4M75E

Crystal structure of lsm1-7 complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
75
Chain Sequence
ILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDSRNEKVMQHHGRMLLSGNNIAILVPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
total genus 10
structure length 75
sequence length 79
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75E00
4M7AE 2FB7A 4XTZA 2VXEA 3JCMX 5LJ3h 4M7AC 4M7DG 5LJ5e 2RM4A 4N0AA 4XTWA 4M7AD 3VU3C 5I21A 4PJOF 2E10A 4M7AG 4WF2A 4PNOA 3JCMh 3JB9D 3JCMP 3JCMg 5GAMj 5GAOr 2DTOA 3V7SA 3JCMe 3V8LA 4M78F 4XU2A 3RIRA 3EFSA 1D3BA 1WNLA 2DZCA 3RERA 3AHUA 4X9DA 4NL2A 3QO3A 5GANf 3JCMJ 4F7UA 1MGQA 2FYKA 4C8QA 5GAMg 4Y91A 3JCMd 5GAN5 2DTIA 3BFMA 4J6YA 5GAN2 5GAN3 2DEQA 2E65A 5GAN6 3JCMb 5GANj 2EAYA 1BIAA 2HNIA 4M77G 1I4K1 5GMKm 5GAN4 1KQ1A 5GAOp 4RCBA 4XU0A 5LJ3e 4M7DB 2RA2A 4M7DA 4M7DD 2VXFA 3RUXA 2EJGA 4M7AB 5GANh 1B34A 2EJFA 4M77E 4M7AA 4X9CA 4C92A 2DTHA 3SWNC 1M5Q1 4XU1A 3RESA 5GANe 4F7UG 4HT9A 4XTUA 2EWNA 2DXTA 5GAN7 5LJ5f 1Y96A 4EMKA 3JB9H 5GAOm 5CAIA 3JCMQ 1KQ2A 1WQ7A 1B34B 2ZGWA 4J5YA 4J6WA 4C92D 2YHTA 4M78E 4C92B 4EMKC 4OP0A 4QVCA 2CGHA 4C8QC 2K57A 2DJZA 4M7AF 4DQ2A 4C8QE 4PJOD 4PJOA 3V8JA 4PJOB 4M78C 3JB9F 3PGGA 2E64A 4M78G 5GAMd 4XTYA 4M75E 4M77A 3RKYA 3V8KA 4NOYA 5LJ5g 1WQWA 4C8QF 3L2ZA 3QSUA 2QTXA 2RB6A 2VC8A 1U1SA 2I2LA 4F7UB 2JN0A 3SWNB 4M75C 3V7CA 5LJ3f 3SWNA 4JRKA 1I81A 4M75G 3BW1A 4XQ3A 3M4GA 4M77F 5LJ5d 5GAMe 1I5LA 2YLBA 5LJ3d 1H641 2DZ9A 4C92G 4A53A 5GAN8 3FJPA 3INZA 3SB2A 1N9SA 3V7RA 4EMGA 4XTXA 4C92C 5GAMh 3HSBA 1WPYA 1LJOA 4M7DF 2DXUA 4C8QB 1M8VA 3FIFA 4PJOG 3GIBA 1X01A 4N0AC 5GANg 3FB9A 4V2SA 4XTVA 5LJ3j 3JCMW 4PJOC 4M78B 4C92E 5GAMf 3QHSA 5GMKi 1HK9A 4M78D 5GMKe 4NL3A 3EFRA 5LJ5j 3BDUA 4F7UE 1U1TA 4M77C 1Y96B 4J6XA 4EMKB 4M77D 1HXDA 3RKXA 3BY7A 5GAOn 5GAOq 2RD1A 5GMKj 4M75D 3HFOA 4MMLA 4JUVA 4M75B 1YCYA 4M78A 3RKWA 4QVDA 4EMHA 4M7DC 2YLCA 3JB9G 1LNXA 1N9RA 4JRIA 4PJOE 1I8FA 1JBMA 1LOJA 3HFNA 4JLIA 4HA8A 1BIBA 4M7DE 2E1HA 4MMKA 4A54A 2E41A 2DVEA 4XU3A 5GAOl 3JB9I 4M77B 4C8QG 4C8QD 3QUIA 4M75A 3JCMV 3JCMf 3JB9J 5LJ3g 5GMKh 5GANd 4HT8A 4F7UF 1JRIA 4M75F 2DKGA 3JCMc 5GMKl 1TH7A 5DY9A 2Y90A 4RCCA 3L1AA 2EJ9A 5LJ5h 4C92F 1D3BB
chains in the Genus database with same CATH superfamily
2K6DA 3LYIA 3SEMA 1WHLA 5FU7C 3CBMA 5C0MA 4LUEA 3VRZA 5A0LA 2LCCA 5KH6A 2QQRA 3V7SA 4J9EA 4DEYA 1RAAB 4LD9K 5A2QE 1M30A 3CC2T 3CD6T 2M16A 2CH4A 2GTJA 4C8QA 1I0CA 1VIFA 1V1CA 3CC4A 2JVVA 2QA4Q 2QQSA 4FYWB 4EDUA 3EHQA 5GAN4 5LJ3e 2DXBA 2RA2A 3WVEB 1G2BA 1JXOA 5DLOA 2E5QA 2R58A 4PJNA 4F7UG 4ANJA 5IHNA 3OS0A 4HVUA 3JB9H 4OMNA 3J7AF 4DOVA 2AKKA 5KYXB 2E64A 1OYXA 1ZA1B 3OBWA 1ZSZB 2FZKB 8AT1B 1DJ7B 4C5IA 2LCSA 1IGQA 3VUZA 3GPLA 4ORZA 2VB6A 4IKFA 3EFOA 2NWMA 1VQNQ 2DIGA 2YLBA 4C92G 1H8KA 1Y57A 3G4SA 3TSZA 3H9NA 1VQ9T 3M55A 1NBEB 4OB3B 1PD1A 5LJ3j 1QMCA 3QDFA 4FSXA 4JS4A 1AEYA 1RLQC 1U1TA 2CREA 1IGUA 1OPKA 1OU9A 4HCKA 4ZGEB 4E7JA 4MMLA 4JUVA 3WXMB 1KIKA 1D0YA 3JB9G 1LNXA 1WYXA 5CCAA 2RF0A 4HA8A 2E41A 3TEEA 1Q82R 3M9QA 3QUIA 1VQMQ 3OYMA 4HKEA 3CXCA 3M0UA 4F7UF 2O9VA 2HKNA 2AZVA 1QKXA 2YXYA 3RDVA 5GAMd 3PNWC 3EGXA 2FZGB 2L5QA 1HYOA 2EQJA 1QLYA 4PNOA 4RUGA 1S72Q 1RL2A 2DTOA 2ROTA 4KT0E 2YUOA 1VQKA 5GANf 1PD0A 3QYHB 1UDLA 1VQ7Q 1QVGP 5KCOA 3M57A 1Q86U 2LJ1A 2OJ2A 1UTIA 2FRYA 2RMOA 1BIAA 2M0OA 2RJEA 3PMIA 4C5HA 2RPNA 1KQSS 1QVFS 5GANh 3CPWP 1XQHA 2KQWA 5GANe 4AFSC 1FWZA 5C6SA 1UHFA 1R0BG 2RI2A 2BZYA 3CCVQ 2LMJA 1Q81C 4F17A 4E7LA 4J6WA 1VQ4T 3M56A 2RK1A 3CCEQ 4PJOA 1UECA 3CCMA 5CKFA 2LP5A 3L2ZA 1YHQA 3HL8A 1JU5C 3SWNA 3EG1A 3OYCA 3LX7A 5CQXA 4DOWA 1YJNA 5GANg 1NPRA 2RHUA 3CPFA 3OB9A 4NL3A 3M0QA 1JB0E 1IHWA 1YJNQ 2GTOA 2P84A 5GAOn 5GAOq 2CYZB 2H8HA 5FU7B 2OTJQ 4M78A 4M75B 1OX8A 1UEBA 1ZBXA 3LWHA 5KE3A 1KHCA 4J9FA 1KG1A 2A36A 2M0YA 3JB9I 4C8QD 3JCMV 1BKBA 4ESRA 5IAYA 1JRIA 1NYGA 1SG5A 4LDWA 3NFCA 3VRYA 3L1AA 2V1RA 4M7AE 3MP6A 4XTZA 3FRNA 1GFCA 2CSQA 2JS0A 3MPUB 3HP9A 4L5GA 3OS2A 1WJSA 4FT2A 1ZSGA 3CCVT 2RHZA 1JEGA 2K7AA 3V8LA 3CCQT 4BE1A 2JM9A 3D7SB 1MHNA 3A8HB 2L3SA 3BFMA 5CIUA 5GAN2 3WVDB 5D7UA 2IVWA 1ZX6A 4C5GA 3X24B 4M7DB 3CMET 3ULRB 1VQLA 3LLRA 1YWPA 1VQ6A 1YJ9T 1CSKA 4C0ZA 4XU1A 2RHXA 2EGAA 2CDTA 1UFFA 5HK0A 2VV5A 4EMKA 4QQGA 2DM1A 3JCMQ 1M90U 4RKUE 4C92B 2HAXA 2QXFA 5FU6C 3ER0A 3GOXA 5AYFA 3F70A 4A4EA 1YJWA 3THKA 2FRWA 3QG1A 3VKIA 3EHRA 7AT1B 1VQLQ 4A53A 1N9SA 2HKQB 4EMGA 4FW2A 3CXCS 1D0ZA 3MO8A 4PJJA 4OB0B 5GJWB 1HK9A 1RUWA 4YTLA 2QA4T 1KC8U 2DEUA 1VQ5T 1IRXA 4GLMA 2VWFA 3BY7A 1TXQA 2O4XA 2CZ1B 1QWEA 3HFNA 1YWOA 2LT4A 3L2QA 2E12A 1GCQA 2BIVA 4J8OA 2QG9B 2EYQA 1Q7YR 1J3TA 1KQSA 1S72T 3FJ5A 1D0XA 1NYFA 1H92A 2RQWA 4AG2C 4WF2A 3LW5E 2QI2A 3JCMg 2ABLA 3DB3A 1WNLA 2A0FB 2EGEA 3MEWA 3VV0A 4JPBW 3E1SA 2A7YA 4AT1B 4OMLA 2YUNA 5GAMg 3OYHA 2XIDA 3CC7Q 2D1XA 3C95A 2DE0X 3OSSC 3ZEHA 3CC4Q 4C0GA 2EKOA 1KQ1A 2KT1A 2DD5A 4R56A 4M7DA 3RUXA 4MZPA 5CKDA 1IO6A 2CT3A 4M7AA 3OYJA 2V8KA 1QVFA 2L89A 1VQ6Q 1AZEA 3M53A 5LJ5f 5GAOm 2EGCA 1GXIE 1VQ6T 2MIOA 1W2BP 1YJ9A 2JJ9A 4C8QC 1H3ZA 2RO0A 4F04B 1TUCA 3I56T 2IIMA 3MP8A 1M1KC 4B9XA 3X28B 1MMDA 2E6ZA 2BE7D 4N4GA 1NJIU 3PTAA 4LE9A 2QAZA 5LJ5d 3VJPA 1H641 1WPYA 1PM3A 4AFUC 4JRPA 5GAMf 2JMAA 3EGUA 3FDRA 3M0RA 4J9GA 2O4XB 4OF1A 2EYZA 2K3YA 2KK4A 3PIOA 2PNIA 3G4SQ 3VS3A 1I07A 4FIBA 1G3WA 4XU3A 5FW9A 2CT4A 3S3OA 3JRZA 3SFMA 5L23A 1ARKA 3IQLA 3CD6Q 4C0DC 4JJBA 2RN8A 4KH1B 3JAME 2GCXA 2EYWA 2EBPA 3CMAT 4M7DG 1VQPA 2KXDA 3ASKA 3E2UA 4M7AG 1UJ0A 4J7IA 1VYUA 3MHXA 1GL5A 1EZZB 1MGQA 2VKNA 3OW2S 2FPDA 3CMEQ 3PT9A 2H3EB 4BI8B 4OMPA 1M8MA 5I2SA 2ED0A 1M1KU 2DD4A 2EJGA 1VQ9Q 2EJFA 4HXJA 3S3NA 2ROLA 3RESA 2L3QA 1BI0A 2P0QA 2MI6A 4PLIA 2CP7A 3EG2A 2LZ6B 4ZTFA 3HRUA 3PVLA 2YHTA 1XOVA 3G71Q 2CKKA 4BDYA 1N5ZA 2WSCE 5DM7R 4OVAA 1BBZA 3CCEA 4F7UB 4Z88A 3L2RA 3RR6A 3BW1A 1GCQC 3LGLA 1AWXA 1C1AA 1WX6A 3REBB 2RHIA 2DYIA 1JQQA 2AKLA 1VUBA 2M9UA 4PJOC 4C92E 4HCBA 3TREA 4AFQC 2FG0A 4K11A 3BDUA 1M27C 1ZBJA 1Q81U 4J6XA 1UGSB 1E6HA 3RKXA 3EH2A 3H0HA 3RKWA 3U23A 4FYXB 2B86A 2WACA 3OS5A 1YNZA 1QCFA 4M7DE 3GLXA 1UB4A 1NLPC 3CCRQ 3C94A 3M0PA 1W1FA 3EGDB 5KYYB 2CS7A 1UGQB 1OZ3A 4MDXA 2FB7A 3JCMX 3R6NA 5LJ5e 1W70A 2ZAEA 1C6VX 3JCMh 3JCMP 3H41A 1BCMA 4XU2A 3RERA 1U8RA 1K9MC 2MCNA 1PCXA 2FYKA 1VQOT 4HVVA 2KT8A 2DNUA 3UT1A 3OYEA 1UGRB 4XU0A 3EAEA 2KROA 1KHIA 2DA9A 5I22A 1XJWB 1ABQA 1N8RR 3M0SA 2HL5C 2VGMA 2P0KA 4XTUA 4OMOA 3HRSA 1NPPA 1Y96A 3HKSA 1X6GA 1WQ7A 2QYZA 2BUDA 4OP0A 3Q1JA 4JZ3A 3O5ZA 2D6FA 4C8QE 3H0FA 4BI4A 5KCHA 3FLGA 1SSHA 4GLKA 4DA4A 2GQIA 4A4FA 2XU8A 4BE0A 2LT1A 2IPOB 3V7CA 1Q86C 3CCMT 4XQ3A 3M4GA 4M77F 8ATCB 2KRMA 2H3JA 2PU9B 3CCET 3V7RA 4C92C 4LDUA 1ZUUA 1Q95G 2HQHA 4WCIA 4C0DB 4HCZA 4OB2B 4M78D 5LJ5j 1RI0A 1TSFA 