5GAN2

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
90
structure length
90
Chain Sequence
b'MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan200
4Y91A 4J6YA 1N9RA 4M75C 2DZ9A 4C8QB 1D3BA 5GAN4 4C92A 2VC8A 4C92G 4QVCA 4MMLA 3JCMX 5LJ3e 5GAN8 4M7DC 1LOJA 4M78B 3PGGA 2DTOA 5GAN6 4M7AB 4XTXA 4F7UA 4OP0A 4F7UG 5GAMh 3JB9I 5GAOn 3L1AA 4M77B 4XTWA 4J6XA 5GMKe 3BY7A 4NL3A 3JCMW 4C92E 3EFSA 2DEQA 1BIBA 4PJOD 2FYKA 4N0AA 4EMKB 3V7SA 1WQ7A 4F7UE 5GANg 5I21A 3RUXA 3AHUA 4HA8A 2VXEA 3JCMd 5GAOq 5GANj 4XU3A 5GAMe 5GAOl 3JB9H 4C8QD 2ZGWA 3QSUA 3BW1A 5GMKi 5GAN5 2E41A 3EFRA 4M75B 5GANh 5GAN7 4M78D 3JCMg 4JRIA 5LJ5f 1M8VA 3QUIA 3V8JA 4M7AD 4M7DB 3JCMV 4J6WA 1KQ1A 3SWNB 4A53A 4M77D 1M5Q1 2DTHA 1B34A 4JRKA 4M77F 1Y96A 3JCMP 4C92C 4PJOG 1I5LA 4PJOA 5GANd 4HT8A 2YHTA 2EJ9A 1MGQA 4RCCA 2CGHA 5LJ5e 3JCMh 5GAMf 3VU3C 3JCMb 2VXFA 2YLBA 4XU2A 3V7RA 2RD1A 4PJOF 3SWNA 1KQ2A 2EWNA 2RA2A 1LNXA 4PJOE 1WPYA 2RM4A 1JRIA 4MMKA 4RCBA 3FIFA 4N0AC 4M78A 4M78G 3QO3A 4NL2A 3V8LA 5GAOr 4M75D 5GMKm 4M75F 5GAMg 4C8QF 3JCMe 4M7DD 4M77A 4M77G 3JCMc 1I81A 2E64A 4C8QE 4M78F 5LJ3g 2FB7A 3FB9A 4M7AF 1U1TA 5LJ3j 1WNLA 3RERA 4M78E 1HXDA 5GANf 4EMKA 3FJPA 4X9CA 2DKGA 1D3BB 2K57A 3BDUA 4M7AE 4C92B 3RESA 2EJFA 1JBMA 4M77E 4XQ3A 1YCYA 2EJGA 5GAOp 3JB9J 5LJ3h 5GMKj 1Y96B 5DY9A 4F7UB 4PJOC 5GANe 3QHSA 2DVEA 4NOYA 1HK9A 2DTIA 3JCMf 4JUVA 1I4K1 4M75G 4M75A 2JN0A 4C8QA 4C8QG 4EMHA 3HFNA 1BIAA 2YLCA 4XTUA 3RKYA 3JB9D 3JB9F 5LJ3d 4M7DA 4M7DG 1N9SA 2QTXA 2HNIA 3SWNC 5GAMj 4HT9A 3HSBA 4XTVA 4M7AA 4C8QC 3RKXA 2DXUA 4M7AG 4X9DA 3HFOA 4XU1A 3L2ZA 4M7DF 4DQ2A 4J5YA 4M78C 4M75E 1H641 5LJ5d 4M7AC 3BFMA 4XTYA 2DZCA 5CAIA 3V7CA 4M7DE 4C92D 4A54A 3INZA 3RKWA 4C92F 4M77C 5GMKl 4JLIA 4XTZA 4V2SA 3V8KA 5GAN3 2E65A 3M4GA 5LJ5g 4F7UF 3RIRA 5GAOm 1X01A 5GAMd 5LJ5j 4EMKC 1B34B 2DJZA 2E1HA 2RB6A 1U1SA 4PNOA 3GIBA 3JB9G 4PJOB 1TH7A 2E10A 5GAN2 4XU0A 4WF2A 2Y90A 5LJ3f 3SB2A 2EAYA 1LJOA 4EMGA 3JCMQ 2DXTA 4QVDA 5LJ5h 3JCMJ 5GMKh 1I8FA 1WQWA 2I2LA
chains in the Genus database with same CATH superfamily
4C5GA 4J6YA 3GBQA 2A08A 1ZQ1A 2FZGB 4QVCA 1YBYA 2LQKA 4JJCA 4PJJA 2KAFA 3CMEQ 4OMPA 3I35A 3P8DA 3HRUA 1BI1A 3URGA 1PD0A 1IHWA 3V7SA 4RTWA 1Q86C 2X4YA 5FW9A 3CCSA 2VXEA 4E7SA 5GANj 2OTJT 1W1FA 1MV3A 3UA6A 1WHGA 1FMWA 4M78D 2K3XA 3G71Q 3OYFA 1B3QA 2JVVA 3CCMA 2L5QA 2CGHA 4PKCC 5HK0A 3H0IA 3E1SA 5D6WA 2HQHA 3VS4A 3QO3A 2RQUA 2JOYA 2KT8A 3CCRA 2XD0A 3WVEB 1N6AA 2R58A 1I81A 3OS2A 2DM1A 2JW4A 1JJ2S 4HCKA 3CCLT 3RESA 1YJNQ 3M0TA 1QKWA 5IHIA 3RR6A 5I2SA 1UGPB 5CO7A 2QI2A 1YP5A 2RJEA 2LQ8A 1VQMT 5HK3A 4C8QC 2QG9B 1YHQT 3NMZC 4L59A 2DJQA 3CC2A 2F5TX 3CXCA 1E6HA 4L6V5 1R8OB 2CUBA 2NLUA 5LJ5g 2YWWA 2LJ0A 2X51A 1MMGA 4OGCA 2CP3A 4DA4A 4E6RA 2HL3A 1I0CA 5IXFA 4LUDA 5GMKh 4LNPA 1D0ZA 1Q86U 3OYHA 1FX7A 2KRNA 4C92G 4Y28E 3CC4Q 2DL3A 1QVFS 3TSWA 1H3HA 4PK4A 3L1AA 2HBPA 4FSXA 3QBYA 1BI0A 3M0QA 2HQEA 3OS0A 5GAMe 4QQGA 2ENMA 2ED0A 4J9BA 1VQ7T 2M51A 3JCMg 4TVRA 4C0DC 1M8VA 2MK5A 4BDZA 2DXCA 1ZUUA 2V1QA 3HRSA 2DTHA 3RBBB 3JCMP 4RTYA 2KI7A 1KHIA 3META 1VQLT 3MKDA 1UEBA 2O9VA 2RA2A 2DYBA 1OYXA 1T3SA 1SG5A 1C6VX 2RHIA 2RMOA 2OTJA 3HKSA 5DY9A 1UJYA 4KBMB 1PRLC 1K9MU 1RLPC 2FHDA 5LJ3d 4R0KA 1NEBA 3L2RA 1GFDA 4XU1A 4AFQC 1UFFA 2BZ8A 1RABB 2SRCA 2HSPA 2CP5A 2PU9B 1TSFA 4EIKA 2KYBA 1WHKA 1Q7YC 1MNEA 1U1SA 3QDRB 1LCKA 2EQKA 1YITQ 1QWEA 1PNJA 3F70A 5KYYB 4M7DC 2KY9A 3DB4A 4J7IA 2L3PA 3JB9I 3SFMA 5GAOn 4M77B 2AKKA 1JJ2P 4F14A 5D6XA 2O2OA 2J6OA 3EAEA 2XK0A 2Z0WA 1WHHA 1X27A 2E12A 3CCQT 1YHQA 3UDCA 3OYJA 1WGSA 1ZA1B 1NLOC 4M75B 2KSSA 4MZMA 1WA7A 3G71A 3I55T 1YI2Q 1D09B 2EJ9A 2D9TA 1RAIB 1H3ZA 1GXIE 5I22A 2LJ1A 1VQ9Q 1ZUYA 2O4XA 3I9QA 4IIOA 5KYUB 1PWTA 2RI5A 1HXDA 2DXBA 1QVFP 2NUPA 1NPPA 2M0YA 1Y7XA 1SPKA 5FROA 2DETA 2AHJB 2OAUA 1YJNA 2ATCB 1QVGA 1ABQA 4C8QA 2SEMA 4FT2A 4ZN1A 1Q7YU 3PE0A 3EGXB 4JPBW 5GAMj 2VV5A 1VQ5Q 2VUBA 4RTZA 2QDYB 3EGUA 4M78C 2C0OA 2JT4A 4K11A 3H8ZA 1BI3A 2M9UA 2DF6A 3QPHA 4XTZA 2QA4T 2KRMA 5GAN3 2KEAA 3A1PA 3RNJA 3M9QA 1E7OA 4JRPA 1V1CA 3CD6Q 3OYGA 4JJDA 2DXTA 4QVDA 5GAMg 2QGFB 1T3LA 4Y91A 1JO8A 1D3BA 4AT1B 2GF7A 3L42A 2VC8A 1JJ2A 3EG9B 1RACB 2ZPIB 1N27A 2BKDN 2X4JA 2DRMA 1M1FA 1G8XA 4R56A 1KD1C 1M9SA 1TUDA 1WHJA 4C5HA 1ZSZC 4LDUA 1X6GA 2L3RA 1Y57A 4ANJA 1YNZA 5GAN5 3A8OB 3PMIA 5GANh 5LJ5f 3OS1A 4B6MA 1KQ1A 1UDLA 4HVVA 4FIBA 3LGFA 4RCCA 4DOVA 4PJMA 5CKEA 2EYZA 4DEXA 2EKHA 2E3HA 3SWNA 2EVRA 2F69A 1G3TA 4NL2A 1M4ZA 3CEYA 3OYNA 3O8VA 4JZ3A 1BCMA 1Q82C 4F16A 2OTLQ 3JRZA 4F17A 1QVFA 3EG0A 3E9FA 1NPRA 2CH4A 2K57A 1BK2A 2D8JA 2K6DA 2MPXC 5IT9E 1GCQA 5IH2A 1C1AA 3OBWA 4LD9K 1UUEA 2DRKA 4QVZA 2LDMA 5KYXA 3OYEA 4JRQA 3TREA 2L89A 3JCMf 2F2WA 3VRYA 4J9EA 1OU8A 1UGRB 3I55A 4J9IA 3SDZA 2R5AA 4LXCA 4BY6B 4QQ6A 1AT1B 4X34A 2DZCA 5DLQE 4BB7A 3ASKA 3PNWC 4IIMA 2CSQA 1TTHB 2XG8D 3QWXX 4F7UF 3M55A 1PCXA 2JS2A 4PJOB 2K3YA 4WF2A 3FRNA 1WXBA 2DERA 1KD1U 1G2BA 3RDVA 1PKSA 2KNBB 3G4ST 1NEGA 4XTXA 4OP0A 4PJNA 1WLPB 1UHFA 1M2VB 1VQ6A 1VQPA 4CC4B 3JCMW 1WFWA 5J3BA 2BTTA 4EMKB 2OJ2A 1LPLA 3HPWA 4HA8A 3SEMA 3CCMT 2DA9A 3PIOA 4BUGA 4C0GA 1W2BS 2QA4A 2O01E 1K9AA 1Q82U 3CCRT 1Y96A 1X2KA 2XKOC 2MOXA 1Q86R 5LJ5e 1VYUA 1RLQC 3QKJA 3DLLA 3H0FA 1KQ2A 4FYXB 2DYIA 2RM4A 1JRIA 4RCBA 4FL6A 2M16A 2FPDA 2GFUA 2KXCA 4OMLA 2MMPA 2M02A 3PVLA 4M77G 2JMAA 5LJ3g 3X26B 4PJLA 2HZYA 9ATCB 4HCCA 1VQOA 2A3LA 3FJPA 2QEXQ 3MEUA 4M7AE 2A28A 4ELYC 2YRDA 4DOWA 1ZUKA 3CC2T 1GFCA 2C0IA 3MEVA 4M75G 1EZZB 4FU6A 4KUIA 1UGSB 3HSBA 1NM7A 4M7AG 2CUDA 2DL5A 1WX6A 2KROA 1XNIA 2O31A 3L2ZA 1VQ5A 2CZ6B 3QG1A 5GMKl 4KGZB 2RHXA 4Z8AA 1RADB 2KXDA 1NJIR 2RN8A 4D6WA 1QQJA 4LDXA 1TH7A 2DL4A 5CR2A 3CCJT 3VYHB 3CCVQ 2CYZB 2LP5A 2JXBA 4OB3B 4E7IA 1FWZA 4NL3A 3VS1A 2B8AA 4C8QB 5GAN4 4ESRA 3L2UA 5CKDA 1M3CA 5A0LA 4LUEA 1K9MR 3J7AF 4DBQA 2X4WA 2CZ1B 2CP6A 4ORZA 1RAGB 4BI8B 5KYNA 2VGNA 1ZSZA 3EHRA 3LLRA 4CRIA 2LQNA 3M0RA 4KRTA 3ER0A 2QDLA 4BI3A 2NUTA 2EIFA 2HDAA 1OEBA 3H9NA 3V8JA 3J81E 3CMAQ 1W70A 3RMQA 3M0PA 3G6ET 1B34A 4JRKA 2PUOB 4BE2A 2DX1A 5GAMf 4FCYA 4RTVA 2CH4W 4J8OA 3M54A 2H8HA 4KH1B 3CCLQ 1ACMB 4LD6A 1RAAB 3MEWA 3G4SA 4J7FA 1N5ZA 1O75A 3JCMc 4C0DB 1QLYA 4HVWA 1WNLA 2CP0A 2CP2A 2H3EB 2RK2A 3LYIA 1JBMA 6AT1B 2EGAA 1HK9A 1TXQA 2COYA 2FRWA 4EMHA 2X3XD 2QQAA 3RKYA 3CPWS 3JB9D 1MMAA 1QCFA 2QTXA 3FDRA 1PKTA 3D7SB 4OB2B 2J6KA 2HEQA 1BU1A 2HL5C 2EYXA 2K2MA 2QK0A 1W2BP 1D1AA 2D0NA 4XTYA 1YJWQ 2HQXA 3EFOB 5LJ5j 2HCKA 1Z9ZA 3GIBA 3A98A 3IQLA 1OV3A 3E2UA 3SB2A 1OZ2A 3NTHA 5KH6A 5KYXB 4BACA 4RUGA 4FSSA 4N4IA 3MP6A 1EIFA 4ATOA 2W10A 2KT1A 3HTRA 5AYFA 1IGQA 1N8RC 3FEOA 3MP8A 4ZGEB 3HRTA 4ZGDB 1KC8R 4C92E 1VQ7Q 3MHXA 3OYAA 3G71T 2PNIA 1JB0E 3PVQA 4JS4A 1BKBA 4O5VA 1VQLQ 1RI0A 3QUIA 