2JTMA

Solution structure of sso6901 from sulfolobus solfataricus p2
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
60
structure length
60
Chain Sequence
MSSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Biochemical and structural characterization of Cren7, a novel chromatin protein conserved among Crenarchaea
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
total genus 7
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2007-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11520 Cren7 Chromatin protein Cren7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jtmA00
3LWIA 2JTMA 3KXTA 3LWHA 4R55A 4R56A
chains in the Genus database with same CATH superfamily
2EGCA 1WJRA 1WGSA 4ZGDB 1NZ9A 2K5LA 3EHQA 1X2KA 4FIBA 2DE0X 4M75G 2OTJA 1NPRA 2AT1B 3CBOA 3LGFA 1FXXA 2LX7A 4ZNXA 3RKWA 4F7UF 5KYYA 3M55A 3M53A 2EFIA 2X3XD 4ORZA 4BI4A 1JEGA 2BUDA 4JJDA 1H641 4ZN3A 5GMKi 3FEOA 2BZYA 2GNCA 4WTOB 3CCMT 1K9MU 2VKNA 5DLQE 2F2VA 1KQ2A 2IG0A 1X6GA 4JDSA 1YJ9T 1EX4A 5AYFA 2BIVA 2GTJA 3KBGA 4RMOA 3EAEA 2PUKB 2RD1A 5DM7R 2YUPA 1MNDA 3L2WA 1B07A 3JB9D 2PU9B 4OMLA 1TUDA 2V1QA 4OGCA 2G6FX 1BIBA 5LJ5f 3X28B 2OTLQ 4OB2B 2JTMA 4PLLA 1JBMA 2JTFA 3AT1B 2KXCA 3VS5A 3G71A 2QA4A 1N8RC 3TQ7P 2FB7A 2WSFE 1AD5A 2QYZA 5IHNA 5I2SA 2CP7A 1VIEA 1VQ7A 2LZ6B 1BU1A 2QEXQ 3FLGA 4RTYA 3J80E 4PJOB 1SSFA 1K73R 3FRNA 3HSBA 1VQLT 1C6VX 4F17A 2RN8A 4JJCA 4BI3A 2F1LA 2RI3A 3PVQA 1ZBXA 5KE3A 1VQ4A 3L1AA 3G4SQ 2K4YA 1N9RA 1KQSS 4XTZA 5J26A 4J9CA 1K9MC 2MAMA 2QGGA 2V1RA 4C92A 3MPUB 4F04B 3JCMX 2NUTB 1IXDA 4PL6A 3L2RA 3CC4Q 2H8HA 4BB7A 2AIRB 1QKXA 1G3SA 2ZCFB 4E7IA 2LJ1A 3GNFB 2OTLA 1R0BG 4C5GA 4RG2A 3SHWA 3OBWA 4M7DD 3UWNA 4XTWA 1H8KA 1JJ2A 4DOWA 4HVVA 4L5GA 2ED1A 3CCJQ 2VV5A 2L0AA 3QPHA 1ARKA 3I5RA 3OYCA 2LVMA 3FIFA 1W2BA 3I35A 1KC8R 4M77E 5GANg 1MUZA 2L3QA 2G3RA 4J9HA 4EMGA 3JB9G 1Q95G 2Y4YA 1KQ1A 2IPOB 4AT1B 2NUPA 2CYZB 5A0DA 3OYDA 2X4XA 3QHSA 5GAOp 4HVWA 3CC7T 3V7RA 2JUFA 1FX7A 4J7IA 3O5ZA 1XQHA 2K2VA 3E1SA 3G4SA 3ZFJA 2KNBB 1GBQA 2M16A 1SEMA 3H9NA 1QW1A 4HXJA 3JCMe 2HQXA 1TXQA 2BZ8A 3RBBB 4LN2A 1X27A 4M78A 2O9VA 3GIBA 3CEYA 3C0CA 2FYKA 3E2UA 5KYWA 2DF6A 3L2ZA 4C92C 3CCSA 2DXCA 1QWFA 1Y07A 2NLUA 1G3YA 1VUBA 2JTEA 3ZEHA 4EIKA 1Y7XA 2GTOA 4C8QD 1AWWA 2CGHA 5FW9A 4BACA 4MZMA 5GJVB 4E7KA 3CCUQ 4LD6A 1TUGB 3GPLA 2E3HA 1TUCA 1AHJB 1NJIC 1BCOA 3RMQA 1UGQB 1KHCA 4AFZC 4M75B 3NTIA 2RMOA 4HCCA 3I55T 3L42A 2LJ3A 4E7SA 4A4HA 2JVVA 1WJQA 1N8RR 1ABQA 2X3WD 1W4SA 3RUXA 7AT1B 1Q81U 1FMVA 4JUVA 4L59A 3ZBDA 2RJFA 3UDCA 2VGMA 2FPEA 3MEVA 3A8LB 1WLPB 2IIMA 4PJOE 4QKUA 4LUDA 4GLKA 4Z8AA 1PWTA 1PNJA 3M0TA 4JS4A 2QG9B 2CREA 2EYXA 4Y91A 3DB3A 2FEIA 2DYIA 1RL2A 2WSEE 1YITQ 2KXDA 1YCSB 2XKOC 1UG1A 3CCVT 4M78C 1BKBA 3FB9A 3CPWP 3VRYA 4F7UG 3MEWA 5GAN3 1DJ7B 2LQKA 2YWWA 3R6NA 1E6HA 2A7YA 1K9MR 3QWYA 1Q86U 5A2QE 2O01E 2X4YA 1ZSZB 2EW3A 4KGVB 2LDMA 5IXFA 2DAQA 3ULRB 2A36A 1YJNQ 2EKOA 5CIUA 1VQ6Q 5DY9A 3LH5A 3HHTB 3LYIA 3VJPA 1VQKT 5GANf 3VS2A 4C0GA 2V26A 5LJ5h 2QK0A 2K3BA 1K8AU 2ABLA 2E65A 2RHIA 4MZPA 1XOVA 4QVZA 2CUBA 3SEMA 4Y92A 4DQ2A 2CZ1B 1H3HA 4PLIA 1WXUA 3REAB 3PNWC 2EYZA 2HQHA 4XTUA 1UGVA 1RI0A 1Q81C 2DJZA 1WX6A 1RAEB 2ZPFB 4QW2A 1FMKA 1BI2A 4A54A 1YHQT 2ENMA 1X6OA 3DLMA 2O88A 3QSUA 2GGRA 4WCIA 2W10A 3CXCA 3GNGA 4N4HA 3IQLA 2DMOA 1AVZC 5GAMh 2PVGB 2QI2A 1KQSP 1I5LA 2L3SA 3S3MA 4OMPA 4M77A 2QQ9A 3UF4A 2CP2A 4C0DC 2LP5A 5CKHA 3P8DA 1R77A 1M2VB 2ZPIB 2L5QA 3OMCA 4B9XA 2EJGA 4KBMB 1YJNA 4FU6A 1VOMA 4LDXA 3VS3A 4J9BA 1AWJA 2ZGWA 4RUGA 3L2QA 1VQMA 3PFSA 1KD1U 3JB9I 2KT8A 4IIMA 4DEXA 2LT4A 2A28A 3M0PA 2HCKA 3MKDA 1TWBA 1BBZA 1IZ6A 3OS2A 3QYGB 2E41A 4O5VA 2E3IA 2E6ZA 2RJCA 5KYXB 2LT1A 2IVWA 1G3WA 2DK3A 2MF2A 3GLXA 2OTJT 1NJIR 2KGTA 3PT9A 3H0IA 2DXBA 4M75E 1UE9A 1M3BA 3EH1A 3NPFA 3RESA 1NLPC 1RAAB 4J9FA 2KBTA 2EQIA 4CRIA 3CCLQ 3OYJA 1J3TA 1W6XA 2BTTA 3M0SA 3HRUA 5L23A 1IB8A 1YWOA 3RNJA 1Q82C 3SB2A 1QVFA 3MCAB 4KT0E 1F1BB 4XTVA 2BE9B 3KFVA 5KCOA 1WDXA 1X6BA 1TS9A 1T3LA 4KUIA 4XU0A 2GQIA 5LJ5j 5GMKj 4HVUA 3G6ET 5GJWB 4BY6C 1GCQA 3VV0A 2XMFA 4KUDK 4M77C 1PHTA 5I11A 4BE2A 2V8JA 3JCMg 4YTLA 4TVRA 3VKIA 1KFZA 4XTYA 1CKAA 5LJ5d 1B3QA 3CCQA 2DBKA 1NPPA 1TH7A 2CH4W 1K76A 2QAZA 4GLMA 3META 4C92D 1QVGA 2GCXA 2GFAA 1VQPQ 1QVPA 1WQ7A 1OU9A 2DERA 3G71T 4M7AF 3M0QA 4PJOA 1AWXA 1OU8A 4DBHA 1LJOA 2W0ZA 1VQ7T 3QBYA 2FL7A 5FU7C 2QQBA 4EMHA 1VQ9Q 1MHNA 2F2XA 4J5YA 4LUEA 1VQNQ 3A8MB 1LNXA 4EMKB 1FMWA 2K57A 2HEQA 2L3RA 1WJSA 1O75A 3UT1A 1S72T 4DEYA 4BI8B 1TTHB 4ELYC 2DVEA 3R6OA 3MP8A 2RQWA 3OYFA 1WHJA 4IUUA 4PFPA 2RF0A 5GAMd 4UC4A 2HAXA 3SWNB 3L2VA 3P8HA 1UB4A 2HKQB 2L89A 1SSHA 2LJ0A 3CCLA 2B86A 3OYBA 5CKEA 1JB0E 4FYWB 5IHKA 4OMQA 1IREB 2QA4Q 2MYSA 3V8LA 4AG1C 4M7DF 1V76A 3M9QA 4J6XA 1Q81R 2EVRA 2JZ2A 3QDFA 1I8FA 2YRCA 2QASA 1OULA 1U06A 8ATCB 3CD6A 2F5TX 3OW2A 1QQJA 1ZUYA 2K2MA 3CMEQ 1JRIA 1E7OA 2RM4A 4X1VA 1HJDA 2ROTA 2OTLT 3M57A 5M9OA 5HKCA 3H8ZA 2CZ7B 3NFCA 4Q5WA 2FHDA 2J7IA 1CSKA 1VQPA 4ANJA 1PRLC 4PJJA 1UDLA 1VQ4Q 4KULA 3EHRA 1PKTA 2JS2A 2LNVA 1WHKA 4OB0B 4QT7A 2EQMA 3X20B 4PJOC 2NUZA 5IH2A 1OI1A 1YWPA 2CT3A 4JJNK 4C8QB 2A37A 1QKWA 1VQ9A 2QEXT 2EKHA 3CPWS 3PIOA 2EJ9A 1VQNA 3BW1A 3JCMW 5I22A 5GANh 3JCMJ 4JLGA 1WZOA 3RDVA 3VU3C 1U8RA 2DETA 2K3XA 1M1GA 3EFOB 4N0AA 4J9EA 2C0TA 3S3NA 2DVJA 1B34B 4LXCA 3RMSA 2KROA 2RHXA 1YIJA 4JLIA 2DILA 3REBB 5C0MA 1WFWA 2DIGA 3EG2A 3G4ST 2LRQA 2P4RA 1WXBA 1WHGA 2PZ1A 3EG9A 4C8QF 4ZTFA 4N4GA 1ZUKA 1YCYA 5GMKm 2DKGA 3CC2A 2E12A 2JOYA 3CCRQ 3JCMf 3TU4K 3CCEA 2VYTA 1M3CA 1IRXA 2JN0A 2JM9A 1WA7A 2Y90A 1SRLA 3CC4T 3CQTA 2YT6A 2ESWA 3CMEA 1D1CA 2AKKA 5CO7A 3F70A 1G83A 1Q82R 2J06A 4PFZA 2EGEA 4M7AD 3X25B 4F16A 5KYUB 5FU6B 4M75A 1KHIA 3CCJT 4IKFA 2CT4A 1YJWA 1M1FA 2J6KA 3OSSC 2WSCE 3MJXA 4RG8A 4MZTA 1QMCA 2JT4A 2EQKA 5L8RE 1GFCA 2YUNA 1KJWA 2F5KA 2OX7A 1XNIA 2E10A 4FL6A 4Z02A 2B8AA 4RTUA 2QTXA 4EPCA 4A4EA 3CCSQ 5A0LA 2DO3A 3CPFA 2COYA 4QVDA 2LQNA 2XHCA 4XU3A 5A0GA 2JS0A 1GBRA 2DRMA 1B7TA 1V1CA 4FM4B 4E7HA 2K7AA 1VYVA 3EGUA 2EYQA 2YLCA 1BCMA 3QXEB 3CCRA 2M1HA 3JCMQ 1AOJA 1LVKA 1ZSZA 3ER0A 2KMTA 4MDWA 3H41A 2HZYA 3JCMV 4HCZA 4A4FA 4MMLA 2KSSA 3Q1JA 5GANj 3TSWA 4Z89A 2KYBA 4F7UE 4A4GA 1RACB 