5GAN2

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
90
structure length
90
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan200
2DZCA 4JLIA 4F7UF 2DVEA 1N9SA 4MMKA 4M7DB 5GAMd 1Y96A 3RKWA 2DZ9A 4F7UE 4M7AF 5GAN8 3HFNA 4XQ3A 4M7AC 4C8QC 3JCMX 1B34A 2RD1A 5GANh 4NL3A 3BFMA 4M75G 4M77A 4C8QE 1D3BA 2E64A 3HSBA 2EWNA 3M4GA 5GANf 3PGGA 5GAN4 1Y96B 2EAYA 5GAN6 4NOYA 2HNIA 5GMKe 5LJ5d 4J6WA 2DJZA 3JCMP 2QTXA 3V7RA 4M75A 5LJ3d 1B34B 5GAOp 3SWNC 3JB9D 4M77B 3JB9J 5GANg 1D3BB 2RM4A 2VC8A 3INZA 3FJPA 4XU1A 5GANe 4QVCA 1JBMA 5GMKl 4M7DG 4M78F 4V2SA 3QSUA 2DKGA 3V8LA 1I4K1 4M78C 4EMHA 4M75B 4F7UA 5GMKj 3JCMQ 4JUVA 4PJOF 3EFSA 3AHUA 3JCMW 2Y90A 4M7AA 3SB2A 2VXFA 1KQ1A 4M77D 3EFRA 2EJ9A 3JCMf 3JCMc 5GANj 1WPYA 3V7SA 1X01A 2FYKA 2ZGWA 4DQ2A 4M77G 3V8JA 4X9CA 4M75D 1HK9A 4M7AB 5GAMh 4N0AC 3JCMg 4C8QF 1H641 2E41A 3JCMe 4HT8A 1KQ2A 5I21A 4C92C 4QVDA 4C92E 3JB9H 2RB6A 3L1AA 4M78A 4PNOA 1WQWA 4M7DD 5GAOl 2VXEA 2EJGA 5LJ5h 4M7AD 2DTOA 4F7UG 1MGQA 3JB9I 4PJOA 3RKXA 5LJ3h 2JN0A 5GAN2 2DTHA 4XU0A 3QO3A 3RIRA 2E10A 4M7AG 1U1TA 4HA8A 4M78B 1M5Q1 3BW1A 4MMLA 5GAN7 2FB7A 1HXDA 4J5YA 4PJOB 1U1SA 2E1HA 3BY7A 2YLCA 4C8QA 2EJFA 3RUXA 5GANd 3JB9F 4RCCA 5GAN5 4RCBA 3VU3C 3BDUA 4F7UB 2DXTA 4M7DE 4Y91A 2DEQA 4JRIA 1I5LA 4PJOD 4C8QB 4A53A 4M78G 3SWNA 4HT9A 4C92F 2CGHA 5GAMf 1LNXA 4PJOG 4A54A 4M77F 3FIFA 2DXUA 4J6YA 3RESA 4M77C 4XTXA 4XTYA 4M77E 3SWNB 5GAMg 5GAMe 4C8QD 1LJOA 4M75F 3JCMd 2YHTA 3QHSA 5LJ5f 4M75C 1I81A 5GMKm 2YLBA 5LJ3f 3V8KA 4M75E 4C8QG 3L2ZA 3RERA 2E65A 3V7CA 4EMKC 4XTZA 5LJ5g 4N0AA 4X9DA 4XU3A 5GMKh 5LJ5e 5GAMj 5GAOn 5LJ3g 4M7DF 4PJOE 4M7DC 5LJ3e 4C92A 1I8FA 1WNLA 2RA2A 5GAOq 4XTVA 5GAOr 4M78D 4M7AE 2K57A 4JRKA 1LOJA 1BIAA 4EMGA 3GIBA 5LJ5j 4C92B 5GAN3 2I2LA 3JCMV 5LJ3j 1M8VA 5GMKi 3FB9A 3QUIA 3JCMb 1BIBA 3JCMJ 1WQ7A 5DY9A 1TH7A 4EMKA 1N9RA 3JB9G 4OP0A 1YCYA 4XTWA 4J6XA 4NL2A 4XU2A 5GAOm 4C92D 4M7DA 4M78E 1JRIA 3RKYA 3JCMh 4PJOC 3HFOA 4WF2A 5CAIA 4C92G 4EMKB 2DTIA 4XTUA
chains in the Genus database with same CATH superfamily
2FRWA 1ZBXA 3URGA 1Q82R 1U06A 1X6BA 2FL7A 1N8RR 2PUKB 3HL8A 3ZL7C 2EAYA 2F69A 5GMKe 3OYFA 2NLUA 1RAFB 3QSUA 2A7YA 1T3LA 5FU7B 4OGCA 1Y7XA 2CDTA 3I56T 4ANJA 2CS7A 2YRCA 1YJNA 1WXUA 2EQMA 5L23A 1Q86U 4D8DA 3CPWA 1Y07A 2CUDA 2EVRA 2L8DA 1WJSA 2QK0A 4LXCA 2JTMA 4MDWA 1KSWA 3FEOA 2KAFA 3CPFA 1UGQB 1J3TA 1QWEA 2GFUA 2QEXT 1B3QA 1T3SA 2OTJA 1OU8A 3VV0A 2JTEA 4OMOA 3FC3A 4RKUE 9ATCB 5FU6B 2KRMA 5D6YA 2B86A 4JRIA 2FVUA 2JJ9A 3SWNA 2RN8A 3QDFA 1SSHA 2XDBA 4XAXB 3E9GA 2A0FB 2AT1B 4RTWA 3L2ZA 2EGAA 4KRTA 2QASA 4XU3A 2AIRB 5LJ3e 4C92A 3NFCA 4J83A 3QJ6A 4FCYA 3TU4K 3CCJA 1MNDA 3MEAA 1UJ0A 3C0CA 1BIBA 1WHMA 5GAOm 2XIDA 3RKYA 1YJ9T 3OYLA 2LC4A 4B9WA 4C92G 3REAB 4XTUA 1LCKA 1N9SA 3CCMA 3VJPA 2ENMA 3UATA 1YJNT 5FRMA 2PVGB 2MPXC 2KR3A 5IAYA 1ABQA 1M90R 3JRZA 1QVFP 1D0YA 4ZTJA 5FW9A 1VQLQ 2CSIA 4M77B 2DIGA 3OA6A 1WHLA 2BUDA 2XICA 3H0IA 2Y90A 2PNIA 2EJ9A 1KK7A 2GQIA 4HVVA 1WPYA 2FYKA 3EGXB 5FLXE 1F1BB 1FX7A 1KFZA 1KQ2A 1VQMQ 3S3OA 3ME9A 1GXIE 3FDRA 4LDVA 5GAOl 5CO7A 2OTJQ 1QVFA 3DKMA 3HKSA 1LVKA 1M2OA 2DRMA 1M1KC 3BY7A 2GCXA 1YNZA 4NS5A 1VIEA 2DEQA 2OAUA 1X6GA 2YRVA 1HSQA 4HT9A 1QMCA 1IZ6A 2CGHA 2L5QA 1XTDA 3MP6A 4BDYA 1EX4A 1D0XA 3CCJT 5GAMe 5IN1A 1PKSA 3GBQA 4OMMA 4HKEA 2DX1A 1PNJA 4MDXA 3EFOB 4DEXA 2RA2A 3PT9A 5A0GA 2KRNA 5FWCA 3CCMT 3GIBA 4RTZA 2I2LA 3CCJQ 1CSKA 2W10A 2KT1A 3WVDB 2E6NA 4DOWA 3PMTA 1YFNA 5I11A 3JCMh 4BE0A 3OS5A 3NGPA 4C0GA 5CAIA 1NPPA 5FU6C 4FW1A 3VRYA 2LCCA 4JS5A 1VQ4Q 4QQ6A 1E7OA 3TSZA 4KUIA 2CT3A 2KE9A 2ED1A 1YCSB 3SEMA 2HAXA 2EPDA 4V2SA 2CZ6B 2KVQG 1SHFA 4M7AA 1JU5C 2VXFA 2CSQA 3SB2A 5CCAA 3DLLA 4HCBA 2Y4XA 1BKBA 4M75D 3H6ZA 2K5IA 2GBQA 4M78A 2V8KA 3KFVA 2RQRA 2KQWA 1MGQA 1WGSA 4Z02A 2K79A 1BU1A 3QO3A 2DEUA 1WJQA 4M7AG 3QZ5B 1AZEA 4C8QA 4IKFA 2EJFA 2P0PA 2AZVA 1NYFA 5GJVB 1MHNA 1BI2A 4M78G 1ABOA 3RMQA 4OMNA 3QDRB 1PHTA 4M77C 3CCLA 2VGMA 4R56A 2CT4A 3EAEA 2H3EB 3CMAA 2OX7A 2QQAA 3ZBDA 4C8QG 4JPBW 1I5OB 4OVAA 3JSCA 1Y0MA 1RABB 5KCOA 4XTVA 2M51A 4JRKA 4EMGA 2MAMA 3QWXX 4JJCA 4QKUA 4DEYA 3E1SA 2LX7A 2RQUA 3PVQA 3JCMb 2PTKA 4LDWA 1FMWA 1PM3A 2GTOA 3TCJA 2M0OA 2MWOA 1KHCA 1JRIA 1UGVA 4IUUA 5D6XA 1IREB 3QYHB 1YHQA 2DZCA 1ZUKA 4ME7A 2QG9B 4QVZA 1Y96A 3BDLA 1I07A 1D1CA 5CKBA 1P92A 4M7AC 2MF2A 3SDZA 4L6V5 1OYXA 3SHWA 2HKQB 1BI1A 3LWHA 1C1AA 1S1NA 2LP5A 1RI0A 4RTUA 1S72A 1QLYA 1W2BP 4FSSA 4M78C 3JCMQ 3PIPA 1EFNA 2E3IA 5GANj 1RAAB 4ZTFA 1VUBA 5D6WA 4KH0B 3JCMg 1Z9ZA 2K6DA 1QVGP 2QDLA 4Z8AA 1PSEA 4PJOA 1Q7YC 1Q7YR 3HP9A 1VA7A 4CC3A 1G3WA 1UHCA 1G83A 4R0KA 1VQ6T 3X26B 4HCKA 1M1KU 3CMAT 2K3YA 5I2MA 1G8XA 2KMTA 1WHJA 1WYXA 4Y91A 1M9SA 4PFPA 3I9QA 4B9XA 4OMFB 1I5LA 2J05A 3PTAA 2X4YA 4PJOG 3FLGA 2AKKA 2DXUA 3ZEHA 3CCLQ 2L3QA 1D1BA 3META 1QVGA 3JCMd 5LJ5f 3CMAQ 1K9MU 3OMCA 1KD1C 2GQVA 2JNGA 1KD1R 1HJDA 1YHQT 1K76A 2EQUA 3M0TA 2G6FX 2K2MA 2LMJA 1M8MA 2LX9A 3QIIA 1KQSP 2ATCB 4J9DA 4KULA 3OYHA 4JJBA 2ZPHB 2GGRA 4EMKA 5GJWB 2A36A 4J6XA 1OQKA 4C92D 1FXXA 2G3RA 1OEBA 3U23A 2RI2A 5KYWA 2CP2A 2CREA 2EGEA 2PU9B 4GLKA 4ZN1A 4F7UE 1VQPQ 2KT8A 2EYWA 3EGUA 3HSBA 2ZPGB 2E64A 3I35A 3CC4A 1UTIA 4R55A 1UGRB 1RAGB 2JUFA 2KROA 4BDZA 3LYIA 3TREA 1S72Q 1KQSA 4BI3A 2EQIA 3EFSA 1YN8A 5C0MA 4C0ZA 2CH4W 4C0FA 1TOVA 1VQKA 1N27A 2D6FA 2AZSA 3CMEQ 1I1JA 3L1AA 1AT1B 2VVKA 4FSXA 4DA4A 2DTOA 2JN0A 2HSPA 2DTHA 2K9GA 2FB7A 1M3BA 1K8AC 1HXDA 3OYYA 2CH4A 5CKFA 3VS6A 1K8AR 3RUXA 3OYNA 4RCCA 3PE0A 2BZYA 1UB4A 2F2XA 2RF0A 2DXBA 3I5RA 1Q81U 4E7IA 2E5KA 1ARKA 1LNXA 1BB9A 4LDUA 2L3SA 3S3MA 1NG2A 2MOXA 1E6HA 5I22A 3BE3A 1YBYA 2YLBA 5LJ3f 4E7ZA 2O9VA 4LD9K 4EIKA 4EMKC 3LGLA 1ZHIA 1QWFA 3EH1A 2FG0A 3J80E 1X2KA 2RQTA 7AT1B 1NJIC 3CXCP 3E19A 1NJIR 2Z0WA 3M57A 3CC4T 1BK2A 2COYA 5DY9A 2RI3A 3OB9A 1TH7A 4IURA 3CCSA 2YUOA 4C0DB 4M7DA 1M2VA 2FZKB 1M30A 1W70A 2HDAA 3RBBB 1AVZC 3M0PA 4EPCA 2QGFB 5HKCA 1M3CA 1GBQA 1TUCA 4NL3A 1K73C 1D3BA 1VQKT 3M4GA 2NUTB 1AWOA 3VS2A 4LNPA 2VGNA 4J6WA 2DJZA 5KYUA 2DLPA 2JZ2A 1W6XA 3EGDA 4M7DG 3INZA 1JBMA 3MEWA 2RQWA 3CXCA 3CPWP 2XD0A 3PMIA 1EZZB 4J9GA 3MEUA 5CQYA 5CR2A 2P4TA 3VKIA 2LT1A 1JXMA 1VQKQ 1N8RC 1TSFA 2BZXA 4FM4B 1YP5A 4F14A 4XK8E 2VWFA 1AEYA 1JO8A 1Z9QA 5A2QE 1VQLA 4PNOA 1UG1A 5KYYA 4M7AD 4C5IA 1Q7YU 1D1AA 1TWBA 3CQTA 3M4YA 1UGSB 1UEBA 2A28A 4MMLA 5CIUA 1TU0B 2COWA 2O4XB 2E1HA 2ZAEA 2WSEE 1X2QA 1H8KA 1QKWA 1U5SA 2MCNA 2XI9A 1UGPB 4J9EA 4JZ4A 4BACA 2DL7A 4ELZC 5HK3A 1VQMA 5GAMf 2K5LA 2LQKA 3FIFA 5HY6A 3RESA 1OOTA 2QDYB 4C8QD 3S3NA 2LQ8A 2QQRA 2P0QA 2IVWA 1ZA1B 2YUQA 3OYAA 4Z88A 1K4US 3CCST 1KC8C 2DD4A 3L42A 4CC2A 4M7DC 2DBMA 2KXDA 2LZ6B 1KC8R 2CZ7B 1W2BS 1ZA2B 1M1FA 4M4ZA 1PCXA 5FRNA 5GMKi 2R5AA 5HCKA 1TUDA 4PJJA 1FMVA 