1VQKQ

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqkQ00
3CPWP 3CMAQ 1VQNQ 1YHQQ 1KQSP 3CCRQ 1KC8R 1VQKQ 1YJNQ 3CC4Q 3CD6Q 1S72Q 3CCJQ 1YI2Q 2OTLQ 1VQLQ 1Q81R 1K8AR 1VQ6Q 3CXCP 3CCQQ 1VQ7Q 1YJWQ 1Q86R 1VQPQ 3G6EQ 1YJ9Q 1W2BP 1YITQ 2OTJQ 3I55Q 1K73R 1VQOQ 1JJ2P 1VQ5Q 3CMEQ 2QEXQ 3CCLQ 3CCMQ 3CCUQ 1N8RR 1VQ4Q 3G71Q 3CC7Q 1VQMQ 1K9MR 1M90R 3CC2Q 3CCEQ 3OW2P 1NJIR 1KD1R 1M1KR 3CCSQ 2QA4Q 1YIJQ 1VQ8Q 3G4SQ 1QVGP 1Q82R 1QVFP 3I56Q 1VQ9Q 3CCVQ 1Q7YR
chains in the Genus database with same CATH superfamily
2P0PA 2ED0A 2KROA 2X51A 4KGZB 3VJPA 4RUGA 3EAEA 3TSZA 2CYZB 2CP2A 2LDMA 1UB4A 4LN2A 3A8MB 1OI1A 3KXTA 1PRMC 5KYYB 1UJYA 1K1ZA 4C8QA 5DLOA 2MOXA 1ZBJA 3M54A 5HCKA 3CPFA 1NLOC 3CXCP 2O4XB 1QMCA 1M8MA 3OYHA 3FJPA 1H3HA 3EFOB 4KGXB 5FROA 3HFOA 5A2QE 4E6RA 2K7AA 3QPHA 4C92G 2HL5C 1BCOA 1JO8A 3BY7A 1D0YA 2E10A 3M9QA 2DX1A 4DQ2A 2LCSA 1YWOA 3CCQQ 3L2UA 3DB3A 1R8OB 1VQ9A 1GXIE 5IN1A 2F2VA 3CPWA 2EW3A 3UA6A 2FL7A 2GBQA 1FXXA 2FEIA 3R6OA 4FW1A 4LUDA 2FYKA 4J6WA 2PUOB 4ZGJB 4F04B 3OA6A 2V8KA 2DIQA 3P8BB 3UA7A 3CCJT 3JAME 4C92C 4X9CA 4JUVA 2OX7A 1HK9A 1BU1A 3CCET 5GAMd 3TEEA 3HFNA 4A4HA 1M90R 5IHKA 5CKEA 1SRMA 2WACA 2J7IA 2LQKA 1UGVA 1Y7XA 5GAOn 4M7DA 1QVFP 1MV3A 2YUQA 2OI3A 2BZYA 4QVDA 3QHSA 4C8QF 3QO3A 1YITQ 2BUDA 1YN8A 2MYSA 2GQIA 2E70A 4E47A 3RR6A 3CCUA 2YXYA 1GBQA 3NPFA 4JJCA 4M75A 3CCJQ 2L3SA 1EFNA 5LJ3d 2L2PA 4JJDA 1NBEB 1WHKA 3INZA 1ZUYA 2RD1A 4JS4A 2DFUA 1UGSB 1H8KA 1VQMQ 3CCEQ 4AG2C 5GAN4 1VQ7A 1OOTA 4KUIA 4X34A 2COZA 3V8LA 2M0YA 2VXEA 3BE3A 2RN8A 4C0FA 3FRNA 4C5HA 3JB9I 3JCMJ 1ARKA 2QA4A 1AEYA 2JS0A 2JNGA 1KC8U 1B34B 2QDLA 3S3NA 2FPFA 3M0UA 4E2FB 5I2SA 1D1CA 5J26A 1RAFB 1Y57A 5FRNA 4KULA 2L3RA 1YCSB 3CCVT 1QVGP 4EMKC 1Y96A 3JV3A 1VQKT 2HQHA 3CC4T 1S72T 1N9RA 3CD6Q 5J3BA 3LGFA 4A53A 3CCSA 3I56A 4M7DF 4XTZA 2CH4W 2JM8A 1HSQA 4BI4A 1AOJA 1TU0B 2JVVA 3M56A 1Q7YC 2LCLA 1AWXA 5CKDA 4DBQA 2O2OA 1UECA 2RHIA 3MO8A 2QTXA 2FHDA 2VUBA 3HRTA 1NJIU 1M1KU 1ZX6A 4J9CA 3HL8A 4F7UF 1KQ1A 1UEBA 1YCYA 4RCBA 4AT1B 1VQ6Q 4CC7A 2YWWA 2RI2A 2QG9B 2AT1B 3EH2A 2YUNA 4OMFB 1MV0B 2DEUA 5L8RE 1WXTA 2H3EB 4BE1A 3OS1A 1Z9ZA 5CVIA 1VQNT 4WTOB 2A28A 3M5AA 7AT1B 1QW1A 2YDLA 2VWFA 2P0QA 4E7ZA 3JCMV 2XD0A 3S3OA 3OYNA 1N27A 4WCIA 4M75E 1GCPA 4Z8AA 3QDRB 1M3CA 1VQOA 2C0OA 2J06A 2M16A 5D6YA 4JRPA 1MMNA 2DTOA 3A8HB 1D1AA 3TSWA 1D09B 1YJNQ 3VRZA 1M30A 2OTLQ 2E3HA 3M0TA 5GMKl 4OB1B 3CMET 4FU6A 1G3SA 5DY9A 1VQ4T 2FPEA 2DEQA 3EGXA 2KRMA 2DVJA 1EX4A 3WXMB 1S1NA 1X01A 3I55A 4RTYA 3CCLT 5GANj 4J9FA 4PJOA 2HBPA 2YT6A 1WI7A 3FIFA 1AT1B 3VKIA 2YUOA 3REAB 2RJCA 4N0AA 3PMIA 2H8HA 3GLXA 2ZPFB 1WGSA 2X4WA 2HCKA 1K76A 4HT9A 2E6NA 3RBBB 2VB6A 1T0HA 5C6SA 1NZ9A 4PJJA 1UGRB 4BY6C 5D6WA 2EQIA 2HL3A 4LDXA 3P8HA 2A08A 1Q7YR 5LL6S 4OB0B 3CC2A 1MMGA 2DTHA 1N8RC 4HCCA 2J6FA 2HSPA 2DXBA 1RACB 2ROTA 1I8FA 1PD0A 5FWCA 3G71Q 2RHYA 1TWBA 3OYFA 2JTMA 2IIMA 2AZVA 5KYUA 1GFCA 3U23A 1QVFS 4AFUC 5AT1B 1CKBA 2K79A 1ZLMA 4BE0A 2LCCA 2VYTA 3NMZC 1UUEA 4HKEA 1QP3A 4BY6B 5L23A 3WVEB 3QSUA 2EQMA 4QQDA 2QEXQ 1U3OA 4M75B 3M59A 2WSFE 5GAMg 2KEAA 3VUZA 3JCMc 1T3SA 1OX8A 2RJFA 4FYXB 2JZ2A 3OYKA 2YRCA 1WXUA 1NE8A 5A0GA 2C0IA 1WFWA 2L0AA 4IIMA 5HK0A 2CZ7B 1WHGA 4PJOF 4Y28E 1R77A 3LLRA 3RIRA 2PZ1A 3OBWA 1GFDA 2BE7D 2MMPA 3QIIA 4PK4A 1K8AC 1GRIA 4FYWB 1M90U 2CZ0B 1LNXA 1RUWA 3BDUA 5KYXB 5LJ3g 4DOVA 1Y96B 4ZTFA 1VQPQ 2D8HA 3GNGA 4C0ZA 3CCMT 3CCJA 4B9XA 2I0NA 1T0JA 2K6DA 3EG2A 1QCNA 2LTOA 5IXFA 5IT9E 1Q81C 3FEOA 1VOMA 3CCEA 2RHUA 3V7RA 1PKSA 2OAUA 4A4GA 1IGUA 4ZTJA 1WX6A 1VUBA 5M9OA 1W2BS 2LVMA 1N8RR 3RNJA 3UT1A 2QQ9A 2DXTA 3EG3A 5LJ5f 3BFMA 3CBPA 4V2SA 2EGCA 1I1JA 5FRMA 4NL2A 1YJ9T 3H6ZA 1YJWQ 4QQ6A 2NUPA 2PQWA 4C0DC 3MCAB 4C92A 5GAOr 4EPCA 2HMAA 2R5MA 2VGNA 2SEMA 1X6BA 5HKCA 4RTUA 3MEWA 1AWJA 5LJ5j 1TTHB 2CKKA 4XTXA 1X2QA 1QVFA 1TOVA 4M78G 4C5EA 3M4GA 5GMKj 4M77G 5DM7R 1RI0A 2K57A 1AWWA 3OSVA 3IQLA 3JCMh 1X43A 3GPLA 2KBTA 3EGXB 1MHNA 2ABLA 1D0ZA 4C0DB 1X2KA 4JZ3A 2YRDA 2CSIA 1NG2A 1K8AR 1W6XA 3FLGA 1BIBA 3TQ7P 3CCVA 1LCKA 4M78C 4M7AG 4L59A 1M2VA 1I5LA 4C5IA 1VQKA 2IPOB 4M77C 1S72A 3CC4A 2X4YA 1C1AA 2FG0A 3OW2P 2A0FB 1I5OB 2JUFA 3OYMA 2HBWA 3JB9D 1U1SA 1SSHA 3QG1A 