4F7UE 1M90C 4KUDK 2A37A 4PKCC 1MV3A 4M75D 4FL6A 3MEVA 1TUGB 1MMGA 3QYGB 1Q81R 1M90R 1JO8A 4BE2A 2K5LA 1W2BA 2GQVA 1YIJT 3EGDA 2MWOA 3QBYA 3CCLA 2DVJA 5LL6S 1IXDA 4FM4B 4Z8AA 4BDZA 1LPLA 4N0AA 4B9WA 4PJOF 2E10A 1K1ZA 4IUUA 2LX9A 2BZXA 3QKJA 3X20B 3QJYA 4BI3A 1PC0A 3QJ6A 3AHUA 2DYBA 4RG8A 2MAMA 2CUDA 3C0CA 2C0OA 5IHIA 5M9OA 1K76A 3NPFA 3QZ9B 5J39A 2DEQA 3JCMb 1MMAA 1BCOA 4J9IA 2JUFA 2YSQA 1QWFA 1QVGA 2YRVA 2ZCFB 4DBQA 1M1FA 2OAWA 5FLXE 3UWNA 3G4ST 1SF9A 5D6WA 1VQ9A 1MUZA 5EC7A 3UATA 4XK8E 2ZPBB 2QEXA 2QK0A 1PSEA 3HRTA 2DLPA 2COWA 2I0NA 2JNGA 5FWCA 1B07A 2ZZDA 2RJCA 1VQMT 4L6V5 2KY9A 2ATCB 2K5IA 3KFVA 2L3PA 2LX7A 2YWWA 3QZ5B 3X25B 1YI2T 3VS1A 1SRMA 2CP2A 2DZ9A 4ZN3A 2EQMA 4M4ZA 3FJPA 1SPKA 3INZA 1RLPC 3FC3A 5HY6A 2CP3A 3TQ7P 2HBWA 5GMKe 5HCKA 4CRIA 4KGZB 4IUQA 5KYUB 3ZBDA 2EQUA 4E7HA 1VQKT 4JRIA 2LCLA 4A54A 3M5AA 4QT7A 4M75F 4JDSA 2DERA 2RQRA 1TH7A 2J7IA 3M54A 2OTLA 1NM7A 4J6YA 4XTWA 3OW2A 3S6WA 2FPFA 2KXCA 1T3SA 2JXBA 5GAOr 1S72A 2K2VA 1WXTA 2EQIA 1K9AA 4IIOA 2VASA 4FYVB 2IG0A 3A8LB 1WIEA 1NZ9A 5FRMA 4MDWA 1W4SA 4J9HA 5GAN3 2QGGA 3CCSA 2LNHB 1Q82C 2DFUA 1Y7XA 1IHVA 4PFOA 2F2XA 2XK0A 5CQYA 1YJ9Q 1PRMC 3CEYA 1B34A 4Z02A 5I2MA 3VS2A 2DL8A 5L8RE 4ZGDB 1W2BS 1VQ8Q 5GAN7 4ZN1A 3N5BB 3OYKA 1VQ8T 1QQJA 1O75A 3CCJT 3PE0A 4IUVA 4RTYA 1K0SA 1JJ2A 5KYXA 2DRKA 4M78G 2LJ3A 3MP1A 5IN1A 3CC4T 4J9BA 2NUTB 3PFSA 3CQTA 2QTXA 2RB6A 5J3BA 2QEXT 2SEMA 1GCPA 1M9SA 2CZ7B 3H8ZA 3QIIA 4VUBA 2E6NA 1KFZA 2DRMA 1TTHB 5GAN8 5GAMh 3L2VA 1LJOA 1MMNA 1PHTA 3FIFA 4N0AC 2XKOC 1M1KR 2KVQG 3VUBA 1UG1A 1X27A 1XTDA 2DAQA 2MOXA 2GNCA 3I9QA 3G7ZA 1RAEB 3PIPA 1JJ2P 3SD4A 3M0TA 2V1QA 3OYGA 1QW1A 4L59A 2Z0WA 3I35A 1I8FA 4JLIA 3I56Q 4AFZC 1VOMA 4JZ4A 3OYBA 1OPLA 3META 4QVZA 1XNIA 4M75A 4BD3A 2M1HA 4C0FA 4ATOA 3QWXX 2VYTA 4ELZC 4KGVB 2E4HA 4E47A 1QP2A 3SDZA 1WHMA 2PUKB 1VQ7T 1N8RC 3EFOB 1U5SA 4M78F 1K8AR 1D3BA 1GFDA 4BB7A 2HQEA 3OYYA 2DTIA 2WSEE 3EG9B 1PKTA 4ME7A 3CMAQ 3C12A 4Q5WA 1IZ6A 2EAYA 5CKBA 1PG5B 4M7AB 1QVGS 5FWBA 1EIFA 5HK3A 1QCNA 1NJIR 2DXTA 2B8AA 3OA6A 2LNVA 4A4KA 2LRQA 2MYSA 2KYMA 1Y07A 2BE9B 1M2VA 4BY6C 2K57A 1SKUB 3MCAB 3G6ET 4XTYA 2QASA 1X2QA 2R5MA 5LJ5g 1U06A 3CCJA 1K9MU 3PVQA 1FMKA 5LJ3d 1VYTA 4XTXA 1NG2A 2MK5A 2O9SA 2ESWA 1X01A 3FB9A 4E7SA 3QHSA 1CKBA 1KD1C 1M4ZA 4CC4B 1WFWA 1YFNA 4M77D 3CCLQ 3OYAA 1D09B 3HFOA 2K5FA 1X75C 1ZHIA 4DBHA 2CUBA 3G71T 2E1HA 3NTIA 2DVEA 5GAOl 3OYDA 1FMWA 3EH1A 1X69A 5LJ3g 2OTJA 4LN2A 5GANd 4HT8A 1WZOA 2FL7A 2KSSA 4Y28E 2F5TX 2RH2A 5DY9A 1B3QA 2YDLA 1K8AC 4D8KA 1ZQ1A 5LJ3h 3C4SA 4A4GA 5IXFA 4JRQA 5I21A 2DO3A 1FMVA 3ZL7C 2AK5A 4BUGA 3RIRA 2HBPA 1R0CB 4PK4A 2YUQA 1K73R 5CKEA 5KYUA 5GAN5 2EQKA 5CK9A 2EVRA 2RJDA 5GAN6 2K79A 1VQOA 2E3HA 3CXCP 4X9CA 3UA7A 2OX7A 3P8DA 2X4YA 4CC2A 1YCSB 3S3MA 4NS5A 2KR3A 5CAIA 2RI5A 2ZGWA 4J9CA 2QQBA 3CPWS 2R57A 1E7OA 3EGXB 3V8JA 3R6OA 3L42A 3PGGA 3VYGA 3I55T 1BK2A 4LD6A 2OTLQ 4NOYA 3M58A 2W0ZA 4JJCA 2CZ6B 4LDYA 2HSPA 2JN0A 1UGVA 2GBQA 2XDDA 2QDLA 2KEAA 2PVDB 2NUZA 4O5VA 1G3YA 2CZ0B 2EFIA 2D8JA 1OI1A 3UDCA 4JS5A 2O88A 2HL3A 3CCUA 3ZFJA 2A28A 3GIBA 3EG9A 1GBRA 2LTOA 3DLMA 2LVMA 2EW3A 3A8MB 2C0IA 2YT6A 3LWIA 1JXMA 1SHGA 5KYNA 2LQWA 1SEMA 1RABB 1PNJA 4F16A 2VUBA 3VYHB 4J83A 3CCRA 4TVRA 2J06A 3REAB 1WDXA 1O9SA 1TWBA 2O01E 3OMGA 1FYNA 2DF6A 4X1VA 1VQKQ 4C92F 3CPWA 4FU6A 3BE3A 3CC7A 3CCLT 3CC2Q 3RMSA 1G8XA 2P0PA 2DL3A 3J80E 1TU0B 1D1BA 3HPWA 4X9DA 1R8OB 1C0MA 3MEUA 4ZGJB 4BY6B 4J9DA 3M4YA 1Y0MA 1HD3A 2CH4W 4HVWA 1Z9QA 1Q7YU 1YI2Q 3NGPA 2E70A 1M1GA 3OYLA 3GP8A 4M7DD 1YHQQ 1T0HA 1WHGA 1ZLMA 1T3LA 4C92A 2FZCB 1R77A 3NTHA 2KDSA 5AT1B 2C0TA 2K3XA 5J26A 1LVKA 5GANj 4J5YA 2KGTA 2L0AA 2GF7A 4II1A 3CC2A 3CD6A 4RTUA 4PJOD 1MNEA 2XDBA 1X43A 3L2WA 1VYVA 3HHTB 1M3CA 3H6ZA 4ZTJA 3SHWA 2X51A 2XG8D 1X2KA 3SWNB 1UUEA 1CKAA 1OZ2A 3P8HA 1RAGB 2AIRB 3HTRA 4A4HA 4KGXB 2LQNA 4MZMA 4PL6A 1KQSP 2D0QB 2JZ2A 2MF2A 3JV3A 3VS4A 3JCMW 4EIKA 1YI2A 1KD1R 1BI2A 4D8DA 2DBKA 4DBFA 2K2MA 4M77C 1LCKA 1HXDA 1QCOA 2KAFA 3DB4A 3CCVA 1SRLA 1YCYA 3L2UA 3CCQA 4IUPA 1Q7YC 1N9RA 4UC4A 3DKMA 2R5AA 2X4JA 2JW4A 3P8BB 3KBGA 4E6RA 3DLLA 5GMKh 3OQ5A 4KUIA 4DBRA 3CCRT 2NUPB 1SSFA 2NUTA 2DK3A 4LDXA 2W10A 2HZYA 2RM4A 4M7AD 1WA7A 3VU3C 2J6OA 1RACB 1GRIA 5GAMj 2F69A 2RHYA 1T0JA 2DZCA 1K4US 1K73C 2RJFA 2XMFA 1KD1U 3JCMJ 4R0KA 2X4XA 2HNIA 3MJXA 1YBYA 4RCBA 1YJWT 1AT1B 2K4YA 1WXBA 1VQPT 3CCST 1M3AA 2KNBB 5IH2A 1TG0A 1VQPQ 4M78E 4KBMB 4Z89A 3JB9F 4M75E 1TOVA 1YP5A 1K73U 1P92A 4PFZA 2QDYB 3MEAA 2PTKA 1U1SA 4M75C 4R55A 3LGFA 2L8DA 5KYWB 2DL7A 4RTXA 1RAFB 4EPCA 1W6XA 1I5LA 2X3WD 2D9TA 2BKDN 1G3TA 2K3BA 4V2SA 4M78B 5GMKi 2COZA 1TS9A 2YUPA 1Y96B 2RD1A 2KI7A 2J6KA 1FX7A 2FEIA 4QVDA 1NEBA 2EPDA 4OGEA 4BACA 4PJOE 3I5RA 3CCQQ 1RADB 2ZPHB 2RI3A 2QEXQ 4D6WA 1TUDA 1N27A 3NMZC 2JT4A 4OGCA 4PFPA 1KSWA 1X6BA 5GMKl 3CCUQ 4Y92A 4M7DC 5LJ5h 1D3BB 1YIJQ 2ECZA 5KE2A 1OV3A 4PJLA 2LQKA 5CO7A 5A0GA 5HKCA 3E9FA 1WHKA 4E7IA 2JOYA 3QDRB 3QPHA 3G1JA 3BDLA 1E6GA 4F7UA 4JJDA 4Y91A 2FO0A 4M77G 1GBQA 2JM8A 1OU8A 1G83A 1K8AU 2JTMA 2VXFA 3TVTA 1EX4A 2V26A 3J81E 3A98A 3GF5A 1N6AA 4M77E 1M2VB 2CSIA 2DTHA 2AHJB 3SWNC 2QTVA 3A5ZB 1RAIB 2GFAA 6AT1B 4AMCA 2XDPA 2EWNA 2F2VA 1I1JA 3LH5A 1KQ2A 3CCJQ 2CGHA 2DJZA 1PKSA 2HDAA 2ZPEB 4ZNXA 2DMOA 1BYMA 1AWWA 1YITQ 3QSUA 1D1AA 2VC8A 2D0NA 5EG2A 1OQKA 1NJIC 5D6YA 1VQ5Q 4JRKA 1VQLT 1I81A 3NTKA 3OMCA 2LDMA 2HQXA 1QP3A 2V8IA 2X35A 1QVPA 2ZPGB 3SB2A 1KJWA 3E9GA 4LDVA 3HSBA 2DXUA 2VVKA 2JMCA 5IXBA 4PJOG 4IURA 4XTVA 5FRNA 1YITA 3CMAA 3OYFA 2HEQA 2A3LA 5GMKj 2X3XD 1X6OA 2PQWA 4EMHA 3MKDA 1LOJA 3EG3A 4MMKA 4KH0B 4C8QG 3KXTA 1SHFA 3O8VA 4E7ZA 1WJQA 1H3HA 2KRSA 3RNJA 2DKGA 3OS1A 4J7FA 4LXCA 2LQ8A 1ZSZA 1U3OA 1AZGB 1NE8A 1ACMB 2HCKA 4EMKC 2QA4A 2VXEA 4M7AC 2O2OA 1VQ5A 2DL4A 2NUPA 1PWTA 3E19A 1OOTA 3I55Q 1Y71A 3VS5A 1WJRA 3URGA 1NLOC 3TSWA 1WXUA 4P5NA 1OULA 1ZUYA 1AVZC 2O31A 2ZPIB 2DETA 2E65A 1IREB 5GMKm 3GBQA 1MV0B 5IHKA 3CCSQ 2XHCA 2DX1A 1D1CA 1K9MR 4B6MA 1VQ4A 1F1BB 3NHNA 1ZA2B 4KRTA 1UJYA 2RQUA 3A8OB 4JJNK 1KC8C 4CI0C 2FVUA 1B7TA 2DXCA 3A8GB 1UE9A 1WHJA 1YHQT 1UGPB 4M7AF 2RK2A 3VS0A 4OMQA 4M78C 1M2OA 3RBBB 2HD0A 3G6EQ 3V8KA 4FSSA 4N4IA 2K9GA 4C8QF 2I2LA 4AG1C 1YJNT 1WHHA 3I55A 2Y4XA 4M75G 4PLLA 5CVIA 5GJVB 3OSVA 2P4RA 2AT1B 3QWYA 2DJQA 3PMTA 4GY5A 2RQTA 3VS7A 3EFRA 3CCUT 3I56A 1AHJB 2E5KA 2KRNA 4E2FB 1VQ4Q 4QKUA 1AWOA 1YITT 1VQMA 3LH0A 4ELYC 1BIBA 2L2PA 1G3SA 4KULA 3JCMf 1V76A 5KYYA 1PRLC 1HJDA 3JCMc 2EKHA 2XD0A 1RI9A 4RCCA 2SRCA 4M77B 4RTZA 2PUOB 1BB9A 2DIQA 3QXEB 4LUDA 1AD5A 1WGSA 4HCCA 1A0NB 1UHCA 1VQNT 3JCMe 2C06A 4RMOA 2EYYA 2MPXC 4NL2A 3QO3A 1AOJA 3M59A 2BTTA 4F14A 3CC7T 3CMEA 2WSFE 3JCMd 3I5SA 3FEOA 4MZTA 4A63B 5GAOp 1I4K1 1BU1A 3RMQA 4RTTA 3AT1B 2PVGB 3UA6A 1KC8R 1YJWQ 