4M75E

Crystal structure of lsm1-7 complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
75
Chain Sequence
ILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDSRNEKVMQHHGRMLLSGNNIAILVPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 10
structure length 75
sequence length 79
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75E00
5LJ3g 1N9SA 5GANf 4QVDA 2JN0A 4DQ2A 5GMKh 5GAOr 3V8LA 4EMKC 4V2SA 4XQ3A 5LJ5d 3SWNA 4M75B 2VXFA 5LJ5e 1JRIA 3JB9I 1D3BB 3M4GA 1I5LA 4M7AG 2HNIA 2ZGWA 5GAN7 2DJZA 4C8QB 1H641 4M7AF 1HXDA 5GMKe 2E10A 5GANd 3PGGA 3V7SA 3JB9G 4A53A 5GANe 5GAN4 1B34B 4XTXA 3L2ZA 3JB9F 4N0AA 3V8JA 3INZA 1HK9A 3GIBA 2DZ9A 3QHSA 3JCMb 4JRIA 4XTZA 4PJOD 2RD1A 2RM4A 4M78D 4PJOA 4M78A 5LJ3f 1MGQA 4M7AE 4F7UE 4C92E 4XU0A 2DXUA 3HFNA 1LOJA 3RKWA 3JCMc 4M77B 5LJ3h 1KQ1A 4J6YA 3FJPA 2FB7A 3V8KA 4EMKA 2DVEA 4M7DB 1I4K1 1Y96A 5DY9A 5GANj 3RESA 4NL3A 4M7DC 1WNLA 5GAMg 1M8VA 5GAMh 4HA8A 4XU1A 4PNOA 5LJ3d 3FB9A 2DXTA 4M75C 4PJOG 4M78G 2E64A 3BW1A 5LJ3e 3JCMX 4J6WA 2DTIA 2YLCA 4M78F 4PJOF 4C92B 4F7UB 4C8QC 2DKGA 4OP0A 3JCMQ 3L1AA 5GAMd 3HSBA 5GAN8 1BIAA 5GAMe 4WF2A 5GAN5 5GAOq 3JB9H 2RB6A 2QTXA 1N9RA 5LJ5j 4M75G 3RKXA 4PJOE 4J6XA 2I2LA 4M78E 4M75F 2DEQA 4QVCA 2E1HA 3JB9J 1KQ2A 4C8QG 5GMKj 4JRKA 2E41A 5GMKm 4M77D 1M5Q1 2DZCA 4RCBA 4X9CA 1YCYA 4C8QF 5GAMf 4XU3A 1U1TA 2EAYA 4M77C 5GAOn 4M7DD 4XU2A 3QSUA 3JCMJ 2K57A 5GAOm 1WQWA 4M7DA 2YHTA 4MMLA 2EJ9A 3BY7A 4M75D 3BDUA 4M75A 2Y90A 4MMKA 1D3BA 2EJFA 1WPYA 4C8QD 4M7AB 5GAOp 4EMHA 3EFSA 4C8QA 5GAN6 3JCMP 5GMKi 2E65A 2FYKA 3RKYA 3SB2A 5GMKl 4M7AC 4F7UA 3VU3C 2YLBA 4C92C 4HT8A 5I21A 4M77G 1B34A 1I81A 3V7CA 4M7DG 1BIBA 4M77F 4EMKB 5GAOl 4J5YA 3EFRA 2DTOA 1Y96B 4M7DF 2CGHA 2DTHA 3SWNB 3QO3A 3BFMA 5GANg 4XTWA 3JCMf 2EWNA 5GANh 3SWNC 4NOYA 5LJ3j 3JCMg 2VXEA 3V7RA 3JCMh 5GAN2 4M77A 1JBMA 4C92G 4F7UG 3QUIA 5CAIA 3RERA 4M77E 4C92F 4F7UF 3HFOA 1X01A 4X9DA 4XTVA 4XTYA 4M7DE 5GAMj 1WQ7A 1U1SA 2EJGA 3JCMW 3FIFA 1TH7A 4M75E 3JCMd 4N0AC 4HT9A 4NL2A 3JCMV 4Y91A 1LJOA 3JCMe 4A54A 5LJ5f 4XTUA 1I8FA 4M78B 4M7AD 4PJOB 4RCCA 5GAN3 4C8QE 1LNXA 2VC8A 4JLIA 2RA2A 4C92D 5LJ5g 3AHUA 4C92A 4M7AA 3RIRA 4EMGA 4PJOC 5LJ5h 4M78C 3RUXA 4JUVA 3JB9D
chains in the Genus database with same CATH superfamily
1QCFA 1NG2A 4KGXB 2PVDB 2JN0A 2MWOA 1T3SA 1IZ6A 4ANJA 1AWOA 3G6EQ 3SWNA 3CC2Q 1YHQQ 2VXFA 2G6FX 2J6OA 2KR3A 2HNIA 4MZTA 2DIGA 4M7AF 1C0MA 2LTOA 1M1GA 4O6JA 3JB9F 2ENMA 2VUBA 3MP1A 3NFCA 1ABQA 3CC4T 4ELZC 2CREA 1BCMA 1M1FA 3L2UA 1JXOA 3FJPA 2PU9B 1I4K1 1QP2A 4FM4B 1NM7A 2HKQB 1M8VA 3L2RA 4GLMA 4E7HA 1PG5B 1FMVA 1M2OA 1W70A 2PTKA 4BI8B 3TCJA 2GGRA 3M5AA 4RTZA 3VS4A 2HBWA 5GAN8 2RB6A 2HQHA 2XDDA 3EAEA 3NHNA 4X1VA 2A36A 2DEQA 1KQSA 2X51A 2RQWA 4XU2A 4M7DA 4FIBA 5GAOm 4N4HA 3QDFA 3VKIA 4RG2A 1GCQC 2EVRA 4EMHA 3FEOA 3JCMP 1AT1B 2K5FA 4CC4B 2IG0A 4HT8A 4F16A 5I21A 4OB1B 3OS1A 4IIOA 4EMKB 5CCAA 1BU1A 2DTHA 2DM1A 3JCMg 4FL6A 3VS1A 2EGEA 5KH6A 2E12A 5CAIA 2ED1A 4QQDA 1IREB 2JTFA 1R0BG 2COWA 4FT2A 1VQKA 4IIMA 3C94A 3JCMd 5IT9E 4XTUA 3EFOB 3H9NA 2FZKB 4JDSA 3QKJA 4M7AD 5LJ5g 4FT4A 4CI0C 2HKNA 3JB9D 2COYA 3V8LA 1JXMA 2XU8A 5LJ5d 4R56A 4J9IA 3OYIA 2MK5A 2HDAA 3S3OA 1VQLA 1YIJA 2O88A 1OX8A 2EQMA 2CH4A 1B34B 3M53A 4AMCA 2KRMA 4KT0E 3MEAA 2EQKA 1JEGA 2H3JA 4EIKA 2EGCA 4XU0A 1Q82C 1QWEA 1AD5A 1VQ8A 2LNHB 2HSEB 3L2VA 4NL3A 1VQ6A 2XDBA 1WFWA 2M16A 4C0FA 3LGLA 2E64A 2LP5A 3CCLQ 4C8QC 1RAGB 3J80E 4PJOE 3CD6Q 4QVCA 2E1HA 4C5HA 2CDTA 3A8GB 2EAYA 2QK0A 2K57A 1WQWA 1YWOA 2BKDN 1S72A 2QASA 1EFNA 1B07A 1U8RA 1EZZB 3H41A 4C92C 2QQBA 1G3SA 4M77F 1UGQB 8AT1B 1OX9A 2MOXA 4LD6A 2EWNA 1G3TA 4NOYA 1IGUA 3V7RA 2M02A 5KE2A 4F7UG 3CC7Q 1X27A 3HFOA 3A8HB 1Q81C 1UFFA 4KH1B 1WQ7A 3VS0A 3CCEQ 1TH7A 3OYDA 2YRVA 1XQHA 1YNZA 2EGAA 4NL2A 2O9VA 2QGGA 4M78B 2QXFA 1HD3A 4M7AA 3L2WA 1N9SA 2KYMA 2MIOA 3FC3A 4JRQA 1N6AA 1GBQA 4HCCA 2EBPA 2XD0A 3X24B 1VQNT 1M3AA 4LD9K 4BD3A 1QVGP 2EQIA 3ASKA 4FYVB 2J05A 1G3YA 2DL8A 2E70A 4J9GA 4PK4A 2KVQG 2LMJA 3M54A 5ECAA 1NYFA 2JW4A 2FPEA 2DXUA 2CS7A 4J6YA 1O75A 2LT4A 3QYGB 4RTUA 4XU1A 5LJ3d 1PKSA 2RF0A 3JCMX 1KC8U 3G6EA 4PJNA 2DKGA 3CCUQ 3CC2A 1SSHA 1HSQA 1YHQA 2OTJT 4WF2A 1V1CA 1YBYA 2E5KA 4HXJA 3OW2S 3C95A 4AT1B 2JM8A 4M77D 4X9CA 2D0NA 1U1TA 4LDYA 2CP3A 2KROA 4BY6C 3CMAA 4PLLA 1WJSA 3GOXA 4C8QD 1VQ5T 2MWPA 2HAXA 1IHWA 2PUKB 2ABLA 2LX9A 1BIBA 2JOYA 1QVFS 1EX4A 3HL8A 3NTHA 5FRNA 3S3NA 3JCMf 5HKCA 1NYGA 3NPFA 4L6V5 3EGDB 4PLIA 2ATCB 2RK1A 4M75E 4HT9A 2RQTA 3JCMV 1GCQA 1T3LA 2QQSA 3OYEA 1D0XA 1X6OA 4HCZA 5LJ5f 4C92D 3N5BB 3QYHB 1NJIU 5KYNA 2PQWA 1QWFA 1M2VA 1K73U 4DQ2A 2FPDA 3EH1A 4ZTJA 2FO0A 5CR2A 4GLKA 3HRTA 1BK2A 2ZPBB 4LDVA 1ZBJA 5GAN7 3UA7A 3A8MB 4ZN1A 2E10A 3CMEQ 2HCKA 2HBPA 1YI2Q 4PFPA 2LCLA 2YUPA 1YWPA 4XTZA 4RTVA 4A4KA 1MUZA 1W2BS 1Q7YR 1YITQ 2F2WA 5I2SA 1PC0A 2HZYA 4Z8AA 4MDWA 2KXCA 1N8RU 2IVWA 1X43A 3U23A 4QVZA 3OBYA 1WNLA 5GAMg 1G83A 1OEBA 4FCYA 1JB0E 1NZ9A 1H92A 2V8IA 1WXUA 1ACMB 2DILA 4J83A 3L1AA 5GAMd 4QW2A 2DX1A 1KQSP 3C12A 2MCNA 2K2VA 5CK9A 3CCSQ 2JMAA 2RJDA 1YJ9Q 2HL5C 2LCCA 2RQVA 1VQMT 2YRCA 3AHUA 5GAOq 3MPUB 1K9AA 2FPFA 4A4GA 3TU4K 1FWZA 1RABB 2CP5A 2DJQA 3P8HA 2IIMA 3VYHB 3CCMT 2JT4A 4C8QA 4DOWA 4QT7A 3FLGA 1JJ2P 1VQOT 3VYGA 2K79A 2XHCA 2KE9A 2DTOA 3CCLA 4RTXA 3BFMA 1AVZC 4FYYB 3OYAA 1K73R 2ED0A 4J7FA 4IKFA 1WJRA 5IHNA 4F7UF 4X9DA 2HQXA 4M7DE 3CD6A 1CKBA 4E7SA 1JO8A 3SHWA 1GFCA 3QPHA 4C92A 1QVPA 2X4JA 4LUEA 1UGSB 2LQKA 2CH4W 1NEGA 4D6WA 1PRLC 2JM9A 4OVAA 4M75B 1D3BB 5IH2A 5CQYA 1OULA 4TVRA 2QEXQ 2XMFA 2NUTA 5J39A 3QG1A 4KULA 1Y7XA 1Q86C 1KD1U 3R6NA 1MNEA 3V8JA 2BZ8A 4KUDK 4LDXA 1HK9A 5DLOA 2RNAA 1RAHB 3CC7A 2EQUA 5FWCA 7AT1B 1VA7A 1MGQA 5LJ3f 4C0ZA 1AWXA 1UGPB 4LDUA 3CCEA 1M1KC 1PSEA 4Y92A 4OMMA 2EPDA 1Y07A 2AIRB 2DVEA 3CCRQ 2RMOA 2YDLA 2VB6A 2B86A 2FL7A 3EG3A 3SDZA 2KNBB 4HA8A 2RQUA 4M78G 2JS2A 1K1ZA 2LC4A 2OX7A 3T9NA 2A3LA 2KYBA 2LZ6B 1WHKA 4OP0A 5DLQE 3E9FA 1ZUYA 1FXXA 4II1A 1V29B 4E7LA 2BE7D 1QVGA 1KHCA 2ZPHB 1ZX6A 2KBTA 8ATCB 2XKOC 4MMKA 1UG1A 1A0NB 2DL7A 4JJCA 3C0CA 1Y0MA 3RKYA 2FYKA 2X4YA 3PMIA 3EFRA 4GY5A 4PFOA 3C4SA 3CCUA 4J9FA 2EQJA 1KFZA 1IXDA 1BI2A 2KK4A 3MO8A 3EG2A 3OY9A 3P8BB 1N27A 1NPRA 5GJVB 3L2QA 1VQKT 1OZ2A 2K4YA 3A5ZB 2H8HA 5HK0A 2NLUA 1KD1R 4BACA 3CCQA 1VQ4T 5FU6B 2HD0A 5EC7A 3VS7A 1ZUKA 1ZHIA 2H3EB 4V2SA 4XQ3A 1VQLT 2J6FA 1YIJT 2WSFE 1C1AA 1M27C 2O31A 1Q82U 2VWFA 3VRZA 1PRMC 5IHIA 2DZ9A 2X3WD 2F1LA 1VQ8T 4M7AE 3D7SB 4RUGA 4Z89A 1B7TA 3X25B 5AYFA 3HFNA 3EG9B 4JRPA 3RMQA 3SFMA 1KQ1A 2P4TA 1VQ6T 4IURA 2I0NA 3LWIA 2D8HA 5D6XA 1OV3A 3FB9A 3GPLA 2QYZA 4FU6A 4J6WA 2DTIA 1OYXA 3M0RA 4OMLA 2LT1A 5IAYA 1QCOA 2QG9B 2EW3A 3TVTA 5LJ5j 1G5VA 2B8AA 4L5GA 2LCSA 1YI2A 3OYMA 3G71Q 3KFVA 1F1BB 2O4XA 4RCBA 2DXBA 