4M75E

Crystal structure of lsm1-7 complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
75
Chain Sequence
ILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDSRNEKVMQHHGRMLLSGNNIAILVPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 10
structure length 75
sequence length 79
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75E00
1Y96A 2VXFA 4M78F 4F7UG 3JB9J 3HSBA 4M7DD 3QO3A 4A53A 4XQ3A 4MMKA 5GAOn 1U1SA 3QSUA 3BDUA 4M77A 1X01A 4EMKA 5GMKm 3BFMA 3RIRA 4C92D 3JCMP 1B34A 4J6WA 1N9SA 5GMKl 3VU3C 5GAN8 2E41A 1BIBA 2DXTA 4N0AA 5GAN2 3FJPA 2EJFA 5GAN4 4M7DC 4PJOE 4XTXA 3JB9I 4M75D 5LJ3j 5GMKh 4M7DA 3RKWA 4C8QB 2DKGA 2E64A 5DY9A 4C92C 4J6XA 1JRIA 4M78D 1BIAA 1MGQA 4C92G 1H641 3QHSA 3RKXA 3JCMc 4XTVA 2RD1A 4F7UE 1Y96B 3V8JA 1I81A 1N9RA 3M4GA 4M75C 2E65A 4M75G 5GAN5 4RCCA 1M8VA 3RESA 4C8QF 3JCMf 5GANf 4M77B 4F7UA 2RM4A 4M78C 1WQWA 4XU3A 4EMKB 5GMKe 3EFSA 3JCMb 2DEQA 3GIBA 2RA2A 4M78G 1U1TA 4J6YA 3EFRA 5GANd 3JCMd 5GMKj 2EJ9A 1WNLA 5GANh 3JB9F 2YLCA 4HT9A 4M7AF 4RCBA 4M7DE 3V7RA 2DTHA 3PGGA 4X9CA 4J5YA 4XTZA 2RB6A 5GANj 2VC8A 4DQ2A 4JRKA 5GAOm 3L1AA 4M7AC 3INZA 4M77F 2E1HA 2FYKA 4X9DA 3JB9G 4M7AG 5GAOl 4PJOB 5LJ5f 4MMLA 4C92E 4Y91A 3RKYA 4QVDA 1HXDA 3JCMW 4QVCA 5GAOr 5CAIA 3V8KA 3QUIA 1LJOA 5LJ5d 4A54A 4C8QD 5GAMg 5GAMe 4XU1A 2CGHA 3SWNB 3JCMg 4C92A 5GANe 3JCMe 5GANg 3RERA 4NOYA 4PJOF 5GAN3 5GAN7 1YCYA 2DTIA 1I4K1 2ZGWA 4HA8A 4F7UB 5GAMf 5GAN6 1KQ1A 3JB9D 1KQ2A 4M7AD 4M78E 1JBMA 3V7CA 4M75A 2E10A 3RUXA 3AHUA 1B34B 1LOJA 4PJOG 4C8QC 1I8FA 5GAMd 5GAMh 4M77D 2K57A 3JCMh 4C8QG 4M78A 1D3BA 2EAYA 3SWNA 5LJ5g 5LJ5e 3FB9A 3SWNC 3HFNA 4F7UF 4HT8A 4M7DB 3BY7A 5LJ5j 3V8LA 1WPYA 4WF2A 4EMGA 2YHTA 2YLBA 2EWNA 4M77C 2DZ9A 3SB2A 4EMKC 3FIFA 4EMHA 2I2LA 4M7AA 4M77G 4PJOD 1LNXA 4C92B 3HFOA 5LJ5h 4JUVA 4M75E 2JN0A 4N0AC 1I5LA 4M7DF 4JLIA 5GAMj 3JCMQ 5GMKi 3JCMV 4M75B 2EJGA 2DXUA 2HNIA 5LJ3e 5LJ3g 3JB9H 4PJOC 2DVEA 4NL2A 4M7DG 5GAOq 2DJZA 4C8QE 1M5Q1 4V2SA 4C92F 4NL3A 1HK9A 1D3BB 4M78B 3V7SA 4JRIA 4OP0A 4XTWA 4XTUA 5LJ3f 2VXEA 4PJOA 1TH7A 4XTYA 4XU2A 4C8QA 2DTOA 2QTXA 3L2ZA 4PNOA 4M7AE 2FB7A 2DZCA 4M75F 1WQ7A 3BW1A 5LJ3d 3JCMJ 5LJ3h 5I21A 4XU0A 3JCMX 5GAOp 2Y90A 4M7AB 4M77E
chains in the Genus database with same CATH superfamily
3CCUQ 1AD5A 1K9MC 1JXMA 2EQJA 1M27C 5HK3A 1QVGA 2PVGB 1RADB 1X6OA 1U06A 2F5TX 4KGZB 3VS3A 4KRTA 3CMAT 1Y71A 2OTJT 3OMGA 1PSFA 2GFAA 3M0RA 4C92C 2P4RA 3MEUA 1UDLA 1N27A 3OYYA 4PL6A 3JCMc 5CIUA 1WXUA 4DBRA 1M8VA 4RMOA 3H6ZA 1KIKA 3EG3A 4JLGA 1CKAA 2EGAA 2ATCB 2RHYA 3CCQA 3UATA 3GNFB 2FZCB 5AT1B 4IUPA 2RB6A 3CC7T 1FMKA 5I22A 2QDYB 1GFDA 2LDMA 4PJOB 4J9EA 2DL3A 2DILA 3EG9A 2CP6A 2J05A 3KFVA 5J39A 2QASA 2CSIA 4AFZC 1KC8R 4LUEA 2A7YA 1SPKA 2IPOB 5IHKA 2NUTA 1B34B 1M30A 2BE7D 3CEYA 3I35A 3CXCA 1TS9A 3LH5A 1N8RU 1PKTA 2LP5A 5FU7C 2KDSA 2GGRA 2EW3A 3CC4T 1N6AA 4OB3B 4BDYA 5CKEA 5GMKi 3JCMV 3MO8A 2YWWA 1K73R 2DYIA 4PJMA 4FSXA 4XK8E 4C8QE 1V76A 3OMCA 3ZBDA 1C6VX 5LJ3f 4F04B 1IREB 5I11A 5A0GA 8ATCB 2FPDA 3OB9A 1DJ7B 4M7AB 4XQ3A 2O9SA 2DRMA 4LDUA 4R55A 1WHJA 2VGMA 1N5ZA 5GMKl 2GTJA 2DYBA 2YXYA 5GMKh 4M7DA 1J3TA 2IIMA 4II1A 4ME7A 2R5MA 3OYGA 1MGQA 3HHTB 3EGUA 3A5ZB 4A63B 3UA7A 3X20B 1IHVA 2CP5A 4Z02A 5IH2A 2KSSA 4FM4B 1VQ8T 3JCMd 5C6SA 1TUGB 3VKIA 4DOVA 2J6KA 5KH6A 2AKKA 2QA4A 4JRPA 4C92E 2L3RA 6AT1B 4Y91A 1HXDA 2ZPBB 1QVFA 5LJ5d 2JTFA 2FPEA 1XQHA 2L0AA 4C0DB 1UE9A 3LH0A 1VIEA 1HYOA 3JB9D 1WXTA 2FZGB 4C5IA 2DRKA 5C0MA 1LOJA 2FZKB 2K57A 4BY6B 2BUDA 3UWNA 3SWNC 3CMAQ 3SDZA 2OTJQ 3EG9B 2YLBA 1SSFA 1FYNA 3EH2A 4JLIA 1AWWA 1UUEA 2CP2A 1D1AA 2NUTB 1KHIA 3DKMA 4PJNA 2QGFB 2GCXA 3V7SA 2RHIA 2E3HA 1WHMA 4XTUA 4AG2C 2K5FA 4L59A 4PNOA 2LJ3A 3MJXA 1PWTA 5LJ3h 2RK2A 4D8KA 4AMCA 1Q82R 1QKWA 3I56T 2NUPA 3E1SA 1KC8U 2Z0WA 3QSUA 4RKUE 4EMKA 1X75C 3GOXA 2QEXT 2MWPA 4XTXA 1K9AA 2YRCA 1NZ9A 2FO0A 1M3CA 4VUBA 4M78D 4EIKA 4B9XA 3CCLA 5KYUA 3M56A 1BCOA 2E12A 2CKKA 1RAHB 3ME9A 2FHDA 2KK4A 4C8QF 2M1HA 5IT9E 1WQWA 2CSQA 3UA6A 1K73U 2RA2A 3TU4K 1UGPB 1AWJA 2RHZA 5HCKA 3CC4Q 2QXFA 5GAOm 2NWMA 4QT7A 1NJIR 5L8RE 4AT1B 2V8KA 4O5VA 3VS4A 4AFUC 4RUGA 4CI0C 2ABLA 2F69A 3S6WA 2C0TA 2DD4A 1YHQA 3CBOA 1RL2A 1AT1B 3TEEA 5CO7A 1GBRA 5LJ5j 2JM9A 3E9FA 5FWCA 3URGA 4PJOD 1GXIE 3CCJA 2JMCA 2ECZA 2K79A 1KD1R 1I1JA 4N0AC 2JN0A 3P8DA 4ATOA 3CMAA 2LMJA 2GBQA 4NL2A 3VUZA 1OEBA 4C92F 3CCQT 1ACMB 2E5KA 4XTYA 2L89A 4C8QA 2VASA 1VQ8Q 4M7AE 4E47A 3H0HA 2HMAA 1Y96A 4C0GA 1JB0E 3QO3A 4A53A 3RBBB 3M59A 1U1SA 2OTLA 3JCMP 4J6WA 5EG2A 4M7DC 2L3QA 3VS1A 2JOYA 1U5SA 1ZSZB 4J9DA 4GLKA 5GJWB 3RKWA 1QCNA 3MEVA 1K8AR 3EGXA 4QVZA 2KEAA 1X2KA 1X2QA 2ZZDA 1VQKA 3CCMA 1TU0B 2XDDA 4EMKB 5GMKe 3EHQA 2KT1A 3EFRA 5GANd 2YLCA 2KROA 3MEWA 3HPWA 3PIOA 4OMOA 3JV3A 1RI9A 2E1HA 2DAQA 1Q82U 2QQSA 4GBQA 2FL7A 4XU1A 2CGHA 4C92A 2OX7A 2RH2A 2FRYA 3OYAA 2VGNA 1G83A 2DTIA 1HD3A 2W10A 1LCKA 3EFOA 3RNJA 3I56Q 3CXCS 3OW2P 4KUIA 4F16A 4FU6A 2QEXQ 1UECA 2DETA 2GNCA 2M0OA 2J6FA 3SHWA 3T9NA 2ZCFB 2RQTA 5HY6A 2E70A 3SEMA 2KRMA 3OYDA 4KH1B 1RAIB 1NJIU 1S1NA 2JM8A 3H0FA 1EIFA 3EG1A 3LGLA 1G3YA 4XU0A 2CDTA 2QA4T 1BI0A 2X35A 4QQDA 1OI1A 3TSWA 1BCMA 5I2SA 2Y4XA 1IGQA 2O31A 5FU6B 2QDLA 1KC8C 2PNIA 4RTVA 2DXTA 3M53A 3EGDA 3M57A 5D6WA 1H92A 1ZA1B 2D0NA 4C8QB 4QQ6A 3LWIA 5DY9A 3QBYA 2BZ8A 4J9CA 5KCHA 1KD1U 2RD1A 1Y96B 3X26B 2WSFE 3PVLA 3QYGB 4J7FA 5GAN5 2EQIA 1WHKA 4TVRA 2DX1A 3I55T 3OBYA 1M8MA 1K73C 4M7AF 4M7DE 1WYXA 4RTXA 3VJPA 5HK0A 2EYQA 3JB9G 3M55A 3EGXB 2B86A 3TCJA 3CCQQ 1YJWA 2SEMA 2FPFA 3OYBA 1VYTA 2MF2A 5GANj 1YCYA 1G3TA 1KHCA 3EG2A 3CBMA 1KK7A 4OMNA 3QWYA 2DJQA 3OY9A 2EYYA 2RO0A 3FB9A 1K8AU 2HBPA 3HFNA 1NYFA 2GFUA 2P84A 1NEBA 1AHJB 1ZX6A 2RI5A 5CR2A 3CCSA 3MKDA 2PZ1A 1LNXA 2WSCE 4C92B 3HFOA 2DVJA 3CCLT 4JDSA 1TOVA 2QEXA 3NTIA 1M1KR 3A98A 3EFOB 1ABOA 1M3BA 3MCAB 1G5VA 4XTWA 4OMQA 4MZTA 5CK9A 3C4SA 3OS1A 1TUDA 1OPLA 4K11A 4ZGEB 5CQYA 3BW1A 5IHNA 4Q5WA 2EYWA 3SWNA 3HSBA 1OQKA 1OULA 1V1CA 2MMPA 2ESWA 2YSQA 1YNZA 1X01A 5GMKm 1M4ZA 2JNGA 3E19A 4Y92A 1D0ZA 1PG5B 3RMSA 2X4YA 1YHQT 1BYMA 3G4SA 2CUDA 3QKJA 4XTVA 1I81A 4WTOB 2CP0A 4M75G 5FW9A 3CCJT 1GFCA 1VQ5T 1BI3A 1PD1A 2DBKA 1QP3A 4E6RA 3JCMb 5FU7B 1RAFB 5FWBA 3LWHA 1UGVA 3EGDB 8AT1B 1K76A 1K4US 4JRKA 2JTMA 3OQ5A 4BUGA 5M9OA 1WI7A 1XOVA 3JCMW 1SEMA 3WVDB 3G6EA 1SRLA 1Q82C 1AZEA 3OYNA 3QYHB 3ZFJA 3LGFA 3CBPA 2DFUA 5GAN3 1W1FA 1EFNA 1NG2A 2DIGA 3V7CA 2QA4Q 4P5NA 4C5GA 1YIJA 4PJOG 2OTLT 2EQUA 1AWXA 3QIIA 3CMEQ 1BU1A 1VQ4A 2KT8A 1KSWA 2VV5A 2PUOB 1WHHA 1Q7YU 4IKFA 2JS0A 2LCCA 1R77A 1VQKT 1X69A 4M7DF 3CCMT 3CCEA 2CYZB 2COYA 4OMPA 4N4HA 2EJGA 2YT6A 3JSCA 2LQ8A 1YFNA 4OGCA 1VQOA 4XU2A 3OYKA 3I55Q 2DTOA 3OYMA 2OJ2A 1CKBA 2DL7A 1G3WA 4ANJA 5GAOn 4ELZC 1WX6A 1VUBA 3A8LB 4LDYA 4N0AA 1T0HA 