4FYYB 3VUBA 2NUTA 3GNFB 1IXDA 1Q81R 3NTIA 1K0SA 4LD6A 4ESRA 1G83A 2PVOB 3THKA 4M7AC 3LX7A 3C4SA 4A63B 4J9EA 2F5TX 1WA7A 2SRCA 2M0OA 2F69A 4J9IA 2ATCB 2RB6A 5GANh 1AHJB 1UHCA 2YLCA 2RQUA 3JCMb 1E6HA 4C92F 2JN0A 4P5NA 1WIEA 3OMCA 1ABOA 4OF1A 1XQHA 3RESA 3RERA 2CUBA 3CCQT 2AKKA 4EMKA 5KYUB 1RLPC 1M1GA 3H8ZA 1PCXA 1VQ5Q 1VQNA 2LT4A 3ZBDA 5CAIA 4ANJA 2AIRB 4GY5A 2KYMA 1W2BA 1QKXA 4C92E 4R55A 2C0TA 1K73C 1K4US 2KXDA 3EHRA 4HT8A 2ESWA 2R57A 1U5SA 2G6FX 1V76A 2YSQA 2XKOC 1KQ2A 2DA9A 2CS7A 2LJ1A 4BD3A 3M0QA 5GAN7 5HY6A 5IAYA 1M2OA 1LOJA 2DYIA 2HD0A 1OPKA 3S6WA 3CMEA 1VQ4A 2AHJB 3L2WA 2H3JA 4PL6A 1YI2Q 1Q7YU 3G6ET 2QI2A 2D9TA 2EIFA 2ECZA 3LW5E 1YITT 1KSWA 1SPKA 3CCLA 2CP7A 1ZUKA 2E65A 2JMCA 2MF2A 4MZPA 5FU7C 1VYUA 1R0CB 2LRQA 4RG8A 3E9FA 3VS3A 4ELZC 1WHLA 2CREA 5HK3A 3OYIA 4OMMA 3PVLA 4MZMA 2V1QA 3RMQA 2KT1A 3RKYA 2Y4YA 5LJ5g 1VQMT 5KE3A 1SSFA 1YFNA 2CP6A 1BI0A 4JJNK 2HDAA 3OS0A 1PNJA 3OYJA 4E7KA 2E4HA 1CKAA 3LH0A 2PVGB 2QQBA 4N4IA 3FJ5A 3CCRQ 1I4K1 3A8LB 4KBMB 1KQSS 1X27A 2M51A 3G6EQ 2BZ8A 2E6ZA 3JCMX 4LNPA 2YRVA 1KFZA 3M0PA 4ZGDB 2BZXA 2NUPB 1RAGB 1VQ8T 2I2LA 3MPUB 4C92B 1HXDA 3NTHA 4HCZA 3GBQA 3CD6T 2E3IA 1D3BA 3QYHB 3VYGA 2EGAA 2JT4A 4QQGA 1MMDA 2EGEA 4IUVA 4RTZA 1K73R 4HVVA 1KHCA 1X6OA 1B7TA 2DD5A 3HRSA 3QKJA 2K5IA 1WQWA 1MNEA 1YIJQ 4C0GA 1KIKA 1RLQC 4LXCA 4AFQC 5GAMf 4RKUE 5GAN8 4CC2A 1G8XA 4BDYA 4E7HA 1VQ6T 3QDFA 3JCMd 3A1PA 1ZSZC 2DKGA 3M55A 2JM9A 4RG2A 4C8QD 3NGPA 3HPWA 4GLMA 1JBMA 2O31A 5CR2A 3HRUA 1F1BB 4A4KA 4IUQA 2RPNA 3VRYA 2EKOA 5KYXA 1N8RU 4ELYC 1M2VB 1SHGA 1VQ8Q 3CCMA 3URGA 3G7ZA 4BDZA 2KNBB 2MK5A 2K3YA 1M3AA 1WJRA 2QQAA 4QT7A 3V8KA 2DZCA 1WQ7A 1K9MC 3FC3A 2NUTB 5GAMj 5KYNA 4C8QG 4CC3A 2LX9A 2DRKA 3SWNC 2RM4A 5LJ3f 1QVPA 1O75A 3E1SA 1OU8A 2KXCA 2DBMA 1Q86C 4JZ4A 2L3QA 1WHMA 2PTKA 6AT1B 1YJNT 5GANd 1M4ZA 2OTLT 4FYVB 2KK4A 2O9SA 3I5SA 1KK7A 3DLLA 1Q82C 3V7CA 2R58A 1JJ2S 2J05A 2DK3A 1SHFA 4EMKB 5GJVB 2QGFB 1N9SA 2XMFA 1WJSA 4M75F 5CKFA 1IB8A 4D6WA 4LUEA 1YJ9A 2DZ9A 2K5FA 4II1A 3JSCA 5LJ3j 2EJFA 4PJLA 3OYYA 1O9SA 3VS0A 2XK0A 3QWYA 1YBYA 4XTYA 2LNHB 3VS2A 2KRSA 2CDTA 2NYSA 4M7DD 3CMAA 1K8AU 5EG2A 3JCMe 1KQSA 1Z9QA 1UJ0A 5FWBA 1E6GA 3AHUA 1TUDA 4RTTA 2J6KA 1VYTA 3KFVA 2C06A 2YUPA 3LWHA 3CPWP 5IH2A 3O8VA 1V1CA 5FW9A 3PGGA 2OTJT 4ZNXA 3CXCS 3WVDB 1Q81U 4M7DG 5DLQE 3G71T 2QASA 3EH1A 2EPDA 2V8JA 2OJ2A 2K4YA 4M75D 5GAN6 3TREA 2KDSA 2JOYA 2DO3A 1D0XA 4F7UG 1RAHB 4RTWA 2P4TA 2RJEA 1BYMA 2QEXT 2M9UA 5GANe 1BCMA 5A0LA 2ZPHB 4XK8E 1K9MR 3J81E 4ATOA 1BI3A 3C95A 5KH6A 2KQWA 1ZBXA 3UPUA 3I5RA 1ZA2B 2P4RA 3QBYA 1Q86R 2OTJQ 2EVRA 2K9GA 2O9VA 2RI5A 3TU4K 3CCQA 3GOXA 3OS5A 2A36A 4M78A 5GAOp 3HHTB 3I9QA 3H9NA 3SB2A 1Q82R 3H0FA 4M77A 2LC4A 4HCBA 4AFZC 4BI3A 1UE9A 1T3LA 1XNIA 1PSEA 1C0MA 4ZN1A 1I81A 1VQPT 1OU9A 2LQNA 4Z88A 1WHHA 4KGVB 5GJWB 1D3BB 3EG9B 9ATCB 1M1FA 1AD5A 3ASKA 3O5ZA 3G4ST 3VS4A 1SF9A 4M7AA 2LQWA 4LDYA 1JJ2A 1VQ9Q 4QKUA 1YNZA 2QK0A 4XTVA 2E64A 2GFUA 3Q1JA 2RHZA 1QKWA 3EFRA 2RQWA 5GAOm 1WYXA 1B3QA 3N5BB 4X9DA 2CZ1B 1UDLA 1PKTA 2P84A 5GAN5 4OMQA 3G6EA 2HQXA 4PLLA 2OAWA 4JDSA 1YITA 4K11A 1VA7A 2A3LA 3LWIA 4FW2A 2IG0A 1KJWA 4QW2A 4JLGA 3S3MA 2RH2A 1EIFA 5J39A 1QWFA 1FYNA 1YJWT 4AFSC 3JRZA 3OYDA 4X1VA 1NYFA 1SRLA 4AMCA 4B6MA 1PD1A 2EJ9A 5GMKi 1ABQA 5CO7A 2XDDA 2EWNA 4MDXA 4OMLA 4ORZA 3CXCA 3RMSA 3H0HA 2MCNA 3G4SQ 4F16A 1WZOA 1QWEA 1QVGS 1X69A 3UF4A 2LNVA 1VQMA 3OSSC 1LPLA 3L2RA 2CUDA 4M78F 8AT1B 2DVEA 2RA2A 4DBFA 3META 1CSKA 4OGEA 2JMAA 4FM4B 4PJOD 4OVAA 2RO0A 2ZZDA 3CCUQ 3H41A 2L89A 1K73U 2XHCA 2IVWA 3MP1A 2LJ0A 4XU3A 1HYOA 2KMTA 3T9NA 1TS9A 1EZZB 2DJZA 2J6OA 2WSCE 3J7AF 5GAMh 4QVZA 2A37A 1VQ8A 1PM3A 4M78E 3EGUA 4M7AF 1VQ7Q 1A0NB 2KGTA 3EG0A 1RABB 2ZPIB 3PE0A 4M77E 4PJOG 3CD6A 1BI1A 2GFAA 4J9BA 1BKBA 1OZ3A 1ZA1B 3C0CA 2K2MA 3QXEB 2D6FA 3VYHB 4IUPA 2FRYA 1JXOA 2FPDA 4DA4A 4M7AE 2ZPBB 2MAMA 3VU3C 2R5AA 1NLPC 2FZGB 5CIUA 3SFMA 1OPLA 2K3XA 2CP5A 4PJMA 1VQ6A 4BACA 1NPPA 5CKHA 1PC0A 3QWXX 3RKXA 1MUZA 3CCSQ 4WF2A 5LJ3h 3I56Q 1YHQT 4HVUA 3OYCA 1KHIA 2DMOA 2F2WA 4IIOA 1W4SA 5C0MA 1VQ5T 1M3BA 4IUUA 1YWPA 1Y71A 4E7SA 3A98A 2DBKA 4IUTA 3V8JA 4F14A 4BUGA 2XIDA 2KE9A 1MMAA 3JCMP 1H3ZA 3QJ6A 1B07A 3CQTA 