1VQKQ

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqkQ00
1YI2Q 1YHQQ 3CCMQ 1YJWQ 1VQ4Q 1VQNQ 3CPWP 1NJIR 3CD6Q 3CCUQ 1KD1R 2OTJQ 3CCSQ 1Q81R 1K8AR 1M90R 3CCRQ 1YJNQ 3G4SQ 3CCQQ 3I56Q 1YIJQ 1Q7YR 1K9MR 1VQOQ 3CC7Q 1QVGP 1Q86R 3CMAQ 1Q82R 1K73R 1VQ8Q 1VQLQ 1S72Q 1VQ6Q 3CMEQ 1W2BP 3G71Q 1VQ5Q 2QEXQ 3OW2P 3CC4Q 1VQ7Q 2OTLQ 3CCEQ 3CXCP 1N8RR 3CCVQ 1VQPQ 3CCJQ 1YITQ 1VQKQ 1QVFP 3G6EQ 1KC8R 1YJ9Q 1JJ2P 1M1KR 1KQSP 3I55Q 1VQMQ 3CC2Q 1VQ9Q 2QA4Q 3CCLQ
chains in the Genus database with same CATH superfamily
3LYIA 3FB9A 3OYBA 3C94A 1TSFA 1BI0A 1EZZB 3CPWA 1BCOA 3VRZA 5A0LA 2JM9A 2FZKB 1I07A 3OSSC 1OV3A 2CGHA 3CD6A 4DEXA 3CCQT 2X4XA 1QVGS 1G2BA 4BDZA 1JJ2P 2ZPHB 1WQWA 4KGVB 1WHMA 4M75A 4CC4B 2XIDA 3PVQA 2P0KA 4LE9A 4HCZA 2LCCA 3CCVA 2COWA 1KD1R 3RIRA 4JS5A 2M9UA 1VOMA 4JDSA 3SWNC 2RK2A 1WHKA 2PU9B 3HP9A 4BI3A 3META 4EMHA 2DL5A 3JCMc 3PTAA 2O01E 3M59A 4M77C 3OS2A 3G71Q 4J9EA 2KK4A 1N8RR 4UC4A 1Q95G 1I5LA 4OMNA 1ZHIA 2X35A 1WHLA 4CC3A 2A36A 2FL7A 1UGVA 2DBMA 4E47A 3HTRA 3CCLQ 5CR2A 2LTOA 2PNIA 1OQKA 1Y7XA 1G3TA 4FL6A 5KH6A 2XHCA 4RG8A 1BU1A 5GAN6 3E9GA 1Q81C 1K73C 4HA8A 3H0HA 4LD9K 3EGUA 3JCMh 5C6SA 4EMKC 4DBFA 4PK4A 5IHNA 3KFVA 4QQ6A 2LJ3A 3A8MB 1R0CB 3UA7A 3JCMd 3FRNA 2CDTA 2KSSA 2RHXA 1X01A 1D0YA 1D0ZA 4OMLA 5GAMd 2WSFE 2ESWA 3QWXX 1M30A 3M0QA 2RQWA 2KI7A 1YHQT 4A4GA 4M78F 4OGEA 3EGXB 3FEOA 4XU0A 4HCBA 4KRTA 1BBZA 2RQVA 1K8AR 3RESA 2DTOA 1Q7YR 2JTMA 2BE9B 2LC4A 3OYYA 4J9CA 3QBYA 5HCKA 3RDVA 5FROA 2HNIA 4MMLA 2AT1B 2A0FB 3C95A 1KQ2A 4D6WA 1RAIB 5CKFA 2D0QB 3OBWA 3H0FA 5GANf 3J81E 3O5ZA 4KUDK 2L3PA 2EFIA 2NUZA 2E6ZA 2ZZDA 4AFQC 2DETA 3VS2A 2KMTA 1PWTA 4HXJA 4M7DC 4HT9A 4F7UA 4PNOA 3CXCP 2A3LA 4C0DC 3QUIA 4F7UG 4HT8A 2D1XA 2QAZA 2DEQA 4Z8AA 5CVIA 5KYUA 2AKLA 3EHRA 2EYYA 1YHQQ 1NE8A 5LJ5j 1MMGA 5IN1A 4PFZA 2VUBA 5GAN5 1QCNA 1H641 4P5NA 1HK9A 3ZBDA 4KGZB 3OS0A 1FMWA 4EMGA 2EYWA 5FWBA 2EVRA 2PZ1A 2KGTA 1VQ4A 3CMAT 4O5VA 1M1KR 2DL8A 1UUEA 4KULA 1BKBA 2RHZA 2X3WD 2ZAEA 5J26A 3R6NA 1VQPA 2ECZA 1H3ZA 2K79A 2XDDA 3QJ6A 1GBRA 5M9OA 4RCCA 2ATCB 4BE1A 3BE3A 3G6EQ 1X6OA 3OS5A 3OYCA 4KGXB 6AT1B 2LCLA 1XTDA 2CSQA 2JW4A 1K1ZA 4X34A 1WA7A 2HQHA 2V8IA 3ME9A 3U23A 4ZN1A 1VQMA 3JCMV 1MV0B 4CC2A 2E70A 3S6WA 4E7HA 2LDMA 2G3RA 1ZUUA 1VIEA 1MMDA 4M78G 2CP3A 2QQBA 2JUFA 3C12A 3QZ5B 1Y71A 5CIUA 1QKWA 2GQIA 4M78B 1P92A 1PHTA 3CPFA 1X75C 2DTHA 4JJNK 2RM4A 3SD4A 1WPYA 5FU6C 4K11A 2JMCA 2OTLT 2JS2A 4V2SA 1XOVA 4LXCA 2EYQA 4OP0A 1NYFA 1RUWA 2RB6A 3HRTA 5DM7R 2F5KA 2OTLA 1HSQA 3P8DA 2V26A 3JCMe 2X51A 4JS4A 4PJOD 2LQNA 2QXFA 4XU2A 2YUQA 1GFCA 2E3IA 3G6ET 1MUZA 2SEMA 4GBQA 3VS5A 3AT1B 4EIKA 3OYGA 1UGRB 1QMCA 2JVVA 3TREA 1SHFA 2GFUA 4E7JA 3EGDA 1AVZC 4RTTA 5ECAA 2EWNA 3DKMA 1NJIU 1J3TA 4VUBA 4FM4B 2DE0X 3PT9A 1KG1A 4M78E 2ZPEB 2G6FX 3FDRA 3OYJA 1V1CA 1GL5A 1AZEA 3H0IA 3MEAA 2QQ9A 3M9QA 4J83A 5GMKm 2DL7A 2J6KA 2DXTA 4FT2A 5KYYA 2OTLQ 3HPWA 2ZPIB 3CCVQ 3H9NA 3VUBA 5KYNA 1X6BA 1RAEB 5D7UA 4JJBA 4FCYA 2DYIA 4ELZC 2O31A 3VS1A 9ATCB 4E6RA 2QGFB 3DB4A 3I9QA 3M57A 1E6HA 1Q7YC 1HD3A 1WXTA 3OY9A 3QWYA 1IREB 1QP2A 1X69A 1GCPA 3CCQA 2BZ8A 2EQUA 1VQ5Q 5CQXA 3TVTA 1VQ7Q 4M7DF 5GAOp 1LOJA 3LH0A 1YP5A 2I2LA 2EQIA 3MO8A 2NLUA 2YRCA 5EG2A 1LVKA 1AEYA 1CSKA 4J9BA 2LT4A 3OB9A 4C0ZA 1VQLA 1Z9ZA 1GRIA 4OB2B 5A0GA 1KQ1A 3G4SA 2NUPA 3BW1A 1WZOA 2L3QA 2JXBA 1QKXA 2BZYA 3V7SA 2M1HA 1KC8R 1O9SA 1NG2A 5KYYB 2O88A 1NLPC 1YHQA 4MZTA 4NL2A 3BDLA 1AWOA 4M7AG 4D8KA 3CC2T 5GAOm 4L59A 3VRYA 4RKUE 3UPUA 3EG0A 3QHSA 2AK5A 1T0HA 1N8RC 3OYNA 5L23A 2CT3A 2KVQG 4M7DE 4M78D 1SRLA 3Q1JA 2EBPA 2HD0A 2LNVA 4A4FA 3MKDA 1JRIA 2RO0A 2J05A 3M4YA 1RI0A 4BUGA 4RTWA 4M4ZA 3V8KA 3I55T 3WVEB 4OMQA 1UFFA 2E12A 5A2QE 1B34A 1WHGA 1M8MA 4Y92A 4PFPA 1QVFS 4C8QD 2LQKA 1YNZA 3RKYA 1T0JA 2FPEA 3OW2S 2HMAA 1YCSB 2LJ0A 3UA6A 2KT1A 4PJOB 1BK2A 1YIJQ 2Z0WA 2YHTA 4WCIA 3CBPA 2EKHA 3H6ZA 5AYFA 1M9SA 1ZSGA 2QQSA 4NS5A 4PJOG 1YN8A 4PKCC 2F1LA 2OTJA 1BIAA 2LQWA 1KFZA 2KYBA 4A53A 5GMKl 5GJWB 3HSBA 2DIQA 2DXBA 2FZGB 2RI3A 1KHIA 3QPHA 2X3XD 1BI2A 1UG1A 1D3BB 1Q81R 1WFWA 2R5AA 2XU8A 1YJ9T 5GAN2 2DZCA 2EW3A 4M7DB 2YRVA 3IQLA 3JB9F 3EG3A 2HQXA 3HRUA 1OU9A 2ROTA 1VQNT 2E41A 1RLPC 1N9RA 5I2SA 