2JTMA

Solution structure of sso6901 from sulfolobus solfataricus p2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
60
structure length
60
Chain Sequence
MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Biochemical and structural characterization of Cren7, a novel chromatin protein conserved among Crenarchaea
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
total genus 7
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2007-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11520 Cren7 Chromatin protein Cren7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jtmA00
3LWHA 4R56A 2JTMA 3KXTA 3LWIA 4R55A
chains in the Genus database with same CATH superfamily
3CCMA 2FPDA 4XU2A 1WHKA 4JJDA 1VQLT 1G3SA 3OW2P 2QQSA 3E9FA 4QVCA 5GANj 1KQSA 5C6SA 2GFAA 3HTRA 1QKXA 3WXMB 3CCJQ 1ZSZB 3J80E 2XDPA 2RK2A 1NLOC 4LUDA 3S6WA 2LRQA 1ZBJA 1ZUUA 1K76A 3HPWA 4LDVA 3CCLA 2XDBA 5GAMf 4J9GA 2QDYB 4JJNK 2RHIA 2RHYA 4HA8A 5CQXA 4F7UG 2XKOC 2JS0A 3CCEA 3EGXB 1WHMA 1KIKA 1M1FA 3VYGA 2L3QA 3V8JA 1FX7A 2FB7A 2W10A 4OB0B 4EMKC 1BKBA 1UE9A 4OMMA 4C5GA 2MWPA 1KG1A 2KYMA 4KULA 2XG8D 1Q81C 3OS1A 3VRZA 1B7TA 2LJ3A 3PMIA 2JMAA 2ED1A 2EQIA 4JRQA 1QVGS 3RMQA 1IRXA 2IG0A 2A3LA 2QTXA 3HL8A 4KGVB 2ZPBB 3MEUA 5KYYA 4ZGEB 5KYWA 1I8FA 1W6XA 2DIQA 2X3XD 4II1A 1U1SA 2JTMA 1JEGA 3EH1A 1Q86C 1VQLA 4DOWA 1T0HA 1YBYA 3ZL7C 2XU8A 1VQ9Q 4M77C 3JCMW 1U8RA 2OTJT 4OB1B 3SD4A 5CK9A 4C92B 4C0FA 4FW2A 2ABLA 1PG5B 3X28B 5GANh 5LJ5f 1SG5A 1IGUA 3C95A 1Z9ZA 2R5MA 2D6FA 1I81A 3AHUA 2DMOA 4R56A 1HSQA 2DE0X 1EFNA 2DYBA 2H3JA 2K2MA 1ZUYA 5GAN8 2AIRB 2HCKA 1KD1R 2DZCA 1MMAA 3CBOA 3JV3A 2GBQA 4FCYA 2XI9A 1SSFA 4OB3B 4QQ6A 1D1AA 2OAUA 3REBB 2FRWA 2C0OA 2O9VA 3E1SA 1D0XA 3DLMA 1WXTA 1G8XA 2EGAA 4NS5A 4E7KA 3HHTB 4YTLA 5GAOl 3OYKA 1T0JA 3CCST 3QG1A 1UGPB 3SEMA 1HJDA 1QVPA 3I55T 2HMAA 2CP2A 2RQVA 1YI2Q 4FIBA 1ZSZA 1JXMA 2KI7A 2GNCA 1IXDA 2DETA 1RLPC 2V1QA 5FWBA 2ED0A 1QCNA 4QQDA 3TCJA 2J05A 3RKXA 4AFSC 2QASA 4HCCA 4KGXB 5GAOr 2DM1A 1C6VX 5FWCA 2MAMA 4N4HA 3EH2A 2OTJA 3EGXA 4M7DD 1XTDA 3UDCA 1M5Q1 3JCMP 2BKDN 1ZSGA 2HEQA 1TUDA 2J06A 4X34A 2DXBA 4Z02A 3D7SB 3EG1A 4ZTJA 1TG0A 1HD3A 1IHVA 1QW1A 3BDUA 2E6ZA 3M0UA 4HVWA 1RADB 4M7AF 1NLPC 4BUGA 2CZ0B 2J6FA 4N4GA 4RG8A 1WJSA 2DYIA 5IHIA 1N27A 5CIUA 2QYZA 1NZ9A 1UUEA 2EYQA 2DEQA 1TSFA 2NUPB 1RLQC 4M7DE 2QQBA 2CZ1B 2EJGA 2DO3A 3OYCA 1TU0B 1UDLA 2IVWA 3CC7A 1SPKA 4K11A 2K4YA 1DJ7B 1TXQA 3CCSA 2XD0A 3JB9I 4L5GA 3NTKA 3I55A 2YDLA 5IHKA 1WIEA 2X4WA 1Q81R 3GP8A 2J6KA 8ATCB 1YITQ 1VQMQ 1BIBA 2D8JA 5IN1A 3JCMV 1HYOA 4M7AB 1I5LA 3OW2A 1M1KU 3DB3A 4KH0B 2I0NA 3CCVQ 2JT4A 3OYBA 3V7RA 4A4KA 2OTLQ 1H92A 1R8OB 5HCKA 4Z8AA 3L2ZA 4C8QD 1QCFA 2LMJA 1X2KA 1NPPA 4GLKA 5FW9A 3OS2A 1K8AR 1OX8A 2DRMA 2YWWA 3LWIA 4M7DG 1MMDA 2KAFA 2RI3A 2D0QB 5KYXB 1NEBA 2VGNA 1K9MC 5GAN3 1V1CA 2GTOA 1X43A 2EIFA 3MEAA 5GANd 4LDUA 4BY6C 1VQOQ 3G6ET 2O9SA 4RKUE 1PHTA 1R0CB 1VQKT 4M7DC 2NYSA 5AT1B 4C8QE 1I4K1 3H0FA 5CR2A 2HL3A 3CEYA 4IUTA 3VS4A 2PUOB 1AWJA 4PNOA 1AD5A 3V7SA 1EX4A 1D09B 2F5KA 3P8HA 2X35A 4IKFA 1K73C 5EG2A 3G71T 4JJBA 1KHIA 4E7SA 1BI2A 1RAGB 3LGFA 2HKNA 2NUZA 3G4SQ 3OYHA 1NPRA 2VV5A 2QI2A 3JB9J 3N5BB 2CYZB 5LJ3d 5I21A 1KQSP 2DL7A 1IZ6A 2QDLA 2QQAA 1SEMA 4OB2B 2Y4XA 2DF6A 2HKQB 3QUIA 2EBPA 5DY9A 2K57A 1KQ2A 2RM4A 4XTXA 3UA6A 4BD3A 4PFPA 4C0GA 2EYYA 3TEEA 1AEYA 3A5ZB 2NWMA 3VS2A 3EFSA 2XICA 5GMKm 2DZ9A 2RHUA 3MPUB 4C8QG 1PRMC 3OYLA 3HFNA 2P0KA 3ZEHA 2CP0A 2EKHA 2E10A 2M02A 2NUPA 2RI5A 1WZOA 4WTOB 2A7YA 5GAN2 1KQSS 4JS4A 2P4TA 3M55A 1GXIE 2FZCB 3CMEQ 2JN0A 3C4SA 2DXUA 1UGQB 5AYFA 3G6EA 4BE0A 1KC8U 4WF2A 3H9NA 1VQKA 2GGRA 2QQ9A 1ZA2B 1NJIR 1AZGB 2ZPGB 2G3RA 4J9IA 1W2BP 2O4XB 1ZUKA 1YWOA 1YN8A 5DLOA 4M7AA 1U1TA 2A36A 3IQLA 2YXYA 2RF0A 1VQ8Q 3GOXA 3G71A 4F7UB 3U23A 5A0GA 1UEBA 1R77A 1PSFA 3QBYA 4XTVA 1YI2T 1UHFA 1NYGA 4XU0A 3P8BB 1YJNT 1VOMA 4DBHA 3G7ZA 2RJDA 1M9SA 5I2SA 2E64A 1OI1A 3ME9A 5I2MA 3FC3A 2JM9A 3H0IA 5KYXA 2DNUA 4E47A 4TVRA 2WACA 1RAAB 3TSZA 2EJFA 1YIJT 1QMCA 3JCMe 2EYZA 2JTEA 1WGSA 5D7UA 2QGFB 1WJQA 3EGUA 4MZTA 4FT4A 3VS1A 2M0OA 2MOXA 5GJWB 2E41A 4ME7A 1TH7A 2BZYA 1SRLA 4BDZA 2AKKA 2H8HA 4LUEA 1W70A 5GMKj 1G5VA 2LNVA 3RERA 5GAOq 4AMCA 2K79A 1FMVA 5LJ5g 1XNIA 1I0CA 1H3ZA 4MMKA 2VASA 2JVVA 1Q82C 1M1GA 2D1XA 1TWBA 3VV0A 2JMCA 1RL2A 5HY6A 1WJRA 3L2RA 3CBMA 5LJ3g 2OI3A 2VVKA 1WA7A 3OBWA 2DL5A 3THKA 2X51A 1H3HA 4KT0E 4BB7A 1G3TA 3OYEA 3CD6T 1H641 1K0XA 2YUNA 1YI2A 2FO0A 1YITT 2B8AA 2YRDA 1YJNA 3VRYA 2ENMA 4ZN1A 3A1PA 4QVZA 1K73R 3CCVT 3L2UA 1D1CA 2OTLT 4OMLA 1Q7YU 1KJWA 1OU8A 2OX7A 3VYHB 4N0AA 1T3SA 2J7IA 2X4XA 3CPWP 4OF1A 3V8LA 4DQ2A 1YIJA 1PKTA 1WLPB 4MZMA 4JS5A 4KUIA 3V7CA 1X6GA 1I1JA 4J9CA 3X25B 1QKWA 2LC4A 4GY5A 5GAN5 3FJ5A 4J6YA 2YUPA 1UGRB 3CQTA 4ZN3A 3CC2Q 2O4XA 3EHQA 3CMAQ 3QHSA 1VA7A 3MJXA 2PUKB 3JCMf 1AVZC 3GIBA 1GCPA 2KK4A 4HVUA 1I5OB 2LTOA 4A4GA 2JXBA 4F7UA 1NEGA 1YJ9Q 1VQOT 4M77D 3JB9H 3OYYA 2WSEE 2ROTA 3M0TA 3I56T 4IUPA 1PWTA 2DEUA 5GMKh 2CP3A 3HFOA 4RTZA 5CKHA 3CC4Q 3CCRT 1VQ7Q 2YLBA 2JM8A 3HP9A 2DL3A 2K2VA 1OULA 2VYTA 2DJZA 3E9GA 4HCKA 1VQ6Q 2Y4YA 4J7IA 2QEXQ 3CD6A 1ABOA 3META 3C12A 1ABQA 1YITA 5CCAA 2QA4A 2GQVA 1M90C 2CP6A 5GANe 2R5AA 4M77E 3SFMA 3ASKA 3CCVA 2DJQA 3O5ZA 4AFUC 4OMNA 2FRYA 2FG0A 1E6HA 2L2PA 4HXJA 2KSSA 2KXDA 3VU3C 3PNWC 4M7DF 5LJ5j 2C06A 1YFNA 5GAN6 1RI9A 4RCBA 3EFRA 3AT1B 2EW3A 3OW2S 2R57A 1VQNQ 1PKSA 2CP5A 1M3AA 1JXOA 5M9OA 3OYDA 2MPXC 4PJOC 1JBMA 1M2VB 5LJ3j 3JCMb 1WDXA 2EGCA 2YUOA 5CKEA 4BI4A 4OGEA 5LJ3e 3CMET 3BW1A 2DAQA 3I9QA 1QLYA 1VQOA 2L8DA 2AK5A 1VQPA 4OMOA 1WHJA 4QKUA 3H8ZA 4OGCA 4Z89A 3KXTA 1W2BA 4C0DB 3I56A 1N5ZA 4BY6B 4M77G 3CCRA 1QQJA 2EAYA 2L0AA 2FEIA 2ZPEB 4M7DB 1ZA1B 2SEMA 2HNIA 2EQMA 4F14A 3OYFA 4NOYA 3PIOA 1N8RC 1WPYA 1VQ8T 3S3MA 2DRKA 1T3LA 2F69A 2ESWA 2JNGA 4C5EA 3UF4A 1K8AC 3OMGA 4J8OA 2COZA 3OYGA 1Q82R 4FT2A 2RN8A 1OQKA 1GL5A 1M30A 1S1NA 4D8KA 4E7LA 2DX1A 4J83A 3OYMA 2EQUA 1JU5C 2JS2A 3BY7A 1M3BA 2MCNA 4C8QF 5CAIA 2ZPHB 2BE9B 5GANf 2AT1B 2CUBA 2ZCFB 3FJPA 2C0TA 4J5YA 1WXBA 4QW2A 3F70A 2PTKA 3SWNC 5LJ5h 4JLGA 3MHXA 3UPUA 1A0NB 1N6AA 1G3WA 4DBQA 1BCOA 1VQ4T 5GAOm 5IT9E 3JCMc 5FU7C 3SDZA 1UB4A 4RTTA 1YJWQ 1WHGA 