1VQKQ

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqkQ00
1JJ2P 3CC4Q 3CCMQ 3CC2Q 1VQNQ 2QEXQ 2OTLQ 1VQOQ 3CCJQ 3CCEQ 1KQSP 3OW2P 3CC7Q 3CCVQ 3I55Q 1Q81R 1K73R 1NJIR 1VQ8Q 3CCSQ 1YJWQ 1Q7YR 1VQKQ 1K9MR 2QA4Q 3CCUQ 1QVFP 3I56Q 1YJ9Q 3CXCP 1VQ9Q 1YITQ 1VQ4Q 1VQPQ 3G71Q 1S72Q 3CPWP 1M90R 1VQMQ 1N8RR 1YI2Q 1VQ6Q 1YHQQ 1KC8R 1VQ5Q 3G6EQ 1VQLQ 1YIJQ 1M1KR 3CMAQ 1QVGP 1K8AR 1KD1R 3CCQQ 1YJNQ 1W2BP 2OTJQ 1Q82R 3CCLQ 1Q86R 3CMEQ 1VQ7Q 3CCRQ 3CD6Q 3G4SQ
chains in the Genus database with same CATH superfamily
5C0MA 1V76A 2CH4A 2DXBA 4JLIA 3FC3A 1W4SA 2L3PA 2QK0A 4ZN3A 3V7CA 2RQTA 5CR2A 1RL2A 2DD4A 1A0NB 4ELYC 5GAN5 2RHZA 4M75F 4NS5A 4FW2A 1F1BB 4M78A 2JS2A 2YUPA 2OTLA 2KI7A 4BY6C 2O31A 1O75A 2ZPGB 2HNIA 2YRVA 1V1CA 4XTZA 1IHWA 1QVFP 4M7AF 3EFOA 2VVKA 4JJCA 4LDYA 2X4YA 1VQ7A 2XKOC 4FYVB 2YLBA 1N5ZA 4OMOA 1W1FA 2DXTA 2PNIA 4OMMA 2PUOB 3LLRA 1GBQA 5CQXA 3HFOA 4F04B 2W0ZA 4J9CA 4OMQA 1VYTA 3URGA 2JUFA 2LMJA 2DYIA 4J9HA 4KUDK 1ZA2B 4FU6A 2KMTA 2RJDA 2D1XA 1D0ZA 1TS9A 2FB7A 2VASA 3OYJA 1KC8R 2KRSA 2LTOA 2DX1A 2RB6A 4BB7A 2E4HA 1YJNQ 2RQWA 5IHIA 3RESA 4J6WA 3E2UA 5J26A 1YNZA 3CC7Q 4XTWA 4XU1A 3F70A 4RTVA 4V2SA 4ATOA 3PVQA 2K6DA 4DQ2A 3NHNA 2SRCA 4MMLA 3DLLA 2RK1A 4X34A 5IT9E 5D6YA 3TU4K 1LCKA 2KEAA 4NL2A 2KGTA 1OZ2A 4F7UA 1W6XA 1XJWB 2CZ7B 2K5LA 1IGQA 2LNVA 4ANJA 3PIPA 2L89A 3SDZA 3CCQT 3CBMA 4FSSA 4JRKA 2JMAA 3VUBA 1P92A 2ECZA 3N5BB 1MNEA 2XDDA 2QDLA 4C92D 4JLGA 1M2VA 1YJWT 2QXFA 2M9UA 2M0YA 5IHNA 4F16A 1BYMA 1QVFA 1G2BA 1VQNQ 1YJ9A 3LH5A 1JXOA 4QW2A 2EGCA 2LVMA 2FRYA 5A0DA 5GMKm 1Y07A 2EIFA 4M4ZA 1VQLA 4GBQA 1O9SA 3L1AA 1AVZC 3MEUA 5I11A 3V7SA 4E7SA 1M90R 1WHGA 2FG0A 4Z8AA 4NL3A 1UGRB 3CCMA 2O88A 3MP6A 5FU6C 1PKSA 3VS0A 3OYEA 4C92A 2FRWA 2QASA 1K73U 2RI3A 2WSCE 1RABB 2EWNA 3CCRT 1VQ9Q 1YBYA 3SFMA 4XAXB 1VQMQ 2VKNA 1D1CA 4MZTA 4M77F 5FU7C 1OPLA 2J6FA 1H92A 2EYYA 3PNWC 5L8RE 1Q86R 1OI1A 3MKDA 4JRQA 2QAZA 3OW2P 2AK5A 1G8XA 2DM1A 3H9NA 3QKJA 1WA7A 2CP6A 2JXBA 3VYHB 5L23A 5FRMA 2GTJA 1BCOA 3RKYA 2KAFA 1PWTA 1ABQA 4LDVA 1M1KR 2RM4A 1RAAB 1W2BP 4KBMB 4BI4A 3H0FA 4C0FA 1FXXA 1CKBA 1UGVA 2A28A 3V8LA 1IRXA 3EGXB 1Q7YR 2Z0WA 1VYVA 3CC4T 1FMWA 1MMAA 2DBMA 3QBYA 3G6EQ 2JW4A 2DA9A 3A8HB 2JT4A 2DYBA 3EFRA 4RG2A 2EYQA 3R6NA 2EKHA 1N27A 4CC7A 4N0AA 2QA4Q 1X6BA 3E1SA 2HBPA 1Y0MA 1Y96A 2DMOA 3E19A 5GAN8 1ARKA 2YSQA 1BIBA 3CMEA 2YUQA 1K73C 3EFSA 1X75C 4J83A 1WFWA 1U3OA 4J9FA 4L5GA 4HVVA 4J9DA 2JM9A 4HVWA 2YDLA 1PD1A 3C95A 1WHHA 1X69A 3OYHA 2V8KA 3C94A 1QCNA 3ZFJA 2R58A 2ZCFB 1ZUYA 1C6VX 3VJPA 3OS2A 3G71Q 4PJNA 1UHFA 3V8KA 1QWEA 3CCQA 1CSKA 1S72Q 1M2OA 3CCJT 4A4FA 5GMKj 1IHVA 1AD5A 4IURA 3OW2A 3PMIA 3CCUT 1W70A 2DIQA 1RAGB 1YJWA 1I07A 2LCLA 4QQ6A 1VQ5T 4A4EA 1G3WA 5CKEA 2LQ8A 3CCSQ 3LH0A 5J39A 1QKXA 2FYKA 2L0AA 1W2BA 3X28B 3QO3A 2LNHB 3G4SA 2QQAA 3I56T 3CCLQ 2DFUA 2HQXA 2E41A 3ASKA 3EG9B 3DB3A 2X4WA 3UF4A 3UDCA 2V8IA 4BDYA 4PJMA 2C0TA 1M3AA 1D3BB 2JJ9A 4ZGDB 1G3TA 1GCQC 2DILA 3NTHA 2X51A 2AIRB 2RA2A 1AWOA 5I2SA 2LCCA 4E7HA 1KIKA 3HRSA 1UDLA 1UGPB 4LNPA 3GBQA 2XIDA 3LGLA 4ESRA 4ZGEB 1VQ6Q 2CSQA 1RACB 2RD1A 2G3RA 3P8HA 3NTKA 2CP2A 1YITT 2M51A 2HDAA 2F2VA 2J06A 4II1A 1WJQA 1KHCA 3GNFB 3QUIA 1I0CA 2M0OA 1QMCA 1TXQA 1T0HA 4OB1B 1KK7A 4R0KA 2KY9A 2CZ1B 4XQ3A 4BE1A 3JCMc 1B34A 3ME9A 3VS4A 5A0LA 3CC4A 1WXUA 4M78B 3I35A 1QKWA 2FO0A 1TTHB 1WIEA 1UUEA 4CI0C 3QXEB 3WVEB 2FPFA 2DL5A 2FVUA 1VQ8Q 2LP5A 3EFOB 2RJEA 3QYHB 2SEMA 5GMKi 4PK4A 2DETA 4AFQC 2L3RA 2JTMA 1JU5C 1QVFS 4BDZA 1KD1U 3L42A 2A0FB 4F14A 1M3CA 1QP2A 5GAMh 1RI0A 2LQWA 4M7DE 3S6WA 3SEMA 3L2WA 2VB6A 2P0KA 4KT0E 1VQ7T 4PJOG 1X27A 1KQ2A 1Q7YC 1RI9A 5DM7R 3L2RA 3C12A 3M0TA 1NYFA 2NUPA 3CCUA 1YHQT 2YUOA 1VQOQ 4ZN1A 4PNOA 1MMGA 1SRLA 1UB4A 2E70A 5EC7A 2DZ9A 4Q5WA 4FCYA 3HHTB 4C8QE 2E6ZA 2ZGWA 3EH1A 4HCKA 5LJ5h 3PVLA 3A8OB 2D0QB 4HKEA 4D8KA 3RDVA 3QWXX 2MOXA 3QDFA 3I56A 2VXFA 9ATCB 2RNAA 2AZSA 4CC3A 1FYNA 4C8QC 2J05A 2KSSA 3T9NA 2DL3A 2V26A 2ZZDA 4M7AA 5I21A 4O5VA 1YCSB 3SD4A 2XI9A 3MEVA 2HKNA 4PJLA 1YP5A 1OYXA 2OAUA 1BI0A 3RKXA 3M54A 1KD1C 3A5ZB 3TSZA 1MHNA 2ED0A 1IZ6A 2HSPA 2RK2A 3CPFA 5GANe 2CP0A 2FHDA 4OVAA 4QVZA 2VGMA 3TREA 2CREA 2K5FA 3CD6Q 3HRTA 5FRNA 4GY5A 