2GQVA 1YITA 4QKUA 1TUDA 3H8ZA 1S72T 1WI7A 2L3PA 1VQPQ 2DA9A 2W0ZA 9ATCB 3SB2A 3VJPA 4F7UA 4DEXA 1I81A 2XK0A 2K5IA 3HTRA 1W1FA 1K8AU 2RQRA 2M9UA 1Q81U 2JNGA 2ZCFB 1SRLA 3PMTA 1MNDA 3CCSA 3KBGA 2X9HA 1YJ9A 2QTVA 3CBPA 1D0ZA 1K9MR 3I5SA 3UF4A 1ARKA 1QQJA 3JCMW 2PVOB 1Q95G 2AKKA 1NLOC 4E2FB 1I8FA 2A28A 5J3BA 4M78C 3MEUA 4F17A 3THKA 1VQ7Q 1VIFA 3L42A 5IHKA 3CXCS 1JJ2A 4C0DB 1JU5C 2QQ9A 2KY9A 1MV0B 2LQNA 3JCMb 1Z9ZA 3WXMB 2RN8A 1X6BA 2GFUA 4B9WA 5FW9A 4A4HA 3JCMc 1KIKA 2GNCA 2M1HA 4BI3A 4HCKA 1XJWB 5HY6A 3VUBA 1Y96A 1I5OB 1NPPA 2DYIA 3G6ET 1M3BA 2R5MA 3CC2T 4M78F 6AT1B 2FG0A 1WHMA 1SRMA 2RH2A 2DXCA 1KG1A 2R5AA 3ULRB 3MEVA 4KGZB 2QEXA 2DEUA 4CC2A 2QTXA 3OYNA 3VS2A 4M75G 4Z02A 4RTWA 1UGRB 4J6XA 2OTLA 4KUIA 1K8AR 1VYUA 5CKEA 5D6WA 1BB9A 5GMKj 2KRSA 2CT3A 1M5Q1 1YP5A 3CMAT 4M77C 1VYVA 1QP3A 1TG0A 2Y90A 4A4FA 3UDCA 2LJ0A 3EGUA 4P5NA 3OS2A 2Y4XA 4CC3A 3OW2P 2E3IA 3CCJQ 4BE0A 2JVVA 2RI5A 2ZZDA 2CP6A 3DB3A 1PD0A 4AFSC 2CGHA 1FX7A 1P92A 1ZSZC 5KYUA 5LJ3j 2DETA 2EYXA 5FU7B 2KQWA 3OBWA 4M77E 1UEBA 2FVUA 1IO6A 1TOVA 2LDMA 2XG8D 2EJGA 1U1SA 2AT1B 1QVFP 2L8DA 3LYIA 2MI6A 4OMFB 3SD4A 1AZEA 4C8QE 5GAN4 5A0LA 1GFDA 1OQKA 2V26A 3I56Q 2EIFA 1WDXA 3M4GA 3E9GA 3M55A 3PIPA 4J9CA 2DK3A 2G3RA 4DBHA 2F5KA 2CT4A 3G7ZA 2ZPEB 4M78D 3OYGA 4C92E 5KYWA 4E7JA 1LOJA 3H0HA 4RTTA 2LQWA 1LCKA 3EH2A 3QBYA 1S1NA 2GF7A 1WLPB 4VUBA 1W2BP 2BIVA 1AZGB 2VGMA 2D0QB 2L3RA 3H0FA 1M2VB 2RI2A 1TUGB 4RTYA 2DBMA 3RKXA 4J9HA 4OB0B 4JRKA 3KUFA 2Y4YA 1YJWA 4BE1A 2AZSA 3OMCA 5I22A 5GAOp 4PJMA 3OYBA 2NUPA 5GMKi 2E65A 2W10A 5GMKl 4Z88A 3VU3C 3NMZC 3CCLT 4ZNXA 2E4HA 5GANg 2YUNA 3HKSA 1M30A 3OYLA 1I07A 3JCMh 5GAN2 2X35A 3CD6T 1VIEA 4XTVA 3CBOA 1VQ9Q 5GAMj 2L5QA 3ER0A 3DLMA 3G71A 4PJOB 5LJ5h 3ZEHA 3M59A 3I55Q 3OMGA 3OYJA 4UC4A 1VQPA 2LX7A 1Q86U 4CC7A 3H0IA 2MMPA 2J06A 2QA4Q 2E6NA 2X3XD 1VQOQ 4C8QB 4ME7A 1M1KU 4XTXA 3INZA 3CC7T 1AWJA 2PNIA 2R57A 3CCET 2RO0A 2CSQA 4M78A 1K4US 2AZVA 3BE3A 2EYYA 4PJLA 2C0IA 2C0OA 1GCPA 3OS0A 1DJ7B 2J6KA 1MV3A 3GNGA 2K9GA 1VQ7A 2YLCA 1BKBA 1WXBA 4C92B 3ZBDA 3H6ZA 1WJQA 3HRSA 2DBKA 1KC8R 1BIAA 5KYXA 2D9TA 2VV5A 4MZPA 3TEEA 2CP0A 4M75F 1NE8A 5KCOA 2NUTB 5FRMA 2F2XA 2XI9A 3UPUA 3MP8A 3LWHA 3VV0A 3VRYA 3DKMA 2KSSA 2QDYB 1G2BA 2EJFA 4LUDA 2ZPGB 3M58A 1M90U 1BBZA 1HJDA 1RAFB 2FEIA 2GQIA 3OQ5A 2DL4A 3REBB 2P4RA 3M57A 3CCUT 3LX7A 4E7KA 3QO3A 3PFSA 3JAME 2KDSA 3CPWS 5KE3A 4M77A 1G3WA 5KYYA 4XK8E 2AKLA 4E6RA 2CP7A 2GTJA 3OYYA 2YSQA 3EGXA 1J3TA 4N0AC 3CCQT 4FSSA 3AT1B 2DMOA 1FYNA 4EMGA 4F7UE 1YJNQ 1UGVA 3FJ5A 4C5IA 4ZTFA 1NJIR 1OU9A 1ZA1B 4PKCC 5GMKh 5GAOr 3KXTA 3OW2A 3URGA 2QDLA 1ZSZA 3CCJA 1WYXA 3ZFJA 1QMCA 2ZGWA 5GANe 3A98A 2XDPA 4MZMA 1QKWA 2FRWA 2VKNA 2JTMA 3M0SA 3RBBB 4J9BA 4Q5WA 4HKEA 3P8DA 4FYXB 3RKWA 1UTIA 4OMPA 5CKHA 5LJ3h 1QVFA 2FB7A 5D7UA 2LQ8A 3UA6A 2KGTA 1Q7YC 2AHJB 1XOVA 3RESA 1N8RR 2EYWA 4AFQC 4PL6A 4E7ZA 3OYFA 1VQ4Q 1E7OA 3G4SQ 4O5VA 5I11A 3EHQA 2GTOA 2O9SA 1GL5A 4M4ZA 4OMNA 3I56A 3EHRA 3E2UA 4EPCA 1BCOA 1M9SA 2HQEA 3JB9H 4PJJA 5CIUA 4YTLA 1BI0A 3DLLA 3CCVQ 2EYQA 2GCXA 2E41A 1U06A 1YITT 1YCYA 1M8MA 3SEMA 3QSUA 4HCBA 2C06A 1Y71A 1WPYA 1RADB 2O01E 3ZL7C 1RAIB 2IPOB 3V7CA 2F69A 2WSEE 1TSFA 5L8RE 3SWNB 1W2BA 2FHDA 3CEYA 2V1QA 5L23A 4BI4A 1VOMA 3CCST 1MMGA 1YJ9T 2VXEA 2OI3A 1PM3A 1NJIC 3JSCA 5LL6S 4ZN3A 1YCSB 5IXFA 1JBMA 2CUDA 3PVLA 1K73C 3LLRA 3QJ6A 2K3XA 1SSFA 3CC4Q 2YUOA 3PNWC 3PIOA 5GAN3 1LNXA 2DF6A 4QQGA 3RUXA 3NGPA 1KK7A 4C5GA 1WIEA 4QVDA 2O2OA 4EMKC 2RHIA 3LH0A 4NS5A 3UATA 3CQTA 3PT9A 3RR6A 1N8RC 1NEBA 3L2ZA 2JJ9A 1TXQA 4FSXA 3GIBA 3CXCP 1H3ZA 3LH5A 1OZ3A 4DEYA 1VQ9A 2YUQA 3RMSA 4JS4A 1C6VX 1O9SA 4M7DB 5DY9A 3O8VA 2ECZA 2EYZA 3NTIA 5GAMh 2YT6A 4PJOG 3I55A 1X69A 3E1SA 2NUZA 2QEXT 2RI3A 2QA4A 4IUQA 3OSSC 5GAN5 1SHFA 2R58A 2CZ0B 4LNPA 2OTLT 2COZA 1UJYA 3EG1A 1AWWA 1D0YA 3IQLA 3HHTB 2MF2A 3QXEB 1ZLMA 3OA6A 4C8QG 4DA4A 2Z0WA 1KQ2A 1UB4A 4R0KA 4HVWA 5GAMf 3OSVA 2YHTA 3OYKA 1XNIA 3BDUA 1TWBA 3S3MA 1K76A 2LNVA 3I5RA 4DBQA 2D1XA 4J5YA 3FDRA 1Y96B 2AK5A 5A2QE 3CMEA 3GF5A 1ZQ1A 2QI2A 4EDUA 4ZGDB 2BZXA 1UUEA 3A8OB 3RERA 4C92G 2BTTA 3QUIA 2KAFA 3ME9A 1KJWA 5FU7C 5A0GA 1QKXA 1GXIE 5CKDA 2RA2A 2ESWA 2FZGB 3CMAQ 1PCXA 2DL3A 2JMCA 1KD1C 2KRNA 2SRCA 1UE9A 3S6WA 5HK3A 4KH0B 1JRIA 3VUZA 2DJZA 2HMAA 3PGGA 4N0AA 1Q82R 2M51A 1RI0A 1T0HA 5KYUB 4OGEA 3A8LB 4LN2A 2LJ3A 5FROA 1RLQC 2A0FB 5M9OA 2NWMA 2KT1A 1WZOA 1YJNA 1TU0B 4OMOA 2GFAA 1PKTA 2L3SA 3BW1A 3MEWA 4DBRA 2HEQA 1BI1A 2M0OA 3X20B 2DRKA 3JCMQ 1MMNA 1H8KA 1EIFA 4IUTA 4E7IA 4OB2B 1M4ZA 4M78E 3JB9J 3GNFB 4WTOB 3EG9A 2DZCA 2VASA 1YJWT 1K0SA 4IUVA 1PD1A 4JS5A 5CKFA 4M7AB 1YHQT 2JZ2A 5KYWB 2V8JA 2F2VA 3OB9A 3OYCA 4L59A 4B6MA 1VQ4A 5GAOl 2OAUA 3G4SA 3TSZA 2QGFB 1UHCA 3M0TA 3MHXA 1VQNQ 2EFIA 1Q81R 2P0KA 3RNJA 2A37A 1OOTA 4A4EA 5DM7R 2P84A 3M0QA 1X01A 3CCVA 1QW1A 2DVJA 3G71T 3J7AF 2J7IA 2V8KA 2K3BA 3FIFA 1RUWA 3CCRA 3HP9A 1K9MC 4PJOC 1U3OA 1N5ZA 5GJWB 4LE9A 1R77A 1VQPT 1RLPC 3E19A 1D1CA 1GRIA 2D8JA 1YFNA 4KRTA 1ZUUA 2CSIA 2LVMA 4JLGA 1I5LA 4Y28E 3LW5E 1H641 2NUPB 5HCKA 2OTJQ 4LDWA 3M56A 2X4XA 4J9EA 2E6ZA 4A63B 2EKHA 2DFUA 2RJCA 2DIQA 4JZ3A 4BB7A 3MCAB 2D6FA 1SEMA 1D1AA 4D8DA 2MPXC 1PNJA 1PSFA 3QWYA 3CC4A 1WHHA 1KSWA 4N4IA 1RAEB 3V8KA 4EMKA 5GANj 3M0UA 2WACA 1VQ5Q 1VQ7T 2DO3A 1B3QA 4PJOF 4DBFA 2V1RA 2KI7A 1IHVA 3TSWA 4LXCA 5CO7A 3EFOA 5FLXE 1M3CA 1LPLA 5IN1A 1UDLA 1X75C 2CZ7B 2WSCE 4F14A 4GBQA 2L0AA 5GMKm 4C8QF 4ESRA 2MYSA 3CXCA 4K11A 3JCMJ 3I9QA 1K8AC 2MAMA 3BY7A 1CSKA 5GAN6 4R55A 2DRMA 1V76A 1OPLA 1X6GA 1B34A 1Z9QA 3J81E 4M7DG 2E3HA 4FW1A 2ZPFB 1AOJA 1PHTA 2NYSA 1IB8A 1TUCA 2PZ1A 2DD5A 4C92F 4KGVB 4J7IA 4CRIA 1I1JA 5KYXB 3JCMe 1KHIA 4RKUE 3CPWP 1D09B 1VYTA 5LJ3g 3PE0A 5AT1B 3CCJT 3JRZA 4HVUA 2QQRA 4IUPA 1E6GA 4IUUA 5LJ5e 3JB9I 5D6YA 2DE0X 1X2QA 1K0XA 1RI9A 5GANd 4D8KA 2VGNA 1UHFA 1T0JA 4J9DA 3PTAA 1ABOA 1Q7YU 1VQMQ 4PJOD 2RM4A 1SPKA 4JZ4A 2CUBA 4M77B 4QQ6A 5KYYB 1XTDA 1H3HA 3VS6A 4JJDA 3I35A 3CCMQ 3CCQQ 1BI3A 3EGXB 2RHXA 4M75C 3MKDA 3JV3A 3I56T 1TS9A 1WHJA 3EG0A 3HSBA 1WHGA 1MMAA 2OAWA 1W6XA 4ZGJB 1ZSZB 3TREA 4BUGA 1WHLA 2KMTA 4XAXB 2K7AA 2BUDA 3FRNA 1RL2A 2HL3A 2RHZA 4MMLA 2KEAA 2YRDA 2RJFA 1I0CA 2DL5A 1R8OB 3A1PA 4J8OA 5EG2A 3MJXA 3QWXX 4JJNK 1E6HA 2CZ1B 2K2MA 2L2PA 2YLBA 2A08A 2DERA 2DD4A 2C0TA 3SWNC 2JXBA 1D1BA 1HYOA 2P0QA 2QQAA 1AHJB 1WX6A 4XTYA 1G8XA 4KBMB 2JUFA 4HVVA 4OB3B 3LGFA 1IRXA 2P0PA 3GBQA 2DYBA 4OMQA 5KCHA 1U5SA 4JLIA 2VYTA 1UJ0A 1QVGS 2LRQA 2YWWA 2JS0A 5CKBA 3QJYA 1NBEB 1Q86R 4BE2A 4M7AG 2ROLA 5GMKe 3QDRB 3V7SA 3JB9G 3CPFA 4A53A 1VQNA 1M1KR 4B9XA 2XIDA 3F70A 2ZAEA 1ZA2B 1VQ9T 2RD1A 4PFZA 2A7YA 4PJOA 2FRYA 2CP2A 4ELYC 3QZ9B 5FU6C 2JTEA 3PVQA 2M0YA 4M7DC 5CVIA 3I55T 5FWBA 4AG1C 3GLXA 4PNOA 2DXTA 3EGDA 5LJ3e 2QA4T 