3I55Q 4J9DA 2YSQA 4AFZC 3V8JA 2DJZA 4C92C 1QQJA 3RBBB 2COYA 1VIFA 2CUBA 2RQTA 1D0XA 3JRZA 4F7UE 1ZBXA 3CPWS 3OQ5A 2DJQA 2LQ8A 2W0ZA 4RCBA 2J06A 4M7AB 1BI3A 1AD5A 1X27A 1V76A 1WHJA 4M77F 2DRMA 3G7ZA 4LUDA 3GP8A 3HKSA 2RI2A 1S1NA 2HEQA 2DD5A 3S3NA 4IUQA 3PMIA 2K9GA 3PMTA 1JU5C 1KD1C 2EYXA 3TSWA 2AZVA 4QVZA 5HKCA 2BUDA 1Y0MA 1D3BA 2JTEA 3A8GB 5KCOA 1QLYA 4IUVA 1NM7A 1KQSA 1SHGA 3KXTA 4AMCA 3VJPA 3VS3A 2E10A 2NWMA 2QQRA 1UGSB 4TVRA 4PFOA 3LWIA 2M16A 3M54A 3EGDB 3QG1A 3UT1A 5LJ3e 1CKAA 1ZSZC 1ZA1B 1SRMA 4M7AD 2RK1A 2LP5A 3SWNA 1NLOC 1KC8C 2LJ1A 4Y28E 3WXMB 4PJOE 3JCMb 1MNEA 2DXUA 2GBQA 1OEBA 4ZGEB 4J6YA 4J7FA 5CKBA 3CMEA 1JJ2A 1SG5A 4KT0E 3OYLA 2DM1A 1IHVA 3CXCS 1JXMA 2FG0A 1PCXA 1UEBA 4ORZA 5GAMh 3UWNA 7AT1B 4QKUA 4FYYB 2QYZA 2MI6A 5GAN8 2RQUA 2C0TA 4LD6A 4M77B 5KYXB 3JCMg 1HYOA 2KROA 1JXOA 1PSEA 1IB8A 3A8HB 1QW1A 1FWZA 2JN0A 4RTXA 2XG8D 1IRXA 4PL6A 3OMCA 3H8ZA 1UHFA 2BZXA 3JB9I 5I22A 3JAME 1TU0B 4DQ2A 4QVDA 1IXDA 2H3JA 1YBYA 2K5LA 3QDRB 1K9MC 1K73R 2DL3A 4RUGA 3DLMA 2MPXC 2E4HA 1TH7A 5CKEA 1SKUB 4IUTA 1JO8A 4IIMA 1TG0A 2C0IA 4C0GA 4ZNXA 1ZSZB 4BY6B 3CQTA 3PFSA 2GQVA 1C1AA 3CCSA 1VQ9A 1AOJA 1MGQA 5I2MA 2QDLA 1M2VB 1Y07A 4C5IA 3OYEA 5IHIA 1Y96B 3LGFA 3X24B 3GLXA 4L6V5 4PJOF 1W1FA 5KYXA 2WSCE 2DO3A 5GAOl 3M53A 4XAXB 3O8VA 4C8QE 2XKOC 2EQMA 2F2VA 2E6NA 2F5TX 5IT9E 1VQ7A 4J9GA 1NEBA 1B34B 1RAFB 2E5KA 2QA4T 2M02A 2VVKA 3INZA 3CC4Q 4IURA 4C8QC 4F04B 2CZ0B 3M0PA 1ZQ1A 5GJVB 2CP2A 3FC3A 4OGCA 4FSXA 5D6YA 1M2OA 1U1TA 2QEXT 1T3SA 2RA2A 3VYGA 3JB9J 4ESRA 2HQEA 2HAXA 2DPPB 3LGLA 2ZCFB 3A8LB 4OVAA 1LJOA 3QJYA 3ZFJA 1M2VA 1QVPA 2R58A 3CC7A 4C92G 1VYTA 2CREA 3OYAA 1ZUKA 2E1HA 2VXEA 1IZ6A 2E65A 3CCUQ 4M7DD 4XU1A 2BIVA 3X26B 1BYMA 2XK0A 4ZN3A 1YITA 2L3SA 1VUBA 3JCMf 4BI8B 1WNLA 4M75G 3L2UA 4OMMA 3CC4T 1M1KC 4MZMA 1UTIA 4RG2A 4F14A 2ABLA 4C8QB 2KXDA 3BFMA 1MNDA 3L42A 5CKHA 3TEEA 1D09B 3PIPA 1ZA2B 1YITT 3GF5A 1N6AA 2KRSA 2M0OA 1R77A 2RJFA 1M90C 2XDBA 2QEXQ 4YTLA 2YLCA 5GAN3 5L8RE 4M77G 2LCSA 1KHCA 3CC4A 2JS0A 1BB9A 5IAYA 2JJ9A 5IHKA 1VQ6A 3EAEA 4F17A 2DFUA 2YRDA 1UHCA 1M27C 2D6FA 3OYMA 4E7IA 4DBRA 2CP7A 2VB6A 3QYHB 5LJ5d 3PGGA 2QASA 3EH1A 4DEYA 2K5IA 3EG9A 3R6OA 3HFOA 1V29B 4QW2A 5CKDA 3CCST 4RTZA 2O9SA 2FZCB 4D8DA 4GLKA 2F2WA 4N4IA 4JJDA 3REAB 5IXBA 1AZGB 2FPDA 5GMKi 3OBYA 2IG0A 3N5BB 1AWXA 3RR6A 4C0DB 5KYWA 2MWOA 1YWPA 2I0NA 1M5Q1 4MDXA 2X4YA 2RN8A 1VQ8Q 2J6OA 4LDYA 1GXIE 1BI1A 4OF1A 4M75B 1K76A 1VQNA 2Y90A 2DMOA 4PJLA 2FVUA 1MHNA 2DBKA 1LNXA 2FRWA 3G71T 2DLPA 2KNBB 3PE0A 4XK8E 1UDLA 2ENMA 3J80E 1QVGP 1Q86R 1T3LA 2K2VA 1VQKA 1BCMA 3CCLT 1VA7A 4B9WA 5GAN7 3OYDA 2KEAA 1VYVA 3E1SA 1M8VA 2DF6A 3URGA 2DNUA 3BDUA 4FSSA 4ME7A 2X4JA 3CCSQ 3MHXA 1TXQA 1FX7A 4MMKA 4JPBW 1VQKT 1NPPA 1SF9A 1D1AA 3CMAA 2VKNA 3NTHA 1PM3A 3CXCA 1YJNT 2LT1A 1QP3A 2ED1A 3MJXA 4IIOA 2XD0A 1VQ8T 3VYHB 1Q7YU 1S72T 1GCQC 3OS1A 1W6XA 3HRSA 3X25B 4AFUC 4A4HA 4C92D 8ATCB 2IPOB 3CC7Q 3EGXA 8AT1B 4OMPA 1Q82C 3P8BB 2VWFA 4N0AA 4KUIA 3M58A 4JRPA 5LJ5g 2HL3A 1R8OB 1UJ0A 2EJGA 4LDVA 1X2QA 4GLMA 4LN2A 4QVCA 3CCJA 1WXUA 2WACA 2VC8A 1JJ2S 1NPRA 4M75D 2VGNA 1NJIC 2RHUA 4QQDA 3V8LA 4N4GA 1FYNA 3CCLA 1VQKQ 2SRCA 1OPKA 1WYXA 1VQOT 1VQLT 5FU7C 1G3SA 1YI2Q 2L3RA 4JUVA 4PLIA 1U1SA 3CBMA 1KSWA 1M3CA 1M1GA 2LX9A 1OX9A 1S72Q 1OULA 1PKSA 3P8HA 1YCYA 3NGPA 3QXEB 5KYUB 1JBMA 1UE9A 2DK3A 4N4HA 3JB9G 4FU6A 2NUPB 1PD0A 4HCCA 3L2WA 4FW1A 2KAFA 4II1A 1G3YA 1QWFA 2AIRB 3CMAQ 2NYSA 4JZ3A 1XJWB 3MP1A 2D8HA 1AHJB 5HK3A 1IHWA 2X4WA 4M75C 2COZA 3QIIA 3WVDB 4C5GA 5HY6A 4AG2C 1OOTA 3QYGB 1PNJA 3MCAB 3L2RA 1QWEA 3CMET 1NYGA 2EJ9A 1K8AC 3UF4A 1PC0A 4PJJA 1WHHA 3HL8A 3I56A 1VQOQ 2C0OA 3I5RA 2ZPFB 5LJ3h 3X20B 1VQLQ 1H8KA 1X2KA 4PJNA 1YI2T 2JZ2A 2FYKA 1U3OA 4Y91A 5IXFA 5IH2A 2DXCA 4C8QA 5A0DA 4XTVA 2OAUA 2AKKA 3G6EA 4J8OA 3QSUA 3T9NA 2A7YA 4A54A 3CPWP 3ZL7C 1TUDA 4IUUA 5DLQE 2DAQA 2QA4A 4XTZA 1EFNA 1VQ8A 4M78A 2RQRA 2YWWA 3F70A 1NBEB 2QDYB 4J6WA 2RHYA 1SSHA 2EJFA 5FRNA 1LCKA 3A1PA 4Z89A 4BY6C 1RAGB 2XDPA 1Q86U 1D1BA 3S3OA 2PVGB 3GIBA 3FJPA 4M77E 4OB3B 3M5AA 1B7TA 3TU4K 3CMEQ 2MF2A 3VUZA 1VQ9T 2R57A 5CQYA 2D8JA 1NEGA 3CD6T 3OYKA 3RNJA 4RTUA 4F7UB 4E2FB 2LRQA 3I35A 2CP5A 5FLXE 1M3AA 