5GAN2

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
90
structure length
90
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords U4 snRNA
total genus 16
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan200
3PGGA 5GAN6 5DY9A 4M7DD 1X01A 3RKWA 3HSBA 1BIAA 3BY7A 4XTWA 4C92D 1I5LA 4NOYA 3RKXA 5GANe 5GAMd 4M77B 4PJOC 3FJPA 4X9DA 5LJ5e 3BW1A 3JB9F 4PJOF 2DXUA 4M75B 4N0AA 3L2ZA 5LJ5j 1KQ1A 2DZCA 3SWNB 4A53A 2EJGA 2RA2A 5I21A 4EMKB 4M75C 4C8QD 5GAMj 4Y91A 5GMKe 1WQ7A 2DVEA 1KQ2A 1B34B 3QUIA 1LOJA 3RUXA 1TH7A 4M78G 4C92G 3HFNA 2I2LA 4PJOE 1MGQA 2RM4A 2EWNA 5LJ3g 2E65A 1WNLA 2HNIA 2JN0A 4F7UG 4M78D 1U1SA 4A54A 2DTIA 3JCMb 2FB7A 5LJ3f 5LJ3d 3VU3C 3FIFA 1H641 4X9CA 2Y90A 4M75E 1N9RA 2EJ9A 2DEQA 4XTXA 3JCMf 4M7AF 4M77D 4NL3A 3FB9A 5GANg 4M7AB 5GAN8 5LJ5g 4OP0A 3JCMe 1I8FA 3RESA 2EAYA 3JB9J 4F7UE 1M5Q1 3JB9G 1Y96A 3L1AA 4C8QG 5GMKj 5GAN3 5GAN4 4XTYA 5LJ3h 5GAOr 3JCMh 2E41A 4C8QE 4MMKA 1I4K1 1WPYA 3INZA 4XU0A 5GANd 4EMGA 1YCYA 4M78C 3BFMA 4C92B 5LJ3e 2DTOA 3V7RA 3RIRA 4J6YA 4PNOA 4C92F 2DKGA 5GAOp 1B34A 4MMLA 4M7DG 4M7DF 2QTXA 4N0AC 3JB9H 3JCMc 2YHTA 3V7SA 1D3BB 5GMKm 3GIBA 4QVDA 3SB2A 4DQ2A 3BDUA 1U1TA 4M75G 1JBMA 5CAIA 5LJ5f 4M75F 5LJ5h 2E1HA 4M77C 5GAOm 3V8JA 5GANf 4PJOB 4PJOG 3JCMg 4NL2A 4M7AG 4M78A 2VXEA 1WQWA 2E64A 2YLBA 2DJZA 1HK9A 3JCMX 4JUVA 3QHSA 1D3BA 4C8QA 4EMKC 5GMKi 1M8VA 4V2SA 4HT9A 5LJ5d 3JCMd 4JRKA 4XU2A 4M7AD 2FYKA 2K57A 3HFOA 4XU1A 5GAMf 4XTZA 4J5YA 3JCMP 5GAOq 4M7DE 4WF2A 3M4GA 2ZGWA 3SWNA 4C8QB 4C92C 5GAMe 5GMKh 4HT8A 2YLCA 4JLIA 4M78F 3RKYA 2E10A 4M77F 4F7UA 2DTHA 5GAOl 4M77G 2EJFA 3JCMW 4JRIA 5LJ3j 5GAMh 3JCMJ 3EFSA 5GAN2 2RD1A 3QO3A 4RCBA 4XTVA 5GAOn 4PJOA 4M7AA 4M7DC 3EFRA 2CGHA 4M75A 3JB9I 3QSUA 2DXTA 4C92E 1JRIA 4F7UB 2VXFA 4XQ3A 4QVCA 5GAN5 5GAN7 5GANj 3JB9D 4M78B 4M75D 4C8QC 4EMKA 1LNXA 4M7AE 2RB6A 4M7DA 2DZ9A 4HA8A 4C8QF 4C92A 3JCMQ 2VC8A 1N9SA 3V8KA 4M78E 4M7DB 4XTUA 1HXDA 4EMHA 5GAMg 4M77A 4F7UF 4PJOD 3V8LA 3RERA 4J6XA 3JCMV 5GMKl 1Y96B 4RCCA 1LJOA 3V7CA 3AHUA 5GANh 4M7AC 1BIBA 4J6WA 4XU3A 3SWNC 4M77E 1I81A
chains in the Genus database with same CATH superfamily
3SDZA 5GAN6 4FU6A 2OTJT 3CQTA 1D1BA 1I5LA 1VQ8T 2YSQA 4X9DA 3I55Q 1VQ9Q 4N0AA 3I56T 3CPWS 2PNIA 2QGFB 4MZPA 2BE7D 4QQ6A 4JRPA 1FMWA 1I07A 3PNWC 3JAME 5KYXB 2HZYA 1IHWA 2LNHB 5KYUB 3FIFA 1QMCA 2M1HA 2DEQA 1Q81C 1QP3A 3SHWA 4NL3A 4HCZA 1VQ4T 4D8KA 1TG0A 4F7UE 2E12A 4YTLA 3P8BB 2DA9A 4EDUA 2EYWA 1K9MC 3QPHA 3CD6A 2K6DA 4MZMA 2QGGA 2EQJA 2K7AA 3CCLA 1SPKA 3FRNA 4QT7A 3TU4K 5D6WA 1BB9A 3RMSA 2QQRA 2XD0A 4JZ4A 4BE0A 3VJPA 1WZOA 2CP5A 2E5QA 2DL8A 5L8RE 4PJJA 4C0FA 4M77C 5CAIA 5GAOm 1B3QA 4DEXA 1N27A 1UGQB 3QIIA 4RUGA 1PSEA 4MDWA 2RJDA 1CKBA 4V2SA 1K9MU 3MP6A 2RQUA 1QP2A 4ZGDB 4ZGEB 1RUWA 1VIEA 4KULA 2M16A 5IN1A 5CKEA 5IH2A 3HHTB 3OBWA 1K4US 2EJFA 2MWPA 4JRIA 2DFUA 3GBQA 1VQKT 4XTVA 2CGHA 3UA7A 4A4GA 1M9SA 5GAN7 3REAB 4M78B 2RK2A 4FYVB 3EAEA 5CKHA 3QJ6A 2P0KA 2LQWA 4Y92A 1YJ9A 1YJNQ 1KQSA 1LJOA 1IREB 3VKIA 1ZA2B 2X4XA 2EQMA 4HVVA 2M02A 2JS0A 1WHHA 3QJYA 1H3ZA 1Q86U 2AKLA 2O2OA 3M59A 2HMAA 2IPOB 1PM3A 1EIFA 3EG1A 5GMKe 4ELZC 3CC7T 4C5HA 1LOJA 3RUXA 4KH0B 4D6WA 4FCYA 1VQ4Q 2XKOC 2JN0A 1VQ6Q 2DL5A 1LPLA 3QG1A 3CCQA 2DTIA 1BK2A 3X25B 3JSCA 1LVKA 4M77D 2JXBA 3CCUT 1WX6A 1VQOA 3C4SA 2J05A 1NEBA 2VASA 5CO7A 3QKJA 2P4RA 2F69A 2HKNA 3UATA 2E41A 4C8QE 3CCRQ 2COWA 1ACMB 4C0DC 5I11A 2F2VA 5FRMA 1WJQA 2A3LA 2AZSA 1BCOA 3CCRA 4PNOA 1JB0E 4MMLA 2DLPA 2XDBA 1R0BG 4M7DF 3C94A 3VS2A 4AMCA 3VYHB 1C1AA 3VS0A 3H0FA 4GBQA 2XK0A 2MK5A 3EFOA 1PKSA 4IIMA 2CS7A 4DBRA 1S72A 2DJZA 2ZPGB 9ATCB 4PJLA 1U8RA 4EMKC 1TWBA 1H8KA 4JZ3A 4IUPA 1MV3A 4XU1A 2QEXQ 4KH1B 4FW1A 2J06A 5GAOq 1VQNT 4C8QB 5GAMe 2HDAA 3KBGA 3JCMW 4RKUE 3S3OA 4OMPA 2QDLA 1TSFA 2DX1A 2DXTA 2DERA 2PVDB 2OJ2A 3DLLA 4J9HA 4HCBA 2DZ9A 4C92A 3I56A 1YP5A 4J7IA 1G3WA 3RMQA 4M77A 1YNZA 2ROTA 3BE3A 1UFFA 3AHUA 2LMJA 5GANh 1UJ0A 1OPLA 2K3YA 4KUIA 1JJ2A 3PGGA 1W70A 2RH2A 3H6ZA 3GOXA 4M77B 1VQMT 1H92A 3JB9F 4PJOF 1KFZA 1MMDA 1G8XA 3MJXA 4WTOB 1WHMA 3HRTA 2CZ6B 4ZNXA 3I9QA 1YFNA 1AT1B 1ARKA 1U3OA 1VQNQ 3JCMb 2RHUA 2JZ2A 4J9DA 4OB0B 1W2BS 2B86A 3WXMB 1K8AU 3E2UA 4R55A 2EAYA 4EIKA 1K9MR 2QYZA 3L1AA 1OZ2A 1OU8A 3JCMh 4PFPA 4OMOA 4XU0A 1YIJQ 5FU7C 1FYNA 1M30A 1GBRA 3X20B 4J8OA 1QCFA 2YHTA 3MEUA 1AWXA 1GCQA 4ZN1A 3A98A 1YHQQ 2WSEE 4RMOA 1N8RC 1K73C 1T0JA 5GMKi 3OSVA 3VYGA 2RHZA 2YT6A 1RLPC 3CCQQ 3R6OA 3HL8A 2GTJA 4Y28E 2RI3A 4WF2A 5CR2A 1VQ6T 5FWBA 5KYXA 1Y71A 3CXCA 3MHXA 3CPWP 4KGXB 2G6FX 3ZFJA 1D0XA 3WVDB 1RAAB 5CQYA 4BI3A 2MIOA 2LT4A 1RAFB 2L8DA 1S72Q 5IHNA 1M2VB 3RKWA 3RKXA 2HQXA 3CCVA 2EVRA 2ED1A 3M55A 2NLUA 1M90U 1VQOT 3QZ5B 3OW2P 3AT1B 1ABQA 4J9BA 3VS7A 3OMGA 5CIUA 2L3PA 1N5ZA 1Q81R 1MNDA 2JNGA 2NUZA 2RI2A 2YWWA 2CZ1B 5IHKA 4C0GA 2RF0A 1MMAA 3TQ7P 1Y7XA 4C8QG 4XTYA 2EKOA 1R8OB 2SRCA 3OYGA 3LWIA 4PFOA 1S72T 3RBBB 1QCNA 5DLOA 2FPFA 3L2WA 1ZUYA 2A36A 2ZPFB 5GMKm 4ORZA 2LZ6B 2JTMA 2LNVA 3URGA 5KYYB 4IURA 2KE9A 1NPRA 2KRNA 5FLXE 1VQ7A 2XI9A 3ZBDA 1D1CA 3MEVA 5CK9A 2K5FA 2BTTA 2RJCA 2QQSA 1AZGB 1Q7YU 1TUCA 1QVFA 4KT0E 3OS5A 1Y07A 4ANJA 4RTTA 1K1ZA 3I5RA 3OYFA 2HCKA 4M77G 4JJNK 1YI2T 2RK1A 1VQKQ 3C12A 3CC4A 3M57A 1QKWA 3HKSA 4X1VA 2GF7A 1JRIA 2E6NA 3CC4Q 3VV0A 1IGQA 2DMOA 1TU0B 1VQMA 3DKMA 3M0SA 3RNJA 4RG2A 2DM1A 4M78E 1XOVA 2QQAA 5A0GA 3RERA 2VUBA 1BIBA 1NJIC 1UUEA 1AWWA 1YIJT 5J3BA 4A4KA 3S3MA 5CCAA 5GANe 1R77A 2IVWA 2XIDA 3CPWA 3META 4BACA 5CKDA 3A1PA 5DLQE 2EJGA 1KD1R 2JTFA 3QUIA 2VB6A 1TH7A 2V8JA 2FZGB 2E65A 1BKBA 2LQ8A 6AT1B 4A54A 2GCXA 1JXOA 3D7SB 3MP8A 5KCOA 2EGCA 3TVTA 3VS5A 2EJ9A 1KK7A 4FT2A 3TREA 1K0XA 5GAN8 3HP9A 4AFZC 2XDDA 1V29B 3MP1A 1M2VA 4AFQC 1TUDA 4C92B 1NYFA 4DEYA 3MEAA 4JJCA 1UGVA 3UA6A 3I5SA 3BDUA 3SEMA 4E7KA 1PD0A 3A8GB 4ATOA 4QQGA 2LP5A 3EFOB 4DOVA 4O5VA 1YITQ 2YLBA 1N6AA 1QW1A 2KT1A 5GJWB 3CCJA 2RHXA 4AT1B 4BY6C 4CC4B 3OS0A 4J9EA 3JCMd 1RACB 2DAQA 1X6OA 3M56A 4HCKA 2KVQG 2G3RA 5GMKh 1YJWA 4L6V5 2NUPA 4MZTA 2YLCA 4M78F 2V8KA 1QVGA 4IUVA 2DO3A 2JMAA 2NYSA 1AWJA 2HBPA 2EYYA 4M7AA 1PKTA 1UEBA 2EFIA 4E7HA 4EMKA 1WXUA 2V1QA 3VUBA 2CKKA 4EMHA 3M5AA 1FMKA 3EG9A 2FRWA 3LYIA 3V7CA 4PK4A 2WACA 3OS1A 1Q82C 1G83A 4UC4A 2XMFA 1RI0A 3EG9B 2DXUA 1KG1A 4M75B 3L2ZA 2LDMA 2GFAA 4A53A 1HJDA 1EFNA 2LJ1A 2D0NA 1MGQA 2A08A 4GLKA 2J6KA 2FHDA 2DRKA 1NLPC 2RQVA 3S3NA 1OX9A 2KSSA 4BDZA 1NM7A 2Y90A 4RTUA 2QXFA 3H9NA 5CVIA 5EC7A 2RMOA 3PIPA 4AG1C 3LLRA 1WXBA 2QQBA 3UT1A 3JB9G 3G6EA 2VWFA 4CC7A 2FPDA 1YBYA 1QKXA 2K5LA 3M0QA 1OV3A 1VQ7T 2F1LA 4C5EA 1B34A 4M7DG 2RJFA 2E3HA 4N0AC 1SSHA 3VRZA 1QWFA 1XQHA 4DQ2A 1VQ8A 1JBMA 5KCHA 2EQKA 5KYNA 1T0HA 2W10A 2OAWA 1GFDA 2KQWA 3CC4T 1MV0B 3OYCA 2EPDA 2VV5A 1ZUUA 4M7AD 2KR3A 2DD4A 