5GAN2

The overall structure of the yeast spliceosomal u4/u6.u5 tri-snrnp at 3.7 angstrom
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
90
structure length
90
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISCTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U4 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
pubmed doi rcsb
total genus 16
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gan200
1N9SA 2DTHA 4EMHA 4M7DG 4PJOG 3HFNA 4XTWA 2DVEA 5LJ3h 4C8QE 4C8QC 4M78G 5GAMj 4XTVA 5GAMd 4EMKA 4NL3A 5GMKe 5GAMf 2DTOA 4M75G 5GAMg 3JCMd 2DKGA 3FJPA 3GIBA 3PGGA 3JCMW 4M78C 3JCMf 1WQ7A 4M78E 3JCMg 5GMKl 4M77A 2E10A 5GAOp 2VC8A 5GAOq 4M75C 4PJOA 2DEQA 4M75E 5GANj 3JCMX 5GANd 2E41A 3JCMb 2E64A 4F7UB 5GMKh 2YHTA 3JB9G 1KQ2A 4XU2A 2YLCA 5GANg 1I4K1 5GANf 4NOYA 5GAN3 1B34B 1BIBA 1WQWA 4EMGA 3HSBA 1HK9A 5CAIA 3QO3A 4M7AC 1KQ1A 4J6XA 4M7AE 3RIRA 4XTUA 4DQ2A 4XTZA 3AHUA 4XU0A 3EFRA 3SWNA 4EMKC 2DXTA 2RB6A 1X01A 4M77G 3RUXA 1Y96B 2YLBA 2QTXA 3FB9A 4WF2A 4QVDA 4M7AD 2I2LA 4OP0A 4XTXA 4M77C 2VXEA 4M77E 4M7DC 4M7DE 4HA8A 4PJOC 4PJOE 3V7RA 1M5Q1 4X9CA 4C92B 2K57A 1H641 2RA2A 4F7UF 3QHSA 2E1HA 5GAMe 3BDUA 4HT8A 4HT9A 5I21A 4F7UA 4MMKA 4J6WA 4RCBA 1MGQA 3M4GA 4M7AB 3JCMe 1B34A 3SWNC 4JRIA 4N0AA 3V7CA 3V8LA 4M78D 3SB2A 4C92D 5GAN5 4M75D 2E65A 2RD1A 5GAMh 5GANe 2DZ9A 1I5LA 2DJZA 4J6YA 5LJ5d 4C8QB 3QUIA 3EFSA 1JBMA 3JCMh 1Y96A 5LJ5g 1D3BB 4PNOA 5LJ3j 5LJ5f 5LJ3d 1LOJA 4M7DB 4F7UG 2JN0A 2VXFA 5DY9A 3BFMA 5LJ3f 3V7SA 4X9DA 4A53A 4C92F 5LJ3g 3JCMQ 5GANh 5GAOl 2DXUA 4M78B 4A54A 1JRIA 4M75B 4XU1A 4C92A 4XU3A 1M8VA 2HNIA 4F7UE 5GAN7 4NL2A 4C8QD 3RERA 2CGHA 1HXDA 5GMKj 4N0AC 3BW1A 1LNXA 5GAN8 3FIFA 3JB9H 5GAOr 4J5YA 4M7AF 4M77D 4M7DD 5GAN2 3VU3C 3RKWA 4PJOD 3JCMJ 2EJ9A 2DTIA 4XTYA 3RKYA 4RCCA 2FB7A 4XQ3A 3JCMV 5GMKm 3JB9I 4EMKB 2EJFA 3L1AA 3V8JA 1TH7A 4C8QF 4C92G 5LJ5j 3L2ZA 4QVCA 1LJOA 2EJGA 3JCMc 5GMKi 1I8FA 1WPYA 4M77F 4C8QA 4M7DF 3BY7A 4PJOF 3JB9J 4M77B 1D3BA 2ZGWA 3RKXA 5GAOn 4JUVA 4C92C 3JB9D 4M78F 4C92E 4M7DA 2FYKA 4JLIA 2RM4A 1BIAA 1U1TA 4M75F 4M7AG 4M78A 4M7AA 3HFOA 4V2SA 4PJOB 2DZCA 5LJ5e 4M75A 3INZA 3JCMP 1N9RA 1WNLA 5GAN6 3V8KA 4MMLA 5LJ3e 4JRKA 2EAYA 1YCYA 3JB9F 1I81A 5GAN4 4C8QG 3SWNB 2Y90A 5GAOm 4Y91A 3QSUA 3RESA 5LJ5h 1U1SA 2EWNA
chains in the Genus database with same CATH superfamily
2IVWA 2V8IA 4R55A 1VYVA 1KIKA 2QDYB 1UB4A 2FPFA 2DIGA 2QQAA 2DM1A 3H6ZA 1AWOA 2RJDA 4XK8E 4ZTFA 4FYYB 4CI0C 2OTJQ 1QWEA 2DAQA 3L2VA 2FHDA 2EFIA 5KE3A 1CKBA 3M57A 5CAIA 2B8AA 2K5LA 2YUOA 3URGA 1UFFA 3HPWA 2XDBA 1WXUA 3A8HB 1RADB 3G71Q 3LWIA 4PL6A 1VQLT 4HA8A 1TXQA 4LUDA 4CC2A 2K57A 3FDRA 1QLYA 2MAMA 1WZOA 5GAMe 4HT9A 1UJYA 3M5AA 3EG0A 1B34A 5GAMh 4AFZC 4JRQA 2QQ9A 4RTXA 3CC4A 4E2FB 1M4ZA 1UG1A 3MP6A 3MEWA 3J80E 2EIFA 3MPUB 1BI2A 4X9DA 2NWMA 1FMKA 4X34A 3I9QA 3QYGB 1IO6A 2LZ6B 2EPDA 3M9QA 3GLXA 4FSSA 2IIMA 2CGHA 1QW1A 5ECAA 3CMEA 3JB9H 2OI3A 3KXTA 2A3LA 2KYBA 2QXFA 3JCMJ 3CCEA 1TOVA 2FB7A 3JCMV 3THKA 2P0PA 1E7OA 3CCVA 5HY6A 4PJOF 1T0HA 1D3BA 3RKXA 2QG9B 2B86A 3HFOA 1SRLA 4DEYA 1WNLA 1N27A 1WHJA 2HBPA 3I56Q 4JRKA 1OULA 3MCAB 2DZ9A 1N9SA 2IPOB 4PJOG 1WGSA 5GAMj 3H0FA 4NL3A 1JJ2P 5GAMf 5IH2A 4O5VA 4HCKA 1DJ7B 4E7SA 2RI2A 1UGRB 5GANd 1M3CA 1YJNT 3H8ZA 2WSCE 4GLMA 1AD5A 2K5FA 3WXMB 5CCAA 1BI0A 1VQ4Q 2L89A 4HCBA 4FYVB 4AFUC 1ZUUA 2VXEA 2RHYA 3U23A 4X9CA 3H0HA 2ZPEB 1YI2T 5KCOA 1M2OA 3G4SA 4HT8A 1N8RC 1EX4A 1VQOT 2F2WA 2RI3A 1MGQA 3QZ5B 4J9EA 4IUUA 2CT3A 4MZPA 4BD3A 3TCJA 2H3JA 2QGGA 2L3RA 1QVFS 1OV3A 2JOYA 3E9GA 2DXUA 3S3MA 2CP0A 2FZGB 3CC2T 5DM7R 2VGNA 3CCRQ 2FO0A 3A8MB 3OYNA 1RLPC 2NUPA 5DLQE 3UPUA 3BW1A 2YRCA 4M77D 1RAIB 1YITT 3E1SA 5CQYA 4JS5A 3A8OB 1TU0B 3JB9I 2Y4XA 1M2VB 1M3BA 5FU6B 3TEEA 4VUBA 3MJXA 2DX1A 1D09B 3I35A 4K11A 2XU8A 5AT1B 4UC4A 3JCMP 2BUDA 3V8KA 3F70A 3CCMT 2YRDA 1RAFB 1QWFA 2Y90A 1ZSZB 2A37A 5KYXA 3EFOA 4F16A 3M0RA 2LC4A 3DKMA 3EG9B 2KR3A 3LH5A 2PQWA 3EGUA 3CCLQ 2KT1A 4TVRA 2ATCB 2QEXQ 2QEXT 1KQ2A 1MUZA 1N5ZA 3VYHB 1WQWA 4EMGA 2C0TA 2XKOC 1IREB 1KQ1A 4WTOB 2K2MA 1X2QA 1VUBA 2E12A 2J05A 2LRQA 3UDCA 2YRVA 3OS0A 3NFCA 2E5KA 4D8KA 2AKKA 1YNZA 3JRZA 4IURA 3C95A 2EYQA 5GJVB 2L3PA 3WVDB 1WX6A 3VJPA 3UT1A 4M7AB 3VS0A 2X4YA 2OTJA 4N0AA 2ESWA 2GTJA 2JUFA 3OYHA 3OSVA 4WCIA 5LJ3d 1MMGA 3CCQQ 1K8AR 4M7DB 2HKNA 1QCOA 1G3TA 4PLLA 1K4US 2LP5A 2RI5A 3R6NA 4N0AC 3FIFA 4LN2A 1HYOA 1WXTA 3KFVA 4Q5WA 1X43A 1NJIR 2J6KA 3QPHA 4GLKA 1BK2A 1VQKQ 2CP6A 3V8JA 1D1CA 1QVGA 5A2QE 4RTUA 3A5ZB 2CS7A 2KSSA 2FYKA 2W0ZA 4JLIA 2E4HA 3CPWP 3SEMA 1OQKA 4E7IA 1RAEB 5C6SA 5D7UA 1Q86C 1NJIU 1KHCA 1E6HA 2DL4A 3P8BB 2QA4T 4EPCA 2RQRA 1W2BS 1TUCA 5C0MA 1O75A 1VQNA 3NTHA 1Y07A 1QQJA 2VYTA 3JCMW 3EG3A 2J6OA 4M77A 4IUPA 1D0ZA 4FIBA 1QP2A 2JVVA 4YTLA 3AHUA 2DXCA 3I56A 1JXOA 2ZPHB 4JRPA 2M16A 1Y96B 1KSWA 1NM7A 3L42A 3RMSA 1ZX6A 2CUDA 1PG5B 4M77C 1UDLA 2J06A 4IUTA 4PJOE 1M5Q1 4OVAA 2L3QA 8AT1B 4FM4B 1RAGB 3H0IA 3CMAT 2EVRA 4FW1A 3CCJA 3QDFA 1KJWA 1NYGA 1AZEA 3M56A 3ER0A 4JRIA 2DIQA 2BZYA 4PKCC 1JJ2S 2C0OA 4FCYA 1AOJA 2V8KA 3QUIA 3GP8A 2E70A 4J9CA 1VYUA 4AMCA 2E3HA 3BFMA 4LXCA 5CR2A 4E7LA 4A54A 1QKWA 4XU1A 4C92A 1YJWQ 2PVDB 2JM8A 2EBPA 2PNIA 4PK4A 2V1RA 5KYUA 4M7AF 2CZ7B 4C0GA 3CC4T 2JNGA 3C0CA 4D8DA 2GCXA 1IRXA 1JXMA 2M0YA 1NEBA 4KH0B 1YP5A 2QASA 2X3WD 1IGUA 1VIEA 2MOXA 1D0XA 3CEYA 2EJGA 3CPFA 1M27C 1XOVA 4M7DF 2A08A 1HSQA 3OYAA 3QYHB 2V8JA 4JUVA 4C92C 1KQSP 3CMET 3O5ZA 4M7AG 1IGQA 1RABB 1KG1A 1SPKA 2DZCA 5LJ5e 3CCET 1UJ0A 2OTLA 4QQ6A 1D1AA 1Q81R 2AKLA 3JB9F 3HTRA 2EGCA 1WJRA 3A98A 1YCSB 4OMNA 5LJ5h 4M7DG 1TG0A 4C8QE 3PIOA 2FRWA 5GAMg 1FMWA 2CP7A 3OYCA 1HD3A 3PFSA 4FSXA 5GMKl 1VQ9T 1GFDA 1Q81U 1GBRA 5LL6S 2X4WA 3OQ5A 3JB9G 1G83A 2COYA 3EGDA 4E7ZA 1VQ5A 3DLMA 2MWOA 4FL6A 5KYNA 3OSSC 3OYJA 3SWNA 1H8KA 2RB6A 1UUEA 3G6EQ 3VS7A 1PSFA 2LTOA 1PC0A 1VQMQ 1FMVA 2I2LA 3NTIA 4A4EA 1VQ6A 2YUPA 1AZGB 1QVFA 1UE9A 1LCKA 4LDUA 3HP9A 5I21A 2MWPA 3QKJA 3SWNC 2ZAEA 1MMNA 2LJ3A 3G1JA 3LGFA 2EGAA 2HL3A 2MYSA 1I0CA 2K3YA 2BZXA 4JLGA 1KC8U 5KCHA 4CC3A 5LJ5f 4N4IA 2WACA 2VXFA 3G4ST 1KHIA 4KUIA 1K9MR 3OW2P 3CCSQ 4NL2A 2E6ZA 1M1KR 3CD6Q 3CD6T 5AYFA 2H8HA 3CCUA 3VYGA 1PD0A 5FU7B 3SHWA 2EKHA 3QWYA 1UTIA 1K9MU 1AWXA 3BY7A 2EGEA 3OS5A 3TSWA 3L2WA 2HSPA 1H3ZA 1U1TA 2F2VA 4KUDK 3GOXA 1M1KU 2AK5A 4JPBW 2CREA 2LQ8A 4C5HA 3E19A 5GAOm 4Y91A 4EMHA 4ANJA 3UATA 1TTHB 2DLPA 4BY6B 2QQRA 2NYSA 1WQ7A 4M78E 3OB9A 1G3SA 1ZUYA 4ZNXA 2AZVA 2E41A 3HSBA 1HK9A 1VQ7Q 3DLLA 1OU9A 2QTVA 1QVGS 1SSHA 2K5IA 3RUXA 2XG8D 1NBEB 1G3WA 5J3BA 1ACMB 2DETA 2EQKA 1NLOC 4OB1B 1V29B 2X4XA 2DK3A 2KVQG 3I55A 3BDUA 1U5SA 3JAME 2LCSA 2BTTA 4ORZA 3JCMe 3V8LA 4ZGEB 4JJNK 2VV5A 4C8QB 3JCMh 4RKUE 2C0IA 2FPDA 1VQLQ 4A53A 1PM3A 2KAFA 1FYNA 1RI0A 2YT6A 1Y57A 