1VQKQ

The structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vqkQ00
1YJWQ 1VQ9Q 1Q82R 1VQ5Q 1VQMQ 1VQOQ 2QEXQ 1YIJQ 3CC7Q 1W2BP 1YHQQ 3G71Q 1YJNQ 3CMAQ 1KQSP 3CC2Q 3CCRQ 1VQNQ 1YJ9Q 3CCJQ 1VQ8Q 3CCEQ 1N8RR 1VQKQ 1VQ7Q 3I56Q 3CPWP 1Q81R 1NJIR 1KD1R 1K73R 3CCQQ 3CCMQ 3CCUQ 3CC4Q 1QVFP 1VQ6Q 1JJ2P 2QA4Q 3OW2P 1Q7YR 2OTJQ 1M1KR 1K9MR 3CD6Q 3G4SQ 3CCVQ 1K8AR 3CXCP 1YI2Q 2OTLQ 3CCLQ 3CCSQ 1S72Q 1VQPQ 1QVGP 1KC8R 1VQLQ 1VQ4Q 3I55Q 1M90R 1Q86R 3CMEQ 3G6EQ 1YITQ
chains in the Genus database with same CATH superfamily
3CPWA 1B3QA 2FRYA 2CSQA 2OTLA 5J39A 4C92A 1LJOA 1VQNQ 5CK9A 1SG5A 2RHZA 5KCHA 1ZHIA 2NUPA 4A4EA 2JOYA 2RPNA 1G83A 1M3CA 1MHNA 2K4YA 2K3XA 1T3LA 5GMKm 1QP2A 2CZ7B 4QQ6A 4KRTA 1WX6A 2HKNA 1QVPA 5C0MA 3EGXA 2GFAA 1QCNA 2M0YA 2P0QA 4IKFA 2RH2A 1D0XA 1LNXA 2HMAA 1YCYA 2DPPB 2JT4A 2L0AA 1R77A 3OYFA 2V8IA 4JJCA 2O4XA 3X26B 4N4HA 4XK8E 1VQKT 5KE3A 1FX7A 4M78A 4BE1A 4F7UG 3QZ9B 4BD3A 5CR2A 4LDXA 4C0FA 2KRSA 5GANd 1JXOA 1WHMA 2CYZB 1AD5A 5GAMd 1JU5C 2DL3A 5LJ3g 3F70A 5LJ5e 4PLIA 2J6KA 4JRPA 3S3NA 1IB8A 1WQ7A 2AZVA 3JCMQ 2YRDA 1NEGA 3M0TA 3DLLA 3E9GA 2GTOA 3OSVA 4QVZA 1TG0A 1KSWA 1OYXA 1TXQA 1YJNQ 4E7SA 3BW1A 3QJ6A 3ZEHA 3I5RA 3QPHA 3PIOA 1VQPA 2X51A 2KDSA 5GAN4 4GLMA 4M75G 6AT1B 1AWWA 1WHKA 1OPKA 4MMKA 2EYWA 3CXCP 2J6FA 4C5HA 1QQJA 2L3RA 3OYNA 4F7UB 3TQ7P 1RLPC 4KGVB 2MOXA 4Z8AA 4F04B 3S6WA 4RTTA 3M0UA 3E9FA 4ANJA 1XOVA 4Z88A 2X3XD 4ZN3A 5CVIA 1WXBA 2DL4A 3CCST 5I2SA 2LTOA 4M7AC 2DXBA 4HKEA 1V29B 3CCJT 4M75D 1KQSS 3GPLA 1RAFB 3GOXA 3MP6A 4HCCA 1TH7A 4A4FA 1Q81R 2DRMA 4B6MA 1QVFP 2V26A 2DA9A 3I55T 3OW2P 4DOVA 1K73U 1NM7A 3UA7A 4F7UF 1RACB 1AEYA 1KD1C 3TCJA 2B86A 3OS1A 5DLOA 4C0GA 2RQWA 1P92A 3OYBA 4RTWA 4E6RA 4JZ3A 4X9DA 4ELYC 2CUDA 4MDWA 1WQWA 2QA4T 1SSHA 1SPKA 3EGUA 4PFOA 1UJ0A 1ZA2B 2DL5A 5HKCA 4LDYA 2QQAA 4FYVB 1W1FA 4RCBA 3WVDB 1XJWB 5GAN6 3NTKA 2J05A 2DYIA 2EQMA 4E2FB 2M02A 1EIFA 1GBQA 1HK9A 2PNIA 1M3AA 4LUEA 2ZPEB 1F1BB 1I0CA 1U1TA 2E5QA 4FW1A 4O5VA 2JMCA 1JEGA 2RHIA 4ME7A 1JJ2P 1BIBA 2BE7D 2GBQA 3LLRA 1YJ9A 4PJOF 2EIFA 2DJZA 3GNFB 2YLBA 1A0NB 1KC8R 2DVEA 4F7UA 1TTHB 3RKXA 3MEWA 1VQ5Q 2BZXA 2CT4A 2E5KA 2AK5A 2D1XA 3OBWA 1T3SA 3JB9H 4HT8A 2QQ9A 2QQSA 1UTIA 2MWPA 3RIRA 3PFSA 5IH2A 5KYUB 1VQ9T 2V1QA 4C8QE 2YUOA 5GAMh 3UF4A 2EJ9A 2KT1A 1AT1B 1BK2A 1FMVA 3CXCA 1UHCA 1HD3A 2KI7A 4C5EA 3CCMQ 3JCMg 2QGGA 3EG2A 3LWIA 1VQ6T 2COWA 1O9SA 1RABB 2QG9B 1KK7A 2EW3A 4YTLA 1PD0A 3HL8A 3LH0A 1WHGA 2J06A 4CC7A 4HCKA 5D6YA 2K2MA 3FIFA 4M77G 3HP9A 3QYGB 3INZA 3RMQA 3QWYA 3UDCA 5GAOr 2OI3A 2CZ0B 5IN1A 1WGSA 5FU7B 3DB3A 2RI2A 2EQKA 5GANf 1NZ9A 2RJDA 3CC2A 2E12A 1T0HA 5GAMf 4LD6A 2KXDA 2Z0WA 3BE3A 1UJYA 5IT9E 5LJ3d 5IHKA 1YIJQ 4A4HA 2J7IA 1QVFA 2X4YA 3OW2A 1VQ8Q 2HSEB 1MNEA 1TUCA 3CC7A 2ZPBB 3QWXX 5A0DA 4ZTJA 2QQRA 5AT1B 4FT4A 4M77B 4LDVA 2GGRA 2LCSA 1M1KU 2RHUA 1YHQT 2FHDA 3EHQA 4VUBA 5CKHA 4J9CA 3QBYA 2EJGA 3SD4A 3L2UA 1UGSB 1ZUUA 1B7TA 3KFVA 2RQRA 3VYHB 3J81E 4FSSA 4J8OA 2QASA 1OX9A 5KYUA 1JO8A 3A8HB 4FCYA 1U5SA 2LQWA 4HVVA 2P84A 1WA7A 4JZ4A 3I55Q 1IHWA 4CRIA 1KIKA 4J7FA 1VQ7T 3ULRB 4LNPA 3REBB 3EGDB 2K6DA 1JJ2A 4X34A 4GY5A 4LE9A 3QJYA 2COYA 3H0IA 1Q81U 4IURA 3KUFA 3CMAA 4RUGA 2W10A 3FC3A 4LD9K 2K5FA 1M2OA 3MKDA 1K73C 2M1HA 1VQNT 2DEQA 2LX9A 1H8KA 4FSXA 3M58A 1OV3A 3WXMB 3LYIA 3JCMV 4CI0C 2A0FB 2DTHA 3CCEQ 1VYTA 4M7DC 1CSKA 2DTOA 2ZPHB 5I2MA 3P8HA 2JN0A 4J9HA 4OB0B 1WI7A 2KRMA 3Q1JA 1TS9A 4M7DE 1W4SA 2AHJB 1VQPQ 2MYSA 1M9SA 2E70A 1K4US 1NLOC 1NJIR 2F2XA 4PJOC 2CH4W 3JRZA 3SB2A 2HDAA 1OZ3A 1YP5A 3CCRA 2R58A 3LH5A 2ABLA 4RMOA 4PJOE 3AT1B 3G1JA 4M77A 1MMAA 4FL6A 4BB7A 1KC8U 1YI2A 2VUBA 3CCLA 1TOVA 5FU6C 2RK2A 1YITA 3CMEA 2QK0A 4RTZA 3HRSA 4EMGA 2V8KA 1IO6A 3QDFA 1QCFA 3CCUA 2O2OA 1YJNT 3NMZC 4EPCA 4JDSA 3CCVA 2Y4XA 1OU9A 3EGDA 2JXBA 1VOMA 2NUPB 1VQLA 2MPXC 4ZN1A 5LJ3h 3MP8A 1GXIE 2FPDA 2L5QA 2CH4A 5CO7A 1I81A 1KJWA 1Q86R 2KVQG 4QKUA 2JTFA 4RCCA 3JCMd 2FVUA 3NPFA 3LWHA 3JSCA 3CD6A 1EX4A 3CBMA 4UC4A 3MEVA 2DTIA 2HAXA 4KGXB 3OYJA 3OYKA 2QTXA 3URGA 1QW1A 5GAOq 2NUZA 1UGRB 2LJ0A 2JUFA 3QHSA 3M57A 3GLXA 4P5NA 1H3ZA 4C8QG 3PE0A 2P4RA 1ABOA 4JRIA 1NG2A 3O8VA 3BDLA 1S72A 2XU8A 5LJ3f 2NUTB 3JB9D 4PLLA 1KHIA 