5GAN2

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
90
structure length
90
Chain Sequence
b'MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan200
4NOYA 3RKYA 4M7DG 2E41A 1WPYA 2EJ9A 4XU0A 4HA8A 4QVDA 3RUXA 4M77G 5GMKm 1LNXA 4M7DE 4M7DB 3HFNA 5GMKj 2VXFA 4V2SA 1M5Q1 4M75E 1BIAA 1YCYA 3JB9H 4M75B 1M8VA 2K57A 2QTXA 2E65A 1TH7A 4JLIA 3SB2A 3INZA 3JCMh 3JCMb 1I4K1 2E1HA 5GAN8 2EJGA 4M75F 3EFSA 4J6XA 4C92E 4RCBA 3JCMJ 2DXUA 4XQ3A 4NL3A 5GAOl 2YLBA 4XTVA 3RKXA 4M7AD 4OP0A 4F7UE 5GAMg 3V8JA 4HT9A 4F7UB 3AHUA 2DEQA 5LJ3g 3L1AA 4M78A 4C8QD 5GAMf 4WF2A 2DTHA 4C92F 3JCMQ 3JB9F 4PJOE 1KQ2A 5LJ3f 4PJOB 5LJ3e 2RM4A 5GMKl 3PGGA 5GAOp 5GAN4 3BY7A 2HNIA 4XTXA 3V8KA 4M7DD 4M7AF 1WQWA 3JCMW 3FJPA 4M75D 3JCMV 2I2LA 2DKGA 2EJFA 4C8QF 4XTWA 4JRIA 5GAN6 4M77E 1LJOA 2DVEA 4M78G 3L2ZA 4M77B 2DTOA 1MGQA 1B34B 4XTZA 4M78E 4M7DF 2ZGWA 3RKWA 4M78B 4HT8A 4NL2A 3V8LA 5GMKi 3QO3A 4C92D 4M75C 2DZCA 3JB9D 3SWNC 3RESA 1JBMA 3FIFA 4A54A 5GAMd 4EMKC 3BDUA 1WNLA 2VXEA 4JUVA 5LJ3d 5GAMh 3HSBA 3FB9A 3QSUA 2RA2A 5LJ3h 2FYKA 4EMGA 1KQ1A 1JRIA 1D3BA 5GAN2 2YLCA 4PJOD 5I21A 5GAMe 3JB9I 4C92C 5LJ5g 1HK9A 2CGHA 2E10A 5GANg 3QUIA 4F7UF 3M4GA 5LJ5f 5LJ5e 4M7AC 5GANf 3V7RA 5GANe 3BFMA 4N0AC 4M77D 4PJOF 3V7CA 5LJ3j 4XU1A 4C8QC 3JCMP 4XTYA 4PJOC 1Y96A 2FB7A 5GAOr 4M78D 3JB9J 2EWNA 4J6WA 5GAN7 4X9DA 4RCCA 1N9SA 4M7DC 1D3BB 4M75A 2DTIA 3SWNA 1H641 4M77F 2YHTA 3JCMc 1X01A 4M77C 4MMKA 4EMKA 2DXTA 5GAOn 2EAYA 4M78F 3RERA 1U1SA 4J5YA 2VC8A 5GMKe 4DQ2A 5GAOq 5LJ5d 4C92A 2DZ9A 1Y96B 5GANd 1I5LA 4M75G 3GIBA 5LJ5h 1LOJA 4X9CA 1U1TA 5GANh 3VU3C 4F7UA 4XU3A 4M7AA 1HXDA 4N0AA 1WQ7A 4XU2A 3SWNB 4EMHA 3JCMd 5GAMj 4C8QA 4PJOA 1I81A 4EMKB 3JCMg 4XTUA 2DJZA 3BW1A 2RB6A 2E64A 4C92G 5GAN3 3JB9G 5GAN5 4QVCA 5LJ5j 3HFOA 4J6YA 5DY9A 3JCMf 4Y91A 3EFRA 3JCMe 5GANj 4M7DA 2Y90A 4F7UG 4C92B 4PNOA 4MMLA 4A53A 4M7AG 4M77A 3RIRA 3JCMX 5GMKh 1N9RA 1B34A 1BIBA 1I8FA 4JRKA 3V7SA 2RD1A 4PJOG 4C8QG 4M7AB 5GAOm 4M7AE 5CAIA 3QHSA 2JN0A 4C8QE 4M78C 4C8QB
chains in the Genus database with same CATH superfamily
1SEMA 4M7DG 3NPFA 4HA8A 2PVDB 3HFNA 1X75C 1KJWA 2I0NA 1MV0B 1YCYA 1KC8C 2F2WA 4Q5WA 2YSQA 2K2MA 2DM1A 3G71T 4C92E 2PQWA 1LCKA 1OPLA 1RL2A 1Y7XA 2K3BA 1YHQA 3L2VA 2PZ1A 3QDRB 1K73U 2RQUA 2E6ZA 2WACA 2JZ2A 4C0DB 3M4YA 2CUBA 3X28B 3CBOA 1N8RC 1OU8A 1QLYA 2KNBB 2O9SA 3SWNC 1GXIE 2IVWA 4XAXB 2E12A 3L2UA 1OU9A 1OYXA 1NEBA 3HKSA 1YJNA 2QA4T 1ZUKA 3C4SA 2J7IA 2KSSA 1CSKA 1KFZA 3JCMP 1QWFA 2JTMA 4Y28E 2XI9A 3JB9J 2LMJA 2DL7A 5HK3A 3KFVA 2H8HA 4FSSA 1M1KU 3M0RA 2DAQA 1BI0A 1ZBXA 1JXOA 2DIQA 3FDRA 1S72A 2E3HA 1JQQA 4PLLA 4PFZA 1YJWT 4B9XA 1YBYA 2BUDA 1B07A 4OB0B 4C0ZA 1UB4A 3JCMf 3P8DA 4C92B 3X25B 1IXDA 4E6RA 1VQ7Q 4JJCA 2KVQG 2KY9A 3NFCA 5CAIA 5IXBA 3VS6A 3NTKA 1M30A 7AT1B 5FRMA 2COZA 3RDVA 1SHGA 2YRCA 4JJDA 3EG3A 4KGXB 4QQDA 3CCQA 1NZ9A 1VA7A 3CC2A 5HCKA 4RTTA 4J6XA 3O8VA 3CC7A 2DBMA 4OP0A 1R8OB 3N5BB 2C06A 4M78A 5CIUA 4C8QD 1K9MU 2A7YA 3E9FA 2JW4A 3M9QA 3BY7A 2HNIA 4XTXA 3V8KA 1M2VA 1W70A 3OYMA 2EJFA 4JPBW 3G6EA 1QQJA 3OYDA 4PJLA 1QCOA 1OX8A 4L59A 3S6WA 1WDXA 2ZPIB 2KE9A 2JTEA 3FB9A 5KYXB 3UA7A 1GCPA 4F17A 2GCXA 3M4GA 2DILA 4WTOB 2RQWA 3SDZA 1VQ6T 1W1FA 3V7CA 1YIJA 5FW9A 2CREA 2O4XA 5L8RE 3TVTA 3CCRQ 4OMMA 1VQOT 1SRLA 1VQNT 2DD4A 4M78F 5GMKe 2ENMA 3GP8A 2R58A 3NMZC 1U1TA 4OGCA 5DM7R 2GFUA 2B8AA 4PL6A 2HAXA 5CKDA 1WQ7A 4EMKB 4RTYA 5AYFA 2QXFA 1C1AA 4J6YA 3HTRA 1MUZA 1AWXA 3CCLA 1D1AA 2M1HA 5GMKh 2K5IA 1PKSA 2RD1A 4C8QG 2F5KA 1HSQA 3A1PA 3AT1B 4J8OA 3L2RA 2FZCB 4ZGDB 2RK2A 3MKDA 4M77G 2BTTA 4M7DB 1R0CB 2YWWA 2EYZA 1M8VA 3LLRA 1AHJB 2E65A 2F2XA 4CC4B 1I4K1 1Q7YR 4KUDK 2CP2A 2KROA 1Q86C 4ELYC 5GAMg 4F7UB 3AHUA 4FW1A 1GFCA 1C0MA 1QVGS 5IT9E 2CZ6B 2RM4A 2KQWA 2KXCA 3JCMW 2DERA 3VS2A 3OMGA 3PMTA 1D0YA 3OMCA 2EBPA 2RJEA 3GOXA 3M0SA 1B34B 4R56A 1EFNA 2JS0A 3GF5A 3RKWA 1PRMC 2LC4A 3C12A 1BKBA 4YTLA 5LJ3d 1PNJA 1WXTA 2FVUA 2ROLA 2NYSA 2DYBA 1VQ8T 5I21A 2GQIA 3G4SA 3MPUB 2FG0A 3H0IA 3TEEA 4OB1B 3PIPA 2F69A 2CP5A 5LJ5e 3SD4A 1YI2T 1TUCA 2W0ZA 4ZNXA 2PU9B 1TSFA 3CC4T 1KQSS 3CPWA 1AWWA 3MO8A 1IGUA 2HL5C 3OYHA 3Q1JA 4E7ZA 2M0YA 4MMKA 3G7ZA 4C5IA 1M3AA 2EQMA 3CBMA 4FU6A 2OTLT 4C92A 3CCMQ 1PC0A 3PE0A 5LJ5h 1WHJA 1Q81R 1KHCA 4DBQA 3CCVT 4J9HA 3NHNA 2XDBA 4MDXA 2RB6A 1Z9ZA 3JB9G 2AKLA 1GRIA 1ACMB 1QMCA 2Y90A 3CPWP 3JCMX 1VQKT 4M78C 2QQRA 4J9DA 1EIFA 3M0UA 3SHWA 1T3LA 1OPKA 4F14A 5GMKm 5A0GA 3PFSA 4V2SA 2QK0A 4QVZA 4A4EA 4FYXB 2QA4A 4AG2C 4C5EA 2JVVA 1PRLC 1YN8A 5CR2A 4MZTA 3A5ZB 4BI8B 4HT9A 1YITT 1G3SA 5HKCA 2DRKA 4NS5A 4C92F 1KQ2A 4LDUA 3I5SA 3U23A 3OS2A 5GAN4 2EGEA 3OY9A 5KYXA 5KH6A 4M77E 1B7TA 2AK5A 2P4TA 1R77A 1SKUB 3I56Q 1X6OA 4C92D 2DZCA 3OYJA 2X9HA 1NJIU 1M90R 1AWOA 2HBPA 3GLXA 1HJDA 1KQ1A 4IIOA 1SRMA 4OMLA 2Z0WA 1MMDA 3A8OB 3QZ9B 1XNIA 5GANe 4HCZA 3HRUA 4OB2B 2BE7D 2DXBA 1D0ZA 2R57A 1TWBA 4PJJA 3ZFJA 1D3BB 2XDDA 2O9VA 2V1RA 4EMKA 1Y0MA 4HCBA 5GAOq 2DZ9A 4IUTA 5GANh 5CQYA 3KUFA 1K4US 3QYGB 2M9UA 1ABQA 4IUPA 5KCHA 3H9NA 4M7DA 1QKWA 4MMLA 4E2FB 1AZEA 5ECAA 1N9RA 2BZXA 1BIBA 1RAIB 3V7SA 4M7AE 5I2SA 3SEMA 1VQMQ 3CMAQ 4JJBA 4C8QB 2DMOA 1KC8U 4ESRA 2A3LA 1PHTA 2NLUA 2QGFB 1YFNA 2MOXA 1G3TA 4ZTJA 3RUXA 1TUGB 1B3QA 1QKXA 1BIAA 3VRYA 1JXMA 3INZA 5D7UA 2J6FA 2DNUA 2ATCB 1VYVA 2DFUA 3JAME 3CCSQ 1QW1A 3OYLA 1VQ7T 4XQ3A 3RKXA 5KYUB 1ZSGA 2CH4A 1G3YA 1N8RU 1VQNA 1A0NB 1K8AU 2ZPGB 2NWMA 2K4YA 1QCNA 3MP1A 2MIOA 1YJ9Q 1RUWA 4M7DF 2EPDA 1KIKA 5IHKA 2K2VA 2YDLA 3OYYA 3VJPA 5IXFA 3DB3A 3OBWA 1VQLA 5GAN2 3JB9I 4C92C 4A63B 2MCNA 2KT1A 1MNEA 2HL3A 4F7UF 5LJ5f 2KYBA 1M1KR 5LJ3j 1O9SA 4LNPA 4BE2A 5KYYA 4OB3B 4LE9A 2QEXA 1VQ4Q 4BY6C 1PCXA 2A37A 4WCIA 1VQ5A 2P0QA 5CKHA 1SHFA 4GBQA 1M2VB 3SFMA 1IGQA 2D6FA 3QYHB 4Y92A 2MWPA 4XU3A 2DETA 4EPCA 4XU2A 2YUOA 5GAMj 4O5VA 3CCRT 3HFOA 4RG2A 1H3ZA 2VVKA 4DA4A 3QIIA 4DEXA 2DL8A 2JS2A 2G3RA 4FW2A 2YRDA 1Q95G 2O4XB 2VYTA 3I5RA 1V76A 4RTZA 6AT1B 2KMTA 2CDTA 3VS4A 5GAN8 2HSEB 3WXMB 1WJRA 3CXCS 1K9MR 3TSZA 1YHQQ 3GPLA 3NTIA 1YI2A 5GAOl 4IUQA 1E6GA 4CC3A 2EVRA 3L2WA 3JCMQ 3OW2S 2JXBA 2V26A 2QDLA 3UATA 2XIDA 3JCMV 3H6ZA 4JZ3A 3WVEB 1R0BG 3ME9A 4DOVA 4PLIA 1M4ZA 4AMCA 3CCVA 1UUEA 1G2BA 2EGAA 2HSPA 4EMKC 1QP3A 1FMWA 2WSCE 4HKEA 1BCOA 3VS1A 2O01E 1AWJA 4AFQC 5L23A 1D3BA 2K5FA 5CO7A 1MMAA 3QZ5B 2IG0A 2E10A 2HQHA 2DIGA 1W6XA 4O6JA 4D8KA 5GANf 3V7RA 3CMEA 1BU1A 2FPDA 4XU1A 4RMOA 3L42A 4M7DC 4N4IA 3I55A 2ECZA 2L2PA 3DLMA 1U1SA 2VGMA 2VC8A 1S72Q 1Q81C 1Y96B 3J7AF 2JNGA 4BUGA 2KT8A 3VKIA 4C8QA 2LT1A 1RLQC 2KRMA 1XOVA 3A8MB 3CCJQ 1WHLA 3VS5A 3VUZA 3GNGA 2DVJA 4Y91A 2A36A 2C0IA 2VWFA 2LJ0A 4C5GA 1WA7A 4M77A 1WYXA 4PJOG 1TTHB 1OEBA 2PNIA 2LTOA 3CCMT 2JN0A 3A8LB 4LUEA 1WPYA 3A98A 2EYYA 1ZUYA 4QVDA 2VGNA 