2JTMA

Solution structure of sso6901 from sulfolobus solfataricus p2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
60
structure length
60
Chain Sequence
MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Putative uncharacterized protein
publication title Biochemical and structural characterization of Cren7, a novel chromatin protein conserved among Crenarchaea
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 7
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2007-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11520 Cren7 Chromatin protein Cren7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jtmA00
2JTMA 3LWHA 3LWIA 3KXTA 4R56A 4R55A
chains in the Genus database with same CATH superfamily
1LCKA 4J6YA 2DYBA 2CT4A 2DXTA 1CKAA 1S72T 5KE2A 2MPXC 2X3XD 2X3WD 1ABQA 1RLPC 1W1FA 1SHFA 4HT8A 2DL5A 4DA4A 2P4RA 3JB9J 2DJQA 1Q82C 4E7SA 2D8HA 1ZLMA 1R0CB 3H8ZA 1M3BA 1YN8A 2DE0X 4J83A 4XTWA 3S3NA 3QDFA 4OMOA 1QP2A 4OGCA 2OAUA 1BIAA 4EMKB 2COWA 2P4TA 4IUTA 5FW9A 3CPFA 4CC4B 1OX9A 1T0HA 1ZHIA 1VQMQ 5M9OA 4KBMB 1EIFA 5CR2A 1KQSP 3CCRT 3M59A 2HD0A 3OQ5A 2JUFA 3CXCP 3CCUA 1W6XA 1QLYA 1XJWB 5CKBA 2EFIA 2KVQG 3GNGA 1YI2T 4FCYA 3JV3A 3L2VA 2JJ9A 4ANJA 4FU6A 3UT1A 2FZGB 4J9BA 2DXBA 2R5AA 2GQIA 4DEXA 2QASA 3VS7A 1AZGB 4RMOA 3G71T 4ATOA 2CS7A 2KE9A 1X6GA 3CCQQ 2CT3A 2QYZA 2YUOA 4C92D 5C6SA 3OW2A 4XTYA 3VV0A 2FL7A 3FEOA 4C0FA 1G83A 2VB6A 1YHQQ 5KYUB 2J6KA 1Q86U 3ER0A 2RJDA 4CC3A 5HY6A 2ECZA 2DYIA 1WQWA 1CKBA 4M77C 1O9SA 1JBMA 2E5KA 2K5IA 1OYXA 3HKSA 5HCKA 4AFSC 1WLPB 2QG9B 1Q7YR 3T9NA 4BI3A 1QW1A 4OMMA 3CCJA 2QDYB 1WJSA 2EAYA 5L23A 1JJ2A 2E12A 2FPEA 1AWJA 4Z02A 3PFSA 1W2BP 1NEBA 5DLOA 3OS0A 5A2QE 1SKUB 1N8RR 3CC2A 2EIFA 3RUXA 3I9QA 4PNOA 4MMKA 4LD9K 3WVDB 2KYBA 5KYXA 4C5HA 1QCOA 4J9IA 4DBHA 5GMKe 1G8XA 4C5EA 2EQKA 4RTVA 5GMKi 1MV0B 4HXJA 1V1CA 2XMFA 1FWZA 3RDVA 3AT1B 1OOTA 4A4KA 5CKHA 4M7DD 2OAWA 1UUEA 1ZBJA 1ZUKA 5GANf 1M1FA 3PVLA 1U1SA 4EMGA 4Z89A 4JRPA 3JB9F 1YIJT 4C0DB 3E2UA 2YUQA 4Y91A 5D6YA 4ME7A 4X1VA 2J6FA 4UC4A 4FIBA 5FU7C 4F16A 2QEXA 5GAN8 1VQOQ 3NTIA 5FU6B 1VYTA 3PNWC 2YWWA 4JJDA 4EMHA 1HK9A 1H3HA 5KE3A 2MYSA 1VQ4Q 1JQQA 1IRXA 3HSBA 1XQHA 2KT1A 2VC8A 4A4HA 4OMPA 2M16A 1Y96A 2J6OA 2LP5A 3VS5A 1IB8A 1U3OA 4KH0B 1YJNT 1Q81R 4JRQA 4F04B 1PSEA 3VUZA 1Y71A 1YWPA 1D0XA 1P92A 2LX9A 1YFNA 5KYNA 3NGPA 1KC8U 4BDYA 3CCST 4BB7A 2PTKA 1OULA 4P5NA 2E6NA 1FMVA 3EAEA 4M77E 5KYYB 3OYNA 3I56Q 3G4SA 3PIOA 2XKOC 3U23A 2FRYA 2DXCA 1VIEA 2Z0WA 1TS9A 2DM1A 1X27A 3UDCA 2YRDA 4M77A 2JTFA 4ORZA 3KUFA 3M0RA 1Q81C 1VQLT 4ZNXA 3CD6Q 3M58A 2LQWA 4M78E 5KYXB 2RA2A 2O2OA 4N4GA 2E10A 3UWNA 4J7IA 2DA9A 3CC4Q 4MMLA 3TEEA 4M78A 3GNFB 2OI3A 2O9SA 2HKNA 1PNJA 1JXOA 2RI2A 4DOVA 3S3OA 4KT0E 2EJ9A 1HSQA 2GGRA 2O9VA 4FSXA 5A0GA 2JMCA 1OX8A 4IIMA 3SB2A 1UJ0A 4JJNK 1EZZB 4K11A 4PJOE 2M0YA 1KQSA 4PJLA 1U5SA 2RM4A 1QVPA 3MP6A 5LJ3f 4FW2A 3DLLA 1M2VA 4QQ6A 1VQPA 5L8RE 1UECA 2RJEA 3PT9A 3RNJA 1LOJA 2HQEA 2LJ0A 2CUDA 3CCLT 2COYA 2OTLT 1WIEA 2E3IA 3CC7A 5LJ5j 4E7HA 5FRNA 3UPUA 3EGDB 3G1JA 3OS1A 2C06A 2E65A 1TUCA 4R55A 2DMOA 3F70A 3FJPA 4FYWB 4X9CA 4F7UF 3OYCA 3QPHA 1I4K1 3FB9A 3CMAT 3OA6A 3VS6A 1I5OB 2YRVA 3EG1A 4ELZC 2EGAA 1RUWA 4QQGA 3VS0A 2A0FB 4LXCA 4M7AD 3MO8A 1F1BB 5GAMf 1N9RA 3ZEHA 3TSWA 3JCMQ 1YJWQ 1VQ5T 1WNLA 2E64A 4E7LA 3MEVA 2EKHA 2ZAEA 3VUBA 2PZ1A 1VQ6Q 3M5AA 4C92G 2BZYA 1T3LA 3I55Q 2XDDA 3OMCA 4M77B 4Y92A 5GAN3 1M4ZA 1IHWA 1I07A 3QIIA 1W2BA 1IXDA 2X4WA 2DTIA 4Q5WA 2EWNA 2DF6A 1WQ7A 5CCAA 4MZMA 3C12A 3HFOA 3E9FA 2RNAA 2DRMA 1Q7YU 2DL7A 2EKOA 1NJIR 4C8QD 2GFUA 2RD1A 2DAQA 2SRCA 1UGQB 2LT4A 4M78B 1BIBA 2Y90A 2AHJB 1N8RU 2KYMA 3CBOA 3TSZA 2K6DA 4A63B 1KJWA 4OMFB 1VQNQ 1BKBA 4J6XA 1U8RA 5GAOn 3PGGA 3QXEB 1SG5A 1WA7A 4RCCA 3EG2A 1C6VX 1S72Q 1K0SA 1M2VB 2BTTA 3HRUA 4M7DG 3SWNC 1NJIC 4XU0A 3V7RA 4PJJA 2L0AA 3CCQA 3QWYA 1BI2A 3V7CA 4C92C 1SRLA 1YHQA 3JCMP 3L2ZA 2CP5A 1UDLA 2MWOA 1AVZC 1M5Q1 4JS4A 2RJFA 4JLIA 1RI9A 1HD3A 1YCSB 5EG2A 2CZ0B 4BD3A 1M9SA 1Y7XA 4JJBA 2HBWA 1NZ9A 1W70A 5GAOp 1I8FA 3EG0A 1RAEB 1ZQ1A 3LGLA 1EX4A 3X26B 3CCRQ 2DILA 2LCSA 2AIRB 4F7UG 3CCVA 3MP8A 2GF7A 2SEMA 2JNGA 2RQVA 1M1KU 2COZA 1Q81U 4II1A 1QCNA 2X51A 2RHIA 2VXFA 5KYWB 5IHKA 2YDLA 1AWXA 3CPWA 1YI2Q 4OMQA 4HVVA 2BZ8A 1K8AR 2M9UA 2RPNA 2K79A 3VS2A 2LQ8A 3MEWA 1M2OA 4D6WA 2DVJA 4RUGA 4M7DC 6AT1B 3A5ZB 3VS1A 3VYGA 2DD4A 1NG2A 2DBMA 1M27C 2I2LA 3EHRA 4LUEA 2LTOA 2FZKB 1BK2A 3G71Q 1G5VA 2DIGA 3CQTA 2DEUA 4XU1A 2RK1A 3BW1A 2KT8A 1NBEB 4ZN3A 4NOYA 2IIMA 2RQWA 3ZL7C 3QJ6A 3OYFA 1NEGA 2NUTA 1VQOA 2RK2A 5GAOm 4DBFA 1PCXA 1I0CA 2K5LA 4JZ4A 1R77A 2C0IA 2FHDA 1K73R 4B9XA 2MMPA 1MUZA 1K4US 4MDWA 1OQKA 4JS5A 2I0NA 2BUDA 4J5YA 4PJOF 3TVTA 4LDWA 3MHXA 1Q82R 3CC2T 1UGRB 1YJ9T 2EYYA 1BI0A 2XU8A 3PMTA 1ZX6A 2LQKA 2ZPEB 1H92A 1KHIA 2EYXA 5GAOr 4LDUA 4BACA 1ZA2B 2NUPB 1RAGB 3SWNA 5LJ3e 1TSFA 2CP0A 4M75F 1AOJA 3I56A 4RTZA 4C92A 5FROA 3NTKA 4RG8A 1K73C 2RHZA 1SSHA 1UTIA 4BI4A 2YUPA 1WHJA 2IVWA 2CDTA 2EPDA 4J9FA 2CUBA 1D1AA 1YP5A 4RTXA 4JDSA 1KFZA 2VVKA 3CD6A 2HQXA 1YIJQ 2QA4A 4QKUA 3OYHA 2EYZA 4J9DA 4KUIA 1VQ8A 4YTLA 1D0ZA 2CP6A 2QEXT 5CKFA 1M90U 3HL8A 2QQ9A 1WXTA 3QHSA 4PFPA 2QGFB 4M7AG 1X43A 3FIFA 2CP7A 5GAMe 2BKDN 1K76A 5IHIA 3JSCA 2HSEB 4XU3A 1GL5A 2RQRA 4L6V5 1FYNA 3MEAA 2HCKA 1XTDA 3MCAB 3JB9D 1Z9ZA 3HFNA 5IXBA 2KEAA 2YUNA 2QQAA 2DPPB 1YJNQ 4XTUA 4M7DA 2CGHA 2FRWA 3OW2S 4EPCA 5FLXE 1AEYA 2R5MA 2NUTB 7AT1B 5FWBA 1NYGA 3CCSQ 4C8QG 1U1TA 2XI9A 4AFQC 2FG0A 1B07A 1JO8A 1JJ2S 3QO3A 2OJ2A 2XG8D 1QVFP 3SDZA 5LJ5g 5CAIA 5LJ5d 2YT6A 1VQ7A 1YCYA 4OGEA 4C5GA 4LDVA 1ZSZC 2LX7A 4TVRA 1V76A 4DBRA 2DJZA 5GAN5 1WXBA 1VQLQ 1SSFA 1D3BB 5HK0A 4M7AC 3SWNB 1YJWA 1KQ1A 3M0UA 5HKCA 1JRIA 4BY6C 2QTVA 4ZGJB 2GBQA 2K3YA 4C92B 2LNVA 3CBPA 4PJMA 1VQ6A 3OS2A 3M54A 1H8KA 3JCMg 3JCMd 1YNZA 3J81E 1X01A 3BDLA 3META 4ZGEB 1N27A 5GAOl 1YWOA 1KD1R 4M75G 4IUVA 3SHWA 2CREA 3H0FA 4C0ZA 1UGPB 3X24B 1NPPA 1J3TA 4NL3A 2B8AA 2GTOA 3M4YA 2KSSA 1PRLC 1VQPT 2KMTA 4C8QC 4J6WA 2E41A 1UEBA 3RKYA 3V8KA 1RI0A 1D1BA 3CC7T 3CCLQ 4RCBA 2OTLQ 1K1ZA 2M02A 4OVAA 1SF9A 2VUBA 1VUBA 3RMSA 1RAHB 2KK4A 4JRIA 3OYIA 4L5GA 3GPLA 1VQNA 1WHHA 3THKA 2HSPA 1XNIA 1KK7A 2JMAA 3JB9H 