2LDMA

Solution structure of human phf20 tudor2 domain bound to a p53 segment containing a dimethyllysine analog p53k370me2
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
77
Chain Sequence
SSEFQINEQVLASWSDSRFYPAKVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFSKDQNIVGNARGSRAHSSHLSKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title PHF20 is an effector protein of p53 double lysine methylation that stabilizes and activates p53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
molecule keywords Uncharacterized protein
total genus 14
structure length 77
sequence length 78
ec nomenclature
pdb deposition date 2011-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ldmA01
1SSFA 2EFIA 4FL6A 3MEUA 4IUVA 2BUDA 3M9QA 4QQGA 2L89A 3MP8A 3OYDA 4L59A 2RO0A 2RHUA 3OS1A 1OYXA 4FU6A 3OYCA 1KHCA 1WGSA 4C5IA 2IG0A 2RHIA 2RJDA 3PFSA 4QVZA 3L2WA 2B8AA 2DIGA 3FLGA 3L42A 2D9TA 3OYKA 4PLIA 3OS0A 4BE0A 3OYNA 4LD6A 4ZTJA 2LDMA 2RHYA 2L8DA 4IUQA 3NTHA 3FEOA 3S6WA 4B9XA 2RJEA 5D6XA 4QW2A 3OY9A 1H3ZA 3OQ5A 3OYJA 3LGLA 3UWNA 4B9WA 5C6SA 3QIIA 4X34A 2R5MA 1WJQA 2RJFA 2X4XA 3LX7A 3MEAA 4GY5A 5D6YA 2EQUA 2GFUA 4A4FA 4BDYA 3L2QA 3GOXA 5IN1A 2EQKA 3P8HA 2M16A 4C5GA 1XNIA 4IURA 2JTFA 3OYIA 2M0OA 5FRNA 3DB4A 2R57A 4IUUA 4PL6A 3OYLA 3O8VA 2XDPA 3PMIA 3OMCA 4IUTA 2VYTA 2E5QA 3E9GA 3ASKA 3L2VA 4BE1A 2EQMA 3KUFA 3MEWA 2G3RA 2CKKA 2F5KA 4N4IA 4E7LA 1G5VA 2NLUA 2LVMA 2WACA 4IUPA 2LTOA 2X35A 3F70A 2RI3A 3OYFA 2BKDN 4Q5WA 3DLMA 2XK0A 2X4WA 3LGFA 2BIVA 2O4XA 3LLRA 3NTIA 3LYIA 4NS5A 2RI5A 2RHXA 1RI0A 2RHZA 3OS2A 3Q1JA 5FROA 1OZ3A 3FDRA 3L2RA 4BDZA 3QJ6A 3MP1A 1WJRA 4E7KA 3LH0A 5FRMA 2PQWA 3DB3A 2GF7A 3EAEA 4A4GA 3L2UA 5CIUA 2MWPA 3OYGA 3ME9A 4CRIA 2LRQA 4OVAA 4EDUA 2P0KA 2R5AA 3OYBA 3SD4A 2R58A 3E9FA 2EKOA 3UT1A 4ZTFA 4C5EA 3C4SA 2EQJA 3QKJA 4C5HA 4A4HA 4RG2A 1MHNA 2X4YA 4E7HA 5KH6A 2O4XB 2YRVA 3MEVA 2HQEA 5J26A 3OA6A 2HQXA 2RJCA 3OYEA 4BE2A 4PLLA 3PNWC 3H8ZA 4II1A 3OYAA 3H6ZA 3MO8A 3BDLA 3META 3OB9A 2K3XA 3S3OA 4E7JA 4BD3A 2RI2A 4QQDA 3QBYA 2M1HA 4IKFA 4UC4A 1OZ2A 2GFAA 4HCZA 4QQ6A 4Z02A 2DIQA 4BACA 3OYMA 4A4EA 5J39A 2FHDA 1WJSA 2K3YA 5C0MA 1N27A 2LCCA 2QQRA 4N4HA 4E7IA 2JZ2A 5KCHA 3PMTA 5KE2A 3MP6A 5D6WA 5IAYA 3OMGA 2E6NA 3NTKA 3FC3A 1OI1A 2QQSA 3P8DA 5KE3A 3OYHA 5M9OA 5KCOA 2L3RA 4N4GA 2DAQA 3S3MA 2MWOA 3CEYA 3S3NA 3ZEHA
chains in the Genus database with same CATH superfamily
3AHUA 5GAMh 4XU1A 1KC8R 1S1NA 3JCMX 3RKXA 2DERA 2HMAA 4C0DB 3M55A 2RJDA 2YLCA 4TVRA 3V7SA 3L2WA 2IPOB 3FLGA 4M75E 3TSWA 3G7ZA 1G3SA 1OOTA 5GMKj 4JPBW 4OMOA 5CO7A 2RJEA 3I5RA 4HCCA 3SB2A 4B9WA 5C6SA 5LJ3g 2QA4Q 4M78F 1KQSA 2MI6A 4EIKA 2K5LA 3V7RA 4MDXA 4C8QD 1YI2Q 2E41A 2PVGB 4AG2C 1NEGA 2E5QA 2KDSA 4DQ2A 1SKUB 2CKKA 3I55A 3RKYA 2X35A 2DD4A 4B6MA 1C1AA 2IIMA 1BIAA 1N9SA 4DBRA 4MMLA 3JCMc 3QWXX 1VQNA 1RI0A 5GANj 2DETA 2CDTA 1NJIR 1I81A 1ZHIA 3LH0A 2GF7A 1K0SA 1SRMA 4J7IA 1GCQA 5CKDA 2R5AA 3OW2S 1VQ4A 1PG5B 3CC2T 2EQJA 4F7UF 1QP3A 2RF0A 3CPWP 1YNZA 4II1A 4M7DE 4XU0A 4M7DC 4J6WA 2KT1A 3ZL7C 1BI2A 3EGXB 1NPPA 1R0CB 5KYNA 5GAN6 2K3YA 3EGDA 4MZMA 1RAHB 4PFPA 4VUBA 5GANf 2L0AA 1SG5A 1JJ2P 2PNIA 3X28B 2MYSA 1AZGB 2KSSA 2GNCA 2VASA 1WLPB 1YI2T 4M4ZA 4OF1A 2Y90A 3OYHA 1K4US 4M75D 4PJOG 4MZTA 5GAOq 1UJYA 2MWOA 1NZ9A 2KBTA 1M3BA 1N5ZA 1VYVA 2AZSA 3M9QA 2QQ9A 1JJ2S 2LNHB 1VQ8Q 4RMOA 1YWPA 2AT1B 2IG0A 1U1TA 2V26A 4C92D 1YFNA 2QQBA 1QVFA 4EMKB 1ZBJA 4E47A 4E7ZA 2D8JA 3GLXA 4RTTA 4PFZA 3CCRA 2P0QA 1QLYA 3EG2A 1UTIA 1N6AA 2OX7A 3QDFA 3VRZA 1KQ1A 1H92A 5D6YA 3DLLA 2CUBA 5A0GA 2YSQA 5GANh 2M51A 1BYMA 4RTVA 5FRNA 4RTWA 2V8IA 5CKEA 2XDPA 3A8MB 5LJ5h 5I21A 2D8HA 4E7LA 3TVTA 3CCUT 1WXUA 1EIFA 2Y4YA 1FMKA 5DLOA 4E7SA 4M75B 4C0GA 4J9CA 1VQOQ 3CCQA 1YP5A 4HVVA 2V1QA 5GAMd 4QKUA 5CR2A 1JEGA 4JZ3A 2FZKB 2PU9B 2QGGA 4OVAA 2CUDA 1IO6A 2E3IA 2EGAA 1UHCA 5LJ3e 4D8DA 1YHQQ 3OA6A 5LJ3d 2F5TX 3HRTA 1KHIA 2LCLA 4C8QE 1Y07A 1X75C 4M78B 4A4EA 3CCLT 2GQIA 1R0BG 3A8HB 3URGA 2CZ6B 1YITA 1WHHA 2D0QB 2FG0A 1WI7A 1U3OA 2DAQA 3QXEB 3QO3A 1ZQ1A 3EHQA 2BE9B 3VUBA 2RHUA 3OS1A 1XTDA 2F2XA 1WGSA 1HJDA 4QVZA 3CCEQ 4EPCA 4BE0A 1RUWA 4C92C 4ZTJA 4ZGDB 4EMGA 2O31A 2DD5A 2HKNA 2W0ZA 1UGQB 3H0IA 4BB7A 2LQ8A 2VUBA 2DJQA 4PL6A 2VC8A 1M3AA 4JRKA 3WXMB 2NLUA 1SEMA 4KUDK 4IUPA 4JZ4A 3UATA 3HRSA 2BIVA 4FCYA 2DXBA 4PJMA 3E1SA 2MCNA 2K5FA 1TUCA 3A98A 1QMCA 1E6HA 2DKGA 5FRMA 2E70A 4C0ZA 3JB9H 1I5OB 4EDUA 1U8RA 1K9MC 2P0KA 2OAUA 3NFCA 3OYBA 3T9NA 3R6NA 1YBYA 2D1XA 3FB9A 4GBQA 2HQEA 2I0NA 2HQXA 1S72A 2FZCB 3OYAA 2K3XA 1IHVA 2FZGB 1G3YA 2ZPEB 4M7AA 4L5GA 1VQ9T 2DXTA 3WVDB 1KQ2A 3CCMT 1RAIB 3L2ZA 5D6WA 5IAYA 3ZFJA 2X3XD 3HRUA 3QZ9B 4ZGJB 1TUDA 2VVKA 1W2BP 3VUZA 3A8OB 1YWOA 5LJ5g 4JRIA 5HY6A 2JXBA 4J7FA 1NG2A 3PFSA 1JU5C 2OTJT 4M77D 2O88A 1IZ6A 2O9VA 4J9BA 5GAOm 1VQKT 3CBPA 3OY9A 2A3LA 5LJ3f 5GAOl 2JS2A 3V8KA 2RQWA 3QYHB 4ZGEB 4QVDA 2ZPBB 1NM7A 1M9SA 1H641 4M7DF 4PJJA 1X6BA 2DL8A 5CKFA 4C5GA 3HTRA 2JTFA 3DB4A 4FIBA 1WX6A 3ASKA 4BE1A 1ZSZB 3GNFB 2F5KA 1TS9A 1AWJA 2EIFA 5KYXA 5IT9E 4M7DA 1VQLT 2KRSA 4OB3B 2RA2A 4J9EA 4K11A 2RD1A 1UJ0A 2X3WD 5CVIA 2QDLA 2V8KA 2A08A 8ATCB 1D0XA 1UGSB 3A8GB 5LJ3h 1VIEA 4GLMA 2RQTA 4A4GA 1WHLA 2EYYA 4F7UA 1UHFA 1Z9QA 4CI0C 3GIBA 3CCMQ 1PD1A 5EC7A 2DRKA 5KH6A 2RJCA 2OTLQ 4KRTA 1BIBA 5HK3A 1NE8A 2JTMA 5I2MA 3QYGB 3J80E 1OU9A 4DBQA 2JS0A 1PM3A 1MUZA 2J6FA 1K0XA 2L3PA 2FEIA 1YIJQ 3CD6A 2ZAEA 2L5QA 2XD0A 1Y57A 1Y96B 4LUDA 3UF4A 2L3RA 1X69A 2DVEA 1UB4A 4C0FA 4DOVA 2EFIA 4FW1A 2CGHA 2BUDA 3EG9B 2NUPB 4FU6A 1G3TA 1JO8A 1C6VX 1V76A 2YLBA 3OYNA 2LDMA 4OMFB 5KYUA 2HD0A 4QW2A 1NLOC 4O6JA 2EJFA 3JCMe 3JCMP 1VQ6Q 4JS5A 1ZUKA 4XTUA 4OMLA 4KGXB 1WZOA 3VS5A 1YJWQ 4PJNA 2E3HA 1BCMA 2CT4A 2QEXQ 2F1LA 1M3CA 3CC7A 4XTZA 5FU6C 1TSFA 5LJ3j 3M57A 3X20B 3J81E 2RI5A 4XK8E 3BW1A 1O9SA 3UDCA 3FDRA 4AFZC 1AWWA 2FO0A 1PSFA 3DKMA 1YI2A 4LE9A 2O9SA 1PD0A 2DXCA 4XTXA 2J6OA 3UT1A 3E9FA 4C5HA 4A54A 3SDZA 2DFUA 5J26A 2G6FX 3C94A 2E6ZA 4F04B 1IGQA 3JB9J 1GBQA 2DEUA 3CCRT 2K6DA 2YUOA 5GMKi 2KE9A 1VYUA 2FHDA 2A37A 1SHGA 3HL8A 2QQRA 3P8BB 4NL2A 4XU2A 1TG0A 3JB9I 3RMSA 4JUVA 3SHWA 3RERA 1X27A 2QASA 1GFDA 3CMAA 2DF6A 1M4ZA 3CCSA 1I07A 3EG3A 3JAME 3CMEA 3HHTB 2K9GA 1D3BA 2RHIA 4KT0E 3G4ST 2GQVA 3L42A 3CCQT 3JRZA 4PLIA 4M7AF 2AIRB 1WHKA 3VRYA 3VS1A 2VWFA 4R0KA 1VQ7A 4YTLA 1U1SA 1UG1A 1MGQA 2IVWA 3SWNC 4KH1B 2ROLA 3JB9G 1OQKA 2RM4A 4BDYA 4ZNXA 1IHWA 3KFVA 3FRNA 1RI9A 2RN8A 2JVVA 2Z0WA 3M56A 4HA8A 4M75C 4OMMA 4IUTA 3E9GA 1KJWA 1QCFA 1VQKQ 1VQMQ 2QYZA 2CP2A 3RMQA 1VQPQ 1VQLQ 5GAN5 2LT4A 1GL5A 1K9AA 1QVGA 4ELYC 2DA9A 2RHZA 4R56A 3QJ6A 1YITT 1WDXA 2HBPA 2K7AA 3JB9F 3NHNA 2F2VA 1Q82R 2JM9A 3H9NA 4PJOE 1MHNA 3MEVA 4LXCA 4BI8B 4LNPA 4HXJA 2HCKA 