2GBQA 3CBMA 1WGSA 1GBRA 1SKUB 2DAQA 3HRUA 2CYZB 1ZBXA 4ORZA 2DNUA 2K6DA 5I2MA 2OTJA 3DB4A 1N9RA 4JJBA 2I2LA 1KC8C 1VQKQ 1FMWA 4AFUC 4BY6B 3O5ZA 3NTKA 3REAB 1RAAB 4M75D 3EFSA 4X34A 3M0PA 1M90R 1VQ5A 3OS5A 2KXDA 2XICA 3CMET 1ZSGA 1CKAA 1QLYA 1VQLQ 4OGCA 1YIJQ 3OYHA 4M7DF 2PUOB 2RK2A 2BZYA 4DOVA 1YI2T 2RHYA 1BYMA 5GANh 2VVKA 1MMDA 4JPBW 3TQ7P 4FW2A 2ROTA 5A0DA 2K5LA 2CZ6B 4N4GA 2OTLQ 1AEYA 1VQ8Q 1RACB 1TTHB 2EKOA 4E47A 2RJEA 4Y91A 1PWTA 3RDVA 1VQ6Q 4JUVA 4A54A 3QZ5B 2X4WA 5GANf 2K3YA 3MP6A 1WXTA 4C5EA 2ZPIB 4BDYA 3WVEB 4F04B 1JQQA 1QCNA 1VUBA 1HXDA 3QIIA 3R6OA 3M9QA 1SHGA 2BE9B 2L3QA 3QHSA 4FYWB 3X26B 4JRIA 2F5TX 2YXYA 3META 4BDZA 1YN8A 2O4XB 5IXBA 3Q1JA 1OI1A 1S72Q 1KQSS 3X28B 1YJNT 2QAZA 2DPPB 2FZCB 3CPWA 4RG8A 5C0MA 1Y57A 4C0DC 4F7UB 4OF1A 5GAMe 4ZGEB 1SF9A 2PVGB 3VS3A 4RMOA 2SEMA 2HSPA 1M90C 3GP8A 1JJ2S 2CKKA 1UECA 4XU3A 1VQMA 4M7DD 5GAOn 2EJ9A 3G1JA 1OPKA 3UT1A 1OU8A 2E5QA 4M75A 4WCIA 1D3BA 1R0CB 2OJ2A 1W4SA 4C0GA 3CCMA 4AFZC 5CQXA 1WA7A 4M7AC 4ATOA 3G4ST 3BDLA 4M77G 1LVKA 1VQOA 5J26A 3M4YA 3WVDB 4AG2C 5C6SA 3HPWA 3UWNA 4XTWA 3VS5A 2KT8A 4MDXA 1SG5A 2DLPA 2L89A 3CCVT 1K9MU 1FMKA 2LJ1A 3CCRT 1X2KA 1LJOA 1NLPC 4RCCA 2RPNA 2VC8A 2RHUA 1IGQA 1MHNA 3RIRA 1YJWQ
chains in the Genus database with same CATH topology
3M59A 1VQPT 2PVDB 2JN0A 3OMGA 3E19A 2MWOA 4UC4A 4D6WA 3OYJA 1VQPA 1IZ6A 1Q86U 4OVAA 2MMPA 3SWNA 4M75B 2VXFA 2LVMA 4JLGA 1D3BB 2E6NA 4Y28E 5CQYA 4TVRA 2HNIA 1I5LA 3LW5E 4MZTA 4C8QB 1H641 2DIGA 4M7AF 2LTOA 4LDWA 3M56A 4ME7A 2X4XA 1M1KU 1M1GA 4O6JA 5J39A 3QG1A 4KULA 1Y7XA 4XTXA 1Q86C 3JB9F 1KD1U 2E6ZA 3V8JA 4LDXA 4KUDK 3INZA 1HK9A 3CC7T 2VUBA 2RJCA 2DIQA 3MP1A 4BB7A 2R57A 3NFCA 3MCAB 5DLOA 2D6FA 3CCET 3CC7A 2EQUA 2RO0A 3CC4T 4M78A 5LJ3f 1MGQA 1PSFA 4C0ZA 4ELZC 1UGPB 1M1KC 4LDUA 3CCEA 1PSEA 1M1FA 3CC4A 3L2UA 1Y07A 4N4IA 3FJPA 3V8KA 2PU9B 2DVEA 4EMKA 1I4K1 5GANj 1QP2A 4FM4B 1M8VA 2WACA 3L2RA 1VQ7T 2DO3A 2FL7A 3SDZA 4HA8A 3OS0A 1DJ7B 3GNGA 4E7HA 4M78G 4BI8B 2LC4A 1VQ7A 4PJOF 2YLCA 3T9NA 3TCJA 1BKBA 4C92B 2A3LA 3M5AA 3ZBDA 3H6ZA 4OP0A 1WJQA 3HRSA 5DLQE 5GAN8 1BIAA 3E9FA 2D9TA 2VV5A 4MZPA 2RB6A 1FXXA 4II1A 3TEEA 1V29B 5CO7A 2XDDA 4E7LA 5FLXE 3EAEA 4M75F 5IN1A 1KHCA 2ZPHB 1X75C 2DEQA 2CZ7B 1QVGA 1NE8A 2WSCE 5KCOA 5GMKm 4C8QF 1KQSA 5FRMA 2XI9A 3UPUA 3CXCA 3MP8A 4XU2A 3LWHA 3VV0A 4FIBA 5GAOm 3JCMJ 4M7DA 1K8AC 2MAMA 3BY7A 4N4HA 2XKOC 3DKMA 4MMKA 2KSSA 2QDYB 3VKIA 2EJFA 2ZPGB 3M58A 1M90U 4RG2A 4EMHA 5GAN6 3FEOA 4R55A 3JCMP 2K5FA 2IG0A 3RKYA 2FYKA 2X4YA 3OQ5A 4HT8A 5I21A 1B34A 3PMIA 4OB1B 3J81E 3OS1A 4M7DG 4EMKB 3M57A 3EFRA 4GY5A 5CCAA 3CCUT 3LX7A 4E7KA 2DTHA 2ZPFB 3C4SA 3QO3A 3PFSA 3CCUA 2EQJA 3JAME 3JCMg 4FL6A 2KDSA 3CPWS 5KE3A 1BI2A 5KH6A 2E12A 2KK4A 3MO8A 4M77A 1G3WA 3P8BB 3OY9A 1N27A 1NPRA 2DD5A 4XK8E 5CAIA 3L2QA 4QQDA 1IREB 4C92F 1VQKT 2JTFA 4J7IA 4CRIA 4FT2A 1VQKA 3C94A 3OYYA 3JCMd 1OZ2A 2K4YA 3A5ZB 4N0AC 5IT9E 3CCQT 5HK0A 3JCMe 1KG1A 2NLUA 1KHIA 4RKUE 4XTUA 4BACA 4JDSA 4M7AD 3QKJA 5LJ5g 3CCQA 4FT4A 1VQ4T 4EMGA 5FU6B 2HD0A 4F7UE 4CI0C 3JB9D 5LJ3g 4ZTFA 4C5IA 1ZHIA 4PKCC 3CCJT 3JRZA 5GMKh 5GAOr 3KXTA 3V8LA 4V2SA 3OW2A 3URGA 2XU8A 4XQ3A 2QQRA 4IUPA 5LJ5d 4R56A 3CCJA 3OYIA 1VQLT 4IUUA 3ZFJA 5LJ5e 3JB9I 1YIJT 5D6YA 2WSFE 2ZGWA 3S3OA 1VQLA 1YIJA 2EQMA 5GANd 2VGNA 1Q82U 5GANe 1B34B 3M53A 2XDPA 3PTAA 2DZ9A 4KT0E 3MEAA 1Q7YU 4MZMA 2EQKA 4PJOD 2RM4A 2H3JA 2JTMA 1VQ8T 4M7AE 3X25B 4XU0A 5AYFA 1Q82C 3HFNA 4Q5WA 4JRPA 4HKEA 3P8DA 3RKWA 3RMQA 3SFMA 4M77B 4QQ6A 1KQ1A 5CKHA 5LJ3h 1QVFA 2P4TA 2FB7A 1VQ6T 1XTDA 4IURA 2LQ8A 3LWIA 3L2VA 1Q7YC 2AHJB 1XOVA 3RESA 4NL3A 1VQ6A 1BI3A 4PL6A 3OYFA 2XDBA 2M16A 5D6XA 2RHXA 3FB9A 3LGLA 4M75C 4C0FA 3GPLA 2E64A 4FU6A 4J6WA 2DTIA 4O5VA 3I56T 1OYXA 4C8QC 3I56A 2LT1A 5IAYA 3HSBA 3J80E 4EPCA 1M9SA 2HQEA 3JB9H 4ZGJB 3TREA 5CIUA 5LJ5j 4YTLA 1BI0A 4BUGA 2B8AA 4L5GA 2KMTA 3DLLA 2EYQA 4PJOE 1G5VA 1YI2A 4QVCA 2E1HA 2GCXA 3OYMA 4XAXB 2E41A 4C5HA 2O4XA 2BUDA 4RCBA 1YCYA 3FRNA 1YITT 1RL2A 2DXBA 2EAYA 2GQVA 3A8GB 2RHZA 3QSUA 2K57A 1WQWA 1YITA 4MMLA 4HCBA 2RJFA 3H8ZA 1S72T 2C06A 1Y71A 2BKDN 1R8OB 1WPYA 1S72A 4J8OA 5EG2A 2O01E 4JJNK 1U8RA 3SB2A 3VJPA 2CZ1B 4F7UA 2YLBA 2QQBA 4C92C 1I81A 3V7CA 2F69A 2WSEE 1G3SA 2XK0A 2K5IA 4M77F 5L8RE 1UGQB 1K8AU 2M9UA 1Q81U 3SWNB 1W2BA 2FHDA 2DD4A 2JNGA 2ZCFB 3CEYA 4BI4A 4LD6A 2EWNA 3PMTA 1G3TA 3SWNC 4NOYA 3CCST 1YJ9T 2VXEA 1NJIC 3V7RA 3JSCA 2P0QA 5LL6S 4ZN3A 5KE2A 3CCSA 2QQAA 1JBMA 3KBGA 4F7UG 1YJ9A 1AHJB 1K73C 3CBPA 3HFOA 3LLRA 3A8HB 4XTYA 1Q81C 3QJ6A 4KBMB 2JUFA 1WQ7A 2K3XA 4OB3B 1SSFA 2PVOB 3LGFA 1TH7A 3JCMW 2P0PA 3OYDA 2YRVA 1XQHA 3PNWC 4NL2A 5KCHA 3PIOA 1I8FA 4M78B 2QXFA 5GAN3 1LNXA 4JLIA 4M7AA 2VYTA 5J3BA 4M78C 3MEUA 4QQGA 3RUXA 1QVGS 2LRQA 4C5GA 3L2WA 1N9SA 4QVDA 1VIFA 3L42A 4EMKC 3FC3A 3CXCS 2RHIA 3LH0A 1N6AA 5CKBA 4JRQA 3QJYA 1JJ2A 4HCCA 4NS5A 4C0DB 4BE2A 2XD0A 4M7AG 3PT9A 3X24B 1VQNT 5GMKe 4LD9K 4BD3A 3QDRB 3V7SA 3ASKA 3JB9G 3CPFA 4A53A 1N8RC 1VQNA 2QQ9A 2KY9A 3L2ZA 1G3YA 4FSXA 4B9XA 2E70A 2XIDA 3F70A 3GIBA 3JCMb 2KVQG 1VQ9T 1H3ZA 1OZ3A 2RD1A 3M54A 2A7YA 3WXMB 4PJOA 2GFUA 4B9WA 1VQ9A 2DXUA 3RMSA 4ELYC 4JS4A 3QZ9B 4A4HA 2CS7A 3JCMc 1O9SA 4J6YA 2M1HA 1O75A 2LT4A 5FU6C 5HY6A 4BI3A 4M7DB 3VUBA 1Y96A 3QYGB 5DY9A 3O8VA 4M7DC 5CVIA 3I55T 1NPPA 3GLXA 3NTIA 5GAMh 4XU1A 5LJ3d 4PNOA 2DXTA 4PJOG 3I55A 5LJ3e 3G6ET 3JCMX 2R5MA 3CC2T 4M78F 1KC8U 2QA4T 3CBMA 3G6EA 1WGSA 2DKGA 3CC2A 1YHQA 2RH2A 2DXCA 3E1SA 2QEXT 2DAQA 2RI3A 2QA4A 3HRUA 2CYZB 4IUQA 2R5AA 4WF2A 1ZBXA 3OSSC 5GAN5 2OTJT 2R58A 3MEVA 2QEXA 2CZ0B 2OTLT 5I2MA 2OTJA 1YBYA 2QTXA 3DB4A 3OYNA 1N9RA 4M75G 4Z02A 3OW2S 1UGRB 4J6XA 2I2LA 3C95A 4KUIA 1KC8C 2OTLA 5CKEA 3OA6A 3HHTB 2MF2A 3QXEB 5D6WA 4DA4A 4C8QG 1KQ2A 5GMKj 1UB4A 1M5Q1 4M77D 4X9CA 4BY6B 3CMAT 5GAMf 1U1TA 4M77C 4LDYA 3OSVA 3NTKA 4BY6C 2YHTA 3OYKA 4PLLA 3CMAA 4M75D 1QP3A 1XNIA 1WJSA 3BDUA 3GOXA 2Y90A 3S3MA 4A4FA 3UDCA 4P5NA 3OS2A 2Y4XA 4C8QD 2LNVA 3EFSA 1VQ5T 2MWPA 4X34A 2HAXA 4BE0A 1VQ5A 2JVVA 3OS5A 2RI5A 2PUKB 2ZZDA 3OYEA 2LX9A 2XICA 3DB3A 3CMET 1BIBA 2JOYA 4J5YA 3FDRA 4OGCA 1Y96B 3OYHA 1QVFS 4M7DF 2CGHA 2PUOB 2RK2A 4DOVA 5A2QE 3CMEA 1YI2T 2RHYA 3HL8A 3NTHA 3GF5A 5FRNA 1BYMA 1ZQ1A 3S3NA 3JCMf 5HKCA 1FX7A 1P92A 2QI2A 4EDUA 5GANh 4ZGDB 5LJ3j 4L6V5 4PLIA 3A8OB 3RERA 5FU7B 2KQWA 3QUIA 4C92G 2KAFA 3ME9A 3OBWA 4M77E 5A0DA 1UEBA 2FVUA 2K5LA 2CZ6B 5FU7C 2LDMA 2XG8D 2EJGA 1U1SA 4N4GA 2RK1A 5A0GA 4M75E 4HT9A 2EKOA 1GXIE 3JCMV 2QQSA 2RJEA 2L8DA 4Y91A 4E47A 3LYIA 1X6OA 4HCZA 5LJ5f 2MI6A 4OMFB 3SD4A 4C8QE 4C92D 5CKDA 2RA2A 3N5BB 3QYHB 1NJIU 5GAN4 5A0LA 4JUVA 4A54A 2PQWA 3QZ5B 2X4WA 5GANf 1K73U 1KD1C 4DQ2A 2K3YA 3MP6A 4ZTJA 5CR2A 3S6WA 4GLKA 4C5EA 2ZPIB 3HRTA 5HK3A 2ZPBB 4BDYA 1JRIA 2EIFA 3WVEB 3M4GA 4LDVA 