2LDMA

Solution structure of human phf20 tudor2 domain bound to a p53 segment containing a dimethyllysine analog p53k370me2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
77
Chain Sequence
b'SSEFQINEQVLASWSDSRFYPAKVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFSKDQNIVGNARGSRAHSSHLSKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
molecule tags Transcription/protein binding
source organism Homo sapiens
publication title PHF20 is an effector protein of p53 double lysine methylation that stabilizes and activates p53.
pubmed doi rcsb
total genus 14
structure length 77
sequence length 78
ec nomenclature
pdb deposition date 2011-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ldmA01
3DB3A 3MP6A 2RHIA 4IUVA 3PFSA 4QQDA 2P0KA 2R58A 3P8DA 2BKDN 5IAYA 4PL6A 5M9OA 1OZ2A 4E7IA 3LYIA 4IURA 3BDLA 2X4YA 3OYNA 5J26A 2IG0A 2LRQA 3L42A 2X4WA 3OYDA 3L2UA 4BE1A 3L2QA 3S3OA 3OYEA 2GFAA 3MP1A 3FLGA 3OYLA 3L2VA 4IUPA 3CEYA 3S3NA 2L3RA 4IUTA 5CIUA 2R57A 4C5EA 3MEVA 3L2RA 3META 2L89A 1OZ3A 1WJSA 4OVAA 4Q5WA 3QIIA 3MEAA 5FROA 3DB4A 3SD4A 2MWOA 2B8AA 3LGFA 3LH0A 4A4GA 5KCOA 3QBYA 5C0MA 3OYFA 3E9GA 3OYKA 4X34A 4BDZA 4QQ6A 2RJFA 2EQKA 2LCCA 4BACA 3S6WA 3PMTA 4UC4A 3OS2A 2MWPA 2RJCA 3QKJA 4ZTJA 1MHNA 2X4XA 2YRVA 3OYHA 1G5VA 2X35A 2DIGA 2RHXA 4A4FA 3M9QA 2WACA 3NTKA 3UWNA 3OYBA 4E7LA 2EQUA 4RG2A 5KE2A 4E7JA 3FDRA 2RI2A 2K3XA 2M0OA 3OS0A 2XDPA 2O4XB 5KH6A 2D9TA 3P8HA 3PMIA 4N4IA 1WJRA 2LTOA 2PQWA 3OB9A 4GY5A 2RJDA 3UT1A 4BD3A 3ASKA 3OYMA 2BIVA 3OYJA 5FRNA 2EFIA 3OYCA 2DIQA 2CKKA 5D6XA 2EQMA 2L8DA 2QQRA 4PLIA 4PLLA 4NS5A 3H8ZA 2XK0A 1OYXA 3LLRA 3OYIA 4L59A 2GFUA 3DLMA 2E6NA 4FL6A 5C6SA 3EAEA 3H6ZA 2LVMA 3LX7A 5KE3A 5D6YA 3FEOA 2RI3A 4QVZA 3OS1A 4E7HA 2RHZA 4B9XA 2JZ2A 4EDUA 2G3RA 4C5HA 2FHDA 4FU6A 3MEWA 3PNWC 2R5AA 3OA6A 1XNIA 2VYTA 4BE2A 4N4HA 3S3MA 2DAQA 4A4EA 3OYAA 2RI5A 1WGSA 2O4XA 1N27A 3FC3A 3OYGA 5KCHA 4B9WA 5FRMA 3O8VA 4Z02A 3C4SA 3NTIA 2QQSA 5J39A 3E9FA 3MEUA 3MO8A 4E7KA 2NLUA 3F70A 1OI1A 2HQXA 3OMCA 2RJEA 1H3ZA 2EQJA 2JTFA 4N4GA 2RO0A 3Q1JA 2F5KA 3NTHA 4IKFA 3GOXA 4QW2A 4IUUA 5D6WA 4IUQA 2M1HA 4C5GA 4HCZA 3ZEHA 2RHUA 3KUFA 2BUDA 2E5QA 4BDYA 5IN1A 2GF7A 2R5MA 3ME9A 4ZTFA 2HQEA 1RI0A 2EKOA 3LGLA 1SSFA 4II1A 4LD6A 3QJ6A 4QQGA 2LDMA 3L2WA 4CRIA 3MP8A 3OQ5A 2K3YA 3OY9A 4C5IA 4BE0A 2RHYA 3OMGA 1WJQA 4A4HA 1KHCA 2M16A
chains in the Genus database with same CATH superfamily
5FWBA 2VXEA 5M9OA 3CCST 2JN0A 2IG0A 2K9GA 4RTVA 1JU5C 2EGAA 4IUPA 2RQRA 1VQMT 1QP3A 4LDYA 1K9MU 1UTIA 4Q5WA 4ZGDB 4A4GA 1K9AA 4KUIA 5GAN6 2DXCA 2HL5C 4ATOA 2KI7A 5GAN2 3I5SA 2EQKA 5GANg 2KYBA 1YITA 4FW1A 1MHNA 2CH4W 1UJ0A 3HRTA 3CPWP 1YJNT 3M9QA 2EWNA 3RMSA 4RG2A 4E7JA 2YUOA 2ZPFB 1NBEB 1AOJA 2D9TA 2IVWA 2EPDA 3ASKA 3CCJT 4BY6C 2QA4T 2YHTA 1VIFA 2Z0WA 3MKDA 3QYGB 4LDVA 3OS1A 3JCMh 1RAGB 3O5ZA 1JJ2S 3PVQA 2K6DA 3S3MA 2KT8A 1SG5A 4J9CA 1BKBA 1I8FA 1LOJA 2IPOB 2GNCA 5CQYA 3CC7Q 4Z02A 1EFNA 1D0XA 5D7UA 1H3HA 3QSUA 4PKCC 2RF0A 1WNLA 4IUUA 4KGVB 4PJOF 2OAUA 3M4GA 4HCZA 4R56A 3BDUA 3M57A 4WF2A 3TQ7P 1KC8R 5GMKm 3ZFJA 1Q7YU 4XU3A 4FW2A 1HSQA 2RHIA 4M7AF 2HBWA 1U1TA 1WHHA 2DYBA 5FW9A 3LYIA 4PJOB 3EH2A 3OW2P 5GANe 3JCMQ 3J81E 2LRQA 1UGPB 3EFOB 4JDSA 2M0YA 5KYUB 1ZUKA 3CC4A 4IUTA 5CKDA 1OZ3A 1QCOA 1WQWA 3SD4A 4MZPA 3LH0A 1VQ4Q 3OYKA 1M8VA 2H3JA 4XTUA 3G71T 4XTZA 3OYHA 2K3BA 2RHXA 4Z89A 1NEBA 1J3TA 3CBMA 1MNDA 2VVKA 2EQUA 1BI0A 1MMNA 2GTOA 3BY7A 2WSCE 3PVLA 5A0LA 1KC8C 1AZEA 3BW1A 1VQMA 2LTOA 2VKNA 4C92A 1Z9QA 4NS5A 3SHWA 2EKHA 3VKIA 1OYXA 1HJDA 2GFUA 1RUWA 3EAEA 4J9HA 3PTAA 2OTJT 3IQLA 4B9XA 3NPFA 2F2WA 1VQMQ 1Q82R 2ABLA 2CP6A 1M8MA 1PRMC 1WGSA 2MOXA 2HQHA 1JO8A 3G6ET 3H0FA 3UATA 3CC4T 1S72Q 2MMPA 2QQSA 3MO8A 3URGA 2DO3A 3CCRQ 1H3ZA 1AZGB 3JCMV 3KFVA 1YI2Q 2E6ZA 2JT4A 1QVGS 1AWXA 1RAFB 2FEIA 5CVIA 1M27C 1Y0MA 2I0NA 2R5MA 4J7IA 2D6FA 3VS6A 2E3HA 1ARKA 3RKXA 1YBYA 2DM1A 1W4SA 2F5TX 1M2VA 2CT4A 2E70A 2R58A 1UUEA 1K9MC 4WCIA 2EQIA 4Z8AA 5GAOp 4BI8B 4LUDA 1M30A 2DMOA 4C8QD 3CPFA 2KNBB 4OMQA 1VQ9T 1D0ZA 3S3OA 1RI9A 2QTVA 3VYHB 3OYLA 2O9SA 3L2VA 2CZ7B 3CBPA 1BIBA 4D6WA 3JB9I 4LDXA 2OX7A 4QVCA 3L2QA 3JB9F 2DYIA 3GBQA 5KCOA 3MHXA 1NEGA 2JMCA 3CCJA 1Q7YR 5J3BA 5LJ3d 4PJOD 2RJCA 2MCNA 1ZBXA 1JBMA 2HNIA 4F7UF 2HD0A 1BBZA 1IGQA 4RTTA 4E47A 3JCMJ 4NOYA 1ZSZC 1TSFA 4ELYC 4M75E 1YCSB 1OEBA 1M90U 1I1JA 4FT2A 2ZZDA 4MMKA 1VQLQ 4PK4A 5GMKi 3FJ5A 3G71A 3HSBA 1M3BA 5LJ5g 1VQ5T 4XU2A 2XDBA 2NYSA 4M78F 4OB2B 4PJLA 2DE0X 2E10A 5GAMj 1OULA 1UDLA 5LJ3e 1YWPA 1N8RR 2GQIA 3I56Q 2B86A 2GGRA 3PGGA 4RTZA 4C0DC 2E1HA 2DL8A 4J5YA 3RDVA 3EG3A 2AHJB 5CQXA 3PE0A 3FIFA 3ME9A 2A36A 2BZYA 1K73C 2LDMA 1B07A 5IHKA 1WHKA 2JJ9A 2PUOB 1YIJT 1D1CA 2K4YA 3LH5A 3CC2A 4ZGEB 3DB3A 1C0MA 4IUVA 1CSKA 1YWOA 1M1KR 4PFOA 2P0KA 1TH7A 2G6FX 4AFQC 4KULA 1W1FA 2PTKA 2X4YA 2E65A 1FMWA 1Z9ZA 3I55Q 4M77F 2KAFA 2RD1A 5CR2A 3VJPA 4F7UG 3VRZA 3CMAQ 2DA9A 3QIIA 5GANh 2FZCB 2JS2A 1M90R 3LGFA 2KRNA 5GMKe 3M0PA 5A0DA 4FYYB 3VU3C 1ZQ1A 2LCCA 3X28B 2KK4A 5L8RE 1G5VA 1AD5A 1FMKA 4E7SA 5L23A 4M7AD 2DILA 2PUKB 2WACA 1BI3A 4GLMA 3CQTA 2M0OA 4J9FA 1WA7A 2EGEA 5FU7C 3CD6A 1PHTA 4XTXA 4GY5A 1GCPA 4PFPA 3CD6T 2CH4A 1EIFA 2ZPIB 1YI2A 2QQRA 1BK2A 5CO7A 4EPCA 2X9HA 3MCAB 2YRCA 2JTMA 3EHRA 1Q82U 4AFUC 3BFMA 3CCEA 1IO6A 2KSSA 4E7HA 3HHTB 4EDUA 2XI9A 2HMAA 2KQWA 2VYTA 4BE2A 2DAQA 4OGCA 1BCMA 2RI5A 5KCHA 4OB1B 3CCEQ 3E9FA 1C6VX 2EAYA 1Y57A 4AG1C 3CMET 4CC7A 2XKOC 1RLPC 3CC2Q 3CCET 1KQSA 2OTLA 4LNPA 2E5QA 3QJYA 1VQ5A 3QJ6A 2M02A 1TU0B 3CXCP 4MDXA 1I5OB 2KT1A 3HFOA 3PFSA 2P84A 2BKDN 3CCRA 2DRMA 4DBRA 2LQNA 1ACMB 4R55A 1OU9A 2L3QA 2HCKA 3OYEA 4PNOA 2L3RA 5CIUA 5DLQE 1ABQA 1IB8A 5FROA 3FC3A 3MEAA 1AVZC 1BCOA 2QTXA 3CCQA 2XICA 1ZA2B 3I35A 3G4ST 1G2BA 4ZTJA 2YSQA 4M7DC 2A3LA 4RMOA 1QLYA 5LJ3f 3V8KA 2YUPA 2QEXA 2NUTA 1VQ6Q 1W2BS 1MV0B 1PG5B 1W70A 2FB7A 3CD6Q 2ZGWA 3H8ZA 3VS2A 2V8IA 4JLIA 4QVZA 1QMCA 2FO0A 1I81A 1Y96B 3REAB 1M3CA 3HTRA 2QEXT 2R5AA 4C8QB 4LD9K 3M0UA 3EGDB 1WXUA 4OF1A 1M3AA 1UFFA 1B34B 2QQ9A 1QCFA 1SPKA 2HQXA 5KYYA 1VQ7A 2EYXA 2C0OA 2DX1A 1N6AA 4HVUA 3CCSA 1JXOA 4XTVA 2DERA 4E7ZA 2GCXA 2RM4A 3RESA 3N5BB 1HYOA 3AHUA 2KROA 5GANf 2K79A 4MDWA 4OB0B 4LD6A 3L2WA 5AT1B 1OV3A 1JXMA 2L3PA 5KYXA 2RMOA 1QVFS 1OZ2A 2O01E 5AYFA 1Q86C 1GFCA 3TVTA 1YJ9T 1NYGA 2JTEA 4M77A 1R8OB 4N0AA 1D0YA 4ANJA 4KRTA 3CCUA 2HZYA 4C5EA 4F7UA 2E4HA 5GAN5 3OYGA 5CKEA 2CSIA 3CMEA 2DXBA 1WZOA 4X1VA 2D0NA 2L5QA 8AT1B 3CCMT 1KG1A 1QKWA 4HXJA 1YCYA 3JSCA 3NMZC 3OSSC 3VS4A 1T0JA 1ZX6A 2DD5A 1KHIA 2WSEE 1X69A 2CZ6B 4XTYA 4E7LA 1IRXA 2DL7A 3AT1B 4JJBA 4OMFB 2X3WD 1Q82C 2HSEB 2JMAA 5GAN3 1X01A 2EJFA 2L3SA 2A08A 3CC7A 1YJWQ 2VV5A 5D6XA 2LNHB 3CBOA 1C1AA 1G8XA 2E6NA 1YIJQ 1PC0A 