5I11A 2FB7A 1Q82U 2KBTA 4XU3A 4B9XA 1OI1A 1SEMA 1G8XA 1SPKA 1X43A 2PUKB 3VS7A 2D9TA 2DVJA 4LNPA 5CK9A 3G4ST 2JMAA 2VYTA 2C06A 2YXYA 2DIGA 3EHQA 3OYHA 3CCVT 2L5QA 5LJ3d 1XQHA 1SSFA 1WIEA 3QDFA 2ED0A 1IGQA 1PRMC 1I5OB 1YJWA 2FEIA 2DD4A 2QG9B 3EFOA 2P0QA 1YJ9A 1B3QA 1I0CA 4OB1B 3OW2A 5LJ5h 5FW9A 2DA9A 5AT1B 1KQSP 1K4US 4JZ4A 1VQ9Q 1W2BS 1NZ9A 2CH4A 1YJWQ 1VQ4Q 2FHDA 3CD6Q 2IIMA 2OJ2A 3JB9D 1WJSA 5CO7A 4C92E 2CZ7B 2EQJA 3UATA 3SFMA 2W10A 3NHNA 3TSZA 3KBGA 4N0AC 1RI9A 2EGEA 4RTYA 5KE2A 1AWJA 2P0PA 4X9DA 2KE9A 3EFRA 2JTFA 5GAMg 3G4SQ 2PQWA 1FMKA 3I55A 3NPFA 3L2QA 2VXFA 2K2MA 2CSIA 4HVVA 3FLGA 3CCJQ 4X1VA 4ZTJA 3CCRT 1FXXA 2AHJB 1UJYA 4CI0C 2K3BA 3M56A 3I5SA 3CC2Q 4FYVB 3CCRA 3VS6A 1WDXA 4NOYA 1W70A 2Y4XA 1X6GA 1OU8A 2OX7A 3CCMA 2DTIA 3V7CA 4B6MA 2JNGA 1YJWT 1VQ4T 3QO3A 2F2XA 3FJ5A 2M51A 5GANj 2L8DA 2CUDA 2ZPGB 1EX4A 5LJ5f 1G5VA 4C8QF 2LX7A 4KBMB 1YIJA 4M7AF 3CCMQ 1N5ZA 4BB7A 4EMKA 1K9AA 2JM8A 4JRIA 1I4K1 3A98A 1EIFA 1VQOA 2CP6A 2YUOA 4NL3A 2EKOA 3E9FA 1TWBA 2YT6A 5DY9A 1UGQB 1YIJT 3ULRB 2CYZB 1PRLC 2QI2A 4J5YA 1OX8A 1KC8U 1ZBJA 1NJIR 3CCJT 1KJWA 5LJ3f 5GANh 3CCRQ 3G71A 1U06A 3QKJA 1N8RU 2DEUA 2LNHB 4C8QG 1MV3A 1ZSZA 3MPUB 3M0RA 1GBQA 1K9MU 2DX1A 2DZ9A 5CCAA 2A08A 2H3EB 1KQSS 4E7ZA 3RUXA 3NMZC 4E7KA 4J9IA 3OYIA 2K3YA 2DKGA 3JCMX 3HFNA 1RLQC 2YLBA 1YJ9Q 3MEUA 3L2VA 1VQ5T 3ER0A 1Y96A 3JCMJ 1VQ7T 2R5MA 3QZ9B 4J6XA 2LZ6B 1R0BG 2RNAA 3VU3C 1VQPT 2K4YA 2OAWA 2XICA 4HKEA 2GTJA 3CCMT 1W4SA 2AZSA 2A28A 1WJRA 3V7RA 3DLLA 1GFDA 4AG1C 1HJDA 4M78C 2KR3A 3VKIA 1JB0E 3EG2A 1QCOA 2RH2A 1E7OA 5C0MA 3NTIA 2RPNA 3VS4A 3LH5A 4XTXA 5GANd 2CZ6B 5GMKj 5GAOr 1WGSA 2BE7D 4J9FA 3M0SA 2CP0A 3PNWC 4Z02A 2NUTA 1TUGB 1YI2A 3H41A 3RMSA 1K8AU 4HVUA 4AT1B 2K7AA 2V8KA 4J7IA 4XTWA 3HHTB 2CS7A 1RAHB 1BIBA 1I1JA 4MZPA 1XNIA 3C4SA 4CC7A 2HKNA 1GCQA 2K57A 1HXDA 5D6XA 1W2BP 2MWPA 3JV3A 1PD1A 2JT4A 1VQPQ 3NFCA 1DJ7B 2QTXA 3L2ZA 2K3XA 2V1QA 3PIOA 4PJMA 2E5QA 3SB2A 3I56Q 1WXBA 3RKWA 4AFSC 2VGMA 2QK0A 1TOVA 1YJNA 2YDLA 4WTOB 4PLLA 3CC2A 1VQMT 4FW2A 3MEVA 2P4TA 3C0CA 1QVFA 4IUPA 4EPCA 5EC7A 2EQKA 2FPFA 4XQ3A 4F16A 4CRIA 3EFOB 3RMQA 2A37A 2EAYA 2KXCA 1OYXA 2NUTB 4OMFB 5HK0A 5LJ3g 2PUOB 1ACMB 3UDCA 2EYZA 4BD3A 1D1CA 2D0NA 3M4GA 1RADB 1WI7A 1W2BA 4JLGA 4FYXB 3SHWA 2WSEE 4M7DA 2ZGWA 4FYWB 1KIKA 4J9HA 3RKXA 2LVMA 2PVOB 2RI5A 1ZX6A 2CKKA 1VQNQ 4M77A 3EH2A 2XMFA 4DBQA 4M75E 4X9CA 1F1BB 2HZYA 3MEWA 2IVWA 3LX7A 3THKA 3ZEHA 1ABOA 3I56T 3E19A 4C92F 1Q81U 2V8JA 2ROLA 2BKDN 4F7UF 4KH1B 1FMVA 4JJCA 4ANJA 2B8AA 1PG5B 5GAOq 3E2UA 5FRMA 1VQMQ 1RL2A 4QT7A 5GAMe 1A0NB 4DA4A 3JCMQ 3MP6A 4RMOA 3D7SB 3JCMP 3OA6A 2HKQB 1OPLA 3JB9H 5I21A 5GAN4 2MK5A 3CCUA 3M0UA 5FU7B 5GAMj 2GCXA 2KY9A 2ZPBB 3CBOA 3S3MA 5GAMf 1TTHB 3EG1A 3GNFB 1KD1U 1VQ6Q 2DYBA 1ARKA 1O75A 1WJQA 2XI9A 4DOWA 3REBB 4EMKB 4C5EA 1ZLMA 2BTTA 3M55A 5LL6S 4R0KA 3A8OB 4ELYC 3LWHA 5GMKh 2QA4Q 1U5SA 1MMAA 4C92A 2B86A 2HCKA 2GNCA 1QVGA 3TCJA 4BE2A 3LW5E 4BDYA 3JCMW 1B07A 1VYUA 1RAAB 4Q5WA 3RERA 4E7SA 2MYSA 2E3HA 2F69A 4LDWA 1M1FA 1OZ3A 2J6FA 4JRQA 2OTJT 4LDXA 4ZGDB 2HSEB 4BE0A 2O4XB 2FO0A 2MIOA 3G1JA 4JLIA 4RTVA 2L2PA 3GBQA 1Q82R 4E7LA 2PTKA 5J39A 3CCUT 1JEGA 1QVFP 3VV0A 2HL5C 2GGRA 1YFNA 3OSVA 4L5GA 1VQ6T 2L0AA 3AHUA 2RF0A 1N9SA 2MCNA 1M3BA 2EIFA 4HCKA 1ZUYA 2HBPA 1N27A 3L1AA 2HDAA 4M7AC 2MOXA 1WX6A 4C92B 4A4KA 1H92A 3FIFA 3OMGA 2KQWA 2O9VA 3M0TA 2DILA 4O6JA 4C0FA 4ATOA 4PJOA 2EPDA 2PVDB 5GANg 2FRYA 1TUCA 2OTJQ 2RJEA 1K0SA 2CH4W 2RJDA 4LDUA 2DERA 2O4XA 2KYMA 3CCEA 2RJCA 2HBWA 3PVLA 2MAMA 1C6VX 5LJ3j 1I81A 2YUNA 3SDZA 3JSCA 5LJ5e 4FT4A 5D6WA 4FIBA 2RD1A 3CEYA 2O2OA 1C0MA 2L89A 2Y4YA 3CCEQ 2P84A 4DOVA 3GPLA 2QQAA 1TS9A 1U8RA 1ABQA 2M0YA 1Q86C 4DBHA 3ASKA 3KUFA 3OW2P 2K6DA 3X28B 1KK7A 4PJOC 2KDSA 1QCFA 4LUEA 5KYWB 4Z88A 1M90U 4MDWA 2H8HA 1UGPB 1YWOA 1OZ2A 4M7AA 2HSPA 2X9HA 1M1KU 1Y57A 4R55A 3EFSA 1K9MR 4QQGA 2VV5A 5FWCA 1I8FA 1PKTA 4A4EA 5J3BA 4M7DG 2CT4A 5GAOn 4R56A 2CZ1B 1UB4A 4JRKA 2DL4A 1S72A 5FU6B 4BI4A 1RACB 4BACA 1H3HA 2DVEA 1G3WA 2RHIA 4A63B 1AT1B 4HVWA 2P4RA 2E64A 5CAIA 1K73U 2KRNA 2RMOA 4ZTFA 1WQ7A 2DRKA 2GTOA 3CCET 1UECA 4XTYA 2QTVA 1LPLA 3NTKA 5KE3A 1K0XA 4IKFA 1RABB 1MMNA 5KCHA 2V1RA 4KH0B 3SEMA 4ZGJB 1G83A 4M7AE 2YUPA 4GY5A 5GMKe 3BY7A 1M90R 2QGGA 1YJNQ 4M77D 1E6GA 3CCQQ 3GOXA 1VQ5A 4OB0B 2KRMA 2VASA 3A5ZB 2KT8A 3SWNB 1WLPB 4XTUA 1YITQ 2JOYA 2QEXA 1M4ZA 4WF2A 3OYFA 2EGCA 3CC7T 1AWWA 1IGUA 3TQ7P 3MP8A 5GANe 3J7AF 3LLRA 2K5FA 4M75F 4EDUA 1Z9QA 3GNGA 2OI3A 2MMPA 2J7IA 5DLOA 4C5HA 1IO6A 1JQQA 2GFAA 2GF7A 3VS0A 2EGAA 1PSFA 3DB3A 2LMJA 3EG9B 1CKBA 4OMOA