4BE1A 2VXFA 3CCQQ 5KYUA 4HVWA 1Q86U 3CC2Q 1X6GA 2DLPA 2EJGA 2HD0A 1QVGA 1XTDA 1YWOA 3A8HB 1PD1A 1OZ2A 2L3RA 1GBRA 3MJXA 3S3MA 4QQ6A 1VQPA 1TXQA 2CH4W 2DF6A 1U5SA 1WHKA 2J6OA 1MV3A 5HK0A 4E7IA 3MP6A 3KXTA 1U06A 3MEVA 1U8RA 3LH5A 4BY6B 1UEBA 4C8QF 2GQVA 2H3JA 4FYVB 2FO0A 1QVFS 2P0PA 1WXBA 3RR6A 2K3YA 3C0CA 2XDPA 5GMKi 4PFPA 3PVLA 1QVGP 1M3CA 1JRIA 3IQLA 4J9EA 4M77D 2OTJA 4C0FA 3I56T 2EWNA 2EYQA 2L0AA 1ABOA 2A08A 2FHDA 1C6VX 3JCMc 1KSWA 2LX9A 2MK5A 3P8BB 1OV3A 5GJVB 3RERA 4LXCA 2ZPEB 4GY5A 1AEYA 2X3XD 1OI1A 2W10A 3QBYA 1EX4A 2ZZDA 4N0AA 1KQSP 2J6KA 1IREB 1IRXA 1UDLA 1NPRA 2HCKA 4DEYA 4ZN1A 1OZ3A 4OMPA 3M58A 4X34A 2L5QA 3QXEB 3QJYA 4JZ4A 2DK3A 4FIBA 2EJ9A 1H92A 4K11A 4B6MA 2K3XA 2RNAA 2ZPBB 4J7IA 3CCUQ 1O75A 1Q82C 1K73C 9ATCB 2BE9B 3I9QA 1UECA 2XU8A 4RCBA 2DXUA 4KUIA 3PTAA 1VQMT 5D6YA 4M7AD 3V8JA 3CMAT 2HMAA 5LJ3g 2RHYA 2ZAEA 3JB9F 4PJOE 5C0MA 5DLQE 2L8DA 5FRNA 2X4YA 4FCYA 2EQKA 3X26B 1WQWA 2E6NA 4ZTFA 3CPFA 3CCST 4LDVA 1NJIR 2KGTA 1W2BS 1JO8A 2COYA 2DX1A 2R5MA 3JB9D 3RESA 3FC3A 5DLOA 5A2QE 3CCRA 2ZPFB 3G4SQ 1M3BA 5GAMh 4QW2A 5A0DA 2L89A 3OYBA 1SSHA 3FLGA 2JM9A 2V8KA 5KCOA 1M8MA 3A8GB 1PD0A 1YJ9T 3I35A 2MF2A 3X20B 5CK9A 4C8QC 1Y96A 2EYXA 2QASA 4RG8A 4J6WA 4J9GA 2AT1B 3CD6A 2DTIA 2XK0A 4M77C 1WHHA 3OYCA 1TS9A 2X4WA 4CC2A 2XICA 4DQ2A 5I2MA 4BE0A 4OMQA 4M75G 1RAEB 3E2UA 1VQ4T 1RAAB 2E64A 2R5AA 4QVCA 1VUBA 1PM3A 1KC8R 4EDUA 4M7AG 1PSEA 2X3WD 1WJSA 2IPOB 2DD5A 1NE8A 4JRQA 3G71A 2QG9B 3F70A 3GBQA 3RKYA 2OX7A 4J9CA 2H3EB 4ATOA 1K9AA 1HYOA 5KYYB 3OS5A 4FYWB 3VYHB 3OYEA 2K5LA 5J3BA 4QT7A 1M2OA 2COWA 4F16A 1CKAA 2GFAA 3REAB 3EG2A 3URGA 1X69A 2LCSA 4BDYA 1N8RR 2X4XA 1KD1C 2YLBA 4XTVA 1K8AR 3HPWA 1TOVA 1X2KA 3GNFB 2RJDA 2JJ9A 4JS4A 4JRPA 1VIEA 2CZ1B 2KYMA 1WHGA 3WVDB 3L2ZA 2VUBA 1D1BA 1YHQT 4LN2A 2ZGWA 1VOMA 2NUTA 2OAUA 1AOJA 4LUDA 3VRZA 4LD6A 3BE3A 2YXYA 3LWHA 2CZ0B 2NUPA 3QSUA 3HL8A 5IH2A 2D8HA 4FL6A 2EYWA 2M0OA 3CCMA 3C94A 3BFMA 4N0AC 5IHIA 4E47A 2FB7A 3RBBB 3ASKA 3OB9A 3EH1A 3OYAA 2K7AA 1Z9QA 1YJWA 1FYNA 2DXTA 2J05A 2D9TA 2OJ2A 1LPLA 3JRZA 2QQBA 3PMIA 5LJ5d 4BD3A 2ABLA 2KBTA 2CP3A 1IZ6A 2G6FX 3OYNA 4EMHA 5CCAA 3VV0A 2KXDA 4XTUA 2P0KA 1UTIA 2YT6A 5IAYA 4J83A 3PVQA 2NUZA 1S72T 2KEAA 2VB6A 1D1CA 5KE3A 1ZBJA 2ED0A 1PSFA 1CKBA 1ZUUA 4BDZA 2D1XA 3RNJA 1M5Q1 3LYIA 4M75E 3CCJT 1VQ9Q 1SG5A 2EGCA 3G1JA 2D8JA 4FT2A 2GNCA 1YWPA 3QWYA 1YNZA 2JMCA 2E1HA 1S1NA 3OW2A 1JJ2S 2XD0A 3QG1A 1WHMA 5GAMf 3CCEQ 2F1LA 3CCQT 3UPUA 1V29B 4KGZB 3CC2T 2AKKA 4BB7A 4ME7A 4JRIA 3JV3A 4M77B 2DTOA 5KE2A 3OYGA 4PJMA 1MGQA 2FPEA 2WSFE 4M78E 4HT8A 4JLGA 2LJ3A 5FWBA 1VQ6A 1VQLQ 2QYZA 3FIFA 2WSEE 1AZGB 3OW2P 4JUVA 1MMGA 2RA2A 2RI3A 4KH0B 4AFSC 2LQWA 1WZOA 4R0KA 2HKNA 4J7FA 1ZLMA 4OMOA 1VQOA 2LQ8A 3QUIA 2Y4YA 2YUPA 2QEXQ 1ZA2B 2SRCA 1ZQ1A 2QGGA 2DA9A 1OQKA 1UGSB 2CZ7B 1VQ5Q 1J3TA 1UHCA 3NGPA 3O5ZA 1QVPA 2RHUA 3M54A 1VIFA 5FU6C 2LT4A 1UFFA 3QPHA 2BIVA 2F5TX 1P92A 5GANd 2ED1A 1VQMA 2XHCA 4J9BA 2PVGB 1HXDA 2PUKB 1D0XA 4PJOA 2K9GA 3JCMg 1GBQA 4GLKA 1NPPA 5GAN5 2CP7A 3LX7A 3S3NA 2CSQA 2MPXC 4RKUE 4PNOA 1WGSA 3RIRA 4MZMA 4JRKA 4M7AB 4IUVA 1W4SA 2K6DA 4ZGEB 1Q86R 4ELZC 2E41A 4HCCA 2RI5A 2ZCFB 2OAWA 5GMKj 3FEOA 4JLIA 4AFZC 4J9FA 1K1ZA 3PIOA 2EKHA 2FPFA 3JCMb 1UGPB 2VKNA 1YJ9A 3H0HA 2YRVA 1UGVA 3JCMJ 4PK4A 4LDYA 4NL3A 1RI9A 1BI1A 1T3SA 1IO6A 1UHFA 2FRYA 2EFIA 2J06A 2BZ8A 3VS3A 2RQRA 4KGVB 5GMKl 2O31A 5GAOp 3EG9A 4CI0C 2O2OA 2DKGA 3CCUT 2KR3A 1BK2A 1U3OA 1Q7YC 3TSWA 1VQ8A 1HD3A 2E5QA 1D09B 3CC4A 4KH1B 2FEIA 4PJOD 3S3OA 3CMEQ 5CVIA 3LW5E 4PKCC 4XK8E 1AVZC 3ER0A 2QQSA 3EGXA 4OGEA 2OTLA 3I55Q 2DO3A 4XTYA 2RPNA 2P4RA 2ESWA 4X9DA 1DJ7B 3G4ST 2LDMA 2M02A 1YJNQ 2EAYA 4J9IA 4J5YA 2E3IA 1ARKA 2EKOA 1G3WA 3REBB 1M1FA 1VQKA 4A4KA 4AT1B 4F04B 5LJ5j 1N6AA 2EIFA 2L3SA 2V8JA 4F7UG 2A28A 3EH2A 3FRNA 3JB9H 2B86A 3DB4A 1X2QA 3EG0A 4E7SA 3QHSA 4QKUA 4NOYA 1Q82U 4XU0A 2RN8A 4RUGA 2CT3A 1YITA 3MEAA 2E5KA 3FJ5A 1K8AC 5D6XA 2HDAA 3L2QA 1NM7A 1H3HA 1K0XA 2DRMA 1VQPQ 2JTFA 2VASA 2D0QB 4E7HA 1WXUA 3M57A 3LGLA 4WF2A 3PGGA 1ZSZB 1W2BA 3TU4K 3JSCA 5FWCA 4M4ZA 3M55A 1V1CA 5FU6B 2LCCA 4ORZA 1UE9A 2RF0A 3EG1A 3CC7Q 2FZKB 3V8LA 3QO3A 1NLOC 1TU0B 4A4FA 2VXEA 1UJYA 1G83A 2LNHB 2YLCA 5HY6A 3G6EQ 3HP9A 2OTJQ 2YUNA 3VS0A 1SSFA 4E7KA 4P5NA 1WX6A 1OX9A 4A4HA 1W2BP 4PJOC 2RMOA 3NTHA 2RQTA 4IIMA 3M0QA 3MCAB 4E7JA 1M90C 4M75A 3CCJA 4IKFA 4M77F 2V1QA 4RTVA 3META 1H8KA 2RHIA 3GIBA 2EW3A 1LOJA 3E1SA 1YIJQ 3VU3C 1IHVA 1KQSA 3X24B 2NUTB 4M7AA 1IB8A 3MP8A 2FZGB 1KHIA 2RJCA 2LJ1A 2JOYA 2DJZA 3BW1A 2NUPB 5GANj 2FRWA 4E7LA 4KBMB 1WJQA 2DL5A 5M9OA 1I5OB 3C95A 2RJFA 3QWXX 1IHWA 1VQ7A 3VS7A 3OYKA 2ZPHB 1K0SA 2RO0A 4M7DE 3KBGA 2DL3A 4MZPA 1KD1U 2K57A 2QTXA 4HVVA 2QQ9A 1OULA 3CCLQ 4M75F 2KK4A 3J80E 1XQHA 5CKFA 2RH2A 4F7UE 3MHXA 4KULA 4AG1C 2DTHA 1G8XA 1RADB 2X51A 2E4HA 3HHTB 2X4JA 2PUOB 1VYUA 3LH0A 5LJ3e 2RK1A 4M7AF 1VQ9T 4M75D 2DE0X 1WI7A 5EG2A 3QJ6A 2V8IA 1M1GA 3TQ7P 4Z8AA 2PTKA 3D7SB 4Z88A 3EGDA 1QWEA 3CCET 4HCKA 1ZHIA 5LJ3h 2FYKA 3EFOB 4EMGA 5GAMe 4ZGJB 4FM4B 1HK9A 2JMAA 3UDCA 4BI4A 1NEGA 1RAFB 2CP6A 4FT4A 1KG1A 5KYNA 1F1BB 1YP5A 2K79A 2DXCA 3CD6Q 1FMVA 1NLPC 1I1JA 4FYYB 4VUBA 5GAOr 4M78D 3TREA 1VQLT 3HRSA 5FU7C 1FX7A 4AFUC 1M27C 1M9SA 1OOTA 2GTJA 5GAOn 1NBEB 3EHQA 2L3QA 3OSSC 1SF9A 1UG1A 2OI3A 2XG8D 3MEWA 1M1KC 2QEXT 1TUDA 2JUFA 3CQTA 2IIMA 4BI3A 4LD9K 3SWNB 1VQ5T 4ANJA 4TVRA 3H0FA 1E6HA 5GAN3 4N4HA 2RHXA 5CQXA 3CCUA 4HXJA 5LL6S 3RMQA 3G71Q 3VUBA 2MAMA 2DL4A 2LZ6B 3PT9A 4C5HA 2RQVA 4L6V5 2MWOA 4JDSA 1JJ2A 1PKTA 3UT1A 1ZSZA 2KAFA 4GLMA 1X6BA 1X43A 8ATCB 4DOWA 1MHNA 2JM8A 4BACA 3R6OA 4PJOB 5D6WA 4RTUA 2QA4Q 3FJPA 3OSVA 1JB0E 2CSIA 2PVOB 2Y4XA 1K9MC 4M78G 2YUQA 2AZVA 4RTXA 2CKKA 2QI2A 1JJ2P 4JS5A 5CKBA 1WLPB 1PWTA 4M75C 1NYFA 1RI0A 2QDYB 4ZN3A 5GAMd 1T0HA 3DLLA 3BDUA 1YCSB 3BDLA 5J39A 4IURA 1FMKA 3OS0A 5LJ5g 2CGHA 5I11A 5KYWB 1RACB 2VV5A 4M7AC 2KRNA 1E7OA 2GTOA 1GFDA 1GCQA 1WIEA 1YJWQ 2GF7A 2FL7A 5IHNA 3M5AA 3EHRA 1N9SA 4RCCA 3H41A 1Y71A 2BZYA 2YHTA 3PNWC 2LQNA 3EG9B 3CMET 2M51A 3UF4A 5A0LA 3UWNA 1I5LA 4MDWA 4FSXA 3I55T 5J26A 1MMNA 2SEMA 1GL5A 4C0GA 2MMPA 5IN1A 2CYZB 2MYSA 5FROA 3UA6A 1YJNT 4A53A 2CT4A 3E19A 2HEQA 5GAOm 3H8ZA 4C8QE 3EGXB 4CRIA 1JEGA 5C6SA 2XKOC 1LNXA 1I07A 4II1A 2X35A 3ZEHA 3VYGA 1TH7A 3SB2A 4R55A 4N4GA 3ULRB 3M56A 2CS7A 2M16A 3EFSA 3OA6A 4Z02A 2LCLA 2DEQA 4D6WA 3MEUA 4A4GA 1Q7YU 2QQAA 2DYIA 2GBQA 5LJ3f 2HQXA 3T9NA 2GGRA 5FU7B 3CXCA 3EFOA 5GAN6 1VYTA 5FLXE 3M59A 4DBFA 4LDXA 1VQ6Q 3P8HA 1ZX6A 4PJNA 3ZL7C 1VQPT 1NG2A 2E70A 4KRTA 4NL2A 1QCFA 4PFOA 1K76A 4A54A 1RABB 3I56A 3HSBA 1VQOQ 1VQNQ 2EQUA 4DBRA 1UJ0A 2CUDA 2JT4A 5GANg 3DKMA 3TCJA 1TG0A 4DBHA 4RTWA 3OS1A 3CC7T 3CXCP 5GAN7 4C0DC 2DBKA 3SWNA 2C0OA 1X01A 