2VGNA 2XICA 1M3AA 2XDPA 3MP6A 3CCMA 5KYYB 4DBRA 2KAFA 1SRMA 1X69A 3HL8A 3CCUT 5GANd 5IAYA 1KQSA 4VUBA 4J9IA 4M75C 3MP1A 2DL4A 2RPNA 4AFUC 1UHCA 5GAOm 2QQAA 1MNEA 3NHNA 4J8OA 2DXTA 2R5MA 2EGAA 2LCSA 4RTZA 3AHUA 2MCNA 1N27A 1OV3A 4XK8E 2CSIA 2YUQA 4J9GA 2DNUA 1N6AA 3P8BB 5GMKl 4JS5A 2DL5A 5LJ3e 4M7AG 2KR3A 4PFOA 2OJ2A 2LTOA 3QUIA 2CP5A 3VS6A 3QZ9B 3OSVA 1MMDA 3D7SB 3VS1A 2D6FA 2LQWA 1M30A 5CKBA 1U3OA 2E4HA 5I2MA 1HXDA 1UJYA 3OYHA 1VQLA 1MV3A 1EZZB 1TSFA 2KDSA 3HP9A 4LDVA 5KYNA 3QIIA 4NL2A 5GAMe 2J6FA 2DL7A 2ECZA 1YITT 2VUBA 2X9HA 2PQWA 2EAYA 4B6MA 5FRNA 4FCYA 4CC7A 3VRZA 2DFUA 2EJFA 1TOVA 3ME9A 3PVLA 4JRIA 4BDYA 1H92A 1ZUUA 2DIQA 4M7DG 1W1FA 1YJNT 3C94A 2EYYA 2XK0A 1VQ6T 2KRSA 1I4K1 1GRIA 3MHXA 4RKUE 4D8KA 4A53A 1RAIB 1D0YA 1VQMT 2HNIA 1G2BA 4GBQA 5KYXA 2L8DA 5CKDA 1AWOA 2DEQA 4C5EA 2EPDA 1LCKA 1GL5A 2R5AA 1JU5C 4PJOD 2J05A 2RQTA 2ATCB 2RHUA 2EIFA 1C1AA 4IUPA 4KGZB 3I9QA 4OMFB 3LH0A 1CKBA 1OPLA 3A98A 5D7UA 3LGLA 5CVIA 4C92F 1SHGA 1VQMQ 4X9DA 5AT1B 5GMKh 3NTHA 2MWPA 4C0FA 1NG2A 4BDZA 2K79A 4PJNA 2P4TA 2BKDN 4OVAA 3RERA 2MOXA 5CK9A 4AMCA 4FSSA 3E19A 2RNAA 3JCMh 5GAOl 4C8QG 3OYNA 1PG5B 3UPUA 1JJ2P 4ZN1A 1UGSB 4LE9A 4M4ZA 4J9DA 3WVDB 2DEUA 2C06A 1W2BP 2NYSA 2O4XA 1RLPC 3SWNA 4ESRA 1Y71A 5KYWB 5J3BA 1AT1B 3LX7A 2KEAA 4LDUA 2X4JA 4XAXB 3VYGA 3GOXA 1WYXA 2DZ9A 1RABB 2RQRA 1VQ5A 2FRWA 1K73U 2OI3A 3U23A 1N5ZA 1Q86C 2ZPHB 3CCQQ 4F7UA 1M2OA 3PGGA 2D0QB 5DLOA 2EQJA 3L2UA 1OX8A 3CCLT 4ELZC 4BE1A 3I55A 4C5HA 2DA9A 1BI1A 3SDZA 4IUVA 4M78F 3S6WA 3X26B 3S3OA 2Z0WA 2JNGA 1K8AC 1MMGA 3H0HA 3G1JA 1ZHIA 1OOTA 3OYEA 1T0JA 4C0ZA 4BUGA 3M4YA 3I56Q 1YBYA 4Z88A 2VB6A 4OGEA 1ZQ1A 2NWMA 2GQVA 4B9WA 3SD4A 1UGRB 3UA7A 1ZX6A 5HK0A 1Z9ZA 3M4GA 4JRQA 3RKXA 1VYTA 3OYAA 2V8KA 3DB4A 3V7SA 4HKEA 5CKFA 5GAN4 9ATCB 1M90U 1VQPT 1WXTA 3A8HB 3PTAA 2XU8A 2RA2A 2AKLA 1I07A 5I21A 3CBPA 4L6V5 1ACMB 3BFMA 2CP6A 3OYMA 1K0XA 3A5ZB 1M1KU 3QG1A 2OAWA 2COZA 1P92A 4M7AB 1VQ9T 2KE9A 1VQNT 1ZBJA 1NEGA 4C0DB 4M75D 2HL5C 3CD6Q 1OPKA 1X43A 2MK5A 3SWNC 2DXUA 2HD0A 2CKKA 1PSFA 1EIFA 5GAOn 2MWOA 1VQKA 2RH2A 4O6JA 1PD0A 4CC2A 2K3YA 1M8VA 5HCKA 2RI5A 1YIJT 1LPLA 1TU0B 1IGQA 3ASKA 1YP5A 2FG0A 1WNLA 2EQUA 4R56A 1NBEB 2QA4T 1MV0B 4ZTJA 5HK3A 5LJ3g 1KD1C 3JCMd 3T9NA 4JRPA 1HYOA 2EWNA 1QP3A 1YHQA 3I56A 1RAHB 1BYMA 5KYUA 2RQVA 4M7DB 3JCMb 3CMET 5C6SA 1D0XA 3M0UA 2YXYA 2HBWA 6AT1B 3OA6A 2E5QA 1KG1A 5GAMg 1M90C 1RUWA 2LCCA 2ROLA 2XI9A 3GF5A 2I0NA 1X75C 4MMKA 1YIJQ 3M0RA 3QKJA 4OMNA 4R55A 1VQ4T 2KRMA 3EG3A 3LWIA 5IHIA 2YSQA 2NUTA 1SG5A 3RKYA 2QDLA 3ZL7C 2E1HA 1M1KC 2CP0A 4NL3A 3KXTA 3EGDB 1SHFA 4CC3A 3CC2Q 1E6GA 2AHJB 2KQWA 4BY6B 1YI2Q 2QXFA 1UGPB 3CCEQ 1SF9A 1PC0A 2RHYA 5HY6A 3LLRA 3THKA 3EGXB 1GCQC 2D9TA 2LNHB 5CCAA 4NOYA 1VQOQ 1PRMC 1T0HA 3TSZA 4M78D 5GAN7 3NMZC 3PE0A 3KUFA 4RCCA 1YJWQ 1WHLA 2DLPA 3QZ5B 2V8IA 3M58A 4J6YA 5FU7B 4M77F 3OYGA 4LDWA 2M9UA 4DBFA 2L2PA 1T3SA 4HA8A 4DBQA 4PKCC 4IURA 3CCRT 3WVEB 1Q86R 4R0KA 5ECAA 4PJLA 4V2SA 5FROA 2HQEA 5IN1A 1NYGA 2JMAA 4NS5A 1BK2A 3TVTA 3O8VA 2FZGB 5FU6C 4JZ3A 4E47A 4RTVA 4QQDA 4C92G 1UHFA 1K8AR 4J83A 1JQQA 3JB9J 4D6WA 2P0KA 1VQ8Q 2A0FB 4OP0A 1OZ2A 2XD0A 2JM8A 3G6EA 2A08A 1VYUA 3EG0A 2HL3A 5GAOr 1UECA 4OB3B 5FRMA 3FJ5A 3A8GB 4OMOA 1YI2A 4E2FB 2DD5A 4GY5A 3TEEA 4XTXA 4XU2A 3OS5A 3CCST 2CP3A 4FYYB 1JJ2S 1U5SA 4QVCA 3CMAA 2X4WA 2RK2A 3HRTA 2ZAEA 1VQOA 4M7AE 2VWFA 5LJ3f 4LDYA 3CCMQ 1JXOA 1W2BS 1S1NA 4A63B 3A1PA 1NLOC 1PSEA 2GBQA 2XIDA 2MMPA 2YHTA 4KH0B 1K1ZA 1QVFP 1YJ9Q 3LW5E 3NTKA 3V8KA 1MMNA 1S72A 1Y96B 4IIOA 4CC4B 1YFNA 2QTVA 2ZPGB 2ZPBB 3CPWA 1AZEA 4DA4A 5IXBA 1I81A 2DD4A 3OQ5A 5GAMf 2E70A 1M8MA 2YLBA 2VXEA 2PVOB 1KK7A 1M27C 2X35A 2ED0A 2AZSA 2D8JA 1M9SA 3PIPA 1QVGP 3HPWA 1KD1R 4AG2C 2DL3A 2KT1A 1OX9A 1Z9QA 4M78G 4PJOF 4N0AC 3N5BB 2LCLA 2H3JA 2P0PA 3JV3A 2EYWA 3H0FA 4M7DE 1IGUA 1VQ8A 1U1TA 5FWBA 1D3BB 4KRTA 2CSQA 2FZCB 2CH4A 3VYHB 1I0CA 1VQLQ 4HCBA 3I5SA 4LD9K 4DOVA 3BDUA 2DX1A 1K4US 1M90R 3MO8A 1G3TA 1UEBA 2PVDB 3E9GA 3H6ZA 5EG2A 4BE0A 1RADB 4FYVB 1PD1A 3BE3A 1EFNA 3C4SA 4AFQC 1N9SA 4FYXB 3LWHA 4K11A 1M1KR 3VS4A 4E7JA 1BB9A 1SKUB 1KIKA 1ABOA 1NJIU 3FJPA 4FSXA 3J81E 3QJ6A 2MPXC 4M77D 2QEXA 3V7CA 3V8JA 4X34A 1YJ9A 3OYKA 3UATA 4E7ZA 1Q7YU 2MI6A 1K0SA 5LJ5e 2O9SA 5GMKe 2D8HA 1QWEA 2HBPA 3OW2P 4X9CA 3M56A 3VS7A 3C95A 2FRYA 2O31A 4RCBA 3CBMA 4WF2A 2R57A 1IO6A 5GAOq 1YN8A 5CQYA 5GAN6 5D6YA 3J7AF 4ATOA 1YNZA 4PK4A 1ZLMA 2RJDA 1RAFB 2X51A 4ME7A 4C8QE 1QCNA 3M54A 3OS1A 3JB9H 3MEUA 1M5Q1 1IHWA 3EG9B 1BIAA 2CZ6B 3UA6A 3CC4A 2EBPA 3HKSA 3EH2A 5KCHA 1RI9A 4IUQA 1M2VA 2D0NA 1OQKA 2SRCA 4FW1A 2C0OA 2M0YA 3CC7Q 3FC3A 2F2WA 1ZSZC 1VQ5T 3CCJA 1GFDA 5CAIA 4PJMA 2DM1A 1G8XA 4F14A 3EFRA 1A0NB 1O9SA 2M0OA 5EC7A 1UTIA 2RJEA 4QQGA 1R8OB 1KSWA 3OYYA 3QJYA 3E9FA 1QLYA 1AEYA 1Q7YC 2AK5A 2YUOA 2YDLA 1WIEA 4C92B 2MIOA 2QQSA 4OMMA 1RAGB 2HSEB 5IT9E 4XU1A 2FO0A 1VQ5Q 4M75F 3CXCS 4XQ3A 1M4ZA 4D8DA 4C5IA 2HKNA 2K5IA 2ZZDA 3C12A 4M77G 2LMJA 4M7AA 1SPKA 2QGFB 3QYHB 3DKMA 1G5VA 1HSQA 3HFOA 4IUTA 3I55Q 3MEAA 2JW4A 4EDUA 2J6OA 1K9AA 3INZA 3G7ZA 1R0CB 4RTTA 2Y4XA 2GF7A 1W70A 2KVQG 2K6DA 3CC7A 2ZPEB 2YRDA 2KRNA 3CCUA 2BE7D 5GAN8 2NUPB 4MDXA 1AZGB 2FPDA 3CCQT 2PUOB 2COWA 2VASA 5FLXE 5GAN5 1QP2A 5KH6A 3FDRA 4M7DA 3NGPA 4EMKA 3CCVQ 4KGXB 3JAME 1HK9A 2BZXA 1XTDA 2FZKB 5LJ3h 4AFSC 1WHMA 1JO8A 2RK1A 2RI2A 1MMAA 3I56T 4HT8A 1NM7A 4M78B 2XDBA 8AT1B 1UJ0A 2K9GA 2E6NA 4LNPA 3HFNA 1WHHA 2HDAA 3RIRA 1D1BA 5CR2A 3GP8A 1VQKQ 3OB9A 3EGDA 1Q82U 2DTIA 2DL8A 1QVFS 5CQXA 4QQ6A 1D09B 4N4IA 2QDYB 3JSCA 1YITA 5KE2A 2DZCA 4RTWA 2RB6A 4JPBW 1XJWB 4M7AC 2AZVA 2O2OA 4ZGEB 3WXMB 1I5OB 1RLQC 3OY9A 1BI0A 3EGXA 2L3PA 1UUEA 2KYMA 4KH1B 3BY7A 3OYIA 3VS0A 1HD3A 1YHQQ 2P0QA 3EG1A 2LX9A 2VXFA 2WACA 3CD6T 4PJOG 3PMTA 1QVGS 3GBQA 1VQ6A 2YRVA 3A8OB 2XG8D 2SEMA 3OMGA 2I2LA 4BD3A 2E64A 1WI7A 1WQWA 5D6WA 4RTXA 3HTRA 4CI0C 4C8QA 2D1XA 2KI7A 3VUBA 3VUZA 1U1SA 1MGQA 5LL6S 4JZ4A 4FT2A 4II1A 3CCVA 2M02A 2CDTA 3OYLA 3PMIA 3QDRB 5FWCA 4M7DC 1OEBA 2QQRA 4EMKC 3JCMP 2DBMA 4Y28E 3EFOA 1PKSA 2VVKA 3RR6A 1X2QA 1PCXA 1KC8U 1NE8A 3JB9F 1B34A 2A3LA 1FWZA 1VIFA 2JXBA 2DPPB 5GANe 1TG0A 4PNOA 1K73C 2DTOA 1UFFA 2DTHA 5LJ5g 3M59A 1ZA1B 2OAUA 3HRSA 4E6RA 1Q7YR 2RO0A 2CUDA 2P84A 1X01A 1ZSGA 2RQUA 1C0MA 1Y0MA 4C92E 3BDLA 2GFUA 4J6WA 2C0IA 2XDDA 1NYFA 2KK4A 3QWXX 3M5AA 1OYXA 3OW2S 4FW2A 4ZGJB 3CC2T 1Y57A 2FPFA 3SFMA 2E5KA 1I1JA 1YI2T 3OBYA 2HMAA 3CCET 2OTJQ 2HSPA 5LJ3j 1PM3A 3QO3A 1BI3A 4JRKA 1D1AA 2DRKA 4P5NA 3CMAT 3X24B 1V29B 1Y96A 4A4KA 5LJ3d 1NEBA 1VQOT 1IHVA 4OB1B 4HCKA 1GXIE 4JJBA 2CZ0B 2H3EB 3JCMc 2JJ9A 1GCPA 5GAMj 2DJQA 1YJWT 3G6EQ 1H3ZA 2LC4A 4C8QC 1OZ3A 2R58A 3OS0A 3DLLA 1JXMA 2KY9A 5J39A 2VC8A 1KC8C 2O4XB 2CS7A 2K5FA 1QCOA 3JRZA 1WPYA 4M77B 3URGA 4E7LA 3EFSA 1FYNA 1LOJA 3G71Q 1D3BA 1N8RU 3CMAQ 2JMCA 4HT9A 4F7UB 1ZA2B 2F69A 5D6XA 2DYBA 4J7FA 2PNIA 3CXCP 1VQ7Q 4M78E 5GAN2 1VQ8T 2FVUA 1D0ZA 3TCJA 2LQ8A 3TREA 4FT4A 1VA7A 2PTKA 2M51A 1QCFA 1S72Q 4OF1A 2RHZA
