1VQKQ

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqkQ00
3CCRQ 1VQ4Q 1Q81R 1KC8R 1NJIR 3CXCP 3I56Q 3G6EQ 3CCMQ 1Q86R 1VQ9Q 1K73R 1YIJQ 1N8RR 1K8AR 3CCSQ 3CCLQ 3CCVQ 1VQKQ 1VQLQ 1M1KR 3CCQQ 1Q7YR 1VQ6Q 3CCEQ 3I55Q 3CD6Q 1YJNQ 1YJWQ 1JJ2P 1YITQ 1VQ8Q 3CMEQ 1K9MR 3CC7Q 1QVFP 1VQMQ 1VQ5Q 2OTJQ 3OW2P 1M90R 2QEXQ 1S72Q 3G4SQ 1KD1R 1VQ7Q 1YHQQ 1VQNQ 1YI2Q 3CC2Q 1VQOQ 1W2BP 1Q82R 1YJ9Q 1QVGP 2OTLQ 3CCJQ 3CPWP 3CC4Q 3CMAQ 3G71Q 1VQPQ 3CCUQ 1KQSP 2QA4Q
chains in the Genus database with same CATH superfamily
2BTTA 3OYGA 3VS4A 4C92A 1F1BB 2L5QA 4PFZA 4E7KA 4HCBA 1N5ZA 2ZPGB 4E47A 1SPKA 3P8DA 1EX4A 1DJ7B 2QEXT 4XU0A 2QTXA 2YUPA 5LL6S 3OYHA 2CYZB 2RHYA 4Q5WA 1VQPT 1S72A 2EQKA 3CPWP 1M4ZA 4HCZA 3G71Q 2CSIA 4N4IA 2KGTA 2NUTB 4M7AF 1UJYA 4DEXA 1W70A 3BDUA 4EMKB 2K9GA 1IO6A 4E6RA 3I5SA 1I8FA 4CRIA 3CD6Q 3BY7A 1QW1A 1D1AA 1YHQT 3QYGB 1GBRA 1OV3A 1VQMQ 1LPLA 1VYTA 1M90U 2XDDA 2KE9A 3C95A 2WACA 1D1BA 3M0RA 5IAYA 1NE8A 2K2MA 5CVIA 4RUGA 1K73C 3G6EQ 1UG1A 2V1QA 4F16A 2X51A 2KSSA 2CUDA 2PNIA 2PU9B 3JCMQ 1BBZA 3EGDA 2K2VA 3MEUA 4RTWA 1RI0A 2J6KA 1YWOA 2K79A 2AKKA 1Q82R 2NUTA 3L42A 2QEXA 5GMKi 1S1NA 3QIIA 1X2KA 2DO3A 2QXFA 4XU3A 2XMFA 3TQ7P 3CCVT 1VQPA 4AG2C 1QVGS 2RHXA 4QVZA 2JS0A 5LJ5h 4KBMB 1NPPA 1B34B 2OTJQ 1PD0A 4JJNK 1HYOA 1YHQA 4MZPA 1KQ1A 4EPCA 4JPBW 3ZL7C 3EAEA 1D0ZA 2WSFE 2C0OA 2HCKA 3BE3A 4CC4B 2JTEA 2XIDA 1MMNA 5KYYB 1T3LA 1KD1C 1W1FA 4FT2A 2NUPB 2EQJA 3I35A 4PJOD 2KXDA 2L0AA 1YHQQ 4C92C 3MP1A 3CC4T 4BD3A 3QWXX 5FRNA 4LUDA 4F7UF 5CKFA 3DKMA 2HSPA 3EHRA 2QQSA 1VIFA 2EGAA 3CCMA 3A8LB 3HKSA 1UHCA 2EVRA 4M77C 2F2WA 3D7SB 4OB0B 4EIKA 1KD1R 3MEVA 2SRCA 3EFRA 1G3SA 5D6XA 1GBQA 3CBOA 1I07A 2DEUA 3TSZA 2ZPIB 4J9CA 2XK0A 5FROA 1OU9A 4KUDK 1Y71A 1QKWA 3CCVQ 1WA7A 2VWFA 3RKWA 2LX9A 1UGVA 1YJNQ 1VQ5T 1YITQ 2DZ9A 4FYYB 2FRWA 1KHIA 4QQDA 4DEYA 3CC2T 2XDPA 3REAB 4JS5A 5GMKm 2HKNA 1D3BB 2XG8D 1VYVA 4KT0E 1JJ2A 3HTRA 3JB9G 4C0FA 1X6OA 1WDXA 3S3MA 3CC4A 4M77E 2GQIA 2HEQA 4JJDA 4PJOF 3OYFA 2KQWA 2QI2A 2P0KA 5KCOA 1M27C 2PQWA 4EMKC 2RK2A 1AZEA 1YI2Q 1E6HA 1GCQC 1AWJA 4C92G 2Y4XA 3VS2A 2RHIA 3FB9A 4FU6A 2CH4W 1Q81R 3JCMV 2NUZA 4J9DA 2KT8A 5DLQE 1WLPB 3NTIA 2D1XA 2ATCB 4L59A 3PTAA 2EAYA 1UGRB 1HK9A 4K11A 1Q7YU 3CC7Q 5J3BA 4M7DA 1ZBXA 2CT3A 1D3BA 2LX7A 2LQWA 1UUEA 2CZ7B 1RI9A 1SRMA 4JLIA 4ESRA 1MMAA 4QT7A 1VQ5A 5LJ5j 4X9CA 4J9EA 3CMAQ 1M9SA 1WXTA 3CC2A 4DOVA 4E7JA 3UT1A 1O75A 4LD9K 5KYNA 2HNIA 1GXIE 5GAN8 2DJZA 4C8QC 4RTZA 3KXTA 2KXCA 3EGUA 5IXFA 1M90C 3OYCA 3LLRA 3GPLA 3QJYA 3OSSC 3M9QA 3TCJA 2Z0WA 1GRIA 5HCKA 4BI8B 3RUXA 2E65A 5KYXB 5GAMd 3M0SA 1WQ7A 1YCSB 5I2MA 2WSCE 2P84A 1QVGA 3OBYA 1V1CA 4B9XA 5IN1A 1C0MA 1JRIA 4NS5A 2E64A 3JV3A 3META 2DMOA 1QWEA 1M90R 2KROA 2DAQA 1WFWA 2LQNA 1K9AA 2I2LA 2E70A 1ZUYA 1X75C 5M9OA 2HKQB 4C8QE 2O9SA 2YRVA 2COZA 4C5EA 2VGMA 1UDLA 3HSBA 1HD3A 4BDYA 5CQYA 5KE3A 2QG9B 2R57A 1MHNA 2RNAA 2CP6A 2COWA 3UPUA 4IKFA 2IG0A 2BZYA 4PKCC 1PKTA 5GAOn 1I5OB 5GMKj 5CIUA 4LUEA 4XTZA 3PFSA 1KC8C 4IIMA 2PTKA 3I9QA 2GFAA 2K3YA 1G3WA 2ABLA 3O5ZA 1WXBA 2A28A 3SHWA 1Z9QA 4A4FA 1AHJB 2E6ZA 1UJ0A 1TTHB 3FLGA 4M75B 3OS2A 4ZTFA 3FJPA 3SWNA 3JCMJ 1EZZB 2B86A 3I56T 5LJ3e 1KC8R 1UHFA 2FVUA 4LDVA 2H3JA 2LMJA 3M0PA 2GF7A 3FDRA 5GAMh 2GNCA 2QQBA 4Z8AA 1TU0B 4XQ3A 2JVVA 2X4YA 1WX6A 3QWYA 4J7IA 3VS1A 4HCKA 2D0NA 2DL3A 3VV0A 1AZGB 4Y28E 3M57A 5GAN5 2AHJB 5GANd 1YIJQ 1M5Q1 1M2OA 4AMCA 2IVWA 1K8AU 4QVDA 1OULA 4Z89A 4FIBA 3I55Q 1NZ9A 2GFUA 3MPUB 2O4XB 5CKEA 3WVDB 3PE0A 4M75A 2H3EB 3LGFA 2V26A 2DRMA 3L2ZA 2E5KA 5FRMA 3SDZA 3LWIA 1YJ9T 3TVTA 4L5GA 2G3RA 4RCBA 2JUFA 1VQ9T 3CCLT 1BYMA 5I22A 1K73U 4BE1A 1YJWT 1IB8A 3I56A 2LT1A 4J5YA 2M16A 4HVWA 1MV0B 1BB9A 5KYUA 2F1LA 5GAN3 1FXXA 2MIOA 3TSWA 3OYAA 3PIPA 3QJ6A 5FW9A 3M5AA 4M7AB 2LRQA 4OMNA 3MEAA 1YNZA 2O4XA 2ED1A 4M7DG 2DD4A 1WYXA 5KH6A 3CMEQ 4R55A 1GFCA 2DL7A 5GAOm 2ZPEB 2LZ6B 4M78C 3CQTA 2RJCA 1HXDA 2RI5A 2AK5A 2RQUA 4J8OA 3MP6A 2EJ9A 2VGNA 4MDXA 1YJ9A 4PNOA 4A4KA 1VQ9A 1Y0MA 1X2QA 1K9MC 1ZUUA 3QHSA 5HK0A 3CCLA 1U3OA 5GANh 1GFDA 1V29B 1K76A 1U5SA 2D9TA 1UFFA 2QQ9A 3A5ZB 1PHTA 2MOXA 5KYWB 3RBBB 1YJWQ 4M78E 2CKKA 2CUBA 4BE2A 1ZSZB 4DBRA 4VUBA 5LJ5f 2RI3A 5KE2A 3G71T 