1UGRB 2EQIA 3CPWS 2EQJA 1Y07A 1RAGB 4D8DA 2AIRB 3G6ET 2HZYA 3CEYA 2OTJT 4KT0E 1XJWB 1SPKA 4EIKA 4OF1A 1KK7A 4F7UA 3OQ5A 2LQKA 4CC7A 2XMFA 5GJWB 4LDWA 4C92G 8AT1B 1ZSZC 1BI2A 1VQ9A 5DY9A 2HQEA 3JCMe 1Q81U 2LRQA 1N27A 2F2VA 1UGQB 3QKJA 1Q82R 1K73R 2L3PA 2LX7A 1B34A 2KRSA 4JJNK 2AHJB 2LNVA 3LGFA 1BYMA 2LP5A 1YIJT 2O88A 1X27A 4X1VA 3CCEA 2AZSA 3CMAA 4M75B 3EAEA 3R6NA 2DJQA 3JCMh 3M53A 4IUUA 2QAZA 3CBPA 2A0FB 3OBYA 4L5GA 1T0JA 2DPPB 4Z89A 3CCSA 3OYFA 1AT1B 4HVUA 3L1AA 4QQGA 3HRTA 1VQ8Q 4M7DD 2RHZA 2I2LA 2BKDN 3M0TA 3OYIA 2HBWA 4XTWA 1LJOA 2DVEA 5CKEA 3CCLT 2KI7A 1GCQC 4XTZA 5KYWA 1YI2Q 4M78B 3CC4Q 1RLPC 2C0TA 1ZA1B 5I22A 3THKA 3RMSA 5AT1B 1JBMA 1WNLA 1EZZB 3M0PA 2MI6A 1BBZA 1QVFA 2OTLQ 2P84A 1M90U 1NJIC 2KDSA 2LVMA 4PJOF 1N5ZA 3CCVQ 1QP2A 4OMFB 4OMNA 1BB9A 4OVAA 3ZBDA 3E9GA 1H641 1BCMA 1RAHB 1VQ4A 1BI3A 3EGUA 1PG5B 2CP0A 1NYGA 2RI2A 1VQKQ 2QTVA 1Y57A 1AD5A 1I0CA 1FXXA 4X9CA 3CD6T 1QVFP 5EC7A 1MNDA 3JCMd 2D0NA 1I81A 2HKQB 3EGDB 3QDFA 2DEUA 1WFWA 3EFRA 4B9WA 1JU5C 4UC4A 2ROTA 3LWIA 3J81E 1I8FA 1LVKA 1G5VA 1FWZA 1KD1R 1YITQ
chains in the Genus database with same CATH topology
1KC8U 3F70A 3RKYA 4M7DG 4ATOA 2A3LA 1VQ7A 3OYKA 2ZPHB 2NLUA 2RO0A 1G3TA 4HA8A 3KBGA 3RUXA 4ZTJA 4M7DE 2PVDB 3OS5A 3VYHB 3HFNA 1X75C 3OYEA 2K5LA 5J3BA 4MZPA 1BIAA 1YCYA 1KD1U 2K57A 2QTXA 2QQ9A 1KC8C 3INZA 2GFAA 4Q5WA 3JAME 4M75F 3URGA 3G71T 1QW1A 2KK4A 3J80E 4C92E 3OYLA 4BDYA 1VQ7T 2PQWA 1XQHA 4XQ3A 2X4XA 1KD1C 2YLBA 4XTVA 2RH2A 5CKFA 3RKXA 1RL2A 1Y7XA 3HPWA 4F7UE 1YHQA 3MHXA 4KULA 3GNFB 3L2VA 2DTHA 2RJDA 3HHTB 2X4JA 1G3YA 2PUOB 3LH0A 5LJ3e 4JS4A 1N8RU 1VQNA 2RK1A 3QDRB 4JRPA 1K73U 1K8AU 4M7AF 1VQ9T 2E6ZA 2ZPGB 1VIEA 2WACA 2CZ1B 2JZ2A 2K4YA 3MP1A 4M75D 4C0DB 3M4YA 3WVDB 3L2ZA 3X28B 2VUBA 3CBOA 5EG2A 3QJ6A 1YHQT 1N8RC 4M7DF 2ZGWA 2OAUA 2V8IA 1M1GA 2K2VA 4LD6A 3SWNC 1GXIE 2IVWA 3OYYA 3LWHA 4XAXB 2E12A 2CZ0B 3VJPA 3CCET 1ZHIA 3QSUA 3HL8A 3L2UA 5LJ3h 3DB3A 1OYXA 2FYKA 3OBWA 4EMGA 1VQLA 4FL6A 3HKSA 5GAN2 1YJNA 2QA4T 5GAMe 4ZGJB 4FM4B 3JB9I 4C92C 1HK9A 3UDCA 4BI4A 4F7UF 2M0OA 4FT4A 3C4SA 5LJ5f 3CCMA 1KG1A 3C94A 3BFMA 2KSSA 4N0AC 2DXCA 5LJ3j 1O9SA 3JCMP 4VUBA 2JTMA 4E47A 2FB7A 4Y28E 2XI9A 4BE2A 4M78D 5GAOr 4OB3B 3TREA 2QEXA 3JB9J 4BY6C 3ASKA 3OB9A 5HK3A 1VQLT 3HRSA 3OYAA 5FU7C 1FX7A 1M9SA 1M1KU 1VQ5A 2P0QA 5CKHA 1YJWA 2DAQA 2DXTA 5GAOn 2D9TA 1BI0A 1ZBXA 3SFMA 3JRZA 2QQBA 3OSSC 2D6FA 3PMIA 2DIQA 5LJ5d 4BD3A 2XG8D 3MEWA 3QYHB 1M1KC 2QEXT 3FDRA 1IZ6A 2JUFA 2MWPA 1S72A 4XU3A 4BI3A 4PLLA 4LD9K 3SWNB 4XU2A 4EPCA 3OYNA 4EMHA 4TVRA 5CCAA 5GAMj 4B9XA 1YJWT 1YBYA 2BUDA 4O5VA 3VV0A 4OB0B 4XTUA 4C0ZA 3CCRT 1UB4A 2P0KA 4N4HA 5GAN3 2RHXA 3HFOA 5CQXA 3P8DA 4RG2A 3JCMf 1H3ZA 3CCUA 5LL6S 5IAYA 3RMQA 4C92B 4J83A 3X25B 4DA4A 1S72T 3QIIA 3VUBA 2KVQG 2KY9A 3NFCA 5CAIA 2MAMA 5KE3A 3NTKA 1PSFA 3PT9A 5FRMA 4BDZA 4C5HA 2G3RA 2O4XB 2VYTA 4L6V5 2MWOA 1M5Q1 2KMTA 3LYIA 4M75E 4JDSA 3CCJT 1JJ2A 4FT2A 3UT1A 4QQDA 3CCQA 2E1HA 5GAN8 1NZ9A 3WXMB 1WJRA 3CXCS 3CC2A 4J6XA 3GPLA 3OW2A 1JJ2S 2KAFA 3NTIA 1YI2A 3O8VA 5GAOl 3CC7A 4IUQA 2XD0A 4M7AD 4OP0A 3QG1A 4DOWA 1MHNA 1R8OB 3N5BB 2C06A 4M78A 5CIUA 4C8QD 3L2WA 5GAMf 3JCMQ 4BACA 2A7YA 3R6OA 3OW2S 1K9MU 3E9FA 4PJOB 3M9QA 5D6WA 3CCQT 3BY7A 2HNIA 4XTXA 3V8KA 3UPUA 1V29B 3FJPA 3OSVA 2XIDA 3CC2T 1JB0E 3JCMV 3OYMA 4BB7A 2EJFA 4ME7A 3H6ZA 3G6EA 2PVOB 4JRIA 2Y4XA 3WVEB 1K9MC 3ME9A 4M78G 4DOVA 4M77B 2DTOA 5KE2A 3OYGA 1MGQA 4PLIA 2CKKA 3OYDA 2QI2A 2WSFE 4M78E 4JS5A 1M4ZA 4HT8A 5CKBA 4JLGA 3CCVA 4M75C 4L59A 3S6WA 1VQ6A 4ZN3A 1RI0A 2QDYB 3FIFA 2WSEE 5GAMd 3DLLA 4EMKC 3BDUA 1QP3A 4JUVA 2ZPIB 2WSCE 3FB9A 4HKEA 2O01E 2RA2A 2RI3A 3BDLA 1D3BA 5J39A 4IURA 2K5FA 5CO7A 4J7FA 3QZ5B 3OS0A 2IG0A 5LJ5g 2CGHA 2E10A 1VQOA 2LQ8A 3QUIA 2Y4YA 2GCXA 2VV5A 2DIGA 3M4GA 4O6JA 4M7AC 5GANf 3V7RA 3CMEA 1ZQ1A 3SDZA 1VQ6T 1YIJA 3V7CA 4XU1A 1UGSB 2CZ7B 4RMOA 2GF7A 2O4XA 2FL7A 5L8RE 3M5AA 4RCCA 1N9SA 3L42A 4M7DC 1QVPA 2RHUA 3M54A 4N4IA 3I55A 1Y71A 2YHTA 1VIFA 1VQOT 5FU6C 3PNWC 2LT4A 1VQNT 3DLMA 2DD4A 4M78F 3QPHA 1U1SA 3CMET 2BIVA 2VGMA 2VC8A 5GMKe 1Q81C 3GP8A 2R58A 5A0LA 2F5TX 1P92A 3UWNA 5GANd 1Y96B 3J7AF 2JNGA 4MDWA 4BUGA 1VQMA 1I5LA 2XHCA 1U1TA 4OGCA 3VKIA 5DM7R 2GFUA 2B8AA 4PL6A 2PVGB 2HAXA 4FSXA 3I55T 1HXDA 2PUKB 5CKDA 1WQ7A 5J26A 4C8QA 4PJOA 4EMKB 2LT1A 3A8MB 1XOVA 3JCMg 4GLKA 1NPPA 5AYFA 2MMPA 5IN1A 2CYZB 2QXFA 3LX7A 3VUZA 3GNGA 4J6YA 4Y91A 5GAN5 3S3NA 5FROA 4RKUE 4C5GA 4PNOA 4A53A 1YJNT 1WGSA 3CCLA 4M77A 3RIRA 2M1HA 3E19A 4MZMA 5GMKh 2K5IA 4JRKA 4C8QG 2RD1A 4PJOG 5GAOm 2F5KA 4M7AB 4J8OA 3H8ZA 3L2RA 4IUVA 2LTOA 3CCMT 2JN0A 1W4SA 4C8QE 4ZGEB 4CRIA 3A8LB 4ELZC 2E41A 4ZGDB 1WPYA 4HCCA 2RK2A 2RI5A 2ZCFB 5C6SA 2XKOC 4QVDA 2VGNA 4M77G 4BE1A 1LNXA 4M7DB 5GMKj 2VXFA 4II1A 2X35A 3ZEHA 1M8VA 1Q86U 3LLRA 3VYGA 1AHJB 1TH7A 2E65A 3FEOA 4JLIA 3SB2A 4R55A 3PIOA 4N4GA 3JCMb 1I4K1 1UGPB 2EJGA 1YJ9A 2HD0A 3M56A 4KUDK 2YRVA 1QVGA 1XTDA 2CS7A 2M16A 3EFSA 3JCMJ 4LDYA 3A8HB 3OA6A 1OZ2A 4Z02A 4NL3A 1Q86C 2L3RA 2LCLA 4ELYC 1BI1A 5GAMg 3S3MA 4F7UB 4QQ6A 3AHUA 2DEQA 4D6WA 1VQPA 3MEUA 4A4GA 1Q7YU 1QVGS 5IT9E 2QQAA 2EFIA 2CZ6B 5LJ3f 2RM4A 5HK0A 5GMKl 5GAOp 4E7IA 3MP6A 2HQXA 3T9NA 3MEVA 3KXTA 2KQWA 1U8RA 4BY6B 3JCMW 4CI0C 1UEBA 5FU7B 2DKGA 3OMGA 3PMTA 2GQVA 2H3JA 4C8QF 3OMCA 5GAN6 3CXCA 3CCUT 5FLXE 1Q7YC 3M59A 1QVFS 1VQ8A 4LDXA 2RJEA 3GOXA 3P8HA 1B34B 2P0PA 4R56A 1VQPT 3GF5A 3RKWA 2K3YA 2E70A 2XDPA 4NL2A 5GMKi 2E5QA 2LC4A 3C12A 1BKBA 4A54A 4YTLA 3CC4A 5LJ3d 1Q81U 3I56A 3HSBA 2FVUA 2EQUA 1JRIA 4PJOD 3S3OA 1VQ8T 5CVIA 3LW5E 5I21A 4PKCC 1VQ5T 3G4SA 4XK8E 5GANg 3ER0A 3DKMA 3TEEA 3TCJA 4OB1B 3PIPA 2QQSA 2F69A 5LJ5e 4OGEA 4M77D 3SD4A 2OTLA 3OS1A 1YI2T 2OTJA 2DO3A 4XTYA 4C0FA 2PU9B 3CC4T 3CC7T 3I56T 3CPWA 1KQSS 2EWNA 2EYQA 3MO8A 5GAN7 4X9DA 4C0DC 1DJ7B 2FHDA 3SWNA 3OYHA 3Q1JA 3G4ST 2LDMA 3JCMc 1X01A 2LX9A 4MMKA 3P8BB 1UGRB 3G7ZA 4C5IA 2EAYA 2EQJA 3CPWS 1Y07A 3RERA 4J5YA 3CBMA 2EQMA 3G71A 4FU6A 2OTLT 3G6ET 2ZPEB 4GY5A 3CEYA 2OTJT 4KT0E 4C92A 2EKOA 4OF1A 5LJ5h 1OI1A 1G3WA 4F7UA 3QBYA 1KHCA 1M1FA 1VQKA 4N0AA 2ZZDA 3CCVT 3OQ5A 4A4KA 2LQKA 1IREB 2XDBA 1NPRA 4MDXA 4LDWA 2RB6A 4C92G 1BI2A 3JB9G 1VQ9A 5LJ5j 5DY9A 1N6AA 2HQEA 3JCMe 2EIFA 1N27A 2LRQA 2V8JA 1UGQB 2Y90A 4F7UG 4ZN1A 3QKJA 1OZ3A 3M58A 4X34A 3FRNA 3JCMX 1B34A 2L5QA 3JB9H 3DB4A 3QXEB 3QJYA 4JJNK 2AHJB 2LNVA 3LGFA 3QHSA 1VQKT 2DK3A 4FIBA 4M78C 2QQRA 1BYMA 4NOYA 1YIJT 1EIFA 2EJ9A 1Q82U 4XU0A 5GMKm 3CCEA 5A0GA 3CMAA 1YITA 3PFSA 4V2SA 3MEAA 4QVZA 4A4EA 2K3XA 4M75B 3EAEA 2ZPBB 2QA4A 4J7IA 4C5EA 1O75A 3JCMh 3M53A 1Q82C 1K73C 1K8AC 4IUUA 5D6XA 3CBPA 2JVVA 3L2QA 2XU8A 2JTFA 4RCBA 2DXUA 3OBYA 4L5GA 2D0QB 1NE8A 2DPPB 4KUIA 5CR2A 5D6YA 3PTAA 1VQMT 4E7HA 3CCSA 3M57A 