1IB8A 1Z9ZA 3VS6A 4HT9A 1BI1A 5A0DA 3OYNA 1I5OB 4IUTA 4C92D 4CC7A 4QVCA 1M3BA 2FHDA 4PJOB 2YRCA 3A1PA 1ABOA 1FXXA 5CKHA 4LNPA 2QGFB 3RKYA 1WQWA 2XICA 2KBTA 4QQDA 1G5VA 2CP0A 5LJ3f 3G71A 2CP6A 2DPPB 3OY9A 3JSCA 5CR2A 4QW2A 5GAMe 2D8HA 3UF4A 2OTJT 4M7DF 3UPUA 2QQAA 1YIJA 3KUFA 4FW1A 2PZ1A 1VQ8A 4C8QB 2ENMA 2RNAA 4RTWA 1ZSZC 4EMKB 2FPEA 4X34A 1WLPB 4FYYB 2G6FX 2MWPA 1BI3A 2YLCA 2J05A 2ED1A 4JLGA 2YRDA 3OYIA 4FT4A 5I11A 1KK7A 2JTEA 2ZPFB 1MNDA 1VQOQ 2RQVA 4RG2A 2X9HA 1QVFP 5D6XA 1QKWA 2EJ9A 1ZUKA 1VA7A 3CBOA 1N8RU 4C5EA 3JB9D 4IIMA 1AWJA 3EFSA 5FROA 1NEGA 2GFUA 3TU4K 4RTVA 3GNGA 2V8JA 5FU6B 5IT9E 2XI9A 5DLQE 4PJMA 3GNFB 1VQNA 2JTFA 1YN8A 4GBQA 2DL5A 2EYXA 2OI3A 4O6JA 2F1LA 1K0XA 3CBPA 4CC3A 1VQ7A 1EFNA 1M5Q1 1V29B 1RAHB 2J6FA 2HSEB 2MMPA 3CCMQ 2HMAA 1B34B 2DILA 4FCYA 2LC4A 2GGRA 4OMFB 4DQ2A 3EG0A 3H0IA 2BZ8A 5KYWA 2DBMA 4M77A 2KE9A 3OBYA 2G3RA 9ATCB 1Q86R 4WTOB 2EIFA 1VIEA 2VGNA 5ECAA 1PSFA 2KMTA 2PVOB 2NLUA 2NYSA 2JS2A 2LJ0A 3ME9A 1S1NA 1M8VA 1JJ2S 2AZSA 2OTLT 2M02A 2CP5A 2A08A 2F5KA 3G6EA 4OMMA 2KYBA 1HSQA 2P4TA 2Y4YA 3OW2P 2QQ9A 4XAXB 4N4HA 2COYA 4E7KA 3TCJA 1JBMA 1Q82U 3X26B 4DEXA 3JB9J 2L3RA 1WI7A 1OX9A 1OEBA 3T9NA 4QQ6A 4OB1B 2E3IA 2Y90A 2OAUA 2X4WA 2F2WA 2M51A
chains in the Genus database with same CATH topology
2PUKB 3LYIA 5KE2A 1VQ7T 4M7DG 1VQPA 1N8RC 3ASKA 5FU7C 4M7AG 3CBMA 2LQKA 5CO7A 5C0MA 4J7IA 5A0GA 5A0LA 2LCCA 5HKCA 3E9FA 4E7IA 5KH6A 3CMAT 2JOYA 2QQRA 3V7SA 3MHXA 3QDRB 4M78F 4LD9K 1D3BA 5A2QE 3QPHA 3CC2T 3CD6T 3BDLA 2M16A 4BB7A 4F7UA 1MGQA 4C8QA 2HQEA 4Y91A 1VIFA 3OYYA 3OW2S 2DTIA 2WSEE 3CC4A 4ME7A 3PT9A 2JVVA 3C12A 4BI8B 2QQSA 4Q5WA 1IZ6A 2EAYA 4M77G 4EDUA 5I2SA 5GAN4 1M1KU 2DD4A 5LJ3e 2DXBA 2RA2A 3WVEB 5CKBA 2JTMA 2VXFA 1K8AU 2EJGA 3J81E 4M7AB 3GF5A 5DLOA 2E5QA 2EJFA 1N6AA 4M77E 3S3NA 1QVGS 2DTHA 2AHJB 2R58A 3SWNC 3A5ZB 3RESA 2GFAA 4F7UG 1EIFA 5HK3A 1BI0A 2P0QA 2EWNA 2DXTA 2MI6A 2B8AA 2XDPA 4PLIA 3OS0A 2LNVA 3OA6A 4A4KA 3JB9H 2LRQA 4ZTFA 1KQ2A 1Y07A 3J7AF 4DOVA 3HRUA 2YHTA 4BY6C 2CGHA 2K57A 2DJZA 3MCAB 1XOVA 2ZPEB 3G6ET 2E64A 1OYXA 2CKKA 3OBWA 4XTYA 1BYMA 2R5MA 5LJ5g 1DJ7B 2WSCE 4C5IA 4BDYA 5DM7R 3CCJA 3QSUA 2VC8A 4OVAA 1K9MU 3CCEA 5EG2A 3VUZA 4F7UB 3GPLA 3L2RA 1NJIC 5D6YA 4JRKA 1VQLT 4IKFA 1I81A 3BW1A 3NTKA 3OMCA 3LGLA 2LDMA 2DIGA 2HQXA 2YLBA 5LJ3d 4C92G 1QP3A 2V8IA 2X35A 1QVPA 2ZPGB 3SB2A 3E9GA 3G4SA 4XTXA 4LDVA 3HSBA 2DXUA 2RHIA 1VQ9T 4PJOG 3M55A 1X01A 4IURA 4OB3B 1VUBA 3FB9A 4XTVA 2M9UA 4FSXA 5LJ3j 4C92E 4JS4A 3TREA 3QHSA 4HCBA 1YITA 5FRNA 3CMAA 4PJOC 3OYFA 1KD1C 1M4ZA 3BDUA 1U1TA 1Q81U 4J6XA 1UGSB 4M77D 2A3LA 3RKXA 3OYAA 5GMKj 4ZGEB 4E7JA 3HFOA 4MMLA 4JUVA 3RKWA 3WXMB 1X6OA 2K5FA 2PQWA 1X75C 4EMHA 3JB9G 1LNXA 2WACA 3OS5A 1LOJA 1ZHIA 5CCAA 4HA8A 4M7DE 3G71T 2E1HA 4MMKA 3GLXA 2E41A 3NTIA 1UB4A 2DVEA 3TEEA 5GAOl 3OYDA 4C8QG 3C94A 3M9QA 3KXTA 3O8VA 3QUIA 1WJQA 5LJ3g 3OYMA 2OTJA 4HKEA 3CXCA 5GANd 4HT8A 4F7UF 2FL7A 2CS7A 2DKGA 2KSSA 4Y28E 1UGQB 2F5TX 2RH2A 5DY9A 3OS1A 4J7FA 1OZ3A 2LQ8A 5GAMd 4EMKC 1NE8A 3CCMT 1K8AC 4MDXA 2QA4A 2FB7A 3PNWC 2VXEA 3JCMX 1ZQ1A 5LJ3h 3C4SA 4A4GA 5LJ5e 4M7AC 4JRQA 5I21A 1VQ5A 2L5QA 2DO3A 2EQJA 4PNOA 3JCMh 3E19A 3JCMP 1RL2A 2DTOA 4KT0E 1Y71A 4XU2A 3RIRA 4BUGA 2HBPA 1VQKA 3RERA 1WJRA 3URGA 5GANf 4P5NA 1U8RA 1K9MC 3QYHB 2FYKA 1VQOT 5CKEA 5GAN5 2EQKA 2ZPIB 3M57A 5KCOA 1Q86U 5CK9A 3UT1A 2E65A 1IREB 2RJDA 1UGRB 5GAN6 3OYEA 1BIAA 5GMKm 2M0OA 2RJEA 4XU0A 3PMIA 3EAEA 4C5HA 2XHCA 1VQOA 1KHIA 1KQSS 1QVFS 5GANh 4X9CA 1XQHA 3P8DA 1VQ4A 2X4YA 2KQWA 5GANe 1FWZA 2VGMA 3S3MA 2P0KA 4XTUA 5C6SA 3HRSA 3A8OB 4NS5A 1NPPA 1Y96A 3HKSA 4JJNK 2RI2A 1Q81C 5CAIA 2RI5A 1KC8C 4CI0C 2FVUA 1WQ7A 2DXCA 2ZGWA 3A8GB 2QQBA 2BUDA 4J6WA 3CPWS 4E7LA 2R57A 4OP0A 1VQ4T 3Q1JA 3M56A 2RK1A 1UGPB 1YHQT 2D6FA 2RK2A 4C8QE 4M7AF 4PJOA 3V8JA 3R6OA 4M78C 3L42A 3PGGA 3VYGA 4BI4A 5KCHA 3I55T 3CCMA 2HD0A 3FLGA 4LD6A 3V8KA 4N4IA 4GLKA 4NOYA 3M58A 5CKFA 4DA4A 4C8QF 3L2ZA 4A4FA 1YHQA 2XU8A 4BE0A 2CZ6B 2I2LA 4LDYA 2LT1A 2JN0A 3HL8A 2XDDA 3V7CA 1YJNT 3SWNA 1Q86C 3I55A 2Y4XA 4M75G 2PVDB 4O5VA 4XQ3A 1G3YA 3M4GA 2CZ0B 4PLLA 2EFIA 4M77F 5CVIA 1OI1A 3UDCA 4JS5A 3OSVA 2H3JA 2PU9B 3OYCA 3LX7A 3CCUA 3ZFJA 3CCET 3V7RA 4C92C 4LDUA 5CQXA 4DOWA 3PMTA 1YJNA 4GY5A 3GIBA 5GANg 1NPRA 2LTOA 2RHUA 3DLMA 4HCZA 2LVMA 3CPFA 4C0DB 4OB2B 3OB9A 4M78D 4NL3A 3EFRA 3A8MB 5LJ5j 3CCUT 1RI0A 1JB0E 3LWIA 4F7UE 3I56A 1M90C 4KUDK 4PKCC 1AHJB 5GAOn 5GAOq 2CYZB 4M75D 5FU7B 4M78A 4M75B 1YITT 1VQMA 1UEBA 2VUBA 3LH0A 3VYHB 4FL6A 4ELYC 1ZBXA 4J83A 3MEVA 3LWHA 3CCRA 5KE3A 1BIBA 1KHCA 4TVRA 1KG1A 3JB9I 1G3SA 3QYGB 4C8QD 4KULA 3JCMf 3JCMV 1BKBA 4BE2A 2K5LA 1W2BA 1O9SA 2GQVA 5IAYA 1YIJT 1JRIA 2MWOA 3QBYA 3CCLA 2O01E 3OMGA 3JCMc 4LDWA 2XD0A 3NFCA 5LL6S 4RCCA 3L1AA 4M77B 4C92F 2PUOB 4FM4B 3CPWA 4M7AE 3MP6A 4BDZA 4XTZA 3FRNA 2DIQA 4N0AA 3HP9A 4FU6A 3QXEB 4L5GA 4PJOF 2E10A 4B9WA 1WGSA 3OS2A 3CC7A 3CCLT 1WJSA 4FT2A 4IUUA 4HCCA 2LX9A 3QKJA 3RMSA 2P0PA 2RHZA 3CCVT 1VQNT 3JCMe 3V8LA 3X20B 3J80E 3QJYA 4BI3A 4RMOA 3CCQT 3QJ6A 4BE1A 2C06A 3HPWA 4X9DA 3AHUA 4NL2A 1R8OB 3QO3A 4RG8A 3M59A 3MEUA 4ZGJB 4BY6B 3CC7T 2MAMA 3CMEA 2WSFE 3JCMd 3M4YA 5M9OA 1MHNA 3A8HB 3BFMA 3FEOA 3QZ9B 4MZTA 5CIUA 5GAN2 5J39A 3WVDB 1Q7YU 2DEQA 2IVWA 3JCMb 5GAOp 1I4K1 4C5GA 2E70A 3X24B 3RMQA 4M7DB 2JUFA 1M1GA 3OYLA 3GP8A 3CMET 4M7DD 2PVGB 1QVGA 1VQLA 3LLRA 1VQ6A 2YRVA 1YJ9T 4C92A 4C0ZA 4XU1A 2RHXA 2ZCFB 4HT9A 1BI1A 1M1FA 3NTHA 5A0DA 2KDSA 5FLXE 3UWNA 2VV5A 4EMKA 5HK0A 3OYNA 3G4ST 2K3XA 4QQGA 1M90U 4IUTA 3JCMQ 5J26A 5D6WA 1VQ9A 5GANj 4C92D 4J5YA 4RKUE 4C92B 4QVCA 2HAXA 2QXFA 5FU6C 2GF7A 4II1A 3CC2A 3CD6A 2FHDA 4XK8E 2ZPBB 2QEXA 4PJOD 4PJOB 2XDBA 3L2WA 1PSEA 3HRTA 1FXXA 3ER0A 5CKHA 3HHTB 3GOXA 2JNGA 3RKYA 5AYFA 3H6ZA 4ZTJA 1WQWA 2XICA 2ZZDA 3F70A 2RJCA 1VQMT 2XG8D 4L6V5 4A4EA 2KY9A 4QQDA 3SWNB 1YJWA 1G5VA 5LJ3f 2K5IA 3G71A 2DPPB 1OZ2A 3OY9A 3QZ5B 3JSCA 3P8HA 3X25B 4A4HA 3QG1A 4QW2A 3VKIA 5CR2A 1YI2T 5GAMe 4MZMA 2DZ9A 4ZN3A 2EQMA 4A53A 3FJPA 3INZA 4PL6A 1N9SA 4EMGA 3UPUA 2D0QB 2JZ2A 2QQAA 1YIJA 3KUFA 3CXCS 4M7DF 1VQ8A 2MF2A 4C8QB 3FC3A 3MO8A 5HY6A 3JCMW 1YI2A 4OB0B 1HK9A 1BI2A 5GMKe 4YTLA 2QA4T 4CRIA 1KC8U 4M77C 4EMKB 1VQ5T 1HXDA 4IUQA 4X34A 3BY7A 2O4XA 3ZBDA 2KAFA 2EQUA 3DB4A 3CCVA 1YCYA 2MWPA 3L2UA 3CCQA 4IUPA 1BI3A 2YLCA 1Q7YC 4E7HA 1VQKT 1N9RA 2CZ1B 4JLGA 4JRIA 2LCLA 4UC4A 3DKMA 3HFNA 3OYIA 4FT4A 4A54A 2R5AA 2X4JA 3M5AA 3P8BB 2LT4A 3KBGA 2ZPFB 3DLLA 3L2QA 4RG2A 2E12A 5GMKh 3OQ5A 4KUIA 3CCRT 2BIVA 4M75F 4JDSA 4J8OA 5D6XA 2EYQA 1TH7A 1SSFA 3M54A 2OTLA 1KQSA 2EJ9A 1S72T 4J6YA 2DK3A 4LDXA 2RM4A 4XTWA 3OW2A 4M7AD 3VU3C 3CBOA 3S6WA 1N8RU 4WF2A 4C5EA 3LW5E 2QI2A 3JB9D 3JCMg 5GAMj 5GAOr 2F69A 1S72A 2RHYA 3DB3A 3EFSA 2K2VA 5FROA 1WNLA 