1IB8A 4FM4B 3OB9A 3CC4Q 4BD3A 2K5IA 3G4SQ 1OULA 3M59A 4MDWA 2K2VA 1FWZA 4RTZA 4C8QG 1WJSA 2JT4A 2JMAA 2DILA 1OX8A 3RIRA 2FB7A 1AWOA 3OMGA 5A2QE 3NTKA 3QDRB 3EFRA 4QT7A 5FLXE 5DY9A 2OAWA 5CQYA 4IUVA 4BUGA 4V2SA 2PVOB 3LH5A 1M1KC 2RO0A 4C5IA 1W2BS 2D9TA 1B7TA 1X43A 2RHYA 4JDSA 4IUQA 1YJ9T 2LJ3A 3NPFA 4NOYA 1RLPC 3A8LB 3I56Q 4GY5A 2EQUA 3UPUA 4LUEA 4F7UE 2ESWA 4FYXB 1VQPA 3J7AF 4GLKA 1VQ6A 2LMJA 2QI2A 1I8FA 2EJ9A 2HSEB 3EGDB 1M1KU 5IH2A 3H0FA 4N4IA 4AFQC 1MMGA 1K8AR 2J7IA 4FSSA 1WQ7A 2EW3A 3M0TA 2D6FA 2X4WA 3LYIA 4DEYA 3RESA 3CCUA 1WXBA 5FROA 4DOWA 1RACB 1X6GA 3LWHA 3CMEQ 4C92G 1FXXA 2A0FB 2ZPGB 4ZTFA 4PK4A 2DYBA 2EJGA 1GRIA 3QHSA 3G71A 4E7HA 4M75A 5FWBA 1ZUUA 1NYGA 2KGTA 1VA7A 1RL2A 1PNJA 4J9IA 4C0DC 4ATOA 4C8QC 5GMKm 1KFZA 4J5YA 4UC4A 1M1KR 1Q95G 1Q82U 4X9CA 2RK1A 3OYMA 1I1JA 2WSEE 4HCBA 2CP5A 3QWYA 2FPEA 3PMTA 1M30A 2AKKA 1YCYA 2OTJQ 1MMDA 4KH0B 4PJOB 2ZZDA 3PIPA 1RAGB 1VQLA 3A1PA 1AVZC 2P4TA 2QDYB 1WQWA 6AT1B 4FYYB 2CZ1B 2EWNA 2B8AA 5CCAA 1Q82C 3CXCP 4LD6A 2QAZA 2HKQB 2XMFA 3NTHA 2ABLA 2K57A 2J06A 5D6XA 1WIEA 1U5SA 2QTVA 1Q7YU 2CP3A 1WJQA 1JB0E 2LJ1A 4C8QB 3MCAB 1IGUA 4OGEA 4LDYA 3MJXA 3OSVA 1SHFA 5L23A 1HSQA 2DMOA 1T3LA 3OYIA 3OYLA 4D8KA 3CCRQ 2GTJA 1ZA1B 5CKBA 4KBMB 3UA7A 3CCLQ 1D0ZA 4M78A 2CH4A 3JCMf 2DJZA 3EH1A 1PKTA 4HVWA 1OPKA 2KROA 1UECA 5GJVB 2BZ8A 2DL3A 4JLIA 1PHTA 1W2BA 2E12A 4EMHA 1WPYA 3KXTA 2PQWA 3EFOB 2KY9A 1B3QA 5CIUA 2DL4A 4F7UB 1PWTA 1K73R 3THKA 1VQ5A 3FJPA 4RG2A 1K1ZA 2DK3A 2X4YA 3M0RA 1X01A 1T0JA 1TH7A 3PNWC 3H8ZA 1WHGA 3HSBA 3MO8A 3RUXA 2PTKA 5LJ5f 4E7JA 3I5SA 2HZYA 3VS3A 1B34B 1LOJA 3D7SB 4XQ3A 2DTOA 1YJNA 2AZVA 1D1BA 4M78D 2P84A 4M7AD 4PNOA 1ZSZA 4HVUA 2MF2A 1VUBA 5EG2A 2DRMA 2DBKA 3TSZA 1VQ9A 1JBMA 1UGVA 1OI1A 2P0PA 1VQMT 4RTYA 5CKHA 2LZ6B 2KK4A 2XG8D 3CCMA 3EG1A 3CXCA 2OTLA 4HKEA 1B07A 2L89A 3OYDA 4PJOF 1EFNA 4P5NA 5IHIA 1JJ2A 1SRLA 2ZCFB 1MMNA 2DLPA 5AYFA 1QVGS 1GCQC 3FEOA 3MKDA 3G6EA 1BU1A 3OQ5A 2XKOC 1VQ8T 2BZXA 2BZYA 1Q86R 2RJFA 4JS4A 5HCKA 2KI7A 2RQUA 3HP9A 1I0CA 2M16A 2JN0A 2SRCA 3BDUA 1CKAA 2DX1A 2JW4A 4AG1C 1B34A 2G3RA 2VGMA 3CBOA 2WACA 3CCET 1BKBA 1FX7A 1OU8A 5CQXA 1YHQA 4M7AB 2O4XA 4OB1B 3EGXA 1G3WA 1XJWB 1ZX6A 3N5BB 3VJPA 4DA4A 5GAMj 4RCBA 3Q1JA 3MP1A 1NEBA 1T3SA 3C95A 3PVLA 1TWBA 4Z88A 1S72Q 3EFOA 2CP0A 1YIJT 4M7AE 4J83A 4A53A 4RTXA 3GP8A 4M77G 4C5EA 4A4HA 1QWFA 2YRVA 5KYWA 4IIOA 1HYOA 4Z8AA 2NUTA 4PLLA 4F17A 1M8MA 2FL7A 5GAN2 2JOYA 4BI4A 1VQ7T 2XIDA 4FW2A 4IKFA 5LJ5e 2E64A 2L3SA 3CCVT 2XDBA 1K73U 1NPRA 4IIMA 3LWIA 3M0SA 4PFOA 2L2PA 1AZEA 2DPPB 3RKWA 4LDVA 4KGZB 3FC3A 1YITQ 2HNIA 3EFSA 4LDUA 3ZEHA 4A63B 2QEXT 4QQGA 4EMKA 2LJ0A 5KYYB 2COWA 4LDWA 3VYHB 3E19A 1LPLA 3CCJT 2E5KA 4BY6C 1K73C 1OX9A 2H3JA 1QW1A 1H3ZA 4PKCC 2HSPA 4M77A 2NUPA 3EG9A 2GGRA 2GTOA 2CZ7B 2D0NA 1J3TA 2I2LA 1VQ5Q 3EHRA 3MEAA 5LL6S 4A4FA 2DEQA 4JJNK 3AT1B 4C8QF 3M4GA 4MMKA 1M90R 1IXDA 2EKHA 1FMVA 2GCXA 2C0TA 3MEWA 1MNDA 1R77A 4ZN3A 3SFMA 2H8HA 2RI3A 3O5ZA 2YT6A 1M2VB 5GAN4 2RHXA 1OZ3A 3CMAQ 2LQNA 2PVDB 4F7UG 3L2UA 2MPXC 3PGGA 1QWEA 2J6KA 4CRIA 4R55A 4DEXA 2HAXA 2CP7A 2JMCA 2PUKB 4E2FB 2EQIA 1GXIE 4M7DD 5GANg 4XU3A 1AOJA 2OI3A 2OJ2A 2COYA 4QQDA 1AHJB 2EGEA 5FU7C 1M90C 3JCMh 2DVJA 2QK0A 1Y71A 4Z02A 1YJ9A 1YJWA 4LN2A 1RAFB 4HT8A 4JJBA 3I56A 3M5AA 1D0YA 3CC4T 4JRQA 1GBRA 5GAN7 1KD1R 1YJNQ 1VQPT 2EPDA 1KK7A 5KE3A 2L3QA 2ECZA 2RB6A 1QCNA 1Q7YR 2JJ9A 4M77B 3A5ZB 3CCST 3QUIA 1M90U 3TQ7P 1K9MR 1X2QA 1M5Q1 2VB6A 1UGRB 1WHJA 3L1AA 1D3BB 2MAMA 2ED0A 2CS7A 4XTVA 5A0LA 3CPWA 4OMPA 2XU8A 2R5MA 4F16A 3CC2Q 4Y28E 2GBQA 5FU7B 3C12A 2X4JA 1AWXA 1W4SA 2V1RA 5IN1A 2DBMA 3VYGA 2M0OA 1E6GA 3O8VA 2ZGWA 3OYYA 3X26B 4ORZA 3I9QA 2O01E 1W6XA 5CAIA 2LVMA 2CH4W 5AT1B 3F70A 1QCOA 2MK5A 2ATCB 3DLMA 1T0HA 2A7YA 3V8LA 4ZN1A 2K4YA 2PUOB 1GCPA 2ED1A 3VS2A 2QG9B 1VQOT 1Q7YC 1KSWA 1ABQA 2FYKA 3EAEA 3JCMJ 1ACMB 2LCSA 2LRQA 2YUNA 3X24B 2VV5A 1X2KA 1PSEA 3CCJQ 1LNXA 4RG8A 3QKJA 1QVFP 1VYTA 3ZBDA 3MHXA 1K8AC 3INZA 5IHKA 4BE2A 2WSCE 5GANe 3IQLA 3H6ZA 2MOXA 3MPUB 3META 1D1CA 4AT1B 3KBGA 5GMKl 3S3OA 4LDXA 2YHTA 3REAB 3JB9D 4QQ6A 3ULRB 1RLQC 2JTEA 4M78E 3CCVQ 3I55Q 4DBFA 3HFNA 1AT1B 3TU4K 2E6NA 2FVUA 4OMQA 1QKXA 3EGUA 2K3BA 4XTWA 2RQVA 2RQRA 3M54A 5KCOA 1MNEA 2KAFA 3PTAA 1NJIC 3H41A 1UFFA 5KYYA 1AEYA 3M4YA 1MMAA 1VOMA 4CC4B 1ZA2B 2L8DA 4N0AC 1QVFS 1SSHA 4CC3A 3JCMW 1IREB 1XQHA 4J9FA 1CSKA 2KXDA 2LP5A 1RABB 4ESRA 1PKSA 3I55T 2EBPA 3GOXA 1VQ5T 2FRWA 4FT4A 3P8HA 1XNIA 2YRDA 8AT1B 3OMCA 1NJIU 4M7AC 4J9GA 3VV0A 2C0IA 2M9UA 4M75G 2QA4T 4PJOD 1YJNT 2KYBA 3CQTA 1N9RA 4XTYA 1N8RR 1VQ6T 3NTIA 1BB9A 1M27C 4AMCA 1UUEA 3VS7A 1D09B 1Q86C 1UGPB 1VQ4T 3CC2A 1D1AA 3L2RA 4BDZA 1KC8C 1WJRA 4E7KA 2MWPA 4JLGA 2CP6A 1QQJA 1BK2A 4Z89A 4RKUE 3C4SA 3EH2A 5FWCA 4PJLA 4EMKC 1LJOA 2J05A 2FRYA 1H8KA 2NUZA 2KEAA 3C0CA 2YRCA 5D7UA 2DTHA 3PVQA 2KR3A 1JXOA 1OZ2A 3SEMA 3G6ET 3G71T 1Q86U 5GANd 1VQ8A 2AKLA 4M77E 5J39A 1Q81U 2COZA 2E10A 1Y7XA 4C92F 3MP6A 1EZZB 1ZLMA 3UA6A 5IXBA 2YDLA 4C8QA 4FL6A 3M0PA 4C92A 5GAOn 1FMWA 1XOVA 4ELZC 4L59A 3I35A 3LW5E 1TTHB 1ZUYA 1FYNA 5GAMf 2DNUA 5HKCA 3OS0A 1HXDA 2LX9A 3CPFA 4KUIA 4B9XA 1Y96A 3OYJA 7AT1B 5LJ5d 1M1GA 3G71Q 2VKNA 3QG1A 4X34A 1QKWA 2XI9A 4PJOA 3LX7A 3CCQQ 2ENMA 5GMKe 1M1FA 1RADB 3PMIA 2Y4XA 3CCUQ 4OGCA 3VS6A 2VXFA 3G1JA 2EYZA 2JNGA 2MIOA 1OEBA 3CCVA 1YCSB 3NMZC 1RAEB 3JSCA 2JUFA 4WF2A 5IXFA 2EYXA 3CD6Q 3PE0A 1H3HA 2AK5A 2HL3A 4WTOB 2P4RA 5GAN3 1G2BA 5DM7R 3TEEA 1Q81R 1BCOA 3JCMV 3WVEB 2WSFE 2DZ9A 3CCLA 1NBEB 4M77C 4ME7A 1R8OB 2BTTA 2CREA 1KG1A 2RI2A 3QBYA 2M1HA 3FJ5A 3BE3A 2DIQA 2RH2A 4BACA 3CBMA 5C0MA 1N27A 2KMTA 2KQWA 4E7IA 1VQNT 5KE2A 1WYXA 3GBQA 2LX7A 1W1FA 3OSSC 2CZ0B 2QXFA 2VGNA 3OW2P 4QVCA 5M9OA 2B86A 4KGVB 3S3MA 2E4HA 2KYMA 5FW9A 3CEYA 5ECAA 1W70A 2M02A 1JRIA 1UE9A 3RR6A 1BI0A 4Y91A 1PRMC 1VQMA 2DIGA 1F1BB 3BY7A 2OTLT 3M0QA 2W10A 3GPLA 2ZPHB 1CKBA 2XHCA 2CYZB 4MZPA 1PCXA 2NYSA 2X4XA 5GMKh 4O5VA 3OW2A 1DJ7B 4F14A 4IURA 1RAAB 2NWMA 2QTXA 2R57A 3VU3C 3L2VA 2EQMA 4M78G 4M7AG 3PIOA 4Q5WA 4HCKA 3LGFA 1YJ9Q 3RDVA 1YJWT 5KYWB 2HQHA 5I22A 3TCJA 3I56T 3CC4A 2EVRA 3CCEA 5CK9A 2KXCA 1YHQT 3SWNA 1WXTA 3DB3A 5HK0A 1V1CA 1S72T 2V8JA 4WCIA 4KULA 4M75F 2A28A 2EGCA 3OBWA 1QVPA 5J3BA 4ANJA 3PT9A 4D6WA 2DTIA 2HL5C 1GFCA 2EAYA 2FPDA 2ROTA 3H0HA 3HKSA 5GAN8 1KQSS 2O4XB 3ER0A 1YIJA 4X1VA 3BDLA 1IRXA 1AD5A 3VS0A 1M2VA 4L6V5 2CT3A 1BI1A 4JRPA 5KYXB 4M7DB 1OV3A 1V29B 1VQ4Q 3QZ5B 2YUQA 1KIKA 2CSIA 2JZ2A 1I5LA 1WA7A 2YUPA 3HPWA 3QSUA 4BI3A 3QPHA 1N8RC 2OTJA 1ZSZC 1NYFA 2C06A 1K8AU 1SSFA 5L8RE 1M2OA 3MP8A 1ABOA 2LNVA 1G83A 1LCKA 1TOVA 3OYCA 2H3EB 1PC0A 5GJWB 1C0MA 2QEXA 2XICA 1VQOA 3S6WA 3RBBB 2RK2A 2DXUA 3LGLA 3UWNA 1HD3A 4OB2B 4BY6B 3QIIA 3GNGA 3CCJA 1QP2A 3EG0A 