chains in the Genus database with same CATH topology
1YI2Q 1YHQQ 3CCMQ 1YJWQ 1VQ4Q 1VQNQ 3CPWP 1NJIR 3CD6Q 3CCUQ 1KD1R 2OTJQ 3CCSQ 1Q81R 1K8AR 1M90R 3CCRQ 1YJNQ 3G4SQ 3CCQQ 3I56Q 1YIJQ 1Q7YR 1K9MR 1VQOQ 3CC7Q 1QVGP 1Q86R 3CMAQ 1Q82R 1K73R 1VQ8Q 1VQLQ 1S72Q 1VQ6Q 3CMEQ 1W2BP 3G71Q 1VQ5Q 2QEXQ 3OW2P 3CC4Q 1VQ7Q 2OTLQ 3CCEQ 3CXCP 1N8RR 3CCVQ 1VQPQ 3CCJQ 1YITQ 1VQKQ 1QVFP 3G6EQ 1KC8R 1YJ9Q 1JJ2P 1M1KR 1KQSP 3I55Q 1VQMQ 3CC2Q 1VQ9Q 2QA4Q 3CCLQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 Q;  1YHQ Q;  3CCM Q;  1YJW Q;  1VQ4 Q;  1VQN Q;  3CPW P;  1NJI R;  3CD6 Q;  3CCU Q;  1KD1 R;  2OTJ Q;  3CCS Q;  1Q81 R;  1K8A R;  1M90 R;  3CCR Q;  1YJN Q;  3G4S Q;  3CCQ Q;  3I56 Q;  1YIJ Q;  1Q7Y R;  1K9M R;  1VQO Q;  3CC7 Q;  1QVG P;  1Q86 R;  3CMA Q;  1Q82 R;  1K73 R;  1VQ8 Q;  1VQL Q;  1S72 Q;  1VQ6 Q;  3CME Q;  1W2B P;  3G71 Q;  1VQ5 Q;  2QEX Q;  3OW2 P;  3CC4 Q;  1VQ7 Q;  2OTL Q;  3CCE Q;  3CXC P;  1N8R R;  3CCV Q;  1VQP Q;  3CCJ Q;  1YIT Q;  1VQK Q;  1QVF P;  3G6E Q;  1KC8 R;  1YJ9 Q;  1JJ2 P;  1M1K R;  1KQS P;  3I55 Q;  1VQM Q;  3CC2 Q;  1VQ9 Q;  2QA4 Q;  3CCL Q; 
#chains in the Genus database with same CATH topology
 3LYI A;  3FB9 A;  3OYB A;  3C94 A;  1TSF A;  1BI0 A;  1EZZ B;  3CPW A;  1BCO A;  3VRZ A;  5A0L A;  2JM9 A;  2FZK B;  1I07 A;  3OSS C;  1OV3 A;  2CGH A;  3CD6 A;  4DEX A;  3CCQ T;  2X4X A;  1QVG S;  1G2B A;  4BDZ A;  1JJ2 P;  2ZPH B;  1WQW A;  4KGV B;  1WHM A;  4M75 A;  4CC4 B;  2XID A;  3PVQ A;  2P0K A;  4LE9 A;  4HCZ A;  2LCC A;  3CCV A;  2COW A;  1KD1 R;  3RIR A;  4JS5 A;  2M9U A;  1VOM A;  4JDS A;  3SWN C;  2RK2 A;  1WHK A;  2PU9 B;  3HP9 A;  4BI3 A;  3MET A;  4EMH A;  2DL5 A;  3JCM c;  3PTA A;  2O01 E;  3M59 A;  4M77 C;  3OS2 A;  3G71 Q;  4J9E A;  2KK4 A;  1N8R R;  4UC4 A;  1Q95 G;  1I5L A;  4OMN A;  1ZHI A;  2X35 A;  1WHL A;  4CC3 A;  2A36 A;  2FL7 A;  1UGV A;  2DBM A;  4E47 A;  3HTR A;  3CCL Q;  5CR2 A;  2LTO A;  2PNI A;  1OQK A;  1Y7X A;  1G3T A;  4FL6 A;  5KH6 A;  2XHC A;  4RG8 A;  1BU1 A;  5GAN 6;  3E9G A;  1Q81 C;  1K73 C;  4HA8 A;  3H0H A;  4LD9 K;  3EGU A;  3JCM h;  5C6S A;  4EMK C;  4DBF A;  4PK4 A;  5IHN A;  3KFV A;  4QQ6 A;  2LJ3 A;  3A8M B;  1R0C B;  3UA7 A;  3JCM d;  3FRN A;  2CDT A;  2KSS A;  2RHX A;  1X01 A;  1D0Y A;  1D0Z A;  4OML A;  5GAM d;  2WSF E;  2ESW A;  3QWX X;  1M30 A;  3M0Q A;  2RQW A;  2KI7 A;  1YHQ T;  4A4G A;  4M78 F;  4OGE A;  3EGX B;  3FEO A;  4XU0 A;  4HCB A;  4KRT A;  1BBZ A;  2RQV A;  1K8A R;  3RES A;  2DTO A;  1Q7Y R;  2JTM A;  2BE9 B;  2LC4 A;  3OYY A;  4J9C A;  3QBY A;  5HCK A;  3RDV A;  5FRO A;  2HNI A;  4MML A;  2AT1 B;  2A0F B;  3C95 A;  1KQ2 A;  4D6W A;  1RAI B;  5CKF A;  2D0Q B;  3OBW A;  3H0F A;  5GAN f;  3J81 E;  3O5Z A;  4KUD K;  2L3P A;  2EFI A;  2NUZ A;  2E6Z A;  2ZZD A;  4AFQ C;  2DET A;  3VS2 A;  2KMT A;  1PWT A;  4HXJ A;  4M7D C;  4HT9 A;  4F7U A;  4PNO A;  3CXC P;  2A3L A;  4C0D C;  3QUI A;  4F7U G;  4HT8 A;  2D1X A;  2QAZ A;  2DEQ A;  4Z8A A;  5CVI A;  5KYU A;  2AKL A;  3EHR A;  2EYY A;  1YHQ Q;  1NE8 A;  5LJ5 j;  1MMG A;  5IN1 A;  4PFZ A;  2VUB A;  5GAN 5;  1QCN A;  1H64 1;  4P5N A;  1HK9 A;  3ZBD A;  4KGZ B;  3OS0 A;  1FMW A;  4EMG A;  2EYW A;  5FWB A;  2EVR A;  2PZ1 A;  2KGT A;  1VQ4 A;  3CMA T;  4O5V A;  1M1K R;  2DL8 A;  1UUE A;  4KUL A;  1BKB A;  2RHZ A;  2X3W D;  2ZAE A;  5J26 A;  3R6N A;  1VQP A;  2ECZ A;  1H3Z A;  2K79 A;  2XDD A;  3QJ6 A;  1GBR A;  5M9O A;  4RCC A;  2ATC B;  4BE1 A;  3BE3 A;  3G6E Q;  1X6O A;  3OS5 A;  3OYC A;  4KGX B;  6AT1 B;  2LCL A;  1XTD A;  2CSQ A;  2JW4 A;  1K1Z A;  4X34 A;  1WA7 A;  2HQH A;  2V8I A;  3ME9 A;  3U23 A;  4ZN1 A;  1VQM A;  3JCM V;  1MV0 B;  4CC2 A;  2E70 A;  3S6W A;  4E7H A;  2LDM A;  2G3R A;  1ZUU A;  1VIE