4J6YA 1P92A 5GAMj 1ZQ1A 1MNEA 3G1JA 2CSQA 4M75C 4ZN1A 2DL5A 3CD6T 3OQ5A 2GGRA 4B6MA 1VQMT 1M3BA 1WHJA 2LCSA 2L3QA 5A0LA 4R0KA 1LVKA 3UF4A 1C6VX 1AWOA 3HP9A 1XTDA 1RACB 4DBFA 4V2SA 1MNDA 3G6ET 2DVJA 3M4YA 4F7UB 1ZUKA 1YBYA 3MEWA 4C5HA 4JRIA 5CKHA 4PJLA 2YT6A 3S3OA 1BI3A 3Q1JA 3JCMg 1YN8A 1ZA1B 2P0QA 5D7UA 5LJ3d 1E7OA 5A2QE 2A37A 3O8VA 4PJMA 3G71A 1Y7XA 2I0NA 1N27A 2KAFA 1HJDA 2HD0A 1FMWA 3FJ5A 4PFPA 3WXMB 2OTJT 1Z9ZA 2CP3A 3CD6A 1VQNQ 4AFUC 3DB4A 5C6SA 3RDVA 3EGDB 4F7UA 4C0ZA 2DFUA 2DXBA 4XTXA 1VQMA 2ECZA 4OMOA 4Z88A 3CCUQ 4AFSC 3M54A 1OZ2A 5A0DA 2EYWA 2V1RA 1K8AC 4M75G 4KGZB 2JNGA 5IH2A 3G6EA 4DQ2A 1QVPA 2RJFA 1JJ2P 4M7AC 2BE9B 2YRDA 2HMAA 3GIBA 4FYXB 3JB9D 2JT4A 1M1GA 2K3BA 3GOXA 2MF2A 1UTIA 1BI0A 4FYVB 4E7ZA 4IUPA 5GANj 2ZAEA 3QZ9B 1K8AR 3MO8A 4L6V5 2DNUA 5I11A 5CKBA 1OX8A 4C92D 1VQ7Q 2NWMA 2OTJA 3JCMf 4OP0A 4RG2A 4ATOA 2KRSA 3X26B 4C5IA 2KRNA 3P8BB 4PJOA 3EG0A 1OEBA 4OMFB 1SG5A 4A54A 1K73R 2QGFB 1WHHA 4AG1C 2Y90A 1YJNT 4M77D 5LJ3h 1YITT 1VQ6Q 2YHTA 1BCMA 5L23A 2J6FA 3SEMA 3F70A 3J80E 4C0DB 3GBQA 4HCCA 1WGSA 2QYZA 5IHNA 2YWWA 2LTOA 2C0TA 3UWNA 3KBGA 4JJCA 2XD0A 1ZSZC 3INZA 1KC8U 2JW4A 2P4RA 3CCSQ 1FMKA 2JN0A 2M51A 3J81E 2DYIA 1C1AA 2PVDB 3UDCA 2C06A 2HBWA 3GF5A 4M7AG 4A4HA 1G3TA 1H92A 2EGCA 3V8LA 1YI2T 4F14A 4ZNXA 5GAMg 2GCXA 3V8JA 3VKIA 3N5BB 1QVGP 4GLKA 2OTLQ 3PIOA 2KK4A 1KJWA 4MMLA 5KCHA 3C12A 3JCMc 2HQEA 1Y96B 1W2BS 3E1SA 3RKYA 4GY5A 2O31A 1X27A 2LCLA 3CC7T 3CCVA 3QDRB 4PK4A 1X43A 4CC7A 5FLXE 4N4GA 3OYKA 1KIKA 1PC0A 2MMPA 1YJNA 2RQWA 4JZ3A 3QUIA 3OYBA 1YITA 5J39A 3CMAT 5GAOq 4KRTA 4XU2A 2EBPA 4D6WA 3PGGA 1Y07A 2XHCA 4M77F 3EG3A 1YWPA 1WHLA 2B8AA 1OYXA 3T9NA 2LJ1A 3L1AA 4A53A 3M4GA 2PUKB 3KUFA 2F2VA 1X6BA 2EGEA 4C92E 3ME9A 3R6OA 4A63B 2CGHA 2XDBA 1M2VA 1W2BP 5CKDA 4M7DB 1XJWB 3DB3A 1Y96A 2CREA 2PVGB 3KFVA 3UA6A 1YI2A 4XTVA 3JRZA 3VUBA 4FYWB 2JS2A 3JAME 8ATCB 1TS9A 4XTWA 4C8QD 1EIFA 2GQVA 3VJPA 3QG1A 2L3SA 3MP8A 3V8KA 2ZPHB 4PJNA 1IZ6A 5I21A 3CC7A 2JZ2A 1I4K1 2EYXA 2HQXA 4DBQA 1NJIC 1R0CB 2MWPA 5GAMf 4RTVA 3CMAA 5EG2A 4EMHA 4XK8E 2E4HA 4ZN3A 1TXQA 4Y92A 3TU4K 2VV5A 4F7UG 3VRZA 5GJVB 2M0OA 2LCCA 2E1HA 3EGXA 4UC4A 3H8ZA 1AWWA 5GANg 2MAMA 2KVQG 3EG9B 2EYQA 4F17A 5LJ3j 5GAN4 3L2QA 5IHKA 4C5GA 2RB6A 4LD6A 2EFIA 4OMLA 4XAXB 2KYMA 3RIRA 2EKOA 3VYHB 4ORZA 1M1KU 2RK1A 3FIFA 4FL6A 1X01A 1K9MU 3OYIA 1JXMA 3OA6A 1KSWA 2FRYA 3QZ5B 3M0UA 1RLPC 4C8QF 4X9DA 4FCYA 2JMCA 2MCNA 4ELZC 3CCRQ 2X4JA 2YRCA 3M58A 2DF6A 1OPKA 4C0DC 1Q86U 2HAXA 3V7CA 3AT1B 5CCAA 2EWNA 4JRQA 2A36A 2VYTA 5IT9E 4OMQA 3L2RA 2DIGA 1CKBA 4NL3A 5CR2A 3G4SQ 3EG9A 3LYIA 3L2VA 3M0QA 1VQOQ 4PJOG 3REBB 3CCJQ 6AT1B 2KT1A 1D0XA 3BFMA 4HT8A 2RA2A 1YIJT 4RTUA 1WJQA 2FPEA 3SWNB 3H0FA 1U8RA 3I55T 2HL5C 3R6NA 5D6YA 2DIQA 3HRUA 3JB9J 2L3RA 5ECAA 1VUBA 3HFOA 3X28B 2OJ2A 1KQ2A 2DKGA 1XNIA 4FSSA 1KHCA 2OI3A 2CDTA 2QQRA 3PMTA 2QA4Q 4QKUA 4DBHA 2DE0X 2DTHA 5GANf 1WHGA 2K4YA 4MMKA 1W2BA 2O2OA 3C4SA 5CK9A 4R56A 2DETA 2OAWA 3MHXA 1TOVA 1SSHA 4ELYC 5CAIA 2RH2A 1PNJA 4J7FA 1SRLA 1AEYA 2JOYA 1R0BG 2VXFA 4XTUA 2EQMA 2V8IA 4J9HA 5DLOA 1IGUA 1RAAB 2J05A 1FWZA 1VQ4Q 1IXDA 1TWBA 2BE7D 1KK7A 1LCKA 4M7DC 2RD1A 1NG2A 4IUUA 1VQLQ 2X3XD 3CMET 3JCMW 1YIJA 1TSFA 3NHNA 3I55A 3P8HA 2SEMA 2FEIA 2CT4A 4RMOA 2X35A 5KYUB 2ROLA 1T3SA 7AT1B 5LJ5e 2O88A 2DL4A 1ZHIA 1KFZA 4KUIA 1T0HA 2E6NA 2FL7A 1GL5A 2DM1A 1NYGA 2X4WA 4BI4A 1G8XA 1ZBJA 3CBPA 4M78D 4OB3B 4X1VA 2JXBA 4KGXB 2LQKA 5D6WA 2MK5A 2LDMA 2KYBA 4M7DE 1NLPC 2Y4YA 4JJBA 1PM3A 4BE0A 1N8RC 3BW1A 3WVEB 4BY6B 1MV3A 3OMCA 2FZCB 4XTYA 3BDLA 2VUBA 2F2XA 2RHUA 5LJ5g 1B7TA 2F69A 3CMEA 2BUDA 2ENMA 1U1SA 5GMKl 4B9WA 3VRYA 2VVKA 4RCCA 4QW2A 3RKXA 3OYMA 3CCQQ 1PG5B 2BKDN 3E2UA 4LE9A 4QVCA 2E12A 2FB7A 3EFOA 3QYHB 1T0JA 3OW2S 2A08A 5GMKe 2FZKB 1NLOC 2LVMA 2M0YA 4LN2A 3JCMP 2JM8A 2YUOA 2L3PA 3A98A 1M1KC 4M78F 2X4XA 3EG2A 2AIRB 2A3LA 2BZXA 3A1PA 4AFQC 1OOTA 3SWNC 2M9UA 1YJWA 4A4EA 3CEYA 2AKLA 2KY9A 2IIMA 4FW2A 4AFZC 3V7RA 1ZLMA 1Q86C 3OSVA 2RI2A 3LH5A 4HVVA 1M1KR 1PD1A 1QCOA 2LJ0A 1QKXA 4D8DA 1JEGA 1VQ8Q 5FU7B 4M4ZA 1K9MR 1ZSGA 1VQNT 1YFNA 1VYUA 2KMTA 3SFMA 5GAOp 5LJ3f 1BIBA 3QDFA 3JCMe 3CCUT 1E6GA 2ZPBB 1O9SA 1Q86R 1U06A 3VS3A 1BK2A 