4ZGJB 2QEXQ 1YITA 2LT1A 1M5Q1 3SWNA 1Q82C 4M78D 3JCMb 1VQ4Q 1D09B 3TQ7P 3OYMA 2H8HA 1YI2Q 1N6AA 2FPDA 2LRQA 3UA6A 4AG1C 2WSEE 5KE2A 1IXDA 2E64A 3HKSA 1G3SA 4ME7A 3R6OA 3NTIA 5CVIA 2MI6A 5CIUA 2EJFA 3MP1A 3LWHA 1YJNT 4N4HA 3OA6A 1GL5A 3DLMA 2JOYA 2R5MA 2VXEA 1ZX6A 2X3XD 3OW2S 3QDRB 3CC7T 3OBYA 1WHKA 3CBPA 3AT1B 3VS2A 5FWBA 3WVDB 4HCBA 1K8AU 2GCXA 3J80E 5GAN7 1NLOC 2RJCA 5DY9A 1HK9A 1OU9A 2X4JA 4F7UE 1W2BS 4KGVB 1HJDA 1LPLA 4RTUA 1K73R 1Q81U 3CQTA 4MZMA 1BI1A 2QTVA 4IUPA 1MNDA 4GLMA 3I5RA 4PJOB 2DE0X 2HL3A 2KT1A 1U1TA 5GAOn 1SHFA 1IB8A 1JQQA 2G6FX 2IIMA 2WSFE 2P0QA 3CC2Q 3OYBA 4J7IA 1YHQA 1I1JA 1GRIA 2MWPA 3X25B 3VU3C 1Y96B 3QWYA 3ZL7C 1WQ7A 3JB9D 2DD5A 1AHJB 1VQNT 2EGAA 4M7DF 4KUIA 2YRCA 2CGHA 2E12A 2RHIA 2OJ2A 3UA7A 2QEXA 5KH6A 4N4GA 1PSEA 1SPKA 4PLLA 2R57A 3JAME 3FLGA 3M0QA 1KQ1A 4OMLA 1R77A 3X20B 3INZA 3CCVQ 1YI2A 2XU8A 1VUBA 2DO3A 4C92E 3CMET 4XTYA 3CEYA 4LDWA 3JCMJ 1H641 5LJ5g 2GQIA 2D0NA 4Y28E 1D0YA 4IKFA 2GBQA 3VRYA 3D7SB 1R0CB 4HT8A 4FYYB 4C92C 1VQ9T 1GFDA 3OMCA 4JJBA 2IPOB 2RJFA 1VQMT 1AEYA 3FJ5A 2HKQB 1E6GA 4OP0A 1K8AC 1BKBA 3VS7A 2DIGA 4C8QF 1RLPC 1NJIU 1WJRA 3OBWA 5FWCA 4A54A 1WXBA 1UEBA 3CBOA 2EFIA 3H0HA 2DNUA 2GNCA 2VGNA 1Q81C 4F17A 1OPKA 3QIIA 2EYXA 2QQ9A 4M75G 2LDMA 3M9QA 4RTWA 1UFFA 3EH2A 4ZTJA 3QHSA 1WLPB 2BZ8A 5GJWB 5GANh 4RCCA 3UT1A 3KUFA 3G4ST 1UGSB 4M7AG 2VC8A 2ABLA 1JO8A 1M3BA 1QVGP 3ULRB 3TCJA 4B6MA 4PL6A 3G6ET 3AHUA 3OSVA 3OYDA 5C6SA 1JRIA 2KXCA 4C0DB 2ED1A 1C1AA 4RTYA 1NEGA 4HXJA 3GLXA 1YJNA 4JJDA 4DBHA 3M0UA 5GAN2 4M7DG 3VS6A 3JB9H 3CC7A 3CCVA 4EMGA 1PKTA 3GP8A 4PJOD 1SSFA 2VUBA 4AFSC 8ATCB 3RERA 3FRNA 1FX7A 1ZBJA 3IQLA 2LCSA 4FT2A 2ZPBB 1VA7A 1B34B 1X2KA 4FT4A 4CC4B 1NJIC 1U5SA 4J6YA 1OULA 1PSFA 4BD3A 3CMAQ 2DEQA 1BCMA 2W10A 3RMSA 2OI3A 3G71T 2LZ6B 4J5YA 2YUNA 2BE9B 4K11A 2DTIA 3VV0A 2F5KA 2NUTA 1WHJA 4E2FB 1KC8U 4PJOA 4LDUA 4Z02A 2D8HA 4F7UF 2DKGA 3CCST 5GAN4 1VQNA 3U23A 1UG1A 2XG8D 3HSBA 4JS5A 3JB9J 1UECA 3M4YA 4JJNK 2A08A 1KQSP 1NLPC 2J6OA 5GAMe 3CCLT 1JB0E 3RMQA 2RQVA 2XDBA 1QVGA 1TSFA 4EDUA 4OF1A 4LUDA 4AFUC 3LX7A 4P5NA 1RAIB 1DJ7B 4DEYA 1R0BG 1NPRA 3BY7A 1PHTA 5HK3A 5FLXE 4LD9K 1D0XA 2EJ9A 3CCRQ 1OV3A 2P4TA 4LUEA 1RAHB 3RR6A 1WX6A 2NUPB 2JVVA 4E7ZA 1I81A 2CSIA 1VQ9A 1CKAA 3GPLA 4CC2A 1VQMA 2R5AA 1K9MU 3E9FA 3L2UA 2KRMA 1BK2A 1VQPQ 1SHGA 2CUDA 4RCBA 1N9SA 1AWXA 1QVPA 4M77G 1KD1R 1IGUA 4M75B 2HCKA 4OMNA 4C92F 3PTAA 4ELZC 3KXTA 1D1BA 2GFAA 4XTVA 4C0DC 5LJ5e 1KJWA 3VYGA 2P84A 5GAMd 3TVTA 4JZ4A 3CMAA 4M7AB 4DBRA 2J7IA 3VS3A 2CP7A 3BW1A 1K9AA 2L3SA 1YCYA 3JCMV 2O01E 1Q82R 1PM3A 5LL6S 2JZ2A 5D7UA 4OB3B 1E7OA 5GANg 2DPPB 2MAMA 2LT4A 2M02A 1M4ZA 3G6EA 1NE8A 3PE0A 1LJOA 1YWPA 4KH0B 2AHJB 2K79A 3CPWP 2RMOA 1LOJA 4JPBW 3OMGA 1VQ8T 1IO6A 1YIJQ 1KQSA 3FB9A 3VS5A 3RNJA 2QA4A 1M30A 3QZ9B 5LJ3e 3SWNB 5LJ5d 1X6OA 2D8JA 1S1NA 2EQKA 1TUGB 4PFZA 2P0PA 3MHXA 2CYZB 5CQYA 1X43A 2B8AA 3OYCA 1K76A 4AT1B 1FWZA 5CAIA 3JB9I 1BI3A 1K9MC 4FW1A 4JUVA 2CP3A 2EKOA 2JMCA 2LQNA 1M9SA 2DK3A 3BE3A 2PQWA 1Z9QA 1VQPA 3WXMB 1WQWA 3OQ5A 3G71A 1S72A 4A63B 1U8RA 5GAOr 2XICA 4X1VA 4RTTA 2IVWA 4E7IA 2HZYA 3HTRA 2K3XA 1VQOT 2LX7A 2YWWA 3HPWA 1R8OB 4LN2A 1Q95G 1WI7A 2PVGB 4HCZA 3OYIA 1PRLC 4EMHA 2F5TX 3CCSA 1K0XA 4JRIA 1WNLA 3CCEQ 1UTIA 1NZ9A 2OX7A 1T3LA 3EG1A 1I4K1 1X6GA 3PMTA 3CCLA 4J6XA 1EZZB 1N8RU 3HL8A 4FIBA 5J3BA 3OS0A 2KT8A 1NPPA 1FMKA 3EHQA 1KHIA 1I8FA 1ACMB 2DTOA 1M8VA 3QZ5B 2H3EB 4C5IA 4EMKA 3OY9A 2VWFA 4UC4A 4B9XA 3CPWA 1EFNA 3I55Q 2QTXA 3NGPA 3JSCA 4M75D 4TVRA 2XDPA 1WHMA 2LJ0A 1OQKA 4J9BA 1PG5B 4JDSA 4X9DA 1YN8A 1D1AA 2BZYA 2DRMA 2DXCA 4M77B 2L2PA 2RO0A 3JCMQ 1K8AR 5EG2A 1H8KA 4RKUE 2HQHA 1AOJA 2YLCA 2X4XA 5KYUA 1VOMA 3JCMh 1OX8A 4RG8A 4M7AD 4D6WA 3QJ6A 2RPNA 1H3HA 2LJ3A 4BUGA 4IIOA 2EQJA 1Q81R 3H8ZA 3MEAA 1YWOA 4EIKA 1VQ6A 5CKHA 5KCOA 1WPYA 2EW3A 2QEXT 4BE2A 3C0CA 3A8MB 4EPCA 4LDXA 4Z89A 2OTJQ 7AT1B 5CO7A 4IUQA 1VQ4T 4M75A 4PKCC 3SWNC 2DAQA 1YI2T 3UPUA 4BY6B 2MF2A 3Q1JA 4PJJA 1XOVA 2MMPA 4KGZB 1RUWA 1BI2A 4M7DD 1EIFA 5IXBA 5DLQE 1NYGA 2QG9B 1NEBA 4C0GA 1IREB 4FYXB 1QCOA 3EG3A 1HYOA 3VRZA 1OEBA 3M56A 2DLPA 2YRDA 1N8RC 1VQ8A 5HY6A 2D9TA 2C0IA 4CRIA 4M78E 4BE0A 2OTLQ 2GFUA 3RKWA 5IXFA 