2QI2A 4NL2A 1GCQA 3TEEA 3CCSQ 1IHWA 3A5ZB 1K1ZA 5DLQE 3CC7A 2ED0A 3DB3A 2J6KA 4AFSC 2GFAA 3CCVQ 2OI3A 3CBMA 3RKWA 3OYKA 3KXTA 5GAN8 1YI2Q 2EGCA 2PQWA 4ZGEB 1OZ2A 3HTRA 4II1A 3PVLA 2HEQA 3FRNA 4RUGA 2ZPFB 3EG3A 4N4GA 4QVCA 2DXCA 1OV3A 1VQLT 1I4K1 2HBWA 3EG0A 2Y4YA 3I5SA 4QQGA 1IB8A 3JCMc 1OX9A 2XKOC 4A4KA 2KY9A 4DQ2A 1D0ZA 2KGTA 1VQ4A 1I0CA 4N0AC 1M90C 3OBYA 3JCMe 4FW2A 1N6AA 4QVDA 4RMOA 1MNEA 4D8KA 3VS4A 3NTIA 4CC4B 2OJ2A 3EG9B 2WSFE 1VQMT 2XMFA 5GAN2 1WA7A 1NE8A 4C0DC 2A37A 4HA8A 4Z89A 4PJLA 3BW1A 3P8BB 3I55A 2AHJB 2OTJT 2VUBA 2FPEA 4F7UB 2MK5A 4UC4A 2X3XD 4LDXA 2DL4A 4PJOD 4C92F 1E6GA 1RLPC 2EYZA 2KXCA 5IHIA 1V29B 3RR6A 2EQKA 5FWBA 3TSWA 1LJOA 3A1PA 3H0FA 2C06A 2H3JA 4M75E 1WHKA 4XTZA 1GCQC 3CC7T 2JW4A 1PSFA 3A8HB 1ZUUA 3MPUB 3ULRB 2K57A 3RNJA 3VS5A 4J9CA 4J9HA 3ZFJA 2R57A 1XNIA 1QCNA 3M53A 3JB9G 3ER0A 5FU7C 1AD5A 1ZSZB 3CC7Q 2DTIA 3VYGA 1CKBA 3R6NA 1JJ2S 1VYVA 2EQJA 4XQ3A 1WIEA 4M77A 3UPUA 1K73U 2EWNA 1GBRA 3G6EQ 1VQ4T 3JCMP 2QTXA 5GAOp 2DL5A 4FYYB 3HPWA 3JB9J 4LUEA 4XU1A 2FEIA 1HYOA 1G3TA 4F04B 4PK4A 3V8LA 4F7UA 3EGXA 2QGGA 2K5FA 2V8IA 3JCMW 2X4JA 1WHHA 3JAME 1Q82U 1VOMA 2JXBA 2ZGWA 5KCHA 4M77G 4AG2C 1R8OB 2MI6A 3I55T 2ZCFB 4E2FB 1N8RU 3UT1A 4OB3B 1RL2A 1SF9A 2O88A 3S6WA 3QG1A 4ZGDB 2DYBA 1Y57A 3E9FA 2F5KA 2YXYA 1SSFA 1PKTA 4F7UG 3JB9I 1PD1A 4J9BA 2O01E 1MV3A 4A4EA 3I55Q 3N5BB 1RAEB 2JM9A 3CCUA 2D0NA 3SD4A 3CCEQ 3M0RA 2RK1A 4LE9A 2WACA 3VS7A 3E2UA 3EHRA 2L3RA 4F16A 4QT7A 4KGVB 3OSVA 8AT1B 4RG8A 4M77F 5LL6S 5AYFA 2FPDA 3G4SA 4F17A 3QHSA 3VS1A 3EFOA 3OW2P 1NBEB 2E65A 2YUPA 2JS2A 2GNCA 1ZUYA 2EYQA 3LW5E 3CPWS 1GCPA 2LVMA 1MMGA 5LJ5j 3VUZA 3ASKA 1M8VA 2F5TX 3LWIA 3JCMJ 4CC7A 1BCMA 3MCAB 4OP0A 3DLMA 3UWNA 2PVOB 1C6VX 1RLQC 2QA4Q 3LLRA 3GPLA 1NLOC 4M7AF 3J7AF 1VQ8Q 1AOJA 3OW2A 1DJ7B 4PFOA 3CD6Q 4BD3A 2OAWA 4J9FA 1TXQA 5GANg 2RM4A 2L3PA 3OBWA 5IXFA 4M78F 5GMKj 3A8LB 4KGXB 3OYEA 2EYXA 3Q1JA 4N4HA 1VQPA 4C8QF 1M90U 2XU8A 1N5ZA 4C92E 1ZQ1A 2RHIA 2JVVA 1X6OA 3P8HA 3RKXA 5I2SA 1PD0A 1XQHA 4PJNA 4FIBA 1IRXA 1ACMB 5HK0A 2JMCA 1IXDA 3G4ST 3NHNA 2P84A 2YLCA 3EHQA 2L89A 5GANd 2D9TA 3CCUQ 2DXTA 2HMAA 3CMEA 2NUPB 1WDXA 2K4YA 5M9OA 4JZ3A 2JS0A 2IPOB 1YITA 3G4SQ 1GFDA 1I81A 3GF5A 5GMKm 1Y71A 3GP8A 2DK3A 3CCLT 1BCOA 3QKJA 3OYCA 4X34A 4ZGJB 1RAIB 2V26A 2DBKA 4A4FA 1OPLA 5LJ3j 1QP2A 4BI4A 3FB9A 2FHDA 2ECZA 4AFZC 3CBPA 2DVJA 5ECAA 2LQWA 4E47A 4WF2A 2ESWA 2A08A 1QVFS 5J3BA 3OYIA 2DZ9A 4C5GA 2DA9A 2RD1A 2NWMA 2QYZA 1ZX6A 1VQPT 3RMSA 2LRQA 5KE2A 3V7RA 1B34B 5GMKl 4E7SA 3WVEB 2MWPA 4M75B 4JUVA 4PJOF 2E70A 2DM1A 3EG1A 1KQ1A 4VUBA 3EFRA 1S72T 1TTHB 4HXJA 3VYHB 4HT8A 1UDLA 4AFQC 2R5MA 2VXEA 2RJEA 4GLMA 1NZ9A 3CMET 2DFUA 3EG2A 2HZYA 3UF4A 1OULA 3MHXA 2KK4A 4J5YA 2BIVA 2EYYA 3OS2A 5IHKA 1O9SA 3QYGB 5GAN5 2HSEB 2QQBA 1BBZA 1K9AA 4FT4A 5FROA 1NEBA 2ABLA 2CKKA 2DE0X 4ORZA 2FZGB 3PNWC 4K11A 1JQQA 4CRIA 3VUBA 1YITQ 1R77A 4ATOA 2EFIA 3EH2A 3A8OB 4J7IA 1HD3A 1IGUA 4D6WA 2ZPEB 2LNVA 5KYXB 3FJ5A 5GAMj 2P0KA 3OMGA 2YT6A 4J7FA 2J6FA 4M7AE 1IGQA 5CVIA 2X4XA 4OMPA 1H3HA 2CUBA 3JV3A 3UDCA 3HHTB 4KUDK 1WQ7A 2I0NA 3C12A 4AG1C 2D8HA 2MIOA 2B8AA 1GFCA 4M78E 1XOVA 1AHJB 4GBQA 5D7UA 4MMKA 3R6OA 3HFNA 5IH2A 4JS4A 3OS1A 4DBFA 4M75G 4C8QE 4E6RA 3X20B 2DETA 2HQHA 2M16A 4OMQA 3PFSA 4PL6A 4BE2A 2RO0A 2RMOA 4FU6A 4E7HA 2XG8D 2COZA 3C94A 1QCFA 4M77D 3L2VA 3JCMf 3G7ZA 3CCVA 5IXBA 2BTTA 2KRSA 1YI2A 2QEXA 2OTLA 2K3XA 2GTJA 2EBPA 5EG2A 3G71Q 1XJWB 3CCQQ 1PWTA 3RIRA 2QXFA 2M02A 1M5Q1 3OY9A 1A0NB 3A8MB 2P4RA 4J9IA 3VU3C 2E3HA 2RHXA 1YJWQ 3LX7A 2IIMA 4AMCA 3QXEB 5IT9E 4OB0B 2DAQA 2RJCA 2V1RA 2VKNA 3SWNB 2H8HA 1NM7A 4O5VA 2A3LA 4M75C 3OYMA 2LCLA 1TG0A 4N0AA 4M7DF 2LQNA 3LH0A 4A4GA 2BE7D 5GAOr 4M78D 4B6MA 2FO0A 4MZTA 1LOJA 3H9NA 4C92B 1QCOA 4DBRA 2R58A 1YJ9A 2M0YA 3M9QA 2AK5A 4DBQA 2O2OA 2J7IA 1MMDA 4AT1B 1KD1U 4PJOE 2RJDA 3KBGA 1KG1A 2AKLA 2M9UA 2NUTA 2CP7A 4MZPA 5AT1B 1IHVA 3GLXA 4IUPA 1SHGA 3L2UA 2PUOB 2QQSA 2BKDN 3CCVT 2LJ0A 1WFWA 1YI2T 2MMPA 3D7SB 2NUZA 2OTLT 3CBOA 3I56Q 5GANe 2D1XA 2DKGA 4EMHA 1U8RA 1QVGS 3M55A 2RNAA 1MMNA 1PG5B 1QQJA 3M0SA 1WXTA 2DILA 2QEXQ 4ELYC 3SFMA 3P8DA 2OTLQ 2PVDB 5DM7R 2RB6A 3G6EA 4PLLA 5LJ5h 2O4XA 1RACB 4KBMB 5GAN7 2YWWA 4RTXA 1U1SA 2ZPBB 1AZGB 1NEGA 4JJNK 4FL6A 4X1VA 4Q5WA 2DMOA 4CI0C 1G2BA 1H3ZA 1SRMA 1WX6A 3CCRA 4RTVA 1AWJA 1KIKA 1QKXA 4OGEA 2DO3A 2DRKA 2QQ9A 3RERA 3NTHA 1K8AU 1KQSS 5GMKh 5GAOn 3CCEA 5A0LA 2DF6A 2DL8A 2YSQA 2C0IA 3M0QA 2VYTA 1BIAA 2LT4A 4WCIA 1WI7A 1YJ9Q 1UE9A 4O6JA 2KYBA 1R0CB 4A4HA 2HKNA 1YJNQ 3A8GB 2RPNA 5CKDA 8ATCB 2VB6A 4EDUA 2KSSA 2X9HA 3JCMX 5GANh 2L0AA 5GAN4 3PGGA 1NJIU 3OYDA 2V8JA 3M5AA 1M1GA 2X3WD 3NMZC 3SWNC 1UFFA 2VC8A 1W4SA 1JEGA 3G6ET 3MEVA 4C5HA 2QA4A 3X25B 2HBPA 1X69A 4N4IA 3TVTA 2VV5A 1M1KR 2K2VA 3X24B 2JTFA 2DL3A 1HK9A 4M7AB 4PKCC 3UA6A 3C4SA 1VQ8A 3EG9A 3MKDA 4C92C 4FYXB 3UA7A 2K7AA 2GF7A 4WTOB 3CD6A 1PRMC 1WQWA 3IQLA 1WZOA 4HVWA 4KT0E 1K0XA 5CQXA 5LJ3h 4IUTA 1K9MC 2RI5A 3G1JA 4M78B 3NTKA 2W0ZA 1K9MR 2O31A 4LUDA 1QP3A 3CCRT 2HL3A 3JB9F 4M7DE 1VYTA 4Y92A 2XHCA 3MJXA 4C8QB 1AWXA 3CCET 3VS0A 3QWYA 2HQXA 2J6OA 2CYZB 1NYGA 1OU9A 4MZMA 3CCRQ 2YHTA 1IO6A 3OSSC 3V8KA 2CP6A 1YWPA 2RK2A 3V7CA 1QVPA 2YUNA 3CXCS 2IG0A 5J39A 5LJ5g 4X9DA 4JRQA 3CCMQ 2BE9B 5GAOq 4HVUA 1G3YA 4OB2B 2HCKA 3M0UA 3DB4A 3H41A 2JOYA 5DLOA 4IUVA 1VQ9A 3QUIA 1NPRA 4GY5A 3GOXA 1ZSZA 4RTTA 1U3OA 4C5EA 2CZ1B 5EC7A 1RUWA 4JLIA 4PLIA 1X75C 3QBYA 4F7UF 1KC8U 1WXBA 3C95A 1MMAA 2QA4T 1OZ3A 1UECA 3LH5A 4OMLA 4A63B 1Y96B 5GAN6 4NOYA 2HNIA 5LJ5d 1G3SA 2EKHA 1VQ8T 2EIFA 1K0SA 1M3AA 2WSCE 4J8OA 3FJPA 2KNBB 1VQ7A 1ZBJA 3CD6T 2CP0A 4BI8B 2EW3A 4KGZB 3O8VA 4JJDA 2KBTA 3QJYA 1MV0B 1MUZA 1B7TA 2C0TA 3V7SA 1X01A 2DYIA 1FYNA 2X4WA 3V8JA 1C0MA 3KUFA 3AT1B 5GAMh 1Q81C 2C0OA 1GRIA 3LGFA 1H641 2E41A 5KYNA 1Q81R 4JLGA 4M7DD 2KI7A 2EJGA 3J81E 1VQ6A 3MP8A 5KH6A 3MP1A 2KEAA 1M27C 4PJOB 4IUQA 3O5ZA 1VYUA 2VASA 2KYMA 3A98A 2ZZDA 2E12A 2JM8A 4RCBA 3BDUA 5C6SA 2KDSA 2ROTA 3CCUT 4TVRA 1YIJA 4A54A 3F70A 2L2PA 1VQ9T 2XDDA 1ZSGA 1BI3A 2DIQA 1QW1A 1ZSZC 2E4HA 2J06A 1CKAA 1VQNA 5LJ3g 1RI9A 2XK0A 4IIMA 3OYBA 4E7JA 1SEMA 1VQ9Q 1M4ZA 5L8RE 1WJRA 1VQOA 2CP3A 1YCYA 3CC2A 3HRSA 2BZ8A 3GNFB 4EMKB 1VQ7T 4HCZA 2LDMA 1KHIA 2DVEA 2O9SA 5KYWB 1VQ5A 4C8QC 5KE3A 2PZ1A 2X35A 1X27A 2RHUA 4AFUC 5LJ3d 3AHUA 4IIOA 4L59A 4OF1A 4RTYA 2E6ZA 2RHYA 1VQ7Q 3MO8A 1TUGB 2CZ0B 4QW2A 4RG2A 2LCSA 4E7KA 4BY6B 1Q86C 2JT4A 1W2BA 4QQDA 1Q86R 2HQEA 1FMKA 3CEYA 1OI1A 1OPKA 1W1FA 2ROLA 1SRLA 3JB9H 4BUGA 2K3BA 1VQ6Q 1YIJT 3H0HA 3T9NA 1AWWA 2E10A 4FYVB 1U1TA 4ZN3A 1X43A 2DD5A 2M1HA 2NUPA 2DPPB 3OS0A 4A53A 1VQNT 4OB1B 1RADB 2FPFA 1BI0A 1YIJQ 4J6YA 3GNGA 3G71A 1T0JA 1VIFA 4M77E 5GAMg 1GL5A 1UJYA 2NYSA 2D0QB 3CCQA 