4JJCA 2GFUA 3BFMA 1N8RU 2DL5A 2F69A 2HEQA 3VKIA 1JQQA 1X6OA 1BI3A 2VYTA 2M0YA 2K79A 2LC4A 4AFSC 1YN8A 1VQNQ 4NL3A 3M58A 1SF9A 2DL7A 2XDDA 1KD1C 2BKDN 1ZSGA 2QQAA 2XK0A 3VS4A 3LLRA 4FYVB 4RTUA 1JXMA 4NS5A 4X9DA 2DM1A 4J6XA 3OS2A 2KRNA 2KT8A 2NUTB 4A4KA 1SPKA 3V8JA 3SWNB 4OMNA 1OPLA 3OYGA 3ME9A 1UEBA 1PRLC 1G8XA 5A0DA 1MV0B 1KQSP 1UDLA 2A36A 3E2UA 4OP0A 2EKOA 2K2MA 5IHNA 4FYWB 2YXYA 2DYIA 1K76A 1KD1U 4J8OA 4OB0B 3CCSQ 3CD6T 4XAXB 2KNBB 4CC2A 2DE0X 1TUGB 3HFOA 1KC8U 2ZPIB 4N4HA 3CC7Q 4DBHA 2DO3A 5KCHA 1BBZA 3GF5A 1HK9A 2QQSA 3P8DA 3JCMd 1NLPC 2LQKA 4N4GA 1A0NB 2F2WA 1TU0B 3S3NA 3MEUA 1P92A 3R6OA 2C0OA 4E6RA 2EYQA 2QA4A 1OYXA 1KHCA 5KYUB 2VXEA 4LD9K 3OYKA 2BE7D 4FT2A 1Q81C 3V7CA 3RNJA 1Y0MA 3JCMg 2RMOA 2DZCA 4C92B 4M78C 3X25B 5LJ5j 2ZPFB 1U06A 3M0UA 4M7DG 1E7OA 4FSXA 3CC7T 5GAMg 2O2OA 3L2QA 2EQKA 9ATCB 2MMPA 1K9MU 3M53A 4IUUA 3TREA 4CC7A 2JM8A 2YWWA 1VQ7Q 3KUFA 4C92E 4JJDA 1G5VA 2LT1A 3FIFA 4Y92A 2LTOA 3OYFA 1I4K1 4J9HA 1M8VA 4AFUC 1LVKA 3CXCS 1TXQA 3OS5A 1ARKA 4HT9A 1VQKA 2RNAA 1Z9ZA 5GAMe 2E65A 3JV3A 1EX4A 1MV3A 1WHMA 1ZBXA 5DLQE 2HBWA 5FU6B 3SD4A 3U23A 1VIFA 2R58A 1QVGP 4RUGA 2CSQA 2LQWA 2E1HA 4J6YA 4N0AA 3OYEA 1VQ9Q 2EYWA 5GAOr 4M77F 1WFWA 2X9HA 1O75A 3JCMb 5GAOp 4PJOC 2GFAA 4HCZA 4RCCA 3REBB 5I2SA 5I11A 2HDAA 3CMAT 3NGPA 2QGFB 3QJYA 1WNLA 2LCCA 2AHJB 3CMET 2PZ1A 3OBYA 4J9DA 3JCMQ 3G6EQ 2FPFA 2KVQG 2X51A 2KRMA 3G4SA 2RPNA 2SEMA 3CPWS
chains in the Genus database with same CATH topology
3AHUA 2EFIA 4FL6A 2CGHA 5GAMh 2OTLA 4HKEA 2BUDA 4C92A 4XU1A 5GAOn 1XOVA 2L89A 4ELZC 3JCMX 3OYDA 4L59A 4PJOF 3RKXA 4C0DB 3LW5E 4P5NA 4FU6A 1G3TA 3M55A 2RJDA 1JJ2A 2YLCA 4TVRA 3V7SA 5GAMf 3L2WA 3FLGA 2ZCFB 5HKCA 2YLBA 4M75E 3OS0A 3G7ZA 3OYNA 1G3SA 1HXDA 2LDMA 4OMFB 2LX9A 5AYFA 5GMKj 2HD0A 3CPFA 1QVGS 4KUIA 5CO7A 3FEOA 4B9XA 2RJEA 4QW2A 1Y96A 3G6EA 3OQ5A 3OYJA 4HCCA 3SB2A 2XKOC 4O6JA 4B9WA 2EJFA 3JCMe 3JCMP 1VQ8T 5C6SA 5LJ3g 5LJ5d 1M1GA 3QG1A 4JS5A 4X34A 4XTUA 2XI9A 4M78F 4PJOA 2RJFA 3LX7A 1KQSA 2MI6A 4JS4A 5GMKe 2K5LA 3HP9A 3V7RA 4MDXA 4C8QD 2E41A 2M16A 1M1FA 2JN0A 3BDUA 2PVGB 3PMIA 2Y4XA 2E5QA 2KDSA 4DQ2A 1B34A 4OGCA 2G3RA 2CKKA 2VGMA 2VXFA 3CBOA 2JNGA 3I55A 3CC7A 2WACA 4XTZA 3RKYA 3CCET 1BKBA 2X35A 5FU6C 1FX7A 5CQXA 5LJ3j 3CCVA 1YHQA 2DD4A 4M7AB 3M57A 3X20B 2O4XA 1BIAA 3J81E 4OB1B 1N9SA 1G3WA 3JSCA 2RI5A 4XK8E 3N5BB 4MMLA 3JCMc 3VJPA 2JUFA 3BW1A 1RI0A 5GAMj 4WF2A 4DA4A 4RCBA 5GANj 1VQNA 1O9SA 3Q1JA 3UDCA 3FDRA 3MP1A 1I81A 3C95A 1ZHIA 3LH0A 1PSFA 3DKMA 2GF7A 1YI2A 1YIJT 4M7AE 4J7IA 5CKDA 4J83A 4A53A 2R5AA 3GP8A 2DXCA 4XTXA 5GAN3 4M77G 3UT1A 3E9FA 3TEEA 5DM7R 3OW2S 4C5EA 1VQ4A 3CC2T 2EQJA 4C5HA 3JCMV 3WVEB 4A4HA 1QP3A 2WSFE 3SDZA 4A54A 4F7UF 2YRVA 5J26A 2DZ9A 4PLLA 3CCLA 4II1A 3C94A 2E6ZA 4M77C 4ME7A 1R8OB 4M7DE 4XU0A 4M7DC 2FL7A 3JB9J 5GAN2 2JOYA 4J6WA 4BI4A 1BI2A 1KG1A 1VQ7T 2RI2A 2XIDA 3QBYA 2M1HA 4IKFA 3CCRT 5LJ5e 2E64A 3CCVT 2XDBA 1NPPA 1K73U 5GAN6 2DIQA 2RH2A 5GMKi 4BACA 3CBMA 1NPRA 2FHDA 3LWIA 2K3YA 3HL8A 5C0MA 1N27A 2KMTA 2KQWA 2QQRA 4E7IA 1VQNT 4MZMA 3P8BB 4NL2A 4VUBA 5KE2A 4XU2A 2DPPB 5GANf 3JB9I 3RKWA 3RMSA 4JUVA 4LDVA 3OSSC 3X28B 2CZ0B 2QXFA 3RERA 2VGNA 2KSSA 1YI2T 3FC3A 3CMAA 4OF1A 2HNIA 2Y90A 1M4ZA 4M75D 4PJOG 4QVCA 5M9OA 3OYHA 4MZTA 3EFSA 5GAOq 3CCSA 3S3MA 2MWOA 1NZ9A 4LDUA 3CEYA 3ZEHA 2QEXT 3JAME 3CMEA 3M9QA 1JRIA 4QQGA 3HHTB 4EMKA 2QQ9A 1JJ2S 4RMOA 1BI0A 4Y91A 4LDWA 1D3BA 2IG0A 2RHIA 1U1TA 4KT0E 4C92D 1VQMA 2QQBA 3VYHB 2DIGA 4EMKB 1QVFA 3E19A 2GQVA 3L42A 4E47A 3G4ST 3CCQT 3JRZA 4PLIA 3BY7A 3CCJT 4M7AF 4BY6C 1K73C 3GLXA 2OTLT 2H3JA 1VQ7A 1QW1A 1H3ZA 3CCRA 4YTLA 2P0QA 1U1SA 4PKCC 3GPLA 4M77A 2ZPHB 2XHCA 1MGQA 2IVWA 2CYZB 3SWNC 2CZ7B 4MZPA 1N6AA 1KQ1A 2I2LA 2X4XA 3MEAA 5D6YA 3DLLA 3JB9G 5A0GA 5LL6S 4A4FA 2RM4A 5GANh 2DEQA 4BDYA 5GMKh 4JJNK 4O5VA 1BYMA 4C8QF 3OW2A 1DJ7B 3M4GA 4IURA 3FRNA 4MMKA 5FRNA 2QTXA 2V8IA 2R57A 5CKEA 2JVVA 3M56A 4HA8A 2XDPA 4M75C 3VU3C 4IUTA 3A8MB 3E9GA 3L2VA 2GCXA 5LJ5h 5I21A 2EQMA 3MEWA 4E7LA 3CCUT 4ZN3A 1YJWA 4M78G 4M7AG 3SFMA 2RI3A 3PIOA 1EIFA 2Y4YA 3RMQA 4Q5WA 3LGFA 5DLOA 1YJWT 4M75B 5GAN4 5GAN5 4C0GA 2LT4A 1QVGA 3TCJA 3CCQA 4ELYC 2RHXA 3I56T 2RHZA 3CC4A 1OZ3A 3CCEA 4R56A 3QJ6A 2PVDB 5CK9A 1YHQT 5GAMd 1YITT 3SWNA 5CR2A 3DB3A 5HK0A 4F7UG 3L2UA 2HBPA 2V8JA 1S72T 3PGGA 2PU9B 4KULA 4M75F 3JB9F 4CRIA 4OVAA 4R55A 3OBWA 1QVPA 5J3BA 2HAXA 3PT9A 4D6WA 2DTIA 2EAYA 2PUKB 4PJOE 3HKSA 5GAN8 1MHNA 5LJ3e 1KQSS 2O4XB 3OA6A 3MEVA 4BI8B 1GXIE 5LJ3d 3ER0A 4M7DD 2F5TX 5GANg 1YIJA 4XU3A 4FM4B 3OB9A 3BDLA 3HRTA 1KHIA 4BD3A 2K5IA 2LCLA 3M59A 4QQDA 1AHJB 4L6V5 5FU7C 1Y07A 4C8QE 4MDWA 1M90C 3JCMh 1Y71A 1X75C 2K2VA 1FWZA 4M78B 1BI1A 4Z02A 4A4EA 1YJ9A 4JRPA 4C8QG 3CCLT 1WJSA 4M7DB 1V29B 3QZ5B 4HT8A 3I56A 3M5AA 2JZ2A 3RIRA 3A8HB 2FB7A 3CC4T 1I5LA 3URGA 4JRQA 2CZ6B 3HPWA 5GAN7 1YITA 3OMGA 1VQPT 3QSUA 5A2QE 4BI3A 2D0QB 3QPHA 3NTKA 3QDRB 1N8RC 5KE3A 2OTJA 3EFRA 2C06A 3QXEB 2DAQA 5FLXE 5DY9A 1K8AU 3QO3A 2RB6A 1SSFA 1ZQ1A 5CQYA 4IUVA 5L8RE 4BUGA 4V2SA 2PVOB 3MP8A 1M1KC 2RO0A 2LNVA 2RHUA 4M77B 3VUBA 3A5ZB 3OS1A 1XTDA 3OYCA 1WGSA 4C5IA 4QVZA 3CCST 1W2BS 3QUIA 2D9TA 4EPCA 1M90U 4BE0A 4C92C 4ZTJA 2RHYA 1M5Q1 4JDSA 4ZGDB 4EMGA 1UGRB 2XICA 3L1AA 4IUQA 3S6WA 1D3BB 2MAMA 2QEXA 2RK2A 1VQOA 2DD5A 2DXUA 4XTVA 2CS7A 3LGLA 3UWNA 5A0LA 3CPWA 1YJ9T 4OB2B 4BY6B 2XU8A 3QIIA 2R5MA 1UGQB 4NOYA 3GNGA 4Y28E 3A8LB 3CCJA 1QP2A 4GY5A 2EQUA 5FU7B 3UPUA 3C12A 2GFUA 3BFMA 1N8RU 2X4JA 4F7UE 4BB7A 1W4SA 2F69A 2LQ8A 5IN1A 3VYGA 3VKIA 2VUBA 1VQPA 3J7AF 1X6OA 2M0OA 4GLKA 1VQ6A 2QI2A 1I8FA 1BI3A 4PL6A 2EJ9A 3O8VA 2VC8A 2ZGWA 2VYTA 2LC4A 3OYYA 3X26B 1M1KU 2O01E 4JRKA 4N4IA 4NL3A 3WXMB 2NLUA 3M58A 4KUDK 5CAIA 2LVMA 4IUPA 2XDDA 3F70A 1KD1C 1WQ7A 2BKDN 2QQAA 2D6FA 3DLMA 2XK0A 2X4WA 3HRSA 2BIVA 2A7YA 2DXBA 3V8LA 3LLRA 3LYIA 4NS5A 4X9DA 3RESA 3E1SA 4ZN1A 2K4YA 4J6XA 2PUOB 2K5FA 3OS2A 3CCUA 5FROA 4DOWA 4A4KA 1VQOT 1Q7YC 2DKGA 5FRMA 2E70A 3V8JA 2FYKA 3EAEA 4C0ZA 3LWHA 3SWNB 3JB9H 3JCMJ 3OYGA 3ME9A 1UEBA 2LRQA 4EDUA 1U8RA 2P0KA 2OAUA 3NFCA 2VV5A 3X24B 1PSEA 5A0DA 1K9MC 4C92G 1FXXA 3OYBA 4OP0A 2EKOA 2ZPGB 1LNXA 4RG8A 3T9NA 4ZTFA 3QKJA 1YBYA 3FB9A 2EJGA 3ZBDA 3MHXA 3QHSA 3G71A 4E7HA 1K8AC 4M75A 3INZA 2HQEA 4BE2A 2HQXA 1S72A 1RL2A 2WSCE 4C0DC 5GANe 3OYAA 1KD1U 4ATOA 3H6ZA 3META 5GMKl 2K3XA 3KBGA 3S3OA 4LDXA 4J8OA 4OB0B 1G3YA 4C8QC 2ZPEB 5GMKm 4J5YA 4UC4A 2YHTA 3CD6T 3JB9D 1Q82U 4M7AA 4X9CA 4L5GA 4QQ6A 2RK1A 4XAXB 1VQ9T 3OYMA 2WSEE 2DXTA 3WVDB 1KQ2A 3HFOA 4M78E 4HCBA 1KC8U 2ZPIB 4N4HA 3CCMT 2DO3A 5KCHA 3PMTA 1YCYA 3L2ZA 5D6WA 5IAYA 3HFNA 3ZFJA 3GF5A 3HRUA 3QZ9B 3TU4K 2E6NA 2FVUA 4ZGJB 1HK9A 2QQSA 3P8DA 4XTWA 3JCMd 5KCOA 3M54A 2LQKA 4N4GA 3VUZA 3A8OB 4PJOB 3S3NA 