2LMJA 4HVWA 1SRLA 2M51A 1JQQA 4KH0B 3QDRB 2RF0A 1RI9A 5C6SA 2D8JA 4OMLA 3SDZA 1G3WA 1M1KC 2BTTA 1N9SA 2K2VA 3SEMA 2R57A 5LJ3e 4DBHA 4E7KA 5FRNA 2AKLA 2PU9B 2CGHA 3CCQA 2QDYB 1BB9A 2DXTA 4RKUE 1K8AU 2CDTA 1WXUA 2EKOA 3VS2A 3X24B 2PVOB 4QVCA 1PSFA 2YXYA 3QXEB 3L2RA 2XD0A 1BU1A 3EFOB 2KQWA 1Y71A 4C0DC 3JCMJ 3HTRA 2QXFA 4DBFA 1VQ5T 1SSFA 4KBMB 4ZNXA 5CKDA 2MAMA 4OMPA 1Q81C 2E65A 3H0FA 2MI6A 8ATCB 1BI3A 3HSBA 2O88A 3CC2Q 4AG1C 2X4XA 4NOYA 2XK0A 3TREA 2H8HA 2E10A 2KNBB 2DAQA 3CBOA 3M4GA 2DNUA 4IUUA 1IGUA 2CP6A 2NYSA 1YWPA 4A53A 3CCJA 3SHWA 1OEBA 2JM8A 1OOTA 4RTUA 2LCLA 4XTVA 2YRVA 1NBEB 1I4K1 2CS7A 2ENMA 3QSUA 2EFIA 5CKEA 2DL8A 4C5GA 3JCMX 2SEMA 3CCMT 1W2BP 5EC7A 1TUDA 3V8LA 3RDVA 3OS5A 2XICA 5CCAA 3C94A 2NUTA 3O5ZA 1K76A 1AZEA 2GCXA 5KYXB 1D0ZA 4OB2B 3VJPA 3G6EQ 4OGEA 5CKFA 3G4SA 2MCNA 2KMTA 3EG3A 3TSWA 2OTJT 2CREA 2LC4A 4J5YA 4PK4A 1T0JA 1CKBA 1MMGA 1VQMA 1HJDA 3JCMh 1WJSA 2YUPA 4AMCA 3G71A 5ECAA 1QCOA 5IHNA 3MEUA 3LW5E 1YIJT 4C8QA 4EMHA 1JXMA 4IUVA 3G7ZA 3CC4A 1KQ2A 4AFSC 1VQ8T 1KHCA 1X6BA 3DKMA 4DA4A 3BDUA 3ZBDA 4R55A 3CMAQ 4J9BA 1BCOA 3H6ZA 1OU8A 1EZZB 4X9CA 1X75C 1M5Q1 4HT9A 3EFOA 5D6XA 2IG0A 1WJQA 4MZMA 3META 4KH1B 3OS0A 2XG8D 1IZ6A 3NTHA 1QVGP 3CPFA 3MHXA 2LVMA 4WF2A 5GAOl 2DE0X 3C12A 4M7AE 3OBYA 2KGTA 3FDRA 2FZKB 2YHTA 4Z02A 2YUQA 4M75B 4JS5A 3JCMf 2G3RA 1MV0B 2VKNA 2LQKA 4M7DD 3ASKA 3RNJA 2RJCA 1HYOA 4ZGJB 1UGPB 4XU2A 1SRMA 4C92C 3EFRA 2WSCE 3M0SA 4DOWA 4C92E 3CPWS 1IHVA 2EKHA 2ZAEA 3CCRQ 5KCOA 1JBMA 1LCKA 1NLPC 5LJ5g 4PJOD 3JCMe 2WSEE 2KR3A 2K57A 1YI2Q 3IQLA 2L2PA 2QGFB 4FYYB 1VA7A 3OS2A 4X1VA 1UG1A 5KYXA 2J6OA 1G8XA 2OX7A 2K3YA 2H3JA 3CMEQ 3CCET 4N0AA 4M75F 2CP2A 2EWNA 1BBZA 3V7SA 1J3TA 1VQ4A 5A0GA 4NL3A 4OMMA 1VQPT 3EG1A 4II1A 2GF7A 2FL7A 8AT1B 3CCVQ 4M78C 2KYMA 1QWEA 4HCZA 1W2BA 1VQLQ 1MV3A 2DZCA 1D09B 4DBQA 4RG8A 2YLCA 4M78E 2XMFA 2HKQB 2BUDA 1WXTA 2I2LA 2LQNA 3V8KA 1K8AC 4L59A 2FB7A 1ZX6A 1X01A 1Q7YR 5I21A 2ZPFB 3MJXA 1YBYA 1K9MR 1Y57A 3CD6Q 4PJNA 4PKCC 2O9SA 5GANh 5GAN5 2DVJA 3PMTA 3E1SA 3RUXA 4AFQC 3V8JA 1E6HA 2KE9A 3JAME 4HXJA 2KXCA 5GANj 3OMCA 3VUBA 1V1CA 4M75A 1IRXA 1X69A 2EAYA 5GAMj 4Y28E 1VQOA 3A1PA 1D1AA 4D8KA 3BFMA 4QVDA 1VQ7A 2ED0A 2CUBA 2R5AA 2HD0A 1WJRA 3VS3A 2F2VA 4QQGA 3ZL7C 1C0MA 2QTVA 4KULA 1IREB 1JRIA 2HNIA 1C1AA 5CQXA 3JCMb 1QKXA 2DLPA 2R5MA 3HRUA 2FPEA 2IVWA 1QVGA 2C06A 2OTJQ 1H92A 4C5IA 2RQTA 1VIFA 4F16A 4EMKB 3M56A 2KRNA 2CSIA 2K7AA 1N5ZA 1SEMA 3I5SA 1ZUKA 3JB9J 4KT0E 2DF6A 4KUDK 2EQIA 4LXCA 4Z89A 1JB0E 2VXFA 3HFNA 3QO3A 2IIMA 2E4HA 4FYXB 2OTLQ 1M1GA 1NEBA 5GANe 1KG1A 1QMCA 5GAMe 1ZBJA 2M16A 1Y7XA 5DM7R 3MP1A 2O9VA 3PVLA 1UUEA 1YJWA 2E41A 4J6WA 1GCQA 2DEUA 1RAAB 4PJMA 4F17A 1K1ZA 3V7RA 3EG0A 1G5VA 4AFZC 3ME9A 2NLUA 2EQJA 4JJBA 3GBQA 2KT8A 2BIVA 2AZSA 1RAGB 3OMGA 2RQUA 4E7ZA 4BI8B 4BE0A 2DYBA 1KQ1A 1ZSGA 2EBPA 4M4ZA 2K9GA 2EYZA 2FRWA 4JS4A 3A8LB 3HFOA 2C0TA 4AT1B 1UE9A 4M77F 5FROA 4A4GA 2FYKA 3JB9I 1HXDA 4F7UE 5IAYA 1LPLA 2DD4A 1UEBA 4JPBW 4AG2C 1G3YA 4JJDA 1TU0B 2DKGA 1BYMA 4XTWA 2QDLA 4E7IA 2DILA 2RHYA 3G4SQ 1N27A 3RR6A 3CEYA 5LL6S 2GTJA 2RA2A 5L23A 4ELZC 1NYFA 4EMKA 4M75C 1U3OA 3CC2T 5LJ5d 3R6NA 4J6YA 3VS0A 1VQMQ 4HCBA 2BKDN 2LT4A 3G71Q 1KQSP 1ZUYA 2VV5A 1OX8A 4ESRA 2RNAA 1MMNA 1CKAA 3P8BB 3CXCS 3CC4Q 2QEXA 1U06A 1PKTA 4J9FA 1VUBA 4QQDA 3REAB 3L2ZA 1H641 1FMKA 3I56A 3LGFA 4ORZA 1R0CB 3RESA 3VUZA 4OMOA 3VRZA 2EYXA 3A8MB 4GBQA 1B34B 1FXXA 3VS5A 4J9DA 2C0OA 3GIBA 5A0LA 4MDXA 2L3PA 2M0OA 5DY9A 1PWTA 3TVTA 3H41A 4J7IA 3R6OA 4Y92A 3G6ET 3JCMc 1Z9ZA 1Q7YU 3OB9A 1K9MU 4M7AD 5FWCA 2KROA 2JZ2A 2MWOA 4C0ZA 2JVVA 2LJ3A 2LZ6B 1QVFS 2AT1B 1NPPA 3OW2S 2GNCA 1ZA1B 2F5TX 5GMKl 3ZFJA 1I8FA 2K3BA 4OVAA 9ATCB 4C92D 3JB9G 3CMAT 2A36A 3OYGA 2ZZDA 5LJ3j 4LN2A 2OAWA 1GCQC 3QYHB 2RB6A 2CP5A 2F5KA 4HA8A 2DL7A 2B8AA 5HK0A 2BE9B 3M0PA 1AOJA 4KUIA 1Y0MA 1ARKA 2K5LA 1M27C 3SFMA 3FRNA 4JRKA 4EDUA 3D7SB 1UGVA 1VQ4Q 2YDLA 1GL5A 1MUZA 2MK5A 2F2WA 1WNLA 3I35A 1M30A 2L8DA 1X2QA 4MMLA 1YJ9Q 1JJ2S 1FWZA 1E7OA 2X4WA 1BI1A 1MNDA 3VS4A 2DBKA 1Q95G 3A5ZB 4R56A 3DLMA 4M78D 5GMKh 2OJ2A 1VQKA 3GP8A 3CCRT 3UT1A 1PG5B 4BY6B 5FU7C 1B34A 3WVEB 2DIQA 3TEEA 1M8MA 1N8RR 2QI2A 1YI2T 1UHFA 2X3WD 4WTOB 