5L23A 4OF1A 2RHXA 3Q1JA 1T0JA 3H9NA 1LPLA 4OB0B 4BACA 1BI3A 5GMKm 1SRMA 2LX7A 4FYXB 1LJOA 3JCMc 5HKCA 1W2BA 1I8FA 4DBFA 2LMJA 3L2UA 3ZFJA 4V2SA 2LJ1A 1N9RA 4Z88A 4HVUA 2RQVA 4N4HA 3AT1B 3PIPA 1BCMA 2K79A 2KY9A 3SDZA 3M54A 3OYBA 2K3BA 2LX9A 2X9HA 4JZ4A 1ZBJA 3JCMf 4EDUA 4BE1A 3JSCA 4NS5A 5HK0A 4LNPA 2HBWA 3QBYA 1WHGA 4IIOA 2DE0X 4M7AE 1VQNT 4XU0A 4HXJA 3MEUA 2AZSA 3ZBDA 2VB6A 1BKBA 1KQSS 1SG5A 1JJ2A 1PWTA 1X27A 1AT1B 1N6AA 4M7DE 1G2BA 4C5IA 5FWBA 1BI1A 1X69A 1D0YA 1V76A 1YJNQ 2FPEA 3RNJA 1NE8A 4RCBA 1S72A 3DB4A 2XK0A 2XD0A 3KUFA 2DVJA 2YWWA 1ZHIA 2D8JA 5FW9A 2JTMA 2D9TA 1PD1A 4OMMA 2YDLA 2HEQA 2KMTA 3V7SA 3CCJT 1VOMA 2BE7D 4M78B 1JRIA 1WJSA 2MIOA 1VQPA 1YI2Q 1YIJA 2J6FA 2A36A 1OU8A 5I22A 1P92A 2CUBA 1KC8C 1VQOQ 1WHLA 5GAN8 4F17A 5GAOr 2PUOB 2EJ9A 4L6V5 4OMFB 4EMKB 4C8QF 4KGXB 1YFNA 4E6RA 1RLQC 1GCQA 3JB9J 3X28B 1OZ2A 3A8LB 2SEMA 1YHQQ 1YHQT 3OYGA 3CBOA 4MZMA 3CC2Q 4F14A 4C0ZA 3INZA 3RMQA 3TREA 2RHZA 1ZLMA 4O6JA 4C8QG 3OS2A 4BE0A 3M0TA 5FROA 1YITQ 2X51A 3RERA 1KD1R 4BI8B 4AT1B 1GCQC 3VUZA 4MDXA 5GAMd 3OYKA 4ELYC 2F5KA 2LCCA 1IB8A 1M2VA 3LX7A 3PVQA 2OTLT 3TQ7P 3X24B 4GY5A 1PKTA 5GAOq 2DEQA 3I5SA 4M75E 2R58A 5GJWB 2YLCA 2DRMA 2ED0A 1KD1U 3CCMQ 4BDYA 4BE2A 1ABQA 3HKSA 4RTWA 4DA4A 2BIVA 1K73R 2KRMA 1ZSZA 1UGVA 2L0AA 4RG8A 5FU6C 2YUQA 1Q7YR 4QQGA 2LQWA 3EG9A 2PVGB 1R0BG 3CBMA 2O4XB 2XIDA 2E1HA 1M1FA 1KK7A 5D6WA 3UF4A 1K73U 2Y4YA 1VQ8A 2JS2A 2ROTA 1ZSZC 2KYMA 5GAN5 4C92D 1UECA 3PE0A 1VQ7A 1Q7YU 2JTEA 3S6WA 5LJ5g 2JXBA 4AFSC 1LOJA 2BKDN 5DY9A 1UGQB 1WXBA 4RUGA 3L2RA 1B7TA 4J5YA 2XICA 3GPLA 4OGCA 3MEAA 3BDLA 4LD9K 1UEBA 4GBQA 2AHJB 1WPYA 2QQBA 1EIFA 2L3SA 3BE3A 3E2UA 1M9SA 1WJQA 1YJ9T 4M78F 3G71A 4M7DA 3EHRA 1FXXA 1M8MA 3CCUT 4MMLA 1YCYA 3QJYA 1ZSGA 2MF2A 3REAB 1U3OA 3PNWC 1OEBA 4A63B 2GNCA 1K8AU 4XTWA 2DVEA 3TSZA 2K4YA 4M78G 3VS4A 2A28A 2EQUA 5IXFA 1MV3A 1W6XA 5GMKe 1CKAA 4QKUA 4PJNA 3CPWA 2JS0A 3VRYA 5GMKh 4E47A 1I4K1 4PFOA 1PHTA 1FX7A 2HZYA 4J6XA 3RIRA 2O88A 2E6NA 2F69A 2QA4Q 3OMGA 1X01A 4HKEA 2QTXA 4B9XA 1M90R 2DERA 2GGRA 3V7RA 3CC7T 2EQJA 4PLIA 1YWOA 2PUKB 5EG2A 1H641 3LYIA 5CK9A 3HHTB 2ZPGB 1IHWA 1WIEA 5HCKA 2V26A 1W70A 4PJMA 4HCCA 3SB2A 1M90U 2EKOA 1I5LA 2DJZA 3E9FA 3ME9A 3HRUA 1JBMA 1Y96A 1NPPA 5KYYA 4XAXB 1NYFA 2O9SA 4Z89A 5GAOl 3I55T 1K9AA 4M75B 2HNIA 4F7UE 3CMAQ 1BU1A 1MMAA 5GMKj 1XNIA 4KBMB 3VS2A 4PJOD 1G3YA 2CH4W 4RCCA 3EHQA 1RACB 4OMOA 1KFZA 3OBWA 5IXBA 2HKQB 2ZPFB 5IHNA 1VQ4A 2E3IA 2HQHA 4R0KA 2HSEB 3OBYA 4BUGA 4L59A 2KRSA 3CC4Q 3EG1A 2GTOA 3VV0A 1NEGA 3M0QA 3RESA 2WSFE 4JDSA 4OMQA 1U06A 4IKFA 2R5AA 3M58A 2QAZA 2RQWA 2DTOA 3FJPA 1KQSA 4JJBA 2MI6A 2RH2A 3JCMg 1ZQ1A 3CMEQ 1IXDA 1ZA1B 4LUEA 5CVIA 2DD4A 2E64A 1Q82R 5GAN3 3CCEQ 4NOYA 4C5GA 4DOVA 3MEVA 1V1CA 4DQ2A 4XTZA 3CCRA 3CCVT 2DFUA 3OMCA 2XHCA 3HL8A 3GBQA 4BB7A 5A0GA 1Q82U 2DXBA 1VQ9Q 1QP3A 3VKIA 4KT0E 3O8VA 2VUBA 3HRSA 2DBKA 1TWBA 4KULA 3V7CA 2KBTA 2L2PA 2F1LA 1SHGA 2XDDA 2A0FB 2XDPA 1RI9A 3OY9A 1M1GA 1TUDA 2RO0A 1S72T 3QJ6A 2FRYA 2EYWA 1NG2A 3MHXA 1ZUKA 3CCLA 2DL3A 8ATCB 3IQLA 2QEXA 4A4FA 5GAN2 3DB3A 2KNBB 4X1VA 1AVZC 2E5QA 2FEIA 2EJFA 5LJ5j 1YIJT 1VQPT 2KDSA 4A4KA 1N8RR 4M77F 3EGXA 3M0SA 3G4SQ 1VIFA 4KGZB 3C12A 3OW2A 2HCKA 4M75F 2LNVA 2LNHB 2COWA 2PU9B 1VA7A 1AEYA 1PCXA 2VGMA 3QZ9B 2X35A 4M75G 3I5RA 2RJFA 2VC8A 4PJOA 3CCQA 4LD6A 4F7UB 2RHUA 1K8AC 2OX7A 1NLPC 3TU4K 3NHNA 4AG1C 2KE9A 1X75C 3LLRA 1UHFA 3OYYA 3J81E 4JJDA 2DPPB 5FU7C 2YUNA 1QCFA 3FRNA 1VQKA 3CXCP 5KYWB 3N5BB 1PRLC 2NUZA 1NJIC 4PJOC 2DJQA 1WHMA 1AWWA 2DMOA 1QKXA 1SSFA 1YWPA 2GFAA 3VUBA 3UA7A 3UWNA 4M78D 1H92A 4C0DC 5GANe 1U8RA 4DBHA 4J6YA 1JQQA 5CKHA 5LJ5d 2JMCA 2LJ0A 1JU5C 2DNUA 2NUTB 3RBBB 3CPWS 4E7JA 4PJJA 2NLUA 2CZ0B 5I11A 5GANh 3EAEA 2X3XD 3CBPA 4E7KA 4B6MA 6AT1B 2YXYA 1VQ8T 2D0QB 2DYIA 4KGVB 4FT4A 1XTDA 2CZ6B 4AFQC 2Z0WA 4Y28E 2FL7A 3X20B 2DBMA 5FLXE 1RUWA 1SEMA 4XTYA 4OB2B 4XQ3A 1X6BA 4J9DA 4AG2C 2JJ9A 2MK5A 3JV3A 4RTTA 4PJLA 1NZ9A 3EG2A 4C8QA 3M55A 2LT1A 3P8DA 2PVOB 2RM4A 1X2KA 1RAHB 2V1QA 3R6OA 1PNJA 2OTJT 2CP3A 3OYDA 2CP2A 2KGTA 5IHKA 3CMAA 2EAYA 2I0NA 2HD0A 1PKSA 2L5QA 4XTXA 3QIIA 4J8OA 2ENMA 2RJCA 4EIKA 4C8QC 3G71T 5CO7A 2P84A 3MKDA 5D6XA 1GCPA 3GIBA 2DL7A 2ZZDA 3PGGA 1OI1A 4J7IA 4P5NA 5GANj 4II1A 2YHTA 5GANf 1B34B 2KRNA 2JMAA 2QQSA 4RG2A 1GFCA 2LDMA 1YJWA 2FVUA 2BZ8A 1D1BA 1Z9QA 1OOTA 1C1AA 2DXTA 2K6DA 3OYMA 2KT8A 1O9SA 1SKUB 1X6GA 2O9VA 1EZZB 1W2BP 1Q86R 2DA9A 5L8RE 2HAXA 1G5VA 5CKEA 4CRIA 1M3AA 4F7UF 5IAYA 2D1XA 1TUGB 3PT9A 3OA6A 1G8XA 5DLOA 4A4GA 4FW2A 1VQNQ 1Q86U 1Q82C 3LH0A 2E65A 2D0NA 2FZCB 1TS9A 2MPXC 1W1FA 1Q81C 2CT4A 4QVZA 1D3BB 2YSQA 3OYIA 2QGFB 4F7UG 4M7AD 1PRMC 2RK1A 4OGEA 2DO3A 1OPKA 2GBQA 1WHKA 1TSFA 1VYTA 1VQ9A 1I07A 3I56T 1R77A 1HXDA 1I1JA 2ECZA 3H41A 5KH6A 1R8OB 4M7DD 3VU3C 3RKWA 2DTIA 4F04B 2KEAA 4DOWA 3WVEB 2DYBA 2H3EB 4OMLA 3L2ZA 5GMKi 4JZ3A 1QVPA 5A0DA 2ZGWA 3OS1A 3CCJQ 3JB9D 3G6EA 1VQMA 2JW4A 3MP8A 1WI7A 1S1NA 4M78A 4RTVA 2QYZA 1MHNA 3NTKA 5LJ3e 2CZ1B 2COZA 3EH1A 2JM9A 2P4RA 5CKBA 1A0NB 2F5TX 5D6YA 2JTFA 3QXEB 5LJ3h 1Y7XA 1VQ4T 4EMKA 1SHFA 1K0SA 1MMDA 3JCMd 7AT1B 4M78C 1WFWA 2M51A 5GAOp 2O2OA 5CIUA 3JCMX 4XU2A 2XI9A 1UGPB 3S3OA 3CCSA 3QO3A 1K9MC 1JEGA 3FEOA 2OAUA 3M0PA 4EMKC 2DEUA 2P0KA 2YLBA 3CD6A 2O31A 3FB9A 4QVDA 2C06A 1M1KC 3OW2S 4KRTA 4M77E 1WLPB 3FC3A 2OTLQ 4ZN3A 3T9NA 2XMFA 5FWCA 2EYYA 1Y71A 2DF6A 4HVVA 2NUPB 3VS5A 5CQXA 3CCRT 2A7YA 1OPLA 1ZBXA 3X25B 4J9BA 3M53A 4M75D 5HK3A 2G3RA 2GQIA 2RK2A 4PNOA 3PMTA 3SFMA 5LJ3j 3HRTA 1AHJB 5LJ3f 4OB3B 4DBRA 5FRMA 1VQ5Q 2AIRB 1VQ5T 5GAN7 2O4XA 4LDXA 1OYXA 1W4SA 2ABLA 3RR6A 2CYZB 2LT4A 5KYXB 2CSQA 2KI7A 3LW5E 2VVKA 2K3XA 4RTYA 3CXCS 3RKYA 1VQ6Q 3EFOB 1VQ6T 3QG1A 2LQNA 3QWXX 2CH4A 1BBZA 4Z8AA 4QT7A 3CCLT 1LVKA 4C92E 1EFNA 4KH1B 1UHCA 3NGPA 3VS6A 2DD5A 5GAN4 2MMPA 2PTKA 2JZ2A 5KE2A 4M7AA 1T3SA 2OJ2A 1K1ZA 3A8GB 4XTVA 2AT1B 1MV0B 2KK4A 2ZPIB 3LGLA 3NMZC 4LE9A 3ZL7C 3PMIA 1YJ9Q 5IT9E 3RDVA 3JCMb 1VQLA 3CCUQ 1BIBA 1M30A 2QI2A 1FWZA 3VS3A 4M7AC 5J39A 2PZ1A 3ASKA 2VWFA 4WF2A 1OX9A 4OP0A 2M1HA 3CCQT 3VS1A 2RHIA 4M7DC 3S3NA 3EH2A 4JJCA 4QQDA 4J9FA 2RA2A 3REBB 2GFUA 4OMPA 4MMKA 4FT2A 2O01E 2RPNA 3M0UA 5I2MA 2VKNA 3P8HA 1VQKT 3META 1H3HA 2GF7A 2JT4A 3FJ5A 4LDYA 1QMCA 3EFSA 4CC4B 1QVGP 4Y92A 3GNFB 2JN0A 5GAOn 5IN1A 4J83A 3CC7Q 4ME7A 3L2QA 3MO8A 1M8VA 3ULRB 3UA6A 3NPFA 1GRIA 3M4YA 3LWHA 3SD4A 5CKDA 1IHVA 1JB0E 4D6WA 2P4TA 3X26B 3VRZA 3OYLA 1OX8A 1TH7A 4RMOA 2RJEA 4M77B 3TVTA 3I55Q 3ZEHA 2LQKA 4M75A 3FLGA 2DL5A 2KROA 3C94A 3CQTA 1YJNA 4PFPA 2WSEE 3QSUA 4RTZA 2RQUA 4IUVA 1JO8A 3HFNA 2EYZA 5KYYB 4ESRA 2ZPBB 1Q95G 2IG0A 4FU6A 1E6GA 2M0OA 2KXCA 4J7FA 2LVMA 3A1PA 2E10A 3J7AF 4M75C 5GANg 1YI2A 2GQVA 4FYWB 4XTUA 2K2VA 4IUQA 2K9GA 4L5GA 3EFRA 1VQOA 2G6FX 4ZGDB 1NPRA 