3OS1A 3AHUA 1H3HA 3S3NA 2QQAA 1QP3A 5HKCA 4OGEA 1A0NB 3X25B 1Y57A 1K1ZA 5J26A 1LJOA 1RAGB 3VS6A 1RLQC 1TUDA 3HHTB 1QWFA 1TUGB 1SHGA 1JO8A 5GAN7 2A0FB 4BACA 4E7SA 2PVOB 2E5QA 2FPDA 1G83A 3M59A 4OB1B 3ZFJA 2EKHA 1WQWA 2DXUA 1VQKQ 1WXUA 2QDYB 4IIOA 4M7AD 1FX7A 1PWTA 4HT9A 2D8HA 4KGVB 1NYFA 3OYNA 2DTOA 1I0CA 1VQ7T 1ACMB 2K3XA 2EQUA 3NPFA 3LGLA 1VQNA 2DERA 4M75E 4KH1B 4MZMA 2R5AA 1NJIU 2DYBA 3CCUA 2E41A 1YCYA 2EJGA 1G5VA 1VQ6T 2YXYA 4CI0C 3CCEQ 3C94A 1XOVA 2NLUA 3CXCA 2LT4A 3EG1A 4BY6C 1QMCA 2M1HA 2VASA 3VS7A 4JZ4A 3E9GA 1D1CA 3RMSA 3EH2A 2ZPFB 2DA9A 1B07A 3CCST 2RQTA 4PLLA 3U23A 1GCPA 4IUQA 4PJOB 3MCAB 4PLIA 2WSEE 2KNBB 3M0TA 4O6JA 1KG1A 4PL6A 4J6XA 1NEGA 2OTLT 4M77A 1H8KA 1WI7A 3ER0A 2QGGA 1VQ7A 2ZCFB 4II1A 2PZ1A 5DM7R 2EYZA 3OB9A 5EC7A 3M55A 2FZGB 4J9IA 4FW1A 5DY9A 1W4SA 1OI1A 2AT1B 5FU6B 1WJSA 4ANJA 1WIEA 3LH0A 1VA7A 1S72Q 1VQ6A 1Q82C 2K7AA 4JS4A 3QSUA 4A4GA 1JBMA 2A7YA 1LOJA 1IRXA 3MJXA 3I5RA 3HFNA 1I5LA 2K5LA 3OW2A 3IQLA 2YDLA 3ULRB 5GAMe 2EIFA 4M7AE 1SEMA 2KI7A 1WHMA 2QK0A 3CCSA 1RABB 2H8HA 3HL8A 2ZZDA 2PUOB 3NMZC 1PSFA 4IURA 3V7SA 2JJ9A 4HKEA 4NL2A 1VIEA 2RO0A 5FU7C 4EMKA 2LJ3A 4C8QB 3CCMT 4CC3A 5L8RE 5CO7A 2OTLA 1GCQA 2P4TA 1IGQA 4JRPA 3E19A 1JXOA 2CS7A 3JB9F 3RESA 3NGPA 2QEXQ 2DLPA 5I2SA 3TREA 2FPFA 3URGA 2JTMA 5GAOl 2DVEA 1N6AA 1VQPQ 4Z02A 4FSXA 1M2VB 1R77A 1RAIB 1ZA2B 1AWXA 2VKNA 1TH7A 2RF0A 1IHVA 1M3CA 4C92F 4J6WA 3JB9H 4BDZA 1X6GA 2J7IA 4C8QA 3JCMd 4FM4B 3ASKA 5C0MA 2DXTA 1QVFA 4ME7A 1PRMC 1B34A 3H41A 4WTOB 2D6FA 3HRSA 3QKJA 1JB0E 1CSKA 4JRKA 5AT1B 3RR6A 1BCOA 3QPHA 3MKDA 2NYSA 4E7LA 3H6ZA 5AYFA 3CCRT 3EGXB 2BZ8A 4J9FA 3CCMQ 4OMMA 2XU8A 4F7UE 4QQ6A 5GANe 5KYYA 2F5KA 2GTOA 2NUPA 4X34A 3CPWA 5GMKh 1N8RU 2DRKA 4LXCA 3G4ST 3QXEB 1RL2A 4LNPA 1VQOT 1MGQA 3CCJT 3LX7A 4GLMA 4PJOC 3VU3C 4DA4A 4LDXA 3GLXA 1M8MA 1Q81C 4HA8A 5GAN6 2FG0A 2DJQA 1MUZA 1AVZC 1BI1A 2GBQA 8AT1B 4Y91A 2G6FX 1KQSS 4RTYA 3RMQA 2RMOA 3J7AF 3HRTA 4BI3A 3OS5A 5GAOr 3FEOA 1QQJA 5FWBA 5FU6C 3CC4Q 2QA4T 3RERA 4KH0B 1NJIR 1M3AA 3THKA 3M56A 3JCMh 3CCRA 3A8OB 1UECA 2EW3A 2CP0A 3FRNA 4MZTA 2R5MA 4M77G 1WNLA 2DBKA 4PJOE 4AT1B 1NM7A 2CP5A 2KEAA 2HL3A 3A8HB 1I1JA 3G4SA 1VQ4T 2HBPA 2DD5A 1VQOA 1KQSP 1QP2A 3CCJA 3S6WA 4LDYA 2K5FA 2VXEA 4O5VA 1VQLT 4N0AA 4E2FB 2RN8A 2YLBA 4BB7A 1JU5C 1Q95G 1I81A 2V8KA 2W10A 2DZCA 2HZYA 2FO0A 1TUCA 1VQ5Q 2QTVA 4C0GA 2RJDA 1MMDA 3CC2Q 4RTTA 1XQHA 2QDLA 3PVLA 2AZSA 2E10A 1H3ZA 2JTFA 4JLGA 3X24B 3HPWA 4FT4A 3LW5E 4M7DD 3H0HA 1RAFB 4TVRA 2QA4A 2D0QB 2ED0A 2MWOA 4M78B 1UGSB 3CBMA 1J3TA 2FYKA 2YLCA 2K5IA 3OYEA 3X20B 2HQHA 4XU1A 3JCMb 2DBMA 1VOMA 2RQRA 2L8DA 2LP5A 2QAZA 3SD4A 2QASA 4J83A 2CZ0B 3VS5A 4EDUA 1VQ4A 1OPLA 4EMGA 3GNFB 4OGCA 2LC4A 1AT1B 2L2PA 1VQLA 3L2WA 4YTLA 1OU8A 5KYXA 2J06A 4ZGJB 1UE9A 2LNHB 1SF9A 2F5TX 4M78A 4OB2B 2EPDA 1K0SA 3NTKA 4PJJA 4OF1A 3CCQT 2CP2A 4C8QG 3RNJA 3OMGA 2DXCA 1SSFA 1TG0A 4QQGA 4IUTA 4M7DF 1UEBA 1FYNA 2DILA 1PRLC 2JM9A 1SHFA 1X69A 4RTXA 2E3HA 3VYGA 3VUZA 1RADB 2O9VA 2RQVA 2HDAA 2K57A 3CXCS 4WF2A 2EJFA 4ZGDB 2XICA 5HK3A 2CZ6B 1BI2A 3PNWC 3ZBDA 1R8OB 3NTHA 4LDWA 1V76A 3LWHA 2V8JA 4N0AC 3EFSA 2AZVA 3EFOB 4IUVA 2CZ1B 3NFCA 5IHIA 2YUNA 3G7ZA 2DX1A 1UB4A 3OYLA 4MDWA 3EH1A 1UGPB 1VQ8T 2X9HA 1KQSA 1OX9A 3H9NA 3CCQA 5LJ3g 4ZGEB 2YUQA 2LNVA 4BUGA 3EHQA 1BIAA 2GTJA 1BKBA 3VS0A 1Q82U 3PMIA 2LQ8A 4J9BA 2DPPB 5GAN2 3CXCP 2OAUA 3DLMA 1N8RR 1IHWA 3A8MB 2DTIA 1D09B 3GP8A 2EYYA 3TEEA 1G2BA 1M30A 2MI6A 1ABOA 1RAEB 1NPRA 2J6OA 1WJRA 1CKAA 1LNXA 1PSEA 5CQXA 1ZX6A 9ATCB 3A8GB 2M02A 1QCFA 1AOJA 2YSQA 4D8KA 1K0XA 2FHDA 3I56Q 1WHKA 2OX7A 4M75D 1VQKT 2O01E 1FMVA 1Q7YC 1ABQA 3DLLA 4DOWA 1U1TA 1M8VA 4J9GA 2DEQA 2JMAA 2KR3A 3L2UA 4E7HA 1VQ8A 1NEBA 1RAHB 1G3YA 3E9FA 4JDSA 4HVUA 4OMPA 2RM4A 3JCMX 1WZOA 3JSCA 1MMGA 2XI9A 2KDSA 2RPNA 2L89A 2CH4A 4PFOA 3CCET 3OYYA 1SKUB 1Q7YR 2C0IA 4GBQA 3PVQA 1H641 2KBTA 2W0ZA 4NOYA 3OW2P 1AD5A 4M7AA 1KD1U 1OZ3A 3FC3A 3SB2A 3OBWA 5GJWB 1PKSA 2X3WD 2ROTA 5HY6A 1YJ9Q 2COYA 3OS0A 2EQIA 1ARKA 2KRMA 1VQ9Q 2HSEB 2R58A 1D0YA 3CCLQ 3C0CA 3JB9I 1VQKA 3PT9A 2ESWA 3UA7A 1IREB 2BIVA 1RUWA 4LDUA 4WCIA 4M75F 1BU1A 3ZEHA 1UGQB 2MYSA 2P0PA 3OY9A 1QVFS 5FWCA 1NBEB 5IXBA 1PCXA 4CC2A 3UATA 3OYJA 2D8JA 4C92B 1M1FA 2E3IA 2VC8A 4ZTJA 2K6DA 2XKOC 1S72T 1WPYA 4E7IA 2CP7A 3CCEA 3M53A 3H0IA 1OQKA 1N9RA 4M78G 1N9SA 4RG8A 1YP5A 2DL8A 4F04B 1W6XA 3OYDA 4M77B 2MPXC 5KYWA 3CPFA 4HXJA 1Q81U 2ZGWA 1QCNA 1K4US 1HSQA 2RJEA 2VB6A 4N4HA 3CPWS 5A0GA 1QLYA 1ZSZA 4JUVA 1JQQA 2IPOB 1B3QA 1QVFP 2DK3A 3GNGA 4P5NA 2RHZA 4RKUE 4OVAA 3QO3A 1EFNA 5LJ5d 3QBYA 1JJ2S 4KULA