1YHQQ 1VQOT 1O75A 3CC2T 2XDPA 1YITT 2FRYA 1FWZA 3X28B 2V1QA 3VS3A 1VQNQ 1Q95G 2RQVA 2X51A 1I8FA 1WNLA 2ZPIB 1YJWA 2D8JA 3M59A 1V76A 2LNHB 4JDSA 3TQ7P 1VQ5T 4BB7A 3L2QA 1VQOQ 4E7LA 3HRTA 4XTWA 2RJFA 1EIFA 3CC2Q 3RDVA 1RAHB 4PJOC 4HCCA 3OQ5A 4LN2A 2YDLA 1OX8A 5CK9A 2DJQA 3PIOA 3OYJA 4M7DB 1M2VB 5GAMd 3L2RA 3QPHA 3HRUA 1R0BG 1B34A 2LJ1A 1VQ5Q 1JXOA 3BFMA 4ZNXA 5GANf 2RH2A 3WXMB 4KH1B 2QAZA 1JJ2P 4M75A 2F2VA 3JB9D 1D3BB 1JB0E 4FYWB 1T0HA 2SEMA 3REBB 5KYUB 5IHNA 1G5VA 3EGDB 1UHFA 4DOVA 4BE1A 2F2WA 1KJWA 1SPKA 4X9CA 3VRZA 2E5QA 4L5GA 3M56A 3THKA 4FT2A 5I21A 2LJ3A 4ESRA 1PC0A 1WHGA 1ZLMA 2F1LA 4YTLA 4LD6A 2HD0A 1V1CA 1PRLC 3I56A 4XU0A 2DNUA 1BYMA 3G71T 2EKOA 5CKEA 2MYSA 5KYYB 1JJ2A 4P5NA 2JMAA 3CCQT 1H92A 2FZCB 2DERA 3L2WA 5J26A 1SKUB 1TS9A 4PFZA 3QZ9B 1YJWT 3OW2S 1NLPC 2HL5C 4XTXA 1YWOA 4XTYA 2RHZA 4M75F 2CP5A 5KYXA 6AT1B 1D09B 2QTVA 3NPFA 2YRDA 5A0DA 4PJMA 4BY6C 5LJ5e 3M54A 1UUEA 3H8ZA 5CKHA 3CC4Q 4Y28E 1SG5A 1K73R 5GAN3 3JCMV 1LPLA 2SRCA 3OYGA 1N9RA 4DBHA 4XU2A 2LTOA 4JRPA 1B07A 3HFOA 1Q82C 4LDYA 1WLPB 3M58A
chains in the Genus database with same CATH topology
4EDUA 1ZBXA 3URGA 2PU9B 4GLKA 2KSSA 4ZN1A 4F7UE 4M7AF 3J7AF 2FL7A 2PUKB 3JCMX 5GANh 3OW2A 3HSBA 2ZPGB 2E64A 3HL8A 3CC4A 1DJ7B 5GAN4 3PGGA 2EAYA 1NJIU 3OYDA 2F69A 5GMKe 4R55A 2V8JA 4BD3A 1UGRB 1M1GA 3M5AA 2NLUA 3OYFA 3SWNC 2JUFA 5GANg 2RM4A 2VC8A 4BDZA 3OBWA 3LYIA 3TREA 1W4SA 4M78F 3G6ET 3QSUA 2A7YA 5GMKj 1KQSA 3MEVA 4BI3A 3A8LB 3OYEA 4C5HA 3EFSA 4OGCA 1Y7XA 3Q1JA 5FU7B 5C0MA 2QA4A 3X25B 4C0ZA 2CS7A 2HBPA 3I56T 1YJNA 4C0FA 2EQMA 4N4IA 4N4HA 2VV5A 1Q86U 2K2VA 3CPWA 1VQKA 3X24B 1Y07A 2JTFA 1VQPA 2L8DA 1N27A 1HK9A 4M7AB 2D6FA 4PKCC 1WJSA 3C4SA 4C8QF 1M90U 1VQ8A 2XU8A 4C92C 2JTMA 4MDWA 4C92E 1ZQ1A 2GF7A 3FEOA 2KAFA 3CPFA 1UGQB 2RHIA 1WQWA 3L1AA 3CD6A 2GFUA 2JVVA 4FSXA 2QEXT 4DA4A 2DTOA 1X6OA 3P8HA 4KT0E 5CQXA 3RKXA 5LJ3h 2JN0A 5I2SA 2OTJA 2DTHA 4IUTA 1XQHA 1K9MC 2RI5A 4FIBA 5HK0A 4M78B 3NTKA 2FB7A 3VV0A 1K8AC 1HXDA 3OYYA 1QP3A 3CCRT 5CKFA 3G4ST 3FC3A 2YLCA 4RKUE 5FU6B 3RUXA 3OYNA 2L89A 5GANd 2D9TA 3JB9F 4RCCA 4M7DE 5D6YA 2DXTA 2XHCA 1UB4A 4JRIA 2FVUA 2DXBA 4C8QB 3SWNA 1Q81U 4E7IA 3CCET 3CMEA 1LNXA 2XDBA 4XAXB 4LDUA 2K4YA 5M9OA 3S3MA 2HQXA 3E9GA 2CYZB 4MZMA 1YITA 2YHTA 1I81A 3GF5A 5GMKm 1YBYA 2YLBA 1Y71A 3OSSC 5LJ3f 3V8KA 3GP8A 2DK3A 3L2ZA 3CCLT 3QKJA 2RK2A 4LD9K 3V7CA 1QVPA 4EMKC 3CXCS 3LGLA 2IG0A 5J39A 5LJ5g 4X34A 4X9DA 4XU3A 3OYCA 1ZHIA 4ZGJB 4JRQA 5LJ3e 4C92A 3J80E 5GAOq 3NFCA 4J83A 3QJ6A 4A4FA 1G3YA 4OB2B 3TU4K 1NJIC 3CCJA 3DB4A 5LJ3j 2JOYA 1QP2A 3MEAA 3E19A 4BI4A 5DLOA 3FB9A 3M57A 4IUVA 3QUIA 1VQ9A 2FHDA 1BIBA 3CC4T 5DY9A 1NPRA 4GY5A 2RI3A 3OB9A 1TH7A 3CBPA 4IURA 3GOXA 5GAOm 3CCSA 4C5EA 2XIDA 4C0DB 4M7DA 3RKYA 4E47A 1YJ9T 4WF2A 2LC4A 3OYLA 4B9WA 2CZ1B 4C92G 4XTUA 1QVFS 4JLIA 4PLIA 1X75C 3QBYA 4F7UF 1N9SA 3CCMA 4EPCA 3VJPA 1KC8U 5J3BA 3OYIA 2DZ9A 3C95A 2QA4T 1OZ3A 4C5GA 1YJNT 2PVGB 5FRMA 5HKCA 5IAYA 4NL3A 2RD1A 1K73C 1D3BA 1VQKT 3M4GA 3JRZA 1Y96B 5GAN6 4NOYA 1VQPT 2HNIA 5LJ5d 4ZTJA 3RMSA 2VGNA 1G3SA 2DJZA 2LRQA 4J6WA 3V7RA 2EIFA 5KE2A 1B34B 1VQ8T 2JZ2A 4M77B 2WSCE 4J8OA 4M7DG 5GMKl 3INZA 3FJPA 2DIGA 3OA6A 1JBMA 2BUDA 3WVEB 1VQ7A 3MEWA 3CD6T 2XICA 3CXCA 4BI8B 2MWPA 4M75B 2XD0A 3PMIA 4JUVA 2E70A 4PJOF 2Y90A 3MEUA 5CQYA 1KQ1A 3O8VA 4VUBA 3EFRA 2EJ9A 2P4TA 3QJYA 5CR2A 1WPYA 1S72T 3V7SA 3VKIA 1X01A 2FYKA 2LT1A 2X4WA 5FLXE 3V8JA 1N8RC 1FX7A 4FM4B 3KUFA 5GAMh 1Q81C 3LGFA 1H641 2E41A 3VYHB 4HT8A 1KQ2A 4XK8E 3S3OA 3ME9A 1GXIE 3FDRA 4LDVA 5A2QE 1VQLA 4JLGA 4PNOA 4M7DD 5GAOl 2R5MA 2VXEA 2RJEA 2EJGA 5CO7A 3J81E 1NZ9A 4C5IA 1VQ6A 3CMET 4M7AD 1Q7YU 3MP8A 5KH6A 3MP1A 3M4YA 1UGSB 1UEBA 3MHXA 3DKMA 2KK4A 3HKSA 4MMLA 5CIUA 1QVFA 4J5YA 2BIVA 4PJOB 2O4XB 4IUQA 1M1KC 2E1HA 3BY7A 2WSEE 3OS2A 2GCXA 2ZZDA 1O9SA 2E12A 3QYGB 4RCBA 5GAN5 3BDUA 2XI9A 4NS5A 1UGPB 1VIEA 5C6SA 2KDSA 2DEQA 2OAUA 2QQBA 2YRVA 4FT4A 5FROA 2CKKA 4BACA 4HT9A 4ELZC 3CCUT 1IZ6A 5HK3A 2CGHA 2L5QA 1XTDA 3MP6A 5GAMf 4TVRA 3PNWC 4BDYA 1YIJA 4A54A 2K5LA 2LQKA 3FIFA 5HY6A 3RESA 3F70A 4CRIA 2QDYB 3VUBA 5GAMe 4C8QD 3CCJT 5IN1A 3S3NA 1VQ9T 2LQ8A 4ATOA 2EFIA 2QQRA 3A8OB 2P0QA 1BI3A 2IVWA 4HKEA 4J7IA 2DIQA 1QW1A 2XDDA 3OYAA 4D6WA 2ZPEB 3CCST 2LNVA 5GAMj 1KC8C 2DD4A 3L42A 1VQNA 4MDXA 5LJ3g 4M7DC 2XK0A 2RA2A 2P0KA 3PT9A 3OMGA 5A0GA 4J7FA 2CZ7B 1W2BS 4M7AE 3OYBA 3CCMT 1M1FA 4E7JA 3GIBA 5FRNA 5CVIA 2I2LA 2X4XA 5GMKi 2R5AA 3UDCA 3WVDB 2E6NA 3HHTB 4KUDK 1M4ZA 1WQ7A 5L8RE 1WJRA 3C12A 1VQOA 2QI2A 4DOWA 1YCYA 3CC2A 4NL2A 3HRSA 3PMTA 2B8AA 3TEEA 4M78E 3A5ZB 3JCMh 3GNFB 3OS5A 4BE0A 5DLQE 3CC7A 4C0GA 5CAIA 1XOVA 1NPPA 4EMKB 1VQ7T 1AHJB 2LDMA 3DB3A 1KHIA 4HCZA 2GFAA 2DVEA 5FU6C 4MMKA 2LCCA 3RKWA 3CBMA 3OYKA 3R6OA 5GAN8 3HFNA 3KXTA 4JS5A 4JS4A 4QQ6A 1VQ5A 2PQWA 4C8QC 5KE3A 3OS1A 4M75G 4ZGEB 4KUIA 1OZ2A 4C8QE 2X35A 3X20B 4II1A 2M16A 3PFSA 4PL6A 2RHUA 3FRNA 5LJ3d 4BE2A 2RO0A 2ZPFB 4FU6A 3AHUA 4QVCA 4N4GA 4E7HA 2DXCA 4L59A 4OF1A 2HAXA 2E6ZA 4V2SA 2RHYA 2CZ6B 2XG8D 1VQLT 2KVQG 3MO8A 1I4K1 2Y4YA 2CZ0B 4QQGA 4QW2A 4RG2A 3C94A 4E7KA 4M7AA 3SB2A 2VXFA 3JCMc 4M77D 5CCAA 4BY6B 3JCMf 3L2VA 2XKOC 3DLLA 1Q86C 4A4KA 1W2BA 3G7ZA 2KY9A 3CCVA 4HCBA 2Y4XA 4DQ2A 4QQDA 2HQEA 1BKBA 4M75D 3CEYA 3H6ZA 1VQ4A 2K5IA 1YI2A 4N0AC 2QEXA 1M90C 3OBYA 1OI1A 3JCMe 2OTLA 4QVDA 1N6AA 4RMOA 2K3XA 3JB9H 4M78A 2V8KA 5EG2A 3NTIA 4BUGA 2KQWA 1MGQA 1WGSA 2WSFE 1VQMT 5GAN2 1YIJT 1NE8A 4Z02A 3QO3A 3T9NA 1WJQA 3RIRA 2E10A 4C0DC 2QXFA 4M7AG 1U1TA 4HA8A 4ZN3A 1M5Q1 3BW1A 3OY9A 3P8BB 3QZ5B 3I55A 2DD5A 2AHJB 2M1HA 3A8MB 2OTJT 4C8QA 4IKFA 2EJFA 2VUBA 2P0PA 4F7UB 3VU3C 4UC4A 2RHXA 4LDXA 3LX7A 1MHNA 2DPPB 4PJOD 1BI2A 4A53A 3OS0A 4M78G 1VQNT 4C92F 3QXEB 4OB1B 3RMQA 5IT9E 4OB0B 2DAQA 1BI0A 2RJCA 3QDRB 4J6YA 4M77C 1V29B 3CCLA 2EQKA 3GNGA 3G71A 1VIFA 2VGMA 4M77E 3SWNB 5GAMg 4R56A 4O5VA 1LJOA 3EAEA 2C06A 2D0QB 3CMAA 3CCQA 2A3LA 2H3JA 2QQAA 4M75C 3ZBDA 3OYMA 4M75E 4C8QG 1VQOT 4OVAA 2LCLA 3JSCA 1O75A 3CC2T 2XDPA 4XTZA 4N0AA 1YITT 4M7DF 1FWZA 3X28B 5KCOA 3LH0A 4A4GA 1I8FA 3CC7T 1WNLA 2ZPIB 4XTVA 1PSFA 3A8HB 4M78D 5GAOr 1YJWA 2K57A 4MZTA 4JRKA 1LOJA 4EMGA 3M59A 4C92B 2MAMA 3ZFJA 4JDSA 2R57A 1VQ5T 3E1SA 1XNIA 2R58A 4BB7A 3JCMb 1YJ9A 4LDWA 3L2QA 3M53A 4E7LA 3M9QA 3JB9G 3HRTA 4XTWA 2RJFA 1EIFA 3TCJA 2M0OA 2MWOA 3ER0A 1KHCA 1JRIA 4IUUA 5D6XA 1IREB 3OQ5A 3QYHB 5FU7C 1YHQA 4HCCA 4PJOC 1KD1U 4PJOE 2RJDA 3KBGA 5CK9A 3PIOA 1KG1A 2DTIA 2DZCA 2M9UA 4ME7A 3OYJA 4QVZA 3VYGA 4M7DB 1JJ2S 5GAMd 1Y96A 4MZPA 3L2RA 2EQJA 3BDLA 4XQ3A 3GLXA 3QPHA 1P92A 3HRUA 4IUPA 5CKBA 3L2UA 1B34A 2PUOB 4M7AC 2MF2A 2QQSA 3BFMA 4M77A 2BKDN 3CCVT 3UPUA 1K73U 2EWNA 2RH2A 5GANf 3SDZA 4L6V5 1OYXA 3WXMB 1VQ4T 1YI2T 3JCMP 2QTXA 5GAOp 