1RAEB 5IXFA 1T3SA 3UF4A 3CPWP 4BI3A 5FROA 2V26A 1MV0B 2DKGA 4PJJA 2DXBA 4F17A 1VYVA 2EIFA 2F5KA 3CCRA 1S72A 4M75C 2GTOA 2V1RA 2K5IA 1KD1C 2E65A 2GQIA 2DEQA 4X1VA 2O4XB 1E6HA 2QYZA 2EJ9A 3CCLQ 3P8HA 4E7IA 2YUNA 1W2BP 2K2MA 3MEAA 1IXDA 3QDRB 4JJDA 1G8XA 3QUIA 2LQKA 1WJRA 4C8QD 3FC3A 1Q86U 4A4KA 3PNWC 1FWZA 1QQJA 2MAMA 4LDWA 2ZGWA 2RJDA 5KYXA 2A36A 3AHUA 1ZA2B 9ATCB 2RJCA 5GAMd 2GF7A 3OA6A 4JJCA 3IQLA 1MMDA 2LT4A 2E5QA 1W2BS 1RABB 3RMQA 5D6YA 1MHNA 1Z9QA 5KE3A 2A37A 4M77G 3M0PA 4ZN3A 1YHQQ 3QJYA 4A4EA 3CMEA 4HVUA 1WZOA 1JO8A 2DJZA 3CCJQ 2CZ7B 1G2BA 2DLPA 1VQ5Q 3M0TA 1WJSA 2KYMA 3JRZA 5J3BA 1YJWT 2R58A 3BDUA 3I55A 2NYSA 5CCAA 2K3YA 4C92D 1OYXA 4MDWA 5HKCA 2DEUA 4D6WA 2QQBA 3ZL7C 4ZGJB 1TTHB 4J9GA 3U23A 3JB9I 3MP6A 4IIOA 3L42A 4OMFB 2OTLQ 3OS2A 4HXJA 1WIEA 3CCST 2BE9B 1FMVA 3JAME 3KUFA 2KYBA 4E7HA 2LC4A 2MPXC 4F14A 3S3NA 1M90R 2X9HA 4CC7A 2L5QA 1KQSP 3LYIA 1ZUKA 4E7LA 1VQKQ 4R0KA 3CCMQ 1IRXA 3META 4J7IA 2LJ0A 2COWA 3L2RA 4LD6A 3UT1A 1WFWA 2AIRB 1IB8A 4IUTA 2EGCA 2FRWA 2L3PA 1KQ2A 2K2VA 1PRMC 1W70A 2RI2A 1RAAB 1M2OA 1VQMT 1WGSA 1YJNA 3E9GA 1MMAA 2K6DA 4J8OA 1EZZB 3UPUA 3P8BB 4M7DB 1VOMA 1WPYA 3N5BB 3G4ST 4M77C 4BACA 2DZ9A 4DBFA 1JQQA 1UGSB 3CPFA 2BZXA 2HBWA 3HKSA 1Q7YC 1NEGA 2V1QA 3R6NA 5GAMj 4LDXA 2K4YA 4XAXB 5KYXB 4B6MA 2H3JA 2A28A 2DVEA 3G1JA 2JJ9A 4B9WA 2E6NA 3PVQA 3KBGA 3HRTA 1TH7A 2F2VA 1JU5C 5CKBA 5KYWA 3G71A 3I5SA 3BE3A 3FDRA 3KXTA 2LZ6B 3M4YA 2MK5A 1NLOC 4Z88A 1VQ5A 4CC4B 5KE2A 1N8RC 3G6ET 3VRZA 1UGQB 3MP1A 2YUPA 3RIRA 3QXEB 2C0IA 2HSEB 1YBYA 2RNAA 2AT1B 1YIJT 1BK2A 1SHFA 5FRNA 1MMNA 1IHWA 1VQ4T 2M16A 4Y28E 2JMAA 1RI0A 2CZ0B 3JCMf 3QWXX 1U8RA 2CT4A 4YTLA 1BI2A 3CCET 3CCVA 4HT9A 3VYHB 2ZPEB 4IUVA 1YI2A 3INZA 1R8OB 1Q95G 5LJ5f 3H0IA 3MHXA 1VQOT 1VQ6A 4O6JA 2JUFA 4MZMA 2DL8A 1WXBA 3GPLA 2LQWA 3EAEA 2LJ1A 2NUPB 1Q86C 4DEYA 2RJEA 4HVVA 4M7AD 1VQ7Q 1YJWQ 3QG1A 1PCXA 1D3BA 5CQXA 3H41A 1OZ2A 1RLPC 2JT4A 3TVTA 1F1BB 2H3EB 1AVZC 5KYUB 4ESRA 2I2LA 2SRCA 4DOWA 2CUBA 1NLPC 1NPPA 1PNJA 4FW1A 3CCRT 1S72T 3M9QA 5L23A 1M90U 4GLMA 2XHCA 2DXUA 4E7KA 3JB9H 2ED0A 2QQRA 3CCSQ 5GAOq 2HAXA 2QQ9A 1BB9A 2HSPA 3BDLA 3E2UA 4OP0A 3REBB 3UDCA 2DD5A 1KJWA 2EBPA 4FYYB 4M75F 3JCMJ 1YJ9A 3TSZA 1UB4A 4PLLA 5IN1A 5GAOp 1YITA 4HVWA 4M77E 3A1PA 4ZGDB 3OYFA 1W2BA 1FXXA 2DERA 5D7UA 4IIMA 3BFMA 4JS5A 1I0CA 1QWEA 1X43A 3ZEHA 1BIBA 2P0PA 3FJPA 2KE9A 2W0ZA 3OW2S 1OX8A 3X24B 2D9TA 1VQMQ 1QP2A 2HQXA 3HL8A 2ZAEA 4OB0B 3L2VA 3S3OA 2HL5C 3CD6A 4AFQC 3QHSA 2EKOA 2BZYA 2Y4YA 1M2VA 1M9SA 2DL4A 3G4SQ 3EFSA 2K5LA 3CMET 2R5AA 3V7RA 2LVMA 2M51A 2EVRA 2VC8A 2ENMA 2P4TA 4BE1A 3PTAA 5GAOr 5CAIA 2DA9A 2L8DA 2YDLA 1G3SA 1UG1A 1KQ1A 2HCKA 3QJ6A 4M75A 3RUXA 4ORZA 2LCSA 4LDVA 3PIPA 1LPLA 3VV0A 3G6EQ 1ZQ1A 4DBQA 2KR3A 1HSQA 1X27A 2E6ZA 2KNBB 4L5GA 2PU9B 2JW4A 1VQ7A 1YIJQ 3QPHA 4JRQA 1VQLA 1UHFA 2M0YA 3PFSA 4PKCC 1VQ4Q 3JCMQ 1VQPA 4QKUA 2IG0A 2ZPIB 1VQNA 1D3BB 1UEBA 4R56A 4PJOA 2O01E 4M4ZA 2ROTA 2LT1A 1OU8A 2DZCA 3CCEQ 5LJ3d 2X4XA 2YRDA 1GL5A 4A4GA 3OS5A 4F7UG 2VXFA 2F2WA 2A0FB 4M7DD 4HCKA 4MMKA 2XDBA 1H8KA 1VQOQ 1W6XA 1PD0A 2HD0A 2RHUA 1OU9A 2J06A 1B34A 2VB6A 3WXMB 2RQRA 1KFZA 5IXBA 1KG1A 3RDVA 4KUDK 1QWFA 1YJNT 3CQTA 4JS4A 4J9FA 2KBTA 4PFOA 2PUKB 1JRIA 3HTRA 5DLOA 1E6GA 2KQWA 2H8HA 1PKSA 2M02A 3O8VA 4J9IA 5GANf 2L2PA 3C12A 1VQMA 3M58A 4M78G 3EG0A 5GMKj 1WNLA 3CCRQ 1S72Q 3TQ7P 4ZTFA 4IUUA 4DEXA 4M77F 2OI3A 1GBQA 2RJFA 2BKDN 3G71T 2COZA 1LJOA 5GAMg 3JCMg 3THKA 1M2VB 4HCBA 4PLIA 1C1AA 1WA7A 3HRSA 3OSVA 1VQ9T 1JBMA 4IURA 2VUBA 1GRIA 4RTUA 5A2QE 2VYTA 3G7ZA 5LJ5g 4ELYC 5LL6S 2X4WA 1TSFA 1Y57A 1ZBJA 2I0NA 3H8ZA 4WF2A 4EMGA 1IO6A 2YHTA 2EWNA 1WDXA 3OSSC 5IAYA 4JUVA 2V8IA 1QCOA 2WACA 3F70A 4OVAA 2RQVA 4KT0E 3DB4A 4M75B 2DF6A 2RPNA 1M90C 4FIBA 4V2SA 1YCSB 1BI1A 1MUZA 4JJNK 1M5Q1 4NL3A 3CCVT 4PJLA 4QW2A 2GQVA 4L6V5 2FB7A 1YI2T 3PT9A 4X34A 1R0BG 1Z9ZA 1BBZA 5IHIA 2MCNA 1YP5A 2K3BA 1VQ6T 1ZHIA 2LX9A 1T3LA 1NBEB 4M77A 4JZ4A 3A8OB 3OS0A 1Q81R 4FT2A 2E3IA 1D1CA 3OYEA 3R6OA 3EHRA 7AT1B 2EJFA 5GAN4 3VYGA 2LRQA 5LJ3j 3X28B 1RAGB 2O2OA 1E7OA 4FYWB 1NJIC 5DM7R 4J6XA 1BIAA 3EH1A 1N9RA 2QI2A 1UTIA 4RCCA 5KCOA 2VKNA 4M78C 3GIBA 1B7TA 2HQHA 1RUWA 5ECAA 2J6OA 5GANh 4ZNXA 2B8AA 4DBHA 4X9CA 4J5YA 1Y07A 4KGVB 2KRNA 4DQ2A 4WCIA 3J80E 4M7AG 2JXBA 1WHGA 3V8KA 3OW2A 3C95A 2QK0A 2X3WD 5GAMe 1YJ9T 3SWNB 3JCMe 1YITT 2C06A 2AZSA 2HZYA 1OV3A 2OAWA 4JPBW 1MNEA 4LXCA 1M1KU 1GCQC 2P0KA 3OYIA 4DA4A 4E7JA 1O75A 2QAZA 5LJ5e 3CPWS 3ER0A 2KMTA 4J83A 5CKFA 1UJYA 3VS5A 3DB3A 2PVDB 2DK3A 5CKHA 2QTVA 1M3AA 2CH4W 2YRVA 1YJNQ 3CD6T 1NYGA 2KGTA 2EQKA 1K0XA 3FEOA 2JTEA 2KXCA 4PJOC 1I5OB 2M9UA 2XDPA 3CCUA 2XKOC 1FX7A 2XMFA 2EKHA 5KYYA 2VXEA 3FRNA 3L2ZA 2CH4A 2YUQA 4E2FB 1H3ZA 1K8AC 1OOTA 2DMOA 4C0FA 3VUBA 2IVWA 2DXCA 2CZ1B 3JB9J 4E7ZA 1ZSGA 3REAB 2XU8A 4RTWA 3G71Q 2AKLA 2HDAA 4RG2A 4BD3A 5GAN2 2DBMA 3AT1B 3C0CA 1VQ9Q 2O9VA 2DM1A 1JEGA 3VS6A 3OYLA 4OB1B 1RLQC 2R57A 2RMOA 2MWOA 1H641 2LNHB 1SG5A 1IZ6A 4F7UE 4J9HA 1SSHA 4JJBA 1VQ7T 3PMIA 3RESA 4LN2A 4M77B 1VQLT 1JXOA 4J6YA 1Y0MA 4OMMA 3NTHA 2DTHA 1VQPT 2DIQA 1JJ2P 3FLGA 3GP8A 1VQNT 3CC2T 2MYSA 4M7AC 2CT3A 4RTZA 3OYCA 2AZVA 1GCPA 2EGEA 4QVDA 1PRLC 1K1ZA 1ZUYA 1TWBA 1VYUA 3HRUA 3CCVQ 4FSSA 5GANg 1QW1A 1K9MR 3RERA 4NOYA 3VS0A 1YI2Q 5GAN7 1I4K1 1Q81U 5D6XA 4M78E 4IUQA 1XJWB 1VQ6Q 4NS5A 1ZSZA 1SF9A 1JJ2S 4AFSC 3OYHA 4HT8A 2RF0A 2HKNA 4FL6A 2D6FA 4AG1C 3CC7Q 1Y7XA 3A8GB 3GBQA 2QG9B 4UC4A 4C5HA 1XTDA 4RTYA 2LTOA 2ZPHB 4M75E 4KGXB 4C0ZA 4FT4A 3PE0A 3NHNA 4BI4A 2P0QA 1SKUB 4M7DG 2A3LA 5J26A 4EDUA 3NFCA 1YWOA 4JRIA 1KQSS 5A0DA 2RK1A 2ED1A 1WJQA 2FVUA 3HP9A 4C0DC 3O5ZA 3L2UA 4FCYA 4CC2A 2MOXA 1NE8A 2KY9A 3M0QA 1U3OA 2BTTA 4BY6C 4BE2A 2RI3A 5GAN8 1YJ9Q 2E41A 1BKBA 1YITQ 4PJOE 4KBMB 1X6GA 2X51A 1LVKA 4M75D 2ROLA 5KYYB 4HKEA 1HJDA 1CSKA 2E64A 1WHLA 3I5RA 3OBWA 1FMWA 1UHCA 2QQAA 4HCZA 3RKXA 1ZBXA 5FLXE 3J81E 2F2XA 2XICA 2XG8D 3LX7A 1VQ9A 2FEIA 2HEQA 4CRIA 2RM4A 1UFFA 1AEYA 2DL5A 2KVQG 2RQUA 2KI7A 3M0UA 3CD6Q 3JB9F 2G6FX 2CP3A 4JZ3A 2FYKA 2X3XD 1TXQA 3ULRB 2AK5A 2XD0A 1QVGP 1D09B 4Z8AA 2DO3A 4A54A 5GANe 5A0LA 4QQGA 3NMZC 3L2QA 5GAMf 4MZPA 1B3QA 2FG0A 3L2WA 2E4HA 2E10A 2OTJA 1M1KC 1I8FA 2HKQB 1P92A 1RACB 1ABQA 1MNDA 3DLMA 4PFPA 4F7UF 1NPRA 3S3MA 1A0NB 3QZ5B 1D0YA 3LLRA 1AOJA 4FW2A 1QVGS 1O9SA 2V8JA 4BE0A 1WLPB 4N4GA 2BIVA 2DE0X 1TG0A 3GF5A 1QCFA 3VRYA 4LE9A 4J9BA 5LJ3g 3CC7A 5I2MA 5AYFA 4OGEA 1PHTA 1D0XA 1VQLQ 3QDFA 4PK4A 5GJVB 2EFIA 1VQPQ 4KULA 3RR6A 1SHGA 3JCMX 1K9MU 4M78F 3CPWA 3CC2Q 1MMGA 1VQNQ 2AHJB 1M1FA 4ZN1A 2K3XA 3VS7A 2EYZA 5FRMA 2LCLA 3CXCP 3M5AA 3VU3C 4EPCA 1PC0A 4RTTA 1MV3A 2J7IA 3MPUB 5KYNA 4HCCA 1EX4A 1T0JA 3CC4A 4N4IA 2CREA 4LUDA 2XIDA 4F7UA 2PTKA 1ZUUA 4XU3A 1PSEA 3SD4A 3OYJA 1UJ0A 4RCBA 1ARKA 