4M75E

Crystal structure of lsm1-7 complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
75
Chain Sequence
b'ILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDSRNEKVMQHHGRMLLSGNNIAILVPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 10
structure length 75
sequence length 79
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75E00
1YCYA 4M7AB 4Y91A 2DXTA 5CAIA 2QTXA 1M8VA 2DZ9A 5GAMh 2K57A 1B34B 3QHSA 3JCMc 5GAMd 4JRKA 4C8QB 5GAMg 3HFNA 3JCMf 4PNOA 2DTOA 5I21A 4M7DG 3EFRA 1H641 5GAN2 3SWNA 1TH7A 3RKXA 2VC8A 1KQ2A 5GAN5 5GAOl 4EMHA 4M78F 4C92G 5LJ3j 4XU3A 1I4K1 2RA2A 4V2SA 3RERA 1JRIA 3V7SA 4XQ3A 5GANf 5GAN8 3INZA 2RD1A 4M75G 5GAMj 4M7AC 1JBMA 3QSUA 5GAOr 1U1SA 4XU1A 4M78G 4C8QC 1WPYA 4XTUA 2RB6A 4M78E 2E10A 5GMKe 5GMKm 3BFMA 4M7DD 1HK9A 4RCBA 5LJ3h 4M7DF 4EMKA 1LOJA 5LJ5e 2YLCA 5LJ3d 2DTIA 2DZCA 2DXUA 3RKWA 4C92D 2DTHA 5LJ3g 2FYKA 4M77B 4C92F 3RIRA 5GAOn 4M75D 3PGGA 3EFSA 3L1AA 4F7UB 3JCMX 3JB9I 3RKYA 4DQ2A 5GANj 4M75F 4C92A 2E1HA 2HNIA 3HFOA 4M7AG 4M7DE 4PJOB 3V8LA 4X9DA 4M78D 5DY9A 4XTVA 3JCMh 4HT8A 4M75A 3JCMd 4C92E 1MGQA 4JLIA 2DEQA 3SB2A 3JCMg 1I8FA 3L2ZA 4J6XA 4M78A 4M75E 2EAYA 4M77C 5GANh 2E64A 3RESA 5GANd 2RM4A 5GANg 1D3BA 4N0AA 4XU2A 5LJ5f 4MMLA 4XTYA 4M7AD 4XTXA 1BIAA 4HT9A 4PJOC 2E41A 4M7AF 5GAN3 2FB7A 5GAN7 3V8JA 5GAOm 3SWNB 4C8QD 4M7DA 4C8QF 1WQ7A 4M7AA 3JCMJ 2YHTA 3V7CA 1HXDA 1KQ1A 1Y96A 4RCCA 3VU3C 3BDUA 4NL3A 1BIBA 2Y90A 3BY7A 4M78B 4QVCA 3JCMb 1I81A 4MMKA 1WNLA 1X01A 1I5LA 4M7AE 2YLBA 5GMKj 3JB9D 4M77G 2EJ9A 3V8KA 3QUIA 4C8QG 3JCMQ 4C8QE 3RUXA 5LJ5j 3V7RA 4F7UG 4JUVA 2EJGA 4J6YA 4QVDA 4PJOG 4EMKB 3SWNC 1M5Q1 3BW1A 5LJ3e 3GIBA 4NOYA 4XTZA 4M7DB 3JB9F 1Y96B 5GMKh 4X9CA 4M78C 5GAMe 3FB9A 2DJZA 4A53A 2JN0A 2EJFA 4C92B 4J5YA 4M77D 1N9SA 5LJ5h 2VXEA 2E65A 2DKGA 2ZGWA 5GMKl 5LJ5d 4M77F 5LJ5g 4OP0A 2I2LA 4N0AC 4M75B 3JB9G 3FJPA 4NL2A 4WF2A 3JCMW 3JB9H 4F7UF 3JCMe 4PJOD 4M77A 4A54A 3FIFA 4EMKC 1B34A 1LNXA 1N9RA 4PJOF 4C8QA 2VXFA 5GAOq 3AHUA 4F7UA 4M7DC 4J6WA 1U1TA 3QO3A 1LJOA 2DVEA 3M4GA 4M77E 5GAOp 4PJOA 1D3BB 4JRIA 5GANe 3JCMV 4C92C 4F7UE 5GAN6 3JB9J 5LJ3f 4EMGA 4XTWA 3JCMP 2EWNA 2CGHA 5GMKi 3HSBA 4PJOE 5GAN4 4XU0A 4M75C 4HA8A 5GAMf 1WQWA
chains in the Genus database with same CATH superfamily
2W0ZA 4J7IA 3R6NA 1B34B 3LH0A 3QHSA 3JCMc 5GAMd 3OYLA 1M1KC 3UA6A 4C5EA 2DTOA 1YJWQ 4P5NA 3L42A 1TH7A 4J9DA 2JTFA 2JJ9A 3MKDA 3OYIA 1Q81U 2RK2A 2KRSA 2P4RA 5GAMj 1YJNT 3UPUA 4GBQA 1VQ8Q 1VQ6T 1K73C 3OYCA 2LTOA 2G3RA 4BD3A 1RUWA 2LC4A 1WX6A 2CZ7B 2DXUA 2RPNA 1IHVA 1OEBA 2EYWA 2DD4A 2M0OA 4F7UB 3PVLA 3REAB 2DL8A 5FROA 4DEXA 5EG2A 3CBMA 1WZOA 3NFCA 4GLMA 2KR3A 3CBOA 4B9XA 1ZA1B 5GANg 2HKQB 2YUOA 1UGPB 4XTXA 2QQ9A 1NJIU 3EFOA 4AFSC 3CCUA 2JT4A 1WHKA 2COYA 5CKDA 1VQNA 2FRYA 2L3PA 2E6ZA 4LDXA 5GMKj 4FYYB 5J26A 3CCQQ 3CCMT 3OY9A 2HQHA 1OZ2A 1RAAB 1JO8A 4KUDK 3JB9F 5GMKh 1D1CA 3LYIA 2HBWA 2J7IA 4M75B 1IZ6A 1YJWA 4J83A 1B34A 4PJOF 5FRMA 2DILA 3QO3A 1LJOA 4BE0A 4ZGDB 2KE9A 1RACB 1VQ8A 3JB9J 1R0BG 2CSQA 2QGFB 1QKWA 2CH4W 2EYXA 3CCRA 2KK4A 2E70A 4XU0A 1VQLA 1SKUB 4E7LA 4KH0B 5GAMg 2MI6A 6AT1B 1YJ9Q 1VQKT 4IUTA 5LJ3j 4E7JA 3CCSQ 2EGCA 1WI7A 5CQYA 3PFSA 3X24B 2XK0A 1KC8U 1HYOA 3I55T 1VYTA 3VRZA 3OYEA 4K11A 4XTUA 4M78E 3BFMA 2ECZA 2FEIA 2LX9A 5LJ3h 3RKWA 2MIOA 2NUZA 1M3AA 2C06A 2ZCFB 4FU6A 1Z9ZA 3EFSA 2MWOA 4C5GA 3RBBB 3DB3A 4KUIA 1M2VA 3G6ET 2R5MA 1OU8A 4FL6A 4C92E 3CCQA 3SB2A 3M0PA 5KYNA 1K9MU 4D8KA 1Y57A 2RJFA 1Q95G 3A98A 4LUDA 3TSZA 1BI0A 1OI1A 4ELYC 2PVGB 3EGXA 3RMSA 2CREA 4A4GA 5KYWB 2DERA 1WQ7A 1FMVA 4X1VA 3J81E 1D1AA 1VQ7A 5IHKA 2JZ2A 1M2OA 5LJ5j 4J6YA 1Q7YC 4RTZA 1E6HA 3HHTB 1UHFA 2V8JA 4M7DB 5FWCA 3QBYA 3OS5A 4X9CA 4M78C 2JN0A 1YP5A 4FSXA 1IRXA 4ZN3A 5LJ5h 3X25B 1YJ9A 4DA4A 3JB9G 3JCMW 2PNIA 3JB9H 1UGQB 4PJOD 4M77A 4EMKC 1Q81R 2O01E 3CCSA 2KNBB 2E4HA 3AHUA 3CD6T 1YNZA 1U8RA 2VASA 3M54A 1NPRA 1I1JA 4C92C 5GAN6 1VQMQ 4ANJA 1NG2A 2XHCA 1N8RU 4RTWA 2OAWA 2HL5C 4JRQA 3CMAQ 3O8VA 4JRKA 3OSVA 5KE3A 3C4SA 3M4YA 2O4XB 2KBTA 2JTMA 4XU3A 2YUQA 5GANf 2RD1A 1VA7A 4ZGJB 2NLUA 3M53A 1WPYA 1ZUKA 5GMKm 1H3HA 2HQEA 1R77A 1NJIR 4RCBA 1NM7A 4Z02A 2DXBA 2K5LA 1QWFA 1UTIA 2AK5A 4X9DA 4C0ZA 5IT9E 4N4HA 5KYWA 4ZTJA 2BKDN 5A0GA 2V1RA 2PU9B 3QZ5B 3VYGA 1SRMA 1QVGA 4HCZA 4XU2A 1EIFA 4MMLA 2D6FA 2VUBA 3V8JA 4M7DA 2ABLA 1VQ9T 4E7IA 3OSSC 2NUTB 2ZPBB 5KH6A 5L23A 3VS1A 2BE7D 3UT1A 1VQMA 3S6WA 2ZPIB 2J6FA 1O9SA 3FB9A 2NWMA 3L2QA 1WIEA 4HCKA 1WXUA 2VGNA 2R57A 2I0NA 1M1GA 4L59A 2E5QA 4J6WA 1KC8R 1WHMA 4DBRA 3CEYA 3S3NA 5HKCA 5KYUB 3RNJA 4BY6B 4M7AB 1PG5B 3MJXA 2D0NA 2RI5A 1OOTA 3I56A 5CO7A 1H641 3LWIA 4JJNK 4M78F 2OTJQ 1JJ2A 3INZA 1E7OA 1K9MR 4XK8E 5I2MA 3QJYA 1I0CA 1K4US 1U1SA 4QQGA 3CC7Q 3MPUB 1VQ4Q 2QEXQ 2QA4T 4PJLA 3HL8A 1JXMA 4C92F 4C0DB 2RQWA 2DPPB 1QVFP 2KYMA 3RKYA 1N6AA 3H0IA 4JLIA 2M0YA 2DXCA 1C6VX 2H8HA 5CKHA 3OA6A 2MCNA 2M51A 2KT8A 2CYZB 5IHIA 1VQ5A 3GP8A 2KROA 5IXBA 2PVOB 2V8KA 2DMOA 1X69A 1KD1U 3PIPA 1JU5C 4HVVA 3VU3C 2CP2A 1NEGA 4Y92A 5FU7B 4QVCA 4R0KA 1ZQ1A 2YUPA 3OYJA 3NGPA 1WLPB 4KULA 1N8RR 4IURA 2XDPA 3M0TA 3OYMA 2ZPHB 1HJDA 2EJFA 3AT1B 2LX7A 3MO8A 2ZGWA 3MP6A 5J3BA 3PMTA 1ZA2B 1YIJT 5CCAA 4QVZA 4J9GA 2OTJA 2EFIA 4RMOA 4PJOA 1NYGA 2EKHA 2CUBA 2QDYB 4LDWA 2X4XA 3CC7A 1NPPA 1WQWA 2QEXA 5CKBA 1VQ4A 5CAIA 4Y91A 3A8LB 3L2VA 2DZ9A 1G3YA 2DA9A 1YITT 5C0MA 2A7YA 1QMCA 2EYYA 2LQWA 1X43A 3VV0A 1KIKA 3T9NA 1P92A 4J9BA 5I22A 2GTJA 3LWHA 2ED0A 3GBQA 1I5OB 1VQPQ 4XU1A 2XI9A 3BDLA 4M78G 3GPLA 1ZSGA 2DO3A 4C92D 1M90C 1ZBJA 2A3LA 4AG2C 5GAOn 1D0XA 2P4TA 5KE2A 3PTAA 3GLXA 3JCMh 4HT8A 2LCSA 4HCBA 2M16A 3OBWA 2O31A 2XDBA 3CCJT 2RQVA 3G71A 4JJDA 4N0AA 2P0KA 2X4YA 2K3YA 1QKXA 2QQRA 3JCMJ 3HRTA 1AT1B 3JRZA 2F2XA 1X01A 4C0FA 3CC4A 3CCLT 4F7UG 2WSEE 3QWXX 2DNUA 2LJ3A 3RR6A 1M5Q1 4EIKA 1AVZC 4B9WA 2BZXA 4RKUE 4M4ZA 3CCVT 1YJNQ 5GAMe 1MV3A 1SSHA 3J7AF 1VQ6Q 4IUQA 4KT0E 4RG2A 3OW2P 2CT4A 1UGSB 1GXIE 2CP0A 2I2LA 1TUCA 1X6BA 3IQLA 1VYUA 3EG2A 2A08A 1QVFS 3G4SQ 3JSCA 2QAZA 2F69A 2RHYA 3A8GB 3EFOB 4XTWA 3JCMP 1NZ9A 2HCKA 2KAFA 3NHNA 3EHQA 2LJ1A 4JDSA 1KHCA 4FYWB 2RHXA 3SHWA 1GL5A 1X75C 2OTLT 2LRQA 2GFUA 1D1BA 2EQJA 3OQ5A 4EMHA 4LDVA 4OMFB 2L0AA 3RERA 2JUFA 5FU6C 5GAN8 4M75G 4E47A 1ZSZC 4BI4A 2XIDA 4C0GA 5GMKe 3CCMQ 2D9TA 3CPWA 4A4EA 2RHIA 1KQSP 1G8XA 3F70A 1JQQA 3MEUA 4F14A 1YHQT 3VUBA 2R58A 3A8OB 4AFUC 1BI2A 4OB1B 2MOXA 1M3CA 1WFWA 1JEGA 2X3WD 1TWBA 3EGDB 1W2BA 2AZVA 2RMOA 3N5BB 4OMLA 3P8DA 4LD6A 2CP3A 1PD0A 1ZUYA 4XTYA 1LPLA 4RG8A 4QT7A 1VQ6A 1NLPC 1QW1A 3RDVA 4NL3A 5CKFA 1GFDA 1VIEA 2HKNA 1I81A 3L2RA 1R0CB 1QP2A 1VQKQ 2J6KA 4C8QE 3G4SA 2VB6A 1VUBA 4YTLA 1ZUUA 2J6OA 1WYXA 1FXXA 5LJ3e 1PD1A 4A4HA 1JXOA 2QDLA 4OB0B 4DOWA 2DJZA 1Q82C 3M0RA 2CP6A 3I55Q 2VXEA 1M2VB 