2KAFA 2ZZDA 3MEUA 1P92A 3R6OA 5LJ5g 3PIPA 4JRIA 5HY6A 1VQLA 3PTAA 1NJIC 2QA4A 2EYQA 2P4TA 4J7FA 1OYXA 2QDYB 1KHCA 1WQWA 2CZ1B 3M4YA 2EWNA 3PFSA 4M77D 2B8AA 2VXEA 2OTJT 5CCAA 4LD9K 3OYKA 1Q82C 1IZ6A 4LD6A 5GAOm 4FT2A 1VQKT 2L8DA 3CBPA 4N0AC 1Q81C 3V7CA 1QVFS 3NTHA 2K57A 3OY9A 3JCMW 2A3LA 1IREB 1XQHA 5D6XA 5LJ3f 5GAOl 3V8KA 3JCMg 2DZCA 3QYHB 4ZGEB 3CCMA 4C92B 1Q7YU 4M78C 3X25B 4QVDA 1WJQA 2ZPBB 5LJ5j 2ZPFB 1M9SA 1JB0E 4C8QB 4M7DG 1H641 4M7DF 3MCAB 4FSXA 3I55T 3CC7T 5GAMg 3L2QA 3GOXA 1VQ5T 2EQKA 4FT4A 3OSVA 4LDYA 3P8HA 2MMPA 4OGEA 5CKFA 4C5GA 1XNIA 3OYIA 2JTFA 1K9MU 3M53A 3DB4A 4IUUA 3OYLA 3TREA 4FIBA 3OMCA 1NJIU 4M7AC 3ASKA 4BE1A 3KUFA 3GNFB 3VV0A 4C92E 5CKBA 2F5KA 4KBMB 1G5VA 2LT1A 2EIFA 3FIFA 4M7DA 5IT9E 1VQLT 2LTOA 2M9UA 4M75G 1I4K1 4M78A 3OYFA 2QA4T 3JCMf 4OB3B 1YJNT 4PJOD 1M8VA 2DJZA 1N9RA 4XTYA 3CXCS 1VQ6T 2RA2A 3NTIA 2RD1A 5CVIA 2V8KA 3OS5A 1Q86C 1UGPB 1VQ4T 3CC2A 1VQKA 4HT9A 1UGSB 4JLIA 5GAMe 3L2RA 3A8GB 4BDZA 1W2BA 2E12A 1WJRA 1VIEA 5LJ3h 4E7KA 1KC8C 4EMHA 1WPYA 2E65A 3KXTA 2PQWA 2KY9A 4A4GA 4DOVA 5CIUA 2MWPA 4JLGA 1ZBXA 4F7UB 5DLQE 4F7UA 5FU6B 3SD4A 4CI0C 1VIFA 2R58A 3GIBA 4RKUE 3C4SA 1VQ5A 3FJPA 4RG2A 2DK3A 2X4YA 5KH6A 1X01A 2E1HA 1TH7A 4EMKC 1LJOA 4J6YA 2RJCA 4N0AA 3OYEA 3PNWC 5GAOr 3H8ZA 4M77F 3HSBA 3MO8A 3RUXA 1BIBA 5LJ5f 1O75A 4E7JA 5HK3A 3JCMb 1B34B 1NE8A 1LOJA 2DTHA 5GAOp 2JTMA 1OZ2A 2GFAA 4XQ3A 4PJOC 5I2MA 3QYGB 4HCZA 4RCCA 2DTOA 3J80E 5GANd 3G6ET 3G71T 1YJNA 5I2SA 1Q86U 1VQ8A 4M77E 5J39A 1Q81U 3CMAT 3QJYA 4M78D 4M7AD 4PNOA 1WNLA 2E10A 2LCCA 2AHJB 2MF2A 1Y7XA 4C92F 3MP6A 1VUBA 5EG2A 3CMET 3CD6A 3OBYA 3JCMQ 1JBMA 1VQ9A 2L5QA 2XD0A 2KVQG 1OI1A 2P0PA 1VQMT 1Y96B 2L3RA 5CKHA 4C8QA 3G4SA 2KK4A 2DVEA 2XG8D 1UB4A 4C0FA 3CXCA 3CPWS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SSF A;  2EFI A;  4FL6 A;  3MEU A;  4IUV A;  2BUD A;  3M9Q A;  4QQG A;  2L89 A;  3MP8 A;  3OYD A;  4L59 A;  2RO0 A;  2RHU A;  3OS1 A;  1OYX A;  4FU6 A;  3OYC A;  1KHC A;  1WGS A;  4C5I A;  2IG0 A;  2RHI A;  2RJD A;  3PFS A;  4QVZ A;  3L2W A;  2B8A A;  2DIG A;  3FLG A;  3L42 A;  2D9T A;  3OYK A;  4PLI A;  3OS0 A;  4BE0 A;  3OYN A;  4LD6 A;  4ZTJ A;  2LDM A;  2RHY A;  2L8D A;  4IUQ A;  3NTH A;  3FEO A;  3S6W A;  4B9X A;  2RJE A;  5D6X A;  4QW2 A;  3OY9 A;  1H3Z A;  3OQ5 A;  3OYJ A;  3LGL A;  3UWN A;  4B9W A;  5C6S A;  3QII A;  4X34 A;  2R5M A;  1WJQ A;  2RJF A;  2X4X A;  3LX7 A;  3MEA A;  4GY5 A;  5D6Y A;  2EQU A;  2GFU A;  4A4F A;  4BDY A;  3L2Q A;  3GOX A;  5IN1 A;  2EQK A;  3P8H A;  2M16 A;  4C5G A;  1XNI A;  4IUR A;  2JTF A;  3OYI A;  2M0O A;  5FRN A;  3DB4 A;  2R57 A;  4IUU A;  4PL6 A;  3OYL A;  3O8V A;  2XDP A;  3PMI A;  3OMC A;  4IUT A;  2VYT A;  2E5Q A;  3E9G A;  3ASK A;  3L2V A;  4BE1 A;  2EQM A;  3KUF A;  3MEW A;  2G3R A;  2CKK A;  2F5K A;  4N4I A;  4E7L A;  1G5V A;  2NLU A;  2LVM A;  2WAC A;  4IUP A;  2LTO A;  2X35 A;  3F70 A;  2RI3 A;  3OYF A;  2BKD N;  4Q5W A;  3DLM A;  2XK0 A;  2X4W A;  3LGF A;  2BIV A;  2O4X A;  3LLR A;  3NTI A;  3LYI A;  4NS5 A;  2RI5 A;  2RHX A;  1RI0 A;  2RHZ A;  3OS2 A;  3Q1J A;  5FRO A;  1OZ3 A;  3FDR A;  3L2R A;  4BDZ A;  3QJ6 A;  3MP1 A;  1WJR A;  4E7K A;  3LH0 A;  5FRM A;  2PQW A;  3DB3 A;  2GF7 A;  3EAE A;  4A4G A;  3L2U A;  5CIU A;  2MWP A;  3OYG A;  3ME9 A;  4CRI A;  2LRQ A;  4OVA A;  4EDU A;  2P0K A;  2R5A A;  3OYB A;  3SD4 A;  2R58 A;  3E9F A;  2EKO A;  3UT1 A;  4ZTF A;  4C5E A;  3C4S A;  2EQJ A;  3QKJ A;  4C5H A;  4A4H A;  4RG2 A;  1MHN A;  2X4Y A;  4E7H A;  5KH6 A;  2O4X B;  2YRV A;  3MEV A;  2HQE A;  5J26 A;  3OA6 A;  2HQX A;  2RJC A;  3OYE A;  4BE2 A;  4PLL A;  3PNW C;  3H8Z A;  4II1 A;  3OYA A;  3H6Z A;  3MO8 A;  3BDL A;  3MET A;  3OB9 A;  2K3X A;  3S3O A;  4E7J A;  4BD3 A;  2RI2 A;  4QQD A;  3QBY A;  2M1H A;  4IKF A;  4UC4 A;  1OZ2 A;  2GFA A;  4HCZ A;  4QQ6 A;  4Z02 A;  2DIQ A;  4BAC A;  3OYM A;  4A4E A;  5J39 A;  2FHD A;  1WJS A;  2K3Y A;  5C0M A;  1N27 A;  2LCC A;  2QQR A;  4N4H A;  4E7I A;  2JZ2 A;  5KCH A;  3PMT A;  5KE2 A;  3MP6 A;  5D6W A;  5IAY A;  3OMG A;  2E6N A;  3NTK A;  3FC3 A;  1OI1 A;  2QQS A;  3P8D A;  5KE3 A;  3OYH A;  5M9O A;  5KCO A;  2L3R A;  4N4G A;  2DAQ A;  3S3M A;  2MWO A;  3CEY A;  3S3N A;  3ZEH A; 
#chains in the Genus database with same CATH topology
 3AHU A;  5GAM h;  4XU1 A;  1KC8 R;  1S1N A;  3JCM X;  3RKX A;  2DER A;  2HMA A;  4C0D B;  3M55 A;  2RJD A;  2YLC A;  4TVR A;  3V7S A;  3L2W A;  2IPO B;  3FLG A;  4M75 E;  3TSW A;  3G7Z A;  1G3S A;  1OOT A;  5GMK j;  4JPB W;  4OMO A;  5CO7 A;  2RJE A;  3I5R A;  4HCC A;  3SB2 A;  4B9W A;  5C6S A;  5LJ3 g;  2QA4 Q;  4M78 F;  1KQS A;  2MI6 A;  4EIK A;  2K5L A;  3V7R A;  4MDX A;  4C8Q D;  1YI2 Q;  2E41 A;  2PVG B;  4AG2 C;  1NEG A;  2E5Q A;  2KDS A;  4DQ2 A;  1SKU B;  2CKK A;  3I55 A;  3RKY A;  2X35 A;  2DD4 A;  4B6M A;  1C1A A;  2IIM A;  1BIA A;  1N9S A;  4DBR A;  4MML A;  3JCM c;  3QWX X;  1VQN A;  1RI0 A;  5GAN j;  2DET A;  2CDT A;  1NJI R;  1I81 A;  1ZHI A;  3LH0 A;  2GF7 A;  1K0S A;  1SRM A;  4J7I A;  1GCQ A;  5CKD A;  2R5A A;  3OW2 S;  1VQ4 A;  1PG5 B;  3CC2 T;  2EQJ A;  4F7U F;  1QP3 A;  2RF0 A;  3CPW P;  1YNZ A;  4II1 A;  4M7D E;  4XU0 A;  4M7D C;  4J6W A;  2KT1 A;  3ZL7 C;  1BI2 A;  3EGX B;  1NPP A;  1R0C B;  5KYN A;  5GAN 6;  2K3Y A;  3EGD A;  4MZM A;  1RAH B;  4PFP A;  4VUB A;  5GAN f;  2L0A A;  1SG5 A;  1JJ2 P;  2PNI A;  3X28 B;  2MYS A;  1AZG B;  2KSS A;  2GNC A;  2VAS A;  1WLP B;  1YI2 T;  4M4Z A;  4OF1 A;  2Y90 A;  3OYH A;  1K4U S;  4M75 D;  4PJO G;  4MZT A;  5GAO q;  1UJY A;  2MWO A;  1NZ9 A;  2KBT A;  1M3B A;  1N5Z A;  1VYV A;  2AZS A;  3M9Q A;  2QQ9 A;  1JJ2 S;  2LNH B;  1VQ8 Q;  4RMO A;  1YWP A;  2AT1 B;  2IG0 A;  1U1T A;  2V26 A;  4C92 D;  1YFN A;  2QQB A;  1QVF A;  4EMK B;  1ZBJ A;  4E47 A;  4E7Z A;  2D8J A;  3GLX A;  4RTT A;  4PFZ A;  3CCR A;  2P0Q A;  1QLY A;  3EG2 A;  1UTI A;  1N6A A;  2OX7 A;  3QDF A;  3VRZ A;  1KQ1 A;  1H92 A;  5D6Y A;  3DLL A;  2CUB A;  5A0G A;  2YSQ A;  5GAN h;  2M51 A;  1BYM A;  4RTV A;  5FRN A;  4RTW A;  2V8I A;  5CKE A;  2XDP A;  3A8M B;  5LJ5 h;  5I21 A;  2D8H A;  4E7L A;  3TVT A;  3CCU T;  1WXU A;  1EIF A;  2Y4Y A;  1FMK A;  5DLO A;  4E7S A;  4M75 B;  4C0G A;  4J9C A;  1VQO Q;  3CCQ A;  1YP5 A;  4HVV A;  2V1Q A;  5GAM d;  4QKU A;  5CR2 A;  1JEG A;  4JZ3 A;  2FZK B;  2PU9 B;  2QGG A;  4OVA A;  2CUD A;  1IO6 A;  2E3I A;  2EGA A;  1UHC A;  5LJ3 e;  4D8D A;  1YHQ Q;  3OA6 A;  5LJ3 d;  2F5T X;  3HRT A;  1KHI A;  2LCL A;  4C8Q E;  1Y07 A;  1X75 C;  4M78 B;  4A4E A;  3CCL T;  2GQI A;  1R0B G;  3A8H B;  3URG A;  2CZ6 B;  1YIT A;  1WHH A;  2D0Q B;  2FG0 A;  1WI7 A;  