4XTXA 2BZYA 4OB1B 3CMET 2A37A 2JM9A 4C8QB 1G2BA 5A2QE 3X25B 1KQSA 1QP3A 1SHGA 2EPDA 1VQOQ 1AVZC 2VGMA 3I9QA 2C0IA 1I5OB 1UGQB 1PHTA 4XTYA 3CCVT 5LJ5h 4M77C 3JB9F 5KE2A 1VQLT 3S3MA 3RKYA 4ZTFA 2HSPA 1ZLMA 3M59A 4M77E 2E6NA 1TUGB 2ROTA 4XTUA 4QW2A 1D3BB 2DRKA 2LP5A 1WFWA 1ZBXA 4A4KA 3CCSA 3CD6T 2PVGB 3THKA 1M8VA 2K5IA 1ACMB 1MGQA 3HRTA 4DEYA 4BDYA 4DEXA 4C8QF 1OULA 3CBPA 5GMKe 4IUQA 3EHRA 4DQ2A 2DM1A 5D7UA 2VASA 3CC7Q 4J6XA 1G3SA 5LJ5f 1AWJA 3I55A 4E7HA 3EFSA 1E6GA 2RD1A 2WSFE 3X28B 1S72T 2RO0A 4OMFB 3NGPA 1SKUB 1I5LA 1K0SA 1NJIU 5GAOp 1O75A 2FEIA 1U8RA 3L42A 2EYYA 5J26A 3A8OB 3VU3C 3H8ZA 2AIRB 1K0XA 1W6XA 1YJWQ 2QA4A 1DJ7B 4XQ3A 1X6GA 3FLGA 2VWFA 1OI1A 4PNOA 3UA6A 3AHUA 1KC8C 4KGZB 2O01E 2DJQA 2CP3A 1ABQA 1GFCA 4EIKA 2LX7A 1SF9A 3CCEA 3H0HA 4L6V5 5HY6A 1RI0A 1M90R 2ROLA 4M7DG 2DFUA 1Q82R 3CCQT 1Q7YC 2RM4A 1K9MC 4OMNA 1NYGA 2EYQA 2RJEA 5FW9A 5KYYB 5GAN8 2OTLT 2RI3A 2A08A 1M1KR 1BI2A 4HVUA 3FJPA 1VYUA 2VGNA 2BZ8A 4PL6A 2W0ZA 5CAIA 3PTAA 1PRMC 2RHXA 1YN8A 4PJOG 1D3BA 2FG0A 1Q86U 2JW4A 2ESWA 1LOJA 3OYDA 2MMPA 2PZ1A 4OP0A 1ZQ1A 2RK1A 2ZPIB 3QKJA 2DERA 1VQ9A 2LT1A 2DK3A 3OY9A 2L3SA 1WPYA 2HQHA 4GLKA 3MPUB 1AWXA 2RI5A 4M7DB 2LJ1A 1BCMA 3QZ5B 2DX1A 1UFFA 1YNZA 3C95A 3QIIA 1KFZA 5GAN3 2QEXQ 4BDZA 1D1BA 1WDXA 3I56Q 2QAZA 1VQ6A 1AHJB 5DLQE 4XTZA 2Y90A 2PUOB 3L2WA 4PJOB 3CCLQ 2HL3A 3M0RA 3QUIA 1RL2A 5L8RE 1YITQ 4CC4B 4CC2A 1EFNA 1YCSB 4PFPA 1RLQC 1ZSZB 4JJNK 1BKBA 2FZCB 2KEAA 5KYNA 1IXDA 3G4ST 2EGAA 3PMIA 1XNIA 1M2VB 3CCUQ 1N8RU 4PJLA 3VYGA 3U23A 3JCMP 1UDLA 3OYMA 3EH2A 4M7DF 2GFUA 3A98A 3HPWA 5FU6B 2EJFA 1X2KA 1VQMT 3S3OA 5FLXE 4BE2A 4FU6A 3G71T 3SWNB 2HBPA 2ZCFB 3KBGA 4TVRA 4A63B 1OZ2A 1I1JA 1N6AA 2LRQA 1M4ZA 4RG2A 7AT1B 1R8OB 3CC4T 2AKKA 2LQ8A 2VXEA 2RN8A 5KYYA 5GAOn 1GRIA 4OGCA 1YHQA 3VKIA 2RMOA 2P0KA 4BY6C 2HQEA 3E19A 1K9AA 3M0QA 3E2UA 2FPFA 1D1CA 3LX7A 3P8DA 4LDWA 2ED1A 1QLYA 2RJFA 2YWWA 2F69A 5EG2A 2PTKA 2ATCB 4V2SA 2CP7A 4C8QC 4RTVA 2HEQA 2CP0A 2YUNA 2ZGWA 1IGQA 2JS2A 2LNHB 1FMWA 2JTEA 3MO8A 2RQVA 3OSSC 4M7DA 2DXUA 4K11A 4LDUA 3PVQA 1S72Q 2P0PA 2LCCA 5IXBA 3QG1A 4N4GA 4OB3B 1YFNA 4PFZA 3MEAA 4J9GA 2KK4A 5HCKA 1Y07A 3RBBB 1YWOA 1VQKQ 5GAOm 3GNGA 1Z9QA 4MZTA 3EAEA 2XDBA 1C6VX 4QT7A 4IUTA 1PD1A 2CZ1B 1VQNA 2XKOC 3VRYA 2XI9A 2NWMA 5I11A 2EGEA 4PJOA 3JCMW 1NJIC 2JTMA 1I07A 1GFDA 1AWOA 1ZSZA 1QKWA 1WHJA 1KD1R 5CQYA 3FB9A 2M9UA 3CCQQ 1M2VA 3OYLA 1VQ4T 5GAN7 4NL2A 4J83A 5D6WA 3M9QA 5GJWB 2A7YA 1WZOA 1YJ9T 3SWNA 2DETA 2JMAA 3V7CA 3L1AA 5FWBA 2A3LA 1M90U 3HKSA 1Q82U 3PIPA 1BI0A 2PVDB 1RAIB 2DXCA 4XAXB 1PRLC 3ER0A 1M1FA 2KY9A 1TSFA 4J9IA 3BY7A 4M77D 4N0AC 2PUKB 1D0YA 2JS0A 2XDDA 3A8GB 1S1NA 3CCSQ 4FYWB 4C0DB 3C0CA 3J80E 3RMSA 3LGLA 4LUDA 4B9XA 2HL5C 4BI4A 5KH6A 5GJVB 1RAHB 3CCJQ 3NFCA 3G6EA 1AZGB 1M3BA 3HHTB 2V1RA 1PKSA 1Q86C 1XQHA 3T9NA 3X20B 3VV0A 1K8AR 1YJNA 2CKKA 3KXTA 2LDMA 4JUVA 1VQOT 3RERA 2MF2A 2KYBA 1OPLA 4ZGEB 4L5GA 1W2BS 3TSZA 3J7AF 1QWFA 2QQBA 2E3HA 4R0KA 2ZPGB 1W70A 2E1HA 3L2VA 5AYFA 2GQIA 2QA4Q 4O6JA 3NTIA 1XTDA 2X9HA 1NE8A 3N5BB 5IHIA 4E7JA 1GCPA 1WIEA 2D0NA 3OYYA 5CKBA 2DD5A 2D0QB 2E3IA 3UATA 4BI3A 2CT3A 1VYVA 5IXFA 1BIAA 4F14A 5CIUA 2EGCA 2HQXA 2EQUA 4M75E 4Y91A 4M7AG 3EH1A 2P4TA 4N4IA 2D8HA 1N9RA 2XDPA 4XU1A 1X43A 4E7LA 2GQVA 4IIMA 4BUGA 5GANg 3CC7T 1N8RC 3GF5A 1RADB 2YT6A 4BACA 1RAEB 1FYNA 2ECZA 4ATOA 5GAMg 2EVRA 2XIDA 1WHHA 2CZ6B 4NS5A 2XHCA 3EG9B 3OYAA 3CPWP 4C92G 3H9NA 2KAFA 2VB6A 2JNGA 4IUPA 4A54A 1Y96B 3FJ5A 5M9OA 3OYHA 3L2QA 1QVGS 1YJWT 1ZSZC 1HSQA 2FZGB 1UB4A 1MMDA 1VQ9Q 1WLPB 2KBTA 4XU0A 4M7AB 2F1LA 5KYWB 3OA6A 1NPRA 3PT9A 2MIOA 5J3BA 2A28A 3SWNC 2HCKA 2L89A 1VIEA 4B9WA 4ZGDB 3MCAB 4OMQA 3VS6A 1GBRA 3M5AA 2DO3A 1VQ6Q 1RUWA 1V76A 3JV3A 4JRQA 4C92B 1WHLA 4CC3A 1U1SA 4M78G 4RTYA 3OYEA 3RKWA 1PM3A 2X35A 4OF1A 2O31A 2QYZA 3OYIA 4E47A 2VYTA 1VQ5A 2L3QA 4XU3A 2JJ9A 2Y4YA 2WACA 1SHFA 4PJJA 4FIBA 1PCXA 1G3TA 2LNVA 2V8JA 2HBWA 1PC0A 4M7AF 5GMKi 3C4SA 4IIOA 4D6WA 3EGXB 1WYXA 2X4JA 3FEOA 1K73R 2DZ9A 3UPUA 3VS7A 1KD1U 4Q5WA 2VC8A 4WCIA 4FW2A 2QEXT 2O4XB 3PNWC 3TU4K 4D8DA 3CCMA 3M4YA 4RTXA 4C92F 2E6ZA 4M78B 3UWNA 3I56T 5HK3A 1X6OA 2D6FA 2YRCA 3OQ5A 1YHQQ 2E64A 5GMKj 1LVKA 2IPOB 3VS1A 3EG9A 4EMKC 1M90C 1UECA 2KSSA 2DMOA 3CCLT 5GAN2 1Q82C 4JLGA 4FT2A 4DBRA 1PSEA 1YITT 1Y96A 2YSQA 3PGGA 2D9TA 5FRMA 2SRCA 4FM4B 2G6FX 2OTJA 2PQWA 1X27A 2OAUA 2I0NA 3CCUT 2VVKA 4M7AA 3CQTA 5I22A 4AFUC 2DIGA 5KYWA 1VQ7Q 1B07A 3NHNA 4MZPA 1OQKA 2DBMA 3M55A 4C8QD 3M53A 1H3HA 1YIJA 2COZA 3OYCA 2FO0A 3M54A 3DB4A 4J9EA 1VQ8A 4JLIA 1PNJA 1TWBA 2H3EB 4M78F 1R0BG 5LJ5j 2HZYA 2K79A