3A5ZB 4MZTA 3V8JA 4BI8B 3OYFA 1YITT 3CMAT 4HT9A 1G3SA 5LJ3g 3L1AA 4QQGA 5HKCA 3LGLA 2RHYA 4NS5A 4WF2A 4C92F 3JB9F 4PJOE 5C0MA 5DLQE 2L8DA 3HRTA 4LDUA 1KQ2A 5FRNA 3PGGA 2X4YA 3OS2A 5GAN4 4M7DD 3OY9A 2EQKA 3X26B 1WQWA 2RHZA 1W2BA 2E6NA 4ZTFA 3TU4K 2I2LA 2BKDN 3JSCA 3OYIA 5KH6A 4XTWA 4M77E 1LJOA 2DVEA 3M55A 3CPFA 5CKEA 3CCLT 5FU6B 3CCST 2P4TA 4LDVA 4XTZA 2LCCA 4M78B 1W2BS 3V8LA 2R5MA 1X6OA 3QO3A 4C92D 2DZCA 3JB9D 3OYJA 3RESA 3RMSA 1JBMA 5DLOA 3FC3A 5A2QE 3CCRA 1WNLA 2ZPFB 2VXEA 4A4FA 5GAMh 1NJIU 4QW2A 2HBPA 5A0DA 2L89A 3GLXA 2MI6A 1KQ1A 3FLGA 3OYBA 2YLCA 2V8KA 5HY6A 5KCOA 1QVFA 3HP9A 3A8OB 3A8GB 3QZ9B 1SSFA 1M90U 1NJIC 2KDSA 1YJ9T 4E7KA 4P5NA 1XNIA 5GANe 2LVMA 4HCZA 2MF2A 3HRUA 4A4HA 4OB2B 3X20B 4PJOF 5CK9A 2DXBA 4C8QC 4PJOC 1Y96A 3NTHA 1QP2A 4OMFB 2R57A 4RG8A 3MCAB 4J6WA 4OVAA 4E7JA 3ZBDA 3ZFJA 3CD6A 1D3BB 3E9GA 4M75A 2XDDA 3CCJA 1M90C 2DTIA 4IKFA 1H641 4M77F 2XK0A 4M77C 3OYCA 4EMKA 1VQ4A 2X4WA 1BI3A 3META 2XICA 4DQ2A 4HCBA 5I2MA 4BE0A 2RI2A 5GAOq 2RHIA 2DZ9A 4IUTA 4M75G 3GIBA 1FXXA 1LOJA 4X9CA 3E1SA 5GANh 3VU3C 1KQSA 3X24B 5CQYA 3CD6T 4M7AA 3MP8A 4C0GA 3JCMd 3KUFA 1KHIA 1I81A 2M9UA 3QYGB 4IUPA 5KCHA 1VQ4T 2RJCA 2JOYA 2DJZA 3BW1A 2E64A 2R5AA 4QVCA 4M7DA 1VUBA 5GANj 4B9WA 3EFRA 4UC4A 4MMLA 4EDUA 4E7LA 4M7AG 3LWIA 4KBMB 1WJQA 5M9OA 3J81E 1N9RA 1PSEA 1BIBA 1I8FA 1WJSA 3C95A 3V7SA 5I2SA 4M7AE 1G5VA 1FWZA 2RJFA 2DD5A 4JRQA 4C8QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NOY A;  3RKY A;  4M7D G;  2E41 A;  1WPY A;  2EJ9 A;  4XU0 A;  4HA8 A;  4QVD A;  3RUX A;  4M77 G;  5GMK m;  1LNX A;  4M7D E;  4M7D B;  3HFN A;  5GMK j;  2VXF A;  4V2S A;  1M5Q 1;  4M75 E;  1BIA A;  1YCY A;  3JB9 H;  4M75 B;  1M8V A;  2K57 A;  2QTX A;  2E65 A;  1TH7 A;  4JLI A;  3SB2 A;  3INZ A;  3JCM h;  3JCM b;  1I4K 1;  2E1H A;  5GAN 8;  2EJG A;  4M75 F;  3EFS A;  4J6X A;  4C92 E;  4RCB A;  3JCM J;  2DXU A;  4XQ3 A;  4NL3 A;  5GAO l;  2YLB A;  4XTV A;  3RKX A;  4M7A D;  4OP0 A;  4F7U E;  5GAM g;  3V8J A;  4HT9 A;  4F7U B;  3AHU A;  2DEQ A;  5LJ3 g;  3L1A A;  4M78 A;  4C8Q D;  5GAM f;  4WF2 A;  2DTH A;  4C92 F;  3JCM Q;  3JB9 F;  4PJO E;  1KQ2 A;  5LJ3 f;  4PJO B;  5LJ3 e;  2RM4 A;  5GMK l;  3PGG A;  5GAO p;  5GAN 4;  3BY7 A;  2HNI A;  4XTX A;  3V8K A;  4M7D D;  4M7A F;  1WQW A;  3JCM W;  3FJP A;  4M75 D;  3JCM V;  2I2L A;  2DKG A;  2EJF A;  4C8Q F;  4XTW A;  4JRI A;  5GAN 6;  4M77 E;  1LJO A;  2DVE A;  4M78 G;  3L2Z A;  4M77 B;  2DTO A;  1MGQ A;  1B34 B;  4XTZ A;  4M78 E;  4M7D F;  2ZGW A;  3RKW A;  4M78 B;  4HT8 A;  4NL2 A;  3V8L A;  5GMK i;  3QO3 A;  4C92 D;  4M75 C;  2DZC A;  3JB9 D;  3SWN C;  3RES A;  1JBM A;  3FIF A;  4A54 A;  5GAM d;  4EMK C;  3BDU A;  1WNL A;  2VXE A;  4JUV A;  5LJ3 d;  5GAM h;  3HSB A;  3FB9 A;  3QSU A;  2RA2 A;  5LJ3 h;  2FYK A;  4EMG A;  1KQ1 A;  1JRI A;  1D3B A;  5GAN 2;  2YLC A;  4PJO D;  5I21 A;  5GAM e;  3JB9 I;  4C92 C;  5LJ5 g;  1HK9 A;  2CGH A;  2E10 A;  5GAN g;  3QUI A;  4F7U F;  3M4G A;  5LJ5 f;  5LJ5 e;  4M7A C;  5GAN f;  3V7R A;  5GAN e;  3BFM A;  4N0A C;  4M77 D;  4PJO F;  3V7C A;  5LJ3 j;  4XU1 A;  4C8Q C;  3JCM P;  4XTY A;  4PJO C;  1Y96 A;  2FB7 A;  5GAO r;  4M78 D;  3JB9 J;  2EWN A;  4J6W A;  5GAN 7;  4X9D A;  4RCC A;  1N9S A;  4M7D C;  1D3B B;  4M75 A;  2DTI A;  3SWN A;  1H64 1;  4M77 F;  2YHT A;  3JCM c;  1X01 A;  4M77 C;  4MMK A;  4EMK A;  2DXT A;  5GAO n;  2EAY A;  4M78 F;  3RER A;  1U1S A;  4J5Y A;  2VC8 A;  5GMK e;  4DQ2 A;  5GAO q;  5LJ5 d;  4C92 A;  2DZ9 A;  1Y96 B;  5GAN d;  1I5L A;  4M75 G;  3GIB A;  5LJ5 h;  1LOJ A;  4X9C A;  1U1T A;  5GAN h;  3VU3 C;  4F7U A;  4XU3 A;  4M7A A;  1HXD A;  4N0A A;  1WQ7 A;  4XU2 A;  3SWN B;  4EMH A;  3JCM d;  5GAM j;  4C8Q A;  4PJO A;  1I81 A;  4EMK B;  3JCM g;  4XTU A;  2DJZ A;  3BW1 A;  2RB6 A;  2E64 A;  4C92 G;  5GAN 3;  3JB9 G;  5GAN 5;  4QVC A;  5LJ5 j;  3HFO A;  4J6Y A;  5DY9 A;  3JCM f;  4Y91 A;  3EFR A;  3JCM e;  5GAN j;  4M7D A;  2Y90 A;  4F7U G;  4C92 B;  4PNO A;  4MML A;  4A53 A;  4M7A G;  4M77 A;  3RIR A;  3JCM X;  5GMK h;  1N9R A;  1B34 A;  1BIB A;  1I8F A;  4JRK A;  3V7S A;  2RD1 A;  4PJO G;  4C8Q G;  4M7A B;  5GAO m;  4M7A E;  5CAI A;  3QHS A;  2JN0 A;  4C8Q E;  4M78 C;  4C8Q B; 
#chains in the Genus database with same CATH topology
 1SEM A;  4M7D G;  3NPF A;  4HA8 A;  2PVD B;  3HFN A;  1X75 C;  1KJW A;  2I0N A;  1MV0 B;  1YCY A;  1KC8 C;  2F2W A;  4Q5W A;  2YSQ A;  2K2M A;  2DM1 A;  3G71 T;  4C92 E;  2PQW A;  1LCK A;  1OPL A;  1RL2 A;  1Y7X A;  2K3B A;  1YHQ A;  3L2V A;  2PZ1 A;  3QDR B;  1K73 U;  2RQU A;  2E6Z A;  2WAC A;  2JZ2 A;  4C0D B;  3M4Y A;  2CUB A;  3X28 B;  3CBO A;  1N8R C;  1OU8 A;  1QLY A;  2KNB B;  2O9S A;  3SWN C;  1GXI E;  2IVW A;  4XAX B;  2E12 A;  3L2U A;  1OU9 A;  1OYX A;  1NEB A;  3HKS A;  1YJN A;  2QA4 T;  1ZUK A;  3C4S A;  2J7I A;  2KSS A;  1CSK A;  1KFZ A;  3JCM P;  1QWF A;  2JTM A;  4Y28 E;  2XI9 A;  3JB9 J;  2LMJ A;  2DL7 A;  5HK3 A;  3KFV A;  2H8H A;  4FSS A;  1M1K U;  3M0R A;  2DAQ A;  1BI0 A;  1ZBX A;  1JXO A;  2DIQ A;  3FDR A;  1S72 A;  2E3H A;  1JQQ A;  4PLL A;  4PFZ A;  1YJW T;  4B9X A;  1YBY A;  2BUD A;  1B07 A;  4OB0 B;  4C0Z A;  1UB4 A;  3JCM f;  3P8D A;  4C92 B;  3X25 B;  1IXD A;  4E6R A;  1VQ7 Q;  4JJC A;  2KVQ G;  2KY9 A;  3NFC A;  5CAI A;  5IXB A;  3VS6 A;  3NTK A;  1M30 A;  7AT1 B;  5FRM A;  2COZ A;  3RDV A;  1SHG A;  2YRC A;  4JJD A;  3EG3 A;  4KGX B;  4QQD A;  3CCQ A;  1NZ9 A;  1VA7 A;  3CC2 A;  5HCK A;  4RTT A;  4J6X A;  3O8V A;  3CC7 A;  2DBM A;  4OP0 A;  1R8O B;  3N5B B;  2C06 A;  4M78 A;  5CIU A;  4C8Q D;  1K9M U;  2A7Y A;  3E9F A;  2JW4 A;  3M9Q A;  3BY7 A;  2HNI A;  4XTX A;  3V8K A;  1M2V A;  1W70 A;  3OYM A;  2EJF A;  4JPB W;  3G6E A;  1QQJ A;  3OYD A;  4PJL A;  1QCO A;  1OX8 A;  4L59 A;  3S6W A;  1WDX A;  2ZPI B;  2KE9 A;  2JTE A;  3FB9 A;  5KYX B;  3UA7 A;  1GCP A;  4F17 A;  2GCX A;  3M4G A;  2DIL A;  4WTO B;  2RQW A;  3SDZ A;  1VQ6 T;  1W1F A;  3V7C A;  1YIJ A;  5FW9 A;  2CRE A;  2O4X A;  5L8R E;  3TVT A;  3CCR Q;  4OMM A;  1VQO T;  1SRL A;  1VQN T;  2DD4 A;  4M78 F;  5GMK e;  2ENM A;  3GP8 A;  2R58 A;  3NMZ C;  1U1T A;  4OGC A;  5DM7 R;  2GFU A;  2B8A A;  4PL6 A;  2HAX A;  5CKD A;  1WQ7 A;  4EMK B;  4RTY A;  5AYF A;  2QXF A;  1C1A A;  4J6Y A;  3HTR A;  1MUZ A;  1AWX A;  3CCL A;  1D1A A;  2M1H A;  5GMK h;  2K5I A;  1PKS A;  2RD1 A;  4C8Q G;  2F5K A;  1HSQ A;  3A1P A;  3AT1 B;  4J8O A;  3L2R A;  2FZC B;  4ZGD B;  2RK2 A;  3MKD A;  4M77 G;  2BTT A;  4M7D B;  1R0C B;  2YWW A;  2EYZ A;  1M8V A;  3LLR A;  1AHJ B;  2E65 A;  2F2X A;  4CC4 B;  1I4K 1;  1Q7Y R;  4KUD K;  2CP2 A;  2KRO A;  1Q86 C;  