1YNZA 2X3XD 3E19A 2C06A 1N9SA 2ATCB 4DBFA 4J83A 1QWFA 3HKSA 2KRMA 1YJ9A 3OA6A 1CKAA 3CC7T 3M0SA 4RUGA 1WXBA 3M5AA 1XQHA 1SF9A 1ZA1B 1VQLA 1QVGP 4DOWA 1GFDA 2DFUA 2OJ2A 1FYNA 3GOXA 4IUQA 4J6WA 3QZ5B 2A28A 3V7CA 2RK2A 4DEXA 4QKUA 4JLGA 2LC4A 4D8KA 1X75C 1TOVA 2LJ0A 4F14A 1W6XA 2QI2A 2LT1A 1KQSP 3CCLT 2CP5A 4BE0A 2QASA 3VYGA 2PU9B 3CCLA 4JS4A 4M7AB 1X43A 1IZ6A 2QG9B 4F7UE 4FYWB 4OMPA 5GJWB 1LPLA 3X26B 2KEAA 2X4WA 4M77G 4BE1A 4JS5A 3C95A 5GAMe 1M1KC 4RKUE 3L2RA 1VQ7T 3GNGA 2AKKA 3H0IA 4UC4A 1AT1B 5CKBA 2NUPA 3QKJA 1PKSA 2MYSA 2X4XA 2D1XA 5GANd 2EIFA 4KGXB 3EFRA 3C12A 4J6YA 2SEMA 5CAIA 2ZAEA 2GTJA 1S1NA 4BD3A 2PQWA 4O6JA 3UT1A 2RJDA 2OAWA 2YLCA 1K8AU 3OW2S 4L5GA 1X6BA 1M9SA 1P92A 4A54A 2RI3A 1GCQA 1PD1A 2HEQA 4M7DF 2AT1B 4FU6A 4ZN3A 3WVDB 4M7DB 1RL2A 1NE8A 3TSZA 2QA4A 3GLXA 4E7KA 4Y91A 2NWMA 2RJEA 3V8JA 3H41A 4JJNK 2KVQG 4C8QA 2RH2A 3A8GB 4QT7A 3C94A 2QQAA 1BYMA 2M51A 2X4JA 1X2QA 5KYUA 3EFOA 5GJVB 2D8HA 4ZTFA 1YJWT 1RI0A 4J6XA 2LJ3A 5KYNA 4HCBA 2CT3A 4DBHA 1E6GA 4OMOA 2V8JA 2J6OA 1K9MR 2O31A 2VXFA 2YLBA 3M53A 1VQNQ 4PJMA 3RKYA 5GAMh 1Q86R 1SKUB 2H8HA 4IURA 1I5LA 2FPEA 1OX9A 3CCSQ 2JOYA 1X2KA 2VWFA 3QYHB 2AZSA 2C0TA 1MMGA 4CC2A 2MK5A 2GFAA 3MP1A 3A1PA 2DETA 1VQOQ 2QQBA 3OS5A 2J6KA 2L89A 4BDZA 3FRNA 1PD0A 5C0MA 2PZ1A 3ZBDA 4A53A 4JPBW 1BI2A 1QP2A 3GIBA 2NUZA 3JCMX 2GQVA 1HK9A 2DZCA 1GRIA 3VUZA 3R6NA 2HKNA 3CCLQ 2EJ9A 2K3XA 2LP5A 2XDPA 2O4XB 3DKMA 3JB9J 1U8RA 4M7DG 4BY6B 1R0CB 1TG0A 2V26A 2CSQA 4M77B 5IT9E 3OYIA 2AKLA 2JVVA 2YXYA 2K2VA 4PFZA 5GANj 2JZ2A 3UA7A 3X20B 4EMHA 4A63B 4M75A 1KK7A 3A8LB 3OYAA 1BB9A 5KYWB 2BZ8A 1S72A 2ZPEB 4LUEA 3O8VA 3F70A 1OI1A 1WIEA 1VQ4T 4MMLA 1ZSZA 1NJIC 5KYXB 4AFSC 4EMKC 1K8AR 1PM3A 1YJNA 4HCKA 3H0HA 3CMEQ 2V8KA 3KUFA 4EMKB 4OMMA 2GF7A 1VQKA 3I55A 4M7DD 4M7AE 5LJ5j 2LMJA 1G3TA 1K1ZA 4F7UB 2AK5A 2LX7A 1T0HA 4A4HA 4JRPA 5DLOA 3RIRA 2FZGB 1WPYA 4JRIA 5LJ3g 3OYNA 1D1BA 1K4US 3L2UA 3S3NA 2QDYB 4NL2A 1FWZA 3WXMB 3M58A 4X34A 2FL7A 3S6WA 4M78C 1UB4A 1QVFA 3EG9A 4M4ZA 1LCKA 1NPRA 1YITT 1R0BG 2DEUA 4OB3B 1MV3A 3NTKA 2F1LA 4M78B 4C0ZA 2XDDA 3UA6A 1KQ2A 3PMIA 2DF6A 4RTYA 3RKWA 4DQ2A 3HFNA 1K0SA 2L8DA 2J6FA 9ATCB 5GAN8 1VQPQ 3DLMA 5CKHA 5KE3A 2CDTA 5D6YA 3ER0A 1U5SA 2RHZA 2VASA 3QWYA 3G7ZA 2G3RA 4C5HA 4C92B 5LJ5f 1TUDA 1YHQQ 2NUTB 1N5ZA 3ULRB 3JCMe 1ABOA 3CCMQ 5FRMA 2JS0A 2QGFB 3C4SA 1YHQT 1I07A 2C0IA 2EQJA 2PVDB 3CCRT 1WQ7A 2XHCA 3Q1JA 4XU1A 3M59A 1X27A 3EGXB 1VYTA 3VS5A 2P0PA 3RNJA 1VQ9A 2BUDA 4J8OA 4YTLA 1AEYA 1ZHIA 4M7DA 1X6GA 5GAOl 1SSFA 3THKA 1PCXA 1UJYA 3MP8A 3OQ5A 4GLKA 1Q7YC 3MPUB 3META 5GAOr 3UDCA 5HY6A 3A8OB 4MZMA 7AT1B 3U23A 1VQLT 5I22A 2LQKA 4E2FB 1T3LA 3BDLA 1WFWA 4Y92A 3A8HB 2DLPA 2DNUA 1EX4A 1K73R 5LJ3j 2YWWA 1WJSA 2KGTA 1LNXA 2MWOA 1FXXA 2KBTA 3E9GA 3EG2A 4EMGA 3EG1A 4J9BA 1F1BB 2QGGA 4GBQA 2XG8D 2MWPA 2MIOA 1XJWB 2X51A 1KQ1A 1VUBA 2VGMA 4MZTA 2V1QA 1KC8U 2HAXA 3INZA 5KE2A 1PSFA 3M0RA 3TU4K 3VS3A 2BTTA 1SHFA 3OYJA 4JUVA 3J7AF 2CKKA 1RAHB 1PSEA 4BI3A 4XU0A 3M0TA 4CC3A 3TSWA 1BU1A 2DL4A 2DXUA 4C8QE 5C6SA 1OPKA 2LVMA 4RCBA 1B7TA 1JB0E 4VUBA 4B6MA 1WHMA 3PT9A 4M78A 2RQWA 2KR3A 4M75G 1NZ9A 3X24B 5ECAA 1JEGA 3EGXA 5IHNA 4M78D 2K7AA 2FRYA 4K11A 4PJOE 3P8BB 5GMKj 2ZPBB 5HKCA 1K0XA 4M75B 2JW4A 1ZLMA 2F5KA 3JAME 3A5ZB 2CS7A 3SWNC 3G71Q 4C5GA 2HDAA 3MJXA 4FYVB 1KD1U 4M75D 2VC8A 5IN1A 4DBQA 4HCCA 4KT0E 4DEYA 4M7AC 1RAEB 2OI3A 3ZL7C 1KHCA 1Q81U 3LW5E 2DTHA 3CCVT 4QQDA 3R6OA 2EVRA 1D3BA 3V8LA 2BZXA 2JNGA 1Y71A 1U06A 3RUXA 4PJOC 2OTLQ 1QWEA 3L42A 2YDLA 2QXFA 2O88A 2R57A 4M7AG 3QWXX 2ROTA 4F16A 2A0FB 1MUZA 4JJCA 3OYFA 2RQVA 1ZSGA 4M77C 3CCUQ 4C8QF 3EFSA 4M78E 2D8JA 4J7FA 3OS2A 3EG0A 3EGDA 3J80E 5I21A 3A8MB 4A4FA 1U3OA 3OYBA 2FPDA 1D1AA 1UGSB 1UECA 4ELZC 3VS1A 5GAN7 4FSXA 5CKFA 4JRQA 1O75A 1Y07A 2HBPA 4JRKA 1N8RC 1LVKA 5KYYB 2E12A 1N9RA 2JM8A 4ZN1A 2NUPB 2Y90A 3H6ZA 2OTJQ 3FEOA 1W2BA 3CPWA 3BE3A 1SSHA 4XQ3A 1WDXA 1KJWA 4QVDA 5CCAA 2H3EB 4EMKA 3PNWC 2O2OA 2A37A 3G6EQ 2LJ1A 5I11A 4B9WA 3CMAA 3NTIA 3SDZA 2FPFA 4X9CA 3QPHA 4LDUA 5FU7B 4BUGA 1VQ8T 2DJQA 2JTFA 1VQ7Q 1SHGA 4IKFA 4ZNXA 1M4ZA 2CZ0B 4FCYA 3OBYA 3ZEHA 4HVVA 1RAIB 2E3IA 2O9VA 1IREB 5GAOm 2F2VA 4Z88A 2E5KA 2HQEA 2YUQA 1GXIE 3TREA 2AZVA 2AIRB 3OY9A 2CUDA 2CYZB 1K73U 3OMGA 2RHYA 2ZPGB 1LJOA 2PNIA 3P8DA 1YJ9Q 2RQTA 4L6V5 4E7IA 1M1FA 1QCNA 4ORZA 2K57A 2RB6A 3JV3A 3SWNB 2KY9A 3I9QA 2CUBA 1VQPA 5A0GA 3M0QA 3CCQQ 4AMCA 1Q81R 3QHSA 2FVUA 2XMFA 3EH1A 2B8AA 2MF2A 3CXCA 2EYQA 2RN8A 2KDSA 2KRSA 4ME7A 4OMNA 1RAAB 5LL6S 3JRZA 2YUNA 3X25B 4BACA 3GP8A 3JCMd 1VQ8A 4LN2A 2E64A 2YRVA 3JCMg 1UEBA 1WHGA 5CK9A 2M9UA 4AT1B 3VUBA 5LJ5e 2CZ1B 1KQSS 1HXDA 1VIEA 3P8HA 1UGQB 1WJRA 2CP3A 2EFIA 1EZZB 2XK0A 1I0CA 1UGVA 1X6OA 1G3SA 5IXBA 2HL3A 4M78G 4ZGJB 3PIOA 4M77D 3OBWA 2DK3A 2O4XA 4OMLA 2L2PA 1KD1C 3G4SQ 3JCMc 4XAXB 1TS9A 3SWNA 3G6EA 4X9DA 4N4GA 2L0AA 2RO0A 1QQJA 2P0QA 2V1RA 3EGUA 1MNEA 1Q81C 2M1HA 4C92G 4M77E 2ED1A 2KMTA 4BDYA 3OYYA 1U1SA 2DVEA 3QDRB 5IXFA 1M2OA 3LGLA 2LX9A 3QDFA 2M16A 1M90C 3M4YA 5LJ5d 1NM7A 3TEEA 1V1CA 2LQ8A 4E6RA 3CCVA 1VQ9Q 1OOTA 1V29B 2WSFE 1BI1A 1VQNA 1YP5A 1FMVA 2DD4A 4C92D 3VRYA 4RCCA 3VS0A 1RABB 3CMAT 3CCQT 1VQOT 4OVAA 1VA7A 1UGRB 3VV0A 1M1GA 1WHJA 2IIMA 4RTWA 1AWWA 2XU8A 2XD0A 4HA8A 2RJFA 5LJ5h 4C92C 4KH1B 1QW1A 4FT4A 2EW3A 4F17A 3A98A 2VGNA 3FDRA 2RI2A 1AWOA 1JRIA 1A0NB 4CI0C 5FU6C 3HPWA 2EGCA 3H9NA 2F2XA 4LE9A 4N4IA 1TUCA 5FRNA 5I2SA 5GAOq 4OGEA 2E41A 4KBMB 4LDWA 4C0GA 2KXDA 2VUBA 1G3WA 5A2QE 1VQPT 3I55T 4M75F 2VB6A 4N4HA 2CP2A 4A4EA 4J9GA 1IGUA 3FB9A 3MEUA 4JJDA 1YIJA 4FM4B 1YI2T 2DBKA 2RPNA 1WI7A 1UHFA 3KXTA 2FYKA 3I56T 4WTOB 1WXTA 1AWJA 1MMDA 3JCMf 4O5VA 2QDLA 1D09B 1OX8A 2OTJA 1YJNQ 2MAMA 2LCSA 4Y28E 1YFNA 1OPLA 2W10A 3OSVA 2DZ9A 4AFZC 2FRWA 2MI6A 3M54A 1W2BP 4CRIA 2K3YA 4RTXA 1MGQA 2ZCFB 1H641 4PL6A 5HK0A 3JB9G 2K2MA 3G1JA 1TWBA 5GAMg 3V7SA 3HRUA 1H92A 2PVOB 1I4K1 4JZ3A 2ZPHB 3OYDA 1JJ2P 1CKBA 5EC7A 1RLQC 4FIBA 2EYZA 1SRLA 3RBBB 1E7OA 3CCMA 2LCLA 1IHWA 1B3QA 2Y4XA 3DB4A 2DVJA 2QK0A 3QBYA 1ZUUA 4PJOG 2HKQB 4IIMA 1HD3A 2COWA 2CREA 3NFCA 3PMTA 3V7RA 3JCMW 2X35A 1T3SA 4KGZB 5GAOn 1YITQ 2EYWA 3HRSA 3T9NA 4C8QG 3CPWS 1IXDA 2PVGB 3JCMP 3KBGA 2BIVA 1QVPA 1VQOA 3OYCA 2DIQA 1YHQA 3RERA 1YN8A 2EQMA 4FSSA 4PLIA 2YT6A 4PLLA 1ZSZB 3LLRA 4L59A 4HKEA 2BE7D 5KYWA 1VQNT 2HSPA 5LJ3h 3SFMA 3MEWA 1S72T 1M5Q1 2EYYA 1GBRA 1O9SA 4C8QC 4RTUA 3CCUT 5FWCA 2ENMA 2NLUA 4C0FA 4N0AC 3JB9H 1RACB 3QG1A 2DL3A 1SRMA 1G83A 1VQKT 1N8RU 3TCJA 2DJZA 4AG2C 3LWHA 2QAZA 1TXQA 1VQ6T 1VQKQ 4J9DA 3GPLA 2QA4Q 1NLOC 4JZ4A 4J9EA 3SB2A 4C5IA 3FJPA 1WJQA 3GF5A 1KIKA 1MMAA 3MP6A 4HT9A 1E6HA 2J06A 2JXBA 3VS7A 5IAYA 2DBMA 4F04B 1G3YA 3EG9B 5HCKA 4C92F 1JQQA 2RA2A 3I5RA 5J26A 5GMKh 2QEXQ 