1U3O A;  2DAQ A;  3QXE B;  3QO3 A;  1ZQ1 A;  3EHQ A;  2BE9 B;  3VUB A;  2RHU A;  3OS1 A;  1XTD A;  2F2X A;  1WGS A;  1HJD A;  4QVZ A;  3CCE Q;  4EPC A;  4BE0 A;  1RUW A;  4C92 C;  4ZTJ A;  4ZGD B;  4EMG A;  2O31 A;  2DD5 A;  2HKN A;  2W0Z A;  1UGQ B;  3H0I A;  4BB7 A;  2LQ8 A;  2VUB A;  2DJQ A;  4PL6 A;  2VC8 A;  1M3A A;  4JRK A;  3WXM B;  2NLU A;  1SEM A;  4KUD K;  4IUP A;  4JZ4 A;  3UAT A;  3HRS A;  2BIV A;  4FCY A;  2DXB A;  4PJM A;  3E1S A;  2MCN A;  2K5F A;  1TUC A;  3A98 A;  1QMC A;  1E6H A;  2DKG A;  5FRM A;  2E70 A;  4C0Z A;  3JB9 H;  1I5O B;  4EDU A;  1U8R A;  1K9M C;  2P0K A;  2OAU A;  3NFC A;  3OYB A;  3T9N A;  3R6N A;  1YBY A;  2D1X A;  3FB9 A;  4GBQ A;  2HQE A;  2I0N A;  2HQX A;  1S72 A;  2FZC B;  3OYA A;  2K3X A;  1IHV A;  2FZG B;  1G3Y A;  2ZPE B;  4M7A A;  4L5G A;  1VQ9 T;  2DXT A;  3WVD B;  1KQ2 A;  3CCM T;  1RAI B;  3L2Z A;  5D6W A;  5IAY A;  3ZFJ A;  2X3X D;  3HRU A;  3QZ9 B;  4ZGJ B;  1TUD A;  2VVK A;  1W2B P;  3VUZ A;  3A8O B;  1YWO A;  5LJ5 g;  4JRI A;  5HY6 A;  2JXB A;  4J7F A;  1NG2 A;  3PFS A;  1JU5 C;  2OTJ T;  4M77 D;  2O88 A;  1IZ6 A;  2O9V A;  4J9B A;  5GAO m;  1VQK T;  3CBP A;  3OY9 A;  2A3L A;  5LJ3 f;  5GAO l;  2JS2 A;  3V8K A;  2RQW A;  3QYH B;  4ZGE B;  4QVD A;  2ZPB B;  1NM7 A;  1M9S A;  1H64 1;  4M7D F;  4PJJ A;  1X6B A;  2DL8 A;  5CKF A;  4C5G A;  3HTR A;  2JTF A;  3DB4 A;  4FIB A;  1WX6 A;  3ASK A;  4BE1 A;  1ZSZ B;  3GNF B;  2F5K A;  1TS9 A;  1AWJ A;  2EIF A;  5KYX A;  5IT9 E;  4M7D A;  1VQL T;  2KRS A;  4OB3 B;  2RA2 A;  4J9E A;  4K11 A;  2RD1 A;  1UJ0 A;  2X3W D;  5CVI A;  2QDL A;  2V8K A;  2A08 A;  8ATC B;  1D0X A;  1UGS B;  3A8G B;  5LJ3 h;  1VIE A;  4GLM A;  2RQT A;  4A4G A;  1WHL A;  2EYY A;  4F7U A;  1UHF A;  1Z9Q A;  4CI0 C;  3GIB A;  3CCM Q;  1PD1 A;  5EC7 A;  2DRK A;  5KH6 A;  2RJC A;  2OTL Q;  4KRT A;  1BIB A;  5HK3 A;  1NE8 A;  2JTM A;  5I2M A;  3QYG B;  3J80 E;  1OU9 A;  4DBQ A;  2JS0 A;  1PM3 A;  1MUZ A;  2J6F A;  1K0X A;  2L3P A;  2FEI A;  1YIJ Q;  3CD6 A;  2ZAE A;  2L5Q A;  2XD0 A;  1Y57 A;  1Y96 B;  4LUD A;  3UF4 A;  2L3R A;  1X69 A;  2DVE A;  1UB4 A;  4C0F A;  4DOV A;  2EFI A;  4FW1 A;  2CGH A;  2BUD A;  3EG9 B;  2NUP B;  4FU6 A;  1G3T A;  1JO8 A;  1C6V X;  1V76 A;  2YLB A;  3OYN A;  2LDM A;  4OMF B;  5KYU A;  2HD0 A;  4QW2 A;  1NLO C;  4O6J A;  2EJF A;  3JCM e;  3JCM P;  1VQ6 Q;  4JS5 A;  1ZUK A;  4XTU A;  4OML A;  4KGX B;  1WZO A;  3VS5 A;  1YJW Q;  4PJN A;  2E3H A;  1BCM A;  2CT4 A;  2QEX Q;  2F1L A;  1M3C A;  3CC7 A;  4XTZ A;  5FU6 C;  1TSF A;  5LJ3 j;  3M57 A;  3X20 B;  3J81 E;  2RI5 A;  4XK8 E;  3BW1 A;  1O9S A;  3UDC A;  3FDR A;  4AFZ C;  1AWW A;  2FO0 A;  1PSF A;  3DKM A;  1YI2 A;  4LE9 A;  2O9S A;  1PD0 A;  2DXC A;  4XTX A;  2J6O A;  3UT1 A;  3E9F A;  4C5H A;  4A54 A;  3SDZ A;  2DFU A;  5J26 A;  2G6F X;  3C94 A;  2E6Z A;  4F04 B;  1IGQ A;  3JB9 J;  1GBQ A;  2DEU A;  3CCR T;  2K6D A;  2YUO A;  5GMK i;  2KE9 A;  1VYU A;  2FHD A;  2A37 A;  1SHG A;  3HL8 A;  2QQR A;  3P8B B;  4NL2 A;  4XU2 A;  1TG0 A;  3JB9 I;  3RMS A;  4JUV A;  3SHW A;  3RER A;  1X27 A;  2QAS A;  1GFD A;  3CMA A;  2DF6 A;  1M4Z A;  3CCS A;  1I07 A;  3EG3 A;  3JAM E;  3CME A;  3HHT B;  2K9G A;  1D3B A;  2RHI A;  4KT0 E;  3G4S T;  2GQV A;  3L42 A;  3CCQ T;  3JRZ A;  4PLI A;  4M7A F;  2AIR B;  1WHK A;  3VRY A;  3VS1 A;  2VWF A;  4R0K A;  1VQ7 A;  4YTL A;  1U1S A;  1UG1 A;  1MGQ A;  2IVW A;  3SWN C;  4KH1 B;  2ROL A;  3JB9 G;  1OQK A;  2RM4 A;  4BDY A;  4ZNX A;  1IHW A;  3KFV A;  3FRN A;  1RI9 A;  2RN8 A;  2JVV A;  2Z0W A;  3M56 A;  4HA8 A;  4M75 C;  4OMM A;  4IUT A;  3E9G A;  1KJW A;  1QCF A;  1VQK Q;  1VQM Q;  2QYZ A;  2CP2 A;  3RMQ A;  1VQP Q;  1VQL Q;  5GAN 5;  2LT4 A;  1GL5 A;  1K9A A;  1QVG A;  4ELY C;  2DA9 A;  2RHZ A;  4R56 A;  3QJ6 A;  1YIT T;  1WDX A;  2HBP A;  2K7A A;  3JB9 F;  3NHN A;  2F2V A;  1Q82 R;  2JM9 A;  3H9N A;  4PJO E;  1MHN A;  3MEV A;  4LXC A;  4BI8 B;  4LNP A;  4HXJ A;  2HCK A;  1IB8 A;  4FM4 B;  3OB9 A;  3CC4 Q;  4BD3 A;  2K5I A;  3G4S Q;  1OUL A;  3M59 A;  4MDW A;  2K2V A;  1FWZ A;  4RTZ A;  4C8Q G;  1WJS A;  2JT4 A;  2JMA A;  2DIL A;  1OX8 A;  3RIR A;  2FB7 A;  1AWO A;  3OMG A;  5A2Q E;  3NTK A;  3QDR B;  3EFR A;  4QT7 A;  5FLX E;  5DY9 A;  2OAW A;  5CQY A;  4IUV A;  4BUG A;  4V2S A;  2PVO B;  3LH5 A;  1M1K C;  2RO0 A;  4C5I A;  1W2B S;  2D9T A;  1B7T A;  1X43 A;  2RHY A;  4JDS A;  4IUQ A;  1YJ9 T;  2LJ3 A;  3NPF A;  4NOY A;  1RLP C;  3A8L B;  3I56 Q;  4GY5 A;  2EQU A;  3UPU A;  4LUE A;  4F7U E;  2ESW A;  4FYX B;  1VQP A;  3J7A F;  4GLK A;  1VQ6 A;  2LMJ A;  2QI2 A;  1I8F A;  2EJ9 A;  2HSE B;  3EGD B;  1M1K U;  5IH2 A;  3H0F A;  4N4I A;  4AFQ C;  1MMG A;  1K8A R;  2J7I A;  4FSS A;  1WQ7 A;  2EW3 A;  3M0T A;  2D6F A;  2X4W A;  3LYI A;  4DEY A;  3RES A;  3CCU A;  1WXB A;  5FRO A;  4DOW A;  1RAC B;  1X6G A;  3LWH A;  3CME Q;  4C92 G;  1FXX A;  2A0F B;  2ZPG B;  4ZTF A;  4PK4 A;  2DYB A;  2EJG A;  1GRI A;  3QHS A;  3G71 A;  4E7H A;  4M75 A;  5FWB A;  1ZUU A;  1NYG A;  2KGT A;  1VA7 A;  1RL2 A;  1PNJ A;  4J9I A;  4C0D C;  4ATO A;  4C8Q C;  5GMK m;  1KFZ A;  4J5Y A;  4UC4 A;  1M1K R;  1Q95 G;  1Q82 U;  4X9C A;  2RK1 A;  3OYM A;  1I1J A;  2WSE E;  4HCB A;  2CP5 A;  3QWY A;  2FPE A;  3PMT A;  1M30 A;  2AKK A;  1YCY A;  2OTJ Q;  1MMD A;  4KH0 B;  4PJO B;  2ZZD A;  3PIP A;  1RAG B;  1VQL A;  3A1P A;  1AVZ C;  2P4T A;  2QDY B;  1WQW A;  6AT1 B;  4FYY B;  2CZ1 B;  2EWN A;  2B8A A;  5CCA A;  1Q82 C;  3CXC P;  4LD6 A;  2QAZ A;  2HKQ B;  2XMF A;  3NTH A;  2ABL A;  2K57 A;  2J06 A;  5D6X A;  1WIE A;  1U5S A;  2QTV A;  1Q7Y U;  2CP3 A;  1WJQ A;  1JB0 E;  2LJ1 A;  4C8Q B;  3MCA B;  1IGU A;  4OGE A;  4LDY A;  3MJX A;  3OSV A;  1SHF A;  5L23 A;  1HSQ A;  2DMO A;  1T3L A;  3OYI A;  3OYL A;  4D8K A;  3CCR Q;  2GTJ A;  1ZA1 B;  5CKB A;  4KBM B;  3UA7 A;  3CCL Q;  1D0Z A;  4M78 A;  2CH4 A;  3JCM f;  2DJZ A;  3EH1 A;  1PKT A;  4HVW A;  1OPK A;  2KRO A;  1UEC A;  5GJV B;  2BZ8 A;  2DL3 A;  4JLI A;  1PHT A;  1W2B A;  2E12 A;  4EMH A;  1WPY A;  3KXT A;  2PQW A;  3EFO B;  2KY9 A;  1B3Q A;  5CIU A;  2DL4 A;  4F7U B;  1PWT A;  1K73 R;  3THK A;  1VQ5 A;  3FJP A;  4RG2 A;  1K1Z A;  2DK3 A;  2X4Y A;  3M0R A;  1X01 A;  1T0J A;  1TH7 A;  3PNW C;  3H8Z A;  1WHG A;  3HSB A;  3MO8 A;  3RUX A;  2PTK A;  5LJ5 f;  4E7J A;  3I5S A;  2HZY A;  3VS3 A;  1B34 B;  1LOJ A;  3D7S B;  4XQ3 A;  2DTO A;  1YJN A;  2AZV A;  1D1B A;  4M78 D;  2P84 A;  4M7A D;  4PNO A;  1ZSZ A;  4HVU A;  2MF2 A;  1VUB A;  5EG2 A;  2DRM A;  2DBK A;  3TSZ A;  1VQ9 A;  1JBM A;  1UGV A;  1OI1 A;  2P0P A;  1VQM T;  4RTY A;  5CKH A;  