2DZCA 3MEWA 1K73C 2RJFA 2GFUA 3VV0A 1KD1U 3TU4K 3JCMJ 3E1SA 2A7YA 5GAMg 3GNGA 2V8JA 5FU6B 5IT9E 3OYHA 2XI9A 2X4XA 2XIDA 2IG0A 3A8LB 3GNFB 5DLQE 1VQNA 2JTFA 1NZ9A 5FRMA 4MDWA 3C95A 1W4SA 5GAN3 3OSSC 3ZEHA 3CCSA 2HNIA 1Q82C 4C0GA 2EKOA 1KQ1A 1Y7XA 1YBYA 2DD5A 4RCBA 4R56A 4O6JA 4M7DA 3RUXA 2XK0A 4MZPA 5CQYA 5CKDA 1YJWT 4Z02A 3CEYA 1B34A 5I2MA 1W2BS 4M7AA 5L8RE 4ZGDB 2V8KA 3CBPA 3OYJA 1VQ7A 1M5Q1 1QVFA 1V29B 2K4YA 2L89A 1VQPT 3CCST 3M53A 5GAN7 4ZN1A 5LJ5f 3N5BB 5GAOm 2MMPA 1GXIE 3OYKA 1VQ8T 1VQ6T 1B34B 1YJ9A 2LC4A 4M78E 4KBMB 4C8QC 1O75A 3CCJT 2RO0A 1H3ZA 4OMFB 4DQ2A 4IUVA 3JB9F 1JJ2A 3I56T 4M78G 3MP8A 3MP1A 5IN1A 3CC4T 4M75E 4B9XA 1M1KC 4M77A 3X28B 2E6ZA 1K73U 1P92A 3PFSA 2QDYB 3OBYA 3MEAA 2QTXA 2G3RA 2RB6A 1U1SA 5J3BA 2QEXT 2EIFA 4M75C 4N4GA 1VIEA 2VGNA 1M9SA 3LGFA 2CZ7B 4R55A 1NJIU 2L8DA 3H8ZA 3PTAA 3QIIA 4VUBA 1PSFA 2E6NA 2KMTA 2NLUA 2PVOB 3VJPA 5LJ5d 4EPCA 2OTJT 1I5LA 1H641 3ME9A 5GAN8 5GAMh 3L2VA 1WPYA 1LJOA 2D9TA 1M8VA 3FIFA 4N0AC 2BKDN 1JJ2S 1G3TA 2XKOC 4V2SA 4JRPA 2OTLT 4M78B 5GAMf 2KVQG 5GMKi 3VUBA 1XTDA 2DAQA 2F5KA 3G6EA 2Y4YA 2P4TA 1Y96B 3G7ZA 3FDRA 2QQ9A 4XAXB 2RD1A 2O4XB 4OF1A 3PIPA 4N4HA 1FX7A 3SD4A 3OYGA 4QVDA 1QW1A 4L59A 2K3YA 4E7KA 2KK4A 4OGEA 3TCJA 3PIOA 4BACA 1I8FA 1JBMA 4JLIA 1Q82U 4PJOE 4FIBA 3OYBA 1G3WA 4XU3A 3S3OA 3META 3X26B 3JRZA 3SFMA 4QVZA 2ZPHB 1XNIA 2RI3A 4M75A 4BD3A 3JB9J 2L3RA 2M1HA 4C0FA 4D6WA 4ATOA 1N27A 4C0DC 3T9NA 4QQ6A 4OB1B 4OGCA 2VYTA 4ELZC 5GMKl 2Y90A 2OAUA 2X4WA 4E47A 1QP2A 3JAME 2GCXA 4M7DC 5LJ5h 3SDZA 1D3BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A E;  2FB7 A;  4XTZ A;  2VXE A;  3JCM X;  5LJ3 h;  4M7A C;  4M7D G;  5LJ5 e;  2RM4 A;  4N0A A;  4XTW A;  4M7A D;  3VU3 C;  5I21 A;  4PJO F;  2E10 A;  4M7A G;  4WF2 A;  4PNO A;  3JCM h;  3JB9 D;  3JCM P;  3JCM g;  5GAM j;  5GAO r;  2DTO A;  3V7S A;  3JCM e;  3V8L A;  4M78 F;  4XU2 A;  3RIR A;  3EFS A;  1D3B A;  1WNL A;  2DZC A;  3RER A;  3AHU A;  4X9D A;  4NL2 A;  3QO3 A;  5GAN f;  3JCM J;  4F7U A;  1MGQ A;  2FYK A;  4C8Q A;  5GAM g;  4Y91 A;  3JCM d;  5GAN 5;  2DTI A;  3BFM A;  4J6Y A;  5GAN 2;  5GAN 3;  2DEQ A;  2E65 A;  5GAN 6;  3JCM b;  5GAN j;  2EAY A;  1BIA A;  2HNI A;  4M77 G;  1I4K 1;  5GMK m;  5GAN 4;  1KQ1 A;  5GAO p;  4RCB A;  4XU0 A;  5LJ3 e;  4M7D B;  2RA2 A;  4M7D A;  4M7D D;  2VXF A;  3RUX A;  2EJG A;  4M7A B;  5GAN h;  1B34 A;  2EJF A;  4M77 E;  4M7A A;  4X9C A;  4C92 A;  2DTH A;  3SWN C;  1M5Q 1;  4XU1 A;  3RES A;  5GAN e;  4F7U G;  4HT9 A;  4XTU A;  2EWN A;  2DXT A;  5GAN 7;  5LJ5 f;  1Y96 A;  4EMK A;  3JB9 H;  5GAO m;  5CAI A;  3JCM Q;  1KQ2 A;  1WQ7 A;  1B34 B;  2ZGW A;  4J5Y A;  4J6W A;  4C92 D;  2YHT A;  4M78 E;  4C92 B;  4EMK C;  4OP0 A;  4QVC A;  2CGH A;  4C8Q C;  2K57 A;  2DJZ A;  4M7A F;  4DQ2 A;  4C8Q E;  4PJO D;  4PJO A;  3V8J A;  4PJO B;  4M78 C;  3JB9 F;  3PGG A;  2E64 A;  4M78 G;  5GAM d;  4XTY A;  4M75 E;  4M77 A;  3RKY A;  3V8K A;  4NOY A;  5LJ5 g;  1WQW A;  4C8Q F;  3L2Z A;  3QSU A;  2QTX A;  2RB6 A;  2VC8 A;  1U1S A;  2I2L A;  4F7U B;  2JN0 A;  3SWN B;  4M75 C;  3V7C A;  5LJ3 f;  3SWN A;  4JRK A;  1I81 A;  4M75 G;  3BW1 A;  4XQ3 A;  3M4G A;  4M77 F;  5LJ5 d;  5GAM e;  1I5L A;  2YLB A;  5LJ3 d;  1H64 1;  2DZ9 A;  4C92 G;  4A53 A;  5GAN 8;  3FJP A;  3INZ A;  3SB2 A;  1N9S A;  3V7R A;  4EMG A;  4XTX A;  4C92 C;  5GAM h;  3HSB A;  1WPY A;  1LJO A;  4M7D F;  2DXU A;  4C8Q B;  1M8V A;  3FIF A;  4PJO G;  3GIB A;  1X01 A;  4N0A C;  5GAN g;  3FB9 A;  4V2S A;  4XTV A;  5LJ3 j;  3JCM W;  4PJO C;  4M78 B;  4C92 E;  5GAM f;  3QHS A;  5GMK i;  1HK9 A;  4M78 D;  5GMK e;  4NL3 A;  3EFR A;  5LJ5 j;  3BDU A;  4F7U E;  1U1T A;  4M77 C;  1Y96 B;  4J6X A;  4EMK B;  4M77 D;  1HXD A;  3RKX A;  3BY7 A;  5GAO n;  5GAO q;  2RD1 A;  5GMK j;  4M75 D;  3HFO A;  4MML A;  4JUV A;  4M75 B;  1YCY A;  4M78 A;  3RKW A;  4QVD A;  4EMH A;  4M7D C;  2YLC A;  3JB9 G;  1LNX A;  1N9R A;  4JRI A;  4PJO E;  1I8F A;  1JBM A;  1LOJ A;  3HFN A;  4JLI A;  4HA8 A;  1BIB A;  4M7D E;  2E1H A;  4MMK A;  4A54 A;  2E41 A;  2DVE A;  4XU3 A;  5GAO l;  3JB9 I;  4M77 B;  4C8Q G;  4C8Q D;  3QUI A;  4M75 A;  3JCM V;  3JCM f;  3JB9 J;  5LJ3 g;  5GMK h;  5GAN d;  4HT8 A;  4F7U F;  1JRI A;  4M75 F;  2DKG A;  3JCM c;  5GMK l;  1TH7 A;  5DY9 A;  2Y90 A;  4RCC A;  3L1A A;  2EJ9 A;  5LJ5 h;  4C92 F;  1D3B B; 
#chains in the Genus database with same CATH topology
 2K6D A;  3LYI A;  3SEM A;  1WHL A;  5FU7 C;  3CBM A;  5C0M A;  4LUE A;  3VRZ A;  5A0L A;  2LCC A;  5KH6 A;  2QQR A;  3V7S A;  4J9E A;  4DEY A;  1RAA B;  4LD9 K;  5A2Q E;  1M30 A;  3CC2 T;  3CD6 T;  2M16 A;  2CH4 A;  2GTJ A;  4C8Q A;  1I0C A;  1VIF A;  1V1C A;  3CC4 A;  2JVV A;  2QA4 Q;  2QQS A;  4FYW B;  4EDU A;  3EHQ A;  5GAN 4;  5LJ3 e;  2DXB A;  2RA2 A;  3WVE B;  1G2B A;  1JXO A;  5DLO A;  2E5Q A;  2R58 A;  4PJN A;  4F7U G;  4ANJ A;  5IHN A;  3OS0 A;  4HVU A;  3JB9 H;  4OMN A;  3J7A F;  4DOV A;  2AKK A;  5KYX B;  2E64 A;  1OYX A;  1ZA1 B;  3OBW A;  1ZSZ B;  2FZK B;  8AT1 B;  1DJ7 B;  4C5I A;  2LCS A;  1IGQ A;  3VUZ A;  3GPL A;  4ORZ A;  2VB6 A;  4IKF A;  3EFO A;  2NWM A;  1VQN Q;  2DIG A;  2YLB A;  4C92 G;  1H8K A;  1Y57 A;  3G4S A;  3TSZ A;  3H9N A;  1VQ9 T;  3M55 A;  1NBE B;  4OB3 B;  1PD1 A;  5LJ3 j;  1QMC A;  3QDF A;  4FSX A;  4JS4 A;  1AEY A;  1RLQ C;  1U1T A;  2CRE A;  1IGU A;  1OPK A;  1OU9 A;  4HCK A;  4ZGE B;  4E7J A;  4MML A;  4JUV A;  3WXM B;  1KIK A;  1D0Y A;  3JB9 G;  1LNX A;  1WYX A;  5CCA A;  2RF0 A;  4HA8 A;  2E41 A;  3TEE A;  1Q82 R;  3M9Q A;  3QUI A;  1VQM Q;  3OYM A;  4HKE A;  3CXC A;  3M0U A;  4F7U F;  2O9V A;  2HKN A;  2AZV A;  1QKX A;  2YXY A;  3RDV A;  5GAM d;  3PNW C;  3EGX A;  2FZG B;  2L5Q A;  1HYO A;  2EQJ A;  1QLY A;  4PNO A;  4RUG A;  1S72 Q;  1RL2 A;  2DTO A;  2ROT A;  4KT0 E;  2YUO A;  1VQK A;  5GAN f;  1PD0 A;  3QYH B;  1UDL A;  1VQ7 Q;  1QVG P;  5KCO A;  3M57 A;  1Q86 U;  2LJ1 A;  2OJ2 A;  1UTI A;  2FRY A;  2RMO A;  1BIA A;  2M0O A;  2RJE A;  3PMI A;  4C5H A;  2RPN A;  1KQS S;  1QVF S;  5GAN h;  3CPW P;  1XQH A;  2KQW A;  5GAN e;  4AFS C;  1FWZ A;  5C6S A;  1UHF A;  1R0B G;  2RI2 A;  2BZY A;  3CCV Q;  2LMJ A;  1Q81 C;  4F17 A;  4E7L A;  4J6W A;  1VQ4 T;  3M56 A;  2RK1 A;  3CCE Q;  4PJO A;  1UEC A;  3CCM A;  5CKF A;  2LP5 A;  3L2Z A;  1YHQ A;  3HL8 A;  1JU5 C;  3SWN A;  3EG1 A;  3OYC A;  3LX7 A;  5CQX A;  4DOW A;  1YJN A;  5GAN g;  1NPR A;  2RHU A;  3CPF A;  3OB9 A;  4NL3 A;  3M0Q A;  1JB0 E;  1IHW A;  1YJN Q;  2GTO A;  2P84 A;  5GAO n;  5GAO q;  2CYZ B;  2H8H A;  5FU7 B;  2OTJ Q;  4M78 A;  4M75 B;  1OX8 A;  1UEB A;  1ZBX A;  3LWH A;  5KE3 A;  1KHC A;  4J9F A;  1KG1 A;  2A36 A;  