5IT9E 4J5YA 2XICA 3I55T 4RTVA 1NZ9A 4BE2A 1VQ9T 4HT8A 2MAMA 1VQ4A 2O01E 3PTAA 3LH0A 5LJ3j 3OYDA 2E5KA 2KMTA 3P8DA 1KD1C 3CD6T 4BD3A 1OOTA 1IO6A 1N8RR 3CCLT 4OMNA 4PKCC 2DL7A 1OX8A 1LNXA 1FWZA 3HTRA 1HSQA 3CCMT 3UPUA 1BBZA 2K9GA 4J6XA 2E4HA 3PFSA 2ATCB 2FEIA 4AFUC 3I35A 3BY7A 2ESWA 1YN8A 3OYIA 4B9WA 1WLPB 2I0NA 5LJ5e 2PZ1A 3CXCP 3GNFB 1KC8C 4OB1B 1X2KA 1SHFA 3G4SA 4LE9A 4TVRA 4VUBA 3RR6A 2AIRB 1VQKA 2K5IA 1M3BA 2HKQB 3M53A 4M75E 4PL6A 4OMMA 2D1XA 4DOWA 2F2WA 2KAFA 3RESA 2A37A 3GP8A 1AD5A 4LDWA 2EBPA 5LJ3h 3FLGA 4B6MA 4E7JA 1TXQA 3P8HA 4OB3B 3BFMA 3QYHB 2GNCA 1X69A 1U1TA 1VQLQ 5FRNA 4M75F 5IXFA 4M78A 4F17A 1VQ7Q 4JUVA 3QHSA 2DJQA 4E6RA 1RI9A 2K57A 2LCSA 3SWNA 4BB7A 1A0NB 2CZ7B 4ESRA 2E3IA 3R6NA 1RAHB 5GAMh 3L2UA 1FMVA 2ZZDA 4IKFA 4M7DC 1P92A 4F7UB 5GAN5 3CCRT 3G7ZA 1UGPB 4C8QC 2RB6A 4XTUA 2HL5C 2YRCA 1VQ8Q 4QVZA 4PJOD 1NJIR 1XJWB 3JCMV 3CCSA 4FT4A 2LRQA 4QW2A 2EQIA 2X51A 4M77E 2M0OA 2MPXC 1PNJA 2AZVA 3SFMA 3JV3A 4E47A 5KH6A 4E7LA 4CC3A 5FWCA 1KQ1A 5ECAA 1OPKA 4PLLA 3OSSC 2DVJA 2DETA 5GAMj 3FC3A 2GBQA 1YJWQ 4ZGJB 5C0MA 1X75C 4LD6A 1WNLA 4J9FA 4DBHA 2FB7A 3CEYA 2XHCA 3X28B 3CMET 1K76A 2ZPIB 1AEYA 2KRMA 4P5NA 2DL3A 4JJDA 1GCQC 4BDYA 2L5QA 1M90R 2HSPA 3INZA 5GANd 1K0SA 4NS5A 2CYZB 2DTOA 3LGLA 4HVWA 2P4TA 4LUDA 3NFCA 3OYNA 1OULA 2ED0A 3G71A 1JQQA 4JDSA 3I55A 1VQ9A 5HY6A 1VUBA 1JJ2S 1KIKA 1RAEB 1OEBA 2E64A 1HK9A 2RJEA 1GL5A 1ABOA 5FU6B 4C8QA 5LL6S 4HT9A 1NYGA 3TEEA 2KRSA 4XTZA 4FYYB 2HEQA 3JCMP 3CMAT 5KE3A 1WA7A 3CCMA 1G2BA 4M77F 3DLMA 3M54A 2FL7A 2DXBA 1TOVA 2YRVA 3EFSA 1CKAA 2KEAA 1KC8R 4N4IA 2BZ8A 1QVGS 3QSUA 7AT1B 2YUQA 2COYA 2VXFA 5GANj 5HK3A 1Q86R 1RADB 4J7FA 4DBQA 2CP6A 3A8HB 3EH2A 2W0ZA 5D6YA 1X43A 2KGTA 8AT1B 3BDLA 3G4ST 4OF1A 2O9SA 4M7AC 2K79A 5DY9A 3CC2A 5L23A 2EKHA 2M0YA 4PLIA 2KDSA 4LXCA 2J6FA 2DZCA 2MWOA 1UECA 2LCLA 2OI3A 2DVEA 1KQ2A 1VQ6A 5D7UA 1K8AR 1OU9A 3KFVA 1QQJA 3QYGB 4JLGA 4M7AF 2H3JA 1ZHIA 3EG0A 3JCMe 1BI3A 1TS9A 2OTLQ 4XAXB 2BZXA 2PVGB 3FDRA 1IRXA 3HPWA 4MMKA 4E7SA 5LJ3e 1VQ5Q 1MMGA 2ZCFB 2R5AA 3JCMc 2V8IA 3V7SA 2KY9A 5LJ5f 2CSQA 1YJNT 2ABLA 3NTKA 3X26B 4L5GA 2JS2A 1M1KC 3SD4A 2HL3A 4MDXA 4HXJA 2RNAA 4KRTA 3PT9A 4AG2C 4M7DE 1RAGB 5KE2A 3OYAA 2P84A 1WJSA 3CCST 4CRIA 1WHJA 2HBWA 1E6GA 3DB3A 2M51A 3JB9I 1QVFP 4QVCA 4OMLA 3ZL7C 1UTIA 2Y4XA 3LX7A 1SRMA 1EX4A 1N9SA 1HXDA 1PD1A 2CH4W 1J3TA 2J7IA 3ASKA 2RN8A 2SEMA 2DD5A 3SWNC 1SEMA 1C0MA 2O31A 2Y4YA 4C92D 1BU1A 3ZEHA 3THKA 1KJWA 4ZTJA 3O5ZA 5I21A 2QEXA 2PUOB 1JU5C 1I0CA 3E9GA 4EMKB 1VQLT 2DXCA 1WQ7A 1ZBJA 1KHCA 1M3AA 1MNEA 1KC8U 4PJOE 5LJ3g 1YI2A 1YITT 2QG9B 4M78D 2JM9A 3QWXX 3E1SA 3WVEB 1Q81U 4OGEA 3FJ5A 3PVQA 3OYEA 1HYOA 3G71T 1X6BA 1KSWA 2HQHA 3OS2A 4KGVB 1M8MA 3CCEQ 1YCYA 2CDTA 2F5TX 4RTWA 1D09B 3E19A 3G1JA 4RTXA 3N5BB 5GAOp 2EW3A 1YIJA 2DBKA 4C0ZA 2VVKA 2QQ9A 3A8OB 3CMAA 4PJOB 1NPPA 1QLYA 2LC4A 2EYXA 4IUQA 1U06A 4DBFA 4BY6B 4ZN3A 1C6VX 3OYLA 2LQNA 1ZSZC 3HRUA 1VQPQ 1VQ5T 4JS5A 1WJRA 2ZGWA 4JS4A 3M4YA 2A7YA 2E10A 1UGSB 5GAOl 3L2VA 2OTLA 1H3HA 3G6EQ 2AHJB 2K2VA 3QO3A 3M58A 3OY9A 3EG3A 3A8LB 5GAOn 3EHRA 3T9NA 4OGCA 4M75A 2K4YA 5HK0A 3CC2T 3REBB 1WI7A 4M75D 2CSIA 4M7AE 2X4WA 2P0QA 3J80E 4C8QF 3JCMQ 3V8KA 2RPNA 1KQSP 1D0YA 3PIOA 5J39A 3OYMA 1GFCA 2JW4A 2EIFA 4XU3A 3CCVQ 3U23A 1FXXA 4M7DD 2MYSA 4CI0C 1BIAA 1Z9ZA 4NOYA 1BI1A 2E6ZA 5GAMd 1Q95G 4KGZB 3EGDA 2VYTA 2K3BA 5A2QE 4LNPA 2QA4T 1WHKA 2KROA 5IHIA 4BI4A 3HFNA 2EWNA 4R56A 3VU3C 4X9CA 1N9RA 3JCMf 4Z88A 4A4HA 4M7AB 1M1KR 1VQPT 3M9QA 2JOYA 2X4YA 1GXIE 1V76A 1F1BB 5GAOr 4LDVA 5EG2A 3CCLQ 3O8VA 2VKNA 4M4ZA 4A4FA 2QA4Q 3LW5E 3M0RA 1AWOA 3CD6Q 1NG2A 2DYIA 1S1NA 3SB2A 3L42A 1Q82U 2R58A 2CP2A 5GANf 4KUDK 1UHFA 1HD3A 4QKUA 3OYJA 3JCMX 2OTJA 2DNUA 1M90C 3QBYA 2JVVA 2OTJQ 2FZCB 2FYKA 2E70A 1SHGA 1GBQA 3TSWA 1MHNA 2LX7A 1VYTA 3MPUB 3G6ET 4WCIA 3OW2S 1X2QA 1RLQC 2DPPB 2JM8A 4C5IA 3OYHA 1M1FA 3QZ9B 2ROLA 4LN2A 3MEWA 1WDXA 5GJVB 2L89A 4M7DB 2RO0A 3C0CA 4F7UF 3OYBA 1VQLA 1IZ6A 4QQDA 1UDLA 2FO0A 1JJ2P 1Y96B 4D8DA 1YWPA 5GAN3 1X01A 2HAXA 1Y0MA 2R57A 3H0HA 2QTVA 2GGRA 1Q86C 2O9VA 2HQEA 2QAZA 1M3CA 4C8QD 1UG1A 4F14A 2O4XA 1VOMA 4M78G 4C92G 2I2LA 4A63B 2HNIA 4F7UG 1YCSB 2DBMA 2EGAA 2L0AA 1I1JA 1UJYA 2Z0WA 3FB9A 5GANg 1E7OA 2XU8A 1I8FA 1O75A 2LQKA 4GY5A 3J7AF 1W4SA 1IB8A 1Y96A 2AKKA 2YUNA 4HVUA 4FM4B 2L3SA 3CC7Q 1WHLA 2JJ9A 1O9SA 2DF6A 3ME9A 1PC0A 1VQ5A 2IIMA 3NPFA 1YJ9T 2NWMA 1NJIU 2E1HA 4PJOG 4M7AG 2VXEA 3CCJQ 4BE1A 2OTLT 4ZTFA 1YWOA 2X9HA 1JEGA 2NUPB 2KBTA 1OI1A 2X35A 1OZ3A 4JRKA 4XU2A 4F16A 4Z02A 5CKBA 1QVFS 2IG0A 3VS1A 3GF5A 4Q5WA 2L3RA 1BI2A 2CH4A 3CCQT 4LDYA 1FX7A 1NEGA 2BE9B 4EPCA 1B7TA 5A0LA 2CT3A 4PJOA 1UE9A 3EH1A 3CCUA 2KXCA 3JB9D 5AYFA 2DK3A 1PHTA 4HA8A 3OQ5A 3CCUQ 1BCMA 2JMCA 3EHQA 2D8JA 2EYQA 4PJMA 4II1A 2QA4A 1ZSZA 5GMKl 1G3YA 4RCCA 4RTYA 5HKCA 2ZPBB 4JPBW 1I4K1 3M0TA 3UDCA 1WYXA 2ZAEA 2F2XA 3EGUA 1BI0A 5IAYA 5IXBA 2GQVA 1VQPA 4E2FB 2RA2A 4M75C 4Y91A 1XNIA 4FSSA 3H41A 1B34B 4IUUA 2JTEA 3CCMQ 2WSFE 4CC2A 2RM4A 1ZA1B 2DILA 3LWHA 1U1SA 1DJ7B 2C0IA 2D9TA 4LDUA 4N4HA 1VQNA 3VRYA 4OP0A 2VGNA 1G5VA 5KYWB 2DEUA 4OMQA 2CT4A 3PMTA 3OYKA 4R0KA 1GRIA 3CCSQ 3V7RA 2LTOA 3CCEA 2ECZA 3EGXA 2QTXA 3I56Q 3JB9H 3GIBA 2KYBA 2FZKB 3A5ZB 2YUPA 4FIBA 4NL2A 4Z89A 3F70A 2JUFA 2CP0A 3MCAB 3OBYA 1IXDA 1N8RU 5LJ5d 5M9OA 5I2SA 3CMEA 3HFOA 2DYBA 1AOJA 3M4GA 1MMNA 1G3SA 3CMEQ 4F7UA 2F5KA 2QASA 3CBOA 5GAN2 2RD1A 4RCBA 2BZYA 3X24B 2PQWA 4C0DB 4J9GA 4C92E 1KD1U 3C95A 5DM7R 4BI8B 1K73U 2LJ0A 2XG8D 2PUKB 4KBMB 3L2RA 2PU9B 1G3TA 2MF2A 5GAMg 1VQMQ 2NUTA 4BUGA 3OMCA 2DL4A 2PTKA 2B8AA 3HSBA 1GCPA 2CUBA 2L3QA 1VA7A 5C6SA 2C0TA 2COZA 5LJ5j 2EYZA 2K2MA 2KI7A 3SWNB 1YHQA 1NBEB 4IIOA 2RHIA 5FU7B 4HKEA 5KYUA 8ATCB 3L2QA 3CPFA 3G4SQ 5LJ3f 2MMPA 2FRYA 3MKDA 3JRZA 4XTXA 1WIEA 1PSFA 5LJ5g 2XDPA 1SF9A 5A0DA 3TCJA 5GMKj 2J6OA 2A0FB 1WXTA 2GTOA 4E7IA 1U5SA 1WPYA 2OX7A 4EMGA 2R5MA 5I2MA 1E6HA 2DKGA 4ME7A 1ZSGA 2L2PA 2P0PA 2DE0X 5FROA 3GPLA 4M75G 1QVPA 2D8HA 4GLMA 3V8JA 1ZSZB 3TSZA 1KQSS 3CBMA 1W2BP 1Q7YC 3CCVT 1TUGB 4OB2B 3ULRB 2LX9A 3VS6A 1KHIA 4XK8E 4RTZA 5KYWA 1PRLC 1EZZB 5FU6C 2EGEA 4RG8A 1QVGP 4F04B 4PJNA 1YI2Q 2DTHA 2RQWA 1RABB 5I22A 2AK5A 3NTHA 5HCKA 1SKUB 3E9FA 1M1GA 4E7ZA 2QK0A 4FYXB 3VS4A 2KXDA 2KT8A 1SG5A 3UWNA 1NLOC 3V8LA 1NE8A 1T3LA 3FEOA 4HCCA 1Y57A 2H3EB 2D6FA 2HD0A 2ENMA 1YJ9Q 1YJNA 2H8HA 4AFSC 1I81A 2MCNA 2CP7A 4FW2A 4OMFB 4XTWA 1XTDA 5KYYA 3FJPA 3CMAQ 1K73R 4FL6A 2RHYA 1UGRB 1BYMA 2CP3A 3GNGA 2X3XD 2FG0A 1M4ZA 4J9IA 1Z9QA 2V1RA 5LJ3d 4N4GA 3CCET 1X6GA 4JJBA 4FYWB 1RAIB 1WGSA 1M5Q1 1VQOQ 4ELYC 2O88A 1D0ZA 2WSCE 1IHVA 4M78C 1VIFA 2YDLA 4J6YA 4C92F 1I5OB 2QI2A 1PG5B 2DRMA 3NTIA 1Q82R 2MI6A 2KK4A 5CKFA 4QVDA 1QWEA 2CREA 2FPEA 1T3SA 3NMZC 4C5GA 2NUTB 