4ELY C;  5GAM g;  4F7U B;  3AHU A;  4FW1 A;  1GFC A;  1C0M A;  1QVG S;  5IT9 E;  2CZ6 B;  2RM4 A;  2KQW A;  2KXC A;  3JCM W;  2DER A;  3VS2 A;  3OMG A;  3PMT A;  1D0Y A;  3OMC A;  2EBP A;  2RJE A;  3GOX A;  3M0S A;  1B34 B;  4R56 A;  1EFN A;  2JS0 A;  3GF5 A;  3RKW A;  1PRM C;  2LC4 A;  3C12 A;  1BKB A;  4YTL A;  5LJ3 d;  1PNJ A;  1WXT A;  2FVU A;  2ROL A;  2NYS A;  2DYB A;  1VQ8 T;  5I21 A;  2GQI A;  3G4S A;  3MPU B;  2FG0 A;  3H0I A;  3TEE A;  4OB1 B;  3PIP A;  2F69 A;  2CP5 A;  5LJ5 e;  3SD4 A;  1YI2 T;  1TUC A;  2W0Z A;  4ZNX A;  2PU9 B;  1TSF A;  3CC4 T;  1KQS S;  3CPW A;  1AWW A;  3MO8 A;  1IGU A;  2HL5 C;  3OYH A;  3Q1J A;  4E7Z A;  2M0Y A;  4MMK A;  3G7Z A;  4C5I A;  1M3A A;  2EQM A;  3CBM A;  4FU6 A;  2OTL T;  4C92 A;  3CCM Q;  1PC0 A;  3PE0 A;  5LJ5 h;  1WHJ A;  1Q81 R;  1KHC A;  4DBQ A;  3CCV T;  4J9H A;  3NHN A;  2XDB A;  4MDX A;  2RB6 A;  1Z9Z A;  3JB9 G;  2AKL A;  1GRI A;  1ACM B;  1QMC A;  2Y90 A;  3CPW P;  3JCM X;  1VQK T;  4M78 C;  2QQR A;  4J9D A;  1EIF A;  3M0U A;  3SHW A;  1T3L A;  1OPK A;  4F14 A;  5GMK m;  5A0G A;  3PFS A;  4V2S A;  2QK0 A;  4QVZ A;  4A4E A;  4FYX B;  2QA4 A;  4AG2 C;  4C5E A;  2JVV A;  1PRL C;  1YN8 A;  5CR2 A;  4MZT A;  3A5Z B;  4BI8 B;  4HT9 A;  1YIT T;  1G3S A;  5HKC A;  2DRK A;  4NS5 A;  4C92 F;  1KQ2 A;  4LDU A;  3I5S A;  3U23 A;  3OS2 A;  5GAN 4;  2EGE A;  3OY9 A;  5KYX A;  5KH6 A;  4M77 E;  1B7T A;  2AK5 A;  2P4T A;  1R77 A;  1SKU B;  3I56 Q;  1X6O A;  4C92 D;  2DZC A;  3OYJ A;  2X9H A;  1NJI U;  1M90 R;  1AWO A;  2HBP A;  3GLX A;  1HJD A;  1KQ1 A;  4IIO A;  1SRM A;  4OML A;  2Z0W A;  1MMD A;  3A8O B;  3QZ9 B;  1XNI A;  5GAN e;  4HCZ A;  3HRU A;  4OB2 B;  2BE7 D;  2DXB A;  1D0Z A;  2R57 A;  1TWB A;  4PJJ A;  3ZFJ A;  1D3B B;  2XDD A;  2O9V A;  2V1R A;  4EMK A;  1Y0M A;  4HCB A;  5GAO q;  2DZ9 A;  4IUT A;  5GAN h;  5CQY A;  3KUF A;  1K4U S;  3QYG B;  2M9U A;  1ABQ A;  4IUP A;  5KCH A;  3H9N A;  4M7D A;  1QKW A;  4MML A;  4E2F B;  1AZE A;  5ECA A;  1N9R A;  2BZX A;  1BIB A;  1RAI B;  3V7S A;  4M7A E;  5I2S A;  3SEM A;  1VQM Q;  3CMA Q;  4JJB A;  4C8Q B;  2DMO A;  1KC8 U;  4ESR A;  2A3L A;  1PHT A;  2NLU A;  2QGF B;  1YFN A;  2MOX A;  1G3T A;  4ZTJ A;  3RUX A;  1TUG B;  1B3Q A;  1QKX A;  1BIA A;  3VRY A;  1JXM A;  3INZ A;  5D7U A;  2J6F A;  2DNU A;  2ATC B;  1VYV A;  2DFU A;  3JAM E;  3CCS Q;  1QW1 A;  3OYL A;  1VQ7 T;  4XQ3 A;  3RKX A;  5KYU B;  1ZSG A;  2CH4 A;  1G3Y A;  1N8R U;  1VQN A;  1A0N B;  1K8A U;  2ZPG B;  2NWM A;  2K4Y A;  1QCN A;  3MP1 A;  2MIO A;  1YJ9 Q;  1RUW A;  4M7D F;  2EPD A;  1KIK A;  5IHK A;  2K2V A;  2YDL A;  3OYY A;  3VJP A;  5IXF A;  3DB3 A;  3OBW A;  1VQL A;  5GAN 2;  3JB9 I;  4C92 C;  4A63 B;  2MCN A;  2KT1 A;  1MNE A;  2HL3 A;  4F7U F;  5LJ5 f;  2KYB A;  1M1K R;  5LJ3 j;  1O9S A;  4LNP A;  4BE2 A;  5KYY A;  4OB3 B;  4LE9 A;  2QEX A;  1VQ4 Q;  4BY6 C;  1PCX A;  2A37 A;  4WCI A;  1VQ5 A;  2P0Q A;  5CKH A;  1SHF A;  4GBQ A;  1M2V B;  3SFM A;  1IGQ A;  2D6F A;  3QYH B;  4Y92 A;  2MWP A;  4XU3 A;  2DET A;  4EPC A;  4XU2 A;  2YUO A;  5GAM j;  4O5V A;  3CCR T;  3HFO A;  4RG2 A;  1H3Z A;  2VVK A;  4DA4 A;  3QII A;  4DEX A;  2DL8 A;  2JS2 A;  2G3R A;  4FW2 A;  2YRD A;  1Q95 G;  2O4X B;  2VYT A;  3I5R A;  1V76 A;  4RTZ A;  6AT1 B;  2KMT A;  2CDT A;  3VS4 A;  5GAN 8;  2HSE B;  3WXM B;  1WJR A;  3CXC S;  1K9M R;  3TSZ A;  1YHQ Q;  3GPL A;  3NTI A;  1YI2 A;  5GAO l;  4IUQ A;  1E6G A;  4CC3 A;  2EVR A;  3L2W A;  3JCM Q;  3OW2 S;  2JXB A;  2V26 A;  2QDL A;  3UAT A;  2XID A;  3JCM V;  3H6Z A;  4JZ3 A;  3WVE B;  1R0B G;  3ME9 A;  4DOV A;  4PLI A;  1M4Z A;  4AMC A;  3CCV A;  1UUE A;  1G2B A;  2EGA A;  2HSP A;  4EMK C;  1QP3 A;  1FMW A;  2WSC E;  4HKE A;  1BCO A;  3VS1 A;  2O01 E;  1AWJ A;  4AFQ C;  5L23 A;  1D3B A;  2K5F A;  5CO7 A;  1MMA A;  3QZ5 B;  2IG0 A;  2E10 A;  2HQH A;  2DIG A;  1W6X A;  4O6J A;  4D8K A;  5GAN f;  3V7R A;  3CME A;  1BU1 A;  2FPD A;  4XU1 A;  4RMO A;  3L42 A;  4M7D C;  4N4I A;  3I55 A;  2ECZ A;  2L2P A;  3DLM A;  1U1S A;  2VGM A;  2VC8 A;  1S72 Q;  1Q81 C;  1Y96 B;  3J7A F;  2JNG A;  4BUG A;  2KT8 A;  3VKI A;  4C8Q A;  2LT1 A;  1RLQ C;  2KRM A;  1XOV A;  3A8M B;  3CCJ Q;  1WHL A;  3VS5 A;  3VUZ A;  3GNG A;  2DVJ A;  4Y91 A;  2A36 A;  2C0I A;  2VWF A;  2LJ0 A;  4C5G A;  1WA7 A;  4M77 A;  1WYX A;  4PJO G;  1TTH B;  1OEB A;  2PNI A;  2LTO A;  3CCM T;  2JN0 A;  3A8L B;  4LUE A;  1WPY A;  3A98 A;  2EYY A;  1ZUY A;  4QVD A;  2VGN A;  4BE1 A;  2VXF A;  3CCQ Q;  5KYU A;  4HVW A;  1Q86 U;  3CC2 Q;  1X6G A;  2DLP A;  2EJG A;  2HD0 A;  1QVG A;  1XTD A;  1YWO A;  3A8H B;  1PD1 A;  1OZ2 A;  2L3R A;  1GBR A;  3MJX A;  3S3M A;  4QQ6 A;  1VQP A;  1TXQ A;  2CH4 W;  2DF6 A;  1U5S A;  1WHK A;  2J6O A;  1MV3 A;  5HK0 A;  4E7I A;  3MP6 A;  3KXT A;  1U06 A;  3MEV A;  1U8R A;  3LH5 A;  4BY6 B;  1UEB A;  4C8Q F;  2GQV A;  2H3J A;  4FYV B;  2FO0 A;  1QVF S;  2P0P A;  1WXB A;  3RR6 A;  2K3Y A;  3C0C A;  2XDP A;  5GMK i;  4PFP A;  3PVL A;  1QVG P;  1M3C A;  1JRI A;  3IQL A;  4J9E A;  4M77 D;  2OTJ A;  4C0F A;  3I56 T;  2EWN A;  2EYQ A;  2L0A A;  1ABO A;  2A08 A;  2FHD A;  1C6V X;  3JCM c;  1KSW A;  2LX9 A;  2MK5 A;  3P8B B;  1OV3 A;  5GJV B;  3RER A;  4LXC A;  2ZPE B;  4GY5 A;  1AEY A;  2X3X D;  1OI1 A;  2W10 A;  3QBY A;  1EX4 A;  2ZZD A;  4N0A A;  1KQS P;  2J6K A;  1IRE B;  1IRX A;  1UDL A;  1NPR A;  2HCK A;  4DEY A;  4ZN1 A;  1OZ3 A;  4OMP A;  3M58 A;  4X34 A;  2L5Q A;  3QXE B;  3QJY A;  4JZ4 A;  2DK3 A;  4FIB A;  2EJ9 A;  1H92 A;  4K11 A;  4B6M A;  2K3X A;  2RNA A;  2ZPB B;  4J7I A;  3CCU Q;  1O75 A;  1Q82 C;  1K73 C;  9ATC B;  2BE9 B;  3I9Q A;  1UEC A;  2XU8 A;  4RCB A;  2DXU A;  4KUI A;  3PTA A;  1VQM T;  5D6Y A;  4M7A D;  3V8J A;  3CMA T;  2HMA A;  5LJ3 g;  2RHY A;  2ZAE A;  3JB9 F;  4PJO E;  5C0M A;  5DLQ E;  2L8D A;  5FRN A;  2X4Y A;  4FCY A;  2EQK A;  3X26 B;  1WQW A;  2E6N A;  4ZTF A;  3CPF A;  3CCS T;  4LDV A;  1NJI R;  2KGT A;  1W2B S;  1JO8 A;  2COY A;  2DX1 A;  2R5M A;  3JB9 D;  3RES A;  3FC3 A;  5DLO A;  5A2Q E;  3CCR A;  2ZPF B;  3G4S Q;  1M3B A;  5GAM h;  4QW2 A;  5A0D A;  2L89 A;  3OYB A;  1SSH A;  3FLG A;  2JM9 A;  2V8K A;  5KCO A;  1M8M A;  3A8G B;  1PD0 A;  1YJ9 T;  3I35 A;  2MF2 A;  3X20 B;  5CK9 A;  4C8Q C;  1Y96 A;  2EYX A;  2QAS A;  4RG8 A;  4J6W A;  4J9G A;  2AT1 B;  3CD6 A;  2DTI A;  2XK0 A;  4M77 C;  1WHH A;  3OYC A;  1TS9 A;  2X4W A;  4CC2 A;  2XIC A;  4DQ2 A;  5I2M A;  4BE0 A;  4OMQ A;  4M75 G;  1RAE B;  3E2U A;  1VQ4 T;  1RAA B;  2E64 A;  2R5A A;  4QVC A;  1VUB A;  1PM3 A;  1KC8 R;  4EDU A;  4M7A G;  1PSE A;  2X3W D;  1WJS