2EJGA 2F2WA 5KCHA 1KD1C 2VGNA 2KAFA 1CSKA 5DLQE 2DZ9A 2H3EB 4B9WA 3CMAQ 1K8AU 3M0TA 4N4IA 3X28B 1VQKT 3RKWA 4QVDA 3BE3A 2PVDB 3OYYA 4X9DA 2WACA 2GNCA 3S3MA 2F5TX 3JCMJ 1H641 1OEBA 1VQ5Q 3UA7A 2RHYA 2ZPHB 3QG1A 2A3LA 2FPDA 3GP8A 4XAXB 1NLOC 1C0MA 2AZSA 2JTEA 1NE8A 3JCMX 4ZTJA 5GAN4 4BE2A 3JB9I 2EQUA 2MWPA 3OYBA 3MP1A 2EBPA 2FYKA 3QUIA 3DB3A 2JS2A 1IREB 2LMJA 4HVWA 3GF5A 1K73U 2NWMA 3H0HA 4MZTA 3TCJA 3TU4K 2GCXA 2OX7A 2ESWA 4LE9A 2DLPA 3C95A 1ZSZA 3CMET 3CCMT 1YITA 4QQDA 5CQXA 1T0JA 1Q82U 1UB4A 1ZSGA 2NYSA 1VQ9Q 2F69A 5A0LA 2CSQA 2QTXA 4EIKA 1QCFA 3X20B 1YI2A 2LZ6B 4M7AA 3Q1JA 4WF2A 2OTJA 1JEGA 2KY9A 2DL8A 2CZ1B 1WHLA 1OZ2A 2YRCA 4XK8E 1SEMA 3G6EA 4XQ3A 3SD4A 3DB4A 4E2FB 1R8OB 2HMAA 1I1JA 3G71A 2Y4YA 4E7IA 4QW2A 2FEIA 1B3QA 3JCMW 5GJWB 5J39A 3QSUA 4ESRA 2VV5A 5GANj 2KROA 2VGMA 2QI2A 3REAB 4C8QA 3EGXA 2PQWA 3FLGA 2V1RA 4ZTFA 3CCEA 3MEUA 4J7FA 1OU9A 4JZ3A 4XTXA 3CXCA 3H6ZA 2P0PA 3OS5A 1WJQA 5IAYA 2D0QB 2RHUA 2K2VA 1TWBA 2A08A 2HQHA 2AT1B 5FRMA 3CCVT 3TREA 3LYIA 4RTYA 3JB9G 1QWFA 1K9MR 3NFCA 2L8DA 3HTRA 2QXFA 3QBYA 3SEMA 4A4EA 1OZ3A 8ATCB 4FSSA 1KHCA 1OPLA 2RN8A 5GJVB 1Y96B 4HCBA 5CVIA 1LPLA 2HL5C 4RTTA 1QVFA 4J9GA 1EFNA 4KH1B 1W2BS 2BE7D 1GCQC 1PWTA 2CYZB 2JXBA 1PM3A 1QQJA 3LH0A 1QVGP 3VRYA 1ARKA 2KDSA 1R0BG 4R0KA 1FMKA 2H3JA 4J9EA 3KFVA 4CC7A 1Y0MA 4PK4A 1YIJA 2V8KA 1K9MC 2DVEA 2K7AA 2MI6A 5DY9A 1WX6A 1VQOT 1VYUA 1KG1A 3UATA 4EMKC 1NM7A 1IGQA 5CO7A 9ATCB 1VQMA 3M0PA 1N6AA 1RAIB 3QJYA 4RTWA 1GRIA 2JW4A 2FO0A 2P0KA 5GANh 2L5QA 2DO3A 2EGCA 1YJNA 3CC2Q 1Q95G 5D6XA 2ED1A 1KD1U 2YLCA 1YJ9Q 4BDZA 2EYQA 2VASA 2L89A 2X9HA 3OMGA 3EGXB 4E7ZA 1MV3A 3CCSA 2DXUA 5I2MA 4N0AC 5LJ3j 4RKUE 3M55A 3EG9A 4AMCA 5LJ5h 2K9GA 4D8KA 4D8DA 3OYMA 1WXUA 2RH2A 4PJOD 1BI3A 3EG3A 2JT4A 3OYGA 3MKDA 3QYGB 4HCZA 5AYFA 5LL6S 1TU0B 3URGA 2F2XA 1PHTA 1VQLA 1GXIE 1G3YA 2QA4T 1Q86R 5C0MA 1X2QA 5FU7B 1VQ8T 4M75D 2V26A 1PRMC 3CPWS 3J7AF 2ED0A 3NTHA 2QEXQ 2IG0A 3M4GA 3JCMh 2O31A 2ABLA 1AZEA 1BB9A 2XICA 3G7ZA 2K3XA 5GAMj 5ECAA 2W10A 2D0NA 1UHCA 3RMQA 2KR3A 3R6OA 4B6MA 2AZVA 3CCUT 1RABB 3VJPA 2KXDA 1GCQA 1BU1A 2ZPIB 1M8VA 2R58A 1Q86C 1HYOA 1UJYA 3MJXA 2PU9B 4F17A 1ZA1B 3JAME 3OYAA 3L2QA 2E5QA 4OMLA 3OBWA 2KRSA 4M77F 1MMGA 1UE9A 4RTUA 5J26A 3GLXA 1E6GA 1Z9QA 4EMKA 1RADB 1AWOA 2DD5A 2RHXA 2PVOB 2E4HA 2F1LA 1VQ7T 3HP9A 3CMAA 4IUQA 4KGVB 2KBTA 4C0DC 1Y57A 4F14A 3JCMe 4M78F 1UHFA 5GAN6 3ZBDA 3HRTA 4QVCA 3L1AA 5FU6C 1FXXA 2EGEA 1X6BA 3LX7A 1WHMA 4OF1A 1B7TA 1VQ5A 1VQ4A 3EFOA 1G3SA 4HA8A 3FC3A 4QVZA 2K57A 1NLPC 2XK0A 3I5SA 3CCJT 4KGXB 3M9QA 1N9SA 3EG9B 3KBGA 2MF2A 3GBQA 2DERA 3A8OB 2A7YA 3V7SA 2BIVA 4N0AA 3M0QA 4AG2C 2ROLA 3H0IA 2KRNA 1MMDA 2XIDA 1M30A 4C92E 1WI7A 2EJFA 1MHNA 2JN0A 2DFUA 3PTAA 3E19A 3LWHA 5GMKj 4BE1A 1GFDA 1WZOA 1ZBXA 3WXMB 1IGUA 3CC7Q 2X4XA 1VQ9A 4CC2A 1K9MU 2V8JA 4IUPA 2J05A 1LNXA 2YHTA 1QVGA 2EQIA 2BZXA 2XHCA 1TUDA 2DNUA 2ZGWA 8AT1B 4A4GA 3RESA 3J80E 2B86A 2F5KA 3REBB 2PUOB 1KC8C 2JZ2A 4JUVA 4OB3B 5D7UA 1VQKQ 2YSQA 3RR6A 2J7IA 2L3RA 3CC4A 1RACB 1W4SA 1T3SA 2QQRA 1SRMA 4DEYA 4FM4B 4XTZA 1UFFA 3ME9A 3EFRA 3CBMA 2LNHB 5IT9E 1WHGA 5CIUA 4E47A 5CKDA 4M7DE 2QQSA 2R57A 4J9CA 3A1PA 5A0DA 5GANg 5GANd 4M77G 1UG1A 2GQVA 3H9NA 1BBZA 3EHQA 2DIQA 1GCPA 4R56A 2FB7A 2A28A 1NJIU 5I22A 1X2KA 2L3PA 4QT7A 3G4ST 2D6FA 1OV3A 2GFAA 1YITT 1X69A 3CMEQ 3CCMQ 3EFOB 3VKIA 2D8JA 4O5VA 4M78G 4JRKA 4F7UE 2OTJT 2O4XA 1XOVA 3PMIA 3L42A 2PVGB 1GFCA 2DEQA 1PD0A 5HK3A 2D1XA 5EC7A 5GMKh 2DX1A 2RMOA 2GTJA 4F7UA 3G6ET 2AKLA 3L2UA 1TG0A 1IO6A 1BYMA 1LJOA 4E7JA 4PJOG 3N5BB 3JRZA 1BCMA 2CH4A 2YXYA 3KXTA 3L2WA 3UA6A 3A8MB 3RKXA 4AT1B 3I55A 3NMZC 2DK3A 1VOMA 3P8HA 4PJNA 3MPUB 3TQ7P 3CCET 1VA7A 1PG5B 3OB9A 5KYYA 1JB0E 4J8OA 3S6WA 2E1HA 3GOXA 2V8IA 3OSVA 1G3TA 1VYVA 2HNIA 4HVUA 2BE9B 4WCIA 4ELYC 3M57A 1RL2A 2EQMA 4X34A 2M1HA 3PE0A 2WSFE 5IN1A 3CCVQ 1YJ9A 4M78C 3SFMA 2LRQA 4GLMA 2QGGA 2RJCA 2DZCA 2QQBA 1B34A 3M0SA 1BCOA 1YBYA 2LJ3A 2H8HA 2JS0A 2JM9A 4FT2A 4PL6A 1SPKA 5FWCA 3DLMA 2VWFA 1Q7YC 4M7DB 1S72A 1TTHB 4FT4A 2LQNA 1N5ZA 4PJOC 1WFWA 1E7OA 5IHNA 2K5FA 2X4JA 1QKXA 3DKMA 3RIRA 5LJ3d 2VKNA 5LJ3g 2A37A 2NUZA 1OPKA 2DTHA 2WSCE 4IUUA 5GAOq 1N8RC 2K3BA 4GBQA 3A8HB 4AFZC 2DKGA 3BY7A 4IKFA 2HZYA 1UGSB 4M75C 3FRNA 4CRIA 3C0CA 1ACMB 1PKTA 1A0NB 3BFMA 3UF4A 1VQMT 2O4XB 3EGDA 3VS3A 1I5LA 4KRTA 5LJ5f 1TUGB 1PSFA 3FDRA 3CCRA 4F7UB 2WSEE 2DL4A 4C5IA 4M7AE 3P8DA 1M1KR 2KGTA 2DETA 1O75A 4RG2A 5GAMg 5GAMd 1TXQA 2NLUA 4C92F 1AT1B 2HEQA 4HT9A 2G6FX 3HRSA 1KQSS 2C0OA 1NYFA 1AHJB 1WDXA 2EVRA 2RB6A 3JCMf 4N4HA 1M1GA 2XD0A 5IXFA 3M56A 3CXCS 1K0XA 3CPWP 3PVQA 4M4ZA 1ZUYA 3A98A 3OYLA 5AT1B 1D1CA 4C8QE 3LH5A 3CCQT 1M1KC 2CZ6B 4ZGDB 4FYVB 1YHQT 2ENMA 3ULRB 2JM8A 3LWIA 4A54A 4BUGA 2QA4Q 2CH4W 4PLIA 2ZCFB 1VQ8Q 1Y07A 1B34B 1DJ7B 2AKKA 4EDUA 2AK5A 3VRZA 2KI7A 1QVFS 3QZ9B 1M3AA 1WGSA 3P8BB 1AWWA 3OSSC 2K2MA 4BE0A 2CZ7B 2KXCA 3EH1A 3ZFJA 4IIOA 4OB0B 1UGVA 1PKSA 4M7DF 4LDYA 1RLQC 2RO0A 2EYWA 5J3BA 2F2VA 2DBKA 4LD6A 5CKEA 4LDXA 1MNDA 2VYTA 3VYHB 1OI1A 1V29B 3CCUQ 3LLRA 3O8VA 4PJOA 2G3RA 2RQUA 4AG1C 2RQTA 4PFOA 1HJDA 4M75E 4PFZA 2M51A 2HAXA 1WPYA 2ZPBB 2O01E 3LGFA 4XTVA 1FX7A 4XU2A 4PLLA 4M75A 3HPWA 1SHGA 2M0OA 4E7KA 1ZUUA 3FJ5A 4CI0C 4OP0A 3BDUA 1VQ7Q 3EH2A 1ZSZB 1ABOA 4GY5A 2QAZA 1VQKA 3OBYA 2X35A 4AFUC 3C4SA 1M90R 3E1SA 4M7AB 2C0TA 5GAN7 3OYEA 2RI5A 5GMKm 4V2SA 4M77D 2EQJA 3E9GA 4BY6B 5KH6A 1VQ4T 2CKKA 2FZCB 4VUBA 1MGQA 5IH2A 3C94A 5KYWA 2PNIA 3CCJQ 4JLGA 2HL3A 2VXEA 4A4FA 3L2RA 4JPBW 4E6RA 2P0QA 3LW5E 2L3SA 4NS5A 2FPFA 5GAN2 3WVEB 3H41A 2MIOA 4M78D 4FYYB 3JCMc 2LCCA 3VS4A 3IQLA 1X6OA 3INZA 3NHNA 4HCCA 1FMWA 4BI8B 4C8QB 3OYKA 1M90C 2P84A 1BI1A 3M53A 3I56T 2KNBB 3EFSA 3RERA 3CMEA 2E70A 3CCMA 1S1NA 4OB1B 4LN2A 4FL6A 1VQ9T 1TOVA 2QK0A 2HKQB 2D9TA 5I2SA 2DRKA 2FVUA 1QMCA 1PD1A 2EW3A 4C0GA 2IPOB 3D7SB 3CD6T 2L2PA 3NPFA 1IHVA 3QZ5B 4Z88A 4KGZB 4O6JA 4PJOB 4DBQA 1M3CA 3CC4T 1TH7A 4DQ2A 3AHUA 1LVKA 3OW2P 2K4YA 2QDLA 5GANe 2CP2A 2ATCB 2X4YA 1MMAA 2JTMA 1RAAB 5CQYA 2O88A 2ZZDA 3OYDA 2NUPA 2LT1A 3I35A 4IURA 3QYHB 4M75B 4HCKA 2ZPFB 4A53A 1QKWA 3QDRB 1D09B 4Z8AA 2JVVA 1JJ2P 4WTOB 2CP3A 3VU3C 2KQWA 1X75C 4MZPA 2LCLA 4KUDK 1JU5C 1M8MA 2LVMA 2A36A 3O5ZA 5LJ5e 1C1AA 4GLKA 1HXDA 3CCLA 2OTLA 1GBRA 4M7AF 1KIKA 5CK9A 3QWXX 4OMNA 4NL2A 4KULA 1H3ZA 3G4SQ 1YITQ 1RAFB 2DL3A 1G3WA 5KCOA 2Y4XA 1KQ2A 4MDXA 3R6NA 5DM7R 2JOYA 2OTJQ 2PUKB 2LDMA 1U06A 3HHTB 5LJ3h 5I21A 3EGUA 3I5RA 2XDBA 1G2BA 3G6EQ 4LNPA 2MOXA 1YJWT 1WJRA 3PIPA 4C8QF 2ZPGB 4DOWA 1WYXA 2YLBA 3A8GB 4OB2B 3OY9A 1VQ6T 1NPRA 3OYJA 3I55T 1OU8A 2LJ1A 1GBQA 4PKCC 1D0YA 3V8LA 2RI3A 1E6HA 1QVGS 2DTOA 3CCEQ 3V8JA 1MMNA 4HKEA 2E6ZA 2HBPA 2LC4A 5GMKl 4FW1A 1I81A 1K8AC 1WHKA 3JCMb 5I11A 1KC8R 4L59A 3ASKA 2CSIA 2L3QA 2MK5A 2E3HA 1QWEA 2MCNA 1JXMA 4JJCA 1IZ6A 3JCMV 1VQPQ 2KRMA 5GAMh 2MAMA 1AD5A 4FYXB 1PC0A 2V1QA 1K9AA 4J9HA 2RF0A 5D6WA 2XDPA 5KYUA 1VIFA 3A8LB 4Y28E 3X25B 2ROTA 1D3BA 1QP3A 4ZN1A 3GIBA 3RBBB 1VQNT 1MNEA 2HDAA 2W0ZA 2J06A 3QKJA 1KSWA 4LUDA 3CEYA