3ULRB 2X3XD 3MHXA 3OMGA 3P8DA 1VQLT 4L6V5 3PIOA 2PUKB 3E2UA 3OQ5A 1IHVA 3I55T 3C12A 2XI9A 3OYAA 2VC8A 1WNLA 2JXBA 2X4JA 4J6YA 3ZL7C 1YJNA 3BDLA 3NFCA 2OTLA 5KYWA 4Z89A 2FB7A 1HD3A 2EYQA 1JB0E 1IZ6A 3JB9G 4J6XA 1YHQQ 3CBMA 4M78B 3OY9A 1YI2T 1NPRA 2W10A 3VS6A 4M77B 2GGRA 1HJDA 2D1XA 2FO0A 1QVGA 1VQOQ 5CQXA 4Y91A 2GQVA 2LT1A 2XU8A 3HKSA 1GCQC 2XDBA 1UGQB 2PU9B 2HNIA 3SWNA 2EYXA 2VGMA 4Y92A 4O5VA 3L1AA 1WHJA 4M7AB 1VQLQ 2LZ6B 4NL3A 2QGGA 4XU2A 3I55Q 2RQRA 1PWTA 3L2ZA 4KT0E 1JEGA 3ZFJA 2Z0WA 2M02A 3OYGA 2LQ8A 5CK9A 2OTJA 1WXBA 4KUDK 4J7IA 1K9MU 2X9HA 4C92D 2RF0A 1JXMA 3G71A 3CCRT 4CC4B 2L5QA 4DEXA 4C5GA 2PVDB 4MMLA 5IHNA 4OP0A 4Z02A 1DJ7B 1U06A 5I22A 1Q86U 1UTIA 3CC2Q 4D8KA 4OB2B 2V8IA 3TCJA 3JCMQ 1M9SA 3A5ZB 2QEXA 1NYGA 1SKUB 4J8OA 4RTXA 1Q82U 1X6GA 2WSEE 3EG1A 5GAN3 3MKDA 3NHNA 3QYGB 4BB7A 2E12A 2M1HA 2D8JA 1PHTA 1IHWA 4DOWA 3GP8A 2ZCFB 1AVZC 3KUFA 1YIJT 4VUBA 1TUGB 2XICA 4XQ3A 1AZGB 1N6AA 3QUIA 3ER0A 3HTRA 3EHQA 3L2VA 3M58A 2P0KA 2PNIA 4YTLA 1KD1C 2EQJA 2QAZA 1FMWA 5ECAA 5FU7B 2KY9A 2EJGA 1XTDA 2GF7A 2BTTA 1VQPA 2CT4A 2DJQA 4E7LA 3X20B 4E7IA 5CCAA 1ZUUA 2CP3A 1JU5C 1TSFA 1NEGA 3ME9A 5I2MA 1WDXA 3EG9A 3G4SA 1P92A 5EC7A 4JLIA 5GMKm 2HKNA 3CC7T 2MWPA 2CP0A 4F7UA 4EMGA 1FMKA 1RADB 3CBOA 1OX9A 2GNCA 5I21A 3DB4A 3FB9A 2RHXA 3CEYA 1VIFA 2KAFA 2DF6A 2DD4A 3PTAA 2MWOA 2DPPB 3RKWA 4OGCA 4RTVA 2CT3A 2EQKA 4FSSA 4HXJA 3UDCA 4C8QE 1FMVA 1N5ZA 3SHWA 3M57A 1U8RA 4LDWA 3EGDA 2LX7A 4F17A 1YJWA 5IHIA 4A4EA 4CI0C 4KRTA 4JRIA 2AZSA 1VIEA 1QLYA 2EFIA 5LJ5h 1J3TA 2HEQA 1BI2A 2DM1A 1Q95G 4UC4A 2HQEA 5GAN2 4A4FA 4HCKA 4LE9A 2JTFA 5GMKh 2JJ9A 2DNUA 1AWOA 3CC7Q 2D0QB 3NTKA 1M8VA 4A54A 4JRQA 3X26B 4TVRA 3OW2S 1JRIA 1M27C 5GAMe 1ZHIA 4HVWA 4PLIA 4N4GA 2E5KA 2DL5A 2MIOA 1ZSZB 5KYWB 3HSBA 1SEMA 3QZ9B 3V7SA 2VXFA 1IREB 1KG1A 2LP5A 1W2BP 5AYFA 1QCFA 2K2VA 2QYZA 4C8QC 3MEAA 3JCMf 2QTVA 2FRWA 4Q5WA 1IO6A 3A8GB 3MEUA 1KD1R 2RK1A 2JTEA 3GIBA 3OYLA 3GF5A 4GBQA 1ZQ1A 1C6VX 4J9DA 1OV3A 4XTUA 2X4XA 2RI3A 3BW1A 4J7FA 2GTOA 3SWNB 1M5Q1 3JB9J 3UWNA 4M7DE 1SG5A 4R56A 1E7OA 5LJ3e 1W70A 1OULA 1K9AA 1G2BA 3DLMA 4XU0A 5FLXE 4QVCA 2ZGWA 2CGHA 1NEBA 2CZ6B 2FVUA 2F5KA 4RMOA 3CCVQ 1RAEB 2DE0X 2HAXA 1YP5A 5D6XA 4F7UE 2DRMA 1I0CA 2YHTA 1VQKQ 4RCCA 3CC4Q 1S72Q 4C8QB 1OZ2A 2CH4A 2F2XA 2O01E 3LH5A 1YHQA 5GANf 3JCMW 3HP9A 2A7YA 4O6JA 5KE2A 2E41A 1QCOA 2DIGA 2KT8A 2V1RA 2B8AA 1UGPB 2EYYA 1VQ5A 4PFZA 4EIKA 3L42A 5KCOA 3D7SB 1UFFA 2DETA 2JS2A 2NWMA 2EYZA 2EAYA 2K3BA 2V26A 2QXFA 2L8DA 2LJ3A 1QQJA 4M7DC 1VQLA 1GL5A 3E9GA 4FSXA 1XJWB 4M75G 1IGQA 1BK2A 1VQ9T 2QQSA 5I11A 4ME7A 2FZKB 1UG1A 3VS7A 1VQNQ 2DERA 1TH7A 1G5VA 2DL8A 2COWA 4BI8B 5CQYA 2COYA 2NUZA 1WJQA 2RJDA 3PT9A 2O88A 4NS5A 5IXBA 1YI2A 3DKMA 1QP2A 2EYWA 1JQQA 1KC8C 1RAAB 5FU6C 2E1HA 1MGQA 2MI6A 4M75C 2D0NA 3QJYA 1WPYA 1OQKA 3C94A 3PNWC 3X24B 1G3WA 1MNDA 2DILA 3OW2A 4M7DB 3FDRA 3MP8A 2DAQA 4J83A 5CKBA 3CMEQ 4OMNA 1VQ4Q 3AT1B 2HSEB 3SD4A 1TG0A 2AK5A 3L2QA 3QZ5B 2YLBA 4J9HA 2DL3A 4MMKA 4F7UB 3CCLQ 3OYEA 3M4YA 1I07A 4FCYA 2BE9B 1H641 1R0BG 4MZTA 1NJIC 3OS2A 5D7UA 1X75C 3F70A 5FU6B 1M1KC 5KYYA 3J80E 2B86A 3MEVA 2EQUA 5KCHA 3CCUT 1FWZA 4B9WA 3CCRA 1TUCA 2DXCA 2ZAEA 1TXQA 2ENMA 2O4XA 1ZSGA 3EGDB 2HKQB 4J5YA 1GCQA 4D8DA 4XTWA 2DTIA 1VQ7T 3EFOA 3H0IA 2RQTA 5LJ5d 3MJXA 4JS5A 4AG1C 1V29B 4L5GA 4LDVA 2QA4T 2Y90A 3M0RA 2QDYB 3PMTA 3PIPA 2KYBA 3RUXA 2KR3A 4EMHA 4J9GA 4PKCC 3JCMg 1YIJA 3OYBA 3SEMA 2JW4A 4PJOE 2KRNA 4M77F 4HA8A 2X35A 3X28B 1Y07A 3G1JA 1XOVA 2RQVA 4JRKA 3CCST 2EBPA 2RNAA 2QQRA 3I56T 4JPBW 4BE2A 2F1LA 2CSQA 1LJOA 3VS5A 1KC8R 1KQSP 1W1FA 2DXUA 2BIVA 5GAOq 1LVKA 3M53A 1RL2A 4ZGEB 2DLPA 4DBRA 4R0KA 4N4HA 1G3YA 4XAXB 4LDUA 2ZPEB 2E5QA 3I35A 2ED1A 2K5LA 4OMOA 2QA4Q 2FZCB 1H92A 4IURA 3CC7A 1BB9A 4FT4A 1GBRA 1K0XA 3MP6A 3UATA 5GANg 2DL4A 4DBHA 4M78D 2G3RA 2DL7A 4PFOA 1PRLC 4M77D 5A0DA 3CCMQ 2GCXA 4ZN3A 4PJOC 2HZYA 2BKDN 1U1TA 2NLUA 1NJIR 2KI7A 5LJ5e 1M1KR 4LD9K 3JB9F 3CMAT 4N0AC 2KSSA 4CRIA 3M0SA 3KBGA 5GMKe 4NOYA 3CPWS 2LMJA 4EDUA 1BIAA 8ATCB 3OB9A 4M7AD 1VQOT 1PSFA 3LYIA 1RAIB 1WLPB 1NM7A 2DYBA 3REBB 4OMPA 4GLKA 1Y0MA 3A8OB 1OEBA 1OYXA 4KH0B 3JB9H 3OBYA 2VKNA 3EFSA 4IKFA 2ZPGB 4KH1B 3VV0A 1FX7A 1KD1U 1B34A 3ZEHA 3SDZA 1VYVA 2GTJA 2ROLA 3PFSA 4PJOB 2X3WD 2Y4XA 1YJ9Q 5GAOl 2EKHA 2W0ZA 4MDWA 1ZSZA 3LGLA 2VASA 2KVQG 1G3TA 2VV5A 3CMAQ 4M4ZA 2XG8D 3RDVA 1RI9A 1D1BA 4PJNA 1PG5B 2VVKA 1UHFA 4FIBA 1M90C 3PVQA 2MPXC 1BBZA 4FL6A 2RK2A 4FT2A 3X25B 1IRXA 1JJ2P 2XDPA 1AZEA 3CC2T 4XU1A 4JJBA 2AKLA 4E7JA 4DEYA 4PNOA 3TVTA 4PFPA 2L3PA 3E19A 1ACMB 3VS1A 4OB3B 2RMOA 3R6NA