chains in the Genus database with same CATH topology
1YJWQ 1VQ9Q 1Q82R 1VQ5Q 1VQMQ 1VQOQ 2QEXQ 1YIJQ 3CC7Q 1W2BP 1YHQQ 3G71Q 1YJNQ 3CMAQ 1KQSP 3CC2Q 3CCRQ 1VQNQ 1YJ9Q 3CCJQ 1VQ8Q 3CCEQ 1N8RR 1VQKQ 1VQ7Q 3I56Q 3CPWP 1Q81R 1NJIR 1KD1R 1K73R 3CCQQ 3CCMQ 3CCUQ 3CC4Q 1QVFP 1VQ6Q 1JJ2P 2QA4Q 3OW2P 1Q7YR 2OTJQ 1M1KR 1K9MR 3CD6Q 3G4SQ 3CCVQ 1K8AR 3CXCP 1YI2Q 2OTLQ 3CCLQ 3CCSQ 1S72Q 1VQPQ 1QVGP 1KC8R 1VQLQ 1VQ4Q 3I55Q 1M90R 1Q86R 3CMEQ 3G6EQ 1YITQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW Q;  1VQ9 Q;  1Q82 R;  1VQ5 Q;  1VQM Q;  1VQO Q;  2QEX Q;  1YIJ Q;  3CC7 Q;  1W2B P;  1YHQ Q;  3G71 Q;  1YJN Q;  3CMA Q;  1KQS P;  3CC2 Q;  3CCR Q;  1VQN Q;  1YJ9 Q;  3CCJ Q;  1VQ8 Q;  3CCE Q;  1N8R R;  1VQK Q;  1VQ7 Q;  3I56 Q;  3CPW P;  1Q81 R;  1NJI R;  1KD1 R;  1K73 R;  3CCQ Q;  3CCM Q;  3CCU Q;  3CC4 Q;  1QVF P;  1VQ6 Q;  1JJ2 P;  2QA4 Q;  3OW2 P;  1Q7Y R;  2OTJ Q;  1M1K R;  1K9M R;  3CD6 Q;  3G4S Q;  3CCV Q;  1K8A R;  3CXC P;  1YI2 Q;  2OTL Q;  3CCL Q;  3CCS Q;  1S72 Q;  1VQP Q;  1QVG P;  1KC8 R;  1VQL Q;  1VQ4 Q;  3I55 Q;  1M90 R;  1Q86 R;  3CME Q;  3G6E Q;  1YIT Q; 
#chains in the Genus database with same CATH topology
 3CPW A;  1B3Q A;  2FRY A;  2CSQ A;  2OTL A;  5J39 A;  4C92 A;  1LJO A;  1VQN Q;  5CK9 A;  1SG5 A;  2RHZ A;  5KCH A;  1ZHI A;  2NUP A;  4A4E A;  2JOY A;  2RPN A;  1G83 A;  1M3C A;  1MHN A;  2K4Y A;  2K3X A;  1T3L A;  5GMK m;  1QP2 A;  2CZ7 B;  4QQ6 A;  4KRT A;  1WX6 A;  2HKN A;  1QVP A;  5C0M A;  3EGX A;  2GFA A;  1QCN A;  2M0Y A;  2P0Q A;  4IKF A;  2RH2 A;  1D0X A;  1LNX A;  2HMA A;  1YCY A;  2DPP B;  2JT4 A;  2L0A A;  1R77 A;  3OYF A;  2V8I A;  4JJC A;  2O4X A;  3X26 B;  4N4H A;  4XK8 E;  1VQK T;  5KE3 A;  1FX7 A;  4M78 A;  4BE1 A;  4F7U G;  3QZ9 B;  4BD3 A;  5CR2 A;  4LDX A;  4C0F A;  2KRS A;  5GAN d;  1JXO A;  1WHM A;  2CYZ B;  1AD5 A;  5GAM d;  1JU5 C;  2DL3 A;  5LJ3 g;  3F70 A;  5LJ5 e;  4PLI A;  2J6K A;  4JRP A;  3S3N A;  1IB8 A;  1WQ7 A;  2AZV A;  3JCM Q;  2YRD A;  1NEG A;  3M0T A;  3DLL A;  3E9G A;  2GTO A;  3OSV A;  4QVZ A;  1TG0 A;  1KSW A;  1OYX A;  1TXQ A;  1YJN Q;  4E7S A;  3BW1 A;  3QJ6 A;  3ZEH A;  3I5R A;  3QPH A;  3PIO A;  1VQP A;  2X51 A;  2KDS A;  5GAN 4;  4GLM A;  4M75 G;  6AT1 B;  1AWW A;  1WHK A;  1OPK A;  4MMK A;  2EYW A;  3CXC P;  2J6F A;  4C5H A;  1QQJ A;  2L3R A;  3OYN A;  4F7U B;  3TQ7 P;  1RLP C;  4KGV B;  2MOX A;  4Z8A A;  4F04 B;  3S6W A;  4RTT A;  3M0U A;  3E9F A;  4ANJ A;  1XOV A;  4Z88 A;  2X3X D;  4ZN3 A;  5CVI A;  1WXB A;  2DL4 A;  3CCS T;  5I2S A;  2LTO A;  4M7A C;  2DXB A;  4HKE A;  1V29 B;  3CCJ T;  4M75 D;  1KQS S;  3GPL A;  1RAF B;  3GOX A;  3MP6 A;  4HCC A;  1TH7 A;  4A4F A;  1Q81 R;  2DRM A;  4B6M A;  1QVF P;  2V26 A;  2DA9 A;  3I55 T;  3OW2 P;  4DOV A;  1K73 U;  1NM7 A;  3UA7 A;  4F7U F;  1RAC B;  1AEY A;  1KD1 C;  3TCJ A;  2B86 A;  3OS1 A;  5DLO A;  4C0G A;  2RQW A;  1P92 A;  3OYB A;  4RTW A;  4E6R A;  4JZ3 A;  4X9D A;  4ELY C;  2CUD A;  4MDW A;  1WQW A;  2QA4 T;  1SSH A;  1SPK A;  3EGU A;  4PFO A;  1UJ0 A;  1ZA2 B;  2DL5 A;  5HKC A;  4LDY A;  2QQA A;  4FYV B;  1W1F A;  4RCB A;  3WVD B;  1XJW B;  5GAN 6;  3NTK A;  2J05 A;  2DYI A;  2EQM A;  4E2F B;  2M02 A;  1EIF A;  1GBQ A;  1HK9 A;  2PNI A;  1M3A A;  4LUE A;  2ZPE B;  1F1B B;  1I0C A;  1U1T A;  2E5Q A;  4FW1 A;  4O5V A;  2JMC A;  1JEG A;  2RHI A;  4ME7 A;  1JJ2 P;  1BIB A;  2BE7 D;  2GBQ A;  3LLR A;  1YJ9 A;  4PJO F;  2EIF A;  2DJZ A;  3GNF B;  2YLB A;  1A0N B;  1KC8 R;  2DVE A;  4F7U A;  1TTH B;  3RKX A;  3MEW A;  1VQ5 Q;  2BZX A;  2CT4 A;  2E5K A;  2AK5 A;  2D1X A;  3OBW A;  1T3S A;  3JB9 H;  4HT8 A;  2QQ9 A;  2QQS A;  1UTI A;  2MWP A;  3RIR A;  3PFS A;  5IH2 A;  5KYU B;  1VQ9 T;  2V1Q A;  4C8Q E;  2YUO