chains in the Genus database with same CATH topology
3CCRQ 1VQ4Q 1Q81R 1KC8R 1NJIR 3CXCP 3I56Q 3G6EQ 3CCMQ 1Q86R 1VQ9Q 1K73R 1YIJQ 1N8RR 1K8AR 3CCSQ 3CCLQ 3CCVQ 1VQKQ 1VQLQ 1M1KR 3CCQQ 1Q7YR 1VQ6Q 3CCEQ 3I55Q 3CD6Q 1YJNQ 1YJWQ 1JJ2P 1YITQ 1VQ8Q 3CMEQ 1K9MR 3CC7Q 1QVFP 1VQMQ 1VQ5Q 2OTJQ 3OW2P 1M90R 2QEXQ 1S72Q 3G4SQ 1KD1R 1VQ7Q 1YHQQ 1VQNQ 1YI2Q 3CC2Q 1VQOQ 1W2BP 1Q82R 1YJ9Q 1QVGP 2OTLQ 3CCJQ 3CPWP 3CC4Q 3CMAQ 3G71Q 1VQPQ 3CCUQ 1KQSP 2QA4Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR Q;  1VQ4 Q;  1Q81 R;  1KC8 R;  1NJI R;  3CXC P;  3I56 Q;  3G6E Q;  3CCM Q;  1Q86 R;  1VQ9 Q;  1K73 R;  1YIJ Q;  1N8R R;  1K8A R;  3CCS Q;  3CCL Q;  3CCV Q;  1VQK Q;  1VQL Q;  1M1K R;  3CCQ Q;  1Q7Y R;  1VQ6 Q;  3CCE Q;  3I55 Q;  3CD6 Q;  1YJN Q;  1YJW Q;  1JJ2 P;  1YIT Q;  1VQ8 Q;  3CME Q;  1K9M R;  3CC7 Q;  1QVF P;  1VQM Q;  1VQ5 Q;  2OTJ Q;  3OW2 P;  1M90 R;  2QEX Q;  1S72 Q;  3G4S Q;  1KD1 R;  1VQ7 Q;  1YHQ Q;  1VQN Q;  1YI2 Q;  3CC2 Q;  1VQO Q;  1W2B P;  1Q82 R;  1YJ9 Q;  1QVG P;  2OTL Q;  3CCJ Q;  3CPW P;  3CC4 Q;  3CMA Q;  3G71 Q;  1VQP Q;  3CCU Q;  1KQS P;  2QA4 Q; 
#chains in the Genus database with same CATH topology
 2BTT A;  3OYG A;  3VS4 A;  4C92 A;  1F1B B;  2L5Q A;  4PFZ A;  4E7K A;  4HCB A;  1N5Z A;  2ZPG B;  4E47 A;  1SPK A;  3P8D A;  1EX4 A;  1DJ7 B;  2QEX T;  4XU0 A;  2QTX A;  2YUP A;  5LL6 S;  3OYH A;  2CYZ B;  2RHY A;  4Q5W A;  1VQP T;  1S72 A;  2EQK A;  3CPW P;  1M4Z A;  4HCZ A;  3G71 Q;  2CSI A;  4N4I A;  2KGT A;  2NUT B;  4M7A F;  1UJY A;  4DEX A;  1W70 A;  3BDU A;  4EMK B;  2K9G A;  1IO6 A;  4E6R A;  3I5S A;  1I8F A;  4CRI A;  3CD6 Q;  3BY7 A;  1QW1 A;  1D1A A;  1YHQ T;  3QYG B;  1GBR A;  1OV3 A;  1VQM Q;  1LPL A;  1VYT A;  1M90 U;  2XDD A;  2KE9 A;  3C95 A;  2WAC A;  1D1B A;  3M0R A;  5IAY A;  1NE8 A;  2K2M A;  5CVI A;  4RUG A;  1K73 C;  3G6E Q;  1UG1 A;  2V1Q A;  4F16 A;  2X51 A;  2KSS A;  2CUD A;  2PNI A;  2PU9 B;  3JCM Q;  1BBZ A;  3EGD A;  2K2V A;  3MEU A;  4RTW A;  1RI0 A;  2J6K A;  1YWO A;  2K79 A;  2AKK A;  1Q82 R;  2NUT A;  3L42 A;  2QEX A;  5GMK i;  1S1N A;  3QII A;  1X2K A;  2DO3 A;  2QXF A;  4XU3 A;  2XMF A;  3TQ7 P;  3CCV T;  1VQP A;  4AG2 C;  1QVG S;  2RHX A;  4QVZ A;  2JS0 A;  5LJ5 h;  4KBM B;  1NPP A;  1B34 B;  2OTJ Q;  1PD0 A;  4JJN K;  1HYO A;  1YHQ A;  4MZP A;  1KQ1 A;  4EPC A;  4JPB W;  3ZL7 C;  3EAE A;  1D0Z A;  2WSF E;  2C0O A;  2HCK A;  3BE3 A;  4CC4 B;  2JTE A;  2XID A;  1MMN A;  5KYY B;  1T3L A;  1KD1 C;  1W1F A;  4FT2 A;  2NUP B;  2EQJ A;  3I35 A;  4PJO D;  2KXD A;  2L0A A;  1YHQ Q;  4C92 C;  3MP1 A;  3CC4 T;  4BD3 A;  3QWX X;  5FRN A;  4LUD A;  4F7U F;  5CKF A;  3DKM A;  2HSP A;  3EHR A;  2QQS A;  1VIF A;  2EGA A;  3CCM A;  3A8L B;  3HKS A;  1UHC A;  2EVR A;  4M77 C;  2F2W A;  3D7S B;  4OB0 B;  4EIK A;  1KD1 R;  3MEV A;  2SRC A;  3EFR A;  1G3S A;  5D6X A;  1GBQ A;  3CBO A;  1I07 A;  2DEU A;  3TSZ A;  2ZPI B;  4J9C A;  2XK0 A;  5FRO A;  1OU9 A;  4KUD K;  1Y71 A;  1QKW A;  3CCV Q;  1WA7 A;  2VWF A;  3RKW A;  2LX9 A;  1UGV A;  1YJN Q;  1VQ5 T;  1YIT Q;  2DZ9 A;  4FYY B;  2FRW A;  1KHI A;  4QQD A;  4DEY A;  3CC2 T;  2XDP A;  3REA B;  4JS5 A;  5GMK m;  2HKN A;  1D3B B;  2XG8 D;  1VYV A;  4KT0 E;  1JJ2 A;  3HTR A;  3JB9 G;  4C0F A;  1X6O A;  1WDX A;  3S3M A;  3CC4 A;  4M77 E;  2GQI A;  2HEQ A;  4JJD A;  4PJO F;  3OYF A;  2KQW A;  2QI2 A;  2P0K A;  5KCO A;  1M27 C;  2PQW A;  4EMK C;  2RK2 A;  1AZE A;  1YI2 Q;  1E6H A;  1GCQ C;  1AWJ A;  4C92 G;  2Y4X A;  3VS2 A;  2RHI A;  3FB9 A;  4FU6 A;  2CH4 W;  1Q81 R;  3JCM V;  2NUZ A;  4J9D A;  2KT8 A;  5DLQ E;  1WLP B;  3NTI A;  2D1X A;  2ATC B;  4L59 A;  3PTA A;  2EAY A;  1UGR B;  1HK9 A;  4K11 A;  1Q7Y U;  3CC7 Q;  5J3B A;  4M7D A;  1ZBX A;  2CT3 