3A8HB 4XU1A 4R55A 4CC7A 5CVIA 4WCIA 1UTIA 5LJ3h 1FWZA 3OB9A 1TUCA 4C8QB 1AHJB 2HBWA 1IO6A 3QZ9B 4OMQA 4JPBW 2LT1A 1X01A 1YP5A 2VXFA 5IXFA 1BB9A 2FZGB 2KDSA 2FPFA 3R6OA 3EAEA 2RHXA 5IHNA 1ZHIA 1Y96B 2AHJB 3BE3A 1RAFB 1YHQQ 1BK2A 3UATA 3QWXX 4CC2A 1K4US 4OMPA 5DLQE 3E19A 4Y92A 4RCCA 4IURA 2DTHA 1M2VA 3CPWA 2LJ0A 1M90R 4J9HA 4JZ3A 5KE3A 1NJIC 3LWHA 1LOJA 2E70A 2DTOA 3A98A 3UA7A 4DOVA 1LNXA 3SB2A 5FROA 3CC2T 5J3BA 2KT8A 1VQ4A 4M7DA 1BYMA 3T9NA 4FW1A 4ZGJB 1NG2A 4XU3A 1QVFP 1IREB 1OPKA 1S72T 1VQ5T 1UGSB 1YJ9T 8AT1B 3KBGA 3NHNA 2VWFA 4C92D 2O2OA 5GAMd 1KC8R 3FIFA 5HKCA 4B9WA 2QQRA 4PKCC 1Q95G 3HRTA 2BZXA 1WI7A 1X75C 3FRNA 3C94A 2F5TX 3RKYA 1OV3A 4KGZB 3CXCP 2CUDA 3CCMQ 2QEXT 1ARKA 2IIMA 3QPHA 2KRMA 4V2SA 1D1BA 2ZGWA 3I5SA 1XOVA 4QQGA 1K1ZA 1D3BB 1N8RR 1KSWA 2M1HA 3PE0A 3CCJT 4M75D 3MO8A 4C92E 1AOJA 3X26B 5A0LA 4JRPA 4A4FA 2DK3A 2L5QA 3FEOA 3HRSA 1Y57A 4D6WA 1AWXA 3DB4A 1MMNA 4BE2A 3CCLQ 1MGQA 4M78D 2DILA 1ACMB 9ATCB 4BDYA 3CC2A 3PVLA 1KD1U 1AWOA 4C8QA 3CCEQ 1BI3A 2O01E 1HXDA 1B34B 4F04B 2NUTB 3JB9D 2DL8A 4M75E 1S72A 1U06A 1VQ5A 2VC8A 4X1VA 2QTVA 1YJ9A 4M4ZA 5LJ5d 2MK5A 2RNAA 4FYWB 3S3NA 4E7ZA 1Y96A 1D0ZA 4FSSA 4PJLA 2A0FB 3A8LB 4XTYA 4C92G 4M78E 4DBRA 4ZTFA 3GLXA 2XDDA 5CO7A 1WQWA 2CKKA 4PJJA 3P8DA 4FU6A 1IGQA 2QEXA 4JZ4A 3FB9A 2XHCA 2KGTA 2H3EB 1VQLQ 2MWOA 1VQ9T 4PFZA 4EDUA 1C1AA 5KCHA 4C92C 2PVDB 3CCJA 4X9DA 2V1RA 3H0HA 3H6ZA 2OAWA 1OOTA 4E7HA 2DBKA 5KYNA 5FU6C 1U5SA 5CQYA 1SF9A 3PMTA 4M75G 1FMWA 1TS9A 4MMLA 1X69A 2QGGA 3OA6A 2E5QA 1B3QA 3VKIA 4AG1C 5D6YA 4RUGA 1RAHB 3URGA 3GNFB 2YT6A 2ZPFB 2L3RA 2YRCA 4KUDK 4M78G 3HKSA 2YHTA 3OYJA 4M75C 4E2FB 5GAMg 4E7JA 1GCQC 1YCSB 5CKDA 4EMKB 4A4EA 5HK3A 2HSPA 4M77F 4AFZC 1YJWT 4EIKA 4HCZA 3EG3A 1M8MA 3MP6A 1BI0A 4Z88A 1SHGA 3JB9G 1VIEA 3O8VA 4PJNA 1VYTA 2NLUA 2ZAEA 1K0SA 3QXEB 4M78C 2E4HA 2DLPA 1Q81U 1D3BA 4UC4A 1BIAA 5LL6S 3DKMA 3NGPA 2R58A 4KH1B 4J9FA 1VYVA 2X4YA 1WHLA 3M58A 4R0KA 2DD4A 1W2BS 1LPLA 4MZPA 3LH0A 4IIOA 1VQ9A 3VS0A 3EG0A 5J39A 2PVGB 3EG2A 2CDTA 2LDMA 4L6V5 2EPDA 1YHQT 4LDWA 2MIOA 1Q86U 2A08A 2GTJA 4M77B 1O75A 2OTJQ 1P92A 2E5KA 1E7OA 3VUZA 2BIVA 1B34A 3CCUQ 2DFUA 3CBPA 3JCMJ 2NUTA 3QJ6A 3ER0A 2QXFA 3KUFA 3M54A 3TU4K 2RK1A 1N9SA 3RESA 2W0ZA 1QWEA 3INZA 1TUGB 3JRZA 4VUBA 4DBFA 1UFFA 5GMKe 4IUQA 2KT1A 3SWNB 5GAOp 1OYXA 4XK8E 1QVFA 3NTHA 1HK9A 3OS0A 5KH6A 3QDRB 3EFOB 4LDYA 1N9RA 2K5LA 2V26A 2RMOA 1X27A 3CC7Q 3M0SA 5IXBA 5J26A 1M1KC 2C0IA 2IPOB 3QO3A 3CCSQ 1FMKA 4XQ3A 1SRMA 2EQJA 1VQMT 3JSCA 3NTIA 4PJOD 4M7AC 2QK0A 1W1FA 4X9CA 3CXCA 2BZ8A 4ELZC 2Z0WA 4ZNXA 7AT1B 3CCMT 2RPNA 2KR3A 4BI8B 1M8VA 4QT7A 2GQIA 2X3WD 4F16A 2GFUA 1JB0E 1MNDA 4JRKA 1ZBXA 3GBQA 2LQ8A 5GAMj 2O88A 2JTFA 1X6BA 4FSXA 1LJOA 5GAMe 5GAN4 1CKAA 2CSIA 6AT1B 1RI0A 3QDFA 4ORZA 2D0NA 4HCBA 4EMKA 4PJOE 2J6OA 4Y91A 4PLLA 3CCLT 2HAXA 1WYXA 4ELYC 1V76A 3CPWS 4JDSA 3M0PA 3WVDB 1F1BB 1JJ2P 1UJYA 2YRVA 1VYUA 3RIRA 5I11A 3L2QA 5KYUB 2EJ9A 4O6JA 5D6WA 3RBBB 1PM3A 4AFQC 2AKLA 4F7UE 2QG9B 1IB8A 3ZBDA 2E12A 1KHCA 2LJ1A 3M5AA 3PVQA 1VQMA 3G4ST 4RTWA 4M77A 5EC7A 2KXCA 1UG1A 2YSQA 4PL6A 1RABB 2OTLA 2KVQG 4PJOG 2RQTA 3MEVA 1C0MA 2WSFE 2RJEA 4HKEA 3REAB 2P0QA 1GFCA 4BI3A 1RAEB 2LQWA 3RDVA 2YLCA 4NL2A 1M27C 5LJ5e 1MV3A 2DXTA 3QKJA 3SWNA 2AZVA 4J9DA 4N0AC 5GAMh 2P84A 1QVGP 1KC8C 2RO0A 3EFOA 4N4IA 1U3OA 4D8DA 4LD9K 3PIPA 2A28A 3VS3A 2L3PA 4OMFB 3G6EQ 4EPCA 2LQKA 3L2VA 1VQKQ 1K9MU 3HSBA 3CPFA 2E3HA 2EWNA 4IUUA 4KRTA 5ECAA 4C92F 3PT9A 1BI1A 4EMGA 2FYKA 2F2WA 5HK0A 2HZYA 1W4SA 1YCYA 2EYXA 2G6FX 3G71Q 2MF2A 2JW4A 1JRIA 3G4SA 2K5FA 3M0RA 4XTWA 1OZ3A 4RTUA 3L1AA 2LNHB 4J9BA 2K5IA 4ATOA 2MYSA 4JLIA 1EIFA 2BTTA 2JUFA 1K73U 1G2BA 2EKOA 3EGDB 1M1KR 5FLXE 1WXUA 2WSCE 4M75F 2RA2A 3OQ5A 4PK4A 3SHWA 1B07A 1D0YA 1WFWA 2COYA 3JCMQ 2PVOB 3MKDA 1X6OA 3CCUT 2KYBA 3CCQQ 4BE1A 1G3YA 4JJCA 5KYUA 1MHNA 5FU6B 2V8IA 4M78F 2RHZA 1YNZA 3CMEA 2LZ6B 5GMKi 4HT8A 1OZ2A 1EZZB 4E6RA 2E3IA 1M3CA 4C5IA 4DEYA 3A8GB 5FRNA 1ZX6A 3JB9F 2XMFA 2CGHA 3H41A 5LJ3f 2FL7A 4RMOA 3OYIA 4LN2A 1AT1B 3VS7A 1SKUB 4M75B 1WX6A 2ROLA 1G83A 3RMSA 2PNIA 1VQ8A 2ZPIB 3JCMd 3M4GA 3CC7T 2LVMA 1LVKA 2KQWA 1JO8A 1AZEA 2DVEA 4M78B 3ZFJA 1Q7YC 3I5RA 3J81E 4HVVA 1YJNQ 2CH4W 4LD6A 2E1HA 3GPLA 4RTVA 5I22A 2EGEA 3RKWA 4L59A 2ZZDA 2F2XA 3GNGA 4B9XA 1LCKA 3LW5E 2FZKB 4QVDA 4CC3A 2VGMA 1YIJQ 4MDWA 2HSEB 3CCUA 3E2UA 2FHDA 4NL3A 5C0MA 3RUXA 2SRCA 3OYNA 1VIFA 4A63B 3CMAT 4JRIA 1MV0B 1NYFA 2F1LA 1KFZA 1NBEB 3TSWA 5KE2A 1KK7A 1TTHB 2K3BA 1PD1A 4FL6A 2L3SA 1JJ2A 2DL4A 1OPLA 4LDXA 2I2LA 2DERA 3OYAA 5IAYA 3QWYA 4XAXB 3NPFA 3OY9A 4AG2C 2DD5A 2AZSA 3LX7A 3CC4T 4LE9A 2D8HA 2X9HA 2VXEA 1VQ7T 4BACA 2KRNA 3EGDA 1ZQ1A 4KBMB 2DXCA 1VQ6T 2DPPB 1RAIB 1XJWB 2RD1A 1Q82U 4FYVB 1QVFS 1QP3A 4IUVA 3LGLA 4ZGDB 3CD6Q 1OX9A 1ZSZC 4C92A 1VUBA 3RR6A 3R6NA 4OP0A 5DM7R 2QA4Q 3VS6A 4C0ZA 4JUVA 1OU9A 2DA9A 4IIMA 4P5NA 4GLMA 5A0DA 2LX7A 3PFSA 2KE9A 3QSUA 2X4JA 3RNJA 1SHFA 1WQ7A 4Y28E 3TREA 1JQQA 2CT3A 2HQEA 1SSHA 2LCLA 3CXCS 1VQNT 2BE7D 4EMHA 2EVRA 1Q86R 3CMAA 2RQWA 2LCSA 4Q5WA 2ATCB 1QVGA 1QWFA 4M75A 1GCQA 2QAZA 1GBRA 3EG9B 5KCOA 4LNPA 1YWPA 5GJVB 4C0DC 1H8KA 2VKNA 1MUZA 1VQPQ 1AWWA 4O5VA 3MP8A 3M0QA 1PNJA 3JCMg 2OJ2A 3PGGA 4M78A 1I07A 2HQHA 3I56Q 3CC4A 4A54A 2KRSA 3QJYA 1VQ7A 2RI2A 3LYIA 2LT4A 3CCRQ 2DTIA 1VQ6A 3UT1A 3UWNA 1PSEA 4PLIA 2RJCA 2JOYA 1XQHA 3BDLA 1CKBA 3KFVA 3OSSC 2PQWA 5L8RE 4PJOF 2M0YA 3QYGB 4ESRA 3HRUA 2V8KA 1Y0MA 3BFMA 1Y7XA 2KNBB 2MI6A 2E65A 4B6MA 3OBYA 3DLLA 4RTYA 1O9SA 2RH2A 4RTXA 3M59A 1M90U 3PTAA 1Q7YR 2K3YA 1QP2A 3FDRA 2CP7A 3VJPA 3JAME 4FYYB 2Y90A 1VQNA 4HT9A 2HQXA 2BUDA 3QYHB 3M4YA 1MNEA 2P4RA 4F7UF 5IH2A 3CCQT 3TVTA 4M7AD 2E6NA 3MP1A 1UHCA 2YUQA 1TOVA 3OSVA 2DBMA 4PJOB 5GMKl 3M53A 2RJFA 3S3OA 3MEWA 4CRIA 3G1JA 4C8QC 3GF5A 1M2OA 5L23A 2KEAA 5FRMA 2LX9A 2LP5A 1PRLC 3MCAB 2DIGA 2VUBA 2PU9B 5CKFA 1RUWA 4M7AE 2CSQA 1CSKA 5A2QE 1WNLA 4OVAA 3V8KA 2KBTA 4CC4B 2M51A 1GBQA 4FYXB 1K9AA 4XTZA 2M16A 3J7AF 1N8RU 1NE8A 4RG2A 2M9UA 3Q1JA 3X24B 4J6WA 3NMZC 1K8AU 2HD0A 2F2VA 1Z9QA 3ULRB 2JJ9A 3WVEB 4DA4A 1PC0A 4ANJA 2JZ2A 3EG9A 2RB6A 3QIIA 2HDAA 4A53A 2KY9A 4E7IA 1J3TA 1WHHA 4LXCA 1BBZA 3CCQA 2A37A 1FXXA 3LLRA 2XIDA 4J9EA 5GANg 4AT1B 1PCXA 2ECZA 4PJMA 1VQ4Q 2V8JA 4M7AG 1YJWA 3C0CA 2HL5C 5GAN7 2RQRA 5FU7B 4FM4B 3VS5A 3X20B 3LH5A 2EQKA 2EYWA 2XK0A 1UJ0A 3NFCA 1BCMA 2CT4A 3OS5A 2K9GA 3I55Q 1K9MR 2CREA 5D6XA 5GAOn 3FLGA 2GCXA 1UGVA 2O31A 2CS7A 3TQ7P 4J6XA 1RACB 2FVUA 1YHQA 4F17A 5KYYB 5KYWB 1FYNA 1V29B 2LCCA 2QA4T 1MMGA 1NM7A 1ZLMA 2B86A 4GBQA 1M4ZA 2P0PA 2LQNA 1QCOA 4C5HA 2CH4A 3M9QA 2K7AA 1BU1A 4PJOA 2K3XA 3OMCA 1KD1C 3M57A 3EHRA 2CZ7B 1PD0A 1GRIA 1KQ1A 3A8MB 4J7FA 2KMTA 2DKGA 1Y07A 3CCET 2FPEA 3QZ5B 3VUBA 1R0BG 1NJIU 3JCMh 2K6DA 1IHWA 2RQUA 1Y71A 2PZ1A 3A8OB 4MDXA 2L89A 3JCMX 3I35A 1X2QA 1UECA 1S72Q 2EFIA 1OEBA 4A4HA 1VQ5Q 2CZ6B 2GF7A 2COWA 2HBPA 4CI0C 1E6GA 3L2WA 1VQPT 2KROA 4DEXA 5CKBA 1GFDA 3M56A 2DVJA 3L42A 4XTUA 2MMPA 2VB6A 4PFOA 2D9TA 1JJ2S