chains in the Genus database with same CATH topology
3CPWP 3CMAQ 1VQNQ 1YHQQ 1KQSP 3CCRQ 1KC8R 1VQKQ 1YJNQ 3CC4Q 3CD6Q 1S72Q 3CCJQ 1YI2Q 2OTLQ 1VQLQ 1Q81R 1K8AR 1VQ6Q 3CXCP 3CCQQ 1VQ7Q 1YJWQ 1Q86R 1VQPQ 3G6EQ 1YJ9Q 1W2BP 1YITQ 2OTJQ 3I55Q 1K73R 1VQOQ 1JJ2P 1VQ5Q 3CMEQ 2QEXQ 3CCLQ 3CCMQ 3CCUQ 1N8RR 1VQ4Q 3G71Q 3CC7Q 1VQMQ 1K9MR 1M90R 3CC2Q 3CCEQ 3OW2P 1NJIR 1KD1R 1M1KR 3CCSQ 2QA4Q 1YIJQ 1VQ8Q 3G4SQ 1QVGP 1Q82R 1QVFP 3I56Q 1VQ9Q 3CCVQ 1Q7YR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW P;  3CMA Q;  1VQN Q;  1YHQ Q;  1KQS P;  3CCR Q;  1KC8 R;  1VQK Q;  1YJN Q;  3CC4 Q;  3CD6 Q;  1S72 Q;  3CCJ Q;  1YI2 Q;  2OTL Q;  1VQL Q;  1Q81 R;  1K8A R;  1VQ6 Q;  3CXC P;  3CCQ Q;  1VQ7 Q;  1YJW Q;  1Q86 R;  1VQP Q;  3G6E Q;  1YJ9 Q;  1W2B P;  1YIT Q;  2OTJ Q;  3I55 Q;  1K73 R;  1VQO Q;  1JJ2 P;  1VQ5 Q;  3CME Q;  2QEX Q;  3CCL Q;  3CCM Q;  3CCU Q;  1N8R R;  1VQ4 Q;  3G71 Q;  3CC7 Q;  1VQM Q;  1K9M R;  1M90 R;  3CC2 Q;  3CCE Q;  3OW2 P;  1NJI R;  1KD1 R;  1M1K R;  3CCS Q;  2QA4 Q;  1YIJ Q;  1VQ8 Q;  3G4S Q;  1QVG P;  1Q82 R;  1QVF P;  3I56 Q;  1VQ9 Q;  3CCV Q;  1Q7Y R; 
#chains in the Genus database with same CATH topology
 2P0P A;  2ED0 A;  2KRO A;  2X51 A;  4KGZ B;  3VJP A;  4RUG A;  3EAE A;  3TSZ A;  2CYZ B;  2CP2 A;  2LDM A;  1UB4 A;  4LN2 A;  3A8M B;  1OI1 A;  3KXT A;  1PRM C;  5KYY B;  1UJY A;  1K1Z A;  4C8Q A;  5DLO A;  2MOX A;  1ZBJ A;  3M54 A;  5HCK A;  3CPF A;  1NLO C;  3CXC P;  2O4X B;  1QMC A;  1M8M A;  3OYH A;  3FJP A;  1H3H A;  3EFO B;  4KGX B;  5FRO A;  3HFO A;  5A2Q E;  4E6R A;  2K7A A;  3QPH A;  4C92 G;  2HL5 C;  1BCO A;  1JO8 A;  3BY7 A;  1D0Y A;  2E10 A;  3M9Q A;  2DX1 A;  4DQ2 A;  2LCS A;  1YWO A;  3CCQ Q;  3L2U A;  3DB3 A;  1R8O B;  1VQ9 A;  1GXI E;  5IN1 A;  2F2V A;  3CPW A;  2EW3 A;  3UA6 A;  2FL7 A;  2GBQ A;  1FXX A;  2FEI A;  3R6O A;  4FW1 A;  4LUD A;  2FYK A;  4J6W A;  2PUO B;  4ZGJ B;  4F04 B;  3OA6 A;  2V8K A;  2DIQ A;  3P8B B;  3UA7 A;  3CCJ T;  3JAM E;  4C92 C;  4X9C A;  4JUV A;  2OX7 A;  1HK9 A;  1BU1 A;  3CCE T;  5GAM d;  3TEE A;  3HFN A;  4A4H A;  1M90 R;  5IHK A;  5CKE A;  1SRM A;  2WAC A;  2J7I A;  2LQK A;  1UGV A;  1Y7X A;  5GAO n;  4M7D A;  1QVF P;  1MV3 A;  2YUQ A;  2OI3 A;  2BZY A;  4QVD A;  3QHS A;  4C8Q F;  3QO3 A;  1YIT Q;  2BUD A;  1YN8 A;  2MYS A;  2GQI A;  2E70 A;  4E47 A;  3RR6 A;  3CCU A;  2YXY A;  1GBQ A;  3NPF A;  4JJC A;  4M75 A;  3CCJ Q;  2L3S A;  1EFN A;  5LJ3 d;  2L2P A;  4JJD A;  1NBE B;  1WHK A;  3INZ A;  1ZUY A;  2RD1 A;  4JS4 A;  2DFU A;  1UGS B;  1H8K A;  1VQM Q;  3CCE Q;  4AG2 C;  5GAN 4;  1VQ7 A;  1OOT A;  4KUI A;  4X34 A;  2COZ A;  3V8L A;  2M0Y A;  2VXE A;  3BE3 A;  2RN8 A;  4C0F A;  3FRN A;  4C5H A;  3JB9 I;  3JCM J;  1ARK A;  2QA4 A;  1AEY A;  2JS0 A;  2JNG A;  1KC8 U;  1B34 B;  2QDL A;  3S3N A;  2FPF A;  3M0U A;  4E2F B;  5I2S A;  1D1C A;  5J26 A;  1RAF B;  1Y57 A;  5FRN A;  4KUL A;  2L3R A;  1YCS B;  3CCV T;  1QVG P;  4EMK C;  1Y96 A;  3JV3 A;  1VQK T;  2HQH A;  3CC4 T;  1S72 T;  1N9R A;  3CD6 Q;  5J3B A;  3LGF A;  4A53 A;  3CCS A;  3I56 A;  4M7D F;  4XTZ A;  2CH4 W;  2JM8 A;  1HSQ A;  4BI4 A;  1AOJ A;  1TU0 B;  2JVV A;  3M56 A;  1Q7Y C;  2LCL A;  1AWX A;  5CKD A;  4DBQ A;  2O2O A;  1UEC A;  2RHI A;  3MO8 A;  2QTX A;  2FHD A;  2VUB A;  3HRT A;  1NJI U;  1M1K U;  1ZX6 A;  4J9C A;  3HL8 A;  4F7U F;  1KQ1 A;  1UEB A;  1YCY A;  4RCB A;  4AT1 B;  1VQ6 Q;  4CC7 A;  2YWW A;  2RI2 A;  2QG9 B;  2AT1 B;  3EH2 A;  2YUN A;  4OMF B;  1MV0 B;  2DEU A;  5L8R E;  1WXT A;  2H3E B;  4BE1 A;  3OS1 A;  1Z9Z A;  5CVI A;  1VQN T;  4WTO B;  2A28 A;  3M5A A;  7AT1 B;  1QW1 A;  2YDL A;  2VWF A;  2P0Q A;  4E7Z A;  3JCM V;  2XD0 A;  3S3O A;  3OYN A;  1N27 A;  4WCI A;  4M75 E;  1GCP A;  4Z8A