3FLGA 1M1KU 1BIAA 1VYVA 3CEYA 3MEVA 3QO3A 3D7SB 5IHIA 2JUFA 1VQ8Q 3CC4Q 2DRKA 4QQ6A 2GBQA 3RR6A 1TUGB 4M75C 2FZKB 1VQ4A 3HP9A 1UG1A 2KE9A 2RNAA 4HT8A 2ROLA 3SEMA 3G4SA 1K76A 4BI4A 4KUDK 8ATCB 5GMKl 1AHJB 3E1SA 3OS0A 4ESRA 4DOVA 3C0CA 1PNJA 3UF4A 3NHNA 5EG2A 1NPPA 1VOMA 1K8AC 3QXEB 1OU8A 1QVGA 1NJIR 2XIDA 2ESWA 1FX7A 4FL6A 3LX7A 3I56A 1Q86U 1QKXA 2F69A 5DY9A 2DL5A 4BB7A 1SEMA 1XNIA 3QUIA 1IHVA 2J05A 2DPPB 2FG0A 5I2MA 1ZBJA 5HK3A 4PJOA 2DXTA 5J39A 2CP0A 3OMCA 3JB9D 1UHCA 2SRCA 3NTHA 2KYMA 4RG8A 1NLPC 4QW2A 1Y96A 3NGPA 5DM7R 2D0QB 2LQWA 3E2UA 1RADB 3EHQA 2EKOA 1QVFP 2RQUA 4II1A 6AT1B 1H8KA 3CCVQ 1GCQC 3L2ZA 1KSWA 2JM9A 1NG2A 1PKTA 1PWTA 1TTHB 2I2LA 2W0ZA 4FYXB 2Y4YA 3CCJQ 2RK1A 3L1AA 4C0DB 1VYUA 2OTLT 1KFZA 1WLPB 2DTOA 4R0KA 2BE9B 1NYFA 3M55A 1VQ5Q 5FU6B 1GBQA 2ED0A 4DA4A 4P5NA 3REBB 4J9IA 4D8DA 3DLLA 3QZ9B 4EIKA 1V76A 3UPUA 3M56A 1D3BB 4M7AA 1WYXA 4PJNA 1JJ2A 4PJJA 1R77A 1KD1R 4M7DE 2DIGA 2J7IA 2KXCA 3UWNA 1VQ6A 4A4KA 2A7YA 2DTIA 5GAMf 4KH0B 5FLXE 5KH6A 3HL8A 3JCMb 2MPXC 3OYMA 3OB9A 2LNVA 1YJWA 3WVEB 2ECZA 1B34A 4IIOA 2CP7A 1PRLC 2DEQA 2QYZA 3LWIA 5IH2A 2LT4A 1OQKA 2DKGA 2YRDA 1ZUYA 2EBPA 2FHDA 2COYA 2LZ6B 1N27A 1WHLA 2K5FA 4V2SA 4LXCA 4TVRA 2P4RA 2K5LA 3CC2T 2EJGA 5GAMd 3PIPA 3RMQA 1NJIU 4XTWA 4NL3A 4CC4B 2COZA 2CGHA 1XOVA 4OP0A 1Q95G 1DJ7B 5D6WA 1UE9A 3OW2A 1GL5A 1Y7XA 3GNFB 2RHUA 1WX6A 1M2VB 4XK8E 2P4TA 4QQGA 4C92E 1XTDA 4HVWA 5GAN4 3CXCS 2K5IA
chains in the Genus database with same CATH topology
3M4YA 5DLOA 5LJ5d 3RIRA 4JRPA 3HFOA 4MDXA 3PFSA 3TEEA 2BKDN 2VXEA 5M9OA 2LQ8A 3CCRA 3CCVA 1WPYA 3CCST 2JN0A 4JRIA 5LJ3g 3OYNA 1V29B 2WSFE 1BI1A 2IG0A 1VQNA 4R55A 2DD4A 3L2UA 4C92D 3OYEA 4IUPA 4PNOA 4RCCA 1VQMT 1QP3A 4LDYA 2L3RA 2QDYB 5CIUA 3S3NA 1K9MU 3CMAT 5DLQE 3CCQT 5FROA 4OVAA 4NL2A 4Q5WA 3MEAA 3FC3A 4ZGDB 1FWZA 4A4GA 1UGRB 3VV0A 1M1GA 4KUIA 5GAN6 2DXCA 2QTXA 3CCQA 2XICA 3WXMB 4ATOA 3M58A 4X34A 2XU8A 2XD0A 5GAN2 4HA8A 2RJFA 2EQKA 2FL7A 3S6WA 4M78C 5LJ5h 3G4ST 1UB4A 5GANg 4ZTJA 1QVFA 1YITA 1MHNA 4M7DC 2A3LA 4RMOA 1NPRA 4C92C 3HRTA 1YJNT 1QW1A 4FT4A 1YITT 3M9QA 2EWNA 4OB3B 5LJ3f 3NTKA 3V8KA 3RMSA 4RG2A 4M78B 4E7JA 2VGNA 3FDRA 4C0ZA 2RI2A 1JRIA 2XDDA 1KQ2A 2ZPFB 4CI0C 2QEXA 5FU6C 2D9TA 3HPWA 3PMIA 4N4IA 1W2BS 3RKWA 2IVWA 3ASKA 5FRNA 4DQ2A 3HFNA 2FB7A 5I2SA 5GAOq 3CCJT 4BY6C 2L8DA 4OGEA 2QA4T 2E41A 2YHTA 2ZGWA 4KBMB 3H8ZA 4LDWA 5GAN8 1VIFA 2V8IA 4JLIA 4C0GA 3DLMA 5CKHA 3QYGB 4LDVA 5KE3A 5D6YA 2VUBA 4QVZA 3OS1A 1G3WA 3JCMh 3ER0A 5A2QE 1I81A 1Y96B 2RHZA 1VQPT 3G7ZA 2G3RA 4C5HA 4C92B 5LJ5f 3I55T 1JJ2S 4M75F 2QEXT 2R5AA 3S3MA 4C8QB 4N4HA 4LD9K 4A4EA 1BKBA 1I8FA 1LOJA 5CQYA 3JCMe 5FRMA 4OF1A 4Z02A 1B34B 2QQ9A 3C4SA 3FB9A 3MEUA 1YIJA 1YHQT 2HQXA 1VQ7A 2PVDB 2EQJA 4FM4B 1YI2T 3CCRT 1WQ7A 3QSUA 2XHCA 1N6AA 3Q1JA 4PKCC 3KXTA 2FYKA 3I56T 1WNLA 4XU1A 3CCSA 3M59A 3JCMf 4O5VA 4IUUA 4XTVA 4PJOF 2OAUA 1M90C 2P0PA 2OTJA 2GCXA 2RM4A 3M4GA 4HCZA 3RESA 3N5BB 4R56A 2BUDA 2MAMA 1VQ9A 3BDUA 3M57A 3AHUA 4Y28E 4J8OA 3OSVA 4YTLA 4WF2A 5GANf 2DZ9A 5GMKm 1ZHIA 4M7DA 2MI6A 1SSFA 3ZFJA 5GAOl 1Q7YU 3M54A 4MDWA 4OB0B 4LD6A 4XU3A 3L2WA 4CRIA 3MP8A 3OQ5A 2K3YA 4GLKA 1Q7YC 3META 5GAOr 3UDCA 1MGQA 2RHIA 5HY6A 2ZCFB 3A8OB 4MZMA 4M7AF 1U1TA 1QVFS 1H641 4PL6A 5HK0A 3JB9G 1VQLT 1OZ2A 2O01E 5AYFA 1Q86C 3LYIA 5GAMg 2LQKA 3V7SA 3HRUA 4PJOB 3BDLA 5GANe 3JCMQ 3J81E 1YJ9T 2LRQA 2PVOB 1I4K1 1UGPB 3A8HB 2ZPHB 4JDSA 3OYDA 4M77A 1R8OB 4N0AA 4FIBA 3CCUA 3CC4A 4IUTA 4C5EA 4F7UA 3CCMA 2LCLA 5CKDA 5LJ3j 1OZ3A 1WJSA 5CKEA 5GAN5 3OYGA 1WQWA 2Y4XA 1LNXA 2MWOA 2DXBA 3DB4A 1FXXA 3LH0A 4MZPA 2L5QA 3QBYA 3SD4A 4PJOG 3CCMT 3E9GA 3OYKA 4EMGA 1KG1A 3CMEA 1M8VA 2XG8D 1YCYA 3NFCA 3JSCA 3OSSC 3PMTA 2MWPA 2H3JA 3V7RA 4XTUA 3G71T 3JCMW 4XTZA 3OYHA 1KQ1A 2DD5A 2X35A 1KHIA 2WSEE 2CZ6B 1VUBA 2RHXA 2VGMA 4XTYA 3CBMA 4MZTA 1KC8U 4E7LA 5GAOn 2HAXA 2EQUA 3INZA 1BI0A 3BY7A 1PSFA 5KE2A 4OMFB 2WSCE 3HRSA 5A0LA 1KC8C 3TU4K 1Q82C 3T9NA 4C8QG 3CPWS 5GAN3 2PVGB 3BW1A 1X01A 2EJFA 1VQMA 2LTOA 3CC7A 3OYJA 4JUVA 3KBGA 3JCMP 3J7AF 2BIVA 1QVPA 1VQOA 3OYCA 2DIQA 2VV5A 2CKKA 4C92A 5D6XA 1YHQA 2EQMA 1PSEA 3RERA 4PLIA 4PLLA 4BI3A 4XU0A 4NS5A 3VKIA 3CBOA 1OYXA 3LLRA 4L59A 2GFUA 4HKEA 2E6NA 2DXUA 4C8QE 3EAEA 5C6SA 2LVMA 1VQNT 3PTAA 3E19A 5LJ3h 4RCBA 2C06A 2OTJT 1JB0E 4VUBA 4B9XA 1N9SA 3PT9A 4J83A 3SFMA 3HKSA 3MEWA 4M78A 1YJ9A 3OA6A 4M75G 1M5Q1 1S72T 1NZ9A 3X24B 1O9SA 1WGSA 3CC7T 4C8QC 3G6ET 4M78D 3CC4T 3M5AA 3CCUT 1XQHA 2MMPA 2QQSA 3P8BB 3MO8A 3URGA 5GMKj 2NLUA 4C0FA 2DO3A 2ZPBB 4PJOE 4N0AC 5HKCA 3JB9H 1H3ZA 3QG1A 1VQLA 3JCMV 4M75B 4DOWA 2E6ZA 2F5KA 1QVGS 3JAME 3A5ZB 2CS7A 3GOXA 5CVIA 3SWNC 4IUQA 1VQKT 1N8RU 4C5GA 4J6WA 3TCJA 1KD1U 2DJZA 3QZ5B 3V7CA 3LWHA 2RK2A 4M75D 2VC8A 5IN1A 2R5MA 4J7IA 2D6FA 4JLGA 4HCCA 1VQ6T 2LC4A 1X75C 4KT0E 4M7AC 3GPLA 3RKXA 2QI2A 2LT1A 1YBYA 3SB2A 4C5IA 3CCLT 4BE0A 3FJPA 1WJQA 1W4SA 1KHCA 3GF5A 1Q81U 3LW5E 2DTHA 3VYGA 3MP6A 2PU9B 3CCVT 2F5TX 3CCLA 4QQDA 4HT9A 3R6OA 4M7AB 2E70A 4JS4A 1D3BA 2R58A 5IAYA 1K9MC 3V8LA 1IZ6A 2JNGA 1G3YA 1Y71A 4F7UE 4C92F 5GAOp 2RA2A 4BI8B 3RUXA 4PJOC 5J26A 4C8QD 5GMKh 3CPFA 3X26B 3L42A 3CC2T 2X4WA 1VQ9T 4M77G 4BE1A 3S3OA 3VYHB 3OYLA 4JS5A 3FLGA 1M1KU 3C95A 1BIAA 2QXFA 3L2VA 2CZ7B 3CBPA 1BIBA 3CEYA 4D6WA 5GAMe 3JB9I 2R57A 4LDXA 3MEVA 3QO3A 4RKUE 3L2RA 1M1KC 4M7AG 4QVCA 3L2QA 1VQ7T 3JB9F 2JUFA 5KCOA 3GNGA 3MHXA 3OYFA 4M77C 3CCJA 4C8QF 5J3BA 5LJ3d 3EFSA 4QQ6A 4M78E 4J7FA 4UC4A 3OS2A 5CKBA 2RJCA 3QKJA 4M75C 1VQ4A 1ZBXA 3HP9A 4PJOD 2X4XA 3J80E 5GANd 4HT8A 2EIFA 5I21A 3G4SA 1JBMA 3EFRA 3C12A 3A8MB 2HNIA 4J6YA 4A4FA 4BI4A 4F7UF 2HD0A 4KUDK 3OYBA 5GMKl 1AHJB 3E1SA 1UGSB 4E47A 4ELZC 3JCMJ 4NOYA 3OS0A 5CAIA 4DOVA 4ELYC 5GAN7 4M75E 4BD3A 2PQWA 4O6JA 1M90U 3UT1A 2RJDA 4FSXA 5CKFA 4JRQA 1O75A 2YLCA 5EG2A 1Y07A 2HBPA 1K8AU 1NPPA 4FT2A 4JRKA 2ZZDA 4MMKA 3OW2S 1N8RC 4L5GA 1K8AC 2E12A 3QXEB 1QVGA 1N9RA 2XIDA 4ZN1A 1M9SA 1FX7A 4FL6A 1P92A 2Y90A 3H6ZA 4A54A 3LX7A 5GMKi 3I56A 3FEOA 2RI3A 1W2BA 3CPWA 3G71A 4XQ3A 1Q86U 3HSBA 4QVDA 5LJ5g 5CCAA 1VQ5T 4M7DF 2F69A 4FU6A 4XU2A 4ZN3A 5DY9A 3PNWC 4EMKA 2XDBA 4BB7A 1XNIA 4M78F 3QUIA 4OB2B 3WVDB 4M7DB 2DPPB 2E10A 5I2MA 5GAMj 5HK3A 1RL2A 4B9WA 5LJ3e 4PJOA 2DXTA 1NE8A 3CMAA 3NTIA 3SDZA 4X9CA 5J39A 3GLXA 3QPHA 4LDUA 4Y91A 2QA4A 4E7KA 3OMCA 2RJEA 5FU7B 4BUGA 3JB9D 1VQ8T 2JTFA 3V8JA 3PGGA 4JJNK 4C0DC 2KVQG 2E1HA 4C8QA 2RH2A 3NTHA 3A8GB 4RG8A 4IKFA 4QW2A 1M4ZA 2CZ0B 1Y96A 3OBYA 4J5YA 3C94A 3ZEHA 2QQAA 1BYMA 2AHJB 5DM7R 2X4JA 5CQXA 2D0QB 3FIFA 3ME9A 1IREB 5GAOm 4ZTFA 2HQEA 1YJWT 1RI0A 2EKOA 4J6XA 1GXIE 3TREA 4HCBA 1K73C 4II1A 2LDMA 3OY9A 2V8JA 2CYZB 2PUOB 1YIJT 2RHYA 3OMGA 1K73U 2K4YA 3L2ZA 2ZPGB 4ZGEB 3CC2A 2VXFA 3DB3A 1LJOA 4IUVA 2YLBA 2P0KA 