3EGXB 1WQWA 2QEXT 1K9AA 5CQXA 1M27C 1M8VA 2BIVA 2YXYA 1YITA 2D0QB 1UB4A 3Q1JA 4L59A 1M1KU 4J83A 4B9XA 2X3WD 5D6XA 3J81E 4C92C 3M0UA 4JLIA 4LUEA 4FSXA 1V1CA 2QDYB 3OW2A 2CZ0B 2DIQA 2FVUA 3QDRB 3EFRA 2LT1A 3LH5A 1JO8A 1AHJB 1W2BA 1MUZA 3PVLA 4DA4A 3G71Q 1ZBXA 2EQUA 1YHQT 2GFUA 3S6WA 1ZQ1A 2YUOA 2V26A 2KNBB 2MOXA 1K8AC 2DIGA 2ZPHB 3QXEB 4JRQA 4PJOC 4K11A 3BW1A 5FW9A 1ZLMA 5AT1B 2LCCA 2BKDN 3CCJT 2GQIA 5J26A 2LJ3A 1CSKA 1H641 1VYUA 1YJWT 1Q7YR 2LVMA 3JB9J 2CUDA 4LD9K 1ZUKA 3PE0A 3MO8A 3CC7A 5GAN4 3VS3A 1PCXA 1RL2A 1B07A 2A28A 2X4JA 2C0OA 4A4EA 3CXCS 3OYYA 1AVZC 2BUDA 3RIRA 1IGUA 1X27A 2ZPEB 3RDVA 1R0CB 4Z8AA 1D3BB 3NHNA 1OQKA 3NGPA 5LJ5h 2OAUA 2RQTA 3H0IA 2C06A 3JCMg 3OB9A 1SSFA 2RQRA 3HRSA 1UHCA 1WFWA 3EG2A 1W1FA 3CC2Q 3IQLA 3ER0A 1D3BA 1VYVA 3CBPA 1M2OA 3A8MB 1D1AA 1WHGA 2O4XB 3DB4A 3PMIA 2HSEB 3QDFA 1LCKA 4OVAA 1TTHB 5GAMf 3KXTA 1ZX6A 1W6XA 3QWYA 3OA6A 2AT1B 3KUFA 3RKYA 1PRMC 2YRDA 3GLXA 1OYXA 2KYMA 3LGFA 2VGMA 4PFZA 3JCMJ 2RI5A 4IUTA 2M9UA 3EGDB 1QCOA 3M0PA 4XQ3A 4LDXA 2JT4A 1JXMA 4M7DA 1PWTA 2VC8A 1SRLA 4O6JA 3H8ZA 1AZEA 2PVOB 3VUZA 3UF4A 2K3XA 4J6WA 4X34A 4J9CA
chains in the Genus database with same CATH topology
1YIJT 3SDZA 5DY9A 4FU6A 5GAN6 3UDCA 2OTJT 5J3BA 4A4KA 3S3MA 3CC2A 1I5LA 5CCAA 5GANe 1VQ8T 4X9DA 2IVWA 1BI0A 2XIDA 3CPWA 3META 4BACA 4PLIA 2KDSA 4N0AA 5CKDA 3I56T 3CPWS 5IAYA 2GQVA 4MZPA 1VQPA 4QQ6A 2DZCA 5DLQE 2MWOA 2EJGA 2RA2A 4M75C 2LCLA 4Y91A 1XNIA 2DVEA 1KQ2A 1VQ6A 1B34B 2JTFA 3QUIA 4JRPA 1TH7A 4IUUA 2V8JA 2WSFE 3PNWC 2RM4A 3JAME 2E65A 1BKBA 2LQ8A 3LWHA 1U1SA 3QYGB 4A54A 1DJ7B 2GCXA 4JLGA 3FIFA 2D9TA 3MP8A 4LDUA 4N4HA 5KCOA 2M1HA 2DEQA 2EJ9A 1VQNA 1Q81C 4FT2A 1QP3A 1ZHIA 2H3JA 3TREA 4HCZA 4NL3A 1VQ4T 4M7AF 5GAN8 4OP0A 2VGNA 3JCMe 3HP9A 1G5VA 1BI3A 4F7UE 4XAXB 2PVGB 3FDRA 2E12A 2XDDA 4YTLA 3P8BB 3PMTA 1V29B 3HPWA 4EDUA 3CD6A 1K9MC 3QPHA 3MP1A 3OYKA 4MMKA 4MZMA 4C92B 5LJ3e 3CCLA 2EQJA 3V7RA 2LTOA 3MEAA 3FRNA 3TU4K 3CCEA 5D6WA 2QTXA 2ZCFB 3RMSA 2R5AA 3JB9H 3JCMc 2QQRA 2XD0A 2V8IA 3V7SA 4BE0A 3GIBA 2KY9A 3VJPA 3BDUA 2E5QA 3A5ZB 5L8RE 4C0FA 5CAIA 5LJ5f 4FIBA 4M77C 5GAOm 4E7KA 4NL2A 3A8GB 4ATOA 1N27A 1UGQB 4QQGA 3QIIA 4DOVA 1YJNT 4O5VA 2YLBA 1N6AA 1PSEA 1QW1A 3NTKA 3X26B 4L5GA 3F70A 4MDWA 2RJDA 2JUFA 3CCJA 2RHXA 3MCAB 3OBYA 4V2SA 1N8RU 1M1KC 3SD4A 4BY6C 5M9OA 5LJ5d 3OS0A 1K9MU 3MP6A 4ZGDB 1QP2A 4ZGEB 3JCMd 5I2SA 4MDXA 2DAQA 1X6OA 3HFOA 1VIEA 3M56A 3CMEA 3PT9A 2M16A 4KULA 5IN1A 4M7DE 2KVQG 2G3RA 3M4GA 5GMKh 1YJWA 4L6V5 4MZTA 5CKEA 5KE2A 3HHTB 1G3SA 2YLCA 3OBWA 3OYAA 4M78F 2V8KA 1QVGA 4IUVA 4F7UA 2EJFA 2DO3A 2F5KA 2MWPA 1WJSA 4JRIA 3CBOA 1VQKT 2HBPA 5GAN2 2RD1A 4RCBA 4XTVA 4CRIA 3CCST 4M7AA 3X24B 2PQWA 4C0DB 1UEBA 2CGHA 3DB3A 3JB9I 4C92E 1KD1U 3C95A 4A4GA 4QVCA 1M9SA 5GAN7 5DM7R 2EFIA 4E7HA 4M78B 4BI8B 4EMKA 1K73U 2RK2A 2Y4XA 3EAEA 2XG8D 2PUKB 3LX7A 3QJ6A 4KBMB 2P0KA 5CKHA 1N9SA 2PU9B 3L2RA 1G3TA 2MF2A 2CKKA 3VUBA 1HXDA 4EMHA 5GAMg 3M5AA 1YJ9A 1KQSA 3LYIA 4BUGA 3OMCA 1LJOA 3ASKA 3V7CA 1IREB 2DD5A 3VKIA 2WACA 3SWNC 3OS1A 1Q82C 2B8AA 4UC4A 3HSBA 1RI0A 2Y4YA 4C92D 2X4XA 2EQMA 1NJIC 3ZEHA 3QJYA 1H3ZA 1Q86U 5C6SA 2DXUA 1KG1A 4M75B 4ZTJA 3L2ZA 3M59A 5LJ5j 2LDMA 2GFAA 3SWNB 4A53A 2PUOB 5I21A 1EIFA 2QEXA 1YHQA 4EMKB 3E9GA 1VQLT 2DXCA 5GMKe 1WQ7A 4ELZC 1KHCA 3CC7T 4C5HA 1LOJA 3RUXA 4D6WA 1KC8U 2RHIA 5FU7B 4PJOE 4HKEA 1MGQA 2XKOC 5LJ3g 4GLKA 3L2QA 2JN0A 1YI2A 2FHDA 3QG1A 4M78D 3CCQA 1YITT 2DTIA 3S3NA 3CPFA 3WVEB 3E1SA 5LJ3f 2KSSA 4BDZA 2MMPA 3X25B 1Q81U 3JSCA 2Y90A 4OGEA 2QXFA 3JRZA 4XTXA 5CVIA 4M77D 3PIPA 3CCUT 3OYEA 1PSFA 1VQOA 5LJ5g 3G71T 3LLRA 3C4SA 2QQBA 2XDPA 5A0DA 3UT1A 5CO7A 3TCJA 3QKJA 3G6EA 3JB9G 5GMKj 2F69A 3OS2A 2E41A 4C8QE 1YBYA 2K5LA 4E7IA 1WPYA 4C0DC 1YCYA 4EMGA 1VQ7T 1WJQA 2A3LA 2F5TX 3CCRA 3E19A 4C5EA 5FRMA 2R5MA 4PNOA 3N5BB 5I2MA 2DKGA 3TEEA 1B34A 1JB0E 4MMLA 2RJFA 5GAOp 1YIJA 2XDBA 3C94A 4ME7A 4M7DF 4C0ZA 4N0AC 3VYHB 2P0PA 1XQHA 4DQ2A 5FROA 1VQ8A 3GPLA 2QQ9A 1JBMA 2XK0A 1QVPA 3A8OB 4M75G 3CMAA 4PJOB 3V8JA 5KCHA 1NPPA 2EQKA 2LC4A 2CS7A 4IUQA 1S72A 2DJZA 2ZPGB 1KQSS 4BY6B 1U8RA 2KQWA 3CC4T 4ZN3A 4EMKC 3CBMA 3OYLA 3CCVT 1Q7YC 3OYCA 4OB2B 4IUPA 2VV5A 3HRUA 2LX9A 4M7AD 1KHIA 4XK8E 4XU1A 4JS5A 1VQ5T 2DD4A 5IT9E 4J5YA 1WJRA 5FU6C 5GAOq 2XICA 4RG8A 2ZGWA 1NZ9A 4C8QB 5GAMe 3I55T 4BE2A 2MAMA 1VQ9T 4JS4A 3M4YA 2A7YA 1VQ4A 2O01E 2E10A 1UGSB 3KBGA 3PTAA 5GAOl 2DTHA 3LH0A 3L2VA 3JCMW 5LJ3j 2OTLA 2AHJB 2K2VA 2KMTA 3M58A 3P8DA 3QO3A 4RKUE 3A8LB 3OY9A 5GAOn 3OYDA 3S3OA 1KD1C 3CD6T 3T9NA 4OGCA 4M75A 2K4YA 4BD3A 2DXTA 2PVDB 5HK0A 3NTHA 3CC2T 3DLLA 3E9FA 3CCLT 4PKCC 4M75D 4HCBA 1LNXA 1M1GA 1FWZA 2X4WA 4M7AE 2P0QA 3J80E 2DZ9A 4C8QF 4C92A 3I56A 3JCMQ 3V8KA 3CCMT 4J7IA 3UPUA 1G3WA 3UWNA 3RMQA 4M77A 3PIOA 3V8LA 1NE8A 3FEOA 5J39A 4J6XA 4HCCA 3OYMA 3PFSA 2D6FA 3AHUA 5GANh 2HD0A 1YJNA 2EIFA 2K3YA 4KUIA 4XU3A 1I81A 3PGGA 1JJ2A 2RH2A 1FXXA 4M7DD 4CI0C 4OMFB 3H6ZA 1BIAA 3BY7A 4XTWA 3GOXA 4NOYA 5GAMd 1BI1A 1XTDA 2E6ZA 4M77B 3FJPA 4B9WA 5LJ5e 3OYIA 1VQMT 3JB9F 4FL6A 2RHYA 4PJOF 1UGRB 1BYMA 2VYTA 3GNGA 3GNFB 1KC8C 5A2QE 2QA4T 1M4ZA 4OB1B 3HRTA 3G4SA 2CZ6B 4BI4A 4TVRA 3HFNA 4VUBA 2EWNA 4R56A 3JCMb 1VQKA 2K5IA 2RHUA 2JZ2A 5LJ3d 3VU3C 4N4GA 4X9CA 3M53A 4M75E 4PL6A 1N9RA 4OB0B 3CCET 3JCMf 1W2BS 3WXMB 4M7AB 4A4HA 4DOWA 1VQPT 1K8AU 2KAFA 3M9QA 2EAYA 2JOYA 3RESA 4R55A 2X4YA 1WGSA 1GXIE 1M5Q1 3L1AA 3GP8A 4LDWA 4ELYC 5LJ3h 1OZ2A 3FLGA 4LDVA 3JCMh 5EG2A 4E7JA 5GAOr 3O8VA 3P8HA 2WSCE 4XU0A 4A4FA 4OB3B 5FU7C 3LW5E 4M78C 3BFMA 3QYHB 1VIFA 4J6YA 4C92F 2QI2A 3NTIA 3X20B 2MI6A 4J8OA 2KK4A 2YHTA 5CKFA 3MEUA 4QVDA 3SB2A 1U1TA 3L42A 5FRNA 1Q82U 2R58A 4M75F 5GANf 4C5GA 4KUDK 4M78A 4ZN1A 1WQWA 2QEXT 5CQXA 3OYJA 2WSEE 3JCMX 4RMOA 4JUVA 3QHSA 1N8RC 1K73C 2OTJA 1M90C 3QBYA 5GMKi 1M8VA 3OSVA 3VYGA 2JVVA 2RHZA 2BIVA 1YITA 2D0QB 3R6OA 1UB4A 3HL8A 3Q1JA 4L59A 1M1KU 2FYKA 2E70A 2K57A 4J83A 4B9XA 5D6XA 4Y28E 1MHNA 2RI3A 4WF2A 3SWNA 4BB7A 5CR2A 4C92C 3J81E 1VQ6T 1Y71A 2CZ7B 4JLIA 4FSXA 2QDYB 5GAMh 3G6ET 3OW2A 2CZ0B 3CXCA 3OW2S 2DIQA 2FVUA 3L2UA 3MHXA 2ZZDA 3QDRB 2DPPB 4IKFA 4M7DC 3EFRA 3ZFJA 4M7DG 2LT1A 1P92A 4C5IA 3OYHA 1YI2T 1M1FA 4F7UB 4JJNK 3WVDB 5GAN5 3CCRT 3G7ZA 1UGPB 3QZ9B 1AHJB 4C8QC 2RB6A 3MEWA 5CQYA 4BI3A 1W2BA 4DA4A 2L89A 4M7DB 4XTUA 1ZBXA 2EQUA 2LT4A 2RO0A 2GFUA 4QVZA 3S6WA 4F7UF 3OYBA 1YHQT 1VQLA 1ZQ1A 4PJOD 1IZ6A 4QQDA 3JCMV 3CCSA 4FT4A 2LRQA 1Y96B 4QW2A 1VQNT 4M77E 5GAN3 2M0OA 2L8DA 1X01A 1K8AC 3RKWA 2HAXA 2DIGA 2ZPHB 3QXEB 3RKXA 2HQXA 4JRQA 2R57A 4PJOC 3CCVA 3BW1A 3SFMA 3M55A 4E47A 5KH6A 4E7LA 2NLUA 1M90U 1KQ1A 1VQOT 3QZ5B 1Q86C 2HQEA 4PLLA 3OSSC 4C8QD 5GAMj 3FC3A 2LCCA 4ZGJB 5C0MA 2O4XA 2BKDN 4M78G 1X75C 4C92G 3CCJT 2I2LA 4LD6A 3OMGA 1WNLA 2HNIA 