chains in the Genus database with same CATH topology
2CGHA 5LJ3f 2FL7A 3FC3A 3CCMA 4RMOA 4BDYA 4XU2A 3OYIA 3CC2A 1KD1U 4E47A 4TVRA 4C8QA 2WACA 4M75B 2EJFA 1VQLT 1YIJT 1G3SA 1BI3A 2O01E 3RMSA 2QQSA 1HXDA 3E9FA 3JCMe 1B34B 1VQ8A 1WGSA 2ZPIB 4QVCA 3JCMd 5GANj 3M4GA 3JB9D 3CC7T 4M75E 2LVMA 1S72A 1KQSA 1WJQA 5C6SA 2KQWA 1VQ5A 2GFAA 2VC8A 1YJ9A 4MZTA 4FT4A 3WXMB 5LJ5d 3J80E 2M0OA 2DVEA 2XDPA 2RK2A 3S3NA 4M78B 2E41A 3ZFJA 1Q7YC 4ME7A 3S6WA 1TH7A 1Y96A 2LRQA 4BDZA 3J81E 3HPWA 5GMKj 4LDVA 1G5VA 2LNVA 3RERA 4M7DA 3A8LB 5GAOq 4XTYA 4C92G 4M78E 3CCLA 2XDBA 5GAMf 4LD6A 5LJ5g 2E1HA 4ZTFA 2QDYB 3GPLA 4JJNK 1XNIA 2RHIA 2RHYA 3GLXA 4HA8A 5CQXA 4F7UG 4MMKA 5CO7A 3RKWA 1WQWA 2CKKA 2ZZDA 4L59A 2XKOC 2XDDA 3CCEA 3GNGA 3P8DA 4B9XA 1M1FA 4FU6A 3VYGA 2JVVA 2QEXA 3V8JA 1FX7A 2FB7A 1M1GA 3LW5E 1Q82C 4QVDA 3FB9A 2XHCA 3VV0A 2VGMA 4MDWA 4OB0B 1RL2A 4EMKC 1BKBA 5HY6A 2MWOA 1VQ9T 1WJRA 3L2RA 4EDUA 3CCUA 2FHDA 4NL3A 5C0MA 5KCHA 3RUXA 3CBMA 4C92C 2MWPA 2PVDB 4C5GA 1VIFA 5LJ3g 3OYNA 3CMAT 3CCJA 1KG1A 3OBWA 4KULA 2XG8D 4JRIA 1Q81C 3OS1A 4X9DA 3H6ZA 4KT0E 4BB7A 1G3TA 3OYEA 4E7HA 1H641 3PMIA 3CD6T 1YI2A 1QVGS 4JRQA 3RMQA 5FU6C 2IG0A 2A3LA 2B8AA 2QTXA 3HL8A 5CQYA 5KE2A 1YITT 3PMTA 4BE2A 2ZPBB 3MEUA 4M75G 1YJNA 4MMLA 4ZGEB 3OA6A 4ZN1A 1I8FA 2E5QA 4FL6A 1JJ2A 4QVZA 4LDXA 3VKIA 3CCVT 2I2LA 2DIQA 3L2UA 5D6YA 1Q7YU 2OTLT 3OYAA 4II1A 1M90C 5IAYA 1U1SA 2JTMA 4N0AA 3VYHB 2X4XA 4XAXB 4OF1A 3URGA 3OY9A 3V8LA 3GNFB 2ZPFB 4DQ2A 2DD5A 2L3RA 3LX7A 3CC4T 1Q86C 4DOWA 1YIJA 1VQLA 1VQ7T 1YBYA 2VXEA 4KUDK 4M78G 4MZMA 4BACA 4JS5A 4KUIA 3V7CA 3HKSA 2XU8A 2YHTA 3OYJA 1ZQ1A 4M75C 3X25B 5GAMg 2LC4A 4GY5A 4KBMB 2DXCA 5GAN5 4E7JA 4J6YA 1VQ6T 1UGRB 2DPPB 4M77C 5CKDA 3JCMW 1U8RA 4EMKB 4A4EA 5HK3A 2RD1A 4ZN3A 2O4XA 1Q82U 4M77F 3QHSA 1YJWT 2OTJT 4HCZA 1QP3A 4OB1B 3SD4A 5CK9A 4IUVA 2PUKB 3MP6A 1BI0A 4C0FA 4C92B 3LGLA 4ZGDB 3JCMf 3JB9G 3GIBA 1VIEA 3O8VA 4C92A 1VUBA 2NLUA 3X28B 5GANh 2KK4A 4OP0A 5DM7R 3QXEB 4M78C 5LJ5f 3C95A 2LTOA 4JUVA 4A4GA 4C0ZA 1Q81U 4F7UA 1D3BA 4UC4A 1BIAA 1VQOT 4M77D 3JB9H 3OYYA 5LL6S 2R5MA 3DKMA 2D6FA 1I81A 4P5NA 3AHUA 5A0DA 2WSEE 3PFSA 2R58A 4R56A 3QSUA 2X4JA 3I56T 4IUPA 2H3JA 1WQ7A 2X4YA 3M58A 4Y28E 2DD4A 3TREA 5GAN8 5GMKh 1W2BS 3LH0A 2HQEA 4MZPA 3HFOA 5CKHA 2DZCA 3CCRT 2LCLA 3CXCS 3CBOA 2YLBA 1VQ9A 1VQNT 4EMHA 3HP9A 5J39A 2K2VA 2PVGB 2XI9A 1SSFA 2LDMA 4L6V5 3CMAA 2OAUA 2VYTA 4OB3B 2DJZA 3E9GA 4QQ6A 1YHQT 2Y4YA 4J7IA 4LDWA 4Q5WA 1Q86U 1QVGA 3E1SA 3CD6A 3DLMA 4M77B 1O75A 3META 1P92A 4M75A 4NS5A 3C12A 4E7KA 1YITA 3VUZA 3HHTB 4YTLA 2BIVA 2GQVA 1B34A 5CCAA 5KCOA 5GAOl 3OYKA 2QA4A 3CBPA 5GANe 3JCMJ 3QJ6A 2R5AA 4M77E 3SFMA 3CCST 3ASKA 1UGPB 3ER0A 3QG1A 2QXFA 3KUFA 1QVPA 3CCVA 3M54A 4C0DC 3I55T 3TU4K 2RK1A 1N9SA 3RESA 4FIBA 3MP8A 4O5VA 3JCMg 3PGGA 2KSSA 4M78A 3VU3C 3INZA 3PNWC 3JRZA 4QQDA 4VUBA 3CC4A 4A54A 5LJ5j 4M7DF 3TCJA 1VQ7A 3QJYA 5GAN6 2C06A 5GMKe 2RI2A 3RKXA 4RCBA 4IUQA 4HCCA 3LYIA 2LT4A 5GAOr 3EFRA 2DTIA 3SWNB 3OW2S 2R57A 5GAOp 1OYXA 4XK8E 1VQ6A 2MAMA 4N4HA 3UT1A 1PSEA 3UWNA 4PLIA 1QVFA 2RJCA 2JOYA 1XQHA 1HK9A 3NTHA 5M9OA 3OS0A 3BDLA 5KH6A 3QDRB 3OYDA 2OTJA 4M7DD 4PJOC 3OSSC 4LDYA 2PQWA 1XTDA 3UDCA 5L8RE 1JBMA 1N9RA 1M5Q1 2K5LA 4PJOF 3JCMP 3QYGB 5LJ3j 2BKDN 3JCMb 3HRUA 2V8KA 3BFMA 1Y7XA 5CKEA 4BI4A 4OGEA 5LJ3e 3CMET 4X34A 2MI6A 2DXBA 3BW1A 4Z02A 2DAQA 4ZTJA 2E65A 5J26A 1VQOA 3QO3A 1M1KC 1QW1A 2L8DA 3OBYA 3DLLA 3BDUA 1VQPA 1O9SA 4XQ3A 2RH2A 3H8ZA 2EQJA 4OGCA 3KXTA 1VQMT 2E6ZA 3JSCA 3NTIA 1W2BA 4PJOD 3M59A 1M90U 4M7AC 4C0DB 3I56A 3PTAA 2K3YA 4BY6B 1QP2A 4X9CA 3CXCA 4ELZC 4M7AF 4BUGA 2CZ0B 3FDRA 4M77G 4N4GA 4RG8A 1WJSA 3CCMT 3CCRA 2EAYA 1N27A 2ZPEB 5CIUA 3VJPA 3JAME 4M7DB 4BI8B 1M8VA 2Y90A 1NZ9A 1VQNA 2HQXA 4HT9A 2BUDA 2EYQA 2HNIA 2DEQA 2EQMA 1OI1A 3QYHB 2GFUA 1JB0E 3OYFA 3M4YA 4JRKA 4NOYA 3PIOA 1N8RC 1WPYA 1VQ8T 1ZBXA 2QQBA 4M7DE 2CZ1B 4F7UF 3S3MA 2F69A 2LQ8A 3CCQT 1H3ZA 2EJGA 4C5EA 2JNGA 4M7AD 5GAMj 1K8AC 2JTFA 3OMGA 4J8OA 2DO3A 2E6NA 3MP1A 4FSXA 3OYCA 1LJOA 3OSVA 3OYGA 4FT2A 5GAMe 2IVWA 3CC7A 5GAN4 4PJOB 5GMKl 1RI0A 3M53A 2RJFA 3S3OA 2K4YA 1DJ7B 3CCSA 2XD0A 3JB9I 3MEWA 4HCBA 4L5GA 3NTKA 4CRIA 4EMKA 3I55A 4E7LA 4PJOE 1QVFS 2X4WA 4J83A 4Y91A 4C8QC 2EQUA 3OYMA 3GP8A 3BY7A 4PLLA 3CCLT 4C8QF 2HAXA 5CAIA 3GF5A 1BIBA 4ELYC 5IN1A 3JCMV 2ZPHB 5GANf 5FRMA 2LX9A 4M7AB 3CPWS 3OW2A 3DB3A 1I5LA 1M1KU 4JDSA 3WVDB 2ZCFB 3FJPA 4J5YA 3OYBA 4QW2A 3V7RA 3F70A 2YRVA 3MCAB 4A4KA 1R8OB 2DIGA 2VUBA 2PU9B 5CKFA 3RIRA 4M7AE 3L2ZA 4C8QD 3SWNC 1WNLA 5A2QE 4OVAA 3L2QA 3V8KA 5LJ5h 4JLGA 3MHXA 3UPUA 1NPPA 2EJ9A 4GLKA 4O6JA 1N6AA 4XTZA 1G3WA 5D6WA 3OS2A 2M16A 1VQ4T 5GAOm 5IT9E 3JCMc 5FU7C 3SDZA 3LWIA 3J7AF 1UB4A 1NE8A 1N8RU 4F7UE 4M7DG 3ZBDA 2E12A 4RG2A 2M9UA 3Q1JA 3X24B 4J6WA 1KHCA 1K8AU 2HD0A 2RI3A 2KAFA 3A8HB 3M5AA 4XU1A 4R55A 2D0QB 1VQMA 3G4ST 5CVIA 4M77A 5LJ3h 1FWZA 3WVEB 4DA4A 3OB9A 2VGNA 2JZ2A 4C8QB 5GAN3 1K9MC 2RB6A 1AHJB 3QIIA 2EIFA 3MEAA 5GANd 4LDUA 4PL6A 4A53A 3QZ9B 4BY6C 2OTLA 2KY9A 3G6ET 2KVQG 2LT1A 4PJOG 1X01A 4RKUE 4E7IA 3MEVA 2VXFA 1VQKT 4M7DC 4C8QE 2WSFE 2RJEA 4HKEA 1I4K1 2P0QA 3CCQA 5CR2A 1FXXA 2KDSA 4BI3A 3LLRA 3CEYA 2XIDA 4IUTA 2YLCA 4NL2A 5LJ5e 3R6OA 5GANg 3EAEA 2RHXA 2PUOB 4PNOA 1ZHIA 2DXTA 3V7SA 1Y96B 2AHJB 3QKJA 3SWNA 2V8JA 2F5KA 4M7AG 3P8HA 1YJWA 2X35A 4IKFA 1K73C 5EG2A 5GAN7 3G71T 4N0AC 1KHIA 5FU7B 4FM4B 5GAMh 1BI2A 1KC8C 3LGFA 2RO0A 3X20B 4N4IA 5DLQE 2EQKA 3E19A 4RCCA 4IURA 3OYHA 