chains in the Genus database with same CATH topology
3BDUA 2DEQA 4C5EA 1WJRA 1WGSA 3MO8A 2E41A 4ZGDB 1NZ9A 2K5LA 4O5VA 1G3TA 1UEBA 2PVDB 2E6ZA 2RJCA 3E9GA 3H6ZA 1QVFA 2R5AA 4FIBA 2LT1A 4M75G 2OTJA 5EG2A 1NPRA 4PJOD 2IVWA 3CBOA 3LGFA 1G3WA 2DK3A 2MF2A 3GLXA 2OTJT 4BE0A 1FXXA 3PT9A 3RKWA 2RHUA 4F7UF 2EIFA 3M55A 3M53A 2DXBA 3C4SA 1N9SA 2EFIA 4M75E 4BI4A 3RESA 3LWHA 4IUPA 4E7JA 4OMFB 2BUDA 4CRIA 3LH0A 1H641 1NJIU 3OYJA 3FJPA 4FSXA 3FEOA 4ZN3A 5GMKi 3J81E 3QJ6A 3HRUA 3CCMT 3LGLA 1K9MU 1Q82C 5CVIA 4M77D 3SB2A 4C92F 3MCAB 5DLQE 3V7CA 3V8JA 4KT0E 2QEXA 4X34A 1KQ2A 4XTVA 1YJ9A 2IG0A 3OYKA 5KCOA 4JDSA 1YJ9T 4X9DA 5AYFA 2BIVA 3KBGA 4KUIA 4XU0A 3EAEA 2PUKB 5GMKh 2RD1A 5LJ5j 4RMOA 3NTHA 5GMKj 2MWPA 4C0FA 5DM7R 3L2WA 3G6ET 2MI6A 1Q7YU 4BY6C 5LJ5e 3JB9D 4BDZA 3VV0A 5GMKe 2PU9B 2HBPA 2P4TA 4X9CA 4KUDK 4M77C 2BKDN 4BE2A 3M56A 2V8JA 3C95A 4OGCA 3JCMg 1BIBA 4YTLA 4TVRA 4OVAA 4RCBA 3VKIA 3CBMA 3RERA 4XTYA 5CK9A 5LJ5f 3X28B 5LJ5d 3CCQA 4WF2A 1NPPA 3E19A 1TH7A 4OB2B 2R57A 2JTMA 5GAOq 3JCMh 5GAOl 3META 5CQYA 4PLLA 4C92D 1JBMA 5GAN6 5D6YA 2JTFA 4C8QG 3OYNA 1QVGA 3J7AF 2GCXA 2GFAA 3UPUA 4ATOA 4ZN1A 1QVPA 1WQ7A 1N8RC 3G71A 1UGSB 2QA4A 3G71T 4M7AF 3WVDB 2RJDA 5LL6S 2FB7A 2WSFE 4ME7A 4C8QE 4PJOA 3M54A 5I2SA 3OS1A 1VIEA 2C06A 3JB9H 3MEUA 1VQ7A 1LJOA 1M5Q1 1VQ7T 1BIAA 2CZ6B 3QBYA 2FL7A 5FU7C 3CC4A 2QQBA 3HKSA 3FLGA 4EMHA 1MHNA 4J5YA 5KCHA 2O4XA 3J80E 4PJOB 1SSFA 3A8MB 1LNXA 4EMKB 4IUQA 3FRNA 3SWNA 3HSBA 2K57A 1VQLT 1Y71A 1WJSA 2L3RA 1O75A 3UT1A 1S72T 4LD9K 4BI8B 5J3BA 3LX7A 4ELYC 4LDUA 2X4JA 4XAXB 2DVEA 3R6OA 3VYGA 4BI3A 3MP8A 3GOXA 2DZ9A 2RI3A 3OYFA 1VQ5A 3FC3A 4IUUA 1K73U 5GAMd 4UC4A 1VQ5T 3SWNB 2HAXA 3CCJA 1ZBXA 3P8HA 3L2VA 1UB4A 2L89A 5CAIA 5KE3A 2ZPHB 1Q86C 1VQ4A 4F7UA 3L1AA 3PGGA 2D0QB 5DLOA 3CCLA 3EFRA 2EQJA 3OYBA 2K4YA 1N9RA 5CKEA 3L2UA 1KQSS 1JB0E 1O9SA 4XTZA 3CCLT 5J26A 2M0OA 1IREB 1K9MC 4ELZC 4BE1A 3V8LA 2MAMA 3I55A 2RJEA 4QQGA 4C5HA 4M7DF 3M9QA 4J6XA 1BI1A 3SDZA 4IUVA 4M78F 3S6WA 3X26B 1R8OB 3S3OA 3OYYA 2JZ2A 4C92A 1I8FA 2JNGA 1K8AC 3QJYA 3E9FA 3JCMX 1ZHIA 4PL6A 3OYEA 3L2RA 4C0ZA 1Q7YC 3CD6A 4BUGA 2F5TX 4BB7A 3OW2A 1G3SA 3M4YA 1YBYA 4OGEA 1ZQ1A 2GQVA 1JRIA 4B9WA 4C92B 3SD4A 1UGRB 2RM4A 5HK0A 3M4GA 2ZCFB 4JRQA 4E7IA 2QQSA 3GNFB 2OTLA 3RKXA 4C5GA 4RG2A 5IT9E 3OBWA 2OTLT 3M57A 4XU1A 2V8KA 3DB4A 3UWNA 4HKEA 4XTWA 3H8ZA 2CZ7B 3NFCA 4M75F 4Q5WA 5CKFA 2FHDA 4DOWA 4L5GA 4XQ3A 3CXCS 1VQPA 1M4ZA 1M90U 2VV5A 2K5IA 4C5IA 2ZZDA 1VQPT 3C12A 3A8HB 4KULA 3PTAA 3QPHA 2XU8A 2RA2A 3OYCA 2LVMA 4M77G 5HKCA 2LNVA 3FIFA 4M7AA 5I21A 1W2BA 4OB0B 3CBPA 3DKMA 3QYHB 1G5VA 3HFOA 4L6V5 2EQMA 3BFMA 3X20B 4IUTA 4PJOC 3OYMA 1OI1A 3MEAA 4M77E 5GANg 3A5ZB 4EDUA 1M1KU 4JJNK 2G3RA 4C8QB 3INZA 3QG1A 1VQ9A 4EMGA 1P92A 3G7ZA 2QEXT 3CPWS 2Y4YA 2EJ9A 4M7AB 3PIOA 1KQ1A 3JB9G 1VQ9T 1VQNA 3BW1A 3JCMW 5GANh 1VQNT 4C0DB 3JCMJ 4JLGA 4M75D 2CYZB 2Y4XA 5A0DA 3OYDA 2GF7A 3VU3C 2X4XA 3SWNC 2DXUA 1U8RA 2KVQG 2HD0A 2K3XA 1M1GA 2CKKA 1PSFA 2ZPEB 3CC7A 4N0AA 1EIFA 3QHSA 5GAOp 5GAOn 3CC7T 2MWOA 3V7RA 2JUFA 1FX7A 1VQKA 3CCUA 2RH2A 4O6JA 3S3NA 4J7IA 1B34B 3RMSA 5GAN8 2RHXA 4MDXA 1XQHA 2K2VA 2K3YA 3E1SA 4JLIA 3G4SA 1YIJA 5C0MA 4M7DD 3CCQT 1M8VA 2RI5A 3ZFJA 1YIJT 2DIGA 3G4ST 2LRQA 2PUOB 1JJ2A 5FLXE 2M16A 5GAN5 3ASKA 1WNLA 1QP2A 4C8QF 4ZTFA 2EQUA 1QW1A 4N4GA 3JCMe 4R56A 2HQXA 1YCYA 2QA4T 5GMKm 5KH6A 2DKGA 3CC2A 4ZTJA 2E12A 3FDRA 5HK3A 4M7DA 5LJ3g 4EMKA 5M9OA 2JOYA 4M78A 1KD1C 3JCMf 3JCMd 3TU4K 3CEYA 3CCEA 3GIBA 2FYKA 1HK9A 3T9NA 3JAME 3L2ZA 2VYTA 4C92C 1XTDA 3CCSA 5LJ3h 2DXCA 2JN0A 4JRPA 2EWNA 1YHQA 1QP3A 2Y90A 1Y07A 3CC4T 3I56A 2NLUA 2RK1A 2RI2A 1G3YA 3OYAA 1BYMA 3CMEA 4M7DB 3JCMb 3I56T 4HT8A 2XDBA 4M78B 1VUBA 3CMET 5C6SA 5CO7A 3ZEHA 3F70A 2E6NA 1Y7XA 3HFNA 4C8QD 3OA6A 2E5QA 4M7AD 3X25B 1KG1A 5GAMg 3RIRA 2CGHA 1M90C 5FU6B 5CR2A 4BACA 4MZMA 4E7KA 3GP8A 2LCCA 2XI9A 3GF5A 4LD6A 4M75A 3OB9A 1KHIA 3GPLA 1X75C 3CCJT 1Q82U 2DTIA 4MMKA 4IKFA 1YJWA 1M1FA 3QKJA 4R55A 1AHJB 1QVFS 5CQXA 3OSSC 4QQ6A 2WSCE 1VQ4T 4RG8A 1NJIC 3RMQA 4N4IA 2QDYB 1UGQB 4MZTA 1KHCA 3LWIA 3JSCA 1YITA 5KE2A 2DZCA 3RKYA 2RB6A 2EQKA 5L8RE 4M7AC 2E1HA 4ZGEB 4M75B 3WXMB 1M1KC 3NTIA 4NL3A 3KXTA 2F5KA 4DOVA 4HCCA 3I55T 3OY9A 3L42A 1BI0A 1XNIA 2E10A 4FL6A 2AHJB 2KQWA 4Z02A 4A4HA 2QXFA 4BY6B 1UGPB 2B8AA 1WJQA 2JVVA 2QTXA 4EPCA 3BY7A 3OYIA 4A4EA 1W4SA 3RUXA 5A0LA 2P0QA 1Q81U 2RHYA 2DO3A 2LX9A 2VXFA 2WACA 3CD6T 4JUVA 3CPFA 4L59A 5HY6A 3PMTA 4PJOG 3ZBDA 2RJFA 4QVDA 1QVGS 3LLRA 1VQ6A 3UDCA 2D9TA 2VGMA 2XHCA 4XU3A 2YRVA 5CCAA 5A0GA 3A8OB 2XG8D 3MEVA 3A8LB 4NOYA 3V7SA 3OMGA 2I2LA 4PJOE 4BD3A 4GLKA 2E64A 4M78D 5GAN7 4JS4A 1WQWA 4FM4B 4E7HA 5D6WA 3KUFA 4CI0C 4RCCA 4C8QA 4Y91A 2EYQA 3VUBA 3VUZA 3QZ5B 1U1SA 1MGQA 2V8IA 3DB3A 3M58A 1RL2A 2YLCA 4J6YA 4M77F 3QXEB 2WSEE 5FU7B 4LDWA 2M9UA 3OYGA 3CCRA 4FT2A 4HA8A 4II1A 3CCVA 2M1HA 4IURA 4PKCC 3JCMQ 3OYLA 2XKOC 3PMIA 3QDRB 3WVEB 3CCRT 3ER0A 2QQRA 4EMKC 3CCVT 2KMTA 4M78C 3JCMP 4MDWA 4Y28E 1BKBA 3FB9A 4V2SA 5FROA 4F7UG 3MEWA 2HQEA 5IN1A 5GAN3 1DJ7B 4NS5A 3JCMV 1KC8U 2LQKA 3O8VA 1NE8A 4HCZA 4MMLA 4A4FA 3JB9F 2A7YA 1B34A 2KSSA 3Q1JA 5GANj 2A3LA 1Q86U 5FU6C 5A2QE 2O01E 2X4YA 1FWZA 4F7UE 1VIFA 4A4GA 2LDMA 2DPPB 2VGNA 5GANe 2DAQA 2XICA 4PNOA 1K73C 2DTOA 2EKOA 2XDPA 3MP6A 4E47A 3CCMA 5CIUA 4QQDA 4C92G 5DY9A 2DTHA 4J83A 3M59A 2OAUA 2KAFA 3HHTB 3HRSA 3LYIA 5LJ5g 2RO0A 3JB9J 3HL8A 3VJPA 4D6WA 1X01A 5GANf 5GANd 3CCUT 1VQKT 5IAYA 