5GAN2

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
90
structure length
90
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords U4 snRNA
total genus 16
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan200
3JCMh 4C8QE 5LJ3j 4M7AE 5LJ5g 3RKYA 4M7AA 1I8FA 3V7SA 5GAMh 2FYKA 2HNIA 3JCMb 1H641 5LJ5h 3BDUA 4MMKA 4XU2A 3RKWA 4M75F 3JCMW 5LJ5j 4M7DB 5GAN7 5GMKl 4JRKA 4X9DA 4M7DD 4M7AF 3RUXA 4F7UE 5CAIA 5LJ5e 3AHUA 4M7AD 3INZA 1X01A 4M7DG 3JCMX 4J5YA 4PJOD 4J6YA 2EJFA 4C92E 5GAMf 2RA2A 5LJ5f 3JCMe 4Y91A 3V8KA 1KQ2A 1BIBA 4JUVA 4C8QC 1I5LA 4NOYA 3JCMf 5GANe 4M78A 2DKGA 4XTUA 3JB9G 4C8QG 4N0AA 4PJOF 1I81A 4QVDA 5GANh 2E1HA 5GMKe 3GIBA 3SWNC 2DJZA 3JCMd 2VC8A 5GANf 4PJOC 1KQ1A 3L2ZA 4C8QF 3EFRA 3JB9J 4M77A 1HXDA 3BFMA 4M75C 3EFSA 5GMKj 3SWNA 4PJOE 1LJOA 5GAOl 3FJPA 3JCMQ 2DXUA 2YHTA 4WF2A 4XU0A 4A53A 4F7UG 4NL3A 1YCYA 4M75G 3JCMg 3V7RA 3QHSA 1B34B 4XTVA 5GAMe 5GMKm 5LJ3h 4F7UF 3JCMJ 1D3BA 2Y90A 4C92A 5GAMj 4C8QB 1B34A 1WNLA 4J6WA 4C8QD 2ZGWA 2DZCA 2EAYA 1Y96B 2RB6A 3BW1A 4EMGA 4M75E 5GAN3 5GAOn 4M7DE 1HK9A 1U1SA 4A54A 2DTHA 4F7UA 2DXTA 5GAOm 2VXEA 2DEQA 3L1AA 3RESA 3SB2A 3RERA 4X9CA 4XU3A 4XTYA 2I2LA 4M7DC 4V2SA 1JRIA 1M8VA 4PJOG 3QO3A 4QVCA 3JB9F 4M75B 5LJ3g 3QUIA 1WQWA 4RCBA 1TH7A 1BIAA 3HFNA 4M77E 5GANg 3JB9D 3M4GA 5GAOq 1M5Q1 4OP0A 5LJ3e 4XU1A 3FIFA 5GAOp 3V7CA 4J6XA 3RKXA 5GAN2 4NL2A 4M77C 4M75A 4M78F 5GAMd 4EMHA 4M78E 2YLBA 4PJOA 4XTWA 3QSUA 5LJ5d 4EMKA 1JBMA 4XTXA 5GAN6 3V8JA 2EJ9A 2DTOA 2CGHA 2EWNA 4M77F 1N9RA 4HA8A 5GANj 1Y96A 4JLIA 3SWNB 3VU3C 4EMKB 3FB9A 4M77G 4XQ3A 1WQ7A 4PNOA 3RIRA 5GMKh 1D3BB 2VXFA 4C92G 3JCMP 4F7UB 2E65A 4M78B 5LJ3d 4N0AC 5DY9A 4M78D 2FB7A 4M78C 2YLCA 1LOJA 2DVEA 2E10A 4C92B 1LNXA 5LJ3f 4C8QA 4MMLA 4EMKC 4M78G 5GMKi 2E64A 5GANd 4M7DF 2RD1A 2DTIA 5I21A 3JB9H 2K57A 4M7AC 2RM4A 2EJGA 1N9SA 2QTXA 4M7AG 4DQ2A 4XTZA 3PGGA 2E41A 5GAMg 1MGQA 3JCMc 4HT9A 5GAN5 3JB9I 4M75D 4M7DA 1U1TA 5GAN8 5GAN4 4HT8A 3BY7A 4JRIA 4M7AB 4RCCA 3V8LA 4M77B 5GAOr 1WPYA 4PJOB 3HFOA 4M77D 4C92F 2DZ9A 4C92C 2JN0A 4C92D 3HSBA 1I4K1 3JCMV
chains in the Genus database with same CATH superfamily
3RKYA 3C94A 2J7IA 5LJ5h 5KE2A 1HYOA 3GF5A 3I56A 2JTMA 2FPDA 1AVZC 1V76A 2CREA 3MP8A 2ED1A 5KYUB 1KFZA 4DBFA 3ULRB 1TUDA 4OB1B 1AWWA 3L2ZA 2OTLA 2JZ2A 4M77A 1HXDA 2NUZA 3EFOA 1KQSP 2OJ2A 5CQXA 4PFPA 1BI0A 1YITT 2CSIA 3MKDA 1VQ7T 2YSQA 3PIOA 3EG9A 4F17A 3CCVQ 1D1BA 1TXQA 3VJPA 4FW1A 2EQKA 2BZYA 1QVFA 3S3MA 1X2KA 2WACA 3LYIA 4FIBA 1WI7A 2ENMA 2O4XB 4XU1A 6AT1B 1U8RA 1ZUYA 2DD5A 1BBZA 2YLBA 1YITA 3V8JA 4XK8E 1F1BB 1MMAA 3M0UA 2C0IA 1H3ZA 3TQ7P 1N9RA 2JJ9A 5FU7C 1M1GA 1WHHA 1VYUA 1NYGA 3G4ST 2JTEA 2VV5A 4EIKA 3EG9B 4M78G 1XJWB 3DB3A 1JQQA 2A0FB 4BI8B 3M58A 4AG2C 3I35A 2EPDA 3JV3A 3QWYA 4DQ2A 1MNEA 1VQMQ 1VQ4Q 2Z0WA 2KRNA 1TWBA 2BKDN 2EYYA 4BD3A 4R56A 4M77B 4C5EA 2YUNA 1NG2A 2ABLA 2G3RA 4MZTA 3CMAT 3QBYA 3CC2A 2K4YA 5DLOA 1N6AA 4JJCA 2B8AA 3CCUT 1I07A 4O6JA 1X01A 1RAGB 1ACMB 3BE3A 1JU5C 1D1CA 5CIUA 3UF4A 1NEGA 2ZPEB 2X51A 2KXCA 2QQSA 3I9QA 1NJIC 4E2FB 3OYLA 2LJ3A 3EGXA 1TUGB 3OS1A 3EFRA 4J7FA 4F04B 2O31A 2ZAEA 3CCSA 3S3OA 2RK2A 3JCMQ 4LD9K 1PM3A 3A8HB 4Y92A 2ATCB 2D9TA 4OGCA 2FEIA 1K8AR 1T3LA 3BW1A 1I0CA 2QEXA 1UFFA 1U1SA 3MEAA 3QDFA 3FRNA 3S3NA 2BE7D 3L1AA 2DEQA 3DKMA 3CPWS 3H0FA 4AFSC 1KC8R 3A8MB 4XTYA 1Y57A 3QYGB 2MPXC 3X25B 2QK0A 3C4SA 2LTOA 2QG9B 1TU0B 3PFSA 1V29B 2GFAA 4ORZA 4RG8A 3J7AF 2GNCA 2H8HA 4DBHA 5GAN2 3NFCA 4C5HA 2CP7A 3CCQQ 3TCJA 2DLPA 1PSEA 1NYFA 2CS7A 2KNBB 4GBQA 1YI2T 4D8DA 4WCIA 1QWEA 2I0NA 2QDLA 3I55A 3ASKA 1B7TA 4M78D 5J26A 1G3YA 2JMCA 3SFMA 3CCMA 1M90U 1EZZB 2RD1A 1OZ2A 3VS5A 2E41A 1G5VA 2DAQA 3GNFB 2E12A 3M9QA 4M7AB 1W2BS 2FRWA 3VV0A 1KQSA 1VYVA 4FSXA 4C92D 3HSBA 2LP5A 4J9IA 3JCMW 2RHZA 3E1SA 2KR3A 2YUQA 1WXUA 2KMTA 5A0DA 4KUDK 2C0OA 1QVFS 4Z89A 2CP3A 4PJOD 3CCMT 1E6HA 4RTTA 1KQ2A 4C8QC 4OB2B 4M78A 2DMOA 3REBB 1JJ2S 1Q95G 4ZGJB 5EG2A 1RAIB 3SWNA 3CQTA 2QQAA 2VVKA 3OW2A 1VQ6Q 2K2MA 3FJPA 1SG5A 4WF2A 2QA4Q 2CZ1B 2JNGA 2DZCA 3PIPA 3CD6A 2DM1A 2L3RA 1GRIA 1UEBA 1PWTA 1Q82C 2RK1A 2LJ1A 2MOXA 3G6ET 2AZVA 2PTKA 4PFZA 3JB9D 3VYGA 8ATCB 1M5Q1 2KVQG 1Q86R 4IUPA 1SKUB 2EKOA 1ZA2B 2AZSA 4M4ZA 2K6DA 1VQNQ 4JLGA 1PCXA 2CZ6B 1VQPT 3VU3C 2HAXA 4M77G 3FDRA 1E6GA 3NGPA 2YDLA 1OEBA 2E5KA 1YHQT 1SF9A 2EQUA 3O8VA 3CPWP 2EJGA 2IVWA 3WVDB 2LQNA 2DJQA 3JCMc 8AT1B 1C1AA 4HT8A 2X4YA 2DEUA 4A4KA 2HL5C 2XI9A 4RTYA 1BI3A 1XQHA 1Q86C 4FSSA 1AEYA 1UJ0A 1G8XA 3T9NA 4Z02A 2QGGA 4FYYB 1VQPA 1VQKA 4K11A 1JJ2A 1CSKA 3A8OB 3S6WA 1K9MC 1QCNA 3AHUA 3QJYA 1LVKA 2KQWA 2RPNA 4QVZA 2F1LA 2HSEB 3UT1A 2K3YA 1KD1R 4QQ6A 3V8KA 1BIBA 2CT3A 3CMAA 1WDXA 4F14A 5GANe 2EGCA 4Z8AA 5CK9A 2A28A 1R77A 3CCRT 3FLGA 2F2XA 1WJSA 3JB9J 4HKEA 1ZBJA 2OTJA 3M0QA 2WSFE 1AHJB 2E3IA 2HQXA 4ESRA 2YXYA 2DYIA 2FG0A 2D0NA 2ZPFB 1NEBA 5LJ3h 1PRLC 3JCMJ 1SEMA 2JM8A 4EMHA 4C8QD 3VS3A 2QXFA 2CZ0B 4JRQA 4M75E 1OULA 1OU9A 3FEOA 3N5BB 2RJEA 2P4TA 1U5SA 3J80E 3EGDB 3H6ZA 1YJWT 2EKHA 5AT1B 2DRKA 4A4FA 5LJ3g 3HFNA 1GCPA 2DILA 5J3BA 3V7CA 4RUGA 2LQWA 2KY9A 4NL2A 3KFVA 2LRQA 4F16A 3CPWA 1BYMA 4AFZC 1TG0A 2CKKA 4OB3B 5HK3A 1BCMA 1O9SA 2V8KA 1N8RU 2QYZA 1ZSGA 4Z88A 1X6OA 2E65A 3OYEA 3UPUA 2FB7A 4M78C 4CC4B 4C8QA 5LJ3f 2D8HA 2JMAA 4EMKC 1U06A 1K73C 1PD0A 2QTXA 1RLQC 4XTZA 1X6BA 1MV0B 3R6OA 1RACB 1RI9A 4LDVA 3OQ5A 4C0ZA 4J9HA 1I4K1 2NYSA 3CC7A 1W2BP 3JCMh 2DF6A 2FYKA 1YI2Q 1M2OA 1XNIA 5IT9E 5GAN7 4X9DA 3VS1A 1UTIA 1ARKA 2RA2A 3VKIA 4J8OA 3PVLA 4NOYA 1VQ9A 1K1ZA 2DKGA 2DIQA 4JJBA 1VQLQ 1SHGA 4ZN1A 2A36A 4BB7A 2D6FA 3CCQA 5GMKj 3RDVA 1I5OB 1LJOA 1KC8C 2HQEA 2J6KA 4II1A 1Q81U 3RMQA 2R57A 1KK7A 1XOVA 4X1VA 3OSSC 3CCLQ 5FRNA 4EMGA 3HTRA 2JVVA 5GAOm 4E7KA 2LMJA 1ZA1B 1NBEB 3MPUB 5L8RE 1QVGS 1M1KR 2KGTA 4C0GA 4L5GA 1WX6A 5DLQE 1YJNA 4M75A 2M9UA 4XTXA 4XAXB 2EJ9A 4FYXB 1UHFA 1IHVA 2QAZA 2CGHA 2EWNA 4M77F 5HK0A 3M4YA 4PJNA 4ATOA 4JLIA 1VQMT 1IHWA 3CMEA 1Z9ZA 3VS7A 2FO0A 1FMWA 4C92G 4F7UB 3OYCA 1B07A 2O88A 4PL6A 3VUBA 2KROA 3A98A 1LNXA 1W1FA 2V1RA 4PJLA 4KRTA 1PG5B 2P0PA 3EG1A 1M3AA 2DYBA 1GCQC 2RI3A 1M1FA 5KYXA 1N8RC 4A4HA 2GQIA 4DBQA 1GFDA 1NE8A 1TUCA 4AFQC 3V7SA 2VUBA 3BDUA 1WXBA 2O9SA 1WXTA 3G6EQ 1LPLA 2DIGA 3OYNA 2QQRA 1UGVA 4JUVA 2A3LA 2YUOA 2DFUA 1WLPB 2RJFA 4LN2A 3OS2A 1KD1U 1D09B 2DJZA 2AIRB 4J9BA 4HXJA 2CP2A 5FWCA 1YBYA 2BIVA 1FX7A 3ZL7C 4IUTA 5CR2A 4BACA 4YTLA 1VQNA 2AHJB 1GXIE 1VUBA 1K4US 3G71Q 4FYWB 2O01E 3JCMg 5GJVB 1KQSS 1JB0E 2NLUA 5GAMe 1VQOQ 3CCET 1V1CA 3M54A 1VQ7Q 4ZGEB 4B9WA 2RJDA 3M5AA 3G4SA 1G3WA 3CPFA 1WYXA 4FU6A 3MP6A 1BCOA 1Y0MA 3PMTA 3OYFA 1D1AA 1M2VB 2FL7A 4M7DC 5I22A 2JXBA 1M8VA 4OGEA 3JB9F 3DLMA 2IG0A 1PSFA 3CBOA 3GPLA 4OP0A 5D7UA 2M16A 2L2PA 2XU8A 5DM7R 2KRMA 1NM7A 3NTIA 