2EYXA 1C0MA 1J3TA 1I5OB 2M02A 5J26A 4MZTA 2RMOA 2CP5A 1WDXA 2DILA 4CC7A 2K7AA 2D6FA 2KQWA 4C92B 1BCOA 2L8DA 2ROLA 2HMAA 3D7SB 2CDTA 1BB9A 2EQIA 1YJWT 4MDWA 5KYUB 1YHQA 3QDRB 2F2XA 2P0QA 3CC2A 3CCVQ 1MNEA 1K0XA 3GF5A 2CKKA 5A0LA 1YITA 1F1BB 4BI3A 2QDLA 3M59A 4C5EA 2D8HA 1KD1C 1AWJA 2M9UA 3OYFA 2DL8A 5IHIA 1T3LA 4C8QD 4J9HA 2R57A 5EC7A 1GXIE 1XQHA 3GNGA 1WYXA 3CCMA 3L1AA 2DRKA 4QW2A 2LCLA 4N4GA 1OZ3A 3KBGA 1K73C 2RN8A 2KXDA 1UGSB 2QK0A 1S72Q 4R56A 4M4ZA 3EGDB 1R0CB 1IZ6A 5GAN6 1RAAB 1Q7YC 2J7IA 4ZN1A 3SWNB 5M9OA 2DTHA 5CKFA 2W10A 4J9IA 3G6ET 1VQMT 2FZKB 4HVWA 2ZCFB 1YIJQ 4ZGJB 1VQPQ 1XJWB 1KC8R 4LDVA 1ABOA 2DKGA 1BYMA 1X6OA 2SRCA 4ZTJA 1QVFP 1C6VX 2BE9B 1WHHA 3G7ZA 1B07A 4A4HA 2X4JA 4JS4A 1PSEA 1CSKA 4E7HA 5FRNA 4Z02A 1WA7A 1N8RU 4M77G 3EGXB 9ATCB 1QCNA 3MP1A 2CSIA 2FG0A 2HQXA 2EW3A 1RL2A 4ELZC 2RQTA 3CCST 3QHSA 1YJ9A 4F7UA 4J6WA 1GL5A 3M4GA 1YN8A 5I2SA 1GBQA 4IIMA 2HQEA 2RD1A 1YBYA 4BI4A 4DEXA 3CXCA 1MNDA 1Z9ZA 1SF9A 3JCMQ 4PJOB 5LJ3g 2RNAA 4PFZA 4C92F 5KYWA 1K76A 2VASA 2ED1A 4XU3A 2OAWA 4HCZA 4J9GA 1LNXA 2R5MA 4ATOA 2RF0A 4C0DB 4LDWA 2MCNA 4DBQA 4C92G 3PVLA 4QVCA 3OYEA 2QA4A 4BY6C 2EQMA 2NUTA 1ARKA 1B3QA 4C0FA 1BIAA 4B9WA 1HJDA 1ZA2B 1VQ8Q 1M90C 3CC7A 1Y0MA 1VQ7T 2HDAA 3C4SA 3PTAA 1I81A 4BDZA 2HL5C 1U1SA 2EWNA
chains in the Genus database with same CATH topology
4M7DG 2IVWA 3QXEB 2V8IA 4R55A 1K8AU 4XTWA 2DVEA 5LJ3h 4C8QE 1Y7XA 2K4YA 4M78G 3PIOA 2QDYB 1UB4A 4EMKA 3G4ST 2DIGA 2EQUA 5GMKe 2QQAA 1VQ4T 5GAMg 3OYCA 3H6ZA 3JCMd 3PFSA 4FSXA 2RJDA 4M78C 5GMKl 1VQ9T 5GAOp 1Q81U 5LL6S 2X4WA 4XK8E 5CIUA 3CPWA 3JCMX 4ZTFA 3OQ5A 3JB9G 5GMKh 4CI0C 4E47A 4XU2A 1I4K1 2DAQA 3L2VA 2XI9A 2FHDA 2EFIA 1VQ5A 5KE3A 1UGPB 1FX7A 3DLMA 2MWOA 3M57A 2B8AA 3QO3A 5CAIA 4FL6A 3CCSA 4J6XA 2K5LA 3RIRA 1K9MC 3FEOA 3URGA 3OSSC 3HPWA 2XDBA 2E6NA 2F69A 2OAUA 3OYJA 3OMGA 3SWNA 4EMKC 2RB6A 1X01A 2P0KA 4HKEA 2YLBA 3CD6A 3A8HB 2QTXA 3LWIA 1PSFA 2LTOA 3FB9A 4B9XA 4QVDA 2C06A 2I2LA 3NTIA 4PL6A 4A4EA 1M1KC 1VQ6A 3OW2S 4M77E 1VQLT 4HA8A 3V7RA 3FC3A 4ZN3A 3CC7T 2EQJA 4PLIA 5EG2A 2PUKB 1QVFA 3T9NA 2K57A 1H641 3FDRA 1Y71A 3LYIA 5CK9A 2MAMA 3HHTB 4LDUA 2ZPGB 5CQXA 5GAMe 3CCRT 3HP9A 4HT9A 5I21A 2MWPA 3M5AA 2A7YA 3QKJA 1ZBXA 1B34A 3X25B 4HCCA 3SWNC 3M53A 3SB2A 3G71T 2EWNA 1M90U 3LGFA 4M75D 2K3YA 5HK3A 2EKOA 5GAMh 4JRQA 2QQ9A 4JLGA 1KC8U 1I5LA 3CC4A 2DJZA 3E9FA 5KCHA 3ME9A 3HRUA 1JBMA 1M4ZA 1Y96A 2G3RA 1NPPA 2RK2A 2EIFA 3MEWA 3MP6A 3PMTA 4N4IA 4PNOA 3HRTA 2WACA 3SFMA 5LJ3j 2VXFA 1BI2A 1AHJB 4XAXB 5LJ3f 1KHIA 4KUIA 4X9DA 5GAOl 4X34A 3I55T 4OB3B 3QYGB 5FRMA 3M9QA 4M75B 1VQ5T 3GLXA 2HNIA 4F7UE 5GAN7 4NL2A 2O4XA 4LDXA 2CGHA 1QW1A 5GMKj 1XNIA 1OYXA 1W4SA 3CMEA 4KBMB 2CYZB 2E6ZA 2LT4A 3KXTA 2A3LA 3JB9H 2QXFA 3CD6T 4PJOD 5AYFA 3JCMJ 3LW5E 1G3YA 3CCEA 2K3XA 3CCUA 3VYGA 3CXCS 3RKYA 4RCCA 2FB7A 3JCMV 1VQ6T 3QG1A 2P0PA 5FU7B 3CCVA 1K9MU 3OBWA 5HY6A 3BY7A 4PJOF 3OS5A 1D3BA 3RKXA 3L2WA 3CCLT 4C92E 2ZPFB 1H3ZA 1VQ4A 1U1TA 4KUDK 3GOXA 3HFOA 1M1KU 1WNLA 3OBYA 1N27A 2HBPA 4BUGA 4JRKA 2DD5A 4L59A 2LQ8A 4C5HA 5GAN4 3E19A 5GAOm 2MMPA 2JZ2A 3MCAB 4Y91A 3RESA 3VV0A 2WSFE 4JDSA 2DZ9A 5KE2A 4M7AA 1N9SA 4EMHA 4PJOG 4IKFA 2R5AA 1WGSA 3M58A 5GAMj 3A8GB 4XTVA 4NL3A 5GAMf 2DTOA 4O5VA 2KK4A 3FJPA 1KQSA 2ZPIB 4BY6B 3LGLA 1DJ7B 2QQRA 2MI6A 3PMIA 2RH2A 1WQ7A 4M78E 3JCMg 2RI2A 3OB9A 1G3SA 1ZQ1A 5IT9E 1UGRB 5GANd 5CVIA 2DD4A 2E41A 2E64A 3JCMb 1YJNT 3H8ZA 1VQLA 5GAN3 4NOYA 4C5GA 4DOVA 1BIBA 2WSCE 3MEVA 3HSBA 1HK9A 2QI2A 1FWZA 4M7AC 3DLLA 2K5FA 4XTZA 4DQ2A 3CCRA 3CCVT 1QVGS 3WXMB 5J39A 5CCAA 2K5IA 3ASKA 3RUXA 3OMCA 2XHCA 2XG8D 4WF2A 1BI0A 2L89A 3HL8A 4OP0A 2M1HA 4HCBA 3CCQT 1G3WA 4BB7A 2RHIA 2VXEA 5A0GA 4M7DC 2RHYA 5J3BA 1Q82U 3S3NA 4X9CA 2DXBA 2ZPEB 1YI2T 1QP3A 2EQKA 4QQDA 2RA2A 4OB1B 1V29B 2X4XA 4KT0E 2GFUA 3O8VA 3VKIA 2DK3A 2KVQG 2VUBA 3I55A 3G4SA 3BDUA 3HRSA 4HT8A 1N8RC 1VQOT 4MMKA 3JAME 2RI3A 4FT2A 2O01E 1MGQA 3JCMe 3QZ5B 4KULA 4IUUA 3V7CA 3V8LA 5I2MA 4ZGEB 3P8HA 4JJNK 1VQKT 3META 2GF7A 4MZPA 4LDYA 4BD3A 2VV5A 3TCJA 4C8QB 3EFSA 2H3JA 3JCMh 4RKUE 2L3RA 3GNFB 2XDDA 1QVFS 2XDPA 2JOYA 3E9GA 2JN0A 5GAOn 5IN1A 4A53A 4J83A 2DXUA 2KAFA 3S3MA 3OY9A 1M1GA 4ME7A 3L2QA 2RO0A 1S72T 1RI0A 3MO8A 3QJ6A 1M8VA 3CC2T 5DM7R 3MHXA 2VGNA 3M4YA 3CCLA 4OF1A 3A8MB 3OYNA 2RHXA 3Q1JA 5DLQE 3LWHA 3BW1A 3UPUA 2QEXA 4A4FA 4M77D 3SD4A 4OB0B 5CKDA 3DB3A 5GAN2 1YITT 1JB0E 4BACA 3E1SA 1BI3A 2P4TA 4D6WA 5CQYA 3X26B 4JS5A 3OYLA 5GMKm 3A8OB 2E5QA 3JB9I 2EJFA 2Y4XA 1TH7A 4RMOA 5LJ5j 1YIJT 1VQPT 1LJOA 3J80E 3JCMc 5HKCA 2KDSA 1I8FA 4A4KA 1W2BA 4M77F 5FU6B 3TEEA 2RJEA 4M77B 1VIFA 3ZEHA 3L2UA 4VUBA 3C12A 3OW2A 3ZFJA 4M75F 2LQKA 4V2SA 2XU8A 4UC4A 4M75A 3JCMP 2LNVA 1N9RA 2BUDA 3FLGA 2PU9B 3V8KA 3F70A 3CCMT 4N4HA 3C94A 1YJNA 2Y90A 2WSEE 2VGMA 3PIPA 3QSUA 4IUVA 3QZ9B 2KY9A 3SDZA 3HFNA 4M7DA 2X35A 3M54A 2LC4A 2ZPBB 3DKMA 3OYBA 4M75G 2IG0A 2LX9A 4FU6A 2PQWA 2M0OA 3JCMf 4J7FA 4EDUA 2LVMA 4TVRA 4BE1A 2E10A 3JSCA 2RJFA 2VC8A 4M75C 3J7AF 4PJOA 3CCQA 4LD6A 4NS5A 2QEXT 1VQMT 4F7UB 1KQ2A 5HK0A 5GANg 2RHUA 3VYHB 1K8AC 3TU4K 1WQWA 3QBYA 2GQVA 4EMGA 1YI2A 2XKOC 1IREB 1X75C 1KQ1A 3LLRA 4M7AE 1VQNT 4XTUA 3OYYA 3J81E 2K2VA 4IUQA 4L5GA 4XU0A 2DPPB 3EFRA 1VQOA 5FU7C 3MEUA 4ZGDB 1NPRA 1VUBA 2E12A 3ZBDA 1BKBA 1KQSS 1JJ2A 3FRNA 2LRQA 1VQKA 5J26A 4MZTA 3N5BB 3UDCA 2D6FA 1N6AA 5D6YA 1NJIC 2YRVA 4C5IA 3OS0A 3NFCA 2KQWA 4C92B 4M7DE 4PJOC 2L8DA 1BI1A 3JRZA 4IURA 1YJWT 3C95A 4MDXA 2EYQA 4MDWA 1SSFA 5LJ5f 2GFAA 1YHQA 3WVDB 3QDRB 1NE8A 4RCBA 3VJPA 3VUBA 3UT1A 2P0QA 4M7AB 3DB4A 1S72A 2X4YA 2XK0A 3UWNA 3CC2A 2OTJA 4N0AA 2XD0A 4M78D 3KUFA 1ZHIA 4C0DC 5GANe 3GF5A 2CKKA 5A0LA 1U8RA 4J6YA 5CKHA 5LJ5d 1YITA 2JUFA 3OYHA 3OSVA 4BI3A 2JTMA 5LJ3d 2D9TA 4M7DB 3M59A 2KMTA 3V7SA 3CPWS 4E7JA 4C5EA 3CCJT 2NLUA 2CZ0B 1KD1C 5GANh 3EAEA 4M78B 1G3TA 4PLLA 1JRIA 1WJSA 1VQPA 1YIJA 3CBPA 4E7KA 2M9UA 3OYFA 1VQ8T 2D0QB 2RI5A 4FT4A 4C8QD 1P92A 1XTDA 2CZ6B 1KC8C 4N0AC 5GAN8 3FIFA 2FL7A 4Y28E 5GAOr 3X20B 2R57A 2PUOB 2EJ9A 4Q5WA 1GXIE 4L6V5 5FLXE 3QPHA 1XQHA 4GLKA 4OB2B 4OMFB 4XTYA 4XQ3A 3GNGA 4EMKB 3CCMA 3L1AA 3V8JA 4C8QF 4QW2A 2LCLA 4N4GA 5A2QE 1QVGA 3A5ZB 1OZ3A 1NZ9A 4C8QA 3KBGA 3M55A 3JB9J 2CS7A 2LT1A 3X28B 1OZ2A 3A8LB 2KSSA 1K73C 3P8DA 1YHQT 2FYKA 2PVOB 1UGSB 4JLIA 2RM4A 3R6OA 3OYGA 3S3OA 3CBOA 4MZMA 4R56A 4E7IA 2OTJT 4C0ZA 3INZA 5C6SA 1IZ6A 3OYDA 1KHCA 1Q86C 1NJIU 5GAN6 3RMQA 1Q7YC 3TREA 3CMAA 2EAYA 2RHZA 4O6JA 4ZN1A 2HD0A 4C8QG 3OS2A 3SWNB 4BE0A 5FROA 3P8BB 2QA4T 2L5QA 4EPCA 5M9OA 4XTXA 3RERA 3QIIA 4BI8B 1W2BS 2DTHA 4J8OA 5CKFA 2RJCA 4C8QC 3VUZA 5C0MA 3G6ET 5GAMd 5CO7A 1O75A 2F5KA 4ELYC 2LCCA 2ZCFB 3NTHA 4ZGJB 1Y07A 1VQNA 5D6XA 2VYTA 4LDVA 3LX7A 2DKGA 3GIBA 1BYMA 2ZZDA 1X6OA 3PGGA 3JCMW 2OTLT 3X24B 4GY5A 1OI1A 4M77A 