4M75A 2MMPA 1BI1A 3LWHA 3HPWA 3JB9J 3JB9D 1D3BB 1JB0E 3CBOA 2OTLT 4XU1A 1RI0A 5GANe 1S72A 1G3TA 2DKGA 3V8LA 4M78C 4F7UA 4EMHA 3JCMQ 2K5FA 2V8IA 1U8RA 3JCMW 3M55A 3PIPA 1QVGS 1G5VA 2X4JA 3JAME 5GANj 1Q82U 4DOVA 4BE1A 2ZGWA 4ZTFA 5KCHA 1VUBA 5D6WA 4M77G 1R8OB 2MI6A 4X9CA 2ZCFB 3I55T 1N8RU 2E5QA 4L5GA 3JCMg 3M56A 4OB3B 3UT1A 1RL2A 4FT2A 4ELYC 3SFMA 3P8DA 5I21A 2PVDB 3S6WA 5DM7R 2RB6A 4YTLA 3QG1A 4ZGDB 3G6EA 3E9FA 2F5KA 4PLLA 1SSFA 4LD6A 5LJ5h 2HD0A 4F7UG 1PSEA 3JB9I 1Q7YC 2O4XA 4PJOA 3I56A 4XU0A 4KBMB 5GAN7 3HP9A 2O01E 1BYMA 3G71T 1G3WA 2EKOA 5CKEA 1JJ2A 4P5NA 1VQ6T 1U1SA 4A4EA 3N5BB 3X26B 1M1KU 3CMAT 2ZPBB 2K3YA 3CCQT 3CCUA 5I2MA 3SD4A 4JJNK 2RK1A 2KMTA 2WACA 3L2WA 5J26A 4Y91A 1M9SA 4FL6A 4B9XA 4OMFB 2L3RA 1I5LA 4Q5WA 3PTAA 2X4YA 3OSVA 4CI0C 4PJOG 3FLGA 3QZ9B 1YJWT 4RG8A 4M77F 3OW2S 2DXUA 5LL6S 1VQMA 5AYFA 4XTXA 3ZEHA 1H3ZA 4XTYA 3META 2RHZA 3CCRA 1QVGA 3G4SA 4M75F 3JCMd 3QHSA 5LJ5f 1K9MU 3OMCA 1KD1C 4OGEA 2DO3A 2GQVA 2QQ9A 5A0DA 4BY6C 2E65A 3NTHA 2JNGA 1K8AU 3RERA 1KQSS 5GMKh 5GAOn 5LJ5e 3CCEA 5A0LA 3M54A 1YHQT 3H8ZA 2EYQA 5CKHA 2EQUA 3LW5E 3CPWS 2VYTA 1BIAA 2LVMA 4Y28E 5LJ5j 5GAN3 3QIIA 2LX9A 2LT4A 3JCMV 3VUZA 3ASKA 1M8VA 2F5TX 3LWIA 4KULA 3OYHA 3JCMJ 2ZPHB 4O6JA 4EMKA 1N9RA 3MCAB 4OP0A 3DLMA 3OYGA 4J6XA 4XU2A 2LTOA 3UWNA 4JRPA 4C92D 1FXXA 2PVOB 2G3RA 4A4HA 3HFOA 3LLRA 1Q82C 3A8GB 2RI2A 4LDYA 5CKDA 3GPLA 3M58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZC A;  4JLI A;  4F7U F;  2DVE A;  1N9S A;  4MMK A;  4M7D B;  5GAM d;  1Y96 A;  3RKW A;  2DZ9 A;  4F7U E;  4M7A F;  5GAN 8;  3HFN A;  4XQ3 A;  4M7A C;  4C8Q C;  3JCM X;  1B34 A;  2RD1 A;  5GAN h;  4NL3 A;  3BFM A;  4M75 G;  4M77 A;  4C8Q E;  1D3B A;  2E64 A;  3HSB A;  2EWN A;  3M4G A;  5GAN f;  3PGG A;  5GAN 4;  1Y96 B;  2EAY A;  5GAN 6;  4NOY A;  2HNI A;  5GMK e;  5LJ5 d;  4J6W A;  2DJZ A;  3JCM P;  2QTX A;  3V7R A;  4M75 A;  5LJ3 d;  1B34 B;  5GAO p;  3SWN C;  3JB9 D;  4M77 B;  3JB9 J;  5GAN g;  1D3B B;  2RM4 A;  2VC8 A;  3INZ A;  3FJP A;  4XU1 A;  5GAN e;  4QVC A;  1JBM A;  5GMK l;  4M7D G;  4M78 F;  4V2S A;  3QSU A;  2DKG A;  3V8L A;  1I4K 1;  4M78 C;  4EMH A;  4M75 B;  4F7U A;  5GMK j;  3JCM Q;  4JUV A;  4PJO F;  3EFS A;  3AHU A;  3JCM W;  2Y90 A;  4M7A A;  3SB2 A;  2VXF A;  1KQ1 A;  4M77 D;  3EFR A;  2EJ9 A;  3JCM f;  3JCM c;  5GAN j;  1WPY A;  3V7S A;  1X01 A;  2FYK A;  2ZGW A;  4DQ2 A;  4M77 G;  3V8J A;  4X9C A;  4M75 D;  1HK9 A;  4M7A B;  5GAM h;  4N0A C;  3JCM g;  4C8Q F;  1H64 1;  2E41 A;  3JCM e;  4HT8 A;  1KQ2 A;  5I21 A;  4C92 C;  4QVD A;  4C92 E;  3JB9 H;  2RB6 A;  3L1A A;  4M78 A;  4PNO A;  1WQW A;  4M7D D;  5GAO l;  2VXE A;  2EJG A;  5LJ5 h;  4M7A D;  2DTO A;  4F7U G;  1MGQ A;  3JB9 I;  4PJO A;  3RKX A;  5LJ3 h;  2JN0 A;  5GAN 2;  2DTH A;  4XU0 A;  3QO3 A;  3RIR A;  2E10 A;  4M7A G;  1U1T A;  4HA8 A;  4M78 B;  1M5Q 1;  3BW1 A;  4MML A;  5GAN 7;  2FB7 A;  1HXD A;  4J5Y A;  4PJO B;  1U1S A;  2E1H A;  3BY7 A;  2YLC A;  4C8Q A;  2EJF A;  3RUX A;  5GAN d;  3JB9 F;  4RCC A;  5GAN 5;  4RCB A;  3VU3 C;  3BDU A;  4F7U B;  2DXT A;  4M7D E;  4Y91 A;  2DEQ A;  4JRI A;  1I5L A;  4PJO D;  4C8Q B;  4A53 A;  4M78 G;  3SWN A;  4HT9 A;  4C92 F;  2CGH A;  5GAM f;  1LNX A;  4PJO G;  4A54 A;  4M77 F;  3FIF A;  2DXU A;  4J6Y A;  3RES A;  4M77 C;  4XTX A;  4XTY A;  4M77 E;  3SWN B;  5GAM g;  5GAM e;  4C8Q D;  1LJO A;  4M75 F;  3JCM d;  2YHT A;  3QHS A;  5LJ5 f;  4M75 C;  1I81 A;  5GMK m;  2YLB A;  5LJ3 f;  3V8K A;  4M75 E;  4C8Q G;  3L2Z A;  3RER A;  2E65 A;  3V7C A;  4EMK C;  4XTZ A;  5LJ5 g;  4N0A A;  4X9D A;  4XU3 A;  5GMK h;  5LJ5 e;  5GAM j;  5GAO n;  5LJ3 g;  4M7D F;  4PJO E;  4M7D C;  5LJ3 e;  4C92 A;  1I8F A;  1WNL A;  2RA2 A;  5GAO q;  4XTV A;  5GAO r;  4M78 D;  4M7A E;  2K57 A;  4JRK A;  1LOJ A;  1BIA A;  4EMG A;  3GIB A;  5LJ5 j;  4C92 B;  5GAN 3;  2I2L A;  3JCM V;  5LJ3 j;  1M8V A;  5GMK i;  3FB9 A;  3QUI A;  3JCM b;  1BIB A;  3JCM J;  1WQ7 A;  5DY9 A;  1TH7 A;  4EMK A;  1N9R A;  3JB9 G;  4OP0 A;  1YCY A;  4XTW A;  4J6X A;  4NL2 A;  4XU2 A;  5GAO m;  4C92 D;  4M7D A;  4M78 E;  1JRI A;  3RKY A;  3JCM h;  4PJO C;  3HFO A;  4WF2 A;  5CAI A;  4C92 G;  4EMK B;  2DTI A;  4XTU A; 
#chains in the Genus database with same CATH topology
 2FRW A;  1ZBX A;  3URG A;  1Q82 R;  1U06 A;  1X6B A;  2FL7 A;  1N8R R;  2PUK B;  3HL8 A;  3ZL7 C;  2EAY A;  2F69 A;  5GMK e;  3OYF A;  2NLU A;  1RAF B;  3QSU A;  2A7Y A;  1T3L A;  5FU7 B;  4OGC A;  1Y7X A;  2CDT A;  3I56 T;  4ANJ A;  2CS7 A;  2YRC A;  1YJN A;  1WXU A;  2EQM A;  5L23 A;  1Q86 U;  4D8D A;  3CPW A;  1Y07 A;  2CUD A;  2EVR A;  2L8D A;  1WJS A;  2QK0 A;  4LXC A;  2JTM A;  4MDW A;  1KSW A;  3FEO A;  2KAF A;  3CPF A;  1UGQ B;  1J3T A;  1QWE A;  2GFU A;  2QEX T;  1B3Q A;  1T3S A;  2OTJ A;  1OU8 A;  3VV0 A;  2JTE A;  4OMO A;  3FC3 A;  4RKU E;  9ATC B;  5FU6 B;  2KRM A;  5D6Y A;  2B86 A;  4JRI A;  2FVU A;  2JJ9 A;  3SWN A;  2RN8 A;  3QDF A;  1SSH A;  2XDB A;  4XAX B;  3E9G A;  2A0F B;  2AT1 B;  4RTW A;  3L2Z A;  2EGA A;  4KRT A;  2QAS A;  4XU3 A;  2AIR B;  5LJ3 e;  4C92 A;  3NFC A;  4J83 A;  3QJ6 A;  4FCY A;  3TU4 K;  3CCJ A;  1MND A;  3MEA A;  1UJ0 A;  3C0C A;  1BIB A;  1WHM A;  5GAO m;  2XID A;  3RKY A;  1YJ9 T;  3OYL A;  2LC4 A;  4B9W A;  4C92 G;  3REA B;  4XTU A;  1LCK A;  1N9S A;  3CCM A;  3VJP A;  2ENM A;  3UAT A;  1YJN T;  5FRM A;  2PVG B;  2MPX C;  2KR3 A;  5IAY A;  1ABQ A;  1M90 R;  3JRZ A;  1QVF P;  1D0Y A;  4ZTJ A;  5FW9 A;  1VQL Q;  2CSI A;  4M77 B;  2DIG A;  3OA6 A;  1WHL A;  2BUD A;  2XIC A;  3H0I A;  2Y90 A;  2PNI A;  2EJ9 A;  1KK7 A;  2GQI A;  4HVV A;  1WPY A;  2FYK A;  3EGX B;  5FLX E;  1F1B B;  1FX7 A;  1KFZ A;  1KQ2 A;  1VQM Q;  3S3O A;  3ME9 A;  1GXI E;  3FDR A;  4LDV A;  5GAO l;  5CO7 A;  2OTJ Q;  1QVF A;  3DKM A;  3HKS A;  1LVK A;  1M2O A;  2DRM A;  1M1K C;  3BY7 A;  2GCX A;  1YNZ A;  4NS5 A;  1VIE A;  2DEQ A;  2OAU A;  1X6G A;  2YRV A;  1HSQ A;  4HT9 A;  1QMC A;  1IZ6 A;  2CGH A;  2L5Q A;  1XTD A;  3MP6 A;  4BDY A;  1EX4 A;  1D0X A;  3CCJ T;  5GAM e;  5IN1 A;  1PKS A;  3GBQ A;  4OMM A;  4HKE A;  2DX1 A;  1PNJ A;  4MDX A;  3EFO B;  4DEX A;  2RA2 A;  3PT9 A;  5A0G A;  2KRN A;  5FWC A;  3CCM T;  3GIB A;  4RTZ A;  2I2L A;  3CCJ Q;  1CSK A;  2W10 A;  2KT1 A;  3WVD B;  2E6N A;  4DOW A;  3PMT A;  1YFN A;  5I11 A;  3JCM h;  4BE0 A;  3OS5 A;  3NGP A;  4C0G A;  5CAI A;  1NPP A;  5FU6 C;  4FW1 A;  3VRY A;  2LCC A;  4JS5 A;  1VQ4 Q;  4QQ6 A;  1E7O A;  3TSZ A;  4KUI A;  2CT3 A;  2KE9 A;  2ED1 A;  1YCS B;  3SEM A;  2HAX A;  2EPD A;  4V2S A;  2CZ6 B;  2KVQ G;  1SHF A;  4M7A A;  1JU5 C;  2VXF A;  2CSQ A;  