A;  1MMD A;  4M78 G;  2CP3 A;  2QQB A;  2JUF A;  3C12 A;  3QZ5 B;  1Y71 A;  5CIU A;  1QKW A;  2GQI A;  4M78 B;  1P92 A;  1PHT A;  3CPF A;  1X75 C;  2DTH A;  4JJN K;  2RM4 A;  3SD4 A;  1WPY A;  5FU6 C;  4K11 A;  2JMC A;  2OTL T;  2JS2 A;  4V2S A;  1XOV A;  4LXC A;  2EYQ A;  4OP0 A;  1NYF A;  1RUW A;  2RB6 A;  3HRT A;  5DM7 R;  2F5K A;  2OTL A;  1HSQ A;  3P8D A;  2V26 A;  3JCM e;  2X51 A;  4JS4 A;  4PJO D;  2LQN A;  2QXF A;  4XU2 A;  2YUQ A;  1GFC A;  2E3I A;  3G6E T;  1MUZ A;  2SEM A;  4GBQ A;  3VS5 A;  3AT1 B;  4EIK A;  3OYG A;  1UGR B;  1QMC A;  2JVV A;  3TRE A;  1SHF A;  2GFU A;  4E7J A;  3EGD A;  1AVZ C;  4RTT A;  5ECA A;  2EWN A;  3DKM A;  1NJI U;  1J3T A;  4VUB A;  4FM4 B;  2DE0 X;  3PT9 A;  1KG1 A;  4M78 E;  2ZPE B;  2G6F X;  3FDR A;  3OYJ A;  1V1C A;  1GL5 A;  1AZE A;  3H0I A;  3MEA A;  2QQ9 A;  3M9Q A;  4J83 A;  5GMK m;  2DL7 A;  2J6K A;  2DXT A;  4FT2 A;  5KYY A;  2OTL Q;  3HPW A;  2ZPI B;  3CCV Q;  3H9N A;  3VUB A;  5KYN A;  1X6B A;  1RAE B;  5D7U A;  4JJB A;  4FCY A;  2DYI A;  4ELZ C;  2O31 A;  3VS1 A;  9ATC B;  4E6R A;  2QGF B;  3DB4 A;  3I9Q A;  3M57 A;  1E6H A;  1Q7Y C;  1HD3 A;  1WXT A;  3OY9 A;  3QWY A;  1IRE B;  1QP2 A;  1X69 A;  1GCP A;  3CCQ A;  2BZ8 A;  2EQU A;  1VQ5 Q;  5CQX A;  3TVT A;  1VQ7 Q;  4M7D F;  5GAO p;  1LOJ A;  3LH0 A;  1YP5 A;  2I2L A;  2EQI A;  3MO8 A;  2NLU A;  2YRC A;  5EG2 A;  1LVK A;  1AEY A;  1CSK A;  4J9B A;  2LT4 A;  3OB9 A;  4C0Z A;  1VQL A;  1Z9Z A;  1GRI A;  4OB2 B;  5A0G A;  1KQ1 A;  3G4S A;  2NUP A;  3BW1 A;  1WZO A;  2L3Q A;  2JXB A;  1QKX A;  2BZY A;  3V7S A;  2M1H A;  1KC8 R;  1O9S A;  1NG2 A;  5KYY B;  2O88 A;  1NLP C;  1YHQ A;  4MZT A;  4NL2 A;  3BDL A;  1AWO A;  4M7A G;  4D8K A;  3CC2 T;  5GAO m;  4L59 A;  3VRY A;  4RKU E;  3UPU A;  3EG0 A;  3QHS A;  2AK5 A;  1T0H A;  1N8R C;  3OYN A;  5L23 A;  2CT3 A;  2KVQ G;  4M7D E;  4M78 D;  1SRL A;  3Q1J A;  2EBP A;  2HD0 A;  2LNV A;  4A4F A;  3MKD A;  1JRI A;  2RO0 A;  2J05 A;  3M4Y A;  1RI0 A;  4BUG A;  4RTW A;  4M4Z A;  3V8K A;  3I55 T;  3WVE B;  4OMQ A;  1UFF A;  2E12 A;  5A2Q E;  1B34 A;  1WHG A;  1M8M A;  4Y92 A;  4PFP A;  1QVF S;  4C8Q D;  2LQK A;  1YNZ A;  3RKY A;  1T0J A;  2FPE A;  3OW2 S;  2HMA A;  1YCS B;  2LJ0 A;  3UA6 A;  2KT1 A;  4PJO B;  1BK2 A;  1YIJ Q;  2Z0W A;  2YHT A;  4WCI A;  3CBP A;  2EKH A;  3H6Z A;  5AYF A;  1M9S A;  1ZSG A;  2QQS A;  4NS5 A;  4PJO G;  1YN8 A;  4PKC C;  2F1L A;  2OTJ A;  1BIA A;  2LQW A;  1KFZ A;  2KYB A;  4A53 A;  5GMK l;  5GJW B;  3HSB A;  2DIQ A;  2DXB A;  2FZG B;  2RI3 A;  1KHI A;  3QPH A;  2X3X D;  1BI2 A;  1UG1 A;  1D3B B;  1Q81 R;  1WFW A;  2R5A A;  2XU8 A;  1YJ9 T;  5GAN 2;  2DZC A;  2EW3 A;  4M7D B;  2YRV A;  3IQL A;  3JB9 F;  3EG3 A;  2HQX A;  3HRU A;  1OU9 A;  2ROT A;  1VQN T;  2E41 A;  1RLP C;  1N9R A;  5I2S A;  3I55 Q;  4J9D A;  2YSQ A;  4AFZ C;  3V8J A;  2DJZ A;  4C92 C;  1QQJ A;  3RBB B;  2COY A;  1VIF A;  2CUB A;  2RQT A;  1D0X A;  3JRZ A;  4F7U E;  1ZBX A;  3CPW S;  3OQ5 A;  2DJQ A;  2LQ8 A;  2W0Z A;  4RCB A;  2J06 A;  4M7A B;  1BI3 A;  1AD5 A;  1X27 A;  1V76 A;  1WHJ A;  4M77 F;  2DRM A;  3G7Z A;  4LUD A;  3GP8 A;  3HKS A;  2RI2 A;  1S1N A;  2HEQ A;  2DD5 A;  3S3N A;  4IUQ A;  3PMI A;  2K9G A;  3PMT A;  1JU5 C;  1KD1 C;  2EYX A;  3TSW A;  2AZV A;  4QVZ A;  5HKC A;  2BUD A;  1Y0M A;  1D3B A;  2JTE A;  3A8G B;  5KCO A;  1QLY A;  4IUV A;  1NM7 A;  1KQS A;  1SHG A;  3KXT A;  4AMC A;  3VJP A;  3VS3 A;  2E10 A;  2NWM A;  2QQR A;  1UGS B;  4TVR A;  4PFO A;  3LWI A;  2M16 A;  3M54 A;  3EGD B;  3QG1 A;  3UT1 A;  5LJ3 e;  1CKA A;  1ZSZ C;  1ZA1 B;  1SRM A;  4M7A D;  2RK1 A;  2LP5 A;  3SWN A;  1NLO C;  1KC8 C;  2LJ1 A;  4Y28 E;  3WXM B;  4PJO E;  3JCM b;  1MNE A;  2DXU A;  2GBQ A;  1OEB A;  4ZGE B;  4J6Y A;  4J7F A;  5CKB A;  3CME A;  1JJ2 A;  1SG5 A;  4KT0 E;  3OYL A;  2DM1 A;  1IHV A;  3CXC S;  1JXM A;  2FG0 A;  1PCX A;  1UEB A;  4ORZ A;  5GAM h;  3UWN A;  7AT1 B;  4QKU A;  4FYY B;  2QYZ A;  2MI6 A;  5GAN 8;  2RQU A;  2C0T A;  4LD6 A;  4M77 B;  5KYX B;  3JCM g;  1HYO A;  2KRO A;  1JXO A;  1PSE A;  1IB8 A;  3A8H B;  1QW1 A;  1FWZ A;  2JN0 