A;  2IPO B;  2DD5 A;  1NE8 A;  4JRQ A;  3G71 A;  2QG9 B;  3F70 A;  3GBQ A;  3RKY A;  2OX7 A;  4J9C A;  2H3E B;  4ATO A;  1K9A A;  1HYO A;  5KYY B;  3OS5 A;  4FYW B;  3VYH B;  3OYE A;  2K5L A;  5J3B A;  4QT7 A;  1M2O A;  2COW A;  4F16 A;  1CKA A;  2GFA A;  3REA B;  3EG2 A;  3URG A;  1X69 A;  2LCS A;  4BDY A;  1N8R R;  2X4X A;  1KD1 C;  2YLB A;  4XTV A;  1K8A R;  3HPW A;  1TOV A;  1X2K A;  3GNF B;  2RJD A;  2JJ9 A;  4JS4 A;  4JRP A;  1VIE A;  2CZ1 B;  2KYM A;  1WHG A;  3WVD B;  3L2Z A;  2VUB A;  1D1B A;  1YHQ T;  4LN2 A;  2ZGW A;  1VOM A;  2NUT A;  2OAU A;  1AOJ A;  4LUD A;  3VRZ A;  4LD6 A;  3BE3 A;  2YXY A;  3LWH A;  2CZ0 B;  2NUP A;  3QSU A;  3HL8 A;  5IH2 A;  2D8H A;  4FL6 A;  2EYW A;  2M0O A;  3CCM A;  3C94 A;  3BFM A;  4N0A C;  5IHI A;  4E47 A;  2FB7 A;  3RBB B;  3ASK A;  3OB9 A;  3EH1 A;  3OYA A;  2K7A A;  1Z9Q A;  1YJW A;  1FYN A;  2DXT A;  2J05 A;  2D9T A;  2OJ2 A;  1LPL A;  3JRZ A;  2QQB A;  3PMI A;  5LJ5 d;  4BD3 A;  2ABL A;  2KBT A;  2CP3 A;  1IZ6 A;  2G6F X;  3OYN A;  4EMH A;  5CCA A;  3VV0 A;  2KXD A;  4XTU A;  2P0K A;  1UTI A;  2YT6 A;  5IAY A;  4J83 A;  3PVQ A;  2NUZ A;  1S72 T;  2KEA A;  2VB6 A;  1D1C A;  5KE3 A;  1ZBJ A;  2ED0 A;  1PSF A;  1CKB A;  1ZUU A;  4BDZ A;  2D1X A;  3RNJ A;  1M5Q 1;  3LYI A;  4M75 E;  3CCJ T;  1VQ9 Q;  1SG5 A;  2EGC A;  3G1J A;  2D8J A;  4FT2 A;  2GNC A;  1YWP A;  3QWY A;  1YNZ A;  2JMC A;  2E1H A;  1S1N A;  3OW2 A;  1JJ2 S;  2XD0 A;  3QG1 A;  1WHM A;  5GAM f;  3CCE Q;  2F1L A;  3CCQ T;  3UPU A;  1V29 B;  4KGZ B;  3CC2 T;  2AKK A;  4BB7 A;  4ME7 A;  4JRI A;  3JV3 A;  4M77 B;  2DTO A;  5KE2 A;  3OYG A;  4PJM A;  1MGQ A;  2FPE A;  2WSF E;  4M78 E;  4HT8 A;  4JLG A;  2LJ3 A;  5FWB A;  1VQ6 A;  1VQL Q;  2QYZ A;  3FIF A;  2WSE E;  1AZG B;  3OW2 P;  4JUV A;  1MMG A;  2RA2 A;  2RI3 A;  4KH0 B;  4AFS C;  2LQW A;  1WZO A;  4R0K A;  2HKN A;  4J7F A;  1ZLM A;  4OMO A;  1VQO A;  2LQ8 A;  3QUI A;  2Y4Y A;  2YUP A;  2QEX Q;  1ZA2 B;  2SRC A;  1ZQ1 A;  2QGG A;  2DA9 A;  1OQK A;  1UGS B;  2CZ7 B;  1VQ5 Q;  1J3T A;  1UHC A;  3NGP A;  3O5Z A;  1QVP A;  2RHU A;  3M54 A;  1VIF A;  5FU6 C;  2LT4 A;  1UFF A;  3QPH A;  2BIV A;  2F5T X;  1P92 A;  5GAN d;  2ED1 A;  1VQM A;  2XHC A;  4J9B A;  2PVG B;  1HXD A;  2PUK B;  1D0X A;  4PJO A;  2K9G A;  3JCM g;  1GBQ A;  4GLK A;  1NPP A;  5GAN 5;  2CP7 A;  3LX7 A;  3S3N A;  2CSQ A;  2MPX C;  4RKU E;  4PNO A;  1WGS A;  3RIR A;  4MZM A;  4JRK A;  4M7A B;  4IUV A;  1W4S A;  2K6D A;  4ZGE B;  1Q86 R;  4ELZ C;  2E41 A;  4HCC A;  2RI5 A;  2ZCF B;  2OAW A;  5GMK j;  3FEO A;  4JLI A;  4AFZ C;  4J9F A;  1K1Z A;  3PIO A;  2EKH A;  2FPF A;  3JCM b;  1UGP B;  2VKN A;  1YJ9 A;  3H0H A;  2YRV A;  1UGV A;  3JCM J;  4PK4 A;  4LDY A;  4NL3 A;  1RI9 A;  1BI1 A;  1T3S A;  1IO6 A;  1UHF A;  2FRY A;  2EFI A;  2J06 A;  2BZ8 A;  3VS3 A;  2RQR A;  4KGV B;  5GMK l;  2O31 A;  5GAO p;  3EG9 A;  4CI0 C;  2O2O A;  2DKG A;  3CCU T;  2KR3 A;  1BK2 A;  1U3O A;  1Q7Y C;  3TSW A;  1VQ8 A;  1HD3 A;  2E5Q A;  1D09 B;  3CC4 A;  4KH1 B;  2FEI A;  4PJO D;  3S3O A;  3CME Q;  5CVI A;  3LW5 E;  4PKC C;  4XK8 E;  1AVZ C;  3ER0 A;  2QQS A;  3EGX A;  4OGE A;  2OTL A;  3I55 Q;  2DO3 A;  4XTY A;  2RPN A;  2P4R A;  2ESW A;  4X9D A;  1DJ7 B;  3G4S T;  2LDM A;  2M02 A;  1YJN Q;  2EAY A;  4J9I A;  4J5Y A;  2E3I A;  1ARK A;  2EKO A;  1G3W A;  3REB B;  1M1F A;  1VQK A;  4A4K A;  4AT1 B;  4F04 B;  5LJ5 j;  1N6A A;  2EIF A;  2L3S A;  2V8J A;  4F7U G;  2A28 A;  3EH2 A;  3FRN A;  3JB9 H;  2B86 A;  3DB4 A;  1X2Q A;  3EG0 A;  4E7S A;  3QHS A;  4QKU A;  4NOY A;  1Q82 U;  4XU0 A;  2RN8 A;  4RUG A;  2CT3 A;  1YIT A;  3MEA A;  2E5K A;  3FJ5 A;  1K8A C;  5D6X A;  2HDA A;  3L2Q A;  1NM7 A;  1H3H A;  1K0X A;  2DRM A;  1VQP Q;  2JTF A;  2VAS A;  2D0Q B;  4E7H A;  1WXU A;  3M57 A;  3LGL A;  4WF2 A;  3PGG A;  1ZSZ B;  1W2B A;  3TU4 K;  3JSC A;  5FWC A;  4M4Z A;  3M55 A;  1V1C A;  5FU6 B;  2LCC A;  4ORZ A;  1UE9 A;  2RF0 A;  3EG1 A;  3CC7 Q;  2FZK B;  3V8L A;  3QO3 A;  1NLO C;  1TU0 B;  4A4F A;  2VXE A;  1UJY A;  1G83 A;  2LNH B;  2YLC A;  5HY6 A;  3G6E Q;  3HP9 A;  2OTJ Q;  2YUN A;  3VS0 A;  1SSF A;  4E7K A;  4P5N A;  1WX6 A;  1OX9 A;  4A4H A;  1W2B P;  4PJO C;  2RMO A;  3NTH A;  2RQT A;  4IIM A;  3M0Q A;  3MCA B;  4E7J A;  1M90 C;  4M75 A;  3CCJ A;  4IKF A;  4M77 F;  2V1Q A;  4RTV A;  3MET A;  1H8K A;  2RHI A;  3GIB A;  2EW3 A;  1LOJ A;  3E1S A;  1YIJ Q;  3VU3 C;  1IHV A;  1KQS A;  3X24 B;  2NUT B;  4M7A A;  1IB8 A;  3MP8 A;  2FZG B;  1KHI A;  2RJC A;  2LJ1 A;  2JOY A;  2DJZ A;  3BW1 A;  2NUP B;  5GAN j;  2FRW A;  4E7L A;  4KBM B;  1WJQ A;  2DL5 A;  5M9O A;  1I5O B;  3C95 A;  2RJF A;  3QWX X;  1IHW A;  1VQ7 A;  3VS7 A;  3OYK A;  2ZPH B;  1K0S A;  2RO0 A;  4M7D E;  3KBG A;  2DL3 A;  4MZP A;  1KD1 U;  2K57 A;  2QTX A;  4HVV A;  2QQ9 A;  1OUL A;  3CCL Q;  4M75 F;  2KK4 A;  3J80 E;  1XQH A;  5CKF A;  2RH2 A;  4F7U E;  3MHX A;  4KUL A;  4AG1 C;  2DTH A;  1G8X A;  1RAD B;  2X51 A;  2E4H A;  3HHT B;  2X4J A;  2PUO B;  1VYU A;  3LH0 A;  5LJ3 e;  2RK1 A;  4M7A F;  1VQ9 T;  4M75 D;  2DE0 X;  1WI7 A;  5EG2 A;  3QJ6 A;  2V8I A;  1M1G A;  3TQ7 P;  4Z8A A;  2PTK A;  3D7S B;  4Z88 A;  3EGD A;  1QWE A;  3CCE T;  4HCK A;  1ZHI A;  5LJ3 h;  2FYK A;  3EFO B;  4EMG A;  5GAM e;  4ZGJ B;  4FM4 B;  1HK9 A;  2JMA A;  3UDC A;  4BI4 A;  1NEG A;  1RAF B;  2CP6 A;  4FT4 A;  1KG1 A;  5KYN A;  1F1B B;  1YP5 A;  2K79 A;  2DXC A;  3CD6 Q;  1FMV A;  1NLP C;  1I1J A;  4FYY B;  4VUB A;  5GAO r;  4M78 D;  3TRE A;  1VQL T;  3HRS A;  5FU7 C;  1FX7 A;  4AFU C;  1M27 C;  1M9S A;  1OOT A;  2GTJ A;  5GAO n;  1NBE B;  3EHQ A;  2L3Q A;  3OSS C;  1SF9 A;  1UG1 A;  2OI3 A;  2XG8 D;  3MEW A;  1M1K C;  2QEX T;  1TUD A;  2JUF A;  3CQT A;  2IIM A;  4BI3 A;  4LD9 K;  3SWN B;  1VQ5 T;  4ANJ A;  4TVR A;  3H0F A;  1E6H A;  5GAN 3;  4N4H A;  2RHX A;  5CQX A;  3CCU A;  4HXJ A;  5LL6 S;  3RMQ A;  3G71 Q;  3VUB A;  2MAM A;  2DL4 A;  2LZ6 B;  3PT9 A;  4C5H A;  2RQV A;  4L6V 5;  2MWO A;  4JDS A;  1JJ2 A;  1PKT A;  3UT1 A;  1ZSZ A;  2KAF A;  4GLM A;  1X6B A;  1X43 A;  8ATC B;  4DOW A;  1MHN A;  2JM8 A;  4BAC A;  3R6O A;  4PJO B;  5D6W A;  4RTU A;  2QA4 Q;  3FJP A;  3OSV A;  1JB0 E;  2CSI A;  2PVO B;  2Y4X A;  1K9M C;  4M78 G;  2YUQ A;  2AZV A;  4RTX A;  2CKK A;  2QI2 A;  1JJ2 P;  4JS5 A;  5CKB A;  1WLP B;  1PWT A;  4M75 C;  1NYF A;  1RI0 A;  2QDY B;  4ZN3 A;  5GAM d;  1T0H A;  3DLL A;  3BDU A;  1YCS B;  3BDL A;  5J39 A;  4IUR A;  1FMK A;  3OS0 A;  5LJ5 g;  2CGH A;  5I11 A;  5KYW B;  1RAC B;  2VV5 A;  4M7A C;  2KRN A;  1E7O A;  2GTO A;  1GFD A;  1GCQ A;  1WIE A;  1YJW Q;  