3VUZA 5GAN7 2DJZA 3E9GA 1VUBA 1HXDA 3A8MB 3M55A 4ZN1A 2E10A 3PGGA 3PIPA 2HBPA 3QIIA 2DK3A 3R6OA 2G3RA 4N0AA 3M9QA 2F5KA 2LCLA 3QHSA 1RI0A 3X26B 3G7ZA 4JRIA 4XTZA 2ZPEB 4A4KA 4M78D 2F5TX 1W2BS 3META 3OYGA 4BDZA 4C92E 4OGEA 4E7JA 3A8LB 5I2SA 1LOJA 2O4XB 5FROA 5M9OA 3Q1JA 1OI1A 1KQSS 4MDWA 1N8RU 2IVWA 3X28B 1YJNT 3QBYA 2GF7A 3OBYA 1WNLA 4QVZA 5GAMg 2DPPB 1YJNA 3CPWA 4VUBA 2GFAA 1JB0E 4RG8A 5C0MA 2BIVA 1NZ9A 3BW1A 3MEWA 2VGMA 4C0DC 2V8IA 2D0QB 1BI1A 2M0OA 4F7UB 2L3RA 4OF1A 4J83A 3X20B 3JCMQ 3L1AA 5GAMd 4QW2A 3C12A 2RI2A 1EIFA 4IUTA 5GAMe 4ZGEB 2K2VA 5CK9A 2RJDA 2PVGB 4RMOA 4OB2B 2LCCA 4E7IA 1M90C 3RKXA 1M4ZA 3GP8A 4M78E 1JJ2S 2CKKA 3JB9J 3GNFB 4OB0B 1VQMT 4JRKA 3AHUA 2DZCA 5GAOq 3KUFA 1YJWT 4XU3A 1VQMA 4M7DD 4IUVA 5GAOn 2Y4YA 4A4GA 1YJWA 2EJ9A 3TU4K 1FWZA 3UT1A 4JS5A 2E5QA 4M75A 4BE1A 3P8HA 3OMCA 5CKFA 1D3BA 3VYHB 3CCMT 4M7AB 5GAOp 1YHQT 4C8QA 1W4SA 2JZ2A 4DOWA 3OYBA 3FLGA 3ZEHA 4C0GA 5GMKi 3CCMA 2E65A 2V8JA 5CQXA 3VYGA 5GMKl 1VQOT 4M7AC 3VU3C 3OB9A 3OYCA 3G4ST 3BDLA 4L59A 4M77G 3CCLT 4ATOA 1VQOA 2XHCA 5J26A 1VQ4A 5GAOl 2OAUA 3M4YA 2DTOA 3G4SA 3CCLA 3WVDB 5C6SA 3HPWA 3BFMA 5GANg 3UWNA 4XTWA 3OYAA 3HKSA 3MHXA 2EFIA 2P0KA 4MDXA 4J7FA 4A4EA 5DM7R 3OYLA 3JCMh 4IKFA 2L89A 5GAN2 2X35A 1WJRA 3CCVT 1K9MU 3CD6T 1VIEA 4F7UF 4XTVA 1X01A 4X9DA 2HQXA 3CBOA 1QW1A 5GAMj 3CCVA 2L5QA 3G71T 2V8KA 3CD6A 3J7AF 4M7DE 3ER0A 3FIFA 3DLMA 3CCRT 1VQ8A 3G71A 1LJOA 3CCRA 4PJOB 3HP9A 4RCCA 2VC8A 2RHUA 1K9MC 1MHNA 3QPHA 4C92A 1QVPA 2X4JA 3RIRA 5LJ5h 4PJOC 1UGSB 2LQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ3 g;  1N9S A;  5GAN f;  4QVD A;  2JN0 A;  4DQ2 A;  5GMK h;  5GAO r;  3V8L A;  4EMK C;  4V2S A;  4XQ3 A;  5LJ5 d;  3SWN A;  4M75 B;  2VXF A;  5LJ5 e;  1JRI A;  3JB9 I;  1D3B B;  3M4G A;  1I5L A;  4M7A G;  2HNI A;  2ZGW A;  5GAN 7;  2DJZ A;  4C8Q B;  1H64 1;  4M7A F;  1HXD A;  5GMK e;  2E10 A;  5GAN d;  3PGG A;  3V7S A;  3JB9 G;  4A53 A;  5GAN e;  5GAN 4;  1B34 B;  4XTX A;  3L2Z A;  3JB9 F;  4N0A A;  3V8J A;  3INZ A;  1HK9 A;  3GIB A;  2DZ9 A;  3QHS A;  3JCM b;  4JRI A;  4XTZ A;  4PJO D;  2RD1 A;  2RM4 A;  4M78 D;  4PJO A;  4M78 A;  5LJ3 f;  1MGQ A;  4M7A E;  4F7U E;  4C92 E;  4XU0 A;  2DXU A;  3HFN A;  1LOJ A;  3RKW A;  3JCM c;  4M77 B;  5LJ3 h;  1KQ1 A;  4J6Y A;  3FJP A;  2FB7 A;  3V8K A;  4EMK A;  2DVE A;  4M7D B;  1I4K 1;  1Y96 A;  5DY9 A;  5GAN j;  3RES A;  4NL3 A;  4M7D C;  1WNL A;  5GAM g;  1M8V A;  5GAM h;  4HA8 A;  4XU1 A;  4PNO A;  5LJ3 d;  3FB9 A;  2DXT A;  4M75 C;  4PJO G;  4M78 G;  2E64 A;  3BW1 A;  5LJ3 e;  3JCM X;  4J6W A;  2DTI A;  2YLC A;  4M78 F;  4PJO F;  4C92 B;  4F7U B;  4C8Q C;  2DKG A;  4OP0 A;  3JCM Q;  3L1A A;  5GAM d;  3HSB A;  5GAN 8;  1BIA A;  5GAM e;  4WF2 A;  5GAN 5;  5GAO q;  3JB9 H;  2RB6 A;  2QTX A;  1N9R A;  5LJ5 j;  4M75 G;  3RKX A;  4PJO E;  4J6X A;  2I2L A;  4M78 E;  4M75 F;  2DEQ A;  4QVC A;  2E1H A;  3JB9 J;  1KQ2 A;  4C8Q G;  5GMK j;  4JRK A;  2E41 A;  5GMK m;  4M77 D;  1M5Q 1;  2DZC A;  4RCB A;  4X9C A;  1YCY A;  4C8Q F;  5GAM f;  4XU3 A;  1U1T A;  2EAY A;  4M77 C;  5GAO n;  4M7D D;  4XU2 A;  3QSU A;  3JCM J;  2K57 A;  5GAO m;  1WQW A;  4M7D A;  2YHT A;  4MML A;  2EJ9 A;  3BY7 A;  4M75 D;  3BDU A;  4M75 A;  2Y90 A;  4MMK A;  1D3B A;  2EJF A;  1WPY A;  4C8Q D;  4M7A B;  5GAO p;  4EMH A;  3EFS A;  4C8Q A;  5GAN 6;  3JCM P;  5GMK i;  2E65 A;  2FYK A;  3RKY A;  3SB2 A;  5GMK l;  4M7A C;  4F7U A;  3VU3 C;  2YLB A;  4C92 C;  4HT8 A;  5I21 A;  4M77 G;  1B34 A;  1I81 A;  3V7C A;  4M7D G;  1BIB A;  4M77 F;  4EMK B;  5GAO l;  4J5Y A;  3EFR A;  2DTO A;  1Y96 B;  4M7D F;  2CGH A;  2DTH A;  3SWN B;  3QO3 A;  3BFM A;  5GAN g;  4XTW A;  3JCM f;  2EWN A;  5GAN h;  3SWN C;  4NOY A;  5LJ3 j;  3JCM g;  2VXE A;  3V7R A;  3JCM h;  5GAN 2;  4M77 A;  1JBM A;  4C92 G;  4F7U G;  3QUI A;  5CAI A;  3RER A;  4M77 E;  4C92 F;  4F7U F;  3HFO A;  1X01 A;  4X9D A;  4XTV A;  4XTY A;  4M7D E;  5GAM j;  1WQ7 A;  1U1S A;  2EJG A;  3JCM W;  3FIF A;  1TH7 A;  4M75 E;  3JCM d;  4N0A C;  4HT9 A;  4NL2 A;  3JCM V;  4Y91 A;  1LJO A;  3JCM e;  4A54 A;  5LJ5 f;  4XTU A;  1I8F A;  4M78 B;  4M7A D;  4PJO B;  4RCC A;  5GAN 3;  4C8Q E;  1LNX A;  2VC8 A;  4JLI A;  2RA2 A;  4C92 D;  5LJ5 g;  3AHU A;  4C92 A;  4M7A A;  3RIR A;  4EMG A;  4PJO C;  5LJ5 h;  4M78 C;  3RUX A;  4JUV A;  3JB9 D; 
#chains in the Genus database with same CATH topology
 1QCF A;  1NG2 A;  4KGX B;  2PVD B;  2JN0 A;  2MWO A;  1T3S A;  1IZ6 A;  4ANJ A;  1AWO A;  3G6E Q;  3SWN A;  3CC2 Q;  1YHQ Q;  2VXF A;  2G6F X;  2J6O A;  2KR3 A;  2HNI A;  4MZT A;  2DIG A;  4M7A F;  1C0M A;  2LTO A;  1M1G A;  4O6J A;  3JB9 F;  2ENM A;  2VUB A;  3MP1 A;  3NFC A;  1ABQ A;  3CC4 T;  4ELZ C;  2CRE A;  1BCM A;  1M1F A;  3L2U A;  1JXO A;  3FJP A;  2PU9 B;  1I4K 1;  1QP2 A;  4FM4 B;  1NM7 A;  2HKQ B;  1M8V A;  3L2R A;  4GLM A;  4E7H A;  1PG5 B;  1FMV A;  1M2O A;  1W70 A;  2PTK A;  4BI8 B;  3TCJ A;  2GGR A;  3M5A A;  4RTZ A;  3VS4 A;  2HBW A;  5GAN 8;  2RB6 A;  2HQH A;  2XDD A;  3EAE A;  3NHN A;  4X1V A;  2A36 A;  2DEQ A;  1KQS A;  2X51 A;  2RQW A;  4XU2 A;  4M7D A;  4FIB A;  5GAO m;  4N4H A;  3QDF A;  3VKI A;  4RG2 A;  1GCQ C;  2EVR A;  4EMH A;  3FEO A;  3JCM P;  1AT1 B;  2K5F A;  4CC4 B;  2IG0 A;  4HT8 A;  4F16 A;  5I21 A;  4OB1 B;  3OS1 A;  4IIO A;  4EMK B;  5CCA A;  1BU1 A;  2DTH A;  2DM1 A;  3JCM g;  4FL6 A;  3VS1 A;  2EGE A;  5KH6 A;  2E12 A;  5CAI A;  2ED1 A;  4QQD A;  1IRE B;  2JTF A;  1R0B G;  2COW A;  4FT2 A;  1VQK A;  4IIM A;  3C94 A;  3JCM d;  5IT9 E;  4XTU A;  3EFO B;  3H9N A;  2FZK B;  4JDS A;  3QKJ A;  4M7A D;  5LJ5 g;  4FT4 A;  4CI0 C;  2HKN A;  3JB9 D;  2COY A;  3V8L A;  1JXM A;  2XU8 A;  5LJ5 d;  4R56 A;  4J9I A;  3OYI A;  2MK5 A;  2HDA A;  3S3O A;  1VQL A;  1YIJ A;  2O88 A;  1OX8 A;  2EQM A;  2CH4 A;  1B34 B;  3M53 A;  4AMC A;  2KRM A;  4KT0 E;  3MEA A;  2EQK A;  1JEG A;  2H3J A;  4EIK A;  2EGC A;  4XU0 A;  1Q82 C;  1QWE A;  1AD5 A;  1VQ8 A;  2LNH B;  2HSE B;  3L2V A;  4NL3 A;  1VQ6 A;  2XDB A;  1WFW A;  2M16 A;  4C0F A;  3LGL A;  2E64 A;  2LP5 A;  3CCL Q;  4C8Q C;  1RAG B;  3J80 E;  4PJO E;  3CD6 Q;  4QVC A;  2E1H A;  4C5H A;  2CDT A;  3A8G B;  2EAY A;  2QK0 A;  2K57 A;  1WQW A;  1YWO A;  2BKD N;  1S72 A;  2QAS A;  1EFN A;  1B07 A;  1U8R A;  1EZZ B;  3H41 A;  4C92 C;  2QQB A;  1G3S A;  4M77 F;  1UGQ B;  8AT1 B;  1OX9 A;  2MOX A;  4LD6 A;  2EWN A;  1G3T A;  4NOY A;  1IGU A;  3V7R A;  2M02 A;  5KE2 A;  4F7U G;  3CC7 Q;  1X27 A;  3HFO A;  3A8H B;  1Q81 C;  1UFF A;  4KH1 B;  1WQ7 A;  3VS0 A;  3CCE Q;  1TH7 A;  3OYD A;  2YRV A;  1XQH A;  1YNZ A;  2EGA A;  4NL2 A;  2O9V A;  2QGG A;  4M78 B;  2QXF