2P0KA 1KQSA 4VUBA 4C0GA 4M75C 3MP1A 4OP0A 1OZ2A 4C92E 5LJ5h 5GAN4 2XD0A 3G6EA 1K8AU 3BDLA 5GAOm 2E65A 2QQAA 2GFUA 2RHIA 1XOVA 4J6WA 4MZPA 4QVZA 4J8OA 2XDDA 4DQ2A 2KK4A 2DXTA 2R5MA 3M5AA 2CZ1B 1OYXA 4PLIA 5GAOr 3OW2S 3PNWC 4OB3B 4ZGJB 4XTUA 3CC2T 3SFMA 1YI2A 1N27A 3A8GB 5FRMA 3AHUA 2DD5A 4GY5A 1RI0A 1YI2T 3TEEA 4XTXA 2DJZA 3OBYA 4XU2A 1Q81C 3CCET 3OS5A 4XK8E 2ZPFB 4QW2A 5LJ3j 3CCST 3QO3A 1BI2A 1N6AA 3P8BB 4A54A 1YHQT 5GMKl 1JJ2S 4JS5A 4M7AG 1BI3A 4JRKA 5LJ3e 1X6OA 3DLMA 4QVCA 3QSUA 2LTOA 3CMAA 4P5NA 2X4WA 3QUIA 2RK2A 3HRTA 3QZ9B 3X24B 1V29B 1VQOA 3CMAT 3OSVA 3CXCA 1Y96A 4M7AE 5LJ3f 4LDYA 5LJ3d 4A4KA 1VQOT 2D6FA 4OB1B 3GNGA 1W2BS 4N4HA 5CKBA 1PSEA 2XIDA 1GXIE 2MMPA 2YHTA 5I2MA 2CZ0B 1HXDA 3JCMc 5GAMh 2PVGB 3LW5E 2QI2A 3NTKA 5GAMj 3OYHA 3V8KA 1VQLA 1I5LA 1YJWT 2KDSA 3HP9A 4LDVA 1Y96B 1S72A 1H3ZA 2LC4A 3S3MA 3QIIA 4NL2A 4C8QC 5GAMe 1OZ3A 2ZPGB 1YITT 4M77A 2ZPBB 2QQ9A 2VUBA 2PQWA 2R58A 2EAYA 3OS0A 3CPWA 3DLLA 4C0DC 4DA4A 2KY9A 5J39A 2VC8A 1KC8C 2O4XB 1I81A 5CKHA 2DD4A 3OQ5A 3P8DA 5GAMf 2E70A 2YLBA 5FRNA 2VXEA 2CS7A 2K5FA 2PVOB 3JRZA 2EJFA 1WPYA 4M77B 2ZPIB 3URGA 2L5QA 3ME9A 3OMCA 4B9XA 4E7LA 3EFSA 4JRIA 2X35A 1LOJA 2EJGA 4BDYA 4KBMB 1M9SA 4FU6A 3PIPA 1YJNA 3HPWA 2DIQA 4M7DG 1D3BA 1YJNT 3C94A 4M78G 4LDXA 4PJOF 2XK0A 1N8RU 1VQ6T 2ZGWA 1I4K1 4N0AC 3N5BB 4F7UB 2LCLA 4HT9A 2H3JA 3MHXA 4RKUE 2P0PA 2F69A 5D6XA 4A53A 4J7FA 1VQ8A 3L2QA 1VQMA 4M7DE 1U1TA 4M78E 3PFSA 5GAN2 1KD1U 3JB9I 4M7DC 1VQ8T 1VQMT 2FVUA 3TCJA 2HNIA 1D3BB 2LQ8A 2LT4A 3TREA 4FT4A 2L8DA 5CKDA 3VYHB 1IZ6A 3OS2A 4HCBA 3QYGB 4OF1A 2RHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWI A;  2JTM A;  3KXT A;  3LWH A;  4R55 A;  4R56 A; 
#chains in the Genus database with same CATH topology
 2EGC A;  1WJR A;  1WGS A;  4ZGD B;  1NZ9 A;  2K5L A;  3EHQ A;  1X2K A;  4FIB A;  2DE0 X;  4M75 G;  2OTJ A;  1NPR A;  2AT1 B;  3CBO A;  3LGF A;  1FXX A;  2LX7 A;  4ZNX A;  3RKW A;  4F7U F;  5KYY A;  3M55 A;  3M53 A;  2EFI A;  2X3X D;  4ORZ A;  4BI4 A;  1JEG A;  2BUD A;  4JJD A;  1H64 1;  4ZN3 A;  5GMK i;  3FEO A;  2BZY A;  2GNC A;  4WTO B;  3CCM T;  1K9M U;  2VKN A;  5DLQ E;  2F2V A;  1KQ2 A;  2IG0 A;  1X6G A;  4JDS A;  1YJ9 T;  1EX4 A;  5AYF A;  2BIV A;  2GTJ A;  3KBG A;  4RMO A;  3EAE A;  2PUK B;  2RD1 A;  5DM7 R;  2YUP A;  1MND A;  3L2W A;  1B07 A;  3JB9 D;  2PU9 B;  4OML A;  1TUD A;  2V1Q A;  4OGC A;  2G6F X;  1BIB A;  5LJ5 f;  3X28 B;  2OTL Q;  4OB2 B;  2JTM A;  4PLL A;  1JBM A;  2JTF A;  3AT1 B;  2KXC A;  3VS5 A;  3G71 A;  2QA4 A;  1N8R C;  3TQ7 P;  2FB7 A;  2WSF E;  1AD5 A;  2QYZ A;  5IHN A;  5I2S A;  2CP7 A;  1VIE A;  1VQ7 A;  2LZ6 B;  1BU1 A;  2QEX Q;  3FLG A;  4RTY A;  3J80 E;  4PJO B;  1SSF A;  1K73 R;  3FRN A;  3HSB A;  1VQL T;  1C6V X;  4F17 A;  2RN8 A;  4JJC A;  4BI3 A;  2F1L A;  2RI3 A;  3PVQ A;  1ZBX A;  5KE3 A;  1VQ4 A;  3L1A A;  3G4S Q;  2K4Y A;  1N9R A;  1KQS S;  4XTZ A;  5J26 A;  4J9C A;  1K9M C;  2MAM A;  2QGG A;  2V1R A;  4C92 A;  3MPU B;  4F04 B;  3JCM X;  2NUT B;  1IXD A;  4PL6 A;  3L2R A;  3CC4 Q;  2H8H A;  4BB7 A;  2AIR B;  1QKX A;  1G3S A;  2ZCF B;  4E7I A;  2LJ1 A;  3GNF B;  2OTL A;  1R0B G;  4C5G A;  4RG2 A;  3SHW A;  3OBW A;  4M7D D;  3UWN A;  4XTW A;  1H8K A;  1JJ2 A;  4DOW A;  4HVV A;  4L5G A;  2ED1 A;  3CCJ Q;  2VV5 A;  2L0A A;  3QPH A;  1ARK A;  3I5R A;  3OYC A;  2LVM A;  3FIF A;  1W2B A;  3I35 A;  1KC8 R;  4M77 E;  5GAN g;  1MUZ A;  2L3Q A;  2G3R A;  4J9H A;  4EMG A;  3JB9 G;  1Q95 G;  2Y4Y A;  1KQ1 A;  2IPO B;  4AT1 B;  2NUP A;  2CYZ B;  5A0D A;  3OYD A;  2X4X A;  3QHS A;  5GAO p;  4HVW A;  3CC7 T;  3V7R A;  2JUF A;  1FX7 A;  4J7I A;  3O5Z A;  1XQH A;  2K2V A;  3E1S A;  3G4S A;  3ZFJ A;  2KNB B;  1GBQ A;  2M16 A;  1SEM A;  3H9N A;  1QW1 A;  4HXJ A;  3JCM e;  2HQX A;  1TXQ A;  2BZ8 A;  3RBB B;  4LN2 A;  1X27 A;  4M78 A;  2O9V A;  3GIB A;  3CEY A;  3C0C A;  2FYK A;  3E2U A;  5KYW A;  2DF6 A;  3L2Z A;  4C92 C;  3CCS A;  2DXC A;  1QWF A;  1Y07 A;  2NLU A;  1G3Y A;  1VUB A;  2JTE A;  3ZEH A;  4EIK A;  1Y7X A;  2GTO A;  4C8Q D;  1AWW A;  2CGH A;  5FW9 A;  4BAC A;  4MZM A;  5GJV B;  4E7K A;  3CCU Q;  4LD6 A;  1TUG B;  3GPL A;  2E3H A;  1TUC A;  1AHJ B;  1NJI C;  1BCO A;  3RMQ A;  1UGQ B;  1KHC A;  4AFZ C;  4M75 B;  3NTI A;  2RMO A;  4HCC A;  3I55 T;  3L42 A;  2LJ3 A;  4E7S A;  4A4H A;  2JVV A;  1WJQ A;  1N8R R;  1ABQ A;  2X3W D;  1W4S A;  3RUX A;  7AT1 B;  1Q81 U;  1FMV A;  4JUV A;  4L59 A;  3ZBD A;  2RJF A;  3UDC A;  2VGM A;  2FPE A;  3MEV A;  3A8L B;  1WLP B;  2IIM A;  4PJO E;  4QKU A;  4LUD A;  4GLK A;  4Z8A A;  1PWT A;  1PNJ A;  3M0T A;  4JS4 A;  2QG9 B;  2CRE A;  2EYX A;  4Y91 A;  3DB3 A;  2FEI A;  2DYI A;  1RL2 A;  2WSE E;  1YIT Q;  2KXD A;  1YCS B;  2XKO C;  1UG1 A;  3CCV T;  4M78 C;  1BKB A;  3FB9 A;  3CPW P;  3VRY A;  4F7U G;  3MEW A;  5GAN 3;  1DJ7 B;  2LQK A;  2YWW A;  3R6N A;  1E6H A;  2A7Y A;  1K9M R;  3QWY A;  1Q86 U;  5A2Q E;  2O01 E;  2X4Y A;  1ZSZ B;  2EW3 A;  4KGV B;  2LDM A;  5IXF A;  2DAQ A;  3ULR B;  2A36 A;  1YJN Q;  2EKO A;  5CIU A;  1VQ6 Q;  5DY9 A;  3LH5 A;  3HHT B;  3LYI A;  3VJP A;  1VQK T;  5GAN f;  3VS2 A;  4C0G A;  2V26 A;  5LJ5 h;  2QK0 A;  2K3B A;  1K8A U;  2ABL A;  2E65 A;  2RHI A;  4MZP A;  1XOV A;  4QVZ A;  2CUB A;  3SEM A;  4Y92 A;  4DQ2 A;  2CZ1 B;  1H3H A;  4PLI A;  1WXU A;  3REA B;  3PNW C;  2EYZ A;  2HQH A;  4XTU A;  1UGV A;  1RI0 A;  1Q81 C;  2DJZ A;  1WX6 A;  1RAE B;  2ZPF B;  4QW2 A;  1FMK A;  1BI2 A;  4A54 A;  1YHQ T;  2ENM A;  1X6O A;  3DLM A;  2O88 A;  3QSU A;  2GGR A;  4WCI A;  2W10 A;  3CXC A;  3GNG A;  4N4H A;  3IQL A;  2DMO A;  1AVZ C;  5GAM h;  2PVG B;  2QI2 A;  1KQS P;  1I5L A;  2L3S A;  3S3M A;  4OMP A;  4M77 A;  2QQ9 A;  3UF4 A;  2CP2 A;  4C0D C;  2LP5 A;  5CKH A;  3P8D A;  1R77 A;  1M2V B;  2ZPI B;  2L5Q A;  3OMC A;  4B9X A;  2EJG A;  4KBM B;  1YJN A;  4FU6 A;  1VOM A;  4LDX A;  3VS3 A;  4J9B A;  1AWJ A;  2ZGW A;  4RUG A;  3L2Q A;  1VQM A;  3PFS A;  1KD1 U;  3JB9 I;  2KT8 A;  4IIM A;  4DEX A;  2LT4 A;  2A28 A;  3M0P A;  2HCK A;  3MKD A;  1TWB A;  1BBZ A;  1IZ6 A;  3OS2 A;  3QYG B;  2E41 A;  4O5V A;  2E3I A;  2E6Z A;  