3EG1A 1UDLA 1H3ZA 2JM9A 1NEBA 3UA7A 4BDYA 4JPBW 1D09B 3VJPA 1SG5A 3CCUT 4IUVA 3EGXB 3G6EQ 1M1FA 1PCXA 1OYXA 4AFZC 1VIFA 1RADB 3CCMA 4FIBA 5CVIA 2JTEA 5KYXA 1MMAA 2L3QA 4OGEA 5I21A 4M7DG 2YRVA 4DBFA 4XAXB 4PJNA 4V2SA 3I5SA 3V7SA 4CI0C 1AZEA 4A4KA 1WJRA 5GAOr 4C8QC 1HD3A 2J06A 1BBZA 2V26A 1ZLMA 3MEVA 4PLIA 1YJWT 3EGDA 4CC4B 4EMKA 5LJ5e 2WSFE 5LJ3d 3PIOA 4CC7A 4M77B 3I35A 2EQUA 4PFOA 2DF6A 4C92A 3OS0A 3CCRT 2LNHB 1YI2T 4BE2A 4F17A 1VQLT 3OW2S 2B86A 3X28B 5A2QE 2DL3A 4OVAA 4IIMA 3QIIA 3CD6Q 1OPLA 1D3BA 3MHXA 1AWOA 1KFZA 3OS1A 2O9VA 4GY5A 1T3LA 1M3BA 2SRCA 3WVDB 3C95A 2KY9A 3BDUA 1M1KU 3OYKA 1BIBA 2DL5A 4DEYA 4FSSA 2YLBA 4ORZA 2C0TA 3JCMQ 4JUVA 2FPFA 2FL7A 2X4WA 2ZPGB 4FM4B 3SWNC 3G6EA 2EPDA 2CZ0B 1H92A 2EBPA 2ROLA 3CCQT 1K0SA 2RI2A 5LJ5d 4FT4A 3FJPA 2ZPEB 2RN8A 3FIFA 8AT1B 3CPFA 1XTDA 1KQSS 1G2BA 5I11A 1EZZB 1WHHA 2BE9B 4FT2A 4F7UE 4E7ZA 1GCQA 3JB9D 2LT4A 3A8HB 4UC4A 2K57A 1VQ7T 2RH2A 1U3OA 3HFNA 4IIOA 3EFRA 1IHWA 2EW3A 2VC8A 3MEAA 5GAOl 4F04B 3U23A 3ZL7C 3CCET 1VQ9Q 3PNWC 3QSUA 4IUPA 4MZPA 2Z0WA 2O9SA 1OPKA 2FZGB 3CD6A 5DLQE 2RK1A 4LN2A 5LJ3g 2KSSA 3QZ9B 3EG9B 3OYDA 2FPEA 1RL2A 3H8ZA 2EYZA 3I9QA 3PGGA 4A63B 3GNFB 4DQ2A 3WVEB 2D8HA 4DBQA 2RNAA 4M7AG 4PL6A 5DY9A 1QQJA 4XTVA 3C0CA 2QASA 3M5AA 4M75E 2CT3A 2EAYA 3CXCP 2RM4A 3HTRA 2YWWA 3PVQA 2GBQA 2JXBA 5GAN7 1ZHIA 3M57A 4C8QF 3CC2Q 2KVQG 2A37A 2K5IA 2NYSA 1YBYA 1Y71A 4ZGEB 1OQKA 1ARKA 3URGA 3KXTA 1NBEB 2J05A 3LW5E 3EH2A 2AHJB 2FHDA 1K76A 1OV3A 1Y7XA 3EGUA 5A0DA 2PTKA 2PUOB 3LLRA 1ABOA 5LJ5g 4ZN1A 2FZKB 2QA4Q 3FJ5A 5HCKA 1N9RA 2H3JA 1FX7A 5CK9A 3M4GA 1GCPA 3VKIA 5I2SA 4N4IA 3X20B 3HSBA 2EWNA 3VS7A 1FMWA 1BYMA 1G3WA 1G83A 4M75C 5GAMf 2AT1B 3CMAA 2K7AA 2QI2A 4RTYA 2LP5A 1UG1A 1WXTA 1EX4A 2LNVA 3PE0A 3EG9A 1I4K1 3OMCA 3Q1JA 1JRIA 4HCCA 3LH5A 4RUGA 2V8IA 2X3XD 1ABQA 2JMAA 1Q7YU 2L3RA 3CBPA 3OYAA 3NTIA 3DB4A 2X51A 2DTIA 5LL6S 2F2VA 4OMPA 4OMNA 2JM8A 2K2MA 3M0QA 1T0HA 2R5AA 1TTHB 3CC2A 2RI3A 1M1KR 1TUDA 4FYXB 4M7DE 4PJOB 1MV0B 4CC2A 2JS2A 2DYIA 2KI7A 3ER0A 2DEQA 2RO0A 1YFNA 2HAXA 3E2UA 4C5HA 1V76A 2YRDA 3I56T 1BI1A 3RESA 3LGFA 1BI3A 1CKAA 2ED1A 2CDTA 1YWOA 7AT1B 2KXDA 1ZBXA 3ZBDA 4C8QD 2E6NA 4J9CA 3UATA 2QA4A 2K4YA 1BU1A 1CKBA 2GNCA 2WACA 1YITQ 2VGMA 2CZ6B 2KRMA 2DK3A 4C8QG 3SEMA 3C94A 3TCJA 1ACMB 1WXBA 4D6WA 2DETA 1PKSA 2JOYA 4KH1B 1M27C 2MMPA 1CSKA 4MDWA 2MAMA 2RQUA 3HRSA 4F7UF 3JCMe 4A54A 1VQ5T 3RMQA 1TS9A 1JB0E 3VRYA 4JS5A 4OB2B 3HRUA 4M7DC 1AWWA 1K1ZA 4GLKA 5GAOp 2O88A 5LJ3f 2L89A 3QJ6A 1MMNA 2HMAA 2PQWA 4HVWA 5ECAA 4FYVB 4MDXA 3CCJQ 2WSCE 4E6RA 2L5QA 3CXCS 2KT1A 5HK0A 3MCAB 2RJCA 1TXQA 1QCFA 2DX1A 2MYSA 3KBGA 3P8BB 4BB7A 5GAN5 1ZX6A 1UECA 1T0JA 4E7HA 4J9HA 4RTVA 2GFAA 4AMCA 2NUPA 4MZTA 1QCNA 3CCLQ 1HSQA 2VVKA 2BZYA 4L5GA 1LOJA 2MK5A 5IXFA 1UUEA 2COZA 2L2PA 5DLOA 3I5RA 3CCVQ 3JB9I 4M75F 2EGEA 2HSEB 4M78D 2LDMA 3JCMd 2QEXT 1QLYA 3HKSA 2D8JA 2DRMA 4Z89A 2ZAEA 1W1FA 5LJ5f 1K8AU 2CKKA 5KCOA 1TG0A 3WXMB 2DVJA 1HXDA 1RABB 1ZSZA 4EDUA 5FLXE 1Q81C 2BIVA 1UJ0A 2DEUA 4M7AE 4RTXA 3V8KA 5IH2A 3QUIA 3LGLA 1VQOT 1E6GA 1X27A 2SEMA 1PNJA 3SD4A 2QXFA 3C12A 2DBKA 4J5YA 1N9SA 1S1NA 2FRWA 1PWTA 1TSFA 2K3XA 3G71T 4J9IA 2DBMA 1FMKA 3VS2A 4FW2A 4JRIA 4HVUA 4EMGA 5IHNA 1Q7YR 1NJIC 3CCLA 4LE9A 3OYFA 2DXTA 2A0FB 3CC4T 1SRLA 1M8VA 3A5ZB 1LVKA 2FPDA 2HDAA 3P8HA 4ZNXA 2EQKA 1G3TA 1KQ2A 1QVPA 2DE0X 1UB4A 1RAFB 2RA2A 1F1BB 1Q86U 4O5VA 4BI3A 1OU9A 3CMET 4WCIA 1IREB 1I07A 4BY6C 4M7AC 2C0IA 2K3BA 1G5VA 1IGQA 2RB6A 4CRIA 2E10A 4OMMA 8ATCB 2RQTA 1VQPA 2RQRA 4BACA 5IN1A 4M7DF 2KYBA 4E7KA 2DZCA 2DTHA 4OMOA 3ZEHA 4ELZC 1KK7A 1WGSA 1BCMA 4M75D 5GANj 3MP8A 2MPXC 2QYZA 4AG1C 5KYYA 2L3SA 1MGQA 2E3IA 2QK0A 3QWYA 3JCMg 2E3HA 4OMQA 1WHLA 2MF2A 2HL3A 1PC0A 3QDRB 5GANh 5DM7R 5KCHA 5KYXB 2DL4A 4JJBA 3ULRB 1QWEA 4N4GA 1S72T 1KD1R 3CCUQ 2LZ6B 2LQNA 4JZ4A 4PKCC 1AWJA 2Y90A 4M78B 2BTTA 1DJ7B 2EVRA 2Y4XA 3JCMb 1KC8C 1V29B 4M77G 2IG0A 2O2OA 5EC7A 3V7RA 3UDCA 1N27A 1V1CA 4EMKB 3BW1A 1RLQC 4R55A 4XTZA 1PSEA 1UE9A 1QVGP 2RF0A 1AOJA 5FU7C 1AHJB 1TUGB 4LNPA 4RTTA 1YJNA 2VWFA 1FWZA 4C92B 4X34A 5D6WA 4ME7A 2DJQA 4N0AC 3S3MA 4WF2A 1M90U 2A28A 1OX9A 3E9FA 1TOVA 2VXFA 1B07A 2A36A 1K9MC 1D3BB 2BUDA 3TREA 3CCRQ 2AKLA 1YI2Q 1D0ZA 2Y4YA 1VQLQ 2KMTA 1MMDA 1GFCA 1OULA 1YCYA 5C6SA 2K5FA 4CC3A 3M56A 4BI8B 3UWNA 5GAMh 1QVFA 1UGVA 1AD5A 2QGGA 3G4ST 2M9UA 4TVRA 3CQTA 3SWNA 3OYNA 4XQ3A 1SPKA 3GOXA 1W70A 3VS4A 4BDZA 3O5ZA 3H6ZA 3OYGA 1K8AR 1VQNT 4M7DD 2DRKA 1LCKA 1SHFA 2YLCA 2ATCB 3ASKA 9ATCB 1EFNA 3NPFA 3RIRA 1XNIA 3JCMX 1X2KA 3V8LA 4J8OA 2XG8D 1Y07A 3JV3A 4KRTA 1H8KA 3L2ZA 4M78A 3L2UA 2YUNA 1N8RC 4HXJA 1JJ2P 2EQMA 1KSWA 1RAHB 4LDUA 2YSQA 4EPCA 4M7AF 4B6MA 2LMJA 2XMFA 4BUGA 3VS3A 4J9EA 4DOVA 3A8MB 3UF4A 3BY7A 1VQ8T 4ESRA 3HPWA 1I5LA 1VQ7Q 3MP1A 4KGZB 2EKOA 4OF1A 3QDFA 1UGRB 1VQKA 4Y28E 3E1SA 4LD9K 3GF5A 1TU0B 3QYHB 3OS2A 1YI2A 4HKEA 3GIBA 4ZTFA 5A0LA 1QP3A 1Y96B 3CCEQ 3SFMA 3EH1A 2K6DA 1UEBA 3I55A 2CH4A 5GMKl 2KGTA 3DLMA 4NL2A 2IVWA 1KJWA 2DYBA 1J3TA 4LUEA 1Q86R 4F7UA 3QYGB 5AYFA 5GAN4 2P84A 2FO0A 1K73U 1XOVA 4Q5WA 3H0FA 3PT9A 2CP5A 3JCMf 2XD0A 3ZFJA 1UJYA 5CKEA 2KXCA 2LCCA 1M30A 4E7SA 2HBPA 2RHZA 5CR2A 2HD0A 4PJMA 1BCOA 3L2WA 1BKBA 2ESWA 4JZ3A 1HK9A 1UHCA 5J39A 4AFQC 1YWPA 2ZZDA 1Q82U 1M9SA 3M59A 1QVGS 1WJSA 2HNIA 3TU4K 2KEAA 2OAUA 4M75A 3OYBA 4PK4A 3H41A 2DAQA 2KQWA 2YRCA 1IGUA 2DM1A 2F1LA 2FZCB 1YJ9T 1MNEA 3JAME 2AKKA 3G1JA 1Z9QA 4M7AD 1MUZA 2M1HA 2VYTA 3CCEA 3M0UA 3OW2A 3CCST 2E5KA 1NLOC 4VUBA 3V7CA 1KQ1A 1Y96A 3QPHA 1M90R 1N5ZA 4ATOA 3HP9A 3THKA 1WNLA 4Z88A 1GRIA 3QXEB 3M58A 3REBB 3KFVA 1W6XA 4KGVB 1KHIA 4PJOG 3OBYA 3BE3A 1W4SA 2PVDB 3QG1A 2EQIA 4IUUA 3LX7A 2E65A 1IB8A 1FYNA 4PFPA 4R56A 1R8OB 4M77E 1U1TA 2DVEA 2FVUA 2GCXA 4QQ6A 2EGAA 5HK3A 5GMKi 5FWBA 1Y0MA 1KD1C 1WA7A 2RJDA 2QQAA 4HA8A 1KQSA 2CUDA 2QTXA 4LXCA 1JJ2S 3I56Q 1SSFA 2LT1A 1XJWB 4PNOA 4OB3B 2RHUA 4MZMA 3KUFA 1RAEB 2DIGA 2PZ1A 3QKJA 1VQ9A 2B8AA 1G3SA 1X6GA 4C5IA 2QG9B 1D0YA 1AEYA 2FYKA 1GCQC 4L6V5 2AIRB 2YXYA 3HFOA 4BE1A 1VQMT 2KRNA 2ZPFB 3ME9A 5AT1B 1T3SA 2D0QB 5HY6A 2IIMA 3VYHB 3CMAT 4M77C 1VQ5Q 2E64A 2YT6A 3OYHA 2OJ2A 2W10A 5FRNA 4Z8AA 5GAN3 2COWA 5GAOm 3CPWP 2OX7A 5CQXA 2PUKB 3OYYA 5GJWB 2D1XA 2F2WA 1O75A 1NE8A 2NUPB 1MMGA 2EJGA 2O4XA 3TVTA 2CP7A 1YIJQ 2KDSA 1K8AC 2VV5A 1W2BP 3CC2T 2CS7A 1X6OA 1K73R 4A53A 1MHNA 4JRPA 3M9QA 2DD5A 2JW4A 1C1AA 2QQBA 2DIQA 3OMGA 2VKNA 4QQDA 1XQHA 4J7FA 5IAYA 1X2QA 3JCMV 1U5SA 2CGHA 5FU6B 1WJQA 3J80E 4NS5A 3NTHA 1ZSZB 1BK2A 1QCOA 3FRNA 1Q82R 4OGCA 3X26B 2XDDA 4PJJA 2LQ8A 2X9HA 3S3OA 4FCYA 2HQXA 3EG3A 3R6OA 2MWPA 1U06A 1JBMA 2NUTA 1NYFA 1WDXA 3TEEA 4IKFA 1B3QA 1PRLC 1RAIB 4O6JA 1VQOQ 1A0NB 2DFUA 2EYQA 2F5KA 4DBHA 1PHTA 2K2VA 5FW9A 3H9NA 1Q86C 3TSWA 1PKTA 1RAGB 2EIFA 