2GF7 A;  2FL7 A;  5IHN A;  3M5A A;  3EHR A;  1N9S A;  4RCC A;  3H41 A;  1Y71 A;  2BZY A;  2YHT A;  3PNW C;  2LQN A;  3EG9 B;  3CME T;  2M51 A;  3UF4 A;  5A0L A;  3UWN A;  1I5L A;  4MDW A;  4FSX A;  3I55 T;  5J26 A;  1MMN A;  2SEM A;  1GL5 A;  4C0G A;  2MMP A;  5IN1 A;  2CYZ B;  2MYS A;  5FRO A;  3UA6 A;  1YJN T;  4A53 A;  2CT4 A;  3E19 A;  2HEQ A;  5GAO m;  3H8Z A;  4C8Q E;  3EGX B;  4CRI A;  1JEG A;  5C6S A;  2XKO C;  1LNX A;  1I07 A;  4II1 A;  2X35 A;  3ZEH A;  3VYG A;  1TH7 A;  3SB2 A;  4R55 A;  4N4G A;  3ULR B;  3M56 A;  2CS7 A;  2M16 A;  3EFS A;  3OA6 A;  4Z02 A;  2LCL A;  2DEQ A;  4D6W A;  3MEU A;  4A4G A;  1Q7Y U;  2QQA A;  2DYI A;  2GBQ A;  5LJ3 f;  2HQX A;  3T9N A;  2GGR A;  5FU7 B;  3CXC A;  3EFO A;  5GAN 6;  1VYT A;  5FLX E;  3M59 A;  4DBF A;  4LDX A;  1VQ6 Q;  3P8H A;  1ZX6 A;  4PJN A;  3ZL7 C;  1VQP T;  1NG2 A;  2E70 A;  4KRT A;  4NL2 A;  1QCF A;  4PFO A;  1K76 A;  4A54 A;  1RAB B;  3I56 A;  3HSB A;  1VQO Q;  1VQN Q;  2EQU A;  4DBR A;  1UJ0 A;  2CUD A;  2JT4 A;  5GAN g;  3DKM A;  3TCJ A;  1TG0 A;  4DBH A;  4RTW A;  3OS1 A;  3CC7 T;  3CXC P;  5GAN 7;  4C0D C;  2DBK A;  3SWN A;  2C0O A;  1X01 A;  1UGR B;  2EQI A;  3CPW S;  2EQJ A;  1Y07 A;  1RAG B;  4D8D A;  2AIR B;  3G6E T;  2HZY A;  3CEY A;  2OTJ T;  4KT0 E;  1XJW B;  1SPK A;  4EIK A;  4OF1 A;  1KK7 A;  4F7U A;  3OQ5 A;  2LQK A;  4CC7 A;  2XMF A;  5GJW B;  4LDW A;  4C92 G;  8AT1 B;  1ZSZ C;  1BI2 A;  1VQ9 A;  5DY9 A;  2HQE A;  3JCM e;  1Q81 U;  2LRQ A;  1N27 A;  2F2V A;  1UGQ B;  3QKJ A;  1Q82 R;  1K73 R;  2L3P A;  2LX7 A;  1B34 A;  2KRS A;  4JJN K;  2AHJ B;  2LNV A;  3LGF A;  1BYM A;  2LP5 A;  1YIJ T;  2O88 A;  1X27 A;  4X1V A;  3CCE A;  2AZS A;  3CMA A;  4M75 B;  3EAE A;  3R6N A;  2DJQ A;  3JCM h;  3M53 A;  4IUU A;  2QAZ A;  3CBP A;  2A0F B;  3OBY A;  4L5G A;  1T0J A;  2DPP B;  4Z89 A;  3CCS A;  3OYF A;  1AT1 B;  4HVU A;  3L1A A;  4QQG A;  3HRT A;  1VQ8 Q;  4M7D D;  2RHZ A;  2I2L A;  2BKD N;  3M0T A;  3OYI A;  2HBW A;  4XTW A;  1LJO A;  2DVE A;  5CKE A;  3CCL T;  2KI7 A;  1GCQ C;  4XTZ A;  5KYW A;  1YI2 Q;  4M78 B;  3CC4 Q;  1RLP C;  2C0T A;  1ZA1 B;  5I22 A;  3THK A;  3RMS A;  5AT1 B;  1JBM A;  1WNL A;  1EZZ B;  3M0P A;  2MI6 A;  1BBZ A;  1QVF A;  2OTL Q;  2P84 A;  1M90 U;  1NJI C;  2KDS A;  2LVM A;  4PJO F;  1N5Z A;  3CCV Q;  1QP2 A;  4OMF B;  4OMN A;  1BB9 A;  4OVA A;  3ZBD A;  3E9G A;  1H64 1;  1BCM A;  1RAH B;  1VQ4 A;  1BI3 A;  3EGU A;  1PG5 B;  2CP0 A;  1NYG A;  2RI2 A;  1VQK Q;  2QTV A;  1Y57 A;  1AD5 A;  1I0C A;  1FXX A;  4X9C A;  3CD6 T;  1QVF P;  5EC7 A;  1MND A;  3JCM d;  2D0N A;  1I81 A;  2HKQ B;  3EGD B;  3QDF A;  2DEU A;  1WFW A;  3EFR A;  4B9W A;  1JU5 C;  4UC4 A;  2ROT A;  3LWI A;  3J81 E;  1I8F A;  1LVK A;  1G5V A;  1FWZ A;  1KD1 R;  1YIT Q; 
#chains in the Genus database with same CATH homology
 1KC8 U;  3F70 A;  3RKY A;  4M7D G;  4ATO A;  2A3L A;  1VQ7 A;  3OYK A;  2ZPH B;  2NLU A;  2RO0 A;  1G3T A;  4HA8 A;  3KBG A;  3RUX A;  4ZTJ A;  4M7D E;  2PVD B;  3OS5 A;  3VYH B;  3HFN A;  1X75 C;  3OYE A;  2K5L A;  5J3B A;  4MZP A;  1BIA A;  1YCY A;  1KD1 U;  2K57 A;  2QTX A;  2QQ9 A;  1KC8 C;  3INZ A;  2GFA A;  4Q5W A;  3JAM E;  4M75 F;  3URG A;  3G71 T;  1QW1 A;  2KK4 A;  3J80 E;  4C92 E;  3OYL A;  4BDY A;  1VQ7 T;  2PQW A;  1XQH A;  4XQ3 A;  2X4X A;  1KD1 C;  2YLB A;  4XTV A;  2RH2 A;  5CKF A;  3RKX A;  1RL2 A;  1Y7X A;  3HPW A;  4F7U E;  1YHQ A;  3MHX A;  4KUL A;  3GNF B;  3L2V A;  2DTH A;  2RJD A;  3HHT B;  2X4J A;  1G3Y A;  2PUO B;  3LH0 A;  5LJ3 e;  4JS4 A;  1N8R U;  1VQN A;  2RK1 A;  3QDR B;  4JRP A;  1K73 U;  1K8A U;  4M7A F;  1VQ9 T;  2E6Z A;  2ZPG B;  1VIE A;  2WAC A;  2CZ1 B;  2JZ2 A;  2K4Y A;  3MP1 A;  4M75 D;  4C0D B;  3M4Y A;  3WVD B;  3L2Z A;  3X28 B;  2VUB A;  3CBO A;  5EG2 A;  3QJ6 A;  1YHQ T;  1N8R C;  4M7D F;  2ZGW A;  2OAU A;  2V8I A;  1M1G A;  2K2V A;  4LD6 A;  3SWN C;  1GXI E;  2IVW A;  3OYY A;  3LWH A;  4XAX B;  2E12 A;  2CZ0 B;  3VJP A;  3CCE T;  1ZHI A;  3QSU A;  3HL8 A;  3L2U A;  5LJ3 h;  3DB3 A;  1OYX A;  2FYK A;  3OBW A;  4EMG A;  1VQL A;  4FL6 A;  3HKS A;  5GAN 2;  1YJN A;  2QA4 T;  5GAM e;  4ZGJ B;  4FM4 B;  3JB9 I;  4C92 C;  1HK9 A;  3UDC A;  4BI4 A;  4F7U F;  2M0O A;  4FT4 A;  3C4S A;  5LJ5 f;  3CCM A;  1KG1 A;  3C94 A;  3BFM A;  2KSS A;  4N0A C;  2DXC A;  5LJ3 j;  1O9S A;  3JCM P;  4VUB A;  2JTM A;  4E47 A;  2FB7 A;  4Y28 E;  2XI9 A;  4BE2 A;  4M78 D;  5GAO r;  4OB3 B;  3TRE A;  2QEX A;  3JB9 J;  4BY6 C;  3ASK A;  3OB9 A;  5HK3 A;  1VQL T;  3HRS A;  3OYA A;  5FU7 C;  1FX7 A;  1M9S A;  1M1K U;  1VQ5 A;  2P0Q A;  5CKH A;  1YJW A;  2DAQ A;  2DXT A;  5GAO n;  2D9T A;  1BI0 A;  1ZBX A;  3SFM A;  3JRZ A;  2QQB A;  3OSS C;  2D6F A;  3PMI A;  2DIQ A;  5LJ5 d;  4BD3 A;  2XG8 D;  3MEW A;  3QYH B;  1M1K C;  2QEX T;  3FDR A;  1IZ6 A;  2JUF A;  2MWP A;  1S72 A;  4XU3 A;  4BI3 A;  4PLL A;  4LD9 K;  3SWN B;  4XU2 A;  4EPC A;  3OYN A;  4EMH A;  4TVR A;  5CCA A;  5GAM j;  4B9X A;  1YJW T;  1YBY A;  2BUD A;  4O5V A;  3VV0 A;  4OB0 B;  4XTU A;  4C0Z A;  3CCR T;  1UB4 A;  2P0K A;  4N4H A;  5GAN 3;  2RHX A;  3HFO A;  5CQX A;  3P8D A;  4RG2 A;  3JCM f;  1H3Z A;  3CCU A;  5LL6 S;  5IAY A;  3RMQ A;  4C92 B;  4J83 A;  3X25 B;  4DA4 A;  1S72 T;  3QII A;  3VUB A;  2KVQ G;  2KY9 A;  3NFC A;  5CAI A;  2MAM A;  5KE3 A;  3NTK A;  1PSF A;  3PT9 A;  5FRM A;  4BDZ A;  4C5H A;  2G3R A;  2O4X B;  2VYT A;  4L6V 5;  2MWO A;  1M5Q 1;  2KMT A;  3LYI A;  4M75 E;  4JDS A;  3CCJ T;  1JJ2 A;  4FT2 A;  3UT1 A;  4QQD A;  3CCQ A;  2E1H A;  5GAN 8;  1NZ9 A;  3WXM B;  1WJR A;  3CXC S;  3CC2 A;  4J6X A;  3GPL A;  3OW2 A;  1JJ2 S;  2KAF A;  3NTI A;  1YI2 A;  3O8V A;  5GAO l;  3CC7 A;  4IUQ A;  2XD0 A;  4M7A D;  4OP0 A;  3QG1 A;  4DOW A;  1MHN A;  1R8O B;  3N5B B;  2C06 A;  4M78 A;  5CIU A;  4C8Q D;  3L2W A;  5GAM f;  3JCM Q;  4BAC A;  2A7Y A;  3R6O A;  3OW2 S;  1K9M U;  3E9F A;  4PJO B;  3M9Q A;  5D6W A;  3CCQ T;  3BY7 A;  2HNI A;  4XTX A;  3V8K A;  3UPU A;  1V29 B;  3FJP A;  3OSV A;  2XID A;  3CC2 T;  1JB0 E;  3JCM V;  3OYM A;  4BB7 A;  2EJF A;  4ME7 A;  3H6Z A;  3G6E A;  2PVO B;  4JRI A;  2Y4X A;  3WVE B;  1K9M C;  3ME9 A;  4M78 G;  4DOV A;  4M77 B;  2DTO A;  5KE2 A;  3OYG A;  1MGQ A;  4PLI A;  2CKK A;  3OYD A;  2QI2 A;  2WSF E;  4M78 E;  4JS5 A;  1M4Z A;  4HT8 A;  5CKB A;  4JLG A;  3CCV A;  4M75 C;  4L59 A;  3S6W A;  1VQ6 A;  4ZN3 A;  1RI0 A;  2QDY B;  3FIF A;  2WSE E;  5GAM d;  3DLL A;  4EMK C;  3BDU A;  1QP3 A;  4JUV A;  2ZPI B;  2WSC E;  3FB9 A;  4HKE A;  2O01 E;  2RA2 A;  2RI3 A;  3BDL A;  1D3B A;  5J39 A;  4IUR A;  2K5F A;  5CO7 A;  4J7F A;  