A;  1HD3 A;  4M7A A;  3L2W A;  1N9S A;  2KYM A;  2MIO A;  3FC3 A;  4JRQ A;  1N6A A;  1GBQ A;  4HCC A;  2EBP A;  2XD0 A;  3X24 B;  1VQN T;  1M3A A;  4LD9 K;  4BD3 A;  1QVG P;  2EQI A;  3ASK A;  4FYV B;  2J05 A;  1G3Y A;  2DL8 A;  2E70 A;  4J9G A;  4PK4 A;  2KVQ G;  2LMJ A;  3M54 A;  5ECA A;  1NYF A;  2JW4 A;  2FPE A;  2DXU A;  2CS7 A;  4J6Y A;  1O75 A;  2LT4 A;  3QYG B;  4RTU A;  4XU1 A;  5LJ3 d;  1PKS A;  2RF0 A;  3JCM X;  1KC8 U;  3G6E A;  4PJN A;  2DKG A;  3CCU Q;  3CC2 A;  1SSH A;  1HSQ A;  1YHQ A;  2OTJ T;  4WF2 A;  1V1C A;  1YBY A;  2E5K A;  4HXJ A;  3OW2 S;  3C95 A;  4AT1 B;  2JM8 A;  4M77 D;  4X9C A;  2D0N A;  1U1T A;  4LDY A;  2CP3 A;  2KRO A;  4BY6 C;  3CMA A;  4PLL A;  1WJS A;  3GOX A;  4C8Q D;  1VQ5 T;  2MWP A;  2HAX A;  1IHW A;  2PUK B;  2ABL A;  2LX9 A;  1BIB A;  2JOY A;  1QVF S;  1EX4 A;  3HL8 A;  3NTH A;  5FRN A;  3S3N A;  3JCM f;  5HKC A;  1NYG A;  3NPF A;  4L6V 5;  3EGD B;  4PLI A;  2ATC B;  2RK1 A;  4M75 E;  4HT9 A;  2RQT A;  3JCM V;  1GCQ A;  1T3L A;  2QQS A;  3OYE A;  1D0X A;  1X6O A;  4HCZ A;  5LJ5 f;  4C92 D;  3N5B B;  3QYH B;  1NJI U;  5KYN A;  2PQW A;  1QWF A;  1M2V A;  1K73 U;  4DQ2 A;  2FPD A;  3EH1 A;  4ZTJ A;  2FO0 A;  5CR2 A;  4GLK A;  3HRT A;  1BK2 A;  2ZPB B;  4LDV A;  1ZBJ A;  5GAN 7;  3UA7 A;  3A8M B;  4ZN1 A;  2E10 A;  3CME Q;  2HCK A;  2HBP A;  1YI2 Q;  4PFP A;  2LCL A;  2YUP A;  1YWP A;  4XTZ A;  4RTV A;  4A4K A;  1MUZ A;  1W2B S;  1Q7Y R;  1YIT Q;  2F2W A;  5I2S A;  1PC0 A;  2HZY A;  4Z8A A;  4MDW A;  2KXC A;  1N8R U;  2IVW A;  1X43 A;  3U23 A;  4QVZ A;  3OBY A;  1WNL A;  5GAM g;  1G83 A;  1OEB A;  4FCY A;  1JB0 E;  1NZ9 A;  1H92 A;  2V8I A;  1WXU A;  1ACM B;  2DIL A;  4J83 A;  3L1A A;  5GAM d;  4QW2 A;  2DX1 A;  1KQS P;  3C12 A;  2MCN A;  2K2V A;  5CK9 A;  3CCS Q;  2JMA A;  2RJD A;  1YJ9 Q;  2HL5 C;  2LCC A;  2RQV A;  1VQM T;  2YRC A;  3AHU A;  5GAO q;  3MPU B;  1K9A A;  2FPF A;  4A4G A;  3TU4 K;  1FWZ A;  1RAB B;  2CP5 A;  2DJQ A;  3P8H A;  2IIM A;  3VYH B;  3CCM T;  2JT4 A;  4C8Q A;  4DOW A;  4QT7 A;  3FLG A;  1JJ2 P;  1VQO T;  3VYG A;  2K79 A;  2XHC A;  2KE9 A;  2DTO A;  3CCL A;  4RTX A;  3BFM A;  1AVZ C;  4FYY B;  3OYA A;  1K73 R;  2ED0 A;  4J7F A;  4IKF A;  1WJR A;  5IHN A;  4F7U F;  4X9D A;  2HQX A;  4M7D E;  3CD6 A;  1CKB A;  4E7S A;  1JO8 A;  3SHW A;  1GFC A;  3QPH A;  4C92 A;  1QVP A;  2X4J A;  4LUE A;  1UGS B;  2LQK A;  2CH4 W;  1NEG A;  4D6W A;  1PRL C;  2JM9 A;  4OVA A;  4M75 B;  1D3B B;  5IH2 A;  5CQY A;  1OUL A;  4TVR A;  2QEX Q;  2XMF A;  2NUT A;  5J39 A;  3QG1 A;  4KUL A;  1Y7X A;  1Q86 C;  1KD1 U;  3R6N A;  1MNE A;  3V8J A;  2BZ8 A;  4KUD K;  4LDX A;  1HK9 A;  5DLO A;  2RNA A;  1RAH B;  3CC7 A;  2EQU A;  5FWC A;  7AT1 B;  1VA7 A;  1MGQ A;  5LJ3 f;  4C0Z A;  1AWX A;  1UGP B;  4LDU A;  3CCE A;  1M1K C;  1PSE A;  4Y92 A;  4OMM A;  2EPD A;  1Y07 A;  2AIR B;  2DVE A;  3CCR Q;  2RMO A;  2YDL A;  2VB6 A;  2B86 A;  2FL7 A;  3EG3 A;  3SDZ A;  2KNB B;  4HA8 A;  2RQU A;  4M78 G;  2JS2 A;  1K1Z A;  2LC4 A;  2OX7 A;  3T9N A;  2A3L A;  2KYB A;  2LZ6 B;  1WHK A;  4OP0 A;  5DLQ E;  3E9F A;  1ZUY A;  1FXX A;  4II1 A;  1V29 B;  4E7L A;  2BE7 D;  1QVG A;  1KHC A;  2ZPH B;  1ZX6 A;  2KBT A;  8ATC B;  2XKO C;  4MMK A;  1UG1 A;  1A0N B;  2DL7 A;  4JJC A;  3C0C A;  1Y0M A;  3RKY A;  2FYK A;  2X4Y A;  3PMI A;  3EFR A;  4GY5 A;  4PFO A;  3C4S A;  3CCU A;  4J9F A;  2EQJ A;  1KFZ A;  1IXD A;  1BI2 A;  2KK4 A;  3MO8 A;  3EG2 A;  3OY9 A;  3P8B B;  1N27 A;  1NPR A;  5GJV B;  3L2Q A;  1VQK T;  1OZ2 A;  2K4Y A;  3A5Z B;  2H8H A;  5HK0 A;  2NLU A;  1KD1 R;  4BAC A;  3CCQ A;  1VQ4 T;  5FU6 B;  2HD0 A;  5EC7 A;  3VS7 A;  1ZUK A;  1ZHI A;  2H3E B;  4V2S A;  4XQ3 A;  1VQL T;  2J6F A;  1YIJ T;  2WSF E;  1C1A A;  1M27 C;  2O31 A;  1Q82 U;  2VWF A;  3VRZ A;  1PRM C;  5IHI A;  2DZ9 A;  2X3W D;  2F1L A;  1VQ8 T;  4M7A E;  3D7S B;  4RUG A;  4Z89 A;  1B7T A;  3X25 B;  5AYF A;  3HFN A;  3EG9 B;  4JRP A;  3RMQ A;  3SFM A;  1KQ1 A;  2P4T A;  1VQ6 T;  4IUR A;  2I0N A;  3LWI A;  2D8H A;  5D6X A;  1OV3 A;  3FB9 A;  3GPL A;  2QYZ A;  4FU6 A;  4J6W A;  2DTI A;  1OYX A;  3M0R A;  4OML A;  2LT1 A;  5IAY A;  1QCO A;  2QG9 B;  2EW3 A;  3TVT A;  5LJ5 j;  1G5V A;  2B8A A;  4L5G A;  2LCS A;  1YI2 A;  3OYM A;  3G71 Q;  3KFV A;  1F1B B;  2O4X A;  4RCB A;  2DXB A;  2GQV A;  1YIT A;  4QKU A;  1TUD A;  3H8Z A;  1S72 T;  1WI7 A;  2L3P A;  1VQP Q;  2DA9 A;  2W0Z A;  9ATC B;  3SB2 A;  3VJP A;  4F7U A;  4DEX A;  1I81 A;  2XK0 A;  2K5I A;  3HTR A;  1W1F A;  1K8A U;  2RQR A;  2M9U A;  1Q81 U;  2JNG A;  2ZCF B;  1SRL A;  3PMT A;  1MND A;  3CCS A;  3KBG A;  2X9H A;  1YJ9 A;  2QTV A;  3CBP A;  1D0Z A;  1K9M R;  3I5S A;  3UF4 A;  1ARK A;  1QQJ A;  3JCM W;  2PVO B;  1Q95 G;  2AKK A;  1NLO C;  4E2F B;  1I8F A;  2A28 A;  5J3B A;  4M78 C;  3MEU A;  4F17 A;  3THK A;  1VQ7 Q;  1VIF A;  3L42 A;  5IHK A;  3CXC S;  1JJ2 A;  4C0D B;  1JU5 C;  2QQ9 A;  2KY9 A;  1MV0 B;  2LQN A;  3JCM b;  1Z9Z A;  3WXM B;  2RN8 A;  1X6B A;  2GFU A;  4B9W A;  5FW9 A;  4A4H A;  3JCM c;  1KIK A;  2GNC A;  2M1H A;  4BI3 A;  4HCK A;  1XJW B;  5HY6 A;  3VUB A;  1Y96 A;  1I5O B;  1NPP A;  2DYI A;  3G6E T;  1M3B A;  2R5M A;  3CC2 T;  4M78 F;  6AT1 B;  2FG0 A;  1WHM A;  1SRM A;  2RH2 A;  2DXC A;  1KG1 A;  2R5A A;  3ULR B;  3MEV A;  4KGZ B;  2QEX A;  2DEU A;  4CC2 A;  2QTX A;  3OYN A;  3VS2 A;  4M75 G;  4Z02 A;  4RTW A;  1UGR B;  4J6X A;  2OTL A;  4KUI A;  1K8A R;  1VYU A;  5CKE A;  5D6W A;  1BB9 A;  5GMK j;  2KRS A;  2CT3 A;  1M5Q 1;  1YP5 A;  3CMA T;  4M77 C;  1VYV A;  1QP3 A;  1TG0 A;  2Y90 A;  4A4F A;  3UDC A;  2LJ0 A;  3EGU A;  4P5N A;  3OS2 A;  2Y4X A;  4CC3 A;  3OW2 P;  2E3I A;  3CCJ Q;  4BE0 A;  2JVV A;  2RI5 A;  2ZZD A;  2CP6 A;  3DB3 A;  1PD0 A;  4AFS C;  2CGH A;  1FX7 A;  1P92 A;  1ZSZ C;  5KYU A;  5LJ3 j;  2DET A;  2EYX A;  5FU7 B;  2KQW A;  3OBW A;  4M77 E;  1UEB A;  2FVU A;  1IO6 A;  1TOV A;  2LDM A;  2XG8 D;  2EJG A;  1U1S A;  2AT1 B;  1QVF P;  2L8D A;  3LYI A;  2MI6 A;  4OMF B;  3SD4 A;  1AZE A;  4C8Q E;  5GAN 4;  5A0L A;  1GFD A;  1OQK A;  2V26 A;  3I56 Q;  2EIF A;  1WDX A;  3M4G A;  3E9G A;  3M55 A;  3PIP A;  4J9C A;  2DK3 A;  2G3R A;  4DBH A;  2F5K A;  2CT4 A;  3G7Z A;  2ZPE B;  4M78 D;  3OYG A;  4C92 E;  5KYW A;  4E7J A;  1LOJ A;  3H0H A;  4RTT A;  2LQW A;  1LCK A;  3EH2 A;  3QBY A;  1S1N A;  2GF7 A;  1WLP B;  4VUB A;  1W2B P;  2BIV A;  1AZG B;  2VGM A;  2D0Q B;  2L3R A;  3H0F A;  1M2V B;  2RI2 A;  1TUG B;  4RTY A;  2DBM A;  3RKX A;  4J9H A;  4OB0 B;  4JRK A;  3KUF A;  2Y4Y A;  1YJW A;  4BE1 A;  2AZS A;  3OMC A;  5I22 A;  5GAO p;  4PJM A;  3OYB A;  2NUP A;  5GMK i;  