A;  4RTX A;  2XG8 D;  1IRX A;  4PL6 A;  3OMC A;  3H8Z A;  1UHF A;  2BZX A;  3JB9 I;  5I22 A;  3JAM E;  1TU0 B;  4DQ2 A;  4QVD A;  1IXD A;  2H3J A;  1YBY A;  2K5L A;  3QDR B;  1K9M C;  1K73 R;  2DL3 A;  4RUG A;  3DLM A;  2MPX C;  2E4H A;  1TH7 A;  5CKE A;  1SKU B;  4IUT A;  1JO8 A;  4IIM A;  1TG0 A;  2C0I A;  4C0G A;  4ZNX A;  1ZSZ B;  4BY6 B;  3CQT A;  3PFS A;  2GQV A;  1C1A A;  3CCS A;  1VQ9 A;  1AOJ A;  1MGQ A;  5I2M A;  2QDL A;  1M2V B;  1Y07 A;  4C5I A;  3OYE A;  5IHI A;  1Y96 B;  3LGF A;  3X24 B;  3GLX A;  4L6V 5;  4PJO F;  1W1F A;  5KYX A;  2WSC E;  2DO3 A;  5GAO l;  3M53 A;  4XAX B;  3O8V A;  4C8Q E;  2XKO C;  2EQM A;  2F2V A;  2E6N A;  2F5T X;  5IT9 E;  1VQ7 A;  4J9G A;  1NEB A;  1B34 B;  1RAF B;  2E5K A;  2QA4 T;  2M02 A;  2VVK A;  3INZ A;  3CC4 Q;  4IUR A;  4C8Q C;  4F04 B;  2CZ0 B;  3M0P A;  1ZQ1 A;  5GJV B;  2CP2 A;  3FC3 A;  4OGC A;  4FSX A;  5D6Y A;  1M2O A;  1U1T A;  2QEX T;  1T3S A;  2RA2 A;  3VYG A;  3JB9 J;  4ESR A;  2HQE A;  2HAX A;  2DPP B;  3LGL A;  2ZCF B;  3A8L B;  4OVA A;  1LJO A;  3QJY A;  3ZFJ A;  1M2V A;  1QVP A;  2R58 A;  3CC7 A;  4C92 G;  1VYT A;  2CRE A;  3OYA A;  1ZUK A;  2E1H A;  2VXE A;  1IZ6 A;  2E65 A;  3CCU Q;  4M7D D;  4XU1 A;  2BIV A;  3X26 B;  1BYM A;  2XK0 A;  4ZN3 A;  1YIT A;  2L3S A;  1VUB A;  3JCM f;  4BI8 B;  1WNL A;  4M75 G;  3L2U A;  4OMM A;  3CC4 T;  1M1K C;  4MZM A;  1UTI A;  4RG2 A;  4F14 A;  2ABL A;  4C8Q B;  2KXD A;  3BFM A;  1MND A;  3L42 A;  5CKH A;  3TEE A;  1D09 B;  3PIP A;  1ZA2 B;  1YIT T;  3GF5 A;  1N6A A;  2KRS A;  2M0O A;  1R77 A;  2RJF A;  1M90 C;  2XDB A;  2QEX Q;  4YTL A;  2YLC A;  5GAN 3;  5L8R E;  4M77 G;  2LCS A;  1KHC A;  3CC4 A;  2JS0 A;  1BB9 A;  5IAY A;  2JJ9 A;  5IHK A;  1VQ6 A;  3EAE A;  4F17 A;  2DFU A;  2YRD A;  1UHC A;  1M27 C;  2D6F A;  3OYM A;  4E7I A;  4DBR A;  2CP7 A;  2VB6 A;  3QYH B;  5LJ5 d;  3PGG A;  2QAS A;  3EH1 A;  4DEY A;  2K5I A;  3EG9 A;  3R6O A;  3HFO A;  1V29 B;  4QW2 A;  5CKD A;  3CCS T;  4RTZ A;  2O9S A;  2FZC B;  4D8D A;  4GLK A;  2F2W A;  4N4I A;  4JJD A;  3REA B;  5IXB A;  1AZG B;  2FPD A;  5GMK i;  3OBY A;  2IG0 A;  3N5B B;  1AWX A;  3RR6 A;  4C0D B;  5KYW A;  2MWO A;  1YWP A;  2I0N A;  1M5Q 1;  4MDX A;  2X4Y A;  2RN8 A;  1VQ8 Q;  2J6O A;  4LDY A;  1GXI E;  1BI1 A;  4OF1 A;  4M75 B;  1K76 A;  1VQN A;  2Y90 A;  2DMO A;  4PJL A;  2FVU A;  1MHN A;  2DBK A;  1LNX A;  2FRW A;  3G71 T;  2DLP A;  2KNB B;  3PE0 A;  4XK8 E;  1UDL A;  2ENM A;  3J80 E;  1QVG P;  1Q86 R;  1T3L A;  2K2V A;  1VQK A;  1BCM A;  3CCL T;  1VA7 A;  4B9W A;  5GAN 7;  3OYD A;  2KEA A;  1VYV A;  3E1S A;  1M8V A;  2DF6 A;  3URG A;  2DNU A;  3BDU A;  4FSS A;  4ME7 A;  2X4J A;  3CCS Q;  3MHX A;  1TXQ A;  1FX7 A;  4MMK A;  4JPB W;  1VQK T;  1NPP A;  1SF9 A;  1D1A A;  3CMA A;  2VKN A;  3NTH A;  1PM3 A;  3CXC A;  1YJN T;  2LT1 A;  1QP3 A;  2ED1 A;  3MJX A;  4IIO A;  2XD0 A;  1VQ8 T;  3VYH B;  1Q7Y U;  1S72 T;  1GCQ C;  3OS1 A;  1W6X A;  3HRS A;  3X25 B;  4AFU C;  4A4H A;  4C92 D;  8ATC B;  2IPO B;  3CC7 Q;  3EGX A;  8AT1 B;  4OMP A;  1Q82 C;  3P8B B;  2VWF A;  4N0A A;  4KUI A;  3M58 A;  4JRP A;  5LJ5 g;  2HL3 A;  1R8O B;  1UJ0 A;  2EJG A;  4LDV A;  1X2Q A;  4GLM A;  4LN2 A;  4QVC A;  3CCJ A;  1WXU A;  2WAC A;  2VC8 A;  1JJ2 S;  1NPR A;  4M75 D;  2VGN A;  1NJI C;  2RHU A;  4QQD A;  3V8L A;  4N4G A;  1FYN A;  3CCL A;  1VQK Q;  2SRC A;  1OPK A;  1WYX A;  1VQO T;  1VQL T;  5FU7 C;  1G3S A;  1YI2 Q;  2L3R A;  4JUV A;  4PLI A;  1U1S A;  3CBM A;  1KSW A;  1M3C A;  1M1G A;  2LX9 A;  1OX9 A;  1S72 Q;  1OUL A;  1PKS A;  3P8H A;  1YCY A;  3NGP A;  3QXE B;  5KYU B;  1JBM A;  1UE9 A;  2DK3 A;  4N4H A;  3JB9 G;  4FU6 A;  2NUP B;  1PD0 A;  4HCC A;  3L2W A;  4FW1 A;  2KAF A;  4II1 A;  1G3Y A;  1QWF A;  2AIR B;  3CMA Q;  2NYS A;  4JZ3 A;  1XJW B;  3MP1 A;  2D8H A;  1AHJ B;  5HK3 A;  1IHW A;  2X4W A;  4M75 C;  2COZ A;  3QII A;  3WVD B;  4C5G A;  5HY6 A;  4AG2 C;  1OOT A;  3QYG B;  1PNJ A;  3MCA B;  3L2R A;  1QWE A;  3CME T;  1NYG A;  2EJ9 A;  1K8A C;  3UF4 A;  1PC0 A;  4PJJ A;  1WHH A;  3HL8 A;  3I56 A;  1VQO Q;  2C0O A;  3I5R A;  2ZPF B;  5LJ3 