2IPOB 1YIJA 3G71Q 3D7SB 2JNGA 3H0HA 1K9AA 1BIAA 2HSPA 5GJVB 3EG0A 2FB7A 2OTJT 5KYUA 2XICA 5D6XA 1YN8A 2CSIA 4M7AA 2YHTA 1MNDA 2V1QA 2C0OA 1UFFA 3CC4Q 1RI0A 4MMKA 4RTUA 2ENMA 3CC7T 3FEOA 5M9OA 1YITA 1VQ4T 1PRMC 2K79A 3VS5A 1KG1A 2JMCA 4NOYA 3CMEQ 3EAEA 2LVMA 1B7TA 3M0SA 4M77F 4OP0A 2HZYA 5KYYB 1GBRA 1WHJA 3VS0A 4KBMB 1LNXA 4QW2A 2DL7A 5GAOq 3VUZA 3NMZC 3META 2JS0A 2K9GA 5GANe 5L8RE 2OTLQ 4PJOE 2L8DA 3OB9A 1VQOA 1C0MA 2XU8A 4J9FA 3DLLA 3MEWA 4C8QB 4D8DA 3CCJA 1WHGA 2HEQA 3NTKA 2LCLA 5GAN2 3RKXA 1S72Q 1IXDA 4C92G 3CPWS 1OZ3A 3CXCA 1SF9A 1YHQQ 3E19A 3FC3A 1M4ZA 2GQVA 4KGXB 1YCSB 2RJEA 3SDZA 1AZGB 2XKOC 1W2BS 5D7UA 2BZ8A 3L1AA 3GNGA 1VYVA 2E1HA 2GQIA 3CCVA 4F16A 2P0PA 2LQKA 4AT1B 2DLPA 2H3EB 1I8FA 5D6YA 4J6XA 2FG0A 4PLLA 5GANd 3CMEA 4HT9A 2OI3A 3EHRA 2AZSA 1PM3A 2M02A 2E41A 4FW1A 4PJOC 1M8MA 2G6FX 2P0QA 2JVVA 2F5TX 3SWNB 2CZ1B 4II1A 4RCCA 4QKUA 3FDRA 4LDYA 1VQPT 3E9GA 2EJ9A 2QQSA 1BB9A 4JLGA 3RUXA 3G7ZA 1GBQA 1SEMA 2ROTA 1IO6A 4QVDA 1K0XA 4A4FA 2OTLA 1AWXA 2GF7A 4C0DC 4PFZA 4JS4A 1RI9A 2YDLA 2GTOA 4WTOB 4M77D 4JJCA 2DKGA 3M55A 2X4JA 1SHGA 1RLPC 1VQNQ 3FLGA 2E12A 3A1PA 1OX8A 2QTVA 1S72A 5CIUA 4C8QA 2LJ0A 2X35A 1PSFA 3TQ7P 2GGRA 1VOMA 1YHQA 3DKMA 4E2FB 3VS6A 3PMIA
chains in the Genus database with same CATH topology
2QEXA 5CKBA 1K73U 1XOVA 4Y91A 3A8LB 5CAIA 4J7IA 3L2VA 2DZ9A 4Q5WA 1B34B 1G3YA 3LH0A 3PT9A 3QHSA 3JCMc 5C0MA 5GAMd 3OYLA 3CMAA 1YITT 1M1KC 4C5EA 2A7YA 2QI2A 3JCMf 2XD0A 2DTOA 3VV0A 4P5NA 3L42A 1TH7A 2LNVA 3T9NA 2JTFA 3ZFJA 1P92A 5CKEA 1I4K1 3OMCA 3OYIA 1Q81U 3Q1JA 1JRIA 2LCCA 2RK2A 5GAMj 3LWHA 4HCCA 1YJNT 2HBPA 2RHZA 2V8IA 2HD0A 5CR2A 3UPUA 1VQ6T 1K73C 3OYCA 2LTOA 4XU1A 2XI9A 3BDLA 4M78G 3L2WA 2G3RA 2L3RA 3CBPA 1Q7YU 1BKBA 3GPLA 4BD3A 3OYAA 1HK9A 2LC4A 3NTIA 3DB4A 5J39A 2DTIA 2DO3A 2CZ7B 2DXUA 5LL6S 4C92D 2ZZDA 1M90C 2A3LA 2R5AA 1Q82U 1M9SA 5GAOn 3CC2A 2DD4A 2M0OA 2RI3A 3M59A 4F7UB 1QVGS 1WJSA 2P4TA 2HNIA 5KE2A 3TU4K 4M7DE 4PJOB 3PTAA 3GLXA 5FROA 2OAUA 3JCMh 4HT8A 4M75A 5EG2A 3ER0A 4HCBA 2M16A 3OYBA 2DEQA 3OBWA 2RO0A 2DAQA 2HAXA 2KQWA 3CBMA 3NFCA 4C5HA 2XDBA 3CCJT 3I56T 3G71A 1BI1A 3RESA 3LGFA 1YJ9T 3CBOA 1BI3A 4B9XA 5GANg 3JAME 4N0AA 2P0KA 1UGPB 2M1HA 2QQ9A 2VYTA 4XTXA 3CCEA 2X4YA 1NJIU 1ZBXA 2K3YA 3ZBDA 3OW2A 3CCST 4C8QD 2E6NA 3CCUA 2QQRA 4VUBA 3JCMJ 3HRTA 3V7CA 1KQ1A 1Y96A 3JRZA 3QPHA 5CKDA 1VQNA 2QA4A 4ATOA 3HP9A 2K4YA 1WNLA 1X01A 2E6ZA 4C0FA 3CC4A 2WACA 5GMKj 2VGMA 5J26A 4LDXA 3CCLT 2CZ6B 2DK3A 4C8QG 3QXEB 3CCMT 3OY9A 3C94A 3M58A 3TCJA 4F7UG 2WSEE 1OZ2A 1KHIA 4PJOG 4D6WA 1M5Q1 3OBYA 4KUDK 4B9WA 4RKUE 2JOYA 3CCVT 3JB9F 2MMPA 5GMKh 1W4SA 5GAMe 2PVDB 3J7AF 3QG1A 4IUUA 3LX7A 4IUQA 3LYIA 2E65A 4KT0E 4RG2A 4MDWA 1GXIE 1UGSB 2MAMA 2I2LA 4M75B 4R56A 3HRSA 1IZ6A 4F7UF 3JCMe 1YJWA 4A54A 4J83A 1B34A 1VQ5T 3RMQA 1R8OB 1JB0E 4PJOF 4JS5A 5FRMA 4OB2B 3HRUA 4M7DC 4M77E 1U1TA 3QO3A 1LJOA 2DVEA 2FVUA 4GLKA 5GAOp 3JSCA 4ZGDB 4BE0A 1QVFS 2GCXA 4QQ6A 1VQ8A 2F69A 3JB9J 2RHYA 3A8GB 4XTWA 2L89A 3QJ6A 5LJ3f 5HK3A 1NZ9A 5GMKi 3CCRA 3JCMP 2KK4A 1KD1C 2PQWA 2RJDA 2QQAA 2E70A 4HA8A 4XU0A 1VQLA 2KAFA 1KQSA 2QTXA 4MDXA 1JJ2S 4E7LA 2WSCE 3CXCS 2L5QA 5GAMg 2MI6A 1SSFA 1VQKT 2LT1A 1KHCA 4JDSA 4PNOA 5HK0A 2RHXA 3MCAB 1X75C 2RJCA 2OTLT 2LRQA 2GFUA 2EQJA 2RHUA 4IUTA 3KUFA 4MZMA 3OQ5A 3KBGA 4OB3B 3P8BB 4BB7A 4EMHA 4LDVA 4OMFB 5LJ3j 5GAN5 4E7JA 3RERA 2JUFA 4E7HA 2DIGA 5CQYA 3PFSA 5FU6C 2XK0A 4M75G 3X24B 5GAN8 1KC8U 4E47A 3QKJA 1VQ9A 3I55T 2GFAA 3OYEA 4BI4A 2XIDA 4C0GA 2B8AA 1G3SA 4XTUA 4M78E 4C5IA 4MZTA 5GMKe 3BFMA 2LX9A 2D9TA 4L5GA 5LJ3h 3CPWA 1LOJA 4A4EA 2RHIA 3RKWA 2FYKA 5DLOA 3F70A 2ZCFB 4FU6A 2C06A 4L6V5 3EFSA 3JB9I 3MEUA 1YHQT 4M75F 2MWOA 3VUBA 2R58A 3A8OB 3HFOA 4C5GA 4BE1A 3DB3A 4KUIA 4M78D 1VQMT 2LDMA 3G6ET 1BI2A 2ZPFB 4OB1B 2R5MA 4FL6A 3JCMd 4C92E 2QEXT 3SB2A 3CCQA 3ME9A 2D0QB 1W2BA 3HKSA 1K9MU 5HY6A 3VYHB 3CMAT 4M77C 3N5BB 2RJFA 2E64A 3P8DA 3OYHA 4LD6A 1BI0A 1OI1A 4ELYC 5LJ5f 2CKKA 1K8AU 4XTYA 5FRNA 2PVGB 5KCOA 4RG8A 3WXMB 5GAN3 3RMSA 1VQ6A 5GAOm 4A4GA 1QW1A 1WQ7A 4NL3A 1HXDA 5CQXA 5CKFA 2PUKB 3OYYA 3J81E 4EDUA 5FLXE 1VIEA 2BIVA 1Q81C 1I81A 3L2RA 1VQ4A 1O75A 4M7AE 1QP2A 1VQ7A 3V8KA 2JZ2A 3QUIA 3LGLA 4C8QE 5LJ5j 1NE8A 1VQOT 3G4SA 1VUBA 2EJGA 2O4XA 4J6YA 1Q7YC 4YTLA 2KDSA 1K8AC 1FXXA 2VV5A 3CC2T 3HHTB 5LJ3e 4A4HA 2CS7A 1X6OA 2V8JA 4M7DB 3QBYA 3OS5A 4OB0B 4X9CA 4M78C 2QXFA 3C12A 2DJZA 1MHNA 2JN0A 3SD4A 4A53A 4DOWA 4JRPA 3M9QA 4FSXA 1N9SA 2DD5A 4J5YA 2VXEA 4ZN3A 5LJ5h 3X25B 1YJ9A 4DA4A 3JB9G 2QQBA 3JCMW 2DIQA 3OMGA 3JB9H 1UGQB 4PJOD 4M77A 2K3XA 4EMKC 3G71T 4QQDA 1H3ZA 2O01E 3CCSA 3AHUA 3CD6T 1XQHA 4J7FA 1U8RA 5IAYA 4BDYA 3M54A 4JRIA 3VJPA 1NPRA 3JCMV 4C92C 5GAN6 3CCUT 4IUVA 4EMGA 2CGHA 1NJIC 1M1FA 1OYXA 2XHCA 1N8RU 1VIFA 3CCLA 3OYFA 3CCMA 5FU6B 1WJQA 3J80E 2DXTA 4FIBA 4NS5A 3CC4T 1M8VA 3NTHA 4JRQA 1Q82C 3O8VA 3A5ZB 3FRNA 5CVIA 4JRKA 3P8HA 4OGCA 3X26B 2XDDA 4OGEA 2EQKA 5I21A 4M7DG 3OSVA 1G3TA 5KE3A 2YRVA 2LQ8A 3C4SA 3M4YA 4XAXB 1KQ2A 2O4XB 3S3OA 1QVPA 4V2SA 2JTMA 1UB4A 2RA2A 4XU3A 2HQXA 1Q86U 4O5VA 4BI3A 3V7SA 4CI0C 3CMET 5GANf 3R6OA 1IREB 2RD1A 4BY6C 2MWPA 4M7AC 1JBMA 4ZGJB 2NLUA 4A4KA 1WJRA 3M53A 3TEEA 4C8QC 5GAOr 4IKFA 1WPYA 1G5VA 2RB6A 4CRIA 1VQPA 2E10A 5GMKm 2HQEA 3MEVA 4PLIA 4BACA 1YJWT 4RCBA 4O6JA 5IN1A 4EMKA 4E7KA 5LJ5e 4M7DF 2WSFE 5LJ3d 2DZCA 3PIOA 2DTHA 4Z02A 2EYQA 3ZEHA 4M77B 2F5KA 4ELZC 1WGSA 2EQUA 2DXBA 4M75D 5GANj 2K2VA 2K5LA 3MP8A 4C92A 1Q86C 3OS0A 3CCRT 4X9DA 4C0ZA 5IT9E 4N4HA 4BE2A 4ZTJA 1YI2T 2EIFA 1VQLT 2BKDN 5A0GA 1MGQA 3JCMg 3OW2S 2PU9B 3QZ5B 3VYGA 2MF2A 3X28B 5A2QE 1YIJA 3QDRB 4OVAA 5GANh 1QVGA 2JNGA 4HCZA 5DM7R 3QIIA 5KCHA 1D3BA 4XU2A 1EIFA 3MHXA 4MMLA 3OS1A 1BIAA 4GY5A 4N4GA 1S72T 2D6FA 2FB7A 2VUBA 3V8JA 2OTJT 3WVDB 3C95A 2XICA 5D6XA 4M7DA 2KY9A 4M7AA 2YHTA 1VQ9T 4PKCC 3BDUA 1M1KU 3OYKA 1BIBA 2Y90A 4M78B 2Y4XA 1RI0A 1DJ7B 4MMKA 3OSSC 2ZPBB 3JCMb 5KH6A 2YLBA 4E7IA 1KC8C 1V29B 4M77G 3CC7T 3FEOA 5M9OA 2IG0A 1YITA 3JCMQ 1VQ4T 3UT1A 3V7RA 4JUVA 1KG1A 3UDCA 1N27A 2FL7A 2X4WA 4EMKB 2ZPGB 4FM4B 3SWNC 3BW1A 1VQMA 3G6EA 4NOYA 4R55A 4XTZA 3S6WA 1PSEA 2ZPIB 3EAEA 2LVMA 2CZ0B 1O9SA 5FU7C 1AHJB 3FB9A 1YJNA 4C92B 1FWZA 3CCQT 3L2QA 4X34A 5D6WA 2RI2A 5LJ5d 4M77F 4ME7A 4OP0A 4N0AC 4FT4A 3S3MA 3FJPA 2ZPEB 4WF2A 2VGNA 1M90U 3FIFA 4KBMB 1LNXA 2R57A 3E9FA 4QW2A 3CPFA 2VXFA 5GAOq 1XTDA 1KQSS 1M1GA 3VUZA 4L59A 1K9MC 2E5QA 3META 4J6WA 3CEYA 3S3NA 1D3BB 5GANe 2BUDA 4FT2A 5L8RE 4F7UE 3TREA 2Y4YA 5HKCA 4PJOE 2L8DA 2KMTA 3JB9D 3OB9A 2LT4A 3A8HB 4UC4A 1YCYA 5C6SA 4BY6B 2K5FA 4M7AB 1VQOA 2XU8A 3M56A 4BI8B 3UWNA 2RI5A 5GAMh 2K57A 3DLLA 1VQ7T 1QVFA 3MEWA 4C8QB 2RH2A 3CCJA 3HFNA 3I56A 5CO7A 3G4ST 3NTKA 2LCLA 2M9UA 4TVRA 3EFRA 1H641 5GAN2 3SWNA 3RKXA 3OYNA 2VC8A 