5GAOq 4J7IA 4P5NA 4ZTJA 2DEQA 4M75E 5GANj 2R58A 3G7ZA 2YHTA 4II1A 4IUPA 2YLCA 5GANf 1B34B 4A4HA 1KD1U 2QQSA 4FIBA 1QP2A 2JVVA 2X4JA 4JS4A 4RG2A 2LDMA 1YJWA 1PSEA 4YTLA 4BDYA 4BE2A 4E7HA 2FVUA 3AHUA 2DXCA 5FRNA 3HKSA 4Z02A 3I56A 4DA4A 2BIVA 2ZPHB 4JRPA 2DXTA 3OYMA 1N8RU 4M77G 2M16A 1Y96B 1O9SA 3L42A 4RG8A 3RMSA 3MP1A 5FU6C 5L8RE 4M77C 2HAXA 4QQGA 1G5VA 4IUTA 2PVGB 5CKEA 4PJOE 1M5Q1 2HQXA 4OVAA 4FM4B 1RL2A 4ELZC 4CRIA 3CBMA 2O4XB 3CCST 4F7UF 3CMAT 2XIDA 3QHSA 3OYKA 2E1HA 1YJ9A 3CCJA 1M1FA 5D6WA 4F7UA 4J6WA 3PT9A 5IAYA 3OA6A 1K73U 2Y4YA 5DLOA 3ER0A 3M4GA 4A4GA 4JRIA 5I2SA 1VQ8A 2DIQA 5GAN5 4PKCC 4C92D 1JJ2S 1Q86U 1Q82C 3LH0A 2HQEA 1VQ7A 2E65A 2RD1A 1Q7YU 2V8KA 1YBYA 4BI4A 3QUIA 1Q81C 3S6WA 3GP8A 2E70A 4QVZA 5LJ5g 1D3BB 3CXCA 1LOJA 3OYIA 4F7UG 2BKDN 5DY9A 3JCMQ 3BFMA 5LJ3g 1UGQB 4M7AD 4PJOB 4C92F 5CR2A 4E7LA 2RK1A 4OGEA 4A54A 2DO3A 3L2RA 4XU1A 4C92A 4XU3A 2PVDB 1VQ9A 4HCZA 3I56T 1HXDA 1LNXA 5KH6A 4M7AF 2R5MA 1R8OB 2CZ7B 2XICA 2JNGA 4J5YA 4C0GA 3VU3C 3RKWA 3CC4T 4M7DD 4ATOA 3GPLA 4OGCA 2DTIA 2GCXA 3MEAA 4C0DB 4DOWA 3BDLA 4LDWA 4LD9K 1UEBA 3WVEB 1VIEA 2AHJB 4C92G 3CEYA 3L2ZA 4QVCA 3OYEA 2EJGA 3CPFA 5GMKi 1QVPA 1WPYA 1XOVA 2QQBA 2QA4A 1EIFA 4M7DF 5A0DA 1M9SA 2ZGWA 1WJQA 3OS1A 3OYAA 3QYHB 2V8JA 4JUVA 4M78F 4BY6C 4C92C 2EQMA 3G6EA 3G71A 3JB9D 1YJ9T 1VQMA 4C0FA 3MP8A 1BIAA 3CMET 4M7AG 1FXXA 4M78A 4B9WA 1KG1A 2DZCA 5LJ5e 1M90C 3CCET 3CC7A 1MHNA 3CCUT 2OTLA 3NTKA 4QQ6A 4MMLA 5LJ3e 2CZ1B 1VQ7T 3C4SA 1YCYA 3QJYA 1I81A 3PTAA 1WJRA 3JB9F 5CKBA 2MF2A 4BDZA 5KCOA 3PNWC 3M56A 2F5TX 5LJ5h 1U1SA 2JTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9S A;  2DTH A;  4EMH A;  4M7D G;  4PJO G;  3HFN A;  4XTW A;  2DVE A;  5LJ3 h;  4C8Q E;  4C8Q C;  4M78 G;  5GAM j;  4XTV A;  5GAM d;  4EMK A;  4NL3 A;  5GMK e;  5GAM f;  2DTO A;  4M75 G;  5GAM g;  3JCM d;  2DKG A;  3FJP A;  3GIB A;  3PGG A;  3JCM W;  4M78 C;  3JCM f;  1WQ7 A;  4M78 E;  3JCM g;  5GMK l;  4M77 A;  2E10 A;  5GAO p;  2VC8 A;  5GAO q;  4M75 C;  4PJO A;  2DEQ A;  4M75 E;  5GAN j;  3JCM X;  5GAN d;  2E41 A;  3JCM b;  2E64 A;  4F7U B;  5GMK h;  2YHT A;  3JB9 G;  1KQ2 A;  4XU2 A;  2YLC A;  5GAN g;  1I4K 1;  5GAN f;  4NOY A;  5GAN 3;  1B34 B;  1BIB A;  1WQW A;  4EMG A;  3HSB A;  1HK9 A;  5CAI A;  3QO3 A;  4M7A C;  1KQ1 A;  4J6X A;  4M7A E;  3RIR A;  4XTU A;  4DQ2 A;  4XTZ A;  3AHU A;  4XU0 A;  3EFR A;  3SWN A;  4EMK C;  2DXT A;  2RB6 A;  1X01 A;  4M77 G;  3RUX A;  1Y96 B;  2YLB A;  2QTX A;  3FB9 A;  4WF2 A;  4QVD A;  4M7A D;  2I2L A;  4OP0 A;  4XTX A;  4M77 C;  2VXE A;  4M77 E;  4M7D C;  4M7D E;  4HA8 A;  4PJO C;  4PJO E;  3V7R A;  1M5Q 1;  4X9C A;  4C92 B;  2K57 A;  1H64 1;  2RA2 A;  4F7U F;  3QHS A;  2E1H A;  5GAM e;  3BDU A;  4HT8 A;  4HT9 A;  5I21 A;  4F7U A;  4MMK A;  4J6W A;  4RCB A;  1MGQ A;  3M4G A;  4M7A B;  3JCM e;  1B34 A;  3SWN C;  4JRI A;  4N0A A;  3V7C A;  3V8L A;  4M78 D;  3SB2 A;  4C92 D;  5GAN 5;  4M75 D;  2E65 A;  2RD1 A;  5GAM h;  5GAN e;  2DZ9 A;  1I5L A;  2DJZ A;  4J6Y A;  5LJ5 d;  4C8Q B;  3QUI A;  3EFS A;  1JBM A;  3JCM h;  1Y96 A;  5LJ5 g;  1D3B B;  4PNO A;  5LJ3 j;  5LJ5 f;  5LJ3 d;  1LOJ A;  4M7D B;  4F7U G;  2JN0 A;  2VXF A;  5DY9 A;  3BFM A;  5LJ3 f;  3V7S A;  4X9D A;  4A53 A;  4C92 F;  5LJ3 g;  3JCM Q;  5GAN h;  5GAO l;  2DXU A;  4M78 B;  4A54 A;  1JRI A;  4M75 B;  4XU1 A;  4C92 A;  4XU3 A;  1M8V A;  2HNI A;  4F7U E;  5GAN 7;  4NL2 A;  4C8Q D;  3RER A;  2CGH A;  1HXD A;  5GMK j;  4N0A C;  3BW1 A;  1LNX A;  5GAN 8;  3FIF A;  3JB9 H;  5GAO r;  4J5Y A;  4M7A F;  4M77 D;  4M7D D;  5GAN 2;  3VU3 C;  3RKW A;  4PJO D;  3JCM J;  2EJ9 A;  2DTI A;  4XTY A;  3RKY A;  4RCC A;  2FB7 A;  4XQ3 A;  3JCM V;  5GMK m;  3JB9 I;  4EMK B;  2EJF A;  3L1A A;  3V8J A;  1TH7 A;  4C8Q F;  4C92 G;  5LJ5 j;  3L2Z A;  4QVC A;  1LJO A;  2EJG A;  3JCM c;  5GMK i;  1I8F A;  1WPY A;  4M77 F;  4C8Q A;  4M7D F;  3BY7 A;  4PJO F;  3JB9 J;  4M77 B;  1D3B A;  2ZGW A;  3RKX A;  5GAO n;  4JUV A;  4C92 C;  3JB9 D;  4M78 F;  4C92 E;  4M7D A;  2FYK A;  4JLI A;  2RM4 A;  1BIA A;  1U1T A;  4M75 F;  4M7A G;  4M78 A;  4M7A A;  3HFO A;  4V2S A;  4PJO B;  2DZC A;  5LJ5 e;  4M75 A;  3INZ A;  3JCM P;  1N9R A;  1WNL A;  5GAN 6;  3V8K A;  4MML A;  5LJ3 e;  4JRK A;  2EAY A;  1YCY A;  3JB9 F;  1I81 A;  5GAN 4;  4C8Q G;  3SWN B;  2Y90 A;  5GAO m;  4Y91 A;  3QSU A;  3RES A;  5LJ5 h;  1U1S A;  2EWN A; 
#chains in the Genus database with same CATH topology
 2IVW A;  2V8I A;  4R55 A;  1VYV A;  1KIK A;  2QDY B;  1UB4 A;  2FPF A;  2DIG A;  2QQA A;  2DM1 A;  3H6Z A;  1AWO A;  2RJD A;  4XK8 E;  4ZTF A;  4FYY B;  4CI0 C;  2OTJ Q;  1QWE A;  2DAQ A;  3L2V A;  2FHD A;  2EFI A;  5KE3 A;  1CKB A;  3M57 A;  5CAI A;  2B8A A;  2K5L A;  2YUO A;  3URG A;  1UFF A;  3HPW A;  2XDB A;  1WXU A;  3A8H B;  1RAD B;  3G71 Q;  3LWI A;  4PL6 A;  1VQL T;  4HA8 A;  1TXQ A;  4LUD A;  4CC2 A;  2K57 A;  3FDR A;  1QLY A;  2MAM A;  1WZO A;  5GAM e;  4HT9 A;  1UJY A;  3M5A A;  3EG0 A;  1B34 A;  5GAM h;  4AFZ C;  4JRQ A;  2QQ9 A;  4RTX A;  3CC4 A;  4E2F B;  1M4Z A;  1UG1 A;  3MP6 A;  3MEW A;  3J80 E;  2EIF A;  3MPU B;  1BI2 A;  4X9D A;  2NWM A;  1FMK A;  4X34 A;  3I9Q A;  3QYG B;  1IO6 A;  2LZ6 B;  2EPD A;  3M9Q A;  3GLX A;  4FSS A;  2IIM A;  2CGH A;  1QW1 A;  5ECA A;  3CME A;  3JB9 H;  2OI3 A;  3KXT A;  2A3L A;  2KYB A;  2QXF A;  3JCM J;  3CCE A;  1TOV A;  2FB7 A;  3JCM V;  3THK A;  2P0P A;  1E7O A;  3CCV A;  5HY6 A;  4PJO F;  1T0H A;  1D3B A;  3RKX A;  2QG9 B;  2B86 A;  3HFO A;  1SRL A;  4DEY A;  1WNL A;  1N27 A;  1WHJ A;  2HBP A;  3I56 Q;  4JRK A;  1OUL A;  3MCA B;  2DZ9 A;  1N9S A;  2IPO B;  4PJO G;  1WGS A;  5GAM j;  3H0F A;  4NL3 A;  1JJ2 P;  5GAM f;  5IH2 A;  4O5V A;  4HCK A;  1DJ7 B;  4E7S A;  2RI2 A;  1UGR B;  5GAN d;  1M3C A;  1YJN T;  3H8Z A;  2WSC E;  4GLM A;  1AD5 A;  2K5F A;  3WXM B;  5CCA A;  1BI0 A;  1VQ4 Q;  2L89 A;  4HCB A;  4FYV B;  4AFU C;  1ZUU A;  2VXE A;  2RHY A;  3U23 A;  4X9C A;  3H0H A;  2ZPE B;  1YI2 T;  5KCO A;  1M2O A;  3G4S A;  4HT8 A;  1N8R C;  1EX4 A;  1VQO T;  2F2W A;  2RI3 A;  1MGQ A;  3QZ5 B;  4J9E A;  4IUU A;  2CT3 A;  4MZP A;  4BD3 A;  3TCJ A;  2H3J A;  2QGG A;  2L3R A;  1QVF S;  1OV3 A;  2JOY A;  3E9G A;  2DXU A;  3S3M A;  2CP0 A;  2FZG B;  3CC2 T;  5DM7 R;  2VGN A;  3CCR Q;  2FO0 A;  3A8M B;  3OYN A;  1RLP C;  2NUP A;  5DLQ E;  3UPU A;  3BW1 A;  2YRC A;  4M77 D;  1RAI B;  1YIT T;  3E1S A;  5CQY A;  4JS5 A;  3A8O B;  1TU0 B;  3JB9 I;  2Y4X A;  1M2V B;  1M3B A;  5FU6 B;  3TEE A;  4VUB A;  3MJX A;  2DX1 A;  1D09 B;  3I35 A;  4K11 A;  2XU8 A;  5AT1 B;  4UC4 A;  3JCM P;  2BUD A;  3V8K A;  3F70 A;  3CCM T;  2YRD A;  1RAF B;  1QWF A;  