2LDMA

Solution structure of human phf20 tudor2 domain bound to a p53 segment containing a dimethyllysine analog p53k370me2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
77
Chain Sequence
SSEFQINEQVLASWSDSRFYPAKVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFSKDQNIVGNARGSRAHSSHLSKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title PHF20 is an effector protein of p53 double lysine methylation that stabilizes and activates p53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
total genus 14
structure length 77
sequence length 78
ec nomenclature
pdb deposition date 2011-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ldmA01
2XK0A 1RI0A 2L8DA 2QQSA 5FRNA 3O8VA 2GF7A 1OI1A 2RJEA 4FL6A 5FRMA 2IG0A 2RI2A 2R5AA 2RHUA 4OVAA 3QIIA 4BACA 2X35A 4C5HA 4HCZA 3S3OA 2RI3A 4NS5A 2DIGA 3OYHA 3E9GA 3DB3A 2RHZA 3FEOA 3UWNA 2RI5A 3FC3A 3S3NA 5CIUA 5M9OA 2GFAA 2VYTA 3H8ZA 3L42A 3META 5IAYA 3MO8A 2LRQA 2O4XA 4E7HA 3LLRA 2RHIA 4PLLA 2K3YA 2MWOA 3MEUA 1WJSA 4QVZA 4BE1A 3DB4A 3FDRA 2JZ2A 5KCHA 2YRVA 4IKFA 2CKKA 2G3RA 3QJ6A 1WJQA 3SD4A 3OYJA 2M0OA 4QW2A 2LDMA 4N4IA 3E9FA 2EQUA 1OZ3A 4PL6A 3OYBA 3OYIA 3BDLA 3MP8A 3P8DA 2LVMA 2EQMA 5J26A 3OYFA 3OYLA 3OS1A 3ZEHA 3OMCA 2EFIA 3OYAA 2RHXA 4QQ6A 4II1A 3OYGA 3PMIA 3P8HA 5KCOA 3LGFA 4C5IA 3NTIA 4A4GA 2EQKA 3OYCA 3OA6A 4L59A 2NLUA 3PNWC 3OYKA 3OYEA 4BE0A 2HQXA 4PLIA 5KE2A 2P0KA 3ASKA 4A4EA 4EDUA 3LX7A 1WJRA 4Q5WA 3F70A 4QQDA 3S6WA 3C4SA 3LGLA 4ZTJA 2JTFA 5C6SA 5J39A 3CEYA 3EAEA 2BKDN 4E7LA 3OYDA 4IUUA 4A4FA 3UT1A 4Z02A 2LCCA 3OYNA 3GOXA 5KE3A 3S3MA 4IUVA 2M16A 4QQGA 2B8AA 3MEVA 4LD6A 3MP1A 2R5MA 2FHDA 2K3XA 2R57A 3NTKA 4B9XA 3FLGA 2RJCA 2L89A 1KHCA 1OZ2A 2X4WA 3PFSA 4N4GA 2EQJA 4IUTA 2MWPA 3LH0A 4BD3A 1MHNA 4BDZA 2RJDA 2L3RA 1OYXA 3DLMA 3QBYA 2LTOA 4N4HA 5C0MA 3OS2A 3L2VA 4IUPA 3OYMA 3OY9A 4GY5A 3L2QA 4FU6A 3OS0A 4IURA 4E7IA 3MEAA 4C5GA 2QQRA 2E5QA 1XNIA 4ZTFA 2BUDA 3ME9A 5FROA 2BIVA 3PMTA 2RO0A 2EKOA 2E6NA 3L2RA 4E7KA 3H6ZA 4B9WA 2R58A 2M1HA 2HQEA 2RJFA 2XDPA 1N27A 3QKJA 3MEWA 3L2WA 2DAQA 2WACA 2DIQA 4RG2A 2D9TA 1WGSA 2GFUA 2PQWA 4BDYA 4IUQA 5D6WA 3Q1JA 1SSFA 4A4HA 3M9QA 3NTHA 2O4XB 2F5KA 3LYIA 5D6YA 3OMGA 4C5EA 4CRIA 1H3ZA 4BE2A 4E7JA 2X4XA 3L2UA 3OB9A 3OQ5A 2RHYA 5D6XA 3KUFA 4UC4A 2X4YA 1G5VA 5IN1A 5KH6A 4X34A 3MP6A
chains in the Genus database with same CATH superfamily
1PSFA 5HK0A 2L8DA 3TSWA 5FRNA 1UE9A 5GMKi 1M2VB 4C0DB 1YITT 4WCIA 1IHWA 1BBZA 3CMAT 1Y7XA 3I55Q 2QAZA 1GCQC 4J9BA 4OMPA 2KGTA 1ZBJA 1TXQA 5LJ3g 4C8QB 4E7HA 2F69A 2LJ0A 2GQVA 2O2OA 2CT3A 4BI3A 1ACMB 2CUDA 3JCMc 5GMKl 3EGDA 1W4SA 2YRDA 4C92F 2DMOA 3OYJA 2PU9B 1VQ5A 1YCYA 2EQUA 2DZ9A 4L5GA 2EYXA 1X2QA 4M7AG 2NWMA 3RBBB 5FU7B 2E10A 4J6WA 2DETA 1HJDA 2FVUA 4XU0A 3JCMh 3OYGA 2L3PA 2JW4A 4L59A 1H3HA 2IVWA 4WTOB 2GTOA 1M2OA 2EIFA 3MJXA 3JAME 4ELYC 1D0ZA 4L6V5 5IHIA 3CCJQ 1OU9A 5KE3A 1M2VA 1AWOA 2EGAA 3EH1A 1TWBA 1RAHB 2DK3A 1VYTA 3PFSA 2F2WA 4M4ZA 2DXUA 2L3RA 4C8QA 2E65A 3JCMd 3HHTB 2QA4Q 3UDCA 4ME7A 2M1HA 2JS0A 2RJFA 2DAQA 2WACA 2D9TA 2HBWA 3BDUA 2GFUA 2K2MA 4M7AC 4J8OA 4EMKA 1I8FA 1NLOC 1VQ8T 3JCMQ 1WX6A 4M77G 4BI4A 1M8VA 5KH6A 5L23A 3MP6A 3RESA 4EDUA 4J5YA 1QCFA 2DO3A 2JOYA 5I21A 2QQSA 3M59A 5IXBA 2EGEA 3M58A 3JCMg 3M55A 3MKDA 3VJPA 1FX7A 2AZSA 2DIGA 3PGGA 2JM8A 3GBQA 3T9NA 4CC7A 4EMHA 3DB3A 3CC4T 2JS2A 4PJOC 2P0QA 5GANe 2RQRA 2D0QB 2ATCB 3META 3E19A 1YCSB 3GNFB 3CCRA 2CZ0B 5CCAA 2ROLA 3TCJA 2G3RA 2XKOC 4N4IA 1R0CB 3E9FA 5GAOn 4Z8AA 3GPLA 4PJLA 1KQSP 1GXIE 4C92B 4RTYA 3HP9A 3OYIA 2MCNA 4PJOE 2K9GA 3NFCA 1E7OA 4PJOD 2NUZA 4OB1B 5LJ5j 3OA6A 2AHJB 1MMNA 2A7YA 4OGCA 1X75C 1NPPA 1N9SA 2JTFA 2KDSA 1PRMC 2RB6A 4AT1B 3REBB 3G6EQ 3VRZA 2DBKA 3CCEA 4KT0E 1MMDA 2R5MA 1TH7A 3ZL7C 4M7AF 1UUEA 1U3OA 1K73R 3RKXA 2QYZA 1WA7A 4CC3A 3LH0A 3DLMA 2I0NA 2FRWA 4RTWA 1IXDA 3L2QA 1WHJA 2JXBA 2E5QA 1VQ4T 1K9MU 2XU8A 3EFOA 2E6NA 1CKAA 3L2RA 3VUZA 4E7KA 2YWWA 2XDPA 2MF2A 3VRYA 4LE9A 4RG2A 2KI7A 1WFWA 1D0YA 8ATCB 3CC7T 1TTHB 3PTAA 4C92A 1SSFA 4PJJA 1MUZA 4BE2A 2DFUA 4DBRA 4JS4A 1AZEA 1UEBA 2VC8A 4FW2A 1Y07A 3O8VA 1Y57A 2DTIA 2K5IA 4LUDA 2RI2A 2R5AA 1O75A 4E2FB 1YI2T 3S3OA 1OQKA 1UHCA 1K9MC 3HRTA 1D09B 3UWNA 1K8AR 3LH5A 1M90U 2FYKA 2QQAA 1VQ9A 1GFDA 2M02A 3MHXA 1W1FA 3CCQA 4M77F 3M4GA 1EX4A 3RKWA 5LJ5d 2LDMA 1M1KU 2HAXA 4LN2A 1D0XA 3JB9F 2FG0A 2AK5A 3X25B 2PZ1A 3CCVQ 1WXTA 3OYCA 4F7UG 3OYEA 4N0AC 2ZAEA 2JTMA 1AWJA 4RCCA 1GCQA 3FIFA 2K7AA 5FWBA 1WQ7A 5LJ5g 4Y28E 1X6OA 5GJVB 2CP2A 2KXDA 4DQ2A 4M75E 4LD6A 1NEBA 2ECZA 4M75D 3FLGA 1WQWA 1I0CA 2X4WA 4ZGJB 1BK2A 4J6YA 3OS2A 1OYXA 2HZYA 1RLQC 4JPBW 1XNIA 2BUDA 1KQ1A 4LDVA 1YJWA 3QJYA 2V1QA 5ECAA 2HQHA 4RMOA 1C6VX 3I56A 2DIQA 2P0PA 1GL5A 3M53A 3QHSA 3CXCA 1PHTA 2E3HA 4PFZA 4OF1A 3QZ9B 4PJOB 1HXDA 1PRLC 1PKSA 1YHQA 1K0XA 2E6ZA 2MMPA 3VS5A 1NJIR 2MI6A 2A08A 4HCZA 5KYXB 3X24B 2RHZA 1ZSGA 2X3XD 1BU1A 4CC4B 1TUDA 1VQOA 1Q95G 3JV3A 2CSQA 2JZ2A 4M7AA 4IKFA 2AKLA 1SF9A 5J3BA 1OZ3A 1KSWA 3TSZA 3RKYA 4KGZB 1QCNA 3G71Q 1QP2A 3CCLQ 3R6NA 3PVQA 3ZEHA 2FB7A 3CCRT 2QG9B 3EG9A 3OYAA 4FT2A 2KAFA 5KCOA 1B3QA 1M4ZA 3TEEA 4A4EA 3ASKA 3KFVA 3OBWA 2E4HA 3M4YA 2ABLA 1YWPA 3I55A 3EFRA 3BY7A 4A4FA 3OYNA 5FW9A 3V8JA 1BKBA 5CAIA 1WDXA 3BW1A 4DOVA 2Y4YA 1RADB 4N4GA 4ZNXA 2ED0A 5GAOp 1V76A 4BDZA 4ATOA 2O01E 1SG5A 4EMKC 2VVKA 4FYYB 1HK9A 3FJPA 5DY9A 3QYGB 2NYSA 3CCET 1Q81U 1N9RA 4FW1A 2DF6A 4C8QE 4O6JA 2WSFE 5GAN2 2YUQA 4JJNK 4C8QD 5IHNA 1XQHA 2E1HA 3CC2Q 6AT1B 1KD1R 4J6XA 2LX9A 4ZN1A 3KUFA 5GANf 2LP5A 2VGNA 3URGA 2NUTB 1GFCA 3CCJA 4KH1B 1UTIA 1M30A 1OI1A 4BACA 3JCMP 1Q86R 4C5HA 4AG2C 1TSFA 3H9NA 1M3AA 3SWNC 3E9GA 4KULA 1PNJA 3CCSQ 1X2KA 4PKCC 1K9MR 1Z9ZA 1IHVA 2AZVA 3J80E 2MWOA 2VV5A 2QA4A 3CC2T 3A1PA 1M3CA 4ZGEB 2LCLA 3MPUB 2V8IA 4J83A 3PT9A 2L2PA 1PD0A 1AEYA 1VQ9T 1LCKA 2EQMA 3VUBA 1U8RA 1SHFA 1YJNQ 3CCQT 1V1CA 2GTJA 4JDSA 2CZ6B 1RAEB 1BI1A 1D3BB 3LGFA 3L2ZA 3NTIA 1PG5B 2DERA 1ARKA 5GAMe 1GRIA 1RI9A 3S6WA 5A2QE 2D8HA 2LX7A 4ZTJA 1UFFA 4F04B 1VQ6Q 1M90R 2NUTA 4JS5A 4FSSA 4P5NA 4Z02A 1AWWA 4Y91A 1MMAA 1I4K1 2PVDB 4NL2A 2LQ8A 1G3YA 5GMKh 1M1KR 2DZCA 1VQNQ 2QEXQ 2VKNA 4IURA 1SRLA 2CS7A 1YIJQ 1BYMA 1UGRB 3H6ZA 4D8KA 2YDLA 4O5VA 4XAXB 3SDZA 2GQIA 4KRTA 3FJ5A 1JB0E 2DL3A 4N0AA 3NTHA 2MYSA 3LYIA 1NYFA 4C5EA 1YJWT 3CD6Q 2YHTA 2DLPA 1D3BA 2DTOA 3I56T 1K1ZA 4C92D 1U1SA 3G6EA 4FL6A 1JRIA 1T0HA 2A36A 3VS3A 1WIEA 1MGQA 1VYUA 3FEOA 3CMET 3S3NA 2VASA 2RI5A 4IIOA 2DL8A 3ULRB 3X20B 2OAUA 1OV3A 3O5ZA 4J9FA 4M78C 1YHQT 4PFOA 4XQ3A 3TREA 1ZX6A 2ZPFB 3VS0A 1KC8R 3H0IA 4PK4A 4LDWA 1VQOT 4TVRA 2LCSA 3EG3A 2QDYB 1TUCA 2L5QA 2PVGB 3OYYA 4DA4A 2BE7D 2YSQA 2E12A 1QVGA 3CBMA 1EIFA 2XG8D 1EFNA 1QW1A 5GAN8 2HQXA 1FXXA 1PCXA 3G1JA 1VQ7Q 