3MEAA 3LWIA 5GAOl 4JJNK 4M78F 4C92G 3CPWS 4XQ3A 1JJ2A 3INZA 1OZ3A 3GOXA 3PNWC 3CXCA 3CCET 4M75C 3QSUA 4IUPA 4XK8E 4MZPA 3QJYA 5I2MA 4BDZA 3E19A 1U1SA 4QQGA 3H6ZA 3FC3A 3OYGA 5DLQE 1VQNT 3CD6A 4M7DD 1M4ZA 2GQVA 2QA4T 2RK1A 2YLCA 3HL8A 5LJ3g 2RJEA 2KSSA 3SDZA 3ASKA 2XKOC 3QZ9B 3OYDA 4C92F 1W2BS 3RIRA 4C0DB 1XNIA 1RL2A 3H8ZA 3JCMX 2DPPB 3L1AA 3PGGA 3GNFB 3RKYA 4DQ2A 3WVEB 3GNGA 3CCVA 2E1HA 4M7AG 4PL6A 3V8LA 2P0PA 5DY9A 4J8OA 2LQKA 4XTVA 2XG8D 1N6AA 1Y07A 4JLIA 3M5AA 1I8FA 5D6YA 2DXCA 3L2ZA 4J6XA 5CKHA 4M7AD 4M78A 3OA6A 3L2UA 4PLLA 4M75E 1N8RC 2EAYA 2CYZB 2EQMA 1VQ5A 5GANd 3GP8A 2RM4A 4LDUA 2PVOB 2V8KA 3CMEA 4HT9A 4PJOC 4EPCA 1KD1U 2E41A 3PIPA 4M7AF 2P0QA 2JVVA 5GAN7 1ZHIA 2F5TX 3M57A 3SWNB 4BUGA 2CZ1B 4II1A 4C8QF 2KVQG 4RCCA 2K5IA 3VU3C 4DOVA 3FDRA 4LDYA 3A8MB 1VQ8T 3BY7A 1YBYA 5FU7B 4QVCA 1VQPT 1Y71A 3E9GA 3HPWA 4ZGEB 3MP1A 1I5LA 1ZQ1A 2EJ9A 2EKOA 4OF1A 3OYJA 2QQSA 4JLGA 3RUXA 3G7ZA 1UGRB 3URGA 3KXTA 1VQKA 4Y28E 3E1SA 4LD9K 4QVDA 3LW5E 3GF5A 4A4FA 2OTLA 3QYHB 3OS2A 2AHJB 4KULA 4HKEA 1YI2A 2GF7A 3GIBA 4IURA 2FHDA 4C0DC 4ZTFA 1Y7XA 2XDPA 5A0DA 3OYMA 2ZPHB 5A0LA 1QP3A 1Y96B 4JS4A 3SFMA 2PUOB 3LLRA 1UEBA 2EJFA 4M77D 3MO8A 3I55A 2DKGA 2ZGWA 3MP6A 3M55A 5GMKl 5J3BA 2X4JA 5LJ5g 3PMTA 3DLMA 4ZN1A 4NL2A 1YIJT 3FLGA 2IVWA 2E12A 1S72A 5CCAA 1N9RA 4QVZA 5CIUA 4C8QA 2OTJA 4F7UA 3QYGB 2EFIA 2H3JA 1FX7A 5CK9A 3M4GA 4RMOA 2X35A 1PSFA 4PJOA 3VKIA 5I2SA 2QDYB 4N4IA 3X20B 1YHQA 4LDWA 3HSBA 3DKMA 2EWNA 2X4XA 5AYFA 1BYMA 3CC7A 1G3WA 5GAN4 3PMIA 1NPPA 5GAMf 1WQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YCY A;  4M7A B;  4Y91 A;  2DXT A;  5CAI A;  2QTX A;  1M8V A;  2DZ9 A;  5GAM h;  2K57 A;  1B34 B;  3QHS A;  3JCM c;  5GAM d;  4JRK A;  4C8Q B;  5GAM g;  3HFN A;  3JCM f;  4PNO A;  2DTO A;  5I21 A;  4M7D G;  3EFR A;  1H64 1;  5GAN 2;  3SWN A;  1TH7 A;  3RKX A;  2VC8 A;  1KQ2 A;  5GAN 5;  5GAO l;  4EMH A;  4M78 F;  4C92 G;  5LJ3 j;  4XU3 A;  1I4K 1;  2RA2 A;  4V2S A;  3RER A;  1JRI A;  3V7S A;  4XQ3 A;  5GAN f;  5GAN 8;  3INZ A;  2RD1 A;  4M75 G;  5GAM j;  4M7A C;  1JBM A;  3QSU A;  5GAO r;  1U1S A;  4XU1 A;  4M78 G;  4C8Q C;  1WPY A;  4XTU A;  2RB6 A;  4M78 E;  2E10 A;  5GMK e;  5GMK m;  3BFM A;  4M7D D;  1HK9 A;  4RCB A;  5LJ3 h;  4M7D F;  4EMK A;  1LOJ A;  5LJ5 e;  2YLC A;  5LJ3 d;  2DTI A;  2DZC A;  2DXU A;  3RKW A;  4C92 D;  2DTH A;  5LJ3 g;  2FYK A;  4M77 B;  4C92 F;  3RIR A;  5GAO n;  4M75 D;  3PGG A;  3EFS A;  3L1A A;  4F7U B;  3JCM X;  3JB9 I;  3RKY A;  4DQ2 A;  5GAN j;  4M75 F;  4C92 A;  2E1H A;  2HNI A;  3HFO A;  4M7A G;  4M7D E;  4PJO B;  3V8L A;  4X9D A;  4M78 D;  5DY9 A;  4XTV A;  3JCM h;  4HT8 A;  4M75 A;  3JCM d;  4C92 E;  1MGQ A;  4JLI A;  2DEQ A;  3SB2 A;  3JCM g;  1I8F A;  3L2Z A;  4J6X A;  4M78 A;  4M75 E;  2EAY A;  4M77 C;  5GAN h;  2E64 A;  3RES A;  5GAN d;  2RM4 A;  5GAN g;  1D3B A;  4N0A A;  4XU2 A;  5LJ5 f;  4MML A;  4XTY A;  4M7A D;  4XTX A;  1BIA A;  4HT9 A;  4PJO C;  2E41 A;  4M7A F;  5GAN 3;  2FB7 A;  5GAN 7;  3V8J A;  5GAO m;  3SWN B;  4C8Q D;  4M7D A;  4C8Q F;  1WQ7 A;  4M7A A;  3JCM J;  2YHT A;  3V7C A;  1HXD A;  1KQ1 A;  1Y96 A;  4RCC A;  3VU3 C;  3BDU A;  4NL3 A;  1BIB A;  2Y90 A;  3BY7 A;  4M78 B;  4QVC A;  3JCM b;  1I81 A;  4MMK A;  1WNL A;  1X01 A;  1I5L A;  4M7A E;  2YLB A;  5GMK j;  3JB9 D;  4M77 G;  2EJ9 A;  3V8K A;  3QUI A;  4C8Q G;  3JCM Q;  4C8Q E;  3RUX A;  5LJ5 j;  3V7R A;  4F7U G;  4JUV A;  2EJG A;  4J6Y A;  4QVD A;  4PJO G;  4EMK B;  3SWN C;  1M5Q 1;  3BW1 A;  5LJ3 e;  3GIB A;  4NOY A;  4XTZ A;  4M7D B;  3JB9 F;  1Y96 B;  5GMK h;  4X9C A;  4M78 C;  5GAM e;  3FB9 A;  2DJZ A;  4A53 A;  2JN0 A;  2EJF A;  4C92 B;  4J5Y A;  4M77 D;  1N9S A;  5LJ5 h;  2VXE A;  2E65 A;  2DKG A;  2ZGW A;  5GMK l;  5LJ5 d;  4M77 F;  5LJ5 g;  4OP0 A;  2I2L A;  4N0A C;  4M75 B;  3JB9 G;  3FJP A;  4NL2 A;  4WF2 A;  3JCM W;  3JB9 H;  4F7U F;  3JCM e;  4PJO D;  4M77 A;  4A54 A;  3FIF A;  4EMK C;  1B34 A;  1LNX A;  1N9R A;  4PJO F;  4C8Q A;  2VXF A;  5GAO q;  3AHU A;  4F7U A;  4M7D C;  4J6W A;  1U1T A;  3QO3 A;  1LJO A;  2DVE A;  3M4G A;  4M77 E;  5GAO p;  4PJO A;  1D3B B;  4JRI A;  5GAN e;  3JCM V;  4C92 C;  4F7U E;  5GAN 6;  3JB9 J;  5LJ3 f;  4EMG A;  4XTW A;  3JCM P;  2EWN A;  2CGH A;  5GMK i;  3HSB A;  4PJO E;  5GAN 4;  4XU0 A;  4M75 C;  4HA8 A;  5GAM f;  1WQW A; 
#chains in the Genus database with same CATH topology
 2W0Z A;  4J7I A;  3R6N A;  1B34 B;  3LH0 A;  3QHS A;  3JCM c;  5GAM d;  3OYL A;  1M1K C;  3UA6 A;  4C5E A;  2DTO A;  1YJW Q;  4P5N A;  3L42 A;  1TH7 A;  4J9D A;  2JTF A;  2JJ9 A;  3MKD A;  3OYI A;  1Q81 U;  2RK2 A;  2KRS A;  2P4R A;  5GAM j;  1YJN T;  3UPU A;  4GBQ A;  1VQ8 Q;  1VQ6 T;  1K73 C;  3OYC A;  2LTO A;  2G3R A;  4BD3 A;  1RUW A;  2LC4 A;  1WX6 A;  2CZ7 B;  2DXU A;  2RPN A;  1IHV A;  1OEB A;  2EYW A;  2DD4 A;  2M0O A;  4F7U B;  3PVL A;  3REA B;  2DL8 A;  5FRO A;  4DEX A;  5EG2 A;  3CBM A;  1WZO A;  3NFC A;  4GLM A;  2KR3 A;  3CBO A;  4B9X A;  1ZA1 B;  5GAN g;  2HKQ B;  2YUO A;  1UGP B;  4XTX A;  2QQ9 A;  1NJI U;  3EFO A;  4AFS C;  3CCU A;  2JT4 A;  1WHK A;  2COY A;  5CKD A;  1VQN A;  2FRY A;  2L3P A;  2E6Z A;  4LDX A;  5GMK j;  4FYY B;  5J26 A;  3CCQ Q;  3CCM T;  3OY9 A;  2HQH A;  1OZ2 A;  1RAA B;  1JO8 A;  4KUD K;  3JB9 F;  5GMK h;  1D1C A;  3LYI A;  2HBW A;  2J7I A;  4M75 B;  1IZ6 A;  1YJW A;  4J83 A;  1B34 A;  4PJO F;  5FRM A;  2DIL A;  3QO3 A;  1LJO A;  4BE0 A;  4ZGD B;  2KE9 A;  1RAC B;  1VQ8 A;  3JB9 J;  1R0B G;  2CSQ A;  2QGF B;  1QKW A;  2CH4 W;  2EYX A;  3CCR A;  2KK4 A;  2E70 A;  4XU0 A;  1VQL A;  1SKU B;  4E7L A;  4KH0 B;  5GAM g;  2MI6 A;  6AT1 B;  1YJ9 Q;  1VQK T;  4IUT A;  5LJ3 j;  4E7J A;  3CCS Q;  2EGC A;  1WI7 A;  5CQY A;  3PFS A;  3X24 B;  2XK0 A;  1KC8 U;  1HYO A;  3I55 T;  1VYT A;  3VRZ A;  3OYE A;  4K11 A;  4XTU A;  4M78 E;  3BFM A;  2ECZ A;  2FEI A;  2LX9 A;  5LJ3 h;  3RKW A;  2MIO A;  2NUZ A;  1M3A A;  2C06 A;  2ZCF B;  4FU6 A;  1Z9Z A;  3EFS A;  2MWO A;  4C5G A;  3RBB B;  3DB3 A;  4KUI A;  1M2V A;  3G6E T;  2R5M A;  1OU8 A;  4FL6 A;  4C92 E;  3CCQ A;  3SB2 A;  3M0P A;  5KYN A;  1K9M U;  4D8K A;  1Y57 A;  2RJF A;  1Q95 G;  3A98 A;  4LUD A;  3TSZ A;  1BI0 A;  1OI1 A;  4ELY C;  2PVG B;  3EGX A;  3RMS A;  2CRE A;  4A4G A;  5KYW B;  2DER A;  1WQ7 A;  1FMV A;  4X1V A;  3J81 E;  1D1A A;  1VQ7 A;  5IHK A;  2JZ2 A;  1M2O A;  5LJ5 j;  4J6Y A;  1Q7Y C;  4RTZ A;  1E6H A;  3HHT B;  1UHF A;  2V8J A;  4M7D B;  5FWC A;  3QBY A;  3OS5 A;  4X9C A;  4M78 C;  2JN0 A;  1YP5 A;  4FSX A;  1IRX A;  4ZN3 A;  5LJ5 h;  3X25 B;  1YJ9 A;  4DA4 A;  3JB9 G;  3JCM W;  2PNI A;  3JB9 H;  1UGQ B;  4PJO D;  4M77 A;  4EMK