A;  3QDR B;  1M3C A;  1VQO A;  2C0O A;  2J06 A;  2M16 A;  5D6Y A;  4JRP A;  1MMN A;  2DTO A;  3A8H B;  1D1A A;  3TSW A;  1D09 B;  1YJN Q;  3VRZ A;  1M30 A;  2OTL Q;  2E3H A;  3M0T A;  5GMK l;  4OB1 B;  3CME T;  4FU6 A;  1G3S A;  5DY9 A;  1VQ4 T;  2FPE A;  2DEQ A;  3EGX A;  2KRM A;  2DVJ A;  1EX4 A;  3WXM B;  1S1N A;  1X01 A;  3I55 A;  4RTY A;  3CCL T;  5GAN j;  4J9F A;  4PJO A;  2HBP A;  2YT6 A;  1WI7 A;  3FIF A;  1AT1 B;  3VKI A;  2YUO A;  3REA B;  2RJC A;  4N0A A;  3PMI A;  2H8H A;  3GLX A;  2ZPF B;  1WGS A;  2X4W A;  2HCK A;  1K76 A;  4HT9 A;  2E6N A;  3RBB B;  2VB6 A;  1T0H A;  5C6S A;  1NZ9 A;  4PJJ A;  1UGR B;  4BY6 C;  5D6W A;  2EQI A;  2HL3 A;  4LDX A;  3P8H A;  2A08 A;  1Q7Y R;  5LL6 S;  4OB0 B;  3CC2 A;  1MMG A;  2DTH A;  1N8R C;  4HCC A;  2J6F A;  2HSP A;  2DXB A;  1RAC B;  2ROT A;  1I8F A;  1PD0 A;  5FWC A;  3G71 Q;  2RHY A;  1TWB A;  3OYF A;  2JTM A;  2IIM A;  2AZV A;  5KYU A;  1GFC A;  3U23 A;  1QVF S;  4AFU C;  5AT1 B;  1CKB A;  2K79 A;  1ZLM A;  4BE0 A;  2LCC A;  2VYT A;  3NMZ C;  1UUE A;  4HKE A;  1QP3 A;  4BY6 B;  5L23 A;  3WVE B;  3QSU A;  2EQM A;  4QQD A;  2QEX Q;  1U3O A;  4M75 B;  3M59 A;  2WSF E;  5GAM g;  2KEA A;  3VUZ A;  3JCM c;  1T3S A;  1OX8 A;  2RJF A;  4FYX B;  2JZ2 A;  3OYK A;  2YRC A;  1WXU A;  1NE8 A;  5A0G A;  2C0I A;  1WFW A;  2L0A A;  4IIM A;  5HK0 A;  2CZ7 B;  1WHG A;  4PJO F;  4Y28 E;  1R77 A;  3LLR A;  3RIR A;  2PZ1 A;  3OBW A;  1GFD A;  2BE7 D;  2MMP A;  3QII A;  4PK4 A;  1K8A C;  1GRI A;  4FYW B;  1M90 U;  2CZ0 B;  1LNX A;  1RUW A;  3BDU A;  5KYX B;  5LJ3 g;  4DOV A;  1Y96 B;  4ZTF A;  1VQP Q;  2D8H A;  3GNG A;  4C0Z A;  3CCM T;  3CCJ A;  4B9X A;  2I0N A;  1T0J A;  2K6D A;  3EG2 A;  1QCN A;  2LTO A;  5IXF A;  5IT9 E;  1Q81 C;  3FEO A;  1VOM A;  3CCE A;  2RHU A;  3V7R A;  1PKS A;  2OAU A;  4A4G A;  1IGU A;  4ZTJ A;  1WX6 A;  1VUB A;  5M9O A;  1W2B S;  2LVM A;  1N8R R;  3RNJ A;  3UT1 A;  2QQ9 A;  2DXT A;  3EG3 A;  5LJ5 f;  3BFM A;  3CBP A;  4V2S A;  2EGC A;  1I1J A;  5FRM A;  4NL2 A;  1YJ9 T;  3H6Z A;  1YJW Q;  4QQ6 A;  2NUP A;  2PQW A;  4C0D C;  3MCA B;  4C92 A;  5GAO r;  4EPC A;  2HMA A;  2R5M A;  2VGN A;  2SEM A;  1X6B A;  5HKC A;  4RTU A;  3MEW A;  1AWJ A;  5LJ5 j;  1TTH B;  2CKK A;  4XTX A;  1X2Q A;  1QVF A;  1TOV A;  4M78 G;  4C5E A;  3M4G A;  5GMK j;  4M77 G;  5DM7 R;  1RI0 A;  2K57 A;  1AWW A;  3OSV A;  3IQL A;  3JCM h;  1X43 A;  3GPL A;  2KBT A;  3EGX B;  1MHN A;  2ABL A;  1D0Z A;  4C0D B;  1X2K A;  4JZ3 A;  2YRD A;  2CSI A;  1NG2 A;  1K8A R;  1W6X A;  3FLG A;  1BIB A;  3TQ7 P;  3CCV A;  1LCK A;  4M78 C;  4M7A G;  4L59 A;  1M2V A;  1I5L A;  4C5I A;  1VQK A;  2IPO B;  4M77 C;  1S72 A;  3CC4 A;  2X4Y A;  1C1A A;  2FG0 A;  3OW2 P;  2A0F B;  1I5O B;  2JUF A;  3OYM A;  2HBW A;  3JB9 D;  1U1S A;  1SSH A;  3QG1 A;  4FYY B;  3VUB A;  2NUT A;  3GNF B;  1IXD A;  1Q81 R;  3NTI A;  1K0S A;  4LD6 A;  4ESR A;  1G83 A;  2PVO B;  3THK A;  4M7A C;  3LX7 A;  3C4S A;  4A63 B;  4J9E A;  2F5T X;  1WA7 A;  2SRC A;  2M0O A;  2F69 A;  4J9I A;  2ATC B;  2RB6 A;  5GAN h;  1AHJ B;  1UHC A;  2YLC A;  2RQU A;  3JCM b;  1E6H A;  4C92 F;  2JN0 A;  4P5N A;  1WIE A;  3OMC A;  1ABO A;  4OF1 A;  1XQH A;  3RES A;  3RER A;  2CUB A;  3CCQ T;  2AKK A;  4EMK A;  5KYU B;  1RLP C;  1M1G A;  3H8Z A;  1PCX A;  1VQ5 Q;  1VQN A;  2LT4 A;  3ZBD A;  5CAI A;  4ANJ A;  2AIR B;  4GY5 A;  2KYM A;  1W2B A;  1QKX A;  4C92 E;  4R55 A;  2C0T A;  1K73 C;  1K4U S;  2KXD A;  3EHR A;  4HT8 A;  2ESW A;  2R57 A;  1U5S A;  2G6F X;  1V76 A;  2YSQ A;  2XKO C;  1KQ2 A;  2DA9 A;  2CS7 A;  2LJ1 A;  4BD3 A;  3M0Q A;  5GAN 7;  5HY6 A;  5IAY A;  1M2O A;  1LOJ A;  2DYI A;  2HD0 A;  1OPK A;  3S6W A;  3CME A;  1VQ4 A;  2AHJ B;  3L2W A;  2H3J A;  4PL6 A;  1YI2 Q;  1Q7Y U;  3G6E T;  2QI2 A;  2D9T A;  2EIF A;  2ECZ A;  3LW5 E;  1YIT T;  1KSW A;  1SPK A;  3CCL A;  2CP7 A;  1ZUK A;  2E65 A;  2JMC A;  2MF2 A;  4MZP A;  5FU7 C;  1VYU A;  1R0C B;  2LRQ A;  4RG8 A;  3E9F A;  3VS3 A;  4ELZ C;  1WHL A;  2CRE A;  5HK3 A;  3OYI A;  4OMM A;  3PVL A;  4MZM A;  2V1Q A;  3RMQ A;  2KT1 A;  3RKY A;  2Y4Y A;  5LJ5 g;  1VQM