2XI9A 3PGGA 2YUOA 4X9DA 3CCUT 1QVPA 5GAOl 3J7AF 5KYWB 1YN8A 2RHXA 2K9GA 4QVCA 4CC3A 4E7SA 4BB7A 2XK0A 2EQMA 1H3HA 4PJOF 1K0SA 2ZPGB 4HA8A 1ZSZC 5GAN6 3Q1JA 1C0MA 4LD9K 1W4SA 4OMLA 1Q81C 1SRMA 2RN8A 3NGPA 2HQEA 3FJ5A 5GAMh 4M77D 3JCMh 4C8QG 4M78A 2KAFA 5CKDA 1IGUA 2LQNA 1UGRB 1NM7A 4BDZA 3BY7A 1TUCA 3V8LA 2NLUA 2LNVA 3SB2A 4EMKC 3X25B 2JZ2A 5LJ5h 2LX7A 4FYVB 1OPKA 2HL3A 2JS2A 1VQ8A 3QZ9B 2NUZA 2VWFA 4RG8A 2D1XA 4KH0B 2HNIA 5LJ3e 2PVOB 2A08A 2KXDA 3M54A 1QVFP 1GCQA 1OZ3A 1R0CB 2G3RA 2MIOA 2D0QB 1VIFA 4C5EA 5I21A 3NPFA 2Y90A 1B07A 1JJ2A 1Q7YR 2X4JA 4BI8B 1QKXA 2C0OA 3LW5E 1N9SA 5DLQE 4GY5A 2CZ6B 5CVIA 4ZTJA 3GLXA 2EYXA 3CC2A 2CS7A 1QVFS 2QGGA 4D8DA 2WSEE 4C92G 4A4HA 1VA7A 1AZGB 2F1LA 1KQSA 5EC7A 3V8JA 2D8JA 3A8HB 1N8RR 3M4GA 3PMTA 1QLYA 4PFZA 2JVVA 3C94A 1U1TA 2MI6A 3ASKA 4XTZA 2O88A 2L3SA 3D7SB 3L1AA 1QMCA 1I07A 4OB2B 3VS2A 1M1GA 1OX9A 1X6BA 3WVEB 4MMLA 3RKYA 3I56A 5FU6C 1V29B 3M0SA 3A8MB 3DLLA 2OAUA 4LNPA 4OF1A 4F7UB 2DPPB 2K7AA 2D8HA 3I9QA 4C8QC 3H9NA 4MDXA 2EAYA 1YWPA 4FYXB 4A4FA 1PM3A 2PQWA 4M7AA 3FIFA 4EMHA 1XNIA 1Q86R 3GNGA 1I5LA 3SFMA 4Z89A 1D1BA 2O4XA 2EPDA 2RQWA 2VVKA 2KRSA 1ZLMA 1HK9A 2CP7A 4M78B 2ZPFB 2QTXA 3NTKA 1WQ7A 1AWOA 2DNUA 3MP8A 3TREA
chains in the Genus database with same CATH topology
1BI0A 3JB9J 2X35A 4QQDA 1OI1A 1VQ5A 1K9MC 5KE2A 1N8RC 2XU8A 3G6ET 2EQJA 5I2SA 2Y4XA 1UGQB 3MP1A 5FU6B 1KC8C 5HK3A 3RIRA 1QVGA 2PVGB 1X6OA 3QXEB 4RG2A 2F5TX 4BD3A 2DXTA 3M53A 5GAN2 3CMAT 1Y71A 3M57A 5D6WA 2OTJT 1YBYA 3OMGA 1YIJT 1PSFA 2GFAA 4C8QB 4QQ6A 3OYLA 5DY9A 4C92C 3LWIA 5FRNA 4OB1B 5HKCA 3MEUA 3QBYA 2R57A 1VQ4T 1N27A 2MWOA 5KCHA 2M16A 1H641 3OYYA 4PL6A 3JCMc 1IZ6A 4Y28E 4F7UE 2RD1A 5CIUA 1Y96B 1KD1U 3G71T 1RI0A 3X26B 2WSFE 2CZ0B 3QYGB 1VQ7T 4J7FA 5GAN5 1M8VA 4RMOA 3PMIA 3RESA 3JCMf 3H6ZA 4M77B 4JLGA 1VQLT 4TVRA 1U8RA 3I55T 3OBYA 4J6YA 2RHYA 4YTLA 3CCQA 1BI2A 1K73C 3CCET 3CCVA 4M7AF 4HT9A 3GNFB 3VYHB 3NTHA 2DTHA 1VQPT 4M7DE 4IUPA 2RB6A 2ZPEB 2DIQA 4IUVA 3CC7T 3VJPA 3FLGA 2QDYB 5HK0A 3GP8A 1YI2A 3INZA 3CC2T 2EYQA 2LDMA 1R8OB 1VQNT 3JB9G 4PJOB 3M55A 5LJ5f 3MHXA 3OYCA 1VQOT 4M7AC 1VQ6A 4QVDA 4O6JA 3TCJA 2JUFA 4MZMA 1YJWA 3HRUA 3GPLA 3EAEA 5GANg 5J39A 3OYBA 1QW1A 3RERA 4NOYA 1Q86C 2MF2A 5GANj 5GAN7 2RJEA 1YCYA 1G3TA 1I4K1 1KHCA 1Q81U 3CBMA 5D6XA 4M7AD 2A7YA 4M78E 4IUQA 1B34B 4NS5A 3QG1A 1D3BA 5CQXA 3OY9A 1OZ2A 2RO0A 3FB9A 1JJ2S 1K8AU 2HBPA 3CEYA 3HFNA 2GFUA 3OYHA 4HT8A 3CXCA 1AHJB 2RI5A 4FL6A 2D6FA 5CR2A 3CCSA 1N8RU 1Y7XA 3A8GB 2I2LA 1LNXA 2WSCE 4UC4A 3HFOA 5FU7C 4C5HA 4C92B 4DOWA 1XTDA 3CCLT 1NPPA 2KDSA 2LTOA 4JDSA 2ZPHB 3CCRT 4M75E 1S72T 4C0ZA 4FT4A 1N6AA 4OB3B 2QEXA 3M9QA 3NTIA 3CC4T 1M90U 4BDYA 5CKEA 2XHCA 5GMKi 3JCMV 3MO8A 2DXUA 4E7KA 3JB9H 2QQRA 3MCAB 2P0QA 4FSXA 4XK8E 4BI4A 4C8QE 2A3LA 5J26A 4EDUA 3OMCA 3NFCA 3ZBDA 2QQ9A 5GAOq 2HAXA 1KQSS 4JRIA 3BDLA 4OP0A 4XTWA 3UDCA 5LJ3f 5A0DA 2RK1A 1IREB 4MZTA 2DD5A 5CK9A 3C4SA 3OS1A 1WJQA 5A0GA 4ZGEB 4M75F 5CQYA 3BW1A 3JCMJ 1YJ9A 2FVUA 3HP9A 4Q5WA 1UB4A 4PLLA 5IN1A 4C0DC 3OB9A 1DJ7B 4M7AB 5GAOp 3L2UA 1YITA 4M77E 3SWNA 3HSBA 4ZGDB 2MMPA 4XQ3A 3OYFA 1NE8A 4LDUA 2KY9A 4R55A 1W2BA 1FXXA 2VGMA 1X01A 4BY6C 5GMKm 4BE2A 1M4ZA 3BFMA 2RI3A 4JS5A 2JNGA 3E19A 5GMKl 5GAN8 2E41A 3ZEHA 1BIBA 2P0PA 1BKBA 3FJPA 4PJOE 4KBMB 3RMSA 2X4YA 3OW2S 4M75D 4HKEA 5GMKh 4M7DA 1YHQT 1BYMA 3X24B 2D9TA 3G4SA 1QP2A 2E64A 2HQXA 3HL8A 4II1A 2R5MA 4ME7A 3OBWA 4OB0B 3OYGA 3L2VA 3S3OA 1MGQA 3HHTB 3CD6A 2QQAA 4HCZA 3A5ZB 3QHSA 3RKXA 3QKJA 3X20B 1ZBXA 2EKOA 4XTVA 5FLXE 3J81E 1I81A 2XICA 2Y4YA 2XG8D 4M75G 4Z02A 3LX7A 3CCJT 1VQ9A 1M9SA 1VQ5T 4CRIA 1BI3A 2RM4A 1QP3A 3EFSA 3JCMb 2K5LA 3CMET 5FU7B 2KSSA 4FM4B 2KVQG 1VQ8T 3JCMd 3LWHA 5C6SA 3JB9F 2R5AA 3V7RA 3VKIA 2LVMA 4DOVA 2VC8A 4JRKA 2JTMA 2P4TA 3OQ5A 5KH6A 2FYKA 4BUGA 5M9OA 4BE1A 2QA4A 4JRPA 1XOVA 2L3RA 4C92E 4Y91A 3PTAA 1HXDA 3JCMW 2XD0A 3WVDB 5GAOr 5CAIA 2DO3A 2ZPBB 3G6EA 1QVFA 5LJ5d 2L8DA 4A54A 3JCMP 3OYNA 2JTFA 1Q82C 5GANe 3QYHB 1XQHA 5A0LA 3ZFJA 3LGFA 3CBPA 4QQGA 1G3SA 5GAN3 4C0DB 3L2QA 5GAMf 3LH0A 1VIEA 4MZPA 3JB9D 1KQ1A 3L2WA 2QA4T 2DIGA 3V7CA 4C5IA 3QJ6A 2E10A 4M75A 3RUXA 2OTJA 1M1KC 4P5NA 4C5GA 5C0MA 1LOJA 4PJOG 1YIJA 1I8FA 4LDVA 3PIPA 2EQUA 2OTLT 1P92A 3QIIA 2K57A 3VV0A 4BY6B 2BUDA 3UWNA 3DLMA 1ZQ1A 1VQ4A 3SWNC 1NPRA 4F7UF 3S3MA 3QZ5B 3LLRA 2E6ZA 4L5GA 3SDZA 2PU9B 1QVGS 2YLBA 2VV5A 2PUOB 1SSFA 1VQ7A 1O9SA 2V8JA 1Q7YU 4BE0A 3QPHA 4IKFA 4JRQA 4N4GA 2BIVA 2LCCA 1VQLA 3PFSA 3GF5A 1VQKT 4PKCC 4M7DF 4JLIA 3CCMT 3CCEA 3JCMQ 2CYZB 4N4HA 1VQPA 2EJGA 5LJ3g 3CC7A 1KHIA 3DKMA 2IG0A 2ZPIB 3JSCA 5AYFA 5I2MA 1VQNA 4OGEA 1D3BB 2GCXA 2RHIA 2LQ8A 3V7SA 4XTUA 1UEBA 4OGCA 4R56A 1VQOA 2K5FA 4PJOA 2O01E 4XU2A 3OYKA 2DTOA 4L59A 4PNOA 2LT1A 2DZCA 3OYMA 5LJ3d 2EFIA 2X4XA 5LJ3h 2RK2A 3TREA 4KULA 3JCMX 4A4GA 3OS5A 1K9MU 4F7UG 2VXFA 4M78F 1G3WA 3I56T 3CPWA 4M7DD 2AHJB 3E1SA 1M1FA 4MMKA 4ZN1A 4ELZC 5GAOn 1KC8U 2XDBA 2K3XA 3QSUA 4RKUE 4EMKA 1VUBA 2HD0A 3A8LB 2RHUA 4LDYA 1X75C 2LCLA 3GOXA 1B34A 2QEXT 5FRMA 3M5AA 3VU3C 3WXMB 4EPCA 4N0AA 2MWPA 1KG1A 4XTXA 4KUDK 4BI3A 1NZ9A 5FROA 1YJNT 4JS4A 2DKGA 4HCCA 2PUKB 1JRIA 4VUBA 4M78D 5DLOA 2KQWA 4B9XA 3CCLA 2DXBA 4M7DG 2EIFA 2F5KA 3M56A 3CCRA 1S72A 3O8VA 3CC4A 2E12A 4M75C 4N4IA 2CKKA 2K5IA 3ME9A 2E65A 1KD1C 2FHDA 2KK4A 2XIDA 2M1HA 3C12A 4C8QF 4F7UA 5GANf 5IT9E 1VQMA 1WQWA 4XU3A 3M58A 1K73U 2DEQA 2RA2A 4M78G 2O4XB 1PSEA 3SD4A 3TU4K 5GMKj 2EJ9A 1WNLA 1UGPB 3P8HA 3OYJA 4E7IA 4RCBA 2XI9A 2RHZA 3PGGA 4ZTFA 4IUUA 2QXFA 5GAOm 4M77F 4X9DA 3CCUT 1QVPA 5GAOl 3J7AF 5L8RE 3MEAA 2RHXA 2RJFA 3QDRB 4QVCA 2BKDN 2V8KA 2LQKA 1LJOA 3QUIA 1WJRA 4BB7A 4C8QD 5GAMg 4A4KA 3FC3A 3JCMg 1Q86U 4O5VA 2XK0A 1FWZA 3PNWC 2EQMA 2MAMA 4LDWA 4HCBA 4PJOF 2ZPGB 4HA8A 2ZGWA 4PLIA 5GAN6 3Q1JA 4CI0C 2F69A 2RJDA 3HRSA 3OSVA 1VQ9T 1JBMA 4IURA 3S6WA 1W4SA 4LD9K 2VUBA 1Q81C 3AHUA 5GAMd 2RJCA 2HQEA 5A2QE 5GAMh 2GF7A 2VYTA 4M77D 2DD4A 3JCMh 3G7ZA 4M78A 2KAFA 4C8QG 5CKDA 3OA6A 1YHQA 5LJ5g 4ELYC 3CBOA 1RL2A 5LL6S 3TEEA 2X4WA 1UGRB 5CO7A 2LT4A 4BDZA 2E5QA 3BY7A 5LJ5j 1W2BS 3V8LA 2NLUA 3H8ZA 4WF2A 4EMGA 2YHTA 3E9FA 2LNVA 3RMQA 5D6YA 2EWNA 3SB2A 4EMKC 3URGA 1MHNA 5KE3A 3CCJA 4PJOD 4M77G 1GXIE 3OSSC 4ZN3A 3X25B 2JZ2A 5LJ5h 3QJYA 4A4EA 5IAYA 3CMEA 4JUVA 2V8IA 2JN0A 4N0AC 2WACA 3F70A 3P8DA 4OVAA 1VQ8A 3QZ9B 4ATOA 4KT0E 3DB4A 4RG8A 4M75B 3OYEA 3CMAA 1M90C 2HNIA 5LJ3e 4FIBA 2PVOB 4NL2A 3VUZA 1BI1A 2DJZA 4JJNK 1M5Q1 4V2SA 4C92F 4NL3A 2CZ7B 3M54A 3CCQT 1OZ3A 2G3RA 3CCVT 2D0QB 1VIFA 4XTYA 2L89A 4C5EA 4C8QA 4QW2A 2GQVA 4L6V5 4M7AE 2FB7A 4E47A 1WJSA 1YI2T 3PT9A 4X34A 5I21A 2Y90A 3JRZA 1Y96A 1VQ6T 4C0GA 1JJ2A 1JB0E 3QO3A 5J3BA 4A53A 1ZHIA 2X4JA 2LX9A 3M59A 4BI8B 1YJWT 2R58A 1U1SA 3BDUA 3I55A 4M77A 2OTLA 5CCAA 2K3YA 