2ED0A 4J9EA 3MEUA 4GLKA 3M53A 2DTOA 3U23A 1GCQA 3UA6A 1UB4A 3OMCA 3UATA 1Y96A 1IZ6A 3L2QA 2DXBA 4J83A 2VXFA 2O4XA 4LDWA 1UE9A 1OPKA 5GMKi 1GBQA 3OBYA 2Y4YA 4ZGDB 1WHLA 2ZCFB 1YJWQ 2HEQA 3RNJA 4QW2A 2V8JA 3HHTB 2K5IA 1A0NB 2MCNA 1K9AA 4RCCA 3V8LA 1QKXA 3HFOA 4B9XA 1JXMA 2QASA 2EQMA 4LDUA 1UG1A 1H641 4M75F 2RHYA 4M7DB 2MAMA 1TOVA 1QVPA 5GAMf 3CC7T 4M7AG 4Y91A 3CCJT 2P84A 3RR6A 1OI1A 1M30A 2PUKB 4QVDA 1EIFA 5FU7B 3L2UA 1NPRA 1RAEB 4M75C 2MWOA 2BZXA 1VQ5T 2FPEA 1RAHB 4DA4A 1C0MA 1H3HA 4JPBW 4FT2A 2DK3A 3CCLT 4XTVA 1WHKA 1D3BA 3MJXA 4OMLA 2F2WA 4N4IA 4PFOA 4HVUA 1YJ9T 3RBBB 5KYWB 1Q82R 4J9CA 3OS0A 3P8HA 4CC3A 5KYWA 2BUDA 5D6YA 2RF0A 1OX8A 1YJ9Q 2KEAA 2BTTA 4BUGA 2CP5A 4BE1A 1YIJA 5D6WA 3CC7Q 4OMNA 1OV3A 4M78F 2EYQA 4PJOA 3H41A 5LJ5d 1SSFA 2RNAA 2M02A 3FC3A 4L59A 2C0TA 2Y4XA 5GMKh 1KHCA 3CCRQ 2G6FX 3CCJA 1VQLA 2K5LA 4M7DF 3M57A 4LD6A 1UECA 3TREA 2VWFA 3NPFA 4KUIA 3OYBA 4M7DA 2X4XA 1VA7A 2ROTA 3A8GB 1M3BA 2FPFA 1X43A 2NUPA 1Y7XA 1Q81R 2RHUA 3CCLA 2IPOB 1K76A 4C8QE 2R5MA 1M90R 4XU2A 2E4HA 2WSCE 4RTXA 1BK2A 4CRIA 5LJ5j 1T3SA 2GFUA 4RTUA 1KJWA 3UA7A 2DA9A 3EFOB 1G83A 1IRXA 4LE9A 3EGXB 4OMOA 1MMDA 3REAB 1ABQA 2LT4A 2LCCA 4LXCA 3JB9G 1I81A 2KSSA 5GANh 3EG2A 4PJOC 2L5QA 4R55A 4JRPA 2SEMA 2HBPA 4DEYA 1HSQA 3BFMA 5L23A 2EGAA 1UDLA 5GAOl 3HP9A 2RMOA 2LX7A 3TVTA 3I5RA 1FXXA 1RI0A 1X2QA 3QDRB 4F7UF 2X35A 1S72A 1JJ2P 2X4WA 3QKJA 1K8AU 2LZ6B 2VXEA 1K9MU 2J06A 4MZMA 1HJDA 2JTFA 3WVEB 2HBWA 1P92A 1DJ7B 5LJ3e 3KBGA 1YN8A 2K3XA 1IXDA 1IB8A 2RI5A 5GAMd 4DEXA 3EGUA 2DVJA 2X3WD 1TTHB 1PKTA 2EBPA 4M78B 1D0YA 4JS5A 2P0QA 5ECAA 2AKKA 3OYDA 1U3OA 1VQ8A 4MMLA 1K0SA 2E64A 1AZGB 2FRYA 5IHKA 4M7AC 1K8AC 4PKCC 5GAMg 2PVGB 5CKHA 5GAN4 4PJMA 4CI0C 3LW5E 1YHQQ 1VQOA 1VIFA 2EVRA 2RHXA 3PT9A 4GY5A 3THKA 1PKSA 1K73U 1ZUUA 1TSFA 2A08A 1MHNA 4MDWA 4RKUE 3GOXA 3E9FA 2LX9A 2EJFA 4J6YA 5LJ5f 2CH4A 1AOJA 1WHMA 2VB6A 1RAFB 3JCMf 2E1HA 2VC8A 3ZEHA 4C8QF 2GF7A 3QJ6A 3VYHB 4KH1B 3CC2Q 4J9FA 4BDZA 1VIEA 1BU1A 4R0KA 3TSWA 4ZNXA 3OYAA 2NWMA 4BE0A 2L3PA 4XU0A 1HD3A 2PZ1A 2IIMA 3OB9A 5GMKm 4RTWA 4FCYA 2XK0A 2EAYA 5CKBA 2RHIA 1HK9A 2DL4A 2F69A 3JRZA 1YJWA 1FWZA 1VQ5A 4XU3A 1UGPB 3CCSQ 2KK4A 2O9VA 4E7IA 2RQVA 2L0AA 1D0ZA 1TH7A 2X9HA 2YWWA 2NUPB 5IHIA 1ABOA 2CDTA 1M1KC 1AWOA 4GLMA 1QKWA 4J6XA 3E2UA 1QVGP 3L2WA 2GCXA 3G1JA 1R0CB 5IHNA 5FU6C 4KGXB 2KAFA 4XQ3A 3RIRA 3JAME 3IQLA 3ZFJA 1VQ9T 1OYXA 2YLCA 2DVEA 4LDXA 1AZEA 3I56Q 2EIFA 4E7LA 2FZCB 1MGQA 2AK5A 2DPPB 2OI3A 5GAN8 3NTHA 2M0YA 3ZBDA 2K7AA 1VYTA 3I55Q 2QA4T 4JZ3A 4M7AE 1IGUA 4DOVA 5LJ5g 1UGRB 5GAMh 3LWHA 1QP2A 4RMOA 3C95A 4M7AF 2JS0A 1EFNA 2QQBA 2RO0A 3TEEA 4EPCA 2COZA 1YIJQ 4KBMB 3QZ5B 2LCLA 3CCVA 5GANf 1KQ1A 2EYXA 1RL2A 3DB4A 1G2BA 3LGLA 4AG1C 1PC0A 4JJNK 2RQRA 2HKQB 1YFNA 4A53A 2P4RA 1YCYA 2V8IA 4ELZC 4ZN3A 1BKBA 1FMKA 3FJ5A 4A4EA 1B34B 2HD0A 3SHWA 2EQIA 4IUUA 3PE0A 2L3SA 3G7ZA 4M7DE 3L42A 4LUDA 5FLXE 5HCKA 2PVOB 3SB2A 3RERA 1BB9A 3M55A 4QKUA 2ZPIB 1YWOA 3VUZA 4PJOG 1RAAB 3EAEA 1VQ6A 2ROLA 3A1PA 4PLLA 4QQGA 3J81E 3CEYA 1JEGA 3C0CA 5FWBA 1W2BA 2MMPA 3L2RA 2COYA 3MEVA 3CD6Q 2ZPGB 3PVQA 2QGFB 1QCOA 1VQ4T 4AMCA 3SWNB 1RABB 2HKNA 2ECZA 2LC4A 4C92B 3ME9A 5I21A 1WHGA 1WFWA 1IREB 1QQJA 4C0DC 4E7JA 4KGVB 3CC4Q 4PJOB 2ZPHB 3OW2S 4EDUA 3RMSA 5GANj 1E7OA 1ZX6A 2DX1A 1S72Q 3QIIA 5LJ3j 4PJJA 1H92A 2PVDB 3LX7A 2M0OA 3CCUA 1ZSZB 3EH2A 1Q7YC 4JRKA 1KG1A 3RUXA 4F7UE 5CAIA 3CXCA 5KE3A 2EYWA 5A0LA 2AT1B 1FYNA 1KD1C 2LNHB 1ZSZA 2PNIA 1LCKA 3HKSA 4N0AA 4PJOF 2QEXQ 2DL8A 1NJIR 3OYIA 2CT4A 2XMFA 2XKOC 3CCST 1VQPQ 1VQKQ 3EH1A 3VRZA 4MZPA 2V26A 4F7UG 3OW2P 4C5IA 3META 4HVWA 1ZUKA 3KXTA 2KE9A 5KYNA 2E70A 3OY9A 3G71T 1VQ8Q 1Y96B 2DERA 1JXOA 9ATCB 1Q7YR 1OZ3A 5FRMA 3KUFA 4HCZA 1VQKT 2OTJQ 2I2LA 3P8DA 2GBQA 2K79A 2O2OA 1YCSB 2YRVA 2FHDA 1WA7A 4FYVB 1IGQA 2XG8D 1WIEA 1WZOA 2E5QA 3M0RA 2DO3A 4HCBA 1I1JA 2EQJA 3CCMQ 4CC2A 4BE2A 4M77C 2H3JA 1EX4A 3QSUA 2EYZA 3HRSA 5C6SA 5CVIA 3M59A 2OTLT 4HCKA 2LJ0A 1ZSZC 1WQ7A 4RTVA 4L6V5 3OYHA 2H3EB 4E7SA 1M3CA 4LDYA 3LH0A 2CH4W 4BI3A 1K73R 4E6RA 3URGA 4CC7A 3E19A 2HCKA 4HT9A 3JB9I 2R5AA 4C0DB 2LVMA 4IIOA 1GBRA 2MWPA 4ZTFA 1QVFP 4M77D 2DZ9A 5I2MA 2F5KA 4FL6A 5IAYA 7AT1B 2V1QA 4WTOB 2YUPA 4RTZA 5J39A 2HDAA 3O5ZA 2CYZB 2QDYB 1T0JA 2M51A 3NHNA 1Q82U 1VQ5Q 2RH2A 1AD5A 3INZA 4E47A 3QYHB 2J6OA 1X27A 2OAUA 3EG0A 2QA4A 2GTOA 1QLYA 2ESWA 3SEMA 2HMAA 4C8QG 1OQKA 5CO7A 4AFUC 1YI2A 2OAWA 5IXFA 4M75G 3V7RA 2W10A 3L2VA 2E6ZA 1ZHIA 2KT1A 4C92A 1B34A 1VQLT 4J6WA 2ZGWA 1Q7YU 2DXCA 2GGRA 1C6VX 3LH5A 4PK4A 4X9CA 3AT1B 3DLLA 3MP1A 2XIDA 2HL3A 1OPLA 4QVCA 1OU8A 1WQWA 4RCBA 5GANg 2A37A 1NZ9A 1QP3A 2ZZDA 2RI2A 3OYMA 3GNGA 1JBMA 2RQWA 2AKLA 1N27A 2COWA 2PQWA 3PTAA 4HA8A 2W0ZA 1CKBA 3CXCP 4QT7A 4J9GA 4LNPA 1YJNQ 2KXDA 4JS4A 2DL7A 3CMET 4JJDA 1W6XA 2L8DA 2CP6A 1ZLMA 3PGGA 1QMCA 1VOMA 2DL3A 1U1TA 2JUFA 4JRIA 3CMAQ 2DETA 5D6XA 4C92C 4A4GA 2JS2A 4ANJA 4M7AA 2HNIA 2M1HA 5I2SA 3JCMb 4MMKA 2B86A 2YRDA 3VRYA 4M7DG 3JCMX 1PNJA 2PU9B 4B6MA 4FT4A 1RLPC 2C06A 2E3HA 1XTDA 5KYXB 3OYYA 4MDXA 1ZBXA 1QWFA 3EFSA 1PHTA 3CCVT 2ZPBB 3A8LB 2DXUA 2YHTA 4NL3A 3QHSA 1MUZA 2Y90A 5GAN3 3SD4A 3CC2T 2XHCA 3OYKA 1R8OB 4V2SA 2MYSA 1JRIA 3A5ZB 1J3TA 3CC4A 3G71A 4IURA 3D7SB 2QQ9A 5IH2A 2KI7A 5KCOA 5GAOp 1RADB 3CCEQ 3QXEB 4M78E 5KH6A 2WSEE 3MEWA 3CCUQ 2CUBA 1AWXA 5FROA 2XDPA 4EMKB 1D3BB 4KH0B 3JCMP 2LQ8A 5LJ3d 4A63B 2LDMA 2QEXT 3Q1JA 3LLRA 2DTIA 1IO6A 2L89A 1D0XA 1ZQ1A 4M75D 1AWJA 4ME7A 1M4ZA 5HY6A 1SRMA 4JDSA 3MCAB 5GAOr 1WPYA 1QVGA 1VQ9Q 4E7HA 3H0HA 1NJIU 1UUEA 1T0HA 3M0PA 2LT1A 3LWIA 2DE0X 1RUWA 4M7DD 3EGDA 3X20B 2KBTA 2JM9A 4OMPA 2XDBA 4P5NA 2OTJT 3M0SA 1OOTA 4D8KA 3EHRA 3SDZA 4XTUA 3GIBA 3SWNC 1KSWA 4OMQA 4ELYC 1X75C 4BY6C 1WHJA 1G3TA 3UWNA 5KYUA 3OBWA 5GAMj 5GAN5 4C8QB 5M9OA 4AT1B 2KT8A 2RB6A 2HQHA 2JOYA 2VGMA 1GL5A 2DXTA 4DBRA 3EHQA 3RESA 5A2QE 1M90C 3OMGA 2F2VA 2K9GA 4X34A 5IN1A 1SRLA 3BDLA 1MMNA 3CMEQ 3VS0A 1Q81C 2QTVA 4UC4A 3QWXX 3CBPA 1YJNT 5GAOq 1CKAA 1R0BG 1H8KA 1WJRA 1MV3A 3FIFA 5CKEA 2X3XD 2GTJA 4BY6B 1Q86U 1B3QA 5GAN6 1X6GA 2LQKA 4Y28E 5HKCA 2OTLQ 4N4GA 2KRSA 1W4SA 3FB9A 4PNOA 5KYYA 2D1XA 4N0AC 5DY9A 2SRCA 1LOJA 2E10A 5GANd 1KHIA 5A0GA 2EW3A 4OF1A 3OSVA 1WJQA 4PLIA 2RM4A 3TSZA 3G6EA 1VQNT 5C0MA 1UHCA 3H8ZA 4D6WA 3I5SA 1VQ8T 2JT4A 1G3SA 2QI2A 2J05A 1Y07A 2DL5A 4OMMA 1UJYA 1W70A 5CKDA 2MF2A 1YITQ 3RKWA 1S1NA 3NTKA 1N5ZA 1Y71A 2FVUA 3QPHA 4M7AD 2DNUA 4J5YA 1WGSA 1TS9A 2MK5A 5I11A 1I5LA 1VQ7A 3VS6A 5GJWB 3G4SQ 2DBMA 1MNDA 5GMKe 1BI2A 1M9SA 3QZ9B 2DBKA 2XDDA 2RJCA 2VYTA 1VQMA 4N4HA 1M2VA 1VQ4A 2K5FA 1SPKA 4O5VA 3HPWA 3JSCA 1AT1B 3HRUA 1N8RR 3HL8A 2PUOB 1WNLA 4ZTJA 1O75A 2RQTA 4C5GA 2JW4A 4FM4B 2YRCA 2DTHA 1YWPA 2VGNA 3GBQA 5CQYA 4OVAA 2OX7A 2MI6A 2R58A 1MMGA 