C;  1Q81 R;  2O01 E;  3CCS A;  2KNB B;  2E4H A;  3AHU A;  3CD6 T;  1YNZ A;  1U8R A;  2VAS A;  3M54 A;  1NPR A;  1I1J A;  4C92 C;  5GAN 6;  1VQM Q;  4ANJ A;  1NG2 A;  2XHC A;  1N8R U;  4RTW A;  2OAW A;  2HL5 C;  4JRQ A;  3CMA Q;  3O8V A;  4JRK A;  3OSV A;  5KE3 A;  3C4S A;  3M4Y A;  2O4X B;  2KBT A;  2JTM A;  4XU3 A;  2YUQ A;  5GAN f;  2RD1 A;  1VA7 A;  4ZGJ B;  2NLU A;  3M53 A;  1WPY A;  1ZUK A;  5GMK m;  1H3H A;  2HQE A;  1R77 A;  1NJI R;  4RCB A;  1NM7 A;  4Z02 A;  2DXB A;  2K5L A;  1QWF A;  1UTI A;  2AK5 A;  4X9D A;  4C0Z A;  5IT9 E;  4N4H A;  5KYW A;  4ZTJ A;  2BKD N;  5A0G A;  2V1R A;  2PU9 B;  3QZ5 B;  3VYG A;  1SRM A;  1QVG A;  4HCZ A;  4XU2 A;  1EIF A;  4MML A;  2D6F A;  2VUB A;  3V8J A;  4M7D A;  2ABL A;  1VQ9 T;  4E7I A;  3OSS C;  2NUT B;  2ZPB B;  5KH6 A;  5L23 A;  3VS1 A;  2BE7 D;  3UT1 A;  1VQM A;  3S6W A;  2ZPI B;  2J6F A;  1O9S A;  3FB9 A;  2NWM A;  3L2Q A;  1WIE A;  4HCK A;  1WXU A;  2VGN A;  2R57 A;  2I0N A;  1M1G A;  4L59 A;  2E5Q A;  4J6W A;  1KC8 R;  1WHM A;  4DBR A;  3CEY A;  3S3N A;  5HKC A;  5KYU B;  3RNJ A;  4BY6 B;  4M7A B;  1PG5 B;  3MJX A;  2D0N A;  2RI5 A;  1OOT A;  3I56 A;  5CO7 A;  1H64 1;  3LWI A;  4JJN K;  4M78 F;  2OTJ Q;  1JJ2 A;  3INZ A;  1E7O A;  1K9M R;  4XK8 E;  5I2M A;  3QJY A;  1I0C A;  1K4U S;  1U1S A;  4QQG A;  3CC7 Q;  3MPU B;  1VQ4 Q;  2QEX Q;  2QA4 T;  4PJL A;  3HL8 A;  1JXM A;  4C92 F;  4C0D B;  2RQW A;  2DPP B;  1QVF P;  2KYM A;  3RKY A;  1N6A A;  3H0I A;  4JLI A;  2M0Y A;  2DXC A;  1C6V X;  2H8H A;  5CKH A;  3OA6 A;  2MCN A;  2M51 A;  2KT8 A;  2CYZ B;  5IHI A;  1VQ5 A;  3GP8 A;  2KRO A;  5IXB A;  2PVO B;  2V8K A;  2DMO A;  1X69 A;  1KD1 U;  3PIP A;  1JU5 C;  4HVV A;  3VU3 C;  2CP2 A;  1NEG A;  4Y92 A;  5FU7 B;  4QVC A;  4R0K A;  1ZQ1 A;  2YUP A;  3OYJ A;  3NGP A;  1WLP B;  4KUL A;  1N8R R;  4IUR A;  2XDP A;  3M0T A;  3OYM A;  2ZPH B;  1HJD A;  2EJF A;  3AT1 B;  2LX7 A;  3MO8 A;  2ZGW A;  3MP6 A;  5J3B A;  3PMT A;  1ZA2 B;  1YIJ T;  5CCA A;  4QVZ A;  4J9G A;  2OTJ A;  2EFI A;  4RMO A;  4PJO A;  1NYG A;  2EKH A;  2CUB A;  2QDY B;  4LDW A;  2X4X A;  3CC7 A;  1NPP A;  1WQW A;  2QEX A;  5CKB A;  1VQ4 A;  5CAI A;  4Y91 A;  3A8L B;  3L2V A;  2DZ9 A;  1G3Y A;  2DA9 A;  1YIT T;  5C0M A;  2A7Y A;  1QMC A;  2EYY A;  2LQW A;  1X43 A;  3VV0 A;  1KIK A;  3T9N A;  1P92 A;  4J9B A;  5I22 A;  2GTJ A;  3LWH A;  2ED0 A;  3GBQ A;  1I5O B;  1VQP Q;  4XU1 A;  2XI9 A;  3BDL A;  4M78 G;  3GPL A;  1ZSG A;  2DO3 A;  4C92 D;  1M90 C;  1ZBJ A;  2A3L A;  4AG2 C;  5GAO n;  1D0X A;  2P4T A;  5KE2 A;  3PTA A;  3GLX A;  3JCM h;  4HT8 A;  2LCS A;  4HCB A;  2M16 A;  3OBW A;  2O31 A;  2XDB A;  3CCJ T;  2RQV A;  3G71 A;  4JJD A;  4N0A A;  2P0K A;  2X4Y A;  2K3Y A;  1QKX A;  2QQR A;  3JCM J;  3HRT A;  1AT1 B;  3JRZ A;  2F2X A;  1X01 A;  4C0F A;  3CC4 A;  3CCL T;  4F7U G;  2WSE E;  3QWX X;  2DNU A;  2LJ3 A;  3RR6 A;  1M5Q 1;  4EIK A;  1AVZ C;  4B9W A;  2BZX A;  4RKU E;  4M4Z A;  3CCV T;  1YJN Q;  5GAM e;  1MV3 A;  1SSH A;  3J7A F;  1VQ6 Q;  4IUQ A;  4KT0 E;  4RG2 A;  3OW2 P;  2CT4 A;  1UGS B;  1GXI E;  2CP0 A;  2I2L A;  1TUC A;  1X6B A;  3IQL A;  1VYU A;  3EG2 A;  2A08 A;  1QVF S;  3G4S Q;  3JSC A;  2QAZ A;  2F69 A;  2RHY A;  3A8G B;  3EFO B;  4XTW A;  3JCM P;  1NZ9 A;  2HCK A;  2KAF A;  3NHN A;  3EHQ A;  2LJ1 A;  4JDS A;  1KHC A;  4FYW B;  2RHX A;  3SHW A;  1GL5 A;  1X75 C;  2OTL T;  2LRQ A;  2GFU A;  1D1B A;  2EQJ A;  3OQ5 A;  4EMH A;  4LDV A;  4OMF B;  2L0A A;  3RER A;  2JUF A;  5FU6 C;  5GAN 8;  4M75 G;  4E47 A;  1ZSZ C;  4BI4 A;  2XID A;  4C0G A;  5GMK e;  3CCM Q;  2D9T A;  3CPW A;  4A4E A;  2RHI A;  1KQS P;  1G8X A;  3F70 A;  1JQQ A;  3MEU A;  4F14 A;  1YHQ T;  3VUB A;  2R58 A;  3A8O B;  4AFU C;  1BI2 A;  4OB1 B;  2MOX A;  1M3C A;  1WFW A;  1JEG A;  2X3W D;  1TWB A;  3EGD B;  1W2B A;  2AZV A;  2RMO A;  3N5B B;  4OML A;  3P8D A;  4LD6 A;  2CP3 A;  1PD0 A;  1ZUY A;  4XTY A;  1LPL A;  4RG8 A;  4QT7 A;  1VQ6 A;  1NLP C;  1QW1 A;  3RDV A;  4NL3 A;  5CKF A;  1GFD A;  1VIE A;  2HKN A;  1I81 A;  3L2R A;  1R0C B;  1QP2 A;  1VQK Q;  2J6K A;  4C8Q E;  3G4S A;  2VB6 A;  1VUB A;  4YTL A;  1ZUU A;  2J6O A;  1WYX A;  1FXX A;  5LJ3 e;  1PD1 A;  4A4H A;  1JXO A;  2QDL A;  4OB0 B;  4DOW A;  2DJZ A;  1Q82 C;  3M0R A;  2CP6 A;  3I55 Q;  2VXE A;  1M2V B;  3EG1 A;  1UDL A;  1H3Z A;  2JM9 A;  1NEB A;  3UA7 A;  4BDY A;  4JPB W;  1D09 B;  3VJP A;  1SG5 A;  3CCU T;  4IUV A;  3EGX B;  3G6E Q;  1M1F A;  1PCX A;  1OYX A;  4AFZ C;  1VIF A;  1RAD B;  3CCM A;  4FIB A;  5CVI A;  2JTE A;  5KYX A;  1MMA A;  2L3Q A;  4OGE A;  5I21 A;  4M7D G;  2YRV A;  4DBF A;  4XAX B;  4PJN A;  4V2S A;  3I5S A;  3V7S A;  4CI0 C;  1AZE A;  4A4K A;  1WJR A;  5GAO r;  4C8Q C;  1HD3 A;  2J06 A;  1BBZ A;  2V26 A;  1ZLM A;  3MEV A;  4PLI A;  1YJW T;  3EGD A;  4CC4 B;  4EMK A;  5LJ5 e;  2WSF E;  5LJ3 d;  3PIO A;  4CC7 A;  4M77 B;  3I35 A;  2EQU A;  4PFO A;  2DF6 A;  4C92 A;  3OS0 A;  3CCR T;  2LNH B;  1YI2 T;  4BE2 A;  4F17 A;  1VQL T;  3OW2 S;  2B86 A;  3X28 B;  5A2Q E;  2DL3 A;  4OVA A;  4IIM A;  3QII A;  3CD6 Q;  1OPL A;  1D3B A;  3MHX A;  1AWO A;  1KFZ A;  3OS1 A;  2O9V A;  4GY5 A;  1T3L A;  1M3B A;  2SRC A;  3WVD B;  3C95 A;  2KY9 A;  3BDU A;  1M1K U;  3OYK A;  1BIB A;  2DL5 A;  4DEY A;  4FSS A;  2YLB A;  4ORZ A;  2C0T A;  3JCM Q;  4JUV A;  2FPF A;  2FL7 A;  2X4W A;  2ZPG B;  4FM4 B;  3SWN C;  3G6E A;  2EPD A;  2CZ0 B;  1H92 A;  2EBP A;  2ROL A;  3CCQ T;  1K0S A;  2RI2 A;  5LJ5 d;  4FT4 A;  3FJP A;  2ZPE B;  2RN8 A;  3FIF A;  8AT1 B;  3CPF A;  1XTD A;  1KQS S;  1G2B A;  5I11 A;  1EZZ B;  1WHH A;  2BE9 B;  4FT2 A;  4F7U E;  4E7Z A;  1GCQ A;  3JB9 D;  2LT4 A;  3A8H B;  4UC4 A;  2K57 A;  1VQ7 T;  2RH2 A;  1U3O A;  3HFN A;  4IIO A;  3EFR A;  1IHW A;  2EW3 A;  2VC8 A;  3MEA A;  5GAO l;  4F04 B;  3U23 A;  3ZL7 C;  3CCE T;  1VQ9 Q;  3PNW C;  3QSU A;  4IUP A;  4MZP A;  2Z0W A;  2O9S A;  1OPK A;  2FZG B;  3CD6 A;  5DLQ E;  2RK1 A;  4LN2 A;  5LJ3 g;  2KSS A;  3QZ9 B;  3EG9 B;  3OYD A;  2FPE A;  1RL2 A;  3H8Z A;  2EYZ A;  3I9Q A;  3PGG A;  4A63 B;  3GNF B;  4DQ2 A;  3WVE B;  2D8H A;  4DBQ A;  2RNA A;  4M7A G;  4PL6 A;  5DY9 A;  1QQJ A;  4XTV A;  3C0C A;  2QAS A;  3M5A A;  4M75 E;  2CT3 A;  2EAY A;  3CXC P;  2RM4 A;  3HTR A;  2YWW A;  3PVQ A;  2GBQ A;  2JXB A;  5GAN 7;  1ZHI A;  3M57 A;  4C8Q F;  3CC2 Q;  2KVQ G;  2A37 A;  2K5I A;  2NYS A;  1YBY A;  1Y71 A;  4ZGE B;  1OQK A;  1ARK A;  3URG A;  3KXT A;  1NBE B;  2J05 A;  3LW5 E;  3EH2 A;  2AHJ B;  2FHD A;  1K76 A;  1OV3 A;  1Y7X A;  3EGU A;  5A0D A;  2PTK A;  2PUO B;  3LLR A;  1ABO A;  5LJ5 g;  4ZN1 A;  2FZK B;  2QA4 Q;  3FJ5 