A;  1D3B A;  2LX7 A;  2LQW A;  1UUE A;  2CZ7 B;  1RI9 A;  1SRM A;  4JLI A;  4ESR A;  1MMA A;  4QT7 A;  1VQ5 A;  5LJ5 j;  4X9C A;  4J9E A;  3CMA Q;  1M9S A;  1WXT A;  3CC2 A;  4DOV A;  4E7J A;  3UT1 A;  1O75 A;  4LD9 K;  5KYN A;  2HNI A;  1GXI E;  5GAN 8;  2DJZ A;  4C8Q C;  4RTZ A;  3KXT A;  2KXC A;  3EGU A;  5IXF A;  1M90 C;  3OYC A;  3LLR A;  3GPL A;  3QJY A;  3OSS C;  3M9Q A;  3TCJ A;  2Z0W A;  1GRI A;  5HCK A;  4BI8 B;  3RUX A;  2E65 A;  5KYX B;  5GAM d;  3M0S A;  1WQ7 A;  1YCS B;  5I2M A;  2WSC E;  2P84 A;  1QVG A;  3OBY A;  1V1C A;  4B9X A;  5IN1 A;  1C0M A;  1JRI A;  4NS5 A;  2E64 A;  3JV3 A;  3MET A;  2DMO A;  1QWE A;  1M90 R;  2KRO A;  2DAQ A;  1WFW A;  2LQN A;  1K9A A;  2I2L A;  2E70 A;  1ZUY A;  1X75 C;  5M9O A;  2HKQ B;  4C8Q E;  2O9S A;  2YRV A;  2COZ A;  4C5E A;  2VGM A;  1UDL A;  3HSB A;  1HD3 A;  4BDY A;  5CQY A;  5KE3 A;  2QG9 B;  2R57 A;  1MHN A;  2RNA A;  2CP6 A;  2COW A;  3UPU A;  4IKF A;  2IG0 A;  2BZY A;  4PKC C;  1PKT A;  5GAO n;  1I5O B;  5GMK j;  5CIU A;  4LUE A;  4XTZ A;  3PFS A;  1KC8 C;  4IIM A;  2PTK A;  3I9Q A;  2GFA A;  2K3Y A;  1G3W A;  2ABL A;  3O5Z A;  1WXB A;  2A28 A;  3SHW A;  1Z9Q A;  4A4F A;  1AHJ B;  2E6Z A;  1UJ0 A;  1TTH B;  3FLG A;  4M75 B;  3OS2 A;  4ZTF A;  3FJP A;  3SWN A;  3JCM J;  1EZZ B;  2B86 A;  3I56 T;  5LJ3 e;  1KC8 R;  1UHF A;  2FVU A;  4LDV A;  2H3J A;  2LMJ A;  3M0P A;  2GF7 A;  3FDR A;  5GAM h;  2GNC A;  2QQB A;  4Z8A A;  1TU0 B;  4XQ3 A;  2JVV A;  2X4Y A;  1WX6 A;  3QWY A;  4J7I A;  3VS1 A;  4HCK A;  2D0N A;  2DL3 A;  3VV0 A;  1AZG B;  4Y28 E;  3M57 A;  5GAN 5;  2AHJ B;  5GAN d;  1YIJ Q;  1M5Q 1;  1M2O A;  4AMC A;  2IVW A;  1K8A U;  4QVD A;  1OUL A;  4Z89 A;  4FIB A;  3I55 Q;  1NZ9 A;  2GFU A;  3MPU B;  2O4X B;  5CKE A;  3WVD B;  3PE0 A;  4M75 A;  2H3E B;  3LGF A;  2V26 A;  2DRM A;  3L2Z A;  2E5K A;  5FRM A;  3SDZ A;  3LWI A;  1YJ9 T;  3TVT A;  4L5G A;  2G3R A;  4RCB A;  2JUF A;  1VQ9 T;  3CCL T;  1BYM A;  5I22 A;  1K73 U;  4BE1 A;  1YJW T;  1IB8 A;  3I56 A;  2LT1 A;  4J5Y A;  2M16 A;  4HVW A;  1MV0 B;  1BB9 A;  5KYU A;  2F1L A;  5GAN 3;  1FXX A;  2MIO A;  3TSW A;  3OYA A;  3PIP A;  3QJ6 A;  5FW9 A;  3M5A A;  4M7A B;  2LRQ A;  4OMN A;  3MEA A;  1YNZ A;  2O4X A;  2ED1 A;  4M7D G;  2DD4 A;  1WYX A;  5KH6 A;  3CME Q;  4R55 A;  1GFC A;  2DL7 A;  5GAO m;  2ZPE B;  2LZ6 B;  4M78 C;  3CQT A;  2RJC A;  1HXD A;  2RI5 A;  2AK5 A;  2RQU A;  4J8O A;  3MP6 A;  2EJ9 A;  2VGN A;  4MDX A;  1YJ9 A;  4PNO A;  4A4K A;  1VQ9 A;  1Y0M A;  1X2Q A;  1K9M C;  1ZUU A;  3QHS A;  5HK0 A;  3CCL A;  1U3O A;  5GAN h;  1GFD A;  1V29 B;  1K76 A;  1U5S A;  2D9T A;  1UFF A;  2QQ9 A;  3A5Z B;  1PHT A;  2MOX A;  5KYW B;  3RBB B;  1YJW Q;  4M78 E;  2CKK A;  2CUB A;  4BE2 A;  1ZSZ B;  4DBR A;  4VUB A;  5LJ5 f;  2RI3 A;  5KE2 A;  3G71 T;  4J6Y A;  1P92 A;  5GAM j;  1ZQ1 A;  1MNE A;  3G1J A;  2CSQ A;  4M75 C;  4ZN1 A;  2DL5 A;  3CD6 T;  3OQ5 A;  2GGR A;  4B6M A;  1VQM T;  1M3B A;  1WHJ A;  2LCS A;  2L3Q A;  5A0L A;  4R0K A;  1LVK A;  3UF4 A;  1C6V X;  1AWO A;  3HP9 A;  1XTD A;  1RAC B;  4DBF A;  4V2S A;  1MND A;  3G6E T;  2DVJ A;  3M4Y A;  4F7U B;  1ZUK A;  1YBY A;  3MEW A;  4C5H A;  4JRI A;  5CKH A;  4PJL A;  2YT6 A;  3S3O A;  1BI3 A;  3Q1J A;  3JCM g;  1YN8 A;  1ZA1 B;  2P0Q A;  5D7U A;  5LJ3 d;  1E7O A;  5A2Q E;  2A37 A;  3O8V A;  4PJM A;  3G71 A;  1Y7X A;  2I0N A;  1N27 A;  2KAF A;  1HJD A;  2HD0 A;  1FMW A;  3FJ5 A;  4PFP A;  3WXM B;  2OTJ T;  1Z9Z A;  2CP3 A;  3CD6 A;  1VQN Q;  4AFU C;  3DB4 A;  5C6S A;  3RDV A;  3EGD B;  4F7U A;  4C0Z A;  2DFU A;  2DXB A;  4XTX A;  1VQM A;  2ECZ A;  4OMO A;  4Z88 A;  3CCU Q;  4AFS C;  3M54 A;  1OZ2 A;  5A0D A;  2EYW A;  2V1R A;  1K8A C;  4M75 G;  4KGZ B;  2JNG A;  5IH2 A;  3G6E A;  4DQ2 A;  1QVP A;  2RJF A;  1JJ2 P;  4M7A C;  2BE9 B;  2YRD A;  2HMA A;  3GIB A;  4FYX B;  3JB9 D;  2JT4 A;  1M1G A;  2K3B A;  3GOX A;  2MF2 A;  1UTI A;  1BI0 A;  4FYV B;  4E7Z A;  4IUP A;  5GAN j;  2ZAE A;  3QZ9 B;  1K8A R;  3MO8 A;  4L6V 5;  2DNU A;  5I11 A;  5CKB A;  1OX8 A;  4C92 D;  1VQ7 Q;  2NWM A;  2OTJ A;  3JCM f;  4OP0 A;  4RG2 A;  4ATO