1OULA 2KDSA 4M7AD 4M7DB 3JCMV 1MMDA 4PJOG 4AFZC 4HT8A 2YHTA 1MGQA 1AOJA 3CCJA 3WVDB 1U06A 3ZEHA 2VB6A 2JTFA 4PJOF 1HYOA 2X35A 5CVIA 1VQNQ 1EFNA 2JJ9A 2P4RA 1M1KR 1GBRA 1MNDA 2LNHB 5GJWB 1M27C 1VQ8Q 1PG5B 2RF0A 1YJNT 4AG1C 1ZBJA 1JXOA 3M0SA 5LL6S 2JS0A 1YCYA 1V29B 1Y96B 4O6JA 4F7UB 4GLKA 4AG2C 1G3WA 1U5SA 4JUVA 2JN0A 3HFNA 1BBZA 1RAFB 2COWA 3SWNC 4DBRA 1W2BA 4J9GA 3OY9A 3G6EA 3M0UA 1R0BG 2K5LA 4UC4A 3CC7Q 2BIVA 2ZPEB 1K73R 3CC4T 2ROTA 4XU0A 1GCQC 2DO3A 5LJ3f 4BD3A 1IB8A 4EMGA 2ED1A 2I0NA 3NTIA 3QZ5B 4J9FA 2R5MA 3GNFB 1YWOA 1M30A 4C92A 3QZ9B 4M78B 5KE3A 1U8RA 1T0HA 5GMKe 2DIQA 3EFSA 5L8RE 1BIBA 1TS9A 2EPDA 3I56Q 2GQVA 5FWCA 3EGDB 1G3SA 4MZTA 5KCHA 1OU9A 1HJDA 5GAOq 2EQMA 4BE0A 2E5KA 3S3NA 2ZGWA 3CPWP 3KUFA 3WXMB 2AZVA 4OVAA 4MZPA 1WYXA 5ECAA 4AMCA 2V8IA 2F1LA 2EYQA 2EYYA 2MI6A 1KD1R 3VJPA 3CMEA 3R6OA 4J83A 3LH5A 1VQKQ 2FL7A 5GAOr 3ULRB 2K4YA 2RNAA 4C8QF 5CQXA 2YRCA 2CREA 3FB9A 3NGPA 3VS0A 1CKBA 1T0JA 3BDUA 3C95A 2DLPA 3A8GB 1UTIA 1QCNA 3PT9A 4NOYA 1OI1A 2LCLA 3U23A 2HNIA 4E2FB 5L23A 1M1GA 2LT4A 1VUBA 2GCXA 2YXYA 3HFOA 4PFOA 4DQ2A 4OB0B 2VASA 1WHLA 4C92D 1WI7A 3RKWA 1M90R 4YTLA 1AVZC 2A36A 2DJZA 4PNOA 5J26A 1I5OB 4KH0B 1VQ6T 1VQPT 3M59A 1LJOA 5FLXE 4ZGJB 1NYGA 2EKOA 2I2LA 2V8KA 4WTOB 4ZN3A 1YIJQ 4DEYA 2KRSA 4MMLA 1S72Q 5LJ3e 2ZZDA 2DTOA 2Y4YA 4C5EA 3NPFA 5A2QE 3FLGA 2B86A 4XTWA 3A8LB 2K9GA 2DNUA 2JZ2A 3CCUQ 3CPWA 1YI2T 3M4YA 1X6BA 3FJ5A 2ABLA 2D1XA 2HSEB 3M56A 2DK3A 3L2VA 2KVQG 3OSSC 1J3TA 5GAN7 1QW1A 2ESWA 4C0ZA 1TU0B 4KGVB 5IAYA 2PQWA 2KK4A 1ZA2B 2JMCA 3CC4A 2A37A 2JTEA 3GF5A 2K7AA 2LZ6B 1VQ9T 5GANd 1D0YA 3DB3A 4WCIA 1WHMA 4J9CA 2LJ3A 3VU3C 5KYWA 3VYGA 1VQOT 1SRMA 4Q5WA 4RG2A 2ZPGB 1WJRA 1MHNA 1BCOA 3THKA 1VQNA 1I1JA 5GMKm 1IO6A 2L3QA 1WDXA 2MIOA 4PL6A 3N5BB 3L2WA 2ZPFB 3VS7A 1FMVA 1BB9A 3P8HA 2G6FX 1VQ5T 1C0MA 4X1VA 5GMKj 1UB4A 2HKNA 1P92A 2LQWA 2DVEA 5FWBA 2PVOB 4QW2A 1WJQA 4M7DG 4A4HA 3X20B 2H3JA 2RQRA 2RJCA 4M7DF 5LJ5d 2E5QA 4QKUA 4M7AC 2CKKA 3REBB 1Y71A 1OPLA 2MWOA 3MPUB 4A63B 2XDBA 3M4GA 1SF9A 2QQSA 1PM3A 1AEYA 3CCSQ 4IKFA 1FMKA 2E10A 2DEUA 2Y90A 2P0PA 2CS7A 2P0KA 5LJ5h 3O5ZA 4OMOA 2CT4A 2IPOB 1RAHB 3CBMA 4A4FA 3T9NA 3A8HB 3CCMQ 4F7UG 3UWNA 2OAWA 3ME9A 2FO0A 2MWPA 4N0AA 3ZBDA 2AK5A 3JCMd 3CCRQ 1IGUA 3TQ7P 3QXEB 2OX7A 2QGGA 1F1BB 3OMCA 2GTOA 1IREB 1YITA 2K5IA 2YSQA 2QQRA 4MDWA 2RQVA 4FYVB 4RTUA 1TWBA 2EYWA 2XI9A 2BZYA 1I5LA 1ZBXA 1Q81C 4A4EA 1AD5A 2E70A 3OB9A 3JCMh 2PVDB 1SSFA 1OZ3A 2HMAA 2EWNA 1A0NB 1VA7A 4M78G 3OYCA 2RH2A 2RO0A 2FG0A 1CSKA 1AZGB 4M78F 3CCEQ 2LX7A 5LJ3j 2AIRB 4Z02A 2LT1A 1AWWA 1YI2A 4M77E 4XQ3A 5GAOp 2C0TA 1B07A 1O9SA 4C5IA 4FYWB 1UGQB 1YJ9Q 2VKNA 1VYVA 3JB9F 4RKUE 1N9SA 4XTVA 5C0MA 1VQ9A 5A0GA 4J5YA 4M75E 1SHGA 3L2QA 2ROLA 3BFMA 2R57A 2PUKB 2P0QA 2QASA 1VOMA 2X9HA 1AZEA 1DJ7B 2E1HA 4XK8E 5FU6C 3UF4A 3JCMJ 2KMTA 4HCZA 3CQTA 4CC7A 3OYKA 1VQ4Q 1GBQA 1WIEA 1M2OA 2O4XB 3E19A 3UA7A 3OS5A 1S1NA 2ZAEA 2Y4XA 5D7UA 3OYBA 2M0OA 3MCAB 4A4KA 2RHUA 1JQQA 3GNGA 1Q81U 5DM7R 2NUPB 5D6YA 1R0CB 3I5RA 4Z88A 3C4SA 3CD6A 3BW1A 2BUDA 2LRQA 2K5FA 3AT1B 3HHTB 2LX9A 2MYSA 1Y0MA 4A53A 2L8DA 3NHNA 1SHFA 2OTJQ 4C92C 1K76A 1Q95G 8AT1B 1WXTA 2RHYA 4OGEA 1ZX6A 4OF1A 3SD4A 1WXUA 2DMOA 5KYYA 2RQTA 1XQHA 3LX7A 5HY6A 1K8AC 1SEMA 3PMTA 1OPKA 1UGVA 4M77A 4FW1A 1B7TA 5M9OA 2E64A 1U3OA 2WACA 3LWHA 3RERA 1PC0A 1KFZA 1D3BB 4A4GA 2QAZA 2DL7A 7AT1B 2FZKB 2HAXA 2D0QB 3VKIA 3JSCA 1K0XA 4M75A 3CBPA 2YUOA 2FZCB 2RI3A 4HT9A 4M7AA 4X9DA 2C06A 3MO8A 2IVWA 2OTLA 2XIDA 5CAIA 3CCVT 1NYFA 4PFPA 3X24B 1TOVA 1ZHIA 3V8KA 4N4GA 4GY5A 1VQMQ 1IRXA 3QJ6A 2KYMA 3QJYA 1RAEB 5GAMd 1IXDA 3PFSA 1NBEB 1G83A 4BDYA 2EFIA 1YHQQ 5KYUA 1QVGS 4RTTA 3JCMQ 1OX9A 1D1BA 3SWNB 3VS5A 2E4HA 2F5KA 5GAN8 2E6NA 3UATA 5GAMh 1W6XA 2YT6A 2MCNA 3JAME 2J6FA 2EBPA 3GP8A 1AWOA 1QKXA 2DEQA 4OMFB 3KBGA 3EGXA 1WQ7A 3CMAT 5GANg 1MMNA 2X4XA 1WZOA 3BE3A 3CMET 1OQKA 2WSFE 3NFCA 3JB9H 2XU8A 4GBQA 2FRYA 2JNGA 2E41A 3EFRA 1JU5C 2EQIA 4HCBA 2ZCFB 3SHWA 4J6WA 4M77D 1M5Q1 3CPFA 3VS2A 5I11A 1K8AU 1Q7YR 3QIIA 5FU7C 2F2XA 5KE2A 1KQSS 1TUCA 3MJXA 3OYIA 1W4SA 3JV3A 1OX8A 4XU2A 4CC3A 3TSZA 2G3RA 2VYTA 5CKFA 4PJOE 1NE8A 1NJIC 2FEIA 1G5VA 3EG9A 2GNCA 1TUGB 4N4HA 1GCPA 4M75D 1KHCA 4OB1B 1PHTA 1X75C 4ELZC 3CCEA 5GJVB 2V8JA 4HKEA 2LVMA 5KCOA 5CQYA 1K9MC 2EJGA 4IUUA 2GGRA 4DBFA 3R6NA 5J39A 3PTAA 2ZPBB 1YJWT 2YLCA 4XTUA 1YJ9A 2FVUA 2EGEA 3RKXA 1QWFA 2E3IA 2BZXA 4C92F 4CC2A 5HCKA 4V2SA 4JJNK 4Y92A 2QEXA 5C6SA 4CI0C 2RB6A 1HSQA 2L3SA 2D6FA 5IHKA 2EAYA 3C94A 3OSVA 1I8FA 4C0FA 2GTJA 4NS5A 2KGTA 4IUTA 5CKBA 2YDLA 1LOJA 3X25B 1QVPA 3PGGA 1VQ4A 3BY7A 3OYYA 1LVKA 1M3BA 1X6OA 5DLOA 2DL8A 2GFAA 1N8RU 3VUZA 2AT1B 4IUVA 3AHUA 3KFVA 5GAOl 5HKCA 2DBMA 4JS5A 1TG0A 3CCVA 3ZFJA 4ZTJA 1GL5A 1NJIU 2LCSA 1VQNT 1UG1A 4E47A 4RMOA 4FW2A 4BI4A 4PJOA 3CCQQ 2PVGB 2JM8A 3RMSA 3GLXA 1VQ8T 1BYMA 3OW2S 4J9HA 3JCMb 1QP3A 4JDSA 2O9SA 3G1JA 1WPYA 4MMKA 2DIGA 2XICA 1ZSGA 3I55Q 4N0AC 3NTKA 2LMJA 1QVGP 1M2VA 4ZNXA 4C8QE 1KIKA 2CZ0B 3UPUA 4EMKA 5IHNA 4X9CA 2DKGA 3CMAA 1JEGA 3S6WA 2EJFA 4PLLA 3JB9J 2AZSA 1IHVA 5LJ3h 3LW5E 2RHZA 4JJBA 2O88A 3TU4K 1KC8C 3OYLA 3EG2A 2IIMA 4C8QG 2AKLA 5CK9A 1ZSZB 3CC7T 4QQDA 1UECA 4KGXB 4II1A 3CCLA 1YFNA 4LDVA 2NUTB 4AFSC 2LTOA 1VQ6Q 1VQPQ 1E6GA 3QWYA 3INZA 2CDTA 3G7ZA 1QCOA 1SRLA 2L2PA 4ME7A 1X01A 3RIRA 1VQMA 4B9WA 1KQSP 2MF2A 1B34B 1ABOA 3MP1A 3LGLA 2DFUA 3TEEA 1Q82R 1V76A 1R77A 1H92A 3HP9A 1KK7A 2CT3A 2EGCA 2QA4Q 1IZ6A 1D1CA 3I56T 1XTDA 1M1KC 2QXFA 3M57A 5FRNA 5GAN6 4M7AB 1YITT 3EG3A 4J6XA 1VIEA 4MDXA 2BE9B 1YJWA 4PJOD 2FYKA 2NWMA 1HD3A 4QT7A 4LDWA 3RUXA 4DBHA 2DVJA 2YUPA 1YN8A 3QSUA 2J06A 3VV0A 2XMFA 2ECZA 5GMKi 4JRIA 3EG1A 1VQOQ 4OMNA 1VIFA 3GOXA 1VQKT 5A0DA 4PFZA 5EC7A 4Z89A 2YLBA 3E9GA 3TVTA 3QDFA 4RTXA 1VQ7A 4EDUA 5IXBA 2A0FB 1K73C 1EX4A 3UT1A 4E7JA 4E7KA 3OBYA 3EHQA 3C12A 5CCAA 1KC8U 2K79A 1I07A 2HBWA 1Q81R 1VQLA 2RPNA 4LE9A 1H8KA 2LCCA 5GANf 5FRMA 2VWFA 4EPCA 3TCJA 1X2QA 1KJWA 1AWJA 4D8DA 8ATCB 1PSEA 3REAB 3QHSA 3QYHB 2DILA 4KT0E 2DTIA 3I5SA 1I4K1 4PLIA 1PSFA 3A5ZB 5IN1A 2DXUA 2V26A 2V1RA 3VS3A 1Z9QA 1K0SA 2PTKA 1VQ8A 2RI2A 3M58A 2RJDA 4M7DE 1PD1A 1KQSA 4M77C 2L0AA 1M1KU 2P84A 1YIJT 2E65A 4IUQA 1S72T 2J05A 3H41A 2VVKA 2QQ9A 3OW2P 3OMGA 2ZPHB 2EQJA 2CSIA 3DKMA 1N9RA 4M75C 2DZ9A 2X3WD 3CCUT 2WSEE 3CD6T 2FPEA 2RQWA 1BI2A 3PIPA 4VUBA 3EH1A 1M3AA 1X43A 3H6ZA 4LDYA 2GBQA 4J9DA 3CC7A 3QYGB 2VGMA 4F7UE 4KULA 5FU6B 1UE9A 2KBTA 1RUWA 2LC4A 3G4SQ 4FYYB 1D0XA 4C8QD 2XDDA 3DLMA 1SSHA 1K73U 1KG1A 4OMQA 1AHJB 2K3BA 2DPPB 3EH2A 3EFOA 4IUPA 5CIUA 2QQBA 3BDLA 4E7LA 4JZ4A 3CCQA 3HL8A 3CXCS 2VXFA 2RD1A 2K2VA 2RJFA 1M90C 3OYDA 5AT1B 2W0ZA 1LNXA 3I56A 3LWIA 4RG8A 2P4TA 3V8LA 2A7YA 5I2MA 1M8MA 2E6ZA 4OMMA 2FB7A 3GPLA 