1AWJA 4HT9A 1JBMA 2DJQA 3OYLA 5CKDA 3V8JA 5LJ5f 4M78C 3NMZC 1LVKA 3ZEHA 1M8MA 4QQGA 2RHUA 1GFCA 3MCAB 4M7DA 4KRTA 5LJ3h 3OYNA 4HCCA 3M53A 4DOVA 1JJ2P 2EYZA 4IUVA 1QVGS 1NJIR 4RUGA 2E6NA 5KYXA 3M58A 4ORZA 3OS1A 3CC2T 3P8BB 4RTZA 3MEWA 5AYFA 4AFZC 4JZ3A 3M4GA 1VQOA 4KULA 2V1RA 5D6XA 3EHRA 2FL7A 1XTDA 1BIAA 4B9WA 3QJYA 1NM7A 2P4RA 3FJPA 3EGDA 3L2QA 2F2WA 5KYWA 4J7FA 1QW1A 2MK5A 1JEGA 2L3QA 4O6JA 2VYTA 3CCVT 1HSQA 1BBZA 2AZVA 1OOTA 2O9SA 5GANd 2CS7A 3NFCA 5KE3A 2FPEA 2IG0A 4E6RA 3VKIA 4BI8B 2RH2A 2VV5A 3L2VA 3SB2A 3ZBDA 1YFNA 1TH7A 2E65A 4HA8A 2RI5A 5GANj 3REAB 3A8LB 2FZGB 2K57A 1VQKQ 4M77D 1Z9ZA 2RHXA 2CKKA 2NUTB 1ZSZA 4X9CA 4BACA 5GAN6 4MMKA 3RBBB 5FW9A 2CT4A 5GAMg 2YT6A 1V29B 1UJ0A 5FU6B 4C5GA 2AKLA 5KCHA 3GOXA 3QSUA 3THKA 4YTLA 1MV0B 2A37A 3BDUA 2I0NA 4DOWA 1ZA1B 1YJ9Q 2H3JA 1Y57A 3J81E 1KQSS 3E9GA 2FZKB 3CD6A 1JJ2A 3JV3A 2JTFA 1VQLQ 2A36A 5FU7B 4MDXA 2F2XA 4M77A 1X01A 3JCMg 3JCMW 3M55A 5GAOl 2EYWA 1TU0B 1MV3A 3CCMQ 2MIOA 1VQ4A 1AT1B 3M0PA 1QQJA 2AKKA 4R55A 3M57A 2DEUA 2DERA 2HD0A 4OGCA 4KH1B 2BTTA 2KXDA 2M16A 3H41A 1U1SA 3PGGA 1G3YA 4LD6A 4XK8E 2NUZA 2DXUA 2MYSA 4VUBA 4Y91A 5IH2A 1RLQC 2I2LA 1M1FA 5IN1A 3X26B 2EQUA 1BU1A 2CH4W 2KYBA 2BKDN 2PZ1A 2K3YA 1QWFA 1WDXA 2LC4A 5DLOA 6AT1B 4BI3A 2CDTA 1VQKA 3EGUA 1KG1A 4J9EA 1SRMA 4L59A 4FM4B 4RTXA 1WYXA 3LWIA 3CMAT 2O2OA 1KSWA 5IHKA 2PVDB 1K9MR 1T0JA 2DZCA 2K2MA 2RN8A 2HQEA 4M78F 5I22A 4L6V5 5LJ3g 4A53A 2E3HA 2ZPHB 3CC2A 4PJOE 2PTKA 2X35A 5KYYA 3CPWS 3LW5E 3OB9A 3BFMA 3HP9A 2A7YA 2J6KA 5IAYA 2RQRA 3GF5A 4QKUA 4PJOC 1UE9A 4DBQA 1TWBA 2CZ6B 2ROTA 4DA4A 1C0MA 2E10A 3REBB 2KYMA 2QA4T 3CMEQ 2FZCB 2M1HA 2F69A 4N0AC 4XU0A 4PFPA 2RHYA 2L5QA 5GANf 3HRUA 2DL8A 3NPFA 2HEQA 4ZTFA 1WHLA 4OB0B 3OYYA 2EQIA 3CXCP 2HAXA 4QVDA 2V1QA 5HCKA 1K0SA 2ZAEA 4LXCA 2CUBA 1B3QA 3VUZA 3CCQQ 3ER0A 1VQPT 4WTOB 1KFZA 2EJGA 2A3LA 1S72T 2HBWA 3QPHA 1K4US 3TEEA 2QQSA 3BDLA 2JS0A 1YJWQ 4A4HA 2COWA 3I9QA 4C8QG 4NOYA 1AWWA 1VYUA 2DF6A 2EPDA 2O4XB 4IUUA 2ZPEB 4A4GA 5KYNA 4IUTA 3JB9F 5M9OA 2K2VA 4QT7A 3G4SQ 4EMKB 2K9GA 4ZNXA 1BB9A 3KBGA 5GMKe 1MUZA 2GF7A 2ZPIB 5GAN3 5D6WA 2QQRA 3M0SA 1MGQA 3OYGA 1HD3A 1N9RA 4LE9A 2EGEA 1E6HA 4M78G 2EAYA 4R56A 2HL5C 4AMCA 2QI2A 5KYUB 2Y4YA 1GXIE 2D6FA 3DKMA 1I5OB 8AT1B 1SSHA 3FEOA 1YIJT 4A4KA 1UGQB 5CKFA 3V7RA 3JCMe 3PFSA 3EG2A 1PD0A 1N8RR 4FL6A 2V8JA 2ATCB 2NLUA 1WGSA 3A8GB 1ZHIA 2KR3A 2NYSA 2E3IA 3CXCA 2PVOB 1VQ6T 1B7TA 2BUDA 2KDSA 2QDYB 3TSWA 1G5VA 4OMPA 2KROA 1Y7XA 1XQHA 1M90U 2XK0A 4PFOA 2K4YA 2XMFA 2DVJA 2KNBB 1FMVA 2MWOA 4OB2B 4HVUA 5GAMj 2KK4A 1VIFA 4DEXA 3JCMX 1AZEA 3CC4Q 2KE9A 2YHTA 1KC8C 2L8DA 3O5ZA 1QLYA 1OX9A 2DVEA 2Y4XA 3JCMd 2FEIA 3CCET 3S3OA 3GIBA 4M7DB 2LJ1A 4C5HA 4F7UG 3JB9G 2CT3A 2CP5A 2HMAA 2COYA 4XTUA 1Q86U 3PT9A 2B86A 2DBKA 1HXDA 1M27C 2RF0A 4OGEA 5KYXB 5I2MA 2COZA 1JJ2S 2MPXC 4PJOF 3P8DA 3CCRA 1ZUKA 2ROLA 3I55T 5LJ5j 3L2ZA 1XNIA 4EMKC 1M1KU 1ZUUA 4N4IA 3G7ZA 3META 2QYZA 2E1HA 3CCJQ 5CCAA 1RADB 2X3WD 3EG0A 3EGDB 5GMKl 1Q7YU 3CCUQ 4C8QB 1TOVA 5KYWB 1NG2A 1ABOA 2DL7A 3C4SA 3QYGB 1H3ZA 1VQ5Q 2ESWA 2WACA 2GGRA 5CK9A 1NBEB 4AG2C 1M90C 3UATA 1OZ3A 2BIVA 4C92G 4JS4A 4M75E 3RIRA 1UHCA 5LJ3d 3J7AF 2OTJT 1TUCA 1VIEA 2GQVA 3I56Q 2DL4A 2RI2A 1EX4A 4J8OA 1SEMA 1ZSZB 3MJXA 1OU8A 4XTXA 2O4XA 1SKUB 4M75C 3QG1A 5LJ3j 2RQUA 1I5LA 4M7AE 2O9VA 1WXTA 5GMKh 5AT1B 2JNGA 5GAOm 3UWNA 2F1LA 2Y90A 4QQDA 1GCQA 1Q86C 4E7LA 3EGXA 4M7AC 3DB4A 4C5EA 1AZGB 4JRPA 1WJSA 1YIJA 1TG0A 2OTLT 1J3TA 2BE7D 2BZXA 3H0IA 3OS5A 2DJZA 3JCMP 4KGXB 3H6ZA 1PCXA 2PU9B 3MP8A 2JM8A 3MO8A 2MCNA 1WZOA 1M1KC 4Y92A 2K7AA 1ZBXA 3CD6T 1YITQ 2OAWA 4QVCA 3SHWA 4M7DC 2ZPFB 5GAMf 3CCJA 3X24B 1Q82U 3EAEA 4E7KA 1MMDA 3OYFA 3S3NA 1Y71A 3OYAA 2K5IA 1ZSGA 3A98A 2JN0A 4IIMA 4RMOA 2HSEB 2JTEA 1VQ5A 1UJYA 2ENMA 2LQKA 2C0OA 3S3MA 4FSXA 3LGFA 4GLKA 3GNGA 2X9HA 2K3BA 4MDWA 2GTOA 3M0RA 4F7UB 3JCMf 3CCEA 3RUXA 5ECAA 4WCIA 4Z88A 1K1ZA 1SF9A 2QQBA 1LNXA 3O8VA 1PC0A 3PIOA 2NWMA 3LYIA 5A0GA 3JRZA 2PUKB 4DBFA 4J9IA 5GAOq 4E7JA 1M2VB 1QP3A 1QCFA 4FYWB 4OMFB 1VQKT 2E5KA 2C06A 1G83A 3HFNA 5KYYB 1VQ7Q 5GJVB 3I55A 2KRNA 2E5QA 2KBTA 4XU3A 4C8QD 1ZQ1A 5FROA 1B07A 3EG9A 3OYKA 3FDRA 2XD0A 3KFVA 3MPUB 4PLIA 1GBRA 2AT1B 1ZSZC 2EQMA 1JXMA 1SG5A 4E47A 5CKBA 3M59A 5GAOp 2XHCA 1YHQQ 1U06A 1TUDA 4MZPA 1MMNA 1RAFB 4WF2A 4C0ZA 1YJ9T 2KQWA 1D3BA 4D8DA 2QGFB 2EBPA 2QGGA 3FIFA 4XU2A 4M77E 4C92B 3I5SA 3VS1A 1PNJA 3A1PA 2KVQG 1VQLT 5HKCA 1GCPA 1M1GA 5A2QE 1ZLMA 2DTHA 2DRKA 4J9GA 1PRMC 2OTJA 4C8QA 3CCMT 3M5AA 4M77C 5LJ3f 1T3SA 3OSSC 5HK0A 3CXCS 2CZ0B 1RAEB 3G1JA 1X2QA 2YXYA 2EVRA 2LX9A