2BKDN 3ER0A 2DE0X 2JMCA 4EMKB 1WHKA 2M16A 2EBPA 2E5KA 3PIOA 5L8RE 3A98A 1YN8A 3NMZC 2OTJQ 3EGUA 2KEAA 2YXYA 1ZUKA 3QZ5B 4JLIA 2KE9A 3QBYA 3C12A 4LDUA 4DEYA 3I55T 5CR2A 1RAGB 3L2VA 3OYMA 4GY5A 3M56A 3MEAA 5AYFA 1RUWA 1WPYA 1Y0MA 3H41A 2ZPEB 4E47A 1QWFA 3VU3C 4R55A 4HA8A 4DOWA 3CCVA 3OBYA 4A4HA 1XTDA 4C0FA 3RUXA 4OMMA 1QMCA 4M78F 2COZA 3RIRA 2RQTA 5KYUB 3LW5E 2QQBA 2RK1A 1RI0A 4JRPA 3M0UA 3OYHA 2L0AA 1NPRA 2W10A 3PVLA 2DEUA 2QQ9A 4LDXA 1LVKA 2PTKA 1GCPA 8AT1B 1Q81R 3CCJT 2VXFA 1NBEB 1T0JA 2XDBA 3QDRB 3M0PA 3RMSA 2CKKA 3HTRA 2CP5A 2XIDA 2DYIA 3OW2P 5GANj 4M7AE 2RPNA 2A28A 2DL5A 2QA4T 3I5RA 4M7AD 2CSIA 1YP5A 4MMLA 4XU1A 4A63B 1VQKQ 1JXMA 3V7SA 2CH4A 5FU6B 3LWHA 3EFOB 3SWNA 4PJNA 1IZ6A 5KYUA 3RDVA 4D8DA 1VOMA 2X9HA 3OW2A 2PUOB 2F1LA 2LJ3A 1QVGS 3G4SQ 1K4US 2DL4A 5GAN6 1AVZC 3MCAB 2FPDA 4M77C 2FRYA 3A8OB 3EG2A 4RTUA 2C0OA 4FU6A 3OS0A 3UF4A 2JT4A 1UECA 3HPWA 4FCYA 3G71A 5CKHA 3CCLA 5GANh 1YFNA 5A0GA 2ZGWA 1KQSA 1JJ2P 2FO0A 5D6WA 2PUKB 1Q82U 4KUDK 4EPCA 1PSEA 4HVVA 4M77E 3JCMb 5LL6S 1QVPA 1M8MA 4AMCA 4PFPA 1OEBA 4M77D 2XK0A 4M78B 4J9DA 4QT7A 5KYWB 2GF7A 3DKMA 2QDLA 1U1TA 2O88A 2K6DA 2P4TA 3JB9D 2VXEA 3QO3A 4Z89A 5GANd 2FZCB 4HKEA 4LD9K 3MO8A 1QP3A 2CZ1B 3G6ET 1Z9QA 1Q82C 1RLPC 2SEMA 1Q7YC 4DEXA 3H0FA 3QWYA 2HL5C 2OX7A 4M75G 4HT8A 3G7ZA 3CC2A 4RTTA 2DYBA 4RCBA 1FYNA 2MK5A 3OMCA 4FM4B 2VGMA 2DBMA 5GANg 4BE0A 2DM1A 3TQ7P 5GAOl 1R0BG 2IPOB 2ROTA 1I1JA 3CEYA 1IGUA 1VIEA 4M7DG 4M78A 4AFUC 3CCSA 1VIFA 2LCCA 5KYWA 4BUGA 2B8AA 2VB6A 4F16A 2CT4A 4A4KA 4RUGA 2DVEA 4D6WA 3AHUA 4ZGDB 4IUPA 4JJDA 5HY6A 4CI0C 3EGXB 4OB0B 3OSVA 2RQUA 1M9SA 4B9WA 1UG1A 2HQEA 3OW2S 3L2WA 1YJNA 4BDYA 3Q1JA 2J6OA 4XTZA 2CP6A 3OMGA 4J9IA 2P4RA 1I81A 2X4XA 1SEMA 3A5ZB 2F5TX 3M57A 4M7AB 1VQ6A 1QKWA 2K3BA 3CCVT 3QUIA 2RJEA 1BIAA 5GAOr 3FB9A 1KQSS 4ORZA 2KROA 3EG9B 2KYBA 5AT1B 1OPKA 2XMFA 3H8ZA 1VQNA 1AHJB 4J7FA 2GGRA 2QEXA 4OP0A 2EYQA 4PLLA 4DBFA 3MEUA 3CMEA 1LOJA 1YIJA 4BI8B 4BE1A 2EKHA 4FYXB 5D7UA 3OS5A 3QXEB 3HRSA 3EGXA 2KYMA 2DTHA 3OYBA 2CREA 3RNJA 1FMKA 3OYFA 1UDLA 3SHWA 2LMJA 2E70A 3CD6A 3BE3A 4EIKA 2BTTA 2QTXA 3JRZA 3PMIA 2OTLQ 2EJ9A 3A8MB 3QPHA 4A4GA 2KT1A 4F7UE 1SSHA 2YT6A 1JXOA 9ATCB 3P8BB 4QQDA 3C4SA 2QGFB 2EJGA 4C8QG 2DD4A 1VQMQ 4M77B 1WHGA 2HMAA 2WSCE 2EQIA 2SRCA 1ZSZC 2R57A 1VUBA 1MNDA 4HXJA 1P92A 4RTVA 1N8RC 2K79A 1QQJA 2LTOA 3CPWP 1UJYA 2D8JA 2ZPGB 4ELZC 1X6GA 2GCXA 1RL2A 2X4JA 1G3SA 3C95A 5DM7R 2M9UA 4KGXB 3AT1B 2DKGA 2DNUA 2RD1A 3QKJA 1LNXA 4M7DF 1WGSA 5EC7A 5A0LA 1CSKA 1E6HA 2JUFA 1SPKA 2XHCA 1H3ZA 3G71T 2Y4XA 3OQ5A 1MV3A 5D6XA 3CCLT 5IN1A 1LPLA 1X01A 3SFMA 4F7UF 1UGQB 3UA6A 1K0SA 1H8KA 1I5OB 3EG0A 4HVWA 2OTJA 1NEGA 3EH2A 4M77A 4XU3A 5M9OA 3C0CA 3CCUQ 4GLKA 1T3SA 2DRKA 3GP8A 3HFOA 4QKUA 1WHHA 1VQLQ 2KR3A 2K3YA 2M0YA 1QCOA 1WJSA 2COWA 2FPFA 1AT1B 3HRUA 3FDRA 3M0TA 2WSEE 4BY6C 2JNGA 1M1GA 3VYGA 1UHFA 2HEQA 2OJ2A 2RM4A 2B86A 4RKUE 4VUBA 2NLUA 3PNWC 2HL3A 1S72Q 5GMKj 3LX7A 1BI2A 1RAIB 3LGLA 3CQTA 3EAEA 1VQLT 5I2SA 1M27C 2YLBA 1TOVA 2DD5A 3S3MA 4JJBA 1LJOA 2QI2A 2FHDA 5A0DA 1I5LA 2RJCA 2L89A 1G3WA 4IUTA 4C92G 1KQ2A 2BZYA 3OY9A 3CCST 3TVTA 2QQRA 2HSEB 2BIVA 4AFZC 2D6FA 5LJ3e 1BIBA 2PQWA 4K11A 1VQKA 4CRIA 2XI9A 1QLYA 3VV0A 4FYVB 4OB3B 2KRSA 3I5SA 1G3TA 2H8HA 2OAWA 2P84A 4X34A 1YJNT 5CQYA 1K73U 2RQWA 2E3IA 3C94A 2QASA 3CCMQ 3RR6A 4X9DA 1WXUA 3JB9H 1MMGA 2L3QA 4OMNA 5FRMA 1G2BA 3G4SA 1R77A 2X35A 4F7UB 2ZPBB 1VA7A 2Z0WA 1VQ6T 2QK0A 3GIBA 1WI7A 5GAMh 2DXBA 1HSQA 1RABB 2O4XA 2KY9A 1V29B 2YLCA 1WLPB 1TUGB 5LJ3h 3WVEB 3DB4A 2RH2A 4R56A 2M0OA 4HT9A 5CQXA 1VQNT 4PL6A 3M0SA 4JUVA 1K73C 5HK3A 2QEXT 1YJ9Q 2M51A 3V7CA 5J26A 1YIJT 1RAFB 4QQ6A 2A37A 1ABOA 3P8HA 4C5IA 1YITQ 4M7DA 4PLIA 2NUPA 3CMAQ 2Y90A 2J6FA 1ZSZB 2PVOB 1MV0B 2MPXC 5J39A 1EZZB 1IB8A 3CD6T 1MNEA 4IUUA 2FPEA 4IUVA 2LC4A 3U23A 2FZKB 4MMKA 4F7UA 3NTKA 2JJ9A 5DLQE 4M78E 4GBQA 1JBMA 1H92A 1IRXA 1TS9A 4KGVB 4MDXA 1MHNA 4M78D 2DXTA 4HCBA 1OX9A 3JCMe 3H0HA 3EHQA 1T3LA 3SEMA 4XTXA 2BZ8A 3SB2A 4XU2A 1K8AC 7AT1B 2R58A 5HCKA 5GAMg 2J7IA 4DBQA 2K4YA 2MIOA 1ZHIA 3I35A 4X1VA 1KG1A 1F1BB 2QGGA 5IXFA 2C0TA 1ZA2B 3M9QA 1W2BP 4E7ZA 1YNZA 3WVDB 2GBQA 1KJWA 4HVUA 2RNAA 1G8XA 2DRMA 1SHGA 1N5ZA 2HCKA 4E7SA 1ZSZA 1BI3A 4OMOA 2RHUA 4ESRA 1D1CA 5GJWB 2RI3A 4MZPA 2CP3A 4GLMA 3JSCA 2W0ZA 1QWEA 2V8KA 3X28B 1VQ7T 2YUNA 1WXBA 1W2BA 3GLXA 2LRQA 3LLRA 4FSXA 2RHIA 4BY6B 1C1AA 2ZCFB 3SWNB 2OTJT 4KUIA 4QVZA 1VQ8Q 1WHLA 3VS4A 1H641 5IT9E 2L3SA 4EMGA 4JJCA 4LUEA 1VQPQ 2CDTA 4PJOG 2EYYA 2LVMA 3CBPA 1UJ0A 4C0GA 3M5AA 3HL8A 2EFIA 1NJIU 2DJQA 2A0FB 2EQKA 3V8KA 2YUPA 2RQVA 3L1AA 3CC4Q 5EG2A 2XICA 4JRQA 4QQGA 2CP0A 1B07A 3A8HB 1WZOA 3TU4K 1NG2A 1VQPT 2ZPIB 1KHCA 1OZ2A 2KVQG 3QWXX 2EQJA 5FWCA 2JM9A 3I9QA 5C0MA 4AFQC 4J7IA 3JB9I 1NJIC 4MZTA 2MOXA 3PMTA 2OI3A 2O9VA 3INZA 3CPFA 3JB9G 1JEGA 4AG1C 1N27A 2CH4W 3MEWA 2HNIA 2LJ1A 1IGQA 4J9HA 2QXFA 1OPLA 2RK2A 4NL3A 2OTLA 3QDFA 2DVJA 2VUBA 4OB2B 5DLOA 1ZUUA 4AFSC 2KQWA 1K76A 2J06A 2AKKA 4WF2A 2RHYA 4UC4A 1QVFP 1BI0A 2O31A 1D1BA 1VYVA 4F14A 1VQMA 1VQKT 1M3BA 4XTVA 4NS5A 2F2VA 5CIUA 5CO7A 2GFAA 2VWFA 1VQ4Q 1PM3A 1UGVA 2HDAA 2RMOA 2XDDA 1HD3A 1QVFA 2JTEA 3IQLA 4R0KA 3G4ST 1Q7YU 1UB4A 2JMAA 2K5LA 3VYHB 1X6BA 2RF0A 5LJ5e 1KD1U 3CC7Q 1O9SA 3QJ6A 1WJQA 1XOVA 2RA2A 1CKBA 1JJ2A 3QG1A 1W2BS 2KRNA 1Q86U 4II1A 3UPUA 2KMTA 2LT4A 1BCMA 1NYGA 4V2SA 4JRIA 1YI2Q 2P0KA 2EYWA 4OMLA 4Q5WA 3BFMA 2FEIA 3F70A 2DILA 3A8GB 2HBPA 1PD1A 4QVCA 5GAOq 5GMKm 3RERA 1KD1C 5GAMf 3MEVA 3CCUA 3GF5A 3VS2A 4PJOF 1VQLA 4RG8A 5LJ5h 2IIMA 4A53A 5LJ3f 3E2UA 2MWPA 4ANJA 4N4HA 2KRMA 1JU5C 3JB9J 1Q86C 2V26A 3ME9A 3R6OA 1D1AA 1W6XA 1PKTA 1PC0A 2CYZB 3J81E 1YWOA 1VQ5Q 1NM7A 1JO8A 5CKEA 2F5KA 1S72A 3REAB 3OB9A 1N6AA 1G5VA 2G6FX 1RAAB 5I2MA 3M0QA 1NZ9A 4PNOA 1ZBXA 5CKFA 5CKBA 3JCMJ 4M75C 1AZGB 1UGSB 1YBYA 2O9SA 4LDYA 3KXTA 5IAYA 2DL7A 3FRNA 3V7RA 1VQ5T 2X3WD 4BB7A 4JLGA 1M90C 2HKQB 2YRVA 4JRKA 1ZQ1A 3SD4A 4IIMA 3NHNA 4OMFB 2LT1A 2C06A 4HCKA 2ZZDA 4M7DC 4Z88A 2EAYA 4ZN3A 3OYLA 3OS1A 2EYZA 2PNIA 3CXCP 1M1KC 3VS7A 1PWTA 1U06A 3ZFJA 1R8OB 4DBHA 2K2VA 3CCMA 1QVFS 3N5BB 4XK8E 1Y71A 2F2XA 2HKNA 3QSUA 5C6SA 1KC8U 3THKA 4M7DE 3EHRA 2H3JA 1N8RU 3UT1A 1UGPB 3GOXA 3JCMf 4M7DD 1JJ2S 4X9CA 5KYNA 3GNGA 4OMQA 4Y92A 2DJZA 1IREB 1RACB 5KYYB 3HSBA 1W70A 2RJDA 2DA9A 5I11A 3M54A 4MDWA 4ZTFA 4MZMA 1QKXA 3CCRQ 1YJ9A 1FMVA 3EG1A 5CVIA 4IUQA 3UATA 3HKSA 2V8JA 4M75F 1YITA 1KC8C 1ABQA 3X26B 3CMAA 1TU0B 1I07A 3VS6A 4E7JA 3LWIA 2D0NA 2CZ7B 3NPFA 1KK7A 1M1FA 2X51A 5I22A 3VKIA 2EGCA 2OTLT 4LXCA 2MAMA 3HFNA 2IG0A 3NGPA 4OVAA 2LQNA 4JZ4A 4RTZA 1SKUB 2LNHB 2D1XA 2YRCA 1HYOA 3L42A 3CCEQ 1VQMT 4J9CA 4C0DC 5KYYA 3CPWA 1VQ7A 1B34B 2V1RA 4C0ZA 2ED1A 4PJOA 4FT4A 5HKCA 4QW2A 4XTUA 