chains in the Genus database with same CATH topology
1BI2A 3V7CA 4J6YA 1YJ9A 4C92C 4M78C 4XTXA 3SFMA 3CXCA 2DXTA 1YHQA 3H6ZA 2LRQA 3JCMP 2P0PA 3L2ZA 1S72T 3OS5A 5KE2A 2RJCA 1WJQA 5IAYA 2D0QB 2RHUA 2MWOA 2K2VA 1M5Q1 2DZCA 2QQBA 1B34A 4JS4A 2RJFA 1YBYA 4HT8A 4JLIA 4DA4A 3JB9J 5FRMA 3CCVT 3TREA 3LYIA 4FT2A 4PL6A 5EG2A 3JB9G 1Q82C 2CZ0B 3NFCA 1M9SA 1Y7XA 4BD3A 3DLMA 3H8ZA 1NZ9A 1Q7YC 4M7DB 2L8DA 4J83A 1S72A 5GAOp 1I8FA 2QXFA 3QBYA 4FT4A 4XTWA 4A4EA 3S3NA 4PJOC 1OZ3A 1QP2A 1ZQ1A 3LGLA 4OGCA 3X26B 2OAUA 1BIAA 4EMKB 1KHCA 5LJ3g 2K5FA 2X4JA 3DKMA 3RIRA 5LJ3d 1Y96B 4HCBA 2P4TA 5CVIA 4F7UG 2DTHA 3CCVA 2WSCE 4IUUA 4IUTA 5GAOq 3MP8A 1QVFA 1N8RC 3CPFA 1W2BS 2GF7A 1ZHIA 2JNGA 3A8HB 1M1KU 5M9OA 2CYZB 4KBMB 1Q81U 3LH0A 1EIFA 2DKGA 3BY7A 4II1A 5CR2A 4IKFA 3CCRT 1UGSB 2RHIA 2VXFA 3M59A 2KDSA 4M75C 3CEYA 2HD0A 3FRNA 4CRIA 2H3JA 3CPWA 3OQ5A 2JUFA 3BFMA 3CCUA 2M9UA 1VQMT 2O4XB 1YIJA 1I5LA 2LQ8A 2V8KA 5CKBA 2EFIA 3MEWA 5LJ5f 4D6WA 2KVQG 1K9MC 1PSFA 3GNGA 2DVEA 4M7DC 2MI6A 5DY9A 3FDRA 3CCRA 3A5ZB 3VYGA 1YI2T 4F7UB 1VQOT 1KG1A 2WSEE 2DD4A 4EMKC 3L2VA 4FU6A 3UT1A 2I2LA 4C5IA 4M7AE 2LTOA 3P8DA 5CO7A 1G5VA 1VQMA 2DIGA 4XU1A 2RK1A 3BW1A 1O75A 4RG2A 2DXBA 2R5AA 4ZN3A 5GAMg 1N6AA 4NOYA 5GAMd 3QJYA 2NLUA 4C92F 3QJ6A 3OYFA 4HT9A 1VQOA 2RK2A 2P0KA 5GAOm 3HRSA 5GANh 4RMOA 1KQSS 3G71T 1AHJB 2L5QA 2DO3A 2K5LA 2RB6A 3JCMf 4ATOA 2CS7A 1YJNA 4N4HA 2FHDA 1M1GA 5D6XA 4B9XA 2YLCA 4C92D 5C6SA 1KD1U 2XD0A 3CXCS 3M56A 4XTYA 2MMPA 3VV0A 4BDZA 3OW2A 2FL7A 3FEOA 4C0FA 4MDWA 4JS5A 1Q86U 2EYQA 3ER0A 2RJDA 2BUDA 3OYLA 5HY6A 2L89A 3OMGA 3CCSA 1WQWA 4J5YA 4M77C 4PJOF 1O9SA 4LDWA 4C8QE 2DXUA 1JBMA 3CCQT 5I2MA 3MHXA 3CC2T 2K5IA 1OYXA 4N0AC 5LJ3j 1M1KC 3HKSA 1UGRB 4RKUE 2CZ6B 1YJ9T 3M55A 4ZGDB 1BI0A 2XU8A 3PMTA 3T9NA 5LJ5h 1YHQT 4BI3A 1QW1A 2LQKA 3CCJA 3LWIA 2ZPEB 2QDYB 4A54A 1KHIA 1WJSA 2EAYA 4BUGA 3OYMA 5GAOr 1JJ2A 4LDUA 2E12A 4BACA 3SWNA 4Z02A 2RH2A 4PJOD 3PFSA 5LJ3e 4PLIA 1BI3A 2ZCFB 5DLOA 3OYGA 4M75F 1Y07A 1B34B 1DJ7B 3QYGB 4HCZA 5AYFA 5LL6S 3OS0A 3I56A 5A2QE 3CC2A 4EDUA 2EIFA 3RUXA 4PNOA 4C92A 5FROA 3QZ9B 1QVFS 3NTKA 4MMKA 4RG8A 3P8BB 1WGSA 3URGA 1K73C 3OSSC 1VQLA 1G3YA 3WVDB 2QA4T 4BE0A 2RHZA 2CZ7B 4LD9K 1GXIE 4C5HA 5C0MA 3ZFJA 4OB0B 4BI4A 5FU7B 5GMKe 1VQ8T 4M7DF 4LDYA 2EQKA 4M75D 4C5EA 1W2BA 3CPWS 2IVWA 3J7AF 5GMKi 2RO0A 3NTHA 5J3BA 2IG0A 3M4GA 4LD6A 4JDSA 5CKEA 3JCMh 4LDXA 3VYHB 2VYTA 3CD6A 1OI1A 1V29B 1FWZA 3LLRA 2HQXA 2QA4A 3OYHA 2XICA 3O8VA 4PJOA 4A4KA 5CKHA 3G7ZA 4M7DD 1VQ8A 2K3XA 4KUIA 4YTLA 5GAMj 2G3RA 5GANf 1M1FA 2QEXT 1U1SA 5CKFA 1M90U 3HL8A 3R6OA 4M75E 3RMQA 4EMGA 2QQ9A 4JRPA 3QHSA 3CCUT 3JB9F 4M7AG 1YIJT 3VJPA 3FIFA 2HAXA 1WPYA 2ZPBB 4C0DB 2O01E 2ZPIB 5GAMe 2BKDN 1M8VA 4Y91A 3LGFA 2R58A 3JSCA 5D6YA 1Q86C 4ME7A 4XTVA 1FX7A 4XU2A 4PLLA 4M75A 4UC4A 4XU3A 4FIBA 3HPWA 4E7KA 2M0OA 2PU9B 5FU7C 4L6V5 3JAME 2QEXA 5GAN8 3NTIA 3MEAA 3MCAB 1XTDA 5FU6B 3PNWC 4CI0C 3OYAA 3L2QA 2E5QA 3JB9D 3OBWA 4OP0A 3BDUA 4EMHA 3HFNA 1HK9A 4M77F 5KE3A 2QQAA 2DPPB 4XTUA 4M7DA 2CGHA 3HSBA 5J26A 3OW2S 4EPCA 4GY5A 5FLXE 1XQHA 2R5MA 3GLXA 1VQKA 2VC8A 3OBYA 2X35A 3C4SA 4EMKA 3E1SA 4A4HA 2DD5A 2M16A 2PVOB 2RHXA 1Y96A 4M7AB 5GAN7 2RI5A 5GMKm 3OYEA 1VQ7T 4V2SA 4M77D 2EQJA 3E9GA 4BY6B 3HP9A 4C8QG 3CMAA 1YJNT 4JRQA 5KH6A 1VQ4T 4IUQA 1PSEA 1U1TA 4C0DC 3VUZA 2XI9A 2CKKA 1Y71A 4VUBA 1MGQA 1P92A 3JCMe 4M78F 2LX9A 5GAN6 3C94A 3HRTA 3ZBDA 4QVCA 4JLGA 1KC8U 1JJ2S 3L1AA 2VXEA 4BDYA 3QO3A 2XG8D 4A4FA 3CCST 3SDZA 4BB7A 5LJ5g 5CAIA 5LJ5d 3L2RA 5FU6C 1FXXA 1VQ7A 2P0QA 3LX7A 1YCYA 3LW5E 4P5NA 4OGEA 2E6NA 4OF1A 4C5GA 4NS5A 1VQ5A 3EAEA 4M77E 4LDVA 1VQ4A 3OYNA 5GAN2 3PIOA 2XKOC 1G3SA 4HA8A 3WVEB 3FC3A 4TVRA 3G4SA 4QVZA 2DJZA 2K57A 2XK0A 2DXCA 4M78D 3JCMc 5GAN5 1VIEA 2LCCA 3M9QA 3CCJT 1SSFA 1N9SA 1X6OA 3KBGA 3UDCA 3INZA 4HCCA 2MF2A 4BI8B 3A8OB 1D3BB 4C8QB 5HK0A 4M77A 3OYKA 1M90C 2A7YA 2JTFA 4M7AC 3SWNB 1YJWA 1KQ1A 3V7SA 1BI1A 5HKCA 3M53A 2BIVA 1JRIA 4N0AA 4BY6C 3I56T 3KUFA 3EFSA 3RERA 4ZGJB 2E70A 3CMEA 3CCMA 1Q81C 4OB1B 2XIDA 2K3YA 1VQLT 4C92B 2LNVA 3CBPA 4FL6A 1VQ9T 3OS2A 1VQ6A 3M58A 3M54A 4C92E 2EJFA 4M78E 3JCMg 3JCMd 1MHNA 2JN0A 2D9TA 2RA2A 4N4GA 5I2SA 3J81E 1X01A 3BDLA 2E10A 3META 4ZGEB 3UWNA 3PTAA 4J7IA 1N27A 2FVUA 3E19A 5GAOl 3LWHA 5GMKj 4M75G 4IUVA 4BE1A 4MMLA 4C0GA 3TEEA 4M78A 1ZBXA 3GNFB 3WXMB 3CD6T 2X4XA 4C0ZA 3QZ5B 1UGPB 2RI2A 4DOVA 3S3OA 1VQ9A 3X24B 1NPPA 4KT0E 2EJ9A 4NL3A 2B8AA 4O6JA 4FSXA 3M4YA 2KSSA 5A0GA 1K9MU 2V8JA 4PJOB 3SB2A 1VQPT 4IUPA 2KMTA 4C8QC 4J6WA 1LNXA 2E41A 4JJNK 1UEBA 2YHTA 1QVGA 4PJOE 3CC4T 1TH7A 1KQSA 3RKYA 2XHCA 4DQ2A 3V8KA 3AHUA 1RI0A 2K4YA 3CC7T 2ZGWA 2RM4A 5GANe 4A4GA 4RCBA 3RESA 3J80E 4OVAA 1QVPA 2X4YA 2JTMA 2VUBA 5CQYA 3MP6A 5LJ3f 2F5KA 1VUBA 2PUOB 1KC8C 3RMSA 2ZZDA 2JZ2A 3OYDA 3DLLA 4JUVA 2KK4A 4OB3B 4JRIA 2LT1A 4QQ6A 3OYIA 4IURA 4L5GA 3QYHB 4M75B 3GPLA 5L8RE 1VQPA 1VQNA 2RJEA 3PT9A 1XNIA 2L3RA 2ZPFB 1LOJA 2HQEA 1W4SA 4A53A 3CC4A 2QQRA 3CCLT 2OTLT 3CC7A 5FRNA 3JB9H 2EJGA 5KCHA 5LJ5j 4E7HA 1KD1C 2VGNA 3QDRB 2KAFA 5DLQE 2DZ9A 2JVVA 4FM4B 4XTZA 4B9WA 3UPUA 3ME9A 3VU3C 2KQWA 1X75C 3EFRA 3CBMA 2LCLA 4MZPA 3OS1A 1K8AU 2C06A 2E65A 4KUDK 2LVMA 4N4IA 3X28B 4R55A 5IT9E 1VQKT 5CIUA 4E47A 5LJ5e 3F70A 3FJPA 3RKWA 5CKDA 4GLKA 4M7DE 1HXDA 4QVDA 2QQSA 4X9CA 4F7UF 2R57A 3OYCA 3QPHA 3CCLA 2PVDB 1I4K1 2OTLA 3FB9A 3OYYA 4X9DA 2WACA 3S3MA 3CMAT 4M7AF 3OA6A 2F5TX 5CK9A 1H641 3JCMJ 5A0DA 