chains in the Genus database with same CATH topology
1JJ2P 3CC4Q 3CCMQ 3CC2Q 1VQNQ 2QEXQ 2OTLQ 1VQOQ 3CCJQ 3CCEQ 1KQSP 3OW2P 3CC7Q 3CCVQ 3I55Q 1Q81R 1K73R 1NJIR 1VQ8Q 3CCSQ 1YJWQ 1Q7YR 1VQKQ 1K9MR 2QA4Q 3CCUQ 1QVFP 3I56Q 1YJ9Q 3CXCP 1VQ9Q 1YITQ 1VQ4Q 1VQPQ 3G71Q 1S72Q 3CPWP 1M90R 1VQMQ 1N8RR 1YI2Q 1VQ6Q 1YHQQ 1KC8R 1VQ5Q 3G6EQ 1VQLQ 1YIJQ 1M1KR 3CMAQ 1QVGP 1K8AR 1KD1R 3CCQQ 1YJNQ 1W2BP 2OTJQ 1Q82R 3CCLQ 1Q86R 3CMEQ 1VQ7Q 3CCRQ 3CD6Q 3G4SQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 P;  3CC4 Q;  3CCM Q;  3CC2 Q;  1VQN Q;  2QEX Q;  2OTL Q;  1VQO Q;  3CCJ Q;  3CCE Q;  1KQS P;  3OW2 P;  3CC7 Q;  3CCV Q;  3I55 Q;  1Q81 R;  1K73 R;  1NJI R;  1VQ8 Q;  3CCS Q;  1YJW Q;  1Q7Y R;  1VQK Q;  1K9M R;  2QA4 Q;  3CCU Q;  1QVF P;  3I56 Q;  1YJ9 Q;  3CXC P;  1VQ9 Q;  1YIT Q;  1VQ4 Q;  1VQP Q;  3G71 Q;  1S72 Q;  3CPW P;  1M90 R;  1VQM Q;  1N8R R;  1YI2 Q;  1VQ6 Q;  1YHQ Q;  1KC8 R;  1VQ5 Q;  3G6E Q;  1VQL Q;  1YIJ Q;  1M1K R;  3CMA Q;  1QVG P;  1K8A R;  1KD1 R;  3CCQ Q;  1YJN Q;  1W2B P;  2OTJ Q;  1Q82 R;  3CCL Q;  1Q86 R;  3CME Q;  1VQ7 Q;  3CCR Q;  3CD6 Q;  3G4S Q; 
#chains in the Genus database with same CATH topology
 5C0M A;  1V76 A;  2CH4 A;  2DXB A;  4JLI A;  3FC3 A;  1W4S A;  2L3P A;  2QK0 A;  4ZN3 A;  3V7C A;  2RQT A;  5CR2 A;  1RL2 A;  2DD4 A;  1A0N B;  4ELY C;  5GAN 5;  2RHZ A;  4M75 F;  4NS5 A;  4FW2 A;  1F1B B;  4M78 A;  2JS2 A;  2YUP A;  2OTL A;  2KI7 A;  4BY6 C;  2O31 A;  1O75 A;  2ZPG B;  2HNI A;  2YRV A;  1V1C A;  4XTZ A;  1IHW A;  1QVF P;  4M7A F;  3EFO A;  2VVK A;  4JJC A;  4LDY A;  2X4Y A;  1VQ7 A;  2XKO C;  4FYV B;  2YLB A;  1N5Z A;  4OMO A;  1W1F A;  2DXT A;  2PNI A;  4OMM A;  2PUO B;  3LLR A;  1GBQ A;  5CQX A;  3HFO A;  4F04 B;  2W0Z A;  4J9C A;  4OMQ A;  1VYT A;  3URG A;  2JUF A;  2LMJ A;  2DYI A;  4J9H A;  4KUD K;  1ZA2 B;  4FU6 A;  2KMT A;  2RJD A;  2D1X A;  1D0Z A;  1TS9 A;  2FB7 A;  2VAS A;  3OYJ A;  1KC8 R;  2KRS A;  2LTO A;  2DX1 A;  2RB6 A;  4BB7 A;  2E4H A;  1YJN Q;  2RQW A;  5IHI A;  3RES A;  4J6W A;  3E2U A;  5J26 A;  1YNZ A;  3CC7 Q;  4XTW A;  4XU1 A;  3F70 A;  4RTV A;  4V2S A;  4ATO A;  3PVQ A;  2K6D A;  4DQ2 A;  3NHN A;  2SRC A;  4MML A;  3DLL A;  2RK1 A;  4X34 A;  5IT9 E;  5D6Y A;  3TU4 K;  1LCK A;  2KEA A;  4NL2 A;  2KGT A;  1OZ2 A;  4F7U A;  1W6X A;  1XJW B;  2CZ7 B;  2K5L A;  1IGQ A;  2LNV A;  4ANJ A;  3PIP A;  2L89 A;  3SDZ A;  3CCQ T;  3CBM A;  4FSS A;  4JRK A;  2JMA A;  3VUB A;  1P92 A;  2ECZ A;  3N5B B;  1MNE A;  2XDD A;  2QDL A;  4C92 D;  4JLG A;  1M2V A;  1YJW T;  2QXF A;  2M9U A;  2M0Y A;  5IHN A;  4F16 A;  1BYM A;  1QVF A;  1G2B A;  1VQN Q;  1YJ9 A;  3LH5 A;  1JXO A;  4QW2 A;  2EGC A;  2LVM A;  2FRY A;  5A0D A;  5GMK m;  1Y07 A;  2EIF A;  4M4Z A;  1VQL A;  4GBQ A;  1O9S A;  3L1A A;  1AVZ C;  3MEU A;  5I11 A;  3V7S A;  4E7S A;  1M90 R;  1WHG A;  2FG0 A;  4Z8A A;  4NL3 A;  1UGR B;  3CCM A;  2O88 A;  3MP6 A;  5FU6 C;  1PKS A;  3VS0 A;  3OYE A;  4C92 A;  2FRW A;  2QAS A;  1K73 U;  2RI3 A;  2WSC E;  1RAB B;  2EWN A;  3CCR T;  1VQ9 Q;  1YBY A;  3SFM A;  4XAX B;  1VQM Q;  2VKN A;  1D1C A;  4MZT A;  4M77 F;  5FU7 C;  1OPL A;  2J6F A;  1H92 A;  2EYY A;  3PNW C;  5L8R E;  1Q86 R;  1OI1 A;  3MKD A;  4JRQ A;  2QAZ A;  3OW2 P;  2AK5 A;  1G8X A;  2DM1 A;  3H9N A;  3QKJ A;  1WA7 A;  2CP6 A;  2JXB A;  3VYH B;  5L23 A;  5FRM A;  2GTJ A;  1BCO A;  3RKY A;  2KAF A;  1PWT A;  1ABQ A;  4LDV A;  1M1K R;  2RM4 A;  1RAA B;  1W2B P;  4KBM B;  4BI4 A;  3H0F A;  4C0F A;  1FXX A;  1CKB A;  1UGV A;  2A28 A;  3V8L A;  1IRX A;  3EGX B;  1Q7Y R;  2Z0W A;  1VYV A;  3CC4 T;  1FMW A;  1MMA A;  2DBM A;  3QBY A;  3G6E Q;  2JW4 A;  2DA9 A;  3A8H B;  2JT4 A;  2DYB A;  3EFR A;  4RG2 A;  2EYQ A;  3R6N A;  2EKH A;  1N27 