2RJC A;  5KYX B;  2LT1 A;  2IVW A;  1G3W A;  2DK3 A;  2MF2 A;  3GLX A;  2OTJ T;  1NJI R;  2KGT A;  3PT9 A;  3H0I A;  2DXB A;  4M75 E;  1UE9 A;  1M3B A;  3EH1 A;  3NPF A;  3RES A;  1NLP C;  1RAA B;  4J9F A;  2KBT A;  2EQI A;  4CRI A;  3CCL Q;  3OYJ A;  1J3T A;  1W6X A;  2BTT A;  3M0S A;  3HRU A;  5L23 A;  1IB8 A;  1YWO A;  3RNJ A;  1Q82 C;  3SB2 A;  1QVF A;  3MCA B;  4KT0 E;  1F1B B;  4XTV A;  2BE9 B;  3KFV A;  5KCO A;  1WDX A;  1X6B A;  1TS9 A;  1T3L A;  4KUI A;  4XU0 A;  2GQI A;  5LJ5 j;  5GMK j;  4HVU A;  3G6E T;  5GJW B;  4BY6 C;  1GCQ A;  3VV0 A;  2XMF A;  4KUD K;  4M77 C;  1PHT A;  5I11 A;  4BE2 A;  2V8J A;  3JCM g;  4YTL A;  4TVR A;  3VKI A;  1KFZ A;  4XTY A;  1CKA A;  5LJ5 d;  1B3Q A;  3CCQ A;  2DBK A;  1NPP A;  1TH7 A;  2CH4 W;  1K76 A;  2QAZ A;  4GLM A;  3MET A;  4C92 D;  1QVG A;  2GCX A;  2GFA A;  1VQP Q;  1QVP A;  1WQ7 A;  1OU9 A;  2DER A;  3G71 T;  4M7A F;  3M0Q A;  4PJO A;  1AWX A;  1OU8 A;  4DBH A;  1LJO A;  2W0Z A;  1VQ7 T;  3QBY A;  2FL7 A;  5FU7 C;  2QQB A;  4EMH A;  1VQ9 Q;  1MHN A;  2F2X A;  4J5Y A;  4LUE A;  1VQN Q;  3A8M B;  1LNX A;  4EMK B;  1FMW A;  2K57 A;  2HEQ A;  2L3R A;  1WJS A;  1O75 A;  3UT1 A;  1S72 T;  4DEY A;  4BI8 B;  1TTH B;  4ELY C;  2DVE A;  3R6O A;  3MP8 A;  2RQW A;  3OYF A;  1WHJ A;  4IUU A;  4PFP A;  2RF0 A;  5GAM d;  4UC4 A;  2HAX A;  3SWN B;  3L2V A;  3P8H A;  1UB4 A;  2HKQ B;  2L89 A;  1SSH A;  2LJ0 A;  3CCL A;  2B86 A;  3OYB A;  5CKE A;  1JB0 E;  4FYW B;  5IHK A;  4OMQ A;  1IRE B;  2QA4 Q;  2MYS A;  3V8L A;  4AG1 C;  4M7D F;  1V76 A;  3M9Q A;  4J6X A;  1Q81 R;  2EVR A;  2JZ2 A;  3QDF A;  1I8F A;  2YRC A;  2QAS A;  1OUL A;  1U06 A;  8ATC B;  3CD6 A;  2F5T X;  3OW2 A;  1QQJ A;  1ZUY A;  2K2M A;  3CME Q;  1JRI A;  1E7O A;  2RM4 A;  4X1V A;  1HJD A;  2ROT A;  2OTL T;  3M57 A;  5M9O A;  5HKC A;  3H8Z A;  2CZ7 B;  3NFC A;  4Q5W A;  2FHD A;  2J7I A;  1CSK A;  1VQP A;  4ANJ A;  1PRL C;  4PJJ A;  1UDL A;  1VQ4 Q;  4KUL A;  3EHR A;  1PKT A;  2JS2 A;  2LNV A;  1WHK A;  4OB0 B;  4QT7 A;  2EQM A;  3X20 B;  4PJO C;  2NUZ A;  5IH2 A;  1OI1 A;  1YWP A;  2CT3 A;  4JJN K;  4C8Q B;  2A37 A;  1QKW A;  1VQ9 A;  2QEX T;  2EKH A;  3CPW S;  3PIO A;  2EJ9 A;  1VQN A;  3BW1 A;  3JCM W;  5I22 A;  5GAN h;  3JCM J;  4JLG A;  1WZO A;  3RDV A;  3VU3 C;  1U8R A;  2DET A;  2K3X A;  1M1G A;  3EFO B;  4N0A A;  4J9E A;  2C0T A;  3S3N A;  2DVJ A;  1B34 B;  4LXC A;  3RMS A;  2KRO A;  2RHX A;  1YIJ A;  4JLI A;  2DIL A;  3REB B;  5C0M A;  1WFW A;  2DIG A;  3EG2 A;  3G4S T;  2LRQ A;  2P4R A;  1WXB A;  1WHG A;  2PZ1 A;  3EG9 A;  4C8Q F;  4ZTF A;  4N4G A;  1ZUK A;  1YCY A;  5GMK m;  2DKG A;  3CC2 A;  2E12 A;  2JOY A;  3CCR Q;  3JCM f;  3TU4 K;  3CCE A;  2VYT A;  1M3C A;  1IRX A;  2JN0 A;  2JM9 A;  1WA7 A;  2Y90 A;  1SRL A;  3CC4 T;  3CQT A;  2YT6 A;  2ESW A;  3CME A;  1D1C A;  2AKK A;  5CO7 A;  3F70 A;  1G83 A;  1Q82 R;  2J06 A;  4PFZ A;  2EGE A;  4M7A D;  3X25 B;  4F16 A;  5KYU B;  5FU6 B;  4M75 A;  1KHI A;  3CCJ T;  4IKF A;  2CT4 A;  1YJW A;  1M1F A;  2J6K A;  3OSS C;  2WSC E;  3MJX A;  4RG8 A;  4MZT A;  1QMC A;  2JT4 A;  2EQK A;  5L8R E;  1GFC A;  2YUN A;  1KJW A;  2F5K A;  2OX7 A;  1XNI A;  2E10 A;  4FL6 A;  4Z02 A;  2B8A A;  4RTU A;  2QTX A;  4EPC A;  4A4E A;  3CCS Q;  5A0L A;  2DO3 A;  3CPF A;  2COY A;  4QVD A;  2LQN A;  2XHC A;  4XU3 A;  5A0G A;  2JS0 A;  1GBR A;  2DRM A;  1B7T A;  1V1C A;  4FM4 B;  4E7H A;  2K7A A;  1VYV A;  3EGU A;  2EYQ A;  2YLC A;  1BCM A;  3QXE B;  3CCR A;  2M1H A;  3JCM Q;  1AOJ A;  1LVK A;  1ZSZ A;  3ER0 A;  2KMT A;  4MDW A;  3H41 A;  2HZY A;  3JCM V;  4HCZ A;  4A4F A;  4MML A;  2KSS A;  3Q1J A;  5GAN j;  3TSW A;  4Z89 A;  2KYB A;  4F7U E;  4A4G A;  1RAC B;  2VGN A;  2XIC A;  1M3A A;  2XDP A;  3MP6 A;  3CCM A;  5KYY B;  4DBR A;  2KAF A;  1SRM A;  1X69 A;  3HL8 A;  3CCU T;  5GAN d;  5IAY A;  1KQS A;  4VUB A;  4J9I A;  4M75 C;  3MP1 A;  2DL4 A;  2RPN A;  4AFU C;  1UHC A;  5GAO m;  2QQA A;  1MNE A;  3NHN A;  4J8O A;  2DXT A;  2R5M A;  2EGA A;  2LCS A;  4RTZ A;  3AHU A;  2MCN A;  1N27 A;  1OV3 A;  4XK8 E;  2CSI A;  2YUQ A;  4J9G A;  2DNU A;  1N6A A;  3P8B B;  5GMK l;  4JS5 A;  2DL5 A;  5LJ3 e;  4M7A G;  2KR3 A;  4PFO A;  2OJ2 A;  2LTO A;  3QUI A;  2CP5 A;  3VS6 A;  3QZ9 B;  3OSV A;  1MMD A;  3D7S B;  3VS1 A;  2D6F A;  2LQW A;  1M30 A;  5CKB A;  1U3O A;  2E4H A;  5I2M A;  1HXD A;  1UJY A;  3OYH A;  1VQL A;  1MV3 A;  1EZZ B;  1TSF A;  2KDS A;  3HP9 A;  4LDV A;  5KYN A;  3QII A;  4NL2 A;  5GAM e;  2J6F A;  2DL7 A;  2ECZ A;  1YIT T;  2VUB A;  2X9H A;  2PQW A;  2EAY A;  4B6M A;  5FRN A;  4FCY A;  4CC7 A;  3VRZ A;  2DFU A;  2EJF A;  1TOV A;  3ME9 A;  3PVL A;  4JRI A;  4BDY A;  1H92 A;  1ZUU A;  2DIQ A;  4M7D G;  1W1F A;  1YJN T;  3C94 A;  2EYY A;  2XK0 A;  1VQ6 T;  2KRS A;  1I4K 1;  1GRI A;  3MHX A;  4RKU E;  4D8K A;  4A53 A;  1RAI B;  1D0Y A;  1VQM T;  2HNI A;  1G2B A;  4GBQ A;  5KYX A;  2L8D A;  5CKD A;  1AWO A;  2DEQ A;  4C5E A;  2EPD A;  1LCK A;  1GL5 A;  2R5A A;  1JU5 C;  4PJO D;  2J05 A;  2RQT A;  2ATC B;  2RHU A;  2EIF A;  1C1A A;  4IUP A;  4KGZ B;  3I9Q A;  4OMF B;  3LH0 A;  1CKB A;  1OPL A;  3A98 A;  5D7U A;  3LGL A;  5CVI A;  4C92 F;  1SHG A;  1VQM Q;  4X9D A;  5AT1 B;  5GMK h;  3NTH A;  2MWP A;  4C0F A;  1NG2 A;  4BDZ A;  2K79 A;  4PJN A;  2P4T A;  2BKD N;  4OVA A;  3RER A;  2MOX A;  5CK9 A;  4AMC A;  4FSS A;  3E19 A;  2RNA A;  3JCM h;  5GAO l;  4C8Q G;  3OYN A;  1PG5 B;  3UPU A;  1JJ2 P;  4ZN1 A;  1UGS B;  4LE9 A;  4M4Z A;  4J9D A;  3WVD B;  2DEU A;  2C06 A;  1W2B P;  2NYS A;  2O4X A;  1RLP C;  3SWN A;  4ESR A;  1Y71 A;  5KYW B;  5J3B A;  1AT1 B;  3LX7 A;  2KEA A;  4LDU A;  2X4J A;  4XAX B;  3VYG A;  3GOX A;  1WYX A;  2DZ9 A;  1RAB B;  2RQR A;  1VQ5 A;  2FRW A;  1K73 U;  2OI3 A;  3U23 A;  1N5Z A;  1Q86 C;  2ZPH B;  3CCQ Q;  4F7U A;  1M2O A;  3PGG A;  2D0Q B;  5DLO A;  2EQJ A;  3L2U A;  1OX8 A;  3CCL T;  4ELZ C;  4BE1 A;  3I55 A;  4C5H A;  2DA9 A;  1BI1 A;  3SDZ A;  4IUV A;  4M78 F;  3S6W A;  3X26 B;  3S3O A;  2Z0W A;  2JNG A;  1K8A C;  1MMG A;  3H0H A;  3G1J A;  1ZHI A;  1OOT A;  3OYE A;  1T0J A;  