1SKUB 4FT4A 4M78E 5CKHA 1FYNA 4C92B 3M5AA 2F2VA 1NZ9A 2J7IA 4IURA 2OTLT 3OA6A 5GANe 1K1ZA 1YCSB 1K8AR 1AWXA 2COZA 1BIAA 2QYZA 4M7DA 2HD0A 3OQ5A 1VQKA 4B9XA 3H0HA 1FXXA 3CCST 1YWPA 4ZTFA 2DD5A 2BE7D 4P5NA 3FC3A 3CC2Q 2YUNA 3V7CA 4L5GA 3A8MB 3OW2A 1K4US 2OI3A 3JB9G 4HVUA 5GAN2 1NG2A 3ZL7C 3JCMX 2LNVA 2DAQA 1XOVA 1NLPC 4F7UA 3CCJQ 1MV0B 2WSCE 2YRVA 3VS6A 4R55A 3S3OA 2KE9A 2JTMA 2MAMA 3OYMA 5I21A 4LN2A 4XU3A 4XAXB 1M90U 1ZLMA 3C0CA 2PZ1A 1VYTA 4D8KA 4E7ZA 2CP7A 1YIJA 2NUZA 4M77F 1S72A 2CZ7B 4JLGA 2DD4A 2JM9A 2XDPA 3V7RA 3CCET 2KQWA 2YUQA 3Q1JA 3VRZA 2M1HA 3CCUA 3FIFA 3G6EQ 4HXJA 4M78A 3J80E 3LH0A 4M75F 3JCMe 1N8RR 4M7DD 1GRIA 2FPFA 1PRMC 4BY6C 4KUDK 4F04B 1YJ9T 4M7AF 1U1TA 1X69A 3EGDA 2IG0A 5FU7B 2NYSA 1WJSA 3VUBA 1RL2A 3MEAA 1XJWB 2GQIA 1UHCA 4PJOC 4M4ZA 1QMCA 2EQUA 1Y07A 3KXTA 1CKAA 2DBKA 2HKQB 1QP2A 2QEXT 2EW3A 1G3YA 2D8HA 2JUFA 2RK1A 1H641 2QTVA 3S3MA 2XHCA 3P8BB 1OOTA 3CBOA 4A54A 4JLIA 1KSWA 2DE0X 5GAOm 1VQ4T 2KR3A 4EMKC 3M53A 1MUZA 1RI9A 4FM4B 3X28B 3CXCP 1UJ0A 4E7HA 4GLMA 1ARKA 4BE1A 5EG2A 5KYWB 4AFUC 1WQWA 1JXMA
chains in the Genus database with same CATH topology
4C5GA 4ZN3A 4J6YA 4C0FA 4NS5A 1ZQ1A 4QVCA 4IUTA 4MMLA 5LJ3e 2ZZDA 5CKBA 1LOJA 3X25B 1QVPA 3PGGA 1YBYA 1VQ4A 3G4ST 2DTOA 2LQKA 2Y4YA 4XTXA 4C5EA 4OP0A 5A2QE 2KAFA 3FLGA 4XTWA 3A8LB 1VQ6A 1VQPA 3P8DA 3BY7A 3JCMW 3HRUA 1BI1A 3OYYA 3URGA 5DLOA 1X6OA 2JZ2A 5J3BA 2GFAA 4EMKB 1N8RU 3V7SA 3VUZA 4IUVA 3CPWA 3HPWA 1YI2T 2X4YA 3CCSA 4HA8A 2VXEA 3CCMT 5GANj 3M4YA 1Q86C 3AHUA 2OTJT 5GAOl 5HKCA 4JS5A 3PIOA 3M56A 4BUGA 3CCVA 2DK3A 3ZFJA 2KVQG 3L2VA 3OSSC 4C0GA 4ZTJA 1W2BS 5GAN7 1NJIU 4M78D 1QW1A 2K3XA 2QA4A 4C0ZA 2O01E 1VQNT 5IAYA 2PQWA 2KK4A 1Q82U 3CCRT 1Y96A 4E47A 4RMOA 1VQ9T 3GF5A 4BI4A 3OYFA 3CC4A 2XKOC 2JVVA 2PVGB 5GANd 4PJOA 3RMSA 3GLXA 3CCMA 2L5QA 2CGHA 5LJ5e 1VQ8T 1BYMA 4PKCC 3DB3A 3OW2S 5HK0A 3QKJA 3VU3C 1QP3A 3JCMb 3DLLA 3E1SA 4JDSA 3VYGA 1VQOT 1KQ2A 4Q5WA 4RG2A 5D6WA 1WPYA 2DIGA 1JRIA 2RM4A 2XICA 1WJRA 2ZPGB 4FL6A 1MHNA 4MMKA 4RCBA 4N0AC 3NTKA 3QO3A 1VQNA 2M16A 2GFUA 2JOYA 3CCRA 2XD0A 5GMKm 2MMPA 3WVEB 1N6AA 2R58A 4M77G 1I81A 3OS2A 4C8QE 5LJ3g 3X26B 2CZ0B 1JJ2S 4HCCA 4PL6A 3UPUA 2A3LA 3N5BB 4EMKA 3L2WA 3FJPA 2ZPFB 2DKGA 3MEUA 4X9CA 3P8HA 3CMAA 3CCLT 4M7AE 3RESA 2EJFA 3S6WA 4PLLA 1VQ5T 4ELYC 3JB9J 5LJ3h 3LW5E 2RHZA 1UB4A 4DOWA 5GMKj 3TU4K 3CC2T 1P92A 2DVEA 1KC8C 3MEVA 5I2SA 3OYLA 1UGPB 4M75G 5CO7A 2PVOB 4C8QG 4QW2A 2QI2A 5CK9A 1WJQA 2RJEA 4FU6A 2LQ8A 4A4HA 3CC7T 1VQMT 4M7DG 5HK3A 4QQDA 3X20B 4KUIA 1UGSB 2H3JA 4II1A 3HSBA 4M7AG 4C8QC 3CCLA 4LDVA 2RJCA 1XNIA 3L2ZA 1VQ5A 1YHQT 4M7DF 5LJ5d 2CZ6B 2E5QA 2LTOA 4L59A 2CKKA 4M7AC 1Y71A 3QG1A 5GMKl 2MWOA 3INZA 3CC2A 2XDBA 2F5TX 3CXCA 4L6V5 1R8OB 2NLUA 3G7ZA 2RHXA 3M4GA 5LJ5g 3RIRA 4ME7A 2QQSA 1X01A 1VQMA 4B9WA 2MF2A 1B34B 4D6WA 4IKFA 3MP1A 4OGCA 4LDXA 1TH7A 2E10A 3LGLA 5CR2A 3TEEA 2Y90A 3CCJT 4DA4A 3VYHB 2P0PA 2CS7A 2CYZB 3HP9A 2P0KA 5LJ5h 4OB3B 5GMKh 4E7IA 1FWZA 4NL3A 1IZ6A 1Q86U 2B8AA 4C8QB 3OYHA 3I56T 1XTDA 1FX7A 5GAN4 1M1KC 4C92G 3L2UA 5CKDA 2QXFA 3M57A 4Y28E 5A0LA 5FRNA 3CBMA 4A4FA 1QVFS 5GAN6 4M7AB 3T9NA 3A8HB 4F7UG 3J7AF 3UWNA 2X4WA 2CZ1B 3L1AA 1YITT 2HBPA 3ME9A 3QBYA 4FSXA 1BI0A 4J6XA 4BI8B 1VIEA 4MDXA 2MWPA 1YJWA 2VGNA 3LLRA 4PJOD 2FYKA 4N0AA 3ZBDA 4CRIA 2HQEA 4LDWA 3OS0A 3RUXA 3JCMd 3ER0A 4BI3A 5GAMe 3QXEB 4QQGA 2EIFA 3OMCA 3PTAA 3QSUA 3VV0A 1IREB 5GMKi 1YITA 1VQ7T 2K5IA 3JCMg 4JRIA 4TVRA 4C0DC 2QQRA 4MDWA 3V8JA 3J81E 4BDZA 1M8VA 1VIFA 2DXCA 3GOXA 1VQKT 3RMQA 3HRSA 2DTHA 1B34A 4JRKA 2XI9A 3G6ET 3JCMP 1I5LA 1ZBXA 2PUOB 1Q81C 4A4EA 2E70A 4BE2A 1KHIA 3OB9A 3JCMh 3META 5A0DA 5GAMf 1VQLT 2PVDB 1SSFA 2YLBA 1OZ3A 3E9GA 1UEBA 1VQ7A 4EDUA 2EWNA 4J8OA 2RA2A 3M54A 1K73C 3UT1A 4E7JA 4E7KA 3OBYA 3C12A 4LD6A 1OYXA 3MEWA 4M78G 3OYCA 3G4SA 4J7FA 5CCAA 1KC8U 2RH2A 2RO0A 1O75A 3JCMc 4C0DB 4M78F 1VQLA 5LJ3j 1WNLA 5GANf 4Z02A 2LCCA 5FRMA 2LT1A 2RHIA 4EPCA 2RK2A 3LYIA 3TCJA 1JBMA 1YI2A 4M77E 4XQ3A 2OTJA 5GAOp 3HKSA 5DY9A 4C5IA 1O9SA 1PSEA 3QHSA 1UGQB 3QYHB 1HK9A 4KT0E 2DTIA 1I4K1 4EMHA 4KBMB 2QQAA 1K9MU 4PLIA 3RKYA 3CPWS 3JB9D 2FHDA 5LJ3d 4RKUE 1PSFA 3JB9F 1N9SA 2QTXA 3A5ZB 5IN1A 3FDRA 4XTVA 5C0MA 2DXUA 3L2RA 4OB2B 1VQ9A 5A0GA 4XU1A 4J5YA 4M75E 3L2QA 1VQ8A 2RI2A 3BFMA 3M58A 2R57A 2RJDA 2PUKB 4XTYA 2P0QA 1KQSA 4M7DE 4M77C 1M1KU 2PU9B 2HQXA 2E65A 1YIJT 4IUQA 1DJ7B 5LJ5j 1S72T 2E1HA 1Q7YC 1U1SA 3GIBA 2QQ9A 4XK8E 3QDRB 5FU6C 3OMGA 3SB2A 1OZ2A 3NTHA 2ZPHB 2EQJA 2EQKA 5KH6A 3JCMJ 2KMTA 4HCZA 4BACA 3DKMA 1N9RA 4M75C 2DZ9A 3OYKA 3CCUT 4N4IA 3F70A 3MP6A 4M7DC 1EIFA 2WSEE 2KY9A 3DB4A 4J7IA 1VQOA 4ATOA 2O4XB 3CD6T 3E19A 3JB9I 5AYFA 1N8RC 3SFMA 1BI2A 3FEOA 3OS5A 5GAOn 4M77B 3PIPA 3MP8A 4VUBA 3HRTA 4ZGEB 4ZGDB 3H6ZA 2Y4XA 4C92E 3OYBA 2M0OA 3MCAB 3MHXA 4A4KA 4LDYA 2RHUA 5D6XA 3CC7A 3EAEA 3OYAA 3G71T 3QYGB 2VGMA 2XK0A 3GNGA 4F7UE 1Q81U 5DM7R 4KULA 1JB0E 5D6YA 5FU6B 2LC4A 2E12A 3CCQT 4JS4A 1YHQA 3UDCA 1BKBA 3C4SA 3OYJA 3CD6A 1WGSA 4O5VA 4C8QD 2XDDA 3DLMA 3BW1A 2BUDA 1K73U 1KG1A 4M75B 2KSSA 2LRQA 1AHJB 1RI0A 4MZMA 2K5FA 3QUIA 2KDSA 4M7AD 3HHTB 4M7DB 3JCMV 2DPPB 2LX9A 4A53A 2L8DA 4IUPA 3I55T 3G71A 5CIUA 2QQBA 3BDLA 4C92C 4PJOG 4HT8A 4E7LA 2YHTA 2EJ9A 2D9TA 1MGQA 3CCJA 3CCQA 3HL8A 3WVDB 3CXCS 2RHYA 2VXFA 3ZEHA 1H3ZA 1GXIE 2RD1A 2JTFA 2K2VA 2RJFA 4PJOF 2X35A 4OGEA 1M90C 3OYDA 5CVIA 3SD4A 4OF1A 1LNXA 3I56A 3LWIA 4RG8A 2P4TA 3V8LA 2A7YA 5I2MA 1XQHA 2O4XA 3LX7A 5HY6A 1K8AC 3PMTA 4M77A 1YJNT 5M9OA 2E64A 2E6ZA 3LWHA 2WACA 3GPLA 2FB7A 2RI5A 3RERA 4FT4A 4M78E 1HXDA 2DXBA 1D3BB 5CKHA 4A4GA 4C92B 3M5AA 5LL6S 1NPPA 1NZ9A 1YCYA 1V29B 4IURA 1Y7XA 2HAXA 1Y96B 4O6JA 4F7UB 2OTLT 4GLKA 2D0QB 5FROA 2AHJB 3VKIA 5GANe 3OA6A 1G3WA 3JSCA 2OAUA 1YJNA 4JUVA 1QVGA 4M75A 3CBPA 2JN0A 4C8QA 3HFNA 1BIAA 4M7DA 2HD0A 4FT2A 3OQ5A 4ZN1A 2RI3A 1W2BA 3SWNC 1Q7YU 5GAMj 1VQKA 2VV5A 4HT9A 4B9XA 3OY9A 1FXXA 3G6EA 3CCST 4M7AA 4X9DA 2VUBA 2C06A 4ZTFA 2DD5A 2QDYB 2K5LA 3MO8A 4P5NA 4M78C 3FC3A 2IVWA 2OTLA 2XIDA 4UC4A 5CAIA 3CCVT 3H8ZA 4L5GA 3V7CA 4PJOC 1BI3A 2M9UA 3X24B 3A8MB 3QPHA 4XTZA 1ZHIA 3OW2A 3V8KA 2QA4T 4N4GA 4GY5A 5GAN3 2BIVA 3QJ6A 2ZPEB 3QJYA 5GAMd 3M9QA 3CC4T 3PFSA 3JB9G 4JRPA 4BDYA 2EFIA 5GAN2 4XU0A 2DO3A 3OYGA 5LJ3f 4BD3A 4EMGA 1QVGS 3NTIA 3QZ5B 3JCMQ 2DXTA 4QVDA 4JRQA 2R5MA 5GAMg 3SWNB 3GNFB 4Y91A 1D3BA 2GF7A 3L42A 4C92A 2VC8A 3QZ9B 2F5KA 3JCMX 5GAN8 2E6NA 2LNVA 1JJ2A 4M78B 2DAQA 1XOVA 2ZPIB 4F7UA 5GAMh 5KE3A 1N27A 1U8RA 3JAME 2BKDN 3GP8A 5GMKe 2WSCE 2X4JA 2YRVA 2DIQA 3EFSA 1M1FA 2DEQA 5L8RE 4R55A 1BIBA 3S3OA 4OMFB 3KBGA 4R56A 1KD1C 1M9SA 2GQVA 2JTMA 1G3SA 1WQ7A 2MAMA 4MZTA 5KCHA 5GANg 5I21A 3OYMA 3CMAT 4C5HA 5GAOq 2X4XA 2EQMA 4LDUA 4BE0A 4XU3A 3CMET 4XAXB 3S3NA 