3SB2 A;  5CCA A;  3DLL A;  4HCB A;  2Y4X A;  1BKB A;  4M75 D;  3H6Z A;  2K5I A;  2GBQ A;  4M78 A;  2V8K A;  3KFV A;  2RQR A;  2KQW A;  1MGQ A;  1WGS A;  4Z02 A;  2K79 A;  1BU1 A;  3QO3 A;  2DEU A;  1WJQ A;  4M7A G;  3QZ5 B;  1AZE A;  4C8Q A;  4IKF A;  2EJF A;  2P0P A;  2AZV A;  1NYF A;  5GJV B;  1MHN A;  1BI2 A;  4M78 G;  1ABO A;  3RMQ A;  4OMN A;  3QDR B;  1PHT A;  4M77 C;  3CCL A;  2VGM A;  4R56 A;  2CT4 A;  3EAE A;  2H3E B;  3CMA A;  2OX7 A;  2QQA A;  3ZBD A;  4C8Q G;  4JPB W;  1I5O B;  4OVA A;  3JSC A;  1Y0M A;  1RAB B;  5KCO A;  4XTV A;  2M51 A;  4JRK A;  4EMG A;  2MAM A;  3QWX X;  4JJC A;  4QKU A;  4DEY A;  3E1S A;  2LX7 A;  2RQU A;  3PVQ A;  3JCM b;  2PTK A;  4LDW A;  1FMW A;  1PM3 A;  2GTO A;  3TCJ A;  2M0O A;  2MWO A;  1KHC A;  1JRI A;  1UGV A;  4IUU A;  5D6X A;  1IRE B;  3QYH B;  1YHQ A;  2DZC A;  1ZUK A;  4ME7 A;  2QG9 B;  4QVZ A;  1Y96 A;  3BDL A;  1I07 A;  1D1C A;  5CKB A;  1P92 A;  4M7A C;  2MF2 A;  3SDZ A;  4L6V 5;  1OYX A;  3SHW A;  2HKQ B;  1BI1 A;  3LWH A;  1C1A A;  1S1N A;  2LP5 A;  1RI0 A;  4RTU A;  1S72 A;  1QLY A;  1W2B P;  4FSS A;  4M78 C;  3JCM Q;  3PIP A;  1EFN A;  2E3I A;  5GAN j;  1RAA B;  4ZTF A;  1VUB A;  5D6W A;  4KH0 B;  3JCM g;  1Z9Z A;  2K6D A;  1QVG P;  2QDL A;  4Z8A A;  1PSE A;  4PJO A;  1Q7Y C;  1Q7Y R;  3HP9 A;  1VA7 A;  4CC3 A;  1G3W A;  1UHC A;  1G83 A;  4R0K A;  1VQ6 T;  3X26 B;  4HCK A;  1M1K U;  3CMA T;  2K3Y A;  5I2M A;  1G8X A;  2KMT A;  1WHJ A;  1WYX A;  4Y91 A;  1M9S A;  4PFP A;  3I9Q A;  4B9X A;  4OMF B;  1I5L A;  2J05 A;  3PTA A;  2X4Y A;  4PJO G;  3FLG A;  2AKK A;  2DXU A;  3ZEH A;  3CCL Q;  2L3Q A;  1D1B A;  3MET A;  1QVG A;  3JCM d;  5LJ5 f;  3CMA Q;  1K9M U;  3OMC A;  1KD1 C;  2GQV A;  2JNG A;  1KD1 R;  1HJD A;  1YHQ T;  1K76 A;  2EQU A;  3M0T A;  2G6F X;  2K2M A;  2LMJ A;  1M8M A;  2LX9 A;  3QII A;  1KQS P;  2ATC B;  4J9D A;  4KUL A;  3OYH A;  4JJB A;  2ZPH B;  2GGR A;  4EMK A;  5GJW B;  2A36 A;  4J6X A;  1OQK A;  4C92 D;  1FXX A;  2G3R A;  1OEB A;  3U23 A;  2RI2 A;  5KYW A;  2CP2 A;  2CRE A;  2EGE A;  2PU9 B;  4GLK A;  4ZN1 A;  4F7U E;  1VQP Q;  2KT8 A;  2EYW A;  3EGU A;  3HSB A;  2ZPG B;  2E64 A;  3I35 A;  3CC4 A;  1UTI A;  4R55 A;  1UGR B;  1RAG B;  2JUF A;  2KRO A;  4BDZ A;  3LYI A;  3TRE A;  1S72 Q;  1KQS A;  4BI3 A;  2EQI A;  3EFS A;  1YN8 A;  5C0M A;  4C0Z A;  2CH4 W;  4C0F A;  1TOV A;  1VQK A;  1N27 A;  2D6F A;  2AZS A;  3CME Q;  1I1J A;  3L1A A;  1AT1 B;  2VVK A;  4FSX A;  4DA4 A;  2DTO A;  2JN0 A;  2HSP A;  2DTH A;  2K9G A;  2FB7 A;  1M3B A;  1K8A C;  1HXD A;  3OYY A;  2CH4 A;  5CKF A;  3VS6 A;  1K8A R;  3RUX A;  3OYN A;  4RCC A;  3PE0 A;  2BZY A;  1UB4 A;  2F2X A;  2RF0 A;  2DXB A;  3I5R A;  1Q81 U;  4E7I A;  2E5K A;  1ARK A;  1LNX A;  1BB9 A;  4LDU A;  2L3S A;  3S3M A;  1NG2 A;  2MOX A;  1E6H A;  5I22 A;  3BE3 A;  1YBY A;  2YLB A;  5LJ3 f;  4E7Z A;  2O9V A;  4LD9 K;  4EIK A;  4EMK C;  3LGL A;  1ZHI A;  1QWF A;  3EH1 A;  2FG0 A;  3J80 E;  1X2K A;  2RQT A;  7AT1 B;  1NJI C;  3CXC P;  3E19 A;  1NJI R;  2Z0W A;  3M57 A;  3CC4 T;  1BK2 A;  2COY A;  5DY9 A;  2RI3 A;  3OB9 A;  1TH7 A;  4IUR A;  3CCS A;  2YUO A;  4C0D B;  4M7D A;  1M2V A;  2FZK B;  1M30 A;  1W70 A;  2HDA A;  3RBB B;  1AVZ C;  3M0P A;  4EPC A;  2QGF B;  5HKC A;  1M3C A;  1GBQ A;  1TUC A;  4NL3 A;  1K73 C;  1D3B A;  1VQK T;  3M4G A;  2NUT B;  1AWO A;  3VS2 A;  4LNP A;  2VGN A;  4J6W A;  2DJZ A;  5KYU A;  2DLP A;  2JZ2 A;  1W6X A;  3EGD A;  4M7D G;  3INZ A;  1JBM A;  3MEW A;  2RQW A;  3CXC A;  3CPW P;  2XD0 A;  3PMI A;  1EZZ B;  4J9G A;  3MEU A;  5CQY A;  5CR2 A;  2P4T A;  3VKI A;  2LT1 A;  1JXM A;  1VQK Q;  1N8R C;  1TSF A;  2BZX A;  4FM4 B;  1YP5 A;  4F14 A;  4XK8 E;  2VWF A;  1AEY A;  1JO8 A;  1Z9Q A;  5A2Q E;  1VQL A;  4PNO A;  1UG1 A;  5KYY A;  4M7A D;  4C5I A;  1Q7Y U;  1D1A A;  1TWB A;  3CQT A;  3M4Y A;  1UGS B;  1UEB A;  2A28 A;  4MML A;  5CIU A;  1TU0 B;  2COW A;  2O4X B;  2E1H A;  2ZAE A;  2WSE E;  1X2Q A;  1H8K A;  1QKW A;  1U5S A;  2MCN A;  2XI9 A;  1UGP B;  4J9E A;  4JZ4 A;  4BAC A;  2DL7 A;  4ELZ C;  5HK3 A;  1VQM A;  5GAM f;  2K5L A;  2LQK A;  3FIF A;  5HY6 A;  3RES A;  1OOT A;  2QDY B;  4C8Q D;  3S3N A;  2LQ8 A;  2QQR A;  2P0Q A;  2IVW A;  1ZA1 B;  2YUQ A;  3OYA A;  4Z88 A;  1K4U S;  3CCS T;  1KC8 C;  2DD4 A;  3L42 A;  4CC2 A;  4M7D C;  2DBM A;  2KXD A;  2LZ6 B;  1KC8 R;  2CZ7 B;  1W2B S;  1ZA2 B;  1M1F A;  4M4Z A;  1PCX A;  5FRN A;  5GMK i;  2R5A A;  5HCK A;  1TUD A;  4PJJ A;  1FMV A;  2QI2 A;  4NL2 A;  1GCQ A;  3TEE A;  3CCS Q;  1IHW A;  3A5Z B;  1K1Z A;  5DLQ E;  3CC7 A;  2ED0 A;  3DB3 A;  2J6K A;  4AFS C;  2GFA A;  3CCV Q;  2OI3 A;  3CBM A;  3RKW A;  3OYK A;  3KXT A;  5GAN 8;  1YI2 Q;  2EGC A;  2PQW A;  4ZGE B;  1OZ2 A;  3HTR A;  4II1 A;  3PVL A;  2HEQ A;  3FRN A;  4RUG A;  2ZPF B;  3EG3 A;  4N4G A;  4QVC A;  2DXC A;  1OV3 A;  1VQL T;  1I4K 1;  2HBW A;  3EG0 A;  2Y4Y A;  3I5S A;  4QQG A;  1IB8 A;  3JCM c;  1OX9 A;  2XKO C;  4A4K A;  2KY9 A;  4DQ2 A;  1D0Z A;  2KGT A;  1VQ4 A;  1I0C A;  4N0A C;  1M90 C;  3OBY A;  3JCM e;  4FW2 A;  1N6A A;  4QVD A;  4RMO A;  1MNE A;  4D8K A;  3VS4 A;  3NTI A;  4CC4 B;  2OJ2 A;  3EG9 B;  2WSF E;  1VQM T;  2XMF A;  5GAN 2;  1WA7 A;  1NE8 A;  4C0D C;  2A37 A;  4HA8 A;  4Z89 A;  4PJL A;  3BW1 A;  3P8B B;  3I55 A;  2AHJ B;  2OTJ T;  2VUB A;  2FPE A;  4F7U B;  2MK5 A;  4UC4 A;  2X3X D;  4LDX A;  2DL4 A;  4PJO D;  4C92 F;  1E6G A;  1RLP C;  2EYZ A;  2KXC A;  5IHI A;  1V29 B;  3RR6 A;  2EQK A;  5FWB A;  3TSW A;  1LJO A;  3A1P A;  3H0F A;  2C06 A;  2H3J A;  4M75 E;  1WHK A;  4XTZ A;  1GCQ C;  3CC7 T;  2JW4 A;  1PSF A;  3A8H B;  1ZUU A;  3MPU B;  3ULR B;  2K57 A;  3RNJ A;  3VS5 A;  4J9C A;  4J9H A;  3ZFJ A;  2R57 A;  1XNI A;  1QCN A;  3M53 A;  3JB9 G;  3ER0 A;  5FU7 C;  1AD5 A;  1ZSZ B;  3CC7 Q;  2DTI A;  3VYG A;  1CKB A;  3R6N A;  1JJ2 S;  1VYV A;  2EQJ A;  4XQ3 A;  1WIE A;  4M77 A;  3UPU A;  1K73 U;  2EWN A;  1GBR A;  3G6E Q;  1VQ4 T;  3JCM P;  2QTX A;  5GAO p;  2DL5 A;  4FYY B;  3HPW A;  3JB9 J;  4LUE A;  4XU1 A;  2FEI A;  1HYO A;  1G3T A;  4F04 B;  4PK4 A;  3V8L A;  4F7U A;  3EGX A;  2QGG A;  2K5F A;  2V8I A;  3JCM W;  2X4J A;  1WHH A;  3JAM E;  1Q82 U;  1VOM A;  2JXB A;  2ZGW A;  5KCH A;  4M77 G;  4AG2 C;  1R8O B;  2MI6 A;  3I55 T;  2ZCF B;  4E2F B;  1N8R U;  3UT1 A;  4OB3 B;  1RL2 A;  1SF9 A;  2O88 A;  3S6W A;  3QG1 A;  4ZGD B;  2DYB A;  1Y57 A;  3E9F A;  2F5K A;  2YXY A;  1SSF A;  1PKT A;  4F7U G;  3JB9 I;  1PD1 A;  4J9B A;  2O01 E;  1MV3 A;  4A4E A;  3I55 Q;  3N5B B;  1RAE B;  2JM9 A;  3CCU A;  2D0N A;  3SD4 A;  3CCE Q;  3M0R A;  2RK1 