T;  5KE3 A;  1SSF A;  1YFN A;  2CP6 A;  1BI0 A;  4JJN K;  2HDA A;  3OS0 A;  1PNJ A;  3OYJ A;  4E7K A;  2E4H A;  1CKA A;  3LH0 A;  2PVG B;  2QQB A;  4N4I A;  3FJ5 A;  3CCR Q;  1I4K 1;  3A8L B;  4KBM B;  1KQS S;  1X27 A;  2M51 A;  3G6E Q;  2BZ8 A;  2E6Z A;  3JCM X;  4LNP A;  2YRV A;  1KFZ A;  3M0P A;  4ZGD B;  2BZX A;  2NUP B;  1RAG B;  1VQ8 T;  2I2L A;  3MPU B;  4C92 B;  1HXD A;  3NTH A;  4HCZ A;  3GBQ A;  3CD6 T;  2E3I A;  1D3B A;  3QYH B;  3VYG A;  2EGA A;  2JT4 A;  4QQG A;  1MMD A;  2EGE A;  4IUV A;  4RTZ A;  1K73 R;  4HVV A;  1KHC A;  1X6O A;  1B7T A;  2DD5 A;  3HRS A;  3QKJ A;  2K5I A;  1WQW A;  1MNE A;  1YIJ Q;  4C0G A;  1KIK A;  1RLQ C;  4LXC A;  4AFQ C;  5GAM f;  4RKU E;  5GAN 8;  4CC2 A;  1G8X A;  4BDY A;  4E7H A;  1VQ6 T;  3QDF A;  3JCM d;  3A1P A;  1ZSZ C;  2DKG A;  3M55 A;  2JM9 A;  4RG2 A;  4C8Q D;  3NGP A;  3HPW A;  4GLM A;  1JBM A;  2O31 A;  5CR2 A;  3HRU A;  1F1B B;  4A4K A;  4IUQ A;  2RPN A;  3VRY A;  2EKO A;  5KYX A;  1N8R U;  4ELY C;  1M2V B;  1SHG A;  1VQ8 Q;  3CCM A;  3URG A;  3G7Z A;  4BDZ A;  2KNB B;  2MK5 A;  2K3Y A;  1M3A A;  1WJR A;  2QQA A;  4QT7 A;  3V8K A;  2DZC A;  1WQ7 A;  1K9M C;  3FC3 A;  2NUT B;  5GAM j;  5KYN A;  4C8Q G;  4CC3 A;  2LX9 A;  2DRK A;  3SWN C;  2RM4 A;  5LJ3 f;  1QVP A;  1O75 A;  3E1S A;  1OU8 A;  2KXC A;  2DBM A;  1Q86 C;  4JZ4 A;  2L3Q A;  1WHM A;  2PTK A;  6AT1 B;  1YJN T;  5GAN d;  1M4Z A;  2OTL T;  4FYV B;  2KK4 A;  2O9S A;  3I5S A;  1KK7 A;  3DLL A;  1Q82 C;  3V7C A;  2R58 A;  1JJ2 S;  2J05 A;  2DK3 A;  1SHF A;  4EMK B;  5GJV B;  2QGF B;  1N9S A;  2XMF A;  1WJS A;  4M75 F;  5CKF A;  1IB8 A;  4D6W A;  4LUE A;  1YJ9 A;  2DZ9 A;  2K5F A;  4II1 A;  3JSC A;  5LJ3 j;  2EJF A;  4PJL A;  3OYY A;  1O9S A;  3VS0 A;  2XK0 A;  3QWY A;  1YBY A;  4XTY A;  2LNH B;  3VS2 A;  2KRS A;  2CDT A;  2NYS A;  4M7D D;  3CMA A;  1K8A U;  5EG2 A;  3JCM e;  1KQS A;  1Z9Q A;  1UJ0 A;  5FWB A;  1E6G A;  3AHU A;  1TUD A;  4RTT A;  2J6K A;  1VYT A;  3KFV A;  2C06 A;  2YUP A;  3LWH A;  3CPW P;  5IH2 A;  3O8V A;  1V1C A;  5FW9 A;  3PGG A;  2OTJ T;  4ZNX A;  3CXC S;  3WVD B;  1Q81 U;  4M7D G;  5DLQ E;  3G71 T;  2QAS A;  3EH1 A;  2EPD A;  2V8J A;  2OJ2 A;  2K4Y A;  4M75 D;  5GAN 6;  3TRE A;  2KDS A;  2JOY A;  2DO3 A;  1D0X A;  4F7U G;  1RAH B;  4RTW A;  2P4T A;  2RJE A;  1BYM A;  2QEX T;  2M9U A;  5GAN e;  1BCM A;  5A0L A;  2ZPH B;  4XK8 E;  1K9M R;  3J81 E;  4ATO A;  1BI3 A;  3C95 A;  5KH6 A;  2KQW A;  1ZBX A;  3UPU A;  3I5R A;  1ZA2 B;  2P4R A;  3QBY A;  1Q86 R;  2OTJ Q;  2EVR A;  2K9G A;  2O9V A;  2RI5 A;  3TU4 K;  3CCQ A;  3GOX A;  3OS5 A;  2A36 A;  4M78 A;  5GAO p;  3HHT B;  3I9Q A;  3H9N A;  3SB2 A;  1Q82 R;  3H0F A;  4M77 A;  2LC4 A;  4HCB A;  4AFZ C;  4BI3 A;  1UE9 A;  1T3L A;  1XNI A;  1PSE A;  1C0M A;  4ZN1 A;  1I81 A;  1VQP T;  1OU9 A;  2LQN A;  4Z88 A;  1WHH A;  4KGV B;  5GJW B;  1D3B B;  3EG9 B;  9ATC B;  1M1F A;  1AD5 A;  3ASK A;  3O5Z A;  3G4S T;  3VS4 A;  1SF9 A;  4M7A A;  2LQW A;  4LDY A;  1JJ2 A;  1VQ9 Q;  4QKU A;  1YNZ A;  2QK0 A;  4XTV A;  2E64 A;  2GFU A;  3Q1J A;  2RHZ A;  1QKW A;  3EFR A;  2RQW A;  5GAO m;  1WYX A;  1B3Q A;  3N5B B;  4X9D A;  2CZ1 B;  1UDL A;  1PKT A;  2P84 A;  5GAN 5;  4OMQ A;  3G6E A;  2HQX A;  4PLL A;  2OAW A;  4JDS A;  1YIT A;  4K11 A;  1VA7 A;  2A3L A;  3LWI A;  4FW2 A;  2IG0 A;  1KJW A;  4QW2 A;  4JLG A;  3S3M A;  2RH2 A;  1EIF A;  5J39 A;  1QWF A;  1FYN A;  1YJW T;  4AFS C;  3JRZ A;  3OYD A;  4X1V A;  1NYF A;  1SRL A;  4AMC A;  4B6M A;  1PD1 A;  2EJ9 A;  5GMK i;  1ABQ A;  5CO7 A;  2XDD A;  2EWN A;  4MDX A;  4OML A;  4ORZ A;  3CXC A;  3RMS A;  3H0H A;  2MCN A;  3G4S Q;  4F16 A;  1WZO A;  1QWE A;  1QVG S;  1X69 A;  3UF4 A;  2LNV A;  1VQM A;  3OSS C;  1LPL A;  3L2R A;  2CUD A;  4M78 F;  8AT1 B;  2DVE A;  2RA2 A;  4DBF A;  3MET A;  1CSK A;  4OGE A;  2JMA A;  4FM4 B;  4PJO D;  4OVA A;  2RO0 A;  2ZZD A;  3CCU Q;  3H41 A;  2L89 A;  1K73 U;  2XHC A;  2IVW A;  3MP1 A;  2LJ0 A;  4XU3 A;  1HYO A;  2KMT A;  3T9N A;  1TS9 A;  1EZZ B;  2DJZ A;  2J6O A;  2WSC E;  3J7A F;  5GAM h;  4QVZ A;  2A37 A;  1VQ8 A;  1PM3 A;  4M78 E;  3EGU