2Y90 A;  1ZSZ B;  2A37 A;  5KYX A;  3EFO A;  4F16 A;  3M0R A;  2LC4 A;  3DKM A;  3EG9 B;  2KR3 A;  3LH5 A;  2PQW A;  3EGU A;  3CCL Q;  2KT1 A;  4TVR A;  2ATC B;  2QEX Q;  2QEX T;  1KQ2 A;  1MUZ A;  1N5Z A;  3VYH B;  1WQW A;  4EMG A;  2C0T A;  2XKO C;  1IRE B;  1KQ1 A;  4WTO B;  2K2M A;  1X2Q A;  1VUB A;  2E12 A;  2J05 A;  2LRQ A;  3UDC A;  2YRV A;  3OS0 A;  3NFC A;  2E5K A;  4D8K A;  2AKK A;  1YNZ A;  3JRZ A;  4IUR A;  3C95 A;  2EYQ A;  5GJV B;  2L3P A;  3WVD B;  1WX6 A;  3VJP A;  3UT1 A;  4M7A B;  3VS0 A;  2X4Y A;  2OTJ A;  4N0A A;  2ESW A;  2GTJ A;  2JUF A;  3OYH A;  3OSV A;  4WCI A;  5LJ3 d;  1MMG A;  3CCQ Q;  1K8A R;  4M7D B;  2HKN A;  1QCO A;  1G3T A;  4PLL A;  1K4U S;  2LP5 A;  2RI5 A;  3R6N A;  4N0A C;  3FIF A;  4LN2 A;  1HYO A;  1WXT A;  3KFV A;  4Q5W A;  1X43 A;  1NJI R;  2J6K A;  3QPH A;  4GLK A;  1BK2 A;  1VQK Q;  2CP6 A;  3V8J A;  1D1C A;  1QVG A;  5A2Q E;  4RTU A;  3A5Z B;  2CS7 A;  2KSS A;  2FYK A;  2W0Z A;  4JLI A;  2E4H A;  3CPW P;  3SEM A;  1OQK A;  4E7I A;  1RAE B;  5C6S A;  5D7U A;  1Q86 C;  1NJI U;  1KHC A;  1E6H A;  2DL4 A;  3P8B B;  2QA4 T;  4EPC A;  2RQR A;  1W2B S;  1TUC A;  5C0M A;  1O75 A;  1VQN A;  3NTH A;  1Y07 A;  1QQJ A;  2VYT A;  3JCM W;  3EG3 A;  2J6O A;  4M77 A;  4IUP A;  1D0Z A;  4FIB A;  1QP2 A;  2JVV A;  4YTL A;  3AHU A;  2DXC A;  3I56 A;  1JXO A;  2ZPH B;  4JRP A;  2M16 A;  1Y96 B;  1KSW A;  1NM7 A;  3L42 A;  3RMS A;  1ZX6 A;  2CUD A;  1PG5 B;  4M77 C;  1UDL A;  2J06 A;  4IUT A;  4PJO E;  1M5Q 1;  4OVA A;  2L3Q A;  8AT1 B;  4FM4 B;  1RAG B;  3H0I A;  3CMA T;  2EVR A;  4FW1 A;  3CCJ A;  3QDF A;  1KJW A;  1NYG A;  1AZE A;  3M56 A;  3ER0 A;  4JRI A;  2DIQ A;  2BZY A;  4PKC C;  1JJ2 S;  2C0O A;  4FCY A;  1AOJ A;  2V8K A;  3QUI A;  3GP8 A;  2E70 A;  4J9C A;  1VYU A;  4AMC A;  2E3H A;  3BFM A;  4LXC A;  5CR2 A;  4E7L A;  4A54 A;  1QKW A;  4XU1 A;  4C92 A;  1YJW Q;  2PVD B;  2JM8 A;  2EBP A;  2PNI A;  4PK4 A;  2V1R A;  5KYU A;  4M7A F;  2CZ7 B;  4C0G A;  3CC4 T;  2JNG A;  3C0C A;  4D8D A;  2GCX A;  1IRX A;  1JXM A;  2M0Y A;  1NEB A;  4KH0 B;  1YP5 A;  2QAS A;  2X3W D;  1IGU A;  1VIE A;  2MOX A;  1D0X A;  3CEY A;  2EJG A;  3CPF A;  1M27 C;  1XOV A;  4M7D F;  2A08 A;  1HSQ A;  3OYA A;  3QYH B;  2V8J A;  4JUV A;  4C92 C;  1KQS P;  3CME T;  3O5Z A;  4M7A G;  1IGQ A;  1RAB B;  1KG1 A;  1SPK A;  2DZC A;  5LJ5 e;  3CCE T;  1UJ0 A;  2OTL A;  4QQ6 A;  1D1A A;  1Q81 R;  2AKL A;  3JB9 F;  3HTR A;  2EGC A;  1WJR A;  3A98 A;  1YCS B;  4OMN A;  5LJ5 h;  4M7D G;  1TG0 A;  4C8Q E;  3PIO A;  2FRW A;  5GAM g;  1FMW A;  2CP7 A;  3OYC A;  1HD3 A;  3PFS A;  4FSX A;  5GMK l;  1VQ9 T;  1GFD A;  1Q81 U;  1GBR A;  5LL6 S;  2X4W A;  3OQ5 A;  3JB9 G;  1G83 A;  2COY A;  3EGD A;  4E7Z A;  1VQ5 A;  3DLM A;  2MWO A;  4FL6 A;  5KYN A;  3OSS C;  3OYJ A;  3SWN A;  1H8K A;  2RB6 A;  1UUE A;  3G6E Q;  3VS7 A;  1PSF A;  2LTO A;  1PC0 A;  1VQM Q;  1FMV A;  2I2L A;  3NTI A;  4A4E A;  1VQ6 A;  2YUP A;  1AZG B;  1QVF A;  1UE9 A;  1LCK A;  4LDU A;  3HP9 A;  5I21 A;  2MWP A;  3QKJ A;  3SWN C;  2ZAE A;  1MMN A;  2LJ3 A;  3G1J A;  3LGF A;  2EGA A;  2HL3 A;  2MYS A;  1I0C A;  2K3Y A;  2BZX A;  4JLG A;  1KC8 U;  5KCH A;  4CC3 A;  5LJ5 f;  4N4I A;  2WAC A;  2VXF A;  3G4S T;  1KHI A;  4KUI A;  1K9M R;  3OW2 P;  3CCS Q;  4NL2 A;  2E6Z A;  1M1K R;  3CD6 Q;  3CD6 T;  5AYF A;  2H8H A;  3CCU A;  3VYG A;  1PD0 A;  5FU7 B;  3SHW A;  2EKH A;  3QWY A;  1UTI A;  1K9M U;  1AWX A;  3BY7 A;  2EGE A;  3OS5 A;  3TSW A;  3L2W A;  2HSP A;  1H3Z A;  1U1T A;  2F2V A;  4KUD K;  3GOX A;  1M1K U;  2AK5 A;  4JPB W;  2CRE A;  2LQ8 A;  4C5H A;  3E19 A;  5GAO m;  4Y91 A;  4EMH A;  4ANJ A;  3UAT A;  1TTH B;  2DLP A;  4BY6 B;  2QQR A;  2NYS A;  1WQ7 A;  4M78 E;  3OB9 A;  1G3S A;  1ZUY A;  4ZNX A;  2AZV A;  2E41 A;  3HSB A;  1HK9 A;  1VQ7 Q;  3DLL A;  1OU9 A;  2QTV A;  1QVG S;  1SSH A;  2K5I A;  3RUX A;  2XG8 D;  1NBE B;  1G3W A;  5J3B A;  1ACM B;  2DET A;  2EQK A;  1NLO C;  4OB1 B;  1V29 B;  2X4X A;  2DK3 A;  2KVQ G;  3I55 A;  3BDU A;  1U5S A;  3JAM E;  2LCS A;  2BTT A;  4ORZ A;  3JCM e;  3V8L A;  4ZGE B;  4JJN K;  2VV5 A;  4C8Q B;  3JCM h;  4RKU E;  2C0I A;  2FPD A;  1VQL Q;  4A53 A;  1PM3 A;  2KAF A;  1FYN A;  1RI0 A;  2YT6 A;  1Y57 A;  5L23 A;  4OF1 A;  2RHX A;  3Q1J A;  1T0J A;  3H9N A;  1LPL A;  4OB0 B;  4BAC A;  1BI3 A;  5GMK m;  1SRM A;  2LX7 A;  4FYX B;  1LJO A;  3JCM c;  5HKC A;  1W2B A;  1I8F A;  4DBF A;  2LMJ A;  3L2U A;  3ZFJ A;  4V2S A;  2LJ1 A;  1N9R A;  4Z88 A;  4HVU A;  2RQV A;  4N4H A;  3AT1 B;  3PIP A;  1BCM A;  2K79 A;  2KY9 A;  3SDZ A;  3M54 A;  3OYB A;  2K3B A;  2LX9 A;  2X9H A;  4JZ4 A;  1ZBJ A;  3JCM f;  4EDU A;  4BE1 A;  3JSC A;  4NS5 A;  5HK0 A;  4LNP A;  2HBW A;  3QBY A;  1WHG A;  4IIO A;  2DE0 X;  4M7A E;  1VQN T;  4XU0 A;  4HXJ A;  3MEU A;  2AZS A;  3ZBD A;  2VB6 A;  1BKB A;  1KQS S;  1SG5 A;  1JJ2 A;  1PWT A;  1X27 A;  1AT1 B;  1N6A A;  4M7D E;  1G2B A;  4C5I A;  5FWB A;  1BI1 A;  1X69 A;  1D0Y A;  1V76 A;  1YJN Q;  2FPE A;  3RNJ A;  1NE8 A;  4RCB A;  1S72 A;  3DB4 A;  2XK0 A;  2XD0 A;  3KUF A;  2DVJ A;  2YWW A;  1ZHI A;  2D8J A;  5FW9 A;  2JTM A;  2D9T A;  1PD1 A;  4OMM A;  2YDL A;  2HEQ A;  2KMT A;  3V7S A;  3CCJ T;  1VOM A;  2BE7 D;  4M78 B;  1JRI A;  1WJS A;  2MIO A;  1VQP A;  1YI2 Q;  1YIJ A;  2J6F A;  2A36 A;  1OU8 A;  5I22 A;  1P92 A;  2CUB A;  1KC8 C;  1VQO Q;  1WHL A;  5GAN 8;  4F17 A;  5GAO r;  2PUO B;  2EJ9 A;  4L6V 5;  4OMF B;  4EMK B;  4C8Q F;  4KGX B;  1YFN A;  4E6R A;  1RLQ C;  1GCQ A;  3JB9 J;  3X28 B;  1OZ2 A;  3A8L B;  2SEM A;  1YHQ Q;  1YHQ T;  3OYG A;  3CBO A;  4MZM A;  3CC2 Q;  4F14 A;  4C0Z A;  3INZ A;  3RMQ A;  3TRE A;  2RHZ A;  1ZLM A;  4O6J A;  4C8Q G;  3OS2 A;  4BE0 A;  3M0T A;  5FRO A;  1YIT Q;  2X51 A;  3RER A;  1KD1 R;  4BI8 B;  4AT1 B;  1GCQ C;  3VUZ A;  4MDX A;  5GAM d;  3OYK A;  4ELY C;  2F5K A;  2LCC A;  1IB8 A;  1M2V A;  3LX7 A;  3PVQ A;  2OTL T;  3TQ7 P;  3X24 B;  4GY5 A;  1PKT A;  5GAO q;  2DEQ A;  3I5S A;  4M75 E;  2R58 A;  5GJW B;  2YLC A;  2DRM A;  2ED0 A;  1KD1 U;  3CCM Q;  4BDY A;  4BE2 A;  1ABQ A;  3HKS A;  4RTW A;  4DA4 A;  2BIV A;  1K73 R;  2KRM A;  1ZSZ A;  1UGV A;  2L0A A;  4RG8 A;  5FU6 C;  2YUQ A;  1Q7Y R;  4QQG A;  2LQW A;  3EG9 A;  2PVG B;  1R0B G;  3CBM A;  2O4X B;  2XID A;  2E1H A;  1M1F A;  1KK7 A;  5D6W A;  3UF4 A;  1K73 U;  2Y4Y A;  1VQ8 A;  2JS2 A;  2ROT A;  1ZSZ C;  2KYM A;  5GAN 5;  4C92 D;  1UEC A;  3PE0 A;  1VQ7 A;  1Q7Y U;  2JTE A;  3S6W A;  5LJ5 g;  2JXB A;  4AFS C;  1LOJ A;  2BKD N;  5DY9 A;  1UGQ B;  1WXB A;  4RUG A;  3L2R A;  1B7T A;  4J5Y A;  2XIC A;  3GPL A;  4OGC A;  3MEA A;  3BDL A;  4LD9 