4C8QC 2YUOA 2KNBB 1NE8A 3BDLA 2DEQA 2EW3A 5KYXA 1B7TA 3WXMB 2RN8A 4QVDA 5GAN3 2EPDA 4A54A 2JVVA 2ESWA 2LQWA 1WHMA 1AOJA 2GNCA 1WJRA 1OX8A 5FU7C 4E6RA 1Q82R 2DX1A 4PJMA 2KXCA 5GAOm 1XJWB 1SRMA 1K9AA 1NLPC 1Q7YR 4B9XA 1M5Q1 1J3TA 1AWXA 4J9GA 1WYXA 2DXCA 4BD3A 2AIRB 3A8LB 1VQ8A 1ZA1B 1VQ9Q 2I2LA 4E7IA 2KSSA 2H3EB 1OULA 1VQPA 2ZPHB 3CCUT 3CCQQ 1B34A 2EKOA 4YTLA 1Y96B 3PIPA 2CP7A 1BB9A 3EFSA 1Q81C 5GAN4 3CXCS 2A3LA 2O4XB 5D6YA 2E41A 3JCMW 3L2UA 2QTVA 3CC4A 5GAMj 2X4YA 4M75B 1WNLA 2KT8A 3E1SA 1OU8A 5GMKe 5LJ3j 2EVRA 1U5SA 3J7AF 4J9EA 3RMQA 3QIIA 2J05A 3KBGA 1S72T 4C8QF 2ENMA 5LJ5f 1TG0A 3FC3A 4HCCA 4OGEA 1X69A 2VYTA 2FZGB 3QYHB 1KIKA 4M7DB 3OSSC 2NUPB 1FMWA 2CUBA 1GBRA 1ZUYA 5KCHA 1OOTA 2COYA 1G83A 2K5FA 1YJWQ 2C0IA 1Y96A 3MP8A 3P8DA 2K57A 5FU6C 5GAN5 3V8LA 4M78G 3I56Q 1S1NA 4LNPA 2RHXA 3UA7A 2DPPB 1X27A 1AD5A 4F17A 3OYKA 2HSPA 4C92C 3JCMX 3CPWS 5KE2A 1DJ7B 1ZLMA 4M75A 3CMEQ 3DLLA 2KK4A 4NOYA 5IH2A 5FLXE 4E7LA 4XTWA 3OYDA 1YHQQ 4XTYA 1X43A 5CK9A 1VQ4A 2AT1B 3MP1A 2KBTA 3CCMT 4CC2A 1FWZA 2K3XA 1IO6A 5IHKA 1E6GA 4FYWB 4FIBA 2XD0A 4C92E 3CC7A 2EJFA 1VQOQ 3EGDB 4JZ3A 4B6MA 1K8AU 2LNVA 4C5GA 3D7SB 2HD0A 5FROA 2LQKA 2RO0A 4RTXA 3M0RA 5GAMd 4KBMB 3PE0A 2BZXA 5CKDA 2E64A 4KH0B 2J6KA 3ZBDA 2BE9B 2EWNA 5LJ3d 1KFZA 1QVGP 3VS1A 2FL7A 5GAN7 2LZ6B 1BCOA 3CBOA 2CGHA 1YI2A 2JN0A 1YJ9T 1KHIA 1A0NB 1N8RR 3JCMV 1C0MA 1GBQA 1JQQA
chains in the Genus database with same CATH topology
1PSFA 1VQMA 3CCVT 5HK0A 3CCJA 2L8DA 3QUIA 5FRNA 5GMKi 1YITT 1OI1A 2RJEA 4C0DB 1BIAA 1VQKT 5GAOr 3FB9A 4BACA 1KQSS 3JCMP 4XTVA 4C5HA 3CMAT 4NS5A 3SWNC 1Y7XA 3E9GA 4KULA 5CIUA 5CO7A 2GFAA 5LJ3g 3H8ZA 4PKCC 1VQNA 4C8QB 1AHJB 4J7FA 2QEXA 4E7HA 2F69A 4OP0A 2GQVA 2EYQA 4PLLA 3J80E 2XDDA 2MWOA 3MEUA 1QVFA 4BI3A 1LOJA 3CMEA 1YIJA 3G4ST 2VV5A 2QA4A 1UB4A 2K5LA 3JCMc 3VYHB 4BI8B 5GMKl 5LJ5e 4BE1A 1KD1U 1W4SA 4C92F 3CC2T 4ZGEB 1O9SA 2LCLA 3OS5A 3QXEB 3QJ6A 1WJQA 2V8IA 3HRSA 4J83A 3PT9A 3OYJA 1XOVA 2PU9B 1VQ5A 1YCYA 2EQUA 2DZ9A 4L5GA 2DTHA 1VQ9T 3OYBA 2RA2A 4M7AG 2EQMA 3VUBA 3OYFA 1JJ2A 5FU7B 1U8RA 2E10A 4J6WA 2E70A 3QG1A 3CCQT 3CD6A 1W2BS 2FVUA 4XU0A 2QTXA 3JRZA 3JCMh 1Q86U 4JDSA 2CZ6B 4II1A 3OYGA 1BI1A 3PMIA 3UPUA 1D3BB 2EJ9A 2KMTA 2LT4A 3A8MB 3LGFA 3QPHA 3L2ZA 3NTIA 4A4GA 4L59A 4F7UE 4V2SA 4JRIA 2P0KA 3P8BB 5GAMe 4Q5WA 3BFMA 3F70A 4QQDA 3S6WA 3A8GB 2HBPA 2IVWA 2EJGA 3C4SA 5A2QE 4ZTJA 4C8QG 2DD4A 4JS5A 2EIFA 3JAME 4P5NA 4M77B 4ELYC 4L6V5 4Z02A 4QVCA 5GAOq 2WSCE 5KE3A 5GMKm 3RERA 1KD1C 5GAMf 3MEVA 4Y91A 3CCUA 3GF5A 1I4K1 2PVDB 4NL2A 2LQ8A 2R57A 1VUBA 4PJOF 1G3YA 4RG8A 1VQLA 1P92A 5LJ5h 1N8RC 2DK3A 4A53A 5LJ3f 3PFSA 2MWPA 5GMKh 2DXUA 2L3RA 2DZCA 4C8QA 4N4HA 2LTOA 3JB9J 2ZPGB 4IURA 4ELZC 2CS7A 2E65A 2GCXA 1RL2A 2X4JA 3ME9A 3JCMd 3R6OA 1Q86C 1G3SA 3C95A 5DM7R 1BYMA 3HHTB 1UGRB 3UDCA 3H6ZA 2M9UA 4ME7A 2M1HA 2RJFA 2DKGA 2RD1A 3QKJA 4O5VA 2CYZB 4XAXB 3SDZA 3J81E 2DAQA 2WACA 1LNXA 2D9TA 3BDUA 1WGSA 2GFUA 4M7DF 4M7AC 4J8OA 4EMKA 1JB0E 1I8FA 1VQ8T 4N0AA 5A0LA 2JUFA 3JCMQ 3NTHA 2XHCA 5CKEA 2F5KA 3LYIA 4C5EA 1S72A 1YJWT 1H3ZA 4M77G 3G71T 3OB9A 2Y4XA 3OQ5A 4BI4A 5D6XA 3CCLT 1M8VA 1N6AA 2YHTA 1G5VA 5IN1A 1D3BA 5KH6A 1X01A 2DTOA 3I56T 3MP6A 3RESA 4EDUA 5I2MA 4J5YA 3SFMA 4F7UF 4C92D 2DO3A 1U1SA 2JOYA 1UGQB 2QQSA 5I21A 3G6EA 3M59A 1NZ9A 4PNOA 4FL6A 3M58A 3JCMg 1ZBXA 5CKFA 1JRIA 3M55A 5CKBA 2OTJA 3JCMJ 3VJPA 1FX7A 3PGGA 2DIGA 1MGQA 4M75C 3T9NA 1UGSB 4EMHA 3DB3A 3FEOA 4M77A 3CMET 2RI5A 4XU3A 2P0QA 3CC4T 5GANe 3S3NA 5M9OA 1YBYA 4LDYA 3X20B 3KXTA 2D0QB 2OAUA 4M78C 1YHQT 3META 5IAYA 3FRNA 4XQ3A 4GLKA 3V7RA 3HFOA 3TREA 3GP8A 4BB7A 3E19A 1VQ5T 2K3YA 2ZPFB 4JLGA 3GNFB 1WJSA 3CCRA 1M90C 3HRUA 2CZ0B 3FDRA 5CCAA 3TCJA 2YRVA 2G3RA 2XKOC 4LDWA 4JRKA 1ZQ1A 3SD4A 4OMFB 2LT1A 2C06A 4N4IA 1VQOT 3E9FA 5GAOn 3GPLA 4TVRA 1GXIE 2ZZDA 2QDYB 2PVGB 2L5QA 3OYYA 2EAYA 2WSEE 4C92B 4DA4A 3HP9A 4BY6C 3OYIA 4ZN3A 4PJOE 2E12A 2JNGA 3OYLA 3OS1A 1QVGA 3NFCA 1M1KC 1M1GA 3CBMA 1EIFA 4PJOD 2XG8D 3VYGA 3ZFJA 1R8OB 2RM4A 4OB1B 1QW1A 5LJ5j 4RKUE 4VUBA 2K2VA 2AHJB 3OA6A 2NLUA 3PNWC 3N5BB 5GAN8 3CCMA 1QVFS 2HQXA 4XK8E 1FXXA 1Y71A 5GMKj 3LX7A 2A7YA 4OGCA 1BI2A 3LGLA 1X75C 1NPPA 1N9SA 2JTFA 2KDSA 5C6SA 3EAEA 3QSUA 1VQLT 2BKDN 2RB6A 3ER0A 1KC8U 5I2SA 2YLBA 4M7DE 2H3JA 1N8RU 3UT1A 1UGPB 2DD5A 4EMKB 3GOXA 3S3MA 3JCMf 2M16A 1LJOA 3PIOA 1JJ2S 4M7DD 3CCEA 4KT0E 4X9CA 5L8RE 2R5MA 1TH7A 2QI2A 3GNGA 2FHDA 5A0DA 4M7AF 2DJZA 1I5LA 1IREB 3RKXA 2RJCA 2L89A 3HSBA 3QZ5B 1G3WA 4IUTA 3LH0A 4JLIA 4C92G 2RJDA 3C12A 3DLMA 3QBYA 4LDUA 5CR2A 3I55T 1KQ2A 3L2VA 3OYMA 3OY9A 4GY5A 3M54A 3L2QA 3CCST 3M56A 3MEAA 4MDWA 2QQRA 2E5QA 1VQ4T 1K9MU 5AYFA 4ZTFA 4MZMA 2BIVA 2XU8A 1WPYA 1YJ9A 2D6FA 2E6NA 3L2RA 4E7KA 3VUZA 2ZPEB 4E47A 2XDPA 5LJ3e 2MF2A 1BIBA 4RG2A 2PQWA 5CVIA 3VU3C 4IUQA 4HA8A 4DOWA 4R55A 3CCVA 3CC7T 3OBYA 3PTAA 3HKSA 1SSFA 4A4HA 2V8JA 4C92A 1XTDA 4M75F 1YITA 1KC8C 4C0FA 3RUXA 1VQKA 4CRIA 3X26B 2XI9A 3CMAA 3VV0A 4OB3B 4BE2A 4E7JA 4M78F 1G3TA 3LWIA 4M7DC 2CZ7B 3LW5E 4X34A 1YJNT 5CQYA 4JS4A 2QQBA 1K73U 1M1FA 1UEBA 3C94A 2VC8A 3VKIA 2RK1A 1RI0A 1Y07A 4X9DA 2OTLT 3JB9H 3O8VA 2DTIA 2K5IA 2MAMA 4JRPA 3HFNA 2IG0A 2RI2A 2R5AA 1O75A 4OVAA 3G4SA 5FRMA 2X35A 3S3OA 1YI2T 4F7UB 2ZPBB 3OYHA 1K9MC 3HRTA 3UWNA 1VQ6T 1NPRA 3L42A 1M90U 2FYKA 2QQ9A 2QQAA 3GIBA 4LDXA 5GAMh 1VQ9A 2DXBA 1VQMT 2O4XA 3CCJT 4C0DC 2VXFA 2KY9A 1V29B 2YLCA 3MHXA 2XDBA 3CCQA 5LJ3h 4M77F 3CPWA 3WVEB 3M4GA 1B34B 3QDRB 1VQ7A 3DB4A 2RH2A 3RMSA 4C0ZA 4PJOA 3RKWA 2CKKA 4FT4A 5LJ5d 4R56A 5HKCA 2M0OA 4QW2A 4XTUA 2XIDA 2LDMA 4HT9A 4C8QC 1M1KU 5CQXA 1VQNT 4PL6A 2HAXA 5GANj 4JUVA 1K73C 5HK3A 1NE8A 3BDLA 2QEXT 4M7AE 3V7CA 3JB9F 2DEQA 5J26A 1YIJT 3X25B 2QA4T 4M7AD 4QQ6A 3WXMB 3P8HA 4C5IA 4QVDA 5GAN3 4MMLA 4XU1A 4A54A 3OYCA 2JVVA 4F7UG 4M7DA 3OYEA 3V7SA 4N0AC 4PLIA 2Y90A 5FU6B 1WJRA 3LWHA 2JTMA 2PVOB 5FU7C 3SWNA 1Q7YU 4RCCA 1IZ6A 5J39A 3CD6T 3FIFA 1WQ7A 4IUUA 5LJ5g 3OW2A 4Y28E 1X6OA 5GAOm 4PJOC 2PUOB 4IUVA 4DQ2A 4M75E 2LC4A 4LD6A 1QVGS 4MMKA 4F7UA 3NTKA 4B9XA 5DLQE 4M78E 4M75D 3FLGA 1JBMA 5GAN6 1M5Q1 1WQWA 4MDXA 2X4WA 4ZGJB 2DXCA 4BD3A 1MHNA 3MCAB 4J6YA 4M78D 1OYXA 3A8LB 4M77C 3OS2A 2DXTA 3A8OB 1VQ8A 4HCBA 2I2LA 4FU6A 3JCMe 3OS0A 4E7IA 2KSSA 1XNIA 1VQPA 2BUDA 1KQ1A 3HPWA 4LDVA 2ZPHB 3QJYA 4XTXA 3CCUT 1YJWA 1B34A 2EKOA 4YTLA 5CKHA 3G71A 3SB2A 3CCLA 4XU2A 1Y96B 1K8AC 2R58A 5GANh 5A0GA 3PIPA 5GAMg 2ZGWA 4RMOA 1KQSA 3I56A 2DIQA 2P0PA 2K4YA 1ZHIA 3EFSA 1Q81C 5GAN4 5D6WA 2PUKB 1Q82U 4KUDK 3CXCS 1KG1A 2A3LA 3M53A 3M9QA 3QHSA 4EPCA 1PSEA 2O4XB 3CXCA 5D6YA 2E41A 3JCMW 3WVDB 4M77E 3JCMb 4OF1A 3L2UA 5LL6S 3CC4A 5GAMj 1QVPA 2X4YA 4M75B 3QZ9B 4PJOB 1HXDA 4M77D 1WNLA 1YHQA 3E1SA 2XK0A 2E6ZA 5GMKe 4M78B 5LJ3j 2MMPA 