A;  5GAM h;  3UF4 A;  2EJ9 A;  2KT1 A;  1AT1 B;  1BK2 A;  1FMV A;  3CXC A;  1UHC A;  1HD3 A;  2KI7 A;  4C5E A;  3CCM Q;  3JCM g;  2QGG A;  3EG2 A;  3LWI A;  1VQ6 T;  2COW A;  1O9S A;  1RAB B;  2QG9 B;  1KK7 A;  2EW3 A;  4YTL A;  1PD0 A;  3HL8 A;  3LH0 A;  1WHG A;  2J06 A;  4CC7 A;  4HCK A;  5D6Y A;  2K2M A;  3FIF A;  4M77 G;  3HP9 A;  3QYG B;  3INZ A;  3RMQ A;  3QWY A;  3UDC A;  5GAO r;  2OI3 A;  2CZ0 B;  5IN1 A;  1WGS A;  5FU7 B;  3DB3 A;  2RI2 A;  2EQK A;  5GAN f;  1NZ9 A;  2RJD A;  3CC2 A;  2E12 A;  1T0H A;  5GAM f;  4LD6 A;  2KXD A;  2Z0W A;  3BE3 A;  1UJY A;  5IT9 E;  5LJ3 d;  5IHK A;  1YIJ Q;  4A4H A;  2J7I A;  1QVF A;  2X4Y A;  3OW2 A;  1VQ8 Q;  2HSE B;  1MNE A;  1TUC A;  3CC7 A;  2ZPB B;  3QWX X;  5A0D A;  4ZTJ A;  2QQR A;  5AT1 B;  4FT4 A;  4M77 B;  4LDV A;  2GGR A;  2LCS A;  1M1K U;  2RHU A;  1YHQ T;  2FHD A;  3EHQ A;  4VUB A;  5CKH A;  4J9C A;  3QBY A;  2EJG A;  3SD4 A;  3L2U A;  1UGS B;  1ZUU A;  1B7T A;  3KFV A;  2RQR A;  3VYH B;  3J81 E;  4FSS A;  4J8O A;  2QAS A;  1OX9 A;  5KYU A;  1JO8 A;  3A8H B;  4FCY A;  1U5S A;  2LQW A;  4HVV A;  2P84 A;  1WA7 A;  4JZ4 A;  3I55 Q;  1IHW A;  4CRI A;  1KIK A;  4J7F A;  1VQ7 T;  3ULR B;  4LNP A;  3REB B;  3EGD B;  2K6D A;  1JJ2 A;  4X34 A;  4GY5 A;  4LE9 A;  3QJY A;  2COY A;  3H0I A;  1Q81 U;  4IUR A;  3KUF A;  3CMA A;  4RUG A;  2W10 A;  3FC3 A;  4LD9 K;  2K5F A;  1M2O A;  3MKD A;  1K73 C;  2M1H A;  1VQN T;  2DEQ A;  2LX9 A;  1H8K A;  4FSX A;  3M58 A;  1OV3 A;  3WXM B;  3LYI A;  3JCM V;  4CI0 C;  2A0F B;  2DTH A;  3CCE Q;  1VYT A;  4M7D C;  1CSK A;  2DTO A;  2ZPH B;  5I2M A;  3P8H A;  2JN0 A;  4J9H A;  4OB0 B;  1WI7 A;  2KRM A;  3Q1J A;  1TS9 A;  4M7D E;  1W4S A;  2AHJ B;  1VQP Q;  2MYS A;  1M9S A;  2E70 A;  1K4U S;  1NLO C;  1NJI R;  2F2X A;  4PJO C;  2CH4 W;  3JRZ A;  3SB2 A;  2HDA A;  1OZ3 A;  1YP5 A;  3CCR A;  2R58 A;  3LH5 A;  2ABL A;  4RMO A;  4PJO E;  3AT1 B;  3G1J A;  4M77 A;  1MMA A;  4FL6 A;  4BB7 A;  1KC8 U;  1YI2 A;  2VUB A;  3CCL A;  1TOV A;  5FU6 C;  2RK2 A;  1YIT A;  3CME A;  2QK0 A;  4RTZ A;  3HRS A;  4EMG A;  2V8K A;  1IO6 A;  3QDF A;  1QCF A;  3CCU A;  2O2O A;  1YJN T;  3NMZ C;  4EPC A;  4JDS A;  3CCV A;  2Y4X A;  1OU9 A;  3EGD A;  2JXB A;  1VOM A;  2NUP B;  1VQL A;  2MPX C;  4ZN1 A;  5LJ3 h;  3MP8 A;  1GXI E;  2FPD A;  2L5Q A;  2CH4 A;  5CO7 A;  1I81 A;  1KJW A;  1Q86 R;  2KVQ G;  4QKU A;  2JTF A;  4RCC A;  3JCM d;  2FVU A;  3NPF A;  3LWH A;  3JSC A;  3CD6 A;  1EX4 A;  3CBM A;  4UC4 A;  3MEV A;  2DTI A;  2HAX A;  4KGX B;  3OYJ A;  3OYK A;  2QTX A;  3URG A;  1QW1 A;  5GAO q;  2NUZ A;  1UGR B;  2LJ0 A;  2JUF A;  3QHS A;  3M57 A;  3GLX A;  4P5N A;  1H3Z A;  4C8Q G;  3PE0 A;  2P4R A;  1ABO A;  4JRI A;  1NG2 A;  3O8V A;  3BDL A;  1S72 A;  2XU8 A;  5LJ3 f;  2NUT B;  3JB9 D;  4PLL A;  1KHI A;  2LMJ A;  4HVW A;  1SRL A;  2M51 A;  1JQQ A;  4KH0 B;  3QDR B;  2RF0 A;  1RI9 A;  5C6S A;  2D8J A;  4OML A;  3SDZ A;  1G3W A;  1M1K C;  2BTT A;  1N9S A;  2K2V A;  3SEM A;  2R57 A;  5LJ3 e;  4DBH A;  4E7K A;  5FRN A;  2AKL A;  2PU9 B;  2CGH A;  3CCQ A;  2QDY B;  1BB9 A;  2DXT A;  4RKU E;  1K8A U;  2CDT A;  1WXU A;  2EKO A;  3VS2 A;  3X24 B;  2PVO B;  4QVC A;  1PSF A;  2YXY A;  3QXE B;  3L2R A;  2XD0 A;  1BU1 A;  3EFO B;  2KQW A;  1Y71 A;  4C0D C;  3JCM J;  3HTR A;  2QXF A;  4DBF A;  1VQ5 T;  1SSF A;  4KBM B;  4ZNX A;  5CKD A;  2MAM A;  4OMP A;  1Q81 C;  2E65 A;  3H0F A;  2MI6 A;  8ATC B;  1BI3 A;  3HSB A;  2O88 A;  3CC2 Q;  4AG1 C;  2X4X A;  4NOY A;  2XK0 A;  3TRE A;  2H8H A;  2E10 A;  2KNB B;  2DAQ A;  3CBO A;  3M4G A;  2DNU A;  4IUU A;  1IGU A;  2CP6 A;  2NYS A;  1YWP A;  4A53 A;  3CCJ A;  3SHW A;  1OEB A;  2JM8 A;  1OOT A;  4RTU A;  2LCL A;  4XTV A;  2YRV A;  1NBE B;  1I4K 1;  2CS7 A;  2ENM A;  3QSU A;  2EFI A;  5CKE A;  2DL8 A;  4C5G A;  3JCM X;  2SEM A;  3CCM T;  1W2B P;  5EC7 A;  1TUD A;  3V8L A;  3RDV A;  3OS5 A;  2XIC A;  5CCA A;  3C94 A;  2NUT A;  3O5Z A;  1K76 A;  1AZE A;  2GCX A;  5KYX B;  1D0Z A;  4OB2 B;  3VJP A;  3G6E Q;  4OGE A;  5CKF A;  3G4S A;  2MCN A;  2KMT A;  3EG3 A;  3TSW A;  2OTJ T;  2CRE A;  2LC4 A;  4J5Y A;  