2L3RA 2WSFE 3NFCA 1M90U 3JB9H 2ZGWA 2XU8A 5GAN5 2JNGA 3A8OB 3KUFA 3PMIA 2E41A 3EFRA 3WXMB 5GANh 4HCBA 2ZCFB 4OVAA 4MZPA 5LJ5f 3OS1A 1YIJA 4J6WA 1KQ1A 2V8IA 4M77D 1M5Q1 2EYQA 3CPFA 2MI6A 4M77F 1S72A 1K8AU 2CZ7B 4JLGA 3QIIA 5FU7C 5KE2A 1KQSS 2DD4A 3LGFA 4FIBA 4RCCA 4DOVA 3OYIA 2XDPA 3VJPA 3CMEA 1W4SA 5CKEA 4XU2A 3V7RA 3R6OA 3CCET 2KQWA 3SWNA 4J83A 2G3RA 2VYTA 3Q1JA 5CKFA 2M1HA 2FL7A 4PJOE 1NE8A 1NJIC 3CCUA 2F69A 1G3TA 3FIFA 4M78A 1M4ZA 4NL2A 3CEYA 3J80E 3OYNA 3O8VA 5GAOr 1G5VA 3LH0A 4N4HA 4M75D 2K4YA 4M75F 1Q82C 4C8QF 5CQXA 1KHCA 4OB1B 3JCMe 4M7DD 3JRZA 1QVFA 4BY6C 3E9FA 4KUDK 3FB9A 1YJ9T 1NPRA 1X75C 4ELZC 4M7AF 1U1TA 3CCEA 2K57A 2V8JA 3BDUA 4HKEA 2IG0A 3C95A 5FU7B 2LVMA 5KCOA 5IT9E 5CQYA 1WJSA 3VUBA 1K9MC 3A8GB 1RL2A 2EJGA 3MEAA 3OBWA 4IUUA 4LD9K 3OYEA 4QVZA 2LDMA 5J39A 2EQUA 1Y07A 3PT9A 2ZPBB 4NOYA 2L89A 3JCMf 1OI1A 2LCLA 3TREA 3KXTA 1QP2A 1YJWT 2YLCA 2QEXT 4XTUA 1YJ9A 1G3YA 2FVUA 2HNIA 1UGRB 3I55A 3RKXA 1M1GA 2LT4A 1VUBA 2GCXA 3HFOA 2JUFA 3SDZA 2R5AA 4DQ2A 2RK1A 4OB0B 1H641 4QQ6A 4BY6B 3S3MA 4X34A 2DZCA 2XHCA 3P8BB 5DLQE 4BB7A 4C92D 4A54A 3CBOA 3ASKA 3PNWC 3RKWA 4C92F 4JLIA 4V2SA 2XG8D 4JJNK 2QEXA 4F7UF 4YTLA 3M55A 5GAOm 1VQ4T 5C6SA 4CI0C 4EMKC 2DJZA 2RB6A 4PNOA 5J26A 3M53A 4FM4B 4PJOB 2K3YA 3X28B 4E7HA 4WF2A 1VQPT 3FRNA 1VQ6T 3M59A 4BE1A 2D6FA 2EAYA 1LJOA 3C94A 5EG2A 3OSVA 5FLXE 4ZGJB 1KD1U 2EKOA 1I8FA 1WQWA 2I2LA 2V8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y91 A;  4J6Y A;  1N9R A;  4M75 C;  2DZ9 A;  4C8Q B;  1D3B A;  5GAN 4;  4C92 A;  2VC8 A;  4C92 G;  4QVC A;  4MML A;  3JCM X;  5LJ3 e;  5GAN 8;  4M7D C;  1LOJ A;  4M78 B;  3PGG A;  2DTO A;  5GAN 6;  4M7A B;  4XTX A;  4F7U A;  4OP0 A;  4F7U G;  5GAM h;  3JB9 I;  5GAO n;  3L1A A;  4M77 B;  4XTW A;  4J6X A;  5GMK e;  3BY7 A;  4NL3 A;  3JCM W;  4C92 E;  3EFS A;  2DEQ A;  1BIB A;  4PJO D;  2FYK A;  4N0A A;  4EMK B;  3V7S A;  1WQ7 A;  4F7U E;  5GAN g;  5I21 A;  3RUX A;  3AHU A;  4HA8 A;  2VXE A;  3JCM d;  5GAO q;  5GAN j;  4XU3 A;  5GAM e;  5GAO l;  3JB9 H;  4C8Q D;  2ZGW A;  3QSU A;  3BW1 A;  5GMK i;  5GAN 5;  2E41 A;  3EFR A;  4M75 B;  5GAN h;  5GAN 7;  4M78 D;  3JCM g;  4JRI A;  5LJ5 f;  1M8V A;  3QUI A;  3V8J A;  4M7A D;  4M7D B;  3JCM V;  4J6W A;  1KQ1 A;  3SWN B;  4A53 A;  4M77 D;  1M5Q 1;  2DTH A;  1B34 A;  4JRK A;  4M77 F;  1Y96 A;  3JCM P;  4C92 C;  4PJO G;  1I5L A;  4PJO A;  5GAN d;  4HT8 A;  2YHT A;  2EJ9 A;  1MGQ A;  4RCC A;  2CGH A;  5LJ5 e;  3JCM h;  5GAM f;  3VU3 C;  3JCM b;  2VXF A;  2YLB A;  4XU2 A;  3V7R A;  2RD1 A;  4PJO F;  3SWN A;  1KQ2 A;  2EWN A;  2RA2 A;  1LNX A;  4PJO E;  1WPY A;  2RM4 A;  1JRI A;  4MMK A;  4RCB A;  3FIF A;  4N0A C;  4M78 A;  4M78 G;  3QO3 A;  4NL2 A;  3V8L A;  5GAO r;  4M75 D;  5GMK m;  4M75 F;  5GAM g;  4C8Q F;  3JCM e;  4M7D D;  4M77 A;  4M77 G;  3JCM c;  1I81 A;  2E64 A;  4C8Q E;  4M78 F;  5LJ3 g;  2FB7 A;  3FB9 A;  4M7A F;  1U1T A;  5LJ3 j;  1WNL A;  3RER A;  4M78 E;  1HXD A;  5GAN f;  4EMK A;  3FJP A;  4X9C A;  2DKG A;  1D3B B;  2K57 A;  3BDU A;  4M7A E;  4C92 B;  3RES A;  2EJF A;  1JBM A;  4M77 E;  4XQ3 A;  1YCY A;  2EJG A;  5GAO p;  3JB9 J;  5LJ3 h;  5GMK j;  1Y96 B;  5DY9 A;  4F7U B;  4PJO C;  5GAN e;  3QHS A;  2DVE A;  4NOY A;  1HK9 A;  2DTI A;  3JCM f;  4JUV A;  1I4K 1;  4M75 G;  4M75 A;  2JN0 A;  4C8Q A;  4C8Q G;  4EMH A;  3HFN A;  1BIA A;  2YLC A;  4XTU A;  3RKY A;  3JB9 D;  3JB9 F;  5LJ3 d;  4M7D A;  4M7D G;  1N9S A;  2QTX A;  2HNI A;  3SWN C;  5GAM j;  4HT9 A;  3HSB A;  4XTV A;  4M7A A;  4C8Q C;  3RKX A;  2DXU A;  4M7A G;  4X9D A;  3HFO A;  4XU1 A;  3L2Z A;  4M7D F;  4DQ2 A;  4J5Y A;  4M78 C;  4M75 E;  1H64 1;  5LJ5 d;  4M7A C;  3BFM A;  4XTY A;  2DZC A;  5CAI A;  3V7C A;  4M7D E;  4C92 D;  4A54 A;  3INZ A;  3RKW A;  4C92 F;  4M77 C;  5GMK l;  4JLI A;  4XTZ A;  4V2S A;  3V8K A;  5GAN 3;  2E65 A;  3M4G A;  5LJ5 g;  4F7U F;  3RIR A;  5GAO m;  1X01 A;  5GAM d;  5LJ5 j;  4EMK C;  1B34 B;  2DJZ A;  2E1H A;  2RB6 A;  1U1S A;  4PNO A;  3GIB A;  3JB9 G;  4PJO B;  1TH7 A;  2E10 A;  5GAN 2;  4XU0 A;  4WF2 A;  2Y90 A;  5LJ3 f;  3SB2 A;  2EAY A;  1LJO A;  4EMG A;  3JCM Q;  2DXT A;  4QVD A;  5LJ5 h;  3JCM J;  5GMK h;  1I8F A;  1WQW A;  2I2L A; 
#chains in the Genus database with same CATH topology
 4C5G A;  4J6Y A;  3GBQ A;  2A08 A;  1ZQ1 A;  2FZG B;  4QVC A;  1YBY A;  2LQK A;  4JJC A;  4PJJ A;  2KAF A;  3CME Q;  4OMP A;  3I35 A;  3P8D A;  3HRU A;  1BI1 A;  3URG A;  1PD0 A;  1IHW A;  3V7S A;  4RTW A;  1Q86 C;  2X4Y A;  5FW9 A;  3CCS A;  2VXE A;  4E7S A;  5GAN j;  2OTJ T;  1W1F A;  1MV3 A;  3UA6 A;  1WHG A;  1FMW A;  4M78 D;  2K3X A;  3G71 Q;  3OYF A;  1B3Q A;  2JVV A;  3CCM A;  2L5Q A;  2CGH A;  4PKC C;  5HK0 A;  3H0I A;  3E1S A;  5D6W A;  2HQH A;  3VS4 A;  3QO3 A;  2RQU A;  2JOY A;  2KT8 A;  3CCR A;  2XD0 A;  3WVE B;  1N6A A;  2R58 A;  1I81 A;  3OS2 A;  2DM1 A;  2JW4 A;  1JJ2 S;  4HCK A;  3CCL T;  3RES A;  1YJN Q;  3M0T A;  1QKW A;  5IHI A;  3RR6 A;  5I2S A;  1UGP B;  5CO7 A;  2QI2 A;  1YP5 A;  2RJE A;  2LQ8 A;  1VQM T;  5HK3 A;  4C8Q C;  2QG9 B;  1YHQ T;  3NMZ C;  4L59 A;  2DJQ A;  3CC2 A;  2F5T X;  3CXC A;  1E6H A;  4L6V 5;  1R8O B;  2CUB A;  2NLU A;  5LJ5 g;  2YWW A;  2LJ0 A;  2X51 A;  1MMG A;  4OGC A;  2CP3 A;  4DA4 A;  4E6R A;  2HL3 A;  1I0C A;  5IXF A;  4LUD A;  5GMK h;  4LNP A;  1D0Z A;  1Q86 U;  3OYH A;  1FX7 A;  2KRN A;  4C92 G;  4Y28 E;  3CC4 Q;  2DL3 A;  1QVF S;  3TSW A;  1H3H A;  4PK4 A;  3L1A A;  2HBP A;  4FSX A;  3QBY A;  1BI0 A;  3M0Q A;  2HQE A;  3OS0 A;  5GAM e;  4QQG A;  2ENM A;  2ED0 A;  4J9B A;  1VQ7 T;  2M51 A;  3JCM g;  4TVR A;  4C0D C;  1M8V A;  2MK5 A;  4BDZ A;  2DXC A;  1ZUU A;  2V1Q A;  3HRS A;  2DTH A;  3RBB B;  3JCM P;  4RTY A;  2KI7 A;  1KHI A;  3MET A;  1VQL T;  3MKD A;  1UEB A;  2O9V A;  2RA2 A;  2DYB A;  1OYX A;  1T3S A;  1SG5 A;  1C6V X;  2RHI A;  2RMO A;  2OTJ A;  3HKS A;  5DY9 A;  1UJY A;  4KBM B;  1PRL C;  1K9M U;  1RLP C;  2FHD A;  5LJ3 d;  4R0K A;  1NEB A;  3L2R A;  1GFD A;  4XU1 A;  4AFQ C;  1UFF A;  2BZ8 A;  1RAB B;  2SRC A;  2HSP A;  2CP5 A;  2PU9 B;  1TSF A;  4EIK A;  2KYB A;  1WHK A;  1Q7Y C;  1MNE A;  1U1S A;  3QDR B;  1LCK A;  2EQK A;  1YIT Q;  1QWE A;  1PNJ A;  3F70 A;  5KYY B;  4M7D C;  2KY9 A;  3DB4 A;  4J7I A;  2L3P A;  3JB9 I;  3SFM A;  5GAO n;  4M77 B;  2AKK A;  1JJ2 P;  4F14 A;  5D6X A;  2O2O A;  2J6O A;  3EAE A;  2XK0 A;  2Z0W A;  1WHH A;  1X27 A;  2E12 A;  3CCQ T;  1YHQ A;  3UDC A;  3OYJ A;  1WGS A;  1ZA1 B;  1NLO C;  4M75 B;  2KSS A;  4MZM A;  1WA7 A;  3G71 A;  3I55 T;  1YI2 Q;  1D09 B;  2EJ9 A;  2D9T A;  1RAI B;  1H3Z A;  1GXI E;  5I22 A;  2LJ1 A;  