2GF7A 3DKMA 1U1TA 3J7AF 1BI3A 2RHUA 3RMQA 3QIIA 2MI6A 3KBGA 4HCZA 4C8QF 2RI3A 4MZPA 1S72T 5LJ5f 2P4TA 3JSCA 2RHZA 3X24B 3JB9D 2V8KA 2VXEA 3FC3A 4OGEA 3X28B 3QO3A 1VQ7T 4HCCA 2VYTA 1VQOA 3QYHB 5GANd 4HKEA 1W2BA 4LD9K 3GLXA 3MO8A 1QP3A 2LRQA 3LLRA 2CZ1B 4M7DB 3G6ET 3OSSC 2RHIA 4FSXA 4BY6B 2ZCFB 1Q82C 3SWNB 2OTJT 4KUIA 4QVZA 2JZ2A 5KCHA 4M7AA 4IKFA 5J3BA 1H641 5IT9E 4EMGA 1OZ3A 1Q7YC 2K5FA 3RKYA 4M75G 4HT8A 3G7ZA 1Y96A 3MP8A 3P8DA 1QP2A 4PJOG 3CC2A 2LVMA 2K57A 3CBPA 5FU6C 5GAN5 4RCBA 3V8LA 2FB7A 3ZEHA 4M78G 3CCRT 4C0GA 3M5AA 3HL8A 2EFIA 3OMCA 3OYAA 2RHXA 4FT2A 4FM4B 1NJIU 2VGMA 2DPPB 2KAFA 5KCOA 2EQKA 5GANg 1M4ZA 3OYKA 3V8KA 4BE0A 3TEEA 4C92C 3JCMX 3CPWS 5KE2A 4A4EA 3ASKA 5GAOl 3L1AA 3OBWA 1DJ7B 3M4YA 4M75A 3DLLA 2KK4A 4NOYA 3CEYA 5EG2A 5FLXE 3I55A 4E7LA 4XTWA 1VIEA 2XICA 3OYDA 3EFRA 4M78A 4XTYA 3BY7A 4M7DG 4A4FA 3CCSA 1VIFA 2LCCA 3OYNA 4BUGA 3V8JA 5CK9A 1VQ4A 4JRQA 4QQGA 1BKBA 2B8AA 5CAIA 3MP1A 3CCMT 3A8HB 1FWZA 4A4KA 3TU4K 2K3XA 3BW1A 4DOVA 2Y4YA 1VQPT 2ZPIB 2DVEA 1KHCA 1OZ2A 2KVQG 4N4GA 4D6WA 2EQJA 4FIBA 5GAOp 4BDZA 2XD0A 4C92E 3CC7A 2EJFA 5C0MA 4ATOA 2O01E 3AHUA 1K8AU 4J7IA 4EMKC 4ZGDB 4IUPA 3JB9I 1HK9A 5HY6A 2LNVA 3FJPA 5DY9A 3QYGB 4C5GA 1NJIC 4MZTA 4CI0C 2HD0A 5FROA 2LQKA 3CCET 1Q81U 3PMTA 1N9RA 2RO0A 5GAMd 4OB0B 4KBMB 3OSVA 3INZA 3CPFA 4C8QE 1M9SA 2E64A 4B9WA 5CKDA 3JB9G 4O6JA 2HQEA 2WSFE 5GAN2 1N27A 3OW2S 3MEWA 2HNIA 3L2WA 1YJNA 3ZBDA 4JJNK 2EWNA 5LJ3d 4C8QD 4BDYA 2QXFA 1XQHA 2RK2A 3Q1JA 2E1HA 4NL3A 2OTLA 2VUBA 2FL7A 5GAN7 4OB2B 5DLOA 4XTZA 3OMGA 3CBOA 1I81A 2CGHA 2KQWA 1YI2A 2JN0A 4J6XA 2LX9A 2X4XA 1YJ9T 4ZN1A 4WF2A 2RHYA 1KHIA 3KUFA 4UC4A 3A5ZB 2F5TX 1BI0A 3M57A 3JCMV 4M7AB 1VQ6A 5GANf 2VGNA 3URGA 3RIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XK0 A;  1RI0 A;  2L8D A;  2QQS A;  5FRN A;  3O8V A;  2GF7 A;  1OI1 A;  2RJE A;  4FL6 A;  5FRM A;  2IG0 A;  2RI2 A;  2R5A A;  2RHU A;  4OVA A;  3QII A;  4BAC A;  2X35 A;  4C5H A;  4HCZ A;  3S3O A;  2RI3 A;  4NS5 A;  2DIG A;  3OYH A;  3E9G A;  3DB3 A;  2RHZ A;  3FEO A;  3UWN A;  2RI5 A;  3FC3 A;  3S3N A;  5CIU A;  5M9O A;  2GFA A;  2VYT A;  3H8Z A;  3L42 A;  3MET A;  5IAY A;  3MO8 A;  2LRQ A;  2O4X A;  4E7H A;  3LLR A;  2RHI A;  4PLL A;  2K3Y A;  2MWO A;  3MEU A;  1WJS A;  4QVZ A;  4BE1 A;  3DB4 A;  3FDR A;  2JZ2 A;  5KCH A;  2YRV A;  4IKF A;  2CKK A;  2G3R A;  3QJ6 A;  1WJQ A;  3SD4 A;  3OYJ A;  2M0O A;  4QW2 A;  2LDM A;  4N4I A;  3E9F A;  2EQU A;  1OZ3 A;  4PL6 A;  3OYB A;  3OYI A;  3BDL A;  3MP8 A;  3P8D A;  2LVM A;  2EQM A;  5J26 A;  3OYF A;  3OYL A;  3OS1 A;  3ZEH A;  3OMC A;  2EFI A;  3OYA A;  2RHX A;  4QQ6 A;  4II1 A;  3OYG A;  3PMI A;  3P8H A;  5KCO A;  3LGF A;  4C5I A;  3NTI A;  4A4G A;  2EQK A;  3OYC A;  3OA6 A;  4L59 A;  2NLU A;  3PNW C;  3OYK A;  3OYE A;  4BE0 A;  2HQX A;  4PLI A;  5KE2 A;  2P0K A;  3ASK A;  4A4E A;  4EDU A;  3LX7 A;  1WJR A;  4Q5W A;  3F70 A;  4QQD A;  3S6W A;  3C4S A;  3LGL A;  4ZTJ A;  2JTF A;  5C6S A;  5J39 A;  3CEY A;  3EAE A;  2BKD N;  4E7L A;  3OYD A;  4IUU A;  4A4F A;  3UT1 A;  4Z02 A;  2LCC A;  3OYN A;  3GOX A;  5KE3 A;  3S3M A;  4IUV A;  2M16 A;  4QQG A;  2B8A A;  3MEV A;  4LD6 A;  3MP1 A;  2R5M A;  2FHD A;  2K3X A;  2R57 A;  3NTK A;  4B9X A;  3FLG A;  2RJC A;  2L89 A;  1KHC A;  1OZ2 A;  2X4W A;  3PFS A;  4N4G A;  2EQJ A;  4IUT A;  2MWP A;  3LH0 A;  4BD3 A;  1MHN A;  4BDZ A;  2RJD A;  2L3R A;  1OYX A;  3DLM A;  3QBY A;  2LTO A;  4N4H A;  5C0M A;  3OS2 A;  3L2V A;  4IUP A;  3OYM A;  3OY9 A;  4GY5 A;  3L2Q A;  4FU6 A;  3OS0 A;  4IUR A;  4E7I A;  3MEA A;  4C5G A;  2QQR A;  2E5Q A;  1XNI A;  4ZTF A;  2BUD A;  3ME9 A;  5FRO A;  2BIV A;  3PMT A;  2RO0 A;  2EKO A;  2E6N A;  3L2R A;  4E7K A;  3H6Z A;  4B9W A;  2R58 A;  2M1H A;  2HQE A;  2RJF A;  2XDP A;  1N27 A;  3QKJ A;  3MEW A;  3L2W A;  2DAQ A;  2WAC A;  2DIQ A;  4RG2 A;  2D9T A;  1WGS A;  2GFU A;  2PQW A;  4BDY A;  4IUQ A;  5D6W A;  3Q1J A;  1SSF A;  4A4H A;  3M9Q A;  3NTH A;  2O4X B;  2F5K A;  3LYI A;  5D6Y A;  3OMG A;  4C5E A;  4CRI A;  1H3Z A;  4BE2 A;  4E7J A;  2X4X A;  3L2U A;  3OB9 A;  3OQ5 A;  2RHY A;  5D6X A;  3KUF A;  4UC4 A;  2X4Y A;  1G5V A;  5IN1 A;  5KH6 A;  4X34 A;  3MP6 A; 
#chains in the Genus database with same CATH topology
 1PSF A;  5HK0 A;  2L8D A;  3TSW A;  5FRN A;  1UE9 A;  5GMK i;  1M2V B;  4C0D B;  1YIT T;  4WCI A;  1IHW A;  1BBZ A;  3CMA T;  1Y7X A;  3I55 Q;  2QAZ A;  1GCQ C;  4J9B A;  4OMP A;  2KGT A;  1ZBJ A;  1TXQ A;  5LJ3 g;  4C8Q B;  4E7H A;  2F69 A;  2LJ0 A;  2GQV A;  2O2O A;  2CT3 A;  4BI3 A;  1ACM B;  2CUD A;  3JCM c;  5GMK l;  3EGD A;  1W4S A;  2YRD A;  4C92 F;  2DMO A;  3OYJ A;  2PU9 B;  1VQ5 A;  1YCY A;  2EQU A;  2DZ9 A;  4L5G A;  2EYX A;  1X2Q A;  4M7A G;  2NWM A;  3RBB B;  5FU7 B;  2E10 A;  4J6W A;  2DET A;  1HJD A;  2FVU A;  4XU0 A;  3JCM h;  3OYG A;  2L3P A;  2JW4 A;  4L59 A;  1H3H A;  2IVW A;  4WTO B;  2GTO A;  1M2O A;  2EIF A;  3MJX A;  3JAM E;  4ELY C;  1D0Z A;  4L6V 5;  5IHI A;  3CCJ Q;  1OU9 A;  5KE3 A;  1M2V A;  1AWO A;  2EGA A;  3EH1 A;  1TWB A;  1RAH B;  2DK3 A;  1VYT A;  3PFS A;  2F2W A;  4M4Z A;  2DXU A;  2L3R A;  4C8Q A;  2E65 A;  3JCM d;  3HHT B;  2QA4 Q;  3UDC A;  4ME7 A;  2M1H A;  2JS0 A;  2RJF A;  2DAQ A;  2WAC A;  2D9T A;  2HBW A;  3BDU A;  2GFU A;  2K2M A;  4M7A C;  4J8O A;  4EMK A;  1I8F A;  1NLO C;  1VQ8 T;  3JCM Q;  1WX6 A;  4M77 G;  4BI4 A;  1M8V A;  5KH6 A;  5L23 A;  3MP6 A;  3RES A;  4EDU A;  4J5Y A;  1QCF A;  2DO3 A;  2JOY A;  5I21 A;  2QQS A;  3M59 A;  5IXB A;  2EGE A;  3M58 A;  3JCM g;  3M55 A;  3MKD A;  3VJP A;  1FX7 A;  2AZS A;  2DIG A;  3PGG A;  2JM8 A;  3GBQ A;  3T9N A;  4CC7 A;  4EMH A;  3DB3 A;  3CC4 T;  2JS2 A;  4PJO C;  2P0Q A;  5GAN e;  2RQR A;  2D0Q B;  2ATC B;  3MET A;  3E19 A;  1YCS B;  3GNF B;  3CCR A;  2CZ0 B;  5CCA A;  2ROL A;  3TCJ A;  2G3R A;  2XKO C;  4N4I A;  1R0C B;  3E9F A;  5GAO n;  4Z8A A;  3GPL A;  4PJL A;  1KQS P;  1GXI E;  4C92 B;  4RTY A;  3HP9 A;  3OYI A;  2MCN A;  4PJO E;  2K9G A;  3NFC A;  1E7O A;  4PJO D;  2NUZ A;  4OB1 B;  5LJ5 j;  3OA6 A;  2AHJ B;  1MMN A;  2A7Y A;  4OGC A;  1X75 C;  1NPP A;  1N9S A;  2JTF A;  2KDS A;  1PRM C;  2RB6 A;  4AT1 B;  3REB B;  3G6E Q;  3VRZ A;  2DBK A;  3CCE A;  4KT0 E;  1MMD A;  2R5M A;  1TH7 A;  3ZL7 C;  4M7A F;  1UUE A;  1U3O A;  1K73 R;  3RKX A;  2QYZ A;  1WA7 A;  4CC3 A;  3LH0 A;  3DLM A;  2I0N A;  2FRW A;  4RTW A;  1IXD A;  3L2Q A;  1WHJ A;  2JXB A;  2E5Q A;  1VQ4 T;  1K9M U;  2XU8 A;  3EFO A;  2E6N A;  1CKA A;  3L2R A;  3VUZ A;  4E7K A;  2YWW A;  2XDP A;  2MF2 A;  3VRY A;  4LE9 A;  4RG2 A;  2KI7 A;  1WFW A;  1D0Y A;  8ATC B;  3CC7 