h;  3X20 B;  1VQL Q;  1H8K A;  1X2K A;  4PJN A;  1YI2 T;  2JZ2 A;  2FYK A;  1U3O A;  4Y91 A;  5IXF A;  5IH2 A;  2DXC A;  4C8Q A;  5A0D A;  4XTV A;  2OAU A;  2AKK A;  3G6E A;  4J8O A;  3QSU A;  3T9N A;  2A7Y A;  4A54 A;  3CPW P;  3ZL7 C;  1TUD A;  4IUU A;  5DLQ E;  2DAQ A;  2QA4 A;  4XTZ A;  1EFN A;  1VQ8 A;  4M78 A;  2RQR A;  2YWW A;  3F70 A;  1NBE B;  2QDY B;  4J6W A;  2RHY A;  1SSH A;  2EJF A;  5FRN A;  1LCK A;  3A1P A;  4Z89 A;  4BY6 C;  1RAG B;  2XDP A;  1Q86 U;  1D1B A;  3S3O A;  2PVG B;  3GIB A;  3FJP A;  4M77 E;  4OB3 B;  3M5A A;  1B7T A;  3TU4 K;  3CME Q;  2MF2 A;  3VUZ A;  1VQ9 T;  2R57 A;  5CQY A;  2D8J A;  1NEG A;  3CD6 T;  3OYK A;  3RNJ A;  4RTU A;  4F7U B;  4E2F B;  2LRQ A;  3I35 A;  2CP5 A;  5FLX E;  1M3A A;  5I11 A;  2FB7 A;  1Q82 U;  2KBT A;  4XU3 A;  4B9X A;  1OI1 A;  1SEM A;  1G8X A;  1SPK A;  1X43 A;  2PUK B;  3VS7 A;  2D9T A;  2DVJ A;  4LNP A;  5CK9 A;  3G4S T;  2JMA A;  2VYT A;  2C06 A;  2YXY A;  2DIG A;  3EHQ A;  3OYH A;  3CCV T;  2L5Q A;  5LJ3 d;  1XQH A;  1SSF A;  1WIE A;  3QDF A;  2ED0 A;  1IGQ A;  1PRM C;  1I5O B;  1YJW A;  2FEI A;  2DD4 A;  2QG9 B;  3EFO A;  2P0Q A;  1YJ9 A;  1B3Q A;  1I0C A;  4OB1 B;  3OW2 A;  5LJ5 h;  5FW9 A;  2DA9 A;  5AT1 B;  1KQS P;  1K4U S;  4JZ4 A;  1VQ9 Q;  1W2B S;  1NZ9 A;  2CH4 A;  1YJW Q;  1VQ4 Q;  2FHD A;  3CD6 Q;  2IIM A;  2OJ2 A;  3JB9 D;  1WJS A;  5CO7 A;  4C92 E;  2CZ7 B;  2EQJ A;  3UAT A;  3SFM A;  2W10 A;  3NHN A;  3TSZ A;  3KBG A;  4N0A C;  1RI9 A;  2EGE A;  4RTY A;  5KE2 A;  1AWJ A;  2P0P A;  4X9D A;  2KE9 A;  3EFR A;  2JTF A;  5GAM g;  3G4S Q;  2PQW A;  1FMK A;  3I55 A;  3NPF A;  3L2Q A;  2VXF A;  2K2M A;  2CSI A;  4HVV A;  3FLG A;  3CCJ Q;  4X1V A;  4ZTJ A;  3CCR T;  1FXX A;  2AHJ B;  1UJY A;  4CI0 C;  2K3B A;  3M56 A;  3I5S A;  3CC2 Q;  4FYV B;  3CCR A;  3VS6 A;  1WDX A;  4NOY A;  1W70 A;  2Y4X A;  1X6G A;  1OU8 A;  2OX7 A;  3CCM A;  2DTI A;  3V7C A;  4B6M A;  2JNG A;  1YJW T;  1VQ4 T;  3QO3 A;  2F2X A;  3FJ5 A;  2M51 A;  5GAN j;  2L8D A;  2CUD A;  2ZPG B;  1EX4 A;  5LJ5 f;  1G5V A;  4C8Q F;  2LX7 A;  4KBM B;  1YIJ A;  4M7A F;  3CCM Q;  1N5Z A;  4BB7 A;  4EMK A;  1K9A A;  2JM8 A;  4JRI A;  1I4K 1;  3A98 A;  1EIF A;  1VQO A;  2CP6 A;  2YUO A;  4NL3 A;  2EKO A;  3E9F A;  1TWB A;  2YT6 A;  5DY9 A;  1UGQ B;  1YIJ T;  3ULR B;  2CYZ B;  1PRL C;  2QI2 A;  4J5Y A;  1OX8 A;  1KC8 U;  1ZBJ A;  1NJI R;  3CCJ T;  1KJW A;  5LJ3 f;  5GAN h;  3CCR Q;  3G71 A;  1U06 A;  3QKJ A;  1N8R U;  2DEU A;  2LNH B;  4C8Q G;  1MV3 A;  1ZSZ A;  3MPU B;  3M0R A;  1GBQ A;  1K9M U;  2DX1 A;  2DZ9 A;  5CCA A;  2A08 A;  2H3E B;  1KQS S;  4E7Z A;  3RUX A;  3NMZ C;  4E7K A;  4J9I A;  3OYI A;  2K3Y A;  2DKG A;  3JCM X;  3HFN A;  1RLQ C;  2YLB A;  1YJ9 Q;  3MEU A;  3L2V A;  1VQ5 T;  3ER0 A;  1Y96 A;  3JCM J;  1VQ7 T;  2R5M A;  3QZ9 B;  4J6X A;  2LZ6 B;  1R0B G;  2RNA A;  3VU3 C;  1VQP T;  2K4Y A;  2OAW A;  2XIC A;  4HKE A;  2GTJ A;  3CCM T;  1W4S A;  2AZS A;  2A28 A;  1WJR A;  3V7R A;  3DLL A;  1GFD A;  4AG1 C;  1HJD A;  4M78 C;  2KR3 A;  3VKI A;  1JB0 E;  3EG2 A;  1QCO A;  2RH2 A;  1E7O A;  5C0M A;  3NTI A;  2RPN A;  3VS4 A;  3LH5 A;  4XTX A;  5GAN d;  2CZ6 B;  5GMK j;  5GAO r;  1WGS A;  2BE7 D;  4J9F A;  3M0S A;  2CP0 A;  3PNW C;  4Z02 A;  2NUT A;  1TUG B;  1YI2 A;  3H41 A;  3RMS A;  1K8A U;  4HVU A;  4AT1 B;  2K7A A;  2V8K A;  4J7I A;  4XTW A;  3HHT B;  2CS7 A;  1RAH B;  1BIB A;  1I1J A;  4MZP A;  1XNI A;  3C4S A;  4CC7 A;  2HKN A;  1GCQ A;  2K57 A;  1HXD A;  5D6X A;  1W2B P;  2MWP A;  3JV3 A;  1PD1 A;  2JT4 A;  1VQP Q;  3NFC A;  1DJ7 B;  2QTX A;  3L2Z A;  2K3X A;  2V1Q A;  3PIO A;  4PJM A;  2E5Q A;  3SB2 A;  3I56 Q;  1WXB A;  3RKW A;  4AFS C;  2VGM A;  2QK0 A;  1TOV A;  1YJN A;  2YDL A;  4WTO B;  4PLL A;  3CC2 A;  1VQM T;  4FW2 A;  3MEV A;  2P4T A;  3C0C A;  1QVF A;  4IUP A;  4EPC A;  5EC7 A;  2EQK A;  2FPF A;  4XQ3 A;  4F16 A;  4CRI A;  3EFO B;  3RMQ A;  2A37 A;  2EAY A;  2KXC A;  1OYX A;  2NUT B;  4OMF B;  5HK0 A;  5LJ3 g;  2PUO B;  1ACM B;  3UDC A;  2EYZ A;  4BD3 A;  1D1C A;  2D0N A;  3M4G A;  1RAD B;  1WI7 A;  1W2B A;  4JLG A;  4FYX B;  3SHW