A;  4M7A F;  1VQ7 Q;  1A0N B;  2KGT A;  3EG0 A;  1RAB B;  2ZPI B;  3PE0 A;  4M77 E;  4PJO G;  3CD6 A;  1BI1 A;  2GFA A;  4J9B A;  1BKB A;  1OZ3 A;  1ZA1 B;  3C0C A;  2K2M A;  3QXE B;  2D6F A;  3VYH B;  4IUP A;  2FRY A;  1JXO A;  2FPD A;  4DA4 A;  4M7A E;  2ZPB B;  2MAM A;  3VU3 C;  2R5A A;  1NLP C;  2FZG B;  5CIU A;  3SFM A;  1OPL A;  2K3X A;  2CP5 A;  4PJM A;  1VQ6 A;  4BAC A;  1NPP A;  5CKH A;  1PC0 A;  3QWX X;  3RKX A;  1MUZ A;  3CCS Q;  4WF2 A;  5LJ3 h;  3I56 Q;  1YHQ T;  4HVU A;  3OYC A;  1KHI A;  2DMO A;  2F2W A;  4IIO A;  1W4S A;  5C0M A;  1VQ5 T;  1M3B A;  4IUU A;  1YWP A;  1Y71 A;  4E7S A;  3A98 A;  2DBK A;  4IUT A;  3V8J A;  4F14 A;  4BUG A;  2XID A;  2KE9 A;  1MMA A;  3JCM P;  1H3Z A;  3QJ6 A;  1B07 A;  3CQT A;  3ULR B;  2X3X D;  3MHX A;  3OMG A;  3P8D A;  1VQL T;  4L6V 5;  3PIO A;  2PUK B;  3E2U A;  3OQ5 A;  1IHV A;  3I55 T;  3C12 A;  2XI9 A;  3OYA A;  2VC8 A;  1WNL A;  2JXB A;  2X4J A;  4J6Y A;  3ZL7 C;  1YJN A;  3BDL A;  3NFC A;  2OTL A;  5KYW A;  4Z89 A;  2FB7 A;  1HD3 A;  2EYQ A;  1JB0 E;  1IZ6 A;  3JB9 G;  4J6X A;  1YHQ Q;  3CBM A;  4M78 B;  3OY9 A;  1YI2 T;  1NPR A;  2W10 A;  3VS6 A;  4M77 B;  2GGR A;  1HJD A;  2D1X A;  2FO0 A;  1QVG A;  1VQO Q;  5CQX A;  4Y91 A;  2GQV A;  2LT1 A;  2XU8 A;  3HKS A;  1GCQ C;  2XDB A;  1UGQ B;  2PU9 B;  2HNI A;  3SWN A;  2EYX A;  2VGM A;  4Y92 A;  4O5V A;  3L1A A;  1WHJ A;  4M7A B;  1VQL Q;  2LZ6 B;  4NL3 A;  2QGG A;  4XU2 A;  3I55 Q;  2RQR A;  1PWT A;  3L2Z A;  4KT0 E;  1JEG A;  3ZFJ A;  2Z0W A;  2M02 A;  3OYG A;  2LQ8 A;  5CK9 A;  2OTJ A;  1WXB A;  4KUD K;  4J7I A;  1K9M U;  2X9H A;  4C92 D;  2RF0 A;  1JXM A;  3G71 A;  3CCR T;  4CC4 B;  2L5Q A;  4DEX A;  4C5G A;  2PVD B;  4MML A;  5IHN A;  4OP0 A;  4Z02 A;  1DJ7 B;  1U06 A;  5I22 A;  1Q86 U;  1UTI A;  3CC2 Q;  4D8K A;  4OB2 B;  2V8I A;  3TCJ A;  3JCM Q;  1M9S A;  3A5Z B;  2QEX A;  1NYG A;  1SKU B;  4J8O A;  4RTX A;  1Q82 U;  1X6G A;  2WSE E;  3EG1 A;  5GAN 3;  3MKD A;  3NHN A;  3QYG B;  4BB7 A;  2E12 A;  2M1H A;  2D8J A;  1PHT A;  1IHW A;  4DOW A;  3GP8 A;  2ZCF B;  1AVZ C;  3KUF A;  1YIJ T;  4VUB A;  1TUG B;  2XIC A;  4XQ3 A;  1AZG B;  1N6A A;  3QUI A;  3ER0 A;  3HTR A;  3EHQ A;  3L2V A;  3M58 A;  2P0K A;  2PNI A;  4YTL A;  1KD1 C;  2EQJ A;  2QAZ A;  1FMW A;  5ECA A;  5FU7 B;  2KY9 A;  2EJG A;  1XTD A;  2GF7 A;  2BTT A;  1VQP A;  2CT4 A;  2DJQ A;  4E7L A;  3X20 B;  4E7I A;  5CCA A;  1ZUU A;  2CP3 A;  1JU5 C;  1TSF A;  1NEG A;  3ME9 A;  5I2M A;  1WDX A;  3EG9 A;  3G4S A;  1P92 A;  5EC7 A;  4JLI A;  5GMK m;  2HKN A;  3CC7 T;  2MWP A;  2CP0 A;  4F7U A;  4EMG A;  1FMK A;  1RAD B;  3CBO A;  1OX9 A;  2GNC A;  5I21 A;  3DB4 A;  3FB9 A;  2RHX A;  3CEY A;  1VIF A;  2KAF A;  2DF6 A;  2DD4 A;  3PTA A;  2MWO A;  2DPP B;  3RKW A;  4OGC A;  4RTV A;  2CT3 A;  2EQK A;  4FSS A;  4HXJ A;  3UDC A;  4C8Q E;  1FMV A;  1N5Z A;  3SHW A;  3M57 A;  1U8R A;  4LDW A;  3EGD A;  2LX7 A;  4F17 A;  1YJW A;  5IHI A;  4A4E A;  4CI0 C;  4KRT A;  4JRI A;  2AZS A;  1VIE A;  1QLY A;  2EFI A;  5LJ5 h;  1J3T A;  2HEQ A;  1BI2 A;  2DM1 A;  1Q95 G;  4UC4 A;  2HQE A;  5GAN 2;  4A4F A;  4HCK A;  4LE9 A;  2JTF A;  5GMK h;  2JJ9 A;  2DNU A;  1AWO A;  3CC7 Q;  2D0Q B;  3NTK A;  1M8V A;  4A54 A;  4JRQ A;  3X26 B;  4TVR A;  3OW2 S;  1JRI A;  1M27 C;  5GAM e;  1ZHI A;  4HVW A;  4PLI A;  4N4G A;  2E5K A;  2DL5 A;  2MIO A;  1ZSZ B;  5KYW B;  3HSB A;  1SEM A;  3QZ9 B;  3V7S A;  2VXF A;  1IRE B;  1KG1 A;  2LP5 A;  1W2B P;  5AYF A;  1QCF A;  2K2V A;  2QYZ A;  4C8Q C;  3MEA A;  3JCM f;  2QTV A;  2FRW A;  4Q5W A;  1IO6 A;  3A8G B;  3MEU A;  1KD1 R;  2RK1 A;  2JTE A;  3GIB A;  3OYL A;  3GF5 A;  4GBQ A;  1ZQ1 A;  1C6V X;  4J9D A;  1OV3 A;  4XTU A;  2X4X A;  2RI3 A;  3BW1 A;  4J7F A;  2GTO A;  3SWN B;  1M5Q 1;  3JB9 J;  3UWN A;  4M7D E;  1SG5 A;  4R56 A;  1E7O A;  5LJ3 e;  1W70 A;  1OUL A;  1K9A A;  1G2B A;  3DLM A;  4XU0 A;  5FLX E;  4QVC A;  2ZGW A;  2CGH A;  1NEB A;  2CZ6 B;  2FVU A;  2F5K A;  4RMO A;  3CCV Q;  1RAE B;  2DE0 X;  2HAX A;  1YP5 A;  5D6X A;  4F7U E;  2DRM A;  1I0C A;  2YHT A;  1VQK Q;  4RCC A;  3CC4 Q;  1S72 Q;  4C8Q B;  