3P8DA 3M53A 1TH7A 2I2LA 2Y4YA 4L6V5 3RKYA 2RK1A 5GAMh 3L1AA 4E7IA 4KULA 4C0DB 1M1FA 4IURA 1I5LA 2K57A 2RB6A 2OTLT 2X4YA 2E65A 3SWNB 2JOYA 2KY9A 2DTOA 3QYHB 3M55A 1VQPA 2GFAA 3MP1A 2KAFA 2RD1A 4M77F 5FU6B 5A0GA 5CR2A 3VJPA 4F7UG 4DA4A 2QQBA 4P5NA 3OS5A 3QHSA 2FVUA 2L89A 4BDZA 3QIIA 5GANh 3FRNA 2B8AA 2MF2A 3LGFA 3CXCA 3QZ9B 2EYQA 4ME7A 2KDSA 5A0DA 5C0MA 5GMKe 3VU3C 3DLLA 3UPUA 3ZBDA 5LL6S 1ZQ1A 3JRZA 3M56A 1D3BB 3CD6A 3X25B 2LCCA 4BACA 4M7AA 3GP8A 4A53A 1JJ2A 3JCMd 3X28B 1VQ8A 1BI2A 2KK4A 2E64A 2YRVA 3JCMg 1QP2A 5L8RE 3GIBA 1G5VA 3JCMX 1UEBA 4M7DE 2DIGA 2GQVA 4M7AD 1HK9A 2PUKB 2WACA 2DZCA 2M9UA 3UWNA 4A4KA 5CK9A 2A7YA 1VQ6A 2DTIA 3VUZA 5GAMf 1BI3A 5FLXE 3VUBA 2EJ9A 2K3XA 2M0OA 5LJ5e 2CZ1B 5FU7C 1KQSS 1HXDA 2XDPA 2O4XB 1VIEA 5KH6A 3P8HA 1VQOT 3HL8A 3JCMb 3DKMA 3JB9J 1U8RA 1UGQB 1WJRA 3OB9A 2LNVA 4GY5A 4XTXA 4BY6B 3OYMA 3WVEB 1YJWA 4M7DG 3CD6T 2EFIA 1B34A 1EIFA 2ZPIB 1YI2A 2QQRA 2DEQA 5CO7A 4M77B 5IT9E 2XK0A 4EPCA 3MCAB 3OYIA 3LWIA 2JVVA 2JTMA 1Q82U 2LT4A 3BFMA 3CCEA 2KSSA 1X6OA 2DKGA 2K2VA 3HHTB 4E7HA 1G3SA 2JZ2A 5GANj 4EDUA 2XI9A 2KQWA 3X20B 2FHDA 4EMHA 4M78G 4M75A 4ZGJB 2VYTA 3A8LB 3PIOA 4M77D 3OBWA 2DAQA 4BE2A 4OGCA 3OYAA 2RI5A 2DK3A 2O4XA 1N27A 2K5FA 4V2SA 1S72A 5KCHA 2ZPEB 1KD1C 4TVRA 2K5LA 3O8VA 3JCMc 2EJGA 4OB1B 4XAXB 5GAMd 3E9FA 3PIPA 3SWNA 3RMQA 1NJIU 4XTWA 2EAYA 3F70A 4NL3A 1OI1A 4X9DA 3G6EA 1VQ4T 3CMET 4MMLA 2XKOC 4N4GA 2CGHA 1NJIC 2RO0A 4EMKC 1YJNA 3CCET 2P0QA 1KQSA 1XOVA 2OTLA 4OP0A 1DJ7B 5D6WA 1Q81C 3OW2A 2M1HA 2V8KA 4C92G 4M77E 1Y7XA 3GNFB 2RHUA 3KUFA 2E5QA 2KMTA 4BDYA 3QJYA 3OYYA 4EMKB 2GF7A 1VQKA 3I55A 4M7DD 1U1SA 2DVEA 1VQ5A 3QDRB 4M7AE 5LJ5j 4XK8E 1G3TA 3LGLA 2P4TA 2LX9A 4F7UB 3QJ6A 4QQGA 4C92E 1XTDA 5GAN4 3CXCS 2K5IA 4A4HA 2M16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DB3 A;  3MP6 A;  2RHI A;  4IUV A;  3PFS A;  4QQD A;  2P0K A;  2R58 A;  3P8D A;  2BKD N;  5IAY A;  4PL6 A;  5M9O A;  1OZ2 A;  4E7I A;  3LYI A;  4IUR A;  3BDL A;  2X4Y A;  3OYN A;  5J26 A;  2IG0 A;  2LRQ A;  3L42 A;  2X4W A;  3OYD A;  3L2U A;  4BE1 A;  3L2Q A;  3S3O A;  3OYE A;  2GFA A;  3MP1 A;  3FLG A;  3OYL A;  3L2V A;  4IUP A;  3CEY A;  3S3N A;  2L3R A;  4IUT A;  5CIU A;  2R57 A;  4C5E A;  3MEV A;  3L2R A;  3MET A;  2L89 A;  1OZ3 A;  1WJS A;  4OVA A;  4Q5W A;  3QII A;  3MEA A;  5FRO A;  3DB4 A;  3SD4 A;  2MWO A;  2B8A A;  3LGF A;  3LH0 A;  4A4G A;  5KCO A;  3QBY A;  5C0M A;  3OYF A;  3E9G A;  3OYK A;  4X34 A;  4BDZ A;  4QQ6 A;  2RJF A;  2EQK A;  2LCC A;  4BAC A;  3S6W A;  3PMT A;  4UC4 A;  3OS2 A;  2MWP A;  2RJC A;  3QKJ A;  4ZTJ A;  1MHN A;  2X4X A;  2YRV A;  3OYH A;  1G5V A;  2X35 A;  2DIG A;  2RHX A;  4A4F A;  3M9Q A;  2WAC A;  3NTK A;  3UWN A;  3OYB A;  4E7L A;  2EQU A;  4RG2 A;  5KE2 A;  4E7J A;  3FDR A;  2RI2 A;  2K3X A;  2M0O A;  3OS0 A;  2XDP A;  2O4X B;  5KH6 A;  2D9T A;  3P8H A;  3PMI A;  4N4I A;  1WJR A;  2LTO A;  2PQW A;  3OB9 A;  4GY5 A;  2RJD A;  3UT1 A;  4BD3 A;  3ASK A;  3OYM A;  2BIV A;  3OYJ A;  5FRN A;  2EFI A;  3OYC A;  2DIQ A;  2CKK A;  5D6X A;  2EQM A;  2L8D A;  2QQR A;  4PLI A;  4PLL A;  4NS5 A;  3H8Z A;  2XK0 A;  1OYX A;  3LLR A;  3OYI A;  4L59 A;  2GFU A;  3DLM A;  2E6N A;  4FL6 A;  5C6S A;  3EAE A;  3H6Z A;  2LVM A;  3LX7 A;  5KE3 A;  5D6Y A;  3FEO A;  2RI3 A;  4QVZ A;  3OS1 A;  4E7H A;  2RHZ A;  4B9X A;  2JZ2 A;  4EDU A;  2G3R A;  4C5H A;  2FHD A;  4FU6 A;  3MEW A;  3PNW C;  2R5A A;  3OA6 A;  1XNI A;  2VYT A;  4BE2 A;  4N4H A;  3S3M A;  2DAQ A;  4A4E A;  3OYA A;  2RI5 A;  1WGS A;  2O4X A;  1N27 A;  3FC3 A;  3OYG A;  5KCH A;  4B9W A;  5FRM A;  3O8V A;  4Z02 A;  3C4S A;  3NTI A;  2QQS A;  5J39 A;  3E9F A;  3MEU A;  3MO8 A;  4E7K A;  2NLU A;  3F70 A;  1OI1 A;  2HQX A;  3OMC A;  2RJE A;  1H3Z A;  2EQJ A;  2JTF A;  4N4G A;  2RO0 A;  3Q1J A;  2F5K A;  3NTH A;  4IKF A;  3GOX A;  4QW2 A;  4IUU A;  5D6W A;  4IUQ A;  2M1H A;  4C5G A;  4HCZ A;  3ZEH A;  2RHU A;  3KUF A;  2BUD A;  2E5Q A;  4BDY A;  5IN1 A;  2GF7 A;  2R5M A;  3ME9 A;  4ZTF A;  2HQE A;  1RI0 A;  2EKO A;  3LGL A;  1SSF A;  4II1 A;  4LD6 A;  3QJ6 A;  4QQG A;  2LDM A;  3L2W A;  4CRI A;  3MP8 A;  3OQ5 A;  2K3Y A;  3OY9 A;  4C5I A;  4BE0 A;  2RHY A;  3OMG A;  1WJQ A;  4A4H A;  1KHC A;  2M16 A; 
#chains in the Genus database with same CATH topology
 5FWB A;  2VXE A;  5M9O A;  3CCS T;  2JN0 A;  2IG0 A;  2K9G A;  4RTV A;  1JU5 C;  2EGA A;  4IUP A;  2RQR A;  1VQM T;  1QP3 A;  4LDY A;  1K9M U;  1UTI A;  4Q5W A;  4ZGD B;  4A4G A;  1K9A A;  4KUI A;  5GAN 6;  2DXC A;  2HL5 C;  4ATO A;  2KI7 A;  5GAN 2;  3I5S A;  2EQK A;  5GAN g;  2KYB A;  1YIT A;  4FW1 A;  1MHN A;  2CH4 W;  1UJ0 A;  3HRT A;  3CPW P;  1YJN T;  3M9Q A;  2EWN A;  3RMS A;  4RG2 A;  4E7J A;  2YUO A;  2ZPF B;  1NBE B;  1AOJ A;  2D9T A;  2IVW A;  2EPD A;  3ASK A;  3CCJ T;  4BY6 C;  2QA4 T;  2YHT A;  1VIF A;  2Z0W A;  3MKD A;  3QYG B;  4LDV A;  3OS1 A;  3JCM h;  1RAG B;  3O5Z A;  1JJ2 S;  3PVQ A;  2K6D A;  3S3M A;  2KT8 A;  1SG5 A;  4J9C A;  1BKB A;  1I8F A;  1LOJ A;  2IPO B;  2GNC A;  5CQY A;  3CC7 Q;  4Z02 A;  1EFN A;  1D0X A;  5D7U A;  1H3H A;  3QSU A;  4PKC C;  2RF0 A;  1WNL A;  4IUU A;  4KGV B;  4PJO F;  2OAU A;  3M4G A;  4HCZ A;  4R56 A;  3BDU A;  3M57 A;  4WF2 A;  3TQ7 P;  1KC8 R;  5GMK m;  3ZFJ A;  1Q7Y U;  4XU3 A;  4FW2 A;  1HSQ A;  2RHI A;  4M7A F;  2HBW A;  1U1T A;  1WHH A;  2DYB A;  5FW9 A;  3LYI A;  4PJO B;  3EH2 A;  3OW2 P;  5GAN e;  3JCM Q;  3J81 E;  2LRQ A;  1UGP B;  3EFO B;  4JDS A;  2M0Y A;  5KYU B;  1ZUK A;  3CC4 A;  4IUT A;  5CKD A;  1OZ3 A;  1QCO A;  1WQW A;  3SD4 A;  4MZP A;  3LH0 A;  1VQ4 Q;  3OYK A;  1M8V A;  2H3J A;  4XTU A;  3G71 T;  4XTZ A;  3OYH A;  2K3B A;  2RHX A;  4Z89 A;  1NEB A;  1J3T A;  3CBM A;  1MND A;  2VVK A;  2EQU A;  1BI0 A;  1MMN A;  2GTO A;  3BY7 A;  2WSC E;  3PVL A;  5A0L A;  1KC8 C;  1AZE A;  3BW1 A;  1VQM A;  2LTO A;  2VKN A;  4C92 A;  1Z9Q A;  4NS5 A;  3SHW A;  2EKH A;  3VKI A;  1OYX A;  1HJD A;  2GFU A;  1RUW A;  3EAE A;  4J9H A;  3PTA A;  2OTJ T;  3IQL A;  4B9X A;  3NPF A;  2F2W A;  1VQM Q;  1Q82 R;  2ABL A;  2CP6 A;  1M8M A;  1PRM C;  1WGS A;  2MOX A;  2HQH A;  1JO8 A;  3G6E T;  3H0F A;  3UAT A;  3CC4 T;  1S72 Q;  2MMP A;  2QQS A;  3MO8 A;  3URG A;  2DO3 A;  3CCR Q;  1H3Z A;  1AZG B;  3JCM V;  3KFV A;  1YI2 Q;  2E6Z A;  2JT4 A;  1QVG S;  1AWX A;  1RAF B;  2FEI A;  5CVI A;  1M27 C;  1Y0M A;  2I0N A;  2R5M A;  4J7I A;  2D6F A;  3VS6 A;  2E3H A;  1ARK A;  3RKX A;  1YBY A;  2DM1 A;  1W4S A;  2F5T X;  1M2V A;  2CT4 A;  2E70 A;  2R58 A;  1UUE A;  1K9M C;  4WCI A;  2EQI A;  4Z8A A;  5GAO p;  4BI8 B;  4LUD A;  1M30 A;  2DMO A;  4C8Q D;  3CPF A;  2KNB