2DTHA 1NPRA 2VV5A 2QI2A 2XK0A 3CPWA 3JB9J 4LD9K 3PIPA 3N5BB 2CYZB 5LJ3d 5I21A 3NFCA 1IZ6A 2QQAA 5KE3A 3OS5A 1NJIC 4OB2B 5D6XA 2Y4XA 4OMFB 3QUIA 2LQKA 5DY9A 4EPCA 2K57A 1LOJA 5GAOn 3LWHA 3L2VA 1KQ2A 2RM4A 2E70A 4XTXA 3FLGA 2DTOA 1K9MU 4BD3A 3HSBA 3CPFA 4DOVA 4C0GA 2GCXA 1LNXA 3SB2A 5FROA 3CC2T 2EWNA 4IUUA 2CS7A 5J3BA 3TEEA 3A5ZB 3PT9A 1BI1A 3EFSA 2XICA 4C92F 2DZ9A 4EMGA 4J6XA 2FYKA 2RHUA 5GMKm 1VQ4A 5HK0A 3JB9F 4C8QG 2FVUA 1YHQA 1BYMA 3T9NA 3OYLA 3HFNA 1W4SA 2P0KA 3ZEHA 4ZGJB 4XU3A 1YCYA 1V29B 2E10A 2LCCA 1IREB 2RI5A 2QA4T 1S72T 2MF2A 1UGSB 2A7YA 1JRIA 1VQ5T 1YJ9T 5GAN2 3G4SA 2K5FA 4XTWA 3KBGA 1KQSS 1M4ZA 1OZ3A 4JS4A 2P0PA 3L1AA 2P4TA 3M55A 4C92D 5GAMd 1GXIE 2K5IA 3FIFA 4C5HA 4ATOA 3M9QA 4JLIA 1EIFA 5HKCA 2JUFA 2JN0A 2K3XA 4PJOA 3OMCA 3C4SA 1K73U 2DXUA 4B9WA 1KD1C 1UGQB 5AYFA 3M57A 2QQRA 4PKCC 2CZ7B 3G6EA 2EKOA 4BE0A 1KC8U 4WF2A 3HRTA 1VQKA 2QQ9A 1X75C 5FLXE 1KQ1A 3A8MB 4J7FA 2WSCE 2ZPGB 2KMTA 2G3RA 3FRNA 2DKGA 2O4XB 3C94A 2F5TX 3RKYA 4M75F 2RA2A 1Y07A 3CCET 3QZ5B 3VUBA 2QEXT 1NJIU 3OQ5A 3JCMh 5DLOA 4M7AA 1U1TA 3JCMQ 1Y71A 3A8OB 3QPHA 4MDXA 2L89A 2PVOB 4V2SA 2ZGWA 3JCMX 1X6OA 3CCUT 1XOVA 4QQGA 3G71A 3GOXA 4F7UB 1D3BB 4BE1A 1G3YA 2M1HA 3CCJT 4M75D 5A0GA 2EFIA 3MO8A 1MHNA 4C92E 4A4HA 1UEBA 2V8IA 5FU6B 3X26B 1PSFA 4M78F 2CZ6B 2GF7A 2RHZA 3QBYA 3CMEA 2HBPA 5A0LA 4CI0C 3L2WA 4XTVA 4JRPA 1YI2T 1VQPT 5GMKi 4A4FA 2DK3A 2L5QA 3FEOA 4HT8A 1OZ2A 3P8BB 4XU0A 5CKBA 3HRSA 1YJNT 3G7ZA 3M56A 2RJDA 4D6WA 4C5IA 3L42A 3A8GB 1M9SA 3DB4A 4XTUA 5I2SA 2MMPA 5FRNA 2E64A 1MGQA 4M78D 3ME9A 5I2MA 2D9TA 1JJ2S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWH A;  4R56 A;  2JTM A;  3KXT A;  3LWI A;  4R55 A; 
#chains in the Genus database with same CATH topology
 3CCM A;  2FPD A;  4XU2 A;  1WHK A;  4JJD A;  1VQL T;  1G3S A;  3OW2 P;  2QQS A;  3E9F A;  4QVC A;  5GAN j;  1KQS A;  5C6S A;  2GFA A;  3HTR A;  1QKX A;  3WXM B;  3CCJ Q;  1ZSZ B;  3J80 E;  2XDP A;  2RK2 A;  1NLO C;  4LUD A;  3S6W A;  2LRQ A;  1ZBJ A;  1ZUU A;  1K76 A;  3HPW A;  4LDV A;  3CCL A;  2XDB A;  5GAM f;  4J9G A;  2QDY B;  4JJN K;  2RHI A;  2RHY A;  4HA8 A;  5CQX A;  4F7U G;  2XKO C;  2JS0 A;  3CCE A;  3EGX B;  1WHM A;  1KIK A;  1M1F A;  3VYG A;  2L3Q A;  3V8J A;  1FX7 A;  2FB7 A;  2W10 A;  4OB0 B;  4EMK C;  1BKB A;  1UE9 A;  4OMM A;  4C5G A;  2MWP A;  1KG1 A;  2KYM A;  4KUL A;  2XG8 D;  1Q81 C;  3OS1 A;  3VRZ A;  1B7T A;  2LJ3 A;  3PMI A;  2JMA A;  2ED1 A;  2EQI A;  4JRQ A;  1QVG S;  3RMQ A;  1IRX A;  2IG0 A;  2A3L A;  2QTX A;  3HL8 A;  4KGV B;  2ZPB B;  3MEU A;  5KYY A;  4ZGE B;  5KYW A;  1I8F A;  1W6X A;  2DIQ A;  2X3X D;  4II1 A;  1U1S A;  2JTM A;  1JEG A;  3EH1 A;  1Q86 C;  1VQL A;  4DOW A;  1T0H A;  1YBY A;  3ZL7 C;  2XU8 A;  1VQ9 Q;  4M77 C;  3JCM W;  1U8R A;  2OTJ T;  4OB1 B;  3SD4 A;  5CK9 A;  4C92 B;  4C0F A;  4FW2 A;  2ABL A;  1PG5 B;  3X28 B;  5GAN h;  5LJ5 f;  1SG5 A;  1IGU A;  3C95 A;  1Z9Z A;  2R5M A;  2D6F A;  1I81 A;  3AHU A;  2DMO A;  4R56 A;  1HSQ A;  2DE0 X;  1EFN A;  2DYB A;  2H3J A;  2K2M A;  1ZUY A;  5GAN 8;  2AIR B;  2HCK A;  1KD1 R;  2DZC A;  1MMA A;  3CBO A;  3JV3 A;  2GBQ A;  4FCY A;  2XI9 A;  1SSF A;  4OB3 B;  4QQ6 A;  1D1A A;  2OAU A;  3REB B;  2FRW A;  2C0O A;  2O9V A;  3E1S A;  1D0X A;  3DLM A;  1WXT A;  1G8X A;  2EGA A;  4NS5 A;  4E7K A;  3HHT B;  4YTL A;  5GAO l;  3OYK A;  1T0J A;  3CCS T;  3QG1 A;  1UGP B;  3SEM A;  1HJD A;  1QVP A;  3I55 T;  2HMA A;  2CP2 A;  2RQV A;  1YI2 Q;  4FIB A;  1ZSZ A;  1JXM A;  2KI7 A;  2GNC A;  1IXD A;  2DET A;  1RLP C;  2V1Q A;  5FWB A;  2ED0 A;  1QCN A;  4QQD A;  3TCJ A;  2J05 A;  3RKX A;  4AFS C;  2QAS A;  4HCC A;  4KGX B;  5GAO r;  2DM1 A;  1C6V X;  5FWC A;  2MAM A;  4N4H A;  3EH2 A;  2OTJ A;  3EGX A;  4M7D D;  1XTD A;  3UDC A;  1M5Q 1;  3JCM P;  2BKD N;  1ZSG A;  2HEQ A;  1TUD A;  2J06 A;  4X34 A;  2DXB A;  4Z02 A;  3D7S B;  3EG1 A;  4ZTJ A;  1TG0 A;  1HD3 A;  1IHV A;  1QW1 A;  3BDU A;  2E6Z A;  3M0U A;  4HVW A;  1RAD B;  4M7A F;  1NLP C;  4BUG A;  2CZ0 B;  2J6F A;  4N4G A;  4RG8 A;  1WJS A;  2DYI A;  5IHI A;  1N27 A;  5CIU A;  2QYZ A;  1NZ9 A;  1UUE A;  2EYQ A;  2DEQ A;  1TSF A;  2NUP B;  1RLQ C;  4M7D E;  2QQB A;  2CZ1 B;  2EJG A;  2DO3 A;  3OYC A;  1TU0 B;  1UDL A;  2IVW A;  3CC7 A;  1SPK A;  4K11 A;  2K4Y A;  1DJ7 B;  1TXQ A;  3CCS A;  2XD0 A;  3JB9 I;  4L5G A;  3NTK A;  3I55 A;  2YDL A;  5IHK A;  1WIE A;  2X4W A;  1Q81 R;  3GP8 A;  2J6K A;  8ATC B;  1YIT Q;  1VQM Q;  1BIB A;  2D8J A;  5IN1 A;  3JCM V;  1HYO A;  4M7A B;  1I5L A;  3OW2 A;  1M1K U;  3DB3 A;  4KH0 B;  2I0N A;  3CCV Q;  2JT4 A;  3OYB A;  3V7R A;  4A4K A;  2OTL Q;  1H92 A;  1R8O B;  5HCK A;  4Z8A A;  3L2Z A;  4C8Q D;  1QCF A;  2LMJ A;  1X2K A;  1NPP A;  4GLK A;  5FW9 A;  3OS2 A;  1K8A R;  1OX8 A;  2DRM A;  2YWW A;  3LWI A;  4M7D G;  1MMD A;  2KAF A;  2RI3 A;  2D0Q B;  5KYX B;  1NEB A;  2VGN A;  1K9M C;  5GAN 3;  1V1C A;  2GTO A;  1X43 A;  2EIF A;  3MEA A;  5GAN d;  4LDU A;  4BY6 C;  1VQO Q;  3G6E T;  2O9S A;  4RKU E;  1PHT A;  1R0C B;  1VQK T;  4M7D C;  2NYS A;  5AT1 B;  4C8Q E;  1I4K 1;  3H0F A;  5CR2 A;  2HL3 A;  3CEY A;  4IUT A;  3VS4 A;  2PUO B;  1AWJ A;  4PNO A;  1AD5 A;  3V7S A;  1EX4 A;  1D09 B;  2F5K A;  3P8H A;  2X35 A;  4IKF A;  1K73 C;  5EG2 A;  3G71 T;  4JJB A;  1KHI A;  4E7S A;  1BI2 A;  1RAG B;  3LGF A;  2HKN A;  2NUZ A;  3G4S Q;  3OYH A;  1NPR A;  2VV5 A;  2QI2 A;  3JB9 J;  3N5B B;  2CYZ B;  5LJ3 d;  5I21 A;  1KQS P;  2DL7 A;  1IZ6 A;  2QDL A;  2QQA A;  1SEM A;  4OB2 B;  2Y4X A;  2DF6 A;  2HKQ B;  3QUI A;  2EBP A;  5DY9 A;  2K57 A;  1KQ2 A;  2RM4 A;  4XTX A;  3UA6 A;  4BD3 A;  4PFP A;  4C0G A;  2EYY A;  3TEE A;  1AEY A;  3A5Z B;  2NWM A;  3VS2 A;  3EFS A;  2XIC A;  5GMK m;  2DZ9 A;  2RHU A;  3MPU B;  4C8Q G;  1PRM C;  3OYL A;  3HFN A;  2P0K A;  3ZEH A;  2CP0 A;  2EKH A;  2E10 A;  2M02 A;  2NUP A;  2RI5 A;  1WZO A;  4WTO B;  2A7Y A;  5GAN 2;  1KQS S;  4JS4 A;  2P4T A;  3M55 A;  1GXI E;  2FZC B;  3CME Q;  2JN0 A;  3C4S A;  2DXU A;  1UGQ B;  5AYF A;  3G6E A;  4BE0 A;  1KC8 U;  4WF2 A;  3H9N A;  1VQK A;  2GGR A;  2QQ9 A;  1ZA2 B;  1NJI R;  1AZG B;  