A;  2KRS A;  3X26 B;  4C5I A;  2KRN A;  3P8B B;  4PJO A;  3EG0 A;  1OEB A;  4OMF B;  1SG5 A;  4A54 A;  1K73 R;  2QGF B;  1WHH A;  4AG1 C;  2Y90 A;  1YJN T;  4M77 D;  5LJ3 h;  1YIT T;  1VQ6 Q;  2YHT A;  1BCM A;  5L23 A;  2J6F A;  3SEM A;  3F70 A;  3J80 E;  4C0D B;  3GBQ A;  4HCC A;  1WGS A;  2QYZ A;  5IHN A;  2YWW A;  2LTO A;  2C0T A;  3UWN A;  3KBG A;  4JJC A;  2XD0 A;  1ZSZ C;  3INZ A;  1KC8 U;  2JW4 A;  2P4R A;  3CCS Q;  1FMK A;  2JN0 A;  2M51 A;  3J81 E;  2DYI A;  1C1A A;  2PVD B;  3UDC A;  2C06 A;  2HBW A;  3GF5 A;  4M7A G;  4A4H A;  1G3T A;  1H92 A;  2EGC A;  3V8L A;  1YI2 T;  4F14 A;  4ZNX A;  5GAM g;  2GCX A;  3V8J A;  3VKI A;  3N5B B;  1QVG P;  4GLK A;  2OTL Q;  3PIO A;  2KK4 A;  1KJW A;  4MML A;  5KCH A;  3C12 A;  3JCM c;  2HQE A;  1Y96 B;  1W2B S;  3E1S A;  3RKY A;  4GY5 A;  2O31 A;  1X27 A;  2LCL A;  3CC7 T;  3CCV A;  3QDR B;  4PK4 A;  1X43 A;  4CC7 A;  5FLX E;  4N4G A;  3OYK A;  1KIK A;  1PC0 A;  2MMP A;  1YJN A;  2RQW A;  4JZ3 A;  3QUI A;  3OYB A;  1YIT A;  5J39 A;  3CMA T;  5GAO q;  4KRT A;  4XU2 A;  2EBP A;  4D6W A;  3PGG A;  1Y07 A;  2XHC A;  4M77 F;  3EG3 A;  1YWP A;  1WHL A;  2B8A A;  1OYX A;  3T9N A;  2LJ1 A;  3L1A A;  4A53 A;  3M4G A;  2PUK B;  3KUF A;  2F2V A;  1X6B A;  2EGE A;  4C92 E;  3ME9 A;  3R6O A;  4A63 B;  2CGH A;  2XDB A;  1M2V A;  1W2B P;  5CKD A;  4M7D B;  1XJW B;  3DB3 A;  1Y96 A;  2CRE A;  2PVG B;  3KFV A;  3UA6 A;  1YI2 A;  4XTV A;  3JRZ A;  3VUB A;  4FYW B;  2JS2 A;  3JAM E;  8ATC B;  1TS9 A;  4XTW A;  4C8Q D;  1EIF A;  2GQV A;  3VJP A;  3QG1 A;  2L3S A;  3MP8 A;  3V8K A;  2ZPH B;  4PJN A;  1IZ6 A;  5I21 A;  3CC7 A;  2JZ2 A;  1I4K 1;  2EYX A;  2HQX A;  4DBQ A;  1NJI C;  1R0C B;  2MWP A;  5GAM f;  4RTV A;  3CMA A;  5EG2 A;  4EMH A;  4XK8 E;  2E4H A;  4ZN3 A;  1TXQ A;  4Y92 A;  3TU4 K;  2VV5 A;  4F7U G;  3VRZ A;  5GJV B;  2M0O A;  2LCC A;  2E1H A;  3EGX A;  4UC4 A;  3H8Z A;  1AWW A;  5GAN g;  2MAM A;  2KVQ G;  3EG9 B;  2EYQ A;  4F17 A;  5LJ3 j;  5GAN 4;  3L2Q A;  5IHK A;  4C5G A;  2RB6 A;  4LD6 A;  2EFI A;  4OML A;  4XAX B;  2KYM A;  3RIR A;  2EKO A;  3VYH B;  4ORZ A;  1M1K U;  2RK1 A;  3FIF A;  4FL6 A;  1X01 A;  1K9M U;  3OYI A;  1JXM A;  3OA6 A;  1KSW A;  2FRY A;  3QZ5 B;  3M0U A;  1RLP C;  4C8Q F;  4X9D A;  4FCY A;  2JMC A;  2MCN A;  4ELZ C;  3CCR Q;  2X4J A;  2YRC A;  3M58 A;  2DF6 A;  1OPK A;  4C0D C;  1Q86 U;  2HAX A;  3V7C A;  3AT1 B;  5CCA A;  2EWN A;  4JRQ A;  2A36 A;  2VYT A;  5IT9 E;  4OMQ A;  3L2R A;  2DIG A;  1CKB A;  4NL3 A;  5CR2 A;  3G4S Q;  3EG9 A;  3LYI A;  3L2V A;  3M0Q A;  1VQO Q;  4PJO G;  3REB B;  3CCJ Q;  6AT1 B;  2KT1 A;  1D0X A;  3BFM A;  4HT8 A;  2RA2 A;  1YIJ T;  4RTU A;  1WJQ A;  2FPE A;  3SWN B;  3H0F A;  1U8R A;  3I55 T;  2HL5 C;  3R6N A;  5D6Y A;  2DIQ A;  3HRU A;  3JB9 J;  2L3R A;  5ECA A;  1VUB A;  3HFO A;  3X28 B;  2OJ2 A;  1KQ2 A;  2DKG A;  1XNI A;  4FSS A;  1KHC A;  2OI3 A;  2CDT A;  2QQR A;  3PMT A;  2QA4 Q;  4QKU A;  4DBH A;  2DE0 X;  2DTH A;  5GAN f;  1WHG A;  2K4Y A;  4MMK A;  1W2B A;  2O2O A;  3C4S A;  5CK9 A;  4R56 A;  2DET A;  2OAW A;  3MHX A;  1TOV A;  1SSH A;  4ELY C;  5CAI A;  2RH2 A;  1PNJ A;  4J7F A;  1SRL A;  1AEY A;  2JOY A;  1R0B G;  2VXF A;  4XTU A;  2EQM A;  2V8I A;  4J9H A;  5DLO A;  1IGU A;  1RAA B;  2J05 A;  1FWZ A;  1VQ4 Q;  1IXD A;  1TWB A;  2BE7 D;  1KK7 A;  1LCK A;  4M7D C;  2RD1 A;  1NG2 A;  4IUU A;  1VQL Q;  2X3X D;  3CME T;  3JCM W;  1YIJ A;  1TSF A;  3NHN A;  3I55 A;  3P8H A;  2SEM A;  2FEI A;  2CT4 A;  4RMO A;  2X35 A;  5KYU B;  2ROL A;  1T3S A;  7AT1 B;  5LJ5 e;  2O88 A;  2DL4 A;  1ZHI A;  1KFZ A;  4KUI A;  1T0H A;  2E6N A;  2FL7 A;  1GL5 A;  2DM1 A;  1NYG A;  2X4W A;  4BI4 A;  1G8X A;  1ZBJ A;  3CBP A;  4M78 D;  4OB3 B;  4X1V A;  2JXB A;  4KGX B;  2LQK A;  5D6W A;  2MK5 A;  2LDM A;  2KYB A;  4M7D E;  1NLP C;  2Y4Y A;  4JJB A;  1PM3 A;  4BE0 A;  1N8R C;  3BW1 A;  3WVE B;  4BY6 B;  1MV3 A;  3OMC A;  2FZC B;  4XTY A;  3BDL A;  2VUB A;  2F2X A;  2RHU A;  5LJ5 g;  1B7T A;  2F69 A;  3CME A;  2BUD A;  2ENM A;  1U1S A;  5GMK l;  4B9W A;  3VRY A;  2VVK A;  4RCC A;  4QW2 A;  3RKX A;  3OYM