A;  4CC7 A;  4N0A A;  2QA4 Q;  1X6B A;  3E1S A;  2HBP A;  1Y0M A;  1Y96 A;  2DMO A;  3E19 A;  5GAN 8;  1ARK A;  2YSQ A;  1BIB A;  3CME A;  2YUQ A;  1K73 C;  3EFS A;  1X75 C;  4J83 A;  1WFW A;  1U3O A;  4J9F A;  4L5G A;  4HVV A;  4J9D A;  2JM9 A;  4HVW A;  2YDL A;  1PD1 A;  3C95 A;  1WHH A;  1X69 A;  3OYH A;  2V8K A;  3C94 A;  1QCN A;  3ZFJ A;  2R58 A;  2ZCF B;  1ZUY A;  1C6V X;  3VJP A;  3OS2 A;  3G71 Q;  4PJN A;  1UHF A;  3V8K A;  1QWE A;  3CCQ A;  1CSK A;  1S72 Q;  1M2O A;  3CCJ T;  4A4F A;  5GMK j;  1IHV A;  1AD5 A;  4IUR A;  3OW2 A;  3PMI A;  3CCU T;  1W70 A;  2DIQ A;  1RAG B;  1YJW A;  1I07 A;  2LCL A;  4QQ6 A;  1VQ5 T;  4A4E A;  1G3W A;  5CKE A;  2LQ8 A;  3CCS Q;  3LH0 A;  5J39 A;  1QKX A;  2FYK A;  2L0A A;  1W2B A;  3X28 B;  3QO3 A;  2LNH B;  3G4S A;  2QQA A;  3I56 T;  3CCL Q;  2DFU A;  2HQX A;  2E41 A;  3ASK A;  3EG9 B;  3DB3 A;  2X4W A;  3UF4 A;  3UDC A;  2V8I A;  4BDY A;  4PJM A;  2C0T A;  1M3A A;  1D3B B;  2JJ9 A;  4ZGD B;  1G3T A;  1GCQ C;  2DIL A;  3NTH A;  2X51 A;  2AIR B;  2RA2 A;  1AWO A;  5I2S A;  2LCC A;  4E7H A;  1KIK A;  3HRS A;  1UDL A;  1UGP B;  4LNP A;  3GBQ A;  2XID A;  3LGL A;  4ESR A;  4ZGE B;  1VQ6 Q;  2CSQ A;  1RAC B;  2RD1 A;  2G3R A;  3P8H A;  3NTK A;  2CP2 A;  1YIT T;  2M51 A;  2HDA A;  2F2V A;  2J06 A;  4II1 A;  1WJQ A;  1KHC A;  3GNF B;  3QUI A;  1I0C A;  2M0O A;  1QMC A;  1TXQ A;  1T0H A;  4OB1 B;  1KK7 A;  4R0K A;  2KY9 A;  2CZ1 B;  4XQ3 A;  4BE1 A;  3JCM c;  1B34 A;  3ME9 A;  3VS4 A;  5A0L A;  3CC4 A;  1WXU A;  4M78 B;  3I35 A;  1QKW A;  2FO0 A;  1TTH B;  1WIE A;  1UUE A;  4CI0 C;  3QXE B;  3WVE B;  2FPF A;  2DL5 A;  2FVU A;  1VQ8 Q;  2LP5 A;  3EFO B;  2RJE A;  3QYH B;  2SEM A;  5GMK i;  4PK4 A;  2DET A;  4AFQ C;  2L3R A;  2JTM A;  1JU5 C;  1QVF S;  4BDZ A;  1KD1 U;  3L42 A;  2A0F B;  4F14 A;  1M3C A;  1QP2 A;  5GAM h;  1RI0 A;  2LQW A;  4M7D E;  3S6W A;  3SEM A;  3L2W A;  2VB6 A;  2P0K A;  4KT0 E;  1VQ7 T;  4PJO G;  1X27 A;  1KQ2 A;  1Q7Y C;  1RI9 A;  5DM7 R;  3L2R A;  3C12 A;  3M0T A;  1NYF A;  2NUP A;  3CCU A;  1YHQ T;  2YUO A;  1VQO Q;  4ZN1 A;  4PNO A;  1MMG A;  1SRL A;  1UB4 A;  2E70 A;  5EC7 A;  2DZ9 A;  4Q5W A;  4FCY A;  3HHT B;  4C8Q E;  2E6Z A;  2ZGW A;  3EH1 A;  4HCK A;  5LJ5 h;  3PVL A;  3A8O B;  2D0Q B;  4HKE A;  4D8K A;  3RDV A;  3QWX X;  2MOX A;  3QDF A;  3I56 A;  2VXF A;  9ATC B;  2RNA A;  2AZS A;  4CC3 A;  1FYN A;  4C8Q C;  2J05 A;  2KSS A;  3T9N A;  2DL3 A;  2V26 A;  2ZZD A;  4M7A A;  5I21 A;  4O5V A;  1YCS B;  3SD4 A;  2XI9 A;  3MEV A;  2HKN A;  4PJL A;  1YP5 A;  1OYX A;  2OAU A;  1BI0 A;  3RKX A;  3M54 A;  1KD1 C;  3A5Z B;  3TSZ A;  1MHN A;  2ED0 A;  1IZ6 A;  2HSP A;  2RK2 A;  3CPF A;  5GAN e;  2CP0 A;  2FHD A;  4OVA A;  4QVZ A;  2VGM A;  3TRE A;  2CRE A;  2K5F A;  3CD6 Q;  3HRT A;  5FRN A;  4GY5 A;  4ZGJ B;  2QEX Q;  1YIT A;  2LT1 A;  1M5Q 1;  3SWN A;  1Q82 C;  4M78 D;  3JCM b;  1VQ4 Q;  1D09 B;  3TQ7 P;  3OYM A;  2H8H A;  1YI2 Q;  1N6A A;  2FPD A;  2LRQ A;  3UA6 A;  4AG1 C;  2WSE E;  5KE2 A;  1IXD A;  2E64 A;  3HKS A;  1G3S A;  4ME7 A;  3R6O A;  3NTI A;  5CVI A;  2MI6 A;  5CIU A;  2EJF A;  3MP1 A;  3LWH A;  1YJN T;  4N4H A;  3OA6 A;  1GL5 A;  3DLM A;  2JOY A;  2R5M A;  2VXE A;  1ZX6 A;  2X3X D;  3OW2 S;  3QDR B;  3CC7 T;  3OBY A;  1WHK A;  3CBP A;  3AT1 B;  3VS2 A;  5FWB A;  3WVD B;  4HCB A;  1K8A U;  2GCX A;  3J80 E;  5GAN 7;  1NLO C;  2RJC A;  5DY9 A;  1HK9 A;  1OU9 A;  2X4J A;  4F7U E;  1W2B S;  4KGV B;  1HJD A;  1LPL A;  4RTU A;  1K73 R;  1Q81 U;  3CQT A;  4MZM A;  1BI1 A;  2QTV A;  4IUP A;  1MND A;  4GLM A;  3I5R A;  4PJO B;  2DE0 X;  2HL3 A;  2KT1 A;  1U1T A;  5GAO n;  1SHF A;  1IB8 A;  1JQQ A;  2G6F X;  2IIM A;  2WSF E;  2P0Q A;  3CC2 Q;  3OYB A;  4J7I A;  1YHQ A;  1I1J A;  1GRI A;  2MWP A;  3X25 B;  3VU3 C;  1Y96 B;  3QWY A;  3ZL7 C;  1WQ7 A;  3JB9 D;  2DD5 A;  1AHJ B;  1VQN T;  2EGA A;  4M7D F;  4KUI A;  2YRC A;  2CGH A;  2E12 A;  2RHI A;  2OJ2 A;  3UA7 A;  2QEX A;  5KH6 A;  4N4G A;  1PSE A;  1SPK A;  4PLL A;  2R57 A;  3JAM E;  3FLG A;  3M0Q A;  1KQ1 A;  4OML A;  1R77 A;  3X20 B;  3INZ A;  3CCV Q;  1YI2 A;  2XU8 