2ZPG B;  2G3R A;  4J9I A;  1W2B P;  2O4X B;  1ZUK A;  1YWO A;  1YN8 A;  5DLO A;  4M7A A;  1U1T A;  2A36 A;  3IQL A;  2YXY A;  2RF0 A;  1VQ8 Q;  3GOX A;  3G71 A;  4F7U B;  3U23 A;  5A0G A;  1UEB A;  1R77 A;  1PSF A;  3QBY A;  4XTV A;  1YI2 T;  1UHF A;  1NYG A;  4XU0 A;  3P8B B;  1YJN T;  1VOM A;  4DBH A;  3G7Z A;  2RJD A;  1M9S A;  5I2S A;  2E64 A;  1OI1 A;  3ME9 A;  5I2M A;  3FC3 A;  2JM9 A;  3H0I A;  5KYX A;  2DNU A;  4E47 A;  4TVR A;  2WAC A;  1RAA B;  3TSZ A;  2EJF A;  1YIJ T;  1QMC A;  3JCM e;  2EYZ A;  2JTE A;  1WGS A;  5D7U A;  2QGF B;  1WJQ A;  3EGU A;  4MZT A;  4FT4 A;  3VS1 A;  2M0O A;  2MOX A;  5GJW B;  2E41 A;  4ME7 A;  1TH7 A;  2BZY A;  1SRL A;  4BDZ A;  2AKK A;  2H8H A;  4LUE A;  1W70 A;  5GMK j;  1G5V A;  2LNV A;  3RER A;  5GAO q;  4AMC A;  2K79 A;  1FMV A;  5LJ5 g;  1XNI A;  1I0C A;  1H3Z A;  4MMK A;  2VAS A;  2JVV A;  1Q82 C;  1M1G A;  2D1X A;  1TWB A;  3VV0 A;  2JMC A;  1RL2 A;  5HY6 A;  1WJR A;  3L2R A;  3CBM A;  5LJ3 g;  2OI3 A;  2VVK A;  1WA7 A;  3OBW A;  2DL5 A;  3THK A;  2X51 A;  1H3H A;  4KT0 E;  4BB7 A;  1G3T A;  3OYE A;  3CD6 T;  1H64 1;  1K0X A;  2YUN A;  1YI2 A;  2FO0 A;  1YIT T;  2B8A A;  2YRD A;  1YJN A;  3VRY A;  2ENM A;  4ZN1 A;  3A1P A;  4QVZ A;  1K73 R;  3CCV T;  3L2U A;  1D1C A;  2OTL T;  4OML A;  1Q7Y U;  1KJW A;  1OU8 A;  2OX7 A;  3VYH B;  4N0A A;  1T3S A;  2J7I A;  2X4X A;  3CPW P;  4OF1 A;  3V8L A;  4DQ2 A;  1YIJ A;  1PKT A;  1WLP B;  4MZM A;  4JS5 A;  4KUI A;  3V7C A;  1X6G A;  1I1J A;  4J9C A;  3X25 B;  1QKW A;  2LC4 A;  4GY5 A;  5GAN 5;  3FJ5 A;  4J6Y A;  2YUP A;  1UGR B;  3CQT A;  4ZN3 A;  3CC2 Q;  2O4X A;  3EHQ A;  3CMA Q;  3QHS A;  1VA7 A;  3MJX A;  2PUK B;  3JCM f;  1AVZ C;  3GIB A;  1GCP A;  2KK4 A;  4HVU A;  1I5O B;  2LTO A;  4A4G A;  2JXB A;  4F7U A;  1NEG A;  1YJ9 Q;  1VQO T;  4M77 D;  3JB9 H;  3OYY A;  2WSE E;  2ROT A;  3M0T A;  3I56 T;  4IUP A;  1PWT A;  2DEU A;  5GMK h;  2CP3 A;  3HFO A;  4RTZ A;  5CKH A;  3CC4 Q;  3CCR T;  1VQ7 Q;  2YLB A;  2JM8 A;  3HP9 A;  2DL3 A;  2K2V A;  1OUL A;  2VYT A;  2DJZ A;  3E9G A;  4HCK A;  1VQ6 Q;  2Y4Y A;  4J7I A;  2QEX Q;  3CD6 A;  1ABO A;  3MET A;  3C12 A;  1ABQ A;  1YIT A;  5CCA A;  2QA4 A;  2GQV A;  1M90 C;  2CP6 A;  5GAN e;  2R5A A;  4M77 E;  3SFM A;  3ASK A;  3CCV A;  2DJQ A;  3O5Z A;  4AFU C;  4OMN A;  2FRY A;  2FG0 A;  1E6H A;  2L2P A;  4HXJ A;  2KSS A;  2KXD A;  3VU3 C;  3PNW C;  4M7D F;  5LJ5 j;  2C06 A;  1YFN A;  5GAN 6;  1RI9 A;  4RCB A;  3EFR A;  3AT1 B;  2EW3 A;  3OW2 S;  2R57 A;  1VQN Q;  1PKS A;  2CP5 A;  1M3A A;  1JXO A;  5M9O A;  3OYD A;  2MPX C;  4PJO C;  1JBM A;  1M2V B;  5LJ3 j;  3JCM b;  1WDX A;  2EGC A;  2YUO A;  5CKE A;  4BI4 A;  4OGE A;  5LJ3 e;  3CME T;  3BW1 A;  2DAQ A;  3I9Q A;  1QLY A;  1VQO A;  2L8D A;  2AK5 A;  1VQP A;  4OMO A;  1WHJ A;  4QKU A;  3H8Z A;  4OGC A;  4Z89 A;  3KXT A;  1W2B A;  4C0D B;  3I56 A;  1N5Z A;  4BY6 B;  4M77 G;  3CCR A;  1QQJ A;  2EAY A;  2L0A A;  2FEI A;  2ZPE B;  4M7D B;  1ZA1 B;  2SEM A;  2HNI A;  2EQM A;  4F14 A;  3OYF A;  4NOY A;  3PIO A;  1N8R C;  1WPY A;  1VQ8 T;  3S3M A;  2DRK A;  1T3L A;  2F69 A;  2ESW A;  2JNG A;  4C5E A;  3UF4 A;  1K8A C;  3OMG A;  4J8O A;  2COZ A;  3OYG A;  1Q82 R;  4FT2 A;  2RN8 A;  1OQK A;  1GL5 A;  1M30 A;  1S1N A;  4D8K A;  4E7L A;  2DX1 A;  4J83 A;  3OYM A;  2EQU A;  1JU5 C;  2JS2 A;  3BY7 A;  1M3B A;  2MCN A;  4C8Q F;  5CAI A;  2ZPH B;  2BE9 B;  5GAN f;  2AT1 B;  2CUB A;  2ZCF B;  3FJP A;  2C0T A;  4J5Y A;  1WXB A;  4QW2 A;  3F70 A;  2PTK A;  3SWN C;  5LJ5 h;  4JLG A;  3MHX A;  3UPU A;  1A0N B;  1N6A A;  1G3W A;  4DBQ A;  1BCO A;  1VQ4 T;  5GAO m;  5IT9 E;  3JCM c;  5FU7 C;  3SDZ A;  1UB4 A;  4RTT A;  1YJW Q;  1WHG A;  3A8H B;  4XU1 A;  4R55 A;  4CC7 A;  5CVI A;  4WCI A;  1UTI A;  5LJ3 h;  1FWZ A;  3OB9 A;  1TUC A;  4C8Q B;  1AHJ B;  2HBW A;  1IO6 A;  3QZ9 B;  4OMQ A;  4JPB W;  2LT1 A;  1X01 A;  1YP5 A;  2VXF A;  5IXF A;  1BB9 A;  2FZG B;  2KDS A;  2FPF A;  3R6O A;  3EAE A;  2RHX A;  5IHN A;  1ZHI A;  1Y96 B;  2AHJ B;  3BE3 A;  1RAF B;  1YHQ Q;  1BK2 A;  3UAT A;  3QWX X;  4CC2 A;  1K4U S;  4OMP A;  5DLQ E;  3E19 A;  4Y92 A;  4RCC A;  4IUR A;  2DTH A;  1M2V A;  3CPW A;  2LJ0 A;  1M90 R;  4J9H A;  4JZ3 A;  5KE3 A;  1NJI C;  3LWH A;  1LOJ A;  2E70 A;  2DTO A;  3A98 A;  3UA7 A;  4DOV A;  1LNX A;  3SB2 A;  5FRO A;  3CC2 T;  5J3B A;  2KT8 A;  1VQ4 A;  4M7D A;  1BYM A;  3T9N A;  4FW1 A;  4ZGJ B;  1NG2 A;  4XU3 A;  1QVF P;  1IRE B;  1OPK A;  1S72 T;  1VQ5 T;  1UGS B;  1YJ9 T;  8AT1 B;  3KBG A;  3NHN A;  2VWF A;  4C92 D;  2O2O A;  5GAM d;  1KC8 R;  3FIF A;  5HKC A;  4B9W A;  2QQR A;  4PKC C;  1Q95 G;  3HRT A;  2BZX A;  1WI7 A;  1X75 C;  3FRN A;  3C94 A;  2F5T X;  3RKY A;  1OV3 A;  4KGZ B;  3CXC P;  2CUD A;  3CCM Q;  2QEX T;  1ARK A;  2IIM A;  3QPH A;  2KRM A;  4V2S A;  1D1B A;  2ZGW A;  3I5S A;  1XOV A;  4QQG A;  1K1Z A;  1D3B B;  1N8R R;  1KSW A;  2M1H A;  3PE0 A;  3CCJ T;  4M75 D;  3MO8 A;  4C92 E;  1AOJ A;  3X26 B;  5A0L A;  4JRP A;  4A4F A;  2DK3 A;  2L5Q A;  3FEO A;  3HRS A;  1Y57 A;  4D6W A;  1AWX A;  3DB4 A;  1MMN A;  4BE2 A;  3CCL Q;  1MGQ A;  4M78 D;  2DIL A;  1ACM B;  9ATC B;  4BDY A;  3CC2 A;  3PVL A;  1KD1 U;  1AWO A;  4C8Q A;  3CCE Q;  1BI3 A;  2O01 E;  1HXD A;  1B34 B;  4F04 B;  2NUT B;  3JB9 D;  2DL8 A;  4M75 E;  1S72 A;  1U06 A;  1VQ5 A;  2VC8 A;  4X1V A;  2QTV A;  1YJ9 A;  4M4Z A;  5LJ5 d;  2MK5 A;  2RNA A;  4FYW B;  3S3N A;  4E7Z A;  1Y96 A;  1D0Z A;  4FSS A;  4PJL A;  2A0F B;  3A8L B;  4XTY A;  4C92 G;  4M78 E;  4DBR A;  4ZTF A;  3GLX A;  2XDD A;  5CO7 A;  1WQW A;  2CKK A;  4PJJ A;  3P8D A;  4FU6 A;  1IGQ A;  2QEX A;  4JZ4 A;  3FB9 A;  2XHC A;  2KGT A;  2H3E B;  1VQL Q;  2MWO A;  1VQ9 T;  4PFZ A;  4EDU A;  1C1A A;  5KCH A;  4C92 C;  2PVD B;  3CCJ A;  4X9D A;  2V1R A;  3H0H A;  3H6Z A;  2OAW A;  1OOT A;  4E7H A;  2DBK A;  5KYN A;  5FU6 C;  1U5S A;  5CQY A;  1SF9 A;  3PMT A;  4M75 G;  1FMW A;  1TS9 A;  4MML A;  1X69 A;  2QGG A;  3OA6 A;  2E5Q A;  1B3Q A;  3VKI A;  4AG1 C;  5D6Y A;  4RUG A;  1RAH B;  3URG A;  3GNF B;  2YT6 A;  2ZPF B;  2L3R A;  2YRC A;  4KUD