3LGFA 4M75B 3QUIA 3R6NA 4M77E 3VS4A 1YNZA 3ER0A 3F70A 3RKXA 3PNWC 5FU6B 3OA6A 2DD4A 4KGZB 4XTWA 4EMKA 2KYMA 3CC4T 4TVRA 4HCCA 3CCQT 1PD1A 3CD6T 2K2VA 4Q5WA 1M27C 1YP5A 3QG1A 2BE9B 2RQUA 3MHXA 1NLPC 5AYFA 3OYGA 2NUTB 3CBMA 3BY7A 3EG3A 4IUVA 2YT6A 2CUDA 4FW2A 4C92F 4DOWA 2L3QA 2KDSA 2JN0A 1Z9QA 3M0TA 3VS2A 4J7IA 2CZ7B 1I8FA 5CKFA 3X28B 2D0QB 5CCAA 4NS5A 1M8MA 1UGSB 3NMZC 5GMKl 2VASA 2DRMA 5LJ5e 5LL6S 2MIOA 1YHQA 4VUBA 4C0FA 4C92E 3JCMe 4KULA 2K3BA 4IKFA 1YIJT 1QCFA 2BZ8A 2FZGB 1FMVA 3M56A 2CP0A 4IUQA 4QQDA 3JCMd 3CCEA 3X24B 1M1KU 2RN8A 1SHFA 3H9NA 1SSHA 3HRTA 3OYJA 2D8JA 4PJOE 1NLOC 3C12A 2HSPA 2J6FA 1YJ9A 4J9DA 1VQOT 2LCSA 2XICA 2LNVA 2P0KA 2CSQA 5GAOn 3WXMB 4A54A 3GLXA 4F7UA 2F5TX 3MO8A 2E6NA 4OB0B 3QO3A 3H0IA 3P8BB 2XD0A 4KT0E 1BIAA 3CCRA 1K0XA 3M4GA 3CCJQ 3OS5A 2HZYA 3I55T 4OMFB 3UDCA 1VQ6T 1OX9A 2NUTA 2GQVA 1K9MR 4IIMA 4BDYA 1UGQB 1KIKA 1NPPA 3I56T 1X69A 2KYBA 1JO8A 2VKNA 3E9GA 1QW1A 5EC7A 5IXBA 5FW9A 4RG2A 4HVVA 5KYYB 3JB9H 2K57A 3GP8A 1N9SA 2A7YA 1GFCA 1KC8U 3X26B 4E7ZA 4BI4A 4JZ4A 1PRMC 1BI1A 3CXCS 2EGEA 2FZKB 3TU4K 2EFIA 3PMIA 2X4JA 5KCHA 1S72T 4LUEA 3JCMV
chains in the Genus database with same CATH topology
3CC7A 3JCMh 3RKYA 4M7AA 3C94A 2FYKA 1K73U 2HNIA 2M1HA 5I2SA 3JCMb 5LJ5h 4MMKA 5KE2A 1MHNA 4MDWA 1XNIA 3GF5A 3I56A 2JTMA 5IT9E 5GAN7 4X9DA 4RKUE 4M7DG 3GOXA 3JCMX 3E9FA 2PU9B 2LX9A 2EJFA 4J6YA 5LJ5f 2RA2A 3VKIA 4FT4A 4J8OA 4NOYA 2C06A 3JCMf 1VQ9A 2DKGA 3MP8A 2DIQA 2E1HA 1XTDA 2VC8A 3OYYA 4OB1B 3ZEHA 4BB7A 4ZN1A 2D6FA 3L2ZA 4C8QF 3CCQA 2OTLA 2GF7A 2JZ2A 3QJ6A 1ZBXA 1HXDA 4M77A 3VYHB 3EFSA 5GMKj 4MDXA 4BDZA 1VIEA 1LJOA 1KC8C 3CCVT 2HQEA 5CQXA 3OYAA 2ZPBB 1BI0A 3A8LB 4BE0A 2DXUA 2YHTA 1YITT 4II1A 4XU0A 4NL3A 1Q81U 3RMQA 2R57A 1VQ7T 3QHSA 1XOVA 3OSSC 3OB9A 5GMKm 3PIOA 2Y90A 2XK0A 5FRNA 4EMGA 2EAYA 5CKBA 5GAN3 2RHIA 3SD4A 1HK9A 2JVVA 2F69A 3JRZA 3VJPA 5GAOm 1YJWA 1FWZA 3CC2T 2XHCA 1VQ5A 4XU3A 3OYKA 2EQKA 1UGPB 4E7IA 1R8OB 2KK4A 4V2SA 4E7KA 1JRIA 3A5ZB 1QVFA 3S3MA 3CC4A 3G71A 1TH7A 5L8RE 4IURA 2WACA 2QQ9A 3LYIA 4FIBA 1QVGS 1M1KC 2O4XB 4XU1A 5KCOA 4C0GA 5GAOp 4L5GA 5DLQE 4J6XA 1YJNA 1U8RA 2DD5A 4M75A 2M9UA 3QXEB 4M78E 5KH6A 2YLBA 3L2WA 1YITA 2WSEE 3MEWA 4XTXA 4XAXB 3V8JA 2EJ9A 2GCXA 4XK8E 5FROA 1H3ZA 2CGHA 2EWNA 4M77F 5FU6C 1N9RA 5HK0A 3M4YA 2XDPA 2KAFA 4ATOA 4JLIA 5FU7C 1VQMT 4EMKB 3CMEA 4XQ3A 1M1GA 3RIRA 3JAME 1D3BB 4C92G 3ZFJA 4F7UB 3JCMP 3OYCA 1VQ9T 2LQ8A 4PL6A 5LJ3d 3VUBA 2LDMA 3G4ST 1OYXA 2QEXT 3Q1JA 2YLCA 2DVEA 2VV5A 4LDXA 1LNXA 4M78G 3DB3A 3LLRA 4BI8B 2DTIA 2P0PA 3M58A 2EIFA 2L89A 4E7LA 1ZQ1A 4DQ2A 1MGQA 2RI3A 4M75D 2DPPB 4ME7A 1M1FA 5GAN8 3NTHA 1M4ZA 5HY6A 1N8RC 2BKDN 4R56A 4BD3A 4JDSA 4A4HA 3MCAB 4M77B 1WPYA 3ZBDA 4C5EA 5GAOr 1QVGA 4E7HA 1NJIU 2QA4T 1NE8A 2G3RA 4DOVA 4ZN3A 4MZTA 5LJ5g 4M7AE 1UGRB 3V7SA 5GAMh 3LWHA 3CMAT 2LT1A 2VUBA 3LWIA 3QBYA 3BDUA 3CC2A 2K4YA 1QP2A 5DLOA 1N6AA 4RMOA 4M7DD 3C95A 4M7AF 2B8AA 3CCUT 2DIGA 4O6JA 3X20B 1X01A 2XDBA 4P5NA 3OYNA 2QQBA 2OTJT 2QQRA 5CIUA 2RO0A 2ZPEB 4JUVA 3TEEA 4EPCA 2A3LA 1KD1U 3OS2A 2RJFA 3SDZA 4XTUA 4KBMB 2QQSA 1NJIC 3QZ5B 2LCLA 3GIBA 3CCVA 3SWNC 2DJZA 3OYLA 5GANf 1KQ1A 3OS1A 3EFRA 4J7FA 1RL2A 3DB4A 1YBYA 3LGLA 2BIVA 3CCSA 4ELYC 3S3OA 1FX7A 4IUTA 5CR2A 2RK2A 4JJNK 4BACA 4YTLA 1VQNA 2AHJB 1GXIE 1VUBA 3JCMQ 1X75C 4A53A 4LD9K 1YCYA 2O01E 2V8IA 3JCMg 1BKBA 4BY6C 4ELZC 4A4EA 1B34B 1JB0E 2NLUA 5GAMe 1KQSS 1G3TA 3A8HB 1VQLT 2HD0A 3UWNA 3M54A 4ZGEB 3OBWA 2D9TA 4IUUA 4OGCA 4B9WA 4C8QB 2RJDA 3M5AA 5M9OA 5GAMj 5GAN5 3G7ZA 2RB6A 3BW1A 3G4SA 1G3WA 2QEXA 3CPFA 4M7DE 3L42A 1U1SA 2JOYA 3MEAA 2VGMA 4FU6A 3MP6A 3FRNA 5FLXE 3S3NA 2DXTA 2PVOB 3L1AA 2DEQA 3DKMA 3RESA 3PMTA 3SB2A 5A2QE 3CPWS 3OYFA 3CCET 3A8MB 4XTYA 1M90C 3M55A 3OMGA 2FL7A 2ZPIB 4M7DC 3VUZA 3QYGB 4X34A 5IN1A 3X25B 3BDLA 4PJOG 4OGEA 3JB9F 1M8VA 3EAEA 1VQ6A 1Q81C 3DLMA 4UC4A 3C4SA 2LTOA 3CBPA 1YJNT 2IG0A 1PSFA 3CBOA 4PLLA 3CEYA 4QQGA 3PFSA 5GAOq 3J81E 1WJRA 4OP0A 1V29B 2GFAA 4RG8A 2MMPA 3FIFA 2M16A 5CKEA 3L2RA 1W2BA 3J7AF 4BY6B 5GAN2 3MEVA 3NFCA 2XU8A 4C5HA 1Q86U 5DM7R 1YHQA 3NTIA 5GAN6 2LQKA 4Y28E 5HKCA 2ZPGB 3TCJA 1PSEA 2CS7A 3MEUA 3M53A 2DTOA 4GLKA 4N4GA 1YI2T 1VQ4T 1W4SA 1UB4A 1S72A 3OMCA 1Y96A 3SWNB 1IZ6A 3L2QA 3FB9A 4PNOA 2DXBA 4J83A 2VXFA 2O4XA 4LDWA 3I55A 3ASKA 4N0AC 5DY9A 4M78D 5J26A 1LOJA 1G3YA 2E10A 3SFMA 4C92B 2LC4A 5GANd 1KHIA 3CCMA 5A0GA 5GMKi 1M90U 4OF1A 2RD1A 3OSVA 3ME9A 1WJQA 4PLIA 3OBYA 5I21A 2RM4A 2Y4YA 4ZGDB 2ZCFB 1IREB 1OZ2A 2E41A 1G5VA 2DAQA 3GNFB 4QW2A 3G6EA 2E12A 4C0DC 4E7JA 2V8JA 1VQNT 5C0MA 3HHTB 2K5IA 3M9QA 3H8ZA 4M7AB 4RCCA 3V8LA 4D6WA 1W2BS 3VV0A 1VQ8T 4PJOB 3HFOA 2ZPHB 1G3SA 4B9XA 4EDUA 3OW2S 2QI2A 1KQSA 3RMSA 2EQMA 4FSXA 4LDUA 4C92D 5GANj 3HSBA 1Y07A 3QIIA 5LJ3j 5CKDA 2MF2A 2PVDB 3LX7A 1H641 2M0OA 3CCUA 3RKWA 3JCMW 4M75F 2RHYA 2RHZA 3NTKA 4M7DB 1Q7YC 3E1SA 4JRKA 1Y71A 1KG1A 2KMTA 2MAMA 2FVUA 3RUXA 1QVPA 4F7UE 5A0DA 5CAIA 3QPHA 5KE3A 5A0LA 3CXCA 4KUDK 1QVFS 4M7AD 4J5YA 1KD1C 4PJOD 1WGSA 5GAMf 3CCMT 3CC7T 4M7AG 4Y91A 1KQ2A 3CCJT 4C8QC 1I5LA 1VQ7A 4OB2B 1OI1A 4M78A 3HKSA 4N0AA 2PUKB 4PJOF 4QVDA 1EIFA 5GMKe 5FU7B 3OYIA 2XKOC 1BI2A 1M9SA 3QZ9B 3CCST 1JJ2S 3L2UA 4ZGJB 5EG2A 1NPRA 2XDDA 4M75C 2RJCA 2VYTA 3SWNA 2MWOA 4MZPA 1VQMA 4N4HA 1VQ5T 2QQAA 1VQ4A 2K5FA 4DA4A 4O5VA 3OW2A 3HPWA 3FJPA 4WF2A 4F7UG 4FT2A 2DK3A 3CCLT 3JSCA 4A4GA 4C5IA 4XTVA 2CZ1B 3HRUA 3META 3KXTA 1D3BA 2E70A 2JNGA 2PUOB 3HL8A 1WNLA 3OY9A 3G71T 4ZTJA 1O75A 2DZCA 1Y96B 3PIPA 3CD6A 4C5GA 2L3RA 4N4IA 4FM4B 1YJ9T 2DTHA 1OZ3A 2VGNA 1UEBA 3KUFA 4HCZA 5FRMA 1VQKT 1Q82C 2RK1A 5CQYA 4OVAA 3OS0A 2I2LA 3P8HA 3P8DA 2BUDA 2MI6A 2YRVA 2R58A 3G6ET 5D6YA 3LGFA 4M75B 3QUIA 2FHDA 4M77E 3JB9D 2XG8D 3ER0A 3VYGA 2E5QA 4BUGA 1M5Q1 2DO3A 4BE1A 1YIJA 4HCBA 2KVQG 5D6WA 3F70A 3RKXA 2EQJA 3PNWC 4BE2A 4IUPA 4M77C 4M78F 5FU6B 2H3JA 2EYQA 3OA6A 2DD4A 4PJOA 4XTWA 3QSUA 5LJ5d 4EMKA 1SSFA 3CC4T 3HRSA 2EKOA 4TVRA 5C6SA 5CVIA 3FC3A 3M59A 3CCQT 2OTLT 4HCCA 4L59A 4JLGA 2CZ6B 2Y4XA 1VQPT 3VU3C 2K2VA 2HAXA 3CD6T 4M77G 4Q5WA 5GMKh 1KHCA 1WQ7A 3FDRA 4L6V5 3OYHA 3CCJA 3QG1A 4LDYA 1VQLA 3LH0A 4BI3A 1YHQT 2K5LA 4M7DF 2EQUA 3M57A 4LD6A 3O8VA 3MHXA 3URGA 3TREA 2EJGA 2IVWA 5AYFA 3OYGA 4KUIA 3WVDB 3E19A 3OYBA 3JCMc 4HT9A 4M7DA 3JB9I 2R5AA 2X4XA 2LVMA 4C0DB 4HT8A 3CBMA 2MWPA 3BY7A 2X4YA 4IUVA 4A4KA 3A8GB 4ZTFA 2XI9A 4M77D 1BI3A 1XQHA 4C92F 4DOWA 1Q86C 2DZ9A 2KDSA 1Y7XA 5I2MA 2F5KA 4FL6A 2RHUA 2JN0A 5IAYA 3GPLA 3CCLA 4C8QE 4J7IA 2CZ7B 5J39A 1I8FA 5CKFA 3T9NA 4Z02A 2D0QB 2R5MA 3X28B 2CYZB 5CCAA 1VQPA 4XU2A 2QDYB 2WSCE 4NS5A 1VQKA 4CRIA 5LJ5j 1Q82U 1JJ2A 1UGSB 3A8OB 5GMKl 2RH2A 2GFUA 3S6WA 1K9MC 5LJ5e 3QJYA 3AHUA 2KQWA 3INZA 4QVZA 5LL6S 4E47A 3UT1A 2K3YA 3QYHB 4VUBA 4C0FA 4C92E 