5CIUA 5J26A 4F7UG 2FB7A 3CEYA 2XHCA 3X28B 3CMET 2ZPIB 1H641 2JNGA 2RI2A 2CZ1B 4P5NA 1YJWT 3FB9A 5GANg 2LVMA 2XU8A 3JB9J 1I8FA 4C0GA 1O75A 4BDYA 2LQKA 4GY5A 4LD9K 3J7AF 1W4SA 2L5QA 3MO8A 1Y96A 1Y7XA 4C8QG 3CC7A 5GAN4 4XTYA 2EKOA 1RL2A 1R8OB 4FM4B 3OYGA 3LWIA 2X4JA 3INZA 5GANd 1S72T 4A4EA 3CXCS 3OYYA 4NS5A 1O9SA 2CYZB 2BUDA 2DTOA 3LGLA 3RIRA 2P4TA 2ZPEB 3ME9A 3NFCA 5DLOA 3OYNA 3L2WA 2ZPFB 1VQ5A 3G71A 1D3BB 5GMKm 2JTMA 4JDSA 5LJ5h 1YJ9T 1NJIU 2OAUA 3I55A 2E1HA 1VQ9A 2C06A 2LNVA 3URGA 4PJOG 3OB9A 3JCMg 4M7AG 5HY6A 2VXEA 4IURA 1VUBA 1SSFA 3HRSA 1NPRA 1JJ2S 2E64A 4BE1A 5FLXE 2OTLT 1HK9A 4ZTFA 2RJEA 5FU6B 2XI9A 3ER0A 1D3BA 4C8QA 5LL6S 1VQ7A 3CBPA 3ZBDA 4HT9A 3MEVA 1OI1A 5CK9A 4HT8A 2K5FA 3A8MB 2X35A 1OZ3A 2O4XB 2RJCA 2QQSA 3DB4A 3PMIA 4JRKA 4XU2A 5CKBA 4Z02A 4OVAA 5GAMf 2IG0A 4XTZA 1Q7YU 1QVFA 1QVFS 3JCMP 3GF5A 3KXTA 4KT0E 3OS5A 4Q5WA 1Y07A 5KE3A 3OA6A 3CMAT 2L3RA 3KUFA 3RKYA 3CCMA 3GLXA 1OYXA 3LGFA 3DLMA 2VGMA 3M54A 4M77F 2FL7A 4M77G 1BI2A 2RK1A 2DXBA 3OYFA 3CCQT 4LDYA 2YRVA 1FX7A 3C12A 3EFSA 4EPCA 3JCMJ 2RI5A 3CC4A 5A0LA 4PJOA 3M57A 4IUTA 2M9UA 4N4IA 3HKSA 1QVGS 3QSUA 2GF7A 1JRIA 2E6NA 3CCUA 2VXFA 4XQ3A 3VV0A 4LDXA 5GANj 3JB9D 5AYFA 5HK3A 1VQMA 4J7FA 3DKMA 2DK3A 3A8HB 4M7DA 4HA8A 3OQ5A 4RG2A 2VC8A 4O6JA 4M78E 1XOVA 2QQAA 5D6YA 5A0GA 2EYQA 4II1A 3RERA 2QA4A 3H8ZA 2VUBA 3BDLA 5GMKl 3G4ST 1G3YA 2PVOB 4OF1A 4RCCA 3VUZA 2ZPBB 5HKCA 2K3XA 1BIBA 4M7AC 4J6WA 4X34A 1I4K1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGG A;  5GAN 6;  5DY9 A;  4M7D D;  1X01 A;  3RKW A;  3HSB A;  1BIA A;  3BY7 A;  4XTW A;  4C92 D;  1I5L A;  4NOY A;  3RKX A;  5GAN e;  5GAM d;  4M77 B;  4PJO C;  3FJP A;  4X9D A;  5LJ5 e;  3BW1 A;  3JB9 F;  4PJO F;  2DXU A;  4M75 B;  4N0A A;  3L2Z A;  5LJ5 j;  1KQ1 A;  2DZC A;  3SWN B;  4A53 A;  2EJG A;  2RA2 A;  5I21 A;  4EMK B;  4M75 C;  4C8Q D;  5GAM j;  4Y91 A;  5GMK e;  1WQ7 A;  2DVE A;  1KQ2 A;  1B34 B;  3QUI A;  1LOJ A;  3RUX A;  1TH7 A;  4M78 G;  4C92 G;  3HFN A;  2I2L A;  4PJO E;  1MGQ A;  2RM4 A;  2EWN A;  5LJ3 g;  2E65 A;  1WNL A;  2HNI A;  2JN0 A;  4F7U G;  4M78 D;  1U1S A;  4A54 A;  2DTI A;  3JCM b;  2FB7 A;  5LJ3 f;  5LJ3 d;  3VU3 C;  3FIF A;  1H64 1;  4X9C A;  2Y90 A;  4M75 E;  1N9R A;  2EJ9 A;  2DEQ A;  4XTX A;  3JCM f;  4M7A F;  4M77 D;  4NL3 A;  3FB9 A;  5GAN g;  4M7A B;  5GAN 8;  5LJ5 g;  4OP0 A;  3JCM e;  1I8F A;  3RES A;  2EAY A;  3JB9 J;  4F7U E;  1M5Q 1;  3JB9 G;  1Y96 A;  3L1A A;  4C8Q G;  5GMK j;  5GAN 3;  5GAN 4;  4XTY A;  5LJ3 h;  5GAO r;  3JCM h;  2E41 A;  4C8Q E;  4MMK A;  1I4K 1;  1WPY A;  3INZ A;  4XU0 A;  5GAN d;  4EMG A;  1YCY A;  4M78 C;  3BFM A;  4C92 B;  5LJ3 e;  2DTO A;  3V7R A;  3RIR A;  4J6Y A;  4PNO A;  4C92 F;  2DKG A;  5GAO p;  1B34 A;  4MML A;  4M7D G;  4M7D F;  2QTX A;  4N0A C;  3JB9 H;  3JCM c;  2YHT A;  3V7S A;  1D3B B;  5GMK m;  3GIB A;  4QVD A;  3SB2 A;  4DQ2 A;  3BDU A;  1U1T A;  4M75 G;  1JBM A;  5CAI A;  5LJ5 f;  4M75 F;  5LJ5 h;  2E1H A;  4M77 C;  5GAO m;  3V8J A;  5GAN f;  4PJO B;  4PJO G;  3JCM g;  4NL2 A;  4M7A G;  4M78 A;  2VXE A;  1WQW A;  2E64 A;  2YLB A;  2DJZ A;  1HK9 A;  3JCM X;  4JUV A;  3QHS A;  1D3B A;  4C8Q A;  4EMK C;  5GMK i;  1M8V A;  4V2S A;  4HT9 A;  5LJ5 d;  3JCM d;  4JRK A;  4XU2 A;  4M7A D;  2FYK A;  2K57 A;  3HFO A;  4XU1 A;  5GAM f;  4XTZ A;  4J5Y A;  3JCM P;  5GAO q;  4M7D E;  4WF2 A;  3M4G A;  2ZGW A;  3SWN A;  4C8Q B;  4C92 C;  5GAM e;  5GMK h;  4HT8 A;  2YLC A;  4JLI A;  4M78 F;  3RKY A;  2E10 A;  4M77 F;  4F7U A;  2DTH A;  5GAO l;  4M77 G;  2EJF A;  3JCM W;  4JRI A;  5LJ3 j;  5GAM h;  3JCM J;  3EFS A;  5GAN 2;  2RD1 A;  3QO3 A;  4RCB A;  4XTV A;  5GAO n;  4PJO A;  4M7A A;  4M7D C;  3EFR A;  2CGH A;  4M75 A;  3JB9 I;  3QSU A;  2DXT A;  4C92 E;  1JRI A;  4F7U B;  2VXF A;  4XQ3 A;  4QVC A;  5GAN 5;  5GAN 7;  5GAN j;  3JB9 D;  4M78 B;  4M75 D;  4C8Q C;  4EMK A;  1LNX A;  4M7A E;  2RB6 A;  4M7D A;  2DZ9 A;  4HA8 A;  4C8Q F;  4C92 A;  3JCM Q;  2VC8 A;  1N9S A;  3V8K A;  4M78 E;  4M7D B;  4XTU A;  1HXD A;  4EMH A;  5GAM g;  4M77 A;  4F7U F;  4PJO D;  3V8L A;  3RER A;  4J6X A;  3JCM V;  5GMK l;  1Y96 B;  4RCC A;  1LJO A;  3V7C A;  3AHU A;  5GAN h;  4M7A C;  1BIB A;  4J6W A;  4XU3 A;  3SWN C;  4M77 E;  1I81 A; 
#chains in the Genus database with same CATH topology
 3SDZ A;  5GAN 6;  4FU6 A;  2OTJ T;  3CQT A;  1D1B A;  1I5L A;  1VQ8 T;  2YSQ A;  4X9D A;  3I55 Q;  1VQ9 Q;  4N0A A;  3I56 T;  3CPW S;  2PNI A;  2QGF B;  4MZP A;  2BE7 D;  4QQ6 A;  4JRP A;  1FMW A;  1I07 A;  3PNW C;  3JAM E;  5KYX B;  2HZY A;  1IHW A;  2LNH B;  5KYU B;  3FIF A;  1QMC A;  2M1H A;  2DEQ A;  1Q81 C;  1QP3 A;  3SHW A;  4NL3 A;  4HCZ A;  1VQ4 T;  4D8K A;  1TG0 A;  4F7U E;  2E12 A;  4YTL A;  3P8B B;  2DA9 A;  4EDU A;  2EYW A;  1K9M C;  3QPH A;  3CD6 A;  2K6D A;  4MZM A;  2QGG A;  2EQJ A;  2K7A A;  3CCL A;  1SPK A;  3FRN A;  4QT7 A;  3TU4 K;  5D6W A;  1BB9 A;  3RMS A;  2QQR A;  2XD0 A;  4JZ4 A;  4BE0 A;  3VJP A;  1WZO A;  2CP5 A;  2E5Q A;  2DL8 A;  5L8R E;  4PJJ A;  4C0F A;  4M77 C;  5CAI A;  5GAO m;  1B3Q A;  4DEX A;  1N27 A;  1UGQ B;  3QII A;  4RUG A;  1PSE A;  4MDW A;  2RJD A;  1CKB A;  4V2S A;  1K9M U;  3MP6 A;  2RQU A;  1QP2 A;  4ZGD B;  4ZGE B;  1RUW A;  1VIE A;  4KUL A;  2M16 A;  5IN1 A;  5CKE A;  5IH2 A;  3HHT B;  3OBW A;  1K4U S;  2EJF A;  2MWP A;  4JRI A;  2DFU A;  3GBQ A;  1VQK T;  4XTV A;  2CGH A;  3UA7 A;  4A4G A;  1M9S A;  5GAN 7;  3REA B;  4M78 B;  2RK2 A;  4FYV B;  3EAE A;  5CKH A;  3QJ6 A;  2P0K A;  2LQW A;  4Y92 A;  1YJ9 A;  1YJN Q;  1KQS A;  1LJO A;  1IRE B;  3VKI A;  1ZA2 B;  2X4X A;  2EQM A;  4HVV A;  2M02 A;  2JS0 A;  1WHH A;  3QJY A;  1H3Z A;  1Q86 U;  2AKL A;  2O2O A;  3M59 A;  2HMA A;  2IPO B;  1PM3 A;  1EIF A;  3EG1 A;  5GMK e;  4ELZ C;  3CC7 T;  4C5H A;  1LOJ A;  3RUX A;  4KH0 B;  4D6W A;  4FCY A;  1VQ4 Q;  2XKO C;  2JN0 A;  1VQ6 Q;  2DL5 A;  1LPL A;  3QG1 A;  3CCQ A;  2DTI A;  1BK2 A;  3X25 B;  3JSC A;  1LVK A;  4M77 D;  2JXB A;  3CCU T;  1WX6 A;  1VQO A;  3C4S A;  2J05 A;  1NEB A;  2VAS A;  5CO7 A;  3QKJ A;  2P4R A;  2F69 A;  2HKN A;  3UAT A;  2E41 A;  4C8Q E;  3CCR Q;  2COW A;  1ACM B;  4C0D C;  5I11 A;  2F2V A;  5FRM A;  1WJQ A;  2A3L A;  2AZS A;  1BCO A;  3CCR A;  4PNO A;  1JB0 E;  4MML A;  2DLP A;  2XDB A;  1R0B G;  4M7D F;  3C94 A;  3VS2 A;  4AMC A;  3VYH B;  1C1A A;  3VS0 A;  3H0F A;  4GBQ A;  2XK0 A;  2MK5 A;  3EFO A;  1PKS A;  4IIM A;  2CS7 A;  4DBR A;  1S72 A;  2DJZ A;  2ZPG B;  9ATC B;  4PJL A;  1U8R A;  4EMK C;  1TWB A;  1H8K A;  4JZ3 A;  4IUP A;  1MV3 A;  4XU1 A;  2QEX Q;  4KH1 B;  4FW1 A;  2J06 A;  5GAO q;  1VQN T;  4C8Q B;  5GAM