K;  1UEB A;  4GBQ A;  2AHJ B;  1WPY A;  2QQB A;  1EIF A;  2L3S A;  3BE3 A;  3E2U A;  1M9S A;  1WJQ A;  1YJ9 T;  4M78 F;  3G71 A;  4M7D A;  3EHR A;  1FXX A;  1M8M A;  3CCU T;  4MML A;  1YCY A;  3QJY A;  1ZSG A;  2MF2 A;  3REA B;  1U3O A;  3PNW C;  1OEB A;  4A63 B;  2GNC A;  1K8A U;  4XTW A;  2DVE A;  3TSZ A;  2K4Y A;  4M78 G;  3VS4 A;  2A28 A;  2EQU A;  5IXF A;  1MV3 A;  1W6X A;  5GMK e;  1CKA A;  4QKU A;  4PJN A;  3CPW A;  2JS0 A;  3VRY A;  5GMK h;  4E47 A;  1I4K 1;  4PFO A;  1PHT A;  1FX7 A;  2HZY A;  4J6X A;  3RIR A;  2O88 A;  2E6N A;  2F69 A;  2QA4 Q;  3OMG A;  1X01 A;  4HKE A;  2QTX A;  4B9X A;  1M90 R;  2DER A;  2GGR A;  3V7R A;  3CC7 T;  2EQJ A;  4PLI A;  1YWO A;  2PUK B;  5EG2 A;  1H64 1;  3LYI A;  5CK9 A;  3HHT B;  2ZPG B;  1IHW A;  1WIE A;  5HCK A;  2V26 A;  1W70 A;  4PJM A;  4HCC A;  3SB2 A;  1M90 U;  2EKO A;  1I5L A;  2DJZ A;  3E9F A;  3ME9 A;  3HRU A;  1JBM A;  1Y96 A;  1NPP A;  5KYY A;  4XAX B;  1NYF A;  2O9S A;  4Z89 A;  5GAO l;  3I55 T;  1K9A A;  4M75 B;  2HNI A;  4F7U E;  3CMA Q;  1BU1 A;  1MMA A;  5GMK j;  1XNI A;  4KBM B;  3VS2 A;  4PJO D;  1G3Y A;  2CH4 W;  4RCC A;  3EHQ A;  1RAC B;  4OMO A;  1KFZ A;  3OBW A;  5IXB A;  2HKQ B;  2ZPF B;  5IHN A;  1VQ4 A;  2E3I A;  2HQH A;  4R0K A;  2HSE B;  3OBY A;  4BUG A;  4L59 A;  2KRS A;  3CC4 Q;  3EG1 A;  2GTO A;  3VV0 A;  1NEG A;  3M0Q A;  3RES A;  2WSF E;  4JDS A;  4OMQ A;  1U06 A;  4IKF A;  2R5A A;  3M58 A;  2QAZ A;  2RQW A;  2DTO A;  3FJP A;  1KQS A;  4JJB A;  2MI6 A;  2RH2 A;  3JCM g;  1ZQ1 A;  3CME Q;  1IXD A;  1ZA1 B;  4LUE A;  5CVI A;  2DD4 A;  2E64 A;  1Q82 R;  5GAN 3;  3CCE Q;  4NOY A;  4C5G A;  4DOV A;  3MEV A;  1V1C A;  4DQ2 A;  4XTZ A;  3CCR A;  3CCV T;  2DFU A;  3OMC A;  2XHC A;  3HL8 A;  3GBQ A;  4BB7 A;  5A0G A;  1Q82 U;  2DXB A;  1VQ9 Q;  1QP3 A;  3VKI A;  4KT0 E;  3O8V A;  2VUB A;  3HRS A;  2DBK A;  1TWB A;  4KUL A;  3V7C A;  2KBT A;  2L2P A;  2F1L A;  1SHG A;  2XDD A;  2A0F B;  2XDP A;  1RI9 A;  3OY9 A;  1M1G A;  1TUD A;  2RO0 A;  1S72 T;  3QJ6 A;  2FRY A;  2EYW A;  1NG2 A;  3MHX A;  1ZUK A;  3CCL A;  2DL3 A;  8ATC B;  3IQL A;  2QEX A;  4A4F A;  5GAN 2;  3DB3 A;  2KNB B;  4X1V A;  1AVZ C;  2E5Q A;  2FEI A;  2EJF A;  5LJ5 j;  1YIJ T;  1VQP T;  2KDS A;  4A4K A;  1N8R R;  4M77 F;  3EGX A;  3M0S A;  3G4S Q;  1VIF A;  4KGZ B;  3C12 A;  3OW2 A;  2HCK A;  4M75 F;  2LNV A;  2LNH B;  2COW A;  2PU9 B;  1VA7 A;  1AEY A;  1PCX A;  2VGM A;  3QZ9 B;  2X35 A;  4M75 G;  3I5R A;  2RJF A;  2VC8 A;  4PJO A;  3CCQ A;  4LD6 A;  4F7U B;  2RHU A;  1K8A C;  2OX7 A;  1NLP C;  3TU4 K;  3NHN A;  4AG1 C;  2KE9 A;  1X75 C;  3LLR A;  1UHF A;  3OYY A;  3J81 E;  4JJD A;  2DPP B;  5FU7 C;  2YUN A;  1QCF A;  3FRN A;  1VQK A;  3CXC P;  5KYW B;  3N5B B;  1PRL C;  2NUZ A;  1NJI C;  4PJO C;  2DJQ A;  1WHM A;  1AWW A;  2DMO A;  1QKX A;  1SSF A;  1YWP A;  2GFA A;  3VUB A;  3UA7 A;  3UWN A;  4M78 D;  1H92 A;  4C0D C;  5GAN e;  1U8R A;  4DBH A;  4J6Y A;  1JQQ A;  5CKH A;  5LJ5 d;  2JMC A;  2LJ0 A;  1JU5 C;  2DNU A;  2NUT B;  3RBB B;  3CPW S;  4E7J A;  4PJJ A;  2NLU A;  2CZ0 B;  5I11 A;  5GAN h;  3EAE A;  2X3X D;  3CBP A;  4E7K A;  4B6M A;  6AT1 B;  2YXY A;  1VQ8 T;  2D0Q B;  2DYI A;  4KGV B;  4FT4 A;  1XTD A;  2CZ6 B;  4AFQ C;  2Z0W A;  4Y28 E;  2FL7 A;  3X20 B;  2DBM A;  5FLX E;  1RUW A;  1SEM A;  4XTY A;  4OB2 B;  4XQ3 A;  1X6B A;  4J9D A;  4AG2 C;  2JJ9 A;  2MK5 A;  3JV3 A;  4RTT A;  4PJL A;  1NZ9 A;  3EG2 A;  4C8Q A;  3M55 A;  2LT1 A;  3P8D A;  2PVO B;  2RM4 A;  1X2K A;  1RAH B;  2V1Q A;  3R6O A;  1PNJ A;  2OTJ T;  2CP3 A;  3OYD A;  2CP2 A;  2KGT A;  5IHK A;  3CMA A;  2EAY A;  2I0N A;  2HD0 A;  1PKS A;  2L5Q A;  4XTX A;  3QII A;  4J8O A;  2ENM A;  2RJC A;  4EIK A;  4C8Q C;  3G71 T;  5CO7 A;  2P84 A;  3MKD A;  5D6X A;  1GCP A;  3GIB A;  2DL7 A;  2ZZD A;  3PGG A;  1OI1 A;  4J7I A;  4P5N A;  5GAN j;  4II1 A;  2YHT A;  5GAN f;  1B34 B;  2KRN A;  2JMA A;  2QQS A;  4RG2 A;  1GFC A;  2LDM A;  1YJW A;  2FVU A;  2BZ8 A;  1D1B A;  1Z9Q A;  1OOT A;  1C1A A;  2DXT A;  2K6D A;  3OYM A;  2KT8 A;  1O9S A;  1SKU B;  1X6G A;  2O9V A;  1EZZ B;  1W2B P;  1Q86 R;  2DA9 A;  5L8R E;  2HAX A;  1G5V A;  5CKE A;  4CRI A;  1M3A A;  4F7U F;  5IAY A;  2D1X A;  1TUG B;  3PT9 A;  3OA6 A;  1G8X A;  5DLO A;  4A4G A;  4FW2 A;  1VQN Q;  1Q86 U;  1Q82 C;  3LH0 A;  2E65 A;  2D0N A;  2FZC B;  1TS9 A;  2MPX C;  1W1F A;  1Q81 C;  2CT4 A;  4QVZ A;  1D3B B;  2YSQ A;  3OYI A;  2QGF B;  4F7U G;  4M7A D;  1PRM C;  2RK1 A;  4OGE A;  2DO3 A;  1OPK A;  2GBQ A;  1WHK A;  1TSF A;  1VYT A;  1VQ9 A;  1I07 A;  3I56 T;  1R77 A;  1HXD A;  1I1J A;  2ECZ A;  3H41 A;  5KH6 A;  1R8O B;  4M7D D;  3VU3 C;  3RKW A;  2DTI A;  4F04 B;  2KEA A;  4DOW A;  3WVE B;  2DYB A;  2H3E B;  4OML A;  3L2Z A;  5GMK i;  4JZ3 A;  1QVP A;  5A0D A;  2ZGW A;  3OS1 A;  3CCJ Q;  3JB9 D;  3G6E A;  1VQM A;  2JW4 A;  3MP8 A;  1WI7 A;  1S1N A;  4M78 A;  4RTV A;  2QYZ A;  1MHN A;  3NTK A;  5LJ3 e;  2CZ1 B;  2COZ A;  3EH1 A;  2JM9 A;  2P4R A;  5CKB A;  1A0N B;  2F5T X;  5D6Y A;  2JTF A;  3QXE B;  5LJ3 h;  1Y7X A;  1VQ4 T;  4EMK A;  1SHF A;  1K0S A;  1MMD A;  3JCM d;  7AT1 B;  4M78 C;  1WFW A;  2M51 A;  5GAO p;  2O2O A;  5CIU A;  3JCM X;  4XU2 A;  2XI9 A;  1UGP B;  3S3O A;  3CCS A;  3QO3 A;  1K9M C;  1JEG A;  3FEO A;  2OAU A;  3M0P A;  4EMK C;  2DEU A;  2P0K A;  2YLB A;  3CD6 A;  2O31 A;  3FB9 A;  4QVD A;  2C06 A;  1M1K C;  3OW2 S;  4KRT A;  4M77 E;  1WLP B;  3FC3 A;  2OTL Q;  4ZN3 A;  3T9N A;  2XMF A;  5FWC A;  2EYY A;  1Y71 A;  2DF6 A;  4HVV A;  2NUP B;  3VS5 A;  5CQX A;  3CCR T;  2A7Y A;  1OPL A;  1ZBX A;  3X25 B;  4J9B A;  3M53 A;  4M75 D;  5HK3 A;  2G3R A;  2GQI A;  2RK2 A;  4PNO A;  3PMT A;  3SFM A;  5LJ3 j;  3HRT A;  1AHJ B;  5LJ3 f;  4OB3 B;  4DBR A;  5FRM A;  1VQ5 Q;  2AIR B;  1VQ5 T;  5GAN 7;  2O4X A;  4LDX A;  1OYX A;  1W4S A;  2ABL A;  3RR6 A;  2CYZ B;  2LT4 A;  5KYX B;  2CSQ A;  2KI7 A;  3LW5 E;  2VVK A;  2K3X A;  4RTY A;  3CXC S;  3RKY A;  1VQ6 Q;  3EFO B;  1VQ6 T;  3QG1 A;  2LQN A;  3QWX X;  2CH4 A;  1BBZ A;  4Z8A A;  4QT7 A;  3CCL T;  1LVK A;  4C92 E;  1EFN A;  4KH1 B;  1UHC A;  3NGP A;  3VS6 A;  2DD5 A;  5GAN 4;  2MMP A;  2PTK A;  2JZ2 A;  5KE2 A;  4M7A A;  1T3S A;  2OJ2 A;  1K1Z A;  3A8G B;  4XTV A;  2AT1 B;  1MV0 B;  2KK4 A;  2ZPI B;  3LGL A;  3NMZ C;  4LE9 A;  3ZL7 C;  3PMI A;  1YJ9 Q;  5IT9 E;  3RDV A;  3JCM b;  1VQL A;  3CCU Q;  1BIB A;  1M30 A;  2QI2 A;  1FWZ A;  3VS3 A;  4M7A C;  5J39 A;  2PZ1 A;  3ASK A;  2VWF A;  4WF2 A;  1OX9 A;  4OP0 A;  2M1H A;  3CCQ T;  3VS1 A;  2RHI A;  4M7D C;  3S3N A;  3EH2 A;  4JJC A;  4QQD A;  4J9F A;  2RA2 A;  3REB B;  2GFU A;  4OMP A;  