2OAUA 4KULA 4QQ6A 3V8KA 3JCMe 2QA4A 1BIBA 4IKFA 3CMAA 1YIJT 5GANe 2LCCA 2LT4A 3M56A 3JB9G 4C8QG 5CK9A 1I81A 2KSSA 5GANh 4IUQA 4QQDA 4PJOC 3JCMd 3CCEA 2L5QA 3FLGA 3X24B 4R55A 3CCRT 4JRPA 5CO7A 1M1KU 1YI2A 2HBPA 1WJSA 3JB9J 4HKEA 3BFMA 2OTJA 3HRTA 2WSFE 3OYJA 4PJOE 1AHJB 2HQXA 3C12A 5GAOl 2ZPFB 3HP9A 1YJ9A 4M75G 3V7RA 1FXXA 1RI0A 5LJ3h 1VQOT 3QDRB 4F7UF 3L2VA 3JCMJ 2XICA 2E6ZA 1ZHIA 2LNVA 2X35A 1B34A 4C92A 4J6WA 4C8QD 2ZGWA 2QXFA 2P0KA 2X4WA 2CZ0B 2DXCA 4EMHA 4M75E 5GAOn 4JRQA 1Q7YU 3QKJA 3WXMB 4A54A 3GLXA 3FEOA 4F7UA 1K8AU 2F5TX 3N5BB 2RJEA 2P4TA 2VXEA 3MO8A 4X9CA 3J80E 3DLLA 1K9MU 2E6NA 3H6ZA 3MP1A 4MZMA 4OB0B 1YJWT 2XIDA 2JTFA 3QO3A 4QVCA 4A4FA 3P8BB 3WVEB 1WQWA 5LJ3g 4RCBA 1P92A 1BIAA 4KT0E 3HFNA 3CCRA 5GANg 2XD0A 3M4GA 1DJ7B 5LJ3e 5J3BA 3V7CA 3KBGA 1NZ9A 1QP3A 2K3XA 2KY9A 2ZZDA 4NL2A 2RI5A 3OS5A 5GAMd 2LRQA 3I55T 3CPWA 1BYMA 2RI2A 3OYMA 3RERA 3GNGA 1JBMA 4OMFB 3UDCA 2CKKA 1N27A 4OB3B 5HK3A 1VQ6T 2PQWA 3PTAA 1O9SA 2GQVA 2V8KA 1N8RU 4HA8A 4BDYA 1UGQB 1NPPA 3I56T 3E9GA 1X6OA 2E65A 4M78B 1QW1A 3OYEA 4JS5A 2P0QA 2FB7A 3UPUA 4M78C 3OYDA 4C8QA 5LJ3f 1VQ8A 4MMLA 4RG2A 4EMKC 2E64A 4JS4A 1K73C 3CMET 3JB9H 2K57A 4M7AC 3GP8A 1K8AC 4PKCC 1N9SA 2A7YA 2L8DA 2QTXA 5GAMg 4XTZA 3PGGA 2PVGB 1KC8U 3X26B 5CKHA 1U1TA 2JUFA 3R6OA 5GAN4 4BI4A 4CI0C 3LW5E 4JRIA 3CXCS 1BI1A 3OQ5A 4LDVA 3TU4K 1S72T 2EFIA 3PMIA 4C0ZA 1VQOA 1VIFA 5D6XA 2RHXA 2X4JA 3PT9A 4GY5A 4C92C 5KCHA 1I4K1 3JCMV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM h;  4C8Q E;  5LJ3 j;  4M7A E;  5LJ5 g;  3RKY A;  4M7A A;  1I8F A;  3V7S A;  5GAM h;  2FYK A;  2HNI A;  3JCM b;  1H64 1;  5LJ5 h;  3BDU A;  4MMK A;  4XU2 A;  3RKW A;  4M75 F;  3JCM W;  5LJ5 j;  4M7D B;  5GAN 7;  5GMK l;  4JRK A;  4X9D A;  4M7D D;  4M7A F;  3RUX A;  4F7U E;  5CAI A;  5LJ5 e;  3AHU A;  4M7A D;  3INZ A;  1X01 A;  4M7D G;  3JCM X;  4J5Y A;  4PJO D;  4J6Y A;  2EJF A;  4C92 E;  5GAM f;  2RA2 A;  5LJ5 f;  3JCM e;  4Y91 A;  3V8K A;  1KQ2 A;  1BIB A;  4JUV A;  4C8Q C;  1I5L A;  4NOY A;  3JCM f;  5GAN e;  4M78 A;  2DKG A;  4XTU A;  3JB9 G;  4C8Q G;  4N0A A;  4PJO F;  1I81 A;  4QVD A;  5GAN h;  2E1H A;  5GMK e;  3GIB A;  3SWN C;  2DJZ A;  3JCM d;  2VC8 A;  5GAN f;  4PJO C;  1KQ1 A;  3L2Z A;  4C8Q F;  3EFR A;  3JB9 J;  4M77 A;  1HXD A;  3BFM A;  4M75 C;  3EFS A;  5GMK j;  3SWN A;  4PJO E;  1LJO A;  5GAO l;  3FJP A;  3JCM Q;  2DXU A;  2YHT A;  4WF2 A;  4XU0 A;  4A53 A;  4F7U G;  4NL3 A;  1YCY A;  4M75 G;  3JCM g;  3V7R A;  3QHS A;  1B34 B;  4XTV A;  5GAM e;  5GMK m;  5LJ3 h;  4F7U F;  3JCM J;  1D3B A;  2Y90 A;  4C92 A;  5GAM j;  4C8Q B;  1B34 A;  1WNL A;  4J6W A;  4C8Q D;  2ZGW A;  2DZC A;  2EAY A;  1Y96 B;  2RB6 A;  3BW1 A;  4EMG A;  4M75 E;  5GAN 3;  5GAO n;  4M7D E;  1HK9 A;  1U1S A;  4A54 A;  2DTH A;  4F7U A;  2DXT A;  5GAO m;  2VXE A;  2DEQ A;  3L1A A;  3RES A;  3SB2 A;  3RER A;  4X9C A;  4XU3 A;  4XTY A;  2I2L A;  4M7D C;  4V2S A;  1JRI A;  1M8V A;  4PJO G;  3QO3 A;  4QVC A;  3JB9 F;  4M75 B;  5LJ3 g;  3QUI A;  1WQW A;  4RCB A;  1TH7 A;  1BIA A;  3HFN A;  4M77 E;  5GAN g;  3JB9 D;  3M4G A;  5GAO q;  1M5Q 1;  4OP0 A;  5LJ3 e;  4XU1 A;  3FIF A;  5GAO p;  3V7C A;  4J6X A;  3RKX A;  5GAN 2;  4NL2 A;  4M77 C;  4M75 A;  4M78 F;  5GAM d;  4EMH A;  4M78 E;  2YLB A;  4PJO A;  4XTW A;  3QSU A;  5LJ5 d;  4EMK A;  1JBM A;  4XTX A;  5GAN 6;  3V8J A;  2EJ9 A;  2DTO A;  2CGH A;  2EWN A;  4M77 F;  1N9R A;  4HA8 A;  5GAN j;  1Y96 A;  4JLI A;  3SWN B;  3VU3 C;  4EMK B;  3FB9 A;  4M77 G;  4XQ3 A;  1WQ7 A;  4PNO A;  3RIR A;  5GMK h;  1D3B B;  2VXF A;  4C92 G;  3JCM P;  4F7U B;  2E65 A;  4M78 B;  5LJ3 d;  4N0A C;  5DY9 A;  4M78 D;  2FB7 A;  4M78 C;  2YLC A;  1LOJ A;  2DVE A;  2E10 A;  4C92 B;  1LNX A;  5LJ3 f;  4C8Q A;  4MML A;  4EMK C;  4M78 G;  5GMK i;  2E64 A;  5GAN d;  4M7D F;  2RD1 A;  2DTI A;  5I21 A;  3JB9 H;  2K57 A;  4M7A C;  2RM4 A;  2EJG A;  1N9S A;  2QTX A;  4M7A G;  4DQ2 A;  4XTZ A;  3PGG A;  2E41 A;  5GAM g;  1MGQ A;  3JCM c;  4HT9 A;  5GAN 5;  3JB9 I;  4M75 D;  4M7D A;  1U1T A;  5GAN 8;  5GAN 4;  4HT8 A;  3BY7 A;  4JRI A;  4M7A B;  4RCC A;  3V8L A;  4M77 B;  5GAO r;  1WPY A;  4PJO B;  3HFO A;  4M77 D;  4C92 F;  2DZ9 A;  4C92 C;  2JN0 A;  4C92 D;  3HSB A;  1I4K 1;  3JCM V; 
#chains in the Genus database with same CATH topology
 3RKY A;  3C94 A;  2J7I A;  5LJ5 h;  5KE2 A;  1HYO A;  3GF5 A;  3I56 A;  2JTM A;  2FPD A;  1AVZ C;  1V76 A;  2CRE A;  3MP8 A;  2ED1 A;  5KYU B;  1KFZ A;  4DBF A;  3ULR B;  1TUD A;  4OB1 B;  1AWW A;  3L2Z A;  2OTL A;  2JZ2 A;  4M77 A;  1HXD A;  2NUZ A;  3EFO A;  1KQS P;  2OJ2 A;  5CQX A;  4PFP A;  1BI0 A;  1YIT T;  2CSI A;  3MKD A;  1VQ7 T;  2YSQ A;  3PIO A;  3EG9 A;  4F17 A;  3CCV Q;  1D1B A;  1TXQ A;  3VJP A;  4FW1 A;  2EQK A;  2BZY A;  1QVF A;  3S3M A;  1X2K A;  2WAC A;  3LYI A;  4FIB A;  1WI7 A;  2ENM A;  2O4X B;  4XU1 A;  6AT1 B;  1U8R A;  1ZUY A;  2DD5 A;  1BBZ A;  2YLB A;  1YIT A;  3V8J A;  4XK8 E;  1F1B B;  1MMA A;  3M0U A;  2C0I A;  1H3Z A;  3TQ7 P;  1N9R A;  2JJ9 A;  5FU7 C;  1M1G A;  1WHH A;  1VYU A;  1NYG A;  3G4S T;  2JTE A;  2VV5 A;  4EIK A;  3EG9 B;  4M78 G;  1XJW B;  3DB3 A;  1JQQ A;  2A0F B;  4BI8 B;  3M58 A;  4AG2 C;  3I35 A;  2EPD A;  3JV3 A;  3QWY A;  4DQ2 A;  1MNE A;  1VQM Q;  1VQ4 Q;  2Z0W A;  2KRN A;  1TWB A;  2BKD N;  2EYY A;  4BD3 A;  4R56 A;  4M77 B;  4C5E A;  2YUN A;  1NG2 A;  2ABL A;  2G3R A;  4MZT A;  3CMA T;  3QBY A;  3CC2 A;  2K4Y A;  5DLO A;  1N6A A;  4JJC A;  2B8A A;  3CCU T;  1I07 A;  4O6J A;  1X01 A;  1RAG B;  1ACM B;  3BE3 A;  1JU5 C;  1D1C A;  5CIU A;  3UF4 A;  1NEG A;  2ZPE B;  2X51 A;  2KXC A;  2QQS A;  3I9Q A;  1NJI C;  4E2F B;  3OYL A;  2LJ3 A;  3EGX A;  1TUG B;  3OS1 A;  3EFR A;  4J7F A;  4F04 B;  2O31 A;  2ZAE A;  3CCS A;  3S3O A;  2RK2 A;  3JCM Q;  4LD9 K;  1PM3 A;  3A8H B;  4Y92 A;  2ATC B;  2D9T A;  4OGC A;  2FEI A;  1K8A R;  1T3L A;  3BW1 A;  1I0C A;  2QEX A;  1UFF A;  1U1S A;  3MEA A;  3QDF A;  3FRN A;  3S3N A;  2BE7 D;  3L1A A;  2DEQ A;  3DKM A;  3CPW S;  3H0F A;  4AFS C;  1KC8 R;  3A8M B;  4XTY A;  1Y57 A;  3QYG B;  2MPX C;  3X25 B;  2QK0 A;  3C4S A;  2LTO A;  2QG9 B;  1TU0 B;  3PFS A;  1V29 B;  2GFA A;  4ORZ A;  4RG8 A;  3J7A F;  2GNC A;  2H8H A;  4DBH A;  5GAN 2;  3NFC A;  4C5H A;  2CP7 A;  3CCQ Q;  3TCJ A;  2DLP A;  1PSE A;  1NYF A;  2CS7 A;  2KNB B;  4GBQ A;  1YI2 T;  4D8D A;  4WCI A;  1QWE A;  2I0N A;  2QDL A;  3I55 A;  3ASK A;  1B7T A;  4M78 D;  5J26 A;  1G3Y A;  2JMC A;  3SFM A;  3CCM A;  1M90 U;  1EZZ B;  2RD1 A;  1OZ2 A;  3VS5 A;  2E41 A;  1G5V A;  2DAQ A;  3GNF B;  2E12 A;  3M9Q A;  4M7A B;  1W2B S;  2FRW A;  3VV0 A;  1KQS