3A8OB 4C92D 3OS0A 1OYXA 3LW5E 4FT2A 1N9SA 4J6WA 4MDWA 5DLQE 5EG2A 3R6OA 4GY5A 2CZ6B 2QQBA 5CVIA 4D6WA 4ZGJB 5GAN4 2EJFA 4ZTJA 2JOYA 3GLXA 4M7DC 3VYGA 3CC2A 3JB9I 2LRQA 3MP6A 2CS7A 1QVFS 3L42A 5LJ3j 4GLKA 3X28B 3RKWA 3MEVA 1NJIC 4OMFB 5DM7R 2WSEE 4J6XA 4QVZA 1BIAA 4C92G 4A4HA 1KQSA 3OS2A 2ZZDA 1VQKA 3V8JA 3A8HB 1N9RA 3M4GA 3CCMA 3CCST 2QI2A 3PMTA 4RCCA 5KCOA 3JAME 3KUFA 4M78C 4EMKB 5GMKe 2XDDA 4E7HA 2JVVA 2LC4A 3C94A 3GIBA 3S3NA 1U1TA 3EFRA 5GANd 5GANh 2L5QA 2YLCA 2B8AA 3LYIA 2MI6A 4X9CA 3ASKA 3MEWA 4J5YA 1Y07A 3HPWA 4XTZA 4E7LA 3PIOA 4DQ2A 3L1AA 4OB2B 3META 1M1GA 2E1HA 4J7IA 3J80E 4M7AG 3WVEB 4MMLA 2DAQA 3RKYA 3L2RA 3I56A 4LD6A 1Q82U 2QQSA 3V8KA 3UT1A 2FL7A 5FU6C 1V29B 3C95A 3OW2A 1YJ9T 5GAMe 4XU1A 2CGHA 3SWNB 4C92A 3A8MB 3JCMe 4IUTA 3DLLA 1YITT 2C06A 2OAUA 2RH2A 3OYAA 2VGNA 4OF1A 2DTIA 4F7UB 1KQ2A 2K2VA 1M1KU 2RI2A 2DPPB 2P0KA 1VQMT 3OYIA 1WGSA 4C8QC 3CXCS 4E7JA 4DA4A 1YJNA 1O75A 3E9GA 4KUIA 2EAYA 4MDXA 5LJ5e 4FU6A 4J8OA 3UPUA 3CPWS 3P8BB 3ER0A 4A4FA 2KMTA 4M7DB 4J83A 5CKFA 3DB3A 1WPYA 2M0OA 2PQWA 2PVDB 2DK3A 3N5BB 5CKHA 3G4ST 4M77C 4BACA 4M7AA 2DZ9A 2YRVA 1UGSB 3FIFA 4EMHA 1XNIA 3CPFA 3T9NA 3CD6T 3HKSA 1Q7YC 2ZCFB 3GNGA 2EQKA 1I5LA 3SFMA 3FEOA 5GAMj 4LDXA 2K4YA 2O4XA 2E70A 4XAXB 5HY6A 3OYDA 2H3JA 4PJOC 2DVEA 2M9UA 4B9WA 2XDPA 3CCUA 1HK9A 2E6NA 4M78B 2XKOC 1NJIU 1FX7A 1EIFA 2ZPFB 2VXEA 3KBGA 3HRTA 1TH7A 3FRNA 2QTXA 5CKBA 3L2ZA 3G71A 3NTKA 3LGLA 1WQ7A 1H3ZA 1K8AC 3FDRA 3KXTA 1G3YA 4XU0A 4C0FA 3M4YA 1G5VA 3VUBA 3MP8A 2IVWA 2DXCA 2CZ1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y96 A;  2VXF A;  4M78 F;  4F7U G;  3JB9 J;  3HSB A;  4M7D D;  3QO3 A;  4A53 A;  4XQ3 A;  4MMK A;  5GAO n;  1U1S A;  3QSU A;  3BDU A;  4M77 A;  1X01 A;  4EMK A;  5GMK m;  3BFM A;  3RIR A;  4C92 D;  3JCM P;  1B34 A;  4J6W A;  1N9S A;  5GMK l;  3VU3 C;  5GAN 8;  2E41 A;  1BIB A;  2DXT A;  4N0A A;  5GAN 2;  3FJP A;  2EJF A;  5GAN 4;  4M7D C;  4PJO E;  4XTX A;  3JB9 I;  4M75 D;  5LJ3 j;  5GMK h;  4M7D A;  3RKW A;  4C8Q B;  2DKG A;  2E64 A;  5DY9 A;  4C92 C;  4J6X A;  1JRI A;  4M78 D;  1BIA A;  1MGQ A;  4C92 G;  1H64 1;  3QHS A;  3RKX A;  3JCM c;  4XTV A;  2RD1 A;  4F7U E;  1Y96 B;  3V8J A;  1I81 A;  1N9R A;  3M4G A;  4M75 C;  2E65 A;  4M75 G;  5GAN 5;  4RCC A;  1M8V A;  3RES A;  4C8Q F;  3JCM f;  5GAN f;  4M77 B;  4F7U A;  2RM4 A;  4M78 C;  1WQW A;  4XU3 A;  4EMK B;  5GMK e;  3EFS A;  3JCM b;  2DEQ A;  3GIB A;  2RA2 A;  4M78 G;  1U1T A;  4J6Y A;  3EFR A;  5GAN d;  3JCM d;  5GMK j;  2EJ9 A;  1WNL A;  5GAN h;  3JB9 F;  2YLC A;  4HT9 A;  4M7A F;  4RCB A;  4M7D E;  3V7R A;  2DTH A;  3PGG A;  4X9C A;  4J5Y A;  4XTZ A;  2RB6 A;  5GAN j;  2VC8 A;  4DQ2 A;  4JRK A;  5GAO m;  3L1A A;  4M7A C;  3INZ A;  4M77 F;  2E1H A;  2FYK A;  4X9D A;  3JB9 G;  4M7A G;  5GAO l;  4PJO B;  5LJ5 f;  4MML A;  4C92 E;  4Y91 A;  3RKY A;  4QVD A;  1HXD A;  3JCM W;  4QVC A;  5GAO r;  5CAI A;  3V8K A;  3QUI A;  1LJO A;  5LJ5 d;  4A54 A;  4C8Q D;  5GAM g;  5GAM e;  4XU1 A;  2CGH A;  3SWN B;  3JCM g;  4C92 A;  5GAN e;  3JCM e;  5GAN g;  3RER A;  4NOY A;  4PJO F;  5GAN 3;  5GAN 7;  1YCY A;  2DTI A;  1I4K 1;  2ZGW A;  4HA8 A;  4F7U B;  5GAM f;  5GAN 6;  1KQ1 A;  3JB9 D;  1KQ2 A;  4M7A D;  4M78 E;  1JBM A;  3V7C A;  4M75 A;  2E10 A;  3RUX A;  3AHU A;  1B34 B;  1LOJ A;  4PJO G;  4C8Q C;  1I8F A;  5GAM d;  5GAM h;  4M77 D;  2K57 A;  3JCM h;  4C8Q G;  4M78 A;  1D3B A;  2EAY A;  3SWN A;  5LJ5 g;  5LJ5 e;  3FB9 A;  3SWN C;  3HFN A;  4F7U F;  4HT8 A;  4M7D B;  3BY7 A;  5LJ5 j;  3V8L A;  1WPY A;  4WF2 A;  4EMG A;  2YHT A;  2YLB A;  2EWN A;  4M77 C;  2DZ9 A;  3SB2 A;  4EMK C;  3FIF A;  4EMH A;  2I2L A;  4M7A A;  4M77 G;  4PJO D;  1LNX A;  4C92 B;  3HFO A;  5LJ5 h;  4JUV A;  4M75 E;  2JN0 A;  4N0A C;  1I5L A;  4M7D F;  4JLI A;  5GAM j;  3JCM Q;  5GMK i;  3JCM V;  4M75 B;  2EJG A;  2DXU A;  2HNI A;  5LJ3 e;  5LJ3 g;  3JB9 H;  4PJO C;  2DVE A;  4NL2 A;  4M7D G;  5GAO q;  2DJZ A;  4C8Q E;  1M5Q 1;  4V2S A;  4C92 F;  4NL3 A;  1HK9 A;  1D3B B;  4M78 B;  3V7S A;  4JRI A;  4OP0 A;  4XTW A;  4XTU A;  5LJ3 f;  2VXE A;  4PJO A;  1TH7 A;  4XTY A;  4XU2 A;  4C8Q A;  2DTO A;  2QTX A;  3L2Z A;  4PNO A;  4M7A E;  2FB7 A;  2DZC A;  4M75 F;  1WQ7 A;  3BW1 A;  5LJ3 d;  3JCM J;  5LJ3 h;  5I21 A;  4XU0 A;  3JCM X;  5GAO p;  2Y90 A;  4M7A B;  4M77 E; 
#chains in the Genus database with same CATH topology
 3CCU Q;  1AD5 A;  1K9M C;  1JXM A;  2EQJ A;  1M27 C;  5HK3 A;  1QVG A;  2PVG B;  1RAD B;  1X6O A;  1U06 A;  2F5T X;  4KGZ B;  3VS3 A;  4KRT A;  3CMA T;  1Y71 A;  2OTJ T;  3OMG A;  1PSF A;  2GFA A;  3M0R A;  4C92 C;  2P4R A;  3MEU A;  1UDL A;  1N27 A;  3OYY A;  4PL6 A;  3JCM c;  5CIU A;  1WXU A;  4DBR A;  1M8V A;  4RMO A;  3H6Z A;  1KIK A;  3EG3 A;  4JLG A;  1CKA A;  2EGA A;  2ATC B;  2RHY A;  3CCQ A;  3UAT A;  3GNF B;  2FZC B;  5AT1 B;  4IUP A;  2RB6 A;  3CC7 T;  1FMK A;  5I22 A;  2QDY B;  1GFD A;  2LDM A;  4PJO B;  4J9E A;  2DL3 A;  2DIL A;  3EG9 A;  2CP6 A;  2J05 A;  3KFV A;  5J39 A;  2QAS A;  2CSI A;  4AFZ C;  1KC8 R;  4LUE A;  2A7Y A;  1SPK A;  2IPO B;  5IHK A;  2NUT A;  1B34 B;  1M30 A;  2BE7 D;  3CEY A;  3I35 A;  3CXC A;  1TS9 A;  3LH5 A;  1N8R U;  1PKT A;  2LP5 A;  5FU7 C;  2KDS A;  2GGR A;  2EW3 A;  3CC4 T;  1N6A A;  4OB3 B;  4BDY A;  5CKE A;  5GMK i;  3JCM V;  3MO8 A;  2YWW A;  1K73 R;  2DYI A;  4PJM A;  4FSX A;  4XK8 E;  4C8Q E;  1V76 A;  3OMC A;  3ZBD A;  1C6V X;  5LJ3 f;  4F04 B;  1IRE B;  5I11 A;  5A0G A;  8ATC B;  2FPD A;  3OB9 A;  1DJ7 B;  4M7A B;  4XQ3 A;  2O9S A;  2DRM A;  4LDU A;  4R55 A;  1WHJ A;  2VGM A;  1N5Z A;  5GMK l;  2GTJ A;  2DYB A;  2YXY A;  5GMK h;  4M7D A;  1J3T A;  2IIM A;  4II1 A;  4ME7 A;  2R5M A;  3OYG A;  1MGQ A;  3HHT B;  3EGU A;  3A5Z B;  4A63 B;  3UA7 A;  3X20 B;  1IHV A;  2CP5 A;  4Z02 A;  5IH2 A;  2KSS A;  4FM4 B;  1VQ8 T;  3JCM d;  5C6S A;  1TUG B;  3VKI A;  4DOV A;  2J6K A;  5KH6 A;  2AKK A;  2QA4 A;  4JRP A;  4C92 E;  2L3R A;  6AT1 B;  4Y91 A;  1HXD A;  2ZPB B;  1QVF A;  5LJ5 d;  2JTF A;  2FPE A;  1XQH A;  2L0A A;  4C0D B;  1UE9 A;  3LH0 A;  1VIE A;  1HYO A;  3JB9 D;  1WXT A;  2FZG B;  4C5I A;  2DRK A;  5C0M A;  1LOJ A;  2FZK B;  2K57 A;  4BY6 B;  2BUD A;  3UWN A;  3SWN C;  3CMA Q;  3SDZ A;  2OTJ Q;  3EG9 B;  2YLB A;  1SSF A;  1FYN A;  3EH2 A;  4JLI A;  1AWW A;  1UUE A;  2CP2 A;  1D1A A;  2NUT B;  1KHI A;  3DKM A;  4PJN A;  2QGF B;  2GCX A;  3V7S A;  2RHI A;  2E3H A;  1WHM A;  4XTU A;  4AG2 C;  2K5F A;  4L59 A;  4PNO A;  2LJ3 A;  3MJX A;  1PWT A;  5LJ3 h;  2RK2 A;  4D8K A;  4AMC A;  1Q82 R;  1QKW A;  3I56 T;  2NUP A;  3E1S A;  1KC8 U;  2Z0W A;  3QSU A;  4RKU E;  4EMK A;  1X75 