5GANg 5GANd 4M77G 4NL2A 2RHYA 2YRVA 2ZPHB 3QG1A 2GQVA 4KULA 1H3ZA 2A3LA 4ELZC 3GP8A 4XAXB 2DIQA 4R56A 1NE8A 2FB7A 4QQGA 3JCMX 4ZTJA 1G3WA 5KCOA 4M7AD 5GAN4 4BE2A 2Y4XA 3MO8A 5GAMf 2EQUA 1N9RA 3ZEHA 3JB9I 1KQ2A 3JCMQ 4MDXA 5DM7R 2JOYA 1NJIU 2MWPA 3OYBA 1WNLA 2E64A 3MP1A 1VQ5T 2PUKB 3QUIA 2FYKA 2GFAA 2LDMA 3G4ST 1YITT 2D6FA 4E7LA 3DB3A 3MEVA 1IREB 3HHTB 5LJ3h 3VKIA 3VUBA 3GF5A 4O5VA 5I21A 1K73U 3M5AA 2XDBA 4C92G 4MZTA 3TCJA 3TU4K 4M78G 2GCXA 4JRKA 2XDDA 1YJWT 3OMCA 1WJRA 4M77B 4F7UE 5GAN3 1M4ZA 4C8QF 2ZPGB 3PIPA 2O4XA 4DOWA 1XOVA 3C95A 2OTJT 3PMIA 2YLBA 3L42A 2PVGB 3CMET 3A8GB 2DEQA 3QIIA 2X4WA 5HK3A 3CCMT 4OB2B 2EWNA 4Q5WA 4QQDA 5CQXA 1YITA 1WQ7A 5CCAA 3OY9A 5GMKh 4MZMA 1VQ6T 1Q82U 3C12A 3HFOA 1UB4A 1NPRA 3OYJA 3E9FA 4F7UA 3I55T 2F69A 5A0LA 3G6ET 2QTXA 1YI2A 3X20B 1Q7YU 4M7AA 4PKCC 2EKOA 3Q1JA 4C8QD 3V8LA 5GMKl 3L2UA 2RI3A 1BYMA 1LJOA 2GFUA 4WF2A 4E7JA 1QVGS 2OTJA 2DTOA 2RD1A 4PJOG 3V8JA 2KY9A 4HKEA 2E6ZA 2HBPA 2CZ1B 2LC4A 2DAQA 1I81A 3JRZA 3N5BB 1K8AC 1UGQB 2LT4A 1OZ2A 3KXTA 3L2WA 3JCMb 4L59A 4M78B 3ASKA 1BIBA 2Y90A 2AHJB 4XK8E 1N8RU 3A8MB 3RKXA 3I55A 3G6EA 3CBOA 4XQ3A 2DK3A 3SD4A 1IZ6A 3P8HA 3JCMV 3DB4A 3CCET 4OMFB 1BKBA 1R8OB 3OB9A 2MAMA 2Y4YA 5IN1A 5GAMh 4QW2A 3G71A 4E7IA 1JB0E 4J8OA 4J6XA 3S6WA 2E1HA 3GOXA 3JCMW 1U8RA 5GAOn 2V8IA 3OSVA 3PGGA 3QXEB 5D6WA 5J39A 3QSUA 2XDPA 2VV5A 1VIFA 3A8LB 1G3TA 4RCCA 4Y28E 2HNIA 3X25B 5GANj 2VGMA 2QI2A 1D3BA 1QP3A 4C8QA 4ELYC 3M57A 4ZN1A 3GIBA 1RL2A 2EQMA 2PQWA 3FLGA 4X34A 2M1HA 4ZTFA 1VQNT 3CCEA 3HRUA 4M7DG 3SWNC 1NJIC 3MEUA 4XU0A 3V7RA 3QKJA 4J7FA 2WSFE 3CCQA 2DTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JTM A;  3LWH A;  3LWI A;  3KXT A;  4R56 A;  4R55 A; 
#chains in the Genus database with same CATH topology
 1LCK A;  4J6Y A;  2DYB A;  2CT4 A;  2DXT A;  1CKA A;  1S72 T;  5KE2 A;  2MPX C;  2X3X D;  2X3W D;  1ABQ A;  1RLP C;  1W1F A;  1SHF A;  4HT8 A;  2DL5 A;  4DA4 A;  2P4R A;  3JB9 J;  2DJQ A;  1Q82 C;  4E7S A;  2D8H A;  1ZLM A;  1R0C B;  3H8Z A;  1M3B A;  1YN8 A;  2DE0 X;  4J83 A;  4XTW A;  3S3N A;  3QDF A;  4OMO A;  1QP2 A;  4OGC A;  2OAU A;  1BIA A;  4EMK B;  2COW A;  2P4T A;  4IUT A;  5FW9 A;  3CPF A;  4CC4 B;  1OX9 A;  1T0H A;  1ZHI A;  1VQM Q;  5M9O A;  4KBM B;  1EIF A;  5CR2 A;  1KQS P;  3CCR T;  3M59 A;  2HD0 A;  3OQ5 A;  2JUF A;  3CXC P;  3CCU A;  1W6X A;  1QLY A;  1XJW B;  5CKB A;  2EFI A;  2KVQ G;  3GNG A;  1YI2 T;  4FCY A;  3JV3 A;  3L2V A;  2JJ9 A;  4ANJ A;  4FU6 A;  3UT1 A;  2FZG B;  4J9B A;  2DXB A;  2R5A A;  2GQI A;  4DEX A;  2QAS A;  3VS7 A;  1AZG B;  4RMO A;  3G71 T;  4ATO A;  2CS7 A;  2KE9 A;  1X6G A;  3CCQ Q;  2CT3 A;  2QYZ A;  2YUO A;  4C92 D;  5C6S A;  3OW2 A;  4XTY A;  3VV0 A;  2FL7 A;  3FEO A;  4C0F A;  1G83 A;  2VB6 A;  1YHQ Q;  5KYU B;  2J6K A;  1Q86 U;  3ER0 A;  2RJD A;  4CC3 A;  5HY6 A;  2ECZ A;  2DYI A;  1WQW A;  1CKB A;  4M77 C;  1O9S A;  1JBM A;  2E5K A;  2K5I A;  1OYX A;  3HKS A;  5HCK A;  4AFS C;  1WLP B;  2QG9 B;  1Q7Y R;  3T9N A;  4BI3 A;  1QW1 A;  4OMM A;  3CCJ A;  2QDY B;  1WJS A;  2EAY A;  5L23 A;  1JJ2 A;  2E12 A;  2FPE A;  1AWJ A;  4Z02 A;  3PFS A;  1W2B P;  1NEB A;  5DLO A;  3OS0 A;  5A2Q E;  1SKU B;  1N8R R;  3CC2 A;  2EIF A;  3RUX A;  3I9Q A;  4PNO A;  4MMK A;  4LD9 K;  3WVD B;  2KYB A;  5KYX A;  4C5H A;  1QCO A;  4J9I A;  4DBH A;  5GMK e;  1G8X A;  4C5E A;  2EQK A;  4RTV A;  5GMK i;  1MV0 B;  4HXJ A;  1V1C A;  2XMF A;  1FWZ A;  3RDV A;  3AT1 B;  1OOT A;  4A4K A;  5CKH A;  4M7D D;  2OAW A;  1UUE A;  1ZBJ A;  1ZUK A;  5GAN f;  1M1F A;  3PVL A;  1U1S A;  4EMG A;  4Z89 A;  4JRP A;  3JB9 F;  1YIJ T;  4C0D B;  3E2U A;  2YUQ A;  4Y91 A;  5D6Y A;  4ME7 A;  4X1V A;  2J6F A;  4UC4 A;  4FIB A;  5FU7 C;  4F16 A;  2QEX A;  5GAN 8;  1VQO Q;  3NTI A;  5FU6 B;  1VYT A;  3PNW C;  2YWW A;  4JJD A;  4EMH A;  1HK9 A;  1H3H A;  5KE3 A;  2MYS A;  1VQ4 Q;  1JQQ A;  1IRX A;  3HSB A;  1XQH A;  2KT1 A;  2VC8 A;  4A4H A;  4OMP A;  2M16 A;  1Y96 A;  2J6O A;  2LP5 A;  3VS5 A;  1IB8 A;  1U3O A;  4KH0 B;  1YJN T;  1Q81 R;  4JRQ A;  4F04 B;  1PSE A;  3VUZ A;  1Y71 A;  1YWP A;  1D0X A;  1P92 A;  2LX9 A;  1YFN A;  5KYN A;  3NGP A;  1KC8 U;  4BDY A;  3CCS T;  4BB7 A;  2PTK A;  1OUL A;  4P5N A;  2E6N A;  1FMV A;  3EAE A;  4M77 E;  5KYY B;  3OYN A;  3I56 Q;  3G4S A;  3PIO A;  2XKO C;  3U23 A;  2FRY A;  2DXC A;  1VIE A;  2Z0W A;  1TS9 A;  2DM1 A;  1X27 A;  3UDC A;  2YRD A;  4M77 A;  2JTF A;  4ORZ A;  3KUF A;  3M0R A;  1Q81 C;  1VQL T;  4ZNX A;  3CD6 Q;  3M58 A;  2LQW A;  4M78 E;  5KYX B;  2RA2 A;  2O2O A;  4N4G A;  2E10 A;  3UWN A;  4J7I A;  2DA9 A;  3CC4 Q;  4MML A;  3TEE A;  4M78 A;  3GNF B;  2OI3 A;  2O9S A;  2HKN A;  1PNJ A;  1JXO A;  2RI2 A;  4DOV A;  3S3O A;  4KT0 E;  2EJ9 A;  1HSQ A;  2GGR A;  2O9V A;  4FSX A;  5A0G A;  2JMC A;  1OX8 A;  4IIM A;  3SB2 A;  1UJ0 A;  4JJN K;  1EZZ B;  4K11 A;  4PJO E;  2M0Y A;  1KQS A;  4PJL A;  1U5S A;  2RM4 A;  1QVP A;  3MP6 A;  5LJ3 f;  4FW2 A;  3DLL A;  1M2V A;  4QQ6 A;  1VQP A;  5L8R E;  1UEC A;  2RJE A;  3PT9 A;  3RNJ A;  1LOJ A;  2HQE A;  2LJ0 A;  2CUD A;  3CCL T;  2COY A;  2OTL T;  1WIE A;  2E3I A;  3CC7 A;  5LJ5 j;  4E7H A;  5FRN A;  3UPU A;  3EGD B;  3G1J A;  3OS1 A;  2C06 A;  2E65 A;  1TUC A;  4R55 A;  2DMO A;  3F70 A;  3FJP A;  4FYW B;  4X9C A;  4F7U F;  3OYC A;  3QPH A;  1I4K 1;  3FB9 A;  3CMA T;  3OA6 A;  3VS6 A;  1I5O B;  2YRV A;  3EG1 A;  4ELZ C;  2EGA A;  1RUW A;  4QQG A;  3VS0 A;  2A0F B;  4LXC A;  4M7A D;  3MO8 A;  1F1B B;  5GAM f;  1N9R A;  3ZEH A;  3TSW A;  3JCM Q;  1YJW Q;  1VQ5 T;  1WNL A;  2E64 A;  4E7L A;  3MEV A;  2EKH A;  2ZAE A;  3VUB A;  2PZ1 A;  1VQ6 Q;  3M5A A;  4C92 G;  2BZY A;  1T3L A;  3I55 Q;  2XDD A;  3OMC A;  4M77 B;  4Y92 A;  5GAN 3;  1M4Z A;  1IHW A;  1I07 A;  3QII A;  1W2B A;  1IXD A;  2X4W A;  2DTI A;  4Q5W A;  2EWN A;  2DF6 A;  1WQ7 A;  5CCA A;  4MZM A;  3C12 A;  3HFO A;  3E9F A;  2RNA A;  2DRM A;  1Q7Y U;  2DL7 A;  2EKO A;  1NJI R;  4C8Q D;  2GFU A;  2RD1 A;  2DAQ A;  2SRC A;  1UGQ B;  2LT4 A;  4M78 B;  1BIB A;  2Y90 A;  2AHJ B;  1N8R U;  2KYM A;  3CBO A;  3TSZ A;  2K6D A;  4A63 B;  1KJW A;  4OMF B;  