A;  1VYV A;  4FSX A;  4C92 D;  3HSB A;  2LP5 A;  4J9I A;  3JCM W;  2RHZ A;  3E1S A;  2KR3 A;  2YUQ A;  1WXU A;  2KMT A;  5A0D A;  4KUD K;  2C0O A;  1QVF S;  4Z89 A;  2CP3 A;  4PJO D;  3CCM T;  1E6H A;  4RTT A;  1KQ2 A;  4C8Q C;  4OB2 B;  4M78 A;  2DMO A;  3REB B;  1JJ2 S;  1Q95 G;  4ZGJ B;  5EG2 A;  1RAI B;  3SWN A;  3CQT A;  2QQA A;  2VVK A;  3OW2 A;  1VQ6 Q;  2K2M A;  3FJP A;  1SG5 A;  4WF2 A;  2QA4 Q;  2CZ1 B;  2JNG A;  2DZC A;  3PIP A;  3CD6 A;  2DM1 A;  2L3R A;  1GRI A;  1UEB A;  1PWT A;  1Q82 C;  2RK1 A;  2LJ1 A;  2MOX A;  3G6E T;  2AZV A;  2PTK A;  4PFZ A;  3JB9 D;  3VYG A;  8ATC B;  1M5Q 1;  2KVQ G;  1Q86 R;  4IUP A;  1SKU B;  2EKO A;  1ZA2 B;  2AZS A;  4M4Z A;  2K6D A;  1VQN Q;  4JLG A;  1PCX A;  2CZ6 B;  1VQP T;  3VU3 C;  2HAX A;  4M77 G;  3FDR A;  1E6G A;  3NGP A;  2YDL A;  1OEB A;  2E5K A;  1YHQ T;  1SF9 A;  2EQU A;  3O8V A;  3CPW P;  2EJG A;  2IVW A;  3WVD B;  2LQN A;  2DJQ A;  3JCM c;  8AT1 B;  1C1A A;  4HT8 A;  2X4Y A;  2DEU A;  4A4K A;  2HL5 C;  2XI9 A;  4RTY A;  1BI3 A;  1XQH A;  1Q86 C;  4FSS A;  1AEY A;  1UJ0 A;  1G8X A;  3T9N A;  4Z02 A;  2QGG A;  4FYY B;  1VQP A;  1VQK A;  4K11 A;  1JJ2 A;  1CSK A;  3A8O B;  3S6W A;  1K9M C;  1QCN A;  3AHU A;  3QJY A;  1LVK A;  2KQW A;  2RPN A;  4QVZ A;  2F1L A;  2HSE B;  3UT1 A;  2K3Y A;  1KD1 R;  4QQ6 A;  3V8K A;  1BIB A;  2CT3 A;  3CMA A;  1WDX A;  4F14 A;  5GAN e;  2EGC A;  4Z8A A;  5CK9 A;  2A28 A;  1R77 A;  3CCR T;  3FLG A;  2F2X A;  1WJS A;  3JB9 J;  4HKE A;  1ZBJ A;  2OTJ A;  3M0Q A;  2WSF E;  1AHJ B;  2E3I A;  2HQX A;  4ESR A;  2YXY A;  2DYI A;  2FG0 A;  2D0N A;  2ZPF B;  1NEB A;  5LJ3 h;  1PRL C;  3JCM J;  1SEM A;  2JM8 A;  4EMH A;  4C8Q D;  3VS3 A;  2QXF A;  2CZ0 B;  4JRQ A;  4M75 E;  1OUL A;  1OU9 A;  3FEO A;  3N5B B;  2RJE A;  2P4T A;  1U5S A;  3J80 E;  3EGD B;  3H6Z A;  1YJW T;  2EKH A;  5AT1 B;  2DRK A;  4A4F A;  5LJ3 g;  3HFN A;  1GCP A;  2DIL A;  5J3B A;  3V7C A;  4RUG A;  2LQW A;  2KY9 A;  4NL2 A;  3KFV A;  2LRQ A;  4F16 A;  3CPW A;  1BYM A;  4AFZ C;  1TG0 A;  2CKK A;  4OB3 B;  5HK3 A;  1BCM A;  1O9S A;  2V8K A;  1N8R U;  2QYZ A;  1ZSG A;  4Z88 A;  1X6O A;  2E65 A;  3OYE A;  3UPU A;  2FB7 A;  4M78 C;  4CC4 B;  4C8Q A;  5LJ3 f;  2D8H A;  2JMA A;  4EMK C;  1U06 A;  1K73 C;  1PD0 A;  2QTX A;  1RLQ C;  4XTZ A;  1X6B A;  1MV0 B;  3R6O A;  1RAC B;  1RI9 A;  4LDV A;  3OQ5 A;  4C0Z A;  4J9H A;  1I4K 1;  2NYS A;  3CC7 A;  1W2B P;  3JCM h;  2DF6 A;  2FYK A;  1YI2 Q;  1M2O A;  1XNI A;  5IT9 E;  5GAN 7;  4X9D A;  3VS1 A;  1UTI A;  1ARK A;  2RA2 A;  3VKI A;  4J8O A;  3PVL A;  4NOY A;  1VQ9 A;  1K1Z A;  2DKG A;  2DIQ A;  4JJB A;  1VQL Q;  1SHG A;  4ZN1 A;  2A36 A;  4BB7 A;  2D6F A;  3CCQ A;  5GMK j;  3RDV A;  1I5O B;  1LJO A;  1KC8 C;  2HQE A;  2J6K A;  4II1 A;  1Q81 U;  3RMQ A;  2R57 A;  1KK7 A;  1XOV A;  4X1V A;  3OSS C;  3CCL Q;  5FRN A;  4EMG A;  3HTR A;  2JVV A;  5GAO m;  4E7K A;  2LMJ A;  1ZA1 B;  1NBE B;  3MPU B;  5L8R E;  1QVG S;  1M1K R;  2KGT A;  4C0G A;  4L5G A;  1WX6 A;  5DLQ E;  1YJN A;  4M75 A;  2M9U A;  4XTX A;  4XAX B;  2EJ9 A;  4FYX B;  1UHF A;  1IHV A;  2QAZ A;  2CGH A;  2EWN A;  4M77 F;  5HK0 A;  3M4Y A;  4PJN A;  4ATO A;  4JLI A;  1VQM T;  1IHW A;  3CME A;  1Z9Z A;  3VS7 A;  2FO0 A;  1FMW A;  4C92 G;  4F7U B;  3OYC A;  1B07 A;  2O88 A;  4PL6 A;  3VUB A;  2KRO A;  3A98 A;  1LNX A;  1W1F A;  2V1R A;  4PJL A;  4KRT A;  1PG5 B;  2P0P A;  3EG1 A;  1M3A A;  2DYB A;  1GCQ C;  2RI3 A;  1M1F A;  5KYX A;  1N8R C;  4A4H A;  2GQI A;  4DBQ A;  1GFD A;  1NE8 A;  1TUC A;  4AFQ C;  3V7S A;  2VUB A;  3BDU A;  1WXB A;  2O9S A;  1WXT A;  3G6E Q;  1LPL A;  2DIG A;  3OYN A;  2QQR A;  1UGV A;  4JUV A;  2A3L A;  2YUO A;  2DFU A;  1WLP B;  2RJF A;  4LN2 A;  3OS2 A;  1KD1 U;  1D09 B;  2DJZ A;  2AIR B;  4J9B A;  4HXJ A;  2CP2 A;  5FWC A;  1YBY A;  2BIV A;  1FX7 A;  3ZL7 C;  4IUT A;  5CR2 A;  4BAC A;  4YTL A;  1VQN A;  2AHJ B;  1GXI E;  1VUB A;  1K4U S;  3G71 Q;  4FYW B;  2O01 E;  3JCM g;  5GJV B;  1KQS S;  1JB0 E;  2NLU A;  5GAM e;  1VQO Q;  3CCE T;  1V1C A;  3M54 A;  1VQ7 Q;  4ZGE B;  4B9W A;  2RJD A;  3M5A A;  3G4S A;  1G3W A;  3CPF A;  1WYX A;  4FU6 A;  3MP6 A;  1BCO A;  1Y0M A;  3PMT A;  3OYF A;  1D1A A;  1M2V B;  2FL7 A;  4M7D C;  5I22 A;  2JXB A;  1M8V A;  4OGE A;  3JB9 F;  3DLM A;  2IG0 A;  1PSF A;  3CBO A;  3GPL A;  4OP0 A;  5D7U A;  2M16 A;  2L2P A;  2XU8 A;  5DM7 R;  2KRM A;  1NM7 A;  3NTI A;  2ED0 A;  4J9E A;  3MEU A;  4GLK A;  3M53 A;  2DTO A;  3U23 A;  1GCQ A;  3UA6 A;  1UB4 A;  3OMC A;  3UAT A;  1Y96 A;  1IZ6 A;  3L2Q A;  2DXB A;  4J83 A;  2VXF A;  2O4X A;  4LDW A;  1UE9 A;  1OPK A;  5GMK i;  1GBQ A;  3OBY A;  2Y4Y A;  4ZGD B;  1WHL A;  2ZCF B;  1YJW Q;  2HEQ A;  3RNJ A;  4QW2 A;  2V8J A;  3HHT B;  2K5I A;  1A0N B;  2MCN A;  1K9A A;  4RCC A;  3V8L A;  1QKX A;  3HFO A;  4B9X A;  1JXM A;  2QAS A;  2EQM A;  4LDU A;  1UG1 A;  1H64 1;  4M75 F;  2RHY A;  4M7D B;  2MAM A;  1TOV A;  1QVP A;  5GAM f;  3CC7 T;  4M7A G;  4Y91 A;  3CCJ T;  2P84 A;  3RR6 A;  1OI1 A;  1M30 A;  2PUK B;  4QVD A;  1EIF A;  5FU7 B;  3L2U A;  1NPR A;  1RAE B;  4M75 C;  2MWO A;  2BZX A;  1VQ5 T;  2FPE A;  1RAH B;  4DA4 A;  1C0M A;  1H3H A;  4JPB W;  4FT2 A;  2DK3 A;  3CCL T;  4XTV A;  1WHK A;  1D3B A;  3MJX A;  4OML A;  2F2W A;  4N4I A;  4PFO A;  4HVU A;  1YJ9 T;  3RBB B;  5KYW B;  1Q82 R;  4J9C A;  3OS0 A;  3P8H A;  4CC3 A;  5KYW A;  2BUD A;  5D6Y A;  2RF0 A;  1OX8 A;  1YJ9 Q;  2KEA A;  2BTT A;  4BUG A;  2CP5 A;  4BE1 A;  1YIJ A;  5D6W A;  3CC7 Q;  4OMN A;  1OV3 A;  4M78 F;  2EYQ A;  4PJO A;  3H41 A;  5LJ5 d;  1SSF A;  2RNA A;  2M02 A;  3FC3 A;  4L59 A;  2C0T A;  2Y4X A;  5GMK h;  1KHC A;  3CCR Q;  2G6F X;  3CCJ A;  1VQL A;  2K5L A;  4M7D F;  3M57 A;  4LD6 A;  1UEC A;  3TRE A;  2VWF A;  3NPF A;  4KUI A;  3OYB A;  4M7D A;  2X4X A;  1VA7 A;  2ROT A;  3A8G B;  1M3B A;  2FPF A;  1X43 A;  2NUP A;  1Y7X A;  1Q81 R;  2RHU A;  3CCL A;  2IPO B;  1K76 A;  4C8Q E;  2R5M A;  1M90 R;  4XU2 A;  2E4H A;  2WSC E;  4RTX A;  1BK2 A;  4CRI A;  5LJ5 j;  1T3S A;  2GFU A;  4RTU A;  1KJW A;  3UA7 A;  2DA9 A;  3EFO B;  1G83 A;  1IRX A;  4LE9 A;  3EGX B;  4OMO A;  1MMD A;  3REA B;  1ABQ A;  2LT4 A;  2LCC A;  4LXC A;  3JB9 G;  1I81 A;  2KSS A;  5GAN h;  3EG2 A;  4PJO C;  2L5Q A;  4R55 A;  4JRP A;  2SEM A;  2HBP A;  4DEY A;  1HSQ A;  3BFM A;  5L23 A;  2EGA A;  1UDL A;  5GAO l;  3HP9 A;  2RMO A;  2LX7 A;  3TVT A;  3I5R A;  1FXX A;  1RI0 A;  1X2Q A;  3QDR B;  4F7U F;  2X35 A;  1S72 A;  1JJ2 P;  2X4W A;  3QKJ A;  1K8A U;  2LZ6 B;  2VXE A;  1K9M U;  2J06 A;  4MZM A;  1HJD A;  2JTF A;  3WVE B;  2HBW A;  1P92 A;  