2LZ6 B;  2KK4 A;  2XG8 D;  3CCM A;  3EG1 A;  3CXC A;  2OTL A;  4HKE A;  1B07 A;  2L89 A;  3OYD A;  4PJO F;  1EFN A;  4P5N A;  5IHI A;  1JJ2 A;  1SRL A;  2ZCF B;  1MMN A;  2DLP A;  5AYF A;  1QVG S;  1GCQ C;  3FEO A;  3MKD A;  3G6E A;  1BU1 A;  3OQ5 A;  2XKO C;  1VQ8 T;  2BZX A;  2BZY A;  1Q86 R;  2RJF A;  4JS4 A;  5HCK A;  2KI7 A;  2RQU A;  3HP9 A;  1I0C A;  2M16 A;  2JN0 A;  2SRC A;  3BDU A;  1CKA A;  2DX1 A;  2JW4 A;  4AG1 C;  1B34 A;  2G3R A;  2VGM A;  3CBO A;  2WAC A;  3CCE T;  1BKB A;  1FX7 A;  1OU8 A;  5CQX A;  1YHQ A;  4M7A B;  2O4X A;  4OB1 B;  3EGX A;  1G3W A;  1XJW B;  1ZX6 A;  3N5B B;  3VJP A;  4DA4 A;  5GAM j;  4RCB A;  3Q1J A;  3MP1 A;  1NEB A;  1T3S A;  3C95 A;  3PVL A;  1TWB A;  4Z88 A;  1S72 Q;  3EFO A;  2CP0 A;  1YIJ T;  4M7A E;  4J83 A;  4A53 A;  4RTX A;  3GP8 A;  4M77 G;  4C5E A;  4A4H A;  1QWF A;  2YRV A;  5KYW A;  4IIO A;  1HYO A;  4Z8A A;  2NUT A;  4PLL A;  4F17 A;  1M8M A;  2FL7 A;  5GAN 2;  2JOY A;  4BI4 A;  1VQ7 T;  2XID A;  4FW2 A;  4IKF A;  5LJ5 e;  2E64 A;  2L3S A;  3CCV T;  2XDB A;  1K73 U;  1NPR A;  4IIM A;  3LWI A;  3M0S A;  4PFO A;  2L2P A;  1AZE A;  2DPP B;  3RKW A;  4LDV A;  4KGZ B;  3FC3 A;  1YIT Q;  2HNI A;  3EFS A;  4LDU A;  3ZEH A;  4A63 B;  2QEX T;  4QQG A;  4EMK A;  2LJ0 A;  5KYY B;  2COW A;  4LDW A;  3VYH B;  3E19 A;  1LPL A;  3CCJ T;  2E5K A;  4BY6 C;  1K73 C;  1OX9 A;  2H3J A;  1QW1 A;  1H3Z A;  4PKC C;  2HSP A;  4M77 A;  2NUP A;  3EG9 A;  2GGR A;  2GTO A;  2CZ7 B;  2D0N A;  1J3T A;  2I2L A;  1VQ5 Q;  3EHR A;  3MEA A;  5LL6 S;  4A4F A;  2DEQ A;  4JJN K;  3AT1 B;  4C8Q F;  3M4G A;  4MMK A;  1M90 R;  1IXD A;  2EKH A;  1FMV A;  2GCX A;  2C0T A;  3MEW A;  1MND A;  1R77 A;  4ZN3 A;  3SFM A;  2H8H A;  2RI3 A;  3O5Z A;  2YT6 A;  1M2V B;  5GAN 4;  2RHX A;  1OZ3 A;  3CMA Q;  2LQN A;  2PVD B;  4F7U G;  3L2U A;  2MPX C;  3PGG A;  1QWE A;  2J6K A;  4CRI A;  4R55 A;  4DEX A;  2HAX A;  2CP7 A;  2JMC A;  2PUK B;  4E2F B;  2EQI A;  1GXI E;  4M7D D;  5GAN g;  4XU3 A;  1AOJ A;  2OI3 A;  2OJ2 A;  2COY A;  4QQD A;  1AHJ B;  2EGE A;  5FU7 C;  1M90 C;  3JCM h;  2DVJ A;  2QK0 A;  1Y71 A;  4Z02 A;  1YJ9 A;  1YJW A;  4LN2 A;  1RAF B;  4HT8 A;  4JJB A;  3I56 A;  3M5A A;  1D0Y A;  3CC4 T;  4JRQ A;  1GBR A;  5GAN 7;  1KD1 R;  1YJN Q;  1VQP T;  2EPD A;  1KK7 A;  5KE3 A;  2L3Q A;  2ECZ A;  2RB6 A;  1QCN A;  1Q7Y R;  2JJ9 A;  4M77 B;  3A5Z B;  3CCS T;  3QUI A;  1M90 U;  3TQ7 P;  1K9M R;  1X2Q A;  1M5Q 1;  2VB6 A;  1UGR B;  1WHJ A;  3L1A A;  1D3B B;  2MAM A;  2ED0 A;  2CS7 A;  4XTV A;  5A0L A;  3CPW A;  4OMP A;  2XU8 A;  2R5M A;  4F16 A;  3CC2 Q;  4Y28 E;  2GBQ A;  5FU7 B;  3C12 A;  2X4J A;  1AWX A;  1W4S A;  2V1R A;  5IN1 A;  2DBM A;  3VYG A;  2M0O A;  1E6G A;  3O8V A;  2ZGW A;  3OYY A;  3X26 B;  4ORZ A;  3I9Q A;  2O01 E;  1W6X A;  5CAI A;  2LVM A;  2CH4 W;  5AT1 B;  3F70 A;  1QCO A;  2MK5 A;  2ATC B;  3DLM A;  1T0H A;  2A7Y A;  3V8L A;  4ZN1 A;  2K4Y A;  2PUO B;  1GCP A;  2ED1 A;  3VS2 A;  2QG9 B;  1VQO T;  1Q7Y C;  1KSW A;  1ABQ A;  2FYK A;  3EAE A;  3JCM J;  1ACM B;  2LCS A;  2LRQ A;  2YUN A;  3X24 B;  2VV5 A;  1X2K A;  1PSE A;  3CCJ Q;  1LNX A;  4RG8 A;  3QKJ A;  1QVF P;  1VYT A;  3ZBD A;  3MHX A;  1K8A C;  3INZ A;  5IHK A;  4BE2 A;  2WSC E;  5GAN e;  3IQL A;  3H6Z A;  2MOX A;  3MPU B;  3MET A;  1D1C A;  4AT1 B;  3KBG A;  5GMK l;  3S3O A;  4LDX A;  2YHT A;  3REA B;  3JB9 D;  4QQ6 A;  3ULR B;  1RLQ C;  2JTE A;  4M78 E;  3CCV Q;  3I55 Q;  4DBF A;  3HFN A;  1AT1 B;  3TU4 K;  2E6N A;  2FVU A;  4OMQ A;  1QKX A;  3EGU A;  2K3B A;  4XTW A;  2RQV A;  2RQR A;  3M54 A;  5KCO A;  1MNE A;  2KAF A;  3PTA A;  1NJI C;  3H41 A;  1UFF A;  5KYY A;  1AEY A;  3M4Y A;  1MMA A;  1VOM A;  4CC4 B;  1ZA2 B;  2L8D A;  4N0A C;  1QVF S;  1SSH A;  4CC3 A;  3JCM W;  1IRE B;  1XQH A;  4J9F A;  1CSK A;  2KXD A;  2LP5 A;  1RAB B;  4ESR A;  1PKS A;  3I55 T;  2EBP A;  3GOX A;  1VQ5 T;  2FRW A;  4FT4 A;  3P8H A;  1XNI A;  2YRD A;  8AT1 B;  3OMC A;  1NJI U;  4M7A C;  4J9G A;  3VV0 A;  2C0I A;  2M9U A;  4M75 G;  2QA4 T;  4PJO D;  1YJN T;  2KYB A;  3CQT A;  1N9R A;  4XTY A;  1N8R R;  1VQ6 T;  3NTI A;  1BB9 A;  1M27 C;  4AMC A;  1UUE A;  3VS7 A;  1D09 B;  1Q86 C;  1UGP B;  1VQ4 T;  3CC2 A;  1D1A A;  3L2R A;  4BDZ A;  1KC8 C;  1WJR A;  4E7K A;  2MWP A;  4JLG A;  2CP6 A;  1QQJ A;  1BK2 A;  4Z89 A;  4RKU E;  3C4S A;  3EH2 A;  5FWC A;  4PJL A;  4EMK C;  1LJO A;  2J05 A;  2FRY A;  1H8K A;  2NUZ A;  2KEA A;  3C0C A;  2YRC A;  5D7U A;  2DTH A;  3PVQ A;  2KR3 A;  1JXO A;  1OZ2 A;  3SEM A;  3G6E T;  3G71 T;  1Q86 U;  5GAN d;  1VQ8 A;  2AKL A;  4M77 E;  5J39 A;  1Q81 U;  2COZ A;  2E10 A;  1Y7X A;  4C92 F;  3MP6 A;  1EZZ B;  1ZLM A;  3UA6 A;  5IXB A;  2YDL A;  4C8Q A;  4FL6 A;  3M0P A;  4C92 A;  5GAO n;  1FMW A;  1XOV A;  4ELZ C;  4L59 A;  3I35 A;  3LW5 E;  1TTH B;  1ZUY A;  1FYN A;  5GAM f;  2DNU A;  5HKC A;  3OS0 A;  1HXD A;  2LX9 A;  3CPF A;  4KUI A;  4B9X A;  1Y96 A;  3OYJ A;  7AT1 B;  5LJ5 d;  1M1G A;  3G71 Q;  2VKN A;  3QG1 A;  4X34 A;  1QKW A;  2XI9 A;  4PJO A;  3LX7 A;  3CCQ Q;  2ENM A;  5GMK e;  1M1F A;  1RAD B;  3PMI A;  2Y4X A;  3CCU Q;  4OGC A;  3VS6 A;  2VXF A;  3G1J A;  2EYZ A;  2JNG A;  2MIO A;  1OEB A;  3CCV A;  1YCS B;  3NMZ C;  1RAE B;  3JSC A;  2JUF A;  4WF2 A;  5IXF A;  2EYX A;  3CD6 Q;  3PE0 A;  1H3H A;  2AK5 A;  2HL3 A;  4WTO B;  2P4R A;  5GAN 3;  1G2B A;  5DM7 R;  3TEE A;  1Q81 R;  1BCO A;  3JCM V;  3WVE B;  2WSF E;  2DZ9 A;  3CCL A;  1NBE B;  4M77 C;  4ME7 A;  1R8O B;  2BTT A;  2CRE A;  1KG1 A;  2RI2 A;  3QBY A;  2M1H A;  3FJ5 A;  3BE3 A;  2DIQ A;  2RH2 A;  4BAC A;  3CBM A;  5C0M A;  1N27 A;  2KMT A;  2KQW A;  4E7I A;  1VQN T;  5KE2 A;  1WYX A;  3GBQ A;  2LX7 A;  1W1F A;  3OSS C;  2CZ0 B;  2QXF A;  2VGN A;  3OW2 P;  4QVC A;  5M9O A;  2B86 A;  4KGV B;  3S3M A;  2E4H A;  2KYM A;  5FW9 A;  3CEY A;  5ECA A;  1W70 A;  2M02 A;  1JRI A;  1UE9 A;  3RR6 A;  1BI0 A;  4Y91 A;  1PRM C;  1VQM A;  2DIG A;  1F1B B;  3BY7 A;  2OTL T;  3M0Q A;  2W10 A;  3GPL A;  2ZPH B;  1CKB A;  2XHC A;  2CYZ B;  4MZP A;  1PCX A;  2NYS A;  2X4X A;  5GMK h;  4O5V A;  3OW2 A;  1DJ7 B;  4F14 A;  4IUR A;  1RAA B;  2NWM A;  2QTX A;  2R57 A;  3VU3 C;  3L2V A;  2EQM A;  4M78 G;  4M7A G;  3PIO A;  4Q5W A;  4HCK A;  3LGF A;  1YJ9 Q;  3RDV A;  1YJW T;  5KYW B;  2HQH A;  5I22 A;  3TCJ A;  3I56 T;  3CC4 A;  2EVR A;  3CCE A;  5CK9 A;  2KXC A;  1YHQ T;  3SWN A;  1WXT A;  3DB3 A;  5HK0 A;  1V1C A;  1S72 T;  2V8J A;  4WCI A;  4KUL A;  4M75 F;  2A28 A;  2EGC A;  3OBW A;  1QVP A;  5J3B A;  4ANJ A;  3PT9 A;  4D6W A;  2DTI A;  2HL5 C;  1GFC A;  2EAY A;  2FPD A;  2ROT A;  