A;  3CCQ Q;  1PG5 B;  2BKD N;  3E2U A;  4LE9 A;  4QVC A;  2E12 A;  2FB7 A;  3EFO A;  3QYH B;  1T0J A;  3OW2 S;  2A08 A;  5GMK e;  2FZK B;  1NLO C;  2LVM A;  2M0Y A;  4LN2 A;  3JCM P;  2JM8 A;  2YUO A;  2L3P A;  3A98 A;  1M1K C;  4M78 F;  2X4X A;  3EG2 A;  2AIR B;  2A3L A;  2BZX A;  3A1P A;  4AFQ C;  1OOT A;  3SWN C;  2M9U A;  1YJW A;  4A4E A;  3CEY A;  2AKL A;  2KY9 A;  2IIM A;  4FW2 A;  4AFZ C;  3V7R A;  1ZLM A;  1Q86 C;  3OSV A;  2RI2 A;  3LH5 A;  4HVV A;  1M1K R;  1PD1 A;  1QCO A;  2LJ0 A;  1QKX A;  4D8D A;  1JEG A;  1VQ8 Q;  5FU7 B;  4M4Z A;  1K9M R;  1ZSG A;  1VQN T;  1YFN A;  1VYU A;  2KMT A;  3SFM A;  5GAO p;  5LJ3 f;  1BIB A;  3QDF A;  3JCM e;  3CCU T;  1E6G A;  2ZPB B;  1O9S A;  1Q86 R;  1U06 A;  3VS3 A;  1BK2 A;  3OS1 A;  3AHU A;  1H3H A;  3S3N A;  2QQA A;  1QP3 A;  5HKC A;  4OGE A;  1A0N B;  3X25 B;  1Y57 A;  1K1Z A;  5J26 A;  1LJO A;  1RAG B;  3VS6 A;  1RLQ C;  1TUD A;  3HHT B;  1QWF A;  1TUG B;  1SHG A;  1JO8 A;  5GAN 7;  2A0F B;  4BAC A;  4E7S A;  2PVO B;  2E5Q A;  2FPD A;  1G83 A;  3M59 A;  4OB1 B;  3ZFJ A;  2EKH A;  1WQW A;  2DXU A;  1VQK Q;  1WXU A;  2QDY B;  4IIO A;  4M7A D;  1FX7 A;  1PWT A;  4HT9 A;  2D8H A;  4KGV B;  1NYF A;  3OYN A;  2DTO A;  1I0C A;  1VQ7 T;  1ACM B;  2K3X A;  2EQU A;  3NPF A;  3LGL A;  1VQN A;  2DER A;  4M75 E;  4KH1 B;  4MZM A;  2R5A A;  1NJI U;  2DYB A;  3CCU A;  2E41 A;  1YCY A;  2EJG A;  1G5V A;  1VQ6 T;  2YXY A;  4CI0 C;  3CCE Q;  3C94 A;  1XOV A;  2NLU A;  3CXC A;  2LT4 A;  3EG1 A;  4BY6 C;  1QMC A;  2M1H A;  2VAS A;  3VS7 A;  4JZ4 A;  3E9G A;  1D1C A;  3RMS A;  3EH2 A;  2ZPF B;  2DA9 A;  1B07 A;  3CCS T;  2RQT A;  4PLL A;  3U23 A;  1GCP A;  4IUQ A;  4PJO B;  3MCA B;  4PLI A;  2WSE E;  2KNB B;  3M0T A;  4O6J A;  1KG1 A;  4PL6 A;  4J6X A;  1NEG A;  2OTL T;  4M77 A;  1H8K A;  1WI7 A;  3ER0 A;  2QGG A;  1VQ7 A;  2ZCF B;  4II1 A;  2PZ1 A;  5DM7 R;  2EYZ A;  3OB9 A;  5EC7 A;  3M55 A;  2FZG B;  4J9I A;  4FW1 A;  5DY9 A;  1W4S A;  1OI1 A;  2AT1 B;  5FU6 B;  1WJS A;  4ANJ A;  1WIE A;  3LH0 A;  1VA7 A;  1S72 Q;  1VQ6 A;  1Q82 C;  2K7A A;  4JS4 A;  3QSU A;  4A4G A;  1JBM A;  2A7Y A;  1LOJ A;  1IRX A;  3MJX A;  3I5R A;  3HFN A;  1I5L A;  2K5L A;  3OW2 A;  3IQL A;  2YDL A;  3ULR B;  5GAM e;  2EIF A;  4M7A E;  1SEM A;  2KI7 A;  1WHM A;  2QK0 A;  3CCS A;  1RAB B;  2H8H A;  3HL8 A;  2ZZD A;  2PUO B;  3NMZ C;  1PSF A;  4IUR A;  3V7S A;  2JJ9 A;  4HKE A;  4NL2 A;  1VIE A;  2RO0 A;  5FU7 C;  4EMK A;  2LJ3 A;  4C8Q B;  3CCM T;  4CC3 A;  5L8R E;  5CO7 A;  2OTL A;  1GCQ A;  2P4T A;  1IGQ A;  4JRP A;  3E19 A;  1JXO A;  2CS7 A;  3JB9 F;  3RES A;  3NGP A;  2QEX Q;  2DLP A;  5I2S A;  3TRE A;  2FPF A;  3URG A;  2JTM A;  5GAO l;  2DVE A;  1N6A A;  1VQP Q;  4Z02 A;  4FSX A;  1M2V B;  1R77 A;  1RAI B;  1ZA2 B;  1AWX A;  2VKN A;  1TH7 A;  2RF0 A;  1IHV A;  1M3C A;  4C92 F;  4J6W A;  3JB9 H;  4BDZ A;  1X6G A;  2J7I A;  4C8Q A;  3JCM d;  4FM4 B;  3ASK A;  5C0M A;  2DXT A;  1QVF A;  4ME7 A;  1PRM C;  1B34 A;  3H41 A;  4WTO B;  2D6F A;  3HRS A;  3QKJ A;  1JB0 E;  1CSK A;  4JRK A;  5AT1 B;  3RR6 A;  1BCO A;  3QPH A;  3MKD A;  2NYS A;  4E7L A;  3H6Z A;  5AYF A;  3CCR T;  3EGX B;  2BZ8 A;  4J9F A;  3CCM Q;  4OMM A;  2XU8 A;  4F7U E;  4QQ6 A;  5GAN e;  5KYY A;  2F5K A;  2GTO A;  2NUP A;  4X34 A;  3CPW A;  5GMK h;  1N8R U;  2DRK A;  4LXC A;  3G4S T;  3QXE B;  1RL2 A;  4LNP A;  1VQO T;  1MGQ A;  3CCJ T;  3LX7 A;  4GLM A;  4PJO C;  3VU3 C;  4DA4 A;  4LDX A;  3GLX A;  1M8M A;  1Q81 C;  4HA8 A;  5GAN 6;  2FG0 A;  2DJQ A;  1MUZ A;  1AVZ C;  1BI1 A;  2GBQ A;  8AT1 B;  4Y91 A;  2G6F X;  1KQS S;  4RTY A;  3RMQ A;  2RMO A;  3J7A F;  3HRT A;  4BI3 A;  3OS5 A;  5GAO r;  3FEO A;  1QQJ A;  5FWB A;  5FU6 C;  3CC4 Q;  2QA4 T;  3RER A;  4KH0 B;  1NJI R;  1M3A A;  3THK A;  3M56 A;  3JCM h;  3CCR A;  3A8O B;  1UEC A;  2EW3 A;  2CP0 A;  3FRN A;  4MZT A;  2R5M A;  4M77 G;  1WNL A;  2DBK A;  4PJO E;  4AT1 B;  1NM7 A;  2CP5 A;  2KEA A;  2HL3 A;  3A8H B;  1I1J A;  3G4S A;  1VQ4 T;  2HBP A;  2DD5 A;  1VQO A;  1KQS P;  1QP2 A;  3CCJ A;  3S6W A;  4LDY A;  2K5F A;  2VXE A;  4O5V A;  1VQL T;  4N0A A;  