1DJ7 B;  5LJ3 e;  3KBG A;  1YN8 A;  2K3X A;  1IXD A;  1IB8 A;  2RI5 A;  5GAM d;  4DEX A;  3EGU A;  2DVJ A;  2X3W D;  1TTH B;  1PKT A;  2EBP A;  4M78 B;  1D0Y A;  4JS5 A;  2P0Q A;  5ECA A;  2AKK A;  3OYD A;  1U3O A;  1VQ8 A;  4MML A;  1K0S A;  2E64 A;  1AZG B;  2FRY A;  5IHK A;  4M7A C;  1K8A C;  4PKC C;  5GAM g;  2PVG B;  5CKH A;  5GAN 4;  4PJM A;  4CI0 C;  3LW5 E;  1YHQ Q;  1VQO A;  1VIF A;  2EVR A;  2RHX A;  3PT9 A;  4GY5 A;  3THK A;  1PKS A;  1K73 U;  1ZUU A;  1TSF A;  2A08 A;  1MHN A;  4MDW A;  4RKU E;  3GOX A;  3E9F A;  2LX9 A;  2EJF A;  4J6Y A;  5LJ5 f;  2CH4 A;  1AOJ A;  1WHM A;  2VB6 A;  1RAF B;  3JCM f;  2E1H A;  2VC8 A;  3ZEH A;  4C8Q F;  2GF7 A;  3QJ6 A;  3VYH B;  4KH1 B;  3CC2 Q;  4J9F A;  4BDZ A;  1VIE A;  1BU1 A;  4R0K A;  3TSW A;  4ZNX A;  3OYA A;  2NWM A;  4BE0 A;  2L3P A;  4XU0 A;  1HD3 A;  2PZ1 A;  2IIM A;  3OB9 A;  5GMK m;  4RTW A;  4FCY A;  2XK0 A;  2EAY A;  5CKB A;  2RHI A;  1HK9 A;  2DL4 A;  2F69 A;  3JRZ A;  1YJW A;  1FWZ A;  1VQ5 A;  4XU3 A;  1UGP B;  3CCS Q;  2KK4 A;  2O9V A;  4E7I A;  2RQV A;  2L0A A;  1D0Z A;  1TH7 A;  2X9H A;  2YWW A;  2NUP B;  5IHI A;  1ABO A;  2CDT A;  1M1K C;  1AWO A;  4GLM A;  1QKW A;  4J6X A;  3E2U A;  1QVG P;  3L2W A;  2GCX A;  3G1J A;  1R0C B;  5IHN A;  5FU6 C;  4KGX B;  2KAF A;  4XQ3 A;  3RIR A;  3JAM E;  3IQL A;  3ZFJ A;  1VQ9 T;  1OYX A;  2YLC A;  2DVE A;  4LDX A;  1AZE A;  3I56 Q;  2EIF A;  4E7L A;  2FZC B;  1MGQ A;  2AK5 A;  2DPP B;  2OI3 A;  5GAN 8;  3NTH A;  2M0Y A;  3ZBD A;  2K7A A;  1VYT A;  3I55 Q;  2QA4 T;  4JZ3 A;  4M7A E;  1IGU A;  4DOV A;  5LJ5 g;  1UGR B;  5GAM h;  3LWH A;  1QP2 A;  4RMO A;  3C95 A;  4M7A F;  2JS0 A;  1EFN A;  2QQB A;  2RO0 A;  3TEE A;  4EPC A;  2COZ A;  1YIJ Q;  4KBM B;  3QZ5 B;  2LCL A;  3CCV A;  5GAN f;  1KQ1 A;  2EYX A;  1RL2 A;  3DB4 A;  1G2B A;  3LGL A;  4AG1 C;  1PC0 A;  4JJN K;  2RQR A;  2HKQ B;  1YFN A;  4A53 A;  2P4R A;  1YCY A;  2V8I A;  4ELZ C;  4ZN3 A;  1BKB A;  1FMK A;  3FJ5 A;  4A4E A;  1B34 B;  2HD0 A;  3SHW A;  2EQI A;  4IUU A;  3PE0 A;  2L3S A;  3G7Z A;  4M7D E;  3L42 A;  4LUD A;  5FLX E;  5HCK A;  2PVO B;  3SB2 A;  3RER A;  1BB9 A;  3M55 A;  4QKU A;  2ZPI B;  1YWO A;  3VUZ A;  4PJO G;  1RAA B;  3EAE A;  1VQ6 A;  2ROL A;  3A1P A;  4PLL A;  4QQG A;  3J81 E;  3CEY A;  1JEG A;  3C0C A;  5FWB A;  1W2B A;  2MMP A;  3L2R A;  2COY A;  3MEV A;  3CD6 Q;  2ZPG B;  3PVQ A;  2QGF B;  1QCO A;  1VQ4 T;  4AMC A;  3SWN B;  1RAB B;  2HKN A;  2ECZ A;  2LC4 A;  4C92 B;  3ME9 A;  5I21 A;  1WHG A;  1WFW A;  1IRE B;  1QQJ A;  4C0D C;  4E7J A;  4KGV B;  3CC4 Q;  4PJO B;  2ZPH B;  3OW2 S;  4EDU A;  3RMS A;  5GAN j;  1E7O A;  1ZX6 A;  2DX1 A;  1S72 Q;  3QII A;  5LJ3 j;  4PJJ A;  1H92 A;  2PVD B;  3LX7 A;  2M0O A;  3CCU A;  1ZSZ B;  3EH2 A;  1Q7Y C;  4JRK A;  1KG1 A;  3RUX A;  4F7U E;  5CAI A;  3CXC A;  5KE3 A;  2EYW A;  5A0L A;  2AT1 B;  1FYN A;  1KD1 C;  2LNH B;  1ZSZ A;  2PNI A;  1LCK A;  3HKS A;  4N0A A;  4PJO F;  2QEX Q;  2DL8 A;  1NJI R;  3OYI A;  2CT4 A;  2XMF A;  2XKO C;  3CCS T;  1VQP Q;  1VQK Q;  3EH1 A;  3VRZ A;  4MZP A;  2V26 A;  4F7U G;  3OW2 P;  4C5I A;  3MET A;  4HVW A;  1ZUK A;  3KXT A;  2KE9 A;  5KYN A;  2E70 A;  3OY9 A;  3G71 T;  1VQ8 Q;  1Y96 B;  2DER A;  1JXO A;  9ATC B;  1Q7Y R;  1OZ3 A;  5FRM A;  3KUF A;  4HCZ A;  1VQK T;  2OTJ Q;  2I2L A;  3P8D A;  2GBQ A;  2K79 A;  2O2O A;  1YCS B;  2YRV A;  2FHD A;  1WA7 A;  4FYV B;  1IGQ A;  2XG8 D;  1WIE A;  1WZO A;  2E5Q A;  3M0R A;  2DO3 A;  4HCB A;  1I1J A;  2EQJ A;  3CCM Q;  4CC2 A;  4BE2 A;  4M77 C;  2H3J A;  1EX4 A;  3QSU A;  2EYZ A;  3HRS A;  5C6S A;  5CVI A;  3M59 A;  2OTL T;  4HCK A;  2LJ0 A;  1ZSZ C;  1WQ7 A;  4RTV A;  4L6V 5;  3OYH A;  2H3E B;  4E7S A;  1M3C A;  4LDY A;  3LH0 A;  2CH4 W;  4BI3 A;  1K73 R;  4E6R A;  3URG A;  4CC7 A;  3E19 A;  2HCK A;  4HT9 A;  3JB9 I;  2R5A A;  4C0D B;  2LVM A;  4IIO A;  1GBR A;  2MWP A;  4ZTF A;  1QVF P;  4M77 D;  2DZ9 A;  5I2M A;  2F5K A;  4FL6 A;  5IAY A;  7AT1 B;  2V1Q A;  4WTO B;  2YUP A;  4RTZ A;  5J39 A;  2HDA A;  3O5Z A;  2CYZ B;  2QDY B;  1T0J A;  2M51 A;  3NHN A;  1Q82 U;  1VQ5 Q;  2RH2 A;  1AD5 A;  3INZ A;  4E47 A;  3QYH B;  2J6O A;  1X27 A;  2OAU A;  3EG0 A;  2QA4 A;  2GTO A;  1QLY A;  2ESW A;  3SEM A;  2HMA A;  4C8Q G;  1OQK A;  5CO7 A;  4AFU C;  1YI2 A;  2OAW A;  5IXF A;  4M75 G;  3V7R A;  2W10 A;  3L2V A;  2E6Z A;  1ZHI A;  2KT1 A;  4C92 A;  1B34 A;  1VQL T;  4J6W A;  2ZGW A;  1Q7Y U;  2DXC A;  2GGR A;  1C6V X;  3LH5 A;  4PK4 A;  4X9C A;  3AT1 B;  3DLL A;  3MP1 A;  2XID A;  2HL3 A;  1OPL A;  4QVC A;  1OU8 A;  1WQW A;  4RCB A;  5GAN g;  2A37 A;  1NZ9 A;  1QP3 A;  2ZZD A;  2RI2 A;  3OYM A;  3GNG A;  1JBM A;  2RQW A;  2AKL A;  1N27 A;  2COW A;  2PQW A;  3PTA A;  4HA8 A;  2W0Z A;  1CKB A;  3CXC P;  4QT7 A;  4J9G A;  4LNP A;  1YJN Q;  2KXD A;  4JS4 A;  2DL7 A;  3CME T;  4JJD A;  1W6X A;  2L8D A;  2CP6 A;  1ZLM A;  3PGG A;  1QMC A;  1VOM A;  2DL3 A;  1U1T A;  2JUF A;  4JRI A;  3CMA Q;  2DET A;  5D6X A;  4C92 C;  4A4G A;  2JS2 A;  4ANJ A;  4M7A A;  2HNI A;  2M1H A;  5I2S A;  3JCM b;  4MMK A;  2B86 A;  2YRD A;  3VRY A;  4M7D G;  3JCM X;  1PNJ A;  2PU9 B;  4B6M A;  4FT4 A;  1RLP C;  2C06 A;  2E3H A;  1XTD A;  5KYX B;  3OYY A;  4MDX A;  1ZBX A;  1QWF A;  3EFS A;  1PHT A;  3CCV T;  2ZPB B;  3A8L B;  2DXU A;  2YHT A;  4NL3 A;  3QHS A;  1MUZ A;  2Y90 A;  5GAN 3;  3SD4 A;  3CC2 T;  2XHC A;  3OYK A;  1R8O B;  4V2S A;  2MYS A;  1JRI A;  3A5Z B;  1J3T A;  3CC4 A;  3G71 A;  4IUR A;  3D7S B;  2QQ9 A;  5IH2 A;  2KI7 A;  5KCO A;  5GAO p;  1RAD B;  3CCE Q;  3QXE B;  4M78 E;  5KH6 A;  2WSE E;  3MEW A;  3CCU Q;  2CUB A;  1AWX A;  5FRO A;  2XDP A;  4EMK B;  1D3B B;  4KH0 B;  3JCM P;  2LQ8 A;  5LJ3 d;  4A63 B;  2LDM A;  2QEX T;  3Q1J A;  3LLR A;  2DTI A;  1IO6 A;  2L89 A;  1D0X A;  1ZQ1 A;  4M75 D;  1AWJ A;  4ME7 A;  1M4Z A;  5HY6 A;  1SRM A;  4JDS A;  3MCA B;  5GAO r;  1WPY A;  1QVG A;  1VQ9 Q;  4E7H A;  3H0H A;  1NJI U;  1UUE A;  1T0H A;  3M0P A;  2LT1 A;  3LWI A;  2DE0 X;  1RUW A;  4M7D D;  3EGD A;  3X20 B;  2KBT A;  2JM9 A;  4OMP A;  2XDB A;  4P5N A;  2OTJ T;  3M0S A;  1OOT A;  4D8K A;  3EHR A;  3SDZ A;  4XTU A;  3GIB A;  3SWN C;  1KSW A;  4OMQ A;  4ELY C;  1X75 C;  4BY6 C;  1WHJ A;  1G3T A;  3UWN A;  5KYU A;  3OBW A;  5GAM j;  5GAN 5;  4C8Q B;  5M9O A;  4AT1 B;  2KT8 A;  2RB6 A;  2HQH A;  2JOY A;  2VGM A;  1GL5 A;  2DXT A;  4DBR A;  3EHQ A;  3RES A;  5A2Q E;  1M90 C;  3OMG A;  2F2V A;  2K9G A;  4X34 A;  5IN1 A;  1SRL A;  3BDL A;  1MMN A;  3CME Q;  3VS0 A;  1Q81 C;  2QTV A;  4UC4 A;  3QWX X;  3CBP A;  1YJN T;  5GAO q;  1CKA A;  1R0B G;  1H8K