K;  4M78 G;  3HKS A;  2YHT A;  3OYJ A;  4M75 C;  4E2F B;  5GAM g;  4E7J A;  1GCQ C;  1YCS B;  5CKD A;  4EMK B;  4A4E A;  5HK3 A;  2HSP A;  4M77 F;  4AFZ C;  1YJW T;  4EIK A;  4HCZ A;  3EG3 A;  1M8M A;  3MP6 A;  1BI0 A;  4Z88 A;  1SHG A;  3JB9 G;  1VIE A;  3O8V A;  4PJN A;  1VYT A;  2NLU A;  2ZAE A;  1K0S A;  3QXE B;  4M78 C;  2E4H A;  2DLP A;  1Q81 U;  1D3B A;  4UC4 A;  1BIA A;  5LL6 S;  3DKM A;  3NGP A;  2R58 A;  4KH1 B;  4J9F A;  1VYV A;  2X4Y A;  1WHL A;  3M58 A;  4R0K A;  2DD4 A;  1W2B S;  1LPL A;  4MZP A;  3LH0 A;  4IIO A;  1VQ9 A;  3VS0 A;  3EG0 A;  5J39 A;  2PVG B;  3EG2 A;  2CDT A;  2LDM A;  4L6V 5;  2EPD A;  1YHQ T;  4LDW A;  2MIO A;  1Q86 U;  2A08 A;  2GTJ A;  4M77 B;  1O75 A;  2OTJ Q;  1P92 A;  2E5K A;  1E7O A;  3VUZ A;  2BIV A;  1B34 A;  3CCU Q;  2DFU A;  3CBP A;  3JCM J;  2NUT A;  3QJ6 A;  3ER0 A;  2QXF A;  3KUF A;  3M54 A;  3TU4 K;  2RK1 A;  1N9S A;  3RES A;  2W0Z A;  1QWE A;  3INZ A;  1TUG B;  3JRZ A;  4VUB A;  4DBF A;  1UFF A;  5GMK e;  4IUQ A;  2KT1 A;  3SWN B;  5GAO p;  1OYX A;  4XK8 E;  1QVF A;  3NTH A;  1HK9 A;  3OS0 A;  5KH6 A;  3QDR B;  3EFO B;  4LDY A;  1N9R A;  2K5L A;  2V26 A;  2RMO A;  1X27 A;  3CC7 Q;  3M0S A;  5IXB A;  5J26 A;  1M1K C;  2C0I A;  2IPO B;  3QO3 A;  3CCS Q;  1FMK A;  4XQ3 A;  1SRM A;  2EQJ A;  1VQM T;  3JSC A;  3NTI A;  4PJO D;  4M7A C;  2QK0 A;  1W1F A;  4X9C A;  3CXC A;  2BZ8 A;  4ELZ C;  2Z0W A;  4ZNX A;  7AT1 B;  3CCM T;  2RPN A;  2KR3 A;  4BI8 B;  1M8V A;  4QT7 A;  2GQI A;  2X3W D;  4F16 A;  2GFU A;  1JB0 E;  1MND A;  4JRK A;  1ZBX A;  3GBQ A;  2LQ8 A;  5GAM j;  2O88 A;  2JTF A;  1X6B A;  4FSX A;  1LJO A;  5GAM e;  5GAN 4;  1CKA A;  2CSI A;  6AT1 B;  1RI0 A;  3QDF A;  4ORZ A;  2D0N A;  4HCB A;  4EMK A;  4PJO E;  2J6O A;  4Y91 A;  4PLL A;  3CCL T;  2HAX A;  1WYX A;  4ELY C;  1V76 A;  3CPW S;  4JDS A;  3M0P A;  3WVD B;  1F1B B;  1JJ2 P;  1UJY A;  2YRV A;  1VYU A;  3RIR A;  5I11 A;  3L2Q A;  5KYU B;  2EJ9 A;  4O6J A;  5D6W A;  3RBB B;  1PM3 A;  4AFQ C;  2AKL A;  4F7U E;  2QG9 B;  1IB8 A;  3ZBD A;  2E12 A;  1KHC A;  2LJ1 A;  3M5A A;  3PVQ A;  1VQM A;  3G4S T;  4RTW A;  4M77 A;  5EC7 A;  2KXC A;  1UG1 A;  2YSQ A;  4PL6 A;  1RAB B;  2OTL A;  2KVQ G;  4PJO G;  2RQT A;  3MEV A;  1C0M A;  2WSF E;  2RJE A;  4HKE A;  3REA B;  2P0Q A;  1GFC A;  4BI3 A;  1RAE B;  2LQW A;  3RDV A;  2YLC A;  4NL2 A;  1M27 C;  5LJ5 e;  1MV3 A;  2DXT A;  3QKJ A;  3SWN A;  2AZV A;  4J9D A;  4N0A C;  5GAM h;  2P84 A;  1QVG P;  1KC8 C;  2RO0 A;  3EFO A;  4N4I A;  1U3O A;  4D8D A;  4LD9 K;  3PIP A;  2A28 A;  3VS3 A;  2L3P A;  4OMF B;  3G6E Q;  4EPC A;  2LQK A;  3L2V A;  1VQK Q;  1K9M U;  3HSB A;  3CPF A;  2E3H A;  2EWN A;  4IUU A;  4KRT A;  5ECA A;  4C92 F;  3PT9 A;  1BI1 A;  4EMG A;  2FYK A;  2F2W A;  5HK0 A;  2HZY A;  1W4S A;  1YCY A;  2EYX A;  2G6F X;  3G71 Q;  2MF2 A;  2JW4 A;  1JRI A;  3G4S A;  2K5F A;  3M0R A;  4XTW A;  1OZ3 A;  4RTU A;  3L1A A;  2LNH B;  4J9B A;  2K5I A;  4ATO A;  2MYS A;  4JLI A;  1EIF A;  2BTT A;  2JUF A;  1K73 U;  1G2B A;  2EKO A;  3EGD B;  1M1K R;  5FLX E;  1WXU A;  2WSC E;  4M75 F;  2RA2 A;  3OQ5 A;  4PK4 A;  3SHW A;  1B07 A;  1D0Y A;  1WFW A;  2COY A;  3JCM Q;  2PVO B;  3MKD A;  1X6O A;  3CCU T;  2KYB A;  3CCQ Q;  4BE1 A;  1G3Y A;  4JJC A;  5KYU A;  1MHN A;  5FU6 B;  2V8I A;  4M78 F;  2RHZ A;  1YNZ A;  3CME A;  2LZ6 B;  5GMK i;  4HT8 A;  1OZ2 A;  1EZZ B;  4E6R A;  2E3I A;  1M3C A;  4C5I A;  4DEY A;  3A8G B;  5FRN A;  1ZX6 A;  3JB9 F;  2XMF A;  2CGH A;  3H41 A;  5LJ3 f;  2FL7 A;  4RMO A;  3OYI A;  4LN2 A;  1AT1 B;  3VS7 A;  1SKU B;  4M75 B;  1WX6 A;  2ROL A;  1G83 A;  3RMS A;  2PNI A;  1VQ8 A;  2ZPI B;  3JCM d;  3M4G A;  3CC7 T;  2LVM A;  1LVK A;  2KQW A;  1JO8 A;  1AZE A;  2DVE A;  4M78 B;  3ZFJ A;  1Q7Y C;  3I5R A;  3J81 E;  4HVV A;  1YJN Q;  2CH4 W;  4LD6 A;  2E1H A;  3GPL A;  4RTV A;  5I22 A;  2EGE A;  3RKW A;  4L59 A;  2ZZD A;  2F2X A;  3GNG A;  4B9X A;  1LCK A;  3LW5 E;  2FZK B;  4QVD A;  4CC3 A;  2VGM A;  1YIJ Q;  4MDW A;  2HSE B;  3CCU A;  3E2U A;  2FHD A;  4NL3 A;  5C0M A;  3RUX A;  2SRC A;  3OYN A;  1VIF A;  4A63 B;  3CMA T;  4JRI A;  1MV0 B;  1NYF A;  2F1L A;  1KFZ A;  1NBE B;  3TSW A;  5KE2 A;  1KK7 A;  1TTH B;  2K3B A;  1PD1 A;  4FL6 A;  2L3S A;  1JJ2 A;  2DL4 A;  1OPL A;  4LDX A;  2I2L A;  2DER A;  3OYA A;  5IAY A;  3QWY A;  4XAX B;  3NPF A;  3OY9 A;  4AG2 C;  2DD5 A;  2AZS A;  3LX7 A;  3CC4 T;  4LE9 A;  2D8H A;  2X9H A;  2VXE A;  1VQ7 T;  4BAC A;  2KRN A;  3EGD A;  1ZQ1 A;  4KBM B;  2DXC A;  1VQ6 T;  2DPP B;  1RAI B;  1XJW B;  2RD1 A;  1Q82 U;  4FYV B;  1QVF S;  1QP3 A;  4IUV A;  3LGL A;  4ZGD B;  3CD6 Q;  1OX9 A;  1ZSZ C;  4C92 A;  1VUB A;  3RR6 A;  3R6N A;  4OP0 A;  5DM7 R;  2QA4 Q;  3VS6 A;  4C0Z A;  4JUV A;  1OU9 A;  2DA9 A;  4IIM A;  4P5N A;  4GLM A;  5A0D A;  2LX7 A;  3PFS A;  2KE9 A;  3QSU A;  2X4J A;  3RNJ A;  1SHF A;  1WQ7 A;  4Y28 E;  3TRE A;  1JQQ A;  2CT3 A;  2HQE A;  1SSH A;  2LCL A;  3CXC S;  1VQN T;  2BE7 D;  4EMH A;  2EVR A;  1Q86 R;  3CMA A;  2RQW A;  2LCS A;  4Q5W A;  2ATC B;  1QVG A;  1QWF A;  4M75 A;  1GCQ A;  2QAZ A;  1GBR A;  3EG9 B;  5KCO A;  4LNP A;  1YWP A;  5GJV B;  4C0D C;  1H8K A;  2VKN A;  1MUZ A;  1VQP Q;  1AWW A;  4O5V A;  3MP8 A;  3M0Q A;  1PNJ A;  3JCM g;  2OJ2 A;  3PGG A;  4M78 A;  1I07 A;  2HQH A;  3I56 Q;  3CC4 A;  4A54 A;  2KRS A;  3QJY A;  1VQ7 A;  2RI2 A;  3LYI A;  2LT4 A;  3CCR Q;  2DTI A;  1VQ6 A;  3UT1 A;  3UWN A;  1PSE A;  4PLI A;  2RJC A;  2JOY A;  1XQH A;  3BDL A;  1CKB A;  3KFV A;  3OSS C;  2PQW A;  5L8R E;  4PJO F;  2M0Y A;  3QYG B;  4ESR A;  3HRU A;  2V8K A;  1Y0M A;  3BFM A;  1Y7X A;  2KNB B;  2MI6 A;  2E65 A;  4B6M A;  3OBY A;  3DLL A;  4RTY A;  1O9S A;  2RH2 A;  4RTX A;  3M59 A;  1M90 U;  3PTA A;  1Q7Y R;  2K3Y A;  1QP2 A;  3FDR A;  2CP7 A;  3VJP A;  3JAM E;  4FYY B;  2Y90 A;  1VQN A;  4HT9 A;  2HQX A;  2BUD A;  3QYH B;  3M4Y A;  1MNE A;  2P4R A;  4F7U F;  5IH2 A;  3CCQ T;  3TVT A;  4M7A D;  2E6N A;  3MP1 A;  1UHC A;  2YUQ A;  1TOV A;  3OSV A;  2DBM A;  4PJO B;  5GMK l;  3M53 A;  2RJF A;  3S3O A;  3MEW A;  4CRI A;  3G1J A;  4C8Q