C;  3GOX A;  2QEX T;  2MWP A;  4XTX A;  1K9A A;  2YRC A;  1NZ9 A;  2FO0 A;  1M3C A;  4VUB A;  4M78 D;  4EIK A;  4B9X A;  3CCL A;  5KYU A;  3M56 A;  1BCO A;  2E12 A;  2CKK A;  1RAH B;  3ME9 A;  2FHD A;  2KK4 A;  4C8Q F;  2M1H A;  5IT9 E;  1WQW A;  2CSQ A;  3UA6 A;  1K73 U;  2RA2 A;  3TU4 K;  1UGP B;  1AWJ A;  2RHZ A;  5HCK A;  3CC4 Q;  2QXF A;  5GAO m;  2NWM A;  4QT7 A;  1NJI R;  5L8R E;  4AT1 B;  2V8K A;  4O5V A;  3VS4 A;  4AFU C;  4RUG A;  4CI0 C;  2ABL A;  2F69 A;  3S6W A;  2C0T A;  2DD4 A;  1YHQ A;  3CBO A;  1RL2 A;  1AT1 B;  3TEE A;  5CO7 A;  1GBR A;  5LJ5 j;  2JM9 A;  3E9F A;  5FWC A;  3URG A;  4PJO D;  1GXI E;  3CCJ A;  2JMC A;  2ECZ A;  2K79 A;  1KD1 R;  1I1J A;  4N0A C;  2JN0 A;  3P8D A;  4ATO A;  3CMA A;  2LMJ A;  2GBQ A;  4NL2 A;  3VUZ A;  1OEB A;  4C92 F;  3CCQ T;  1ACM B;  2E5K A;  4XTY A;  2L89 A;  4C8Q A;  2VAS A;  1VQ8 Q;  4M7A E;  4E47 A;  3H0H A;  2HMA A;  1Y96 A;  4C0G A;  1JB0 E;  3QO3 A;  4A53 A;  3RBB B;  3M59 A;  1U1S A;  2OTL A;  3JCM P;  4J6W A;  5EG2 A;  4M7D C;  2L3Q A;  3VS1 A;  2JOY A;  1U5S A;  1ZSZ B;  4J9D A;  4GLK A;  5GJW B;  3RKW A;  1QCN A;  3MEV A;  1K8A R;  3EGX A;  4QVZ A;  2KEA A;  1X2K A;  1X2Q A;  2ZZD A;  1VQK A;  3CCM A;  1TU0 B;  2XDD A;  4EMK B;  5GMK e;  3EHQ A;  2KT1 A;  3EFR A;  5GAN d;  2YLC A;  2KRO A;  3MEW A;  3HPW A;  3PIO A;  4OMO A;  3JV3 A;  1RI9 A;  2E1H A;  2DAQ A;  1Q82 U;  2QQS A;  4GBQ A;  2FL7 A;  4XU1 A;  2CGH A;  4C92 A;  2OX7 A;  2RH2 A;  2FRY A;  3OYA A;  2VGN A;  1G83 A;  2DTI A;  1HD3 A;  2W10 A;  1LCK A;  3EFO A;  3RNJ A;  3I56 Q;  3CXC S;  3OW2 P;  4KUI A;  4F16 A;  4FU6 A;  2QEX Q;  1UEC A;  2DET A;  2GNC A;  2M0O A;  2J6F A;  3SHW A;  3T9N A;  2ZCF B;  2RQT A;  5HY6 A;  2E70 A;  3SEM A;  2KRM A;  3OYD A;  4KH1 B;  1RAI B;  1NJI U;  1S1N A;  2JM8 A;  3H0F A;  1EIF A;  3EG1 A;  3LGL A;  1G3Y A;  4XU0 A;  2CDT A;  2QA4 T;  1BI0 A;  2X35 A;  4QQD A;  1OI1 A;  3TSW A;  1BCM A;  5I2S A;  2Y4X A;  1IGQ A;  2O31 A;  5FU6 B;  2QDL A;  1KC8 C;  2PNI A;  4RTV A;  2DXT A;  3M53 A;  3EGD A;  3M57 A;  5D6W A;  1H92 A;  1ZA1 B;  2D0N A;  4C8Q B;  4QQ6 A;  3LWI A;  5DY9 A;  3QBY A;  2BZ8 A;  4J9C A;  5KCH A;  1KD1 U;  2RD1 A;  1Y96 B;  3X26 B;  2WSF E;  3PVL A;  3QYG B;  4J7F A;  5GAN 5;  2EQI A;  1WHK A;  4TVR A;  2DX1 A;  3I55 T;  3OBY A;  1M8M A;  1K73 C;  4M7A F;  4M7D E;  1WYX A;  4RTX A;  3VJP A;  5HK0 A;  2EYQ A;  3JB9 G;  3M55 A;  3EGX B;  2B86 A;  3TCJ A;  3CCQ Q;  1YJW A;  2SEM A;  2FPF A;  3OYB A;  1VYT A;  2MF2 A;  5GAN j;  1YCY A;  1G3T A;  1KHC A;  3EG2 A;  3CBM A;  1KK7 A;  4OMN A;  3QWY A;  2DJQ A;  3OY9 A;  2EYY A;  2RO0 A;  3FB9 A;  1K8A U;  2HBP A;  3HFN A;  1NYF A;  2GFU A;  2P84 A;  1NEB A;  1AHJ B;  1ZX6 A;  2RI5 A;  5CR2 A;  3CCS A;  3MKD A;  2PZ1 A;  1LNX A;  2WSC E;  4C92 B;  3HFO A;  2DVJ A;  3CCL T;  4JDS A;  1TOV A;  2QEX A;  3NTI A;  1M1K R;  3A98 A;  3EFO B;  1ABO A;  1M3B A;  3MCA B;  1G5V A;  4XTW A;  4OMQ A;  4MZT A;  5CK9 A;  3C4S A;  3OS1 A;  1TUD A;  1OPL A;  4K11 A;  4ZGE B;  5CQY A;  3BW1 A;  5IHN A;  4Q5W A;  2EYW A;  3SWN A;  3HSB A;  1OQK A;  1OUL A;  1V1C A;  2MMP A;  2ESW A;  2YSQ A;  1YNZ A;  1X01 A;  5GMK m;  1M4Z A;  2JNG A;  3E19 A;  4Y92 A;  1D0Z A;  1PG5 B;  3RMS A;  2X4Y A;  1YHQ T;  1BYM A;  3G4S A;  2CUD A;  3QKJ A;  4XTV A;  1I81 A;  4WTO B;  2CP0 A;  4M75 G;  5FW9 A;  3CCJ T;  1GFC A;  1VQ5 T;  1BI3 A;  1PD1 A;  2DBK A;  1QP3 A;  4E6R A;  3JCM b;  5FU7 B;  1RAF B;  5FWB A;  3LWH A;  1UGV A;  3EGD B;  8AT1 B;  1K76 A;  1K4U S;  4JRK A;  2JTM A;  3OQ5 A;  4BUG A;  5M9O A;  1WI7 A;  1XOV A;  3JCM W;  1SEM A;  3WVD B;  3G6E A;  1SRL A;  1Q82 C;  1AZE A;  3OYN A;  3QYH B;  3ZFJ A;  3LGF A;  3CBP A;  2DFU A;  5GAN 3;  1W1F A;  1EFN A;  1NG2 A;  2DIG A;  3V7C A;  2QA4 Q;  4P5N A;  4C5G A;  1YIJ A;  4PJO G;  2OTL T;  2EQU A;  1AWX A;  3QII A;  3CME Q;  1BU1 A;  1VQ4 A;  2KT8 A;  1KSW A;  2VV5 A;  2PUO B;  1WHH A;  1Q7Y U;  4IKF A;  2JS0 A;  2LCC A;  1R77 A;  1VQK T;  1X69 A;  4M7D F;  3CCM T;  3CCE A;  2CYZ B;  2COY A;  4OMP A;  4N4H A;  2EJG A;  2YT6 A;  3JSC A;  2LQ8 A;  1YFN A;  4OGC A;  1VQO A;  4XU2 A;  3OYK A;  3I55 Q;  2DTO A;  3OYM A;  2OJ2 A;  1CKB A;  2DL7 A;  1G3W A;  4ANJ A;  5GAO n;  4ELZ C;  1WX6 A;  1VUB A;  3A8L B;  4LDY A;  4N0A A;  1T0H A;  1RAE B;  5IXF A;  1T3S A;  3UF4 A;  3CPW P;  4BI3 A;  5FRO A;  2V26 A;  1MV0 B;  2DKG A;  4PJJ A;  2DXB A;  4F17 A;  1VYV A;  2EIF A;  2F5K A;  3CCR A;  1S72 A;  4M75 C;  2GTO A;  2V1R A;  2K5I A;  1KD1 C;  2E65 A;  2GQI A;  2DEQ A;  4X1V A;  2O4X B;  1E6H A;  2QYZ A;  2EJ9 A;  3CCL Q;  3P8H A;  4E7I A;  2YUN A;  1W2B P;  2K2M A;  3MEA A;  1IXD A;  3QDR B;  4JJD A;  1G8X A;  3QUI A;  2LQK A;  1WJR A;  4C8Q D;  3FC3 A;  1Q86 U;  4A4K A;  3PNW C;  1FWZ A;  1QQJ A;  2MAM A;  4LDW A;  2ZGW A;  2RJD A;  5KYX A;  2A36 A;  3AHU A;  1ZA2 B;  9ATC B;  2RJC A;  5GAM d;  2GF7 A;  3OA6 A;  4JJC A;  3IQL A;  1MMD A;  2LT4 A;  2E5Q A;  1W2B S;  1RAB B;  3RMQ A;  5D6Y A;  1MHN A;  1Z9Q A;  5KE3 A;  2A37 A;  4M77 G;  3M0P A;  4ZN3 A;  1YHQ Q;  3QJY A;  4A4E A;  3CME A;  4HVU A;  1WZO A;  1JO8 A;  2DJZ A;  3CCJ Q;  2CZ7 B;  1G2B A;  2DLP A;  1VQ5 Q;  3M0T A;  1WJS A;  2KYM A;  3JRZ A;  5J3B A;  1YJW T;  2R58 A;  3BDU A;  3I55 A;  2NYS A;  5CCA A;  2K3Y A;  4C92 D;  1OYX A;  4MDW A;  5HKC A;  2DEU A;  4D6W A;  2QQB A;  3ZL7 C;  4ZGJ B;  1TTH B;  4J9G A;  3U23 A;  3JB9 I;  3MP6 A;  4IIO A;  3L42 A;  4OMF B;  2OTL Q;  3OS2 A;  4HXJ A;  1WIE A;  3CCS T;  2BE9 B;  1FMV A;  3JAM E;  3KUF A;  2KYB A;  4E7H A;  2LC4 A;  2MPX C;  4F14 A;  3S3N A;  1M90 R;  2X9H A;  4CC7 A;  2L5Q A;  1KQS P;  3LYI A;  1ZUK A;  4E7L A;  1VQK Q;  4R0K A;  3CCM Q;  1IRX A;  3MET A;  4J7I A;  2LJ0 A;  2COW A;  3L2R A;  4LD6 A;  3UT1 A;  1WFW A;  2AIR B;  1IB8 A;  4IUT A;  2EGC A;  2FRW A;  2L3P A;  1KQ2 A;  2K2V A;  1PRM C;  1W70 A;  2RI2 A;  1RAA B;  1M2O A;  1VQM T;  1WGS A;  1YJN A;  3E9G A;  1MMA A;  2K6D A;  4J8O A;  1EZZ B;  3UPU A;  3P8B B;  4M7D B;  1VOM A;  1WPY A;  3N5B B;  3G4S T;  4M77 C;  4BAC A;  2DZ9 A;  4DBF A;  1JQQ A;  1UGS B;  3CPF A;  2BZX A;  2HBW A;  3HKS A;  1Q7Y C;  1NEG A;  2V1Q A;  3R6N A;  5GAM j;  4LDX A;  2K4Y A;  4XAX B;  5KYX B;  4B6M A;  2H3J A;  2A28 A;  2DVE A;  3G1J A;  2JJ9 A;  4B9W A;  2E6N A;  3PVQ A;  3KBG A;  3HRT A;  1TH7 A;  2F2V A;  1JU5 C;  5CKB A;  5KYW A;  3G71 A;  3I5S A;  3BE3 A;  3FDR A;  3KXT A;  2LZ6 B;  3M4Y A;  2MK5 A;  1NLO C;  4Z88 A;  1VQ5 A;  4CC4 B;  5KE2 A;  1N8R C;  3G6E T;  3VRZ A;  1UGQ B;  3MP1 A;  2YUP A;  3RIR A;  3QXE B;  2C0I A;  2HSE B;  1YBY A;  2RNA A;  