4PK4 A;  1T0J A;  1CKB A;  1MMG A;  1VQM A;  1HJD A;  3JCM h;  1WJS A;  2YUP A;  4AMC A;  3G71 A;  5ECA A;  1QCO A;  5IHN A;  3MEU A;  3LW5 E;  1YIJ T;  4C8Q A;  4EMH A;  1JXM A;  4IUV A;  3G7Z A;  3CC4 A;  1KQ2 A;  4AFS C;  1VQ8 T;  1KHC A;  1X6B A;  3DKM A;  4DA4 A;  3BDU A;  3ZBD A;  4R55 A;  3CMA Q;  4J9B A;  1BCO A;  3H6Z A;  1OU8 A;  1EZZ B;  4X9C A;  1X75 C;  1M5Q 1;  4HT9 A;  3EFO A;  5D6X A;  2IG0 A;  1WJQ A;  4MZM A;  3MET A;  4KH1 B;  3OS0 A;  2XG8 D;  1IZ6 A;  3NTH A;  1QVG P;  3CPF A;  3MHX A;  2LVM A;  4WF2 A;  5GAO l;  2DE0 X;  3C12 A;  4M7A E;  3OBY A;  2KGT A;  3FDR A;  2FZK B;  2YHT A;  4Z02 A;  2YUQ A;  4M75 B;  4JS5 A;  3JCM f;  2G3R A;  1MV0 B;  2VKN A;  2LQK A;  4M7D D;  3ASK A;  3RNJ A;  2RJC A;  1HYO A;  4ZGJ B;  1UGP B;  4XU2 A;  1SRM A;  4C92 C;  3EFR A;  2WSC E;  3M0S A;  4DOW A;  4C92 E;  3CPW S;  1IHV A;  2EKH A;  2ZAE A;  3CCR Q;  5KCO A;  1JBM A;  1LCK A;  1NLP C;  5LJ5 g;  4PJO D;  3JCM e;  2WSE E;  2KR3 A;  2K57 A;  1YI2 Q;  3IQL A;  2L2P A;  2QGF B;  4FYY B;  1VA7 A;  3OS2 A;  4X1V A;  1UG1 A;  5KYX A;  2J6O A;  1G8X A;  2OX7 A;  2K3Y A;  2H3J A;  3CME Q;  3CCE T;  4N0A A;  4M75 F;  2CP2 A;  2EWN A;  1BBZ A;  3V7S A;  1J3T A;  1VQ4 A;  5A0G A;  4NL3 A;  4OMM A;  1VQP T;  3EG1 A;  4II1 A;  2GF7 A;  2FL7 A;  8AT1 B;  3CCV Q;  4M78 C;  2KYM A;  1QWE A;  4HCZ A;  1W2B A;  1VQL Q;  1MV3 A;  2DZC A;  1D09 B;  4DBQ A;  4RG8 A;  2YLC A;  4M78 E;  2XMF A;  2HKQ B;  2BUD A;  1WXT A;  2I2L A;  2LQN A;  3V8K A;  1K8A C;  4L59 A;  2FB7 A;  1ZX6 A;  1X01 A;  1Q7Y R;  5I21 A;  2ZPF B;  3MJX A;  1YBY A;  1K9M R;  1Y57 A;  3CD6 Q;  4PJN A;  4PKC C;  2O9S A;  5GAN h;  5GAN 5;  2DVJ A;  3PMT A;  3E1S A;  3RUX A;  4AFQ C;  3V8J A;  1E6H A;  2KE9 A;  3JAM E;  4HXJ A;  2KXC A;  5GAN j;  3OMC A;  3VUB A;  1V1C A;  4M75 A;  1IRX A;  1X69 A;  2EAY A;  5GAM j;  4Y28 E;  1VQO A;  3A1P A;  1D1A A;  4D8K A;  3BFM A;  4QVD A;  1VQ7 A;  2ED0 A;  2CUB A;  2R5A A;  2HD0 A;  1WJR A;  3VS3 A;  2F2V A;  4QQG A;  3ZL7 C;  1C0M A;  2QTV A;  4KUL A;  1IRE B;  1JRI A;  2HNI A;  1C1A A;  5CQX A;  3JCM b;  1QKX A;  2DLP A;  2R5M A;  3HRU A;  2FPE A;  2IVW A;  1QVG A;  2C06 A;  2OTJ Q;  1H92 A;  4C5I A;  2RQT A;  1VIF A;  4F16 A;  4EMK B;  3M56 A;  2KRN A;  2CSI A;  2K7A A;  1N5Z A;  1SEM A;  3I5S A;  1ZUK A;  3JB9 J;  4KT0 E;  2DF6 A;  4KUD K;  2EQI A;  4LXC A;  4Z89 A;  1JB0 E;  2VXF A;  3HFN A;  3QO3 A;  2IIM A;  2E4H A;  4FYX B;  2OTL Q;  1M1G A;  1NEB A;  5GAN e;  1KG1 A;  1QMC A;  5GAM e;  1ZBJ A;  2M16 A;  1Y7X A;  5DM7 R;  3MP1 A;  2O9V A;  3PVL A;  1UUE A;  1YJW A;  2E41 A;  4J6W A;  1GCQ A;  2DEU A;  1RAA B;  4PJM A;  4F17 A;  1K1Z A;  3V7R A;  3EG0 A;  1G5V A;  4AFZ C;  3ME9 A;  2NLU A;  2EQJ A;  4JJB A;  3GBQ A;  2KT8 A;  2BIV A;  2AZS A;  1RAG B;  3OMG A;  2RQU A;  4E7Z A;  4BI8 B;  4BE0 A;  2DYB A;  1KQ1 A;  1ZSG A;  2EBP A;  4M4Z A;  2K9G A;  2EYZ A;  2FRW A;  4JS4 A;  3A8L B;  3HFO A;  2C0T A;  4AT1 B;  1UE9 A;  4M77 F;  5FRO A;  4A4G A;  2FYK A;  3JB9 I;  1HXD A;  4F7U E;  5IAY A;  1LPL A;  2DD4 A;  1UEB A;  4JPB W;  4AG2 C;  1G3Y A;  4JJD A;  1TU0 B;  2DKG A;  1BYM A;  4XTW A;  2QDL A;  4E7I A;  2DIL A;  2RHY A;  3G4S Q;  1N27 A;  3RR6 A;  3CEY A;  5LL6 S;  2GTJ A;  2RA2 A;  5L23 A;  4ELZ C;  1NYF A;  4EMK A;  4M75 C;  1U3O A;  3CC2 T;  5LJ5 d;  3R6N A;  4J6Y A;  3VS0 A;  1VQM Q;  4HCB A;  2BKD N;  2LT4 A;  3G71 Q;  1KQS P;  1ZUY A;  2VV5 A;  1OX8 A;  4ESR A;  2RNA A;  1MMN A;  1CKA A;  3P8B B;  3CXC S;  3CC4 Q;  2QEX A;  1U06 A;  1PKT A;  4J9F A;  1VUB A;  4QQD A;  3REA B;  3L2Z A;  1H64 1;  1FMK A;  3I56 A;  3LGF A;  4ORZ A;  1R0C B;  3RES A;  3VUZ A;  4OMO A;  3VRZ A;  2EYX A;  3A8M B;  4GBQ A;  1B34 B;  1FXX A;  3VS5 A;  4J9D A;  2C0O A;  3GIB A;  5A0L A;  4MDX A;  2L3P A;  2M0O A;  5DY9 A;  1PWT A;  3TVT A;  3H41 A;  4J7I A;  3R6O A;  4Y92 A;  3G6E T;  3JCM c;  1Z9Z A;  1Q7Y U;  3OB9 A;  1K9M U;  4M7A D;  5FWC A;  2KRO A;  2JZ2 A;  2MWO A;  4C0Z A;  2JVV A;  2LJ3 A;  2LZ6 B;  1QVF S;  2AT1 B;  1NPP A;  3OW2 S;  2GNC A;  1ZA1 B;  2F5T X;  5GMK l;  3ZFJ A;  1I8F A;  