1VQ9 Q;  1ZUY A;  2O4X A;  3I9Q A;  4IIO A;  5KYU B;  1PWT A;  2RI5 A;  1HXD A;  2DXB A;  1QVF P;  2NUP A;  1NPP A;  2M0Y A;  1Y7X A;  1SPK A;  5FRO A;  2DET A;  2AHJ B;  2OAU A;  1YJN A;  2ATC B;  1QVG A;  1ABQ A;  4C8Q A;  2SEM A;  4FT2 A;  4ZN1 A;  1Q7Y U;  3PE0 A;  3EGX B;  4JPB W;  5GAM j;  2VV5 A;  1VQ5 Q;  2VUB A;  4RTZ A;  2QDY B;  3EGU A;  4M78 C;  2C0O A;  2JT4 A;  4K11 A;  3H8Z A;  1BI3 A;  2M9U A;  2DF6 A;  3QPH A;  4XTZ A;  2QA4 T;  2KRM A;  5GAN 3;  2KEA A;  3A1P A;  3RNJ A;  3M9Q A;  1E7O A;  4JRP A;  1V1C A;  3CD6 Q;  3OYG A;  4JJD A;  2DXT A;  4QVD A;  5GAM g;  2QGF B;  1T3L A;  4Y91 A;  1JO8 A;  1D3B A;  4AT1 B;  2GF7 A;  3L42 A;  2VC8 A;  1JJ2 A;  3EG9 B;  1RAC B;  2ZPI B;  1N27 A;  2BKD N;  2X4J A;  2DRM A;  1M1F A;  1G8X A;  4R56 A;  1KD1 C;  1M9S A;  1TUD A;  1WHJ A;  4C5H A;  1ZSZ C;  4LDU A;  1X6G A;  2L3R A;  1Y57 A;  4ANJ A;  1YNZ A;  5GAN 5;  3A8O B;  3PMI A;  5GAN h;  5LJ5 f;  3OS1 A;  4B6M A;  1KQ1 A;  1UDL A;  4HVV A;  4FIB A;  3LGF A;  4RCC A;  4DOV A;  4PJM A;  5CKE A;  2EYZ A;  4DEX A;  2EKH A;  2E3H A;  3SWN A;  2EVR A;  2F69 A;  1G3T A;  4NL2 A;  1M4Z A;  3CEY A;  3OYN A;  3O8V A;  4JZ3 A;  1BCM A;  1Q82 C;  4F16 A;  2OTL Q;  3JRZ A;  4F17 A;  1QVF A;  3EG0 A;  3E9F A;  1NPR A;  2CH4 A;  2K57 A;  1BK2 A;  2D8J A;  2K6D A;  2MPX C;  5IT9 E;  1GCQ A;  5IH2 A;  1C1A A;  3OBW A;  4LD9 K;  1UUE A;  2DRK A;  4QVZ A;  2LDM A;  5KYX A;  3OYE A;  4JRQ A;  3TRE A;  2L89 A;  3JCM f;  2F2W A;  3VRY A;  4J9E A;  1OU8 A;  1UGR B;  3I55 A;  4J9I A;  3SDZ A;  2R5A A;  4LXC A;  4BY6 B;  4QQ6 A;  1AT1 B;  4X34 A;  2DZC A;  5DLQ E;  4BB7 A;  3ASK A;  3PNW C;  4IIM A;  2CSQ A;  1TTH B;  2XG8 D;  3QWX X;  4F7U F;  3M55 A;  1PCX A;  2JS2 A;  4PJO B;  2K3Y A;  4WF2 A;  3FRN A;  1WXB A;  2DER A;  1KD1 U;  1G2B A;  3RDV A;  1PKS A;  2KNB B;  3G4S T;  1NEG A;  4XTX A;  4OP0 A;  4PJN A;  1WLP B;  1UHF A;  1M2V B;  1VQ6 A;  1VQP A;  4CC4 B;  3JCM W;  1WFW A;  5J3B A;  2BTT A;  4EMK B;  2OJ2 A;  1LPL A;  3HPW A;  4HA8 A;  3SEM A;  3CCM T;  2DA9 A;  3PIO A;  4BUG A;  4C0G A;  1W2B S;  2QA4 A;  2O01 E;  1K9A A;  1Q82 U;  3CCR T;  1Y96 A;  1X2K A;  2XKO C;  2MOX A;  1Q86 R;  5LJ5 e;  1VYU A;  1RLQ C;  3QKJ A;  3DLL A;  3H0F A;  1KQ2 A;  4FYX B;  2DYI A;  2RM4 A;  1JRI A;  4RCB A;  4FL6 A;  2M16 A;  2FPD A;  2GFU A;  2KXC A;  4OML A;  2MMP A;  2M02 A;  3PVL A;  4M77 G;  2JMA A;  5LJ3 g;  3X26 B;  4PJL A;  2HZY A;  9ATC B;  4HCC A;  1VQO A;  2A3L A;  3FJP A;  2QEX Q;  3MEU A;  4M7A E;  2A28 A;  4ELY C;  2YRD A;  4DOW A;  1ZUK A;  3CC2 T;  1GFC A;  2C0I A;  3MEV A;  4M75 G;  1EZZ B;  4FU6 A;  4KUI A;  1UGS B;  3HSB A;  1NM7 A;  4M7A G;  2CUD A;  2DL5 A;  1WX6 A;  2KRO A;  1XNI A;  2O31 A;  3L2Z A;  1VQ5 A;  2CZ6 B;  3QG1 A;  5GMK l;  4KGZ B;  2RHX A;  4Z8A A;  1RAD B;  2KXD A;  1NJI R;  2RN8 A;  4D6W A;  1QQJ A;  4LDX A;  1TH7 A;  2DL4 A;  5CR2 A;  3CCJ T;  3VYH B;  3CCV Q;  2CYZ B;  2LP5 A;  2JXB A;  4OB3 B;  4E7I A;  1FWZ A;  4NL3 A;  3VS1 A;  2B8A A;  4C8Q B;  5GAN 4;  4ESR A;  3L2U A;  5CKD A;  1M3C A;  5A0L A;  4LUE A;  1K9M R;  3J7A F;  4DBQ A;  2X4W A;  2CZ1 B;  2CP6 A;  4ORZ A;  1RAG B;  4BI8 B;  5KYN A;  2VGN A;  1ZSZ A;  3EHR A;  3LLR A;  4CRI A;  2LQN A;  3M0R A;  4KRT A;  3ER0 A;  2QDL A;  4BI3 A;  2NUT A;  2EIF A;  2HDA A;  1OEB A;  3H9N A;  3V8J A;  3J81 E;  3CMA Q;  1W70 A;  3RMQ A;  3M0P A;  3G6E T;  1B34 A;  4JRK A;  2PUO B;  4BE2 A;  2DX1 A;  5GAM f;  4FCY A;  4RTV A;  2CH4 W;  4J8O A;  3M54 A;  2H8H A;  4KH1 B;  3CCL Q;  1ACM B;  4LD6 A;  1RAA B;  3MEW A;  3G4S A;  4J7F A;  1N5Z A;  1O75 A;  3JCM c;  4C0D B;  1QLY A;  4HVW A;  1WNL A;  2CP0 A;  2CP2 A;  2H3E B;  2RK2 A;  3LYI A;  1JBM A;  6AT1 B;  2EGA A;  1HK9 A;  1TXQ A;  2COY A;  2FRW A;  4EMH A;  2X3X D;  2QQA A;  3RKY A;  3CPW S;  3JB9 D;  1MMA A;  1QCF A;  2QTX A;  3FDR A;  1PKT A;  3D7S B;  4OB2 B;  2J6K A;  2HEQ A;  1BU1 A;  2HL5 C;  2EYX A;  2K2M A;  2QK0 A;  1W2B P;  1D1A A;  2D0N A;  4XTY A;  1YJW Q;  2HQX A;  3EFO B;  5LJ5 j;  2HCK A;  1Z9Z A;  3GIB A;  3A98 A;  3IQL A;  1OV3 A;  3E2U A;  3SB2 A;  1OZ2 A;  3NTH A;  5KH6 A;  5KYX B;  4BAC A;  4RUG A;  4FSS A;  4N4I A;  3MP6 A;  1EIF A;  4ATO A;  2W10 A;  2KT1 A;  3HTR A;  5AYF A;  1IGQ A;  1N8R C;  3FEO A;  3MP8 A;  4ZGE B;  3HRT A;  4ZGD B;  1KC8 R;  4C92 E;  1VQ7 Q;  3MHX A;  3OYA A;  3G71 T;  2PNI A;  1JB0 E;  3PVQ A;  4JS4 A;  1BKB A;  4O5V A;  1VQL Q;  1RI0 A;  3QUI A;  1OUL A;  2KDS A;  4M7A D;  4M7D B;  3JCM V;  1MMD A;  4PJO G;  4AFZ C;  4HT8 A;  2YHT A;  1MGQ A;  1AOJ A;  3CCJ A;  3WVD B;  1U06 A;  3ZEH A;  2VB6 A;  2JTF A;  4PJO F;  1HYO A;  2X35 A;  5CVI A;  1VQN Q;  1EFN A;  2JJ9 A;  2P4R A;  1M1K R;  1GBR A;  1MND A;  2LNH B;  5GJW B;  1M27 C;  1VQ8 Q;  1PG5 B;  2RF0 A;  1YJN T;  4AG1 C;  1ZBJ A;  1JXO A;  3M0S A;  5LL6 S;  2JS0 A;  1YCY A;  1V29 B;  1Y96 B;  4O6J A;  4F7U B;  4GLK A;  4AG2 C;  1G3W A;  1U5S A;  4JUV A;  2JN0 A;  3HFN A;  1BBZ A;  1RAF B;  2COW A;  3SWN C;  4DBR A;  1W2B A;  4J9G A;  3OY9 A;  3G6E A;  3M0U A;  1R0B G;  2K5L A;  4UC4 A;  3CC7 Q;  2BIV A;  2ZPE B;  1K73 R;  3CC4 T;  2ROT A;  4XU0 A;  1GCQ C;  2DO3 A;  5LJ3 f;  4BD3 A;  1IB8 A;  4EMG A;  2ED1 A;  2I0N A;  3NTI A;  3QZ5 B;  4J9F A;  2R5M A;  3GNF B;  1YWO A;  1M30 A;  4C92 A;  3QZ9 B;  4M78 B;  5KE3 A;  1U8R A;  1T0H A;  5GMK e;  2DIQ A;  3EFS A;  5L8R E;  1BIB A;  1TS9 A;  2EPD A;  3I56 Q;  2GQV A;  5FWC A;  3EGD B;  1G3S A;  4MZT A;  5KCH A;  1OU9 A;  1HJD A;  5GAO q;  2EQM A;  4BE0 A;  2E5K A;  3S3N A;  2ZGW A;  3CPW P;  3KUF A;  3WXM B;  2AZV A;  4OVA A;  4MZP A;  1WYX A;  5ECA A;  4AMC A;  2V8I A;  2F1L A;  2EYQ A;  2EYY A;  2MI6 A;  1KD1 R;  3VJP A;  3CME A;  3R6O A;  4J83 A;  3LH5 A;  1VQK Q;  2FL7 A;  5GAO r;  3ULR B;  2K4Y A;  2RNA A;  4C8Q F;  5CQX A;  2YRC A;  2CRE A;  3FB9 A;  3NGP A;  3VS0 A;  1CKB A;  1T0J A;  3BDU A;  3C95 A;  2DLP A;  3A8G B;  1UTI A;  1QCN A;  3PT9 A;  4NOY A;  1OI1 A;  2LCL A;  3U23 A;  2HNI A;  4E2F B;  5L23 A;  1M1G A;  2LT4 A;  1VUB A;  2GCX A;  2YXY A;  3HFO A;  4PFO A;  4DQ2 A;  4OB0 B;  2VAS A;  1WHL A;  4C92 D;  1WI7 A;  3RKW A;  1M90 R;  4YTL A;  1AVZ C;  2A36 A;  2DJZ A;  4PNO A;  5J26 A;  1I5O B;  4KH0 B;  1VQ6 T;  1VQP T;  3M59 A;  1LJO A;  5FLX E;  4ZGJ B;  1NYG A;  2EKO A;  2I2L A;  2V8K A;  4WTO B;  4ZN3 A;  1YIJ Q;  4DEY A;  2KRS A;  4MML A;  1S72 Q;  5LJ3 e;  2ZZD A;  2DTO A;  2Y4Y A;  4C5E A;  3NPF A;  5A2Q E;  3FLG A;  2B86 A;  4XTW A;  3A8L B;  2K9G A;  2DNU A;  2JZ2 A;  3CCU Q;  3CPW A;  1YI2 T;  3M4Y A;  1X6B A;  3FJ5 A;  2ABL