2AT1 B;  1YIJ T;  1BK2 A;  1SHF A;  5FRN A;  1MMN A;  1IHW A;  1VQ4 T;  2M16 A;  4Y28 E;  2JMA A;  1RI0 A;  2CZ0 B;  3JCM f;  3QWX X;  1U8R A;  2CT4 A;  4YTL A;  1BI2 A;  3CCE T;  3CCV A;  4HT9 A;  3VYH B;  2ZPE B;  4IUV A;  1YI2 A;  3INZ A;  1R8O B;  1Q95 G;  5LJ5 f;  3H0I A;  3MHX A;  1VQO T;  1VQ6 A;  4O6J A;  2JUF A;  4MZM A;  2DL8 A;  1WXB A;  3GPL A;  2LQW A;  3EAE A;  2LJ1 A;  2NUP B;  1Q86 C;  4DEY A;  2RJE A;  4HVV A;  4M7A D;  1VQ7 Q;  1YJW Q;  3QG1 A;  1PCX A;  1D3B A;  5CQX A;  3H41 A;  1OZ2 A;  1RLP C;  2JT4 A;  3TVT A;  1F1B B;  2H3E B;  1AVZ C;  5KYU B;  4ESR A;  2I2L A;  2SRC A;  4DOW A;  2CUB A;  1NLP C;  1NPP A;  1PNJ A;  4FW1 A;  3CCR T;  1S72 T;  3M9Q A;  5L23 A;  1M90 U;  4GLM A;  2XHC A;  2DXU A;  4E7K A;  3JB9 H;  2ED0 A;  2QQR A;  3CCS Q;  5GAO q;  2HAX A;  2QQ9 A;  1BB9 A;  2HSP A;  3BDL A;  3E2U A;  4OP0 A;  3REB B;  3UDC A;  2DD5 A;  1KJW A;  2EBP A;  4FYY B;  4M75 F;  3JCM J;  1YJ9 A;  3TSZ A;  1UB4 A;  4PLL A;  5IN1 A;  5GAO p;  1YIT A;  4HVW A;  4M77 E;  3A1P A;  4ZGD B;  3OYF A;  1W2B A;  1FXX A;  2DER A;  5D7U A;  4IIM A;  3BFM A;  4JS5 A;  1I0C A;  1QWE A;  1X43 A;  3ZEH A;  1BIB A;  2P0P A;  3FJP A;  2KE9 A;  2W0Z A;  3OW2 S;  1OX8 A;  3X24 B;  2D9T A;  1VQM Q;  1QP2 A;  2HQX A;  3HL8 A;  2ZAE A;  4OB0 B;  3L2V A;  3S3O A;  2HL5 C;  3CD6 A;  4AFQ C;  3QHS A;  2EKO A;  2BZY A;  2Y4Y A;  1M2V A;  1M9S A;  2DL4 A;  3G4S Q;  3EFS A;  2K5L A;  3CME T;  2R5A A;  3V7R A;  2LVM A;  2M51 A;  2EVR A;  2VC8 A;  2ENM A;  2P4T A;  4BE1 A;  3PTA A;  5GAO r;  5CAI A;  2DA9 A;  2L8D A;  2YDL A;  1G3S A;  1UG1 A;  1KQ1 A;  2HCK A;  3QJ6 A;  4M75 A;  3RUX A;  4ORZ A;  2LCS A;  4LDV A;  3PIP A;  1LPL A;  3VV0 A;  3G6E Q;  1ZQ1 A;  4DBQ A;  2KR3 A;  1HSQ A;  1X27 A;  2E6Z A;  2KNB B;  4L5G A;  2PU9 B;  2JW4 A;  1VQ7 A;  1YIJ Q;  3QPH A;  4JRQ A;  1VQL A;  1UHF A;  2M0Y A;  3PFS A;  4PKC C;  1VQ4 Q;  3JCM Q;  1VQP A;  4QKU A;  2IG0 A;  2ZPI B;  1VQN A;  1D3B B;  1UEB A;  4R56 A;  4PJO A;  2O01 E;  4M4Z A;  2ROT A;  2LT1 A;  1OU8 A;  2DZC A;  3CCE Q;  5LJ3 d;  2X4X A;  2YRD A;  1GL5 A;  4A4G A;  3OS5 A;  4F7U G;  2VXF A;  2F2W A;  2A0F B;  4M7D D;  4HCK A;  4MMK A;  2XDB A;  1H8K A;  1VQO Q;  1W6X A;  1PD0 A;  2HD0 A;  2RHU A;  1OU9 A;  2J06 A;  1B34 A;  2VB6 A;  3WXM B;  2RQR A;  1KFZ A;  5IXB A;  1KG1 A;  3RDV A;  4KUD K;  1QWF A;  1YJN T;  3CQT A;  4JS4 A;  4J9F A;  2KBT A;  4PFO A;  2PUK B;  1JRI A;  3HTR A;  5DLO A;  1E6G A;  2KQW A;  2H8H A;  1PKS A;  2M02 A;  3O8V A;  4J9I A;  5GAN f;  2L2P A;  3C12 A;  1VQM A;  3M58 A;  4M78 G;  3EG0 A;  5GMK j;  1WNL A;  3CCR Q;  1S72 Q;  3TQ7 P;  4ZTF A;  4IUU A;  4DEX A;  4M77 F;  2OI3 A;  1GBQ A;  2RJF A;  2BKD N;  3G71 T;  2COZ A;  1LJO A;  5GAM g;  3JCM g;  3THK A;  1M2V B;  4HCB A;  4PLI A;  1C1A A;  1WA7 A;  3HRS A;  3OSV A;  1VQ9 T;  1JBM A;  4IUR A;  2VUB A;  1GRI A;  4RTU A;  5A2Q E;  2VYT A;  3G7Z A;  5LJ5 g;  4ELY C;  5LL6 S;  2X4W A;  1TSF A;  1Y57 A;  1ZBJ A;  2I0N A;  3H8Z A;  4WF2 A;  4EMG A;  1IO6 A;  2YHT A;  2EWN A;  1WDX A;  3OSS C;  5IAY A;  4JUV A;  2V8I A;  1QCO A;  2WAC A;  3F70 A;  4OVA A;  2RQV A;  4KT0 E;  3DB4 A;  4M75 B;  2DF6 A;  2RPN A;  1M90 C;  4FIB A;  4V2S A;  1YCS B;  1BI1 A;  1MUZ A;  4JJN K;  1M5Q 1;  4NL3 A;  3CCV T;  4PJL A;  4QW2 A;  2GQV A;  4L6V 5;  2FB7 A;  1YI2 T;  3PT9 A;  4X34 A;  1R0B G;  1Z9Z A;  1BBZ A;  5IHI A;  2MCN A;  1YP5 A;  2K3B A;  1VQ6 T;  1ZHI A;  2LX9 A;  1T3L A;  1NBE B;  4M77 A;  4JZ4 A;  3A8O B;  3OS0 A;  1Q81 R;  4FT2 A;  2E3I A;  1D1C A;  3OYE A;  3R6O A;  3EHR A;  7AT1 B;  2EJF A;  5GAN 4;  3VYG A;  2LRQ A;  5LJ3 j;  3X28 B;  1RAG B;  2O2O A;  1E7O A;  4FYW B;  1NJI C;  5DM7 R;  4J6X A;  1BIA A;  3EH1 A;  1N9R A;  2QI2 A;  1UTI A;  4RCC A;  5KCO A;  2VKN A;  4M78 C;  3GIB A;  1B7T A;  2HQH A;  1RUW A;  5ECA A;  2J6O A;  5GAN h;  4ZNX A;  2B8A A;  4DBH A;  4X9C A;  4J5Y A;  1Y07 A;  4KGV B;  2KRN A;  4DQ2 A;  4WCI A;  3J80 E;  4M7A G;  2JXB A;  1WHG A;  3V8K A;  3OW2 A;  3C95 A;  2QK0 A;  2X3W D;  5GAM e;  1YJ9 T;  3SWN B;  3JCM e;  1YIT T;  2C06 A;  2AZS A;  2HZY A;  1OV3 A;  2OAW A;  4JPB W;  1MNE A;  4LXC A;  1M1K U;  1GCQ C;  2P0K A;  3OYI A;  4DA4 A;  4E7J A;  1O75 A;  2QAZ A;  5LJ5 e;  3CPW S;  3ER0 A;  2KMT A;  4J83 A;  5CKF A;  1UJY A;  3VS5 A;  3DB3 A;  2PVD B;  2DK3 A;  5CKH A;  2QTV A;  1M3A A;  2CH4 W;  2YRV A;  1YJN Q;  3CD6 T;  1NYG A;  2KGT A;  2EQK A;  1K0X A;  3FEO A;  2JTE A;  2KXC A;  4PJO C;  1I5O B;  2M9U A;  2XDP A;  3CCU A;  2XKO C;  1FX7 A;  2XMF A;  2EKH A;  5KYY A;  2VXE A;  3FRN A;  3L2Z A;  2CH4 A;  2YUQ A;  4E2F B;  1H3Z A;  1K8A C;  1OOT A;  2DMO A;  4C0F A;  3VUB A;  2IVW A;  2DXC A;  2CZ1 B;  3JB9 J;  4E7Z A;  1ZSG A;  3REA B;  2XU8 A;  4RTW A;  3G71 Q;  2AKL A;  2HDA A;  4RG2 A;  4BD3 A;  5GAN 2;  2DBM A;  3AT1 B;  3C0C A;  1VQ9 Q;  2O9V A;  2DM1 A;  1JEG A;  3VS6 A;  3OYL A;  4OB1 B;  1RLQ C;  2R57 A;  2RMO A;  2MWO A;  1H64 1;  2LNH B;  1SG5 A;  1IZ6 A;  4F7U E;  4J9H A;  1SSH A;  4JJB A;  1VQ7 T;  3PMI A;  3RES A;  4LN2 A;  4M77 B;  1VQL T;  1JXO A;  4J6Y A;  1Y0M A;  4OMM A;  3NTH A;  2DTH A;  1VQP T;  2DIQ A;  1JJ2 P;  3FLG A;  3GP8 A;  1VQN T;  3CC2 T;  2MYS A;  4M7A C;  2CT3 A;  4RTZ A;  3OYC A;  2AZV A;  1GCP A;  2EGE A;  4QVD A;  1PRL C;  1K1Z A;  1ZUY A;  1TWB A;  1VYU A;  3HRU A;  3CCV Q;  4FSS A;  5GAN g;  1QW1 A;  1K9M R;  3RER A;  4NOY A;  3VS0 A;  1YI2 Q;  5GAN 7;  1I4K 1;  1Q81 U;  5D6X A;  4M78 E;  4IUQ A;  1XJW B;  1VQ6 Q;  4NS5 A;  1ZSZ A;  1SF9 A;  1JJ2 S;  4AFS C;  3OYH A;  4HT8 A;  2RF0 A;  2HKN A;  4FL6 A;  2D6F A;  4AG1 C;  3CC7 Q;  1Y7X A;  3A8G B;  3GBQ A;  2QG9 B;  4UC4 A;  4C5H A;  1XTD A;  4RTY A;  2LTO A;  2ZPH B;  4M75 E;  4KGX B;  4C0Z A;  4FT4 A;  3PE0 A;  3NHN A;  4BI4 A;  2P0Q A;  1SKU B;  4M7D G;  2A3L A;  5J26 A;  4EDU A;  3NFC A;  1YWO A;  4JRI A;  1KQS S;  5A0D A;  2RK1 A;  2ED1 A;  1WJQ A;  2FVU A;  3HP9 A;  4C0D C;  3O5Z A;  3L2U A;  4FCY A;  4CC2 A;  2MOX A;  1NE8 A;  2KY9 A;  3M0Q A;  1U3O A;  2BTT A;  4BY6 C;  4BE2 A;  2RI3 A;  5GAN 8;  1YJ9 Q;  2E41 A;  1BKB A;  1YIT Q;  4PJO E;  4KBM B;  1X6G A;  2X51 A;  1LVK A;  4M75 D;  2ROL A;  5KYY B;  4HKE A;  1HJD A;  1CSK A;  2E64 A;  1WHL A;  3I5R A;  3OBW A;  1FMW A;  1UHC A;  2QQA A;  4HCZ A;  3RKX A;  1ZBX A;  5FLX E;  3J81 E;  2F2X A;  2XIC A;  2XG8 D;  3LX7 A;  1VQ9 A;  2FEI A;  2HEQ A;  4CRI A;  2RM4 A;  1UFF A;  1AEY A;  2DL5 A;  2KVQ G;  2RQU A;  2KI7 A;  3M0U A;  3CD6 Q;  3JB9 F;  2G6F X;  2CP3 A;  4JZ3 A;  2FYK A;  2X3X D;  1TXQ A;  3ULR B;  2AK5 A;  2XD0 A;  1QVG P;  1D09 B;  