4C0Z A;  4BUG A;  3M4Y A;  3I56 Q;  1YBY A;  4Z88 A;  2VB6 A;  4OGE A;  1ZQ1 A;  2NWM A;  2GQV A;  4B9W A;  3SD4 A;  1UGR B;  3UA7 A;  1ZX6 A;  5HK0 A;  1Z9Z A;  3M4G A;  4JRQ A;  3RKX A;  1VYT A;  3OYA A;  2V8K A;  3DB4 A;  3V7S A;  4HKE A;  5CKF A;  5GAN 4;  9ATC B;  1M90 U;  1VQP T;  1WXT A;  3A8H B;  3PTA A;  2XU8 A;  2RA2 A;  2AKL A;  1I07 A;  5I21 A;  3CBP A;  4L6V 5;  1ACM B;  3BFM A;  2CP6 A;  3OYM A;  1K0X A;  3A5Z B;  1M1K U;  3QG1 A;  2OAW A;  2COZ A;  1P92 A;  4M7A B;  1VQ9 T;  2KE9 A;  1VQN T;  1ZBJ A;  1NEG A;  4C0D B;  4M75 D;  2HL5 C;  3CD6 Q;  1OPK A;  1X43 A;  2MK5 A;  3SWN C;  2DXU A;  2HD0 A;  2CKK A;  1PSF A;  1EIF A;  5GAO n;  2MWO A;  1VQK A;  2RH2 A;  4O6J A;  1PD0 A;  4CC2 A;  2K3Y A;  1M8V A;  5HCK A;  2RI5 A;  1YIJ T;  1LPL A;  1TU0 B;  1IGQ A;  3ASK A;  1YP5 A;  2FG0 A;  1WNL A;  2EQU A;  4R56 A;  1NBE B;  2QA4 T;  1MV0 B;  4ZTJ A;  5HK3 A;  5LJ3 g;  1KD1 C;  3JCM d;  3T9N A;  4JRP A;  1HYO A;  2EWN A;  1QP3 A;  1YHQ A;  3I56 A;  1RAH B;  1BYM A;  5KYU A;  2RQV A;  4M7D B;  3JCM b;  3CME T;  5C6S A;  1D0X A;  3M0U A;  2YXY A;  2HBW A;  6AT1 B;  3OA6 A;  2E5Q A;  1KG1 A;  5GAM g;  1M90 C;  1RUW A;  2LCC A;  2ROL A;  2XI9 A;  3GF5 A;  2I0N A;  1X75 C;  4MMK A;  1YIJ Q;  3M0R A;  3QKJ A;  4OMN A;  4R55 A;  1VQ4 T;  2KRM A;  3EG3 A;  3LWI A;  5IHI A;  2YSQ A;  2NUT A;  1SG5 A;  3RKY A;  2QDL A;  3ZL7 C;  2E1H A;  1M1K C;  2CP0 A;  4NL3 A;  3KXT A;  3EGD B;  1SHF A;  4CC3 A;  3CC2 Q;  1E6G A;  2AHJ B;  2KQW A;  4BY6 B;  1YI2 Q;  2QXF A;  1UGP B;  3CCE Q;  1SF9 A;  1PC0 A;  2RHY A;  5HY6 A;  3LLR A;  3THK A;  3EGX B;  1GCQ C;  2D9T A;  2LNH B;  5CCA A;  4NOY A;  1VQO Q;  1PRM C;  1T0H A;  3TSZ A;  4M78 D;  5GAN 7;  3NMZ C;  3PE0 A;  3KUF A;  4RCC A;  1YJW Q;  1WHL A;  2DLP A;  3QZ5 B;  2V8I A;  3M58 A;  4J6Y A;  5FU7 B;  4M77 F;  3OYG A;  4LDW A;  2M9U A;  4DBF A;  2L2P A;  1T3S A;  4HA8 A;  4DBQ A;  4PKC C;  4IUR A;  3CCR T;  3WVE B;  1Q86 R;  4R0K A;  5ECA A;  4PJL A;  4V2S A;  5FRO A;  2HQE A;  5IN1 A;  1NYG A;  2JMA A;  4NS5 A;  1BK2 A;  3TVT A;  3O8V A;  2FZG B;  5FU6 C;  4JZ3 A;  4E47 A;  4RTV A;  4QQD A;  4C92 G;  1UHF A;  1K8A R;  4J83 A;  1JQQ A;  3JB9 J;  4D6W A;  2P0K A;  1VQ8 Q;  2A0F B;  4OP0 A;  1OZ2 A;  2XD0 A;  2JM8 A;  3G6E A;  2A08 A;  1VYU A;  3EG0 A;  2HL3 A;  5GAO r;  1UEC A;  4OB3 B;  5FRM A;  3FJ5 A;  3A8G B;  4OMO A;  1YI2 A;  4E2F B;  2DD5 A;  4GY5 A;  3TEE A;  4XTX A;  4XU2 A;  3OS5 A;  3CCS T;  2CP3 A;  4FYY B;  1JJ2 S;  1U5S A;  4QVC A;  3CMA A;  2X4W A;  2RK2 A;  3HRT A;  2ZAE A;  1VQO A;  4M7A E;  2VWF A;  5LJ3 f;  4LDY A;  3CCM Q;  1JXO A;  1W2B S;  1S1N A;  4A63 B;  3A1P A;  1NLO C;  1PSE A;  2GBQ A;  2XID A;  2MMP A;  2YHT A;  4KH0 B;  1K1Z A;  1QVF P;  1YJ9 Q;  3LW5 E;  3NTK A;  3V8K A;  1MMN A;  1S72 A;  1Y96 B;  4IIO A;  4CC4 B;  1YFN A;  2QTV A;  2ZPG B;  2ZPB B;  3CPW A;  1AZE A;  4DA4 A;  5IXB A;  1I81 A;  2DD4 A;  3OQ5 A;  5GAM f;  2E70 A;  1M8M A;  2YLB A;  2VXE A;  2PVO B;  1KK7 A;  1M27 C;  2X35 A;  2ED0 A;  2AZS A;  2D8J A;  1M9S A;  3PIP A;  1QVG P;  3HPW A;  1KD1 R;  4AG2 C;  2DL3 A;  2KT1 A;  1OX9 A;  1Z9Q A;  4M78 G;  4PJO F;  4N0A C;  3N5B B;  2LCL A;  2H3J A;  2P0P A;  3JV3 A;  2EYW A;  3H0F A;  4M7D E;  1IGU A;  1VQ8 A;  1U1T A;  5FWB A;  1D3B B;  4KRT A;  2CSQ A;  2FZC B;  2CH4 A;  3VYH B;  1I0C A;  1VQL Q;  4HCB A;  3I5S A;  4LD9 K;  4DOV A;  3BDU A;  2DX1 A;  1K4U S;  1M90 R;  3MO8 A;  1G3T A;  1UEB A;  2PVD B;  3E9G A;  3H6Z A;  5EG2 A;  4BE0 A;  1RAD B;  4FYV B;  1PD1 A;  3BE3 A;  1EFN A;  3C4S A;  4AFQ C;  1N9S A;  4FYX B;  3LWH A;  4K11 A;  1M1K R;  3VS4 A;  4E7J A;  1BB9 A;  1SKU B;  1KIK A;  1ABO A;  1NJI U;  3FJP A;  4FSX A;  3J81 E;  3QJ6 A;  2MPX C;  4M77 D;  2QEX A;  3V7C A;  3V8J A;  4X34 A;  1YJ9 A;  3OYK A;  3UAT A;  4E7Z A;  1Q7Y U;  2MI6 A;  1K0S A;  5LJ5 e;  2O9S A;  5GMK e;  2D8H A;  1QWE A;  2HBP A;  3OW2 P;  4X9C A;  3M56 A;  3VS7 A;  3C95 A;  2FRY A;  2O31 A;  4RCB A;  3CBM A;  4WF2 A;  2R57 A;  1IO6 A;  5GAO q;  1YN8 A;  5CQY A;  5GAN 6;  5D6Y A;  3J7A F;  4ATO A;  1YNZ A;  4PK4 A;  1ZLM A;  2RJD A;  1RAF B;  2X51 A;  4ME7 A;  4C8Q E;  1QCN A;  3M54 A;  3OS1 A;  3JB9 H;  3MEU A;  1M5Q 1;  1IHW A;  3EG9 B;  1BIA A;  2CZ6 B;  3UA6 A;  3CC4 A;  2EBP A;  3HKS A;  3EH2 A;  5KCH A;  1RI9 A;  4IUQ A;  1M2V A;  2D0N A;  1OQK A;  2SRC A;  4FW1 A;  2C0O A;  2M0Y A;  3CC7 Q;  3FC3 A;  2F2W A;  1ZSZ C;  1VQ5 T;  3CCJ A;  1GFD A;  5CAI A;  4PJM A;  2DM1 A;  1G8X A;  4F14 A;  3EFR A;  1A0N B;  1O9S A;  2M0O A;  5EC7 A;  1UTI A;  2RJE A;  4QQG A;  1R8O B;  1KSW A;  3OYY A;  3QJY A;  3E9F A;  1QLY A;  1AEY A;  1Q7Y C;  2AK5 A;  2YUO A;  2YDL A;  1WIE A;  4C92 B;  2MIO A;  2QQS A;  4OMM A;  1RAG B;  2HSE B;  5IT9 E;  4XU1 A;  2FO0 A;  1VQ5 Q;  4M75 F;  3CXC S;  4XQ3 A;  1M4Z A;  4D8D A;  4C5I A;  2HKN A;  2K5I A;  2ZZD A;  3C12 A;  4M77 G;  2LMJ A;  4M7A A;  1SPK A;  2QGF B;  3QYH B;  3DKM A;  1G5V A;  1HSQ A;  3HFO A;  4IUT A;  3I55 Q;  3MEA A;  2JW4 A;  4EDU A;  2J6O A;  1K9A A;  3INZ A;  3G7Z A;  1R0C B;  4RTT A;  2Y4X A;  2GF7 A;  1W70 A;  2KVQ G;  2K6D A;  3CC7 A;  2ZPE B;  2YRD A;  2KRN A;  3CCU A;  2BE7 D;  5GAN 8;  2NUP B;  4MDX A;  1AZG B;  2FPD A;  3CCQ T;  2PUO B;  2COW A;  2VAS A;  5FLX E;  5GAN 5;  1QP2 A;  5KH6 A;  3FDR A;  4M7D A;  3NGP A;  4EMK A;  3CCV Q;  4KGX B;  3JAM E;  1HK9 A;  2BZX A;  1XTD A;  2FZK B;  5LJ3 h;  4AFS C;  1WHM A;  1JO8 A;  2RK1 A;  2RI2 A;  1MMA A;  3I56 T;  4HT8 A;  1NM7 A;  4M78 B;  2XDB A;  8AT1 B;  1UJ0 A;  2K9G A;  2E6N A;  4LNP A;  3HFN A;  1WHH A;  2HDA A;  3RIR A;  1D1B A;  5CR2 A;  3GP8 A;  1VQK Q;  3OB9 A;  3EGD A;  1Q82 U;  2DTI A;  2DL8 A;  1QVF S;  5CQX A;  4QQ6 A;  1D09 B;  4N4I A;  2QDY B;  3JSC A;  1YIT A;  5KE2 A;  2DZC A;  4RTW A;  2RB6 A;  4JPB W;  1XJW B;  4M7A C;  2AZV A;  2O2O A;  4ZGE B;  3WXM B;  1I5O B;  1RLQ C;  3OY9 A;  1BI0 A;  3EGX A;  2L3P A;  1UUE A;  2KYM A;  4KH1 B;  3BY7 A;  3OYI A;  3VS0 A;  1HD3 A;  1YHQ Q;  2P0Q A;  3EG1 A;  2LX9 A;  2VXF A;  2WAC A;  3CD6 T;  4PJO G;  3PMT A;  1QVG