3H0H A;  3HKS A;  5GAN 8;  1KQS S;  2O4X B;  3ER0 A;  1YIJ A;  4X1V A;  3BDL A;  1IRX A;  1AD5 A;  3VS0 A;  1M2V A;  4L6V 5;  2CT3 A;  1BI1 A;  4JRP A;  5KYX B;  4M7D B;  1OV3 A;  1V29 B;  1VQ4 Q;  3QZ5 B;  2YUQ A;  1KIK A;  2CSI A;  2JZ2 A;  1I5L A;  1WA7 A;  2YUP A;  3HPW A;  3QSU A;  4BI3 A;  3QPH A;  1N8R C;  2OTJ A;  1ZSZ C;  1NYF A;  2C06 A;  1K8A U;  1SSF A;  5L8R E;  1M2O A;  3MP8 A;  1ABO A;  2LNV A;  1G83 A;  1LCK A;  1TOV A;  3OYC A;  2H3E B;  1PC0 A;  5GJW B;  1C0M A;  2QEX A;  2XIC A;  1VQO A;  3S6W A;  3RBB B;  2RK2 A;  2DXU A;  3LGL A;  3UWN A;  1HD3 A;  4OB2 B;  4BY6 B;  3QII A;  3GNG A;  3CCJ A;  1QP2 A;  3EG0 A;  4JJC A;  2GFU A;  3BFM A;  1N8R U;  2DL5 A;  2F69 A;  2HEQ A;  3VKI A;  1JQQ A;  1X6O A;  1BI3 A;  2VYT A;  2M0Y A;  2K79 A;  2LC4 A;  4AFS C;  1YN8 A;  1VQN Q;  4NL3 A;  3M58 A;  1SF9 A;  2DL7 A;  2XDD A;  1KD1 C;  2BKD N;  1ZSG A;  2QQA A;  2XK0 A;  3VS4 A;  3LLR A;  4FYV B;  4RTU A;  1JXM A;  4NS5 A;  4X9D A;  2DM1 A;  4J6X A;  3OS2 A;  2KRN A;  2KT8 A;  2NUT B;  4A4K A;  1SPK A;  3V8J A;  3SWN B;  4OMN A;  1OPL A;  3OYG A;  3ME9 A;  1UEB A;  1PRL C;  1G8X A;  5A0D A;  1MV0 B;  1KQS P;  1UDL A;  2A36 A;  3E2U A;  4OP0 A;  2EKO A;  2K2M A;  5IHN A;  4FYW B;  2YXY A;  2DYI A;  1K76 A;  1KD1 U;  4J8O A;  4OB0 B;  3CCS Q;  3CD6 T;  4XAX B;  2KNB B;  4CC2 A;  2DE0 X;  1TUG B;  3HFO A;  1KC8 U;  2ZPI B;  4N4H A;  3CC7 Q;  4DBH A;  2DO3 A;  5KCH A;  1BBZ A;  3GF5 A;  1HK9 A;  2QQS A;  3P8D A;  3JCM d;  1NLP C;  2LQK A;  4N4G A;  1A0N B;  2F2W A;  1TU0 B;  3S3N A;  3MEU A;  1P92 A;  3R6O A;  2C0O A;  4E6R A;  2EYQ A;  2QA4 A;  1OYX A;  1KHC A;  5KYU B;  2VXE A;  4LD9 K;  3OYK A;  2BE7 D;  4FT2 A;  1Q81 C;  3V7C A;  3RNJ A;  1Y0M A;  3JCM g;  2RMO A;  2DZC A;  4C92 B;  4M78 C;  3X25 B;  5LJ5 j;  2ZPF B;  1U06 A;  3M0U A;  4M7D G;  1E7O A;  4FSX A;  3CC7 T;  5GAM g;  2O2O A;  3L2Q A;  2EQK A;  9ATC B;  2MMP A;  1K9M U;  3M53 A;  4IUU A;  3TRE A;  4CC7 A;  2JM8 A;  2YWW A;  1VQ7 Q;  3KUF A;  4C92 E;  4JJD A;  1G5V A;  2LT1 A;  3FIF A;  4Y92 A;  2LTO A;  3OYF A;  1I4K 1;  4J9H A;  1M8V A;  4AFU C;  1LVK A;  3CXC S;  1TXQ A;  3OS5 A;  1ARK A;  4HT9 A;  1VQK A;  2RNA A;  1Z9Z A;  5GAM e;  2E65 A;  3JV3 A;  1EX4 A;  1MV3 A;  1WHM A;  1ZBX A;  5DLQ E;  2HBW A;  5FU6 B;  3SD4 A;  3U23 A;  1VIF A;  2R58 A;  1QVG P;  4RUG A;  2CSQ A;  2LQW A;  2E1H A;  4J6Y A;  4N0A A;  3OYE A;  1VQ9 Q;  2EYW A;  5GAO r;  4M77 F;  1WFW A;  2X9H A;  1O75 A;  3JCM b;  5GAO p;  4PJO C;  2GFA A;  4HCZ A;  4RCC A;  3REB B;  5I2S A;  5I11 A;  2HDA A;  3CMA T;  3NGP A;  2QGF B;  3QJY A;  1WNL A;  2LCC A;  2AHJ B;  3CME T;  2PZ1 A;  3OBY A;  4J9D A;  3JCM Q;  3G6E Q;  2FPF A;  2KVQ G;  2X51 A;  2KRM A;  3G4S A;  2RPN A;  2SEM A;  3CPW S; 
#chains in the Genus database with same CATH homology
 3AHU A;  2EFI A;  4FL6 A;  2CGH A;  5GAM h;  2OTL A;  4HKE A;  2BUD A;  4C92 A;  4XU1 A;  5GAO n;  1XOV A;  2L89 A;  4ELZ C;  3JCM X;  3OYD A;  4L59 A;  4PJO F;  3RKX A;  4C0D B;  3LW5 E;  4P5N A;  4FU6 A;  1G3T A;  3M55 A;  2RJD A;  1JJ2 A;  2YLC A;  4TVR A;  3V7S A;  5GAM f;  3L2W A;  3FLG A;  2ZCF B;  5HKC A;  2YLB A;  4M75 E;  3OS0 A;  3G7Z A;  3OYN A;  1G3S A;  1HXD A;  2LDM A;  4OMF B;  2LX9 A;  5AYF A;  5GMK j;  2HD0 A;  3CPF A;  1QVG S;  4KUI A;  5CO7 A;  3FEO A;  4B9X A;  2RJE A;  4QW2 A;  1Y96 A;  3G6E A;  3OQ5 A;  3OYJ A;  4HCC A;  3SB2 A;  2XKO C;  4O6J A;  4B9W A;  2EJF A;  3JCM e;  3JCM P;  1VQ8 T;  5C6S A;  5LJ3 g;  5LJ5 d;  1M1G A;  3QG1 A;  4JS5 A;  4X34 A;  4XTU A;  2XI9 A;  4M78 F;  4PJO A;  2RJF A;  3LX7 A;  1KQS A;  2MI6 A;  4JS4 A;  5GMK e;  2K5L A;  3HP9 A;  3V7R A;  4MDX A;  4C8Q D;  2E41 A;  2M16 A;  1M1F A;  2JN0 A;  3BDU A;  2PVG B;  3PMI A;  2Y4X A;  2E5Q A;  2KDS A;  4DQ2 A;  1B34 A;  4OGC A;  2G3R A;  2CKK A;  2VGM A;  2VXF A;  3CBO A;  2JNG A;  3I55 A;  3CC7 A;  2WAC A;  4XTZ A;  3RKY A;  3CCE T;  1BKB A;  2X35 A;  5FU6 C;  1FX7 A;  5CQX A;  5LJ3 j;  3CCV A;  1YHQ A;  2DD4 A;  4M7A B;  3M57 A;  3X20 B;  2O4X A;  1BIA A;  3J81 E;  4OB1 B;  1N9S A;  1G3W A;  3JSC A;  2RI5 A;  4XK8 E;  3N5B B;  4MML A;  3JCM c;  3VJP A;  2JUF A;  3BW1 A;  1RI0 A;  5GAM j;  4WF2 A;  4DA4 A;  4RCB A;  5GAN j;  1VQN A;  1O9S A;  3Q1J A;  3UDC A;  3FDR A;  3MP1 A;  1I81 A;  3C95 A;  1ZHI A;  3LH0 A;  1PSF A;  3DKM A;  2GF7 A;  1YI2 A;  1YIJ T;  4M7A E;  4J7I A;  5CKD A;  4J83 A;  4A53 A;  2R5A A;  3GP8 A;  2DXC A;  4XTX A;  5GAN 3;  4M77 G;  3UT1 A;  3E9F A;  3TEE A;  5DM7 R;  3OW2 S;  4C5E A;  1VQ4 A;  3CC2 T;  2EQJ A;  4C5H A;  3JCM V;  3WVE B;  4A4H A;  1QP3 A;  2WSF E;  3SDZ A;  4A54 A;  4F7U F;  2YRV A;  5J26 A;  2DZ9 A;  4PLL A;  3CCL A;  4II1 A;  3C94 A;  2E6Z A;  4M77 C;  4ME7 A;  1R8O B;  4M7D E;  4XU0 A;  4M7D C;  2FL7 A;  3JB9 J;  5GAN 2;  2JOY A;  4J6W A;  4BI4 A;  1BI2 A;  1KG1 A;  1VQ7 T;  2RI2 A;  2XID A;  3QBY A;  2M1H A;  4IKF A;  3CCR T;  5LJ5 e;  2E64 A;  3CCV T;  2XDB A;  1NPP A;  1K73 U;  5GAN 6;  2DIQ A;  2RH2 A;  5GMK i;  4BAC A;  3CBM A;  1NPR A;  2FHD A;  3LWI A;  2K3Y A;  3HL8 A;  5C0M A;  1N27 A;  2KMT A;  2KQW A;  2QQR A;  4E7I A;  1VQN T;  4MZM A;  3P8B B;  4NL2 A;  4VUB A;  5KE2 A;  4XU2 A;  2DPP B;  5GAN f;  3JB9 I;  3RKW A;  3RMS A;  4JUV A;  4LDV A;  3OSS C;  3X28 B;  2CZ0 B;  2QXF A;  3RER A;  2VGN A;  2KSS A;  1YI2 T;  3FC3 A;  3CMA A;  4OF1 A;  2HNI A;  2Y90 A;  1M4Z A;  4M75 D;  4PJO G;  4QVC A;  5M9O A;  3OYH A;  4MZT A;  3EFS A;  5GAO q;  3CCS A;  3S3M A;  2MWO A;  1NZ9 A;  4LDU A;  3CEY A;  3ZEH A;  2QEX T;  3JAM E;  3CME A;  3M9Q A;  1JRI A;  4QQG A;  3HHT B;  4EMK A;  2QQ9 A;  1JJ2 S;  4RMO A;  1BI0 A;  4Y91 A;  4LDW A;  1D3B A;  2IG0 A;  2RHI A;  1U1T A;  4KT0 E;  4C92 D;  1VQM A;  2QQB A;  3VYH B;  2DIG A;  4EMK B;  1QVF A;  3E19 A;  2GQV A;  3L42 A;  4E47 A;  3G4S T;  3CCQ T;  3JRZ A;  4PLI A;  3BY7 A;  3CCJ T;  4M7A F;  4BY6 C;  1K73 C;  3GLX A;  2OTL T;  2H3J A;  1VQ7 A;  1QW1 A;  1H3Z A;  3CCR A;  4YTL A;  2P0Q A;  1U1S A;  4PKC C;  3GPL A;  4M77 A;  2ZPH B;  2XHC A;  1MGQ A;  2IVW A;  2CYZ B;  3SWN C;  2CZ7 B;  4MZP A;  1N6A A;  1KQ1 A;  2I2L A;  2X4X A;  3MEA A;  5D6Y A;  3DLL A;  3JB9 G;  5A0G A;  5LL6 S;  4A4F A;  2RM4 A;  5GAN h;  2DEQ A;  4BDY A;  5GMK h;  4JJN K;  4O5V A;  1BYM A;  4C8Q F;  3OW2 A;  1DJ7 B;  3M4G A;  4IUR A;  3FRN A;  4MMK A;  5FRN A;  2QTX A;  2V8I A;  2R57 A;  5CKE A;  2JVV A;  3M56 A;  4HA8 A;  2XDP A;  4M75 C;  3VU3 C;  4IUT A;  3A8M B;  3E9G A;  3L2V A;  2GCX A;  5LJ5 h;  5I21 A;  2EQM A;  3MEW A;  4E7L A;  3CCU T;  4ZN3 A;  1YJW A;  4M78 G;  4M7A G;  