A;  5HCK A;  1N9R A;  2H3J A;  1FX7 A;  5CK9 A;  3M4G A;  1GCP A;  3VKI A;  5I2S A;  4N4I A;  3X20 B;  3HSB A;  2EWN A;  3VS7 A;  1FMW A;  1BYM A;  1G3W A;  1G83 A;  4M75 C;  5GAM f;  2AT1 B;  3CMA A;  2K7A A;  2QI2 A;  4RTY A;  2LP5 A;  1UG1 A;  1WXT A;  1EX4 A;  2LNV A;  3PE0 A;  3EG9 A;  1I4K 1;  3OMC A;  3Q1J A;  1JRI A;  4HCC A;  3LH5 A;  4RUG A;  2V8I A;  2X3X D;  1ABQ A;  2JMA A;  1Q7Y U;  2L3R A;  3CBP A;  3OYA A;  3NTI A;  3DB4 A;  2X51 A;  2DTI A;  5LL6 S;  2F2V A;  4OMP A;  4OMN A;  2JM8 A;  2K2M A;  3M0Q A;  1T0H A;  2R5A A;  1TTH B;  3CC2 A;  2RI3 A;  1M1K R;  1TUD A;  4FYX B;  4M7D E;  4PJO B;  1MV0 B;  4CC2 A;  2JS2 A;  2DYI A;  2KI7 A;  3ER0 A;  2DEQ A;  2RO0 A;  1YFN A;  2HAX A;  3E2U A;  4C5H A;  1V76 A;  2YRD A;  3I56 T;  1BI1 A;  3RES A;  3LGF A;  1BI3 A;  1CKA A;  2ED1 A;  2CDT A;  1YWO A;  7AT1 B;  2KXD A;  1ZBX A;  3ZBD A;  4C8Q D;  2E6N A;  4J9C A;  3UAT A;  2QA4 A;  2K4Y A;  1BU1 A;  1CKB A;  2GNC A;  2WAC A;  1YIT Q;  2VGM A;  2CZ6 B;  2KRM A;  2DK3 A;  4C8Q G;  3SEM A;  3C94 A;  3TCJ A;  1ACM B;  1WXB A;  4D6W A;  2DET A;  1PKS A;  2JOY A;  4KH1 B;  1M27 C;  2MMP A;  1CSK A;  4MDW A;  2MAM A;  2RQU A;  3HRS A;  4F7U F;  3JCM e;  4A54 A;  1VQ5 T;  3RMQ A;  1TS9 A;  1JB0 E;  3VRY A;  4JS5 A;  4OB2 B;  3HRU A;  4M7D C;  1AWW A;  1K1Z A;  4GLK A;  5GAO p;  2O88 A;  5LJ3 f;  2L89 A;  3QJ6 A;  1MMN A;  2HMA A;  2PQW A;  4HVW A;  5ECA A;  4FYV B;  4MDX A;  3CCJ Q;  2WSC E;  4E6R A;  2L5Q A;  3CXC S;  2KT1 A;  5HK0 A;  3MCA B;  2RJC A;  1TXQ A;  1QCF A;  2DX1 A;  2MYS A;  3KBG A;  3P8B B;  4BB7 A;  5GAN 5;  1ZX6 A;  1UEC A;  1T0J A;  4E7H A;  4J9H A;  4RTV A;  2GFA A;  4AMC A;  2NUP A;  4MZT A;  1QCN A;  3CCL Q;  1HSQ A;  2VVK A;  2BZY A;  4L5G A;  1LOJ A;  2MK5 A;  5IXF A;  1UUE A;  2COZ A;  2L2P A;  5DLO A;  3I5R A;  3CCV Q;  3JB9 I;  4M75 F;  2EGE A;  2HSE B;  4M78 D;  2LDM A;  3JCM d;  2QEX T;  1QLY A;  3HKS A;  2D8J A;  2DRM A;  4Z89 A;  2ZAE A;  1W1F A;  5LJ5 f;  1K8A U;  2CKK A;  5KCO A;  1TG0 A;  3WXM B;  2DVJ A;  1HXD A;  1RAB B;  1ZSZ A;  4EDU A;  5FLX E;  1Q81 C;  2BIV A;  1UJ0 A;  2DEU A;  4M7A E;  4RTX A;  3V8K A;  5IH2 A;  3QUI A;  3LGL A;  1VQO T;  1E6G A;  1X27 A;  2SEM A;  1PNJ A;  3SD4 A;  2QXF A;  3C12 A;  2DBK A;  4J5Y A;  1N9S A;  1S1N A;  2FRW A;  1PWT A;  1TSF A;  2K3X A;  3G71 T;  4J9I A;  2DBM A;  1FMK A;  3VS2 A;  4FW2 A;  4JRI A;  4HVU A;  4EMG A;  5IHN A;  1Q7Y R;  1NJI C;  3CCL A;  4LE9 A;  3OYF A;  2DXT A;  2A0F B;  3CC4 T;  1SRL A;  1M8V A;  3A5Z B;  1LVK A;  2FPD A;  2HDA A;  3P8H A;  4ZNX A;  2EQK A;  1G3T A;  1KQ2 A;  1QVP A;  2DE0 X;  1UB4 A;  1RAF B;  2RA2 A;  1F1B B;  1Q86 U;  4O5V A;  4BI3 A;  1OU9 A;  3CME T;  4WCI A;  1IRE B;  1I07 A;  4BY6 C;  4M7A C;  2C0I A;  2K3B A;  1G5V A;  1IGQ A;  2RB6 A;  4CRI A;  2E10 A;  4OMM A;  8ATC B;  2RQT A;  1VQP A;  2RQR A;  4BAC A;  5IN1 A;  4M7D F;  2KYB A;  4E7K A;  2DZC A;  2DTH A;  4OMO A;  3ZEH A;  4ELZ C;  1KK7 A;  1WGS A;  1BCM A;  4M75 D;  5GAN j;  3MP8 A;  2MPX C;  2QYZ A;  4AG1 C;  5KYY A;  2L3S A;  1MGQ A;  2E3I A;  2QK0 A;  3QWY A;  3JCM g;  2E3H A;  4OMQ A;  1WHL A;  2MF2 A;  2HL3 A;  1PC0 A;  3QDR B;  5GAN h;  5DM7 R;  5KCH A;  5KYX B;  2DL4 A;  4JJB A;  3ULR B;  1QWE A;  4N4G A;  1S72 T;  1KD1 R;  3CCU Q;  2LZ6 B;  2LQN A;  4JZ4 A;  4PKC C;  1AWJ A;  2Y90 A;  4M78 B;  2BTT A;  1DJ7 B;  2EVR A;  2Y4X A;  3JCM b;  1KC8 C;  1V29 B;  4M77 G;  2IG0 A;  2O2O A;  5EC7 A;  3V7R A;  3UDC A;  1N27 A;  1V1C A;  4EMK B;  3BW1 A;  1RLQ C;  4R55 A;  4XTZ A;  1PSE A;  1UE9 A;  1QVG P;  2RF0 A;  1AOJ A;  5FU7 C;  1AHJ B;  1TUG B;  4LNP A;  4RTT A;  1YJN A;  2VWF A;  1FWZ A;  4C92 B;  4X34 A;  5D6W A;  4ME7 A;  2DJQ A;  4N0A C;  3S3M A;  4WF2 A;  1M90 U;  2A28 A;  1OX9 A;  3E9F A;  1TOV A;  2VXF A;  1B07 A;  2A36 A;  1K9M C;  1D3B B;  2BUD A;  3TRE A;  3CCR Q;  2AKL A;  1YI2 Q;  1D0Z A;  2Y4Y A;  1VQL Q;  2KMT A;  1MMD A;  1GFC A;  1OUL A;  1YCY A;  5C6S A;  2K5F A;  4CC3 A;  3M56 A;  4BI8 B;  3UWN A;  5GAM h;  1QVF A;  1UGV A;  1AD5 A;  2QGG A;  3G4S T;  2M9U A;  4TVR A;  3CQT A;  3SWN A;  3OYN A;  4XQ3 A;  1SPK A;  3GOX A;  1W70 A;  3VS4 A;  4BDZ A;  3O5Z A;  3H6Z A;  3OYG A;  1K8A R;  1VQN T;  4M7D D;  2DRK A;  1LCK A;  1SHF A;  2YLC A;  2ATC B;  3ASK A;  9ATC B;  1EFN A;  3NPF A;  3RIR A;  1XNI A;  3JCM X;  1X2K A;  3V8L A;  4J8O A;  2XG8 D;  1Y07 A;  3JV3 A;  4KRT A;  1H8K A;  3L2Z A;  4M78 A;  3L2U A;  2YUN A;  1N8R C;  4HXJ A;  1JJ2 P;  2EQM A;  1KSW A;  1RAH B;  4LDU A;  2YSQ A;  4EPC A;  4M7A F;  4B6M A;  2LMJ A;  2XMF A;  4BUG A;  3VS3 A;  4J9E A;  4DOV A;  3A8M B;  3UF4 A;  3BY7 A;  1VQ8 T;  4ESR A;  3HPW A;  1I5L A;  1VQ7 Q;  3MP1 A;  4KGZ B;  2EKO A;  4OF1 A;  3QDF A;  1UGR B;  1VQK A;  4Y28 E;  3E1S A;  4LD9 K;  3GF5 A;  1TU0 B;  3QYH B;  3OS2 A;  1YI2 A;  4HKE A;  3GIB A;  4ZTF A;  5A0L A;  1QP3 A;  1Y96 B;  3CCE Q;  3SFM A;  3EH1 A;  2K6D A;  1UEB A;  3I55 A;  2CH4 A;  5GMK l;  2KGT A;  3DLM A;  4NL2 A;  2IVW A;  1KJW A;  2DYB A;  1J3T A;  4LUE A;  1Q86 R;  4F7U A;  3QYG B;  5AYF A;  5GAN 4;  2P84 A;  2FO0 A;  1K73 U;  1XOV A;  4Q5W A;  3H0F A;  3PT9 A;  2CP5 A;  3JCM f;  2XD0 A;  3ZFJ A;  1UJY A;  5CKE A;  2KXC A;  2LCC A;  1M30 A;  4E7S A;  2HBP A;  2RHZ A;  5CR2 A;  2HD0 A;  4PJM A;  1BCO A;  3L2W A;  1BKB A;  2ESW A;  4JZ3 A;  1HK9 A;  1UHC A;  5J39 A;  4AFQ C;  1YWP A;  2ZZD A;  1Q82 U;  1M9S A;  3M59 A;  1QVG S;  1WJS A;  2HNI A;  3TU4 K;  2KEA A;  2OAU A;  4M75 A;  3OYB A;  4PK4 A;  3H41 A;  2DAQ A;  2KQW A;  2YRC A;  1IGU A;  2DM1 A;  2F1L A;  2FZC B;  1YJ9 T;  1MNE A;  3JAM E;  2AKK A;  3G1J A;  1Z9Q A;  4M7A D;  1MUZ A;  2M1H A;  2VYT A;  3CCE A;  3M0U A;  3OW2 A;  3CCS T;  2E5K A;  1NLO C;  4VUB A;  3V7C A;  1KQ1 A;  1Y96 A;  3QPH A;  1M90 R;  1N5Z A;  4ATO A;  3HP9 A;  3THK A;  1WNL A;  4Z88 A;  1GRI A;  3QXE B;  3M58 A;  3REB B;  3KFV A;  1W6X A;  4KGV B;  1KHI A;  4PJO G;  3OBY A;  3BE3 A;  1W4S A;  2PVD B;  3QG1 A;  2EQI A;  4IUU A;  3LX7 A;  2E65 A;  1IB8 A;  1FYN A;  4PFP A;  4R56 A;  1R8O B;  4M77 E;  1U1T A;  2DVE A;  2FVU A;  2GCX A;  4QQ6 A;  2EGA A;  5HK3 A;  5GMK i;  5FWB A;  1Y0M A;  1KD1 C;  1WA7 A;  2RJD A;  2QQA A;  4HA8 A;  1KQS A;  2CUD A;  2QTX A;  4LXC A;  1JJ2 S;  3I56 Q;  1SSF A;  2LT1 A;  1XJW B;  4PNO A;  4OB3 B;  2RHU A;  4MZM A;  3KUF A;  1RAE B;  2DIG A;  2PZ1 A;  3QKJ A;  1VQ9 A;  2B8A A;  1G3S A;  1X6G A;  4C5I A;  2QG9 B;  1D0Y A;  1AEY A;  2FYK A;  1GCQ C;  4L6V 5;  2AIR B;  2YXY A;  3HFO A;  4BE1 A;  1VQM T;  2KRN A;  2ZPF B;  3ME9 A;  5AT1 B;  1T3S A;  2D0Q B;  5HY6 A;  2IIM A;  