S;  3GBQ A;  1VQ6 A;  2YRV A;  3A8O B;  2XG8 D;  2SEM A;  3OMG A;  2I2L A;  4BD3 A;  2E64 A;  1WI7 A;  1WQW A;  5D6W A;  4RTX A;  3HTR A;  4CI0 C;  4C8Q A;  2D1X A;  2KI7 A;  3VUB A;  3VUZ A;  1U1S A;  1MGQ A;  5LL6 S;  4JZ4 A;  4FT2 A;  4II1 A;  3CCV A;  2M02 A;  2CDT A;  3OYL A;  3PMI A;  3QDR B;  5FWC A;  4M7D C;  1OEB A;  2QQR A;  4EMK C;  3JCM P;  2DBM A;  4Y28 E;  3EFO A;  1PKS A;  2VVK A;  3RR6 A;  1X2Q A;  1PCX A;  1KC8 U;  1NE8 A;  3JB9 F;  1B34 A;  2A3L A;  1FWZ A;  1VIF A;  2JXB A;  2DPP B;  5GAN e;  1TG0 A;  4PNO A;  1K73 C;  2DTO A;  1UFF A;  2DTH A;  5LJ5 g;  3M59 A;  1ZA1 B;  2OAU A;  3HRS A;  4E6R A;  1Q7Y R;  2RO0 A;  2CUD A;  2P84 A;  1X01 A;  1ZSG A;  2RQU A;  1C0M A;  1Y0M A;  4C92 E;  3BDL A;  2GFU A;  4J6W A;  2C0I A;  2XDD A;  1NYF A;  2KK4 A;  3QWX X;  3M5A A;  1OYX A;  3OW2 S;  4FW2 A;  4ZGJ B;  3CC2 T;  1Y57 A;  2FPF A;  3SFM A;  2E5K A;  1I1J A;  1YI2 T;  3OBY A;  2HMA A;  3CCE T;  2OTJ Q;  2HSP A;  5LJ3 j;  1PM3 A;  3QO3 A;  1BI3 A;  4JRK A;  1D1A A;  2DRK A;  4P5N A;  3CMA T;  3X24 B;  1V29 B;  1Y96 A;  4A4K A;  5LJ3 d;  1NEB A;  1VQO T;  1IHV A;  4OB1 B;  4HCK A;  1GXI E;  4JJB A;  2CZ0 B;  2H3E B;  3JCM c;  2JJ9 A;  1GCP A;  5GAM j;  2DJQ A;  1YJW T;  3G6E Q;  1H3Z A;  2LC4 A;  4C8Q C;  1OZ3 A;  2R58 A;  3OS0 A;  3DLL A;  1JXM A;  2KY9 A;  5J39 A;  2VC8 A;  1KC8 C;  2O4X B;  2CS7 A;  2K5F A;  1QCO A;  3JRZ A;  1WPY A;  4M77 B;  3URG A;  4E7L A;  3EFS A;  1FYN A;  1LOJ A;  3G71 Q;  1D3B A;  1N8R U;  3CMA Q;  2JMC A;  4HT9 A;  4F7U B;  1ZA2 B;  2F69 A;  5D6X A;  2DYB A;  4J7F A;  2PNI A;  3CXC P;  1VQ7 Q;  4M78 E;  5GAN 2;  1VQ8 T;  2FVU A;  1D0Z A;  3TCJ A;  2LQ8 A;  3TRE A;  4FT4 A;  1VA7 A;  2PTK A;  2M51 A;  1QCF A;  1S72 Q;  4OF1 A;  2RHZ A; 
#chains in the Genus database with same CATH homology
 3BDU A;  2DEQ A;  4C5E A;  1WJR A;  1WGS A;  3MO8 A;  2E41 A;  4ZGD B;  1NZ9 A;  2K5L A;  4O5V A;  1G3T A;  1UEB A;  2PVD B;  2E6Z A;  2RJC A;  3E9G A;  3H6Z A;  1QVF A;  2R5A A;  4FIB A;  2LT1 A;  4M75 G;  2OTJ A;  5EG2 A;  1NPR A;  4PJO D;  2IVW A;  3CBO A;  3LGF A;  1G3W A;  2DK3 A;  2MF2 A;  3GLX A;  2OTJ T;  4BE0 A;  1FXX A;  3PT9 A;  3RKW A;  2RHU A;  4F7U F;  2EIF A;  3M55 A;  3M53 A;  2DXB A;  3C4S A;  1N9S A;  2EFI A;  4M75 E;  4BI4 A;  3RES A;  3LWH A;  4IUP A;  4E7J A;  4OMF B;  2BUD A;  4CRI A;  3LH0 A;  1H64 1;  1NJI U;  3OYJ A;  3FJP A;  4FSX A;  3FEO A;  4ZN3 A;  5GMK i;  3J81 E;  3QJ6 A;  3HRU A;  3CCM T;  3LGL A;  1K9M U;  1Q82 C;  5CVI A;  4M77 D;  3SB2 A;  4C92 F;  3MCA B;  5DLQ E;  3V7C A;  3V8J A;  4KT0 E;  2QEX A;  4X34 A;  1KQ2 A;  4XTV A;  1YJ9 A;  2IG0 A;  3OYK A;  5KCO A;  4JDS A;  1YJ9 T;  4X9D A;  5AYF A;  2BIV A;  3KBG A;  4KUI A;  4XU0 A;  3EAE A;  2PUK B;  5GMK h;  2RD1 A;  5LJ5 j;  4RMO A;  3NTH A;  5GMK j;  2MWP A;  4C0F A;  5DM7 R;  3L2W A;  3G6E T;  2MI6 A;  1Q7Y U;  4BY6 C;  5LJ5 e;  3JB9 D;  4BDZ A;  3VV0 A;  5GMK e;  2PU9 B;  2HBP A;  2P4T A;  4X9C A;  4KUD K;  4M77 C;  2BKD N;  4BE2 A;  3M56 A;  2V8J A;  3C95 A;  4OGC A;  3JCM g;  1BIB A;  4YTL A;  4TVR A;  4OVA A;  4RCB A;  3VKI A;  3CBM A;  3RER A;  4XTY A;  5CK9 A;  5LJ5 f;  3X28 B;  5LJ5 d;  3CCQ A;  4WF2 A;  1NPP A;  3E19 A;  1TH7 A;  4OB2 B;  2R57 A;  2JTM A;  5GAO q;  3JCM h;  5GAO l;  3MET A;  5CQY A;  4PLL A;  4C92 D;  1JBM A;  5GAN 6;  5D6Y A;  2JTF A;  4C8Q G;  3OYN A;  1QVG A;  3J7A F;  2GCX A;  2GFA A;  3UPU A;  4ATO A;  4ZN1 A;  1QVP A;  1WQ7 A;  1N8R C;  3G71 A;  1UGS B;  2QA4 A;  3G71 T;  4M7A F;  3WVD B;  2RJD A;  5LL6 S;  2FB7 A;  2WSF E;  4ME7 A;  4C8Q E;  4PJO A;  3M54 A;  5I2S A;  3OS1 A;  1VIE A;  2C06 A;  3JB9 H;  3MEU A;  1VQ7 A;  1LJO A;  1M5Q 1;  1VQ7 T;  1BIA A;  2CZ6 B;  3QBY A;  2FL7 A;  5FU7 C;  3CC4 A;  2QQB A;  3HKS A;  3FLG A;  4EMH A;  1MHN A;  4J5Y A;  5KCH A;  2O4X A;  3J80 E;  4PJO B;  1SSF A;  3A8M B;  1LNX A;  4EMK B;  4IUQ A;  3FRN A;  3SWN A;  3HSB A;  2K57 A;  1VQL T;  1Y71 A;  1WJS A;  2L3R A;  1O75 A;  3UT1 A;  1S72 T;  4LD9 K;  4BI8 B;  5J3B A;  3LX7 A;  4ELY C;  4LDU A;  2X4J A;  4XAX B;  2DVE A;  3R6O A;  3VYG A;  4BI3 A;  3MP8 A;  3GOX A;  2DZ9 A;  2RI3 A;  3OYF A;  1VQ5 A;  3FC3 A;  4IUU A;  1K73 U;  5GAM d;  4UC4 A;  1VQ5 T;  3SWN B;  2HAX A;  3CCJ A;  1ZBX A;  3P8H A;  3L2V A;  1UB4 A;  2L89 A;  5CAI A;  5KE3 A;  2ZPH B;  1Q86 C;  1VQ4 A;  4F7U A;  3L1A A;  3PGG A;  2D0Q B;  5DLO A;  3CCL A;  3EFR A;  2EQJ A;  3OYB A;  2K4Y A;  1N9R A;  5CKE A;  3L2U A;  1KQS S;  1JB0 E;  1O9S A;  4XTZ A;  3CCL T;  5J26 A;  2M0O A;  1IRE B;  1K9M C;  4ELZ C;  4BE1 A;  3V8L A;  2MAM A;  3I55 A;  2RJE A;  4QQG A;  4C5H A;  4M7D F;  3M9Q A;  4J6X A;  1BI1 A;  3SDZ A;  4IUV A;  4M78 F;  3S6W A;  3X26 B;  1R8O B;  3S3O A;  3OYY A;  2JZ2 A;  4C92 A;  1I8F A;  2JNG A;  1K8A C;  3QJY A;  3E9F A;  3JCM X;  1ZHI A;  4PL6 A;  3OYE A;  3L2R A;  4C0Z A;  1Q7Y C;  3CD6 A;  4BUG A;  2F5T X;  4BB7 A;  3OW2 A;  1G3S A;  3M4Y A;  1YBY A;  4OGE A;  1ZQ1 A;  2GQV A;  1JRI A;  4B9W A;  4C92 B;  3SD4 A;  1UGR B;  2RM4 A;  5HK0 A;  3M4G A;  2ZCF B;  4JRQ A;  4E7I A;  2QQS A;  3GNF B;  2OTL A;  3RKX A;  4C5G A;  4RG2 A;  5IT9 E;  3OBW A;  2OTL T;  3M57 A;  4XU1 A;  2V8K A;  3DB4 A;  3UWN A;  4HKE A;  4XTW A;  3H8Z A;  2CZ7 B;  3NFC A;  4M75 F;  4Q5W A;  5CKF A;  2FHD A;  4DOW A;  4L5G A;  4XQ3 A;  3CXC S;  1VQP A;  1M4Z A;  1M90 U;  2VV5 A;  2K5I A;  4C5I A;  2ZZD A;  1VQP T;  3C12 A;  3A8H B;  4KUL A;  3PTA A;  3QPH A;  2XU8 A;  2RA2 A;  3OYC A;  2LVM A;  4M77 G;  5HKC A;  2LNV A;  3FIF A;  4M7A A;  5I21 A;  1W2B A;  4OB0 B;  3CBP A;  3DKM A;  3QYH B;  1G5V A;  3HFO A;  4L6V 5;  2EQM A;  3BFM A;  3X20 B;  4IUT A;  4PJO C;  3OYM A;  1OI1 A;  3MEA A;  4M77 E;  5GAN g;  3A5Z B;  4EDU A;  1M1K U;  4JJN K;  2G3R A;  4C8Q B;  3INZ A;  3QG1 A;  1VQ9 A;  4EMG A;  1P92 A;  3G7Z A;  2QEX T;  3CPW S;  2Y4Y A;  2EJ9 A;  4M7A B;  3PIO A;  1KQ1 A;  3JB9 G;  1VQ9 T;  1VQN A;  3BW1 A;  3JCM W;  5GAN h;  1VQN T;  4C0D B;  3JCM J;  4JLG A;  4M75 D;  2CYZ B;  2Y4X A;  5A0D A;  3OYD A;  2GF7 A;  3VU3 C;  2X4X A;  3SWN C;  2DXU