3QZ5 B;  3OS0 A;  2IG0 A;  5LJ5 g;  2CGH A;  2E10 A;  1VQO A;  2LQ8 A;  3QUI A;  2Y4Y A;  2GCX A;  2VV5 A;  2DIG A;  3M4G A;  4O6J A;  4M7A C;  5GAN f;  3V7R A;  3CME A;  1ZQ1 A;  3SDZ A;  1VQ6 T;  1YIJ A;  3V7C A;  4XU1 A;  1UGS B;  2CZ7 B;  4RMO A;  2GF7 A;  2O4X A;  2FL7 A;  5L8R E;  3M5A A;  4RCC A;  1N9S A;  3L42 A;  4M7D C;  1QVP A;  2RHU A;  3M54 A;  4N4I A;  3I55 A;  1Y71 A;  2YHT A;  1VIF A;  1VQO T;  5FU6 C;  3PNW C;  2LT4 A;  1VQN T;  3DLM A;  2DD4 A;  4M78 F;  3QPH A;  1U1S A;  3CME T;  2BIV A;  2VGM A;  2VC8 A;  5GMK e;  1Q81 C;  3GP8 A;  2R58 A;  5A0L A;  2F5T X;  1P92 A;  3UWN A;  5GAN d;  1Y96 B;  3J7A F;  2JNG A;  4MDW A;  4BUG A;  1VQM A;  1I5L A;  2XHC A;  1U1T A;  4OGC A;  3VKI A;  5DM7 R;  2GFU A;  2B8A A;  4PL6 A;  2PVG B;  2HAX A;  4FSX A;  3I55 T;  1HXD A;  2PUK B;  5CKD A;  1WQ7 A;  5J26 A;  4C8Q A;  4PJO A;  4EMK B;  2LT1 A;  3A8M B;  1XOV A;  3JCM g;  4GLK A;  1NPP A;  5AYF A;  2MMP A;  5IN1 A;  2CYZ B;  2QXF A;  3LX7 A;  3VUZ A;  3GNG A;  4J6Y A;  4Y91 A;  5GAN 5;  3S3N A;  5FRO A;  4RKU E;  4C5G A;  4PNO A;  4A53 A;  1YJN T;  1WGS A;  3CCL A;  4M77 A;  3RIR A;  2M1H A;  3E19 A;  4MZM A;  5GMK h;  2K5I A;  4JRK A;  4C8Q G;  2RD1 A;  4PJO G;  5GAO m;  2F5K A;  4M7A B;  4J8O A;  3H8Z A;  3L2R A;  4IUV A;  2LTO A;  3CCM T;  2JN0 A;  1W4S A;  4C8Q E;  4ZGE B;  4CRI A;  3A8L B;  4ELZ C;  2E41 A;  4ZGD B;  1WPY A;  4HCC A;  2RK2 A;  2RI5 A;  2ZCF B;  5C6S A;  2XKO C;  4QVD A;  2VGN A;  4M77 G;  4BE1 A;  1LNX A;  4M7D B;  5GMK j;  2VXF A;  4II1 A;  2X35 A;  3ZEH A;  1M8V A;  1Q86 U;  3LLR A;  3VYG A;  1AHJ B;  1TH7 A;  2E65 A;  3FEO A;  4JLI A;  3SB2 A;  4R55 A;  3PIO A;  4N4G A;  3JCM b;  1I4K 1;  1UGP B;  2EJG A;  1YJ9 A;  2HD0 A;  3M56 A;  4KUD K;  2YRV A;  1QVG A;  1XTD A;  2CS7 A;  2M16 A;  3EFS A;  3JCM J;  4LDY A;  3A8H B;  3OA6 A;  1OZ2 A;  4Z02 A;  4NL3 A;  1Q86 C;  2L3R A;  2LCL A;  4ELY C;  1BI1 A;  5GAM g;  3S3M A;  4F7U B;  4QQ6 A;  3AHU A;  2DEQ A;  4D6W A;  1VQP A;  3MEU A;  4A4G A;  1Q7Y U;  1QVG S;  5IT9 E;  2QQA A;  2EFI A;  2CZ6 B;  5LJ3 f;  2RM4 A;  5HK0 A;  5GMK l;  5GAO p;  4E7I A;  3MP6 A;  2HQX A;  3T9N A;  3MEV A;  3KXT A;  2KQW A;  1U8R A;  4BY6 B;  3JCM W;  4CI0 C;  1UEB A;  5FU7 B;  2DKG A;  3OMG A;  3PMT A;  2GQV A;  2H3J A;  4C8Q F;  3OMC A;  5GAN 6;  3CXC A;  3CCU T;  5FLX E;  1Q7Y C;  3M59 A;  1QVF S;  1VQ8 A;  4LDX A;  2RJE A;  3GOX A;  3P8H A;  1B34 B;  2P0P A;  4R56 A;  1VQP T;  3GF5 A;  3RKW A;  2K3Y A;  2E70 A;  2XDP A;  4NL2 A;  5GMK i;  2E5Q A;  2LC4 A;  3C12 A;  1BKB A;  4A54 A;  4YTL A;  3CC4 A;  5LJ3 d;  1Q81 U;  3I56 A;  3HSB A;  2FVU A;  2EQU A;  1JRI A;  4PJO D;  3S3O A;  1VQ8 T;  5CVI A;  3LW5 E;  5I21 A;  4PKC C;  1VQ5 T;  3G4S A;  4XK8 E;  5GAN g;  3ER0 A;  3DKM A;  3TEE A;  3TCJ A;  4OB1 B;  3PIP A;  2QQS A;  2F69 A;  5LJ5 e;  4OGE A;  4M77 D;  3SD4 A;  2OTL A;  3OS1 A;  1YI2 T;  2OTJ A;  2DO3 A;  4XTY A;  4C0F A;  2PU9 B;  3CC4 T;  3CC7 T;  3I56 T;  3CPW A;  1KQS S;  2EWN A;  2EYQ A;  3MO8 A;  5GAN 7;  4X9D A;  4C0D C;  1DJ7 B;  2FHD A;  3SWN A;  3OYH A;  3Q1J A;  3G4S T;  2LDM A;  3JCM c;  1X01 A;  2LX9 A;  4MMK A;  3P8B B;  1UGR B;  3G7Z A;  4C5I A;  2EAY A;  2EQJ A;  3CPW S;  1Y07 A;  3RER A;  4J5Y A;  3CBM A;  2EQM A;  3G71 A;  4FU6 A;  2OTL T;  3G6E T;  2ZPE B;  4GY5 A;  3CEY A;  2OTJ T;  4KT0 E;  4C92 A;  2EKO A;  4OF1 A;  5LJ5 h;  1OI1 A;  1G3W A;  4F7U A;  3QBY A;  1KHC A;  1M1F A;  1VQK A;  4N0A A;  2ZZD A;  3CCV T;  3OQ5 A;  4A4K A;  2LQK A;  1IRE B;  2XDB A;  1NPR A;  4MDX A;  4LDW A;  2RB6 A;  4C92 G;  1BI2 A;  3JB9 G;  1VQ9 A;  5LJ5 j;  5DY9 A;  1N6A A;  2HQE A;  3JCM e;  2EIF A;  1N27 A;  2LRQ A;  2V8J A;  1UGQ B;  2Y90 A;  4F7U G;  4ZN1 A;  3QKJ A;  1OZ3 A;  3M58 A;  4X34 A;  3FRN A;  3JCM X;  1B34 A;  2L5Q A;  3JB9 H;  3DB4 A;  3QXE B;  3QJY A;  4JJN K;  2AHJ B;  2LNV A;  3LGF A;  3QHS A;  1VQK T;  2DK3 A;  4FIB A;  4M78 C;  2QQR A;  1BYM A;  4NOY A;  1YIJ T;  1EIF A;  2EJ9 A;  1Q82 U;  4XU0 A;  5GMK m;  3CCE A;  5A0G A;  3CMA A;  1YIT A;  3PFS A;  4V2S A;  3MEA A;  4QVZ A;  4A4E A;  2K3X A;  4M75 B;  3EAE A;  2ZPB B;  2QA4 A;  4J7I A;  4C5E A;  1O75 A;  3JCM h;  3M53 A;  1Q82 C;  1K73 C;  1K8A C;  4IUU A;  5D6X A;  3CBP A;  2JVV A;  3L2Q A;  2XU8 A;  2JTF A;  4RCB A;  2DXU A;  3OBY A;  4L5G A;  2D0Q B;  1NE8 A;  2DPP B;  4KUI A;  5CR2 A;  5D6Y A;  3PTA A;  1VQM T;  4E7H A;  3CCS A;  3M57 A;  3A5Z B;  4MZT A;  3V8J A;  4BI8 B;  3OYF A;  1YIT T;  3CMA T;  4HT9 A;  1G3S A;  5LJ3 g;  3L1A A;  4QQG A;  5HKC A;  3LGL A;  2RHY A;  4NS5 A;  4WF2 A;  4C92 F;  3JB9 F;  4PJO E;  5C0M A;  5DLQ E;  2L8D A;  3HRT A;  4LDU A;  1KQ2 A;  5FRN A;  3PGG A;  2X4Y A;  3OS2 A;  5GAN 4;  4M7D D;  3OY9 A;  2EQK A;  3X26 B;  1WQW A;  2RHZ A;  1W2B A;  2E6N A;  4ZTF A;  3TU4 K;  2I2L A;  2BKD N;  3JSC A;  3OYI A;  5KH6 A;  4XTW A;  4M77 E;  1LJO A;  2DVE A;  3M55 A;  3CPF A;  5CKE A;  3CCL T;  5FU6 B;  3CCS T;  2P4T A;  4LDV A;  4XTZ A;  2LCC A;  4M78 B;  1W2B S;  3V8L A;  2R5M A;  1X6O A;  3QO3 A;  4C92 D;  2DZC A;  3JB9 D;  3OYJ A;  3RES A;  3RMS A;  1JBM A;  5DLO A;  3FC3 A;  5A2Q E;  3CCR A;  1WNL A;  2ZPF B;  2VXE A;  4A4F A;  5GAM h;  1NJI U;  4QW2 A;  2HBP A;  5A0D A;  2L89 A;  3GLX A;  2MI6 A;  1KQ1 A;  3FLG A;  3OYB A;  2YLC A;  2V8K A;  5HY6 A;  5KCO A;  1QVF A;  3HP9 A;  3A8O B;  3A8G B;  3QZ9 B;  1SSF A;  1M90 U;  1NJI C;  2KDS A;  1YJ9 T;  4E7K A;  4P5N A;  1XNI A;  5GAN e;  2LVM A;  4HCZ A;  2MF2 A;  3HRU A;  4A4H A;  4OB2 B;  3X20 B;  4PJO F;  5CK9 A;  2DXB A;  4C8Q C;  4PJO C;  1Y96 A;  3NTH A;  1QP2 A;  4OMF B;  2R57 A;  4RG8 A;  3MCA B;  4J6W A;  4OVA A;  4E7J A;  3ZBD A;  3ZFJ A;  3CD6 A;  1D3B B;  3E9G A;  4M75 A;  2XDD A;  3CCJ A;  1M90 C;  2DTI A;  4IKF A;  1H64 1;  4M77 F;  2XK0 A;  4M77 C;  3OYC A;  4EMK A;  1VQ4 A;  2X4W A;  1BI3 A;  3MET A;  2XIC A;  4DQ2 A;  4HCB A;  5I2M A;  4BE0 A;  2RI2 A;  5GAO q;  2RHI A;  2DZ9 A;  4IUT A;  4M75 G;  3GIB A;  1FXX A;  1LOJ A;  4X9C A;  3E1S A;  5GAN h;  3VU3 C;  1KQS A;  3X24 B;  5CQY A;  3CD6 T;  4M7A A;  3MP8 A;  4C0G A;  3JCM d;  3KUF A;  1KHI A;  1I81 A;  2M9U A;  3QYG B;  4IUP A;  5KCH A;  1VQ4 T;  2RJC A;  2JOY A;  2DJZ A;  3BW1 A;  2E64 A;  2R5A A;  4QVC A;  4M7D A;  1VUB A;  5GAN j;  4B9W A;  3EFR A;  4UC4 A;  4MML A;  4EDU A;  4E7L A;  4M7A G;  3LWI A;  4KBM B;  1WJQ A;  5M9O A;  3J81 E;  1N9R A;  1PSE A;  1BIB A;  1I8F A;  1WJS A;  3C95 A;  3V7S A;  5I2S A;  4M7A E;  1G5V A;  1FWZ A;  2RJF A;  2DD5 A;  4JRQ A;  4C8Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...