A;  4LE9 A;  2WAC A;  3VS7 A;  3E2U A;  3EHR A;  2L3R A;  4F16 A;  4QT7 A;  4KGV B;  3OSV A;  8AT1 B;  4RG8 A;  4M77 F;  5LL6 S;  5AYF A;  2FPD A;  3G4S A;  4F17 A;  3QHS A;  3VS1 A;  3EFO A;  3OW2 P;  1NBE B;  2E65 A;  2YUP A;  2JS2 A;  2GNC A;  1ZUY A;  2EYQ A;  3LW5 E;  3CPW S;  1GCP A;  2LVM A;  1MMG A;  5LJ5 j;  3VUZ A;  3ASK A;  1M8V A;  2F5T X;  3LWI A;  3JCM J;  4CC7 A;  1BCM A;  3MCA B;  4OP0 A;  3DLM A;  3UWN A;  2PVO B;  1C6V X;  1RLQ C;  2QA4 Q;  3LLR A;  3GPL A;  1NLO C;  4M7A F;  3J7A F;  1VQ8 Q;  1AOJ A;  3OW2 A;  1DJ7 B;  4PFO A;  3CD6 Q;  4BD3 A;  2OAW A;  4J9F A;  1TXQ A;  5GAN g;  2RM4 A;  2L3P A;  3OBW A;  5IXF A;  4M78 F;  5GMK j;  3A8L B;  4KGX B;  3OYE A;  2EYX A;  3Q1J A;  4N4H A;  1VQP A;  4C8Q F;  1M90 U;  2XU8 A;  1N5Z A;  4C92 E;  1ZQ1 A;  2RHI A;  2JVV A;  1X6O A;  3P8H A;  3RKX A;  5I2S A;  1PD0 A;  1XQH A;  4PJN A;  4FIB A;  1IRX A;  1ACM B;  5HK0 A;  2JMC A;  1IXD A;  3G4S T;  3NHN A;  2P84 A;  2YLC A;  3EHQ A;  2L89 A;  5GAN d;  2D9T A;  3CCU Q;  2DXT A;  2HMA A;  3CME A;  2NUP B;  1WDX A;  2K4Y A;  5M9O A;  4JZ3 A;  2JS0 A;  2IPO B;  1YIT A;  3G4S Q;  1GFD A;  1I81 A;  3GF5 A;  5GMK m;  1Y71 A;  3GP8 A;  2DK3 A;  3CCL T;  1BCO A;  3QKJ A;  3OYC A;  4X34 A;  4ZGJ B;  1RAI B;  2V26 A;  2DBK A;  4A4F A;  1OPL A;  5LJ3 j;  1QP2 A;  4BI4 A;  3FB9 A;  2FHD A;  2ECZ A;  4AFZ C;  3CBP A;  2DVJ A;  5ECA A;  2LQW A;  4E47 A;  4WF2 A;  2ESW A;  2A08 A;  1QVF S;  5J3B A;  3OYI A;  2DZ9 A;  4C5G A;  2DA9 A;  2RD1 A;  2NWM A;  2QYZ A;  1ZX6 A;  1VQP T;  3RMS A;  2LRQ A;  5KE2 A;  3V7R A;  1B34 B;  5GMK l;  4E7S A;  3WVE B;  2MWP A;  4M75 B;  4JUV A;  4PJO F;  2E70 A;  2DM1 A;  3EG1 A;  1KQ1 A;  4VUB A;  3EFR A;  1S72 T;  1TTH B;  4HXJ A;  3VYH B;  4HT8 A;  1UDL A;  4AFQ C;  2R5M A;  2VXE A;  2RJE A;  4GLM A;  1NZ9 A;  3CME T;  2DFU A;  3EG2 A;  2HZY A;  3UF4 A;  1OUL A;  3MHX A;  2KK4 A;  4J5Y A;  2BIV A;  2EYY A;  3OS2 A;  5IHK A;  1O9S A;  3QYG B;  5GAN 5;  2HSE B;  2QQB A;  1BBZ A;  1K9A A;  4FT4 A;  5FRO A;  1NEB A;  2ABL A;  2CKK A;  2DE0 X;  4ORZ A;  2FZG B;  3PNW C;  4K11 A;  1JQQ A;  4CRI A;  3VUB A;  1YIT Q;  1R77 A;  4ATO A;  2EFI A;  3EH2 A;  3A8O B;  4J7I A;  1HD3 A;  1IGU A;  4D6W A;  2ZPE B;  2LNV A;  5KYX B;  3FJ5 A;  5GAM j;  2P0K A;  3OMG A;  2YT6 A;  4J7F A;  2J6F A;  4M7A E;  1IGQ A;  5CVI A;  2X4X A;  4OMP A;  1H3H A;  2CUB A;  3JV3 A;  3UDC A;  3HHT B;  4KUD K;  1WQ7 A;  2I0N A;  3C12 A;  4AG1 C;  2D8H A;  2MIO A;  2B8A A;  1GFC A;  4M78 E;  1XOV A;  1AHJ B;  4GBQ A;  5D7U A;  4MMK A;  3R6O A;  3HFN A;  5IH2 A;  4JS4 A;  3OS1 A;  4DBF A;  4M75 G;  4C8Q E;  4E6R A;  3X20 B;  2DET A;  2HQH A;  2M16 A;  4OMQ A;  3PFS A;  4PL6 A;  4BE2 A;  2RO0 A;  2RMO A;  4FU6 A;  4E7H A;  2XG8 D;  2COZ A;  3C94 A;  1QCF A;  4M77 D;  3L2V A;  3JCM f;  3G7Z A;  3CCV A;  5IXB A;  2BTT A;  2KRS A;  1YI2 A;  2QEX A;  2OTL A;  2K3X A;  2GTJ A;  2EBP A;  5EG2 A;  3G71 Q;  1XJW B;  3CCQ Q;  1PWT A;  3RIR A;  2QXF A;  2M02 A;  1M5Q 1;  3OY9 A;  1A0N B;  3A8M B;  2P4R A;  4J9I A;  3VU3 C;  2E3H A;  2RHX A;  1YJW Q;  3LX7 A;  2IIM A;  4AMC A;  3QXE B;  5IT9 E;  4OB0 B;  2DAQ A;  2RJC A;  2V1R A;  2VKN A;  3SWN B;  2H8H A;  1NM7 A;  4O5V A;  2A3L A;  4M75 C;  3OYM A;  2LCL A;  1TG0 A;  4N0A A;  4M7D F;  2LQN A;  3LH0 A;  4A4G A;  2BE7 D;  5GAO r;  4M78 D;  4B6M A;  2FO0 A;  4MZT A;  1LOJ A;  3H9N A;  4C92 B;  1QCO A;  4DBR A;  2R58 A;  1YJ9 A;  2M0Y A;  3M9Q A;  2AK5 A;  4DBQ A;  2O2O A;  2J7I A;  1MMD A;  4AT1 B;  1KD1 U;  4PJO E;  2RJD A;  3KBG A;  1KG1 A;  2AKL A;  2M9U A;  2NUT A;  2CP7 A;  4MZP A;  5AT1 B;  1IHV A;  3GLX A;  4IUP A;  1SHG A;  3L2U A;  2PUO B;  2QQS A;  2BKD N;  3CCV T;  2LJ0 A;  1WFW A;  1YI2 T;  2MMP A;  3D7S B;  2NUZ A;  2OTL T;  3CBO A;  3I56 Q;  5GAN e;  2D1X A;  2DKG A;  4EMH A;  1U8R A;  1QVG S;  3M55 A;  2RNA A;  1MMN A;  1PG5 B;  1QQJ A;  3M0S A;  1WXT A;  2DIL A;  2QEX Q;  4ELY C;  3SFM A;  3P8D A;  2OTL Q;  2PVD B;  5DM7 R;  2RB6 A;  3G6E A;  4PLL A;  5LJ5 h;  2O4X A;  1RAC B;  4KBM B;  5GAN 7;  2YWW A;  4RTX A;  1U1S A;  2ZPB B;  1AZG B;  1NEG A;  4JJN K;  4FL6 A;  4X1V A;  4Q5W A;  2DMO A;  4CI0 C;  1G2B A;  1H3Z A;  1SRM A;  1WX6 A;  3CCR A;  4RTV A;  1AWJ A;  1KIK A;  1QKX A;  4OGE A;  2DO3 A;  2DRK A;  2QQ9 A;  3RER A;  3NTH A;  1K8A U;  1KQS S;  5GMK h;  5GAO n;  3CCE A;  5A0L A;  2DF6 A;  2DL8 A;  2YSQ A;  2C0I A;  3M0Q A;  2VYT A;  1BIA A;  2LT4 A;  4WCI A;  1WI7 A;  1YJ9 Q;  1UE9 A;  4O6J A;  2KYB A;  1R0C B;  4A4H A;  2HKN A;  1YJN Q;  3A8G B;  2RPN A;  5CKD A;  8ATC B;  2VB6 A;  4EDU A;  2KSS A;  2X9H A;  3JCM X;  5GAN h;  2L0A A;  5GAN 4;  3PGG A;  1NJI U;  3OYD A;  2V8J A;  3M5A A;  1M1G A;  2X3W D;  3NMZ C;  3SWN C;  1UFF A;  2VC8 A;  1W4S A;  1JEG A;  3G6E T;  3MEV A;  4C5H A;  2QA4 A;  3X25 B;  2HBP A;  1X69 A;  4N4I A;  3TVT A;  2VV5 A;  1M1K R;  2K2V A;  3X24 B;  2JTF A;  2DL3 A;  1HK9 A;  4M7A B;  4PKC C;  3UA6 A;  3C4S A;  1VQ8 A;  3EG9 A;  3MKD A;  4C92 C;  4FYX B;  3UA7 A;  2K7A A;  2GF7 A;  4WTO B;  3CD6 A;  1PRM C;  1WQW A;  3IQL A;  1WZO A;  4HVW A;  4KT0 E;  1K0X A;  5CQX A;  5LJ3 h;  4IUT A;  1K9M C;  2RI5 A;  3G1J A;  4M78 B;  3NTK A;  2W0Z A;  1K9M R;  2O31 A;  4LUD A;  1QP3 A;  3CCR T;  2HL3 A;  3JB9 F;  4M7D E;  1VYT A;  4Y92 A;  2XHC A;  3MJX A;  4C8Q B;  1AWX A;  3CCE T;  3VS0 A;  3QWY A;  2HQX A;  2J6O A;  2CYZ B;  1NYG A;  1OU9 A;  4MZM A;  3CCR Q;  2YHT A;  1IO6 A;  3OSS C;  3V8K A;  2CP6 A;  1YWP A;  2RK2 A;  3V7C A;  1QVP A;  2YUN A;  3CXC S;  2IG0 A;  5J39 A;  5LJ5 g;  4X9D A;  4JRQ A;  3CCM Q;  2BE9 B;  5GAO q;  4HVU A;  1G3Y A;  4OB2 B;  2HCK A;  3M0U A;  3DB4 A;  3H41 A;  2JOY A;  5DLO A;  4IUV A;  1VQ9 A;  3QUI A;  1NPR A;  4GY5 A;  3GOX A;  1ZSZ A;  4RTT A;  1U3O A;  4C5E A;  2CZ1 B;  5EC7 A;  1RUW A;  4JLI A;  4PLI A;  1X75 C;  3QBY A;  4F7U F;  1KC8 U;  1WXB A;  3C95 A;  1MMA A;  2QA4 T;  1OZ3 A;  1UEC A;  3LH5 A;  4OML A;  4A63 B;  1Y96 B;  5GAN 6;  4NOY A;  2HNI A;  5LJ5 d;  1G3S A;  2EKH A;  1VQ8 T;  2EIF A;  1K0S A;  1M3A A;  2WSC E;  4J8O A;  3FJP A;  2KNB B;  1VQ7 A;  1ZBJ A;  3CD6 T;  2CP0 A;  4BI8 B;  2EW3 A;  4KGZ B;  3O8V A;  4JJD A;  2KBT A;  3QJY A;  1MV0 B;  1MUZ A;  1B7T A;  2C0T A;  3V7S A;  1X01 A;  2DYI A;  1FYN A;  2X4W A;  3V8J A;  1C0M A;  3KUF A;  3AT1 B;  5GAM h;  1Q81 C;  2C0O A;  1GRI A;  3LGF A;  1H64 1;  2E41 A;  5KYN A;  1Q81 R;  4JLG A;  4M7D D;  2KI7 A;  2EJG A;  3J81 E;  1VQ6 A;  3MP8 A;  5KH6 A;  3MP1 A;  2KEA A;  1M27 C;  4PJO B;  4IUQ A;  3O5Z A;  1VYU A;  2VAS A;  2KYM A;  3A98 A;  