4MMK A;  4FT2 A;  2O01 E;  2RPN A;  3M0U A;  5I2M A;  2VKN A;  3P8H A;  1VQK T;  3MET A;  1H3H A;  2GF7 A;  2JT4 A;  3FJ5 A;  4LDY A;  1QMC A;  3EFS A;  4CC4 B;  1QVG P;  4Y92 A;  3GNF B;  2JN0 A;  5GAO n;  5IN1 A;  4J83 A;  3CC7 Q;  4ME7 A;  3L2Q A;  3MO8 A;  1M8V A;  3ULR B;  3UA6 A;  3NPF A;  1GRI A;  3M4Y A;  3LWH A;  3SD4 A;  5CKD A;  1IHV A;  1JB0 E;  4D6W A;  2P4T A;  3X26 B;  3VRZ A;  3OYL A;  1OX8 A;  1TH7 A;  4RMO A;  2RJE A;  4M77 B;  3TVT A;  3I55 Q;  3ZEH A;  2LQK A;  4M75 A;  3FLG A;  2DL5 A;  2KRO A;  3C94 A;  3CQT A;  1YJN A;  4PFP A;  2WSE E;  3QSU A;  4RTZ A;  2RQU A;  4IUV A;  1JO8 A;  3HFN A;  2EYZ A;  5KYY B;  4ESR A;  2ZPB B;  1Q95 G;  2IG0 A;  4FU6 A;  1E6G A;  2M0O A;  2KXC A;  4J7F A;  2LVM A;  3A1P A;  2E10 A;  3J7A F;  4M75 C;  5GAN g;  1YI2 A;  2GQV A;  4FYW B;  4XTU A;  2K2V A;  4IUQ A;  2K9G A;  4L5G A;  3EFR A;  1VQO A;  2G6F X;  4ZGD B;  1NPR A;  2EYX A;  1C0M A;  1J3T A;  1I5O B;  2M02 A;  5J26 A;  4MZT A;  2RMO A;  2CP5 A;  1WDX A;  2DIL A;  4CC7 A;  2K7A A;  2D6F A;  2KQW A;  4C92 B;  1BCO A;  2L8D A;  2ROL A;  2HMA A;  3D7S B;  2CDT A;  1BB9 A;  2EQI A;  1YJW T;  4MDW A;  5KYU B;  1YHQ A;  3QDR B;  2F2X A;  2P0Q A;  3CC2 A;  3CCV Q;  1MNE A;  1K0X A;  3GF5 A;  2CKK A;  5A0L A;  1YIT A;  1F1B B;  4BI3 A;  2QDL A;  3M59 A;  4C5E A;  2D8H A;  1KD1 C;  1AWJ A;  2M9U A;  3OYF A;  2DL8 A;  5IHI A;  1T3L A;  4C8Q D;  4J9H A;  2R57 A;  5EC7 A;  1GXI E;  1XQH A;  3GNG A;  1WYX A;  3CCM A;  3L1A A;  2DRK A;  4QW2 A;  2LCL A;  4N4G A;  1OZ3 A;  3KBG A;  1K73 C;  2RN8 A;  2KXD A;  1UGS B;  2QK0 A;  1S72 Q;  4R56 A;  4M4Z A;  3EGD B;  1R0C B;  1IZ6 A;  5GAN 6;  1RAA B;  1Q7Y C;  2J7I A;  4ZN1 A;  3SWN B;  5M9O A;  2DTH A;  5CKF A;  2W10 A;  4J9I A;  3G6E T;  1VQM T;  2FZK B;  4HVW A;  2ZCF B;  1YIJ Q;  4ZGJ B;  1VQP Q;  1XJW B;  1KC8 R;  4LDV A;  1ABO A;  2DKG A;  1BYM A;  1X6O A;  2SRC A;  4ZTJ A;  1QVF P;  1C6V X;  2BE9 B;  1WHH A;  3G7Z A;  1B07 A;  4A4H A;  2X4J A;  4JS4 A;  1PSE A;  1CSK A;  4E7H A;  5FRN A;  4Z02 A;  1WA7 A;  1N8R U;  4M77 G;  3EGX B;  9ATC B;  1QCN A;  3MP1 A;  2CSI A;  2FG0 A;  2HQX A;  2EW3 A;  1RL2 A;  4ELZ C;  2RQT A;  3CCS T;  3QHS A;  1YJ9 A;  4F7U A;  4J6W A;  1GL5 A;  3M4G A;  1YN8 A;  5I2S A;  1GBQ A;  4IIM A;  2HQE A;  2RD1 A;  1YBY A;  4BI4 A;  4DEX A;  3CXC A;  1MND A;  1Z9Z A;  1SF9 A;  3JCM Q;  4PJO B;  5LJ3 g;  2RNA A;  4PFZ A;  4C92 F;  5KYW A;  1K76 A;  2VAS A;  2ED1 A;  4XU3 A;  2OAW A;  4HCZ A;  4J9G A;  1LNX A;  2R5M A;  4ATO A;  2RF0 A;  4C0D B;  4LDW A;  2MCN A;  4DBQ A;  4C92 G;  3PVL A;  4QVC A;  3OYE A;  2QA4 A;  4BY6 C;  2EQM A;  2NUT A;  1ARK A;  1B3Q A;  4C0F A;  1BIA A;  4B9W A;  1HJD A;  1ZA2 B;  1VQ8 Q;  1M90 C;  3CC7 A;  1Y0M A;  1VQ7 T;  2HDA A;  3C4S A;  3PTA A;  1I81 A;  4BDZ A;  2HL5 C;  1U1S A;  2EWN A; 
#chains in the Genus database with same CATH homology
 4M7D G;  2IVW A;  3QXE B;  2V8I A;  4R55 A;  1K8A U;  4XTW A;  2DVE A;  5LJ3 h;  4C8Q E;  1Y7X A;  2K4Y A;  4M78 G;  3PIO A;  2QDY B;  1UB4 A;  4EMK A;  3G4S T;  2DIG A;  2EQU A;  5GMK e;  2QQA A;  1VQ4 T;  5GAM g;  3OYC A;  3H6Z A;  3JCM d;  3PFS A;  4FSX A;  2RJD A;  4M78 C;  5GMK l;  1VQ9 T;  5GAO p;  1Q81 U;  5LL6 S;  2X4W A;  4XK8 E;  5CIU A;  3CPW A;  3JCM X;  4ZTF A;  3OQ5 A;  3JB9 G;  5GMK h;  4CI0 C;  4E47 A;  4XU2 A;  1I4K 1;  2DAQ A;  3L2V A;  2XI9 A;  2FHD A;  2EFI A;  1VQ5 A;  5KE3 A;  1UGP B;  1FX7 A;  3DLM A;  2MWO A;  3M57 A;  2B8A A;  3QO3 A;  5CAI A;  4FL6 A;  3CCS A;  4J6X A;  2K5L A;  3RIR A;  1K9M C;  3FEO A;  3URG A;  3OSS C;  3HPW A;  2XDB A;  2E6N A;  2F69 A;  2OAU A;  3OYJ A;  3OMG A;  3SWN A;  4EMK C;  2RB6 A;  1X01 A;  2P0K A;  4HKE A;  2YLB A;  3CD6 A;  3A8H B;  2QTX A;  3LWI A;  1PSF A;  2LTO A;  3FB9 A;  4B9X A;  4QVD A;  2C06 A;  2I2L A;  3NTI A;  4PL6 A;  4A4E A;  1M1K C;  1VQ6 A;  3OW2 S;  4M77 E;  1VQL T;  4HA8 A;  3V7R A;  3FC3 A;  4ZN3 A;  3CC7 T;  2EQJ A;  4PLI A;  5EG2 A;  2PUK B;  1QVF A;  3T9N A;  2K57 A;  1H64 1;  3FDR A;  1Y71 A;  3LYI A;  5CK9 A;  2MAM A;  3HHT B;  4LDU A;  2ZPG B;  5CQX A;  5GAM e;  3CCR T;  3HP9 A;  4HT9 A;  5I21 A;  2MWP A;  3M5A A;  2A7Y A;  3QKJ A;  1ZBX A;  1B34 A;  3X25 B;  4HCC A;  3SWN C;  3M53 A;  3SB2 A;  3G71 T;  2EWN A;  1M90 U;  3LGF A;  4M75 D;  2K3Y A;  5HK3 A;  2EKO A;  5GAM h;  4JRQ A;  2QQ9 A;  4JLG A;  1KC8 U;  1I5L A;  3CC4 A;  2DJZ A;  3E9F A;  5KCH A;  3ME9 A;  3HRU A;  1JBM A;  1M4Z A;  1Y96 A;  2G3R A;  1NPP A;  2RK2 A;  2EIF A;  3MEW A;  3MP6 A;  3PMT A;  4N4I A;  4PNO A;  3HRT A;  2WAC A;  3SFM A;  5LJ3 j;  2VXF A;  1BI2 A;  1AHJ B;  4XAX B;  5LJ3 f;  1KHI A;  4KUI A;  4X9D A;  5GAO l;  4X34 A;  3I55 T;  4OB3 B;  3QYG B;  5FRM A;  3M9Q A;  4M75 B;  1VQ5 T;  3GLX A;  2HNI A;  4F7U E;  5GAN 7;  4NL2 A;  2O4X A;  4LDX A;  2CGH A;  1QW1 A;  5GMK j;  1XNI A;  1OYX A;  1W4S A;  3CME A;  4KBM B;  2CYZ B;  2E6Z A;  2LT4 A;  3KXT A;  2A3L A;  3JB9 H;  2QXF A;  3CD6 T;  4PJO D;  5AYF A;  3JCM J;  3LW5 E;  1G3Y A;  3CCE A;  2K3X A;  3CCU A;  3VYG A;  3CXC S;  3RKY A;  4RCC A;  2FB7 A;  3JCM V;  1VQ6 T;  3QG1 A;  2P0P A;  5FU7 B;  3CCV A;  1K9M U;  3OBW A;  5HY6 A;  3BY7 A;  4PJO F;  3OS5 A;  1D3B A;  3RKX A;  3L2W A;  3CCL T;  4C92 E;  2ZPF B;  1H3Z A;  1VQ4 A;  1U1T A;  4KUD K;  3GOX A;  3HFO A;  1M1K U;  1WNL A;  3OBY A;  1N27 A;  2HBP A;  4BUG A;  4JRK A;  2DD5 A;  4L59 A;  2LQ8 A;  4C5H A;  5GAN 4;  3E19 A;  5GAO m;  2MMP A;  2JZ2 A;  3MCA B;  4Y91 A;  3RES A;  3VV0 A;  2WSF E;  4JDS A;  2DZ9 A;  5KE2 A;  4M7A A;  1N9S A;  4EMH A;  4PJO G;  4IKF A;  2R5A A;  1WGS A;  3M58 A;  5GAM j;  3A8G B;  4XTV A;  4NL3 A;  5GAM f;  2DTO A;  4O5V A;  2KK4 A;  3FJP A;  1KQS A;  2ZPI B;  4BY6 B;  3LGL A;  1DJ7 B;  2QQR A;  2MI6 A;  3PMI A;  2RH2 A;  1WQ7 A;  4M78 E;  3JCM g;  2RI2 A;  3OB9 A;  1G3S A;  1ZQ1 A;  5IT9 E;  1UGR B;  5GAN d;  5CVI A;  2DD4 A;  2E41 A;  2E64 A;  3JCM b;  1YJN T;  3H8Z A;  1VQL A;  5GAN 3;  4NOY A;  4C5G A;  4DOV A;  1BIB A;  2WSC E;  3MEV A;  3HSB A;  1HK9 A;  2QI2 A;  1FWZ A;  4M7A C;  3DLL A;  2K5F A;  4XTZ A;  4DQ2 A;  3CCR A;  3CCV T;  1QVG S;  3WXM B;  5J39 A;  5CCA A;  2K5I A;  3ASK A;  3RUX A;  3OMC A;  2XHC A;  2XG8 D;  4WF2 A;  1BI0 A;  2L89 A;  3HL8 A;  4OP0 A;  2M1H A;  4HCB A;  3CCQ T;  1G3W A;  4BB7 A;  2RHI A;  2VXE A;  5A0G A;  4M7D C;  2RHY A;  5J3B A;  1Q82 U;  3S3N A;  4X9C A;  2DXB A;  2ZPE B;  1YI2 T;  1QP3 A;  2EQK A;  4QQD A;  2RA2 A;  4OB1 B;  1V29 B;  2X4X A;  4KT0 E;  2GFU A;  3O8V A;  3VKI A;  2DK3 A;  2KVQ G;  2VUB A;  3I55 A;  3G4S A;  3BDU A;  3HRS A;  4HT8 A;  1N8R C;  1VQO T;  