A;  1U8R A;  2KVQ G;  2HD0 A;  2K3X A;  1M1G A;  2CKK A;  1PSF A;  2ZPE B;  3CC7 A;  4N0A A;  1EIF A;  3QHS A;  5GAO p;  5GAO n;  3CC7 T;  2MWO A;  3V7R A;  2JUF A;  1FX7 A;  1VQK A;  3CCU A;  2RH2 A;  4O6J A;  3S3N A;  4J7I A;  1B34 B;  3RMS A;  5GAN 8;  2RHX A;  4MDX A;  1XQH A;  2K2V A;  2K3Y A;  3E1S A;  4JLI A;  3G4S A;  1YIJ A;  5C0M A;  4M7D D;  3CCQ T;  1M8V A;  2RI5 A;  3ZFJ A;  1YIJ T;  2DIG A;  3G4S T;  2LRQ A;  2PUO B;  1JJ2 A;  5FLX E;  2M16 A;  5GAN 5;  3ASK A;  1WNL A;  1QP2 A;  4C8Q F;  4ZTF A;  2EQU A;  1QW1 A;  4N4G A;  3JCM e;  4R56 A;  2HQX A;  1YCY A;  2QA4 T;  5GMK m;  5KH6 A;  2DKG A;  3CC2 A;  4ZTJ A;  2E12 A;  3FDR A;  5HK3 A;  4M7D A;  5LJ3 g;  4EMK A;  5M9O A;  2JOY A;  4M78 A;  1KD1 C;  3JCM f;  3JCM d;  3TU4 K;  3CEY A;  3CCE A;  3GIB A;  2FYK A;  1HK9 A;  3T9N A;  3JAM E;  3L2Z A;  2VYT A;  4C92 C;  1XTD A;  3CCS A;  5LJ3 h;  2DXC A;  2JN0 A;  4JRP A;  2EWN A;  1YHQ A;  1QP3 A;  2Y90 A;  1Y07 A;  3CC4 T;  3I56 A;  2NLU A;  2RK1 A;  2RI2 A;  1G3Y A;  3OYA A;  1BYM A;  3CME A;  4M7D B;  3JCM b;  3I56 T;  4HT8 A;  2XDB A;  4M78 B;  1VUB A;  3CME T;  5C6S A;  5CO7 A;  3ZEH A;  3F70 A;  2E6N A;  1Y7X A;  3HFN A;  4C8Q D;  3OA6 A;  2E5Q A;  4M7A D;  3X25 B;  1KG1 A;  5GAM g;  3RIR A;  2CGH A;  1M90 C;  5FU6 B;  5CR2 A;  4BAC A;  4MZM A;  4E7K A;  3GP8 A;  2LCC A;  2XI9 A;  3GF5 A;  4LD6 A;  4M75 A;  3OB9 A;  1KHI A;  3GPL A;  1X75 C;  3CCJ T;  1Q82 U;  2DTI A;  4MMK A;  4IKF A;  1YJW A;  1M1F A;  3QKJ A;  4R55 A;  1AHJ B;  1QVF S;  5CQX A;  3OSS C;  4QQ6 A;  2WSC E;  1VQ4 T;  4RG8 A;  1NJI C;  3RMQ A;  4N4I A;  2QDY B;  1UGQ B;  4MZT A;  1KHC A;  3LWI A;  3JSC A;  1YIT A;  5KE2 A;  2DZC A;  3RKY A;  2RB6 A;  2EQK A;  5L8R E;  4M7A C;  2E1H A;  4ZGE B;  4M75 B;  3WXM B;  1M1K C;  3NTI A;  4NL3 A;  3KXT A;  2F5K A;  4DOV A;  4HCC A;  3I55 T;  3OY9 A;  3L42 A;  1BI0 A;  1XNI A;  2E10 A;  4FL6 A;  2AHJ B;  2KQW A;  4Z02 A;  4A4H A;  2QXF A;  4BY6 B;  1UGP B;  2B8A A;  1WJQ A;  2JVV A;  2QTX A;  4EPC A;  3BY7 A;  3OYI A;  4A4E A;  1W4S A;  3RUX A;  5A0L A;  2P0Q A;  1Q81 U;  2RHY A;  2DO3 A;  2LX9 A;  2VXF A;  2WAC A;  3CD6 T;  4JUV A;  3CPF A;  4L59 A;  5HY6 A;  3PMT A;  4PJO G;  3ZBD A;  2RJF A;  4QVD A;  1QVG S;  3LLR A;  1VQ6 A;  3UDC A;  2D9T A;  2VGM A;  2XHC A;  4XU3 A;  2YRV A;  5CCA A;  5A0G A;  3A8O B;  2XG8 D;  3MEV A;  3A8L B;  4NOY A;  3V7S A;  3OMG A;  2I2L A;  4PJO E;  4BD3 A;  4GLK A;  2E64 A;  4M78 D;  5GAN 7;  4JS4 A;  1WQW A;  4FM4 B;  4E7H A;  5D6W A;  3KUF A;  4CI0 C;  4RCC A;  4C8Q A;  4Y91 A;  2EYQ A;  3VUB A;  3VUZ A;  3QZ5 B;  1U1S A;  1MGQ A;  2V8I A;  3DB3 A;  3M58 A;  1RL2 A;  2YLC A;  4J6Y A;  4M77 F;  3QXE B;  2WSE E;  5FU7 B;  4LDW A;  2M9U A;  3OYG A;  3CCR A;  4FT2 A;  4HA8 A;  4II1 A;  3CCV A;  2M1H A;  4IUR A;  4PKC C;  3JCM Q;  3OYL A;  2XKO C;  3PMI A;  3QDR B;  3WVE B;  3CCR T;  3ER0 A;  2QQR A;  4EMK C;  3CCV T;  2KMT A;  4M78 C;  3JCM P;  4MDW A;  4Y28 E;  1BKB A;  3FB9 A;  4V2S A;  5FRO A;  4F7U G;  3MEW A;  2HQE A;  5IN1 A;  5GAN 3;  1DJ7 B;  4NS5 A;  3JCM V;  1KC8 U;  2LQK A;  3O8V A;  1NE8 A;  4HCZ A;  4MML A;  4A4F A;  3JB9 F;  2A7Y A;  1B34 A;  2KSS A;  3Q1J A;  5GAN j;  2A3L A;  1Q86 U;  5FU6 C;  5A2Q E;  2O01 E;  2X4Y A;  1FWZ A;  4F7U E;  1VIF A;  4A4G A;  2LDM A;  2DPP B;  2VGN A;  5GAN e;  2DAQ A;  2XIC A;  4PNO A;  1K73 C;  2DTO A;  2EKO A;  2XDP A;  3MP6 A;  4E47 A;  3CCM A;  5CIU A;  4QQD A;  4C92 G;  5DY9 A;  2DTH A;  4J83 A;  3M59 A;  2OAU A;  2KAF A;  3HHT B;  3HRS A;  3LYI A;  5LJ5 g;  2RO0 A;  3JB9 J;  3HL8 A;  3VJP A;  4D6W A;  1X01 A;  5GAN f;  5GAN d;  3CCU T;  1VQK T;  5IAY A;  2P0K A;  1KQS A;  4VUB A;  4C0G A;  4M75 C;  3MP1 A;  4OP0 A;  1OZ2 A;  4C92 E;  5LJ5 h;  5GAN 4;  2XD0 A;  3G6E A;  1K8A U;  3BDL A;  5GAO m;  2E65 A;  2QQA A;  2GFU A;  2RHI A;  1XOV A;  4J6W A;  4MZP A;  4QVZ A;  4J8O A;  2XDD A;  4DQ2 A;  2KK4 A;  2DXT A;  2R5M A;  3M5A A;  2CZ1 B;  1OYX A;  4PLI A;  5GAO r;  3OW2 S;  3PNW C;  4OB3 B;  4ZGJ B;  4XTU A;  3CC2 T;  3SFM A;  1YI2 A;  1N27 A;  3A8G B;  5FRM A;  3AHU A;  2DD5 A;  4GY5 A;  1RI0 A;  1YI2 T;  3TEE A;  4XTX A;  2DJZ A;  3OBY A;  4XU2 A;  1Q81 C;  3CCE T;  3OS5 A;  4XK8 E;  2ZPF B;  4QW2 A;  5LJ3 j;  3CCS T;  3QO3 A;  1BI2 A;  1N6A A;  3P8B B;  4A54 A;  1YHQ T;  5GMK l;  1JJ2 S;  4JS5 A;  4M7A G;  1BI3 A;  4JRK A;  5LJ3 e;  1X6O A;  3DLM A;  4QVC A;  3QSU A;  2LTO A;  3CMA A;  4P5N A;  2X4W A;  3QUI A;  2RK2 A;  3HRT A;  3QZ9 B;  3X24 B;  1V29 B;  1VQO A;  3CMA T;  3OSV A;  3CXC A;  1Y96 A;  4M7A E;  5LJ3 f;  4LDY A;  5LJ3 d;  4A4K A;  1VQO T;  2D6F A;  4OB1 B;  3GNG A;  1W2B S;  4N4H A;  5CKB A;  1PSE A;  2XID A;  1GXI E;  2MMP A;  2YHT A;  5I2M A;  2CZ0 B;  1HXD A;  3JCM c;  5GAM h;  2PVG B;  3LW5 E;  2QI2 A;  3NTK A;  5GAM j;  3OYH A;  3V8K A;  1VQL A;  1I5L A;  1YJW T;  2KDS A;  3HP9 A;  4LDV A;  1Y96 B;  1S72 A;  1H3Z A;  2LC4 A;  3S3M A;  3QII A;  4NL2 A;  4C8Q C;  5GAM e;  1OZ3 A;  2ZPG B;  1YIT T;  4M77 A;  2ZPB B;  2QQ9 A;  2VUB A;  2PQW A;  2R58 A;  2EAY A;  3OS0 A;  3CPW A;  3DLL A;  4C0D C;  4DA4 A;  2KY9 A;  5J39 A;  2VC8 A;  1KC8 C;  2O4X B;  1I81 A;  5CKH A;  2DD4 A;  3OQ5 A;  3P8D A;  5GAM f;  2E70 A;  2YLB A;  5FRN A;  2VXE A;  2CS7 A;  2K5F A;  2PVO B;  3JRZ A;  2EJF A;  1WPY A;  4M77 B;  2ZPI B;  3URG A;  2L5Q A;  3ME9 A;  3OMC A;  4B9X A;  4E7L A;  3EFS A;  4JRI A;  2X35 A;  1LOJ A;  2EJG A;  4BDY A;  4KBM B;  1M9S A;  4FU6 A;  3PIP A;  1YJN A;  3HPW A;  2DIQ A;  4M7D G;  1D3B A;  1YJN T;  3C94 A;  4M78 G;  4LDX A;  4PJO F;  2XK0 A;  1N8R U;  1VQ6 T;  2ZGW A;  1I4K 1;  4N0A C;  3N5B B;  4F7U B;  2LCL A;  4HT9 A;  2H3J A;  3MHX A;  4RKU E;  2P0P A;  2F69 A;  5D6X A;  4A53 A;  4J7F A;  1VQ8 A;  3L2Q A;  1VQM A;  4M7D E;  1U1T A;  4M78 E;  3PFS A;  5GAN 2;  1KD1 U;  3JB9 I;  4M7D C;  1VQ8 T;  1VQM T;  2FVU A;  3TCJ A;  2HNI A;  1D3B B;  2LQ8 A;  2LT4 A;  3TRE A;  4FT4 A;  2L8D A;  5CKD A;  3VYH B;  1IZ6 A;  3OS2 A;  4HCB A;  3QYG B;  4OF1 A;  2RHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...