e;  2HDA A;  3KBG A;  3JCM W;  4RKU E;  3S3O A;  4OMP A;  2QDL A;  1TSF A;  2DX1 A;  2DXT A;  2DER A;  2PVD B;  2OJ2 A;  3DLL A;  4J9H A;  4HCB A;  2DZ9 A;  4C92 A;  3I56 A;  1YP5 A;  4J7I A;  1G3W A;  3RMQ A;  4M77 A;  1YNZ A;  2ROT A;  3BE3 A;  1UFF A;  3AHU A;  2LMJ A;  5GAN h;  1UJ0 A;  1OPL A;  2K3Y A;  4KUI A;  1JJ2 A;  3PGG A;  1W70 A;  2RH2 A;  3H6Z A;  3GOX A;  4M77 B;  1VQM T;  1H92 A;  3JB9 F;  4PJO F;  1KFZ A;  1MMD A;  1G8X A;  3MJX A;  4WTO B;  1WHM A;  3HRT A;  2CZ6 B;  4ZNX A;  3I9Q A;  1YFN A;  1AT1 B;  1ARK A;  1U3O A;  1VQN Q;  3JCM b;  2RHU A;  2JZ2 A;  4J9D A;  4OB0 B;  1W2B S;  2B86 A;  3WXM B;  1K8A U;  3E2U A;  4R55 A;  2EAY A;  4EIK A;  1K9M R;  2QYZ A;  3L1A A;  1OZ2 A;  1OU8 A;  3JCM h;  4PFP A;  4OMO A;  4XU0 A;  1YIJ Q;  5FU7 C;  1FYN A;  1M30 A;  1GBR A;  3X20 B;  4J8O A;  1QCF A;  2YHT A;  3MEU A;  1AWX A;  1GCQ A;  4ZN1 A;  3A98 A;  1YHQ Q;  2WSE E;  4RMO A;  1N8R C;  1K73 C;  1T0J A;  5GMK i;  3OSV A;  3VYG A;  2RHZ A;  2YT6 A;  1RLP C;  3CCQ Q;  3R6O A;  3HL8 A;  2GTJ A;  4Y28 E;  2RI3 A;  4WF2 A;  5CR2 A;  1VQ6 T;  5FWB A;  5KYX A;  1Y71 A;  3CXC A;  3MHX A;  3CPW P;  4KGX B;  2G6F X;  3ZFJ A;  1D0X A;  3WVD B;  1RAA B;  5CQY A;  4BI3 A;  2MIO A;  2LT4 A;  1RAF B;  2L8D A;  1S72 Q;  5IHN A;  1M2V B;  3RKW A;  3RKX A;  2HQX A;  3CCV A;  2EVR A;  2ED1 A;  3M55 A;  2NLU A;  1M90 U;  1VQO T;  3QZ5 B;  3OW2 P;  3AT1 B;  1ABQ A;  4J9B A;  3VS7 A;  3OMG A;  5CIU A;  2L3P A;  1N5Z A;  1Q81 R;  1MND A;  2JNG A;  2NUZ A;  2RI2 A;  2YWW A;  2CZ1 B;  5IHK A;  4C0G A;  2RF0 A;  1MMA A;  3TQ7 P;  1Y7X A;  4C8Q G;  4XTY A;  2EKO A;  1R8O B;  2SRC A;  3OYG A;  3LWI A;  4PFO A;  1S72 T;  3RBB B;  1QCN A;  5DLO A;  2FPF A;  3L2W A;  1ZUY A;  2A36 A;  2ZPF B;  5GMK m;  4ORZ A;  2LZ6 B;  2JTM A;  2LNV A;  3URG A;  5KYY B;  4IUR A;  2KE9 A;  1NPR A;  2KRN A;  5FLX E;  1VQ7 A;  2XI9 A;  3ZBD A;  1D1C A;  3MEV A;  5CK9 A;  2K5F A;  2BTT A;  2RJC A;  2QQS A;  1AZG B;  1Q7Y U;  1TUC A;  1QVF A;  4KT0 E;  3OS5 A;  1Y07 A;  4ANJ A;  4RTT A;  1K1Z A;  3I5R A;  3OYF A;  2HCK A;  4M77 G;  4JJN K;  1YI2 T;  2RK1 A;  1VQK Q;  3C12 A;  3CC4 A;  3M57 A;  1QKW A;  3HKS A;  4X1V A;  2GF7 A;  1JRI A;  2E6N A;  3CC4 Q;  3VV0 A;  1IGQ A;  2DMO A;  1TU0 B;  1VQM A;  3DKM A;  3M0S A;  3RNJ A;  4RG2 A;  2DM1 A;  4M78 E;  1XOV A;  2QQA A;  5A0G A;  3RER A;  2VUB A;  1BIB A;  1NJI C;  1UUE A;  1AWW A;  1YIJ T;  5J3B A;  4A4K A;  3S3M A;  5CCA A;  5GAN e;  1R77 A;  2IVW A;  2XID A;  3CPW A;  3MET A;  4BAC A;  5CKD A;  3A1P A;  5DLQ E;  2EJG A;  1KD1 R;  2JTF A;  3QUI A;  2VB6 A;  1TH7 A;  2V8J A;  2FZG B;  2E65 A;  1BKB A;  2LQ8 A;  6AT1 B;  4A54 A;  2GCX A;  1JXO A;  3D7S B;  3MP8 A;  5KCO A;  2EGC A;  3TVT A;  3VS5 A;  2EJ9 A;  1KK7 A;  4FT2 A;  3TRE A;  1K0X A;  5GAN 8;  3HP9 A;  4AFZ C;  2XDD A;  1V29 B;  3MP1 A;  1M2V A;  4AFQ C;  1TUD A;  4C92 B;  1NYF A;  4DEY A;  3MEA A;  4JJC A;  1UGV A;  3UA6 A;  3I5S A;  3BDU A;  3SEM A;  4E7K A;  1PD0 A;  3A8G B;  4ATO A;  4QQG A;  2LP5 A;  3EFO B;  4DOV A;  4O5V A;  1YIT Q;  2YLB A;  1N6A A;  1QW1 A;  2KT1 A;  5GJW B;  3CCJ A;  2RHX A;  4AT1 B;  4BY6 C;  4CC4 B;  3OS0 A;  4J9E A;  3JCM d;  1RAC B;  2DAQ A;  1X6O A;  3M56 A;  4HCK A;  2KVQ G;  2G3R A;  5GMK h;  1YJW A;  4L6V 5;  2NUP A;  4MZT A;  2YLC A;  4M78 F;  2V8K A;  1QVG A;  4IUV A;  2DO3 A;  2JMA A;  2NYS A;  1AWJ A;  2HBP A;  2EYY A;  4M7A A;  1PKT A;  1UEB A;  2EFI A;  4E7H A;  4EMK A;  1WXU A;  2V1Q A;  3VUB A;  2CKK A;  4EMH A;  3M5A A;  1FMK A;  3EG9 A;  2FRW A;  3LYI A;  3V7C A;  4PK4 A;  2WAC A;  3OS1 A;  1Q82 C;  1G83 A;  4UC4 A;  2XMF A;  1RI0 A;  3EG9 B;  2DXU A;  1KG1 A;  4M75 B;  3L2Z A;  2LDM A;  2GFA A;  4A53 A;  1HJD A;  1EFN A;  2LJ1 A;  2D0N A;  1MGQ A;  2A08 A;  4GLK A;  2J6K A;  2FHD A;  2DRK A;  1NLP C;  2RQV A;  3S3N A;  1OX9 A;  2KSS A;  4BDZ A;  1NM7 A;  2Y90 A;  4RTU A;  2QXF A;  3H9N A;  5CVI A;  5EC7 A;  2RMO A;  3PIP A;  4AG1 C;  3LLR A;  1WXB A;  2QQB A;  3UT1 A;  3JB9 G;  3G6E A;  2VWF A;  4CC7 A;  2FPD A;  1YBY A;  1QKX A;  2K5L A;  3M0Q A;  1OV3 A;  1VQ7 T;  2F1L A;  4C5E A;  1B34 A;  4M7D G;  2RJF A;  2E3H A;  4N0A C;  1SSH A;  3VRZ A;  1QWF A;  1XQH A;  4DQ2 A;  1VQ8 A;  1JBM A;  5KCH A;  2EQK A;  5KYN A;  1T0H A;  2W10 A;  2OAW A;  1GFD A;  2KQW A;  3CC4 T;  1MV0 B;  3OYC A;  2EPD A;  2VV5 A;  1ZUU A;  4M7A D;  2KR3 A;  2DD4 A;  5IT9 E;  4J5Y A;  2XIC A;  3I55 T;  4RTV A;  1NZ9 A;  4BE2 A;  1VQ9 T;  4HT8 A;  2MAM A;  1VQ4 A;  2O01 E;  3PTA A;  3LH0 A;  5LJ3 j;  3OYD A;  2E5K A;  2KMT A;  3P8D A;  1KD1 C;  3CD6 T;  4BD3 A;  1OOT A;  1IO6 A;  1N8R R;  3CCL T;  4OMN A;  4PKC C;  2DL7 A;  1OX8 A;  1LNX A;  1FWZ A;  3HTR A;  1HSQ A;  3CCM T;  3UPU A;  1BBZ A;  2K9G A;  4J6X A;  2E4H A;  3PFS A;  2ATC B;  2FEI A;  4AFU C;  3I35 A;  3BY7 A;  2ESW A;  1YN8 A;  3OYI A;  4B9W A;  1WLP B;  2I0N A;  5LJ5 e;  2PZ1 A;  3CXC P;  3GNF B;  1KC8 C;  4OB1 B;  1X2K A;  1SHF A;  3G4S A;  4LE9 A;  4TVR A;  4VUB A;  3RR6 A;  2AIR B;  1VQK A;  2K5I A;  1M3B A;  2HKQ B;  3M53 A;  4M75 E;  4PL6 A;  4OMM A;  2D1X A;  4DOW A;  2F2W A;  2KAF A;  3RES A;  2A37 A;  3GP8 A;  1AD5 A;  4LDW A;  2EBP A;  5LJ3 h;  3FLG A;  4B6M A;  4E7J A;  1TXQ A;  3P8H A;  4OB3 B;  3BFM A;  3QYH B;  2GNC A;  1X69 A;  1U1T A;  1VQL Q;  5FRN A;  4M75 F;  5IXF A;  4M78 A;  4F17 A;  1VQ7 Q;  4JUV A;  3QHS A;  2DJQ A;  4E6R A;  1RI9 A;  2K57 A;  2LCS A;  3SWN A;  4BB7 A;  1A0N B;  2CZ7 B;  4ESR A;  2E3I A;  3R6N A;  1RAH B;  5GAM h;  3L2U A;  1FMV A;  2ZZD A;  4IKF A;  4M7D C;  1P92 A;  4F7U B;  5GAN 5;  3CCR T;  3G7Z A;  1UGP B;  4C8Q C;  2RB6 A;  4XTU A;  2HL5 C;  2YRC A;  1VQ8 Q;  4QVZ A;  4PJO D;  1NJI R;  1XJW B;  3JCM V;  3CCS A;  4FT4 A;  2LRQ A;  4QW2 A;  2EQI A;  2X51 A;  4M77 E;  2M0O A;  2MPX C;  1PNJ A;  2AZV A;  3SFM A;  3JV3 A;  4E47 A;  5KH6 A;  4E7L A;  4CC3 A;  5FWC A;  1KQ1 A;  5ECA A;  1OPK A;  4PLL A;  3OSS C;  2DVJ A;  2DET A;  5GAM j;  3FC3 A;  2GBQ A;  1YJW Q;  4ZGJ B;  5C0M A;  1X75 C;  4LD6 A;  1WNL A;  4J9F A;  4DBH A;  2FB7 A;  3CEY A;  2XHC A;  3X28 B;  3CME T;  1K76 A;  2ZPI B;  1AEY A;  2KRM A;  4P5N A;  2DL3 A;  4JJD A;  1GCQ C;  4BDY A;  2L5Q A;  1M90 R;  2HSP A;  3INZ A;  5GAN d;  1K0S A;  4NS5 A;  2CYZ B;  2DTO A;  3LGL A;  4HVW A;  2P4T A;  4LUD A;  3NFC A;  3OYN A;  1OUL A;  2ED0 A;  3G71 A;  1JQQ A;  4JDS A;  3I55 A;  1VQ9 A;  5HY6 A;  1VUB A;  1JJ2 S;  1KIK A;  1RAE B;  1OEB A;  2E64 A;  1HK9 A;  2RJE A;  1GL5 A;  1ABO A;  5FU6 B;  4C8Q A;  5LL6 S;  4HT9 A;  1NYG A;  3TEE A;  2KRS A;  4XTZ A;  4FYY B;  