A;  1VUB A;  2DO3 A;  4C92 E;  3CME T;  4XTY A;  3CEY A;  4LDW A;  3JCM J;  1H64 1;  5LJ5 g;  2GQI A;  2D0N A;  4Y28 E;  1D0Y A;  4IKF A;  2GBQ A;  3VRY A;  3D7S B;  1R0C B;  4HT8 A;  4FYY B;  4C92 C;  1VQ9 T;  1GFD A;  3OMC A;  4JJB A;  2IPO B;  2RJF A;  1VQM T;  1AEY A;  3FJ5 A;  2HKQ B;  1E6G A;  4OP0 A;  1K8A C;  1BKB A;  3VS7 A;  2DIG A;  4C8Q F;  1RLP C;  1NJI U;  1WJR A;  3OBW A;  5FWC A;  4A54 A;  1WXB A;  1UEB A;  3CBO A;  2EFI A;  3H0H A;  2DNU A;  2GNC A;  2VGN A;  1Q81 C;  4F17 A;  1OPK A;  3QII A;  2EYX A;  2QQ9 A;  4M75 G;  2LDM A;  3M9Q A;  4RTW A;  1UFF A;  3EH2 A;  4ZTJ A;  3QHS A;  1WLP B;  2BZ8 A;  5GJW B;  5GAN h;  4RCC A;  3UT1 A;  3KUF A;  3G4S T;  1UGS B;  4M7A G;  2VC8 A;  2ABL A;  1JO8 A;  1M3B A;  1QVG P;  3ULR B;  3TCJ A;  4B6M A;  4PL6 A;  3G6E T;  3AHU A;  3OSV A;  3OYD A;  5C6S A;  1JRI A;  2KXC A;  4C0D B;  2ED1 A;  1C1A A;  4RTY A;  1NEG A;  4HXJ A;  3GLX A;  1YJN A;  4JJD A;  4DBH A;  3M0U A;  5GAN 2;  4M7D G;  3VS6 A;  3JB9 H;  3CC7 A;  3CCV A;  4EMG A;  1PKT A;  3GP8 A;  4PJO D;  1SSF A;  2VUB A;  4AFS C;  8ATC B;  3RER A;  3FRN A;  1FX7 A;  1ZBJ A;  3IQL A;  2LCS A;  4FT2 A;  2ZPB B;  1VA7 A;  1B34 B;  1X2K A;  4FT4 A;  4CC4 B;  1NJI C;  1U5S A;  4J6Y A;  1OUL A;  1PSF A;  4BD3 A;  3CMA Q;  2DEQ A;  1BCM A;  2W10 A;  3RMS A;  2OI3 A;  3G71 T;  2LZ6 B;  4J5Y A;  2YUN A;  2BE9 B;  4K11 A;  2DTI A;  3VV0 A;  2F5K A;  2NUT A;  1WHJ A;  4E2F B;  1KC8 U;  4PJO A;  4LDU A;  4Z02 A;  2D8H A;  4F7U F;  2DKG A;  3CCS T;  5GAN 4;  1VQN A;  3U23 A;  1UG1 A;  2XG8 D;  3HSB A;  4JS5 A;  3JB9 J;  1UEC A;  3M4Y A;  4JJN K;  2A08 A;  1KQS P;  1NLP C;  2J6O A;  5GAM e;  3CCL T;  1JB0 E;  3RMQ A;  2RQV A;  2XDB A;  1QVG A;  1TSF A;  4EDU A;  4OF1 A;  4LUD A;  4AFU C;  3LX7 A;  4P5N A;  1RAI B;  1DJ7 B;  4DEY A;  1R0B G;  1NPR A;  3BY7 A;  1PHT A;  5HK3 A;  5FLX E;  4LD9 K;  1D0X A;  2EJ9 A;  3CCR Q;  1OV3 A;  2P4T A;  4LUE A;  1RAH B;  3RR6 A;  1WX6 A;  2NUP B;  2JVV A;  4E7Z A;  1I81 A;  2CSI A;  1VQ9 A;  1CKA A;  3GPL A;  4CC2 A;  1VQM A;  2R5A A;  1K9M U;  3E9F A;  3L2U A;  2KRM A;  1BK2 A;  1VQP Q;  1SHG A;  2CUD A;  4RCB A;  1N9S A;  1AWX A;  1QVP A;  4M77 G;  1KD1 R;  1IGU A;  4M75 B;  2HCK A;  4OMN A;  4C92 F;  3PTA A;  4ELZ C;  3KXT A;  1D1B A;  2GFA A;  4XTV A;  4C0D C;  5LJ5 e;  1KJW A;  3VYG A;  2P84 A;  5GAM d;  3TVT A;  4JZ4 A;  3CMA A;  4M7A B;  4DBR A;  2J7I A;  3VS3 A;  2CP7 A;  3BW1 A;  1K9A A;  2L3S A;  1YCY A;  3JCM V;  2O01 E;  1Q82 R;  1PM3 A;  5LL6 S;  2JZ2 A;  5D7U A;  4OB3 B;  1E7O A;  5GAN g;  2DPP B;  2MAM A;  2LT4 A;  2M02 A;  1M4Z A;  3G6E A;  1NE8 A;  3PE0 A;  1LJO A;  1YWP A;  4KH0 B;  2AHJ B;  2K79 A;  3CPW P;  2RMO A;  1LOJ A;  4JPB W;  3OMG A;  1VQ8 T;  1IO6 A;  1YIJ Q;  1KQS A;  3FB9 A;  3VS5 A;  3RNJ A;  2QA4 A;  1M30 A;  3QZ9 B;  5LJ3 e;  3SWN B;  5LJ5 d;  1X6O A;  2D8J A;  1S1N A;  2EQK A;  1TUG B;  4PFZ A;  2P0P A;  3MHX A;  2CYZ B;  5CQY A;  1X43 A;  2B8A A;  3OYC A;  1K76 A;  4AT1 B;  1FWZ A;  5CAI A;  3JB9 I;  1BI3 A;  1K9M C;  4FW1 A;  4JUV A;  2CP3 A;  2EKO A;  2JMC A;  2LQN A;  1M9S A;  2DK3 A;  3BE3 A;  2PQW A;  1Z9Q A;  1VQP A;  3WXM B;  1WQW A;  3OQ5 A;  3G71 A;  1S72 A;  4A63 B;  1U8R A;  5GAO r;  2XIC A;  4X1V A;  4RTT A;  2IVW A;  4E7I A;  2HZY A;  3HTR A;  2K3X A;  1VQO T;  2LX7 A;  2YWW A;  3HPW A;  1R8O B;  4LN2 A;  1Q95 G;  1WI7 A;  2PVG B;  4HCZ A;  3OYI A;  1PRL C;  4EMH A;  2F5T X;  3CCS A;  1K0X A;  4JRI A;  1WNL A;  3CCE Q;  1UTI A;  1NZ9 A;  2OX7 A;  1T3L A;  3EG1 A;  1I4K 1;  1X6G A;  3PMT A;  3CCL A;  4J6X A;  1EZZ B;  1N8R U;  3HL8 A;  4FIB A;  5J3B A;  3OS0 A;  2KT8 A;  1NPP A;  1FMK A;  3EHQ A;  1KHI A;  1I8F A;  1ACM B;  2DTO A;  1M8V A;  3QZ5 B;  2H3E B;  4C5I A;  4EMK A;  3OY9 A;  2VWF A;  4UC4 A;  4B9X A;  3CPW A;  1EFN A;  3I55 Q;  2QTX A;  3NGP A;  3JSC A;  4M75 D;  4TVR A;  2XDP A;  1WHM A;  2LJ0 A;  1OQK A;  4J9B A;  1PG5 B;  4JDS A;  4X9D A;  1YN8 A;  1D1A A;  2BZY A;  2DRM A;  2DXC A;  4M77 B;  2L2P A;  2RO0 A;  3JCM Q;  1K8A R;  5EG2 A;  1H8K A;  4RKU E;  2HQH A;  1AOJ A;  2YLC A;  2X4X