4MMK A;  3JAM E;  2RI3 A;  4FT2 A;  2O01 E;  1MGQ A;  3JCM e;  3QZ5 B;  4KUL A;  4IUU A;  3V7C A;  3V8L A;  5I2M A;  4ZGE B;  3P8H A;  4JJN K;  1VQK T;  3MET A;  2GF7 A;  4MZP A;  4LDY A;  4BD3 A;  2VV5 A;  3TCJ A;  4C8Q B;  3EFS A;  2H3J A;  3JCM h;  4RKU E;  2L3R A;  3GNF B;  2XDD A;  1QVF S;  2XDP A;  2JOY A;  3E9G A;  2JN0 A;  5GAO n;  5IN1 A;  4A53 A;  4J83 A;  2DXU A;  2KAF A;  3S3M A;  3OY9 A;  1M1G A;  4ME7 A;  3L2Q A;  2RO0 A;  1S72 T;  1RI0 A;  3MO8 A;  3QJ6 A;  1M8V A;  3CC2 T;  5DM7 R;  3MHX A;  2VGN A;  3M4Y A;  3CCL A;  4OF1 A;  3A8M B;  3OYN A;  2RHX A;  3Q1J A;  5DLQ E;  3LWH A;  3BW1 A;  3UPU A;  2QEX A;  4A4F A;  4M77 D;  3SD4 A;  4OB0 B;  5CKD A;  3DB3 A;  5GAN 2;  1YIT T;  1JB0 E;  4BAC A;  3E1S A;  1BI3 A;  2P4T A;  4D6W A;  5CQY A;  3X26 B;  4JS5 A;  3OYL A;  5GMK m;  3A8O B;  2E5Q A;  3JB9 I;  2EJF A;  2Y4X A;  1TH7 A;  4RMO A;  5LJ5 j;  1YIJ T;  1VQP T;  1LJO A;  3J80 E;  3JCM c;  5HKC A;  2KDS A;  1I8F A;  4A4K A;  1W2B A;  4M77 F;  5FU6 B;  3TEE A;  2RJE A;  4M77 B;  1VIF A;  3ZEH A;  3L2U A;  4VUB A;  3C12 A;  3OW2 A;  3ZFJ A;  4M75 F;  2LQK A;  4V2S A;  2XU8 A;  4UC4 A;  4M75 A;  3JCM P;  2LNV A;  1N9R A;  2BUD A;  3FLG A;  2PU9 B;  3V8K A;  3F70 A;  3CCM T;  4N4H A;  3C94 A;  1YJN A;  2Y90 A;  2WSE E;  2VGM A;  3PIP A;  3QSU A;  4IUV A;  3QZ9 B;  2KY9 A;  3SDZ A;  3HFN A;  4M7D A;  2X35 A;  3M54 A;  2LC4 A;  2ZPB B;  3DKM A;  3OYB A;  4M75 G;  2IG0 A;  2LX9 A;  4FU6 A;  2PQW A;  2M0O A;  3JCM f;  4J7F A;  4EDU A;  2LVM A;  4TVR A;  4BE1 A;  2E10 A;  3JSC A;  2RJF A;  2VC8 A;  4M75 C;  3J7A F;  4PJO A;  3CCQ A;  4LD6 A;  4NS5 A;  2QEX T;  1VQM T;  4F7U B;  1KQ2 A;  5HK0 A;  5GAN g;  2RHU A;  3VYH B;  1K8A C;  3TU4 K;  1WQW A;  3QBY A;  2GQV A;  4EMG A;  1YI2 A;  2XKO C;  1IRE B;  1X75 C;  1KQ1 A;  3LLR A;  4M7A E;  1VQN T;  4XTU A;  3OYY A;  3J81 E;  2K2V A;  4IUQ A;  4L5G A;  4XU0 A;  2DPP B;  3EFR A;  1VQO A;  5FU7 C;  3MEU A;  4ZGD B;  1NPR A;  1VUB A;  2E12 A;  3ZBD A;  1BKB A;  1KQS S;  1JJ2 A;  3FRN A;  2LRQ A;  1VQK A;  5J26 A;  4MZT A;  3N5B B;  3UDC A;  2D6F A;  1N6A A;  5D6Y A;  1NJI C;  2YRV A;  4C5I A;  3OS0 A;  3NFC A;  2KQW A;  4C92 B;  4M7D E;  4PJO C;  2L8D A;  1BI1 A;  3JRZ A;  4IUR A;  1YJW T;  3C95 A;  4MDX A;  2EYQ A;  4MDW A;  1SSF A;  5LJ5 f;  2GFA A;  1YHQ A;  3WVD B;  3QDR B;  1NE8 A;  4RCB A;  3VJP A;  3VUB A;  3UT1 A;  2P0Q A;  4M7A B;  3DB4 A;  1S72 A;  2X4Y A;  2XK0 A;  3UWN A;  3CC2 A;  2OTJ A;  4N0A A;  2XD0 A;  4M78 D;  3KUF A;  1ZHI A;  4C0D C;  5GAN e;  3GF5 A;  2CKK A;  5A0L A;  1U8R A;  4J6Y A;  5CKH A;  5LJ5 d;  1YIT A;  2JUF A;  3OYH A;  3OSV A;  4BI3 A;  2JTM A;  5LJ3 d;  2D9T A;  4M7D B;  3M59 A;  2KMT A;  3V7S A;  3CPW S;  4E7J A;  4C5E A;  3CCJ T;  2NLU A;  2CZ0 B;  1KD1 C;  5GAN h;  3EAE A;  4M78 B;  1G3T A;  4PLL A;  1JRI A;  1WJS A;  1VQP A;  1YIJ A;  3CBP A;  4E7K A;  2M9U A;  3OYF A;  1VQ8 T;  2D0Q B;  2RI5 A;  4FT4 A;  4C8Q D;  1P92 A;  1XTD A;  2CZ6 B;  1KC8 C;  4N0A C;  5GAN 8;  3FIF A;  2FL7 A;  4Y28 E;  5GAO r;  3X20 B;  2R57 A;  2PUO B;  2EJ9 A;  4Q5W A;  1GXI E;  4L6V 5;  5FLX E;  3QPH A;  1XQH A;  4GLK A;  4OB2 B;  4OMF B;  4XTY A;  4XQ3 A;  3GNG A;  4EMK B;  3CCM A;  3L1A A;  3V8J A;  4C8Q F;  4QW2 A;  2LCL A;  4N4G A;  5A2Q E;  1QVG A;  3A5Z B;  1OZ3 A;  1NZ9 A;  4C8Q A;  3KBG A;  3M55 A;  3JB9 J;  2CS7 A;  2LT1 A;  3X28 B;  1OZ2 A;  3A8L B;  2KSS A;  1K73 C;  3P8D A;  1YHQ T;  2FYK A;  2PVO B;  1UGS B;  4JLI A;  2RM4 A;  3R6O A;  3OYG A;  3S3O A;  3CBO A;  4MZM A;  4R56 A;  4E7I A;  2OTJ T;  4C0Z A;  3INZ A;  5C6S A;  1IZ6 A;  3OYD A;  1KHC A;  1Q86 C;  1NJI U;  5GAN 6;  3RMQ A;  1Q7Y C;  3TRE A;  3CMA A;  2EAY A;  2RHZ A;  4O6J A;  4ZN1 A;  2HD0 A;  4C8Q G;  3OS2 A;  3SWN B;  4BE0 A;  5FRO A;  3P8B B;  2QA4 T;  2L5Q A;  4EPC A;  5M9O A;  4XTX A;  3RER A;  3QII A;  4BI8 B;  1W2B S;  2DTH A;  4J8O A;  5CKF A;  2RJC A;  4C8Q C;  3VUZ A;  5C0M A;  3G6E T;  5GAM d;  5CO7 A;  1O75 A;  2F5K A;  4ELY C;  2LCC A;  2ZCF B;  3NTH A;  4ZGJ B;  1Y07 A;  1VQN A;  5D6X A;  2VYT A;  4LDV A;  3LX7 A;  2DKG A;  3GIB A;  1BYM A;  2ZZD A;  1X6O A;  3PGG A;  3JCM W;  2OTL T;  3X24 B;  4GY5 A;  1OI1 A;  4M77 A;  5GAO q;  4J7I A;  4P5N A;  4ZTJ A;  2DEQ A;  4M75 E;  5GAN j;  2R58 A;  3G7Z A;  2YHT A;  4II1 A;  4IUP A;  2YLC A;  5GAN f;  1B34 B;  4A4H A;  1KD1 U;  2QQS A;  4FIB A;  1QP2 A;  2JVV A;  2X4J A;  4JS4 A;  4RG2 A;  2LDM A;  1YJW A;  1PSE A;  4YTL A;  4BDY A;  4BE2 A;  4E7H A;  2FVU A;  3AHU A;  2DXC A;  5FRN A;  3HKS A;  4Z02 A;  3I56 A;  4DA4 A;  2BIV A;  2ZPH B;  4JRP A;  2DXT A;  3OYM A;  1N8R U;  4M77 G;  2M16 A;  1Y96 B;  1O9S A;  3L42 A;  4RG8 A;  3RMS A;  3MP1 A;  5FU6 C;  5L8R E;  4M77 C;  2HAX A;  4QQG A;  1G5V A;  4IUT A;  2PVG B;  5CKE A;  4PJO E;  1M5Q 1;  2HQX A;  4OVA A;  4FM4 B;  1RL2 A;  4ELZ C;  4CRI A;  3CBM A;  2O4X B;  3CCS T;  4F7U F;  3CMA T;  2XID A;  3QHS A;  3OYK A;  2E1H A;  1YJ9 A;  3CCJ A;  1M1F A;  5D6W A;  4F7U A;  4J6W A;  3PT9 A;  5IAY A;  3OA6 A;  1K73 U;  2Y4Y A;  5DLO A;  3ER0 A;  3M4G A;  4A4G A;  4JRI A;  5I2S A;  1VQ8 A;  2DIQ A;  5GAN 5;  4PKC C;  4C92 D;  1JJ2 S;  1Q86 U;  1Q82 C;  3LH0 A;  2HQE A;  1VQ7 A;  2E65 A;  2RD1 A;  1Q7Y U;  2V8K A;  1YBY A;  4BI4 A;  3QUI A;  1Q81 C;  3S6W A;  3GP8 A;  2E70 A;  4QVZ A;  5LJ5 g;  1D3B B;  3CXC A;  1LOJ A;  3OYI A;  4F7U G;  2BKD N;  5DY9 A;  3JCM Q;  3BFM A;  5LJ3 g;  1UGQ B;  4M7A D;  4PJO B;  4C92 F;  5CR2 A;  4E7L A;  2RK1 A;  4OGE A;  4A54 A;  2DO3 A;  3L2R A;  4XU1 A;  4C92 A;  4XU3 A;  2PVD B;  1VQ9 A;  4HCZ A;  3I56 T;  1HXD A;  1LNX A;  5KH6 A;  4M7A F;  2R5M A;  1R8O B;  2CZ7 B;  2XIC A;  2JNG A;  4J5Y A;  4C0G A;  3VU3 C;  3RKW A;  3CC4 T;  4M7D D;  4ATO A;  3GPL A;  4OGC A;  2DTI A;  2GCX A;  3MEA A;  4C0D B;  4DOW A;  3BDL A;  4LDW A;  4LD9 K;  1UEB A;  3WVE B;  1VIE A;  2AHJ B;  4C92 G;  3CEY A;  3L2Z A;  4QVC A;  3OYE A;  2EJG A;  3CPF A;  5GMK i;  1QVP A;  1WPY A;  1XOV A;  2QQB A;  2QA4 A;  1EIF A;  4M7D F;  5A0D A;  1M9S A;  2ZGW A;  1WJQ A;  3OS1 A;  3OYA A;  3QYH B;  2V8J A;  4JUV A;  4M78 F;  4BY6 C;  4C92 C;  2EQM A;  3G6E A;  3G71 A;  3JB9 D;  1YJ9 T;  1VQM A;  4C0F A;  3MP8 A;  1BIA A;  3CME T;  4M7A G;  1FXX A;  4M78 A;  4B9W A;  1KG1 A;  2DZC A;  5LJ5 e;  1M90 C;  3CCE T;  3CC7 A;  1MHN A;  3CCU T;  2OTL A;  3NTK A;  4QQ6 A;  4MML A;  5LJ3 e;  2CZ1 B;  1VQ7 T;  3C4S A;  1YCY A;  3QJY A;  1I81 A;  3PTA A;  1WJR A;  3JB9 F;  5CKB A;  2MF2 A;  4BDZ A;  5KCO A;  3PNW C;  3M56 A;  2F5T X;  5LJ5 h;  1U1S A;  2JTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...