T;  1TTH B;  3PTA A;  4C92 A;  1SSF A;  4PJJ A;  1MUZ A;  4BE2 A;  2DFU A;  4DBR A;  4JS4 A;  1AZE A;  1UEB A;  2VC8 A;  4FW2 A;  1Y07 A;  3O8V A;  1Y57 A;  2DTI A;  2K5I A;  4LUD A;  2RI2 A;  2R5A A;  1O75 A;  4E2F B;  1YI2 T;  3S3O A;  1OQK A;  1UHC A;  1K9M C;  3HRT A;  1D09 B;  3UWN A;  1K8A R;  3LH5 A;  1M90 U;  2FYK A;  2QQA A;  1VQ9 A;  1GFD A;  2M02 A;  3MHX A;  1W1F A;  3CCQ A;  4M77 F;  3M4G A;  1EX4 A;  3RKW A;  5LJ5 d;  2LDM A;  1M1K U;  2HAX A;  4LN2 A;  1D0X A;  3JB9 F;  2FG0 A;  2AK5 A;  3X25 B;  2PZ1 A;  3CCV Q;  1WXT A;  3OYC A;  4F7U G;  3OYE A;  4N0A C;  2ZAE A;  2JTM A;  1AWJ A;  4RCC A;  1GCQ A;  3FIF A;  2K7A A;  5FWB A;  1WQ7 A;  5LJ5 g;  4Y28 E;  1X6O A;  5GJV B;  2CP2 A;  2KXD A;  4DQ2 A;  4M75 E;  4LD6 A;  1NEB A;  2ECZ A;  4M75 D;  3FLG A;  1WQW A;  1I0C A;  2X4W A;  4ZGJ B;  1BK2 A;  4J6Y A;  3OS2 A;  1OYX A;  2HZY A;  1RLQ C;  4JPB W;  1XNI A;  2BUD A;  1KQ1 A;  4LDV A;  1YJW A;  3QJY A;  2V1Q A;  5ECA A;  2HQH A;  4RMO A;  1C6V X;  3I56 A;  2DIQ A;  2P0P A;  1GL5 A;  3M53 A;  3QHS A;  3CXC A;  1PHT A;  2E3H A;  4PFZ A;  4OF1 A;  3QZ9 B;  4PJO B;  1HXD A;  1PRL C;  1PKS A;  1YHQ A;  1K0X A;  2E6Z A;  2MMP A;  3VS5 A;  1NJI R;  2MI6 A;  2A08 A;  4HCZ A;  5KYX B;  3X24 B;  2RHZ A;  1ZSG A;  2X3X D;  1BU1 A;  4CC4 B;  1TUD A;  1VQO A;  1Q95 G;  3JV3 A;  2CSQ A;  2JZ2 A;  4M7A A;  4IKF A;  2AKL A;  1SF9 A;  5J3B A;  1OZ3 A;  1KSW A;  3TSZ A;  3RKY A;  4KGZ B;  1QCN A;  3G71 Q;  1QP2 A;  3CCL Q;  3R6N A;  3PVQ A;  3ZEH A;  2FB7 A;  3CCR T;  2QG9 B;  3EG9 A;  3OYA A;  4FT2 A;  2KAF A;  5KCO A;  1B3Q A;  1M4Z A;  3TEE A;  4A4E A;  3ASK A;  3KFV A;  3OBW A;  2E4H A;  3M4Y A;  2ABL A;  1YWP A;  3I55 A;  3EFR A;  3BY7 A;  4A4F A;  3OYN A;  5FW9 A;  3V8J A;  1BKB A;  5CAI A;  1WDX A;  3BW1 A;  4DOV A;  2Y4Y A;  1RAD B;  4N4G A;  4ZNX A;  2ED0 A;  5GAO p;  1V76 A;  4BDZ A;  4ATO A;  2O01 E;  1SG5 A;  4EMK C;  2VVK A;  4FYY B;  1HK9 A;  3FJP A;  5DY9 A;  3QYG B;  2NYS A;  3CCE T;  1Q81 U;  1N9R A;  4FW1 A;  2DF6 A;  4C8Q E;  4O6J A;  2WSF E;  5GAN 2;  2YUQ A;  4JJN K;  4C8Q D;  5IHN A;  1XQH A;  2E1H A;  3CC2 Q;  6AT1 B;  1KD1 R;  4J6X A;  2LX9 A;  4ZN1 A;  3KUF A;  5GAN f;  2LP5 A;  2VGN A;  3URG A;  2NUT B;  1GFC A;  3CCJ A;  4KH1 B;  1UTI A;  1M30 A;  1OI1 A;  4BAC A;  3JCM P;  1Q86 R;  4C5H A;  4AG2 C;  1TSF A;  3H9N A;  1M3A A;  3SWN C;  3E9G A;  4KUL A;  1PNJ A;  3CCS Q;  1X2K A;  4PKC C;  1K9M R;  1Z9Z A;  1IHV A;  2AZV A;  3J80 E;  2MWO A;  2VV5 A;  2QA4 A;  3CC2 T;  3A1P A;  1M3C A;  4ZGE B;  2LCL A;  3MPU B;  2V8I A;  4J83 A;  3PT9 A;  2L2P A;  1PD0 A;  1AEY A;  1VQ9 T;  1LCK A;  2EQM A;  3VUB A;  1U8R A;  1SHF A;  1YJN Q;  3CCQ T;  1V1C A;  2GTJ A;  4JDS A;  2CZ6 B;  1RAE B;  1BI1 A;  1D3B B;  3LGF A;  3L2Z A;  3NTI A;  1PG5 B;  2DER A;  1ARK A;  5GAM e;  1GRI A;  1RI9 A;  3S6W A;  5A2Q E;  2D8H A;  2LX7 A;  4ZTJ A;  1UFF A;  4F04 B;  1VQ6 Q;  1M90 R;  2NUT A;  4JS5 A;  4FSS A;  4P5N A;  4Z02 A;  1AWW A;  4Y91 A;  1MMA A;  1I4K 1;  2PVD B;  4NL2 A;  2LQ8 A;  1G3Y A;  5GMK h;  1M1K R;  2DZC A;  1VQN Q;  2QEX Q;  2VKN A;  4IUR A;  1SRL A;  2CS7 A;  1YIJ Q;  1BYM A;  1UGR B;  3H6Z A;  4D8K A;  2YDL A;  4O5V A;  4XAX B;  3SDZ A;  2GQI A;  4KRT A;  3FJ5 A;  1JB0 E;  2DL3 A;  4N0A A;  3NTH A;  2MYS A;  3LYI A;  1NYF A;  4C5E A;  1YJW T;  3CD6 Q;  2YHT A;  2DLP A;  1D3B A;  2DTO A;  3I56 T;  1K1Z A;  4C92 D;  1U1S A;  3G6E A;  4FL6 A;  1JRI A;  1T0H A;  2A36 A;  3VS3 A;  1WIE A;  1MGQ A;  1VYU A;  3FEO A;  3CME T;  3S3N A;  2VAS A;  2RI5 A;  4IIO A;  2DL8 A;  3ULR B;  3X20 B;  2OAU A;  1OV3 A;  3O5Z A;  4J9F A;  4M78 C;  1YHQ T;  4PFO A;  4XQ3 A;  3TRE A;  1ZX6 A;  2ZPF B;  3VS0 A;  1KC8 R;  3H0I A;  4PK4 A;  4LDW A;  1VQO T;  4TVR A;  2LCS A;  3EG3 A;  2QDY B;  1TUC A;  2L5Q A;  2PVG B;  3OYY A;  4DA4 A;  2BE7 D;  2YSQ A;  2E12 A;  1QVG A;  3CBM A;  1EIF A;  2XG8 D;  1EFN A;  1QW1 A;  5GAN 8;  2HQX A;  1FXX A;  1PCX A;  3G1J A;  1VQ7 Q;  2BKD N;  3ER0 A;  2DE0 X;  2JMC A;  4EMK B;  1WHK A;  2M16 A;  2EBP A;  2E5K A;  3PIO A;  5L8R E;  3A98 A;  1YN8 A;  3NMZ C;  2OTJ Q;  3EGU A;  2KEA A;  2YXY A;  1ZUK A;  3QZ5 B;  4JLI A;  2KE9 A;  3QBY A;  3C12 A;  4LDU A;  4DEY A;  3I55 T;  5CR2 A;  1RAG B;  3L2V A;  3OYM A;  4GY5 A;  3M56 A;  3MEA A;  5AYF A;  1RUW A;  1WPY A;  1Y0M A;  3H41 A;  2ZPE B;  4E47 A;  1QWF A;  3VU3 C;  4R55 A;  4HA8 A;  4DOW A;  3CCV A;  3OBY A;  4A4H A;  1XTD A;  4C0F A;  3RUX A;  4OMM A;  1QMC A;  4M78 F;  2COZ A;  3RIR A;  2RQT A;  5KYU B;  3LW5 E;  2QQB A;  2RK1 A;  1RI0 A;  4JRP A;  3M0U A;  3OYH A;  2L0A A;  1NPR A;  2W10 A;  3PVL A;  2DEU A;  2QQ9 A;  4LDX A;  1LVK A;  2PTK A;  1GCP A;  8AT1 B;  1Q81 R;  3CCJ T;  2VXF A;  1NBE B;  1T0J A;  2XDB A;  3QDR B;  3M0P A;  3RMS A;  2CKK A;  3HTR A;  2CP5 A;  2XID A;  2DYI A;  3OW2 P;  5GAN j;  4M7A E;  2RPN A;  2A28 A;  2DL5 A;  2QA4 T;  3I5R A;  4M7A D;  2CSI A;  1YP5 A;  4MML A;  4XU1 A;  4A63 B;  1VQK Q;  1JXM A;  3V7S A;  2CH4 A;  5FU6 B;  3LWH A;  3EFO B;  3SWN A;  4PJN A;  1IZ6 A;  5KYU A;  3RDV A;  4D8D A;  1VOM A;  2X9H A;  3OW2 A;  2PUO B;  2F1L A;  2LJ3 A;  1QVG S;  3G4S Q;  1K4U S;  2DL4 A;  5GAN 6;  1AVZ C;  3MCA B;  2FPD A;  4M77 C;  2FRY A;  3A8O B;  3EG2 A;  4RTU A;  2C0O A;  4FU6 A;  3OS0 A;  3UF4 A;  2JT4 A;  1UEC A;  3HPW A;  4FCY A;  3G71 A;  5CKH A;  3CCL A;  5GAN h;  1YFN A;  5A0G A;  2ZGW A;  1KQS A;  1JJ2 P;  2FO0 A;  5D6W A;  2PUK B;  1Q82 U;  4KUD K;  4EPC A;  1PSE A;  4HVV A;  4M77 E;  3JCM b;  5LL6 S;  1QVP A;  1M8M A;  4AMC A;  4PFP A;  1OEB A;  4M77 D;  2XK0 A;  4M78 B;  4J9D A;  4QT7 A;  5KYW B;  2GF7 A;  3DKM A;  2QDL A;  1U1T A;  2O88 A;  2K6D A;  2P4T A;  3JB9 D;  2VXE A;  3QO3 A;  4Z89 A;  5GAN d;  2FZC B;  4HKE A;  4LD9 K;  3MO8 A;  1QP3 A;  2CZ1 B;  3G6E T;  1Z9Q A;  1Q82 C;  1RLP C;  2SEM A;  1Q7Y C;  4DEX A;  3H0F A;  3QWY A;  2HL5 C;  2OX7 A;  4M75 G;  4HT8 A;  3G7Z A;  3CC2 A;  4RTT A;  2DYB A;  4RCB A;  1FYN A;  2MK5 A;  3OMC A;  4FM4 B;  2VGM A;  2DBM A;  5GAN g;  4BE0 A;  2DM1 A;  3TQ7 P;  5GAO l;  1R0B G;  2IPO B;  2ROT A;  1I1J A;  3CEY A;  1IGU A;  1VIE A;  4M7D G;  4M78 A;  4AFU C;  3CCS A;  1VIF A;  2LCC A;  5KYW A;  4BUG A;  2B8A A;  2VB6 A;  4F16 A;  2CT4 A;  4A4K A;  4RUG A;  2DVE A;  4D6W A;  3AHU A;  4ZGD B;  4IUP A;  4JJD A;  5HY6 A;  4CI0 C;  3EGX B;  4OB0 B;  3OSV A;  2RQU A;  1M9S A;  4B9W A;  1UG1 A;  2HQE A;  3OW2 S;  3L2W A;  1YJN A;  4BDY A;  3Q1J A;  2J6O A;  4XTZ A;  2CP6 A;  3OMG A;  4J9I A;  2P4R A;  1I81 A;  2X4X A;  1SEM A;  3A5Z B;  2F5T X;  3M57 