1VQN Q;  1BKB A;  4J6X A;  1U8R A;  5GAO n;  3PGG A;  3QXE B;  1SG5 A;  1WA7 A;  4RCC A;  3EG2 A;  1C6V X;  1S72 Q;  1K0S A;  1M2V B;  2BTT A;  3HRU A;  4M7D G;  3SWN C;  1NJI C;  4XU0 A;  3V7R A;  4PJJ A;  2L0A A;  3CCQ A;  3QWY A;  1BI2 A;  3V7C A;  4C92 C;  1SRL A;  1YHQ A;  3JCM P;  3L2Z A;  2CP5 A;  1UDL A;  2MWO A;  1AVZ C;  1M5Q 1;  4JS4 A;  2RJF A;  4JLI A;  1RI9 A;  1HD3 A;  1YCS B;  5EG2 A;  2CZ0 B;  4BD3 A;  1M9S A;  1Y7X A;  4JJB A;  2HBW A;  1NZ9 A;  1W70 A;  5GAO p;  1I8F A;  3EG0 A;  1RAE B;  1ZQ1 A;  3LGL A;  1EX4 A;  3X26 B;  3CCR Q;  2DIL A;  2LCS A;  2AIR B;  4F7U G;  3CCV A;  3MP8 A;  2GF7 A;  2SEM A;  2JNG A;  2RQV A;  1M1K U;  2COZ A;  1Q81 U;  4II1 A;  1QCN A;  2X51 A;  2RHI A;  2VXF A;  5KYW B;  5IHK A;  2YDL A;  1AWX A;  3CPW A;  1YI2 Q;  4OMQ A;  4HVV A;  2BZ8 A;  1K8A R;  2M9U A;  2RPN A;  2K79 A;  3VS2 A;  2LQ8 A;  3MEW A;  1M2O A;  4D6W A;  2DVJ A;  4RUG A;  4M7D C;  6AT1 B;  3A5Z B;  3VS1 A;  3VYG A;  2DD4 A;  1NG2 A;  2DBM A;  1M27 C;  2I2L A;  3EHR A;  4LUE A;  2LTO A;  2FZK B;  1BK2 A;  3G71 Q;  1G5V A;  2DIG A;  3CQT A;  2DEU A;  4XU1 A;  2RK1 A;  3BW1 A;  2KT8 A;  1NBE B;  4ZN3 A;  4NOY A;  2IIM A;  2RQW A;  3ZL7 C;  3QJ6 A;  3OYF A;  1NEG A;  2NUT A;  1VQO A;  2RK2 A;  5GAO m;  4DBF A;  1PCX A;  1I0C A;  2K5L A;  4JZ4 A;  1R77 A;  2C0I A;  2FHD A;  1K73 R;  4B9X A;  2MMP A;  1MUZ A;  1K4U S;  4MDW A;  1OQK A;  4JS5 A;  2I0N A;  2BUD A;  4J5Y A;  4PJO F;  3TVT A;  4LDW A;  3MHX A;  1Q82 R;  3CC2 T;  1UGR B;  1YJ9 T;  2EYY A;  1BI0 A;  2XU8 A;  3PMT A;  1ZX6 A;  2LQK A;  2ZPE B;  1H92 A;  1KHI A;  2EYX A;  5GAO r;  4LDU A;  4BAC A;  1ZA2 B;  2NUP B;  1RAG B;  3SWN A;  5LJ3 e;  1TSF A;  2CP0 A;  4M75 F;  1AOJ A;  3I56 A;  4RTZ A;  4C92 A;  5FRO A;  3NTK A;  4RG8 A;  1K73 C;  2RHZ A;  1SSH A;  1UTI A;  4BI4 A;  2YUP A;  1WHJ A;  2IVW A;  2CDT A;  2EPD A;  4J9F A;  2CUB A;  1D1A A;  1YP5 A;  4RTX A;  4JDS A;  1KFZ A;  2VVK A;  3CD6 A;  2HQX A;  1YIJ Q;  2QA4 A;  4QKU A;  3OYH A;  2EYZ A;  4J9D A;  4KUI A;  1VQ8 A;  4YTL A;  1D0Z A;  2CP6 A;  2QEX T;  5CKF A;  1M90 U;  3HL8 A;  2QQ9 A;  1WXT A;  3QHS A;  4PFP A;  2QGF B;  4M7A G;  1X43 A;  3FIF A;  2CP7 A;  5GAM e;  2BKD N;  1K76 A;  5IHI A;  3JSC A;  2HSE B;  4XU3 A;  1GL5 A;  2RQR A;  4L6V 5;  1FYN A;  3MEA A;  2HCK A;  1XTD A;  3MCA B;  3JB9 D;  1Z9Z A;  3HFN A;  5IXB A;  2KEA A;  2YUN A;  2QQA A;  2DPP B;  1YJN Q;  4XTU A;  4M7D A;  2CGH A;  2FRW A;  3OW2 S;  4EPC A;  5FLX E;  1AEY A;  2R5M A;  2NUT B;  7AT1 B;  5FWB A;  1NYG A;  3CCS Q;  4C8Q G;  1U1T A;  2XI9 A;  4AFQ C;  2FG0 A;  1B07 A;  1JO8 A;  1JJ2 S;  3QO3 A;  2OJ2 A;  2XG8 D;  1QVF P;  3SDZ A;  5LJ5 g;  5CAI A;  5LJ5 d;  2YT6 A;  1VQ7 A;  1YCY A;  4OGE A;  4C5G A;  4LDV A;  1ZSZ C;  2LX7 A;  4TVR A;  1V76 A;  4DBR A;  2DJZ A;  5GAN 5;  1WXB A;  1VQL Q;  1SSF A;  1D3B B;  5HK0 A;  4M7A C;  3SWN B;  1YJW A;  1KQ1 A;  3M0U A;  5HKC A;  1JRI A;  4BY6 C;  2QTV A;  4ZGJ B;  2GBQ A;  2K3Y A;  4C92 B;  2LNV A;  3CBP A;  4PJM A;  1VQ6 A;  3OS2 A;  3M54 A;  1H8K A;  3JCM g;  3JCM d;  1YNZ A;  3J81 E;  1X01 A;  3BDL A;  3MET A;  4ZGE B;  1N27 A;  5GAO l;  1YWO A;  1KD1 R;  4M75 G;  4IUV A;  3SHW A;  2CRE A;  3H0F A;  4C0Z A;  1UGP B;  3X24 B;  1NPP A;  1J3T A;  4NL3 A;  2B8A A;  2GTO A;  3M4Y A;  2KSS A;  1PRL C;  1VQP T;  2KMT A;  4C8Q C;  4J6W A;  2E41 A;  1UEB A;  3RKY A;  3V8K A;  1RI0 A;  1D1B A;  3CC7 T;  3CCL Q;  4RCB A;  2OTL Q;  1K1Z A;  2M02 A;  4OVA A;  1SF9 A;  2VUB A;  1VUB A;  3RMS A;  1RAH B;  2KK4 A;  4JRI A;  3OYI A;  4L5G A;  3GPL A;  1VQN A;  1WHH A;  3THK A;  2HSP A;  1XNI A;  1KK7 A;  2JMA A;  3JB9 H;  2EJG A;  2F2W A;  5KCH A;  1KD1 C;  2VGN A;  2KAF A;  1CSK A;  5DLQ E;  2DZ9 A;  2H3E B;  4B9W A;  3CMA Q;  1K8A U;  3M0T A;  4N4I A;  3X28 B;  1VQK T;  3RKW A;  4QVD A;  3BE3 A;  2PVD B;  3OYY A;  4X9D A;  2WAC A;  2GNC A;  3S3M A;  2F5T X;  3JCM J;  1H64 1;  1OEB A;  1VQ5 Q;  3UA7 A;  2RHY A;  2ZPH B;  3QG1 A;  2A3L A;  2FPD A;  3GP8 A;  4XAX B;  1NLO C;  1C0M A;  2AZS A;  2JTE A;  1NE8 A;  3JCM X;  4ZTJ A;  5GAN 4;  4BE2 A;  3JB9 I;  2EQU A;  2MWP A;  3OYB A;  3MP1 A;  2EBP A;  2FYK A;  3QUI A;  3DB3 A;  2JS2 A;  1IRE B;  2LMJ A;  4HVW A;  3GF5 A;  1K73 U;  2NWM A;  3H0H A;  4MZT A;  3TCJ A;  3TU4 K;  2GCX A;  2OX7 A;  2ESW A;  4LE9 A;  2DLP A;  3C95 A;  1ZSZ A;  3CME T;  3CCM T;  1YIT A;  4QQD A;  5CQX A;  1T0J A;  1Q82 U;  1UB4 A;  1ZSG A;  2NYS A;  1VQ9 Q;  2F69 A;  5A0L A;  2CSQ A;  2QTX A;  4EIK A;  1QCF A;  3X20 B;  1YI2 A;  2LZ6 B;  4M7A A;  3Q1J A;  4WF2 A;  2OTJ A;  1JEG A;  2KY9 A;  2DL8 A;  2CZ1 B;  1WHL A;  1OZ2 A;  2YRC A;  4XK8 E;  1SEM A;  3G6E A;  4XQ3 A;  3SD4 A;  3DB4 A;  4E2F B;  1R8O B;  2HMA A;  1I1J A;  3G71 A;  2Y4Y A;  4E7I A;  4QW2 A;  2FEI A;  1B3Q A;  3JCM W;  5GJW B;  5J39 A;  3QSU A;  4ESR A;  2VV5 A;  5GAN j;  2KRO A;  2VGM A;  2QI2 A;  3REA B;  4C8Q A;  3EGX A;  2PQW A;  3FLG A;  2V1R A;  4ZTF A;  3CCE A;  3MEU A;  4J7F A;  1OU9 A;  4JZ3 A;  4XTX A;  3CXC A;  3H6Z A;  2P0P A;  3OS5 A;  1WJQ A;  5IAY A;  2D0Q B;  2RHU A;  2K2V A;  1TWB A;  2A08 A;  2HQH A;  2AT1 B;  5FRM A;  3CCV T;  3TRE A;  3LYI A;  4RTY A;  3JB9 G;  1QWF A;  1K9M R;  3NFC A;  2L8D A;  3HTR A;  2QXF A;  3QBY A;  3SEM A;  4A4E A;  1OZ3 A;  8ATC B;  4FSS A;  1KHC A;  1OPL A;  2RN8 A;  5GJV B;  1Y96 B;  4HCB A;  5CVI A;  1LPL A;  2HL5 C;  4RTT A;  1QVF A;  4J9G A;  1EFN A;  4KH1 B;  1W2B S;  2BE7 D;  1GCQ C;  1PWT A;  2CYZ B;  2JXB A;  1PM3 A;  1QQJ A;  3LH0 A;  1QVG P;  3VRY A;  1ARK A;  2KDS A;  1R0B G;  4R0K A;  1FMK A;  2H3J A;  4J9E A;  3KFV A;  4CC7 A;  1Y0M A;  4PK4 A;  1YIJ A;  2V8K A;  1K9M C;  2DVE A;  2K7A A;  2MI6 A;  5DY9 A;  1WX6 A;  1VQO T;  1VYU A;  1KG1 A;  3UAT A;  4EMK C;  1NM7 A;  1IGQ A;  5CO7 A;  9ATC B;  1VQM A;  3M0P A;  1N6A A;  1RAI B;  3QJY A;  4RTW A;  1GRI A;  2JW4 A;  2FO0 A;  2P0K A;  5GAN h;  2L5Q A;  2DO3 A;  2EGC A;  1YJN A;  3CC2 Q;  1Q95 G;  5D6X A;  2ED1 A;  1KD1 U;  2YLC A;  1YJ9 Q;  4BDZ A;  2EYQ A;  2VAS A;  2L89 A;  2X9H A;  3OMG A;  3EGX B;  4E7Z