2HEQ A;  3JCM P;  3CMA T;  5KE3 A;  1WA7 A;  3CCM A;  1G2B A;  4M77 F;  3DLM A;  3M54 A;  2FL7 A;  2DXB A;  1TOV A;  2YRV A;  3EFS A;  1CKA A;  2KEA A;  1KC8 R;  4N4I A;  2BZ8 A;  1QVG S;  3QSU A;  7AT1 B;  2YUQ A;  2COY A;  2VXF A;  5GAN j;  5HK3 A;  1Q86 R;  1RAD B;  4J7F A;  4DBQ A;  2CP6 A;  3A8H B;  3EH2 A;  2W0Z A;  5D6Y A;  1X43 A;  2KGT A;  8AT1 B;  3BDL A;  3G4S T;  4OF1 A;  2O9S A;  4M7A C;  2K79 A;  5DY9 A;  3CC2 A;  5L23 A;  2EKH A;  2M0Y A;  4PLI A;  2KDS A;  4LXC A;  2J6F A;  2DZC A;  2MWO A;  1UEC A;  2LCL A;  2OI3 A;  2DVE A;  1KQ2 A;  1VQ6 A;  5D7U A;  1K8A R;  1OU9 A;  3KFV A;  1QQJ A;  3QYG B;  4JLG A;  4M7A F;  2H3J A;  1ZHI A;  3EG0 A;  3JCM e;  1BI3 A;  1TS9 A;  2OTL Q;  4XAX B;  2BZX A;  2PVG B;  3FDR A;  1IRX A;  3HPW A;  4MMK A;  4E7S A;  5LJ3 e;  1VQ5 Q;  1MMG A;  2ZCF B;  2R5A A;  3JCM c;  2V8I A;  3V7S A;  2KY9 A;  5LJ5 f;  2CSQ A;  1YJN T;  2ABL A;  3NTK A;  3X26 B;  4L5G A;  2JS2 A;  1M1K C;  3SD4 A;  2HL3 A;  4MDX A;  4HXJ A;  2RNA A;  4KRT A;  3PT9 A;  4AG2 C;  4M7D E;  1RAG B;  5KE2 A;  3OYA A;  2P84 A;  1WJS A;  3CCS T;  4CRI A;  1WHJ A;  2HBW A;  1E6G A;  3DB3 A;  2M51 A;  3JB9 I;  1QVF P;  4QVC A;  4OML A;  3ZL7 C;  1UTI A;  2Y4X A;  3LX7 A;  1SRM A;  1EX4 A;  1N9S A;  1HXD A;  1PD1 A;  2CH4 W;  1J3T A;  2J7I A;  3ASK A;  2RN8 A;  2SEM A;  2DD5 A;  3SWN C;  1SEM A;  1C0M A;  2O31 A;  2Y4Y A;  4C92 D;  1BU1 A;  3ZEH A;  3THK A;  1KJW A;  4ZTJ A;  3O5Z A;  5I21 A;  2QEX A;  2PUO B;  1JU5 C;  1I0C A;  3E9G A;  4EMK B;  1VQL T;  2DXC A;  1WQ7 A;  1ZBJ A;  1KHC A;  1M3A A;  1MNE A;  1KC8 U;  4PJO E;  5LJ3 g;  1YI2 A;  1YIT T;  2QG9 B;  4M78 D;  2JM9 A;  3QWX X;  3E1S A;  3WVE B;  1Q81 U;  4OGE A;  3FJ5 A;  3PVQ A;  3OYE A;  1HYO A;  3G71 T;  1X6B A;  1KSW A;  2HQH A;  3OS2 A;  4KGV B;  1M8M A;  3CCE Q;  1YCY A;  2CDT A;  2F5T X;  4RTW A;  1D09 B;  3E19 A;  3G1J A;  4RTX A;  3N5B B;  5GAO p;  2EW3 A;  1YIJ A;  2DBK A;  4C0Z A;  2VVK A;  2QQ9 A;  3A8O B;  3CMA A;  4PJO B;  1NPP A;  1QLY A;  2LC4 A;  2EYX A;  4IUQ A;  1U06 A;  4DBF A;  4BY6 B;  4ZN3 A;  1C6V X;  3OYL A;  2LQN A;  1ZSZ C;  3HRU A;  1VQP Q;  1VQ5 T;  4JS5 A;  1WJR A;  2ZGW A;  4JS4 A;  3M4Y A;  2A7Y A;  2E10 A;  1UGS B;  5GAO l;  3L2V A;  2OTL A;  1H3H A;  3G6E Q;  2AHJ B;  2K2V A;  3QO3 A;  3M58 A;  3OY9 A;  3EG3 A;  3A8L B;  5GAO n;  3EHR A;  3T9N A;  4OGC A;  4M75 A;  2K4Y A;  5HK0 A;  3CC2 T;  3REB B;  1WI7 A;  4M75 D;  2CSI A;  4M7A E;  2X4W A;  2P0Q A;  3J80 E;  4C8Q F;  3JCM Q;  3V8K A;  2RPN A;  1KQS P;  1D0Y A;  3PIO A;  5J39 A;  3OYM A;  1GFC A;  2JW4 A;  2EIF A;  4XU3 A;  3CCV Q;  3U23 A;  1FXX A;  4M7D D;  2MYS A;  4CI0 C;  1BIA A;  1Z9Z A;  4NOY A;  1BI1 A;  2E6Z A;  5GAM d;  1Q95 G;  4KGZ B;  3EGD A;  2VYT A;  2K3B A;  5A2Q E;  4LNP A;  2QA4 T;  1WHK A;  2KRO A;  5IHI A;  4BI4 A;  3HFN A;  2EWN A;  4R56 A;  3VU3 C;  4X9C A;  1N9R A;  3JCM f;  4Z88 A;  4A4H A;  4M7A B;  1M1K R;  1VQP T;  3M9Q A;  2JOY A;  2X4Y A;  1GXI E;  1V76 A;  1F1B B;  5GAO r;  4LDV A;  5EG2 A;  3CCL Q;  3O8V A;  2VKN A;  4M4Z A;  4A4F A;  2QA4 Q;  3LW5 E;  3M0R A;  1AWO A;  3CD6 Q;  1NG2 A;  2DYI A;  1S1N A;  3SB2 A;  3L42 A;  1Q82 U;  2R58 A;  2CP2 A;  5GAN f;  4KUD K;  1UHF A;  1HD3 A;  4QKU A;  3OYJ A;  3JCM X;  2OTJ A;  2DNU A;  1M90 C;  3QBY A;  2JVV A;  2OTJ Q;  2FZC B;  2FYK A;  2E70 A;  1SHG A;  1GBQ A;  3TSW A;  1MHN A;  2LX7 A;  1VYT A;  3MPU B;  3G6E T;  4WCI A;  3OW2 S;  1X2Q A;  1RLQ C;  2DPP B;  2JM8 A;  4C5I A;  3OYH A;  1M1F A;  3QZ9 B;  2ROL A;  4LN2 A;  3MEW A;  1WDX A;  5GJV B;  2L89 A;  4M7D B;  2RO0 A;  3C0C A;  4F7U F;  3OYB A;  1VQL A;  1IZ6 A;  4QQD A;  1UDL A;  2FO0 A;  1JJ2 P;  1Y96 B;  4D8D A;  1YWP A;  5GAN 3;  1X01 A;  2HAX A;  1Y0M A;  2R57 A;  3H0H A;  2QTV A;  2GGR A;  1Q86 C;  2O9V A;  2HQE A;  2QAZ A;  1M3C A;  4C8Q D;  1UG1 A;  4F14 A;  2O4X A;  1VOM A;  4M78 G;  4C92 G;  2I2L A;  4A63 B;  2HNI A;  4F7U G;  1YCS B;  2DBM A;  2EGA A;  2L0A A;  1I1J A;  1UJY A;  2Z0W A;  3FB9 A;  5GAN g;  1E7O A;  2XU8 A;  1I8F A;  1O75 A;  2LQK A;  4GY5 A;  3J7A F;  1W4S A;  1IB8 A;  1Y96 A;  2AKK A;  2YUN A;  4HVU A;  4FM4 B;  2L3S A;  3CC7 Q;  1WHL A;  2JJ9 A;  1O9S A;  2DF6 A;  3ME9 A;  1PC0 A;  1VQ5 A;  2IIM A;  3NPF A;  1YJ9 T;  2NWM A;  1NJI U;  2E1H A;  4PJO G;  4M7A G;  2VXE A;  3CCJ Q;  4BE1 A;  2OTL T;  4ZTF A;  1YWO A;  2X9H A;  1JEG A;  2NUP B;  2KBT A;  1OI1 A;  2X35 A;  1OZ3 A;  4JRK A;  4XU2 A;  4F16 A;  4Z02 A;  5CKB A;  1QVF S;  2IG0 A;  3VS1 A;  3GF5 A;  4Q5W A;  2L3R A;  1BI2 A;  2CH4 A;  3CCQ T;  4LDY A;  1FX7 A;  1NEG A;  2BE9 B;  4EPC A;  1B7T A;  5A0L A;  2CT3 A;  4PJO A;  1UE9 A;  3EH1 A;  3CCU A;  2KXC A;  3JB9 D;  5AYF A;  2DK3 A;  1PHT A;  4HA8 A;  3OQ5 A;  3CCU Q;  1BCM A;  2JMC A;  3EHQ A;  2D8J A;  2EYQ A;  4PJM A;  4II1 A;  2QA4 A;  1ZSZ A;  5GMK l;  1G3Y A;  4RCC A;  4RTY A;  5HKC A;  2ZPB B;  4JPB W;  1I4K 1;  3M0T A;  3UDC A;  1WYX A;  2ZAE A;  2F2X A;  3EGU A;  1BI0 A;  5IAY A;  5IXB A;  2GQV A;  1VQP A;  4E2F B;  2RA2 A;  4M75 C;  4Y91 A;  1XNI A;  4FSS A;  3H41 A;  1B34 B;  4IUU A;  2JTE A;  3CCM Q;  2WSF E;  4CC2 A;  2RM4 A;  1ZA1 B;  2DIL A;  3LWH A;  1U1S A;  1DJ7 B;  2C0I A;  2D9T A;  4LDU A;  4N4H A;  1VQN A;  3VRY A;  4OP0 A;  2VGN A;  1G5V A;  5KYW B;  2DEU A;  4OMQ A;  2CT4 A;  3PMT A;  3OYK A;  4R0K A;  1GRI A;  3CCS Q;  3V7R A;  2LTO A;  3CCE A;  2ECZ A;  3EGX A;  2QTX A;  3I56 Q;  3JB9 H;  3GIB A;  2KYB A;  2FZK B;  3A5Z B;  2YUP A;  4FIB A;  4NL2 A;  4Z89 A;  3F70 A;  2JUF A;  2CP0 A;  3MCA B;  3OBY A;  1IXD A;  1N8R U;  5LJ5 d;  5M9O A;  5I2S A;  3CME A;  3HFO A;  2DYB A;  1AOJ A;  3M4G A;  1MMN A;  1G3S A;  3CME Q;  4F7U A;  2F5K A;  2QAS A;  3CBO A;  5GAN 2;  2RD1 A;  4RCB A;  2BZY A;  3X24 B;  2PQW A;  4C0D B;  4J9G A;  4C92 E;  1KD1 U;  3C95 A;  5DM7 R;  4BI8 B;  1K73 U;  2LJ0 A;  2XG8 D;  2PUK B;  4KBM B;  3L2R A;  2PU9 B;  1G3T A;  2MF2 A;  5GAM g;  1VQM Q;  2NUT A;  4BUG A;  3OMC A;  2DL4 A;  2PTK A;  2B8A A;  3HSB A;  1GCP A;  2CUB A;  2L3Q A;  1VA7 A;  5C6S A;  2C0T A;  2COZ A;  5LJ5 j;  2EYZ A;  2K2M A;  2KI7 A;  3SWN B;  1YHQ A;  1NBE B;  4IIO A;  2RHI A;  5FU7 B;  4HKE A;  5KYU A;  8ATC B;  3L2Q A;  3CPF A;  3G4S Q;  5LJ3 f;  2MMP A;  2FRY A;  3MKD A;  3JRZ A;  4XTX A;  1WIE A;  1PSF A;  5LJ5 g;  2XDP A;  1SF9 A;  5A0D A;  3TCJ A;  5GMK j;  2J6O A;  2A0F B;  1WXT A;  2GTO A;  4E7I A;  1U5S A;  1WPY A;  2OX7 A;  4EMG A;  2R5M A;  5I2M A;  1E6H A;  2DKG A;  4ME7 A;  1ZSG A;  2L2P A;  2P0P A;  2DE0 X;  5FRO A;  3GPL A;  4M75 G;  1QVP A;  2D8H A;  4GLM A;  3V8J