A;  4M7A B;  1VQ6 A;  1QKW A;  2K3B A;  3CCV T;  3QUI A;  2RJE A;  1BIA A;  5GAO r;  3FB9 A;  1KQS S;  4ORZ A;  2KRO A;  3EG9 B;  2KYB A;  5AT1 B;  1OPK A;  2XMF A;  3H8Z A;  1VQN A;  1AHJ B;  4J7F A;  2GGR A;  2QEX A;  4OP0 A;  2EYQ A;  4PLL A;  4DBF A;  3MEU A;  3CME A;  1LOJ A;  1YIJ A;  4BI8 B;  4BE1 A;  2EKH A;  4FYX B;  5D7U A;  3OS5 A;  3QXE B;  3HRS A;  3EGX A;  2KYM A;  2DTH A;  3OYB A;  2CRE A;  3RNJ A;  1FMK A;  3OYF A;  1UDL A;  3SHW A;  2LMJ A;  2E70 A;  3CD6 A;  3BE3 A;  4EIK A;  2BTT A;  2QTX A;  3JRZ A;  3PMI A;  2OTL Q;  2EJ9 A;  3A8M B;  3QPH A;  4A4G A;  2KT1 A;  4F7U E;  1SSH A;  2YT6 A;  1JXO A;  9ATC B;  3P8B B;  4QQD A;  3C4S A;  2QGF B;  2EJG A;  4C8Q G;  2DD4 A;  1VQM Q;  4M77 B;  1WHG A;  2HMA A;  2WSC E;  2EQI A;  2SRC A;  1ZSZ C;  2R57 A;  1VUB A;  1MND A;  4HXJ A;  1P92 A;  4RTV A;  1N8R C;  2K79 A;  1QQJ A;  2LTO A;  3CPW P;  1UJY A;  2D8J A;  2ZPG B;  4ELZ C;  1X6G A;  2GCX A;  1RL2 A;  2X4J A;  1G3S A;  3C95 A;  5DM7 R;  2M9U A;  4KGX B;  3AT1 B;  2DKG A;  2DNU A;  2RD1 A;  3QKJ A;  1LNX A;  4M7D F;  1WGS A;  5EC7 A;  5A0L A;  1CSK A;  1E6H A;  2JUF A;  1SPK A;  2XHC A;  1H3Z A;  3G71 T;  2Y4X A;  3OQ5 A;  1MV3 A;  5D6X A;  3CCL T;  5IN1 A;  1LPL A;  1X01 A;  3SFM A;  4F7U F;  1UGQ B;  3UA6 A;  1K0S A;  1H8K A;  1I5O B;  3EG0 A;  4HVW A;  2OTJ A;  1NEG A;  3EH2 A;  4M77 A;  4XU3 A;  5M9O A;  3C0C A;  3CCU Q;  4GLK A;  1T3S A;  2DRK A;  3GP8 A;  3HFO A;  4QKU A;  1WHH A;  1VQL Q;  2KR3 A;  2K3Y A;  2M0Y A;  1QCO A;  1WJS A;  2COW A;  2FPF A;  1AT1 B;  3HRU A;  3FDR A;  3M0T A;  2WSE E;  4BY6 C;  2JNG A;  1M1G A;  3VYG A;  1UHF A;  2HEQ A;  2OJ2 A;  2RM4 A;  2B86 A;  4RKU E;  4VUB A;  2NLU A;  3PNW C;  2HL3 A;  1S72 Q;  5GMK j;  3LX7 A;  1BI2 A;  1RAI B;  3LGL A;  3CQT A;  3EAE A;  1VQL T;  5I2S A;  1M27 C;  2YLB A;  1TOV A;  2DD5 A;  3S3M A;  4JJB A;  1LJO A;  2QI2 A;  2FHD A;  5A0D A;  1I5L A;  2RJC A;  2L89 A;  1G3W A;  4IUT A;  4C92 G;  1KQ2 A;  2BZY A;  3OY9 A;  3CCS T;  3TVT A;  2QQR A;  2HSE B;  2BIV A;  4AFZ C;  2D6F A;  5LJ3 e;  1BIB A;  2PQW A;  4K11 A;  1VQK A;  4CRI A;  2XI9 A;  1QLY A;  3VV0 A;  4FYV B;  4OB3 B;  2KRS A;  3I5S A;  1G3T A;  2H8H A;  2OAW A;  2P84 A;  4X34 A;  1YJN T;  5CQY A;  1K73 U;  2RQW A;  2E3I A;  3C94 A;  2QAS A;  3CCM Q;  3RR6 A;  4X9D A;  1WXU A;  3JB9 H;  1MMG A;  2L3Q A;  4OMN A;  5FRM A;  1G2B A;  3G4S A;  1R77 A;  2X35 A;  4F7U B;  2ZPB B;  1VA7 A;  2Z0W A;  1VQ6 T;  2QK0 A;  3GIB A;  1WI7 A;  5GAM h;  2DXB A;  1HSQ A;  1RAB B;  2O4X A;  2KY9 A;  1V29 B;  2YLC A;  1WLP B;  1TUG B;  5LJ3 h;  3WVE B;  3DB4 A;  2RH2 A;  4R56 A;  2M0O A;  4HT9 A;  5CQX A;  1VQN T;  4PL6 A;  3M0S A;  4JUV A;  1K73 C;  5HK3 A;  2QEX T;  1YJ9 Q;  2M51 A;  3V7C A;  5J26 A;  1YIJ T;  1RAF B;  4QQ6 A;  2A37 A;  1ABO A;  3P8H A;  4C5I A;  1YIT Q;  4M7D A;  4PLI A;  2NUP A;  3CMA Q;  2Y90 A;  2J6F A;  1ZSZ B;  2PVO B;  1MV0 B;  2MPX C;  5J39 A;  1EZZ B;  1IB8 A;  3CD6 T;  1MNE A;  4IUU A;  2FPE A;  4IUV A;  2LC4 A;  3U23 A;  2FZK B;  4MMK A;  4F7U A;  3NTK A;  2JJ9 A;  5DLQ E;  4M78 E;  4GBQ A;  1JBM A;  1H92 A;  1IRX A;  1TS9 A;  4KGV B;  4MDX A;  1MHN A;  4M78 D;  2DXT A;  4HCB A;  1OX9 A;  3JCM e;  3H0H A;  3EHQ A;  1T3L A;  3SEM A;  4XTX A;  2BZ8 A;  3SB2 A;  4XU2 A;  1K8A C;  7AT1 B;  2R58 A;  5HCK A;  5GAM g;  2J7I A;  4DBQ A;  2K4Y A;  2MIO A;  1ZHI A;  3I35 A;  4X1V A;  1KG1 A;  1F1B B;  2QGG A;  5IXF A;  2C0T A;  1ZA2 B;  3M9Q A;  1W2B P;  4E7Z A;  1YNZ A;  3WVD B;  2GBQ A;  1KJW A;  4HVU A;  2RNA A;  1G8X A;  2DRM A;  1SHG A;  1N5Z A;  2HCK A;  4E7S A;  1ZSZ A;  1BI3 A;  4OMO A;  2RHU A;  4ESR A;  1D1C A;  5GJW B;  2RI3 A;  4MZP A;  2CP3 A;  4GLM A;  3JSC A;  2W0Z A;  1QWE A;  2V8K A;  3X28 B;  1VQ7 T;  2YUN A;  1WXB A;  1W2B A;  3GLX A;  2LRQ A;  3LLR A;  4FSX A;  2RHI A;  4BY6 B;  1C1A A;  2ZCF B;  3SWN B;  2OTJ T;  4KUI A;  4QVZ A;  1VQ8 Q;  1WHL A;  3VS4 A;  1H64 1;  5IT9 E;  2L3S A;  4EMG A;  4JJC A;  4LUE A;  1VQP Q;  2CDT A;  4PJO G;  2EYY A;  2LVM A;  3CBP A;  1UJ0 A;  4C0G A;  3M5A A;  3HL8 A;  2EFI A;  1NJI U;  2DJQ A;  2A0F B;  2EQK A;  3V8K A;  2YUP A;  2RQV A;  3L1A A;  3CC4 Q;  5EG2 A;  2XIC A;  4JRQ A;  4QQG A;  2CP0 A;  1B07 A;  3A8H B;  1WZO A;  3TU4 K;  1NG2 A;  1VQP T;  2ZPI B;  1KHC A;  1OZ2 A;  2KVQ G;  3QWX X;  2EQJ A;  5FWC A;  2JM9 A;  3I9Q A;  5C0M A;  4AFQ C;  4J7I A;  3JB9 I;  1NJI C;  4MZT A;  2MOX A;  3PMT A;  2OI3 A;  2O9V A;  3INZ A;  3CPF A;  3JB9 G;  1JEG A;  4AG1 C;  1N27 A;  2CH4 W;  3MEW A;  2HNI A;  2LJ1 A;  1IGQ A;  4J9H A;  2QXF A;  1OPL A;  2RK2 A;  4NL3 A;  2OTL A;  3QDF A;  2DVJ A;  2VUB A;  4OB2 B;  5DLO A;  1ZUU A;  4AFS C;  2KQW A;  1K76 A;  2J06 A;  2AKK A;  4WF2 A;  2RHY A;  4UC4 A;  1QVF P;  1BI0 A;  2O31 A;  1D1B A;  1VYV A;  4F14 A;  1VQM A;  1VQK T;  1M3B A;  4XTV A;  4NS5 A;  2F2V A;  5CIU A;  5CO7 A;  2GFA A;  2VWF A;  1VQ4 Q;  1PM3 A;  1UGV A;  2HDA A;  2RMO A;  2XDD A;  1HD3 A;  1QVF A;  2JTE A;  3IQL A;  4R0K A;  3G4S T;  1Q7Y U;  1UB4 A;  2JMA A;  2K5L A;  3VYH B;  1X6B A;  2RF0 A;  5LJ5 e;  1KD1 U;  3CC7 Q;  1O9S A;  3QJ6 A;  1WJQ A;  1XOV A;  2RA2 A;  1CKB A;  1JJ2 A;  3QG1 A;  1W2B S;  2KRN A;  1Q86 U;  4II1 A;  3UPU A;  2KMT A;  2LT4 A;  1BCM A;  1NYG A;  4V2S A;  4JRI A;  1YI2 Q;  2P0K A;  2EYW A;  4OML A;  4Q5W A;  3BFM A;  2FEI A;  3F70 A;  2DIL A;  3A8G B;  2HBP A;  1PD1 A;  4QVC A;  5GAO q;  5GMK m;  3RER A;  1KD1 C;  5GAM f;  3MEV A;  3CCU A;  3GF5 A;  3VS2 A;  4PJO F;  1VQL A;  4RG8 A;  5LJ5 h;  2IIM A;  4A53 A;  5LJ3 f;  3E2U A;  2MWP A;  4ANJ A;  4N4H A;  2KRM A;  1JU5 C;  3JB9 J;  1Q86 C;  2V26 A;  3ME9 A;  3R6O A;  1D1A A;  1W6X A;  1PKT A;  1PC0 A;  2CYZ B;  3J81 E;  1YWO A;  1VQ5 Q;  1NM7 A;  1JO8 A;  5CKE A;  2F5K A;  1S72 A;  3REA B;  3OB9 A;  1N6A A;  1G5V A;  2G6F X;  1RAA B;  5I2M A;  3M0Q A;  1NZ9 A;  4PNO A;  1ZBX A;  5CKF A;  5CKB A;  3JCM J;  4M75 C;  1AZG B;  1UGS B;  1YBY A;  2O9S A;  4LDY A;  3KXT A;  5IAY A;  2DL7 A;  3FRN A;  3V7R A;  1VQ5 T;  2X3W D;  4BB7 A;  4JLG A;  1M90 C;  2HKQ B;  2YRV A;  4JRK A;  1ZQ1 A;  3SD4 A;  4IIM A;  3NHN A;  4OMF B;  2LT1 A;  2C06 A;  4HCK A;  2ZZD A;  4M7D C;  4Z88 A;  2EAY A;  4ZN3 A;  3OYL A;  3OS1 A;  2EYZ A;  2PNI A;  3CXC P;  1M1K C;  3VS7 A;  1PWT A;  1U06 A;  3ZFJ A;  1R8O B;  4DBH A;  2K2V A;  3CCM A;  1QVF S;  3N5B B;  4XK8 E;  1Y71 A;  2F2X A;  2HKN A;  3QSU A;  5C6S A;  1KC8 U;  3THK A;  4M7D E;  3EHR A;  2H3J A;  1N8R U;  3UT1 A;  1UGP B;  3GOX A;  3JCM f;  4M7D D;  1JJ2 S;  4X9C A;  5KYN A;  3GNG A;  4OMQ A;  4Y92 A;  