A;  5KYU A;  1VOM A;  3JCM h;  1OX8 A;  4RG8 A;  4M7A D;  4D6W A;  3QJ6 A;  2RPN A;  1H3H A;  2LJ3 A;  4BUG A;  4IIO A;  2EQJ A;  1Q81 R;  3H8Z A;  3MEA A;  1YWO A;  4EIK A;  1VQ6 A;  5CKH A;  5KCO A;  1WPY A;  2EW3 A;  2QEX T;  4BE2 A;  3C0C A;  3A8M B;  4EPC A;  4LDX A;  4Z89 A;  2OTJ Q;  7AT1 B;  5CO7 A;  4IUQ A;  1VQ4 T;  4M75 A;  4PKC C;  3SWN C;  2DAQ A;  1YI2 T;  3UPU A;  4BY6 B;  2MF2 A;  3Q1J A;  4PJJ A;  1XOV A;  2MMP A;  4KGZ B;  1RUW A;  1BI2 A;  4M7D D;  1EIF A;  5IXB A;  5DLQ E;  1NYG A;  2QG9 B;  1NEB A;  4C0G A;  1IRE B;  4FYX B;  1QCO A;  3EG3 A;  1HYO A;  3VRZ A;  1OEB A;  3M56 A;  2DLP A;  2YRD A;  1N8R C;  1VQ8 A;  5HY6 A;  2D9T A;  2C0I A;  4CRI A;  4M78 E;  4BE0 A;  2OTL Q;  2GFU A;  3RKW A;  5IXF A;  1AWJ A;  4HT9 A;  1JBM A;  2DJQ A;  3OYL A;  5CKD A;  3V8J A;  5LJ5 f;  4M78 C;  3NMZ C;  1LVK A;  3ZEH A;  1M8M A;  4QQG A;  2RHU A;  1GFC A;  3MCA B;  4M7D A;  4KRT A;  5LJ3 h;  3OYN A;  4HCC A;  3M53 A;  4DOV A;  1JJ2 P;  2EYZ A;  4IUV A;  1QVG S;  1NJI R;  4RUG A;  2E6N A;  5KYX A;  3M58 A;  4ORZ A;  3OS1 A;  3CC2 T;  3P8B B;  4RTZ A;  3MEW A;  5AYF A;  4AFZ C;  4JZ3 A;  3M4G A;  1VQO A;  4KUL A;  2V1R A;  5D6X A;  3EHR A;  2FL7 A;  1XTD A;  1BIA A;  4B9W A;  3QJY A;  1NM7 A;  2P4R A;  3FJP A;  3EGD A;  3L2Q A;  2F2W A;  5KYW A;  4J7F A;  1QW1 A;  2MK5 A;  1JEG A;  2L3Q A;  4O6J A;  2VYT A;  3CCV T;  1HSQ A;  1BBZ A;  2AZV A;  1OOT A;  2O9S A;  5GAN d;  2CS7 A;  3NFC A;  5KE3 A;  2FPE A;  2IG0 A;  4E6R A;  3VKI A;  4BI8 B;  2RH2 A;  2VV5 A;  3L2V A;  3SB2 A;  3ZBD A;  1YFN A;  1TH7 A;  2E65 A;  4HA8 A;  2RI5 A;  5GAN j;  3REA B;  3A8L B;  2FZG B;  2K57 A;  1VQK Q;  4M77 D;  1Z9Z A;  2RHX A;  2CKK A;  2NUT B;  1ZSZ A;  4X9C A;  4BAC A;  5GAN 6;  4MMK A;  3RBB B;  5FW9 A;  2CT4 A;  5GAM g;  2YT6 A;  1V29 B;  1UJ0 A;  5FU6 B;  4C5G A;  2AKL A;  5KCH A;  3GOX A;  3QSU A;  3THK A;  4YTL A;  1MV0 B;  2A37 A;  3BDU A;  2I0N A;  4DOW A;  1ZA1 B;  1YJ9 Q;  2H3J A;  1Y57 A;  3J81 E;  1KQS S;  3E9G A;  2FZK B;  3CD6 A;  1JJ2 A;  3JV3 A;  2JTF A;  1VQL Q;  2A36 A;  5FU7 B;  4MDX A;  2F2X A;  4M77 A;  1X01 A;  3JCM g;  3JCM W;  3M55 A;  5GAO l;  2EYW A;  1TU0 B;  1MV3 A;  3CCM Q;  2MIO A;  1VQ4 A;  1AT1 B;  3M0P A;  1QQJ A;  2AKK A;  4R55 A;  3M57 A;  2DEU A;  2DER A;  2HD0 A;  4OGC A;  4KH1 B;  2BTT A;  2KXD A;  2M16 A;  3H41 A;  1U1S A;  3PGG A;  1G3Y A;  4LD6 A;  4XK8 E;  2NUZ A;  2DXU A;  2MYS A;  4VUB A;  4Y91 A;  5IH2 A;  1RLQ C;  2I2L A;  1M1F A;  5IN1 A;  3X26 B;  2EQU A;  1BU1 A;  2CH4 W;  2KYB A;  2BKD N;  2PZ1 A;  2K3Y A;  1QWF A;  1WDX A;  2LC4 A;  5DLO A;  6AT1 B;  4BI3 A;  2CDT A;  1VQK A;  3EGU A;  1KG1 A;  4J9E A;  1SRM A;  4L59 A;  4FM4 B;  4RTX A;  1WYX A;  3LWI A;  3CMA T;  2O2O A;  1KSW A;  5IHK A;  2PVD B;  1K9M R;  1T0J A;  2DZC A;  2K2M A;  2RN8 A;  2HQE A;  4M78 F;  5I22 A;  4L6V 5;  5LJ3 g;  4A53 A;  2E3H A;  2ZPH B;  3CC2 A;  4PJO E;  2PTK A;  2X35 A;  5KYY A;  3CPW S;  3LW5 E;  3OB9 A;  3BFM A;  3HP9 A;  2A7Y A;  2J6K A;  5IAY A;  2RQR A;  3GF5 A;  4QKU A;  4PJO C;  1UE9 A;  4DBQ A;  1TWB A;  2CZ6 B;  2ROT A;  4DA4 A;  1C0M A;  2E10 A;  3REB B;  2KYM A;  2QA4 T;  3CME Q;  2FZC B;  2M1H A;  2F69 A;  4N0A C;  4XU0 A;  4PFP A;  2RHY A;  2L5Q A;  5GAN f;  3HRU A;  2DL8 A;  3NPF A;  2HEQ A;  4ZTF A;  1WHL A;  4OB0 B;  3OYY A;  2EQI A;  3CXC P;  2HAX A;  4QVD A;  2V1Q A;  5HCK A;  1K0S A;  2ZAE A;  4LXC A;  2CUB A;  1B3Q A;  3VUZ A;  3CCQ Q;  3ER0 A;  1VQP T;  4WTO B;  1KFZ A;  2EJG A;  2A3L A;  1S72 T;  2HBW A;  3QPH A;  1K4U S;  3TEE A;  2QQS A;  3BDL A;  2JS0 A;  1YJW Q;  4A4H A;  2COW A;  3I9Q A;  4C8Q G;  4NOY A;  1AWW A;  1VYU A;  2DF6 A;  2EPD A;  2O4X B;  4IUU A;  2ZPE B;  4A4G A;  5KYN A;  4IUT A;  3JB9 F;  5M9O A;  2K2V A;  4QT7 A;  3G4S Q;  4EMK B;  2K9G A;  4ZNX A;  1BB9 A;  3KBG A;  5GMK e;  1MUZ A;  2GF7 A;  2ZPI B;  5GAN 3;  5D6W A;  2QQR A;  3M0S A;  1MGQ A;  3OYG A;  1HD3 A;  1N9R A;  4LE9 A;  2EGE A;  1E6H A;  4M78 G;  2EAY A;  4R56 A;  2HL5 C;  4AMC A;  2QI2 A;  5KYU B;  2Y4Y A;  1GXI E;  2D6F A;  3DKM A;  1I5O B;  8AT1 B;  1SSH