2E65 A;  2W10 A;  5GMK l;  4Z88 A;  3VU3 C;  3NMZ C;  3CCL T;  4ZNX A;  2E4H A;  5GAN g;  2YUN A;  3HKS A;  1M30 A;  3OYL A;  1I07 A;  3JCM h;  5GAN 2;  2X35 A;  3CD6 T;  1VIE A;  4XTV A;  3CBO A;  1VQ9 Q;  5GAM j;  2L5Q A;  3ER0 A;  3DLM A;  3G71 A;  4PJO B;  5LJ5 h;  3ZEH A;  3M59 A;  3I55 Q;  3OMG A;  3OYJ A;  4UC4 A;  1VQP A;  2LX7 A;  1Q86 U;  4CC7 A;  3H0I A;  2MMP A;  2J06 A;  2QA4 Q;  2E6N A;  2X3X D;  1VQO Q;  4C8Q B;  4ME7 A;  1M1K U;  4XTX A;  3INZ A;  3CC7 T;  1AWJ A;  2PNI A;  2R57 A;  3CCE T;  2RO0 A;  2CSQ A;  4M78 A;  1K4U S;  2AZV A;  3BE3 A;  2EYY A;  4PJL A;  2C0I A;  2C0O A;  1GCP A;  3OS0 A;  1DJ7 B;  2J6K A;  1MV3 A;  3GNG A;  2K9G A;  1VQ7 A;  2YLC A;  1BKB A;  1WXB A;  4C92 B;  3ZBD A;  3H6Z A;  1WJQ A;  3HRS A;  2DBK A;  1KC8 R;  1BIA A;  5KYX A;  2D9T A;  2VV5 A;  4MZP A;  3TEE A;  2CP0 A;  4M75 F;  1NE8 A;  5KCO A;  2NUT B;  5FRM A;  2F2X A;  2XI9 A;  3UPU A;  3MP8 A;  3LWH A;  3VV0 A;  3VRY A;  3DKM A;  2KSS A;  2QDY B;  1G2B A;  2EJF A;  4LUD A;  2ZPG B;  3M58 A;  1M90 U;  1BBZ A;  1HJD A;  1RAF B;  2FEI A;  2GQI A;  3OQ5 A;  2DL4 A;  3REB B;  2P4R A;  3M57 A;  3CCU T;  3LX7 A;  4E7K A;  3QO3 A;  3PFS A;  3JAM E;  2KDS A;  3CPW S;  5KE3 A;  4M77 A;  1G3W A;  5KYY A;  4XK8 E;  2AKL A;  4E6R A;  2CP7 A;  2GTJ A;  3OYY A;  2YSQ A;  3EGX A;  1J3T A;  4N0A C;  3CCQ T;  4FSS A;  3AT1 B;  2DMO A;  1FYN A;  4EMG A;  4F7U E;  1YJN Q;  1UGV A;  3FJ5 A;  4C5I A;  4ZTF A;  1NJI R;  1OU9 A;  1ZA1 B;  4PKC C;  5GMK h;  5GAO r;  3KXT A;  3OW2 A;  3URG A;  2QDL A;  1ZSZ A;  3CCJ A;  1WYX A;  3ZFJ A;  1QMC A;  2ZGW A;  5GAN e;  3A98 A;  2XDP A;  4MZM A;  1QKW A;  2FRW A;  2VKN A;  2JTM A;  3M0S A;  3RBB B;  4J9B A;  4Q5W A;  4HKE A;  3P8D A;  4FYX B;  3RKW A;  1UTI A;  4OMP A;  5CKH A;  5LJ3 h;  1QVF A;  2FB7 A;  5D7U A;  2LQ8 A;  3UA6 A;  2KGT A;  1Q7Y C;  2AHJ B;  1XOV A;  3RES A;  1N8R R;  2EYW A;  4AFQ C;  4PL6 A;  4E7Z A;  3OYF A;  1VQ4 Q;  1E7O A;  3G4S Q;  4O5V A;  5I11 A;  3EHQ A;  2GTO A;  2O9S A;  1GL5 A;  4M4Z A;  4OMN A;  3I56 A;  3EHR A;  3E2U A;  4EPC A;  1BCO A;  1M9S A;  2HQE A;  3JB9 H;  4PJJ A;  5CIU A;  4YTL A;  1BI0 A;  3DLL A;  3CCV Q;  2EYQ A;  2GCX A;  2E41 A;  1U06 A;  1YIT T;  1YCY A;  1M8M A;  3SEM A;  3QSU A;  4HCB A;  2C06 A;  1Y71 A;  1WPY A;  1RAD B;  2O01 E;  3ZL7 C;  1RAI B;  2IPO B;  3V7C A;  2F69 A;  2WSE E;  1TSF A;  5L8R E;  3SWN B;  1W2B A;  2FHD A;  3CEY A;  2V1Q A;  5L23 A;  4BI4 A;  1VOM A;  3CCS T;  1MMG A;  1YJ9 T;  2VXE A;  2OI3 A;  1PM3 A;  1NJI C;  3JSC A;  5LL6 S;  4ZN3 A;  1YCS B;  5IXF A;  1JBM A;  2CUD A;  3PVL A;  1K73 C;  3LLR A;  3QJ6 A;  2K3X A;  1SSF A;  3CC4 Q;  2YUO A;  3PNW C;  3PIO A;  5GAN 3;  1LNX A;  2DF6 A;  4QQG A;  3RUX A;  3NGP A;  1KK7 A;  4C5G A;  1WIE A;  4QVD A;  2O2O A;  4EMK C;  2RHI A;  3LH0 A;  4NS5 A;  3UAT A;  3CQT A;  3PT9 A;  3RR6 A;  1N8R C;  1NEB A;  3L2Z A;  2JJ9 A;  1TXQ A;  4FSX A;  3GIB A;  3CXC P;  1H3Z A;  3LH5 A;  1OZ3 A;  4DEY A;  1VQ9 A;  2YUQ A;  3RMS A;  4JS4 A;  1C6V X;  1O9S A;  4M7D B;  5DY9 A;  3O8V A;  2ECZ A;  2EYZ A;  3NTI A;  5GAM h;  2YT6 A;  4PJO G;  3I55 A;  1X69 A;  3E1S A;  2NUZ A;  2QEX T;  2RI3 A;  2QA4 A;  4IUQ A;  3OSS C;  5GAN 5;  1SHF A;  2R58 A;  2CZ0 B;  4LNP A;  2OTL T;  2COZ A;  1UJY A;  3EG1 A;  1AWW A;  1D0Y A;  3IQL A;  3HHT B;  2MF2 A;  3QXE B;  1ZLM A;  3OA6 A;  4C8Q G;  4DA4 A;  2Z0W A;  1KQ2 A;  1UB4 A;  4R0K A;  4HVW A;  5GAM f;  3OSV A;  2YHT A;  3OYK A;  1XNI A;  3BDU A;  1TWB A;  3S3M A;  1K76 A;  2LNV A;  3I5R A;  4DBQ A;  2D1X A;  4J5Y A;  3FDR A;  1Y96 B;  2AK5 A;  5A2Q E;  3CME A;  3GF5 A;  1ZQ1 A;  2QI2 A;  4EDU A;  4ZGD B;  2BZX A;  1UUE A;  3A8O B;  3RER A;  4C92 G;  2BTT A;  3QUI A;  2KAF A;  3ME9 A;  1KJW A;  5FU7 C;  5A0G A;  1QKX A;  1GXI E;  5CKD A;  2RA2 A;  2ESW A;  2FZG B;  3CMA Q;  1PCX A;  2DL3 A;  2JMC A;  1KD1 C;  2KRN A;  2SRC A;  1UE9 A;  3S6W A;  5HK3 A;  4KH0 B;  1JRI A;  3VUZ A;  2DJZ A;  2HMA A;  3PGG A;  4N0A A;  1Q82 R;  2M51 A;  1RI0 A;  1T0H A;  5KYU B;  4OGE A;  3A8L B;  4LN2 A;  2LJ3 A;  5FRO A;  1RLQ C;  2A0F B;  5M9O A;  2NWM A;  2KT1 A;  1WZO A;  1YJN A;  1TU0 B;  4OMO A;  2GFA A;  1PKT A;  2L3S A;  3BW1 A;  3MEW A;  4DBR A;  2HEQ A;  1BI1 A;  2M0O A;  3X20 B;  2DRK A;  3JCM Q;  1MMN A;  1H8K A;  1EIF A;  4IUT A;  4E7I A;  4OB2 B;  1M4Z A;  4M78 E;  3JB9 J;  3GNF B;  4WTO B;  3EG9 A;  2DZC A;  2VAS A;  1YJW T;  1K0S A;  4IUV A;  1PD1 A;  4JS5 A;  5CKF A;  4M7A B;  1YHQ T;  2JZ2 A;  5KYW B;  2V8J A;  2F2V A;  3OB9 A;  3OYC A;  4L59 A;  4B6M A;  1VQ4 A;  5GAO l;  2OAU A;  3G4S A;  3TSZ A;  2QGF B;  1UHC A;  3M0T A;  3MHX A;  1VQN Q;  2EFI A;  1Q81 R;  2P0K A;  3RNJ A;  2A37 A;  1OOT A;  4A4E A;  5DM7 R;  2P84 A;  3M0Q A;  1X01 A;  3CCV A;  1QW1 A;  2DVJ A;  3G71 T;  3J7A F;  2J7I A;  2V8K A;  2K3B A;  3FIF A;  1RUW A;  3CCR A;  3HP9 A;  1K9M C;  4PJO C;  1U3O A;  1N5Z A;  5GJW B;  4LE9 A;  1R77 A;  1VQP T;  1RLP C;  3E19 A;  1D1C A;  1GRI A;  2D8J A;  1YFN A;  4KRT A;  1ZUU A;  2CSI A;  2LVM A;  4JLG A;  1I5L A;  4Y28 E;  3LW5 E;  1H64 1;  2NUP B;  5HCK A;  2OTJ Q;  4LDW A;  3M56 A;  2X4X A;  4J9E A;  2E6Z A;  4A63 B;  2EKH A;  2DFU A;  2RJC A;  2DIQ A;  4JZ3 A;  4BB7 A;  3MCA B;  2D6F A;  1SEM A;  1D1A A;  4D8D A;  2MPX C;  1PNJ A;  1PSF A;  3QWY A;  3CC4 A;  1WHH A;  1KSW A;  4N4I A;  1RAE B;  3V8K A;  4EMK A;  5GAN j;  3M0U A;  2WAC A;  1VQ5 Q;  1VQ7 T;  2DO3 A;  1B3Q A;  4PJO F;  4DBF A;  2V1R A;  2KI7 A;  1IHV A;  3TSW A;  4LXC A;  5CO7 A;  3EFO A;  5FLX E;  1M3C A;  1LPL A;  5IN1 A;  1UDL A;  1X75 C;  2CZ7 B;  2WSC E;  4F14 A;  4GBQ A;  2L0A A;  5GMK m;  4C8Q F;  4ESR A;  2MYS A;  3CXC A;  4K11 A;  3JCM J;  3I9Q A;  1K8A C;  2MAM A;  3BY7 A;  1CSK A;  5GAN 6;  4R55 A;  2DRM A;  1V76 A;  1OPL A;  1X6G A;  1B34 A;  1Z9Q A;  3J81 E;  4M7D G;  2E3H A;  4FW1 A;  2ZPF B;  1AOJ A;  1PHT A;  2NYS A;  1IB8 A;  1TUC A;  2PZ1 A;  2DD5 A;  4C92 F;  4KGV B;  4J7I A;  4CRI A;  1I1J A;  5KYX B;  3JCM e;  1KHI A;  4RKU E;  3CPW P;  1D09 B;  1VYT A;  5LJ3 g;  3PE0 A;  5AT1 B;  3CCJ T;  3JRZ A;  4HVU A;  2QQR A;  4IUP A;  1E6G A;  4IUU A;  5LJ5 e;  3JB9 I;  5D6Y A;  2DE0 X;  1X2Q A;  1K0X A;  1RI9 A;  5GAN d;  4D8K A;  2VGN A;  1UHF A;  1T0J A;  4J9D A;  3PTA A;  1ABO A;  1Q7Y U;  1VQM Q;  4PJO D;  2RM4 A;  1SPK A;  4JZ4 A;  2CUB A;  4M77 B;  4QQ6 A;  5KYY B;  1XTD A;  1H3H A;  3VS6 A;  4JJD A;  3I35 A;  3CCM Q;  3CCQ Q;  1BI3 A;  3EGX B;  2RHX A;  4M75 C;  3MKD A;  3JV3 A;  3I56 T;  1TS9 A;  1WHJ A;  3EG0 A;  3HSB A;  1WHG A;  1MMA A;  2OAW A;  1W6X A;  4ZGJ B;  1ZSZ B;  