2DJZ A;  1IRE B;  1RAC B;  5KYY B;  3HSB A;  1W70 A;  2RJD A;  2DA9 A;  5I11 A;  3M54 A;  4MDW A;  4ZTF A;  4MZM A;  1QKX A;  3CCR Q;  1YJ9 A;  1FMV A;  3EG1 A;  5CVI A;  4IUQ A;  3UAT A;  3HKS A;  2V8J A;  4M75 F;  1YIT A;  1KC8 C;  1ABQ A;  3X26 B;  3CMA A;  1TU0 B;  1I07 A;  3VS6 A;  4E7J A;  3LWI A;  2D0N A;  2CZ7 B;  3NPF A;  1KK7 A;  1M1F A;  2X51 A;  5I22 A;  3VKI A;  2EGC A;  2OTL T;  4LXC A;  2MAM A;  3HFN A;  2IG0 A;  3NGP A;  4OVA A;  2LQN A;  4JZ4 A;  4RTZ A;  1SKU B;  2LNH B;  2D1X A;  2YRC A;  1HYO A;  3L42 A;  3CCE Q;  1VQM T;  4J9C A;  4C0D C;  5KYY A;  3CPW A;  1VQ7 A;  1B34 B;  2V1R A;  4C0Z A;  2ED1 A;  4PJO A;  4FT4 A;  5HKC A;  4QW2 A;  4XTU A;  4C8Q C;  2YUO A;  2KNB B;  1NE8 A;  3BDL A;  2DEQ A;  2EW3 A;  5KYX A;  1B7T A;  3WXM B;  2RN8 A;  4QVD A;  5GAN 3;  2EPD A;  4A54 A;  2JVV A;  2ESW A;  2LQW A;  1WHM A;  1AOJ A;  2GNC A;  1WJR A;  1OX8 A;  5FU7 C;  4E6R A;  1Q82 R;  2DX1 A;  4PJM A;  2KXC A;  5GAO m;  1XJW B;  1SRM A;  1K9A A;  1NLP C;  1Q7Y R;  4B9X A;  1M5Q 1;  1J3T A;  1AWX A;  4J9G A;  1WYX A;  2DXC A;  4BD3 A;  2AIR B;  3A8L B;  1VQ8 A;  1ZA1 B;  1VQ9 Q;  2I2L A;  4E7I A;  2KSS A;  2H3E B;  1OUL A;  1VQP A;  2ZPH B;  3CCU T;  3CCQ Q;  1B34 A;  2EKO A;  4YTL A;  1Y96 B;  3PIP A;  2CP7 A;  1BB9 A;  3EFS A;  1Q81 C;  5GAN 4;  3CXC S;  2A3L A;  2O4X B;  5D6Y A;  2E41 A;  3JCM W;  3L2U A;  2QTV A;  3CC4 A;  5GAM j;  2X4Y A;  4M75 B;  1WNL A;  2KT8 A;  3E1S A;  1OU8 A;  5GMK e;  5LJ3 j;  2EVR A;  1U5S A;  3J7A F;  4J9E A;  3RMQ A;  3QII A;  2J05 A;  3KBG A;  1S72 T;  4C8Q F;  2ENM A;  5LJ5 f;  1TG0 A;  3FC3 A;  4HCC A;  4OGE A;  1X69 A;  2VYT A;  2FZG B;  3QYH B;  1KIK A;  4M7D B;  3OSS C;  2NUP B;  1FMW A;  2CUB A;  1GBR A;  1ZUY A;  5KCH A;  1OOT A;  2COY A;  1G83 A;  2K5F A;  1YJW Q;  2C0I A;  1Y96 A;  3MP8 A;  3P8D A;  2K57 A;  5FU6 C;  5GAN 5;  3V8L A;  4M78 G;  3I56 Q;  1S1N A;  4LNP A;  2RHX A;  3UA7 A;  2DPP B;  1X27 A;  1AD5 A;  4F17 A;  3OYK A;  2HSP A;  4C92 C;  3JCM X;  3CPW S;  5KE2 A;  1DJ7 B;  1ZLM A;  4M75 A;  3CME Q;  3DLL A;  2KK4 A;  4NOY A;  5IH2 A;  5FLX E;  4E7L A;  4XTW A;  3OYD A;  1YHQ Q;  4XTY A;  1X43 A;  5CK9 A;  1VQ4 A;  2AT1 B;  3MP1 A;  2KBT A;  3CCM T;  4CC2 A;  1FWZ A;  2K3X A;  1IO6 A;  5IHK A;  1E6G A;  4FYW B;  4FIB A;  2XD0 A;  4C92 E;  3CC7 A;  2EJF A;  1VQO Q;  3EGD B;  4JZ3 A;  4B6M A;  1K8A U;  2LNV A;  4C5G A;  3D7S B;  2HD0 A;  5FRO A;  2LQK A;  2RO0 A;  4RTX A;  3M0R A;  5GAM d;  4KBM B;  3PE0 A;  2BZX A;  5CKD A;  2E64 A;  4KH0 B;  2J6K A;  3ZBD A;  2BE9 B;  2EWN A;  5LJ3 d;  1KFZ A;  1QVG P;  3VS1 A;  2FL7 A;  5GAN 7;  2LZ6 B;  1BCO A;  3CBO A;  2CGH A;  1YI2 A;  2JN0 A;  1YJ9 T;  1KHI A;  1A0N B;  1N8R R;  3JCM V;  1C0M A;  1GBQ A;  1JQQ A; 
#chains in the Genus database with same CATH homology
 1PSF A;  1VQM A;  3CCV T;  5HK0 A;  3CCJ A;  2L8D A;  3QUI A;  5FRN A;  5GMK i;  1YIT T;  1OI1 A;  2RJE A;  4C0D B;  1BIA A;  1VQK T;  5GAO r;  3FB9 A;  4BAC A;  1KQS S;  3JCM P;  4XTV A;  4C5H A;  3CMA T;  4NS5 A;  3SWN C;  1Y7X A;  3E9G A;  4KUL A;  5CIU A;  5CO7 A;  2GFA A;  5LJ3 g;  3H8Z A;  4PKC C;  1VQN A;  4C8Q B;  1AHJ B;  4J7F A;  2QEX A;  4E7H A;  2F69 A;  4OP0 A;  2GQV A;  2EYQ A;  4PLL A;  3J80 E;  2XDD A;  2MWO A;  3MEU A;  1QVF A;  4BI3 A;  1LOJ A;  3CME A;  1YIJ A;  3G4S T;  2VV5 A;  2QA4 A;  1UB4 A;  2K5L A;  3JCM c;  3VYH B;  4BI8 B;  5GMK l;  5LJ5 e;  4BE1 A;  1KD1 U;  1W4S A;  4C92 F;  3CC2 T;  4ZGE B;  1O9S A;  2LCL A;  3OS5 A;  3QXE B;  3QJ6 A;  1WJQ A;  2V8I A;  3HRS A;  4J83 A;  3PT9 A;  3OYJ A;  1XOV A;  2PU9 B;  1VQ5 A;  1YCY A;  2EQU A;  2DZ9 A;  4L5G A;  2DTH A;  1VQ9 T;  3OYB A;  2RA2 A;  4M7A G;  2EQM A;  3VUB A;  3OYF A;  1JJ2 A;  5FU7 B;  1U8R A;  2E10 A;  4J6W A;  2E70 A;  3QG1 A;  3CCQ T;  3CD6 A;  1W2B S;  2FVU A;  4XU0 A;  2QTX A;  3JRZ A;  3JCM h;  1Q86 U;  4JDS A;  2CZ6 B;  4II1 A;  3OYG A;  1BI1 A;  3PMI A;  3UPU A;  1D3B B;  2EJ9 A;  2KMT A;  2LT4 A;  3A8M B;  3LGF A;  3QPH A;  3L2Z A;  3NTI A;  4A4G A;  4L59 A;  4F7U E;  4V2S A;  4JRI A;  2P0K A;  3P8B B;  5GAM e;  4Q5W A;  3BFM A;  3F70 A;  4QQD A;  3S6W A;  3A8G B;  2HBP A;  2IVW A;  2EJG A;  3C4S A;  5A2Q E;  4ZTJ A;  4C8Q G;  2DD4 A;  4JS5 A;  2EIF A;  3JAM E;  4P5N A;  4M77 B;  4ELY C;  4L6V 5;  4Z02 A;  4QVC A;  5GAO q;  2WSC E;  5KE3 A;  5GMK m;  3RER A;  1KD1 C;  5GAM f;  3MEV A;  4Y91 A;  3CCU A;  3GF5 A;  1I4K 1;  2PVD B;  4NL2 A;  2LQ8 A;  2R57 A;  1VUB A;  4PJO F;  1G3Y A;  4RG8 A;  1VQL A;  1P92 A;  5LJ5 h;  1N8R C;  2DK3 A;  4A53 A;  5LJ3 f;  3PFS A;  2MWP A;  5GMK h;  2DXU A;  2L3R A;  2DZC A;  4C8Q A;  4N4H A;  2LTO A;  3JB9 J;  2ZPG B;  4IUR A;  4ELZ C;  2CS7 A;  2E65 A;  2GCX A;  1RL2 A;  2X4J A;  3ME9 A;  3JCM d;  3R6O A;  1Q86 C;  1G3S A;  3C95 A;  5DM7 R;  1BYM A;  3HHT B;  1UGR B;  3UDC A;  3H6Z A;  2M9U A;  4ME7 A;  2M1H A;  2RJF A;  2DKG A;  2RD1 A;  3QKJ A;  4O5V A;  2CYZ B;  4XAX B;  3SDZ A;  3J81 E;  2DAQ A;  2WAC A;  1LNX A;  2D9T A;  3BDU A;  1WGS A;  2GFU A;  4M7D F;  4M7A C;  4J8O A;  4EMK A;  1JB0 E;  1I8F A;  1VQ8 T;  4N0A A;  5A0L A;  2JUF A;  3JCM Q;  3NTH A;  2XHC A;  5CKE A;  2F5K A;  3LYI A;  4C5E A;  1S72 A;  1YJW T;  1H3Z A;  4M77 G;  3G71 T;  3OB9 A;  2Y4X A;  3OQ5 A;  4BI4 A;  5D6X A;  3CCL T;  1M8V A;  1N6A A;  2YHT A;  1G5V A;  5IN1 A;  1D3B A;  5KH6 A;  1X01 A;  2DTO A;  3I56 T;  3MP6 A;  3RES A;  4EDU A;  5I2M A;  4J5Y A;  3SFM A;  4F7U F;  4C92 D;  2DO3 A;  1U1S A;  2JOY A;  1UGQ B;  2QQS A;  5I21 A;  3G6E A;  3M59 A;  1NZ9 A;  4PNO A;  4FL6 A;  3M58 A;  3JCM g;  1ZBX A;  5CKF A;  1JRI A;  3M55 A;  5CKB A;  2OTJ A;  3JCM J;  3VJP A;  1FX7 A;  3PGG A;  2DIG A;  1MGQ A;  4M75 C;  3T9N A;  1UGS B;  4EMH A;  3DB3 A;  3FEO A;  4M77 A;  3CME T;  2RI5 A;  4XU3 A;  2P0Q A;  3CC4 T;  5GAN e;  3S3N A;  5M9O A;  1YBY A;  4LDY A;  3X20 B;  3KXT A;  2D0Q B;  2OAU A;  4M78 C;  1YHQ T;  3MET A;  5IAY A;  3FRN A;  4XQ3 A;  4GLK A;  3V7R A;  3HFO A;  3TRE A;  3GP8 A;  4BB7 A;  3E19 A;  1VQ5 T;  2K3Y A;  2ZPF B;  4JLG A;  3GNF B;  1WJS A;  3CCR A;  1M90 C;  3HRU A;  2CZ0 B;  3FDR A;  5CCA A;  3TCJ A;  2YRV A;  2G3R A;  2XKO C;  4LDW A;  4JRK A;  1ZQ1 A;  3SD4 A;  4OMF B;  2LT1 A;  2C06 A;  4N4I A;  1VQO T;  3E9F A;  5GAO n;  3GPL A;  4TVR A;  1GXI E;  2ZZD A;  2QDY B;  2PVG B;  2L5Q A;  3OYY A;  2EAY A;  2WSE E;  4C92 B;  4DA4 A;  3HP9 A;  4BY6 C;  3OYI A;  4ZN3 A;  4PJO E;  2E12 A;  2JNG A;  3OYL A;  3OS1 A;  1QVG A;  3NFC A;  1M1K C;  1M1G A;  3CBM A;  1EIF A;  4PJO D;  2XG8 D;  3VYG A;  3ZFJ A;  1R8O B;  2RM4 A;  