4E2F B;  2RN8 A;  2YLB A;  4BB7 A;  1JU5 C;  1Q95 G;  1I81 A;  2V8K A;  2W10 A;  2DZC A;  2HZY A;  2FO0 A;  1TUC A;  1VQ5 Q;  2QTV A;  4C0G A;  2RJD A;  1MMD A;  3CC2 Q;  4RTT A;  1XQH A;  2QDL A;  3PVL A;  2AZS A;  2E10 A;  1H3Z A;  2JTF A;  4JLG A;  3X24 B;  3HPW A;  4FT4 A;  3LW5 E;  4M7D D;  3H0H A;  1RAF B;  4TVR A;  2QA4 A;  2D0Q B;  2ED0 A;  2MWO A;  4M78 B;  1UGS B;  3CBM A;  1J3T A;  2FYK A;  2YLC A;  2K5I A;  3OYE A;  3X20 B;  2HQH A;  4XU1 A;  3JCM b;  2DBM A;  1VOM A;  2RQR A;  2L8D A;  2LP5 A;  2QAZ A;  3SD4 A;  2QAS A;  4J83 A;  2CZ0 B;  3VS5 A;  4EDU A;  1VQ4 A;  1OPL A;  4EMG A;  3GNF B;  4OGC A;  2LC4 A;  1AT1 B;  2L2P A;  1VQL A;  3L2W A;  4YTL A;  1OU8 A;  5KYX A;  2J06 A;  4ZGJ B;  1UE9 A;  2LNH B;  1SF9 A;  2F5T X;  4M78 A;  4OB2 B;  2EPD A;  1K0S A;  3NTK A;  4PJJ A;  4OF1 A;  3CCQ T;  2CP2 A;  4C8Q G;  3RNJ A;  3OMG A;  2DXC A;  1SSF A;  1TG0 A;  4QQG A;  4IUT A;  4M7D F;  1UEB A;  1FYN A;  2DIL A;  1PRL C;  2JM9 A;  1SHF A;  1X69 A;  4RTX A;  2E3H A;  3VYG A;  3VUZ A;  1RAD B;  2O9V A;  2RQV A;  2HDA A;  2K57 A;  3CXC S;  4WF2 A;  2EJF A;  4ZGD B;  2XIC A;  5HK3 A;  2CZ6 B;  1BI2 A;  3PNW C;  3ZBD A;  1R8O B;  3NTH A;  4LDW A;  1V76 A;  3LWH A;  2V8J A;  4N0A C;  3EFS A;  2AZV A;  3EFO B;  4IUV A;  2CZ1 B;  3NFC A;  5IHI A;  2YUN A;  3G7Z A;  2DX1 A;  1UB4 A;  3OYL A;  4MDW A;  3EH1 A;  1UGP B;  1VQ8 T;  2X9H A;  1KQS A;  1OX9 A;  3H9N A;  3CCQ A;  5LJ3 g;  4ZGE B;  2YUQ A;  2LNV A;  4BUG A;  3EHQ A;  1BIA A;  2GTJ A;  1BKB A;  3VS0 A;  1Q82 U;  3PMI A;  2LQ8 A;  4J9B A;  2DPP B;  5GAN 2;  3CXC P;  2OAU A;  3DLM A;  1N8R R;  1IHW A;  3A8M B;  2DTI A;  1D09 B;  3GP8 A;  2EYY A;  3TEE A;  1G2B A;  1M30 A;  2MI6 A;  1ABO A;  1RAE B;  1NPR A;  2J6O A;  1WJR A;  1CKA A;  1LNX A;  1PSE A;  5CQX A;  1ZX6 A;  9ATC B;  3A8G B;  2M02 A;  1QCF A;  1AOJ A;  2YSQ A;  4D8K A;  1K0X A;  2FHD A;  3I56 Q;  1WHK A;  2OX7 A;  4M75 D;  1VQK T;  2O01 E;  1FMV A;  1Q7Y C;  1ABQ A;  3DLL A;  4DOW A;  1U1T A;  1M8V A;  4J9G A;  2DEQ A;  2JMA A;  2KR3 A;  3L2U A;  4E7H A;  1VQ8 A;  1NEB A;  1RAH B;  1G3Y A;  3E9F A;  4JDS A;  4HVU A;  4OMP A;  2RM4 A;  3JCM X;  1WZO A;  3JSC A;  1MMG A;  2XI9 A;  2KDS A;  2RPN A;  2L89 A;  2CH4 A;  4PFO A;  3CCE T;  3OYY A;  1SKU B;  1Q7Y R;  2C0I A;  4GBQ A;  3PVQ A;  1H64 1;  2KBT A;  2W0Z A;  4NOY A;  3OW2 P;  1AD5 A;  4M7A A;  1KD1 U;  1OZ3 A;  3FC3 A;  3SB2 A;  3OBW A;  5GJW B;  1PKS A;  2X3W D;  2ROT A;  5HY6 A;  1YJ9 Q;  2COY A;  3OS0 A;  2EQI A;  1ARK A;  2KRM A;  1VQ9 Q;  2HSE B;  2R58 A;  1D0Y A;  3CCL Q;  3C0C A;  3JB9 I;  1VQK A;  3PT9 A;  2ESW A;  3UA7 A;  1IRE B;  2BIV A;  1RUW A;  4LDU A;  4WCI A;  4M75 F;  1BU1 A;  3ZEH A;  1UGQ B;  2MYS A;  2P0P A;  3OY9 A;  1QVF S;  5FWC A;  1NBE B;  5IXB A;  1PCX A;  4CC2 A;  3UAT A;  3OYJ A;  2D8J A;  4C92 B;  1M1F A;  2E3I A;  2VC8 A;  4ZTJ A;  2K6D A;  2XKO C;  1S72 T;  1WPY A;  4E7I A;  2CP7 A;  3CCE A;  3M53 A;  3H0I A;  1OQK A;  1N9R A;  4M78 G;  1N9S A;  4RG8 A;  1YP5 A;  2DL8 A;  4F04 B;  1W6X A;  3OYD A;  4M77 B;  2MPX C;  5KYW A;  3CPF A;  4HXJ A;  1Q81 U;  2ZGW A;  1QCN A;  1K4U S;  1HSQ A;  2RJE A;  2VB6 A;  4N4H A;  3CPW S;  5A0G A;  1QLY A;  1ZSZ A;  4JUV A;  1JQQ A;  2IPO B;  1B3Q A;  1QVF P;  2DK3 A;  3GNG A;  4P5N A;  2RHZ A;  4RKU E;  4OVA A;  3QO3 A;  1EFN A;  5LJ5 d;  3QBY A;  1JJ2 S;  4KUL A; 
#chains in the Genus database with same CATH homology
 3CCR Q;  1VQ4 Q;  1Q81 R;  1KC8 R;  1NJI R;  3CXC P;  3I56 Q;  3G6E Q;  3CCM Q;  1Q86 R;  1VQ9 Q;  1K73 R;  1YIJ Q;  1N8R R;  1K8A R;  3CCS Q;  3CCL Q;  3CCV Q;  1VQK Q;  1VQL Q;  1M1K R;  3CCQ Q;  1Q7Y R;  1VQ6 Q;  3CCE Q;  3I55 Q;  3CD6 Q;  1YJN Q;  1YJW Q;  1JJ2 P;  1YIT Q;  1VQ8 Q;  3CME Q;  1K9M R;  3CC7 Q;  1QVF P;  1VQM Q;  1VQ5 Q;  2OTJ Q;  3OW2 P;  1M90 R;  2QEX Q;  1S72 Q;  3G4S Q;  1KD1 R;  1VQ7 Q;  1YHQ Q;  1VQN Q;  1YI2 Q;  3CC2 Q;  1VQO Q;  1W2B P;  1Q82 R;  1YJ9 Q;  1QVG P;  2OTL Q;  3CCJ Q;  3CPW P;  3CC4 Q;  3CMA Q;  3G71 Q;  1VQP Q;  3CCU Q;  1KQS P;  2QA4 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...