3TRE A;  4BUG A;  1WHL A;  2KMT A;  4XAX B;  2K7A A;  2BUD A;  3FRN A;  1RL2 A;  2HL3 A;  2RHZ A;  4MML A;  2KEA A;  2YRD A;  2RJF A;  1I0C A;  2DL5 A;  1R8O B;  3A1P A;  4J8O A;  5EG2 A;  3MJX A;  3QWX X;  4JJN K;  1E6H A;  2CZ1 B;  2K2M A;  2L2P A;  2YLB A;  2A08 A;  2DER A;  2DD4 A;  2C0T A;  3SWN C;  2JXB A;  1D1B A;  1HYO A;  2P0Q A;  2QQA A;  1AHJ B;  1WX6 A;  4XTY A;  1G8X A;  4KBM B;  2JUF A;  4HVV A;  4OB3 B;  3LGF A;  1IRX A;  2P0P A;  3GBQ A;  2DYB A;  4OMQ A;  5KCH A;  1U5S A;  4JLI A;  2VYT A;  1UJ0 A;  1QVG S;  2LRQ A;  2YWW A;  2JS0 A;  5CKB A;  3QJY A;  1NBE B;  1Q86 R;  4BE2 A;  4M7A G;  2ROL A;  5GMK e;  3QDR B;  3V7S A;  3JB9 G;  3CPF A;  4A53 A;  1VQN A;  1M1K R;  4B9X A;  2XID A;  3F70 A;  2ZAE A;  1ZA2 B;  1VQ9 T;  2RD1 A;  4PFZ A;  2A7Y A;  4PJO A;  2FRY A;  2CP2 A;  4ELY C;  3QZ9 B;  5FU6 C;  2JTE A;  3PVQ A;  2M0Y A;  4M7D C;  5CVI A;  3I55 T;  5FWB A;  4AG1 C;  3GLX A;  4PNO A;  2DXT A;  3EGD A;  5LJ3 e;  2QA4 T;  2GBQ A;  3CBM A;  1WGS A;  1GBR A;  1SKU B;  2DAQ A;  3HRU A;  2CYZ B;  1ZBX A;  4ORZ A;  2DNU A;  2K6D A;  5I2M A;  2OTJ A;  3DB4 A;  1N9R A;  4JJB A;  2I2L A;  1KC8 C;  1VQK Q;  1FMW A;  4AFU C;  4BY6 B;  3O5Z A;  3NTK A;  3REA B;  1RAA B;  4M75 D;  3EFS A;  4X34 A;  3M0P A;  1M90 R;  1VQ5 A;  3OS5 A;  2KXD A;  2XIC A;  3CME T;  1ZSG A;  1CKA A;  1QLY A;  1VQL Q;  4OGC A;  1YIJ Q;  3OYH A;  4M7D F;  2PUO B;  2RK2 A;  2BZY A;  4DOV A;  1YI2 T;  2RHY A;  1BYM A;  5GAN h;  2VVK A;  1MMD A;  4JPB W;  3TQ7 P;  4FW2 A;  2ROT A;  5A0D A;  2K5L A;  2CZ6 B;  4N4G A;  2OTL Q;  1AEY A;  1VQ8 Q;  1RAC B;  1TTH B;  2EKO A;  4E47 A;  2RJE A;  4Y91 A;  1PWT A;  3RDV A;  1VQ6 Q;  4JUV A;  4A54 A;  3QZ5 B;  2X4W A;  5GAN f;  2K3Y A;  3MP6 A;  1WXT A;  4C5E A;  2ZPI B;  4BDY A;  3WVE B;  4F04 B;  1JQQ A;  1QCN A;  1VUB A;  1HXD A;  3QII A;  3R6O A;  3M9Q A;  1SHG A;  2BE9 B;  2L3Q A;  3QHS A;  4FYW B;  3X26 B;  4JRI A;  2F5T X;  2YXY A;  3MET A;  4BDZ A;  1YN8 A;  2O4X B;  5IXB A;  3Q1J A;  1OI1 A;  1S72 Q;  1KQS S;  3X28 B;  1YJN T;  2QAZ A;  2DPP B;  2FZC B;  3CPW A;  4RG8 A;  5C0M A;  1Y57 A;  4C0D C;  4F7U B;  4OF1 A;  5GAM e;  4ZGE B;  1SF9 A;  2PVG B;  3VS3 A;  4RMO A;  2SEM A;  2HSP A;  1M90 C;  3GP8 A;  1JJ2 S;  2CKK A;  1UEC A;  4XU3 A;  1VQM A;  4M7D D;  5GAO n;  2EJ9 A;  3G1J A;  1OPK A;  3UT1 A;  1OU8 A;  2E5Q A;  4M75 A;  4WCI A;  1D3B A;  1R0C B;  2OJ2 A;  1W4S A;  4C0G A;  3CCM A;  4AFZ C;  5CQX A;  1WA7 A;  4M7A C;  4ATO A;  3G4S T;  3BDL A;  4M77 G;  1LVK A;  1VQO A;  5J26 A;  3M4Y A;  3WVD B;  4AG2 C;  5C6S A;  3HPW A;  3UWN A;  4XTW A;  3VS5 A;  2KT8 A;  4MDX A;  1SG5 A;  2DLP A;  2L89 A;  3CCV T;  1K9M U;  1FMK A;  2LJ1 A;  3CCR T;  1X2K A;  1LJO A;  1NLP C;  4RCC A;  2RPN A;  2VC8 A;  2RHU A;  1IGQ A;  1MHN A;  3RIR A;  1YJW Q; 
#chains in the Genus database with same CATH homology
 3M59 A;  1VQP T;  2PVD B;  2JN0 A;  3OMG A;  3E19 A;  2MWO A;  4UC4 A;  4D6W A;  3OYJ A;  1VQP A;  1IZ6 A;  1Q86 U;  4OVA A;  2MMP A;  3SWN A;  4M75 B;  2VXF A;  2LVM A;  4JLG A;  1D3B B;  2E6N A;  4Y28 E;  5CQY A;  4TVR A;  2HNI A;  1I5L A;  3LW5 E;  4MZT A;  4C8Q B;  1H64 1;  2DIG A;  4M7A F;  2LTO A;  4LDW A;  3M56 A;  4ME7 A;  2X4X A;  1M1K U;  1M1G A;  4O6J A;  5J39 A;  3QG1 A;  4KUL A;  1Y7X A;  4XTX A;  1Q86 C;  3JB9 F;  1KD1 U;  2E6Z A;  3V8J A;  4LDX A;  4KUD K;  3INZ A;  1HK9 A;  3CC7 T;  2VUB A;  2RJC A;  2DIQ A;  3MP1 A;  4BB7 A;  2R57 A;  3NFC A;  3MCA B;  5DLO A;  2D6F A;  3CCE T;  3CC7 A;  2EQU A;  2RO0 A;  3CC4 T;  4M78 A;  5LJ3 f;  1MGQ A;  1PSF A;  4C0Z A;  4ELZ C;  1UGP B;  1M1K C;  4LDU A;  3CCE A;  1PSE A;  1M1F A;  3CC4 A;  3L2U A;  1Y07 A;  4N4I A;  3FJP A;  3V8K A;  2PU9 B;  2DVE A;  4EMK A;  1I4K 1;  5GAN j;  1QP2 A;  4FM4 B;  1M8V A;  2WAC A;  3L2R A;  1VQ7 T;  2DO3 A;  2FL7 A;  3SDZ A;  4HA8 A;  3OS0 A;  1DJ7 B;  3GNG A;  4E7H A;  4M78 G;  4BI8 B;  2LC4 A;  1VQ7 A;  4PJO F;  2YLC A;  3T9N A;  3TCJ A;  1BKB A;  4C92 B;  2A3L A;  3M5A A;  3ZBD A;  3H6Z A;  4OP0 A;  1WJQ A;  3HRS A;  5DLQ E;  5GAN 8;  1BIA A;  3E9F A;  2D9T A;  2VV5 A;  4MZP A;  2RB6 A;  1FXX A;  4II1 A;  3TEE A;  1V29 B;  5CO7 A;  2XDD A;  4E7L A;  5FLX E;  3EAE A;  4M75 F;  5IN1 A;  1KHC A;  2ZPH B;  1X75 C;  2DEQ A;  2CZ7 B;  1QVG A;  1NE8 A;  2WSC E;  5KCO A;  5GMK m;  4C8Q F;  1KQS A;  5FRM A;  2XI9 A;  3UPU A;  3CXC A;  3MP8 A;  4XU2 A;  3LWH A;  3VV0 A;  4FIB A;  5GAO m;  3JCM J;  4M7D A;  1K8A C;  2MAM A;  3BY7 A;  4N4H A;  2XKO C;  3DKM A;  4MMK A;  2KSS A;  2QDY B;  3VKI A;  2EJF A;  2ZPG B;  3M58 A;  1M90 U;  4RG2 A;  4EMH A;  5GAN 6;  3FEO A;  4R55 A;  3JCM P;  2K5F A;  2IG0 A;  3RKY A;  2FYK A;  2X4Y A;  3OQ5 A;  4HT8 A;  5I21 A;  1B34 A;  3PMI A;  4OB1 B;  3J81 E;  3OS1 A;  4M7D G;  4EMK B;  3M57 A;  3EFR A;  4GY5 A;  5CCA A;  3CCU T;  3LX7 A;  4E7K A;  2DTH A;  2ZPF B;  3C4S A;  3QO3 A;  3PFS A;  3CCU A;  2EQJ A;  3JAM E;  3JCM g;  4FL6 A;  2KDS A;  3CPW S;  5KE3 A;  1BI2 A;  5KH6 A;  2E12 A;  2KK4 A;  3MO8 A;  4M77 A;  1G3W A;  3P8B B;  3OY9 A;  1N27 A;  1NPR A;  2DD5 A;  4XK8 E;  5CAI A;  3L2Q A;  4QQD A;  1IRE B;  4C92 F;  1VQK T;  2JTF A;  4J7I A;  4CRI A;  4FT2 A;  1VQK A;  3C94 A;  3OYY A;  3JCM d;  1OZ2 A;  2K4Y A;  3A5Z B;  4N0A C;  5IT9 E;  3CCQ T;  5HK0 A;  3JCM e;  1KG1 A;  2NLU A;  1KHI A;  4RKU E;  4XTU A;  4BAC A;  4JDS A;  4M7A D;  3QKJ A;  5LJ5 g;  3CCQ A;  4FT4 A;  1VQ4 T;  4EMG A;  5FU6 B;  2HD0 A;  4F7U E;  4CI0 C;  3JB9 D;  5LJ3 g;  4ZTF A;  4C5I A;  1ZHI A;  4PKC C;  3CCJ T;  3JRZ A;  5GMK h;  5GAO r;  3KXT A;  3V8L A;  4V2S A;  3OW2 A;  3URG A;  2XU8 A;  4XQ3 A;  2QQR A;  4IUP A;  5LJ5 d;  4R56 A;  3CCJ A;  3OYI A;  1VQL T;  4IUU A;  3ZFJ A;  5LJ5 e;  3JB9 I;  1YIJ T;  5D6Y A;  2WSF E;  2ZGW A;  3S3O A;  1VQL A;  1YIJ A;  2EQM A;  5GAN d;  2VGN A;  1Q82 U;  5GAN e;  1B34 B;  3M53 A;  2XDP A;  3PTA A;  2DZ9 A;  4KT0 E;  3MEA A;  1Q7Y U;  4MZM A;  2EQK A;  4PJO D;  2RM4 A;  2H3J A;  2JTM A;  1VQ8 T;  4M7A E;  3X25 B;  4XU0 A;  5AYF A;  1Q82 C;  3HFN A;  4Q5W A;  4JRP A;  4HKE A;  3P8D A;  3RKW A;  3RMQ A;  3SFM A;  4M77 B;  4QQ6 A;  1KQ1 A;  5CKH A;  5LJ3 h;  1QVF A;  2P4T A;  2FB7 A;  1VQ6 T;  1XTD A;  4IUR A;  2LQ8 A;  3LWI A;  3L2V A;  1Q7Y C;  2AHJ B;  1XOV A;  3RES A;  4NL3 A;  1VQ6 A;  1BI3 A;  4PL6 A;  3OYF A;  2XDB A;  2M16 A;  5D6X A;  2RHX A;  3FB9 A;  3LGL A;  4M75 C;  4C0F A;  3GPL A;  2E64 A;  4FU6 A;  4J6W A;  2DTI A;  4O5V A;  3I56 T;  1OYX A;  4C8Q C;  3I56 A;  2LT1 A;  5IAY A;  3HSB A;  3J80 E;  4EPC A;  1M9S A;  2HQE A;  3JB9 H;  4ZGJ B;  3TRE A;  5CIU A;  5LJ5 j;  4YTL A;  1BI0 A;  4BUG A;  2B8A A;  4L5G A;  2KMT A;  3DLL A;  2EYQ A;  4PJO E;  1G5V A;  1YI2 A;  4QVC A;  2E1H A;  2GCX A;  3OYM A;  4XAX B;  2E41 A;  4C5H A;  2O4X A;  2BUD A;  4RCB A;  1YCY A;  3FRN A;  1YIT T;  1RL2 A;  2DXB A;  2EAY A;  2GQV A;  3A8G B;  2RHZ A;  3QSU A;  2K57 A;  1WQW A;  1YIT A;  4MML A;  4HCB A;  2RJF A;  3H8Z A;  1S72 T;  2C06 A;  1Y71 A;  2BKD N;  1R8O B;  1WPY A;  1S72 A;  4J8O A;  5EG2 A;  2O01 E;  4JJN K;  1U8R A;  3SB2 A;  3VJP A;  2CZ1 B;  4F7U A;  2YLB A;  2QQB A;  4C92 C;  1I81 A;  3V7C A;  2F69 A;  2WSE E;  1G3S A;  2XK0 A;  2K5I A;  4M77 F;  5L8R E;  1UGQ B;  1K8A U;  2M9U A;  1Q81 U;  3SWN B;  1W2B A;  2FHD A;  2DD4 A;  2JNG A;  2ZCF B;  3CEY A;  4BI4 A;  4LD6 A;  2EWN A;  3PMT A;  1G3T A;  3SWN C;  4NOY A;  3CCS T;  1YJ9 T;  2VXE A;  1NJI C;  3V7R A;  3JSC A;  2P0Q A;  5LL6 S;  4ZN3 A;  5KE2 A;  3CCS A;  2QQA A;  1JBM A;  3KBG A;  4F7U G;  1YJ9 A;  1AHJ B;  1K73 C;  3CBP A;  3HFO A;  3LLR A;  3A8H B;  4XTY A;  1Q81 C;  3QJ6 A;  4KBM B;  2JUF A;  1WQ7 A;  2K3X A;  4OB3 B;  1SSF A;  2PVO B;  3LGF A;  1TH7 A;  3JCM W;  2P0P A;  3OYD A;  2YRV A;  1XQH A;  3PNW C;  4NL2 A;  5KCH A;  3PIO A;  1I8F A;  4M78 B;  2QXF A;  5GAN 3;  1LNX A;  4JLI A;  4M7A A;  2VYT A;  5J3B A;  4M78 C;  3MEU A;  4QQG A;  3RUX A;  1QVG S;  2LRQ A;  4C5G A;  3L2W A;  1N9S A;  4QVD A;  1VIF A;  3L42 A;  4EMK C;  3FC3 A;  3CXC S;  2RHI A;  3LH0 A;  1N6A A;  5CKB A;  4JRQ A;  3QJY A;  1JJ2 A;  4HCC A;  4NS5 A;  4C0D B;  4BE2 A;  2XD0 A;  4M7A G;  3PT9 A;  3X24 B;  1VQN T;  5GMK e;  4LD9 K;  4BD3 A;  3QDR B;  3V7S A;  3ASK A;  3JB9 G;  3CPF A;  4A53 A;  1N8R C;  1VQN A;  2QQ9 A;  2KY9 A;  3L2Z A;  1G3Y A;  4FSX A;  4B9X A;  2E70 A;  2XID A;  3F70 A;  3GIB A;  3JCM b;  2KVQ G;  1VQ9 T;  1H3Z A;  1OZ3 A;  2RD1 A;  3M54 A;  2A7Y A;  3WXM B;  4PJO A;  2GFU A;  4B9W A;  1VQ9 A;  2DXU A;  3RMS A;  4ELY C;  4JS4 A;  3QZ9 B;  4A4H A;  2CS7 A;  3JCM c;  1O9S A;  4J6Y A;  2M1H A;  1O75 A;  2LT4 A;  5FU6 C;  5HY6 A;  4BI3 A;  4M7D B;  3VUB A;  1Y96 A;  3QYG B;  5DY9 A;  3O8V A;  4M7D C;  5CVI A;  3I55 T;  1NPP A;  3GLX A;  3NTI A;  5GAM h;  4XU1 A;  5LJ3 d;  4PNO A;  2DXT A;  4PJO G;  3I55 A;  5LJ3 e;  3G6E T;  3JCM X;  2R5M A;  3CC2 T;  4M78 F;  1KC8 U;  2QA4 T;  3CBM A;  3G6E A;  1WGS A;  2DKG A;  3CC2 A;  1YHQ A;  2RH2 A;  2DXC A;  3E1S A;  2QEX T;  2DAQ A;  2RI3 A;  2QA4 A;  3HRU A;  2CYZ B;  4IUQ A;  2R5A A;  4WF2 A;  1ZBX A;  3OSS C;  5GAN 5;  2OTJ T;  2R58 A;  3MEV A;  2QEX A;  2CZ0 B;  2OTL T;  5I2M A;  2OTJ A;  1YBY A;  2QTX A;  3DB4 A;  3OYN A;  1N9R A;  4M75 G;  4Z02 A;  3OW2 S;  1UGR B;  4J6X A;  2I2L A;  3C95 A;  4KUI A;  1KC8 C;  2OTL A;  5CKE A;  3OA6 A;  3HHT B;  2MF2 A;  3QXE B;  5D6W A;  4DA4 A;  4C8Q G;  1KQ2 A;  5GMK j;  1UB4 A;  1M5Q 1;  4M77 D;  4X9C A;  4BY6 B;  3CMA T;  5GAM f;  1U1T A;  4M77 C;  4LDY A;  3OSV A;  3NTK A;  4BY6 C;  2YHT A;  3OYK A;  4PLL A;  3CMA A;  4M75 D;  1QP3 A;  1XNI A;  1WJS A;  3BDU A;  3GOX A;  2Y90 A;  3S3M A;  4A4F A;  3UDC A;  4P5N A;  3OS2 A;  2Y4X A;  4C8Q D;  2LNV A;  3EFS A;  1VQ5 T;  2MWP A;  4X34 A;  2HAX A;  4BE0 A;  1VQ5 A;  2JVV A;  3OS5 A;  2RI5 A;  2PUK B;  2ZZD A;  3OYE A;  2LX9 A;  2XIC A;  3DB3 A;  3CME T;  1BIB A;  2JOY A;  4J5Y A;  3FDR A;  4OGC A;  1Y96 B;  3OYH A;  1QVF S;  4M7D F;  2CGH A;  2PUO B;  2RK2 A;  4DOV A;  5A2Q E;  3CME A;  1YI2 T;  2RHY A;  3HL8 A;  3NTH A;  3GF5 A;  5FRN A;  1BYM A;  1ZQ1 A;  3S3N A;  3JCM f;  5HKC A;  1FX7 A;  1P92 A;  2QI2 A;  4EDU A;  5GAN h;  4ZGD B;  5LJ3 j;  4L6V 5;  4PLI A;  3A8O B;  3RER A;  5FU7 B;  2KQW A;  3QUI A;  4C92 G;  2KAF A;  3ME9 A;  3OBW A;  4M77 E;  5A0D A;  1UEB A;  2FVU A;  2K5L A;  2CZ6 B;  5FU7 C;  2LDM A;  2XG8 D;  2EJG A;  1U1S A;  4N4G A;  2RK1 A;  5A0G A;  4M75 E;  4HT9 A;  2EKO A;  1GXI E;  3JCM V;  2QQS A;  2RJE A;  2L8D A;  4Y91 A;  4E47 A;  3LYI A;  1X6O A;  4HCZ A;  5LJ5 f;  2MI6 A;  4OMF B;  3SD4 A;  4C8Q E;  4C92 D;  5CKD A;  2RA2 A;  3N5B B;  3QYH B;  1NJI U;  5GAN 4;  5A0L A;  4JUV A;  4A54 A;  2PQW A;  3QZ5 B;  2X4W A;  5GAN f;  1K73 U;  1KD1 C;  4DQ2 A;  2K3Y A;  3MP6 A;  4ZTJ A;  5CR2 A;  3S6W A;  4GLK A;  4C5E A;  2ZPI B;  3HRT A;  5HK3 A;  2ZPB B;  4BDY A;  1JRI A;  2EIF A;  3WVE B;  3M4G A;  4LDV A;  3VUZ A;  5GAN 7;  2DJZ A;  3E9G A;  1VUB A;  1HXD A;  3A8M B;  3M55 A;  4ZN1 A;  2E10 A;  3PGG A;  3PIP A;  2HBP A;  3QII A;  2DK3 A;  3R6O A;  2G3R A;  4N0A A;  3M9Q A;  2F5K A;  2LCL A;  3QHS A;  1RI0 A;  3X26 B;  3G7Z A;  4JRI A;  4XTZ A;  2ZPE B;  4A4K A;  4M78 D;  2F5T X;  1W2B S;  3MET A;  3OYG A;  4BDZ A;  4C92 E;  4OGE A;  4E7J A;  3A8L B;  5I2S A;  1LOJ A;  2O4X B;  5FRO A;  5M9O A;  3Q1J A;  1OI1 A;  1KQS S;  4MDW A;  1N8R U;  2IVW A;  3X28 B;  1YJN T;  3QBY A;  2GF7 A;  3OBY A;  1WNL A;  4QVZ A;  5GAM g;  2DPP B;  1YJN A;  3CPW A;  4VUB A;  2GFA A;  1JB0 E;  4RG8 A;  5C0M A;  2BIV A;  1NZ9 A;  3BW1 A;  3MEW A;  2VGM A;  4C0D C;  2V8I A;  2D0Q B;  1BI1 A;  2M0O A;  4F7U B;  2L3R A;  4OF1 A;  4J83 A;  3X20 B;  3JCM Q;  3L1A A;  5GAM d;  4QW2 A;  3C12 A;  2RI2 A;  1EIF A;  4IUT A;  5GAM e;  4ZGE B;  2K2V A;  5CK9 A;  2RJD A;  2PVG B;  4RMO A;  4OB2 B;  2LCC A;  4E7I A;  1M90 C;  3RKX A;  1M4Z A;  3GP8 A;  4M78 E;  1JJ2 S;  2CKK A;  3JB9 J;  3GNF B;  4OB0 B;  1VQM T;  4JRK A;  3AHU A;  2DZC A;  5GAO q;  3KUF A;  1YJW T;  4XU3 A;  1VQM A;  4M7D D;  4IUV A;  5GAO n;  2Y4Y A;  4A4G A;  1YJW A;  2EJ9 A;  3TU4 K;  1FWZ A;  3UT1 A;  4JS5 A;  2E5Q A;  4M75 A;  4BE1 A;  3P8H A;  3OMC A;  5CKF A;  1D3B A;  3VYH B;  3CCM T;  4M7A B;  5GAO p;  1YHQ T;  4C8Q A;  1W4S A;  2JZ2 A;  4DOW A;  3OYB A;  3FLG A;  3ZEH A;  4C0G A;  5GMK i;  3CCM A;  2E65 A;  2V8J A;  5CQX A;  3VYG A;  5GMK l;  1VQO T;  4M7A C;  3VU3 C;  3OB9 A;  3OYC A;  3G4S T;  3BDL A;  4L59 A;  4M77 G;  3CCL T;  4ATO A;  1VQO A;  2XHC A;  5J26 A;  1VQ4 A;  5GAO l;  2OAU A;  3M4Y A;  2DTO A;  3G4S A;  3CCL A;  3WVD B;  5C6S A;  3HPW A;  3BFM A;  5GAN g;  3UWN A;  4XTW A;  3OYA A;  3HKS A;  3MHX A;  2EFI A;  2P0K A;  4MDX A;  4J7F A;  4A4E A;  5DM7 R;  3OYL A;  3JCM h;  4IKF A;  2L89 A;  5GAN 2;  2X35 A;  1WJR A;  3CCV T;  1K9M U;  3CD6 T;  1VIE A;  4F7U F;  4XTV A;  1X01 A;  4X9D A;  2HQX A;  3CBO A;  1QW1 A;  5GAM j;  3CCV A;  2L5Q A;  3G71 T;  2V8K A;  3CD6 A;  3J7A F;  4M7D E;  3ER0 A;  3FIF A;  3DLM A;  3CCR T;  1VQ8 A;  3G71 A;  1LJO A;  3CCR A;  4PJO B;  3HP9 A;  4RCC A;  2VC8 A;  2RHU A;  1K9M C;  1MHN A;  3QPH A;  4C92 A;  1QVP A;  2X4J A;  3RIR A;  5LJ5 h;  4PJO C;  1UGS B;  2LQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...