C;  3GF5 A;  1M2O A;  5L23 A;  2KEA A;  5FRM A;  2LX9 A;  2LP5 A;  1PRL C;  3MCA B;  2DIG A;  2VUB A;  2PU9 B;  5CKF A;  1RUW A;  4M7A E;  2CSQ A;  1CSK A;  5A2Q E;  1WNL A;  4OVA A;  3V8K A;  2KBT A;  4CC4 B;  2M51 A;  1GBQ A;  4FYX B;  1K9A A;  4XTZ A;  2M16 A;  3J7A F;  1N8R U;  1NE8 A;  4RG2 A;  2M9U A;  3Q1J A;  3X24 B;  4J6W A;  3NMZ C;  1K8A U;  2HD0 A;  2F2V A;  1Z9Q A;  3ULR B;  2JJ9 A;  3WVE B;  4DA4 A;  1PC0 A;  4ANJ A;  2JZ2 A;  3EG9 A;  2RB6 A;  3QII A;  2HDA A;  4A53 A;  2KY9 A;  4E7I A;  1J3T A;  1WHH A;  4LXC A;  1BBZ A;  3CCQ A;  2A37 A;  1FXX A;  3LLR A;  2XID A;  4J9E A;  5GAN g;  4AT1 B;  1PCX A;  2ECZ A;  4PJM A;  1VQ4 Q;  2V8J A;  4M7A G;  1YJW A;  3C0C A;  2HL5 C;  5GAN 7;  2RQR A;  5FU7 B;  4FM4 B;  3VS5 A;  3X20 B;  3LH5 A;  2EQK A;  2EYW A;  2XK0 A;  1UJ0 A;  3NFC A;  1BCM A;  2CT4 A;  3OS5 A;  2K9G A;  3I55 Q;  1K9M R;  2CRE A;  5D6X A;  5GAO n;  3FLG A;  2GCX A;  1UGV A;  2O31 A;  2CS7 A;  3TQ7 P;  4J6X A;  1RAC B;  2FVU A;  1YHQ A;  4F17 A;  5KYY B;  5KYW B;  1FYN A;  1V29 B;  2LCC A;  2QA4 T;  1MMG A;  1NM7 A;  1ZLM A;  2B86 A;  4GBQ A;  1M4Z A;  2P0P A;  2LQN A;  1QCO A;  4C5H A;  2CH4 A;  3M9Q A;  2K7A A;  1BU1 A;  4PJO A;  2K3X A;  3OMC A;  1KD1 C;  3M57 A;  3EHR A;  2CZ7 B;  1PD0 A;  1GRI A;  1KQ1 A;  3A8M B;  4J7F A;  2KMT A;  2DKG A;  1Y07 A;  3CCE T;  2FPE A;  3QZ5 B;  3VUB A;  1R0B G;  1NJI U;  3JCM h;  2K6D A;  1IHW A;  2RQU A;  1Y71 A;  2PZ1 A;  3A8O B;  4MDX A;  2L89 A;  3JCM X;  3I35 A;  1X2Q A;  1UEC A;  1S72 Q;  2EFI A;  1OEB A;  4A4H A;  1VQ5 Q;  2CZ6 B;  2GF7 A;  2COW A;  2HBP A;  4CI0 C;  1E6G A;  3L2W A;  1VQP T;  2KRO A;  4DEX A;  5CKB A;  1GFD A;  3M56 A;  2DVJ A;  3L42 A;  4XTU A;  2MMP A;  2VB6 A;  4PFO A;  2D9T A;  1JJ2 S; 
#chains in the Genus database with same CATH homology
 2CGH A;  5LJ3 f;  2FL7 A;  3FC3 A;  3CCM A;  4RMO A;  4BDY A;  4XU2 A;  3OYI A;  3CC2 A;  1KD1 U;  4E47 A;  4TVR A;  4C8Q A;  2WAC A;  4M75 B;  2EJF A;  1VQL T;  1YIJ T;  1G3S A;  1BI3 A;  2O01 E;  3RMS A;  2QQS A;  1HXD A;  3E9F A;  3JCM e;  1B34 B;  1VQ8 A;  1WGS A;  2ZPI B;  4QVC A;  3JCM d;  5GAN j;  3M4G A;  3JB9 D;  3CC7 T;  4M75 E;  2LVM A;  1S72 A;  1KQS A;  1WJQ A;  5C6S A;  2KQW A;  1VQ5 A;  2GFA A;  2VC8 A;  1YJ9 A;  4MZT A;  4FT4 A;  3WXM B;  5LJ5 d;  3J80 E;  2M0O A;  2DVE A;  2XDP A;  2RK2 A;  3S3N A;  4M78 B;  2E41 A;  3ZFJ A;  1Q7Y C;  4ME7 A;  3S6W A;  1TH7 A;  1Y96 A;  2LRQ A;  4BDZ A;  3J81 E;  3HPW A;  5GMK j;  4LDV A;  1G5V A;  2LNV A;  3RER A;  4M7D A;  3A8L B;  5GAO q;  4XTY A;  4C92 G;  4M78 E;  3CCL A;  2XDB A;  5GAM f;  4LD6 A;  5LJ5 g;  2E1H A;  4ZTF A;  2QDY B;  3GPL A;  4JJN K;  1XNI A;  2RHI A;  2RHY A;  3GLX A;  4HA8 A;  5CQX A;  4F7U G;  4MMK A;  5CO7 A;  3RKW A;  1WQW A;  2CKK A;  2ZZD A;  4L59 A;  2XKO C;  2XDD A;  3CCE A;  3GNG A;  3P8D A;  4B9X A;  1M1F A;  4FU6 A;  3VYG A;  2JVV A;  2QEX A;  3V8J A;  1FX7 A;  2FB7 A;  1M1G A;  3LW5 E;  1Q82 C;  4QVD A;  3FB9 A;  2XHC A;  3VV0 A;  2VGM A;  4MDW A;  4OB0 B;  1RL2 A;  4EMK C;  1BKB A;  5HY6 A;  2MWO A;  1VQ9 T;  1WJR A;  3L2R A;  4EDU A;  3CCU A;  2FHD A;  4NL3 A;  5C0M A;  5KCH A;  3RUX A;  3CBM A;  4C92 C;  2MWP A;  2PVD B;  4C5G A;  1VIF A;  5LJ3 g;  3OYN A;  3CMA T;  3CCJ A;  1KG1 A;  3OBW A;  4KUL A;  2XG8 D;  4JRI A;  1Q81 C;  3OS1 A;  4X9D A;  3H6Z A;  4KT0 E;  4BB7 A;  1G3T A;  3OYE A;  4E7H A;  1H64 1;  3PMI A;  3CD6 T;  1YI2 A;  1QVG S;  4JRQ A;  3RMQ A;  5FU6 C;  2IG0 A;  2A3L A;  2B8A A;  2QTX A;  3HL8 A;  5CQY A;  5KE2 A;  1YIT T;  3PMT A;  4BE2 A;  2ZPB B;  3MEU A;  4M75 G;  1YJN A;  4MML A;  4ZGE B;  3OA6 A;  4ZN1 A;  1I8F A;  2E5Q A;  4FL6 A;  1JJ2 A;  4QVZ A;  4LDX A;  3VKI A;  3CCV T;  2I2L A;  2DIQ A;  3L2U A;  5D6Y A;  1Q7Y U;  2OTL T;  3OYA A;  4II1 A;  1M90 C;  5IAY A;  1U1S A;  2JTM A;  4N0A A;  3VYH B;  2X4X A;  4XAX B;  4OF1 A;  3URG A;  3OY9 A;  3V8L A;  3GNF B;  2ZPF B;  4DQ2 A;  2DD5 A;  2L3R A;  3LX7 A;  3CC4 T;  1Q86 C;  4DOW A;  1YIJ A;  1VQL A;  1VQ7 T;  1YBY A;  2VXE A;  4KUD K;  4M78 G;  4MZM A;  4BAC A;  4JS5 A;  4KUI A;  3V7C A;  3HKS A;  2XU8 A;  2YHT A;  3OYJ A;  1ZQ1 A;  4M75 C;  3X25 B;  5GAM g;  2LC4 A;  4GY5 A;  4KBM B;  2DXC A;  5GAN 5;  4E7J A;  4J6Y A;  1VQ6 T;  1UGR B;  2DPP B;  4M77 C;  5CKD A;  3JCM W;  1U8R A;  4EMK B;  4A4E A;  5HK3 A;  2RD1 A;  4ZN3 A;  2O4X A;  1Q82 U;  4M77 F;  3QHS A;  1YJW T;  2OTJ T;  4HCZ A;  1QP3 A;  4OB1 B;  3SD4 A;  5CK9 A;  4IUV A;  2PUK B;  3MP6 A;  1BI0 A;  4C0F A;  4C92 B;  3LGL A;  4ZGD B;  3JCM f;  3JB9 G;  3GIB A;  1VIE A;  3O8V A;  4C92 A;  1VUB A;  2NLU A;  3X28 B;  5GAN h;  2KK4 A;  4OP0 A;  5DM7 R;  3QXE B;  4M78 C;  5LJ5 f;  3C95 A;  2LTO A;  4JUV A;  4A4G A;  4C0Z A;  1Q81 U;  4F7U A;  1D3B A;  4UC4 A;  1BIA A;  1VQO T;  4M77 D;  3JB9 H;  3OYY A;  5LL6 S;  2R5M A;  3DKM A;  2D6F A;  1I81 A;  4P5N A;  3AHU A;  5A0D A;  2WSE E;  3PFS A;  2R58 A;  4R56 A;  3QSU A;  2X4J A;  3I56 T;  4IUP A;  2H3J A;  1WQ7 A;  2X4Y A;  3M58 A;  4Y28 E;  2DD4 A;  3TRE A;  5GAN 8;  5GMK h;  1W2B S;  3LH0 A;  2HQE A;  4MZP A;  3HFO A;  5CKH A;  2DZC A;  3CCR T;  2LCL A;  3CXC S;  3CBO A;  2YLB A;  1VQ9 A;  1VQN T;  4EMH A;  3HP9 A;  5J39 A;  2K2V A;  2PVG B;  2XI9 A;  1SSF A;  2LDM A;  4L6V 5;  3CMA A;  2OAU A;  2VYT A;  4OB3 B;  2DJZ A;  3E9G A;  4QQ6 A;  1YHQ T;  2Y4Y A;  4J7I A;  4LDW A;  4Q5W A;  1Q86 U;  1QVG A;  3E1S A;  3CD6 A;  3DLM A;  4M77 B;  1O75 A;  3MET A;  1P92 A;  4M75 A;  4NS5 A;  3C12 A;  4E7K A;  1YIT A;  3VUZ A;  3HHT B;  4YTL A;  2BIV A;  2GQV A;  1B34 A;  5CCA A;  5KCO A;  5GAO l;  3OYK A;  2QA4 A;  3CBP A;  5GAN e;  3JCM J;  3QJ6 A;  2R5A A;  4M77 E;  3SFM A;  3CCS T;  3ASK A;  1UGP B;  3ER0 A;  3QG1 A;  2QXF A;  3KUF A;  1QVP A;  3CCV A;  3M54 A;  4C0D C;  3I55 T;  3TU4 K;  2RK1 A;  1N9S A;  3RES A;  4FIB A;  3MP8 A;  4O5V A;  3JCM g;  3PGG A;  2KSS A;  4M78 A;  3VU3 C;  3INZ A;  3PNW C;  3JRZ A;  4QQD A;  4VUB A;  3CC4 A;  4A54 A;  5LJ5 j;  4M7D F;  3TCJ A;  1VQ7 A;  3QJY A;  5GAN 6;  2C06 A;  5GMK e;  2RI2 A;  3RKX A;  4RCB A;  4IUQ A;  4HCC A;  3LYI A;  2LT4 A;  5GAO r;  3EFR A;  2DTI A;  3SWN B;  3OW2 S;  2R57 A;  5GAO p;  1OYX A;  4XK8 E;  1VQ6 A;  2MAM A;  4N4H A;  3UT1 A;  1PSE A;  3UWN A;  4PLI A;  1QVF A;  2RJC A;  2JOY A;  1XQH A;  1HK9 A;  3NTH A;  5M9O A;  3OS0 A;  3BDL A;  5KH6 A;  3QDR B;  3OYD A;  2OTJ A;  4M7D D;  4PJO C;  3OSS C;  4LDY A;  2PQW A;  1XTD A;  3UDC A;  5L8R E;  1JBM A;  1N9R A;  1M5Q 1;  2K5L A;  4PJO F;  3JCM P;  3QYG B;  5LJ3 j;  2BKD N;  3JCM b;  3HRU A;  2V8K A;  3BFM A;  1Y7X A;  5CKE A;  4BI4 A;  4OGE A;  5LJ3 e;  3CME T;  4X34 A;  2MI6 A;  2DXB A;  3BW1 A;  4Z02 A;  2DAQ A;  4ZTJ A;  2E65 A;  5J26 A;  1VQO A;  3QO3 A;  1M1K C;  1QW1 A;  2L8D A;  3OBY A;  3DLL A;  3BDU A;  1VQP A;  1O9S A;  4XQ3 A;  2RH2 A;  3H8Z A;  2EQJ A;  4OGC A;  3KXT A;  1VQM T;  2E6Z A;  3JSC A;  3NTI A;  1W2B A;  4PJO D;  3M59 A;  1M90 U;  4M7A C;  4C0D B;  3I56 A;  3PTA A;  2K3Y A;  4BY6 B;  1QP2 A;  4X9C A;  3CXC A;  4ELZ C;  4M7A F;  4BUG A;  2CZ0 B;  3FDR A;  4M77 G;  4N4G A;  4RG8 A;  1WJS A;  3CCM T;  3CCR A;  2EAY A;  1N27 A;  2ZPE B;  5CIU A;  3VJP A;  3JAM E;  4M7D B;  4BI8 B;  1M8V A;  2Y90 A;  1NZ9 A;  1VQN A;  2HQX A;  4HT9 A;  2BUD A;  2EYQ A;  2HNI A;  2DEQ A;  2EQM A;  1OI1 A;  3QYH B;  2GFU A;  1JB0 E;  3OYF A;  3M4Y A;  4JRK A;  4NOY A;  3PIO A;  1N8R C;  1WPY A;  1VQ8 T;  1ZBX A;  2QQB A;  4M7D E;  2CZ1 B;  4F7U F;  3S3M A;  2F69 A;  2LQ8 A;  3CCQ T;  1H3Z A;  2EJG A;  4C5E A;  2JNG A;  4M7A D;  5GAM j;  1K8A C;  2JTF A;  3OMG A;  4J8O A;  2DO3 A;  2E6N A;  3MP1 A;  4FSX A;  3OYC A;  1LJO A;  3OSV A;  3OYG A;  4FT2 A;  5GAM e;  2IVW A;  3CC7 A;  5GAN 4;  4PJO B;  5GMK l;  1RI0 A;  3M53 A;  2RJF A;  3S3O A;  2K4Y A;  1DJ7 B;  3CCS A;  2XD0 A;  3JB9 I;  3MEW A;  4HCB A;  4L5G A;  3NTK A;  4CRI A;  4EMK A;  3I55 A;  4E7L A;  4PJO E;  1QVF S;  2X4W A;  4J83 A;  4Y91 A;  4C8Q C;  2EQU A;  3OYM A;  3GP8 A;  3BY7 A;  4PLL A;  3CCL T;  4C8Q F;  2HAX A;  5CAI A;  3GF5 A;  1BIB A;  4ELY C;  5IN1 A;  3JCM V;  2ZPH B;  5GAN f;  5FRM A;  2LX9 A;  4M7A B;  3CPW S;  3OW2 A;  3DB3 A;  1I5L A;  1M1K U;  4JDS A;  3WVD B;  2ZCF B;  3FJP A;  4J5Y A;  3OYB A;  4QW2 A;  3V7R A;  3F70 A;  2YRV A;  3MCA B;  4A4K A;  1R8O B;  2DIG A;  2VUB A;  2PU9 B;  5CKF A;  3RIR A;  4M7A E;  3L2Z A;  4C8Q D;  3SWN C;  1WNL A;  5A2Q E;  4OVA A;  3L2Q A;  3V8K A;  5LJ5 h;  4JLG A;  3MHX A;  3UPU A;  1NPP A;  2EJ9 A;  4GLK A;  4O6J A;  1N6A A;  4XTZ A;  1G3W A;  5D6W A;  3OS2 A;  2M16 A;  1VQ4 T;  5GAO m;  5IT9 E;  3JCM c;  5FU7 C;  3SDZ A;  3LWI A;  3J7A F;  1UB4 A;  1NE8 A;  1N8R U;  4F7U E;  4M7D G;  3ZBD A;  2E12 A;  4RG2 A;  2M9U A;  3Q1J A;  3X24 B;  4J6W A;  1KHC A;  1K8A U;  2HD0 A;  2RI3 A;  2KAF A;  3A8H B;  3M5A A;  4XU1 A;  4R55 A;  2D0Q B;  1VQM A;  3G4S T;  5CVI A;  4M77 A;  5LJ3 h;  1FWZ A;  3WVE B;  4DA4 A;  3OB9 A;  2VGN A;  2JZ2 A;  4C8Q B;  5GAN 3;  1K9M C;  2RB6 A;  1AHJ B;  3QII A;  2EIF A;  3MEA A;  5GAN d;  4LDU A;  4PL6 A;  4A53 A;  3QZ9 B;  4BY6 C;  2OTL A;  2KY9 A;  3G6E T;  2KVQ G;  2LT1 A;  4PJO G;  1X01 A;  4RKU E;  4E7I A;  3MEV A;  2VXF A;  1VQK T;  4M7D C;  4C8Q E;  2WSF E;  2RJE A;  4HKE A;  1I4K 1;  2P0Q A;  3CCQ A;  5CR2 A;  1FXX A;  2KDS A;  4BI3 A;  3LLR A;  3CEY A;  2XID A;  4IUT A;  2YLC A;  4NL2 A;  5LJ5 e;  3R6O A;  5GAN g;  3EAE A;  2RHX A;  2PUO B;  4PNO A;  1ZHI A;  2DXT A;  3V7S A;  1Y96 B;  2AHJ B;  3QKJ A;  3SWN A;  2V8J A;  2F5K A;  4M7A G;  3P8H A;  1YJW A;  2X35 A;  4IKF A;  1K73 C;  5EG2 A;  5GAN 7;  3G71 T;  4N0A C;  1KHI A;  5FU7 B;  4FM4 B;  5GAM h;  1BI2 A;  1KC8 C;  3LGF A;  2RO0 A;  3X20 B;  4N4I A;  5DLQ E;  2EQK A;  3E19 A;  4RCC A;  4IUR A;  3OYH A;  2DTH A;  1NPR A;  2VV5 A;  2QI2 A;  2XK0 A;  3CPW A;  3JB9 J;  4LD9 K;  3PIP A;  3N5B B;  2CYZ B;  5LJ3 d;  5I21 A;  3NFC A;  1IZ6 A;  2QQA A;  5KE3 A;  3OS5 A;  1NJI C;  4OB2 B;  5D6X A;  2Y4X A;  4OMF B;  3QUI A;  2LQK A;  5DY9 A;  4EPC A;  2K57 A;  1LOJ A;  5GAO n;  3LWH A;  3L2V A;  1KQ2 A;  2RM4 A;  2E70 A;  4XTX A;  3FLG A;  2DTO A;  1K9M U;  4BD3 A;  3HSB A;  3CPF A;  4DOV A;  4C0G A;  2GCX A;  1LNX A;  3SB2 A;  5FRO A;  3CC2 T;  2EWN A;  4IUU A;  2CS7 A;  5J3B A;  3TEE A;  3A5Z B;  3PT9 A;  1BI1 A;  3EFS A;  2XIC A;  4C92 F;  2DZ9 A;  4EMG A;  4J6X A;  2FYK A;  2RHU A;  5GMK m;  1VQ4 A;  5HK0 A;  3JB9 F;  4C8Q G;  2FVU A;  1YHQ A;  1BYM A;  3T9N A;  3OYL A;  3HFN A;  1W4S A;  2P0K A;  3ZEH A;  4ZGJ B;  4XU3 A;  1YCY A;  1V29 B;  2E10 A;  2LCC A;  1IRE B;  2RI5 A;  2QA4 T;  1S72 T;  2MF2 A;  1UGS B;  2A7Y A;  1JRI A;  1VQ5 T;  1YJ9 T;  5GAN 2;  3G4S A;  2K5F A;  4XTW A;  3KBG A;  1KQS S;  1M4Z A;  1OZ3 A;  4JS4 A;  2P0P A;  3L1A A;  2P4T A;  3M55 A;  4C92 D;  5GAM d;  1GXI E;  2K5I A;  3FIF A;  4C5H A;  4ATO A;  3M9Q A;  4JLI A;  1EIF A;  5HKC A;  2JUF A;  2JN0 A;  2K3X A;  4PJO A;  3OMC A;  3C4S A;  1K73 U;  2DXU A;  4B9W A;  1KD1 C;  1UGQ B;  5AYF A;  3M57 A;  2QQR A;  4PKC C;  2CZ7 B;  3G6E A;  2EKO A;  4BE0 A;  1KC8 U;  4WF2 A;  3HRT A;  1VQK A;  2QQ9 A;  1X75 C;  5FLX E;  1KQ1 A;  3A8M B;  4J7F A;  2WSC E;  2ZPG B;  2KMT A;  2G3R A;  3FRN A;  2DKG A;  2O4X B;  3C94 A;  2F5T X;  3RKY A;  4M75 F;  2RA2 A;  1Y07 A;  3CCE T;  3QZ5 B;  3VUB A;  2QEX T;  1NJI U;  3OQ5 A;  3JCM h;  5DLO A;  4M7A A;  1U1T A;  3JCM Q;  1Y71 A;  3A8O B;  3QPH A;  4MDX A;  2L89 A;  2PVO B;  4V2S A;  2ZGW A;  3JCM X;  1X6O A;  3CCU T;  1XOV A;  4QQG A;  3G71 A;  3GOX A;  4F7U B;  1D3B B;  4BE1 A;  1G3Y A;  2M1H A;  3CCJ T;  4M75 D;  5A0G A;  2EFI A;  3MO8 A;  1MHN A;  4C92 E;  4A4H A;  1UEB A;  2V8I A;  5FU6 B;  3X26 B;  1PSF A;  4M78 F;  2CZ6 B;  2GF7 A;  2RHZ A;  3QBY A;  3CME A;  2HBP A;  5A0L A;  4CI0 C;  3L2W A;  4XTV A;  4JRP A;  1YI2 T;  1VQP T;  5GMK i;  4A4F A;  2DK3 A;  2L5Q A;  3FEO A;  4HT8 A;  1OZ2 A;  3P8B B;  4XU0 A;  5CKB A;  3HRS A;  1YJN T;  3G7Z A;  3M56 A;  2RJD A;  4D6W A;  4C5I A;  3L42 A;  3A8G B;  1M9S A;  3DB4 A;  4XTU A;  5I2S A;  2MMP A;  5FRN A;  2E64 A;  1MGQ A;  4M78 D;  3ME9 A;  5I2M A;  2D9T A;  1JJ2 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...