2M0Y A;  3JB9 I;  4C8Q D;  3JCM V;  1BKB A;  4ESR A;  5IAY A;  1JRI A;  1NYG A;  1SG5 A;  4LDW A;  3NFC A;  3VRY A;  3L1A A;  2V1R A;  4M7A E;  3MP6 A;  4XTZ A;  3FRN A;  1GFC A;  2CSQ A;  2JS0 A;  3MPU B;  3HP9 A;  4L5G A;  3OS2 A;  1WJS A;  4FT2 A;  1ZSG A;  3CCV T;  2RHZ A;  1JEG A;  2K7A A;  3V8L A;  3CCQ T;  4BE1 A;  2JM9 A;  3D7S B;  1MHN A;  3A8H B;  2L3S A;  3BFM A;  5CIU A;  5GAN 2;  3WVD B;  5D7U A;  2IVW A;  1ZX6 A;  4C5G A;  3X24 B;  4M7D B;  3CME T;  3ULR B;  1VQL A;  3LLR A;  1YWP A;  1VQ6 A;  1YJ9 T;  1CSK A;  4C0Z A;  4XU1 A;  2RHX A;  2EGA A;  2CDT A;  1UFF A;  5HK0 A;  2VV5 A;  4EMK A;  4QQG A;  2DM1 A;  3JCM Q;  1M90 U;  4RKU E;  4C92 B;  2HAX A;  2QXF A;  5FU6 C;  3ER0 A;  3GOX A;  5AYF A;  3F70 A;  4A4E A;  1YJW A;  3THK A;  2FRW A;  3QG1 A;  3VKI A;  3EHR A;  7AT1 B;  1VQL Q;  4A53 A;  1N9S A;  2HKQ B;  4EMG A;  4FW2 A;  3CXC S;  1D0Z A;  3MO8 A;  4PJJ A;  4OB0 B;  5GJW B;  1HK9 A;  1RUW A;  4YTL A;  2QA4 T;  1KC8 U;  2DEU A;  1VQ5 T;  1IRX A;  4GLM A;  2VWF A;  3BY7 A;  1TXQ A;  2O4X A;  2CZ1 B;  1QWE A;  3HFN A;  1YWO A;  2LT4 A;  3L2Q A;  2E12 A;  1GCQ A;  2BIV A;  4J8O A;  2QG9 B;  2EYQ A;  1Q7Y R;  1J3T A;  1KQS A;  1S72 T;  3FJ5 A;  1D0X A;  1NYF A;  1H92 A;  2RQW A;  4AG2 C;  4WF2 A;  3LW5 E;  2QI2 A;  3JCM g;  2ABL A;  3DB3 A;  1WNL A;  2A0F B;  2EGE A;  3MEW A;  3VV0 A;  4JPB W;  3E1S A;  2A7Y A;  4AT1 B;  4OML A;  2YUN A;  5GAM g;  3OYH A;  2XID A;  3CC7 Q;  2D1X A;  3C95 A;  2DE0 X;  3OSS C;  3ZEH A;  3CC4 Q;  4C0G A;  2EKO A;  1KQ1 A;  2KT1 A;  2DD5 A;  4R56 A;  4M7D A;  3RUX A;  4MZP A;  5CKD A;  1IO6 A;  2CT3 A;  4M7A A;  3OYJ A;  2V8K A;  1QVF A;  2L89 A;  1VQ6 Q;  1AZE A;  3M53 A;  5LJ5 f;  5GAO m;  2EGC A;  1GXI E;  1VQ6 T;  2MIO A;  1W2B P;  1YJ9 A;  2JJ9 A;  4C8Q C;  1H3Z A;  2RO0 A;  4F04 B;  1TUC A;  3I56 T;  2IIM A;  3MP8 A;  1M1K C;  4B9X A;  3X28 B;  1MMD A;  2E6Z A;  2BE7 D;  4N4G A;  1NJI U;  3PTA A;  4LE9 A;  2QAZ A;  5LJ5 d;  3VJP A;  1H64 1;  1WPY A;  1PM3 A;  4AFU C;  4JRP A;  5GAM f;  2JMA A;  3EGU A;  3FDR A;  3M0R A;  4J9G A;  2O4X B;  4OF1 A;  2EYZ A;  2K3Y A;  2KK4 A;  3PIO A;  2PNI A;  3G4S Q;  3VS3 A;  1I07 A;  4FIB A;  1G3W A;  4XU3 A;  5FW9 A;  2CT4 A;  3S3O A;  3JRZ A;  3SFM A;  5L23 A;  1ARK A;  3IQL A;  3CD6 Q;  4C0D C;  4JJB A;  2RN8 A;  4KH1 B;  3JAM E;  2GCX A;  2EYW A;  2EBP A;  3CMA T;  4M7D G;  1VQP A;  2KXD A;  3ASK A;  3E2U A;  4M7A G;  1UJ0 A;  4J7I A;  1VYU A;  3MHX A;  1GL5 A;  1EZZ B;  1MGQ A;  2VKN A;  3OW2 S;  2FPD A;  3CME Q;  3PT9 A;  2H3E B;  4BI8 B;  4OMP A;  1M8M A;  5I2S A;  2ED0 A;  1M1K U;  2DD4 A;  2EJG A;  1VQ9 Q;  2EJF A;  4HXJ A;  3S3N A;  2ROL A;  3RES A;  2L3Q A;  1BI0 A;  2P0Q A;  2MI6 A;  4PLI A;  2CP7 A;  3EG2 A;  2LZ6 B;  4ZTF A;  3HRU A;  3PVL A;  2YHT A;  1XOV A;  3G71 Q;  2CKK A;  4BDY A;  1N5Z A;  2WSC E;  5DM7 R;  4OVA A;  1BBZ A;  3CCE A;  4F7U B;  4Z88 A;  3L2R A;  3RR6 A;  3BW1 A;  1GCQ C;  3LGL A;  1AWX A;  1C1A A;  1WX6 A;  3REB B;  2RHI A;  2DYI A;  1JQQ A;  2AKL A;  1VUB A;  2M9U A;  4PJO C;  4C92 E;  4HCB A;  3TRE A;  4AFQ C;  2FG0 A;  4K11 A;  3BDU A;  1M27 C;  1ZBJ A;  1Q81 U;  4J6X A;  1UGS B;  1E6H A;  3RKX A;  3EH2 A;  3H0H A;  3RKW A;  3U23 A;  4FYX B;  2B86 A;  2WAC A;  3OS5 A;  1YNZ A;  1QCF A;  4M7D E;  3GLX A;  1UB4 A;  1NLP C;  3CCR Q;  3C94 A;  3M0P A;  1W1F A;  3EGD B;  5KYY B;  2CS7 A;  1UGQ B;  1OZ3 A;  4MDX A;  2FB7 A;  3JCM X;  3R6N A;  5LJ5 e;  1W70 A;  2ZAE A;  1C6V X;  3JCM h;  3JCM P;  3H41 A;  1BCM A;  4XU2 A;  3RER A;  1U8R A;  1K9M C;  2MCN A;  1PCX A;  2FYK A;  1VQO T;  4HVV A;  2KT8 A;  2DNU A;  3UT1 A;  3OYE A;  1UGR B;  4XU0 A;  3EAE A;  2KRO A;  1KHI A;  2DA9 A;  5I22 A;  1XJW B;  1ABQ A;  1N8R R;  3M0S A;  2HL5 C;  2VGM A;  2P0K A;  4XTU A;  4OMO A;  3HRS A;  1NPP A;  1Y96 A;  3HKS A;  1X6G A;  1WQ7 A;  2QYZ A;  2BUD A;  4OP0 A;  3Q1J A;  4JZ3 A;  3O5Z A;  2D6F A;  4C8Q E;  3H0F A;  4BI4 A;  5KCH A;  3FLG A;  1SSH A;  4GLK A;  4DA4 A;  2GQI A;  4A4F A;  2XU8 A;  4BE0 A;  2LT1 A;  2IPO B;  3V7C A;  1Q86 C;  3CCM T;  4XQ3 A;  3M4G A;  4M77 F;  8ATC B;  2KRM A;  2H3J A;  2PU9 B;  3CCE T;  3V7R A;  4C92 C;  4LDU A;  1ZUU A;  1Q95 G;  2HQH A;  4WCI A;  4C0D B;  4HCZ A;  4OB2 B;  4M78 D;  5LJ5 j;  1RI0 A;  1TSF A;  4F7U E;  1M90 C;  4KUD K;  2A37 A;  4PKC C;  1MV3 A;  4M75 D;  4FL6 A;  3MEV A;  1TUG B;  1MMG A;  3QYG B;  1Q81 R;  1M90 R;  1JO8 A;  4BE2 A;  2K5L A;  1W2B A;  2GQV A;  1YIJ T;  3EGD A;  2MWO A;  3QBY A;  3CCL A;  2DVJ A;  5LL6 S;  1IXD A;  4FM4 B;  4Z8A A;  4BDZ A;  1LPL A;  4N0A A;  4B9W A;  4PJO F;  2E10 A;  1K1Z A;  4IUU A;  2LX9 A;  2BZX A;  3QKJ A;  3X20 B;  3QJY A;  4BI3 A;  1PC0 A;  3QJ6 A;  3AHU A;  2DYB A;  4RG8 A;  2MAM A;  2CUD A;  3C0C A;  2C0O A;  5IHI A;  5M9O A;  1K76 A;  3NPF A;  3QZ9 B;  5J39 A;  2DEQ A;  3JCM b;  1MMA A;  1BCO A;  4J9I A;  2JUF A;  2YSQ A;  1QWF A;  1QVG A;  2YRV A;  2ZCF B;  4DBQ A;  1M1F A;  2OAW A;  5FLX E;  3UWN A;  3G4S T;  1SF9 A;  5D6W A;  1VQ9 A;  1MUZ A;  5EC7 A;  3UAT A;  4XK8 E;  2ZPB B;  2QEX A;  2QK0 A;  1PSE A;  3HRT A;  2DLP A;  2COW A;  2I0N A;  2JNG A;  5FWC A;  1B07 A;  2ZZD A;  2RJC A;  1VQM T;  4L6V 5;  2KY9 A;  2ATC B;  2K5I A;  3KFV A;  2L3P A;  2LX7 A;  2YWW A;  3QZ5 B;  3X25 B;  1YI2 T;  3VS1 A;  1SRM A;  2CP2 A;  2DZ9 A;  4ZN3 A;  2EQM A;  4M4Z A;  3FJP A;  1SPK A;  3INZ A;  1RLP C;  3FC3 A;  5HY6 A;  2CP3 A;  3TQ7 P;  2HBW A;  5GMK e;  5HCK A;  4CRI A;  4KGZ B;  4IUQ A;  5KYU B;  3ZBD A;  2EQU A;  4E7H A;  1VQK T;  4JRI A;  2LCL A;  4A54 A;  3M5A A;  4QT7 A;  4M75 F;  4JDS A;  2DER A;  2RQR A;  1TH7 A;  2J7I A;  3M54 A;  2OTL A;  1NM7 A;  4J6Y A;  4XTW A;  3OW2 A;  3S6W A;  2FPF A;  2KXC A;  1T3S A;  2JXB A;  5GAO r;  1S72 A;  2K2V A;  1WXT A;  2EQI A;  1K9A A;  4IIO A;  2VAS A;  4FYV B;  2IG0 A;  3A8L B;  1WIE A;  1NZ9 A;  5FRM A;  4MDW A;  1W4S A;  4J9H A;  5GAN 3;  2QGG A;  3CCS A;  2LNH B;  1Q82 C;  2DFU A;  1Y7X A;  1IHV A;  4PFO A;  2F2X A;  2XK0 A;  5CQY A;  1YJ9 Q;  1PRM C;  3CEY A;  1B34 A;  4Z02 A;  5I2M A;  3VS2 A;  2DL8 A;  5L8R E;  4ZGD B;  1W2B S;  1VQ8 Q;  5GAN 7;  4ZN1 A;  3N5B B;  3OYK A;  1VQ8 T;  1QQJ A;  1O75 A;  3CCJ T;  3PE0 A;  4IUV A;  4RTY A;  1K0S A;  1JJ2 A;  5KYX A;  2DRK A;  4M78 G;  2LJ3 A;  3MP1 A;  5IN1 A;  3CC4 T;  4J9B A;  2NUT B;  3PFS A;  3CQT A;  2QTX A;  2RB6 A;  5J3B A;  2QEX T;  2SEM A;  1GCP A;  1M9S A;  2CZ7 B;  3H8Z A;  3QII A;  4VUB A;  2E6N A;  1KFZ A;  2DRM A;  1TTH B;  5GAN 8;  5GAM h;  3L2V A;  1LJO A;  1MMN A;  1PHT A;  3FIF A;  4N0A C;  2XKO C;  1M1K R;  2KVQ G;  3VUB A;  1UG1 