A;  1ZSZ B;  3TSZ A;  1KQS S;  3CBM A;  1W2B P;  1Q7Y C;  3CCV T;  1TUG B;  4OB2 B;  3ULR B;  2LX9 A;  3VS6 A;  1KHI A;  4XK8 E;  4RTZ A;  5KYW A;  1PRL C;  1EZZ B;  5FU6 C;  2EGE A;  4RG8 A;  1QVG P;  4F04 B;  4PJN A;  1YI2 Q;  2DTH A;  2RQW A;  1RAB B;  5I22 A;  2AK5 A;  3NTH A;  5HCK A;  1SKU B;  3E9F A;  1M1G A;  4E7Z A;  2QK0 A;  4FYX B;  3VS4 A;  2KXD A;  2KT8 A;  1SG5 A;  3UWN A;  1NLO C;  3V8L A;  1NE8 A;  1T3L A;  3FEO A;  4HCC A;  1Y57 A;  2H3E B;  2D6F A;  2HD0 A;  2ENM A;  1YJ9 Q;  1YJN A;  2H8H A;  4AFS C;  1I81 A;  2MCN A;  2CP7 A;  4FW2 A;  4OMF B;  4XTW A;  1XTD A;  5KYY A;  3FJP A;  3CMA Q;  1K73 R;  4FL6 A;  2RHY A;  1UGR B;  1BYM A;  2CP3 A;  3GNG A;  2X3X D;  2FG0 A;  1M4Z A;  4J9I A;  1Z9Q A;  2V1R A;  5LJ3 d;  4N4G A;  3CCE T;  1X6G A;  4JJB A;  4FYW B;  1RAI B;  1WGS A;  1M5Q 1;  1VQO Q;  4ELY C;  2O88 A;  1D0Z A;  2WSC E;  1IHV A;  4M78 C;  1VIF A;  2YDL A;  4J6Y A;  4C92 F;  1I5O B;  2QI2 A;  1PG5 B;  2DRM A;  3NTI A;  1Q82 R;  2MI6 A;  2KK4 A;  5CKF A;  4QVD A;  1QWE A;  2CRE A;  2FPE A;  1T3S A;  3NMZ C;  4C5G A;  2NUT B;  3EGX B;  1WQW A;  2QEX T;  1K9A A;  5CQX A;  1M27 C;  1M8V A;  2BIV A;  2YXY A;  1YIT A;  2D0Q B;  1UB4 A;  3Q1J A;  4L59 A;  1M1K U;  4J83 A;  4B9X A;  2X3W D;  5D6X A;  3J81 E;  4C92 C;  3M0U A;  4JLI A;  4LUE A;  4FSX A;  1V1C A;  2QDY B;  3OW2 A;  2CZ0 B;  2DIQ A;  2FVU A;  3QDR B;  3EFR A;  2LT1 A;  3LH5 A;  1JO8 A;  1AHJ B;  1W2B A;  1MUZ A;  3PVL A;  4DA4 A;  3G71 Q;  1ZBX A;  2EQU A;  1YHQ T;  2GFU A;  3S6W A;  1ZQ1 A;  2YUO A;  2V26 A;  2KNB B;  2MOX A;  1K8A C;  2DIG A;  2ZPH B;  3QXE B;  4JRQ A;  4PJO C;  4K11 A;  3BW1 A;  5FW9 A;  1ZLM A;  5AT1 B;  2LCC A;  2BKD N;  3CCJ T;  2GQI A;  5J26 A;  2LJ3 A;  1CSK A;  1H64 1;  1VYU A;  1YJW T;  1Q7Y R;  2LVM A;  3JB9 J;  2CUD A;  4LD9 K;  1ZUK A;  3PE0 A;  3MO8 A;  3CC7 A;  5GAN 4;  3VS3 A;  1PCX A;  1RL2 A;  1B07 A;  2A28 A;  2X4J A;  2C0O A;  4A4E A;  3CXC S;  3OYY A;  1AVZ C;  2BUD A;  3RIR A;  1IGU A;  1X27 A;  2ZPE B;  3RDV A;  1R0C B;  4Z8A A;  1D3B B;  3NHN A;  1OQK A;  3NGP A;  5LJ5 h;  2OAU A;  2RQT A;  3H0I A;  2C06 A;  3JCM g;  3OB9 A;  1SSF A;  2RQR A;  3HRS A;  1UHC A;  1WFW A;  3EG2 A;  1W1F A;  3CC2 Q;  3IQL A;  3ER0 A;  1D3B A;  1VYV A;  3CBP A;  1M2O A;  3A8M B;  1D1A A;  1WHG A;  2O4X B;  3DB4 A;  3PMI A;  2HSE B;  3QDF A;  1LCK A;  4OVA A;  1TTH B;  5GAM f;  3KXT A;  1ZX6 A;  1W6X A;  3QWY A;  3OA6 A;  2AT1 B;  3KUF A;  3RKY A;  1PRM C;  2YRD A;  3GLX A;  1OYX A;  2KYM A;  3LGF A;  2VGM A;  4PFZ A;  3JCM J;  2RI5 A;  4IUT A;  2M9U A;  3EGD B;  1QCO A;  3M0P A;  4XQ3 A;  4LDX A;  2JT4 A;  1JXM A;  4M7D A;  1PWT A;  2VC8 A;  1SRL A;  4O6J A;  3H8Z A;  1AZE A;  2PVO B;  3VUZ A;  3UF4 A;  2K3X A;  4J6W A;  4X34 A;  4J9C A; 
#chains in the Genus database with same CATH homology
 1YIJ T;  3SDZ A;  5DY9 A;  4FU6 A;  5GAN 6;  3UDC A;  2OTJ T;  5J3B A;  4A4K A;  3S3M A;  3CC2 A;  1I5L A;  5CCA A;  5GAN e;  1VQ8 T;  4X9D A;  2IVW A;  1BI0 A;  2XID A;  3CPW A;  3MET A;  4BAC A;  4PLI A;  2KDS A;  4N0A A;  5CKD A;  3I56 T;  3CPW S;  5IAY A;  2GQV A;  4MZP A;  1VQP A;  4QQ6 A;  2DZC A;  5DLQ E;  2MWO A;  2EJG A;  2RA2 A;  4M75 C;  2LCL A;  4Y91 A;  1XNI A;  2DVE A;  1KQ2 A;  1VQ6 A;  1B34 B;  2JTF A;  3QUI A;  4JRP A;  1TH7 A;  4IUU A;  2V8J A;  2WSF E;  3PNW C;  2RM4 A;  3JAM E;  2E65 A;  1BKB A;  2LQ8 A;  3LWH A;  1U1S A;  3QYG B;  4A54 A;  1DJ7 B;  2GCX A;  4JLG A;  3FIF A;  2D9T A;  3MP8 A;  4LDU A;  4N4H A;  5KCO A;  2M1H A;  2DEQ A;  2EJ9 A;  1VQN A;  1Q81 C;  4FT2 A;  1QP3 A;  1ZHI A;  2H3J A;  3TRE A;  4HCZ A;  4NL3 A;  1VQ4 T;  4M7A F;  5GAN 8;  4OP0 A;  2VGN A;  3JCM e;  3HP9 A;  1G5V A;  1BI3 A;  4F7U E;  4XAX B;  2PVG B;  3FDR A;  2E12 A;  2XDD A;  4YTL A;  3P8B B;  3PMT A;  1V29 B;  3HPW A;  4EDU A;  3CD6 A;  1K9M C;  3QPH A;  3MP1 A;  3OYK A;  4MMK A;  4MZM A;  4C92 B;  5LJ3 e;  3CCL A;  2EQJ A;  3V7R A;  2LTO A;  3MEA A;  3FRN A;  3TU4 K;  3CCE A;  5D6W A;  2QTX A;  2ZCF B;  3RMS A;  2R5A A;  3JB9 H;  3JCM c;  2QQR A;  2XD0 A;  2V8I A;  3V7S A;  4BE0 A;  3GIB A;  2KY9 A;  3VJP A;  3BDU A;  2E5Q A;  3A5Z B;  5L8R E;  4C0F A;  5CAI A;  5LJ5 f;  4FIB A;  4M77 C;  5GAO m;  4E7K A;  4NL2 A;  3A8G B;  4ATO A;  1N27 A;  1UGQ B;  4QQG A;  3QII A;  4DOV A;  1YJN T;  4O5V A;  2YLB A;  1N6A A;  1PSE A;  1QW1 A;  3NTK A;  3X26 B;  4L5G A;  3F70 A;  4MDW A;  2RJD A;  2JUF A;  3CCJ A;  2RHX A;  3MCA B;  3OBY A;  4V2S A;  1N8R U;  1M1K C;  3SD4 A;  4BY6 C;  5M9O A;  5LJ5 d;  3OS0 A;  1K9M U;  3MP6 A;  4ZGD B;  1QP2 A;  4ZGE B;  3JCM d;  5I2S A;  4MDX A;  2DAQ A;  1X6O A;  3HFO A;  1VIE A;  3M56 A;  3CME A;  3PT9 A;  2M16 A;  4KUL A;  5IN1 A;  4M7D E;  2KVQ G;  2G3R A;  3M4G A;  5GMK h;  1YJW A;  4L6V 5;  4MZT A;  5CKE A;  5KE2 A;  3HHT B;  1G3S A;  2YLC A;  3OBW A;  3OYA A;  4M78 F;  2V8K A;  1QVG A;  4IUV A;  4F7U A;  2EJF A;  2DO3 A;  2F5K A;  2MWP A;  1WJS A;  4JRI A;  3CBO A;  1VQK T;  2HBP A;  5GAN 2;  2RD1 A;  4RCB A;  4XTV A;  4CRI A;  3CCS T;  4M7A A;  3X24 B;  2PQW A;  4C0D B;  1UEB A;  2CGH A;  3DB3 A;  3JB9 I;  4C92 E;  1KD1 U;  3C95 A;  4A4G A;  4QVC A;  1M9S A;  5GAN 7;  5DM7 R;  2EFI A;  4E7H A;  4M78 B;  4BI8 B;  4EMK A;  1K73 U;  2RK2 A;  2Y4X A;  3EAE A;  2XG8 D;  2PUK B;  3LX7 A;  3QJ6 A;  4KBM B;  2P0K A;  5CKH A;  1N9S A;  2PU9 B;  3L2R A;  1G3T A;  2MF2 A;  2CKK A;  3VUB A;  1HXD A;  4EMH A;  5GAM g;  3M5A A;  1YJ9 A;  1KQS A;  3LYI A;  4BUG A;  3OMC A;  1LJO A;  3ASK A;  3V7C A;  1IRE B;  2DD5 A;  3VKI A;  2WAC A;  3SWN C;  3OS1 A;  1Q82 C;  2B8A A;  4UC4 A;  3HSB A;  1RI0 A;  2Y4Y A;  4C92 D;  2X4X A;  2EQM A;  1NJI C;  3ZEH A;  3QJY A;  1H3Z A;  1Q86 U;  5C6S A;  2DXU A;  1KG1 A;  4M75 B;  4ZTJ A;  3L2Z A;  3M59 A;  5LJ5 j;  2LDM A;  2GFA A;  3SWN B;  4A53 A;  2PUO B;  5I21 A;  1EIF A;  2QEX A;  1YHQ A;  4EMK B;  3E9G A;  1VQL T;  2DXC A;  5GMK e;  1WQ7 A;  4ELZ C;  1KHC A;  3CC7 T;  4C5H A;  1LOJ A;  3RUX A;  4D6W A;  1KC8 U;  2RHI A;  5FU7 B;  4PJO E;  4HKE A;  1MGQ A;  2XKO C;  5LJ3 g;  4GLK A;  3L2Q A;  2JN0 A;  1YI2 A;  2FHD A;  3QG1 A;  4M78 D;  3CCQ A;  1YIT T;  2DTI A;  3S3N A;  3CPF A;  3WVE B;  3E1S A;  5LJ3 f;  2KSS A;  4BDZ A;  2MMP A;  3X25 B;  1Q81 U;  3JSC A;  2Y90 A;  4OGE A;  2QXF A;  3JRZ A;  4XTX A;  5CVI A;  4M77 D;  3PIP A;  3CCU T;  3OYE A;  1PSF A;  1VQO A;  5LJ5 g;  3G71 T;  3LLR A;  3C4S A;  2QQB A;  2XDP A;  5A0D A;  3UT1 A;  5CO7 A;  3TCJ A;  3QKJ A;  3G6E A;  3JB9 G;  5GMK j;  2F69 A;  3OS2 A;  2E41 A;  4C8Q E;  1YBY A;  2K5L A;  4E7I A;  1WPY A;  4C0D C;  