4Z8A A;  2DO3 A;  4A54 A;  5GAN e;  5A0L A;  4QQG A;  3NMZ C;  3L2Q A;  5GAM f;  4MZP A;  1B3Q A;  2FG0 A;  3L2W A;  2E4H A;  2E10 A;  2OTJ A;  1M1K C;  1I8F A;  2HKQ B;  1P92 A;  1RAC B;  1ABQ A;  1MND A;  3DLM A;  4PFP A;  4F7U F;  1NPR A;  3S3M A;  1A0N B;  3QZ5 B;  1D0Y A;  3LLR A;  1AOJ A;  4FW2 A;  1QVG S;  1O9S A;  2V8J A;  4BE0 A;  1WLP B;  4N4G A;  2BIV A;  2DE0 X;  1TG0 A;  3GF5 A;  1QCF A;  3VRY A;  4LE9 A;  4J9B A;  5LJ3 g;  3CC7 A;  5I2M A;  5AYF A;  4OGE A;  1PHT A;  1D0X A;  1VQL Q;  3QDF A;  4PK4 A;  5GJV B;  2EFI A;  1VQP Q;  4KUL A;  3RR6 A;  1SHG A;  3JCM X;  1K9M U;  4M78 F;  3CPW A;  3CC2 Q;  1MMG A;  1VQN Q;  2AHJ B;  1M1F A;  4ZN1 A;  2K3X A;  3VS7 A;  2EYZ A;  5FRM A;  2LCL A;  3CXC P;  3M5A A;  3VU3 C;  4EPC A;  1PC0 A;  4RTT A;  1MV3 A;  2J7I A;  3MPU B;  5KYN A;  4HCC A;  1EX4 A;  1T0J A;  3CC4 A;  4N4I A;  2CRE A;  4LUD A;  2XID A;  4F7U A;  2PTK A;  1ZUU A;  4XU3 A;  1PSE A;  3SD4 A;  3OYJ A;  1UJ0 A;  4RCB A;  1ARK A;  2XI9 A;  3PGG A;  2YUO A;  4X9D A;  3CCU T;  1QVP A;  5GAO l;  3J7A F;  5KYW B;  1YN8 A;  2RHX A;  2K9G A;  4QVC A;  4CC3 A;  4E7S A;  4BB7 A;  2XK0 A;  2EQM A;  1H3H A;  4PJO F;  1K0S A;  2ZPG B;  4HA8 A;  1ZSZ C;  5GAN 6;  3Q1J A;  1C0M A;  4LD9 K;  1W4S A;  4OML A;  1Q81 C;  1SRM A;  2RN8 A;  3NGP A;  2HQE A;  3FJ5 A;  5GAM h;  4M77 D;  3JCM h;  4C8Q G;  4M78 A;  2KAF A;  5CKD A;  1IGU A;  2LQN A;  1UGR B;  1NM7 A;  4BDZ A;  3BY7 A;  1TUC A;  3V8L A;  2NLU A;  2LNV A;  3SB2 A;  4EMK C;  3X25 B;  2JZ2 A;  5LJ5 h;  2LX7 A;  4FYV B;  1OPK A;  2HL3 A;  2JS2 A;  1VQ8 A;  3QZ9 B;  2NUZ A;  2VWF A;  4RG8 A;  2D1X A;  4KH0 B;  2HNI A;  5LJ3 e;  2PVO B;  2A08 A;  2KXD A;  3M54 A;  1QVF P;  1GCQ A;  1OZ3 A;  1R0C B;  2G3R A;  2MIO A;  2D0Q B;  1VIF A;  4C5E A;  5I21 A;  3NPF A;  2Y90 A;  1B07 A;  1JJ2 A;  1Q7Y R;  2X4J A;  4BI8 B;  1QKX A;  2C0O A;  3LW5 E;  1N9S A;  5DLQ E;  4GY5 A;  2CZ6 B;  5CVI A;  4ZTJ A;  3GLX A;  2EYX A;  3CC2 A;  2CS7 A;  1QVF S;  2QGG A;  4D8D A;  2WSE E;  4C92 G;  4A4H A;  1VA7 A;  1AZG B;  2F1L A;  1KQS A;  5EC7 A;  3V8J A;  2D8J A;  3A8H B;  1N8R R;  3M4G A;  3PMT A;  1QLY A;  4PFZ A;  2JVV A;  3C94 A;  1U1T A;  2MI6 A;  3ASK A;  4XTZ A;  2O88 A;  2L3S A;  3D7S B;  3L1A A;  1QMC A;  1I07 A;  4OB2 B;  3VS2 A;  1M1G A;  1OX9 A;  1X6B A;  3WVE B;  4MML A;  3RKY A;  3I56 A;  5FU6 C;  1V29 B;  3M0S A;  3A8M B;  3DLL A;  2OAU A;  4LNP A;  4OF1 A;  4F7U B;  2DPP B;  2K7A A;  2D8H A;  3I9Q A;  4C8Q C;  3H9N A;  4MDX A;  2EAY A;  1YWP A;  4FYX B;  4A4F A;  1PM3 A;  2PQW A;  4M7A A;  3FIF A;  4EMH A;  1XNI A;  1Q86 R;  3GNG A;  1I5L A;  3SFM A;  4Z89 A;  1D1B A;  2O4X A;  2EPD A;  2RQW A;  2VVK A;  2KRS A;  1ZLM A;  1HK9 A;  2CP7 A;  4M78 B;  2ZPF B;  2QTX A;  3NTK A;  1WQ7 A;  1AWO A;  2DNU A;  3MP8 A;  3TRE A; 
#chains in the Genus database with same CATH homology
 1BI0 A;  3JB9 J;  2X35 A;  4QQD A;  1OI1 A;  1VQ5 A;  1K9M C;  5KE2 A;  1N8R C;  2XU8 A;  3G6E T;  2EQJ A;  5I2S A;  2Y4X A;  1UGQ B;  3MP1 A;  5FU6 B;  1KC8 C;  5HK3 A;  3RIR A;  1QVG A;  2PVG B;  1X6O A;  3QXE B;  4RG2 A;  2F5T X;  4BD3 A;  2DXT A;  3M53 A;  5GAN 2;  3CMA T;  1Y71 A;  3M57 A;  5D6W A;  2OTJ T;  1YBY A;  3OMG A;  1YIJ T;  1PSF A;  2GFA A;  4C8Q B;  4QQ6 A;  3OYL A;  5DY9 A;  4C92 C;  3LWI A;  5FRN A;  4OB1 B;  5HKC A;  3MEU A;  3QBY A;  2R57 A;  1VQ4 T;  1N27 A;  2MWO A;  5KCH A;  2M16 A;  1H64 1;  3OYY A;  4PL6 A;  3JCM c;  1IZ6 A;  4Y28 E;  4F7U E;  2RD1 A;  5CIU A;  1Y96 B;  1KD1 U;  3G71 T;  1RI0 A;  3X26 B;  2WSF E;  2CZ0 B;  3QYG B;  1VQ7 T;  4J7F A;  5GAN 5;  1M8V A;  4RMO A;  3PMI A;  3RES A;  3JCM f;  3H6Z A;  4M77 B;  4JLG A;  1VQL T;  4TVR A;  1U8R A;  3I55 T;  3OBY A;  4J6Y A;  2RHY A;  4YTL A;  3CCQ A;  1BI2 A;  1K73 C;  3CCE T;  3CCV A;  4M7A F;  4HT9 A;  3GNF B;  3VYH B;  3NTH A;  2DTH A;  1VQP T;  4M7D E;  4IUP A;  2RB6 A;  2ZPE B;  2DIQ A;  4IUV A;  3CC7 T;  3VJP A;  3FLG A;  2QDY B;  5HK0 A;  3GP8 A;  1YI2 A;  3INZ A;  3CC2 T;  2EYQ A;  2LDM A;  1R8O B;  1VQN T;  3JB9 G;  4PJO B;  3M55 A;  5LJ5 f;  3MHX A;  3OYC A;  1VQO T;  4M7A C;  1VQ6 A;  4QVD A;  4O6J A;  3TCJ A;  2JUF A;  4MZM A;  1YJW A;  3HRU A;  3GPL A;  3EAE A;  5GAN g;  5J39 A;  3OYB A;  1QW1 A;  3RER A;  4NOY A;  1Q86 C;  2MF2 A;  5GAN j;  5GAN 7;  2RJE A;  1YCY A;  1G3T A;  1I4K 1;  1KHC A;  1Q81 U;  3CBM A;  5D6X A;  4M7A D;  2A7Y A;  4M78 E;  4IUQ A;  1B34 B;  4NS5 A;  3QG1 A;  1D3B A;  5CQX A;  3OY9 A;  1OZ2 A;  2RO0 A;  3FB9 A;  1JJ2 S;  1K8A U;  2HBP A;  3CEY A;  3HFN A;  2GFU A;  3OYH A;  4HT8 A;  3CXC A;  1AHJ B;  2RI5 A;  4FL6 A;  2D6F A;  5CR2 A;  3CCS A;  1N8R U;  1Y7X A;  3A8G B;  2I2L A;  1LNX A;  2WSC E;  4UC4 A;  3HFO A;  5FU7 C;  4C5H A;  4C92 B;  4DOW A;  1XTD A;  3CCL T;  1NPP A;  2KDS A;  2LTO A;  4JDS A;  2ZPH B;  3CCR T;  4M75 E;  1S72 T;  4C0Z A;  4FT4 A;  1N6A A;  4OB3 B;  2QEX A;  3M9Q A;  3NTI A;  3CC4 T;  1M90 U;  4BDY A;  5CKE A;  2XHC A;  5GMK i;  3JCM V;  3MO8 A;  2DXU A;  4E7K A;  3JB9 H;  2QQR A;  3MCA B;  2P0Q A;  4FSX A;  4XK8 E;  4BI4 A;  4C8Q E;  2A3L A;  5J26 A;  4EDU A;  3OMC A;  3NFC A;  3ZBD A;  2QQ9 A;  5GAO q;  2HAX A;  1KQS S;  4JRI A;  3BDL A;  4OP0 A;  4XTW A;  3UDC A;  5LJ3 f;  5A0D A;  2RK1 A;  1IRE B;  4MZT A;  2DD5 A;  5CK9 A;  3C4S A;  3OS1 A;  1WJQ A;  5A0G A;  4ZGE B;  4M75 F;  5CQY A;  3BW1 A;  3JCM J;  1YJ9 A;  2FVU A;  3HP9 A;  4Q5W A;  1UB4 A;  4PLL A;  5IN1 A;  4C0D C;  3OB9 A;  1DJ7 B;  4M7A B;  5GAO p;  3L2U A;  1YIT A;  4M77 E;  3SWN A;  3HSB A;  4ZGD B;  2MMP A;  4XQ3 A;  3OYF A;  1NE8 A;  4LDU A;  2KY9 A;  4R55 A;  1W2B A;  1FXX A;  2VGM A;  1X01 A;  4BY6 C;  5GMK m;  4BE2 A;  1M4Z A;  3BFM A;  2RI3 A;  4JS5 A;  2JNG A;  3E19 A;  5GMK l;  5GAN 8;  2E41 A;  3ZEH A;  1BIB A;  2P0P A;  1BKB A;  3FJP A;  4PJO E;  4KBM B;  3RMS A;  2X4Y A;  3OW2 S;  4M75 D;  4HKE A;  5GMK h;  4M7D A;  1YHQ T;  1BYM A;  3X24 B;  2D9T A;  3G4S A;  1QP2 A;  2E64 A;  2HQX A;  3HL8 A;  4II1 A;  2R5M A;  4ME7 A;  3OBW A;  4OB0 B;  3OYG A;  3L2V A;  3S3O A;  1MGQ A;  3HHT B;  3CD6 A;  2QQA A;  4HCZ A;  3A5Z B;  3QHS A;  3RKX A;  3QKJ A;  3X20 B;  1ZBX A;  2EKO A;  4XTV A;  5FLX E;  3J81 E;  1I81 A;  2XIC A;  2Y4Y A;  2XG8 D;  4M75 G;  4Z02 A;  3LX7 A;  3CCJ T;  1VQ9 A;  1M9S A;  1VQ5 T;  4CRI A;  1BI3 A;  2RM4 A;  1QP3 A;  3EFS A;  3JCM b;  2K5L A;  3CME T;  5FU7 B;  2KSS A;  4FM4 B;  2KVQ G;  1VQ8 T;  3JCM d;  3LWH A;  5C6S A;  3JB9 F;  2R5A A;  3V7R A;  3VKI A;  2LVM A;  4DOV A;  2VC8 A;  4JRK A;  2JTM A;  2P4T A;  3OQ5 A;  5KH6 A;  2FYK A;  4BUG A;  5M9O A;  4BE1 A;  2QA4 A;  4JRP