4OB1 B;  1QW1 A;  5LJ5 j;  4RKU E;  4VUB A;  2K2V A;  2AHJ B;  3OA6 A;  2NLU A;  3PNW C;  3N5B B;  5GAN 8;  3CCM A;  1QVF S;  2HQX A;  4XK8 E;  1FXX A;  1Y71 A;  5GMK j;  3LX7 A;  2A7Y A;  4OGC A;  1BI2 A;  3LGL A;  1X75 C;  1NPP A;  1N9S A;  2JTF A;  2KDS A;  5C6S A;  3EAE A;  3QSU A;  1VQL T;  2BKD N;  2RB6 A;  3ER0 A;  1KC8 U;  5I2S A;  2YLB A;  4M7D E;  2H3J A;  1N8R U;  3UT1 A;  1UGP B;  2DD5 A;  4EMK B;  3GOX A;  3S3M A;  3JCM f;  2M16 A;  1LJO A;  3PIO A;  1JJ2 S;  4M7D D;  3CCE A;  4KT0 E;  4X9C A;  5L8R E;  2R5M A;  1TH7 A;  2QI2 A;  3GNG A;  2FHD A;  5A0D A;  4M7A F;  2DJZ A;  1I5L A;  1IRE B;  3RKX A;  2RJC A;  2L89 A;  3HSB A;  3QZ5 B;  1G3W A;  4IUT A;  3LH0 A;  4JLI A;  4C92 G;  2RJD A;  3C12 A;  3DLM A;  3QBY A;  4LDU A;  5CR2 A;  3I55 T;  1KQ2 A;  3L2V A;  3OYM A;  3OY9 A;  4GY5 A;  3M54 A;  3L2Q A;  3CCS T;  3M56 A;  3MEA A;  4MDW A;  2QQR A;  2E5Q A;  1VQ4 T;  1K9M U;  5AYF A;  4ZTF A;  4MZM A;  2BIV A;  2XU8 A;  1WPY A;  1YJ9 A;  2D6F A;  2E6N A;  3L2R A;  4E7K A;  3VUZ A;  2ZPE B;  4E47 A;  2XDP A;  5LJ3 e;  2MF2 A;  1BIB A;  4RG2 A;  2PQW A;  5CVI A;  3VU3 C;  4IUQ A;  4HA8 A;  4DOW A;  4R55 A;  3CCV A;  3CC7 T;  3OBY A;  3PTA A;  3HKS A;  1SSF A;  4A4H A;  2V8J A;  4C92 A;  1XTD A;  4M75 F;  1YIT A;  1KC8 C;  4C0F A;  3RUX A;  1VQK A;  4CRI A;  3X26 B;  2XI9 A;  3CMA A;  3VV0 A;  4OB3 B;  4BE2 A;  4E7J A;  4M78 F;  1G3T A;  3LWI A;  4M7D C;  2CZ7 B;  3LW5 E;  4X34 A;  1YJN T;  5CQY A;  4JS4 A;  2QQB A;  1K73 U;  1M1F A;  1UEB A;  3C94 A;  2VC8 A;  3VKI A;  2RK1 A;  1RI0 A;  1Y07 A;  4X9D A;  2OTL T;  3JB9 H;  3O8V A;  2DTI A;  2K5I A;  2MAM A;  4JRP A;  3HFN A;  2IG0 A;  2RI2 A;  2R5A A;  1O75 A;  4OVA A;  3G4S A;  5FRM A;  2X35 A;  3S3O A;  1YI2 T;  4F7U B;  2ZPB B;  3OYH A;  1K9M C;  3HRT A;  3UWN A;  1VQ6 T;  1NPR A;  3L42 A;  1M90 U;  2FYK A;  2QQ9 A;  2QQA A;  3GIB A;  4LDX A;  5GAM h;  1VQ9 A;  2DXB A;  1VQM T;  2O4X A;  3CCJ T;  4C0D C;  2VXF A;  2KY9 A;  1V29 B;  2YLC A;  3MHX A;  2XDB A;  3CCQ A;  5LJ3 h;  4M77 F;  3CPW A;  3WVE B;  3M4G A;  1B34 B;  3QDR B;  1VQ7 A;  3DB4 A;  2RH2 A;  3RMS A;  4C0Z A;  4PJO A;  3RKW A;  2CKK A;  4FT4 A;  5LJ5 d;  4R56 A;  5HKC A;  2M0O A;  4QW2 A;  4XTU A;  2XID A;  2LDM A;  4HT9 A;  4C8Q C;  1M1K U;  5CQX A;  1VQN T;  4PL6 A;  2HAX A;  5GAN j;  4JUV A;  1K73 C;  5HK3 A;  1NE8 A;  3BDL A;  2QEX T;  4M7A E;  3V7C A;  3JB9 F;  2DEQ A;  5J26 A;  1YIJ T;  3X25 B;  2QA4 T;  4M7A D;  4QQ6 A;  3WXM B;  3P8H A;  4C5I A;  4QVD A;  5GAN 3;  4MML A;  4XU1 A;  4A54 A;  3OYC A;  2JVV A;  4F7U G;  4M7D A;  3OYE A;  3V7S A;  4N0A C;  4PLI A;  2Y90 A;  5FU6 B;  1WJR A;  3LWH A;  2JTM A;  2PVO B;  5FU7 C;  3SWN A;  1Q7Y U;  4RCC A;  1IZ6 A;  5J39 A;  3CD6 T;  3FIF A;  1WQ7 A;  4IUU A;  5LJ5 g;  3OW2 A;  4Y28 E;  1X6O A;  5GAO m;  4PJO C;  2PUO B;  4IUV A;  4DQ2 A;  4M75 E;  2LC4 A;  4LD6 A;  1QVG S;  4MMK A;  4F7U A;  3NTK A;  4B9X A;  5DLQ E;  4M78 E;  4M75 D;  3FLG A;  1JBM A;  5GAN 6;  1M5Q 1;  1WQW A;  4MDX A;  2X4W A;  4ZGJ B;  2DXC A;  4BD3 A;  1MHN A;  3MCA B;  4J6Y A;  4M78 D;  1OYX A;  3A8L B;  4M77 C;  3OS2 A;  2DXT A;  3A8O B;  1VQ8 A;  4HCB A;  2I2L A;  4FU6 A;  3JCM e;  3OS0 A;  4E7I A;  2KSS A;  1XNI A;  1VQP A;  2BUD A;  1KQ1 A;  3HPW A;  4LDV A;  2ZPH B;  3QJY A;  4XTX A;  3CCU T;  1YJW A;  1B34 A;  2EKO A;  4YTL A;  5CKH A;  3G71 A;  3SB2 A;  3CCL A;  4XU2 A;  1Y96 B;  1K8A C;  2R58 A;  5GAN h;  5A0G A;  3PIP A;  5GAM g;  2ZGW A;  4RMO A;  1KQS A;  3I56 A;  2DIQ A;  2P0P A;  2K4Y A;  1ZHI A;  3EFS A;  1Q81 C;  5GAN 4;  5D6W A;  2PUK B;  1Q82 U;  4KUD K;  3CXC S;  1KG1 A;  2A3L A;  3M53 A;  3M9Q A;  3QHS A;  4EPC A;  1PSE A;  2O4X B;  3CXC A;  5D6Y A;  2E41 A;  3JCM W;  3WVD B;  4M77 E;  3JCM b;  4OF1 A;  3L2U A;  5LL6 S;  3CC4 A;  5GAM j;  1QVP A;  2X4Y A;  4M75 B;  3QZ9 B;  4PJO B;  1HXD A;  4M77 D;  1WNL A;  1YHQ A;  3E1S A;  2XK0 A;  2E6Z A;  5GMK e;  4M78 B;  5LJ3 j;  2MMP A;  2GF7 A;  3DKM A;  1U1T A;  3J7A F;  1BI3 A;  2RHU A;  3RMQ A;  3QII A;  2MI6 A;  3KBG A;  4HCZ A;  4C8Q F;  2RI3 A;  4MZP A;  1S72 T;  5LJ5 f;  2P4T A;  3JSC A;  2RHZ A;  3X24 B;  3JB9 D;  2V8K A;  2VXE A;  3FC3 A;  4OGE A;  3X28 B;  3QO3 A;  1VQ7 T;  4HCC A;  2VYT A;  1VQO A;  3QYH B;  5GAN d;  4HKE A;  1W2B A;  4LD9 K;  3GLX A;  3MO8 A;  1QP3 A;  2LRQ A;  3LLR A;  2CZ1 B;  4M7D B;  3G6E T;  3OSS C;  2RHI A;  4FSX A;  4BY6 B;  2ZCF B;  1Q82 C;  3SWN B;  2OTJ T;  4KUI A;  4QVZ A;  2JZ2 A;  5KCH A;  4M7A A;  4IKF A;  5J3B A;  1H64 1;  5IT9 E;  4EMG A;  1OZ3 A;  1Q7Y C;  2K5F A;  3RKY A;  4M75 G;  4HT8 A;  3G7Z A;  1Y96 A;  3MP8 A;  3P8D A;  1QP2 A;  4PJO G;  3CC2 A;  2LVM A;  2K57 A;  3CBP A;  5FU6 C;  5GAN 5;  4RCB A;  3V8L A;  2FB7 A;  3ZEH A;  4M78 G;  3CCR T;  4C0G A;  3M5A A;  3HL8 A;  2EFI A;  3OMC A;  3OYA A;  2RHX A;  4FT2 A;  4FM4 B;  1NJI U;  2VGM A;  2DPP B;  2KAF A;  5KCO A;  2EQK A;  5GAN g;  1M4Z A;  3OYK A;  3V8K A;  4BE0 A;  3TEE A;  4C92 C;  3JCM X;  3CPW S;  5KE2 A;  4A4E A;  3ASK A;  5GAO l;  3L1A A;  3OBW A;  1DJ7 B;  3M4Y A;  4M75 A;  3DLL A;  2KK4 A;  4NOY A;  3CEY A;  5EG2 A;  5FLX E;  3I55 A;  4E7L A;  4XTW A;  1VIE A;  2XIC A;  3OYD A;  3EFR A;  4M78 A;  4XTY A;  3BY7 A;  4M7D G;  4A4F A;  3CCS A;  1VIF A;  2LCC A;  3OYN A;  4BUG A;  3V8J A;  5CK9 A;  1VQ4 A;  4JRQ A;  4QQG A;  1BKB A;  2B8A A;  5CAI A;  3MP1 A;  3CCM T;  3A8H B;  1FWZ A;  4A4K A;  3TU4 K;  2K3X A;  3BW1 A;  4DOV A;  2Y4Y A;  1VQP T;  2ZPI B;  2DVE A;  1KHC A;  1OZ2 A;  2KVQ G;  4N4G A;  4D6W A;  2EQJ A;  4FIB A;  5GAO p;  4BDZ A;  2XD0 A;  4C92 E;  3CC7 A;  2EJF A;  5C0M A;  4ATO A;  2O01 E;  3AHU A;  1K8A U;  4J7I A;  4EMK C;  4ZGD B;  4IUP A;  3JB9 I;  1HK9 A;  5HY6 A;  2LNV A;  3FJP A;  5DY9 A;  3QYG B;  4C5G A;  1NJI C;  4MZT A;  4CI0 C;  2HD0 A;  5FRO A;  2LQK A;  3CCE T;  1Q81 U;  3PMT A;  1N9R A;  2RO0 A;  5GAM d;  4OB0 B;  4KBM B;  3OSV A;  3INZ A;  3CPF A;  4C8Q E;  1M9S A;  2E64 A;  4B9W A;  5CKD A;  3JB9 G;  4O6J A;  2HQE A;  2WSF E;  5GAN 2;  1N27 A;  3OW2 S;  3MEW A;  2HNI A;  3L2W A;  1YJN A;  3ZBD A;  4JJN K;  2EWN A;  5LJ3 d;  4C8Q D;  4BDY A;  2QXF A;  1XQH A;  2RK2 A;  3Q1J A;  2E1H A;  4NL3 A;  2OTL A;  2VUB A;  2FL7 A;  5GAN 7;  4OB2 B;  5DLO A;  4XTZ A;  3OMG A;  3CBO A;  1I81 A;  2CGH A;  2KQW A;  1YI2 A;  2JN0 A;  4J6X A;  2LX9 A;  2X4X A;  1YJ9 T;  4ZN1 A;  4WF2 A;  2RHY A;  1KHI A;  3KUF A;  4UC4 A;  3A5Z B;  2F5T X;  1BI0 A;  3M57 A;  3JCM V;  4M7A B;  1VQ6 A;  5GAN f;  2VGN A;  3URG A;  3RIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...