A;  1MV3 A;  3CCS A;  2DXU A;  5I2M A;  4N0A C;  5LJ3 j;  4RKU E;  3M55 A;  3EG9 A;  4AMC A;  5LJ5 h;  2K9G A;  4D8K A;  4D8D A;  3OYM A;  1WXU A;  2RH2 A;  4PJO D;  1BI3 A;  3EG3 A;  2JT4 A;  3OYG A;  3MKD A;  3QYG B;  4HCZ A;  5AYF A;  5LL6 S;  1TU0 B;  3URG A;  2F2X A;  1PHT A;  1VQL A;  1GXI E;  1G3Y A;  2QA4 T;  1Q86 R;  5C0M A;  1X2Q A;  5FU7 B;  1VQ8 T;  4M75 D;  2V26 A;  1PRM C;  3CPW S;  3J7A F;  2ED0 A;  3NTH A;  2QEX Q;  2IG0 A;  3M4G A;  3JCM h;  2O31 A;  2ABL A;  1AZE A;  1BB9 A;  2XIC A;  3G7Z A;  2K3X A;  5GAM j;  5ECA A;  2W10 A;  2D0N A;  1UHC A;  3RMQ A;  2KR3 A;  3R6O A;  4B6M A;  2AZV A;  3CCU T;  1RAB B;  3VJP A;  2KXD A;  1GCQ A;  1BU1 A;  2ZPI B;  1M8V A;  2R58 A;  1Q86 C;  1HYO A;  1UJY A;  3MJX A;  2PU9 B;  4F17 A;  1ZA1 B;  3JAM E;  3OYA A;  3L2Q A;  2E5Q A;  4OML A;  3OBW A;  2KRS A;  4M77 F;  1MMG A;  1UE9 A;  4RTU A;  5J26 A;  3GLX A;  1E6G A;  1Z9Q A;  4EMK A;  1RAD B;  1AWO A;  2DD5 A;  2RHX A;  2PVO B;  2E4H A;  2F1L A;  1VQ7 T;  3HP9 A;  3CMA A;  4IUQ A;  4KGV B;  2KBT A;  4C0D C;  1Y57 A;  4F14 A;  3JCM e;  4M78 F;  1UHF A;  5GAN 6;  3ZBD A;  3HRT A;  4QVC A;  3L1A A;  5FU6 C;  1FXX A;  2EGE A;  1X6B A;  3LX7 A;  1WHM A;  4OF1 A;  1B7T A;  1VQ5 A;  1VQ4 A;  3EFO A;  1G3S A;  4HA8 A;  3FC3 A;  4QVZ A;  2K57 A;  1NLP C;  2XK0 A;  3I5S A;  3CCJ T;  4KGX B;  3M9Q A;  1N9S A;  3EG9 B;  3KBG A;  2MF2 A;  3GBQ A;  2DER A;  3A8O B;  2A7Y A;  3V7S A;  2BIV A;  4N0A A;  3M0Q A;  4AG2 C;  2ROL A;  3H0I A;  2KRN A;  1MMD A;  2XID A;  1M30 A;  4C92 E;  1WI7 A;  2EJF A;  1MHN A;  2JN0 A;  2DFU A;  3PTA A;  3E19 A;  3LWH A;  5GMK j;  4BE1 A;  1GFD A;  1WZO A;  1ZBX A;  3WXM B;  1IGU A;  3CC7 Q;  2X4X A;  1VQ9 A;  4CC2 A;  1K9M U;  2V8J A;  4IUP A;  2J05 A;  1LNX A;  2YHT A;  1QVG A;  2EQI A;  2BZX A;  2XHC A;  1TUD A;  2DNU A;  2ZGW A;  8AT1 B;  4A4G A;  3RES A;  3J80 E;  2B86 A;  2F5K A;  3REB B;  2PUO B;  1KC8 C;  2JZ2 A;  4JUV A;  4OB3 B;  5D7U A;  1VQK Q;  2YSQ A;  3RR6 A;  2J7I A;  2L3R A;  3CC4 A;  1RAC B;  1W4S A;  1T3S A;  2QQR A;  1SRM A;  4DEY A;  4FM4 B;  4XTZ A;  1UFF A;  3ME9 A;  3EFR A;  3CBM A;  2LNH B;  5IT9 E;  1WHG A;  5CIU A;  4E47 A;  5CKD A;  4M7D E;  2QQS A;  2R57 A;  4J9C A;  3A1P A;  5A0D A;  5GAN g;  5GAN d;  4M77 G;  1UG1 A;  2GQV A;  3H9N A;  1BBZ A;  3EHQ A;  2DIQ A;  1GCP A;  4R56 A;  2FB7 A;  2A28 A;  1NJI U;  5I22 A;  1X2K A;  2L3P A;  4QT7 A;  3G4S T;  2D6F A;  1OV3 A;  2GFA A;  1YIT T;  1X69 A;  3CME Q;  3CCM Q;  3EFO B;  3VKI A;  2D8J A;  4O5V A;  4M78 G;  4JRK A;  4F7U E;  2OTJ T;  2O4X A;  1XOV A;  3PMI A;  3L42 A;  2PVG B;  1GFC A;  2DEQ A;  1PD0 A;  5HK3 A;  2D1X A;  5EC7 A;  5GMK h;  2DX1 A;  2RMO A;  2GTJ A;  4F7U A;  3G6E T;  2AKL A;  3L2U A;  1TG0 A;  1IO6 A;  1BYM A;  1LJO A;  4E7J A;  4PJO G;  3N5B B;  3JRZ A;  1BCM A;  2CH4 A;  2YXY A;  3KXT A;  3L2W A;  3UA6 A;  3A8M B;  3RKX A;  4AT1 B;  3I55 A;  3NMZ C;  2DK3 A;  1VOM A;  3P8H A;  4PJN A;  3MPU B;  3TQ7 P;  3CCE T;  1VA7 A;  1PG5 B;  3OB9 A;  5KYY A;  1JB0 E;  4J8O A;  3S6W A;  2E1H A;  3GOX A;  2V8I A;  3OSV A;  1G3T A;  1VYV A;  2HNI A;  4HVU A;  2BE9 B;  4WCI A;  4ELY C;  3M57 A;  1RL2 A;  2EQM A;  4X34 A;  2M1H A;  3PE0 A;  2WSF E;  5IN1 A;  3CCV Q;  1YJ9 A;  4M78 C;  3SFM A;  2LRQ A;  4GLM A;  2QGG A;  2RJC A;  2DZC A;  2QQB A;  1B34 A;  3M0S A;  1BCO A;  1YBY A;  2LJ3 A;  2H8H A;  2JS0 A;  2JM9 A;  4FT2 A;  4PL6 A;  1SPK A;  5FWC A;  3DLM A;  2VWF A;  1Q7Y C;  4M7D B;  1S72 A;  1TTH B;  4FT4 A;  2LQN A;  1N5Z A;  4PJO C;  1WFW A;  1E7O A;  5IHN A;  2K5F A;  2X4J A;  1QKX A;  3DKM A;  3RIR A;  5LJ3 d;  2VKN A;  5LJ3 g;  2A37 A;  2NUZ A;  1OPK A;  2DTH A;  2WSC E;  4IUU A;  5GAO q;  1N8R C;  2K3B A;  4GBQ A;  3A8H B;  4AFZ C;  2DKG A;  3BY7 A;  4IKF A;  2HZY A;  1UGS B;  4M75 C;  3FRN A;  4CRI A;  3C0C A;  1ACM B;  1PKT A;  1A0N B;  3BFM A;  3UF4 A;  1VQM T;  2O4X B;  3EGD A;  3VS3 A;  1I5L A;  4KRT A;  5LJ5 f;  1TUG B;  1PSF A;  3FDR A;  3CCR A;  4F7U B;  2WSE E;  2DL4 A;  4C5I A;  4M7A E;  3P8D A;  1M1K R;  2KGT A;  2DET A;  1O75 A;  4RG2 A;  5GAM g;  5GAM d;  1TXQ A;  2NLU A;  4C92 F;  1AT1 B;  2HEQ A;  4HT9 A;  2G6F X;  3HRS A;  1KQS S;  2C0O A;  1NYF A;  1AHJ B;  1WDX A;  2EVR A;  2RB6 A;  3JCM f;  4N4H A;  1M1G A;  2XD0 A;  5IXF A;  3M56 A;  3CXC S;  1K0X A;  3CPW P;  3PVQ A;  4M4Z A;  1ZUY A;  3A98 A;  3OYL A;  5AT1 B;  1D1C A;  4C8Q E;  3LH5 A;  3CCQ T;  1M1K C;  2CZ6 B;  4ZGD B;  4FYV B;  1YHQ T;  2ENM A;  3ULR B;  2JM8 A;  3LWI A;  4A54 A;  4BUG A;  2QA4 Q;  2CH4 W;  4PLI A;  2ZCF B;  1VQ8 Q;  1Y07 A;  1B34 B;  1DJ7 B;  2AKK A;  4EDU A;  2AK5 A;  3VRZ A;  2KI7 A;  1QVF S;  3QZ9 B;  1M3A A;  1WGS A;  3P8B B;  1AWW A;  3OSS C;  2K2M A;  4BE0 A;  2CZ7 B;  2KXC A;  3EH1 A;  3ZFJ A;  4IIO A;  4OB0 B;  1UGV A;  1PKS A;  4M7D F;  4LDY A;  1RLQ C;  2RO0 A;  2EYW A;  5J3B A;  2F2V A;  2DBK A;  4LD6 A;  5CKE A;  4LDX A;  1MND A;  2VYT A;  3VYH B;  1OI1 A;  1V29 B;  3CCU Q;  3LLR A;  3O8V A;  4PJO A;  2G3R A;  2RQU A;  4AG1 C;  2RQT A;  4PFO A;  1HJD A;  4M75 E;  4PFZ A;  2M51 A;  2HAX A;  1WPY A;  2ZPB B;  2O01 E;  3LGF A;  4XTV A;  1FX7 A;  4XU2 A;  4PLL A;  4M75 A;  3HPW A;  1SHG A;  2M0O A;  4E7K A;  1ZUU A;  3FJ5 A;  4CI0 C;  4OP0 A;  3BDU A;  1VQ7 Q;  3EH2 A;  1ZSZ B;  1ABO A;  4GY5 A;  2QAZ A;  1VQK A;  3OBY A;  2X35 A;  4AFU C;  3C4S A;  1M90 R;  3E1S A;  4M7A B;  2C0T A;  5GAN 7;  3OYE A;  2RI5 A;  5GMK m;  4V2S A;  4M77 D;  2EQJ A;  3E9G A;  4BY6 B;  5KH6 A;  1VQ4 T;  2CKK A;  2FZC B;  4VUB A;  1MGQ A;  5IH2 A;  3C94 A;  5KYW A;  2PNI A;  3CCJ Q;  4JLG A;  2HL3 A;  2VXE A;  4A4F A;  3L2R A;  4JPB W;  4E6R A;  2P0Q A;  3LW5 E;  2L3S A;  4NS5 A;  2FPF A;  5GAN 2;  3WVE B;  3H41 A;  2MIO A;  4M78 D;  4FYY B;  3JCM c;  2LCC A;  3VS4 A;  3IQL A;  1X6O A;  3INZ A;  3NHN A;  4HCC A;  1FMW A;  4BI8 B;  4C8Q B;  3OYK A;  1M90 C;  2P84 A;  1BI1 A;  3M53 A;  3I56 T;  2KNB B;  3EFS A;  3RER A;  3CME A;  2E70 A;  3CCM A;  1S1N A;  4OB1 B;  4LN2 A;  4FL6 A;  1VQ9 T;  1TOV A;  2QK0 A;  2HKQ B;  2D9T A;  5I2S A;  2DRK A;  