3VYH B;  3CMA T;  4M77 C;  1VQ5 Q;  2E64 A;  2YT6 A;  3OYH A;  2OJ2 A;  2W10 A;  5FRN A;  4Z8A A;  5GAN 3;  2COW A;  5GAO m;  3CPW P;  2OX7 A;  5CQX A;  2PUK B;  3OYY A;  5GJW B;  2D1X A;  2F2W A;  1O75 A;  1NE8 A;  2NUP B;  1MMG A;  2EJG A;  2O4X A;  3TVT A;  2CP7 A;  1YIJ Q;  2KDS A;  1K8A C;  2VV5 A;  1W2B P;  3CC2 T;  2CS7 A;  1X6O A;  1K73 R;  4A53 A;  1MHN A;  4JRP A;  3M9Q A;  2DD5 A;  2JW4 A;  1C1A A;  2QQB A;  2DIQ A;  3OMG A;  2VKN A;  4QQD A;  1XQH A;  4J7F A;  5IAY A;  1X2Q A;  3JCM V;  1U5S A;  2CGH A;  5FU6 B;  1WJQ A;  3J80 E;  4NS5 A;  3NTH A;  1ZSZ B;  1BK2 A;  1QCO A;  3FRN A;  1Q82 R;  4OGC A;  3X26 B;  2XDD A;  4PJJ A;  2LQ8 A;  2X9H A;  3S3O A;  4FCY A;  2HQX A;  3EG3 A;  3R6O A;  2MWP A;  1U06 A;  1JBM A;  2NUT A;  1NYF A;  1WDX A;  3TEE A;  4IKF A;  1B3Q A;  1PRL C;  1RAI B;  4O6J A;  1VQO Q;  1A0N B;  2DFU A;  2EYQ A;  2F5K A;  4DBH A;  1PHT A;  2K2V A;  5FW9 A;  3H9N A;  1Q86 C;  3TSW A;  1PKT A;  1RAG B;  2EIF A;  2IPO B;  1YIJ A;  3G71 Q;  3D7S B;  2JNG A;  3H0H A;  1K9A A;  1BIA A;  2HSP A;  5GJV B;  3EG0 A;  2FB7 A;  2OTJ T;  5KYU A;  2XIC A;  5D6X A;  1YN8 A;  2CSI A;  4M7A A;  2YHT A;  1MND A;  2V1Q A;  2C0O A;  1UFF A;  3CC4 Q;  1RI0 A;  4MMK A;  4RTU A;  2ENM A;  3CC7 T;  3FEO A;  5M9O A;  1YIT A;  1VQ4 T;  1PRM C;  2K79 A;  3VS5 A;  1KG1 A;  2JMC A;  4NOY A;  3CME Q;  3EAE A;  2LVM A;  1B7T A;  3M0S A;  4M77 F;  4OP0 A;  2HZY A;  5KYY B;  1GBR A;  1WHJ A;  3VS0 A;  4KBM B;  1LNX A;  4QW2 A;  2DL7 A;  5GAO q;  3VUZ A;  3NMZ C;  3MET A;  2JS0 A;  2K9G A;  5GAN e;  5L8R E;  2OTL Q;  4PJO E;  2L8D A;  3OB9 A;  1VQO A;  1C0M A;  2XU8 A;  4J9F A;  3DLL A;  3MEW A;  4C8Q B;  4D8D A;  3CCJ A;  1WHG A;  2HEQ A;  3NTK A;  2LCL A;  5GAN 2;  3RKX A;  1S72 Q;  1IXD A;  4C92 G;  3CPW S;  1OZ3 A;  3CXC A;  1SF9 A;  1YHQ Q;  3E19 A;  3FC3 A;  1M4Z A;  2GQV A;  4KGX B;  1YCS B;  2RJE A;  3SDZ A;  1AZG B;  2XKO C;  1W2B S;  5D7U A;  2BZ8 A;  3L1A A;  3GNG A;  1VYV A;  2E1H A;  2GQI A;  3CCV A;  4F16 A;  2P0P A;  2LQK A;  4AT1 B;  2DLP A;  2H3E B;  1I8F A;  5D6Y A;  4J6X A;  2FG0 A;  4PLL A;  5GAN d;  3CME A;  4HT9 A;  2OI3 A;  3EHR A;  2AZS A;  1PM3 A;  2M02 A;  2E41 A;  4FW1 A;  4PJO C;  1M8M A;  2G6F X;  2P0Q A;  2JVV A;  2F5T X;  3SWN B;  2CZ1 B;  4II1 A;  4RCC A;  4QKU A;  3FDR A;  4LDY A;  1VQP T;  3E9G A;  2EJ9 A;  2QQS A;  1BB9 A;  4JLG A;  3RUX A;  3G7Z A;  1GBQ A;  1SEM A;  2ROT A;  1IO6 A;  4QVD A;  1K0X A;  4A4F A;  2OTL A;  1AWX A;  2GF7 A;  4C0D C;  4PFZ A;  4JS4 A;  1RI9 A;  2YDL A;  2GTO A;  4WTO B;  4M77 D;  4JJC A;  2DKG A;  3M55 A;  2X4J A;  1SHG A;  1RLP C;  1VQN Q;  3FLG A;  2E12 A;  3A1P A;  1OX8 A;  2QTV A;  1S72 A;  5CIU A;  4C8Q A;  2LJ0 A;  2X35 A;  1PSF A;  3TQ7 P;  2GGR A;  1VOM A;  1YHQ A;  3DKM A;  4E2F B;  3VS6 A;  3PMI A; 
#chains in the Genus database with same CATH homology
 2QEX A;  5CKB A;  1K73 U;  1XOV A;  4Y91 A;  3A8L B;  5CAI A;  4J7I A;  3L2V A;  2DZ9 A;  4Q5W A;  1B34 B;  1G3Y A;  3LH0 A;  3PT9 A;  3QHS A;  3JCM c;  5C0M A;  5GAM d;  3OYL A;  3CMA A;  1YIT T;  1M1K C;  4C5E A;  2A7Y A;  2QI2 A;  3JCM f;  2XD0 A;  2DTO A;  3VV0 A;  4P5N A;  3L42 A;  1TH7 A;  2LNV A;  3T9N A;  2JTF A;  3ZFJ A;  1P92 A;  5CKE A;  1I4K 1;  3OMC A;  3OYI A;  1Q81 U;  3Q1J A;  1JRI A;  2LCC A;  2RK2 A;  5GAM j;  3LWH A;  4HCC A;  1YJN T;  2HBP A;  2RHZ A;  2V8I A;  2HD0 A;  5CR2 A;  3UPU A;  1VQ6 T;  1K73 C;  3OYC A;  2LTO A;  4XU1 A;  2XI9 A;  3BDL A;  4M78 G;  3L2W A;  2G3R A;  2L3R A;  3CBP A;  1Q7Y U;  1BKB A;  3GPL A;  4BD3 A;  3OYA A;  1HK9 A;  2LC4 A;  3NTI A;  3DB4 A;  5J39 A;  2DTI A;  2DO3 A;  2CZ7 B;  2DXU A;  5LL6 S;  4C92 D;  2ZZD A;  1M90 C;  2A3L A;  2R5A A;  1Q82 U;  1M9S A;  5GAO n;  3CC2 A;  2DD4 A;  2M0O A;  2RI3 A;  3M59 A;  4F7U B;  1QVG S;  1WJS A;  2P4T A;  2HNI A;  5KE2 A;  3TU4 K;  4M7D E;  4PJO B;  3PTA A;  3GLX A;  5FRO A;  2OAU A;  3JCM h;  4HT8 A;  4M75 A;  5EG2 A;  3ER0 A;  4HCB A;  2M16 A;  3OYB A;  2DEQ A;  3OBW A;  2RO0 A;  2DAQ A;  2HAX A;  2KQW A;  3CBM A;  3NFC A;  4C5H A;  2XDB A;  3CCJ T;  3I56 T;  3G71 A;  1BI1 A;  3RES A;  3LGF A;  1YJ9 T;  3CBO A;  1BI3 A;  4B9X A;  5GAN g;  3JAM E;  4N0A A;  2P0K A;  1UGP B;  2M1H A;  2QQ9 A;  2VYT A;  4XTX A;  3CCE A;  2X4Y A;  1NJI U;  1ZBX A;  2K3Y A;  3ZBD A;  3OW2 A;  3CCS T;  4C8Q D;  2E6N A;  3CCU A;  2QQR A;  4VUB A;  3JCM J;  3HRT A;  3V7C A;  1KQ1 A;  1Y96 A;  3JRZ A;  3QPH A;  5CKD A;  1VQN A;  2QA4 A;  4ATO A;  3HP9 A;  2K4Y A;  1WNL A;  1X01 A;  2E6Z A;  4C0F A;  3CC4 A;  2WAC A;  5GMK j;  2VGM A;  5J26 A;  4LDX A;  3CCL T;  2CZ6 B;  2DK3 A;  4C8Q G;  3QXE B;  3CCM T;  3OY9 A;  3C94 A;  3M58 A;  3TCJ A;  4F7U G;  2WSE E;  1OZ2 A;  1KHI A;  4PJO G;  4D6W A;  1M5Q 1;  3OBY A;  4KUD K;  4B9W A;  4RKU E;  2JOY A;  3CCV T;  3JB9 F;  2MMP A;  5GMK h;  1W4S A;  5GAM e;  2PVD B;  3J7A F;  3QG1 A;  4IUU A;  3LX7 A;  4IUQ A;  3LYI A;  2E65 A;  4KT0 E;  4RG2 A;  4MDW A;  1GXI E;  1UGS B;  2MAM A;  2I2L A;  4M75 B;  4R56 A;  3HRS A;  1IZ6 A;  4F7U F;  3JCM e;  1YJW A;  4A54 A;  4J83 A;  1B34 A;  1VQ5 T;  3RMQ A;  1R8O B;  1JB0 E;  4PJO F;  4JS5 A;  5FRM A;  4OB2 B;  3HRU A;  4M7D C;  4M77 E;  1U1T A;  3QO3 A;  1LJO A;  2DVE A;  2FVU A;  4GLK A;  5GAO p;  3JSC A;  4ZGD B;  4BE0 A;  1QVF S;  2GCX A;  4QQ6 A;  1VQ8 A;  2F69 A;  3JB9 J;  2RHY A;  3A8G B;  4XTW A;  2L89 A;  3QJ6 A;  5LJ3 f;  5HK3 A;  1NZ9 A;  5GMK i;  3CCR A;  3JCM P;  2KK4 A;  1KD1 C;  2PQW A;  2RJD A;  2QQA A;  2E70 A;  4HA8 A;  4XU0 A;  1VQL A;  2KAF A;  1KQS A;  2QTX A;  4MDX A;  1JJ2 S;  4E7L A;  2WSC E;  3CXC S;  2L5Q A;  5GAM g;  2MI6 A;  1SSF A;  1VQK T;  2LT1 A;  1KHC A;  4JDS A;  4PNO A;  5HK0 A;  2RHX A;  3MCA B;  1X75 C;  2RJC A;  2OTL T;  2LRQ A;  2GFU A;  2EQJ A;  2RHU A;  4IUT A;  3KUF A;  4MZM A;  3OQ5 A;  3KBG A;  4OB3 B;  3P8B B;  4BB7 A;  4EMH A;  4LDV A;  4OMF B;  5LJ3 j;  5GAN 5;  4E7J A;  3RER A;  2JUF A;  4E7H A;  2DIG A;  5CQY A;  3PFS A;  5FU6 C;  2XK0 A;  4M75 G;  3X24 B;  5GAN 8;  1KC8 U;  4E47 A;  3QKJ A;  1VQ9 A;  3I55 T;  2GFA A;  3OYE A;  4BI4 A;  2XID A;  4C0G A;  2B8A A;  1G3S A;  4XTU A;  4M78 E;  4C5I A;  4MZT A;  5GMK e;  3BFM A;  2LX9 A;  2D9T A;  4L5G A;  5LJ3 h;  3CPW A;  1LOJ A;  4A4E A;  2RHI A;  3RKW A;  2FYK A;  5DLO A;  3F70 A;  2ZCF B;  4FU6 A;  2C06 A;  4L6V 5;  3EFS A;  3JB9 I;  3MEU A;  1YHQ T;  4M75 F;  2MWO A;  3VUB A;  2R58 A;  3A8O B;  3HFO A;  4C5G A;  4BE1 A;  3DB3 A;  4KUI A;  4M78 D;  1VQM T;  2LDM A;  3G6E T;  1BI2 A;  2ZPF B;  4OB1 B;  2R5M A;  4FL6 A;  3JCM d;  4C92 E;  2QEX T;  3SB2 A;  3CCQ A;  