1OZ2 A;  2CH4 A;  2F2X A;  2O01 E;  3LH5 A;  1YHQ A;  5GAN f;  3JCM W;  3HP9 A;  2A7Y A;  4O6J A;  5KE2 A;  2E41 A;  1QCO A;  2DIG A;  2KT8 A;  2V1R A;  2B8A A;  1UGP B;  2EYY A;  1VQ5 A;  4PFZ A;  4EIK A;  3L42 A;  5KCO A;  3D7S B;  1UFF A;  2DET A;  2JS2 A;  2NWM A;  2EYZ A;  2EAY A;  2K3B A;  2V26 A;  2QXF A;  2L8D A;  2LJ3 A;  1QQJ A;  4M7D C;  1VQL A;  1GL5 A;  3E9G A;  4FSX A;  1XJW B;  4M75 G;  1IGQ A;  1BK2 A;  1VQ9 T;  2QQS A;  5I11 A;  4ME7 A;  2FZK B;  1UG1 A;  3VS7 A;  1VQN Q;  2DER A;  1TH7 A;  1G5V A;  2DL8 A;  2COW A;  4BI8 B;  5CQY A;  2COY A;  2NUZ A;  1WJQ A;  2RJD A;  3PT9 A;  2O88 A;  4NS5 A;  5IXB A;  1YI2 A;  3DKM A;  1QP2 A;  2EYW A;  1JQQ A;  1KC8 C;  1RAA B;  5FU6 C;  2E1H A;  1MGQ A;  2MI6 A;  4M75 C;  2D0N A;  3QJY A;  1WPY A;  1OQK A;  3C94 A;  3PNW C;  3X24 B;  1G3W A;  1MND A;  2DIL A;  3OW2 A;  4M7D B;  3FDR A;  3MP8 A;  2DAQ A;  4J83 A;  5CKB A;  3CME Q;  4OMN A;  1VQ4 Q;  3AT1 B;  2HSE B;  3SD4 A;  1TG0 A;  2AK5 A;  3L2Q A;  3QZ5 B;  2YLB A;  4J9H A;  2DL3 A;  4MMK A;  4F7U B;  3CCL Q;  3OYE A;  3M4Y A;  1I07 A;  4FCY A;  2BE9 B;  1H64 1;  1R0B G;  4MZT A;  1NJI C;  3OS2 A;  5D7U A;  1X75 C;  3F70 A;  5FU6 B;  1M1K C;  5KYY A;  3J80 E;  2B86 A;  3MEV A;  2EQU A;  5KCH A;  3CCU T;  1FWZ A;  4B9W A;  3CCR A;  1TUC A;  2DXC A;  2ZAE A;  1TXQ A;  2ENM A;  2O4X A;  1ZSG A;  3EGD B;  2HKQ B;  4J5Y A;  1GCQ A;  4D8D A;  4XTW A;  2DTI A;  1VQ7 T;  3EFO A;  3H0I A;  2RQT A;  5LJ5 d;  3MJX A;  4JS5 A;  4AG1 C;  1V29 B;  4L5G A;  4LDV A;  2QA4 T;  2Y90 A;  3M0R A;  2QDY B;  3PMT A;  3PIP A;  2KYB A;  3RUX A;  2KR3 A;  4EMH A;  4J9G A;  4PKC C;  3JCM g;  1YIJ A;  3OYB A;  3SEM A;  2JW4 A;  4PJO E;  2KRN A;  4M77 F;  4HA8 A;  2X35 A;  3X28 B;  1Y07 A;  3G1J A;  1XOV A;  2RQV A;  4JRK A;  3CCS T;  2EBP A;  2RNA A;  2QQR A;  3I56 T;  4JPB W;  4BE2 A;  2F1L A;  2CSQ A;  1LJO A;  3VS5 A;  1KC8 R;  1KQS P;  1W1F A;  2DXU A;  2BIV A;  5GAO q;  1LVK A;  3M53 A;  1RL2 A;  4ZGE B;  2DLP A;  4DBR A;  4R0K A;  4N4H A;  1G3Y A;  4XAX B;  4LDU A;  2ZPE B;  2E5Q A;  3I35 A;  2ED1 A;  2K5L A;  4OMO A;  2QA4 Q;  2FZC B;  1H92 A;  4IUR A;  3CC7 A;  1BB9 A;  4FT4 A;  1GBR A;  1K0X A;  3MP6 A;  3UAT A;  5GAN g;  2DL4 A;  4DBH A;  4M78 D;  2G3R A;  2DL7 A;  4PFO A;  1PRL C;  4M77 D;  5A0D A;  3CCM Q;  2GCX A;  4ZN3 A;  4PJO C;  2HZY A;  2BKD N;  1U1T A;  2NLU A;  1NJI R;  2KI7 A;  5LJ5 e;  1M1K R;  4LD9 K;  3JB9 F;  3CMA T;  4N0A C;  2KSS A;  4CRI A;  3M0S A;  3KBG A;  5GMK e;  4NOY A;  3CPW S;  2LMJ A;  4EDU A;  1BIA A;  8ATC B;  3OB9 A;  4M7A D;  1VQO T;  1PSF A;  3LYI A;  1RAI B;  1WLP B;  1NM7 A;  2DYB A;  3REB B;  4OMP A;  4GLK A;  1Y0M A;  3A8O B;  1OEB A;  1OYX A;  4KH0 B;  3JB9 H;  3OBY A;  2VKN A;  3EFS A;  4IKF A;  2ZPG B;  4KH1 B;  3VV0 A;  1FX7 A;  1KD1 U;  1B34 A;  3ZEH A;  3SDZ A;  1VYV A;  2GTJ A;  2ROL A;  3PFS A;  4PJO B;  2X3W D;  2Y4X A;  1YJ9 Q;  5GAO l;  2EKH A;  2W0Z A;  4MDW A;  1ZSZ A;  3LGL A;  2VAS A;  2KVQ G;  1G3T A;  2VV5 A;  3CMA Q;  4M4Z A;  2XG8 D;  3RDV A;  1RI9 A;  1D1B A;  4PJN A;  1PG5 B;  2VVK A;  1UHF A;  4FIB A;  1M90 C;  3PVQ A;  2MPX C;  1BBZ A;  4FL6 A;  2RK2 A;  4FT2 A;  3X25 B;  1IRX A;  1JJ2 P;  2XDP A;  1AZE A;  3CC2 T;  4XU1 A;  4JJB A;  2AKL A;  4E7J A;  4DEY A;  4PNO A;  3TVT A;  4PFP A;  2L3P A;  3E19 A;  1ACM B;  3VS1 A;  4OB3 B;  2RMO A;  3R6N A; 
#chains in the Genus database with same CATH homology
 3CPW P;  3CMA Q;  1VQN Q;  1YHQ Q;  1KQS P;  3CCR Q;  1KC8 R;  1VQK Q;  1YJN Q;  3CC4 Q;  3CD6 Q;  1S72 Q;  3CCJ Q;  1YI2 Q;  2OTL Q;  1VQL Q;  1Q81 R;  1K8A R;  1VQ6 Q;  3CXC P;  3CCQ Q;  1VQ7 Q;  1YJW Q;  1Q86 R;  1VQP Q;  3G6E Q;  1YJ9 Q;  1W2B P;  1YIT Q;  2OTJ Q;  3I55 Q;  1K73 R;  1VQO Q;  1JJ2 P;  1VQ5 Q;  3CME Q;  2QEX Q;  3CCL Q;  3CCM Q;  3CCU Q;  1N8R R;  1VQ4 Q;  3G71 Q;  3CC7 Q;  1VQM Q;  1K9M R;  1M90 R;  3CC2 Q;  3CCE Q;  3OW2 P;  1NJI R;  1KD1 R;  1M1K R;  3CCS Q;  2QA4 Q;  1YIJ Q;  1VQ8 Q;  3G4S Q;  1QVG P;  1Q82 R;  1QVF P;  3I56 Q;  1VQ9 Q;  3CCV Q;  1Q7Y R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...