2ZZD A;  2E12 A;  2JM8 A;  4RCB A;  3BDU A;  5C6S A;  2KDS A;  2ROT A;  3CCU T;  4TVR A;  1YIJ A;  4A54 A;  3F70 A;  2L2P A;  1VQ9 T;  2XDD A;  1ZSG A;  1BI3 A;  2DIQ A;  1QW1 A;  1ZSZ C;  2E4H A;  2J06 A;  1CKA A;  1VQN A;  5LJ3 g;  1RI9 A;  2XK0 A;  4IIM A;  3OYB A;  4E7J A;  1SEM A;  1VQ9 Q;  1M4Z A;  5L8R E;  1WJR A;  1VQO A;  2CP3 A;  1YCY A;  3CC2 A;  3HRS A;  2BZ8 A;  3GNF B;  4EMK B;  1VQ7 T;  4HCZ A;  2LDM A;  1KHI A;  2DVE A;  2O9S A;  5KYW B;  1VQ5 A;  4C8Q C;  5KE3 A;  2PZ1 A;  2X35 A;  1X27 A;  2RHU A;  4AFU C;  5LJ3 d;  3AHU A;  4IIO A;  4L59 A;  4OF1 A;  4RTY A;  2E6Z A;  2RHY A;  1VQ7 Q;  3MO8 A;  1TUG B;  2CZ0 B;  4QW2 A;  4RG2 A;  2LCS A;  4E7K A;  4BY6 B;  1Q86 C;  2JT4 A;  1W2B A;  4QQD A;  1Q86 R;  2HQE A;  1FMK A;  3CEY A;  1OI1 A;  1OPK A;  1W1F A;  2ROL A;  1SRL A;  3JB9 H;  4BUG A;  2K3B A;  1VQ6 Q;  1YIJ T;  3H0H A;  3T9N A;  1AWW A;  2E10 A;  4FYV B;  1U1T A;  4ZN3 A;  1X43 A;  2DD5 A;  2M1H A;  2NUP A;  2DPP B;  3OS0 A;  4A53 A;  1VQN T;  4OB1 B;  1RAD B;  2FPF A;  1BI0 A;  1YIJ Q;  4J6Y A;  3GNG A;  3G71 A;  1T0J A;  1VIF A;  4M77 E;  5GAM g;  1GL5 A;  1UJY A;  2NYS A;  2D0Q B;  3CCQ A;  1YHQ Q;  1VQO T;  1O75 A;  3CC2 T;  2XDP A;  1YIT T;  2FRY A;  1FWZ A;  3X28 B;  2V1Q A;  3VS3 A;  1VQN Q;  1Q95 G;  2RQV A;  2X51 A;  1I8F A;  1WNL A;  2ZPI B;  1YJW A;  2D8J A;  3M59 A;  1V76 A;  2LNH B;  4JDS A;  3TQ7 P;  1VQ5 T;  4BB7 A;  3L2Q A;  1VQO Q;  4E7L A;  3HRT A;  4XTW A;  2RJF A;  1EIF A;  3CC2 Q;  3RDV A;  1RAH B;  4PJO C;  4HCC A;  3OQ5 A;  4LN2 A;  2YDL A;  1OX8 A;  5CK9 A;  2DJQ A;  3PIO A;  3OYJ A;  4M7D B;  1M2V B;  5GAM d;  3L2R A;  3QPH A;  3HRU A;  1R0B G;  1B34 A;  2LJ1 A;  1VQ5 Q;  1JXO A;  3BFM A;  4ZNX A;  5GAN f;  2RH2 A;  3WXM B;  4KH1 B;  2QAZ A;  1JJ2 P;  4M75 A;  2F2V A;  3JB9 D;  1D3B B;  1JB0 E;  4FYW B;  1T0H A;  2SEM A;  3REB B;  5KYU B;  5IHN A;  1G5V A;  3EGD B;  1UHF A;  4DOV A;  4BE1 A;  2F2W A;  1KJW A;  1SPK A;  4X9C A;  3VRZ A;  2E5Q A;  4L5G A;  3M56 A;  3THK A;  4FT2 A;  5I21 A;  2LJ3 A;  4ESR A;  1PC0 A;  1WHG A;  1ZLM A;  2F1L A;  4YTL A;  4LD6 A;  2HD0 A;  1V1C A;  1PRL C;  3I56 A;  4XU0 A;  2DNU A;  1BYM A;  3G71 T;  2EKO A;  5CKE A;  2MYS A;  5KYY B;  1JJ2 A;  4P5N A;  2JMA A;  3CCQ T;  1H92 A;  2FZC B;  2DER A;  3L2W A;  5J26 A;  1SKU B;  1TS9 A;  4PFZ A;  3QZ9 B;  1YJW T;  3OW2 S;  1NLP C;  2HL5 C;  4XTX A;  1YWO A;  4XTY A;  2RHZ A;  4M75 F;  2CP5 A;  5KYX A;  6AT1 B;  1D09 B;  2QTV A;  3NPF A;  2YRD A;  5A0D A;  4PJM A;  4BY6 C;  5LJ5 e;  3M54 A;  1UUE A;  3H8Z A;  5CKH A;  3CC4 Q;  4Y28 E;  1SG5 A;  1K73 R;  5GAN 3;  3JCM V;  1LPL A;  2SRC A;  3OYG A;  1N9R A;  4DBH A;  4XU2 A;  2LTO A;  4JRP A;  1B07 A;  3HFO A;  1Q82 C;  4LDY A;  1WLP B;  3M58 A; 
#chains in the Genus database with same CATH homology
 4EDU A;  1ZBX A;  3URG A;  2PU9 B;  4GLK A;  2KSS A;  4ZN1 A;  4F7U E;  4M7A F;  3J7A F;  2FL7 A;  2PUK B;  3JCM X;  5GAN h;  3OW2 A;  3HSB A;  2ZPG B;  2E64 A;  3HL8 A;  3CC4 A;  1DJ7 B;  5GAN 4;  3PGG A;  2EAY A;  1NJI U;  3OYD A;  2F69 A;  5GMK e;  4R55 A;  2V8J A;  4BD3 A;  1UGR B;  1M1G A;  3M5A A;  2NLU A;  3OYF A;  3SWN C;  2JUF A;  5GAN g;  2RM4 A;  2VC8 A;  4BDZ A;  3OBW A;  3LYI A;  3TRE A;  1W4S A;  4M78 F;  3G6E T;  3QSU A;  2A7Y A;  5GMK j;  1KQS A;  3MEV A;  4BI3 A;  3A8L B;  3OYE A;  4C5H A;  3EFS A;  4OGC A;  1Y7X A;  3Q1J A;  5FU7 B;  5C0M A;  2QA4 A;  3X25 B;  4C0Z A;  2CS7 A;  2HBP A;  3I56 T;  1YJN A;  4C0F A;  2EQM A;  4N4I A;  4N4H A;  2VV5 A;  1Q86 U;  2K2V A;  3CPW A;  1VQK A;  3X24 B;  1Y07 A;  2JTF A;  1VQP A;  2L8D A;  1N27 A;  1HK9 A;  4M7A B;  2D6F A;  4PKC C;  1WJS A;  3C4S A;  4C8Q F;  1M90 U;  1VQ8 A;  2XU8 A;  4C92 C;  2JTM A;  4MDW A;  4C92 E;  1ZQ1 A;  2GF7 A;  3FEO A;  2KAF A;  3CPF A;  1UGQ B;  2RHI A;  1WQW A;  3L1A A;  3CD6 A;  2GFU A;  2JVV A;  4FSX A;  2QEX T;  4DA4 A;  2DTO A;  1X6O A;  3P8H A;  4KT0 E;  5CQX A;  3RKX A;  5LJ3 h;  2JN0 A;  5I2S A;  2OTJ A;  2DTH A;  4IUT A;  1XQH A;  1K9M C;  2RI5 A;  4FIB A;  5HK0 A;  4M78 B;  3NTK A;  2FB7 A;  3VV0 A;  1K8A C;  1HXD A;  3OYY A;  1QP3 A;  3CCR T;  5CKF A;  3G4S T;  3FC3 A;  2YLC A;  4RKU E;  5FU6 B;  3RUX A;  3OYN A;  2L89 A;  5GAN d;  2D9T A;  3JB9 F;  4RCC A;  4M7D E;  5D6Y A;  2DXT A;  2XHC A;  1UB4 A;  4JRI A;  2FVU A;  2DXB A;  4C8Q B;  3SWN A;  1Q81 U;  4E7I A;  3CCE T;  3CME A;  1LNX A;  2XDB A;  4XAX B;  4LDU A;  2K4Y A;  5M9O A;  3S3M A;  2HQX A;  3E9G A;  2CYZ B;  4MZM A;  1YIT A;  2YHT A;  1I81 A;  3GF5 A;  5GMK m;  1YBY A;  2YLB A;  1Y71 A;  3OSS C;  5LJ3 f;  3V8K A;  3GP8 A;  2DK3 A;  3L2Z A;  3CCL T;  3QKJ A;  2RK2 A;  4LD9 K;  3V7C A;  1QVP A;  4EMK C;  3CXC S;  3LGL A;  2IG0 A;  5J39 A;  5LJ5 g;  4X34 A;  4X9D A;  4XU3 A;  3OYC A;  1ZHI A;  4ZGJ B;  4JRQ A;  5LJ3 e;  4C92 A;  3J80 E;  5GAO q;  3NFC A;  4J83 A;  3QJ6 A;  4A4F A;  1G3Y A;  4OB2 B;  3TU4 K;  1NJI C;  3CCJ A;  3DB4 A;  5LJ3 j;  2JOY A;  1QP2 A;  3MEA A;  3E19 A;  4BI4 A;  5DLO A;  3FB9 A;  3M57 A;  4IUV A;  3QUI A;  1VQ9 A;  2FHD A;  1BIB A;  3CC4 T;  5DY9 A;  1NPR A;  4GY5 A;  2RI3 A;  3OB9 A;  1TH7 A;  3CBP A;  4IUR A;  3GOX A;  5GAO m;  3CCS A;  4C5E A;  2XID A;  4C0D B;  4M7D A;  3RKY A;  4E47 A;  1YJ9 T;  4WF2 A;  2LC4 A;  3OYL A;  4B9W A;  2CZ1 B;  4C92 G;  4XTU A;  1QVF S;  4JLI A;  4PLI A;  1X75 C;  3QBY A;  4F7U F;  1N9S A;  3CCM A;  4EPC A;  3VJP A;  1KC8 U;  5J3B A;  3OYI A;  2DZ9 A;  3C95 A;  2QA4 T;  1OZ3 A;  4C5G A;  1YJN T;  2PVG B;  5FRM A;  5HKC A;  5IAY A;  4NL3 A;  2RD1 A;  1K73 C;  1D3B A;  1VQK T;  3M4G A;  3JRZ A;  1Y96 B;  5GAN 6;  4NOY A;  1VQP T;  2HNI A;  5LJ5 d;  4ZTJ A;  3RMS A;  2VGN A;  1G3S A;  2DJZ A;  2LRQ A;  4J6W A;  3V7R A;  2EIF A;  5KE2 A;  1B34 B;  1VQ8 T;  2JZ2 A;  4M77 B;  2WSC E;  4J8O A;  4M7D G;  5GMK l;  3INZ A;  3FJP A;  2DIG A;  3OA6 A;  1JBM A;  2BUD A;  3WVE B;  1VQ7 A;  3MEW A;  3CD6 T;  2XIC A;  3CXC A;  4BI8 B;  2MWP A;  4M75 B;  2XD0 A;  3PMI A;  4JUV A;  2E70 A;  4PJO F;  2Y90 A;  3MEU A;  5CQY A;  1KQ1 A;  3O8V A;  4VUB A;  3EFR A;  2EJ9 A;  2P4T A;  3QJY A;  5CR2 A;  1WPY A;  1S72 T;  3V7S A;  3VKI A;  1X01 A;  2FYK A;  2LT1 A;  2X4W A;  5FLX E;  3V8J A;  1N8R C;  1FX7 A;  4FM4 B;  3KUF A;  5GAM h;  1Q81 C;  3LGF A;  1H64 1;  2E41 A;  3VYH B;  4HT8 A;  1KQ2 A;  4XK8 E;  3S3O A;  3ME9 A;  1GXI E;  3FDR A;  4LDV A;  5A2Q E;  1VQL A;  4JLG A;  4PNO A;  4M7D D;  5GAO l;  2R5M A;  2VXE A;  2RJE A;  2EJG A;  5CO7 A;  3J81 E;  1NZ9 A;  4C5I A;  1VQ6 A;  3CME T;  4M7A D;  1Q7Y U;  3MP8 A;  5KH6 A;  3MP1 A;  3M4Y A;  