2FVU A;  1QMC A;  1PD1 A;  2EW3 A;  4C0G A;  2IPO B;  3D7S B;  3CD6 T;  2L2P A;  3NPF A;  1IHV A;  3QZ5 B;  4Z88 A;  4KGZ B;  4O6J A;  4PJO B;  4DBQ A;  1M3C A;  3CC4 T;  1TH7 A;  4DQ2 A;  3AHU A;  1LVK A;  3OW2 P;  2K4Y A;  2QDL A;  5GAN e;  2CP2 A;  2ATC B;  2X4Y A;  1MMA A;  2JTM A;  1RAA B;  5CQY A;  2O88 A;  2ZZD A;  3OYD A;  2NUP A;  2LT1 A;  3I35 A;  4IUR A;  3QYH B;  4M75 B;  4HCK A;  2ZPF B;  4A53 A;  1QKW A;  3QDR B;  1D09 B;  4Z8A A;  2JVV A;  1JJ2 P;  4WTO B;  2CP3 A;  3VU3 C;  2KQW A;  1X75 C;  4MZP A;  2LCL A;  4KUD K;  1JU5 C;  1M8M A;  2LVM A;  2A36 A;  3O5Z A;  5LJ5 e;  1C1A A;  4GLK A;  1HXD A;  3CCL A;  2OTL A;  1GBR A;  4M7A F;  1KIK A;  5CK9 A;  3QWX X;  4OMN A;  4NL2 A;  4KUL A;  1H3Z A;  3G4S Q;  1YIT Q;  1RAF B;  2DL3 A;  1G3W A;  5KCO A;  2Y4X A;  1KQ2 A;  4MDX A;  3R6N A;  5DM7 R;  2JOY A;  2OTJ Q;  2PUK B;  2LDM A;  1U06 A;  3HHT B;  5LJ3 h;  5I21 A;  3EGU A;  3I5R A;  2XDB A;  1G2B A;  3G6E Q;  4LNP A;  2MOX A;  1YJW T;  1WJR A;  3PIP A;  4C8Q F;  2ZPG B;  4DOW A;  1WYX A;  2YLB A;  3A8G B;  4OB2 B;  3OY9 A;  1VQ6 T;  1NPR A;  3OYJ A;  3I55 T;  1OU8 A;  2LJ1 A;  1GBQ A;  4PKC C;  1D0Y A;  3V8L A;  2RI3 A;  1E6H A;  1QVG S;  2DTO A;  3CCE Q;  3V8J A;  1MMN A;  4HKE A;  2E6Z A;  2HBP A;  2LC4 A;  5GMK l;  4FW1 A;  1I81 A;  1K8A C;  1WHK A;  3JCM b;  5I11 A;  1KC8 R;  4L59 A;  3ASK A;  2CSI A;  2L3Q A;  2MK5 A;  2E3H A;  1QWE A;  2MCN A;  1JXM A;  4JJC A;  1IZ6 A;  3JCM V;  1VQP Q;  2KRM A;  5GAM h;  2MAM A;  1AD5 A;  4FYX B;  1PC0 A;  2V1Q A;  1K9A A;  4J9H A;  2RF0 A;  5D6W A;  2XDP A;  5KYU A;  1VIF A;  3A8L B;  4Y28 E;  3X25 B;  2ROT A;  1D3B A;  1QP3 A;  4ZN1 A;  3GIB A;  3RBB B;  1VQN T;  1MNE A;  2HDA A;  2W0Z A;  2J06 A;  3QKJ A;  1KSW A;  4LUD A;  3CEY A; 
#chains in the Genus database with same CATH homology
 1BI2 A;  3V7C A;  4J6Y A;  1YJ9 A;  4C92 C;  4M78 C;  4XTX A;  3SFM A;  3CXC A;  2DXT A;  1YHQ A;  3H6Z A;  2LRQ A;  3JCM P;  2P0P A;  3L2Z A;  1S72 T;  3OS5 A;  5KE2 A;  2RJC A;  1WJQ A;  5IAY A;  2D0Q B;  2RHU A;  2MWO A;  2K2V A;  1M5Q 1;  2DZC A;  2QQB A;  1B34 A;  4JS4 A;  2RJF A;  1YBY A;  4HT8 A;  4JLI A;  4DA4 A;  3JB9 J;  5FRM A;  3CCV T;  3TRE A;  3LYI A;  4FT2 A;  4PL6 A;  5EG2 A;  3JB9 G;  1Q82 C;  2CZ0 B;  3NFC A;  1M9S A;  1Y7X A;  4BD3 A;  3DLM A;  3H8Z A;  1NZ9 A;  1Q7Y C;  4M7D B;  2L8D A;  4J83 A;  1S72 A;  5GAO p;  1I8F A;  2QXF A;  3QBY A;  4FT4 A;  4XTW A;  4A4E A;  3S3N A;  4PJO C;  1OZ3 A;  1QP2 A;  1ZQ1 A;  3LGL A;  4OGC A;  3X26 B;  2OAU A;  1BIA A;  4EMK B;  1KHC A;  5LJ3 g;  2K5F A;  2X4J A;  3DKM A;  3RIR A;  5LJ3 d;  1Y96 B;  4HCB A;  2P4T A;  5CVI A;  4F7U G;  2DTH A;  3CCV A;  2WSC E;  4IUU A;  4IUT A;  5GAO q;  3MP8 A;  1QVF A;  1N8R C;  3CPF A;  1W2B S;  2GF7 A;  1ZHI A;  2JNG A;  3A8H B;  1M1K U;  5M9O A;  2CYZ B;  4KBM B;  1Q81 U;  3LH0 A;  1EIF A;  2DKG A;  3BY7 A;  4II1 A;  5CR2 A;  4IKF A;  3CCR T;  1UGS B;  2RHI A;  2VXF A;  3M59 A;  2KDS A;  4M75 C;  3CEY A;  2HD0 A;  3FRN A;  4CRI A;  2H3J A;  3CPW A;  3OQ5 A;  2JUF A;  3BFM A;  3CCU A;  2M9U A;  1VQM T;  2O4X B;  1YIJ A;  1I5L A;  2LQ8 A;  2V8K A;  5CKB A;  2EFI A;  3MEW A;  5LJ5 f;  4D6W A;  2KVQ G;  1K9M C;  1PSF A;  3GNG A;  2DVE A;  4M7D C;  2MI6 A;  5DY9 A;  3FDR A;  3CCR A;  3A5Z B;  3VYG A;  1YI2 T;  4F7U B;  1VQO T;  1KG1 A;  2WSE E;  2DD4 A;  4EMK C;  3L2V A;  4FU6 A;  3UT1 A;  2I2L A;  4C5I A;  4M7A E;  2LTO A;  3P8D A;  5CO7 A;  1G5V A;  1VQM A;  2DIG A;  4XU1 A;  2RK1 A;  3BW1 A;  1O75 A;  4RG2 A;  2DXB A;  2R5A A;  4ZN3 A;  5GAM g;  1N6A A;  4NOY A;  5GAM d;  3QJY A;  2NLU A;  4C92 F;  3QJ6 A;  3OYF A;  4HT9 A;  1VQO A;  2RK2 A;  2P0K A;  5GAO m;  3HRS A;  5GAN h;  4RMO A;  1KQS S;  3G71 T;  1AHJ B;  2L5Q A;  2DO3 A;  2K5L A;  2RB6 A;  3JCM f;  4ATO A;  2CS7 A;  1YJN A;  4N4H A;  2FHD A;  1M1G A;  5D6X A;  4B9X A;  2YLC A;  4C92 D;  5C6S A;  1KD1 U;  2XD0 A;  3CXC S;  3M56 A;  4XTY A;  2MMP A;  3VV0 A;  4BDZ A;  3OW2 A;  2FL7 A;  3FEO A;  4C0F A;  4MDW A;  4JS5 A;  1Q86 U;  2EYQ A;  3ER0 A;  2RJD A;  2BUD A;  3OYL A;  5HY6 A;  2L89 A;  3OMG A;  3CCS A;  1WQW A;  4J5Y A;  4M77 C;  4PJO F;  1O9S A;  4LDW A;  4C8Q E;  2DXU A;  1JBM A;  3CCQ T;  5I2M A;  3MHX A;  3CC2 T;  2K5I A;  1OYX A;  4N0A C;  5LJ3 j;  1M1K C;  3HKS A;  1UGR B;  4RKU E;  2CZ6 B;  1YJ9 T;  3M55 A;  4ZGD B;  1BI0 A;  2XU8 A;  3PMT A;  3T9N A;  5LJ5 h;  1YHQ T;  4BI3 A;  1QW1 A;  2LQK A;  3CCJ A;  3LWI A;  2ZPE B;  2QDY B;  4A54 A;  1KHI A;  1WJS A;  2EAY A;  4BUG A;  3OYM A;  5GAO r;  1JJ2 A;  4LDU A;  2E12 A;  4BAC A;  3SWN A;  4Z02 A;  2RH2 A;  4PJO D;  3PFS A;  5LJ3 e;  4PLI A;  1BI3 A;  2ZCF B;  5DLO A;  3OYG A;  4M75 F;  1Y07 A;  1B34 B;  1DJ7 B;  3QYG B;  4HCZ A;  5AYF A;  5LL6 S;  3OS0 A;  3I56 A;  5A2Q E;  3CC2 A;  4EDU A;  2EIF A;  3RUX A;  4PNO A;  4C92 A;  5FRO A;  3QZ9 B;  1QVF S;  3NTK A;  4MMK A;  4RG8 A;  3P8B B;  1WGS A;  3URG A;  1K73 C;  3OSS C;  1VQL A;  1G3Y A;  3WVD B;  2QA4 T;  4BE0 A;  2RHZ A;  2CZ7 B;  4LD9 K;  1GXI E;  4C5H A;  5C0M A;  3ZFJ A;  4OB0 B;  4BI4 A;  5FU7 B;  5GMK e;  1VQ8 T;  4M7D F;  4LDY A;  2EQK A;  4M75 D;  4C5E A;  1W2B A;  3CPW S;  2IVW A;  3J7A F;  5GMK i;  2RO0 A;  3NTH A;  5J3B A;  2IG0 A;  3M4G A;  4LD6 A;  4JDS A;  5CKE A;  3JCM h;  4LDX A;  3VYH B;  2VYT A;  3CD6 A;  1OI1 A;  1V29 B;  1FWZ A;  3LLR A;  2HQX A;  2QA4 A;  3OYH A;  2XIC A;  3O8V A;  4PJO A;  4A4K A;  5CKH A;  3G7Z A;  4M7D D;  1VQ8 A;  2K3X A;  4KUI A;  4YTL A;  5GAM j;  2G3R A;  5GAN f;  1M1F A;  2QEX T;  1U1S A;  5CKF A;  1M90 U;  3HL8 A;  3R6O A;  4M75 E;  3RMQ A;  4EMG A;  2QQ9 A;  4JRP A;  3QHS A;  3CCU T;  3JB9 F;  4M7A G;  1YIJ T;  3VJP A;  3FIF A;  2HAX A;  1WPY A;  2ZPB B;  4C0D B;  2O01 E;  2ZPI B;  5GAM e;  2BKD N;  1M8V A;  4Y91 A;  3LGF A;  2R58 A;  3JSC A;  5D6Y A;  1Q86 C;  4ME7 A;  4XTV A;  1FX7 A;  4XU2 A;  4PLL A;  4M75 A;  4UC4 A;  4XU3 A;  4FIB A;  3HPW A;  4E7K A;  2M0O A;  2PU9 B;  5FU7 C;  4L6V 5;  3JAM E;  2QEX A;  5GAN 8;  3NTI A;  3MEA A;  3MCA B;  1XTD A;  5FU6 B;  3PNW C;  4CI0 C;  3OYA A;  