;  5LL6 S;  1NJI C;  4PJO G;  1S72 T;  2YLC A;  4XU1 A;  5GMK e;  4OB0 B;  3GIB A;  3ZFJ A;  4M7A C;  4E7K A;  4N4H A;  1Y96 B;  2FYK A;  1EIF A;  1Q86 U;  3CCQ T;  3QSU A;  3PT9 A;  5FRO A;  2YHT A;  2DTO A;  5I2M A;  1YJ9 A;  1M90 C;  4XTV A;  3CCM T;  5DLQ E;  1Q82 C;  2BIV A;  2A7Y A;  3NTH A;  4RCC A;  2RI5 A;  2P0P A;  4OB2 B;  4RMO A;  1N27 A;  4ZN1 A;  4M7D A;  2OTJ A;  4M7A F;  4ZTJ A;  2XDP A;  2KY9 A;  3OYA A;  1WJR A;  4M7D E;  2DIQ A;  2FHD A;  4KUD K;  3OYL A;  5L8R E;  3OBW A;  4C8Q D;  4JS5 A;  1VQL T;  4J8O A;  4E7I A;  1Q7Y U;  3M58 A;  3JCM W;  4ZGJ B;  4C5I A;  3OYB A;  3CCQ A;  1Y71 A;  4LDX A;  2ZCF B;  2HQX A;  2DTH A;  2GFU A;  4ME7 A;  3SDZ A;  5KCO A;  2E41 A;  3CCM A;  2QA4 T;  1YJW A;  3E9F A;  2E6Z A;  2EKO A;  3L2Q A;  3I56 T;  2VGM A;  3L2Z A;  5GMK l;  3GNF B;  4M78 B;  4BI8 B;  2RHU A;  3HFN A;  2PUK B;  4VUB A;  4C8Q G;  1VQL A;  4C0D C;  3I55 T;  1ZHI A;  2V8I A;  2VGN A;  1D3B A;  3M53 A;  4M7A E;  4CI0 C;  1Q86 C;  3LGF A;  4MZP A;  3DLM A;  2DJZ A;  2RHX A;  2QA4 A;  1VQ7 T;  4M75 C;  4JS4 A;  1WQW A;  2E70 A;  5LJ5 g;  2E10 A;  2CYZ B;  2R5M A;  2EJ9 A;  5FU7 C;  3CXC S;  3CCS A;  2RH2 A;  2K5F A;  5A0D A;  3I56 A;  3TU4 K;  2XID A;  2E12 A;  5LJ5 j;  1XNI A;  2VC8 A;  2L3R A;  5A2Q E;  3OMC A;  2RD1 A;  3OB9 A;  4M75 F;  4QW2 A;  5LJ3 f;  2Y4Y A;  3QII A;  5GAN f;  3M54 A;  2K3X A;  3RKX A;  1QW1 A;  3GOX A;  4E7J A;  3L2U A;  4PL6 A;  4J83 A;  3RES A;  5CVI A;  2E65 A;  2D0Q B;  1VQM A;  1Q81 U;  2EAY A;  3QUI A;  2WSE E;  1WQ7 A;  3QZ9 B;  2DAQ A;  4A53 A;  3OYG A;  4N0A C;  2Y90 A;  3CCL T;  4IUT A;  4DA4 A;  1VQ7 A;  1X01 A;  4B9X A;  4C0Z A;  5HK0 A;  3S3O A;  5KCH A;  5KE2 A;  2X4X A;  3GLX A;  3PMT A;  4NL3 A;  4IUR A;  1XQH A;  4OF1 A;  4C92 D;  4O5V A;  2KQW A;  5LJ5 d;  2XDD A;  4E7H A;  4BE0 A;  3HHT B;  3JCM J;  3V8J A;  3HP9 A;  3J81 E;  3UPU A;  3CMA T;  1YBY A;  5HKC A;  3BW1 A;  3O8V A;  3WVD B;  2QQS A;  2BKD N;  3ME9 A;  4PLL A;  3CCL A;  1SSF A;  4HA8 A;  4L59 A;  1YJN T;  4M75 E;  5D6Y A;  2X35 A;  1D3B B;  1O75 A;  2KAF A;  4L6V 