A;  2D1X A;  2HSE B;  3M56 A;  2DK3 A;  3L2V A;  2KVQ G;  3OSS C;  1J3T A;  5GAN 7;  1QW1 A;  2ESW A;  4C0Z A;  1TU0 B;  4KGV B;  5IAY A;  2PQW A;  2KK4 A;  1ZA2 B;  2JMC A;  3CC4 A;  2A37 A;  2JTE A;  3GF5 A;  2K7A A;  2LZ6 B;  1VQ9 T;  5GAN d;  1D0Y A;  3DB3 A;  4WCI A;  1WHM A;  4J9C A;  2LJ3 A;  3VU3 C;  5KYW A;  3VYG A;  1VQO T;  1SRM A;  4Q5W A;  4RG2 A;  2ZPG B;  1WJR A;  1MHN A;  1BCO A;  3THK A;  1VQN A;  1I1J A;  5GMK m;  1IO6 A;  2L3Q A;  1WDX A;  2MIO A;  4PL6 A;  3N5B B;  3L2W A;  2ZPF B;  3VS7 A;  1FMV A;  1BB9 A;  3P8H A;  2G6F X;  1VQ5 T;  1C0M A;  4X1V A;  5GMK j;  1UB4 A;  2HKN A;  1P92 A;  2LQW A;  2DVE A;  5FWB A;  2PVO B;  4QW2 A;  1WJQ A;  4M7D G;  4A4H A;  3X20 B;  2H3J A;  2RQR A;  2RJC A;  4M7D F;  5LJ5 d;  2E5Q A;  4QKU A;  4M7A C;  2CKK A;  3REB B;  1Y71 A;  1OPL A;  2MWO A;  3MPU B;  4A63 B;  2XDB A;  3M4G A;  1SF9 A;  2QQS A;  1PM3 A;  1AEY A;  3CCS Q;  4IKF A;  1FMK A;  2E10 A;  2DEU A;  2Y90 A;  2P0P A;  2CS7 A;  2P0K A;  5LJ5 h;  3O5Z A;  4OMO A;  2CT4 A;  2IPO B;  1RAH B;  3CBM A;  4A4F A;  3T9N A;  3A8H B;  3CCM Q;  4F7U G;  3UWN A;  2OAW A;  3ME9 A;  2FO0 A;  2MWP A;  4N0A A;  3ZBD A;  2AK5 A;  3JCM d;  3CCR Q;  1IGU A;  3TQ7 P;  3QXE B;  2OX7 A;  2QGG A;  1F1B B;  3OMC A;  2GTO A;  1IRE B;  1YIT A;  2K5I A;  2YSQ A;  2QQR A;  4MDW A;  2RQV A;  4FYV B;  4RTU A;  1TWB A;  2EYW A;  2XI9 A;  2BZY A;  1I5L A;  1ZBX A;  1Q81 C;  4A4E A;  1AD5 A;  2E70 A;  3OB9 A;  3JCM h;  2PVD B;  1SSF A;  1OZ3 A;  2HMA A;  2EWN A;  1A0N B;  1VA7 A;  4M78 G;  3OYC A;  2RH2 A;  2RO0 A;  2FG0 A;  1CSK A;  1AZG B;  4M78 F;  3CCE Q;  2LX7 A;  5LJ3 j;  2AIR B;  4Z02 A;  2LT1 A;  1AWW A;  1YI2 A;  4M77 E;  4XQ3 A;  5GAO p;  2C0T A;  1B07 A;  1O9S A;  4C5I A;  4FYW B;  1UGQ B;  1YJ9 Q;  2VKN A;  1VYV A;  3JB9 F;  4RKU E;  1N9S A;  4XTV A;  5C0M A;  1VQ9 A;  5A0G A;  4J5Y A;  4M75 E;  1SHG A;  3L2Q A;  2ROL A;  3BFM A;  2R57 A;  2PUK B;  2P0Q A;  2QAS A;  1VOM A;  2X9H A;  1AZE A;  1DJ7 B;  2E1H A;  4XK8 E;  5FU6 C;  3UF4 A;  3JCM J;  2KMT A;  4HCZ A;  3CQT A;  4CC7 A;  3OYK A;  1VQ4 Q;  1GBQ A;  1WIE A;  1M2O A;  2O4X B;  3E19 A;  3UA7 A;  3OS5 A;  1S1N A;  2ZAE A;  2Y4X A;  5D7U A;  3OYB A;  2M0O A;  3MCA B;  4A4K A;  2RHU A;  1JQQ A;  3GNG A;  1Q81 U;  5DM7 R;  2NUP B;  5D6Y A;  1R0C B;  3I5R A;  4Z88 A;  3C4S A;  3CD6 A;  3BW1 A;  2BUD A;  2LRQ A;  2K5F A;  3AT1 B;  3HHT B;  2LX9 A;  2MYS A;  1Y0M A;  4A53 A;  2L8D A;  3NHN A;  1SHF A;  2OTJ Q;  4C92 C;  1K76 A;  1Q95 G;  8AT1 B;  1WXT A;  2RHY A;  4OGE A;  1ZX6 A;  4OF1 A;  3SD4 A;  1WXU A;  2DMO A;  5KYY A;  2RQT A;  1XQH A;  3LX7 A;  5HY6 A;  1K8A C;  1SEM A;  3PMT A;  1OPK A;  1UGV A;  4M77 A;  4FW1 A;  1B7T A;  5M9O A;  2E64 A;  1U3O A;  2WAC A;  3LWH A;  3RER A;  1PC0 A;  1KFZ A;  1D3B B;  4A4G A;  2QAZ A;  2DL7 A;  7AT1 B;  2FZK B;  2HAX A;  2D0Q B;  3VKI A;  3JSC A;  1K0X A;  4M75 A;  3CBP A;  2YUO A;  2FZC B;  2RI3 A;  4HT9 A;  4M7A A;  4X9D A;  2C06 A;  3MO8 A;  2IVW A;  2OTL A;  2XID A;  5CAI A;  3CCV T;  1NYF A;  4PFP A;  3X24 B;  1TOV A;  1ZHI A;  3V8K A;  4N4G A;  4GY5 A;  1VQM Q;  1IRX A;  3QJ6 A;  2KYM A;  3QJY A;  1RAE B;  5GAM d;  1IXD A;  3PFS A;  1NBE B;  1G83 A;  4BDY A;  2EFI A;  1YHQ Q;  5KYU A;  1QVG S;  4RTT A;  3JCM Q;  1OX9 A;  1D1B A;  3SWN B;  3VS5 A;  2E4H A;  2F5K A;  5GAN 8;  2E6N A;  3UAT A;  5GAM h;  1W6X A;  2YT6 A;  2MCN A;  3JAM E;  2J6F A;  2EBP A;  3GP8 A;  1AWO A;  1QKX A;  2DEQ A;  4OMF B;  3KBG A;  3EGX A;  1WQ7 A;  3CMA T;  5GAN g;  1MMN A;  2X4X A;  1WZO A;  3BE3 A;  3CME T;  1OQK A;  2WSF E;  3NFC A;  3JB9 H;  2XU8 A;  4GBQ A;  2FRY A;  2JNG A;  2E41 A;  3EFR A;  1JU5 C;  2EQI A;  4HCB A;  2ZCF B;  3SHW A;  4J6W A;  4M77 D;  1M5Q 1;  3CPF A;  3VS2 A;  5I11 A;  1K8A U;  1Q7Y R;  3QII A;  5FU7 C;  2F2X A;  5KE2 A;  1KQS S;  1TUC A;  3MJX A;  3OYI A;  1W4S A;  3JV3 A;  1OX8 A;  4XU2 A;  4CC3 A;  3TSZ A;  2G3R A;  2VYT A;  5CKF A;  4PJO E;  1NE8 A;  1NJI C;  2FEI A;  1G5V A;  3EG9 A;  2GNC A;  1TUG B;  4N4H A;  1GCP A;  4M75 D;  1KHC A;  4OB1 B;  1PHT A;  1X75 C;  4ELZ C;  3CCE A;  5GJV B;  2V8J A;  4HKE A;  2LVM A;  5KCO A;  5CQY A;  1K9M C;  2EJG A;  4IUU A;  2GGR A;  4DBF A;  3R6N A;  5J39 A;  3PTA A;  2ZPB B;  1YJW T;  2YLC A;  4XTU A;  1YJ9 A;  2FVU A;  2EGE A;  3RKX A;  1QWF A;  2E3I A;  2BZX A;  4C92 F;  4CC2 A;  5HCK A;  4V2S A;  4JJN K;  4Y92 A;  2QEX A;  5C6S A;  4CI0 C;  2RB6 A;  1HSQ A;  2L3S A;  2D6F A;  5IHK A;  2EAY A;  3C94 A;  3OSV A;  1I8F A;  4C0F A;  2GTJ A;  4NS5 A;  2KGT A;  4IUT A;  5CKB A;  2YDL A;  1LOJ A;  3X25 B;  1QVP A;  3PGG A;  1VQ4 A;  3BY7 A;  3OYY A;  1LVK A;  1M3B A;  1X6O A;  5DLO A;  2DL8 A;  2GFA A;  1N8R U;  3VUZ A;  2AT1 B;  4IUV A;  3AHU A;  3KFV A;  5GAO l;  5HKC A;  2DBM A;  4JS5 A;  1TG0 A;  3CCV A;  3ZFJ A;  4ZTJ A;  1GL5 A;  1NJI U;  2LCS A;  1VQN T;  1UG1 A;  4E47 A;  4RMO A;  4FW2 A;  4BI4 A;  4PJO A;  3CCQ Q;  2PVG B;  2JM8 A;  3RMS A;  3GLX A;  1VQ8 T;  1BYM A;  3OW2 S;  4J9H A;  3JCM b;  1QP3 A;  4JDS A;  2O9S A;  3G1J A;  1WPY A;  4MMK A;  2DIG A;  2XIC A;  1ZSG A;  3I55 Q;  4N0A C;  3NTK A;  2LMJ A;  1QVG P;  1M2V A;  4ZNX A;  4C8Q E;  1KIK A;  2CZ0 B;  3UPU A;  4EMK A;  5IHN A;  4X9C A;  2DKG A;  3CMA A;  1JEG A;  3S6W A;  2EJF A;  4PLL A;  3JB9 J;  2AZS A;  1IHV A;  5LJ3 h;  3LW5 E;  2RHZ A;  4JJB A;  2O88 A;  3TU4 K;  1KC8 C;  3OYL A;  3EG2 A;  2IIM A;  4C8Q G;  2AKL A;  5CK9 A;  1ZSZ B;  3CC7 T;  4QQD A;  1UEC A;  4KGX B;  4II1 A;  3CCL A;  1YFN A;  4LDV A;  2NUT B;  4AFS C;  2LTO A;  1VQ6 Q;  1VQP Q;  1E6G A;  3QWY A;  3INZ A;  2CDT A;  3G7Z A;  1QCO A;  1SRL A;  2L2P A;  4ME7 A;  1X01 A;  3RIR A;  1VQM A;  4B9W A;  1KQS P;  2MF2 A;  1B34 B;  1ABO A;  3MP1 A;  3LGL A;  2DFU A;  3TEE A;  1Q82 R;  1V76 A;  1R77 A;  1H92 A;  3HP9 A;  1KK7 A;  2CT3 A;  2EGC A;  2QA4 Q;  1IZ6 A;  1D1C A;  3I56 T;  1XTD A;  1M1K C;  2QXF A;  3M57 A;  5FRN A;  5GAN 6;  4M7A B;  1YIT T;  3EG3 A;  4J6X A;  1VIE A;  4MDX A;  2BE9 B;  1YJW A;  4PJO D;  2FYK A;  2NWM A;  1HD3 A;  4QT7 A;  4LDW A;  3RUX A;  4DBH A;  2DVJ A;  2YUP A;  1YN8 A;  3QSU A;  2J06 A;  3VV0 A;  2XMF A;  2ECZ A;  5GMK i;  4JRI A;  3EG1 A;  1VQO Q;  4OMN A;  1VIF A;  3GOX A;  1VQK T;  5A0D A;  4PFZ A;  5EC7 A;  4Z89 A;  2YLB A;  3E9G A;  3TVT A;  3QDF A;  4RTX A;  1VQ7 A;  4EDU A;  5IXB A;  2A0F B;  1K73 C;  1EX4 A;  3UT1 A;  4E7J A;  4E7K A;  3OBY A;  3EHQ A;  3C12 A;  5CCA A;  1KC8 U;  2K79 A;  1I07 A;  2HBW A;  1Q81 R;  1VQL A;  2RPN A;  4LE9 A;  1H8K A;  2LCC A;  5GAN f;  5FRM A;  2VWF A;  4EPC A;  