B;  4OMQ A;  1VQ9 T;  1D0Z A;  3S3O A;  1RI9 A;  2QTV A;  3VYH B;  3OYL A;  2O9S A;  3L2V A;  2CZ7 B;  3CBP A;  1BIB A;  4D6W A;  3JB9 I;  4LDX A;  2OX7 A;  4QVC A;  3L2Q A;  3JB9 F;  2DYI A;  3GBQ A;  5KCO A;  3MHX A;  1NEG A;  2JMC A;  3CCJ A;  1Q7Y R;  5J3B A;  5LJ3 d;  4PJO D;  2RJC A;  2MCN A;  1ZBX A;  1JBM A;  2HNI A;  4F7U F;  2HD0 A;  1BBZ A;  1IGQ A;  4RTT A;  4E47 A;  3JCM J;  4NOY A;  1ZSZ C;  1TSF A;  4ELY C;  4M75 E;  1YCS B;  1OEB A;  1M90 U;  1I1J A;  4FT2 A;  2ZZD A;  4MMK A;  1VQL Q;  4PK4 A;  5GMK i;  3FJ5 A;  3G71 A;  3HSB A;  1M3B A;  5LJ5 g;  1VQ5 T;  4XU2 A;  2XDB A;  2NYS A;  4M78 F;  4OB2 B;  4PJL A;  2DE0 X;  2E10 A;  5GAM j;  1OUL A;  1UDL A;  5LJ3 e;  1YWP A;  1N8R R;  2GQI A;  3I56 Q;  2B86 A;  2GGR A;  3PGG A;  4RTZ A;  4C0D C;  2E1H A;  2DL8 A;  4J5Y A;  3RDV A;  3EG3 A;  2AHJ B;  5CQX A;  3PE0 A;  3FIF A;  3ME9 A;  2A36 A;  2BZY A;  1K73 C;  2LDM A;  1B07 A;  5IHK A;  1WHK A;  2JJ9 A;  2PUO B;  1YIJ T;  1D1C A;  2K4Y A;  3LH5 A;  3CC2 A;  4ZGE B;  3DB3 A;  1C0M A;  4IUV A;  1CSK A;  1YWO A;  1M1K R;  4PFO A;  2P0K A;  1TH7 A;  2G6F X;  4AFQ C;  4KUL A;  1W1F A;  2PTK A;  2X4Y A;  2E65 A;  1FMW A;  1Z9Z A;  3I55 Q;  4M77 F;  2KAF A;  2RD1 A;  5CR2 A;  3VJP A;  4F7U G;  3VRZ A;  3CMA Q;  2DA9 A;  3QII A;  5GAN h;  2FZC B;  2JS2 A;  1M90 R;  3LGF A;  2KRN A;  5GMK e;  3M0P A;  5A0D A;  4FYY B;  3VU3 C;  1ZQ1 A;  2LCC A;  3X28 B;  2KK4 A;  5L8R E;  1G5V A;  1AD5 A;  1FMK A;  4E7S A;  5L23 A;  4M7A D;  2DIL A;  2PUK B;  2WAC A;  1BI3 A;  4GLM A;  3CQT A;  2M0O A;  4J9F A;  1WA7 A;  2EGE A;  5FU7 C;  3CD6 A;  1PHT A;  4XTX A;  4GY5 A;  1GCP A;  4PFP A;  3CD6 T;  2CH4 A;  1EIF A;  2ZPI B;  1YI2 A;  2QQR A;  1BK2 A;  5CO7 A;  4EPC A;  2X9H A;  3MCA B;  2YRC A;  2JTM A;  3EHR A;  1Q82 U;  4AFU C;  3BFM A;  3CCE A;  1IO6 A;  2KSS A;  4E7H A;  3HHT B;  4EDU A;  2XI9 A;  2HMA A;  2KQW A;  2VYT A;  4BE2 A;  2DAQ A;  4OGC A;  1BCM A;  2RI5 A;  5KCH A;  4OB1 B;  3CCE Q;  3E9F A;  1C6V X;  2EAY A;  1Y57 A;  4AG1 C;  3CME T;  4CC7 A;  2XKO C;  1RLP C;  3CC2 Q;  3CCE T;  1KQS A;  2OTL A;  4LNP A;  2E5Q A;  3QJY A;  1VQ5 A;  3QJ6 A;  2M02 A;  1TU0 B;  3CXC P;  4MDX A;  1I5O B;  2KT1 A;  3HFO A;  3PFS A;  2P84 A;  2BKD N;  3CCR A;  2DRM A;  4DBR A;  2LQN A;  1ACM B;  4R55 A;  1OU9 A;  2L3Q A;  2HCK A;  3OYE A;  4PNO A;  2L3R A;  5CIU A;  5DLQ E;  1ABQ A;  1IB8 A;  5FRO A;  3FC3 A;  3MEA A;  1AVZ C;  1BCO A;  2QTX A;  3CCQ A;  2XIC A;  1ZA2 B;  3I35 A;  3G4S T;  1G2B A;  4ZTJ A;  2YSQ A;  4M7D C;  2A3L A;  4RMO A;  1QLY A;  5LJ3 f;  3V8K A;  2YUP A;  2QEX A;  2NUT A;  1VQ6 Q;  1W2B S;  1MV0 B;  1PG5 B;  1W70 A;  2FB7 A;  3CD6 Q;  2ZGW A;  3H8Z A;  3VS2 A;  2V8I A;  4JLI A;  4QVZ A;  1QMC A;  2FO0 A;  1I81 A;  1Y96 B;  3REA B;  1M3C A;  3HTR A;  2QEX T;  2R5A A;  4C8Q B;  4LD9 K;  3M0U A;  3EGD B;  1WXU A;  4OF1 A;  1M3A A;  1UFF A;  1B34 B;  2QQ9 A;  1QCF A;  1SPK A;  2HQX A;  5KYY A;  1VQ7 A;  2EYX A;  2C0O A;  2DX1 A;  1N6A A;  4HVU A;  3CCS A;  1JXO A;  4XTV A;  2DER A;  4E7Z A;  2GCX A;  2RM4 A;  3RES A;  3N5B B;  1HYO A;  3AHU A;  2KRO A;  5GAN f;  2K79 A;  4MDW A;  4OB0 B;  4LD6 A;  3L2W A;  5AT1 B;  1OV3 A;  1JXM A;  2L3P A;  5KYX A;  2RMO A;  1QVF S;  1OZ2 A;  2O01 E;  5AYF A;  1Q86 C;  1GFC A;  3TVT A;  1YJ9 T;  1NYG A;  2JTE A;  4M77 A;  1R8O B;  4N0A A;  1D0Y A;  4ANJ A;  4KRT A;  3CCU A;  2HZY A;  4C5E A;  4F7U A;  2E4H A;  5GAN 5;  3OYG A;  5CKE A;  2CSI A;  3CME A;  2DXB A;  1WZO A;  4X1V A;  2D0N A;  2L5Q A;  8AT1 B;  3CCM T;  1KG1 A;  1QKW A;  4HXJ A;  1YCY A;  3JSC A;  3NMZ C;  3OSS C;  3VS4 A;  1T0J A;  1ZX6 A;  2DD5 A;  1KHI A;  2WSE E;  1X69 A;  2CZ6 B;  4XTY A;  4E7L A;  1IRX A;  2DL7 A;  3AT1 B;  4JJB A;  4OMF B;  2X3W D;  1Q82 C;  2HSE B;  2JMA A;  5GAN 3;  1X01 A;  2EJF A;  2L3S A;  2A08 A;  3CC7 A;  1YJW Q;  2VV5 A;  5D6X A;  2LNH B;  3CBO A;  1C1A A;  1G8X A;  2E6N A;  1YIJ Q;  1PC0 A;  1YNZ A;  2X3X D;  3E19 A;  2C06 A;  1N9S A;  2ATC B;  4DBF A;  4J83 A;  1QWF A;  3HKS A;  2KRM A;  1YJ9 A;  3OA6 A;  1CKA A;  3CC7 T;  3M0S A;  4RUG A;  1WXB A;  3M5A A;  1XQH A;  1SF9 A;  1ZA1 B;  1VQL A;  1QVG P;  4DOW A;  1GFD A;  2DFU A;  2OJ2 A;  1FYN A;  3GOX A;  4IUQ A;  4J6W A;  3QZ5 B;  2A28 A;  3V7C A;  2RK2 A;  4DEX A;  4QKU A;  4JLG A;  2LC4 A;  4D8K A;  1X75 C;  1TOV A;  2LJ0 A;  4F14 A;  1W6X A;  2QI2 A;  2LT1 A;  1KQS P;  3CCL T;  2CP5 A;  4BE0 A;  2QAS A;  3VYG A;  2PU9 B;  3CCL A;  4JS4 A;  4M7A B;  1X43 A;  1IZ6 A;  2QG9 B;  4F7U E;  4FYW B;  4OMP A;  5GJW B;  1LPL A;  3X26 B;  2KEA A;  2X4W A;  4M77 G;  4BE1 A;  4JS5 A;  3C95 A;  5GAM e;  1M1K C;  4RKU E;  3L2R A;  1VQ7 T;  3GNG A;  2AKK A;  3H0I A;  4UC4 A;  1AT1 B;  5CKB A;  2NUP A;  3QKJ A;  1PKS A;  2MYS A;  2X4X A;  2D1X A;  5GAN d;  2EIF A;  4KGX B;  3EFR A;  3C12 A;  4J6Y A;  2SEM A;  5CAI A;  2ZAE A;  2GTJ A;  1S1N A;  4BD3 A;  2PQW A;  4O6J A;  3UT1 A;  2RJD A;  2OAW A;  2YLC A;  1K8A U;  3OW2 S;  4L5G A;  1X6B A;  1M9S A;  1P92 A;  4A54 A;  2RI3 A;  1GCQ A;  1PD1 A;  2HEQ A;  4M7D F;  2AT1 B;  4FU6 A;  4ZN3 A;  3WVD B;  4M7D B;  1RL2 A;  1NE8 A;  3TSZ A;  2QA4 A;  3GLX A;  4E7K A;  4Y91 A;  2NWM A;  2RJE A;  3V8J A;  3H41 A;  4JJN K;  2KVQ G;  4C8Q A;  2RH2 A;  3A8G B;  4QT7 A;  3C94 A;  2QQA A;  1BYM A;  2M51 A;  2X4J A;  1X2Q A;  5KYU A;  3EFO A;  5GJV B;  2D8H A;  4ZTF A;  1YJW T;  1RI0 A;  4J6X A;  2LJ3 A;  5KYN A;  4HCB A;  2CT3 A;  4DBH A;  1E6G A;  4OMO A;  2V8J A;  2J6O A;  1K9M R;  2O31 A;  2VXF A;  2YLB A;  3M53 A;  1VQN Q;  4PJM A;  3RKY A;  5GAM h;  1Q86 R;  1SKU B;  2H8H A;  4IUR A;  1I5L A;  2FPE A;  1OX9 A;  3CCS Q;  2JOY A;  1X2K A;  2VWF A;  3QYH B;  2AZS A;  2C0T A;  1MMG A;  4CC2 A;  2MK5 A;  2GFA A;  3MP1 A;  3A1P A;  2DET A;  1VQO Q;  2QQB A;  3OS5 A;  2J6K A;  2L89 A;  4BDZ A;  3FRN A;  1PD0 A;  5C0M A;  2PZ1 A;  3ZBD A;  4A53 A;  4JPB W;  1BI2 A;  1QP2 A;  3GIB A;  2NUZ A;  3JCM X;  2GQV A;  1HK9 A;  2DZC A;  1GRI A;  3VUZ A;  3R6N A;  2HKN A;  3CCL Q;  2EJ9 A;  2K3X A;  2LP5 A;  2XDP A;  2O4X B;  3DKM A;  3JB9 J;  1U8R A;  4M7D G;  4BY6 B;  1R0C B;  1TG0 A;  2V26 A;  2CSQ A;  4M77 B;  5IT9 E;  3OYI A;  2AKL A;  2JVV A;  2YXY A;  2K2V A;  4PFZ A;  5GAN j;  2JZ2 A;  3UA7 A;  3X20 B;  4EMH A;  4A63 B;  4M75 A;  1KK7 A;  3A8L B;  3OYA A;  1BB9 A;  5KYW B;  2BZ8 A;  1S72 A;  2ZPE B;  4LUE A;  3O8V A;  3F70 A;  1OI1 A;  1WIE A;  1VQ4 T;  4MML A;  1ZSZ A;  1NJI C;  5KYX B;  4AFS C;  4EMK C;  1K8A R;  1PM3 A;  1YJN A;  4HCK A;  3H0H A;  3CME Q;  2V8K A;  3KUF A;  4EMK B;  4OMM A;  2GF7 A;  1VQK