A;  1XOV A;  2L3R A;  4C92 E;  4Y91 A;  3PTA A;  1HXD A;  3JCM W;  2XD0 A;  3WVD B;  5GAO r;  5CAI A;  2DO3 A;  2ZPB B;  3G6E A;  1QVF A;  5LJ5 d;  2L8D A;  4A54 A;  3JCM P;  3OYN A;  2JTF A;  1Q82 C;  5GAN e;  3QYH B;  1XQH A;  5A0L A;  3ZFJ A;  3LGF A;  3CBP A;  4QQG A;  1G3S A;  5GAN 3;  4C0D B;  3L2Q A;  5GAM f;  3LH0 A;  1VIE A;  4MZP A;  3JB9 D;  1KQ1 A;  3L2W A;  2QA4 T;  2DIG A;  3V7C A;  4C5I A;  3QJ6 A;  2E10 A;  4M75 A;  3RUX A;  2OTJ A;  1M1K C;  4P5N A;  4C5G A;  5C0M A;  1LOJ A;  4PJO G;  1YIJ A;  1I8F A;  4LDV A;  3PIP A;  2EQU A;  2OTL T;  1P92 A;  3QII A;  2K57 A;  3VV0 A;  4BY6 B;  2BUD A;  3UWN A;  3DLM A;  1ZQ1 A;  1VQ4 A;  3SWN C;  1NPR A;  4F7U F;  3S3M A;  3QZ5 B;  3LLR A;  2E6Z A;  4L5G A;  3SDZ A;  2PU9 B;  1QVG S;  2YLB A;  2VV5 A;  2PUO B;  1SSF A;  1VQ7 A;  1O9S A;  2V8J A;  1Q7Y U;  4BE0 A;  3QPH A;  4IKF A;  4JRQ A;  4N4G A;  2BIV A;  2LCC A;  1VQL A;  3PFS A;  3GF5 A;  1VQK T;  4PKC C;  4M7D F;  4JLI A;  3CCM T;  3CCE A;  3JCM Q;  2CYZ B;  4N4H A;  1VQP A;  2EJG A;  5LJ3 g;  3CC7 A;  1KHI A;  3DKM A;  2IG0 A;  2ZPI B;  3JSC A;  5AYF A;  5I2M A;  1VQN A;  4OGE A;  1D3B B;  2GCX A;  2RHI A;  2LQ8 A;  3V7S A;  4XTU A;  1UEB A;  4OGC A;  4R56 A;  1VQO A;  2K5F A;  4PJO A;  2O01 E;  4XU2 A;  3OYK A;  2DTO A;  4L59 A;  4PNO A;  2LT1 A;  2DZC A;  3OYM A;  5LJ3 d;  2EFI A;  2X4X A;  5LJ3 h;  2RK2 A;  3TRE A;  4KUL A;  3JCM X;  4A4G A;  3OS5 A;  1K9M U;  4F7U G;  2VXF A;  4M78 F;  1G3W A;  3I56 T;  3CPW A;  4M7D D;  2AHJ B;  3E1S A;  1M1F A;  4MMK A;  4ZN1 A;  4ELZ C;  5GAO n;  1KC8 U;  2XDB A;  2K3X A;  3QSU A;  4RKU E;  4EMK A;  1VUB A;  2HD0 A;  3A8L B;  2RHU A;  4LDY A;  1X75 C;  2LCL A;  3GOX A;  1B34 A;  2QEX T;  5FRM A;  3M5A A;  3VU3 C;  3WXM B;  4EPC A;  4N0A A;  2MWP A;  1KG1 A;  4XTX A;  4KUD K;  4BI3 A;  1NZ9 A;  5FRO A;  1YJN T;  4JS4 A;  2DKG A;  4HCC A;  2PUK B;  1JRI A;  4VUB A;  4M78 D;  5DLO A;  2KQW A;  4B9X A;  3CCL A;  2DXB A;  4M7D G;  2EIF A;  2F5K A;  3M56 A;  3CCR A;  1S72 A;  3O8V A;  3CC4 A;  2E12 A;  4M75 C;  4N4I A;  2CKK A;  2K5I A;  3ME9 A;  2E65 A;  1KD1 C;  2FHD A;  2KK4 A;  2XID A;  2M1H A;  3C12 A;  4C8Q F;  4F7U A;  5GAN f;  5IT9 E;  1VQM A;  1WQW A;  4XU3 A;  3M58 A;  1K73 U;  2DEQ A;  2RA2 A;  4M78 G;  2O4X B;  1PSE A;  3SD4 A;  3TU4 K;  5GMK j;  2EJ9 A;  1WNL A;  1UGP B;  3P8H A;  3OYJ A;  4E7I A;  4RCB A;  2XI9 A;  2RHZ A;  3PGG A;  4ZTF A;  4IUU A;  2QXF A;  5GAO m;  4M77 F;  4X9D A;  3CCU T;  1QVP A;  5GAO l;  3J7A F;  5L8R E;  3MEA A;  2RHX A;  2RJF A;  3QDR B;  4QVC A;  2BKD N;  2V8K A;  2LQK A;  1LJO A;  3QUI A;  1WJR A;  4BB7 A;  4C8Q D;  5GAM g;  4A4K A;  3FC3 A;  3JCM g;  1Q86 U;  4O5V A;  2XK0 A;  1FWZ A;  3PNW C;  2EQM A;  2MAM A;  4LDW A;  4HCB A;  4PJO F;  2ZPG B;  4HA8 A;  2ZGW A;  4PLI A;  5GAN 6;  3Q1J A;  4CI0 C;  2F69 A;  2RJD A;  3HRS A;  3OSV A;  1VQ9 T;  1JBM A;  4IUR A;  3S6W A;  1W4S A;  4LD9 K;  2VUB A;  1Q81 C;  3AHU A;  5GAM d;  2RJC A;  2HQE A;  5A2Q E;  5GAM h;  2GF7 A;  2VYT A;  4M77 D;  2DD4 A;  3JCM h;  3G7Z A;  4M78 A;  2KAF A;  4C8Q G;  5CKD A;  3OA6 A;  1YHQ A;  5LJ5 g;  4ELY C;  3CBO A;  1RL2 A;  5LL6 S;  3TEE A;  2X4W A;  1UGR B;  5CO7 A;  2LT4 A;  4BDZ A;  2E5Q A;  3BY7 A;  5LJ5 j;  1W2B S;  3V8L A;  2NLU A;  3H8Z A;  4WF2 A;  4EMG A;  2YHT A;  3E9F A;  2LNV A;  3RMQ A;  5D6Y A;  2EWN A;  3SB2 A;  4EMK C;  3URG A;  1MHN A;  5KE3 A;  3CCJ A;  4PJO D;  4M77 G;  1GXI E;  3OSS C;  4ZN3 A;  3X25 B;  2JZ2 A;  5LJ5 h;  3QJY A;  4A4E A;  5IAY A;  3CME A;  4JUV A;  2V8I A;  2JN0 A;  4N0A C;  2WAC A;  3F70 A;  3P8D A;  4OVA A;  1VQ8 A;  3QZ9 B;  4ATO A;  4KT0 E;  3DB4 A;  4RG8 A;  4M75 B;  3OYE A;  3CMA A;  1M90 C;  2HNI A;  5LJ3 e;  4FIB A;  2PVO B;  4NL2 A;  3VUZ A;  1BI1 A;  2DJZ A;  4JJN K;  1M5Q 1;  4V2S A;  4C92 F;  4NL3 A;  2CZ7 B;  3M54 A;  3CCQ T;  1OZ3 A;  2G3R A;  3CCV T;  2D0Q B;  1VIF A;  4XTY A;  2L89 A;  4C5E A;  4C8Q A;  4QW2 A;  2GQV A;  4L6V 5;  4M7A E;  2FB7 A;  4E47 A;  1WJS A;  1YI2 T;  3PT9 A;  4X34 A;  5I21 A;  2Y90 A;  3JRZ A;  1Y96 A;  1VQ6 T;  4C0G A;  1JJ2 A;  1JB0 E;  3QO3 A;  5J3B A;  4A53 A;  1ZHI A;  2X4J A;  2LX9 A;  3M59 A;  4BI8 B;  1YJW T;  2R58 A;  1U1S A;  3BDU A;  3I55 A;  4M77 A;  2OTL A;  5CCA A;  2K3Y A;  3A8O B;  4C92 D;  3OS0 A;  1OYX A;  3LW5 E;  4FT2 A;  1N9S A;  4J6W A;  4MDW A;  5DLQ E;  5EG2 A;  3R6O A;  4GY5 A;  2CZ6 B;  2QQB A;  5CVI A;  4D6W A;  4ZGJ B;  5GAN 4;  2EJF A;  4ZTJ A;  2JOY A;  3GLX A;  4M7D C;  3VYG A;  3CC2 A;  3JB9 I;  2LRQ A;  3MP6 A;  2CS7 A;  1QVF S;  3L42 A;  5LJ3 j;  4GLK A;  3X28 B;  3RKW A;  3MEV A;  1NJI C;  4OMF B;  5DM7 R;  2WSE E;  4J6X A;  4QVZ A;  1BIA A;  4C92 G;  4A4H A;  1KQS A;  3OS2 A;  2ZZD A;  1VQK A;  3V8J A;  3A8H B;  1N9R A;  3M4G A;  3CCM A;  3CCS T;  2QI2 A;  3PMT A;  4RCC A;  5KCO A;  3JAM E;  3KUF A;  4M78 C;  4EMK B;  5GMK e;  2XDD A;  4E7H A;  2JVV A;  2LC4 A;  3C94 A;  3GIB A;  3S3N A;  1U1T A;  3EFR A;  5GAN d;  5GAN h;  2L5Q A;  2YLC A;  2B8A A;  3LYI A;  2MI6 A;  4X9C A;  3ASK A;  3MEW A;  4J5Y A;  1Y07 A;  3HPW A;  4XTZ A;  4E7L A;  3PIO A;  4DQ2 A;  3L1A A;  4OB2 B;  3MET A;  1M1G A;  2E1H A;  4J7I A;  3J80 E;  4M7A G;  3WVE B;  4MML A;  2DAQ A;  3RKY A;  3L2R A;  3I56 A;  4LD6 A;  1Q82 U;  2QQS A;  3V8K A;  3UT1 A;  2FL7 A;  5FU6 C;  1V29 B;  3C95 A;  3OW2 A;  1YJ9 T;  5GAM e;  4XU1 A;  2CGH A;  3SWN B;  4C92 A;  3A8M B;  3JCM e;  4IUT A;  3DLL A;  1YIT T;  2C06 A;  2OAU A;  2RH2 A;  3OYA A;  2VGN A;  4OF1 A;  2DTI A;  4F7U B;  1KQ2 A;  2K2V A;  1M1K U;  2RI2 A;  2DPP B;  2P0K A;  1VQM T;  3OYI A;  1WGS A;  4C8Q C;  3CXC S;  4E7J A;  4DA4 A;  1YJN A;  1O75 A;  3E9G A;  4KUI A;  2EAY A;  4MDX A;  5LJ5 e;  4FU6 A;  4J8O A;  3UPU A;  3CPW S;  3P8B B;  3ER0 A;  4A4F A;  2KMT A;  4M7D B;  4J83 A;  5CKF A;  3DB3 A;  1WPY A;  2M0O A;  2PQW A;  2PVD B;  2DK3 A;  3N5B B;  5CKH A;  3G4S T;  4M77 C;  4BAC A;  4M7A A;  2DZ9 A;  2YRV A;  1UGS B;  3FIF A;  4EMH A;  1XNI A;  3CPF A;  3T9N A;  3CD6 T;  3HKS A;  1Q7Y C;  2ZCF B;  3GNG A;  2EQK A;  1I5L A;  3SFM A;  3FEO A;  5GAM j;  4LDX A;  2K4Y A;  2O4X A;  2E70 A;  4XAX B;  5HY6 A;  3OYD A;  2H3J A;  4PJO C;  2DVE A;  2M9U A;  4B9W A;  2XDP A;  3CCU A;  1HK9 A;  2E6N A;  4M78 B;  2XKO C;  1NJI U;  1FX7 A;  1EIF A;  2ZPF B;  2VXE A;  3KBG A;  3HRT A;  1TH7 A;  3FRN A;  2QTX A;  5CKB A;  3L2Z A;  3G71 A;  3NTK A;  3LGL A;  1WQ7 A;  1H3Z A;  1K8A C;  3FDR A;  3KXT A;  1G3Y A;  4XU0 A;  4C0F A;  3M4Y A;  1G5V A;  3VUB A;  3MP8 A;  2IVW A;  2DXC A;  2CZ1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...