A;  1X27 A;  1XTD A;  2DAQ A;  2MOX A;  2GNC A;  3I9Q A;  3G7Z A;  1RAE B;  3PIP A;  1JJ2 P;  3SD4 A;  3M0T A;  2V1Q A;  3OYG A;  1QW1 A;  4L59 A;  2Z0W A;  3I35 A;  1I8F A;  4JLI A;  3I56 Q;  4AFZ C;  1VOM A;  4JZ4 A;  3OYB A;  1OPL A;  3MET A;  4QVZ A;  1XNI A;  4M75 A;  4BD3 A;  2M1H A;  4C0F A;  4ATO A;  3QWX X;  2VYT A;  4ELZ C;  4KGV B;  2E4H A;  4E47 A;  1QP2 A;  3SDZ A;  1WHM A;  2PUK B;  1VQ7 T;  1N8R C;  3EFO B;  1U5S A;  4M78 F;  1K8A R;  1D3B A;  1GFD A;  4BB7 A;  2HQE A;  3OYY A;  2DTI A;  2WSE E;  3EG9 B;  1PKT A;  4ME7 A;  3CMA Q;  3C12 A;  4Q5W A;  1IZ6 A;  2EAY A;  5CKB A;  1PG5 B;  4M7A B;  1QVG S;  5FWB A;  1EIF A;  5HK3 A;  1QCN A;  1NJI R;  2DXT A;  2B8A A;  3OA6 A;  2LNV A;  4A4K A;  2LRQ A;  2MYS A;  2KYM A;  1Y07 A;  2BE9 B;  1M2V A;  4BY6 C;  2K57 A;  1SKU B;  3MCA B;  3G6E T;  4XTY A;  2QAS A;  1X2Q A;  2R5M A;  5LJ5 g;  1U06 A;  3CCJ A;  1K9M U;  3PVQ A;  1FMK A;  5LJ3 d;  1VYT A;  4XTX A;  1NG2 A;  2MK5 A;  2O9S A;  2ESW A;  1X01 A;  3FB9 A;  4E7S A;  3QHS A;  1CKB A;  1KD1 C;  1M4Z A;  4CC4 B;  1WFW A;  1YFN A;  4M77 D;  3CCL Q;  3OYA A;  1D09 B;  3HFO A;  2K5F A;  1X75 C;  1ZHI A;  4DBH A;  2CUB A;  3G71 T;  2E1H A;  3NTI A;  2DVE A;  5GAO l;  3OYD A;  1FMW A;  3EH1 A;  1X69 A;  5LJ3 g;  2OTJ A;  4LN2 A;  5GAN d;  4HT8 A;  1WZO A;  2FL7 A;  2KSS A;  4Y28 E;  2F5T X;  2RH2 A;  5DY9 A;  1B3Q A;  2YDL A;  1K8A C;  4D8K A;  1ZQ1 A;  5LJ3 h;  3C4S A;  4A4G A;  5IXF A;  4JRQ A;  5I21 A;  2DO3 A;  1FMV A;  3ZL7 C;  2AK5 A;  4BUG A;  3RIR A;  2HBP A;  1R0C B;  4PK4 A;  2YUQ A;  1K73 R;  5CKE A;  5KYU A;  5GAN 5;  2EQK A;  5CK9 A;  2EVR A;  2RJD A;  5GAN 6;  2K79 A;  1VQO A;  2E3H A;  3CXC P;  4X9C A;  3UA7 A;  2OX7 A;  3P8D A;  2X4Y A;  4CC2 A;  1YCS B;  3S3M A;  4NS5 A;  2KR3 A;  5CAI A;  2RI5 A;  2ZGW A;  4J9C A;  2QQB A;  3CPW S;  2R57 A;  1E7O A;  3EGX B;  3V8J A;  3R6O A;  3L42 A;  3PGG A;  3VYG A;  3I55 T;  1BK2 A;  4LD6 A;  2OTL Q;  4NOY A;  3M58 A;  2W0Z A;  4JJC A;  2CZ6 B;  4LDY A;  2HSP A;  2JN0 A;  1UGV A;  2GBQ A;  2XDD A;  2QDL A;  2KEA A;  2PVD B;  2NUZ A;  4O5V A;  1G3Y A;  2CZ0 B;  2EFI A;  2D8J A;  1OI1 A;  3UDC A;  4JS5 A;  2O88 A;  2HL3 A;  3CCU A;  3ZFJ A;  2A28 A;  3GIB A;  3EG9 A;  1GBR A;  2LTO A;  3DLM A;  2LVM A;  2EW3 A;  3A8M B;  2C0I A;  2YT6 A;  3LWI A;  1JXM A;  1SHG A;  5KYN A;  2LQW A;  1SEM A;  1RAB B;  1PNJ A;  4F16 A;  2VUB A;  3VYH B;  4J83 A;  3CCR A;  4TVR A;  2J06 A;  3REA B;  1WDX A;  1O9S A;  1TWB A;  2O01 E;  3OMG A;  1FYN A;  2DF6 A;  4X1V A;  1VQK Q;  4C92 F;  3CPW A;  4FU6 A;  3BE3 A;  3CC7 A;  3CCL T;  3CC2 Q;  3RMS A;  1G8X A;  2P0P A;  2DL3 A;  3J80 E;  1TU0 B;  1D1B A;  3HPW A;  4X9D A;  1R8O B;  1C0M A;  3MEU A;  4ZGJ B;  4BY6 B;  4J9D A;  3M4Y A;  1Y0M A;  1HD3 A;  2CH4 W;  4HVW A;  1Z9Q A;  1Q7Y U;  1YI2 Q;  3NGP A;  2E70 A;  1M1G A;  3OYL A;  3GP8 A;  4M7D D;  1YHQ Q;  1T0H A;  1WHG A;  1ZLM A;  1T3L A;  4C92 A;  2FZC B;  1R77 A;  3NTH A;  2KDS A;  5AT1 B;  2C0T A;  2K3X A;  5J26 A;  1LVK A;  5GAN j;  4J5Y A;  2KGT A;  2L0A A;  2GF7 A;  4II1 A;  3CC2 A;  3CD6 A;  4RTU A;  4PJO D;  1MNE A;  2XDB A;  1X43 A;  3L2W A;  1VYV A;  3HHT B;  1M3C A;  3H6Z A;  4ZTJ A;  3SHW A;  2X51 A;  2XG8 D;  1X2K A;  3SWN B;  1UUE A;  1CKA A;  1OZ2 A;  3P8H A;  1RAG B;  2AIR B;  3HTR A;  4A4H A;  4KGX B;  2LQN A;  4MZM A;  4PL6 A;  1KQS P;  2D0Q B;  2JZ2 A;  2MF2 A;  3JV3 A;  3VS4 A;  3JCM W;  4EIK A;  1YI2 A;  1KD1 R;  1BI2 A;  4D8D A;  2DBK A;  4DBF A;  2K2M A;  4M77 C;  1LCK A;  1HXD A;  1QCO A;  2KAF A;  3DB4 A;  3CCV A;  1SRL A;  1YCY A;  3L2U A;  3CCQ A;  4IUP A;  1Q7Y C;  1N9R A;  4UC4 A;  3DKM A;  2R5A A;  2X4J A;  2JW4 A;  3P8B B;  3KBG A;  4E6R A;  3DLL A;  5GMK h;  3OQ5 A;  4KUI A;  4DBR A;  3CCR T;  2NUP B;  1SSF A;  2NUT A;  2DK3 A;  4LDX A;  2W10 A;  2HZY A;  2RM4 A;  4M7A D;  1WA7 A;  3VU3 C;  2J6O A;  1RAC B;  1GRI A;  5GAM j;  2F69 A;  2RHY A;  1T0J A;  2DZC A;  1K4U S;  1K73 C;  2RJF A;  2XMF A;  1KD1 U;  3JCM J;  4R0K A;  2X4X A;  2HNI A;  3MJX A;  1YBY A;  4RCB A;  1YJW T;  1AT1 B;  2K4Y A;  1WXB A;  1VQP T;  3CCS T;  1M3A A;  2KNB B;  5IH2 A;  1TG0 A;  1VQP Q;  4M78 E;  4KBM B;  4Z89 A;  3JB9 F;  4M75 E;  1TOV A;  1YP5 A;  1K73 U;  1P92 A;  4PFZ A;  2QDY B;  3MEA A;  2PTK A;  1U1S A;  4M75 C;  4R55 A;  3LGF A;  2L8D A;  5KYW B;  2DL7 A;  4RTX A;  1RAF B;  4EPC A;  1W6X A;  1I5L A;  2X3W D;  2D9T A;  2BKD N;  1G3T A;  2K3B A;  4V2S A;  4M78 B;  5GMK i;  2COZ A;  1TS9 A;  2YUP A;  1Y96 B;  2RD1 A;  2KI7 A;  2J6K A;  1FX7 A;  2FEI A;  4QVD A;  1NEB A;  2EPD A;  4OGE A;  4BAC A;  4PJO E;  3I5R A;  3CCQ Q;  1RAD B;  2ZPH B;  2RI3 A;  2QEX Q;  4D6W A;  1TUD A;  1N27 A;  3NMZ C;  2JT4 A;  4OGC A;  4PFP A;  1KSW A;  1X6B A;  5GMK l;  3CCU Q;  4Y92 A;  4M7D C;  5LJ5 h;  1D3B B;  1YIJ Q;  2ECZ A;  5KE2 A;  1OV3 A;  4PJL A;  2LQK A;  5CO7 A;  5A0G A;  5HKC A;  3E9F A;  1WHK A;  4E7I A;  2JOY A;  3QDR B;  3QPH A;  3G1J A;  3BDL A;  1E6G A;  4F7U A;  4JJD A;  4Y91 A;  2FO0 A;  4M77 G;  1GBQ A;  2JM8 A;  1OU8 A;  1G83 A;  1K8A U;  2JTM A;  2VXF A;  3TVT A;  1EX4 A;  2V26 A;  3J81 E;  3A98 A;  3GF5 A;  1N6A A;  4M77 E;  1M2V B;  2CSI A;  2DTH A;  2AHJ B;  3SWN C;  2QTV A;  3A5Z B;  1RAI B;  2GFA A;  6AT1 B;  4AMC A;  2XDP A;  2EWN A;  2F2V A;  1I1J A;  3LH5 A;  1KQ2 A;  3CCJ Q;  2CGH A;  2DJZ A;  1PKS A;  2HDA A;  2ZPE B;  4ZNX A;  2DMO A;  1BYM A;  1AWW A;  1YIT Q;  3QSU A;  1D1A A;  2VC8 A;  2D0N A;  5EG2 A;  1OQK A;  1NJI C;  5D6Y A;  1VQ5 Q;  4JRK A;  1VQL T;  1I81 A;  3NTK A;  3OMC A;  2LDM A;  2HQX A;  1QP3 A;  2V8I A;  2X35 A;  1QVP A;  2ZPG B;  3SB2 A;  1KJW A;  3E9G A;  4LDV A;  3HSB A;  2DXU A;  2VVK A;  2JMC A;  5IXB A;  4PJO G;  4IUR A;  4XTV A;  5FRN A;  1YIT A;  3CMA A;  3OYF A;  2HEQ A;  2A3L A;  5GMK j;  2X3X D;  1X6O A;  2PQW A;  4EMH A;  3MKD A;  1LOJ A;  3EG3 A;  4MMK A;  4KH0 B;  4C8Q G;  3KXT A;  1SHF A;  3O8V A;  4E7Z A;  1WJQ A;  1H3H A;  2KRS A;  3RNJ A;  2DKG A;  3OS1 A;  4J7F A;  4LXC A;  2LQ8 A;  1ZSZ A;  1U3O A;  1AZG B;  1NE8 A;  1ACM B;  2HCK A;  4EMK C;  2QA4 A;  2VXE A;  4M7A C;  2O2O A;  1VQ5 A;  2DL4 A;  2NUP A;  1PWT A;  3E19 A;  1OOT A;  3I55 Q;  1Y71 A;  3VS5 A;  1WJR A;  3URG A;  1NLO C;  3TSW A;  1WXU A;  4P5N A;  1OUL A;  1ZUY A;  1AVZ C;  2O31 A;  2ZPI B;  2DET A;  2E65 A;  1IRE B;  5GMK m;  3GBQ A;  1MV0 B;  5IHK A;  3CCS Q;  2XHC A;  2DX1 A;  1D1C A;  1K9M R;  4B6M A;  1VQ4 A;  1F1B B;  3NHN A;  1ZA2 B;  4KRT A;  1UJY A;  2RQU A;  3A8O B;  4JJN K;  1KC8 C;  4CI0 C;  2FVU A;  1B7T A;  2DXC A;  3A8G B;  1UE9 A;  1WHJ A;  1YHQ T;  