1YCY A;  4EMG A;  1VQ7 T;  1WJQ A;  2A3L A;  2F5T X;  3CCR A;  3E19 A;  4C5E A;  5FRM A;  2R5M A;  4PNO A;  3N5B B;  5I2M A;  2DKG A;  3TEE A;  1B34 A;  1JB0 E;  4MML A;  2RJF A;  5GAO p;  1YIJ A;  2XDB A;  3C94 A;  4ME7 A;  4M7D F;  4C0Z A;  4N0A C;  3VYH B;  2P0P A;  1XQH A;  4DQ2 A;  5FRO A;  1VQ8 A;  3GPL A;  2QQ9 A;  1JBM A;  2XK0 A;  1QVP A;  3A8O B;  4M75 G;  3CMA A;  4PJO B;  3V8J A;  5KCH A;  1NPP A;  2EQK A;  2LC4 A;  2CS7 A;  4IUQ A;  1S72 A;  2DJZ A;  2ZPG B;  1KQS S;  4BY6 B;  1U8R A;  2KQW A;  3CC4 T;  4ZN3 A;  4EMK C;  3CBM A;  3OYL A;  3CCV T;  1Q7Y C;  3OYC A;  4OB2 B;  4IUP A;  2VV5 A;  3HRU A;  2LX9 A;  4M7A D;  1KHI A;  4XK8 E;  4XU1 A;  4JS5 A;  1VQ5 T;  2DD4 A;  5IT9 E;  4J5Y A;  1WJR A;  5FU6 C;  5GAO q;  2XIC A;  4RG8 A;  2ZGW A;  1NZ9 A;  4C8Q B;  5GAM e;  3I55 T;  4BE2 A;  2MAM A;  1VQ9 T;  4JS4 A;  3M4Y A;  2A7Y A;  1VQ4 A;  2O01 E;  2E10 A;  1UGS B;  3KBG A;  3PTA A;  5GAO l;  2DTH A;  3LH0 A;  3L2V A;  3JCM W;  5LJ3 j;  2OTL A;  2AHJ B;  2K2V A;  2KMT A;  3M58 A;  3P8D A;  3QO3 A;  4RKU E;  3A8L B;  3OY9 A;  5GAO n;  3OYD A;  3S3O A;  1KD1 C;  3CD6 T;  3T9N A;  4OGC A;  4M75 A;  2K4Y A;  4BD3 A;  2DXT A;  2PVD B;  5HK0 A;  3NTH A;  3CC2 T;  3DLL A;  3E9F A;  3CCL T;  4PKC C;  4M75 D;  4HCB A;  1LNX A;  1M1G A;  1FWZ A;  2X4W A;  4M7A E;  2P0Q A;  3J80 E;  2DZ9 A;  4C8Q F;  4C92 A;  3I56 A;  3JCM Q;  3V8K A;  3CCM T;  4J7I A;  3UPU A;  1G3W A;  3UWN A;  3RMQ A;  4M77 A;  3PIO A;  3V8L A;  1NE8 A;  3FEO A;  5J39 A;  4J6X A;  4HCC A;  3OYM A;  3PFS A;  2D6F A;  3AHU A;  5GAN h;  2HD0 A;  1YJN A;  2EIF A;  2K3Y A;  4KUI A;  4XU3 A;  1I81 A;  3PGG A;  1JJ2 A;  2RH2 A;  1FXX A;  4M7D D;  4CI0 C;  4OMF B;  3H6Z A;  1BIA A;  3BY7 A;  4XTW A;  3GOX A;  4NOY A;  5GAM d;  1BI1 A;  1XTD A;  2E6Z A;  4M77 B;  3FJP A;  4B9W A;  5LJ5 e;  3OYI A;  1VQM T;  3JB9 F;  4FL6 A;  2RHY A;  4PJO F;  1UGR B;  1BYM A;  2VYT A;  3GNG A;  3GNF B;  1KC8 C;  5A2Q E;  2QA4 T;  1M4Z A;  4OB1 B;  3HRT A;  3G4S A;  2CZ6 B;  4BI4 A;  4TVR A;  3HFN A;  4VUB A;  2EWN A;  4R56 A;  3JCM b;  1VQK A;  2K5I A;  2RHU A;  2JZ2 A;  5LJ3 d;  3VU3 C;  4N4G A;  4X9C A;  3M53 A;  4M75 E;  4PL6 A;  1N9R A;  4OB0 B;  3CCE T;  3JCM f;  1W2B S;  3WXM B;  4M7A B;  4A4H A;  4DOW A;  1VQP T;  1K8A U;  2KAF A;  3M9Q A;  2EAY A;  2JOY A;  3RES A;  4R55 A;  2X4Y A;  1WGS A;  1GXI E;  1M5Q 1;  3L1A A;  3GP8 A;  4LDW A;  4ELY C;  5LJ3 h;  1OZ2 A;  3FLG A;  4LDV A;  3JCM h;  5EG2 A;  4E7J A;  5GAO r;  3O8V A;  3P8H A;  2WSC E;  4XU0 A;  4A4F A;  4OB3 B;  5FU7 C;  3LW5 E;  4M78 C;  3BFM A;  3QYH B;  1VIF A;  4J6Y A;  4C92 F;  2QI2 A;  3NTI A;  3X20 B;  2MI6 A;  4J8O A;  2KK4 A;  2YHT A;  5CKF A;  3MEU A;  4QVD A;  3SB2 A;  1U1T A;  3L42 A;  5FRN A;  1Q82 U;  2R58 A;  4M75 F;  5GAN f;  4C5G A;  4KUD K;  4M78 A;  4ZN1 A;  1WQW A;  2QEX T;  5CQX A;  3OYJ A;  2WSE E;  3JCM X;  4RMO A;  4JUV A;  3QHS A;  1N8R C;  1K73 C;  2OTJ A;  1M90 C;  3QBY A;  5GMK i;  1M8V A;  3OSV A;  3VYG A;  2JVV A;  2RHZ A;  2BIV A;  1YIT A;  2D0Q B;  3R6O A;  1UB4 A;  3HL8 A;  3Q1J A;  4L59 A;  1M1K U;  2FYK A;  2E70 A;  2K57 A;  4J83 A;  4B9X A;  5D6X A;  4Y28 E;  1MHN A;  2RI3 A;  4WF2 A;  3SWN A;  4BB7 A;  5CR2 A;  4C92 C;  3J81 E;  1VQ6 T;  1Y71 A;  2CZ7 B;  4JLI A;  4FSX A;  2QDY B;  5GAM h;  3G6E T;  3OW2 A;  2CZ0 B;  3CXC A;  3OW2 S;  2DIQ A;  2FVU A;  3L2U A;  3MHX A;  2ZZD A;  3QDR B;  2DPP B;  4IKF A;  4M7D C;  3EFR A;  3ZFJ A;  4M7D G;  2LT1 A;  1P92 A;  4C5I A;  3OYH A;  1YI2 T;  1M1F A;  4F7U B;  4JJN K;  3WVD B;  5GAN 5;  3CCR T;  3G7Z A;  1UGP B;  3QZ9 B;  1AHJ B;  4C8Q C;  2RB6 A;  3MEW A;  5CQY A;  4BI3 A;  1W2B A;  4DA4 A;  2L89 A;  4M7D B;  4XTU A;  1ZBX A;  2EQU A;  2LT4 A;  2RO0 A;  2GFU A;  4QVZ A;  3S6W A;  4F7U F;  3OYB A;  1YHQ T;  1VQL A;  1ZQ1 A;  4PJO D;  1IZ6 A;  4QQD A;  3JCM V;  3CCS A;  4FT4 A;  2LRQ A;  1Y96 B;  4QW2 A;  1VQN T;  4M77 E;  5GAN 3;  2M0O A;  2L8D A;  1X01 A;  1K8A C;  3RKW A;  2HAX A;  2DIG A;  2ZPH B;  3QXE B;  3RKX A;  2HQX A;  4JRQ A;  2R57 A;  4PJO C;  3CCV A;  3BW1 A;  3SFM A;  3M55 A;  4E47 A;  5KH6 A;  4E7L A;  2NLU A;  1M90 U;  1KQ1 A;  1VQO T;  3QZ5 B;  1Q86 C;  2HQE A;  4PLL A;  3OSS C;  4C8Q D;  5GAM j;  3FC3 A;  2LCC A;  4ZGJ B;  5C0M A;  2O4X A;  2BKD N;  4M78 G;  1X75 C;  4C92 G;  3CCJ T;  2I2L A;  4LD6 A;  3OMG A;  1WNL A;  2HNI A;  5CIU A;  5J26 A;  4F7U G;  2FB7 A;  3CEY A;  2XHC A;  3X28 B;  3CME T;  2ZPI B;  1H64 1;  2JNG A;  2RI2 A;  2CZ1 B;  4P5N A;  1YJW T;  3FB9 A;  5GAN g;  2LVM A;  2XU8 A;  3JB9 J;  1I8F A;  4C0G A;  1O75 A;  4BDY A;  2LQK A;  4GY5 A;  4LD9 K;  3J7A F;  1W4S A;  2L5Q A;  3MO8 A;  1Y96 A;  1Y7X A;  4C8Q G;  3CC7 A;  5GAN 4;  4XTY A;  2EKO A;  1RL2 A;  1R8O B;  4FM4 B;  3OYG A;  3LWI A;  2X4J A;  3INZ A;  5GAN d;  1S72 T;  4A4E A;  3CXC S;  3OYY A;  4NS5 A;  1O9S A;  2CYZ B;  2BUD A;  2DTO A;  3LGL A;  3RIR A;  2P4T A;  2ZPE B;  3ME9 A;  3NFC A;  5DLO A;  3OYN A;  3L2W A;  2ZPF B;  1VQ5 A;  3G71 A;  1D3B B;  5GMK m;  2JTM A;  4JDS A;  5LJ5 h;  1YJ9 T;  1NJI U;  2OAU A;  3I55 A;  2E1H A;  1VQ9 A;  2C06 A;  2LNV A;  3URG A;  4PJO G;  3OB9 A;  3JCM g;  4M7A G;  5HY6 A;  2VXE A;  4IUR A;  1VUB A;  1SSF A;  3HRS A;  1NPR A;  1JJ2 S;  2E64 A;  4BE1 A;  5FLX E;  2OTL T;  1HK9 A;  4ZTF A;  2RJE A;  5FU6 B;  2XI9 A;  3ER0 A;  1D3B A;  4C8Q A;  5LL6 S;  1VQ7 A;  3CBP A;  3ZBD A;  4HT9 A;  3MEV A;  1OI1 A;  5CK9 A;  4HT8 A;  2K5F A;  3A8M B;  2X35 A;  1OZ3 A;  2O4X B;  2RJC A;  2QQS A;  3DB4 A;  3PMI A;  4JRK A;  4XU2 A;  5CKB A;  4Z02 A;  4OVA A;  5GAM f;  2IG0 A;  4XTZ A;  1Q7Y U;  1QVF A;  1QVF S;  3JCM P;  3GF5 A;  3KXT A;  4KT0 E;  3OS5 A;  4Q5W A;  1Y07 A;  5KE3 A;  3OA6 A;  3CMA T;  2L3R A;  3KUF A;  3RKY A;  3CCM A;  3GLX A;  1OYX A;  3LGF A;  3DLM A;  2VGM A;  3M54 A;  4M77 F;  2FL7 A;  4M77 G;  1BI2 A;  2RK1 A;  2DXB A;  3OYF A;  3CCQ T;  4LDY A;  2YRV A;  1FX7 A;  3C12 A;  3EFS A;  4EPC A;  3JCM J;  2RI5 A;  3CC4 A;  5A0L A;  4PJO A;  3M57 A;  4IUT A;  2M9U A;  4N4I A;  3HKS A;  1QVG S;  3QSU A;  2GF7 A;  1JRI A;  2E6N A;  3CCU A;  2VXF A;  4XQ3 A;  3VV0 A;  4LDX A;  5GAN j;  3JB9 D;  5AYF A;  5HK3 A;  1VQM A;  4J7F A;  3DKM A;  2DK3 A;  3A8H B;  4M7D A;  4HA8 A;  3OQ5 A;  4RG2 A;  2VC8 A;  4O6J A;  4M78 E;  1XOV A;  2QQA A;  5D6Y A;  5A0G A;  2EYQ A;  4II1 A;  3RER A;  2QA4 A;  3H8Z A;  2VUB A;  3BDL A;  5GMK l;  3G4S T;  1G3Y A;  2PVO B;  4OF1 A;  4RCC A;  3VUZ A;  2ZPB B;  5HKC A;  2K3X A;  1BIB A;  4M7A C;  4J6W A;  4X34 A;  1I4K 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...