5;  2P0Q A;  1M4Z A;  4BE1 A;  2EQK A;  4XU0 A;  4C92 G;  1QVG S;  4DQ2 A;  3KBG A;  2R57 A;  2RM4 A;  2F5K A;  5LJ3 h;  4BB7 A;  5GAN h;  3R6O A;  1K9M C;  2D9T A;  2ZPE B;  3OMG A;  4LDY A;  5CR2 A;  1UGS B;  1YIT T;  2XIC A;  5EG2 A;  2CZ6 B;  1VQ6 A;  2RK1 A;  5IN1 A;  4M78 C;  2B8A A;  2EIF A;  3JB9 F;  2LCL A;  5CKD A;  5GMK h;  2KMT A;  5GAN 7;  1K73 U;  1VQ8 T;  4IUP A;  3JCM V;  1Y07 A;  3HRT A;  3MP6 A;  2LQK A;  4B9W A;  2HQE A;  3LYI A;  1VQ5 T;  1QVF S;  4OMF B;  3JSC A;  4FU6 A;  3Q1J A;  4MML A;  2CS7 A;  3C4S A;  3CBP A;  4M78 F;  5GAM g;  4JLG A;  2WAC A;  2E6N A;  3A8G B;  3JCM e;  1N8R C;  1O9S A;  3VJP A;  4ZGD B;  1OZ3 A;  2LQ8 A;  3GPL A;  3X28 B;  3EAE A;  4EDU A;  1QP3 A;  5GAM j;  1AHJ B;  1HK9 A;  2KK4 A;  2VXF A;  3G4S T;  2Y4X A;  1I81 A;  1NPR A;  4A4H A;  3H8Z A;  3OBY A;  1VQ8 A;  4M77 A;  2PVO B;  3JCM c;  3KXT A;  2FVU A;  2JZ2 A;  4A4K A;  1VQ5 A;  1ZBX A;  3G71 T;  2K3Y A;  4M77 E;  3C94 A;  3OS5 A;  2KSS A;  3P8B B;  3SB2 A;  2QQ9 A;  3HPW A;  4OGE A;  1YCY A;  4QQD A;  3X25 B;  1NJI U;  2RHY A;  4M7D F;  5CKE A;  2QI2 A;  4F7U G;  3X26 B;  4M78 E;  5GAM d;  3L42 A;  1KD1 C;  3CPF A;  1IZ6 A;  4Y91 A;  2BUD A;  3UT1 A;  1M90 U;  4C5G A;  1LOJ A;  2ZPH B;  3M56 A;  5J3B A;  1Q82 U;  3GNG A;  2HAX A;  3JCM Q;  1G3T A;  2CZ7 B;  3G71 A;  4FT2 A;  1G3Y A;  5GAN 5;  1KQ1 A;  5I21 A;  3V7S A;  1BI0 A;  2CKK A;  3LWH A;  3CBM A;  5GAN 6;  3NTK A;  4OB3 B;  4LD6 A;  2JUF A;  3A8M B;  2RO0 A;  4LD9 K;  1WGS A;  2HD0 A;  2H3J A;  4NS5 A;  2EYQ A;  5D6X A;  3CXC A;  3CC7 T;  4PJO A;  3TCJ A;  2DZC A;  4X34 A;  1W4S A;  1I8F A;  2XKO C;  3A5Z B;  3SWN A;  3NFC A;  3QPH A;  4LDV A;  4XU3 A;  3VKI A;  4R55 A;  2K2V A;  3OYJ A;  1S72 A;  2D6F A;  3MP8 A;  3OS2 A;  4V2S A;  3QYH B;  5LJ5 e;  2QTX A;  2X4Y A;  3RMQ A;  4ELY C;  1BIA A;  2K57 A;  3C95 A;  2LC4 A;  4M77 B;  4HCZ A;  5CKF A;  3OYC A;  4BDZ A;  5GAO r;  2R58 A;  2K5L A;  2PU9 B;  2XK0 A;  3WVE B;  4N4I A;  3CC7 A;  3VUZ A;  4M7A D;  2WSC E;  3LW5 E;  5CO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...