A;  2WSE E;  4M7D A;  2ZGW A;  4FYW B;  1KIK A;  4J9H A;  3RKX A;  2LVM A;  2PVO B;  2RI5 A;  1ZX6 A;  2CKK A;  1VQN Q;  4M77 A;  3EH2 A;  2XMF A;  4DBQ A;  4M75 E;  4X9C A;  1F1B B;  2HZY A;  3MEW A;  2IVW A;  3LX7 A;  3THK A;  3ZEH A;  1ABO A;  3I56 T;  3E19 A;  4C92 F;  1Q81 U;  2V8J A;  2ROL A;  2BKD N;  4F7U F;  4KH1 B;  1FMV A;  4JJC A;  4ANJ A;  2B8A A;  1PG5 B;  5GAO q;  3E2U A;  5FRM A;  1VQM Q;  1RL2 A;  4QT7 A;  5GAM e;  1A0N B;  4DA4 A;  3JCM Q;  3MP6 A;  4RMO A;  3D7S B;  3JCM P;  3OA6 A;  2HKQ B;  1OPL A;  3JB9 H;  5I21 A;  5GAN 4;  2MK5 A;  3CCU A;  3M0U A;  5FU7 B;  5GAM j;  2GCX A;  2KY9 A;  2ZPB B;  3CBO A;  3S3M A;  5GAM f;  1TTH B;  3EG1 A;  3GNF B;  1KD1 U;  1VQ6 Q;  2DYB A;  1ARK A;  1O75 A;  1WJQ A;  2XI9 A;  4DOW A;  3REB B;  4EMK B;  4C5E A;  1ZLM A;  2BTT A;  3M55 A;  5LL6 S;  4R0K A;  3A8O B;  4ELY C;  3LWH A;  5GMK h;  2QA4 Q;  1U5S A;  1MMA A;  4C92 A;  2B86 A;  2HCK A;  2GNC A;  1QVG A;  3TCJ A;  4BE2 A;  3LW5 E;  4BDY A;  3JCM W;  1B07 A;  1VYU A;  1RAA B;  4Q5W A;  3RER A;  4E7S A;  2MYS A;  2E3H A;  2F69 A;  4LDW A;  1M1F A;  1OZ3 A;  2J6F A;  4JRQ A;  2OTJ T;  4LDX A;  4ZGD B;  2HSE B;  4BE0 A;  2O4X B;  2FO0 A;  2MIO A;  3G1J A;  4JLI A;  4RTV A;  2L2P A;  3GBQ A;  1Q82 R;  4E7L A;  2PTK A;  5J39 A;  3CCU T;  1JEG A;  1QVF P;  3VV0 A;  2HL5 C;  2GGR A;  1YFN A;  3OSV A;  4L5G A;  1VQ6 T;  2L0A A;  3AHU A;  2RF0 A;  1N9S A;  2MCN A;  1M3B A;  2EIF A;  4HCK A;  1ZUY A;  2HBP A;  1N27 A;  3L1A A;  2HDA A;  4M7A C;  2MOX A;  1WX6 A;  4C92 B;  4A4K A;  1H92 A;  3FIF A;  3OMG A;  2KQW A;  2O9V A;  3M0T A;  2DIL A;  4O6J A;  4C0F A;  4ATO A;  4PJO A;  2EPD A;  2PVD B;  5GAN g;  2FRY A;  1TUC A;  2OTJ Q;  2RJE A;  1K0S A;  2CH4 W;  2RJD A;  4LDU A;  2DER A;  2O4X A;  2KYM A;  3CCE A;  2RJC A;  2HBW A;  3PVL A;  2MAM A;  1C6V X;  5LJ3 j;  1I81 A;  2YUN A;  3SDZ A;  3JSC A;  5LJ5 e;  4FT4 A;  5D6W A;  4FIB A;  2RD1 A;  3CEY A;  2O2O A;  1C0M A;  2L89 A;  2Y4Y A;  3CCE Q;  2P84 A;  4DOV A;  3GPL A;  2QQA A;  1TS9 A;  1U8R A;  1ABQ A;  2M0Y A;  1Q86 C;  4DBH A;  3ASK A;  3KUF A;  3OW2 P;  2K6D A;  3X28 B;  1KK7 A;  4PJO C;  2KDS A;  1QCF A;  4LUE A;  5KYW B;  4Z88 A;  1M90 U;  4MDW A;  2H8H A;  1UGP B;  1YWO A;  1OZ2 A;  4M7A A;  2HSP A;  2X9H A;  1M1K U;  1Y57 A;  4R55 A;  3EFS A;  1K9M R;  4QQG A;  2VV5 A;  5FWC A;  1I8F A;  1PKT A;  4A4E A;  5J3B A;  4M7D G;  2CT4 A;  5GAO n;  4R56 A;  2CZ1 B;  1UB4 A;  4JRK A;  2DL4 A;  1S72 A;  5FU6 B;  4BI4 A;  1RAC B;  4BAC A;  1H3H A;  2DVE A;  1G3W A;  2RHI A;  4A63 B;  1AT1 B;  4HVW A;  2P4R A;  2E64 A;  5CAI A;  1K73 U;  2KRN A;  2RMO A;  4ZTF A;  1WQ7 A;  2DRK A;  2GTO A;  3CCE T;  1UEC A;  4XTY A;  2QTV A;  1LPL A;  3NTK A;  5KE3 A;  1K0X A;  4IKF A;  1RAB B;  1MMN A;  5KCH A;  2V1R A;  4KH0 B;  3SEM A;  4ZGJ B;  1G83 A;  4M7A E;  2YUP A;  4GY5 A;  5GMK e;  3BY7 A;  1M90 R;  2QGG A;  1YJN Q;  4M77 D;  1E6G A;  3CCQ Q;  3GOX A;  1VQ5 A;  4OB0 B;  2KRM A;  2VAS A;  3A5Z B;  2KT8 A;  3SWN B;  1WLP B;  4XTU A;  1YIT Q;  2JOY A;  2QEX A;  1M4Z A;  4WF2 A;  3OYF A;  2EGC A;  3CC7 T;  1AWW A;  1IGU A;  3TQ7 P;  3MP8 A;  5GAN e;  3J7A F;  3LLR A;  2K5F A;  4M75 F;  4EDU A;  1Z9Q A;  3GNG A;  2OI3 A;  2MMP A;  2J7I A;  5DLO A;  4C5H A;  1IO6 A;  1JQQ A;  2GFA A;  2GF7 A;  3VS0 A;  2EGA A;  1PSF A;  3DB3 A;  2LMJ A;  3EG9 B;  1CKB A;  4OMO A; 
#chains in the Genus database with same CATH homology
 1YI2 Q;  1YHQ Q;  3CCM Q;  1YJW Q;  1VQ4 Q;  1VQN Q;  3CPW P;  1NJI R;  3CD6 Q;  3CCU Q;  1KD1 R;  2OTJ Q;  3CCS Q;  1Q81 R;  1K8A R;  1M90 R;  3CCR Q;  1YJN Q;  3G4S Q;  3CCQ Q;  3I56 Q;  1YIJ Q;  1Q7Y R;  1K9M R;  1VQO Q;  3CC7 Q;  1QVG P;  1Q86 R;  3CMA Q;  1Q82 R;  1K73 R;  1VQ8 Q;  1VQL Q;  1S72 Q;  1VQ6 Q;  3CME Q;  1W2B P;  3G71 Q;  1VQ5 Q;  2QEX Q;  3OW2 P;  3CC4 Q;  1VQ7 Q;  2OTL Q;  3CCE Q;  3CXC P;  1N8R R;  3CCV Q;  1VQP Q;  3CCJ Q;  1YIT Q;  1VQK Q;  1QVF P;  3G6E Q;  1KC8 R;  1YJ9 Q;  1JJ2 P;  1M1K R;  1KQS P;  3I55 Q;  1VQM Q;  3CC2 Q;  1VQ9 Q;  2QA4 Q;  3CCL Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...