A;  3I55 A;  4M7D D;  4M7A E;  5LJ5 j;  2LMJ A;  1G3T A;  1K1Z A;  4F7U B;  2AK5 A;  2LX7 A;  1T0H A;  4A4H A;  4JRP A;  5DLO A;  3RIR A;  2FZG B;  1WPY A;  4JRI A;  5LJ3 g;  3OYN A;  1D1B A;  1K4U S;  3L2U A;  3S3N A;  2QDY B;  4NL2 A;  1FWZ A;  3WXM B;  3M58 A;  4X34 A;  2FL7 A;  3S6W A;  4M78 C;  1UB4 A;  1QVF A;  3EG9 A;  4M4Z A;  1LCK A;  1NPR A;  1YIT T;  1R0B G;  2DEU A;  4OB3 B;  1MV3 A;  3NTK A;  2F1L A;  4M78 B;  4C0Z A;  2XDD A;  3UA6 A;  1KQ2 A;  3PMI A;  2DF6 A;  4RTY A;  3RKW A;  4DQ2 A;  3HFN A;  1K0S A;  2L8D A;  2J6F A;  9ATC B;  5GAN 8;  1VQP Q;  3DLM A;  5CKH A;  5KE3 A;  2CDT A;  5D6Y A;  3ER0 A;  1U5S A;  2RHZ A;  2VAS A;  3QWY A;  3G7Z A;  2G3R A;  4C5H A;  4C92 B;  5LJ5 f;  1TUD A;  1YHQ Q;  2NUT B;  1N5Z A;  3ULR B;  3JCM e;  1ABO A;  3CCM Q;  5FRM A;  2JS0 A;  2QGF B;  3C4S A;  1YHQ T;  1I07 A;  2C0I A;  2EQJ A;  2PVD B;  3CCR T;  1WQ7 A;  2XHC A;  3Q1J A;  4XU1 A;  3M59 A;  1X27 A;  3EGX B;  1VYT A;  3VS5 A;  2P0P A;  3RNJ A;  1VQ9 A;  2BUD A;  4J8O A;  4YTL A;  1AEY A;  1ZHI A;  4M7D A;  1X6G A;  5GAO l;  1SSF A;  3THK A;  1PCX A;  1UJY A;  3MP8 A;  3OQ5 A;  4GLK A;  1Q7Y C;  3MPU B;  3MET A;  5GAO r;  3UDC A;  5HY6 A;  3A8O B;  4MZM A;  7AT1 B;  3U23 A;  1VQL T;  5I22 A;  2LQK A;  4E2F B;  1T3L A;  3BDL A;  1WFW A;  4Y92 A;  3A8H B;  2DLP A;  2DNU A;  1EX4 A;  1K73 R;  5LJ3 j;  2YWW A;  1WJS A;  2KGT A;  1LNX A;  2MWO A;  1FXX A;  2KBT A;  3E9G A;  3EG2 A;  4EMG A;  3EG1 A;  4J9B A;  1F1B B;  2QGG A;  4GBQ A;  2XG8 D;  2MWP A;  2MIO A;  1XJW B;  2X51 A;  1KQ1 A;  1VUB A;  2VGM A;  4MZT A;  2V1Q A;  1KC8 U;  2HAX A;  3INZ A;  5KE2 A;  1PSF A;  3M0R A;  3TU4 K;  3VS3 A;  2BTT A;  1SHF A;  3OYJ A;  4JUV A;  3J7A F;  2CKK A;  1RAH B;  1PSE A;  4BI3 A;  4XU0 A;  3M0T A;  4CC3 A;  3TSW A;  1BU1 A;  2DL4 A;  2DXU A;  4C8Q E;  5C6S A;  1OPK A;  2LVM A;  4RCB A;  1B7T A;  1JB0 E;  4VUB A;  4B6M A;  1WHM A;  3PT9 A;  4M78 A;  2RQW A;  2KR3 A;  4M75 G;  1NZ9 A;  3X24 B;  5ECA A;  1JEG A;  3EGX A;  5IHN A;  4M78 D;  2K7A A;  2FRY A;  4K11 A;  4PJO E;  3P8B B;  5GMK j;  2ZPB B;  5HKC A;  1K0X A;  4M75 B;  2JW4 A;  1ZLM A;  2F5K A;  3JAM E;  3A5Z B;  2CS7 A;  3SWN C;  3G71 Q;  4C5G A;  2HDA A;  3MJX A;  4FYV B;  1KD1 U;  4M75 D;  2VC8 A;  5IN1 A;  4DBQ A;  4HCC A;  4KT0 E;  4DEY A;  4M7A C;  1RAE B;  2OI3 A;  3ZL7 C;  1KHC A;  1Q81 U;  3LW5 E;  2DTH A;  3CCV T;  4QQD A;  3R6O A;  2EVR A;  1D3B A;  3V8L A;  2BZX A;  2JNG A;  1Y71 A;  1U06 A;  3RUX A;  4PJO C;  2OTL Q;  1QWE A;  3L42 A;  2YDL A;  2QXF A;  2O88 A;  2R57 A;  4M7A G;  3QWX X;  2ROT A;  4F16 A;  2A0F B;  1MUZ A;  4JJC A;  3OYF A;  2RQV A;  1ZSG A;  4M77 C;  3CCU Q;  4C8Q F;  3EFS A;  4M78 E;  2D8J A;  4J7F A;  3OS2 A;  3EG0 A;  3EGD A;  3J80 E;  5I21 A;  3A8M B;  4A4F A;  1U3O A;  3OYB A;  2FPD A;  1D1A A;  1UGS B;  1UEC A;  4ELZ C;  3VS1 A;  5GAN 7;  4FSX A;  5CKF A;  4JRQ A;  1O75 A;  1Y07 A;  2HBP A;  4JRK A;  1N8R C;  1LVK A;  5KYY B;  2E12 A;  1N9R A;  2JM8 A;  4ZN1 A;  2NUP B;  2Y90 A;  3H6Z A;  2OTJ Q;  3FEO A;  1W2B A;  3CPW A;  3BE3 A;  1SSH A;  4XQ3 A;  1WDX A;  1KJW A;  4QVD A;  5CCA A;  2H3E B;  4EMK A;  3PNW C;  2O2O A;  2A37 A;  3G6E Q;  2LJ1 A;  5I11 A;  4B9W A;  3CMA A;  3NTI A;  3SDZ A;  2FPF A;  4X9C A;  3QPH A;  4LDU A;  5FU7 B;  4BUG A;  1VQ8 T;  2DJQ A;  2JTF A;  1VQ7 Q;  1SHG A;  4IKF A;  4ZNX A;  1M4Z A;  2CZ0 B;  4FCY A;  3OBY A;  3ZEH A;  4HVV A;  1RAI B;  2E3I A;  2O9V A;  1IRE B;  5GAO m;  2F2V A;  4Z88 A;  2E5K A;  2HQE A;  2YUQ A;  1GXI E;  3TRE A;  2AZV A;  2AIR B;  3OY9 A;  2CUD A;  2CYZ B;  1K73 U;  3OMG A;  2RHY A;  2ZPG B;  1LJO A;  2PNI A;  3P8D A;  1YJ9 Q;  2RQT A;  4L6V 5;  4E7I A;  1M1F A;  1QCN A;  4ORZ A;  2K57 A;  2RB6 A;  3JV3 A;  3SWN B;  2KY9 A;  3I9Q A;  2CUB A;  1VQP A;  5A0G A;  3M0Q A;  3CCQ Q;  4AMC A;  1Q81 R;  3QHS A;  2FVU A;  2XMF A;  3EH1 A;  2B8A A;  2MF2 A;  3CXC A;  2EYQ A;  2RN8 A;  2KDS A;  2KRS A;  4ME7 A;  4OMN A;  1RAA B;  5LL6 S;  3JRZ A;  2YUN A;  3X25 B;  4BAC A;  3GP8 A;  3JCM d;  1VQ8 A;  4LN2 A;  2E64 A;  2YRV A;  3JCM g;  1UEB A;  1WHG A;  5CK9 A;  2M9U A;  4AT1 B;  3VUB A;  5LJ5 e;  2CZ1 B;  1KQS S;  1HXD A;  1VIE A;  3P8H A;  1UGQ B;  1WJR A;  2CP3 A;  2EFI A;  1EZZ B;  2XK0 A;  1I0C A;  1UGV A;  1X6O A;  1G3S A;  5IXB A;  2HL3 A;  4M78 G;  4ZGJ B;  3PIO A;  4M77 D;  3OBW A;  2DK3 A;  2O4X A;  4OML A;  2L2P A;  1KD1 C;  3G4S Q;  3JCM c;  4XAX B;  1TS9 A;  3SWN A;  3G6E A;  4X9D A;  4N4G A;  2L0A A;  2RO0 A;  1QQJ A;  2P0Q A;  2V1R A;  3EGU A;  1MNE A;  1Q81 C;  2M1H A;  4C92 G;  4M77 E;  2ED1 A;  2KMT A;  4BDY A;  3OYY A;  1U1S A;  2DVE A;  3QDR B;  5IXF A;  1M2O A;  3LGL A;  2LX9 A;  3QDF A;  2M16 A;  1M90 C;  3M4Y A;  5LJ5 d;  1NM7 A;  3TEE A;  1V1C A;  2LQ8 A;  4E6R A;  3CCV A;  1VQ9 Q;  1OOT A;  1V29 B;  2WSF E;  1BI1 A;  1VQN A;  1YP5 A;  1FMV A;  2DD4 A;  4C92 D;  3VRY A;  4RCC A;  3VS0 A;  1RAB B;  3CMA T;  3CCQ T;  1VQO T;  4OVA A;  1VA7 A;  1UGR B;  3VV0 A;  1M1G A;  1WHJ A;  2IIM A;  4RTW A;  1AWW A;  2XU8 A;  2XD0 A;  4HA8 A;  2RJF A;  5LJ5 h;  4C92 C;  4KH1 B;  1QW1 A;  4FT4 A;  2EW3 A;  4F17 A;  3A98 A;  2VGN A;  3FDR A;  2RI2 A;  1AWO A;  1JRI A;  1A0N B;  4CI0 C;  5FU6 C;  3HPW A;  2EGC A;  3H9N A;  2F2X A;  4LE9 A;  4N4I A;  1TUC A;  5FRN A;  5I2S A;  5GAO q;  4OGE A;  2E41 A;  4KBM B;  4LDW A;  4C0G A;  2KXD A;  2VUB A;  1G3W A;  5A2Q E;  1VQP T;  3I55 T;  4M75 F;  2VB6 A;  4N4H A;  2CP2 A;  4A4E A;  4J9G A;  1IGU A;  3FB9 A;  3MEU A;  4JJD A;  1YIJ A;  4FM4 B;  1YI2 T;  2DBK A;  2RPN A;  1WI7 A;  1UHF A;  3KXT A;  2FYK A;  3I56 T;  4WTO B;  1WXT A;  1AWJ A;  1MMD A;  3JCM f;  4O5V A;  2QDL A;  1D09 B;  1OX8 A;  2OTJ A;  1YJN Q;  2MAM A;  2LCS A;  4Y28 E;  1YFN A;  1OPL A;  2W10 A;  3OSV A;  2DZ9 A;  4AFZ C;  2FRW A;  2MI6 A;  3M54 A;  1W2B P;  4CRI A;  2K3Y A;  4RTX A;  1MGQ A;  2ZCF B;  1H64 1;  4PL6 A;  5HK0 A;  3JB9 G;  2K2M A;  3G1J A;  1TWB A;  5GAM g;  3V7S A;  3HRU A;  1H92 A;  2PVO B;  1I4K 1;  4JZ3 A;  2ZPH B;  3OYD A;  1JJ2 P;  1CKB A;  5EC7 A;  1RLQ C;  4FIB A;  2EYZ A;  1SRL A;  3RBB B;  1E7O A;  3CCM A;  2LCL A;  1IHW A;  1B3Q A;  2Y4X A;  3DB4 A;  2DVJ A;  2QK0 A;  3QBY A;  1ZUU A;  4PJO G;  2HKQ B;  4IIM A;  1HD3 A;  2COW A;  2CRE A;  3NFC A;  3PMT A;  3V7R A;  3JCM W;  2X35 A;  1T3S A;  4KGZ B;  5GAO n;  1YIT Q;  2EYW A;  3HRS A;  3T9N A;  4C8Q G;  3CPW S;  1IXD A;  2PVG B;  3JCM P;  3KBG A;  2BIV A;  1QVP A;  1VQO A;  3OYC A;  2DIQ A;  1YHQ A;  3RER A;  1YN8 A;  2EQM A;  4FSS A;  4PLI A;  2YT6 A;  4PLL A;  1ZSZ B;  3LLR A;  4L59 