1UGS B;  1UEB A;  3MHX A;  3DKM A;  2KK4 A;  3HKS A;  4MML A;  5CIU A;  1QVF A;  4J5Y A;  2BIV A;  4PJO B;  2O4X B;  4IUQ A;  1M1K C;  2E1H A;  3BY7 A;  2WSE E;  3OS2 A;  2GCX A;  2ZZD A;  1O9S A;  2E12 A;  3QYG B;  4RCB A;  5GAN 5;  3BDU A;  2XI9 A;  4NS5 A;  1UGP B;  1VIE A;  5C6S A;  2KDS A;  2DEQ A;  2OAU A;  2QQB A;  2YRV A;  4FT4 A;  5FRO A;  2CKK A;  4BAC A;  4HT9 A;  4ELZ C;  3CCU T;  1IZ6 A;  5HK3 A;  2CGH A;  2L5Q A;  1XTD A;  3MP6 A;  5GAM f;  4TVR A;  3PNW C;  4BDY A;  1YIJ A;  4A54 A;  2K5L A;  2LQK A;  3FIF A;  5HY6 A;  3RES A;  3F70 A;  4CRI A;  2QDY B;  3VUB A;  5GAM e;  4C8Q D;  3CCJ T;  5IN1 A;  3S3N A;  1VQ9 T;  2LQ8 A;  4ATO A;  2EFI A;  2QQR A;  3A8O B;  2P0Q A;  1BI3 A;  2IVW A;  4HKE A;  4J7I A;  2DIQ A;  1QW1 A;  2XDD A;  3OYA A;  4D6W A;  2ZPE B;  3CCS T;  2LNV A;  5GAM j;  1KC8 C;  2DD4 A;  3L42 A;  1VQN A;  4MDX A;  5LJ3 g;  4M7D C;  2XK0 A;  2RA2 A;  2P0K A;  3PT9 A;  3OMG A;  5A0G A;  4J7F A;  2CZ7 B;  1W2B S;  4M7A E;  3OYB A;  3CCM T;  1M1F A;  4E7J A;  3GIB A;  5FRN A;  5CVI A;  2I2L A;  2X4X A;  5GMK i;  2R5A A;  3UDC A;  3WVD B;  2E6N A;  3HHT B;  4KUD K;  1M4Z A;  1WQ7 A;  5L8R E;  1WJR A;  3C12 A;  1VQO A;  2QI2 A;  4DOW A;  1YCY A;  3CC2 A;  4NL2 A;  3HRS A;  3PMT A;  2B8A A;  3TEE A;  4M78 E;  3A5Z B;  3JCM h;  3GNF B;  3OS5 A;  4BE0 A;  5DLQ E;  3CC7 A;  4C0G A;  5CAI A;  1XOV A;  1NPP A;  4EMK B;  1VQ7 T;  1AHJ B;  2LDM A;  3DB3 A;  1KHI A;  4HCZ A;  2GFA A;  2DVE A;  5FU6 C;  4MMK A;  2LCC A;  3RKW A;  3CBM A;  3OYK A;  3R6O A;  5GAN 8;  3HFN A;  3KXT A;  4JS5 A;  4JS4 A;  4QQ6 A;  1VQ5 A;  2PQW A;  4C8Q C;  5KE3 A;  3OS1 A;  4M75 G;  4ZGE B;  4KUI A;  1OZ2 A;  4C8Q E;  2X35 A;  3X20 B;  4II1 A;  2M16 A;  3PFS A;  4PL6 A;  2RHU A;  3FRN A;  5LJ3 d;  4BE2 A;  2RO0 A;  2ZPF B;  4FU6 A;  3AHU A;  4QVC A;  4N4G A;  4E7H A;  2DXC A;  4L59 A;  4OF1 A;  2HAX A;  2E6Z A;  4V2S A;  2RHY A;  2CZ6 B;  2XG8 D;  1VQL T;  2KVQ G;  3MO8 A;  1I4K 1;  2Y4Y A;  2CZ0 B;  4QQG A;  4QW2 A;  4RG2 A;  3C94 A;  4E7K A;  4M7A A;  3SB2 A;  2VXF A;  3JCM c;  4M77 D;  5CCA A;  4BY6 B;  3JCM f;  3L2V A;  2XKO C;  3DLL A;  1Q86 C;  4A4K A;  1W2B A;  3G7Z A;  2KY9 A;  3CCV A;  4HCB A;  2Y4X A;  4DQ2 A;  4QQD A;  2HQE A;  1BKB A;  4M75 D;  3CEY A;  3H6Z A;  1VQ4 A;  2K5I A;  1YI2 A;  4N0A C;  2QEX A;  1M90 C;  3OBY A;  1OI1 A;  3JCM e;  2OTL A;  4QVD A;  1N6A A;  4RMO A;  2K3X A;  3JB9 H;  4M78 A;  2V8K A;  5EG2 A;  3NTI A;  4BUG A;  2KQW A;  1MGQ A;  1WGS A;  2WSF E;  1VQM T;  5GAN 2;  1YIJ T;  1NE8 A;  4Z02 A;  3QO3 A;  3T9N A;  1WJQ A;  3RIR A;  2E10 A;  4C0D C;  2QXF A;  4M7A G;  1U1T A;  4HA8 A;  4ZN3 A;  1M5Q 1;  3BW1 A;  3OY9 A;  3P8B B;  3QZ5 B;  3I55 A;  2DD5 A;  2AHJ B;  2M1H A;  3A8M B;  2OTJ T;  4C8Q A;  4IKF A;  2EJF A;  2VUB A;  2P0P A;  4F7U B;  3VU3 C;  4UC4 A;  2RHX A;  4LDX A;  3LX7 A;  1MHN A;  2DPP B;  4PJO D;  1BI2 A;  4A53 A;  3OS0 A;  4M78 G;  1VQN T;  4C92 F;  3QXE B;  4OB1 B;  3RMQ A;  5IT9 E;  4OB0 B;  2DAQ A;  1BI0 A;  2RJC A;  3QDR B;  4J6Y A;  4M77 C;  1V29 B;  3CCL A;  2EQK A;  3GNG A;  3G71 A;  1VIF A;  2VGM A;  4M77 E;  3SWN B;  5GAM g;  4R56 A;  4O5V A;  1LJO A;  3EAE A;  2C06 A;  2D0Q B;  3CMA A;  3CCQ A;  2A3L A;  2H3J A;  2QQA A;  4M75 C;  3ZBD A;  3OYM A;  4M75 E;  4C8Q G;  1VQO T;  4OVA A;  2LCL A;  3JSC A;  1O75 A;  3CC2 T;  2XDP A;  4XTZ A;  4N0A A;  1YIT T;  4M7D F;  1FWZ A;  3X28 B;  5KCO A;  3LH0 A;  4A4G A;  1I8F A;  3CC7 T;  1WNL A;  2ZPI B;  4XTV A;  1PSF A;  3A8H B;  4M78 D;  5GAO r;  1YJW A;  2K57 A;  4MZT A;  4JRK A;  1LOJ A;  4EMG A;  3M59 A;  4C92 B;  2MAM A;  3ZFJ A;  4JDS A;  2R57 A;  1VQ5 T;  3E1S A;  1XNI A;  2R58 A;  4BB7 A;  3JCM b;  1YJ9 A;  4LDW A;  3L2Q A;  3M53 A;  4E7L A;  3M9Q A;  3JB9 G;  3HRT A;  4XTW A;  2RJF A;  1EIF A;  3TCJ A;  2M0O A;  2MWO A;  3ER0 A;  1KHC A;  1JRI A;  4IUU A;  5D6X A;  1IRE B;  3OQ5 A;  3QYH B;  5FU7 C;  1YHQ A;  4HCC A;  4PJO C;  1KD1 U;  4PJO E;  2RJD A;  3KBG A;  5CK9 A;  3PIO A;  1KG1 A;  2DTI A;  2DZC A;  2M9U A;  4ME7 A;  3OYJ A;  4QVZ A;  3VYG A;  4M7D B;  1JJ2 S;  5GAM d;  1Y96 A;  4MZP A;  3L2R A;  2EQJ A;  3BDL A;  4XQ3 A;  3GLX A;  3QPH A;  1P92 A;  3HRU A;  4IUP A;  5CKB A;  3L2U A;  1B34 A;  2PUO B;  4M7A C;  2MF2 A;  2QQS A;  3BFM A;  4M77 A;  2BKD N;  3CCV T;  3UPU A;  1K73 U;  2EWN A;  2RH2 A;  5GAN f;  3SDZ A;  4L6V 5;  1OYX A;  3WXM B;  1VQ4 T;  1YI2 T;  3JCM P;  2QTX A;  5GAO p;  4M75 A;  2MMP A;  1BI1 A;  3LWH A;  3HPW A;  3JB9 J;  3JB9 D;  1D3B B;  1JB0 E;  3CBO A;  2OTL T;  4XU1 A;  1RI0 A;  5GAN e;  1S72 A;  1G3T A;  2DKG A;  3V8L A;  4M78 C;  4F7U A;  4EMH A;  3JCM Q;  2K5F A;  2V8I A;  1U8R A;  3JCM W;  3M55 A;  3PIP A;  1QVG S;  1G5V A;  2X4J A;  3JAM E;  5GAN j;  1Q82 U;  4DOV A;  4BE1 A;  2ZGW A;  4ZTF A;  5KCH A;  1VUB A;  5D6W A;  4M77 G;  1R8O B;  2MI6 A;  4X9C A;  2ZCF B;  3I55 T;  1N8R U;  2E5Q A;  4L5G A;  3JCM g;  3M56 A;  4OB3 B;  3UT1 A;  1RL2 A;  4FT2 A;  4ELY C;  3SFM A;  3P8D A;  5I21 A;  2PVD B;  3S6W A;  5DM7 R;  2RB6 A;  4YTL A;  3QG1 A;  4ZGD B;  3G6E A;  3E9F A;  2F5K A;  4PLL A;  1SSF A;  4LD6 A;  5LJ5 h;  2HD0 A;  4F7U G;  1PSE A;  3JB9 I;  1Q7Y C;  2O4X A;  4PJO A;  3I56 A;  4XU0 A;  4KBM B;  5GAN 7;  3HP9 A;  2O01 E;  1BYM A;  3G71 T;  1G3W A;  2EKO A;  5CKE A;  1JJ2 A;  4P5N A;  1VQ6 T;  1U1S A;  4A4E A;  3N5B B;  3X26 B;  1M1K U;  3CMA T;  2ZPB B;  2K3Y A;  3CCQ T;  3CCU A;  5I2M A;  3SD4 A;  4JJN K;  2RK1 A;  2KMT A;  2WAC A;  3L2W A;  5J26 A;  4Y91 A;  1M9S A;  4FL6 A;  4B9X A;  4OMF B;  2L3R A;  1I5L A;  4Q5W A;  3PTA A;  2X4Y A;  3OSV A;  4CI0 C;  4PJO G;  3FLG A;  3QZ9 B;  1YJW T;  4RG8 A;  4M77 F;  3OW2 S;  2DXU A;  5LL6 S;  1VQM A;  5AYF A;  4XTX A;  3ZEH A;  1H3Z A;  4XTY A;  3MET A;  2RHZ A;  3CCR A;  1QVG A;  3G4S A;  4M75 F;  3JCM d;  3QHS A;  5LJ5 f;  1K9M U;  3OMC A;  1KD1 C;  4OGE A;  2DO3 A;  2GQV A;  2QQ9 A;  5A0D A;  4BY6 C;  2E65 A;  3NTH A;  2JNG A;  1K8A U;  3RER A;  1KQS S;  5GMK h;  5GAO n;  5LJ5 e;  3CCE A;  5A0L A;  3M54 A;  1YHQ T;  3H8Z A;  2EYQ A;  5CKH A;  2EQU A;  3LW5 E;  3CPW S;  2VYT A;  1BIA A;  2LVM A;  4Y28 E;  5LJ5 j;  5GAN 3;  3QII A;  2LX9 A;  2LT4 A;  3JCM V;  3VUZ A;  3ASK A;  1M8V A;  2F5T X;  3LWI A;  4KUL A;  3OYH A;  3JCM J;  2ZPH B;  4O6J A;  4EMK A;  1N9R A;  3MCA B;  4OP0 A;  3DLM A;  3OYG A;  4J6X A;  4XU2 A;  2LTO A;  3UWN A;  4JRP A;  4C92 D;  1FXX A;  2PVO B;  2G3R A;  4A4H A;  3HFO A;  3LLR A;  1Q82 C;  3A8G B;  2RI2 A;  4LDY A;  5CKD A;  3GPL A;  3M58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...