A;  1WJR A;  1MV3 A;  3FIF A;  5CKE A;  2X3X D;  2GTJ A;  4BY6 B;  1Q86 U;  1B3Q A;  5GAN 6;  1X6G A;  2LQK A;  4Y28 E;  5HKC A;  2OTL Q;  4N4G A;  2KRS A;  1W4S A;  3FB9 A;  4PNO A;  5KYY A;  2D1X A;  4N0A C;  5DY9 A;  2SRC A;  1LOJ A;  2E10 A;  5GAN d;  1KHI A;  5A0G A;  2EW3 A;  4OF1 A;  3OSV A;  1WJQ A;  4PLI A;  2RM4 A;  3TSZ A;  3G6E A;  1VQN T;  5C0M A;  1UHC A;  3H8Z A;  4D6W A;  3I5S A;  1VQ8 T;  2JT4 A;  1G3S A;  2QI2 A;  2J05 A;  1Y07 A;  2DL5 A;  4OMM A;  1UJY A;  1W70 A;  5CKD A;  2MF2 A;  1YIT Q;  3RKW A;  1S1N A;  3NTK A;  1N5Z A;  1Y71 A;  2FVU A;  3QPH A;  4M7A D;  2DNU A;  4J5Y A;  1WGS A;  1TS9 A;  2MK5 A;  5I11 A;  1I5L A;  1VQ7 A;  3VS6 A;  5GJW B;  3G4S Q;  2DBM A;  1MND A;  5GMK e;  1BI2 A;  1M9S A;  3QZ9 B;  2DBK A;  2XDD A;  2RJC A;  2VYT A;  1VQM A;  4N4H A;  1M2V A;  1VQ4 A;  2K5F A;  1SPK A;  4O5V A;  3HPW A;  3JSC A;  1AT1 B;  3HRU A;  1N8R R;  3HL8 A;  2PUO B;  1WNL A;  4ZTJ A;  1O75 A;  2RQT A;  4C5G A;  2JW4 A;  4FM4 B;  2YRC A;  2DTH A;  1YWP A;  2VGN A;  3GBQ A;  5CQY A;  4OVA A;  2OX7 A;  2MI6 A;  2R58 A;  1MMG A;  3LGF A;  4M75 B;  3QUI A;  3R6N A;  4M77 E;  3VS4 A;  1YNZ A;  3ER0 A;  3F70 A;  3RKX A;  3PNW C;  5FU6 B;  3OA6 A;  2DD4 A;  4KGZ B;  4XTW A;  4EMK A;  2KYM A;  3CC4 T;  4TVR A;  4HCC A;  3CCQ T;  1PD1 A;  3CD6 T;  2K2V A;  4Q5W A;  1M27 C;  1YP5 A;  3QG1 A;  2BE9 B;  2RQU A;  3MHX A;  1NLP C;  5AYF A;  3OYG A;  2NUT B;  3CBM A;  3BY7 A;  3EG3 A;  4IUV A;  2YT6 A;  2CUD A;  4FW2 A;  4C92 F;  4DOW A;  2L3Q A;  2KDS A;  2JN0 A;  1Z9Q A;  3M0T A;  3VS2 A;  4J7I A;  2CZ7 B;  1I8F A;  5CKF A;  3X28 B;  2D0Q B;  5CCA A;  4NS5 A;  1M8M A;  1UGS B;  3NMZ C;  5GMK l;  2VAS A;  2DRM A;  5LJ5 e;  5LL6 S;  2MIO A;  1YHQ A;  4VUB A;  4C0F A;  4C92 E;  3JCM e;  4KUL A;  2K3B A;  4IKF A;  1YIJ T;  1QCF A;  2BZ8 A;  2FZG B;  1FMV A;  3M56 A;  2CP0 A;  4IUQ A;  4QQD A;  3JCM d;  3CCE A;  3X24 B;  1M1K U;  2RN8 A;  1SHF A;  3H9N A;  1SSH A;  3HRT A;  3OYJ A;  2D8J A;  4PJO E;  1NLO C;  3C12 A;  2HSP A;  2J6F A;  1YJ9 A;  4J9D A;  1VQO T;  2LCS A;  2XIC A;  2LNV A;  2P0K A;  2CSQ A;  5GAO n;  3WXM B;  4A54 A;  3GLX A;  4F7U A;  2F5T X;  3MO8 A;  2E6N A;  4OB0 B;  3QO3 A;  3H0I A;  3P8B B;  2XD0 A;  4KT0 E;  1BIA A;  3CCR A;  1K0X A;  3M4G A;  3CCJ Q;  3OS5 A;  2HZY A;  3I55 T;  4OMF B;  3UDC A;  1VQ6 T;  1OX9 A;  2NUT A;  2GQV A;  1K9M R;  4IIM A;  4BDY A;  1UGQ B;  1KIK A;  1NPP A;  3I56 T;  1X69 A;  2KYB A;  1JO8 A;  2VKN A;  3E9G A;  1QW1 A;  5EC7 A;  5IXB A;  5FW9 A;  4RG2 A;  4HVV A;  5KYY B;  3JB9 H;  2K57 A;  3GP8 A;  1N9S A;  2A7Y A;  1GFC A;  1KC8 U;  3X26 B;  4E7Z A;  4BI4 A;  4JZ4 A;  1PRM C;  1BI1 A;  3CXC S;  2EGE A;  2FZK B;  3TU4 K;  2EFI A;  3PMI A;  2X4J A;  5KCH A;  1S72 T;  4LUE A;  3JCM V; 
#chains in the Genus database with same CATH homology
 3CC7 A;  3JCM h;  3RKY A;  4M7A A;  3C94 A;  2FYK A;  1K73 U;  2HNI A;  2M1H A;  5I2S A;  3JCM b;  5LJ5 h;  4MMK A;  5KE2 A;  1MHN A;  4MDW A;  1XNI A;  3GF5 A;  3I56 A;  2JTM A;  5IT9 E;  5GAN 7;  4X9D A;  4RKU E;  4M7D G;  3GOX A;  3JCM X;  3E9F A;  2PU9 B;  2LX9 A;  2EJF A;  4J6Y A;  5LJ5 f;  2RA2 A;  3VKI A;  4FT4 A;  4J8O A;  4NOY A;  2C06 A;  3JCM f;  1VQ9 A;  2DKG A;  3MP8 A;  2DIQ A;  2E1H A;  1XTD A;  2VC8 A;  3OYY A;  4OB1 B;  3ZEH A;  4BB7 A;  4ZN1 A;  2D6F A;  3L2Z A;  4C8Q F;  3CCQ A;  2OTL A;  2GF7 A;  2JZ2 A;  3QJ6 A;  1ZBX A;  1HXD A;  4M77 A;  3VYH B;  3EFS A;  5GMK j;  4MDX A;  4BDZ A;  1VIE A;  1LJO A;  1KC8 C;  3CCV T;  2HQE A;  5CQX A;  3OYA A;  2ZPB B;  1BI0 A;  3A8L B;  4BE0 A;  2DXU A;  2YHT A;  1YIT T;  4II1 A;  4XU0 A;  4NL3 A;  1Q81 U;  3RMQ A;  2R57 A;  1VQ7 T;  3QHS A;  1XOV A;  3OSS C;  3OB9 A;  5GMK m;  3PIO A;  2Y90 A;  2XK0 A;  5FRN A;  4EMG A;  2EAY A;  5CKB A;  5GAN 3;  2RHI A;  3SD4 A;  1HK9 A;  2JVV A;  2F69 A;  3JRZ A;  3VJP A;  5GAO m;  1YJW A;  1FWZ A;  3CC2 T;  2XHC A;  1VQ5 A;  4XU3 A;  3OYK A;  2EQK A;  1UGP B;  4E7I A;  1R8O B;  2KK4 A;  4V2S A;  4E7K A;  1JRI A;  3A5Z B;  1QVF A;  3S3M A;  3CC4 A;  3G71 A;  1TH7 A;  5L8R E;  4IUR A;  2WAC A;  2QQ9 A;  3LYI A;  4FIB A;  1QVG S;  1M1K C;  2O4X B;  4XU1 A;  5KCO A;  4C0G A;  5GAO p;  4L5G A;  5DLQ E;  4J6X A;  1YJN A;  1U8R A;  2DD5 A;  4M75 A;  2M9U A;  3QXE B;  4M78 E;  5KH6 A;  2YLB A;  3L2W A;  1YIT A;  2WSE E;  3MEW A;  4XTX A;  4XAX B;  3V8J A;  2EJ9 A;  2GCX A;  4XK8 E;  5FRO A;  1H3Z A;  2CGH A;  2EWN A;  4M77 F;  5FU6 C;  1N9R A;  5HK0 A;  3M4Y A;  2XDP A;  2KAF A;  4ATO A;  4JLI A;  5FU7 C;  1VQM T;  4EMK B;  3CME A;  4XQ3 A;  1M1G A;  3RIR A;  3JAM E;  1D3B B;  4C92 G;  3ZFJ A;  4F7U B;  3JCM P;  3OYC A;  1VQ9 T;  2LQ8 A;  4PL6 A;  5LJ3 d;  3VUB A;  2LDM A;  3G4S T;  1OYX A;  2QEX T;  3Q1J A;  2YLC A;  2DVE A;  2VV5 A;  4LDX A;  1LNX A;  4M78 G;  3DB3 A;  3LLR A;  4BI8 B;  2DTI A;  2P0P A;  3M58 A;  2EIF A;  2L89 A;  4E7L A;  1ZQ1 A;  4DQ2 A;  1MGQ A;  2RI3 A;  4M75 D;  2DPP B;  4ME7 A;  1M1F A;  5GAN 8;  3NTH A;  1M4Z A;  5HY6 A;  1N8R C;  2BKD N;  4R56 A;  4BD3 A;  4JDS A;  4A4H A;  3MCA B;  4M77 B;  1WPY A;  3ZBD A;  4C5E A;  5GAO r;  1QVG A;  4E7H A;  1NJI U;  2QA4 T;  1NE8 A;  2G3R A;  4DOV A;  4ZN3 A;  4MZT A;  5LJ5 g;  4M7A E;  1UGR B;  3V7S A;  5GAM h;  3LWH A;  3CMA T;  2LT1 A;  2VUB A;  3LWI A;  3QBY A;  3BDU A;  3CC2 A;  2K4Y A;  1QP2 A;  5DLO A;  1N6A A;  4RMO A;  4M7D D;  3C95 A;  4M7A F;  2B8A A;  3CCU T;  2DIG A;  4O6J A;  3X20 B;  1X01 A;  2XDB A;  4P5N A;  3OYN A;  2QQB A;  2OTJ T;  2QQR A;  5CIU A;  2RO0 A;  2ZPE B;  4JUV A;  3TEE A;  4EPC A;  2A3L A;  1KD1 U;  3OS2 A;  2RJF A;  3SDZ A;  4XTU A;  4KBM B;  2QQS A;  1NJI C;  3QZ5 B;  2LCL A;  3GIB A;  3CCV A;  3SWN C;  2DJZ A;  3OYL A;  5GAN f;  1KQ1 A;  3OS1 A;  3EFR A;  4J7F A;  1RL2 A;  3DB4 A;  1YBY A;  3LGL A;  2BIV A;  3CCS A;  4ELY C;  3S3O A;  1FX7 A;  4IUT A;  5CR2 A;  2RK2 A;  4JJN K;  4BAC A;  4YTL A;  1VQN A;  2AHJ B;  1GXI E;  1VUB A;  3JCM Q;  1X75 C;  4A53 A;  4LD9 K;  1YCY A;  2O01 E;  2V8I A;  3JCM g;  1BKB A;  4BY6 C;  4ELZ C;  4A4E A;  1B34 B;  1JB0 E;  2NLU A;  5GAM e;  1KQS S;  1G3T A;  3A8H B;  1VQL T;  2HD0 A;  3UWN A;  3M54 A;  4ZGE B;  3OBW A;  2D9T A;  4IUU A;  4OGC A;  4B9W A;  4C8Q B;  2RJD A;  3M5A A;  5M9O A;  5GAM j;  5GAN 5;  3G7Z A;  2RB6 A;  3BW1 A;  3G4S A;  1G3W A;  2QEX A;  3CPF A;  4M7D E;  3L42 A;  1U1S A;  2JOY A;  3MEA A;  2VGM A;  4FU6 A;  3MP6 A;  3FRN A;  5FLX E;  3S3N A;  2DXT A;  2PVO B;  3L1A A;  2DEQ A;  3DKM A;  3RES A;  3PMT A;  3SB2 A;  5A2Q E;  3CPW S;  3OYF A;  3CCE T;  3A8M B;  4XTY A;  1M90 C;  3M55 A;  