1UGP B;  4M7A F;  2RK2 A;  3VS0 A;  4OMQ A;  4M78 C;  1M2O A;  3RBB B;  2HD0 A;  3G6E Q;  3V8K A;  4FSS A;  4N4I A;  2K9G A;  4C8Q F;  2I2L A;  4AG1 C;  1YJN T;  1WHH A;  3I55 A;  2Y4X A;  4M75 G;  4PLL A;  5CVI A;  5GJV B;  3OSV A;  2P4R A;  2AT1 B;  3QWY A;  2DJQ A;  3PMT A;  4GY5 A;  2RQT A;  3VS7 A;  3EFR A;  3CCU T;  3I56 A;  1AHJ B;  2E5K A;  2KRN A;  4E2F B;  1VQ4 Q;  4QKU A;  1AWO A;  1YIT T;  1VQM A;  3LH0 A;  4ELY C;  1BIB A;  2L2P A;  1G3S A;  4KUL A;  3JCM f;  1V76 A;  5KYY A;  1PRL C;  1HJD A;  3JCM c;  2EKH A;  2XD0 A;  1RI9 A;  4RCC A;  2SRC A;  4M77 B;  4RTZ A;  2PUO B;  1BB9 A;  2DIQ A;  3QXE B;  4LUD A;  1AD5 A;  1WGS A;  4HCC A;  1A0N B;  1UHC A;  1VQN T;  3JCM e;  2C06 A;  4RMO A;  2EYY A;  2MPX C;  4NL2 A;  3QO3 A;  1AOJ A;  3M59 A;  2BTT A;  4F14 A;  3CC7 T;  3CME A;  2WSF E;  3JCM d;  3I5S A;  3FEO A;  4MZT A;  4A63 B;  5GAO p;  1I4K 1;  1BU1 A;  3RMQ A;  4RTT A;  3AT1 B;  2PVG B;  3UA6 A;  1KC8 R;  1YJW Q;  1IB8 A;  1Z9Z A;  3VS6 A;  4HT9 A;  1BI1 A;  5A0D A;  3OYN A;  1I5O B;  4IUT A;  4C92 D;  4CC7 A;  4QVC A;  1M3B A;  2FHD A;  4PJO B;  2YRC A;  3A1P A;  1ABO A;  1FXX A;  5CKH A;  4LNP A;  2QGF B;  3RKY A;  1WQW A;  2XIC A;  2KBT A;  4QQD A;  1G5V A;  2CP0 A;  5LJ3 f;  3G71 A;  2CP6 A;  2DPP B;  3OY9 A;  3JSC A;  5CR2 A;  4QW2 A;  5GAM e;  2D8H A;  3UF4 A;  2OTJ T;  4M7D F;  3UPU A;  2QQA A;  1YIJ A;  3KUF A;  4FW1 A;  2PZ1 A;  1VQ8 A;  4C8Q B;  2ENM A;  2RNA A;  4RTW A;  1ZSZ C;  4EMK B;  2FPE A;  4X34 A;  1WLP B;  4FYY B;  2G6F X;  2MWP A;  1BI3 A;  2YLC A;  2J05 A;  2ED1 A;  4JLG A;  2YRD A;  3OYI A;  4FT4 A;  5I11 A;  1KK7 A;  2JTE A;  2ZPF B;  1MND A;  1VQO Q;  2RQV A;  4RG2 A;  2X9H A;  1QVF P;  5D6X A;  1QKW A;  2EJ9 A;  1ZUK A;  1VA7 A;  3CBO A;  1N8R U;  4C5E A;  3JB9 D;  4IIM A;  1AWJ A;  3EFS A;  5FRO A;  1NEG A;  2GFU A;  3TU4 K;  4RTV A;  3GNG A;  2V8J A;  5FU6 B;  5IT9 E;  2XI9 A;  5DLQ E;  4PJM A;  3GNF B;  1VQN A;  2JTF A;  1YN8 A;  4GBQ A;  2DL5 A;  2EYX A;  2OI3 A;  4O6J A;  2F1L A;  1K0X A;  3CBP A;  4CC3 A;  1VQ7 A;  1EFN A;  1M5Q 1;  1V29 B;  1RAH B;  2J6F A;  2HSE B;  2MMP A;  3CCM Q;  2HMA A;  1B34 B;  2DIL A;  4FCY A;  2LC4 A;  2GGR A;  4OMF B;  4DQ2 A;  3EG0 A;  3H0I A;  2BZ8 A;  5KYW A;  2DBM A;  4M77 A;  2KE9 A;  3OBY A;  2G3R A;  9ATC B;  1Q86 R;  4WTO B;  2EIF A;  1VIE A;  2VGN A;  5ECA A;  1PSF A;  2KMT A;  2PVO B;  2NLU A;  2NYS A;  2JS2 A;  2LJ0 A;  3ME9 A;  1S1N A;  1M8V A;  1JJ2 S;  2AZS A;  2OTL T;  2M02 A;  2CP5 A;  2A08 A;  2F5K A;  3G6E A;  4OMM A;  2KYB A;  1HSQ A;  2P4T A;  2Y4Y A;  3OW2 P;  2QQ9 A;  4XAX B;  4N4H A;  2COY A;  4E7K A;  3TCJ A;  1JBM A;  1Q82 U;  3X26 B;  4DEX A;  3JB9 J;  2L3R A;  1WI7 A;  1OX9 A;  1OEB A;  3T9N A;  4QQ6 A;  4OB1 B;  2E3I A;  2Y90 A;  2OAU A;  2X4W A;  2F2W A;  2M51 A; 
#chains in the Genus database with same CATH homology
 2PUK B;  3LYI A;  5KE2 A;  1VQ7 T;  4M7D G;  1VQP A;  1N8R C;  3ASK A;  5FU7 C;  4M7A G;  3CBM A;  2LQK A;  5CO7 A;  5C0M A;  4J7I A;  5A0G A;  5A0L A;  2LCC A;  5HKC A;  3E9F A;  4E7I A;  5KH6 A;  3CMA T;  2JOY A;  2QQR A;  3V7S A;  3MHX A;  3QDR B;  4M78 F;  4LD9 K;  1D3B A;  5A2Q E;  3QPH A;  3CC2 T;  3CD6 T;  3BDL A;  2M16 A;  4BB7 A;  4F7U A;  1MGQ A;  4C8Q A;  2HQE A;  4Y91 A;  1VIF A;  3OYY A;  3OW2 S;  2DTI A;  2WSE E;  3CC4 A;  4ME7 A;  3PT9 A;  2JVV A;  3C12 A;  4BI8 B;  2QQS A;  4Q5W A;  1IZ6 A;  2EAY A;  4M77 G;  4EDU A;  5I2S A;  5GAN 4;  1M1K U;  2DD4 A;  5LJ3 e;  2DXB A;  2RA2 A;  3WVE B;  5CKB A;  2JTM A;  2VXF A;  1K8A U;  2EJG A;  3J81 E;  4M7A B;  3GF5 A;  5DLO A;  2E5Q A;  2EJF A;  1N6A A;  4M77 E;  3S3N A;  1QVG S;  2DTH A;  2AHJ B;  2R58 A;  3SWN C;  3A5Z B;  3RES A;  2GFA A;  4F7U G;  1EIF A;  5HK3 A;  1BI0 A;  2P0Q A;  2EWN A;  2DXT A;  2MI6 A;  2B8A A;  2XDP A;  4PLI A;  3OS0 A;  2LNV A;  3OA6 A;  4A4K A;  3JB9 H;  2LRQ A;  4ZTF A;  1KQ2 A;  1Y07 A;  3J7A F;  4DOV A;  3HRU A;  2YHT A;  4BY6 C;  2CGH A;  2K57 A;  2DJZ A;  3MCA B;  1XOV A;  2ZPE B;  3G6E T;  2E64 A;  1OYX A;  2CKK A;  3OBW A;  4XTY A;  1BYM A;  2R5M A;  5LJ5 g;  1DJ7 B;  2WSC E;  4C5I A;  4BDY A;  5DM7 R;  3CCJ A;  3QSU A;  2VC8 A;  4OVA A;  1K9M U;  3CCE A;  5EG2 A;  3VUZ A;  4F7U B;  3GPL A;  3L2R A;  1NJI C;  5D6Y A;  4JRK A;  1VQL T;  4IKF A;  1I81 A;  3BW1 A;  3NTK A;  3OMC A;  3LGL A;  2LDM A;  2DIG A;  2HQX A;  2YLB A;  5LJ3 d;  4C92 G;  1QP3 A;  2V8I A;  2X35 A;  1QVP A;  2ZPG B;  3SB2 A;  3E9G A;  3G4S A;  4XTX A;  4LDV A;  3HSB A;  2DXU A;  2RHI A;  1VQ9 T;  4PJO G;  3M55 A;  1X01 A;  4IUR A;  4OB3 B;  1VUB A;  3FB9 A;  4XTV A;  2M9U A;  4FSX A;  5LJ3 j;  4C92 E;  4JS4 A;  3TRE A;  3QHS A;  4HCB A;  1YIT A;  5FRN A;  3CMA A;  4PJO C;  3OYF A;  1KD1 C;  1M4Z A;  3BDU A;  1U1T A;  1Q81 U;  4J6X A;  1UGS B;  4M77 D;  2A3L A;  3RKX A;  3OYA A;  5GMK j;  4ZGE B;  4E7J A;  3HFO A;  4MML A;  4JUV A;  3RKW A;  3WXM B;  1X6O A;  2K5F A;  2PQW A;  1X75 C;  4EMH A;  3JB9 G;  1LNX A;  2WAC A;  3OS5 A;  1LOJ A;  1ZHI A;  5CCA A;  4HA8 A;  4M7D E;  3G71 T;  2E1H A;  4MMK A;  3GLX A;  2E41 A;  3NTI A;  1UB4 A;  2DVE A;  3TEE A;  5GAO l;  3OYD A;  4C8Q G;  3C94 A;  3M9Q A;  3KXT A;  3O8V A;  3QUI A;  1WJQ A;  5LJ3 g;  3OYM A;  2OTJ A;  4HKE A;  3CXC A;  5GAN d;  4HT8 A;  4F7U F;  2FL7 A;  2CS7 A;  2DKG A;  2KSS A;  4Y28 E;  1UGQ B;  2F5T X;  2RH2 A;  5DY9 A;  3OS1 A;  4J7F A;  1OZ3 A;  2LQ8 A;  5GAM d;  4EMK C;  1NE8 A;  3CCM T;  1K8A C;  4MDX A;  2QA4 A;  2FB7 A;  3PNW C;  2VXE A;  3JCM X;  1ZQ1 A;  5LJ3 h;  3C4S A;  4A4G A;  5LJ5 e;  4M7A C;  4JRQ A;  5I21 A;  1VQ5 A;  2L5Q A;  2DO3 A;  2EQJ A;  4PNO A;  3JCM h;  3E19 A;  3JCM P;  1RL2 A;  2DTO A;  4KT0 E;  1Y71 A;  4XU2 A;  3RIR A;  4BUG A;  2HBP A;  1VQK A;  3RER A;  1WJR A;  3URG A;  5GAN f;  4P5N A;  1U8R A;  1K9M C;  3QYH B;  2FYK A;  1VQO T;  5CKE A;  5GAN 5;  2EQK A;  2ZPI B;  3M57 A;  5KCO A;  1Q86 U;  5CK9 A;  3UT1 A;  2E65 A;  1IRE B;  2RJD A;  1UGR B;  5GAN 6;  3OYE A;  1BIA A;  5GMK m;  2M0O A;  2RJE A;  4XU0 A;  3PMI A;  3EAE A;  4C5H A;  2XHC A;  1VQO A;  1KHI A;  1KQS S;  1QVF S;  5GAN h;  4X9C A;  1XQH A;  3P8D A;  1VQ4 A;  2X4Y A;  2KQW A;  5GAN e;  1FWZ A;  2VGM A;  3S3M A;  2P0K A;  4XTU A;  5C6S A;  3HRS A;  3A8O B;  4NS5 A;  1NPP A;  1Y96 A;  3HKS A;  4JJN K;  2RI2 A;  1Q81 C;  5CAI A;  2RI5 A;  1KC8 C;  4CI0 C;  2FVU A;  1WQ7 A;  2DXC A;  2ZGW A;  3A8G B;  2QQB A;  2BUD A;  4J6W A;  3CPW S;  4E7L A;  2R57 A;  4OP0 A;  1VQ4 T;  3Q1J A;  3M56 A;  2RK1 A;  1UGP B;  1YHQ T;  2D6F A;  2RK2 A;  4C8Q E;  4M7A F;  4PJO A;  3V8J A;  3R6O A;  4M78 C;  3L42 A;  