A;  4HKE A;  2BE7 D;  5KYW A;  1VQN T;  2HSP A;  5LJ3 h;  3SFM A;  3MEW A;  1S72 T;  1M5Q 1;  2EYY A;  1GBR A;  1O9S A;  4C8Q C;  4RTU A;  3CCU T;  5FWC A;  2ENM A;  2NLU A;  4C0F A;  4N0A C;  3JB9 H;  1RAC B;  3QG1 A;  2DL3 A;  1SRM A;  1G83 A;  1VQK T;  1N8R U;  3TCJ A;  2DJZ A;  4AG2 C;  3LWH A;  2QAZ A;  1TXQ A;  1VQ6 T;  1VQK Q;  4J9D A;  3GPL A;  2QA4 Q;  1NLO C;  4JZ4 A;  4J9E A;  3SB2 A;  4C5I A;  3FJP A;  1WJQ A;  3GF5 A;  1KIK A;  1MMA A;  3MP6 A;  4HT9 A;  1E6H A;  2J06 A;  2JXB A;  3VS7 A;  5IAY A;  2DBM A;  4F04 B;  1G3Y A;  3EG9 B;  5HCK A;  4C92 F;  1JQQ A;  2RA2 A;  3I5R A;  5J26 A;  5GMK h;  2QEX Q;  3FLG A;  1M1K U;  1BIA A;  1VYV A;  3CEY A;  3MEV A;  3QO3 A;  3D7S B;  5IHI A;  2JUF A;  1VQ8 Q;  3CC4 Q;  2DRK A;  4QQ6 A;  2GBQ A;  3RR6 A;  1TUG B;  4M75 C;  2FZK B;  1VQ4 A;  3HP9 A;  1UG1 A;  2KE9 A;  2RNA A;  4HT8 A;  2ROL A;  3SEM A;  3G4S A;  1K76 A;  4BI4 A;  4KUD K;  8ATC B;  5GMK l;  1AHJ B;  3E1S A;  3OS0 A;  4ESR A;  4DOV A;  3C0C A;  1PNJ A;  3UF4 A;  3NHN A;  5EG2 A;  1NPP A;  1VOM A;  1K8A C;  3QXE B;  1OU8 A;  1QVG A;  1NJI R;  2XID A;  2ESW A;  1FX7 A;  4FL6 A;  3LX7 A;  3I56 A;  1Q86 U;  1QKX A;  2F69 A;  5DY9 A;  2DL5 A;  4BB7 A;  1SEM A;  1XNI A;  3QUI A;  1IHV A;  2J05 A;  2DPP B;  2FG0 A;  5I2M A;  1ZBJ A;  5HK3 A;  4PJO A;  2DXT A;  5J39 A;  2CP0 A;  3OMC A;  3JB9 D;  1UHC A;  2SRC A;  3NTH A;  2KYM A;  4RG8 A;  1NLP C;  4QW2 A;  1Y96 A;  3NGP A;  5DM7 R;  2D0Q B;  2LQW A;  3E2U A;  1RAD B;  3EHQ A;  2EKO A;  1QVF P;  2RQU A;  4II1 A;  6AT1 B;  1H8K A;  3CCV Q;  1GCQ C;  3L2Z A;  1KSW A;  2JM9 A;  1NG2 A;  1PKT A;  1PWT A;  1TTH B;  2I2L A;  2W0Z A;  4FYX B;  2Y4Y A;  3CCJ Q;  2RK1 A;  3L1A A;  4C0D B;  1VYU A;  2OTL T;  1KFZ A;  1WLP B;  2DTO A;  4R0K A;  2BE9 B;  1NYF A;  3M55 A;  1VQ5 Q;  5FU6 B;  1GBQ A;  2ED0 A;  4DA4 A;  4P5N A;  3REB B;  4J9I A;  4D8D A;  3DLL A;  3QZ9 B;  4EIK A;  1V76 A;  3UPU A;  3M56 A;  1D3B B;  4M7A A;  1WYX A;  4PJN A;  1JJ2 A;  4PJJ A;  1R77 A;  1KD1 R;  4M7D E;  2DIG A;  2J7I A;  2KXC A;  3UWN A;  1VQ6 A;  4A4K A;  2A7Y A;  2DTI A;  5GAM f;  4KH0 B;  5FLX E;  5KH6 A;  3HL8 A;  3JCM b;  2MPX C;  3OYM A;  3OB9 A;  2LNV A;  1YJW A;  3WVE B;  2ECZ A;  1B34 A;  4IIO A;  2CP7 A;  1PRL C;  2DEQ A;  2QYZ A;  3LWI A;  5IH2 A;  2LT4 A;  1OQK A;  2DKG A;  2YRD A;  1ZUY A;  2EBP A;  2FHD A;  2COY A;  2LZ6 B;  1N27 A;  1WHL A;  2K5F A;  4V2S A;  4LXC A;  4TVR A;  2P4R A;  2K5L A;  3CC2 T;  2EJG A;  5GAM d;  3PIP A;  3RMQ A;  1NJI U;  4XTW A;  4NL3 A;  4CC4 B;  2COZ A;  2CGH A;  1XOV A;  4OP0 A;  1Q95 G;  1DJ7 B;  5D6W A;  1UE9 A;  3OW2 A;  1GL5 A;  1Y7X A;  3GNF B;  2RHU A;  1WX6 A;  1M2V B;  4XK8 E;  2P4T A;  4QQG A;  4C92 E;  1XTD A;  4HVW A;  5GAN 4;  3CXC S;  2K5I A; 
#chains in the Genus database with same CATH homology
 3M4Y A;  5DLO A;  5LJ5 d;  3RIR A;  4JRP A;  3HFO A;  4MDX A;  3PFS A;  3TEE A;  2BKD N;  2VXE A;  5M9O A;  2LQ8 A;  3CCR A;  3CCV A;  1WPY A;  3CCS T;  2JN0 A;  4JRI A;  5LJ3 g;  3OYN A;  1V29 B;  2WSF E;  1BI1 A;  2IG0 A;  1VQN A;  4R55 A;  2DD4 A;  3L2U A;  4C92 D;  3OYE A;  4IUP A;  4PNO A;  4RCC A;  1VQM T;  1QP3 A;  4LDY A;  2L3R A;  2QDY B;  5CIU A;  3S3N A;  1K9M U;  3CMA T;  5DLQ E;  3CCQ T;  5FRO A;  4OVA A;  4NL2 A;  4Q5W A;  3MEA A;  3FC3 A;  4ZGD B;  1FWZ A;  4A4G A;  1UGR B;  3VV0 A;  1M1G A;  4KUI A;  5GAN 6;  2DXC A;  2QTX A;  3CCQ A;  2XIC A;  3WXM B;  4ATO A;  3M58 A;  4X34 A;  2XU8 A;  2XD0 A;  5GAN 2;  4HA8 A;  2RJF A;  2EQK A;  2FL7 A;  3S6W A;  4M78 C;  5LJ5 h;  3G4S T;  1UB4 A;  5GAN g;  4ZTJ A;  1QVF A;  1YIT A;  1MHN A;  4M7D C;  2A3L A;  4RMO A;  1NPR A;  4C92 C;  3HRT A;  1YJN T;  1QW1 A;  4FT4 A;  1YIT T;  3M9Q A;  2EWN A;  4OB3 B;  5LJ3 f;  3NTK A;  3V8K A;  3RMS A;  4RG2 A;  4M78 B;  4E7J A;  2VGN A;  3FDR A;  4C0Z A;  2RI2 A;  1JRI A;  2XDD A;  1KQ2 A;  2ZPF B;  4CI0 C;  2QEX A;  5FU6 C;  2D9T A;  3HPW A;  3PMI A;  4N4I A;  1W2B S;  3RKW A;  2IVW A;  3ASK A;  5FRN A;  4DQ2 A;  3HFN A;  2FB7 A;  5I2S A;  5GAO q;  3CCJ T;  4BY6 C;  2L8D A;  4OGE A;  2QA4 T;  2E41 A;  2YHT A;  2ZGW A;  4KBM B;  3H8Z A;  4LDW A;  5GAN 8;  1VIF A;  2V8I A;  4JLI A;  4C0G A;  3DLM A;  5CKH A;  3QYG B;  4LDV A;  5KE3 A;  5D6Y A;  2VUB A;  4QVZ A;  3OS1 A;  1G3W A;  3JCM h;  3ER0 A;  5A2Q E;  1I81 A;  1Y96 B;  2RHZ A;  1VQP T;  3G7Z A;  2G3R A;  4C5H A;  4C92 B;  5LJ5 f;  3I55 T;  1JJ2 S;  4M75 F;  2QEX T;  2R5A A;  3S3M A;  4C8Q B;  4N4H A;  4LD9 K;  4A4E A;  1BKB A;  1I8F A;  1LOJ A;  5CQY A;  3JCM e;  5FRM A;  4OF1 A;  4Z02 A;  1B34 B;  2QQ9 A;  3C4S A;  3FB9 A;  3MEU A;  1YIJ A;  1YHQ T;  2HQX A;  1VQ7 A;  2PVD B;  2EQJ A;  4FM4 B;  1YI2 T;  3CCR T;  1WQ7 A;  3QSU A;  2XHC A;  1N6A A;  3Q1J A;  4PKC C;  3KXT A;  2FYK A;  3I56 T;  1WNL A;  4XU1 A;  3CCS A;  3M59 A;  3JCM f;  4O5V A;  4IUU A;  4XTV A;  4PJO F;  2OAU A;  1M90 C;  2P0P A;  2OTJ A;  2GCX A;  2RM4 A;  3M4G A;  4HCZ A;  3RES A;  3N5B B;  4R56 A;  2BUD A;  2MAM A;  1VQ9 A;  3BDU A;  3M57 A;  3AHU A;  4Y28 E;  4J8O A;  3OSV A;  4YTL A;  4WF2 A;  5GAN f;  2DZ9 A;  5GMK m;  1ZHI A;  4M7D A;  2MI6 A;  1SSF A;  3ZFJ A;  5GAO l;  1Q7Y U;  3M54 A;  4MDW A;  4OB0 B;  4LD6 A;  4XU3 A;  3L2W A;  4CRI A;  3MP8 A;  3OQ5 A;  2K3Y A;  4GLK A;  1Q7Y C;  3MET A;  5GAO r;  3UDC A;  1MGQ A;  2RHI A;  5HY6 A;  2ZCF B;  3A8O B;  4MZM A;  4M7A F;  1U1T A;  1QVF S;  1H64 1;  4PL6 A;  5HK0 A;  3JB9 G;  1VQL T;  1OZ2 A;  2O01 E;  5AYF A;  1Q86 C;  3LYI A;  5GAM g;  2LQK A;  3V7S A;  3HRU A;  4PJO B;  3BDL A;  5GAN e;  3JCM Q;  3J81 E;  1YJ9 T;  2LRQ A;  2PVO B;  1I4K 1;  1UGP B;  3A8H B;  2ZPH B;  4JDS A;  3OYD A;  4M77 A;  1R8O B;  4N0A A;  4FIB A;  3CCU A;  3CC4 A;  4IUT A;  4C5E A;  4F7U A;  3CCM A;  2LCL A;  5CKD A;  5LJ3 j;  1OZ3 A;  1WJS A;  5CKE A;  5GAN 5;  3OYG A;  1WQW A;  2Y4X A;  1LNX A;  2MWO A;  2DXB A;  3DB4 A;  1FXX A;  3LH0 A;  4MZP A;  2L5Q A;  3QBY A;  3SD4 A;  4PJO G;  3CCM T;  3E9G A;  3OYK A;  4EMG A;  1KG1 A;  3CME A;  1M8V A;  2XG8 D;  1YCY A;  3NFC A;  3JSC A;  3OSS C;  3PMT A;  2MWP A;  2H3J A;  3V7R A;  4XTU A;  3G71 T;  3JCM W;  4XTZ A;  3OYH A;  1KQ1 A;  2DD5 A;  2X35 A;  1KHI A;  2WSE E;  2CZ6 B;  1VUB A;  2RHX A;  2VGM A;  4XTY A;  3CBM A;  4MZT A;  1KC8 U;  4E7L A;  5GAO n;  2HAX A;  2EQU A;  3INZ A;  1BI0 A;  3BY7 A;  1PSF A;  5KE2 A;  4OMF B;  2WSC E;  3HRS A;  5A0L A;  1KC8 C;  3TU4 K;  1Q82 C;  3T9N A;  4C8Q G;  3CPW S;  5GAN 3;  2PVG B;  3BW1 A;  1X01 A;  2EJF A;  1VQM A;  2LTO A;  3CC7 A;  3OYJ A;  4JUV A;  3KBG A;  3JCM P;  3J7A F;  2BIV A;  1QVP