3OMG A;  2FL7 A;  2ZPI B;  4M7D C;  3VUZ A;  3QYG B;  4X34 A;  5IN1 A;  3X25 B;  3BDL A;  4PJO G;  4OGE A;  3JB9 F;  1M8V A;  3EAE A;  1VQ6 A;  1Q81 C;  3DLM A;  4UC4 A;  3C4S A;  2LTO A;  3CBP A;  1YJN T;  2IG0 A;  1PSF A;  3CBO A;  4PLL A;  3CEY A;  4QQG A;  3PFS A;  5GAO q;  3J81 E;  1WJR A;  4OP0 A;  1V29 B;  2GFA A;  4RG8 A;  2MMP A;  3FIF A;  2M16 A;  5CKE A;  3L2R A;  1W2B A;  3J7A F;  4BY6 B;  5GAN 2;  3MEV A;  3NFC A;  2XU8 A;  4C5H A;  1Q86 U;  5DM7 R;  1YHQ A;  3NTI A;  5GAN 6;  2LQK A;  4Y28 E;  5HKC A;  2ZPG B;  3TCJ A;  1PSE A;  2CS7 A;  3MEU A;  3M53 A;  2DTO A;  4GLK A;  4N4G A;  1YI2 T;  1VQ4 T;  1W4S A;  1UB4 A;  1S72 A;  3OMC A;  1Y96 A;  3SWN B;  1IZ6 A;  3L2Q A;  3FB9 A;  4PNO A;  2DXB A;  4J83 A;  2VXF A;  2O4X A;  4LDW A;  3I55 A;  3ASK A;  4N0A C;  5DY9 A;  4M78 D;  5J26 A;  1LOJ A;  1G3Y A;  2E10 A;  3SFM A;  4C92 B;  2LC4 A;  5GAN d;  1KHI A;  3CCM A;  5A0G A;  5GMK i;  1M90 U;  4OF1 A;  2RD1 A;  3OSV A;  3ME9 A;  1WJQ A;  4PLI A;  3OBY A;  5I21 A;  2RM4 A;  2Y4Y A;  4ZGD B;  2ZCF B;  1IRE B;  1OZ2 A;  2E41 A;  1G5V A;  2DAQ A;  3GNF B;  4QW2 A;  3G6E A;  2E12 A;  4C0D C;  4E7J A;  2V8J A;  1VQN T;  5C0M A;  3HHT B;  2K5I A;  3M9Q A;  3H8Z A;  4M7A B;  4RCC A;  3V8L A;  4D6W A;  1W2B S;  3VV0 A;  1VQ8 T;  4PJO B;  3HFO A;  2ZPH B;  1G3S A;  4B9X A;  4EDU A;  3OW2 S;  2QI2 A;  1KQS A;  3RMS A;  2EQM A;  4FSX A;  4LDU A;  4C92 D;  5GAN j;  3HSB A;  1Y07 A;  3QII A;  5LJ3 j;  5CKD A;  2MF2 A;  2PVD B;  3LX7 A;  1H64 1;  2M0O A;  3CCU A;  3RKW A;  3JCM W;  4M75 F;  2RHY A;  2RHZ A;  3NTK A;  4M7D B;  1Q7Y C;  3E1S A;  4JRK A;  1Y71 A;  1KG1 A;  2KMT A;  2MAM A;  2FVU A;  3RUX A;  1QVP A;  4F7U E;  5A0D A;  5CAI A;  3QPH A;  5KE3 A;  5A0L A;  3CXC A;  4KUD K;  1QVF S;  4M7A D;  4J5Y A;  1KD1 C;  4PJO D;  1WGS A;  5GAM f;  3CCM T;  3CC7 T;  4M7A G;  4Y91 A;  1KQ2 A;  3CCJ T;  4C8Q C;  1I5L A;  1VQ7 A;  4OB2 B;  1OI1 A;  4M78 A;  3HKS A;  4N0A A;  2PUK B;  4PJO F;  4QVD A;  1EIF A;  5GMK e;  5FU7 B;  3OYI A;  2XKO C;  1BI2 A;  1M9S A;  3QZ9 B;  3CCS T;  1JJ2 S;  3L2U A;  4ZGJ B;  5EG2 A;  1NPR A;  2XDD A;  4M75 C;  2RJC A;  2VYT A;  3SWN A;  2MWO A;  4MZP A;  1VQM A;  4N4H A;  1VQ5 T;  2QQA A;  1VQ4 A;  2K5F A;  4DA4 A;  4O5V A;  3OW2 A;  3HPW A;  3FJP A;  4WF2 A;  4F7U G;  4FT2 A;  2DK3 A;  3CCL T;  3JSC A;  4A4G A;  4C5I A;  4XTV A;  2CZ1 B;  3HRU A;  3MET A;  3KXT A;  1D3B A;  2E70 A;  2JNG A;  2PUO B;  3HL8 A;  1WNL A;  3OY9 A;  3G71 T;  4ZTJ A;  1O75 A;  2DZC A;  1Y96 B;  3PIP A;  3CD6 A;  4C5G A;  2L3R A;  4N4I A;  4FM4 B;  1YJ9 T;  2DTH A;  1OZ3 A;  2VGN A;  1UEB A;  3KUF A;  4HCZ A;  5FRM A;  1VQK T;  1Q82 C;  2RK1 A;  5CQY A;  4OVA A;  3OS0 A;  2I2L A;  3P8H A;  3P8D A;  2BUD A;  2MI6 A;  2YRV A;  2R58 A;  3G6E T;  5D6Y A;  3LGF A;  4M75 B;  3QUI A;  2FHD A;  4M77 E;  3JB9 D;  2XG8 D;  3ER0 A;  3VYG A;  2E5Q A;  4BUG A;  1M5Q 1;  2DO3 A;  4BE1 A;  1YIJ A;  4HCB A;  2KVQ G;  5D6W A;  3F70 A;  3RKX A;  2EQJ A;  3PNW C;  4BE2 A;  4IUP A;  4M77 C;  4M78 F;  5FU6 B;  2H3J A;  2EYQ A;  3OA6 A;  2DD4 A;  4PJO A;  4XTW A;  3QSU A;  5LJ5 d;  4EMK A;  1SSF A;  3CC4 T;  3HRS A;  2EKO A;  4TVR A;  5C6S A;  5CVI A;  3FC3 A;  3M59 A;  3CCQ T;  2OTL T;  4HCC A;  4L59 A;  4JLG A;  2CZ6 B;  2Y4X A;  1VQP T;  3VU3 C;  2K2V A;  2HAX A;  3CD6 T;  4M77 G;  4Q5W A;  5GMK h;  1KHC A;  1WQ7 A;  3FDR A;  4L6V 5;  3OYH A;  3CCJ A;  3QG1 A;  4LDY A;  1VQL A;  3LH0 A;  4BI3 A;  1YHQ T;  2K5L A;  4M7D F;  2EQU A;  3M57 A;  4LD6 A;  3O8V A;  3MHX A;  3URG A;  3TRE A;  2EJG A;  2IVW A;  5AYF A;  3OYG A;  4KUI A;  3WVD B;  3E19 A;  3OYB A;  3JCM c;  4HT9 A;  4M7D A;  3JB9 I;  2R5A A;  2X4X A;  2LVM A;  4C0D B;  4HT8 A;  3CBM A;  2MWP A;  3BY7 A;  2X4Y A;  4IUV A;  4A4K A;  3A8G B;  4ZTF A;  2XI9 A;  4M77 D;  1BI3 A;  1XQH A;  4C92 F;  4DOW A;  1Q86 C;  2DZ9 A;  2KDS A;  1Y7X A;  5I2M A;  2F5K A;  4FL6 A;  2RHU A;  2JN0 A;  5IAY A;  3GPL A;  3CCL A;  4C8Q E;  4J7I A;  2CZ7 B;  5J39 A;  1I8F A;  5CKF A;  3T9N A;  4Z02 A;  2D0Q B;  2R5M A;  3X28 B;  2CYZ B;  5CCA A;  1VQP A;  4XU2 A;  2QDY B;  2WSC E;  4NS5 A;  1VQK A;  4CRI A;  5LJ5 j;  1Q82 U;  1JJ2 A;  1UGS B;  3A8O B;  5GMK l;  2RH2 A;  2GFU A;  3S6W A;  1K9M C;  5LJ5 e;  3QJY A;  3AHU A;  2KQW A;  3INZ A;  4QVZ A;  5LL6 S;  4E47 A;  3UT1 A;  2K3Y A;  3QYH B;  4VUB A;  4C0F A;  4C92 E;  2OAU A;  4KUL A;  4QQ6 A;  3V8K A;  3JCM e;  2QA4 A;  1BIB A;  4IKF A;  3CMA A;  1YIJ T;  5GAN e;  2LCC A;  2LT4 A;  3M56 A;  3JB9 G;  4C8Q G;  5CK9 A;  1I81 A;  2KSS A;  5GAN h;  4IUQ A;  4QQD A;  4PJO C;  3JCM d;  3CCE A;  2L5Q A;  3FLG A;  3X24 B;  4R55 A;  3CCR T;  4JRP A;  5CO7 A;  1M1K U;  1YI2 A;  2HBP A;  1WJS A;  3JB9 J;  4HKE A;  3BFM A;  2OTJ A;  3HRT A;  2WSF E;  3OYJ A;  4PJO E;  1AHJ B;  2HQX A;  3C12 A;  5GAO l;  2ZPF B;  3HP9 A;  1YJ9 A;  4M75 G;  3V7R A;  1FXX A;  1RI0 A;  5LJ3 h;  1VQO T;  3QDR B;  4F7U F;  3L2V A;  3JCM J;  2XIC A;  2E6Z A;  1ZHI A;  2LNV A;  2X35 A;  1B34 A;  4C92 A;  4J6W A;  4C8Q D;  2ZGW A;  2QXF A;  2P0K A;  2X4W A;  2CZ0 B;  2DXC A;  4EMH A;  4M75 E;  5GAO n;  4JRQ A;  1Q7Y U;  3QKJ A;  3WXM B;  4A54 A;  3GLX A;  3FEO A;  4F7U A;  1K8A U;  2F5T X;  3N5B B;  2RJE A;  2P4T A;  2VXE A;  3MO8 A;  4X9C A;  3J80 E;  3DLL A;  1K9M U;  2E6N A;  3H6Z A;  3MP1 A;  4MZM A;  4OB0 B;  1YJW T;  2XID A;  2JTF A;  3QO3 A;  4QVC A;  4A4F A;  3P8B B;  3WVE B;  1WQW A;  5LJ3 g;  4RCB A;  1P92 A;  1BIA A;  4KT0 E;  3HFN A;  3CCR A;  5GAN g;  2XD0 A;  3M4G A;  1DJ7 B;  5LJ3 e;  5J3B A;  3V7C A;  3KBG A;  1NZ9 A;  1QP3 A;  2K3X A;  2KY9 A;  2ZZD A;  4NL2 A;  2RI5 A;  3OS5 A;  5GAM d;  2LRQ A;  3I55 T;  3CPW A;  1BYM A;  2RI2 A;  3OYM A;  3RER A;  3GNG A;  1JBM A;  4OMF B;  3UDC A;  2CKK A;  1N27 A;  4OB3 B;  5HK3 A;  1VQ6 T;  2PQW A;  3PTA A;  1O9S A;  2GQV A;  2V8K A;  1N8R U;  4HA8 A;  4BDY A;  1UGQ B;  1NPP A;  3I56 T;  3E9G A;  1X6O A;  2E65 A;  4M78 B;  1QW1 A;  3OYE A;  4JS5 A;  2P0Q A;  2FB7 A;  3UPU A;  4M78 C;  3OYD A;  4C8Q A;  5LJ3 f;  1VQ8 A;  4MML A;  4RG2 A;  4EMK C;  2E64 A;  4JS4 A;  1K73 C;  3CME T;  3JB9 H;  2K57 A;  4M7A C;  3GP8 A;  1K8A C;  4PKC C;  1N9S A;  2A7Y A;  2L8D A;  2QTX A;  5GAM g;  4XTZ A;  3PGG A;  2PVG B;  1KC8 U;  3X26 B;  5CKH A;  1U1T A;  2JUF A;  3R6O A;  5GAN 4;  4BI4 A;  4CI0 C;  3LW5 E;  4JRI A;  3CXC S;  1BI1 A;  3OQ5 A;  4LDV A;  3TU4 K;  1S72 T;  2EFI A;  3PMI A;  4C0Z A;  1VQO A;  1VIF A;  5D6X A;  2RHX A;  2X4J A;  3PT9 A;  4GY5 A;  4C92 C;  5KCH A;  1I4K 1;  3JCM V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...