3TCJ A;  1X2Q A;  1KJW A;  1AWJ A;  4D8D A;  8ATC B;  1PSE A;  3REA B;  3QHS A;  3QYH B;  2DIL A;  4KT0 E;  2DTI A;  3I5S A;  1I4K 1;  4PLI A;  1PSF A;  3A5Z B;  5IN1 A;  2DXU A;  2V26 A;  2V1R A;  3VS3 A;  1Z9Q A;  1K0S A;  2PTK A;  1VQ8 A;  2RI2 A;  3M58 A;  2RJD A;  4M7D E;  1PD1 A;  1KQS A;  4M77 C;  2L0A A;  1M1K U;  2P84 A;  1YIJ T;  2E65 A;  4IUQ A;  1S72 T;  2J05 A;  3H41 A;  2VVK A;  2QQ9 A;  3OW2 P;  3OMG A;  2ZPH B;  2EQJ A;  2CSI A;  3DKM A;  1N9R A;  4M75 C;  2DZ9 A;  2X3W D;  3CCU T;  2WSE E;  3CD6 T;  2FPE A;  2RQW A;  1BI2 A;  3PIP A;  4VUB A;  3EH1 A;  1M3A A;  1X43 A;  3H6Z A;  4LDY A;  2GBQ A;  4J9D A;  3CC7 A;  3QYG B;  2VGM A;  4F7U E;  4KUL A;  5FU6 B;  1UE9 A;  2KBT A;  1RUW A;  2LC4 A;  3G4S Q;  4FYY B;  1D0X A;  4C8Q D;  2XDD A;  3DLM A;  1SSH A;  1K73 U;  1KG1 A;  4OMQ A;  1AHJ B;  2K3B A;  2DPP B;  3EH2 A;  3EFO A;  4IUP A;  5CIU A;  2QQB A;  3BDL A;  4E7L A;  4JZ4 A;  3CCQ A;  3HL8 A;  3CXC S;  2VXF A;  2RD1 A;  2K2V A;  2RJF A;  1M90 C;  3OYD A;  5AT1 B;  2W0Z A;  1LNX A;  3I56 A;  3LWI A;  4RG8 A;  2P4T A;  3V8L A;  2A7Y A;  5I2M A;  1M8M A;  2E6Z A;  4OMM A;  2FB7 A;  3GPL A;  1SKU B;  4FT4 A;  4M78 E;  5CKH A;  1FYN A;  4C92 B;  3M5A A;  2F2V A;  1NZ9 A;  2J7I A;  4IUR A;  2OTL T;  3OA6 A;  5GAN e;  1K1Z A;  1YCS B;  1K8A R;  1AWX A;  2COZ A;  1BIA A;  2QYZ A;  4M7D A;  2HD0 A;  3OQ5 A;  1VQK A;  4B9X A;  3H0H A;  1FXX A;  3CCS T;  1YWP A;  4ZTF A;  2DD5 A;  2BE7 D;  4P5N A;  3FC3 A;  3CC2 Q;  2YUN A;  3V7C A;  4L5G A;  3A8M B;  3OW2 A;  1K4U S;  2OI3 A;  3JB9 G;  4HVU A;  5GAN 2;  1NG2 A;  3ZL7 C;  3JCM X;  2LNV A;  2DAQ A;  1XOV A;  1NLP C;  4F7U A;  3CCJ Q;  1MV0 B;  2WSC E;  2YRV A;  3VS6 A;  4R55 A;  3S3O A;  2KE9 A;  2JTM A;  2MAM A;  3OYM A;  5I21 A;  4LN2 A;  4XU3 A;  4XAX B;  1M90 U;  1ZLM A;  3C0C A;  2PZ1 A;  1VYT A;  4D8K A;  4E7Z A;  2CP7 A;  1YIJ A;  2NUZ A;  4M77 F;  1S72 A;  2CZ7 B;  4JLG A;  2DD4 A;  2JM9 A;  2XDP A;  3V7R A;  3CCE T;  2KQW A;  2YUQ A;  3Q1J A;  3VRZ A;  2M1H A;  3CCU A;  3FIF A;  3G6E Q;  4HXJ A;  4M78 A;  3J80 E;  3LH0 A;  4M75 F;  3JCM e;  1N8R R;  4M7D D;  1GRI A;  2FPF A;  1PRM C;  4BY6 C;  4KUD K;  4F04 B;  1YJ9 T;  4M7A F;  1U1T A;  1X69 A;  3EGD A;  2IG0 A;  5FU7 B;  2NYS A;  1WJS A;  3VUB A;  1RL2 A;  3MEA A;  1XJW B;  2GQI A;  1UHC A;  4PJO C;  4M4Z A;  1QMC A;  2EQU A;  1Y07 A;  3KXT A;  1CKA A;  2DBK A;  2HKQ B;  1QP2 A;  2QEX T;  2EW3 A;  1G3Y A;  2D8H A;  2JUF A;  2RK1 A;  1H64 1;  2QTV A;  3S3M A;  2XHC A;  3P8B B;  1OOT A;  3CBO A;  4A54 A;  4JLI A;  1KSW A;  2DE0 X;  5GAO m;  1VQ4 T;  2KR3 A;  4EMK C;  3M53 A;  1MUZ A;  1RI9 A;  4FM4 B;  3X28 B;  3CXC P;  1UJ0 A;  4E7H A;  4GLM A;  1ARK A;  4BE1 A;  5EG2 A;  5KYW B;  4AFU C;  1WQW A;  1JXM A; 
#chains in the Genus database with same CATH homology
 4C5G A;  4ZN3 A;  4J6Y A;  4C0F A;  4NS5 A;  1ZQ1 A;  4QVC A;  4IUT A;  4MML A;  5LJ3 e;  2ZZD A;  5CKB A;  1LOJ A;  3X25 B;  1QVP A;  3PGG A;  1YBY A;  1VQ4 A;  3G4S T;  2DTO A;  2LQK A;  2Y4Y A;  4XTX A;  4C5E A;  4OP0 A;  5A2Q E;  2KAF A;  3FLG A;  4XTW A;  3A8L B;  1VQ6 A;  1VQP A;  3P8D A;  3BY7 A;  3JCM W;  3HRU A;  1BI1 A;  3OYY A;  3URG A;  5DLO A;  1X6O A;  2JZ2 A;  5J3B A;  2GFA A;  4EMK B;  1N8R U;  3V7S A;  3VUZ A;  4IUV A;  3CPW A;  3HPW A;  1YI2 T;  2X4Y A;  3CCS A;  4HA8 A;  2VXE A;  3CCM T;  5GAN j;  3M4Y A;  1Q86 C;  3AHU A;  2OTJ T;  5GAO l;  5HKC A;  4JS5 A;  3PIO A;  3M56 A;  4BUG A;  3CCV A;  2DK3 A;  3ZFJ A;  2KVQ G;  3L2V A;  3OSS C;  4C0G A;  4ZTJ A;  1W2B S;  5GAN 7;  1NJI U;  4M78 D;  1QW1 A;  2K3X A;  2QA4 A;  4C0Z A;  2O01 E;  1VQN T;  5IAY A;  2PQW A;  2KK4 A;  1Q82 U;  3CCR T;  1Y96 A;  4E47 A;  4RMO A;  1VQ9 T;  3GF5 A;  4BI4 A;  3OYF A;  3CC4 A;  2XKO C;  2JVV A;  2PVG B;  5GAN d;  4PJO A;  3RMS A;  3GLX A;  3CCM A;  2L5Q A;  2CGH A;  5LJ5 e;  1VQ8 T;  1BYM A;  4PKC C;  3DB3 A;  3OW2 S;  5HK0 A;  3QKJ A;  3VU3 C;  1QP3 A;  3JCM b;  3DLL A;  3E1S A;  4JDS A;  3VYG A;  1VQO T;  1KQ2 A;  4Q5W A;  4RG2 A;  5D6W A;  1WPY A;  2DIG A;  1JRI A;  2RM4 A;  2XIC A;  1WJR A;  2ZPG B;  4FL6 A;  1MHN A;  4MMK A;  4RCB A;  4N0A C;  3NTK A;  3QO3 A;  1VQN A;  2M16 A;  2GFU A;  2JOY A;  3CCR A;  2XD0 A;  5GMK m;  2MMP A;  3WVE B;  1N6A A;  2R58 A;  4M77 G;  1I81 A;  3OS2 A;  4C8Q E;  5LJ3 g;  3X26 B;  2CZ0 B;  1JJ2 S;  4HCC A;  4PL6 A;  3UPU A;  2A3L A;  3N5B B;  4EMK A;  3L2W A;  3FJP A;  2ZPF B;  2DKG A;  3MEU A;  4X9C A;  3P8H A;  3CMA A;  3CCL T;  4M7A E;  3RES A;  2EJF A;  3S6W A;  4PLL A;  1VQ5 T;  4ELY C;  3JB9 J;  5LJ3 h;  3LW5 E;  2RHZ A;  1UB4 A;  4DOW A;  5GMK j;  3TU4 K;  3CC2 T;  1P92 A;  2DVE A;  1KC8 C;  3MEV A;  5I2S A;  3OYL A;  1UGP B;  4M75 G;  5CO7 A;  2PVO B;  4C8Q G;  4QW2 A;  2QI2 A;  5CK9 A;  1WJQ A;  2RJE A;  4FU6 A;  2LQ8 A;  4A4H A;  3CC7 T;  1VQM T;  4M7D G;  5HK3 A;  4QQD A;  3X20 B;  4KUI A;  1UGS B;  2H3J A;  4II1 A;  3HSB A;  4M7A G;  4C8Q C;  3CCL A;  4LDV A;  2RJC A;  1XNI A;  3L2Z A;  1VQ5 A;  1YHQ T;  4M7D F;  5LJ5 d;  2CZ6 B;  2E5Q A;  2LTO A;  4L59 A;  2CKK A;  4M7A C;  1Y71 A;  3QG1 A;  5GMK l;  2MWO A;  3INZ A;  3CC2 A;  2XDB A;  2F5T X;  3CXC A;  4L6V 5;  1R8O B;  2NLU A;  3G7Z A;  2RHX A;  3M4G A;  5LJ5 g;  3RIR A;  4ME7 A;  2QQS A;  1X01 A;  1VQM A;  4B9W A;  2MF2 A;  1B34 B;  4D6W A;  4IKF A;  3MP1 A;  4OGC A;  4LDX A;  1TH7 A;  2E10 A;  3LGL A;  5CR2 A;  3TEE A;  2Y90 A;  3CCJ T;  4DA4 A;  3VYH B;  2P0P A;  2CS7 A;  2CYZ B;  3HP9 A;  2P0K A;  5LJ5 h;  4OB3 B;  5GMK h;  4E7I A;  1FWZ A;  4NL3 A;  1IZ6 A;  1Q86 U;  2B8A A;  4C8Q B;  3OYH A;  3I56 T;  1XTD A;  1FX7 A;  5GAN 4;  1M1K C;  4C92 G;  3L2U A;  5CKD A;  2QXF A;  3M57 A;  4Y28 E;  5A0L A;  5FRN A;  3CBM A;  4A4F A;  1QVF S;  5GAN 6;  4M7A B;  3T9N A;  3A8H B;  4F7U G;  3J7A F;  3UWN A;  2X4W A;  2CZ1 B;  3L1A A;  1YIT T;  2HBP A;  3ME9 A;  3QBY A;  4FSX A;  1BI0 A;  4J6X A;  4BI8 B;  1VIE A;  4MDX A;  2MWP A;  1YJW A;  2VGN A;  3LLR A;  4PJO D;  2FYK A;  4N0A A;  3ZBD A;  4CRI A;  2HQE A;  4LDW A;  3OS0 A;  3RUX A;  3JCM d;  3ER0 A;  4BI3 A;  5GAM e;  3QXE B;  4QQG A;  2EIF A;  3OMC A;  3PTA A;  3QSU A;  3VV0 A;  1IRE B;  5GMK i;  1YIT A;  1VQ7 T;  2K5I A;  3JCM g;  4JRI A;  4TVR A;  4C0D C;  2QQR A;  4MDW A;  3V8J A;  3J81 E;  4BDZ A;  1M8V A;  1VIF A;  2DXC A;  3GOX A;  1VQK T;  3RMQ A;  3HRS A;  2DTH A;  1B34 A;  4JRK A;  2XI9 A;  3G6E T;  3JCM P;  1I5L A;  1ZBX A;  2PUO B;  1Q81 C;  4A4E A;  2E70 A;  4BE2 A;  1KHI A;  3OB9 A;  3JCM h;  3MET A;  5A0D A;  5GAM f;  1VQL T;  2PVD B;  1SSF A;  2YLB A;  1OZ3 A;  3E9G A;  