A;  3FEO A;  1YIJ T;  4A4K A;  1UGQ B;  5CKF A;  3V7R A;  3JCM e;  3PFS A;  3EG2 A;  1PD0 A;  1N8R R;  4FL6 A;  2V8J A;  2ATC B;  2NLU A;  1WGS A;  3A8G B;  1ZHI A;  2KR3 A;  2NYS A;  2E3I A;  3CXC A;  2PVO B;  1VQ6 T;  1B7T A;  2BUD A;  2KDS A;  2QDY B;  3TSW A;  1G5V A;  4OMP A;  2KRO A;  1Y7X A;  1XQH A;  1M90 U;  2XK0 A;  4PFO A;  2K4Y A;  2XMF A;  2DVJ A;  2KNB B;  1FMV A;  2MWO A;  4OB2 B;  4HVU A;  5GAM j;  2KK4 A;  1VIF A;  4DEX A;  3JCM X;  1AZE A;  3CC4 Q;  2KE9 A;  2YHT A;  1KC8 C;  2L8D A;  3O5Z A;  1QLY A;  1OX9 A;  2DVE A;  2Y4X A;  3JCM d;  2FEI A;  3CCE T;  3S3O A;  3GIB A;  4M7D B;  2LJ1 A;  4C5H A;  4F7U G;  3JB9 G;  2CT3 A;  2CP5 A;  2HMA A;  2COY A;  4XTU A;  1Q86 U;  3PT9 A;  2B86 A;  2DBK A;  1HXD A;  1M27 C;  2RF0 A;  4OGE A;  5KYX B;  5I2M A;  2COZ A;  1JJ2 S;  2MPX C;  4PJO F;  3P8D A;  3CCR A;  1ZUK A;  2ROL A;  3I55 T;  5LJ5 j;  3L2Z A;  1XNI A;  4EMK C;  1M1K U;  1ZUU A;  4N4I A;  3G7Z A;  3MET A;  2QYZ A;  2E1H A;  3CCJ Q;  5CCA A;  1RAD B;  2X3W D;  3EG0 A;  3EGD B;  5GMK l;  1Q7Y U;  3CCU Q;  4C8Q B;  1TOV A;  5KYW B;  1NG2 A;  1ABO A;  2DL7 A;  3C4S A;  3QYG B;  1H3Z A;  1VQ5 Q;  2ESW A;  2WAC A;  2GGR A;  5CK9 A;  1NBE B;  4AG2 C;  1M90 C;  3UAT A;  1OZ3 A;  2BIV A;  4C92 G;  4JS4 A;  4M75 E;  3RIR A;  1UHC A;  5LJ3 d;  3J7A F;  2OTJ T;  1TUC A;  1VIE A;  2GQV A;  3I56 Q;  2DL4 A;  2RI2 A;  1EX4 A;  4J8O A;  1SEM A;  1ZSZ B;  3MJX A;  1OU8 A;  4XTX A;  2O4X A;  1SKU B;  4M75 C;  3QG1 A;  5LJ3 j;  2RQU A;  1I5L A;  4M7A E;  2O9V A;  1WXT A;  5GMK h;  5AT1 B;  2JNG A;  5GAO m;  3UWN A;  2F1L A;  2Y90 A;  4QQD A;  1GCQ A;  1Q86 C;  4E7L A;  3EGX A;  4M7A C;  3DB4 A;  4C5E A;  1AZG B;  4JRP A;  1WJS A;  1YIJ A;  1TG0 A;  2OTL T;  1J3T A;  2BE7 D;  2BZX A;  3H0I A;  3OS5 A;  2DJZ A;  3JCM P;  4KGX B;  3H6Z A;  1PCX A;  2PU9 B;  3MP8 A;  2JM8 A;  3MO8 A;  2MCN A;  1WZO A;  1M1K C;  4Y92 A;  2K7A A;  1ZBX A;  3CD6 T;  1YIT Q;  2OAW A;  4QVC A;  3SHW A;  4M7D C;  2ZPF B;  5GAM f;  3CCJ A;  3X24 B;  1Q82 U;  3EAE A;  4E7K A;  1MMD A;  3OYF A;  3S3N A;  1Y71 A;  3OYA A;  2K5I A;  1ZSG A;  3A98 A;  2JN0 A;  4IIM A;  4RMO A;  2HSE B;  2JTE A;  1VQ5 A;  1UJY A;  2ENM A;  2LQK A;  2C0O A;  3S3M A;  4FSX A;  3LGF A;  4GLK A;  3GNG A;  2X9H A;  2K3B A;  4MDW A;  2GTO A;  3M0R A;  4F7U B;  3JCM f;  3CCE A;  3RUX A;  5ECA A;  4WCI A;  4Z88 A;  1K1Z A;  1SF9 A;  2QQB A;  1LNX A;  3O8V A;  1PC0 A;  3PIO A;  2NWM A;  3LYI A;  5A0G A;  3JRZ A;  2PUK B;  4DBF A;  4J9I A;  5GAO q;  4E7J A;  1M2V B;  1QP3 A;  1QCF A;  4FYW B;  4OMF B;  1VQK T;  2E5K A;  2C06 A;  1G83 A;  3HFN A;  5KYY B;  1VQ7 Q;  5GJV B;  3I55 A;  2KRN A;  2E5Q A;  2KBT A;  4XU3 A;  4C8Q D;  1ZQ1 A;  5FRO A;  1B07 A;  3EG9 A;  3OYK A;  3FDR A;  2XD0 A;  3KFV A;  3MPU B;  4PLI A;  1GBR A;  2AT1 B;  1ZSZ C;  2EQM A;  1JXM A;  1SG5 A;  4E47 A;  5CKB A;  3M59 A;  5GAO p;  2XHC A;  1YHQ Q;  1U06 A;  1TUD A;  4MZP A;  1MMN A;  1RAF B;  4WF2 A;  4C0Z A;  1YJ9 T;  2KQW A;  1D3B A;  4D8D A;  2QGF B;  2EBP A;  2QGG A;  3FIF A;  4XU2 A;  4M77 E;  4C92 B;  3I5S A;  3VS1 A;  1PNJ A;  3A1P A;  2KVQ G;  1VQL T;  5HKC A;  1GCP A;  1M1G A;  5A2Q E;  1ZLM A;  2DTH A;  2DRK A;  4J9G A;  1PRM C;  2OTJ A;  4C8Q A;  3CCM T;  3M5A A;  4M77 C;  5LJ3 f;  1T3S A;  3OSS C;  5HK0 A;  3CXC S;  2CZ0 B;  1RAE B;  3G1J A;  1X2Q A;  2YXY A;  2EVR A;  2LX9 A; 
#chains in the Genus database with same CATH homology
 1JJ2 P;  3CC4 Q;  3CCM Q;  3CC2 Q;  1VQN Q;  2QEX Q;  2OTL Q;  1VQO Q;  3CCJ Q;  3CCE Q;  1KQS P;  3OW2 P;  3CC7 Q;  3CCV Q;  3I55 Q;  1Q81 R;  1K73 R;  1NJI R;  1VQ8 Q;  3CCS Q;  1YJW Q;  1Q7Y R;  1VQK Q;  1K9M R;  2QA4 Q;  3CCU Q;  1QVF P;  3I56 Q;  1YJ9 Q;  3CXC P;  1VQ9 Q;  1YIT Q;  1VQ4 Q;  1VQP Q;  3G71 Q;  1S72 Q;  3CPW P;  1M90 R;  1VQM Q;  1N8R R;  1YI2 Q;  1VQ6 Q;  1YHQ Q;  1KC8 R;  1VQ5 Q;  3G6E Q;  1VQL Q;  1YIJ Q;  1M1K R;  3CMA Q;  1QVG P;  1K8A R;  1KD1 R;  3CCQ Q;  1YJN Q;  1W2B P;  2OTJ Q;  1Q82 R;  3CCL Q;  1Q86 R;  3CME Q;  1VQ7 Q;  3CCR Q;  3CD6 Q;  3G4S Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...