3PGG A;  3VYG A;  4BI4 A;  5KCH A;  3I55 T;  3CCM A;  2HD0 A;  3FLG A;  4LD6 A;  3V8K A;  4N4I A;  4GLK A;  4NOY A;  3M58 A;  5CKF A;  4DA4 A;  4C8Q F;  3L2Z A;  4A4F A;  1YHQ A;  2XU8 A;  4BE0 A;  2CZ6 B;  2I2L A;  4LDY A;  2LT1 A;  2JN0 A;  3HL8 A;  2XDD A;  3V7C A;  1YJN T;  3SWN A;  1Q86 C;  3I55 A;  2Y4X A;  4M75 G;  2PVD B;  4O5V A;  4XQ3 A;  1G3Y A;  3M4G A;  2CZ0 B;  4PLL A;  2EFI A;  4M77 F;  5CVI A;  1OI1 A;  3UDC A;  4JS5 A;  3OSV A;  2H3J A;  2PU9 B;  3OYC A;  3LX7 A;  3CCU A;  3ZFJ A;  3CCE T;  3V7R A;  4C92 C;  4LDU A;  5CQX A;  4DOW A;  3PMT A;  1YJN A;  4GY5 A;  3GIB A;  5GAN g;  1NPR A;  2LTO A;  2RHU A;  3DLM A;  4HCZ A;  2LVM A;  3CPF A;  4C0D B;  4OB2 B;  3OB9 A;  4M78 D;  4NL3 A;  3EFR A;  3A8M B;  5LJ5 j;  3CCU T;  1RI0 A;  1JB0 E;  3LWI A;  4F7U E;  3I56 A;  1M90 C;  4KUD K;  4PKC C;  1AHJ B;  5GAO n;  5GAO q;  2CYZ B;  4M75 D;  5FU7 B;  4M78 A;  4M75 B;  1YIT T;  1VQM A;  1UEB A;  2VUB A;  3LH0 A;  3VYH B;  4FL6 A;  4ELY C;  1ZBX A;  4J83 A;  3MEV A;  3LWH A;  3CCR A;  5KE3 A;  1BIB A;  1KHC A;  4TVR A;  1KG1 A;  3JB9 I;  1G3S A;  3QYG B;  4C8Q D;  4KUL A;  3JCM f;  3JCM V;  1BKB A;  4BE2 A;  2K5L A;  1W2B A;  1O9S A;  2GQV A;  5IAY A;  1YIJ T;  1JRI A;  2MWO A;  3QBY A;  3CCL A;  2O01 E;  3OMG A;  3JCM c;  4LDW A;  2XD0 A;  3NFC A;  5LL6 S;  4RCC A;  3L1A A;  4M77 B;  4C92 F;  2PUO B;  4FM4 B;  3CPW A;  4M7A E;  3MP6 A;  4BDZ A;  4XTZ A;  3FRN A;  2DIQ A;  4N0A A;  3HP9 A;  4FU6 A;  3QXE B;  4L5G A;  4PJO F;  2E10 A;  4B9W A;  1WGS A;  3OS2 A;  3CC7 A;  3CCL T;  1WJS A;  4FT2 A;  4IUU A;  4HCC A;  2LX9 A;  3QKJ A;  3RMS A;  2P0P A;  2RHZ A;  3CCV T;  1VQN T;  3JCM e;  3V8L A;  3X20 B;  3J80 E;  3QJY A;  4BI3 A;  4RMO A;  3CCQ T;  3QJ6 A;  4BE1 A;  2C06 A;  3HPW A;  4X9D A;  3AHU A;  4NL2 A;  1R8O B;  3QO3 A;  4RG8 A;  3M59 A;  3MEU A;  4ZGJ B;  4BY6 B;  3CC7 T;  2MAM A;  3CME A;  2WSF E;  3JCM d;  3M4Y A;  5M9O A;  1MHN A;  3A8H B;  3BFM A;  3FEO A;  3QZ9 B;  4MZT A;  5CIU A;  5GAN 2;  5J39 A;  3WVD B;  1Q7Y U;  2DEQ A;  2IVW A;  3JCM b;  5GAO p;  1I4K 1;  4C5G A;  2E70 A;  3X24 B;  3RMQ A;  4M7D B;  2JUF A;  1M1G A;  3OYL A;  3GP8 A;  3CME T;  4M7D D;  2PVG B;  1QVG A;  1VQL A;  3LLR A;  1VQ6 A;  2YRV A;  1YJ9 T;  4C92 A;  4C0Z A;  4XU1 A;  2RHX A;  2ZCF B;  4HT9 A;  1BI1 A;  1M1F A;  3NTH A;  5A0D A;  2KDS A;  5FLX E;  3UWN A;  2VV5 A;  4EMK A;  5HK0 A;  3OYN A;  3G4S T;  2K3X A;  4QQG A;  1M90 U;  4IUT A;  3JCM Q;  5J26 A;  5D6W A;  1VQ9 A;  5GAN j;  4C92 D;  4J5Y A;  4RKU E;  4C92 B;  4QVC A;  2HAX A;  2QXF A;  5FU6 C;  2GF7 A;  4II1 A;  3CC2 A;  3CD6 A;  2FHD A;  4XK8 E;  2ZPB B;  2QEX A;  4PJO D;  4PJO B;  2XDB A;  3L2W A;  1PSE A;  3HRT A;  1FXX A;  3ER0 A;  5CKH A;  3HHT B;  3GOX A;  2JNG A;  3RKY A;  5AYF A;  3H6Z A;  4ZTJ A;  1WQW A;  2XIC A;  2ZZD A;  3F70 A;  2RJC A;  1VQM T;  2XG8 D;  4L6V 5;  4A4E A;  2KY9 A;  4QQD A;  3SWN B;  1YJW A;  1G5V A;  5LJ3 f;  2K5I A;  3G71 A;  2DPP B;  1OZ2 A;  3OY9 A;  3QZ5 B;  3JSC A;  3P8H A;  3X25 B;  4A4H A;  3QG1 A;  4QW2 A;  3VKI A;  5CR2 A;  1YI2 T;  5GAM e;  4MZM A;  2DZ9 A;  4ZN3 A;  2EQM A;  4A53 A;  3FJP A;  3INZ A;  4PL6 A;  1N9S A;  4EMG A;  3UPU A;  2D0Q B;  2JZ2 A;  2QQA A;  1YIJ A;  3KUF A;  3CXC S;  4M7D F;  1VQ8 A;  2MF2 A;  4C8Q B;  3FC3 A;  3MO8 A;  5HY6 A;  3JCM W;  1YI2 A;  4OB0 B;  1HK9 A;  1BI2 A;  5GMK e;  4YTL A;  2QA4 T;  4CRI A;  1KC8 U;  4M77 C;  4EMK B;  1VQ5 T;  1HXD A;  4IUQ A;  4X34 A;  3BY7 A;  2O4X A;  3ZBD A;  2KAF A;  2EQU A;  3DB4 A;  3CCV A;  1YCY A;  2MWP A;  3L2U A;  3CCQ A;  4IUP A;  1BI3 A;  2YLC A;  1Q7Y C;  4E7H A;  1VQK T;  1N9R A;  2CZ1 B;  4JLG A;  4JRI A;  2LCL A;  4UC4 A;  3DKM A;  3HFN A;  3OYI A;  4FT4 A;  4A54 A;  2R5A A;  2X4J A;  3M5A A;  3P8B B;  2LT4 A;  3KBG A;  2ZPF B;  3DLL A;  3L2Q A;  4RG2 A;  2E12 A;  5GMK h;  3OQ5 A;  4KUI A;  3CCR T;  2BIV A;  4M75 F;  4JDS A;  4J8O A;  5D6X A;  2EYQ A;  1TH7 A;  1SSF A;  3M54 A;  2OTL A;  1KQS A;  2EJ9 A;  1S72 T;  4J6Y A;  2DK3 A;  4LDX A;  2RM4 A;  4XTW A;  3OW2 A;  4M7A D;  3VU3 C;  3CBO A;  3S6W A;  1N8R U;  4WF2 A;  4C5E A;  3LW5 E;  2QI2 A;  3JB9 D;  3JCM g;  5GAM j;  5GAO r;  2F69 A;  1S72 A;  2RHY A;  3DB3 A;  3EFS A;  2K2V A;  5FRO A;  1WNL A;  2DZC A;  3MEW A;  1K73 C;  2RJF A;  2GFU A;  3VV0 A;  1KD1 U;  3TU4 K;  3JCM J;  3E1S A;  2A7Y A;  5GAM g;  3GNG A;  2V8J A;  5FU6 B;  5IT9 E;  3OYH A;  2XI9 A;  2X4X A;  2XID A;  2IG0 A;  3A8L B;  3GNF B;  5DLQ E;  1VQN A;  2JTF A;  1NZ9 A;  5FRM A;  4MDW A;  3C95 A;  1W4S A;  5GAN 3;  3OSS C;  3ZEH A;  3CCS A;  2HNI A;  1Q82 C;  4C0G A;  2EKO A;  1KQ1 A;  1Y7X A;  1YBY A;  2DD5 A;  4RCB A;  4R56 A;  4O6J A;  4M7D A;  3RUX A;  2XK0 A;  4MZP A;  5CQY A;  5CKD A;  1YJW T;  4Z02 A;  3CEY A;  1B34 A;  5I2M A;  1W2B S;  4M7A A;  5L8R E;  4ZGD B;  2V8K A;  3CBP A;  3OYJ A;  1VQ7 A;  1M5Q 1;  1QVF A;  1V29 B;  2K4Y A;  2L89 A;  1VQP T;  3CCS T;  3M53 A;  5GAN 7;  4ZN1 A;  5LJ5 f;  3N5B B;  5GAO m;  2MMP A;  1GXI E;  3OYK A;  1VQ8 T;  1VQ6 T;  1B34 B;  1YJ9 A;  2LC4 A;  4M78 E;  4KBM B;  4C8Q C;  1O75 A;  3CCJ T;  2RO0 A;  1H3Z A;  4OMF B;  4DQ2 A;  4IUV A;  3JB9 F;  1JJ2 A;  3I56 T;  4M78 G;  3MP8 A;  3MP1 A;  5IN1 A;  3CC4 T;  4M75 E;  4B9X A;  1M1K C;  4M77 A;  3X28 B;  2E6Z A;  1K73 U;  1P92 A;  3PFS A;  2QDY B;  3OBY A;  3MEA A;  2QTX A;  2G3R A;  2RB6 A;  1U1S A;  5J3B A;  2QEX T;  2EIF A;  4M75 C;  4N4G A;  1VIE A;  2VGN A;  1M9S A;  3LGF A;  2CZ7 B;  4R55 A;  1NJI U;  2L8D A;  3H8Z A;  3PTA A;  3QII A;  4VUB A;  1PSF A;  2E6N A;  2KMT A;  2NLU A;  2PVO B;  3VJP A;  5LJ5 d;  4EPC A;  2OTJ T;  1I5L A;  1H64 1;  3ME9 A;  5GAN 8;  5GAM h;  3L2V A;  1WPY A;  1LJO A;  2D9T A;  1M8V A;  3FIF A;  4N0A C;  2BKD N;  1JJ2 S;  1G3T A;  2XKO C;  4V2S A;  4JRP A;  2OTL T;  4M78 B;  5GAM f;  2KVQ G;  5GMK i;  3VUB A;  1XTD A;  2DAQ A;  2F5K A;  3G6E A;  2Y4Y A;  2P4T A;  1Y96 B;  3G7Z A;  3FDR A;  2QQ9 A;  4XAX B;  2RD1 A;  2O4X B;  4OF1 A;  3PIP A;  4N4H A;  1FX7 A;  3SD4 A;  3OYG A;  4QVD A;  1QW1 A;  4L59 A;  2K3Y A;  4E7K A;  2KK4 A;  4OGE A;  3TCJ A;  3PIO A;  4BAC A;  1I8F A;  1JBM A;  4JLI A;  1Q82 U;  4PJO E;  4FIB A;  3OYB A;  1G3W A;  4XU3 A;  3S3O A;  3MET A;  3X26 B;  3JRZ A;  3SFM A;  4QVZ A;  2ZPH B;  1XNI A;  2RI3 A;  4M75 A;  4BD3 A;  3JB9 J;  2L3R A;  2M1H A;  4C0F A;  4D6W A;  4ATO A;  1N27 A;  4C0D C;  3T9N A;  4QQ6 A;  4OB1 B;  4OGC A;  2VYT A;  4ELZ C;  5GMK l;  2Y90 A;  2OAU A;  2X4W A;  4E47 A;  1QP2 A;  3JAM E;  2GCX A;  4M7D C;  5LJ5 h;  3SDZ A;  1D3B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...