1UEB A;  1VQ7 A;  4EDU A;  2EWN A;  4J8O A;  2RA2 A;  3M54 A;  1K73 C;  3UT1 A;  4E7J A;  4E7K A;  3OBY A;  3C12 A;  4LD6 A;  1OYX A;  3MEW A;  4M78 G;  3OYC A;  3G4S A;  4J7F A;  5CCA A;  1KC8 U;  2RH2 A;  2RO0 A;  1O75 A;  3JCM c;  4C0D B;  4M78 F;  1VQL A;  5LJ3 j;  1WNL A;  5GAN f;  4Z02 A;  2LCC A;  5FRM A;  2LT1 A;  2RHI A;  4EPC A;  2RK2 A;  3LYI A;  3TCJ A;  1JBM A;  1YI2 A;  4M77 E;  4XQ3 A;  2OTJ A;  5GAO p;  3HKS A;  5DY9 A;  4C5I A;  1O9S A;  1PSE A;  3QHS A;  1UGQ B;  3QYH B;  1HK9 A;  4KT0 E;  2DTI A;  1I4K 1;  4EMH A;  4KBM B;  2QQA A;  1K9M U;  4PLI A;  3RKY A;  3CPW S;  3JB9 D;  2FHD A;  5LJ3 d;  4RKU E;  1PSF A;  3JB9 F;  1N9S A;  2QTX A;  3A5Z B;  5IN1 A;  3FDR A;  4XTV A;  5C0M A;  2DXU A;  3L2R A;  4OB2 B;  1VQ9 A;  5A0G A;  4XU1 A;  4J5Y A;  4M75 E;  3L2Q A;  1VQ8 A;  2RI2 A;  3BFM A;  3M58 A;  2R57 A;  2RJD A;  2PUK B;  4XTY A;  2P0Q A;  1KQS A;  4M7D E;  4M77 C;  1M1K U;  2PU9 B;  2HQX A;  2E65 A;  1YIJ T;  4IUQ A;  1DJ7 B;  5LJ5 j;  1S72 T;  2E1H A;  1Q7Y C;  1U1S A;  3GIB A;  2QQ9 A;  4XK8 E;  3QDR B;  5FU6 C;  3OMG A;  3SB2 A;  1OZ2 A;  3NTH A;  2ZPH B;  2EQJ A;  2EQK A;  5KH6 A;  3JCM J;  2KMT A;  4HCZ A;  4BAC A;  3DKM A;  1N9R A;  4M75 C;  2DZ9 A;  3OYK A;  3CCU T;  4N4I A;  3F70 A;  3MP6 A;  4M7D C;  1EIF A;  2WSE E;  2KY9 A;  3DB4 A;  4J7I A;  1VQO A;  4ATO A;  2O4X B;  3CD6 T;  3E19 A;  3JB9 I;  5AYF A;  1N8R C;  3SFM A;  1BI2 A;  3FEO A;  3OS5 A;  5GAO n;  4M77 B;  3PIP A;  3MP8 A;  4VUB A;  3HRT A;  4ZGE B;  4ZGD B;  3H6Z A;  2Y4X A;  4C92 E;  3OYB A;  2M0O A;  3MCA B;  3MHX A;  4A4K A;  4LDY A;  2RHU A;  5D6X A;  3CC7 A;  3EAE A;  3OYA A;  3G71 T;  3QYG B;  2VGM A;  2XK0 A;  3GNG A;  4F7U E;  1Q81 U;  5DM7 R;  4KUL A;  1JB0 E;  5D6Y A;  5FU6 B;  2LC4 A;  2E12 A;  3CCQ T;  4JS4 A;  1YHQ A;  3UDC A;  1BKB A;  3C4S A;  3OYJ A;  3CD6 A;  1WGS A;  4O5V A;  4C8Q D;  2XDD A;  3DLM A;  3BW1 A;  2BUD A;  1K73 U;  1KG1 A;  4M75 B;  2KSS A;  2LRQ A;  1AHJ B;  1RI0 A;  4MZM A;  2K5F A;  3QUI A;  2KDS A;  4M7A D;  3HHT B;  4M7D B;  3JCM V;  2DPP B;  2LX9 A;  4A53 A;  2L8D A;  4IUP A;  3I55 T;  3G71 A;  5CIU A;  2QQB A;  3BDL A;  4C92 C;  4PJO G;  4HT8 A;  4E7L A;  2YHT A;  2EJ9 A;  2D9T A;  1MGQ A;  3CCJ A;  3CCQ A;  3HL8 A;  3WVD B;  3CXC S;  2RHY A;  2VXF A;  3ZEH A;  1H3Z A;  1GXI E;  2RD1 A;  2JTF A;  2K2V A;  2RJF A;  4PJO F;  2X35 A;  4OGE A;  1M90 C;  3OYD A;  5CVI A;  3SD4 A;  4OF1 A;  1LNX A;  3I56 A;  3LWI A;  4RG8 A;  2P4T A;  3V8L A;  2A7Y A;  5I2M A;  1XQH A;  2O4X A;  3LX7 A;  5HY6 A;  1K8A C;  3PMT A;  4M77 A;  1YJN T;  5M9O A;  2E64 A;  2E6Z A;  3LWH A;  2WAC A;  3GPL A;  2FB7 A;  2RI5 A;  3RER A;  4FT4 A;  4M78 E;  1HXD A;  2DXB A;  1D3B B;  5CKH A;  4A4G A;  4C92 B;  3M5A A;  5LL6 S;  1NPP A;  1NZ9 A;  1YCY A;  1V29 B;  4IUR A;  1Y7X A;  2HAX A;  1Y96 B;  4O6J A;  4F7U B;  2OTL T;  4GLK A;  2D0Q B;  5FRO A;  2AHJ B;  3VKI A;  5GAN e;  3OA6 A;  1G3W A;  3JSC A;  2OAU A;  1YJN A;  4JUV A;  1QVG A;  4M75 A;  3CBP A;  2JN0 A;  4C8Q A;  3HFN A;  1BIA A;  4M7D A;  2HD0 A;  4FT2 A;  3OQ5 A;  4ZN1 A;  2RI3 A;  1W2B A;  3SWN C;  1Q7Y U;  5GAM j;  1VQK A;  2VV5 A;  4HT9 A;  4B9X A;  3OY9 A;  1FXX A;  3G6E A;  3CCS T;  4M7A A;  4X9D A;  2VUB A;  2C06 A;  4ZTF A;  2DD5 A;  2QDY B;  2K5L A;  3MO8 A;  4P5N A;  4M78 C;  3FC3 A;  2IVW A;  2OTL A;  2XID A;  4UC4 A;  5CAI A;  3CCV T;  3H8Z A;  4L5G A;  3V7C A;  4PJO C;  1BI3 A;  2M9U A;  3X24 B;  3A8M B;  3QPH A;  4XTZ A;  1ZHI A;  3OW2 A;  3V8K A;  2QA4 T;  4N4G A;  4GY5 A;  5GAN 3;  2BIV A;  3QJ6 A;  2ZPE B;  3QJY A;  5GAM d;  3M9Q A;  3CC4 T;  3PFS A;  3JB9 G;  4JRP A;  4BDY A;  2EFI A;  5GAN 2;  4XU0 A;  2DO3 A;  3OYG A;  5LJ3 f;  4BD3 A;  4EMG A;  1QVG S;  3NTI A;  3QZ5 B;  3JCM Q;  2DXT A;  4QVD A;  4JRQ A;  2R5M A;  5GAM g;  3SWN B;  3GNF B;  4Y91 A;  1D3B A;  2GF7 A;  3L42 A;  4C92 A;  2VC8 A;  3QZ9 B;  2F5K A;  3JCM X;  5GAN 8;  2E6N A;  2LNV A;  1JJ2 A;  4M78 B;  2DAQ A;  1XOV A;  2ZPI B;  4F7U A;  5GAM h;  5KE3 A;  1N27 A;  1U8R A;  3JAM E;  2BKD N;  3GP8 A;  5GMK e;  2WSC E;  2X4J A;  2YRV A;  2DIQ A;  3EFS A;  1M1F A;  2DEQ A;  5L8R E;  4R55 A;  1BIB A;  3S3O A;  4OMF B;  3KBG A;  4R56 A;  1KD1 C;  1M9S A;  2GQV A;  2JTM A;  1G3S A;  1WQ7 A;  2MAM A;  4MZT A;  5KCH A;  5GAN g;  5I21 A;  3OYM A;  3CMA T;  4C5H A;  5GAO q;  2X4X A;  2EQM A;  4LDU A;  4BE0 A;  4XU3 A;  3CME T;  4XAX B;  3S3N A;  2L3R A;  2WSF E;  3NFC A;  1M90 U;  3JB9 H;  2ZGW A;  2XU8 A;  5GAN 5;  2JNG A;  3A8O B;  3KUF A;  3PMI A;  2E41 A;  3EFR A;  3WXM B;  5GAN h;  4HCB A;  2ZCF B;  4OVA A;  4MZP A;  5LJ5 f;  3OS1 A;  1YIJ A;  4J6W A;  1KQ1 A;  2V8I A;  4M77 D;  1M5Q 1;  2EYQ A;  3CPF A;  2MI6 A;  4M77 F;  1S72 A;  1K8A U;  2CZ7 B;  4JLG A;  3QII A;  5FU7 C;  5KE2 A;  1KQS S;  2DD4 A;  3LGF A;  4FIB A;  4RCC A;  4DOV A;  3OYI A;  2XDP A;  3VJP A;  3CME A;  1W4S A;  5CKE A;  4XU2 A;  3V7R A;  3R6O A;  3CCE T;  2KQW A;  3SWN A;  4J83 A;  2G3R A;  2VYT A;  3Q1J A;  5CKF A;  2M1H A;  2FL7 A;  4PJO E;  1NE8 A;  1NJI C;  3CCU A;  2F69 A;  1G3T A;  3FIF A;  4M78 A;  1M4Z A;  4NL2 A;  3CEY A;  3J80 E;  3OYN A;  3O8V A;  5GAO r;  1G5V A;  3LH0 A;  4N4H A;  4M75 D;  2K4Y A;  4M75 F;  1Q82 C;  4C8Q F;  5CQX A;  1KHC A;  4OB1 B;  3JCM e;  4M7D D;  3JRZ A;  1QVF A;  4BY6 C;  3E9F A;  4KUD K;  3FB9 A;  1YJ9 T;  1NPR A;  1X75 C;  4ELZ C;  4M7A F;  1U1T A;  3CCE A;  2K57 A;  2V8J A;  3BDU A;  4HKE A;  2IG0 A;  3C95 A;  5FU7 B;  2LVM A;  5KCO A;  5IT9 E;  5CQY A;  1WJS A;  3VUB A;  1K9M C;  3A8G B;  1RL2 A;  2EJG A;  3MEA A;  3OBW A;  4IUU A;  4LD9 K;  3OYE A;  4QVZ A;  2LDM A;  5J39 A;  2EQU A;  1Y07 A;  3PT9 A;  2ZPB B;  4NOY A;  2L89 A;  3JCM f;  1OI1 A;  2LCL A;  3TRE A;  3KXT A;  1QP2 A;  1YJW T;  2YLC A;  2QEX T;  4XTU A;  1YJ9 A;  1G3Y A;  2FVU A;  2HNI A;  1UGR B;  3I55 A;  3RKX A;  1M1G A;  2LT4 A;  1VUB A;  2GCX A;  3HFO A;  2JUF A;  3SDZ A;  2R5A A;  4DQ2 A;  2RK1 A;  4OB0 B;  1H64 1;  4QQ6 A;  4BY6 B;  3S3M A;  4X34 A;  2DZC A;  2XHC A;  3P8B B;  5DLQ E;  4BB7 A;  4C92 D;  4A54 A;  3CBO A;  3ASK A;  3PNW C;  3RKW A;  4C92 F;  4JLI A;  4V2S A;  2XG8 D;  4JJN K;  2QEX A;  4F7U F;  4YTL A;  3M55 A;  5GAO m;  1VQ4 T;  5C6S A;  4CI0 C;  4EMK C;  2DJZ A;  2RB6 A;  4PNO A;  5J26 A;  3M53 A;  4FM4 B;  4PJO B;  2K3Y A;  3X28 B;  4E7H A;  4WF2 A;  1VQP T;  3FRN A;  1VQ6 T;  3M59 A;  4BE1 A;  2D6F A;  2EAY A;  1LJO A;  3C94 A;  5EG2 A;  3OSV A;  5FLX E;  4ZGJ B;  1KD1 U;  2EKO A;  1I8F A;  1WQW A;  2I2L A;  2V8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...