3L2Q A;  2E5Q A;  3JB9 D;  3OBW A;  4OP0 A;  3BDU A;  4EMH A;  3HFN A;  1HK9 A;  4M77 F;  5KE3 A;  2QQA A;  2DPP B;  4XTU A;  4M7D A;  2CGH A;  3HSB A;  5J26 A;  3OW2 S;  4EPC A;  4GY5 A;  5FLX E;  1XQH A;  2R5M A;  3GLX A;  1VQK A;  2VC8 A;  3OBY A;  2X35 A;  3C4S A;  4EMK A;  3E1S A;  4A4H A;  2DD5 A;  2M16 A;  2PVO B;  2RHX A;  1Y96 A;  4M7A B;  5GAN 7;  2RI5 A;  5GMK m;  3OYE A;  1VQ7 T;  4V2S A;  4M77 D;  2EQJ A;  3E9G A;  4BY6 B;  3HP9 A;  4C8Q G;  3CMA A;  1YJN T;  4JRQ A;  5KH6 A;  1VQ4 T;  4IUQ A;  1PSE A;  1U1T A;  4C0D C;  3VUZ A;  2XI9 A;  2CKK A;  1Y71 A;  4VUB A;  1MGQ A;  1P92 A;  3JCM e;  4M78 F;  2LX9 A;  5GAN 6;  3C94 A;  3HRT A;  3ZBD A;  4QVC A;  4JLG A;  1KC8 U;  1JJ2 S;  3L1A A;  2VXE A;  4BDY A;  3QO3 A;  2XG8 D;  4A4F A;  3CCS T;  3SDZ A;  4BB7 A;  5LJ5 g;  5CAI A;  5LJ5 d;  3L2R A;  5FU6 C;  1FXX A;  1VQ7 A;  2P0Q A;  3LX7 A;  1YCY A;  3LW5 E;  4P5N A;  4OGE A;  2E6N A;  4OF1 A;  4C5G A;  4NS5 A;  1VQ5 A;  3EAE A;  4M77 E;  4LDV A;  1VQ4 A;  3OYN A;  5GAN 2;  3PIO A;  2XKO C;  1G3S A;  4HA8 A;  3WVE B;  3FC3 A;  4TVR A;  3G4S A;  4QVZ A;  2DJZ A;  2K57 A;  2XK0 A;  2DXC A;  4M78 D;  3JCM c;  5GAN 5;  1VIE A;  2LCC A;  3M9Q A;  3CCJ T;  1SSF A;  1N9S A;  1X6O A;  3KBG A;  3UDC A;  3INZ A;  4HCC A;  2MF2 A;  4BI8 B;  3A8O B;  1D3B B;  4C8Q B;  5HK0 A;  4M77 A;  3OYK A;  1M90 C;  2A7Y A;  2JTF A;  4M7A C;  3SWN B;  1YJW A;  1KQ1 A;  3V7S A;  1BI1 A;  5HKC A;  3M53 A;  2BIV A;  1JRI A;  4N0A A;  4BY6 C;  3I56 T;  3KUF A;  3EFS A;  3RER A;  4ZGJ B;  2E70 A;  3CME A;  3CCM A;  1Q81 C;  4OB1 B;  2XID A;  2K3Y A;  1VQL T;  4C92 B;  2LNV A;  3CBP A;  4FL6 A;  1VQ9 T;  3OS2 A;  1VQ6 A;  3M58 A;  3M54 A;  4C92 E;  2EJF A;  4M78 E;  3JCM g;  3JCM d;  1MHN A;  2JN0 A;  2D9T A;  2RA2 A;  4N4G A;  5I2S A;  3J81 E;  1X01 A;  3BDL A;  2E10 A;  3MET A;  4ZGE B;  3UWN A;  3PTA A;  4J7I A;  1N27 A;  2FVU A;  3E19 A;  5GAO l;  3LWH A;  5GMK j;  4M75 G;  4IUV A;  4BE1 A;  4MML A;  4C0G A;  3TEE A;  4M78 A;  1ZBX A;  3GNF B;  3WXM B;  3CD6 T;  2X4X A;  4C0Z A;  3QZ5 B;  1UGP B;  2RI2 A;  4DOV A;  3S3O A;  1VQ9 A;  3X24 B;  1NPP A;  4KT0 E;  2EJ9 A;  4NL3 A;  2B8A A;  4O6J A;  4FSX A;  3M4Y A;  2KSS A;  5A0G A;  1K9M U;  2V8J A;  4PJO B;  3SB2 A;  1VQP T;  4IUP A;  2KMT A;  4C8Q C;  4J6W A;  1LNX A;  2E41 A;  4JJN K;  1UEB A;  2YHT A;  1QVG A;  4PJO E;  3CC4 T;  1TH7 A;  1KQS A;  3RKY A;  2XHC A;  4DQ2 A;  3V8K A;  3AHU A;  1RI0 A;  2K4Y A;  3CC7 T;  2ZGW A;  2RM4 A;  5GAN e;  4A4G A;  4RCB A;  3RES A;  3J80 E;  4OVA A;  1QVP A;  2X4Y A;  2JTM A;  2VUB A;  5CQY A;  3MP6 A;  5LJ3 f;  2F5K A;  1VUB A;  2PUO B;  1KC8 C;  3RMS A;  2ZZD A;  2JZ2 A;  3OYD A;  3DLL A;  4JUV A;  2KK4 A;  4OB3 B;  4JRI A;  2LT1 A;  4QQ6 A;  3OYI A;  4IUR A;  4L5G A;  3QYH B;  4M75 B;  3GPL A;  5L8R E;  1VQP A;  1VQN A;  2RJE A;  3PT9 A;  1XNI A;  2L3R A;  2ZPF B;  1LOJ A;  2HQE A;  1W4S A;  4A53 A;  3CC4 A;  2QQR A;  3CCL T;  2OTL T;  3CC7 A;  5FRN A;  3JB9 H;  2EJG A;  5KCH A;  5LJ5 j;  4E7H A;  1KD1 C;  2VGN A;  3QDR B;  2KAF A;  5DLQ E;  2DZ9 A;  2JVV A;  4FM4 B;  4XTZ A;  4B9W A;  3UPU A;  3ME9 A;  3VU3 C;  2KQW A;  1X75 C;  3EFR A;  3CBM A;  2LCL A;  4MZP A;  3OS1 A;  1K8A U;  2C06 A;  2E65 A;  4KUD K;  2LVM A;  4N4I A;  3X28 B;  4R55 A;  5IT9 E;  1VQK T;  5CIU A;  4E47 A;  5LJ5 e;  3F70 A;  3FJP A;  3RKW A;  5CKD A;  4GLK A;  4M7D E;  1HXD A;  4QVD A;  2QQS A;  4X9C A;  4F7U F;  2R57 A;  3OYC A;  3QPH A;  3CCL A;  2PVD B;  1I4K 1;  2OTL A;  3FB9 A;  3OYY A;  4X9D A;  2WAC A;  3S3M A;  3CMA T;  4M7A F;  3OA6 A;  2F5T X;  5CK9 A;  1H64 1;  3JCM J;  5A0D A;  5GAN g;  5GAN d;  4M77 G;  4NL2 A;  2RHY A;  2YRV A;  2ZPH B;  3QG1 A;  2GQV A;  4KUL A;  1H3Z A;  2A3L A;  4ELZ C;  3GP8 A;  4XAX B;  2DIQ A;  4R56 A;  1NE8 A;  2FB7 A;  4QQG A;  3JCM X;  4ZTJ A;  1G3W A;  5KCO A;  4M7A D;  5GAN 4;  4BE2 A;  2Y4X A;  3MO8 A;  5GAM f;  2EQU A;  1N9R A;  3ZEH A;  3JB9 I;  1KQ2 A;  3JCM Q;  4MDX A;  5DM7 R;  2JOY A;  1NJI U;  2MWP A;  3OYB A;  1WNL A;  2E64 A;  3MP1 A;  1VQ5 T;  2PUK B;  3QUI A;  2FYK A;  2GFA A;  2LDM A;  3G4S T;  1YIT T;  2D6F A;  4E7L A;  3DB3 A;  3MEV A;  1IRE B;  3HHT B;  5LJ3 h;  3VKI A;  3VUB A;  3GF5 A;  4O5V A;  5I21 A;  1K73 U;  3M5A A;  2XDB A;  4C92 G;  4MZT A;  3TCJ A;  3TU4 K;  4M78 G;  2GCX A;  4JRK A;  2XDD A;  1YJW T;  3OMC A;  1WJR A;  4M77 B;  4F7U E;  5GAN 3;  1M4Z A;  4C8Q F;  2ZPG B;  3PIP A;  2O4X A;  4DOW A;  1XOV A;  3C95 A;  2OTJ T;  3PMI A;  2YLB A;  3L42 A;  2PVG B;  3CME T;  3A8G B;  2DEQ A;  3QII A;  2X4W A;  5HK3 A;  3CCM T;  4OB2 B;  2EWN A;  4Q5W A;  4QQD A;  5CQX A;  1YIT A;  1WQ7 A;  5CCA A;  3OY9 A;  5GMK h;  4MZM A;  1VQ6 T;  1Q82 U;  3C12 A;  3HFO A;  1UB4 A;  1NPR A;  3OYJ A;  3E9F A;  4F7U A;  3I55 T;  2F69 A;  5A0L A;  3G6E T;  2QTX A;  1YI2 A;  3X20 B;  1Q7Y U;  4M7A A;  4PKC C;  2EKO A;  3Q1J A;  4C8Q D;  3V8L A;  5GMK l;  3L2U A;  2RI3 A;  1BYM A;  1LJO A;  2GFU A;  4WF2 A;  4E7J A;  1QVG S;  2OTJ A;  2DTO A;  2RD1 A;  4PJO G;  3V8J A;  2KY9 A;  4HKE A;  2E6Z A;  2HBP A;  2CZ1 B;  2LC4 A;  2DAQ A;  1I81 A;  3JRZ A;  3N5B B;  1K8A C;  1UGQ B;  2LT4 A;  1OZ2 A;  3KXT A;  3L2W A;  3JCM b;  4L59 A;  4M78 B;  3ASK A;  1BIB A;  2Y90 A;  2AHJ B;  4XK8 E;  1N8R U;  3A8M B;  3RKX A;  3I55 A;  3G6E A;  3CBO A;  4XQ3 A;  2DK3 A;  3SD4 A;  1IZ6 A;  3P8H A;  3JCM V;  3DB4 A;  3CCE T;  4OMF B;  1BKB A;  1R8O B;  3OB9 A;  2MAM A;  2Y4Y A;  5IN1 A;  5GAM h;  4QW2 A;  3G71 A;  4E7I A;  1JB0 E;  4J8O A;  4J6X A;  3S6W A;  2E1H A;  3GOX A;  3JCM W;  1U8R A;  5GAO n;  2V8I A;  3OSV A;  3PGG A;  3QXE B;  5D6W A;  5J39 A;  3QSU A;  2XDP A;  2VV5 A;  1VIF A;  3A8L B;  1G3T A;  4RCC A;  4Y28 E;  2HNI A;  3X25 B;  5GAN j;  2VGM A;  2QI2 A;  1D3B A;  1QP3 A;  4C8Q A;  4ELY C;  3M57 A;  4ZN1 A;  3GIB A;  1RL2 A;  2EQM A;  2PQW A;  3FLG A;  4X34 A;  2M1H A;  4ZTF A;  1VQN T;  3CCE A;  3HRU A;  4M7D G;  3SWN C;  1NJI C;  3MEU A;  4XU0 A;  3V7R A;  3QKJ A;  4J7F A;  2WSF E;  3CCQ A;  2DTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...