A;  1VQO A;  3OYC A;  2DIQ A;  2VV5 A;  2CKK A;  4C92 A;  5D6X A;  1YHQ A;  2EQM A;  1PSE A;  3RER A;  4PLI A;  4PLL A;  4BI3 A;  4XU0 A;  4NS5 A;  3VKI A;  3CBO A;  1OYX A;  3LLR A;  4L59 A;  2GFU A;  4HKE A;  2E6N A;  2DXU A;  4C8Q E;  3EAE A;  5C6S A;  2LVM A;  1VQN T;  3PTA A;  3E19 A;  5LJ3 h;  4RCB A;  2C06 A;  2OTJ T;  1JB0 E;  4VUB A;  4B9X A;  1N9S A;  3PT9 A;  4J83 A;  3SFM A;  3HKS A;  3MEW A;  4M78 A;  1YJ9 A;  3OA6 A;  4M75 G;  1M5Q 1;  1S72 T;  1NZ9 A;  3X24 B;  1O9S A;  1WGS A;  3CC7 T;  4C8Q C;  3G6E T;  4M78 D;  3CC4 T;  3M5A A;  3CCU T;  1XQH A;  2MMP A;  2QQS A;  3P8B B;  3MO8 A;  3URG A;  5GMK j;  2NLU A;  4C0F A;  2DO3 A;  2ZPB B;  4PJO E;  4N0A C;  5HKC A;  3JB9 H;  1H3Z A;  3QG1 A;  1VQL A;  3JCM V;  4M75 B;  4DOW A;  2E6Z A;  2F5K A;  1QVG S;  3JAM E;  3A5Z B;  2CS7 A;  3GOX A;  5CVI A;  3SWN C;  4IUQ A;  1VQK T;  1N8R U;  4C5G A;  4J6W A;  3TCJ A;  1KD1 U;  2DJZ A;  3QZ5 B;  3V7C A;  3LWH A;  2RK2 A;  4M75 D;  2VC8 A;  5IN1 A;  2R5M A;  4J7I A;  2D6F A;  4JLG A;  4HCC A;  1VQ6 T;  2LC4 A;  1X75 C;  4KT0 E;  4M7A C;  3GPL A;  3RKX A;  2QI2 A;  2LT1 A;  1YBY A;  3SB2 A;  4C5I A;  3CCL T;  4BE0 A;  3FJP A;  1WJQ A;  1W4S A;  1KHC A;  3GF5 A;  1Q81 U;  3LW5 E;  2DTH A;  3VYG A;  3MP6 A;  2PU9 B;  3CCV T;  2F5T X;  3CCL A;  4QQD A;  4HT9 A;  3R6O A;  4M7A B;  2E70 A;  4JS4 A;  1D3B A;  2R58 A;  5IAY A;  1K9M C;  3V8L A;  1IZ6 A;  2JNG A;  1G3Y A;  1Y71 A;  4F7U E;  4C92 F;  5GAO p;  2RA2 A;  4BI8 B;  3RUX A;  4PJO C;  5J26 A;  4C8Q D;  5GMK h;  3CPF A;  3X26 B;  3L42 A;  3CC2 T;  2X4W A;  1VQ9 T;  4M77 G;  4BE1 A;  3S3O A;  3VYH B;  3OYL A;  4JS5 A;  3FLG A;  1M1K U;  3C95 A;  1BIA A;  2QXF A;  3L2V A;  2CZ7 B;  3CBP A;  1BIB A;  3CEY A;  4D6W A;  5GAM e;  3JB9 I;  2R57 A;  4LDX A;  3MEV A;  3QO3 A;  4RKU E;  3L2R A;  1M1K C;  4M7A G;  4QVC A;  3L2Q A;  1VQ7 T;  3JB9 F;  2JUF A;  5KCO A;  3GNG A;  3MHX A;  3OYF A;  4M77 C;  3CCJ A;  4C8Q F;  5J3B A;  5LJ3 d;  3EFS A;  4QQ6 A;  4M78 E;  4J7F A;  4UC4 A;  3OS2 A;  5CKB A;  2RJC A;  3QKJ A;  4M75 C;  1VQ4 A;  1ZBX A;  3HP9 A;  4PJO D;  2X4X A;  3J80 E;  5GAN d;  4HT8 A;  2EIF A;  5I21 A;  3G4S A;  1JBM A;  3EFR A;  3C12 A;  3A8M B;  2HNI A;  4J6Y A;  4A4F A;  4BI4 A;  4F7U F;  2HD0 A;  4KUD K;  3OYB A;  5GMK l;  1AHJ B;  3E1S A;  1UGS B;  4E47 A;  4ELZ C;  3JCM J;  4NOY A;  3OS0 A;  5CAI A;  4DOV A;  4ELY C;  5GAN 7;  4M75 E;  4BD3 A;  2PQW A;  4O6J A;  1M90 U;  3UT1 A;  2RJD A;  4FSX A;  5CKF A;  4JRQ A;  1O75 A;  2YLC A;  5EG2 A;  1Y07 A;  2HBP A;  1K8A U;  1NPP A;  4FT2 A;  4JRK A;  2ZZD A;  4MMK A;  3OW2 S;  1N8R C;  4L5G A;  1K8A C;  2E12 A;  3QXE B;  1QVG A;  1N9R A;  2XID A;  4ZN1 A;  1M9S A;  1FX7 A;  4FL6 A;  1P92 A;  2Y90 A;  3H6Z A;  4A54 A;  3LX7 A;  5GMK i;  3I56 A;  3FEO A;  2RI3 A;  1W2B A;  3CPW A;  3G71 A;  4XQ3 A;  1Q86 U;  3HSB A;  4QVD A;  5LJ5 g;  5CCA A;  1VQ5 T;  4M7D F;  2F69 A;  4FU6 A;  4XU2 A;  4ZN3 A;  5DY9 A;  3PNW C;  4EMK A;  2XDB A;  4BB7 A;  1XNI A;  4M78 F;  3QUI A;  4OB2 B;  3WVD B;  4M7D B;  2DPP B;  2E10 A;  5I2M A;  5GAM j;  5HK3 A;  1RL2 A;  4B9W A;  5LJ3 e;  4PJO A;  2DXT A;  1NE8 A;  3CMA A;  3NTI A;  3SDZ A;  4X9C A;  5J39 A;  3GLX A;  3QPH A;  4LDU A;  4Y91 A;  2QA4 A;  4E7K A;  3OMC A;  2RJE A;  5FU7 B;  4BUG A;  3JB9 D;  1VQ8 T;  2JTF A;  3V8J A;  3PGG A;  4JJN K;  4C0D C;  2KVQ G;  2E1H A;  4C8Q A;  2RH2 A;  3NTH A;  3A8G B;  4RG8 A;  4IKF A;  4QW2 A;  1M4Z A;  2CZ0 B;  1Y96 A;  3OBY A;  4J5Y A;  3C94 A;  3ZEH A;  2QQA A;  1BYM A;  2AHJ B;  5DM7 R;  2X4J A;  5CQX A;  2D0Q B;  3FIF A;  3ME9 A;  1IRE B;  5GAO m;  4ZTF A;  2HQE A;  1YJW T;  1RI0 A;  2EKO A;  4J6X A;  1GXI E;  3TRE A;  4HCB A;  1K73 C;  4II1 A;  2LDM A;  3OY9 A;  2V8J A;  2CYZ B;  2PUO B;  1YIJ T;  2RHY A;  3OMG A;  1K73 U;  2K4Y A;  3L2Z A;  2ZPG B;  4ZGE B;  3CC2 A;  2VXF A;  3DB3 A;  1LJO A;  4IUV A;  2YLB A;  2P0K A;  3P8D A;  3M53 A;  1TH7 A;  2I2L A;  2Y4Y A;  4L6V 5;  3RKY A;  2RK1 A;  5GAM h;  3L1A A;  4E7I A;  4KUL A;  4C0D B;  1M1F A;  4IUR A;  1I5L A;  2K57 A;  2RB6 A;  2OTL T;  2X4Y A;  2E65 A;  3SWN B;  2JOY A;  2KY9 A;  2DTO A;  3QYH B;  3M55 A;  1VQP A;  2GFA A;  3MP1 A;  2KAF A;  2RD1 A;  4M77 F;  5FU6 B;  5A0G A;  5CR2 A;  3VJP A;  4F7U G;  4DA4 A;  2QQB A;  4P5N A;  3OS5 A;  3QHS A;  2FVU A;  2L89 A;  4BDZ A;  3QII A;  5GAN h;  3FRN A;  2B8A A;  2MF2 A;  3LGF A;  3CXC A;  3QZ9 B;  2EYQ A;  4ME7 A;  2KDS A;  5A0D A;  5C0M A;  5GMK e;  3VU3 C;  3DLL A;  3UPU A;  3ZBD A;  5LL6 S;  1ZQ1 A;  3JRZ A;  3M56 A;  1D3B B;  3CD6 A;  3X25 B;  2LCC A;  4BAC A;  4M7A A;  3GP8 A;  4A53 A;  1JJ2 A;  3JCM d;  3X28 B;  1VQ8 A;  1BI2 A;  2KK4 A;  2E64 A;  2YRV A;  3JCM g;  1QP2 A;  5L8R E;  3GIB A;  1G5V A;  3JCM X;  1UEB A;  4M7D E;  2DIG A;  2GQV A;  4M7A D;  1HK9 A;  2PUK B;  2WAC A;  2DZC A;  2M9U A;  3UWN A;  4A4K A;  5CK9 A;  2A7Y A;  1VQ6 A;  2DTI A;  3VUZ A;  5GAM f;  1BI3 A;  5FLX E;  3VUB A;  2EJ9 A;  2K3X A;  2M0O A;  5LJ5 e;  2CZ1 B;  5FU7 C;  1KQS S;  1HXD A;  2XDP A;  2O4X B;  1VIE A;  5KH6 A;  3P8H A;  1VQO T;  3HL8 A;  3JCM b;  3DKM A;  3JB9 J;  1U8R A;  1UGQ B;  1WJR A;  3OB9 A;  2LNV A;  4GY5 A;  4XTX A;  4BY6 B;  3OYM A;  3WVE B;  1YJW A;  4M7D G;  3CD6 T;  2EFI A;  1B34 A;  1EIF A;  2ZPI B;  1YI2 A;  2QQR A;  2DEQ A;  5CO7 A;  4M77 B;  5IT9 E;  2XK0 A;  4EPC A;  3MCA B;  3OYI A;  3LWI A;  2JVV A;  2JTM A;  1Q82 U;  2LT4 A;  3BFM A;  3CCE A;  2KSS A;  1X6O A;  2DKG A;  2K2V A;  3HHT B;  4E7H A;  1G3S A;  2JZ2 A;  5GAN j;  4EDU A;  2XI9 A;  2KQW A;  3X20 B;  2FHD A;  4EMH A;  4M78 G;  4M75 A;  4ZGJ B;  2VYT A;  3A8L B;  3PIO A;  4M77 D;  3OBW A;  2DAQ A;  4BE2 A;  4OGC A;  3OYA A;  2RI5 A;  2DK3 A;  2O4X A;  1N27 A;  2K5F A;  4V2S A;  1S72 A;  5KCH A;  2ZPE B;  1KD1 C;  4TVR A;  2K5L A;  3O8V A;  3JCM c;  2EJG A;  4OB1 B;  4XAX B;  5GAM d;  3E9F A;  3PIP A;  3SWN A;  3RMQ A;  1NJI U;  4XTW A;  2EAY A;  3F70 A;  4NL3 A;  1OI1 A;  4X9D A;  3G6E A;  1VQ4 T;  3CME T;  4MML A;  2XKO C;  4N4G A;  2CGH A;  1NJI C;  2RO0 A;  4EMK C;  1YJN A;  3CCE T;  2P0Q A;  1KQS A;  1XOV A;  2OTL A;  4OP0 A;  1DJ7 B;  5D6W A;  1Q81 C;  3OW2 A;  2M1H A;  2V8K A;  4C92 G;  4M77 E;  1Y7X A;  3GNF B;  2RHU A;  3KUF A;  2E5Q A;  2KMT A;  4BDY A;  3QJY A;  3OYY A;  4EMK B;  2GF7 A;  1VQK A;  3I55 A;  4M7D D;  1U1S A;  2DVE A;  1VQ5 A;  3QDR B;  4M7A E;  5LJ5 j;  4XK8 E;  1G3T A;  3LGL A;  2P4T A;  2LX9 A;  4F7U B;  3QJ6 A;  4QQG A;  4C92 E;  1XTD A;  5GAN 4;  3CXC S;  2K5I A;  4A4H A;  2M16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...