2K3B A;  4OVA A;  9ATC B;  4C92 D;  3JB9 G;  3CMA T;  2A36 A;  3OYG A;  2ZZD A;  5LJ3 j;  4LN2 A;  2OAW A;  1GCQ C;  3QYH B;  2RB6 A;  2CP5 A;  2F5K A;  4HA8 A;  2DL7 A;  2B8A A;  5HK0 A;  2BE9 B;  3M0P A;  1AOJ A;  4KUI A;  1Y0M A;  1ARK A;  2K5L A;  1M27 C;  3SFM A;  3FRN A;  4JRK A;  4EDU A;  3D7S B;  1UGV A;  1VQ4 Q;  2YDL A;  1GL5 A;  1MUZ A;  2MK5 A;  2F2W A;  1WNL A;  3I35 A;  1M30 A;  2L8D A;  1X2Q A;  4MML A;  1YJ9 Q;  1JJ2 S;  1FWZ A;  1E7O A;  2X4W A;  1BI1 A;  1MND A;  3VS4 A;  2DBK A;  1Q95 G;  3A5Z B;  4R56 A;  3DLM A;  4M78 D;  5GMK h;  2OJ2 A;  1VQK A;  3GP8 A;  3CCR T;  3UT1 A;  1PG5 B;  4BY6 B;  5FU7 C;  1B34 A;  3WVE B;  2DIQ A;  3TEE A;  1M8M A;  1N8R R;  2QI2 A;  1YI2 T;  1UHF A;  2X3W D;  4WTO B;  4XTX A;  2BZY A;  4OB1 B;  3CME T;  2A37 A;  2JM9 A;  4C8Q B;  1G2B A;  5A2Q E;  3X25 B;  1KQS A;  1QP3 A;  1SHG A;  2EPD A;  1VQO Q;  1AVZ C;  2VGM A;  3I9Q A;  2C0I A;  1I5O B;  1UGQ B;  1PHT A;  4XTY A;  3CCV T;  5LJ5 h;  4M77 C;  3JB9 F;  5KE2 A;  1VQL T;  3S3M A;  3RKY A;  4ZTF A;  2HSP A;  1ZLM A;  3M59 A;  4M77 E;  2E6N A;  1TUG B;  2ROT A;  4XTU A;  4QW2 A;  1D3B B;  2DRK A;  2LP5 A;  1WFW A;  1ZBX A;  4A4K A;  3CCS A;  3CD6 T;  2PVG B;  3THK A;  1M8V A;  2K5I A;  1ACM B;  1MGQ A;  3HRT A;  4DEY A;  4BDY A;  4DEX A;  4C8Q F;  1OUL A;  3CBP A;  5GMK e;  4IUQ A;  3EHR A;  4DQ2 A;  2DM1 A;  5D7U A;  2VAS A;  3CC7 Q;  4J6X A;  1G3S A;  5LJ5 f;  1AWJ A;  3I55 A;  4E7H A;  3EFS A;  1E6G A;  2RD1 A;  2WSF E;  3X28 B;  1S72 T;  2RO0 A;  4OMF B;  3NGP A;  1SKU B;  1I5L A;  1K0S A;  1NJI U;  5GAO p;  1O75 A;  2FEI A;  1U8R A;  3L42 A;  2EYY A;  5J26 A;  3A8O B;  3VU3 C;  3H8Z A;  2AIR B;  1K0X A;  1W6X A;  1YJW Q;  2QA4 A;  1DJ7 B;  4XQ3 A;  1X6G A;  3FLG A;  2VWF A;  1OI1 A;  4PNO A;  3UA6 A;  3AHU A;  1KC8 C;  4KGZ B;  2O01 E;  2DJQ A;  2CP3 A;  1ABQ A;  1GFC A;  4EIK A;  2LX7 A;  1SF9 A;  3CCE A;  3H0H A;  4L6V 5;  5HY6 A;  1RI0 A;  1M90 R;  2ROL A;  4M7D G;  2DFU A;  1Q82 R;  3CCQ T;  1Q7Y C;  2RM4 A;  1K9M C;  4OMN A;  1NYG A;  2EYQ A;  2RJE A;  5FW9 A;  5KYY B;  5GAN 8;  2OTL T;  2RI3 A;  2A08 A;  1M1K R;  1BI2 A;  4HVU A;  3FJP A;  1VYU A;  2VGN A;  2BZ8 A;  4PL6 A;  2W0Z A;  5CAI A;  3PTA A;  1PRM C;  2RHX A;  1YN8 A;  4PJO G;  1D3B A;  2FG0 A;  1Q86 U;  2JW4 A;  2ESW A;  1LOJ A;  3OYD A;  2MMP A;  2PZ1 A;  4OP0 A;  1ZQ1 A;  2RK1 A;  2ZPI B;  3QKJ A;  2DER A;  1VQ9 A;  2LT1 A;  2DK3 A;  3OY9 A;  2L3S A;  1WPY A;  2HQH A;  4GLK A;  3MPU B;  1AWX A;  2RI5 A;  4M7D B;  2LJ1 A;  1BCM A;  3QZ5 B;  2DX1 A;  1UFF A;  1YNZ A;  3C95 A;  3QII A;  1KFZ A;  5GAN 3;  2QEX Q;  4BDZ A;  1D1B A;  1WDX A;  3I56 Q;  2QAZ A;  1VQ6 A;  1AHJ B;  5DLQ E;  4XTZ A;  2Y90 A;  2PUO B;  3L2W A;  4PJO B;  3CCL Q;  2HL3 A;  3M0R A;  3QUI A;  1RL2 A;  5L8R E;  1YIT Q;  4CC4 B;  4CC2 A;  1EFN A;  1YCS B;  4PFP A;  1RLQ C;  1ZSZ B;  4JJN K;  1BKB A;  2FZC B;  2KEA A;  5KYN A;  1IXD A;  3G4S T;  2EGA A;  3PMI A;  1XNI A;  1M2V B;  3CCU Q;  1N8R U;  4PJL A;  3VYG A;  3U23 A;  3JCM P;  1UDL A;  3OYM A;  3EH2 A;  4M7D F;  2GFU A;  3A98 A;  3HPW A;  5FU6 B;  2EJF A;  1X2K A;  1VQM T;  3S3O A;  5FLX E;  4BE2 A;  4FU6 A;  3G71 T;  3SWN B;  2HBP A;  2ZCF B;  3KBG A;  4TVR A;  4A63 B;  1OZ2 A;  1I1J A;  1N6A A;  2LRQ A;  1M4Z A;  4RG2 A;  7AT1 B;  1R8O B;  3CC4 T;  2AKK A;  2LQ8 A;  2VXE A;  2RN8 A;  5KYY A;  5GAO n;  1GRI A;  4OGC A;  1YHQ A;  3VKI A;  2RMO A;  2P0K A;  4BY6 C;  2HQE A;  3E19 A;  1K9A A;  3M0Q A;  3E2U A;  2FPF A;  1D1C A;  3LX7 A;  3P8D A;  4LDW A;  2ED1 A;  1QLY A;  2RJF A;  2YWW A;  2F69 A;  5EG2 A;  2PTK A;  2ATC B;  4V2S A;  2CP7 A;  4C8Q C;  4RTV A;  2HEQ A;  2CP0 A;  2YUN A;  2ZGW A;  1IGQ A;  2JS2 A;  2LNH B;  1FMW A;  2JTE A;  3MO8 A;  2RQV A;  3OSS C;  4M7D A;  2DXU A;  4K11 A;  4LDU A;  3PVQ A;  1S72 Q;  2P0P A;  2LCC A;  5IXB A;  3QG1 A;  4N4G A;  4OB3 B;  1YFN A;  4PFZ A;  3MEA A;  4J9G A;  2KK4 A;  5HCK A;  1Y07 A;  3RBB B;  1YWO A;  1VQK Q;  5GAO m;  3GNG A;  1Z9Q A;  4MZT A;  3EAE A;  2XDB A;  1C6V X;  4QT7 A;  4IUT A;  1PD1 A;  2CZ1 B;  1VQN A;  2XKO C;  3VRY A;  2XI9 