3SFM A;  2RI3 A;  3PIO A;  1EIF A;  2Y4Y A;  3RMQ A;  4Q5W A;  3LGF A;  5DLO A;  1YJW T;  4M75 B;  5GAN 4;  5GAN 5;  4C0G A;  2LT4 A;  1QVG A;  3TCJ A;  3CCQ A;  4ELY C;  2RHX A;  3I56 T;  2RHZ A;  3CC4 A;  1OZ3 A;  3CCE A;  4R56 A;  3QJ6 A;  2PVD B;  5CK9 A;  1YHQ T;  5GAM d;  1YIT T;  3SWN A;  5CR2 A;  3DB3 A;  5HK0 A;  4F7U G;  3L2U A;  2HBP A;  2V8J A;  1S72 T;  3PGG A;  2PU9 B;  4KUL A;  4M75 F;  3JB9 F;  4CRI A;  4OVA A;  4R55 A;  3OBW A;  1QVP A;  5J3B A;  2HAX A;  3PT9 A;  4D6W A;  2DTI A;  2EAY A;  2PUK B;  4PJO E;  3HKS A;  5GAN 8;  1MHN A;  5LJ3 e;  1KQS S;  2O4X B;  3OA6 A;  3MEV A;  4BI8 B;  1GXI E;  5LJ3 d;  3ER0 A;  4M7D D;  2F5T X;  5GAN g;  1YIJ A;  4XU3 A;  4FM4 B;  3OB9 A;  3BDL A;  3HRT A;  1KHI A;  4BD3 A;  2K5I A;  2LCL A;  3M59 A;  4QQD A;  1AHJ B;  4L6V 5;  5FU7 C;  1Y07 A;  4C8Q E;  4MDW A;  1M90 C;  3JCM h;  1Y71 A;  1X75 C;  2K2V A;  1FWZ A;  4M78 B;  1BI1 A;  4Z02 A;  4A4E A;  1YJ9 A;  4JRP A;  4C8Q G;  3CCL T;  1WJS A;  4M7D B;  1V29 B;  3QZ5 B;  4HT8 A;  3I56 A;  3M5A A;  2JZ2 A;  3RIR A;  3A8H B;  2FB7 A;  3CC4 T;  1I5L A;  3URG A;  4JRQ A;  2CZ6 B;  3HPW A;  5GAN 7;  1YIT A;  3OMG A;  1VQP T;  3QSU A;  5A2Q E;  4BI3 A;  2D0Q B;  3QPH A;  3NTK A;  3QDR B;  1N8R C;  5KE3 A;  2OTJ A;  3EFR A;  2C06 A;  3QXE B;  2DAQ A;  5FLX E;  5DY9 A;  1K8A U;  3QO3 A;  2RB6 A;  1SSF A;  1ZQ1 A;  5CQY A;  4IUV A;  5L8R E;  4BUG A;  4V2S A;  2PVO B;  3MP8 A;  1M1K C;  2RO0 A;  2LNV A;  2RHU A;  4M77 B;  3VUB A;  3A5Z B;  3OS1 A;  1XTD A;  3OYC A;  1WGS A;  4C5I A;  4QVZ A;  3CCS T;  1W2B S;  3QUI A;  2D9T A;  4EPC A;  1M90 U;  4BE0 A;  4C92 C;  4ZTJ A;  2RHY A;  1M5Q 1;  4JDS A;  4ZGD B;  4EMG A;  1UGR B;  2XIC A;  3L1A A;  4IUQ A;  3S6W A;  1D3B B;  2MAM A;  2QEX A;  2RK2 A;  1VQO A;  2DD5 A;  2DXU A;  4XTV A;  2CS7 A;  3LGL A;  3UWN A;  5A0L A;  3CPW A;  1YJ9 T;  4OB2 B;  4BY6 B;  2XU8 A;  3QII A;  2R5M A;  1UGQ B;  4NOY A;  3GNG A;  4Y28 E;  3A8L B;  3CCJ A;  1QP2 A;  4GY5 A;  2EQU A;  5FU7 B;  3UPU A;  3C12 A;  2GFU A;  3BFM A;  1N8R U;  2X4J A;  4F7U E;  4BB7 A;  1W4S A;  2F69 A;  2LQ8 A;  5IN1 A;  3VYG A;  3VKI A;  2VUB A;  1VQP A;  3J7A F;  1X6O A;  2M0O A;  4GLK A;  1VQ6 A;  2QI2 A;  1I8F A;  1BI3 A;  4PL6 A;  2EJ9 A;  3O8V A;  2VC8 A;  2ZGW A;  2VYT A;  2LC4 A;  3OYY A;  3X26 B;  1M1K U;  2O01 E;  4JRK A;  4N4I A;  4NL3 A;  3WXM B;  2NLU A;  3M58 A;  4KUD K;  5CAI A;  2LVM A;  4IUP A;  2XDD A;  3F70 A;  1KD1 C;  1WQ7 A;  2BKD N;  2QQA A;  2D6F A;  3DLM A;  2XK0 A;  2X4W A;  3HRS A;  2BIV A;  2A7Y A;  2DXB A;  3V8L A;  3LLR A;  3LYI A;  4NS5 A;  4X9D A;  3RES A;  3E1S A;  4ZN1 A;  2K4Y A;  4J6X A;  2PUO B;  2K5F A;  3OS2 A;  3CCU A;  5FRO A;  4DOW A;  4A4K A;  1VQO T;  1Q7Y C;  2DKG A;  5FRM A;  2E70 A;  3V8J A;  2FYK A;  3EAE A;  4C0Z A;  3LWH A;  3SWN B;  3JB9 H;  3JCM J;  3OYG A;  3ME9 A;  1UEB A;  2LRQ A;  4EDU A;  1U8R A;  2P0K A;  2OAU A;  3NFC A;  2VV5 A;  3X24 B;  1PSE A;  5A0D A;  1K9M C;  4C92 G;  1FXX A;  3OYB A;  4OP0 A;  2EKO A;  2ZPG B;  1LNX A;  4RG8 A;  3T9N A;  4ZTF A;  3QKJ A;  1YBY A;  3FB9 A;  2EJG A;  3ZBD A;  3MHX A;  3QHS A;  3G71 A;  4E7H A;  1K8A C;  4M75 A;  3INZ A;  2HQE A;  4BE2 A;  2HQX A;  1S72 A;  1RL2 A;  2WSC E;  4C0D C;  5GAN e;  3OYA A;  1KD1 U;  4ATO A;  3H6Z A;  3MET A;  5GMK l;  2K3X A;  3KBG A;  3S3O A;  4LDX A;  4J8O A;  4OB0 B;  1G3Y A;  4C8Q C;  2ZPE B;  5GMK m;  4J5Y A;  4UC4 A;  2YHT A;  3CD6 T;  3JB9 D;  1Q82 U;  4M7A A;  4X9C A;  4L5G A;  4QQ6 A;  2RK1 A;  4XAX B;  1VQ9 T;  3OYM A;  2WSE E;  2DXT A;  3WVD B;  1KQ2 A;  3HFO A;  4M78 E;  4HCB A;  1KC8 U;  2ZPI B;  4N4H A;  3CCM T;  2DO3 A;  5KCH A;  3PMT A;  1YCY A;  3L2Z A;  5D6W A;  5IAY A;  3HFN A;  3ZFJ A;  3GF5 A;  3HRU A;  3QZ9 B;  3TU4 K;  2E6N A;  2FVU A;  4ZGJ B;  1HK9 A;  2QQS A;  3P8D A;  4XTW A;  3JCM d;  5KCO A;  3M54 A;  2LQK A;  4N4G A;  3VUZ A;  3A8O B;  4PJO B;  3S3N A;  2KAF A;  2ZZD A;  3MEU A;  1P92 A;  3R6O A;  5LJ5 g;  3PIP A;  4JRI A;  5HY6 A;  1VQL A;  3PTA A;  1NJI C;  2QA4 A;  2EYQ A;  2P4T A;  4J7F A;  1OYX A;  2QDY B;  1KHC A;  1WQW A;  2CZ1 B;  3M4Y A;  2EWN A;  3PFS A;  4M77 D;  2B8A A;  2VXE A;  2OTJ T;  5CCA A;  4LD9 K;  3OYK A;  1Q82 C;  1IZ6 A;  4LD6 A;  5GAO m;  4FT2 A;  1VQK T;  2L8D A;  3CBP A;  4N0A C;  1Q81 C;  3V7C A;  1QVF S;  3NTH A;  2K57 A;  3OY9 A;  3JCM W;  2A3L A;  1IRE B;  1XQH A;  5D6X A;  5LJ3 f;  5GAO l;  3V8K A;  3JCM g;  2DZC A;  3QYH B;  4ZGE B;  3CCM A;  4C92 B;  1Q7Y U;  4M78 C;  3X25 B;  4QVD A;  1WJQ A;  2ZPB B;  5LJ5 j;  2ZPF B;  1M9S A;  1JB0 E;  4C8Q B;  4M7D G;  1H64 1;  4M7D F;  3MCA B;  4FSX A;  3I55 T;  3CC7 T;  5GAM g;  3L2Q A;  3GOX A;  1VQ5 T;  2EQK A;  4FT4 A;  3OSV A;  4LDY A;  3P8H A;  2MMP A;  4OGE A;  5CKF A;  4C5G A;  1XNI A;  3OYI A;  2JTF A;  1K9M U;  3M53 A;  3DB4 A;  4IUU A;  3OYL A;  3TRE A;  4FIB A;  3OMC A;  1NJI U;  4M7A C;  3ASK A;  4BE1 A;  3KUF A;  3GNF B;  3VV0 A;  4C92 E;  5CKB A;  2F5K A;  4KBM B;  1G5V A;  2LT1 A;  2EIF A;  3FIF A;  4M7D A;  5IT9 E;  1VQL T;  2LTO A;  2M9U A;  4M75 G;  1I4K 1;  4M78 A;  3OYF A;  2QA4 T;  3JCM f;  4OB3 B;  1YJN T;  4PJO D;  1M8V A;  2DJZ A;  1N9R A;  4XTY A;  3CXC S;  1VQ6 T;  2RA2 A;  3NTI A;  2RD1 A;  5CVI A;  2V8K A;  3OS5 A;  1Q86 C;  1UGP B;  1VQ4 T;  3CC2 A;  1VQK A;  4HT9 A;  1UGS B;  4JLI A;  5GAM e;  3L2R A;  3A8G B;  4BDZ A;  1W2B A;  2E12 A;  1WJR A;  1VIE A;  5LJ3 h;  4E7K A;  1KC8 C;  4EMH A;  1WPY A;  2E65 A;  3KXT A;  2PQW A;  2KY9 A;  4A4G A;  4DOV A;  5CIU A;  2MWP A;  4JLG A;  1ZBX A;  4F7U B;  5DLQ E;  4F7U A;  5FU6 B;  3SD4 A;  4CI0 C;  1VIF A;  2R58 A;  3GIB A;  4RKU E;  3C4S A;  1VQ5 A;  3FJP A;  4RG2 A;  2DK3 A;  2X4Y A;  5KH6 A;  1X01 A;  2E1H A;  1TH7 A;  4EMK C;  1LJO A;  4J6Y A;  2RJC A;  4N0A A;  3OYE A;  3PNW C;  5GAO r;  3H8Z A;  4M77 F;  3HSB A;  3MO8 A;  3RUX A;  1BIB A;  5LJ5 f;  1O75 A;  4E7J A;  5HK3 A;  3JCM b;  1B34 B;  1NE8 A;  1LOJ A;  2DTH A;  5GAO p;  2JTM A;  1OZ2 A;  2GFA A;  4XQ3 A;  4PJO C;  5I2M A;  3QYG B;  4HCZ A;  4RCC A;  2DTO A;  3J80 E;  5GAN d;  3G6E T;  3G71 T;  1YJN A;  5I2S A;  1Q86 U;  1VQ8 A;  4M77 E;  5J39 A;  1Q81 U;  3CMA T;  3QJY A;  4M78 D;  4M7A D;  4PNO A;  1WNL A;  2E10 A;  2LCC A;  2AHJ B;  2MF2 A;  1Y7X A;  4C92 F;  3MP6 A;  1VUB A;  5EG2 A;  3CME T;  3CD6 A;  3OBY A;  3JCM Q;  1JBM A;  1VQ9 A;  2L5Q A;  2XD0 A;  2KVQ G;  1OI1 A;  2P0P A;  1VQM T;  1Y96 B;  2L3R A;  5CKH A;  4C8Q A;  3G4S A;  2KK4 A;  2DVE A;  2XG8 D;  1UB4 A;  4C0F A;  3CXC A;  3CPW S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...