3ME9 A;  2D0Q B;  1W2B A;  3HKS A;  1K9M U;  5HY6 A;  3VYH B;  3CMA T;  4M77 C;  3N5B B;  2RJF A;  2E64 A;  3P8D A;  3OYH A;  4LD6 A;  1BI0 A;  1OI1 A;  4ELY C;  5LJ5 f;  2CKK A;  1K8A U;  4XTY A;  5FRN A;  2PVG B;  5KCO A;  4RG8 A;  3WXM B;  5GAN 3;  3RMS A;  1VQ6 A;  5GAO m;  4A4G A;  1QW1 A;  1WQ7 A;  4NL3 A;  1HXD A;  5CQX A;  5CKF A;  2PUK B;  3OYY A;  3J81 E;  4EDU A;  5FLX E;  1VIE A;  2BIV A;  1Q81 C;  1I81 A;  3L2R A;  1VQ4 A;  1O75 A;  4M7A E;  1QP2 A;  1VQ7 A;  3V8K A;  2JZ2 A;  3QUI A;  3LGL A;  4C8Q E;  5LJ5 j;  1NE8 A;  1VQO T;  3G4S A;  1VUB A;  2EJG A;  2O4X A;  4J6Y A;  1Q7Y C;  4YTL A;  2KDS A;  1K8A C;  1FXX A;  2VV5 A;  3CC2 T;  3HHT B;  5LJ3 e;  4A4H A;  2CS7 A;  1X6O A;  2V8J A;  4M7D B;  3QBY A;  3OS5 A;  4OB0 B;  4X9C A;  4M78 C;  2QXF A;  3C12 A;  2DJZ A;  1MHN A;  2JN0 A;  3SD4 A;  4A53 A;  4DOW A;  4JRP A;  3M9Q A;  4FSX A;  1N9S A;  2DD5 A;  4J5Y A;  2VXE A;  4ZN3 A;  5LJ5 h;  3X25 B;  1YJ9 A;  4DA4 A;  3JB9 G;  2QQB A;  3JCM W;  2DIQ A;  3OMG A;  3JB9 H;  1UGQ B;  4PJO D;  4M77 A;  2K3X A;  4EMK C;  3G71 T;  4QQD A;  1H3Z A;  2O01 E;  3CCS A;  3AHU A;  3CD6 T;  1XQH A;  4J7F A;  1U8R A;  5IAY A;  4BDY A;  3M54 A;  4JRI A;  3VJP A;  1NPR A;  3JCM V;  4C92 C;  5GAN 6;  3CCU T;  4IUV A;  4EMG A;  2CGH A;  1NJI C;  1M1F A;  1OYX A;  2XHC A;  1N8R U;  1VIF A;  3CCL A;  3OYF A;  3CCM A;  5FU6 B;  1WJQ A;  3J80 E;  2DXT A;  4FIB A;  4NS5 A;  3CC4 T;  1M8V A;  3NTH A;  4JRQ A;  1Q82 C;  3O8V A;  3A5Z B;  3FRN A;  5CVI A;  4JRK A;  3P8H A;  4OGC A;  3X26 B;  2XDD A;  4OGE A;  2EQK A;  5I21 A;  4M7D G;  3OSV A;  1G3T A;  5KE3 A;  2YRV A;  2LQ8 A;  3C4S A;  3M4Y A;  4XAX B;  1KQ2 A;  2O4X B;  3S3O A;  1QVP A;  4V2S A;  2JTM A;  1UB4 A;  2RA2 A;  4XU3 A;  2HQX A;  1Q86 U;  4O5V A;  4BI3 A;  3V7S A;  4CI0 C;  3CME T;  5GAN f;  3R6O A;  1IRE B;  2RD1 A;  4BY6 C;  2MWP A;  4M7A C;  1JBM A;  4ZGJ B;  2NLU A;  4A4K A;  1WJR A;  3M53 A;  3TEE A;  4C8Q C;  5GAO r;  4IKF A;  1WPY A;  1G5V A;  2RB6 A;  4CRI A;  1VQP A;  2E10 A;  5GMK m;  2HQE A;  3MEV A;  4PLI A;  4BAC A;  1YJW T;  4RCB A;  4O6J A;  5IN1 A;  4EMK A;  4E7K A;  5LJ5 e;  4M7D F;  2WSF E;  5LJ3 d;  2DZC A;  3PIO A;  2DTH A;  4Z02 A;  2EYQ A;  3ZEH A;  4M77 B;  2F5K A;  4ELZ C;  1WGS A;  2EQU A;  2DXB A;  4M75 D;  5GAN j;  2K2V A;  2K5L A;  3MP8 A;  4C92 A;  1Q86 C;  3OS0 A;  3CCR T;  4X9D A;  4C0Z A;  5IT9 E;  4N4H A;  4BE2 A;  4ZTJ A;  1YI2 T;  2EIF A;  1VQL T;  2BKD N;  5A0G A;  1MGQ A;  3JCM g;  3OW2 S;  2PU9 B;  3QZ5 B;  3VYG A;  2MF2 A;  3X28 B;  5A2Q E;  1YIJ A;  3QDR B;  4OVA A;  5GAN h;  1QVG A;  2JNG A;  4HCZ A;  5DM7 R;  3QII A;  5KCH A;  1D3B A;  4XU2 A;  1EIF A;  3MHX A;  4MML A;  3OS1 A;  1BIA A;  4GY5 A;  4N4G A;  1S72 T;  2D6F A;  2FB7 A;  2VUB A;  3V8J A;  2OTJ T;  3WVD B;  3C95 A;  2XIC A;  5D6X A;  4M7D A;  2KY9 A;  4M7A A;  2YHT A;  1VQ9 T;  4PKC C;  3BDU A;  1M1K U;  3OYK A;  1BIB A;  2Y90 A;  4M78 B;  2Y4X A;  1RI0 A;  1DJ7 B;  4MMK A;  3OSS C;  2ZPB B;  3JCM b;  5KH6 A;  2YLB A;  4E7I A;  1KC8 C;  1V29 B;  4M77 G;  3CC7 T;  3FEO A;  5M9O A;  2IG0 A;  1YIT A;  3JCM Q;  1VQ4 T;  3UT1 A;  3V7R A;  4JUV A;  1KG1 A;  3UDC A;  1N27 A;  2FL7 A;  2X4W A;  4EMK B;  2ZPG B;  4FM4 B;  3SWN C;  3BW1 A;  1VQM A;  3G6E A;  4NOY A;  4R55 A;  4XTZ A;  3S6W A;  1PSE A;  2ZPI B;  3EAE A;  2LVM A;  2CZ0 B;  1O9S A;  5FU7 C;  1AHJ B;  3FB9 A;  1YJN A;  4C92 B;  1FWZ A;  3CCQ T;  3L2Q A;  4X34 A;  5D6W A;  2RI2 A;  5LJ5 d;  4M77 F;  4ME7 A;  4OP0 A;  4N0A C;  4FT4 A;  3S3M A;  3FJP A;  2ZPE B;  4WF2 A;  2VGN A;  1M90 U;  3FIF A;  4KBM B;  1LNX A;  2R57 A;  3E9F A;  4QW2 A;  3CPF A;  2VXF A;  5GAO q;  1XTD A;  1KQS S;  1M1G A;  3VUZ A;  4L59 A;  1K9M C;  2E5Q A;  3MET A;  4J6W A;  3CEY A;  3S3N A;  1D3B B;  5GAN e;  2BUD A;  4FT2 A;  5L8R E;  4F7U E;  3TRE A;  2Y4Y A;  5HKC A;  4PJO E;  2L8D A;  2KMT A;  3JB9 D;  3OB9 A;  2LT4 A;  3A8H B;  4UC4 A;  1YCY A;  5C6S A;  4BY6 B;  2K5F A;  4M7A B;  1VQO A;  2XU8 A;  3M56 A;  4BI8 B;  3UWN A;  2RI5 A;  5GAM h;  2K57 A;  3DLL A;  1VQ7 T;  1QVF A;  3MEW A;  4C8Q B;  2RH2 A;  3CCJ A;  3HFN A;  3I56 A;  5CO7 A;  3G4S T;  3NTK A;  2LCL A;  2M9U A;  4TVR A;  3EFR A;  1H64 1;  5GAN 2;  3SWN A;  3RKX A;  3OYN A;  2VC8 A;  3MEA A;  3LWI A;  5GAO l;  4JJN K;  4M78 F;  4C92 G;  3CPW S;  4XQ3 A;  1JJ2 A;  3INZ A;  1OZ3 A;  3GOX A;  3PNW C;  3CXC A;  3CCE T;  4M75 C;  3QSU A;  4IUP A;  4XK8 E;  4MZP A;  3QJY A;  5I2M A;  4BDZ A;  3E19 A;  1U1S A;  4QQG A;  3H6Z A;  3FC3 A;  3OYG A;  5DLQ E;  1VQN T;  3CD6 A;  4M7D D;  1M4Z A;  2GQV A;  2QA4 T;  2RK1 A;  2YLC A;  3HL8 A;  5LJ3 g;  2RJE A;  2KSS A;  3SDZ A;  3ASK A;  2XKO C;  3QZ9 B;  3OYD A;  4C92 F;  1W2B S;  3RIR A;  4C0D B;  1XNI A;  1RL2 A;  3H8Z A;  3JCM X;  2DPP B;  3L1A A;  3PGG A;  3GNF B;  3RKY A;  4DQ2 A;  3WVE B;  3GNG A;  3CCV A;  2E1H A;  4M7A G;  4PL6 A;  3V8L A;  2P0P A;  5DY9 A;  4J8O A;  2LQK A;  4XTV A;  2XG8 D;  1N6A A;  1Y07 A;  4JLI A;  3M5A A;  1I8F A;  5D6Y A;  2DXC A;  3L2Z A;  4J6X A;  5CKH A;  4M7A D;  4M78 A;  3OA6 A;  3L2U A;  4PLL A;  4M75 E;  1N8R C;  2EAY A;  2CYZ B;  2EQM A;  1VQ5 A;  5GAN d;  3GP8 A;  2RM4 A;  4LDU A;  2PVO B;  2V8K A;  3CME A;  4HT9 A;  4PJO C;  4EPC A;  1KD1 U;  2E41 A;  3PIP A;  4M7A F;  2P0Q A;  2JVV A;  5GAN 7;  1ZHI A;  2F5T X;  3M57 A;  3SWN B;  4BUG A;  2CZ1 B;  4II1 A;  4C8Q F;  2KVQ G;  4RCC A;  2K5I A;  3VU3 C;  4DOV A;  3FDR A;  4LDY A;  3A8M B;  1VQ8 T;  3BY7 A;  1YBY A;  5FU7 B;  4QVC A;  1VQP T;  1Y71 A;  3E9G A;  3HPW A;  4ZGE B;  3MP1 A;  1I5L A;  1ZQ1 A;  2EJ9 A;  2EKO A;  4OF1 A;  3OYJ A;  2QQS A;  4JLG A;  3RUX A;  3G7Z A;  1UGR B;  3URG A;  3KXT A;  1VQK A;  4Y28 E;  3E1S A;  4LD9 K;  4QVD A;  3LW5 E;  3GF5 A;  4A4F A;  2OTL A;  3QYH B;  3OS2 A;  2AHJ B;  4KUL A;  4HKE A;  1YI2 A;  2GF7 A;  3GIB A;  4IUR A;  2FHD A;  4C0D C;  4ZTF A;  1Y7X A;  2XDP A;  5A0D A;  3OYM A;  2ZPH B;  5A0L A;  1QP3 A;  1Y96 B;  4JS4 A;  3SFM A;  2PUO B;  3LLR A;  1UEB A;  2EJF A;  4M77 D;  3MO8 A;  3I55 A;  2DKG A;  2ZGW A;  3MP6 A;  3M55 A;  5GMK l;  5J3B A;  2X4J A;  5LJ5 g;  3PMT A;  3DLM A;  4ZN1 A;  4NL2 A;  1YIJ T;  3FLG A;  2IVW A;  2E12 A;  1S72 A;  5CCA A;  1N9R A;  4QVZ A;  5CIU A;  4C8Q A;  2OTJ A;  4F7U A;  3QYG B;  2EFI A;  2H3J A;  1FX7 A;  5CK9 A;  3M4G A;  4RMO A;  2X35 A;  1PSF A;  4PJO A;  3VKI A;  5I2S A;  2QDY B;  4N4I A;  3X20 B;  1YHQ A;  4LDW A;  3HSB A;  3DKM A;  2EWN A;  2X4X A;  5AYF A;  1BYM A;  3CC7 A;  1G3W A;  5GAN 4;  3PMI A;  1NPP A;  5GAM f;  1WQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...