A;  2NWM A;  5I11 A;  2EGE A;  4PJO A;  3JCM W;  1NJI C;  2JTM A;  1I07 A;  1GFD A;  1AWO A;  1ZSZ A;  1QKW A;  1WHJ A;  1KD1 R;  5CQY A;  3FB9 A;  2M9U A;  3CCQ Q;  1M2V A;  3OYL A;  1VQ4 T;  5GAN 7;  4NL2 A;  4J83 A;  5D6W A;  3M9Q A;  5GJW B;  2A7Y A;  1WZO A;  1YJ9 T;  3SWN A;  2DET A;  2JMA A;  3V7C A;  3L1A A;  5FWB A;  2A3L A;  1M90 U;  3HKS A;  1Q82 U;  3PIP A;  1BI0 A;  2PVD B;  1RAI B;  2DXC A;  4XAX B;  1PRL C;  3ER0 A;  1M1F A;  2KY9 A;  1TSF A;  4J9I A;  3BY7 A;  4M77 D;  4N0A C;  2PUK B;  1D0Y A;  2JS0 A;  2XDD A;  3A8G B;  1S1N A;  3CCS Q;  4FYW B;  4C0D B;  3C0C A;  3J80 E;  3RMS A;  3LGL A;  4LUD A;  4B9X A;  2HL5 C;  4BI4 A;  5KH6 A;  5GJV B;  1RAH B;  3CCJ Q;  3NFC A;  3G6E A;  1AZG B;  1M3B A;  3HHT B;  2V1R A;  1PKS A;  1Q86 C;  1XQH A;  3T9N A;  3X20 B;  3VV0 A;  1K8A R;  1YJN A;  2CKK A;  3KXT A;  2LDM A;  4JUV A;  1VQO T;  3RER A;  2MF2 A;  2KYB A;  1OPL A;  4ZGE B;  4L5G A;  1W2B S;  3TSZ A;  3J7A F;  1QWF A;  2QQB A;  2E3H A;  4R0K A;  2ZPG B;  1W70 A;  2E1H A;  3L2V A;  5AYF A;  2GQI A;  2QA4 Q;  4O6J A;  3NTI A;  1XTD A;  2X9H A;  1NE8 A;  3N5B B;  5IHI A;  4E7J A;  1GCP A;  1WIE A;  2D0N A;  3OYY A;  5CKB A;  2DD5 A;  2D0Q B;  2E3I A;  3UAT A;  4BI3 A;  2CT3 A;  1VYV A;  5IXF A;  1BIA A;  4F14 A;  5CIU A;  2EGC A;  2HQX A;  2EQU A;  4M75 E;  4Y91 A;  4M7A G;  3EH1 A;  2P4T A;  4N4I A;  2D8H A;  1N9R A;  2XDP A;  4XU1 A;  1X43 A;  4E7L A;  2GQV A;  4IIM A;  4BUG A;  5GAN g;  3CC7 T;  1N8R C;  3GF5 A;  1RAD B;  2YT6 A;  4BAC A;  1RAE B;  1FYN A;  2ECZ A;  4ATO A;  5GAM g;  2EVR A;  2XID A;  1WHH A;  2CZ6 B;  4NS5 A;  2XHC A;  3EG9 B;  3OYA A;  3CPW P;  4C92 G;  3H9N A;  2KAF A;  2VB6 A;  2JNG A;  4IUP A;  4A54 A;  1Y96 B;  3FJ5 A;  5M9O A;  3OYH A;  3L2Q A;  1QVG S;  1YJW T;  1ZSZ C;  1HSQ A;  2FZG B;  1UB4 A;  1MMD A;  1VQ9 Q;  1WLP B;  2KBT A;  4XU0 A;  4M7A B;  2F1L A;  5KYW B;  3OA6 A;  1NPR A;  3PT9 A;  2MIO A;  5J3B A;  2A28 A;  3SWN C;  2HCK A;  2L89 A;  1VIE A;  4B9W A;  4ZGD B;  3MCA B;  4OMQ A;  3VS6 A;  1GBR A;  3M5A A;  2DO3 A;  1VQ6 Q;  1RUW A;  1V76 A;  3JV3 A;  4JRQ A;  4C92 B;  1WHL A;  4CC3 A;  1U1S A;  4M78 G;  4RTY A;  3OYE A;  3RKW A;  1PM3 A;  2X35 A;  4OF1 A;  2O31 A;  2QYZ A;  3OYI A;  4E47 A;  2VYT A;  1VQ5 A;  2L3Q A;  4XU3 A;  2JJ9 A;  2Y4Y A;  2WAC A;  1SHF A;  4PJJ A;  4FIB A;  1PCX A;  1G3T A;  2LNV A;  2V8J A;  2HBW A;  1PC0 A;  4M7A F;  5GMK i;  3C4S A;  4IIO A;  4D6W A;  3EGX B;  1WYX A;  2X4J A;  3FEO A;  1K73 R;  2DZ9 A;  3UPU A;  3VS7 A;  1KD1 U;  4Q5W A;  2VC8 A;  4WCI A;  4FW2 A;  2QEX T;  2O4X B;  3PNW C;  3TU4 K;  4D8D A;  3CCM A;  3M4Y A;  4RTX A;  4C92 F;  2E6Z A;  4M78 B;  3UWN A;  3I56 T;  5HK3 A;  1X6O A;  2D6F A;  2YRC A;  3OQ5 A;  1YHQ Q;  2E64 A;  5GMK j;  1LVK A;  2IPO B;  3VS1 A;  3EG9 A;  4EMK C;  1M90 C;  1UEC A;  2KSS A;  2DMO A;  3CCL T;  5GAN 2;  1Q82 C;  4JLG A;  4FT2 A;  4DBR A;  1PSE A;  1YIT T;  1Y96 A;  2YSQ A;  3PGG A;  2D9T A;  5FRM A;  2SRC A;  4FM4 B;  2G6F X;  2OTJ A;  2PQW A;  1X27 A;  2OAU A;  2I0N A;  3CCU T;  2VVK A;  4M7A A;  3CQT A;  5I22 A;  4AFU C;  2DIG A;  5KYW A;  1VQ7 Q;  1B07 A;  3NHN A;  4MZP A;  1OQK A;  2DBM A;  3M55 A;  4C8Q D;  3M53 A;  1H3H A;  1YIJ A;  2COZ A;  3OYC A;  2FO0 A;  3M54 A;  3DB4 A;  4J9E A;  1VQ8 A;  4JLI A;  1PNJ A;  1TWB A;  2H3E B;  4M78 F;  1R0B G;  5LJ5 j;  2HZY A;  2K79 A; 
#chains in the Genus database with same CATH homology
 1YJW Q;  1VQ9 Q;  1Q82 R;  1VQ5 Q;  1VQM Q;  1VQO Q;  2QEX Q;  1YIJ Q;  3CC7 Q;  1W2B P;  1YHQ Q;  3G71 Q;  1YJN Q;  3CMA Q;  1KQS P;  3CC2 Q;  3CCR Q;  1VQN Q;  1YJ9 Q;  3CCJ Q;  1VQ8 Q;  3CCE Q;  1N8R R;  1VQK Q;  1VQ7 Q;  3I56 Q;  3CPW P;  1Q81 R;  1NJI R;  1KD1 R;  1K73 R;  3CCQ Q;  3CCM Q;  3CCU Q;  3CC4 Q;  1QVF P;  1VQ6 Q;  1JJ2 P;  2QA4 Q;  3OW2 P;  1Q7Y R;  2OTJ Q;  1M1K R;  1K9M R;  3CD6 Q;  3G4S Q;  3CCV Q;  1K8A R;  3CXC P;  1YI2 Q;  2OTL Q;  3CCL Q;  3CCS Q;  1S72 Q;  1VQP Q;  1QVG P;  1KC8 R;  1VQL Q;  1VQ4 Q;  3I55 Q;  1M90 R;  1Q86 R;  3CME Q;  3G6E Q;  1YIT Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...